2WZMA

Crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
274
structure length
274
Chain Sequence
b'AIPTVTLNDDNTLPVVGIGVGELSDSEAERSVSAALEAGYRLIDTAAAYGNEAAVGRAIAASGIPRDEIYVTTKLATPDQGFTSSQAAARASLERLGLDYVDLYLIHWPGGDTSKYVDSWGGLMKVKEDGIARSIGVCNFGAEDLETIVSLTYFTPAVNQIELHPLLNQAALREVNAGYNIVTEAYGPLGVGRLLDHPAVTAIAEAHGRTAAQVLLRWSIQLGNVVISRSANPERIASNLDVFGFELTADEMETLNGLDDGTRFRPDPATYTGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDO-KETO REDUCTASE
molecule tags Oxidoreductase
source organism Mycobacterium smegmatis
publication title Crystal Structure and Comparative Functional Analyses of a Mycobacterium Aldo-Keto Reductase.
pubmed doi rcsb
total genus 106
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 1.1.1.218: Morphine 6-dehydrogenase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2wzmA00
3V36A 4DBUA 3LBOA 3R7MA 3UZZA 4WDUA 1UR3M 4FA3A 4HBKA 1PWMA 4JQAA 3FX4A 3LENA 2INEA 2FGBA 3FJNA 4YU1A 5LIXX 1PWLA 2PDCA 2FVLA 1J96A 3H4GA 1R38A 4YVVA 3WBWA 3COTA 1OG6A 3Q65A 3GHUA 1AH0A 2BGQA 1S1PA 2PDJA 3M64A 4DBSA 2IPWA 2PD5A 3G1RA 3H7UA 3LQGA 2PDNA 1C9WA 1QWKA 2F38A 3S3GA 3CAVA 2FZ9A 3VXGA 4AUBA 5HA7A 1A80A 4WDTA 2HE5A 4JTQA 1LWIA 3CMFA 4I5XA 1PZ1A 4PR4A 2FZBA 2ACRA 1RY0A 3LD5A 3UGRA 1ZQ5A 3LEPA 3ONBA 3KRBA 3UWEA 2DUXA 3R6IA 4FZIA 1T40A 1PYFA 4YVPA 3B3DA 1RALA 4FALA 3V0TA 4WRHA 1FRBA 4XVDA 4H7CA 4QX4A 3M4HA 4XO6A 2HDJA 2PDFA 4LBSA 2PDGA 4EXAA 1YE6A 2PDKA 4JTAA 4JQ4A 2NVDA 5AZ0A 5DANA 4Q3MA 2PEVA 2ACQA 2IPFA 2WZTA 1EL3A 4NKCA 2PDQA 1HQTA 5M2FX 1S2AA 2PF8A 4Q7BA 3LN3A 4WDXA 4PUWA 4JTDA 1ADSA 3H7RA 3UZXA 4LAZA 3M0IA 4GIEA 3UZYA 2F2KA 3UYIA 4XAPA 2PFHA 4MHBA 1AZ1A 4JTRA 1ZSXA 2IPJA 4QBXA 3Q67A 4JTCA 2VDGA 4R9OA 1XJBA 3T42A 4XZNX 2HEJA 4ICCX 4YVXA 3U2CA 4DBWA 4PRRA 3C3UA 3WBYA 2P5NA 1JEZA 4GA8A 3LZ3A 4PUUA 3EB4A 1Z8AA 3V0SA 2HV5A 4RPQA 2PDMA 1Z9AA 2IS7A 3R94A 3CV7A 4IGSA 4L1XA 3UG8A 4JQ2A 3MC5A 2PDPA 3BV7A 5LIUX 2BP1A 1XF0A 2QXWA 3F7JA 4PRTA 3CV6A 2PD9A 4GCAA 4LB3A 3WCZA 1S2CA 2PDXA 2I17A 2HVOA 4QR6A 2PDWA 1IHIA 4GQGA 2ACUA 2IPGA 4XZIA 3GHRA 2IQ0A 3NTYA 1LQAA 1MZRA 1T41A 3BUVA 3QKZA 4IJCA 4WGHA 5LIWX 4LAUA 1ZGDA 4ASTA 4EXBA 1EXBA 2PZNA 2AGTA 2PDUA 3BURA 5C7HA 3LZ5A 4XZHA 4XZMX 2IKJA 1EF3A 1MRQA 1X97A 2A79A 5HNUA 2PDIA 1AH4A 3DN5A 4HMNA 2CLPA 1HW6A 4ZFCA 1VBJA 5LIYX 1IEIA 4G5DA 3RX2A 3GHSA 1PZ0A 1X96A 3GHTA 1K8CA 1RY8A 4XZLX 1Q5MA 1AZ2A 4PMJA 4LBRA 3DOPA 4JIRA 4FAMA 2IKHA 4DZ5A 3LUTA 3LNMA 1Z89A 2HE8A 2ALRA 5JH1A 2C91A 2DUZA 2I16A 3RX4A 1YE4A 2IQDA 2IKIA 3ERPA 3R43A 4WDWA 4H8NA 1SM9A 1YNQA 2PDLA 3O0KA 4QXIA 2FZ8A 4GACA 3R8HA 1YNPA 2PDBA 2R24A 3R8GA 4XK2A 4GABA 1VP5A 1S1RA 2BGSA 4IJRA 2PDHA 1GVEA 2NVCA 3N6QA 3BCJA 4JQ3A 3UZWA 2J8TA 3O3RA 1QRQA 2INZA 3P2VA 2PDYA 5KETA 1Z3NA 1X98A 3EAUA 1AFSA 3UP8A 3R58A 4XVEA 1M9HA 2IKGA 1MI3A 3WG6A 4L1WA 5LIKX 4XO7A 1XGDA 3V35A 2HVNA 2WZMA 3EB3A 5JH2A 1Q13A 2DV0A 3CAQA 4JQ1A 4JIIX 3V0UA 3G5EA 4WEVX 1ZUAX 2R9RA 3D3FA 4JIHA 3MB9A 3WBXA 3UFYA 4OTKA 3GUGA 4LB4A 4F40A 3ONCA 1AH3A 1US0A 3CASA 3LQLA 2ACSA 2FZDA 4GQ0A 3N2TA 3RX3A 5AZ1A 4YS1A 5HNTA 1EKOA 2ISFA
chains in the Genus database with same CATH superfamily
3TTYA 2V9DA 6REQA 3FAWA 3ZT5A 3VKCA 4TTGA 2PBOA 3OVRA 4DAFA 4S38A 4GD0A 4A8LA 3BK0A 1MZHA 2GVEA 5F4SA 2OXNA 2WVVB 2XIMA 5I6SA 1Q65A 4K8GA 3MZ2A 3AYVA 2DP3A 3GK0A 2AMGA 4HJWA 3IEBA 1HZYA 4JIQA 4C6NA 2GJNA 3NZRA 4P7LA 2F8QA 3Q65A 4JKKA 5FEPA 1BAGA 3LXBA 2XUCA 4JY9A 1AH0A 1MW3A 2IPWA 3W2LA 1S38A 4PTVA 4DXVA 2AKMA 4GYKA 1VCVA 1RK5A 4O0KA 4RK8A 2I9EA 3I3DA 3MY9A 5KSWA 3TYDA 4I9JA 1XBYA 2H8XA 3NURA 3U2OA 3LCHA 2XGIA 4C7FA 1QATA 3G77A 3VAVA 3F4WA 1A80A 1QAPA 3DUGA 1JNDA 3M07A 4A22A 1VFUA 1H5VA 1GHRA 4ZOAA 1NVMA 4DBEA 1W54A 1SGJA 2GQ9A 1SQ7A 4MSSA 4UZUA 3E2VA 2CBVA 2PCEA 3MI3A 4GNKB 3ABXA 3B8VA 3KRZA 3NZGA 5A8MA 4WJEA 2ZBTA 5I0DA 1W1TA 4DAIA 4Q8WA 4JFVA 3TFCA 2I5IA 4MLJA 2VRJA 3KL3A 4MPQA 1PDYA 1UP2A 2DZXA 1FP9A 3ALGA 4HA4A 1WOAA 3UZ5A 1N2VA 5CC5A 3PTQA 1HN1A 5U7SA 4EANA 1FWEC 3W00A 1MEIA 4D1JA 4RDYA 1EJRC 4UTIA 1OVDA 3ZLHA 3VNIA 3GTFA 1OQFA 3KVMA 3I7QA 2ZC1A 1HGYA 2Z4GA 3ABOA 2YDAA 2F2KA 1IE7C 3NSNA 1LBLA 1OBAA 3SUVA 3BW4A 3QZEA 4QCFA 2ZKMX 1HIZA 2ZFAA 3ECQA 3VFLA 1H1YA 2VURA 3WLKX 3GS6A 1XSJA 2JALA 4AWEA 1J79A 3AISA 2P76A 4W86A 1R0MA 3VM7A 1J8VA 1JEZA 1VQTA 3SSJA 3OJGA 2WCAA 1XGZA 5XINA 3GC4A 4F4RA 3TTOA 5GNYA 3W1QA 4W7UA 4OUEA 5D03A 3B40A 1KGUA 3Q4DA 2Z26A 3S5ZA 4Z2GA 1OJXA 3MMTA 1PTAA 1A5BA 3B9EA 3WN6A 4AX7A 1X8FA 1QBAA 3M43A 4DYEA 3BO9A 1S2TA 3NSMA 1KKOA 2R1NA 1VKFA 5TD4A 1ZBCA 2Z7KA 4MTVA 1TCMA 1SZNA 3C52A 3KZPA 4QE5A 3WDIA 1O66A 4KT2A 1CDGA 1SW3A 4IZGA 2ACUA 3CH9A 1ZENA 1R47A 3TW9A 2PSNA 3GHRA 2GQAA 2Q71A 4P7NA 3W29A 3P14A 3TWAA 4LUIA 1BEUA 3GAYA 1QPQA 1PX4A 2AAMA 3S1XA 3DFTA 4DWDA 1V3IA 4QFUA 3BXWA 2AGTA 2PDUA 3ABQA 4X9SA 1UWAA 2C19A 5U4NA 2XIJA 5HUOA 3ITCA 3F5LA 3PZGA 1W3TA 4O12A 3U2ZA 3PJTA 3SUUA 5L6UA 4MJ2A 3JS3A 4JX5A 1V0MA 3OW1A 1MW0A 3S1GA 4N0RA 2PA6A 2O4MA 1BGGA 2D69A 5DY2A 5BOOA 4WF7A 1SU5A 1UD2A 1GW1A 1A3XA 4ZBCA 3HQPA 4AZBA 3U5UA 2VR2A 3URBA 1WDRA 4AHPA 4P8UA 4JIRA 3ARVA 1A5OC 3B05A 3U4AA 1LROA 4UR9A 3W2NA 4WK9A 5E0FA 4IMAA 