2XFFA

Crystal structure of barley beta-amylase complexed with acarbose
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
486
structure length
486
Chain Sequence
NVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BETA-AMYLASE
publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
total genus 188
structure length 486
sequence length 486
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xffA00
4LX4A 5A8QA 3AISA 3O9NA 2XGBA 2D23A 4GQRA 3ZIZA 3CZKA 4M56A 3IJ9A 3VD7A 3WN6A 3BAJA 5HBFA 3AIUA 4E4PA 4BQ4A 1XH2A 4PTMA 3WL1A 3AOFA 1BYDA 1CXEA 4DWSC 4P8UA 1UR9A 4XV0A 3RJXA 4D6DA 3PN8A 1PPIA 4AD0A 1CIUA 1SMDA 1TMQA 3HU7A 3OB8A 4GI6A 2YA2A 4ML4A 4GIAA 1MQPA 1V6WA 4HOWA 1FFQA 4OUEA 2VMFA 4RE2A 4W5UA 2DSZA 3K4AA 4TTUA 3FHQA 3RJYA 1B3VA 1JI1A 3OG2A 2JEPA 4TUFA 2WWDA 3BAYA 1CNVA 3TTOA 2OWXA 3VGHA 3W4RA 3ZSSA 5A2AA 2FH6A 3L4ZA 4NI3A 3UR7A 3WUGA 1OINA 1R86A 1GORA 1UWRA 4OBSA 3FAWA 2XFRA 3AMDA 1LWHA 4M1RA 1E1FA 3L2LA 2WZIA 2WSPA 4MPKA 1V6UA 1QVBA 2DQXA 3KL5A 1AQMA 1ISWA 4ZXLA 1BHGA 1JZ7A 5AYIA 1L8NA 3ARYA 1NOFA 1I1XA 1KCLA 2XUCA 1FHLA 3ALFA 1WPCA 2VR4A 2CXGA 2WWCA 3BCFA 3EYPA 4UCFA 1MXGA 4AZ7A 3VOCA 1BAGA 4JFSA 5A8PA 1JD9A 4OIFA 1ISYA 3EDFA 1LL4A 2CESA 1M7XA 5HDRA 1UH3A 4B9ZA 4P8WA 1WNOA 2CYGA 1HJQA 3DYPA 4PSRA 3GXMA 2VRQA 3BSGA 3U7VA 3A4XA 4CU8A 4KMQA 4AWEA 1RPKA 1C91A 3U5YA 4EAMA 1BFNA 1CENA 4D1IA 3RPMA 3WMBA 4F9DA 3KL0A 3NIYA 2VNCA 3QOKA 3OA5A 2BY3A 2J47A 1UKTA 1Z32X 1WO2A 3ZR6A 1Q6EA 4KGLA 3HJEA 3CO4A 1E1EA 1TVNA 1GVYA 4P7NA 3F5KA 3POCA 1TG7A 4HOXA 2WXDM 4TVDA 4U33A 8CGTA 4AYSA 3SCWA 3VDHA 1B31A 3FNDA 3L4TA 3A4WA 5FD0A 2D1ZA 3WENA 1DP0A 1AMYA 3BMWA 3VGFA 3QOMA 1XCXA 4MADA 1F4AA 2UY4A 2GJRA 3AS2A 2FGZA 5DT5A 1JDDA 4KH2A 3W6LA 1QW9A 3AZSA 2W61A 2WKLA 4NZCA 4PMNA 1KWGA 3II1A 3NSXA 2ZX8A 3AHTA 3BAXA 1B2YA 1LG2A 3SUUA 1E3XA 2BVTA 2BFGA 2NT0A 2YIHA 3G6LA 3GTNA 4F79A 1BLIA 1ZB5A 2J7DA 2D0GA 3SCSA 1EDGA 4UOZA 1J0KA 4BS0A 2PWGA 2YL5A 3VIPA 4QLLA 4AEFA 3WDQA 2DT0A 1LG1A 3VGEA 5D4YA 3BSHA 1WDPA 1QW8A 1LLOA 2BNJA 4W7VA 2XJ7A 1JIBA 1WDSA 2DPEA 1IZKA 1RH9A 1QOXA 1V6VA 3OLIA 4DWSB 2Z1SA 4MB3A 3AMLA 1RD6A 4HU0A 5A6SA 3WUFA 1FOBA 1CXFA 5D9PA 4QDMA 4PTVA 4JZ5A 1IZJA 4GXPA 1LWJA 1O6IA 3WH5A 1UZ1A 1CXIA 1AVAA 4M8UA 3AIWA 4D6GA 2WLYA 2ZWZA 4HZ7A 1NWSA 1TR1A 2VCCA 2WBGA 1E72M 4H8VA 3WUBA 3AHXA 3QGVA 1YHTA 3J7HA 1ZJBA 2VX7A 3W25A 1EHAA 1Y7VA 2ZE0A 1VBUA 3BGAA 4CD4A 4X0VA 4D6CA 5M3WA 1K9EA 4AZ5A 1CLVA 2J75A 1J11A 2BXZA 1TZ7A 1JYNA 4S3KA 5KZ6A 2WMGA 1D7FA 1QI3A 1E40A 3WF2A 3VMPA 1VFFA 3CZLA 1RP9A 1CGWA 2E0PA 3WKZA 3WMCA 4D6EA 1FP9A 2PC8A 1S46A 1ZU8A 5C70A 1VAHA 1JI2A 1DWHM 3T2QA 1GUVA 1VEPA 3O6AA 3VUPA 1TFVA 3SIMA 4KWUA 3W27A 1JFXA 2WSKA 1GQIA 4B16A 4H8UA 3AYSA 4WF7A 1C8QA 1IV8A 1H2JA 4KRUA 2FH8A 3FAXA 2GFTA 2W4XA 3VDBA 9CGTA 1A3HA 5E0CA 1W1YA 1UZ4A 1Q6CA 2BVYA 1BYCA 3RM4A 4BQ3A 2UY2A 4JFWA 1KR1A 2OYMA 2WM0A 2V38A 4W84A 4A3YA 2YDQA 4LYPA 4PMUA 2VJXA 4ACYA 5EBAA 5I5RA 2D3LA 1SYTA 3T0AA 4W5ZA 4WKFA 5DMYA 2CPUA 1IT0A 3SUWA 3U7BA 5A6AA 2VVSA 1VF8A 3W26A 4P7LA 2EQDA 2WHMA 4PUDA 4GZJA 2OYKA 2CNCA 3IAQA 3VU2A 5HOSA 2EXOA 3M46A 5I23A 1JNEA 3QR3A 1JDCA 4V2XA 3RDKA 4BF7A 4E2OA 5ABFB 3ARRA 3FXYA 3AMCA 4UOJA 3PBGA 2W67A 2VURA 4J3TA 3I3EA 5D8ZA 4UR9A 1V6YA 1FA2A 1OIMA 1W1VA 2BY2A 2F8QA 1UA3A 1ISXA 1VJSA 4MJ2A 1W2PA 3AZTA 1D3CA 5C71A 2J25A 3GBDA 1MFUA 2J4GA 1W9XA 5AYBA 1TE1A 5JBEA 1C92A 4UNIA 1HKMA 4R27A 3B9AA 2W92A 2BVDA 3MUY1 4Q22A 2XWEA 4FLOA 3EDDA 3CZJA 2F61A 4MNJA 3VGGA 2X1IA 4Z2JA 3ZJ8A 3MUAA 3ZJ6A 5JBFA 2G3NA 3TTSA 3VINA 1EIBA 2V5CA 3WDPP 1CZ1A 2WMJA 3ZT5A 4BCEA 1E4LA 2PWDA 4E8DA 3N15A 3POHA 3BAIA 3WSUA 1DWGM 2Y4SA 1GVIA 1QI2A 4PCSA 5ABEA 1QBAA 3O2LA 3PTQA 3WD4A 6CGTA 5E0FA 2ZXAA 4KGJA 1FHDA 4LPCA 3OZOA 5I3DA 1QNOA 3CZ8A 2CETA 2W91A 2WC7A 4OKDA 2BY0A 2J7CA 2B31A 2UWFA 4UZUA 4UQCA 1HJVA 5HXMA 2VZUA 5A2BA 4D71A 1PIFA 1W3LA 4YHEA 1KXVA 1QI0A 4AD1A 4F9JA 2WHJA 1WZKA 1KBBA 1UUQA 2ZIDA 1DTUA 3M7SA 2G41A 3TP4A 2GJXB 4AZ6A 3VNZA 3THCA 4HA4A 3AS0A 4U5IA 4QLJA 5GNZA 2GDVA 2G4FA 2D0FA 3SCRA 3EMZA 5ABFA 1E6QM 4GINA 1UWSA 4BA0A 3AIRA 4HPHA 1HJXA 2PF0A 1PZ2A 3WQWA 2G3MA 1E0VA 2D0HA 2VZSA 3VDCA 2PB1A 3VD9A 1MW0A 3BCDA 3SUVA 2E40A 1HF6A 3BAWA 4ZEPA 3A4AA 5A6JA 2UY3A 2JALA 3WNMA 3ZO9A 4HMEA 2ZWYA 1ISZA 2O9RA 1UD2A 3WNOA 2X09A 2VCAA 2XFYA 1EOMA 4LYQA 2GUYA 3IJ8A 1W1PA 3TA9A 3FY1A 4MJ4A 4TTGA 3LPGA 4BQ5A 4DUXA 5CQ1A 2G8ZA 1M03A 1QHOA 3SCQA 1C8YA 1JYXA 2TAAA 2AMGA 1E5NA 3AHZA 3WIJA 4JKMA 3PZIA 1KR0A 1OB0A 3W37A 1BF2A 1HL8A 2FHCA 3VO0A 2WAGA 1UG6A 5CPSA 3VM7A 1ITXA 3G6MA 1BGGA 1J0IA 2VX4A 1KGWA 2DDXA 4M24A 2DT1A 4B3LA 1KBKA 5CPTA 5I77A 1EDQA 2ZX9A 2CEQA 4B3KA 3RMEA 3MSGA 4IM4A 1E0XA 4W8AA 1XCWA 3ZQ9A 4H8HA 1LL7A 4HP5A 1MWOA 3MV01 1XSIA 2A3CA 1QHPA 3RILA 4ZENA 2VZVA 3OLGA 3VKKA 3MS8A 1K6AA 1EQPA 4U2YA 1ZBVA 1JGIA 1E71M 3OGVA 1E6NA 1GW1A 4UQBA 1GOQA 1V08A 4AZIA 4AD2A 1TA3B 1HT6A 2QV4A 1H5VA 3ARZA 1UH2A 3VGBA 3VIGA 5EB8A 1UKOA 2VT0A 5BCAA 1PEZA 3EMCA 5BRPA 5HPCA 3WNNA 3M6DA 3VIKA 3AXHA 3WBEA 1CGUA 3K1DA 4V28A 3CBWA 2DH2A 2YL8A 3CHFA 1B0IA 3N12A 1E6XM 2VVNA 3WELA 3HMCA 3N11A 1WDQA 