3CQKA

Crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ and sulfate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
276
structure length
276
Chain Sequence
QIPLGIYEKALPAGECWLERLQLAKTLGFDFVEMSVDETDERLSRLDWSREQRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAEVAKARDWVKARMAKAGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords L-ribulose-5-phosphate 3-epimerase ulaE
publication title Structure of L-xylulose-5-Phosphate 3-epimerase (UlaE) from the anaerobic L-ascorbate utilization pathway of Escherichia coli: identification of a novel phosphate binding motif within a TIM barrel fold.
pubmed doi rcsb
source organism Escherichia coli
total genus 114
structure length 276
sequence length 276
chains with identical sequence B
ec nomenclature ec 5.1.3.22: L-ribulose-5-phosphate 3-epimerase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3cqkA00
2HK1A 4A8LA 4QEHA 1XYMA 3XISA 3IUHA 1XLLA 3N4AA 6XIMA 1XLHA 1XINA 1XIIA 5H1WA 3U0HA 3VNJA 1XYLA 2X7VA 4ZB0A 3UU0A 4J4KA 1TZ9A 3AALA 3C0QA 4YTRA 1DE5A 2GUBA 3ITYA 1DXIA 4QDWA 1XIHA 2HCVA 4YTUA 3KWSA 4W4QA 3TVAA 5XIMA 5C9ZA 1QUMA 1XIMA 1DIDA 1A0CA 2XINA 5B7ZA 1XYBA 3L23A 4XKMA 1YX1A 3CNYA 3ITXA 4PFHA 1I60A 1XIDA 1XIGA 1BXCA 4QDPA 3M0XA 1MNZA 3CQHA 3C0SA 3VYLA 3BWWA 2NQJA 1S5NA 1O1HA 1GW9A 4US6A 4A8IA 4A8NA 2G0WA 1I6NA 2OU4A 3BANA 1QTWA 1XLGA 2J6VA 4DVOA 4XIAA 3VNMA 1XLFA 4EACA 2G4JA 3ITTA 4DUOA 1S5MA 1MUWA 1QT1A 3KBWA 4QE4A 5EMKA 2QW5A 2GYIA 4QE1A 4HNOA 2GVEA 3KCOA 4X60A 4YTSA 1XIFA 7XIMA 6XIAA 4YTQA 1XLIA 5B80A 3DBNA 3DX5A 3BZJA 2ZDSA 5B7YA 8XIAA 4K3ZA 3BDKA 3IUIA 3JU2A 3M0LA 3CQJA 2XIMA 4ZB5A 2Q02A 2GLKA 4QE5A 3CQKA 4OVXA 1XLMA 1CLKA 1XLDA 3XINA 3U3HA 3UVAA 3KBNA 1XIEA 3GNXA 8XIMA 2I57A 3QXBA 4ZBCA 4QEEA 2NQ9A 2XISA 2QUNA 3WQOA 3QYSA 3VNKA 9XIAA 3NGFA 1XICA 3LMZA 3P6LA 5H6HA 3M0MA 1OADA 4GJJA 3ITLA 3KCLA 3AYVA 3VNLA 4HGXA 1XLKA 3UA3A 4XISA 4EAYA 5AVNA 2QULA 3FVMA 3C0LA 1XLCA 2I56A 1XLJA 1XP3A 3M0VA 1XLBA 1XYCA 5XINA 2QUMA 4Q7IA 4G56A 3AAMA 2ZVRA 4GJIA 1XYAA 3CQIA 4GQBA 5AVHA 1A0DA 2HK0A 5EMLA 4ZB2A 3TC3A 4X63A 3UXIA 3QC0A 4LNCA 1DIEA 4X61A 3VNIA 3XIMA 4K1GA 4PGLA 2X7WA 3KBVA 4XSMA 2NQHA 3IUDA 3KBSA 3CWHA 1K77A 3P14A 1XLAA 4E3VA 1XIJA 4XIMA 5XIAA 4A8RA 5EMMA 4HHMA 3QZAA 3OBEA 3ITOA 3M0HA 4KW2A 3M0YA 4XSLA 1XIBA 4YTTA 3BZGA 5I7GA 5TNVA 3AYTA 1DE6A 3ITVA 5J8LA 3KBMA 1D8WA 1XLEA 3KTCA 9XIMA 4GLEA 5FA5A 3KBJA 1BXBA 1A0EA 3UA4A 5EMJA 1XISA 3KCJA 4HHLA
chains in the Genus database with same CATH superfamily
5A6JA 4P8XA 5FF4A 4EP8C 4UFJA 3W1UA 4HVXA 3BLLA 3SADA 3V1HA 3VIKA 3QZEA 1X7FA 4GQGA 4KERA 1CW2A 3OGRA 2EGZA 4IQLA 3LHUA 2WM0A 1VCVA 4CN4A 5IFPA 1ME8A 2R1KA 3W7PA 3AXIA 3B0YA 2OTDA 4DJFD 2VX5A 3QV8A 2YXOA 2WK2A 3WBYA 3ZQ9A 2YW4A 1MYRA 2J6VA 3MQTA 4C6DA 4MDOA 1EPXA 1HKKA 1JF6A 5B80A 5J5RA 5CZSA 3L5MA 5JU6A 1TJ0A 1R7OA 4MB5A 2XM2A 1Z42A 5E70A 4E6MA 1QI0A 4XD6A 2VP8A 4PUEA 3EGJA 5K9CA 1SO4A 4JQ4A 2VC7A 4KH2A 6ENLA 1OADA 1E6NA 2WBGA 3GVWA 3WH6A 1M03A 1FHDA 3W02A 1K4HA 4H4IA 5KZ6A 2HK0A 5EMLA 1H09A 1HTIA 2EQDA 3U7BA 2GWGA 4TVDA 1VCFA 2O7QA 2XPKA 3WLRA 1HP5A 1RD6A 4HA1A 3W86A 1W9XA 2DQWA 2QYGA 3NGJA 1BTMA 2WPBA 4HA4A 3RPTA 3WLNA 2JE8A 2ZUWA 3LHWA 5EFFA 2O9PA 4X2PA 4CQ9A 1H2JA 3H7UA 4IUOA 3TXZA 2GOKA 1Q6LA 4UMCA 2MNRA 1TV2A 4IL2A 1QUMA 3ABZA 4LAKA 4JTRA 4ONVA 1WKEA 3TTYA 4PL2A 2OVLA 3VGHA 2CIPA 3NQ7A 4K1WA 2V2CA 4AB4A 3W4RA 5M1TA 1IQ8A 2HPMA 3N2CA 4UTHA 1HF6A 1V02E 2HMCA 3DX5A 1NIUA 3MV11 1V93A 2YB1A 2PP3A 2XIMA 2QJNA 3CB3A 3GVVA 1H61A 4B5WA 4Q6JA 1GT8A 5A6BD 5H6HA 3W7DA 4V27A 4FI4A 2ZRXA 3SIZA 2Y8VA 3MO7A 1UW9A 3JZUA 1J4EA 4J3SA 4GJ1A 3R8RA 3WLPA 4GGHA 3IVSA 1JDEA 3P14A 1RQEA 3NVTA 2AMXA 2RDTA 3LI1A 1J0KA 4LW7A 4O53A 4PUNA 3S1UA 5A8GA 5BMWA 5FSDC 2J47A 1J5SA 2Y6ZA 4IMDA 3W88A 1D7KA 3E1F1 4D8AA 1AZ1A 2ZRUA 3TYCA 4LCSA 1IZKA 1I2PA 2VRJA 4UFMA 2NW0A 4GA8A 3B04A 2HE8A 1O94A 2DT3A 5BWFA 4NJIA 2PWEA 3G0SA 3NO5A 1OGGA 3E2VA 4JFWA 2AL2A 2BHZA 4TMBA 3TJIA 1I6NA 1S5WA 4DVOA 4Z17A 4ZO7A 4O1EA 4RZ4A 1L2UA 1RLCL 4AIOA 4AX7A 1ZJIA 4CUCA 3SW6A 3QW4B 1ZZMA 3GX9A 4KESA 4BR1A 3ZO9A 2GJXB 3VZZA 4UBPC 5F4SA 2VEIA 1U22A 5D38A 1UMLA 3TYZA 5AKQA 2ISFA 4HNCA 1REQB 4O11A 1UZ1A 1QPRA 3ITGA 4K39A 4PUJA 2QVNA 2BTMA 2IMRA 1XX1A 2RGLA 1WKYA 3VIGA 3AAMA 3PJWA 4TUFA 3B9NA 4GY1A 1EIXA 2IKIA 3VKBA 1QI5A 4HU4A 4ICNA 5I09A 4WKFA 1HGWA 1TVLA 4CQCA 3A12A 3HN3A 2Z1XA 3H54A 2ZDRA 4ZVJA 3D3FA 1M6JA 3BAXA 1XCWA 2PTYA 5C70A 3NM3A 3TFXA 3EB2A 1J10A 4ZR8A 3RX2A 4BF7A 4D71A 1ZLPA 3LMYA 1NOFA 3G8EA 1JDFA 2CCRA 2GOUA 4PMZA 3PUEA 1DQUA 1GVSA 5C9RA 2KX9A 5LNVA 5D4YA 3HIJA 4HA0A 3I7RA 2WBKA 4J35A 4BHYA 2RGMA 4E8DA 5IM51 1PXGA 3TZNA 4MMWA 1A53A 4Q4OA 3STGA 1S5MA 4WOQA 1AZ2A 2RUSA 3OPSA 4KEVA 1QNSA 4JIRA 4JIHA 5LHEA 4XKYB 5C5YA 1EJRC 4DI9A 1YNPA 1Q4NX 4Q6XA 2FH6A 3M0LA 3F4NA 3UFYA 4MPQA 4MWAA 1XUZA 3W7EA 4DO4A 2FFIA 3N3MA 3VDCA 2Y89A 1Z7AA 4IX2A 2NQ9A 2RJHA 4G7FA 4UFHA 1JRBA 4E2OA 2I7GA 3GD6A 2NUWA 4DJDD 5HQEA 4NT0A 4BY3A 3HQPA 1SW0A 2I14A 2NQHA 3DYPA 4O1DA 3WNLA 3DHFA 3W1NA 4H7CA 4MYAA 4IJRA 2J8FA 4BI5A 4S3GA 1SJCA 1WB0A 1GOWA 1KM2A 3SCVA 1V3IA 4H8NA 2A21A 3LN3A 1PYFA 