4ICNA

Dihydrodipicolinate synthase from shewanella benthica
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
300
structure length
300
Chain Sequence
b'ESWGSHMINGSIVALITPLNSDGTVDYTSLEKLVEYHITEGTDAIVAVGTTGESATLPISEHIAVVGQTVKFASGRIPVIGGNGANATAEAIELTKAQNKLGVAAMLGVTPYYNKPSPKGLIAHYTAVAASTDIPQILYNVPGRTAVDMLPETIAQLVEVPNIIGVKDATGDVARVKQLRDLCGNDFLLYSGDDATAREFLTLGGDGVISVANNIVPKLFKLMCDAALAGDTQAAMAAEDQIKGLFSALFCEANPIPVKWAAHKMGLISQGDIRLPLTELSTEFHGLLLDAMKNARIEVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDRODIPICOLINATE SYNTHASE
publication title Cold enzymology offers insight into molecular evolution in quaternary structure
rcsb
source organism Shewanella benthica
molecule tags Lyase
total genus 102
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4icnA00
1LDCA 3W7LA 1AW2A 3W83A 1HO4A 4ZVJA 5DBTA 3W85A 3RFAA 4N4QA 4JX6A 4Z1BA 4PFMA 4AF0A 1TV7A 1OFEA 3ZFHA 4DEFA 4TMBA 2FIQA 3KVMA 2ZTJA 3W71A 2QF7A 3W7HA 3FA5A 4LNYA 3FEMA 4AHQA 4A21A 3G8EA 3LLDA 1KBJA 4FNTA 1TSIA 3HB9A 3TAKA 4GXMA 1EUNA 5AHMA 3E12A 3KAOA 3LOTA 5C55A 1ICPA 3GR8A 4FO4A 3HPSA 3UXAA 3M44A 2X2GA 1O60A 3W7RA 2F7FA 1EP1A 1Q3NA 4YL2A 3EWUA 3UD6A 3NGJA 5IM51 4C1KA 1PV8A 1HUVA 4I7WA 3G1HA 1B3OA 5AB3A 2Y6ZA 4QQ3A 3BGJA 4CNOA 3LTSA 4UTIA 1AK5A 1JUBA 1TYGA 1R2TA 1DQWA 2Y70A 1PCWA 4S2CA 2XN1A 1W5PA 3PWAA 5U4NA 4XKYB 3LCHA 1LLWA 3ZWSA 2RDUA 3B04A 4JDBA 3C0JA 1JR1A 1EUAA 1C29A 3EWWA 1GWJA 3NQ8A 1TPWA 4AHPA 1PL9A 4PA8A 3GB6A 2NXGA 4K8EA 4MOZA 4RR4A 2Z2UA 4ZQOA 2QCHA 3C4UA 4M7SA 2BX7A 4FNPA 2ZZ3A 1J4EA 2A6NA 3HIJA 2CLMA 1TV8A 3DFQA 1JULA 3G18A 3MP5A 4UTLA 2YSWA 2E77A 2VKZG 4N6FA 3TA6A 4UXDA 2E1DA 1H7RA 5DN1A 4I9AA 3ZR4A 2H3DA 4LW7A 3B06A 1AL8A 4NX5A 3TR2A 5BNKA 3UNDA 3ABSA 3RMJA 3GXPA 3FJ6A 3SI9A 2NX3A 3W7QA 3CB8A 1BEUA 2ZFAA 3IVUA 4GNJA 3K30A 3NQGA 1K03A 5HQEA 5F2IA 2PRHA 5TQLA 4MKNA 3EX1A 2A21A 2A7PA 2CLLA 1SR9A 2H8ZA 3W7PA 3W2UA 1NEYA 1X1ZA 3P67A 5AHLA 3PBVA 3N9RA 3A24A 2W6RA 5F4SA 3W1PA 1SZGA 3M16A 1N55A 3P5YA 5D04C 2YPIA 1HL2A 4Z0SA 4DBDA 5CG7A 3IEBA 3C3NA 4NQ1A 3HGOA 1ZY9A 5KZMA 3W73A 1FQ0A 3LCGA 3O8AA 4IXHA 4Q4KA 1YPFA 3T78A 2YXGA 3MO7A 3PC0A 5J5RA 2Q8ZA 3LXBA 3TC7A 1SPQA 1DL3A 1VYSX 4K38A 2WSRA 3W1RA 3MJYA 5FF2A 3LHVA 3NPWA 4XBKA 1OF8A 4ZL1A 3UWVA 1LBFA 4JNMA 2NXHA 2GJLA 3B0PA 2I1OA 5D05A 1TPH1 3HJZA 3QMRA 2ABBA 1TRIA 2Y62A 3LDVA 3C8FA 4ML9A 3QM3A 4JXCA 3QW4B 4AEOA 4EF8A 2DJXA 4Z0JA 3W22A 2J27A 1GVQA 2QJGA 1O5XA 1ICQA 3IVSA 1K02A 2Q3OA 5DY3A 1VHNA 2OZ0A 4GUIA 4LS2A 4O11A 4LVDA 5BMWA 2QUTA 3BV4A 3S5YA 2VFFA 3UQNA 1LRTA 4RZ4A 3KOFA 1KTCA 1FCUA 1XCFA 3HMJG 1BKSA 3NL2A 4HNVA 3W7CA 3JRKA 5I3HA 4RZ5A 1ME8A 1P4CA 2HS8A 3PF3A 1PE1A 3W72A 1GPWA 1IIHA 3LCIA 2ZZ2A 1W37A 5CSSA 4FEZA 4JD4A 1OYCA 2GQ9A 5EA9A 1IXNA 1JVNA 1H7WA 3LCXA 1DBTA 4H6KA 4O18A 1OFRA 2V82A 4GFSA 4QNWA 5IBXA 1XDLA 5G2IA 3P61A 4LVAA 1QOQA 3FYPA 2C0AA 4JGDA 2HMCA 2JKAA 4HIBA 3C56A 3STGA 1UBSA 5K4XA 3KRZA 2A7RA 2RH9A 3LTPA 2QCDA 1TMHA 1DHPA 1OYAA 1VQTA 4O1BA 1SW7A 3DFNA 1LRQA 2NLIA 1LBLA 3EKLA 4LC8A 3I68A 3IV3A 3TAOA 2ATMA 3CPRA 1XL9A 3PSVA 3QEZA 3SGUA 4LY8A 4Y90A 3QQ1A 3TIMA 4Y8FA 3G1XA 1FY6A 1W5MA 3PBWA 4RJEA 3W74A 2WOQA 3W7OA 1V7YA 2ZA3A 3N2XA 3W84A 2CLIA 5LNWA 1W1ZA 2P10A 3E0IA 3M5VA 3W70A 3TSMA 1ZNNA 1UCWA 1VCVA 5EPDA 3S1UA 2PCQA 3HO8A 3O6CA 3PB2A 4MIMA 5FF4A 4TU1A 1JCYA 5D30A 3QPYA 2YYUA 4MZ1A 1MZHA 3QRHA 1NVMA 4ZQPA 3WFAA 4M5PA 1ALDA 7TIMA 1U83A 1TTQA 5G2WA 1XXXA 2QCCA 1JCMP 2G5WA 1SO4A 5K9CA 1RV8A 3KX6A 3N3MA 3NPUA 1A5SA 2WNZA 4A22A 5HR6A 3NL3A 3M5ZA 4LS0A 4CQ8A 2IQTA 3W2NA 1QO2A 5K9DA 3L67A 4QAIA 4MY1A 5HINA 3EEGA 4DO4A 1PCKA 4NNBA 3D0CA 2QEZA 4BI5A 4MYXA 2X1RA 3LV5A 1GVSA 4LV4A 5KTLA 1FWWA 1O95A 4BI6A 5LHEA 2ZYFA 1FXPA 2O7QA 4OWGA 3F4NA 4QSHA 4HKPA 3BGGA 1AL7A 4YCOA 3NR0A 3DKLA 1I2PA 3GIYA 3LTYA 5H2ZA 4ORIA 1S3HA 4QJ1A 2CZ5A 1H1ZA 4PEKA 2YX0A 3MBFA 1W56A 3L2IA 3EX2A 1TREA 3LHZA 3W2KA 1SW3A 3THQA 1FDJA 2FB2A 4RLIA 1SFLA 3M47A 4CCDA 1T0OA 3W2MA 1XKYA 1TV5A 3DI0A 4UMBA 4HSOA 1B4EA 4X2RA 4G1KA 1IXPA 4BI7A 1JUEA 3DI1A 1S5WA 1SU5A 4ADSA 1WYIA 3L5LA 3MP4A 2J9XA 4Z1AA 3HOJA 2J88A 4O16A 3EWBX 1H63A 4JX5A 4OU1A 1ME9A 2FPYA 5AC7A 3SR7A 2GJNA 3GDTA 1X6UA 3S1VA 1XBZA 4AHOA 2ZA2A 1M7PA 3LCLA 1TIMA 2FQIA 4AWTA 1LZOA 5D2WA 3ZWTA 5G4WA 4DF0A 1TCDA 2V2CA 3L68A 4FX6M 1DV7A 4HNNA 3RLVA 3N34A 3ANYA 3FYOA 1G7VA 3W1AA 4LUIA 5KSWA 3SSJA 2WKJA 4TO8A 5AFDA 2UV8G 5LZLA 5FF7A 4Z1CA 3TQVA 1KA9F 2OMAA 1WBJA 3QH2A 3LRKA 4IMDA 5HNRA 5FEZA 4N9DA 4UFKA 2OJPA 3P7YA 3OVRA 1R2RA 3PBUA 4DPPA 3PB0A 3M0ZA 1ONRA 3GAYA 3SFKA 3H55A 4JDYA 1GVOA 3TJLA 3MWAA 1VYPX 1OFPA 1A53A 3WJYA 4O0KA 3Q94A 1KLZA 3RK8A 4E2DA 4CQ9A 3SJ3A 5TBOA 4JX4A 3A5FA 2YGYA 2CZDA 4JTSA 1VS1A 3MI6A 3P62A 3VFLA 2DZUA 1WXJA 1F76A 3BLFA 2YCEA 4O12A 1LTDA 3TROA 5CZJA 3MYPA 3N9SA 1H7OA 3CU2A 3TUUA 2NWRA 1JCLA 2B7PA 1KM6A 2Y7GA 1N8FA 2Y88A 3UWQA 1GOXA 4OV9A 2AAMA 1TTPA 3HPZA 5I3FA 1W3NA 4KFPA 5E0KA 3OBKA 3IGSA 1KW1A 4CCEA 2GPTA 1MXSA 2WNQA 2B7NA 3G0XA 1K7XA 1QCWA 3ATYA 3S42A 3OVPA 4LRSA 5F4XA 2A4AA 4ADUA 1VH7A 1FCVA 3NAVA 3W1XA 2E5DA 4L4LA 5CZ0A 2DJLA 1RQBA 3HG5A 1OFQA 1LOQA 1F6PA 2BWGA 2QJHA 4WY0A 3HF3A 5L6UA 2DORA 