2HK0A 5A69A 1JCMP 5JVLA 4H8NA 3WJZA 2QGHA 1JCJA 5BWFA 4BQ5A 1TVPA 2ON3A 1UPPA 1WBJA 4XKYB 5FJOA 4OGZA 2DZWA 2OZTA 1VPXA 1HT6A 2A7PA 4JKLA 3DBPA 5A6JA 3L2LA 4UMAA 1KGXA 5A8PA 1DPMA 2BGSA 3UEQA 4JTLA 3STGA 3ES8A 2OELA 4WUIA 2PLJA 1Q8AA 3D0CA 2X42A 4GQQA 2QVNA 3O16A 3A5FA 1PBGA 5EA9A 4MMWA 4LUTA 1X98A 4GNVA 3WG6A 1L9WA 1QXLA 3FEMA 4PMOA 2R94A 3SADA 2YXOA 4JNYA 4RL3A 5A95A 4EVZA 3FA4A 3W7OA 4MJMA 2DV0A 4YTRA 1RCQA 2Z2AA 3RRXA 3HURA 1Z7AA 2Z2BA 3A6OA 2QPUA 2NX9A 3EX4A 5DMLA 4F40A 5CPTA 3ONCA 4V15A 5MHBA 2Y7GA 3LQLA 2WW5A 1JUKA 4I7UA 3PTDA 5JIPA 3ARQA 1UJQA 7REQB 3TW7A 1R7OA 2D23A 1OGGA 1XLEA 2VQTA 4HP5A 3W71A 3A12A 2ZICA 3NZQA 3H54A 4CD4A 4RCXA 2EPHA 4RNFA 3QFWA 3AALA 4UNKA 4UWMA 4NZJA 5H91A 3RG6A 1U83A 4IQJA 3SY1A 3F2BA 2MANA 1CW2A 3ZFHA 1DOSA 2WHJA 3DYMA 4IGNA 3MDWA 3G22A 2Y70A 3DKJA 5CSSA 3WL0A 1W5QA 5HDRA 4XD4A 1POJA 4UFJA 2FGBA 3VMPA 2HQAA 3DG3A 4EPDC 1OT1A 2XN2A 3MU7A 3W1XA 3ORWA 1J96A 4KEUA 4JX4A 3T2OA 3I4EA 1R2SA 3MQTA 4U28A 4E0CA 4NY2A 1JVNA 5CBBA 1XI3A 1GQNA 1JF6A 3TA9A 1B3WA 5DRCA 1T0OA 4NJKA 4PUNA 4DXXA 4DBSA 1EWEA 3VKAA 8XIMA 3EDEA 1TJPA 3GW0A 2V81A 3PUGA 1A5LC 3VDAA 1XS2A 1XLJA 4Y8FA 3RCYA 1UKQA 4HNTA 3DECA 2H8ZA 2J78A 2B4GA 3UG5A 1U1HA 5F2GA 3NCOA 3GVGA 3TYBA 4IXHA 1CNVA 4L5ZA 4QE4A 3C2EA 4JL2A 2JIEA 4I9MA 4DYJA 1NFBA 3TLLA 1XC6A 1A47A 4YYCA 1IXQA 4LOCA 2XH7A 2FTYA 1BXNA 3LHWA 2H3DA 4AD0A 4Q4SA 4GKLA 3PBWA 3OBEA 4KW2A 1O12A 2DW7A 2TYSA 4GCXA 4ZODA 3IWPA 3EPNA 3L4WA 1BF6A 3BC9A 3IUIA 3HM7A 4EAYA 5K9CA 2OPJA 4DN1A 3OA5A 3C0SA 3PJWA 2QJNA 3N34A 4B4FA 3L2IA 4PMRA 3W1NA 1GONA 3KRSA 1XIFA 2V5BA 5CBJA 3VVGA 3N9SA 1EL3A 3H22A 2GJPA 4GFIA 4FOKA 2W9MA 3AMCA 2CITA 2R6OA 2CLMA 1MW2A 3LN3A 2I7GA 2DPEA 3S9ZA 4RW5A 1Q85A 1TRDA 4S3GA 4C6CA 4W8LA 3QHNA 4ZMGA 2XU2A 4LT9A 1N55A 4DM1A 3LPOA 3LMYA 1QHPA 4IPPA 4R53A 5LA0A 2AQWA 1FH9A 4YHGA 1C93A 3WF3A 2HBVA 5AC7A 1E1CB 2WJZA 1GOKA 1KBBA 1B0IA 4C6KA 1Q4NX 2J88A 3SDOA 2NVAA 1UKOA 3STEA 1ITUA 1V6UA 3POHA 5HOSA 1OZMA 2FB2A 3CEPA 1V3MA 2WV8A 1KM0A 2BHZA 4LY8A 4GQRA 1TVNA 4NJIA 2IW0A 1BFNA 4NZCA 4NL1A 3W07A 4LS1A 2QCDA 1EOMA 3CAWA 4BF5A 4AU0A 5AC4A 4RE0A 5E9AA 4EPKA 4U33A 2D2HA 4LCRA 3CNYA 3ANUA 3OZPA 1FWTA 2E9LA 4PRTA 1BGAA 1L6FA 1FXQA 2ZUMA 1XV8A 1BSLA 1S2CA 4PH6A 3OLGA 1H7WA 4F8XA 3LBCA 1IHIA 1B2YA 1TJ2A 3LCXA 4XZIA 3MSYA 5ENLA 3WNOA 3KUMA 2X0HA 3QR0A 1QDSA 1E6QM 2ZA2A 1RQEA 2EEXA 4ASTA 1XQKA 3LZ5A 3ITTA 2PB1A 3SCQA 2PS2A 4TX6A 2WVSA 1AL7A 1I0DA 4GYFA 2VX5A 4CQCA 2Z00A 1LQ2A 4LUTB 3DN5A 4WY0B 3MCMA 2ZVRA 2O0TA 5CZ0A 2VENA 2WM0A 1DJHA 4IFOA 5EL1A 1CPUA 2CIPA 2CWXA 4PUJA 1TPUA 1O5RA 1H50A 3QW3A 3EOUA 4CLMA 2VGIA 1KCLA 1JD7A 4H9MA 4J5NA 3RFAA 2PGWA 1K8CA 4OBTA 3O1NA 1RY8A 3MJYA 2Y85A 3VILA 3KVKA 3AJ7A 1UIPA 1G9HA 1J12A 2NLYA 4MYXA 3BAIA 1UUOA 3B04A 1W1B1 2QAPA 5CSYA 4IMGA 2QCLA 4QJ4B 1BRLB 3W88A 4DJEA 4R34A 2FFIA 4PEEA 4WXYA 1ITQA 3LPFA 1XH2A 1S1RA 4GNJA 2DU2A 4NI3A 1IXPA 2VJXA 3RLVA 2G50A 2Z0IA 3DFPA 3N6QA 2JKPA 5TQLA 1E6PA 1EX5A 3BARA 1W1VA 3HPSA 2INZA 4FPSA 2P10A 2YA1A 1E72M 3AS1A 1XSKA 1SPQA 3UPWA 2Y4SA 4K38A 1UR1A 2NUXA 4L1WA 5C2CA 4XO7A 3UNDA 2WZEA 3AHVA 1FWDC 3G1HA 5KINA 1UBPC 3CB3A 4JEJA 2CC0A 3M41A 4JQ1A 4ZQRA 1F3TA 4LYQA 4HPHA 1K9DA 4GZEA 3LHTA 4FIQA 1ZUAX 2R8WA 5C5YA 5EFFA 5HPOA 3HU7A 4LXFA 3W22A 2VDHA 3P0WA 1I2RA 3PPFA 1X1NA 1AQFA 2CLFA 3AU2A 3QRHA 1HJVA 3L4ZA 1VBUA 3IACA 1XIBA 3DI1A 3N2TA 1ZJAA 3LI1A 1UHVA 5TIMA 4B4HA 3UWQA 4Q4QA 3G1SA 2HNHA 1A0DA 5FAGA 1GEQA 4XD3A 4B5WA 3NEVA 4L4PA 1P0BA 1QOQA 1JZ8A 4RZ6A 5F2MA 1P48A 3AXHA 1WDDA 1HL8A 1UWIA 4QDPA 3EDFA 3LS9A 3OEXA 3SR7A 2VOTA 2XFRA 5K2ZA 1ZP4A 4EKJA 5CAHA 3PPCA 4CN6A 1I1XA 3ZJ6A 4P2VA 4PYSA 3QC3A 4KKXA 5LIXX 1OD0A 4PBEA 4JPGA 4DPQA 3VIPA 3CT7A 2I5GA 5REQB 3R0KA 1OG6A 4V33A 4KFOA 3VGFA 2BGQA 4YMZA 5K7JA 3TYCA 1CXFA 3A64A 3H7UA 3GDMA 1YDVA 5M17A 4ZB2A 3TNBA 2HISA 4W7WA 1A5AA 3SB0A 4NILA 2BODX 4JTKA 3SCUA 5FEZA 3CV1A 4I5UA 4HNLA 4IGHA 5FCZA 5M03A 3S4TA 3TDFA 2X0SA 5DBUA 1PZ1A 3CPRA 4RPPA 4DF2A 2ACRA 1DXIA 4US5D 3S2CA 4O50A 3STFA 3R0UA 3M0XA 2PPGA 3MANA 1OCQA 3GNXA 2E3ZA 4RJEA 4I90A 1UH3A 1JL8A 3PSWA 5I3HA 1UKSA 4DHGA 4JTIA 3T2PA 5LA1A 1DE5A 1UZ4A 1RP8A 2C79A 1O6IA 3IS4A 4LC8A 4F66A 4CQAA 1R9XA 4KWUA 4JHZA 1FP8A 1BQCA 4EXAA 4PUKA 3BANA 4KRTA 4QEEA 1GVYA 1X6UA 1ELSA 4F0KA 3B4YA 4UC5A 3KVLA 5JQ9A 5D8ZA 5CJMA 1V5XA 1S46A 4LVFA 4N9CA 1TR9A 4M29A 5BWAA 2J6XA 3T1GA 2XM1A 1IEWA 4JTDA 5PTDA 5IRPA 2O7QA 4GIEA 5BYWA 4CN1A 1ICSA 5LNWA 1IWAA 3WQEA 3N3MA 3UETA 4FMVA 4HZMA 5LSMA 4JTRA 1AK5A 1DP0A 4ZO8A 5KZEA 2VDGA 4R9OA 2NXHA 4BJHA 2YL8A 2YX0A 1B9BA 4H1ZA 3O6DA 3MYPA 3U2CA 2VNCA 3DFSA 1EGZA 2WWDA 4K1GA 4Y8EA 1OY0A 5FIPA 1M5WA 2WC3A 4GA8A 1SFLA 2QYGA 1FH8A 4CVUA 3V0SA 3REQA 2TSYA 3BLIA 2QJHA 4IGMA 1I60A 3AS3A 4X0VA 3L4TA 5H2ZA 4A8RA 4AF0B 3NDYA 3G1YA 5AC6A 1XIMA 4LYRA 1H09A 1R9YA 4GUIA 1OK6A 1UP0A 4J4KA 4L7ZA 4J3WA 5E09A 2POTA 3PS7A 1JGMA 2ZRYA 4GISA 5F7UA 2FJUB 4GQGA 2OGJA 3NVTA 3MUY1 3P74A 4M51A 1NOFA 1SZRA 1UR0A 1OFAA 2GWNA 1XLHA 3MSRA 1W9DM 3HG3A 4J1OA 3NO1A 1DWFM 4IP4A 3ABRA 4ATWA 3IJQA 3B06A 1RP9A 3E2SA 7REQA 4EPEC 5C7HA 1XYLA 1FWSA 5LNVA 1DHPA 5B7YA 4M24A 1PIGA 1MRQA 3PZMA 