3CQKA

Crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ and sulfate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
276
structure length
276
Chain Sequence
QIPLGIYEKALPAGECWLERLQLAKTLGFDFVEMSVDETDERLSRLDWSREQRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAEVAKARDWVKARMAKAGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of L-xylulose-5-Phosphate 3-epimerase (UlaE) from the anaerobic L-ascorbate utilization pathway of Escherichia coli: identification of a novel phosphate binding motif within a TIM barrel fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords L-ribulose-5-phosphate 3-epimerase ulaE
total genus 114
structure length 276
sequence length 276
chains with identical sequence B
ec nomenclature ec 5.1.3.22: L-ribulose-5-phosphate 3-epimerase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3cqkA00
2GUBA 2QUMA 1O1HA 4XISA 5XIMA 5B7YA 3U3HA 3P14A 1GW9A 1XIIA 1XLEA 3M0HA 4EAYA 3KBMA 1XICA 3AAMA 3ITTA 5EMLA 1XIDA 4US6A 4DUOA 9XIAA 2GYIA 1XLJA 2GLKA 1MNZA 3ITLA 3KTCA 4YTUA 1XIBA 1D8WA 5XINA 5B7ZA 3XISA 4QDPA 3GNXA 4A8IA 3CQIA 4ZBCA 4HHMA 1XLGA 1XISA 4LNCA 4Q7IA 5H6HA 1OADA 3UA4A 3XIMA 4YTTA 3KCOA 5AVHA 3VNKA 3N4AA 2I57A 4W4QA 1XYCA 1DE5A 3AALA 3QZAA 1A0CA 1XLCA 4YTRA 5H1WA 3JU2A 3KBNA 3XINA 3BDKA 3CQHA 3VNJA 3VNLA 3CWHA 2NQJA 3TVAA 5XIAA 1S5MA 3M0XA 3ITVA 1BXCA 3KCJA 7XIMA 4QE5A 1XLKA 3IUIA 1YX1A 2OU4A 2ZDSA 1XLDA 3BWWA 1XYAA 4OVXA 4QDWA 2NQHA 4X60A 6XIMA 3LMZA 3U0HA 1XLAA 1XLLA 4XIMA 3VYLA 3QC0A 3KWSA 1XIFA 1DE6A 2GVEA 5AVNA 3DX5A 3KBSA 3KBJA 4GQBA 2G4JA 2XINA 1XLBA 4QE1A 2XISA 4K3ZA 3ITXA 4ZB0A 3M0VA 1A0DA 5FA5A 3KCLA 5I7GA 4XSMA 2J6VA 3C0LA 3VNMA 1DIDA 2XIMA 3ITYA 4G56A 4GJJA 2HK1A 3TC3A 5J8LA 2NQ9A 3C0SA 1I60A 4YTSA 3KBWA 2QULA 1QT1A 5EMKA 1XYBA 1QUMA 6XIAA 4PGLA 2QW5A 4K1GA 1XYMA 2G0WA 4XSLA 3UU0A 4KW2A 4DVOA 1XYLA 4PFHA 3AYVA 2X7VA 1XLIA 3CQKA 1K77A 3ITOA 1XLMA 2X7WA 8XIMA 4HHLA 4QEHA 1QTWA 1I6NA 1XIGA 2QUNA 1XIHA 2ZVRA 1DIEA 3BZGA 1XLFA 3CNYA 3L23A 4HGXA 3OBEA 4QE4A 1XLHA 1XIMA 4X61A 5B80A 3P6LA 4A8RA 1XIEA 3QYSA 4GLEA 4A8LA 1TZ9A 1MUWA 3BZJA 5C9ZA 3BANA 4XIAA 3QXBA 3AYTA 1DXIA 1S5NA 3C0QA 9XIMA 8XIAA 3IUHA 4GJIA 5EMMA 3M0LA 3M0MA 4X63A 3UXIA 4EACA 4A8NA 3FVMA 3KBVA 4HNOA 4E3VA 4ZB5A 3VNIA 1CLKA 1A0EA 2HCVA 3M0YA 5EMJA 3UA3A 1BXBA 2I56A 4QEEA 4YTQA 3CQJA 2Q02A 3DBNA 1XINA 4ZB2A 3UVAA 5TNVA 4XKMA 3WQOA 1XIJA 2HK0A 3NGFA 4J4KA 1XP3A 3IUDA
chains in the Genus database with same CATH superfamily
1R0MA 4QGCA 1B3ZA 3AJXA 1UP2A 3R2GA 2YR1A 5DMNA 2FVKA 2FJKA 4IGSA 4HIBA 3DKJA 4GWEA 1FFRA 3VGDA 2BG5A 5I09A 3CUHA 1E0VA 1U33A 4Q7BA 4Q4MA 4K7YA 5I7GA 5CZKA 1IGSA 4YHGA 4QDMA 2ICSA 7TAAA 3O0FA 3EPOA 1WAUA 2BB0A 1TB3A 1J2BA 2YCKX 3LA4A 4XQ6A 2WMHA 4C60A 2AKMA 3LHUA 4FXRA 3UU0A 5CKSA 1AODA 2QEZA 3AYVA 2BOFX 3N11A 4PB3A 1X8FA 2C1HA 1H5YA 3R4IA 1BWKA 1V5XA 1V3HA 2JQXA 4DNHA 4QXIA 1FCVA 4X61A 4BQ3A 4DJDA 2WW5A 4RE4A 4WR3A 1P6CA 2R1MA 1EJXC 4NUWA 1D7KA 4C5ZA 4KPLA 3S1XA 3K2GA 2WJDA 4NZ5A 3W7PA 2J7EA 4HA3A 2FH6A 3BG5A 5ECUA 3B4UA 1OIFA 1F07A 4JQAA 4ZXOA 4W5UA 1SSDA 4GYKA 3MUCA 1UUMA 4QEEA 5AB3A 1NDZA 4ES4A 1K7EA 3EOOA 3E0WA 1O1HA 3MWCA 5CPQA 3PZTA 2WB5A 5FL1A 1UWSA 2XPKA 3EX1A 3BQ5A 1W5NA 2EAWA 1JXJA 4J1OA 4PMJA 1XLGA 3TQPA 4QJ5B 4PRRA 1V3LA 1XW8A 3WX7A 3BOFA 1UQYA 3TJLA 3ZT5A 4UWMA 3ONBA 3O6DA 1VHCA 2A0NA 1A5MC 2WQDA 3KLLA 1WXZA 1RA0A 1W3NA 3PB2A 4M1BA 3CUIA 1CXLA 2D0HA 4KWVA 2J66A 4OV4A 3W23A 5ABHA 1D3HA 3TU9A 5BCAA 3GNRA 4H7CA 3QMSA 1MSSA 2A4AA 1KKRA 2NV9A 4WXZA 1UR0A 3AXMA 3MI6A 2VELA 4BF9A 2ZIDA 1AD4A 3OZPA 1V7YA 2D2OA 3L7RA 3L2MA 1WP6A 2GOKA 2CHRA 3BGGA 1I2NA 4U33A 4EP8C 4GLEA 1F4HA 5A8NA 3THDA 1XDMA 4GPNA 4HMCA 3V36A 2V5KA 3H7UA 3TZFA 3S1WA 4K39A 4URIA 4Z1CA 4BR1A 1PCWA 1WKDA 4DO4A 3KBVA 4NX0A 1TR9A 1AD1A 3ABSA 4RR4A 1ME9A 2YXOA 1N55A 2XSXA 4DLFA 2FFIA 1DWGM 5FOOA 3KBMA 5CPTA 2G5WA 2OX4A 4OTKA 4IL0A 2DSKA 3DFSA 3N2OA 3VK5A 4F0RA 3MSRA 2E68A 4HP5A 4JIHA 3QZ6A 5A6MA 3TP4A 1A0CA 3DYMA 1M3UA 3CZLA 1J0KA 3QOMA 4KWWA 4Z2JA 2QCEA 3UERA 4FX6M 2FDMA 3B04A 3QHOA 3EWDA 2EPMX 4BA0A 1BGGA 1JR1A 3B03A 3LHVA 1JCYA 1L6SA 4H8HA 1EPVA 1CX9A 3MJMA 3DG7A 3SURA 3NXFA 5A6JA 1DJNA 4N9EA 3OA5A 3RM9A 3NIYA 1JI1A 3BARA 3BAIA 3D47A 3IACA 3I6TA 3W7KA 5FCZA 2D73A 3GDRA 4C6LA 3LMYA 4B5WA 4QCFA 1OX4B 3W2LA 2OWXA 3LRKA 1PZ1A 3MWAA 1GJPA 4NY2A 2PD5A 3TQKA 3MVTA 3PF3A 1K7XA 4ZR8A 3NURA 3NZQA 1B3OA 4GFSA 1EDQA 2ZVRA 2F61A 5IDZA 3HPFA 1YDOA 4ZOAA 1EGVA 5EBUA 3E5PA 2DH3A 3HQPA 2I9EA 3LPPA 3OEXA 1RH9A 2X40A 4NIRA 3ANUA 3G1SA 1LG2A 4HHHA 1TQJA 2NLYA 2XSAA 4MJMA 3TTYA 3TSBA 1JYXA 3CC1A 3ARYA 1OZMA 5LA2A 3A12A 4FX7A 2P10A 3GNDA 1KLYA 3D3FA 1IT8A 4D1JA 4NQ1A 2BY0A 4AIUA 1BG4A 2Y89A 3NDZA 3RM8A 3MDUA 2P0OA 1VCGA 3GNXA 4I6VA 3MKKA 3HZ3A 3WLIA 5T26A 3IWPA 4IIFA 1DWHM 4WKHA 3SCPA 4GGBA 1GVIA 3TYCA 3NL2A 3FYPA 3QLDA 4MJ2A 4C1NA 1TV3A 3OVPA 3KS5A 3O63A 2J8GA 1XWYA 1XLAA 4YU1A 3W02A 2ZA3A 2NQ5A 4B5VA 1REQB 1XUZA 1B30A 1KQZA 1UP0A 1IZCA 3BVJA 4OGZA 5BU9A 4G56A 4DO7A 3DKLA 1OSEA 1IEQA 4YCOA 4O0ZA 3U8GA 4ALDA 4NAEA 3LHZA 5K2ZA 4PGLA 3T4WA 2J7HA 3W00A 1VRDA 3AXXA 1QR7A 2VFFA 3L0KA 4GQ0A 3QSRA 