1MZHA 1WA3A 2PPGA 3ZSSA 4MSSA 2V5JA 7REQB 5JQ9A 4LV4A 4IMGA 3QPZA 4QM1A 3WNNA 3DAQA 3TU9A 4AVOA 3F1QA 5GQBA 3EKGA 2FB2A 4UTMA 2PGWA 1KM1A 2FIQA 4UQAA 4LQ1A 3KOWA 4RNJA 3RCMA 2DORA 3BCDA 3ARVA 1OC5A 2VXNA 1EJXC 3PBWA 3APYA 1LORA 5K4ZA 1DVJA 4FAMA 3LPFA 1MUWA 3S2CA 1YMYA 3BCJA 1W5QA 4C6QA 1SGJA 1NP2A 1X39A 2CW6A 3SZ8A 2EXOA 3ENLA 3A4JA 1MQRA 2WXDM 2YDQA 4IIEA 2NT1A 1H49A 2GLKA 4UTTC 3GZ3A 4LF1A 1K4GA 2PD9A 4HSNA 2NLYA 1MEHA 1TREA 1WQ5A 3P81A 3NNTA 1VP5A 2BX7A 4Z1AA 4HGXA 1KRMA 1Q6DA 3UT0A 3NQGA 4LT9A 3GXIA 1VHCA 4G56A 2Y61A 1CWYA 3M16A 2E6AA 3Q65A 3I3BA 2GVYA 4EAMA 2GZXA 2R9RA 1POKA 1K02A 2BGSA 4YYCA 3W38A 1MQPA 1WP6A 1OD0A 1O5QA 4HHHA 2G41A 2X2GA 5TBOA 4MG4A 4W86A 1F6KA 1XUUA 4JIPA 3BJSA 4XG1A 4WJ8A 4X9YA 4GO9A 3LS9A 2ZXBA 1BQGA 1JYVA 3M46A 1UR9A 1W3TA 1SMDA 3VE9A 1GGOA 3NIYA 1V6WA 1LUCA 1V6YA 3N19B 1I4NA 1YXYA 3HU7A 3JR2A 4AZHA 3IJQA 4M80A 3S5NA 3V4BA 3UG4A 1W9BM 2VC6A 3T8QA 3QVQA 2YBTA 4X60A 2V2DA 2XTKA 3DBNA 5AHFA 3IUIA 2R1MA 3GTHA 3PANA 2BSLA 2OFJA 5BU6A 1NOUA 4YHEA 4TV6A 4F0KA 1W6TA 4KF1A 1ZS2A 3TYBA 4DLMA 1B4KA 4AW7A 3ARQA 3G1FA 3Q94A 2IKJA 4FR1A 1EC9A 1NAL1 1UA7A 2ESCA 3T07A 3WUGA 4NNCA 3RM4A 3P2VA 2EBNA 3L0NA 5ABGA 3HV8A 1FWEC 2ICSA 3BMWA 4IIFA 4P7OA 4M8UA 2A6NA 1OEPA 3W2UA 1E4NA 4F0MA 3RK8A 3FDGA 2Y7EA 1B3XA 2NLIA 3WD0A 3KWXA 1A0EA 2J66A 5DMLA 2V9DA 3K30A 1BYAA 2DJLA 4OBSA 4HOZA 3TOYA 4QITA 3N2BA 2VZUA 1GHSA 4QG8A 2Z0IA 3TA9A 4FB7A 3HBLA 1PIGA 3NZGA 4NX5A 5DCDA 3EXSA 5T91A 1TWIA 3HGJA 2GK1B 3CLWA 3VD3A 1OFRA 2YA2A 2SFPA 1I60A 4PUDA 4JFTA 3DKJA 5AHIA 3LV6A 2V38A 1LRQA 5C2GA 4GINA 4XIAA 4O19A 3AZTA 2GQ3A 4KFPA 1KFCA 2WWCA 1DWAM 4Q8TA 1UKOA 3MMWA 4H6QA 4IG2B 4DBDA 1JCJA 3H2NA 3TFCA 4JTFA 2Q8LA 2BFGA 1UWTA 3DIPA 4YPJA 3SRHA 4ZXOA 4PC8A 1H50A 5A2AA 4B3ZA 3TWAA 1OFEA 4WKHA 4C6JA 2QLYA 1W8GA 3IRDA 4O1BA 3MPGA 4R5EA 3T4CA 1EA0A 1SZEA 3CH0A 1AMKA 2WCGA 2XVKA 4B5XA 4Y8EA 3G3MA 3AU6A 2WANA 1TIMA 2DH3A 1TA3B 3ITOA 2D24A 3AI0A 2VFEA 2QJHA 3EXRA 4WXYA 1U1JA 1ZAHA 1E51A 1RXOB 3IUHA 1Q7MA 4AWTA 3R0UA 1XW8A 1Z8AA 4ALDA 2MANA 1K1DA 4ERIA 3VOJA 1W5PA 1OG6A 5B7ZA 5I03A 1FH8A 3CTLA 5JH2A 3AWNA 4DUXA 2VQUA 3CV6A 3W25A 1S2WA 3WMLA 4MZ8A 5JBEA 1UZHA 5FOOA 4FF7A 5LA1A 3FA4A 4AWEA 1HJWA 1E0XA 3K4WA 4H19A 3W70A 3DGBA 4JFVA 3B8IA 1M68A 4YU1A 3OP2A 5BCAA 8XIMA 4UWMA 4US5A 5DQPA 4CD7A 2D22A 1WKDA 1AG1O 2Y63A 2GJLA 4PMRA 4IICA 4HZ6A 3GTNA 4Q8UA 1JI2A 3WLSA 3P61A 4X63A 5GPRA 3PUDA 2P0IA 2CFFA 4NI3A 1J6OA 5DBUA 1XLAA 2VUNA 4JHMA 4GYPA 5G4WA 4OECA 2BG5A 5G4EA 4YTTA 5TNVA 4ACZA 4WX2A 3IJDA 4JX4A 3NOYA 2JK2A 4DJEA 5LGXA 1FWDC 2B7QA 2X2YA 4JGDA 2QUVA 1HJVA 1RK6A 4J3ZA 1TUXA 2F61A 1XCXA 4XV0A 3NSMA 2FFCA 4QX4A 2BV9A 1TV4A 3DH7A 3GC4A 2BLEA 4Z1YA 3OQEA 1DIDA 2ZXQA 3GVQA 3SN1A 1Q2SA 4CQAA 4DNHA 2GFTA 3C56A 3LHYA 4JX5A 1S2TA 4KRUA 3BXWA 4H41A 1A47A 3OGVA 2O4MA 3ES8A 1Q6FA 1X1OA 4GD0A 3VPLA 3VX0A 4PB3A 3N25A 1RJRA 2E6YA 3UYCA 1QNPA 4NQ1A 2XM1A 4JYFA 4E2BA 1BWVA 4RW3A 1Q8AA 4OZOA 2P1FA 3G5EA 3FX4A 2ADAA 1EGVA 1XC6A 3WLLA 3QM3A 5EFDA 1S2UA 1V4YA 3AS3A 3OG2A 3OIHA 4EAYA 1UP3A 1QOPA 1W1PA 1R3SA 1IZCA 1Z89A 3NUKA 3T0DA 3W1QA 3Q37A 2B7OA 1ME7A 3EX1A 1BRLB 3UR2A 5I3GA 3PHAA 1TX0A 1JCXA 4OGZA 3SSZA 3MHUA 1B9BA 3HG4A 3RMEA 3WLIA 3EWZA 4GUGA 3E0VA 2Q3OA 1UR0A 1O95A 3NZQA 3ERPA 4W7WA 1JF5A 3F5LA 3PSVA 3PG8A 4K37A 1Q6OA 1SVDA 3LK6A 2VFIA 5K4XA 2WHMA 3WIJA 5LA2A 2E9LA 1P1XA 2PF8A 1MW0A 4NNBA 3TDFA 1XSIA 4HPNA 4LVFA 3II1A 1OF8A 1LTDA 3W9ZA 2CPUA 4BEUA 4QJ3B 4QBXA 4ATDA 2BDQA 3H4XA 4W8LA 2OWXA 1QR7A 4BKNA 2GJXA 4A3HA 3W6YA 3V36A 1MZRA 4M81A 3IVTA 2G97A 1XL9A 3FJ4A 3W72A 3N29A 1EGZA 3W7CA 4ZOAA 1REQA 4C5YA 3GDKA 4IIBA 1J9YA 1IXOA 3BLKA 4UC5A 4HZMA 4U28A 1N8WA 4L7ZA 4H3DA 3W1TA 3L5LA 1TTQA 4AD3A 3CEPA 5E1QA 3MVIA 5CGQA 3G18A 1LL4A 4AEFA 3CAWA 1UUMA 5FI8A 1T96A 2YCEA 5FEPA 3WF0A 3W73A 1JZ4A 3T05A 3U4FA 2V3EA 3MHFA 2CHNA 4ZQMA 4R7OA 2WJEA 2IKHA 4IT1A 4TX6A 1V0KA 4CNNA 1ZY9A 2Z26A 3GH5A 3VI2A 4ADSA 4HN8A 4R85A 4U5IA 4HHLA 5I3FA 4GC4A 4FX6M 4Z1DA 4HN4A 1P0EA 2ABBA 1U2YA 4FMVA 1SZNA 5PTDA 3N34A 4LVGA 4DWSD 1R3VA 1XRFA 3CMFA 2Q3RA 2PDUA 4AD2A 2WCAA 3R0DA 2XINA 4DBWA 1ADDA 3T2QA 1VZWA 4MNLA 4WLCA 1WZLA 2XIIA 3R10A 3GHSA 1QBBA 3VC6A 4N9CA 3PZQA 1ZBCA 4DYJA 3VNYA 4MJ2A 1TWWA 3TLQA 3CL8A 2ABAA 3HB9A 4PYSA 4XKYA 1XSJA 3OVGA 1QRQA 4YTSA 3N2XA 5FF2A 1GOKA 3M6DA 3W6MA 3USBA 4GCXA 4OU1A 5DELA 3B40A 1LYXA 4ZZ9A 1GJUA 2WMIB 1W1ZA 2PLKA 3WQ4A 3REQB 1AL7A 2ISSA 1GOIA 1RQHA 1VPYA 3MP5A 3LEPA 1GJWA 1GOOA 2V5BA 4AYGA 3H26A 3SUSA 2Q01A 3BG9A 1UMYA 1CPUA 1FCQA 4GVFA 4L4OA 1PHQA 2DEPA 3LCIA 1J11A 2BWGA 1FCBA 4EKJA 1F5ZA 1YHTA 1X6NA 4BQ2A 4WCJA 2YBVA 3IGHX 4XSLA 4J3XA 4OTKA 3ZZ1A 3AZRA 3KW3A 4F79A 1FFRA 4AHQA 3KHDA 1U30A 2HS8A 1B9ZA 3GDRA 4K68A 1WXYA 1QAPA 4UQCA 4OBRA 1LWHA 1XLLA 2ON3A 2CXEA 1XIIA 4TQTA 2UWFA 1ML1A 3PBMA 1GQLA 5DEZA 3CV1A 3CHFA 1BYBA 3WH9A 4GNJA 3LTYA 2GQ9A 2CXGA 1M5WA 3NEHA 2PODA 1NSJA 3FA3A 2OSYA 1OINA 2HJPA 1A5OC 4YMZA 2ZZ3A 4BI7A 1BLIA 3UY7A 3VOIA 4CNPA 1QTWA 4IL0A 8A3HA 3TYAA 2TAAA 3DG6A 2EG8A 3KL3A 4GUFA 3NXLA 4LAUA 1JGMA 3GXPA 3I65A 5JBDA 4B9YA 1HL9A 2VGFA 4K3ZA 4JDYA 3LD5A 3S1XA 4J1OA 3PWGA 2D0FA 1FXPA 4KEZA 2XN1A 4WGXA 