2NXIA 3L4XA 5HNUA 1XW8A 4QG6A 2WJFA 2WMIA 3N11A 3IV8A 4OVXA 1TIWA 5CCZA 2YJQA 1KBJA 3KOFA 1VBJA 1J11A 2VGFA 3OB8A 4M1BA 2JKAA 4JDBA 2E77A 1VCFA 4DELA 4CD7A 3MP3A 2OYMA 3QHMA 3TN6A 1V3KA 4XTDA 3ABSA 2OO0A 4AZ5A 2RHGA 1QNRA 3P61A 3URAA 3S1WA 4GZIA 4P8VA 3CWOX 3O6YX 4OV9A 3H70A 1WDSA 4UFIA 1CYGA 2DT2A 3N9KA 4BI5A 2ZA1A 3FA3A 5LGXA 3B9NA 2J74A 3MP4A 3KBMA 3L0KA 4GZJA 1Y5WA 3N6JA 4LANA 2C7FA 3PWIA 4FI4A 3M46A 1S5MA 4U5KA 1LLZA 2Y2WA 4UTUA 3KRUA 1US3A 2E6AA 2R24A 4XSMA 1GVQA 4DBDA 2QMKA 3H26A 2PAJA 4IIBA 2R91A 2E6YA 1ISZA 4RV3A 1QASA 1WE5A 2AGKA 1ZBKA 4O1BA 1JZ5A 2Z1VA 3AYRA 3H2CA 1WNOA 5D2TA 2OFJA 4TVCA 3R5EA 3P2VA 4X2RA 4DXKA 1YLVA 2QV5A 1F05A 2XH0A 1V0KA 3NGJA 2OX4A 5REQA 1IT8A 4M81A 4J27A 4RDWA 2NV2A 4JNMA 4R9XA 1PUDA 2EGZA 3TYAA 3A4WA 3OG3A 2YYUA 3VK5A 1ZAJA 1GQLA 1P0EA 1W56A 2CCRA 4B5TA 2FGZA 4E8CA 3KOWA 5DXYA 2ZRUA 3GUGA 4O1CA 4AVOA 5K9XA 3CASA 4LVAA 2FH8A 1D8CA 5A5WA 1M65A 1XCWA 1V6XA 3MHGA 1BQGA 2WMGA 2YFOA 5HANA 4M1RA 3SUSA 1OGBA 3V18A 3UZZA 4OOZA 4LEQA 4FXRA 5BXTA 1ONXA 3QMRA 1C90A 4D6CA 3BLPX 4ERAA 4HBKA 5D9NA 1PWMA 4RE3A 4HCLA 3WZ0E 2ZYFA 3LENA 1JPDX 1UC5A 1EC7A 1R3RA 1TB3A 3AWNA 1F4HA 3VINA 4XX6A 2NX1A 1OSEA 2GUUA 3G6LA 1K1DA 2KZHA 4QTGA 4BCEA 5E9XA 2BOFX 2XJ7A 1BYCA 3UW6A 3VD5A 2BG5A 2VD8A 2W91A 3C0QA 3HMCA 5D2XA 3IJ7A 2WNNA 3KTCA 1FX6A 1DWJM 5LNUA 1JYVA 3W1AA 3VNMA 1XC4A 2F38A 4B9ZA 3BCFA 5FF7A 3ARYA 3PPGA 1PKLA 3BOXA 1M7XA 3FEQA 1XSIA 4QS6A 1W9PA 3IV3A 4IIDA 1A53A 4MUZA 3T81A 4DO5A 5D9OA 4AW7A 1H1NA 4LGXA 4UR7A 4AD5A 3PB2A 1S2UA 1TJRA 4U2YA 1XLCA 3ONBA 2E5CA 2PI6A 3LBMA 4KRZA 5H1WA 2X0YA 5M3WA 4WY0F 1GQJA 1UWRA 4C6QA 3PZOA 3MP5A 2A6LA 4CNNA 1ECEA 2BY3A 1UZ1A 3PHAA 4BHYA 1HKJA 1JQVA 3G0UA 3N2OA 4XTIA 1MQRA 9RUBA 3EDKA 2CXGA 4HGXA 1L2UA 3ARZA 4PMYA 3OVPA 2BVTA 1G4TA 1TA3A 3IRSA 4HCHA 3W53A 3E0FA 2OLAA 2V2HA 6ENLA 1CCWB 1ZCCA 3KBJA 3THQA 1E1FA 4F0MA 2ACQA 3B4UA 2FH6A 2ZWZA 3G8EA 2VEIA 3W87A 3GTIA 3EX2A 3D46A 1NSJA 4J7RA 2GPTA 2V5KA 1R5YA 5A8NA 2YDRA 2NXGA 3PK7A 4KCWA 1DJGA 2YDSA 3W23A 1KM4A 2RDWA 1UUMA 5AVNA 3NQEA 2A21A 4QNWA 2F6UA 3BVJA 3G6MA 2VCAA 3K4AA 4XZNX 4PMZA 3OLEA 1E0TA 4DBWA 4G7EB 2OOFA 3OTRA 1OC7A 5J5RA 3GR8A 2OMAA 1GKPA 4UFLA 2DZBA 5BMXA 1BPLB 1MDRA 4MFEA 2D73A 2ODOA 4GY1A 4IIFA 2ALDA 4C91A 1DIKA 1EP3A 4ZB0A 4QS5A 3T78A 4RDVA 1EHAA 2O9OA 4GCAA 1PTDA 1DJWA 3DXIA 3THDA 4QR6A 3BDKA 3ARSA 4QCEA 1CXIA 4MNLA 3M5ZA 1TQXA 3ENLA 4KF1A 3MPGA 5BW6A 3R25A 1ME7A 3LCWA 5HBFA 3ANVA 4J3UA 1YPIA 2VHLA 3VD4A 2EQDA 1KBKA 2QW5A 4MUPA 2FLIA 1UKTA 4R85A 2YCLA 3FDKA 6TAAA 4Y9NA 2X41A 1FWNA 3BG5A 1GKQA 2TAAA 2VDIA 2IKJA 2FZMA 2C1HA 3GNNA 2V30A 3DFHA 1ZCOA 4UCGA 3DFNA 2ZZ2A 3AICA 4I5RA 3GBEA 4X2PA 3V3WA 1F6KA 3VIJA 1NAL1 3GTNA 2YOCA 1IEIA 2BY2A 4FR6A 3ZVIA 4RW3A 3FNDA 4HYVA 1GZ1A 1MEWA 1VYSX 1P6CA 5DT5A 3AOFA 4FX8A 4AWSA 3AO0A 4EWND 1I2QA 4GVHA 4KWOA 2OSXA 4PMJA 3M0KA 4YTQA 4DX3A 1CT5A 3W4RA 3UU0A 4S3FA 4W5UA 1AQHA 4PCPA 4Y9AA 4N42A 1HKVA 3R43A 1GOQA 2VZUA 5KITA 2QPXA 2QUTA 1ENUA 4FR1A 3DHDA 2CHNA 4QXIA 4FEZA 3LU2A 4MWAC 3UESA 3GNDA 1I4NA 4GINA 3J7HA 3ZIZA 2GVLA 2I9UA 5AOUA 2VZSA 4PCFA 3LLFA 3GBDA 4KEMA 3I68A 3N2CA 2QCDB 1W9UA 1FOBA 5A2BA 4UOQA 2VEKA 3H2FA 1Z3NA 1XLIA 1AODA 4JFWA 3BAKA 4GX8A 4MZYA 4S1FA 1SJAA 5MKGA 1E9IA 3S42A 1UD8A 2OZ8A 5JH2A 4IICA 1Q13A 2ZRXA 1FVPA 4PMNA 3FFSA 4ZA0A 1EUAA 2CBUA 2VD9A 4KEVA 4WEVX 1P1XA 1ALDA 1SMAA 3IGXA 4OTKA 4ZFMA 1UA3A 2C71A 3GIYA 1F6PA 4LEFA 5SWUA 4N7QA 5CGMA 3EKZA 4PB5A 1JJKA 5AHFA 4PMUA 1EKOA 3ZWSA 3MYOA 2J6VA 1XX1A 3IIXA 3S9IA 3E74A 1EOKA 3KBVA 5AC5A 3W83A 2NT0A 4OOUA 4BS0A 3SI9A 2DZUA 1XPYA 4B5SA 1TV7A 2EF9A 4CD8A 3WF2A 3BLFA 4NQ1A 1I2NA 1RVGA 4QE1A 5D2YA 2WO5A 2QGYA 4TOQA 3LB0A 2PMQA 1BVNP 2WOQA 3MW7A 1CENA 4HJFA 1B5TA 5A6MA 4AMAA 5D9PA 3WLMA 2V69A 1ISXA 4HTBA 1GWJA 3UWZA 5C8BB 1UPMB 3GXPA 3VNKA 4MB1A 4AD4A 1XLKA 1VFSA 1WAUA 1E6XM 3GB6A 3WK1A 5HMEA 2TPSA 2ZQ0A 2HWGA 4FXJA 3WF0A 2WPBA 2XDFA 3MMDA 2FTPA 1A4LA 4MY8A 3QR1A 3I6RA 1JI2A 1XIEA 4PMDA 1KFWA 4TO8A 3IARA 1EBHA 2Y89A 3H6OA 4JTQA 4UTTC 6TIMA 1WCGA 3W7LA 3L12A 3AU6A 1BWVA 3CMFA 5G2WA 2W79A 3MSGA 1HKWA 1A5NC 3TZFA 1GPWA 4O19A 3CWHA 1H41A 3TLQA 3NPUA 2R14A 1FWAC 3HJZA 3FHAA 2GGGA 5CGTA 1DIEA 2V5JA 1WKYA 4UFMA 3B3DA 5TBOA 2EG8A 4G7FA 2OLHA 4J3XA 1E0UA 1QI5A 3WLNA 2X2GA 2PWHA 2JIWA 1A49A 2DGAA 2DY3A 2WLYA 4WCJA 3PANA 2PCQA 3OU8A 1OYBA 4GH1A 3DESA 2OCZA 4JTTA 4B92A 4DVOA 1HKIA 3WNNA 1KC7A 3V16A 4NJHA 3WNKA 1MUMA 2PWDA 3EMQA 3TYUA 3R10A 2P0OA 2PLMA 3CC1A 2ANUA 3SW6A 2V38A 2C16A 2V8ZA 1B31A 3O7UA 3UZXA 1KRBC 1DXEA 3ZZ1A 2QULA 3UZYA 1F76A 5FL0A 2CYGA 2PFHA 1NU5A 4GMEA 4MHBA 3W7HA 2WJDA 2E0PA 1K8YA 1V02A 4H8VA 3HB9A 5DCDA 4JTCA 1TE1A 1JYXA 5JBFA 1EB3A 1R87A 3M0LA 3TSMA 4BQ3A 2BXYA 2D0GA 3B9AA 1KA9F 2KX9A 2VC6A 3REQB 5C9XA 3VNZA 3UR8A 2OEJA 5GQBA 3WMSA 2FZNA 1F74A 1HL2A 4NYUA 1K8XA 4XBSA 1EXPA 4AF0A 1SFTA 1OT2A 3VDBA 1QW9A 2DSVA 4GVIA 3VGDA 1UQYA 4AZCB 1KXVA 3STCA 4W88A 3TSDA 2J66A 4HZ7A 5GNXA 5XIAA 1P7TB 2E9MA 1OX5A 4UTLA 1EWDA 4GQBA 3M0JA 2PD9A 1REQB 4DWSA 4GGBA 2JF6A 3ZJ7A 1J2BA 2PDXA 4F0HA 1GPFA 1FHUA 1LOSA 3PZVA 1BLIA 4M6QA 5CLWA 3A24A 3G1AA 2G3FA 2ZOXA 2O9TA 5I78A 3FJLA 