2XFFA

Crystal structure of barley beta-amylase complexed with acarbose
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
486
structure length
486
Chain Sequence
NVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-AMYLASE
publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 188
structure length 486
sequence length 486
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xffA00
2ESCA 3AISA 1GUVA 3RCNA 2GFTA 1UOKA 2DGAA 4AZIA 1LG1A 3AIUA 2CKRA 2NT0A 5ECUA 1IZJA 2Z1KA 1WCGA 3BSGA 2J47A 2D20A 2DSZA 3VOCA 3CHDA 3VD5A 3MSGA 4HTYA 5I78A 1V0NA 1E6QM 2EPMX 4KGJA 4TVUA 4W86A 5A2AA 3VIHA 3TTOA 4GINA 3BAKA 2W91A 1N82A 3W81A 2V38A 1E5NA 3WEOA 2X05A 5CPSA 5TD4A 1SR0A 1UYQA 5A6LA 4AIEA 2XUCA 4GXPA 2VC9A 3EMQA 3RM9A 3A4AA 3VDAA 3N9KA 1CXFA 3NCOA 1PZ2A 3ARWA 3FHAA 4RE4A 3WEMA 5HPCA 2VX4A 1OT2A 2DH3A 2V5CA 3ZR5A 5BXPA 4GO9A 3UEQA 2VT0A 3CZGA 3WNKA 3AHVA 4WF7A 1BG4A 1OGGA 1WZKA 1LJYA 2Q8XA 1MYRA 1JF5A 1V02A 2ZX9A 5LYRA 1GONA 1QNSA 3VO0A 1ZBCA 4W88A 4HMDA 3T0BA 1K6AA 1TMQA 4GI8A 3FHQA 1UR1A 1HVQA 4E2OA 4MDPA 8A3HA 1BYCA 1NARA 1SFSA 4OUEA 2PBGA 1JYVA 1JYXA 3AS0A 3VPLA 1JZ8A 3SCOA 3CZJA 3VGHA 2WK2A 4E8CA 3RMEA 4CGTA 5JBDA 1MXGA 2DSVA 4PTMA 4WLCA 4TX6A 1DEDA 1NWUA 2VR5A 3I3EA 2JFEX 2G3NA 1BYAA 3QOMA 3WD0A 2YDRA 2IXVA 1BGAA 1H5VA 4OBRA 3QHNA 3AIRA 4LX4A 4TVDA 1V02E 2V3GA 4UOJA 3IANA 3W6MA 1NP0A 4H41A 1YHTA 2CIPA 1HJQA 3AS1A 1HKMA 3MKKA 4HA3A 1QNRA 4EKJA 3ZJ7A 3ZJ6A 3PZMA 2ZUWA 1H41A 2ZWYA 1JNEA 2A3EA 2WZEA 3AROA 4UOQA 4M80A 1JFXA 1WZMA 4D6FA 4FLSA 4AEEA 1FH7A 1EHAA 1Z32X 3WQ4A 4UQCA 2DDXA 4BQ5A 2YOCA 5FCZA 3D5HA 1MQQA 5JBEA 4FLOA 3PZTA 4L4OA 3VMPA 3KWXA 2CHNA 1X6LA 3GNRA 4HOWA 3VNZA 4OZOA 3L4TA 4XUYA 3WFZA 4WSKA 1VJZA 1M03A 3GXFA 4BA0A 2XSAA 4B9YA 4PMXA 3VIJA 3WH8A 3GM8A 2OWXA 4PCTA 4WIWA 4CUCA 3SUWA 3L4UA 2X0HA 4TX8A 5M3WA 1QHPA 4PMRA 4AYSA 4OIFA 4C7GA 2VQTA 1DP0A 4PN2A 2WC3A 1B90A 1HJVA 1TR1A 4A3HA 3GH5A 1G01A 3EDJA 1FHDA 1C8YA 3WF0A 5GNZA 5FKYA 3GYCA 3WBEA 3BAXA 1QI2A 4CD4A 3KL0A 2OWCA 1CDGA 1CXEA 1PX3A 4W89A 2WBKA 4YHEA 3SUUA 1NWSA 4H7VA 4B16A 1OB0A 2W63A 3K8KA 4AZHA 1PX4A 4AIOA 3SCSA 2VO5A 4NRSA 1GQIA 3OGRA 1SYTA 1CENA 4KRUA 1BVNP 2G3IA 1EGZA 1D3CA 4NF7A 1D2KA 1QHZA 3WQ5A 1JI1A 2PBOA 2PWFA 3DHUA 1W9VA 1CEOA 3WDIA 2XGIA 3ARUA 5I6SA 2VRKA 4HU0A 4UQ9A 3WMBA 1ZBWA 3K46A 4CN4A 4UFMA 3U7BA 6CGTA 3AQUA 4NI3A 3WL1A 1UR0A 1UA7A 3ZSTA 1P6WA 4D6GA 5IFPA 1F4HA 2A3BA 1AVAA 2VQUA 2WSKA 2ZX7A 4P7RA 1E40A 3T0DA 1KGUA 2JE8A 3ARTA 4AMCA 2OSWA 4JHOA 5KEZA 4JFUA 4W7VA 3CH9A 5I5RA 3OLIA 4DUWA 1V6UA 1PEZA 3ARPA 3LPOA 3NSMA 1UD3A 4ACZB 2Y4SA 4S3JA 1W1VA 3VDHA 3CUFA 2ZXQA 1GNXA 4UFIA 3GBDA 1V03A 3MV11 3RM4A 2WZHA 1E43A 4M81A 4MJ4A 1QI5A 5D9OA 3WL0A 2GK1A 1CXKA 1KQYA 3MUY1 2JEPA 4MDOA 1OT1A 2W61A 4DWSD 1FA2A 3AMGA 3VGFA 1W1PA 1LQ0A 3GNPA 3T2OA 3VM5A 4PEEA 3DHPA 3AIVA 1B3YA 2WMKA 2VCAA 1UQZA 1VENA 2E40A 4JKMA 3O2LA 2DIEA 4GI6A 1CNVA 2AAAA 1E15A 4TUFA 1ITCA 4CN1A 4UNIA 1XC6A 5HPOA 4D6CA 2YL9A 3WKZA 4OBSA 2DEPA 5DEZA 4EE9A 3WBAA 2J7FA 1XSIA 1WP6A 1LF1A 3L4VA 1XV8A 2BV9A 1US2A 2D3LA 2J7DA 1M7XA 1E4MM 1KR0A 1FFQA 3KL3A 2XTKA 4IUGA 4FLRA 2A3AA 1TVPA 2PWDA 4MNKA 4XV0A 4MAVA 1HKIA 4QCEA 2EXOA 2W5FA 3T0AA 4PTVA 1ZU8A 1UH3A 2YBUA 3AHZA 3RDKA 4J27A 3THCA 2WWCA 4JKLA 5BCAA 6A3HA 1RPKA 4K68A 5A6MA 4JKKA 1EO5A 3A3HA 2EBNA 1M01A 1VFMA 3PBGA 4D6JA 2CITA 3VGDA 3M7SA 5M03A 1UKPA 1VIWA 4GZEA 5CLWA 4F9DA 3BAWA 3ZSSA 3AXHA 2CKSA 4QCFA 3OIHA 1HT6A 2EJ1A 1V3JA 1TUXA 1E6RA 5D4YA 1MW3A 3SURA 3AXIA 3IJ7A 2VVNA 2D23A 3E1F1 2OLHA 3LMYA 3W29A 2YDQA 4TTUA 2UY3A 4MB3A 2VOTA 4AC1X 3UR8A 4U3CA 4X9YA 4W5ZA 3NYDA 2GJXA 3MUZ1 3CHCA 1GJWA 3UETA 5CGMA 3W27A 5I23A 4IPLA 1B3VA 3VDCA 1EH9A 3SIMA 3S6TA 2HVMA 1HXJA 3L2MA 3VGGA 1HVXA 2AOSA 2DH2A 3VGBA 3WH5A 4CU8A 1BQCA 1MXDA 3CIVA 4QLKA 3BCFA 5A6SA 4Z2JA 1GOOA 4CD5A 1KWKA 5M5DA 2DIJA 3WQ6A 3PTMA 5E0CA 3BLPX 2EPOA 4JCLA 1TA3B 4WKFA 5E9AA 1JGIA 3N11A 2EPLX 3MMDA 1UWRA 3RPMA 5BYWA 1E3XA 3O9NA 5ABEA 1H3GA 3M46A 1G94A 1FOBA 4PMYA 1OGBA 2WPGA 3MO4A 4YN5A 5CLTA 1TE1A 4DWSB 2W66A 3SEPA 5CPQA 5A95A 4P7QA 1V3LA 5IHSA 4UZUA 2JEQA 2PWHA 1MFVA 1ITXA 1K9DA 3T08A 2WC4A 4LYRA 4AD5A 4ZE4A 4LQ1A 5CGTA 3SCQA 4ZENA 2WXDM 4GZJA 3UG4A 1V0KA 1XH2A 1H49A 2WYSA 7A3HA 2B31A 1EOMA 1E6NA 5IDIA 1L8NA 2VURA 2WVUA 1KQZA 3VVGA 1E71M 2JF6A 4NRRA 5A6BD 1V6VA 2ZIDA 3PZIA 2J7CA 1JG9A 4AZBA 3POHA 2WAGA 1LL6A 5GQBA 3EMZA 3DECA 3AFBA 5EFFA 5ABGA 4Z2IA 3T09A 3GH4A 2WSPA 1QPKA 2Y8KA 4YPJA 4AD2A 5DFAA 1UR4A 1R8LA 3KL5A 1UWSA 2QMJA 3FN9A 1J18A 2ZX6A 2J74A 3T2PA 3WH9A 1OD0A 1AMYA 1VFUA 4AZ5A 3D3AA 3ZT7A 1JAEA 2O9OA 4MB5A 4PMZA 3BH4A 3VIMA 1Q4NX 5E70A 5BRQA 1JNDA 1UR9A 3BCDA 3HJEA 2CBIA 1HJWA 1G9HA 3N13A 4W7WA 2WLZA 2ZUUA 7CGTA 5JUVA 4E4PA 2XFRA 1J0KA 3TA9A 3WUEA 2V3FA 4W8BA 1PPIA 1CYGA 2ZUNA 4KGLA 2VTFA 1MQPA 1V08A 2UWFA 4M56A 3VIGA 3EDDA 2XSBA 5F7UA 3WD2A 2QHAA 3N15A 4MJ2A 5E6ZA 3K4AA 4KH2A 5D8WA 3WNPA 3W53A 4ACYA 1E73M 3VIIA 3AI0A 3GXDA 4HOXA 1E6SM 1JZ3A 3VD4A 2UY4A 1VB9A 4D1JA 3WDRA 3WF3A 3II1A 2XM1A 2XIIA 5A8NA 3MUAA 4Y7EA 3RO8A 5CPTA 3WUFA 1JXJA 1BHGA 1MQRA 2QPSA 1LWJA 4CU7A 4CU6A 