2XFFA

Crystal structure of barley beta-amylase complexed with acarbose
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
486
structure length
486
Chain Sequence
NVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-AMYLASE
total genus 188
structure length 486
sequence length 486
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xffA00
2W66A 1G0CA 2YBUA 3GXFA 1BLIA 3RPMA 5ECUA 3U7BA 2OSYA 4H41A 1Y7VA 1JAEA 1JYXA 1GONA 3AXIA 2E9LA 2VVNA 2WKGA 3IJ7A 1U2YA 1C8YA 4AZHA 4AD1A 1KGXA 4EKJA 1HJWA 2WBGA 1GCYA 1MYRA 2ZWZA 5FOOA 1CXKA 6TAAA 2JALA 5I0DA 2J7CA 1CGVA 3CHDA 4AY1A 5A6KA 3M07A 4ZE5A 1MW3A 1CDGA 1TVPA 2WB5A 1V6VA 4P7NA 1UZ1A 2J79A 4W86A 4GO9A 1JYNA 2VZUA 4MPKA 2BXZA 3W29A 2WPGA 1FH8A 4Q7NA 2CEQA 4QDMA 3MSGA 3WL0A 2WHKA 3AS2A 1RD6A 4D6IA 4N42A 3PZ9A 5CLWA 2WSPA 5D9PA 1M03A 1WDRA 3FAXA 3WEZA 2J7EA 1GW1A 3AIVA 5ABGA 4AWEA 1W3JA 1CLVA 2VC9A 1NM9A 4MNJA 4MNMA 3WBEA 3BAIA 4PMYA 3QHNA 2JIEA 2WHLA 1R7OA 1J01A 1LL4A 1GOQA 1HIZA 3DYPA 4JIEA 3ARSA 1JIBA 1E15A 3L4YA 2J25A 1OCQA 3AISA 1LG1A 3BCFA 3SUSA 1B3WA 1BAGA 1UD6A 1C3FA 3GBEA 2DEPA 3MUZ1 2ZIDA 1OGBA 1U33A 3TTOA 4PUEA 4X9YA 3QR3A 3VUPA 2YDQA 3L4UA 3SCOA 3WNNA 5TD4A 3SCPA 1TA3B 1LL6A 2ZE0A 1ODZA 3AHTA 1CGXA 5I24A 1ESWA 5ABFB 2G41A 1HX0A 1KXTA 3AYRA 2J8GA 1DHKA 1R85A 2VJXA 4TUFA 4MAVA 2CXGA 3N9KA 4CUCA 5A3HA 1BYBA 3BC9A 2VZSA 3CIVA 1ISZA 2QHAA 4TTUA 2YBTA 2G3MA 1CBGA 4FK9A 2X05A 2D22A 2V3FA 1TR1A 3WUBA 1FP9A 2CBIA 3RIKA 5GNYA 3CZJA 2XFYA 5BRQA 2XVKA 3PZMA 1JAKA 1JXKA 1XCXA 3KWXA 1LJYA 1MXGA 5ABHA 3PHAA 2J62A 2UY4A 2E9BA 3GXIA 3ARYA 1KR0A 4TVDA 4P7RA 4JZ5A 4X0NA 1JXJA 1P6WA 2OYLA 5FIPA 1E4NA 3VIGA 4GPNA 4H04A 3PZIA 5I5RA 4U3AA 4GZEA 5GNZA 4CCDA 4S3JA 1NH6A 4GQRA 3T2OA 3VGDA 4U31A 3JUGA 1IT0A 4H2CA 3TONA 1FH7A 4WK9A 1G5AA 2W5FA 3CUGA 2YDRA 3VM5A 3OZOA 4F66A 4AC1X 1V0KA 3THCA 2WC7A 1J10A 2EBNA 4OJYA 2WMHA 3UCQA 4IUGA 3UG3A 4BQ2A 3O2LA 5IHSA 2WCAA 2XHYA 4IPLA 1KWGA 1J12A 4Z2LA 3SCUA 3VMPA 1LLOA 1EO7A 4TX6A 1JNEA 3WDJA 1XHGA 1QBBA 4D6GA 4FLSA 1J0JA 3TTQA 3WH9A 1RP8A 1NOUA 3VDCA 2NSXA 3SUUA 3N11A 4WKHA 1J0IA 1JD9A 2FHFA 4QAWA 1IZKA 1GNXA 3D5HA 5KEZA 4H7VA 1UWQA 2VO5A 3W81A 2WMGA 4GZJA 3WUEA 2WMFA 4PMDA 1E6QM 2ZUSA 1UWTA 1B9ZA 4GZIA 3AIBA 2WBKA 2BXYA 4PMUA 4UQ9A 4DWSC 3J7HA 3G6LA 3GBDA 3NIYA 3KEHA 3IAQA 4JL2A 2YA0A 5A2CA 1E70M 1FH9A 2DPEA 2J47A 1UD2A 1B2YA 1LQ0A 3WDRA 4DM2A 1EDGA 3AZTA 1JL8A 4XZBA 3GYCA 2XFFA 4W85A 1K9DA 2WC4A 5DT7A 1CENA 1I75A 1VEPA 1CIUA 5CPQA 4E2OA 4PMZA 1L0PA 4RE2A 2XFRA 1E0XA 2BY3A 2F8QA 3PZQA 3CGTA 2WXDM 1GOOA 1YHTA 1L8NA 2ZXQA 2W67A 2VT0A 3W6LA 4AEFA 2VRQA 1QNQA 4J3UA 1TUXA 2DSUA 4E4PA 3VMNA 1O7AA 2W62A 5EB8A 1JYWA 3T0BA 2X09A 1W1TA 2XVNA 5AYIA 3KE0A 3K8MA 4M82A 6CGTA 2BS9A 2WC3A 3RM8A 3MANA 1BG9A 4QCFA 1S46A 5BCAA 1V3IA 1FHLA 3WNKA 1AQHA 2ZX6A 1MW0A 4PEEA 2OSXA 3APGA 3VU2A 2PI6A 3VIKA 3MV11 4P7LA 1KXQA 1R86A 1DWFM 4ACZB 3VNZA 3PN8A 1E43A 1QBAA 4UFJA 3WF4A 4HU8A 4P8XA 1FFQA 3ARTA 1PAMA 4LXFA 3M46A 1XCWA 3AI0A 3OBAA 2Y5EA 1LF1A 5AC5A 4URIA 1BHGA 3TTSA 4D72A 2YJQA 4W5UA 2XVLA 3MKKA 1CWYA 1UWUA 4AZ5A 3MUY1 3SCRA 2A3EA 4JHZA 2ZX5A 2PBGA 5CSUA 2UY3A 2D3LA 4N0RA 3N1AA 5EFFA 1GQJA 4TOQA 2X0HA 3TP4A 3EDEA 4ACZA 3DECA 1DWAM 3WUFA 4FF5A 4MDPA 1QNSA 4XV0A 1V0LA 2WCGA 1E6PA 2YL6A 1BPLB 5DMYA 5FCZA 3FN9A 4BQ3A 1Q6CA 2YL9A 3W24A 1F4HA 4C7FA 1MWOA 3SUWA 3FW6A 4CD7A 1PZ2A 4HA1A 4UQEA 5LA2A 1JZ4A 1OIMA 1N82A 1EIBA 2WLYA 3RJYA 1HXJA 4MB5A 1UD8A 2BY2A 1H5VA 2CETA 4OIFA 1VBRA 1R8LA 1VF8A 2VCBA 3PZNA 5D9MA 1XGZA 2J7BA 1QNRA 1UR8A 1TVNA 4P8VA 2QPUA 3EMZA 4J27A 3NJ3A 4PTXA 3POHA 4B3KA 1B0IA 2EEXA 3OG2A 1JF6A 2FHCA 4WSKA 5CPSA 4AXNA 4U5KA 1VAHA 2VQUA 1M53A 3NSNA 3TOPA 1B3YA 3BAJA 1ZJBA 4M1RA 1ZBWA 5BROA 4V2XA 1E4MM 3BMVA 1C91A 2W92A 2ZICA 3AOFA 4IPNB 1QI3A 2NT0A 3WH7A 1FFRA 3L4ZA 1LG2A 1PEZA 1V08A 4H8UA 1UQZA 4AD3A 3EDFA 3ZIZA 1ISYA 1EQCA 3I3EA 3EDDA 1HJSA 1JZ7A 4B9YA 1RP9A 3QOMA 4AZ6A 4DWSA 4F9JA 5A2BA 2YOCA 3T0DA 3CBWA 1PX8A 3F5LA 4PRWA 2QV4A 1E4IA 3IANA 5FL0A 5E9AA 1JFHA 2VQTA 1V6XA 3ARRA 3WF0A 2ZWYA 3G6MA 5M5DA 3QOKA 1ITXA 3ZR5A 3NDZA 1H3GA 5AY7A 5C8BB 2O9PA 1Z32X 2JE8A 1EO5A 1E1EA 1WAWA 3RM9A 3KL3A 1QPKA 3B9EA 2DT3A 2BVYA 3F5KA 4JKMA 3KL5A 3NSMA 3AQUA 4D6DA 5KZ6A 1UA7A 3L4TA 1AVAA 1GQIA 4GI6A 1GORA 5HPOA 1KCLA 1KFWA 3AIQA 1NOWA 5A6BD 2CITA 4RE3A 1K6AA 3ZR6A 3A6OA 3N18A 3LPOA 1MFUA 3OGRA 1VIWA 4GINA 4F8XA 5DF0A 3VILA 3ZT5A 4B9ZA 1ITCA 1JD7A 3NSXA 1NWTA 4D1IA 4TX8A 2UY2A 1UOKA 4BQ4A 4AD5A 2ZXAA 1LL7A 3B9DA 2V3DA 5GPRA 4LPCA 2VL4A 2O92A 1H41A 3L4WA 2EPOA 2XTKA 4YHGA 4CN1A 4TXEA 1KWKA 9CGTA 1W9PA 3IJ9A 1H09A 2PB1A 1MXDA 1C8XA 1PPIA 3AMKA 3WNOA 3CHFA 3GH4A 4ML4A 3WQ4A 3ZO9A 1PBGA 3AHYA 5E6ZA 4DUXA 4D1JA 2CHNA 2XWEA 4QLLA 4MB3A 3GNRA 5I3DA 1WDPA 3LPGA 4DUWA 3T09A 4PCSA 2OSWA 1M04A 1XSIA 3K4DA 4PMRA 4V28A 1UWRA 3W0KA 3PZVA 3TTYA 4TTGA 1OIFA 3FNDA 1C93A 1KXHA 2F2HA 1HKMA 4M81A 3PTKA 1DP0A 3AFBA 1W9UA 2JEQA 4JCLA 4MJ4A 5A6MA 1MW2A 4NSBA 3RMEA 5ABFA 3WMCA 1JI1A 1BVNP 3OGVA 1HT6A 1XC6A 3LPFA 3ARXA 3WUGA 1QVBA 5A8OA 3AIWA 3EMCA 4YHEA 1E6ZA 1O6IA 3WELA 1FOBA 3M6DA 5JIWA 3GZAA 3BSGA 