1RR2A 4XIAA 2ABAA 1OCJA 3A9BA 1H1ZA 4EXBA 3O15A 1BXCA 4H83A 2X2YA 4PZVA 1NP0A 3BAJA 3SBFA 2W66A 3IPWA 2CU0A 2VVSA 4OT7A 2FB3A 2IMRA 1X97A 4XAGA 1TV8A 3NJ3A 3RGTA 2DQXA 1G4PA 3IVTA 4H9ZA 1ME9A 4IFKA 5BZAA 1E43A 3GYEA 4CCZA 5H8MA 2D24A 2B81A 2VCCA 4HSHA 2BS9A 1H61A 4AD2A 1WO2A 5DELA 1H4PA 4M82A 1VD6A 2YBUA 4FLRA 2BLEA 4BI6A 3LLDA 1FWGC 4WKFA 2F84A 3GHSA 2XFYA 3NQCA 4XZLX 5BOFA 1Q5MA 5BNKA 2VO5A 3WEOA 4XISA 1F73A 1S5WA 3SCPA 2VZOA 2GFTA 2ZC8A 3GY1A 3UCCA 1VPYA 4PE8A 1GVOA 4Z1AA 4AHQA 4XWUA 4BQ2A 2OZ3A 1AJ2A 3HG4A 1ZTVA 3IUDA 5GPRA 2YXGA 2XIBA 3CHDA 3OGVA 4C6MA 4JYDA 4GACA 7ODCA 1YNPA 3VPLA 3QY8A 1GOMA 5HMDA 5CZKA 1VP5A 3L4UA 4HNNA 4R5EA 1PAMA 5CJNA 4XUGA 3UZJA 5CPQA 4HMCA 4UQDA 4GYPA 2EXOA 3ZR5A 4AVNA 3M0MA 1KTBA 4YCOA 1KKRA 4AFYA 4DM2A 3F4VA 1OGSA 2PDYA 3IJLA 2CERA 2V2DA 1J5TA 4WIWA 1U33A 3BMXA 3TNOA 5A2AA 4Y7EA 3JR2A 3QH2A 3Q58A 3WUFA 4LALA 2WZMA 3BICA 3UF9A 3HA1A 2FHFA 3H4XA 2C1IA 3CLMA 4XV0A 1CLKA 1TMHA 3EA3A 4DQWA 7TAAA 4OJYA 3IK2A 3VNLA 1K70A 4UFHA 1E71M 1S3HA 3USZA 3O06A 3CQJA 1O68A 2DW6A 4V2XA 3LCLA 1B4EA 3MKKA 3BGJA 1GYLA 2HS8A 2HJPA 3WQWA 3QFEA 4QLLA 1WDPA 3WDRA 2BNJA 4YS1A 3VDCA 2V6AA 4GK8A 3WDQA 5EB8A 3O63A 1EUNA 1S5NA 3LBOA 1HP5A 4L80A 3NDOA 1G69A 4EP8C 3Q94A 3SRFA 2WMIB 3XISA 4B2DA 3T2QA 1OYCA 2FYMA 3BV4A 2A5HA 3BH4A 4JTFA 1IF2A 2VX7A 1EA9C 2CLIA 3MWCA 2Y7FA 4O10A 4NJGA 1CXHA 3VFCA 1UWQA 5BU6A 1E70M 3WFZA 1WUEA 1PSCA 2XGZA 3W7GA 1TV4A 3WMLA 4CNTA 3TIMA 1TR1A 3TAOA 4MY1A 3M47A 2QJGA 3LRMA 3S47A 4G7EA 3MI6A 4JHOA 1DIDA 4UOJA 3TN5A 4UOZA 3N1AA 1CX9A 2FHBA 3PZ9A 3S83A 1WDQA 3IJ8A 2IQTA 3SRHA 5IM51 4E2DA 3EMZA 4MB3A 5IHSA 1LQ0A 1KCXA 4AD1A 1LRTA 4AZHA 4LAMA 3BE7A 4K8HA 4ATDA 2YYTA 2NUWA 2DZPA 4EPBC 4K36A 3W1TA 1JUBA 1LM1A 1CGTA 4GI9A 3C2VA 1JQXA 2ZXBA 3CS2A 3GU9A 5F2LA 4GXMA 1R30A 5LHEA 1RBLA 3HV9A 4WQ6A 3CWNA 1UWTA 5C7VA 1H11A 2X30A 4PTXA 2QUNA 4GI6A 2YCLB 4TXEA 1OC6A 3BLOA 1L6YA 1U1JA 4H7CA 4XO6A 1GNXA 1TPDA 4Q32A 3GD6A 3WD3A 2QIWA 7TIMA 3CZLA 1PZ2A 2QUVA 3S5YA 4TMCA 1FCQA 4C1NA 3CIXA 3HTWA 2PDKA 3NM1A 1W1PA 1HP4A 4UTJA 3IK4A 1A3WA 1YNYA 1W8SA 1M7OA 4P61A 2D20A 3B8IA 1VBRA 3LRLA 2W62A 2VEPA 4NKCA 4QRNA 2KAUC 4NHVA 3VZZA 4WKHA 4Q7BA 2P8CA 1P4CA 3WDHA 3CUJA 4NAFA 3R12A 5F1UA 2OLSA 4PSRA 1MQPA 3AAMA 5AVHA 1VJIA 5EFDA 5LA2A 4M6PA 3W2UA 2ASHA 5A94A 2PWFA 4FS9A 4O1FA 5I09A 2XN0A 3H12A 2A3CA 3GNOA 4O54A 3V4BA 1ZBVA 5I3KA 4GZ7A 3UXIA 2XWDA 1JPKA 1IZJA 3A4AA 3AXKA 4U31A 1SO3A 2FMOA 2NW0A 3MKVA 4CNSA 4O17A 4KWVA 4LFYA 3IGUA 1AJ0A 4CGTA 3OIXA 1PZ3A 1Y65A 4RZ4A 2P5NA 3EGJA 3QC0A 4EWJA 1GYMA 3QLDA 3QN3A 2WVUA 1CTNA 2GDQA 4EACA 1XRFA 2PDMA 3VDHA 2BHUA 4TQTA 3NXLA 2QDDA 4MLRA 1Q6DA 4H6QA 4LH8A 3WKZA 2NWSA 4Z08A 1XQLA 2XIOA 4DWSC 4EXQA 2WZIA 3EXRA 2WKJA 3V1HA 1KLZA 3LHVA 5CZSA 3FV9A 5F4WA 2VC5A 3TC3A 3PFMA 2XH4A 4S3AA 3U4FA 1IR2A 1EF2A 3OYZA 4HMEA 4AQLA 1KCZA 3PG9A 2X1UA 3T8LA 2HVOA 4PGLA 4A05A 3VD7A 4M3PA 2BHYA 1LL6A 2YCEA 3BQ5A 1JZ2A 2P50A 1W3NA 2BX7A 5CPOA 3LSCA 2CFFA 1RPXA 3KS6A 2H6RA 2E4TA 1PXGA 1AW1A 1FA2A 2E68A 2Z1KA 3K30A 4F0SA 5EU9A 2Q8LA 1M04A 1FKXA 3PFRA 4D8LA 4D6JA 1G94A 1GOOA 5AKQA 4ATLA 4O0QA 3CK5A 1LDCA 4LPCA 3WEMA 4PMVA 1TG7A 4CKQA 3EOEA 5D30A 2ZZ3A 4XZ9A 3RILA 1DORA 1U2YA 3UG4A 4EOUA 3GG7A 2QJJA 1V93A 2CNCA 3WD0A 5JBDA 3NQMA 4UTFA 2BWGA 1EEPA 3GU2A 3BTNA 4WJ8A 3ZJKA 3K5XA 1G1YA 1RUSA 2IKHA 2Q01A 1M41A 2ZZ6A 3EWZA 2I16A 3NQBA 2YR1A 4JTSA 1NTHA 1BTMA 4HA0A 4WDWA 4DIAA 2R1KA 1K4GA 3M16A 1Q6CA 3TR2A 5FF0A 4F9JA 4IP7A 2AL1A 2GZXA 4PCSA 3WSUA 4N2YA 1GVSA 3BLLA 1FHVA 1XYMA 4IIGA 2GSEA 1H7RA 4AZIA 1O94A 3NO5A 3W82A 3LHUA 2NVCA 5D2WA 3UPBA 3BCJA 1D3GA 2SFPA 2C0HA 4KCVA 1FWIC 2BSLA 3JRKA 1XBVA 1IIHA 8CGTA 2YSWA 4ZB5A 2VT0A 3R58A 3EZ4A 1MI3A 3C2YA 1LJYA 4HPNA 2ZUTA 5AHNA 4H9TA 4IMFA 1DVJA 1KNWA 2A7NA 2C6QA 4K68A 1KM5A 3KLKA 3KW3A 3SIMA 3CAQA 2DIEA 3WD1A 3FYPA 3OHMB 3UWWA 2DJXA 3DCPA 3SGUA 4JIHA 3N73A 3FOKA 4C6EA 3MVTA 1VPQA 2ZE3A 4CVWA 3LPPA 4CEUC 3JW7A 4LU0A 5HJXA 1FFQA 3UXLA 1XRVA 1US0A 4M7TA 1QK0A 1S3TC 4H7VA 1H7NA 2INFA 2Z2UA 4ZO7A 5A6SA 3SN0A 3IRDA 2J62A 3A3XA 4CN4A 1XHGA 2X1SA 2REQA 1D3HA 3E2RA 3HFYA 4JX6A 1EDGA 2GGIA 3R7MA 1SR9A 3AMGA 5DXXA 7A3HA 3SY5A 1XRTA 4A8NA 1OFPA 3GKAA 1LG1A 1X6LA 3GC5A 4U10A 3A47A 4CU7A 3VOGA 1WV2A 1JDFA 3FX4A 2MUCA 1JXKA 1JFXA 3WFAA 1I2PA 1RH9A 3FIGA 1UKPA 2HXUA 4LC6A 1I0BA 4QSHA 3NL5A 3TXZA 3LV6A 3P8JA 1WKDA 2GUBA 3DENA 5D8WA 3WBWA 3S5NA 1XYFA 1EQCA 1W2PA 1WZAA 3RR1A 1UP3A 2PRHA 5KTLA 3N12A 1XKJA 2E09A 3HQNA 1W2VA 1VR6A 3KCJA 2W63A 3SJ3A 1VS1A 1TPFA 4DF1A 3NZPA 1J5SA 1V02E 4GG9A 4CQBA 4Z1CA 4XAZA 2FZ9A 1EX1A 2YCIX 2VTFA 3BJSA 2ZE0A 3NQFA 1Q7ZA 5C0QA 1HX0A 1UA7A 2NV9A 2WSPA 4ZTYA 1NEYA 3KBNA 1I8JA 2NQLA 2WMJA 2E28A 4WOQA 3WNLA 1W9XA 1E0XA 3WELA 1XICA 4QG9A 1GJPA 4TR9A 3C2OA 2W6RA 3UWEA 2RH9A 3KCLA 4G1NA 4L4LA 3EOLA 3S6OA 1JPHA 1JYWA 1GVRA 1RALA 3OBKA 1W17A 5A6AA 2Y62A 3O0FA 1OFEA 4GYPC 4GO8A 3VNYA 4QX4A 1LRNA 3M4HA 1MNSA 1XLGA 2PDFA 2RUSA 3EB2A 1V6YA 1J0KA 3WF4A 3FSUA 2F6XA 4L9XA 2WKGA 2PWEA 1PIFA 2OJPA 3IGHX 3CHEA 3GDRA 1GOIA 2QUUA 4C5ZA 1SZEA 3TK7A 1G6CA 2J7EA 2HROA 4KCUA 3LSBA 3L23A 1XIHA 1DE6A 5FF4A 4M5PA 2YL5A 3BQ6A 3R79A 