4NJIA

Crystal structure of quee from burkholderia multivorans in complex with adomet, 6-carboxy-5,6,7,8-tetrahydropterin, and mg2+
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
209
structure length
209
Chain Sequence
TYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQAVCRFCDTDFVGTDGENGGKFKDADALVATIAGLWPAGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFGIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPSRDLNTKLAIDWCKRHPQWRLSMQTHKYLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 7-carboxy-7-deazaguanine synthase
publication title Radical SAM enzyme QueE defines a new minimal core fold and metal-dependent mechanism.
pubmed doi rcsb
source organism Burkholderia multivorans
total genus 67
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 4.3.99.3: 7-carboxy-7-deazaguanine synthase.
pdb deposition date 2013-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4njiA00
3MW7A 3GXNA 4JDYA 2CZDA 4XBKA 3KVMA 5AHMA 3E02A 5D2WA 3DFPA 1ADOA 5G1YA 3QRHA 1P0KA 2F7FA 3FA5A 4LUJA 4UR8A 3EWBX 1ZAHA 1SUXA 7TIMA 1LYXA 2GVJA 1HO4A 5CSSA 3T7VA 4XZ9A 5HUPA 3HGRA 2NLIA 3V1PA 4MLJA 2QJGA 2VFDA 2Y62A 2AGKA 1TYGA 4CLMA 4OHQA 4HIBA 2VFIA 4O15A 5HWJA 4IOTA 1N8FA 3BW3A 3SW6A 4HNTA 3FYOA 3O06A 4L4LA 2A0NA 3F4NA 3IRDA 3HOJA 1QOQA 2RHGA 2GPTA 4IPIA 3WJSA 1PIIA 1OFDA 4FXRA 4NJJA 3CWOX 1GT8A 5G2HA 4FNRA 4JXCA 3NDOA 1AG1O 1M7PA 2EAWA 3LCWA 4AF0B 3LBCA 5LNSA 5C5YA 3N3MA 4Z0JA 1OHLA 1L9WA 3BGGA 4YCOA 1AW1A 3I7SA 5TBOA 4EF8A 2ZDRA 2J24A 2IQTA 3LCIA 4LS0A 1RR2A 4UTLA 2JGQA 1OJXA 3NAVA 3DI0A 2NX3A 4PA8A 1NSJA 4NJGA 4I7VA 3N9RA 4N6FA 1AK5A 3W1MA 3EX2A 3G1YA 4N2YA 4K38A 3WJYA 5HNRA 1GWJA 3LRKA 4LNYA 1KM4A 3U2OA 4Z1DA 2J6XA 1SQ7A 4MKNA 5LGXA 3PB0A 2Z1BA 3W72A 3NL2A 3B0VC 4P61A 2G96A 4CQAA 3DBPA 4K39A 1Z41A 3LHTA 1YLVA 1EIXA 3FJ6A 5AFDA 1KFCA 5U7SA 4AF0A 1SO5A 1FDZA 4JICA 2W79A 2ZA2A 1VYRA 3CPRA 1DJQA 3QMRA 4YL2A 3WK2A 4IX0A 4AB4A 2BWGA 4FNUA 3CLMA 3ANYA 1B9BA 1GVFA 1GEQA 3GX9A 3C6CA 3BG9A 3NA8A 4LUIA 4IMEA 1WV2A 2YDAA 3P5ZA 1NFBA 3WK0A 3BLIA 4WXYA 4X3ZA 5DCEA 2Z2UA 1D3GA 1TREA 4RR4A 2JK2A 1DBTA 1FXQA 3NQCA 2QUUA 4O50A 4ORMA 1G69A 2TYSA 1JQXA 3TROA 3W1XA 1Q6OA 1G67A 3BW2A 3CU2A 1KM3A 4ML9A 4NZJA 5EA9A 1VQTA 1OFPA 3NM3A 5F2IA 3EKZA 3NPXA 4PL1A 3HPZA 1W5QA 4X22A 2QDGA 1SSGA 4QIUA 2ABBA 3MHFA 3W7OA 3B4UA 3QMTA 1VLIA 4WUIA 1K02A 5FI8A 2WNQA 2QCMA 2NUXA 3ZFHA 2YPIA 5AYXA 4HN4A 1K8ZA 1VRDA 5G4EA 4YMZA 3F4WA 4LU0A 2E5CA 3L2IA 1UASA 4UTMA 1W5PA 1JCMP 2DORA 5GVJA 1YTDA 4UTHA 3W7GA 1G4PA 1I2RA 1OG0A 3G24A 5DY3A 2GUUA 1KTBA 3TNOA 1QPNA 3BV4A 3W7NA 3HGJA 2O7SA 3OVQA 3H55A 3LCFA 3TXVA 3B04A 4DXVA 1FWNA 4R34A 2P1FA 2B7OA 1SPQA 3M0ZA 2TMDA 2EPHA 1E51A 4RJEA 2H8ZA 3LI0A 4Z1AA 2J9XA 5D02A 4I9AA 4P2VA 1B57A 2YX0A 4LVBA 3S5NA 4NXKA 3G8RA 5BW6A 1RQBA 4JGDA 4TU1A 4UTWA 3N2XA 1KV5A 2QR6A 2E6DA 3M5ZA 2CLEA 2ZZ7A 4CNNA 1TJRA 5K3VA 5DXYA 3KFTA 3W7HA 5D33A 1ME8A 4UFJA 1Z48A 2YGYA 1T0OA 4NZFA 3W1UA 3MO7A 1UJPA 4BI7A 1U83A 3FOKA 4JD4A 3M9YA 3HBLA 4N9CA 4GRSA 4IXXA 1TRIA 4MFEA 4UNKA 1ICSA 4O57A 2QCFA 1XCFA 3A24A 1EUAA 4ONVA 2CZEA 1GVSA 2H3DA 5K9CA 3EB2A 1RQEA 4Y90A 1SFLA 3LB0A 3TW6A 1O94A 2E77A 3EWWA 3I65A 1EWEA 4MYAA 3GYEA 1K8YA 5CZSA 2Q8LA 1R2RA 1OF6A 3A5VA 1AL7A 1VS1A 1OFAA 4UTTA 1XDLA 3CC1A 4JS3A 1O95A 2ZZ5A 3A9IA 4IUOA 4DF2A 3UY7A 3VCRA 1BEUA 4ALDA 3M5YA 3JS3A 2KZHA 3HIJA 1FXPA 5AHEA 4TR9A 3PVFA 4M6PA 1C29A 3R12A 2V82A 4HSNA 3SR7A 2C0AA 1Z42A 4YLWA 3IIXA 2E6YA 4AH7A 1ME9A 2A85A 2OZ0A 5TQLA 4NUWA 3LHZA 4X9SA 4MY1A 5CKSA 3UWYA 1SZFA 3S0CA 1G4TA 2NUYA 1H63A 5E93A 4LV4A 2E6AA 4UTWC 3MUXA 1H7WA 4EWND 1Q6RA 3PWAA 4N6EA 5D38A 4O16A 4JIPA 3O1NA 3TMQA 1KTCA 2CZFA 3S9YA 3MBDA 5CPOA 3IIZA 4QAIA 2CLLA 4UR7A 1F6PA 4I7WA 4M7TA 1IXNA 4JX5A 2Z6IA 3Q2DA 1EPXA 3EXRA 3W7LA 4EVZA 3W83A 2Y88A 4BWLA 1TPC1 1WAUA 4O53A 3M44A 3W87A 1QOPA 5D30A 3PSVA 1W0MA 1LDCA 4A2SA 2DZXA 1TPWA 5EL1A 2AQWA 2A1YA 4DBDA 2QEZA 3NPUA 2Y85A 3TSBA 5IM51 4Q32A 5KZMA 4GUIA 1OK6A 1IXPA 3L9CA 3HB9A 5K4XA 3A5FA 2C19A 3G1HA 1DKWA 3OIXA 2ZA1A 3NQ7A 3BG3A 4MZYA 3UD6A 3LXCA 1GPWA 3K30A 5AC7A 1KM0A 3O16A 1JVNA 5HUOA 3PY2A 1Q45A 4Y6GA 5LNUA 3T44A 2GJLA 1DL3A 4JYEA 3TW7A 3UXAA 3RFAA 2HS8A 2WSQA 2JKAA 4MVAA 1G7VA 2FPTA 1ML1A 4ZQNA 3LERA 5LHEA 3W22A 1TTPA 1WQ5A 5CSRA 1XDMA 2V8ZA 3MHGA 5G1TA 3GKFA 2RDTA 4WY0B 3UQNA 5D2XA 5MHBA 2QCNA 4KFPA 3C0JA 3JRKA 5IBXA 4BWLC 5D09A 1TV7A 2E09A 4IMDA 1F5ZA 3W7JA 4TIMA 4GNJA 3NR0A 3B0UX 3GAYA 1KM5A 1XUZA 4K36A 3QF0A 3WJWA 4O54A 1F05A 4NQ1A 5E1QA 1CX9A 4O52A 4O17A 4YCPA 2ATMA 4UIOA 1RVGA 2I9EA 5AYZA 3C2VA 1TQXA 1SO4A 3EWUA 4UMBA 2VEMA 3C52A 3O63A 2J88A 2QCDB 2TPSA 3TJXA 5K9DA 1GZGA 5FF4A 1EX5A 1FCVA 1NVMA 2OMAA 3NL6A 5CGQA 4AVFA 1I2PA 3N73A 4JNMA 2E1DA 4WY0A 4ZQMA 3F03K 3ZWSA 3EXTA 2RH9A 3M5XA 4N9DA 5HQEA 3NM1A 5F1VA 3D0CA 3GIYA 3G1XA 1MEHA 3W9ZA 1JRCA 1KM1A 3CEUA 1D3HA 2GQ8A 2WO5A 3TA6A 4XTIA 1FWWA 4AAJA 1V7YA 4CCCA 1W37A 1BWLA 1WBHA 4PCFA 2JBMA 4WY0F 1TJPA 1K7EA 2YW3A 5IBXC 1YDOA 2Y7GA 2CLKA 3W71A 3E49A 2DZTA 5KZEA 4RZ6A 3N19B 1ZAIA 3G1VA 4MY9A 4POCA 2C6QA 1QR7A 3R8RA 1TIMA 5EYWA 3EWZA 1TTJA 2ZRYA 3VE7A 1OYBA 4UXDA 3FLUA 1TPB1 1PV8A 