3CQKA

Crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ and sulfate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
276
structure length
276
Chain Sequence
QIPLGIYEKALPAGECWLERLQLAKTLGFDFVEMSVDETDERLSRLDWSREQRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAEVAKARDWVKARMAKAGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ribulose-5-phosphate 3-epimerase ulaE
publication title Structure of L-xylulose-5-Phosphate 3-epimerase (UlaE) from the anaerobic L-ascorbate utilization pathway of Escherichia coli: identification of a novel phosphate binding motif within a TIM barrel fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 114
structure length 276
sequence length 276
chains with identical sequence B
ec nomenclature ec 5.1.3.22: L-ribulose-5-phosphate 3-epimerase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3cqkA00
4XSLA 2Q02A 3CQIA 3M0HA 3UA3A 3UVAA 3XISA 3BZGA 4GJJA 5I7GA 1MNZA 3BANA 3BZJA 3M0XA 3QXBA 3CWHA 4A8LA 3UU0A 5J8LA 4X60A 3ITLA 2XIMA 3M0LA 3M0YA 2I56A 1XLBA 4Q7IA 3U3HA 1XLJA 1XYAA 1XYBA 3L23A 1XISA 1D8WA 2HK1A 2X7WA 4US6A 4DUOA 4QEHA 4E3VA 5TNVA 4A8RA 1XLHA 2OU4A 4KW2A 3TVAA 2G4JA 4GJIA 9XIMA 3KBNA 2QULA 3VNKA 4X63A 2X7VA 1K77A 1QTWA 1XYMA 4OVXA 3XINA 4EAYA 5C9ZA 1A0DA 5AVNA 1YX1A 3VNIA 1XIMA 3ITOA 2QUMA 5XIMA 3VNMA 3OBEA 2GUBA 1A0CA 3CQKA 5FA5A 1S5MA 5AVHA 3AYTA 2ZDSA 1XLFA 5EMJA 3DX5A 4QE4A 3VNJA 4XIMA 1XLMA 3LMZA 5EMKA 5EMMA 1XLCA 1DE6A 3VYLA 8XIMA 4HNOA 4PGLA 4A8NA 1XIGA 2QW5A 1XLEA 1I6NA 3KWSA 1DXIA 4XISA 4EACA 2NQ9A 1QT1A 1XIBA 4GQBA 4ZB2A 2HCVA 4YTRA 1XYLA 3WQOA 4A8IA 4GLEA 3KCOA 1GW9A 1QUMA 1DIDA 4G56A 1TZ9A 4X61A 2HK0A 1DE5A 2J6VA 5B80A 3NGFA 1A0EA 3GNXA 3ITTA 3KCLA 3M0MA 4QDWA 3CQJA 1MUWA 1BXBA 1CLKA 3N4AA 3AYVA 3KBJA 3QYSA 1XINA 4QE1A 5XINA 4YTQA 4QE5A 3BWWA 3KBSA 4QDPA 5XIAA 2QUNA 1XICA 1XYCA 4XKMA 8XIAA 4XSMA 7XIMA 3CNYA 1XIIA 5EMLA 1OADA 3KBVA 1XIDA 1XIHA 3P14A 4HHMA 1XLKA 4K3ZA 3XIMA 6XIMA 1O1HA 1I60A 4ZB0A 5B7ZA 1XIEA 2GLKA 4HGXA 3AALA 3AAMA 1DIEA 6XIAA 3VNLA 3UA4A 2XISA 4J4KA 4W4QA 3KBMA 3QZAA 3IUDA 3M0VA 5H1WA 4PFHA 3CQHA 3QC0A 3UXIA 1XLIA 3ITYA 2NQJA 3C0SA 5B7YA 2XINA 1XLAA 9XIAA 3KTCA 4YTTA 4YTSA 3DBNA 4ZBCA 2I57A 4QEEA 1XLGA 2G0WA 2NQHA 3TC3A 3JU2A 3P6LA 3FVMA 4XIAA 1S5NA 3ITXA 1XLDA 4YTUA 1XIJA 4DVOA 3IUHA 3KBWA 3C0LA 3BDKA 3IUIA 5H6HA 2GVEA 2GYIA 3ITVA 3U0HA 3KCJA 1XLLA 2ZVRA 1XIFA 4HHLA 1BXCA 4ZB5A 4K1GA 3C0QA 4LNCA 1XP3A
chains in the Genus database with same CATH superfamily
1F73A 1C93A 3CHDA 4POCA 3EKLA 2BZNA 3CT7A 2DIKA 1KFBA 3T07A 2ZE0A 2R9RA 3RU8X 3W81A 1UWQA 3NL5A 5A8GA 4JIEA 2V2HA 3RM4A 5G2WA 2ZQ0A 2HK1A 2HS6A 2I5GA 2WC7A 5A1AA 5CJNA 4DWSD 1YNQA 2OSWA 4A35A 2GWNA 1BVZA 4LYPA 4FXJA 4IIDA 2A3CA 3CMGA 4BI5A 1KCXA 2HNHA 5GVJA 1TSIA 2GDVA 2JEPA 3LU2A 4LYKA 1QOPA 3DDMA 3NZQA 5EL1A 1GTEA 4JFSA 3WQFA 2FZMA 3TE9A 2YCJA 4UR7A 4IP5A 3LCXA 1AJ2A 1E4IA 1UWRA 2J47A 1TYGA 3MS8A 1YEYA 3LRKA 3WO8A 2R8WA 3L5MA 1Q85A 3DKJA 5D2WA 1XIEA 4PSRA 3HURA 3ABRA 1UQYA 3QJAA 3T6CA 4Q4PA 2VP8A 1XBVA 5LA0A 2OR2A 2XVGA 2Y7FA 3L4XA 4FLSA 2CITA 3C8NA 2QVHA 3OGRA 3S8HA 2V63A 2YXGA 2PZNA 2RDWA 3VIGA 2H3DA 1Y8BA 3OGSA 3R43A 1E4NA 4QLKA 3GNOA 4JTKA 1BF2A 2QR6A 1KM4A 4KGLA 2VTFA 3BSHA 1D3CA 2E6AA 3IEBA 2E6FA 2ABBA 1E6XM 5RUBA 2PDYA 2O7QA 3KBNA 4TVUA 2PDXA 1E5NA 2C91A 3I7RA 3I4EA 4LYQA 1Z6KA 5BROA 3T78A 4NZJA 1YRRA 1TTIA 2QGHA 4XV0A 4GRSA 1ZJBA 1E0VA 1CGWA 3PR2A 1VZWA 2OQLA 4I9AA 3WEOA 1XRSA 1M7JA 1VFUA 2VWSA 1EPXA 1NELA 1QHPA 3NR0A 1EP2A 1DJWA 3O6CA 1LOLA 4GI4A 5FF7A 3UA4A 3IS4A 1DJQA 1EEXA 3W74A 2ZX6A 1GEHA 4XO6A 1XKYA 2W62A 2VEGA 2OEMA 1F74A 4ZOBA 3QV7A 5CPTA 4MJ2A 4LW7A 3PBGA 4ZQMA 4C1LA 3EX3A 1M7OA 4O12A 3VM7A 3I3BA 4OV9A 2Q8LA 2A1YA 3W02A 3HV9A 2E0PA 3B4UA 5A6LA 4HJWA 3BCFA 1UWUA 3SRKA 2DZWA 1R38A 3EOEA 3SFKA 3CPGA 4DY1A 5PTDA 1E71M 1VLWA 5C70A 4LBUA 5BXPA 4L65A 3AIQA 4IGHA 1VKFA 4DZIA 3NAVA 4C6PA 2G3NA 2QUVA 3T08A 5HMEA 3W7CA 1GYMA 3QHMA 2QUMA 2QAFA 3EA2A 4D6IA 3GIQA 1DJYA 1FA2A 3N9KA 1EGVA 3MV11 1FFRA 3O0KA 3L4WA 2V38A 3M4HA 3B0UX 3DHDA 3O05A 3TQ0A 3ZJKA 4YL2A 1TJPA 3B97A 3TYEA 3GNXA 1JAKA 4B5XA 1BXBA 1ZALA 1CZ1A 1GNXA 4MNLA 3KUMA 5CPLA 1E0UA 1QBBA 4DYEA 3P14A 2A7NA 3QQ1A 2FJKA 4PMDA 2V2CA 3TUUA 2DSVA 4E4PA 4P8WA 6CGTA 1OWQA 1JF5A 3OYXA 1RP8A 3UCDA 3UXIA 3JS3A 5B7YA 4H3DA 3TC6A 3QKEA 2ZA2A 1FRBA 2GSEA 2NQHA 5GQBA 1GVIA 3WLTA 1I2RA 1DYSA 4QJ5B 4KWOA 5I24A 4UFMA 3QQWA 4KCWA 7TAAA 3QLDA 1GOMA 1ZJHA 5M5DA 3W2LA 1E15A 1UKSA 1DTNA 2ZADA 4J1OA 4J2MA 1QRQA 1TWDA 5BRBA 3CWHA 3H54A 4F9JA 1R3VA 4KEVA 4LEFA 2PTXA 4HCDA 5HATA 3CAQA 2F6XA 3H7VA 5JMUA 1P4CA 3GDLA 1LQ0A 1FWSA 4C6OA 5F2GA 2OMAA 4M6PA 2O9RA 4B2DD 1XYMA 4H8NA 1EZ2A 1UP0A 4JNMA 4URIA 4XAZA 2ACRA 3AC0A 4JPGA 2EEXA 1H7OA 2VNCA 4DYJA 4P7RA 3HPSA 4KEUA 4KEMA 4MNKA 1H7RA 4FIRA 5DRCA 2RH9A 2FVKA 2ZRXA 2NX1A 4QXIA 2HK0A 3TYDA 1ICSA 1E0TA 1PL9A 2W4XA 1ELSA 3MI6A 1S5TA 2YA2A 3P67A 4JN6A 4H19A 1N7KA 2CW6A 3GVWA 3SB0A 3TEVA 1OYAA 3HB9A 3V16A 4I7VA 3ARUA 4HMEA 4HP5A 1ZFJA 1V93A 2FZNA 1FWJC 1TJ0A 2VEFA 4HK5A 3TAKA 1M41A 1AFSA 3B8IA 4FR1A 3PNUA 1CXIA 4O18A 2D2GA 4V1XA 2NUYA 4UC5A 1P0NA 1RPXA 