4ICNA

Dihydrodipicolinate synthase from shewanella benthica
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
300
structure length
300
Chain Sequence
ESWGSHMINGSIVALITPLNSDGTVDYTSLEKLVEYHITEGTDAIVAVGTTGESATLPISEHIAVVGQTVKFASGRIPVIGGNGANATAEAIELTKAQNKLGVAAMLGVTPYYNKPSPKGLIAHYTAVAASTDIPQILYNVPGRTAVDMLPETIAQLVEVPNIIGVKDATGDVARVKQLRDLCGNDFLLYSGDDATAREFLTLGGDGVISVANNIVPKLFKLMCDAALAGDTQAAMAAEDQIKGLFSALFCEANPIPVKWAAHKMGLISQGDIRLPLTELSTEFHGLLLDAMKNARIEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cold enzymology offers insight into molecular evolution in quaternary structure
rcsb
source organism Shewanella benthica
molecule tags Lyase
molecule keywords DIHYDRODIPICOLINATE SYNTHASE
total genus 102
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4icnA00
4O1BA 2PRMA 3S0CA 1PIIA 3LCWA 4N6EA 4EIVA 5D02A 5I3FA 4JIPA 1G4PA 3LCFA 3TAOA 5HQEA 1L6SA 3NQMA 1KTNA 1RQHA 3S5OA 4IUOA 3PAJA 2C18A 3KX6A 3VCRA 1WX0A 3TW6A 3E12A 4MY1A 5DY3A 5FF4A 3NR0A 3V1PA 3BG5A 1A53A 4M6PA 2Y7EA 2A7NA 2OMAA 4OV4A 4UR8A 4I7UA 3BLIA 1QPQA 3PM6A 3WK3A 3EX6A 3BG9A 1QPNA 3STGA 4M5PA 3B0VC 5D09A 1GOXA 3MBFA 4FNPA 1JUKA 2QCEA 3HGJA 4YCPA 5F4XA 3DHFA 4LOCA 2CZ5A 4FNRA 2E6YA 4CCDA 1WBJA 1IF2A 4XKYB 3LBCA 4ONVA 2Z0IA 1RQBA 1TJRA 3N9RA 4DXVA 2CLEA 1LLZA 3NL6A 3HG2A 2ZFAA 5CZJA 3GDMA 1TPVA 2ZRXA 4Q33A 3P5ZA 4HPJA 3IIXA 4EF8A 4O19A 3HQ1A 5CPMA 4YL2A 3W1QA 3W2KA 3H54A 4XKYA 2E6DA 5FF3A 3TQ0A 3PWAA 5CZSA 4KKXA 5K4ZA 4OT7A 4JR5A 4AMAA 2QCMA 1WQ5A 4KWVA 3PSVA 4AAJA 3BPWA 1OFQA 1WAUA 3NPXA 4BWLC 4QM1A 4NU7A 1F7BA 1U5JA 1G69A 5FF7A 4Z0JA 4NUWA 2YYUA 5K9DA 3HIJA 3EWBX 2ZZ3A 3QJAA 4GXMA 2V5LA 3CC1A 2GJLA 3L66A 1SO3A 3EX3A 3GYEA 1G7VA 2WNQA 1X1ZA 3G0XA 3DKJA 3IGUA 1ADOA 4LWWA 4UUIA 1ZENA 3LCLA 4K37A 3KFTA 5CPOA 4NZFA 4JDBA 1F76A 4O4VA 3LBMA 4GWEA 2QJGA 1SZFA 4O1DA 1OF8A 4UIOA 2G96A 3HPXA 4LY8A 3W2MA 3CT7A 3FJLA 5BW6A 1DBTA 3W73A 1F6KA 2NX1A 1LBFA 4OQVA 2E5BA 2QCDB 4LVGA 5CSRA 2QDGA 4ZVJA 3AJXA 4MPQA 1KW1A 1TPEA 2J9YA 1D3GA 3W1TA 3NPWA 4X9SA 2CLIA 4DELA 1VJIA 4Q32A 1JJKA 1OX4B 1UB3A 1PCKA 1MO0A 3W07A 4DF0A 2VFFA 4XBSA 5LGXA 3M6YA 3DH7A 1KM6A 3RF9A 1KFLA 4HPXA 1AW5A 3PB0A 4Q4KA 1Q6OA 4NJGA 1BWLA 5A8GA 5CZTA 5IM51 3N19B 1T99A 5I3JA 4C1LA 1KFEA 5GVJA 2ATSA 2Q3OA 3GAYA 2EKCA 3LI1A 4GUGA 4QNWA 3W22A 4Z1CA 4TR9A 4K36A 4JYDA 1ZAJA 5AFDA 3F4WA 3NQ8A 4Z1BA 2P0OA 1ZJIA 1G4TA 4TU1A 1NSJA 2V81A 2I14A 3KOFA 3PBVA 2ALDA 1AMKA 2NV2A 1NF7A 1ME7A 1SZEA 2ZRYA 4ICNA 1G4SA 3TKFA 3LHVA 2H3DA 3RLUA 2H3BA 1A5AA 2EAWA 1TQJA 1ZHAA 3T78A 3GDTA 2BTMA 4O28A 4WOZA 4JTSA 4IMEA 2E1DA 3P81A 1PE1A 2GQ8A 4IMDA 3Q58A 4DO6A 4FHAA 3B8DA 3MYOA 3A21A 1XXXA 1ZY9A 4LUIA 4R33A 5E1QA 1BTMA 3W7IA 4WJEA 4AXKA 2CU0A 3W76A 3M5YA 3DHDA 4XWUA 3ABOA 5IBXA 1DJNA 4XUGA 4FNTA 1RV8A 1TRIA 3R13A 1H1ZA 3BW4A 3NG3A 3NQEA 4FX6M 2YW4A 4YCOA 3KRSA 2OT1A 2DZSA 3QEZA 3R8RA 1GVSA 3W7HA 3DFPA 4IJBA 3GKFA 3P61A 5A5WA 4MVAA 3W7RA 4R34A 4NX5A 4TMBA 4UFJA 1XC4A 1IGSA 3GXPA 1GWJA 2WSYA 5G2IA 3DXIA 1TQXA 3ELFA 2YSWA 4E2BA 3GZ3A 1QO5A 1LOQA 3KVLA 3QQ1A 4LVFA 1VHNA 1DKWA 2ZZ4A 1VC4A 1AL8A 1JRCA 1OJXA 4BI6A 4ZQCA 3W7CA 4TMCA 1W8SA 2ZZ1A 2QJHA 3ZWTA 3KVJA 4FF7A 3W83A 1T0OA 3TROA 2A6NA 2CWNA 3HG3A 5KSWA 4GRSA 1J2WA 5K4XA 2EGZA 3FIGA 4IMCA 4P2VA 3C2OA 5EKYA 3SSJA 1SR9A 2VEIA 2Y70A 4AHQA 1YTDA 3G1AA 2CLFA 1TPFA 4Y96A 1UASA 1VLIA 4Y90A 2X30A 1TO3A 4UCGA 5FF2A 3F1QA 4KFNA 1B9BA 1FXPA 1X8FA 2NZLA 2YXGA 3G1VA 4NJJA 3L0KA 3W88A 2XN0A 2ZA1A 3MBDA 4JYEA 5BRBA 4S1FA 4ML9A 4JIQA 1TPB1 4KFOA 4DBDA 2CZDA 3MO7A 2D73A 3L67A 2CLHA 3EX4A 4A2SA 3G1DA 5F2MA 3TMLA 4PODA 3P84A 1YYAA 1QOPA 2V9DA 4RLIA 1O5XA 1FDZA 2O7SA 4WD0A 1TTQA 3HG5A 2DZTA 2GVLA 4R7JA 3GX9A 4MY9A 2YR1A 2VFGA 3RLVA 4RKAA 1W31A 1GTHA 4UMCA 4O0KA 3NPUA 2YZRA 4HNNA 3JS3A 1H1YA 4ORIA 5CGQA 1G7UA 2Y62A 1HO1A 2DZXA 1PVNA 3CLMA 5MHBA 3NQ2A 4FXRA 5L6UA 1SO4A 3UQNA 1J4EA 4PH6A 3MYPA 5AYZA 3QM3A 3L65A 3DZ1A 1OYBA 4LT9A 4OHQA 4DF1A 4E2DA 3W7PA 2BZNA 1ZALA 3LTPA 5U7SA 4UTKA 1I8JA 1RZMA 2PCQA 4O1CA 3CEUA 2G95A 1K7XA 2LLEA 1LOSA 3N14A 3ZFHA 1TCDA 3DBPA 1QO2A 2NUXA 3A5VA 3JR2A 4MZYA 5DXYA 3TC6A 3LLDA 3G3DA 3G8RA 1OFRA 2VEPA 4FIQA 4XTDA 3TDFA 3TR2A 3ABSA 3WJZA 1TTJA 5HR7A 3E0IA 1XCFA 4AWTA 4BK9A 2ZRWA 1Q6QA 5D2XA 2HSAA 3W1NA 4CQ9A 3Q2DA 5E93A 2J6XA 4XZ9A 1W5NA 2CZEA 3M47A 3P5YA 3L5AA 1KFKA 3LHUA 2V30A 1XBZA 1LROA 4I7WA 4ZMGA 1PHQA 2W79A 3GAKA 4UFMA 2QDHA 3S9YA 3W2LA 1LBMA 2Y63A 3THAA 3WK0A 2QCLA 3UPBA 4UFHA 3S5NA 3LRLA 5LNVA 2PRLA 3CIWA 4DO5A 1EB3A 4QAIA 4TX9A 2I9EA 4JTIA 1J5TA 3IRDA 1LRNA 3TSBA 3W6YA 1FY6A 2OT0A 5DCDA 1O4UA 3C2FA 1FWRA 4X2RA 1W3TA 3P8IA 1LLWA 5FEPA 4GUIA 1ONRA 3PB2A 3UY8A 3WFAA 3KXQA 5D37A 1EP3A 1R2RA 1W5OA 3WJSA 4UNLA 1EP1A 2VOMA 1WYIA 1W5MA 4HSNA 4RZ6A 2V82A 3TQKA 2QCGA 3RNDA 3W1AA 1QFEA 1O60A 4LW7A 3UZ5A 5KINA 1VPXA 4NJKA 1FBAA 4DBEA 4WX2A 4C1KA 4QQ3A 1XDLA 1LCOA 4UMBA 4JTFA 4MUZA 3TAKA 2HS8A 5HUOA 3BARA 1QAPA 4K38A 3UD6A 3LXBA 2CW6A 3W1MA 3NM3A 4JICA 4GUFA 3RMJA 3QMTA 2A21A 2JKAA 3TSDA 1XL9A 3E49A 3PULA 3T40A 4O52A 3K30A 6TIMA 3UWUA 4B5NA 2X1TA 3S5ZA 3S42A 3EWWA 4Y8FA 4IXHA 3E96A 1AL7A 3STEA 4QNEA 5D2TA 4ADTA 2EHHA 1S5TA 2ISVA 