4L4MA 4NJIA 1OFQA 1UUMA 1THFD 3MP5A 4LTSA 1ONRA 2VXNA 2QCDA 4O0ZA 1H62A 1EEPA 1KV8A 5D2VA 2QCCA 3N2MA 3TFCA 2E5DA 2F84A 3M1ZA 3B8DA 4M6QA 5ABTA 4O1BA 2V81A 4O13A 4ZL1A 1GQNA 2ATSA 5D37A 2GOUA 1H1ZA 2FJKA 4U4MA 4Z08A 5A5WA 5KINA 3W86A 4Y96A 3LCGA 2CW6A 4RV8A 2Y61A 5BMWA 3BLFA 3H53A 1JRBA 3ABQA 2C3ZA 3Q37A 4M5PA 3VNDA 1MEIA 2FTPA 1B4EA 4UFHA 5FF0A 1FDJA 3L0GA 3SGUA 1RZMA 2R94A 3L5AA 2NV1A 2ZZ6A 3NXFA 3THAA 4DPQA 4OE7A 3EWYA 4EIVA 1S5WA 3O6DA 3VFLA 1FWSA 5I3IA 1I8JA 2ZRVA 2ZRUA 5KITA 3QH2A 2X1TA 3GDKA 1GYNA 4WX2A 1RQHA 2VFHA 3NL5A 1I2NA 4NX5A 2P0OA 3QPZA 1FWTA 3PULA 2HTMA 4DO5A 1LTDA 2ZA3A 1F7BA 3G1FA 2B7PA 3LCXA 1WA3A 4JTKA 3LXBA 1JQVA 5DCDA 2WNZA 4UFLA 2YYUA 3SSJA 4JTFA 4K6AA 2V2CA 3UWZA 1A53A 4JTSA 3DH7A 2J9YA 2A2IA 3BARA 3NNTA 3N34A 3NGJA 1SW7A 4IPJA 2Q3RA 1LRQA 3STCA 3NQMA 1TPEA 1TV5A 3DKJA 5KTLA 4BR1A 2JKEA 4O14A 3TAKA 2Y6ZA 1PS9A 3GNDA 1CI1A 3WK3A 1YXYA 3DZ1A 2CLIA 4UMCA 2H90A 4LW7A 5I3GA 4UC5A 3BW4A 3LLDA 2CLHA 4K37A 2DZPA 4EOUA 1GYLA 1SU5A 3TDFA 2ZYFA 1V5XA 1VLWA 3WK1A 3PSWA 3T78A 1AW2A 3W2MA 2WSRA 3W7DA 3NQAA 4RZ4A 2Y7FA 3QSTA 1DJNA 1W5MA 1IXOA 4OV9A 3G0XA 2CLMA 1DOSA 1OABA 2FQIA 1KM6A 1KBIA 1OX5A 3G1DA 3TX9A 4KWVA 5F2LA 2H6RA 3G1AA 4K8EA 2ZZ3A 2ZQ0A 3GDRA 4Q4KA 3W7CA 3E9AA 3M41A 5G4WA 4IMCA 4KKXA 1XBVA 1EP2A 4FO4A 4BI5A 3NQEA 4AEOA 3A22A 3NQDA 5HJLA 1FX6A 5EY5A 5AC6A 3MI3A 1MO0A 2RDUA 3WJXA 5LHFA 4QM1A 3M43A 5CPNA 1TTIA 4DQWA 1XI3A 3KVKA 3LI1A 3W73A 5BRBA 4AXKA 1JCJA 3GB6A 1TTQA 1PVNA 2OT0A 2CLOA 3QEZA 4HPJA 5G5IA 3MYPA 4JYFA 4E38A 1T96A 3LTPA 2I14A 2ZFAA 3KHJA 3FKKA 3W1TA 3QW3A 4ZQRA 4UMAA 3LRLA 2NX1A 3P8IA 3OEXA 3P5YA 3NO5A 3L66A 2QKFA 3LXAA 4ZMGA 1GG1A 2A4AA 3INPA 4MIMA 1XFBA 4JTTA 3GDMA 3TSMA 1KA9F 2V2HA 1W31A 4I7UA 3LHUA 4OU1A 5E0KA 2RFGA 3PF3A 1B4KA 1RV8A 4JYDA 2X16A 2R91A 4UFKA 4XUGA 4RCXA 4RLIA 1SO3A 1QPRA 3GXTA 4Q33A 2VFGA 3W7MA 1XKYA 3MHUA 3C61A 3DHDA 5FF2A 2JKPA 4N4PA 1JCXA 3G8EA 3L0KA 1SR9A 3LCHA 2ZZ2A 1OVDA 2YXGA 5BOOA 1IIGA 3L5MA 3IVSA 1IIHA 1C9DA 3RMJA 4LVAA 5HMSA 3RLVA 5CZ0A 3W2LA 5FEXA 1RD5A 1CW2A 2XN2A 4NU7A 5CPLA 1QAPA 1F76A 1WOBA 4MJZA 4CQ8A 3I7QA 1I2QA 4MOZA 3W3OA 5HWNA 4N9BA 2WJZA 1GVQA 3W88A 5D32A 5K4ZA 3EEGA 3HGOA 4W9TA 1LP6A 2LLEA 1QPQA 4LY8A 3TH6A 1XBZA 4MY8A 1OYAA 1W8SA 1VC4A 1KTNA 3KX6A 1SW3A 3W85A 5D2TA 3O6CA 2PRMA 1HFBA 1P1XA 1LZOA 3DFOA 1WX0A 4O8RA 1F2JA 1K3UA 2V30A 3IIPA 3P84A 3M47A 3FS2A 1JCLA 3E0IA 3B0PA 3LLFA 1SZNA 3PUEA 1LBMA 1RPXA 2A7NA 4UTKA 2WSYA 3CHVA 4H4IA 3T40A 3NPWA 4E2DA 3C4UA 1XL9A 3W7EA 1UUOA 3BPWA 4PFMA 3S42A 3OG3A 1FY6A 4MLRA 3TIMA 3W1PA 1WBJA 3UPBA 3PBUA 2RDWA 3S8HA 3W74A 4FXSA 4JIQA 1TV8A 2PURA 4JDBA 4NX0A 5CPMA 1BKSA 3DI1A 5HULA 4QSHA 3W75A 1QCWA 2VFEA 3Q58A 4DO4A 1OX4B 2QJHA 2QCGA 1VYSX 5LSMA 3DXIA 2NXHA 3RF9A 1DQXA 2ZRZA 3UWWA 1PCKA 3GKAA 4PEKA 3DGRA 3SIZA 1JUBA 2TSYA 2WV8A 3NZ1A 5LGZA 4LS1A 1W3NA 5D04C 2ZBTA 1HUVA 2DJLA 1H5YA 3B05A 1N7KA 2WPBA 3W23A 4LOCA 1SW0A 5LNVA 4C1LA 4A29A 3BG5A 4N02A 2NV2A 5AOUA 2ISVA 1AL8A 3ZWTA 5A8GA 2FFCA 2YW4A 3G18A 3SI9A 3FJLA 4O11A 3LX9A 4OBTA 2PE4A 4OGZA 5C55A 4GJ1A 3CTLA 3IGXA 3CT7A 3W1RA 4UTTC 4GUFA 3NZRA 1J4EA 2V5LA 2YFNA 3PUDA 4QQ3A 3W2NA 3L68A 3TAOA 3PM6A 5U4NA 3W6YA 2VEIA 3LTSA 4O19A 5DBUA 2NX9A 4LT9A 1OX4A 1VGAA 2QF7A 1VYPX 1UB3A 3PG8A 3S1WA 3STGA 5EBUA 4Y9AA 4PH6A 1EA0A 2A5HA 3TE9A 1NF0A 1LLWA 3GLCA 4FNTA 3TR2A 4JR5A 3P67A 5F4SA 4UUIA 5AHNA 3GDTA 3HMJG 4IMFA 3AJXA 3N14A 4LS2A 1FCBA 5FF3A 1S5TA 1FBAA 4GE8A 1TPH1 4O12A 4G1KA 2BXVA 2Y7DA 4A22A 4ADSA 1YTEA 2R14A 1DHPA 1MXSA 3EKLA 3DFNA 3G1SA 3O07A 3LCLA 3GVGA 4RKAA 4ZQCA 3DAQA 5KMYA 3F1QA 1PHQA 1ZAJA 4KFOA 3GK0A 1KFKA 3M7WA 3LRMA 3NQGA 3IVUA 3DFSA 6TIMA 1YXCA 1A5BA 1W3IA 3UWQA 3PUOA 2NWSA 3LV6A 2V5BA 3EWXA 4JTJA 1ME7A 4WOQA 4UTUA 3GAKA 5HR6A 3W1QA 4MZ1A 1QMLA 2E6FA 4HNVA 1LOLA 1LM1A 1X1ZA 3EX3A 4B5NA 4NNCA 2A21A 2DJXA 1VJIA 1A5CA 4NXSA 1K8XA 2A7PA 5I3FA 4CNOA 1G4SA 1EP1A 1ZFJA 2V2DA 5HWMA 4TO8A 3S1XA 4ICNA 5CZTA 1GTHA 2CU0A 3MBFA 1GG0A 4K7VA 3UY8A 3P81A 3QJAA 3W76A 2C16A 3G0UA 5BMXA 4FNQA 4X2RA 4GWEA 4NVTA 4WOZA 3WFAA 1JCYA 4IQLA 4O1DA 2QDHA 1TB3A 4LC6A 1IXQA 4PTNA 4HPXA 4FX6M 3QSRA 5FF7A 5KSWA 4AMAA 3ABOA 1AMKA 1T99A 3UPWA 1HTIA 2O7QA 4IGHA 1H7PA 2Q8ZA 1DV7A 2ALDA 3FEMA 1KLYA 3WJZA 2Y7EA 5CZJA 3RU6A 3KRSA 1LRTA 3L0NA 3PC0A 2CFFA 2W0UA 2QUTA 2V0TA 1OFEA 2VFFA 4UCGA 2HS6A 3IIVA 3TC7A 3LTYA 3HG3A 1Y0EA 1OFBA 1KFJA 2ZRXA 5I3JA 3NEVA 2QAPA 2BX7A 3PG9A 3GR7A 2G95A 3L67A 3NQ8A 2PC4A 3NQ2A 5AHLA 1A5AA 3R89A 5D03A 3SGZA 1S5VA 4HNUA 2G5WA 6ALDA 4BK9A 5C2XA 4E2BA 3O15A 4K7YA 1W1ZA 3UZJA 2Y89A 3LHYA 4NJKA 5I3HA 3RK8A 3L65A 4RK8A 2ZRWA 3P7YA 1VH7A 4ZQPA 3E96A 1NAL1 1WYIA 2NUWA 1KLZA 4U28A 3THQA 2QUVA 3KXQA 5AYYA 4QJ1A 4QITA 3FKRA 5TIMA 3QYQA 2FB3A 3UYCA 2H8XA 4JTUA 3PR2A 3USBA 2BLEA 3I68A 3ABRA 4OV4A 3SJ3A 4J9JA 1IF2A 3SECA 4GUJA 4OQVA 1X7FA 3BVJA 1LBFA 1Q6LA 4WXZA 3L5LA 3IIOA 1ZY9A 1P0NA 2VEPA 4YWIA 4H3DA 2HMCA 5FEWA 3CIXA 3TSDA 1VCGA 1QDSA 3U8GA 3NL3A 4GUHA 3EX6A 3GXPA 3BLEA 3O6YX 1SZEA 4MJMA 3HF3A 2X1RA 1XM3A 3S5YA 2QCHA 2FIQA 2R8WA 1LROA 1SSDA 3W7PA 3W1LA 3T4CA 5J5RA 5AHIA 1QWGA 1TPVA 4JEQA 3EXSA 3S5OA 1H7RA 1LLZA 4IX2A 2A6LA 1XXXA 