2J74A

Structure of beta-1,4-galactanase
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
386
structure length
386
Chain Sequence
GLYVEKVSGLRKDFIKGVDVSSIIALEESGVAFYNESGKKQDIFKTLKEAGVNYVRVRIWNDPYDANGNGYGGGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPAKQKAPKAWANLNFEDKKTALYQYTKQSLKAMKAAGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETDSNILVALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYYPFWHGTLKNLTSVLTSVADTYGKKVMVAETSYTYTAEDGDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPVGPAHRLEKNKALWETYGSGWATSYAAEYDPEDAGKWFGGSAVDNQALFDFKGRPLPSLHVFQYVDTGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YVFO
publication title Investigating the Binding of Beta-1,4-Galactan to Bacillus Licheniformis Beta-1,4-Galactanase by Crystallography and Computational Modeling.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 147
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2006-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2j74A00
3G6MA 4LPCA 1FH8A 3S2CA 1H5VA 4UFLA 4M82A 4CGTA 4JL1A 1DWHM 2HVMA 4KGLA 1ZJAA 3AZSA 5CXPA 3SCVA 4AZCB 5C70A 4PMXA 2F8QA 3OIHA 4FLSA 1UD6A 2WCGA 1HX0A 7A3HA 2O9RA 1UWRA 4DWSB 3CUGA 1TE1A 2QPSA 3AHYA 5KEZA 3WENA 4AEFA 1MXDA 1KQZA 4P8WA 3ALGA 4W5ZA 5EB8A 1QNRA 2GSJA 4H04A 2XFYA 3W27A 4MADA 3K8LA 4CKQA 1FH7A 1BQCA 2J7FA 1LG1A 1GHRA 1HP5A 3WH5A 4W8AA 4D1IA 1M04A 1UR9A 3AIEA 4PEEA 3WNLA 4AXNA 1JNDA 4PUDA 5GNXA 1IZJA 3AROA 4X0NA 5C8BB 3PZ9A 2X0YA 4Y7EA 2J8FA 5BWFA 3WNMA 4MB4A 5D9MA 4GIAA 5DMYA 3U5UA 1G94A 1FP9A 1NP2A 1LF1A 1UKTA 4M56A 4ZXLA 3OLDA 3VGFA 4CU8A 4S3KA 2Y8KA 4UQBA 1Q6GA 1UA7A 1VBUA 2ZX6A 3TONA 2E8ZA 1VFMA 3LPPA 1V3IA 2J4GA 3NYDA 2VT0A 1WCGA 1CPUA 3OGRA 5LA1A 3N15A 3NCOA 2E0PA 4E2OA 1JZ8A 2WB5A 3GTNA 4PSPA 3WN6A 3VM7A 3WQ8A 2D1ZA 4U3CA 4W88A 4HU0A 1E55A 4W5UA 3WQWA 4IPLA 3ZJ6A 4BQ4A 4XZBA 3MS8A 2BNJA 2BVTA 3WF3A 3OB8A 3CUIA 5F7UA 1CXKA 2CNCA 1EA9C 3SCQA 3AHTA 4JFVA 1FHLA 1V08A 3EDFA 1NWRA 4DWSA 4HTYA 1CGXA 2BVDA 2JE8A 3N1AA 3AIWA 3VIHA 2XHYA 4W84A 4WKFA 1KXVA 1JDAA 1BVNP 4J3VA 2XVLA 9CGTA 2WBGA 3OLGA 2O9PA 1I1XA 3B8SA 1NARA 2ZUTA 4U5KA 1ZL1A 4XUYA 2G8ZA 1QOXA 4JL2A 3WMSA 3U7VA 1GHSA 4GZEA 2CKRA 1W9XA 3CTTA 4CU7A 1HN1A 1BGGA 3A4AA 1JZ3A 1E1EA 3WNNA 3UERA 4TVUA 1RPKA 3SUUA 1C91A 1QI3A 2DSWA 4MNLA 2A3HA 1A47A 1OGBA 1UUQA 3SUTA 1XGZA 1E6ZA 2VVNA 1XSIA 2HISA 4JFWA 1PX4A 1HJSA 2W67A 4D6GA 2QLYA 3IJ8A 2XUCA 4KH2A 1YHTA 1WO2A 1BYCA 2O9OA 3PTQA 2EPNA 3D3AA 2G3NA 3K46A 1MW0A 1FHDA 3THCA 1PIFA 1UWIA 4B3LA 3I3BA 4TVDA 3M6DA 2E9LA 2UY2A 3W29A 3WFZA 4LYPA 1TMQA 3F5JA 5IHSA 4PTXA 5A6LA 2J79A 4MB3A 2ZX7A 2J7BA 2WMIB 5BXRA 4J28A 3ZIZA 5DEZA 2FDMA 1US2A 4UQ9A 1UKQA 5A8NA 3JUGA 1E73M 1CBGA 4MJ2A 1EDTA 4CUCA 1MW3A 4Q7NA 1OM0A 2Q8XA 3CMGA 3ARTA 1E72M 3L4VA 2VX4A 1R7AA 1LWJA 3MANA 1EO5A 4JHOA 3ZJ7A 4ATDA 3G6LA 3VMPA 1G0CA 1CDGA 3SCUA 1ODZA 4CD8A 4QLLA 4HU8A 2E3ZA 4PMNA 4UFIA 2XVPA 5GPRA 2BHYA 2V3FA 2GDVA 1HJUA 3KL0A 1EOKA 3RILA 4PMQA 4NZCA 5FCZA 1LLOA 2ZXQA 4PMUA 3ARUA 1VF8A 1FFQA 3LPOA 3AMLA 2BY3A 2VOTA 3UESA 5DT7A 4IISA 5I24A 3PZOA 3VOCA 3WIJA 1JNEA 5A2BA 5I79A 1J0JA 3WUFA 4MAZA 1J12A 4OBSA 3II1A 2ZXAA 2Y5EA 1ISVA 2WHKA 4MJ4A 3WDJA 1E5NA 3WEOA 1E6QM 4UQEA 3VD4A 4PBGA 2PB1A 1E9LA 4J3SA 3L4UA 4V27A 5AYBA 2VX6A 3AMDA 5BCAA 1UOKA 4F66A 1NP0A 4XX6A 3AS3A 2W62A 3QHMA 4YHGA 2QHAA 2OSYA 3WD4A 3TOPA 3AYRA 1PAMA 2VZVA 4RL3A 2ZX5A 1J18A 1LQ0A 3ZT7A 4E4PA 1TG7A 5LYRA 5M17A 1C8QA 5FD0A 4PRWA 3ARSA 4R5EA 3K4AA 1HJXA 3B9AA 3U57A 1D7FA 2XYLA 1CGWA 2OWWA 2DIEA 2CXGA 2O9TA 3WD1A 4P7OA 3RDKA 3VGBA 3PTKA 3PZNA 1UD4A 1YQ2A 3ARPA 4AIOA 1W9PA 1JF5A 2ZUUA 3UG3A 3EDJA 3TA9A 2VRQA 2WC4A 4UZUA 1MWOA 3WUBA 3IAPA 1BF2A 2D20A 2PC8A 1X1NA 3M46A 4UOJA 1H0GA 4WK9A 4A3HA 1V6WA 4TVCA 3DYMA 3VIJA 5EBAA 4HOXA 1AQHA 5JBFA 3GH4A 1G9HA 1WZMA 2VCAA 2VR4A 4WKHA 4HOZA 1UR8A 4BQ5A 1W3LA 1P6WA 4GI6A 4QLKA 2J7CA 3QOMA 3CUFA 3VKKA 2C0HA 2XTKA 2JEPA 2O92A 3F5LA 1FP8A 1GQIA 1NWUA 3GDBA 2RGMA 3N04A 1OSEA 2V3GA 4UQDA 3W37A 1VJSA 1XYZA 2VZSA 2VZOA 4UQCA 5CPQA 1OBAA 3LPGA 3B9EA 2A3BA 1KXQA 5CSUA 1E0WA 2CBVA 1HKKA 3EBVA 3AXIA 2XFRA 4H41A 5AYIA 4ACZB 5GQBA 1UH4A 1UKOA 4F9JA 2VR5A 1Q6DA 1H41A 5JBDA 5ECUA 1VJZA 1KCKA 3VNZA 5E0FA 4CCCA 1DWFM 3K8MA 2D23A 4URIA 5CG0A 1B90A 2VZUA 3HU7A 1BSIA 3W0KA 3W53A 3ECQA 4LX4A 2VQTA 3WD3A 1GOOA 3F5KA 3KWXA 3W24A 4H8UA 1Q6EA 1F4HA 3GM8A 1JYVA 3APGA 1FA2A 4RE3A 1NQ6A 1CEOA 2YIHA 1ZBWA 3TTQA 3BSHA 4X9YA 1E0VA 1DWGM 1Z32X 1W9DM 1DWAM 2OSWA 2FGLA 2D0HA 1XV8A 1BG4A 2ZXBA 3PZVA 2VCBA 1QW9A 1H3GA 3PZIA 4AYSA 3ARZA 1WDPA 4AEEA 1V6UA 1GW1A 3KZSA 1VENA 4X0VA 4FK9A 1J01A 1E15A 4ZXOA 2WCAA 3ZO9A 4PYSA 3AHZA 4FLQA 2WC7A 2D0GA 1JF6A 2DQXA 4OIFA 1HKJA 3MKKA 1D2KA 3KL5A 5CPTA 3PBGA 4ZFMA 1CGTA 1W9UA 1ISWA 3N9KA 3FAXA 3SCOA 3VIOA 1H2JA 5CGTA 1CIUA 2GJXB 3VIPA 3WKZA 2IXVA 2J78A 3NDYA 4J3WA 4BF7A 4DUWA 1B30A 2W63A 5M3WA 2BXZA 5BXSA 3K1DA 3A6OA 4FLRA 4JKLA 1V6XA 4AIUA 4DWSC 4P8XA 4GQQA 2WCSA 4MNKA 4KGJA 2D22A 2QPUA 2YDQA 1KCLA 2AAAA 4PMVA 1GOIA 3UG4A 2CKSA 2C8NA 2EQDA 4D1JA 1HT6A 2CIPA 4ZEPA 5AC4A 4HZ6A 1RH9A 5A95A 1BG9A 4HMCA 1MFVA 1KQYA 2OWXA 1VFFA 5TD4A 4CVWA 3ARYA 1ZBCA 4U2YA 1R7OA 