3MHUA 1H51A 2A3EA 4ZEPA 4MJ4A 1IEWA 4PMNA 1DQWA 3RF9A 1FWBC 3PG9A 3LGGA 3G8EA 1TPUA 3MDUA 4Z2KA 1PZ3A 3H2MA 4LPCA 3BGJA 1F07A 4AUBA 4DLMA 4DJDD 1CT5A 4IQLA 4HD5A 3RR1A 3C2FA 3HF3A 3E02A 5D05A 1LL4A 1KWKA 3VD4A 3E49A 2VT0A 2QW5A 4GZIA 3TSDA 1LBFA 1PJ9A 2VO5A 4ALDA 3T4CA 2E3ZA 1J96A 1QW8A 2VX6A 3EB3A 1BG9A 1LYXA 2ZUWA 4A2SA 2CLOA 2Z28A 2OKTA 3SUWA 4MWAB 4ACZA 3ABOA 4C6EA 1W5NA 1B4KA 1FQ0A 4RE3A 4GYPA 3S6TA 3WBAA 1R3RA 1B4EA 3QMSA 5FD0A 1JQXA 3PSVA 1F3XA 4LF2A 1HUVA 2DZAA 3M0VA 5A8MA 3CQHA 1P43A 3T0AA 3M6YA 4QEEA 1Q3NA 3RCNA 5DN1A 4E2BA 3UPMA 4Q7NA 1JDAA 5BWAA 2QT3A 3P6LA 2GL5A 3A21A 3QH2A 1KR1A 2V9DA 4B15A 1QW9A 4J40A 1TX2A 1SJAA 2ZBTA 4CNPA 2UBPC 1GQNA 4G1NA 2DW7A 3N6QA 3PZTA 1UKOA 1B9ZA 4DRSA 1BPLB 4AIBA 5DCDA 1MZRA 3BSMA 3R4IA 3BPWA 2J9ZA 4M19A 4ZO9A 2CZVA 4BHYA 2ADAA 2QULA 3W9ZA 2VEPA 1BKHA 5LNSA 3KP0A 2QMJA 3W1XA 1UP3A 1PKMA 2G37A 1KM3A 3W01A 3K8MA 4HHPA 3DN5A 1XG4A 3QW4B 3EDEA 1J79A 1E73M 4GNKB 2CETA 1IEXA 1S2CA 1Q2RA 1AH0A 3DFOA 4HB7A 3WQPA 1H3GA 3PULA 5C71A 1TCDA 3MI3A 4AZCB 1R87A 3GNRA 1I1XA 1C29A 3W26A 1Q65A 2PEVA 3GAYA 3R7MA 2IKHA 2CERA 1IIHA 3QC0A 4LAOA 1AJZA 3QPZA 3LB0A 3LCIA 4CCDA 4G9PA 1SW0A 3KLKA 4PTXA 4CN4A 3IJ7A 3AUOA 5FESA 3SUUA 4IX2A 2E5DA 3HIJA 1LBLA 3BMVA 4XSLA 1EO7A 2WPGA 2ISWA 4MSSA 5LXXA 1TWIA 2CZ5A 4QP0A 3SCPA 4RKAA 1VFFA 4ONVA 2BODX 1XCFA 3VOIA 9CGTA 4YU1A 3GNNA 5TBOA 4LUSA 4DI8A 3EPNA 1UH3A 3PWAA 4FLOA 1GVOA 4MPQA 1PIFA 4H6EA 4HK7A 2GJXB 1JULA 1T5AA 3NOEA 1RV8A 4R34A 1RUSA 3CB3A 2EG8A 4GYFA 1RXOB 1T7LA 2EJ1A 2F38A 4ADTA 2JFEX 3NQVA 2X1SA 2OYLA 1VLIA 4RZ6A 4XBKA 3NQFA 1WV2A 2PC4A 2FH6A 2YL8A 2Z2AA 1XYCA 5DCBA 2QDGA 4NG3A 4D6JA 1OADA 1EGMA 3UZXA 1TVLA 1PE1A 2YDQA 2Z1BA 1XC4A 4HYVA 4JIIX 1WOAA 1UJQA 3BLLA 1IQ8A 4YTTA 3TXVA 4HSNA 4YPJA 3IK2A 2WSQA 2A85A 1RBAA 3UCCA 3GVQA 4XZLX 3RM9A 3WD4A 4NX0A 4UTTA 2QDHA 3TKFA 4HNUA 3PB2A 3OG2A 1FWHC 1G5AA 3M5VA 4AHOA 3XISA 4MTVA 2E9BA 1L6FA 2EPHA 1A5OC 3O0FA 4NVTA 1M5WA 4GY0A 3CAWA 1GORA 3N2XA 3QR3A 4UMBA 1SSDA 4GYJA 1KV8A 3F1QA 4IF2A 4DM1A 1K4GA 1W37A 1GKRA 3VGBA 5M03A 2F84A 4JNZA 3MUY1 4HA1A 5AHIA 2QYGA 1OK4A 2YX0A 3K30A 2FB2A 3HQ1A 4GX9A 3PTDA 3S2JA 3OIXA 3GXTA 3DCPA 2DZUA 4ENLA 3B9AA 3HV8A 1A4MA 4AWUA 2R1MA 5E6YA 1X7FA 1HKMA 4DO6A 3GTNA 4DUVA 2CLKA 5I3DA 3GHUA 2OX1A 3T7VA 3NJ3A 1A5SA 1UIOA 3LS9A 2AL2B 4AZBA 4D6DA 3BLDA 2PLKA 2ZCGA 3CZLA 4TVDA 4IIHA 2RDXA 3ID7A 3SSZA 2DZPA 4LY8A 4OECA 5G5IA 5AYZA 2WJFA 4PTMA 3GC4A 2A3BA 1JI1A 2FHBA 4WDXA 3PZIA 5H8MA 5HOSA 2JIEA 3PB0A 1AD4A 2OODA 4LAUA 1DORA 4K1GA 3N73A 2WJZA 3B40A 3GYEA 3B8DA 3P5YA 4DZHA 4TTGA 3QXBA 4W86A 5TQLA 4RX0A 3L4TA 4B5SA 1KTNA 4AQLA 3VKDA 3NVTA 4MKVA 3KHJA 3QF0A 2OYMA 2P88A 3AXHA 2VM8A 3PVFA 3WH9A 2QCDB 2V3DA 2ZVIA 4TX8A 5H2ZA 1VBGA 3M43A 5G4WA 4N02A 3RN6A 1XH1A 4CQAA 4R27A 3CIWA 3H2NA 5HMSA 1BTMA 1YNPA 2XZ9A 4FEZA 2J27A 4S3JA 2WAGA 4PMXA 1B57A 4QRNA 4C60A 2VUYA 5AC5A 4MADA 3BSGA 1A5UA 1GW9A 3N2BA 1JDDA 5FJRA 5I6SA 4KKXA 3NPVA 1JAEA 2X2GA 3A6OA 2C16A 1TKKA 1JD7A 4HIBA 1JUKA 4TIMA 1HL2A 1K8ZA 3S47A 3ERPA 4PUEA 1MDRA 3K13A 1DIEA 1KA9F 3N6JA 2AKZA 1IHIA 4NJJA 3FJ6A 1E43A 4IFKA 4HBKA 4M5PA 4XZIA 1MNSA 3OHMB 3S0CA 1QCWA 1JZ6A 4NYUA 1H5YA 3SQLA 3WD2A 4QSFA 1LCOA 1FWNA 1QPRA 3TONA 3WYZA 2FIQA 2VOTA 4PCTA 4RE0A 5HBFA 3QYQA 3CHFA 4IMFA 1UG6A 3SZ8A 4EPBC 4JBRA 4WOQA 1IZJA 4OV4A 5GNXA 5CG0A 1WAWA 3VNDA 3W2KA 1I45A 4PUNA 5D9MA 2WM1A 3HG3A 2FPVA 1VGAA 1E4MM 1TA3B 3AOFA 1EEPA 3EWWA 4R88A 2WCAA 1NM9A 3NSXA 1D8WA 4MB3A 2G95A 3JW7A 1BYCA 3ZFHA 3LHTA 4GYPC 2X16A 1QNVA 3AXXA 3IJ6A 2WNNA 4ZTXA 2NV2A 1PWMA 2GSHA 3C2OA 3H4XA 3CUGA 1UD8A 2QCGA 2E67A 1U30A 4ZE4A 1XCXA 1VBJA 1N8WA 4B5TA 4NP7A 3DBPA 4PB4A 4B5UA 1VIZA 1XUZA 3NQ6A 2RJHA 1K6AA 1A5KC 2ATSA 3KVJA 3O15A 5E09A 4BQ3A 1DE5A 3TQVA 1XFBA 3KCLA 3UZ5A 4C91A 4BKNA 1JCJA 3STGA 1BAGA 3NO3A 1TPB1 1VH7A 3AYSA 5FJIA 2CPUA 1L9WA 3F4WA 4GFSA 4YHEA 3GSMA 4GX8A 2PSNA 1TCMA 2V68A 3R0UA 4EK7A 3GDTA 2Q09A 3NZGA 2F61A 2OZ0A 3ABSA 4DN1A 3VK5A 3BUVA 1M7PA 4GKLA 1HQTA 3WNOA 2PWDA 1TMLA 4IFOA 2FMNA 1KXVA 1PX3A 4FF5A 1O5RA 3ABQA 2BFGA 4ZL1A 4E38A 3STFA 4S3DA 4LTSA 3RLVA 3LGDA 1ITCA 3WFZA 3DH7A 5C7VA 1IZKA 3DFYA 3N15A 1X8FA 1G1YA 2EPLX 3RDKA 3G1FA 3NL3A 1F5ZA 8RUCA 1JCLA 1MO0A 3NZRA 3E38A 1Y7VA 4QQ3A 1IR1A 3F03K 2Z0IA 3RX2A 5H8PA 2O56A 3QSTA 1EH9A 4R33A 3VKKA 1YTKA 1NIUA 2FHFA 1MQPA 4XVDA 2IUZA 4D71A 3LM7A 2ZC8A 3WLJA 3WDIA 4O0KA 3W37A 3TIMA 3TFXA 3FEQA 2I17A 3WBEA 6PTDA 3R0KA 1XH0A 1TR1A 5CZKA 3W76A 4AAJA 4J3TA 4UTIA 3MA8A 4WY0B 2Y85A 4AHPA 3EA3A 3SCOA 2EPKX 1X38A 1ZY9A 4M0XA 3ES7A 3TZNA 3MJMA 5HK4A 2E6DA 3W24A 4PB5A 1L2UA 3IVSA 2V30A 3GFZA 5CLWA 1Z8AA 3HN3A 1DTUA 2XINA 3KDNA 3BOLA 2D2OA 1Y0EA 3JU2A 1TE1A 1T41A 4IIBA 4WDWA 4Y90A 3AZTA 4YTUA 4XD4A 2ZC1A 3VMPA 1C90A 2A21A 1RSCA 2KX9A 2VRQA 4IG2A 3NG3A 5KEZA 4E2OA 3SIMA 2PAJA 1OT1A 5HR6A 3SECA 4LFYA 1EUNA 1OZMA 3G2GA 3WL0A 3PJUA 4XAFA 8TIMA 4GUGA 2OX4A 2EQDA 2XSAA 6A3HA 5LA2A 4BI7A 3C3UA 4WF7A 4CQ8A 3P80A 4QM1A 3LPPA 1FCQA 2OQHA 3T1GA 3EPOA 5I06A 3BAWA 2Y1HA 3GK0A 3WH7A 1SJDA 3RPDA 1FDJA 4Q33A 1VFTA 3OQEA 1GOIA 1JIBA 2IMRA 3OBAA 3KP1A 5K9DA 2J78A 1S2VA 3RLUA 5F2LA 4UTTC 2GOUA 2H9AA 4HU8A 