4JHZA 1KXHA 1R8LA 3ARVA 2BY1A 4OBRA 2ZUUA 3TTQA 3IANA 3K8MA 3WH8A 1EOKA 1JFHA 5I24A 3GH5A 2E9BA 3RCNA 4CCEA 2DSWA 2IXVA 4EE9A 1BGAA 1C90A 1W9PA 3PZNA 3UCQA 5HPOA 2X8RA 2O92A 5CSUA 4P8VA 3ZT7A 3PZGA 5A8NA 3WD1A 3D3AA 1UR1A 1SR0A 1QNPA 2ZUVA 1DWJM 4CKQA 2WKGA 3ZJKA 5CGMA 4W8BA 3W0KA 5KEZA 4J7RA 3AXIA 4DM1A 1V3KA 1OGBA 1VBRA 1E0WA 1UD8A 4RE4A 4WSJA 2XFFA 3GDBA 4WJXA 1MQRA 1UWTA 1MXDA 2J7BA 1UQYA 2ZUNA 2YDSA 3QHNA 3BLPX 4MB5A 4AZHA 1QI5A 3S2CA 3BH4A 4W87A 1KQYA 1DWAM 5E6YA 2FDMA 3MMDA 5BWFA 3MMWA 3VIFA 3CIVA 1PX3A 3THDA 4P7RA 3T2PA 1HKIA 1ZS2A 3W24A 2YLLA 1FFRA 2WC4A 2Y24A 4MNKA 1B1YA 1US2A 4XZWA 2YL9A 4QP0A 1JZ3A 3GNPA 4Z2GA 1H4PA 4AMCA 1P6WA 3GNOA 7A3HA 4WLCA 2OWCA 3AQUA 2Y8KA 4FLRA 1JZ5A 1VJZA 3W28A 2VX5A 4PTXA 2DGAA 4CVWA 3AROA 2PI6A 4MDOA 4OOZA 1K9FA 1NOWA 3ARPA 3AIVA 2WMHA 1OBAA 1NP0A 2ZUTA 2VRJA 4M81A 2A3AA 1H49A 4D6HA 5A95A 2IUZA 5CSYA 4CN6A 1HJWA 4U3AA 5CG0A 2YBTA 2FHFA 4PCTA 2JEQA 1TA3A 4UZSA 3OBAA 1KB3A 2J7GA 3VDAA 4UFJA 2O9PA 2VQTA 1OCQA 3VM5A 2WMIB 5I6SA 2Z1KA 1D2KA 2DIJA 3WEZA 3ARWA 2PBGA 2GK1B 4H7VA 1JZ4A 1M01A 4BQ2A 1H1NA 4UTFA 1JXJA 2WZEA 3UERA 2DH3A 2Y5EA 4TVUA 4WKHA 1CGTA 4D6JA 2Y8VA 1BPLB 1FH9A 3MMUA 4QCFA 1WAWA 2C7FA 3ARUA 3SCVA 1Q6DA 3W29A 3B8SA 4PMVA 1E4MM 1NOUA 4AZCB 4B9YA 4TXEA 3VIJA 3PZTA 3GM8A 3QHOA 5I0DA 3BC9A 4LYRA 1U30A 3KE0A 5I78A 4PMDA 2DIEA 4QAWA 1DWFM 3DYOA 4FLSA 1TUXA 3WF1A 1JAKA 2RGMA 2C8NA 4PSPA 5AC4A 3VGDA 3IAPA 4PBGA 4WSKA 5GNYA 4U2ZA 1EH9A 4MDPA 3KZSA 1QNSA 1W3JA 1XD1A 4Z2KA 3RM8A 4CU6A 1UD3A 1B3ZA 2WMFA 3WDHA 1ITCA 5D9NA 2FGLA 1KXTA 2G3IA 4D72A 7CGTA 2W5FA 3PTMA 3GZAA 4CD7A 3MUIA 2J7EA 4W7WA 3WDRA 2OWWA 1W9DM 1X1NA 1I1WA 3BMVA 1CGVA 1JL8A 2YKKA 2X05A 8A3HA 1G9HA 1GQLA 4WK9A 3NYDA 4GO8A 1KXQA 4JCLA 2VZOA 1G0CA 2WPGA 2WYSA 2A3HA 2JF6A 2WCGA 2QF8A 1UR8A 3T0DA 1YQ2A 2YOCA 4MB4A 2QLYA 4ZXOA 2WNWA 1UR0A 3L4UA 1V02E 2ZXQA 1HJUA 3I3BA 1JZ2A 2Q8XA 3N04A 4AISA 1UOKA 4C7DA 4PUEA 2ZUMA 3AIEA 1EHNA 4YN5A 3JUGA 4PN2A 1HVQA 2X2YA 1VIWA 2OSXA 3GYCA 1GPFA 1XD0A 2WHLA 5ECUA 2DSVA 3VMNA 3AMKA 4D6FA 4TX8A 1V0MA 1UA7A 4DWSA 2WW5A 4ZFMA 1KGUA 2GK1A 5LA0A 2WANA 4UQAA 2JIEA 2XHYA 1UKPA 2J8FA 4YPJA 2ZX6A 2V3EA 4DWSD 3U5UA 1LJYA 4AEEA 2XGIA 4W89A 4PTWA 3KWXA 4IUGA 3WNLA 1QPKA 3WD3A 5A8OA 3WF3A 4L4OA 1XRVA 1CXHA 2XYLA 4AZCA 1JD7A 1C7SA 3PHAA 2JFEX 1QNRA 3WQVA 2XTKA 2E8ZA 3WL0A 5BXTA 1OD0A 2A3EA 1HVXA 2ZICA 5JBDA 4CCCA 4MAVA 4XZBA 3WEOA 2DT3A 1B30A 5I79A 1JAEA 3N13A 1MQQA 3VIMA 1W3KA 3SUSA 2WCAA 1QBBA 5D9MA 5LYRA 4AZGA 1HXJA 4PRWA 5CJ5A 2YJQA 2VRKA 4AW7A 4RE3A 3F4VA 4GI8A 1CWYA 1G01A 1V3MA 2CBUA 5BYWA 2CIPA 1LL6A 2YBUA 1JXKA 2EPKX 1NM9A 4J3VA 5EFDA 1XYFA 1OWQA 4P7OA 4PMZA 1H3GA 1E9LA 2XIBA 2JIWA 3W53A 2XPKA 1V02A 1HIZA 1CGXA 1CECA 2X0HA 1PIGA 3ARTA 4JCMA 3AXXA 4UFIA 2DEPA 3AHVA 5CGTA 1E6PA 1ZJAA 5HNNA 1EO5A 3AMGA 5CZKA 2WC3A 1MYRA 1WE5A 1UKQA 1OSEA 1C7TA 1J9YA 5IFPA 3L4XA 1GCYA 1GQKA 2ZX7A 5BRQA 3AFBA 2PBOA 5FOOA 3B9EA 5FL0A 4H04A 4CD6A 3NJ3A 1OT2A 4EANA 4NRSA 1BVZA 3UETA 4J3SA 2J62A 3L2MA 5A1AA 2WVSA 2CBVA 4XB3A 1NQ6A 2YA0A 1UD4A 3F5JA 4LGXA 4B15A 3DECA 1TCMA 2ZXDA 1CXLA 4NRRA 1E5JA 1SMAA 2J77A 4QCEA 3ALGA 3W6MA 1PX4A 4CD8A 1JZ6A 4JFVA 4LXFA 1UYQA 3MU7A 3LPOA 3WFZA 3N1AA 2MANA 5A69A 4URIA 4A4AA 3ZR5A 4MNLA 4PYSA 3CZGA 2EJ1A 1U2YA 2HVMA 3LMYA 3AI0A 5BROA 2G3JA 4Z2HA 3BXWA 1I75A 3WF4A 4JFTA 1WZMA 3WBAA 2DT2A 3AS3A 4JKLA 2Y2WA 2GJPA 4S3JA 4UQDA 4GZEA 4OJYA 3DHUA 4CU7A 6TAAA 2QMKA 3MKKA 1CEOA 3SCOA 3M07A 5DO8A 2EPOA 1MW3A 4WIWA 3I3DA 4AD5A 5M5DA 3WNPA 1PBGA 4W88A 2VOTA 6A3HA 4TOQA 2VI0A 5M17A 3W81A 1OGGA 4AXNA 1J18A 1B3XA 4K68A 4QLKA 4W7UA 5E6ZA 3FN9A 3U57A 1E55A 2CERA 2JE8A 2A3BA 2WHKA 2CKSA 3GNRA 3IJ7A 1G5AA 2J7HA 1Q6GA 3W38A 1V6XA 2VZTA 5DF0A 2WVVB 3AIBA 4XUYA 3D5HA 5GPRA 3WQ5A 5E9AA 3IK2A 1V0KA 3WNKA 5JIWA 5FL1A 1UH4A 3FW6A 3TTYA 2ZOXA 3T0BA 4UFLA 1ZL1A 2YLAA 4DUWA 1Q4NX 4C7GA 1XC6A 3QHMA 1HKKA 5A8MA 4MTVA 2BHYA 5JIPA 1HN1A 3A47A 5CLWA 1JYVA 5EFFA 1GZJA 1EQCA 4JIEA 2J7FA 3WD0A 2GVYA 3K4DA 1ZBWA 3ZMRA 5CPQA 1GQJA 4NSBA 4Y7EA 5IDIA 3PZOA 3CZEA 3MANA 1E15A 1XSKA 4GQQA 1GOWA 1BG9A 1HJSA 1UKSA 3CH9A 3KL3A 3WF0A 4P8XA 4AZBA 2QPSA 1HP5A 4ZE5A 2D3NA 1AQHA 1XH1A 4GKLA 5ABGA 1XV8A 3WDIA 2VO5A 3EMQA 1VFOA 3GXFA 4ATWA 4A3HA 3WH9A 2GJXA 1VEOA 1XYZA 3UR8A 2XM1A 3AJ7A 1CTNA 4RL3A 3MV11 3A3HA 4LQ1A 5FIPA 3SCNA 1JYWA 1XH0A 3K8KA 3RIKA 1J0YA 4W8LA 4CGTA 3SUTA 2EBNA 1CLXA 4UQ9A 3NDYA 4HMCA 5IXEA 4M82A 1V0NA 2W62A 2D20A 3EDJA 1J0ZA 4ZE4A 1BG4A 3OIHA 1EA9C 3CMGA 1X6NA 1DEDA 4J3UA 2YDRA 3WQ6A 5IFTA 4FMVA 5E70A 1CXKA 4Q7NA 5A6KA 5IHRA 3MUZ1 5IHSA 1HNYA 1VRXA 2HISA 1HKJA 3NSMA 1B90A 3KEHA 3VIIA 2CHNA 1OM0A 1A47A 2CHOA 2WMKA 2UY5A 1WB0A 1MVYA 4PMXA 4TX6A 2PWHA 3MO4A 3VVGA 4HZ6A 3WEMA 1C93A 1VENA 4HMDA 1BYBA 1V3LA 2WVVA 4UFMA 1KCKA 5DT7A 2RGLA 5BXSA 1Q6FA 1K9DA 3PTKA 4NF7A 3ZJ7A 4HA3A 3PZ9A 3L4WA 2VC9A 1BTCA 3VD4A 2XVNA 3L4YA 1H41A 1AQ0A 1BVNP 3TONA 1V3HA 3APGA 4EK7A 4FLQA 3FHAA 1KGXA 2VCBA 3CTTA 2V3DA 5CLTA 3VX1A 2EO7A 3WFLA 4HPGA 1L0PA 4IISA 1E4IA 2J79A 4UQEA 3AIQA 4CUCA 2YA1A 2ESCA 4IPNB 4GPNA 3N9KA 1B3YA 2ZUSA 2J74A 1PZ3A 1OGSA 2FHBA 