2XFFA

Crystal structure of barley beta-amylase complexed with acarbose
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
486
structure length
486
Chain Sequence
NVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-AMYLASE
total genus 188
structure length 486
sequence length 486
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xffA00
1E4MM 3A3HA 2WC4A 1JAEA 2Y2WA 2Z1SA 3ARVA 3DHPA 4OOZA 3GH4A 4FLOA 3PZNA 1G5AA 4Z2JA 1DWJM 4MAVA 2WAGA 4ZFMA 2CBJA 3UERA 4J7RA 1QI3A 3J7HA 2F2HA 1NQ6A 3B9AA 3ARYA 3BMVA 3VIOA 1B3ZA 3OB8A 2BXZA 2C8NA 2Y4SA 2V3DA 2Y24A 3OLIA 4TXEA 3ZJ6A 1UH2A 3SUWA 5ABFA 4QDMA 2OLHA 4UQEA 4P7QA 1SYTA 5D9OA 3RCNA 1NWRA 3VGEA 1CLXA 1UD3A 3G6LA 3W25A 3QHNA 2ZWYA 3FAWA 1E0XA 4DWSB 1JI2A 1C8QA 5E9AA 5D9NA 1JL8A 2Y8VA 4JHZA 4CN4A 5A6JA 1VIWA 3K4AA 2D20A 1IZKA 2A3AA 2DSZA 2VCCA 2WBGA 4MNMA 1G94A 3O6AA 3T2QA 1V03A 3WH9A 3UCQA 3A4AA 1GVIA 4M1RA 1WP6A 1Z32X 1WZAA 2O9RA 3L4YA 2JF7A 4MNJA 3MS8A 3RDKA 2BHUA 1E72M 1TR1A 3BAIA 3VUPA 3WMSA 5A8OA 5GNZA 3U7BA 1AMYA 1WDQA 3KE0A 4AEEA 2AAAA 4Z2IA 2JFEX 1PPIA 1HP4A 2WW5A 3CUHA 4PMYA 5CJ5A 5E0FA 3GNOA 3WMCA 3IK2A 3GH5A 4W8BA 2DSVA 3WQVA 4D6EA 1X1NA 4IUGA 1J0IA 5I6SA 3W27A 4E2OA 1N82A 2CBUA 3I3BA 4J28A 3VD5A 1JD9A 3IANA 4N42A 4GI6A 3KL3A 1DEDA 1CTNA 3VDHA 1HJVA 2UY4A 3VINA 3W4RA 4QP0A 1MXDA 4CN6A 1JFXA 1E6ZA 3W38A 1CBGA 2VZVA 5I77A 1FA2A 3T08A 4U5KA 4S3KA 1Q6EA 2DT0A 2F61A 3PZTA 4NF7A 4ACZB 1XYFA 4AD2A 1EGZA 1LQ0A 3NSXA 2YL9A 4CCCA 3W29A 1DWGM 5M5DA 4W84A 1HJWA 3RM4A 1QVBA 1W9UA 2FDMA 2DPEA 2D2OA 3D3AA 3SCTA 2ZE0A 5BXSA 1C7TA 1SR0A 4JKMA 1BYAA 3GM8A 4BCEA 1G01A 4TX8A 3WBAA 1K6AA 1M03A 5I5RA 4M29A 4U33A 2ZUWA 3BSGA 1R86A 3VGGA 4U2ZA 1L0PA 2EO7A 4W5UA 4D6JA 4CCEA 4CVWA 2CETA 3K8KA 5E09A 1PIGA 3WDQA 1OIFA 5ABFB 2W91A 3W81A 2WZEA 4W5ZA 2YBTA 4IM4A 1TG7A 4NI3A 1CGYA 1KFWA 4B9ZA 1J10A 1BAGA 3GBEA 3AXHA 4AZ7A 3EDEA 4KRUA 1V3KA 2CKRA 2WC7A 3L2LA 1WDSA 1XH1A 1H0GA 4OIFA 2WPGA 1MWOA 5JBFA 5D9PA 4PCSA 1Q6FA 1TVPA 1TVNA 4D6IA 3VU2A 1Q6CA 3WD3A 5JBEA 1G9HA 4PEEA 3SUSA 3FHAA 1LL4A 1PJ9A 2PWGA 3AS1A 4DWSA 5A8PA 2VRJA 4P8XA 1OT2A 3AICA 4H8UA 2JE8A 3GXMA 5CGMA 2WLZA 5D8WA 3WDIA 1E0VA 3WNPA 1PX8A 5GQBA 5LA1A 1US2A 2V5CA 5ABHA 3IJ7A 1UA7A 5ABGA 3N9KA 3BAKA 1QNSA 1KCLA 1HJUA 3SIMA 1MFUA 3O2LA 4QLLA 3KWXA 1JG9A 1WO2A 3RPMA 1E40A 5D4YA 4UOQA 3RIKA 4GI9A 3VGFA 5HBFA 3RILA 3IJ9A 4AD1A 4U2YA 3T0DA 1GORA 5M17A 1BVNP 3MUY1 1W3HA 2GJRA 3AS3A 1Y7VA 3N11A 4AD5A 2G41A 2VR4A 1U30A 5LA2A 4ACZA 4E4PA 2WKLA 2X1IA 1E6NA 1E4NA 2WHJA 4LGXA 3ZM8A 3VM7A 4PMXA 3NCOA 5EFFA 1PIFA 2VC9A 2WXDM 2BY2A 3CGTA 4U31A 3APGA 1SMAA 2WZIA 1JDCA 3A47A 1VFMA 3AZRA 2BXYA 4BZYA 1OIMA 2X0YA 1CLVA 4P7RA 4P7LA 1UOKA 4GPNA 3UG4A 1UD8A 3W6LA 2ZXDA 2IUZA 3LMYA 2WCSA 3CMJA 1B3XA 1CGWA 1EIBA 4PMQA 1ITCA 1C7SA 2G3MA 3WUGA 1JYVA 1YQ2A 1SMDA 4PTWA 1LWHA 2UY5A 1D7FA 5EMYA 1W1VA 3VIMA 4M81A 1VEPA 4KH2A 5E6ZA 1WB0A 1P6WA 2QMJA 2YDQA 6A3HA 1SFSA 1FFRA 3AHVA 4KGLA 1VJSA 1JZ3A 1GNXA 1DWFM 2VX5A 3WF3A 3AJ7A 1GHRA 4W7VA 1WZMA 3WUEA 1W2PA 4MJ2A 2XIBA 3EDDA 3OZOA 5A95A 4F66A 4YHGA 3B9EA 2RGLA 3VIIA 2AOSA 4K68A 4OJYA 3ZQ9A 4AZHA 1MW0A 1BGGA 1CDGA 4GZEA 1E15A 4WLCA 1A3HA 4JKKA 1ZBVA 2GDUA 3SCRA 4W88A 3FY1A 3EBVA 2JEPA 5JIWA 3WDRA 2XFRA 5CLTA 3K4DA 2NSXA 2EPOA 3AIRA 2EJ1A 4F9DA 4W8AA 4AY1A 2YJQA 1ISXA 3A6OA 4HTYA 1HVQA 1TZ7A 3WH8A 1CXLA 5A6MA 2OYMA 8A3HA 1BLIA 1MQQA 2VMFA 3L4XA 3WBEA 3A4WA 2VQUA 1JZ4A 1JZ5A 1J9YA 3VMPA 1UWRA 1V0LA 1VAHA 2Z1KA 2XVNA 1C8YA 2EXOA 2WBKA 2BNJA 1B90A 4UZSA 1CXIA 3GTNA 1E6SM 1WCGA 1GJWA 5BYWA 1E1EA 5IHRA 1EQCA 3KL0A 3VD9A 2W5FA 4TVCA 4MB5A 2CNCA 1UR2A 2WVUA 4RE3A 5HDRA 1Q6DA 1WZLA 4PCTA 1UZ1A 2VX4A 4D6CA 4XB3A 1C91A 4DM2A 2FHCA 3ZJ7A 1EQPA 2D22A 2NT1A 3OGVA 4DWSD 5JUVA 1R87A 3IAPA 3QGVA 4CD4A 3BAXA 3VX1A 1FP8A 2YA1A 3W26A 3VGBA 2JALA 4UQBA 4JFUA 1BYBA 1QHOA 4HA3A 4F8XA 2EEXA 3WENA 3GXDA 2ZUSA 1LG2A 3B8SA 4XV0A 2XIIA 4DUWA 5FD0A 1M7XA 3GZAA 3M6DA 2V3EA 1M53A 3W0KA 3VPLA 5FL1A 4H7VA 2XM2A 1E5NA 1V0NA 1CNVA 3U7VA 2W4XA 4JL2A 2GDVA 5BXPA 2D0FA 3VO0A 3ZR5A 1CGXA 4YHEA 3ZJKA 4AEFA 2VCBA 5A8QA 1MW2A 3WELA 3F4VA 4UFLA 2VNCA 4MB1A 2VX6A 2CEQA 1XGZA 3ARZA 4HU8A 2EPLX 4ZXLA 5CSYA 2A3BA 3VGDA 1GW1A 1V3HA 1JNEA 1ZU8A 2WMGA 4GZJA 3RJYA 4A3YA 3UG5A 2J7FA 5JBDA 1HP5A 1E71M 3FNDA 4QFUA 2OSXA 1J0JA 1KQYA 1LLOA 1UWQA 3DECA 3ARXA 3T0AA 1W1YA 3CHFA 4P8WA 3CHEA 2OYKA 3NIYA 1R7OA 3MMWA 4LYRA 1DWAM 1VFOA 1CWYA 3POHA 5BCAA 4AMCA 2BHZA 2WM0A 5A8NA 1BQCA 4R5EA 3CZJA 3L4ZA 3TA9A 2BY1A 1KCKA 2PB1A 1TA3B 3T2OA 3CTTA 2CERA 4EANA 5DEZA 1VF8A 2B31A 4AZIA 5CSUA 1BYCA 3WD2A 4J3SA 5A2CA 4CU6A 1B3WA 3AS0A 3CZKA 4PMRA 1ZJBA 4MJ4A 4OOUA 2OWWA 3VD3A 4ATDA 5BXTA 1QI4A 2A3EA 4BQ4A 1W1PA 1EDQA 4M24A 4CD7A 3ALGA 1NP0A 2C7FA 1EOKA 3OLGA 1OGGA 1JZ8A 4E8CA 3WD1A 4PTMA 2WMJA 1WKYA 3TTSA 2D0HA 3ZIZA 2UY3A 3MUIA 5CXPA 1J11A 2J25A 4WSJA 4CN1A 1A47A 3AIUA 3EMQA 1LF1A 1XHGA 3AS2A 7CGTA 3W37A 4D1JA 1CXHA 2J7CA 4PUDA 3WDHA 3II1A 5LA0A 4MAZA 3UETA 1JNDA 4B3LA 3MU7A 5BWFA 3OGSA 1UG6A 2VZTA 4WKAA 2X09A 4HZ7A 2OSYA 4CD5A 3JUGA 5D9MA 3SEPA 1ODZA 3OIHA 3WN6A 1TCMA 3OGRA 4W85A 4C7FA 