2J74A

Structure of beta-1,4-galactanase
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
386
structure length
386
Chain Sequence
GLYVEKVSGLRKDFIKGVDVSSIIALEESGVAFYNESGKKQDIFKTLKEAGVNYVRVRIWNDPYDANGNGYGGGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPAKQKAPKAWANLNFEDKKTALYQYTKQSLKAMKAAGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETDSNILVALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYYPFWHGTLKNLTSVLTSVADTYGKKVMVAETSYTYTAEDGDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPVGPAHRLEKNKALWETYGSGWATSYAAEYDPEDAGKWFGGSAVDNQALFDFKGRPLPSLHVFQYVDTGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords YVFO
publication title Investigating the Binding of Beta-1,4-Galactan to Bacillus Licheniformis Beta-1,4-Galactanase by Crystallography and Computational Modeling.
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 147
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2006-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2j74A00
3AS3A 1RP8A 1H2JA 2ESCA 4WSJA 1AQ0A 2VX5A 5I0DA 1QW8A 1B3VA 4P8XA 4GQRA 1XCWA 3GXMA 4HMCA 1DWGM 1KCKA 1CGTA 1US2A 1JD7A 4PSRA 4BF7A 1KGUA 3AIWA 3L4VA 1JYNA 3VDCA 1J11A 1WZKA 3GDBA 3KZSA 1HIZA 3CHFA 3B9DA 3SIMA 5JIPA 3U5UA 3IK2A 3L4YA 3M07A 3PTQA 1TE1A 1DP0A 1BGGA 4YHGA 3JUGA 2D24A 1CDGA 3IJ9A 3UR7A 1DWHM 2G3JA 2HISA 4JFWA 1ESWA 3WY1A 4WKHA 2X8RA 3VD9A 3VGDA 3CH9A 2WCGA 3K4DA 2Y4SA 1SMAA 1ISVA 1FP9A 3AIBA 3VX0A 2BHYA 1BG4A 3OGSA 4W7WA 5ABHA 1FHDA 3KWXA 2WMIB 3VD7A 4BCEA 5A6BA 1HVXA 1B30A 5I24A 1HX0A 1M01A 2XVLA 1MFVA 1V0MA 5KZ6A 3WMSA 3K1DA 3VMNA 3BLKA 1W2PA 3VINA 5BXTA 2WPGA 3N18A 4JCMA 1WCGA 1TMQA 5EB8A 1LL7A 1M7XA 3LPPA 3T2QA 5JBDA 2VNCA 4GI8A 4WSKA 4D6GA 4PMVA 2CHNA 3WQWA 3FY1A 2EBNA 4CVUA 5M3WA 5A6BD 1HT6A 3SCOA 4M24A 4J3TA 1M53A 2VMFA 6CGTA 3UEQA 2XM1A 1CGVA 3ZT7A 5A8OA 3VPLA 3WBAA 4GXPA 5E6YA 3F4VA 4MADA 2YL5A 1WZAA 1J9YA 2W63A 3RIKA 3NCOA 2UY3A 1XYFA 3U5YA 3BAKA 3WF1A 2G8ZA 2EPLX 2B31A 1J01A 5FOOA 2PI6A 1W9XA 1ZU8A 4PMQA 4XB3A 4MAVA 5A6KA 2WBGA 2WSPA 3N15A 3L4TA 4H8VA 4OJYA 1VBUA 4A4AA 2XVGA 1FH9A 1SFSA 1NQ6A 3AXHA 2XYLA 4DUWA 1E6PA 2ZX7A 4EE9A 3K8KA 5IXEA 4CKQA 1XH2A 1XCXA 3EMQA 3WQ6A 1BSIA 3QR3A 3RPMA 1C8XA 1CYGA 3PZUA 4YN5A 3VD3A 1XSJA 1UQZA 5DFAA 2FH8A 1BF2A 1E6ZA 3WDIA 3I3EA 2ZX8A 1XRVA 3GTNA 4KRUA 1GONA 4WLCA 1E0XA 2DT3A 2BV9A 1ISYA 3OZOA 1XSIA 1GOQA 3PZOA 2CHOA 4BA0A 4JL2A 3GNOA 2YJQA 5JBFA 4NRSA 1BYAA 2W62A 1E15A 3CBWA 3NDYA 1ZBCA 1K9TA 5IFPA 2YLLA 4W86A 1W1PA 2ZX9A 4DM2A 1J0ZA 5D9MA 4PBGA 1W9BM 1XSKA 4PMZA 3OB8A 2CBIA 4AD1A 4MJ4A 2J7BA 1GQLA 1GCYA 3WIJA 2VR5A 3VD4A 3VIIA 2WB5A 3W6LA 3POCA 3VGHA 1XC6A 1QVBA 1W9UA 3KEHA 1OGBA 3WELA 2DT1A 1US3A 3KL5A 3W28A 3AYSA 3ZT5A 1NM9A 1PAMA 2YL9A 5FL1A 2V3FA 3BAYA 4AWEA 1UA3A 2JEPA 3WN6A 1DWFM 3OLGA 2Y8VA 4EKJA 4AYSA 3G6MA 5FCZA 2WM0A 4DWSB 1M03A 4D6CA 3TONA 1V3LA 4MNMA 1LG2A 3MUZ1 3UERA 3SUVA 2HVMA 1ZS2A 4LQ1A 1WPCA 4J7RA 4JCLA 3WDJA 4A3HA 6A3HA 2DEPA 1MQRA 1E3ZA 4MNJA 4UQ9A 3VOCA 1UR4A 1HP4A 4FLRA 3UCQA 3NIYA 1NOWA 1TCMA 2OYMA 2WAGA 2DSZA 1HKKA 4XX6A 2ZUMA 1HF6A 1GJWA 1FA2A 1CXEA 3OGRA 1G1YA 3DC0A 5D4YA 4W87A 1JZ8A 4JL1A 3WDRA 1JDDA 5CLWA 4DWSC 3S2CA 4DM1A 1A47A 1ITCA 2BXYA 3BSHA 1R87A 5JBEA 4U2ZA 4CD5A 4AD0A 1OIFA 3SUSA 4KMQA 3AMLA 2GJRA 4RE4A 2X1IA 4L4OA 4TUFA 1NP0A 1SMDA 4CN1A 1AMYA 4AZCB 5CZKA 4UFLA 2EPOA 4PEEA 5CPSA 4AZ7A 5BXSA 3VDAA 3AHZA 3CMJA 5ABFB 2XTKA 2UY2A 3A6OA 1D2KA 3W4RA 3VM7A 4Z2GA 1KXTA 3HU7A 4EANA 3A4WA 3BCDA 4J27A 4WK9A 2DH2A 3CZEA 2XHYA 1MWOA 3ECQA 3MO4A 1R7OA 3WBEA 2VURA 4A3YA 1NOFA 1K9DA 3PZIA 4ACZB 5GPRA 2G3MA 5D9PA 3IJ7A 3RM8A 1PEZA 2J7DA 1TZ7A 2XFFA 4FF5A 3WD2A 3WUGA 1MQQA 3PZ9A 4JFTA 3DHUA 2ZX5A 3CUHA 4GINA 1JFHA 2E3ZA 3CZGA 1EQCA 3AYRA 1ODZA 1V3IA 2ZUUA 5CGTA 4HZ7A 4PUEA 2JEQA 1V3JA 4PUDA 2D22A 4AISA 3G6LA 2FH6A 4F79A 3K8MA 1YHTA 4UFHA 3VO0A 1V08A 1JGIA 1GOWA 4IISA 4MNLA 1IT0A 4CCEA 5I23A 3MU7A 1G9HA 2XM2A 2ZUVA 2OSYA 4H41A 1V3HA 3WF2A 1JZ7A 4JHZA 1I1XA 4UNIA 4MPKA 1QNRA 1UR1A 3W6MA 2PWEA 1PIGA 1H0IA 4GQQA 1E3XA 3VMPA 4D6IA 3AHXA 4MDOA 3GNPA 2WVTA 1E6XM 1B1YA 5M03A 2XVPA 1CIUA 1CECA 3QHOA 2IXUA 3CHDA 3SURA 4AIUA 1PBGA 4W88A 4XV0A 5C70A 4J3XA 3MSDA 5E09A 2CKSA 1UD2A 1KCLA 2CNCA 4IPNB 3VU2A 4PMOA 4B16A 5CPTA 1UZ1A 3WH5A 3BLPX 4CD7A 1V3MA 2WMHA 4HU0A 3UG4A 1ODUA 1MXGA 1AQMA 3OLIA 2F61A 3WUFA 4ZEPA 4KGLA 4P7NA 2ZUNA 3WF0A 3WENA 1K6AA 3LMYA 3VNZA 5ABEA 4X0VA 1CXFA 5EBAA 4ATDA 3W25A 1LLOA 5CPQA 3QOKA 2VC9A 2QV4A 5I78A 2J7FA 2JIEA 1FFRA 3AICA 4CD6A 3A3HA 3N1AA 5HBFA 1VFFA 2VX6A 2W61A 3IAPA 3QGVA 1X6LA 2FHFA 5DT5A 3W0KA 1BVZA 1GQKA 2XJ7A 1RH9A 1VJZA 1PX4A 4W8LA 4Z2JA 2DPEA 2VCCA 1G01A 5GQBA 1HXJA 2C7FA 4NSBA 4QAWA 5FKYA 2V3DA 1FP8A 3AZSA 2J7GA 1C91A 1AVAA 2ZXDA 1E1FA 1FOBA 2O92A 2Q8XA 4CN6A 4HA4A 3LPGA 1P6WA 4ZFMA 1BGAA 2XSBA 1E9LA 3U7VA 2DGAA 2V3EA 3EDKA 4ATWA 1JXJA 4TVCA 4HTYA 4RE3A 2WVVB 1WZMA 4GO9A 4HU8A 2NT0A 3MUY1 1C3FA 4ZXOA 4W89A 2WWDA 4W7VA 2VT0A 1EOKA 1IV8A 3N04A 2X05A 3BSGA 5C71A 1ZB5A 2BXZA 1OM0A 1EDQA 4QLKA 3SUTA 1JF5A 4FLOA 3WD3A 3AIEA 2ZUTA 4IUGA 3CUJA 4PTVA 1WP6A 4FK9A 3AHYA 4E8DA 2Y2WA 3T0BA 4QFUA 4HPHA 2J7EA 1OT2A 3QHMA 5A6SA 2YDRA 