5F1UA 1H1YA 3STFA 3OHIA 4GFSA 1KFEA 4WJEA 3UXDA 3LGEA 2QAFA 3PS7A 2NXIA 5FEPA 2Z0IA 1DORA 3SFKA 4FNSA 1GJPA 5K2ZA 4S1FA 4FEZA 1TPFA 2NXGA 1HL2A 4UTIA 3MP4A 3KAOA 4DO6A 4AWUA 2W6RA 4MFDA 3YPIA 4ADTA 3S6DA 1ZNNA 3FIGA 1TCDA 4DEFA 4MUZA 2XFWA 2WQPA 2OCZA 4MYXA 4UNLA 4FHAA 4A21A 3W70A 4RXFA 1JUEA 3HJZA 1ALDA 3QZEA 1H50A 2E5BA 4BFAA 4Z0SA 1ICQA 4LVGA 3NQ6A 1FUYA 3CB8A 4LC8A 3NG3A 1FDYA 1QPOA 1M7OA 4O18A 3DU0A 3W2KA 5HR7A 4EF9A 3TUUA 3N9SA 4R7JA 1P4CA 3OVRA 3QQ1A 3OA3A 3KOFA 1SFJA 2ABAA 3DFTA 3PAJA 4GUGA 2X1SA 4KWWA 1VHNA 1KW1A 1LCOA 4O1AA 3ELFA 4AHOA 2GJNA 4NNBA 3UNDA 1H60A 1ICPA 3CWNA 1YPFA 2X30A 4IMGA 4QISA 2HSAA 1KFLA 2GVLA 1A50A 2D73A 2ZTKA 3VI2A 3ATZA 3W1NA 1TMHA 1FCUA 1NF7A 5H2ZA 5DN1A 2QJIA 3B03A 5BNKA 4ADUA 2OJPA 3E12A 3O8AA 3OBKA 1M6JA 1EWDA 2XN1A 4FX7A 1G4EA 1T8XA 3M6YA 2YYTA 1WDWA 3SY5A 3RNDA 1L6YA 3P8JA 3C8FA 1X6UA 3S5ZA 5AHFA 1LORA 2FLIA 2YR1A 4QNWA 1W56A 2QCEA 2C18A 5K9XA 4IWWA 5H91A 1X8FA 1OFOA 1R30A 2YCEA 1WOAA 1SO6A 1SZGA 3C2FA 1N55A 3HPXA 4BI6A 4DELA 4MZ8A 2A6NA 4CCEA 3CQ0A 3NPVA 5J5DA 1XBYA 4LVDA 3VKJA 3G3MA 4CCDA 5K7JA 3KRZA 3TMLA 2OT1A 3QQ0A 2EKCA 2FPYA 3PBVA 5AC8A 3HG4A 3ZR4A 2ZZ4A 4CNPA 5DLCA 3CEPA 1F74A 1ZHAA 5HINA 2WOQA 2VENA 2VEKA 4RXGA 3R2GA 3W07A 2H3BA 2WNNA 1Q6QA 1TQJA 1FCQA 4UTJA 1VZWA 4BF9A 1G6CA 3P62A 1BWKA 3C3NA 4NT0A 3LBMA 2X1UA 1DVJA 4KFNA 4AWTA 4Z1BA 1LRNA 4DF0A 1H7OA 1OX6A 3ATYA 4MPQA 1JULA 4IJBA 2DZSA 3PBYA 4O0KA 4AHQA 1TO3A 5AB3A 1YXDA 1JJKA 3CM4A 1VPXA 1OK4A 5DY2A 1B3OA 8TIMA 3L21A 1W3TA 2E68A 2UV8G 4JX6A 1R46A 2C15A 1VHCA 3UWVA 4LRTA 2GQ9A 1PL9A 5DELA 4A3UA 1JR1A 1MSSA 4C1KA 3S1UA 5LKYA 3HO8A 1XUUA 1FWRA 3B06A 2ZZ1A 4DPPA 3Q94A 2VOMA 4LV9A 2G97A 3W7RA 2A7RA 5F4WA 1LOSA 2JGYA 3NQFA 3EX1A 3KVJA 5D2YA 2VC6A 2EHHA 2FPVA 1OYCA 3GDLA 3BGJA 4OWGA 4M19A 5C54A 4RX0A 4XKYB 3HQ1A 3TQVA 1OFRA 4XQ6A 2BZNA 3FFSA 1ZENA 1DQWA 1F6KA 1YTKA 1YYAA 2YFOA 3R5EA 5AN7A 3EX4A 1LBLA 5LZLA 1ZCOA 3PBWA 4JY9A 1H51A 2V9DA 3C2OA 3DFQA 1O4UA 3W7QA 1UCWA 3V75A 1W54A 1R47A 5F2MA 4FF7A 5DXXA 2CZ5A 2EGZA 2I1OA 4O4VA 1O60A 4A2RA 2RKXA 2BSLA 3QMSA 1UBSA 4ZZ9A 1TPDA 4GXMA 2YSWA 3TV8A 2Y63A 1NEYA 2B4GA 3QM3A 5KZDA 3NVTA 5LNWA 3ZS4A 3A21A 4QNEA 2C14A 4R53A 4FNPA 4XTDA 3W2UA 2P10A 1MZHA 4FB7A 2CLFA 1P5BA 4Y8FA 5DBTA 4HNNA 3TK7A 3RLUA 1I45A 1QO5A 3QPYA 4GBUA 4XWUA 4O10A 2VELA 4JN6A 3LHWA 4CQ9A 5EPDA 4XKYA 1IGSA 4NJHA 2DP3A 1KBJA 1L2UA 5EMUA 1BTMA 4GC4A 4IXHA 3SZ8A 3BO9A 1JUKA 3BK0A 1H7XA 3C56A 4N9EA 1S3HA 1OF8A 5I3KA 4E0CA 2NZLA 3TJLA 2PRHA 3G3DA 4XBSA 4AHPA 3HG2A 3P60A 3LV5A 4OT7A 5DCBA 4ZVJA 2DU2A 3P61A 4FIQA 4JTGA 1L6SA 1PE1A 1F73A 4HHPA 2FDSA 3TKFA 3MYOA 1G7UA 5SWUA 4O1CA 2DZUA 2Q3OA 4TMBA 5CG7A 4FIRA 1O5XA 4DF1A 3P74A 3I6RA 5FESA 1M5WA 2B7NA 3MWAA 3AO0A 1TSIA 1R2TA 3T55A 4LWWA 2QCLA 2FB2A 4PL2A 3MMTA 1TRDA 2Y70A 3JR2A 2OX1A 1AW5A 3QW4B 4H6KA 2PCQA 3NOEA 4WQ6A 2GQAA 4HT3A 3G0SA 4DBEA 3FYPA 4S2CA 3S1VA 3LHVA 3QC3A 3W2JA 1YDVA 2BTMA 3I7RA 3ABSA 4JTEA 4FX8A 3DHFA 1H61A 4S2BA 1GOXA 1GVRA 5EKYA 1XBXA 3NYZA 5C6MA 3VE9A 3TQKA 2Z6JA 1HO1A 4Z1CA 3OVPA 3DENA 3GNNA 2C1HA 2J9ZA 4UFIA 2B0MA 2ISSA 1TPUA 1YADA 1VR6A 1PCWA 2DZVA 2WKJA 4LVFA 2YZRA 3O05A 3W7IA 1MEWA 2DZWA 5L9FA 3A23A 3U6WA 5T26A 3LDVA 1A5SA 3STEA 2TRSA 4NNAA 1VCFA 3C2RA 1KFBA 4R33A 3GR8A 5D05A 3MP3A 2ISWA 3CIWA 1ZALA 3W1AA 5LNRA 4HSOA 2B7QA 4JTIA 2J27A 1I2OA 2X2GA 1K7FA 3UWUA 3TU9A 3HG5A 3IGSA 3M16A 1I4NA 1D9EA 1K7XA 2NWRA 1Q3NA 1EB3A 3G22A 1X1OA 4WZHA 4PC8A 3IGUA 3TQ0A 1QO2A 1O5KA 1KM2A 4AWSA 2XN0A 2ZCGA 3C2EA 1XC4A 3P80A 1QNVA 4D2JA 2CWNA 3NQVA 1VCVA 3W7KA 5F2GA 1HG3A 1JCNA 3MJYA 3HGSA 1YPIA 4YXGA 1EUNA 1C8VA 1L6WA 3MI2A 4RZ5A 2AAMA 3UZ5A 2VKZG 1U5JA 3PB2A 3IEBA 5G2WA 3KVLA 3W84A 1ZJIA 4M7SA 4M6VA 1GVOA 1Z44A 1W5NA 4JX4A 2EF9A 3P82A 4JTLA 3HPSA 1W5OA 1LOQA 1FQ0A 4TMCA 4JTHA 5L6UA 4O28A 5G2IA 4K8HA 4JY8A 4UFMA 1J2WA 4ORIA 3R13A 1EP3A 1QFEA 3GZ3A 3M5VA 2ZTJA 4LRSA 3KRUA 4TX9A 3LOTA 4ZQOA 3TC6A 1PHWA 2GVGA 5F4XA 4PODA 2C13A 3TCEA 1WXJA 1YDNA 4O4WA 3TXZA 1K03A 4N4QA 3QFEA 1H7NA 3TFXA 3MI6A 3IV3A 2PRLA 5FEZA 1GTEA 3LM7A 1J5TA 3IVTA 4WD0A 4HKPA 3DKLA 3H54A 1R2SA
chains in the Genus database with same CATH superfamily
3MW7A 5DQPA 3GXNA 4XVDA 3ZLHA 4AZCA 1AD1A 4XBKA 3KVMA 4L1GA 5FAJA 3F4DA 3OG2A 3QRHA 3BAWA 3FA5A 3GNOA 1VBJA 5CPQA 4G7EB 1SUXA 5CSSA 3T7VA 3W28A 1Q5MA 3UCCA 3HGRA 2EXOA 1KR0A 2QJGA 2WNWA 3BDKA 2VDIA 2FMOA 2AGKA 1A3WA 3AHYA 2RGMA 4CLMA 4JKKA 3A4XA 4IOTA 1EC8A 1S1PA 3BW3A 3SW6A 4L4LA 3GWQA 4YYCA 1QOQA 3BOLA 1MVYA 4TXEA 2QMKA 3CWOX 2V3EA 4QBXA 2ZXAA 3FA4A 3WZ0E 3FJNA 3N3MA 3QHOA 2UY4A 1L9WA 3BGGA 3W53A 1FWCC 1LF1A 4UTLA 3WNPA 3VCNA 1B9ZA 1UKOA 1XRTA 1QBAA 4Z1YA 3MUIA 4W93A 1NSJA 2PI6A 3TTQA 3WF1A 2YCJA 5DMNA 1AK5A 1OY0A 2A3HA 1MI3A 3EX2A 1AJ2A 2BY0A 3I3DA 3OP2A 1GWJA 3MJMA 1J0HA 3QN3A 1E0TA 3V1HA 5J04A 3U2OA 4GZJA 4Z1DA 2J6XA 2J7HA 5LGXA 1V77A 3MCOA 3W72A 3NL2A 2G96A 4CQAA 1OCNA 4KQNA 4L9YA 1IQ8A 1EA9C 4S38A 1GJUA 5FA5A 1S39A 4NL1A 3LUTA 4DI9A 4LX4A 3FJ6A 1A49A 1JDDA 4W7UA 3IUDA 1B3XA 1E0VA 5U7SA 4K3ZA 4IISA 3II1A 1VYRA 3CPRA 1UD5A 3QMRA 3VAVA 2PS2A 4J3UA 1JXJA 3KTXA 4GI8A 3CLMA 3OJGA 3CUHA 4NAFB 1B9BA 3B8WA 1OINA 1GVFA 