5DO8A 3VNYA 4J3UA 4IPNB 4LYPA 1GW1A 4ATDA 3WDQA 3OGSA 3ALGA 4CKQA 2X8RA 4W5UA 2WANA 2V5DA 4JIEA 3NJ3A 1XH1A 2DSWA 2WMGA 4AZ6A 4QAWA 2RGMA 2XG9A 4BZYA 3L4WA 3RJYA 3EBVA 1ZL1A 4MB1A 3WMCA 1XYFA 2BXZA 1ISYA 1DWHM 3APGA 2RGLA 2QMKA 3AMLA 3ARYA 3SUTA 5BWFA 5AC5A 1KR1A 4JAWA 4EAMA 1CGTA 4C7DA 1Y7VA 1E72M 3W82A 1E4IA 4AWEA 2JALA 5ABFB 1CZ1A 2XVGA 4WSJA 4V27A 5A94A 2J7BA 4AD0A 2XHYA 1HNYA 1VRXA 4ACZA 4UTFA 1C91A 2ZXBA 2NT1A 3AZSA 1W3LA 1WNOA 1W2PA 1BF2A 1HP5A 2CYGA 1OIMA 1S46A 3PTQA 1CIUA 3VDBA 5A2CA 1ISVA 2BVTA 3B9AA 4AXNA 4P7OA 3N17A 4RE2A 3ALFA 1B3XA 4DM1A 3WDHA 5M17A 5LA0A 1BLIA 2DSKA 3PZQA 5A1AA 1JD9A 4PUDA 1QOXA 1GJUA 1HJSA 3WSUA 4X0VA 2DPEA 3BLKA 2XVPA 1J0JA 3CZKA 2BXYA 3N1AA 3QR3A 2WHLA 3RJXA 4N0RA 1GZJA 4TTGA 2VNCA 5C8BB 3W28A 1WDSA 5E09A 1WDQA 1BTCA 3LPPA 2W62A 1B1YA 4CCEA 2W4XA 3BAIA 3N04A 3VIKA 1L0PA 2DT2A 3WD1A 4UFHA 3MU7A 2WCSA 4PUEA 1GHRA 3DYPA 3MSDA 1TG7A 4D1IA 1XCWA 3WQWA 5LA1A 4WKHA 4FK9A 2PC8A 1LLOA 3W4RA 1W91A 4JFSA 4ZXLA 3UERA 3F5KA 4XB3A 3K1DA 2YJQA 2ZUSA 4WJXA 3WNMA 4D6HA 2DSUA 4FLQA 1AQMA 4UZSA 2VCBA 3VD9A 5ABHA 5BXRA 3K4DA 4AZ7A 1FP9A 4B3LA 2GDUA 3OLEA 4Z2KA 3SCRA 3GXMA 1LG2A 4NSBA 4TXEA 1K9TA 1IV8A 2VRJA 3WENA 3AMCA 3ARZA 5DF0A 1DHKA 3KEHA 1UH4A 5BROA 3ZOAA 4R5EA 1HIZA 1C7SA 4H8VA 4NZCA 3SUVA 5JBFA 3B9EA 1EQCA 2WHJA 1KGWA 1X6NA 4D71A 2A3HA 2XWDA 4GI9A 3CHFA 4P7LA 2EO7A 1ISZA 1WAWA 4J7RA 4J3SA 3WIJA 1VBRA 2WCAA 2BFGA 2EEXA 4AZCB 3ZO9A 1MVYA 3ARSA 2BY3A 4F66A 4F8XA 1NWTA 1MFUA 3M6DA 3PTKA 3BC9A 4LXFA 1H0GA 1HP4A 5AYIA 3ZJKA 1O7AA 2CEQA 2MANA 1UD6A 4U31A 3IAPA 1W9XA 2VR4A 3SCPA 5A6JA 1JFHA 2EQDA 1TA3A 1XCXA 5CG0A 1I75A 3MMUA 5DT7A 4B15A 1JDAA 3OLDA 2UY2A 5I77A 5I79A 4OOZA 2J77A 3AYSA 2WWDA 1GORA 2AMGA 1JYNA 2YKKA 3VIFA 3CZLA 2ZWZA 1XSKA 3OGVA 4HMEA 3CGTA 3W24A 1HF6A 2BNJA 4P8VA 3CHEA 4MADA 4UFKA 4DWSA 5GNYA 1QVBA 3U5YA 3DC0A 1UA3A 4HPHA 1DWGM 3MMWA 5D9NA 3QGVA 1UKSA 2CNCA 3A4XA 2J7HA 4WK9A 1Q6GA 3I3DA 4YHGA 4HZ8A 1FHLA 1UWIA 1EDQA 2G3MA 1KWGA 3WQVA 2E9MA 1E9LA 1B30A 1V6WA 3PZNA 3F5JA 2J78A 4HA1A 4U2YA 3BSHA 1G1YA 2OYLA 2BHYA 3KZSA 2D0GA 1J10A 1M04A 3VINA 2YL6A 4GIAA 3WNNA 5I2UA 4PMOA 3AIWA 4CD7A 1OWQA 5FD0A 3ARVA 3ARXA 1VAHA 3AZRA 2D0FA 3W26A 5A2BA 4A4AA 5C71A 1OCQA 3CZEA 2YIHA 4WKAA 1W3HA 3FXYA 4HPGA 1HJXA 1EO7A 1B3ZA 3UG3A 2XVNA 3WDPP 1PZ3A 2FHFA 1EDGA 2DT3A 5HDRA 4MNJA 4A3YA 2V3EA 1W1TA 5BXSA 2FHBA 2WMIB 4PTXA 1UHVA 1XGZA 1Q6DA 3ZJ8A 3WNOA 2XGBA 3VD3A 1RP9A 1Q6FA 4PRWA 2PF0A 3UR7A 4RL3A 4M82A 3GH7A 1JI2A 2E3ZA 1HL9A 3OG2A 1ODZA 2XVLA 4HZ7A 2VX7A 3VGEA 1R7AA 1U30A 4UQEA 3WUGA 1J12A 2J8FA 4UQBA 3U57A 1H0IA 2YA0A 4TOQA 3NUKA 3QHMA 3BMVA 3BAYA 1KCLA 5A3HA 3W25A 5C70A 1SMDA 2D2OA 1E0VA 5KZ6A 1E4NA 1UWTA 2E8ZA 2CETA 2OSYA 1CLXA 2ZXDA 2D3NA 1KFWA 2O9RA 3QOKA 1V3KA 1HJUA 1UR2A 3CO4A 2VZUA 2X1IA 1CTNA 1CGUA 1UQYA 4BQ2A 5JIWA 2TAAA 2YLLA 3AS3A 4GQRA 3IJ9A 4M1RA 1B0IA 2VI0A 4XX6A 3GTNA 5HOSA 2X0YA 2WCGA 1UG6A 1V0MA 2ZX5A 3U7VA 3WNLA 3CTTA 2WKLA 3CUJA 1GVYA 1W9DM 3FAWA 1B3WA 4W93A 3TTYA 1FP8A 4KMQA 1KXTA 4FMVA 3PN8A 2CHOA 3BAJA 1JD7A 3U5UA 1RP8A 1BSIA 1PIFA 1UZ1A 1ZB5A 3WFLA 1DWFM 1FH8A 4QP0A 1I1WA 3PZVA 3EYPA 1UR8A 4PYSA 1KXHA 3SCVA 1CXHA 2BHZA 4W7UA 1VEPA 4PCSA 3CUIA 1UKQA 2XFYA 1ESWA 2VZOA 1R87A 4U3AA 1JZ7A 2G3JA 2DT0A 3AHXA 1WE5A 3FY1A 3VKKA 1VEMA 5AY7A 4PSRA 3UG5A 3PZUA 3M07A 5A6BA 3HU7A 2A3CA 5HBFA 4GQQA 1PAMA 2XVKA 3PZOA 1CWYA 5ABFA 2YDSA 5A8MA 4CVUA 1SMAA 3SUSA 2E0PA 3AS2A 1B2YA 1E0WA 1GOKA 4D6EA 4EK7A 3FW6A 1ISXA 1VBUA 1VEOA 1KBBA 3OZOA 1R85A 1MWOA 5I24A 3KE0A 2XJ7A 2GVYA 4W87A 3B9DA 2E9BA 1BG9A 2FH8A 1IT0A 3WELA 2JIWA 2XWEA 5GNXA 4CN6A 1QW9A 1EXPA 4M29A 4U5IA 1CGVA 4C7FA 1Q6CA 2C8NA 1BYBA 3EDEA 5A6KA 5D8ZA 1NP2A 5EBAA 2WVTA 2QLYA 1CXIA 4OJYA 3OA5A 1ECEA 2WVVB 2GUYA 1JXKA 2FDMA 1UWQA 3JUGA 3CPUA 2WMHA 1AQHA 1OBAA 4BCEA 3AHYA 4ZE5A 1VJSA 4LGXA 9CGTA 4HU8A 1GOWA 4P8XA 2WC7A 4B3KA 3WQ8A 1W32A 3VILA 4PMNA 4DUXA 5AYBA 4UQAA 2ZE0A 2CERA 1JIBA 4XZWA 4D6IA 4J28A 2E8YA 4JZ5A 2XIBA 1JZ5A 5IXEA 3ZT5A 2D1ZA 1C93A 1NOFA 2VUYA 3AXXA 4JHZA 4F79A 1H1NA 1C7TA 1HN1A 3POCA 2WHMA 2F61A 2Y24A 3AICA 5FL0A 5GPRA 1E56A 3VX0A 1C8XA 1US3A 3SCNA 2J4GA 4QFUA 3NSXA 4MNLA 1PX8A 7TAAA 2DT1A 4U2ZA 3N12A 1RD6A 1XSJA 1J0HA 4M24A 4UCFA 1A3HA 4CD6A 4FF5A 1KBKA 2C7FA 1E6PA 1PJ9A 1W9PA 5CZKA 2JF7A 4R27A 1W3JA 1WDPA 4PTWA 4GO8A 1H09A 2WKGA 2DQXA 2PWEA 2O92A 3A4WA 1M53A 4B9ZA 1GPFA 1D7FA 3AYRA 1EA9C 2W92A 4OKDA 3DYMA 3BGAA 1WDRA 3GZAA 2QPUA 2XM2A 2CXGA 4H8UA 4AZCA 1OD8A 3EDKA 2XYLA 3PZGA 2ZUVA 2WLYA 1J11A 2Y5EA 2J8GA 3VU2A 4BQ4A 1XD0A 2YBTA 2ZICA 4DM2A 3AMDA 2GSJA 1BGGA 4ATLA 3MUIA 1CBGA 3BXWA 1KGXA 3N18A 4UFJA 5LA2A 2EPNA 1GQKA 1UWUA 3VUPA 1DTUA 2NW0A 4BS0A 4HOZA 1E3ZA 4AD4A 4BF7A 2J75A 1MW0A 4OOUA 5A6AA 3AOFA 2BVDA 1QNQA 1KXQA 2X09A 3SCUA 2ZUTA 4ZFMA 4H8HA 1J0ZA 3UESA 2WNWA 3VM7A 5E6YA 4J3WA 4IISA 2CPUA 1QI0A 6TAAA 3K8MA 2GDVA 1CPUA 5DT5A 3TOPA 4TVCA 1J9YA 3BMWA 1CGWA 1XRVA 2PWGA 1BFNA 3VIPA 1C90A 4UFLA 1V3IA 1NM9A 4V28A 3K8LA 1NQ6A 3OZPA 3TTQA 5JIPA 4HZ6A 2WZIA 3LPFA 1QI4A 3DYOA 2OSXA 1NOUA 1H2JA 2BHUA 4JCMA 5CSYA 1C3FA 2J79A 2VMFA 1HL8A 3AIQA 