4ICNA

Dihydrodipicolinate synthase from shewanella benthica
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
300
structure length
300
Chain Sequence
ESWGSHMINGSIVALITPLNSDGTVDYTSLEKLVEYHITEGTDAIVAVGTTGESATLPISEHIAVVGQTVKFASGRIPVIGGNGANATAEAIELTKAQNKLGVAAMLGVTPYYNKPSPKGLIAHYTAVAASTDIPQILYNVPGRTAVDMLPETIAQLVEVPNIIGVKDATGDVARVKQLRDLCGNDFLLYSGDDATAREFLTLGGDGVISVANNIVPKLFKLMCDAALAGDTQAAMAAEDQIKGLFSALFCEANPIPVKWAAHKMGLISQGDIRLPLTELSTEFHGLLLDAMKNARIEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords DIHYDRODIPICOLINATE SYNTHASE
publication title Cold enzymology offers insight into molecular evolution in quaternary structure
rcsb
source organism Shewanella benthica
total genus 102
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4icnA00
2NXHA 4U4MA 3TQVA 2ZRZA 3HG3A 5LHFA 1RQBA 4NJJA 3LCIA 1D3GA 3W85A 5K7JA 1RV8A 2CZ5A 3C4UA 1FCUA 3HGSA 4DF1A 2YW3A 1B9BA 4TIMA 1G69A 3R2GA 1R2RA 5HR7A 3S0CA 3C2EA 3RK8A 1X8FA 2ABBA 1S5WA 4GUFA 5LGXA 4EF8A 4LVFA 2Y7FA 3M16A 1TRIA 3PS7A 4PODA 4LY8A 4WQ6A 3Q2DA 1EPXA 4KFNA 5A8GA 3ABRA 4UR8A 3G3DA 3NGJA 2Y63A 3LRLA 2ZZ3A 1UB3A 2E68A 1KV5A 2HMCA 2QJIA 4A2SA 1O5XA 1EX5A 4AAJA 5BMXA 5AC7A 3IIXA 1ICPA 3P67A 3B0UX 3W7JA 4X9SA 1TPEA 3CHVA 4XKYB 3TSBA 3C3NA 2YDAA 5K9XA 4MFEA 4AF0B 3H55A 2PE4A 5CZSA 3NQCA 5HWNA 4IWWA 4IMCA 5ABTA 4ALDA 1PE1A 4JTIA 2V2DA 4OV9A 4JTGA 3GDRA 4K37A 3FIGA 1TSIA 3R89A 3WFAA 4Y8FA 3KVKA 3C2VA 3NNTA 2C1HA 3W71A 1A5BA 1IXQA 2DU2A 5FEXA 2VFGA 3BW2A 3LGEA 3N2MA 4PL1A 2GQAA 4TMBA 2ZZ6A 3DENA 2TSYA 3CPRA 1F73A 1I2PA 4X2RA 4AWTA 1GPWA 1QPQA 4AHQA 3I7SA 3IVSA 1KM5A 4JEQA 3G0XA 3P7YA 1XUUA 3W7QA 1SSGA 1FUYA 2OJPA 1YPFA 2CLFA 4IPJA 2G97A 3QJAA 3MUXA 2B7QA 1OYCA 4IMFA 1GT8A 3O06A 3LDVA 1TJRA 1LTDA 3A5FA 2DZPA 4QJ1A 4TX9A 3TH6A 5HNRA 4HSNA 1TMHA 2ABAA 3YPIA 1NF0A 4M19A 4LWWA 2ISVA 4AHOA 3BW4A 4YWIA 2V5BA 1KLZA 3UY7A 3LM7A 2YSWA 3IVTA 2Y7DA 1JULA 3TXZA 1SO5A 1DBTA 5CG7A 5GVJA 1F76A 3VCRA 4MPQA 1IIHA 5L6UA 3DKLA 4C1KA 4TU1A 1H50A 3EB2A 4DELA 2E5BA 3LCWA 5IM51 3DFPA 2H8XA 2A21A 2WSYA 5F4XA 1LCOA 1XL9A 3LHTA 1IXNA 2A2IA 4RV8A 5AHNA 4BI6A 3AJXA 3NO5A 3UPWA 4RKAA 2Y88A 2IQTA 1T8XA 2DP3A 4H3DA 4TMCA 1GG0A 1OF6A 3ELFA 2OT0A 4ZQPA 3N9SA 1XM3A 3DZ1A 3LRKA 2VFIA 3PVFA 3UWWA 5D2WA 2JGYA 4O52A 4CCEA 5K3VA 3PUEA 1LDCA 1UBSA 1Z42A 2F84A 4D2JA 3NQ7A 5H2ZA 3PSVA 4JY8A 1OF8A 2C15A 2DZUA 2B7NA 2J9XA 1JR1A 3EXTA 5TQLA 1DV7A 4M6VA 5LHEA 1ALDA 5FESA 3NR0A 1SSDA 2J6XA 4LVGA 4HNNA 4K38A 2C6QA 4O14A 3U6WA 4M7TA 3ATZA 4JICA 1Q6QA 2QR6A 3GKAA 3LCXA 4UFIA 3OEXA 4JTSA 5D2XA 3NQDA 1JVNA 1DVJA 4O15A 2P0OA 4MZ1A 1LBLA 4M5PA 4DPQA 3LOTA 3MP3A 3MWAA 3NQAA 1YYAA 4MZYA 4O50A 1Y0EA 2HS8A 2BX7A 3B04A 3CT7A 3TFCA 4JGDA 1F7BA 3GNNA 1LM1A 3PBVA 1JCJA 5AYYA 4I9AA 5HULA 1CX9A 4XTIA 1DKWA 4OBTA 3H54A 1HL2A 2CLLA 2CZDA 3NVTA 4KWVA 4UMCA 4HHPA 1LRQA 4MY8A 1QMLA 2ISWA 3KRSA 1ICQA 1WDWA 3M1ZA 5CGQA 3UY8A 1ML1A 2JKPA 2OT1A 3B03A 2RH9A 3ZWTA 1DOSA 4CQ8A 3RF9A 3O1NA 4BK9A 1XC4A 4IMDA 5FF3A 3SR7A 1VHCA 4KKXA 2H90A 4E2DA 1WX0A 5AYZA 4UXDA 1KFJA 2AAMA 4XTDA 1C29A 1FDJA 3SJ3A 3V75A 4YXGA 5HWMA 2Z6JA 4FX8A 4GWEA 4H6KA 2EGZA 1KFLA 1AMKA 4DO5A 2X1TA 2GUUA 3FEMA 3KRUA 4J9JA 3HOJA 4AH7A 1KFKA 2D73A 4U28A 2ISSA 3DHDA 3C61A 3FLUA 5CKSA 4LV4A 5EBUA 3W3OA 3F4WA 4N4QA 1LLWA 1MXSA 2RDWA 3NZRA 2VC6A 3E12A 4FXRA 5J5DA 1TB3A 5KZMA 3T4CA 1JJKA 1EEPA 3W7LA 1A53A 3CEUA 3G24A 4L4MA 2Z0IA 3ABSA 4GBUA 3RFAA 4DF0A 1AL7A 2G5WA 1P0NA 3IVUA 1Q6RA 4POCA 1LOLA 3RU6A 1L6WA 3NQGA 3BO9A 1W3IA 2J9ZA 2ZA1A 3CQ0A 3UWVA 3M5VA 1QR7A 2A7PA 3CU2A 1I4NA 4NJIA 2V2CA 1L2UA 1DHPA 3W1MA 3W1TA 3IV3A 4RZ5A 3SGZA 2DJXA 3BPWA 3O6YX 4JR5A 2I9EA 1WQ5A 3VFLA 5D09A 3L0GA 2PURA 4BI5A 2Q8LA 2Z2UA 3IIOA 5U4NA 4NXKA 5BRBA 2YFOA 3UD6A 1WOAA 3L67A 3M47A 3DFOA 1LZOA 2CLIA 3LHWA 3RLUA 4YMZA 1QPRA 2QCEA 1TPUA 2V8ZA 2YXGA 1U5JA 4MY9A 1UUMA 3ZWSA 1SR9A 2EF9A 1KM1A 3EX4A 5AOUA 2J24A 4IPIA 2RKXA 4P2VA 4DO6A 4XWUA 2GOUA 3TAKA 4Q4KA 4LS0A 1AG1O 2ALDA 3O8AA 1G4EA 1ICSA 3L0NA 1K7FA 5D03A 4G1KA 1YLVA 3L2IA 3SY5A 1M6JA 2R94A 1IGSA 4I7UA 1RVGA 4O10A 4GUIA 2B7PA 2NZLA 4N9BA 4NNBA 4ORMA 3NZ1A 4O57A 5HQEA 2KZHA 2GVGA 4BWLA 3FYPA 4FNSA 5K2ZA 2Y70A 4WXYA 1XBZA 3HF3A 1EUNA 1ZY9A 4FNQA 1I2RA 3TMQA 2QUUA 2PRHA 1IF2A 2B0MA 3MP4A 3NPXA 1GVRA 5K9DA 2YR1A 4FO4A 3WJSA 4JTKA 3GDKA 4JD4A 3G1VA 3SSJA 5DLCA 4BWLC 2HTMA 2PC4A 1P5BA 5LGZA 4LV9A 1GEQA 2RDTA 1TQJA 1TV7A 3N73A 1XUZA 2TMDA 3LBMA 1OK4A 2DZSA 2VOMA 1OX4A 1WBJA 3B4UA 3TJXA 3EKZA 3TV8A 4NNCA 1X6UA 4RCXA 4QM1A 4FX6M 1H7RA 2ZTKA 3HB9A 3BK0A 2F7FA 3HGOA 3IGSA 3CM4A 3UWQA 4R53A 2X1RA 2NLIA 4UFJA 1O60A 2NWSA 3KRZA 1HG3A 3OA3A 4MLJA 5EL1A 3JRKA 3DFTA 1KLYA 2WPBA 4UNLA 3P61A 4WY0F 1LRTA 1QAPA 3VI2A 1J5TA 1KM4A 2GJNA 1YDOA 2JGQA 3BGJA 1LYXA 3UXAA 5DN1A 1JQXA 3KX6A 5KINA 4CNNA 4QISA 2E5DA 3C2FA 4K39A 2QCNA 3R5EA 2DZVA 1N7KA 3W7PA 4Y90A 1ME8A 4BR1A 3W2UA 4K6AA 3T78A 3QH2A 3GB6A 1QDSA 3E0IA 3D0CA 3W1RA 5FF4A 2GVLA 2OMAA 1QOPA 5F2LA 2BWGA 2TRSA 3MP5A 5KTLA 2CW6A 3M44A 1OYAA 3EWWA 4IGHA 2A7RA 1F5ZA 1QWGA 3OG3A 1SZEA 4HPXA 2I14A 1W1ZA 1VPXA 1EWDA 1Q6LA 4O18A 3ZS4A 3GR8A 1M7PA 1FWNA 4JTHA 3W2NA 3M5XA 4O1CA 3G18A 