4NJIA

Crystal structure of quee from burkholderia multivorans in complex with adomet, 6-carboxy-5,6,7,8-tetrahydropterin, and mg2+
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
209
structure length
209
Chain Sequence
TYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQAVCRFCDTDFVGTDGENGGKFKDADALVATIAGLWPAGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFGIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPSRDLNTKLAIDWCKRHPQWRLSMQTHKYLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7-carboxy-7-deazaguanine synthase
publication title Radical SAM enzyme QueE defines a new minimal core fold and metal-dependent mechanism.
pubmed doi rcsb
source organism Burkholderia multivorans
molecule tags Lyase
total genus 67
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 4.3.99.3: 7-carboxy-7-deazaguanine synthase.
pdb deposition date 2013-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4njiA00
3NQCA 4HPXA 1UBSA 2I1OA 1LYXA 2WSYA 1SQ7A 2QUVA 3NEVA 3KVJA 3IVUA 4IXHA 1FCVA 2CLEA 2CLLA 3TIMA 4HNVA 1TQXA 3GR7A 5LNUA 2JKEA 4JTKA 3W7OA 5G1YA 5AC8A 1FX6A 1GJPA 3PC0A 3M5ZA 2V82A 2QCGA 4NJJA 1O4UA 3M43A 4TR9A 2OJPA 5EL1A 1W5MA 3B05A 2RH9A 3G1SA 1XBYA 2QCNA 5MHBA 4M5PA 2E09A 3G1HA 1F74A 2DZWA 1KV5A 4JTHA 1U83A 3RU6A 1SPQA 3TFXA 1KW1A 3UXAA 4UR7A 2BWGA 1H7XA 1H61A 1EP3A 2EPHA 3DBPA 3C52A 3DGRA 3GB6A 3GKFA 4G1KA 2QAFA 3FIGA 3B03A 2GOUA 4GUHA 2J6XA 4NNAA 2CLOA 4O11A 4O14A 1A5CA 1QPQA 5AHEA 1BWLA 3TXZA 1LORA 2YPIA 4KWWA 5DLCA 2G95A 5CZ0A 1GPWA 3KOFA 1K8ZA 3KFTA 3C0JA 1S5TA 5TQLA 1ICSA 2XN2A 4NJKA 1H1ZA 3INPA 1YTDA 2V81A 4IX2A 4IGHA 1OK4A 2ZZ6A 5A5WA 3NA8A 4OT7A 4R53A 1I2RA 1D3GA 1KM6A 1JUKA 2CLHA 1QFEA 3NZRA 1HUVA 4XTIA 1O5KA 4EVZA 4GFSA 2WJZA 1Q6RA 2ZA1A 3L9CA 1GVOA 4HHPA 3F03K 4ONVA 2JK2A 4H3DA 2VFIA 1QR7A 3EWBX 1PVNA 1SZGA 2ABBA 3W1QA 2GVLA 5K2ZA 3W83A 4LNYA 1MXSA 5EBUA 1B4KA 1DQXA 4K8HA 2Z6IA 5SWUA 1VHCA 3TQKA 1JUBA 1OYAA 4L4MA 1W5PA 1VGAA 5LHEA 3OVRA 1W5NA 5C5YA 2Y70A 2ZZ3A 1GYNA 2R14A 4UTUA 1NF7A 1EEPA 4FNPA 5U7SA 3HJZA 4JTGA 1HO1A 2CWNA 5HQEA 3NG3A 4RKAA 4RXGA 4K6AA 4HT3A 2AQWA 1LRQA 1EA0A 3E02A 2RDUA 4O1AA 1Z41A 1ZCOA 4JTUA 1OFPA 1H7OA 3QC3A 3OIXA 1OF8A 1KM1A 7TIMA 1K02A 1A5BA 3LI1A 3TE9A 3B4UA 1THFD 1S5VA 4RK8A 3LRLA 1JCMP 4CCEA 2YR1A 1TTJA 4AF0A 2ABAA 4FX6M 4UTIA 3BO9A 2YYUA 3W1NA 3S0CA 4UTKA 1C9DA 2W0UA 3CIXA 2XN1A 4GC4A 3LCLA 1GEQA 1ZY9A 3BW4A 1Z48A 3VE9A 2J27A 3DH7A 2QAPA 2Q3RA 4K36A 3UWQA 2I14A 3LERA 2ZRVA 1FDJA 2E6DA 2D73A 3PUEA 4JX5A 1F5ZA 1LROA 4WZHA 2A2IA 3LV6A 3RLUA 4RJEA 1BTMA 4JEQA 4AEOA 1CX9A 4TU1A 3CT7A 4LVGA 1ME7A 3PG9A 5I3IA 5AOUA 5FI8A 3P74A 3P5ZA 3NR0A 3I6RA 1QDSA 1JJKA 4Y96A 4AWTA 1LBFA 4A3UA 3FOKA 3HIJA 5I3KA 5D30A 2GPTA 3LLDA 5LNSA 4Z1CA 1OFAA 5F2GA 4FO4A 1A5SA 5F4SA 1XBXA 4IMFA 3FYPA 1AMKA 1KV8A 1YTEA 1KM0A 2QUTA 3CTLA 4OU1A 3PR2A 2Q3OA 1TYGA 3GXNA 3BGJA 3PULA 5FEZA 4HN4A 4W9TA 2XN0A 4JTLA 8TIMA 4BR1A 3IV3A 4UTMA 4GUGA 3W88A 3TUUA 1LTDA 4HKPA 1LOSA 4K38A 4IPIA 5CPMA 4GXMA 3L5AA 5G1TA 5KSWA 3SFKA 1G4PA 4UR8A 3N2MA 1JQXA 4RX0A 1UUMA 3PAJA 4P61A 5HINA 3N3MA 4ZL1A 1W3NA 3D0CA 1RPXA 4ZQRA 2NX9A 2R94A 2WV8A 5AYZA 2OMAA 2QCHA 2UV8G 1UCWA 1YPIA 2CLMA 2VXNA 1LLWA 2EHHA 4LVDA 3S1XA 5LGXA 4BI7A 3WJYA 2Z6JA 3NQ7A 1JCJA 2WQPA 2JKAA 3QW4B 3M0ZA 3OBKA 2A7PA 3PBWA 1TMHA 4TIMA 1RVGA 2PCQA 3NQMA 4FXRA 1H7PA 2NUYA 4WXZA 5CSSA 1KM5A 1Q6OA 4CQ8A 3MI2A 4UTTA 1G4EA 2NV2A 3SGZA 4QNWA 3TC7A 1Q6LA 3MHUA 5FESA 4JICA 2V2HA 4PL1A 3H53A 5ABTA 3GDKA 1A5AA 1LRTA 5AN7A 4PTNA 3NDOA 4K7VA 3SGUA 3O06A 4CLMA 1LP6A 3NQ8A 4CQ9A 3TR2A 2OCZA 1PHWA 1K7FA 3HF3A 2Y62A 1CW2A 1KLZA 4MYAA 3QEZA 3R5EA 4S2CA 5DY3A 2CZEA 4MVAA 3DKJA 1XI3A 3Q94A 1TTIA 1VZWA 3TA6A 1OFRA 3W7DA 3NQGA 3HG2A 4DO4A 4Q4KA 4UFIA 1H62A 2GQ9A 3E12A 2ZQ0A 1H5YA 5E0KA 4JR5A 4JX6A 4NJHA 3DXIA 4O4WA 1F2JA 4EWND 1WYIA 1Z44A 3DFPA 1I2NA 1UB3A 2A7RA 5A8GA 3TSBA 3HGJA 1VCGA 2ZA3A 4FNSA 3NOEA 1GWJA 2YW3A 5F2IA 3MP3A 5HR6A 3QMRA 3RK8A 3W7PA 2E1DA 2Y6ZA 3W7LA 1JRCA 4XKYB 3C2EA 3OA3A 3L5MA 2ZYFA 1FWTA 1ZENA 3ZR4A 3G1FA 4FXSA 3TC6A 3BPWA 4P2VA 4A29A 4X22A 2PURA 3TJLA 5AHMA 2XFWA 1OG0A 1UJPA 2J9XA 2ZRUA 3QW3A 1TJPA 5KINA 1WOAA 3NL3A 3TAOA 1WA3A 4UC5A 3USBA 3ELFA 3EEGA 3O05A 3G1AA 4FX7A 5HULA 2NWRA 1EX5A 1B4EA 2Z0IA 3BLIA 1PS9A 3OG3A 3JRKA 4GUIA 2QJGA 3KVMA 3UY8A 4TO8A 4BWLA 5BNKA 3QH2A 1XCFA 2G97A 3PBUA 3W9ZA 1VC4A 2PC4A 3N9RA 1O60A 3A5VA 3SIZA 4UTWC 4UFLA 5DXYA 3R89A 5H91A 5CPOA 4NT0A 3LTSA 4LT9A 1SSDA 3IVSA 4NU7A 2QUUA 3WK1A 4UCGA 2W6RA 1QNVA 1W37A 2FFCA 4MJMA 3N19B 5D2WA 4K37A 1VYPX 4O12A 3EB2A 2RFGA 2ZRWA 3B0VC 4WOZA 1H51A 3MBFA 3LM7A 3LCGA 4Z0SA 3N34A 4BFAA 4O17A 1MEWA 1IXNA 3ZFHA 4LVFA 4ALDA 1P0KA 1QO2A 2NXIA 1WX0A 4MY8A 1XUZA 2F7FA 4BF9A 2OT1A 3LCWA 3G1VA 4GJ1A 1JCLA 1OVDA 3TMLA 1K3UA 4JTEA 3FS2A 3FLUA 3FKRA 3CEUA 1A53A 5KZEA 2CU0A 3GIYA 4WQ6A 2E6AA 2E5CA 3ATYA 1OABA 3L65A 1KFEA 2HMCA 2BLEA 5CPLA 5K9DA 4DBDA 4DPQA 3HPSA 4O0KA 3P81A 1TPB1 4JTIA 4S2BA 5KMYA 1L6SA 1GQNA 3RFAA 4LV4A 4O54A 4E2DA 1NF0A 3C8FA 3UY7A 3M44A 4JN6A 3N73A 4E0CA 3CEPA 3NO5A 3W7EA 2C6QA 4IMDA 1ZJIA 3MO7A 3H54A 4I7VA 1NVMA 4XQ6A 4YL2A 3GXPA 3QSRA 2VELA 