5HPCA 1G1YA 4B15A 2WMKA 1H5VA 4FK9A 1ITXA 3VILA 5EBAA 4B9YA 1JIBA 8CGTA 5LYRA 4JZ5A 2WC3A 3WNMA 3N17A 3WFZA 2YA2A 3THCA 3AHYA 1F4AA 5E70A 1ZBKA 4NRSA 1AVAA 3L4UA 2YL8A 3AYSA 3ZT6A 2J47A 4PTXA 7TAAA 1JD7A 3OLDA 3VDBA 2Y8KA 2DSUA 3DYMA 2VJXA 4GINA 1MQPA 2JIWA 3W28A 2DDXA 1RP8A 3AXIA 3GH7A 1EO7A 2NT0A 4L4PA 1JYWA 4HZ6A 2DIEA 3M07A 1CECA 4AW7A 1I1XA 4URIA 2X2YA 4IISA 2EPMX 1EOMA 2IXUA 1PAMA 1V3JA 4MB4A 1J01A 1RH9A 1KXTA 1I75A 4BF7A 2E9MA 3FAXA 3EDFA 4AC1X 3AFBA 2BY3A 3WQ4A 1UD4A 1H11A 1NM9A 2WVVB 2ZUUA 1H09A 3PZQA 4W89A 1JXKA 1XCWA 2DQXA 3ZT5A 4PUEA 5AC4A 3ZSSA 3D5HA 1NOFA 4AZ5A 3WNLA 6CGTA 4JIEA 4ZE5A 1GOIA 3VMNA 4CUCA 1CGTA 1OM0A 5F7UA 4C7DA 1CIUA 4FLSA 5HPOA 2MANA 1W9VA 4HZ8A 3BSHA 3ARUA 1NH6A 5I79A 1E73M 2JEQA 1BYDA 3MSGA 4MTVA 2VRQA 4TTGA 3IAQA 3QR3A 1W3JA 1W91A 1WAWA 3CH9A 4AYSA 2WKGA 1GPFA 3LPGA 3IJ8A 3BMWA 4YN5A 1V02A 2J7GA 1ISYA 3WL1A 1E9LA 3BAWA 3L4WA 2WYSA 3VIKA 1LWJA 5M03A 5CLWA 2PF0A 4HP5A 1EA9C 2Y5EA 1B2YA 4WJXA 2ZX9A 3ARTA 1V0KA 4X0VA 5I78A 2YL6A 1O6IA 2XM1A 4W8LA 2YL5A 1UH3A 5BRPA 4A4AA 3WD0A 3VNZA 1DTUA 1ISZA 4J3WA 1KB3A 1GQJA 1LG1A 3AHTA 3CZ8A 2QHAA 1RPKA 3SCSA 4LYPA 2CHOA 2D3LA 1QNRA 1CPUA 1QW8A 4A3HA 1V6VA 3AQUA 2WB5A 5AYIA 2ZOXA 4IPLA 3SCWA 2PWHA 1KQZA 1PX3A 1CXEA 5A6AA 4GO9A 1FFQA 1UWIA 3TTQA 4R27A 3L2MA 2D0GA 3PZMA 2YDRA 5FIPA 3N15A 3ZT7A 4PSPA 3WEOA 3FW6A 3WH7A 2X05A 1W9BM 2VL4A 1CEOA 4UNIA 1UWTA 2DH3A 1UQZA 3W24A 4WF7A 1ESWA 2J62A 2CBIA 2XHYA 1GOOA 3RM9A 3BXWA 4H8VA 2W61A 3CHCA 3ZMRA 4IPNB 1CYGA 2QPSA 1C3FA 1XCXA 2J4GA 3RO8A 1C8XA 1JYNA 1V3MA 3GNPA 2PBOA 2QPUA 4HOWA 2J78A 2WVVA 1JDAA 1V6UA 4WSKA 3BAJA 3AISA 2XGIA 2YBUA 1UKOA 3W6MA 1CZ1A 3WF0A 1S46A 4ACYA 3AIWA 3VOCA 1HKJA 4AIUA 1KR0A 2HVMA 3N1AA 1FHLA 4UFJA 3QOMA 1O7AA 2XVLA 3BAYA 1NOWA 3ALFA 3O9NA 1I1WA 1XSKA 1MFVA 1W1TA 5DFAA 4UOZA 5D8ZA 3WQ6A 1GQIA 1W9DM 1XH0A 2FHFA 4CD6A 1DHKA 5ECUA 1HL9A 1OWQA 3NUKA 5E0CA 1M01A 4PYSA 3UR7A 1GQKA 4PTVA 2XTKA 5E6YA 2QV4A 1FHDA 3VNYA 4OZOA 1NWUA 3FN9A 1PX4A 2VVNA 5CPTA 1J12A 4NZCA 2XPKA 2E4TA 4LQ1A 4CCDA 2A3CA 3AYRA 1ZJAA 1PZ2A 1ZL1A 2WHLA 2C0HA 3GYCA 4GKLA 1VBUA 1B0IA 2PC8A 2PWEA 1UA3A 1V02E 4B3KA 1FP9A 2E8YA 3WUBA 2OYLA 3WNNA 2O92A 2A3HA 4JKLA 4GXPA 3VIHA 1BG9A 4AWEA 5HOSA 3RJXA 1JDDA 1TE1A 3AIBA 2WVSA 2DIJA 3CUGA 4U3AA 1U2YA 4QCEA 1JF5A 3PTMA 5GPRA 1JF6A 2CBVA 2ZUVA 3NDZA 3AI0A 4UZUA 3WY1A 3WH5A 4ML4A 1BGAA 1KGWA 3CZLA 4HMEA 4Z2KA 1EO5A 3M46A 1GONA 1XD0A 1VRXA 1E6QM 2OSWA 5IFTA 1MQRA 2DSWA 1E4IA 1CXKA 1IV8A 4NSBA 4TX6A 4UFHA 3AHXA 3VKKA 5BXRA 3WNOA 1R85A 1G0CA 4QLKA 4UFKA 1UKSA 3CHDA 2DEPA 4UQAA 1CGUA 1Q4NX 3VMOA 3WF1A 3SUVA 5ABEA 2YLLA 1JXJA 1UD2A 3K46A 3VIGA 4JFVA 2E9BA 1NP2A 4Y7EA 1BVZA 2WNWA 4UQDA 1J0HA 2J79A 1L8NA 4J3TA 1KXHA 1LJYA 2VRKA 2FH6A 1VENA 2E0PA 4DUVA 1UUQA 4DWSC 1ZS2A 3SURA 2DH2A 1WNOA 4PN2A 1HX0A 3UR8A 1W9XA 4YPJA 1WE5A 1JZ7A 2O9OA 3WEZA 5A8MA 2UWFA 2ZIDA 4WKHA 2CIPA 1W2VA 3BC9A 5CPSA 3S6TA 1B31A 1KBKA 2GK1B 1CGVA 2D1ZA 3EYPA 2ZX6A 2BY0A 4AIEA 3VGHA 2WMIB 3WEMA 3PN8A 2QF8A 3OA5A 2GVYA 1PEZA 4D6FA 2XFFA 1KWKA 5AC5A 1QNQA 2ZWZA 4Q22A 2WANA 4MPKA 4MNKA 1HKMA 1GVYA 1Q6GA 1HVXA 3F5LA 5IFPA 1WDPA 3MKKA 2XFYA 5AYBA 2J74A 3DYPA 4JCLA 5A6BA 1IZJA 1W3KA 2XJ7A 3ARWA 3EDJA 3PHAA 1V6WA 4UCFA 2W62A 4WIWA 5TD4A 3SCVA 1JI1A 2E8ZA 4MDOA 1UQYA 2D24A 4W93A 3VTRA 1UWUA 2CYGA 2PBGA 2ZUNA 4RE2A 1FH8A 2VURA 3OLEA 1B3VA 3WDJA 3SUUA 1CENA 4D1IA 4OBSA 3VIPA 2E3ZA 4KRTA 2G3NA 4P7OA 1E3XA 4E8DA 3AOFA 1EDGA 2YLAA 4EAMA 3AIEA 2WK2A 1OGSA 2VZUA 2WMFA 3RM8A 3SCOA 3KL5A 4BS0A 4ATWA 1BHGA 3NSNA 1K9DA 2FGLA 1GOKA 3FHQA 3QHOA 5I24A 1B9ZA 4BQ3A 2QMKA 3K8MA 3W82A 5FKYA 1H1NA 2RGMA 1TUXA 4W7WA 2XSAA 2WHKA 1NOUA 4ZE4A 3WIJA 3WF4A 4GQRA 2ESCA 4CVUA 4U3CA 4HMCA 4WK9A 5KEZA 3AROA 4J3XA 5A6LA 1GOQA 3NDYA 1BFNA 1OSEA 1XC6A 4AZ6A 1WDRA 4AZGA 4MADA 2J8FA 3HMCA 1VB9A 1JFHA 1OCQA 2V38A 3ZJ8A 4ZEPA 4D6GA 1HL8A 3TTOA 5I0DA 4Z2HA 5IXEA 3QOKA 3ZR6A 2G3IA 2VO5A 1ODUA 2ZICA 1K9TA 3CUFA 3I3DA 3WKZA 1HXJA 3HJEA 2WVTA 1RP9A 1BSIA 3VM5A 4EKJA 1EDTA 2XG9A 4QCFA 2V3GA 5FCZA 2CESA 4AXNA 2DT1A 2GK1A 4HPGA 2OWCA 4D72A 3TP4A 5A69A 1ECEA 3VD7A 1AQHA 1MYRA 4F9JA 4JHOA 4GI8A 3PTQA 5IDIA 1JYXA 3AXXA 3EMZA 3ECQA 4QAWA 1XH2A 1UR8A 1E43A 4AIOA 2PWDA 3WFLA 1UR9A 1MW1A 2VZOA 4C7GA 1J0YA 1KXQA 1V3IA 1E4LA 1ISVA 3OZPA 3UESA 3AMDA 4V2XA 1TMQA 4HMDA 2XGBA 2VX7A 1AQ0A 4MNLA 2BVTA 2FH8A 1DWHM 1XSJA 3EDKA 4M82A 9CGTA 2WWCA 1VEMA 2GJXA 1E6XM 1UD5A 4EE9A 3WNKA 4PBGA 1E6PA 2D3NA 2W67A 4XX6A 2VQTA 4RE4A 1OINA 3NJ3A 5CG0A 2BV9A 3GXIA 5EB8A 5A3HA 2J8GA 5CPQA 4RL3A 1UKPA 3M7SA 2YOCA 1B30A 3MV11 4GZIA 1J0ZA 1E3ZA 5EFDA 2W92A 3U5UA 3F5KA 4JFTA 4LXFA 1ZB5A 4ZENA 1NWTA 4P7NA 1HJQA 3AMGA 2XSBA 1C90A 4HA4A 3SCUA 4UTFA 4HU0A 3AZSA 6TAAA 2GJPA 4W86A 4Z2LA 4JFSA 4TTUA 3KEHA 4D6HA 4TOQA 2DT2A 2WCGA 5GNXA 2DT3A 2ZXAA 4CU8A 3PZIA 1GUVA 1JAKA 2ZXQA 1HT6A 3N13A 3VD4A 4FLQA 2EPNA 1B1YA 5C71A 2VR5A 1MW3A 2VOTA 1FH9A 4F79A 1MVYA 1LL6A 4CGTA 3AIVA 1US3A 2XWEA 1QI0A 4LYQA 1QI5A 2XVGA 5BRQA 1OD0A 4GQQA 3WQ8A 3PZGA 2YA0A 2EBNA 3I3EA 2NW0A 3AMLA 1E1FA 5C70A 1H4PA 3BLPX 3WL0A 1NWSA 4EK7A 4OUEA 3PZVA 