1S3HA 2QKFA 2VKZG 3A9IA 4FNQA 3BO9A 2YFNA 1MEWA 1NVMA 4NJHA 1OX5A 1GJPA 3T44A 2DZVA 3B06A 3NVTA 4HHPA 2NXHA 2QAFA 4EWND 5FEZA 5BNKA 3M1ZA 4MFEA 4LNYA 1DOSA 3EKLA 3W23A 2TMDA 3LTSA 3RU6A 1TSIA 4E38A 3QSRA 3SGZA 2TPSA 2VEKA 4IPJA 1QOQA 3T7VA 4MIMA 2VENA 4MZ1A 5BMWA 1C29A 3DI1A 5SWUA 2ATMA 2CZFA 4O4WA 1QNVA 2DU2A 4O57A 5FESA 2GUUA 1WOBA 2NXIA 3PBWA 3U8GA 2R91A 2ZQ0A 3TJXA 4W9TA 1R2SA 3HBLA 4X22A 1CI1A 3W3OA 4FNSA 2ZTJA 1OFDA 4RV8A 3W70A 1YPFA 3C6CA 1T96A 2UV8G 5EY5A 4GUHA 3NPVA 5G1YA 4FB7A 3W84A 8TIMA 4N9BA 1TPC1 2BXVA 2KZHA 3JRKA 4JTLA 3SJ3A 4K7VA 3WK2A 4N9EA 3S8HA 3UWYA 3HOJA 4CQAA 2QR6A 2ZRUA 5CPNA 2WJZA 2R14A 1AG1O 3HPZA 3QFEA 1KM4A 2NUWA 1H61A 3BVJA 3IVTA 3W7MA 2BSLA 3IIPA 2RDWA 2V0TA 2XFWA 3B05A 3UZJA 4CNOA 3RFAA 5KZMA 3LOTA 4N2YA 2V2CA 5LSMA 4O16A 3U2OA 3V75A 1L9WA 4JTKA 3C0JA 1SO5A 3HF3A 3PVFA 2RDTA 1GEQA 1Q6RA 3NO5A 5D33A 3SW6A 3OVPA 3FS2A 1MXSA 3LM7A 3UXAA 4O15A 4JX5A 3IEBA 2P1FA 4G1KA 1SU5A 4N6FA 2JGYA 3PF3A 5AYXA 1YDOA 3I7QA 4MJMA 2A7PA 1Z48A 3SGUA 1OFOA 1KFCA 3HG4A 4ZQMA 3M43A 2OCZA 4ADUA 1I2OA 1Z42A 4GNJA 3L2IA 4NNBA 2VEMA 4M6VA 4H3DA 3L9CA 4ZQOA 3C4UA 1GZGA 2NLIA 5EYWA 4P61A 1K7FA 2NX3A 4LRTA 1YXCA 2ZA2A 4PTNA 5J5DA 3W7EA 4OBTA 1JQXA 2DZPA 2TRSA 3TIMA 2JKPA 5LNRA 4PCFA 3SECA 3F03K 1QWGA 2PC4A 1ICQA 3OHIA 2WSQA 4BF9A 3PUEA 1I4NA 3KVKA 2YW3A 3O1NA 1U83A 3O05A 3EWUA 3IIZA 3TX9A 3P82A 2H90A 1Q3NA 4N9CA 2QCFA 3LCHA 1W3NA 3L68A 1YTKA 2Y7FA 3W2UA 1MSSA 1Y0EA 1EX5A 4RJEA 3WJYA 1IXNA 3M7WA 1EWEA 4UC5A 1UCWA 3IGXA 4QIUA 1X7FA 4K6AA 3C56A 3TE9A 1W3IA 3FKRA 2J9XA 3LCGA 3R12A 1IXQA 2BLEA 1H63A 5AC6A 4LC6A 5D32A 3PUDA 1Q45A 3W74A 3GKAA 3M5ZA 2ABBA 1FUYA 3OVRA 5LKYA 4Y6GA 1H51A 1SW0A 3VE7A 5C5YA 3W72A 3ATZA 1QDSA 2B7QA 1GPWA 3PSWA 2H8XA 1HL2A 4FX7A 1YXDA 2NUYA 3A23A 1W5PA 3TK7A 5HR6A 3IVUA 3N2XA 3ABQA 1SFLA 3EWXA 2GPTA 3FKKA 3NZRA 3WJXA 3A5FA 4DPPA 4IOTA 1OYCA 3W86A 4LV9A 5G4EA 1DORA 4UNKA 2FPVA 1EPXA 3ZS4A 2YGYA 1Z41A 4O10A 2DZUA 5AHLA 3B03A 1YXYA 1AK5A 3M9YA 4O50A 1MZHA 1TV8A 3FYOA 1F73A 4S2BA 3CWNA 4AEOA 1XUZA 2PRHA 4CNPA 2C0AA 2C16A 3KRZA 4N4PA 1G67A 1YDNA 4X3ZA 3G1SA 2Y7GA 1OX6A 1XFBA 2YX0A 1K3UA 3I7RA 1O5KA 1VCFA 4EOUA 2WQPA 1K8XA 1GQNA 3BV4A 4DEFA 4MY8A 3BW2A 3DAQA 1W5QA 1DHPA 1LZOA 3OG3A 3H53A 3DFOA 4AH7A 4UTIA 4K7YA 4CQ8A 3TFCA 3FA5A 1OX4A 2V5BA 2Q8LA 5F2LA 3DGRA 4AHPA 5KZEA 3THQA 2X16A 3LDVA 3NAVA 4S2CA 2BWGA 1D9EA 3TMQA 4NT0A 3C2RA 1JCMP 2E5DA 3ZR4A 3DKLA 4HT3A 3NQ7A 2ZRVA 3S1VA 2QCCA 2ZZ6A 1KBJA 3C2VA 4MJZA 4R53A 2JBMA 3L0GA 2Z2UA 3USBA 4ADSA 3CB8A 1I2RA 2XN1A 3STFA 5CZ0A 3PS7A 3W75A 5IBXC 2JK2A 3CM4A 3TUUA 4Z08A 4OE7A 5EMUA 1TV5A 1GVOA 3P74A 3GXNA 1THFD 1JVNA 4HN4A 3TCEA 4UFKA 2JKEA 5HWJA 2DP3A 3HGSA 4JTEA 1WOAA 3VE9A 2GQAA 3N34A 1W56A 4O18A 5I3HA 1ZNNA 2OJPA 3M0ZA 2V8ZA 4UTUA 3O6DA 4MLJA 4O1AA 2A4AA 3TC7A 4K39A 3W7GA 3LHYA 1SZGA 2RDUA 2ISSA 3OA3A 1JRBA 1IIHA 1UUOA 4OWGA 4LUJA 4JEQA 5E0KA 2G5WA 3A22A 1B4KA 1XBVA 5I3IA 2W0UA 2FDSA 1H7PA 4RXFA 3W7KA 4A3UA 5CG7A 1BWKA 3LRKA 5BOOA 3U6WA 4DPQA 1KM3A 4LVBA 3W7LA 1W37A 3QRHA 4YMZA 5TIMA 2JGQA 2WPBA 3PBUA 1VYPX 2X1RA 2ZYFA 4PFMA 1VQTA 1EEPA 5HJLA 1QMLA 3QMSA 4GE8A 1AW1A 3UYCA 2Y7DA 1A5BA 3CQ0A 2FIQA 4HIBA 1YPIA 5HNRA 1LM1A 1EIXA 5I3KA 2WNZA 3BGGA 3CIXA 3TSMA 2C1HA 3LCIA 5DELA 3LI0A 3BW3A 3W7DA 3MI6A 2E6FA 2X1UA 1F74A 4JTTA 4LS2A 2C6QA 3P67A 1DQXA 4LVAA 2FFCA 4AWSA 3LB0A 4XTIA 3HB9A 3GIYA 3W7QA 5LHFA 1B4EA 4XBKA 5CPLA 3FEMA 2NWRA 1W54A 3QW3A 3MW7A 2CLKA 2ZTKA 3P7YA 4N9DA 5K2ZA 3Q94A 3NL2A 5G2WA 1M5WA 3L5MA 2FTPA 1UBSA 2Z6JA 4NZJA 1F2JA 3W7NA 3WK1A 5EL1A 4UR7A 1MEHA 4JX6A 4JTHA 2EF9A 2IQTA 1SO6A 2ZZ5A 1NF0A 3GDRA 1GT8A 1JCXA 1FXQA 3PBYA 3NL3A 2C14A 4EVZA 3FFSA 1SPQA 4KWWA 4UTJA 1B57A 3G8EA 2Z1BA 2X2GA 3CWOX 3O15A 2B4GA 4FO4A 3M5XA 2VFHA 1W0MA 4N4QA 5D05A 4O14A 2QUTA 1TTIA 1LBLA 3LHWA 3GDKA 4AB4A 3W85A 4RZ4A 3NQ6A 1B3OA 3LLFA 1ME8A 1YLVA 1VLWA 2WV8A 1R2TA 1TMHA 1VH7A 4Z1DA 4GJ1A 5D2YA 2VFDA 1GG1A 1I45A 5AHNA 1UUMA 1FX6A 5AN7A 1SUXA 4AVFA 1OFEA 4RR4A 3QZEA 4BWLA 5LNSA 1HUVA 2CLMA 5FEXA 3L5LA 3OEXA 4O12A 3AO0A 3NDOA 5DCBA 2J24A 4MYAA 2VELA 3INPA 3GLCA 2QF7A 2H6RA 3GK0A 3QMRA 3QPZA 3W1XA 4MOZA 4OGZA 1KM0A 3GNDA 2RFGA 3BLEA 3W1UA 1FQ0A 1TTPA 5DBUA 4ORMA 4O0ZA 1K03A 4IQLA 2ISWA 1WDWA 4IMFA 3GR8A 1TPWA 1HFBA 3LV6A 3DFTA 2P10A 5G5IA 5CSSA 2DORA 3MUXA 4FXSA 2C13A 1ZAIA 4POCA 3H55A 1JULA 2ZDRA 1OVDA 3I7SA 4AF0A 3LERA 3HO8A 3EEGA 1G6CA 2NWSA 4NJIA 3EX2A 3NYZA 1VZWA 1ME9A 5AB3A 3NXFA 2B7PA 4IGHA 4IX2A 1P1XA 4WQ6A 2R8WA 2CFFA 1FCVA 1PHWA 1PV8A 3SY5A 2ZZ7A 4JYFA 1OK6A 2J88A 5HWNA 2GVJA 3BGJA 4WUIA 3DFSA 3MI3A 4JD4A 2WOQA 1V7YA 3W71A 5F2GA 2B0MA 2BX7A 1C9DA 1FWTA 4IXXA 1P0NA 2E68A 3EB2A 5CKSA 3UWQA 3PG9A 5G2HA 3MHGA 3ABRA 1JQVA 3UWZA 3KVMA 3KRUA 1XBXA 3M41A 1ZFJA 4LC8A 3O6CA 1RVGA 2A1YA 4WZHA 4HSOA 1DVJA 1JUEA 3W87A 2AAMA 1H7NA 4YWIA 1N7KA 2Q3RA 4I9AA 2A6LA 2R94A 4DO4A 1OFPA 3NQAA 3IV3A 2CLOA 2EPHA 1FCBA 3NQFA 4CCCA 2WSRA 3MWAA 4JX4A 3W2NA 1HG3A 4WY0F 4HNUA 1WA3A 3PUOA 3NNTA 1TPH1 4A21A 5LHEA 1R46A 3EXTA 5HUPA 1K8YA 2J9ZA 1F5ZA 2FPTA 3I65A 1T8XA 5HWMA 1JCYA 3D0CA 3FJ6A 4BFAA 4O17A 1TYGA 2E5CA 3QW4B 4JDYA 1EP2A 2Y89A 3NQVA 