1IEQA 5DRIA 3WDJA 1X7IA 4RE2A 1ISWA 1Q7MA 3VOFA 2XG9A 3C8FA 4GBDA 1ADDA 1AZ1A 1GHSA 4O8AA 3SIZA 3VZYA 3S1VA 2WSRA 4Q8OA 1AW5A 1F3XA 3WH7A 2VMFA 3RO8A 3R11A 4NNBA 1JDDA 5C2XA 3GR4A 1VHCA 2POZA 1FKWA 1GKRA 1W9VA 2I14A 4C1KA 4QSFA 1MXSA 2JGQA 4G2DA 2QNEA 3MSDA 1AVAA 4H6EA 4AZCA 4O13A 2QT3A 4Q8MA 2QZRA 4HU8A 5I03A 1B9ZA 3CLWA 1CGYA 4ERIA 1H7PA 1B1YA 2DFAA 1DQXA 4K7VA 1QU4A 4PUMA 5I77A 1CGVA 5CXPA 6XIAA 3T6CA 3W1UA 3SCWA 2PTYA 1T8QA 3EX6A 3ZVHA 4OE7A 2XGBA 1O95A 1G7VA 1W1YA 4PULA 3GH5A 4QG8A 1D7KA 1EC9A 2PUZA 1XLBA 3DGRA 4X61A 3RU6A 3IIZA 4MVAA 4RE4A 3M9YA 3HPXA 1YDOA 3WLOA 1JDAA 2OTDA 1TSIA 1TCDA 1A5CA 1NWUA 3BWWA 3EEGA 4JYFA 4IG2A 4R27A 1Q6QA 1Q2SA 4TX8A 3TC6A 2PF0A 3N6HA 3QTGA 1A5UA 4I9TA 4O11A 1T41A 3TC7A 4DB7A 1KM3A 3UCQA 2PZNA 3DERA 3RYSA 1E15A 1QT1A 1TO3A 2A3EA 2PP0A 3KXQA 4DY1A 4KGLA 2A79A 2PDIA 3VMOA 1XUUA 2V2CA 5CG7A 2E40A 2WMKA 2PLCA 3GWQA 5ABGA 1ICPA 1E4IA 4AAJA 1HJSA 3II1A 1JCXA 3RX2A 3UPMA 1NDZA 1UIOA 1E51A 3MCNA 1U5HA 1XFCA 4HNOA 3RITA 4I7VA 3NG3A 3Q2DA 8XIAA 3GDTA 3TONA 3W26A 3A22A 2ALRA 1KTCA 5G4HC 3BOFA 1Q4WA 4UUIA 4DUWA 4U4MA 4X3ZA 3OHIA 2A3LA 4MJ4A 4KERA 1TPWA 1YNQA 5HJYA 5B7ZA 2QCGA 1YRRA 3GLCA 4XBJA 1A3HA 3ZJ8A 4ADUA 2UV8G 2XPKA 5A6TC 4N6FA 4H2CA 3AUOA 4L61A 2C18A 4J3VA 3W86A 1OHLA 2FPYA 2A1YA 4B16A 4IPLA 4AXNA 1CXKA 4IMEA 6A3HA 2ZDRA 2LLEA 3SCNA 1M7PA 3CU2A 2V3EA 1A4MA 2VI0A 2Y1HA 3DG7A 4O15A 5FJUA 4AEFA 3CXOA 3M6DA 1LOLA 3EB3A 4GGHA 3EMCA 1PIIA 4DWSB 1CLXA 4N9DA 5I3JA 2RJHA 4ZQCA 2H90A 2Q09A 4ZSUA 4J28A 1GJUA 4K1WA 3MB9A 2WPGA 2HRWA 4KPLA 4V28A 4ZENA 1YTEA 3S2LA 2EPKX 1R8LA 2Y24A 4C6LA 1XL9A 1ICQA 4QNEA 3XINA 3JZEA 2UBPC 3PSVA 5CQ1A 2C15A 2OWWA 1IXOA 3SFKA 5HNTA 1WPCA 3S2MA 2Q8ZA 4J9JA 5B80A 4MIMA 2ISFA 5HQEA 5A6LA 4DBUA 3KTXA 1V79A 2DT0A 1EQPA 1KTNA 1VYPX 4PMXA 1L6SA 5E93A 4LUJA 5LYRA 3L5LA 2F7FA 5EMKA 4RNIA 1XLLA 1J10A 1KR0A 3U9IA 4LQ1A 4NG3A 3SCRA 2UY2A 2V3FA 4GXWA 1JFHA 3U2EA 3P0XA 4ONVA 2CKRA 1JXJA 3OZYA 1H0IA 4GXPA 3U48A 1NOWA 3BZJA 1GQIA 2HCVA 1OD8A 4F48A 3AXIA 2FKPA 2B7PA 3PUEA 3CBWA 3RRAA 5HMSA 5BOEA 2DZVA 3S8HA 1IIGA 2OKTA 5HMFA 3PY2A 3AIVA 1PV8A 5EY5A 3N15A 3SN4A 3VC5A 3POCA 3AIWA 1C9WA 3QQ1A 1GORA 3L66A 4AUBA 4QDWA 3BLDA 4L64A 1W0MA 4V27A 2UZ9A 3T7VA 4HPXA 4WDTA 3MUCA 4Z1YA 3T0CA 1B54A 4CD5A 4V1YA 1A0CA 1NJJA 4IM4A 5FD0A 3VC6A 3UYCA 2GOUA 1FWJC 2DUXA 4RX0A 1CB2A 3W02A 1LL4A 3CZGA 4WKAA 4NZ5A 2X40A 2XFWA 3RCNA 2O56A 3VI2A 2J79A 1DQUA 3S2NA 1UZDA 2HBXA 1C8VA 2A3AA 5ABFA 2UY5A 1VFMA 1EJVC 1SFSA 4IUGA 5BROA 2BBFA 1M6JA 1ONWA 1M03A 4JQ4A 2NVDA 2NZLA 2OSYA 4Q33A 4R7JA 4JR5A 4YWIA 3I3BA 1Q6OA 4UMCA 2WZTA 5AY7A 1EJUC 5DFAA 3VGGA 3PBGA 2ZTKA 1K6AA 1WAWA 3GQYA 1E4NA 4PBFA 2Y8VA 1UW9A 4MWAE 3TZNA 5GJNA 4GUHA 3W72A 4FSAA 4AG0A 5FF3A 1V8EA 3W7IA 5IHRA 3NO3A 1QVBA 5E0KA 3UYIA 3OZMA 4XAPA 4H9XA 3VDGA 4TU1A 1XD1A 2DH3A 3QPZA 4O16A 3RCMA 4W85A 3SRDA 4DJFC 3EOOA 2WC7A 2YL6A 4NJJA 5HWNA 4DRSA 3HGRA 4BKNA 1UR4A 1K6WA 4NZ4A 3MDUA 1BYDA 1RCXB 3AIRA 2J7DA 2WMFA 4A21A 1Z8AA 2I1OA 1F6YA 3SJNA 4B2DD 3VKDA 1VF8A 1LLWA 1QPOA 2IS7A 3CZ8A 4QISA 1QUMA 4IGSA 3T08A 3CB8A 1EJTC 1WX0A 3LXCA 3WNPA 1TX2A 1M68A 3C61A 2WLZA 3URQA 2E8YA 4YNGA 5BRQA 1XF0A 2J9XA 1R6WA 5FJPA 2QF8A 2WNZA 4MNJA 5CGQA 1XLMA 1N8FA 3H2OA 3K8LA 4I8YA 1NQKA 3L21A 4Q4MA 2YBVA 4QQ3A 4PA8A 3OQEA 1B4KA 3RNDA 1I1WA 3TN4A 3CQIA 4ZOCA 3U0HA 3GDBA 4ERGA 2J24A 2X1TA 4HU3A 3TQKA 3ME3A 4GH3A 3MTWA 1XIJA 1OFBA 3RR4A 1EHNA 5A2CA 1VZWA 4H9UA 3T05A 2XISA 3LY0A 4C6OA 3SEPA 1YBQA 3TUUA 3AXXA 3NQ2A 4H2HA 4E8DA 1DEDA 1KQYA 4L56A 3I6EA 3OPSA 2OGYA 1XGEA 5AHMA 3IJ6A 4R88A 1L0PA 1KR1A 2BXZA 1YQ2A 1F4AA 3RPMA 3VZXA 3NQDA 3E12A 3UVIA 3TJXA 5D2VA 4ZFCA 2E25A 2VWTA 1AL8A 2D22A 3W37A 4DZAA 3ZSTA 3IJ9A 4KWWA 3A21A 1KLYA 4NAFB 1X96A 3GHTA 3CH0A 3O2LA 3LHYA 3QV7A 4GOAA 1NF0A 3ZR6A 4GJ1A 4XD6A 3FJ4A 3GXDA 4HD5A 4GIYA 1Q2RA 1PO9A 1H5YA 4IT1A 2V82A 4GUGA 5CPLA 1KFLA 5FEWA 2C91A 2CLKA 1TWDA 3ZR4A 3GXFA 2W4XA 5EMUA 4P7RA 1MO0A 1EC8A 4E3VA 4UB9A 3RUBL 2EPNA 1VJSA 1X6NA 4Y90A 4E4FA 5J04A 3VD9A 1X1OA 2VEMA 5E1QA 2Y8KA 2QCHA 4D2JA 1K03A 2AL2A 3GC2A 2AMXA 4E2OA 2OG9A 2GGJA 3TE9A 1DBTA 3H7VA 3K46A 1MRAA 3WMCA 1IEXA 3VUSA 1XYCA 2J8TA 1J6PA 2NQHA 3CUXA 3W01A 5GJPA 1E6ZA 3CGTA 1FFRA 4XVEA 2VYOA 4QLKA 5IFPA 1XYZA 3V35A 1OFRA 2HVNA 2GVGA 3P3BA 3W25A 3WMBA 1KQZA 4Q7IA 4ZEPA 2CZDA 1RJPA 2VUYA 2HK1A 7ENLA 4IWWA 2OQLA 1JAKA 5C9RA 1XWYA 1UJPA 2OZ0A 5HWMA 3KLLA 5A6BD 1QOPA 2F9RA 3W7QA 3PAJA 1NDVA 4M56A 1TE6A 4ROQA 2CZ5A 3W74A 4UBPC 3B8DA 4HA3A 4ZE4A 5FL1A 2VL4A 4PBGA 1VH7A 4G6CA 3VCRA 2E1DA 4DI9A 4Y9PA 1UWSA 1R86A 3KDNA 3CPGA 3VE7A 2G4FA 3Q37A 2P0IA 5GNZA 4MG4A 5KZ6A 3BLKA 3U7VA 3HG5A 1Q63A 2WSQA 3FVDA 3WLPA 3HG2A 1S5VA 3CL6A 1QNVA 1FCVA 5G2IA 3S2JA 2YA0A 4CNOA 3T4WA 1QHZA 2PDCA 4MNMA 3W76A 3G0SA 3CYVA 1R3YA 2WC4A 3MO7A 4GY7A 5D32A 1UH2A 3RJYA 2ZDSA 2DSKA 4TX9A 4DPPA 4C6DA 3RU8X 4DO7A 1YIXA 3GW3A 3M64A 3RHGA 1SJDA 1TZ7A 3FJ6A 1H49A 3TROA 2VRQA 2BVYA 1KM6A 2J25A 1TWIA 4W93A 4BEUA 1JUEA 4CNUA 3T8QA 3WLSA 3PTMA 5H8UA 3LQGA 4WZHA 3DZ1A 1OZQA 3KP0A 2P3EA 3AIEA 2ESCA 4E3TA 2QCFA 4C1LA 4LUSA 2MNRA 1TREA 1G7UA 4JFTA 1U30A 3PUOA 1XIGA 2QHAA 1K7FA 4N4QA 