4AZBA 3K46A 2Y8VA 1VFUA 1XRVA 1E0WA 1SYTA 4ATWA 3GXMA 2QMKA 1GOMA 4GO8A 3K4AA 4M56A 1BTCA 3ZMRA 3MSDA 2J8FA 3WMBA 3VDBA 4WKAA 1GOKA 5DT5A 4HU0A 1ZBCA 3WF3A 5C70A 2YIHA 1U30A 2CKSA 3WNMA 2AAAA 2VCAA 1EH9A 2XSAA 3AHXA 2WAGA 4MADA 1ZL1A 2VTFA 3BH4A 3RJXA 4Z2JA 2DSWA 1UUQA 3VIFA 2WZHA 4PCTA 3EMQA 1H1NA 1VENA 1H11A 1AQMA 4GIAA 3ZJ8A 3F4VA 3CZKA 3NDYA 1PX4A 4AMCA 3FHQA 2DIEA 1ODUA 3MUIA 4BA0A 1QW9A 5LYRA 1JDCA 5M17A 2ZUNA 1WB0A 1ZBVA 1UKQA 4XZWA 4WJXA 4M24A 5I2UA 5D9OA 2GJRA 3VIMA 2PWHA 1UR2A 3WFZA 4AD0A 2NW0A 2DDXA 3VGHA 1D7FA 2AMGA 2C8NA 5D4YA 2NT1A 2UY5A 2PWDA 4TVUA 3CZ8A 2Z1SA 1G9HA 1KQYA 1KGWA 1E73M 1OT1A 3AMCA 2FH6A 4BF7A 2V38A 4W5ZA 3WEMA 3EBVA 4FLQA 1B1YA 4HTYA 3OB8A 3SUVA 3SCNA 1GVIA 2J74A 1M01A 3SCTA 2BFGA 4W7VA 1J0ZA 2CCRA 4W8LA 3GH7A 1KQZA 1Q6FA 3MMUA 1B30A 3VD7A 4MAZA 4PUDA 1GZJA 4WSJA 5ABEA 1VEOA 4NF7A 4HOZA 3VD4A 2G8ZA 3W82A 4ATLA 1TG7A 4MTVA 2E8ZA 4LYQA 4UQAA 2RGMA 2VOTA 4AZIA 2Q8XA 2DSKA 2E4TA 1KGUA 1A47A 4PSRA 4PTVA 2A3CA 2DT1A 4AW7A 4J3XA 1BQCA 1H49A 4EAMA 3O6AA 1RH9A 3AIUA 1DWJM 2X1IA 1XYFA 4AIUA 3AXXA 5IHRA 1GOIA 2J4GA 2WMJA 3MU7A 4AD4A 2MANA 4U5IA 2O9RA 2WW5A 1DWIM 2UWFA 4MNKA 3SCSA 4QLJA 2WCSA 1OGSA 1OD8A 2WMIA 5FD0A 4AIOA 4HZ8A 5A6LA 2PC8A 1PIFA 3THDA 3U57A 3WD2A 1VJZA 2WZIA 2WNWA 1CXEA 1TMQA 1JNDA 2WKLA 3W6MA 1J18A 3W37A 1CXHA 1JYVA 1BGAA 1ISXA 3IAPA 3HN3A 2RGLA 3U5UA 4D6JA 3MS8A 1CXLA 1OM0A 3AIEA 4L4OA 1E9LA 3GH5A 3VVGA 3WDIA 1CNVA 2V5CA 2W63A 5BRPA 4H8VA 1V6YA 3T0AA 3AJ7A 3NCOA 2E0PA 2GFTA 4FMVA 1W91A 1KXVA 3UETA 3F5JA 1W9XA 2PWGA 1ZB5A 1NWSA 3WQWA 1HJQA 1UWSA 4HA4A 2D0GA 2WANA 4NRRA 2Y24A 4UR9A 5HPCA 3ZT6A 5EMYA 3FHAA 3SIMA 5BXRA 2FH8A 3VPLA 3UEQA 2F61A 1V0MA 3K8KA 3AS0A 3WNPA 1C90A 1WZAA 2CIPA 3N04A 1JDAA 2W4XA 4Z2HA 3GM8A 2CPUA 2VZVA 3FXYA 1JF5A 2X2YA 2YKKA 5E09A 3VIJA 2BVDA 2GVYA 1M7XA 2XYLA 1HKKA 1BF2A 3I3DA 4OBRA 1HKJA 1QI0A 1KB3A 1QNOA 4ZXOA 5HOSA 3N17A 3AXHA 3WD1A 5A94A 4MNLA 4M29A 5A6JA 3IK2A 3WDPP 1ZS2A 5I79A 4EANA 2QLYA 3WQVA 5JBDA 5E70A 4M80A 3DYMA 5D8WA 3OLIA 4PTWA 4J7RA 1GQLA 1G01A 1HVXA 2XJ7A 4W8BA 3II1A 4HP5A 5E6YA 3VMOA 2IUZA 4JKLA 4D71A 2VZTA 2YA1A 2HVMA 3CZGA 4F79A 3ZJKA 4HA3A 3GDBA 5CLTA 1JZ2A 2YL5A 4QFUA 1UH4A 2Y4SA 1ECEA 3PTQA 3WSUA 1NP0A 1US2A 3CMGA 5LA1A 3UG4A 4J3TA 1JZ8A 1RPKA 3W53A 3SEPA 1WE5A 4JAWA 3WD0A 1QW8A 1E72M 4HMCA 3WEOA 1ZBKA 3OA5A 2DIJA 3CUHA 1CLXA 4PMXA 1JGIA 4MJ2A 1SFSA 2ZXBA 3SCQA 4J28A 1V6UA 5EFDA 1FP8A 1UKPA 1SMDA 3T08A 2E9MA 4HPGA 4UFLA 1Q6DA 2J7HA 3WF1A 1VFOA 1ISWA 4AYSA 5D8ZA 4KMQA 1XYZA 4UZUA 2PWFA 5A8PA 5CSYA 2HISA 4J3VA 3WF2A 1JDDA 1CGYA 2OWCA 2BY1A 2A3HA 1WNOA 3AICA 3ZM8A 2CESA 1UR0A 2XIBA 2AOSA 3ZJ7A 1E71M 1W9DM 2YLLA 1AQ0A 5CG0A 1JZ5A 1UKOA 4RE4A 1DEDA 1E0VA 2XGIA 1PJ9A 3WD4A 4P8WA 4D6HA 3QGVA 4ZFMA 4P7OA 4EE9A 1Q6GA 2XUCA 1B3ZA 4PMVA 4Y7EA 4QP0A 2PBOA 1HJXA 2YLAA 1W2PA 1F4AA 1XH1A 3I3BA 4M8UA 5IDIA 1W32A 5A69A 3U5YA 2IXUA 1US3A 3CH9A 3AZSA 1JG9A 1X6NA 2FGZA 5I78A 1C8QA 1DTUA 4WKFA 2BY0A 3RDKA 4U33A 2D0FA 2E40A 2WM0A 1QHOA 1I1XA 1JZ6A 2D0HA 2ZX7A 5F7UA 4DWSD 2GDUA 3NUKA 4UQBA 4JL1A 1E6XM 5BXPA 1I1WA 3VX0A 1JFXA 1K9TA 3VGFA 3AHVA 2G3NA 3RILA 4CD4A 4WIWA 4XUYA 1TZ7A 2J7DA 3WD3A 4BS0A 1FHDA 2G4FA 4WLCA 4ZE4A 4OKDA 2CNCA 1E6SM 2B31A 1QHPA 4J3WA 1BG4A 2JEPA 3BAXA 2ZUWA 3DC0A 4DWSB 8CGTA 3VO0A 1HL9A 1XSJA 5E0FA 4GQQA 3UR8A 4PMQA 1J0YA 2BNJA 2VRKA 3CPUA 1OB0A 4HZ7A 1HJUA 4LYRA 2ZUVA 3HJEA 2BHYA 4UFKA 2TAAA 4YN5A 2J75A 4V27A 2GJPA 5A95A 2V3EA 5M03A 1BYAA 3BSHA 1GHSA 4A3YA 3NYDA 3WN6A 3ZSSA 2GSJA 2DSZA 3SCVA 4AIEA 1E55A 3O9NA 1UKTA 4CN4A 4OOUA 1C7SA 5JBEA 3DHPA 3AMDA 4JFSA 2CBUA 2CBJA 1MW1A 1OSEA 5A8QA 1CYGA 4F9DA 2C7FA 1CZ1A 1WCGA 2Z1KA 5A8NA 1B31A 1E1FA 5GNXA 4U2ZA 1IZJA 1J9YA 2XVPA 4ZENA 1NOFA 1QNPA 1EHNA 4UQCA 2GDVA 5CXPA 3AZRA 3WH8A 1BGGA 2XVGA 4Q22A 4IISA 1ISVA 1VFMA 1W9VA 2FHBA 2XIIA 3PZUA 5A8MA 4U3CA 3S2CA 2VX4A 3ZT7A 2PF0A 3VD9A 3WKZA 4B3LA 4HZ6A 4B16A 3W27A 1HKIA 3BXWA 2VX5A 1UG6A 3WBAA 1ZJAA 1D2KA 1E5JA 3RM4A 5BWFA 5DEZA 4AZ7A 4D6CA 2EPNA 4BQ5A 3VOCA 5A6BA 3WMSA 2XGBA 1OINA 3CMJA 3L2LA 2G3IA 2VR4A 2WVVA 4DUVA 2W61A 2BHZA 1J11A 3ALGA 4MDOA 7A3HA 4GKLA 1IV8A 1KBBA 3VIHA 3PZTA 3N13A 1QOXA 4KGLA 4FLRA 2EO7A 4AEEA 1W3HA 4R27A 4KH2A 5CGTA 4JFWA 1UR1A 2ESCA 3EYPA 2OYMA 3WL1A 3VD3A 4CD5A 4PMOA 3UR7A 4NZCA 1HN1A 5HDRA 1E3XA 4D6FA 1XD0A 3BAWA 2V5DA 4UOZA 1E4LA 2A3AA 4CKQA 2WSKA 1OT2A 2QPSA 1HP4A 5HNNA 1HNYA 1TFVA 1W2VA 3VX1A 2WK2A 4ACYA 4CU8A 3B8SA 1WZMA 1GUVA 1NQ6A 2A3BA 2CKRA 5AC4A 4YPJA 3BLKA 4CVUA 4JFVA 1X1NA 1LWJA 4A4AA 7CGTA 2J7FA 5I23A 2WWCA 3W4RA 1W9BM 1EA9C 2YL8A 2D2OA 4KWUA 2VRJA 2VI0A 1EDTA 3TA9A 3N15A 4WF7A 3WY1A 1Q4NX 2XPKA 3GNOA 1NARA 4U2YA 3OLDA 2XSBA 3VGEA 1UD3A 4S3KA 2DGAA 3SUTA 1J0KA 1KCKA 5BYWA 3W28A 4C7GA 2ZXDA 1E40A 1HF6A 4UTFA 1JZ3A 1CEOA 2DQXA 1JI2A 4OBSA 4UOJA 4IM4A 1WDSA 2WHJA 3HMCA 3WQ5A 1LWHA 2J77A 3WH6A 3WFLA 1VJSA 2WVTA 1MVYA 1XD1A 4P7QA 5CZKA 2EPKX 3PTMA 4EK7A 1V0NA 3POCA 4HMEA 3A4AA 1K9EA 1WO2A 1WPCA 4AZCB 2ZX8A 3BMWA 1PX3A 4NI3A 4PYSA 5CGMA 3MO4A 3ARUA 3BAKA 1E6RA 3WIJA 1BFNA 3WDHA 4UFMA 3BAYA 3ALFA 4JFUA 1WZLA 1B3XA 4UNIA 