4QLJA 3GDBA 4Q22A 4P7NA 3W6LA 2WHKA 1O6IA 1GCYA 1GVIA 4ML4A 4AZGA 2YL5A 1E1FA 1W3KA 4RE3A 3AJ7A 3GNOA 2YA1A 4Q7NA 1X1NA 1YQ2A 1DWJM 3WY1A 3L4YA 2O9TA 2G8ZA 3S2CA 1VFOA 1EOKA 5A8QA 1WKYA 4QDMA 4H04A 2JIEA 4S3KA 5E0FA 2PB1A 3AIBA 3HN3A 1JZ6A 2YLAA 4ZXOA 5FL1A 1I1XA 3WH6A 3L2LA 2OWWA 2VCCA 1GOQA 4MB4A 1W9UA 3ZQ9A 2WMIA 2BVYA 2E9LA 4U5KA 5FOOA 1WB0A 1PIGA 4PMQA 2VL4A 1ZJBA 1ZS2A 3T2QA 4DUVA 4JL2A 1TFVA 1GHSA 3WDJA 2WVSA 2V3DA 3ARRA 1F4AA 3FNDA 4AIUA 1V6YA 3CBWA 1OINA 1OGSA 3WN6A 4X0NA 3A6OA 1MW1A 1U33A 1JF6A 4HMCA 4D6DA 1JZ4A 1JDCA 3AZTA 1R86A 3VX1A 4CD8A 4D72A 1E70M 1V3MA 5IFTA 4AISA 3J7HA 2CBUA 4MPKA 4XZBA 4MTVA 3CLWA 4URIA 5CJ5A 1Q6EA 4CCCA 4PMVA 2Z1SA 4PBGA 1JYWA 1HKKA 3CMJA 1TZ7A 2WB5A 1GQJA 3G6MA 3TONA 2WW5A 1UD8A 3WD3A 2IXUA 1H4PA 4MNMA 2Y2WA 1LWHA 1V6XA 2ZOXA 2VZTA 4V2XA 4HA4A 2O9PA 1QNPA 1TCMA 1UD5A 3AIEA 2D0HA 3WD4A 5EMYA 8CGTA 2E4TA 1QHOA 3WH7A 1MW2A 3ZT6A 5A69A 1V3HA 4LYQA 3WF4A 1NWRA 3OB8A 4GKLA 3VIOA 1UH2A 1UD2A 1KXVA 3TTSA 1K9EA 4AY1A 2ZX8A 3MS8A 2GJRA 1E6ZA 2FHCA 1JZ2A 1C8QA 1FFRA 3A47A 1RH9A 2VZVA 5CQ1A 2D22A 1GOMA 1V0LA 4N42A 1H11A 3L4XA 2W67A 1W9BM 1BVZA 3CUGA 3RILA 2GJPA 2WM0A 3PZ9A 3IJ8A 1EDTA 1WZLA 1XD1A 4DWSC 2F8QA 4UQDA 3AMKA 3QHOA 2G4FA 3W37A 3I3BA 4UR9A 1DWAM 3TP4A 4JFTA 1CECA 3W38A 1EQPA 3GXIA 3NDZA 4J3VA 2CCRA 4L4PA 2CBJA 4CCDA 2CESA 2UY5A 1B9ZA 2J62A 1EHNA 4U33A 5EFDA 1GOIA 3VMNA 1ZBKA 1U2YA 3ECQA 3IAQA 1E6XM 1A47A 2FGZA 2VX5A 3WEZA 1KB3A 1HX0A 2WBGA 3PHAA 4W8LA 1OM0A 1TVNA 4E8DA 1NOWA 1XHGA 5HNNA 5DMYA 3NSNA 4JFWA 4Z2LA 2J7GA 3SCWA 1UKTA 4LPCA 4GZIA 5FIPA 3RM8A 3ZM8A 4ATWA 1QBAA 3VMOA 4KWUA 2FH6A 4PMUA 3SCTA 2D24A 3CUHA 2C0HA 1OSEA 3VTRA 2ZUMA 2NSXA 1CXLA 1QBBA 2XFFA 5AC4A 3G6LA 4AW7A 4AEFA 3ZR6A 1WO2A 4QLLA 4Z2HA 2QV4A 2WVVA 3OLGA 2YL8A 1JAKA 3B8SA 2HISA 5A8OA 1ODUA 3W0KA 1VFFA 1BYDA 3NDYA 4UOZA 4W85A 4F9JA 2F2HA 3L4ZA 5EB8A 3LPGA 3F4VA 1E0XA 3WUBA 2BY2A 3IK2A 4J3XA 3MANA 1DWIM 1QW8A 1UZ4A 2EPKX 2VZSA 4P8WA 2GK1B 5A8PA 4Z2GA 1ISWA 1GQLA 1AQ0A 1VF8A 3GBEA 5BRPA 1J01A 1QI3A 1J0IA 1JDDA 2G41A 1XH0A 4HP5A 2XPKA 4CVWA 3O6AA 4AD3A 3F5LA 1QNOA 2IUZA 3HMCA 1ZJAA 2VJXA 1UUQA 3FAXA 1CLVA 4AD1A 3CMGA 3EDFA 4KRTA 2VX6A 1KCKA 1OIFA 1B31A 3CZ8A 1BPLB 1UKOA 2PI6A 3THDA 5I3DA 5BXTA 1W2VA 1G0CA 1BAGA 2VVSA 1IZKA 1UD4A 2OYKA 3AHTA 2J25A 3ZIZA 1LL4A 3WMSA 3ZMRA 1EIBA 3ARQA 2VRQA 2BY1A 2CBVA 4ZEPA 1XYZA 4W8AA 1E1EA 5D9MA 1CGYA 4PSPA 5HXMA 2WMFA 4M8UA 4J3TA 1PBGA 4JL1A 3VD7A 4EANA 2BY0A 1ZBVA 3WF2A 3NIYA 2X2YA 5I0DA 2YA2A 1LL7A 4H2CA 4JFVA 4IM4A 1E5JA 1HKJA 1WZAA 2WMJA 1C92A 1WPCA 5IHRA 2BS9A 3UCQA 4P8UA 2ZXAA 1R7OA 1J0YA 2FGLA 1JL8A 2Y8VA 1K9FA 1CGXA 4GPNA 5CSUA 4PMDA 3WF1A 4W84A 3EMCA 2QF8A 3OBAA 4MAZA 4BQ3A 1W1YA 3MV01 1G5AA 1FH9A 1NH6A 2OYMA 5CXPA 1E55A 1E4LA 2J7EA 3RIKA 5D9PA 2GJXB
chains in the Genus database with same CATH superfamily
2ESCA 3AISA 2QEZA 2GFTA 1ITUA 4AZIA 3E02A 4BJHA 4DBWA 2JBMA 3BSGA 2D20A 3VOCA 3CHDA 3MSGA 4HTYA 1KRMA 2EPMX 4W86A 3VIHA 3QW4B 4JTQA 1WDDA 1XX1A 2C71A 1K8ZA 4PBEA 5CPSA 2GGJA 1EJVC 4X2RA 1SR0A 4Q4KA 4WRHA 2XUCA 4GXPA 2F6XA 3WEMA 3FHAA 5HPCA 2FQIA 3AWOA 1OFAA 5J5RA 4GO9A 1F6PA 1JVNA 2E77A 3CZGA 3AHVA 4PULA 3CK5A 3LXAA 3MI3A 1MYRA 2WJEA 1YTDA 4G2DA 3TEVA 1EPVA 2GPTA 2FB2A 3YPIA 3TN5A 1TJRA 3VO0A 1WDWA 3G1RA 3B40A 4ZTYA 1KFLA 1TPFA 2I56A 4GVHA 3BDKA 3EEZA 1NARA 1JYVA 3JRKA 2PBGA 1MDLA 4GE8A 4G6CA 1JZ8A 3QKZA 1MXGA 1P0EA 5CEWA 4WLCA 1GKQA 1XIFA 1X39A 3WQPA 3I3EA 5G5IA 2G3NA 4PFMA 3QOMA 4JY9A 4DPQA 2ZZ6A 4C6FA 4GMEA 2YDRA 1H5VA 2PMQA 4JTHA 1EEXA 3QHNA 4MFEA 1D7KA 2QPXA 4HSOA 5IDZA 2E1DA 1SW0A 1O4UA 1TJPA 5I02A 1F6YA 3IRDA 1HJQA 2J66A 2VGGA 3B9NA 3W2KA 3HURA 1H41A 1Q6LA 2A3EA 3AROA 4FLSA 4LB4A 4AEEA 3LRLA 1EHAA 3WQ4A 4BQ5A 3VXGA 1MQQA 2DZTA 1W17A 1A4LA 3R25A 4Q8UA 2HZGA 3KWXA 2CHNA 1REQA 4HOWA 1XLIA 4NKCA 1G4SA 4OZOA 1YKWA 3EB2A 3EOEA 4WSKA 5FJIA 1VJZA 5H91A 1VS1A 3R7MA 2XSAA 3G8RA 4B9YA 4JYFA 4F2BA 4OECA 4LRTA 3GM8A 3FJLA 4PCTA 3LEPA 4WIWA 4CUCA 3SUWA 3P61A 3NPXA 5DCBA 3BLLA 1QHPA 3S5SA 4FI4A 4XG1A 4RZ6A 3HGOA 1B90A 3A3WA 1FWDC 4A3HA 2NUYA 3EDJA 4IPPA 5FKYA 3WBEA 1F5ZA 3IIVA 3MUXA 4M7TA 2RFGA 4EP8C 2NQ9A 2OX4A 3RN6A 3QZEA 4QE4A 1NWSA 4XO6A 2OFJA 1OB0A 4GVIA 3K8KA 4AZHA 1JPHA 4NRSA 1GQIA 1SYTA 3W1UA 1CENA 4WY0F 1FKXA 1QHZA 1TTPA 4O8RA 3W1LA 4HCHA 4LT9A 4C5ZA 1RSCA 3OJGA 3U7BA 1NJJA 6CGTA 2YXOA 2VHLA 4NI3A 1UR0A 3DCPA 4HK5A 4UUIA 1KBLA 1H60A 1TTIA 2R9RA 1IWBA 3N34A 3T0DA 1YYAA 3ANYA 5F4SA 3WBYA 4AMCA 3NPVA 1KM6A 1CX9A 3P8IA 3PNUA 1IXPA 2OU4A 2BX7A 4GFSA 1V6UA 1PEZA 1MRQA 3ME3A 4DJFA 1W1VA 3QQ1A 5AHNA 3S1WA 4BWLA 4GUIA 3VK5A 1GNXA 2OOGA 4UFIA 3TROA 1Z89A 3RM4A 4HU4A 1E43A 3LHWA 3ITYA 3WL0A 1MZHA 2GK1A 1J2WA 3R6IA 3A9BA 1W3NA 2W61A 4DWSD 2XGZA 3USZA 4PB3A 4J1OA 3RF9A 3G0UA 3GNPA 2DVTA 1LBLA 3AIVA 4F40A 1EC9A 1B3YA 3M4HA 2VCAA 1UQZA 4MUZA 3LGDA 2W79A 4JKMA 1SUXA 3HOJA 1U5JA 1LDCA 4YMZA 4UNIA 3QQWA 3DEQA 4D6CA 2YL9A 3WKZA 2AL2B 2Z28A 1BKHA 2DEPA 3OG3A 1VFLA 2J7FA 1XSIA 3PJTA 1WP6A 3L4VA 3DKJA 2BV9A 1BKSA 1E4MM 4N9BA 1YPIA 3S47A 2VC6A 1KR0A 3IGXA 3KL3A 2XTKA 4IUGA 4IIFA 1N8FA 3MZ2A 2R94A 