3NNTA 5AHFA 3TU9A 4UTUA 4JTUA 3CHVA 3RLUA 1X7FA 1C9DA 4WY0F 3LI1A 1ZCOA 3F4WA 3LX9A 4A3UA 2NWSA 3C61A 4IX0A 5EYWA 4X22A 1H7PA 4WOQA 4O8RA 2ZRXA 1L6WA 3I7SA 2NZLA 2C14A 1KBIA 1Z41A 2OX1A 1OX4A 4JY9A 5LGZA 4UTWA 2RKXA 3NQAA 1RVGA 5G4EA 2CWNA 2G97A 1CW2A 2V2DA 4ONVA 2J9ZA 5F2LA 3BO9A 4IQLA 4O50A 4U28A 4ZQCA 1X1OA 2QAFA 1Z44A 2C15A 3QYQA 3PAJA 1RD5A 2CLHA 5K9XA 3EWYA 4NJJA 1G67A 3UZJA 3NYZA 1JQXA 1N7KA 4RXGA 1PVNA 3ATZA 3MYOA 1JRBA 5FEPA 3STEA 1U5JA 2DU2A 4OGZA 5I3JA 2LLEA 1ME7A 4OBTA 3AO0A 3C2OA 4IJBA 3DFTA 4B5NA 3TNOA 1XC4A 2DZVA 4O1CA 4C1LA 2Y61A 4ICNA 1JUKA 2Y63A 1K8YA 4DBEA 3C2FA 2VFDA 3W2LA 1EWEA 3PVFA 5BMXA 5U7SA 4E2BA 3KXQA 1H51A 2B4GA 4TX9A 3IIOA 4NX0A 1GVRA 2ZBTA 2ZA1A 4IMEA 4N9EA 2QDGA 2PURA 1YDNA 2TYSA 3QSRA 4FIRA 5AHIA 3PUEA 1Q6RA 3W7JA 1OG0A 1XDMA 2O7SA 1F74A 4O54A 1T96A 1KTNA 1VPXA 3M9YA 3TH6A 1RQEA 4A2RA 4UTMA 4NXKA 1T8XA 2Y89A 4MFDA 1FWRA 1YADA 1PIIA 4XWUA 3TDFA 5HUPA 5D02A 3L0KA 3SZ8A 1I2QA 4ORMA 1KM5A 1RQHA 1P1XA 4GE8A 3S5ZA 3N73A 3EWZA 3MI2A 3C52A 2ZCGA 4E38A 1GEQA 1SZNA 3BLEA 5AHEA 2YW4A 1IXOA 2JBMA 3R12A 1RR2A 3UPBA 1WA3A 4QISA 3P84A 5AYXA 4UTHA 1ZAHA 4XKYA 3W7MA 5KZEA 1IGSA 4LVBA 3DKJA 2B0MA 3TW6A 3T4CA 3M41A 4M6VA 2CLEA 4O10A 3R5EA 1K8ZA 3LB0A 1PS9A 3DHDA 3F1QA 3KRSA 4UCGA 5LSMA 3BPWA 1GZGA 2QJIA 3G1SA 4NVTA 2Y7EA 3LLFA 3LHTA 3W07A 3A21A 3E9AA 4MLJA 1XFBA 2HS6A 1TQJA 2VEPA 5CKSA 3QF0A 1D3GA 4GC4A 4Q33A 4LT9A 3KVLA 2CLOA 3NM3A 1K3UA 1TJPA 5DELA 4JTTA 4IOTA 4EVZA 4DQWA 4R33A 5HWNA 4GUJA 1GJPA 1TB3A 3LI0A 4AMAA 3BARA 1LBMA 5K4ZA 4QIUA 1EP3A 2H6RA 2XFWA 1A5AA 4LC6A 4IMGA 4RXFA 4UTJA 5CPOA 1KTBA 2ISVA 4JYDA 4FNQA 4M19A 1THFD 3ABRA 1ZHAA 3STFA 1YDOA 1TTIA 5F2MA 3GKFA 2YR1A 1D9EA 1KM2A 3V1PA 3OHIA 1J5TA 4XQ6A 5HULA 4IWWA 4WOZA 3CT7A 4DXVA 4PODA 2KZHA 2BTMA 4WZHA 3TSDA 4PC8A 4AVFA 5DXXA 2CLKA 1FWSA 2G95A 4IPIA 5D09A 4EF9A 4JR5A 1Z48A 3M5YA 4PL1A 1BWKA 5SWUA 3G3MA 3V75A 3NVTA 3WK1A 4POCA 1B57A 1G69A 4WXYA 1L9WA 2VEIA 3UZ5A 3W3OA 1QWGA 1IXQA 4ZQMA 1EP2A 4OE7A 3PS7A 1ML1A 5AYYA 1KFLA 3LGEA 2RFGA 3S9YA 5MHBA 4N6EA 4MPQA 5DXYA 2WSYA 1IF2A 3TE9A 2PE4A 5DBUA 2TRSA 1GYNA 1WDWA 4MJZA 4Y96A 2ZRWA 1H61A 5LKYA 2WO5A 4LUJA 3QMTA 1SQ7A 1WOAA 4XUGA 1NSJA 2GVJA 1LLZA 5CZTA 1DKWA 2Z6IA 1JJKA 1P5BA 2YW3A 3GVGA 2FPTA 5AN7A 3OVQA 4MVAA 3GKAA 3RNDA 3U2OA 3CTLA 2ZTKA 5HR7A 4UFLA 1EPXA 3O05A 1NF7A 2V2HA 1XUZA 1Z42A 1AW1A 2JKEA 4UUIA 5AC8A 3A9IA 1KFJA 1SSDA 3LCFA 3PG8A 3TJXA 4HSNA 1G4EA 2FLIA 3FJLA 3BK0A 1EB3A 1W5OA 3KVJA 3I7RA 1JRCA 3IVTA 1Q6LA 3GDMA 5EMUA 3BLIA 4DO5A 2JGYA 3GDRA 4W9TA 4GUGA 3I7QA 4Y9AA 4UFJA 1QPOA 2YFOA 4FNSA 4RCXA 1YXCA 3TSBA 2CU0A 1W5QA 5A5WA 3GYEA 2ZDRA 2OCZA 5GVJA 2Y7FA 4ALDA 4FX7A 3TXVA 1ZAJA 2DP3A 3BG9A 1YTEA 3LBMA 1B4KA 2QCGA 4N02A 1VR6A 1P0KA 1KFCA 3NQ6A 1VCFA 2C1HA 4HPXA 4L4MA 1QPNA 2ZZ6A 1LM1A 4IMFA 1TPVA 3C2EA 3ELFA 2H90A 4JICA 1H62A 5EKYA 3NG3A 3O63A 3PM6A 1MO0A 4LU0A 3W1UA 3NQDA 2V5BA 3MHUA 4BR1A 3QC3A 2QCEA 4O57A 1A5BA 1OFAA 5FF3A 4BK9A 1GVFA 3YPIA 4D2JA 5LNUA 5CZSA 1I2NA 3DH7A 4XTIA 3NZ1A 3P60A 5AHNA 4NUWA 2OT0A 3W7IA 2GQAA 3E49A 2R14A 2CW6A 2E6YA 4KFNA 3WK2A 1VGAA 3QPZA 1B9BA 1FWNA 4K36A 3HPXA 5HWJA 3GDKA 3BW2A 1HG3A 1UUOA 1MEIA 2X30A 3HG4A 2B7OA 3G1DA 4H4IA 1GG1A 3CIWA 4P61A 4O53A 5C54A 1YYAA 3M7WA 3A23A 3P74A 4BWLA 2V30A 3TK7A 3TFXA 5AOUA 3BG5A 4OQVA 3WK0A 3EXTA 3EX4A 1EWDA 5FEXA 1KV8A 3HG3A 3UXDA 3S1XA 2A85A 3GZ3A 1T99A 2EF9A 4MY9A 3L9CA 4KWVA 3QW3A 2OT1A 2H3BA 5CPNA 1L6SA 2QDHA 3P80A 4HPJA 4UC5A 1LROA 4QITA 3QMSA 3UY7A 3FOKA 3PG9A 5DCDA 2R94A 3FFSA 2BLEA 4UTWC 4UIOA 2WQPA 4UNKA 3CEUA 4IUOA 4O1DA 4HHPA 1KLYA 5K2ZA 2Q8LA 1XBVA 4GWEA 1KFEA 2J9YA 4LOCA 1MEWA 2PRMA 1FCBA 4HT3A 1OFDA 4IX2A 5LHFA 3DENA 2FTPA 5G2HA 3KHJA 4YWIA 2E6AA 1VJIA 1X8FA 3P5ZA 4M6PA 4A29A 2C18A 5BRBA 3Q2DA 5KITA 4WXZA 4UFIA 4UTTA 3QSTA 2VENA 1WV2A 1UASA 2WV8A 3FIGA 3ABOA 5DCBA 4IPJA 1KFKA 2YDAA 1GG0A 1HO1A 3TC6A 1GQNA 4K7VA 3L21A 4JYFA 2HTMA 4FIQA 4JTIA 5HWMA 1F2JA 4JTEA 2A7NA 3IGXA 1OHLA 3LM7A 3L0GA 4I7VA 5KZDA 5K7JA 2E6FA 3ABQA 2YZRA 5CPMA 2DZXA 1L2UA 4FX8A 4UFMA 4HN4A 1TPEA 1YTKA 1NAL1 3SGZA 3R89A 3R8RA 4MUZA 2QCLA 3PSWA 3A22A 1I8JA 1M5WA 3UY8A 2RDWA 3W6YA 4J9JA 2NV2A 3VNDA 3JR2A 3I65A 3NQVA 1TPFA 3CWNA 3LV6A 3PUDA 4JIPA 3I6RA 2ZQ0A 2ZRZA 4WUIA 1M7OA 1WQ5A 3MHGA 1ICSA 4UFHA 1JCNA 3RF9A 4RV8A 4X9SA 3UWZA 1K7FA 5KINA 2NUWA 2EHHA 3MI3A 4N9BA 2CZFA 4BF9A 3S0CA 2H8XA 2E5BA 1G4TA 5D2TA 2C13A 3G1FA 4O1AA 4K7YA 1O94A 3SY5A 2ZZ1A 2V8ZA 1KM1A 3G0UA 3TQKA 1FDZA 2WNNA 1OVDA 1SO5A 4ZQNA 1FCQA 3WJSA 2WSQA 5EL1A 4MZ8A 1GTEA 2G96A 4LWWA 2FB3A 2ZRVA 4YCPA 1WBHA 3W88A 3HGJA 3BG3A 1SO6A 3PY2A 2EKCA 5J5DA 3GAKA 1NFBA 4FF7A 5DLCA 5FEWA 3CLMA 1GTHA 1ZENA 1TPB1 2YYTA 3W7GA 3H54A 2C3ZA 3M5XA 1WX0A 2A5HA 5C5YA 1QR7A 2FDSA 3SW6A 3Q37A 4UR7A 4WX2A 5LGXA 3E02A 4M7TA 1OF6A 3S6DA 3DAQA 1XBXA 1VZWA 2X1TA 3E96A 3WK3A 3GK0A 3OEXA 3DZ1A 3M6YA 3HGRA 4MJMA 3LRLA 4NZJA 1SW0A 3CM4A 2X16A 3T44A 1QO5A 5BOOA 2R91A 4GRSA 2QCMA 1J2WA 3B03A 3N19B 1KM3A 2NX9A 1UJPA 3NQ7A 5DY2A 4P2VA 2A2IA 3UWYA 2GVGA 5EY5A 4DELA 2E68A 2WJZA 1W0MA 1XBYA 3INPA 4JTGA 3NQCA 3P8JA 1XM3A 4JN6A 1OYBA 1LYXA 2V5LA 2VELA 3FLUA 4QNEA 