4JXCA 2X7WA 4ZQPA 3RN6A 1WDWA 4XD6A 3MUAA 2A85A 3V5FA 4BWLA 3OBEA 4QSFA 3QQWA 3GNPA 5BXTA 4UTWA 3DENA 3KW3A 2X42A 3BANA 4C6FA 1IEWA 1QK2A 2NX9A 3VVGA 3COTA 4GQRA 3PWIA 3KFTA 5KETA 1SO3A 1Q66A 3SY1A 3IIZA 4W88A 4KETA 3AMLA 1X7FA 4TV6A 1XDJA 2QUMA 3A3WA 3BJTA 4IWWA 4MSSA 3TTQA 4YN5A 2XIOA 3VO0A 4DJFA 2PODA 4M81A 5FL0A 4FZIA 4TMCA 1XPYA 4MPQA 2NX3A 4A21A 4PUWA 2VXNA 4O10A 4JIRA 5D32A 1CB7B 2VVSA 4OVXA 1SPQA 4GUJA 1JRBA 3A23A 3APTA 4UCGA 3OG3A 3WQ5A 5A8PA 3LCFA 4GUHA 4IFRA 1UWUA 4LC6A 2Y8KA 3M46A 4DUXA 1WZMA 1FH9A 3AUJA 1MZHA 2XSBA 4N9BA 5LGXA 5HMSA 3UPBA 3ID7A 5C9WA 1E6NA 3DHFA 4O4WA 2PDMA 5JH2A 2YXGA 2WJFA 3VDCA 1K02A 3NPXA 1XFBA 3TH6A 2VFIA 4UNLA 5LSMA 3NQAA 1ZJAA 2YX0A 3UXKA 2GQ8A 3LCIA 1IF2A 3MMTA 5AY7A 3A4XA 2OYKA 4NRRA 3W7GA 4CD8A 3LTYA 5DFAA 1GVSA 1U30A 2E5DA 4O0QA 2PGEA 2PWGA 4E3VA 4M0XA 4FX8A 1A0EA 4IT1A 3FHQA 2QPXA 1E4IA 4HCLA 1AA1B 1TMQA 1OFDA 3TYBA 1HL2A 3N2CA 3SJ3A 1YQ2A 3LM3A 1MVYA 4US6A 4QLKA 4NYYA 4JHMA 4J3TA 3A47A 4DJEC 1RVKA 3EOEA 1JXKA 1UB3A 3HG5A 3IIPA 4HTYA 1EWDA 3H23A 1GQJA 3GO2A 3OZYA 1CGUA 3RF9A 1A50A 1J6OA 1QPQA 3BWWA 3WY1A 2ONEA 4LUYA 2J8TA 4S3CA 2FHFA 1RBOB 4LS0A 3UCDA 4DBUA 1LRNA 3C52A 5D05A 2NV2A 4GOAA 2HRWA 3WD1A 3LRLA 3GUWA 3RIKA 3QY6A 4L1GA 3VAVA 3GHUA 1KB3A 4OQVA 3QV6A 3MB9A 1QI4A 1T41A 1H7WA 4JCMA 2V5DA 4JTTA 3V0UA 3S9ZA 1EJVC 3SQLA 3R7MA 4GK8A 5LNRA 4PFHA 2J4GA 1JQXA 4G8TA 1IXNA 3HN3A 1VFHA 1EA0A 8RUCA 3TK7A 2OO6A 2GGIA 1QATA 2VQTA 3R0DA 3LLFA 2J9ZA 1U22A 3GXIA 2VX7A 3TUUA 3ABXA 3NAVA 1F05A 2XN0A 1ME7A 2PC8A 5REQA 4DPPA 3P0XA 3B9DA 4ACYA 3O0KA 3MBDA 2BHUA 4I8DA 3RO6A 4XBSA 2W27A 1H62A 1CECA 4YVPA 3PR2A 1VH7A 5C2CA 1KGUA 1OD0A 3AISA 4DUOA 5HWMA 2A7NA 1Z6KA 4JTGA 1PWLA 5CC6A 3RJYA 4TTGA 1OFPA 1HXJA 2R9RA 3TN6A 1KFEA 3BOXA 4R53A 4I8YA 5AC7A 3NZPA 1NVMA 2PRMA 2A3AA 1J5SA 2YDRA 5AYZA 2BHZA 3KBSA 3N6JA 3W2KA 1GKRA 3T40A 4RCXA 2H6RA 1HX0A 3EEGA 4LAKA 3MMUA 4M7SA 1SJDA 1TIWA 3PBYA 4DX3A 3PSVA 1P7TB 1DTNA 5G5IA 4E8DA 3SRKA 5EFDA 3LS9A 4UUIA 1ZSXA 4DRSA 2VZSA 3UJRA 4XTIA 1J0JA 1TVPA 5C9RA 2YL5A 4HGXA 5A2BA 5CJNA 4PBGA 4S3GA 2HZGA 3W1NA 4N0RA 3UWWA 4C1LA 4YVVA 3DEQA 3NO3A 1X97A 4IFOA 4ADTA 3G0SA 3TV8A 4KKXA 3S46A 4A4AA 1JL8A 3RK8A 3I4KA 3IS4A 4GVIA 3PZQA 4GUIA 3P0WA 4P7NA 1JYWA 3UVAA 3VNZA 1WQ5A 3TQ0A 3VA8A 3NGFA 4CNUA 1ZL1A 1W5OA 4XISA 5DBUA 3OQ8A 1UR8A 1RD6A 1JPKA 5E9AA 5DBTA 3VFLA 1A5KC 1W3HA 3S5OA 4BQ4A 1VCFA 3G6LA 4CD6A 1PE1A 2IPWA 3B0YA 4UMBA 1F9CA 2V6AA 2Z00A 4MKVA 4HNVA 1GOWA 5K4ZA 4LV9A 2WKLA 1H60A 3PSWA 2WBKA 4ZODA 3UWUA 5A6AA 2AL2B 1BKSA 1K9FA 3SCTA 2JALA 1ZJBA 4JN7A 5F4XA 2FTPA 1I45A 1EIBA 5E1QA 1R3TA 5AHLA 4Q8WA 4OJYA 3K4WA 1RAKA 2ACQA 2ANUA 1DIKA 1AH3A 4DJED 3WENA 3DC8A 4AG0A 3NCOA 2WM0A 1LORA 3WUBA 1MQPA 1JZ4A 2WNNA 3T8LA 4Y2WA 4YXGA 1LP6A 1CDGA 1Q6EA 3WLNA 2EPNA 4LV4A 4AWSA 3M0HA 4GYJA 2CLIA 4AZ7A 2WMKA 2P1FA 1V6VA 2E9BA 1EGZA 1S5VA 1YXCA 1I0BA 1YLVA 3MMWA 3MCNA 1RQEA 4YTRA 4H04A 5HQLA 1FP9A 3PUDA 4B91A 1EDGA 1Q5MA 4KEMA 3IANA 1ISZA 5LIXX 3H21A 4L6OA 4QDWA 1FTXA 3O07A 4ZE5A 3NTYA 1XRFA 2DZBA 3H55A 4CNNA 2WMFA 3LNPA 3LZ5A 1AMYA 1QI0A 1WZLA 2YB1A 2XVLA 2XDFA 1K4GA 1I8JA 1E4MM 3B06A 3RX4A 4UMAA 1S2UA 3GVGA 3MPGA 4KF1A 5G1TA 2QW5A 4O1EA 3QY7A 1AQHA 2QXWA 2VFGA 5DANA 4AHQA 3UWYA 2DY3A 4LVAA 4XO7A 3URNA 1Q3NA 2I9UA 3EMCA 1O68A 2WKGA 3VTRA 4C6OA 3VC5A 5K9DA 1UG6A 4P8UA 5JBDA 3AUOA 3EZ4A 5CZJA 4ML9A 5FF0A 3M4HA 4LRTA 4U2YA 1L9WA 4FALA 5HUPA 4AZCA 2WMIA 1TELA 3TC6A 3SUTA 1XL9A 1E4NA 2DT1A 1MEIA 4PL2A 3TW6A 5K9XA 1KCLA 3T42A 2J24A 1UUQA 3QTPA 4DF1A 1D8WA 1GTEA 1VFFA 1KFWA 4GC4A 3MO7A 1E51A 3CEUA 4MPKA 2I57A 1MDRA 3T0CA 4GI8A 1ELSA 1I9CB 3MI3A 3OO2A 1XLDA 1E0WA 3LXBA 4P8XA 3NGJA 5CXPA 3S1GA 2PTYA 3GWQA 4ZEPA 2PDJA 1P43A 2POTA 4UTIA 3G2GA 3CZEA 3M0KA 3GK0A 2CFFA 1VBGA 4OOUA 1XUUA 1V6XA 2Y63A 5EBAA 2E9MA 3W7OA 4DM1A 5ABTA 3MBFA 5J5RA 3K46A 2ZXBA 1UJQA 1DL3A 4JQ1A 3WKZA 2WCSA 2CPUA 4HU0A 4CEXC 3F2CA 1XRVA 3O6YX 5CZSA 4ZFMA 1Q4NX 4DJEA 5I06A 4R7JA 1U2YA 2CHOA 4DO6A 4AC7C 4AQLA 1HKMA 3S8HA 4A8NA 1OEPA 1W8SA 3GC4A 1WKEA 4MJZA 1V7AA 4CGTA 2PLJA 2W4XA 4MY9A 3S2LA 4UOQA 1D7FA 3SZ8A 2YBVA 5HK4A 5M5DA 1OABA 4GABA 2UY4A 1R2SA 1TMHA 4DYKA 2CERA 4H2CA 3RXZA 4A2RA 3OGVA 1RY0A 3ZVHA 2PP3A 1GW1A 4JTDA 3MP4A 1JPMA 2VEFA 2PDFA 5EMYA 4WJXA 1L8PA 4E4FA 4XUGA 3QKZA 2LLEA 1W5PA 2J9YA 3CPUA 2C8NA 3DX5A 2DVXA 2VKZG 3LCLA 2X0SA 3LD5A 3RU6A 4GE8A 3C5QA 2HK1A 4WJ8A 1HKJA 4KRUA 4H9UA 5KEZA 2HTMA 3LEPA 4F79A 3ARUA 3RDKA 3CUFA 4L1WA 4ZOCA 1LT8A 2FIQA 3DECA 1VFSA 2X09A 4H6RA 3A64A 3WDJA 1OCJA 1TRDA 2E67A 5IDIA 3W7NA 3T0BA 3FA3A 2DQXA 3WELA 2WANA 3GH7A 3AMGA 5C2GA 4PTNA 2I1OA 5DCBA 3I7QA 1QW7A 2A2IA 4IQLA 4GQQA 1OINA 4NZCA 2QF7A 3QMTA 4KGJA 3P2VA 1WDQA 5D9NA 1LLWA 4UNKA 2EG6A 1P1MA 4FNPA 1XRSA 1XINA 3SCRA 1RPKA 4FP1A 5DCEA 1KLZA 3VE7A 4FR1A 4RNFA 4OFCA 2YL8A 1GTHA 3FNDA 1FWSA 4UTWC 3VIMA 1HP4A 3P7YA 3C2VA 1W54A 3V7PA 5AHEA 5G1YA 1XLCA 2VRQA 4PMVA 3APGA 5C7HA 4EXAA 1UC4A 2GUYA 4V2XA 1KM2A 1M6JA 4OZOA 2C14A 4WOQA 2V69A 4JICA 1HO4A 3W1PA 3O8AA 5JBFA 2J6VA 3E49A 4JNMA 3ISIX 1BQCA 3R8RA 5DMMA 1RP9A 1P6BA 4DIAA 4US5A 1JG9A 3N2MA 2WVTA 3FYYA 5HMDA 1UWQA 3CPRA 3KE0A 4RL3A 3I65A 