1YDNA 3UJSA 1UH3A 2NV2A 3V5FA 3EYPA 4BWLA 1LRTA 3SQSA 4M7SA 2HV5A 4ACYA 3A6OA 1JRCA 3NQFA 4LXFA 1KR0A 1E4LA 1ISWA 3QGKC 4DJFC 2VD9A 3WQFA 2V3DA 3A3XA 3A9BA 3CHVA 3PR2A 4AH7A 3PPHA 2OR2A 1BGGA 3INPA 3BV4A 1I0DA 3N12A 4MLRA 3KOXA 1EKOA 3MSYA 2V3GA 1GVFA 3UWYA 3GW3A 1F3WA 4LGXA 3R1ZA 2A7NA 5BZAA 3BTNA 2QDDA 5CSUA 5CZJA 4AEEA 1N8IA 4EXBA 2R1NA 4FXRA 5AZ0A 4LYKA 2GGHA 1XLGA 3O6YX 2P88A 4HK6A 2VUYA 3OYZA 8RUCA 2C1GA 4F2UA 3D6NA 1XHGA 2QPUA 4O0KA 5D8ZA 2YDAA 3UESA 1KBKA 4YVXA 1MEIA 3W2JA 3GAKA 5BOFA 4JZ5A 2QV4A 1UASA 2CBUA 3GNXA 4BF9A 1OCJA 1A4MA 2I1OA 1KXTA 4ZBCA 1DJIA 3PZVA 3G24A 2Z6JA 4OV4A 4YCPA 1PE1A 2XG9A 3FEMA 2AAAA 4DYKA 3AXMA 3W2LA 2F6XA 3F5KA 1TYGA 5JIPA 1LLZA 3TJXA 3URQA 1I8JA 3L2IA 4E3VA 5CPMA 1VRXA 3TTSA 3DC8A 2X1SA 5I77A 4L4LA 1UD2A 3C0JA 3BGAA 4DB7A 4GX9A 2OT1A 3RAOA 2YLLA 4DUWA 4DN1A 3AHTA 4PL1A 2I5IA 1TPC1 3DFQA 1X7IA 3OHIA 1JYXA 1CXEA 5A6KA 3VCCA 3AALA 1TWDA 3UCCA 2HCVA 3OVRA 1R3YA 1P0DA 3DI1A 4M29A 4C1NB 2G50A 1KW1A 1J2WA 1LL7A 2GK1A 1RA5A 1Q7QA 4UR7A 1Z32X 4H6KA 1MI3A 3WUBA 1VEMA 3LGEA 3P62A 5EYWA 1PV8A 3IK4A 1K03A 1OT1A 4DAFA 3AFBA 1AQHA 1VIZA 2E68A 2Y5EA 2EG7A 3GZAA 1LOLA 1XIFA 2VVSA 2PUZA 3F03K 4HOWA 2ZA3A 4EK7A 2VFHA 5DBTA 4GZ7A 1HGYA 4AZBA 4F8XA 5GNYA 4IG2A 1P0BA 5CZKA 3O0FA 3V0SA 3F4WA 5D03A 4DNMA 1ISYA 3BC9A 4EPEC 1XGEA 3LMZA 1LG2A 5FJRA 3S4TA 3M0MA 2EPLX 1ZBVA 3HTWA 4GBUA 3WJXA 4DPQA 1XLBA 2Q6ZA 1NP0A 4IPLA 4WDTA 1DQWA 1L6GA 4POCA 3G2GA 1R0MA 3N2OA 5C2XA 3SCUA 3A21A 1TA3A 1W32A 1HL8A 3G1XA 3OIXA 1GYMA 1ZFJA 3FKRA 3L68A 1JJKA 3QKZA 3CUGA 3LRKA 1X6LA 5EMJA 4ATWA 2QDGA 2XVGA 2J7GA 4GFIA 2J7FA 3QHOA 4L80A 1QK2A 1DXIA 4U3CA 1BKHA 2ZTKA 2VI0A 2D2GA 3FIGA 4EANA 5H2ZA 4L64A 3GU2A 2XFWA 4K7VA 3B9DA 3P3BA 1JUEA 2VGIA 3RU6A 1C93A 2PDBA 4WQ6A 1NDVA 4S2BA 3VCRA 1O5KA 4EWJA 4G6CA 2VCCA 1G67A 1EC7A 4WDUA 5D30A 4AY8A 1R38A 2QAFA 1PWLA 4AHPA 2Z1WA 4HIBA 3WQEA 4LVAA 4QTGA 2VX4A 4GYKA 3KCOA 3VZYA 3I3EA 2ZFAA 1W2VA 1BXNA 3WK0A 3WBWA 4N9BA 4D6FA 3KAOA 1TJ1A 1FWNA 3NVDA 2PGRA 1TR1A 3UPBA 2JF6A 5DN1A 3SCPA 2VRKA 1E5JA 3KCLA 4NY2A 3HF3A 4MWAD 3RU8X 2EKGA 4R33A 2OQHA 3F5JA 3DECA 3TA6A 4MZYA 4HU3A 2EKCA 5A94A 4GO8A 2QVHA 3P93A 4XIMA 3VKCA 1XIBA 1XYZA 4R53A 3NQ6A 2HBVA 2DSUA 1SMAA 4OJYA 2DH2A 3FGCB 4GISA 4MZ1A 4KS0A 1QHOA 1DEDA 2HK1A 2YA0A 4QEHA 2W92A 2QJMA 3EWUA 2E8ZA 1UJQA 1OCQA 2IW0A 2UY2A 2ZC8A 3EOLA 4Y8FA 3SDOA 4PN2A 4DM2A 4ORIA 2ZRWA 1PCKA 4J9JA 2C8NA 1W9PA 1LBMA 3W7NA 4XBJA 4NXSA 4W88A 4AD5A 4J3WA 1C8QA 3I10A 1E72M 1SFSA 3CC1A 1P0NA 2PP0A 1EHNA 1H1YA 1OM0A 1SUXA 1KC7A 2V2HA 5AN7A 3R8GA 4DZAA 4M1BA 1VQTA 3C2EA 1K7EA 3UJ2A 4QS5A 4B4HA 4IXXA 1FWCC 5CZTA 4JTDA 3CQJA 3TN5A 4H9XA 1S2VA 2NUXA 1UB3A 3QXBA 3LPGA 3M41A 4B4FA 4G5DA 3WENA 1F07A 3MYOA 2WZEA 3E2QA 3PF3A 4LAZA 4Q22A 1M3UA 2PD5A 5T8GA 2F6UA 1BVWA 1CGVA 1E6XM 2HWGA 1IV8A 1P43A 1JD7A 3VNIA 1B5TA 3XIMA 2ZICA 3EPMA 3DC0A 1H0GA 1YTKA 2OWWA 2ZE3A 2VZOA 4QQUA 4IX0A 3LLXA 1BRLA 3TQVA 2J77A 1DWJM 3W7OA 4F9JA 2OX4A 1DJWA 2FLIA 2X16A 4FR6A 3AIBA 4XAGA 3R25A 5EL1A 3TSDA 3GHRA 1RVKA 2DVTA 4H04A 4KIEA 1US3A 1TPFA 4Q4PA 4GE8A 5CQ1A 3VA8A 3M5ZA 3B0XA 4MLJA 4RL3A 4B90A 3OBAA 1NDYA 5KZDA 2PDCA 4Q4QA 4QDPA 4IZGA 3M5YA 3TR2A 3NSNA 1PX8A 1W9UA 4L61A 1BF6A 3TAOA 5LSMA 1TB3A 2WMFA 3PS7A 5KSWA 4R27A 4ZA0A 3QN3A 3EDJA 4DBUA 4HNOA 3WQ6A 3M5XA 3T0CA 3BUVA 5I07A 1J0JA 1PS9A 2DZXA 5F2LA 2BOFX 2DSZA 4B5TA 2PWVA 5LHFA 3DKLA 2WHLA 1E3XA 3OW1A 2EJ1A 4GH3A 2YYTA 3RIKA 3VMNA 3M0JA 1A3HA 3MSGA 4U31A 1XC4A 4TR9A 2INEA 1XLJA 1E15A 3EX6A 2DT2A 3TW6A 1TV3A 2VRQA 1A0DA 3W6LA 2VQTA 3AZSA 1OY0A 1EUNA 4JKLA 1IWBA 2RFGA 4GH1A 3M0HA 3LXAA 2DUAA 3C8NA 1HKMA 3V0UA 2D0HA 3AO0A 1PSCA 4KCWA 2DT0A 2XWDA 2AKZA 1D3HA 3VNJA 1BYCA 5BU9A 1K8XA 2ZCGA 5BRBA 5HWMA 3OZPA 2CU0A 3KFTA 2ONEA 2ZZ6A 4RDVA 3WQ8A 4M3PA 3NQAA 4I7WA 3TSMA 4FNTA 5HR7A 4INFA 3E49A 1V3KA 2GGGA 1O1HA 2Y7GA 2VD8A 4D6HA 4AFYA 3CHDA 1UQYA 4HSHA 3PJTA 1JPKA 4Z2GA 2VL4A 1SPQA 1UZDA 3VGEA 1I1XA 2BXZA 4RNHA 4YWIA 2W3ZA 3AHVA 2OYKA 1YW1A 1E6SM 3LPPA 7ODCA 3BL3A 1BSIA 4O18A 1C8XA 1A5KC 3RF9A 3REQA 1PUDA 2DW7A 2D3NA 3LSBA 1IT8A 3Q58A 1EYWA 4RZBA 1ADOA 1AJ2A 1OSEA 5HJYA 4LH8A 3B0UX 4HMEA 3BMVA 3QR1A 3DZ1A 4QJ4B 1TV5A 1MRAA 1ZB5A 2ZUUA 4Z1CA 3TTQA 3RLVA 1H1NA 4PGLA 4GIYA 1GKRA 5K7JA 1L9WA 1EWDA 1IWAA 1OJXA 4PBGA 3WDJA 4Q8QA 4G7EB 1JXKA 3C52A 1DE6A 5J8LA 2DZWA 2HS6A 2E6DA 2QPXA 5FF0A 4W85A 5CLTA 3O06A 4WEVX 3NQCA 4G1KA 4XZMX 1XDLA 3WFAA 3BAWA 2E1DA 3W24A 4B3KA 5HMSA 5TAOA 5BROA 4FIRA 1EUAA 1MSSA 3HPZA 3E2SA 3HPXA 4Y9PA 1XIMA 3VU2A 1IXNA 4C6PA 3NL6A 5HUPA 3BOXA 3MTWA 3ZM8A 3KP0A 1HJXA 1TPVA 3M7WA 1ODUA 1UWIA 3WG6A 1ESWA 2RDWA 3O2LA 3RN6A 3TN3A 3VIFA 2OLSA 4FK9A 1JPHA 3S8HA 1CCWB 1ALDA 5G2WA 2F2KA 4N4PA 3PZGA 4L9ZA 7XIMA 1EB3A 2NT0A 4CEUC 1NARA 5HNUA 4K38A 4NRRA 3VOGA 2W4XA 1IE7C 4PCSA 4Q8PA 3CAQA 1KGWA 2DUXA 2PDXA 2I57A 3GC5A 2Z29A 3DFYA 3V5OA 1JGIA 4S3CA 3FNDA 1VLIA 4NF7A 4C6CA 4EPBC 3FOKA 3N9SA 1ZENA 4WK9A 3BH4A 3JVAA 4US5D 5D8WA 1OBAA 5C9WA 3QC0A 2PMQA 1W5OA 3HPSA 3MW7A 2RDXA 3PBGA 5F2MA 1Q63A 3SRDA 2G3MA 3BG3A 2QGYA 4XZNX 3TUUA 3WNMA 4HNNA 4IFKB 2P3ZA 3AMCA 4ZQPA 4JN8A 1PZ0A 1W31A 1DWIM 3MI6A 1XLHA 3RRAA 3U0HA 