1KGUA 2J7HA 5A1AA 5KZ6A 1E0WA 3WDPP 2E9LA 1XYZA 1VBRA 4HA1A 1KWGA 1C92A 1E56A 1VFUA 1JGIA 1GOWA 1J18A 3MANA 1UKTA 3MV01 4ATLA 4BQ5A 4DUXA 1H49A 1TA3A 5DF0A 4H8HA 1H3GA 1OBAA 1W9PA 3ARSA 4PMDA 4MB3A 5I3DA 2X0HA 1QBAA 1KR1A 3SCNA 5M3WA 4X9YA 4UR9A 3QHMA 1UYQA 1PZ3A 2BS9A 2QLYA 2XUCA 3T09A 1K9EA 2J7DA 4QLJA 1E6RA 2VVSA 1UKQA 1D2KA 1HF6A 3GXFA 1QI2A 3DHUA 2CXGA 2WSPA 5I23A 2DGAA 1BF2A 1R7AA 1EHAA 1UH4A 3UEQA 4W7UA 4BQ2A 3HN3A 1JZ2A 4PMNA 3ZO9A 3VDAA 2XWDA 2WSKA 1EH9A 3B9DA 3BLKA 3CUJA 1QNPA 2EPKX 3VX0A 4ZXOA 1V0MA 3MSDA 2J75A 1XV8A 3NYDA 1WPCA 2Q8XA 3BCDA 3MUAA 4H04A 3RMEA 2VTFA 4AZCA 1TFVA 1W3LA 1UWSA 4AZCB 4UOJA 2IXVA 1PBGA 3VVGA 3L4VA 1BTCA 3ZSTA 1E55A 4AD3A 4DM1A 3CPUA 2BVYA 3PZOA 2VI0A 4AZBA 3CLWA 3BH4A 4CU7A 2O9TA 4AD0A 2GFTA 2DSKA 4TVUA 4BA0A 4UQ9A 2PWFA 3ARPA 3DYOA 3BGAA 2E40A 3MMUA 1FH7A 1F4HA 3GNRA 4XUYA 3ARQA 2UY2A 3A4XA 2VCAA 3MO4A 1KBBA 1NARA 3LPPA 2CITA 3CZEA 2FGZA 1XSIA 4TUFA 2JIEA 1GOMA 4L4OA 4D71A 5JIPA 3OG2A 3N18A 3SCQA 4W87A 1OB0A 5I2UA 1AQMA 3S2CA 4HPHA 4J3VA 1GCYA 3E1F1 1HIZA 2FHBA 4KMQA 1D3CA 4KGJA 1V6XA 3SUTA 1X6NA 2G4FA 4FF5A 4PMOA 4MDPA 2JF6A 2CHNA 1OD8A 5HNNA 2V5DA 2ZUMA 4D6DA 2EQDA 4P8VA 1MXGA 2WMHA 2BVDA 3CMGA 3VIFA 1QW9A 4B16A 1K9FA 2PI6A 2ZX7A 4PMVA 4M80A 3THDA 4PMUA 2WCAA 4JFWA 5DT5A 1R8LA 3T0BA 7A3HA 3WQ5A 1U33A 1UZ4A 4PRWA 3MUZ1 3WH6A 4PMZA 2X8RA 1E5JA 3GDBA 3W53A 2G3JA 4UFMA 1RD6A 4N0RA 4FLRA 2W63A 3WQWA 1ISWA 1V3LA 1FOBA 1YHTA 2WWDA 2HISA 2YIHA 1UD6A 3G6MA 4H41A 1VFFA 3PTKA 1V6YA 2XVPA 3WSUA 3U57A 1E70M 4Z2GA 2J7BA 1X6LA 3K8LA 4TVDA 4UQCA 1JZ6A 2O9PA 3TONA 1H2JA 1QPKA 3WUFA 3CBWA 4AD4A 1DWIM 3VIJA 2CKSA 1DP0A 3KZSA 1M04A 5AY7A 3TTYA 2WHMA 5DO8A 4JCMA 3AZTA 5A6BD 1EXPA 2F8QA 3OBAA 1ZBWA 4CD8A 1J0KA 4X0NA 2GSJA 1BG4A 5FOOA 4JAWA 2XYLA 3LPFA 5BROA 2V3FA 1B3YA 1KXVA 2WLYA 2G8ZA 4NRRA 1EHNA 1W32A 3U5YA 2GUYA 2XVKA 3DC0A 1WZKA 3AIQA 4HOZA 3HU7A 3L4TA 2ZX8A 1OGBA 3N12A 4JL1A 2YKKA 3CIVA 1V08A 2WMIA 1QOXA 2D23A 3POCA 3MMDA 4J27A 1H41A 2BFGA 1GHSA 3ARRA 5A2AA 4KWUA 2VUYA 4V28A 1HKKA 1HNYA 4H2CA 1UR1A 1ZBCA 5CQ1A 3NSMA 4P8UA 2YDSA 1KGXA 4OBRA 2GJXB 1QHPA 2ZX5A 4M8UA 1VEOA 3AHZA 3GBDA 4M56A 5FL0A 2AMGA 4WKFA 4LPCA 4XZBA 1C93A 5CGTA 1QNOA 3PBGA 3SCPA 2VZSA 4LX4A 5GNYA 1UR4A 4GIAA 1CXFA 1HKIA 2CCRA 2VT0A 3PZ9A 2W66A 2J7EA 4V27A 1H0IA 1HN1A 3CO4A 4PSRA 5DT7A 3F5JA 4S3JA 4UFIA 1UR0A 3T2PA 1XRVA 4J3UA 3AMCA 2OWXA 3PZUA 4GO8A 3AMKA 5A6KA 1GZJA 3LPOA 2J77A 2ZXBA 2ZUTA 5CZKA 3EMCA 5IHSA 5HXMA 4Q7NA 1HJSA 2BHYA 1GQLA 4AISA 1HJXA 2CPUA 5C8BB 1LL7A 3BCFA 3WMBA 1UHVA 4XZWA 3ZOAA 1QHZA 4CKQA 1VJZA 3TOPA 1BPLB 3N04A 3VDCA 3UG3A 1GJUA 3FXYA 5A94A 1IT0A 3WD4A 3K1DA 1XD1A 1OT1A 5A6SA 5A2BA 1QBBA 4FMVA 2WZHA 4U5IA 2TAAA 5DMYA 3CUIA 3WF2A 3CZGA 4OKDA 4HOXA
chains in the Genus database with same CATH superfamily
2GUBA 3G1SA 2GGHA 3A3HA 3B8WA 2WC4A 3MHGA 1ZTVA 4Q33A 2Y2WA 5B80A 3KBJA 3W71A 1NFBA 4JX6A 3P14A 1P1MA 1O5RA 3HG2A 2E5BA 4FLOA 3PZNA 3W7QA 2OLSA 3CUXA 4IFRA 4ZFMA 3KS6A 1AJ0A 4J7RA 4FAMA 4DJED 2F2HA 2VOMA 2YFNA 2GL5A 4H3DA 5CEWA 4DYEA 4GUJA 4E8GA 3LCGA 4YIWA 2Y24A 1UH2A 1W1A1 4OQVA 3A22A 4P7QA 2HVOA 1SYTA 2WJZA 3RCNA 5KETA 1MUWA 5K9XA 1UD3A 3G6LA 3L0KA 3PTDA 4FNUA 1C8QA 5E9AA 3IVSA 4DJFD 2Y8VA 5U4NA 5A6JA 2FTYA 3K4AA 2D20A 1IZKA 4C90A 3LSBA 4DIAA 4ZQRA 4QG6A 4G56A 3UCQA 3PBMA 3A4AA 3FDGA 1WP6A 1TRIA 2Z1XA 3W70A 3WLMA 2Z26A 3KOFA 4BKNA 3MS8A 3VUPA 1W0MA 1AMYA 1WDQA 4Q8QA 3M47A 4UNLA 4Z2IA 5JQ9A 3C52A 4C60A 1HP4A 1XGEA 3AAMA 5CJ5A 3LCFA 5E0FA 4LOCA 3GNOA 4WRHA 2BP1A 2DSVA 3BLFA 4ZOAA 1X1NA 3G8RA 3W27A 1N82A 4J28A 3VD5A 3IANA 4N42A 1Q7ZA 3KL3A 4J2PA 1DEDA 1CTNA 4DO7A 4QSHA 3UZJA 3MB9A 3W4RA 4QP0A 5A5WA 1V5XA 1MXDA 4ZA0A 4QDWA 3OBKA 4C6CA 4LC8A 2VZVA 3UD6A 3T08A 3S1VA 4U5KA 4HNNA 5FSDC 1XPYA 3LGEA 3U2OA 5AC7A 3B06A 3PZTA 2V69A 4C6MA 4AD2A 2YB1A 1EGZA 1LQ0A 2WJDA 3ABQA 4W84A 3RM4A 4HCLA 1YXCA 1ZGDA 3S8HA 2DPEA 2D2OA 4GG9A 4Z08A 4JTUA 3KBSA 5BMXA 1CX9A 1BYAA 1G01A 1TR9A 3KLLA 2FMNA 2Q71A 1H1ZA 1R46A 4N4QA 2AQWA 2VWSA 4ICNA 3BSGA 3IJLA 4U2ZA 4F0SA 5L6UA 4LU0A 2PSNA 1OIFA 2JKEA 1XCFA 4I8DA 4DEFA 5CPMA 2JGYA 1TG7A 1YDNA 1CGYA 3FA4A 5ECVA 1KFWA 4B9ZA 4S3AA 4IGSA 2V8ZA 1ML1A 4MLJA 4B92A 2ICSA 1WDSA 3ITLA 4OIFA 1EA0A 3ZXWA 1BXNA 4QG9A 1S2AA 1CT5A 3LCWA 4PEEA 3W7DA 3Q67A 1XIGA 3LXAA 1A4LA 4LRSA 3MP3A 5I00A 1OT2A 3EOUA 3ITYA 2V5CA 3TOYA 3BAKA 5LXXA 5I3KA 4BHYA 3M0KA 1OG6A 1JG9A 1WO2A 2BSLA 3NDOA 3RPMA 1ADDA 1F61A 4HBKA 2CW6A 4AUBA 2CLMA 3RIKA 3V3WA 3T0DA 5M17A 4JDBA 1LOLA 2XN2A 2GJRA 4GK8A 1H7RA 4TMCA 2PDCA 4K1GA 3A9IA 4JX4A 4ACZA 1OFDA 4A8NA 5LXEA 1K7XA 2X1IA 1E4NA 3ZM8A 3VM7A 5F2MA 3TJ4A 1XBXA 2JKPA 2WXDM 1KFBA 2BY2A 4NJHA 1EIXA 1VFMA 2BXYA 4Q8OA 3DERA 1OIMA 3BGJA 3UY8A 3C0SA 3PJXA 3HQ1A 2ZXDA 3IGUA 4EVZA 2WCSA 1B3XA 5G1MA 2PU1A 1ITCA 1C7SA 1MRQA 1JYVA 3WBWA 3V0UA 3EPOA 2C13A 1KM3A 4XD6A 1D7FA 1W1VA 3VIMA 3UVAA 3VKCA 5E6ZA 2HEJA 2QMJA 3GX9A 6A3HA 2GQ3A 3AHVA 4KGLA 1Z44A 3UZ5A 1JZ3A 5LNVA 1DWFM 4MSSA 3O0KA 1GHRA 4W7VA 2CLEA 2A85A 1YPIA 3U0HA 1LQ2A 2XIQA 3EDDA 4B5UA 4QSFA 2J24A 4YHGA 2AOSA 1XYLA 5AYZA 2YPIA 5HUOA 1A3HA 