1ZCOA 3ITOA 3M5XA 2NSOA 4TX8A 2X05A 3RITA 3L23A 2BSLA 3L9CA 3A9BA 1A4MA 4G7EB 3GBDA 4LQ1A 2DVUA 3PBMA 5ABFB 3PJUA 4MGGA 1ZCCA 3IJLA 3C61A 1PX4A 5KTLA 1E40A 1UPPA 1R2RA 3B40A 3JVAA 1KV5A 3WQEA 1U83A 4EPBC 5CH9A 3RPDA 2Q6ZA 3NYDA 1H2JA 5IBXA 4X2PA 1HL8A 3IVSA 2V5LA 4QAWA 2HVNA 4P8WA 4S3EA 2BZNA 4FLRA 4E4UA 3WLLA 3UZWA 3QW4B 2Z0IA 5H6HA 3W1RA 1N8WA 3GIQA 1AVAA 3SN1A 1GHSA 3VD4A 4UTUA 2W67A 1J2WA 5CZ0A 3T0TA 3GFZA 1M65A 4Q33A 4LOCA 2DP3A 3AIQA 1W56A 2J9XA 5CGMA 1E0UA 1P4CA 3KWSA 4WGHA 3W75A 5GQBA 4R7OA 1VP5A 3G1VA 1XH0A 2QGHA 4DLMA 2BGQA 1OYBA 4Q8PA 4ACZA 1VFMA 1D3CA 5A1AA 2VD8A 5BMWA 2HBXA 1US0A 4IFKA 3OQEA 2G37A 1J12A 1S2WA 5DRCA 4K1GA 4NHVA 2JGYA 3FAXA 4RDWA 1O5XA 1P0DA 5FD0A 2WLYA 4QHRA 1W1VA 3CQKA 4PRTA 1ZUAX 4HHLA 5I3KA 1V6TA 3ARPA 3GG0A 3R89A 4Y9MA 4GRSA 4OBSA 4HT3A 2TSYA 2VR4A 1IV8A 2QR6A 3SCOA 2H8ZA 1N8FA 1FH7A 4Q6JA 2H90A 3PB0A 1GG1A 4FIRA 2VGIA 3P60A 1E55A 3HMCA 5C5YA 2BTMA 2WSRA 3L5LA 1MEHA 5C9UA 1PCKA 4ZCWA 1QPRA 1GW9A 4DYJA 1OG0A 2QPSA 1NFPA 1QOPA 1XLJA 4KCUA 3IPWA 5JVLA 5BROA 4S3BA 4YTTA 3PZ9A 4E2BA 3HOJA 2DGAA 2GVGA 1EJRC 3B0XA 2QKFA 1FOBA 2QMKA 2ZUSA 4GO8A 1ZAIA 4CU8A 2GJXB 5CLWA 1RCOB 3VI2A 3WCZA 3NSXA 2A6LA 7PTDA 1K3UA 3H2AA 3OIHA 3QLLA 3WNLA 2JF7A 3KRUA 2QUVA 3QVQA 3AMDA 2OGJA 4WUIA 2OFJA 1F3TA 3HBLA 2C19A 5CG0A 3FJLA 1B54A 4S3JA 4WF7A 3V16A 1JIBA 3WBXA 2NUWA 1N8IA 1JCMP 4QSHA 2CZVA 4HYVA 3GW3A 3OB8A 3VUPA 3G8RA 3WLMA 3I6RA 4DBDA 4ATDA 4LAOA 4L4LA 5LXEA 1HGYA 3FY1A 1XIEA 2RDUA 3N15A 3SCSA 3BH4A 1GOMA 1IXQA 1EOKA 1ZQ5A 3PY2A 1HN1A 4J27A 3B4YA 1TWWA 1O94A 2DH2A 4J3XA 4LCSA 3H2NA 5BOFA 1VYRA 2WVUA 3IRSA 4ERAA 2Y8VA 3VOHA 3NG3A 4FR6A 2WCAA 3CHEA 4MY1A 5D30A 2H3BA 4AHPA 2EF9A 1KRCC 4GD0A 4A2SA 3AIUA 2QYGA 3T81A 4KGLA 4XUYA 3ZWSA 4IIGA 2CLPA 1GOKA 4W86A 1E15A 3LTPA 1C9DA 4GXMA 2GVJA 5GJMA 2QNEA 3BLEA 4UQ9A 1SW7A 1NEYA 4HQVA 4AMCA 2WBGA 1HVQA 1DE6A 2YBTA 2QJIA 4H9VA 1WXJA 3W7IA 3M5ZA 4UOZA 1EGMA 3ITXA 2VOMA 4ZB0A 4LBSA 3BC9A 2ZFAA 3VIPA 5AYBA 1QHPA 1FVPA 1LWIA 2G3IA 2GGGA 1U5JA 4PR4A 5HULA 1OC7A 3W2NA 1JF6A 3WLJA 3H2FA 1JVNA 3KXQA 2RDXA 3E2QA 4H7ZA 4NAFA 4DO5A 2ZBTA 5IFTA 3EDFA 4JL2A 3DGBA 2J7DA 2VZUA 2R1LA 3RUBL 4FK9A 2B4GA 3AHVA 2ZZ6A 3T2PA 3UGVA 1OT2A 1UMYA 1M7OA 2WSPA 2VD9A 3M6DA 1OBAA 1G7VA 2ZE3A 1RD5A 3V1HA 3GLCA 3D5HA 2BHYA 3M0ZA 1EX1A 2WHMA 4ZL1A 4GKLA 4AZIA 2E6YA 3I3BA 4LU0A 2YZRA 4AXKA 3V35A 4HVXA 5AHNA 3G1YA 4XK2A 2DSVA 2PDPA 3A5VA 4WQ6A 2BOEX 1MNZA 3EXSA 5FSEC 5EA9A 1VS1A 1CXHA 2BXYA 1E71M 3BG9A 4J5NA 4MWAE 1CW2A 1GORA 5DMYA 2PD9A 3WUFA 4LH8A 3AXIA 2F6UA 4BJHA 3MU7A 4ZQRA 3SY5A 2OOGA 3U4AA 3CAQA 4IPPA 3QC0A 3U2EA 5C70A 3II1A 1W8GA 4M29A 2RH9A 3WEMA 3U57A 5HJXA 1J8VA 2XHYA 3GY1A 3C0LA 1P0NA 1RK6A 1IEXA 3MUXA 3AS1A 3WFAA 1E5NA 1B3YA 5D02A 3GFXA 1TYGA 3UWQA 2QVNA 1GVOA 2F38A 4HOXA 3RYSA 4E2OA 3GVVA 4PMDA 1G01A 1ONEA 1ISYA 1PPIA 3AO0A 1A80A 3WBEA 4X2RA 4QNEA 4MKSA 4H8UA 5MKGA 4XD3A 1SUXA 2OEKA 1NH6A 3WH8A 2YA1A 2X1TA 3B8TA 3U48A 3K1GA 3MP5A 4TU1A 4KERA 5EMJA 4X3ZA 3QSTA 1KM6A 4UFLA 1XGEA 2ACRA 4IX2A 1BHGA 3F4VA 1NDWA 3EYPA 2X8RA 1X7IA 1QCWA 4JKLA 1MWOA 3IGHX 5A6KA 1NTHA 3F4NA 5F4SA 3LHTA 3HV8A 2HPMA 4UZSA 1V0NA 4AD1A 4JN6A 4WKAA 3SB0A 5LIUX 1HTIA 2V5CA 2GVEA 3S2JA 3UR2A 3C2YA 1PTAA 4OU1A 2XM2A 2A5HA 3VOJA 4ZVJA 1G4EA 4DXVA 2ACSA 5J8LA 4GBUA 2AGTA 3WD4A 4IISA 3TN3A 3W2UA 1XCXA 3W26A 3JZEA 1KGWA 1KFCA 2BVWA 4LSBA 2EPKX 1FA2A 5EU9A 3W7DA 1NWTA 5AZ1A 3F2DA 2E8YA 1ZHAA 1BXNA 4XB3A 1BWVA 2VX5A 2ZZ2A 1PDYA 2BNJA 5DY2A 1WE5A 3WNPA 3CO4A 4D2JA 1TKKA 3DHDA 4X63A 2J25A 4I5XA 1TZ7A 2IKHA 4FSAA 1KM1A 3AIBA 1V6YA 1J0YA 3GIYA 3NEVA 1KTNA 4PTXA 1WO2A 3LNMA 3S5ZA 4EKJA 1UPMB 3P14A 4IP7A 2GQ9A 3V75A 5BOEA 2BMBA 3KDOA 4PCNA 4PZVA 1XX1A 2HDJA 4JKKA 4QQ3A 1TZZA 3N4AA 1A3WA 4JTIA 2UZ9A 3DC0A 4H83A 4E4PA 7XIMA 4QE5A 4BY3A 4C6DA 3LCHA 1Q2RA 3KVKA 4UQBA 3RG6A 3THCA 4FXFA 2XINA 2O9PA 1TREA 2FTYA 3LG3A 4NYUA 4JFWA 2VC7A 4JY8A 4RXFA 5CSSA 4CCZA 2X41A 1W37A 2WWCA 4ILSA 1H63A 3KM8A 3W71A 6XIAA 1YXYA 1RPXA 1VR6A 5D03A 1FWJC 4PL1A 4JDYA 3H4XA 4Y8EA 4OT7A 3BMXA 5FEPA 3K8KA 2GGEA 5CBBA 2ZKMX 3W27A 1ONRA 3S6DA 4DQWA 3NM3A 3KL0A 4KFPA 4OWGA 4PFMA 4N42A 1Y5VA 3BCFA 4A3YA 3PG9A 5G2HA 1WOBA 1X6UA 4Q7NA 2XN1A 1CT5A 3DI1A 2UWFA 3FK4A 3SY8A 2CCRA 4JBRA 2PDHA 3USZA 1UUOA 3VIKA 2HWGA 3AAMA 3TTSA 2OELA 4I5RA 1A49A 2Q3OA 4WDUA 4QQUA 4JS3A 3GHSA 1W6TA 2XVPA 1Q4WA 2INZA 4TVDA 4U31A 4HU4A 2OOFA 3SN0A 4FS9A 4B16A 1F74A 1GCYA 1ADOA 4REQB 4XZMX 5C71A 1TJ1A 1T6MA 3AHXA 3VOIA 2GWNA 1MXSA 1ITXA 1W0MA 3HPSA 3O16A 4PBFA 2V2HA 2YZ5A 1W9BM 3B9NA 1ESWA 4MUPA 2VEMA 1LZOA 5F7UA 1RVGA 4OUEA 4NX5A 1QNVA 2V9DA 3TQVA 3N34A 5FEZA 4BFAA 4AVOA 1S46A 3SUVA 1U1HA 3TONA 1GUVA 3AHZA 4TTUA 4ZOBA 3K4DA 4I9JA 2ASHA 1L6GA 1HJVA 3T55A 2Z28A 3UJFA 2QCMA 3LX9A 1YADA 4IX0A 1HJQA 4NJIA 1WDSA 4J28A 4KIEA 5BWAA 3VIGA 2W62A 4WEVX 3H4WA 3LLDA 1QDSA 3WH7A 1JGMA 2A7RA 1UH4A 4MNLA 3LERA 2IKIA 3R5EA 5GNYA 1M7XA 1O4UA 5AC5A 3I6EA 1ZS2A 2QJNA 4F8XA 3CZJA 2OQLA 2GPTA 3NYZA 3CXOA 3C2OA 2NQJA 3DDMA 2WJZA 1T8QA 2QJHA 3EOLA 4GIEA 3N04A 3KEHA 1LBLA 3GXPA 3QY8A 2DORA 3CHDA 3RNDA 3WMSA 1UH3A 3CZKA 1M7JA 4PTWA 1R3WA 4UFIA 1LJYA 3BPWA 3D3AA 