2P0OA 1P5BA 3NQFA 1IXPA 1VH7A 1KFCA 5EA9A 5FEPA 3SR7A 1DL3A 2Y61A 4RCXA 2DZUA 5KZMA 3V75A 3THQA 3W7KA 1I2OA 4LRSA 3S1UA 1EP2A 5F1VA 1FXQA 1PCWA 1WQ5A 3E49A 1S5WA 4JTJA 1W31A 1OX4B 5U4NA 3MW7A 4UFJA 1SZFA 2YYTA 5FF4A 1RQEA 3TU9A 4JTSA 1FXPA 5CGQA 4K7YA 3GDRA 4AB4A 3W1LA 3GDLA 3TDFA 3W2LA 2Y88A 1EUAA 3NPXA 1I2QA 1DJQA 3DI0A 1OK6A 1EPXA 4AWUA 1S3HA 4BI5A 4NX0A 3SECA 3U6WA 1QOPA 2NV1A 5EY5A 2EKCA 2PRLA 3LCXA 2AGKA 4FX8A 3PUOA 3GXTA 4UTLA 2AAMA 2V2CA 3NL2A 2QF7A 4O10A 4PH6A 4KFPA 3C56A 3RNDA 3TSDA 2HS6A 4WY0F 5AC6A 1ZAJA 1OFDA 5EMUA 3QZEA 3W72A 1I2PA 5J5RA 2VFHA 3C2VA 4MZYA 3HPXA 4XZ9A 1FDZA 4AVFA 5D04C 3L0KA 1M7OA 1TPH1 4O15A 3SW6A 5TIMA 2ZZ2A 1VLIA 1FCQA 3GX9A 4PL2A 1R46A 3F1QA 3L68A 5HWMA 2C19A 5G2IA 5KZDA 4GRSA 5HJLA 1QPOA 3CU2A 5CZJA 5G4EA 3Q37A 1SO4A 4PEKA 2A4AA 2F84A 2Q8LA 4ZQNA 3EWXA 3M41A 4O0ZA 3O1NA 1R2SA 3UZJA 4RZ4A 1IXOA 4Y6GA 5K4ZA 4O16A 3CQ0A 4JYEA 3C3NA 1F05A 1FWNA 3LRMA 2RDWA 3HPZA 2OT0A 3G22A 1KTNA 3UZ5A 2VC6A 3O8AA 1H7WA 1RD5A 4AF0B 4Q32A 1FCBA 1G4TA 2ATSA 3EXTA 1HTIA 3A22A 2ZRYA 2VEKA 3W1XA 1SUXA 1ADOA 3ZS4A 3UD6A 4OWGA 4UFKA 3KXQA 2EGZA 4AHOA 3UWVA 2QDGA 2NX1A 1X1ZA 5I3GA 3FYOA 2FPYA 2BXVA 4Z0JA 1AL8A 3RF9A 2IQTA 2QCDA 4WY0A 1OFQA 4UUIA 4ZMGA 1ME8A 2EAWA 4YLWA 3LHWA 4X3ZA 1QPNA 2ISVA 1LDCA 1Q3NA 1W3TA 3LTYA 1GYLA 4O1BA 1SO3A 3W7JA 3MYOA 1WXJA 3G1DA 3QFEA 3DFSA 4NX5A 1TPUA 1TPEA 2ZTJA 2WO5A 3T40A 2GJLA 3W07A 1IIHA 3DKLA 3PB0A 2KZHA 1VQTA 3BW2A 3L0NA 1KM3A 3W3OA 3S5YA 2V0TA 2P10A 2BTMA 4NNBA 2QKFA 1H63A 1KBIA 4JS3A 2NLIA 3S5NA 4N4PA 3W2UA 1U5JA 3M16A 1PL9A 1MO0A 2V30A 2OZ0A 4HPJA 4UNKA 4ZQCA 3Q58A 3B8DA 3STEA 2JGYA 4QNEA 2Y7EA 1GOXA 1OYCA 3UYCA 1DVJA 3BG5A 3NAVA 2E6YA 2ZRZA 5D05A 4NZJA 2V9DA 3PSWA 5J5DA 4N9BA 3TROA 1W3IA 4IJBA 3GAKA 3OVPA 4FNTA 3T4CA 1ONRA 5K3VA 4O13A 3CWOX 1T99A 3LI0A 3MUXA 1Q6QA 2VFDA 4MLJA 3TSMA 4BI6A 3MWAA 4ICNA 3BG3A 1GG0A 1XKYA 3NQ2A 1PE1A 1W5OA 1JCXA 3ANYA 3IVTA 4FHAA 3SSJA 1SO6A 2E5DA 1FBAA 2NWSA 1K8YA 2NXGA 3STFA 4JX4A 3L0GA 1XXXA 1FWRA 2A6NA 4NQ1A 4MFDA 3NQAA 4MOZA 3W1UA 3LV5A 2YZRA 3W2NA 3GZ3A 3IGSA 3O6YX 2C13A 5D2XA 3K30A 3NXFA 1L2UA 3UWZA 3B04A 2NZLA 3NM1A 3BLFA 1XDMA 3B0PA 4PODA 1W56A 3MP4A 4IX0A 4QITA 1SZNA 2I9EA 1N7KA 5KITA 3HMJG 4ORIA 3SY5A 2JBMA 3L66A 4MZ8A 1G7VA 1MEHA 2VEPA 1JVNA 1D3HA 2YDAA 4N9CA 4HNUA 4OGZA 3NPWA 4L4LA 3O6CA 4C1LA 2GVJA 1JULA 2ZBTA 3W86A 2RHGA 3VCRA 3FJ6A 3QYQA 2H8ZA 2VKZG 1TPFA 3M7WA 1K03A 2DZSA 1ZALA 2W79A 1X1OA 3BV4A 4Y90A 3W7GA 2X30A 1EIXA 2Y63A 3MHGA 3GVGA 4JXCA 5D37A 3UXDA 1G4SA 5FEWA 5AHNA 2GQAA 5CKSA 1LBLA 1LLZA 3P8JA 4N6FA 3H55A 3M5YA 2GVGA 1FDYA 1JRBA 4O57A 3LCIA 3G8EA 3KVLA 1AW5A 1XBZA 3G0UA 1O5XA 1QO5A 2HSAA 2TPSA 2LLEA 1ZNNA 4Z1BA 5DY2A 5AHIA 4O28A 2J24A 1AG1O 2C14A 5F4WA 4JY8A 1DHPA 4JIQA 1FQ0A 2QJHA 3BVJA 4QIUA 2QCCA 3TK7A 1RZMA 1JCYA 3QJAA 2VEIA 1KM2A 2ZZ4A 2B7NA 3GNDA 2WNZA 4ADSA 2FDSA 4AHQA 4LS2A 3GAYA 5T26A 1SO5A 2DZTA 1YPFA 3W7HA 5FF3A 5DCBA 1NEYA 3N14A 2TYSA 3PVFA 5D03A 3WK2A 1T96A 5F4XA 4XBKA 4O19A 2FTPA 1H7NA 5AYYA 3DZ1A 4RLIA 3HGSA 3KVKA 3HG5A 5D2VA 3W22A 4UFHA 3TCEA 4LRTA 3NL6A 3NQEA 1YYAA 3VNDA 2DZXA 1DJNA 2VFEA 1N8FA 2QJIA 1TPDA 2X1RA 3LHZA 1VJIA 1WAUA 3HGRA 4ADTA 3VFLA 1GZGA 5BMWA 2ATMA 4N02A 3STGA 1P1XA 1AW2A 1D9EA 3WJXA 1WOBA 2JKPA 4O1CA 4E2BA 3IIPA 1QCWA 3UWUA 2A0NA 2Q8ZA 2YGYA 3W23A 4FIRA 3C2OA 3S6DA 4GWEA 1QPRA 1VR6A 1ZFJA 4MLRA 2ZA2A 4O53A 1ZAIA 1O95A 3HB9A 2DJXA 2PE4A 3GDMA 4FEZA 1V5XA 2B0MA 4U4MA 2ZRXA 4UXDA 3IGUA 5AC7A 2C0AA 3QQ1A 5D38A 3DFQA 4KKXA 1IF2A 3FA5A 3GLCA 2QCMA 3S8HA 4IMEA 2O7SA 3WJZA 4JNMA 1GVQA 5FF2A 3NM3A 2ISWA 3S1WA 1E51A 1BEUA 4JDYA 5HWJA 3HG4A 3I7RA 1JQVA 4DQWA 3NYZA 2GJNA 3Q2DA 3O63A 4YXGA 3E0IA 3EX6A 4YCPA 1R2TA 2PRHA 4ZQOA 3S5ZA 1TPVA 4LTSA 3PF3A 4FF7A 2ZCGA 1JR1A 2A21A 5LHFA 4IPJA 4M6VA 4ADUA 2FPTA 2X1SA 3B06A 1VLWA 4MJZA 4LV9A 1TV5A 1LM1A 1TQJA 3A5FA 4LVBA 4S1FA 3OHIA 1FY6A 1L9WA 2ZZ5A 2V2DA 3MJYA 3TV8A 4JY9A 4DXVA 5HR7A 4DEFA 4RZ5A 2DZPA 3ZWTA 4JDBA 4EOUA 4FNQA 2FLIA 4UTHA 1M7PA 5CZSA 4JD4A 4M6QA 3LLFA 1VPXA 4YWIA 3VE7A 1TO3A 4DF2A 3NPVA 1J5TA 5FF7A 4LW7A 1GT8A 2A6LA 3DFTA 3TW6A 2R91A 2P1FA 2WPBA 3S5OA 1YDOA 1TRDA 1QWGA 2WSQA 1XC4A 4OHQA 1OF6A 3C2FA 4GUJA 1NAL1 1H7RA 3IEBA 3NPUA 4B5NA 2O7QA 2X1UA 4ZQMA 4Z1DA 4DO6A 5IBXC 4QSHA 3NQDA 4O18A 1F73A 4JGDA 2B7PA 4QM1A 4X2RA 4HNTA 1NSJA 3MP5A 3W2KA 1KLYA 3P8IA 2V5BA 4CCCA 4LU0A 1SFJA 1AW1A 3P67A 4NVTA 3A9IA 1DQWA 2HTMA 4YMZA 2YFOA 2Y7FA 3UNDA 4UTJA 4IOTA 3W7MA 1O94A 3FEMA 4OV9A 5AHLA 4AWSA 3PS7A 4A21A 1GTEA 3N9SA 4MY1A 1AK5A 3OEXA 3W85A 3EXSA 2DJLA 2H90A 3DHDA 5CG7A 3FJLA 1LRNA 1X7FA 4WXYA 3MI6A 1C29A 4ZZ9A 3QF0A 4N2YA 2X1TA 3QMTA 3U2OA 1G69A 4QAIA 4H4IA 5HWNA 3PWAA 3WK3A 1OJXA 3LHUA 4M7SA 3QQ0A 1GTHA 1H60A 3CLMA 5DCDA 5G2HA 2FB3A 4FB7A 3ABRA 1TREA 4JIPA 5D02A 2WKJA 3GDTA 1XUUA 3BARA 5D2TA 4LY8A 5IM51 4LUJA 1FUYA 3DHFA 5HMSA 2C18A 3AO0A 1IXQA 1OX5A 1GG1A 3I65A 1VCVA 1AL7A 3SJ3A 2H3BA 2QCDB 5L9FA 4WY0B 3EKZA 4IQLA 5CSRA 1ML1A 3KRZA 1YDVA 3HQ1A 4LS0A 5LSMA 3UWYA 4O4VA 1IGSA 1TPWA 1ZAHA 1ICPA 1UUOA 3HBLA 1OFOA 4PFMA 2E6FA 4KWVA 3G24A 3W2JA 3G3MA 4I9AA 3VKJA 4O52A 4OE7A 1MZHA 4OV4A 3P7YA 3UWWA 3BGGA 1XFBA 3IIXA 