4AXNA 4F8XA 5BRQA 1UHVA 2WMJA 2YLAA 5AC4A 2OWXA 2V5DA 1MFUA 2OYKA 1VIWA 5I2UA 1FH7A 2CXGA 1WE5A 1LG1A 4GI9A 1V0NA 2XGBA 4HOXA 3W26A 3ARPA 5BRPA 1AQHA 1QI0A 1MQPA 2CBUA 2XSAA 1FFQA 1OBAA 4HOWA 4W85A 3WQ5A 1W3LA 5M5DA 3WF3A 4TTGA 1QBBA 5D8WA 3WH7A 3L4ZA 1W1VA 4ZENA 1CXIA 1GOKA 1R86A 2F8QA 4GKLA 2YKKA 2WKLA 1TA3A 3MV01 3WQ8A 2PWDA 2ZWZA 2J7HA 4M82A 1GVYA 1JYWA 4UQEA 5FD0A 4ATLA 1QNPA 1UD8A 1KWKA 4MB3A 4W7UA 4B3KA 1XH0A 2JE8A 5LA2A 4BQ2A 4J3SA 1HJXA 3PTKA 3WMCA 1LWJA 3AIQA 3WNPA 2JIWA 2V5CA 1V6XA 1H41A 1UH4A 4E2OA 1QI3A 2A3AA 1E0VA 3CZLA 1PIFA 1V02E 4P8WA 4AW7A 2X2YA 1FH8A 5HXMA 3MSGA 1C8QA 3MMDA 1C8YA 2PBGA 3VIJA 3DHPA 4TTUA 2ZXAA 4WIWA 4J3UA 3CZJA 3GH5A 2Y5EA 4UFJA 5I79A 3AIRA 1KFWA 3BC9A 4QDMA 1GOIA 2J74A 3VDHA 4PRWA 1BPLB 3AHVA 5HNNA 2VJXA 3RJYA 1M04A 3PHAA 5ABGA 3WDHA 5AC5A 1KXVA 1E71M 3AI0A 2BHZA 3T09A 1KWGA 3WEOA 1B3WA 2RGMA 1TR1A 1KXQA 3OZPA 1OD0A 8A3HA 4BQ5A 5FL0A 1J10A 1UD6A 2CEQA 1B31A 2UWFA 1BYCA 4X9YA 2E40A 1UD5A 3L4UA 3VGBA 5IFTA 1GPFA 4WKAA 3VX1A 2XWDA 3WFLA 3PZMA 4UQAA 3M46A 4D6DA 4GZEA 1OIMA 4EAMA 4Z2LA 4HA1A 1HNYA 1KGWA 3MMWA 1MYRA 3CUGA 3O9NA 3WNNA 1FHLA 1X6NA 1GHRA 1HJUA 3K4AA 4PTMA 1ITXA 4LPCA 2TAAA 2WC3A 4KGJA 3M6DA 4U5KA 3SCVA 4E8CA 2GSJA 4V27A 1WB0A 1CTNA 1DWAM 1B9ZA 1L0PA 1C7TA 2A3HA 2O9TA 3EDFA 1V6YA 2QMKA 3GH4A 3AS1A 2VR4A 4BQ4A 1U2YA 4HA3A 3AMKA 1W9DM 2VQUA 1H09A 7TAAA 2VQTA 3BAWA 2CBJA 1OINA 3ARTA 1VENA 5TD4A 2E8ZA 2W91A 4GI6A 1QNOA 3CPUA 4KH2A 4UQCA 2PB1A 5A8NA 2BVDA 2WCSA 1OSEA 4MDPA 3CZ8A 2J8GA 2GJPA 1BAGA 1I1WA 4HOZA 5A2BA 1TVNA 4JFVA 3ZOAA 1JNEA 3ARXA 1NARA 3ZJ7A 2WANA 4UOQA 3MMUA 4AD3A 3PZQA 5A6MA 2YA2A 4U33A 4PMDA 4Q7NA 1JL8A 3SUWA 1E5JA 2GJXA 1K9FA 5C8BB 3UG5A 4JZ5A 3N11A 4E4PA 4W8AA 3WH8A 2JF7A 3ZMRA 2ZXBA 1J0YA 1DEDA 3WQVA 3DECA 1HJQA 3OLDA 2WHJA 3ALFA 4HMDA 4F66A 3EYPA 3I3DA 1CENA 3W24A 3PBGA 5HPCA 3PN8A 3GYCA 3GNRA 1GOMA 4D6EA 1HKMA 4CCDA 3W81A 1OGGA 5CLTA 1E73M 4CUCA 4GPNA 3WEMA 3HN3A 4P7QA 1VEOA 1S46A 6TAAA 2O9RA 3PTMA 3VIPA 4CU7A 4UFKA 3IAQA 3RCNA 1W9VA 2OLHA 3GBDA 4P8UA 3AXIA 1WDSA 1UR9A 2J4GA 2YL8A 3L4WA 3FNDA 1EDGA 1GZJA 3RDKA 5BXRA 1GHSA 2WHMA 1C92A 5D9OA 1CXKA 4U3AA 5DF0A 1CGYA 3OG2A 4R5EA 5CXPA 4W84A 1VFUA 5A6AA 4UQDA 3GH7A 3W38A 1BTCA 1TUXA 4DUXA 2O9OA 1ZL1A 1N82A 3AXXA 1KB3A 4JHOA 4MNKA 1B3XA 1BFNA 4XZWA 3WL0A 4BQ3A 4UFMA 1KQZA 3AQUA 1E4NA 1R85A 3OGVA 4CD4A 4XZBA 2BY1A 4QP0A 4W93A 2QLYA 1G5AA 2W67A 3MKKA 2WMFA 3QOMA 1MVYA 3L4XA 4JFUA 3WL1A 4EK7A 3VMOA 2WSKA 1UR0A 4H7VA 3KL3A 1V0KA 1Q6FA 3WFZA 3WD4A 3FAWA 2WHLA 3NSMA 2VZUA 4PSPA 1PZ2A 1VB9A 4Q22A 4DWSA 1E43A 1H1NA 3BMVA 1KR1A 1W1YA 4HZ8A 1WAWA 3VIMA 2ZUWA 5E0CA 1V0LA 2D0FA 3CZKA 4P7LA 4NI3A 2D0HA 4Y7EA 1J12A 1Y7VA 1JI1A 1WDQA 1EXPA 2BVTA 3D5HA 4D1IA 2W5FA 3RM4A 3W53A 1HL9A 2EPKX 2G3IA 4V2XA 2BNJA 3WUBA 5CG0A 4U2YA 2YBUA 5AYIA 3LPFA 2XGIA 2PWHA 1CPUA 1U30A 4AY1A 5LA1A 4DWSD 1H11A 1V6UA 4LYRA 4MAZA 1ZJAA 4D6HA 1DWIM 3T0DA 2XIBA 2CPUA 1KBBA 3A4XA 3PZNA 4QLJA 4NF7A 2JALA 3NUKA 3WDPP 4D6JA 2AMGA 1H4PA 5JIWA 4JKLA 1QHZA 4M1RA 1JI2A 2WKGA 1ISZA 1Q4NX 3HJEA 2BHUA 3AS2A 1Q6CA 2WLZA 1JZ5A 2CETA 2GK1A 1UA7A 4Z2KA 3IANA 4OBSA 3NJ3A 3SCTA 2VVSA 4QCFA 4TX6A 4AZCA 4QLLA 5A6LA 3ZJ8A 1UWQA 1J0JA 3VGGA 2OSXA 2ZX6A 2VI0A 5HPOA 4J3WA 1JZ4A 4HMEA 2Y24A 5IDIA 2VCBA 5ABFA 7A3HA 3SEPA 1NOUA 2J75A 3FN9A 4AEEA 4URIA 1JD9A 1RPKA 1B0IA 1E0WA 2YDQA 5IHRA 3MV11 2DT2A 2D23A 3OIHA 3AIUA 1G94A 3BAIA 2IUZA 3VVGA 4UCFA 1MXDA 2Z1SA 3EDEA 1GOOA 1JZ3A 1D7FA 2QF8A 1H49A 1H0GA 1PX3A 2J8FA 4MTVA 3VTRA 5HOSA 5I77A 2J47A 3VKKA 1Q6EA 1C93A 1F4AA 1SR0A 2YL6A 1GW1A 3TOPA 5A2CA 4FMVA 2WC4A 4FLQA 1EO7A 3SCNA 2WBKA 3O6AA 2XFRA 4GZIA 2BY2A 2DT0A 5A8PA 2FGZA 3EMCA 4V28A 1WDPA 2D0GA 2EXOA 4PMNA 2DSWA 1CGUA 1HJWA 3B9AA 2ZOXA 1QNQA 3PZTA 1QHPA 3ZSTA 1TA3B 3TA9A 3TTQA 1V3KA 1TVPA 3IJ8A 3WMBA 4Z2HA 2XUCA 1JAKA 2BFGA 3DYMA 3SCUA 1BYDA 1X1NA 2WMKA 2XPKA 2QPUA 4WF7A 1JXKA 5I3DA 2YA1A 1OWQA 3K46A 3B9EA 4LYPA 2EQDA 5E70A 2Z1KA 3ARZA 1XD1A 3CUFA 1BHGA 1GORA 3D3AA 1JZ6A 1TG7A 1V03A 5GNZA 1UWIA 2EPNA 5A1AA 1H3GA 2PBOA 1KR0A 1U33A 1MW1A 1E6RA 2VZOA 5EMYA 3ARRA 2JFEX 2E8YA 3AHTA 2V3GA 3ZIZA 1E4IA 2W92A 1GQIA 4GZJA 5BXPA 3T2PA 5I5RA 1LJYA 2XVKA 5AYBA 3WD1A 2UY4A 3O2LA 4ZXLA 3ZO9A 1W91A 1CNVA 2GFTA 3RILA 1R7AA 3F5JA 3VD5A 1UWSA 2Y8KA 4UZUA 4B15A 4AD4A 4MB5A 3QHNA 4MB4A 2W66A 4QCEA 2WVUA 3SCPA 5CGMA 3ZSSA 2YA0A 1G0CA 4PYSA 1PX8A 5F7UA 3ZM8A 4CVWA 5D8ZA 5A8MA 1B2YA 1EGZA 2VO5A 5HDRA 2QPSA 3BXWA 4M80A 5ECUA 3AMGA 4U5IA 2CERA 2GUYA 2WC7A 5I6SA 2J78A 1RP9A 3UETA 3VIFA 3ARSA 1QOXA 3WKZA 2DDXA 1HN1A 2J25A 4J28A 3W27A 3AZRA 1UWUA 1CGWA 1GNXA 2WVVA 2ZUSA 3EBVA 3TTSA 1QBAA 2OSWA 4PMRA 3U57A 4MJ2A 3ZQ9A 3VNYA 1CXHA 2OYLA 4LGXA 3EMZA 2OWCA 1PJ9A 3MUIA 1A3HA 5IHSA 3I3BA 1PZ3A 1Q6DA 1E5NA 2VZVA 3THCA 4C7FA 3CUIA 1UWTA 4OBRA 4TXEA 1CZ1A 1QHOA 1HKJA 2DSVA 1UQYA 2FHCA 3S6TA 2RGLA 2VOTA 1E6NA 1HJSA 1RD6A 4S3KA 1BVNP 1HJVA 1UOKA 2VRJA 4R27A 3II1A 1VF8A 1XD0A 5A8QA 2EJ1A 2VZSA 1VEMA 1WKYA 2MANA 5E0FA 3CO4A 2DH3A 1JNDA 1GVIA 1VFOA 4UQBA 1JAEA 2F2HA 3BAXA 4J3VA 4U31A 3AFBA 3GBEA 2XWEA 2E9BA 3E1F1 2XFYA 4W8BA 3N12A 3APGA 3T2OA 1BLIA 1E40A 5GNXA 2ZE0A 4PCTA 2EEXA 1VFMA 