4JKKA 3NQEA 1ZBVA 3V0SA 1KCXA 4W88A 2I5GA 4YCPA 2JEPA 4UUIA 2BTMA 2OT1A 3OVQA 1IXOA 5CLTA 3AIRA 1FWBC 2EJ1A 3VE9A 3LTYA 4W8AA 5C9XA 4JQ4A 3NXLA 1H51A 1YBQA 1B54A 4QS6A 5CGQA 3GXNA 1CXLA 4GI4A 4YLWA 1MQQA 4IICA 2C1HA 3L4XA 4KIRA 1LYXA 3GVGA 4GYJA 5CZSA 4WOQA 2INEA 3RLUA 3DG7A 2F7FA 2GSHA 3FYOA 2RUSA 3HQOA 4L61A 1I4NA 3GTNA 3T55A 5KITA 4EXQA 3C86A 5BYWA 3QV8A 1DJXA 2F6KA 1TCDA 4DHGA 2W5FA 5CSRA 4MB5A 1KNWA 5D2XA 2WVUA 1UR2A 5HDRA 4PCTA 3ABXA 2ZRXA 5A6TC 1BWVA 3TXZA 1FCBA 4HJWA 3WJXA 4AWTA 5K2ZA 2ZE3A 2GGIA 1R38A 2XIOA 1GZ1A 1ZRQA 1EQPA 3IJQA 3GHRA 3G1YA 1WV2A 4XAYA 4DJEA 2DZSA 4CD4A 4NXKA 4NZJA 1CB7B 3W26A 5BOOA 5SWUA 2JALA 1DJZA 4UQBA 2GLKA 2PDPA 2DW6A 4NAEB 2IPGA 4IIDA 1TQXA 3WENA 4DUWA 1M7XA 1M53A 1BRLB 3EPNA 2DZVA 3HFYA 3UA4A 3TQVA 2XM2A 3KVKA 1TWIA 4LW7A 4RDVA 2R14A 3E0IA 4Y2WA 5HMFA 2Y62A 1AL8A 3VO0A 1CGXA 3H70A 1Q6LA 1G4TA 3F4DA 3QR1A 3FJNA 3F4VA 3IIZA 5DLCA 4R7WA 1O60A 2VX6A 2CEQA 3ARZA 4RJEA 1HGYA 1XICA 2RH9A 2Z28A 1ZUAX 3QSTA 1JUEA 3VGDA 3MVIA 1GW1A 1V3HA 3W86A 3RJYA 3KX6A 3UG5A 5JBDA 3FNDA 3PBWA 4PEKA 1LLOA 2C14A 4IQDA 1UWQA 3PBVA 4PUNA 1W1YA 4P8WA 4A6GA 4QNWA 2V68A 2VDHA 1W1B1 2P76A 2R94A 1VFOA 4E2DA 1KM2A 4G7FA 4EF8A 3G1AA 3ISIX 4HNVA 1A5SA 2BY1A 1WXYA 3P61A 3PB2A 1MXSA 2X41A 1KCKA 1RY8A 4S3FA 2UBPC 3T2OA 3CTTA 4AQLA 2QCDB 5HJLA 1Q2SA 4EANA 2D73A 4JX5A 3QW4B 3H22A 2HTMA 2B31A 5CSUA 3BMXA 4DF0A 1B3WA 3UXIA 3AS0A 4LUSB 1ZJBA 2HE5A 1S2WA 4NHVA 2OWWA 1QI4A 1W56A 1SGJA 3B03A 2Y7EA 1XIEA 1D3GA 3OLGA 1AJZA 1F74A 1R3QA 3AC0A 3EA3A 1R9XA 1O1ZA 2D0HA 3I6EA 4A35A 1RQBA 1A53A 4PODA 2Y88A 4C6DA 1J11A 3TWBA 2NV9A 1EC7A 1LF1A 1Z48A 4HB7A 3UJ2A 3AS2A 1TYGA 3CIXA 3EEZA 7CGTA 4JS3A 3DCPA 1CXHA 5HNTA 3NZQA 3GFZA 2X09A 3LI1A 4CD5A 2GQ8A 1Z3NA 3FOKA 5CZ0A 3WO8A 1QO5A 1TCMA 3MJYA 1R3WA 1YNQA 4W85A 1TB3A 3UWWA 1H5VA 2IPFA 4X22A 3QC3A 3SECA 2CZEA 3TC7A 4LUYA 1FDJA 3IUIA 4L9YA 3LDVA 1F4AA 4GD0A 3TROA 4PE8A 3L4UA 3ZT6A 3H26A 3NQBA 4LEFA 3VNKA 3VDBA 4LALA 4C1LA 3DYMA 5KZEA 1OJXA 3W28A 1O5XA 3GE7A 4D8LA 1W5QA 4EXAA 1TJ0A 1WDDA 2Y8UA 2DIEA 4WJEA 2PGEA 1NY1A 2E68A 4FX8A 4YCOA 1PAMA 1R3SA 1V3JA 1KXTA 5B7YA 3UWVA 3IJ6A 4AC1X 3AFBA 4V33A 1QAPA 3TVAA 2ISDA 1NM9A 4WHBA 6REQA 2C1GA 2ZUUA 1OG0A 4KEUA 4W89A 2HPIA 1NOFA 4ZE5A 3VMNA 1Q6RA 3QXBA 4MWAE 1GVFA 3PUGA 3BG3A 3HBLA 5GVJA 3CV7A 3EOOA 5HPOA 1W9VA 4F48A 5TBOA 2QF7A 4HZ8A 4JY9A 3B8IA 3LM7A 4PGLA 4AC7C 4L6HA 2VRQA 1X8FA 4F0HA 1P0NA 1GPFA 1FDYA 3LX9A 2FZ8A 3BMWA 4L1GA 4YN5A 2J7GA 3EGJA 1E9LA 3W7HA 2WYSA 4KKXA 1LWJA 3KVJA 1ZP4A 5M03A 2OB3A 1B2YA 1K8ZA 3GNXA 1XLCA 1E0UA 2VFDA 4X0VA 1T7LA 1XLMA 4XVEA 1IHIA 3HPXA 3WD0A 3PPHA 4LBUA 3V5FA 4JTTA 5AHEA 3HG3A 5HANA 1GQJA 3M64A 1B4EA 4I9JA 2B7QA 2HWGA 3CZ8A 4LYPA 2Z6IA 1CPUA 2FJKA 3AQUA 2WB5A 2ZOXA 5KSWA 1TPWA 3SR7A 3SCWA 2PWHA 5A6AA 1UWIA 3TTQA 4YU1A 8RUCA 4RDWA 4HHHA 2IKHA 4YL2A 4WJ8A 5EMKA 4EPEC 1SVDA 4KRZA 4ZB2A 1X38A 3WEOA 3HOJA 2X05A 3SFWA 1ONRA 1UWTA 5T9CE 1DQUA 4FX7A 3HZ3A 3LK6A 5RUBA 1FWEC 2PE4A 4XTDA 4O1EA 5ABTA 1MRAA 5F4SA 4H8VA 1FKXA 1POJA 3ZMRA 4I7WA 3M5YA 4LYKA 2Z1BA 3GNPA 2PBOA 4MYXA 1YXDA 1IGWA 3SBFA 4ML9A 1QK0A 4WSKA 3BAJA 4HK6A 4DLFA 3W6MA 3HG5A 3DFNA 4ACYA 1BVWA 1UUOA 3QF0A 4AAJA 1KR0A 2HVMA 1BKHA 1W54A 1NOWA 3O9NA 2G3FA 4RZ5A 1W1TA 4MY9A 4LCRA 3H24A 3BQ5A 1LZOA 1DHKA 5ECUA 2DZPA 5E0CA 5DCDA 1VYPX 1GQKA 3DIPA 5E6YA 3TFCA 4LB4A 3S1WA 3P7YA 3VNYA 4OZOA 1PX4A 4LJ3A 2VVNA 5CPTA 2A1YA 3QW3A 1V7AA 4NZCA 4LQ1A 1WA3A 3CIWA 2JK2A 1OC7A 4MWAC 1DVJA 1ZJAA 3G24A 4LF1A 5HUPA 2PC8A 1UA3A 4B3KA 2P3ZA 4UXDA 4O16A 2E8YA 4YVXA 3WNNA 1Q85A 4XSMA 3VIHA 4AWEA 5HOSA 5FJRA 3RJXA 1JDDA 2L5HA 1TPEA 3C2EA 3H7UA 2ZFAA 2GGEA 4B5WA 1RA5A 1EYWA 4GQ0A 1I2PA 5CPLA 1E1CB 1KGWA 4Z2KA 4BEUA 1P1XA 1EO5A 1GONA 3M1ZA 5CG7A 1XD0A 3H2MA 1SO5A 1IEXA 3H21A 4GCAA 4NSBA 1XGDA 4UFHA 3LBOA 3AHXA 4TX6A 3PVFA 5BXRA 3WNOA 4DAIA 1UKSA 3MPGA 2DEPA 5CPOA 1Q4NX 1HL2A 4RDYA 4FNPA 4O15A 1RV8A 3OTRA 1JXJA 1W5NA 3ZLFA 4ZSTA 1UD2A 1AODA 1FWDC 4FNQA 4JFVA 4QTGA 2QT3A 4WR3A 1WBHA 4UMBA 4J3TA 2VRKA 2FH6A 4DUVA 1UUQA 2QQ6A 4XQ6A 1KBJA 1WX0A 1ZCOA 4QS5A 5I06A 3O0FA 2E6FA 3WEZA 5A8MA 2G95A 1OX6A 2UWFA 1KM0A 1K7EA 3KOYA 1W3IA 5CPSA 4ZTXA 1PS9A 2D1ZA 1M41A 2YZ5A 2BY0A 1A3WA 4Q8MA 1OY0A 3R7MA 2FTWA 2DV0A 4C1NA 4Q22A 2ATSA 4O1AA 1GVYA 2YW3A 1FWSA 1HVXA 1Z41A 3F5LA 2XFYA 2KAUC 4UCFA 2W62A 3TAOA 2Y89A 3KBNA 1EZ2A 2ALRA 3NNTA 3EKGA 4N9DA 3FK4A 2D24A 4W93A 1M65A 3VTRA 2PBGA 2ZUNA 5LKYA 1FH8A 1QNVA 2P0IA 1EP2A 4YTTA 4DXKA 1ZQ5A 3W1MA 3G18A 3GHTA 3SUUA 4KPLA 2E7FA 4D1IA 4OBSA 1BRLA 1FWRA 3BLOA 3WMLA 4DXVA 4E8DA 3TKFA 1DE6A 4JYEA 4Q4QA 2VZUA 1FWJC 4HSNA 2C1IA 1A50A 3DG6A 4ATWA 1ZAIA 3NSNA 3Q37A 3FHQA 3S2JA 5I24A 1B9ZA 1GW9A 3NPWA 1H1NA 1TUXA 5CC5A 2XSAA 2ZRVA 1OZQA 2WHKA 4ZE4A 4ZO8A 3LSCA 3R0DA 4CVUA 2IW0A 2AL1A 3MHUA 2V5JA 3AROA 3IV8A 1NF7A 3GU1A 4FA3A 5D37A 4TR9A 2ZCGA 3CEUA 1W31A 2YB4A 1OSEA 4AZ6A 3DFHA 1VIZA 3DDMA 4G7EB 1OCQA 2C6QA 3NM1A 1IGSA 1OZMA 4NASA 4Z2HA 3GDTA 1C9WA 3HPSA 4IMCA 1K9TA 1HXJA 1PZ0A 1ICQA 4KEVA 1BSIA 1IEIA 1I2NA 3PPGA 3N4FA 4AXNA 2DT1A 4LUIA 4D72A 1L8PA 2HSAA 3VD7A 4FOJA 4YYCA 4WQ6A 