4K7VA

Oye1-w116a complexed with (r)-carvone
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLAVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
molecule keywords NADPH dehydrogenase 1
total genus 149
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4k7vA00
1GJPA 1AMKA 1DJNA 3LGEA 1IGSA 1QPNA 1QPQA 4IJBA 4JEQA 4NXSA 4UTWA 5G2WA 2WOQA 3VKJA 3G24A 3EXTA 1FCQA 2A1YA 1NVMA 4UTJA 1K7EA 2CLIA 3FS2A 3B8DA 1DL3A 3BGGA 2ZDRA 3KVJA 5DY2A 3FA5A 4ZZ9A 1SQ7A 3NEVA 3C52A 2CLFA 2TMDA 4KKXA 1ICPA 3P60A 1FXQA 3PR2A 5TQLA 3B05A 2V2CA 1I2OA 3P5ZA 4LVDA 1K8ZA 3RNDA 4XBSA 4HNNA 4O14A 3PBUA 2DZVA 3S5OA 4JYFA 1IIHA 1TIMA 4JTKA 4DPQA 3G0XA 3GAKA 3MW7A 3EB2A 5C5YA 3W2NA 3NL2A 3IGUA 3W88A 4LUIA 3NL6A 1H61A 3EX3A 3P61A 1RR2A 1OJXA 1X8FA 3W2MA 3NQ6A 1SO4A 2ISSA 4RR4A 2ZZ2A 3ABRA 1WX0A 2VKZG 3QM3A 1W54A 4UFLA 1IF2A 4UMAA 2QDGA 1JUBA 3DFQA 3I68A 3FJLA 2ABAA 1H60A 3IRDA 5D04C 3W86A 1SFLA 4UCGA 3UPWA 4NJIA 1P0KA 2WPBA 3PB0A 3DFTA 4WX2A 2ZZ5A 3TW6A 4LC8A 1F76A 3OG3A 2DZSA 4JX5A 4GUHA 5LNUA 2QCFA 3G1VA 4IUOA 1F73A 4YMZA 4RZ4A 1KTNA 3W7QA 3HF3A 3KVKA 4DF1A 3LERA 4QQ3A 5LZLA 4ICNA 2NXGA 4JTHA 4GFSA 1TPVA 3P80A 5D09A 4TMCA 3TUUA 3GAYA 1TREA 3UD6A 2ZRYA 1S3HA 3HG2A 3PS7A 3V75A 3STFA 1DV7A 2YPIA 4I7UA 4XBKA 4Y90A 4BR1A 1OFAA 1A5AA 1XL9A 2CZDA 4OU1A 4HSNA 1GWJA 3LHUA 1SSGA 2DJLA 3EX2A 1RQHA 1JCXA 2PC4A 1ZAIA 5FF2A 1KFCA 3DXIA 4D2JA 4UTMA 3M7WA 2KZHA 4ZMGA 4JICA 1B57A 1F05A 5AHMA 5K7JA 3VNDA 3LBCA 3O6YX 1OYBA 3LI1A 3DZ1A 3L65A 4N6FA 1S5TA 3W70A 4ORIA 4RXGA 1EUAA 4UTTA 3G1YA 2YFNA 2WNQA 2ZA1A 3PBYA 4RJEA 1M7OA 3QJAA 1UASA 4XZ9A 5H2ZA 1FWNA 1ZFJA 1G4SA 3M5VA 1WQ5A 2NV2A 3S42A 4H3DA 5EMUA 1GVRA 2ZRZA 4JXCA 3N14A 3S1WA 4UFMA 4BI6A 1XBYA 1I8JA 1QAPA 1LBLA 2GQ8A 2JKEA 1HO1A 4MFDA 2ATMA 3LM7A 3QMRA 2WJZA 1F6KA 3CWNA 2FTPA 3LB0A 3U8GA 2QAFA 4E2DA 3N9SA 3NM3A 4PL1A 3TAKA 2VC6A 3MHGA 4K8EA 1YDOA 