3WNMA 1NWSA 4C7DA 3TTOA 1QNSA 2GJXB 2E0PA 2WMGA 5A3HA 4C7GA 3OBAA 1W3JA 1E4MM 1MW2A 4JFSA 2NT1A 2BVYA 2J62A 2CBVA 1KXHA 2BS9A 1VEPA 4TVDA 4TX8A 1EQPA 4FLSA 3NSXA 4H2CA 2XIIA 1OGSA 3K8LA 3MS8A 2E9LA 2VUYA 4ACYA 4P7OA 4AZ5A 1UUQA 2NSXA 1B90A 1JF6A 1W3HA 2WW5A 3CMGA 5A69A 4CN4A 3VGFA 4PMXA 4L4PA 2X0YA 4YHEA 3NDZA 2WXDM 2WMIA 3CTTA 1NWTA 1C90A 3AZTA 1R8LA 4AD5A 1EO5A 5BCAA 1W9PA 5CSUA 1ZJBA 2DSKA 5LA0A 2O9PA 5EFDA 3RJXA 1ISWA 1NH6A 1CLXA 3RO8A 3CHEA 1LF1A 4NZCA 3T0AA 1EHAA 3ARWA 2WHKA 4AEFA 1NP2A 4AIEA 4M81A 1HKIA 2D2OA 3WD0A 2PC8A 2D3LA 4P8VA 4AZGA 5LYRA 1WZLA 2OWWA 3TTYA 2V38A 3A47A 1W2VA 4W5ZA 4B3LA 4F9JA 2CKRA 3RMEA 3WSUA 4JKKA 3F5KA 3AROA 1ZBVA 3ZJ6A 4M8UA 1EDTA 2WZEA 2G41A 1UR8A 3A4AA 3EDDA 5BROA 2G4FA 2A3CA 3AISA 1ZBKA 3NYDA 1J18A 4D6FA 1JYXA 4PMYA 2ZIDA 3CLWA 3L2LA 3WF4A 2ZICA 3N13A 1E6QM 3WNOA 4D1JA 1OB0A 3L2MA 3HMCA 3VGEA 1E4LA 1KQYA 3AJ7A 2C0HA 1SYTA 1EHNA 1IZKA 4UTFA 1NWUA 2CYGA 3BGAA 3DYPA 4BS0A 3ARQA 3CIVA 3GXDA 3FHQA 5E6ZA 3BCFA 3WDQA 3VDBA 2AAAA 4H8HA 2WVSA 1DWJM 4TOQA 1VAHA 3WNLA 2WNWA 1IZJA 4RE2A 2ZWYA 1CXLA 2VRKA 3UESA 1V6WA 5CSYA 5A2AA 1OCQA 4XUYA 3AMDA 5A6JA 4MB1A 3SUUA 1KBKA 2IXVA 3WQ4A 4YPJA 4H8UA 2GDUA 1B3ZA 2W4XA 2WCAA 4NRRA 2DIEA 2VRQA 1ECEA 1UH3A 4AC1X 3N17A 3FW6A 1O7AA 2UY5A 2J7CA 3AMCA 4Z2IA 2GK1B 2BY3A 1JDAA 3KE0A 3ARYA 1VBRA 4CU6A 3CGTA 1CBGA 3ZJKA 4HZ6A 4CCCA 1DHKA 1JDCA 4CD8A 5A95A 3ZT6A 1UZ4A 1J0KA 3W37A 4CU8A 3OLEA 1O6IA 3AOFA 1E70M 1MW0A 2A3BA 1HL8A 3SCWA 5DMYA 4UOJA 1UYQA 2C8NA 4F9DA 1UD3A 2JF6A 2E4TA 1CWYA 2DSUA 2VX7A 1KGXA 3PZGA 3PZVA 4ZE5A 4WJXA 5CJ5A 2D20A 1XHGA 5BWFA 1GQJA 3GXFA 2VX4A 5AY7A 4X0NA 1LL6A 3UR8A 1W1TA 3N9KA 1CLVA 3NSNA 5DEZA 4H04A 2WWCA 2PWGA 4K68A 2A3EA 4LYQA 4U3CA 2AOSA 2J79A 4B9ZA 2CITA 4UR9A 4HP5A 1E56A 4D72A 1UKQA 1UKOA 1VJSA 4AD2A 1UR2A 3WEZA 4ML4A 3VIKA 4GIAA 1J0IA 1UKTA 1E72M 2DIJA 5GNYA 1JYVA 1WDRA 1JZ2A 4S3JA 1ISXA 3DYOA 3FXYA 2VVNA 5CQ1A 1BYBA 4IM4A 1E6SM 2EPMX 2YBTA 2WLYA 1UKPA 1D3CA 4PCSA 1UH2A 2ZXQA 1OD8A 1GUVA 4M29A 1PPIA 1HP5A 3THDA 1W32A 4PN2A 5EFFA 2YDSA 1EA9C 4AZBA 2WK2A 1CEOA 1H5VA 2D3NA 1J0HA 1DTUA 4B9YA 3WH9A 1XH1A 1EH9A 1UG6A 3AIVA 3EDJA 3SCQA 1W3KA 4TVUA 2BY0A 4DUVA 1MW3A 3J7HA 2PWFA 2VCAA 4OOZA 5FIPA 4N0RA 3RM9A 4JKMA 3OA5A 4ACZA 1Q6GA 1XV8A 3MANA 4W5UA 3F5LA 3M7SA 4OIFA 3GZAA 4AZIA 3WH6A 1XYZA 3WNKA 1B3YA 4AMCA 3W29A 2CESA 2VZTA 1QI4A 1WNOA 8CGTA 1QI2A 4OUEA 4UFIA 1JIBA 3CHCA 3LPOA 2X09A 3TP4A 3T08A 4KWUA 1E55A 1OT1A 4M56A 3BMWA 5DO8A 9CGTA 3W82A 2XVNA 2GVYA 1QPKA 5DT7A 4ZE4A 1L8NA 4AZ6A 1Z32X 1BG9A 2D1ZA 2FDMA 3AS0A 1ZBWA 3U7BA 3SCSA 4PTXA 1NWRA 4KRTA 1LWHA 2WYSA 3VILA 2CIPA 2G3NA 3GM8A 2J77A 3BAJA 5BYWA 7CGTA 4IPLA 2CCRA 1BQCA 2VL4A 3ZR5A 3ZR6A 1UWRA 2QMJA 2E9MA 4LX4A 3FHAA 2DQXA 2YIHA 2EO7A 3POHA 1V02A 4UZSA 1EIBA 4N42A 2VTFA 4GO8A 2GDVA 4PMUA 3VM5A 2QHAA 2FHBA 4OZOA 5M17A 1LL4A 1LQ0A 3SCRA 3MUAA 1C7SA 3B8SA 4UOZA 3FAXA 3ARUA 4P7RA 3VUPA 4D71A 1E1EA 3UG3A 4CGTA 1K9EA 1V6VA 1XGZA 2PF0A 3KL0A 4AZHA 1WO2A 4PTWA 5KEZA 1JG9A 1QI5A 2WZIA 1TFVA 3ALGA 1I75A 1UD4A 2XG9A 1YQ2A 1UKSA 5A94A 1QW9A 4OOUA 3VIHA 5E9AA 2FGLA 3GXIA 4JIEA 4AIOA 1EOMA 4WKFA 3ARVA 5D9NA 2X0HA 2YOCA 4JAWA 4BZYA 4OKDA 4LXFA 4HPGA 2WZHA 1GJUA 2NW0A 3VIGA 1VRXA 1HVQA 3WUEA 3BH4A 4RL3A 3VIOA 1F4HA 1JFXA 5JUVA 1CGXA
chains in the Genus database with same CATH superfamily
1TJRA 4CNSA 2J9XA 5H6HA 1RP8A 1H2JA 2VX5A 4C1NB 1B3VA 2HSAA 1XDJA 4RPQA 1OYAA 1S5NA 2BWGA 3SIZA 1R2RA 2CZDA 1IEIA 1EIXA 1FKWA 1A5KC 3LUTA 4A3RA 4NXKA 1IF2A 1WZKA 1KLYA 3HPFA 3GUGA 4LUJA 4GYPA 3CHFA 3PJWA 1UUOA 3B9DA 3SIMA 5JIPA 4K8EA 3IK2A 2D24A 1JCLA 3H53A 4L1GA 2VEMA 1DQXA 2G3JA 4JFWA 2IKGA 3TWBA 3WY1A 3NO3A 2GDQA 3VGDA 3LHWA 2WCGA 3K4DA 2Y4SA 3RX2A 1FP9A 5ABHA 3KWXA 3NAVA 3B0XA 2QXWA 5A6BA 1C9DA 4IT1A 1IZCA 4I7WA 1IXNA 4XZIA 2IKIA 2DZTA 1W2PA 5BXTA 1VHNA 4PTNA 4Q8QA 1A5MC 1Y5XA 3KVJA 3DEQA 5EB8A 1K7XA 3LPPA 4D6GA 4NKCA 3S9ZA 4ILSA 2EBNA 4CVUA 1UB3A 3GVRA 3LHVA 3SCOA 5A6BD 4M24A 4J3TA 1N7KA 3UEQA 2XM1A 4AAJA 1C29A 3MCNA 5FJIA 4N9EA 4C91A 3G2GA 2I17A 1XYFA 1KCZA 3U5YA 2BB0A 2EPLX 3W86A 1UJPA 5FOOA 3BDKA 5EMUA 3G1VA 3GZ3A 4XB3A 3KTCA 3L4TA 1BWKA 1FH9A 3SN0A 1XKJA 2XYLA 4MSSA 2ZX7A 3K8KA 5IOBA 5IXEA 4ALDA 3FGCB 3RPMA 1C8XA 1EJWC 4C6KA 1ZFJA 2GJNA 4MFEA 5KTLA 2PCQA 3WDIA 3NQ8A 5AHEA 1XRVA 4RE0A 3KXQA 1GONA 4O1BA 5BMXA 2BV9A 1HO4A 1KM6A 3GDLA 4BA0A 2XZ7A 1X39A 4ICNA 4XBJA 4JL2A 3R13A 5C9WA 1D3GA 1E15A 4G1NA 3G0XA 4IMAA 5IFPA 4EP8C 1ADDA 2DJXA 2ZX9A 2A7PA 4JTQA 5D9MA 1M68A 1W9BM 4PMZA 1D8WA 2EG8A 5U7SA 1F74A 3KM8A 3IWPA 1GQLA 3DFQA 1ZPTA 1PSCA 2ZA1A 4LBUA 1XINA 1XC6A 4GVFA 1TPWA 2D73A 2YXXA 2DT1A 1A0CA 1US3A 2VFFA 3AYSA 1A5CA 2B4GA 4E4FA 1E0TA 4Q4MA 2YL9A 3GC4A 4QJ3B 2Y8VA 4YTTA 5FCZA 4O10A 2WM0A 4OE7A 3N9SA 4PUKA 3TJLA 4DWSB 1M03A 1WOAA 1SZGA 3UWZA 1YXDA 1ZS2A 3C2YA 2Y5SA 4JCLA 1B4KA 1MQRA 1E3ZA 4UQ9A 5HQEA 1HP4A 4H9ZA 3M0XA 3NIYA 4HVXA 2OYMA 3K2GA 1TELA 4BY3A 4WVXA 1R5YA 5HATA 4XX6A 2ZUMA 4Y6GA 1G1YA 4G5DA 4JTAA 1TJ1A 1JZ8A 3E2VA 1EZ2A 5F2GA 2YB4A 5CLWA 3W73A 4DM1A 3HM7A 1A47A 2W6RA 1ITCA 5T26A 3BSHA 3H55A 1S1RA 3H26A 5LNRA 5JBEA 2PDQA 4AD0A 1IWBA 3MSYA 3SUSA 2OT0A 2QDEA 4XD5A 2GJRA 