1BEUA 3GAYA 2ZZ7A 2A6NA 1OFOA 2FTPA 4UTTC 3ZR4A 5HUPA 4CQ9A 2G96A 3W7EA 4HPJA 1FWWA 3SZ8A 1OFEA 3NQ6A 4XUGA 4W9TA 3GR7A 3W2LA 1SFJA 1K3UA 1JUKA 3VE9A 1DJQA 3GXNA 1R2TA 1LBFA 1R47A 1Z44A 2NUYA 4Z1DA 2FIQA 4YL2A 3BARA 4NX0A 2P1FA 3G22A 4RXFA 1QO5A 1VCGA 4B5NA 3NOEA 4HIBA 1S5TA 4IMGA 1H61A 4Q32A 1YADA 3GXPA 1XFBA 4YCOA 4ZQRA 3OVRA 2QUVA 3UYCA 3NQEA 3PULA 4O16A 3EX1A 4AHPA 3IEBA 1Z41A 3QEZA 2CFFA 4CNPA 3TMLA 3GK0A 3MI6A 2C19A 3RLVA 4IXHA 4N6EA 1W56A 4S1FA 4FHAA 4JIPA 1KM6A 1OFPA 1NEYA 3N3MA 4JNMA 2WV8A 1NAL1 1QPNA 2Z1BA 1VQTA 5HMSA 4LUIA 1LROA 4Z1AA 1O94A 4FNRA 3O05A 3G1XA 3HG5A 3ATYA 1GVOA 4UMAA 3HJZA 2OCZA 5J5RA 4AEOA 4NU7A 3BV4A 2DZXA 1KM0A 4AXKA 2QAFA 4RZ4A 1R2SA 3P60A 3TFXA 5BNKA 4AMAA 4ADTA 3OHIA 4UTMA 1S5VA 3W83A 2QDHA 1KM3A 4DF2A 1GTEA 3PBWA 4N6FA 3SFKA 1TCDA 3L5AA 4JTEA 4DO4A 4FXSA 1PCWA 3DFSA 3FFSA 1LORA 4NXSA 1YTEA 2CLHA 1F2JA 3I65A 2NWRA 5KITA 3OBKA 1SO6A 1H51A 3QFEA 4MVAA 1A5CA 4JN6A 1XBYA 2BXVA 1G6CA 1GQNA 2ZYFA 2YGYA 3N34A 4GRSA 3NQVA 3WK2A 1X1ZA 3A24A 2Q3OA 3ZFHA 3W07A 2ZBTA 2WNQA 3MW7A 3CLMA 5DBUA 1IXPA 3MJYA 3W1NA 1GG1A 1VLIA 4GUHA 3W1AA 1B4EA 1L9WA 3TXVA 4OHQA 3UPBA 4MUZA 2QCGA 1TJPA 3TDFA 1SZNA 1VCVA 3TQKA 1G7UA 4MZ8A 3QMRA 3W7GA 5C5YA 4GUGA 2AQWA 3LV6A 3DFNA 5F4SA 1OHLA 3TQ0A 3P81A 2PRLA 4O12A 1GVQA 3LTSA 1Q6OA 2Y6ZA 2NV1A 1VYSX 1WBHA 5G2WA 1KFEA 2EPHA 4MYXA 4ONVA 3BLFA 3MI2A 2BZNA 2EAWA 4LRTA 4JIQA 4CNOA 4MJZA 3TKFA 1AK5A 3TR2A 4LVAA 3UQNA 4GE8A 3NPUA 1OFQA 5DCEA 1RPXA 4BF9A 1PHQA 4JYFA 4UFLA 3QW4B 3N2XA 1O95A 4LC6A 1OABA 3O6CA 5I3HA 3LV5A 1ZAHA 2FPVA 1TV5A 1QPOA 1RZMA 4I7WA 3HPSA 1NFBA 1YDNA 3E49A 4N9EA 3G1FA 3GNDA 1V5XA 1GVFA 2VENA 4LT9A 3S5NA 4DQWA 3QPZA 2JK2A 4IJBA 4K7YA 1J4EA 3HGJA 3TC7A 1W5PA 3U8GA 1J2WA 4FNPA 3QYQA 3TSMA 4RXGA 3PAJA 1DL3A 1VZWA 5CZJA 5FEWA 3PUDA 4FX7A 3HQ1A 3KVLA 5G2IA 2E6AA 4JTJA 2OX1A 2A4AA 3JS3A 1F74A 1YXYA 4IX2A 3W1LA 3E9AA 2V82A 5CZ0A 5T26A 4HNVA 1ZENA 8TIMA 3PG8A 1HFBA 1R46A 2VEPA 1TPB1 4H4IA 5FF7A 1W3TA 2JBMA 3QMTA 1EP2A 6TIMA 2A6LA 2B7OA 1OK6A 5DY2A 3DHFA 3BVJA 5CPLA 4NJKA 1B57A 3P82A 1H5YA 2QCHA 3W7HA 3WJWA 2ATSA 3EWZA 3FKRA 3P74A 1W3NA 5L9FA 3STFA 1VHNA 1H62A 5D30A 1WXJA 3CWNA 3R8RA 4RJEA 2H8ZA 3LLDA 1UUOA 3L68A 5G2HA 2A85A 4FEZA 1EP1A 5AHFA 1ZNNA 1NSJA 5DCDA 1MSSA 3I7RA 3G8RA 3KVMA 1H7PA 2QKFA 5G4EA 4IQLA 4HNTA 3LCLA 1TO3A 5EY5A 2V9DA 1LOSA 4PTNA 3LXAA 1KTBA 5C6MA 3IGUA 1TQXA 4NZJA 1ZAJA 1KTNA 2CWNA 1QOQA 4R7JA 1YXDA 4UTIA 2Y85A 2ZZ5A 3NL2A 5AHMA 1GJPA 1JUBA 1I8JA 4NJGA 3HGRA 3PSWA 1LP6A 1UASA 5AC8A 1W5OA 1FWSA 3MYOA 1W5QA 4GJ1A 1HTIA 3EEGA 2PCQA 4UMBA 3IRDA 1QNVA 1OX4B 1W37A 2YYUA 2ZQ0A 3TW7A 4XBSA 3DAQA 2ZRYA 3DU0A 5KMYA 3W1QA 1YXCA 1F05A 3C52A 1RQEA 1EP3A 1JUEA 4GXMA 3NQ8A 6ALDA 1AW2A 1EWEA 5D04C 4YCPA 4OQVA 5LNWA 1FWRA 3BG9A 2ZZ1A 4OWGA 1BWLA 3KAOA 4JX6A 5D05A 5H91A 5DCBA 1C8VA 3A5VA 2RFGA 5U7SA 1TTJA 4LRSA 3LHVA 3W7RA 3GXTA 4KFOA 1XXXA 3LHYA 3NL3A 2QJHA 4UC5A 3T55A 3PBYA 3GDMA 4ORIA 3EX3A 5F4WA 1YTDA 3TC6A 5MHBA 2O7QA 3S42A 3EWXA 3KFTA 4JTFA 4ZQOA 1OFAA 1H7XA 4XQ6A 4WZHA 3PM6A 1I2QA 4WY0A 2BTMA 3DFQA 3T40A 1JCXA 2VFHA 5F2IA 1T96A 5G1TA 4O11A 2E5CA 1CI1A 2X30A 3THQA 4JY9A 1TYGA 4O54A 4AWSA 3QM3A 2WNNA 4HT3A 1TREA 1OFDA 2QUTA 1SW3A 1AW1A 3NA8A 3M7WA 4WXZA 2GJLA 1G7VA 1EIXA 4EWND 3P8IA 1NVMA 3NYZA 1GOXA 1VCFA 3I7QA 3W7KA 3IIPA 3C0JA 4O17A 4RK8A 4NNAA 2XFWA 4FNUA 2Y61A 3UWYA 3S1VA 2FPTA 4O28A 2R8WA 1TPFA 1H7OA 5HR6A 3NL6A 4E0CA 1W31A 1DQWA 3DI0A 3T44A 3LLFA 3FYOA 1JCNA 4HKPA 3W7NA 4WX2A 1NF7A 1FDYA 1HO1A 4BFAA 4DBEA 2RHGA 5AYXA 5BW6A 2BLEA 3M43A 3L9CA 1KFCA 4NJHA 5D37A 5I3FA 4OU1A 4A22A 4OT7A 1I2NA 1ZAIA 3NDOA 3NQFA 2ZRWA 1A5SA 4QIUA 3PY2A 1L6YA 4N2YA 5AHIA 1Q3NA 2VELA 4N9CA 4O1DA 1AW5A 3GX9A 1KBIA 3TAOA 4DPPA 2WNZA 5LNRA 1SFLA 3W22A 1XKYA 4PA8A 4LS2A 3R12A 4NT0A 1WA3A 5EA9A 5EMUA 1IIGA 4UTWC 3Q58A 3W84A 2E1DA 3UZ5A 4JYDA 4AVFA 1KW1A 1EA0A 2FPYA 2GPTA 3I68A 3C8FA 1ZCOA 1A50A 2QJGA 2DZTA 3F03K 4LOCA 2VFFA 3W1PA 2X16A 1TPC1 5IBXC 2C13A 4JYEA 3FA5A 1HO4A 4PH6A 4XBKA 2X1SA 2VXNA 3ABOA 4WOZA 1RR2A 2FDSA 1N55A 4LW7A 1VLWA 1PVNA 3EWYA 4CQAA 4QQ3A 3UWUA 3C56A 5CPOA 3S6DA 4JXCA 3GDTA 3G0UA 3MO7A 4LS1A 3LERA 3B0VC 1BTMA 3QW3A 3MHUA 2NX3A 1TPVA 4UTJA 2NUXA 2ZFAA 3QMSA 3NQ2A 4O4WA 3BG5A 4WJEA 5DXXA 2H3DA 3BLIA 1GTHA 2J88A 1K8XA 3L0KA 4IUOA 3W72A 4UUIA 4LVDA 2FFCA 4UTUA 4M7SA 2A7NA 1H7NA 2C14A 2FJKA 3ABQA 3QF0A 3NM3A 3W7OA 3AO0A 5SWUA 4UTTA 3G8EA 5C2XA 3KXQA 2DORA 4ML9A 1M7OA 3G1SA 4S2CA 3L65A 1LLZA 4EIVA 5HWJA 5EKYA 1OX5A 2FB2A 2ZTJA 3TIMA 1VJIA 1G67A 5AB3A 1PIIA 3WK0A 3HG2A 3WK1A 5D2VA 5LSMA 2Q3RA 1A5AA 1JCYA 3W2MA 3EXRA 4MJMA 1ZJIA 2E6YA 1OG0A 2C3ZA 2UV8G 3A22A 3RNDA 4O53A 3PF3A 5DELA 2R14A 2R91A 3DXIA 5DXYA 3GDLA 3MMTA 3CIXA 2BSLA 2H3BA 1XI3A 1SPQA 1TTQA 2YFNA 2WKJA 1EUAA 1XCFA 3NPWA 2TYSA 2E6DA 3TA6A 3BGGA 3UNDA 2WJZA 4FNTA 1VR6A 4ZQMA 1F6PA 2E6FA 2YPIA 3B05A 2VKZG 4I7VA 1SUXA 3IGXA 3STEA 1K8YA 3O16A 1TTPA 5TIMA 3SGUA 5K4XA 1TRDA 4TR9A 1G4TA 1MEHA 4ICNA 2VFDA 2ZDRA 4GC4A 2VEIA 4ZMGA 3PC0A 3N19B 1LBMA 1SU5A 3U2OA 3G1AA 1FWTA 4KFPA 5LNVA 1SO4A 1F6KA 1VYRA 1I45A 1JRBA 1PHWA 5KSWA 1OFBA 2C18A 3W7CA 2I1OA 2ZZ4A 