3N18A 4UFKA 3T08A 2EPLX 5CXPA 1B9ZA 1E70M 2NSXA 1H0GA 3SEPA 1DWIM 4EKJA 1KFWA 2QHAA 1W3HA 3ZOAA 5D9OA 3N17A 1BYAA 4Z2IA 2EEXA 3DC0A 4E8CA 1WZLA 3CMJA 4F66A 1GONA 1EGZA 4PMQA 5LA2A 3UG5A 3W82A 3WQ8A 3DYMA 1ESWA 4N0RA 1UWIA 2CITA 4MB1A 2CKRA 4HZ8A 1M04A 3GH4A 1UHVA 1JF6A 4MAZA 2BHUA 2O9TA 3ECQA 2WLZA 3CHCA 4MNMA 1OD8A 1JNDA 2WZHA 2E8YA 1E6ZA 3AS1A 3VTRA 2V3GA 4J27A 2VUYA 1GOIA 4JFUA 1KQZA 4AY1A 3UG3A 1WCGA 3LPFA 4JKKA 4AD3A 2CBIA 2E3ZA 1WKYA 2XVGA 4AC1X 3NSNA 5A2CA 3CPUA 1EO7A 2D24A 3MSDA 4D1JA 3VPLA 3UG4A 3WMSA 3NUKA 2E9LA 2J8GA 1W91A 2XIIA 3VMOA 2VL4A 4KRTA 1GOOA 5DFAA 5FCZA 2NT1A 2WVTA 1US3A 3BAKA 1C8XA 2QMJA 1E6RA 2D22A 3OLDA 3F5LA 2OLHA 4J3WA 1UD6A 2WK2A 2ZUWA 3K46A 3CUGA 2BHZA 1PJ9A 1GOKA 1W9BM 4U5KA 1N82A 2QPUA 1O7AA 1UWUA 3OGRA 3CUFA 3HN3A 4DM2A 4J28A 2PWEA 1ZBCA 2OYLA 5JUVA 5LA1A 3GXDA 3ARXA 2OSWA 1B3WA 4FK9A 4N42A 1E3ZA 4AIEA 3OZPA 1CBGA 1UQZA 4P7QA 1LF1A 1ISVA 1MFVA 4L4PA 4GO9A 4CN4A 2BV9A 1M53A 1E73M 1BSIA 1J0JA 3WUEA 1JZ8A 1F4HA 2XVKA 3GH7A 4X0NA 5BXRA 4QFUA 1NWRA 2V3FA 1HL9A 1MW2A 2C0HA 2GSJA 4AIOA 2XVLA 3AZRA 4CD5A 1W9VA 2EPMX 1NWTA 5M03A 1W1TA 4AIUA 1JDAA 2VX6A 3OGSA 1JG9A 3E1F1 5DEZA 1LQ0A 1GHSA 3CUHA 1FH7A 1CPUA 2E9MA 3ARSA 2WMIA 2AAAA 5A6LA 2DSUA 3CHDA 3WDJA 1SFSA 3EDEA 3CUIA 2EPNA 3AICA 4ACZB 5TD4A 5GNXA 3EDKA 1QI4A 1HP4A 4JL2A 3WD2A 2W63A 4Z2LA 5A94A 3GBEA 3CGTA 1EXPA 1GJUA 2ZX5A 1PX8A 1ODZA 4H41A 4FF5A 4H2CA 3L4VA 4WKAA 1NARA 3PZMA 2XSAA 1V3IA 3RO8A 3A6OA 1GJWA 1W32A 3VIOA 4OZOA 2F2HA 4CN1A 3TOPA 4CCDA 1V03A 2XWDA 2WCSA 4C7FA 1GHRA 1ODUA 1CYGA 1U33A 3VD5A 5C8BB 1QHZA 1E56A 3NCOA 4AD4A 1DHKA 3PZVA 4GI9A 3RM9A 3SCTA 4F8XA 1V0LA 1VEMA 2CCRA 2WBKA 3VNYA 1FP8A 1E6SM 5D8WA 2E4TA 1PAMA 4PMYA 3SCUA 3T2OA 1GOMA 3PZUA 4M29A 1J01A 2WVUA 4W93A 1CGYA 1JF5A 2OSYA 1XGZA 4PMRA 3UESA 1X6LA 1UWQA 3WH7A 1R87A 1OT1A 5I2UA 3CHEA 1ECEA 1R85A 1R7OA 1G1YA 1RP8A 1UD5A 2VQUA 1J10A 1MW1A 5A3HA 1R7AA 4JAWA 1EDTA 2XSBA 5A6BA 3AHYA 5ABHA 4JL1A 1KWKA 3PZQA 3ARQA 2VTFA 2V5DA 3LPPA 4TVCA 5BXPA 3B9DA 2GDUA 2PWFA 4YHGA 4DUVA 5A6BD 2WB5A 4M80A 1E4NA 1WDRA 4HTYA 4X9YA 1H11A 1ZBKA 2JF7A 5AY7A 1W2VA 3NDZA 1OIFA 3ZT6A 3UEQA 4XX6A 3GXIA 7TAAA 4UFHA 2ZXBA 4ACZA 5A6MA 1G94A 4R5EA 1C3FA 1E43A 3CLWA 3AYRA 5AC5A 3VX0A 4PEEA 3ZSTA 3VILA 3SURA 1NH6A 3WH6A 4W86A 4U3CA 3OLEA 1VB9A 1K9TA 4ATDA 4UOQA 4W85A 1VFMA 3BLKA 3VIHA 5EMYA 1J0HA 4HOZA 5E09A 1BQCA 2XM2A 1H09A 5F7UA 1WZAA 1QNQA 3WQ4A 1NWUA 4J3XA 2IXUA 1TVPA 2NW0A 4BZYA 3CUJA 3VD3A 4IPLA 4HU8A 2D2OA 1XSJA 2VR5A 2YL6A 4V27A 2O9OA 2XG9A 4D6IA 2BS9A 2J78A 2CBJA 4GZIA 1W9UA 2W66A 1NP2A 1V3JA 1FH8A 1H0IA 2BXYA 3ZM8A 1UR2A 3SCPA 4JHOA 2AOSA 4OOUA 1GNXA 3K8LA 5FKYA 3DHPA 4U31A 1J12A 2XVPA 4PMOA 2DSKA 3EBVA 4HA1A 4CVUA 4ATLA 3S6TA 1UR4A 2X0YA 5GQBA 1WP6A 3T09A 1CDGA 1HX0A 1VFUA 1XHGA 3WY1A
chains in the Genus database with same CATH superfamily
1R3QA 4HCHA 4UTUA 4ZMGA 5A8QA 3R5EA 3EWWA 2XGBA 4DPQA 3MP3A 4AWTA 4EAYA 2DUXA 3GR8A 3GUGA 1YDNA 3VD7A 3SAZA 3WN6A 1X96A 3LV6A 1EJUC 3H2FA 4E4PA 3SGZA 4NYUA 1EZ2A 1QWGA 1KM0A 4P8UA 1PPIA 4AD0A 5IOBA 3OB8A 1WXYA 4HOWA 1AW2A 2VMFA 1C29A 3K4AA 2Y0FA 4TTUA 1O95A 4AF0B 1ZY9A 3KRZA 2A85A 2WWDA 3W4RA 3ZSSA 5A2AA 2F9RA 2C19A 1XWYA 1OINA 3CYJA 1OX4B 4FSAA 1PYFA 1GORA 3VE9A 4OBSA 1LWHA 5HUPA 3GQYA 3L2LA 3RMJA 2WSPA 1V6UA 4M7TA 1QVBA 2DQXA 1MXSA 2V2HA 3V75A 4LS0A 1X98A 4J9JA 4ZXLA 2I5IA 4C1NA 3EKLA 1DIKA 1N8FA 1AG1O 4S3GA 4C6PA 1AUSL 1KCLA 2PAJA 3MDUA 1SO5A 5HMSA 3S4TA 3EYPA 1MXGA 3OEXA 3TV8A 1BAGA 2D2GA 5J5RA 4IX0A 4FO4A 4OIFA 1R30A 1TCDA 1UH3A 4B9ZA 7ODCA 1HJQA 4I5RA 5HATA 1RAKA 1JDEA 1WUFA 5DLCA 4C6IA 1EFZA 3U7VA 4L6HA 4AWEA 3U5YA 2E6AA 1BFNA 3KL0A 1A3XA 2VNCA 3QOKA 2Z0IA 1F7BA 3D6NA 1UPMB 3LERA 2XN2A 2WXDM 4U33A 8CGTA 1H1YA 3SCWA 1B31A 1HQTA 3W7HA 3IIZA 3SQSA 4PL1A 3P8IA 2CFFA 1DP0A 1AMYA 5F2IA 3KVJA 3T7VA 1G7VA 3C4UA 2ZADA 1GG1A 1F76A 4IGNA 3AS2A 2FGZA 3SN4A 1R2SA 5HQEA 4MZYA 4M51A 4NNBA 2WKLA 4NZCA 1EP3A 1SZNA 3II1A 3DG7A 1DJZA 2PTXA 3GAKA 3LUTA 3ENLA 5AHMA 1IR2A 4V15A 2BFGA 2YIHA 3MWCA 2P10A 3GTNA 4NAFA 4H3DA 4GCAA 2OJPA 3U8GA 1J0KA 2ALRA 3M0IA 3R10A 4O54A 1ADDA 4ZOAA 2DT0A 1LG1A 2WSRA 4QG6A 4CQCA 3OVGA 1QW8A 3VZZA 1LLOA 5DN1A 1BXCA 1XLLA 2XJ7A 4GVIA 4B3ZA 3KRBA 1RH9A 4DNMA 1U5HA 1VZWA 2HTMA 2PLMA 4XVDA 5AECA 1GVFA 3GVRA 4JNYA 1XLCA 4QDMA 2XN0A 2Y1HA 1W5NA 1SO4A 5CPNA 1IZJA 3CV7A 4GXPA 3NEVA 1XDJA 1UZ1A 1CXIA 4KEMA 4M8UA 2PRLA 3AIWA 5DMNA 2HK0A 1WBHA 1EIXA 4HZ7A 1NWSA 1VH7A 1MDRA 2Z28A 3J7HA 3JR2A 1ZJBA 1S2WA 3W25A 1W5OA 5I06A 1YYAA 3AO0A 4IXXA 2HMCA 1XRSA 3B03A 5D30A 2GWNA 4LV4A 1PV8A 4FF7A 1JPIA 1I60A 5FACA 4JQ1A 4KCWA 4DO6A 4S3KA 3W73A 1QI3A 1TJRA 2WPBA 1CGWA 1W56A 4NX0A 3GKFA 1FP9A 1ZU8A 1XXXA 1DWHM 4RPQA 1N8IA 3O6AA 3NQEA 1TFVA 1XLBA 3SIMA 3RCYA 4KWUA 3W27A 1JFXA 1XF0A 4JBRA 3SN1A 2NLYA 1EUAA 5BOEA 2AQOA 1AW1A 1SZGA 2NQHA 4WF7A 2FH8A 4Q8MA 3TJ4A 2BSLA 1R3WA 2GFTA 3IGSA 3O6DA 3IIPA 4R33A 4A3RA 1XDLA 3MWAA 4BQ3A 4JFWA 1KR1A 2OYMA 1A49A 4GQBA 2CLKA 2WM0A 2V38A 5MF5A 1WDDA 2ZC8A 1B3OA 3U0HA 4A3YA 2YDQA 4LVDA 4PMUA 2OEKA 2G50A 3W86A 3G1VA 1XYCA 3SQMA 2E6FA 1SYTA 4WCJA 2E6DA 