3L4XA 2D20A 2J7GA 3E1F1 3PZGA 3ARWA 3OLEA 1V3LA 3VIPA 4DM1A 3W38A 2GK1B 5D9NA 1UA3A 4W89A 1HP5A 2BHUA 2DH3A 3VTRA 3WNLA 4QCEA 2DT0A 3A3HA 1UZ4A 4LQ1A 1OWQA 5I77A 4UZSA 3L2MA 4GI9A 1GJWA 1UYQA 2G3JA 4ATDA 4K68A 1B3VA 1W3KA 3AMLA 1UD4A 1V02A 2ZUUA 3AROA 1GQKA 4OZOA 3AHZA 3SURA 1W1YA 3ZJ6A 3OZPA 3BGAA 2O9OA 2EJ1A 1HL8A 4W7UA 2VURA 5IFPA 3CHEA 4E8CA 4W88A 3GNPA 1GVYA 1EQPA 4JKKA 1VRXA 3GXDA 5JIPA 3CUJA 1FA2A 5AYBA 3DHUA 3PZOA 1D3CA 2VVSA 1OD0A 3FY1A 4PBGA 3WQ8A 3KZSA 2ZUTA 2EQDA 1ZU8A 1OGGA 3WH5A 3RO8A 1HVQA 2WLZA 2OWXA 3QHOA 1EXPA 3MMWA 3OGSA 4CN6A 4MB1A 1UR9A 1BYCA 1EOMA 4XX6A 2WVSA 1PIGA 3WENA 5IFTA 4E8DA 1TE1A 4CGTA 3AS1A 4R5EA 4W7WA 3EDJA 1EGZA 4UQDA 2Y8KA 1MQPA 1QI5A 3WQ6A 1XH0A 1DWHM 2C0HA 2E3ZA 1OBAA 1VBUA 3GTNA 2XM1A 2BV9A 2X0YA 2WMKA 5A6AA 5FKYA 2VX6A 4C7DA 2VZOA 1H2JA 4CCCA 1C92A 3AS3A 5DO8A 1BSIA 2VCCA 5LA0A 2BVTA 4QLKA 1V3KA 3VDAA 2E8YA 3VGGA 2EPMX 6A3HA 4OOZA 3CLWA 3ARZA 1UH3A 2FDMA 4HOWA 4JHOA 4PTMA 4P8UA 4LX4A 1TA3A 2DSVA 1QHZA 4W8AA 1EDQA 2YA2A 4Z2IA 4KGJA 4W93A 4JCMA 2D23A 1CXIA 2VR5A 3VD5A 4TVCA 1GHRA 1H4PA 1CGTA 3MUAA 1CGWA 5M3WA 4CCEA 4HMDA 1VB9A 2J78A 1E5NA 5GQBA 4BCEA 1DWGM 1VFFA 1W3LA 4X0VA 5A2AA 1UR4A 1CGUA 3VGBA 3CTTA 1KR1A 1GOWA 1UHVA 3K1DA 2QF8A 2W91A 5CJ5A 1BVZA 2CHOA 3CZLA 2JIWA 4XB3A 4D6EA 2IXVA 2CYGA 3A47A 4MB4A 1UWIA 1QI4A 1E56A 3D3AA 4FLOA 4JFTA 3T2QA 3VIIA 5FL1A 3CZEA 4PMNA 4AZCA 1WKYA 1J0HA 2XM2A 1MQRA 1H0GA 1E6NA 4CD8A 2PWEA 3VINA 3LMYA 3CO4A 4ZXLA 5HBFA 5I6SA 1V02E 4HOXA 3VIOA 1CECA 7TAAA 1GJUA 1XV8A 4Z2KA 3UESA 2DH2A 3ARPA 1C7TA 2Y2WA 5CQ1A 1R87A 3L4VA 1TCMA 3EDKA 5A1AA 1SR0A 4UOQA 4B15A 1XH2A 1HJVA 5EBAA 4CU6A 4UFHA 2ZOXA 3CHCA 2JF6A 2V3GA 2GJXA 4HPHA 4NRSA 2XG9A 4PSPA 4KRUA 5BXSA 3M7SA 1V3JA 4GXPA 3BCDA 1V3HA 3KL0A 2XWDA 4CD6A 3AYSA 2VMFA 1XSKA 2QMJA 2WHMA 2VUYA 1E3ZA 4RL3A 3ECQA 1NWRA 3B9AA 2GUYA 3N12A 1GPFA 2WWDA 1KBKA 2OYKA 1UQYA 1W1PA 3VM7A 5A6SA 4CVWA 4J3SA 1EOKA 5C71A 1G1YA 2CBVA 2D1ZA 3ZSTA 5CPTA 1R7AA 1SMAA 1V6WA 4L4PA 2WVUA 1NP2A 3W26A 3MV01 4LGXA 4BZYA 2X8RA 5IXEA 2GJXB 5JBFA 1YQ2A 1BYDA 3VNYA 2OLHA 1QI2A 1NWUA 4A3HA 1A3HA 2D3NA 1WP6A 1B90A 3S6TA 8A3HA 2VNCA 3AIRA 2YDSA 2ZX9A 1AMYA 3HU7A 3IJ8A 1CTNA 2EXOA 3LPPA 4GI8A 4KRTA 3QHMA 1UH2A 3MMDA 1Q6EA 3A4WA 2JF7A 4AISA 4CU7A 3VKKA 1K9FA 1MFVA 3UG5A 5BXTA 1W1VA 1UD5A 3DYOA 3AMGA 3CUIA 3VDHA 3A4XA 3CUFA 4W87A 4LYPA 1V3MA 1EHAA 3SCWA 5DFAA 3U7VA 1PZ3A 2O9TA 2WVVB 1V03A 1CPUA 3T2PA 3RCNA 1WDQA 2GK1A 4W84A 1VEMA 3BLPX 3ZOAA 3PBGA 4H8HA 2EPLX 4OUEA 2FGLA 2WZEA 1X6LA 4UFIA 4UCFA 4Z2GA 1G94A 1WZKA 2JFEX 1CXFA 2DT2A 3WDQA 5JUVA 4PN2A 3ZQ9A 3FAWA 1H0IA 3ARQA 3W25A 2WYSA 4AD2A 2ZUMA 2CERA 3ARVA 1MQQA 2OWWA 4AZGA 5E0CA 3OLGA 1UKSA 2VX7A 2WMIB 3UERA 3OIHA 2D24A 4ZEPA 5HXMA 3K8LA
chains in the Genus database with same CATH superfamily
2W66A 2MUCA 3EX1A 2C0AA 3HQPA 3IACA 1JAEA 1P0DA 1GONA 1TWIA 4O53A 3AXIA 3B9NA 4NNCA 3IJ7A 4LUIA 4AZHA 2IS7A 3ITGA 1CXKA 2J7CA 3CHDA 5F4XA 1MW3A 1OC7A 1TVPA 4R7OA 4P7NA 3O1NA 2J79A 3QLDA 4W86A 1LLZA 2I5GA 2E77A 2BOEX 3W29A 1TMLA 4G7FA 1QOQA 4GH3A 1IIGA 5DQPA 3QV8A 1KV5A 2ALRA 4FIQA 4JIPA 3PJXA 3WL0A 3QY8A 3GG8A 4GYPA 1PKYA 4HVXA 4N42A 5D9PA 1M03A 1RBLA 4AX6A 2A6LA 1R2RA 1VR6A 3VDGA 1HW6A 3STGA 1OX6A 3EXSA 1O12A 4PMYA 3QHNA 2WHLA 1J01A 1GOQA 2VD8A 4JTIA 2PCEA 1DXIA 3L4YA 4EVZA 3JW7A 7ENLA 3GBEA 1VP5A 1U33A 1REQB 3DENA 3DZ1A 2FKPA 3QR3A 3VUPA 1J6PA 2YDQA 3KOFA 3L4UA 3M0YA 4XO6A 3SCPA 2ZE0A 1NF0A 1R3RA 1Z42A 3GFZA 4QE4A 4PB3A 4GD0A 2I7GA 5ABFB 1AA1B 1R9ZA 1JQXA 1UB3A 3AYRA 4RZ4A 2J8GA 3ZLGA 2R1LA 3W70A 3TQPA 4MAVA 1H7RA 1J2WA 1YDVA 1HTIA 3BC9A 2DUZA 2IKIA 4HNVA 2YBTA 1YPXA 2D22A 3CQIA 3VNKA 1FP9A 2CBIA 4MLJA 3BPWA 5CBIA 5BRQA 3NM3A 5CSSA 1JAKA 1K02A 1LJYA 4GC3A 2O4QA 1OX4A 3FCPA 3UJSA 1AW2A 1IT7A 3UGVA 3AYTA 1KR0A 4MM1A 1S38A 3VOJA 4JZ5A 2DZTA 1FWIC 1QOPA 1CT5A 2OYLA 5FIPA 1E4NA 4PGLA 1XG3A 1JQVA 3QGAC 3GTXA 3PZIA 4GZEA 3UJRA 5K2ZA 9XIMA 4GQRA 3T2OA 4RLIA 3VGDA 9RUBA 3HV8A 1XRSA 2HK1A 3RLGA 4H2CA 1IT8A 3TONA 1DKWA 2V67A 4JEJA 4JQ4A 2YDRA 3NZGA 7REQB 3VM5A 5DXXA 1E9ZB 4AC1X 4F66A 1Y0EA 3G1FA 5GVJA 2WZTA 1OZQA 1W1A1 2PMQA 1SGJA 4FNSA 1IYXA 1PDZA 3UCQA 2PWVA 2WSRA 1XKYA 4BQ2A 5D32A 1BD0A 4CQAA 4NJJA 4WCJA 4HQVA 2XHYA 1FVPA 1TMHA 1B57A 1KWGA 2VOMA 4YL2A 3VMPA 1LLOA 4TX6A 4AU0A 1JNEA 2ZRWA 3QVQA 3B4YA 4GVHA 1S1PA 3TYBA 3W71A 4D6GA 3WH9A 4FI4A 3MMTA 4L6HA 1RP8A 4I8YA 4H2HA 3PSWA 2NSXA 3SUUA 3TQVA 1OG0A 5DY3A 4WKHA 5KZMA 4HNLA 2BB0A 6XIAA 1SO4A 1JD9A 2QR6A 3MB9A 3R13A 3S42A 2OJPA 2IKGA 4H7VA 3T42A 1K70A 4KT2A 4B2DA 1PHWA 1QW7A 3TYEA 4MZYA 3PR2A 3M43A 4PMDA 5FEPA 1UWTA 3OW1A 3DBPA 3RX3A 3SSJA 4GH1A 1UBPC 3G6LA 4PMJA 5T9CE 1VS1A 3UD6A 2Q02A 5A2CA 3WG6A 4GUFA 1RR2A 2XIQA 3VABA 2HXTA 1TJRA 3KOZA 1B2YA 3GNXA 4D8AA 1QTWA 2XFFA 2WC4A 3E9AA 1VBJA 1I75A 4LUJA 1VEPA 1CIUA 3CEPA 5AYZA 4E2OA 4UR8A 4DJED 3L9CA 5C9WA 3C2RA 5HATA 1GOOA 1L8NA 2W67A 3IWPA 3W6LA 2V69A 5E5CA 2ZKMX 1IGSA 4KETA 2F6UA 1K7XA 3LCLA 3ITOA 5EB8A 4R88A 4A21A 3QM3A 3K8MA 5LNSA 4M6UA 4L1XA 1BG9A 2YCIX 3QMRA 4ZTXA 3ELFA 5BCAA 2J8TA 4XKMA 1KM5A 1UP2A 2A6NA 3VU2A 