2ZCGA 3M9YA 4MLRA 2YW4A 3A9IA 3GAKA 4IX0A 2E77A 2O7SA 4M6PA 1P0KA 5CZTA 3Q37A 1ONRA 3PB0A 3DH7A 3QSTA 3TJLA 1W54A 3BW3A 4R34A 3IIZA 3M41A 4EF9A 3NM1A 3GYEA 1TPH1 2EHHA 1DQXA 3FKKA 3QQ0A 4LUJA 1DJNA 1W5MA 1T99A 1QFEA 3W9ZA 4ZZ9A 1B4KA 3L5MA 1RQHA 3CEPA 4PC8A 3EX2A 2XN0A 1H1ZA 1XDMA 3G1HA 2J27A 1SZGA 5I3IA 3S1UA 3WJZA 4O8RA 3NEVA 2Y89A 5CSSA 3FOKA 3JR2A 4HNUA 1FCQA 4XZ9A 1QCWA 1PL9A 1V7YA 2XN2A 3HPXA 2FLIA 3QPYA 1BWKA 4NZFA 2G95A 5I3GA 5FEPA 2QCDA 2Y7GA 3LB0A 2NXIA 5D38A 4UCGA 3LTPA 1Z48A 1FX6A 4QITA 3N14A 3NQMA 1KM2A 4EVZA 4DEFA 2VEKA 2JKEA 3CB8A 1W5NA 5FI8A 3HMJG 1AL8A 3L21A 5AN7A 5CSRA 4RX0A 3EX6A 1GVSA 3LTYA 3P5ZA 4Z0JA 4Z08A 2QCFA 2CLKA 3EWUA 1FQ0A 5F2MA 1W0MA 3SW6A 1ZFJA 5FF2A 1N8FA 4IOTA 1ME7A 4LTSA 2QCLA 1KTCA 2HSAA 3PBUA 2NUWA 4ADUA 3W1XA 1KBJA 3CIWA 1FCVA 4X22A 4Z0SA 1D9EA 3W70A 4K8HA 5E1QA 2QCMA 3P84A 1TV8A 3PUOA 3NAVA 4QSHA 4MOZA 3P80A 3LX9A 1VH7A 4XKYA 4OE7A 3BLEA 2P10A 3S5ZA 3LCHA 1W8SA 3TK7A 1I2OA 4AF0A 1S3HA 4GFSA 3F4NA 3O6DA 4ZQCA 3SIZA 5I3JA 3BG3A 2C16A 3QSRA 1DORA 3HO8A 1K7XA 5D2TA 1G4SA 5DBTA 4DBDA 1M5WA 5F1VA 1XBXA 5E93A 3H53A 1VRDA 4DXVA 1UJPA 2H6RA 5K9CA 3FJ6A 1JCMP 2ZRVA 3PB2A 5AHLA 3UWZA 2RDUA 4BI7A 2Y7EA 4JTUA 1PS9A 2PRMA 5CPMA 3GIYA 5AC6A 3IIVA 4KWWA 1WYIA 5D33A 4Z1CA 4O0KA 1OYBA 2Z6IA 3TU9A 2QDGA 2CLMA 1L6SA 4EOUA 4NVTA 4E2BA 3HG4A 5HUOA 4JDBA 4UTHA 1ZALA 4LC8A 1OFRA 3LHUA 3O15A 4A2RA 1KV8A 2WOQA 1RD5A 3F1QA 4NQ1A 1KFBA 1XBVA 3M0ZA 3DBPA 4OV4A 2CLOA 3W87A 4CCDA 1SW0A 1JQVA 3W86A 1CW2A 4JX5A 4LU0A 4WY0B 3W7MA 3NXFA 2W6RA 1OX6A 1PV8A 4K36A 2B4GA 3W76A 4FIRA 1H1YA 4MYAA 1YDVA 3S5OA 2V0TA 2EKCA 3PWAA 3DKJA 3M5ZA 2V81A 2NXGA 1FCBA 3LRMA 2ZZ2A 2CZFA 2V30A 5TBOA 3LI0A 1KA9F 3GVGA 5LKYA 3STCA 1TPWA 4Y96A 5G4WA 5BMWA 4N02A 3TROA 1FDZA 4QNEA 5G1YA 3WJYA 3TW6A 1TTIA 2CU0A 1UCWA 4JX4A 3O07A 4ZVJA 1WV2A 4L4LA 2YYTA 2J9YA 3K30A 2ZRUA 4UFHA 1X1OA 3TX9A 4S2BA 4WOQA 1MEIA 4K8EA 2YCEA 2V2HA 4M6QA 4NUWA 2QF7A 3QC3A 4RR4A 2WQPA 5BOOA 2NV2A 3VE7A 4MKNA 1FXQA 3LI1A 3G0SA 3W88A 3LHZA 4UTKA 2HS6A 3OVPA 4PCFA 2E09A 4IXXA 3W2JA 4A3UA 1ADOA 3WK3A 4JS3A 3M6YA 1U83A 3T7VA 1JRCA 2LLEA 2CLEA 3S1WA 3GZ3A 4UR7A 3G1DA 3N9RA 2YX0A 3DI1A 3CTLA 3UXDA 1QO2A 1OJXA 3MHFA 3MBDA 3OIXA 4QNWA 1GZGA 3W74A 2VEMA 3M5YA 1BKSA 1LOQA 3OVQA 3W7IA 3FJLA 4IMEA 2AGKA 3PR2A 1K02A 3WJXA 3P62A 1ZHAA 4A21A 3KVJA 5LZLA 3TE9A 3O63A 1MZHA 4LVBA 4O1BA 3C6CA 2A1YA 4Y9AA 5F1UA 1O5KA 4AB4A 1FXPA 2ATMA 5K4ZA 1TPDA 3DGRA 5FF0A 2W79A 4Y6GA 4MIMA 5A5WA 1PCKA 3L66A 1VYPX 1K7EA 3HIJA 3EKLA 4FIQA 2FB3A 1SW7A 1WOBA 2C0AA 3W73A 3CC1A 2DZWA 2NX1A 1IXOA 4MFDA 3EWBX 7TIMA 3S8HA 5AFDA 3Q94A 4UTLA 2ZRXA 2WO5A 1H60A 4O19A 4LNYA 3MI3A 3EXSA 2QCCA 5KZEA 5FEZA 1SZFA 3HBLA 4X3ZA 3W23A 2WSQA 5LNUA 4Z1BA 3QRHA 4UNKA 3V1PA 3HPZA 2ZA2A 4MY1A 3VNDA 2A5HA 5D32A 5CPNA 5AHEA 2DJLA 5F2GA 3SECA 2JKAA 4QAIA 1TIMA 4GNJA 3I6RA 3INPA 4UTWA 4Q33A 1GYLA 3ANYA 4O1AA 1SQ7A 4CCCA 4FB7A 5C54A 3NPVA 3W75A 4C1LA 3W7DA 4N9DA 1D3HA 5IBXA 3NL5A 3L5LA 4PL2A 4O4VA 3S5YA 2X1UA 2A0NA 4OGZA 4ZL1A 3QQ1A 5E0KA 5I3KA 1SO3A 3QZEA 3LXBA 4UIOA 1FBAA 1E51A 4YLWA 3FS2A 5G5IA 3THAA 3PG9A 3G1YA 3A23A 1G4PA 1MEWA 3MBFA 4K7VA 1HUVA 4PEKA 3UZJA 4ADSA 1VS1A 1WAUA 2GQ9A 1JCLA 3LBCA 1Q45A 4NX5A 1R30A 1O4UA 4JTLA 3STGA 5LNSA 1GWJA 5HJLA 3G3MA 5EPDA 3TCEA 3W1UA 2FQIA 3SI9A 1OVDA 4A29A 4FF7A 3A21A 3P8JA 1P4CA 1YTKA 1X7FA 1K8ZA 3E02A 4N4PA 1H7WA 3MHGA 4HSOA 4JTTA 3LXCA 2Q8ZA 3KHJA 4HN4A 2V5LA 3GLCA 4O0ZA 2X2GA 1THFD 4RZ6A 4WD0A 2Y62A 4PFMA 2XN1A 2GVJA 3KOFA 5HINA 3B0PA 1B3OA 3MYPA 3W6YA 5D2YA 3B8DA 1EB3A 1H63A 3LCFA 4E38A 2W0UA 4O13A 5C55A 3W2KA 1XDLA 2QAPA 4UFKA 3TUUA 3VKJA 3NG3A 3TSDA 3S9YA 4P61A 4JDYA 4R33A 3TNOA 2OZ0A 1YPIA 1FY6A 5EYWA 3RMJA 3P5YA 4UFMA 3R13A 4ZQNA 2QEZA 3LCGA 4WUIA 2NX9A 3GKFA 3USBA 4TO8A 1GYNA 1P1XA 1ME9A 2CZEA 4CLMA 3S1XA 5D02A 1C9DA 5DY3A 2TPSA 1K03A 2VFEA 1MO0A 3E96A 4AWUA 3C2RA 1VGAA 3B06A 1VC4A 2QCDB 2YZRA 4GUJA 1T0OA 2ZA3A 3CWOX 4RLIA 1LRNA 5KZDA 3C2OA 2WSRA 2GQ8A
chains in the Genus database with same CATH superfamily
3L2LA 2R9RA 1C9WA 2NQZA 2ZRZA 3HG3A 3WCZA 5LHFA 5D9PA 3PNUA 3K4DA 1OD0A 2CITA 4W93A 4LUSA 4DF1A 3R2GA 1GW1A 4F0LA 1S5WA 1JPHA 3TA9A 4QJ3B 4W7WA 1Q6EA 5C0QA 4WQ6A 3I10A 2QF8A 4KFNA 3LYEA 5IDIA 2XU2A 4UR8A 3G3DA 5FD0A 1U5VA 3WFLA 1KV5A 3TONA 2QJIA 4A2SA 3TTEA 2CKSA 3P67A 3B0UX 4Q7BA 4J28A 1XYCA 4H7VA 3CHVA 1HKJA 2J62A 4MFEA 1L6GA 1UQZA 3H55A 4E4UA 3NQCA 2XWEA 1W3JA 3MZNA 4IMCA 3KP0A 4XZWA 5EMMA 5ABTA 4B15A 3B40A 4OV9A 2Z7KA 4YTSA 4M81A 3WNKA 3FIGA 1TSIA 1X1NA 3R89A 3TN3A 1O12A 3C2VA 2IPFA 2XZ7A 2DU2A 3BW2A 1XYMA 1CLXA 1XD0A 3N2MA 4PL1A 1TE6A 1UD4A 2PMQA 1RBOB 1F73A 4X2RA 2ODOA 4AWTA 3URAA 1ODUA 2QJMA 1DJWA 3P7YA 2J7FA 3W7QA 3WFZA 2CLFA 4IPJA 2G97A 3RXZA 3POCA 2GK1A 3NEHA 2B7QA 2NT1A 2V63A 4NZCA 3TH6A 4L1WA 4CN1A 4XD6A 3VINA 4I90A 2ISVA 2REQB 2YDQA 3BW4A 4QG8A 2QMKA 4YWIA 4U3CA 1KLZA 1Q63A 2YSWA 3IVTA 2Y7DA 1F76A 2JIWA 3VCRA 1DIEA 3DKLA 4TU1A 1H50A 4AYSA 3EB2A 1M1BA 3MV01 3LCWA 5IM51 1EF2A 2ZUUA 3DIPA 3RG6A 2OFJA 3DFPA 3WBWA 1IXNA 4RV8A 1PIGA 4HMCA 1UPMB 1UWIA 3A47A 2YL9A 1IYXA 4RKAA 1XLFA 1UC4A 4TMCA 1XRVA 3ELFA 4AIBA 2OT0A 