3A3HA 3AS2A 1CXLA 2XIIA 3UCQA 2AMGA 4LQ1A 2V5DA 4AY1A 2PWEA 5I5RA 2VRKA 5CZKA 4FF5A 1TZ7A 1W9BM 1UWSA 3U5YA 2VZTA 2NW0A 3RJYA 2GVYA 1JL8A 2DEPA 1DWJM 4TX8A 1JD9A 2GK1B 2ZUMA 3L2LA 3GH5A 3BSGA 4YPJA 4Z2JA 3T0DA 2J25A 3W38A 1KB3A 4GZJA 1C93A 3RPMA 4UFKA 1B3YA 3NJ3A 1BLIA 4V28A 3OGSA 3VDAA 3AOFA 1VFOA 3WDRA 5I77A 2VQUA 5BYWA 1GPFA 3WMCA 1MW2A 1NM9A 2CHNA 1C90A 5D9PA 4AZBA 3ARRA 5D9NA 3EDDA 2VRJA 1SYTA 1WDRA 3AIRA 1DEDA 5FOOA 1BGAA 2FHCA 3VINA 3RCNA 4CCEA 1UYQA 2DDXA 4HZ8A 5FL1A 4FMVA 1WDQA 1GVYA 1X6NA 4F79A 4M81A 3ZT6A 1RP8A 1UH3A 2DSVA 4YN5A 3AHXA 1QBBA 2G4FA 4MTVA 2CCRA 4JAWA 1LL6A 2CETA 3W82A 1E6XM 5A8QA 2WWCA 3M07A 1O7AA 1G01A 2PWHA 2DPEA 5JIPA 3VX0A 1K9FA 3CZLA 2W5FA 2WW5A 1QI5A 3L4WA 4WKAA 2X1IA 1B3WA 1QI4A 2UY3A 1CGUA 1EO7A 5I2UA 1BFNA 4IM4A 3AQUA 1XYFA 1UQZA 2EXOA 3VIMA 3OGVA 1E4LA 1TA3B 3BCFA 5ABFB 3EMQA 4NRSA 5A2AA 4N0RA 3MMWA 5A6BA 4AZCA 1E6PA 2G3MA 4PTMA 3VIIA 4IUGA 3WQ6A 4QFUA 4P8UA 1CXHA 1B2YA 1JZ5A 3MSGA 1JD7A 1Y7VA 2BXYA 4XB3A 5C71A 1ITXA 4QCFA 1LJYA 4Z2KA 2W61A 1DWIM 3T0BA 1C3FA 4GQRA 4J3UA 1GUVA 3SURA 3WMBA 3SUWA 3SCSA 1W3HA 3MMDA 1TCMA 1UR0A 3T2OA 2X09A 4D6EA 2CBIA 6TAAA 5GNYA 3N17A 2ESCA 2NSXA 1HL8A 2WMKA 1NH6A 4Z2LA 3ZM8A 3CZJA 5CGMA 3IJ9A 2FH6A 3BAXA 3PHAA 1PEZA 3ZMRA 2WHJA 2QMJA 4JCLA 1CECA 2XVNA 3CZGA 1VRXA 3BMVA 2GUYA 3BAWA 1VAHA 2JF7A 3BAJA 2WAGA 3F4VA 4BCEA 2C7FA 3NSMA 3UEQA 2PF0A 1MVYA 4ZENA 2FGZA 4PTWA 3DC0A 4S3JA 3FN9A 3VM5A 1FH9A 4M24A 1PX8A 4AIEA 4TUFA 1QNSA 3BC9A 4B9YA 5AY7A 1ZBKA 1JZ2A 3ARQA 3WBAA 4PMYA 3AXHA 2BY2A 2G3JA 4UTFA 3BAIA 2ZOXA 5EFFA 3ZJKA 3AI0A 2XVGA 1DHKA 2XVKA 3MUIA 1QNPA 3CZKA 4WIWA 4AZGA 2J7HA 1BPLB 3GXIA 5A8OA 4OUEA 3VDCA 4AZHA 4JHZA 2ZX9A 2YL9A 4OKDA 3VX1A 3WEMA 2WZIA 4RE2A 5CLWA 4P7RA 1TR1A 4PCTA 1HJQA 4C7FA 1B3VA 1PPIA 3CUJA 1M01A 2YJQA 2XSAA 1EHNA 4W86A 1U33A 4GXPA 3QHNA 5AC5A 1V0LA 4M29A 2BY1A 3OLIA 1E6SM 1E3XA 2VX5A 1GOKA 5E70A 3UR8A 3EDKA 3UR7A 1NWSA 1EIBA 2V5CA 4JFSA 3TTOA 5KZ6A 4M8UA 4JZ5A 2OYMA 3AMGA 3OG2A 2DT2A 2WVVB 3N12A 2Y24A 2XWEA 3VD3A 3SCPA 4QLJA 2BHUA 2A3CA 4UOQA 2BVYA 5I78A 5EMYA 4QDMA 2JF6A 2ZIDA 3ALFA 4W8LA 4TTGA 5CJ5A 5ABEA 2XGIA 2YA2A 1E6NA 4MDOA 4HZ7A 2W4XA 1GNXA 2WYSA 4GI9A 4ATLA 1C92A 2CHOA 3OA5A 3TP4A 4CD4A 2WLZA 1KWGA 1XHGA 3CH9A 1GJWA 2DH3A 2J75A 2V3DA 4XZWA 3TTSA 3I3DA 4B16A 4AMCA 1UD5A 3A4WA 5CQ1A 1UR2A 2JIEA 2RGLA 4W93A 5IXEA 2FHBA 1V3KA 2YA0A 3VMOA 2PWDA 4B3KA 3AMKA 1C8YA 2UY4A 1BTCA 1HJVA 2WZEA 1H11A 4GO9A 3W6LA 4BZYA 4KRTA 2XFFA 1M03A 4PN2A 1D3CA 2D24A 4ATWA 3CLWA 5A6SA 2WMIA 1UWUA 3CZEA 1JYWA 1CNVA 3T08A 1CWYA 1GONA 3MO4A 5A1AA 3CUHA 1U30A 1GQJA 1OT1A 3D5HA 3N11A 3AIQA 5JUVA 2JFEX 3AJ7A 3T2QA 4DWSD 2WVUA 2WVSA 1ZS2A 4OBRA 4PMDA 3T09A 2EO7A 1V02E 1CXFA 3PTMA 1KWKA 4ML4A 1V3LA 1JI2A 2YLLA 1W32A 1WZKA 2D3LA 1E4IA 2XJ7A 2XM2A 1PZ3A 1U2YA 4LXFA 1V03A 1DP0A 2PI6A 2WVVA 2DH2A 3WUEA 4EAMA 4J3TA 1JAEA 3T0AA 3U7BA 2DT0A 1SR0A 3A4XA 1W1TA 2JIWA 2YLAA 1QHZA 3CHFA 4OOZA 4AZIA 4KWUA 3DHPA 2WPGA 1J0ZA 2J74A 1E70M 3HN3A 1UKSA 1RD6A 1K6AA 2WHMA 1GQKA 4B15A 1KXHA 1H0IA 4NSBA 3ZT5A 1ISZA 1QBAA 5JBEA 1C8XA 2EPMX 1E4NA 3WL1A 1OT2A 1Q6CA 3SCRA 3POHA 3VTRA 1EGZA 1EQPA 3BAKA 2WSPA 2YDSA 1H49A 4AD4A 1WNOA 4W87A 1HVXA 1E0XA 1S46A 1CLVA 1PZ2A 1WZAA 2BS9A 3TTYA 1B3XA 4QAWA 5IDIA 1MQRA 4BA0A 1CGVA 4AWEA 1E5JA 4CCDA 3ZR5A 2VVSA 4HPGA 3THDA 4Z2HA 3VIFA 3SUSA 2FH8A 3WQVA 3CBWA 4TX6A 3WH7A 2Z1KA 2OYLA 1XD0A 4MB5A 1W1PA 2VI0A 2OSXA 2VNCA 1AMYA 4CD7A 3WH6A 4H8VA 2V38A 2CBUA 3MMUA 3MV01 4A4AA 5E09A 3WDQA 4MNJA 1NOWA 1V6YA 2DT3A 5EFDA 2DSUA 3M7SA 1QI2A 3N18A 1JZ4A 5LA2A 3MSDA 3T2PA 1OINA 1UG6A 4D6FA 3RM9A 3VGDA 4CN6A 1LWHA 4W7UA 3VDHA 2GDUA 2CESA 4MNMA 4EKJA 2YOCA 4PMOA 1HKMA 5I23A 4HA1A 5E6ZA 1KFWA 4UZSA 1V0NA 1W91A 1SMDA 2F2HA 3WNKA 2AOSA 1MW1A 1ECEA 1JXJA 1K9TA 3QOKA 2J62A 1R86A 3MV11 4RE4A 4MPKA 4UFMA 4HMEA 3POCA 2WM0A 7CGTA 2BY0A 5IFPA 5JIWA 1OIFA 1JYNA 3BGAA 1XSKA 2XG9A 1A3HA 1CENA 1WZLA 3NSNA 2E9BA 1EOMA 1EDQA 2WZHA 2X05A 4P8VA 3VGEA 2CERA 4MAVA 4GZIA 4OOUA 3BCDA 4DM1A 2BFGA 1V02A 5FKYA 1OD8A 2CYGA 4ACZA 1ISYA 1KR1A 1SFSA 1QNOA 3AIUA 3RM4A 3SCNA 1W1YA 1EHAA 1RP9A 4W7WA 2QMKA 3N13A 4F8XA 3CO4A 1CLXA 3SEPA 2D2OA 3HJEA 1TUXA 3WFLA 1BAGA 1HXJA 1W3KA 3SCWA 1JIBA 1WP6A 5E6YA 2A3EA 5GNZA 1EXPA 3NIYA 2Y2WA 2V3EA 4U3AA 1HKIA 4W89A 4U33A 3FNDA 4M80A 1KXTA 1OGSA 1KBBA 4C7GA 2MANA 1UHVA 3W25A 3BMWA 4AD5A 1UD2A 2WLYA 4L4OA 1E56A 1V0MA 3WH9A 2YL5A 2OWCA 3RO8A 2FHFA 1E6RA 2VX7A 1UR4A 1WPCA 4ACYA 2G41A 1FFRA 2QF8A 4AZ5A 3OZPA 2XM1A 2Y4SA 1ESWA 4K68A 1E4MM 5DT5A 2EBNA 5M5DA 1KR0A 3E1F1 1HL9A 2BHZA 5A6MA 3AZTA 5ABGA 3VUPA 3AHVA 1K9EA 3SIMA 4BQ2A 1IT0A 1L0PA 3BH4A 3PZQA 3GNOA 1IV8A 2CEQA 5ABHA 4HOWA 4CN1A 4JKKA 2WXDM 3FHAA 3MUY1 3WDPP 2GJXA 1LL7A 2E40A 5I6SA 4B9ZA 3GXDA 3QR3A 3GYCA 2EPOA 2XWDA 4AW7A 4HA3A 1VIWA 4H2CA 3AISA 5A6JA 1X6LA 3DHUA 3CIVA 4MB1A 2X2YA 1JDCA 2DSKA 1CGYA 3ZSTA 2XGBA 1OB0A 1ZB5A 2GJPA 2WMGA 1UD3A 3IANA 3ZR6A 3FY1A 2WHLA 3PZUA 1JZ6A 3ZSSA 4LYRA 2XPKA 2WMHA 4M1RA 3CHCA 3BLPX 4Z2IA 3LPFA 3GBDA 1I75A 4JIEA 2J8GA 2J7DA 1GOQA 1M53A 3GBEA 4XV0A 4UOZA 3W6MA 4UQAA 2WANA 2W91A 2ZWYA 2YKKA 2W66A 3I3EA 1B0IA 1KGUA 3VDBA 4D6JA 1KGWA 