1A0DA 2YGYA 3KCLA 4IQEA 2GL5A 4Y8FA 1FDZA 2P50A 1A5UA 3LCGA 1WKYA 5C7VA 1KD0A 2VENA 2HV5A 1E3ZA 1JEZA 4GH1A 3OIXA 4RPQA 2FGZA 1MRQA 3QH2A 3QPZA 4GQGA 1VPYA 4BS0A 3F4WA 2J7FA 4TVUA 7CGTA 1PZ0A 3BO9A 3ZLHA 4LY4A 4KCTA 3STGA 4A8LA 2GJNA 3U2OA 2WVVA 1H0IA 4JIQA 3GM8A 3W1MA 1T0OA 1C90A 1VPQA 3BJFA 7ENLA 2Z1VA 2DPEA 3BLPX 3GUGA 3B8UA 3B8WA 1Q7MA 4GX9A 3VNIA 1KBKA 2A3BA 5HWJA 2ZZ7A 3GXTA 3C56A 1VEMA 1VJZA 5HDRA 1MYRA 4ZA0A 1LL6A 3A9IA 3CAKA 3NSNA 4H6KA 4L9XA 3VIHA 2VX4A 3L66A 1CYGA 5M2FX 3A4AA 1VC4A 1DPMA 1GZ1A 1VBUA 1GPWA 5RUBA 3BAXA 1POJA 1EBHA 3W3OA 3NEHA 3WQFA 1DP0A 1Q8JA 3LV5A 3NO1A 4DWDA 2FH8A 3AU2A 3W85A 3WMBA 3MKCA 4AZBA 1TG7A 1NFGA 3BGJA 1UZDA 2VFEA 3WDPP 3VZZA 4AZHA 1PXGA 5K9CA 3PK7A 4A6GA 4R27A 4N2YA 1BEUA 1F73A 1CNVA 4EWJA 1A5LC 3MO4A 4YTSA 1KXHA 4PUEA 4HU3A 3CT2A 2H8XA 2PB1A 1IZJA 3O7UA 5CZTA 1H7OA 4KW2A 2NVDA 4BWLC 3W29A 4RNIA 4UR7A 1GVYA 5U7SA 1I6NA 3V0TA 5CAKA 3H7RA 1F7BA 4LS2A 4ZO6A 2BS9A 4RZBA 2FTWA 2RJGA 3CV6A 1RA5A 4IMDA 5H91A 4B2DD 4NVTA 3S5YA 4CD7A 1LG1A 1B0IA 1O60A 1UR2A 5EMMA 4G7FA 4UMCA 5I3GA 4LB4A 3KOWA 3GZ3A 4P7RA 2WXDM 3VOGA 1NSJA 1B1YA 2HQAA 4PUKA 2RGMA 4Q4OA 2ZUTA 2VDGA 5HNTA 1C8YA 3TOYA 1XCFA 4W9TA 4A8IA 2WC3A 5FACA 1YNPA 3QZAA 1ME8A 4Q4RA 4M6QA 2R94A 3KUMA 3M0XA 1W3TA 1WDDA 4UFJA 3T08A 2NQZA 4INFA 2ABBA 4RE3A 3T2OA 4UC5A 1XGDA 5ENLA 4S38A 1UBSA 1K8XA 3R0UA 1KV8A 1XLBA 2PE4A 1E5JA 4MOZA 4W7VA 3WSUA 1BYDA 4JTLA 4J2MA 1CI1A 3MZNA 4GY0A 1V4YA 3WFLA 2DZXA 3CZ8A 3NZ1A 1GWJA 3W73A 1VENA 3DERA 3S2NA 1CZ1A 1UMLA 3C6CA 4PEKA 4JTRA 2RJHA 3TR2A 2OG9A 3A6OA 3HV9A 4QRNA 4C6CA 1QRQA 4M8UA 4I5UA 3EX2A 2WWDA 3Q58A 2D0GA 3EX4A 3SSJA 3AMKA 4EACA 3LHYA 3CIWA 4HNOA 3VD3A 3FXGA 4ICNA 3BV4A 2EG7A 3BTNA 4L4MA 3W1QA 5U4NA 3IUDA 2PRHA 1PKLA 3WD0A 4PE8A 1H1NA 3LI0A 3E0VA 1A53A 1CLVA 2WZIA 4L6HA 4DZHA 3XIMA 3CAVA 1R8LA 3RR1A 2DZPA 3E5BA 1GKQA 1Z9AA 1HNYA 3QHMA 2YDQA 1NP0A 4IMEA 4ICCX 1AL8A 4JNYA 3N9KA 1R86A 1W1A1 3REQB 2FHCA 2I17A 3AHYA 2GVYA 4HA0A 4Q32A 3HPZA 4TXEA 5CSYA 1XSIA 3T0AA 3RGTA 2QJMA 1XI3A 4W8BA 3MS8A 1QWKA 2GJRA 1E6ZA 3SM0A 3APYA 3I3EA 1TJPA 1B4EA 1UOKA 3LY0A 4EF9A 2OEMA 4JNZA 5DX7A 4BI6A 2ZICA 4WDXA 1WV2A 2XWDA 2AMXA 2OT1A 3TYDA 3VKBA 1H11A 1FCQA 2BASA 2EXOA 4U5IA 3O15A 4O57A 5BYWA 3NR0A 2E77A 1GVFA 1MFUA 1W2VA 4H8NA 1ITQA 2O9OA 5IOBA 1VF8A 4MY8A 2XN2A 1E6PA 1OF8A 1FWHC 4NI8A 4W7UA 4Q8VA 1JJKA 1AW5A 1XBZA 3PNZA 1VBJA 3MHUA 1E9IA 2DZAA 2Z1SA 3MDWA 1BF2A 1S5WA 2GDUA 2ZRVA 4ZXLA 1Q6RA 3UZZA 1MW1A 2OGYA 5CC7A 1O5QA 3IVUA 1EF2A 3L2IA 5HANA 3EGJA 2YW4A 1EIXA 3Q67A 4O4VA 3GDLA 2UY3A 2AGKA 4LNCA 2PPGA 1W9XA 4CQ9A 3N13A 1F76A 7A3HA 4QIUA 3FIGA 1DE5A 4PEEA 2PDBA 1ZLPA 4E38A 1LWJA 5LA0A 3VX0A 4UTMA 4I7UA 5L9FA 1UD8A 1L6WA 4BEUA 3QR3A 4QLLA 4B5XA 4JYDA 4JFVA 3CIVA 1Z8AA 4R88A 4L9ZA 4I9TA 1SFSA 1ZJHA 2TYSA 1E1EA 1JAKA 1O6IA 2Z2UA 4J3VA 3WQCA 1NOFA 3OZMA 4JQ3A 4RE0A 1I4NA 1EUAA 3ZQ9A 2YA2A 3VGBA 3VILA 2BGNE 1QO5A 3EPNA 1EH9A 4F2BA 4DELA 2V2DA 1EJUC 5I00A 3ZSSA 1A5BA 3P80A 3BE7A 1SO5A 2ZVIA 4GMEA 1RJQA 3WLSA 4CN6A 3PZGA 3CL6A 1NF0A 1GVQA 1L0PA 2OKTA 5LNUA 1V3IA 2AL1A 4AD0A 2PTWA 2HBVA 1KA9F 3OLEA 2B7PA 1TTQA 1OX4A 2IQDA 2VRJA 3L4WA 4HZMA 4F9JA 4ZB5A 1MXDA 1YMYA 3GXFA 3CYJA 2PURA 4AWUA 2HNHA 3L65A 2DUXA 2OX1A 4GYPA 4NU7A 3V1PA 2XJ7A 3M7SA 2QLYA 1IIHA 2ZX6A 4AY1A 2DVTA 4YYFA 4KWUA 3CS2A 3PFRA 2GSEA 5G2WA 4R7WA 3TTEA 3ZJ8A 3WNMA 3R8GA 1GYMA 3IVTA 1H50A 3CHVA 3EWYA 1MW3A 1NQ6A 1NP2A 3UNTA 1Y8BA 3VNDA 3IUIA 5EY5A 4HPJA 1PV8A 1OM0A 1ZENA 4QAIA 1NDYA 3KOYA 2DIJA 2J7GA 1VRXA 1KXVA 5LHFA 1P7TA 1CTNA 3F4CA 1W9DM 5BOOA 2OLAA 1YW1A 4C5YA 5I79A 2DW6A 3I3DA 1XYMA 1RCQA 1QOQA 2NLIA 1RZMA 1J11A 5TD4A 2W6RA 1ZBCA 2ISVA 3CUZA 1JZ7A 4AIEA 1EOMA 1HJSA 4W87A 4A3RA 3EDEA 4L61A 4RE2A 5I3IA 1MQRA 4JYFA 4P7QA 3FSUA 4QM1A 3HPAA 4GI6A 2IPFA 4R33A 2OMAA 4AF0B 1Z3NA 1ZJIA 4K37A 4X0NA 3LXCA 1OG6A 3ZS4A 1RQBA 4GHRA 4CN1A 4M7TA 5K4XA 1IR1A 3SCWA 5GJNA 3R0KA 4HPGA 4LVBA 5EB8A 2DZWA 3GHTA 3N73A 3ARRA 3URAA 3N2TA 3G1FA 4DAIA 1ODZA 4W84A 1V93A 1KFJA 2ZE0A 4Q7IA 2C7FA 5HATA 5AVHA 2GDVA 1FDJA 4V28A 5JXQA 4JX5A 3NQFA 4EK7A 3BDKA 5HOSA 2Y7FA 3DGRA 1ZRQA 3GVWA 4PB5A 4YPJA 4C6JA 2B7NA 1G67A 4NAFB 3MSYA 1N2VA 1JQVA 2X0YA 4QG9A 5I0DA 4KRZA 4U3CA 4XZHA 1JCLA 2D69A 4JIPA 1K8YA 1TR1A 4K8GA 2OPJA 3WL0A 4OBRA 3WBWA 2O92A 2ZYFA 3FLUA 3N9RA 3SEPA 5A6BD 2EJAA 5LGZA 4QROA 1EZ2A 5I78A 1EP3A 2PTXA 4H9MA 3DYPA 3H6OA 1TPEA 2CBJA 5D9MA 3L4XA 2HE5A 2PBOA 3CQ0A 5E0CA 1JFXA 2QUTA 2EPOA 3LPGA 3WK1A 4B5SA 4S3AA 4IM4A 5FJUA 5C2XA 1E70M 3ABZA 2HSAA 2PCQA 3E9AA 2YW3A 4O1FA 4G7EA 2Q71A 4J35A 1GYNA 3BLLA 1QK0A 3M0LA 4PUMA 3PZOA 4FF7A 4O1CA 4G2DA 3WLTA 3RAOA 1CLKA 1EX5A 4C90A 3N6HA 1UASA 4FNUA 3T09A 3P84A 5BW6A 1XG4A 4XKMA 2NT0A 3QN3A 1ZAJA 1YE6A 5I6SA 1OFAA 3GG7A 4GZEA 1LOSA 4R85A 3WK3A 3KX6A 3M41A 1KM4A 1E3XA 1YRRA 3CQHA 2DIEA 2OLSA 5E93A 2V67A 1YX1A 3NQ8A 2ZUNA 3EWXA 4L56A 1H51A 2O56A 4GYFA 3P61A 3I10A 4FI4A 3BG3A 1DWJM 3ABRA 1JZ3A 2VYOA 4FO4A 3W7QA 3OPSA 4PSRA 3LPOA 4GXWA 1AJZA 4JX4A 5CC5A 2VEGA 1XLIA 3F5KA 5E09A 3TE9A 4O1DA 2WVSA 4Y6GA 4GACA 2ZTJA 4XWUA 4IOTA 2QPUA 4LUSB 4XZLX 1X1OA 1DQUA 1Z69A 1OZQA 3O9NA 2Y0FA 1AW1A 3ZVIA 1QW8A 