2WLZA 3WJYA 3Q2DA 1VEMA 1ZTVA 3FHAA 4G5DA 4J5NA 1WAUA 1F4HA 4CLMA 3OVPA 1CLVA 1I8JA 2BX7A 3PPCA 4HTBA 2A7PA 3AAMA 3TNOA 3IV8A 4PE8A 4J4KA 4J2PA 2YLLA 3BW4A 1OG0A 2I1OA 4S3EA 4H04A 3W71A 3LMYA 2PDJA 3VFCA 4V28A 2IQ0A 2X0HA 2Z24A 2NVCA 1KRAC 3H2FA 2Z27A 4JIHA 5AC7A 5JBFA 5E70A 1Q8JA 4IUOA 5CPNA 2WPBA 1BYAA 2QPUA 4WVXA 1BHGA 3WMSA 4EE9A 1W91A 4NZ1A 3KRUA 1ME8A 2FDMA 2ISSA 4Z1CA 2QJMA 2XFYA 3AMDA 3BLKA 4FS9A 1XUUA 9RUBA 4O4VA 4O17A 3ZIZA 1Q45A 3QMTA 1MW0A 1ZAHA 3VD7A 4XZNX 1J0IA 3WLNA 1YE4A 4O11A 4DAFA 3N2MA 1JZ4A 3N34A 1H7NA 1KBIA 3L0GA 1LWIA 2BP1A 3IAQA 2Q8ZA 4RXFA 2WCSA 3O6YX 2CLLA 4LB4A 2QVNA 2X0SA 1B90A 2XG9A 1GG1A 2GDQA 4TQTA 2VRJA 5G2IA 1A5LC 1RBLA 3G3DA 1XL9A 1F61A 2P76A 1GTHA 3CASA 3SY5A 5I5RA 3NQ2A 1JYXA 2PP0A 4D6HA 2J7GA 3EWYA 2J9XA 3V75A 2EJAA 4PCPA 2NXGA 3KDOA 3AS0A 4K7VA 2WWCA 3QBUA 3SSJA 3NPUA 3SDOA 4ZB5A 4MY9A 1W5QA 3S1GA 3UFYA 1B5TA 2PDMA 1IWPA 2BVTA 4EXAA 3MHGA 4GIAA 2OGJA 2HWGA 4FNQA 3S5OA 3M64A 1OINA 2XVLA 3LA4A 4W8BA 3S42A 4WKAA 4A3HA 2ZZ2A 1S5VA 4I3GA 1TV3A 2YSWA 3EA1A 4B9ZA 3MC5A 3T44A 4PMQA 1OYBA 4ZO7A 3F2CA 2VEIA 3LPFA 3VGEA 1EYWA 4A05A 4XZHA 6ENLA 2XH7A 1HP4A 4I7UA 3W72A 1XD0A 3CQ0A 3UCQA 1W1IE 3IIVA 4QCEA 2HVMA 2WSPA 2PWEA 1H63A 3IJIA 2FFCA 5IFTA 4NI8A 4DO4A 3WEZA 4WY0F 1U5HA 3PK7A 1PX4A 3B0PA 4ASTA 4JAWA 1SFJA 1MFVA 3AXMA 1MRQA 2QCNA 3UR5A 4JYDA 3A4AA 2J8FA 2HS8A 4H9ZA 2YBTA 1KFEA 1XIDA 4H41A 4P7NA 1VFSA 3FLUA 3RITA 2WK2A 3EMCA 3GR8A 2D73A 4RLIA 3GH7A 5MHBA 2V81A 2NQZA 7REQA 3DC8A 4M3PA 4XZWA 4J3UA 4ZOCA 4CQBA 3SRFA 4B9YA 4UNIA 1IGWA 3EX1A 2TSYA 4UOJA 4CQ9A 1ISXA 3BDKA 4XB3A 2O4MA 3D3AA 1EB3A 3N6HA 4Q8MA 3LZ3A 3MKKA 5JIPA 1NARA 1ZAJA 1BWKA 2RGMA 3WL1A 1YQ2A 5DBUA 3UP8A 5T9BG 1JD9A 2P3EA 1CGVA 2KAUC 3Q4DA 1NP0A 4H7CA 4AD5A 2JK2A 4WJ8A 2OOFA 4H1ZA 3TDFA 1Q6DA 3LZ5A 3O63A 5A6KA 3B05A 5FF3A 3UWVA 3LG3A 4GY1A 4LCRA 3ZO9A 1KLZA 2ZTJA 5C55A 2C15A 2GZXA 5C9RA 1ZQ5A 5D03A 2W5FA 3WJXA 5CH9A 1XDMA 1V0NA 4YJ5A 1OSEA 1MRAA 4P2VA 3BTNA 1T8XA 4IT1A 2PTDA 3KBVA 1TRDA 2ZWYA 6XIMA 3G1DA 4V15A 2CHNA 4LALA 3I7QA 3HBLA 1QI2A 4RW5A 3DAQA 2Z6JA 3AXIA 5DY2A 2OWWA 4FOJA 2DW6A 1JPIA 1H41A 2IPFA 3PBUA 2E9MA 4A3QA 1W1YA 1FH7A 1HX0A 1V0KA 3HU7A 3QC3A 5A8OA 1A49A 3WENA 5FAJA 2GFTA 1EYEA 3WLQA 4DBWA 3STCA 4Q3MA 1H11A 3BOFA 1O95A 2P0IA 4DO7A 1FCUA 1O5QA 3WK3A 3LXAA 1OGBA 2FPTA 1VBRA 3GTXA 1RR2A 1HVQA 4NZ5A 1KM1A 1MXSA 4L9XA 4WSJA 1VJSA 3TC7A 3UG8A 4DIAA 4M82A 3GQYA 4IMDA 4DX3A 2PURA 4JIQA 3EWZA 1FBAA 4INFA 3ITCA 3LCLA 1V5XA 3S83A 3W7OA 3H70A 4AVOA 2AMGA 3QHNA 4AWEA 3VKJA 8CGTA 4LOCA 3B8UA 1UA7A 3M41A 2ZZ3A 3SR7A 4HCLA 2BOGX 5FEXA 3MSGA 3KOYA 1J5SA 3IJ9A 3BMXA 3I6RA 1XIGA 1EWEA 4EAMA 3KWSA 4KIRA 2PU1A 4H00A 4TR9A 4A2RA 1WZLA 4L6DA 1OFPA 3S5SA 3BJTA 4QAWA 3FYYA 4PMZA 2X1IA 2FZBA 4C6JA 8XIAA 4XSMA 4DF0A 3SFWA 3IVUA 4IJBA 2AGTA 3WMLA 2FZDA 2FJUB 4RCXA 4DJFA 1J6PA 4O1EA 4GUHA 2PWFA 3OVRA 2UV8G 2ALRA 2D20A 3T40A 2JALA 2DU2A 3SCQA 1R30A 3ITYA 4L4LA 1Z41A 2VZVA 1PSCA 2NV9A 4U2YA 5D02A 3FV9A 3ALGA 1CWYA 1XH2A 4V2XA 1EZWA 2GVEA 1FXQA 3M5YA 5REQA 3RPMA 1FOBA 2CC0A 4P5UA 3E2RA 3F4VA 3GXPA 2XWEA 4IQEA 4JKKA 4W89A 1HJWA 3B03A 3FN9A 3I3EA 4A8LA 5A6SA 4JFVA 1Q6FA 3PJTA 5K7JA 4C6IA 5FCZA 3N29A 2G50A 1B3XA 4J35A 3U8GA 3W6LA 1NFPA 1UJPA 4GCAA 5AYIA 1KKRA 4O13A 4XTDA 2VZOA 5C9ZA 3SCWA 4CQCA 1SZFA 1GVEA 5F4SA 2A6LA 3JZEA 3FA5A 3C86A 3K4DA 3UJSA 4XQ6A 1A4LA 5FA5A 3ZVHA 4N42A 5E6ZA 4Q4RA 3RX4A 4U28A 3CH9A 2KZHA 4HN8A 4EACA 3LHYA 1EJUC 4YCPA 2AQOA 5CLTA 4R85A 2V5KA 1YDYA 1TPH1 1VRDA 4GUJA 3GC5A 4LXFA 2CBVA 5U4NA 4FF7A 4DO5A 3N1AA 3T4WA 4NRRA 1UWAA 1OFEA 4TX6A 4S23A 3IIZA 4ZB0A 4MZ1A 4AFYA 3WDPP 2ZICA 4XD5A 5GPRA 2C6QA 4G7EB 1A5BA 2DT3A 3O06A 4PFHA 3B9OA 3CMJA 4C7DA 1ADOA 3BV4A 3GX9A 3UR2A 4AC7C 3T42A 1ECQA 1EJWC 3TWBA 4FSAA 1EXPA 1GHSA 3NDYA 3PZGA 4PUDA 2J7CA 1REQA 2R82A 1GOXA 1PIIA 1LG1A 1XRFA 1RJRA 1JGIA 3O6AA 3CPUA 2B0MA 5J8LA 4CNSA 3MCMA 1O5KA 2FH8A 4K2SA 4C6KA 2RFGA 4UBPC 4CEUC 3LERA 2ACSA 2RAGA 2BY3A 3URQA 3NDZA 4C7FA 4OT7A 4EAYA 4L1WA 3GHTA 1NWSA 3TJIA 1B1YA 1E51A 4BEQA 2NW0A 3BW3A 4Z42C 5AHMA 4C5YA 3BLPX 3T8LA 1FH8A 1RCOB 3VNJA 4XAPA 2BGNE 4KS0A 3SRDA 4Y2WA 3QOMA 4HTYA 2P3ZA 4RXGA 3PFRA 5BRQA 4YTRA 3LBCA 1JZ2A 2GK1A 4JL1A 1OGGA 4ZE5A 2DSKA 3CGTA 3N4AA 3W7HA 4AIOA 3V3WA 2ZX8A 5XIAA 2WMJA 1HTIA 4H6RA 3R12A 3QV9A 2V6AA 3RO8A 3FHQA 1S1RA 4Y6GA 2WOQA 3MYOA 5AHLA 3M46A 3W1QA 1R5YA 4AMCA 3W29A 3VD9A 1XF0A 4Q4SA 4DUWA 4KBXA 5C2CA 3BARA 2NSXA 3G1AA 2J7HA 3AHVA 1CCWB 4L56A 3G77A 5CSSA 3Q37A 4GGHA 4ACZB 3GG7A 1I2OA 4FAMA 4O0ZA 2BHYA 4N9BA 2ISFA 5LIKX 1T0OA 4LC8A 1FFQA 4U33A 3W86A 2YFNA 1J01A 2DDXA 1UP2A 2YCEA 4MMWA 4UTKA 3VE7A 2GVGA 5HJYA 1MNZA 1AA1B 1HO4A 5HWJA 1T40A 2WYSA 2E8YA 1CXFA 4XWUA 1UMYA 3W1AA 1ZNNA 7A3HA 2QV5A 2WMIA 1IEQA 3MVIA 4E3VA 3DEQA 1BYDA 2UY2A 1LQAA 1THFD 2XH0A 1Y5VA 1CGUA 1PBGA 4IGSA 3CO8A 1CX9A 3LTPA 3ARVA 1TE6A 1ZBCA 2X2YA 3D5HA 4B91A 4O10A 1OD8A 2PCEA 5AHNA 4LV4A 2NWSA 1A3HA 4DYKA 1SM9A 5B80A 5D38A 2WANA 4QQUA 3ITTA 5BWFA 1E6RA 1MUWA 3MHFA 4WXYA 2E7FA 2YDAA 3WF1A 3E2SA 1XI3A 1ZUAX 3MV01 1CXEA 3NWRA 3V1PA 2C13A 5A6JA 3UWZA 5I00A 1L6GA 2GJPA 2CHRA 1VEOA 3UG3A 3W85A 3EYPA 4ICNA 