3LXBA 4DO6A 1OFOA 2B7PA 3TMLA 1XQKA 3W7CA 4IIFA 2PP0A 2QUMA 1E43A 1QBAA 4UFJA 3WF4A 3USZA 4MJMA 4CQDA 1AJZA 4E2BA 2QCFA 2PEVA 1P7TA 1VYRA 1QASA 5T8GA 2Y5EA 4X9SA 3TTSA 3BLIA 4LCRA 3M0IA 3UWUA 4W5UA 3FJNA 3E0FA 3IVSA 4HNNA 5C2CA 4JTHA 3OTRA 1KV8A 2PBGA 4I5XA 1TRDA 3DFYA 4IIDA 1WXZA 2UY3A 3GC5A 4LF2A 5EFFA 1GQJA 3W7IA 3IIOA 5CC5A 3EDEA 3UWWA 3CNYA 1M7JA 4XK2A 4PULA 1MUMA 1QNSA 4C6OA 1A3XA 1E6PA 3TFXA 5EMLA 2G97A 3HFYA 3W24A 3AU6A 4DX3A 4CD7A 3C2VA 3MP3A 4ZODA 3ABQA 3DIPA 2CXEA 2G3FA 2WLYA 4MB5A 4LS1A 2HS8A 2BY2A 2CETA 3U2CA 2WNNA 1R8LA 1VF8A 5D9MA 3E38A 1Q4WA 1QPNA 4HPJA 4GYPC 4NNAA 4W9TA 3POHA 4US5D 4B3KA 1B0IA 4MLRA 3TQ0A 4IIHA 5J5DA 3I6RA 3B03A 5CPSA 4HK7A 2VFGA 4U5KA 3B8IA 2PTDA 7REQA 1VAHA 3GK0A 3W7DA 4RDVA 3FJ4A 4ZB2A 5BMXA 3V75A 2ATSA 4DI8A 2PDQA 3UPMA 1C91A 2ZICA 3AOFA 4IPNB 4A8NA 1QI3A 2HPMA 4KEZA 4EF9A 4ILSA 1V08A 5FEWA 1UQZA 1SQ7A 5D04C 3SY8A 3TWAA 1EQCA 1EYWA 3EDDA 2NQ9A 1K77A 3N29A 3WK0A 1RP9A 5K3VA 2NUWA 1XIGA 3GNDA 1PYMA 3LK6A 1FWEC 1Q2SA 3EKLA 2P88A 4TX9A 1JPHA 4L1GA 4E4UA 3PBVA 4H00A 2VQTA 1V6XA 3WYZA 5M5DA 1U1JA 4P2VA 1ZHAA 2D2HA 2OB3A 5TAOA 4BEQA 1T8XA 4K8GA 1Z32X 4IXXA 4UCGA 1DQUA 3R12A 1LBMA 1EO5A 2H8ZA 1E1EA 5G5IA 3VZYA 3DUGA 3MVTA 3DG3A 3IJDA 2BVYA 3F5KA 3VKBA 3RXZA 3B9OA 3NSMA 4AHOA 4QSHA 3FIGA 1ZTVA 5KZ6A 3L4TA 2VC6A 2VELA 4GI6A 4IHCA 3USBA 5G1YA 2TMDA 3C0JA 2ISFA 2CITA 4IQDA 5I3GA 1K6AA 2FFIA 1EJ7L 3QF0A 1ZALA 1MFUA 3QH2A 4S3CA 4F8XA 3VILA 4D1IA 4DQWA 2G0WA 2GGIA 4BQ4A 3CS2A 2ZXAA 1LL7A 3CWNA 2V3DA 2PWUA 4E3VA 4LPCA 4FNUA 1Q65A 3PM6A 1OADA 4DJDC 4E5TA 1AL7A 1AW5A 2CZFA 5J8LA 2CLIA 3FJLA 1MXDA 3BW2A 1C8XA 1PPIA 1E9YB 2C3ZA 3GH4A 1L9WA 3ZO9A 3VNLA 3QZ6A 2VXNA 1YDYA 4OT7A 4JD4A 1UMYA 4MB3A 3SGZA 1WDPA 5DMNA 3T09A 4L80A 1M04A 2ACSA 4HJWA 1R5YA 1OIFA 3FNDA 1C93A 5EPDA 4C90A 1HKMA 4FXJA 4M81A 3G0XA 3BZJA 2DW6A 3IK4A 4O13A 4GX8A 2FLIA 3BWWA 3WJSA 5H2ZA 3AFBA 2A85A 4MJ4A 5FEZA 5A6MA 1MW2A 5D38A 4XWUA 3G24A 3R58A 4OGZA 3SBFA 5ABFA 3LPFA 1XICA 3ARXA 3MI2A 5A8OA 5HMFA 3AIWA 2C16A 3EMCA 1O6IA 4B4HA 1Q63A 5KMYA 2E1DA 2FDSA 3W2KA 3U4FA 3VNMA 4AZBA 3OHIA 1VFUA 1XRVA 2VWSA 3QR1A 4A3RA 1E0WA 3T05A 4GVIA 4M51A 1DJNA 1GOMA 3N3MA 1EL3A 3ZMRA 3GHRA 3MSDA 1KNWA 2GGJA 1QPOA 1XIMA 4KFNA 2YBVA 2VCAA 1I2RA 5HULA 2NUYA 3MUCA 4C6QA 1WXJA 2WAGA 4UTWA 2O56A 1ZL1A 3W6YA 2VTFA 3BH4A 1PYFA 2DSWA 1UUQA 3VIFA 3M0ZA 4C6CA 3EMQA 4R7JA 4RZ5A 4H9ZA 1GTEA 5FAGA 3R94A 4C60A 5HR6A 3NDYA 1TJ0A 3MUIA 1QW9A 5LYRA 4CCZA 1TELA 2R82A 3EKGA 1ZBVA 4DYEA 1RPXA 4YTUA 3R0DA 1D9EA 1W5MA 2GJRA 2OEKA 2QULA 1HGYA 2PDHA 1UR2A 3WFZA 2PZNA 3LM7A 4PUWA 1D7FA 2C8NA 4IP7A 4U4MA 2NT1A 1L6YA 4GACA 1ADSA 3DGRA 4QRNA 2UY5A 2PWDA 1EJTC 3CZ8A 2EF9A 2QKFA 1XJBA 1TB3A 4IJRA 2FH6A 1ZUAX 3B0PA 2Z29A 3F4WA 5H8MA 1B1YA 3H7VA 3OB8A 2VGBA 3SUVA 4GOAA 1YNPA 1GVIA 4W7VA 1EP1A 1J0ZA 4XBKA 2CCRA 1SFJA 3VD7A 3S4TA 1TUFA 1O94A 4FF7A 1DJWA 4OUIA 2TPSA 4WSJA 3P0XA 5ABEA 4HOZA 3VD4A 4FS9A 3U0HA 1TIWA 4ATLA 2NQLA 4MTVA 3VKJA 4QQ3A 5CZSA 2RGMA 2VOTA 4AZIA 2Q8XA 1TIMA 4PTVA 4AY8A 1L2UA 1AODA 2H3BA 3TC7A 1I9CB 3HG5A 1XINA 2DT1A 5A6TC 3DFTA 1N2VA 4DJFC 5IBXA 1TPB1 4EAMA 3O6AA 3W1QA 2IPWA 2Q8ZA 3AIUA 4PCNA 3ZYZA 1H62A 3NQVA 3WLRA 2MANA 4HN8A 3FFSA 1DWIM 4MNKA 3SCSA 1A49A 1DJGA 1OD8A 2R6OA 3RGTA 2B7NA 3M0XA 2NQHA 4FR6A 1FKXA 5EL1A 4H6RA 3WD2A 1CXEA 1VJZA 1IXOA 2WKLA 1PUDA 3T78A 1ISXA 1XYMA 2VFEA 3S2LA 3KCJA 2XN2A 5A8GA 3GH5A 2ON3A 1EBHA 1CNVA 2W63A 5C9RA 1MDRA 5BRPA 3B3DA 5E9XA 4MF4A 1M41A 2V2DA 2XN1A 4FMVA 2GFTA 4V15A 3BV4A 4NT0A 1V79A 3URQA 1ZB5A 3RFAA 5JU6A 4ZA0A 3H2AA 3F2DA 1W1ZA 2D0GA 4NRRA 2Y24A 2VR2A 3W9ZA 1DJZA 2FH8A 3AS0A 3WNPA 3W76A 3FS2A 4I9TA 3S5YA 4LV4A 1N7KA 3LCGA 5I09A 2RH9A 4IMAA 4Q8TA 1OHLA 2CPUA 3GM8A 3AC0A 3VIJA 2BVDA 3IV8A 2GVYA 1M7XA 3GUWA 3IVUA 1VGAA 1PKNA 2CLPA 4H01A 4J40A 3AWNA 5HNTA 3AXHA 4EOUA 1FBAA 1T40A 5A6JA 3WDPP 4PUUA 5E70A 4CQ9A 5AB3A 1IEIA 2VEIA 3DYMA 1DL3A 2ACUA 3VMOA 1XLFA 2XJ7A 1ZCCA 1VYPX 4JKLA 3V7PA 4TV6A 2YA1A 3T0TA 2ZDSA 4XUGA 3BURA 2DZSA 2POZA 2VDHA 2Y4SA 1ECEA 3WSUA 4YYCA 1US2A 2E67A 2Q8LA 4GJJA 5HANA 3UG4A 4Z1CA 2J13A 4YVVA 3WD0A 2JK2A 1OCJA 3A9BA 1BSLA 1ZBKA 3OA5A 4PMXA 1RALA 3CT2A 3V4BA 4HZMA 1JGIA 4MJ2A 3WCZA 3PG9A 4O19A 3V3WA 2ZXBA 3SCQA 1V6UA 2J7HA 1X97A 2X30A 3L65A 1H51A 2E7FA 3LERA 4DELA 5F4WA 2PWFA 5LGXA 1UPMB 3VK5A 1H7PA 1NTHA 2HISA 1JDDA 4Z1BA 4PFHA 1F76A 3MO7A 1HG3A 4OBTA 1RJPA 4AEOA 2QUUA 1OCNA 3Q2DA 1VHNA 3BQ5A 1J79A 1HL2A 4F0LA 1AQ0A 1W9DM 4RE4A 1DEDA 1E0VA 1BQGA 3C56A 3WD4A 3BSMA 4PL2A 2XISA 3B8VA 3QGVA 4EE9A 4DY1A 2QIIA 1XI3A 4MZ8A 3ABOA 4MYXA 5IDIA 4M8UA 3NGJA 3CH9A 4RXGA 2XSXA 3L67A 3P8IA 3RDKA 2D0FA 1BTMA 3GG1A 4FOUA 1I1XA 2DUXA 5CJNA 4UBPC 3DCPA 3Q45A 5BXPA 5FJIA 1I1WA 5RUBA 2VD9A 4GGHA 4LUTB 3NQGA 4X2RA 3R8HA 2XIJA 3QFWA 4CD4A 3KS6A 4IFKB 1TZ7A 4BS0A 3SSZA 1FHDA 4WLCA 5EKYA 2CNCA 4ZQPA 1E6SM 2B31A 1O5XA 3MVIA 3QC3A 2E6FA 2QYGA 3BAXA 1YNYA 2ZUWA 5AZ0A 1ECQA 3N3TA 1XSJA 3DDMA 4JNMA 4OQVA 4FXSA 4GQQA 2BNJA 1EJXC 1OB0A 4HZ7A 4PUMA 3HJEA 1RJQA 4UFKA 2H6RA 2PTZA 3WBWA 5LIXX 4YN5A 3PFMA 4CNPA 2GJPA 2V3EA 5M03A 1XW8A 1BYAA 4PODA 