3N3MA 4CCEA 4M7SA 1FDYA 1XBYA 3MP4A 4O13A 5H91A 4PC8A 3VI2A 3QYQA 3UNDA 4JXCA 1JCLA 3G0SA 2FPYA 2QCNA 3MP3A 2RKXA 4FX8A 2E09A 3G1XA 3G1HA 5LNUA 2PURA 2X1SA 1GVQA 4TIMA 1H7XA 2RHGA 5FI8A 3O16A 3DI0A 4M6QA 2XN2A 4PL1A 1KLYA 4ZZ9A 3W7JA 3PG8A 1RQEA 1H50A 2E6AA 1GVRA 5C54A 1KM1A 1EA0A 2VC6A 5F1UA 3C52A 1EUAA 4ZQRA 1HO4A 2ZA3A 4MLRA 2G97A 2PE4A 3EXSA 2HTMA 1D3HA 1SSDA 3E02A 4BI5A 5HINA 1UJPA 3RK8A 7TIMA 1S5WA 2B7NA 2C19A 1EWDA 3FOKA 4BI7A 3UXDA 3UWWA 3R2GA 4ALDA 4ZQPA 4A2RA 2QCHA 3EWZA 3SR7A 1KM2A 4U4MA 4YLWA 1NFBA 5T26A 3GNNA 1KFBA 4ZQNA 1E51A 3NL5A 1TREA 1TIMA 2TYSA 1JR1A 1LOLA 1V5XA 3HPSA 4RZ5A 1K7EA 1JUBA 3L21A 1L6WA 2A0NA 3R89A 2FB3A 3S6DA 5LNWA 1I2NA 3LV5A 1KLZA 1KA9F 3DFQA 4EF9A 3KHJA 3PC0A 5AC7A 1F05A 2GOUA 3TA6A 4LRSA 3DENA 4NXKA 3W7OA 4K8HA 3GXTA 5LZLA 2VFEA 1VGAA 5KZDA 3HMJG 3NQCA 5D30A 3LX9A 3P8JA 5F2IA 3NZ1A 4UFIA 1YDVA 2NXGA 5FEWA 3UY7A 1LRTA 4FIRA 5G1TA 1L6YA 5DXXA 4L4MA 4MYXA 2ZCGA 3LTYA 4UTLA 1ZAHA 1R30A 1PCWA 2NX9A 4IWWA 5HMSA 2ABAA 5LGZA 1G4EA 5DLCA 4HKPA 5D03A 1YTEA 4RCXA 2YPIA 4LVDA 4H4IA 2Y85A 1IIGA 2A85A 5AC8A 3I68A 2DJXA 3O63A 4LS1A 2OZ0A 5L9FA 1HTIA 1ICSA 4GC4A 4QSHA 3B0UX 1K02A 3N9SA 1VS1A 3QC3A 2TSYA 3T4CA 5K9CA 2RH9A 1Z44A 3MHUA 4OU1A 1OYAA 1KTCA 1K8ZA 2Q8ZA 1TJPA 1LDCA 3VFLA 1SW7A 4K8EA 5KTLA 2FJKA 2YFOA 3IIVA 4H6KA 4JTUA 5DBTA 5H2ZA 2I1OA 3YPIA 2YCEA 3O8AA 4BR1A 4L4LA 3KAOA 2FLIA 5I3GA 1ZCOA 1M7PA 3LRMA 3C8FA 5BMXA 2F7FA 5EPDA 3LHTA 3IGSA 4UTHA 3HGRA 1TV7A 4YXGA 4JN6A 1ICPA 4I7VA 4E0CA 2W6RA 3M16A 5K3VA 4LTSA 3S1XA 5AHEA 4WY0B 3TQVA 5KITA 3MP5A 4NXSA 1O95A 1P4CA 3C61A 4JTGA 3C3NA 4U28A 1FWSA 2Y88A 5F4SA 1FCQA 4GBUA 4UTWC 4O53A 4NX0A 1FWWA 4PEKA 2C3ZA 1WV2A 1BEUA 3B0PA 5AYYA 1W1ZA 4GUJA 1TB3A 1A50A 3P60A 4QITA 3NQDA 1VR6A 4KFPA 1P5BA 4A29A 4LS0A 1ALDA 5AOUA 1DJQA 3STCA 2B7OA 5TQLA 1FWNA 3QPYA 2WNNA 1VRDA 1OFAA 1FDJA 4ZL1A 2A5HA 4JY8A 2WKJA 3O07A 2ZBTA 1AW2A 1ML1A 4RX0A 4Z1AA 4CNNA 4Y9AA 4UTTC 3VNDA 4IX0A 3GVGA 3MI2A 3EXRA 2WO5A 3SZ8A 1JCNA 4DF2A 1X6UA 4WXZA 2E77A 3FYPA 3TW7A 3G1YA 2YYTA 2QAPA 5DN1A 4AHOA 1S5VA 3CHVA 2A7RA 5J5RA 4TO8A 1OHLA 1I2PA 4MKNA 3SI9A 1WBHA 1H62A 4FEZA 4FNUA 2YDAA 3W1RA 3SIZA 1SQ7A 4N02A 4O54A 1KV8A 2DJLA 3TJLA 3CTLA 2ZRZA 4IMGA 3LHZA 3NOEA 4AF0B 1PS9A 2GQ9A 3DU0A 3BK0A 5AHMA 4NQ1A 2J27A 4JY9A 3SFKA 1TPUA 3C2EA 4NVTA 1SZNA 3W1LA 4NNCA 3CU2A 3M5VA 3P80A 2QEZA 1GTEA 1A5SA 5TBOA 1Q6LA 3OIXA 3MMTA 1VYRA 1OABA 2FB2A 3QSTA 2QUVA 4MZ8A 3TU9A 2Y6ZA 5DY2A 1GG0A 2H8ZA 3EKZA 3EX1A 3LXAA 3PY2A 5K7JA 1TRDA 3BLFA 1H7OA 1KBIA 2VXNA 3IIOA 1LORA 5D38A 2DZWA 3HGOA 2V2HA 4WXYA 1QPRA 4JGDA 3G1FA 1IXPA 4Z0SA 1KV5A 5D2VA 3OBKA 3W1PA 3TNOA 1DL3A 5FF0A 3N2MA 1WXJA 3S1WA 1JCJA 1H5YA 1KFJA 1N55A 2O7QA 3N73A 4XQ6A 1KM5A 3NGJA 3A24A 3BG3A 4IPIA 3O06A 3P62A 1SFJA 3PR2A 3NEVA 4M7TA 4DQWA 4PA8A 3Q37A 4LU0A 5U4NA 1DV7A 1OK4A 4MFDA 3TFXA 1XI3A 5D04C 4M19A 1M6JA 1L2UA 3CEPA 5KMYA 3TV8A 3M44A 3CPRA 3IVSA 3NM1A 4J9JA 1R47A 1DQWA 3WJWA 3ZWSA 5ABTA 2V2DA 3ANYA 5F4WA 3S1UA 2VFIA 4UFLA 3S5YA 3T55A 3NA8A 1XDMA 4O8RA 4QISA 2Y61A 3LGEA 3B4UA 1PL9A 3TXVA 3EWYA 1IXOA 6ALDA 3W2JA 5AHFA 3QF0A 5AHIA 1QPOA 5D2WA 5EBUA 1N8FA 1OFBA 3MHFA 3L0NA 5HULA 2AQWA 3VKJA 4UTTA 2HS6A 2A2IA 3UPWA 3OVQA 1OG0A 1KTBA 3UWVA 1CX9A 4WOQA 1SSGA 5K9XA 4D2JA 1CW2A 1VCGA 1FCUA 1EUNA 4PL2A 3R5EA 2OX1A 1X1OA 1XM3A 3ATYA 4UTWA 2C15A 1VCVA 3QQ0A 4WY0A 3DFNA 3B04A 3NQGA 4HNTA 3E9AA 4UTMA 5DCEA 3MJYA 4JS3A 4JTJA 4O11A 3GR7A 5C6MA 4LV4A 4UMAA 4NNAA 5F1VA 2QUUA 4RK8A 1M7OA 5G4WA 3G22A 4RXGA 3QH2A 1XKYA 2QJIA 2GJNA 1A5CA 1P0KA 1VHCA 3LCXA 4CLMA 5C55A 1RPXA 1LYXA 1NAL1 1QCWA 1VYSX 2Z6IA 2AGKA 3G3MA 5EA9A 2GVGA 2NV1A 3HJZA 1C8VA 1QR7A 1GVFA 3TH6A 2HMCA 1OF6A 3GB6A 3LXCA 3G18A 1RD5A 4AWUA 1H7RA 2F84A 3W9ZA 1NEYA 1BKSA 1I2QA 4HNVA 1MEIA 3O6YX 2CLLA 3G24A 1YADA 4QJ1A 1GYNA 1LP6A 1H7WA 3FLUA 1GYLA 1LTDA 3G0UA 1F6PA 1LRQA 3F4NA 1RR2A 3GDLA 1SW3A 1XUUA 5C2XA 2QCDA 3I6RA 1H60A 1TPDA 2ZZ2A 4OV9A 4JNMA 4A22A 3TXZA 4GFSA 1O94A 4UXDA 2FQIA
chains in the Genus database with same CATH superfamily
1TVNA 1XPYA 2ONEA 3EMCA 3TA9A 1X6LA 4EIVA 2UY2A 3LCFA 4IF2A 1RQHA 3S6TA 5B80A 1RA0A 3S5OA 4IUOA 2UY4A 3AS1A 1IT7A 4DI8A 4DIAA 2C18A 2WZTA 3EOLA 3RO8A 4GY1A 1WX0A 3E12A 4MY1A 1JF6A 3WQPA 4DBSA 4FR6A 4CD5A 5FF4A 5AYIA 1NJJA 3BG5A 2Y7EA 4OV4A 4UR8A 1QPQA 2GDQA 4TV5A 5A6SA 3PM6A 3B0VC 4M5PA 4V15A 3U9IA 1GOXA 3MBFA 3DOPA 3TYZA 3KEHA 4D6HA 3ZOAA 3IJLA 4LOCA 4FNRA 4IFRA 4CCDA 2QPXA 3WQOA 2Z0IA 1LLZA 5A8MA 1XKJA 3HG2A 3QTGA 1NOUA 2AL2B 3MSYA 5CBJA 1XH1A 5CGTA 3P5ZA 4HPJA 2WHJA 4EF8A 4JFSA 2D69A 1VPYA 3B4YA 1W1VA 3PPHA 5FF3A 5BXRA 3SJNA 2PLKA 1AODA 3SGGA 4OT7A 3RG6A 4BWLC 4DLFA 4QM1A 2WVTA 4F40A 4AD4A 3EWBX 3QJAA 1Z6KA 5AVNA 1ECEA 4HU3A 4BJHA 2WNQA 2PDPA 3Q45A 4GZIA 1KXVA 4UUIA 1ZENA 2OGYA 3LCLA 4JDBA 1E6SM 1SZFA 4O1DA 3W01A 3HPXA 3W2MA 2VRKA 1RAKA 4P7LA 5BW6A 1DBTA 3W73A 2Q02A 1LBFA 1RP8A 2E5BA 2QCDB 2RGMA 4ZVJA 1FHUA 4WGHA 5A8OA 1TPEA 2J9YA 3KDOA 4QS5A 1OT1A 4MUPA 4X9SA 2CLIA 1VJIA 4Q32A 1JJKA 1OX4B 4AD2A 4DUXA 3WD0A 4GKLA 3FA3A 2OYMA 2D23A 2D0FA 5LGXA 3M6YA 5DANA 1KFLA 4HPXA 1AW5A 1FOBA 1RSCA 3RXZA 3PFMA 2ATSA 2VO5A 2Q3OA 