5DMYA 3R7MA 3SUWA 3U7BA 5A6AA 2BG5A 4J3ZA 3W26A 1XIMA 4DBUA 1MNSA 5HANA 3HTWA 3IAQA 5HOSA 5AHNA 4C1LA 1JNEA 4FR6A 4BF7A 3LB0A 5C9XA 3KW3A 1KNWA 1O4UA 4KERA 1REQB 2VURA 4Q8WA 4LW7A 4GY1A 4UR9A 5G1MA 4JYFA 2INZA 1W1VA 2BY2A 4H9VA 1B4KA 4MJ2A 4UTJA 2DQWA 3AZTA 4MYAA 1D3CA 2P3EA 3GLCA 2J25A 3GBDA 2J4GA 2QNEA 5LGXA 1YDOA 4RZ6A 4UNIA 5JMUA 2PGWA 3UVIA 3M9YA 4IICA 2XWEA 2P3ZA 3KBNA 4Q22A 4QBXA 3EDDA 2QCDB 3PNZA 2D69A 1NY1A 3ZJ8A 3MUAA 3H22A 4O12A 2INEA 3O8AA 1U1UA 3GHUA 3TTSA 3U2CA 3BO9A 4BCEA 1FWTA 2C6QA 2BASA 4YTRA 2XIQA 1E4LA 2PWDA 2NUYA 4E8DA 4AXKA 2NQJA 5EY5A 3H7RA 2YFNA 5EBUA 1D3HA 3S3GA 3O2LA 2FQIA 2XISA 2ZXAA 2Q01A 2NQLA 4US6A 4J5NA 4FR1A 5I3DA 5G4HC 3P74A 5M1TA 4OKDA 2BY0A 2QS8A 2J7CA 2UWFA 4UZUA 4UQCA 1HJVA 1T8XA 1NDVA 3SRDA 5A2BA 1XIFA 3R58A 1W3LA 1GOXA 3TFCA 2QCLA 3ZZ1A 2BOGX 3M0MA 4KFPA 2ZIDA 5G1YA 1DTUA 2V82A 2G41A 4DYEA 4WVXA 3THCA 2CWNA 4DO7A 1FWDC 4U5IA 5GNZA 1IWBA 2Y7GA 4LBRA 2R94A 2OLSA 4R34A 1T96A 3UZWA 1T41A 4OE7A 3TQVA 4LS2A 2Z24A 3WQWA 2G3MA 2D0HA 2VZSA 2PB1A 4B4FA 1CW2A 3GAYA 3VD9A 2FVLA 2O4MA 4GNJA 3SUVA 2E40A 2Z7KA 4NIRA 1F3EA 5TIMA 1FY6A 4WHBA 4ZEPA 1BWLA 3GC5A 3A4AA 1UOZA 2IKHA 4J1OA 1PHQA 2JALA 3ZO9A 1OYBA 2ZWYA 1UD2A 2VCAA 1R3YA 1EOMA 2GUYA 4ONVA 3TA9A 3FY1A 4NJGA 4TTGA 4NY2A 4BQ5A 4ZL1A 4HSOA 1EBGA 4AVFA 1M03A 4AEOA 1QHOA 2ZVRA 7ENLA 2AMGA 4Z1BA 1EGMA 4O0KA 3PZIA 2CLMA 1OB0A 2E68A 3WLTA 5CPSA 1UG6A 1FXPA 4A29A 2RAGA 1BGGA 1IIHA 2VX4A 5AYZA 2OOGA 2DT1A 2ABAA 3O1NA 1KBKA 1RBAA 4DYKA 2BODX 5CPTA 3TU9A 1DE5A 3O05A 2ZX9A 3PS7A 2CEQA 4B3KA 4NAEB 3RMEA 4IM4A 3S6DA 4HNTA 1XJBA 2QCGA 3ZQ9A 4B2DD 1IXNA 1XSIA 4HK6A 1QHPA 1Z9AA 5G4WA 3SRFA 1OVDA 3OLGA 3VKKA 3MS8A 1K6AA 1S38A 3CWHA 4JN6A 5XINA 4MKVA 2POZA 1MI3A 1JGIA 4D8LA 1E71M 1SJCA 3DI0A 1JJKA 1OZMA 3OGVA 1GW1A 1V08A 4YYFA 2V6AA 5EB8A 1UKOA 2HQAA 2X16A 4GNKB 3EWCA 1F74A 3VIKA 1IYXA 1GVEA 4V28A 5T9BG 3CHFA 2BGSA 1JEZA 1E6XM 4O1CA 1ITUA 3WLJA 3PUEA 3TTQA 1S5WA 3T8QA 5I24A 1KO0A 3SR7A 4TMBA 3UCQA 3MT1A 3O63A 4XTDA 2O92A 1K3UA 1P7TB 1BRLB 3S83A 1QNPA 1MRAA 1DWJM 1XIJA 5HJXA 3ZJKA 3GRIA 3UGVA 5CGMA 3W0KA 4YNGA 1VBRA 3GDBA 4NJIA 1R2TA 1UWTA 4F2UA 3C0JA 2ZUNA 4DZHA 3BLPX 4MB5A 3CQJA 3LCWA 2FDMA 1EP2A 4LF2A 3MMDA 1I0BA 3CIVA 4Z0SA 2XIJA 1A3WA 5I3GA 5A6TC 2YLLA 4OWGA 3VKDA 4MNKA 1B1YA 1KRCC 4JIHA 1US2A 3EWBX 4QP0A 3TNBA 4O53A 1P6WA 1XLEA 2OWCA 5DMMA 3CAQA 1VJZA 3HO8A 3OZYA 3W28A 4IPPA 2PI6A 4OOZA 3ZVHB 1NOWA 5CPOA 3AIVA 3PVFA 2V63A 3HQOA 2UBPC 6ALDA 2IUZA 1ZUAX 5CSYA 4MVAA 4U3AA 4C6MA 2YBTA 4QEEA 4PCTA 4OUIA 4XTIA 1TA3A 8TIMA 1M68A 1K6WA 1IT8A 2VQTA 5TF0A 2FPYA 5IBXA 2PGRA 1D2KA 4PCFA 1XQLA 2DIJA 2QULA 4NZ1A 2BVWA 3PUDA 4Y96A 1JXJA 4NYYA 4FNPA 3UERA 4WKHA 4KWOA 2VENA 3BSMA 3MMUA 4QCFA 3W2KA 1GJPA 1PVNA 2VGGA 3A22A 3W29A 3B8SA 3QLLA 1K4HA 2OT0A 4PMVA 4XBKA 1NOUA 3PZTA 2WKJA 4O8AA 2VEPA 3NQDA 3PPFA 1KTBA 1DWFM 3DYOA 4FLSA 4BK9A 1JAKA 1YLVA 1VYSX 2C8NA 5DMLA 1VBGA 3M7WA 3PJUA 4PBGA 4WSKA 1JQXA 4MDPA 1KV5A 3IVUA 4RV8A 3TAOA 2PU0A 5JU6A 2A2IA 4C6FA 4K2SA 4UC5A 2V5JA 3EWXA 3RM8A 2WMFA 2DORA 5B7ZA 1P6CA 3UJ2A 1OQFA 3CIXA 5D9NA 3ITCA 4QEHA 1KXTA 1JRCA 2OGJA 5AHIA 4HTBA 1PSCA 2W5FA 1EA0A 3W9ZA 1Q2SA 3FA5A 3M6YA 2OWWA 4BFAA 3TROA 3BMVA 2FMOA 3IGHX 1G9HA 2PDFA 4ZQCA 4OVXA 1KXQA 4JCLA 3T81A 3C0LA 4KWVA 4O4WA 2QF8A 1YNQA 1Q65A 2YOCA 4ZXOA 4X60A 3L4UA 1DQWA 3W1NA 3P61A 1HJUA 3I3BA 2QCEA 3LHVA 2Q8XA 3W7DA 4AISA 4Y2WA 5H91A 2HS8A 4IH3A 4UXDA 1XD0A 1QU4A 2WHLA 2DY3A 2X0SA 3DENA 5DANA 3BE7A 3TC6A 1X8CA 3NOYA 1J6OA 2WW5A 4XD6A 4EXBA 1IEQA 2Y85A 4ZFMA 3K5XA 4Q7BA 4IL0A 1JVNA 4UQAA 2JIEA 2XHYA 1UKPA 2ZX6A 2V3EA 4HPXA 3U5UA 5C2CA 2NXGA 4PTWA 4UWMA 1OZQA 4HHMA 5A8OA 1TZZA 2XYLA 2VM8A 2REQA 1YXDA 4US5D 2FZDA 4H00A 1QNRA 3WL0A 4K38A 2W79A 1OG6A 1OD0A 4F48A 1OK6A 3MQTA 1QAPA 3DGRA 1TPEA 3ABXA 3E2SA 4NNCA 3A13A 1JAEA 4Q4MA 4LT9A 2HE5A 2GVEA 4RDZA 3SUSA 2G3FA 2WCAA 1PXGA 3ABSA 4AZGA 2A7NA 1XYAA 3Q94A 5DQPA 4G9PA 3DHDA 1XLJA 4ZB2A 4GI8A 3THQA 1V3MA 1DHPA 3NQ8A 2YBUA 4LTSA 1LUCB 2OFJA 1OWQA 1H3GA 2XIBA 1S39A 4DVOA 1CGXA 3URBA 4ERGA 1FWRA 2PLKA 1LYXA 1OFAA 5CGTA 1NF0A 1ZJAA 2DZUA 3OHMB 1MYRA 1GCYA 1GQKA 2VDGA 2ZX7A 3CC1A 1S1RA 5FOOA 5FL0A 1D7KA 1OT2A 1YADA 1MO0A 3AJXA 3HFTA 3P82A 4IFOA 4XUGA 2E67A 1UIOA 4XB3A 2CBVA 1M7PA 1FWWA 2YA0A 2PODA 3MI6A 4B15A 5KETA 1MZRA 1CXLA 3ITTA 4TR9A 4NRRA 3FVMA 3HF3A 3T6CA 4ZB5A 2V68A 3ALGA 5FAJA 1UASA 2YYUA 3LG3A 4CD8A 1LTDA 1JZ6A 3KBSA 3K2GA 3LPOA 2Q8LA 2BDQA 2EF9A 2TRSA 4IMAA 2MANA 2CXEA 4URIA 3QC0A 3GX9A 1GZGA 4PYSA 1U2YA 2WJEA 4NJJA 5AZ1A 5CJMA 3LMYA 3QV8A 3WLSA 5F2GA 5BROA 2FVKA 1JPKA 4S3JA 4R7JA 4NZFA 4OJYA 3DHUA 1XYBA 2QMKA 3UPBA 3M07A 1Q3NA 1HFBA 3GU9A 4NZ4A 2OT1A 3R8GA 4FAMA 3LZ5A 6A3HA 3H70A 1RLDA 3IRDA 4WGXA 1OGGA 4AXNA 7TIMA 1GYMA 1YXCA 3C2YA 2RDWA 4RZBA 2Q09A 3NXLA 4GH3A 2CERA 2JE8A 3F4CA 4FIQA 3R4IA 4GQ0A 3WX7A 3CYVA 2NX1A 1XPGA 3NPUA 1TV7A 4HYVA 5DF0A 1RZMA 3LHTA 3BQ5A 3AIBA 4JIRA 2PP0A 2OEMA 3E38A 1GZ1A 1FWGC 4OTKA 5FL1A 1HO4A 4ADUA 3TTYA 4IT1A 3WLKX 3AAMA 4E5TA 3PBVA 1ZL1A 2YLAA 4QITA 3RU8X 3B8WA 1VCGA 1XIHA 4QJ1A 1EEPA 5C5YA 2FDSA 4XAPA 5CLWA 1JYVA 