1X39A 2CBIA 2CLLA 3GIPA 4TV5A 1J9YA 3ATYA 4PUDA 4NZJA 1PBGA 4NJJA 2HS8A 3TAOA 4ZOEA 3G1RA 1T8XA 4Q8QA 3Q45A 3N9SA 3UZ5A 2WMGA 2YL9A 1ENUA 5CSUA 4X9YA 4QX4A 2PCEA 1UHVA 2Y5SA 4UQCA 1MXGA 1Q6QA 1NDVA 3DH7A 4M1RA 4PTDA 4MDPA 3RX3A 1PWMA 2G96A 2QAPA 2Y7GA 4RX0A 3UR8A 4LTSA 2Z1XA 4LW7A 3Q65A 2W79A 3ITVA 1TX0A 3K13A 4H6QA 5BZAA 2OU4A 3THAA 3WNKA 3STCA 1W1IE 4Y90A 4MHBA 1ISVA 1ZBKA 3E0LA 4PBEA 3E38A 5LA1A 4KH2A 2XFRA 2E6FA 3CTLA 2H9AA 3L12A 7REQB 2NWRA 1E0TA 4DI9A 3CLWA 1V3MA 1AJ0A 4OV9A 4IG2B 4O54A 3IV3A 3ABOA 4EAMA 3HU7A 4AVNA 4LB3A 3S42A 1FX6A 4S3DA 1A5OC 4JTQA 1T99A 4E2DA 4Z1DA 4HPNA 4IIEA 1OK4A 5I23A 1FKXA 4RNHA 3W76A 1LL4A 3BJSA 3GVRA 1PKNA 3L4ZA 4QG8A 3UP8A 4C6MA 3M7WA 2J75A 3V3WA 3BSHA 1TZ9A 3BZJA 4BF5A 4P7LA 3WF3A 1M01A 1T7LA 2HVMA 5T9BG 3IJIA 3WLHA 3SR7A 1PZ3A 1UR4A 6TAAA 4YTQA 5KITA 1FHUA 3FOKA 4DWSB 4EAYA 3MJYA 1EHNA 5DF0A 2I5QA 4PUNA 3W24A 2ZTKA 1ADSA 1NFBA 2W0UA 5LKYA 5A95A 1RK5A 4AY7A 3WK2A 2ZUMA 3FVDA 2R1PA 4S39A 1XFCA 3VNJA 2FGLA 3F1QA 3PPHA 4HJWA 1GK8A 2PU0A 4ROQA 1GGOA 3GC2A 5G4WA 3VCRA 2CXGA 3U2ZA 2DT3A 3OTRA 2E1DA 3OBAA 1Y65A 2WOQA 4W7WA 4QG6A 4I3GA 3PZVA 1R5YA 1GQLA 3F4DA 2YFNA 3NL6A 3U6WA 3SQMA 3W7LA 3HQOA 4F48A 4IUGA 1QPNA 4PMZA 4PMUA 1SZNA 4FLSA 2Y2WA 4MYXA 3ZR6A 4ATLA 3KHJA 3UCQA 1RALA 4O0KA 4Q6XA 2G50A 1R7OA 1TWDA 4YIWA 3HG3A 5AZ0A 4MB5A 1R3QA 4EE9A 4FOJA 1MW0A 4CCCA 5HXMA 4W85A 4NG3A 4IZGA 4KMQA 3TA6A 2G3MA 3W6YA 4H01A 1THFD 1G7UA 3UF9A 4M19A 1E4LA 5E6YA 4HNLA 5DEZA 4AFYA 5E6ZA 2P3ZA 4WY0F 4GUFA 1Y7VA 1S5TA 1CXEA 3ATZA 4L7ZA 1JDFA 5XINA 3SRFA 1EXPA 1JZ2A 2XGZA 3KLKA 4ICMA 3KOZA 4S3KA 2FPTA 2OVLA 4DY1A 4C1NB 1ITCA 4QJ3B 1HT6A 2Y70A 1FWDC 3EDJA 5H1WA 2DV0A 4XAYA 4IFKB 3KL3A 1ZBVA 2HE8A 3KRBA 3GR8A 3W7HA 3ARZA 2QAFA 4CQCA 4AW7A 3PFMA 1QHZA 1J6PA 4JOMA 1EC7A 1HGWA 4HCDA 3QRHA 5CJMA 4ZE4A 1WCGA 3GTFA 5CG7A 1LOLA 2V0TA 1P0KA 3PJXA 3UY8A 1I0DA 1JCXA 5FJPA 4DM2A 3C3UA 1XKYA 4CNPA 3OLIA 3BMVA 3LQGA 2VT0A 1KO0A 3NQGA 1ZB5A 2FZBA 4DN1A 2XFWA 4WIWA 1K6AA 1NELA 3ALFA 4H2HA 2HMCA 3FHAA 4MFEA 4IIHA 3TXVA 3E6EA 4MFDA 1EBGA 3HM7A 2WZHA 5C6MA 4XKYB 1UYQA 1TUXA 1XRTA 1QNOA 3E02A 1DTUA 2Z6IA 5D37A 1OFOA 3FKKA 3H8AA 1VCVA 3QW3A 1AG1O 1B2YA 1V08A 3O06A 3GG8A 1TE1A 5CPLA 1DQWA 4XAGA 1ML1A 3S3GA 2GJXA 1Q6LA 3S6OA 3UD6A 1XF0A 2DSZA 5GPRA 1GPFA 3OZOA 3AZTA 4C7DA 2NXHA 4C6BA 3YPIA 3SBFA 4B90A 5LZLA 2NSXA 2PA6A 2REQB 2Q09A 2VCAA 3GU1A 3R25A 3UBPC 1M03A 4HYRA 1Q7QA 4KCWA 4W89A 2QQ6A 4Z2HA 4HHPA 1M04A 2NXGA 2E09A 2VMFA 2XZ9A 4I6KA 1G0CA 3C0SA 3RJXA 3WQ4A 3WYZA 1TV5A 4NASA 1ZBWA 1L2QA 2FB3A 1JD7A 3JR2A 5EMUA 2X7VA 5HR7A 3N18A 2D1ZA 1HW6A 1YXDA 5EL1A 1RLCL 4Q3MA 4GVFA 1UKPA 5A2CA 2E25A 2WHJA 3P6LA 4F9DA 3QYSA 3S1VA 3VMNA 1VKFA 1M9HA 3G8EA 3KL5A 1W2PA 3BAWA 5HQEA 1Q6CA 2XUCA 4Z2KA 3CASA 2AMGA 4FIQA 1QXLA 5KZEA 1QW9A 1JCTA 4PRWA 4ZQCA 2W66A 3M0IA 2J88A 2J47A 2W3ZA 2GJPA 2RDWA 2FDSA 3L4TA 3FGCA 1PAMA 4IICA 4XVEA 1ZPTA 3JW7A 3OHIA 3I68A 2Q01A 4MWAB 3VNKA 5BXRA 5TQLA 1FHVA 3MVIA 4K7VA 3OG2A 4C7FA 2JEPA 4F0LA 4LVFA 3T44A 5DCDA 2FPYA 5LYRA 1H7PA 2ACUA 4M6PA 3WQDA 2VDHA 1A3XA 3C8NA 3KBJA 1QASA 5D2YA 3HGSA 5AOUA 4WXYA 3MTWA 1HG3A 2O55A 4PH6A 3K5XA 5CLTA 1J96A 4MG4A 4AISA 2ZUUA 3T78A 3KWXA 1PHWA 3ZIZA 1SGJA 1XYLA 2FZ8A 2H3DA 4IH3A 4MB4A 1QTWA 4REQA 5HJYA 5F4WA 3CUXA 2PF8A 4QBXA 3ITCA 1TCDA 3WDHA 1T40A 4GKTA 1JPDX 1Z89A 1BRLB 2I7GA 3LUTA 4W8AA 4D6DA 4DUVA 3GH5A 3MSGA 3PBGA 4FF5A 3SO7A 1Z42A 1KTCA 2CIPA 2GSJA 2V5BA 4PMOA 3IGXA 3KRZA 2QDGA 1OYAA 3ZWTA 4HYWA 4KEZA 3SJNA 1OB0A 5AC8A 5DQPA 2W5FA 4H19A 1JAEA 1XIDA 2VHLA 1TJRA 1J93A 4MYAA 4LBRA 3SRDA 3PG8A 2WMIB 3RR4A 2PMQA 1WKFA 1WPCA 1JYNA 2OQYA 2WYSA 5CPMA 3RCYA 2ESCA 3G1HA 2PDYA 3FEMA 1EEXA 4M3PA 2CWXA 2VR2A 4O17A 5D2WA 4GISA 1IGWA 3LSCA 4YHEA 1DJIA 4K3ZA 3CWOX 2JIEA 1ODUA 4JR5A 3FW6A 4MWAC 2MUCA 2OSXA 1I2RA 1X8CA 3WF1A 1FRBA 3GR7A 1V0LA 4J9JA 1FHDA 1SVDA 2F6KA 1JUBA 2X0HA 5IHSA 1TPWA 3CIXA 1GHRA 4HCHA 4IPIA 2ADAA 5D8WA 3WUEA 1KM0A 4KT2A 4O15A 1ZGDA 2DSWA 3TIMA 1B90A 2FZMA 5T91A 2D2GA 4AIBA 3M16A 5D04C 3NUKA 2FPVA 3PBVA 1MUWA 5A8OA 2PDXA 3ONCA 4UB9A 1I2OA 3QXBA 1H09A 3DHUA 2PLCA 2KZHA 1JUEA 3PP7A 2Q8LA 3S83A 3VIOA 1FWCC 3AS2A 3WF2A 2HCVA 1XBVA 1S1PA 3I7RA 1QNQA 1VZWA 3GW0A 3MA8A 2Y5EA 5KMYA 1OVDA 1IXOA 3CQJA 3WJXA 4UQDA 1G4PA 3OLDA 4DJFC 4M82A 3U3HA 5HNUA 3AICA 3NOEA 5HWNA 2W91A 3QQ1A 1XIBA 1Q6GA 2D3LA 1LQ0A 1UKTA 4B5TA 2F7FA 4Y9PA 1Q45A 3G1XA 2CITA 2VDIA 3KHDA 1J18A 1S3HA 5DELA 1Q2SA 2XVKA 1DXEA 5AECA 3DUGA 1XSJA 2R1NA 1UJPA 1UIOA 3IJ8A 3KVLA 1EEPA 3O1NA 2UV8G 1C8VA 2VWTA 4CNTA 1ZU8A 4XZNX 1DJGA 3L68A 2DSUA 4UTLA 2XIMA 3E1F1 3DFNA 1AZ1A 1OFRA 3OOQA 1SMDA 1LROA 4F4RA 1ZAHA 1Q8AA 1TMLA 2QVHA 4DPQA 4J40A 4QCEA 2J6XA 3IAQA 3UXDA 3K30A 1RUSA 4WSJA 3CV7A 3VGFA 2DFAA 3WJZA 2IQTA 3AROA 1OY0A 5JIPA 4CNOA 5LHEA 5SWUA 1YPFA 4KCVA 3P3BA 4OBTA 4FXSA 9XIMA 1D9EA 1EHAA 3HO8A 3HQNA 2CYGA 4L6DA 3E12A 1PIFA 4I9MA 1GYLA 3AS0A 3UG5A 3WEOA 1PL9A 2KX9A 4XZIA 3UR5A 3V18A 3SN4A 5LNSA 3WJSA 5HPCA 4XBKA 2QT3A 4DWSA 2FZDA 4MZ8A 4LEQA 2C79A 2ZX5A 2VP8A 7ODCA 3N2XA 4O8AA 3C2RA 1F8IA 3CH9A 3MY9A 5XIAA 3ARWA 1HL9A 3M07A 3PAOA 2XH2A 1C7SA 3TR9A 1SO6A 3QGAC 1AQFA 5D38A 