5K2ZA 1ZJIA 1HKIA 3G0SA 4QCEA 2BB0A 1TCDA 4ERIA 1UH3A 1M5WA 3HMJG 2ISVA 4UIOA 3BLDA 3H2FA 2WWCA 3PFMA 4KEUA 1RCQA 4A2RA 2DU2A 5A6MA 1Q65A 1D8WA 3CQJA 1M01A 4JTCA 1A53A 3OP2A 4GI4A 3STCA 1VIWA 1FDZA 3BAWA 4UCGA 3AXHA 1YE6A 2MUCA 1HO4A 4QCFA 1NIUA 4Z1BA 1KW1A 1TX2A 1TV5A 2ABAA 1E6RA 1MW3A 4ZA0A 3SURA 3L5MA 3T6CA 1Q5MA 4UC5A 3S6OA 3NG3A 3W29A 3B8TA 2YDQA 4PB5A 4TTUA 2ZTJA 3PB0A 2VOTA 4AC1X 4W5ZA 3NYDA 2GJXA 1WOAA 4KS0A 3ES7A 5CGMA 5LIXX 3VDCA 4FNQA 1EP3A 3UCCA 1MXDA 3CIVA 3HPZA 1L9WA 4QLKA 1EZ2A 1K4HA 2HTMA 1RXOB 3IJDA 2DIJA 1S2CA 1VCGA 2PDUA 4WKFA 5CBBA 1XI3A 3G22A 4R34A 1K1DA 4LBRA 4GY7A 3IUDA 3S5NA 4CNNA 4KCWA 1GVFA 4YN5A 1GGOA 5AFDA 2VM8A 3U2EA 2W66A 3SEPA 2XFWA 3R43A 4P7QA 6ENLA 2JEQA 3MHFA 1ITXA 5AOUA 1RALA 4XKYB 1DJYA 1YRRA 1LROA 3PUDA 1PDZA 5CGTA 3SCQA 4GZJA 3CAVA 1GEHA 2ONEA 5A6TC 5TAOA 3BE7A 3NQGA 3BARA 7A3HA 4FXSA 3EKGA 1P43A 3B0XA 2RJGA 3VVGA 1E71M 2JF6A 4QJ3B 4QE1A 4NRRA 1YNQA 4C6DA 1LYXA 2V81A 1A5AA 2VDGA 2J7CA 1V93A 5H6HA 5GQBA 1PWMA 4Z2IA 3GH4A 2WSPA 3DDMA 4AD2A 1R3RA 4LS0A 2UZ9A 4PCPA 3KL5A 1CLKA 3Q65A 2HVNA 2OGYA 1FX6A 3H2CA 3QPEA 3QYQA 1OD0A 2IPFA 1ZNNA 4IX0A 4AHQA 3E96A 4MJMA 4MB5A 2FB3A 1Q4NX 2Z2AA 5E70A 1RQEA 4B91A 1W5PA 4UTLA 1UR9A 4GGHA 1HJWA 2V69A 3N13A 2WLZA 3L65A 1A50A 2ZUUA 3OHMB 1WV2A 7CGTA 1EJXC 1LLWA 4L6DA 2XFRA 3TA9A 4F0SA 2V3FA 1CYGA 1GPWA 1V08A 3VIGA 3EDDA 2XSBA 3W1AA 3LLFA 5E6ZA 1QUMA 3K4AA 4RK8A 4DO6A 3W53A 4GCAA 4NI8A 1GVSA 3NM1A 4QEEA 4L6HA 3THQA 3TW6A 3RU6A 3TQKA 4R9XA 3MO7A 1ZRQA 1Z8AA 3KHJA 4IQDA 3WDRA 1OFOA 5A8NA 3MUAA 3RO8A 2VEPA 5CPTA 2DFAA 4CU6A 5DO8A 2Y70A 5EMJA 5FAGA 1TO3A 4LW7A 3WQOA 3KWSA 4K38A 4O4VA 3ALGA 4W5UA 3EWXA 1FWFC 1LWIA 1XH1A 3P93A 3RO6A 3BGJA 1XG4A 4NILA 2YSWA 2X16A 1M3UA 3L4WA 3EBVA 2VOMA 3WMCA 2YPIA 4I6VA 3UZZA 4C6MA 1ISYA 4UR8A 2VFEA 5BWFA 2XSXA 4DXKA 1KR1A 1IIHA 4EAMA 1HL2A 1OC6A 4O17A 1NDVA 3L67A 4KPLA 4HHMA 5A94A 1P0NA 2XHYA 1VRXA 4UTFA 4JQ1A 1C91A 2ZXBA 3EWYA 5BU6A 1WXYA 3P60A 1D3HA 4XQ6A 4QE5A 3VKDA 2NT1A 4NL1A 5LNVA 1IIGA 3MQTA 1ICSA 1XCFA 3PTQA 3UWYA 3OQEA 3FVDA 3M0HA 5EL1A 4C6LA 3G77A 3O8AA 4ZB5A 3WLRA 3T4CA 5G1YA 1BLIA 2DSKA 2POZA 1OG0A 4NIRA 1VGAA 4PUDA 4R33A 1YIXA 3WSUA 2DPEA 1FWEC 5HNTA 4IMDA 1J0JA 2NVDA 1TMHA 2PD9A 1T5AA 3NAVA 1GZJA 2AQWA 4WDWA 2VNCA 5AYXA 1XQKA 4N9CA 3SGGA 3S5OA 3W28A 4Q4SA 4DJEC 3C61A 4CCEA 3M0MA 1OG6A 1GT8A 2YGYA 1L0PA 3TK7A 1EJRC 3AXMA 4B4HA 3QM3A 3MU7A 4PUEA 1GHRA 3GW0A 4K37A 1TG7A 4E2BA 2PC8A 3W4RA 4NNBA 4JTJA 4AU0A 4ZXLA 2ACRA 4XB3A 1L2UA 5KSWA 2HBVA 1TRIA 4HJWA 4WJXA 5FACA 3G1YA 4D6HA 2DSUA 2CLKA 4UZSA 3L0GA 5G2HA 2P53A 1Y5WA 3VD9A 3NXLA 4B3LA 3SCRA 3GXMA 4TV6A 4TXEA 4F3HA 3CEPA 2QCCA 5C9RA 3AMCA 3ARZA 4A05A 1FY6A 3KS6A 1UH4A 3F2CA 3UYIA 3DH7A 1QTWA 4NZCA 3SGZA 1K4GA 5CC3A 3NPUA 1EBGA 3RCMA 4F2TA 4D71A 4HKPA 3AALA 3OTRA 3VUSA 2HROA 5C7HA 4S1FA 5FSEC 4Q4RA 1H62A 1GWJA 3FX4A 4DF2A 1IZCA 2R8WA 3ZO9A 3TNOA 2E09A 3TYBA 3PS7A 3U4AA 2Z6IA 3ARSA 2BY3A 1RA0A 3TN3A 4F66A 3P7YA 4D2JA 4F8XA 6XIAA 1JUEA 1XDLA 1GEQA 2VGIA 1MZRA 3ZJKA 1O7AA 1KFKA 4P2VA 1GTEA 2G96A 3UWVA 1A80A 2IQDA 4CQCA 4EF9A 4PTNA 3EAUA 4XZLX 3EZ4A 5HR6A 1S5TA 2A0NA 1TA3A 1UP2A 4B15A 4BI5A 4O18A 3B8VA 2IKGA 2AMGA 4MZYA 3TFCA 1XGDA 3CZLA 3OGVA 3GXPA 3RUBL 2PPGA 3CGTA 3KOYA 1MO0A 1F6KA 2RHGA 1QVBA 3TQ0A 3U5YA 3MPGA 4GXWA 1DWGM 3MMWA 3QY7A 4WHBA 2PU1A 3A4XA 2XIOA 2A7RA 1VBJA 3URBA 1O12A 2G3MA 2E9MA 1E9LA 4M19A 1Z69A 3S9IA 4YYCA 3F5JA 5DMNA 1WOBA 2J78A 4U10A 1DXFA 1Q8JA 2D0GA 2FJUB 8XIAA 3ITOA 3VINA 2YL6A 5LIKX 5D03A 3ITGA 2BVWA 3TSMA 7ODCA 1OWQA 3HJZA 3FIGA 4XD3A 5TBOA 2DZBA 2HRWA 1Q2RA 3UJRA 5C0QA 1PKYA 1OCQA 3CZEA 4WKAA 3LQGA 1ZAJA 2FVKA 1EB3A 2ATMA 1QAPA 3E5BA 2TRSA 1PZ1A 2B81A 3WJXA 4RNIA 3NL2A 3VKAA 1I60A 2V3EA 1W1TA 5BXSA 1X1ZA 1F7BA 3S9YA 3N2MA 5F1UA 4BF9A 3BLFA 3KBSA 4DBDA 1RP9A 2E1WA 3UNDA 4LS1A 4X60A 1SPQA 1HL9A 3TIMA 1CW2A 2V2HA 1IF2A 1ODZA 2B7QA 2XVLA 3WMLA 2BMBA 3W7PA 1YE4A 5JVLA 2ZRZA 2R14A 4B90A 3WLSA 2ZZ4A 1QWGA 3PAOA 4TOQA 3NUKA 3QHMA 3BMVA 1IWAA 1ADDA 4MIMA 2PZNA 4A8LA 4CNOA 3W25A 3R0DA 1OFEA 1NF7A 4RPPA 1CLXA 2D3NA 2O9RA 2PDFA 1V3KA 2CW6A 1M7OA 2QUNA 3C8FA 5FESA 1FWAC 2PLCA 4GH3A 4BQ2A 4WDUA 4GQRA 3IJ9A 4M1RA 5T26A 2Y88A 2J9ZA 5HINA 1VFTA 1AH4A 3PG8A 3CTTA 1WX0A 1UC4A 2A3LA 2QUTA 4KMQA 4GJ1A 3LENA 1OX4B 4A21A 4TMCA 4LC6A 3V0TA 3N2OA 3WFLA 3ZWTA 1DWFM 1I1WA 2QYGA 1RR2A 2FVMA 3TVAA 4Q8TA 2UV8G 2V6AA 1VEPA 2X7WA 2Q71A 3CUIA 1ME9A 3NVTA 2XFYA 2VZOA 4ZO7A 1K03A 4U3AA 3VNLA 4RLIA 4F0LA 3RU8X 4JX6A 1BD0A 1PKLA 3PZUA 5A6BA 4CLMA 2XVKA 3PZOA 2Y7GA 4DELA 5ABFA 4NYYA 5A8MA 2P50A 4CVUA 2W0UA 3BOLA 2Z00A 2RAGA 1WBJA 1E0WA 5I7GA 4EK7A 3DX5A 1ISXA 2NQJA 1VEOA 1JQXA 4NAFA 3ANUA 4HNNA 1AJ0A 2GVYA 3OYZA 3PC0A 1AW1A 5HMFA 3B9DA 2E9BA 5D05A 1F07A 3TMQA 1KBIA 2JIWA 2QJNA 5H8MA 5GNXA 5BMWA 4M29A 2E68A 3CYVA 1CGVA 1FQ0A 1Q6CA 3EDEA 4Q8VA 3VNJA 3KRBA 4REQA 3GG8A 2WVVB 2C15A 3T1GA 4IG2B 4O16A 3AHYA 1MDRA 4LGXA 9CGTA 2WC7A 4B3KA 4WQ6A 3WQ8A 1W32A 3SQLA 3KP1A 4DUXA 5AYBA 4M5PA 3ABZA 2QVHA 1H5YA 3PFRA 2BZNA 4UQAA 1RLCL 1ICQA 4XZWA 4D6IA 4JZ5A 3VCCA 2XIBA 1JZ5A 3G2GA 4IQLA 3SM0A 2VUYA 