2D3NA 2YBUA 3WELA 1WAWA 3WSUA 4AZ6A 1MXGA 2GK1A 5FL0A 4D6IA 4TXEA 4ZE4A 2J47A 1OWQA 3VIGA 2WC3A 3RIKA 2JEQA 1ZJBA 2PBGA 3W26A 3GXFA 3QHOA 1JFXA 1F4AA 3ARWA 3AXXA 4D71A 4WSJA 1QPKA 1BYDA 5HXMA 3BAYA 3BXWA 5HNNA 5A6AA 3MUZ1 1GOMA 1VEMA 2VURA 3AZRA 1C7SA 4AC1X 3WH8A 1G1YA 3VPLA 1UQYA 4DM2A 1W2VA 5HBFA 1VBRA 2Y8VA 1L8NA 1B31A 1XD1A 1JYXA 4WJXA 4UFJA 3FAWA 4Z2GA 1US3A 5CLTA 3W81A 1N82A 2ZWZA 3VILA 4CD6A 1W2PA 2X8RA 1QVBA 3SUVA 4NRRA 3GXMA 2OYKA 1AQMA 3S6TA 2E8YA 4HMDA 3WL0A 5BXTA 3VU2A 2WKGA 1JZ7A 2DSZA 1JXKA 1OIMA 2VL4A 3CZ8A 3QGVA 3VIKA 2F61A 1UWTA 4PMRA 1H1NA 1W9VA 3BLKA 1B1YA 2XSBA 4BQ3A 1OGGA 3AFBA 3AIVA 1XH2A 2EPKX 3KL3A 4UR9A 1QW8A 2CPUA 4LYQA 5DF0A 3B9DA 4WSKA 3WF2A 3IAQA 3ZJ8A 2NT0A 1HVQA 5IHRA 8A3HA 1O6IA 3HMCA 3GNPA 6CGTA 4YHEA 3AS1A 3AS0A 1TA3A 5ABFA 3GH7A 5D8ZA 1EH9A 4FLOA 2VUYA 2DGAA 4HP5A 4NI3A 3W4RA 1W3JA 1WKYA 2CBJA 2EEXA 1GOWA 1V3HA 5A69A 1BHGA 5A8MA 2WMFA 4GPNA 5A6KA 4OJYA 3KE0A 4GI8A 1V3JA 2WKLA 3VMNA 3PZGA 2ZUNA 2ZE0A 5HDRA 3O9NA 2E9MA 5I3DA 5LA0A 5DO8A 3RJXA 1XSJA 3VVGA 2NT1A 4F9DA 1EDGA 1UH2A 4CVUA 3WF0A 3L4TA 1J0HA 3VD7A 1V0KA 2VO5A 2YA1A 1OD0A 2OLHA 1NWTA 4E8DA 1UZ4A 1VFUA 4PSRA 4LGXA 1JGIA 1GVIA 3ARVA 3WY1A 4D72A 1HIZA 3OZOA 5BXPA 3O2LA 1XCWA 1UA3A 1M7XA 2YBTA 3FXYA 4HA4A 2EJ1A 4PCSA 1AQ0A 5BRPA 1CTNA 2ZUSA 5HOSA 1H09A 1UZ1A 4W8BA 1GJUA 1LL4A 1UD8A 1TFVA 4JCMA 1OCQA 1ZBVA 1QNQA 4U5IA 4L4PA 4PUEA 5D8WA 1E40A 2E4TA 1QHOA 2PWGA 2ZUVA 1V3MA 4BS0A 5FIPA 1JAKA 1DTUA 4D6DA 8CGTA 1QI0A 1MFUA 3OLEA 4P7QA 4ZE5A 4EANA 5A6BD 5HPOA 3WUGA 3CPUA 1W1VA 4AD1A 2VJXA 2GFTA 3L4ZA 2J7GA 1XH0A 3VD9A 1SMAA 5D9OA 2A3AA 2Z1SA 4DUXA 4W85A 4GO8A 3EMCA 7TAAA 2PWFA 4JFUA 3MU7A 1XH1A 3W28A 1PIGA 2WK2A 5CSYA 1BYBA 5BRQA 1K9DA 1FOBA 2ZX8A 3WDHA 3EDEA 1UWQA 3UG5A 1QHPA 4EE9A 1HJWA 1JG9A 4UNIA 3PZTA 3IK2A 4NF7A 4QCEA 3FW6A 4KRUA 4J7RA 2BV9A 5A94A 4J3XA 3ARXA 2VC9A 3WD0A 3K8KA 2WVTA 3AIBA 3IJ7A 5E0CA 1HP4A 1I1WA 2WWDA 3VNYA 2UY5A 1VEPA 3CGTA 3AYSA 4UFHA 3PN8A 3L4YA 4AD3A 5IFTA 4Q22A 5I0DA 1XC6A 5A3HA 3WQ5A 2YDRA 4TOQA 1JFHA 3O6AA 1LG2A 1V6VA 3A47A 1J9YA 1R87A 1ISXA 2DIJA 1C7TA 2ZXDA 4P7NA 4R27A 2ZICA 1E43A 1GQLA 2EPLX 2YL6A 2TAAA 3VD5A 6A3HA 4AISA 2CITA 3L4XA 1J0YA 4GINA 2X0HA 4E8CA 3WF4A 5E9AA 1Q4NX 3WDIA 3PZMA 2WNWA 1ODUA 1XCXA 1G5AA 4OZOA 1J10A 1JDDA 1PBGA 4WLCA 3VO0A 1IZKA 4J27A 1MQPA 4CN4A 4PTVA 3FHQA 4AZ7A 2WBKA 2VTFA 1ITCA 1R8LA 4KMQA 1AVAA 1CYGA 1J11A 1BVZA 4DUVA 4HPHA 1E71M 2PBOA 4D6CA 1KBKA 4JKMA 1TVPA 4H7VA 4PMZA 2YL8A 1UR1A 3UETA 3WNPA 1ZU8A 5DFAA 1GZJA 3DYOA 4P7LA 4TTUA 3OBAA 3WF1A 5M03A 4IPNB 3LMYA 1PX3A 1NOUA 3AICA 4U31A 3NUKA 3MUAA 1WDSA 3J7HA 1J0IA 1HNYA 2UWFA 5D4YA 3SCTA 3VGGA 4A3YA 2W92A 3DECA 3GNRA 1J0KA 3WQ4A 2J77A 1MYRA 3CMJA 3K4DA 1MQQA 1GCYA 4D6HA 4W7VA 4WF7A 4MDPA 2GJRA 1XRVA 3ZQ9A 2QV4A 2JALA 2XIBA 1PJ9A 1E3ZA 1B3ZA 4CD5A 1E1FA 2DT1A 1CXEA 4GKLA 3EYPA 4C7DA 1NOFA 4AD0A 2D0FA 1H4PA 3WEZA 1JI1A 1GORA 5CPSA 3VGHA 1CZ1A 4AD2A 5A2CA 3GZAA 4H8HA 4N42A 3CHDA 1BYAA 3EMZA 3L2MA 3CHEA 1CXIA 4QP0A 3WD2A 1EQCA 4JFTA 1Q6FA 4EK7A 2VMFA 2IUZA 2ZUWA 1WB0A 2G3IA 4CU6A 1KGXA 3NSXA 1UKPA 2IXUA 1R85A 1B9ZA 2B31A 1VB9A 4U2ZA 2WMJA 1TVNA 1WE5A 3AMCA 3RM8A 3NDZA 3RMEA 4UCFA 1HF6A 5A8PA 2VCCA 3ZOAA 3DYPA 4V2XA 5HPCA 1VEOA 3WBEA 2WSKA 2J7EA 3KEHA 3WNOA 5BROA
chains in the Genus database with same CATH superfamily
4UIOA 4UFLA 2QXWA 4JL1A 2HVMA 4EWJA 1DJQA 2I57A 5CBBA 2OJPA 4DJEC 5C70A 3EWZA 3OIHA 4OVXA 3DBPA 4I90A 4DO6A 3CUGA 5F1VA 3VZZA 3AHYA 1DJGA 2ISVA 4IIFA 4HNVA 5DY2A 3ALGA 3BSMA 1NQKA 3ZR4A 3W27A 2ZA3A 3K8LA 2J7FA 3WH5A 4D1IA 3GKAA 1NFPA 4XSMA 4ZQCA 4GABA 4XZHA 4CLMA 1TTQA 3C61A 1JNDA 4PUDA 5GNXA 3ITLA 5C8BB 2X0YA 4Y7EA 1DYSA 5L6UA 3T9PA 4PUKA 5D9MA 5DMYA 3U5UA 1FP9A 1LP6A 2Y8KA 4UQBA 3KRBA 4LC6A 1VBUA 3LU2A 2PTDA 4G1KA 3QV7A 3IV8A 4X3ZA 3DAQA 5LIYX 3UJRA 3EWWA 2C71A 2YCEA 4RW5A 4R9OA 3PUEA 1IHIA 1CPUA 4F0KA 4RNIA 4Y9AA 4GNKB 4PSPA 3EXRA 3VM7A 2Y0FA 2FFIA 2RJGA 4FOJA 4Y8FA 3W7KA 3ZJ6A 1SFJA 3OP2A 4XG1A 1HGWA 4XZBA 2BNJA 5IBXA 2XISA 3MA8A 3NQFA 3CUIA 1CXKA 1EA9C 1R5YA 4C6PA 1K3UA 4MMWA 5H2ZA 4BWLA 4WY0A 4HTYA 4PB3A 2JE8A 3QV9A 1JDAA 2YBVA 4L1GA 4J3VA 3BE7A 3C8FA 1NARA 3U9IA 4C6LA 3KVMA 2OZTA 1ZL1A 1TTPA 3LLFA 2V8ZA 4LCSA 4OV9A 6REQA 4FNTA 3MW7A 4DJEA 1E1EA 5HWNA 1DIOA 3WNNA 3V3WA 4L4MA 3W22A 1QJWA 4GYPA 4MNLA 2ZQ0A 1EBHA 3H2OA 3IK4A 3T55A 4AEOA 2R1PA 4EXQA 2OLAA 1J96A 1E6ZA 1AW1A 3EXSA 5DELA 2W67A 4D6GA 4Q7IA 3UXIA 4QTGA 2P88A 1YHTA 2O9OA 4YWIA 4PB4A 4NP7A 4ZQMA 3K46A 1K70A 4PUMA 1FHDA 2QCNA 3BANA 3I3BA 4TVDA 2QF7A 3GIPA 3UY8A 4GMEA 1EX1A 3CAWA 3SFWA 1U22A 5BXRA 2BXVA 4IIHA 1Q8JA 2QJMA 1ZP4A 4IX2A 1UKQA 4QJ3B 1L6WA 2CZ5A 4LF2A 5D38A 3URQA 2Y88A 3JUGA 2VM8A 1BWLA 5E0KA 3ZXWA 4WGXA 4OUIA 4GJJA 5A5WA 3EWDA 1OM0A 2Q8XA 3ARTA 1S5NA 3L4VA 2GWGA 2QVNA 1S3HA 1MEIA 2VX4A 2VEKA 2DUXA 3PK7A 1LWJA 1V4YA 4LS0A 4NJGA 3ZVHA 3ZJ7A 3PWIA 3SY8A 3VMPA 1G0CA 1DJZA 3SCUA 1ODZA 3IWPA 3A9BA 2XVPA 5GPRA 1IQ8A 2B7PA 1A0EA 4F3HA 3IUIA 1S39A 1EOKA 3B0UX 4NZCA 1Q6QA 1VF8A 3VKBA 3L5MA 3F4NA 3LPOA 2BY3A 4MM1A 3WIJA 3FGCB 4NILA 3A4JA 4Q8PA 1ME9A 3V0SA 4MAZA 3WUFA 2P53A 3CQ0A 4JBRA 3V18A 2Y5EA 4FP1A 5DBUA 2QDDA 4AG0A 