1VCVA 3W7MA 4F4RA 1VS1A 3D46A 3DIPA 1M6JA 5AKQA 1I4NA 4NQ1A 5CAKA 1TQJA 2QPXA 3A24A 5DMYA 1RZMA 2Y8KA 5FJJA 3SY1A 4PMRA 3ISIX 1E5JA 2PZ0A 3TFCA 3MDWA 3E96A 1KCKA 1GJPA 3BZGA 4C1NA 2J66A 2PI6A 5C9XA 2Q3OA 3G1VA 2XU2A 1EQPA 4DQWA 3UY7A 3UBPC 5I02A 4D6CA 1QO5A 3LQGA 1AW2A 2X09A 3WNNA 4WZHA 1VJZA 3GTHA 4LRTA 1O6IA 4IPLA 3VIKA 2WCGA 4H9UA 5FSDC 1K8XA 2DY3A 3ATZA 3VX0A 4UTFA 3AIBA 2BBFA 1M65A 1H0IA 3G1SA 3O16A 4DPQA 1VFHA 1GVYA 2ZUSA 4EKJA 1FWAC 2OB3A 4LUSB 3N9SA 1TZ9A 1WBJA 3ICJA 2C7FA 1QAPA 3L0KA 4O53A 7TIMA 4N2YA 1T8QA 4XKMA 3SADA 2DZSA 4JD4A 4DWDA 1US0A 4UQDA 3CEUA 1U33A 2GUUA 1RY8A 3GE7A 1UWIA 4CN1A 3IJ8A 5DRIA 4OTKA 4O1CA 3WY1A 1ZBWA 5D2XA 3TQKA 5IHRA 1EGZA 1QHZA 3IWPA 1IE7C 4MY8A 3B8SA 1F4AA 1QI0A 1IT7A 4JTTA 3QGVA 3VPLA 1WBHA 2VGBA 3KRBA 1DKWA 1OCJA 2NQLA 2NX9A 2VQTA 1EKOA 1XV8A 3BLFA 4PH6A 2XIIA 1B3VA 2V8ZA 1VENA 5CC3A 3MJYA 2R1LA 2OSXA 2JGYA 2INEA 2UY3A 4HCHA 1CTNA 1PTGA 3W1TA 5D30A 4DJFC 3AMKA 4PCFA 3TLLA 4NT0A 2QJIA 1JCTA 5BNKA 3ITOA 2ALDA 3GDRA 5DELA 5DXYA 4WJXA 4XX6A 4HPGA 1B2YA 2NT1A 3O1NA 1JDFA 3N25A 1GOOA 4AVFA 5D9PA 4MWAE 3BGGA 3UYCA 3UVIA 1RAKA 4JX4A 1BVNP 3CEPA 1GKPA 1K9TA 1R9YA 4FB7A 1E6NA 1R7OA 7ENLA 3WQ4A 1F2JA 2FHCA 4IGMA 3MTWA 1PIGA 2WMGA 5KZDA 1GJUA 1G4EA 1RJPA 2WMHA 4OHQA 3H55A 4C6MA 1NU5A 3V5OA 1ODUA 3SJ3A 4W7UA 4O0QA 1W54A 4LB3A 3NQCA 1AH4A 3AXKA 1TV8A 1LDCA 2FDSA 3B04A 3M7SA 5D37A 1HGYA 1LOQA 1UYQA 4I8YA 3URBA 2A0NA 3M0HA 3DENA 4GHRA 2P8CA 3PJXA 3PFMA 1WXZA 4DBDA 3N13A 2PS2A 2HE5A 1XQKA 3BOXA 1AH3A 3NQDA 3HQPA 2PD5A 2WKJA 3EX4A 3B3DA 1HJQA 2PGWA 4YN5A 3RUBL 1WQ5A 3EWUA 2QCMA 4TUFA 3DX5A 3VKCA 2G96A 2EGZA 1EUAA 1V51A 3CS2A 1NF0A 3UF9A 4PTWA 4UNLA 5KINA 3ZZ1A 3QFWA 5JBDA 3NSNA 2PWHA 2W0UA 3GRIA 1RVGA 1I2NA 4KF1A 4B4HA 2ZZ7A 4NAEA 3BV7A 1O12A 2EPMX 3AQUA 3CV7A 3VIPA 2FVLA 4IFRA 3UYIA 1CW2A 4N9EA 3G24A 3VCRA 4DPPA 4QLLA 1BQGA 2GQ8A 3PHAA 3C0SA 3GTIA 4D2JA 3HQOA 4IHCA 1Q66A 1HNYA 4RZ5A 2PDGA 4HVXA 1GYNA 2VQUA 2PDHA 3NL6A 4ZCWA 2EAWA 4E8DA 4NAFB 5I77A 2ZTKA 3MT1A 4CCEA 2E68A 4MJZA 2CEQA 3A5VA 3U57A 3V7PA 2V5BA 3WH5A 2XGBA 1BF6A 4REQA 1H60A 1OF6A 3NQ8A 3M0LA 1LBMA 1HXJA 4HU4A 4GO8A 1FKWA 3N2TA 3M5XA 5A8PA 4IMEA 1WZKA 3EWDA 1KM0A 3INPA 2OWXA 1U2YA 3KAOA 3LI0A 4CNUA 3WUBA 1ZU8A 3G1YA 2RDUA 2AAMA 3VZYA 4J7RA 1GZ1A 2DGAA 8A3HA 4HPXA 1C8VA 2H8XA 1A0EA 3KS5A 1TX0A 4DWSA 5XINA 4CU6A 4OWGA 4KPLA 3AICA 4GC3A 2QNEA 4UTJA 3IK4A 3UG5A 3TN4A 3RGTA 3KOXA 2V3EA 3WQ5A 2GLKA 2ZUMA 3GNPA 3TK7A 3ZR6A 1JZ7A 1RQEA 5I23A 1OFAA 3PWIA 3SJNA 1GQLA 1AZ1A 1YTDA 1P1MA 3BJSA 4US5A 1E6PA 2OEJA 5E0CA 2O9OA 1W1TA 3UNDA 2GSJA 3B8VA 4MLRA 1W8SA 2DQWA 2TAAA 4BY3A 1H09A 2A6NA 1RJQA 3PBVA 2BXZA 1V0LA 3M07A 1EOMA 2PA6A 3U2CA 4CEXC 2HXUA 3P0WA 3E1F1 3L4VA 3QY6A 2TRSA 4JYEA 3NQMA 3E0LA 1GCYA 1FWGC 3M44A 4MVAA 2D22A 1PEZA 1MQRA 4AXNA 3GR4A 3L0NA 1P0DA 2WSYA 3CZKA 1SZEA 3V0TA 2IPGA 1FX6A 2DQXA 2IKJA 1IXQA 4IQJA 4YVXA 3MUIA 3CHEA 3VMNA 4I6VA 2DORA 3F7JA 4Z17A 2ISVA 4MKNA 2DIEA 1DWFM 4PCSA 1F6PA 2F6KA 5JU6A 4ZR8A 1J0ZA 2QCCA 1L6YA 3F2BA 3W1UA 3OZYA 4C65A 1R2SA 4FNTA 3TMQA 1CXKA 1O66A 2GGJA 2J62A 3TSMA 1GOQA 1TZZA 1JCYA 1Z48A 1KFCA 3VOHA 4MJMA 3LBMA 1FHDA 2VCCA 4JKLA 3WDQA 2YCLB 5DT7A 3WD3A 1SO5A 4ROPA 2VGFA 5F4WA 2QJHA 1DV7A 1J4EA 1DOSA 3N12A 4MM1A 1XSIA 1OX4B 5I3JA 2R94A 3K8LA 3AS3A 3H2EA 1BQCA 2J7DA 4HU3A 1ZENA 1QO2A 2E09A 4IUGA 3NTYA 1TREA 5A94A 1UR2A 1E6QM 2INZA 1V6WA 2VR2A 4ICCX 1UD4A 4QEHA 5TNVA 1UMLA 1HJXA 1MUCA 2C0AA 4FHAA 5CPSA 3QQ0A 4M80A 1MYRA 3VNMA 1BD0A 1XWYA 5EPDA 4H83A 1HJUA 2ZOXA 4WD0A 1IXOA 4WQ6A 4ZO6A 4OBSA 1UQZA 3T2PA 3TYBA 2Z1XA 4Q7BA 4UB9A 3UXDA 5HQMA 3C4UA 1XRVA 4L80A 2E77A 2BB0A 5FIPA 3PWGA 1PDZA 2XPKA 2QAPA 4H9TA 3SCUA 1WZMA 3TYUA 2DSWA 1SW3A 4LS2A 3ZJ7A 1BEUA 4GVFA 4I9TA 3B9NA 3RM8A 1H0GA 3MZNA 3VXGA 1AW1A 3EX6A 3VGFA 1SO4A 4IPPA 5C5YA 3W87A 4AVNA 2D69A 4CNTA 1V02E 1LROA 4FNSA 2GDUA 3W7DA 3AHZA 3LSCA 3LRLA 2D2JA 4MB1A 1G4TA 1MEIA 2J8GA 2WJDA 5JIWA 3T9PA 4OIFA 6REQA 2PDBA 3ZXWA 2HNEA 4C6QA 2PGRA 3PZVA 3TR2A 2G5WA 1SQ7A 3E5PA 2ZRZA 2VXNA 4GKTA 3PJWA 1YBQA 2TYSA 1NWRA 4L9YA 4IPNB 4O8RA 2WB5A 4LANA 1BKSA 5LXEA 4HHHA 3SN0A 1EBGA 1X98A 1O60A 4P8UA 2V2DA 2GUBA 3YPIA 2J13A 3QGAC 3CHCA 4PEKA 2PDWA 1NDWA 3IGXA 1NWUA 2EKCA 3OB8A 5CC7A 4RR4A 4NJGA 3DYMA 2CWNA 1NEYA 4QS5A 2PDKA 1I2PA 2D24A 4B2DA 3NZ1A 3KBSA 5I2UA 3HJZA 1QR7A 3EWXA 2E6YA 2P1FA 3BC9A 3CK5A 4DBEA 1YIXA 4GOAA 1RLCL 4TTUA 4CU7A 3GYCA 1K9EA 3W7GA 3OVGA 2NXHA 1JUEA 2OGYA 6TIMA 3QY7A 4MAZA 4XIAA 1OB0A 5A6BA 2YDSA 2YZ5A 3N3MA 4OZOA 1WKEA 3S3GA 4UMAA 1H1ZA 4RK8A 2G41A 4ICMA 1AJ0A 1BSIA 5FOOA 2FQIA 4U5KA 3RJYA 4H2CA 3VD5A 3WDHA 2FVMA 4I6KA 3F4DA 1JYNA 4PYSA 3R0DA 2PP1A 1TJ1A 1ZHAA 3EWCA 3ZT6A 1G6CA 2AAAA 2ZUTA 4O28A 4GFIA 4D72A 1KD0A 2OXNA 4ES4A 2OKOA 2EG6A 1V0MA 5EMMA 4O1BA 3MWCA 4M7SA 1RK5A 1OFDA 4AMAA 1QUMA 4A6GA 3W2MA 3DYOA 3VDGA 4P7OA 2YCIX 3H24A 2AQVA 4DJDA 3AYRA 3MKCA 5A2CA 2J6XA 3WSUA 1KM6A 3THCA 2FMOA 3OEXA 5SWUA 3OYZA 1W9PA 3RRXA 4OE7A 3WCZA 3KBMA 3MCOA 2D0HA 1B3ZA 1YW1A 3S2MA 4H7ZA 3SCNA 2OZ3A 2BASA 4JR5A 3C2RA 1OFBA 1ME9A 4DVOA 1I1WA 3GU2A 3GHSA 1WKFA 3W7JA 2BS9A 5EKYA 3GIPA 1CGYA 5FF2A 2HPIA 2Y4SA 1K9FA 4DZ5A 