3UNDA 2D24A 3W88A 4ADSA 1S38A 2ZQ0A 3P62A 3GU9A 3VINA 4WSKA 2CLOA 4ZQNA 8CGTA 2BVDA 1OIMA 2A3HA 1DIDA 4IGNA 3FYOA 1NARA 1FCUA 4QS6A 4MTVA 3GTNA 1D8CA 2W63A 3WH6A 1NOWA 2FGBA 2DZUA 3C3NA 3H4GA 3IJ9A 3KZSA 3OA3A 3EAUA 1R9ZA 4MIMA 3GR4A 3B8VA 3D46A 3MYPA 2WKJA 5DO8A 3P5YA 1NOUA 4J2PA 4LWWA 1V0MA 4CCEA 1A3HA 1XLHA 1QJWA 1JNEA 3THQA 3VXGA 1DJHA 2CEQA 3SUWA 3S6TA 4I7VA 4XAPA 2RDTA 3HF3A 1TRIA 4QLJA 3AS3A 1KXTA 5H8UA 1OGGA 4B5NA 4AC1X 4H8VA 3W7EA 2YLLA 2PGRA 5IXEA 2DZSA 4NRSA 1GOOA 5F1VA 5CPNA 4LAMA 4ERIA 4W5ZA 1EPXA 1JUKA 1EL3A 1UZHA 5HMEA 4QR6A 3TAKA 5FSDC 3KDNA 1GOQA 3QJAA 3CV2A 1XKJA 3UYIA 5AFDA 1UR1A 1LL7A 1KNWA 3FKRA 3TWBA 4BQ5A 3STEA 1UH2A 4O53A 2TODA 5HNRA 3GD6A 1H3GA 2EPLX 2X2GA 3MP3A 2C18A 3A4JA 4M24A 4GVGA 2PDIA 4YNGA 2J79A 1FXQA 4QE1A 2P8CA 2Y8UA 1EZWA 2PGWA 3BMWA 4HJFA 3TYUA 3WO8A 5LIYX 5JMUA 3BSGA 3EB2A 5A6BA 5KSWA 2WNQA 2VEPA 3SCVA 5ABEA 1S1RA 2PI6A 4PMRA 2NUYA 4QEHA 4DI8A 1XYFA 3N29A 3W6LA 5BXSA 5J5DA 1A5CA 2CZFA 4KEUA 3GFYA 4M56A 5FF3A 1PKMA 5JU6A 1LUCA 1GQNA 1C8XA 3VGEA 6REQA 3CYVA 5BMXA 4RW3A 4GZ7A 3FAWA 1UOZA 4XKYA 3P81A 3NQEA 5FKYA 2OYMA 3W28A 3HFTA 3H2EA 1XC4A 1R9YA 1BXBA 1HIZA 4GI4A 3T9PA 1S2AA 1SU5A 2C1IA 1BVNP 1FWRA 5EFFA 4H41A 4DJDC 3RLVA 3L0NA 3UVIA 3ES8A 1Z41A 4DWSD 1NM9A 4TR9A 5H8PA 4AWTA 3N17A 4J3UA 4LUSA 1BF6A 3EWZA 3WJYA 2D2JA 4YJ5A 5E70A 3B0UX 2G3FA 5AYXA 3SGGA 1Q63A 2D3NA 1SM9A 2VGGA 4F0KA 1IYXA 3UXAA 3VDGA 3RLUA 2G4JA 4JTSA 4LUTA 1XG3A 1W32A 1Z44A 1VAHA 4FHAA 5L6UA 2EJ1A 1H4PA 2OO0A 3RHGA 2CLMA 3OW1A 1BVZA 1WBHA 5FAGA 1MO0A 2WPBA 4DZ5A 3SAZA 5A8GA 2EO7A 3ANVA 3TSDA 1JPIA 5A6LA 3GQYA 3T1GA 4L64A 1E1CB 4N6EA 1JGIA 3W1LA 5B80A 4L65A 3UYCA 3VKAA 1PSCA 4D8AA 3W86A 3WH5A 5KZ6A 1NJJA 3SDOA 1FDYA 4DHGA 3VM5A 3AIRA 4LPCA 1H7NA 2C91A 3D0CA 1RP8A 3MC5A 1SSGA 3N4EA 1W9VA 5TNVA 3FA5A 3SQSA 2OB3A 3QFWA 4UTFA 3MKVA 3BLKA 4WVXA 1YNQA 2GLKA 1UBPC 1MDLA 5EPDA 2YBUA 4MLRA 2HVOA 1DOSA 2J78A 3M6YA 2R8WA 2QIIA 3NQBA 4IHCA 1I1XA 4W4QA 3NWRA 3PC0A 3AALA 2B7OA 2ZZ5A 2WPGA 5CJ5A 3EOUA 1Q65A 4Q22A 3TMQA 3W22A 1VYSX 3CH0A 5MF5A 3UETA 3R13A 5A69A 1E72M 3LOTA 2E4TA 4UCFA 1EDTA 3NVTA 5IHRA 5D4YA 3NL5A 4UIOA 4MDOA 1YPXA 5AN7A 1AQMA 4LT9A 4D6FA 2EKCA 2WSQA 3UPWA 2C1GA 3ZFHA 1WZKA 3ALGA 3R11A 1FWFC 1VIZA 1UR3M 2R82A 3OGSA 2ZADA 4DBWA 1DV7A 3BZGA 3WUGA 2P76A 3QYQA 3A5FA 4AU0A 3DBPA 3HGJA 1AUSL 4H1ZA 3PPCA 3MI2A 3I4EA 6CGTA 2O7QA 2QMJA 7TIMA 3IUHA 1EF3A 4N4PA 1BRLA 4RLIA 5CGTA 4F40A 3UW6A 2FMNA 1RV8A 3L5MA 4AD5A 1GEQA 1J79A 5M17A 3TYZA 3UPMA 3PBWA 2V38A 3FFSA 2GZXA 1GZJA 3NPVA 2ZX9A 2X16A 3VE9A 2BBFA 3EA3A 1O1ZA 2XH0A 3PTMA 4I9AA 4P2VA 3ZXWA 1KFKA 4NNCA 3KZPA 4XBJA 2INFA 2VGBA 3SUSA 1FWBC 3BSMA 3VOFA 2ZZ4A 2EQDA 3VMPA 2W92A 3E0FA 2OJPA 3UFYA 3BAKA 3DU0A 1GQIA 4XZ9A 4UOJA 3V0SA 3DFTA 1Z32X 4RPPA 4B3LA 1E6SM 1OJXA 2I14A 3UY7A 2AAAA 4AY8A 1QAPA 1TCMA 3W53A 3ZLFA 5BNKA 3AIEA 3CHFA 1KW1A 4GY7A 1V0KA 4X9SA 3WQ6A 4F66A 1DJYA 3RPTA 1UC5A 3WF4A 5JQ9A 3TFCA 5BRQA 3V5CA 4ORIA 3VKDA 4UNIA 4K8HA 3IGSA 2ABAA 1DXFA 3DN5A 4GCXA 3FS2A 3GKFA 5HAOA 3WQ8A 4DWSC 1WOAA 2J7BA 2WM1A 4Z08A 4HN8A 3BLDA 1O95A 1XH1A 2HXTA 1QO2A 1G94A 2V3EA 4KWOA 3UXLA 1LLZA 4Z1BA 2F6XA 2BP1A 2OEJA 2XH7A 3N3MA 2V30A 4Y7EA 2RHGA 2INEA 1EXBA 1TV4A 3BL3A 3ANYA 3EX6A 5B7YA 2Y88A 2PDQA 1F4AA 5G1MA 3DFYA 3BOLA 1IXPA 3EMZA 3IJQA 1R3SA 2WHLA 4PODA 1D3GA 3UA4A 3QC3A 3HPXA 4GG9A 2VUYA 3PWAA 4CCDA 1TJ2A 3S4TA 3FJ4A 3MHFA 2VWSA 1BXCA 2NX1A 3WD2A 2XFYA 4CEUC 4EPEC 3INPA 4O13A 3EOSA 3HFYA 4XIMA 1PHQA 1UD6A 5AYYA 4WX2A 3WZ0E 1FWWA 1IZKA 3G5EA 4N6FA 1T96A 1UWTA 1K4HA 2BY1A 4WRHA 3AXKA 1SFLA 1IT7A 1CGVA 2E8ZA 1XR2A 4JGDA 3H22A 2G0WA 1NY1A 1MW2A 3P5ZA 4XTDA 3G18A 4RW5A 1UROA 3LV6A 4PCTA 1UKQA 3SSZA 3AHTA 1KCZA 4MWAD 1YNYA 5C54A 4NKCA 4PCFA 3ZSTA 2D23A 1B9ZA 3ZO9A 2Z4GA 4AZ6A 4PCPA 2GOUA 4Z2IA 3L0GA 3NVDA 3VKCA 1SQ7A 3CWNA 3ZT7A 1PYFA 4O12A 3R43A 2VVNA 2ZRXA 4UR9A 4HNNA 4HSOA 3N25A 2YDSA 4JEJA 4IPNB 4Y9NA 4RXGA 3DG6A 1DORA 4D72A 1JZ8A 4YTUA 1JDEA 3GSMA 2XIJA 3H70A 2O4QA 4KFOA 1P5BA 3TXZA 1L6YA 1BLIA 2CZEA 3AZRA 3IEBA 4XVDA 4LAUA 4WKFA 3C2EA 1WUFA 1KWKA 1VEPA 1V3KA 1VEOA 4DF0A 1PX8A 5AVNA 1XBXA 3CAWA 1TVNA 3QKEA 4MJ4A 4GQBA 3M0VA 1JZ6A 5I2UA 3OVGA 5C0QA 1BVWA 2FHBA 3LQLA 4XAFA 5DXXA 2JE8A 1KM5A 1QT1A 3W07A 2Z2AA 4C7GA 2BLEA 3SIZA 3W1UA 3TCSA 2XU2A 4RUBA 3LGDA 3ARSA 3UZYA 1ZY9A 4JZ5A 4POCA 1PIGA 2OQHA 4K8EA 1WDRA 2E6AA 3HURA 1KWGA 1K03A 4A35A 4NZ1A 1YDNA 1O7AA 4LNYA 3RM4A 4F0MA 2OWCA 3DESA 1FHLA 3EB3A 4HSNA 2PDCA 2ISWA 4PUJA 5T9CE 4XZWA 2QS8A 3PM6A 1TPFA 2JKPA 3QZEA 1DEDA 1XP3A 2I5GA 1XLEA 4J7RA 1XDLA 2DQWA 4LVGA 3IIVA 2E1WA 4JKMA 5FF2A 3UESA 4HHMA 1SW0A 1BAGA 3U5YA 1DHKA 2CNCA 4DXKA 1W91A 2QV4A 3W25A 2WCGA 4ADUA 3KCJA 4TIMA 4ZO9A 3DAQA 1EJ7L 1WX0A 3VYLA 4B92A 3RPMA 3WDIA 3G0UA 3B05A 3VIIA 3H2CA 3F5LA 1F6YA 5JIWA 1ZP4A 3GX9A 4B9ZA 4IMFA 2VEKA 3V5OA 4M5PA 4LYPA 1KBLA 3A24A 4AH7A 3GYCA 1UD2A 1GJUA 1BSLA 1JF5A 1QI2A 8XIMA 4QITA 2ALRA 1W31A 3BURA 2PF0A 3DG3A 5D09A 1EP1A 4RDVA 3WN6A 2G41A 4MZYA 2HEJA 1OQFA 2IMRA 3ECQA 2BDQA 1V03A 4TX6A 1W5MA 1S5NA 5BXPA 8XIAA 3MCOA 3DI0A 4U2ZA 3BAYA 1UKOA 2PFHA 4B4FA 1L2UA 4MF4A 4O16A 3A3HA 5G4EA 4V1YA 2PLMA 