1E5NA 3KWSA 8TIMA 3TWAA 3E49A 4QHRA 3TJLA 4N4QA 1RV8A 1WAUA 4J3SA 4PL1A 2VX6A 2OXNA 1NY1A 2POZA 5BMWA 1OCJA 3C0SA 2W62A 3RX3A 1UC4A 3IGXA 3WD4A 1KFCA 3A5VA 3AYRA 3QC0A 1PAMA 4NG3A 4FNRA 1LQ0A 3ZT7A 3TJXA 1OFAA 1NF0A 1TG7A 5LYRA 5M17A 3MHGA 3ABSA 3EB2A 2BTMA 4WDXA 3ARSA 3PPGA 1XIJA 3GXTA 1EP2A 5FF7A 3CLMA 1RCOB 2QNEA 3LERA 3LGDA 2J9YA 2CXGA 4WJ8A 3KOYA 3HGOA 4HK5A 3WD1A 3VGBA 4JEJA 3N3MA 3PZNA 1UD4A 1L6GA 4AIOA 3GTHA 1RPXA 3EDJA 2OU4A 4IMDA 1R9YA 1KM3A 4J4KA 4DBWA 1X7FA 3HB9A 2QVHA 3PP7A 4KIEA 1C9DA 2D20A 3M46A 2CZFA 4WK9A 4ZB5A 3VKJA 1XINA 3TX9A 3DYMA 2RJHA 1G9HA 1WZMA 5HJXA 1MUCA 4BQ5A 2IKHA 5DLCA 3N6JA 3VXGA 1SSDA 1A4LA 2J7CA 3VKKA 1Z3NA 2PDQA 2DY3A 4EACA 1LRNA 2JEPA 3NFUA 4V33A 3F5LA 2F9RA 1TIWA 4OQVA 1NWUA 3DKJA 2RGMA 1ZTVA 3G8RA 1MRQA 2QCEA 4UQDA 3G22A 3U2ZA 4R53A 3GG7A 2VZOA 1VFHA 1JPHA 1OBAA 4ORMA 4MWAC 1KCZA 1SZNA 2A3BA 1HKKA 1O95A 3FKRA 3QTPA 4H9VA 3ICJA 4H41A 2PDYA 2OEMA 3FK4A 1UKOA 1A0DA 5ECUA 1ZSXA 3VNZA 3H4GA 4YTUA 1Q85A 2PP0A 1DWFM 3DERA 3K8MA 5CG0A 1Q7MA 2C0AA 1F3EA 4BY3A 4YVXA 3LGGA 4JDBA 1XFCA 5T9CE 1E51A 1YTDA 3W6YA 4FIRA 3V35A 1EXBA 3EWCA 1X8FA 3VK5A 4HVXA 4NHVA 3KDNA 4Y96A 3W84A 4F0LA 5J5RA 1ZBWA 3TDFA 3T81A 4L56A 5U7SA 2Z2AA 3XIMA 1W9DM 2FGLA 2WSYA 2D0HA 1R46A 1XV8A 5TAOA 1A50A 5K4ZA 1EPVA 4C6DA 2ZXBA 1QW9A 3PZIA 4AYSA 1V6UA 1RVKA 1J01A 4ZXOA 3JS3A 4EAYA 3FFSA 4M7TA 4H8NA 1XLJA 4D8LA 3TQ0A 3H23A 3GVWA 1XUZA 5KINA 2D0GA 5I07A 3AUJA 1XGEA 2DQXA 4ML9A 4OIFA 3TN3A 3MKKA 3GTFA 1D2KA 3KL5A 3LTYA 1JCMP 2QIIA 2Q3OA 5BU6A 4HYWA 4EXAA 3BMXA 3N9KA 3WBYA 1CX9A 2VEIA 2GJXB 8XIMA 2OCZA 4HMNA 5IM51 3LZ5A 3NDYA 4J3WA 3ANVA 4BF7A 2WJDA 4ZGYA 3PJUA 1B30A 5M3WA 1OC5A 3CV6A 1LBFA 1V6XA 4O14A 4KGJA 3M0ZA 4PCNA 3F03K 4BI7A 2NQ5A 1D9EA 4H9UA 4JQ1A 2PDWA 1PB0A 2FTPA 2PWVA 5CZSA 1MFVA 2H6RA 1AQFA 1VFFA 3C52A 4MWAA 4U2YA 3WJXA 1W5QA 1JUKA 1A5LC 2ZKMX 3PNUA 1UUMA 3OVGA 4WZHA 3MJMA 3GUGA 2AMGA 3GW0A 1YXDA 5I5RA 2H3BA 5CZKA 3RU8X 1UWSA 3T8QA 4TX8A 2ZUMA 3BSGA 1IXOA 3SRFA 2OZ3A 3TOYA 4ZOBA 4UFKA 3UR2A 3NJ3A 1P6CA 4C6OA 1X96A 3SECA 3WDRA 1GPFA 3WMCA 3LV6A 1NM9A 4QXIA 2J66A 1J5TA 3S3GA 1SO5A 2VRJA 3Q45A 3AIRA 1K02A 3GFYA 2CZEA 2WJFA 1DQXA 2DDXA 3LLXA 3KBSA 4WDUA 4B5VA 3ZT6A 4GJIA 5AC6A 1OHLA 4WXZA 3R0KA 4GBUA 5G2WA 3PY2A 4GY1A 5ABTA 4MTVA 2CCRA 1C29A 3P93A 2CETA 1E6XM 2DPEA 3VX0A 1K9FA 1TSIA 2W5FA 1GEQA 3QYQA 1B3WA 2UY3A 1EO7A 1RK5A 4IM4A 5DRIA 3QBUA 4GY7A 2NXIA 2REQA 1EJRC 3MZNA 2EXOA 1E4LA 1TA3B 1PUDA 4NIRA 3EMQA 2H90A 5G1TA 5A6BA 4AZCA 3QTGA 5FACA 3T42A 1I2PA 3VIIA 2DVUA 1S5MA 3N2TA 1CXHA 1Q6LA 1JZ5A 1JD7A 2BXYA 4XB3A 4DPPA 2VGBA 1OZQA 1LJYA 3WJSA 1DWIM 4KIRA 2VC6A 3VNMA 2IPFA 3SURA 3SUWA 5HWMA 1W3HA 4M6QA 3MMDA 4ICCX 1TPWA 3W1TA 1R9ZA 4IX0A 1YW1A 2J6XA 2NSXA 3CWOX 4YTSA 4Z2LA 2UV8G 2DW7A 1PEZA 3ZMRA 5E93A 2WHJA 2EG6A 1VRXA 2GUYA 3BAWA 4RV3A 4LALA 3UEQA 3DFHA 4L9ZA 5BZAA 4ZENA 4ERAA 3T44A 4L1XA 3V5CA 3FN9A 1VP5A 4AIEA 3GIYA 3BC9A 2I1OA 1R2RA 4L65A 4PRTA 3BQ5A 3WBAA 3WQFA 2GZXA 4PMYA 4QNEA 4UTFA 5H91A 1LT8A 2XVKA 4WSHA 3CZKA 3REQB 1P48A 4XBKA 4G7EB 1TV7A 2EG8A 3W7EA 4JHZA 1DJIA 2ZX9A 5E5CA 4NT0A 2WZIA 5BRBA 1RR2A 1HJQA 1XRSA 1B3VA 1PPIA 3PBYA 5KTLA 2GGEA 1K4HA 3N2MA 1WQ5A 1M01A 3DFNA 5HATA 1LRTA 4LSBA 1EIXA 3XINA 3OLIA 5CZTA 1GOKA 3EDKA 1W56A 3QZEA 2V5CA 3DXIA 4JFSA 2DT2A 3EPMA 3GHSA 3SRDA 4M6VA 3BL3A 4S23A 3EAUA 4RZBA 2A3CA 4UOQA 4S3CA 4DUOA 4O13A 2NZLA 1U5VA 2CLHA 1VLWA 2JF6A 4U28A 1W1A1 1WUFA 4FAMA 4W8LA 5CG7A 2P5NA 1IEVA 5C2XA 4TTGA 3IVSA 4YTRA 2W0UA 1V79A 4H7ZA 6PTDA 4MDOA 3STGA 3BCJA 4RLIA 4L7ZA 3T4WA 4ATLA 1C92A 4AY7A 1R3SA 1KWGA 1XHGA 3W72A 3CH9A 2OR2A 4A05A 4XZWA 2NSOA 1PKMA 3UJSA 3A4WA 3HPSA 5CQ1A 4BK9A 2JIEA 3N73A 2KZHA 1K1DA 2QCLA 2RGLA 4O57A 1MEHA 2YA0A 1XYBA 3RRXA 2A2IA 3AMKA 4J5NA 1G7UA 4GK8A 2WZEA 1H11A 3K5XA 1DJHA 2R1LA 3DC8A 4I8DA 4KRTA 4BZYA 3TV8A 2D24A 4ATWA 3EB3A 3W1MA 1A53A 1M7JA 5A6SA 3TR9A 2NX1A 1TJRA 3RHGA 3T08A 1SVDA 1GONA 4UTHA 2GOKA 3WK0A 3ZLHA 2JFEX 3LTPA 3AJ7A 2QKFA 3T2QA 2WVUA 2WVSA 4OBRA 2IS7A 4FALA 3T09A 1PHQA 1LBMA 3LHWA 2EO7A 4PTDA 2YLLA 4PODA 1PCWA 4D9PA 3A21A 2Z7KA 5D32A 2D3LA 1WZKA 1E4IA 5C7VA 3WLLA 1DP0A 2PI6A 3DFYA 2YB1A 1QO5A 1W1IE 1XL9A 3SM0A 2DT0A 2V2DA 4RPQA 4G9PA 1W1TA 1QHZA 3CWHA 3SJ3A 3DHPA 1SFLA 2I7GA 3PTDA 2J74A 1QWGA 1N8IA 3D46A 3AXKA 1K6AA 2WHMA 1P0BA 3Q67A 1XJBA 3LHZA 3KXQA 3W1QA 3JR2A 4O10A 3MKVA 2ZDRA 3WL1A 1R2SA 3RITA 3MQTA 3JZUA 3UGVA 1H49A 3T07A 1CLVA 2G96A 4HNLA 3RU6A 4DXKA 3TTYA 4QAWA 1XIMA 1EPXA 3NQMA 4CCDA 3ZR5A 2VVSA 4HPGA 3QQWA 3NG3A 3TE9A 3AU2A 1FWHC 1XUUA 3FS2A 1JCLA 4TX9A 2VI0A 2OSXA 1I2QA 4E4UA 3KBVA 4DEFA 4H8VA 3W1AA 4HHPA 4WGHA 2PCQA 2V38A 3CQHA 1RBAA 1V6YA 4C6BA 1DJNA 3N18A 4R88A 4F2BA 1AZ1A 3MSDA 1OINA 3GHUA 3L68A 1FXPA 4W7UA 2GDUA 5BWAA 5I3KA 3DDMA 4Q8TA 1OX6A 2YOCA 4JTAA 1XPGA 5I23A 3IRDA 4HA1A 1V0NA 2VYOA 3WNKA 4KBXA 2AOSA 3G1FA 1LM1A 2PCEA 1MW1A 1GW9A 1ECEA 1JXJA 4F0SA 3ONCA 3TJ4A 2J62A 3M0IA 1B9BA 1TRDA 3BARA 3MV11 4UFMA 4MPKA 4HNNA 3ORWA 4HMEA 5LGXA 7CGTA 1EL3A 3B05A 5JIWA 4DVOA 1K03A 1JYNA 2E7FA 1MNSA 1XSKA 3BGAA 5M1TA 2XG9A 4CEUC 1WZLA 3MCMA 4KEVA 3MCOA 1MO0A 4S39A 3QPEA 3GVQA 3KRUA 1RLCL 1OD8A 4ACZA 1KRAC 4Y9OA 