3P8JA 4ADSA 1LLWA 3PBMA 3DEQA 3QZEA 5IDIA 3R8RA 1FX6A 3PZOA 1RCXB 4AHPA 3FJNA 3G0UA 4EACA 4I7UA 1HJSA 3BOXA 3NPWA 1R5YA 5CC6A 1BKSA 1U1JA 4P8XA 4W9TA 4KCVA 1PIIA 4ES4A 4ZE5A 4GKLA 1S2CA 4C6NA 3LY0A 5EPDA 3G1HA 3WDIA 2O55A 1FWIC 5DX7A 3AU2A 1AJ0A 2PZNA 3GXFA 3JU2A 4R9XA 1Q8AA 2PDIA 4A3HA 1IXOA 2GGIA 3HG3A 4S2BA 4Q8TA 1CTNA 2C13A 4ZBCA 1BSLA 5FIPA 1JYWA 1XH0A 5C7HA 1M7OA 1BEUA 2AL2B 2CZDA 1VIZA 1J0YA 4FXJA 1QPOA 1CLXA 1YPXA 4HMCA 2OZ3A 1DIDA 3L7RA 4M82A 1V0NA 4MZ8A 3TTEA 4ZE4A 3A5FA 2XDFA 5LXEA 3KX6A 3W7RA 5G2HA 1DEDA 3F2DA 5E70A 1JGMA 3HURA 4LJ3A 5A6KA 3DFPA 2HISA 3NSMA 3KEHA 1DL3A 1TIWA 1DE6A 4UNLA 3LM7A 1WB0A 1MVYA 4K36A 4O52A 2PDLA 3MO4A 1CB2A 3WEMA 2V9DA 5MKGB 4HMDA 3V0SA 1BYBA 1V3LA 1AH3A 1XFCA 4A8RA 5DT7A 2RGLA 3IIOA 4E0CA 3HQ1A 3TE9A 3EWZA 3L4WA 3W7EA 1BTCA 5K9XA 1RV8A 2E28A 4GMEA 4Q4KA 5CLTA 4C60A 3LQGA 4IISA 2J79A 3GVVA 4UQEA 2HK1A 3AIQA 4TIMA 5LIKX 3IUHA 3OQ8A 2ESCA 2QJJA 4IPNB 4GPNA 2CZ5A 3N9KA 1B3YA 1LOQA 2I17A 5REQA 1KRBC 1OGSA 3RX4A 3N18A 3XINA 3QPYA 5FJUA 4O14A 2Q02A 3SEPA 3DI1A 4EKJA 2NX9A 3ATZA 2PZ0A 1G67A 3N17A 1BYAA 2YCIX 4LUSA 1L6SA 1IHIA 1BWKA 2EEXA 4LSBA 3DC0A 3W1XA 4E8CA 3LRKA 3S9YA 3N2XA 4F66A 3C0QA 1HTIA 1IEIA 1R9ZA 3WLPA 3OZMA 4DZ5A 2VHLA 2ACRA 5IDZA 4DXVA 2HXTA 2CITA 4NJHA 2GPTA 3GH4A 2Y7FA 1UHVA 3LLDA 1V8EA 3RFAA 1VD6A 1JF6A 1OADA 2WLZA 3DFQA 5HINA 1JNDA 3TH6A 3AS1A 4GACA 1AFSA 1TRDA 5FF0A 4JFUA 2QAFA 2ASHA 2PFHA 1QPNA 5FESA 1Q4WA 4JTGA 2QJGA 3W02A 2R6OA 2XZ7A 3FJLA 4L56A 5A2CA 2YFOA 5AKQA 3SFKA 2D24A 3QVQA 3EX6A 3E49A 3AYTA 1DV7A 3UG4A 4QDWA 3MVIA 2IS7A 2J8GA 3V4BA 4DXKA 3S5NA 3Q65A 5KTLA 3FFSA 1EBHA 3VMOA 2PURA 4RXFA 1E9ZB 4MKNA 4AWUA 2WVTA 4EX4A 3BAKA 1E6RA 2D22A 3OLDA 1TPUA 4JIQA 5JH2A 2OLHA 1NTHA 3C52A 3CUGA 5MHBA 1GOKA 5HR7A 1S2AA 2PDGA 3MTWA 3OGRA 3HN3A 2PDUA 2PWEA 4F0LA 1VS1A 5JUVA 5LA1A 4ZGYA 3ARXA 4MGGA 1B3WA 5KINA 4FK9A 1IWAA 1TMLA 1TTPA 1CBGA 2GWGA 3N4AA 4CN4A 3BQ6A 1M53A 2NUXA 3OP2A 3W87A 3RPDA 1F4HA 3E2VA 2XVKA 3HQPA 4HT3A 4WXYA 4LAOA 4AIOA 1GYNA 2CC0A 5BZAA 1JDAA 1R6WA 2VX6A 3Q2DA 4AX6A 1O66A 3B40A 1GHSA 3FYPA 3L0GA 3ARSA 5AC6A 1UMYA 2AAAA 2C0AA 4Y9PA 3NQ6A 2EPNA 4ACZB 6TIMA 4AHQA 4HHHA 3G5EA 3ZLHA 1HP4A 4JL2A 1A5NC 3WQFA 2HVNA 3GBEA 2PDYA 3UXLA 1EXPA 1GJUA 3B05A 4FF5A 3KFTA 3Q37A 3BMXA 3PZMA 4B92A 4S23A 1V3IA 3MW7A 4GQGA 4B5WA 1GPWA 1W32A 4FB7A 4QR6A 1IXPA 2FLIA 3E0VA 1PWLA 1DJWA 2AMXA 3LRLA 2B0MA 2FTWA 1LQAA 5AFDA 1ODUA 3B0XA 3ERPA 2P0OA 4TU1A 3VD5A 3OJGA 3V36A 3W88A 1JQVA 1QHZA 1E56A 1A5MC 1DHKA 1QJWA 2VFFA 3EB2A 4F8XA 2PTZA 3ZYZA 1KM5A 1FWAC 2WBKA 1VQTA 1FP8A 2E4TA 3C2RA 2FZNA 3T2OA 2KAUC 1GOMA 2DZVA 4L6OA 3SY5A 2WVUA 4L7ZA 1CGYA 2OX4A 7REQB 1ZRQA 2OSYA 5LIYX 4PMRA 3UESA 1X6LA 3FYYA 3RO6A 2OQHA 3GTHA 3U6WA 1XYMA 3ZR4A 3E0LA 3I65A 4XBJA 2QCFA 1UD5A 5IBXC 4JAWA 1EDTA 4JYDA 5A6BA 3NZQA 3AHYA 1EJTC 4LCRA 1ONXA 1XIEA 4NJKA 1E1CB 2QUMA 4TVCA 1XG3A 3TMQA 1ZAJA 4L61A 1LDCA 2JK2A 3B9DA 3WJZA 2PWFA 4YHGA 3EPNA 4M80A 4A3UA 1E4NA 3R94A 4Q4RA 3IIVA 3LYEA 3NZPA 1ZBKA 2JF7A 5AHLA 3I7RA 3HPZA 4GUHA 5AY7A 1W2VA 3LBMA 3UEQA 2VDHA 2ZXBA 4DY1A 2HZGA 1U83A 2H9AA 1E43A 3AYRA 5AC5A 1F6YA 3KBJA 4RJEA 3B8VA 1L6YA 4O4VA 3NL6A 3VZXA 5JH1A 3HM7A 3N2TA 3OLEA 4UTHA 4UOQA 4G1NA 3UYIA 4PBEA 4W85A 1TJ1A 5E09A 1A0DA 1V4YA 1H09A 4FEZA 1WZAA 3WQ4A 2IXUA 3IIXA 4BZYA 2QVNA 3F7JA 1XSJA 2XG9A 3P5ZA 3O6CA 3B8IA 3BW2A 2GGEA 5F1VA 1W9UA 4QG9A 2Z1VA 3QY8A 1ME7A 3KUMA 1O1ZA 2X2GA 3BK0A 5K9DA 1Q85A 1H0IA 3W1MA 5LNSA 4IMGA 3EZ4A 3SCPA 2HNEA 4JHOA 4CNOA 4YIWA 3DHPA 3N6QA 3CAWA 4HIBA 2XVPA 1NF7A 2WSYA 1JUBA 4ATLA 1DJHA 3GXPA 1KFEA 1EPXA 3U4AA 1VFUA 1XHGA 5C8BB 1BF6A 3S1WA 2GJNA 3CZKA 1XP3A 4QS5A 4N9DA 2A5HA 4WQ6A 3ES8A 1FCVA 4E3VA 2CWXA 4JEQA 1P0DA 1XH2A 4BQ4A 4PTMA 1BYDA 1CXEA 4NXSA 3VCRA 1LP6A 2ZYFA 2QW5A 3H26A 1UB3A 3PN8A 3MZNA 1SMDA 3KOXA 2QUTA 1MQPA 3TX9A 1FFQA 4W5UA 2DSZA 3G1RA 3EB4A 3FYOA 2JEPA 3C5QA 4OQVA 4XSLA 3R13A 3QXBA 3TN4A 3C56A 3NL5A 2YCKX 3TTOA 1CNVA 2OWXA 3RNDA 5CZJA 4NT0A 4A3QA 2AKMA 3WUGA 3SADA 1R86A 4XD5A 2FZBA 2YPIA 3FAWA 3AMDA 3L68A 1WOBA 1NFPA 3TR9A 2EG8A 3HZ3A 3M5ZA 3VKCA 2WZIA 4G5DA 3KAOA 2OX1A 1L2UA 3UU0A 4ZR8A 1UW9A 2GQAA 4LUTB 5C9UA 4JQ4A 1NOFA 2PUZA 3LM3A 4BR1A 3F4NA 2E5CA 2X1SA 1S2VA 1WPCA 2VR4A 4R3UA 4RNFA 2WWCA 3BCFA 1S5TA 4AZ7A 2KX9A 5A8PA 1NSJA 3PAOA 1AJZA 4F4RA 1ISYA 3EDFA 1Z48A 4L1XA 4F2TA 4P8WA 1WNOA 4D8AA 4PSRA 4WY0F 4O18A 4AMAA 3H23A 1VHNA 3BSGA 1RJRA 3A4XA 3M16A 4CU8A 3MCOA 4D1IA 4F9DA 3VCNA 1M5WA 4GWEA 3ZLFA 3KOWA 1Z32X 3ZR6A 4QE4A 1Q6EA 3BG9A 4KGLA 4CQ8A 2NXHA 4PCPA 3KOFA 4GFSA 2GOKA 4P7NA 1TVNA 3L9CA 2A21A 3F5KA 3MI2A 1TG7A 2HBXA 4TVDA 1QNVA 2X41A 1P0EA 3VDHA 3FNDA 3L4TA 3WENA 2YCLA 5FD0A 3P81A 3TWBA 3CV1A 4L9YA 2GLKA 1UUMA 1Q7MA 3CQ0A 3QOMA 1XCXA 4HNOA 3ABZA 6ENLA 3QV9A 1YEYA 2C79A 2YSWA 1DOSA 3WLHA 1P1XA 1QW9A 1W17A 2W61A 4JTTA 3EOEA 3G77A 1KWGA 3NSXA 4M7SA 5HNUA 4AF0A 1LG2A 4HCDA 3LOTA 1YTEA 2NT0A 3I6TA 2GVGA 3SW6A 5EMJA 3G6LA 3W7GA 2E25A 3UNTA 1BLIA 1TE6A 4Y9OA 1OX4A 4C6BA 3C8NA 2YB4A 4UOZA 5K4XA 4PB3A 1LLZA 5DCBA 3BOLA 3WDQA 1GEQA 3VGEA 3QV6A 3BSHA 1WDPA 3KS6A 1MMFA 4W7VA 5FF7A 