3EX3A 1VCGA 3TMLA 4CLMA 1W31A 2J24A 3MHFA 2X1UA 3LERA 1SZFA 1SSGA 4DO6A 4CCCA 4EIVA 3TKFA 3CWOX 2V81A 3NA8A 4LVFA 5A8GA 3W1MA 1LCOA 1H1YA 1ZFJA 1OFBA 1RPXA 3DU0A 1KV5A 1FXQA 4U4MA 2A1YA 3LRMA 5C6MA 2DZWA 4OT7A 3NQ2A 1I2OA 4WD0A 4RKAA 3DBPA 3WJWA 4OHQA 5G1TA 2TPSA 3UWWA 4LV9A 3VE9A 3F03K 3NQFA 4LRTA 5CSRA 1I4NA 2C6QA 3L5AA 4H3DA 4WJEA 5IBXC 3S8HA 2CLFA 2XN0A 4UNLA 4PL2A 2VC6A 3C2RA 3L0NA 3DFOA 1K7EA 1F6KA 3PUOA 2EPHA 5AYZA 3LHYA 2QR6A 3NOEA 1R47A 4XTDA 3DFPA 3HG2A 3W75A 1VLIA 3MW7A 1AMKA 4XBSA 3IIVA 4K6AA 2CZEA 1FWTA 1LOSA 2NXIA 1O5KA 3P8IA 4I7UA 2NX1A 3RU6A 5F1UA 4NZFA 3CC1A 4PTNA 1YXDA 1Y0EA 4NXSA 3G0SA 4MZYA 3LCWA 2XN2A 1JCXA 2GQ8A 1I2RA 4AWUA 3HBLA 4KWWA 4S1FA 1UB3A 4GBUA 4YLWA 1VC4A 4YMZA 1P0NA 1IIGA 1MSSA 3FKKA 4Y6GA 2P1FA 3GLCA 3GNNA 5CPLA 5FESA 2Y7DA 1R30A 2QUVA 2TSYA 3NL5A 5E93A 4R34A 3EXSA 3O16A 4JY8A 1YLVA 1M6JA 1H7XA 2QCDB 4NJKA 3DHFA 4ZMGA 5D37A 2JGQA 4IXXA 5H91A 3GXTA 3UYCA 3OG3A 1LOLA 2NUYA 2PC4A 2D73A 1ZALA 3WJXA 4O19A 2QKFA 4HNUA 1Q45A 2Y85A 1F5ZA 2I14A 5E1QA 4IMCA 1V5XA 3O6DA 1E51A 3EKZA 3S5OA 1SFJA 1A5CA 1WOBA 5HJLA 3NZRA 3B0UX 1Q6OA 4YXGA 1HTIA 4AAJA 4FHAA 1EA0A 5D2VA 5FI8A 3NEVA 4TR9A 3W86A 1VYRA 4NJGA 3T7VA 3DXIA 3CQ0A 2ZZ5A 5BW6A 3MP3A 1GT8A 1KFBA 1H7NA 1YXYA 3TFCA 4O4WA 5AC6A 1OJXA 3KVKA 1KM4A 4UTKA 4RK8A 2EGZA 2RDTA 1W3IA 1CI1A 4XZ9A 4AXKA 5D33A 1YTDA 1GYLA 2NUXA 4A2SA 4NJHA 3VKJA 4KKXA 2QAPA 1DORA 3L5MA 3HQ1A 1BTMA 1FBAA 1R46A 2HSAA 3JS3A 2QCNA 2C16A 3IIZA 4NJIA 5DCEA 4Z1DA 3C2VA 1OABA 3T55A 1TTJA 1W54A 1WAUA 2ZRUA 3C6CA 3PULA 3FS2A 3EX6A 4K39A 4O4VA 4O14A 3QZEA 8TIMA 4O15A 3GNDA 3PBYA 5D32A 3UPWA 4BWLC 5LNRA 4GUFA 1QOPA 1BWLA 3DGRA 1YPIA 3STCA 2BSLA 3LHUA 5I3KA 2ISSA 4GJ1A 4PCFA 3LXAA 3W87A 1DVJA 1H50A 1JCJA 3CIXA 2ISWA 5CGQA 3TQ0A 1LP6A 3W76A 4N2YA 4WQ6A 1G4SA 2JKPA 3FKRA 4LS1A 2J6XA 3BVJA 6TIMA 1QAPA 1R2SA 4JTLA 4NNCA 2VOMA 3MMTA 3TW7A 2V9DA 1TPUA 4AWSA 1XUUA 1AG1O 3VI2A 3M1ZA 3O1NA 3W7DA 2W79A 1QDSA 3H53A 2F84A 2C19A 2RHGA 1QPQA 4JTFA 1S5TA 4IGHA 3OA3A 5G1YA 5F1VA 2A6LA 1VLWA 1TRDA 2EAWA 2QCFA 3NPVA 3G1YA 3W7KA 1KM0A 4AH7A 3DFSA 3ZS4A 3EXRA 3N14A 4OV4A 2BZNA 5T26A 3VCRA 4K8HA 4FNRA 2Z1BA 5D03A 3U8GA 1F05A 4CNNA 4O28A 5K3VA 3AJXA 2QUUA 4UTTC 2VEKA 2ZZ7A 3W7NA 4CQAA 2DZTA 3EWXA 3CEPA 4ADTA 3L66A 2TMDA 3W1LA 2Z0IA 3A5VA 3W2JA 2Z6JA 4GUHA 4UR8A 2ZZ4A 1SO3A 1TJRA 1VHCA 3MBDA 1SZEA 3HGSA 1ZJIA 1NF0A 2Q3RA 3G3DA 1OK6A 3BW4A 4LTSA 1TPDA 3P81A 4S2BA 1LRNA 4CNPA 1EIXA 3GX9A 1L6YA 3B0VC 5TIMA 1G7UA 5HMSA 1D3HA 2E6DA 5D2XA 3NL6A 1CX9A 1QFEA 4MFEA 4NT0A 1LORA 1ADOA 2DZPA 3W7EA 3IIPA 3QFEA 3THAA 3KRUA 3EB2A 3NDOA 3O6YX 2I9EA 4MYAA 4JTJA 5D2YA 2VXNA 2VFIA 6ALDA 4R7JA 1FDYA 1OX5A 1UUMA 3G24A 4O0ZA 1O4UA 4EWND 4HNTA 5HUOA 1G4PA 4JS3A 2P0OA 2VFHA 4UMCA 2GUUA 1TO3A 2GOUA 4MY8A 3LBCA 2FJKA 3NXFA 5L9FA 3IIXA 3MUXA 4O52A 2ABAA 3B8DA 1JQVA 3P82A 2R8WA 1I45A 1EX5A 1HFBA 1FX6A 2VFEA 3S1WA 3TX9A 1QNVA 1Q6QA 3G1AA 3B4UA 4LVGA 4NNAA 3GDLA 1F73A 3IRDA 1A50A 2DZSA 1OK4A 1ZAIA 4JTHA 3U6WA 1TQXA 5D38A 1TPC1 4JIQA 4Z08A 2W0UA 3NQEA 4UMAA 5F4WA 4JTKA 1PHQA 5LNSA 4X3ZA 1W8SA 3VE7A 2CFFA 2VFGA 2B7QA 4JEQA 4Q32A 1DJQA 3IGUA 4R53A 4DPQA 4K37A 3QJAA 2ZRYA 2YFNA 1H5YA 5G5IA 1W5NA 3L65A 3OIXA 3TMQA 5KMYA 3GR7A 3T40A 3NO5A 4WY0B 2AGKA 4DF2A 3TCEA 2FPVA 2NV1A 3M43A 3N2MA 4DF1A 4MLRA 1G6CA 4ZQRA 2JK2A 4N9CA 3UWUA 3G22A 1K8XA 3KFTA 1F7BA 3TXZA 1SUXA 4JYEA 3O06A 2ATSA 3BW3A 1XI3A 4FNUA 2AQWA 2E5CA 4N4PA 5EBUA 4AB4A 3B05A 4ZZ9A 3W1TA 4AF0B 1OX4B 1OX6A 1EEPA 3G8RA 2GVLA 3W23A 5I3GA 2V0TA 5LNVA 4O17A 2PRLA 5I3IA 1PHWA 2ALDA 1C8VA 5ABTA 2X1SA 1S5VA 3TV8A 1QMLA 1DQXA 3USBA 3NQMA 4TMCA 4M6QA 4RZ6A 3S5NA 3QQ0A 2E09A 2VEMA 3W9ZA 3LXCA 4NU7A 1FUYA 1DOSA 4BFAA 2A0NA 4RX0A 1AW5A 3R2GA 5FF0A 3G1VA 3NPXA 1OFOA 3O15A 1W3TA 4FB7A 3SECA 2WPBA 4EOUA 3O07A 4TIMA 3PR2A 1VRDA 3GXNA 1H60A 1MEHA 4PH6A 5C2XA 3LHWA 3R13A 3W1NA 4FXRA 4QM1A 4O13A 3Q58A 2FFCA 1RZMA 3SIZA 1YDVA 3NM1A 1DJNA 1QPRA 2BXVA 4FXSA 4KFOA 4E0CA 3WJZA 5F2GA 3W1QA
chains in the Genus database with same CATH superfamily
1LDCA 2PA6A 2IPJA 2WANA 3W83A 2OYLA 3UJSA 4MF4A 4Q4RA 5DBTA 1QNSA 3W85A 1NFGA 4JX6A 4PFMA 1TE1A 2OQLA 4BA0A 3W71A 1QBBA 1GOWA 3FA5A 4A21A 3LLDA 2V68A 2Q8XA 2JALA 3A6OA 3HB9A 4OFCA 1OC5A 3RXZA 3CO8A 4E8GA 1EUNA 1JZ7A 1KGXA 2XIBA 1A5NC 4KEZA 3UXAA 3W7RA 5ECVA 1ZPTA 4YL2A 5FSDC 3DECA 1NH6A 1ZJBA 5EMJA 4Q4PA 5IM51 1HUVA 1BVZA 5JBDA 1B3OA 4HOZA 2O0TA 4W88A 4QQ3A 3BGJA 4UTIA 1DQWA 2Y70A 1YMYA 2V5DA 2XN1A 5A95A 1QHZA 4U10A 2HK0A 3VIJA 1FHVA 2RDUA 3GFXA 7REQB 1B3YA 1JR1A 2GSHA 1PYMA 3BLLA 3NQ8A 1JPKA 1TVPA 3GB6A 1K4GA 4MOZA 4RR4A 4AC7C 4H83A 4ZQOA 3M7SA 3MTWA 1XH1A 4S23A 2G3MA 4M7SA 2BX7A 3LNPA 2XIJA 3DIPA 1AQHA 2REQA 4QE5A 3MZ2A 1JDEA 4IHCA 3ZLHA 3W26A 4OTKA 3CV6A 1XYFA 2E77A 2VKZG 4GZIA 3TA6A 4AEEA 3V3WA 2RDXA 4LW7A 1X6NA 3M0XA 3TR2A 4DJDD 3ID7A 3ABSA 1R8LA 1R7AA 3L12A 2ZFAA 2ZUWA 3K30A 2FKPA 2AGTA 2PRHA 5TQLA 3KBWA 3VM7A 1RY8A 1PTGA 1X1ZA 3IPWA 3P67A 4EAMA 2GJXB 3WQPA 1UR0A 3N9RA 2J6VA 3A24A 4YTUA 1BQGA 3W1PA 5D04C 4O8AA 3O9NA 4RPQA 5CG7A 4ZSTA 5C9ZA 4NQ1A 3HGOA 1ZY9A 3VAVA 3WH7A 2VDGA 5KZMA 1XDJA 3W73A 1FQ0A 4Q4KA 