3V1PA 5F2IA 1YPFA 1HN1A 2BP1A 2WQDA 1KM3A 2OEKA 3VX0A 3TYUA 1C8XA 3W7GA 3FXGA 1TPVA 3T4WA 4WDTA 4TV5A 4M24A 1J0HA 4YTTA 4UCFA 1KV5A 3M5YA 5T91A 1E6PA 2ZZ1A 3PULA 1N2VA 2IKHA 4GO8A 2PGFA 2C0AA 3GXNA 4LJ3A 4ZODA 1YXDA 3CPRA 4PCNA 1JCXA 5GJPA 1D7FA 4MY9A 4AFYA 2W92A 4OKDA 1P6BA 3CEUA 4GACA 5E9XA 1A5KC 2E5BA 3BGAA 1WDRA 2GYIA 2QPUA 5JH2A 3V5OA 1OD8A 3EDKA 4QDPA 4IP4A 4CQBA 3TYCA 4GBDA 4O0KA 4U28A 2WLYA 1J11A 2WSRA 3QPYA 5C7VA 3IRSA 2CWNA 1SW7A 3AMDA 4DRSA 4G56A 4I5RA 3N18A 2AAMA 4S3GA 4UFJA 1ZHAA 1GQKA 3VUPA 4KCUA 2NVCA 4OOUA 4CEUC 2WJFA 4FIRA 3AOFA 3C6CA 2X09A 5E5CA 2ZUTA 4H8HA 1J0ZA 4X9SA 2RKXA 3DZ1A 4GA8A 3NZQA 3NM3A 1XIIA 1J6PA 3VM7A 4LVAA 3GTFA 2TPSA 4IXXA 1QI0A 3GX9A 3HA1A 5D33A 1CPUA 3BW2A 4GKTA 1XRVA 1BFNA 3VIPA 1V3IA 7PTDA 5D38A 3UD6A 4XAZA 1XINA 2NXGA 3TTQA 2VP8A 4RNHA 3DYOA 3GU1A 1K77A 3GR7A 4YLWA 1MSSA 3WJYA 4OWGA 1I2QA 2VMFA 1HL8A 4QLJA 3GDBA 5MHBA 4K36A 1V51A 1O6IA 3W07A 4A8NA 3I6EA 4A3QA 1P48A 4RE3A 2V2DA 1R38A 1BQGA 4L5ZA 4CNTA 4AXKA 2PDCA 4XZ9A 1X1NA 3WY1A 3L4YA 1QU4A 2O9TA 1O5KA 1VFOA 1WKYA 3C52A 1DHPA 1A0CA 2JIEA 4B5TA 5KMYA 2PB1A 2R91A 3KUMA 3AIBA 1JZ6A 3H2MA 4BK9A 1I1XA 4DZIA 1PYFA 3L2LA 1GOQA 4MB4A 4K1GA 4XAPA 2JQXA 3ZQ9A 5FOOA 1QW7A 3IV8A 3M43A 2Z25A 4R88A 4Q8QA 4JBRA 4JGDA 3WLHA 2BXVA 5F2GA 4A6GA 3QR1A 1B9BA 1V6YA 1NFBA 2VXNA 3NA8A 4L1XA 1OINA 4MLJA 4PRRA 1DPMA 3G5EA 3WN6A 3B9OA 4OV9A 1FWRA 5REQA 3HO8A 3VX1A 3RITA 1V3MA 3CPGA 2WKJA 3AUOA 5M2FX 4YVXA 4CCCA 4PMVA 3GYEA 2Q3RA 1TZ7A 4GYJA 2WB5A 1GQJA 3U4FA 3TONA 3E5PA 2V5BA 3LYEA 2IXUA 4MNMA 1IEXA 1K8YA 1VD6A 3INPA 4GNKB 4KFNA 4V2XA 3PJUA 4O10A 1LZOA 3AIEA 1R9ZA 4DHGA 8CGTA 3H7VA 3WH7A 3KCJA 1REQB 1MW2A 4LNYA 2FPYA 4DB7A 5C54A 4LYQA 4K2SA 2BTMA 3UWZA 2CZVA 2OO6A 3ZVHA 4ZCWA 5DY2A 3VIOA 1UH2A 1UD2A 3EOUA 4LAUA 2QV5A 1EGVA 3F4DA 1DORA 2ZX8A 3MS8A 4QROA 3IIZA 1E6ZA 5F2MA 3A47A 1V0LA 2W3ZA 3G0XA 4JDBA 3UZWA 1ME8A 1BVZA 3KOZA 3RILA 3DFOA 1DL3A 3LMZA 1WZLA 1XD1A 4UQDA 4UMAA 3UXLA 5TF0A 3CNYA 5A5WA 3QFWA 1DJWA 2G4FA 2AQVA 4EPEC 4IF2A 1AUSL 4JFTA 3GXIA 3M0VA 4J3VA 6REQA 1BEUA 2DZPA 5G4HC 2CBJA 4GH1A 2CESA 3P8JA 3R13A 4PE8A 4K7VA 5CZTA 5FA5A 1ZBKA 1RVKA 1U2YA 2VD9A 4QG9A 1PCKA 4GQ0A 2WBGA 3PHAA 4W8LA 4KT2A 4DUOA 5FJOA 4XBKA 1A0EA 4FOKA 3GTXA 4L64A 2PP0A 1UUMA 4ATWA 3VMOA 4FOUA 1B5TA 3SCTA 4HPJA 3EOSA 2BLEA 5HMSA 3ITLA 2POTA 1QBBA 2GUUA 4J3ZA 1XR2A 4MWAE 5LIUX 5AC4A 3G6LA 1GKPA 3LI1A 4ZR8A 5CSSA 1JAKA 3B8SA 1ODUA 3AU6A 2C1HA 1VFFA 5LGZA 3C0QA 3V0SA 3L4ZA 3LPGA 4JEJA 2PLKA 3N14A 1E0XA 3SFWA 4QISA 2VZSA 4HMNA 4I90A 2GK1B 1EPXA 4ZVJA 3WZ0E 1GQLA 2C16A 5LIYX 2P8CA 1J0IA 4Q4QA 4F48A 3FEMA 2G41A 3KBJA 1VHCA 5HMDA 1X38A 4DZAA 3GR8A 1PHWA 4R7OA 3T7VA 3GIPA 1S2AA 1UUQA 3FAXA 4FR1A 1KCKA 1TPDA 3KVLA 1B31A 1DIDA 1UKOA 3EOLA 4I3GA 2HK0A 1W2VA 1G0CA 1V6TA 3UA3A 3AHTA 1SSDA 2IMRA 3ARQA 2HVOA 2CBVA 4JX5A 4W8AA 1E1EA 2QJIA 4MUPA 1JCYA 1JPIA 1YX1A 3PSVA 1SZNA 3SB0A 2AMXA 4Q4OA 1LL7A 4QJ1A 3SIZA 5FEXA 4A3UA 4BI7A 3C4UA 5FJJA 1E5JA 4GVGA 1GG0A 1JCNA 1IGSA 5J8LA 4HCDA 3IIPA 3ZXWA 2OZ3A 1H63A 2EKCA 2ZFAA 2NWRA 1DOSA 2GGIA 2FGLA 1K9FA 5AYZA 3R58A 5CSUA 1XL9A 3EMCA 3E0LA 1W1YA 3MV01 1G5AA 3I6RA 3NQFA 4FA3A 1US0A 4IWWA 2GJXB 5KZEA 4U4MA 2ISDA 3RFAA 1FCBA 3AIUA 5ECUA 1H51A 4O1FA 2CXEA 3H6OA 5CC7A 4G7FA 4CQAA 4KGJA 3UF9A 4GINA 3LBCA 3W7IA 3KDNA 1JDEA 1E5NA 3PUEA 3KVMA 1UYQA 5A6LA 4AIEA 4OT7A 2HXTA 2OQLA 3SGUA 3O7UA 1KM0A 3EMQA 3A4AA 4E0CA 3VZYA 3N9KA 3W1NA 2VX4A 1OT2A 3ZR5A 3GFZA 2ZRWA 3CXOA 3C8NA 1NY1A 1AFSA 4NX0A 3GNXA 5H1WA 1LJYA 3QY6A 3PG9A 3PWIA 3AWNA 4AQLA 3QTPA 2ZX9A 4UTUA 1QNSA 3QV6A 2GGEA 2ON3A 3T0BA 1K6AA 1TMQA 1J96A 3QW3A 3U48A 5AC8A 4B4FA 4MDPA 1O94A 1SU5A 3VPLA 3SCOA 3CASA 1CI1A 5JBDA 2ISWA 3R2GA 1DEDA 1AMKA 2CLFA 4MY1A 3LHTA 2VR5A 5CJNA 4MGGA 5HQEA 3UY8A 2IXVA 4TR9A 1BGAA 4DIAA 1I2OA 2C18A 1XDJA 4LWWA 4LX4A 1Q8AA 1V02E 1N8WA 4UOJA 3DFPA 2E28A 3NL3A 1Z44A 4JQ3A 3IANA 3W6MA 4RX0A 1SJAA 3AS1A 1HKMA 3S5ZA 3SN4A 3ICJA 4O0ZA 5B7ZA 3CQIA 1Q63A 3ZJ6A 1QNVA 1W8SA 2ZUWA 5E93A 4AF0A 3GB6A 4UOQA 1R9YA 4D6FA 4FNTA 4AAJA 1GVEA 1FH7A 1Z32X 1KD0A 3UFYA 1R3VA 2YOCA 5JBEA 4E3TA 2Y5JA 4EACA 3VMPA 1TJ1A 3GNRA 3APYA 3EB3A 3L4TA 4XUYA 3CUXA 5CBJA 3GXFA 4BA0A 1TIMA 4PMXA 2A6LA 5BNKA 2OWXA 2DJXA 4XIMA 2R24A 1VYRA 4C65A 4UXDA 3OODA 2X0HA 4TX8A 4C6EA 1ECQA 4AYSA 2ZA3A 1H7WA 2QQ6A 4PR4A 3V3WA 2JKPA 3WJSA 3GH5A 1C8YA 1OX5A 4QHRA 1F74A 5GNZA 3ZS4A 2MNRA 1TPC1 3BAXA 3KL0A 4DI9A 3RCYA 2OWCA 4OV4A 5LKYA 4ZSUA 4W89A 3SUUA 4IIHA 4L80A 4B16A 2ABBA 1XYAA 2W63A 4JX4A 3SQMA 1MUWA 1PX4A 4N4QA 4AIOA 2VO5A 3P5YA 3OGRA 3GC2A 3CQ0A 2BOGX 3F03K 2PBOA 2PWFA 3DHUA 3TNBA 3W1XA 3ATZA 3ARUA 4G7EA 4UQ9A 5AZ1A 3K46A 4CN4A 4UFMA 2QUVA 3U2CA 1B4KA 2IS7A 3AQUA 3WL1A 1BRLA 4X22A 1L8PA 4D6GA 1ZAHA 3CT2A 2A3BA 2VQUA 2WSKA 1I2RA 4GYPC 4P7RA 5HMEA 2Z24A 2Z2BA 2OTDA 2EAWA 3NR0A 2HS6A 3IACA 4JHOA 4PEKA 4W7VA 3OLIA 2J8TA 1XRFA 3NSMA 3LPOA 4LUYA 1UD3A 1K7EA 4S3JA 4BF5A 2ZXQA 3GBDA 4IFKA 3QLLA 3IEBA 3NL6A 4M81A 1QI5A 3FYOA 3E9AA 1AQFA 1KQYA 3MUY1 2WZMA 2JEPA 4MDOA 5C2XA 2QAFA 2ZC8A 1W1PA 1LQ0A 1TPH1 4QX4A 3MSYA 3KDOA 3OQ8A 2WMKA 2CLMA 3LNPA 