1RP9A 4W7WA 2DV0A 1U5JA 3UPWA 2CWNA 1YRRA 4KCUA 1CLXA 2Y62A 4R9XA 2A0NA 1EYEA 3HJEA 3W07A 2MUCA 1T96A 3LENA 1W3KA 2NVDA 3SCWA 5KZMA 2A3EA 5GNZA 2DU2A 1BWKA 1KRCC 1A4MA 4JYEA 3MBDA 4FXJA 1LLWA 4INFA 1ZJIA 3QVQA 5LNSA 1FWGC 2HPMA 3BMWA 1YPIA 4M51A 1E56A 2Q6ZA 5DY3A 3SQMA 1UR4A 4JTQA 1KTNA 2O0TA 2G41A 2VFIA 1D7KA 3NO5A 4ASTA 2EBNA 1KR0A 3E1F1 1HL9A 3LM7A 4FA3A 2A1YA 2AL2A 3BLDA 1IT0A 4K1WA 4DN1A 2ZZ2A 3LRMA 3GNOA 2Y7GA 4HOWA 1TJ1A 3FYOA 2QDGA 2WXDM 3FA5A 3M9YA 2PP3A 2AMXA 4NXKA 2P1FA 2Z0IA 3LGEA 4B9ZA 3TW7A 1KFEA 4C6IA 4XQ6A 4HK6A 4AW7A 2WOQA 2I16A 1ZCCA 1EJ7L 5A6JA 1ZAHA 5FF2A 2QAFA 3PANA 3NXLA 5CAKA 4HHHA 1YNQA 2DSKA 4AHQA 4ZFCA 4N02A 3LN3A 2WMGA 3IANA 5HINA 4KWSA 1Y5WA 1FWCC 3W2MA 1TPEA 2PDXA 5FF4A 1RJQA 2AKMA 4Z2IA 1IYXA 1XKYA 2I17A 4PUUA 3TROA 4TR9A 1W8SA 4QEEA 4KW2A 3S1VA 3W6MA 4UQAA 2WANA 2W91A 3LI0A 3UWWA 4GIYA 4F4RA 3GLCA 4HPNA 3OPSA 3VKDA 4IFKB 2EJAA 2OT0A 4O18A 3LY0A 5AHLA 5HNRA 3HQ1A 3WELA 4AZ6A 4MZ1A 3NQ2A 3UW6A 1MXGA 2GK1A 1BSLA 5FL0A 5HJLA 1PV8A 1OWQA 2WC3A 1FWIC 2PBGA 1VR6A 2R1KA 3QHOA 3CM4A 4D71A 3N19B 4XWUA 3M0HA 4GGHA 5HXMA 2AQVA 3RR4A 4MUPA 3AZRA 1C7SA 2PDUA 1TREA 4AC1X 4R34A 3VPLA 4F2UA 1W2VA 5HBFA 3LNMA 2Y8VA 5CSSA 1B31A 1JYXA 3GS6A 1QTWA 4Z2GA 3QGKC 5CLTA 3GD6A 3S5OA 3QGAC 3G3MA 3C2EA 4O53A 3KBMA 2X8RA 1QVBA 3SUVA 3OHIA 4NRRA 2OYKA 3S6TA 2E8YA 3VU2A 2WKGA 2RKXA 3VE7A 4OT7A 1EWDA 4RE0A 4JX6A 1OIMA 3BJTA 1BKHA 4ZSUA 4TO8A 3QYSA 2F61A 4BI6A 1B3OA 4JNMA 3GC2A 3DUGA 4C6FA 3B8DA 4AF0B 3AIVA 1TQXA 1XH2A 1QW8A 3AUOA 3IAQA 2PRLA 2PF8A 5CC6A 8A3HA 2B0MA 4YHEA 3AS0A 4B2DA 1XYAA 2OT1A 5EGRA 4C6KA 4FLOA 2IQ0A 3CS2A 3W4RA 4MJZA 4LEFA 2CBJA 2EEXA 3VABA 3L67A 4PE8A 3HMJG 1BHGA 2WMFA 5F2IA 5A6KA 5KZDA 3NM3A 1BF6A 2A6NA 2WKLA 1GEHA 2ZUNA 1RD5A 4R3UA 4NJHA 4R7WA 1ZFJA 3L0NA 4C6JA 3WF0A 1E1CB 5TNVA 5G2HA 1NWTA 1RK6A 4B91A 2A85A 3APYA 4LRSA 3PB2A 1IT8A 1GKPA 2WNZA 5BXPA 3QR0A 1S2WA 1XCWA 1UA3A 2QJJA 2PEVA 3SR7A 2DW6A 4C1KA 4PCSA 4MGGA 1Q65A 3B0YA 3N6QA 5HOSA 4TMCA 3ITGA 1OEPA 1H09A 1UZ1A 4YNGA 1F8IA 3W2JA 3C6CA 2ISWA 1J5SA 3AALA 3U6WA 2GVEA 3N4FA 3UP8A 2IMRA 4U5IA 1KA9F 3CV7A 4PUEA 3EPNA 5D8WA 1VIZA 3E2RA 2ZUVA 5CPMA 4BS0A 3OZYA 1JAKA 8CGTA 1QI0A 1MFUA 3OLEA 4IP5A 5HPOA 1W1VA 3E0VA 3PF3A 1F8MA 1UMYA 1TV8A 5LIUX 1XH0A 3VD9A 5D9OA 3K1GA 2A3AA 2BOEX 3LZ3A 1L2UA 3I7SA 4Z08A 3A3XA 2FKPA 2FVKA 4GO8A 2HS8A 7ENLA 1TWZA 4EF9A 7TAAA 1YXYA 1XQKA 1AD1A 4DJDC 4EF8A 1XH1A 2E68A 5LIKX 3TYCA 4YXGA 1BYBA 1K9DA 3KZPA 1HJWA 1JG9A 1GG1A 1T41A 3ARXA 4S3FA 4UTMA 2RAGA 3WD0A 3K8KA 1XWYA 1RQBA 2WVTA 2WNQA 3LUTA 1QK2A 3AIBA 3B8WA 3WG6A 4F48A 1KLZA 2QCDB 2XH4A 2WWDA 3KOXA 1TV5A 1G4SA 3VNYA 4WDWA 2GVGA 4WVXA 1YBQB 4ZQRA 1UPPA 3TQVA 5A3HA 3WQ5A 4RNHA 1JFHA 1X97A 2G97A 5H8PA 4I5UA 3N2CA 3TLQA 5CJMA 3FLUA 4UTWC 3ANUA 3RG6A 1KV5A 1AODA 4JPGA 3L4XA 1J0YA 4GINA 2X0HA 3WF4A 5E9AA 1Q4NX 1OFBA 1VBGA 4EXBA 4ZOCA 4RDVA 1G5AA 2NQLA 2CLMA 2RFGA 3OU8A 1ZAJA 1GVSA 4CQ9A 3B8UA 4AZ7A 2WBKA 3W1UA 3R12A 4IZGA 2A4AA 1R8LA 1MRAA 4LW7A 1CYGA 1BVZA 1LRQA 2TODA 1FKWA 1KBKA 5HNTA 3WO8A 2Q01A 2YL8A 4HN4A 3UETA 1K8ZA 1GZJA 4TTUA 4M5PA 4JTFA 5EPDA 1A5MC 1WDSA 4OBTA 3UJEA 2CLPA 1IXNA 5D4YA 4A3YA 3WQEA 1WBHA 2H9AB 1KO0A 1TWDA 1MYRA 5LNVA 5FI8A 4XAYA 2JALA 2XIBA 1PJ9A 4CD5A 2QUUA 3KP1A 5HK4A 5EY5A 4PZVA 1KTBA 2ZZ4A 4EPKA 3MI2A 1XIEA 4N6EA 1A80A 2ACQA 4A35A 2D0FA 1SZGA 2GJLA 4AQLA 3INPA 2V68A 1XI3A 5EKYA 4Z1YA 1TE6A 3GZAA 1MZHA 2DZTA 1NFBA 3BGGA 2JK2A 3CHEA 1ECQA 3CT2A 4DZHA 3QV6A 4BFAA 1OVDA 1Q6FA 3JVAA 4I5RA 4K1GA 4CU6A 2IXUA 1WXJA 2PRHA 4H9ZA 2B31A 1VB9A 1EJVC 8XIAA 3RM8A 2HS6A 2WSRA 3NDZA 4UCFA 5A8PA 2VCCA 4L4LA 3DYPA 1ZALA 4V2XA 2F2KA 3GO2A 1SPQA 3WNOA 3S2CA 4IQJA 4DJFC 3RCYA 1DWHM 2GGHA 4UTWA 1ZJAA 4POCA 5CXPA 1H7PA 2Y61A 5AHMA 3SCVA 3G5EA 1WA3A 1TTJA 1UD6A 4GXWA 1HX0A 3H55A 7A3HA 3LQGA 3TUUA 3WENA 4AEFA 1MXDA 1H50A 1B4EA 2DZPA 6ALDA 5HUPA 2XFYA 3WLOA 3DG6A 3O63A 1FH7A 1HP5A 3C2YA 5C2CA 1M04A 3UZZA 1UR9A 1FCVA 3B8VA 3S83A 3WNLA 4AXNA 4L5ZA 1SW0A 3EOOA 4X0NA 1I0DA 2DVTA 4MB4A 1JDEA 3FDGA 1MSSA 1NP2A 1UJQA 3T0TA 2V30A 1Q6GA 4MKSA 2ZX6A 2E8ZA 1LT7A 1VFMA 2UBPC 3GU9A 3B06A 4CNNA 1ZAIA 1DE5A 2Z27A 3A5FA 4LV9A 4XD6A 4LAKA 3H7UA 2GOUA 5T26A 3OGRA 5LA1A 4O8RA 3B8IA 1YE4A 3NCOA 1TELA 3OZMA 1JZ8A 4X2PA 4JTIA 4QE1A 2ATSA 3F1QA 4W88A 1X1OA 1H1ZA 2TPSA 3CAQA 4DF0A 4YYCA 4W5UA 3WQWA 1H7XA 5I00A 4JYDA 1S5WA 1IR1A 5F7UA 3WF3A 3OB8A 4JTKA 3AHTA 4JFVA 5CJNA 1V08A 4DHGA 4LB3A 2HZGA 4TU1A 4B92A 2C1GA 2ZYFA 3N1AA 4GWEA 3I68A 3DG3A 2XVLA 4DJDD 5FESA 1JVNA 3B8SA 1IXQA 3T05A 3KCOA 2Y63A 1XRFA 3C0JA 4M6UA 5CC5A 2GVLA 5HR7A 3U7VA 1GHSA 2CKRA 1W9XA 4KWOA 1HN1A 4ICNA 3VZYA 3UERA 4TVUA 1PS9A 4ZQOA 3ABRA 3SUUA 3GSMA 4NYYA 1FWJC 1XGZA 2GPTA 3PJTA 2BODX 2XUCA 4LUTB 1VBHA 1KFJA 3PTQA 2G3NA 1IEIA 1AH4A 1O4UA 1E9YB 1PIFA 3LRLA 2PAJA 2QQ6A 4XZ9A 3DEQA 4ICMA 3M5ZA 4LYPA 1TMQA 4QJ5B 1I8JA 3KOWA 4MB3A 2J7BA 2WMIB 5DEZA 4DBDA 1YDYA 1AJZA 1P7TA 1SU5A 1XDJA 5A8NA 5D2XA 4YCPA 3LRKA 4LCQA 1EDTA 2V2HA 4IL0A 1WDWA 2AQOA 3MP5A 1VH7A 5FAGA 4Q7NA 3C4UA 4HSOA 1E72M 3GTXA 1R7AA 3MC5A 3MANA 4JHOA 3EZ4A 4JGDA 1CDGA 1QO2A 4CD8A 3UCDA 4HU8A 1TO3A 2YZRA 2E3ZA 4PMNA 4Z1BA 2BHYA 2HCVA 