1YPFA 2VI0A 1NY1A 2UBPC 1EJRC 5J5RA 4XAZA 4UB9A 2NLYA 4MNKA 1SPQA 4LAOA 3CL7A 4OZOA 3TW9A 3SN1A 3OLIA 2JIEA 4ZSUA 3W1RA 3MJYA 5FF2A 1KQZA 3NPWA 4P7RA 4XBKA 1MUCA 4ZB0A 3UWVA 4QTGA 2PLMA 2MNRA 3B0PA 3P0XA 1TPH1 4G1NA 2Y62A 2F6XA 1NQ6A 3QM3A 3FV9A 1TX0A 4I9JA 4CEXC 3QW4B 4AEOA 4EF8A 1UZ4A 1MRAA 4Z0JA 2QJGA 1O5XA 4RNIA 4DLMA 3IVSA 1K02A 5JUVA 5DY3A 2EPKX 2VX7A 5BMWA 3OHMB 3BV4A 2C7FA 1LRTA 2CHNA 1FCUA 3APYA 3SRKA 1XCFA 1KB3A 1V3HA 4XISA 5MKGA 4AD3A 4LANA 1FWHC 2PDNA 3LG3A 1KQYA 4IFOA 3W72A 2PCEA 1W37A 2GQ9A 3BANA 3DERA 1JVNA 3M64A 4GFSA 5IBXA 1XDLA 2XWEA 3P61A 3GXMA 4JGDA 4HK7A 2R1NA 3U0HA 1TELA 1S2VA 3FSUA 3WH9A 1RCQA 2A7RA 4ICMA 3LTPA 3LZ3A 1FWBC 4H00A 1DHPA 2QIIA 3EPMA 5CG0A 2ALRA 1OWQA 2NLIA 1KO0A 4JNYA 4LC8A 1NWRA 3CNYA 1NFPA 2NVDA 3PSVA 3QEZA 4JFUA 3S6OA 3LGDA 1ECQA 3PBWA 3VGHA 3W74A 2WOQA 4EPBC 8CGTA 1V7YA 3KDOA 4A35A 4LUSB 1DE5A 4I6VA 3TEVA 2WBKA 3V4BA 5LNWA 1FVPA 3EDJA 3IJ7A 2ONEA 4J7RA 3W70A 1ZNNA 4EXBA 2VMFA 3HO8A 3PB2A 4MIMA 7XIMA 2XZ9A 2PP3A 4GJIA 3H23A 5D30A 4HSHA 1EHAA 3R11A 1MZHA 4Y9NA 4M5PA 2P3EA 4H1ZA 3GY1A 3W24A 1JYWA 4C7FA 1OY0A 3JZUA 1JCMP 3UXLA 1T7LA 1K6AA 2G5WA 3QY6A 1SO4A 2ZICA 4X63A 1IGWA 1A49A 1NELA 1NP2A 1JI1A 4HCLA 3FA4A 2OO0A 5XIMA 3NL3A 3K2GA 4P8XA 4CQ8A 4PUMA 4M82A 1QO2A 4MY1A 3EEGA 1J10A 2AOSA 4DO4A 1PCKA 4NNBA 1DWIM 1N82A 3LPGA 2WHKA 4OVXA 3FGCA 2ACSA 2EPMX 1J6PA 2X1RA 1EQCA 3DG3A 2D2JA 2ZUNA 1UP2A 1GVSA 1A47A 4XK2A 1GONA 1B54A 4I8DA 3DX5A 3PZGA 1J01A 5LHEA 1EZWA 4X60A 4LAMA 3GC4A 4W4QA 2QVNA 3BGGA 3EAUA 2AL1A 1D2KA 3NR0A 3DKLA 1GHSA 3AFBA 4QJ1A 4AD2A 3RCYA 4ERIA 3LHZA 3GXDA 4QG9A 2OWCA 4RLIA 3M47A 2R6OA 4WK9A 2G3NA 1TV5A 4UMBA 4LF2A 2E3ZA 4OKDA 2EPOA 4B90A 1VEOA 2HBVA 3EPOA 1V08A 4WIWA 3L5LA 4ZE4A 3MP4A 2XH7A 3HOJA 2WMFA 2J88A 4QS6A 4DYJA 4MG4A 4GOAA 3KUMA 1ME9A 3PPHA 2FPYA 3GDTA 3S3GA 3VIMA 4CD4A 2GFTA 3WD3A 1XBZA 3D47A 1M7PA 3NTYA 4DVOA 3LCLA 1QBAA 1TIMA 4AWTA 4GCAA 1J8VA 4B3ZA 1B30A 1TCDA 2V2CA 1CXLA 4FX6M 5H1WA 3LD5A 1NOUA 3CZJA 2IPFA 1TA3B 4IL2A 3W1AA 1TX2A 1FOBA 3IGHX 5KSWA 2NQJA 5AFDA 5LZLA 4Z1CA 3G1RA 1KA9F 4XO6A 2OMAA 1TWIA 2WVVB 1PX4A 2DVUA 5BYWA 3TLQA 2OJPA 1ZB5A 3BLPX 3OVRA 3PBUA 2VZUA 1ZSXA 3M6DA 1UZHA 4CU7A 2JFEX 4F0RA 3RHGA 4NYUA 2JF7A 3MWAA 1OFPA 3ARTA 4O0KA 3WBAA 4IIEA 1PXGA 2GGIA 4WDTA 4B5XA 4CQ9A 3SJ3A 3DN5A 4MB5A 2X7VA 4JX4A 3A5FA 2YGYA 2CZDA 4JTSA 1XRTA 3P62A 2DZUA 3TJIA 5G4HC 3GG7A 2CCRA 3K8KA 2WZHA 4ZO6A 2P88A 3L4WA 3B9NA 3B9OA 4GI8A 1Q6GA 1H7OA 5LXEA 5I00A 3IJ8A 2X2YA 1KM6A 2YIHA 4OV9A 2V3GA 3QYSA 4KFPA 2CHOA 4K1GA 1FWDC 1TJ2A 3ALFA 4G7FA 2ISFA 1OCBA 5LIUX 4C6OA 1WCGA 4I3GA 2VX6A 2PAJA 5A94A 4ENLA 4NI3A 5DEZA 3UG8A 5AZ1A 3BAJA 4PBFA 4YTSA 3TTQA 1OFQA 1SJAA 4QLKA 2A3EA 2QJHA 3L4YA 1L6GA 3EZ4A 4MWAE 4OBRA 3MC5A 3TU9A 2NQ5A 3CHVA 1X7FA 4CU6A 1C9DA 3W4RA 4FR6A 3KL0A 2NWSA 3C61A 2WJEA 1UD4A 4WOQA 1B3XA 2ZRXA 2YB1A 1W2PA 4UQDA 3WQOA 2BODX 1ZUAX 1JDAA 4Y9MA 1Z41A 4J3UA 1VFSA 1WDPA 3VIGA 1E0XA 3XIMA 4OOZA 4ONVA 4S3EA 5F2LA 1DYSA 3AQUA 3GNPA 4U28A 4GVIA 1X1OA 2QAFA 5HAOA 2PWHA 2C15A 4GZEA 3L7RA 4DAIA 2PUZA 1RLCL 3R0UA 3UZJA 1TV3A 5I79A 1PX3A 2LLEA 1TR1A 4CNSA 6REQA 4QX4A 4AW7A 4B5NA 1XC4A 4JFWA 2NVAA 2IS7A 2VRJA 4DBEA 1XCWA 2QW5A 1UKPA 4HA4A 2VFDA 4DB7A 3IIOA 3M0IA 2ZA1A 2J7HA 3GG1A 2EJ1A 5AHIA 2WWDA 3VM5A 5EFDA 1OG0A 3FDGA 2O7SA 1FHUA 4NXKA 1OGBA 1FWAC 3BOFA 3QV8A 3A4XA 1K9TA 4PZVA 4KIEA 2HCVA 3AWOA 4S3CA 3LENA 3ZJ6A 3SUWA 1A4MA 2PFHA 2BHYA 1W3HA 4PUJA 1KM5A 2HE8A 3WBEA 1GEQA 1XRVA 4S3BA 1S5NA 2YW4A 4IJCA 4K68A 3R12A 1RR2A 2XFRA 3FVDA 3USZA 1ZAHA 3R10A 1HVXA 3VUPA 5KZEA 2ZC1A 3DKJA 4H8HA 4LY4A 1NWSA 2DT3A 3EMQA 2Q02A 1K8ZA 3R6IA 3F1QA 3ONBA 1AODA 4XB3A 3OZPA 5JH2A 1Q8JA 1J0JA 3A12A 1GZGA 1RBLA 3NUKA 2WM1A 1EF3A 4WF7A 4A8LA 3BLDA 3W07A 1XFBA 1EZ2A 3N2CA 2Y8KA 1ODUA 3EDFA 2VEPA 3VUSA 4RUBA 4HCDA 2AKMA 4Q33A 1C8YA 1HQTA 2CLOA 1TJPA 3N18A 2ZUVA 4GQGA 3FXYA 5A8MA 3A3XA 2PSNA 3ME3A 4AMAA 4GIAA 3BARA 3DDMA 3NSNA 2ZX6A 1EP3A 5CPOA 1KTBA 1S2TA 1F3WA 1JGIA 4MJ4A 1CB2A 3SQMA 3OHIA 4XQ6A 5HULA 4IWWA 4A3HA 3NDZA 2BTMA 3GC2A 4UOZA 3RPMA 1OGGA 5DXXA 5LA1A 4IPIA 2VGFA 3RLGA 3AU2A 1C7SA 5D09A 3PZ9A 1Z48A 5HMFA 4H2CA 3WK1A 1B57A 1DQUA 4FLRA 1IXQA 5CLTA 2VD8A 1KFLA 3LGEA 4MPQA 3BWWA 2R9RA 2WSYA 3OBEA 2PE4A 5DBUA 2TRSA 2BVWA 9XIAA 4Y96A 4DJFD 2ZRWA 1NM9A 3REQA 1W1PA 4L64A 3RX2A 3VC5A 2Z24A 4EXAA 3UP8A 1DKWA 4HMNA 1GQJA 2YW3A 1OD8A 2I5GA 1M53A 2IXVA 3GUGA 4E3TA 3U2OA 4UFLA 3O05A 4PRWA 1Z42A 1GQLA 1UD6A 5C9UA 3A9IA 4JCLA 3H2FA 3HQPA 3SCRA 1M03A 4WKHA 3BK0A 1J0HA 1EB3A 4LYQA 4F79A 3NFUA 1W5OA 1KGWA 1RBAA 3BLIA 2HK1A 2ISDA 3GDRA 4HU8A 4JL1A 5AY7A 4W9TA 5XIAA 1PZ2A 2VTFA 4UFJA 4Y9AA 4DM2A 3ZO9A 3TSBA 2XGBA 3UJEA 5CEWA 3GYEA 4BKNA 3SCTA 2OCZA 3TP4A 1XIBA 2DP3A 2RJGA 2QJJA 2VVSA 3KRBA 4N02A 3NXLA 1V8EA 1VR6A 3GXIA 4O1EA 1KFCA 3ARYA 3A13A 4GYJA 1P0EA 2ZZ6A 4H9TA 2OTDA 4J3TA 4JFTA 1J12A 1UWSA 2H9AA 1H62A 3NQDA 4NKCA 4DZAA 2C79A 5AECA 1W1B1 2PDUA 4DWSA 1XKJA 1VBGA 1OFAA 3PK7A 5FF3A 4WGHA 4BK9A 4DRSA 1GVFA 4Z2JA 3B8UA 3YPIA 2NSXA 4D2JA 5I5RA 1TIWA 3MDWA 5CZSA 3N25A 4DBSA 3WNNA 4K2SA 4XTIA 2BGNE 5BWFA 4UQEA 3UGRA 4NUWA 5DMYA 4FK9A 1UWIA 3MSGA 