1FH7A 1NDYA 1XM3A 3UU0A 2WZEA 1PEZA 1JD9A 3SCTA 3PUEA 1ZL1A 1IEQA 1V6TA 5H2ZA 2I57A 3KHDA 5D4YA 1JR1A 4XZHA 3R25A 1ALDA 2OPJA 4K68A 4K38A 3TN5A 4F79A 3U6WA 4M6UA 4JICA 2G3JA 3GKAA 1ZZMA 3ZVHA 1LG1A 4JTSA 3B9EA 5D9MA 4O15A 4MZ1A 1WZLA 1T5AA 4M1RA 3MWAA 3WBYA 1Y0EA 1M68A 4EXBA 2D69A 3WL1A 3CQKA 2ACUA 4HU3A 4XO6A 3SSZA 8RUCA 4OBTA 4AD0A 2CLLA 4HHPA 4DXXA 2XISA 3GVVA 3VTRA 2JIEA 2X40A 3KRSA 2RJHA 1BFNA 4HK5A 4OOUA 1SJDA 1AUSL 1XR2A 4H2CA 4D6EA 1W9XA 1PKYA 2OT1A 3B03A 2PLMA 2RH9A 4H9XA 2G4JA 1XC4A 3FSUA 4FSAA 5AECA 4UXDA 1KFJA 1VPQA 5T91A 3DEQA 2AAMA 4OUEA 2X09A 3VNYA 2VMFA 3BMVA 2GSEA 5A94A 2VDIA 3WLNA 5AVNA 2EGZA 1TJ1A 3KRUA 4CNSA 3S9IA 2CBVA 1GNXA 3ONBA 4U28A 3NCOA 3VO0A 2J7CA 2ISSA 1GVYA 3AMCA 4NAFA 3C61A 5EBUA 4N4QA 3W24A 1LLWA 4D72A 4GZ7A 3URQA 1ISYA 4GISA 2VRJA 4BJHA 4B91A 4J3UA 2V67A 1JJKA 2HCVA 1KNWA 2Z0IA 1A5UA 1K4GA 3WQ4A 1AL7A 3IVUA 2E3ZA 1Q6RA 4POCA 3RU6A 1V3HA 3NQGA 2VTFA 3BO9A 2AAAA 1W1YA 3CQ0A 3UWVA 1EQCA 1QR7A 2A7PA 1L2UA 4GYKA 3E2SA 3RCNA 4DHGA 1US2A 4EX4A 4KEMA 4JOMA 1JYNA 3CV6A 3U2ZA 4LUTA 4B9YA 2Q8LA 4ZE4A 3SCVA 3PZGA 4GQRA 3PZUA 1A3HA 2NV9A 3A3XA 3IIOA 2YFOA 3UD6A 3M47A 4EWJA 1TPUA 2DSZA 1UKTA 4C65A 1HKVA 1P48A 2XSBA 4JL2A 4NZ5A 2PWFA 3ZWSA 1SR9A 3RN6A 4YHEA 3BXWA 4DJDD 1R3SA 4UR9A 2J24A 4AXNA 4P2VA 4Q4KA 1E0XA 1G4EA 4XISA 3U5YA 3L0NA 3MKCA 4L9ZA 3LPPA 4G1KA 3V7PA 3SBFA 3A9BA 2YLLA 3CASA 4K8GA 1CGYA 2XFFA 2B7PA 3UA4A 1V02E 2KZHA 2GVGA 4FZIA 1EDQA 2PDQA 3C2YA 4WXYA 2XH2A 4X0NA 2INFA 1JFHA 4GCXA 3VOIA 1LT8A 2FKPA 1VFLA 2WW5A 4WSHA 4MWAC 1TIWA 3NPXA 5K9DA 6REQA 1FVPA 4JTKA 3GDKA 4JD4A 1Z7AA 3G1VA 4IFKA 4D1IA 4NZ4A 5A8QA 2RDTA 1DWGM 3QHNA 3N73A 4CQCA 1FWHC 1OK4A 2DZSA 1X38A 1Y5XA 1WBJA 3B4UA 2CBUA 3IV8A 3EKZA 3EWDA 2XFYA 4ILSA 2OSYA 2VRKA 1AQHA 3BK0A 3HGOA 4R53A 4HZMA 4HOZA 3IAPA 1O60A 2NWSA 3KRZA 4OECA 4DWSA 3OA3A 1WDDA 5HMFA 3ARYA 1KLYA 4W8AA 2QIIA 1JXJA 4WY0F 4US5D 1KM4A 1AH3A 3BGJA 5DMYA 4FR6A 5C9WA 3UXAA 4E6MA 5DN1A 1JQXA 3GHSA 3KX6A 3BOLA 1ISZA 3C2FA 4PZVA 3OW1A 4XZLX 3ZOAA 4LCSA 4IP4A 3DUGA 1MQPA 1EL3A 5FSEC 1VIWA 3CIVA 1W9VA 4GXPA 4K6AA 3VKDA 4JL1A 5FF4A 2EPOA 2OMAA 1N2VA 2YDRA 5F2LA 2BWGA 1UR9A 1FFQA 2CW6A 4MJ2A 2J25A 4DUWA 4G7EB 1F5ZA 1QWGA 3B8VA 1SZEA 2I5QA 3N9KA 3W00A 3WQWA 4URIA 3GUWA 4NKCA 3IUHA 2FJUB 1FWDC 4O18A 1X97A 1MXGA 4JTHA 1KO0A 3M5XA 3WH9A 1UW9A 3BJSA 2A6NA 1BQGA 3DERA 3ZR4A 3KOZA 1U30A 4HPJA 3OZOA 3MUAA 4JFVA 7REQB 3AHXA 1Z8AA 3NQ6A 1XS2A 3K2GA 2OWXA 3GR7A 3IANA 3W2LA 3ZMRA 1SFJA 1JUKA 1DJQA 1R2TA 1LBFA 3GXNA 1R47A 1DJIA 4YL2A 2P1FA 3G22A 1QO5A 5D8WA 4KT2A 4IMGA 1H61A 2Y8VA 2E0PA 1DHKA 1X39A 4LBRA 4WIWA 3QLLA 1J11A 5JQ9A 3GXFA 2QUVA 4XBJA 2ICSA 2V5DA 3VILA 1C7SA 2IPJA 3LGGA 2RGLA 3U48A 3GIQA 3MVTA 3QEZA 4FOKA 4CNPA 3F4CA 2AL1A 1MYRA 3MI6A 1DIDA 3HA1A 3O6AA 3QKEA 5A6SA 4N6EA 1W56A 5H6HA 4LCRA 3BAWA 1QBAA 1POJA 4JIPA 5FL0A 2Z1BA 5HMSA 3A12A 3CAKA 3HG5A 1GVOA 4DAIA 4UMAA 1Z69A 3AICA 3PJTA 3RCYA 3TTOA 5J5RA 4GLEA 5G1MA 4AEOA 4QLJA 1KXVA 2QAFA 4IP5A 3OHIA 4UTMA 2BFGA 2ZXQA 1LUCB 4C6JA 2QDHA 3ECQA 1E55A 1GTEA 3KLLA 4GQQA 1J79A 2DW6A 4PN2A 5BCAA 3FFSA 3SRDA 1XYFA 1HN1A 4S3KA 4ZXOA 3OBKA 1H51A 3FJ4A 4XD4A 1A5CA 4PTVA 2BXVA 3EMCA 2ZYFA 4I8YA 4P8WA 2PP1A 4OZOA 5BROA 3A24A 4QHRA 4GJJA 2WSKA 3W07A 2ZBTA 1B3XA 2PI6A 4GO9A 2HXTA 5M1TA 4L56A 3K5XA 4AZBA 4D6CA 1GQKA 3URBA 4GUHA 1TFVA 4AX7A 3W1AA 1OGSA 2OGJA 4Q4OA 2EPMX 4DXKA 2DT3A 3RMEA 3H8AA 1J12A 3EYPA 1EBGA 2QCGA 3TDFA 1V8EA 3IJDA 2W9MA 4UOQA 4GKTA 1IT8A 1G7UA 3QMRA 1WDRA 3EAUA 2PD9A 2FZDA 2BVWA 2GZXA 1UMLA 2V69A 1TJ2A 1U5HA 1EJUC 2Q71A 4O12A 1GVQA 1W1PA 3AMDA 3MSRA 2X2YA 2Y6ZA 2NV1A 2E7FA 2PTDA 1GPFA 1OEPA 4ONVA 3HFYA 2ALRA 3W4RA 4LRTA 4MAVA 4JIQA 3GRIA 3BTNA 3TR2A 2W92A 2XUCA 4CNUA 2POTA 3LU2A 4GVGA 2L5HA 1B31A 2UZ9A 4H9VA 2V3DA 3PPHA 4HB7A 4PTMA 4MM1A 4LC6A 1OABA 1ZAHA 4IL2A 1RZMA 1X7IA 3HPSA 1NFBA 1YDNA 1S1PA 1EFZA 1PDZA 3VOJA 3G1FA 3PPFA 1V5XA 4LAOA 4IJCA 3S5NA 1AQMA 4K7YA 3U8GA 4MG4A 4RXGA 1VFTA 1VZWA 3W02A 5FEWA 2ZVIA 3VNJA 3HQ1A 2E6AA 2OX1A 3JS3A 4W84A 3PFRA 1LQAA 3Q45A 4AC1X 5T26A 4HNVA 2QV5A 8TIMA 3VGFA 5M03A 4F8XA 1Q6GA 2GOKA 5A6MA 1EP2A 3WLLA 1KR0A 1OK6A 5DY2A 3VIPA 4Y9MA 1V0NA 1IEVA 4YN5A 1H5YA 3QR0A 1O1ZA 2Y2WA 3OBEA 3ZLFA 1FH8A 5CBJA 2ATSA 1W2PA 5G4HC 5L9FA 4EXAA 4AD2A 4AD4A 3GR4A 5D30A 2ZDSA 3SUUA 4RJEA 3GWQA 2H8ZA 3L68A 2A85A 2Y0FA 4JAWA 1C8XA 3EOLA 3Q4DA 1OG6A 5KZ6A 4BS0A 1SFTA 1QI3A 4BZYA 5CQ1A 3KVMA 4TUFA 5G4EA 4L4PA 1XLEA 5A95A 5EY5A 4QAWA 1HJSA 2NQHA 4LEQA 3FCPA 4PTNA 4WR3A 3H2AA 4D6GA 1M53A 4QG9A 1KTNA 1XIFA 2HRWA 2VGBA 2Y85A 4MF4A 1ZJHA 2WVUA 1DXIA 5AHMA 2PDPA 1CGWA 1W5OA 1FWSA 4AFYA 3CGTA 3BOXA 3WG6A 1W5QA 4ERIA 2PCQA 4HMDA 1K77A 3PANA 3TLLA 3DU0A 3C52A 2WHLA 1XKJA 3PWGA 1SZRA 4DIAA 4DM2A 1EWEA 5FCZA 3ARRA 4PUMA 2ZZ1A 1LQ0A 1E9ZB 4U2YA 3A5VA 3JW7A 3U2EA 1TTJA 4ZXLA 3LHVA 3W7RA 3R0KA 1XXXA 4F2BA 1R3YA 5IFPA 4U10A 1XIIA 3OZPA 1GKQA 3GDMA 4Q6JA 1YTDA 2FH8A 2O7QA 3AWNA 4XQ6A 3AAMA 4WZHA 3PM6A 2WJFA 1JCXA 2VFHA 1W17A 3DFYA 4XB3A 5C9XA 1RBAA 4C6FA 5G1TA 3SO7A 4WSJA 4JTQA 5KETA 4F9DA 3QM3A 4GQ0A 3U7BA 1TREA 1AW1A 2GJLA 1G7VA 1EIXA 5FAJA 4EWND 3P8IA 2BMBA 4GMEA 