1GEQA 3GX9A 4RDYA 4M29A 3BG9A 3EMQA 3NA8A 3TYAA 4IMEA 9XIAA 3P5ZA 4V15A 4HOWA 5HJYA 4DUXA 3WLJA 3EB4A 3MDUA 4QS6A 3UP8A 4HQVA 2Z2UA 1QT1A 1VFSA 4NI3A 1PYFA 1TVNA 1WKDA 3CHDA 3CAKA 1M65A 1XLGA 4ZSTA 5M17A 1JQXA 4HTBA 2QGHA 3XISA 3BW2A 5D9MA 1V51A 1KM3A 1W3LA 5EA9A 1VQTA 3NM3A 3PZIA 5F2IA 1YBQB 1ELSA 2QDGA 1D3CA 4QIUA 2XG9A 1NQ6A 2J7EA 3QMTA 1XGZA 3CAWA 1DXEA 3KDOA 4ZXLA 2WNQA 4KEVA 2Q09A 3N3TA 5G4EA 1O5RA 4JNYA 3KWXA 4GYFA 1BVZA 4YMZA 2E5CA 2BFGA 4DO7A 3L2IA 3ANUA 4UTMA 1ADDA 1W5PA 3TTSA 5DMYA 1RP8A 3DERA 4M56A 4ASTA 1I2RA 3G24A 3I4EA 3W7NA 3KOYA 1QNQA 3G2GA 2VC9A 3H55A 3B04A 5JIPA 2P1FA 1SPQA 3M0ZA 1XGEA 4PUUA 1E0UA 1EC7A 5HATA 2YX0A 3VNZA 3VO0A 4FK9A 4NXKA 5BW6A 4TU1A 3N2XA 4W84A 3WMLA 2E6DA 4GI4A 4CNNA 1CWYA 4GG9A 5K3VA 3GS6A 4YTQA 3W7HA 3L4TA 1BG4A 2WC4A 2CHRA 4JKMA 4JTDA 1T0OA 3MUAA 3MO7A 1UJPA 1U83A 4KS0A 4IXXA 1V3JA 1ICSA 2CBJA 1M04A 3D3FA 4AD2A 5K9CA 4Y90A 2EG6A 3BAJA 1AZ2A 2OZ3A 4HHLA 4C6QA 2HVNA 2ZZ5A 3A9IA 3KL3A 2REQB 3VNJA 5JBDA 3LNMA 2A3BA 3JS3A 2ZWZA 3KBWA 4DBSA 4J4KA 1HVQA 1HZYA 1KKRA 3PVFA 1C29A 3H7RA 3R12A 2V82A 4GIRA 3W29A 4JFWA 2OZ0A 5TQLA 1SZFA 3T2OA 2NUYA 1A5MC 3B8VA 3AIVA 1XV8A 3WLIA 4S3JA 1XRSA 2E6AA 1CIUA 2EQDA 1ZL1A 5A6MA 3N9KA 1GZJA 2OFJA 4JIPA 3QTGA 3MBDA 8RUCA 3IIZA 4QAIA 1TMLA 1IXNA 4E4UA 2Z6IA 3Q2DA 1HJWA 3W7LA 3W83A 2JFEX 3BJTA 4U3AA 1V08A 1QOPA 3QZ6A 1LL4A 3ES7A 4A2SA 1TPWA 2WYSA 4HPNA 3RJXA 2QEZA 3NPUA 5I77A 2V5CA 4CN4A 4GUIA 1OK6A 1S38A 1IXPA 4WK9A 1B2YA 4AD3A 1MDRA 1ONXA 1H11A 8XIAA 2VURA 4BEUA 4F0MA 3GG8A 5AC7A 3O16A 1UOZA 5GJPA 1Q45A 5AYBA 4JYEA 3GHUA 3S9IA 3UXAA 2HS8A 2D2GA 2Y2WA 1A5UA 4K2SA 4ZQNA 3SCRA 5LHEA 3W22A 2OKOA 1TTPA 1V3LA 4PMQA 3MHGA 5G1TA 3C86A 3GKFA 2RDTA 3UQNA 1XCXA 3WD1A 5MHBA 4GKTA 3DBNA 1XICA 2ZX6A 3JRKA 5B80A 5D09A 3GSMA 1BXCA 4QR6A 1F5ZA 4JL2A 4QRNA 3LPFA 3VIPA 4K36A 1FP9A 1IEIA 1VIWA 1BYBA 3R7MA 3I4KA 1GJWA 3HURA 1DJIA 2OOFA 1Q13A 4UQEA 2FTWA 1V02E 2ATMA 4DJEC 1MWOA 3GE7A 4QE5A 2EPOA 5H8PA 5EMKA 1VFLA 1BWVA 1E3XA 2BNJA 1UC4A 1XFCA 4XO6A 2VEMA 3ANVA 3ITYA 3ZR6A 2TAAA 3PTKA 2J88A 2QCDB 3TJXA 4Q3MA 5FF4A 2ZUTA 3UBPC 1C8YA 1UYQA 1M53A 2E1DA 4WY0A 4Z2LA 3F03K 2VWTA 3ZWSA 3EXTA 3VIMA 5HQEA 5CH9A 3GIYA 3POHA 3DGBA 1V02A 3UVIA 4XTIA 4DJFA 5AZ0A 4AAJA 4CCCA 5A95A 4PCFA 2DVUA 1TJPA 3GYCA 3FN9A 1YDOA 2Y7GA 1F8MA 2DY3A 5FL1A 4PZVA 3T81A 4WGXA 2DIJA 4WKHA 3EWZA 3E2VA 4UXDA 1HNYA 1TPB1 1UUMA 3MP5A 1THFD 4LTSA 5D2VA 1OEPA 1UG6A 2I5GA 3M1ZA 2XM1A 2SFPA 2QV5A 2OLHA 5EGRA 1IZKA 5D37A 3BXWA 5E6ZA 4TX6A 5A5WA 1RXOB 3LCGA 4RV8A 3BLFA 4IT1A 3VNDA 1MEIA 4YTUA 1EJRC 1UA3A 4GVGA 1G0CA 3H2OA 5FF0A 2E9BA 4CN1A 3SGUA 1RZMA 1V6TA 4HD5A 4DJFC 3FNDA 3NXFA 1TE6A 3WLPA 1OT1A 1I8JA 3NIYA 1TVPA 2H9AA 5T8GA 3T4WA 3WDHA 2OODA 3K8KA 3OTRA 3L2MA 3W26A 1PIFA 3O9NA 2FH6A 1FWTA 3M0HA 4DO5A 1LTDA 2ZA3A 4TQTA 3CZJA 1B31A 3SRKA 4JHZA 2Z26A 2CIPA 2OSYA 1HVXA 1UKPA 3M0LA 2WNZA 4WRHA 1Q2SA 4JTFA 4K6AA 3UWZA 3M0YA 4JTSA 4UOJA 2A2IA 4H2HA 3A3XA 1SW7A 4IPJA 3S6OA 2VRKA 2Q3RA 1LRQA 1AFSA 3QLDA 1QNRA 3OODA 4O14A 1J5SA 1VBHA 2Y6ZA 3LGGA 3GIQA 3FK4A 3FVDA 2DVTA 4LW7A 1IWAA 4UC5A 3H8AA 3BW4A 1BQGA 2DQWA 2ZX9A 2GDVA 4DM1A 1JNDA 1WB0A 2BASA 3T78A 2JQXA 4M1BA 1J0ZA 4XAGA 4D6DA 3DCPA 4TV5A 3QSTA 4AZIA 1DJNA 4CD4A 4HPGA 2QZRA 2CLMA 4AFYA 1DOSA 2JIEA 2E1WA 2FQIA 1KM6A 5FKYA 3G1DA 5CBJA 3QTPA 3KBVA 1FVPA 4K8EA 2I9UA 2ZQ0A 3VMNA 3ZSSA 3TYEA 3QOMA 3F2CA 4KKXA 1E3ZA 1D8CA 1EP2A 4FO4A 3NQEA 4AEOA 3O3RA 4H9ZA 3KDNA 3QXBA 5CC7A 4LALA 1YQ2A 3MI3A 5A8MA 3AHVA 3M43A 5CPNA 1J96A 4JEJA 2HWGA 1JGMA 3MV01 1JCJA 3GB6A 3WQ6A 3KTCA 4MSSA 2RAGA 3MYPA 4C6NA 2FGBA 3TYZA 3ZOAA 1XC6A 3NDYA 5FL0A 3WLNA 4IJCA 4YTSA 3FXYA 3P8IA 3P5YA 5CGMA 3NO5A 3L66A 4ZMGA 3BZGA 1GG1A 2NQHA 4JTTA 3L23A 2V2HA 1QBBA 5E0KA 4JYDA 1QTWA 2X16A 4E3TA 2VL4A 4XUGA 3KLKA 4RLIA 4E8GA 1SO3A 4GZIA 4LB4A 3GXTA 4Q33A 3RDKA 4AG0A 5EMYA 4QGCA 4H9TA 1QK0A 3C61A 3H26A 1ZGDA 4JIIX 3UWEA 4IJRA 4LVAA 1JYXA 4U5IA 2KAUC 2ZICA 5CPLA 1QAPA 3H21A 4MJZA 2YXXA 1I2QA 3W3OA 4K68A 3V16A 3F5KA 3AFBA 3EEGA 5M3WA 2LLEA 1QPQA 4NAEA 1XBZA 2JEQA 1Y5XA 1VC4A 1OC6A 4GIYA 4KH2A 4ROQA 1H41A 3IIPA 3RCMA 1UMYA 1OQFA 3M47A 4LSBA 3LLFA 2J8FA 1RPXA 2A7NA 1OIMA 2WSYA 4ATLA 4Q8OA 4DVOA 3CHVA 1GOWA 3T40A 1Q7QA 3C4UA 1XL9A 2PLJA 3BPWA 3IJ7A 2GSHA 6TAAA 4ZTYA 2A3CA 1EF2A 3UPBA 2DFAA 4KEUA 4FXSA 4LEFA 2PURA 4NX0A 2YBUA 1B3ZA 1PWLA 3T9PA 1R3SA 4G8TA 4IPLA 2QJHA 1H4PA 4HMNA 3M6DA 5LSMA 1KKOA 5KEZA 1DQXA 4QQUA 3CH9A 3AS0A 4ZE4A 2ZUVA 3GKAA 4PEKA 3CL6A 3CIVA 2I7GA 4Q4PA 3PWIA 3ISIX 5LGZA 2F2HA 4X9YA 4G6CA 3MMWA 1H5YA 2X2YA 4OVXA 3J7HA 1EOMA 2WPBA 3XIMA 2BBFA 2BVDA 2PTZA 3CAVA 2HVMA 2PDYA 4N02A 1EO7A 3HQNA 1AZ1A 5A8GA 1PSCA 3BC9A 2Z28A 5XIAA 3LX9A 4RV3A 3A13A 1UD3A 3ES8A 5C55A 2VX6A 1J4EA 1NARA 1P48A 4H8VA 1WDRA 2CZVA 1TV4A 3PUDA 5IHRA 3BJFA 5U4NA 3W6YA 2VEIA 5LXEA 1S2UA 1HJUA 3M0JA 1OX4A 3PG8A 3VDBA 4QXIA 4PUWA 5EBUA 4MWAE 4Y9AA 4PH6A 1W1A1 1Z3NA 1NF0A 3CYJA 3MT1A 1V93A 4UUIA 1QW9A 3GH7A 3HMJG 1B54A 5JUVA 3EB3A 4AQLA 2VR5A 4L6HA 3MV11 1B3WA 4O12A 4FLQA 5C70A 2CNCA 1GGOA 4MB5A 1DHPA 5BWFA 4RKAA 3DIPA 5KMYA 2OX4A 3H4GA 3G77A 1LT8A 3U7VA 3EA2A 3GVRA 6TIMA 1YXCA 5HAOA 2XVLA 