2Y7FA 3OOQA 2VDIA 4ADUA 3DBNA 4F0RA 2XH7A 3YPIA 2ZXQA 3ARUA 5TF0A 4IXHA 3PUOA 2Z6IA 2YX0A 2HXTA 1F74A 3AMLA 2VOTA 4H6KA 4IISA 3PZOA 1JRBA 1TJPA 5D37A 1J0JA 1J12A 4OBSA 4MKVA 1H60A 2F6KA 3FV9A 3WDJA 3DG7A 3TN5A 3VD4A 5C9UA 1UPMB 2VFGA 3L4UA 4DXXA 3GDRA 2CWXA 2ISSA 4V27A 5AYBA 5LNWA 1JGMA 3AMDA 3AYVA 3T0CA 4F66A 2ZA2A 5CEWA 3QHMA 3KOZA 2QHAA 3QQ1A 4AB4A 3TOPA 3G1RA 2ZX5A 2QCHA 3L5LA 1K7EA 1DQWA 1TUFA 1WOBA 4AYGA 3P61A 2X1TA 4QE4A 3TC3A 3K4AA 3U57A 3M4HA 2ACRA 3FKKA 3VCCA 2V2CA 2DIEA 2FYMA 3OVQA 4ES4A 3RDKA 1YQ2A 4MY8A 3ARPA 1HO4A 2PDFA 4A8LA 1FWAC 3L9CA 1MWOA 3WUBA 3G0UA 3BLLA 1X1NA 2WZTA 1V6WA 4HCHA 3E2SA 3VIJA 2RDTA 1FKXA 1AQHA 1VFSA 4QG6A 3UBPC 1PE1A 1JUEA 1XDLA 1VPYA 4E2DA 4DJFD 2YDAA 2OODA 4LUYA 1OG6A 1ZUAX 4QLKA 2J24A 2C0HA 4S3AA 2OX1A 2O92A 3P6LA 1GQIA 4Y6GA 3BLFA 1OF8A 2NWRA 3N04A 3Q2DA 4GVGA 1YPXA 3OG3A 1VJSA 1IEXA 1XYZA 4H1ZA 1DE6A 2PU0A 3ZFHA 3PPHA 3C0QA 3LPGA 1VYRA 3S47A 3SRKA 3GDKA 7ODCA 1E0WA 4MG4A 2HSAA 2VENA 2CBVA 3UFYA 3RYSA 2JQXA 5LIXX 1XLCA 2XFRA 2X16A 4UXDA 4G8TA 1Q6DA 5EA9A 3LCHA 2BX7A 5MHBA 3ITVA 1VJZA 3JW7A 4URIA 1B90A 1JCNA 3NZ1A 3SSJA 3N34A 4UBPC 3UG8A 1GOOA 1O1ZA 1XGDA 2EG7A 3W24A 4H8UA 1Q6EA 1F4HA 1FA2A 4RE3A 1THFD 1CEOA 4WDTA 2GWNA 1DWGM 3CQIA 4Z1DA 2DJLA 1DWAM 1XG3A 1SW7A 4CNSA 1E0UA 4HB7A 4IMGA 1O60A 4YIWA 4AEEA 1TPUA 4QISA 1VENA 4X0VA 4FK9A 1ADDA 4PH6A 1VYPX 4XUGA 2QT3A 2WC7A 1MUWA 5AB3A 4M3PA 3FJLA 1JF6A 1HKJA 4C6QA 2VELA 4O11A 4ZFMA 2DVXA 5C0QA 3SCOA 3ATZA 1VGAA 4NUWA 3R25A 4DELA 4UMCA 4B5WA 3WKZA 1O5XA 2IXVA 4E2BA 4Z42C 3MDWA 4HNUA 4DUWA 5REQB 4CQAA 1XPYA 3KTCA 1YEYA 2W63A 3HIJA 4GKTA 2BB0A 1MEWA 4XTDA 4YLWA 5BXSA 3NL5A 3FSUA 4AY8A 4JKLA 5EMJA 4EVZA 3UGRA 4DWSC 2D22A 2YDQA 2DP3A 1KCLA 1GOIA 2C8NA 4FOKA 3S9YA 5M2FX 2BGQA 3NGJA 1BG9A 2OWXA 5TD4A 4AIBA 1QR7A 4CVWA 1AD4A 4CQDA 3HTWA 3SB0A 2QAPA 3A3HA 4FX6M 3AS2A 1W3NA 1FWDC 3UCQA 2OKOA 4NAEA 4MF4A 3M44A 6XIMA 5XINA 3WQCA 2PWEA 4Q8UA 1W9BM 3M0MA 3P5ZA 1DXIA 4PC8A 2VZTA 3RJYA 4AMAA 3EGJA 1JL8A 1XP3A 3L2LA 2J25A 4DB7A 4GZJA 4RNJA 1A5OC 4FX8A 3PC0A 3MSYA 4V28A 2XIQA 3GU1A 4F40A 3STPA 4O54A 2FIQA 5I77A 4GIEA 2NUXA 2ZBTA 1UW9A 3OHMB 4AZBA 3ARRA 1SO4A 1LBLA 4QAIA 4GNJA 3F2DA 3VINA 3LHTA 3MCNA 4H01A 4PTNA 1UYQA 4HZ8A 3HM7A 2VGIA 3BZGA 5FEPA 4FMVA 1WDQA 3PUGA 1ITQA 2ASHA 1KM1A 2QJGA 7TIMA 1UZHA 4Y9PA 4G56A 3DFTA 2BP1A 2OVLA 1FWTA 7REQA 1SUXA 4YN5A 3AHXA 1QBBA 4ZOAA 1FWBC 1V93A 4XO7A 3TW6A 1LL6A 3W82A 3V16A 2WWCA 5CPNA 1O7AA 1TB3A 1G01A 5JIPA 4K3ZA 4IH3A 2WW5A 1QI5A 3VNKA 4LVBA 3O05A 1HKVA 5I2UA 2PE4A 4GCAA 4GUGA 4ZODA 3NQCA 3AQUA 2J8TA 3OGVA 3TK7A 2PFHA 1BD0A 1I2NA 4NRSA 5A2AA 2W9MA 5DQPA 1CCWB 4HYRA 4PTMA 3GWQA 3WQ6A 4QFUA 4UTTC 4OGZA 1Y7VA 2WV8A 5AC7A 5LHFA 5C71A 1ITXA 1BRLA 4Z2KA 2W61A 4GQRA 2YPIA 1KBIA 4JTSA 3WMBA 2QPXA 3C56A 4GXMA 2X09A 4D6EA 5TIMA 4DQWA 3S4TA 1GZ1A 5CKSA 5GNYA 4KF1A 1A3XA 3H2AA 2Q3RA 2WMKA 3WLJA 4KWVA 1F2JA 1VC4A 1EZ2A 1CECA 4ZMGA 1TWSA 2JF7A 1QDSA 3VDGA 2WAGA 4N4PA 4BCEA 4J2MA 3NSMA 2AAMA 2FGZA 3U2OA 4KQNA 4WCJA 5C54A 1XIBA 2D69A 1VZWA 3BLOA 1JZ2A 3L12A 3ARQA 4FNUA 2G3JA 3EKGA 3BAIA 2ZOXA 3AI0A 2XVGA 1DHKA 3VOFA 2VEMA 1K7XA 4AZGA 2QDHA 4M19A 2YSWA 4AZHA 2YL9A 1W0MA 1JRCA 3WEMA 5CLWA 4RE2A 4PCTA 3DKLA 3U48A 4C7FA 5F4WA 2Y5SA 4NX5A 3U8GA 4DO4A 4UCGA 2Y6ZA 3MYOA 4K8EA 4ERGA 1EHNA 4DLMA 3EB4A 3GFXA 3HPAA 1YKWA 4M29A 2BY1A 5H8MA 1E6SM 3H26A 5E70A 4K7VA 1PKNA 3TTOA 4HNTA 5J5DA 5KZ6A 3S0CA 2OYMA 1H63A 4E0CA 1G67A 2Y24A 1XLHA 3H2EA 2QCMA 2OKTA 3MUXA 2BVYA 3CIXA 3N29A 4QDMA 4MY1A 2WKJA 3ALFA 1EP3A 5ABEA 4WUIA 1R3QA 2G37A 2YA2A 5JU6A 3BPWA 3I6RA 1TPDA 5B7YA 2VKZG 3P67A 3P8JA 3B4UA 4ADSA 1S5VA 3OA5A 1DIEA 3TP4A 4CD4A 3IVTA 2WLZA 1IIGA 3FSTA 3QY7A 4UTTA 4EX4A 3RUBL 1YPFA 2J75A 4A8IA 1ONRA 5AECA 4W4QA 3TC7A 2FZMA 4JTUA 1UD5A 5C5YA 1IT7A 1UR2A 1JPMA 5BMXA 1B57A 1SM9A 2FHBA 2D2HA 4QNWA 4TIMA 3VMOA 2X2GA 4JIRA 4OE7A 3V75A 4S38A 3NZGA 1A5NC 4GO9A 2VEGA 3W02A 5FJIA 3W6LA 4TMBA 1VCGA 2G5WA 1CNVA 4RDZA 3MO4A 3TVAA 1SJDA 3A64A 5A1AA 1XKJA 3CUHA 8RUCA 1A5KC 2BOFX 1GQJA 4PUJA 1SJAA 5LSMA 1PWLA 1J2WA 1ZENA 2AKZA 4GUIA 5JUVA 4DWSD 3OBKA 3W7IA 1AFSA 1SO3A 1ZS2A 3WLQA 3VNIA 4PBFA 3V5FA 2ZRYA 1Q2SA 3DFPA 5LHEA 1V02E 4PCFA 4ONVA 4ML4A 1KWKA 1GYLA 4G7FA 3R8GA 3N14A 1PZ3A 3ATYA 1V03A 2DH2A 3LS9A 3KTXA 1XBYA 3T0AA 1EEPA 1SR0A 3GW3A 3U3HA 3A4XA 2JIWA 3CHFA 1OY0A 3SGUA 4OOZA 3CWNA 1AUSL 1G4EA 2WPGA 4GG9A 1UKSA 2A7RA 2YXOA 3B9OA 3E0IA 1KRBC 4E5TA 2FZ8A 1K77A 2ABBA 1FWRA 1P0KA 1ICPA 3ZWSA 1QBAA 1VBJA 5JBEA 3P80A 5DN1A 1VJIA 3R0UA 4OWGA 3RFAA 3UJ2A 3V0TA 3POHA 3VTRA 1XLDA 1EGZA 2PDNA 1WNOA 4ROPA 1QFEA 2W27A 4RDWA 3K4WA 3CIWA 1WZAA 1B3XA 2VR2A 3TYZA 4BA0A 1CGVA 2VC7A 3G3DA 4Z2HA 3LCGA 3KW3A 3SUSA 2NX3A 3HG2A 4HQVA 3WQVA 1EJWC 2Z1KA 2OYLA 1EX5A 2A7NA 5LXXA 4MB5A 4DYKA 2VNCA 1LQAA 3AAMA 3PSWA 3GNXA 4CD7A 4TV6A 2XIMA 3NDOA 2CBUA 1A49A 3MMUA 3MV01 4A4AA 1NOWA 3M7SA 4GI4A 4IICA 4YTQA 5LA2A 2GQ8A 4GC4A 1VD6A 3VGDA 4CN6A 3P74A 1LWHA 4JTLA 5CH9A 2V63A 1ENUA 1J6OA 2QR6A 4G5DA 1KFWA 4UZSA 2FB2A 4HD5A 1TMLA 3H2MA 1R86A 1WDDA 4RE4A 1IE7C 4B3ZA 2ZRXA 3CC1A 3AU6A 4G6CA 4LEQA 4Q4QA 1EZWA 1OIFA 2BLEA 2QUMA 1WV2A 3NOEA 2C13A 2J13A 1EOMA 2X05A 