4UTWA 3M6YA 3W75A 3U8GA 1PCKA 3PG8A 1SZEA 1KA9F 4XTDA 2A1YA 5EPDA 3NVTA 3KAOA 4GNJA 3W70A 4DO5A 2QR6A 5EYWA 4XWUA 1OX4A 3CM4A 5G5IA 3L2IA 3W7CA 1P0NA 4JTFA 3KX6A 3ABQA 2QEZA 1KTCA 1SR9A 5C2XA 3DI1A 3G3DA 5CZTA 1SU5A 3LHYA 3UQNA 4U28A 2V5LA 6TIMA 3O15A 5E1QA 4IUOA 3O07A 3L67A 2BSLA 3G1YA 4EF8A 3L21A 4R7JA 4AAJA 3T44A 3LHVA 3NL5A 4A22A 2B7OA 2E68A 3TFCA 4QISA 2CLKA 4I7WA 5BRBA 3P60A 3FFSA 3LXCA 3DFNA 4ZVJA 1FCUA 3MBDA 4Z1AA 5HUPA 2B4GA 1LOQA 4HNNA 2TSYA 4M6PA 1K7EA 2G5WA 1PHQA 3GK0A 1VRDA 1ZHAA 3W87A 4E38A 5AFDA 1SW7A 3W1MA 1TIMA 5TBOA 4UTTC 2ZZ1A 3LRKA 4TMBA 4GUFA 3WJSA 3M5VA 1KFJA 4RZ6A 2ALDA 5IBXA 3W73A 1YLVA 1TTPA 4WJEA 4N9DA 2ZDRA 1HFBA 3G18A 1F7BA 1RQBA 5F2MA 5FF0A 1M6JA 1SW0A 3EWWA 3PSVA 3CHVA 2BZNA 3IIZA 3NQ6A 3C4UA 3BK0A 1YXDA 3R13A 3G0XA 3W7QA 5L6UA 3GKAA 2ISSA 3F4WA 1P4CA 4UMAA 2DP3A 1MEIA 2DORA 4N9EA 1M5WA 3GYEA 4FNUA 4PCFA 3DFOA 3PBYA 4JTTA 3EWUA 3RMJA 3L5LA 4LWWA 5K4XA 1YADA 3TX9A 1J4EA 3LB0A 3ABSA 1PV8A 3DENA 4XUGA 1H1YA 3WFAA 2J9ZA 3QSTA 1IIGA 5D09A 4NJIA 1TRIA 3IIOA 1Y0EA 1VYRA 3LX9A 2YSWA 4N4QA 5BMXA 1SW3A 3W7NA 4C1KA 1UASA 1OFEA 5K9XA 2CZDA 5DN1A 1ALDA 3W1RA 4NNCA 4OBTA 5CPNA 2R8WA 1OYBA 5C54A 5C55A 3NGJA 5LGZA 3TH6A 3G0SA 4DF0A 3LCHA 3OVQA 3P5YA 3HOJA 4LOCA 5D2YA 4UIOA 1EWEA 2QDHA 3BLEA 1KFLA 5I3JA 3GNNA 3P61A 2DZVA 1F6PA 3W6YA 1K8XA 3A21A 3CPRA 2YW4A 3PUDA 5DELA 4AH7A 1K7XA 3KHJA 1G67A 4LVAA 3NQVA 4Q33A 1KFBA 4MIMA 4BWLC 4NXSA 2WSRA 3BG9A 1DORA 2Y7GA 4QQ3A 4D2JA 3I7QA 1TB3A 3E96A 3LGEA 3M5XA 4ML9A 4YCOA 3I68A 1W5QA 3FKKA 4JYFA 1JCNA 5I3HA 3LCFA 1Q45A 3TKFA 2RKXA 3S42A 2C16A 4EF9A 1VYSX 3EWYA 3EXRA 3VI2A 5BW6A 4O50A 5LNWA 3W74A 4RV8A 4HSOA 3TMQA 2VFGA 3C2RA 1DBTA 2FQIA 1I4NA 1B9BA 3YPIA 3LOTA 3SI9A 4WUIA 1R30A 3W1AA 1W1ZA 3LTPA 2C1HA 4TMCA 3STCA 1EB3A 3M1ZA 4R34A 3TW7A 3TJXA 1NFBA 2A85A 4MUZA 4CNPA 1TTQA 4IMCA 3T55A 3GR8A 1N55A 3S9YA 1VHNA 3MI3A 2X2GA 3EX3A 4HSNA 4NXKA 5K7JA 3HGOA 1L6YA 4AMAA 4XBSA 4WD0A 4DELA 1I45A 4K39A 4UMCA 3TAKA 4TX9A 4M19A 3W76A 1MSSA 1G7UA 2ZTKA 4UNLA 3LBMA 1LZOA 3C6CA 1LBMA 2QCFA 3A23A 4FNRA 4LUIA 3UPBA 4PA8A 1W54A 4NJGA 2FB2A 1G6CA 4POCA 2FJKA 1W0MA 1XM3A 1TJRA 4NZFA 2FPVA 2C3ZA 2A7NA 4DPPA 3IIVA 3E9AA 5E93A 2BX7A 1HO4A 3EX1A 3JS3A 5AHFA 3ZWSA 1KM4A 5D33A 4MKNA 5DBTA 4O1DA 3G1XA 1BKSA 5G4WA 1XL9A 4ZQPA 3NZ1A 4DF1A 2CFFA 5LKYA 2H3DA 5LNRA 1EWDA 2J9YA 3P80A 2J88A 1GVRA 6ALDA 1QMLA 1F6KA 3HG3A 4MPQA 3PBVA 1ICQA 1SFLA 3R8RA 1C8VA 3QRHA 2A5HA 1RQHA 1T0OA 1WV2A 4GE8A 5KTLA 2WOQA 4UMBA 1W8SA 3CWNA 5LNVA 2NX3A 5LZLA 4EIVA 4MYXA 2G96A 1V7YA 2PRMA 1KTBA 5D32A 3EKLA 1JUEA 2WNQA 4WOQA 3T78A 1ME9A 1GVFA 1I8JA 4IMGA 3LBCA 2VEMA 3R2GA 1DV7A 2YCEA 2VENA 5AYXA 3BW3A 2DU2A 3QPYA 1WDWA 3EX4A 4N6EA 1EP1A 1QAPA 2QCLA 1EUNA 1TSIA 2GQ8A 4QJ1A 4LS1A 1YTKA 1X6UA 2V8ZA 4UFMA 4CCDA 3TNOA 3QM3A 3O16A 3WK0A 3CB8A 2H6RA 3MHFA 3P82A 3P84A 4FIQA 4JYDA 4RXFA 2NUWA 2TRSA 1WBHA 3N2XA 5I3FA 4PC8A 2ZFAA 1WBJA 4CNOA 4DBEA 3DU0A 2X16A 3IRDA 4R33A 2VFFA 3M47A 3WJWA 1VS1A 3ABOA 3DAQA 4Y8FA 3JR2A 4HIBA 1RR2A 1LCOA 1LOLA 3W1TA 5GVJA 1XBVA 1TPC1 4J9JA 1FWSA 3F4NA 4CNNA 4CQAA 3HO8A 3TQ0A 3M9YA 5DXXA 1QOQA 4MFEA 1BWKA 3LXAA 4WX2A 5F1UA 4I7UA 3MMTA 3PM6A 4OQVA 2YX0A 4IWWA 4O8RA 4X9SA 4M7TA 3W7RA 1RV8A 4XKYA 3RLVA 1SSGA 3THAA 1DKWA 1A50A 3EX2A 2Z2UA 1L6WA 3I7SA 4MZ1A 2QCEA 2TMDA 3W1PA 2E5BA 5DCEA 3W2MA 1GVSA 2Y85A 1J2WA 1HL2A 1TV8A 5EKYA 1VCFA 3QMSA 2CZ5A 2E77A 2EF9A 4Y9AA 1TV7A 4KFOA 4A2RA 3UPWA 1OFBA 2GUUA 3LDVA 1T8XA 5F2LA 1DOSA 4BK9A 2Y7DA 3B0UX 2OX1A 3AJXA 1HG3A 1R2RA 2HS8A 4K8EA 1KFKA 4NUWA 3CC1A 3SZ8A 3TQVA 3MYPA 4LC8A 3G8RA 3NNTA 1H50A 1CI1A 3R12A 4H6KA 5AB3A 4AXKA 1X8FA 3S1VA 2ZZ7A 1PIIA 5DBUA 2NXHA 3IGXA 3W71A 5K9CA 2YFNA 4A2SA 3O6DA 1B57A 4ORMA 3ATZA 4RR4A 5H2ZA 2B7QA 3A24A 4Z08A 2NUXA 1YXCA 3V1PA 3W7IA 4MY9A 3CIWA 2CW6A 3EWZA 3KRSA 3PY2A 1XDLA 5C6MA 3QPZA 4IXXA 1Z42A 2CLIA 2Y89A 4LC6A 4AHPA 2CLFA 2JGQA 3LHTA 4GBUA 3W84A 3TXVA 3PB2A 2YXGA 5HUOA 2FIQA 5FEXA 3C61A 2RDTA 4KFNA 1B3OA 2CZFA 3KRUA 3P62A 2H8XA 2WNNA 1YXYA 1F76A 1R47A 5BOOA 1OX6A 1YDNA 5G2WA 2VOMA 1OHLA 3T7VA 1TCDA 2Z1BA 5HNRA 3LXBA 1KBJA 1FWWA 2C15A
chains in the Genus database with same CATH superfamily
1M53A 3APTA 3CMJA 2Z1VA 3VMPA 3VXGA 2QT3A 2Y5JA 1KWKA 4IXHA 1YX1A 2D0HA 1JZ2A 5LNUA 3GHSA 2JKEA 5G1YA 1R87A 4I5XA 1GJPA 4IZGA 1GPFA 4AZ7A 3ABZA 1VIZA 2HQAA 5EL1A 3B05A 2RH9A 2QCNA 3GE7A 4S3EA 4XO7A 4M5PA 4E2OA 3G1HA 5GJNA 4UNIA 1KV5A 1V6WA 5EBAA 1U83A 1SPQA 1DPMA 3FY1A 4WDWA 1BVWA 1RCQA 1EL3A 4N0RA 1V0MA 2VGFA 3C52A 2P88A 3MPGA 1QJWA 2FGZA 2QAFA 3B03A 2GOUA 2YCKX 4BF5A 2G3FA 3R4IA 4O14A 1GOMA 1BWLA 1LORA 1NWTA 4KWWA 5D9OA 4PUEA 4Q4SA 5DLCA 4U10A 1GPWA 1GKQA 3KOFA 5FJPA 3IJLA 1ICSA 2XN2A 4DJDD 4F9JA 3ARRA 1H1ZA 2V81A 3RJYA 5A5WA 4R53A 1E40A 2IKJA 1KM6A 1JUKA 3NZRA 1QFEA 3EA2A 4XTIA 4GFSA 4P8VA 4HBKA 4HHPA 3CHFA 2JK2A 5I02A 4CUCA 1UMLA 2DPEA 3VX1A 3CUZA 4ZB5A 2GVLA 2WJEA 2YL8A 3W83A 1KBLA 4QEEA 5EBUA 3RXZA 5SWUA 3BOFA 4WGHA 4Q8TA 4L4MA 1W5PA 2GL5A 2OZ8A 1SJDA 5C5YA 2Y70A 3T8QA 2R14A 4UTUA 1VEPA 4FNPA 4DY1A 3LK6A 1LUCB 3SEPA 2AQWA 2QF8A 3L4YA 2XH0A 3MTWA 7ODCA 3QC3A 1OF8A 1KM1A 3LI1A 2VO5A 3B4UA 2JQXA 4Q8WA 