5G4EA 3ZWSA 3UZWA 4YLWA 1Y65A 4ZZ9A 2E9LA 1WDQA 3CV2A 3G1RA 4DWSC 2Z00A 1CLXA 1F8MA 3DFQA 3NYDA 4GZJA 4QROA 4ADUA 4DXXA 4KWUA 1T99A 3SQMA 3DFPA 3M5ZA 4US5D 2JKEA 3ZT5A 2PWVA 2Y24A 3W73A 3CUZA 3LMZA 4F0SA 1NDVA 1DXIA 3W88A 2OWCA 2W66A 2ZX5A 3KCOA 1E3XA 3GBEA 2ZIDA 3U5YA 2WZIA 1MSSA 1GEQA 4B3LA 1R47A 2H90A 2R1NA 1VAHA 2Y7GA 4WGHA 1BXNA 1UR9A 1LLWA 4NIRA 1GOWA 4GWEA 3A9IA 2PTYA 4IISA 1AVAA 2WSKA 5A6MA 1A3WA 3C3NA 1XGZA 1YPFA 2F9RA 1TPWA 1AUSL 1X6LA 2AOSA 4YNGA 2NXIA 4KFPA 1BSLA 1FY6A 4ZXLA 1R2TA 3W6YA 3GUGA 1YADA 3CL7A 3KTSA 2HDJA 2X1RA 1IEVA 4B90A 5FAGA 2E28A 3BZJA 1NDZA 3VIIA 4NNAA 3M0YA 1UZHA 2XZ7A 1MXDA 2X05A 1DJGA 4H9VA 1EO5A 3CUJA 4KW2A 1KXQA 3HMJG 3E0VA 4UFHA 3U2OA 3RCYA 4AXKA 1G0CA 3PUDA 2ZDSA 3QKZA 4FX6M 1VB9A 3NXLA 5AYXA 1OCQA 3VYLA 1UB3A 1I6NA 3DKLA 3GG8A 5D32A 2NUXA 4FNUA 3FA4A 4QBXA 4A8IA 3BJFA 2FZ8A 4MB4A 4ZSTA 3VIJA 3GS6A 3H22A 1KFJA 1WA3A 3TTSA 1FWCC 4AF0B 2VFFA 2I5QA 3SURA 1I9CB 4AC1X 1PPIA 4LYRA 4D6FA 4A29A 1GVSA 1S2TA 3MYPA 3K46A 1NP2A 4NRSA 4NXKA 1IR2A 1GHRA 2BSLA 4XK2A 1E6ZA 1XHGA 1TUXA 5I03A 3MSRA 4TXEA 2DVXA 1E6SM 1HIZA 5LA1A 3CAVA 3BMWA 3BICA 2G4FA 3BAXA 1JPKA 4ATLA 3TC3A 3H2CA 4J28A 1X1ZA 1SW7A 3RILA 3VC5A 3RO6A 4ZSUA 2A79A 2X7WA 2B7NA 3BG9A 4QCFA 1BWVA 3K8KA 2XN0A 2BY1A 3QW3A 1DWGM 4FK9A 4Q6XA 2DSUA 3Q94A 4GISA 2D23A 3KX6A 2P53A 3GDMA 2ZRUA 3AIUA 4EPKA 4KETA 1S1PA 3UGVA 3GUWA 4XISA 1KQZA 2BDQA 1CPUA 1I0BA 4L9ZA 1VP5A 4UFIA 2ZXDA 4GGBA 3TMLA 4MYXA 3AMLA 4EX4A 5JXQA 3ZLFA 1AODA 4LVFA 4CD5A 3M0JA 4JTGA 1OG6A 5D9OA 3IJDA 1GONA 3AIEA 2PODA 4QDMA 5KMYA 2C3ZA 3KLLA 4X9YA 2OPJA 4NUWA 4C6BA 3T0TA 2PDCA 2ZX9A 5LNVA 3NQ7A 3W2UA 3WF0A 3CIVA 5CJ5A 2V82A 1B30A 4AW7A 3ZR4A 2V0TA 1S5NA 5AHFA 1V77A 4JYFA 4DJED 2XYLA 4O19A 3TA6A 2XGZA 1JZ8A 1EDTA 3C6CA 3WJZA 2VEKA 2PDPA 2PWGA 4PB3A 3W07A 4QSHA 1CI1A 1LUCA 3U9IA 3M0ZA 3TWAA 3TX9A 4D9PA 2GGIA 3RMEA 3DYPA 3ZMRA 4H8UA 1GOKA 1PZ1A 3PAOA 4Q4MA 1XYBA 2WHLA 3PPHA 3E5BA 1K3UA 3NEHA 1REQB 2DZTA 5CJMA 2YW4A 1ITQA 3THQA 3QTPA 4KRZA 3LCHA 4GY7A 3MCNA 3VNIA 5A6BD 3R89A 2R24A 3W82A 3BH4A 3CQKA 4N7QA 1CECA 4L6OA 2QUTA 2OEKA 3A3XA 1G9HA 3MUXA 4W5ZA 3UXKA 1QT1A 4ZB2A 3LXBA 4DM2A 3VMOA 1LRNA 3UR8A 3TN5A 4Q32A 3CYVA 4MFEA 2J75A 1Q4NX 4QDPA 5JQ9A 3P5ZA 1XM3A 3IGHX 1CEOA 2V5LA 3TN3A 1ZZMA 4GNVA 1CB2A 1RBOB 4JTJA 3FXGA 4FX7A 5J5RA 2CCRA 2CLIA 4S2CA 5ECUA 2GK1B 2BHUA 2RJGA 5CEWA 3R2GA 1POJA 4HPHA 2UY5A 1EDGA 1UBSA 1EC9A 2XM1A 3ABZA 2DUXA 3W4RA 2GYIA 2O0TA 4HMDA 4LVBA 3W7RA 3F5JA 4JY8A 3VAVA 4XKYA 3GXMA 1KTCA 3TXZA 2HPMA 5DF0A 2IS7A 3PG8A 1TVNA 3TN6A 2OO0A 1V3IA 3W53A 5K9XA 4C7GA 2J88A 2PRLA 3GKAA 3PAJA 5CGMA 2NUWA 2EPNA 2C1IA 1EF3A 1YX1A 4I90A 3SBFA 3OLDA 1FHVA 2FYMA 3UEQA 3C5QA 1JF6A 4O14A 3OZPA 2F7FA 1VPYA 3L2IA 2OTDA 1E3ZA 3LQLA 1PCWA 3AI0A 1U22A 3DECA 1W9XA 2ZZ5A 3T05A 2WMIB 1C7SA 3O8AA 2OT1A 2REQA 6ALDA 1W1VA 3LOTA 3WFLA 4LQ1A 1ODZA 3VVGA 4ML4A 4DUXA 4IGNA 3BWWA 1G4SA 2NZLA 5LIYX 3PC0A 1WPCA 5LSMA 4PRTA 2BVDA 3UETA 3GW3A 1YMYA 4IH3A 4G1KA 1ZAIA 1VBUA 4G8TA 3QV8A 1LZOA 4LVDA 3IUDA 3FJ4A 1ZB5A 4JQ3A 1TZ7A 5FACA 5I3HA 3GDBA 3QLLA 4W5UA 2YFOA 3DBNA 5LKYA 5KZMA 3VUPA 4TVCA 3D3FA 1PO9A 2PLMA 3VGDA 1TR9A 2J4GA 3U6WA 1O1ZA 3P84A 1NQ6A 3KOFA 4QAIA 2NLYA 4IIEA 1KGUA 1XFCA 3S5YA 4KRTA 3OLGA 4JTLA 1LWHA 5HA7A 4O52A 5EGRA 1HGWA 4Q8UA 1WKDA 1OFQA 3QPEA 2R14A 1BYBA 4F0LA 1OEPA 1TMQA 1Q6RA 4FIQA 5EU9A 5G2HA 2QQ6A 3SQSA 5IRPA 1XYAA 4LBRA 2OLAA 3L2MA 3THAA 3TTOA 4W9TA 3CB8A 4DF2A 4GO9A 1EHAA 4GD0A 3QFEA 4JTRA 2BOFX 4IXXA 3PY2A 3V36A 3COTA 3HG5A 2OYKA 1SYTA 1A53A 1W32A 1XX1A 2WSRA 1XYZA 4W87A 1HN1A 1MDLA 4WIWA 1E55A 4KIEA 2Z1WA 4JDYA 1J6OA 1JEZA 5JUVA 1ICQA 1XPGA 3CWOX 2VYOA 2DH2A 1AL8A 1DWAM 3H2OA 4JOMA 3EOLA 1LLOA 1XSJA 1W17A 4GQGA 1Z7AA 4A3UA 4F3HA 5HQEA 3A4JA 3PSWA 2Z2UA 1I75A 3BCDA 5AC6A 4Q4OA 3DC0A 5I79A 3TYAA 4L1GA 4MGGA 1N8FA 2WVSA 3FAWA 3W70A 4L5ZA 1M3UA 4ATDA 4JCLA 2PBGA 2VD8A 4OGZA 4HSHA 1MEHA 4XO7A 3GXIA 3RAOA 3ZQ9A 2YIHA 4MWAD 4PSPA 3VNZA 2QHAA 1TTQA 3KEHA 1JGMA 4Z2LA 2J8TA 5HMFA 4AD3A 4Y96A 1VCFA 1TA3A 2EPOA 3SGZA 4AZIA 1W6TA 2X30A 3SY8A 1XS2A 1V3JA 1W56A 3NEVA 1TTJA 4AY7A 3EDFA 4IPIA 2P0OA 1KBJA 3AZRA 4MOZA 5HNUA 1JJKA 2QZRA 3N19B 1UKPA 4GVGA 4D8ZA 1J10A 3APGA 1GT8A 3LSBA 3OGVA 1EHNA 2E40A 5XIMA 4DHGA 1GQKA 4LUYA 2QV4A 2VZTA 4PMJA 1LRQA 4WJEA 4C6LA 3LPOA 1X7IA 1QNSA 3VDHA 3S6OA 3I4KA 1PB0A 1WXYA 3QEZA 5DY3A 2YXOA 3W6MA 3CQJA 5CC5A 2PWUA 2ZXQA 3AS1A 1MWOA 3PZQA 3JUGA 1VEPA 1XW8A 1K70A 3S9ZA 1E1EA 2BXYA 1FDZA 4PUUA 1XLKA 4MUZA 4RZ4A 4XD6A 1O1HA 1VIWA 1US2A 1B3OA 3VNLA 1WX0A 3PZMA 1B3YA 1FTXA 4EP8C 3E3HA 4WLCA 4YTSA 4RL3A 3TTYA 4IZGA 3UD6A 4CVUA 4U2ZA 2ZXAA 1P1XA 5K2ZA 1OHLA 3FKRA 1IT8A 3S1VA 2XFRA 4GI8A 1KRMA 3IUHA 3UWEA 1MFUA 1FWRA 3FJNA 4MNJA 3FSTA 2PUZA 5DMLA 4DB7A 1R8LA 3GW0A 3QY8A 3NM3A 1ADSA 1JNDA 3UJFA 4HQVA 3IAPA 1EDQA 2VD9A 3NQBA 1IF2A 1PDYA 3HA1A 1US3A 2I16A 1W3HA 1S3TC 3KOZA 1J0HA 3LLDA 1UASA 4Q8QA 4X63A 2HV5A 4RV3A 1W3KA 3VOFA 1SSGA 4OU1A 3EWBX 1HKKA 2VFHA 4Q4QA 1EPVA 2IPWA 2V69A 4LEQA 3VD3A 3E6EA 3TW9A 4F0MA 1H7PA 1F05A 3LHZA 4LV9A 3PS7A 2BGQA 4HNVA 3VKAA 3T0BA 4I9MA 4K37A 5JVLA 1C9DA 4WY0A 5KZ6A 3SW6A 1X6NA 4Z1AA 2JKPA 3QM3A 