3IIPA 5DEZA 3D46A 1BKHA 3UWYA 2FPTA 3T9PA 1AJZA 3QV7A 3KBMA 3LPFA 5DRIA 2PLKA 3FYOA 3S2NA 3OPSA 2VWTA 4GABA 1NF7A 1FDYA 2DVTA 4ZCWA 3RM8A 3UT0A 2BLEA 3M43A 3L9CA 2XH0A 2CXGA 3SCNA 3RU8X 1I2NA 1ZAIA 3NDOA 3ITGA 1A5SA 4B4HA 1XWYA 5A1AA 5ABFB 1L6YA 1WUFA 3ZT5A 2VELA 3KCJA 4BHYA 4LAMA 4DPPA 1MUCA 5REQA 3OLEA 1SFLA 3WF0A 1PZ2A 3BLOA 5EMUA 1EJWC 1ITQA 1D8WA 2OODA 3OB8A 3Q58A 3CNYA 3W84A 3UZ5A 4DWDA 4JYDA 4DWSD 1A50A 3W1PA 1TPC1 2HE8A 3U4AA 1UWQA 2FDSA 3GG1A 1PYMA 4CQAA 3UWUA 3GC5A 3S6DA 4JXCA 3LERA 4KBXA 3QR3A 4F2UA 1HW6A 3ABZA 2BB0A 3NQ2A 5DXXA 3ITLA 4X9YA 1Y5VA 3TZNA 3W72A 4UUIA 5C7VA 3PJWA 2BG5A 2DY3A 2YBVA 3SY8A 3F7JA 1BVWA 3M0JA 1AH4A 1JF5A 3MMWA 1H7NA 2C14A 1OC7A 2ZICA 3ABQA 3QF0A 3WL0A 3NM3A 3IWPA 2ZIDA 4ML9A 3G1SA 2G50A 3TW9A 5EKYA 2ZTJA 4AVNA 5BWAA 4NY2A 2BXZA 2X41A 3TLQA 2OKTA 3GD6A 3HG2A 1F4AA 3MMDA 4WKHA 2XG9A 3VIOA 1XLMA 3CV2A 3W2MA 4MJMA 3W38A 1W9PA 1A5KC 4XZMX 1JEZA 1B3ZA 3WNMA 2E8ZA 5DELA 3PF3A 3PTQA 5DXYA 1V08A 3DXIA 4ENLA 5FJRA 4XIMA 1OGGA 2YFNA 4L7ZA 3VIGA 1XCFA 1KR1A 3BGGA 2EPLX 3N3TA 3MCOA 4I6VA 1MXDA 3B97A 4R7WA 1SUXA 1BRLB 3CTTA 5K4XA 4KGLA 3SGUA 4TR9A 3R7MA 1W6TA 4ICNA 1PX4A 2ESCA 2VFDA 4HP5A 1IEIA 3LGDA 3IJ7A 3LENA 3N19B 3G1AA 1VBRA 4W5ZA 1L8NA 1SO4A 2QUNA 3THDA 3VUPA 5LNVA 1VYRA 1PHWA 2Q6ZA 5KSWA 4R88A 4PB5A 1B54A 4AEFA 2OB3A 2ZCGA 3M9YA 1HKMA 5I07A 2E9BA 3A9IA 1E56A 3G6MA 2ZVRA 3VGGA 3Q37A 3QN3A 3WNPA 5CPQA 3TJLA 3BW3A 3AOFA 3VZYA 4GI9A 4EF9A 1V0MA 3MDWA 3MC5A 4KEVA 4MSSA 4XZIA 5AKQA 3WDHA 3A4XA 1DQXA 3QQ0A 4AY7A 3CMFA 1QFEA 1GHRA 1GOOA 3EX2A 2XN0A 4WJXA 4QTGA 2OSXA 4YU1A 4HYVA 4JN7A 2OQLA 3G1HA 2TAAA 3S1UA 3CO8A 8XIAA 1WZMA 1UP2A 1RP8A 3A4JA 4O8RA 3NEVA 1JGMA 2Y89A 3JR2A 2ADAA 1XIEA 1PL9A 2DQXA 1NH6A 3QPYA 3HU7A 4GX8A 4Q8WA 3OQEA 3WMSA 1OIMA 1AQFA 1OCJA 4IIEA 3KRBA 2NXIA 1Z48A 3T05A 3NQMA 1KM2A 1WDSA 3A3WA 3UYIA 4IM4A 3HURA 4JFUA 4GCAA 4FR1A 3UCDA 2CBIA 3NSXA 3EX6A 1RK6A 3AALA 2A3EA 4HMEA 1ZBKA 3BJTA 3EWUA 1FQ0A 6XIMA 4H01A 5F2MA 3SW6A 3MKKA 3ZJ8A 4K3ZA 1DWHM 3ARWA 4NHVA 1EC7A 4QS5A 2IKHA 3QY6A 4ADUA 1KBJA 4FPSA 1FCVA 4Z0SA 1D9EA 3C0LA 5HQLA 1UZ1A 1MRQA 4IQDA 1XINA 3CHCA 3OTRA 1IV8A 2HNHA 5DX7A 3QHOA 4H8HA 1VH7A 1BAGA 4DI9A 1IE7C 3PAOA 1EBHA 1W8SA 1VFUA 1S3HA 3H26A 3SADA 2WC3A 2P8CA 4E3VA 2XIBA 3QSRA 1DORA 3N2TA 5D2TA 2P3EA 2O55A 4S3CA 1CPUA 4U5IA 4ZOEA 3T4WA 2AOSA 2VI0A 1CLVA 3EMQA 3C5QA 3ICJA 2PRMA 2ZUNA 5CPMA 2XJ7A 1I9CB 3GIYA 5AC6A 5HBFA 4KWWA 4C5ZA 4Z1CA 3TU9A 3L12A 3B8UA 4E2BA 3BC9A 1F3WA 1OFRA 2QPXA 2EEXA 1S38A 3GW0A 4A2RA 3CPGA 4AZCB 1W1VA 3DYMA 2FHCA 3MB9A 2F6XA 3V35A 3GU2A 1XBVA 4NYUA 3E0VA 4ZEPA 3BZJA 3W87A 4PMUA 3TYDA 3W86A 4WY0B 6TAAA 4W4QA 2REQA 4B5WA 4MYAA 5CH9A 5E09A 1KRBC 3APTA 6A3HA 1YDVA 4WKFA 4OIFA 3CAQA 3RX2A 5EBAA 3GC2A 1FCBA 4GIRA 4A3RA 2A3BA 3R8GA 2DFAA 3ZT6A 2JF7A 1KA9F 5LKYA 5DFAA 4PSPA 3VAVA 5BMWA 4N02A 3TROA 1FDZA 1K6AA 2CU0A 1J96A 2PF0A 3O07A 1V02A 4L4OA 4L4LA 2QPSA 4B90A 2VR4A 3E3HA 3CZEA 3E5PA 3E0WA 1HKIA 3AXHA 1ONWA 4UFHA 4D1JA 1X1OA 3MSYA 4WOQA 4HVXA 1MEIA 2OYMA 1V6YA 5A8MA 2V2HA 4PUDA 1R3WA 2QF7A 3QC3A 4RR4A 1HJWA 2NV2A 3WF2A 3CZJA 1GCYA 3G0SA 3W88A 3OVPA 4PCFA 2Z1SA 1E1FA 1XJBA 1A4MA 3W27A 4JS3A 2F61A 3M6YA 3GG8A 2G4FA 5FJIA 1G1YA 4Z1YA 2WBKA 3HN3A 3N9RA 4KMQA 1QO2A 1XLIA 1MDLA 1CWYA 1E6ZA 4BQ4A 3PP7A 1J0HA 3W74A 2VEMA 4ML4A 1LOQA 4WDUA 1SM9A 4LSBA 3W7IA 3FJLA 3QZ6A 1EPVA 3IRSA 3PR2A 3WJXA 3KUMA 3RHGA 4PTWA 3TE9A 3KL5A 3O63A 2WVSA 2BY1A 1KGWA 2G8ZA 2A1YA 1ZGDA 3N4EA 4Q6XA 5K4ZA 1XG3A 3DGRA 5FF0A 2W79A 3SIMA 1NELA 5A5WA 3L66A 1Q2RA 1CB2A 3KZPA 1M01A 3W01A 3EKLA 4AISA 2FB3A 5LA0A 5IRPA 2DUAA 5A6AA 1XLLA 4ZGYA 4H7ZA 3AWOA 4LH8A 2WO5A 1XDJA 1RAKA 3GXMA 4RV3A 5M3WA 4S38A 3UP8A 1QRQA 2O9PA 4XAYA 5I24A 3S47A 1BYAA 4X3ZA 3WLPA 5LNUA 4Z1BA 2VM8A 2DUXA 3FJNA 3V1PA 1QT1A 3T0CA 4DJDC 4K1WA 2DH3A 1VB9A 2B31A 4QAIA 1E72M 4GNJA 4S3EA 3I6RA 3GTFA 1QATA 1NM9A 4UTWA 2BGNE 3MA8A 1GYLA 1I0DA 1YE4A 3W75A 3MCNA 4N9DA 4ZOCA 4YIWA 3TOYA 5IBXA 2X1UA 4Q8VA 2A0NA 3WQ5A 4C6MA 4JEJA 3VD4A 5E0KA 1A0CA 4GIAA 2D0GA 4GA8A 1X6NA 1J8VA 4UIOA 1KWGA 3THAA 3QTGA 1JI2A 1ZS2A 2PTWA 4F0SA 1N8IA 4IQJA 3UZJA 4ADSA 1VS1A 4HU4A 2GQ9A 3LBCA 4KCWA 1Q45A 1R30A 3OP2A 3RRAA 2PGRA 2MUCA 2VX4A 1TR1A 3HJEA 4IICA 3TCEA 4PMOA 1J93A 3SAZA 5FAGA 1R86A 3M7SA 2WK2A 2VCBA 1P4CA 4GFIA 4FALA 1K8ZA 3APYA 2Z25A 1GYMA 1V6XA 4JTTA 3REQB 5CPSA 4HN4A 4NAEB 4PMVA 4O0ZA 3KBWA 3Q67A 1KC7A 2Y62A 4PFMA 2HK1A 2ZX5A 3CYVA 2XN1A 5HINA 3B0PA 3FX4A 1B3OA 3BAKA 1H63A 1E6NA 1WDPA 4E38A 1AQ0A 1E9LA 4ZTYA 3VKJA 5GNXA 3TSDA 5ABEA 2ZUSA 3TNOA 1UZDA 2OEMA 2QDEA 1YPIA 1FY6A 3VMOA 3RMJA 3P5YA 1MQQA 2PDCA 4IIDA 3B8TA 3GKFA 1WPCA 4HJWA 1R85A 4I9MA 5D02A 3S1XA 1WZAA 2TPSA 4QSFA 3E96A 1VC4A 2ZA3A 3CWOX 4FI4A 1JYVA 3SCSA 3C2OA 2GQ8A 3DFHA 3MCMA 6PTDA 1OT1A 2ZX9A 4F66A 1LF1A 1RQBA 4C6BA 1D3GA 3ALFA 2G3MA 3C4UA 3VYLA 3SN1A 3HGSA 2UY2A 2YW3A 3AZTA 2ABBA 4FAMA 3RDKA 4EF8A 1TRIA 4PODA 1ZP4A 1EJ7L 2WLZA 1EPXA 5A8GA 4DVOA 1QW7A 4H41A 1EH9A 5EMYA 2C71A 2WCSA 4QDMA 2H9AB 4YYCA 1O5XA 1P1MA 1GW9A 2HWGA 4AAJA 5AC7A 5ABHA 3IIXA 3VD7A 1T6MA 5E0CA 4FLRA 1NWSA 3TSBA 1U1UA 4BA0A 1FHVA 3WD0A 4BQ5A 3ZT7A 1E9YB 