3GXIA 4CVWA 1BLIA 4RK8A 3IJ6A 3R94A 2F6XA 3R8HA 5A2AA 3AMLA 5GPRA 3EMQA 4I9MA 1WB0A 3VKKA 1Q6EA 3S0CA 2V67A 5ECVA 4GQBA 1GEQA 4CQBA 2Y0FA 3VE9A 2PTZA 2QAPA 2ZDSA 3AS0A 1XIEA 4KBXA 2ZRVA 2D73A 4JX5A 1F5ZA 4WZHA 3RLUA 1EF3A 3LV6A 1B3YA 5PTDA 4GQGA 1GEHA 1J0YA 1BTMA 3LQLA 2OPJA 5HOSA 4LVGA 5FJUA 1TMLA 4HD5A 2XVNA 4R85A 5FI8A 1XIBA 3I6RA 1JJKA 4Y96A 3H2FA 3PWGA 1YEYA 1LBFA 5A6TC 1JFXA 1V3KA 1PKYA 2OSYA 2V38A 2V5DA 1OFAA 4FO4A 5GNXA 5F4SA 1XBXA 2VURA 3BZGA 1YTEA 1R3TA 3GVVA 2QUTA 4J3XA 4OU1A 3PR2A 1ODUA 4M29A 3OLDA 3UCCA 1QASA 2D23A 4H6EA 1TV3A 5KZ6A 1GVYA 5FEZA 1XRFA 3B4YA 4ERAA 2BOGX 4A3YA 4MUPA 2CYGA 3HQNA 1LTDA 4P7NA 4HKPA 1W9UA 2IUZA 2WMIB 3L5AA 3WDPP 4HU4A 4W84A 4GI6A 1XYLA 1HZYA 1JQXA 4IGMA 1EGMA 1GQJA 3C86A 2DV0A 3DUGA 2PGRA 1JZ8A 3D0CA 2CBIA 2NX9A 4LAOA 2GFTA 2UY2A 2OMAA 1WPCA 4J2PA 1LQ0A 4DWSA 1VFHA 1M7XA 3AS1A 2EHHA 1EIBA 1B90A 2Z6JA 3NQ7A 4WJXA 4Q8NA 3CQJA 1TMHA 4TIMA 1RVGA 4XD4A 3NQMA 3S2JA 1L2QA 2J62A 4QR6A 3PZQA 5CSSA 1Q6OA 1E6NA 2P0IA 3EWCA 3SGZA 2DW7A 5BXSA 1HKVA 4AZIA 1PTDA 1E4LA 4DI9A 1BYCA 1OGGA 4QQUA 1E73M 3H53A 2FMNA 1XLEA 3M0KA 5C7HA 5AN7A 4PTNA 4MWAE 4K7VA 3SGUA 1JYXA 2OKTA 4CLMA 1Y5WA 2QQ6A 1K7FA 3HF3A 2WCAA 1KD0A 5DY3A 1XI3A 4H8NA 3TYCA 4YVPA 3TA6A 3TYEA 3W7DA 3VA8A 3M4HA 3NQGA 3HG2A 4LNCA 1H62A 1G0CA 2PI6A 3RO6A 3WFZA 1H5YA 5E0KA 3DESA 3POCA 1F2JA 2GUYA 3GG7A 1I2NA 1UB3A 3PZTA 2E40A 1XIGA 2G50A 2ZA3A 4FNSA 3ZVHA 2QIWA 2YW3A 5JBEA 3QLLA 4LAUA 2I16A 3WF2A 2Y6ZA 3PJUA 3W7LA 3WLKX 3GXDA 4QLLA 4JN8A 3GFZA 1RA0A 2IW0A 4ASTA 1ZENA 2OGJA 3F7JA 3G1FA 3IUIA 3CBWA 4LCQA 4A29A 2CHOA 4TV6A 2PURA 3TJLA 5AHMA 1OG0A 1UJPA 4IGNA 3QW3A 3BAKA 4RNIA 2WXDM 1D7FA 3ELFA 1A5UA 3PTKA 2NWRA 2PWDA 1EX5A 2EXOA 2Z0IA 3BLIA 1X6LA 3JRKA 4GQQA 3KVMA 3DN5A 4AD2A 1MUCA 2QULA 1VD6A 3RG6A 3W9ZA 2PC4A 3QXBA 1GHSA 3NSXA 1H0GA 3PFMA 3R89A 5H91A 4BKNA 2BASA 3CZKA 4AISA 3R0UA 3LPGA 4UCGA 3ZT7A 3CL8A 4WOZA 3AHXA 3ARQA 3MBFA 3K5XA 1OEPA 1RY8A 2EPOA 3QKEA 5BXTA 1MEWA 1IXNA 4ALDA 2Y1HA 2PGWA 1RVKA 4IIBA 3WH6A 1XUZA 1J79A 4W8BA 2F7FA 4BF9A 3NFUA 4GJ1A 2XUCA 1K3UA 4JTEA 3FS2A 3STPA 3FKRA 3CEUA 4I5RA 3MB9A 3GIYA 4WQ6A 3UGVA 2E6AA 1PBGA 2WVSA 2J6VA 1OCBA 1LLOA 1AD1A 1L6SA 5FJOA 1GQNA 1HJUA 5ECUA 1X7IA 3MV01 4LV4A 4O54A 4E2DA 2JEQA 3UY7A 3M44A 3QY6A 5CC7A 3N73A 4E0CA 3ECQA 3W7EA 4IMDA 2QGYA 2FKPA 3H54A 2YA2A 4XQ6A 4QAWA 3QSRA 1P5BA 1XLAA 2O9TA 4GGHA 4DUOA 3V75A 4Q8VA 1MNZA 5EFFA 2SFPA 4JNYA 1PCWA 1WQ5A 3VGFA 3S4TA 4ZOEA 3WDQA 4UFJA 2WCSA 5FF4A 3TU9A 3M0LA 2CPUA 4GY7A 4TV5A 3JU2A 1S39A 1UR2A 1V93A 3W2LA 2Y88A 4MJ2A 3RM9A 4MPKA 2C1IA 2NSXA 4BI5A 4NX0A 1KBBA 2EKCA 4RDZA 3PTQA 3GXTA 5BXRA 3NL2A 3AUJA 1K4GA 3ITCA 3WNLA 4WY0F 4ACZA 1OFDA 2W3ZA 3QZEA 3W72A 4DWSD 3H4WA 4MZYA 4GD0A 4E4PA 3VDGA 5D04C 4O15A 1P0BA 4H7CA 1HKWA 1QUMA 1A4LA 3UG3A 4Q22A 4LUSA 2HNEA 4QLKA 3F1QA 2VOTA 5HWMA 5I0DA 2OZTA 4GRSA 3C0LA 3XISA 3LPOA 5G4EA 3Q37A 4PSPA 2WC3A 4GX9A 1UZHA 3EWXA 1IHIA 3VIPA 1J6OA 3WD3A 3OYZA 3O1NA 4R7WA 5ABFB 4U5IA 4B16A 3NCOA 4CN4A 2UY4A 4NYUA 1QU4A 5HATA 5HPOA 4JYEA 4YS1A 5IRPA 3KZSA 2PWFA 2PLCA 1PYFA 3U7VA 1ZLPA 1GQIA 4NZ4A 1Y8BA 4U5KA 1KTNA 1EX1A 3ARYA 1CGVA 3NZGA 1RD5A 1FCBA 3WEZA 4DLMA 5CAKA 3W1XA 1ADOA 2HISA 3O7UA 3KXQA 4FF5A 3U5YA 2F61A 3VNYA 1JYVA 2QDGA 3FJNA 3GW3A 2NX1A 3WELA 5I79A 3FYOA 4B5VA 2BXVA 1V6UA 4I9TA 2GGHA 1FKWA 4ROPA 4Q4RA 4CNTA 1RHCA 2D3LA 2EAWA 4UUIA 4C6BA 3LHWA 1LDCA 3I4KA 3W7JA 1VFUA 1WXJA 3QFEA 4U33A 1J10A 4JKMA 3QZAA 1TPUA 3F4DA 2Q02A 1A3WA 4FLRA 1MZRA 3S2LA 3PB0A 2VDIA 2KZHA 1P0EA 2DUZA 3N15A 3L0NA 1KM3A 5TD4A 1QK2A 1DJYA 3ANVA 3TCSA 1KBIA 2ADAA 4PCTA 4CNUA 1LL6A 3T2PA 4N4PA 4PB4A 1U5JA 1E9ZB 2UBPC 4Q4MA 4UNKA 3Q58A 2JGYA 3V35A 1SMAA 1OYCA 3A3WA 4DJDC 3PUGA 3NAVA 3P0XA 4Z2GA 1C3FA 3PSWA 4UCFA 5C2GA 1XQKA 1BTCA 1PKLA 1CYGA 2R1PA 2HJPA 3ERPA 3RR4A 1ONRA 3N1AA 3ZMRA 2AL2B 5HBFA 3IRSA 2NLYA 3MUXA 5BWFA 1UP0A 5IDIA 2RDXA 4ICNA 5XINA 2W4XA 3BG3A 1V03A 1PE1A 1W5OA 3IVTA 3OTRA 4PUJA 3SSJA 4A05A 1XR2A 2E5DA 1ONXA 4RE2A 4ZEPA 2NWSA 4EE9A 5C71A 1K8YA 5BROA 2NXGA 3STFA 2PTDA 4DWSB 1ZU8A 4NILA 4NQ1A 3NQAA 4AEEA 3W1UA 3QVQA 3SCWA 2YZRA 2E9MA 1OADA 3MMWA 1HKMA 1UC5A 3TWAA 3NXFA 4AFYA 3I3DA 3U48A 3B04A 3BLFA 1TWZA 4QITA 2E8ZA 4IIDA 5I5RA 2X09A 2PBGA 4J3SA 3HMJG 3SUTA 2YIHA 2ZWYA 1VFTA 2Y5SA 5J04A 4N9CA 2GZXA 1XFCA 4HNUA 1HJSA 4DVOA 3FVDA 4J3UA 1QBAA 4LY4A 3OGRA 2VCBA 2ZBTA 2RHGA 1UIOA 3GFXA 2H8ZA 3M7WA 1XISA 3WBWA 1CPUA 5D9MA 1ZALA 1FP8A 1B54A 1DEDA 1X1OA 4Y90A 2Y63A 5FEWA 2PLKA 1R85A 2DT2A 4KS0A 4P7OA 5FACA 5CH9A 1XH0A 5CKSA 3BCJA 1LBLA 4WIWA 3ZVHB 3AMGA 3S9IA 4LF1A 4P8UA 3PZMA 1BF6A 2J7DA 2J7FA 4O57A 1XBZA 1QO5A 4H04A 4KRZA 1ZNNA 2DFAA 4Z1BA 4O28A 4J3WA 2J24A 1AG1O 4HPGA 2A3BA 5F4WA 4JY8A 3AXIA 3CLWA 4QIUA 2QCCA 3TK7A 1JCYA 3IARA 2VEIA 2ZZ4A 2B7NA 3UZXA 4ADSA 3VOFA 4LS2A 4MKVA 2OX4A 5G4HC 1YPFA 3AIUA 5FF3A 5D03A 2J4GA 1Z69A 1JXJA 3ONBA 1H7NA 3VKAA 1OCNA 3DZ1A 2IXUA 1WKFA 2OXNA 3OOQA 5D2VA 2UY3A 4E5TA 3NL6A 3NQEA 3TTQA 4D6FA 5FOOA 1O1ZA 2BBFA 1S2AA 4US6A 1BXCA 4D8LA 1YYAA 3VNDA 4U2YA 2QJIA 3CASA 1BWVA 2YDRA 1GZGA 4IHCA 5BMWA 4N02A 1MQQA 3T8LA 2VNCA 3VOJA 4UQAA 4ZENA 1X8CA 3DGBA 2V69A 1AMYA 4DHGA 4HMDA 