1H7RA 4WGHA 2VOMA 2CNCA 2VC5A 2ZKMX 1BG4A 3WEMA 4CCDA 1ITCA 4M24A 4DJED 3CASA 3QPEA 2YCIX 3O6CA 4L4PA 2CKSA 4NIRA 4JQAA 4H01A 1OT2A 2JBMA 3BURA 4JEQA 2JQXA 3MDUA 5FKYA 4ERGA 2NVAA 5EMKA 3SN0A 3NZRA 1IR1A 2C71A 1CXLA 3BOLA 4FNRA 1BEUA 4LOCA 4QLKA 1O5XA 1DHKA 4TVCA 1TPB1 1V3HA 5DCBA 4F4RA 1TFVA 1W1IE 3VNDA 2PGEA 3WK3A 3DYOA 4DPPA 1FTXA 3MU7A 1ELSA 2VGGA 3MP4A 2ISWA 3LCFA 3BVJA 4LWWA 3QLDA 1GNXA 6A3HA 4C6LA 1KM0A 4WVXA 3ICJA 4LUJA 3ONCA 3NJ3A 1VPXA 1ICQA 3UBPC 4MY8A 1GQJA 3WLMA 3CGTA 3I6RA 1O68A 2ZBTA 1HKWA 2OEMA 1HW6A 2ACRA 3GY1A 2OSWA 1HX0A 2XDFA 2GSJA 1CECA 2DZPA 1OQFA 2NX9A 4FIQA 2PDIA 4GVIA 1G5AA 4ADUA 2J62A 1VFOA 3H8AA 5KEZA 4IPJA 2VEKA 1EJTC 1F8MA 4E38A 1TZ9A 3MI2A 3EWBX 4V15A 1TPH1 4GZJA 2VYOA 4WSJA 1XYBA 4ROPA 4IMFA 3R4IA 2XH7A 5CPOA 3L4TA 2QMJA 2V30A 1PTGA 3I4EA 1VYPX 1ZCOA 3ZMRA 1WX0A 2OU4A 3RILA 3BJTA 2E77A 3LHVA 2XVLA 4LV9A 5AC6A 2HVNA 3CZEA 3SRKA 2A1YA 3H7RA 1Q3NA 4MJZA 4GI6A 1QWGA 2QUTA 3LHZA 7ENLA 1MXSA 4KPLA 1W3IA 1VBGA 5TIMA 1JAEA 2DZBA 2JKAA 4U3AA 1WAUA 3RXZA 2YCJA 1KCLA 4LS0A 1PB0A 4ECLA 4GVHA 1XLMA 1AW1A 1CLKA 4J3VA 4MY1A 3RPMA 3NPXA 1VYSX 2BGQA 4WRHA 3CPGA 3CJPA 1WUEA 3CWOX 4AQLA 3H7VA 1TE6A 2Z1KA 2EPNA 2TRSA 2CWNA 2DW6A 3M0VA 4DX3A 3VZXA 1DXEA 1FWSA 3QC3A 1GOQA 2GDQA 4F9DA 5I24A 5AECA 3VM5A 4TVUA 4GQRA 5GJMA 1ITXA 1LF1A 3KXQA 1TRIA 4F0RA 1JULA 1Q85A 5AYBA 3OG3A 4X0NA 1ONRA 2XU2A 1MXGA 3AYTA 1JI1A 5BOOA 1UR1A 1SQ7A 3W29A 5BWAA 3WLJA 4W87A 4Y9AA 3EXTA 4I8DA 1KBJA 1XYMA 3VD9A 2BBFA 1AA1B 3L2LA 5BNKA 2PDWA 3A47A 3PTQA 3USZA 3OLIA 4NILA 1TCDA 4IHCA 1EYEA 4W4QA 3CUIA 3G1YA 1JZ8A 1IXQA 4HYVA 1ENUA 1MNZA 2UZ9A 4H9VA 5I5RA 1QPNA 3LU2A 4I6VA 5EY5A 1PWMA 1X1ZA 1IR2A 1P1MA 4HMNA 3ES7A 1ME9A 3EPNA 2PFHA 5FF3A 2BVTA 4RV3A 2H8XA 2QCNA 4PA8A 3WFLA 1FWHC 2XN2A 1QNQA 4A21A 3M0ZA 3N11A 2CETA 1EEPA 1SJDA 2JGYA 5A69A 1TWZA 2DPEA 3HJEA 1CXIA 3W82A 4DWSC 2DSVA 1QPQA 4MFDA 1B3ZA 3A5FA 5BMXA 4JOMA 4H00A 4FSAA 1UWUA 3GG1A 4MYXA 4CQBA 1LBFA 3BSGA 4QAWA 5BXPA 1GQKA 5MHBA 4PEEA 1K77A 4WKAA 5D33A 1C9DA 3LZ3A 1J8VA 3KVJA 5LNRA 5I7GA 1EF3A 3IJ9A 4L65A 3MUXA 1JNEA 1QWKA 2YDSA 3L5AA 3W7JA 2ZC1A 3FGCA 3N2MA 3WQGA 1ECQA 1HO4A 5CPNA 3N9KA 3E0LA 4UUIA 2A3EA 1WAWA 4JDBA 5I00A 3P0WA 2X7VA 1UD4A 1I2NA 2NXGA 4PCNA 5CCZA 3CH9A 2HROA 2PB1A 3NA8A 4LS1A 2DVXA 3RNDA 1JCTA 7TIMA 3QLLA 4Z2LA 4FOJA 3KLKA 1KTNA 2NXHA 3EX2A 3MJMA 3E02A 1EXPA 3CMJA 3WZ0E 4DY1A 4HU8A 4YL2A 2V8ZA 1AL8A 3V0TA 4NZJA 4LUYA 5FSEC 2DY3A 1EFZA 3PZUA 4HZ7A 4HB7A 3UZYA 3T0BA 2YL6A 3DYMA 2X40A 2W79A 1AQMA 3V18A 3QZ6A 1KCZA 3WMBA 2Z27A 1XYCA 3EKZA 2QPSA 1RCXB 3URNA 3L4UA 5C54A 4GHRA 2GVJA 3TC3A 4LYRA 3MY9A 4LYPA 2OMAA 4I90A 2OELA 2VJXA 3CO8A 1W54A 2YYUA 2WC7A 3P7YA 1VBHA 3P8IA 3UXLA 1IIHA 4WY0F 1QCWA 4JTLA 1VENA 3KP1A 3B06A 2X1RA 2YL5A 2BHUA 2WZIA 4MB3A 2WM1A 2O0TA 4O4VA 1OF6A 2Z24A 3GB6A 4B5SA 1R30A 4QLLA 3HPAA 1XPGA 4R7JA 5CGMA 2VZVA 1X96A 4O50A 3GNPA 5HMEA 1XIGA 1CGXA 3W2MA 5AC4A 2OEJA 3RFAA 4PEKA 1JQVA 3VINA 1KM4A 3TQKA 2AMGA 2XH2A 4UFLA 1OIFA 3LM7A 4JN6A 4EACA 3O9NA 3LA4A 1K7XA 1QOQA 3SY8A 2VTFA 2H90A 4OQVA 1KV8A 1QNRA 3EZ4A 3UZWA 3QJAA 3T81A 4U5KA 2Z2UA 5AYZA 1HKVA 4PR4A 5D32A 4MAZA 1S5TA 4J28A 4UOZA 1TV8A 2A7PA 2R14A 4JTEA 3WQOA 3GTXA 2PAJA 3H2CA 1E73M 3KRZA 2IPWA 2BP1A 2VFFA 1V8EA 1OGSA 3S1VA 3R94A 3IGUA 4BQ3A 4MOZA 4ZO6A 3KBSA 1GZGA 5CSRA 4JKKA 3T42A 1GVQA 4IWWA 3QFEA 3TTEA 3IV8A 4HSOA 2W66A 5SWUA 3MZNA 3QFWA 2BY0A 1TR9A 3GU9A 2BVWA 2YCLA 2VO5A 3W7KA 4DM1A 2EO7A 3L67A 1NY1A 3ITYA 4QDWA 3OZYA 4D6CA 5AHMA 5CSSA 4GUIA 5D2TA 2RHGA 2HSAA 5LIXX 1US2A 1QFEA 3A4XA 4MJMA 4CN6A 2ZXAA 4JTCA 3HFTA 3EDFA 3ZT5A 2BGNE 4W7VA 4Q3MA 3NQ8A 1V77A 3ME3A 1NWRA 7A3HA 3RITA 1AD4A 1V6UA 4PB4A 4OOZA 4B3LA 3VILA 2I17A 5FEXA 5H8PA 2VGBA 4MHBA 3IIXA 4QHRA 5LA0A 2XZ9A 4ORMA 1VHNA 4D9PA 1XBZA 4P7LA 1GQIA 1AQ0A 4HMDA 4DO6A 3LCXA 4F2BA 4D1JA 6TAAA 1CX9A 3LBCA 4MFEA 5HINA 1UOKA 3EMZA 4FLRA 1ONXA 1MMFA 4Z2HA 4X22A 4G7EA 5G2IA 1I2RA 4TTUA 3O0KA 2QEZA 4PMXA 3NFUA 2YLAA 3FV9A 4N9EA 2FB3A 1RPXA 2V81A 3RM9A 2GUYA 4G9PA 5CGTA 3GHUA 3OEXA 4Y96A 1M7OA 1WDDA 3D0CA 3LTPA 5FESA 2QKFA 1ICPA 1HN1A 3AUOA 1E71M 3BOFA 4LALA 2CESA 3PK7A 1FHLA 1OCNA 4JTSA 1XBXA 2R94A 2J4GA 2PF0A 1RH9A 2F2HA 2PU1A 3E96A 3SQMA 4JAWA 1JPMA 1VBJA 4G2DA 4HPJA 1R3RA 4YHGA 3DFTA 3IIPA 1NFPA 5DRIA 4KFNA 4O1CA 3KDNA 4XQ6A 5HANA 1E1CB 2HE5A 1VPQA 2Y1HA 4K8HA 2QDHA 4GG9A 4ZGYA 4GJJA 1CLVA 2ZTJA 3TTOA 3BAIA 2QUMA 2YFNA 1ISZA 3PN8A 3SBFA 1H7XA 2W5FA 3B9OA 3R89A 5DY3A 1FUYA 3LERA 1GEQA 3GFZA 1XQKA 2CWXA 2IQDA 3W28A 2C0AA 2NQJA 3PZOA 4I9TA 4RJEA 4IFKA 4QRNA 3HQOA 2FPTA 3O6DA 3UA4A 2X0HA 4HZ8A 5HNTA 5EMUA 4AISA 2GDUA 4LUSB 4A8LA 2AGKA 4E2VA 1G7UA 3FN9A 4W5UA 2XIJA 5LNUA 1OZQA 3DFHA 3W87A 1D3CA 5BRPA 1H5VA 1LWJA 4GIRA 1KGXA 3S2LA 1CXKA 3PUOA 2WHKA 1TQJA 4A2SA 3C0SA 3RR1A 2ZA1A 3PZ9A 3LCHA 1R8LA 2BY1A 5FD0A 1EZWA 1HUVA 1EP1A 5CG7A 3P5ZA 4LU0A 4LVBA 1K6AA 1S39A 2VFDA 4N6FA 4O15A 1LBLA 3WO8A 4YVPA 1ZBKA 4JQ3A 4O10A 2DZTA 3H21A 3T08A 3VMOA 4PMDA 2A5HA 2DJXA 1RHCA 2EF9A 3P84A 1GKPA 3VNKA 1P5BA 2XWEA 1IHIA 2EPOA 5FL1A 2QULA 3IANA 2YBUA 3AUJA 2JFEX 3HGRA 5XINA 4S3BA 4O12A 1TVNA 2FJKA 4CQDA 4ZSUA 1UPMB 3UETA 