3F4WA 4TUFA 2GOKA 2GWNA 1AMYA 4HNCA 1RXOB 3W1XA 4ROPA 1UCWA 2VR2A 2EPOA 2VEKA 4AZ7A 3GTXA 4KEUA 1WX0A 3HQOA 4Y9OA 3LNMA 3CMJA 3C56A 4Z2GA 4EANA 2HNHA 2QUTA 2OG9A 4J27A 3CZEA 1TJ0A 1W5PA 1XS2A 4WDXA 1OX4A 3ECQA 3WBEA 3NEVA 1DQUA 3ITXA 4O1EA 2XFFA 4IFOA 3PZ9A 4JFTA 3VOHA 3EXTA 4JQ2A 2A2IA 4PL1A 2ZX5A 3MO7A 3LXAA 4EWJA 1X7FA 1L6FA 3UNDA 1MDRA 3WLJA 3AYRA 1ODZA 3NGFA 3KX6A 4HZ7A 2JEQA 7XIMA 3C5QA 3K8MA 3KFTA 1YHTA 3VO0A 1JGIA 1GOWA 4GIRA 4MNLA 1IT0A 5HQMA 5I23A 1TV4A 2EHHA 4H41A 2OSYA 4IF2A 3QMTA 4CQ8A 3R0KA 1EB3A 2PODA 4UNIA 1QNRA 1OK4A 1UR1A 3W6MA 4GQQA 3URAA 2ASHA 4EWND 5TNVA 3FKKA 1R3TA 2ZZ7A 5M03A 2QF7A 3DFNA 2XVPA 1CIUA 1CECA 2PZ0A 3CHDA 3W23A 1GVQA 1GYNA 2QCCA 2HK0A 2ISSA 2GVLA 3L0NA 4LUIA 1V3MA 4HK5A 7PTDA 2DU2A 1ODUA 2PP1A 1L6WA 2F61A 4ZEPA 3LXBA 2NV1A 1QT1A 2CLFA 2H3DA 4IPPA 2ZUNA 4HCLA 3W7IA 1Q85A 5ABEA 3S5NA 1CXFA 5EBAA 1ME9A 3BJSA 4LANA 2OLAA 3QJAA 2JIEA 5K9XA 3S1GA 5AYXA 1FFRA 2O4QA 3AICA 3IPWA 4I9JA 1H7WA 1I2RA 2G96A 4CD6A 5HBFA 3IAPA 1OFEA 2G3FA 4O52A 1RH9A 1XYCA 1OF6A 3JZEA 3NQDA 2DPEA 4HSOA 4MWAE 1J79A 4IIDA 2FVMA 4DY1A 2V3DA 4Y90A 1FP8A 3LCWA 5TQLA 4I9TA 3CPGA 4Y8EA 4RCXA 3FA3A 4LSBA 1E1FA 1R30A 2QCMA 2O92A 4MZ8A 4RX0A 4RNHA 1RCXB 1XLBA 5E9XA 5H91A 3RGTA 4GC3A 2YX0A 4ZFMA 2XSBA 4ATWA 3QV6A 1VFTA 4RE3A 2VFHA 1OC5A 4MYXA 2WVVB 3BWWA 1C3FA 3G1YA 3S46A 3NZGA 2WWDA 3LZ3A 3AU2A 3W1MA 4BEUA 3HOJA 2OXNA 2OEJA 2X05A 3GU2A 5C71A 4E5TA 1GZGA 3UNTA 3SUTA 3VA8A 1PWLA 3WD3A 3AIEA 4NUWA 3WQPA 4C6OA 4PTVA 5DMNA 3NQMA 3GO2A 4LV4A 3AHYA 4KERA 3BURA 1TZZA 2J7EA 3DFSA 3V75A 1OT2A 3G1DA 5BRQA 1UHVA 2WMJA 3U8GA 2E1DA 2OWXA 4IHCA 3R2GA 1VIWA 2YDAA 1FH7A 2CXGA 1WE5A 5HANA 4JIPA 2ACRA 4IXHA 2INEA 2WZMA 4QX4A 4L1WA 5FI8A 2OR2A 2ISFA 3C2EA 4KIEA 1S5TA 2CBUA 2XSAA 1OBAA 4C6CA 3W70A 1W5MA 3PUDA 5M5DA 1GT8A 4TTGA 1ADSA 3MDWA 3KZPA 2Y6ZA 3L4ZA 4YIWA 4FI4A 1GOKA 3OJGA 2IQTA 2YKKA 2CZFA 3N2CA 3MV01 1CI1A 4XAZA 2BTMA 3PUOA 4G8TA 2HXUA 1O60A 4NZ5A 4PCNA 4AY7A 1JYWA 4OU1A 1FHUA 2FZBA 3IIOA 1XH0A 2JE8A 2HK1A 3VNLA 4J3SA 3E0WA 3OBKA 3AIQA 3VK5A 4QJ5B 2VGBA 1XYMA 2PLJA 1E0VA 2QJNA 5CJNA 3GC2A 4HMNA 1JEZA 1XLLA 3R6IA 3FJ6A 1V02E 2QCDA 3HZ3A 5HXMA 3MSGA 1C8QA 1ZLPA 4WXZA 1J8VA 1R47A 2DJLA 3RR1A 2ACUA 2C14A 4J3UA 1BQGA 3GH5A 4UFJA 4W4QA 2X42A 3AIRA 3BC9A 4JQ1A 1YW1A 1LT7A 4PRWA 1X98A 3WLTA 3VZYA 3DOPA 4G56A 2PDYA 1KO0A 4YNGA 3EWCA 2IQDA 2OPJA 4CEUC 1Z44A 2QCHA 1SO5A 4UTWA 1DL3A 3T09A 1KWGA 3WEOA 4HHHA 2OKOA 4B91A 1I0DA 3VOJA 3KLKA 3OZPA 4PB5A 3SY5A 3E2RA 4CQDA 3S4TA 5DANA 2QCEA 4U4MA 1J10A 2CEQA 4UTTA 3VKCA 2QIIA 1BYCA 3WYZA 4HNLA 1OYCA 3NA8A 3L4UA 4UQAA 4XSLA 3M46A 3FSUA 5D32A 4Z2LA 3HG2A 1ADOA 4HA1A 1REQA 1HNYA 3DFYA 1MYRA 3SR7A 3NQ7A 1GEQA 4M6UA 1FHLA 2X16A 1I8JA 2VEPA 1X6NA 1ITXA 4O50A 4LVBA 3PC0A 4V27A 1CTNA 2XDFA 4HD5A 4W9TA 4GBUA 4BQ4A 3NQFA 2V6AA 3AMKA 1W9DM 2MNRA 2VQUA 3H2NA 3W72A 3NGJA 4TO8A 2VQTA 3BAWA 1OINA 5HUPA 1Q7QA 4JTGA 1UZDA 5TD4A 4Z1CA 2PB1A 5A8NA 5KZDA 2BVDA 1LBFA 4ADUA 1XLIA 4MDPA 3M6YA 4ZTYA 1X38A 2GJPA 1MEHA 4JFVA 2ZFAA 4A21A 1EX5A 2FKPA 1AD4A 5C9XA 4AD3A 5A6MA 4I7VA 3EKZA 3ONBA 1S1PA 3I7QA 3H54A 1JL8A 4Q7NA 5IBXC 2QPXA 1XG4A 2PEVA 2GJXA 1K9FA 3N11A 1H7XA 4Q4QA 2EG6A 3WH8A 3YPIA 3E49A 4BR1A 2ZXBA 2GQ3A 2I5QA 1HJQA 1MSSA 3Q4DA 3W7HA 4HMDA 4F66A 3EYPA 4UMAA 1AFSA 3W24A 3U9IA 1THFD 3GNRA 1JCYA 5HWJA 4AUBA 4GPNA 3W7DA 1TVLA 4KW2A 4F2BA 6TAAA 2O9RA 3VFLA 1K7FA 4FOUA 4GJJA 4JR5A 4XTIA 3WX7A 2XH2A 1WDSA 3AYTA 3QSRA 4B5WA 3L4WA 2VC7A 3FNDA 2EGZA 4DQWA 3RDKA 3QZEA 1YTKA 4ZSUA 2HCVA 1GHSA 2WHMA 5D9OA 4J5NA 9XIAA 4ZMGA 3WQEA 1CGYA 3H8AA 5CXPA 2QDDA 3PBMA 3AU6A 3GKFA 4LUTB 4NL1A 1ZQ5A 2YR1A 4B5NA 1A49A 5F2MA 1GG0A 1XQKA 2O9OA 3EGJA 5J5DA 1N82A 1S2AA 3VABA 3H2FA 2EPHA 1BFNA 3LBOA 3KVMA 3WL0A 4GABA 3BLLA 2QV5A 4NJIA 3C0LA 3K1GA 2PRLA 1JDFA 1G5AA 3QOMA 1MVYA 1H7NA 3L4XA 2REQB 5A6TC 3WL1A 4EK7A 3VMOA 1OC6A 4H7VA 3PR2A 4C6LA 1V0KA 1AK5A 1UUMA 4IH3A 3FAWA 3C6CA 1QJWA 4AFYA 4IQDA 3BMVA 2H9AA 1V0LA 1E9YB 2D0FA 3ZZ1A 1TO3A 2I16A 2ZRYA 3N4FA 4Y7EA 1J12A 1WDQA 1Q2RA 1XYBA 2WNNA 1XC4A 3H4WA 4JD4A 4V2XA 2BNJA 1SO4A 5CG0A 2YBUA 1RK5A 5EMMA 3LPFA 2XGIA 3DAQA 2Z00A 5E5CA 1NF7A 3DKLA 3Q2DA 4AY1A 1H11A 1T0OA 1V6UA 3V0SA 4DI8A 1ZJAA 1TTQA 3T0DA 2XIBA 1PVNA 4JNYA 4DO5A 5M2FX 3USBA 4RZ6A 3NUKA 4D6JA 4S3FA 1HGYA 1H4PA 1XIJA 4RR4A 4EAYA 3W2LA 1ZZMA 3ANUA 1LQ2A 4WDTA 3A13A 2I14A 4IGHA 4M1RA 4OTKA 4PCPA 2OODA 3UR5A 2WKJA 1ISZA 4DAIA 1QNVA 5DRIA 3AS2A 4C60A 4GLEA 2CETA 1RBAA 2GK1A 1O5RA 3GQYA 3IGUA 2VVSA 4QCFA 4FR6A 4US5D 3D6NA 4LAKA 1J0JA 3C2VA 2OSXA 2ZX6A 2YBVA 5HPOA 5DXYA 1RY0A 1JZ4A 1L9WA 3T42A 3MKVA 2Y24A 1KTBA 3V1HA 3UZYA 3TVAA 3PSWA 2POTA 4DBWA 5CC3A 2HVOA 2LLEA 3WLMA 1RV8A 1UW9A 4AEEA 4QSHA 2A3LA 5IHRA 3ABQA 2QW5A 3IEBA 1UIPA 3LGGA 3RFAA 2WO5A 3CT2A 4UCFA 4I9AA 2PUZA 1R9ZA 1GOOA 1XW8A 1YMYA 4I3GA 5G2IA 1BRLB 1PX3A 3DX5A 5HOSA 5I77A 2J47A 1Q6EA 1C93A 4DF1A 2YL6A 2C19A 1F3WA 4GNKB 2Z1WA 1IT8A 4GUHA 4L9ZA 4FZIA 1XGDA 4FLQA 1ME8A 2ZC8A 4YVPA 3UXDA 4EXBA 3O6AA 5FSEC 5LIWX 4LEFA 1WUFA 4JIRA 5HWMA 3QM3A 3I68A 2D0GA 1KM3A 1R3RA 5G1MA 1CGUA 1HJWA 4UB9A 3MZNA 2PGEA 5EMJA 4RV3A 3TE9A 3W7NA 3ZSTA 3TTQA 1DTNA 3IJ8A 1JAKA 