1WOBA 3CWHA 3S46A 1PXGA 3IIPA 1QCWA 1XQLA 2QPSA 3KDOA 4TQTA 1V7AA 4DYJA 4GWEA 1QPRA 2R1LA 3WLNA 3E0WA 4MLRA 2ZA2A 3H24A 1ZAIA 4JCLA 3QFWA 2OODA 1O95A 1E0WA 5EMYA 2R1MA 3LUTA 3N2OA 5IFTA 1LF1A 4HVXA 2WKGA 1TZ9A 3IGUA 2C0AA 4J7RA 5D38A 1IF2A 3FA5A 4DM2A 3WJZA 3AIRA 3T4WA 3S1WA 3I7RA 2VCCA 4DQWA 3NYZA 1EF2A 4YXGA 4I8YA 2Y2WA 4MDOA 2VM8A 2PRHA 1EC9A 4LTSA 4TX8A 2ZCGA 3SSZA 2A21A 4ADUA 2X1SA 2J74A 1EZWA 3B06A 3SUUA 5JQ9A 4MJZA 5CPQA 1IWPA 1TV5A 4S1FA 5CGTA 1L9WA 2ZZ5A 3FSUA 3MJYA 1GZ1A 4DEFA 2Y4SA 2GGGA 4JFVA 2DZPA 3OVGA 4GHRA 5AZ0A 1R5YA 2PD9A 3TNBA 3PZNA 5FF7A 4OUEA 2PF8A 1GT8A 2A6LA 1UWAA 1UH4A 1TRDA 1EFZA 1RJQA 4O1FA 4AU0A 1K4HA 3IEBA 1YHTA 3CAWA 2IPJA 4ZQMA 4Z1DA 1M65A 4ACZB 4O18A 1Z89A 1F73A 2PGEA 1OT1A 1NSJA 1WDPA 3S83A 2FZDA 2X41A 3B9EA 2J7HA 2EPNA 3RO8A 3P8IA 2V5BA 4LU0A 4NVTA 4S3DA 3S6TA 4V2XA 2YDQA 2I5IA 4LUSB 4J28A 4IOTA 4UTJA 4OV9A 3PS7A 2GSEA 1CXFA 3AZSA 4MY1A 1L8PA 3OEXA 1VBJA 1JL8A 3ORWA 2XVKA 2VTFA 4MB3A 1GOQA 2NQ9A 3P3BA 3DIPA 4ZZ9A 3TA9A 3IAPA 4N2YA 3U2OA 1Q4WA 3IANA 4DI8A 4H4IA 2XIQA 1MQPA 3WK3A 3N2TA 4ERIA 3N6JA 1NDWA 1GTHA 4UOJA 1H60A 3GU9A 4EAMA 2E8YA 1UOZA 3ABRA 1TREA 1WZKA 3KBWA 4H9VA 4XISA 4LY8A 5HMSA 4I6KA 2C18A 4IL2A 5I2UA 2B31A 2ZOXA 1ML1A 1NARA 1ZL1A 1YDVA 1ZP3A 3UWYA 1FWCC 1TPWA 3U2EA 3HBLA 1KGUA 3W2JA 2QVHA 1KO0A 4X2PA 3G3MA 1XSKA 1QW9A 1SFSA 4HMNA 4UTWA 3M6YA 3W75A 1J5SA 2WAGA 2A1YA 4F0MA 4C6EA 3KAOA 4ZXLA 4RE4A 3CM4A 5G5IA 2Z00A 4JTFA 3KX6A 1PIGA 1X98A 3ABQA 4B5SA 3T08A 3T9PA 3LHYA 1AJZA 3UQNA 4BY3A 3L67A 3PHAA 3EDDA 4AAJA 2JIWA 3MVIA 3BLOA 1GOKA 4JQ2A 5JVLA 2ZADA 3GNPA 1GORA 1FH8A 3CV2A 1BSIA 2GQ3A 4CCZA 1JPHA 4DWSC 4QCFA 3DFNA 4ZVJA 5HUPA 1IT8A 4M6PA 2NW0A 2G5WA 4FOUA 3GK0A 1ZHAA 2VI0A 1SR0A 2C91A 2HE5A 4E38A 4KH2A 1ZJHA 5TBOA 2QDDA 4GUFA 2ALDA 5IBXA 1BYDA 3W26A 3W73A 4IIFA 4WJEA 5I6SA 1JDEA 3OHMB 3EEZA 5HANA 3LZ5A 4MTVA 5FF0A 1C90A 3PSVA 3GIPA 1TE1A 3MUY1 4S3JA 3C4UA 1UBPC 2RJHA 5L6UA 4GI8A 4XUYA 3SUWA 3F4WA 3WLRA 2WJDA 4Q4QA 2BGSA 3AIQA 1PWLA 2GLKA 3SCQA 2OR2A 4JTTA 4Y9OA 2VUNA 3WH8A 4PMXA 2XVPA 3N3TA 1J4EA 3SRFA 3ABSA 3WH5A 1PV8A 4ZOAA 3A4WA 2YSWA 3R11A 4D6EA 4LJ3A 2OLSA 1E70M 4QDMA 1SW3A 2EQDA 4C1KA 1DJWA 5K9XA 1ZUAX 4LH8A 4NNCA 5I3DA 5RUBA 1E55A 3KL3A 3DYOA 4DF0A 1R0MA 2PODA 3P5YA 5D2YA 2QDHA 1ZS2A 3SCTA 2YXXA 3P61A 1MXGA 3A21A 2F8QA 5DELA 2GGEA 3KDNA 1K7XA 5A2BA 4XO6A 3NQVA 1FWGC 2R24A 1JZ6A 1SZRA 3BURA 1UR8A 3VU2A 3BAWA 3QR3A 1E56A 4RDVA 3I7QA 1TB3A 3T6CA 3UP8A 3OLGA 3E96A 1AODA 1W5QA 3THDA 1CGWA 2DSKA 3CS2A 5JU6A 4IMAA 1JZ7A 1ISWA 2C16A 4EF9A 1VYSX 1US2A 3EWYA 4XAGA 3VI2A 4DXXA 4D6JA 5GNZA 2JEPA 4P7QA 3W74A 3QY7A 4RV8A 4HSOA 2E9LA 2VFGA 3TMQA 4IT1A 1B9ZA 4AIOA 3KHDA 1I4NA 3C5QA 2OWCA 3SI9A 3RCNA 3LMYA 4WUIA 1FWEC 4TMCA 2C1HA 2OSWA 3EOUA 1Q7ZA 3M1ZA 2V68A 3WDJA 2WZHA 4PMOA 1YNYA 4IMCA 3T55A 4OFCA 1N55A 4MNLA 4EXAA 3WQ5A 2Y24A 3MI3A 3VIFA 4GZ7A 3EX3A 2ISDA 5K7JA 1TG7A 1L6YA 2XZ7A 3K1GA 3GH4A 4A3RA 1P7TA 1I45A 1JI2A 3WO8A 3ARZA 4MB5A 3CUHA 1MSSA 4EPEC 3UJ2A 2O9PA 4ZSUA 4M56A 1MRQA 3RCYA 3C6CA 2VGIA 2DQWA 2QCFA 1A0EA 3UPBA 3LMZA 1DJXA 4NJGA 4M0XA 4POCA 1L6FA 1XM3A 3W29A 3OBAA 2HEJA 3IIVA 1HO4A 2GJRA 3N2BA 3QR0A 4ZODA 4YIWA 1KXHA 1KM4A 5DBTA 3G1XA 1W8GA 2OQHA 1KR1A 5C9RA 5G4WA 1XL9A 1CDGA 3NZ1A 4ROQA 4ZQPA 3E5PA 4L6OA 2J9YA 3D6NA 3VC6A 6ALDA 3HG3A 3LG3A 1P6CA 1C8VA 1RQHA 2J7CA 1WV2A 4EXBA 5CC3A 3LENA 4WDUA 2G96A 1KTBA 1XLCA 4L9ZA 5I06A 5D32A 3EKLA 1JUEA 2VZSA 3D46A 3WLLA 1ME9A 1DV7A 2VENA 1PKMA 1PZ0A 2DU2A 3QPYA 2VUYA 3DEQA 3I6TA 1J0IA 4QJ1A 2GSHA 1RH9A 1KFWA 4GVHA 3RU8X 2PDQA 4DYEA 1OC7A 2FVKA 3E0VA 4UFMA 1UD6A 4DZHA 3OZMA 1ZPTA 3CB8A 3OZOA 5AY7A 3M6DA 4IUGA 2TRSA 4IIEA 3CHEA 5I3FA 1U5HA 2X16A 3IRDA 3WQVA 4FXJA 5M1TA 1SJBA 3M47A 3BZJA 4Y8FA 3JR2A 2J13A 1WXZA 1RR2A 4C6PA 2ON3A 3W1TA 8RUCA 5GVJA 3PK7A 2AKZA 1Y7VA 3K4DA 4AMCA 4W88A 2PF0A 4CQAA 4DN1A 3V5OA 3UWEA 1PX3A 4LUYA 4MFEA 3EZ4A 3LXAA 4PB3A 4WX2A 5F1UA 3GS6A 4OQVA 4M7TA 3ISIX 3RLVA 3HM7A 1QBBA 2CLPA 3KTXA 2Z2UA 2J8TA 3UNTA 4MZ1A 3CAKA 5EKYA 2F2HA 2E77A 2EF9A 3GSMA 1WDDA 2BVDA 1OFBA 2GUUA 4GNVA 4TVDA 3LDVA 1T8XA 4JFUA 3VD7A 1CENA 2OX1A 3AJXA 4KMQA 3WN6A 1FA2A 1CIUA 2FFIA 5CSYA 4NUWA 4IJRA 3CC1A 5AYIA 1QI2A 3TQVA 3RHGA 1XSIA 1TZ7A 1CI1A 1PWMA 5ENLA 2X7VA 1BRLA 3M0JA 1HGYA 3CO4A 3WDIA 5K9CA 4M1RA 3GHUA 3NGFA 2QMJA 4PMDA 5H2ZA 3WQPA 3P0WA 1ECQA 2PDUA 4GYJA 1WNOA 3OGVA 3W7IA 4BA0A 3N9KA 5AECA 2CW6A 3KRSA 2BOEX 1XDLA 3HJEA 3HZ3A 2G0WA 4KGJA 4Z2HA 1T40A 1Z42A 1ADDA 2CLIA 4GXWA 5BZAA 4LC6A 4AHPA 2JGQA 3W84A 5CPTA 3MS8A 3TXVA 5HUOA 3WKZA 3C61A 3PN8A 2RDTA 1QNOA 4KFNA 1XLIA 4G9PA 2CZFA 2H8XA 3AU6A 3AXKA 3BLKA 1DWHM 3USZA 3OLIA 2A3LA 2VOMA 3CUIA 3T7VA 1RLCL 3K4WA 5EGRA 2C15A 4ZB0A 1R9XA 1IEXA 4HPXA 4ZOBA 2O9RA 4GI4A 3VVGA 2E4TA 1SQ7A 1XV8A 1E5NA 1FCVA 3DOPA 5C7VA 4X63A 3IGHX 1W9VA 2POZA 3ZR5A 3PC0A 3M5ZA 4DRSA 2V82A 1XYMA 2OJPA 1W5MA 3RRXA 4YPJA 5EMLA 1FHUA 1IYXA 1XBYA 1Z32X 4MB1A 1H41A 1SJAA 1HKJA 4AD5A 4JTHA 1ZBCA 3TFXA 3RU6A 1KW1A 2BFGA 1A5MC 2GSJA 4UR7A 3UXAA 2BWGA 2EPHA 2Z1XA 4WJ8A 4QE1A 3DX5A 2W27A 4G1KA 3KEHA 1XS2A 5IHSA 5TAOA 5HK4A 2J6XA 3JUGA 1WCGA 2V3EA 1J96A 2ZXQA 4O11A 1KCLA 1QPQA 5AHEA 