1F61A 3THQA 1FWAC 5A3HA 4M82A 3R0KA 3QHMA 4RK8A 4W93A 3S6TA 4V33A 1TJ2A 2A2IA 3A22A 3PFMA 1BQCA 2DVUA 1L6WA 2XIQA 4WR3A 2XUCA 1GG1A 1CXHA 1JCLA 4GZIA 4XTIA 2PWDA 2Q71A 3GXMA 2NSOA 3KZPA 3AXHA 3DHUA 2IXVA 4EWND 5AC7A 4B16A 4FEZA 3DENA 4KCTA 2X42A 2DT1A 3SUVA 3CQHA 3SURA 2FPVA 3EDDA 4LB4A 1UR2A 4DZ5A 2J7BA 3VIHA 1W1TA 2YFOA 2CLLA 1XG3A 3CB8A 1KQZA 3C5QA 3IJIA 1BHGA 4A6GA 3SI9A 4PE8A 3C2RA 5ABTA 4MUPA 3IWPA 1OWQA 4AD0A 4ZQOA 1UZ4A 3ID7A 3S2JA 4QJ1A 1XFCA 8TIMA 3BDKA 1NELA 1MQQA 5D37A 4KGJA 1FWWA 4OVXA 4UFKA 3S46A 1QBAA 2W9MA 1M7XA 1Z9AA 3TCEA 2QUNA 3LNPA 3EAUA 4XISA 1GPFA 4NYYA 3RO6A 3N2TA 2WSRA 1UROA 1VJIA 2J27A 2GJNA 3KX6A 3HV9A 4ILSA 1IIGA 4O17A 2V3FA 3AHXA 2DSKA 4GGBA 1B3VA 2IQTA 1FXQA 1PPIA 4LF2A 1JUKA 4PUKA 4L1WA 2DZAA 3S3GA 4UQBA 4TXEA 2ZX5A 3MJYA 2Y2WA 5D04C 4AXKA 2OO0A 3EDKA 3G22A 1SR9A 1RPKA 1VIWA 1TCMA 1TPDA 4XKMA 3W26A 3ZSTA 2ALRA 2WMKA 1WDSA 1DHPA 4PCPA 4HYWA 2WNZA 5H91A 1GK8A 4B2DA 1NTHA 1NDZA 5CJ5A 4W84A 1EDQA 3OB8A 3R11A 2IUZA 4BCEA 1KFWA 2NSXA 4NL1A 3ZWSA 2ZDSA 4EX4A 4L56A 4JBRA 3VUSA 3T8LA 5CPSA 5AC5A 5I2UA 5MKGB 3VGFA 4AZ5A 4PCFA 3M07A 4GUJA 3VD5A 1SFTA 1FWRA 1TG7A 1VCGA 1E1FA 4LRSA 4TO8A 4IGNA 3EOEA 3HQNA 2J78A 3L12A 3HG5A 2XYLA 3B8DA 1SM9A 1TPUA 5LIKX 3QKEA 4XSMA 1WNOA 1JPIA 1RCQA 4FNUA 3TYEA 3QGAC 2XVNA 2FMOA 1R3TA 3O8AA 3MVTA 4PTDA 4M7TA 4GQQA 4NU7A 3AIRA 5HUOA 1FP9A 5RUBA 2IPFA 3TWBA 2J8TA 1I2QA 4TX8A 4HNTA 1XISA 1F3EA 5J5DA 3GKAA 2XGZA 4W7UA 1B3WA 3ZFHA 1CBGA 2PTDA 3AU2A 5H8UA 2YIHA 4C5ZA 1MUMA 4BK9A 1TJPA 1L6FA 1NWTA 4CNUA 4XAFA 4C7DA 3BLPX 1PVNA 1VFFA 3DERA 1XGDA 1BF2A 4DWSB 3MUAA 4G1NA 3PPGA 2WQPA 4GXMA 3UERA 2FZNA 1GW9A 3NQ2A 1VRDA 3GBDA 3QW3A 1UD6A 1R86A 3M0KA 1PAMA 1TZ7A 3WFZA 4RDYA 2HDJA 2HXUA 4F3HA 1HVXA 4IJCA 3LG3A 3IIZA 3KVMA 4E8GA 1XCFA 1ISXA 2GQ8A 1FWJC 3MCMA 4NRSA 1OGBA 1QASA 9XIAA 3QYSA 3QTPA 3EX3A 4GY7A 4E4UA 1V7AA 3MBFA 5G4HC 2FHFA 4C7FA 1PZ2A 4UQDA 2WMJA 3KDOA 4J7RA 2I9UA 3GW0A 2QS8A 1ZL1A 4DLFA 4AZCA 1RJQA 2QMKA 4ZENA 1XBVA 3CPRA 4AMAA 5G5IA 1Q5MA 3GBEA 5KZEA 1OX5A 4HNLA 4BI6A 1K8YA 4HTYA 4NZ1A 2WKJA 1UC5A 2E25A 4JKMA 1L6SA 3ORWA 1EGMA 2YB4A 2CKRA 5E6YA 5HAOA 3GG7A 1UUQA 1MXDA 3KWSA 3B3DA 2VR4A 4BA0A 4Q8NA 3O3RA 4GQ0A 2Y62A 1LT8A 4JR5A 2PA6A 4W5ZA 4M56A 4PZVA 5I3JA 3L4WA 4QSHA 4LCQA 1JR1A 3JZEA 1UBSA 1V6VA 3C3UA 4MKVA 2CC0A 3S9YA 1US0A 3U5YA 1UIOA 3L21A 3TNBA 3TOPA 4YJ5A 2CLFA 3U8GA 2PGFA 3VDAA 2CLHA 4LYQA 5HPCA 4MF4A 1KRBC 1C3FA 1XRTA 3DI0A 1S2CA 1CT5A 3B9AA 4P8WA 4RZ5A 4RDWA 5C7HA 5FF7A 4IP7A 3G3DA 2FDMA 4XUGA 4MJ4A 1CGUA 4UQEA 4UR9A 3U48A 1EXBA 3MCNA 3OVQA 3SSJA 3R13A 4LB3A 2YCKX 3MMTA 1TO3A 4NSBA 3W1MA 2E5BA 3LBMA 1DXFA 2QJIA 2HNEA 4EPKA 3V5CA 1XSKA 1GEHA 1VLWA 3DU0A 2YPIA 5A6MA 9XIMA 3NPWA 3QR0A 4O13A 2NWRA 1JFXA 2VKZG 3UWQA 3TKFA 2PSNA 2IQ0A 1PZ1A 3WH7A 3UPMA 3BLEA 4LC6A 3NXFA 4RLIA 1O60A 2J25A 4REQB 3QH2A 2QJGA 1XM3A 4GWEA 1SZGA 5IHRA 3BV7A 3G8RA 1L6YA 1QPKA 4B15A 4FNPA 4US6A 1UR8A 2WV8A 4CNSA 5HR6A 4KRTA 1V0LA 2Q09A 3OLGA 1FWTA 2WVSA 3QPYA 3K2GA 2A6LA 3FAWA 4XBSA 5AYXA 3BW3A 1Y5VA 1Q8JA 3JU2A 4GIAA 2EPKX 4V2XA 2P8BA 3BSHA 2B4GA 3SCOA 1XIEA 3W75A 5DT7A 4QROA 4O1AA 5I3HA 3RHGA 4YS1A 4GABA 2BY2A 1G69A 2BMBA 2WQDA 5FJOA 1TKKA 3BQ6A 1WZAA 1KCXA 2PCEA 1KKOA 1V08A 3DG3A 1UWSA 5AVNA 3UWWA 4H7VA 3GDBA 4OBTA 4HT3A 3C8FA 3PPCA 3UXIA 2X7WA 5DMNA 3TONA 3CUHA 1WXZA 1HJSA 2X8RA 2NUYA 1OHLA 1E0TA 4U2YA 2QUUA 3CWNA 3TP4A 4R34A 3FXGA 4H9MA 1S1PA 1IEVA 1DJGA 3QSTA 4HD5A 1LQ0A 4L1XA 1OIMA 4ZB0A 1EOMA 2NX1A 1MDRA 1C7SA 1M41A 4XZWA 2ISVA 4WY0B 3C3NA 4Y2WA 1QMLA 1FFQA 1XH2A 1W17A 4MWAE 1RUSA 4PMJA 3JUGA 3BK0A 2G3NA 4KWUA 2DGAA 3E0FA 4ROQA 1ZGDA 3W7QA 4F0HA 1RP8A 2J9ZA 3BICA 4XD3A 3FY1A 2CZDA 4YLWA 3UR5A 3I6EA 3GLCA 2OOGA 3C2OA 2CITA 2R82A 3PG9A 1Q45A 1JYNA 3OQ8A 2X41A 2J9XA 3ARUA 3FLUA 4LUIA 4XD5A 2ZX8A 3GNRA 3KBNA 5ECVA 3VIJA 1JQXA 5ENLA 1P6WA 3O63A 4Q32A 3MB9A 1PDZA 4ZCWA 2CBIA 4Z2IA 5EA9A 1S3HA 1CEOA 4DELA 1DBTA 4HOXA 4XB3A 4MKNA 4ZB2A 3GDTA 1IWPA 4HP5A 3SCNA 4LCRA 1NH6A 1OD8A 2J75A 3VOCA 1VJZA 2VR2A 4YXGA 2F8QA 2XGIA 2XJ7A 4XZIA 2NQ5A 1DP0A 1ZPTA 3DEQA 3VD7A 4LUSA 2JEPA 3MBDA 2R1PA 3HOJA 3U7VA 4S38A 1Q66A 4DF2A 6ALDA 3TMQA 2QJJA 2HEJA 5AFDA 3R79A 3DCPA 3TV8A 3NOEA 3MUZ1 4IPPA 3P74A 3RR4A 3JRKA 3H2AA 5I3KA 2VCAA 3T0TA 1PCWA 4FNQA 1AD1A 1H3GA 2C13A 3QF0A 3BANA 2W63A 3V7PA 5KETA 3VNMA 2WCSA 2YXGA 3PTKA 4WF7A 1VFMA 2DIKA 4D6IA 3CU2A 1BSLA 1H4PA 2H6RA 1K9EA 1JNDA 3GG8A 1ZAIA 5HJLA 4QLJA 4KFOA 3U3HA 4DQWA 3T09A 4X2RA 4O54A 4DF0A 4FOKA 3GNDA 3KE0A 5AB3A 5TF0A 4FOUA 4QQ3A 3UZXA 1H51A 4ZOCA 2XH4A 5JUVA 4PSPA 1TPEA 1PTDA 2OSXA 1I9CB 2XFRA 2D0GA 4DXKA 2BXVA 2OZ3A 3H4GA 3UCDA 5M17A 3KBVA 1OCBA 4HPGA 1NJJA 2Z28A 3LDVA 3C4UA 2L5HA 1E4IA 4CGTA 1A49A 2E5DA 5G1YA 3UXKA 2CHOA 1MVYA 5G1TA 1HO1A 1EL3A 4UXDA 3MCOA 2ZADA 2NWSA 3A4WA 3PB0A 3SN4A 2NV1A 4KWSA 2A3AA 3PFRA 4IMEA 3ALGA 1TSIA 5D9OA 1UKTA 5XIMA 1WV2A 1P4CA 4CVUA 4K8GA 2ASHA 3Q4DA 1CGYA 2BVYA 3HGOA 1T7LA 4FS9A 5H8MA 4JTAA 4MNMA 3ALFA 1H60A 3NQVA 3HMJG 2OG9A 1VBRA 2GVEA 2VELA 1KRCC 3NO3A 1F74A 1UP2A 2WSYA 3AHYA 5HULA 3TK7A 5IBXA 1CLXA 2OEKA 2WSKA 3AC0A 1LZOA 3R58A 1XPYA 3BLIA 2Z4GA 2VR5A 4KMQA 5J04A 3SJNA 