3OTRA 3E49A 2F38A 1LL7A 3N4FA 4CCZA 1UUOA 2X30A 1LL4A 4LYKA 4FLOA 3CIWA 2YL6A 4P61A 5C54A 3M7WA 4C6NA 1XW8A 3CUXA 4G7EA 2XIQA 3RO8A 1W9XA 2XVPA 4OQVA 4HA3A 3WK0A 3EXTA 1XCXA 1EWDA 5FEXA 1KV8A 3HG3A 3UXDA 2WHLA 3GZ3A 2EF9A 3WCZA 4MY9A 4KWVA 3MMDA 2D0GA 5M03A 3UPMA 4KPLA 5GNXA 3H7VA 3TYDA 3ZT7A 4UIOA 2Z1SA 1ISWA 4HZ8A 4UNKA 4IUOA 4O1DA 1KLYA 1E5JA 2Q8LA 5CXPA 4AZBA 1XBVA 3T6CA 4IIFA 1BXBA 1MEWA 2PRMA 3DENA 4IQJA 1RK5A 1X8FA 3P5ZA 1AJZA 2C18A 5BRBA 3Q2DA 5KITA 4WXZA 3E0VA 3WQVA 1KRMA 3LMYA 2C71A 3FIGA 1YPXA 1TZZA 1L8NA 2YDAA 1GG0A 4JN8A 2EEXA 7TAAA 3CO4A 4D71A 3V35A 3AZTA 4FIQA 1A80A 4S3JA 2P76A 1OC7A 4KF1A 4JTEA 4AXNA 3BJFA 5I77A 3L0GA 1WUFA 1XIEA 5K7JA 3CZEA 2DZXA 1QI2A 1SGJA 3OGVA 3ZXWA 4HN4A 3PANA 4HNLA 2XFYA 1NAL1 5LA0A 3SGZA 2PGWA 6A3HA 1E9LA 1I8JA 3BAYA 3VNDA 3F5KA 3I65A 4DXKA 1HT6A 4PCNA 3UCDA 3NQVA 4H19A 4GIRA 3LV6A 1NTHA 2ZQ0A 2ZRZA 1M7OA 4BEQA 4LFYA 3GUWA 2UWFA 1J93A 1DIOA 1EJSC 2EHHA 4N9BA 2CZFA 5JH1A 2H8XA 4PB3A 4L80A 4HB7A 1VFUA 4EANA 4PMJA 2DPEA 2WNNA 4RNHA 4B15A 1KRBC 4HZ7A 3UZZA 1UWRA 1IT7A 1J0KA 4AD1A 4Q8OA 1RJPA 2VDHA 1I1WA 3UBPC 3BMXA 3TYEA 1UPPA 1SO6A 2BY0A 3GAKA 1N8WA 1XGZA 3AUJA 3CLMA 1GTHA 4L4OA 3TWAA 1ZENA 3M4HA 2YYTA 2BVDA 5T91A 1QR7A 3SW6A 3KBJA 1UR1A 4UR7A 4WX2A 2REQB 3E02A 1OF6A 4C7DA 1JPDX 4D8ZA 3TJ4A 4QS5A 2J62A 1TG7A 3DZ1A 3H2NA 3M6YA 3HGRA 3LRLA 3CMFA 1CGYA 1SJBA 1SW0A 3FJNA 3GTIA 1JZ6A 1QO5A 2R91A 1CPUA 1MW3A 1J2WA 5HDRA 3AXXA 3BJTA 2NX9A 3NQ7A 4P2VA 4DELA 4E4PA 1XLDA 2P50A 4JTGA 1XM3A 1LYXA 2VELA 2YL5A 1C3FA 4F3HA 1E40A 3EX3A 3TMLA 3QKEA 2J24A 2W66A 4XZWA 4NAEA 4MM1A 1E9YB 4L5ZA 4Y7EA 2V81A 2GDQA 3H6OA 3W1MA 1ZFJA 1AD1A 2P53A 1OFBA 1RPXA 1QNPA 2EO7A 2XINA 4U4MA 2A1YA 2DZWA 4LEQA 1I2OA 3AMKA 3VE9A 3F03K 4LRTA 4J4KA 4OUEA 4I6KA 3NO3A 2IXUA 3L0NA 2PDWA 1K7EA 2PC8A 5AYZA 3BCDA 4Y2WA 1J0IA 4E2OA 2WHMA 3ARXA 5HMDA 3RYSA 3CUFA 4K6AA 2CZEA 4AMCA 2NV9A 2NXIA 1T8QA 1C7TA 5BXRA 3RU6A 5F1UA 4FALA 2FZ8A 1UHVA 3VGDA 1YXDA 5MKGB 5ABFA 3B0XA 2XM2A 2POTA 3N6JA 4NXSA 3G0SA 4KMQA 2VZSA 4LBSA 3VNMA 1VP5A 1JCXA 4W7UA 1IEIA 4ROQA 1UWTA 1D8WA 3ARWA 3HBLA 4QR6A 4S1FA 2J7DA 2GZXA 4LJ3A 1UB3A 3K4WA 4ICCX 1KCKA 2PDKA 1WKEA 1UH4A 1BKHA 3FKKA 4Y6GA 3GNRA 1VAHA 2E8ZA 2WBGA 2XH2A 2Y7DA 5FESA 2TSYA 3U2CA 1ADDA 3LUTA 5FKYA 3DHFA 1WP6A 4IXXA 3I10A 1P7TA 2NUYA 3KBSA 1ZALA 2QKFA 1UKSA 1F5ZA 1LQAA 5E1QA 4IMCA 3EKZA 4OJYA 4M0XA 1SFJA 2GQ3A 1WOBA 4GFIA 3NZRA 3B0UX 1Q6OA 3VPLA 4CNTA 3MU7A 4BS0A 3IS4A 3LY0A 3L2LA 2DW7A 5D2VA 2DSKA 1WZMA 4C6IA 4NJGA 2ZX9A 3DXIA 1PO9A 1GT8A 3TN4A 3GH4A 2CBJA 5AC6A 3KL5A 3KVKA 3T4WA 1KM4A 2PGRA 4S3AA 3SRFA 4RK8A 4ZBCA 4JIIX 3SIMA 3M0YA 2PTZA 4H9ZA 1B3WA 4NASA 1V51A 1DTNA 2QCNA 4DHGA 2C16A 3IIZA 1XD1A 1PYFA 2CESA 4INFA 2XDFA 2OEKA 1JD7A 3FAWA 5GNYA 3UWEA 1CXHA 3PBYA 1IYXA 3UPWA 4BWLC 4GUFA 8RUCA 2INFA 4MB1A 5AYBA 3ZYZA 1EJXC 3FGCB 1EH9A 3M0LA 2BY3A 2ISSA 4WDUA 4PTWA 1H2JA 5B7ZA 1JCJA 3TQ0A 3W76A 3E6EA 4WQ6A 4IFRA 3WEMA 3UXIA 3T08A 1EQPA 3AIVA 1NDWA 4JTLA 4JHZA 1JL8A 3N1AA 1EL3A 1GOQA 4REQA 1X96A 3WLOA 1XUUA 3M1ZA 1LUCA 2I56A 2PWDA 3UXKA 3W6LA 2F84A 1HKMA 4I9MA 1VLWA 2EAWA 1HF6A 2PD9A 1RY0A 3G1YA 3W7KA 3JUGA 3T0TA 3EXRA 1EKOA 3N14A 1JZ5A 1W1A1 4OV4A 4N42A 4ZO7A 3VCRA 4K8HA 1Q85A 1PZ0A 5K3VA 2GGHA 2QUUA 3VCNA 1ONXA 3WQGA 3EWXA 4GQQA 4B2DA 4J1OA 4ADTA 4QJ5B 2VQTA 2Z0IA 3A5VA 2Z6JA 3ORWA 4Z2LA 1SO3A 2HNHA 1EA9C 1VHCA 1SZEA 1U5VA 2Q3RA 4EX4A 3G3DA 4HVXA 4UQCA 3BGAA 4LTSA 1V3KA 1LRNA 1REQA 3UR2A 5IFPA 3GX9A 3L4UA 1O5RA 5TIMA 1CX9A 2EXOA 4D8AA 3CBWA 4MFEA 4KERA 3B8TA 1ADOA 1S5MA 1R38A 3HV9A 4M56A 5D2YA 3OLEA 3GTXA 3G24A 3QHMA 4O0ZA 4B5SA 3URBA 5HPCA 1VD6A 3TTYA 4KCTA 5C2GA 1EJWC 4JS3A 1V3JA 1Y5WA 2VFHA 1JZ3A 3PN8A 4Z2GA 4JKMA 2INEA 3DC8A 4GKTA 3LBCA 3MUXA 1G5AA 3CAWA 4M1RA 4HBKA 4P7LA 5BXSA 1HJWA 1JQVA 3B8DA 1XLHA 1M68A 4LAKA 3GNXA 1FX6A 1KRAC 3GHSA 3BOXA 3MUCA 3TX9A 3G1AA 1F6YA 3VDAA 2EPNA 3RN6A 3IRDA 4MAVA 3KOXA 2OQHA 1OK4A 4JTHA 2X7WA 1TQXA 3GIPA 5D38A 4Z08A 4K3ZA 1FTXA 3AISA 5JIPA 2PDGA 3VE7A 2VFGA 2B7QA 4JEQA 1DJQA 1OT1A 3SO7A 2XH0A 1W5NA 4DJED 3MSYA 5KMYA 1NWUA 1NQKA 4E2VA 3W37A 3OP2A 5TAOA 3N2MA 4MLRA 1YIXA 2JK2A 4RDVA 4JHMA 1F7BA 3PPGA 1V6VA 1SUXA 4U5IA 3AMLA 2Y5SA 4N4PA 1DJZA 3B05A 1GVYA 1ISXA 2Q71A 1EEPA 5I3GA 4F9JA 1I0DA 4HK6A 3MDUA 5CBIA 4A3RA 3H2EA 5JXQA 1MUMA 1V02E 1QMLA 1Y5XA 4WVXA 4RZ6A 3QQ0A 2VEMA 2Y24A 5MF5A 4UQBA 3WUEA 2OLSA 1YE4A 1JFHA 2A0NA 5FF0A 2PZ0A 5CPQA 1ITQA 4QEHA 3EDDA 5BRPA 5A6AA 1UD3A 2J8TA 1V0MA 6REQB 3WDQA 4O0QA 3SECA 5E0CA 1QW8A 4EOUA 3GXNA 3LHWA 1GQIA 4O13A 1S38A 2BXVA 4FXSA 4GY7A 4E0CA 2J75A 3W1QA 2O9RA 3N17A 5JU6A 1S2AA 1X8CA 4ZVJA 3VIIA 4S3GA 3WYZA 4WSJA 1YE6A 4OIFA 1HKKA 4AF0A 1TV7A 1OFEA 4TXEA 3ZFHA 4DEFA 3KVMA 2QF7A 1UR2A 4LNYA 1S39A 3FEMA 3GXFA 2QS8A 4BQ4A 3THCA 3ENLA 3AHYA 3LEPA 2ZADA 3GVWA 2GUYA 1RK6A 4KCUA 4FO4A 2WMKA 3JVAA 2G4FA 3E2VA 3CAVA 5E5CA 1EP1A 3OGRA 2IPWA 4C7GA 1FKWA 3EWUA 1DWGM 1PV8A 4I7WA 5AB3A 4CNOA 3T0AA 1PBGA 1AK5A 1MRQA 4S2CA 1PCWA 1W5PA 2XFFA 3JW7A 5ECUA 3LCHA 5LXXA 1LLWA 3ZWSA 3B04A 4MB3A 3NCOA 1HIZA 2X05A 1DJWA 1YKWA 3PUGA 1EXBA 3F5LA 4RNJA 1PWLA 1EUAA 3APGA 1C29A 1W3KA 3EWWA 1OSEA 