3FEQA 1UQYA 2PF8A 3B3DA 3EOSA 4MNLA 3PUOA 3LV6A 4IQDA 3KLLA 4GIAA 1ME7A 4WOQA 4UTUA 3ZJKA 4AWEA 3FHQA 8XIMA 4HNVA 4IL0A 1LOLA 2WSKA 1LM1A 3LSBA 4OOUA 3BMWA 3UYIA 2DSKA 2I16A 2A21A 1A5CA 3W6LA 2XZ9A 4BF5A 4JL1A 2J8GA 4CNOA 2BGSA 1ZFJA 4TO8A 3S1XA 3P81A 1GOKA 4L6DA 5HA7A 3W76A 4W7WA 3G0UA 4ECLA 5BMXA 5E0FA 4O1DA 4UWMA 2QDHA 3CXOA 5FF7A 3DHPA 4HK7A 3ABOA 1E9IA 4IGHA 1H7PA 4XAPA 3FEMA 5I00A 1KLYA 3WUBA 2HNEA 2FVKA 3RU6A 1EQPA 3D5HA 3PC0A 4O0QA 1IEWA 1ODZA 3ARTA 1OFEA 1JYNA 2VFFA 1RUSA 3IIVA 4MWAC 3W27A 2Z1WA 4PMUA 1Y0EA 1OFBA 1W9DM 2GVEA 5I3JA 2BX7A 5AC4A 3MUCA 2GL5A 4S39A 3ZVHA 2Y5JA 2PWHA 5AHLA 2OLSA 5A2AA 5D03A 1PXGA 3SGZA 2G5WA 5C2XA 4L4PA 3VGHA 3AWNA 4LAKA 2Y89A 2ZRWA 3E96A 1NAL1 3WQDA 4DAIA 1KLZA 2IXVA 5AYYA 4QJ1A 5CXPA 2FB3A 2WVTA 4QCEA 1BXBA 5HMEA 2WMKA 3W25A 2BLEA 3VIGA 2OSXA 3I68A 2V68A 4OV4A 4J9JA 1IF2A 2X41A 4OQVA 3BVJA 1LBFA 1Q6LA 4UR9A 4PMJA 5CZKA 4C1NA 1FP8A 4YWIA 3TSDA 1VCGA 1X96A 1QDSA 4HVXA 4C65A 4AIBA 4J3SA 3IACA 5FAGA 3BLEA 3RRXA 4MJMA 3CASA 3OZOA 2UY3A 2X1RA 1XM3A 3L12A 2NVCA 1E73M 1QUMA 3PUGA 1I0BA 4DBUA 5LIKX 4NRSA 3W7PA 3W1LA 5AHIA 1TPVA 3K13A 1XLCA 2WHJA 1DWGM 2ZVIA 3STFA 2J4GA 3PPGA 2OQYA 3GVVA 4WJEA 1AH4A 3LGEA 1PDZA 2NXIA 1E70M 4CU8A 3SFKA 4E8DA 4RDWA 3B9EA 4IFOA 4S1FA 3QY7A 4E8CA 3FX4A 4PMRA 3UG5A 4KGLA 3A64A 2VOTA 1JAEA 4MFDA 4ADTA 2HCVA 3FIGA 4MUZA 1EC9A 4G7EA 3WBEA 1JI1A 2PLKA 4I8DA 2KX9A 1XD0A 2AMGA 1F3XA 4RXFA 3HJZA 1ALDA 4ES4A 1H50A 3OBEA 3VOGA 1E6SM 3O0FA 1NDYA 1E1CB 3WSUA 1F3EA 2FGZA 3GU9A 3NG3A 1FDYA 1QPOA 3VGBA 4W89A 4O18A 1XSKA 3W2KA 4GNKB 3N9SA 2J77A 3RGTA 4WR3A 3VCCA 4Q4QA 4KCVA 3DFTA 3TJ4A 3PAJA 4D6GA 4AD5A 4KWWA 4HHMA 3ELFA 1XH1A 3LLXA 2AL2B 3VM7A 3FAXA 3USZA 1BD0A 3CWNA 4IIEA 2P8BA 4IMGA 1LG1A 4BQ3A 2HSAA 2GVLA 1A50A 2D73A 3MQTA 1TV2A 2QJIA 4C6JA 4ADUA 1VRXA 4PEEA 1O1HA 1S5MA 1ZP4A 3O8AA 1XRVA 3OBKA 1M6JA 1REQB 1EWDA 1ZU8A 4FX7A 4FLSA 1FWIC 3UA3A 1L6YA 2DPEA 1W32A 2ZWYA 1LORA 4EK7A 3OZPA 5EMLA 2YCEA 1WOAA 4H6EA 3VNYA 1SO6A 3UJ2A 1SZGA 3C2FA 4IG2A 4C60A 3HPXA 1QI5A 4DELA 4EXAA 4YJ5A 3AXMA 5HPOA 1TE1A 3NPVA 3GTHA 2GDQA 4DYEA 1GPFA 1KGUA 4M0XA 1VBGA 2QW5A 3NTYA 5AC8A 3ZR4A 1XWYA 2ZZ4A 2QHAA 1HF6A 3RM9A 5A2CA 3VGGA 1JZ6A 1F74A 1F4AA 5HINA 1JZ3A 4GQGA 2VENA 3TLLA 1ZJBA 5FSDC 3CZLA 1T5AA 4UTJA 2VQUA 4BF9A 3PFMA 1BWKA 3TEVA 2OOGA 4DBWA 4AWTA 2AKMA 2B81A 4U2YA 1POJA 2XFRA 1H7OA 3I6EA 1FHVA 4O0KA 5TD4A 1SJBA 1JJKA 1VPXA 3EOLA 1V0MA 2HRWA 2C15A 4V33A 2GQ9A 1GK8A 1XIGA 3PNUA 1H09A 5TNVA 2INEA 1FWRA 2QVHA 5GPRA 3B8UA 2VOMA 2EPNA 3S83A 5A6JA 2JGYA 3QZAA 5D2YA 2FJUB 4QHRA 2WM1A 4RX0A 3IARA 3IV8A 4XKYB 3HQ1A 4A3HA 3FFSA 1M7JA 1DQWA 3ARYA 3BSHA 4MUPA 3EX4A 3KBNA 1L8PA 5LZLA 1ZCOA 4RDVA 1UD8A 3DFQA 1O4UA 3W7QA 1R47A 2PGRA 3DYPA 4US5D 2XFYA 3GXDA 2Q8XA 5BXTA 5DXXA 3NWRA 1GHRA 2EGZA 2I1OA 3ALGA 4FLOA 2XIIA 1C9WA 1G5AA 4A2RA 3GVQA 1F9CA 1TPDA 3GRIA 3WQFA 3QM3A 5KZDA 1QPKA 1CENA 2R1MA 1W3JA 5BWAA 3W2UA 1E6QM 3CK5A 3ZR5A 4MB1A 5DBTA 4EAMA 1QO5A 3AOFA 3SY8A 2VO5A 1UWUA 4JN6A 5EPDA 1L2UA 4XISA 2E3ZA 1I9CB 2NLYA 2XISA 3E1F1 5C0QA 2YOCA 3C56A 1XYMA 4L56A 3UZWA 4GCXA 2NZLA 2OYMA 4S3KA 2Z7KA 4AHPA 4GACA 1E4LA 2WANA 3P60A 3QV8A 3OGSA 5AVNA 5SWUA 3RR1A 4O1CA 2Q3OA 2WLYA 3SRFA 3WLOA 4DJFD 1JYWA 3I3EA 3P74A 3I6RA 3AO0A 3T55A 3E2RA 2XUCA 2QCLA 2FB2A 4C5YA 3MMTA 2Y70A 3T8QA 3QW4B 1W9UA 1YRRA 4WQ6A 1WDQA 1O6IA 1A5LC 3AJ7A 4XV0A 3SRDA 4BKNA 4K8GA 3ARUA 2CKSA 4JTEA 1V6WA 4NHVA 4YN5A 1IT7A 2AAAA 1GVRA 1GQIA 3GG1A 3HPFA 4S3DA 1EH9A 1M7XA 3ZT5A 3OPSA 2PUZA 3GNNA 1DXIA 2ZUNA 2J9ZA 4UFIA 4U2ZA 3E38A 4X2PA 1YADA 1X6LA 4LF1A 3VC6A 2YZRA 2DZWA 5L9FA 3GW3A 3N11A 3BAXA 5REQA 1VCFA 1PJ9A 4Z2KA 1KFBA 4W88A 3TN5A 1J79A 2WMIB 5AVHA 4HMDA 4IIDA 4J3XA 1JAKA 1ZALA 3W1AA 4ZO6A 2B7QA 3GC5A 1QW7A 2X2GA 3TU9A 4IF2A 1FTXA 3IGSA 3M16A 1H0IA 1HKJA 1D9EA 1K7XA 2NWRA 3UGVA 1EB3A 1R5YA 1X1OA 3RN6A 4PC8A 3IGUA 3TQ0A 1KM2A 4AWSA 3WFZA 4ZXOA 2J13A 3M07A 3NQVA 1V79A 4BA0A 4Q8QA 1OB0A 2ZIDA 4AZCB 5F2GA 5HOSA 4PYSA 4YXGA 1EUNA 4H01A 1IEQA 4JN7A 4RZ5A 3N6JA 1WKYA 3ZXWA 3PB2A 2G3NA 3W84A 1ZJIA 5FJUA 1Z44A 4JX4A 1WDPA 3P82A 3OVGA 1UPPA 3P0WA 1DIDA 1Q6CA 4TTUA 3R13A 2P50A 1R3TA 1UZ4A 1QFEA 2GZXA 4R7WA 4GINA 4LRSA 3KRUA 1EOKA 3TC6A 5F4XA 3TYDA 2C13A 3TCEA 1WXJA 1YDNA 4AY7A 4GNVA 1X98A 1H7NA 3ITXA 2PRLA 1GTEA 3LM7A 5ECVA 3K46A 3KE0A 1UD6A 4GYPA 4V1XA 2D2JA 1R2SA 4E4PA 1TKKA 1JDAA 3E02A 1ADOA 5G1YA 5RUBA 2F7FA 4LUJA 2G3IA 4V2XA 2XINA 3BCFA 3LZ3A 4HYWA 4KIRA 4AXNA 4XZ9A 5HUPA 3WBYA 3V1PA 4MLJA 3N6HA 4DB7A 3CMGA 2VFDA 4R85A 4PCPA 3TJIA 2XDFA 4JFSA 3EPNA 3QV9A 4OHQA 1WUEA 4DLFA 4QFUA 2VFIA 4O15A 1MW2A 1K4HA 5HWJA 2FZ8A 1BPLB 1GUVA 1IEXA 3HOJA 2V3DA 2RHGA 2GPTA 4IPIA 2ZUWA 1AD4A 3B9AA 4JFUA 2WKLA 1EIBA 5G2HA 2PDKA 4FNRA 2QGYA 3NDOA 4KT2A 1EJTC 3LBCA 2GWNA 5LNSA 3S4TA 1OHLA 2DSUA 4YCOA 1E6ZA 1AW1A 5TBOA 2J24A 1RCOB 3ZMRA 1SFTA 1A3HA 1RR2A 1R9YA 2FZNA 3W82A 2WVSA 1W2VA 2C1IA 2NX3A 4FPSA 1WZLA 4NJGA 3R0KA 3POCA 3W1MA 4H1ZA 3EYPA 1JD7A 3G1YA 4D8LA 1JF5A 2PP1A 5FACA 5DEZA 2W27A 3PB0A 2Z1BA 4UQ9A 3VD3A 3B0VC 1N82A 4F9JA 4P61A 3NEHA 3GFXA 4GYKA 1Z41A 4K39A 1P6CA 4B5WA 1GNXA 4LCRA 3UCDA 4FF5A 1KWGA 3ENLA 3TVAA 5C2GA 3CAQA 