3G1AA 3VGEA 3WK1A 3BCDA 1YDOA 1AH3A 3AWOA 2D2GA 2CYGA 3EX4A 3SN0A 1BXBA 1SFSA 3SCNA 4LNYA 1EHAA 4Y9NA 1OYBA 2PRMA 3SEPA 2D2OA 3USZA 4IJCA 1HXJA 3W88A 4JIQA 5C9WA 4LT9A 1WP6A 1EXPA 3GK0A 1HKIA 2IKIA 4XVDA 1QXLA 2CLKA 3RLUA 1KBBA 2IPWA 4IG2A 4IQEA 3WLIA 3S1WA 1OYAA 2MANA 1UHVA 1F6YA 1XF0A 2WLYA 1EGMA 1XX1A 3V1PA 5G1YA 4DNHA 3MVTA 4C90A 3M43A 2OWCA 1CW2A 2FHFA 3H4WA 1E6RA 2VX7A 4RW3A 4LS1A 3CUXA 3DOPA 4HSHA 2P0IA 2WO5A 4AZ5A 3OZPA 1ESWA 3BGJA 1E4MM 2Q8ZA 1L8PA 4G1NA 2BHZA 3MWCA 4WY0B 2PLCA 5ABGA 3EX2A 1K9EA 1ONXA 3O6CA 2ZZ5A 3PZQA 3VOHA 4C6EA 5A8GA 3P82A 1IV8A 5ABHA 1GKQA 4K37A 1DJXA 3T78A 4PEKA 3DFSA 3ITXA 1ICQA 4FSAA 2X1UA 3MUY1 1LL7A 2E40A 4WXYA 6REQB 5I6SA 4GY0A 3E74A 5D02A 3HQNA 1DBTA 4PMJA 2C19A 2XWDA 1N2VA 4LB4A 1X6LA 5BU9A 3OJGA 1KM6A 2VXNA 3E2VA 3KCLA 2NXGA 4PR4A 3FY1A 5G4EA 1JZ6A 5ECVA 3ZSSA 4OHQA 4GRSA 3NWRA 3F4DA 2NV2A 3CHCA 4M1RA 4EPEC 3GHTA 2J8GA 3P14A 4Q4SA 1GOQA 3GBEA 1OK6A 1F73A 3SFKA 2PDJA 1V5XA 1ZPTA 1ICSA 1EWEA 1UZDA 5EYWA 3VDBA 1NDYA 5HMDA 3EA3A 1TX2A 4BHYA 3SAZA 3CK5A 1WAWA 3WSUA 3GTIA 4H00A 3UNDA 1A3WA 4D6IA 4TXEA 4ZE4A 1PTAA 3VIGA 4ZB2A 1T99A 3S42A 3ZVHB 3TTEA 4Q4PA 3GXFA 1Q4WA 2P50A 3ARWA 3ITCA 4K38A 2HROA 3LI1A 4IIGA 2ZZ7A 1W6TA 5A6AA 3MUZ1 4RUBA 1GOMA 1VEMA 1FDZA 3EWUA 1VFTA 2Q8LA 1QAPA 3NL6A 5F4XA 3SN4A 1G1YA 3CEUA 1RY0A 4L64A 1ME7A 1IWPA 1L8NA 2XN2A 1X8CA 1Q13A 4JD4A 4NY2A 3W2UA 4D2JA 4IP7A 4DI8A 1N82A 3NOYA 3P0WA 2GUBA 2PA6A 3WQOA 1W2PA 1S2CA 5FJTA 3IGUA 4B4HA 2DORA 4REQA 1H61A 4HMDA 3WL0A 3QJAA 4M6PA 1JZ7A 5G4HC 4I9TA 4JIIX 5DXYA 3WFAA 1VS1A 1JXKA 3CZ8A 1SO6A 3VCNA 4HN8A 2VP8A 5G5IA 3PPFA 1NJJA 3VIKA 4AWSA 4HT3A 4B4FA 4PMRA 1H1NA 1W9VA 1D3HA 4BQ3A 2QCGA 3CB8A 4UR9A 2EPKX 2CPUA 4E4FA 3B9DA 1FWEC 1UCWA 4JTDA 3WJZA 3KBNA 1O6IA 3GNPA 1TR9A 3HGSA 5ABFA 2INZA 2YXGA 3GH7A 3UWUA 1M7PA 2DGAA 4HP5A 4NI3A 1E9IA 1JUBA 3ZLFA 1HZYA 3CL7A 4QS5A 5B80A 2WJEA 4OJYA 3KE0A 3A12A 3VMNA 4J1OA 1O68A 3WLKX 1U83A 1YX1A 3TNOA 2ZE0A 5HDRA 2E9MA 4FX7A 3B97A 5I3DA 3EEZA 4QG8A 5DO8A 4F0MA 1XSJA 1K8XA 4LTSA 3G2GA 1W8GA 2GLKA 2YA1A 1OD0A 4JTEA 4P5UA 3FXGA 4AVNA 2PD9A 4E8DA 1GVQA 1UZ4A 4PSRA 4LGXA 1GVIA 4D72A 1M1BA 3N2XA 1HIZA 5H6HA 1N8FA 3H70A 3V4BA 3O2LA 1YNPA 3EA1A 1A5CA 1M7XA 1LCOA 2QCCA 4IPPA 5BRPA 1CTNA 1VFLA 1OG0A 4RCXA 3W7PA 3SN1A 3MMTA 2RDUA 2PGFA 4K6AA 3P2VA 2QIWA 3GKFA 2I5IA 4WR3A 1YNYA 1OCQA 2XN0A 4UC5A 4JQ4A 5K4XA 5I3JA 2E4TA 1O1HA 1K7FA 5C6MA 2OOGA 4H9XA 4MLRA 4XIMA 4D6DA 4P7QA 4ZE5A 4EANA 3VUSA 3VA8A 3WUGA 3LSBA 1KM4A 3S2NA 4O4VA 2VJXA 4X63A 1QNVA 4O0ZA 3TW9A 1MDRA 1EC9A 4IMFA 3NPUA 4BEQA 1EP1A 1QATA 4Q4MA 1RBOB 2FFCA 1T8XA 1F3XA 5I09A 3KBWA 1EJXC 1PIGA 4UNKA 5A6TC 3TCEA 1XW8A 1OFQA 3UG5A 2OQLA 3ID7A 1XYCA 5LIWX 1QHPA 2X30A 5EMLA 4NAFA 2BV9A 5A94A 4C1NA 5JQ9A 1W1B1 1NDWA 2VC9A 2Y7DA 2D73A 3G24A 4ZB0A 2NQHA 4NZJA 2GSHA 5E0CA 1NAL1 1TTIA 1U1JA 3THAA 3CGTA 3AYSA 2W79A 4XAPA 5IFTA 4Q22A 4I7WA 4YYFA 4WRHA 2YDRA 4TOQA 3LK6A 4YVPA 4FPSA 2YYUA 4GYJA 6XIAA 3P62A 4NNCA 5F2LA 1LG2A 2TMDA 1V6VA 3A47A 1J9YA 1PO9A 4Y2WA 1ISXA 4AH7A 2DIJA 5AFDA 4AVOA 3LBCA 4ORIA 2EPLX 4XKYB 4FR1A 4J3ZA 2HBXA 2C6QA 1ZY9A 2QCFA 4DIAA 4E8CA 3EX6A 4GBDA 1A5SA 2JGYA 3VYLA 3WDIA 3PZMA 1ODUA 4OZOA 2QJHA 2RDXA 4WLCA 3VO0A 1MQPA 1P4CA 3FHQA 4UTJA 5FSEC 4LFYA 3CPRA 1ITCA 1DL3A 1AVAA 3B3DA 4MWAB 4PBEA 3WBXA 4HTBA 3STFA 4DUVA 4HPHA 2PBOA 3BDKA 4D6CA 2PDIA 1TVPA 4PMZA 3QMRA 1W5NA 1PYMA 1ZU8A 2OMAA 5DFAA 1P0EA 1OFOA 1R47A 2V0TA 3LMYA 3AICA 4U31A 3NUKA 3OODA 4S1FA 1GQNA 1HNYA 3O3RA 2UWFA 3SCTA 4FOUA 2W92A 3GNRA 4PL2A 3Q4DA 1MQQA 1R38A 2OGJA 4D6HA 4N9DA 3I7RA 4MDPA 2GJRA 2AGTA 1XRVA 1EKOA 1E3ZA 2DT1A 2J9XA 5BOFA 5GJPA 1UR3M 2Y1HA 4L9XA 2OO0A 1F07A 2E67A 1H4PA 3P84A 3WEZA 4KEZA 4Q33A 4HNCA 3N3TA 4H8HA 3C2VA 4N42A 3CHDA 4NNAA 5JH2A 4OV4A 4XKYA 5MKGA 4JY9A 3W7NA 4QP0A 1FHUA 3CV2A 3WD2A 1S1RA 4JFTA 1HFBA 2VMFA 1WB0A 1Q2RA 1H51A 1KGXA 3CV1A 3NPXA 4M0XA 5G4WA 4DZAA 2PC4A 1UKPA 3MPGA 2QDEA 3H7RA 4AXKA 3SRHA 2E6FA 2WMJA 4YJ5A 3AMCA 3RPDA 2OELA 3ZOAA 3P3BA 3QEZA 4UTIA 3ZWTA 2OZ0A 3RR1A 1I2OA 3S2JA 4CGTA 1W1ZA 2REQB 3PFRA 3DFOA 3QW4B 1DKWA 2E5DA 6TIMA 4AZCB 2PDLA 4GVIA 3QLDA 4PMXA 2F8QA 1WBJA 3FOKA 3LA4A 4FLSA 2WCGA 3MT1A 1P0NA 3NQVA 2E6AA 2DUZA 1JQVA 2O9RA 4JN6A 1PHWA 1BQGA 1N7KA 4GJ1A 5KEZA 2BSLA 3KHDA 1KQZA 1IR2A 3M5VA 5EB8A 2GSJA 3F2BA 4H04A 4MADA 1H7WA 2E6DA 5AKQA 2ZDSA 4WEVX 1TWWA 3MHFA 1BQCA 1LG1A 4W8AA 3F4WA 3IGHX 4RZ4A 3E38A 3G1VA 3AIEA 4PEEA 4H6RA 2IPGA 4HCDA 3RK8A 4ZZ9A 4C6CA 2F6UA 1IZJA 3AROA 4RDYA 1HO1A 2QULA 2J8FA 1T6MA 3QPZA 3WNMA 2CW6A 2KAUC 3BW4A 3P60A 5C9ZA 4M56A 1LF1A 1UKTA 3OLDA 1UA7A 3M0YA 3TONA 5TBOA 4QQUA 2PURA 5G2IA 3EOLA 1V3IA 3NYDA 1XLMA 3BK0A 2QS8A 3ENLA 3UNTA 1WCGA 1LLZA 2DZVA 1VHNA 3NQ7A 3N15A 2E0PA 2Z4GA 1Y8BA 3TWBA 3RF9A 3BZJA 3GTNA 3WN6A 2HBVA 3LD5A 2G0WA 4FEZA 4U3CA 4KEUA 3B0PA 2ICSA 3GU2A 2PP1A 4FXRA 1E55A 3MYPA 3VNDA 4GE8A 1OC6A 3GAKA 1NDZA 3KLLA 4I7UA 4BQ4A 2BVTA 3VOIA 2Q09A 2CNCA 4IT1A 1AA1B 1R3RA 3K2GA 1F76A 1SFTA 1G69A 1SSGA 4DYJA 2HXUA 3EDFA 3ITYA 1IXPA 3GG8A 2BVDA 2F38A 4GZ7A 5GJMA 4GVHA 3AIWA 3VIHA 4IGHA 3G8EA 5K9CA 2Q02A 2WBGA 1RVGA 1J79A 3B0VC 4XUYA 3LCLA 5AZ0A 2G8ZA 3AJXA 1QOXA 