1BKSA 3PTQA 4IGNA 1OVDA 3EMZA 3K1GA 1TV2A 3DC8A 2PWDA 3WFLA 1UR9A 1MW1A 2DVXA 1KXQA 1KM4A 3UESA 4O1DA 4M51A 1M5WA 1AQ0A 4MNLA 1U5VA 2BVTA 4F2TA 2QCDA 4M82A 5C2GA 3M0YA 4M6UA 1VEMA 1RJQA 3D47A 3HMJG 3I7SA 1TWSA 1VPXA 4AMAA 5I07A 4PBGA 5XIMA 4QEHA 3O07A 3EXRA 1JULA 3PPCA 5K4XA 5BNKA 2Z00A 2GJLA 3V1PA 2AQVA 1EBHA 2Z2UA 1Y0EA 2RDTA 1SR9A 3WJWA 2YOCA 2PDFA 3H23A 1MMFA 1KRMA 2FPVA 4RZ4A 5FJIA 3U5UA 3F5KA 4LXFA 1ZB5A 1JCJA 2OOFA 1IEWA 1HJQA 1K70A 3TC3A 2XSBA 4HA4A 3SCUA 5DANA 3BO9A 3H2FA 6TAAA 3H2CA 2VEPA 4ZQMA 4TTUA 3KEHA 3BSMA 4C6NA 4UNKA 3QMTA 4CU8A 3EEGA 1JAKA 1ONWA 1R47A 4FLQA 1U83A 1L2QA 2NQLA 5FESA 2VOTA 5AYYA 3MWAA 2A3LA 1OADA 1Z9AA 1J2WA 4NAFA 4CGTA 2XWEA 2NVCA 3GIYA 4LYQA 2XVGA 1OD0A 2W9MA 4GQQA 3T07A 3VKBA 1E1FA 3MKVA 5ENLA 4DO6A 3BLPX 4PL1A 3W85A 2C15A 2GVEA 1VLWA 3HIJA 3S9YA 4AVOA 4X63A 2HNHA 3T0CA 4QQUA 2R82A 2E9LA 1RVGA 4OUIA 2EHHA 1VFUA 3DBPA 1GOWA 1J18A 1EEPA 1FHVA 1W1IE 3I7RA 1TA3A 4ERIA 2E5DA 3ARSA 2YBVA 1RVKA 4Q7IA 4XD3A 4RW5A 4JTCA 4DJDC 3CK5A 3W00A 1QPOA 3NURA 3V75A 3DHFA 5XINA 4DBWA 2J7DA 5DBTA 3GXFA 5JH2A 4IIEA 4B91A 1EGVA 1JR1A 3JZEA 1BWLA 1S3TC 3K30A 4JTEA 1DJNA 2I57A 1TVLA 2FVKA 3GIQA 1EHAA 2IQ0A 4OV4A 3ZO9A 4LC6A 5IBXA 4DUOA 2PTYA 3DX5A 3HGJA 2EPKX 3MSDA 2J75A 1DJYA 3NYDA 3BV7A 3OW1A 2RJGA 2VTFA 5FJJA 4BF9A 4FHAA 2E1DA 4UOJA 3TEVA 2FYMA 2IXVA 3VVGA 1BTCA 1LLZA 1H7PA 3NGJA 4AD3A 4KCTA 3CLWA 2V5BA 3AWOA 2GFTA 2DSKA 4BA0A 3ARPA 2H9AA 1FY6A 2QR6A 3TR2A 3BGAA 4J3ZA 3LM3A 3DFPA 4DELA 3MO4A 3LPPA 2QZRA 3FEMA 1CCWB 4MKSA 1ME7A 2OXNA 1PCKA 1R3YA 4F4RA 3GYEA 4L4OA 4WDUA 1E1CA 3N18A 2Y63A 3P62A 1GCYA 1IIHA 1HIZA 3SSJA 3L9CA 3REQA 1D8CA 1X6NA 2G4FA 1YMYA 3M9YA 3M0MA 4RK8A 3CU2A 4S23A 4D6DA 4FNSA 1N8FA 3VIFA 4LVAA 1VCFA 3TAKA 3SM0A 4ZVJA 4M80A 3DI1A 3THDA 4O0QA 4PMUA 4YTUA 1F6PA 1U33A 4Q4SA 4GWEA 1MNSA 1E5JA 3QV9A 2GSEA 2PWVA 4GYKA 4L6OA 4XAPA 3F4CA 4N0RA 3MQTA 4FLRA 1ZY9A 5IOBA 3WQWA 3IGSA 1V3LA 2E25A 3CB3A 4ZQPA 2WWDA 3NEHA 4RV8A 1TV3A 2HISA 2YIHA 1UD6A 4EWND 1T8QA 4QE5A 1XLAA 1RD5A 3PTKA 1W17A 1V6YA 2QS8A 4LVGA 1C8VA 1VS1A 1JZ6A 3UPMA 2VGBA 3SY5A 3TONA 1QPKA 2WQDA 1JQXA 2VGGA 2VEIA 5CAKA 5AY7A 2Z24A 4HGXA 3DGBA 4R7OA 4JCMA 3VKDA 3OBAA 2Y7DA 5H8PA 5LZLA 2VFIA 5K7JA 4JAWA 2XYLA 5BROA 4A05A 4NRRA 1EHNA 3NQ2A 5FF0A 2GUYA 2I16A 3ZVIA 3UZXA 3H54A 3PS7A 4EACA 5LNUA 1XG3A 3B9NA 4PB3A 3AIQA 1UP3A 4H9TA 3L4TA 4XBJA 4CEUC 2WMIA 1QOXA 2D23A 4J27A 1ONEA 2R8WA 1FWIC 4HPXA 3ZZ1A 4JYDA 5CQ1A 4BFAA 4OBRA 2ZX5A 1SUXA 1VEOA 1TV7A 3AHZA 2G0WA 1EF3A 2PDHA 3WK3A 3GBDA 4H4IA 3VNJA 1BXBA 3NZ1A 4LPCA 3U48A 5CGTA 1V8EA 3PBGA 4NNBA 1M6JA 4H00A 1UR4A 1HTIA 4JN6A 2ALDA 1FXPA 4V27A 4QRNA 4RLIA 1FWFC 4UFIA 3CMFA 3T2PA 1WXZA 3E0LA 1WKEA 4GO8A 1TTJA 1ZP3A 3LPOA 3LV5A 2OEJA 3KCOA 5EA9A 2ZUTA 5IHSA 1Y5WA 4HTBA 2BHYA 4PRTA 4AISA 2CPUA 5C8BB 1UHVA 4M6QA 3ZOAA 2ISWA 4MOZA 2C0AA 4CKQA 1Z8AA 3FKKA 3GVVA 1D7KA 4FP1A 3TOPA 1BPLB 2ZZ2A 4L56A 5K3VA 1GJUA 5A94A 3M41A 3WD4A 1XD1A 1OT1A 3DFTA 5A6SA 2AL2B 4IFOA 5A2BA 3HV8A 4FMVA 3W1LA 3HPFA 1FRBA 3IUHA 2OJPA 3WF2A 3CZGA 4LTSA 1TX0A 3T05A 4OKDA 4O52A 2QUUA 3GC4A 1F73A 1KCZA 3ITTA 4QX4A 2XIJA 4AIBA 3T4CA 4OOZA 1R0MA 3GH4A 4Z2JA 1PKYA 5I3IA 3UERA 3H4WA 1NQ6A 3VC6A 3EKLA 3SO7A 1LCOA 3ARYA 1Y5XA 3G0XA 2AQOA 3Q58A 1PKNA 3HQPA 5REQA 3OB8A 1RK6A 1V6TA 4JTQA 2Y4SA 2FDSA 1S2VA 4TXEA 7ODCA 1VPYA 4CQAA 4M7TA 3E74A 4HQVA 5ABFA 1LUCA 4UQEA 4E38A 4LVFA 3LB0A 2YDAA 1JI2A 2V63A 2DVTA 4MM1A 4JHZA 4IFKA 3DEQA 3LEPA 1HQTA 3CPGA 2VCCA 4MNMA 1V03A 1L9WA 1K7FA 3NR0A 1GVIA 4M1RA 2A6NA 1Z32X 1WZAA 1H63A 2JF7A 3TCEA 4DQWA 1QK2A 1RCOB 1TR1A 3WMSA 4V15A 4K38A 3U7BA 1ECQA 3HM7A 1E9YB 3KE0A 2AAAA 5I7GA 2JFEX 5AFDA 3EB3A 4WDXA 4M6PA 2RFGA 4C6QA 4QIUA 4RNHA 2FB3A 2R1PA 4ENLA 3WQVA 4D6EA 4IUGA 4QXIA 3VOGA 1MEWA 4GX9A 4JDYA 2Y85A 2BZNA 2XH7A 3ZFHA 3F2DA 3ITOA 4FOUA 5GJNA 3VINA 4MKVA 4NY2A 1YTDA 1JFXA 1E6ZA 3W38A 2ACQA 3G5EA 2YW4A 4AF0A 3EX1A 4HK5A 3ZS4A 1DOSA 1EJXC 4NF7A 2Q6ZA 1CLKA 3BG9A 1UC5A 4NZ3A 4JXCA 1GOXA 1MUMA 3N3TA 1DWGM 3GR7A 4Q4PA 5M5DA 3W23A 1HJWA 1BXCA 1XUUA 1QVBA 4U28A 4UBPC 4FPSA 1BSLA 1K8XA 3QSRA 1C7TA 1V93A 5CBIA 4F2UA 3GM8A 4Q8PA 3NQVA 4TX8A 5H91A 1FBAA 2BODX 5I5RA 2H3DA 3GDRA 5EMUA 5HMEA 3RNDA 3S2MA 3VA8A 4Z0JA 4HCDA 4CVWA 3O1NA 4C6KA 3TFXA 4N9BA 3O15A 4FB7A 5ABFB 1NSJA 1DJHA 3W81A 1HKWA 1GTHA 4IQJA 9XIAA 4PUUA 2Q01A 3HPZA 1J10A 1Z89A 2ISFA 2NX1A 3EDEA 3GW3A 4QE4A 3S6DA 3S9IA 3L2LA 1TJRA 4DBEA 1MWOA 3W7NA 5C55A 1TVNA 4LCSA 3LV6A 3TYBA 4S3EA 3SUSA 3FHAA 2YYUA 1LL4A 4AWSA 2NUYA 3AS1A 4PUJA 3BLLA 2ACSA 1ALDA 2JE8A 3GXMA 5D8WA 1E0VA 5LA1A 5GQBA 2MNRA 5HA7A 4CQDA 1J4EA 5ABGA 3N9KA 3R10A 1QNSA 2QDEA 1KCLA 3KTCA 1HJUA 2F2KA 4O19A 4GNVA 4HSOA 4UOQA 1T99A 2R1KA 1E0TA 1IEQA 5HWJA 2XN0A 3VGFA 5HBFA 2OKTA 1FQ0A 3GU2A 4FX6M 1J6OA 1PUDA 1GT8A 4FIQA 4MZ8A 1IXNA 1SPQA 1N8WA 1TIMA 2G41A 1R2RA 2VR4A 5XIAA 3CNYA 1WBJA 5HINA 5BRBA 3S5OA 5I02A 2GYIA 2CWNA 4DWDA 4LGXA 1PYMA 4JTKA 3N19B 2E6AA 4PMXA 5G4EA 1EC8A 2OQYA 3APGA 3CL8A 2WZIA 3AZRA 2NLIA 1CLVA 2X0YA 4P7LA 5LGZA 1UOKA 4WEVX 4O11A 4GPNA 3UG4A 2TRSA 1S39A 2ZRWA 3BOXA 3D46A 5D09A 1FWWA 