2VVNA 5BU9A 1CLKA 5HNNA 5AC4A 1V8EA 1KRBC 1NOFA 1UD5A 5CGQA 1TVPA 4M1RA 3UJRA 3TJLA 4GQ0A 1L8PA 4W8AA 4ZVJA 4RNHA 4GZEA 2XISA 3NUKA 1ECEA 3A3HA 1VJIA 3SCTA 3WEMA 4EF8A 1QPNA 4J9JA 1IYXA 5DMMA 4NAEB 1GPFA 1J18A 3FVMA 4LAZA 3IIOA 3L21A 3ITXA 3C0LA 2F2HA 3U0HA 4JEQA 4A21A 3F2DA 5LYRA 3CBWA 4LUTA 1F76A 3SCVA 4LNYA 4FX8A 4XAYA 2J7BA 3QRHA 1H5VA 1PYMA 3EAUA 1TJRA 4EPEC 2WVVA 3I6TA 2A3HA 2VC9A 1DP0A 3RYSA 4AZ5A 1HKJA 1B0IA 1OC6A 1P6BA 4YHGA 1J12A 4KWSA 3I10A 1SR0A 1K77A 3LHVA 3W23A 3EMQA 2VRKA 5GNYA 1Z9AA 4JTUA 3O2LA 3FGCB 3FDKA 3VUSA 4P7QA 3U5UA 4LWWA 3LCWA 4HKPA 3OLIA 4NY2A 2DV0A 3AROA 3WLLA 1E72M 5D2VA 3WJSA 1E1CA 3TCEA 1VFLA 5I09A 3CYJA 1BGAA 1SU5A 1WYIA 1YDVA 1S38A 3AISA 3ZS4A 1G67A 3QZEA 3SIZA 3JVAA 4TMBA 3EOSA 1Q63A 1DQUA 3KRZA 3KL3A 1QJWA 1TUFA 1EXBA 3U2ZA 4OJYA 4RZBA 4WDTA 3L68A 4ZQCA 2FZ9A 3OA5A 1DXEA 1SMDA 1SFLA 3LCFA 2CYGA 5ABGA 5MKGB 1XDLA 3KBWA 1A5CA 1A5NC 1W8GA 3LK6A 5F2IA 4BEUA 1O5XA 3C0QA 2HJPA 4UIOA 2BXVA 3CUFA 3CQIA 1D3HA 2P50A 3KM8A 2EF9A 3N18A 1PAMA 4A22A 2IXVA 3GU1A 3EXRA 2GJLA 1GW1A 3WUGA 4V27A 1POKA 2QPSA 3NZPA 5E93A 5JH1A 2H3BA 4C1KA 3SUVA 3VDCA 2WKGA 2Y5EA 4BZYA 1S39A 1XPYA 1QU4A 3LPGA 3HZ3A 2PD9A 4FA3A 4L6HA 1UZ1A 4AIEA 1RCXB 4XZBA 4ADSA 5BXTA 1GQIA 3SGGA 1JDEA 1WP6A 2R1PA 1W1ZA 3WQ8A 1OZQA 1F7BA 3EEZA 4Q4KA 4LAKA 2Y70A 1JXJA 4HMNA 5HPCA 1DIOA 4FMVA 3MP4A 2QF7A 4JQAA 5DXXA 1EF2A 1JL8A 2AQWA 4BFAA 3NXFA 4GJ1A 4QGCA 1FHLA 3TR9A 4X2PA 4X9SA 1E40A 3S2CA 2PGFA 3G22A 1QFEA 3WG6A 5H1WA 2G3MA 4UXDA 2QIWA 1A5AA 4LU0A 4BQ5A 2BVYA 4E4FA 5JBEA 1WKYA 5D9NA 3MMUA 2IW0A 2W92A 4MNMA 4R3UA 5BOEA 1QK2A 5CZ0A 3LM3A 4Y8EA 3L2LA 4F0HA 3ZWTA 2P5NA 2W63A 4J3ZA 3LHWA 3GLCA 2GQ3A 5LGZA 3DGRA 3AHTA 1XXXA 3CTLA 4X60A 1W3IA 1RLDA 2QJGA 5D2TA 3CXOA 1OJXA 4Z0JA 3RNDA 1XISA 5BOOA 1EIBA 1UUQA 1WDPA 1SJCA 1TELA 5I0DA 4MHBA 3T8QA 2PRHA 1DWJM 1F8IA 1R3SA 4TX9A 2RUSA 4X0VA 1IXPA 3ZVIA 1XJBA 3MZ2A 4F79A 4TV5A 3THUA 3W7IA 4Z1BA 1Y5XA 3PBYA 3FKKA 2EKGA 1BRLB 3FSUA 1EJRC 5EYWA 3VX1A 2ACQA 3GG1A 2NWRA 1P48A 4X22A 1AG1O 3WK2A 2VJXA 3P0XA 5HQLA 5FKYA 3MW7A 2Q8XA 3WDJA 1NF7A 1XC6A 3M7WA 4KEZA 1C9WA 3R8RA 3AJXA 2J74A 1SR9A 4ILSA 2VFEA 4F0RA 2WJEA 3WLHA 4GI9A 1S2AA 3NIYA 4W7WA 1HVXA 3FW6A 2Y0FA 4UTMA 3R8GA 3HGRA 3L4ZA 4TV6A 1VFMA 5FL0A 3LTYA 3CT2A 4E2DA 4FZIA 5CSRA 1A5MC 3BAJA 4FLRA 3DFTA 4MAVA 4R53A 1V3MA 4FO4A 4GBDA 3PZUA 4MIMA 5DX7A 5I07A 4LBSA 1D2KA 5KITA 1XKJA 3GWQA 4K8GA 2FFIA 5EFFA 3DGBA 2X1UA 2PDLA 1BTCA 1F6YA 1W5MA 3DZ1A 3A4WA 3L66A 1CYGA 2YZRA 3B8TA 2XSBA 2YL6A 1W2PA 5AZ0A 3KZSA 2YGYA 4MFDA 3FDGA 3HOJA 1LORA 4HOXA 1ONXA 3AS2A 4BF7A 2DH3A 3TVAA 5K3VA 1QI5A 2CLMA 3UT0A 3WQCA 1LP6A 1V03A 2TODA 6REQB 4JEJA 3G6MA 4M6UA 1IZCA 1V7YA 5LHEA 3P62A 1DEDA 1X1OA 3SN4A 3UW6A 4IL0A 3WLKX 1GPWA 1YBQB 3W2JA 1EJ7L 1Z42A 4GLEA 4E8GA 1P5BA 4R7JA 5E1QA 5LNUA 4W7VA 1J11A 1EA9C 3IRSA 3QHOA 3UPWA 2QLYA 4Z2HA 7XIMA 4JHZA 1PS9A 4I5UA 2WM0A 1ONWA 4W8LA 3OA3A 3MKVA 1GKQA 5G1YA 1LT7A 3OBKA 3IACA 3VTRA 4KGJA 1FCVA 1IIGA 1XLAA 1OD0A 3SN1A 5CQ1A 1C8YA 4R5EA 3AJ7A 2UY4A 2HTMA 2OQYA 3CLWA 3QMRA 3NGJA 4PTVA 4LH8A 5DMNA 1IWBA 3P2VA 2Q02A 3MUAA 2EO7A 1KFLA 4LGXA 4IQDA 2INFA 5IXEA 4QJ1A 3T09A 4WK9A 3CMFA 4GNJA 4ZOAA 4B5WA 2CWXA 5HXMA 4F48A 3SEPA 1NSJA 2H6RA 1E70M 4HU0A 3M16A 4JY9A 1J8VA 2WVTA 1EX1A 1E9IA 4O50A 5J04A 4FI4A 4O16A 4UTUA 1UOKA 1QNOA 4Y9AA 2C1HA 3B9DA 5ENLA 5CGTA 2YJQA 2VGIA 3OBEA 1FDYA 4DELA 1LF1A 3TW7A 3LCGA 1B3WA 1F3WA 1J5TA 2XGIA 4KCTA 3OODA 4AX7A 2O9PA 3CUHA 3ARQA 5AC8A 3QSRA 3T2QA 2FTYA 3MMDA 2VZUA 1B9BA 2PGEA 2ON3A 4CNOA 3T81A 4ZTYA 2Y6ZA 3QYSA 3HO8A 2QUNA 4Y9NA 5LGXA 4HNNA 1KGWA 4B4FA 4WEVX 2A5HA 5BCAA 5CPQA 1ITUA 4ZO8A 3K5XA 5AZ1A 4NF7A 3OPSA 3TSBA 3E74A 1UD2A 1E9ZB 2NQJA 5HULA 4RNJA 2W9MA 3PANA 4A3YA 1DHPA 5BYWA 4UCFA 4W84A 5C7HA 3BCJA 1R3TA 3EGJA 4IICA 1YXDA 4H8HA 4GH1A 2YXXA 2DT0A 4PMVA 4QNEA 2YKKA 4JQ2A 4N6EA 4JL2A 2BG5A 2WKLA 1J93A 1HKWA 4W88A 1RA0A 2QCHA 4NZ3A 5FEZA 3H4GA 1L0PA 2WNWA 4Q7IA 4PZVA 4TOQA 3LENA 3E2QA 3WUFA 3ES8A 5HUOA 3H53A 2QGYA 1IT0A 1WDSA 1HJVA 4JTEA 5E5CA 4RNIA 3N9RA 4IXHA 3RK8A 2ZRVA 2QXWA 3W7QA 1LWJA 4PC8A 2Y62A 3W0KA 4G56A 2J6VA 4BCEA 4XAGA 2OJPA 1SPQA 4FXSA 1O7AA 1VF8A 5AYBA 3HM7A 3NFUA 3QTGA 3W1RA 3KXQA 3CIXA 2ZDRA 2DJLA 2BV9A 4G7EA 2E1WA 2IKGA 4CD7A 2GVLA 3R6IA 4ZA0A 3KL5A 3MP5A 1N55A 2CXGA 1HW6A 3PNZA 2VC7A 2VELA 3BQ6A 1UH2A 3P81A 4JX5A 3L7RA 3U4AA 4LRSA 1BXCA 1W3LA 4PBFA 3RMJA 2MNRA 1I2QA 3FFSA 2CZEA 3O7UA 1EC8A 1PX8A 4V33A 5I7GA 3FVDA 1YPIA 4H6KA 4AWTA 4YYFA 5U7SA 1P7TA 3DFNA 2PLJA 1R6WA 4KESA 1N8IA 3TLQA 2DJXA 5TAOA 3N4FA 3KW3A 2QCEA 4S3KA 3CL6A 1GQJA 1KR0A 3VZXA 2OSYA 3QVQA 1QTWA 4B92A 5KSWA 1NFGA 4GINA 1PWLA 1AZ2A 2WZMA 3KL0A 3W27A 4JN7A 7PTDA 4HNOA 1XBZA 2Z7GA 3A5FA 1C92A 3N14A 5LZLA 2HCVA 5FJUA 4I8DA 1EA0A 4NYYA 1RD5A 4UQAA 3A23A 3QOKA 2IQDA 3MUZ1 1CIUA 1HFBA 1DWIM 4UFLA 3DG6A 4M6QA 2Y63A 3LLXA 2POTA 4AD1A 1KC7A 2VEMA 1ML1A 1J9YA 1PKNA 1GK8A 3CWNA 4C6CA 4LX4A 3B06A 3SGUA 3HQNA 3LNPA 3WH8A 4ZODA 3OG3A 4IP4A 3PUGA 2CHOA 3WQGA 2YLAA 5C6MA 2BNJA 4Z1YA 2PDIA 3EB4A 3RJXA 3GM8A 2OVLA 2E4TA 3NQAA 2CKSA 1CGTA 1PTAA 3GNDA 2JE8A 2ZRYA 2VDGA 1X1NA 4AYSA 4IWWA 4UTWA 1RA5A 