3EA3A 6REQB 3S9ZA 4WDWA 3ARZA 5A5WA 3CQ0A 3T6CA 5A6LA 3TR9A 3CPUA 1K7FA 3MUCA 2AGTA 1KFEA 3EA1A 3GR4A 1JPDX 3WF4A 4LNCA 2WSPA 1EDGA 4AZ7A 4PMVA 1BTCA 1A5BA 1FKXA 2YZRA 1RR2A 4S1FA 1E9YB 5HA7A 2E9MA 1TPWA 3OOQA 1W1YA 1Y65A 4NJKA 1YKWA 1GHRA 3T2PA 3ECQA 2OJPA 1BXBA 3LLFA 3WELA 4GI9A 5M3WA 3WQ5A 1AODA 4DF1A 1GCYA 5C6MA 3VGDA 1LL6A 4MTVA 4ZSTA 4JTGA 1YPIA 1E0WA 4Y7EA 4JL1A 3SY1A 3MDWA 5E0FA 4UNLA 1FHUA 4PTXA 3LPOA 3CYJA 4DHGA 2G3IA 4AY1A 1FDJA 3W7HA 3MT1A 1JDAA 4NAFB 5DRCA 2XSAA 1B54A 1KFKA 2E8YA 5D9PA 5AYYA 3WD4A 2VHLA 1V03A 3EBVA 2ZX6A 1SFJA 3UEQA 3MHGA 3B9EA 4IUGA 3O6AA 4LS2A 1LM1A 5JMUA 2Y5JA 1FCVA 3W7IA 2R1LA 4K7YA 1WBJA 1AUSL 4EIVA 2OOFA 4AU0A 2I56A 2Z6IA 3WLQA 1E6ZA 4LPCA 1N55A 2WJDA 1Y5WA 5LIUX 4JEJA 1CB2A 1G94A 1C90A 4RR4A 4XAYA 4JY9A 2CEQA 1UH2A 3HO8A 3PAJA 1ZUAX 2QCEA 3F4VA 3T9PA 1GW1A 2ODOA 3LSCA 1GYLA 3SRFA 3RMJA 3GUGA 3XISA 3NO1A 5C0QA 3D46A 3TQPA 1V3JA 1WDWA 3R5EA 3AOFA 2C6QA 3CIWA 3IK2A 1SJBA 2CLOA 1SO3A 2CZVA 1YLVA 4CNTA 4KGLA 1QXLA 4Z2JA 2FH8A 4ZE4A 3GH7A 1J79A 3TE9A 4R88A 1GTHA 5BYWA 1M01A 1WCGA 4YN5A 4YCOA 4QCFA 4JYDA 3FSTA 3WKZA 1DKWA 1JDDA 4Q4RA 3KS5A 3OBKA 3T55A 3K4DA 5EMYA 1U1HA 4PULA 2PDGA 3QTGA 3COTA 2CLKA 5C8BB 4R9XA 1UD8A 3AIUA 3PM6A 3NURA 1RCOB 4FXSA 1E70M 2D69A 1LDCA 1XBYA 1JFHA 3KUMA 3WQVA 4I5XA 4OUIA 4LTSA 3N4FA 4D8ZA 2QIWA 4P7QA 2WHJA 1YQ2A 4TV5A 3AIQA 3IGXA 3B05A 3P6LA 1XQLA 4KCUA 1H41A 1UQZA 3CUXA 1V02A 4Q7IA 1X8FA 3O15A 4ENLA 2J13A 2Z1BA 2TPSA 5ABEA 5CBBA 2AOSA 3CWHA 3BG5A 3ABSA 5F4WA 5I02A 1NU5A 5CBIA 1MFVA 1EX5A 3QV9A 1Q7ZA 4F2TA 2OPJA 4GLEA 3RLHA 2OZ0A 1A4LA 5IFTA 2OO6A 2PDFA 4DYEA 1PHWA 2WZHA 2Z7GA 3WX7A 3GHTA 3CBWA 2KAUC 4CU6A 2VVNA 2YA1A 1OFBA 3VOHA 5BW6A 2GUBA 4JICA 1JVNA 4Y9MA 5DX7A 3PPFA 1T99A 4WUIA 3W07A 1GOMA 4O16A 3SM0A 2CLMA 1E9LA 1P6BA 4BF5A 3AIWA 4O28A 1NQ6A 2ZX9A 3CEUA 2ATMA 3BWWA 2W61A 2Y7FA 3EWYA 1F3TA 3FEQA 4A8NA 4IMAA 4XZHA 1FDZA 3LI0A 5D9NA 4Z0JA 1QO2A 3TW7A 3VCNA 4CNOA 4NXKA 3A9IA 1TV7A 5FJPA 4PMUA 2G3JA 2VEGA 3LHTA 5F1UA 2E6FA 1H7PA 1E43A 1N82A 1GVEA 1CENA 1TELA 3ARWA 3W23A 3ZJ8A 2D2JA 3GRIA 2XISA 2NX3A 3B8VA 3I7QA 3OTRA 1F6YA 4LX4A 4HCDA 5IXEA 3E0IA 2JGQA 7REQA 1VFTA 4AVNA 4FLQA 1UKSA 1KM5A 2V63A 1Z44A 2P10A 1ZP4A 3W83A 4NI8A 1QI3A 4MKSA 4ZTYA 1SJAA 2X1TA 1XLEA 3KTCA 1GPWA 4KT2A 4EPDC 5IHSA 2H8ZA 1OC6A 2QQ6A 3DBPA 3WD2A 3ZWTA 1KV5A 2E67A 3TQ0A 3APTA 3SFWA 1JCNA 4REQA 1A0CA 4ZOBA 4ACZB 4PFHA 4V1XA 3F2BA 2VX6A 1GWJA 3ATZA 4IF2A 4A3YA 3RDKA 4P8UA 1RBAA 3A64A 1KBBA 4H9ZA 5A8OA 1HL2A 1TIWA 1U5VA 4Z1BA 2WVUA 1F2JA 3W53A 2DUZA 1ZJBA 1PIIA 3ELFA 5HMFA 3Q67A 2PDHA 4UNKA 1T0OA 5I3IA 1CNVA 3MANA 3UZZA 2PLJA 1R3QA 3N73A 1IXPA 3BLFA 2ZIDA 1CYGA 4XD4A 3DFOA 1J01A 2TYSA 1UBPC 4XUYA 2BNJA 2FZ9A 2VZTA 3PULA 1WXJA 1HJUA 3UWZA 4GMEA 4CLMA 3M4HA 4FHAA 1SW7A 2DIEA 2PBGA 1V7YA 4FLOA 2BODX 1OZMA 4RKAA 2Y70A 5HWNA 2NQLA 5L6UA 1ICSA 5CPLA 1VJSA 5M5DA 4A8RA 5EMMA 1LRNA 3OLDA 1W3LA 2G3FA 5I79A 4N9DA 2IPGA 5CAKA 5FA5A 4RXFA 4S3JA 2PC4A 4WJEA 1GZ1A 3UCQA 1YDOA 5DLCA 4GC3A 2OQLA 4H83A 3NL5A 1ZJAA 1RD5A 1I45A 4UZSA 3N9RA 3V16A 3H2FA 1OG0A 2NVCA 4WY0A 1JDCA 3GIQA 3PBYA 1GYNA 3H22A 4AEOA 3KRBA 4XAZA 4MVAA 2PDYA 4ATLA 4PH6A 4NKCA 2QCFA 3NYDA 5KMYA 3RX4A 3NYZA 2R6OA 2W0UA 1CXFA 3OZMA 1OFQA 1NDWA 1XLIA 3VFLA 1XGZA 4B2DD 4YNGA 4ASTA 4ZO8A 4ZB5A 1PL9A 4MB1A 3GK0A 1VFSA 2EPMX 3J7HA 1KM6A 1EH9A 2VEPA 3QY8A 1TTJA 3GDMA 3GXFA 1RSCA 2G8ZA 2Z2BA 4FP1A 3V1PA 1K9TA 2VZSA 4HQVA 3N18A 3FA5A 3QV6A 1PKYA 2OLAA 4W89A 4C1KA 4CN1A 4JCMA 3NDYA 3AICA 4P5UA 4KWVA 1LJYA 4OIFA 2VT0A 3O16A 2RH9A 4GYFA 3CHEA 4H8HA 5FAJA 2YL8A 4E3TA 2HTMA 3NDOA 4RX0A 3W22A 3CHCA 3K13A 5A8MA 1LG1A 4NJHA 1SW3A 5U7SA 1K70A 5D09A 4P61A 4ZQRA 1Q4WA 4H7ZA 3W7LA 3QQ1A 5LNWA 4L9YA 1HFBA 2ZUVA 3KZSA 1VFUA 4NHVA 2B0MA 2XFYA 4PMYA 3VGBA 1DV7A 4AZ6A 1ZNNA 1QDSA 5I23A 3ITCA 1MW1A 3BLOA 2X0SA 2QW5A 1B30A 1NOWA 1NQKA 3UXDA 2P5NA 4QNEA 3IV3A 3QRHA 1WZMA 1R85A 2UY3A 8XIAA 3ANVA 2WJZA 2C15A 4UTWC 1A5LC 2WNQA 1E1EA 2DZVA 1EF2A 2TODA 4M0XA 2UY4A 2PTZA 3ZR6A 3FJ6A 1FA2A 2W67A 4GNKB 1AQFA 1AFSA 3B8TA 5CC6A 1QVBA 4PRWA 2A7RA 4UTLA 3WMSA 3TC6A 1ITQA 1UCWA 4HK7A 5I6SA 3H70A 2O92A 4RNFA 3FXYA 4AZIA 1V3MA 3ZT7A 3T40A 3JW7A 3EB3A 2IXUA 4K36A 1RBOB 3WEOA 5K2ZA 4CD6A 1UG6A 2FGBA 4OHQA 1EQPA 1FWGC 1XS2A 1J0HA 4ZQNA 4XBKA 4HTBA 2ZQ0A 1U5JA 2V5CA 1A5CA 4EXQA 4YTUA 3GDLA 1UYQA 3OJGA 3CM4A 3AQUA 3HGSA 2BY3A 3M0XA 2HVMA 3EOSA 3W37A 1K9FA 1NVMA 4NJGA 5DXYA 2J74A 3TN4A 2GSHA 1W1A1 5T9BG 4GY0A 1EIBA 4IQEA 4Z42C 2PWGA 2WLYA 4OFCA 3TZFA 1EZ2A 3AJXA 5JH1A 3G6LA 3WYZA 3CO4A 3CQKA 5LZLA 2OZ8A 2X1IA 4LVDA 2J79A 1W56A 4HJFA 1DIOA 2VDHA 3VNLA 1XLKA 6REQA 3AIVA 3SY5A 5D05A 4CD8A 1C9WA 3SGZA 2Y88A 3SCRA 5AVHA 3G1RA 3A4AA 3S1GA 4HCHA 1YE4A 1Z69A 4ICMA 3GVRA 3M64A 1ZSXA 3QQ0A 1M04A 3S2NA 2HRWA 2CZEA 4WZHA 1JIBA 3I6TA 1SZRA 1HIZA 5A95A 3M6YA 1DPMA 4DJDC 2E4TA 2RDUA 4J4KA 2WVTA 3V35A 2P0OA 4DBSA 3WMCA 3V3WA 3IAPA 1BFNA 4JFUA 1WBHA 4LNYA 3ATYA 2G4FA 4MUZA 4XVEA 2Y4SA 1V5XA 4GXPA 2IKGA 1GQNA 4A8IA 3UD6A 5E9XA 1PKLA 1Z6KA 3SQLA 4NP7A 3K4AA 4NAFA 4UTFA 3S5OA 5JXQA 2E40A 3P60A 1GVYA 5AY7A 3S6OA 5KINA 5I06A 1IT7A 3UNDA 3VDHA 1AK5A 3N17A 1U83A 