1EIBA 3WUGA 1OCNA 1QFEA 2OT0A 2X1SA 1YQ2A 3INPA 4JTLA 4F0KA 3S5NA 1IXQA 1JCLA 5F1VA 2Z7KA 3SW6A 2F6XA 2ONEA 2XISA 1PTGA 3VK5A 1OF6A 2O0TA 4N2YA 1KFKA 1UB3A 2R1MA 3S2LA 3WF3A 1JUBA 3N6QA 5AN7A 1EGMA 1TQJA 1EWEA 4MJ2A 1ENUA 2XIBA 1AQFA 4AY7A 3UWEA 3VIIA 4OJYA 4M5PA 3G1FA 1A5OC 4V1YA 4PULA 3TJIA 1BGGA 1CDGA 4AVFA 3R94A 4WLCA 3M5VA 1XL9A 2NV1A 2HQAA 4ZZ9A 1FUYA 1XQLA 1UW9A 3EBVA 3R25A 3WDRA 3QY7A 3LHWA 5AECA 3K4DA 4IT1A 2NSXA 4PBEA 3GXTA 4FALA 2YJQA 2DVUA 3HURA 1ISXA 1RCXB 4GYFA 4OVXA 4HTYA 1IT8A 1HVQA 1TZ7A 3CXOA 2OYMA 1KLYA 2VMFA 5DQPA 3U3HA 1BWKA 2VQUA 4JGDA 4M6VA 1VAHA 3GZ3A 1E51A 1C8YA 5T91A 4EXBA 1RBOB 1IZCA 2EXOA 4NYUA 2YGYA 1AW5A 3LCLA 1E6SM 1WCGA 1GJWA 1OX4A 3UCCA 1UROA 4JOMA 4HHPA 3S3GA 1E1EA 4GUGA 4NNCA 5IHRA 1EQCA 4TVCA 4L9XA 3PWAA 2CNCA 3AWNA 1NDVA 2ZZ6A 1J93A 5AC6A 4JTGA 2TSYA 2PTWA 4DM2A 1VCGA 3R58A 1Z69A 2HS6A 2D22A 3RU6A 3EWZA 2NT1A 3OGVA 5JUVA 4NQ1A 2YA1A 1P0BA 4K8GA 5DCEA 3VGBA 2ZC1A 3TNOA 1QHOA 1S5MA 2IKIA 1P0EA 5CCZA 3W84A 4GE8A 5CBBA 4N9CA 4NUWA 3B0XA 3B8SA 4L1WA 2XIIA 3GZAA 3M6DA 4P61A 4MUZA 3F7JA 4QDPA 3NQCA 4L5ZA 4ZQNA 4WY0B 3VPLA 1NJJA 3CYJA 3UWQA 2NX9A 3U7VA 2W4XA 3ZR5A 4EP8C 3BICA 3QKEA 4DJFA 3PFMA 2VCBA 3O3RA 4CNOA 2WSQA 4UFLA 2CLLA 1XG4A 3S1XA 5D2YA 4MB1A 3MDUA 2CFFA 2OO0A 2J6VA 2EPLX 1AH0A 5REQB 4QHRA 2OCZA 3VFLA 5CSYA 3N3MA 5CJNA 4AU0A 3B40A 3HJZA 4FI4A 1O95A 4I9AA 4S1FA 1J0JA 3LOTA 1KQYA 5G5IA 3Q65A 3GW0A 2KZHA 4D9PA 3W75A 2Z2AA 5HATA 1ZJIA 1JCMP 4LYRA 1DWAM 1KW1A 2QXWA 4R5EA 1G4EA 3D6NA 3LQLA 1JJKA 3OP2A 1TA3B 4E4FA 4XKYA 2CERA 5AVNA 1J2BA 4LFYA 1GEQA 3WD2A 1KV8A 1GYNA 4NZFA 4B5XA 3BCJA 4BEQA 4PMRA 1F8MA 3C3UA 4F40A 2J27A 5BXTA 2YXOA 4BQ4A 1W1PA 1T6MA 1QWGA 1YDOA 1NP0A 2UZ9A 5FEXA 1OYBA 5C7VA 1OGGA 4IZGA 1JZ8A 4E8CA 2NX3A 4JTRA 3WD1A 4PTMA 3GKFA 1JPIA 1R30A 3S5SA 1WQ5A 4XO7A 3ZIZA 2UY3A 2PDQA 3MUIA 4R88A 4O4VA 3W76A 5D38A 5GJPA 3EX3A 3EMQA 1JUKA 3M16A 5CKSA 4US5D 3ME3A 4HIBA 4MAZA 1YPXA 2ZADA 2YCLB 1UMYA 1VH7A 4B3LA 3MU7A 1R5YA 3OGSA 4QISA 1P48A 2VFEA 1KRAC 4JICA 2HXUA 3AYVA 4LAZA 3SEPA 1VGAA 6XIMA 1ODZA 2D2JA 3WN6A 4YWSA 4Q4KA 1ZFJA 1B9BA 3TA6A 4B15A 1MSSA 2CWXA 4FK9A 1JIBA 2RHGA 4O28A 3U4AA 4JZ5A 2VC5A 4CQCA 4HJFA 3V16A 3WFZA 3AHYA 3EWDA 2ZA1A 5E70A 1AVAA 2XINA 2YL8A 4PBFA 2QV5A 3AYSA 1T5AA 7TAAA 3RLVA 2DSUA 3N6JA 1GGOA 2GJNA 2JIWA 3MSRA 1RP8A 2ZZ7A 3G3DA 7ENLA 1JYWA 4KS0A 3QJAA 3M07A 1I1XA 9RUBA 2FGBA 3TN4A 3TWAA 3WZ0E 4IISA 4Z1DA 2QVHA 2IXUA 4BF5A 2W0UA 2YX0A 1J01A 3TTEA 3JZUA 4G1NA 2DIKA 3WQ4A 2PDYA 1UD4A 3WLIA 1R9YA 4QROA 1H09A 5AC4A 3TE9A 3ZT5A 3DUGA 3NQ7A 6CGTA 4JIEA 4C1NB 4OTKA 4CUCA 1CGTA 4TX9A 1ZLPA 2OELA 5F7UA 2H6RA 3UNTA 1CIUA 4FLSA 2WPBA 2B0MA 2MANA 3OVPA 3BSHA 5DMLA 1NH6A 5I79A 3W1RA 1E73M 4Z1AA 2JEQA 2WO5A 1BYDA 1NDZA 1YTEA 3IAQA 3DU0A 1W3JA 1W91A 1WAWA 4LUTB 2WKGA 4S3CA 1I9CB 4R9OA 5FA5A 2Y61A 2PRLA 3C3NA 3BL3A 1ZHAA 2HS8A 4I5RA 4JTSA 3ZVHA 3C6CA 3UF9A 3LY0A 4YTSA 5CLWA 4HVXA 2A7PA 1WAUA 1EA9C 3S42A 4LNYA 2QUNA 4Y8EA 2I5QA 1V0KA 1DV7A 2YL6A 2DZAA 2OZ3A 2XM1A 5E1QA 2YL5A 1P7TA 4A4AA 2Y5JA 5H2ZA 5JU6A 1ISZA 3STPA 3GNDA 2POTA 1LG1A 1RPKA 3QPZA 3N73A 3IVUA 4IIBA 2D3LA 1QW8A 4A3HA 3L5MA 6PTDA 4IPLA 4UCGA 2CU0A 1KQZA 2G37A 4O13A 1FFQA 3NQDA 4R27A 2ZZ5A 3U2CA 2D0GA 3ITGA 2YDRA 3W7GA 2Z27A 3V36A 3ZT7A 4E2VA 2CLPA 3WH7A 4UNIA 1X7IA 2DH3A 3VZXA 2NXHA 3EX4A 4JBRA 4ORMA 1SZGA 2CBIA 4KW2A 1R3TA 3RM9A 2W61A 1CB2A 4IPNB 3W1NA 1YEYA 4HZMA 3PK7A 5I3GA 2Q8LA 5FJPA 1C3FA 3RO8A 1C8XA 4YTQA 3BUVA 3U2EA 2WVVA 4NILA 2YFOA 1V6UA 3AISA 3OIXA 2E6YA 1PB0A 3L12A 3W2KA 3LHUA 3WF0A 1S46A 3AIWA 3A5VA 3VOCA 1RUSA 4TV5A 3M0IA 5EYWA 4DZAA 4XKMA 1FHLA 3CWNA 3VOJA 3WQEA 5G1YA 2XVLA 4O10A 3ALFA 1GKRA 4IQLA 4LVBA 1H62A 4CD6A 3NUKA 4M1BA 1GKPA 3TSDA 3TMLA 3UR7A 4PTVA 1I45A 3T0TA 2VD9A 3RMJA 3STEA 1WUFA 1NWUA 4TMBA 2OFJA 4EOUA 6XIAA 3MJMA 1J12A 1W1ZA 4QJ5B 3FXGA 3VNDA 2XPKA 2RAGA 4DJDD 4B2DA 1XLBA 3NWRA 1PZ2A 2C0HA 3GYCA 4DBDA 2X0SA 1MEHA 2DZXA 1MZRA 4EF9A 2A3HA 5MHBA 1W37A 1AUSL 2TPSA 2R24A 2P53A 2DIJA 3PWGA 4U3AA 4JTFA 4QCEA 1DE5A 5GPRA 2BB0A 2CBVA 3NDZA 5BOFA 2Y7FA 1YXYA 4GBDA 1F3TA 3OODA 4IIFA 1BGAA 3CZLA 3MI6A 3RR1A 1SO6A 1AH3A 3V4BA 1VRXA 1E6QM 2V81A 1XIDA 2GGJA 2DSWA 4RPPA 4ONVA 1CXKA 1IV8A 2PP1A 2Y0FA 4DBSA 3UYIA 1G0CA 4LB3A 2P50A 4UFKA 1SM9A 1XISA 2QJIA 5ABEA 4PFHA 1N7KA 3K46A 3VIGA 4IX0A 5EU9A 1YE6A 2ABAA 3MP5A 1J0HA 1L8NA 4O17A 4MF4A 1QJWA 1LJYA 3L21A 2LLEA 4GCXA 4JNYA 5FF4A 1P6CA 5C54A 3S4TA 3R8HA 4N4PA 1WNOA 5JXQA 4E0CA 2FTPA 3SDOA 3WJZA 3UR8A 4FXSA 4JIHA 3W1QA 1WE5A 5LGXA 2O9OA 2R9RA 1KTCA 4WKHA 3DH7A 5AC8A 3EPMA 2FPYA 1B31A 1KBKA 1CGVA 2QYGA 2ZX6A 4O0KA 2EPHA 2P5NA 3VGHA 3UY7A 3W1UA 4F0RA 4GNJA 4D6FA 1KWKA 2V5LA 5M1TA 5AC5A 2NQJA 2ZWZA 3S47A 2WANA 4MNKA 1HKMA 3W2LA 4QJ3B 3KTXA 1WDPA 3MKKA 1XRFA 4I6VA 1TZZA 5LIYX 1IZJA 2OEMA 3E0WA 1W3KA 1R2TA 3HV9A 1V6WA 2J66A 1QUMA 4K8EA 3EB4A 3TN5A 3AUOA 4WIWA 5MKGB 1LRQA 2E8ZA 3PY2A 4QBXA 5HJXA 2CYGA 1GVQA 5J04A 1K8YA 3ATZA 3IS4A 4HMNA 2NWSA 2NVDA 4BI5A 2DZWA 1EUAA 4I6KA 3QVQA 2XU2A 3WDJA 2V9DA 4S2CA 2O4MA 5G4WA 1YRRA 3VIPA 1WXJA 4IMFA 4KRTA 4NJGA 1E3XA 3AOFA 