4PCTA 3V5FA 5C9RA 4Z2HA 4NASA 4ALDA 5LA1A 2J74A 2PGEA 3M4HA 4P8UA 1W3LA 5HOSA 1UKPA 1KQYA 1EJSC 3KVKA 4NZ1A 3UA3A 3WQ6A 3NNTA 1QI2A 3WF4A 2C1HA 1Z89A 1XX1A 4GPNA 3QY7A 4G7EA 2GQAA 1GOWA 4TMBA 2TSYA 4C6LA 4F0KA 1PBGA 1VPYA 3IVSA 1XUUA 2HBXA 1FUYA 1EGVA 4QLLA 1NU5A 3QY8A 1Q8JA 1H3GA 4IMFA 1GT8A 3OGSA 3O06A 3QPEA 1PDYA 1IWBA 3H6OA 4HSNA 7REQA 1LJYA 1TMHA 2ABAA 4JQ1A 2INZA 4ZTXA 2Z24A 4CU8A 4AHOA 4IHCA 1PKNA 5A6BA 4H7CA 2A3AA 4LPCA 4KRTA 4XV0A 1UH3A 3LM7A 1HJUA 1L8PA 1JULA 3N04A 1SO5A 5CG7A 5GVJA 1UWUA 4MPQA 1IIHA 3UWEA 1IWAA 1S5MA 1RCQA 5CAHA 4BEQA 2WC7A 4DELA 1E3XA 2R6OA 4AD3A 1V3KA 1BVZA 3FVDA 2WSYA 4EK7A 1P43A 4Q4MA 1XL9A 3LHTA 4AZGA 1E71M 3IS4A 3FV9A 3WLRA 4IJRA 3G6LA 3AJXA 1XIHA 3NO5A 3UPWA 3C8NA 4PFHA 1T8XA 3SB0A 4H3DA 1WO2A 4RW3A 4PTDA 3ITVA 4KEZA 1S3TC 1JCTA 1XW8A 2VFIA 2JGYA 4O52A 1QI5A 2VUYA 4CCEA 4ATLA 1RSCA 1LDCA 4CU7A 4XO7A 2OGYA 2QXWA 4D2JA 4D6DA 3E2RA 4PCSA 1HL9A 2C15A 3O2LA 1DV7A 1TVLA 5A3HA 1MWOA 3NR0A 3WLTA 2J6XA 1XICA 4HNNA 3MANA 4WLCA 3MSDA 1C8QA 4M7TA 3VUSA 1LUCA 4ZENA 3LCXA 4UFIA 5GJPA 4C6NA 1ONXA 2HQAA 4M5PA 1K8CA 2J75A 1YYAA 4O50A 2HS8A 2OQHA 2BX7A 3TFCA 5EU9A 2DH2A 2VVSA 1ZTVA 4JGDA 2XM1A 1JFXA 4KS0A 3PBVA 4JN8A 5AYYA 2X7VA 3GU1A 1CX9A 5MKGA 2PSNA 3DESA 2CZDA 2DSKA 4KWVA 4UMCA 3BCFA 2ISWA 4HU0A 2INEA 3RCMA 4GI6A 3ME3A 1XIDA 3UY8A 1TX2A 1ML1A 4DI8A 3OYZA 4CQ8A 1U1HA 2E25A 3RF9A 4BK9A 3SR7A 4V28A 3E2VA 3N4AA 3EDFA 4IPLA 2XFRA 1OC5A 1ONEA 2EO7A 4PRTA 1QXLA 4E2DA 4AIUA 3E1F1 1GOQA 4PSRA 1QK0A 3ITCA 1T8QA 5HWMA 2DSVA 4MTVA 2XIQA 2PUZA 4FX8A 5A2CA 4DO5A 4A3YA 1PX8A 3FNDA 3KDOA 4J9JA 3HOJA 3DHDA 3N2BA 1SMDA 3FLUA 4LV4A 1CTNA 1Q7QA 3UR8A 3F4WA 1GUVA 1OWQA 4FXRA 5HMEA 3WMBA 2NVAA 5J5DA 1K6WA 1XQLA 1OC6A 5FOOA 5KZMA 4FLOA 1MI3A 4LYRA 4V15A 3UG8A 1B3VA 3HZ3A 4S3AA 3ABSA 3K46A 3RFAA 4JBRA 1W2VA 2G5WA 1VRXA 4OUIA 1B3YA 3PZMA 1LOLA 3F5LA 1J5SA 3T42A 2QLYA 1D2KA 2WCGA 1W3IA 2FVMA 1SGJA 3M5VA 4HYWA 3VKKA 1OZMA 2DPEA 3CU2A 2V2CA 5C71A 1YBQB 3TNBA 1PWMA 3W1MA 1FWBC 4XD5A 3SGZA 3AS3A 4PMNA 5BXPA 3O6YX 4QE1A 1WQ5A 2D2JA 3M07A 3H7UA 1OADA 3KZSA 3DGBA 1WOAA 2VEFA 4GVFA 2PF8A 5EGRA 4H6EA 3ABXA 3RLUA 1TE1A 4EAYA 4EPKA 1U5JA 5CJMA 1GOKA 2W4XA 3BAJA 4DM1A 2YCIX 4HA1A 3VM7A 2C91A 2E28A 3GO2A 3OZYA 4MB1A 1F9CA 4IPIA 4DJFA 4DO6A 4XWUA 1FWAC 3TAKA 1AG1O 2ALDA 2PDFA 2VHLA 4ZSTA 3S5SA 3WQOA 1ICSA 4GI4A 1K7FA 1S5NA 1E6XM 1YLVA 3L2IA 5CXPA 1BTCA 4MKSA 2R94A 5EFDA 1RVGA 4HA3A 4PGLA 3FA4A 1Q5MA 2NZLA 1V79A 4NNBA 2YL5A 4BWLA 4FNSA 2Y70A 1ZY9A 4GJIA 3TMQA 4MGGA 3MP4A 2VO5A 2WXDM 5DLCA 4PULA 2PC4A 4GACA 4LV9A 4P7RA 1GEQA 1TQJA 1TV7A 4W85A 3BCDA 3LBMA 4PBFA 3VK5A 3TJXA 1P6CA 3TV8A 2Y4SA 4CKQA 3N12A 4FX6M 1H7RA 2ZTKA 2F7FA 3CM4A 5HK4A 3UWQA 2PCEA 2X1RA 5GJMA 4IIGA 4MLJA 1BSLA 1FKWA 5EL1A 3CV1A 3DFTA 1LRTA 2BY2A 4D8AA 1OSEA 2G0WA 1IT7A 1LYXA 1R5YA 3NVDA 3KP1A 2WWCA 3BQ5A 5KINA 4QISA 2E5DA 1N7KA 2VZOA 1ME8A 4BR1A 1IGWA 1AZ1A 3GB6A 3THUA 3T2OA 2GVLA 1WB0A 1FP9A 2UY5A 1JAKA 2TRSA 3MP5A 1EC9A 2VC5A 3I6TA 5C2GA 4ZE5A 3VIIA 1QK2A 2I14A 3ARXA 1A49A 1XRFA 3ZS4A 1V0LA 1M7PA 1FRBA 4GZEA 3GU9A 4L6OA 4FOUA 2AQVA 4O1CA 3G18A 3V0UA 1BEUA 2ZZ7A 4C5YA 5BU6A 3T0BA 4HK7A 4UTTC 5HUPA 4CQ9A 1PJ9A 3PBGA 3SZ8A 1Q7ZA 1REQB 2WVTA 4XUGA 1CXKA 2EJ1A 1Q6CA 1MFVA 1K3UA 2QQ6A 5ABFA 3VE9A 1JI1A 4Z1DA 3CMJA 3BARA 4RXFA 1BG4A 4DX3A 3NOEA 2Z1VA 1L2QA 1YADA 4YWSA 3QV6A 1EJXC 1TWSA 4YCOA 4ZQRA 4X63A 1I1XA 2YXXA 4V1XA 3JUGA 3NQEA 6ENLA 3PULA 4O16A 3VX1A 3EX1A 5BXTA 4G9PA 4J3WA 3GK0A 5DMMA 3R4IA 4OFCA 4WF7A 2HDJA 1CXFA 3GXIA 3RLVA 3WKZA 1AD1A 1C93A 2XIIA 2Z26A 4S1FA 3V16A 1B0IA 1NEYA 4JNMA 4AY8A 4LUIA 1LROA 4Z1AA 1O94A 3NDZA 1HJQA 3KTXA 2ISDA 2YCKX 4GIYA 2OCZA 5CSYA 4GY0A 3GVRA 3EBVA 4GQBA 3BV4A 3I4KA 1DWFM 1WKEA 2RGMA 3ARQA 4FOJA 1E0TA 3KE0A 4ADTA 3W83A 1RA5A 4F0RA 5AVHA 3PBWA 3SFKA 3L5AA 9CGTA 1K9DA 1UOZA 3B0YA 4JTEA 4LXFA 4FXSA 1PCWA 3DFSA 3S1GA 3AXXA 1Z6KA 3N6JA 1YTEA 2CLHA 1HIZA 1JDEA 3AJ7A 3LNMA 5KITA 3NGFA 1M04A 3SRKA 3L4ZA 3BLPX 1G6CA 2X7WA 1GQNA 1JDFA 5A6BD 4RE3A 3QTPA 3OVGA 4IT1A 1GQIA 3ZFHA 1XGEA 3QV8A 3OIHA 2WNQA 3OZMA 3CLMA 5DBUA 1IXPA 2PEVA 3H2CA 2X8RA 2C1GA 1V93A 5HQMA 3WDIA 3TXVA 4MUZA 3BCJA 1MUWA 4QJ5B 5C5YA 1OGBA 3LV6A 2PA6A 3UG5A 4H2HA 5F4SA 1OHLA 3RRXA 1BRLA 4M82A 3E6EA 3P81A 3LTSA 5G2WA 1V3MA 3BLFA 2Y5JA 2EAWA 1C91A 3AXKA 1DWAM 5A8OA 3EA3A 4MJZA 1F07A 3TKFA 1DJGA 1O66A 4LVAA 1VIZA 4ZO7A 3NPUA 1OFQA 5DCEA 3LEPA 1PHQA 2D3LA 2BGQA 5BOEA 3QW4B 3N2XA 1B5TA 2GWGA 3P0WA 1MVYA 3LV5A 1QPOA 2AL2B 4I7WA 3E49A 4P7NA 4N9EA 3FXGA 3AIUA 1R6WA 1VBJA 4LT9A 3UR5A 3THCA 2WMGA 4AWEA 3CUJA 4IJBA 4MNLA 1J4EA 3TC7A 3TSMA 1UZHA 1VFHA 3PAJA 2EJAA 3L4TA 1DL3A 5GJNA 1JL8A 3T81A 5PTDA 2PWEA 3KVLA 4JTJA 2Y8KA 2IKIA 1UMYA 2VR5A 3E9AA 2V82A 5CZ0A 3WUFA 1R46A 3UPMA 2NQLA 4RNFA 3QR1A 2F9RA 3WBAA 2FZMA 3T09A 1W1TA 5CJ5A 3DHFA 1B57A 4FS9A 1IEXA 4U5KA 3W7HA 2NT0A 3EWZA 3P74A 2R1MA 1WXJA 3WNOA 1EYEA 1JZ5A 4KF1A 3V5OA 4KH2A 3L4WA 4HOWA 2D1ZA 5G2HA 2QJNA 4FEZA 4WEVX 2ZUTA 5AHFA 1RK5A 2IS7A 1DIOA 2VNCA 1MSSA 3I7RA 5DT7A 2OYKA 4ACYA 2QKFA 3LNPA 3KOYA 4HNTA 2CZVA 4UQDA 2GWNA 2V9DA 5E9AA 1LOSA 2OEJA 3LXAA 3SURA 5C9ZA 4IG2B 4P7QA 1TQXA 