3TX9A 2E40A 2VYOA 3O2LA 2J88A 3HPFA 1CNVA 4L1WA 3ZZ1A 3QKEA 3H4GA 1EX5A 4O19A 4YNGA 4S3CA 4CN1A 3KX6A 1EUNA 5GJMA 4OBSA 2FZBA 3VA8A 2Q8LA 1XV8A 3MA8A 1US2A 2D3LA 2J7DA 1BXCA 3P2VA 1ZUAX 1N8IA 4JTSA 2A3AA 1WXJA 2EHHA 4MAVA 1VFSA 1I45A 2W5FA 1HQTA 2YCKX 4KWOA 3T0AA 3G1DA 3G1VA 1SW3A 1RBLA 2GOUA 4O1DA 3DIPA 5G2WA 2G37A 1RPKA 4EPBC 3QZ6A 4RR4A 1Q66A 4JKKA 3LLXA 1EO5A 5GJNA 3E0IA 1SO6A 2CITA 3VGDA 1UKPA 4GZEA 4FSAA 3OBEA 3ZSSA 3EX1A 2CKSA 5MF5A 2HWGA 3O07A 5FSDC 2RDTA 3LMYA 4XSLA 4U3CA 1ZALA 3MUZ1 2ZBTA 2CZ5A 1UJPA 4Q7BA 3UETA 3W27A 5I23A 4IPLA 3VCRA 1EH9A 3SIMA 3S6TA 1HXJA 1EJWC 4HK6A 3L2MA 3CM4A 4ZO6A 1DJHA 4B5SA 2X0SA 3GSMA 3S2NA 2P3EA 1LT8A 5HK4A 5A6SA 1NDYA 3BCFA 4CD5A 3CC1A 4LY4A 4H7ZA 3WQ6A 5E0CA 1QWKA 2EPOA 3KOFA 1TA3B 3GD6A 1GK8A 5E9AA 4LUJA 3G1SA 1UWRA 5BYWA 1RQHA 5ABEA 3M46A 1ZGDA 1FWWA 2V0TA 2FMNA 4O13A 4I9TA 3DBNA 5CLTA 5TQLA 1RK5A 3TA6A 2HSAA 3ID7A 5HNUA 2PURA 1YBQA 1A3XA 3NPWA 5A95A 1V3LA 4XISA 3LGGA 5IHSA 3EXSA 2PWHA 1MFVA 3T08A 2NUXA 4HSHA 3NO3A 3BJTA 1V0KA 1XH2A 4Q8WA 3U8GA 5C9ZA 1SJDA 2WYSA 3TCEA 3P5ZA 1E6NA 4I7VA 5IDIA 1L8NA 1P0BA 1KFJA 4Q33A 3S6DA 1QPNA 5BRBA 1UMLA 1TSIA 4M51A 5AC6A 3DECA 5EFFA 5ABGA 3GLCA 4GIEA 3T09A 4ERGA 1AZ2A 4HJFA 1V5XA 1UR4A 1R8LA 1UWSA 1RCOB 4H9MA 1QXLA 2AKZA 3MJYA 4HTBA 4DNMA 1W1ZA 5B80A 1Q3NA 1VFUA 2E67A 3LU2A 3STFA 4AZ5A 3HV8A 5K3VA 1PV8A 3ZT7A 3W88A 1JAEA 4E38A 5AB3A 2PDKA 4I7WA 3W1RA 5BRQA 3LM7A 1W37A 3BCDA 1BXBA 4DJDC 3TYAA 4E2VA 3Q58A 1HKVA 4GUJA 4R9OA 1JDFA 2I16A 2WQPA 1J0KA 2FMOA 2GWGA 5EPDA 4ROPA 1PPIA 3DAQA 2Y63A 2OJPA 5HUOA 3WBWA 4XK2A 2A7PA 1NF0A 1SFJA 5JMUA 5C55A 5D8WA 3QZAA 2PP1A 1UZDA 3T05A 1AH3A 4EWJA 4TO8A 4ACYA 2NQLA 1TPEA 4IUOA 4C6PA 3GXDA 2V63A 3PAJA 2ADAA 4BEQA 1YLVA 4NJJA 2GVEA 1BF6A 3LZ5A 6PTDA 1LTDA 1Q4WA 2CZFA 3W7LA 3NQDA 4I6KA 1LWJA 5CSRA 1E9IA 1UPMB 2Z7KA 4J3UA 3M9YA 3ZR4A 1FWNA 1GW1A 4ATDA 1RJQA 4CKQA 5LHEA 4HNVA 1VJIA 2F6UA 2WANA 2WMGA 3WLJA 1R46A 3RJYA 1EWDA 1VYPX 5HWMA 1UBPC 3L66A 3G1FA 1DWHM 3APGA 3AMLA 3ARYA 3OOQA 3SUTA 2WSYA 3DI1A 2PF8A 5AC5A 2ZZ2A 1A5UA 2ZZ5A 3W1MA 1TJ0A 3W82A 2VC7A 4AWEA 2JALA 4Q6XA 5ABFB 4BI6A 4ZB2A 3NURA 2XVGA 4KIRA 2JGYA 4V27A 1XIHA 3GDMA 4ACZA 3HB9A 1O95A 1VRDA 1XUUA 1QPQA 3M0LA 1WNOA 4NAFB 1HP5A 3URNA 4KRZA 4KWSA 2FVLA 1S46A 3B0PA 1J79A 1CIUA 3VDBA 2FPVA 1ISVA 4IH3A 5A8GA 3N17A 1PTAA 1PE1A 4DM1A 5M17A 1LM1A 1P1MA 3PZQA 3W70A 4BHYA 4NU7A 4DPPA 1MRAA 4ICNA 4HD5A 5T9CE 1RA5A 2OKTA 4REQB 4B5WA 4X0VA 3K13A 3QR3A 3CZKA 4ZOAA 3RJXA 2OMAA 3QF0A 5C8BB 3MJMA 3R1ZA 4IGSA 3LV6A 4H2HA 3BAIA 3KZPA 2W9MA 4QNWA 4PC8A 5JH1A 2PGEA 3WD1A 4G1NA 4UFHA 4H9TA 1Q6RA 2Z26A 4FO4A 4XZHA 3MSDA 4D1IA 3F2DA 5HANA 1XCWA 1NTHA 3R8HA 4FK9A 3V16A 3QMTA 3MSRA 2XN2A 1W91A 4ICMA 1GZ1A 4C1KA 3UERA 2UBPC 5XINA 2YJQA 4FLQA 3CWHA 1QPRA 2VCBA 5ABHA 1FP9A 2GDUA 3V36A 4NSBA 1LG2A 3N9SA 1K9TA 2VRJA 3WENA 3VNKA 3BUVA 3W2MA 3FJ4A 5DF0A 3KEHA 3JZUA 5LSMA 3ZOAA 4O1CA 4R5EA 2GGHA 1F3TA 2BSLA 1G4PA 2PU0A 3TN4A 1X6NA 1EJSC 2XH7A 4JQAA 4MLRA 4A35A 2EO7A 4DAIA 3GU2A 1VBRA 2WCAA 2EEXA 4ZOEA 2DVUA 3UBPC 2F9RA 4YTRA 5AC7A 1Y65A 1MFUA 3M6DA 4J4KA 4GX9A 2CEQA 2MANA 4FNUA 4U31A 1FXQA 3OO2A 1QASA 1YNYA 2EPHA 1W9XA 1ZFJA 4WR3A 1S3TC 1I75A 3GRIA 3OLDA 2UY2A 3QGKC 4HNLA 5I79A 2CLHA 1OYBA 2J77A 1N55A 3AYSA 2WWDA 1GORA 2Q6ZA 3FLUA 1TE6A 4M0XA 4MKNA 1I4NA 2CU0A 3T44A 4Z17A 4IPJA 2X1TA 4N6EA 4P8VA 3AUJA 4DWSA 1AD1A 2QCMA 4FF7A 3GR4A 3DC0A 3HQNA 4HPHA 4DJFC 1QFEA 4BWLC 3QGVA 2J7HA 3I3DA 4YHGA 2NVAA 3NQ8A 3LCFA 1GG1A 4HPNA 7TIMA 1S5VA 4AC7C 1KWGA 3PTDA 1B30A 3FGCA 3PZNA 1QATA 4GIYA 4L65A 4U2YA 1G1YA 2P0OA 2OYLA 3JVAA 1DQXA 3GDKA 4GIAA 5I2UA 3THAA 4MWAD 1A5MC 3I4KA 4GIRA 4JYEA 3QEZA 5FD0A 3ARXA 1VAHA 4JN8A 3PUGA 2Z2UA 4RV8A 4GRSA 2O56A 1W3HA 4CQ9A 2H8ZA 3LSCA 1HJXA 3FV9A 1TPWA 2TYSA 2XVNA 4OGZA 5HDRA 4MNJA 2B0MA 3GDTA 4Q8PA 3L68A 4PTXA 1UHVA 5G1TA 3KCLA 3XINA 3WNOA 2XGBA 1YDNA 2VFHA 3BQ6A 1Q6FA 3PSWA 2PF0A 2QGYA 1EBHA 3WLOA 3ITCA 4AMAA 1NQKA 3GH7A 3RLVA 1JI2A 2I57A 2PDGA 2QCEA 4HZ7A 2VX7A 1R7AA 3TN6A 1ITQA 3WK2A 5REQB 2V5LA 3UT0A 2J8FA 4GFIA 4XD5A 3U57A 1L6GA 2YA0A 3H2EA 3BAYA 1OEPA 2DZSA 1WUFA 2H9AA 3S46A 1XIBA 1SMDA 4HN4A 1XYLA 1UWTA 1E0TA 4IMFA 2NQHA 3NZGA 2PODA 2E8ZA 4Y8FA 1NDZA 5I3HA 3CJPA 3CO4A 1VPXA 2GSEA 2X1IA 1CTNA 3V0UA 1YXYA 1CGUA 1UQYA 2QDGA 2XINA 6TIMA 4IQJA 2G4JA 3P0WA 4PA8A 4UTTA 2VI0A 1XBYA 4H8NA 1V0MA 2ZX5A 3U7VA 3LTYA 2AGKA 3ZVHB 4XTDA 4PUNA 1GVYA 1W9DM 3KTXA 4NJIA 4GJJA 3H26A 5DRCA 3GY1A 3QC3A 5D30A 1KXTA 4FMVA 2D2HA 1M41A 3BAJA 1JD7A 5G1MA 1PYMA 2OT1A 1PIFA 2D73A 1EEPA 4ZL1A 3HG2A 1FH8A 3PZVA 3CYJA 3EYPA 4PRTA 4WY0A 4LUIA 4KFPA 2EG8A 1ENUA 3C3UA 3GDRA 4NVTA 1JZ7A 2B7NA 1OK4A 2G3JA 2IKIA 4Y9PA 5CC5A 3N3MA 1SZGA 4F0KA 1RJPA 1YDVA 4LAMA 2A3CA 3ITXA 4GQQA 4DVOA 3MI2A 1OF6A 6REQB 2Q8ZA 2HE8A 3CV2A 1Q7QA 1HZYA 1QPOA 4LVDA 2E0PA 3G1AA 1B2YA 3E0FA 3FW6A 3VOFA 4LTSA 5FAJA 1M65A 1VBUA 2V30A 3TLQA 3JU2A 1R85A 1MWOA 1XLDA 3WQFA 3BL3A 2ZRVA 2XJ7A 5H8PA 4W87A 1TR9A 1BG9A 3WELA 1QO5A 5IBXA 5LXEA 3W75A 2DZVA 4HGXA 2ZVIA 3QY8A 2E25A 3DFSA 3VABA 4ICCX 4U5IA 5C9WA 5AHEA 3JZEA 3VOHA 1BYBA 