5A8PA 1XIHA 3TXZA 4C6NA 2OFJA 2YPIA 2CBUA 2BB0A 1TWWA 3H2EA 4WHBA 4GIYA 1IEQA 1K8ZA 1VBHA 3KFTA 3QBUA 1FFRA 4NJKA 1YTDA 4CD8A 4IP5A 3NA8A 1A4MA 4OT7A 2XJ7A 3C0SA 1D3GA 1UD2A 1HUVA 1P48A 5D9NA 1O5KA 2WJZA 4NIRA 1Q6RA 2ZA1A 4H3DA 2VFIA 4BQ3A 1DXFA 1QR7A 2KX9A 1KB3A 2ABBA 3W1QA 4PRRA 3BV7A 1Z9AA 1MXSA 4K8HA 2Z6IA 1EHNA 2GGJA 2ZX7A 3TC3A 1J8VA 3CUFA 1GYNA 1NF7A 1V4YA 1RK5A 1DIDA 2CWNA 5HQEA 3NG3A 2BVYA 3ZR6A 2QUNA 1E4IA 4EANA 3E02A 4GVGA 2RDUA 1HF6A 4O1AA 4KEMA 3I3BA 1F8MA 1GJUA 3KS6A 1S5VA 4CCEA 3T42A 1PB0A 5DF0A 3SRHA 4FX6M 4YYCA 2XTKA 2EO7A 1M68A 4HK5A 4DJEA 2P3ZA 1LJYA 1F3EA 2PLMA 4LALA 3WLHA 2A2IA 3SADA 4PMQA 3SCPA 4AEOA 5A6JA 4KERA 4TU1A 3IJ7A 2ANUA 4CN1A 1ME7A 4B15A 4AYGA 3WEMA 1YNQA 3PG9A 4J35A 3VUSA 5JUVA 3P74A 1F4HA 3NR0A 1RUSA 1V3LA 1QDSA 3F5KA 3GFYA 3NDZA 4AWTA 3UZWA 3LLDA 3BCDA 2NQLA 1AFSA 4WSKA 5BYWA 4S3CA 1P7TB 5F2GA 1MFUA 5FJIA 2XG9A 2RAGA 1AMKA 1KV8A 3CTLA 3MQTA 1EC7A 4D6GA 2CESA 3PULA 4JTLA 4GUGA 2XIBA 3TUUA 4M51A 1X97A 2Y8UA 2WJFA 1US3A 4IPIA 2NQJA 1JPMA 4E8DA 4ZB2A 4UR8A 3OP2A 4PCPA 3N2MA 1DIEA 3O3RA 4RX0A 4P61A 5D9PA 3N3MA 4ZL1A 3R43A 4K3ZA 1MDRA 1RPXA 3GC2A 1TWSA 2V63A 3SUVA 2V6AA 2R94A 2FVLA 2QCHA 2W92A 3EMCA 3GD6A 1LLWA 1JGIA 1W3JA 4LVDA 5LGXA 4BI7A 3WJYA 1H09A 2JKAA 2QJJA 4KT2A 3WLJA 1UD3A 2HVOA 1A0CA 3OBKA 2BHYA 2WMHA 3XIMA 2PCQA 4FXRA 5IXEA 1BGGA 1H7PA 2NUYA 3TN6A 1ISVA 3BMWA 3L2LA 1G5AA 4W7UA 1E1CA 4QNWA 3TC7A 2DZBA 1Q6LA 3PZGA 1BXNA 1EC8A 1S5MA 3PJXA 2V2HA 1IV8A 3WFLA 3GM8A 3GDKA 4AIBA 1LRTA 1OC5A 3VYLA 3F5LA 3O06A 3NQ8A 1ADSA 4CQ9A 3TR2A 1DXEA 4PULA 2Y62A 3QEZA 4S2CA 2J25A 4NHVA 3M46A 2CZEA 4MVAA 3Q94A 3AYRA 4GYFA 1TTIA 1DWAM 2ACSA 3K46A 2NVCA 4QXIA 1ZJAA 4DO4A 2POTA 3E12A 4ERGA 3W00A 3VCCA 4JX6A 4O4WA 2IPWA 5DX7A 4EWND 1WYIA 4L4OA 1Z44A 2DGAA 3AZTA 3TSBA 3NOEA 3PAOA 5F2IA 3MP3A 3MO4A 3QMRA 1ITXA 3FYYA 3W7PA 2E1DA 2ZUNA 4A8IA 4PGLA 3C2EA 1A3HA 3OA3A 2ZYFA 3UJSA 4J3VA 4XG1A 1XRTA 3AYSA 3B0XA 4X22A 1XCWA 5E6ZA 2J9XA 4LBRA 3R6IA 3SQMA 1TJPA 3NL3A 2V5CA 3UBPC 3TAOA 3RM4A 3USBA 5A6SA 1C92A 4QG6A 2AQVA 4FX7A 4C5YA 2ACQA 1OIFA 1ITUA 3OG3A 2BMBA 3KL0A 2VX4A 3UY8A 4JL2A 1XCFA 1VC4A 1ZQ5A 3GQYA 1BRLB 2ZX6A 3VGEA 4AX7A 2YDSA 2OYKA 4UTWC 4UFLA 4ZTYA 1FOBA 1GUVA 4JBRA 4LAZA 3VDAA 3VC5A 1FKXA 1XIJA 1IZJA 1VF8A 1O5QA 3BOXA 2BOFX 3M0YA 1VYPX 4QEHA 3EB2A 2RFGA 3OGSA 3S5SA 1W1IE 1H51A 3LNPA 5DMNA 3A47A 4DLFA 3DECA 4BFAA 3QHOA 3TYAA 2WPGA 3ZFHA 2PUZA 1W1YA 1P0KA 4DJED 3TTOA 4MY8A 1NU5A 1V77A 2OT1A 4ZOCA 4PMJA 3TMLA 1T6MA 1QXLA 2E7FA 5KZEA 2CU0A 1F6YA 3MUZ1 2A3AA 2E5CA 3ATYA 2I5QA 2YL5A 3L65A 4K68A 2HMCA 5CAHA 2BLEA 2XHYA 2IQ0A 4TTUA 2O56A 2QLYA 3ZLHA 3HPSA 4O0KA 1ZB5A 1NDYA 4JTIA 4S2BA 3TZFA 1K9DA 1BYBA 3GR4A 5A6AA 2NT1A 1J0JA 3K8KA 2ONEA 2R1NA 4GCXA 1AZ2A 4JN6A 8CGTA 1K6WA 3NO5A 1NQKA 2BHUA 1V02E 1ZJIA 3MO7A 4LYPA 1R3WA 4YL2A 3GXPA 4IL0A 2P0OA 4MGGA 5CLWA 2GDUA 2NQ5A 3ES8A 3H4GA 1KFCA 5EA9A 4IIGA 5FEPA 1DL3A 5KZMA 3VZZA 3LBOA 4IP4A 3THQA 2WWDA 4PE8A 3S1UA 5F1VA 1FXQA 3RM8A 3GBEA 1S5WA 4TVCA 2VQTA 4Q8QA 1OX4B 5U4NA 3WQ6A 1SZFA 5CGQA 4K7YA 3GDRA 4K8GA 3GDLA 5FD0A 3TDFA 3UR8A 4ZFCA 4QROA 3UU0A 4WF7A 1IT7A 4GISA 1PPIA 3T0CA 5FKYA 2PDFA 2PRLA 3VDCA 4UTLA 1O6IA 1U5VA 4O10A 1EH9A 3UJEA 1KXVA 5AC6A 1ZAJA 1EA9C 1XIDA 1UZDA 3FK4A 1I2PA 4J5NA 3BDKA 4YU1A 2VFHA 4WVXA 5D8ZA 4AVFA 5FAGA 3L0KA 1TPH1 4AIUA 5TIMA 2FH6A 3GX9A 1R46A 2HE8A 1US0A 3T2OA 2D20A 3U7BA 5HJLA 3EB4A 1MW3A 3FHQA 3OQEA 2A4AA 2F84A 2Q8LA 3EPMA 1Y5XA 3M41A 3T0AA 3VOHA 4WLCA 3UF9A 1EJXC 3T05A 1IXOA 2X05A 1CXLA 2PDKA 5LXXA 1A5OC 1ISZA 1F05A 2QJNA 1FWNA 1E71M 5FCZA 3HPZA 1GYMA 3G22A 4JTDA 1H3GA 4NKCA 3GW0A 1H7WA 3CUGA 2DVXA 3EXTA 2JF6A 2ZRYA 2J75A 3UD6A 3GTNA 4UFKA 2CBVA 2EGZA 2PZ0A 4PMUA 4YTRA 2VX7A 1X1ZA 3APYA 3VZXA 5HAOA 2FPYA 4C6QA 2QCDA 4XSMA 4WY0A 5H6HA 1JCTA 1OFQA 1MUWA 2Z4GA 4LX4A 1ME8A 1J0ZA 4YLWA 4X3ZA 3L4XA 3LTYA 3ZVIA 1A49A 1GJWA 1C9WA 2V3GA 1P1MA 9XIMA 5C0QA 3VGDA 4QRNA 3T40A 3W07A 3DKLA 1I0DA 1JDDA 3BW2A 2HXTA 3S5YA 3H2NA 1UW9A 2QKFA 5JMUA 4KCTA 4L6HA 4JS3A 1KRCC 4W89A 7REQA 3RJXA 3M16A 1R3VA 2QGHA 3GO2A 3VUPA 3S3GA 4HPJA 3BANA 4W85A 4RUBA 1BG9A 2Y7EA 1XLKA 3UG4A 3BG5A 4JNZA 3CZJA 2GVYA 2QV5A 5D05A 2PTXA 2V9DA 3MDUA 4IJBA 2R6OA 3T4CA 1HL8A 5EMKA 1U1JA 1IZCA 3CWOX 4UQDA 4MLJA 3GVQA 2RUSA 4KWSA 3AHTA 1NOUA 3WYZA 1JZ5A 5CGMA 1GG0A 3ANYA 1XP3A 4S39A 1FP9A 1QTWA 3KCJA 3RAOA 4NI8A 5MF5A 1QNRA 5EB8A 2A6NA 2HBXA 1TV2A 4MOZA 3A64A 4YN5A 5CEWA 2F2KA 7A3HA 3IGSA 4NAEA 4C91A 3K30A 3NWRA 2YKKA 1L2UA 5HA7A 1CGXA 2PDGA 4IPLA 3NM1A 4LGXA 4PODA 3AC0A 1W56A 3MP4A 1DJHA 2VRKA 2I9EA 2PPGA 3CZLA 1N7KA 2E0PA 4QJ3B 1E1CB 2XDFA 4ORIA 3SQSA 3SY5A 3L66A 5I00A 1E43A 4W4QA 1D3HA 5DT5A 3CGTA 3O6CA 4C1LA 2ZUMA 2Y8VA 4GNKB 1JULA 3NXLA 1I0BA 3VCRA 4AZ5A 2VKZG 4GIRA 3R58A 1DP0A 3KS5A 3W7GA 3LGGA 1EIXA 3GVGA 4CD5A 4JXCA 3SURA 2VHLA 1ZP4A 3UXDA 1G4SA 1QT1A 5AHNA 5FAJA 2GQAA 4YTUA 1KRBC 4YHEA 4GQRA 1LLZA 4W8LA 3RRAA 2AKMA 2AQOA 2GVGA 1FDYA 4GGBA 4UR9A 1AW5A 3P2VA 3FEQA 3G0UA 1TR1A 2TPSA 1J93A 1HJWA 1SJCA 5AHIA 3ZLGA 2C14A 1DWGM 1KCZA 2DEPA 3F2BA 3KBJA 1FHLA 1LWHA 3VGHA 2WNZA 2FDSA 1WDSA 1J01A 4Q8MA 3UEQA 1F3XA 4H1ZA 3W7HA 3MCMA 5DCBA 