2CHOA 5B7ZA 2O92A 3CS2A 1EHAA 4M3PA 1OIFA 4D8ZA 4R7JA 4UTIA 2NVCA 4GK8A 3WUGA 3WDRA 2R1PA 3NL2A 2WVVB 4S3DA 1TMQA 3ID7A 4B3KA 5IHRA 1JUBA 3HGRA 1LP6A 5AC8A 3KS6A 4J1OA 3MYOA 4AZ5A 1HTIA 3UETA 1QNVA 1OX4B 2ZOXA 3TJIA 2RAGA 4AEEA 3TW7A 4AZIA 4XBSA 3UXKA 3WH7A 3DAQA 5KMYA 4AMCA 2ISFA 1YXCA 4WGXA 1EP3A 4GXMA 3OBAA 1KKOA 5LNWA 1FWRA 3BZGA 2RDXA 2DT0A 4OWGA 3EMZA 2OXNA 4E3TA 2OX4A 5DCBA 1C8VA 2BBFA 2PDUA 4JQ3A 3TN4A 3AIBA 3WBEA 3GXTA 1EJRC 4AZCA 2BHUA 2BASA 3PBYA 3RGTA 3WH6A 4ORIA 3EX3A 5F4WA 2IXUA 2D20A 2VWSA 5BXSA 4ZQOA 3AC0A 3VOCA 2Z27A 3WLKX 4WY0A 3DFQA 3BAXA 1HX0A 2WAGA 4DJFD 5F2IA 4HOXA 4O11A 4W89A 3PJXA 2E5CA 1CI1A 1K1DA 1SMAA 2X30A 1BVNP 2J6VA 4JY9A 3DYOA 4O54A 2RUSA 1OFDA 1SW3A 3NA8A 3ZLHA 4WXZA 2G37A 1B90A 3NYZA 1VCFA 1XSIA 3EOSA 5LYRA 1H4PA 4J27A 3UGVA 4LAKA 2VC7A 1UA7A 3H23A 1W31A 1DQWA 3DI0A 1EDTA 1O68A 3LLFA 4HKPA 5I09A 4QXIA 4G2DA 3U57A 3MUIA 1HO1A 1PTDA 4B5XA 4HN8A 4BFAA 5AYXA 1KFCA 5D37A 4CQBA 2E4TA 3ARSA 3NQFA 4MDOA 2ZC1A 2PZNA 1IWPA 3JZUA 5A2AA 3PY2A 4N2YA 2HXUA 1CEOA 1Q65A 4O1DA 1AW5A 3GX9A 2IKGA 2PDWA 4PRWA 5LNRA 3W22A 3AIEA 1KBBA 3V5CA 5DANA 4MADA 2CXEA 5EA9A 3O0KA 2AKMA 2I5IA 2FPYA 1I0BA 4ZO9A 3AHVA 4AZHA 3RPDA 1XYBA 3F03K 2QJGA 4LOCA 2VFFA 2X16A 3B8IA 4Z2JA 2C13A 1E5JA 1MNZA 2FFIA 2X1SA 4MAZA 3EGJA 2C79A 3ABOA 2HBVA 1V6UA 3G77A 1PVNA 1JZ4A 1UZ4A 3EWYA 4CD5A 1E6PA 3J7HA 4XIAA 3GDTA 4H9UA 1LWJA 3G0UA 3EWCA 3L7RA 3MHUA 4WGHA 4XVEA 4JQ2A 3ZSTA 3QHMA 4J2PA 4TOQA 2WYSA 4JIRA 5CEWA 2DZBA 2ZX7A 2ZFAA 4O4WA 4WJEA 3TOPA 1GTHA 1EGMA 3VPLA 2QV4A 1MW0A 2DIKA 1P7TB 4LVDA 3RO6A 2FFCA 3WQ8A 4IUGA 1CT5A 3ZIZA 5M5DA 2A7NA 2OLHA 1KCKA 4HCLA 2FJKA 5DF0A 2OLAA 5E5CA 5C2XA 3M0VA 4KIRA 1YQ2A 1M7OA 1RA0A 4J4KA 4W7VA 2Z2BA 3POHA 2OSWA 1OX5A 1EQPA 1CB7B 5AB3A 4XAFA 4YS1A 3WLQA 1TKKA 2EKGA 3WK0A 1UUQA 5LSMA 4PMRA 1VKFA 2VYOA 1OG0A 4QDWA 4LF1A 5HDRA 1H1NA 3MDUA 3TZFA 3CO4A 3MMTA 2BSLA 3A4AA 1IHIA 1SPQA 4O1EA 2G3NA 4Q7IA 2Z2AA 1TTQA 3KBVA 4Q4SA 2YOCA 5I23A 3JU2A 3ZSSA 1EUAA 1E70M 2Y24A 1M65A 1TVPA 3AHTA 3CUGA 3DECA 4H9YA 3STEA 5EMKA 3O16A 4UOZA 1YNYA 1Z3NA 3UFYA 4BF5A 2G41A 3VNMA 3PC0A 1IZKA 2QNEA 4YNGA 1LBMA 2OWWA 3AYSA 1GJWA 4Z2LA 5A6TC 2J79A 2PDGA 1MMFA 4KERA 3T08A 3PTMA 3P0XA 1M03A 4E4PA 3REQA 5LIKX 3CHDA 4ZB0A 4NAEA 3DH7A 3QSTA 1F8MA 1HP4A 4S3GA 5EMJA 1B1YA 2QW5A 1DE6A 1FHUA 2EHHA 3F5JA 2Y1HA 4IP7A 1J2BA 3PUGA 3F2CA 1B4KA 1RQHA 3CEPA 4F40A 3E0LA 2W66A 4HJFA 1XDMA 2J27A 5JUVA 4HZ7A 3S2JA 2XM2A 1ISXA 5GNZA 3PHAA 1H11A 3FOKA 1FCQA 2X0YA 1HJXA 1KCLA 2PFHA 2XN2A 4NZFA 1PAMA 2G95A 5F7UA 1A0DA 5FEPA 2PLJA 3V36A 3H22A 3LTPA 3S2CA 3NUKA 4EVZA 2JKEA 1XFCA 5FI8A 3HMJG 1UROA 4YVPA 3N11A 3L21A 3S3GA 1IR2A 4RX0A 3SCPA 4Z08A 3F2DA 5CC5A 1FTXA 2J7BA 4KPLA 2W61A 2A79A 4ZA0A 3MS8A 1KWKA 4IOTA 4LTSA 2QCLA 4PB3A 4EPBC 3A4WA 3V0SA 5AYBA 3ZZ1A 5E1QA 1MW3A 1JDDA 1UR1A 2H9AA 3UF9A 3SM0A 4DLMA 1E6SM 4MOZA 1UR8A 3EB4A 5CLTA 4H8NA 3BLEA 2Q8XA 1SR0A 1VJZA 1M9HA 3UNTA 2IQDA 3TK7A 1RH9A 3EPNA 2IQ0A 4GFSA 3O6DA 5E70A 3NSMA 1RCOB 1W1A1 1E1CB 3B9NA 3G1RA 3VX0A 1K7XA 3R0DA 4XZNX 1QPKA 3U4FA 3H53A 2H6RA 5K9CA 3FJ6A 2ZRVA 3PB2A 2OEKA 5AHLA 2RDUA 1E40A 2Y7EA 4JTUA 4MPKA 4CD6A 1EXBA 5H8PA 3K8LA 1WYIA 4E8DA 4YTRA 4JKKA 4O0KA 1OYBA 2PGFA 2Z6IA 1QJWA 1L6SA 1E4NA 3HG4A 3RR1A 3CJPA 5HUOA 2R1NA 4UTHA 1ZALA 3SCRA 4CD7A 2P53A 2FYMA 4MHBA 4NQ1A 4C7FA 4HNCA 5MF5A 1OY0A 1KFBA 4MUPA 3DBPA 3N6QA 4OV4A 2CLOA 1JQVA 1XYAA 4K36A 2PTXA 4FIRA 1O5RA 3WX7A 1QHOA 2EKCA 1OT2A 4UNIA 2ZE3A 2V81A 2CZFA 2V30A 4A8NA 2Z1KA 3LI0A 5I6SA 3GVGA 1UG6A 1XGZA 1HJVA 4Y9NA 3STCA 1TPWA 3FA3A 4QNEA 1W9UA 1UCWA 3GNPA 1KCZA 1WV2A 2YYTA 3FAXA 2VCCA 1UR0A 2ZRUA 1OZQA 4GQGA 3I6EA 3AS2A 1I1WA 2MNRA 4S2BA 1TWZA 5E9XA 4M6QA 3UXLA 5BOOA 2IPWA 4BF7A 3V1HA 4UTKA 3W2JA 4E4FA 3SRHA 4A3UA 4PTXA 1ADOA 2C1IA 4PUEA 2E40A 2VQUA 4B4FA 4QRNA 2LLEA 2WKLA 3G1DA 2YX0A 3DI1A 4PMXA 1OJXA 3MHFA 4OKDA 3OIXA 3R6IA 3M5YA 3VOGA 4CEUC 1MW1A 1NQKA 4GY1A 5CBIA 4IMEA 2AGKA 4OBRA 3P62A 3KVJA 1QNQA 5LZLA 4LFYA 1Q6FA 5LXXA 1A5LC 4DZAA 2OU4A 4O1BA 3ARVA 4Y9AA 5A2BA 2XVNA 1FXPA 2VDHA 2ATMA 1SFSA 1Q6DA 4MIMA 3HIJA 3V0TA 5FL1A 1AFSA 3W73A 3VABA 2ZUMA 2NX1A 4AIEA 1CZ1A 4EANA 3N4FA 9RUBA 3EWBX 3ARTA 3Q94A 4UTLA 2ZRXA 3KEHA 4X0VA 1WXYA 2ACRA 1H60A 4H9ZA 3FGCB 4G7FA 1UWTA 1YNQA 3EXSA 1R9YA 2I7GA 1YMYA 1SZFA 1UA3A 1I75A 4W5UA 3RM4A 1XYZA 3QRHA 2E1WA 5HANA 3HPZA 4MY1A 3VNDA 2A5HA 5AHEA 1S2UA 3SECA 2JKAA 5C2CA 4B2DA 4FK9A 1BHGA 1TIMA 4Q22A 4J2MA 4UQAA 3ANUA 3INPA 1AJ0A 3KS5A 1B2YA 4CCCA 3NPVA 3IARA 4H6RA 3UJEA 2R24A 1VD6A 1D3HA 2BVYA 3MV11 3L5LA 3S5YA 4JCMA 2WMHA 3TYAA 1PO9A 4OGZA 4ZL1A 1ZU8A 1XIMA 5I3KA 1E51A 3FS2A 1G9HA 1G4PA 1MEWA 4K7VA 1KBKA 1UIPA 1CGUA 1YBQA 1FH9A 4JNZA 3WY1A 3O0FA 4E8CA 5XINA 5I78A 4Q8QA 2BHYA 5LNSA 3H2OA 5EPDA 3SN4A 1M7JA 3W1UA 4ERAA 4NP7A 3AI0A 2FQIA 2D22A 3SI9A 3MMUA 4OJYA 1EGZA 3D47A 3DCPA 3AIQA 4FF7A 2QUMA 3OGRA 3A21A 3VIFA 5M17A 1TWIA 2Q02A 1X7FA 1Q13A 3E02A 3ZVIA 4TTGA 2V5LA 3N2OA 4MNKA 1H0IA 3EA2A 4G56A 4C91A 3WLSA 2GSHA 3GBDA 4C6DA 3SUTA 3ITOA 3W6YA 2ANUA 4FLQA 3LCFA 3MUCA 3OGVA 3KCOA 1O6IA 1JDCA 5LA2A 3W25A 2XVGA 4O13A 3TUUA 1GOIA 1UD3A 4P61A 4JDYA 