3LGGA 2QPSA 2G37A 4EX4A 4NZ3A 1CGWA 1J18A 4DJDD 1H7OA 4DJDA 4FP1A 2CWNA 4JTEA 4D6IA 4UTKA 3E1F1 3L2MA 1ZQ5A 1W3KA 1C92A 2A0NA 3GH7A 2OT1A 1QNQA 3B0VC 1J93A 4JZ5A 4IG2B 4W87A 1X38A 2QVHA 3G3DA 3ITGA 2YDQA 1M3UA 4I7WA 3BMVA 3G1XA 2PWGA 3E2QA 1C8XA 1E6RA 4XVDA 2XIIA 5DX7A 4OQVA 4A2SA 3K8KA 1E1EA 1OM0A 4ZTXA 1YE6A 4DO4A 4CU6A 3GM8A 1UC4A 1PL9A 1XCXA 3B8TA 4S3CA 1ECQA 5BXRA 4GI8A 3FKRA 1TPEA 4MFDA 4PUDA 1PS9A 1S2AA 1E56A 1KFEA 3ZMRA 2ISVA 4I6KA 1R3VA 5I2UA 4W7VA 4JN6A 1ADSA 1UD4A 4B91A 4LNCA 4HHMA 2V0TA 1YKWA 1XP3A 5JMUA 1US2A 6CGTA 4IPIA 4RZ5A 1ISVA 1NARA 3NDZA 3ATZA 2CHOA 3ALFA 3OGRA 4HIBA 3RO6A 3CYJA 1ZSXA 4LF1A 4MJZA 2JK2A 4IMDA 4C6IA 2F2HA 3N29A 3LDVA 4WR3A 4A2RA 3VO0A 5IOBA 3N4AA 4Z17A 4H04A 1C9DA 3C3UA 3LZ3A 3N13A 2WVVA 2JBMA 4D9PA 4HSOA 2ADAA 2HV5A 2W92A 1Z9AA 2Y0FA 1X39A 2QCMA 5AYXA 1ITXA 4L1XA 2GDUA 5DMYA 1RJRA 4HCDA 4O1AA 2X05A 1F8IA 4JQ2A 4MDOA 1E40A 1C91A 4Z42C 4M8UA 1CB7B 1RV8A 2J4GA 1RA0A 2BP1A 3N25A 1LYXA 1G01A 3A5VA 3UA3A 2AQVA 2QJIA 3EDDA 1Y8BA 2OT0A 3RLHA 4LYPA 1UQZA 4NXSA 5G4EA 1THFD 1OK4A 2PDWA 3Q45A 1T8XA 4XUYA 3NQ6A 2UY4A 4ML9A 3W9ZA 5HQMA 1QI0A 1V0NA 4V1XA 1MZRA 1VFHA 3DFQA 4MZ8A 4LAUA 3WLJA 4PL1A 1TV3A 1WOBA 3BURA 3HOJA 1VAHA 1X7FA 4HOWA 3OZOA 4DJED 1GW9A 3AIUA 4C90A 4ROPA 3STPA 3HBLA 2GYIA 3GSMA 1FWHC 3DYPA 4XZBA 3SURA 1SZFA 4OKDA 4NRSA 1AG1O 3SUWA 1A0EA 3DI0A 1EO5A 5D04C 4S23A 1DWAM 2XSAA 4I6VA 2XHYA 4M6UA 5CPMA 1PZ0A 1TVLA 3THUA 1SZGA 4XSLA 2Z24A 3LCIA 3EXSA 4W4QA 1TV5A 3E0VA 3F2CA 4P7QA 4QROA 4GJIA 1VRXA 3L0GA 4CD6A 4KWSA 3ERPA 5H6HA 2NQ9A 1T6MA 1DJZA 2EPLX 2Z25A 2ZTJA 3O05A 1D3CA 1RBOB 2PDLA 3CQKA 2WCSA 1IXNA 4UQCA 4JICA 3W70A 3R8HA 3RM4A 3EOSA 2PDBA 1F3EA 4BFAA 2YLAA 4FX6M 3YPIA 4LBUA 3NUKA 4HZ8A 2OSWA 3CQ0A 4YIWA 3WLQA 3U57A 2V3GA 3G24A 3QHOA 3UZWA 4JL1A 4KMQA 4HN4A 4W84A 3OVGA 4H19A 3B8SA 3R13A 3UBPC 1FWCC 5H8PA 1YXYA 1UROA 4LYKA 2D2OA 3DH7A 4JCMA 4QDMA 5EMMA 3H2EA 2DEPA 3WJWA 2AQOA 3UJSA 3VIFA 4XQ6A 4HB7A 5D33A 3QPYA 3FCPA 1QW7A 3GXNA 1C8QA 3URNA 2G4JA 3TVAA 4NXKA 4KFPA 3RX3A 4NRRA 2G3MA 4NT0A 1REQA 3UY8A 3LMZA 4K8EA 4WSJA 2OO6A 1VFOA 2VZVA 3PNZA 1E1CA 2XSBA 3QZ6A 1OG0A 1WKEA 4MOZA 4AIOA 4X0NA 7XIMA 3KWSA 5K3VA 1PPIA 1K77A 1CEOA 4JQAA 2R1PA 2J77A 1Q3NA 4HVXA 3SQSA 2OWXA 1CGXA 3W6MA 1PDZA 2TMDA 3BOLA 2YW3A 3WQCA 3TYZA 4YU1A 1KCKA 2GJLA 1DTUA 3H4GA 4AH7A 2VOMA 4K6AA 1V6TA 2HPIA 3CTLA 2R1MA 5CG0A 4X22A 3BAWA 3W6LA 1JAEA 1K7XA 2I56A 4IIHA 2YCJA 5C71A 5CEWA 1SVDA 5DCEA 2VVNA 3I65A 2W61A 1GYNA 2R1LA 5AYZA 4IISA 4OECA 4DJDC 2A3BA 1Y5XA 2J7FA 1P43A 1WXJA 1VEMA 4ZL1A 2GGEA 4ZR8A 3CAVA 2QCEA 4GJJA 3V1PA 1IWBA 1XISA 4TVDA 4AIBA 4NVTA 4F0LA 3V75A 4GY0A 3UR5A 4IQDA 3MUIA 4PR4A 1RSCA 3EWCA 2VR4A 3SCTA 1LORA 4B3KA 4PTMA 3QGVA 3LD5A 3TMQA 1ISYA 2WCGA 3MVIA 1MUCA 2EKCA 5FF2A 3OBAA 2W0UA 1BWLA 5ABFB 2H9AA 3VX1A 2D0HA 1ME8A 1OCBA 4RV8A 1FRBA 1SMDA 1KD0A 2ZUSA 2HDJA 4ENLA 1S5TA 3K13A 3WK0A 3GO2A 5T26A 4W5ZA 2PTXA 3S5OA 4D6GA 4JTAA 3T09A 3UXDA 4W8BA 4Q3MA 5CBIA 3BAYA 4UIOA 1KRCC 4DNMA 3W27A 3RN6A 3WQDA 3H8AA 3HQ1A 3MZNA 2PDQA 1B90A 2XVLA 2VP8A 1JRBA 3GFZA 4R33A 4FLSA 3PB0A 5I79A 3PBMA 1JNEA 3PC0A 1PHWA 1TZ9A 4YPJA 3KCOA 4LJ3A 3WD4A 4JXCA 3VIHA 1BF2A 4GVFA 2IPJA 1ZU8A 2ZRWA 3WQGA 4HU0A 3L67A 3H4WA 3LX9A 1TZZA 3EWXA 3E0LA 4LRTA 1KBIA 1O1ZA 1RVKA 1V03A 1Z42A 5AB3A 3WH5A 2XVPA 4YN5A 5HAOA 3UXAA 2ZADA 4UQBA 3EB4A 5LXXA 4IFKB 4ORIA 5IDIA 1IT0A 1RPKA 3VX0A 1OFQA 3IANA 3AHTA 3EKGA 2ICSA 2ZZ7A 2PWVA 4LCSA 4IQEA 4HMDA 1GZGA 2AAAA 3T0TA 3DEQA 1KRMA 3VA8A 1DQWA 4FF7A 4PRWA 2HPMA 4UR8A 2P3ZA 4HHLA 4OU1A 3V7PA 4XBKA 1C3FA 1DWGM 1ZY9A 2V67A 2ZUNA 1YHTA 5TNVA 1AJZA 4HSNA 3MT1A 4N02A 1BKSA 1DJNA 5LIWX 3PWGA 3PAOA 1TRIA 4DLFA 1W91A 4O57A 4GBUA 1K9FA 1IT7A 1JZ3A 4E8GA 3WLTA 3W1MA 4PUEA 1KRAC 4IH3A 4GIRA 1JZ4A 1VHNA 1V3JA 3AHXA 3WUGA 4M19A 2CLPA 4IHCA 4XD5A 2DVUA 4LVDA 1I6NA 2WBKA 1V77A 1K3UA 4Y9OA 1RBAA 4N6EA 1GK8A 7CGTA 1LBFA 1M7JA 4WSHA 2HMCA 3W0KA 2Y8UA 2VGGA 4EF9A 4B5XA 4QHRA 2E6DA 2IUZA 2VC7A 2YIHA 5EKYA 3W75A 1A5SA 4QGCA 4FAMA 4CQ8A 3S5SA 3W7RA 3LNMA 2J9YA 3PPHA 5JH1A 3W6YA 2EKGA 2JGYA 1HNYA 2ZUVA 1UB3A 4O52A 1X1ZA 2Z28A 3ATYA 3ZSSA 3CO4A 3OOQA 5J8LA 1JPIA 3AHZA 2E67A 3NYDA 2AL2B 3UERA 6ALDA 2EPOA 2RAGA 4AC7C 4LUSB 3KS5A 4IP5A 3NQGA 1GVFA 4U3CA 4D6EA 3C0LA 3KBWA 2GL5A 1W31A 4R7OA 1S2VA 1W5NA 3MUAA 2EG7A 2VGBA 4OV4A 3ITXA 3EAUA 9CGTA 2IKGA 4C6FA 2G96A 2RDXA 4IQLA 3EWUA 1C7SA 5T91A 4FIRA 3ARTA 4UTTA 1BVWA 4H7ZA 3NQ7A 5JXQA 5HR7A 3G5EA 3GDLA 3FS2A 1DIOA 1UH4A 8A3HA 1HUVA 4IL0A 4NI8A 3GZAA 3LOTA 4IUOA 2DSWA 3WLHA 2TRSA 1FQ0A 3VE9A 3M5XA 1HJQA 3F4NA 4ZZ9A 5C70A 4PTDA 4C7DA 2YB1A 3IIVA 3LPGA 4LRSA 2Y5SA 2WK2A 3OYXA 4H8UA 1F3WA 5DQPA 1L8PA 1J0ZA 2NSOA 4Q6JA 1E5NA 1UR3M 4KETA 3QV8A 4DEFA 4MKNA 4E38A 3PF3A 1JRCA 4WSKA 4JIEA 4GX9A 1ZHAA 5ABTA 2F61A 2XH2A 2INEA 3KZSA 3FJNA 1FTXA 3NQVA 1PWLA 2DT3A 5G1MA 4Q6XA 1MW1A 1J2WA 2VX6A 4MY9A 3NOYA 1BSIA 4YVVA 5CC7A 1C29A 3QQWA 4H01A 1XYAA 2A3HA 4S3JA 1TWSA 2QMJA 3KL5A 5E5CA 3G18A 1E9ZB 1T99A 1TJ0A 5JBEA 2Y7DA 2J75A 1BHGA 3NPWA 1OC5A 1R46A 1OINA 1BG9A 1ZJIA 4I3GA 2YPIA 1F7BA 1HVXA 4QQUA 3XIMA 1VEOA 3AMDA 3CJPA 4Q8QA 1ZJBA 1UMLA 5AECA 