3W02A 1P5BA 2BFGA 4KIRA 1X1NA 2WMKA 2O0TA 1F61A 2QPUA 4IQJA 4WF7A 1WUEA 1JXKA 3RU8X 1ZAIA 3TROA 3K46A 5I3DA 4LYPA 2YZRA 1XD1A 3CUFA 1BHGA 4YCOA 2OCZA 3KRUA 3N6HA 3EA2A 5EL1A 4GX8A 5A1AA 2G5WA 2V68A 1P7TA 3C0QA 1H3GA 4DRSA 1OFOA 5I07A 2VZOA 4ERIA 1RVKA 1Z69A 4NZ4A 3ABSA 2V3GA 1YIXA 4R3UA 1AJ2A 3T0CA 1WXZA 3A64A 1UR3M 2TYSA 2FQIA 4GFIA 4PUMA 3ZO9A 3WLIA 4UXDA 3BG3A 1R7AA 3VAVA 3LMZA 3GVGA 3B0YA 4QHRA 4MB4A 3IJDA 2B7OA 2DW6A 5IRPA 3ZSSA 2YA0A 3BG9A 1G0CA 4PYSA 4HU3A 4LW7A 4MY9A 1GYLA 5AYZA 2BASA 2V82A 2FMNA 5I6SA 1LROA 4QROA 3VIFA 3ARSA 1QOXA 1HN1A 2J25A 3EKLA 1KD0A 4WDUA 2OSWA 4PMRA 4MJ2A 3VNYA 1MZHA 5EPDA 4K8HA 1OZQA 1FQ0A 3HF3A 3DKJA 1PTGA 3MUIA 4PUJA 3W1UA 4L4MA 5F1VA 1KCXA 3ABRA 4O1AA 3CUIA 3O6DA 1UWTA 1DV7A 4TXEA 1CZ1A 3LCHA 1QHOA 2VOMA 2PDHA 2DSVA 1QCWA 4LC8A 3UXLA 2V5KA 4A8LA 2RGLA 3VDGA 1E6NA 4IZGA 5GVJA 3QKZA 3KAOA 2VRJA 1S2UA 3H21A 1G6CA 4NYYA 3II1A 4X2RA 4A6GA 2C71A 2FLIA 1Z41A 4DAFA 3CO4A 1GVIA 2ONEA 1P1XA 4QE1A 4B2DA 2X7VA 3ERPA 1JAEA 3BV7A 3MQTA 4U31A 4UBPC 3GBEA 2E9BA 5JXQA 3IV3A 2WM1A 5G4WA 2A6NA 3U2EA 3T2OA 5GNXA 3MVTA 3WNMA 1QO2A 1VBGA 4C7DA 4Z17A 1XWYA 2WMGA 1H7RA 1VYPX 3F4DA 2FTPA 2JBMA 4B2DD 4GA8A 4QIUA 4UIOA 3VOGA 4FS9A 1KXHA 1VEPA 4FO4A 4CQAA 4TVDA 4TX8A 4BKNA 1OGSA 2PWVA 3CK5A 4P7OA 4H9YA 1O66A 3GXNA 4FB7A 2NSXA 1B90A 3RR4A 1XUZA 3VGFA 1KM2A 1AJZA 1ONRA 5JH2A 3DBPA 2WXDM 3BZGA 1JJKA 1S3HA 1DBTA 2I9EA 4DYKA 3NXFA 1LBLA 1W9PA 2X40A 5FJOA 5AC7A 3TR9A 4H4IA 4S3DA 3MYPA 4F0SA 1XIBA 2V2CA 3TYBA 4LFYA 5EFDA 1OADA 2NLYA 3L5LA 2NVCA 2FZMA 3QY7A 3KDOA 3BOXA 4HBKA 4B4FA 3C2RA 5CZ0A 1KRAC 2D2OA 4P8VA 2HROA 2OEMA 5CGQA 3BGJA 2WSQA 5HJXA 3B04A 2QAFA 4R7WA 3F5KA 3KOZA 3EWUA 4JTDA 2PFHA 3NYDA 4JEJA 1TRDA 4GMEA 3CLWA 2X7WA 1QUMA 3OQ8A 3IJ6A 3GNNA 1S2TA 1D9EA 4YTUA 3HMCA 2PWUA 3AJ7A 4GQ0A 3CQJA 3TQKA 1SYTA 1EHNA 5LHFA 3ARQA 3GXDA 3FHQA 1NTHA 3BCFA 4KETA 3WDQA 3TKFA 3W6YA 3L12A 3HPXA 4TOQA 2EKGA 3RLUA 3IJLA 3UR2A 2VFEA 1H60A 2KAUC 2VRKA 3HG4A 1V6WA 5CSYA 4XUYA 3KVLA 2WJEA 4MB1A 4QNEA 3EWXA 2XH7A 1SZFA 3V35A 4HN4A 3RITA 4LUSB 5AFDA 1L2UA 1UH3A 4GBDA 4JTFA 4EPBC 3FW6A 2Q3RA 1SW3A 4S2CA 3W2JA 3M0VA 2BY3A 4GUIA 3STEA 1JDAA 4GVHA 5BRBA 4JQ3A 1P0KA 1DJZA 1OFDA 4ICCX 3M41A 3V7PA 3V36A 3WLHA 5MHBA 1K03A 4HZ6A 1J2BA 3EOLA 5AOUA 1JDCA 3O05A 4L4LA 4MG4A 3ZT6A 4BF9A 1UZ4A 3W37A 1UWAA 1UP0A 4CNNA 1XYLA 2QGHA 3KOYA 3NQBA 4O53A 2A3BA 1EPVA 4I5UA 2IPGA 3EOUA 3BPWA 1PB0A 3IGXA 2CLOA 2JF6A 2X30A 2P3ZA 5EKYA 3E38A 3W7KA 3P8JA 3MI3A 5CC5A 4ZE5A 2JKAA 1SZRA 3QC3A 4ZB2A 1F5ZA 2D20A 5BWFA 4X0NA 3M44A 4LS2A 1TWZA 1W1TA 3PFRA 5CBJA 1I2NA 5C5YA 4CNTA 3MPGA 5H2ZA 4YMZA 3P0WA 2C1HA 4K68A 5ECVA 4GVGA 4UUIA 1AW2A 4R53A 4C90A 4UR9A 3HURA 1UKQA 4XZ9A 1UKOA 1JCMP 4AD2A 3WEZA 3NQAA 4ML4A 3VIKA 1J0IA 2YXGA 2Z25A 1M65A 5BNKA 1UKTA 5E0KA 1E72M 1FHVA 5GNYA 4L6OA 1JYVA 3C2FA 3KOFA 2OQHA 4LH8A 4ZSTA 4GCAA 1ISXA 2VELA 1XG3A 2VVNA 1JPIA 1AH4A 3T78A 1D3CA 4PCSA 1OCNA 1UH2A 4UMBA 1R3YA 1GUVA 3NM1A 3A9BA 2XU2A 3OPSA 4PN2A 4C6IA 5EFFA 2YDSA 2A7RA 5LSMA 1GVSA 2WK2A 1H5VA 2D3NA 1DTUA 3QMRA 5H1WA 1RBOB 4F0HA 2OZ0A 3H2AA 3J7HA 2PWFA 3G8RA 4IOTA 5FIPA 2Q3OA 4JKMA 1NY1A 5G1YA 4DO4A 4GGHA 1D3HA 4KQNA 3MANA 3NXLA 1XYZA 3WNKA 4O0KA 4AMCA 3W29A 1DKWA 2CESA 1FWIC 1G69A 4UFIA 4FEZA 3CHCA 5FAJA 1F8IA 4DF2A 1QWKA 5CAHA 1DIOA 1ONEA 1OT1A 3BMWA 4M56A 5DO8A 5FEWA 1DVJA 3KCLA 4K3ZA 2GVYA 1QPKA 4DO6A 5DT7A 4ZE4A 4GNVA 1FXQA 1ZBWA 1Q6RA 3SN1A 1NWRA 1MRAA 4OQVA 1LWHA 3VILA 4JX4A 4NX0A 3BAJA 7CGTA 4IPLA 4G7EA 3DI1A 2CCRA 1GQNA 2VL4A 3ZR6A 4QG6A 1FWTA 3SQSA 3OTRA 5J04A 3LCIA 3W7MA 2YIHA 2EO7A 1V51A 1EIBA 4DLFA 4PMUA 1NEYA 3G3DA 3SCRA 4QNWA 3VUSA 3VUPA 1K9EA 1V6VA 4C5YA 3V5OA 2I9UA 3LSBA 3B3DA 4PTWA 1JG9A 1UD4A 2CLMA 4K6AA 3TFXA 3R25A 3VIHA 2FGLA 4JIEA 4AIOA 2R1LA 3ARVA 5D9NA 3R8GA 2X0HA 2YOCA 3BW2A 3QW3A 4JAWA 4MGGA 3E12A 5D30A 3GB6A 4IPJA 1VRXA 2FFCA 1IE7C 3HFYA 3T4CA 3BH4A 1TTJA 4GXMA 4FA3A 3UJSA 3SY1A 5JUVA 2ZCGA 2RUSA 2WQPA 4C6QA 2FJKA 3EA1A 1ZAJA 4P8XA 4GQRA 1XCWA 4RW3A 3AALA 1KCKA 2W27A 4DX3A 4YCPA 1EF2A 4ZQMA 3HG3A 3GW3A 1DIKA 4BF7A 3PY2A 1J11A 3KBJA 3I6EA 2WJFA 3M07A 1TE1A 1DP0A 4UNKA 4S38A 3C3UA 5K4XA 3S3GA 1FWBC 1CDGA 3IJ9A 1DWHM 2NV2A 1ESWA 2QCFA 2V5LA 4WKHA 3N19B 3VD9A 3CH9A 2E28A 5LIUX 2ZA2A 3MZ2A 3A3XA 2HTMA 5MF5A 6ALDA 3AIBA 1BG4A 4Y8FA 2ALDA 3VOFA 3TMQA 4MKSA 4BCEA 3OA3A 1SO3A 2XVLA 2G97A 4QRNA 1EFZA 1V0MA 3Q65A 4JTIA 4WJEA 3N2OA 1VYSX 3L68A 3GXPA 3VINA 2WPGA 1PL9A 3N18A 1TMQA 2VNCA 4WSKA 1W54A 2FPTA 3KBMA 4PMVA 3SJNA 1EZWA 5M3WA 3NVTA 3MHFA 1K8YA 2VMFA 3LG3A 6CGTA 5A8OA 3W9ZA 3BLDA 4GXPA 4MADA 1WZAA 2R14A 4DWDA 3NCOA 2NXIA 3BAKA 3R0UA 3WF1A 2G8ZA 3WBYA 2B31A 2PI6A 3BUVA 3NQ2A 2Z6IA 1RD5A 4MAVA 2WSPA 3N15A 3R43A 4FX8A 2RH9A 4KESA 5AHLA 1EJSC 3AXHA 1QOPA 5DMMA 3BJFA 1RPXA 3ZLHA 3G1AA 1VCVA 1XH2A 4HB7A 3WQ6A 4KPLA 3QR3A 4Q8UA 3PWAA 4ZZ9A 4WCJA 1UQZA 4IX0A 4UTKA 2FH8A 1BF2A 3I3EA 2ZX8A 5KETA 3RO6A 5HUOA 2DT3A 1EJ7L 1ISYA 4N6FA 4WY0B 4KKXA 2X41A 1W5NA 4EF8A 4JYEA 1JUEA 5D2WA 4AF0B 3KHJA 3M43A 4ZB0A 4AY8A 3CBWA 1ZBCA 1K9TA 3P5ZA 1W1PA 4DM2A 5LIYX 2OO0A 4IICA 4Z1BA 1UBPC 2CBIA 3E0FA 3CO8A 4MJ4A 1GCYA 3WIJA 5GJNA 2D2HA 1QK0A 3POCA 3VGHA 