3DC8A 2DPEA 4BEUA 3OLIA 4DLMA 2Z1SA 3GIQA 3E0WA 5A6SA 3WUFA 1QPQA 3LCXA 2DP3A 3LGEA 1W1IE 1QWKA 3UYCA 1RXOB 3HV9A 4QE5A 1LWJA 3N6JA 3RAOA 4GJ1A 1VPXA 2ZWZA 2WBGA 1TV5A 4Q8PA 3CQIA 3QGVA 1TVLA 3IVTA 2WOQA 5H2ZA 2B4GA 1PHWA 2KZHA 4WDXA 1YKWA 2ZE0A 3UWZA 1QDSA 4N4PA 3BGAA 1AD4A 3L67A 4CD4A 2QJMA 1CLVA 3EKZA 4LF1A 3YPIA 3G1FA 2BXZA 2ANUA 1YPIA 1D7FA 2V67A 3SBFA 1RALA 3BZJA 1F5ZA 2E0PA 3O06A 2VFEA 4HU3A 4QS6A 3WKZA 2PDMA 4S1FA 1VAHA 1GUVA 3K1GA 1P6BA 1BXNA 1VEPA 3W1UA 3KDOA 3GXNA 1FBAA 4LCQA 1GQIA 4KFOA 1K02A 3B06A 1YPFA 4H8UA 3AYSA 1A5SA 1C8QA 6XIMA 4KRUA 2VGFA 1J96A 2W4XA 5JXQA 3MB9A 1W1YA 1H61A 1UZ4A 3B3DA 2Z1BA 2BVYA 2P5NA 3RM4A 4ROPA 2UY2A 3R0KA 3GIPA 3DDMA 4W84A 1NQKA 4IFKA 3UXAA 3PM6A 3EWUA 3HG5A 4QE1A 5EBAA 4KF1A 4ZQNA 2D3LA 5HUOA 1JUKA 4R7WA 3UY7A 3TW7A 2Z27A 3T0AA 1J5SA 1LZOA 2HRWA 5HMFA 1DJQA 4I90A 1NJJA 2VVSA 4ZZ9A 1VF8A 3FKKA 4O10A 3GVGA 1XGDA 4G6CA 2W6RA 2OTDA 4MJZA 1NAL1 2CLLA 4V2XA 4JTDA 4MFDA 1SFTA 4E2OA 5ABFB 3ARRA 3GNNA 3QV7A 4F3HA 3NZGA 3FXYA 5BOOA 2PRMA 2HBVA 1QASA 5TAOA 4UOJA 3TDFA 2W67A 1CLKA 3I3EA 5D8ZA 2FGBA 4LBSA 1OIMA 3RGTA 2VWTA 1K77A 2QGYA 4LY4A 2ZZ4A 3ZS4A 3NGJA 1W9XA 3CJPA 4JTIA 1VBHA 1C92A 1HKMA 6PTDA 3C2VA 2L5HA 3MUY1 2X30A 4RW5A 3CZJA 1EUNA 1LOLA 2FIQA 2GOUA 4G56A 3TEVA 1Z69A 2X1IA 3UCDA 4Z2JA 4BKNA 5JBFA 3LCHA 2NWRA 3VINA 3T8LA 2PDKA 2V5CA 1PUDA 3WDPP 3ZT5A 4GGHA 3RN6A 3QQ1A 4TV6A 1SSDA 4IQEA 3W07A 3HFYA 3N15A 1I2PA 2P88A 1R47A 1I2QA 3WSUA 4O1EA 1H7NA 3DCPA 1GVIA 4OV9A 1I2RA 2IPWA 3UGRA 3C2EA 3Q4DA 4Z1CA 3WD4A 3EA3A 4G7FA 4UIOA 3LGDA 4H7ZA 1VKFA 4DELA 4L64A 4QM1A 2ZQ0A 1QNOA 2CETA 3CM4A 2WC7A 4J4KA 3VNIA 5HNTA 4H19A 1P5BA 4D71A 4IX2A 3MDWA 3GR7A 1QI0A 4AD1A 2EG7A 4F9JA 3UD6A 2WHJA 1Z6KA 1PCWA 3TN6A 2F84A 1DQUA 3A9BA 2DUAA 2GDVA 3B97A 2G4FA 3NTYA 4I8YA 4HMNA 3EMZA 1JCJA 1E6QM 4LVBA 1UWSA 3SFWA 1EGVA 3AIRA 4IXHA 3W75A 1KC7A 3R0DA 4FHAA 3C0SA 1HJXA 4NZJA 2NUWA 2B81A 1REQA 3LA4A 3P2VA 4GE8A 1E0VA 3VDCA 3MJMA 1PO9A 2YZ5A 1HF6A 3WNMA 1JCNA 3DZ1A 3TYAA 1XDMA 3LD5A 3KLLA 1VLIA 4HMEA 2O9RA 1A53A 1YX1A 2C71A 4QQ3A 1R9YA 1SUXA 4LYQA 3IJ8A 5KZEA 3N73A 1LBMA 4IF2A 3LPGA 1KLZA 5CEWA 4DXXA 4DUXA 5ENLA 4ZOCA 1M65A 3SCQA 2TAAA 2UZ9A 3S1XA 2IW0A 3GB6A 3USBA 1E5NA 2ACQA 3W37A 1S5NA 2PF8A 2DDXA 4ZO7A 4DI9A 5EMUA 3N29A 4J2PA 2R1KA 1OABA 4RXGA 3V35A 3CEUA 2VEGA 4F40A 4HNLA 2A3CA 5REQB 3QGKC 2VEIA 2ZA1A 1YW1A 2VZVA 3BWWA 1RD5A 4H9MA 5F1UA 1WQ5A 2EKCA 2OKTA 1ZPTA 4EXQA 4AD2A 4WXZA 3TYCA 3LXAA 3SSJA 3TSMA 1H5VA 4ML9A 4ZOBA 3VOGA 1UH2A 3PG8A 2GSHA 3SGGA 1PKMA 5BCAA 2VT0A 4KS0A 1XS2A 1CI1A 4E6MA 1KFJA 3RLGA 3CWOX 5BRPA 3AXHA 3CUXA 4FOJA 3OBEA 1RR2A 1QFEA 3EOSA 3S9IA 4EXAA 2P0IA 3T4WA 3EA1A 2VVNA 2AQWA 3WELA 3N11A 1WDQA 1R8LA 4HSHA 1QATA 2BY1A 2D73A 3IANA 1SPQA 4O50A 3P7YA 3GH5A 1OC5A 4PFMA 2IXVA 4NZ3A 5FJOA 3WJSA 3WQOA 4N2YA 4UR7A 1C90A 3W7PA 2X8RA 4YLWA 3PF3A 2OU4A 3WD1A 2X40A 1LM1A 1SR0A 2C14A 2ZBTA 4CKQA 4OT7A 4PUWA 4W8BA 4L6DA 4K1GA 5KEZA 4A8IA 3AXIA 1V3KA 1E0WA 4S3FA 4WSJA 5FJPA 1MQRA 3KM8A 4BI6A 4UCGA 4H9TA 1MXDA 3GDRA 1W5PA 1UQYA 1YE4A 2YDSA 3QHNA 1QI5A 3S2CA 4EF9A 5E9XA 3L12A 3BH4A 3E5PA 3TZNA 2YCEA 4Z17A 3WBWA 1YE6A 4MJMA 5I07A 1PX3A 3BVJA 3OBKA 2IKJA 4Q32A 1MUMA 1ZS2A 3W24A 3VABA 3DFNA 1FFRA 2WC4A 2Y24A 5KZMA 3H4XA 2MNRA 4INFA 4GIEA 3PG9A 3PFMA 3KS5A 3GNOA 4FLRA 5EKYA 4NAEA 4FX8A 3W71A 2VD8A 2VX5A 4PTXA 2DGAA 3ITOA 2I9EA 4IMCA 3ARPA 4IIBA 1OBAA 1NP0A 2VRJA 4M81A 2A3AA 1KV8A 3IARA 2XH2A 4O15A 1TUFA 2XSXA 1HJWA 5CG0A 5C9ZA 4RNJA 2F7FA 4UZSA 3UZJA 4Q8QA 3P60A 1KB3A 3GHTA 3LDVA 5D38A 2ZRVA 2WQDA 3NEHA 1OX6A 3GU1A 4HJFA 3WEZA 4DRSA 2GK1B 4H7VA 3ME3A 4OU1A 1JZ4A 1M01A 1H1NA 2WZEA 4E2BA 3M41A 2H3DA 2DH3A 4TVUA 1CGTA 2X1RA 2RDUA 3WQEA 4LYKA 3SCVA 1Q6DA 1AJ2A 3T78A 4LBUA 1ZP4A 4AZCB 3GIYA 4TXEA 4D8ZA 1N55A 3QHOA 4TO8A 2V30A 3DAQA 4WZHA 1XI3A 2CLFA 4PMDA 5LSMA 1P7TA 1TZ9A 3V3WA 3FIGA 1BRLA 3WJWA 4H9XA 1TUXA 3WF1A 4AG0A 2J88A 4YYCA 4PSPA 4GYKA 3IWPA 5PTDA 3UXIA 8XIAA 4U2ZA 3H12A 3KHJA 4GFIA 4JIIX 2NV9A 4Q8NA 3UWYA 2ZZ2A 3BW3A 4LEFA 1XD1A 4Z2KA 2G96A 2BGQA 1U1HA 4G2DA 1IEVA 4NNAA 2G3IA 3NQGA 7CGTA 3M0KA 4AVNA 3ANYA 3GZAA 3BJTA 3NDOA 1GVQA 5D05A 1W9DM 1I1WA 3MCNA 4DF1A 2YKKA 2X05A 2POTA 3TW6A 4K8HA 2HVOA 1XYLA 1PDZA 2G97A 3NR0A 1LRNA 3DU0A 3ZVHA 2A7RA 3W23A 1YQ2A 5F2MA 2WNWA 1UR0A 4H6QA 1V02E 3GSMA 2JGQA 1ALDA 1A5OC 4QNEA 1JCYA 4C7DA 1V93A 4JOMA 3KHDA 2NX3A 3AIEA 1EHNA 1VCVA 3GYCA 3QMSA 1EYEA 3WQPA 3BV4A 4ZCWA 5H1WA 3TYZA 2HEJA 2BTMA 5RUBA 4Q8UA 4DWSA 5CPLA 1KGUA 2H9AB 3GDTA 5LA0A 2ISFA 3N3MA 1ZLPA 1WXJA 2J8FA 3ITGA 1K03A 4DB7A 3GVQA 1LJYA 3IJLA 4FX7A 2OXNA 4IWWA 3LNPA 3TW9A 4JQ3A 4IUGA 5T8GA 3WD3A 1QXLA 3GO2A 3WF3A 4XAYA 1XRVA 2YXXA 3V18A 4IPIA 2X7VA 2JFEX 3A5VA 4XO7A 1X1ZA 4HJWA 3VOFA 2DIKA 4LC6A 4N7QA 5JBDA 4CCCA 4XZBA 3WEOA 4HPNA 4GA8A 1ZSXA 4MSSA 1D3GA 1PZ1A 3P62A 3NM3A 3N13A 1T7LA 2BOEX 2UV8G 4REQB 3BLIA 3N14A 1RLCL 1ADOA 3O7UA 4PRTA 2YJQA 3DHFA 4D2JA 1VFSA 3S5OA 4AW7A 4RE3A 3F4VA 4GK8A 2CBUA 4LUYA 5BYWA 1LL6A 1JXKA 3UP8A 1XYFA 2PSNA 2JIWA 3S1UA 1V02A 4C6DA 1AA1B 2ZFAA 2X0HA 3ARTA 4JCMA 4UFIA 3CL8A 5HJYA 1E6PA 5HNNA 