1R5YA 2XUCA 4RW5A 2Z2UA 2QCHA 1Y7VA 2NT0A 3HJEA 4FNPA 5A6SA 2WMIA 3KOWA 4PRTA 3ITXA 3DFQA 1PTDA 4CQDA 4UTLA 2WJDA 3OJGA 3CQHA 4UXDA 5BOEA 2E1DA 4U2ZA 4YN5A 1H7RA 5A8OA 4ZOAA 1EBHA 3WFZA 2GDVA 4DM1A 3U48A 1BGAA 5BRQA 4P7OA 3UNDA 4NZ1A 4GI9A 1UWAA 4XAFA 3VYLA 3FJ6A 1RSCA 2D2GA 1LLOA 4YTRA 2IKJA 1HKVA 4NZCA 5HQEA 1POKA 3R1ZA 2WM0A 2H8ZA 3W7PA 3W2UA 1W9DM 4HZMA 3PBVA 3PFRA 3HFYA 2V69A 3BJSA 2W6RA 1E4IA 1MW1A 5F4SA 1XQKA 1N55A 4US5A 4LB3A 4Z0SA 1HL2A 2I17A 4DUVA 5GNZA 1AZ2A 3C3NA 1CXIA 3IK4A 3CHDA 1SYTA 3AAMA 1EYWA 4C6EA 3O8AA 4IXHA 2PDLA 3DYMA 4H41A 1WUEA 4F9DA 2ZXAA 2Q8ZA 3SDOA 4Y9OA 2BMBA 5FA5A 2WSRA 1KWKA 3LHVA 1SJCA 4QHRA 1RALA 3QC0A 2QDDA 4ZL1A 1LBFA 3PZMA 4WSKA 2NXHA 2W9MA 1Q65A 2F8QA 3REQB 4JN7A 1OIMA 2E28A 1UYQA 3D3FA 4RL3A 1GOMA 3E0LA 4JXCA 3MJMA 3RG6A 3ABZA 1MI3A 3H21A 3A4AA 4B9YA 3G77A 1MMFA 3II1A 1ZTVA 1G01A 2OZ0A 4GUIA 2YKKA 5FJIA 2QUTA 2VFFA 3UETA 4RZ4A 1JGMA 4U31A 5I23A 3HMJG 2I5IA 3WDPP 3W7CA 5I3HA 1ME8A 3BQ6A 1E3XA 3WL1A 1V7AA 3WBYA 3S9ZA 5CSSA 2X41A 1OYCA 5EA9A 4AD4A 3CL6A 1H7WA 1WDSA 3FSTA 1UBPC 3PZNA 4H6KA 1S2UA 4C5ZA 2V82A 5JVLA 3ARVA 2C0AA 4IZGA 3U5UA 1PZ1A 4HIBA 4ZO8A 3GG0A 3STGA 5HQLA 3Q67A 1G9HA 3OBAA 4O1BA 2H9AB 2E1WA 3W82A 1DIKA 2XSBA 3I68A 2BP1A 1YNYA 3J7HA 4P8VA 1FWIC 3QQ1A 3TIMA 4DWSB 3G1XA 1ITUA 1BYCA 3LA4A 1DP0A 3S4TA 2VP8A 1IZKA 3M5VA 4PGLA 1U1HA 2X42A 2WZTA 1GOIA 2VX5A 1X38A 2PF8A 4KIRA 3W0KA 4TU1A 1JCYA 4E4UA 4MZ1A 1CT5A 1VIWA 3CJPA 1UUQA 1NVMA 2PWVA 3L4VA 4M80A 1ALDA 1U83A 3VMPA 1F3EA 2J4GA 2GGJA 5K9CA 4Q8UA 4L9ZA 4MWAC 2QPUA 4G7EB 2ZX5A 1QK2A 2E9MA 1XLKA 1T41A 3M5ZA 3AUOA 1Z89A 5K9DA 1T6MA 3L67A 4QAIA 1OGSA 1O7AA 2FHBA 2QEZA 4BI5A 4MYXA 1A0DA 2J8FA 3VOGA 5A69A 3LV5A 3VD5A 4LV4A 4DJDA 1KCXA 2CZVA 1H1NA 4NAFA 1FWWA 2E25A 3QR1A 2DEPA 1VJZA 2PGFA 4HKPA 1AL7A 3H2CA 4YCOA 1J5SA 1I2PA 3ZVIA 4QCFA 2DT1A 5IHSA 1WZAA 3NYDA 2YX0A 1KRCC 3L2IA 3D5HA 1FDJA 3P6LA 1XKYA 1B4EA 4G1KA 1E56A 2VZVA 4BI7A 3DI1A 1SU5A 4ADSA 4EP8C 1WYIA 1A0EA 1VF8A 2J9XA 3BTNA 3D6NA 3EWBX 3B9AA 4AX7A 4OU1A 5AC7A 3SR7A 2GJNA 1JDCA 3RDKA 2ZA2A 2Z1XA 4DN1A 5FJJA 2QMJA 2FQIA 3VD4A 2FVMA 5D2WA 3ZWTA 2OZ8A 2WPGA 3ANYA 4H9UA 5FL1A 5HOSA 1G7VA 1D7FA 3IANA 4LUIA 1RLDA 4Z2KA 3ITGA 2X0YA 3AIUA 1H4PA 1R0MA 1UC4A 1UR4A 3WD1A 5FEZA 4HP5A 4UFKA 3SURA 1R2RA 2QV5A 3M0ZA 1ONRA 2ZUUA 3B0YA 2VOTA 3QGKC 3WF0A 1VBRA 4AUBA 4PUDA 4A8NA 1WDQA 1A53A 3ARQA 1CGWA 9XIMA 1L8PA 5AZ0A 3S2JA 4IPNB 3RK8A 4YYFA 3ARZA 3TOPA 3ICJA 3MI6A 4JIHA 3K8LA 4TX6A 1WXJA 1F76A 3BLFA 2CWXA 1XSIA 2BGQA 2D3LA 3WLHA 3S2CA 4TV6A 1LTDA 3TROA 3MYPA 3MCNA 5E9AA 1RVKA 3H24A 1DWJM 2NWRA 2UZ9A 3QOKA 4TVUA 4LSBA 2Y1HA 3WLLA 3HPZA 3FK4A 3KDNA 5E0KA 1DJYA 5HJXA 3OBKA 3IGSA 4CCEA 4IIBA 2G4JA 4H7ZA 4HD5A 3BCFA 3MB9A 4ZTYA 4QG6A 1QCWA 5A6LA 4W8AA 3OVPA 4LRSA 2ZE3A 2ANUA 3EDKA 3NAVA 2G50A 2E5DA 5CZ0A 2DJLA 3IJIA 5CC5A 3IUDA 3PJUA 5BU6A 1GVIA 3LK6A 5L6UA 2BY2A 5AHFA 5A6BD 4JTUA 1OB0A 3M0KA 3FY1A 1ZCOA 2Z2AA 3LX9A 4A3UA 4IX0A 5BROA 1XIJA 4X22A 1H7PA 2QF8A 2FGLA 1QASA 3GHTA 4D1JA 3I7SA 2NZLA 1QU4A 5C7HA 1HKWA 4NAEB 5DMLA 1KBIA 3MMWA 2QUNA 4JY9A 5LGZA 3COTA 4GC3A 4UTWA 2XIIA 3VIOA 3NQAA 3NZPA 1RVGA 3RRAA 2A3LA 3QGVA 2CWNA 3AMGA 1CW2A 3RAOA 2V2DA 2GJPA 3KW3A 4LF1A 4XAYA 1V6WA 4L9XA 3GYCA 1Z44A 1RD5A 1WE5A 3EWYA 1JQXA 4H8VA 4IIDA 3ATZA 5B80A 3MYOA 1JRBA 3AZRA 5FAJA 2OXNA 1ME7A 3TVAA 4U33A 1LT7A 4OBTA 3P2VA 4NZ4A 5IDZA 4IJBA 3DFTA 1LF1A 3TNOA 4C1LA 4XAPA 3K8MA 3JU2A 1HJSA 4XX6A 2Y63A 3ARPA 4UCFA 3MSRA 3PVFA 5U7SA 3R8HA 1H51A 3CUJA 3FNDA 2QULA 4TX9A 1GVRA 4HU0A 2PURA 1YDNA 1HJVA 3VGEA 1Q6RA 5ABFB 2EKGA 4JKLA 1T96A 1O1HA 1KTNA 2GSEA 4H7VA 3WQEA 4A2RA 5TF0A 3M0VA 4C6FA 4RDYA 4X9YA 4R7WA 4MFDA 1JZ8A 1FWRA 1YADA 3W01A 3QV7A 4GG9A 4W7VA 2FGZA 1BVWA 3VKCA 3SZ8A 1I2QA 5DMNA 3EEZA 3ARSA 3PZQA 3EWZA 3MI2A 2O55A 1SFSA 5ABEA 3KBMA 1BSLA 4DBUA 3F7JA 5M17A 4KGJA 1P7TB 1RBOB 1WA3A 4C6BA 3S2LA 5AYXA 5LIXX 1IGSA 4KEUA 1XS2A 2PTYA 3STPA 3TW6A 3T4CA 4M6VA 3R5EA 1JNEA 5DANA 1NDZA 1PS9A 2J7EA 3KRSA 1FP9A 1UOZA 4XZIA 4Q7IA 3ZIZA 3AWNA 3LHTA 3E9AA 1XLEA 1H49A 2HS6A 1TQJA 1IZCA 3NOYA 2P8BA 3TTOA 3AALA 5CKSA 3QF0A 3MKCA 4AWEA 5DELA 4HZ6A 1M1BA 1P6BA 4IOTA 1PB0A 1PDZA 3SEPA 3WN6A 3R0KA 4DQWA 1E70M 5I03A 1IQ8A 4GX9A 5M1TA 1RJRA 2A3BA 3OOQA 3SY8A 4QIUA 4C6LA 3VO0A 2XFWA 2H6RA 4HJWA 4C6CA 4LC6A 4RXFA 3WZ0E 1UD8A 2SFPA 1OD0A 1MXDA 1JYXA 3VC6A 3ABRA 1ZHAA 2XJ7A 3AXIA 1GKQA 2GL5A 4MUPA 5F2MA 4XZMX 3GKFA 2YR1A 1KM2A 3V1PA 1J5TA 1XF0A 4WOZA 4PODA 2KZHA 4IMAA 3ARRA 3R7MA 4JEJA 3KL3A 3HZ3A 5AKQA 4PL1A 4F0LA 5SWUA 3G3MA 4EPDC 3AI0A 2OSXA 3NVTA 4GH3A 4YPJA 4REQB 2CYGA 4MNMA 1G69A 3W81A 1L9WA 2VEIA 1JF6A 1QWGA 1AH0A 1EP2A 2HEJA 1LUCB 4P8UA 3N6HA 3PS7A 1B5TA 4AFYA 3SY1A 5AYYA 4KRTA 3S9YA 2AMXA 1F61A 3ITOA 4N6EA 2W62A 2PU1A 3TE9A 3V0SA 1F8IA 2WXDM 2X1IA 3V1HA 2VVNA 4OECA 2QV4A 1ESWA 4TUFA 3L4XA 4FXJA 3EOOA 1SQ7A 3KEHA 4KCWA 1DEDA 3RIKA 1XH2A 3VTRA 4KH2A 3ITTA 2Z6IA 4S3KA 3WEOA 2VR4A 1MQQA 3GVGA 3QXBA 1M41A 1YW1A 1UMYA 1QI5A 3TZFA 1NF7A 1XUZA 1J96A 3T2OA 1AW1A 1UA3A 2JKEA 1QI4A 3E2RA 1CGVA 1SSDA 3LCFA 3WD0A 3TJXA 1IWAA 1G4EA 3FJLA 4BQ2A 3KVJA 4PMVA 5AC5A 1REQB 3AYSA 3IVTA 4ZO9A 