5DMLA 3UJSA 2CZDA 1JDAA 2BY3A 5DXYA 4PCSA 1PZ2A 2JGQA 4GNJA 3P93A 3ITLA 3HB9A 4W93A 4D8LA 5CC3A 5B7ZA 3XISA 5FAJA 3UG3A 5D9OA 3JS3A 5JUVA 1H49A 3HIJA 1XV8A 2VL4A 3H7VA 1KC7A 1LCOA 5KZDA 3TN4A 4MZ1A 4C6PA 4GVHA 3VKKA 4UQEA 2DT2A 4RZ6A 1DYSA 4WSHA 3DXIA 4Q4QA 1B4KA 1SJCA 2O0TA 1PUDA 1XJBA 3Q94A 2QJGA 4BK9A 1LQAA 4GGHA 4AZCB 1U5VA 1X1NA 5DT7A 4AVFA 5ABGA 2ZRWA 4HNCA 4LUTB 1SR9A 3T7VA 3QGKC 2FZNA 3W87A 3ES7A 4FLOA 4QJ1A 3DFHA 4R9OA 1CWYA 1JRCA 1CXFA 3JZUA 1OWQA 3S5NA 2OZTA 1PKYA 1XLMA 3G22A 4L4PA 4MKNA 4PMQA 3W1TA 3LN3A 1FWGC 1VYPX 1FUYA 4PYSA 1XIMA 1VJIA 3NPWA 7REQA 2PDKA 3W83A 4LANA 3KOFA 3C0QA 2Y85A 4GIYA 1ZTVA 2CETA 3URQA 4Q8OA 3PTKA 2FVLA 2TAAA 1RBLA 4TOQA 2CKSA 2GSHA 3SGZA 3NFUA 2QZRA 3SCQA 4NP7A 3ZJKA 2CWNA 2HK0A 3TX9A 2IPGA 5AHFA 5F2MA 3N6QA 3GAKA 2WVVB 2Z29A 3W1AA 3ZZ1A 1M1BA 1FP8A 3MV01 1P1XA 1DJWA 1XISA 4EVZA 3AFBA 3EXRA 4JAWA 4YYCA 4PMYA 3CGTA 3OGRA 2QCDB 1JCJA 1JDCA 3U7BA 3EWCA 3DCPA 3NDYA 3LBCA 1K1DA 1K8CA 3DOPA 4AAJA 4FNQA 4IJCA 4BCEA 1Z48A 1HJXA 4GCAA 2DJXA 3TEVA 3ZR4A 3QR0A 3H2OA 2WZEA 1M68A 1C93A 4N9CA 4RV8A 1NWSA 1Q6DA 4ERGA 2ZXQA 2RGLA 1C3FA 3W38A 2QGYA 1I2QA 2XTKA 4DNMA 1JNDA 4O19A 3D6NA 1LQ2A 1X96A 2PC4A 3S2CA 1DKWA 5KZMA 2XVNA 1UQZA 4UBPC 1B3WA 1TV8A 2ALDA 4V15A 3RLGA 3U5UA 4WDTA 1WXYA 3EA2A 1Y5WA 4JIIX 3QPEA 5DLCA 1ALDA 3PULA 4LY8A 3PUEA 2PWEA 2G8ZA 3O05A 3N14A 2EHHA 4GY1A 1R30A 1TO3A 4FNRA 4H9YA 2GK1A 4CVWA 1IEVA 1YKWA 4JQ2A 4LRSA 2CU0A 2E9LA 3EEZA 1OF6A 5CQ1A 2RKXA 3B0PA 2I5IA 2PEVA 2POZA 4D6IA 2PRLA 3N12A 4QDPA 1VFUA 2H9AB 4PMNA 4LGXA 2X1SA 1XPGA 1ONWA 1FWNA 3VMOA 1SO4A 4F0HA 4ZZ9A 2Z7GA 2V3DA 4GIRA 2CLFA 4OKDA 5IM51 5HJLA 3RILA 1X38A 2QV5A 2F84A 3KRSA 4LYQA 4DAFA 4ATWA 3QGVA 1J4EA 4XX6A 3M9YA 2WO5A 4OE7A 3STPA 1L6FA 5M1TA 2ATMA 4RJEA 3W74A 2P53A 4HKPA 5CAHA 3TNBA 4ZMGA 1FWIC 1WBJA 1PIIA 1DWAM 4L80A 1W3JA 1VGAA 5CGQA 3W37A 4JYEA 4WOZA 1I1WA 1XD0A 2QUNA 4HMEA 2QCDA 3A3XA 4FPSA 3NXLA 1G69A 1XS2A 2V82A 3TSMA 3M5YA 1Q6FA 1QHOA 2ISFA 4GX8A 2OSYA 2OWWA 4NNBA 1O5KA 4IIBA 2YIHA 2OTDA 1WUEA 5EYWA 4LUJA 1K70A 5E0FA 2R14A 3UA3A 2UY5A 3KOXA 3AOFA 1JZ5A 3WQPA 3WQOA 1XIJA 3DYOA 4MNMA 5FF4A 1E9LA 4J3WA 5T8GA 4ENLA 3O3RA 1LBMA 1DIOA 4RZ5A 1XH2A 3IJ6A 4Q8UA 2FB2A 3TTOA 1V6WA 3MCMA 5BRPA 3W1XA 1BG9A 2GWGA 1HUVA 3PZUA 2J74A 5D33A 3XINA 4PA8A 5A2AA 3VDAA 4IMAA 3EB4A 3F7JA 4E0CA 1ZNNA 1MUMA 3PTQA 5HR6A 3M1ZA 1IT0A 3U0HA 1TJ0A 4ZTXA 1XIFA 3VIFA 1WDPA 3MUZ1 4CNSA 2BY2A 3NNTA 3SFWA 4FNSA 2XISA 1E1CA 4N02A 3NA8A 4RNJA 1TWIA 3LBMA 4HN4A 5E0KA 2A1YA 1NAL1 3KBWA 1Z7AA 4YVXA 2RUSA 3CPGA 3REQA 1SFTA 2JBMA 3LTSA 1UD4A 4L9YA 4GNVA 1KR0A 1QOXA 2Y61A 4P7OA 2DW7A 4Z17A 3O6CA 1TPC1 1XHGA 1ICSA 3N1AA 1FBAA 3W81A 3Q2DA 4RDZA 2Z6JA 4A22A 2PSNA 4C1KA 3T05A 3WL1A 3A4WA 4PN2A 3M0MA 1GVEA 1KRMA 2C3ZA 4H9TA 1QNPA 4ACZB 3UG4A 1BFNA 4RK8A 2FZ9A 4ROPA 5GVJA 3M43A 2JKAA 2BGSA 3HTWA 2DDXA 2NXIA 3KTCA 4ECLA 3GU2A 4KBXA 4MAVA 1MI3A 6ENLA 3T8QA 1B57A 1C9WA 2KAUC 4EX4A 1HP5A 4AD4A 1EQCA 4IG2A 4DF2A 3NJ3A 3W9ZA 5IFPA 2QHAA 2Z1WA 3LGEA 3BLOA 2PWHA 3QOKA 3GNNA 1GONA 2Q3RA 1A5SA 4O8RA 4IUOA 3T2QA 1QI3A 1UCWA 4WZHA 1NWUA 3W4RA 4GA8A 2VURA 1VBRA 2HXUA 3E2RA 4ZQOA 3QF0A 2PWVA 4BI5A 1KR1A 3R8HA 1MMFA 5DY3A 3E0IA 2ON3A 3RRAA 2XWEA 4HPHA 1DIEA 4K2SA 4YWSA 3POCA 2OZ8A 3A13A 1SFJA 3EWWA 3W82A 1W1B1 2YCIX 4YS1A 4B2DA 1S39A 4B3ZA 5I03A 5EGRA 2WSYA 2YKKA 3QPYA 3IK4A 3ZJ7A 3VIJA 2HNEA 3FVMA 1QPKA 3G77A 3S1UA 1JD9A 2MNRA 4K1WA 3NZGA 2PU1A 4FAMA 5A6SA 4WY0A 4S23A 1UWRA 2BVTA 5F2LA 3VZXA 4HK5A 2DEPA 2IKJA 4BKNA 1D2KA 1IWPA 3IIXA 2NVAA 2Z1BA 2ZC8A 3OBKA 2XGBA 3Q4DA 2WC7A 5AC4A 4WLCA 2Q8XA 1I75A 4O1AA 4LC8A 1E6QM 1J5TA 3KP0A 1CXIA 2R1KA 2WC4A 3B8SA 3GNOA 3G24A 2P88A 2OODA 3KS6A 4D71A 4F0SA 2ZX8A 3BV7A 4LUIA 2OCZA 3AIWA 2NUXA 1ECEA 1W17A 1TSIA 4NL1A 1UD5A 3MYOA 3LB0A 4XSMA 3VNMA 4HD5A 1YYAA 1M7PA 3C8FA 1CXKA 1QI5A 4U10A 4ZQMA 1HZYA 2NV1A 3DZ1A 1B9BA 4DB7A 3S5SA 1AJ2A 3BQ6A 1MZRA 4KS0A 1YHTA 4DVOA 1RR2A 4G1KA 3EBVA 3CTTA 3ELFA 1LBFA 1JCNA 1B5TA 1ECQA 3ARQA 3TLQA 3ORWA 4MUZA 1MUCA 2WZTA 2DIKA 4JL1A 4YLWA 3FGCB 1EYEA 1X1ZA 1WB0A 3PANA 4HB7A 4YMZA 3RU8X 2VZVA 1YTEA 4MNJA 1F2JA 2Y7DA 4GJIA 4NXSA 3EKZA 3VDHA 2X30A 2YSWA 2R24A 1TWSA 1F3XA 1JFHA 3WMCA 3QEZA 2WNWA 4O50A 1F3EA 1IEIA 3LLXA 1K8ZA 1OX5A 5AYIA 4XG1A 1VLIA 4AF0A 3TA9A 1EWEA 2OZ0A 4GO9A 1BGAA 5TAOA 2REQA 3SCUA 1K9DA 6A3HA 3M0JA 4HTBA 1US2A 1EFZA 2QDDA 4AEOA 1TTIA 4HK6A 4AX7A 2EEXA 4ORMA 1PX3A 4MADA 4TVCA 3VGHA 3GHRA 1X98A 4RKAA 4HSHA 3BCJA 3H24A 1PTDA 4FMVA 3VZYA 2YL6A 3SUUA 3PPGA 5FIPA 2PP1A 3I7SA 1XC6A 4GBDA 3RCNA 4I90A 3OJGA 3FSTA 1BTCA 3QV8A 1C92A 4HNTA 3NSMA 2Y5JA 4Q8TA 4B9YA 1TTPA 1XIHA 3T0DA 2QCNA 1LYXA 3CNYA 1ONXA 2TMDA 3B9OA 2C13A 3P82A 3S47A 2RFGA 1FKWA 3TKFA 5LIKX 1E73M 4Q8NA 1R6WA 4ZSTA 5D2TA 2D20A 2NWSA 3S2MA 1DXIA 3OYXA 2E28A 1HKIA 6PTDA 1UWIA 4QTGA 4NJHA 3PZMA 3TN5A 4RDYA 3N19B 1PVNA 4DEFA 1EQPA 1KFLA 1WYIA 1VPXA 3AXHA 3U4FA 4O14A 4V1XA 5HQMA 1V8EA 1E6XM 4CQDA 1KCKA 2WAGA 1LUCB 6REQB 2Y6ZA 2EG8A 1G4SA 4AUBA 4Q4PA 5H2ZA 2F8QA 1KRBC 5BU6A 5M03A 1MRAA 3GE7A 9CGTA 5I24A 4Z0SA 2JEQA 2AQWA 5K3VA 4X22A 2A7PA 4B15A 1F6KA 3M5VA 3BCDA 3CMFA 3GTIA 2YA0A 4A3UA 