3GAYA 5CEWA 2WCSA 3NDZA 4WJXA 2X7VA 3BZJA 4GUGA 4TR9A 3T2PA 5IFTA 1FHDA 5AFDA 1PTDA 3F4WA 3NQ8A 4Z1BA 3H2AA 3HPFA 3JU2A 4C60A 1BYBA 2NV9A 3AXHA 3N11A 3KOFA 4JPGA 3DUGA 1DJGA 2NV2A 4M29A 2ZRYA 5E70A 5DRIA 3HZ3A 2H3DA 3RLUA 2H3BA 1V6TA 1X38A 1MYRA 4IIFA 1GZJA 3BCFA 3WQWA 2GSJA 4ZO8A 1IV8A 3WLIA 4HBKA 3GDTA 4O28A 1GKPA 5A6BD 2E1DA 2GQ8A 1CEOA 3Q58A 4D8ZA 3N4FA 2DIKA 2VR2A 2PCEA 4X0NA 1WXYA 5E1QA 2FGLA 4WJEA 4AXKA 3DHDA 4XWUA 5MKGB 1DJNA 1KKOA 9RUBA 2ADAA 4I90A 4FNTA 1A0EA 3DESA 3WLQA 4ZSTA 3BW4A 3NG3A 1WDDA 3RRXA 4FX6M 2PDFA 1OEPA 2Y8UA 1L8NA 2OT1A 2J7CA 3DFPA 4IJBA 4I6KA 4UFJA 1XC4A 1IGSA 2X0SA 1R7AA 1EX1A 2F6XA 3DXIA 2ZE0A 3T1GA 1LOQA 4LVFA 3WNNA 4A3RA 1DKWA 2E4TA 4D6DA 1VC4A 1AL8A 4LAMA 1JRCA 1OJXA 4BI6A 4DO7A 4TMCA 1QW8A 2PLCA 2XH4A 4UWMA 3SN4A 2CWNA 3AMGA 4NAEB 1J12A 1Q7MA 2QGHA 3UCCA 4IL0A 1SJAA 3U2ZA 4PMXA 4JN8A 3BOFA 4ZO9A 1VLIA 3OVGA 1NQKA 4KRUA 1TO3A 4UCGA 5FF2A 1B9BA 3G1VA 1S3TC 1Y7VA 1Q8AA 3W88A 2ZA1A 3MBDA 3WDHA 3QPEA 1HJUA 2BS9A 4ML9A 2W4XA 4JIQA 2BHYA 4C6KA 4DBDA 3MO7A 1VBJA 4IIEA 2D73A 2CLHA 1ZBVA 1JD9A 3EX4A 4KWSA 1JEZA 1VFUA 1QOPA 4WD0A 3CV2A 3SIMA 3W82A 2DDXA 1W31A 4JIRA 4HNNA 3GQYA 4GACA 3CS2A 2Y62A 1FP9A 2DZXA 3FHAA 2GK1B 3I6EA 3DG6A 3UQNA 2XH0A 3GG1A 5AYZA 2QJMA 1PX8A 3F5KA 3ZVHB 4TQTA 3W7PA 4LF2A 3WELA 5U7SA 4HN8A 4UTKA 1I8JA 1RZMA 3ITXA 4XO6A 2G95A 3ONBA 2F38A 3UNTA 3ZFHA 2OU4A 1AH0A 1PTAA 2VCBA 2NUXA 4EP8C 3LLDA 3G3DA 1TUXA 1OFRA 3TDFA 3UEQA 1VJZA 4C6EA 3OODA 1S39A 5DQPA 4AWTA 3FCPA 3EDKA 3K1DA 4H8HA 3VOHA 9XIAA 3I4KA 4XZ9A 1W5NA 1V0LA 3L5AA 1UD6A 1GW9A 4ZMGA 1UWTA 3CUXA 4JKMA 4DNHA 3QYSA 1KR1A 3W2LA 3S9YA 1LBMA 5HJYA 2XM1A 3S5NA 3ITCA 3T0CA 3CIWA 1HT6A 1YDYA 4MAVA 5A8PA 3AMLA 4EE9A 1P0DA 4X2RA 4Y9PA 2V3DA 3H4WA 3HV9A 1LLWA 3SRHA 4V28A 4GUIA 3UY8A 3EAUA 3EMZA 5D37A 4H2HA 1DWHM 1GNXA 1XINA 2VOMA 3R58A 4HSNA 2V82A 3GH5A 4QCFA 3TQKA 3RNDA 4U5KA 4ACYA 4NJKA 1FBAA 4AQLA 3AUOA 2BV9A 3H2NA 3U7BA 3TAKA 2VC7A 3BARA 4K38A 2XFFA 2CW6A 3H21A 2PGWA 1VIWA 1QI3A 3KL5A 4GUFA 3RMJA 2A21A 4RE0A 2OGJA 1E0VA 3NZQA 5CJMA 4Z1YA 1XL9A 4CKQA 6TIMA 2X1TA 3W29A 2Q09A 3S42A 4PB4A 3VM7A 1AL7A 2Z25A 3STEA 1ZS2A 1PKYA 4ADTA 1UQYA 1S3HA 2VKZG 3M0MA 3BO9A 1OX5A 1F6YA 3BH4A 3VDCA 4LNYA 3RU6A 4E38A 1F07A 3QR0A 4GI4A 3SEPA 4WDUA 1Q4NX 1PYFA 1QOQA 2QIWA 3FJ4A 3T7VA 4OIFA 4MZ1A 4FI4A 2OKOA 4GYKA 3WDQA 2QVNA 3ZJKA 3JUGA 2ATMA 1TV3A 3AYSA 1WOBA 5HBFA 1IGWA 3M0JA 1XG4A 3TJXA 1R2SA 1JPIA 1XIEA 4RV8A 4E5TA 2UV8G 4MG4A 1UWAA 3W84A 3VVGA 3V1HA 5I06A 1M7JA 2QR6A 2ZRUA 2R14A 4ECLA 3DN5A 1AH3A 5FL1A 2WZHA 1EKOA 2PDBA 3WL0A 3WQCA 1UOZA 2RDWA 4XSLA 4FLSA 3TTQA 3LOTA 3PJWA 4N2YA 5LSMA 4TV6A 4PUWA 1GK8A 5EMKA 2GL5A 1GEQA 4HNOA 1DIEA 3NO5A 3SW6A 4P7NA 2NW0A 4JTQA 1GVYA 5E6YA 1ZCCA 4LBRA 3PTMA 3IEBA 4ZR8A 1VFSA 4JIIX 4ZE4A 2QULA 4N6FA 1IR1A 2JGYA 3PF3A 4B15A 1AJ0A 1YDOA 1GKQA 3I7QA 3WZ0E 3IARA 1U1HA 1Z48A 3OLGA 3MC5A 3DFHA 1O5QA 2OB3A 3MJMA 5CQ1A 2L5HA 2PDQA 4ADUA 1I2OA 3L2IA 1XG3A 2VEMA 2ZUMA 1KQZA 1GZGA 2NLIA 1OGSA 4LB3A 2ZA2A 3N2OA 1JQXA 1UZDA 5EFFA 3APTA 2C8NA 2JKPA 2HE5A 4IICA 4MAZA 2QUMA 1RD6A 2INEA 4YYFA 2Y4SA 3SECA 3M64A 3F03K 1R0MA 4PB5A 4US6A 2PC4A 1UKSA 3VZYA 1ICQA 1XYCA 4LY4A 5LYRA 4JIHA 4TX8A 2BFGA 3WMLA 4GINA 4D6JA 2R1NA 3IRSA 3HJEA 3PJTA 3TX9A 4A8RA 3P82A 2H90A 3B9EA 1Q3NA 4N9CA 1AD1A 2QCFA 5CBIA 1F8IA 1W3NA 6TAAA 2FH8A 1F8MA 1HNYA 1EWEA 3PZ9A 2JEPA 3IGXA 2D2HA 2GJPA 4LF1A 3WFZA 3VIIA 5AC6A 5D32A 3TN4A 4R85A 4XISA 1GKRA 4WF7A 1I0BA 4W8BA 3KOZA 1XSIA 5LA1A 3BLDA 5TNVA 4Y6GA 1SW0A 4KWOA 3VE7A 3QHMA 2B7QA 1L6GA 1HL2A 1B54A 4QHRA 3A12A 4S3CA 2NUYA 1W5PA 5HR6A 1OZMA 3LGDA 1KBBA 4LBUA 4DBUA 2YXOA 3EWXA 3QTPA 2OZTA 1HP5A 4LPCA 1J18A 4CQCA 1VPQA 3QV8A 4RE4A 3WJXA 1CLVA 3A5FA 4IOTA 4N42A 3W86A 4HCHA 1DORA 3ZS4A 2BXZA 1LWHA 4DZ5A 3NWRA 4REQA 3SCOA 1EJ7L 2PUZA 1XQLA 1ZTVA 2GGJA 5M5DA 1F73A 3L2MA 4CNPA 1VBHA 1QBAA 2O9PA 2ZXQA 2C16A 4N4PA 1V7AA 4KH2A 5HPCA 3G1SA 1QVBA 2G3IA 4F0HA 1OX6A 4BEUA 4UQBA 2YX0A 1K3UA 3IJQA 3RUBL 2WQPA 3M0VA 1K8XA 1GQNA 3ARUA 3AYVA 4INFA 2W62A 3BW2A 1POKA 2POTA 3F4DA 4Q22A 2DT3A 4AH7A 2PODA 4K7YA 3FA5A 5TF0A 4QDWA 2Q8LA 4C7DA 1XYBA 1L0PA 3NCOA 2WMJA 4NHVA 5F2LA 1U5HA 1FWCC 4PCSA 2X16A 3LDVA 3NAVA 3TMQA 1H4PA 1SZRA 4KIEA 2Y5EA 3C2VA 3PWGA 4R53A 1DJYA 3USBA 3BV7A 4FOUA 2F2KA 3STFA 5CZ0A 4QEEA 1UH3A 4ML4A 1Q6EA 4E8DA 2EKGA 3MS8A 3AHXA 4Z08A 3WO8A 2OZ8A 5EMUA 2W61A 4WKHA 3A3XA 3P74A 4HZ6A 4HN4A 1XIJA 4DJFA 1TFVA 4UFKA 2DP3A 1JZ4A 2DPEA 4E3TA 5I00A 3VE9A 4CNTA 3N34A 3NOYA 2WC3A 1TX2A 1GHRA 1K9DA 1NH6A 3EKGA 4RE2A 4E4FA 1B3ZA 4K39A 3W7GA 3LHYA 2RDUA 1AFSA 5BYWA 1S2WA 4LUJA 1RBLA 3GVWA 4U3AA 3BQ6A 3ZT5A 5I3IA 4RXFA 2ZXDA 1RALA 5RUBA 1E9ZB 1BFNA 4NAEA 3LRKA 5CC3A 4OECA 3U6WA 1PZ1A 2IUZA 1Q85A 4LVBA 1R3YA 2D3NA 2XZ7A 4YTSA 3E2QA 4MB3A 5FJUA 4UQCA 3PBUA 1VYPX 4AG0A 3QMSA 3LPGA 4GE8A 2W5FA 3AZSA 4HIBA 3R7MA 4AC7C 3D47A 2PWVA 4EACA 4JOMA 3MCOA 5HNRA 1LM1A 1EIXA 1I0DA 3TSMA 3PFRA 1UKOA 4LAKA 1XCWA 3MI6A 5M3WA 2DH3A 3EDJA 3LB0A 3HB9A 2WBGA 3GIYA 3W7QA 2NWRA 4Q8QA 3GXFA 2Z00A 5G2WA 1PIGA 1Z8AA 1M5WA 3QGVA 4MF4A 2FTPA 3WX7A 4XZWA 2WC4A 4GLEA 2J7FA 2XISA 4JX6A 1ELSA 3N04A 3OB8A 