1HO1A 5CZKA 3UA4A 1WE5A 3GHSA 3M43A 3HGOA 3AFBA 2PBOA 3H2EA 3A23A 4H04A 3UWUA 2QZRA 2NQ5A 3L2MA 1FUYA 2WVSA 2OKOA 1SM9A 1UD4A 1TCMA 3P80A 3V0TA 4M1BA 4V1YA 3RCMA 1QO5A 1Q45A 3WQDA 2X42A 4G1KA 3MBDA 3W7MA 3KWSA 3W7IA 4QCEA 3MPGA 3UJRA 4KWWA 4PB4A 1XLGA 3WFZA 3SQLA 4RDWA 2A4AA 3N1AA 1XRTA 4A4AA 1A4MA 2R14A 5M2FX 4MNLA 2EJ1A 1RHCA 3V5CA 4OHQA 1R3TA 2HVMA 3AI0A 5I7GA 1DKWA 1Q13A 2G3JA 4Z2HA 1SO3A 1I75A 3WF4A 3OODA 1VPYA 1FCBA 4JKLA 2Y2WA 4UQDA 2VGBA 6TAAA 3MKKA 1CEOA 2DZBA 4I9MA 4DN1A 3SCOA 2EPOA 4IMFA 5M5DA 3WNPA 2ACSA 2W9MA 5CKSA 3TYEA 3EX2A 4I7VA 3H8AA 1D9EA 1P0BA 1B3XA 3L23A 4Y90A 4QLKA 4W7UA 5CC7A 4XISA 2DUZA 3LS9A 1TQXA 2A3BA 3PTDA 1T6MA 2CKSA 4QDPA 1W3TA 3CV2A 3G8RA 3IJ7A 4AHOA 1FHUA 1V6XA 2VZTA 1CB7B 2VKZG 2WVVB 4W4QA 3EOOA 3BURA 1LUCA 4XUYA 3WFAA 2HWGA 5JIWA 4XSMA 3SRHA 4UTMA 1UH4A 3I68A 1XBZA 2E7FA 3S5ZA 1TPH1 1Y5XA 2YCLB 3G3MA 4ZQMA 3RLHA 3A12A 1Q5MA 1XC6A 5A8MA 5LHEA 1HN1A 3L0KA 3NAVA 5EFFA 3G8EA 4JTJA 1RJPA 4JIEA 1F3TA 2J7FA 2QUNA 4MOZA 2QKFA 4NSBA 1K8YA 4YS1A 1TJ0A 1OCBA 1RQEA 1Y65A 3IS4A 1XSKA 1BG9A 1UKSA 3CH9A 4GLEA 2GQ8A 3D47A 4IG2B 1AQHA 3FA4A 5ABGA 1XV8A 4ORMA 5FSEC 1K7FA 3UR2A 3IUIA 1F73A 5BWAA 2SFPA 2GJXA 3UR8A 2XM1A 1J4EA 4L9XA 2GGJA 1BWVA 1IWPA 4FNRA 4LS1A 6REQB 1CX9A 3RIKA 1EX1A 4CGTA 3FDKA 2EBNA 1SJDA 5IXEA 5TQLA 3Q58A 4FXFA 4RDYA 1BKHA 3O07A 3B0UX 3OIHA 1X6NA 2PPGA 2YDRA 4P2VA 3E2QA 4DQWA 5HULA 4BY3A 1Z41A 2R8WA 3B4UA 2PMQA 2CHNA 1Q6QA 5LHFA 4BI5A 9XIMA 1I6NA 1A50A 3CQHA 1C93A 1SR9A 4B4HA 3W7OA 2PRHA 2BLEA 1IGWA 5LNVA 1SQ7A 1IT7A 3NFUA 3PZ9A 1S2TA 2VYOA 3L4YA 1KBJA 1AQ0A 1OCJA 1V3HA 4FLQA 2P1FA 3W1QA 4IGSA 3WFLA 4HPGA 4X2RA 3LLXA 4M6UA 4XKMA 2ZTKA 1GKRA 4XIMA 3NXFA 3UVAA 4B5SA 3IEBA 5AC7A 3A4JA 5E1QA 4EVZA 3GNXA 4ZQRA 1DWIM 2Y63A 5L9FA 1IIGA 3VZYA 1KFWA 2BOFX 1P43A 2QHAA 4NP7A 1R3VA 3H6OA 3GFZA 3PJXA 3W00A 1A80A 5EMMA 5H6HA 4IFKB 3UG5A 3W82A 3WQ8A 5EMLA 3DYMA 1ESWA 3LLFA 2ALDA 2DW6A 5A8GA 4N0RA 4FNUA 1UWIA 3H4WA 2ZRXA 4WDWA 4S39A 2CKRA 4HZ8A 2AL2A 1W8GA 4LCSA 3DKJA 2X1TA 1TV3A 3HQNA 5T91A 4DJDC 4S3EA 3R6IA 1KQZA 4DX3A 3PWGA 3N4FA 3QLDA 4AD3A 2FPVA 3WLMA 1ONEA 3TQKA 4POCA 4GUJA 4BHYA 2XVGA 1DXIA 3CPUA 3EKGA 4D1JA 4NQ1A 4LRSA 3EEGA 3NUKA 1R38A 4XZHA 1W91A 1NIUA 3S2NA 3G1YA 4KEZA 2NV2A 1GOOA 2QYGA 3H4GA 4UTTA 5MKGA 1LCOA 2QUUA 3G0SA 4AQLA 1C8XA 1FRBA 3GK0A 1UD6A 2WK2A 2ZUWA 3M0LA 4JNMA 2TPSA 1PJ9A 3HOJA 2QPUA 1WKDA 3BJFA 3CS2A 2Z29A 3TLQA 4J28A 1Y5WA 1ZBCA 4H8NA 2HCVA 1DXEA 2OSWA 4ZSUA 4PTNA 1E3ZA 3PUOA 4YVVA 3OZPA 5C54A 4P7QA 5FEPA 1S2UA 4H9ZA 2BV9A 1BSIA 3LU2A 3WUEA 1F2JA 3W6YA 3I7SA 3PWAA 4X0NA 4QFUA 2J13A 2V3FA 3CAVA 2F38A 4MUPA 4DO4A 3STGA 3BJSA 1QO2A 4MWAA 2EPMX 1W1TA 3QKEA 4AIUA 1JG9A 3E1F1 2DZSA 1CPUA 2WMIA 3WDJA 3EDEA 3GG0A 3AICA 2Y5SA 5TD4A 3O3RA 5GNXA 3S1VA 3EDKA 1QI4A 3I7QA 4RX0A 4XZMX 5CBJA 3OIXA 4HD5A 4NG3A 3WD2A 3VDGA 3CGTA 1PX8A 3SIZA 3Q67A 5CJNA 3R0UA 4H2CA 3L4VA 1UP3A 3DIPA 1NARA 3RO8A 4PMJA 2Y5JA 2VC7A 3HGJA 4UBPC 4TV5A 3EXTA 4CNNA 2F2HA 4CN1A 1O60A 1VRDA 1WBJA 4A35A 1H7XA 1V03A 1S5VA 2AAMA 1CYGA 1U33A 2ZRZA 4NKCA 2OVLA 2AL1A 4GHRA 4AD4A 1GK8A 3PBUA 1V0LA 1VEMA 2CCRA 3VNYA 1E6SM 4YTTA 1PAMA 4PMYA 2FPTA 3TYUA 4HB7A 5D2XA 4M29A 4FP1A 3MVTA 4XD3A 2VD9A 3JRKA 1JF5A 2BB0A 3W7CA 3UF9A 1G7UA 1UWQA 2O7SA 1R87A 5J8LA 2NVCA 5HAOA 1OT1A 5I2UA 2FFIA 1EX5A 3AALA 1R85A 5E0KA 1RP8A 4OBTA 2VQUA 1MW1A 3KCOA 1DJNA 4F0HA 1R7AA 4NI8A 2QV5A 4JL1A 1XFBA 1K8XA 3FEQA 3PZQA 3BGGA 4UR8A 3WMLA 3MZ2A 2V5DA 3S42A 5BXPA 5BW6A 4DBEA 7PTDA 4DUVA 5A6BD 2WB5A 4XKYB 3TNOA 3E02A 3GG1A 2Y7DA 3CTLA 4HSNA 3TUUA 1EYWA 1Y8BA 1V6TA 4KIRA 3LSCA 4NX5A 4XX6A 3WZ0E 4ACZA 1Q6LA 1FWJC 4O1BA 1KRAC 1SFJA 4LANA 3VX0A 5F4SA 2B7OA 1NH6A 4W86A 4GY7A 1VB9A 3TSDA 5FJIA 1H51A 3BLKA 3VIHA 1J0HA 4HOZA 1DQXA 4H4IA 4X61A 1BQCA 2XM2A 4BEQA 1O5KA 3TMLA 2C15A 2ZDRA 3CUJA 3VD3A 2PA6A 4R7OA 2YL6A 2IPJA 2NVDA 1A5AA 5U7SA 2BS9A 2CBJA 2DJXA 3GTIA 4GZIA 1OF8A 3UW6A 2Z4GA 4JX5A 1V3JA 1FH8A 2BXYA 3ZM8A 1UR2A 4Q4PA 5EU9A 5I3IA 5DXXA 3T0TA 2QCCA 3WO8A 3S5YA 1KTNA 2WJFA 3N3TA 1TV4A 2Z1XA 1KBIA 2H3BA 4CVUA 2FFCA 3QY7A 1K4GA 3S6TA 7REQA 4O11A 3NA8A 3T9PA 2X0YA 4B5UA 1WP6A 1RPXA 1HX0A 4Z0JA 4H83A 4A6GA 1XRFA 4LX4A 3CO8A 2OG9A 2PLCA 3O9NA 2D23A 4GQRA 1OYCA 2FZ8A 3QPEA 4M56A 3IJ9A 3NQMA 4LAMA 3N2OA 5HBFA 2HJPA 4XWUA 2DFAA 3AOFA 4DWSC 4KFNA 1V77A 1UR9A 3RJXA 2D2JA 5XIAA 1S5MA 1E1CA 3HU7A 2QR6A 4GI6A 4ML4A 4GIAA 3JVAA 4OUEA 1GKQA 5HWNA 3QZ6A 3FHQA 1GTHA 2OB3A 3OG2A 1IZCA 3BLDA 4MLRA 4FX6M 3WLQA 2G37A 1AZ1A 4YVPA 4TUFA 3VGHA 3B0PA 1EP1A 3L4ZA 3GDLA 3UR7A 1VFHA 1FKWA 2CZFA 4X63A 3GG8A 1UWRA 2RDXA 7XIMA 1E1FA 3QW3A 4N9EA 2PCQA 2ZVIA 1ZALA 1NVMA 4F0KA 3CIWA 5AHFA 3KL5A 1AQMA 3M0JA 3BARA 1JZ7A 3VOIA 1F61A 1THFD 5FEXA 5AYIA 1Z89A 4ZB0A 3EX1A 2YYTA 3QR0A 4KBXA 3ISIX 2IPGA 4GIRA 4JTAA 2QGHA 2CXGA 4PUKA 1UR3M 4FALA 4UCFA 3STFA 1JUEA 3VCCA 1M7XA 1PWMA 2JQXA 1RBOB 3TCEA 4JNZA 3V7PA 5AZ0A 3U3HA 1QT1A 3V1HA 4JN8A 3QGAC 1MNZA 4KMQA 1C91A 4K1WA 4EAMA 1XIGA 3WK2A 3WMBA 4JIPA 2G4JA 1FWCC 2BY3A 4C5YA 1OFOA 1F05A 4AFYA 4MF4A 3CK5A 3RUBL 3DKLA 2QUVA 1VLWA 3SSZA 2DZTA 2G95A 3POCA 1QUMA 