1UP3A 4UXDA 2YJQA 2J27A 4UTKA 2VC9A 3M44A 1DJQA 4O11A 1TX2A 4MAZA 1OT1A 2FFCA 1L8NA 2OT0A 4Z42C 2DT0A 1I60A 4AEFA 2QCFA 3F5JA 2YCLB 4US5D 1EC8A 1E0XA 2IXUA 3UEQA 1XYBA 3THUA 5K7JA 3DFOA 3T07A 3BUVA 2C16A 4O52A 1XYZA 5E9XA 4CKQA 1QBAA 4UQAA 1KBIA 4QE4A 4O1BA 3ZLGA 4DZAA 1HKKA 4E2VA 3B97A 4D6GA 2FKPA 1GZGA 1TV2A 3QTGA 5BWFA 1OGSA 4IPLA 1V02A 2OXNA 4V27A 2P0IA 1TIMA 5GNXA 4YWIA 3LK6A 3J7HA 4M51A 2QCGA 3ARTA 4FLQA 3WLQA 1CEOA 1XIIA 2YXXA 3G1AA 1AQ0A 3BW2A 2VNCA 1BQGA 3FN9A 3M47A 4TUFA 3WH9A 2CLHA 1MQQA 1HFBA 4H00A 5DN1A 2VZOA 1DWIM 4S3FA 1TQXA 3SCNA 3NQVA 1FH8A 2PZ0A 4HPXA 1QFEA 1K9TA 3ARVA 3UGRA 4TO8A 3OYZA 1GT8A 4HMNA 1SYTA 4C91A 3VGGA 3ITYA 2SFPA 3NQMA 1XQKA 2E6DA 1KQYA 4EF8A 4WDWA 5FJJA 3CL7A 3CUGA 1A5AA 4BEQA 4XD4A 4AIOA 3GVQA 4H3DA 3EKLA 4Q8MA 1R85A 4CUCA 3KP1A 2GDQA 1EP2A 6ALDA 2WHKA 3QQ0A 1BPLB 3VD9A 4J3SA 4KESA 4HOZA 2VO5A 4JDBA 1C7TA 1EC9A 1VJSA 1HF6A 3LCWA 1SW3A 3H12A 2XVGA 3AYTA 3EX3A 4Z2LA 4MM1A 4LX4A 1Y5XA 4XAZA 4ZTYA 3JUGA 5D8ZA 5A5WA 3CT7A 3KVMA 3VC6A 2BFGA 4KRTA 1K6WA 3WEZA 2V3FA 1U1UA 1ZP3A 3RRXA 3GBEA 5DT5A 2VI0A 5HA7A 1TWZA 1YEYA 1XICA 4GUGA 4H9ZA 3EPMA 4XD5A 3FX4A 4DXXA 4UR8A 4AD3A 2V5JA 4D9PA 5REQB 1K9EA 2CXEA 4PB4A 5HNNA 3W70A 4ZENA 2NVCA 1FCBA 1H1YA 2YOCA 4WJEA 1SJAA 5AHIA 2WSKA 2O9TA 1ITUA 1PEZA 4Y9OA 4NZFA 1LOQA 3KVJA 5CSRA 4HZ8A 2FYMA 4F2UA 5E5CA 2CLKA 1TUFA 4XO6A 4ML4A 3MV11 4AWEA 3G3MA 1UZ4A 1EYWA 4D6HA 2V68A 1OFBA 1Q85A 4H6EA 2FLIA 4BF7A 3MUIA 1LTDA 2QJJA 4GNKB 4IXXA 2YDAA 4N4QA 3TJIA 2IKGA 3FJ6A 3LYEA 3M64A 1QNSA 4NXKA 1HO1A 1FY6A 1G5AA 3WLKX 5I3DA 3HMJG 3CJPA 2X1RA 3SADA 4JTFA 4IXHA 3BLFA 1LRTA 5FEXA 2OLHA 3KAOA 2GQAA 5EKYA 4IGHA 1ICPA 3WF0A 5KINA 5XIMA 3FCPA 4A3QA 3WIJA 1RLDA 4AMAA 2F2KA 1ZFJA 1LRQA 3NPUA 2GJLA 1G1YA 2Y1HA 3T4CA 3PUOA 2PDWA 2EGZA 3EXTA 1PYMA 3OU8A 1H41A 3F2BA 1XCWA 3B9AA 2VFHA 1DJXA 3ZYZA 3UWEA 4N9DA 2EPHA 1RJRA 1OC6A 3C86A 1SZGA 4MB1A 4H4IA 3CM4A 4CQ8A 1A5NC 3LPFA 3LGGA 4KQNA 1TFVA 2X2YA 2IS7A 2AKZA 4HK7A 5AKQA 5G2IA 1NQKA 3BLIA 4UFMA 3WK0A 1XD1A 1SR0A 3CB8A 1SZRA 2EBNA 2WZMA 5CPSA 2DZVA 3DHPA 1XIGA 2JFEX 1TPB1 4MNKA 1S2VA 1NWRA 2A3LA 4NNAA 2PBGA 2VEIA 2FVMA 3NQCA 5LIWX 3E3HA 4AZ5A 2CZ5A 5CPOA 1DVJA 3LRMA 3P67A 3NQ2A 3ZM8A 1KKOA 2CBUA 2Y4SA 1QMLA 2FMOA 4D1IA 3GZAA 1CLXA 2I56A 1IWBA 2HPIA 2Q02A 2ZUWA 4CN4A 4LJ3A 1IHIA 3PAJA 1VD6A 2ZRZA 1E6RA 2W61A 4RZ4A 3CK5A 3QBUA 3IJ7A 2VQUA 2CLEA 2GYIA 3PBUA 2DZTA 1W9UA 5FEWA 8TIMA 3MW7A 3MZ2A 2BX7A 3EA1A 1FWTA 3G3DA 5I3FA 3LBOA 3VCNA 5FESA 1SZEA 1S2TA 4EANA 4JFTA 5ABFA 1W5QA 1ISXA 1IWAA 1WAWA 3G1DA 2ZWZA 3VX1A 2PLKA 2GK1B 1FWEC 3FA4A 4GI9A 2NZLA 1VLWA 6TIMA 1W3KA 2V2CA 4IL2A 2ZX7A 1M53A 1W1PA 1A4LA 2YB4A 3W01A 3CMGA 1EO7A 5F2IA 1H0GA 4F3HA 1MFVA 5HBFA 4JHZA 3RMEA 8A3HA 4OIFA 3NDOA 4MWAA 3WQGA 4G1NA 1TE6A 1UA7A 2WMJA 1YPIA 2BWGA 4IMGA 1YE4A 4IPJA 3W84A 2NW0A 2C71A 3POHA 1O12A 4HU8A 4CVUA 3FDGA 1IE7C 1MEWA 2A21A 4D6EA 3IRDA 2PDLA 5A94A 2B7QA 3OP2A 1G9HA 4PMXA 4JFUA 1LT7A 3U7VA 4D6CA 4H7VA 1E56A 3H26A 3TJ4A 1X6NA 2FQIA 4WCJA 4DJFD 1HJWA 1AH0A 4KWSA 2ZXAA 4AD2A 1QU4A 3TMLA 1WZAA 1GG0A 2Y24A 1E9YB 2O9RA 3CLMA 5I02A 1ADDA 2UY2A 3TOPA 4NAEB 2I16A 3HJEA 3KBNA 2VX6A 4GC3A 3WNNA 3TVAA 1RSCA 3F03K 2GGJA 4YL2A 2VC6A 1XLKA 4JTEA 1LDCA 4WGXA 1XYAA 3IV8A 4JTHA 1MNSA 1M5WA 2IW0A 3URBA 2Z1KA 4E8GA 4F2TA 3GTXA 4FOUA 1QBBA 3WLRA 3L2LA 4BZYA 4D8ZA 3GS6A 1J0ZA 5HINA 4PTMA 2X1UA 3R1ZA 2NQ9A 1W9PA 3HG2A 2YCJA 1LF1A 1K7FA 3PZIA 3UJEA 4NJGA 2CBVA 4GINA 3OHMB 3K8LA 3VFCA 1V79A 4M80A 1XLFA 1OCNA 1UD3A 2Z25A 3VKJA 1EO5A 4DYEA 5IBXC 4DJDD 1W1ZA 3RO8A 1EA9C 4Z1YA 2MANA 1UWAA 1VFOA 2ZA2A 3TJXA 1IQ8A 1QNRA 2J77A 2WK2A 2P8BA 4K38A 4JFSA 4NSBA 3HGRA 2XH4A 2QF8A 1W3IA 3EMQA 1W1TA 1DWFM 3WD3A 3K1DA 2GUBA 3E2VA 1R38A 4NJKA 2ZCGA 1R2TA 2AQOA 2Y62A 3PTDA 3BXWA 4D6JA 4HZ7A 2V63A 3B9EA 4EXQA 2PTDA 4M6UA 4HA4A 4OOZA 4UTJA 1Q6OA 3KCOA 2V81A 2B81A 2G4FA 4WHBA 1XYCA 2OYLA 3IJDA 1S5MA 3MUY1 4FA3A 1AW2A 2ZDSA 3TC7A 2JIWA 1Y0EA 1XLLA 4HNUA 2HJPA 3OVQA 4GZIA 5FJRA 3BICA 1KBJA 2XIQA 3NQ7A 3VDBA 2IXVA 3AMCA 1OYCA 5FA5A 3AC0A 2P3EA 3P8IA 3DFPA 2HROA 3QMRA 2L5HA 1B31A 1KCXA 2AOSA 5EMKA 3MANA 1WNOA 1W1YA 1OFEA 1H7RA 1N7KA 3NOYA 5CBJA 3W0KA 2F9RA 4NI3A 5HPOA 3SI9A 1TPH1 4QP0A 3TLLA 2XG9A 1GJWA 4JD4A 2VC5A 3PJTA 3GDTA 4LF2A 3LDVA 3SFKA 1VFTA 5JBEA 4ZFCA 1LWHA 5PTDA 3OLGA 1I2PA 3SGUA 2GGHA 4LCRA 1BYCA 5C8BB 3JRKA 1GQKA 3G6MA 3AIVA 3OVRA 2Z2BA 4IP5A 3CL8A 2E40A 4IIDA 4Z2GA 4HMDA 2NT1A 4C6IA 3K4AA 5I77A 1JI2A 1AFSA 5F1UA 3JU2A 5H8MA 1CGXA 3ZVHB 1YDVA 4JCLA 3B0VC 2ATSA 3ICJA 5LNVA 1AK5A 3R6IA 1R3YA 5AC6A 4ZO7A 4K36A 1SMAA 4C6KA 2A6NA 2BV9A 4K6AA 3PJWA 1P0EA 3VNYA 3PZNA 2EKGA 2Y7EA 4LBUA 3T6CA 3QHNA 3ZR5A 3B8IA 1KGXA 3GG1A 2PZNA 1KXQA 2G97A 3WFZA 2VR5A 2NQLA 4QFUA 4B3KA 1PJ9A 1EKOA 1OD8A 4G6CA 3RCMA 1EUNA 1FXPA 1KTBA 3PVFA 3B8DA 3W72A 1H1ZA 4Z1AA 3RFAA 1VFLA 3GB6A 4AB4A 2JK2A 1LLOA 2P5NA 3SECA 3ZJ6A 1GEHA 2J62A 2WQPA 4E3TA 5FJTA 3R58A 1POKA 3U2CA 2TPSA 1OHLA 1SJBA 3GDKA 3W7JA 4O28A 3RMJA 1C8QA 2C15A 2B0MA 4GH3A 1R9XA 5D9PA 3H2MA 4JQ4A 1T5AA 3R12A 1UA3A 5EMLA 5GJPA 2VOTA 1GOIA 1YIXA 1S2CA 4ZBCA 3S9YA 5CCZA 1NIUA 2V8ZA 2O7SA 3BGAA 4S1FA 1R3RA