1B1YA 1IR2A 2IQTA 1NF0A 4FR1A 1W1TA 1GT8A 2ZKMX 1JCXA 3AXKA 3S83A 3ZSSA 2C14A 1MFUA 4EVZA 2O56A 2P3EA 1JNEA 4ATWA 4YU1A 3ZJ6A 3ZVHA 1BG9A 3CWOX 3O15A 2VFHA 1TWZA 1W0MA 3ICJA 4PMYA 4N4QA 1EDQA 4O14A 1FWGC 3LUTA 2XWEA 3TN5A 3W85A 4F0LA 3CUJA 4XAFA 5A6MA 4RZ4A 3NQ6A 1B3OA 2P50A 5ABFA 3QZ6A 4GXPA 2C71A 4GISA 3OHMB 1VH7A 7REQB 2DVXA 1RJQA 4Z1DA 4ROPA 4GJ1A 1UR2A 1VFHA 1UUMA 1LL7A 1OFEA 3VNYA 3VGHA 3N6QA 4R9XA 1FP8A 3AO0A 2JIWA 1JDDA 4JQ2A 2J24A 2DH2A 1C7TA 5JQ9A 4GIYA 2VELA 4HYWA 3INPA 3GLCA 3N4EA 3W1XA 2HRWA 1M03A 1KM0A 3B0YA 3W1UA 3NQBA 1FQ0A 5DBUA 2HEJA 4LGXA 1HJSA 2ISWA 1OZQA 4IMFA 3GR8A 2NQ9A 2P10A 3VABA 1R86A 3O0KA 2PBOA 3APGA 3MUXA 4H9ZA 3DG7A 4RUBA 4ZOAA 1JULA 4FXFA 2QF8A 3K4WA 4R3UA 2NWSA 3SB0A 1EIBA 1O6IA 2ALRA 3NYZA 4M8UA 5AC4A 2HBXA 1VZWA 1ME9A 1M53A 4IGHA 2YLLA 4WQ6A 3KCLA 2QVHA 1MNSA 1PV8A 3WQEA 1OK6A 1RJPA 2J88A 3GTNA 3OA5A 2V67A 1SJBA 3MI3A 4BF7A 3LYEA 1V7YA 5F2GA 2A3EA 5FAJA 5HATA 2BX7A 1FWTA 4IXXA 3E74A 1P0NA 3EB2A 3H2FA 3NSMA 5CKSA 3UWQA 4D6FA 1GW1A 2D0HA 1TJ0A 1JQVA 3CQIA 5C70A 3KVMA 3W02A 3PHAA 1B3YA 1CXLA 1H7NA 1TMQA 4I9AA 3QR1A 2R94A 4DO4A 4GQQA 3IV3A 1XCXA 5GNZA 2Y0FA 2Z28A 2D0GA 3CPUA 3PBGA 4HNUA 1WA3A 4IGNA 1TPH1 5LHEA 3G2GA 3UVAA 2FPTA 3I65A 5FJRA 1R3TA 4Y8EA 1W9PA 2A3BA 1B0IA 3MKKA 1TYGA 3WNOA 3QW4B 3OBEA 1EP2A 2Y89A 4WSHA 2CXGA 2XGBA 3VNMA 1CXFA 3E0FA 4M7SA 3KBNA 3G6LA 1ZB5A 4O13A 3IACA 3VI2A 5FL0A 4JXCA 1JCLA 3G0SA 1XISA 2QCNA 4HGXA 4DM2A 4YVVA 4FX8A 4B3KA 1E56A 4HOZA 1JFHA 1ZQ5A 3U0HA 3R10A 6XIAA 3O0FA 3HM7A 1GVQA 4DYKA 1OG6A 3FHQA 3O16A 1VKFA 4F2UA 2XN2A 3NFUA 1V6UA 1E0UA 1XRVA 2F6KA 3PZNA 1GVRA 4LUTA 1E0XA 1EA0A 1D3CA 1ZLPA 3L4WA 4XAGA 1NFGA 2MUCA 4WHBA 3E0VA 4MNLA 1A47A 4IISA 4KW2A 3EXSA 3GS6A 1V08A 2FZMA 1QI5A 3E02A 3CMGA 1LL6A 4BI5A 5HINA 1HW6A 7TIMA 1JF5A 2C19A 2B81A 1H0IA 6REQB 4ALDA 4ZQPA 4A2RA 4G7FA 5ABEA 3GNNA 1KFBA 2VVSA 1E51A 3VKDA 1TIMA 2TYSA 4MNMA 1JUBA 3VOGA 3ONCA 4HNCA 4S3EA 3KOYA 1I2NA 1KLZA 4QG8A 3ABZA 4R7WA 3FVMA 4RDVA 4NXKA 3NURA 4B5XA 1XX1A 2KAUC 5I24A 4AIOA 2VFEA 3ISIX 5KZDA 4IZGA 3GE7A 4L9ZA 5A95A 3F2BA 5D30A 3RHGA 1K70A 3AU6A 3UJFA 3AHVA 3AISA 2J7BA 3LTYA 3ARPA 2GFTA 3B8VA 1ZAHA 3AMDA 2YL9A 1GORA 2NX9A 1JZ3A 5XIMA 2WMIA 5A6JA 5LGZA 3LENA 4U31A 2O92A 5DLCA 3V0UA 1DP0A 4HKPA 3RM9A 5D03A 4RCXA 5C7HA 2Y85A 1IIGA 5AC8A 2DJXA 4LS1A 4BS0A 4AEFA 5L9FA 4Q7IA 5M17A 1ICSA 1TZ9A 2VX4A 4JEJA 3V0SA 3QC3A 1G5AA 1Y65A 1UMLA 2NVDA 3IJ9A 1TJPA 3VFLA 1SW7A 5FJOA 2IS7A 4K8EA 3K46A 5H1WA 3S9IA 2OOFA 2YDSA 1WKDA 3IIVA 1V0NA 1PJ9A 5DBTA 5A6BA 1P0EA 2PGEA 3KAOA 1V8EA 3B9OA 5M03A 4CN6A 3HGRA 4JN6A 3M16A 5K3VA 2UZ9A 5KITA 5I02A 3C61A 2XIBA 1FCQA 4IQDA 5GJNA 3WD4A 1WV2A 4UR9A 4GUJA 4OZOA 3R8GA 3V36A 3LA4A 3P60A 1A4LA 4AWEA 2J7HA 1P5BA 4A29A 2HNHA 4XD6A 5AOUA 3DG3A 4C6PA 3WLOA 1H2JA 2WNNA 2Y5JA 1GJWA 5HOSA 4ZL1A 4JY8A 2WK2A 2J77A 3EMQA 3XINA 3VOCA 3O07A 4MWAE 1ADSA 2FKPA 2BGNE 4MDPA 4DXXA 2E3ZA 2J66A 4Y9AA 1TWWA 3GR4A 3SZ8A 4DZAA 2ASHA 3MUAA 2XDFA 2HXUA 3K8LA 2DY3A 4F0KA 4DJFC 3G1YA 3RMEA 3I6TA 1UPPA 2EXOA 4ZFMA 3ANUA 5I79A 1XIIA 4X63A 1W8GA 3KBSA 3CHVA 3AS0A 4CNSA 1I2PA 4MKNA 1V0KA 2WLZA 3O6AA 4N02A 3A13A 1ITCA 3W25A 4CEXC 3CTLA 5HNTA 4PEEA 4CEUC 5M2FX 2G3JA 4NG3A 2J8GA 5AHMA 3RM8A 4GYPA 3SFKA 2DQXA 3JVAA 3R94A 4NNCA 3PZTA 2O4MA 3M5VA 4FMVA 1GTEA 4QG6A 4M81A 5JMUA 1Q6LA 3MMTA 3OIXA 1QHZA 2FB2A 4Q4PA 3UR5A 3TU9A 3EKZA 4YN5A 2V3FA 4L65A 2O4QA 4H8UA 5DT7A 5K7JA 2Z2AA 1H7OA 3GHSA 2VXNA 3PP7A 1CCWB 1XIHA 2DZWA 1ENUA 4PMVA 4JGDA 3G1FA 1IXPA 4W5ZA 4Z0SA 3OBKA 1EC8A 5FF0A 1JCJA 1H5YA 1N55A 3RGTA 2O7QA 5H8PA 5D8ZA 1W2PA 4PUNA 4KT2A 2PDJA 1WAWA 3EWCA 8RUCA 2A3HA 3O06A 3P62A 1TWSA 4DQWA 2ESCA 1XWYA 2PC8A 1DV7A 3VIOA 3TFXA 3KM8A 3WDIA 1E6RA 4Q3MA 4RL3A 4MWAB 4M19A 1N2VA 3TV8A 3KL3A 1Q8JA 4J3SA 4M51A 4E2VA 1EHNA 2V5CA 2BY0A 1M9HA 2BBFA 4MJ4A 5F4WA 2VFIA 2PTXA 2I7GA 3NA8A 5CPQA 3T2OA 3TYEA 2WWCA 2BDQA 2BY2A 3O9NA 1PL9A 3TWAA 2DSKA 3W2JA 5BRQA 5EBUA 5DT5A 5I03A 3MHFA 2ZX6A 4LAOA 2HS6A 1M41A 1OG0A 4X0VA 1W9UA 3WH9A 1ZL1A 1SFTA 1E9IA 4H83A 3R25A 2VHLA 5IDZA 1OC5A 4V1YA 4WSJA 4PTXA 4FLRA 4EPBC 3R0DA 1MUCA 4JFTA 3UZYA 4XVDA 4F66A 4CQBA 4JS3A 3F2CA 2PWHA 1B2YA 1W1B1 4IPNB 1Z69A 1OCBA 5G4WA 1IEWA 4RXGA 3KL0A 4NI3A 5HQMA 1XKYA 2ZUTA 4C7GA 3MMDA 1VHCA 2YL8A 1RLDA 1XFCA 4W86A 1QCWA 4C6NA 3ZT6A 1DE5A 2WKLA 3G3MA 2Z27A 4GO9A 3FSTA 3P0XA 3GVRA 1QR7A 4FK9A 2F61A 3GB6A 3G18A 4F2BA 1H7RA 3UCDA 1NEYA 3HN3A 2Y8VA 1BKSA 3VOIA 1OSEA 3T0TA 5CBBA 3O6YX 1E4NA 4QJ1A 4P8UA 4E8GA 1ISXA 1LP6A 4G9PA 1GYLA 3I3DA 1LTDA 3L4ZA 3G0UA 2WBKA 1SW3A 1H41A 2QCDA 3PPFA 3U57A 2VWSA 3ARRA 4PSPA 4L9YA 4A22A 3AHTA 3TXZA 4YVPA 9XIMA 3C2YA 1WE5A 2PRMA 3S0CA 2BMBA 3IUHA 2YDRA 4N6EA 3E2VA 3OYXA 1W32A 5FD0A 4JIPA 2NQZA 3BOXA 3TAOA 4BQ4A 5HQEA 1L6SA 3MT1A 1KTNA 4H9TA 4CU7A 3MB9A 1UKPA 3U48A 4HYVA 1BVZA 3FAWA 1EFZA 3NR0A 1Z89A 3STPA 5CC5A 1KGUA 3MANA 3ME3A 3W53A 1W9DM 3HURA 3ZM8A 1TIWA 4ZOBA 4C6DA 3EX6A 3PZQA 4KETA 1J93A 4A8IA 4LAZA 2CZ5A 2RJHA 1IF2A 3RRAA 4AXNA 3RPTA 3UG5A 1FWIC 4KQNA 3GDMA 2VX6A 4AZIA 1HZYA 1U1JA 5KZ6A 3HQ1A 4YL2A 3H23A 4UCFA 1XH0A 4AU0A 3PWAA 4KKXA 3W81A 4WVXA 3FEQA 4ZGYA 3EB4A 