2ZKMX 3OQ8A 1AQFA 5HINA 1OCBA 2HBXA 5BXSA 3CV6A 3M6DA 1W9DM 3VABA 4J27A 4EANA 3VILA 2EG7A 3ME3A 1E9LA 4UCGA 4Z0SA 3MSDA 3APTA 1QASA 4NNCA 1J2WA 2BTMA 3V5FA 2X42A 4PGLA 3N11A 2WWDA 1G01A 1K02A 1UA3A 3IVTA 3QN3A 3HPZA 4L61A 1YXCA 2XJ7A 1V3HA 3P8IA 2NVAA 1M53A 3AFBA 3KBJA 2HMCA 1R46A 4M8UA 1Q7QA 3P93A 1XICA 4FXRA 1DBTA 2GGGA 2WO5A 1TWWA 4KCUA 1FWDC 2Y61A 3N4EA 4Q6JA 1XD1A 2XM2A 3SUSA 4W4QA 1OC5A 4HNLA 2OOGA 1A47A 3P60A 1XR2A 3IIXA 4LF1A 1TB3A 3WNMA 4EWJA 4J3SA 4RDZA 4PBEA 4ORMA 1IEIA 2O92A 3WQVA 2CLFA 1KXTA 4M6VA 4P7LA 2D3NA 3W7NA 5CAHA 3G0UA 3MY9A 4IJCA 1W9VA 2XIJA 2HRWA 4BF5A 1KBLA 2YYTA 2FTWA 1D7FA 1U5VA 4XG1A 4ZQRA 4ZFMA 3I7SA 2GOKA 4LSBA 3V1HA 3HPFA 3SM0A 3L23A 3CZGA 4L1XA 3G1HA 4PN2A 3P82A 5FF4A 1S2UA 3CAKA 1UW9A 1W5OA 2DEPA 1EC7A 2XTKA 1JPDX 1C91A 4HYRA 4FPSA 4S1FA 3VI2A 4I5RA 4QHRA 1MW3A 3CJPA 3G5EA 3MB9A 2DVUA 1AK5A 1LUCB 1XSKA 4KQNA 4DNHA 1SZRA 5FJOA 2A3AA 3GU9A 1Q6EA 1XLMA 4JTHA 4M1BA 1TPC1 4WSKA 4PCNA 4F0KA 5LNWA 2Q71A 1W5PA 2JF7A 1TQXA 1NDYA 5H91A 4IX0A 3M0MA 1W9UA 3OJGA 5ABFA 4ZQPA 5KTLA 4GBUA 1JCXA 3LDVA 2Z1VA 2ZYFA 2QJJA 3ANVA 4DZAA 4ROQA 1HKIA 3TCSA 3PM6A 3S6DA 4O57A 2JF6A 3VOGA 2G3FA 2J7FA 3A12A 3C2YA 3KTCA 3RLHA 3OZOA 4UZSA 3K2GA 4XZMX 4ZMGA 4WUIA 5EMUA 3NO1A 3ZT7A 1QI4A 3W1LA 1JQVA 4LS0A 4C5ZA 3H8AA 1OC7A 1JZ5A 2GWGA 2D3LA 4X3ZA 4FNPA 1QK0A 4O54A 3GXFA 4IPJA 5E9AA 3VGHA 4DI9A 2FPYA 1OQFA 5ECVA 1Q8AA 3AO0A 4NJHA 5D4YA 1XLBA 2V67A 3G0XA 2NSOA 3K4AA 4GVHA 1MXGA 4NXSA 3HFYA 2YR1A 2OU4A 3ZSTA 4DBSA 4QITA 3MI2A 5F2MA 1TWZA 3AIWA 3AIVA 4XKYB 3UWQA 1ISYA 3BK0A 2WZHA 4MDPA 1NQKA 3TP4A 4NU7A 5F7UA 4OBTA 3DI0A 3NYZA 1YNYA 4NI3A 5LIUX 2BVWA 5EBUA 4WXZA 4XTIA 3ITGA 1X8CA 5TF0A 1W2VA 3TV8A 1HKVA 4IL2A 2IKIA 4K8HA 2VFIA 1P6CA 1QI3A 3UWWA 1FKXA 2LLEA 1OYCA 4K3ZA 4IMGA 4PA8A 3RRAA 4Y9MA 4GH3A 4R7WA 3O9NA 4S39A 5A69A 3KVMA 3V35A 4ORIA 2YOCA 1U5JA 2REQB 2PTZA 4F9DA 2VGGA 4QG8A 4KMQA 2RDTA 5DLCA 2VDIA 3H2AA 4Q8WA 1E1FA 1UR4A 3UWUA 1CENA 3WMBA 3CZEA 1NWTA 2ZX7A 1L6WA 1ZGDA 1PUDA 4MKSA 3HJEA 4LNCA 4XBJA 3LBOA 1PKYA 3UPBA 3G3MA 3RIKA 1ISZA 2VUNA 4N4QA 4PTDA 3MPGA 1CDGA 4D6EA 4EIVA 4ZQOA 3U3HA 4MUPA 1R0MA 4XD3A 3RLGA 3DFSA 4US6A 2GVJA 4J3VA 1KCZA 3WF3A 1SJBA 4L4PA 3A13A 5CC6A 4PR4A 4JFTA 1TRIA 2VDHA 5T9CE 1ZBVA 3TW6A 2G3IA 1HO1A 2NQ9A 4UMCA 4O1DA 4MDOA 1XIBA 5LIXX 3BAKA 1UZDA 1DIDA 1R86A 2OFJA 3TTEA 3AYVA 3I6EA 2VFDA 3USZA 1OCNA 2Q6ZA 2EXOA 2DP3A 5H8UA 1I60A 2YBUA 4WR3A 2XIOA 3LXCA 3OVQA 3MBFA 2OO6A 3V18A 2J77A 1Q6OA 4HZ8A 1RD6A 2PE4A 1XLIA 5HAOA 3W22A 3PF3A 1QW7A 4CCCA 1ZS2A 5HDRA 2WC4A 2VX5A 5FEWA 3TYCA 3KCJA 3EEGA 4YYCA 4NZ4A 4NAFA 4HZMA 2W27A 3L5AA 1ZCCA 1M04A 4GQQA 4F2BA 3R79A 3M0XA 4PBGA 3ONBA 1V3LA 4AU0A 5HWMA 1NOUA 1UHVA 2CLPA 3TQPA 1W1PA 3N3TA 1GYLA 5I78A 2HROA 4UTHA 1FVPA 1RHCA 2V5JA 4JIRA 4U10A 4TMCA 3NPXA 3GC2A 5M17A 2YB4A 1QHOA 1GZJA 3H12A 3WIJA 7ODCA 2NQ5A 2PC8A 3KHDA 3VGGA 2GPTA 3REQA 3VU2A 4N0RA 1JNEA 1UBPC 2CESA 3V4BA 1PKLA 3L4YA 3ZLGA 3CNYA 4PL1A 3RX3A 5AFDA 2FB3A 1KKOA 1DIKA 3SCRA 2O9TA 2V5DA 5IFPA 4UTWC 3P61A 3EDDA 4E6MA 4ERIA 3GO2A 3NPWA 2BWGA 2YL9A 3ONCA 4R9XA 4KH2A 4WHBA 2HBVA 2XUCA 3VIFA 1LTDA 3PTQA 2A4AA 3OP2A 1UCWA 1WDRA 4IJRA 1XG3A 1XBXA 3T55A 2P8BA 4LT9A 1YPXA 5D33A 5T26A 2ONEA 3P8JA 5GNZA 3VIOA 2OZTA 4AY8A 5IHSA 3B0YA 1LT8A 2VURA 4AG0A 3BL3A 1OVDA 3EBVA 4AHQA 4ZOEA 3H6OA 3UR7A 5CPOA 3CZJA 3VE9A 3ENLA 4O4WA 1BLIA 2NVDA 2FLIA 5C2XA 3ABXA 3EOUA 3F5LA 1H7WA 3IRDA 2C19A 1NOWA 3G1XA 1Q13A 1OABA 1S5MA 5EMJA 4CD4A 3UQNA 4CD8A 4EF9A 4UQ9A 4XUGA 2ZA3A 2BLEA 3GFXA 2Z26A 4C6DA 1TPEA 4K38A 4AB4A 4HNTA 4YWIA 2VX7A 1JI2A 3IJQA 3PZNA 4NJIA 1MW2A 2CIPA 3ARZA 1EP3A 4HGXA 4PUWA 5ABTA 2OLHA 4GIRA 3RG6A 1ZPTA 2WMFA 3ZOAA 1A50A 3O07A 4DXKA 3A22A 4V1YA 4AZ7A 5DBTA 3JZUA 2X0YA 1TV5A 2HEJA 2VZSA 3F4NA 5C54A 2ASHA 4L4OA 3OO2A 1UC4A 2YCLA 3GY1A 3CH0A 1SO3A 5DQPA 1VQTA 1OFOA 2O4QA 1XIFA 2Y7DA 3GTFA 3HTWA 2XIQA 4K68A 4B16A 1OX4A 1RVKA 4AY1A 3GAKA 3LYEA 4O1FA 1UUOA 5M1TA 2QS8A 2Y89A 3W1PA 1JZ3A 3OHIA 3W83A 3WUEA 4I9JA 5T8GA 1WDWA 5L9FA 3VC6A 4FLQA 4GQRA 1H49A 3NO5A 1FP9A 3WFAA 1C7TA 2BY0A 4DAIA 2XVPA 4LUTB 2E5CA 5K4XA 4LVAA 4N4PA 3OLEA 3BE7A 3I3DA 1XDJA 2WVVB 7CGTA 3BO9A 3AHXA 2ZWZA 5BRPA 3LRMA 4IMCA 4WKFA 3FNDA 1T96A 3NQGA 3GVGA 1N82A 1S2WA 2WBKA 2V3FA 2VC6A 5CG7A 3OU8A 2WQPA 2PMQA 1MEWA 2PFHA 3WNPA 2WVUA 1UC5A 4LVGA 3GG0A 1GVRA 3ARYA 1FWWA 2H8ZA 5EMLA 2RKXA 2ZZ4A 4RDVA 1XIHA 3NQEA 4JS3A 4K39A 2B4GA 4MLJA 1DJZA 4WX2A 2FGZA 5G4HC 3H21A 1KLYA 4IIFA 4E5TA 1RH9A 1M7XA 1KM5A 4ZQNA 3WBXA 3KVKA 1G4PA 4IFKB 3STPA 1X96A 1E1CB 1VFOA 2I7GA 3MP3A 5AOUA 1WZAA 2JBMA 1QPKA 5A3HA 1I0DA 1OF8A 1JVNA 1MW1A 3FIGA 3N2OA 1VRXA 2HZGA 1EIXA 4LS1A 1QDSA 4R7OA 3UVAA 1B54A 2O55A 3RPTA 5AY7A 3HGOA 2Z1KA 3WMCA 3DHUA 4GPNA 2D0FA 4QFUA 2Q01A 3MMTA 5CBBA 1GVQA 5FF0A 3P7YA 4GABA 3S5NA 3WX7A 3VNYA 4OOUA 2E25A 1AQHA 3XINA 1KXHA 4OVXA 4WCJA 1KB3A 2UWFA 5D2YA 3C56A 3EMZA 5EFDA 3DG3A 3W28A 4QR6A 2YW3A 5I3IA 2F8QA 2WHJA 1JRCA 2Y2WA 4C6NA 1U83A 1WCGA 3DUGA 2GQ9A 2HISA 2AKMA 2RGLA 5EA9A 2ZXBA 3AUJA 3NL2A 3WBWA 1D7KA 4D8LA 4H7VA 4AD0A 1AL7A 1UPPA 3KFTA 4UFKA 1DJNA 3TH6A 1VYPX 1YHTA 3BQ5A 3EPMA 1QNQA 4KWVA 1LOSA 