3GDMA 4RE0A 4DO5A 3PBGA 3BC9A 1BQCA 1EC7A 1ZL1A 1UH3A 4JFSA 5CC3A 2E40A 1YXCA 5I6SA 1Q7ZA 5GVJA 2Y7FA 3BE7A 1UW9A 2PMQA 1PIGA 3WQFA 4ALDA 4FX7A 3TXVA 1ZAJA 3LBMA 5DRCA 2Z1WA 2PZNA 2OU4A 4FZIA 2YBVA 2C1HA 3LLXA 1L0PA 1MDLA 3N13A 4D6FA 2YCJA 4JICA 1KFWA 1M7JA 3B9EA 3NG3A 3PM6A 3W1UA 3UT0A 1GK8A 4AIBA 6XIMA 4BR1A 4EPEC 4KWSA 4GIEA 4O57A 2WVTA 3KE0A 1A3WA 3H70A 2WLYA 1BRLB 1XLJA 2MANA 5LNUA 3DH7A 3U4FA 1KBKA 1F4AA 3NZ1A 1JEZA 4H6EA 4R88A 3W7IA 4Q7BA 4PUNA 3F2BA 2NQZA 1W91A 2CW6A 2E6YA 3WK2A 3HPXA 4ROPA 1AVAA 5HNTA 1CCWB 3W53A 3KOZA 4O53A 1YYAA 3SM0A 3A23A 4UNIA 3THUA 1IWPA 1E15A 1Q8AA 3TFXA 4EK7A 5AOUA 4DIAA 4H9VA 4AZ6A 1QT1A 3GHRA 5BOFA 2A85A 1OZQA 3VGGA 3RU8X 4L9YA 1X98A 1XYAA 3L9CA 4FS9A 3QW3A 1VPQA 2H3BA 5CPNA 4MHBA 1L6SA 3P80A 4GQRA 2J47A 4QITA 4E4FA 3QMSA 3C86A 2PBGA 2R94A 3FFSA 7CGTA 4YVXA 4IGSA 2PDYA 2IKGA 2GUBA 2WQPA 2D20A 1O6IA 3CEUA 2HZGA 1GKRA 5A2AA 3IUHA 2OPJA 4WRHA 1KFEA 2J9YA 2WNWA 4L61A 3WQ6A 5LHFA 4MWAA 4YWIA 1CNVA 2E6AA 4M6PA 4A29A 4R5EA 4RZBA 2YLAA 3QSTA 4B91A 1WV2A 5CLWA 1P6WA 1J0YA 4K7VA 1UP3A 3L21A 5A8QA 4Q8WA 3VIPA 2HTMA 1H0IA 1IEXA 2WZIA 4QDPA 1OHLA 3LM7A 3CPUA 4I7VA 3ES8A 5KZDA 4IPLA 2YZRA 3SUUA 3WBWA 1L2UA 4AQLA 3AIQA 3WNMA 4GACA 1CGXA 1YTKA 3WBXA 2VC9A 3R8RA 1XV8A 2QCLA 3A22A 1M5WA 4D9PA 2P3ZA 4J9JA 1XG4A 4GVGA 2EG8A 2W5FA 5AVHA 3VIKA 1I75A 2B31A 4AY8A 1TPFA 3CWNA 4WEVX 3GU2A 1X39A 4JIPA 3I6RA 3N11A 1LG1A 4F4RA 5RUBA 3RPDA 3BAWA 2WC7A 4NZ3A 5KZ6A 1JCNA 4TV5A 4HYVA 3UWZA 4X9SA 1KXVA 2NUWA 3VX1A 4AY7A 4BF9A 2IMRA 3QY8A 1CXFA 3N29A 2C13A 4O1AA 3VDHA 3SY5A 3TQKA 5EB8A 1FCQA 1GTEA 2G96A 4S3FA 3W88A 4HCHA 3BG3A 5CJMA 3AHTA 2VGGA 2OEJA 4FF7A 1JFXA 1ZGDA 2DY3A 3FN9A 3VGFA 3H54A 3M5XA 2AQOA 2FDSA 3DESA 2WMIB 1EJUC 3KP0A 1E55A 3S6DA 3CAKA 3VZZA 5EMYA 1VZWA 3IWPA 3I4EA 3SCWA 5IRPA 1MFUA 1KXQA 5LIWX 2R24A 1ZRQA 4NZJA 5HATA 5CPSA 2X16A 5BOOA 2RUSA 4GRSA 2XGIA 3N19B 2ZUTA 3GTHA 1UJPA 2A3CA 4IQDA 5DY2A 3UWYA 2GVGA 3WNKA 1XBYA 1E1CA 1UZ1A 3O2LA 3FXGA 3VXGA 3AYTA 4QNEA 5DFAA 2PWEA 1A3HA 1SZFA 3OYXA 4BQ3A 1AZ1A 3IRSA 3PJWA 2VRKA 1LCOA 1H1YA 2O4QA 4Q8TA 5KEZA 1JDDA 4LNCA 3DU0A 3IJDA 3GBEA 1AH4A 4KCVA 3NQ2A 4OHQA 1HW6A 1PKMA 3TYZA 3UWWA 2CIPA 4LV9A 1LWIA 4PB4A 1DWAM 3PJXA 2NQ9A 3N12A 4L1XA 3SCSA 4WJEA 1RA0A 4UNLA 1MQPA 4PL2A 1MW0A 5DRIA 2KAUC 1XLCA 5REQA 1JF5A 1F6KA 3SCOA 2EPHA 4ACYA 4GZJA 3E0FA 4PSRA 1Z3NA 3VOHA 3NOEA 4J28A 1U1UA 2CKRA 3W75A 3MW7A 2CERA 4UQAA 1LOSA 2VQUA 3PBMA 1O5KA 1XYCA 4I7UA 2NX1A 3CUHA 1E0WA 1SVDA 3CC1A 2OKOA 4ZA0A 2DIJA 5TNVA 3E38A 3LCWA 2XN2A 2PDPA 4GINA 3L2MA 1CBGA 1F3TA 4GZ7A 1TKKA 1UR9A 3GNNA 2QUVA 3HA1A 2FZNA 1EF2A 4W93A 3T2PA 3O16A 3EB4A 1LT8A 1M6JA 1H7XA 3QY7A 4GY1A 1MFVA 1MNZA 5D37A 5H91A 4U5KA 4HA1A 1PSCA 3WLSA 2Y85A 3TC3A 2I14A 1OADA 1M01A 3S5OA 1EDTA 2WJFA 5HJLA 4YXGA 4LEFA 1YHTA 4HK5A 1W3JA 3CB3A 3TNBA 5FI8A 4TR9A 2RGMA 3RM8A 3T7VA 3CQ0A 1KBLA 1ZBVA 2ZZ5A 2WCAA 4A8IA 5BW6A 3EA1A 1H7NA 5C9WA 3TFCA 4O4WA 1E3ZA 4DWSC 2Y5EA 3ABXA 1KWGA 2RDTA 1CI1A 1SFTA 2D22A 2DW6A 1J2BA 5AVNA 1JAEA 4ACZA 1DORA 2P5NA 3CQKA 4M51A 3ZJKA 1IEWA 4GYFA 4LBRA 1EO7A 3NSXA 4Z1DA 1E6QM 1OABA 3T55A 4F0KA 3ZMRA 4G2DA 3GDBA 1HX0A 1K6WA 2YDRA 4K39A 4O15A 1EX1A 1A5OC 4Q4QA 1IEVA 1BWLA 3OZOA 3UZYA 2BSLA 2GGEA 3LHUA 3EMCA 3LXAA 4Q4OA 1MDRA 4NAFB 3CIXA 5CGQA 3SJNA 3QN3A 2FZDA 1A5UA 2JKPA 3GQYA 3DBNA 1PKLA 4LS1A 5CBJA 4KBXA 4J5NA 9RUBA 1UWQA 1TPUA 4HYWA 2EPLX 1AG1O 3VI2A 4QLJA 1UKTA 3T1GA 3O1NA 4QE1A 1RCOB 3T9PA 3H53A 2C19A 2ZX8A 4CQCA 2G0WA 3KP1A 4B16A 4C91A 2VCAA 3DOPA 4JQ2A 4KGLA 3DFSA 2GWGA 3SFWA 4H2HA 2HE5A 5T26A 3AS3A 2NW0A 3WX7A 1HGWA 3AJXA 1UIPA 4YWSA 4TQTA 1CENA 4JTAA 2TODA 8XIAA 2ZZ7A 3W7NA 2DZTA 2GVEA 3CEPA 1Z7AA 3L66A 1E1FA 3W1LA 2PEVA 3WELA 3PWIA 3LMZA 1MYRA 3HGSA 1NF0A 1UH2A 2XM1A 5E09A 2YJQA 3BLOA 3BW4A 4AIUA 7ENLA 3P81A 1Z32X 1W9BM 1V77A 3PPCA 4JOMA 4HGXA 1L6YA 3I6TA 1D3HA 5D2XA 3SAZA 3SCNA 1S46A 1LORA 3BAXA 3OO2A 1VFTA 3THAA 3KRUA 3EB2A 3NDOA 3OQEA 4JTJA 4W84A 2VFIA 5HA7A 4PUWA 2IW0A 2ZOXA 4RE4A 1UUMA 4EWND 1A5MC 3S6TA 3CQIA 5HUOA 1XIIA 4Z2IA 2ZXBA 4ZB5A 1XPGA 3GHUA 4PCTA 4MY8A 4X61A 2ZIDA 2FJKA 2UY4A 3S2MA 2OKTA 3QPEA 1DTUA 7A3HA 1X7IA 1HFBA 4U3CA 3OZMA 4BZYA 4KS0A 4Z42C 1QNVA 3NZGA 1Q6QA 3B4UA 4LVGA 3ZR6A 2VC7A 2OZTA 4DZ5A 2DVXA 3AIEA 5FACA 4XD5A 2OLAA 2W0UA 4XSLA 4YHGA 3RCMA 3GU9A 1XISA 1PHQA 4CN1A 5BU9A 3CL8A 2CFFA 4Q32A 3IGUA 4DPQA 3QV6A 3WNLA 4JTCA 3O3RA 5G5IA 1ZBCA 3TMQA 3GR7A 2QIWA 2D2OA 3C0SA 4B4FA 2IQ0A 2AGKA 1CECA 1XLAA 3QVQA 3B40A 3TCEA 2NV1A 3HFTA 5CGMA 3S9IA 1G6CA 1OZMA 4N9CA 3ITCA 1R9XA 5LA2A 4IP7A 2RJHA 4IGNA 4BY3A 1VBHA 2ATSA 1XI3A 4FNUA 2E5CA 4AB4A 5B7YA 5A1AA 3W1TA 3WKZA 3ALGA 3BICA 4O17A 1RHCA 1M9HA 4ZEPA 1PHWA 4WHBA 5ABTA 3GTFA 4GYKA 1DQXA 4TMCA 4M6QA 3OIHA 3S5NA 2EBNA 2IKIA 4GXPA 4GLEA 2PLKA 2CBIA 4YNGA 2DH3A 1Q66A 3F4VA 4YTTA 2VGIA 2VCCA 3NPXA 1OFOA 1KBBA 1XLFA 3ES7A 1C8XA 4JQAA 2WPBA 2BV9A 3FHAA 3O07A 1VRDA 4LYRA 4E6MA 1DJGA 1Q7MA 4XUYA 3K1DA 3MY9A 3NM1A 1WDRA 2J66A 1O68A 3UR5A 1FWCC 3CPGA 4KFOA 3WJZA 3AXMA 4KESA 3W7LA 3MVTA 3F5JA 2CITA 3GTNA 4N0RA 4F0HA 3K4DA 3RFAA 1VIZA 3F4DA 4GBDA 4RPPA 4Z1BA 1PWMA 3GVVA 4TMBA 2OVLA 