1FH7A 4N9BA 2B7QA 3UNTA 5JU6A 3M0ZA 2DJLA 2XN1A 3O6AA 4LF2A 4X9YA 1CBGA 1BVZA 3TQPA 5EMYA 1TMQA 4IFRA 1W8GA 5G5IA 2DSUA 3K4DA 1EGMA 4GFSA 2VFDA 2OKOA 2WNWA 4ZXLA 1UR8A 1V6VA 3UWYA 4Z2IA 1WUFA 4O8RA 1D8WA 4KBXA 5AHEA 3IJDA 1P0DA 5A6BA 3WFLA 4AVFA 2C13A 4RZBA 1GCYA 2GOKA 1VRDA 4TV5A 4EK7A 4YVPA 3CUGA 2DSZA 1XCFA 3KM8A 3ITLA 4B3ZA 4HYWA 1TTIA 2NX3A 1AD4A 1KFJA 1OADA 4HNUA 1O60A 1X8CA 4NYYA 3FXYA 4IL2A 5TF0A 5BMWA 3M0VA 5CJ5A 4HYRA 4W8AA 1NWSA 4LCQA 2BFGA 5AZ0A 3EKLA 1QR7A 2PEVA 3G1DA 3TCEA 4P8XA 4Q4OA 5FJIA 3RF9A 3S9YA 5DLCA 1RXOB 2RJGA 3WUEA 4Q4RA 4WDXA 1VEPA 4BWLC 1V08A 3W7MA 1FCUA 8RUCA 3SCSA 3H7RA 5EGRA 2PTDA 1KXQA 4S3BA 4C6PA 1DJIA 1O5XA 1JDCA 2QF7A 3EX1A 1QI3A 4KFNA 1TKKA 2I57A 5C9ZA 5CSRA 1F07A 2D3NA 3QYQA 4ACYA 4QBXA 1DWIM 2WKLA 3LXAA 2PODA 5AHIA 1JZ6A 3T42A 4GE8A 1O4UA 4O14A 1AA1B 4ICCX 1TWWA 3QV6A 5F1VA 1Q6LA 4TUFA 1WP6A 3LGEA 1H63A 3W73A 4ICMA 4OIFA 3WQ5A 4PUUA 3QJAA 1H0GA 4S3EA 1FY6A 4LAKA 2RGMA 4ZOBA 3R94A 3CV7A 4H6RA 4DLMA 1ZP3A 4NASA 2X1IA 1NQ6A 4DJFA 1MQQA 1L6GA 3RLGA 3ITVA 1BD0A 3SN1A 5IFTA 3ITOA 1GGOA 1RAKA 3IVUA 4HPJA 4FLOA 4JNZA 4RLIA 5CLTA 2X16A 4K7YA 4L65A 1XH0A 2QXWA 3W1PA 3F7JA 5IXEA 2GJRA 5FOOA 2J9ZA 4ZGYA 3PVFA 4A3RA 3C86A 1VLIA 5HATA 1LL7A 4NSBA 1OX6A 3VNDA 2YKKA 4D6DA 4LS0A 2X1RA 1XLDA 3N2XA 3NQAA 4J3ZA 1JULA 1BG4A 5FSEC 1O5QA 1W32A 1EXBA 3RPTA 5D4YA 2BY0A 4NNCA 3OGSA 1P5BA 3QGAC 5DT7A 4ZVJA 3WIJA 5KZDA 2R82A 1E6SM 3DU0A 3KHDA 1KGWA 2WAGA 4XAFA 1EH9A 2ZRVA 1PX3A 5E6ZA 4A3UA 3VKJA 3BPWA 3MBFA 3N4EA 3PG8A 3LM3A 5XIMA 1PKYA 3TTSA 1DWHM 3B0UX 3IVSA 4A8IA 1QPRA 2EAWA 3L68A 4GHRA 3E9AA 3KAOA 4DZIA 2GVYA 3HPZA 1B30A 3B97A 2WQPA 3TSBA 3U5YA 1VENA 4Q8TA 1F5ZA 4ZQPA 3L9CA 1TPH1 1QPKA 2ZZ1A 4GKTA 2JE8A 3LLXA 3L5AA 3CHCA 4GVGA 2GK1A 1RK6A 2GUYA 4BA0A 2FFCA 5RUBA 1G67A 1TUFA 4JY8A 3GUWA 1XLAA 1YTKA 2QDEA 4B90A 2HVMA 3BW2A 3BJFA 5FACA 3GVVA 2Q3OA 4E4UA 4L1GA 3C5QA 2WHKA 5I3GA 3S6DA 3MHUA 2H3BA 3PZNA 5D02A 3LI0A 2HXTA 1XIIA 3ARXA 3R8GA 2E7FA 3W7EA 1RA5A 3P8IA 4IX2A 5MF5A 5D37A 3F2DA 1YMYA 3N14A 3KOYA 4PFMA 4F79A 4F9DA 3SECA 3JZUA 3PZUA 3OLDA 1ADOA 4E5TA 3ELFA 3ZLFA 1I75A 4K3ZA 3HN3A 2OEMA 2PGRA 2Z1WA 2EBNA 3MI2A 2AKZA 3NNTA 4JIIX 3K8MA 3B9DA 3OG2A 1TYGA 4YTTA 5ABEA 3UFYA 1TTQA 3N17A 3P5ZA 1AUSL 3W7NA 2PURA 2QIIA 3KBSA 2Q3RA 3N04A 1ZPTA 4OWGA 3VM5A 2ZXAA 3M1ZA 3FY1A 1TPVA 4AD3A 5FESA 5I23A 4C65A 3IAQA 1CI1A 3QQ0A 5A1AA 4UTWA 1UD3A 1DKWA 1XIDA 3T07A 3LGDA 4J2MA 4IJBA 3ZQ9A 1J0HA 4AISA 3S6TA 1G0CA 2BMBA 3FSTA 3NL3A 1SW0A 3ARRA 2A6NA 4L4OA 3EA1A 3NIYA 2WMHA 4ZQMA 2GQ8A 4E2BA 1XR2A 3GX9A 2VFEA 4ZO6A 5D9MA 1XH1A 3WY1A 4TVUA 1IGWA 2P88A 5KEZA 2VFIA 1QCWA 1MSSA 3VGHA 2PD5A 4FK9A 4YCPA 4LSBA 3RM9A 3TJ4A 3QYSA 2XM2A 2XFFA 3IAPA 3MWAA 3GVQA 1PVNA 3AZSA 2J8GA 4I8DA 3CUIA 1FWFC 1NWRA 4P7OA 5GVJA 5HA7A 5HNNA 4Y9MA 4PC8A 3HGJA 4CCCA 3GU1A 3TX9A 3W38A 3THCA 4B5NA 3QTPA 3TJLA 3WF1A 2PBGA 1KXHA 5AFDA 1IR1A 2NLIA 3UGRA 1OB0A 2V5CA 4KQNA 3KRBA 3VTRA 4DUXA 2E9BA 3R6IA 2GVJA 3N2MA 1T40A 1I2OA 4JIPA 3HGSA 4UMBA 1LUCA 5FA5A 1KM2A 4XAYA 4C5YA 1E3XA 5I3FA 3ZLGA 3E0IA 3R8RA 3EA2A 1MVYA 2G3JA 4C1NB 3NPVA 8TIMA 2Y6ZA 4O53A 1XDMA 1NOUA 1OX4A 9XIMA 2QLYA 1E3ZA 4UQEA 1MXGA 3NQ8A 4DZHA 1YXDA 4QJ5B 5IDZA 3E0WA 1XDJA 3I6TA 4FNRA 1U1UA 5FEXA 3W7DA 2ZIDA 2IPFA 4HHHA 1XLFA 1IYXA 5EBAA 2YL9A 5I24A 3BJTA 3BSMA 3GG8A 5FJRA 1EBGA 3GDKA 1F61A 3THAA 2DT1A 2J8FA 4AHOA 3HPAA 1DJYA 1P6WA 4MPKA 3IJIA 3PR2A 1K9EA 2V5LA 2DVTA 4Z2JA 1L6WA 4ADTA 1HO1A 4WVXA 4IMCA 4Z1BA 2DQWA 4ACZA 3I7RA 4H9YA 2E1WA 1NP2A 3VD3A 2BGNE 2OQYA 4EF8A 4Y96A 1S2WA 2QKFA 2FMNA 2V5DA 1I9CB 1TMLA 4Z0SA 1KFCA 2Z1BA 5EMLA 4PFHA 1IZCA 2BXVA 1IZKA 1V7AA 1HL9A 3GNRA 2Q6ZA 4UTWC 4CEXC 2JF7A 3I7SA 2YLLA 5BU9A 1WYIA 2ABBA 3FW6A 3EWDA 3UG8A 3EXTA 2PZ0A 3BW3A 4QITA 3V5FA 1E9LA 1D2KA 3FYOA 3BV7A 2WJEA 1W5PA 1Q8JA 4H9VA 2P8BA 3E49A 1VFLA 4FO4A 1QPNA 3CV6A 2P53A 1SYTA 3LERA 3C2RA 5A6KA 1YXCA 1LLOA 4AWUA 4XB3A 3E38A 1OABA 6REQB 3SAZA 1FBAA 1ZZMA 1TPC1 4ILSA 3CUFA 1K8ZA 1XXXA 4FLQA 1B3ZA 2W27A 1R85A 1HG3A 1SJBA 4H3DA 1LQAA 3M5YA 5DMMA 4WGHA 4JGDA 4BF7A 2J7GA 2ZX8A 2YZ5A 3ES7A 5ECVA 1RQHA 2YB4A 5AHLA 5DBTA 4KRUA 5JUVA 4GI4A 5E0CA 3GXIA 3OA3A 4JAWA 4GUFA 5F2IA 4MYAA 4FNSA 2OYKA 1XG4A 3TQVA 3W24A 4CNPA 3IGSA 1R2TA 4IXXA 3V5CA 3TTQA 2ZX5A 3HO8A 1J4EA 1TTPA 3ARUA 3TJIA 4QLJA 1YPFA 3EPOA 3DG6A 4JYEA 1SO4A 3DOPA 4MZ1A 2GSHA 4YYFA 4DZ5A 3B8WA 2O9RA 4AY1A 1SW7A 1Z89A 2QJMA 2IKIA 5FKYA 1AD1A 4IPNB 4LAOA 1U5JA 3GE7A 4AZGA 2VWSA 4J3TA 1EJXC 4FOJA 5CPNA 2VX4A 4DYKA 5DY3A 1GOXA 1R2RA 5HQLA 2FGLA 5AYYA 3W7JA 3PJXA 4RNJA 3D47A 2XVGA 4XK2A 3CZKA 2WYSA 2PDHA 3M5VA 1IWPA 4FX7A 4INFA 3TFXA 4C6JA 4NF7A 1FWBC 2E6FA 3UR7A 2EJAA 3O3RA 2A2IA 1ONRA 4KGJA 2C14A 3UP8A 1M9HA 1W3LA 3TEVA 3NOEA 4HQVA 1JCNA 3EWYA 3VYLA 2XZ7A 4UTHA 4JD4A 5LNRA 1V6WA 2GSJA 4KIRA 4LV4A 3TN3A 2XZ9A 1UMYA 5M1TA 3D3FA 3HGOA 1Q6RA 4GC4A 1J0IA 1O1HA 1AH3A 1QTWA 5I3DA 2ONEA 4B15A 4DUOA 3DC8A 3BLEA 3MUZ1 2ACSA 2FZDA 2J7HA 1VJZA 1R3QA 3MMUA 2G97A 3GTXA 2BV9A 1P6BA 1FXPA 1MWOA 3O9NA 4XKYA 3TKFA 4AIEA 4L6OA 4S2CA 3ZT6A 4ZQNA 2ZX9A 4TV6A 2Z6JA 2JKEA 3O07A 4FXSA 2FHCA 3ITYA 4ZE5A 2RFGA 4OBRA 2YZRA 4A6GA 1BWKA 