2C19A 2GSJA 3FVMA 1SZEA 2EPHA 1RCOB 4OOUA 4GY0A 3DHPA 4ERGA 3AMDA 1TJPA 1W3NA 2CBUA 4LUTA 5A8QA 3QC0A 1CYGA 1MUWA 4DYJA 5K4XA 2XH7A 2P0IA 3HIJA 3QV9A 1KFBA 4U2ZA 4S3BA 2WPBA 3P67A 1IZJA 1SO3A 4QEEA 4REQB 3YPIA 4LB4A 2OO6A 1K1DA 3WH8A 4Q22A 3EB3A 1K7FA 2Z24A 1MEWA 5K9CA 1X1OA 3B06A 3BO9A 3T0CA 3ZT7A 5IDZA 1H1ZA 3UNTA 2ZBTA 3NWRA 4LY8A 2VUNA 4B3LA 4HZ6A 4J35A 3G1RA 2QS8A 1Z8AA 3CL6A 2VX5A 3LZ3A 5BWFA 4C6KA 3NQ7A 5D2VA 2I14A 3GHSA 1GKQA 1TSIA 3S1UA 2G4JA 3L2LA 4ZMGA 3G5EA 4J1OA 2WVVA 4FAMA 4DUVA 2W61A 4GKLA 3FA4A 3VIHA 3MCOA 3PZTA 3IGUA 4KGLA 3LSBA 1G4PA 4XTIA 1RA0A 4R27A 4KH2A 5CGTA 1UR1A 2ESCA 3EYPA 1RA5A 4JS3A 4NZCA 5HDRA 4BHYA 1RLCL 3QZAA 4S3EA 1E3XA 4A8LA 3AU2A 4UOZA 1E4LA 2A3AA 1HP4A 3O16A 5HNNA 1LQ2A 1TFVA 4FNQA 1K8XA 3BLDA 4ACYA 3CQHA 1KCZA 1GUVA 4H83A 4C1NA 5F2LA 1PKLA 3UVAA 4DJFD 3BLOA 3DC8A 4L9ZA 3M0LA 4A4AA 3TLLA 4LVFA 4LVDA 2YL8A 4ICNA 4KWUA 2PTXA 2VRJA 2VI0A 2VYOA 4KEMA 1ENUA 5JH1A 1XIJA 4DBUA 2XPKA 1FXQA 4NZ5A 1BF6A 4LC8A 2DORA 2Y7GA 2R94A 4WY0B 3C4UA 3DI0A 3DFHA 1ZPTA 5I3FA 3MTWA 2PDNA 3BANA 5BYWA 2C1IA 1HFBA 3IV3A 3WQFA 3N2MA 5FF2A 1E40A 1HF6A 4KBXA 4IPJA 1JI2A 4OBSA 4IL2A 3N19B 2WHJA 3HMCA 4DBWA 2Z6JA 1VYSX 3GR7A 3T44A 2DJXA 1XD1A 5F2GA 1V0NA 3A4AA 3EXRA 2C71A 2PLMA 4ZQRA 1K9EA 1SPQA 4IH3A 3WLJA 3NFUA 3HF3A 3HBLA 2WJEA 5CCZA 1TQJA 4NJIA 3MO4A 1E6RA 4PCPA 1IWPA 5TQLA 4UFMA 4JFUA 3ALFA 3WO8A 3UXLA 2BVWA 4UNIA 4G1NA 2J7GA 4XIAA 3ARWA 3WLMA 5G4WA 3W7EA 4YWIA 1V3LA 3VIPA 2QV5A 2GK1B 2V5KA 3BOXA 3GDRA 3TUUA 3MP4A 2DT0A 3R2GA 1OWQA 3L2MA 3A23A 3T55A 1BXCA 1UYQA 2G3JA 4OE7A 4QTGA 1J93A 1FWFC 4WDWA 1V02A 3SN4A 4IGHA 4OZOA 3AHZA 4C6NA 1W1YA 4AQLA 1L6WA 4IZGA 3NPWA 2O9OA 2NWRA 4A3UA 2VURA 3O0KA 4PR4A 4UTJA 3CHEA 4ICMA 4E8CA 2ZVIA 3LEPA 3NQ8A 1EC8A 4YVXA 3WJXA 3CT7A 4V1XA 3LBMA 4MVAA 2VVSA 3EX3A 1F8MA 1EA0A 1S3TC 1PCKA 2X1TA 4PBGA 3KZSA 2EQDA 3GKAA 5HMSA 3E2SA 3RCMA 3RO8A 1X8FA 4NAFA 2WLZA 4HK6A 4B5NA 2OWXA 5EYWA 3EB2A 4MB1A 1Z9AA 3HM7A 1BYCA 4EWND 4LS0A 4XX6A 2WVSA 5BMWA 3CXOA 4E8DA 4R5EA 3ZLHA 2A21A 3EDJA 4UQDA 4ZFCA 3STFA 1Q7ZA 1QI5A 3WQ6A 2FZ8A 4UUIA 2C0HA 2E3ZA 4HPXA 1VBUA 3GTNA 2VDGA 4DAFA 1R3QA 1XYAA 2OFJA 3UXIA 5A6AA 3GU2A 2VX6A 5DO8A 4GNVA 4IF2A 2BVTA 3LHWA 3W7PA 3VDAA 1ZCOA 3DEQA 3LB0A 1Q7QA 4HK5A 4ORMA 3VNJA 1DQXA 4WJ8A 5G4EA 2FDMA 4HOWA 1K8CA 4PTMA 4PCFA 4KCTA 1PTDA 3C8NA 2DSVA 4W8AA 3MHGA 4Z2IA 4FSAA 3PPFA 3OQ8A 4K38A 2C1HA 4JCMA 1GJPA 4ZZ9A 1CGTA 3K4WA 2ZE3A 1XLDA 4CCEA 1VB9A 2J78A 3N6QA 1YBQA 3MC5A 4I6KA 2YYTA 1W3LA 2V2HA 4X0VA 4LRSA 3SW6A 5A2AA 3UJ2A 1T8QA 1GOWA 3K1DA 4YJ5A 2IXVA 3ZVHB 3A47A 4MB4A 3UZZA 1UWIA 3D3AA 1E56A 4DF2A 3HV9A 1Q85A 1JPIA 3T2QA 3JR2A 4N4PA 2J6XA 4PMNA 5BU6A 2XM2A 3D6NA 1E51A 5LHFA 2PWEA 3D47A 4MKSA 1KFKA 2Q6ZA 3UWVA 3IIZA 4DNHA 3UESA 1C7TA 3IJ6A 2Y2WA 5A1AA 1S1RA 2XZ7A 2OZ3A 3QW3A 4UFHA 2ZOXA 1XBYA 2JF6A 2D73A 1O60A 2V30A 3KLKA 4PSPA 3U4AA 4Q4OA 1PB0A 3UZXA 3ZLFA 2YXOA 5DBTA 3R5EA 3KL0A 2XWDA 2VMFA 3SQLA 3KCLA 1XSKA 2WHMA 2VUYA 1TWSA 3V36A 1JUBA 3D3FA 3ECQA 1EZWA 4GGBA 3UNDA 2PODA 4M5PA 4NYUA 4DZIA 1GPFA 1KBKA 2OYKA 4JTCA 4JYFA 3UBPC 4C1LA 4H7CA 1EOKA 1G1YA 4FOKA 2CBVA 2D1ZA 4YNGA 4B5TA 3ZSTA 1V6WA 1K4GA 4L4PA 3GUGA 3HQOA 1SM9A 2VEGA 5JBFA 1YQ2A 4V33A 1SO6A 4DZHA 1BYDA 2GGEA 4IJCA 1WP6A 8A3HA 4WXYA 1DVJA 1EUNA 1NF7A 1XM3A 1WDDA 2YDSA 3AIRA 2ZX9A 3QHMA 3S83A 4CNOA 4J2PA 4AISA 4BY3A 3VYLA 3MUXA 2EJAA 4POCA 3A5FA 1EGMA 3IJQA 1SW0A 4ZSTA 1I6NA 1RXOB 4O18A 3W7LA 2YZRA 3LHYA 4JY9A 3LY0A 3RO6A 2ZRUA 3TYAA 1XLLA 2QW5A 1PHQA 3MHFA 3T2PA 1WDQA 3ATZA 4TMCA 2OTDA 4Q7IA 2X2GA 2WZEA 4UWMA 4UFIA 1FUYA 5AVHA 3KCOA 1XIFA 4NZFA 1CXFA 2DT2A 2EAWA 5JUVA 3IIXA 4PN2A 3ZQ9A 3OZMA 1H0IA 3S1VA 3W25A 2CERA 4S3DA 2OWWA 3MKCA 4DRSA 4JTDA 3OLGA 1X7IA 1IXPA 2D24A 3NA8A 3VUSA 1T96A 5EBUA 2YBUA 3GXFA 2OSYA 5FACA 1Y7VA 3B4UA 3LN3A 2HQAA 2E9LA 2VVNA 2WKGA 1C8YA 4AD1A 1KGXA 4BEUA 1HJWA 2WBGA 4L5ZA 3U2ZA 1RQBA 3QR0A 5I0DA 1DIOA 2BXVA 3IARA 1CDGA 4HPNA 1THFD 4JTAA 1XP3A 2WB5A 4X3ZA 3NGFA 3W1UA 3W2JA 2HS6A 3S0CA 1FH8A 3WQCA 4QDMA 2PLCA 3MJMA 1HO4A 4A29A 2PURA 4DXXA 5EY5A 4D6IA 5CLWA 3EOEA 3S1WA 4B92A 3O6YX 4HHLA 1JCJA 1W3JA 1J2BA 2QDHA 3HMJG 5DCEA 3BAIA 3DKLA 2YYUA 1Q2RA 2I9UA 2QJIA 4JIEA 5CAKA 3ARSA 1E15A 1LUCB 3ZXWA 1EB3A 3AISA 3UA3A 3T6CA 5F2IA 3SUSA 2EG6A 2HROA 5I3JA 1C3FA 2Q01A 3NOEA 2XGZA 2GJNA 2DEPA 2PD5A 3KHDA 1AJ0A 3VCCA 3MUZ1 2FMOA 1TV2A 3TTOA 4PUEA 3VZZA 4EACA 2OKOA 5C7VA 1CGXA 1ESWA 3L66A 4ZQMA 3M5VA 1U5VA 4XZMX 2MNRA 1R85A 4TUFA 4O1DA 2XH4A 4O0KA 1D8CA 3B0XA 4WX2A 3NPVA 1QJWA 1A5UA 1BYBA 2OZ8A 2VZSA 3CWOX 1PXGA 2QJHA 2VC5A 3GU9A 4A2SA 3T4CA 3N2BA 3VOFA 2E1WA 1TR1A 2J9XA 3DN5A 3RIKA 4WY0F 5GNYA 4YMZA 3KRZA 1OY0A 2XFYA 1SFLA 1XCXA 3F2BA 1LORA 3KVJA 3OHMB 2C18A 2VKZG 3CU2A 5ABHA 3PHAA 3CQJA 1AUSL 1LT8A 2J62A 3DFQA 2D69A 1UPPA 2E9BA 3ARYA 3TJLA 1BEUA 4TVDA 3VNDA 2YCLA 4A8IA 3W73A 1MI3A 3AO0A 3LU2A 3VIGA 4GPNA 4HSNA 1OVDA 3G1HA 3WLQA 5GNZA 3KFTA 3V1HA 1FDZA 1NH6A 1TCDA 3VKCA 3W7MA 4S38A 3UVIA 5A5WA 5D33A 3Q65A 2GUBA 4DWDA 3JUGA 4JYDA 3CH0A 3LI0A 1EJVC 1VD6A 1XLBA 2QGHA 1TTPA 3CUGA 2CHRA 1HGWA 3QPZA 1J10A 