4D6JA 5IRPA 3GG0A 4LFYA 4ZFMA 1ZP3A 4YYFA 4FXJA 3DHPA 3ZJ6A 4H8UA 1EDTA 4FF5A 4ZFCA 1SO5A 2WKLA 1L2QA 5E0CA 2VDGA 4FNSA 4NZFA 5FEZA 3PY2A 3KTXA 4RE4A 5HBFA 3PSWA 1UC4A 4G8TA 3L4VA 1FOBA 4ADTA 2CZFA 2DP3A 2VOTA 2O9OA 1X8CA 4JX6A 3GFXA 4J40A 1V0NA 5CZ0A 2HNHA 3E3HA 4ES4A 1OX6A 2I16A 1S46A 2J7EA 3L4YA 4CEXC 7PTDA 3KCJA 2Y8KA 5H1WA 4GUHA 2HPIA 4I5UA 5HK4A 1F73A 2QCLA 3TN6A 4YTRA 2F9RA 3Q2DA 3E2RA 3OO2A 4MPKA 3TVAA 4AUBA 2PP1A 4AC1X 4TU1A 2PZNA 3UJEA 4JL2A 5CPQA 1QI4A 4M6PA 3G1AA 3TNOA 1G7VA 3RO8A 1C92A 1C7TA 2FZ8A 3ZVHB 4UIOA 3QYQA 1SFLA 3N04A 4U4MA 1JZ3A 3MMDA 4LUTB 4P7NA 2FJUB 2V6AA 3WK2A 2P8CA 4L9XA 3L0GA 1UUOA 3QR3A 2HISA 4ERAA 4GK8A 4H9UA 3VOFA 5DO8A 5LGZA 2P3EA 4QE5A 3SUUA 3A13A 3SR7A 2YW3A 3MO4A 3UJFA 4UMBA 4FO4A 1UWRA 3I7SA 3GNNA 4K8EA 1W3KA 2WWDA 4GFSA 4B5UA 2DQXA 3FVMA 3PWAA 1AJ0A 1GOXA 1QNOA 3I3DA 3VE7A 3HM7A 2ZVRA 3AYRA 4QGCA 2C7FA 4JIEA 2XIOA 3GM8A 4KQNA 4NUWA 2EG6A 1H0IA 1TQXA 4QR6A 3QZAA 1QK0A 1S5VA 3VTRA 1KCKA 4B5NA 4MADA 3T0AA 1XG4A 2OGYA 3AHZA 4JS3A 3UQNA 3CUJA 3CV2A 2C19A 2PTXA 1L8NA 1GVOA 5HATA 3CIVA 3STFA 4A35A 1JAKA 3IACA 1M9HA 4FALA 1JZ5A 3LM3A 3AMLA 1AJZA 3N6HA 1K3UA 3HG3A 3MSDA 2POTA 4LY8A 1F4AA 1B2YA 1NEYA 4WDXA 5I78A 1X98A 5C7VA 3BW4A 4NASA 3F2CA 2WMIA 4JHZA 2W27A 3W1LA 2BVDA 5FJIA 1RP9A 5KITA 2BB0A 3H6OA 1UA3A 3N15A 4AVFA 1Q6EA 3TYUA 2WPGA 2WO5A 5M2FX 4F0SA 3T44A 5HQMA 4IFOA 3DUGA 1C8YA 4D2JA 3KHJA 1W37A 1UOZA 2D73A 4URIA 4N4QA 4FA3A 4O0QA 4HCLA 3L66A 5LYRA 3PWIA 1XLDA 4FZIA 1BGAA 4LANA 3VKJA 4ML4A 4MY9A 1PJ9A 2ALDA 1N7KA 3VNZA 3W84A 2ISDA 3QOMA 2R91A 3AMDA 4QNWA 2F6KA 4HJWA 4AY7A 1TRDA 4IPNB 1DJZA 4RE2A 3TCSA 5FACA 1H1ZA 1A3XA 3CUFA 4IISA 3GIYA 4UTKA 3N13A 5GVJA 3THCA 3ARYA 3POCA 3CZKA 1EO5A 4PTVA 3KBMA 3P80A 2X30A 3WBEA 2C0HA 1FVPA 1H7OA 3SB0A 2AQOA 4GNVA 1UD3A 1PX4A 4GKTA 4KEMA 2ZYFA 3SO7A 5CSYA 4ZL1A 2G95A 2QCMA 3B03A 4C60A 1DE5A 1J6PA 3U2CA 1VAHA 4A3UA 4DZHA 5C9ZA 1CDGA 3SUWA 1YX1A 2A3HA 1UR3M 4XWUA 1O7AA 3MWCA 1CTNA 3WNPA 2F7FA 1MFUA 1YNYA 5FEWA 1MW2A 4XO7A 2WYSA 3TJ4A 1IYXA 2ZZ2A 3BSMA 5D2XA 5E9AA 2WAGA 3NWRA 4L6OA 3U9IA 4V28A 2O55A 1JXJA 4OV9A 3WQPA 1BAGA 4CCCA 3NQDA 1TMHA 3CLMA 1QPOA 5C55A 4HK5A 3EWXA 1R2TA 4WJXA 3L4ZA 2VEMA 4J2PA 2B7PA 2C18A 3W7GA 3FDKA 1LLOA 4D72A 3O07A 4NAEB 1FWBC 3UR7A 2WNWA 4CQ8A 1F7BA 3ARXA 3GO2A 1VFHA 1G4SA 3AYVA 3UXAA 4C6IA 4H9TA 3FW6A 3PZMA 1VH7A 3ABOA 1XP3A 2YL9A 1NF7A 4JIQA 3B0PA 1GKQA 2QAPA 4UTTA 3IPWA 5FJUA 2FDSA 2OZTA 4Q8WA 4M19A 3ABXA 1OYCA 1XIJA 1KLZA 3F4CA 1SU5A 2D2HA 3BZGA 2VCBA 1EBHA 4IQJA 4JTQA 3PJUA 5ABHA 4DUOA 2HVOA 2WKGA 3W85A 2ACQA 3H2MA 4UTIA 7TAAA 1XKJA 4XZBA 2OX1A 5DCEA 4ZOEA 2Y85A 2PWUA 2GJPA 1HNYA 1O5RA 1JUBA 5BXRA 3MSRA 1OK4A 5GJPA 3BMXA 2DU2A 1Y8BA 5G1MA 2WC4A 4TIMA 2V82A 3UZ5A 3VKAA 2F84A 4IMCA 2CLEA 2B7NA 4BQ4A 3LXCA 1E55A 1RY0A 5BRQA 3UVIA 1VKFA 4E5TA 1EJVC 1IEXA 4XZ9A 3WNKA 1RQBA 5CPTA 2TMDA 3OZOA 3STEA 1R5YA 3UVAA 1AH4A 1JZ6A 2G96A 3NGFA 4RZ6A 1SYTA 2OCZA 3W00A 4H8VA 5LNSA 3ANUA 2CHRA 3A3HA 3MV01 4IFRA 3NTYA 1WDPA 8CGTA 1PIFA 3IIOA 1QW9A 2DFAA 3STPA 1XRSA 4ZODA 3GU1A 2BHYA 4XX6A 4O8RA 4W8BA 4C1NA 3R6IA 5HPOA 2UBPC 4HKPA 1ZALA 1VB9A 3Q45A 5HWJA 2O9TA 3KL5A 4JFSA 4AG0A 2PDQA 5JIWA 5F2IA 5K3VA 4JPGA 1Q6RA 1EP3A 3H2EA 3PBUA 3CNYA 1WDRA 4IGSA 3ZLGA 2EJAA 3SJ3A 1A80A 3H12A 3VYLA 2I5GA 2WZMA 3OU8A 2AAMA 3B0VC 4PTNA 3BJFA 1J18A 3WDRA 3SUTA 3AYSA 4JNZA 1ZCCA 1XLFA 5HDRA 1XDJA 3OGSA 3UYIA 3K1GA 3LY0A 1K8CA 3IJ7A 3SGGA 1KR1A 3SCWA 5JVLA 3NPVA 2ZUMA 1G6CA 3NSXA 2ZZ1A 1OVDA 1DWHM 1KLYA 1YADA 4GPNA 3CIXA 5BXSA 3U2EA 2QF7A 2IS7A 3MS8A 2A0NA 1AH0A 5DY2A 1R87A 3MA8A 4GIEA 3WJYA 4S3KA 3PB2A 3UA3A 4TOQA 3GNOA 1VFLA 1E0VA 4X61A 3LENA 4AD1A 1T8QA 1J96A 9CGTA 4K1GA 3EOUA 3LTSA 1E40A 1F3XA 1X97A 3LZ5A 3W01A 1OYAA 3VDBA 1WO2A 3O7UA 2J7DA 4BJHA 1G9HA 3WDPP 1I0BA 4PB5A 4MNKA 4ZE5A 3M5VA 3UPWA 3W71A 1YDVA 5AYIA 2PI6A 1HP4A 1VYRA 5KTLA 1KKRA 3M0IA 3OA5A 2WLZA 7CGTA 3I4KA 3WDHA 1L0PA 2GWNA 3EOOA 3M43A 5EPDA 3BPWA 1R6WA 4PUUA 5FJTA 4AX6A 2G37A 1VD6A 2HQAA 2UY5A 2FVMA 2OYMA 1O1ZA 3OYXA 3DGRA 3R8HA 3PNUA 1XIDA 2REQB 5CEWA 1I75A 2R24A 3KVLA 4AAJA 5DMYA 2PDNA 1QHZA 4PRRA 2GGEA 5REQB 1N8FA 4C90A 1YTDA 2GSEA 3P0XA 4H6RA 2PRHA 1Z3NA 4O14A 2FHCA 2BXYA 1KFJA 5CJMA 4RUBA 4CCEA 2J24A 1W5NA 4EF9A 5FCZA 4A05A 1EJUC 5EGRA 3ZJKA 4LBUA 2FTYA 2YSWA 4Q8OA 2FYMA 2FVLA 1RVGA 4E8CA 4UCGA 4PUWA 4C7GA 3E9AA 2RJGA 3KOFA 3TEVA 3RJXA 2NXIA 1B3OA 3LB0A 3P82A 1V6TA 3DG7A 4JTIA 1EJ7L 2ZUNA 2TSYA 1W1B1 4DEFA 2QZRA 4PCTA 1WE5A 4C6KA 3S83A 1UH4A 3K8MA 4WIWA 5EBUA 3MKCA 3W2NA 1OX4B 4KRZA 2C79A 3MUIA 1W91A 3VGGA 4P7RA 1BVNP 1OFOA 3F7JA 3CZLA 1M7JA 3GFYA 2GGJA 1DJXA 1JD9A 1P7TB 3TMLA 3WLKX 2BZNA 1DJQA 1YBQB 4NG3A 1W1VA 1DL3A 1XIHA 3MKVA 5HOSA 1B90A 2DSWA 3S47A 1DIKA 1W0MA 3CL7A 3W76A 3W1AA 3KTSA 1XH1A 4JIIX 4M5PA 4Z0SA 2JKPA 4GKLA 4C6FA 4D1IA 4F0LA 4AIUA 1YDYA 4QXIA 3IGSA 3CAKA 4GZEA 5A6TC 4KEUA 1M53A 4O52A 2D23A 3C2VA 1D9EA 1R2RA 4U33A 6XIAA 3AMGA 3E5BA 4H2CA 4Q33A 2ZZ7A 3UGRA 3CS2A 1G1YA 3W1PA 2AQVA 4KETA 2WVVB 4IH3A 4Y6GA 1JYWA 2VC9A 4EOUA 4JD4A 4X0VA 1XR2A 3C0LA 3NL2A 4EE9A 3LGDA 1OB0A 2XH0A 1YE6A 1WZKA 3G6MA 4WXZA 4V1YA 3FHAA 4F48A 3ARPA 