4KERA 5I78A 2QCMA 2XIOA 3BPWA 1OFQA 3J7HA 5T9BG 3IJ6A 4C6OA 1KNWA 1HIZA 5FF7A 2PS2A 2EJ1A 2ZZ3A 3VD7A 4MADA 1UWQA 3EX3A 3GYEA 1G7VA 4UOQA 4QRNA 4A4AA 3LD5A 5LIKX 3WUGA 1ADOA 1Q7QA 1ITQA 3LG3A 4WR3A 1YBQA 1QUMA 3C8NA 2Z1XA 2E8ZA 3A9BA 3L4UA 3KFTA 4NZFA 3V5OA 2QJGA 5IHSA 2FFIA 4UIOA 4BY3A 2ZUWA 1EJTC 2DSWA 3FJLA 2NQJA 1NDWA 1F6KA 3LMYA 1EZWA 2VURA 5CSRA 1BF6A 2QDGA 3WN6A 2A3CA 2AOSA 4LQ1A 4ZEPA 2DZBA 1KWKA 3NPWA 3VKAA 3E0WA 4QG9A 1K4HA 1V02A 3AHZA 3PN8A 1PCKA 2PDKA 2OYKA 3BAYA 4XBSA 4GNKB 1QTWA 3V7PA 1NWRA 3RF9A 3BLKA 3AIVA 1R87A 3R4IA 3SCQA 5A8GA 4DJEA 2OSWA 5CZTA 5IM51 2A79A 1J0YA 4MB4A 3CYJA 3N19B 4C1LA 2UWFA 4HHMA 3LI1A 4QNWA 4JYDA 2W3ZA 2VQTA 1UA3A 4IL2A 5DEZA 4LYKA 2JF7A 2BODX 1G4TA 3VGDA 3AYTA 1NSJA 3CZLA 4DJED 4BKNA 3A4AA 3KBMA 1CT5A 4MTVA 4AIUA 1NF7A 1K9TA 1SZEA 4PGLA 4YHGA 3HQPA 4ICNA 1JZ5A 1G4SA 4DAIA 3TKFA 1GONA 5HQLA 2Q6ZA 4H6RA 4DVOA 2EAWA 2IXUA 3T78A 1XLCA 5C9ZA 1R3WA 2BTMA 4WOZA 4IMEA 4KESA 2VX7A 3P81A 3HMCA 1JZ2A 4IMDA 3RCNA 2WSKA 1AD4A 3KTCA 3OZMA 3B8DA 3MYOA 3A21A 4R33A 1AQHA 1DIOA 2VVNA 4H9XA 4WGXA 3K13A 1VBRA 1P6BA 4Y9OA 2YW4A 4OBRA 4D6EA 3W7HA 5CPTA 5A5WA 4NX5A 4JNYA 3S2LA 2WMGA 3GU9A 1FH7A 2DIEA 4XVEA 3BJFA 4ERIA 3MO4A 3ELFA 2YSWA 3TN6A 3LS9A 3GZ3A 1OCNA 3DGBA 3QQ1A 3KVLA 2PTDA 3MSRA 3F5JA 4HK5A 4Q6JA 2QJHA 3ZWTA 3KVJA 3W83A 2ZC1A 1U2YA 1T0OA 3TROA 5KSWA 3T9PA 1J2WA 4YVXA 3CLWA 1XD0A 5K4XA 2EGZA 3FIGA 4IMCA 4LUSA 4LUYA 4PBGA 2FJUB 1I9CB 3SSJA 3TTYA 1UZ1A 1SR9A 3G1AA 4BZYA 3CO8A 4Y96A 4G5DA 1UASA 4Y90A 2X30A 2D24A 4PTWA 2WMFA 1FXPA 1X8FA 2NZLA 2YXGA 3EPOA 4V33A 5M1TA 4C5ZA 3H70A 2V5JA 1VFTA 5BRBA 4S1FA 1SYTA 3EWDA 1FKWA 3PAOA 4AD3A 5D8WA 4QQUA 1HQTA 1CECA 1QNRA 2OLHA 5F2MA 4PODA 3EOEA 3V5FA 2V9DA 1E4IA 2DVUA 5CLWA 1TTQA 2DZTA 4R7JA 2EPNA 3WQVA 1LQ0A 4RKAA 3NPUA 3JS3A 3VD5A 1I75A 4ORIA 4WLCA 3LGGA 1HO1A 4LCSA 5D9NA 4HPNA 5MHBA 3NQ2A 3QQWA 4FXRA 5L6UA 1SO4A 1J4EA 4PH6A 3MYPA 2OO0A 3KLLA 2FGBA 1JYWA 3V18A 1MQRA 3W24A 1ZALA 1OM0A 4J3WA 2WHKA 1KQYA 4U2ZA 5FJTA 4O1CA 3OLEA 1Q7ZA 3U3HA 4RW3A 3N14A 1TCDA 4L6OA 1D8CA 3QC0A 2NQ5A 4RNJA 2V5DA 3BLOA 2GLKA 2CXEA 3QLLA 3KBJA 3EB3A 3TR2A 3ABSA 2OG9A 5B7YA 1RK5A 3MVIA 5E93A 3SFWA 3TYCA 3UWEA 3DX5A 1QJWA 2PWDA 3PK7A 1E5JA 1KFKA 4L5ZA 4I7WA 3GAKA 2QDHA 3DERA 2QCLA 3LRLA 2P0IA 4H2CA 5HMFA 4QAIA 4TX9A 3CGTA 3ABXA 3HQNA 4H6QA 1LRNA 3NO3A 4NSBA 2QV4A 3W6YA 3R79A 1A5LC 2IQDA 1W3TA 2E28A 4EK7A 5FEPA 1PXGA 3PB2A 1R8LA 1EP3A 2XGZA 3WJSA 4OTKA 2SFPA 1EP1A 1WYIA 3RJXA 2WW5A 4ZXLA 1Q5MA 3W1AA 4LW7A 3UZ5A 4HU0A 1VPXA 3FDKA 2JQXA 1E0WA 4DBEA 4WX2A 4HZ8A 1VJSA 3D6NA 1LCOA 4QP0A 4JTFA 4MUZA 1EGZA 3LXBA 3PJXA 3NM3A 2JKAA 2AGTA 3E49A 1A4MA 1DJXA 3UWUA 4B5NA 1EPVA 3S5ZA 1XYMA 3EWWA 1MUMA 3E96A 1JPKA 5HDRA 3SUSA 1S5TA 1GJUA 4FAMA 4HK7A 4NJHA 4E4UA 3B06A 3T81A 1DTUA 4EWND 4MB1A 5BNKA 1ZP3A 3M1ZA 4UB9A 3AHYA 3SADA 3EKLA 1MVYA 3W23A 4D6IA 1TSIA 2DSZA 4Z2KA 1E9LA 3VIKA 2VGFA 4MIMA 2VENA 4RDYA 1PDZA 2PZNA 3QHNA 3WNLA 4PMZA 5BMWA 3DI1A 5SWUA 2Z2BA 3BDKA 1JPDX 1F3XA 3K2GA 3WF3A 2Q8XA 1KRAC 3BLPX 2ACRA 1I6NA 2R91A 2ZQ0A 3HBLA 2P5NA 3VGEA 1N8WA 4I3GA 1YPFA 1TJ2A 3KP1A 4GIRA 4GUHA 1UZ4A 2GJRA 3MVTA 4D1IA 1BXNA 8TIMA 4ZB0A 3U4FA 5AC5A 3WQFA 4ROQA 4K7VA 3E2SA 4KCTA 3HOJA 5CPNA 4Y7EA 2WJZA 3QFEA 2J8TA 3UR2A 3IVTA 2CBVA 3W7MA 1XRTA 4KRZA 2V0TA 2XFWA 4J2MA 2IPFA 3S1GA 4PCTA 3UZJA 5FJPA 1V6XA 1LWIA 5KZMA 3AMCA 3SUVA 4F9JA 1CPUA 1NDVA 3GYCA 3U2OA 3V75A 1L9WA 3MKCA 4Q6XA 3C0JA 1SO5A 3HF3A 1VRXA 4CN4A 3PVFA 3ZQ9A 5D33A 4K1WA 1MXSA 3LM7A 1D8WA 5I77A 1E1EA 4G1KA 4CGTA 1O5RA 3AC0A 4NKCA 4XD3A 1ECQA 2YL5A 3A3WA 2D22A 3SGUA 4ENLA 1C8XA 2ISFA 5JBFA 4ZQMA 3F5LA 3ERPA 1MXDA 4ZQOA 4WEVX 3CAWA 4P61A 2NX3A 2ZX7A 1CGVA 4HTBA 4OBTA 3LPOA 1HKJA 4MDOA 1DWIM 3AXMA 4PCFA 1XLHA 4GHRA 3PZUA 4HCLA 1EYWA 3CV7A 3KVKA 3O1NA 1U83A 1P7TA 1SJCA 3EWUA 3ZLFA 3VIFA 1P6CA 2E9LA 1YTKA 2Y7FA 6CGTA 1MSSA 1Y0EA 3GH7A 2W63A 4A3HA 4BCEA 3BCDA 1IXNA 4UC5A 1ZJHA 4K6AA 3R12A 1IXQA 4F48A 2BLEA 1H63A 1UYQA 3VD4A 5CGMA 3GKAA 3M5ZA 1O12A 1FUYA 1K8CA 1M68A 5LKYA 4IP4A 4Y9MA 3ATZA 4ES4A 1YHTA 1QDSA 3H7UA 2Z7KA 4FX7A 4PN2A 3GHUA 2Q71A 3A23A 3TK7A 3GUWA 3N2XA 1O1ZA 4MM1A 1ITUA 3IWPA 4L4PA 3CAQA 4CD7A 1MQQA 3GDBA 3COTA 2R9RA 4LUSB 1OYCA 4AIEA 1XLDA 1EC7A 4UNKA 4B90A 4O10A 4PULA 4ZBCA 3TWBA 3B03A 2VMFA 1YXYA 1CXIA 1AK5A 4O50A 1E0TA 5H8MA 1PWMA 3FYOA 3TP4A 4S2BA 3CWNA 4AEOA 2PRHA 5CH9A 2YDQA 2WZEA 4A3YA 3B3DA 1XFBA 1M7XA 1O5KA 5FJJA 3GZAA 3GU1A 4MY8A 1QNOA 4M3PA 3V3WA 3VZXA 3OG3A 2C0HA 1E6XM 3MU7A 1CXKA 4PZVA 1TVPA 3N2TA 3TFCA 1MDLA 1OX4A 2V5BA 4IGMA 5DMNA 1E5NA 3AS2A 2BWGA 4F4RA 4DZIA 3DKLA 4DWDA 1XLIA 5A2BA 3NQ7A 1EOMA 4YIWA 1KBJA 2WB5A 3BAXA 4H00A 2ZX9A 2JBMA 6PTDA 1GQIA 1ZZMA 4ADSA 3CB8A 1UPMB 4DUWA 1I2RA 2XN1A 3ARQA 4JFVA 3WYZA 3PS7A 3W75A 3W28A 1M01A 3VKCA 4D8AA 3ZIZA 1THFD 3I4EA 1JVNA 1XSKA 5H8UA 3CUFA 2W67A 3HGSA 4RDZA 1E3XA 1WOAA 1ITXA 1W56A 2PI6A 4TVCA 5I3HA 1ZNNA 3M0ZA 3DDMA 1G01A 3O6DA 4MLJA 3CTTA 4GC3A 4KCWA 1CB7B 3TC7A 2X09A 3OA3A 1IIHA 1UUOA 1PWLA 2J4GA 4OWGA 1FWFC 1LLOA 3W26A 3S2CA 4QLJA 2G5WA 1H09A 3TN3A 1J6OA 1YW1A 2FDSA 4HZ7A 1DXIA 2X0HA 2XIJA 4YHEA 2AL2A 5CG7A 3VINA 2WSPA 