1E0TA 1WBHA 3O15A 2EBNA 3L5AA 4ZQCA 2WMHA 2BASA 2JQXA 3W2UA 1ALDA 4L64A 5IHSA 2WCAA 3OQEA 1ML1A 4GI4A 4JTJA 3SCUA 4EAYA 4JEQA 1EO7A 4JNZA 2PGRA 4FR1A 5HA7A 3EPNA 3APYA 4KEVA 4NAEA 4LAOA 4HCHA 1GNXA 4US5A 5FJRA 4O28A 2WJZA 5K4ZA 2VO5A 3U3HA 1UW9A 2WMGA 1E6QM 1B9ZA 1XFCA 4ZL1A 3GBDA 1OCBA 2GZXA 1IIHA 2YA0A 4WDUA 1E70M 3ZS4A 4GJIA 1YEYA 4GC4A 2QCNA 1R3YA 3NPUA 3G22A 2ISSA 4MWAE 1FH9A 3GTFA 4ZQNA 5HWMA 1UD2A 3QXBA 1LQ0A 5G1TA 1YE4A 3GYCA 1E9IA 4F48A 4AVFA 5DT7A 3GW3A 3NQDA 1W54A 4PMZA 4RE2A 2TRSA 1S2AA 4MWAC 1FWCC 4JQ1A 2ZXQA 5KETA 1FWTA 1PO9A 2VT0A 3R0KA 3PANA 3PB2A 5BOFA 2VRQA 4IMDA 5EMJA 1O7AA 4N7QA 4HHHA 2X09A 3LX9A 4KIEA 2XVNA 3HQ1A 3KE0A 4XZNX 4M82A 1D8WA 4LW7A 4B5XA 2BS9A 5HR7A 5DBUA 1XLKA 3NTYA 3ES7A 3MJYA 1PVNA 3HGRA 4L4LA 4HYRA 3GC4A 2Y6ZA 4QSFA 3IGHX 5AOUA 1FHLA 2J9ZA 3FA5A 1MW0A 1DORA 2OSXA 4P7LA 2NXIA 1RY0A 1VPXA 4DEFA 3H55A 3N4AA 5LIUX 4EPKA 3R7MA 1GYNA 4PTNA 3VZXA 4WEVX 1LF1A 4D72A 1EF2A 3S9ZA 4J3ZA 3QMTA 3MW7A 3TR9A 1CWYA 3R8GA 3VI2A 1EEXA 3SCRA 2A3EA 4AWTA 1KFLA 2ZX5A 4K7VA 3WJZA 5AN7A 4XBJA 5CSUA 2D3LA 4N0RA 1REQA 2X0HA 3TJ4A 3NEHA 3TP4A 1KO0A 4ROQA 3HPSA 2ZZ4A 4MDPA 1V0LA 4JQ3A 1M7OA 3TN6A 2YL6A 4LY4A 4FNRA 3LTPA 3NL5A 4BQ3A 1Q6CA 3LCWA 2O55A 3UU0A 3SJ3A 1MWOA 3SUWA 1PZ2A 3TMQA 1N82A 5HWJA 3HO8A 4XKYB 1HXJA 4Q4MA 4Q7BA 4HNCA 3PNZA 4OIFA 3GRIA 3U6WA 2VCBA 5AHIA 2ZFAA 3PZNA 1L6SA 3WFAA 2J7BA 2QDEA 1QNRA 4HKPA 1TVNA 4RZ6A 4QITA 3NJ3A 1FWGC 3LNPA 1TVLA 1XKJA 1JUKA 2FHCA 4WSKA 1V8EA 4WY0A 2VQUA 3NSNA 4NASA 5BWAA 3PPCA 1ZJBA 4M1RA 5MHBA 4V2XA 4Y8FA 1E4MM 2A79A 3BMVA 3A24A 4DUOA 4KCVA 1LZOA 2NT0A 1FFRA 1EBGA 3DESA 4H8UA 3L23A 5M1TA 1BKHA 1XYLA 3ZIZA 1MRAA 3STCA 1HQTA 5LNUA 4GQGA 3CAQA 5A2BA 1YTEA 3E02A 3W2MA 1BRLA 1PX8A 1WQ5A 4PRWA 3N34A 3IIVA 5FL0A 5E9AA 1JFHA 3ARRA 5I3IA 2ZWYA 1NFGA 4DO4A 1ITXA 2OT1A 3BGGA 2HVNA 2O4MA 3GXNA 1KKRA 1H3GA 5AY7A 5C8BB 2O9PA 1FHUA 3RRXA 1Q6LA 1S2VA 2PDWA 2FB3A 2O7QA 3B0UX 2E6AA 4FX8A 4TQTA 4M0XA 2QDDA 5CPNA 3GFXA 2WQPA 3BCJA 2W27A 4QG6A 4D6DA 1FCQA 4MY8A 5HQLA 4NI8A 3EZ4A 2Z7KA 3GG0A 3KTXA 3AIQA 2QQ6A 3LYEA 3ITCA 2I5IA 4JN7A 3ZR6A 4PUKA 4BI6A 4R85A 4O10A 3PJWA 1UC5A 2AGTA 3N18A 1UWAA 3OGRA 1VIWA 1TPH1 3H70A 3UZYA 2WSQA 4M6VA 2Y5JA 1NWTA 4QR6A 4R53A 2UY2A 4AG0A 3B9DA 6REQA 4M19A 4UNLA 5GPRA 4LUSA 1NSJA 1KWKA 9CGTA 1DIDA 1W9PA 3SFKA 3IJ9A 2E6DA 2PB1A 4PTDA 3HG3A 3P80A 3UPWA 2ZZ6A 3AMKA 1AH3A 1O68A 1IWBA 3KBSA 3OYXA 4Q6XA 3WQ4A 1OX4B 4A8RA 3WQEA 4D1JA 2CHNA 2XWEA 4Q4PA 2PFHA 3OVRA 2ZADA 4LAZA 4IGMA 5I3DA 1G67A 3LPGA 4EXQA 4G1KA 3DI1A 3K4DA 4PMRA 3W07A 1VCGA 2ZA1A 3UCDA 4LOCA 3PZVA 4I6VA 2I56A 5KZEA 4KIRA 1KFJA 3BDKA 1OFDA 3RU8X 4H19A 3PTKA 1L2QA 1Q13A 2DZUA 3KUMA 3H2OA 3RAOA 2P8CA 3G3MA 3RMEA 4PC8A 1JI1A 1XC6A 1HT6A 3SECA 3IIPA 4G8TA 1MUCA 2F2KA 2PDJA 3SY5A 1M68A 2GL5A 2XH0A 1FQ0A 2X16A 3PBYA 1N8IA 2Y8VA 4MWAD 4KWWA 4WGXA 3KBJA 3K4AA 5I3HA 5BRBA 2J8FA 3KVKA 1UOZA 4HU0A 1ZBCA 2AKZA 3CMFA 1W3IA 4IFRA 2X42A 4HHPA 1YXCA 5DMLA 1MEHA 3GVWA 3W2LA 3R10A 3WNMA 3CIXA 1B4EA 1EH9A 2GGGA 1KD0A 1A5LC 2XSAA 3SY1A 3SI9A 3GR4A 3RJXA 3COTA 3Q37A 2WZHA 5EA9A 4PCTA 1H1NA 1VENA 1H11A 1AQMA 1KM3A 2X41A 2XZ9A 3HG4A 3F4VA 2W0UA 3CZKA 4ES4A 2CFFA 3FHQA 2NVCA 1ODUA 3U8GA 1RK6A 1JDCA 2ZUNA 4L9XA 2VFDA 1ZNNA 4JTRA 3S8HA 1R2TA 5CGQA 4ZO8A 2IPJA 3G1DA 2VFFA 2PWHA 3KP0A 4JN6A 4AD0A 4F0MA 3LTYA 3TKFA 2DDXA 2AMGA 1QATA 2QAPA 1MDLA 3GKFA 3WQDA 3DH7A 4Q33A 4LEFA 3PTDA 2Z1SA 1G9HA 1KQYA 1IXQA 2QJNA 4TR9A 4AHPA 1OF6A 4DBDA 3EGJA 4JBRA 2PTYA 2FPYA 2V38A 4DIAA 2B0MA 3BVJA 2ASHA 4FLQA 3PY2A 4HTYA 4HSHA 3SCNA 2PCQA 2QCMA 1M01A 3SCTA 2BFGA 1RVGA 4CNNA 3TYZA 4TU1A 3U2OA 1Q6FA 4GBDA 3IUDA 4HMNA 2OLSA 1ME8A 1SUXA 4PUDA 4C65A 3H26A 4I7UA 3CB3A 1VEOA 2OR2A 5CKSA 3W82A 3LNMA 2Y7EA 1TG7A 8XIAA 3N9SA 1KGUA 3O07A 4PSRA 1X39A 4LV9A 3TW6A 1VBGA 7XIMA 5BOOA 1F05A 4XD3A 3VA8A 3R8RA 2X1IA 4EXBA 1XYFA 1X1ZA 3FGCA 3AXXA 2WMJA 2Z28A 2XU2A 2O9RA 3APTA 3M4HA 3H4GA 4I5RA 4N6EA 1OGSA 4AIOA 1YXDA 4H7ZA 4LBSA 1VFTA 2GVLA 3S46A 5CZTA 1MSSA 5H8PA 2WZIA 1TMQA 1JNDA 3W6MA 4GIYA 4QXIA 2OO0A 3IAPA 3HN3A 4AH7A 2RGLA 2PDBA 1OM0A 4PUJA 3AIEA 3PWAA 4AMAA 4L4OA 4ZOEA 5F4SA 3SZ8A 1UP3A 5AHEA 3VVGA 3EA3A 5AC7A 4N9CA 1VKFA 1KRBC 1AD1A 4IUOA 1LOQA 4H8VA 3C3UA 1J8VA 2ODOA 2YXXA 2E0PA 1X7FA 2PC4A 1KXVA 4JTQA 5H8UA 1W9XA 1NWSA 3WQWA 1HJQA 1UWSA 1ZP4A 4CEUC 2XINA 5AVNA 2WANA 5HPCA 3ZT6A 1XC4A 3FHAA 2I16A 4IMCA 2F61A 3NVTA 3K8KA 5L9FA 3EX4A 4H9TA 4GYFA 1ONWA 2FZDA 1Q8AA 3NAVA 3KOWA 2W4XA 2OX4A 5C5YA 3FXYA 1JF5A 5E09A 1KC7A 3WLLA 1KM2A 2XYLA 3H23A 4GXMA 1BF2A 3NNTA 3QLLA 2HJPA 2YCLB 1QNOA 3O8AA 2VWTA 5CZJA 1XPYA 5HOSA 5AHFA 3WD1A 1ME9A 2CC0A 2OMAA 1ZS2A 4EANA 1PTAA 2QLYA 5JBDA 1W5QA 2ICSA 1VPQA 1QWKA 2QJGA 3NO1A 3C52A 5D8WA 2OOFA 1V7AA 1WUEA 4PTWA 1F6KA 1G01A 4DNMA 4HP5A 5E6YA 2IUZA 1GGOA 5REQA 4D71A 3CZGA 4F79A 4HA3A 1DV7A 3ITTA 1JZ2A 4ZOAA 4QFUA 1XX1A 1S2UA 4JTGA 5LA1A 4J3TA 1JZ8A 3W53A 1RSCA 3KVMA 4BJHA 4GUGA 3SEPA 3DU0A 1DJYA 2ZRYA 3WK3A 2HVOA 3WEOA 3KDNA 2DIJA 3CUHA 1CLXA 1MRQA 3SGGA 1XS2A 5E93A 1FP8A 5FAJA 5FJTA 4PA8A 2E9MA 4HPGA 3C61A 3CLMA 5DCBA 3QGKC 5D8ZA 