4FOJA 2ZTJA 4UOJA 3W7HA 1KBJA 2BOEX 1FP8A 2YCKX 1CLVA 4V1XA 6ENLA 2QLYA 4PUUA 3TAKA 5AHMA 3E12A 4F0MA 3KAOA 3LOTA 5C55A 2R1MA 5JMUA 2Y2WA 3HPSA 1KKOA 3M44A 2DSZA 1Q3NA 3F2DA 4MSSA 1HGYA 2EG6A 2DFAA 3G1HA 3QBUA 1AJ0A 3LTSA 1JUBA 1TYGA 1R2TA 1RAKA 3URAA 3PWAA 3FEQA 3DC0A 1YNQA 5CH9A 3NEHA 4HU4A 1GWJA 1TPWA 4AHPA 1PL9A 4PA8A 2NXGA 2DH2A 3C4UA 4BF7A 2Z2BA 2ZZ3A 2A6NA 2WAGA 2CLMA 2CETA 4GO8A 4OUIA 3V18A 1TV8A 4FF5A 3G18A 1JYNA 5BXTA 4D72A 2YSWA 4N6FA 4KQNA 4XVEA 4I9AA 1HN1A 2H3DA 3VNIA 3WMSA 5KETA 4FLQA 2Z1KA 3LQLA 5FJRA 3T0BA 3TYUA 3RMJA 3GXPA 3SI9A 3W7QA 3DFYA 2CXEA 3K1GA 1BEUA 4GNJA 2DGAA 3CUGA 3NQGA 2I7GA 1TWZA 3GW0A 4MKNA 4PMXA 2CHRA 1NEYA 3LNMA 5AHLA 3H7UA 3U4AA 4E8CA 3CT2A 1SZGA 3P5YA 3RPTA 4Q7NA 1EJTC 4I9TA 3WNPA 3V16A 2VHLA 1JDFA 1Q4NX 4PUKA 2R1KA 4NHVA 2ZWZA 2HJPA 3XINA 4I8YA 3LCGA 1GZJA 3NDYA 3MT1A 3GRIA 4JTQA 3TC7A 4IM4A 1DL3A 4J2PA 2F2KA 5I3DA 4K38A 3G6LA 3RX3A 4GNKB 1OF8A 3BZGA 4L65A 3VDGA 3WUGA 1QOXA 5HMEA 2RAGA 4P7NA 5D05A 2VRQA 3QMRA 1SMDA 2ABBA 1TRIA 3LN3A 1HXJA 3B4YA 3NVDA 1W3LA 1WAWA 2DJXA 1CXKA 4J3ZA 3TTEA 2D2HA 3W22A 5DMMA 1ICQA 2PBOA 2WVSA 2Q3OA 2B81A 2BG5A 3KZPA 4O11A 4F2BA 2FTYA 4LVDA 3VD7A 3WLNA 4XZBA 4AD0A 3S5YA 1PPIA 3CXOA 3SSZA 3KOFA 2XGZA 4KEMA 1YDYA 3B9DA 4D6EA 4RZ5A 1EHNA 4QXIA 4DYEA 2Z28A 1PE1A 2DSUA 4NG3A 2X8RA 3LCIA 2ZZ2A 5LYRA 4JD4A 1IXNA 3VDCA 5CCZA 4ZOEA 3I3DA 3LCXA 1OFRA 4QNWA 5G2IA 4LVAA 2V3DA 3FYPA 3OODA 5FOOA 2X09A 3C56A 4K1WA 5I2UA 4QRNA 3KRZA 5FJTA 2FJUB 1FH9A 1OYAA 4XV0A 2YA1A 2A3HA 2PS2A 3KWXA 4I5RA 4QE4A 3LSBA 3SN0A 1P0DA 1Q6FA 2VUYA 3NO1A 3EKLA 2ATMA 2PGEA 4JHOA 1V3MA 3W02A 3CPRA 5J04A 1XL9A 2QGHA 3SGUA 4LY8A 4Y90A 1YEYA 2TAAA 1NU5A 4Y8FA 1W5MA 2ZUSA 3AHVA 3W84A 2IQDA 2ZE0A 1ELSA 1E0UA 2P10A 3VGBA 3E0IA 1E73M 2XYLA 1PEZA 1UCWA 3S1UA 2C1GA 2PCQA 4Y9PA 1V6XA 5EU9A 4Q8MA 5FF4A 4AG0A 3QPYA 4NSBA 3QRHA 4GXWA 4ZQPA 1XIMA 7TIMA 5CJ5A 1TTQA 1XXXA 2QCCA 3EB3A 5DO8A 1RV8A 1GQKA 3UVIA 4F0SA 3WMBA 4XVDA 1A5SA 4D6HA 1BD0A 1VFFA 3GW3A 2WNZA 1CXEA 5HQMA 1OM0A 3H8AA 4DUXA 1ZJHA 3WMLA 2IQTA 1TWSA 3DGBA 3VOIA 5A2CA 3W2NA 2FH8A 1U2YA 4FOKA 3DHPA 4F40A 3H12A 3KBNA 1VKFA 4AIEA 1TMQA 4URIA 1JZ4A 5KTLA 5A6JA 1VFHA 4PRRA 4BI6A 1A4LA 3H7RA 3S47A 4I5XA 1CIUA 1CLXA 4P5UA 4OWGA 3F4NA 1LQ0A 4IP5A 3LTYA 4D8LA 3LGGA 4YS1A 2CZ5A 5H8PA 4WDXA 3MBFA 3RMEA 3EX2A 1C91A 3THQA 1EJVC 2FB2A 1SFLA 1T0OA 3AOFA 2WVUA 3P93A 3DI0A 4MWAB 4HSOA 4X2RA 5I07A 1IXPA 1Q6DA 1OQFA 3GR4A 3WLRA 4ECLA 1S5WA 1VBUA 2OSYA 4Z1AA 4GYPC 3KOYA 4H6RA 4O16A 3H4WA 3M0MA 3GBDA 3LYEA 4JX5A 1VFLA 4ZB2A 4GI6A 3S1VA 1XIHA 2PU0A 4AHOA 4YJ5A 4TTGA 3CK5A 4AZGA 2W67A 1M04A 4XAGA 3NWRA 2E7FA 1V02A 5G4WA 3CYJA 4DF0A 3L68A 1K1DA 3PTDA 3FHQA 2CKSA 3FYYA 1DV7A 3AHZA 3RLVA 1Z6KA 1XPYA 4QLLA 3IACA 3RGTA 3EDEA 4UWMA 3SSJA 2UV8G 1GJUA 5FF7A 5BZAA 2R1PA 4XZHA 2V3FA 3QH2A 3LRKA 4IMDA 5HNRA 1F8MA 3BUVA 4N9DA 1R9YA 3P7YA 5FD0A 3PB0A 2PDFA 1FFQA 3FX4A 3GAYA 3R4IA 3SFKA 3H55A 4UR9A 3TJLA 3WJYA 2QDEA 1UOKA 3FCPA 4AEFA 3LPPA 1H41A 4LPCA 4NZ5A 5TBOA 1QXLA 5BWAA 1PKNA 1POJA 1VS1A 1IT0A 2BVTA 4WR3A 1ITXA 3ECQA 3VFLA 4JAWA 5CQ1A 4A8RA 1I0BA 3AJ7A 2XWDA 3HQNA 4MTVA 4IG2A 4Q8PA 3N9SA 4WSHA 2GYIA 2Z7GA 1JCLA 4PBEA 1N8FA 2Y88A 1JPMA 2AAMA 1DJXA 5H8UA 1W3NA 4M81A 4FAMA 1XINA 1KW1A 2PWGA 3CTTA 3WUFA 3LBOA 2Z1VA 1S1PA 3NIYA 3W28A 1I6NA 3ATYA 4GD0A 3S42A 3SCUA 4AZ5A 4LALA 1E6RA 4DY1A 4ADUA 1VH7A 2HVMA 3U9IA 3SRHA 4H9YA 4LUYA 1A3XA 3MVIA 1RQBA 1BXCA 4FR1A 3VD3A 3HG5A 1F6PA 2BWGA 4JTRA 4LB4A 3HF3A 2DORA 2VCBA 1EDQA 4UTUA 2DQWA 3RLUA 1E1CB 4GABA 1QNOA 3CS2A 5C0QA 4WY0F 3LI1A 2DZAA 1W8GA 1G1YA 5EYWA 4O8RA 1L6WA 1RCXB 1TJ0A 2C14A 3C5QA 1MUWA 3S46A 1H09A 5G4EA 3BMVA 3MA8A 1LJYA 2G97A 3KCJA 4L4PA 4Z1YA 2AL2A 2OFJA 2J9ZA 3RO6A 1WXZA 3BO9A 4IQLA 4O50A 4ZQCA 2YL8A 3M07A 4DI8A 1G67A 3GWQA 1N7KA 1MVYA 4BHYA 3HV8A 4GQ0A 5FEPA 4OGZA 1CGUA 4W89A 2XTKA 3ZR5A 1UD2A 5REQB 2DZVA 4O1CA 1NOWA 1TWWA 1OINA 4PYSA 1JG9A 1KXTA 1K8YA 3D46A 4XBJA 1US3A 3C2FA 1EWEA 5BMXA 4E2BA 3KXQA 2Z26A 1B31A 3SB0A 2B4GA 4NX0A 4CGTA 2ZBTA 4IMEA 2QDGA 2UY3A 3PUEA 2EG7A 1N8IA 1BYBA 4J35A 3W7JA 1XDMA 3RM4A 2FVKA 4DNMA 4O54A 4GQBA 3TH6A 1RQEA 4UTMA 3VINA 2XSXA 1OG6A 1ZBKA 4C90A 2O9TA 1GHRA 2Y89A 4J27A 1AQ0A 4S39A 3T8LA 4XWUA 2VURA 5HUPA 1MNSA 5D02A 3MQTA 3L0KA 3U2EA 4Q8VA 4ORMA 2WCGA 4GE8A 2BXZA 1N2VA 2ZCGA 5D9PA 4E38A 4F66A 1SZNA 3BLEA 4QEEA 3BL3A 4R27A 4M3PA 2V5JA 4AYSA 3H22A 1DE6A 4IF2A 4QISA 1QWKA 4UTHA 4XKYA 4RNFA 4YVVA 2B0MA 1VJSA 5A8PA 3M41A 3OG2A 2CLEA 1AFSA 3DHDA 4LXFA 4UCGA 1YNPA 2J25A 4NVTA 2Y7EA 3AXKA 3VIFA 3A21A 4MLJA 2BGSA 1XICA 3OGSA 3EOSA 4UOQA 4GC4A 1A0CA 4BEUA 3KVLA 1U22A 1K3UA 4ACZB 5FSEC 4TOQA 2PDMA 4PTDA 4J3XA 4J3VA 4R33A 5HWNA 4IGMA 3A3HA 3LI0A 5K4ZA 4D6IA 3AS0A 3L4ZA 4GJJA 2G8ZA 1A5AA 3CQJA 4UTJA 3CYVA 2IUZA 4JYDA 4B4HA 2C0HA 4M19A 3STFA 1TTIA 1D9EA 1R85A 3CT7A 4R9OA 3WMCA 1JXKA 3TSDA 1KKRA 4KEVA 4F48A 2BHZA 1FH7A 4PC8A 4AVFA 4IP4A 2CLKA 1EGMA 2OYMA 4EF9A 3BMWA 3M5YA 3AU6A 3Q65A 1BWKA 5CBBA 4DJDC 3V75A 5A6BA 1PJ9A 3T42A 1UMLA 1CGTA 2OX4A 4C6KA 4MGGA 2VR5A 4OE7A 3WQ5A 3AIRA 4AD5A 5MHBA 4B3KA 1XRSA 1IF2A 1GEHA 1GYNA 1WDWA 5G1MA 1H61A 2D0FA 5LKYA