2YLAA 1BQGA 1OGSA 4WOZA 3E5BA 3OQEA 2WNQA 2R91A 3LQGA 1BHGA 3O06A 2FGLA 1UIPA 3VUSA 2QMKA 3W82A 5TNVA 3C0LA 4HU3A 3O8AA 2OEKA 3W22A 1NOUA 3WIJA 4R33A 4WY0F 4L6DA 3V35A 4ADTA 4RZ6A 4U3CA 2YCJA 1UUMA 4WK9A 3AJXA 1X39A 1U1UA 5AZ1A 4ALDA 1OFEA 5DRIA 5AHIA 3NDYA 1BFNA 1GKQA 1K02A 1K6WA 1XC6A 1WDRA 4MADA 3CAVA 3HMCA 1JFHA 2V38A 4YXGA 3CT2A 1YW1A 4UC5A 3QOKA 2VO5A 1REQA 4C6FA 3IGXA 4A22A 1AW2A 1G4SA 1Q45A 4IIGA 1RP9A 2HRWA 4EKJA 1XJBA 3NPVA 1RPXA 3A3WA 4IL2A 2XG9A 4QCFA 3UG8A 2Z0IA 4HPGA 4MG4A 5A69A 4A8RA 4F9JA 3E5PA 4JHOA 4Q8NA 4GQBA 3KDOA 4ERGA 3IJIA 1JYXA 3AXXA 1SFLA 1EC9A 3ECQA 1K3UA 1UR8A 4AIOA 1NFGA 2QGHA 2VZOA 4C7GA 3U9IA 2HPMA 1E4LA 1ISVA 3OZPA 1RALA 3H8AA 4HMDA 3LA4A 3E3HA 3DAQA 3I4EA 2XGBA 2VX7A 1EJVC 1DWHM 4L7ZA 3EDKA 4WXZA 4B5VA 1EX5A 2YCKX 4EE9A 4KFPA 1TSIA 1E6PA 3U8GA 3GKAA 1O12A 4XX6A 2OQHA 2W67A 1OINA 4ZTYA 3G22A 1ZENA 1H5YA 1RAKA 5CG0A 3EOLA 3RCMA 5DY2A 1F6KA 2FPTA 4UR8A 2J8GA 3GVQA 3ABRA 4RL3A 3PP7A 3T44A 4I5XA 4H9XA 3VC5A 3WK0A 1V51A 4JQ3A 1GEHA 5EFDA 5C7HA 2W92A 3LRMA 3TMQA 4B4FA 4ZENA 3L67A 1EBGA 2GVGA 3N2XA 1S2CA 2HMCA 4UTFA 3AZSA 1QW7A 4XIMA 4KFNA 4A8IA 3PF3A 1XBYA 4D6HA 3KDNA 4TOQA 1JDEA 3M44A 1CI1A 2DT3A 2OU4A 2ZXAA 4ZO9A 5J5DA 3PZIA 1GUVA 2XFWA 1LBFA 3DG3A 4DAFA 1ME9A 3T1GA 3IIPA 3N2MA 3TLQA 3UXAA 1X97A 4ERAA 3CQJA 1FH9A 4F79A 1MVYA 1EXBA 3OHMB 2VC6A 3HF3A 1QI5A 4XUGA 5F4XA 5CZTA 3PZGA 2EBNA 3AMLA 3IGHX 5C70A 1H4PA 1YLVA 3GHSA 4FR6A 4EK7A 3PBUA 4OUEA 2ANUA 3COTA 3NL2A 4LUSA 2J7HA 3RLHA 3R4IA 2CC0A 4C6IA 1XYZA 1UASA 4ZBCA 4HA1A 5CPNA 3H55A 3SFKA 1C92A 2OZ8A 1E56A 3MANA 1UKTA 4WX2A 1Z7AA 3SADA 4ATLA 4BQ5A 4DUXA 2PD9A 5DF0A 4KWSA 3GTXA 3PPFA 1W8GA 2G50A 4PMDA 1O68A 1QBAA 5M3WA 3LRKA 7PTDA 1M9HA 3PANA 1D9EA 2WJEA 3UW6A 1O5QA 1G67A 4UR9A 3RPDA 1UYQA 4B5SA 1UJPA 1QOQA 2BS9A 2PS2A 2WNNA 4QLJA 1UKQA 4DY1A 5BOEA 2CXGA 3A23A 3TW9A 1J79A 3VNIA 2MUCA 2DGAA 1BF2A 3MCOA 2F84A 3ERPA 4L4LA 3L0NA 2J9YA 4PZVA 1C9DA 1JZ2A 1FWCC 3FCPA 3D0CA 2WSKA 3B9DA 3WK1A 3NL3A 2FFCA 3CUJA 3W2MA 1GTEA 2WJFA 1M7PA 2HBXA 1XV8A 1XYBA 2OOGA 3MUAA 4H04A 1TFVA 4M3PA 1TRDA 4L4MA 4BJHA 1W6TA 4N6EA 3CPUA 5IM51 2FFIA 4DVOA 3LTSA 3BW2A 3K13A 4CU7A 2O9TA 2X30A 3LHYA 4TVUA 4Y6GA 4I9MA 1FH7A 3W02A 4IL0A 2OZ0A 4XUYA 1TX2A 5LNSA 4CQ9A 1CW2A 2VCAA 3WQDA 2CITA 4EAYA 4UB9A 3UBPC 1GVOA 3QTPA 4GYPA 1JPMA 2C91A 2BASA 2XN1A 1GOMA 4D71A 3TV8A 2BDQA 4W87A 3S2CA 3E1F1 1JRBA 3GG1A 1EJSC 4KGJA 3MBFA 1V6XA 3UWUA 3H53A 2JF6A 1OD8A 5HNNA 4D2JA 2EQDA 4P8VA 4A3RA 1P43A 1LROA 3QMRA 2WMHA 2NQHA 3VABA 3CMGA 1AFSA 1K9FA 2ZX7A 3BOFA 4GYPC 2A21A 1TWZA 3QFEA 1F7BA 4CLMA 3PWIA 2WCAA 5DT5A 7A3HA 1VYSX 4EPBC 1UZ4A 2DJXA 2WM1A 3FSUA 1RA0A 3AALA 3RHGA 4JQAA 5H8MA 3W53A 1BEUA 3GIPA 1LBMA 4UIOA 3LGGA 5KZMA 3UQNA 4NAFB 4B5TA 4MHBA 3MKCA 3USBA 3S5ZA 1YHTA 3JVAA 4AHOA 1YBQB 4H41A 1YYAA 3QN3A 4LEQA 1JEZA 1LRTA 1JCYA 3WSUA 3U57A 1QMLA 4GVIA 3GFYA 2PUZA 3LUTA 2O9PA 1H2JA 3CL6A 4KF1A 4R85A 4AD4A 1T8XA 4IP5A 2CKSA 1FCVA 3R43A 3TTYA 1TPC1 3W7CA 1IF2A 4N9EA 1O5KA 5DO8A 2F8QA 4E3VA 5HNUA 4W4QA 4ZQCA 3LPFA 1J5TA 2G8ZA 4O50A 1K1DA 2R1NA 2XSXA 4QQ3A 1UR3M 4JL1A 5HR7A 2C19A 2YKKA 1T41A 3BARA 3MMDA 4I7UA 1VFTA 6REQB 2BFGA 5A2AA 3ARRA 3QZEA 2VUYA 4V28A 1HKKA 1HNYA 4GVFA 1TELA 3SI9A 1UR1A 1AD4A 2ZTJA 4NIRA 3TC6A 1KGXA 1PL9A 1T0OA 4XVDA 4M56A 2AMGA 2BBFA 4WKFA 3SCPA 3APTA 3PB0A 5GNYA 2EG8A 4LX4A 5DX7A 4WSHA 3PZ9A 2W66A 3CASA 3E38A 1H0IA 2H3BA 3CO4A 1GG0A 5C5YA 1KRBC 3AMCA 1NDYA 5A6KA 1ZALA 3AXMA 4Y96A 1OFBA 1Q8AA 5CZKA 3W7IA 6ALDA 4XSLA 4NL1A 1GQLA 1LL7A 3WMBA 3DFQA 4XZWA 4ZB0A 1OABA 5F2GA 2Z4GA 3N04A 3UG3A 2TODA 5EMJA 3LS9A 4U10A 4IPJA 1IT0A 1TPH1 3QRHA 4NZ5A 2WZHA 3MDWA 3ENLA 3GD6A 2BX7A 1OFQA 1LWIA 1E4MM 2PA6A 3W72A 4KWVA 1JAEA 5C9WA 4XZLX 3K5XA 2Z1SA 4LV4A 3ARVA 3DHPA 1A5LC 1FCQA 1QTWA 3GK0A 3DHDA 1DQWA 1DWJM 3GB6A 1TJPA 1XIJA 2G5WA 2ZZ4A 3TCSA 2CBJA 5HWMA 3RN6A 3BZGA 1TTPA 3N2CA 3E12A 3J7HA 1S2UA 3GY1A 3BMVA 2X16A 3VIOA 1J6PA 2BXZA 3CL7A 3LG3A 2V3DA 3U6WA 3ANVA 3OLIA 1MDRA 3IIXA 4H9YA 5D02A 3ZJ6A 2QW5A 5C2XA 1XBZA 2ZZ3A 3EWBX 2OLHA 5D9OA 5EMMA 1NDWA 1NWRA 4NJKA 3VGEA 5AB3A 4FNRA 3FAWA 1Y8BA 2EKCA 2BG5A 4DWSB 3SN0A 4A29A 5D9NA 5FEWA 3APYA 3PSWA 2A3AA 3N2OA 2WBGA 1G94A 2ZA2A 3T2QA 3QV6A 3VDGA 2O9RA 3L4YA 4P2VA 3RDKA 2BHUA 4NP7A 2EKGA 3BAIA 5I3HA 5A8OA 5GNZA 1W8SA 2TMDA 3WLJA 3PR2A 2ZRZA 1QCWA 2CZFA 3R2GA 3CUHA 4PMYA 3C8NA 2OTDA 4UTWA 4IP7A 5F1UA 3MMTA 3WMCA 3LZ5A 3UFYA 4IG2B 4W8BA 4X2RA 2DW7A 4Z17A 5D30A 1J0IA 3R13A 5I6SA 2PURA 5I3JA 3M0HA 5FI8A 3VDHA 1XP3A 1HJVA 4L9ZA 2UY4A 1YDYA 1XLEA 4LF2A 3CWHA 4CN6A 5C9RA 5I77A 1FA2A 3LGDA 1ICSA 3KOWA 4XD4A 1I0BA 2O7SA 1Q6EA 3QLDA 1XLKA 2NQ5A 1XYFA 1EUNA 4XISA 2YL9A 1WUEA 4CCCA 3VNLA 3W29A 1TV8A 1MNZA 4D8ZA 1G6CA 3NPXA 3ANYA 1DJQA 2GWGA 4GGHA 3P5YA 1UJQA 5BWAA 4GA8A 4JN8A 2FDMA 3D3AA 1OEPA 3HG4A 3BPWA 2CZDA 4M7SA 1LM1A 1X98A 4JKMA 4GXWA 3B3DA 3WBAA 1K6AA 1M03A 4LS1A 1DL3A 3EA2A 3STGA 4M29A 3KOXA 4J35A 2PGWA 2E28A 2HBVA 2J13A 3OYXA 2EO7A 4RXFA 3V5OA 3M43A 4D6JA 4FNTA 5HR6A 5CJMA 1IQ8A 2CETA 4HN4A 1PIGA 3MA8A 3STFA 3STCA 2W91A 2Y70A 1XDLA 2P8CA 4OGZA 4TV6A 