3HGSA 4OV9A 1VYSX 3KX6A 3UYCA 5TBOA 2HSAA 3W2KA 2FIQA 3TQKA 4A2RA 3TV8A 1OABA 3HGRA 5EBUA 2NXHA 1M7PA 5LGXA 4ZVJA 1G69A 2Y6ZA 3GXPA 3NQVA 3VFLA 2FFCA 2QF7A 3LRKA 3S8HA 1U5JA 3B03A 1EWDA 4DQWA 3OIXA 2DP3A 4S2CA 4POCA 1OYCA 3RF9A 1WV2A 1SO3A 2NUWA 4AAJA 3TMLA 4WY0A 2O7SA 4CCCA 1H51A 2P0OA 2A6NA 3G1FA 3BVJA 4TX9A 3BG9A 2FB3A 1JUEA 3ABSA 2W0UA 1K7XA 3EX1A 3ZR4A 1TTPA 3FYOA 3DHDA 3FIGA 3L0NA 1Q6LA 3PULA 3STCA 1W5NA 3TSMA 1C8VA 1P4CA 2DORA 4WD0A 3F4WA 2FB2A 4NNAA 1E51A 2BWGA 4JTTA 4L4MA 3G1XA 4JY9A 5D37A 1T99A 1SU5A 5AYYA 7TIMA 5CPNA 2R94A 1YXDA 3A22A 2GOUA 3M44A 1LRQA 5BRBA 4NT0A 4CQ9A 1YTEA 1LTDA 4OWGA 3NGJA 2G95A 3LCHA 1WDWA 3EWZA 2QDHA 2EHHA 4KFOA 3HGOA 4M19A 1H63A 5ABTA 3IEBA 3KXQA 5LNVA 4Q33A 4CLMA 5FEPA 5KZDA 1EP1A 3W7HA 4HNTA 3DKJA 4EF9A 4O4VA 4RXFA 3HB9A 3W72A 5BMWA 1O95A 3BLFA 3VE7A 1F6PA 3BW4A 3OVQA 4UNLA 1TTIA 1D3GA 1DORA 2A7PA 3S5YA 5LHFA 3W1PA 3A24A 3G1AA 1C29A 3BO9A 4JTGA 1EB3A 2XFWA 2YGYA 4Z1DA 1JRBA 2Z6IA 4Z08A 3M47A 3W87A 1ME9A 1J4EA 1LM1A 2A21A 3IIVA 1TB3A 2A7RA 5HQEA 1RQEA 4AMAA 1TV5A 5FF7A 3BGJA 3E12A 3GXNA 4CNNA 4O17A 2Y89A 2EAWA 1R47A 1FCBA 2ZTJA 5E93A 3W7PA 2RH9A 2O7QA 4NZJA 4QJ1A 5EY5A 3DI0A 2WKJA 3MP4A 3QFEA 4JN6A 3P84A 1TPWA 1TPEA 4UMCA 3FLUA 3V1PA 3NAVA 1UJPA 3C4UA 3WJSA 3BW2A 1XDLA 5IBXA 3EKLA 2Y63A 3T7VA 2Y7DA 1GG1A 3D0CA 4FEZA 1DVJA 2DU2A 3M1ZA 2GVGA 3NQDA 1YXYA 1DQWA 1LORA 1OX5A 3W1XA 3HOJA 5G5IA 3Q58A 3UY7A 5FEZA 5C2XA 1SW0A 3PSWA 5F4XA 1W8SA 2QJHA 5F1UA 3UQNA 4NZFA 1ZALA 4JTSA 3EWWA 4L4LA 5K9XA 2QEZA 2CLLA 4NXKA 1GPWA 1KLZA 2OCZA 2XN0A 2J24A 2ALDA 4A3UA 4O11A 4IMDA 2Y85A 5HR6A 2YDAA 3WJXA 2R91A 5AC7A 2ZA2A 4JNMA 4Y6GA 4ZQCA 1GEQA 4R53A 2PRMA 5D05A 1KA9F 1FDJA 2V82A 4E2BA 3TW7A 2CLHA 2NZLA 4XKYB 5CPOA 4UFKA 4A29A 1PHWA 3TSBA 3S1UA 3EWBX 4BFAA 2ZBTA 4K7VA 3RLUA 1H7WA 5D03A 2VEMA 3LCIA 1JJKA 4DO6A 1OFPA 3LLDA 3QEZA 5DELA 1CW2A 4MUZA 5CG7A 