4DF0A 4DJDA 5F2IA 3LRKA 2CLEA 3E2QA 5I03A 1OGBA 2PRMA 1NQKA 5CJMA 3KL5A 4DZHA 4Y2WA 3R1ZA 3HPSA 2DZVA 2Q8LA 2V3FA 5GJMA 1C8VA 1H5YA 2GQ9A 5D38A 3HB9A 2IPFA 3W01A 4DJDD 5D03A 1U22A 4O15A 1HUVA 1ZHAA 3TONA 3CH0A 1MNZA 1DJNA 1EJVC 4J35A 3IGSA 5FJRA 4FAMA 3UERA 1WPCA 3W71A 3WDJA 4A3HA 2QS8A 4P5UA 1UR4A 3DHDA 3OIXA 1TCMA 3TYCA 2OO6A 2WAGA 1F07A 3REQB 3GLCA 3BOLA 3FEQA 2FZ9A 3OGRA 3P82A 4D8LA 2RKXA 1KFBA 3HQNA 2PDXA 4NAEA 4Q6XA 4QEEA 3WDRA 1UMYA 4DWSC 3S2CA 3UW6A 2Y8UA 3SQLA 2BXYA 1MDLA 5RUBA 1ECQA 4OFCA 3UZZA 1SMDA 4IXXA 2PDMA 1ML1A 4AZCB 4N2YA 3TA6A 1FWSA 4UFLA 1QPQA 4IMDA 4WXYA 5BXSA 3VDAA 1TV2A 5EYWA 5ABFB 1UMLA 2XTKA 1D2KA 2YXOA 4H19A 4GH1A 1K4GA 3CL8A 2DZXA 3GHUA 2BXVA 4WK9A 1R3WA 3WK0A 4Y96A 4LV9A 3TSDA 1R7OA 4LBSA 4ASTA 1VP5A 3VKDA 5F4WA 1W37A 1NOFA 3O3RA 3PZIA 4N6EA 5HNUA 2G3MA 4ACZB 3RM8A 3AC0A 3SN4A 4Q4SA 1O12A 1PEZA 1TZ7A 5CBIA 1MQQA 2RAGA 3LHTA 4HA0A 4HN8A 3EA3A 3LV6A 4REQB 2AQVA 3CZGA 2FTWA 1TMLA 1V3IA 1YRRA 1WOBA 4HK6A 5CGTA 2Y89A 4PUEA 3N3TA 1LLWA 2D22A 1XUUA 1U1UA 3G6LA 3TFCA 1WKEA 2PDWA 4UFHA 3UYCA 4IISA 2Z6JA 4CCEA 3ICJA 2XM2A 5HJLA 2ZUVA 4CEXC 1Q6QA 3FYYA 1CT5A 1ZP4A 4JNMA 2WSYA 5K9CA 4JHZA 3SFKA 3CWHA 1X6UA 3RCMA 4C6EA 2PWEA 1PIGA 4UTIA 1UPMB 4D6IA 4NIRA 4MDOA 3LXCA 4DZIA 1E6XM 3C2OA 4EIVA 2IXUA 4LAMA 1L6GA 3SURA 3C0JA 1HO1A 4XV0A 2F38A 3MSDA 1LUCB 3MI2A 2BOEX 1KCLA 4IPNB 3TV8A 3EWYA 1K4HA 2ZDSA 5C9ZA 1MRQA 4B16A 5CPTA 1WXJA 3T55A 3WH5A 1Z89A 3BLPX 2ZC1A 4RDVA 1UIOA 4DUOA 4NYUA 3UG4A 2OVLA 3WUFA 4L6DA 4DBUA 3P60A 4KGLA 1GW9A 3O6YX 4MZ1A 3WENA 1K6AA 3VNZA 4WGHA 4M6QA 4OV4A 4JPGA 1YBQB 3ITOA 3VE9A 4DZAA 5M1TA 3URQA 4ATDA 1BEUA 3IIPA 2OX1A 5CPQA 1TQJA 3EOOA 4ZO7A 1JQXA 5I78A 1TPC1 2R1MA 4XIMA 1D7KA 3C0SA 1ZGDA 2GL5A 2CZVA 3N1AA 2BLEA 1JUBA 2W61A 2VX6A 2BG5A 1N2VA 1XFBA 3QGVA 4LS0A 1X6LA 2YSWA 4PC8A 3W0KA 4XISA 3LLXA 4O16A 1TKKA 1BVZA 2XJ7A 3T05A 1VJZA 4WGXA 2VCCA 1G01A 4JTUA 1K77A 3TZFA 2C7FA 5FKYA 4O19A 2V30A 4EPEC 1T8XA 2H90A 4Q4OA 1AVAA 4QISA 1G4TA 3U2OA 4DBDA 5KMYA 1A5NC 5FACA 3QR1A 4L64A 3PJXA 4L9YA 3U7VA 1E9LA 2DGAA 4O57A 1JXJA 4I5XA 5H8MA 4QS5A 4TVCA 5J8LA 1W5QA 3IUDA 4NNAA 1P0EA 4GO9A 4HU8A 3R94A 2C18A 4I7UA 4W89A 2W3ZA 4Q33A 4XKMA 4C6NA 4E8GA 5HMDA 1EOKA 3N04A 2ZRUA 4ZQNA 3STGA 3WFAA 1TTIA 1P4CA 1CX9A 4FLOA 4FXJA 4LOCA 1X1ZA 2DUZA 2X1TA 3PJUA 5T9CE 4IUGA 2VDHA 2FGBA 4QDPA 2RDTA 1RHCA 3U4FA 2ZZ2A 3NQCA 2Y2WA 2UBPC 4LC6A 1KFLA 4F0LA 3Q67A 4YWSA 4AXNA 3UXIA 3BZJA 5AC4A 3OBEA 3RPTA 3LGEA 1MFUA 4F48A 3UPWA 3GVQA 5EU9A 1V0NA 3EPMA 1MMFA 2QT3A 5BRPA 3OHMB 2GSHA 1AQHA 1MQPA 3T8LA 3GG8A 4MPQA 4R88A 4W85A 1OCBA 1A5UA 3GHSA 1W3LA 2I57A 3WF3A 1XI3A 3BSMA 3HQPA 4XKYA 2QEZA 1CXIA 1R86A 4LAZA 4GX9A 2DZPA 3EB4A 3F2CA 3R10A 4GVIA 3FYOA 2PWDA 3NL3A 2ZVIA 1US0A 3CEPA 4JTTA 4M82A 1GVYA 4QR6A 5KINA 1FBAA 4IIBA 3V1PA 3CL7A 2PDFA 3GK0A 4RNFA 2FPYA 2BVWA 1KWKA 1GJPA 4R7OA 3JZUA 4MB3A 2PDPA 1BXNA 5LA2A 2PDGA 2IKHA 3V5FA 3E2SA 2V5CA 4IMEA 3TC3A 3W7OA 1UH4A 1VC4A 2VEGA 1AD1A 3CZLA 2VEFA 1MEWA 3B0UX 1B4EA 1VIZA 3CJPA 4AW7A 2CHRA 3SADA 3MMDA 2INFA 2FYMA 1B3OA 1ZALA 4GG9A 4FNSA 3FVDA 3ZVHB 1VFHA 4JHMA 3PWGA 4PULA 1IT7A 4FX6M 3PSVA 2XINA 4QDMA 2WOQA 3Q45A 3VDHA 3AHVA 3CLMA 5HNNA 2VJXA 4PB3A 3RJYA 3P84A 3NZQA 3I6RA 2FZNA 4PMJA 3CAWA 3EX6A 2C3ZA 3QV8A 4MY1A 4RLIA 4CLMA 4O8RA 5LKYA 1KRCC 3M7WA 1TR1A 4DB7A 2VGFA 4M19A 1KXQA 3W1NA 3LD5A 8A3HA 1YPFA 1VBJA 3E0LA 1UD6A 2Z1XA 3PPFA 3L0GA 4NQ1A 4HHLA 4A8IA 5IFTA 4WOZA 5JH1A 4FNRA 3QPEA 2XWDA 2WNZA 3WFLA 4Q8MA 5HINA 4D6DA 1IGSA 3FYPA 1OIMA 3P93A 5IM51 3M5XA 1DPMA 1TUFA 1HZYA 3O9NA 1FRBA 3WNNA 1HJUA 3RN6A 2WC3A 3UGRA 4E8CA 3H2CA 4NJHA 4JIHA 5G5IA 2A3HA 2O9TA 1SR9A 2QMKA 3AS1A 3EKGA 1E9IA 2YZ5A 8RUCA 1X1OA 4HA3A 4O1FA 4AHOA 4AWSA 3UD6A 5C54A 1R6WA 4HSHA 2NSOA 3ARTA 5DN1A 1NAL1 1QNOA 5CAKA 3CPUA 3R58A 4UQCA 1GWJA 3ITVA 1AW5A 2QKFA 1I1WA 4QTGA 5A2BA 1Q13A 1TVNA 3F7JA 3ZJ7A 1QFEA 4X9SA 2AL2A 2OZTA 4GIYA 2EF9A 4UOQA 4F0MA 4M5PA 3BLFA 4U33A 4DXKA 1U1JA 1HTIA 1MZRA 1ICQA 5C8BB 3UG5A 4S2BA 4W8AA 1LTDA 3H7UA 2NUYA 2JF7A 3ZMRA 1DEDA 3WQVA 3DECA 2NLIA 4MWAB 3OLDA 1SZNA 1ZCOA 3IUIA 1XLEA 2WHJA 3LBCA 1V7AA 3CU2A 1CENA 3PNUA 3IVTA 3ID7A 3PN8A 3GYCA 1HKMA 4CCDA 5B7YA 1OGGA 1V4YA 5CLTA 1H7OA 4E6MA 1XLHA 2H8XA 5CG7A 3IIVA 1KM4A 3PTMA 3VIPA 4UFKA 2TPSA 3RCNA 3S8HA 4GYKA 3R0DA 3LOTA 2QR6A 2BX7A 3AXIA 3WO8A 3WLOA 2AMXA 4XAGA 3R11A 2BBFA 2YL8A 5KITA 3TW6A 4JIIX 3WZ0E 2TMDA 5SWUA 5AHFA 3G0SA 4JYFA 3RLHA 1B57A 4WY0F 8TIMA 4HSNA 3W1LA 4PFMA 3KS5A 3GH7A 3P8IA 4RUBA 3W38A 4M7TA 3GWQA 1V7YA 4XUGA 1BTCA 3ATYA 1TUXA 5AVNA 4C5ZA 3T0TA 3AXXA 1QO5A 4NNBA 3I7SA 1KB3A 1H1ZA 4HNNA 1B3XA 1BKSA 1ITQA 2B0MA 2PTWA 4BQ3A 2A0NA 4UFMA 4LYKA 4LB4A 5CKSA 3DESA 4CD4A 4QP0A 2QJJA 4W93A 2QLYA 1TJPA 2WMFA 3S9YA 2P50A 4KEZA 1H61A 1L8PA 3RG6A 3WD4A 3MA8A 1IIHA 3FXGA 2VZUA 4IWWA 4Q22A 3Q37A 1H1NA 1KR1A 2EAWA 3VIMA 1JPHA 5E0CA 1XL9A 4UTMA 4UNLA 3CZKA 4IGMA 4P7LA 1Y7VA 1EXPA 1JUKA 1QXLA 5BU9A 3W53A 2EPKX 2G3IA 1RJQA 1GVEA 5HNRA 5LA1A 3N34A 4LYRA 1M6JA 4MAZA 1YYAA 3RCYA 4IGNA 1TB3A 4Z08A 2CPUA 3BLOA 4HHMA 3A4XA 1DIDA 4QLJA 3FJ4A 1VYRA 2VP8A 4JKLA 3QZAA 4RKAA 1FXPA 5XINA 2ZADA 5FESA 1S2VA 3HJEA 1F3EA 1UA7A 