1NEYA 1VPQA 1S2TA 4XBKA 4O19A 2FTPA 3L12A 3HGSA 3KVKA 4HMCA 1TE6A 3HG5A 3W22A 1ELSA 1NJJA 1QW7A 5I78A 3SAZA 1OINA 4D6CA 2PA6A 1F9CA 1DJNA 2VFEA 1XGEA 3CUJA 1TPDA 1EZ2A 2VMFA 1WAUA 3VFLA 3T0BA 3WH7A 2ATMA 1EDQA 2F9RA 4FLSA 1D9EA 2JKPA 3IPWA 1ITQA 2X1IA 4R88A 4EP8C 3UWUA 2A0NA 1E6XM 4KEVA 3C2OA 5CC6A 1NTHA 4OIFA 1EYEA 2IXVA 2WZIA 1VR6A 1ZFJA 3F2DA 1IEIA 4QCEA 3IJ9A 3IK4A 3WNMA 3VFCA 2ZRXA 4JQ4A 5AC7A 4WK9A 3GLCA 1OCJA 2CXGA 2O7SA 4BQ2A 5FF2A 3WSUA 4Z1YA 4TUFA 4RNHA 3NM3A 2CNCA 3A6OA 2OTDA 4JDYA 4BCEA 3O63A 3M07A 3EX6A 2PCEA 1Q8AA 4ZQOA 3S5ZA 3PF3A 4FF7A 4MKSA 2ZUVA 1XHGA 2DZAA 4IPJA 4M6VA 4NZ5A 3HU7A 1UP3A 1DHKA 2ZWZA 4PFHA 1LM1A 1FY6A 3VKBA 3QPEA 3ITTA 4RZ5A 4JDBA 1UYQA 4EOUA 5M5DA 2FLIA 1NDVA 4UTHA 2BXYA 2ICSA 3WLMA 1VPXA 2PBOA 4QX4A 4DF2A 3NPVA 4LW7A 1TVLA 1PSCA 1VFSA 3DFTA 3W28A 4QTGA 2P1FA 2WPBA 3S5OA 4XX6A 1Q85A 4HPHA 1OF6A 2OEMA 3C2FA 4GJJA 3TOPA 2D22A 1EJWC 1W1A1 4FS9A 3OYXA 4GVFA 4B5NA 4B5UA 5AC4A 4LEQA 4QSHA 3NQDA 1TV4A 2VZVA 3W01A 1AQMA 3HPAA 3MP5A 3W2KA 1BQGA 1AW1A 3P67A 1OIMA 2PTYA 2G3JA 4UQEA 1UA7A 4EX4A 4D6IA 1WKDA 1EHAA 3UNDA 4KIRA 3WX7A 4AWSA 3RR1A 3G5EA 3RGTA 4CVUA 3P6LA 4A21A 1GTEA 3FW6A 2XIOA 1N8IA 5CG7A 2EG8A 1X7FA 2VP8A 3O6AA 1C29A 4DJEC 3AFBA 1NM9A 2F6KA 3DBNA 3PWAA 5HWNA 1OJXA 5BOEA 3KTCA 3QQ0A 1TCMA 4RE3A 3G2GA 5G2HA 4FB7A 2A3CA 4AY1A 4JIPA 2CERA 4KGLA 4CD4A 2WKJA 5BOFA 4GY1A 3IV8A 1MUMA 4LUJA 4AD4A 3HMCA 4X0VA 3S2NA 1OX5A 1XLGA 3I65A 4H9MA 1AL7A 1EO7A 1ZRQA 2QCDB 1IE7C 5L9FA 1HJVA 3EKZA 4WY0B 2ZE3A 5CSRA 3VGBA 2XWDA 3HQ1A 3GTIA 4LS0A 2PDYA 1ZAHA 1UUOA 3TJ4A 4KWVA 4M81A 3G24A 4I9AA 5A8NA 3WMCA 1MZHA 3WNPA 1HKKA 3FA3A 3TR9A 3IIXA 3U8GA 1KXQA 1DIOA 1ONEA 3PG8A 1KA9F 5EPDA 2W67A 3NVTA 5HNNA 4ES4A 1IZKA 3W70A 4DO5A 7REQB 2Z24A 3GG8A 3L2IA 2Z2BA 2QEZA 2CXEA 5C2XA 3G3DA 4U28A 5E1QA 4HZ6A 3SQLA 4R7JA 2GYIA 3II1A 4JL1A 4A22A 1GVEA 3TFCA 1PDYA 3T07A 4QISA 2CLKA 2YCJA 3WLPA 1CZ1A 3FFSA 1XJBA 3OB8A 5EMJA 4C6CA 3PPFA 2IQDA 3L23A 1LOQA 1HJQA 4DZ5A 1K7EA 2V3FA 4JTRA 4BQ4A 1BVNP 3CT2A 1M03A 1WZMA 3W87A 4R9OA 5AFDA 1SW7A 2GOKA 1VPYA 4GY0A 1TIMA 3FGCA 3JVAA 4YNGA 2XVGA 3WJSA 3M5VA 3FX4A 1EBHA 1OSEA 3CYJA 1M1BA 4N9DA 2D2GA 1HFBA 5F2MA 4NAEB 1D2KA 1WAWA 2OYMA 2BZNA 1Q63A 3IIZA 5ABFA 1BFNA 3R13A 3G0XA 1DYSA 3QLDA 3CV1A 1P4CA 4UMAA 2DORA 1CGTA 1M5WA 9RUBA 4FNUA 4U3CA 3A4JA 3L5LA 1U22A 1GHRA 1Q6DA 2QIIA 4HA1A 3TX9A 3MMUA 3M0IA 1PDZA 3WFAA 3ZIZA 4JTCA 3PTDA 4MB4A 3IIOA 3GVRA 3TTSA 4FR1A 2Z27A 4H6QA 5BMXA 1OFEA 2HZGA 1WZLA 1ALDA 1J9YA 4GYPC 3A4AA 5CG0A 4R7OA 4RW5A 3AZRA 4Q6XA 2VT0A 1VBRA 4LOCA 3IWPA 1EWEA 4OBRA 1KFLA 3N4EA 1EEXA 4D71A 3VD9A 4AC1X 1KQYA 3CPRA 2YW4A 2XISA 4LVAA 4WKHA 4MIMA 1BVZA 3FVMA 4NXSA 3VD3A 1LG1A 2Y7GA 4QQ3A 5LIWX 3TQPA 2A3HA 3LGEA 1W3HA 4WKFA 4YWSA 4DYKA 1FH9A 2G3MA 5LXEA 3WY1A 2FZ9A 4JYFA 1JCNA 5I3HA 3FDKA 3TKFA 4DBSA 1IEVA 3CPUA 3S42A 7TAAA 3EXRA 2DT1A 3WNNA 4F2UA 3VNMA 4D9PA 2AL2A 1DBTA 4Y7EA 2FQIA 4I90A 2DIKA 3LOTA 4ZSTA 4C1NA 3KW3A 1XYZA 2HXUA 4XK2A 3ALGA 1W1ZA 3HTWA 4HYRA 3LTPA 1GKRA 1GK8A 2A85A 3WMBA 3GR8A 3DHUA 3S9YA 1TX2A 1XC6A 5E5CA 6A3HA 4Q8UA 1V3IA 3F4CA 3H21A 4HSNA 2PDMA 1GQKA 2WANA 2O92A 2OSXA 4WD0A 2J47A 1Q6GA 3NSMA 4FLOA 1RD6A 4M19A 4TX9A 3TAKA 4J3TA 4UNLA 3LBMA 1LZOA 4CU7A 4V27A 4FNRA 3GTXA 3BSHA 4INFA 1VKFA 2FZMA 5CZKA 1RALA 2FPVA 2C3ZA 2ZUWA 1B5TA 5A3HA 2A7NA 4DPPA 1A3XA 2BX7A 1TVPA 1CB7B 2PMQA 5AHFA 1B3WA 2WM0A 1WO2A 3KP0A 3W82A 4EXQA 4GIAA 4G8TA 1BSLA 4JIRA 4DF1A 2CFFA 2ZUSA 5LKYA 4QE4A 5H1WA 4H6RA 1GVRA 1XD1A 3PBVA 1ICQA 3I10A 3R8RA 1OB0A 3QRHA 2A5HA 2VD9A 3ZZ1A 2VRJA 4OUIA 1T0OA 2WOQA 4JQ1A 1W8SA 2DVUA 4XB3A 3E1F1 4EIVA 4AZCA 1MWOA 5JIWA 9XIAA 1GVFA 5JH1A 3LBCA 2TAAA 3R2GA 3DFYA 3BW3A 3H7RA 3LN3A 1WDWA 1XD0A 1EP1A 2QCLA 3B97A 3WLOA 1TSIA 2W62A 3QGKC 5AVHA 1X6UA 5J8LA 1MRAA 3TNOA 3WK0A 3O16A 1AVAA 3MHFA 1UH2A 3P84A 3BCFA 1EBGA 3DYPA 3WEOA 1S46A 5C9XA 4B91A 4R33A 3QY8A 5LIUX 3ZXWA 1AQFA 2RJGA 1W17A 3QGVA 4HIBA 3ZT5A 2D0GA 2FHBA 4N7QA 1PTAA 1EQCA 1LOLA 1POJA 4F2TA 3OQ8A 4W7WA 3HO8A 3PZUA 1QOQA 1BWKA 4BZYA 2EPKX 4E4UA 4PTDA 2YX0A 4X9SA 4EPKA 2G3IA 1RV8A 3NO1A 4C6FA 1LT8A 3AMCA 3EX2A 4AW7A 1XLLA 3I7SA 3W1PA 2E5BA 1HW6A 3W2MA 3HURA 1GVSA 2Y85A 1HL2A 4O0QA 2PWHA 3AQUA 3LPFA 4L64A 2D2HA 5FSDC 1DIKA 1EOMA 1QNSA 3T81A 3TW9A 1HG3A 1XYCA 2JF7A 1KFKA 1ZBWA 3SZ8A 3G8RA 3NNTA 1QHPA 4C6MA 1H50A 2KAUC 5JBFA 1I60A 4HOWA 4H6KA 4AXKA 3S1VA 2VVSA 4IJCA 1MVYA 3AICA 3GNXA 2NXHA 2NQHA 4NL1A 3W71A 5M3WA 1W3KA 2WMJA 2YFNA 2PSNA 4QBXA 3NTYA 1K8CA 4X9YA 5I77A 5HJYA 4CKQA 1YPXA 2B7QA 4P8WA 3BJFA 3UFYA 1YXCA 4DZIA 1K1DA 1Q2RA 4HU0A 3EWZA 1XIFA 3PY2A 4XAPA 5CCZA 4I3GA 1Q7MA 4UZUA 1O68A 3ARPA 4HNLA 3CH0A 5BU9A 3PB2A 2FIQA 1E4NA 4NP7A 2XSBA 4W8AA 3P62A 4LBSA 4US5A 1YXYA 4X61A 4Z42C 2I5GA 1F76A 4KCWA 5G2WA 1BGAA 2GJPA 1TCDA 2Z1BA 5T9CE 3LXBA 2VRQA 2XIJA 3WBEA 7PTDA 1FWWA 3B9AA 5A1AA 3KE0A 3NQCA 2I1OA 4AVOA 5A94A 1LYXA 2WSYA 4GZIA 1ZBVA 3NEVA 3TIMA 1R7OA 2CLLA 3K8MA 1KNWA 1UPPA 1TQXA 3GR7A 1U2YA 4JTKA 3W7OA 5AC8A 1FX6A 3ZT6A 4MG4A 2YJQA 4GO9A 1O4UA 4JKKA 4KQNA 4C6OA 1J0HA 3EA3A 2D1ZA 2VVNA 3G1SA 1HKIA 3VDBA 3AI0A 4LAKA 3V1HA 5MHBA 2WBKA 2ZIDA 2E09A 1JFHA 4W87A 1F74A 