2R14A 4MOZA 3UWVA 1QDSA 2LLEA 4NX0A 1PL9A 3WK3A 3E0IA 3C2OA 4JIQA 4QM1A 4RLIA 2ZRVA 1SR9A 3LOTA 2ATSA 4IXHA 2OJPA 1V7YA 2G96A 3W1RA 3SY5A 3NVTA 3Q2DA 4NUWA 1K03A 1SZFA 3MP3A 4UMBA 2WQPA 3C2FA 3NYZA 1Q45A 5EYWA 1RV8A 4CQ8A 4JS3A 4XKYA 5I3FA 1I2PA 5BNKA 3KVLA 3NQ7A 1KBJA 1ICQA 1WYIA 3VI2A 1LOQA 3CC1A 3ELFA 2QUUA 3C61A 4UTUA 3G1DA 5F2GA 1Z42A 1XCFA 1NEYA 4O1DA 3LCLA 2AAMA 3G0SA 3GNDA 4RX0A 1XI3A 1W3NA 2H3DA 2V2HA 2Q8ZA 2PE4A 3N19B 4M6VA 1TSIA 4FNPA 2QCCA 4MY9A 4RK8A 4FX7A 3VE9A 1VLWA 4ZQNA 3KOFA 1GQNA 2BLEA 2X1UA 3CTLA 3W7NA 4JDYA 2ZFAA 5D33A 4A21A 5L9FA 1KLYA 4ZQMA 2VFFA 5DXXA 3QPZA 1SUXA 4CCDA 2YX0A 1FDYA 4O57A 4Q32A 5LNWA 3O05A 3SGZA 2F7FA 1OFEA 1U83A 1GVSA 3EEGA 3F4NA 1EUNA 4JYEA 3RK8A 5KMYA 1WOBA 4IPIA 4K8HA 1R30A 2IQTA 3I7RA 5AN7A 4FB7A 1QO5A 4IMFA 4K7YA 1O60A 4DF2A 2J9XA 2ZA3A 4LVFA 5EL1A 1H7OA 2WNZA 5FEWA 3S1XA 1VGAA 4JTEA 3O8AA 2VFHA 5DCEA 3CEPA 4JDBA 3W73A 2YFOA 2X1TA 3RLVA 2VFGA 3DFNA 2HS8A 3QPYA 3W7JA 1MEHA 3PUOA 4LV9A 5GVJA 3O1NA 2QJIA 3HGJA 5HR7A 1OFQA 3HPZA 3GDLA 3BARA 3W22A 4XQ6A 1MEWA 4RZ6A 3F03K 1I2RA 2OT1A 2QCMA 2GJLA 3ATYA 3QRHA 2DZPA 4PTNA 3QSRA 5AC8A 3QMSA 2JKAA 5G2IA 3JS3A 3TDFA 4KFPA 4ONVA 2ZRUA 2C3ZA 3O15A 4K37A 3UWYA 3W1TA 2WNNA 3TJXA 2CFFA 1K7FA 1FUYA 3L9CA 4DXVA 5E0KA 2DJXA 3G1SA 3NPVA 4FF7A 3UWUA 2VFIA 3TCEA 1PIIA 3HPXA 1Q3NA 1XFBA 2OMAA 3CIXA 4NNCA 3EKZA 4PFMA 3M0ZA 3M41A 3PVFA 3C2RA 3LTPA 3TFXA 2I1OA 1F5ZA 3B0VC 1OX6A 4I9AA 4QNWA 2JGYA 3LCGA 4LT9A 2FJKA 4O16A 2CZFA 2DZWA 3ZFHA 1W56A 1L6WA 2DZUA 4QSHA 2E5BA 5C54A 4K38A 5HMSA 4XWUA 4KWVA 1TPUA 2GUUA 4RZ5A 3SECA 3M5XA 1A53A 2TPSA 3CEUA 1LLWA 1OX4A 2WO5A 3ABOA 1LCOA 3LI0A 1GVFA 4Y96A 2W79A 3WK2A 3STGA 3DGRA 4A2SA 3T40A 3QW4B 2X30A 3BK0A 3N73A 3SW6A 3S1VA 3THQA 4X3ZA 3M43A 3UY8A 3LHWA 1YLVA 1UCWA 1KV8A 3P5YA 5EA9A 1ZY9A 1FX6A 3C3NA 4DO4A 3WK1A 5AYZA 2V30A 1UBSA 1RD5A 1RQBA 1TJRA 3HG3A 3UWQA 