1HJWA 1XPGA 2ISSA 4QM1A 1P0NA 1LUCB 1UD6A 4PEKA 1QI4A 3AUJA 1RCOB 4ES4A 2DH2A 4IF2A 2XVNA 4KS0A 3UJFA 1DV7A 1ZAIA 1OIFA 4LWWA 3TMLA 3KFTA 1QWGA 1EIXA 4ADSA 4PB4A 4CQ9A 3COTA 3A3WA 1W3HA 5EMJA 4GWEA 4LVGA 4ORMA 4P8WA 1W5OA 4W9TA 4HK5A 3WQ4A 1KO0A 3W7KA 2Z7GA 3FGCA 5A8QA 3NEHA 2PU1A 4X60A 3WQ8A 2JEPA 3T40A 2D1ZA 1QWKA 4JTUA 4RR4A 3UD6A 3F4CA 3H24A 2QDGA 4PCTA 4JTJA 1QO5A 3VABA 1LWIA 1RLCL 3W84A 2NSXA 4AY7A 3CO8A 4ALDA 1WBHA 1XINA 1OWQA 4GLEA 4Q8UA 3WLRA 2WQDA 1PYFA 2WHLA 1B57A 2ZWYA 3H23A 4Q7NA 4YHEA 3M6YA 1MFUA 1YW1A 4ECLA 5C54A 2VRKA 3T0DA 2PE4A 4Q8PA 3C0JA 1KFKA 2PDGA 4NAEA 1HKKA 4PSPA 5HNRA 2FDMA 5MKGB 1PTGA 3CQHA 3SCVA 3O8AA 3T44A 1JCTA 2ZX7A 3SQLA 5G1YA 3C8NA 1F2JA 1QOXA 4LNYA 2CLOA 2P1FA 5M2FX 1E5JA 3EDJA 2OYLA 4PUWA 1SFJA 1KFBA 6PTDA 4UCFA 3QSTA 1CIUA 3PWAA 3M0IA 3U7BA 1Y5VA 1D7FA 3QF0A 4JEQA 3S1UA 2EJ1A 1K4HA 5C9WA 2XINA 4O18A 4EE9A 1YBQB 3NR0A 3Q67A 3KVJA 1SSDA 1XJBA 4ML4A 2HEJA 2DUAA 3DKLA 2GJXB 1IV8A 3WD2A 2QQ6A 2CXEA 2Z1XA 3UGVA 4PRRA 2ZZ5A 3WH6A 5FJTA 3AZTA 1RLDA 2JFEX 4AIUA 1Y0EA 1RQBA 4BEQA 2D0FA 2QCCA 4MADA 5K4XA 1H2JA 2OB3A 4YTUA 3G0XA 1R3SA 1JYNA 3TOYA 1UR2A 3AYTA 1ODUA 3EWWA 2YCKX 2CLLA 4GO9A 3V5OA 4B9YA 4I9AA 1N82A 3CZEA 2PDPA 4JTGA 2XYLA 2BY1A 3G8RA 4L6DA 3CV2A 1UASA 3G1FA 3N2BA 2O92A 5LIUX 2NT1A 3N9RA 4MM1A 3PUDA 3WK3A 4IPJA 2RDTA 5AN7A 1QW8A 4DWSD 3WENA 4YJ5A 4LB3A 3UJRA 1W37A 3SCOA 2A4AA 4DJEC 1Z32X 3NZ1A 3KOXA 1E4MM 3T0BA 5CC6A 1CXLA 5DCBA 3C2FA 3ARPA 3GKFA 1PCWA 2J47A 5CZTA 2IQ0A 2G95A 3DBNA 3GTHA 3P60A 1WXYA 1B3VA 2FVMA 3LCGA 4RXFA 1Q6GA 2WSYA 3QY7A 4LW7A 3K1DA 1V7YA 3GVWA 2CZFA 5CZJA 1POKA 4MAVA 3W2KA 4HNVA 1O7AA 4HMNA 4OFCA 1UZHA 1T5AA 3RAOA 3VCCA 1E6NA 1GQKA 1HKMA 2ISDA 4HNCA 4PN2A 5HINA 3KX6A 3A3HA 2G5WA 2QS8A 1R7AA 5LZLA 4M6VA 3NL2A 2VCBA 3UVAA 2GK1B 1JZ7A 4YL2A 3WQVA 3GRIA 1AZ2A 1PKMA 1VCGA 1RJQA 4D8ZA 4JS3A 3ZM8A 3RDKA 2BVDA 4E4PA 3RX4A 3TU9A 3M0HA 1MYRA 1WQ5A 2IQDA 4B5UA 3M44A 1KV8A 3U3HA 3LTPA 3ABZA 2G41A 1QNPA 3OO2A 2WNQA 2E8ZA 1JCLA 3PM6A 2OR2A 1VB9A 3ZOAA 3E5BA 4GABA 3N18A 4L9YA 5AYIA 2HZGA 4HOZA 3GG0A 4Q22A 4S3KA 1TJ1A 3TP4A 1Y7VA 3GR7A 3W7PA 1LBMA 2QUMA 3HFTA 2BDQA 3HIJA 4JQ3A 4FOUA 3MV01 4POCA 4QAIA 4AZ6A 3E5PA 4WY0A 1VIWA 4BK9A 3C6CA 2XVKA 1Q6EA 2PU0A 3SFWA 1E4LA 3TWBA 3VOCA 1NFGA 3E6EA 3ZS4A 4XZWA 2B7NA 2FQIA 1DJXA 2B31A 1GJWA 1KXTA 1FUYA 3FAXA 3P5YA 4CCDA 3TOPA 3BGGA 2HNEA 4AMCA 3W1RA 4XG1A 3CL7A 3R2GA 3R4IA 1LT7A 4HU4A 4JHMA 5J5DA 3RMEA 1OX4B 4DJFD 3OIHA 3NAVA 1H62A 3H2MA 4GC3A 1YTDA 4RDZA 1GG1A 3W1LA 1VFFA 2ZUWA 1XM3A 5BXSA 2C8NA 1ODZA 5HWJA 2RDUA 1T7LA 3CUZA 3BCDA 3LHZA 2BZNA 2Z1SA 4RUBA 4D72A 2C1GA 1GZJA 3DFYA 2BOEX 4WDUA 2J7BA 1ZL1A 4AYGA 4FA3A 1HJUA 1Z69A 1LF1A 1W1IE 1TQJA 4EIVA 5ECUA 3TCSA 1WZMA 3WQPA 1VBGA 2PGEA 4DNHA 3VGEA 1EFZA 3HQOA 3INPA 1OEPA 3EEZA 2CZVA 1XBXA 1J0YA 4XKMA 1R38A 1J6OA 3NGFA 3PBUA 4BY3A 3QVQA 3D3AA 4NAEB 2G3NA 3LA4A 1PYMA 3BL3A 3PULA 2EO7A 3ZXWA 5BRPA 2BTMA 5AC8A 5DMNA 3ID7A 4B5VA 2PDNA 2PRMA 3SGZA 3GAKA 1AQ0A 3N3TA 3AMKA 4Z0JA 3T55A 3A4JA 2XWEA 5I5RA 2BVWA 1UD5A 4CU8A 2VXNA 1Q7QA 1YPXA 1TV2A 3QZAA 1E73M 4DUVA 1LP6A 4Z1DA 1MNZA 1AW2A 2FZBA 3LCFA 4GIAA 1LCOA 3OP2A 4S39A 3BMWA 1RY0A 3AIBA 4JOMA 1FDYA 3CPUA 3LEPA 2Y63A 1ZNNA 4FZIA 2GJXA 3IIPA 1EZWA 2DZSA 1QI2A 2JEQA 4FNTA 1TTJA 2NUYA 4AX6A 4O4VA 1UOKA 3WO8A 1EIBA 2VFGA 3KOZA 4LVBA 3LYEA 1B3OA 5K9DA 3V0TA 4WRHA 1MDLA 3H21A 4Q4KA 1GVIA 2CHRA 2FPTA 4W89A 1H60A 3RIKA 4NX0A 4LBSA 4B3LA 4UZSA 1EO7A 3CMJA 3E3HA 2VQUA 4QEHA 3K1GA 3KWXA 3UWVA 2F6KA 3AC0A 3KDOA 3DDMA 4UQAA 2FJKA 3AMLA 2PWUA 1FWRA 2ZCGA 2CKSA 3NL6A 1WZLA 2PF8A 1IQ8A 3F03K 3ZYZA 3HMJG 2D3LA 2UWFA 4HA1A 1VC4A 3WQ6A 1SR0A 4ZXOA 2VR5A 4HK7A 4A3YA 4US6A 5LGZA 1W9BM 2NV1A 2Y7EA 4TMBA 1WDWA 2OEKA 2HTMA 1K9TA 3FYYA 1LG2A 3ISIX 3M0YA 1ZAHA 3UT0A 3MS8A 3WBYA 2ATSA 4QJ3B 3OLIA 1HJXA 5FSDC 1CXEA 5HJLA 4AWTA 2VFFA 1SUXA 4HKPA 1JIBA 2PTZA 5K4ZA 2IXUA 4YTSA 4ZOEA 5A3HA 4L9ZA 1YADA 3CUHA 5EYWA 4AZ7A 4HN8A 3B0PA 3DAQA 2FTWA 2J27A 1ITCA 2ISWA 3LNPA 2ZZ4A 4S3DA 3K2GA 5CSUA 1VIZA 3PTKA 3VKBA 3AI0A 1EGVA 4HHPA 3WCZA 3ARWA 4HOXA 1GTEA 1IEVA 2GWGA 4BQ4A 1KW1A 5BRBA 1V3HA 3PP7A 3E02A 4LV9A 1OYAA 3BSGA 4N4PA 1V0LA 2EHHA 4U3AA 2CBIA 1ZGDA 3SZ8A 9XIAA 4XZMX 2CLEA 4DO6A 1EF3A 2ZXQA 5JIWA 3CHFA 2O55A 1YYAA 1K7EA 3SY8A 4IOTA 1V3LA 1DL3A 3L7RA 1W6TA 1XDLA 1QNSA 4OUIA 2RKXA 3AXMA 5FI8A 3AHYA 3MA8A 1G4SA 5HUPA 3VUPA 3MKCA 3QR3A 1TIMA 4FHAA 2QR6A 3VCNA 6XIMA 1F8MA 1NFPA 2HSAA 3RXZA 2ATMA 2JQXA 4LBRA 3VMNA 2Z29A 3N4FA 3F1QA 1XRSA 3VOJA 3LUTA 1XG3A 1XD0A 3GXMA 4ZSTA 4NX5A 3NM3A 3L4YA 3F4DA 1TFVA 2WHMA 3SRKA 1BXBA 1SM9A 3G2GA 1EA0A 1BKHA 1HFBA 2WSKA 1KB3A 3RK8A 3N19B 1AQMA 3AIQA 3W85A 5CPSA 1JG9A 1QFEA 5HK4A 2WBGA 2WB5A 3TV8A 1WB0A 4IJRA 2D2JA 1W1A1 2UY3A 4MB4A 1EDQA 3PZQA 1JI1A 3B03A 4MWAD 3NYZA 1R3WA 4KCTA 4MNKA 2QEZA 1VLWA 1QRQA 3CL8A 4JDYA 5KETA 4RXGA 4JFUA 1E0VA 3GNPA 3H55A 2B0MA 2YBTA 3JVAA 1J0JA 2CETA 2FIQA 2CPUA 3WH9A 4QP0A 3C4UA 1EP2A 3AWOA 2YA2A 3W2JA 3WNMA 1FCBA 1QBBA 2PP1A 3RM8A 4BWLA 4J2PA 1PHQA 1CZ1A 4J35A 3AZRA 4UQ9A 3P6LA 3WJXA 1M53A 5E6YA 4URIA 1Z6KA 2WZHA 3UY7A 3H2AA 2VELA 2V63A 2ZX6A 1Z44A 2DORA 5M5DA