1B1YA 1MNSA 4JNYA 5A1AA 3C86A 1OC7A 3M0YA 4OE7A 5CJNA 3I68A 3S6DA 1D8WA 1QHPA 4UB9A 2ZWZA 4EVZA 2INZA 3UF9A 3UY8A 1RAKA 1SSDA 5CH9A 3FSUA 4IIDA 1SO6A 4A4AA 3A3WA 2VEFA 3SECA 3YPIA 1NFGA 3FJLA 1DOSA 1MEWA 1WOBA 2QCGA 1R7AA 2QT3A 2XHYA 3N4EA 1VF8A 1XFBA 1ITUA 4PTWA 3L23A 2JIWA 1EPVA 3ITXA 1XYFA 2GVGA 4M6VA 2ZRYA 3WY1A 2QCHA 1FX6A 3W74A 1NM9A 1LLWA 1FCUA 4CD4A 4E4FA 1V6XA 3ZVHA 4J3TA 4JTHA 3U5UA 2Q8ZA 3FYYA 4QE4A 3U6WA 4RE3A 4QE1A 2AQWA 3NL3A 4JNMA 3EEGA 4LUTA 1LT7A 3G1VA 5T9CE 3N3TA 3S2MA 1E0UA 4RE0A 4S23A 3QSRA 5CLWA 3S5YA 1W2PA 4BFAA 5BOEA 1N2VA 3PVFA 2ACSA 2HZGA 3D5HA 4N0RA 4S3AA 3W81A 4IP4A 3VC5A 4TMCA 3QV7A 3H23A 1KXQA 5D2VA 5FJJA 3H55A 2C3ZA 3GVGA 3ZLFA 4HYRA 2VDIA 2X09A 1THFD 3GXTA 3KRUA 2C1HA 4Z2KA 1Q6QA 5AZ1A 1HT6A 4GX8A 1GZJA 2VWTA 4B9ZA 4AIEA 1DIEA 3CV7A 2D3LA 3VKDA 2WMHA 1XWYA 3ISIX 2H9AB 6PTDA 1SZFA 1FWIC 2RKXA 3TAKA 1QJWA 1A5NC 3S5SA 1DQXA 4WD0A 3T7VA 4XO6A 4IPIA 3EB4A 5CAHA 1KNWA 3UWEA 3NQMA 3IAQA 1D2KA 4Y90A 1EWEA 2PDKA 3DN5A 3A23A 3IRSA 4PBEA 1TTIA 4B5VA 3LRLA 3E74A 3WEZA 5A6SA 2PC8A 4IOTA 5DT5A 1XDMA 3ZR5A 3ANYA 2CERA 3DFSA 4O1FA 1W9DM 1WKFA 4RPQA 1W3NA 1I1WA 3WN6A 3THUA 1Q65A 3A5VA 3KBWA 3VK5A 2WOQA 3B97A 3G1HA 2QCCA 5AC8A 1EX1A 1KFBA 1SR0A 3GS6A 3UWVA 1GORA 2Q02A 1EEXA 3CZGA 1XD0A 4XAPA 1XD1A 4FPSA 5F7UA 3WCZA 5KZMA 3H2OA 5F4XA 3N14A 1FP8A 2NVDA 3WJZA 3MWAA 3SIMA 3SCTA 1ECEA 2ZX7A 4MNJA 3WH5A 2C1IA 4UTUA 3IVUA 4NNAA 1PKNA 1GUVA 4I6KA 1TX2A 2YX0A 3PTDA 4I7VA 5LIWX 1QW7A 1HKJA 2PTWA 3AROA 4RCXA 5XIAA 1D8CA 3SAZA 1U33A 4UMAA 3DDMA 1AW2A 3QOKA 1EJSC 2C16A 4E0CA 1H11A 2G5WA 3BQ5A 4JQ2A 1CGWA 4NZCA 1DWGM 1JCYA 1IF2A 1B3YA 1J5TA 5HJXA 3NG3A 4NZ5A 4E4PA 4JN7A 1RV8A 3BO9A 2WB5A 1DORA 4UNIA 3VIMA 5D2WA 5M03A 1S3TC 1BVZA 2FVKA 3VD4A 2E9BA 1PEZA 2XZ7A 1ONWA 2VM8A 3DOPA 3IARA 1BWLA 4NZ4A 3MYPA 4RXGA 3BAKA 4J5NA 4O4WA 4KWOA 1D3GA 2OXNA 2YDRA 1I2OA 1PKMA 1ZU8A 3C2YA 2OKOA 3E5PA 3AS2A 2ZVIA 4NAEA 3IEBA 3TC7A 2F38A 3WQCA 4AF0B 4UZUA 3H24A 3WF2A 5E0KA 1H7NA 4BS0A 5C2CA 1V0MA 1U5HA 1O66A 4LY4A 3AS0A 1UWQA 1ISVA 2A4AA 3G0XA 2W91A 2P76A 1YYAA 3A24A 5F1VA 3U4AA 2JALA 4R7WA 3EEZA 4GRSA 4KBXA 4AMCA 4IQDA 9RUBA 1HKIA 1Z41A 2QV5A 4MWAC 2QGHA 2V5DA 3WBXA 3MC5A 2ZWYA 4B91A 1R9ZA 4UCFA 4DJFA 2CBVA 3UR8A 2ATSA 1A5UA 4C6BA 1D7FA 3DFPA 1GG0A 4I9AA 2PDPA 2A79A 3UZJA 4OWGA 3W7RA 3POHA 1J0IA 4LBSA 4WHBA 1T6MA 2EPHA 5FL0A 2A3LA 3RCNA 4X3ZA 1XF0A 4H1ZA 2GYIA 2GL5A 5TD4A 3WK1A 2FZDA 4P8VA 3STCA 2OYLA 2OGJA 1XRVA 2CZ5A 2BS9A 4C6NA 5GJNA 3XINA 1J12A 1LQAA 1ZJHA 1Z48A 2GDVA 1KBLA 4L5ZA 3D47A 4JHOA 2E3ZA 3RGTA 3HZ3A 4C65A 3IIVA 5ECUA 5MF5A 4HNUA 3GYEA 3LOTA 4LJ3A 3ABQA 1LWIA 2WMGA 3FJNA 3GUWA 1RJPA 4OT7A 1W3JA 2DV0A 2Z1VA 1BD0A 3ZS4A 3WL1A 2BOGX 3NDZA 4MB4A 2Y8UA 4RDZA 1KM3A 2ACUA 5A8PA 1BKSA 1Q2RA 2GPTA 4D8LA 4QFUA 2ZA2A 3D3AA 3OBEA 2QCDB 3ITVA 5C71A 4J27A 2PDMA 4PMNA 5HXMA 4D6EA 3TH6A 4N02A 5EB8A 5FAGA 3P5YA 2P50A 2OB3A 2WZTA 4JTJA 2NQZA 3PUGA 1O12A 3GIPA 3FS2A 4FX8A 2AL1A 4CCZA 3KRSA 4IM4A 2GUUA 4OUEA 4XK2A 4HPHA 2YCLB 3DFNA 1YRRA 3BW2A 1U1UA 4S2CA 2VMFA 4RV8A 3PAOA 4ZMGA 3L4XA 4XTDA 5L9FA 1YNQA 2NZLA 2PDJA 1MDLA 2A3CA 4FX7A 1S1RA 2J8GA 1OFAA 3SCSA 5DFAA 5A6BA 4NZ3A 4ZXLA 1T8XA 3VMPA 3WQDA 2QHAA 2Z2AA 4E2DA 3LV5A 4GI8A 3BAYA 1A5AA 1FDYA 5C9UA 2OLHA 4I7UA 2O9RA 1TVPA 3ONBA 3THDA 4MM1A 2A85A 2FZBA 2EEXA 2PBOA 2QIIA 1LCOA 3BGJA 3QQWA 3GR7A 4JY8A 2C91A 2EHHA 4XZLX 2PEVA 4C6MA 2Y24A 1F76A 3HJZA 4UOJA 1DYSA 4ZEPA 2D20A 3VUPA 4I9JA 3G77A 3C61A 3NZPA 3EPOA 5K9DA 4H2HA 2YZ5A 4GOAA 3WD1A 1YXDA 1IEWA 1AW5A 1P48A 3UG5A 2AKMA 1ZRQA 3L65A 2O56A 4UTWA 3FFSA 1XINA 3AS1A 4C91A 1R2SA 1DWFM 3RJYA 2V5KA 3P8JA 4L1GA 1R3WA 1UPPA 4F66A 4R3UA 1S38A 2REQA 3APGA 1XI3A 2R8WA 2I5QA 1IT0A 1E6RA 1FRBA 4HPXA 4LEFA 3TYDA 1IGWA 3DHDA 3OLEA 3GH4A 3ZT6A 5REQA 3EDEA 1OFPA 3VX1A 1E9IA 5D9MA 3E12A 4QS6A 5AOUA 2JIEA 2PURA 1H62A 5LKYA 2Z7KA 2A3BA 1UWAA 4DO7A 2XSXA 1M7PA 3KOZA 4LRTA 5D02A 4AYSA 5DXXA 1V51A 3B8SA 3LLDA 4QEEA 3TSBA 3B4YA 3UW6A 4S39A 4CU8A 1M65A 3ITLA 3CL6A 3M9YA 2D2OA 3FHQA 3ZOAA 1UKQA 1H7WA 1B0IA 1VEPA 4HNVA 1UKPA 1OFDA 2JF7A 2WW5A 4IGMA 1BYDA 2H3DA 1KTCA 4AHOA 4K2SA 3S9IA 3W0KA 4AC7C 3ARSA 3T4WA 5K9XA 1OX4A 4OOUA 5C9XA 3G1DA 3VFCA 1ODZA 2E7FA 3S1WA 4DXXA 1DJNA 5E93A 1C8VA 3NQBA 2PE4A 3UWUA 1P7TA 2W62A 3PP7A 1KXHA 5IOBA 5HNNA 1YBQA 3HPFA 4I9MA 1FKWA 2HXTA 4UOQA 3U2ZA 3MUY1 5CC7A 3QBUA 3BGGA 2ZUTA 3HQ1A 1E3ZA 4KKXA 1BXCA 3SCQA 3PC0A 1VR6A 2ZOXA 3WDQA 4Y9OA 2ZXDA 3V75A 4AXNA 5BXTA 3T1GA 4Q4SA 3PZTA 1YIXA 2X1UA 5DMMA 4NVTA 1DTUA 3RUBL 3WJWA 3LYEA 1FY6A 4AD4A 3H53A 1K6WA 1LQ2A 3BZJA 4QG9A 3WDIA 3LCGA 3B4UA 3LQLA 1WYIA 2XSBA 1R9YA 4DJDA 2WVVA 3UGVA 3F4DA 3MZ2A 1ZQ5A 5ABFB 1IEIA 3FCPA 3ARTA 3GSMA 4M6UA 3EX4A 3KEHA 2PDLA 3HMCA 4CU7A 4N6EA 3PJXA 3EWCA 2VENA 4LSBA 4LAMA 3WD3A 2FTPA 2B81A 1R47A 4IJBA 1LOQA 4GQBA 5E5CA 1T41A 2DZSA 1HXJA 1DJYA 3MMUA 3RPDA 3LQGA 1JCMP 1E4MM 3N6JA 1EQCA 4S3EA 2Y5SA 3BARA 4KW2A 2ZUSA 3GKFA 4C1LA 4WSKA 5CXPA 4H6EA 3AXKA 1GJPA 3KBJA 5DF0A 3HFYA 1A50A 1E5NA 2PU0A 4DZIA 3RLUA 1UD5A 1TE1A 2P53A 3FAXA 4DXVA 1P0KA 2ZZ5A 4DBEA 2CYGA 1ZBWA 4FLSA 1V79A 3OA3A 4IP5A 2E0PA 3ZLHA 4ZTXA 1LP6A 3TROA 5IBXC 2UV8G