2ZUUA 1DPMA 1EIXA 3FJ4A 5AFDA 1TR1A 2WZEA 4O1FA 3I6TA 3NZPA 4LUTA 3BLLA 4AF0A 1SO5A 1WE5A 4XZWA 4BQ2A 4JICA 2W79A 1KD0A 1DJQA 3HJEA 4H8UA 4YL2A 3WK2A 3H7VA 4AB4A 4AW7A 4PBGA 3GTNA 5A1AA 3C6CA 2G37A 3S46A 1OGBA 4MMWA 1VBUA 3MKVA 4ZFCA 2D24A 1GONA 3T05A 1SFSA 1T41A 5AY7A 3G5EA 1D3GA 4RR4A 3AXKA 4ORMA 1G69A 3WLQA 2TYSA 3CHCA 2OXNA 5A6AA 1G67A 3WL1A 3H4XA 3WDJA 1OFPA 1A47A 1L0PA 1UP3A 3SB0A 5GNXA 1MW3A 1R3YA 1K9EA 3L4VA 4NIRA 3W7OA 2VQTA 1LJYA 3WDRA 1VD6A 4GD0A 1MRAA 2YPIA 4PR4A 5AYXA 4QCFA 3N13A 5DF0A 1VRDA 3TYUA 4R3UA 2FVLA 1F8IA 4CEXC 3AMKA 1VJZA 4PE8A 4DYJA 1YMYA 1KQZA 1FKXA 1YTDA 4KGJA 4B16A 1UZDA 1G4PA 3ZT6A 1DEDA 1OG0A 1GOIA 3WF0A 4HCHA 3LYEA 1QPNA 3ITVA 1TJ2A 3PZTA 3NO3A 2QF8A 4JTCA 4H83A 1V0LA 3WYZA 2B7OA 2TMDA 3TYBA 2H8ZA 3LI0A 4J7RA 5D02A 3QR3A 4Q8NA 4P2VA 3FGCA 5JU6A 3S5NA 2P0IA 4JGDA 1G9HA 4MNMA 5C9WA 2WBKA 3CUXA 2F6UA 1EJUC 2BOGX 1UIPA 3M5ZA 3GU1A 1A5KC 1TJRA 3WMSA 1JCTA 5I2UA 1Z48A 2W4XA 3R43A 4L9ZA 3WG6A 3WUEA 4JD4A 3PBMA 3GVWA 1LL6A 2BG5A 1A0DA 4MFEA 3GNRA 4AD4A 1VFMA 1JIBA 1CCWB 1SMDA 3A24A 3CO4A 2X8RA 2CZEA 1TZ7A 3VM5A 3K8MA 3TW6A 3DESA 3L7RA 3WEMA 3VTRA 4MYAA 2DT2A 4J3ZA 3GYEA 1K8YA 5CZSA 2VUNA 3T1GA 2WXDM 1FH7A 4FR6A 1R2RA 3M0MA 1TX2A 2V38A 2XPKA 3MMDA 4UTTA 3CC1A 1O95A 5XINA 3UY7A 3VCRA 3SCSA 2KZHA 5IDZA 3HIJA 1Q63A 4H41A 5AHEA 3L4ZA 1XIEA 4M82A 5BU6A 4UNIA 4YLWA 3IIXA 2E6YA 3U7BA 2PLMA 1VFFA 1UOKA 1RH9A 4WJXA 1Q7ZA 4X9SA 4H2CA 1W1IE 5CKSA 3S0CA 5E93A 3H2EA 1M68A 2HNHA 5CJMA 2QT3A 4X0NA 2QIWA 1H7WA 3FHAA 5CJNA 5I78A 1XIFA 3DC0A 4N6EA 3SDOA 1NOFA 1KTCA 2CZFA 3QY6A 3S9YA 1DWHM 3BAYA 5C9ZA 2VR4A 3VXGA 1OGSA 4I7WA 4M7TA 4JX5A 4FS9A 4AX6A 2QJNA 1EPXA 2QDEA 3EXRA 4XSMA 4EVZA 2Y88A 3SQMA 4P8XA 4ICCX 1XIMA 1UKTA 1OCQA 1OC7A 3W87A 3MU7A 4FMVA 2Z1XA 3UJRA 2CESA 3BWWA 2DZXA 4K1GA 3TN4A 3GBDA 5ABFA 2Y85A 3TSBA 5IM51 5KZMA 3AXIA 3L9CA 3KTSA 2XSBA 5K4XA 2C19A 3EOUA 4V28A 6REQA 4FLRA 1RCXB 4LNCA 3OIXA 3NQ7A 2XYLA 1GPWA 1J12A 1UWTA 1F07A 2Y8KA 1M1BA 3RMEA 2ZVRA 3KW3A 3EZ4A 4U5KA 5LNUA 2IKIA 3S3GA 2VRQA 1DL3A 1CGVA 4PTXA 3BH4A 2YCKX 2DSWA 3TW7A 4F0SA 3AS3A 1ML1A 4OUEA 3JVAA 4ZB0A 4AYSA 1WQ5A 5I0DA 4KEMA 2GWGA 3FA3A 4WY0B 1GZ1A 2OQHA 3URNA 1BG9A 1TA3A 4KFPA 4MADA 3THCA 1E9ZB 5IBXA 2C71A 1PEZA 1TV7A 3IJLA 4IMDA 2F2KA 3SURA 4TIMA 4GNJA 3B0UX 4ERAA 4IM4A 3QF0A 3WJWA 3BOFA 4PMNA 1YHTA 1KBLA 5E1QA 2J66A 1RVGA 3PZNA 3ME3A 3UJFA 1E71M 4ATWA 5AYZA 4IIFA 4RNFA 1SO4A 1SMAA 2BGQA 4A05A 3ZO9A 5BOFA 1XLJA 3C52A 1DJZA 5GNZA 3TN3A 3PZMA 4C7DA 3EDFA 2OMAA 5CGQA 5T9CE 3N73A 2A3AA 4KW2A 3M5XA 1TZ9A 3NM1A 5F1VA 3D0CA 2DIKA 3G1XA 1MEHA 3S2LA 3W9ZA 1KM1A 4S3CA 1BYDA 2HBVA 2GQ8A 4W8AA 2WO5A 3TA6A 4C6LA 4HA3A 2PDLA 1V7YA 1W37A 1BWLA 2JBMA 4WY0F 2Q02A 1K7EA 5CQ1A 2YW3A 5IBXC 4A4AA 3U2CA 3JZUA 3E49A 4LAUA 1EBGA 3WLMA 4LAZA 4MDPA 4RZ6A 1PX3A 3N19B 4MNKA 2C6QA 1QR7A 3S6TA 4HJFA 5LIWX 2DUXA 3QGKC 1TTJA 1V3KA 2H9AB 1HGYA 3N2OA 2BV9A 1OYBA 2EPMX 1R86A 3BCDA 3CZEA 3IANA 3D3AA 5JIWA 1EGZA 2PDXA 5CPTA 1PYMA 2QMJA 3BTNA 4O0ZA 1H62A 1KV8A 4B9ZA 4QJ5B 3T0AA 4O1BA 4O13A 3CMJA 1OZMA 1RA5A 2ATSA 2P8CA 2PLCA 4L7ZA 3K4AA 5ECUA 2Z25A 4AVOA 3SN0A 4BEQA 1H1ZA 4Z08A 2Y61A 1IEVA 3H53A 1AQFA 2C3ZA 3R0UA 1FWGC 2YKKA 2AQVA 3T0DA 3AZTA 4UFHA 5E09A 1ITQA 2DT3A 2R94A 3NZGA 3TWBA 2NV1A 2YZ5A 4WDTA 1DE6A 4OE7A 4EIVA 3O6DA 3DFYA 1FWSA 3ICJA 5I3IA 2ZRVA 4BQ4A 1W8GA 3QH2A 4HA0A 3WH7A 1E55A 4WHBA 1FOBA 1RQHA 4WX2A 3VINA 1NP0A 3FY1A 4IPPA 2NQLA 3VD5A 7XIMA 3QGVA 1EO5A 2P0OA 1XISA 2WHLA 3VIHA 1RPKA 4IP5A 4YWSA 1F7BA 1OCBA 3LCXA 1VKFA 3A3HA 3HM7A 1WA3A 3K4WA 5HQMA 1U5HA 4B3KA 1D7FA 4W85A 4UFLA 1VAHA 3GUWA 2R9RA 4NG3A 1A53A 3WD4A 3NNTA 3NDZA 1TZZA 3STCA 2Q01A 3DKJA 4BR1A 2JKEA 4GXWA 1PS9A 4KF1A 5T9BG 2BB0A 2CLIA 1OADA 1HXJA 2Z00A 3LLDA 4K37A 1Y65A 2DZPA 3AIWA 4GIEA 4EOUA 4WVXA 3TDFA 3HV8A 2ZYFA 3ARWA 2V5JA 3IJIA 3NVDA 4OOZA 2IPJA 3R79A 4LYRA 4OV9A 4AY1A 3G0XA 1EEXA 3WQGA 2ZC8A 1XYFA 4KWVA 3UG8A 3MUY1 1UKQA 2PTDA 3W7CA 1BYAA 4QX4A 4IMCA 4A3YA 1XBVA 3A22A 5JMUA 1HW6A 3NQDA 1S46A 1R3WA 2RDUA 2WMJA 4PTDA 4QM1A 3O0KA 5I03A 2INFA 3S2NA 3IK4A 5MF5A 3RILA 2RJHA 3UVAA 3Q4DA 1PVNA 2VVNA 2D69A 1JZ8A 3H7UA 3T2PA 3GTIA 2BVWA 4FZIA 3OLEA 4F3HA 3KHJA 3GHTA 4HHHA 1XLFA 5IDIA 4ZQRA 1NJJA 4UMAA 2WZMA 2XGZA 3G1RA 4Z17A 2NX1A 5FJPA 1EJVC 1Q8JA 3LXAA 2O0TA 2OYKA 4MIMA 4GO8A 4F4RA 3GDMA 3TSMA 4NAEB 4FOJA 3TWAA 3WD2A 4LEQA 1KA9F 2HXUA 3I3BA 1W31A 4I7UA 4OU1A 3M4HA 3IJDA 3PF3A 1K6AA 1RV8A 2R91A 4UFKA 4F48A 3GZAA 1XR2A 2MNRA 4HJWA 2F6XA 1QPRA 1E56A 2VFGA 3WF4A 3ARVA 3MHUA 5A3HA 3ITCA 4I5UA 3VOCA 5A6LA 2JKPA 2BY2A 3L0KA 3N4EA 1OVDA 2YXGA 1IIGA 4MG4A 3IVSA 1C9DA 4KPLA 5HMSA 3RLVA 5FEXA 1CW2A 2XN2A 4Q4OA 5BU9A 2Q6ZA 3I7QA 1KGXA 4MOZA 2VNCA 5LIUX 4N9BA 2WJZA 4GLEA 4W9TA 3VKBA 5A69A 4I90A 1KTNA 3KX6A 2PRMA 1HFBA 1F2JA 2W66A 5EFFA 1L6FA 1E5NA 3WCZA 1QWKA 1JCLA 3E0IA 3B0PA 3XINA 4JAWA 2WVUA 1DHKA 1PTGA 1SZNA 1UMLA 1XX1A 1MNZA 4GY7A 2J62A 1FWEC 1A0EA 1K9TA 1DWFM 3B4YA 3DX5A 4H4IA 1U30A 2PB1A 5C9UA 4E2DA 3NSNA 2RDXA 4KWOA 4PFMA 3OYXA 9XIMA 4XB3A 2P53A 3W1PA 1VEMA 4XD5A 2RDWA 3S8HA 1TV8A 5G4HC 4S3FA 4G7FA 3GO2A 5HULA 3W75A 2PDPA 2AL1A 1PKNA 2VFEA 3Q58A 1OX4B 3KS6A 