2Y88A 1B57A 3G2GA 4AYSA 3TQPA 2E6YA 2ABBA 2V2CA 1TTJA 3A4WA 2D1ZA 2PDWA 4DIAA 3BMWA 2TODA 1AMKA 4MADA 1F4AA 2UY4A 2GJRA 3IVSA 4PGLA 4RR4A 1TKKA 2FVMA 3L5MA 3H2OA 4PTDA 1JDDA 4KH2A 4AX7A 4I7WA 3W6LA 3AZSA 3GNDA 4QNWA 3BANA 1M41A 4PMNA 1ELSA 2ZX8A 1J79A 3BAXA 1K7EA 3SUUA 3P6LA 4ENLA 1E3XA 2BVTA 4LB4A 2ZZ6A 3QN3A 2ZE3A 1ZB5A 2DU2A 2D0GA 5AC8A 4QLLA 1AL7A 3W84A 4DAFA 4AEFA 5D4YA 2PDPA 3EOUA 5B80A 5CG7A 1MRQA 3ANVA 1UWAA 3GVWA 2WNNA 3DG3A 3KBVA 2BNJA 3GXTA 5B7YA 1JIBA 2Y89A 4M6QA 2PD9A 1IZKA 1FXQA 4LUTA 4DWSB 1UCWA 4CNSA 4HU0A 2QAPA 1W1A1 4I5UA 5C2XA 1FOBA 2ACUA 5CGQA 2H8ZA 3KRSA 2OQLA 1KCXA 5LNWA 4JZ5A 3W2LA 3C3NA 2I5QA 3PBYA 4XBSA 3SO7A 1U22A 3PJWA 4D6GA 2WLYA 4H8VA 4E38A 1KCZA 2H90A 4IP5A 3ABOA 3SECA 3W22A 3NVTA 3CEPA 3URNA 2B7PA 3U2ZA 1EHAA 5FA5A 3LTSA 4KWSA 3E9AA 4KT2A 1VBUA 4GD0A 4KKXA 1DIEA 4D6CA 4Q8VA 1K9EA 4AZ5A 5D09A 4IQJA 1DJIA 3B0YA 5KZ6A 2WMGA 2HE8A 5K3VA 2HV5A 3VMPA 1VFFA 1RP9A 3THUA 3W3OA 3BV7A 3VAVA 2PC8A 1S46A 3CB8A 1BVWA 3PSVA 1JI2A 4DPPA 3RHGA 3VUPA 3NVDA 2WSKA 2BP1A 1V51A 2Z6IA 2QPXA 2A0NA 3GD6A 2J24A 1IV8A 3P0XA 1H2JA 1EKOA 4C91A 4XZLX 3VDBA 4O17A 3BLLA 3XISA 1AH0A 3APTA 3VUSA 2ZA2A 2TYSA 3QYQA 3UWWA 5CZ0A 4LYPA 4EPEC 2RH9A 2VJXA 1K1DA 4O16A 3S9ZA 4IHCA 3ES7A 3TLLA 4DZIA 5BMWA 2ODOA 1XISA 4W5ZA 4ZQOA 2CPUA 1IT0A 4YTUA 3GTXA 4I6VA 4P7LA 2EQDA 2INFA 1S1PA 2WHMA 2BZNA 4PUDA 3P84A 4B5VA 1FWFC 2CNCA 3VU2A 2EXOA 3M46A 4HK7A 3QR3A 4K6AA 4JY9A 2V5BA 3VKAA 4KW2A 1ML1A 3MKVA 2GL5A 2C16A 3AMCA 3UPMA 3RLVA 3PBGA 1VYPX 3LHUA 4ZO6A 1V6YA 3P93A 1FA2A 2VFGA 1TWDA 3RITA 2F8QA 1UA3A 1N8WA 3T07A 1ISXA 1VJSA 2QIIA 3LN3A 3GWQA 1D8CA 1W2PA 3WBXA 4HGXA 3M5XA 5AYBA 3E6EA 3CT7A 2FKPA 5JBEA 3U9IA 3LCFA 4R27A 4S3AA 2BVDA 1JCTA 4FLOA 3KBWA 3DFHA 3T42A 3VGGA 3W72A 4QX4A 4GXWA 2G3NA 1EIBA 5G5IA 2ZA3A 1CZ1A 3C2FA 2AKZA 2W0UA 3BG5A 4PR4A 3L65A 2GGHA 2OELA 1RY8A 3POHA 3BAIA 3DFOA 1TSIA 1K70A 1QI2A 4PCSA 5ABEA 1QBAA 3PTQA 2ON3A 4KGJA 1FHDA 3FS2A 4FNSA 4DWDA 3F4WA 3OZOA 1ONWA 1XR2A 2PEVA 3IACA 4BJHA 1EF2A 2W91A 3K4WA 2B31A 2VFHA 5I3HA 3ZWSA 3QTGA 4PUMA 3UZXA 3W2MA 5HXMA 2VZUA 5DY3A 1PIFA 2RJHA 4DJFA 4M5PA 1HL2A 4MY8A 1BXBA 4YHEA 1KXVA 3PC0A 1GT8A 5FI8A 1WZKA 2YR1A 3M7SA 1TIMA 4UTTC 2GJXB 1QK2A 4AZ6A 4HN4A 3GS6A 3VNZA 3PK7A 4PFHA 1AZ2A 1D8WA 4QLJA 3KRUA 3NPXA 3P14A 5ABFA 4GINA 2R91A 5EGRA 2OMAA 3GYEA 1PZ2A 1ICQA 1KKOA 3NOEA 3RRXA 3FOKA 3KTCA 1Y0EA 5HQLA 3BAWA 4R88A 5A6JA 1YNYA 3C6CA 2UY3A 1PKYA 3CXOA 2CLHA 1ISZA 3VC5A 2GUBA 3WNOA 2X09A 2XFYA 3OG3A 1G4TA 1VFTA 4I6KA 4ICNA 1XUZA 2FTYA 4MWAC 4MJ4A 1RUSA 1FWEC 4FOKA 4B5NA 2G8ZA 4S2CA 2OO6A 1C8YA 1JYXA 2J6VA 1JCMP 3WIJA 3AHZA 4DF0A 3QW4B 4JKMA 2RJGA 1KR0A 1EJXC 4DJDD 1BF2A 3VO0A 3VM7A 1J0IA 3M0XA 4M24A 3TYBA 4B3LA 4PODA 1F6KA 4ICCX 2HXUA 4DYJA 5I77A 2YBVA 1EDQA 1N2VA 1DPMA 4MMWA 2TSYA 4JDBA 2CHRA 1XCWA 4PUJA 4HP5A 1MWOA 3RILA 3ITXA 4AY7A 3HA1A 4C65A 2QQ6A 1E9IA 3CUZA 2G5WA 1TREA 4U2YA 1ZBVA 3MC5A 3THAA 3ORWA 1E6NA 4UQBA 3GFYA 4AZIA 3B9OA 1HT6A 4UUIA 2QV4A 1W3IA 3ARZA 3W1AA 2J9ZA 1UZDA 3GW0A 1PEZA 1W1ZA 3AC0A 3PPHA 3WQCA 4QHRA 5D02A 3WNNA 3M6DA 3NM1A 3N34A 2QIWA 5AVNA 1CGUA 1YIXA 3W85A 4I9JA 1B0IA 3N12A 1C8VA 3KLKA 2BBFA 5IM51 4JHZA 3FDGA 3LX9A 1KXHA 4LY8A 1FHVA 1NFGA 2ZUUA 5AN7A 1JFHA 3LCGA 2E9BA 3TXVA 3U4FA 4XQ6A 3RCNA 1QRQA 4GBDA 4EE9A 1U5VA 4IUOA 1BGAA 3I6RA 4LOCA 1OFQA 1V7AA 3KDNA 2VEKA 5CSUA 2EAWA 4HHPA 4L4MA 4P8VA 3SM0A 3ZT7A 5A8NA 3D3AA 1UR1A 3T1GA 3APYA 2ZUVA 3FCPA 2PE4A 2WO5A 4DZAA 4ORIA 4J7RA 4DM1A 1OGBA 4RE4A 1UD8A 2XFFA 4WJXA 3CB3A 2J7BA 2AGKA 4AZHA 1WUEA 3KBMA 3CH0A 4UMBA 4W87A 1DWAM 5E6YA 2PDNA 4LALA 4JTFA 4NASA 4P7RA 4DBWA 2CU0A 1JPHA 4M0XA 4FI4A 3CT2A 2IQDA 3L66A 1TMHA 3B8UA 5I09A 1EWDA 4ALDA 4IIGA 3V0UA 1JZ3A 1YTKA 4CQAA 4Z2GA 4AMCA 1FTXA 3AQUA 2Y8KA 2NXIA 1KBLA 4LU0A 1O5RA 4FPSA 2VEFA 4CVWA 3AROA 2IQTA 2CW6A 4MDOA 4L1WA 4A05A 1QPRA 3UJEA 2ZUTA 4QJ5B 2XU2A 1H49A 3IPWA 3NL2A 1TWZA 4JX4A 4CN6A 4MWAB 3N2MA 4GCXA 3OBAA 1UROA 1ZCCA 2J7GA 4UFJA 2O9PA 4LVFA 1OCQA 2WMIB 1OFBA 3QSRA 4H7CA 3TWAA 3ARWA 3GKAA 2PBGA 5LIXX 1T99A 3QYSA 3NQ7A 4BQ2A 4UTFA 1RSCA 3BG3A 2JKEA 2QF7A 3A3XA 1S3TC 2Y8VA 1BPLB 1FH9A 2I14A 3NQ2A 2IQ0A 3UQNA 1XICA 4AWSA 3HGRA 2C7FA 4GABA 3ARUA 4QIUA 3S2JA 1VGAA 4B9YA 3VIJA 3GM8A 1L2QA 4LYRA 5I02A 5I78A 1NFBA 1PZ0A 2DIEA 3QTPA 2PTYA 5I3KA 3R43A 1EJSC 5E5CA 5AC4A 2Z1WA 4H6RA 1GEHA 1TPDA 3FSUA 1A5CA 3A3WA 3VGDA 3V5FA 3IAPA 1DJXA 5FJTA 3MA8A 2J27A 3KZSA 5JQ9A 1QCWA 1ME8A 1W3JA 2PGFA 1H5YA 4Q7IA 5LIWX 4JICA 5K7JA 4NILA 1I0DA 1UD3A 1B3ZA 4IQDA 3B0VC 2Z2UA 1X97A 2FGLA 4AVOA 3MUIA 2Y7EA 3UPWA 1QMLA 4W7WA 3WDRA 4CQBA 2GYIA 5CBBA 3LBOA 4JXCA 1JL8A 5CC5A 1PKLA 1GQLA 3NYDA 4GO8A 3B04A 4F0MA 1TB3A 2VZOA 4MY9A 4M3PA 2JF6A 4JQAA 3C86A 2WCGA 1RJQA 1UR8A 3M4HA 2OOFA 3T0DA 5H8MA 1VCFA 2Q3RA 3O0FA 2ZXQA 5CC3A 3ANUA 1JZ2A 3PUGA 1UOKA 4FIRA 4PBFA 1O68A 2C3ZA 1UIPA 2A1YA 2ZUMA 4YN5A 2DJLA 4N6EA 1HVQA 2X2YA 4PL2A 3EAUA 3LCLA 1OEPA 5ECUA 2DSVA 3VMNA 3NQVA 2R9RA 4D6FA 3GDKA 4TX8A 1UA7A 1YNPA 4FA3A 3H24A 4GRSA 2GK1A 3W7QA 1B9BA 2BXVA 1E0UA 3V16A 3G1DA 3KCJA 3SRKA 3SDOA 3RK8A 4YPJA 3E12A 3HPSA 5J5DA