4YCOA 5A6KA 5D8ZA 3CV7A 5EBAA 1R0MA 4OJYA 2DJLA 2VDHA 3OZMA 4YTSA 3Q2DA 3FA4A 1AQHA 2XZ7A 4ZE5A 1VJSA 3HQOA 5DXXA 1GOWA 3TZFA 4L4LA 3GAYA 1FBAA 3UJ2A 2VEFA 3GVGA 1Q7MA 2YCEA 1NU5A 1YEYA 2CERA 1DQUA 4J28A 2E8YA 3IJ6A 4DY1A 3O0FA 3KTCA 2D1ZA 1C93A 4JHZA 3ATYA 2F61A 4A8IA 3PANA 1MEHA 4O14A 3CV1A 4QDWA 4HVXA 4U2ZA 3IJLA 2NQ5A 4HU3A 3E0WA 4CD6A 2GQAA 1KBKA 4LAOA 4GBUA 2OZ8A 5KINA 4GUGA 5CZKA 1W9PA 3BURA 3AO0A 4R27A 4DAFA 1O1ZA 5T9BG 4HPXA 2DORA 2DQXA 2PWEA 1UUOA 3Q67A 3O06A 2O92A 1A3WA 1KM1A 2A1YA 3A4WA 3FKKA 3S8HA 4US6A 4G1KA 1EA9C 3DYMA 2J9YA 3W7DA 3GZAA 2CXGA 3E74A 4IT1A 4AZCA 4E3VA 4LBUA 3NTYA 1RAKA 2PTYA 4ZO8A 3CAKA 3VU2A 2IQ0A 4BQ4A 2YBTA 2YZRA 2ZICA 1TPB1 4DM2A 2GSJA 3S9ZA 1JUKA 1F73A 4I9JA 1SO3A 4DJED 3LK6A 1CBGA 2TODA 5FF0A 2EPNA 3FFSA 4J2MA 2CZEA 4BS0A 4PFHA 5FF3A 4HOZA 1E3ZA 4AD4A 4BF7A 1MW0A 2O7QA 1QNQA 1KXQA 3QGAC 2I1OA 5C9UA 3SFKA 5AHIA 5EMLA 3LLDA 2PDHA 1XJBA 4EPDC 2WNWA 4XAYA 5CZ0A 1EYEA 1DE6A 4Q8OA 2GJLA 4HZMA 3GK0A 1C90A 1S5WA 1TX0A 3IS4A 5KITA 2X30A 4NY2A 1TWIA 1NM9A 2YBVA 4Z1YA 3SRHA 1UWAA 3OZPA 5JIPA 1F8IA 3R4IA 1QI4A 2OSXA 3C2OA 4MYAA 1KNWA 5CSYA 4JCMA 5ABTA 2QVNA 3HG4A 4CQDA 1C3FA 3AIQA 3DG6A 3SO7A 4P7NA 4IIDA 1T96A 1GVIA 3MKVA 5I3FA 3OVQA 2PEVA 3AJ7A 4W4QA 3UU0A 5LNWA 3GNOA 1S2TA 1OABA 1DWJM 3QV9A 2G8ZA 3NFUA 1BXNA 3S2CA 2YR1A 1Q6OA 1EOKA 5A8QA 1V7YA 4KIEA 4QDMA 3LGEA 3SW6A 4RZBA 3HN3A 3VC5A 3LN3A 1TV4A 2YLAA 4ERAA 3KLLA 1XDMA 3FA5A 2DY3A 2VCCA 2WMIA 2BVYA 4U5KA 1PIGA 4PMQA 3NQ2A 3T2QA 4IL0A 3B4UA 4HHHA 2WVSA 1FRBA 4AIUA 4KKXA 3ABQA 5C2GA 3N2BA 3STEA 1OGSA 3TFXA 2QZRA 3CU2A 3AYVA 3A6OA 1KKOA 4IQEA 2A6NA 4D6DA 1JUBA 1JZ4A 2X7VA 3AZTA 4RE0A 3DI0A 4S3EA 4CD8A 3EKLA 4IMGA 4XZBA 4MTVA 4H9XA 3EX2A 1HFBA 3NOYA 4IZGA 1KC7A 4X2PA 4AF0B 1F9CA 3WD3A 5CG7A 1H4PA 4WX2A 3PM6A 2QDDA 2PTWA 1V6XA 2VZTA 1QNPA 2A4AA 4DYJA 1AJZA 4IJCA 3RLGA 3GNNA 4N6FA 1XF0A 3P74A 1XIDA 4CEXC 5A69A 1V3HA 5G4WA 1UB3A 5C6MA 1X96A 2PDYA 1TZZA 2V68A 1KXVA 3A3XA 1K9EA 4AY1A 4LV9A 4LBSA 2R1PA 1GOMA 4A3RA 3K30A 3DBPA 1EUAA 4F0MA 2I5IA 3CL8A 4RXGA 4YVPA 1X1OA 3H2OA 3CUGA 2VUNA 3TW7A 1XLLA 4B2DD 3G3DA 3LBOA 3L0KA 3IJ8A 3EGJA 3QHOA 1M7JA 3VKCA 3L12A 3S1GA 3BCJA 3I3BA 1DWAM 2XZ9A 3W38A 1EQPA 4DO7A 1FHVA 3C56A 4FAMA 4L4PA 3C86A 3SBFA 3LHZA 1B9ZA 4U33A 3WK1A 2DZUA 4KEVA 4ZTXA 2VX5A 1KB3A 2PRMA 1TVNA 4E8DA 1NOWA 1G4EA 5HNNA 3PF3A 5DMYA 3F2BA 4UTJA 4G7EB 5LZLA 1UKTA 3LXBA 1BRLB 2R1MA 1XQLA 4AEOA 3P6LA 3B3DA 1AD4A 2QIWA 3QH2A 1YPXA 3A5VA 4NAEB 2D24A 4FZIA 2ZUMA 2NSXA 3LHYA 4MWAC 4DLMA 4AEFA 4QLLA 1R3YA 3EWZA 5D2TA 4H6QA 1XIMA 3W0KA 2Q3OA 1DJIA 1AA1B 4ZB0A 1V4YA 4F9JA 5EB8A 3H2NA 3G8EA 3F4VA 4WGHA 3WUBA 4IFKB 4J3XA 4HA0A 1X7IA 4AVOA 1QW8A 5DX7A 1UZ4A 1Q45A 2EPKX 3VFLA 5FF2A 2NZLA 4Z2GA 1ISWA 1VF8A 5FEPA 3GBEA 1MMFA 4TIMA 1UZHA 1PS9A 1M9HA 4HQVA 2PDIA 1JDDA 4KEMA 2G3FA 3PB2A 1XH0A 4YVVA 4ZSTA 4HP5A 2XPKA 7XIMA 3W1TA 1Y0EA 3T07A 3HMCA 1T6MA 3RMJA 1WKDA 3SRKA 5I3IA 2GQ3A 3FK4A 5AKQA 1MXSA 2P1FA 1XLFA 2QJGA 3A21A 1BPLB 3P80A 4GHRA 3EWWA 2Z27A 3DHFA 1TKKA 2ACQA 4MKVA 1IZKA 3GHRA 2G95A 3FYYA 2J25A 3ZIZA 3KW3A 4ES4A 1LL4A 4O57A 3WMSA 4C60A 2WM1A 5D9MA 1CGYA 5FJUA 4PSPA 1FDJA 3MBDA 2Y62A 4M8UA 4J3TA 3VD7A 4JL1A 4EANA 3W22A 1ELSA 3CTLA 1GQNA 5EMMA 3WCZA 3WF2A 5U7SA 3NIYA 5CBIA 5JQ9A 2J9XA 3OW1A 1YMYA 4ADSA 1HKJA 1MUCA 1RCXB 2WZTA 1WZAA 2WMJA 1QRQA 4E4UA 1U5HA 1C92A 4UTIA 3UR2A 3LY0A 3PR2A 3NVDA 5U4NA 2BS9A 4UB9A 3H23A 1JL8A 4XVDA 4DI8A 3R11A 4KBXA 3REQA 4W84A 2H90A 1IXQA 4JIRA 3KRSA 4GG9A 5LNSA 1XBXA 1FWIC 3UXDA 2OGJA 5KZMA 2J7EA 3GC5A 3RIKA 4IJRA 3TXVA 1GUVA 2O4MA 4KFOA 2DGAA 3OPSA 1CCWB 4K8HA 2CKRA 4JIHA 2Z1KA 1WCGA 3VD5A 3QRHA 1E6QM 1W3TA 2PCQA 4KCTA 5A2AA 5F2LA 3TTOA 4EWND 3BQ5A 3BAKA 3E49A 1N82A 1R2SA 3WLNA 5TD4A 5IM51 1DQWA 4IXHA 1S2VA 4I8DA 4N9EA 2BGNE 2VC9A 4XZIA 2VWTA 3VDAA 1CXFA 3NCOA 1PZ2A 4XZNX 3SJ3A 2CFFA 2DH3A 1P5BA 5D37A 1XIEA 5DCEA 2VT0A 4H83A 1YBQB 2EGZA 2ZADA 3A13A 1TWDA 1OGGA 1WZKA 1JF5A 2CLLA 3N3TA 5K9XA 4KEZA 4LVGA 4RDZA 5KETA 1ZBCA 1VPYA 3GU9A 4EF8A 3QVQA 4JD4A 4HMDA 1F05A 2FGBA 3O16A 2IQTA 3L0NA 2YYUA 3TZNA 1R3WA 4BY3A 1RUSA 2ZRXA 4GI8A 1K8XA 3FHQA 1UR1A 4E2OA 3LI0A 8A3HA 1VBHA 1BYCA 1FWHC 1JYXA 1XLGA 3IVSA 4NYUA 3VGHA 2WK2A 1W0MA 4E8CA 3RMEA 4O50A 4CGTA 1SZRA 3TC7A 4TX6A 3BG5A 1H7PA 4Z42C 3MCMA 1C29A 3GNDA 4Z0SA 1BYAA 1TB3A 3VC6A 5DLCA 2DIKA 4OBRA 1OF8A 3AIRA 4TVDA 3P3BA 3MCNA 2XN0A 4ZQCA 4TU1A 2Y7EA 1YHTA 2CLIA 3MKKA 2GWNA 3BW3A 3KCOA 4HA3A 1QNRA 2PSNA 4WOZA 4J2PA 4M6PA 1CT5A 2WNZA 3LCLA 4C6JA 4GISA 2ZDSA 1JNEA 3MHGA 4M80A 2WNQA 1J4EA 1PWLA 4L1GA 2GQ9A 2DDXA 4AWTA 3I7QA 2VEMA 5FCZA 3D5HA 2W27A 4FLOA 3PZTA 5K9DA 1X6LA 3E12A 3E38A 3EA3A 3VNZA 3IGHX 3V4BA 1M03A 5I03A 4C6BA 3EA2A 3VIJA 1YADA 1Z7AA 3NEHA 3BLIA 4C6QA 4B5VA 5M3WA 4M3PA 2FYMA 4OIFA 4C7GA 2VQTA 3E6EA 1DP0A 3H70A 4N4PA 3S0CA 3WF0A 4Y90A 4B5UA 4MG4A 3GKAA 4YXGA 1H1YA 3H24A 2YB1A 4LNCA 1TTQA 2DZWA 1PX3A 3EWUA 4S23A 3SY8A 4YHEA 3TSBA 1VC4A 3LRMA 1JJKA 4H7VA 4JR5A 1XG3A 2XH2A 4WXZA 3RXZA 1FWTA 2I5GA 3WQCA 4DYEA 1PL9A 3QN3A 2G3IA 3H22A 2OR2A 4NF7A 3TV8A 1UMYA 1D2KA 3ZVIA 3NQVA 1JI1A 4FS9A 