2QCGA 4C5ZA 3THDA 1U2YA 1VYSX 2W5FA 2NXHA 2ZRZA 2E67A 1B0IA 1PKMA 1KRCC 2VP8A 5D9NA 4LS1A 3UFYA 1NQKA 1BQCA 2V3GA 2W62A 2PDBA 3SIMA 4DXKA 1ESWA 2DJLA 2WWCA 1N7KA 1GORA 1V4YA 3KL0A 4YYFA 1VPQA 3AYRA 4Q8MA 2W3ZA 4HOZA 1C3FA 2ZX7A 3G18A 3SI9A 4W7VA 5I6SA 1Q8AA 4GY0A 3UPMA 3VILA 1PX8A 2R24A 3LBOA 1J0KA 4EPKA 1YKWA 5E0CA 5J8LA 4OGZA 4GJ1A 3CTLA 3IGXA 3W1RA 3NZRA 3HA1A 2YFNA 3GG7A 4QQ3A 1XS2A 3WNMA 4PTVA 1ZQ5A 3PM6A 1V6VA 3B8TA 4WDXA 2NX9A 4LT9A 1CXKA 2QF7A 1UB3A 1XIBA 3GDBA 1YNYA 3S1WA 1EA0A 3AUOA 1LLWA 4FNTA 4KCWA 4ML4A 2D3LA 2Y24A 5AHNA 1U5VA 1Z8AA 4IMFA 3WQEA 4W4QA 5HNNA 4CKQA 1XLKA 2W63A 3EBVA 4J40A 4GE8A 1TPH1 3LGDA 2NVDA 2BXVA 4AD1A 4DJDA 2F6KA 4MNJA 3U9IA 4PSRA 2R14A 1RD6A 3DFNA 3O07A 3LCLA 3GVGA 4RPQA 3A12A 4L5ZA 3LMYA 1ZAJA 4KFOA 3GK0A 3QQWA 3WKZA 2HVOA 3GFZA 3NQGA 1Q4WA 3FVMA 4LB3A 2HV5A 1P7TA 5CBBA 1A5BA 1W3IA 3WQ8A 3UWQA 3NXLA 2OWWA 5BCAA 4H00A 3SUTA 1PBGA 3V0UA 1UROA 1XG3A 2NWSA 2V5BA 2XM2A 3LENA 3EWXA 3S1GA 4UZSA 1US2A 4FOKA 1QMLA 4MZ1A 3ZVHB 3CQIA 2E6FA 4PMYA 3CT2A 1X1ZA 2ZXQA 3BCJA 1VJIA 5A8OA 2PTWA 1EP1A 5HWMA 4DWSA 2HJPA 3MBFA 4K7VA 1HL9A 1Q6GA 4FNQA 5H8MA 3WFAA 4WOZA 1LQ0A 2DGAA 3ONBA 4IQLA 1TB3A 1TIWA 2BODX 1KGWA 2OEKA 1HGWA 4TX8A 1DV7A 2BMBA 5EU9A 3LNPA 4RE2A 4BY3A 4KWUA 3UZZA 3VC5A 1BFNA 1P6BA 1LRTA 4FA3A 3V4BA 1MUWA 4C1NB 3SUWA 4J1OA 2QUTA 4UCGA 1HT6A 2HS6A 3F5JA 3W37A 3TTYA 4L1WA 1X38A 2YA1A 1ZBWA 3GR7A 1QNPA 2G95A 3NQ8A 3R89A 3KBJA 4QTGA 1S5VA 4GGHA 4NZ5A 4FXFA 6ALDA 4E2BA 3O15A 3KHDA 3CV1A 3ONCA 3EGJA 5I3HA 3LHYA 4DM2A 3GXFA 3L65A 2XFFA 4ZQPA 2X05A 4LPCA 3THQA 3KXQA 2GGJA 4QITA 3FKRA 3UYCA 2H8XA 4M81A 2VR2A 1QATA 4ERGA 4DWSC 1W3KA 4DAFA 4DRSA 4LBUA 3UJEA 4R7OA 3DDMA 3SJ3A 3UESA 2AQOA 3L5LA 2D3NA 1P0NA 2VEPA 2HMCA 1CLVA 4LYPA 3EX6A 1JXKA 3O6YX 3WH9A 1SZEA 2WMFA 1XRFA 5CGTA 4QEHA 3WN6A 1JPKA 4GCAA 3S5YA 3RO8A 2QCHA 1AQHA 1B90A 3UXKA 4P8UA 1M01A 5J5RA 2HE5A 3VABA 3WBWA 2PD9A 2WQDA 3VKDA 1C7TA 1ZS2A 1H7RA 4IX2A 4GQBA 1PZ0A 2O9OA 4F2BA 3TONA 3OHIA 4GFSA 4MGGA 4PUEA 4HK6A 4TV6A 5A94A 1BGGA 2OR2A 1U1JA 2P76A 3V7PA 2PBOA 4GZEA 4XZLX 1R6WA 4YNGA 4FEZA 2RGLA 3A4WA 4H6QA 3PANA 4P8WA 2J7BA 1AH3A 2QS8A 4DO6A 4AWUA 1DP0A 3YPIA 1ZNNA 3AI0A 1FHDA 3UF9A 4F0KA 1TCDA 3ID7A 5GNYA 1DJHA 4HMEA 4UNLA 4XD6A 4FHAA 1FA2A 4GVFA 4A21A 3W70A 3U0HA 2WMHA 4OECA 3FXGA 1JUEA 4TVDA 1IT8A 3QZEA 2ZADA 1A0CA 1B3YA 6A3HA 3LQLA 3CV2A 3VIOA 1FUYA 2QUMA 3CB8A 3ITGA 1W2PA 5I07A 1FWBC 2WZTA 1M7OA 3DU0A 4LBRA 5HR7A 2QNEA 4GVIA 2VZOA 1TCMA 3H22A 3OVRA 3BQ5A 4IG2B 4AYGA 1BYCA 3OA3A 1CGXA 1Q6FA 3KOFA 4J5NA 3GU2A 2VC5A 3REQA 2V3FA 2X1SA 3BJSA 1V3IA 1LCOA 1Q6DA 4O1AA 4CVWA 2CHNA 4LCQA 2VTFA 1EDTA 1ICPA 1E9YB 1YPFA 3MWCA 3T08A 4HZ6A 4ROPA 1KFLA 3S2JA 1POKA 1V6XA 3ZYZA 3AZRA 4HU3A 3GR4A 1FCUA 4C6OA 4KWSA 3BSGA 2OJPA 3E12A 1FH8A 2OKTA 4INFA 2XN1A 2GVYA 4UOQA 2ODOA 1T8XA 2WM0A 3SY5A 4FOUA 4F2TA 2POZA 3WQ4A 1XQKA 3C8FA 3S5ZA 2YB4A 3MANA 4UQDA 2ISDA 5K9XA 1WKEA 3AICA 5H91A 3AMLA 2FFIA 1UR8A 4MTVA 4QSFA 1I75A 1N55A 4BCEA 4BI6A 5BOEA 4NRRA 3B9DA 4H7ZA 4CU7A 3CQ0A 1BSLA 1PZ1A 4KETA 2ZXBA 3T0CA 3G3MA 4EP8C 3KRZA 3TMLA 2FPYA 3VX0A 3RPMA 3PBVA 2A3EA 1CECA 2PBGA 1DWIM 4D6IA 5DLCA 4AZGA 1RLCL 3AWOA 2WOQA 2ACQA 1XDJA 2VEKA 2BDQA 3R2GA 2WNNA 1AMYA 1MUMA 1FCQA 3BAIA 4F40A 3P62A 3AU6A 5BZAA 3W24A 4LYQA 1RK6A 3UERA 3C3NA 4NT0A 3SQSA 3GD6A 2YL9A 3KRBA 1LRNA 4URIA 5A2BA 3CUIA 1OX6A 3ATYA 4S3BA 1JULA 2DZAA 2DZSA 5AB3A 1JZ2A 4XIAA 2G8ZA 3FW6A 1HJSA 3L21A 2BS9A 3QOKA 2E68A 2UV8G 1NOUA 2PAJA 4DYKA 3UWVA 1PL9A 3BMXA 2GSEA 1W91A 2FHFA 4Y7EA 4QEEA 3HO8A 4QJ4B 3B06A 2ZZ1A 3Q94A 4IGNA 5KZ6A 2G97A 3W7RA 4XSLA 1GW9A 4BQ5A 1ECQA 3NQFA 3EX1A 7ODCA 1U22A 4GX9A 2FPVA 3GDLA 3BGJA 4M19A 4U3CA 5C54A 3TQVA 1OFRA 2ZE0A 4NI8A 4XQ6A 2BY1A 3GH4A 4CD5A 1YTKA 1YYAA 5A6BA 5AN7A 4A8RA 2AOSA 2XGIA 1J18A 3HPAA 3PBWA 3MVTA 4TVUA 4JY9A 1H51A 2V9DA 5I7GA 1P0BA 1X39A 3MDWA 1RJRA 1J0IA 2FHCA 4JHMA 1ECEA 1CZ1A 3RR4A 2BSLA 1WO2A 2PODA 3PZQA 1UBSA 4GY1A 2VI0A 2HROA 4GXMA 2YSWA 4AZHA 3NVTA 1LG2A 5LNWA 5BYWA 3H6OA 1LT7A 5DT7A 5DFAA 2I5QA 4XTDA 1FWDC 4FB7A 4H9XA 4S3AA 2CLFA 3L4XA 4HNNA 3ECQA 1QXLA 2C91A 3QPYA 4GHRA 4BHYA 2BOFX 2YB1A 2DUAA 3COTA 3VDCA 2R1PA 3AIQA 4NJHA 2DV0A 1KBJA 4CEUC 5CJ5A 4PRRA 2J7GA 1BTMA 1SYTA 4Q22A 4U10A 4N9EA 2UZ9A 7CGTA 2A79A 4E0CA 3TJLA 2XIQA 2PRHA 4M80A 4Y8EA 1NWTA 5ENLA 4C91A 4GI6A 1BSIA 4LXFA 2VGBA 1CXHA 2YA2A 4JTGA 4RW3A 4HA1A 4DJEA 2PZNA 3UW6A 2WBGA 1F73A 4HHPA 3G6MA 2FDSA 3TKFA 3GFYA 3NFUA 5REQB 4TMBA 5CG7A 1T6MA 1O5XA 1EBHA 5FSEC 1QJWA 4FALA 3MWAA 6XIAA 1R2TA 5C7HA 2D20A 4D6HA 3VUSA 2PCQA 4G56A 2GQAA 4HT3A 4FXJA 1JGIA 4Q8PA 1W1TA 3ITLA 4A6GA 3LHVA 1JFXA 1YDVA 3ABSA 5HJXA 1H61A 1Y7VA 1DTUA 4BS0A 4D6JA 1NWRA 4F8XA 1A5OC 3TQKA 2JF7A 4Z1CA 3DENA 1Q66A 2J6VA 1RSCA 2WKJA 1CGUA 4LVFA 3O05A 3W7IA 2GGGA 3U6WA 1H0GA 2TRSA 4NNAA 2WCGA 3ITTA 3GR8A 3OZMA 3MP3A 1UC5A 8CGTA 1UD2A 3WIJA 1I2OA 3UWUA 4I5XA 2O4QA 3BMVA 1Q3NA 3A3WA 3VKKA 2QLYA 4GH1A 1EJWC 4B4FA 1XC4A 1UQZA 3SADA 3T6CA 2CWNA 4ZFMA 2YLLA 3F4CA 4EACA 3QHNA 4B92A 1R3QA 1C8VA 4G2DA 2AAMA 3QLLA 4FP1A 3V36A 5G2WA 1R87A 4M6VA 2QPSA 3ZVIA 3LD5A 4B2DA 3EWCA 3WFLA 3LZ5A 1KCLA 4K8HA 3UZYA 