3LXBA 3ES7A 2PLMA 5DMNA 3OEXA 4GZEA 4X60A 4XSLA 3KRZA 3CTTA 2F6XA 4CU7A 5FAJA 2VFHA 2HVNA 4HGXA 1RPKA 4DBUA 3I6EA 1EYWA 1C91A 2OQYA 2V5BA 1OADA 1ADOA 3UYCA 3SGZA 3L23A 3SUTA 3DI1A 2VVNA 3LM3A 2HISA 2VGFA 1PX4A 4JFWA 4US5D 3SW6A 2QLYA 3IJ8A 2C91A 4KH2A 2BOGX 1WO2A 2ZTJA 2EPNA 3PS7A 3D3AA 3RNDA 2C1HA 3UA3A 4L1WA 1UWIA 4B3LA 3M6DA 2E9LA 2UY2A 1UWAA 1G6CA 4O1FA 4PTXA 2ZX7A 2E77A 4FO4A 3I4EA 1US2A 4UQ9A 4L6DA 4C5YA 3S1XA 4LVGA 1E73M 1CBGA 4MJ2A 3W23A 3LNPA 4A22A 1MW3A 3CMGA 3KX6A 3KTSA 4JX5A 4JTHA 3TC6A 1EO5A 4K2SA 5AYYA 3G6LA 4CQBA 1PXGA 4QLLA 3LDVA 1Z69A 2V3FA 3KL0A 3RILA 4NKCA 2R24A 1LLOA 3PB0A 4B5SA 3KCJA 4NI8A 1FFQA 4R33A 1TV2A 4CCZA 5DT7A 5I24A 1PYFA 4I7VA 3VOCA 1JNEA 3Q58A 5I79A 3FJ4A 1JJKA 3II1A 2ZXAA 1ISVA 1V7YA 5CGQA 2WHKA 1Z8AA 1QOQA 3MP3A 5D2TA 3WEOA 1E6QM 4UQEA 4LVFA 2PZNA 1Z44A 3AXMA 3HGJA 4PB5A 5D2VA 4IJBA 3NGFA 4LAUA 1RQHA 3NA8A 2PTYA 3NQ6A 4XX6A 3AS3A 3W1NA 1BTMA 2I14A 2CLLA 3NZQA 4JTGA 4KFPA 4RL3A 1J18A 4MVAA 1C8QA 3PSVA 1EUAA 5FD0A 4PRWA 4AAJA 1HJXA 3IV3A 3KP0A 3MO7A 4JX4A 1D7FA 1GVEA 1V6TA 2WZMA 2XYLA 4I8YA 1CGWA 3M6YA 2OWWA 1IGWA 2X0SA 3KUMA 2CLEA 4P7OA 3P81A 1W9PA 3TA9A 2VRQA 2ZZ6A 5BNKA 2WC4A 3LBMA 3F4CA 1F3TA 4UZUA 3O15A 3IAPA 2Z1VA 1EJSC 3FYPA 1BF2A 4UOJA 4A3HA 2NVAA 4BF9A 4TVCA 3CB3A 3ABOA 1XCFA 2Y85A 4LBSA 5EBAA 4HOXA 5JBFA 4ZOEA 2VCAA 3GC4A 4WD0A 2VR4A 4DYEA 3BLEA 4QQ3A 4OECA 4WKHA 1UR8A 4IOTA 1P6WA 2Z7GA 4GI6A 3HFYA 4NZ3A 1KM5A 4JR5A 4DY1A 1NDVA 3STCA 4IWWA 1CI1A 3CUFA 1OCNA 1JR1A 1FP8A 5JH1A 4H2HA 1OSEA 2V3GA 3QN3A 2CC0A 2OQHA 3R13A 2Z1BA 2VZSA 2E6YA 4UQCA 3B9EA 1W17A 1IWAA 1KXQA 1QPOA 4HHMA 5CSUA 2DQWA 3I7QA 4AWUA 3VFCA 4ACZB 5GQBA 4F9JA 2VR5A 1AZ2A 1QW7A 5JBDA 1P1MA 1KCKA 2ZADA 4HHLA 5E0FA 4CCCA 4FNQA 3AWNA 3CNYA 1DPMA 1MNZA 1N55A 3GB6A 3W53A 2PWUA 4LX4A 4KPLA 1QPNA 3HBLA 1I6NA 1XXXA 3GM8A 3LCWA 2C1IA 2YIHA 3BSHA 4X9YA 3WLRA 3ONBA 1A5AA 4HJWA 2OSWA 1BG4A 4ZO7A 4XAZA 2VCBA 3KRSA 5HNUA 2O4MA 2PDBA 3FEMA 3QPYA 3LOTA 1GW1A 3KZSA 3B03A 3VOJA 1E15A 2WCAA 4JNZA 1DTNA 3W74A 1JCYA 4PYSA 3U0HA 5EMMA 1M41A 3GE7A 3SY1A 4NASA 4MFEA 2G4JA 3WLPA 3KDOA 2AL2B 1TRIA 3ZVIA 5E1QA 1CGTA 1W9UA 1ISWA 5LZLA 3VIOA 5CGTA 3SQSA 1PL9A 4LRTA 3KVKA 3NYZA 4MLJA 1S5TA 1GJPA 3GYEA 3UQNA 1WKFA 3PVFA 3I10A 2BXZA 4KESA 3A22A 4H6QA 3PR2A 4FLRA 4BWLC 2HK1A 4AIUA 4O52A 4GQQA 4XAFA 1Y65A 1SZEA 1HUVA 2WCSA 4MNKA 3UZ5A 4LVAA 4WY0F 2AAAA 4PMVA 4E38A 2CKSA 4C6MA 3NZRA 4ZEPA 4L80A 4GQBA 5AC4A 1SR9A 4KCVA 5A95A 4D8ZA 4HMCA 2FMNA 2YR1A 1KQYA 4XK2A 3ARYA 1ZBCA 1SJCA 3EA2A 1SW3A 4ZBCA 3PBWA 1R7OA 2P8CA 4Q4OA 4LQ1A 1XIHA 1GPWA 3SJNA 4GYPC 2V5DA 1FRBA 4AY1A 1UC5A 1TZ7A 4FF5A 4PFHA 2NW0A 2GVYA 1DWJM 2GK1B 4I6VA 3GDMA 3W38A 1KB3A 1GGOA 2FPVA 4D8AA 4HSNA 1GYMA 1C93A 4LU0A 3RPMA 4LNCA 1B3YA 1AG1O 3HPXA 3OGSA 3VDAA 2HE5A 2VQUA 3BWWA 5BYWA 3W7HA 1ZNNA 1MW2A 2CHNA 1P6BA 4YMZA 5D9PA 3PULA 1IIHA 3GY1A 4O16A 5D9NA 4IJRA 3EDDA 2I9EA 1SYTA 1WDRA 1DEDA 2FHCA 2Y89A 4O1DA 3SSZA 3M5XA 1XLEA 1GT8A 4O1AA 4CCEA 5FL1A 1W5OA 1REQA 4L61A 5XIAA 1X6NA 1W5PA 1XLIA 4NVTA 4M81A 1RP8A 1UH3A 1UBPC 2DSVA 2R8WA 2PSNA 3TFCA 2IPJA 4JAWA 3BLIA 1J2BA 1OQFA 2ODOA 2PWHA 4HJFA 4WKAA 2X1IA 1QI4A 5C2GA 1CGUA 7XIMA 5AHIA 4QJ1A 1DVJA 4LAOA 1I4NA 3DHDA 1UQZA 3VIMA 1W3TA 3TIMA 2ZE3A 1Z7AA 1TZ9A 1US0A 3MMWA 3GVGA 3M7WA 2G3MA 1F6PA 2FGBA 2YCLB 3G1HA 4IUGA 2YCJA 4P8UA 3MSGA 2J6VA 3BVJA 3UZWA 1NIUA 3OIXA 1GUVA 2PGWA 2YZ5A 4NQ1A 5I3GA 2OX4A 2HMCA 1TCMA 2ZA1A 4Z17A 2CBIA 4DF1A 3N17A 5ENLA 3O16A 1F05A 1DJWA 2MNRA 3LXAA 4DPQA 4Z1AA 5CGMA 1UBSA 3IJ9A 2FH6A 3BAXA 3EWXA 1LROA 4JCLA 3BMVA 3W7RA 3F4VA 2X41A 4DXVA 2GL5A 1UIOA 3DC0A 1GK8A 4S3JA 1RBLA 2TRSA 3VOGA 3VM5A 1FH9A 1V8EA 4TUFA 4WQ6A 1QNSA 4B9YA 5DCEA 3VNJA 5AY7A 1ZBKA 2XZ7A 1EC7A 3ZJKA 2A79A 3MUIA 4H4IA 2E1DA 1QNPA 3N9RA 4U4MA 4G2DA 4WIWA 2J7HA 2Y70A 3GXIA 1GVFA 4OUEA 5A8OA 5HANA 1F9CA 3RLGA 4A8RA 3LQLA 3KAOA 3VX1A 3E0WA 4P7RA 1TR1A 2GSEA 4H7CA 3E0FA 1CT5A 1T7LA 3CUJA 4AHPA 2A5HA 2XSAA 2EKGA 1U33A 3L7RA 1BXNA 5CC3A 3QHNA 3H12A 1V0LA 2ZC1A 2VX5A 2YCLA 1KNWA 4IMEA 1NWSA 3BV4A 1EIBA 3HOJA 2QUNA 3OW1A 4Q8QA 9RUBA 4JZ5A 5F2GA 2F7FA 1NELA 2Z00A 3OG2A 2XWEA 1I0BA 1QOPA 3SCPA 4QLJA 4S2BA 3L0KA 4BI5A 4HZMA 5I78A 5EMYA 3E0LA 1XICA 3QMSA 5CJ5A 4L9YA 1HG3A 2XGIA 3THQA 3W1PA 3LTSA 1E6NA 1TPVA 3P8IA 4HZ7A 3S5NA 1GG0A 3IGSA 2WYSA 3TXZA 1IEWA 5CPLA 4GI9A 5HR6A 4KFNA 3O6YX 1TCDA 2CHOA 3B9NA 3GFZA 3DU0A 2V3DA 2XINA 3I3DA 5KZEA 1V3KA 2PWDA 1KBJA 4B3KA 1ITUA 2OG9A 1HJVA 1M03A 2W3ZA 4PN2A 5CAHA 3CLWA 3IIPA 3SADA 1UWUA 3OVPA 3CZEA 4QE5A 1XLAA 4N9EA 3BJSA 2Y5JA 1LQ2A 1OT1A 2EGZA 3D5HA 1KBLA 4ZQPA 3AIQA 1J93A 2ZCGA 2OLSA 2FJKA 2QUTA 3HPZA 4E2VA 1XC4A 3L65A 1VYSX 4PMDA 9XIAA 1X7IA 1PTGA 3W2KA 4LUJA 5AYZA 1JI2A 1S1PA 1M65A 1GVRA 1W32A 5LXEA 3F7JA 4LXFA 1U2YA 5CBJA 1OC7A 3CU2A 5FJPA 3S5SA 4EAMA 2NX9A 3M47A 4AU0A 2FZBA 3NNTA 5FF0A 4DJED 1GTEA 1TVLA 4MKNA 4KWUA 2W6RA 3FGCA 4ZTYA 4MZYA 1J0ZA 3ABZA 4GH1A 3LX9A 1E70M 3H2FA 3HN3A 1MXSA 2Z25A 3W9ZA 2VFDA 4I5XA 3TYDA 4JXCA 1GQKA 2RH9A 1KXHA 1H0IA 1ISZA 1F5ZA 1K8CA 2RDWA 3V1HA 1S38A 2EPMX 1E4NA 4QEHA 1OT2A 3UU0A 1Q6CA 3M16A 2YDSA 3DFQA 4AD4A 1HVXA 1S46A 1PZ2A 5DANA 3EWYA 1ALDA 2XH0A 2YCIX