1JCTA 4JIPA 3BGGA 1OY0A 2XGIA 2BBFA 5I6SA 1Z42A 4M7SA 5HA7A 1ZBWA 4R53A 1TQJA 3EX4A 3ABSA 1UA7A 1P6WA 3OZYA 3UYCA 2QCDA 3K4WA 1AVAA 4Y9OA 1VIZA 2ZX7A 3C2FA 1E40A 1JPMA 2V8ZA 4L9XA 1KGUA 2JE8A 3L7RA 2OSWA 4JFUA 8XIMA 3CH9A 5I5RA 3V18A 4NHVA 2P10A 3URAA 5DBTA 3ARPA 4ACZB 1PDYA 2Y4SA 4M1BA 3VDHA 1AK5A 2QCFA 1QDSA 3W1PA 4JTDA 4K3ZA 3UP8A 4AVFA 5FI8A 1C9DA 3KOWA 1W5OA 3V75A 3H7UA 1CXKA 3UGVA 4RZ5A 1LBFA 1DKWA 4ROQA 3TJXA 4RDWA 3VGFA 2C1GA 3TQPA 4JTKA 3T2OA 3VM5A 5EKYA 4PEEA 3DHPA 3C3NA 4QSFA 2QDHA 2G0WA 5FJPA 1ONXA 1EC8A 3M5XA 2Z29A 4M6VA 3MB9A 1ZQ5A 1SO5A 1M6JA 2AAAA 1E15A 2BOEX 1ITCA 5HPOA 3ZLHA 2ZDRA 1W5NA 3WBAA 1EC7A 3IWPA 1LF1A 4E6MA 3TMLA 2VFDA 4KW2A 4F4RA 1XLCA 3MBFA 3W71A 3UJSA 2C6QA 1BWVA 3CS2A 4NZJA 2HXUA 1FFQA 1GVQA 3C2EA 2INEA 4JPGA 1TVPA 2RDWA 1RLDA 3W7EA 3S83A 4PTVA 4YU1A 1FVPA 4X63A 2PDQA 2YBUA 4EXQA 3AHZA 3RDKA 1IXOA 3THCA 4JKLA 5BCAA 4GJIA 3EX3A 3BVJA 6A3HA 4HNTA 4WVXA 3A3HA 2HPMA 2BODX 3FSUA 1VFMA 1E9YB 4GYFA 3RLUA 1L6YA 5CLWA 3AC0A 5LGXA 5B7YA 3GVQA 2VR2A 1TVLA 3OIHA 1V3JA 5D4YA 4Z1AA 3HIJA 3AXIA 4GOAA 5J04A 3B03A 2VVNA 2WOQA 2OLHA 3E1F1 5C5YA 1OADA 1S1PA 2C19A 3LV5A 4MB3A 4X9YA 4XAFA 4C6CA 1GJWA 1H50A 1W3IA 3M0KA 3W2LA 2HVMA 4O8AA 3EX6A 4KCVA 1HVXA 3P67A 4NZ5A 1V77A 2DH2A 3WH5A 3U6WA 1BQCA 4Z2JA 1GOOA 3MP5A 2QUUA 3QC0A 1HG3A 2A7NA 4AUBA 4DNHA 4LF2A 1DIEA 3BLPX 4JCLA 3LS9A 1O68A 3OA3A 2PTXA 1JGIA 3RG6A 1R3TA 3MMDA 1IR2A 4ZO9A 3RPMA 4BR1A 3MZNA 3IVUA 1H3GA 1G94A 4PMYA 2JK2A 2WPGA 1FWCC 3O6DA 1L6WA 3W76A 4DWSB 4GVFA 4HB7A 4LC8A 1KTCA 4K1WA 4H01A 3H55A 5CPQA 4UZUA 2WSQA 4US5D 1K9DA 2P76A 5E0KA 1RK6A 4AD5A 4ZE4A 4ZENA 3FJ6A 3UG4A 2ZYFA 3FGCB 3WFAA 2B31A 4S3FA 4H7CA 1P6CA 3RX4A 2WVUA 4TMBA 4WSHA 4CNSA 2ZIDA 3WQDA 3TWBA 3PZIA 5XIAA 3UA4A 5EY5A 3SI9A 3M1ZA 4AZBA 3PNZA 3POHA 2WAGA 1OZQA 3OEXA 2QAPA 3AFBA 3LHUA 1QPKA 3H21A 3B0YA 1WQ5A 1VKFA 2Y8KA 4YPJA 1W8GA 3DC8A 4BEUA 2VD8A 1YW1A 2O0TA 1QK0A 3ISIX 2QMJA 4MM1A 1K6WA 3FN9A 1FCUA 3MP3A 2ZX6A 2XISA 3TU9A 3WH9A 3ORWA 1SFTA 3DFYA 3D3FA 2PC4A 1J5SA 3JR2A 3RNDA 3C2YA 2O9OA 3TW9A 1AZ1A 5PTDA 3BH4A 3VIMA 4RW3A 1AG1O 3MHUA 4ZFCA 2XDFA 4L56A 3R5EA 3BO9A 4DBEA 5DXYA 3NO5A 4Y9MA 3HJEA 2F7FA 3W23A 7REQA 2Y61A 1LQ2A 2Y6ZA 4IFOA 2Y1HA 3UWWA 4F0RA 5JUVA 3SR7A 1IWPA 4IGHA 1E51A 1J2BA 5D2VA 3WQGA 2H9AB 4W8BA 1ICPA 1UW9A 2I9EA 3NQAA 4AWUA 1MQPA 3KBWA 3T8LA 4QAIA 4M56A 1F76A 1XYCA 3SRDA 3PJWA 4L7ZA 3N15A 3ES8A 4MJ2A 4UMCA 1SQ7A 4QS6A 3VI2A 2ICSA 3VNMA 1T0OA 4RKAA 3AI0A 3VIIA 4QJ4B 4HOXA 5HR7A 1O5XA 3TYZA 2GDQA 1POJA 1IT8A 4B92A 1ZP3A 2UY4A 1VB9A 3LTSA 4D1JA 2NWSA 3WF3A 3II1A 1XLBA 2XM1A 3BJSA 4AG0A 1OCBA 4Y7EA 3TR9A 3WUFA 1BHGA 1RY8A 4CU7A 3VNYA 3RPDA 3M0XA 4LYPA 3OGSA 1NELA 3W86A 4IGMA 3NQEA 3NJ3A 4DYKA 2R1NA 4AZ6A 3PWGA 1DE5A 4WY0B 2Y5SA 5DELA 5DMMA 2RGMA 2XG9A 4BZYA 4LUSA 4LANA 1XYFA 4M6QA 2BXZA 1HGWA 3C0LA 3UVAA 2PTZA 2RGLA 4WJEA 3BZJA 3NDOA 1KV8A 1U1HA 1QK2A 4LF1A 1Y7VA 1XBVA 4JXCA 4NP7A 1POKA 1EX1A 5LXXA 1CZ1A 2V2CA 4WSJA 2J7BA 1HNYA 1DXEA 3AZSA 1W3LA 1OCJA 4JTEA 1J8VA 1OIMA 4IIBA 2BVTA 3B9AA 1L6FA 3P62A 2O7SA 4I9AA 4O12A 4AXNA 3A4JA 3ALFA 4QXIA 2GUBA 5D32A 3MC5A 5ECVA 1QOXA 2YXXA 1GJUA 4LVFA 3T0CA 3ZWSA 2E5CA 4HBKA 2XVPA 3N1AA 2BXYA 5F4XA 2WHLA 5EMUA 5HULA 5BOFA 2P3ZA 5BMXA 1BSLA 1WDQA 1BTCA 3LPPA 2W62A 4WEVX 4E8GA 1B1YA 2B4GA 3LCXA 1S1RA 1XWYA 3GVRA 4FP1A 1XKYA 3W85A 3WQWA 4G5DA 5LA1A 2VENA 3LERA 3S3GA 4JFSA 3RK8A 3F5KA 3K1DA 4JTRA 2ZUSA 2PWUA 4Z08A 2NUWA 5HAOA 4IHCA 4Q8MA 5BXRA 4AZ7A 4UTWC 4MYXA 3DOPA 1DJXA 1VHNA 3NNTA 1VP5A 4E2DA 3KS5A 3MT1A 1O5QA 1NFPA 3FKRA 4AX6A 3DKLA 3N4FA 4JIIX 3BMXA 4GY1A 3BPWA 1HIZA 4H8VA 3BW4A 1EQCA 3N6JA 2I5QA 2QNEA 3SECA 1KGWA 4DF1A 2A3HA 1X7FA 5FEZA 3CHFA 3PPHA 1PUDA 4P7LA 1ISZA 4HHPA 1A5LC 3CB3A 1WAWA 3KVJA 4J7RA 1K8CA 2BFGA 4RCXA 4AZCB 1ZY9A 1MVYA 3W7MA 3M0ZA 2DUXA 1NWTA 3R0KA 4FXFA 5SWUA 3BC9A 2R6OA 4ECLA 1RBAA 1G4TA 4GUFA 1ZPTA 4FX6M 3LX9A 3PK7A 2NXHA 5AHMA 2HS8A 4MF4A 1NEYA 3HTWA 4MY8A 2EQDA 1ZCOA 4F0HA 3MMUA 5DT7A 4QG8A 5I77A 4X61A 4OOZA 3E2RA 1Q2SA 1BWKA 2ACSA 1JYNA 3VFCA 2QJMA 3VIFA 2ZWZA 1A5CA 3C2VA 3P82A 3M5VA 3W24A 4HN8A 4MADA 4UFKA 1R6WA 5GNYA 3V35A 2IPGA 1YXCA 1UA3A 1XUZA 4RZ4A 1UKSA 2CNCA 2W6RA 3PBWA 4HZ8A 1XP3A 1S2UA 1FHLA 3BG3A 1UWIA 3LA4A 3WQVA 3VE9A 4HYVA 1TZ9A 1V6WA 2REQA 3TCSA 3FEQA 2I7GA 1UCWA 1TV7A 1ZSXA 2PE4A 2BHYA 3NEVA 1OFDA 3RGTA 1TMLA 1I6NA 1XLJA 3T81A 3UXAA 3AIWA 3EKZA 3SY5A 3U3HA 3B04A 3V1HA 5A2BA 3LCWA 1LOSA 4C6KA 3S1UA 2F84A 2YIHA 2NV2A 3DUGA 4L9ZA 2OZ0A 1EO7A 3TJ4A 3UG3A 1OFRA 3WDPP 4A3YA 2P0IA 1EF2A 2FHBA 2WMIB 2ZCGA 1Q6DA 3ZJ8A 3VZZA 1PIIA 2PGRA 3B4YA 3N25A 4PRWA 5LHFA 3UR7A 4IIEA 2BDQA 4RL3A 2VDIA 1OYAA 2E3ZA 2Q02A 1ONWA 5EGRA 3SADA 3VGEA 1MEWA 1KKRA 4KETA 4UQEA 4ZQPA 3WUGA 1A4MA 1J12A 3N2CA 4ILSA 1UC5A 4UQBA 3BG9A 4GUHA 3N9RA 3GXTA 3CV6A 3S4TA 1EP2A 4R7JA 9XIAA 3GTIA 4S3AA 4WCJA 3JS3A 5C70A 3IV3A 2PLJA 2D2OA 1Q6QA 5KZ6A 3CL6A 4DX3A 3LNMA 1E4NA 3U2ZA 5G2IA 3WLLA 2CETA 3GE7A 1KFWA 3QOKA 1HJUA 1UR2A 2G97A 4UBPC 3M6YA 2YLLA 3CAQA 2CLEA 3AS3A 3AYTA 1XLEA 3QPZA 1B0IA 4YIWA 4JICA 3UPMA 3FA3A 1W31A 2BG5A 2WCGA 1UG6A 3MWCA