2ZZ6A 3IANA 1W1B1 1TV5A 1SZEA 3PG8A 5DCEA 4C6BA 5A6LA 2QDHA 3P5YA 3VGGA 3DFPA 3DH7A 1OFAA 3NPVA 4HMEA 5IDIA 1TIWA 7A3HA 3SEPA 1IXPA 4I8YA 1A50A 4J9JA 1R9YA 3H12A 4HZMA 1Z6KA 1KM5A 3C86A 2PU0A 1JD9A 1B0IA 4NT0A 2DT2A 2D23A 3OIHA 3L0KA 3BAIA 4RZBA 3VVGA 4A2SA 2BODX 2WQDA 5FEPA 4MTVA 3VTRA 1VJIA 3EX1A 3NL6A 1F4AA 1IGWA 3CIXA 2XIJA 3M0HA 1GW1A 2E68A 4LEQA 1F3XA 2Y63A 5FSDC 1TPEA 3SCNA 3PTDA 4GZIA 2DT0A 2OTDA 3QLLA 2Z24A 3B8DA 3EMCA 2QAPA 4V28A 2EXOA 1PKLA 2YCIX 1E1CA 2ZKMX 5D02A 2O56A 3HJZA 3MCOA 2ZOXA 3W22A 1TX0A 1TA3B 3OEXA 3KBVA 6XIAA 3MHGA 2X1SA 3DCPA 4Z2HA 4C6FA 5A8GA 3DYMA 3GRIA 1BYDA 3ZS4A 1XLFA 3CEUA 3CAVA 2R6OA 5E70A 2Z1KA 3ARZA 4O13A 1LRNA 3SGGA 4Q4PA 4PCFA 2CLLA 1JZ6A 2R1NA 2EPNA 3R4IA 2AKZA 5BOOA 4JTEA 2PBOA 2E5CA 2FPVA 3ZVIA 3ARRA 2JFEX 3GE7A 2ZZ5A 4LY8A 2E8YA 4RZ5A 3ZIZA 4UTJA 3TW7A 2W92A 1XYAA 1CB7B 4H01A 3IRSA 4JTCA 3T2PA 4GY1A 5AYBA 3O2LA 4ZXLA 3S42A 1W91A 1CNVA 4LF1A 2O7QA 4XAYA 3AXKA 2PA6A 3F5JA 3ES8A 3VC5A 3P67A 4PA8A 1PTDA 3QHNA 1JCTA 4IIHA 1W3TA 1TV8A 4QCEA 2WVUA 5CGMA 1LZOA 5F7UA 4WEVX 2V63A 2FVKA 4IP4A 1EUAA 4CQCA 4IFRA 4JY9A 4KS0A 4M80A 3TJXA 4U5IA 3KP0A 4LVFA 1Q3NA 1Q6OA 2C15A 2Z0IA 3DG6A 4KBXA 2J78A 1RP9A 3UETA 4NASA 2CXEA 1XLKA 3SFWA 3GDMA 2PRHA 3NOEA 4J28A 3EPOA 1Q4WA 5H8UA 3S2NA 3EBVA 4K37A 3MP4A 4HNOA 4M7SA 1O5XA 1CXHA 2OYLA 4LGXA 4OWGA 3P0XA 2G95A 4C6PA 4MVAA 1LM1A 2OWCA 1WBJA 3MJMA 5IHSA 1U83A 1E5NA 1PKYA 2VFIA 3THCA 2ZRVA 4C7FA 1OFPA 2DQWA 3G0UA 3FX4A 3QFWA 2G50A 4BJHA 4O11A 3W7GA 2FHCA 3S6TA 2OELA 4DLMA 1MEIA 6TIMA 1BVNP 1UOKA 1TV7A 3T7VA 4ZOBA 1XLDA 4R27A 1VF8A 1XD0A 3DU0A 2VZSA 3N2XA 3EX4A 1JNDA 3BTNA 4J3VA 3TSBA 1JPKA 5EGRA 2DVTA 2V5JA 2XWEA 3AFBA 3HFTA 4EOUA 1WDDA 4FNUA 2XFYA 4W8BA 3N12A 1ALDA 4Q4KA 3NZ1A 1BLIA 5BOFA 4PCTA 2EEXA 3T6CA 1NWSA 4HTBA 4AQLA 1SU5A 2E0PA 1W3JA 3BE7A 1DE6A 4JFSA 1AH0A 3BLIA 3B8WA 2BVYA 2J62A 3T40A 3H4GA 2V5BA 2CBVA 3UWVA 4L61A 4ECLA 1AODA 1EQPA 4FLSA 4H2CA 2NWRA 2XIIA 3AWNA 3K8LA 4A8RA 4ACYA 4YTSA 3O0KA 4D9PA 3QN3A 2WW5A 1SSDA 1W3HA 5A69A 1XDLA 4QAIA 1W17A 1H1YA 5I7GA 4PMXA 4L4PA 3WJZA 3GG0A 1A4MA 1PYMA 4YHEA 3NDZA 3CTTA 4K36A 3B8IA 3N2BA 3LZ5A 3NPUA 1R8LA 4AD5A 3Q94A 3PUEA 5CSUA 5T9BG 1LT8A 1V93A 2DSKA 2QNEA 2O9PA 3RJXA 3LRMA 1IR2A 2V9DA 4NZCA 2CLIA 1VCFA 1UJQA 4NJKA 1NP2A 4UTUA 4M81A 1HKIA 4EX4A 5BOEA 4QEHA 2OWWA 4DI9A 1S5VA 2WSRA 4W5ZA 1ZNNA 2ISDA 4P61A 1TYGA 2CKRA 1T7LA 1W56A 4JKKA 3VCNA 2FJUB 1UR8A 1XIHA 3A4AA 5BROA 1Y5WA 4D6FA 1OX4B 3QQ1A 3CS2A 3L2LA 3TCEA 4RDYA 3MWCA 4L1XA 2I1OA 1RAKA 1W31A 5EMLA 1VQTA 1E6QM 1NELA 4AYGA 3CB8A 1E4LA 5DX7A 1A0DA 2Y7GA 2JQXA 1IZKA 4UTFA 3PBYA 4C1KA 1Z8AA 4HYVA 2BP1A 1ZENA 3GY1A 4F0RA 1VAHA 2WNWA 3O16A 3C3NA 4WJ8A 3UESA 1WV2A 5IBXA 1DJYA 1TPB1 3UBPC 1OCQA 3F03K 2DVXA 4XTDA 3TQ0A 2OQLA 2W4XA 2WCAA 3SQMA 2VRQA 3TN5A 4AC1X 3PPCA 4AHQA 4MYAA 2J7CA 3AMCA 2X2GA 3MY9A 4D2JA 3ARYA 4CU6A 1MO0A 4S3EA 3TAOA 1Q45A 1CBGA 2ALRA 3CM4A 1QATA 4JGDA 2I5GA 3PS7A 4CD8A 4L7ZA 3S9IA 4FX7A 4ICMA 1HL8A 1IWAA 5EY5A 1SFLA 3N2MA 2FB2A 3IUHA 4B5TA 3L9CA 2E4TA 3PVFA 1XBZA 4ZVJA 1DORA 1LRTA 3PZVA 3UWYA 2DUAA 3G1FA 3GXFA 5AY7A 3FSTA 1U5VA 3W7JA 2FB3A 4Q32A 4O8AA 1CLVA 4H04A 1EF3A 3M64A 3H2MA 3NQGA 2A3EA 4DBSA 4U3CA 1RA5A 2J79A 4B9ZA 3WLLA 4DVOA 3P14A 3M4HA 2PF8A 4J2PA 5FF3A 3GG7A 1XLAA 5LNUA 3V4BA 1UPPA 3IIZA 5A5WA 1JZ2A 3LS9A 1YTEA 1GYMA 4RXGA 3DYOA 5FEXA 3E9AA 4IM4A 1E6SM 2EPMX 3CHVA 3GFXA 3G8EA 1HKVA 3THAA 3TOYA 1HP5A 4ZA0A 3CAKA 3GAYA 5DELA 1CEOA 1J0HA 1XH1A 4DJEC 1TV3A 3TZNA 1UG6A 4Q8PA 1GK8A 1W3KA 1KBJA 4TVUA 2QUUA 3B8UA 1MW3A 5AC8A 2QJIA 4OOZA 3NWRA 3LTPA 3OA5A 3QR0A 4ACZA 1RY8A 1O1ZA 4M3PA 2A21A 2MUCA 3M7SA 4OIFA 3WH6A 4LUYA 4ZQPA 4REQA 1W3NA 1QI2A 3FJNA 5LIXX 1YKWA 3U3HA 3HPAA 1J4EA 1A5BA 1EJTC 2V2HA 3TP4A 3T08A 1POKA 4XG1A 3PWIA 2OOGA 4WSHA 2DORA 2XVNA 4O54A 3VKAA 1FKXA 2JGQA 4Q8VA 4GQBA 2A85A 4UR7A 1G4SA 4IP7A 4WD0A 3TWAA 1UWRA 4NX5A 1W3IA 2E9MA 3H2OA 2AL1A 1DQWA 4A3QA 3POHA 1BD0A 1AL8A 1K8CA 1BVWA 2FHBA 4OZOA 1LL4A 2GQAA 1LQ0A 2ZZ1A 3MUAA 1TWSA 3FAXA 1E1EA 1KRMA 4LCQA 5TIMA 1XGZA 4L6HA 4H6EA 2NQ5A 3H22A 3VFCA 5KEZA 2WZIA 3EWZA 2QCDB 2FMOA 1UKSA 1TX2A 4UR8A 5A94A 2FDSA 5DBUA 3INPA 4GIEA 1S39A 2GGJA 4YYFA 2B7NA 1U5JA 4BZYA 4J3ZA 2R82A 2WZHA 2NW0A 3VIGA 4DZ5A 4IFKA 3VIOA 5LNSA 1F4HA 1Q7ZA 1JFXA 5LIKX 3SJ3A 3AS3A 1YPIA 4WSJA 2ESCA 1AQ0A 5AKQA 3H70A 1QW8A 2Z4GA 4JICA 3QYQA 3PPGA 5AN7A 3MT1A 4LB3A 2VD9A 2ZVRA 1CGTA 1US2A 1JD7A 1LOQA 3JW7A 4DEFA 5KZEA 1XIFA 1GKQA 5BZAA 3B4UA 3UFYA 4ROQA 1JYNA 3WLKX 5HR6A 3GDBA 1J96A 2VWSA 3KZSA 5LNWA 3TR2A 9RUBA 3KVKA 1REQB 1BGGA 3UR7A 2HISA 1NJJA 5CPNA 3TLQA 3MI6A 6PTDA 2WZTA 4JQAA 3U4AA 4F40A 1WKDA 2BHYA 3OGSA 3G1RA 1P43A 4YTQA 2XFWA 2NQHA 4O28A 1HVXA 1B30A 5AB3A 1HX0A 1XP3A 1MFVA 4HNUA 2SFPA 3BLKA 1QU4A 4H6RA 3UJ2A 3S0CA 4JCMA 1F6YA 1DXIA 1M7XA 4MKNA 1EL3A 3UWEA 1TMHA 4GOAA 4L5ZA 4O12A 3WQWA 3N4AA 3FY1A 5FF0A 5F4SA 1W0MA 3UY7A 2Y7EA 1HT6A 2PP3A 2PZNA 1NDVA 3FLUA 1PCWA 2YL5A 3CPRA 3N6JA 2F9RA 1J9YA 2W63A 1XPYA 1YLVA 1SFJA 1BXBA 1W9XA 4UC5A 5A6KA 4H8VA 3D0CA 1GEHA 1VBUA 4RZ4A 4A4AA 2A5HA 3R12A 2XVGA 1SFSA 1NQ6A 3JVAA 1C9WA 4GRSA 5AVHA 3L66A 5DQPA 4DUWA 3A12A 1E6PA 3NR0A 