4KMQA 4JGDA 3LZ5A 3KRUA 1YRRA 1V93A 3LCFA 5A8PA 2UV8G 1VLIA 1G4EA 4J3VA 3L5MA 3WF2A 1CGYA 2OWCA 1EEPA 3LXCA 3EOOA 4GCXA 3AICA 4RV8A 3ZM8A 2AOSA 3ZJ7A 1ZAIA 1ZLPA 1JZ5A 3OPSA 5K9DA 3P8JA 3TYUA 1PJ9A 4D6HA 3I68A 3LQLA 3C0SA 1Q6GA 2XUCA 2E6YA 3UWYA 1HJXA 1UBSA 1F4AA 1XH1A 1W32A 1ZJIA 1US3A 4F0HA 1G4TA 3I10A 2FGZA 3TN4A 3UF9A 1DTUA 4WKFA 5DY2A 1F7BA 1QAPA 2E40A 4N2YA 1QHOA 3I7RA 1AZ1A 3ES8A 1PCWA 2ZX7A 3GO2A 4DWSD 5F7UA 3E12A 5BW6A 3GXTA 1JFXA 4O4WA 3VGFA 3IJLA 1J96A 4ZO7A 4WIWA 2HTMA 3WD3A 1GVRA 2CZEA 2G4FA 2HMCA 5E0KA 4BF5A 3VC5A 4GUJA 1XBZA 4OKDA 2JEPA 1H1YA 4DWSB 8CGTA 1QU4A 1HL9A 4GWEA 1TTJA 2VEPA 3UR8A 4IXHA 4IMEA 1J0YA 1GVOA 3VOGA 3W22A 3P14A 4Z1DA 3BE7A 4JTTA 2J75A 2VHLA 4V27A 5FJUA 4BK9A 5A95A 2V68A 3BSHA 3R25A 4B5WA 4LVAA 3PF3A 2AAMA 3PULA 1S5NA 3WN6A 4RKAA 4R33A 4H6KA 3TNOA 1E55A 4ZTYA 3F7JA 3W3OA 5J04A 1TQXA 3PUEA 2CBJA 3EWUA 3F4CA 1PS9A 4F9DA 3MDWA 1ONRA 4H9YA 1F3EA 1F2JA 3V5OA 2C7FA 2Z1KA 4EF8A 3AUOA 2QUNA 3ID7A 2ZRXA 4FO4A 1N8FA 3LDVA 1J9YA 3FYPA 1JJKA 1ZRQA 3URNA 4NILA 1EHNA 2GDVA 3GYEA 4O8AA 3W1MA 3AZRA 1BWVA 1BGGA 2XVGA 4IISA 1VFMA 3PZUA 5A8MA 3P61A 3CB8A 5DANA 3NQFA 4IIBA 3WKZA 4OFCA 2RDUA 3I7SA 5I07A 4BWLA 4HU3A 4F4RA 1UG6A 1D2KA 1E5JA 4AZ7A 3C2YA 4D6CA 1A4LA 4DHGA 5T9BG 3WMSA 3N2XA 3CMJA 4R9OA 1QWGA 5I7GA 2R1NA 3MCMA 2VR4A 4RPPA 3RPDA 3H21A 1TE6A 2BHZA 4JXCA 5D37A 2Z1VA 3ALGA 3QEZA 1OK4A 4MDOA 3TFCA 3ZWSA 1KBBA 3E5PA 3N13A 5EMKA 4WDXA 4FLRA 2EO7A 3ABRA 3DFSA 1X38A 1H50A 3UR7A 4V1YA 4D6FA 2WSYA 2O7SA 5AHLA 1QK0A 3BAWA 3PNUA 3RLHA 5LKYA 2HRWA 2BDQA 1C29A 1OT2A 2QPSA 3HZ3A 3LLFA 1KRAC 5KINA 3BARA 1WV2A 3T7VA 2AQOA 4S3AA 3W7JA 8RUCA 3D0CA 4DF1A 3BLKA 1BKSA 3E6EA 4CVUA 4UTUA 2E5DA 4JFVA 1LWJA 4UTTC 4OV9A 3MPGA 1F3XA 2J7FA 5I23A 3W4RA 1EA9C 4MFEA 2GVEA 2UZ9A 4BWLC 3TA9A 9XIAA 3N2TA 3N15A 2REQA 3BJSA 3WY1A 2X0SA 3GNOA 4B2DD 4AIBA 1NARA 3OLDA 1I0BA 4S3KA 1DTNA 3SUTA 2BOGX 3KS5A 5C7HA 1XQLA 3K1GA 3QJAA 3HPAA 4L6OA 2HNHA 4NY2A 4XAZA 3TSBA 1AMKA 4AUBA 4AF0A 3MCNA 4UOJA 1Y5XA 1WDSA 4LC6A 4F2TA 2FGBA 1D3HA 3THQA 2WNZA 3WFLA 3RR4A 3B40A 1MVYA 4P7QA 3PTMA 2PDXA 2P5NA 1JCLA 2PP1A 5PTDA 1FDJA 1SJDA 4AZCB 5CPOA 3BMWA 3GTIA 2E09A 2Z1BA 3EA1A 1PDYA 3BAKA 1BFNA 3WDHA 1WZLA 4JTLA 1NELA 3T1GA 1SSDA 3E1F1 3PZGA 1VH7A 3LA4A 2ZC1A 4DM1A 1P0EA 5D9NA 1PWLA 4W89A 2KAUC 1XYBA 2RJGA 3VOHA 3WNLA 1VBHA 4O54A 4QCEA 4DZAA 2WQDA 4O14A 2Y88A 3QY7A 4UZSA 1GJWA 2W9MA 3CK5A 2FZ9A 4C6LA 1FWBC 4K68A 3BICA 1UD4A 3BV7A 3DG7A 2ZUUA 4DPQA 1GQKA 4Y9PA 5TBOA 3ZJ6A 3FXGA 4KWOA 4LNYA 4YU1A 4ZO6A 3BGAA 3RUBL 4E2DA 4W7UA 2EJ1A 2PUZA 3NQAA 1IEVA 1SO5A 2C6QA 1GVYA 3SGUA 1VRXA 3KBMA 1FRBA 2PE4A 1PIIA 5AYBA 3W72A 3PZOA 4EX4A 3BJFA 4HYWA 4QJ1A 5AYYA 1ZU8A 1OGGA 2NXHA 3CHVA 1HVQA 1EPVA 1TZ9A 4P5UA 3UR5A 3MMWA 4CN6A 2EG7A 3QQ1A 1POJA 1JDEA 3URAA 4GNKB 1TJ2A 5IFTA 1H7WA 6ALDA 2Y8KA 1BXNA 1A5AA 3MKVA 1TPUA 3QSTA 3G0UA 2XH2A 2PZ0A 1OBAA 1ICQA 1OFPA 3KBWA 2BV9A 2WMKA 3C0QA 5FKYA 2I57A 4C7DA 3ITXA 2PDLA 1N55A 1MNSA 1S2WA 2E28A 4ZO9A 4JTKA 3VGGA 2WNQA 1M3UA 4PH6A 3GFYA 4JHOA 1NEYA 4Q4SA 1B54A 1EDQA 3DKJA 2YA2A 4KGJA 2JGYA 1DIKA 4JPGA 4ML9A 3L0KA 1X6UA 1G6CA 2DJLA 3QTGA 3MUAA 4RJEA 1E0UA 4RR4A 1E5NA 3TVAA 5GQBA 1S2CA 1DWGM 1VFFA 3HGSA 3PFRA 2BG5A 3CTTA 5EMUA 1UHVA 3FK4A 2W91A 2QIWA 1Z6KA 2CHOA 2P3EA 4NXSA 5T91A 3MZ2A 4D6EA 1BWKA 1TV8A 4RNHA 1QI4A 2H9AB 1WKYA 2PPGA 1QCWA 1MQRA 3THAA 5LIKX 2PTWA 4IG2B 1H0GA 1E6NA 1NVMA 4L61A 4CD8A 2ACRA 4Q32A 3VINA 3LMYA 3CO4A 5DRCA 3CQKA 5C6MA 4ZXLA 5HBFA 1RUSA 3BJTA 4HOXA 3CV6A 2JKEA 1WKEA 1XBVA 1JCNA 3DG6A 3MA8A 2IKHA 3ARPA 4IX2A 1LDCA 2INFA 1UCWA 2JGQA 2QCLA 4UOQA 5EBAA 2NQJA 3NO3A 1PE1A 4JX6A 3CHCA 2Y61A 3FSUA 4HPHA 4NRSA 2XG9A 3QV7A 1F9CA 3M7SA 1KBIA 1A5KC 4GXPA 1RVKA 3BCDA 1V3HA 4KKXA 2INZA 1TJ1A 2YW4A 4ZBCA 1AG1O 4XZ9A 4H9VA 1GZ1A 2GUYA 1EX5A 4NVTA 4A2RA 1P5BA 4M6PA 2DIKA 1UQYA 1SJAA 2Z25A 3GZ3A 4XG1A 5JQ9A 4J3SA 3LHUA 1B5TA 2V63A 4G6CA 5CPTA 1SMAA 3ABZA 3TZFA 1NP2A 3BL3A 3MV01 3GG7A 4PB5A 5IXEA 3IGSA 5EU9A 2GJXB 3P5ZA 3C86A 3V0UA 3EWBX 1A3HA 2D3NA 3NR0A 1B90A 3NZQA 5HJLA 2V5BA 4O15A 3SN0A 4LAKA 3UY7A 3E0LA 1XGEA 3HU7A 3IJ8A 3LPPA 2XIMA 2XDFA 4KRTA 3MMDA 1Q6EA 2JF7A 4UMAA 3E2RA 4JDBA 1K9FA 1MFVA 1TYGA 3UG5A 1P6CA 1TZZA 1ZENA 4YCPA 4XSMA 1KW1A 1W1VA 3DYOA 4LCSA 3CUFA 2XIOA 4DLFA 3LXAA 4LVGA 4LYPA 1V3MA 3K13A 5DFAA 1WDWA 3ABXA 2G5WA 2O9TA 2OQLA 1DYSA 4UB9A 1CPUA 2KZHA 3RCNA 2GK1A 3BLPX 3GVRA 1R47A 3L12A 3O0FA 4NIRA 2EPLX 2FGLA 4GY1A 3B05A 3WZ0E 1X6LA 4US6A 4JOMA 4NJKA 4OTKA 4AD2A 5HINA 4B5UA 1DBTA 1EWDA 1T7LA 2VX7A 2OODA 3UERA 3WQOA 1TPFA 3LBCA 4RUBA 4K8EA 3SDOA 4E3TA 4ZEPA 3EPOA 5KTLA 3PK7A 4GJ1A 3TIMA 1G0CA 4ENLA 5C9XA 3ITLA 5FF4A 3RPMA 3FGCB 4H41A 1QDSA 1QMLA 1I0DA 4EWJA 1RZMA 3E0VA 4U10A 4EKJA 2DVXA 1KTNA 4NNBA 4O11A 2ZWZA 3BTNA 4IFKA 3O05A 2E25A 6TAAA 3AYVA 5D02A 4AY1A 5A6KA 1UZDA 3DOPA 4Z0JA 4S2BA 3W1NA 4LYKA 4TIMA 1UZ1A 4GO9A 2VZUA 3GLCA 2BXZA 2ZZ2A 2RDWA 2HBVA 2WPGA 3G1SA 4GUHA 4Q7NA 3NQ6A 2C91A 2HXUA 4RW5A 4Y9AA 3CUZA 3M1ZA 4IG2A 3AS2A 4OHQA 1K8ZA 3UG8A 3FAXA 1WDRA 2GQ9A 2H9AA 4FOJA 3DHDA 4CLMA 2PAJA 2VC9A 1NM9A 3WBEA 