4KCVA 3EYPA 4H9YA 5BOOA 4IJRA 4IG2B 3JW7A 3SDOA 2OWCA 1W37A 3QRHA 5TIMA 3N6JA 4E3VA 4Q7NA 2GK1A 3IUDA 4W85A 1EEPA 1VD6A 4S23A 1AW1A 3BMVA 1GUVA 4IFKA 3UBPC 2FIQA 3B8SA 4KGJA 1YPXA 5I3KA 3P3BA 1H3GA 3LI0A 4DWSC 2HROA 2E6FA 1F74A 2WYSA 5C2CA 5REQB 3LSBA 1DQXA 4LVAA 4FF5A 4RV3A 1V3HA 2FFCA 4AWSA 4DJDD 4QAWA 4XBKA 3FEMA 3QW3A 3P7YA 4HZMA 1VB9A 3Q94A 1RUSA 2D2GA 2Z6JA 1F2JA 3W7NA 4ZB2A 3WK1A 1LG1A 2QLYA 4J3VA 1R3RA 5FA5A 4U10A 1SO6A 2WZMA 3GC5A 3GDRA 4NY2A 3VNZA 1GQJA 3PBYA 1AH4A 2WM1A 3BC9A 5E0CA 1B57A 3G8EA 5LIYX 3UG3A 3CMFA 2X2GA 2RDXA 3OQ8A 1QNSA 2G8ZA 4WK9A 5D05A 2QUTA 3CYVA 1EDTA 1ESWA 4OUEA 3LHWA 2PMQA 4AB4A 4A35A 3LLFA 1ME8A 1J9YA 4L64A 2WV8A 2IKIA 1ISZA 3L12A 1TMHA 4M56A 1UHVA 4GGBA 4GD0A 5D2YA 2VFDA 5AHNA 2VL4A 5AN7A 1PO9A 1SUXA 1V6VA 4AVFA 5C9XA 3SCTA 3GFZA 3QZEA 2OKTA 1QHOA 4ZODA 3TTSA 3OEXA 3R0UA 3CQJA 1KKRA 4QBXA 2XSBA 1UC4A 3TYBA 4U33A 2O9RA 3GK0A 3QPZA 4LJ3A 1LL4A 2YBTA 4QR6A 1ISYA 1TTPA 3VMNA 1K03A 3FNDA 2DIJA 1J5SA 4A6GA 1HFBA 4B92A 1RXOB 4HMDA 4JZ5A 3ARVA 4S38A 5CSSA 3TVAA 2C13A 1TZZA 4POCA 1W9BM 3H55A 1OVDA 4AF0A 3PUGA 5JBDA 3KS6A 2VYOA 4AY7A 2WQDA 4JCMA 2B7PA 1WKEA 1P1XA 4IIBA 3USZA 2WWDA 2R8WA 1PHWA 2EG6A 4JYFA 3EBVA 3POHA 3N15A 2CERA 5HWNA 4IUGA 4WUIA 3L7RA 3QV7A 2WOQA 5XINA 4DM1A 1DJIA 5BWAA 4XZIA 2GDVA 2HVMA 4HD5A 3WLJA 3VNIA 5G2HA 3UWZA 3KRUA 1ZFJA 3O6CA 2PP3A 2YLAA 4JTAA 2NQLA 2Q3RA 2XVKA 2CLOA 5E09A 5E0FA 3WMCA 1OD8A 4UQEA 3PUOA 3NUKA 4HSHA 2WZIA 2QZRA 3MZ2A 4A21A 3UPMA 4JBRA 4QROA 3TEVA 2DSVA 2ZX5A 3LM3A 1X7IA 2Z24A 1X39A 5HUPA 1K8YA 4JN7A 5HWMA 5LXEA 1CTNA 3FJ6A 4O17A 2E5CA 3N18A 1PUDA 2J75A 1YNQA 3O2LA 4LUTB 3GVQA 3VXGA 1FDYA 1XBYA 1DJWA 2DFAA 5H91A 3P14A 2NSOA 2YA1A 5GNXA 3OW1A 3ARTA 4PC8A 3UNDA 1BKHA 4K3ZA 2JF6A 2FPYA 3KOXA 1E73M 3QHOA 2RKXA 4HA4A 4G7EB 1AUSL 4PCPA 5LNUA 2PURA 4BEQA 3DI0A 1ZP4A 3PG8A 7TAAA 2V3GA 2VC6A 2XJ7A 3C52A 4J28A 1EUAA 2XYLA 4MLRA 4R27A 4ZENA 2HTMA 4HJWA 1D3HA 3CBWA 1UJPA 4EAMA 3DECA 3FOKA 5LA2A 1UD8A 3UWWA 1ZRQA 3R2GA 5T9CE 2QCHA 4U4MA 3WF1A 4NASA 4YLWA 1BWVA 2PDUA 1KCKA 1S2VA 1YKWA 1S2UA 3POCA 1TREA 1LOLA 1V5XA 3HPSA 1UWUA 3L21A 5E6ZA 2A0NA 3T6CA 1E9YB 1NWUA 1IZJA 3S6DA 5IRPA 5LNWA 4BQ3A 2WHLA 5CLTA 3DFQA 2FHFA 1HVXA 4JL1A 1F05A 1V02E 2GOUA 1MDRA 3TA6A 2XTKA 1V3LA 4LRSA 3VDBA 1PKMA 3W7OA 4K8HA 5GJPA 3K1GA 1VGAA 3HMJG 1JL8A 1UIOA 3P8JA 5F2IA 3NZ1A 1T6MA 4FA3A 4MWAC 2NXGA 5FEWA 3APYA 3UY7A 3WEZA 1WUEA 1JCTA 2PB1A 4M1BA 5G1TA 3UU0A 4L4MA 4MYXA 1QW9A 4UTLA 4TX6A 3ZXWA 2OWXA 1R30A 1PCWA 2PWEA 1G4EA 1N8IA 3EA2A 2R1LA 1YTEA 1JZ7A 1B3VA 8XIAA 3DHPA 1ZJAA 4NZ4A 1ISWA 1E55A 1FH8A 3MMWA 1S38A 4QSHA 3N9SA 1VS1A 1G1YA 1TMLA 3VU2A 3G6MA 2TSYA 1XRFA 5K9CA 3QBUA 2RH9A 1Z44A 5G4HC 1QXLA 1LDCA 4ZB5A 2D20A 3E38A 1C92A 3WBWA 1RJRA 1Q6FA 1JNDA 4JTUA 1Z3NA 4ERAA 3YPIA 3URBA 2FLIA 3H22A 2W91A 3LRMA 5TD4A 1ZJBA 3A4JA 5C9RA 5EPDA 2GGEA 4XUYA 4YXGA 1ICPA 2V63A 2W6RA 2YBVA 3RN6A 3TQVA 3MP5A 4U28A 5F4SA 2Y88A 4GBUA 1ZBCA 1NOFA 3PNUA 4PEKA 2JEQA 1WDRA 2C3ZA 4ZOEA 1BEUA 3B0PA 5AYYA 5E9XA 3D46A 4NYUA 3AQUA 4QITA 3CUHA 4M0XA 1VR6A 3PWIA 3IPWA 1JYXA 2PAJA 3ARWA 3ZJ7A 1ALDA 1LWJA 3STCA 5REQA 2YCJA 1CYGA 5TQLA 1WB0A 3QPYA 4RPQA 5HPOA 3PTKA 4P8WA 1GOIA 2YKKA 4YPJA 2A5HA 2WKJA 1KRMA 1XLGA 3GVVA 5DMMA 3VNDA 4J27A 2DW6A 3GVGA 3EXRA 3AUJA 4DJDA 1WZAA 2GJXB 2E77A 1EHAA 3FYPA 3SUTA 1F3TA 4DWSA 3KUMA 3QOKA 1IT0A 4CD6A 2QAPA 5DN1A 2HZGA 1LQ2A 4A05A 2I5IA 4BF5A 4YTRA 5T8GA 4O54A 4MNJA 1YMYA 1CGTA 3LHZA 2HXTA 4BQ5A 1PS9A 1PIFA 3BK0A 2PTWA 1BAGA 5EMYA 1HL8A 3VUSA 2J79A 3GY1A 2GUYA 2ZE3A 3QZAA 3TZNA 4UQ9A 3TCSA 3CU2A 3P80A 2QEZA 4B4HA 4P7RA 3KTXA 4F79A 3QSTA 4JTRA 1L2QA 1A5MC 3UR8A 2QNEA 4MZ8A 5DY2A 2FHBA 2GWGA 1TELA 3WIJA 1NY1A 4W7UA 3FXGA 4TTUA 3KDNA 3IIOA 5D38A 3HGOA 4H9VA 4WXYA 3BICA 5DO8A 3WF2A 4AY1A 5D2VA 3A3HA 2D1ZA 3CH9A 2P53A 1AZ2A 1DL3A 3NZPA 4D6CA 3CZEA 3N2MA 3L23A 3S1WA 3MQTA 3WL1A 1KFJA 4C5YA 4DUOA 4GH3A 3WCZA 3VGFA 1WUFA 3NGJA 1QT1A 1GQLA 5MKGA 3TYDA 1MQPA 3NEVA 4M7TA 5HMEA 4PA8A 3WQDA 3Q37A 4LU0A 1JFXA 2BVDA 3BSGA 1OK4A 4MFDA 3SRKA 1OIMA 4QE4A 4FZIA 4XIAA 3BL3A 1IEQA 3M44A 1R47A 5A3HA 3FA4A 1S5NA 3LQLA 3S1UA 3M0KA 4PR4A 5A6AA 1XDMA 1IQ8A 1XIMA 4QISA 1REQB 1DTNA 3B4UA 3SRFA 3QKEA 1KGXA 2ZDSA 1QPOA 5AZ0A 1C7SA 1N8FA 2QGYA 1EH9A 3C0LA 2AQWA 3VKJA 4F8XA 4UTTA 1KCLA 3GTIA 1CDGA 4DZHA 1T40A 2P3ZA 1T8QA 5I7GA 3UXIA 2WCGA 1QWKA 4E2OA 3R5EA 3QY7A 4H7VA 3WDPP 2EEXA 1XIDA 4M1RA 4WY0A 2XSXA 3B04A 4HNTA 1XD1A 1DWFM 3MJYA 4JTJA 3XISA 3GR7A 5C6MA 3IJ8A 1FKXA 4UMAA 1PKLA 6XIMA 3T09A 2QUUA 1PTGA 1XSJA 2VD8A 3QH2A 3N9KA 3CHCA 4LYQA 2NLYA 1TZ7A 2GJNA 1U30A 1YNPA 4FS9A 4WIWA 4ZXOA 1WZLA 5C55A 4ICCX 4L1XA 2AGKA 5EA9A 4B3ZA 2GVGA 3UGRA 2O55A 1TG7A 4CNUA 1C8VA 3VCNA 1VBGA 2PDGA 1JPMA 4GQ0A 4KBXA 1T5AA 4XZMX 1JG9A 4AWUA 4HA0A 3W9ZA 3GTFA 1I2QA 3VFCA 2A3LA 5GPRA 1WKYA 2CLLA 5DX7A 3EA1A 1YADA 4UBPC 1GYNA 4PMDA 1XF0A 4Q8VA 5CJNA 1RR2A 3VOJA 1UIPA 5IDIA 1E40A 3L2LA 4OV9A 4GFSA 4L80A 2OWWA 4O1BA 1GOOA 2X41A 5C71A 2AQOA 3VNLA 3LCWA 4B2DA 5I3FA 5LA0A 1G4PA 3S4TA 3NQMA 4H6EA 3P6LA 3PAJA 4DJDC 3KX6A 1S46A 1IWAA 1BVNP 4XIMA 2CCRA 5IFPA 3ES8A 3V1PA 1A53A 4YTTA 2A7NA 4RE3A 