4US6A 1AQFA 3QLDA 4EE9A 1KC7A 3GTFA 3EMQA 1CYGA 3PZUA 4YN5A 3VD3A 4J40A 1XSJA 4XD3A 4MM1A 5DFAA 2ADAA 2JGYA 3M9YA 2QJMA 2G4JA 4WLCA 1E0XA 3CV7A 3E3HA 4QG8A 5D09A 1GOQA 3IARA 3PZOA 2PLKA 1RQHA 4LRTA 1KBIA 2YJQA 5JBFA 3NPWA 1EP3A 4TQTA 2RJHA 3UP8A 1ICSA 3B9NA 4JOMA 3C61A 3W1QA 1J0ZA 4K1WA 5HMEA 1XSKA 2H8ZA 3STPA 1OX5A 2HQAA 5AECA 1R46A 2W79A 2RJGA 4GYJA 2VR5A 4PB4A 2W0UA 3VIIA 3UA4A 4UTHA 3KDNA 2NUXA 4ZOAA 1W9UA 3KEHA 4IQLA 3SW6A 1I2PA 3ZT5A 1F7BA 1I6NA 4KWOA 5F1UA 1NM9A 5FL1A 5AHNA 2VHLA 1S38A 3PAOA 1X96A 4AWEA 1UA3A 3LTSA 4NP7A 3W00A 3LQGA 3WN6A 5B7ZA 4EKJA 1NIUA 3G6MA 1W6TA 3LCFA 3EX2A 3BW3A 3ABZA 4QM1A 4H7ZA 1EP2A 4D6CA 1V3LA 1SW0A 2H9AB 1LG2A 3NEHA 3SUVA 2HVMA 4LQ1A 1XDMA 2PLCA 3K4WA 2DEPA 1ZRQA 5CC6A 2V0TA 4MNJA 2XIQA 3M0KA 3UCQA 2F6KA 4ZO9A 3BL3A 1FWNA 1S2CA 3ANYA 3VNIA 1HKKA 3OOQA 3GU1A 4GACA 1JDEA 1GJWA 2C1IA 3SAZA 4D8AA 3DC0A 4Z1DA 1W1ZA 5D4YA 3GTIA 4W87A 3NZRA 4UTLA 4JL1A 1JDDA 4WOQA 2DZUA 4H83A 4GISA 1T40A 4JQ4A 1R87A 3PBUA 1LORA 2GVEA 3N6QA 1EYWA 5TF0A 3AMLA 1R2TA 2X1IA 4L4OA 1UZHA 3M5ZA 1MI3A 5CZKA 3B8TA 4K39A 4L9XA 3GNXA 2RDUA 3ES7A 4PE8A 3A6OA 4MMWA 3LYEA 3HU7A 2HBVA 3A4WA 3BCDA 2DH2A 1OFRA 2XHYA 3O63A 3VCRA 4DNMA 3MO4A 2VURA 1LYXA 4A3YA 3R8RA 3H2EA 5LXXA 1OQFA 2E1WA 5GPRA 3IJ7A 4NI8A 4V15A 4FF5A 2AKMA 3WD2A 1A3WA 1DJIA 1IEVA 3CUHA 4GINA 3V5CA 4V1YA 2E3ZA 3URNA 3GR8A 3M0ZA 2ICSA 1A4LA 2A7NA 1V3JA 4AISA 1RBLA 2YCLA 1V08A 4HK7A 2VC5A 1KFEA 3MU7A 3SRFA 4R33A 4A05A 3N4EA 3WF2A 4GH3A 3B06A 1VR6A 5K7JA 4MPKA 2IW0A 4NHVA 1FWHC 1H0IA 3UVAA 1E3XA 3VMPA 2DZSA 4L80A 3I10A 1Z7AA 2C1GA 1L6SA 2DZAA 3O07A 4O17A 4AIUA 3W87A 5AZ0A 4DO7A 4W88A 1XGEA 3UY8A 2CKSA 3XIMA 2CNCA 3VU2A 4PMOA 4JS3A 1YPXA 1KV5A 3IRDA 2GYIA 2HE8A 2UV8G 1P7TB 3S5OA 4EPKA 4P7NA 3FEMA 4GFSA 4FP1A 4RDZA 3TTEA 3LMYA 4BI5A 4X0VA 2CZ5A 2ZTKA 2Y62A 3W25A 1LLOA 3O15A 1QPNA 2VC9A 2QV4A 3HV9A 4EF9A 4LS1A 3WLQA 5K2ZA 1QOQA 3A3HA 1BF6A 2XH4A 1YE6A 4TV6A 5DT5A 3T44A 4JTHA 1PX4A 1R0MA 4W8LA 4Z2JA 1OG6A 2BZNA 1OC7A 4K7VA 4MLRA 5GQBA 3LY0A 3AZSA 5FJJA 2J7GA 1FDJA 5MKGB 2IPJA 2ZXDA 3UVIA 4NZJA 4GE8A 2J6XA 1FOBA 4CN6A 3UZWA 1P6WA 1PYFA 5I06A 5FA5A 3EDKA 2P8CA 3SRKA 4YTRA 3G5EA 1XICA 4GWEA 4HTYA 2TSYA 3GU9A 5FJPA 1M5WA 3ZLFA 1J6OA 3QVQA 2NT0A 2QULA 4KWSA 1ME7A 1T96A 3M0IA 3HMJG 1PZ1A 4IGSA 1ZB5A 2BXZA 1B5TA 4E4UA 3TYDA 1VPYA 2XN1A 2ZUTA 4ZGYA 4LVGA 5G1TA 1ZUAX 4RJEA 2Z2AA 3IIXA 4YS1A 1WP6A 4TIMA 1N8IA 4QS6A 1VGAA 1H62A 3T0BA 2YCKX 4HPHA 4WHBA 5A6SA 2YDRA 4F8XA 1ZJHA 1EXBA 2OFJA 1KNWA 4XBSA 5I2UA 2CW6A 3C8NA 4GI9A 3BQ6A 5C7VA 4QSFA 4PBEA 7REQB 3W26A 5I02A 3W83A 2P76A 4IG2A 5K3VA 4ZR8A 4LCSA 3LNPA 3GW0A 3THQA 4HOWA 3CB3A 3GDKA 2HZGA 4KCVA 4H9TA 5D8WA 3AJXA 2OOFA 3GG1A 4PTDA 4ZENA 2OJPA 2F8QA 4GKLA 4HNTA 3N14A 6REQB 1KA9F 2WKLA 1TA3A 3WQ8A 3HGRA 2ZWZA 2J7HA 2BGQA 2OLSA 2ZYFA 4V33A 4UQEA 4ATLA 3NO1A 1OVDA 3CV6A 5FF7A 3TK7A 1UD8A 2NZLA 1A5LC 4W7UA 5LNVA 4ZCWA 4OVXA 4BQ2A 5ABTA 1F6PA 3MTWA 1HJXA 3GFYA 3PTKA 1LWJA 4J1OA 3WMCA 2JIWA 1V6XA 4E0CA 3QMSA 4E2OA 2A3AA 3PNZA 1EBGA 1PIFA 4F2UA 4NXSA 1O4UA 2VUNA 1YADA 1FH8A 5I3IA 2JKEA 4MUPA 2YCJA 4A22A 3GX9A 5C9UA 2PBGA 3DHPA 4TTUA 2ZXAA 3JRKA 3WG6A 4WIWA 1RUSA 3CZJA 2OQYA 5I79A 1JR1A 4Q8NA 2C0AA 4AHPA 1GOIA 2J74A 5BMWA 1LQAA 3OP2A 1BPLB 4L65A 1BTMA 4OUIA 3HV8A 1AH3A 5REQA 4U10A 2PDLA 5AC5A 2VKZG 4XK2A 1I0BA 3PULA 2Y5JA 1E71M 3E0IA 4FXFA 3AI0A 2BHZA 4IQEA 2DW7A 3RX3A 4C1NA 5DCDA 3VNKA 3LGDA 4KT2A 3W1TA 3RPDA 1FWRA 1DYSA 1XLMA 4KFOA 4BQ5A 3GVVA 3W7PA 1UBSA 3RK8A 1K02A 2PGWA 2UWFA 3NOYA 4X9YA 2E40A 1O5QA 3IGHX 1P1MA 1UD5A 3M1ZA 3VGBA 4WKAA 3VX1A 1IEWA 1JGMA 1HW6A 1XJBA 4EAMA 1KGWA 1FWAC 3CUGA 1JRCA 3FJLA 1BSLA 2QYGA 4GUFA 1GHRA 2PDKA 1EWDA 2TAAA 3M6DA 4U5KA 3SCVA 1T6MA 3EXRA 3B4YA 1B9ZA 1L0PA 2CZEA 2VFGA 3EDFA 1V6YA 3GH4A 1DIEA 1UASA 1KTCA 2H6RA 1WDWA 5HJYA 3NZPA 5HMFA 3A5FA 1CLKA 4Q6JA 1O94A 1FWFC 7TAAA 2E77A 3H7RA 3ELFA 3FFSA 2W91A 4GI6A 2VWTA 3W1PA 3KTSA 4NAFB 3DUGA 4KCTA 4PH6A 2WCSA 3U2CA 1OSEA 3CZ8A 3ITLA 2NQZA 1BAGA 4HOZA 5DY3A 1VPXA 1IR1A 3ZOAA 1JNEA 3ARXA 1NARA 1GTHA 2WANA 4OBTA 3U2ZA 3GIQA 3MMUA 1XIDA 3S83A 2OZ3A 1HGWA 2YA2A 4Q3MA 1YDYA 1NU5A 4MOZA 4JBRA 3L5AA 1KFJA 1K8XA 4DBEA 4E4PA 3O7UA 4P2VA 3GKAA 1Y65A 3VCCA 3BICA 1RZMA 1EBHA 4XD4A 3TX9A 2FZ8A 1TPH1 5LGZA 4TV5A 4D6EA 3F4CA 1FVPA 3EWBX 2PTXA 1E73M 3LHUA 2Z7GA 3FGCA 4HJWA 3HN3A 3LX9A 1J5TA 4JY8A 4CU7A 1GOXA 1RLDA 3PB0A 4ZOEA 1NFPA 4FXRA 1AG1O 4H7CA 3IAQA 4RPPA 4X22A 5DRCA 1T41A 4P8UA 4Z1YA 1DE5A 2J4GA 4GC4A 3P6LA 1EDGA 1QASA 4MWAC 1GZJA 2ZE3A 5BXRA 1QTWA 1C92A 1PUDA 1CXKA 3VKJA 4U3AA 3PFMA 3TLLA 4IMFA 2PU1A 3SY8A 4F4RA 4IL2A 2XN2A 4R5EA 4W84A 3S1UA 1VFUA 5A6AA 1SJCA 1V8EA 1M7JA 2D69A 3KW3A 4DUXA 4S3AA 2E6DA 1ZL1A 3QZ6A 4CQBA 4ONVA 1LOSA 4B5XA 4JHOA 4O1CA 4MNKA 3W7RA 2Y0FA 2Y70A 3PB2A 5D33A 3PUGA 2ZRZA 1NDZA 3OGVA 4XZBA 2BY1A 1I9CB 3STFA 4DJFC 3MKKA 3ZR4A 3I4EA 4JFUA 4FNTA 3KL3A 2PDJA 2WV8A 1QR7A 3WFZA 1K7EA 3GUWA 2WHLA 4LU0A 1VB9A 1RCQA 4DWSA 1E43A 1W1YA 4KFPA 1WAWA 2DV0A 1XBXA 1G7VA 1JI1A 3HGOA 2CWNA 2YW3A 2BVTA 4S23A 4WX2A 4EPDC 4D1IA 2G0WA 3RM4A 1HL9A 3M0LA 1ELSA 3NL2A 1Y8BA 2E7FA 4U2YA 4ZQOA 4KF1A 3EB2A 4E2VA 4WRHA 4XZMX 4DWSD 3C52A