2UBPC 3ISIX 2JIEA 1Q8JA 4TV5A 4PFMA 4S23A 1SVDA 5IRPA 3DYPA 1GYLA 1JIBA 3EPMA 2DW7A 3P74A 2J25A 4GNJA 1PL9A 1OCQA 4M3PA 3BCFA 1B3WA 1BAGA 4Q8PA 2FVMA 3TYDA 2PLKA 3W74A 2ZIDA 3H54A 4FALA 3ERPA 1F8IA 4X9YA 1IEQA 3HURA 1YW1A 2BGSA 4FA3A 3SCOA 3WNNA 1ODZA 3AHTA 4B5VA 3PUOA 5D2XA 4H6EA 5AC6A 4YTTA 4NG3A 3KDOA 1IR1A 1HX0A 1JRBA 1KXTA 2PDPA 3RG6A 1DXEA 3TXVA 2GVGA 2OPJA 3K5XA 1GKRA 1DHKA 2VJXA 3OVGA 1Z7AA 4DAIA 3IJIA 2VGGA 3CIVA 4TTUA 1CBGA 3WLIA 5CPMA 3FX4A 3HGJA 2B4GA 5KZDA 3WUBA 2CWNA 3S6OA 3CZJA 2FTYA 2PA6A 4LU0A 5I00A 3PZMA 3HPFA 3KWXA 4O16A 3UZJA 4QEHA 2NX1A 2UY4A 1QK2A 3C5QA 5CC6A 1I60A 4G5DA 4P7RA 1JXJA 3IVTA 4C6JA 1EF3A 4ROPA 3GAKA 2E68A 4DBSA 1C9WA 2HSAA 4H04A 2A2IA 4CCDA 3G1XA 1KFCA 2CLHA 1H7NA 4U31A 1XL9A 4C6PA 4HNOA 3W7RA 1IT0A 4C6MA 4WK9A 2W5FA 4QG9A 3OZOA 4LVBA 1V0KA 4E2VA 3TX9A 3FEMA 4QJ4B 3GAYA 3O2LA 1QO5A 4AVNA 3LHZA 4WUIA 4AYGA 4KS0A 3TLQA 4Z2LA 4JQAA 1P0NA 2F38A 3OODA 4AWSA 2C79A 3Q67A 1YX1A 2Y7FA 1J0JA 3CJPA 3BOFA 2HK0A 3REQB 4Z42C 4AHQA 3RN6A 4ONVA 4QAWA 4I5UA 1QPQA 3TTEA 3D5HA 5KEZA 2GQ8A 4AXKA 1S5MA 1UWQA 2QPXA 4GZJA 3LS9A 2C14A 2OVLA 2ZUSA 2NV9A 3AIBA 3PSVA 2C15A 4UQ9A 4DWSC 3SR7A 4QNEA 3NIYA 3IAQA 4JL2A 1JDFA 3MI6A 1GW9A 2DPEA 2J47A 1R2SA 2DZWA 3W1AA 3BW4A 3I4EA 1CX9A 1TO3A 2A5HA 4QS5A 1JL8A 3W7NA 4XZBA 2POTA 1K9DA 3I6EA 3N25A 1P0KA 4ZB0A 3QZEA 5CPQA 5IOBA 2XFRA 1U5HA 4HIBA 4LS2A 3PZQA 2BY3A 2F8QA 3GD6A 5D09A 1H7OA 1R46A 1LBLA 1XIBA 4E0CA 4J3UA 3KRBA 1TUXA 3L21A 4E4PA 2X7VA 5DRIA 4UTHA 3T0BA 1YMYA 4I8DA 1V6TA 5AYIA 3C6CA 4BFAA 1V77A 2WC3A 4JNYA 2FJKA 3CYVA 4MUZA 4DYKA 1IR2A 1V3IA 4UNKA 1Q6OA 4N9EA 2QCEA 2J27A 1DPMA 4PEEA 1OEPA 2PI6A 1R3SA 3HQNA 3VIKA 3W88A 3W75A 4HGXA 1KXQA 1Z48A 3RLVA 1R86A 3NG3A 1DWFM 1TPWA 4ACZB 3VNZA 4WRHA 3PN8A 1TPDA 4HU8A 1XRTA 1FFQA 4UMBA 3ARTA 1PAMA 4LXFA 1UC4A 2FQIA 3S3GA 3AI0A 1GEQA 3SQSA 4URIA 1BHGA 1XIDA 3ABSA 1M65A 2B7QA 2XVLA 4IPPA 3TAOA 1VC4A 1UWUA 5BNKA 1I2QA 1W37A 2DV0A 3CPRA 2HZGA 1YNQA 3M16A 3T4WA 5C2XA 2HDJA 1K8YA 4C6IA 4TOQA 2FZBA 4FXRA 4DJEA 4ACZA 3MYPA 1DWAM 4BI5A 3RYSA 2CW6A 4C91A 5C2GA 1U5JA 4S3GA 1X96A 4MYAA 1RD5A 4XV0A 3M64A 2QCCA 2H8XA 2ZZ5A 5FCZA 3FN9A 5HMDA 2PGWA 4W4QA 4XZIA 4HA1A 5LA2A 1JZ4A 1EIBA 1SZRA 3GDKA 3OBKA 3RJYA 1J5SA 1I2OA 4XQ6A 1LOLA 4O50A 1VBRA 2OCZA 1A5CA 3NXFA 1PWMA 2VC7A 3ENLA 2Q3OA 2QGYA 3M5XA 3VAVA 4MHBA 1EXBA 1WUFA 2QPUA 2CZDA 1P7TB 2CZ5A 2EEXA 3GXPA 4JHMA 5LNRA 2YW3A 1KM0A 4I9MA 1CCWB 1M53A 5B7ZA 1RHCA 1O5QA 3TOPA 3H6OA 1UASA 2ABAA 4NL1A 5BROA 5CC7A 2GSEA 2W92A 3KOXA 1GVFA 1LG2A 4JY8A 3HGOA 1RK5A 3WBYA 3RU6A 3MP5A 1A5SA 3I3EA 1HJSA 4YYFA 2AQWA 1NDYA 2WM1A 3GU1A 4B9YA 3M7WA 3QOMA 4DWSA 4F9JA 2VEKA 2YOCA 1R0MA 3CBWA 3TCSA 3F5LA 3A22A 2ONEA 4K7YA 1C9DA 1P48A 2QV4A 1E4IA 3IANA 4Y9MA 4O0QA 4DLMA 1KRMA 2GWNA 3G6MA 3QOKA 2FVLA 3BLLA 1GG0A 4Y96A 5FF3A 3P7YA 3TW7A 2JE8A 1LT7A 3W2NA 4DXVA 3B9EA 4Z1YA 2I1OA 4FP1A 2DT3A 3MWCA 4NJHA 2P1FA 1SFTA 2PU0A 3B8TA 2HCVA 1YKWA 1KA9F 1AVAA 4MY9A 1GQIA 3EB4A 5HPOA 2D2JA 1KCLA 1KFWA 2Q09A 1CLKA 1EZ2A 3QN3A 1JUEA 3CWHA 4N6FA 4RW3A 3EWDA 3AXKA 3TSMA 4LUSB 3C2OA 3H4WA 5DF0A 3QYQA 3LRMA 3ZT5A 2GPTA 3GIQA 3NSXA 4H3DA 3A4JA 4TX8A 5FI8A 1QFEA 3R1ZA 4AD5A 6TIMA 4IGSA 3UXKA 4YLWA 4I3GA 5XINA 2VL4A 1H41A 1ONEA 2P0OA 2XTKA 4YHGA 4TXEA 3NQCA 3N9RA 3INPA 2TODA 1LRQA 3CIWA 4ZGYA 2A7NA 1GK8A 1PBGA 5E6ZA 4LAMA 4LJ3A 1B4KA 4EPDC 4QGCA 3EWCA 4K6AA 2QXWA 4O57A 1TTQA 3BGJA 3W83A 3W85A 1H7XA 4NKCA 4PCSA 1XSIA 4MZ1A 3HB9A 5H91A 3K30A 3W0KA 2PDMA 2XN0A 4XAFA 3S47A 5REQB 1GVEA 2F2HA 1QXLA 3NM1A 1XLMA 2ALDA 4JCLA 3CQ0A 3WMCA 3OGVA 5SWUA 3WUGA 2V2CA 3WELA 5JIWA 3BSGA 2V5LA 3MY9A 3K46A 5LXXA 1SYTA 4ATWA 3W01A 2DY3A 4M56A 1GVSA 3PBUA 3VDBA 5DT5A 3SO7A 2GOKA 3WF3A 5C70A 2YIHA 4GZ7A 1U30A 4GFIA 5AHMA 5LIWX 2J6VA 3W02A 3M0HA 3NL2A 4DVOA 4QISA 4Z2JA 4O1BA 5DXYA 2CLMA 3ZJ8A 2EGZA 4DJEC 1PX4A 3KTSA 4PBFA 2DIEA 4BA0A 3PS7A 5M17A 3E0WA 4XZWA 4WJXA 1O5RA 5D9OA 3VIMA 2ZRZA 3NYZA 3R89A 3THUA 1S3HA 4X22A 2PF8A 1H60A 1KM1A 3G0SA 2ZZ1A 5D4YA 1OFBA 3OA3A 4A3QA 2Z0IA 2BODX 1KLYA 4TVUA 1TPC1 3PJTA 1KGWA 4HNTA 1WOBA 5C0QA 1G69A 1A5MC 3PG8A 4K3ZA 3WEMA 3EBVA 4Y2WA 5EMMA 4XBSA 2J74A 3PP7A 3AWOA 3GH7A 3VE7A 4L1WA 1FX6A 1B30A 2Z2BA 1A5OC 4RDYA 4MAZA 3WLOA 3DGBA 3P93A 2PDUA 1E1CB 2G8ZA 2AMXA 3F2CA 4XIMA 3M5YA 4UTIA 1V4YA 2Y8UA 4X60A 4UQAA 1OFAA 4PZVA 2DSKA 1A47A 2HEJA 4UTKA 2JKAA 2GDQA 2ANUA 2V9DA 4J3XA 4LANA 2VGIA 4INFA 4XVDA 1UIOA 4NXKA 1RH9A 1DWJM 3VKAA 2NV1A 4AIUA 3AUJA 2ZQ0A 3TR2A 5IHRA 1GOIA 1MEIA 3MU7A 1GKPA 3HPZA 4U5IA 2UWFA 5FF7A 4IP5A 1GVQA 1IF2A 3A21A 2A4AA 2WCSA 5A6LA 2WMIA 2R1PA 5FD0A 2PC8A 1O1HA 3PVFA 1PIFA 3MBDA 2YCKX 2IQ0A 4GCAA 3H8AA 1X98A 1J18A 3BG5A 1BGAA 1UUOA 1W5OA 4F0KA 1CXLA 2EKGA 4WOZA 1E9LA 4UTMA 1CB2A 4GKTA 3T0AA 3AJ7A 3IPWA 4KEUA 1W91A 1XF0A 1UZHA 1YDOA 4X2PA 3UETA 1VFLA 3F5JA 4PL1A 4Y90A 3TQKA 3LQGA 3RPTA 1O66A 2BP1A 3I4KA 4L7ZA 4UR9A 3P6LA 4Q3MA 2VP8A 5EMYA 5CAHA 3VPLA 4XKYA 3UEQA 4FX7A 2DVUA 5K9XA 2CIPA 2VFIA 1XCFA 3N04A 4QAIA 4WD0A 1H5YA 7ODCA 2X2YA 2YKKA 3OBEA 4QBXA 1I2NA 1UUMA 2Z1WA 1HKKA 1S2TA 3I3DA 1QI0A 3R4IA 2ADAA 4GIS