4D6EA 1MYRA 4JY8A 1J2WA 3BZJA 3GZ3A 1Z6KA 3NQBA 3M5VA 6PTDA 4TX9A 4UB9A 1F4HA 1DIEA 3IAQA 4Q7BA 3UR8A 1K03A 3R8HA 3QFEA 3DHUA 3TFXA 4EANA 3PNZA 2BGNE 1J5TA 1RHCA 3E6EA 4HKPA 4CUCA 2VYOA 3H54A 3WEOA 3BLOA 3AIUA 4JDYA 2I17A 3TYCA 3N2BA 3DFPA 4ZE5A 2Z2BA 1NTHA 4DY1A 3DN5A 4UR8A 4GZ7A 1E0XA 1ZAHA 7TIMA 1LYXA 2GVJA 1HO4A 3FSTA 3IJQA 5I24A 5TF0A 1X6NA 3A4JA 1XQLA 2Y62A 2O92A 2D0GA 4MB3A 3F7JA 2XJ7A 3OLIA 4QLJA 1XH0A 4CNTA 1V8EA 2PZ0A 4RNHA 3SGGA 4HNTA 1XGDA 1ZRQA 2A0NA 3F4NA 4F2UA 3IRDA 1RVKA 3B9OA 3IAPA 1V6UA 3WJSA 3OOQA 4LUTB 4JXCA 4P7QA 2VZUA 3PAOA 1AG1O 1U33A 1M7PA 2EAWA 4AF0B 1J2BA 2INZA 5FJIA 4Z0JA 3SCWA 4YVVA 3LCIA 3TA9A 3CB3A 4M24A 3C0QA 4LS0A 4QAWA 2JGQA 1OJXA 4X0VA 3NAVA 4PUMA 1K9DA 4ZO7A 4PA8A 1LQAA 4XX6A 3U5YA 2XIBA 4UBPC 3TOYA 4N2YA 3WJYA 4YTTA 3PN8A 5HBFA 5HNRA 3LRKA 4QS5A 3MKKA 2Z1SA 1KM4A 4I9JA 4JTRA 3JW7A 2VCCA 2WJDA 3DBPA 1ISVA 3BLPX 3WF3A 3LHTA 2PDMA 3KUMA 3AMCA 1QHOA 1YLVA 3RRAA 1WUFA 2IPGA 1KFCA 4MKVA 1VFTA 2ACRA 3IJ6A 1FDZA 4JQ4A 3R1ZA 1IGWA 4E6MA 3VKAA 4PRWA 2PGFA 2C7FA 3UR2A 2Y8VA 3ARXA 2JE8A 4JCMA 2CBVA 1MZRA 3HU7A 3SUUA 1AA1B 2F61A 4ZBCA 1EZWA 3SSZA 2YDAA 3HMCA 1E4NA 3BLIA 1E4MM 4JZ5A 4Q8UA 5FJTA 5DCEA 1ONEA 2GYIA 3JU2A 3B40A 1TREA 3H24A 3E5BA 1DBTA 1QASA 1FXQA 4US6A 2QUUA 2PGEA 4O50A 1ZB5A 4FSAA 2HPIA 3SCNA 4LUSA 1HJQA 3TROA 1Q6OA 4OJYA 3CU2A 2GJRA 2NQ9A 1YEYA 3EKZA 3FGCB 2J7FA 1HJXA 4X22A 5TAOA 4MJ2A 2VZVA 2ABBA 2Y1HA 3V3WA 2VT0A 1VLIA 5FI8A 4WSHA 7REQA 1JL8A 1BAGA 2NUXA 3ZFHA 2G4JA 2IPWA 3B9NA 1PPIA 3WBXA 1EFZA 3TN6A 4LU0A 4L80A 2C0HA 3QC0A 5H1WA 4F0LA 2G3JA 5LYRA 1CLKA 4P7OA 3H2MA 2DORA 4H19A 5GVJA 2Z1VA 4Z2JA 3W7GA 2EG7A 5DY3A 5HANA 2GUUA 1KTBA 3TNOA 1J01A 3WQWA 1WXZA 3WNNA 2O7SA 4GPNA 4DXVA 1FWNA 4R34A 3S47A 1X7IA 1E51A 4Z1AA 3C2YA 3BSMA 1PKYA 1GQKA 1J0JA 4LVBA 3R8GA 4ZR8A 2DSVA 3G8RA 4OFCA 1RQBA 3PZ9A 1OCJA 1OC5A 2CLEA 2ZZ7A 2EG8A 1XF0A 5D33A 1ME8A 4UFJA 2AGTA 4CNSA 1EXBA 1VEOA 2YGYA 2CYGA 4DZHA 2DH2A 4BI7A 1UZ1A 3M9YA 2DT0A 3HBLA 4N9CA 4H04A 4GRSA 1TRIA 4EWJA 4O57A 5C2CA 1XCFA 1W9VA 1GVSA 2H3DA 4D9PA 3EB2A 1RQEA 3CUJA 5E70A 1SFLA 3T42A 1O94A 3ARZA 3I65A 1E6PA 1EWEA 4KERA 1Q4NX 4WGHA 1AH0A 2EEXA 2G4FA 4N7QA 1AQ0A 2Q8LA 1OF6A 1VPYA 3C5QA 1AL7A 1XDLA 4JS3A 4HTYA 4IUOA 4I3GA 3W38A 3M5YA 3FAWA 4KEZA 3N25A 4DJDD 4HP5A 1VF8A 3DG6A 4TR9A 5ABFB 1EKOA 4MKSA 2AMXA 4C6CA 2OO6A 3SR7A 3C8NA 3GM8A 4Q8VA 3AXHA 1ME9A 3L4WA 3TLQA 6REQB 3LHZA 1PWMA 3OIHA 1G4TA 1RBLA 1H63A 2YCLA 3CZGA 3ERPA 1VEPA 4MM1A 1RY0A 2OB3A 3ARSA 1P43A 1B1YA 4EWND 3VIKA 4IQEA 1Q6RA 3PWAA 1XLAA 5CLWA 2PWUA 4X61A 3SCVA 1HX0A 1RCQA 1ZLPA 3N2TA 1XW8A 3VU2A 2CLLA 4UR7A 1F6PA 2FYMA 1TPC1 1WAUA 4PMXA 1XSIA 3EDEA 4W5ZA 4A8LA 1W0MA 3T0TA 1LDCA 4JIRA 5CSYA 1TA3B 2AQWA 2A1YA 2Y5SA 4DBDA 3WDIA 2D1ZA 3HTWA 4Q32A 5FJRA 2Z2AA 3HB9A 4C90A 4CU6A 3BL3A 3G1HA 4IGMA 1DKWA 4XZIA 5AYIA 2G3MA 1NELA 3BG3A 4H9YA 3UD6A 3GH5A 3GIPA 2PU0A 1J6OA 3QPEA 3AQUA 3VVGA 5HUOA 4CVUA 5PTDA 4L65A 3MKCA 4Y6GA 4HOXA 3T44A 2GJLA 3SCQA 1ODUA 4LY4A 2JKAA 1R8LA 2XU2A 2XWEA 2FPTA 1WZAA 2FTYA 3TC3A 4KMQA 2PDGA 3LERA 1N8WA 2BVTA 3CS2A 1TVLA 1P0EA 1KQYA 4C6MA 3CQJA 5CSRA 5DX7A 1E72M 5D2XA 3DOPA 4GA8A 3SM0A 1I1WA 1X97A 2E09A 1A4MA 4MWAA 2BVYA 4I5RA 1WP6A 3NR0A 3GAYA 1A5NC 1XUZA 3KCJA 3WH5A 3THUA 5M2FX 4YU1A 4L4OA 1M9HA 4ICMA 3EDDA 3S2CA 1CX9A 4O52A 3RITA 4O17A 4UIOA 2I9EA 3HFYA 4A8NA 1R0MA 3C2VA 4CQDA 3VDHA 3VIFA 2B31A 4UMBA 2X7WA 2BXYA 5CG0A 5MKGA 2O56A 2TPSA 1GZGA 1JDFA 1ZBCA 1FCVA 4PMDA 1NVMA 1W17A 3K1DA 3MZNA 4ZQMA 4TUFA 1ZCCA 1EJ7L 1K70A 2VGFA 1JRCA 4NKCA 2D2HA 4G9PA 1D3HA 1QHZA 2VEFA 3PJXA 2DSZA 4HCLA 5FJJA 4JQ1A 1LWHA 5IFTA 3P0XA 2ACSA 3M0KA 3KP0A 2WC3A 3CO8A 3R58A 2YLAA 2CLKA 4HNCA 3W71A 7A3HA 5E6YA 1JF6A 1ZAIA 3CV7A 1TIMA 4P7RA 8A3HA 1F6YA 5EYWA 3UT0A 4I6KA 2Z24A 1YNPA 2ZRYA 2E4TA 2VD8A 3KL5A 3FLUA 2OYLA 3F2DA 5D4YA 4L4MA 1ONRA 2FZBA 2VXNA 1EEPA 3N2MA 4JFTA 2HK1A 1A4LA 2E5DA 3EKGA 2ONEA 3B8DA 2FZ9A 4HA4A 5ABTA 1GQNA 3N1AA 5FJOA 3VMPA 4U4MA 3IJ9A 2PD5A 1GVEA 5KINA 3W86A 1QK2A 4Y96A 2CW6A 3L2LA 2X09A 1BXNA 4IL2A 3Q37A 4REQA 4M5PA 1XLLA 3LMZA 1QNSA 1B4EA 4KCUA 3RJYA 4EXBA 4E2OA 3L0GA 1VFHA 2R6OA 4X63A 2ZZ6A 4M1RA 3THAA 4DPQA 3TQPA 3EMCA 4JTAA 3QHMA 2QDDA 3HQOA 5KITA 2P3EA 4G1NA 1LUCA 3TZFA 2VFHA 2VDGA 4IQJA 4QE1A 3NL5A 4AD0A 1I2NA 4NX5A 5EB8A 1E1EA 4WDUA 3QPZA 1JG9A 3PULA 4H9MA 2HTMA 3MCNA 2B7PA 3PK7A 1W9XA 1JQVA 3OQ8A 2YYUA 3RU8X 1DIOA 2XGBA 3DH7A 1F61A 2QQ6A 2F38A 2J9YA 3BARA 5IHSA 2W92A 3N34A 3EAUA 3CTTA 1ITUA 3IUIA 1L2QA 3NQMA 1TPEA 3AHXA 1DQUA 5CAHA 4ZSUA 3WDQA 4ZOEA 2WAGA 3TAKA 3KZSA 3GNDA 1TWWA 1CI1A 4EE9A 4YHEA 3WK3A 1SJDA 1UP2A 1YXYA 1GKRA 3DZ1A 4UMCA 1KNWA 2H90A 2WB5A 2NT1A 1GYLA 1K77A 1V5XA 1VLWA 3WK1A 3PSWA 4NYUA 4DXXA 1AW2A 3W2MA 2WSRA 3W7DA 3MUZ1 4XUYA 3NQAA 3WLTA 5DT5A 4J3VA 1WNOA 2POTA 1KBIA 1W6TA 1Z9AA 5F2LA 2V5DA 3G1AA 4ACZA 2GLKA 3M7SA 5FIPA 3TR9A 2D0FA 2ZZ3A 2NQZA 4QG6A 3E9AA 2WLZA 3N04A 4ZENA 2Y8UA 3PTDA 4BI5A 2VVSA 3CZKA 3WLSA 2O9PA 4J2MA 3NGFA 5EY5A 2FDMA 5AC6A 1MO0A 5LHFA 1TTIA 4DQWA 4XK2A 4N42A 3LI1A 3OYZA 3U48A 1Y5VA 2OT0A 3KZPA 4NSBA 4HN8A 2CLOA 3QEZA 1I60A 3EOOA 3H23A 4JYFA 4DX3A 4E38A 3LTPA 2I14A 2ZFAA 1JFHA