4IMGA 4XAZA 1W3NA 5D2VA 4AZ7A 4IWWA 4KRUA 1V3KA 3EXTA 5LNWA 3IJDA 1XH1A 1H0GA 5JBFA 3U4FA 4DI8A 1ZAJA 5D9PA 4PCSA 1VBHA 2X2GA 4O0ZA 1HUVA 3VU2A 5JBEA 5F2IA 2R6OA 4XZNX 1PJ9A 2PWGA 2PDJA 4OWGA 4DWSA 1UWAA 2CZ5A 3AICA 5LNRA 1U22A 1US2A 1H7OA 3R0KA 1SW0A 3T42A 3IJ7A 3TJXA 4GVGA 1RJPA 5EGRA 4DB7A 4JIRA 3PUDA 4MJMA 4Q4RA 3QYSA 1MFUA 4QLLA 3QV7A 3I4KA 3QYQA 1E40A 1V79A 2YXXA 3GTIA 4OE7A 4GI9A 3RILA 2W6RA 1SJDA 1GORA 4AHPA 3MUY1 3N14A 2Q02A 4H19A 4E3TA 2E5CA 3N11A 2O7QA 1VD6A 4AD5A 1U30A 3CUZA 5LA2A 4E4PA 1XLFA 2ZDRA 4IMDA 2WHJA 3VCNA 3H6OA 4JR5A 1TIWA 1PIFA 5DN1A 1VPQA 4QNEA 3JU2A 4U31A 4A2SA 1SMAA 1JDCA 4UTTC 1F8IA 1OFAA 4RPQA 4ZSUA 3W6LA 3KVLA 2QCGA 1O4UA 3CMJA 3ABZA 4ZOBA 5AKQA 1CGWA 3QQWA 4IH3A 2G3MA 2YYTA 1SMDA 3FVDA 1NFPA 5JH1A 4UTKA 5EMYA 1VEPA 4QITA 2E1WA 3V18A 3HTWA 1XI3A 4KH2A 3FJ4A 4LAKA 2ZTKA 2DZTA 1WB0A 1IT7A 1FFRA 3B05A 1VJSA 1GNXA 2X40A 4GY0A 2VX5A 3NQAA 3SJ3A 2WNZA 3UPWA 5KTLA 2HV5A 4DZHA 1FCUA 1WZMA 3NZGA 4G1KA 3P60A 2QKFA 3OZOA 5A95A 3W74A 4F66A 3B9EA 5M2FX 4K68A 7REQB 4AZHA 4DO5A 2PF8A 3KCJA 2QIWA 4H9VA 4GZEA 3VOFA 1E15A 4AVNA 3CAQA 3LTPA 3FA5A 4UTHA 3SCRA 5HJYA 4JTDA 1VFSA 4K6AA 4EPDC 1LUCB 2QCFA 1FHUA 2EPOA 3BDKA 5JMUA 3HFTA 8TIMA 3BOLA 2DZUA 3MHFA 3A6OA 5J5RA 4DI9A 4DNHA 5A6MA 8A3HA 4DZIA 1BLIA 1XLDA 4XBSA 3WBEA 3MWCA 1JZ4A 1JZ5A 5HNRA 4GLEA 1R3VA 1J9YA 3VMPA 1UWRA 2HE8A 3WLQA 1V0LA 2Z1KA 3V0TA 2VFHA 4KBXA 4F3HA 2WBKA 4HNCA 1XKYA 4UZSA 1J5SA 4K7VA 1CXIA 2CZVA 3C61A 1DHPA 4AF0B 4OT7A 5TAOA 3GR8A 3G1VA 4BI7A 2KX9A 5E9XA 2ZA3A 3VD9A 1XKJA 3KRSA 5EKYA 1WZLA 3CH0A 3WLRA 2WKJA 4XB3A 3GRIA 1OFPA 3SGUA 1ITUA 2FHCA 2GZXA 2DJLA 3IAPA 3QGVA 3BAXA 3VX1A 3H12A 3W1PA 4LY4A 2ZDSA 1NVMA 1NELA 4MFDA 3P67A 1EJ7L 2ZUSA 3TW6A 3Q94A 1LG2A 4XV0A 2VGIA 5FD0A 2Y5SA 4DJDA 4YNGA 1Q4WA 1G4PA 5FL1A 3OO2A 4H7VA 3NFUA 3QLLA 1J96A 1Q66A 1FX6A 2ABBA 5BXPA 4FXRA 3S5YA 3NVTA 2V82A 4JY8A 3GG0A 1M68A 3W87A 1KLZA 2OGJA 4PUWA 1RR2A 5A8QA 1MW2A 4HK7A 3GO2A 2VNCA 4L80A 3GDLA 1TV4A 4GGBA 2PCEA 1Q65A 4HU8A 4CCZA 1OC5A 4ZXLA 4LAUA 3WYZA 3IIVA 4CNPA 2Z1VA 2A3BA 4A8LA 3URBA 2PGRA 1Q63A 3BJSA 1ZU8A 4GZJA 2J7FA 1HP5A 2V30A 3MCNA 3SRDA 2OSXA 3GXPA 1V4YA 2V6AA 3TZFA 3DECA 3W7PA 3FEQA 3CHFA 3IWPA 2WSYA 3CHEA 5HMDA 1FKWA 2OYKA 1PWLA 1R7OA 3GDMA 3LNPA 2BHZA 2WM0A 5A8NA 1BQCA 3TSBA 3CZJA 3KW3A 1PE1A 4GJJA 2PB1A 3ITXA 1RSCA 3MYOA 3LLDA 1PVNA 5CSSA 2PDKA 1ZJHA 1BYCA 1IWBA 5A2CA 2Q09A 3OYZA 4C6PA 1UC4A 4XAFA 3VD3A 2HK0A 1W5OA 2OG9A 3E2QA 5D2WA 1SO4A 2BWGA 4NYYA 3ALGA 2IQTA 3ID7A 2EG6A 1EOKA 3U2ZA 1F76A 1WOBA 5BMWA 1WKYA 4E4UA 1PWMA 1XIHA 3NZPA 3ABSA 5CXPA 4WSJA 3DXIA 1XR2A 1KTBA 3AIUA 3BW4A 3VCRA 2HVNA 3W37A 1PSCA 3GVWA 5AZ0A 3WDHA 1I0DA 1A5AA 3UETA 2FVMA 1KM1A 5BWFA 3ONCA 4WKAA 2VZTA 3P8JA 5BW6A 1F5ZA 5D9MA 3PG9A 3OIHA 2BGQA 2VXNA 3OGRA 3BZJA 4PR4A 1G1YA 3UVIA 2WMKA 3VILA 3THQA 1KBIA 5LYRA 1MO0A 3WNMA 2FQIA 1PXGA 1EKOA 3THCA 3OEXA 3P80A 1A0CA 4NRSA 3BVJA 5D2TA 2INZA 2VJXA 4GINA 1MQPA 2DDXA 4O18A 3AXIA 3EWWA 3GH7A 2O55A 3EXSA 3QY8A 3VE7A 2B81A 4HZ6A 3LMZA 5K9DA 1CECA 4AW7A 1M7JA 4URIA 4IP4A 4FIRA 2X2YA 2A6LA 3NPUA 3BTNA 1UZHA 2BVWA 1R3RA 1RH9A 1DJGA 1I75A 4JTAA 4YTRA 3M0JA 3L68A 2E9MA 3B0YA 1P0KA 3EDFA 3FAXA 1RHCA 2BY3A 4RW3A 3MT1A 3UPBA 2WVVB 1VFLA 2PGFA 1MZHA 3PZQA 3QFWA 4QE1A 3ZLGA 3W3OA 1JXKA 1XCWA 3E6EA 4PUEA 3D5HA 1XDJA 3WNLA 1GOIA 8XIMA 2Z29A 3E02A 3H2OA 3BE7A 3F2CA 3IPWA 4BI6A 1QATA 3S83A 4O1FA 1THFD 3I6RA 1JPKA 1NAL1 3TJLA 3M4HA 3GUWA 2GGGA 3ARUA 4GHRA 3VCCA 3TN3A 3MSGA 4MTVA 2B7OA 4TTGA 2YXGA 3OHIA 3CQIA 4MMWA 1NF0A 3CH9A 4AYSA 3IV3A 1A0DA 3KHDA 3LPGA 1GWJA 1VRDA 1TREA 4UMAA 3WL1A 2SFPA 2XH2A 5FAJA 3BAWA 3L4WA 3VIKA 1PKLA 2I9UA 3KRBA 1SW3A 3OOQA 3T40A 2PF0A 3PC0A 3T9PA 2ZX9A 1PDZA 5I78A 4C91A 1O6IA 4QR6A 1EP1A 1UH3A 1C29A 4XO6A 1DTUA 1S5TA 1KB3A 4KEZA 5FEPA 3AHTA 3CB8A 3R8GA 8XIAA 2QHAA 3SCSA 1DJWA 4J1OA 3UJRA 4DZ5A 5AYIA 1UP2A 1PX3A 1EWDA 1CXEA 5E0KA 4GO9A 5KMYA 2FKPA 3PZMA 5FIPA 4R3UA 3PUOA 3N15A 3TR9A 4PSPA 2IPJA 1I8JA 1P0DA 4AH7A 4LVDA 3FW6A 1P6BA 1L2UA 3MUCA 1YX1A 1CEOA 3ATYA 5MKGA 3SY8A 1AZ1A 2HROA 3C5QA 4WF7A 3OVRA 1EFZA 3MO7A 2J62A 2UV8G 5U7SA 1XLLA 2C79A 3BXWA 1EL3A 5IRPA 3R8RA 4LCQA 3G2GA 1CYGA 2IS7A 4MUPA 3URNA 3C0QA 3PJWA 3TNBA 1XCXA 2J4GA 5D33A 1JYNA 1V3MA 3V5CA 2QPUA 4HOWA 3TX9A 3ZLHA 3DFYA 2J78A 2PLMA 1JDAA 5AOUA 3BV4A 3W7EA 2AAMA 2ASHA 2VP8A 4JN7A 3P74A 2CXEA 4HNLA 1RY0A 4AIUA 3PBYA 3N1AA 4MY8A 3K4WA 2Z2BA 3QOMA 1PKMA 2QAFA 4M0XA 4RDZA 1A4MA 1XYCA 1XSKA 1MFVA 5DFAA 4UOZA 2PODA 5E5CA 3WQ6A 5CAHA 4REQA 1W9DM 1U5JA 1XH0A 4IOTA 2QGYA 1S1RA 4LUTA 1OWQA 3E96A 4R9XA 1LP6A 3ITCA 4GBUA 4US5A 2XTKA 4C6LA 2QV4A 1FHDA 4ICMA 3FN9A 3BJFA 1K4GA 5AHNA 2E4TA 4CCDA 4LBSA 2A3CA 1TWDA 1U1HA 3TYAA 1P4CA 2QUVA 4GKLA 3TSMA 3N6HA 1V02E 3S9ZA 4OFCA 3RRXA 2OYLA 3CWOX 2O92A 3NVDA 1BG9A 4GVHA 1SZNA 1TE1A 3V7PA 2WVSA 3TXVA 3CUGA 1XIIA 3BW3A 1JF5A 2VM8A 1JF6A 2I14A 3AI0A 4UZUA 2VENA 4ML4A 3REQB 4WUIA 5D03A 4YVVA 5DCBA 3ZYZA 3GS6A 4XBKA 3I65A 2OSWA 3UR2A 2V2HA 3QBUA 4XK2A 5IFTA 1MQRA 4NVTA 1E4IA 5FF2A 2F6UA 3DBNA 3MBDA 1SJBA 4OBTA 3VKKA 1HZYA 3CYVA 1R85A 3L7R