4KFNA 2XIBA 4GA8A 2PRMA 5DT5A 4QTGA 3V0UA 2XFFA 1UWSA 1VHNA 4GC4A 4JDBA 4MPKA 4HK6A 1MMFA 2WNQA 4CUCA 4L4MA 2WBGA 3MANA 1JCMP 2XDFA 4JTAA 3ZR5A 2HQAA 4HA3A 2G8ZA 1CXLA 2ZUUA 2AMXA 2A7RA 2C18A 2F6UA 1G94A 1D3GA 1GVFA 5CKSA 1RQBA 2Y5JA 2IPJA 1E56A 2AL1A 1XGDA 1UZ4A 1YTEA 3WLPA 3WQ6A 3UESA 4MG4A 4CNNA 3S1UA 1SMAA 1TG7A 1Z69A 2J79A 3R8HA 3DXIA 3HMCA 4JZ5A 4BQ2A 3B8WA 1U1HA 9XIMA 2C8NA 3SI9A 1ENUA 3KVLA 3MMWA 3P74A 4LJ3A 3WLOA 5TD4A 3VA8A 4M29A 1FCBA 4BI6A 4BJHA 4LCQA 4DBUA 4HA0A 4NZFA 3VCCA 3WNKA 3L4UA 1WUEA 5A6AA 3FOKA 3S5ZA 4IIGA 2XH4A 3S2NA 4OUIA 1D8CA 4ZENA 1KQYA 1ZCOA 3QV6A 3GIYA 3ANUA 3R25A 1EJXC 4AIUA 4HHMA 4JX6A 1NJJA 3K1DA 3P3BA 2HSAA 4LCSA 4UOZA 4P61A 2XFWA 1E0WA 1GZGA 4LY4A 1XBYA 2QIIA 1NVMA 5FL1A 4D6GA 1ZJIA 4GK8A 1ZP4A 1KRCC 5H6HA 3WH6A 2G97A 3H26A 3FYOA 5CZJA 3WD1A 2PDNA 4B5VA 3MSYA 3O6DA 4RDWA 1QPOA 1BVWA 4IG2B 2V5CA 3RR4A 5D09A 4GXWA 3LNMA 3UGRA 2EBNA 3WELA 4GMEA 2GJRA 2ZUVA 3UU0A 1SUXA 1KTBA 1YLVA 4DXVA 3WNLA 3MVTA 4KRUA 2F2KA 1LLZA 1WDDA 1T6MA 4XVEA 3BAYA 4MF4A 5AHEA 5HMDA 3FY1A 1EL3A 1DL3A 3G18A 2OT0A 2PTWA 1GG0A 5E0KA 1YXYA 2D0GA 5LHFA 3H7RA 3NVDA 4U31A 4Y9OA 4RPQA 2QJNA 1QATA 2VR5A 3N04A 4WSHA 3H23A 1XYLA 3WQOA 2I9UA 2NX3A 1KFKA 4IM4A 2H9AB 2YDRA 4AISA 4YXGA 3WF2A 2DPEA 2POZA 3ALFA 4HMCA 5F4XA 4Q8NA 4RUBA 1IXNA 1TMHA 3UNTA 5G1TA 4UR8A 1DJIA 3NA8A 4GG9A 4PMYA 3CTTA 1UH4A 1OK6A 3ELFA 3NNTA 2BGSA 1QWKA 2YA0A 3L9CA 4FOUA 3DERA 4Q8TA 2C14A 3Q45A 2AGKA 1V7AA 1Y5WA 2BY2A 3LGEA 1XGEA 2ANUA 4PEEA 3QPYA 1VBHA 1W0MA 3ITVA 4JN8A 4B3ZA 2B31A 1ONEA 2PPGA 1NAL1 3UA3A 4PUKA 1FWTA 4N9CA 3PUEA 1AQMA 2Y8VA 2DUZA 4JQ4A 3WD0A 4UQCA 1V08A 3U7VA 4ERGA 5D8ZA 1AQ0A 2OLSA 5HPOA 4XBSA 2BHZA 3E12A 1G7VA 4CD6A 2WV8A 4DUOA 4DJEA 4GJIA 2ESCA 3GXNA 3BVJA 4KWWA 4JHMA 3UWYA 1H61A 4J3XA 4K6AA 4Z2GA 3THDA 1KBBA 1N2VA 4QNWA 1UD3A 5IDIA 1FXPA 5BMWA 4UWMA 1UKQA 1PTDA 5I3KA 5E9XA 1HF6A 1TTPA 2ZE3A 3PP7A 3IGSA 2C0HA 1HT6A 3ARPA 2Z1SA 4S3CA 1XCWA 1O94A 5CPMA 3M9YA 3VINA 1FUYA 4AF0A 1Q6CA 3R10A 2WNZA 2XHYA 5AECA 2OZ8A 3CV1A 3HGSA 2CBIA 1F3EA 3IARA 3BLEA 2DT2A 2B7OA 1R9ZA 1VD6A 1DXFA 5I3GA 3AWNA 1ITXA 4ZBCA 2I57A 4PODA 5KETA 2G0WA 4PUJA 1F9CA 2JGQA 2W91A 3AIRA 3LEPA 4CVWA 2GJNA 1M9HA 4S3FA 3UXAA 3I65A 1YYAA 3HPXA 2JKAA 2ZVRA 3C2VA 1M68A 1K1DA 1RCQA 1RALA 1FH9A 1EWDA 3EX2A 3DFHA 4GJJA 3W84A 2Y8UA 4NSBA 3IPWA 2I14A 1OIFA 5DANA 1OX5A 5A2BA 3IANA 3I68A 4YVVA 3R11A 4CQDA 1UWTA 2IQTA 3SO7A 3V5CA 3L67A 4UQBA 3GZAA 4IMAA 3TTQA 3W7LA 3S9YA 4HA4A 1R3QA 3U48A 3W25A 1JFHA 1DE6A 1Q7ZA 1X97A 4OOZA 1OM0A 3HG2A 3S2LA 3C2EA 3BGAA 4HYWA 4M56A 2Z2BA 2DT1A 1V6VA 1Z44A 4G7FA 5TIMA 4JKMA 2CLEA 5C9UA 4O1AA 1EP1A 1H2JA 4QG6A 4FP1A 5FJTA 3APYA 3ATYA 1CBGA 3UZZA 2EHHA 3ZYZA 1EBHA 1C8QA 3K4WA 2UZ9A 1VPXA 3BXWA 1OGSA 1L2QA 3G6LA 2CLHA 4K7YA 7REQB 1H50A 2FGBA 4UR9A 4C6FA 5AN7A 2XN2A 3EOOA 3GDKA 4S3AA 1SFSA 3AU2A 2YA1A 4CGTA 1LL7A 1QVBA 1Z3NA 1F3TA 3R58A 3GBDA 4BWLA 1EX5A 2CZDA 3BANA 3AU6A 3AWOA 3B9EA 1HL8A 1LRTA 1UR1A 4DF1A 3FAXA 1PXGA 2VC5A 3W38A 3FK4A 3H4WA 3R94A 3PPFA 3W7KA 4H01A 4XZ9A 2I9EA 3TNBA 4DEFA 4BK9A 3ARSA 3C52A 5A8QA 4H9YA 2QDEA 4E0CA 4H6QA 3GXDA 3D6NA 3UERA 3UXLA 1TPDA 5BMXA 1P7TB 3L12A 3B0VC 4R9OA 3WLRA 8XIMA 1AW5A 1ZP3A 4AZGA 1FWIC 4GUIA 1ZL1A 3FXYA 5IDZA 3W00A 2QDDA 3DU0A 3N2CA 1S5WA 1LQ2A 2PF8A 4QIUA 1FWEC 1DPMA 2CZFA 2RHGA 3M47A 1H4PA 1KCLA 4IP7A 2QEZA 4XUYA 4S3BA 2CU0A 2VCAA 2WW5A 6TAAA 3A47A 2BMBA 1OX6A 4WOZA 4GXPA 1JFXA 1XIJA 1LL6A 3IUIA 2PF0A 4EXBA 2IXUA 4I5XA 1M01A 1JPHA 1XLLA 1K7XA 3BG3A 1L6SA 4GIYA 3K1GA 1RK6A 2J9YA 2ISDA 2G3JA 5F1UA 1XYFA 4YWSA 5BW6A 3T0DA 2XVKA 1TPVA 4E2VA 5AB3A 4EVZA 3FX4A 4LC6A 4X0NA 4CCZA 4NX5A 5HNRA 3NOYA 4U4MA 3UZJA 1ICPA 2VR4A 4X2RA 1YE6A 1XLHA 3W7PA 2GVYA 4GXMA 2X7VA 1CXHA 4MWAA 5EY5A 3RHGA 3WK1A 4PRWA 2X41A 3FEMA 3KE0A 4AZHA 1ZSXA 4DNMA 3BURA 3AHYA 5FEPA 3N17A 4MZYA 5I3FA 2FTPA 1KFWA 4JGDA 4E4UA 1K7EA 1RPKA 4QISA 1XINA 3V0SA 1V79A 1EFZA 1ESWA 3KWXA 4MY1A 4EXQA 1V3KA 4H2HA 4RJEA 4U3CA 1UUMA 2Z6IA 4CKQA 3A64A 3RXZA 3KTXA 3MO4A 2OELA 4JFUA 3Q58A 3BW2A 2YL5A 4GCXA 1XLDA 3SUTA 2ACUA 1V6XA 1VPQA 5GJMA 1PYFA 2ZUNA 4HOZA 4ACYA 5REQB 3TZFA 3C61A 4P8XA 4PULA 3S9IA 2WHMA 2JEQA 4AWSA 2R91A 3OW1A 1UIPA 4U3AA 4HN4A 3W1MA 1O68A 3DHPA 3OZMA 2E5BA 5EMYA 3URNA 3MQTA 4D8AA 2VI0A 2TMDA 4KT2A 3JRKA 4A8RA 2E8ZA 4JTIA 2VL4A 3VNKA 1JRBA 4YS1A 2PB1A 5M3WA 3CO4A 4AZCA 3CPRA 3F4CA 3WF4A 2DUAA 3D47A 4RE4A 1S3HA 1H1NA 3A4XA 3ZVHB 1Z89A 4H9XA 2Z25A 3GH4A 3LHUA 4A8NA 4BR1A 4HSOA 3M1ZA 5BU6A 4F2UA 4JNYA 3E2VA 4H8VA 5D8WA 1TIMA 2D1ZA 1MI3A 4Z1DA 4B5NA 2CBJA 1Z32X 3E9AA 1OFRA 4HJFA 4F8XA 4QE1A 2L5HA 4QJ4B 1SO6A 3DG7A 1EJTC 1GUVA 1CB7B 1A3XA 3EKGA 3XIMA 4OBRA 2O7SA 4Y7EA 1QOQA 5BZAA 1DWHM 1VCGA 3QZAA 4Z2IA 3U7BA 1FWFC 4DJEC 3E0WA 1VHCA 5A6TC 2WQDA 1PCKA 1E0XA 1C3FA 1NY1A 1QBAA 5ABFB 4QG9A 2X8RA 1UKTA 1W1B1 3S1XA 1KBKA 1SFTA 2J25A 1W3NA 2ATMA 2Z29A 2QUUA 2VFGA 4RW3A 3A9BA 2VWTA 4UUIA 3IIPA 1M1BA 2PCQA 3WLMA 2I5IA 3SAZA 5A95A 4MB5A 3II1A 5DFAA 2GJXA 3VOJA 4HOWA 2HE8A 4GACA 4FR6A 1PZ0A 1SVDA 4E8CA 1K03A 5EB8A 1ZBKA 2Z7KA 1ISVA 3C0JA 1V6YA 5AVNA 3AZSA 1VC4A 2MANA 3WZ0E 3WQDA 1CGXA 4Y9PA 4DJFD 4QE4A 2PDQA