1CXEA 2J13A 4UQ9A 4GYPC 5EYWA 4K2SA 4UFMA 4A35A 3R13A 2WZHA 3LCGA 4WUIA 2NX9A 3LD5A 4LYQA 3BMWA 1QU4A 3SGGA 2BGSA 3USBA 4B9ZA 3GUGA 3STPA 3VMPA 1BGAA 1BF2A 3UJ2A 2CZEA 1C9DA 2FVLA 2VFEA 3B06A 2QCDB 2YB1A 1JNEA 1T0OA 3IPWA 4H1ZA 1QI4A 4GI8A 3LCIA 3W85A 5K7JA 2CZ5A 3VNIA 1OCQA 4A8LA 1B9BA 1G69A 1R2RA 3S0CA 3C2EA 1X8FA 5LGXA 3HPFA 3II1A 4LVFA 4A05A 1EKOA 3UG3A 1XLCA 2Y7FA 3M16A 1C92A 3PS7A 4LY8A 5CPTA 3Q2DA 3UXIA 2D23A 3ABRA 2C7FA 4KRUA 3NGJA 2Y63A 1MQRA 3LRLA 1UB3A 2E68A 4I5UA 3VDBA 3ITYA 2HE5A 2PD5A 3DG7A 1KB3A 2JF6A 1Z32X 2FMNA 4XD3A 3C3NA 2YDAA 3UZZA 4NIRA 2W27A 1EOMA 4LCQA 4HNLA 5HWNA 1FWGC 3W6MA 4IWWA 1PE1A 4JTIA 2WM0A 4JTGA 3GDRA 2Z28A 2BVTA 3ONCA 4Y8FA 4V1YA 1JYWA 4UQBA 5FEXA 2VFGA 1ENUA 3LGEA 3NTYA 2ZZ6A 3DENA 9XIMA 2QIWA 3CPRA 1I2PA 1XCWA 3QOMA 1Z9AA 3VD3A 1QPQA 3TWBA 1UHVA 7CGTA 1KM5A 4JEQA 2F6UA 3G0XA 4LYKA 1EC8A 1BYBA 2OJPA 1YPFA 3MUXA 2OG9A 3VXGA 3COTA 1JYXA 1OYCA 4NL1A 1SJCA 3LDVA 1TJRA 3A5FA 2DZPA 4TX9A 1ITXA 1H09A 1CCWB 3LM3A 5HNRA 3VZZA 4W8LA 4J35A 1BXNA 3YPIA 4M19A 4LWWA 4CNTA 1XIJA 2Y5SA 4HHHA 2XTKA 4WDXA 5ENLA 5I3DA 4CD8A 4KWSA 1TZ9A 4DBWA 1XLJA 1DBTA 5L6UA 4ATWA 4C1KA 3EEZA 3WLOA 2VCAA 2E5BA 1V4YA 2H8XA 4JFSA 1VP5A 1W3KA 3TWAA 3PWIA 1SJAA 4NILA 5AHNA 1PZ1A 4BI6A 3W6LA 2YCLB 2IQTA 2DP3A 1AVAA 4REQB 1GG0A 1XRTA 1VBUA 3N9SA 3DZ1A 4OBSA 3LS9A 3UWWA 3KBSA 2FH6A 4AX6A 1E9IA 2O9TA 2F84A 5HJXA 1V51A 2FHBA 2W62A 1OF8A 2DZUA 2B7NA 5HNNA 3EXTA 5TQLA 4M6VA 4AC7C 5LHEA 1SSDA 4ROQA 1ZJBA 3L4VA 2C6QA 4O14A 1YRRA 4G8TA 4DYJA 2ZXDA 3NQDA 4JPGA 5CC6A 1EJTC 3TYEA 4GY7A 4Q3MA 1LBLA 3LOTA 3NQAA 3CT7A 1F7BA 1LM1A 1RXOB 2VURA 1JCJA 4I9AA 3RX4A 4XTIA 1DKWA 3RO8A 3H54A 4CCZA 1HL2A 2VX7A 3TTSA 1LRQA 4MY8A 3K8KA 4HPNA 4KWUA 3KL0A 2QVHA 2IUZA 2FGZA 1ICQA 2GLKA 2V5CA 2WQDA 3R0UA 4UWMA 3GIPA 2QJJA 6XIAA 1DOSA 2E9MA 3O1NA 4LJ3A 5FF3A 1VHCA 2HISA 2WHMA 2H90A 3SUVA 4F9JA 1WX0A 5AYZA 3QC0A 2WZIA 4DBSA 4AQLA 4NRRA 1C29A 1FDJA 3V75A 2GYIA 2Z6JA 4GWEA 1AMKA 2X1TA 1KXHA 1UPPA 3GTHA 2IW0A 4HA0A 2A3CA 4AH7A 1KFKA 2D73A 2O4MA 3VD9A 4INFA 4J3ZA 3CLWA 1PWLA 3F4VA 4JHMA 1MXSA 3NZRA 4IPPA 2WMJA 3S83A 3WUBA 4IGMA 4LAUA 3H4WA 1TB3A 4X2PA 4Z2IA 3T4CA 1NOWA 3WLMA 1EEPA 3W7LA 1A53A 3CEUA 3G24A 2P50A 2PTYA 4L4MA 4M0XA 1Y7VA 4DF0A 1P0NA 2AL2A 1POKA 3NO3A 2YL8A 1DTNA 1F61A 1L6WA 1GORA 2J9ZA 4R27A 2W3ZA 2ZA1A 1XYLA 1I4NA 1CXLA 3VDGA 4RPPA 2OZ8A 2XGZA 3B9DA 3W1TA 5H8MA 3IV3A 4DJEC 1RPKA 4J3VA 3IACA 4JR5A 8XIMA 4J40A 2I9EA 4GGHA 4M24A 3WD3A 4L65A 4BI5A 4ROPA 4DLFA 1EO7A 3DYPA 5U4NA 3E38A 2JFEX 3BH4A 2GUYA 1DJHA 3L67A 1LZOA 5XIAA 1R3QA 3LHWA 1ZB5A 4YMZA 3D3AA 3WSUA 4MY9A 3FDGA 4ICCX 7PTDA 2EF9A 3OJGA 1LG2A 1C3FA 4TXEA 1R87A 3T8QA 1KM1A 3N13A 2RKXA 4DZHA 2GOUA 2SFPA 2AGTA 3UVAA 4LS0A 3WUEA 3H4GA 3V18A 3VGBA 3SY5A 4B2DD 1IGSA 4O10A 4U2ZA 3KTCA 4GUIA 4NG3A 4N9BA 4ORMA 3NZ1A 5HQEA 3PZIA 4A8IA 5K2ZA 1QNRA 2XGIA 4LAZA 2P5NA 4RE0A 4FNQA 1EUNA 1I2RA 4IG2A 1D3CA 1HVQA 2PRHA 3GS6A 1RHCA 2B0MA 3GTIA 2YR1A 4FO4A 3WJSA 3SSJA 2FVKA 3TN6A 4BWLC 2HTMA 3BOFA 4HK6A 5LGZA 2WVVA 4G1NA 2FMOA 1GJUA 2VL4A 2J8FA 1XUZA 1VEPA 5A6LA 3WO8A 2VOMA 1OX4A 2VZSA 3QYSA 3VVGA 2FZNA 4HCHA 3VDCA 3GHTA 3FHQA 4QM1A 4HZ6A 1H5VA 3HB9A 3VOHA 3IGSA 2VUNA 5A8NA 1NFPA 4UFJA 1K4HA 4H8UA 4WCJA 1HG3A 1GGOA 4LUYA 4XVDA 1MUMA 3JRKA 2WPBA 2I16A 3P61A 3XISA 1QAPA 1J5TA 1YDOA 4ZB2A 4GH3A 4CVWA 4NZ3A 1NDZA 4CNNA 5HMDA 2QCNA 3R5EA 2CBJA 2DZVA 3W7PA 3RAOA 4XZBA 3T78A 3QH2A 4QE5A 2WSPA 1QDSA 3D0CA 3W1RA 2J7EA 1QOPA 1S2VA 1OYAA 4IGHA 1AD4A 2A7RA 3OG3A 3W82A 3BAIA 4HPXA 3KWSA 2IMRA 1GK8A 4DO7A 1W1ZA 1VPXA 1R3RA 1QBBA 1EWDA 2WCAA 3WN6A 3GR8A 5M2FX 4W8BA 3NWRA 1Q2SA 1Q4NX 1E0WA 3WQGA 4D6HA 3N18A 3GAYA 2UWFA 4IPNB 1LL6A 4LB3A 3ES7A 3QOKA 4F3HA 1OFOA 2W5FA 2D3NA 4F48A 2G96A 1FWWA 1VJSA 2R1KA 3LA4A 3KLKA 4W9TA 4QR6A 1PUDA 4DUOA 2V5JA 3NURA 1P0BA 2Z1WA 4TVUA 1WE5A 4HIBA 1S5TA 3IJQA 3H21A 1K9EA 1YHTA 3GXPA 2VQTA 3OVRA 3UYCA 2GJRA 2FHFA 1MZRA 4AHPA 4LF2A 1Z41A 3MUY1 4S3BA 3TMLA 2PAJA 1YW1A 1GOMA 2D2OA 2VGIA 4J3SA 2OVLA 1LT7A 4AZ7A 2OELA 4FHAA 4WK9A 1JPIA 1OFPA 2WV8A 1NAL1 1PX3A 3O05A 3G1XA 3ATYA 1ITCA 1MNSA 1ZJAA 7ENLA 1KM0A 1XLGA 3C3UA 1P7TA 1UKOA 3P60A 5BNKA 4AMAA 2BY3A 4YTUA 5HJYA 3LQGA 1HP5A 1F3EA 4N6FA 1TCDA 1UJQA 3KM8A 4LGXA 1KRMA 1ZRQA 4JFTA 1GVIA 4NXSA 2DUZA 4I5XA 1F2JA 3I65A 1SO6A 3V3WA 4AW7A 1EF3A 1XG4A 1XBYA 4JN6A 3N29A 2BNJA 3VKCA 3WDQA 2YGYA 1HQTA 3N34A 3NQVA 4UQEA 1VFOA 3MKVA 5BXRA 2OR2A 5JXQA 3DC8A 3GFZA 1HT6A 5JH2A 3E5BA 1JZ6A 4QBXA 1GG1A 3TCSA 4QS6A 3K4WA 3DX5A 1J10A 2WPGA 5C8BB 3F5KA 4OHQA 4DNHA 1V7AA 5H1WA 1JPDX 1TJPA 4LBUA 3TQPA 1UR4A 3VIJA 1SZNA 1VCVA 4MZ8A 4GUGA 1P0DA 3EB3A 2AQWA 1JPKA 2PODA 3UW6A 4GGBA 2OWCA 2WZMA 3DFNA 3CUXA 1JPMA 5DQPA 4PMZA 1Q6OA 4GOAA 4PR4A 1VYSX 1KFEA 2CESA 4MYXA 3ERPA 1PYFA 1UH2A 1NARA 3NFUA 1V03A 2FZBA 3T07A 1WXZA 2UY4A 4S3JA 4WVXA 3UQNA 4GE8A 7A3HA 1RPXA 1F3TA 3FEQA 3T2QA 3MJMA 4M1BA 1BG9A 4HPGA 4B3LA 3U9IA 2YA2A 1O95A 1FKXA 1QNSA 3HTWA 3O6CA 5I3HA 2FPVA 3H24A 4I6KA 3GNDA 2VENA 2PTZA 4DQWA 2JK2A 3HGJA 4MNJA 1J2WA 3QYQA 1CIUA 4F2TA 3AU2A 1XPYA 3PUDA 3PZNA 4CN4A 3IJIA 3FYYA 3AFBA 5G2IA 2A4AA 1F74A 2PDMA 4GNVA 4RPQA