4I8DA 4I7UA 4WRHA 3BLIA 1CB2A 2BVYA 3BG9A 3STGA 1GPFA 2OR2A 5D09A 4D72A 5BOFA 1XJBA 2EBNA 2BVWA 1JUKA 2VT0A 4YCPA 3ALGA 4C6IA 5F4XA 1KC7A 3WQ4A 1AVAA 3LBCA 4ONVA 1HJWA 3BMWA 3N9RA 5I09A 3U2EA 1WO2A 1TVLA 2E0PA 3NL6A 4IM4A 1EGMA 2ZFAA 1TPVA 2ZRXA 4Q33A 4JQ1A 1CXHA 1RPKA 1U1UA 3N3TA 3W2KA 4XKYA 2EG8A 4AMAA 2G50A 3ZYZA 1WQ5A 4HQVA 4X61A 3P2VA 3DCPA 3AZRA 1KXQA 3AOFA 4XAYA 1F7BA 1U5JA 3NJ3A 3TTOA 3HIJA 1C9WA 1TV4A 1IE7C 1A5UA 2WMIB 1KB3A 4NAFA 3R6IA 4I9MA 2V5LA 4GXMA 3LZ5A 3KBVA 2GJLA 5I07A 4HA3A 2YXXA 3F4CA 2Z26A 2ZWZA 3QN3A 3TJIA 4C6QA 1GHSA 4K37A 3TJ4A 5CPOA 1S1PA 1F76A 3LBMA 2ZWYA 4XAPA 1OF8A 4LY8A 4HHHA 3QKZA 3CT7A 2ON3A 1EJVC 4TVDA 1BYAA 3CB3A 4OQVA 3IJDA 4LVGA 3AJXA 1KW1A 1UKQA 1EL3A 3W1TA 4DELA 2C91A 1UB3A 1XIFA 1MO0A 3UJ2A 4C6JA 4DNMA 2VFFA 4AX7A 1CGUA 4V27A 3DH7A 2O9TA 4EPKA 1KM6A 3LMZA 2W9MA 2WMKA 3FVDA 4G8TA 4A8LA 4NJGA 1BWLA 4PMQA 4PMRA 1EOKA 1T99A 5GVJA 1VF8A 3U2CA 3FK4A 1W9VA 4Z1CA 3EGJA 3RAOA 4K36A 1XRSA 4JTCA 1NP0A 2P0OA 2OQLA 1J79A 1ZJIA 1VENA 3K8KA 4TU1A 1FWHC 2V81A 3FXYA 2I14A 4GCAA 1HL9A 3PBVA 1UW9A 4GX9A 3CWHA 3WLLA 1BVWA 2HVNA 1IEXA 1ME7A 2EPMX 4QJ5B 2WVVB 2C79A 2VZUA 3SY8A 4LB4A 4LSBA 1A5AA 3K8MA 3QGAC 4ERGA 1TQJA 4O0QA 2BY3A 1NIUA 3GG8A 7ENLA 2QPSA 3WBEA 3CASA 4DO6A 2IPGA 4FHAA 2UBPC 1DXEA 4OBSA 4GY0A 1ZY9A 4LUIA 1BTMA 9CGTA 3W76A 1ZBKA 3GXDA 3E3HA 3ABOA 5IBXA 3VDGA 4HMCA 1RV8A 3S46A 3TC3A 1F3WA 2CHOA 3FV9A 4XD4A 1NFPA 4YCOA 2PDMA 2G3FA 4ZFCA 1UKTA 2DZSA 3QEZA 3GKFA 2PLMA 4MVAA 2ZOXA 3W7RA 4TMBA 1ZBWA 1ZSXA 3PZGA 1S1RA 5G2IA 5BROA 4E2BA 5E9AA 4LFYA 1VHNA 5BU6A 4JIEA 4Z2GA 3P0WA 4ZQCA 3W7CA 3ALFA 2ZZ1A 4JQ4A 1PBGA 2A6NA 3B9DA 3SQSA 3CV1A 3VK5A 4PE8A 1WCGA 4FALA 2NSXA 1H1NA 3WQ5A 6A3HA 4P2VA 3DFYA 3C2OA 3NTYA 3H2OA 1FH9A 1UR1A 2QT3A 3WEOA 2VEIA 2Y70A 4AHQA 2BOGX 1YQ2A 2CLFA 4IIDA 3SAZA 5C8BB 2XVPA 3F1QA 4KFNA 2XN0A 3F7JA 4JYEA 3H7VA 3MUY1 4KFOA 3PZIA 1OC7A 4BA0A 4GI6A 3UERA 1POJA 1E1CB 4A2SA 3G1DA 1J96A 3P84A 1YYAA 4G2DA 4RLIA 2VCCA 1O5XA 3L4VA 3GX9A 4MY9A 2YR1A 4JFWA 7REQA 2VFGA 1UJQA 1RK6A 2GGIA 4UMCA 1UD2A 2YZRA 2WNWA 1YE4A 1H1YA 2DUZA 1UR4A 3H12A 3AU2A 4GNVA 1G7UA 4HTYA 4US5D 1UP0A 4XSMA 3CLMA 1V3MA 2IKGA 4I8YA 3QM3A 3L65A 4J2PA 4LT9A 4OHQA 2BZNA 4NP7A 3E5BA 3GC2A 1MI3A 2PCQA 2VGGA 1N82A 2LLEA 4HPHA 1LOSA 2ZX8A 3VIJA 2X7WA 1KO0A 3WH8A 4LAUA 1QO2A 3MPGA 3JR2A 4K2SA 3TC6A 5EMMA 4FIQA 2V38A 4XTDA 1C90A 2R1KA 3THDA 1TTJA 3BGAA 1KR0A 1Q4WA 3E0IA 2KX9A 3UF9A 4BK9A 1Q6QA 5HANA 2HSAA 1FA2A 2X0YA 3Q2DA 2J6XA 5A8NA 1B5TA 3SN1A 1JDFA 2V30A 3WH5A 3EPMA 1LROA 4GJJA 4UFMA 5C9UA 4AD1A 3THAA 1C93A 3UW6A 3N1AA 1BXBA 5LNVA 2YZ5A 4H8VA 1EB3A 4JTIA 1J5TA 1VBUA 4HP5A 4AZ7A 3V5CA 3BZGA 1WDPA 4DWSD 2OT0A 5DCDA 1O4UA 3VGBA 3C2FA 1QRQA 2OZ3A 4S3DA 1BHGA 1ONRA 2JE8A 4HVXA 3FGCA 3AZTA 4P7QA 1R2RA 1W5OA 3VIMA 3WLRA 1UZHA 3C3UA 3T42A 2NT1A 4RZ6A 5JUVA 2QCGA 1O60A 3I3BA 5EFDA 4C1KA 1V77A 4Q4MA 4PB3A 3SCUA 4QQ3A 4CU8A 4UMBA 1EGVA 3SCVA 4H9MA 5HUOA 4IFOA 3W1MA 3V16A 3NDYA 3QMTA 1DQUA 2GOKA 3IAPA 1ZUAX 3BWWA 3T40A 3PULA 4O52A 3K30A 2VWTA 8XIMA 3KRBA 4Y8FA 4B5UA 2QV5A 1MMFA 4IXHA 1XDJA 1PX3A 4QNEA 1CIUA 2EHHA 3BMXA 2ISVA 2QKFA 4FNQA 1MEWA 1W3LA 1GJPA 1YBQB 3OG2A 2DZVA 3T44A 1AZ1A 3NVTA 4HHPA 2QAFA 5FEZA 4MFEA 1DOSA 3K5XA 3LTSA 3F2DA 4S3BA 3SGZA 4FPSA 4IHCA 1M65A 2TPSA 4IPJA 1P0BA 3A47A 1RVKA 1HJVA 1R5YA 1F4AA 2CZFA 4O4WA 3K4AA 1Q63A 4O57A 2VI0A 3M0YA 2NXIA 3PBWA 2EJAA 3U8GA 4W9TA 1KFWA 1RHCA 4L1WA 1CI1A 1UUQA 1OFDA 2VZOA 3W70A 5CC6A 3C6CA 3MDUA 5EY5A 1A3HA 3NPVA 4QJ4B 4DYJA 3T8QA 5IXEA 2WJDA 1SVDA 1TPC1 2BXVA 3JRKA 3B8WA 1A5OC 3SJ3A 3WK2A 4N9EA 2PFHA 3GNPA 3MKVA 2AKZA 3HU7A 1EJRC 2WJFA 1AG1O 1FWEC 4WCJA 1W1A1 4AFYA 3BVJA 2WXDM 2BSLA 3IIPA 3LPFA 4PRWA 3MCNA 2OSYA 2V2CA 3HTWA 3RIKA 1NDZA 3EDFA 1HKMA 2BXYA 2CC0A 1Q66A 3URNA 4PRTA 1L8PA 1GEHA 2RDTA 2XH7A 5H6HA 2ANUA 2VZVA 2XHYA 3RCYA 3UXAA 4O15A 2EQDA 3W27A 3FJNA 2VP8A 4JX5A 1Q13A 3T0AA 1SU5A 4HNLA 1BF2A 3ZO9A 4Z2IA 3M4HA 4KWUA 4MJMA 2V6AA 4RPPA 4HB7A 2A7PA 4O1FA 1H49A 1KFCA 4RZBA 4B91A 3TLQA 3M43A 3OYZA 4GNJA 4NNBA 1WNOA 4Q8NA 3VNJA 1WDSA 1BRLA 1VIZA 4M6VA 3L9CA 3LNPA 1EF3A 1SMDA 1YXCA 2PF8A 3KZSA 5J5DA 4Z17A 3W7EA 2C1IA 5FCZA 3WUBA 2X05A 4QEHA 1BRLB 3WSUA 2J25A 4PSRA 4B2DD 3TQPA 1NTHA 3G77A 4AYGA 4IQJA 3BURA 4BF9A 1I4NA 4F0SA 2YW3A 1UR8A 2ZICA 3P93A 4G6CA 4C65A 2PTZA 3IIZA 2ACQA 3LCHA 1NELA 1BQCA 1GOQA 4AX6A 5ECUA 1EX5A 4RJEA 4EWJA 1CWYA 3WLHA 2TODA 3GU2A 3M7WA 2PDNA 5HXMA 1Z7AA 3FKRA 2J9XA 1JZ8A 3LCGA 2VOTA 3GFYA 3U5YA 4LC6A 3PUDA 1Q45A 4UQAA 3OIHA 3W74A 3OVRA 1R85A 2PDIA 5DMYA 5C5YA 1X98A 3ENLA 3W72A 1J0ZA 1CBGA 3PSWA 3CAVA 4I5XA 4M80A 1YXDA 1GYMA 1CXEA 3ABQA 3MY9A 1X8CA 1T7LA 2DT1A 3FKKA 3LEPA 4IT1A 3AICA 3HV8A 2ACSA 4DPPA 1YNYA 5G4EA 1EF2A 2FPVA 1X97A 2BGQA 1Z41A 3BOLA 4AW7A 3ITLA 5EMJA 5AHLA 1B90A 3M9YA 5A2CA 1M1BA 2GVYA 1XLLA 1XUZA 3OGRA 3TONA 3VA8A 3UZWA 1HX0A 1TUFA 4WJ8A 4X3ZA 3UT0A 1WP6A 2Y7GA 2PPGA 4PCNA 4AISA 1EYEA 4W89A 2VDIA 3AFBA 4OOUA 4DEFA 3T8LA 1O7AA 3LU2A 4NZ5A 4XZBA 5HNUA 3DAQA 1W3KA 1DHPA 2PD5A 3H53A 5AKQA 1E43A 4UTIA 4M82A 4CQ8A 4LCRA 1V3JA 3DGRA 4FXJA 4AHPA 4HMEA 5KZEA 3THQA 5FJIA 4DRSA 5CCZA 1KRBC</