2DZWA 2XZ9A 2YA1A 3ZQ9A 3FGCB 1H7XA 1H61A 1EP3A 2UY5A 3DBPA 1S3TC 2ALRA 3DGRA 3GB6A 3L7RA 4H7ZA 3GKFA 3FIGA 4AY8A 1O1HA 2PGFA 1CXHA 4GUHA 2EJ1A 3PANA 4URIA 4NNAA 2CLOA 5BWAA 3F4VA 1S1RA 3N17A 4E3VA 3GUWA 4ML4A 1WUFA 2VEFA 1QATA 1QI4A 4IGSA 1QW8A 3V4BA 5CZ0A 2CHRA 3WD2A 2C71A 3C0JA 4HU8A 3L4TA 5TQLA 2FTWA 4Z2IA 1A47A 3NVDA 4JFSA 1OGBA 4IX2A 1OK4A 4OJYA 3C0QA 2QJMA 3RX3A 4UOZA 4KRTA 2CLHA 3BGAA 1W1VA 5TF0A 4JEJA 3ZO9A 1JAKA 3EWBX 4GA8A 1TKKA 1XF0A 2ACUA 4LNYA 2WLYA 3AXMA 3OU8A 1DQXA 4HYWA 1VHCA 2EEXA 1OYAA 3W4RA 1W5NA 3U3HA 4GZEA 2YB1A 5U7SA 1XH1A 1H1NA 4GG9A 4LCRA 1XIIA 2ASHA 1UHVA 3BH4A 4K6AA 4QE5A 1LRQA 2V5JA 4AY7A 4JTUA 1OFPA 5E9AA 3VIIA 3OIXA 7TIMA 1K02A 1THFD 1BQCA 2XFRA 4F40A 1JCMP 2YR1A 3DC0A 4AF0A 1CEOA 4QHRA 2ABAA 3DYMA 4GINA 2XPKA 4FI4A 3EOSA 2Z7KA 1UOKA 2PWEA 3AMDA 2DSWA 4R9XA 3IJDA 3CIXA 2XN1A 1MFVA 3LCLA 3BW4A 1E0TA 4FZIA 4GKLA 3LSBA 2J27A 4F3HA 3DH7A 2Q3RA 4TXEA 4QG9A 4K36A 4FMVA 1A5LC 1ZZMA 3LERA 1FDJA 1O66A 1CGYA 1JPKA 1DQUA 1RJPA 4FOKA 2EKGA 3B40A 4C1NB 1CX9A 4PTVA 3GRIA 4H8UA 2HVMA 3CT7A 3FSTA 4E8CA 2Z2AA 4HQVA 5I3IA 5LIXX 1D3CA 5AOUA 4JHOA 4Q4OA 4I9JA 4H8HA 3P5ZA 2DT3A 2EG7A 3GXFA 3NIYA 2INFA 2ZXBA 4J40A 4IPNB 5M2FX 1HGWA 1CGUA 4A3UA 3FOKA 3HIJA 5I3KA 3AXHA 3LZ3A 4V28A 4Z1CA 4IMFA 1K70A 3SDOA 4HTYA 4S3GA 1KM0A 1LWJA 1UR9A 4C90A 3KBSA 3U2CA 3O0KA 3PNZA 1W6TA 3BXWA 1XPGA 3IACA 4HN4A 1E5JA 4BR1A 4H19A 3KWSA 1REQA 3WDHA 1VENA 1RPKA 1NH6A 4MMWA 1POKA 1ZSXA 4UQCA 3QYSA 3UYIA 4K38A 1J2BA 4RPPA 5G1TA 5KSWA 3SFKA 1UKSA 1G4PA 2CKSA 5DANA 3AYTA 1UUMA 1GGOA 4FOJA 5HINA 2INZA 4V33A 2ISFA 4QSFA 1PX4A 4TTGA 4J3ZA 1JPDX 4ZQRA 4JHMA 1LL4A 3F2CA 2OZ3A 2WV8A 5AYZA 2R1KA 4US5D 3FHAA 1YPIA 2ZX5A 2VXNA 3EYPA 1X1NA 3WUGA 4B5TA 3LEPA 2WQPA 3QW4B 4GK8A 2X42A 4AZCB 3ARXA 3M0ZA 1J18A 3KLLA 2EPMX 1IQ8A 3R25A 1KM5A 4UTTA 4CQ8A 3MI2A 4XAFA 3VM7A 1O5RA 4O8AA 3MHUA 5IDZA 5FESA 3RPDA 3MCNA 4GQ0A 1TVNA 3R7MA 4GYKA 1OM0A 1A5AA 4H2HA 4AZBA 4PTWA 3ITVA 1TX0A 5G1MA 2OCZA 4I5UA 4PUUA 2PDWA 4MYAA 1W1TA 2VX6A 1FHDA 1AQ0A 1VZWA 1OFRA 3NYDA 2VQUA 1M04A 3SCRA 4UFIA 4BHYA 2GQ9A 4XKMA 4ZO6A 1C91A 3CL7A 4NJHA 4PBGA 3SN4A 1Q66A 3DFPA 2A7RA 4XZWA 5A8GA 3NJ3A 1VCGA 4WKAA 1XW8A 2OELA 3RK8A 2VR4A 1JRCA 3VIJA 3CQIA 2Q01A 2ZICA 3ZR4A 3MA8A 3TC6A 4FXSA 4P2VA 3NURA 1VIWA 1L6GA 1UROA 4C65A 3DHPA 3CL6A 5KINA 1WOAA 1X96A 4KEZA 3UR7A 3EMZA 4F9DA 5HULA 4EPDC 3ARUA 3A12A 1PS9A 1E9LA 4GUIA 3WQWA 2QJGA 4KW2A 4TO8A 4BWLA 5BNKA 3MV11 4DIAA 3BSMA 1OY0A 5AZ1A 1V8EA 1O60A 3A9BA 3URAA 3KTSA 3WZ0E 1HJXA 1P6WA 4IG2B 5FL0A 2VZOA 4A8NA 2WSKA 4MWAA 4LT9A 1AJ0A 3FAXA 3IVSA 1FVPA 4NU7A 2QUUA 3APGA 3RLHA 2JFEX 3WK1A 2W6RA 1QNVA 1W37A 2FFCA 4MJMA 1GVIA 3S1GA 3N19B 1G01A 5D2WA 4K37A 3VNLA 1XYAA 1W9XA 5M17A 3LM7A 2E28A 3CJPA 3LCGA 3N34A 1IWBA 4UB9A 4O17A 2P8CA 4LVFA 4HCLA 1WX0A 4UQBA 4GX8A 3VKDA 4PZVA 1OVDA 4NG3A 3ITGA 3FLUA 4FLQA 3EDKA 2XGBA 2PDPA 3PPHA 2PWVA 1OABA 2PP1A 1F4AA 1E9IA 4Z17A 3WBYA 4DBDA 4DPQA 2CEQA 1TPB1 1TELA 5KMYA 1OD0A 4C6JA 2X2YA 2C0HA 3GXMA 2WHJA 3V18A 4IQEA 1RJRA 2Z28A 3OIHA 3WLQA 3K8LA 1JAEA 1ECEA 3CEPA 5AVNA 2C6QA 1DWIM 4V15A 3KBNA 1NVMA 3VILA 5A6MA 4C6KA 1RXOB 4LPCA 3NQFA 4EK7A 3B3DA 1VH7A 1ZCCA 5A8MA 3SR7A 2Y61A 2WVVA 4RCXA 2WZEA 4L61A 1P43A 1PEZA 4LRSA 1HX0A 3E49A 3ARSA 4W86A 3GVWA 1UPMB 2ESCA 2BP1A 4R5EA 4A3HA 2YYTA 4JTSA 4XIMA 1FXPA 1XYFA 4F2BA 1RP9A 4AB4A 2BY2A 1EUAA 3MY9A 3URQA 2YZ5A 4EACA 1EPXA 4AWUA 3SECA 1NELA 4L1WA 3U6WA 2NV1A 3B8UA 3LCXA 2AGKA 3PUOA 3WBXA 3BICA 2QF7A 3BUVA 1UUQA 2HRWA 3C56A 1JD9A 3TSDA 2HS6A 3KL5A 2INEA 4H2CA 5EMUA 2JIEA 4QS5A 3C2VA 3HPXA 4XAYA 4XZ9A 1FDZA 3W81A 4BJHA 1TA3A 3H7UA 6TAAA 4DJFD 3SW6A 1W91A 1VLIA 1FCQA 1GQLA 4J2MA 4XD6A 2VWSA 3L68A 1JPIA 3ZLFA 1V0KA 5G2IA 2OWWA 1BAGA 4ENLA 2PU0A 3GZAA 1QPOA 4PMNA 1XPYA 5CZJA 2F6UA 1SO4A 5H8MA 4ZQNA 2P3EA 3UETA 1E3ZA 2WZMA 3UZJA 4RZ4A 4H9ZA 4Y6GA 5K4ZA 4LEFA 2XH2A 1YQ2A 4DBWA 4L9XA 3G1RA 1LG2A 3C3NA 4F66A 4NI3A 3DERA 3TYZA 3UZ5A 2D24A 3AS2A 2VC6A 2XWEA 3O8AA 4AF0B 4YTSA 5CPSA 3B9DA 4MNKA 4Q32A 2OLHA 2WSPA 2ATSA 1HTIA 3A22A 1SUXA 4PN2A 4OWGA 3TJIA 3UWVA 2QPUA 1E0XA 2BS9A 4IISA 1V0NA 1HVXA 1JIBA 4ZMGA 1BXBA 4BEUA 5HJXA 4O1BA 1GYLA 1B31A 3OO2A 1IEWA 3D5HA 3TLQA 3G1DA 3DFSA 3NOYA 1AZ1A 2WO5A 4QGCA 1IIHA 1QOXA 1EPVA 2V0TA 4D72A 1DTUA 1BPLB 2AL1A 2PZNA 1XDJA 4D6HA 4KWOA 1EGZA 1Z3NA 2P53A 2ZXDA 1PL9A 4XD3A 2V30A 4ZQCA 3B8DA 4GOAA 3STEA 1EDTA 3AIEA 3RDKA 3UYCA 1DVJA 5CJ5A 2GDQA 4DAIA 2E6YA 1KQZA 1FWBC 4N9BA 1REQB 4MWAD 3GAKA 4CEUC 6REQB 3ANUA 5T9BG 5K3VA 4NZCA 4O13A 4UOQA 2OU4A 3ARTA 1T99A 3LI0A 2JE8A 2VFDA 4IFOA 3V5CA 4BI6A 3O0FA 5C2CA 1XKYA 3NQ2A 1E4MM 3H2MA 4FHAA 4IICA 2QS8A 1SO6A 1MI3A 3C3UA 4H00A 3W6MA 5F7UA 2OEJA 2WKLA 3E2SA 4F79A 2NV9A 1FWRA 1NFGA 4AYSA 3VNZA 2FGBA 4IPPA 4F0SA 3RLGA 4KRUA 4CNSA 3UG5A 3WCZA 1QI5A 2GWNA 4AD1A 2ZUTA 3H2AA 3AAMA 2Y5EA 1XDMA 3B0PA 4N42A 4IX0A 1SZNA 4GMEA 5FSEC 2VZUA 3PBMA 4BF7A 1CNVA 3O9NA 2HPMA 3TP4A 1S2UA 2JBMA 3RILA 1MEHA 4ZO8A 1DXIA 3NPWA 5CBIA 2WMGA 2G41A 1QK0A 4NYYA 2GVJA 2ZE0A 1JEZA 1LQ2A 4AX6A 3QYQA 1XG4A 1TPFA 3I3EA 1K03A 3KCOA 1XLFA 3PZIA 3LA4A 2DZSA 1MDLA 3U57A 2W79A 3EOEA 2X30A 3SFWA 4HP5A 3KRBA 3HV9A