2QR6A 2NX3A 2W6RA 5FEXA 1ZENA 2ZZ7A 4GUFA 3B0UX 2J9ZA 5LKYA 1R2RA 3BG3A 1YADA 2VEKA 5CSRA 2QCHA 2Y62A 4LY8A 2C18A 3MMTA 2A7NA 2E6AA 3NL5A 5CPMA 2QCDB 3HMJG 4LVBA 3IVUA 4WOZA 3STEA 5F4WA 2A6LA 1QFEA 3H53A 1A5BA 4MZYA 4YCPA 3PWAA 1IXOA 2E77A 2QCGA 4RKAA 5FF3A 4G1KA 1LROA 2NWSA 3TFCA 4QNEA 2E6YA 4GRSA 5J5DA 1VQTA 1LOLA 2C1HA 3SZ8A 1QCWA 3L5AA 1VYRA 4MKNA 1QOQA 2ZZ1A 5AHIA 1VH7A 2BZNA 1W5MA 2YW3A 1KM6A 4IMCA 1M6JA 1A50A 1ICSA 4UXDA 5DCDA 3KVMA 3OHIA 2PRHA 3QF0A 4AWTA 3P81A 2DZTA 3OBKA 2G97A 3W2UA 2QUVA 3HG5A 3TK7A 5C6MA 5DY3A 3LTYA 3MI6A 3QYQA 4A22A 4YXGA 3PY2A 4ML9A 3MYOA 1OF6A 3GDKA 1TQXA 3C56A 3L67A 1W3IA 1C9DA 1ME7A 2RDUA 3I6RA 3MWAA 3Q37A 3HO8A 2RHGA 1B3OA 3GB6A 1HL2A 2Z6JA 1GTEA 3DH7A 4PC8A 4U4MA 3EX4A 4FIQA 4N6EA 2Y7GA 1KFEA 4HNUA 4N02A 1HUVA 4IX2A 4DO5A 1FWTA 3FOKA 4M6PA 3P8JA 4GWEA 2J27A 2XN1A 1OX4B 3W84A 3GVGA 1LRNA 3IGSA 3DFSA 5K9DA 4MZ1A 4AEOA 2Y7FA 5BW6A 4W9TA 2TYSA 3QZEA 4O4WA 2A4AA 5FF4A 5LNSA 3UNDA 3TQVA 1WBJA 3W7IA 2Z1BA 2BXVA 3LV6A 3L0KA 3CT7A 4DEFA 1OFBA 1GYNA 1ZAJA 4IMGA 5D32A 4O0ZA 1KV5A 2D73A 3CPRA 4LRSA 3PB2A 5A8GA 2V2DA 3TIMA 1DBTA 1Z44A 4HSOA 1L6SA 1MSSA 3DAQA 1H7PA 3IV3A 1LBMA 1JCMP 4O15A 4C1LA 2H90A 5DN1A 1WXJA 2J9YA 2RDWA 3LTSA 4IPJA 3IVSA 4NQ1A 5KZEA 4Y9AA 4JX6A 3W7EA 1EIXA 4AHQA 4ADSA 1TQJA 4NVTA 1VCVA 3UWZA 1FCUA 1H5YA 3TAOA 4EF8A 4FX8A 4O19A 1KM5A 2CZEA 1H62A 1HG3A 2C15A 4X9SA 2E5DA 2VFDA 3NPXA 4NJHA 4N9EA 3GKFA 4PA8A 3MO7A 3UXDA 4O1BA 1SZNA 4GUJA 1N55A 3MBDA 3HG4A 5AHFA 1X7FA 1XBVA 4Z0SA 1OHLA 2XN2A 3E02A 3NQ2A 3L66A 4WY0F 1TJPA 2VEPA 3QH2A 1JUKA 1EWEA 5DLCA 2OZ0A 5DXYA 1QPOA 4EIVA 3NDOA 3SIZA 4AB4A 1HTIA 3QW3A 5D2WA 3NQAA 1VLIA 3YPIA 4LC6A 4RV8A 2VXNA 2NX9A 3JRKA 5J5RA 3NNTA 2V81A 4ZL1A 1ZNNA 4UTTC 4PODA 4O28A 5SWUA 4GBUA 1BTMA 2VFEA 3LHZA 2V8ZA 2CU0A 5FF0A 3RMJA 1M5WA 1W5QA 4UTWC 5AHLA 4I7WA 3CU2A 3W7DA 5FESA 4UIOA 4FNUA 3WFAA 4MFEA 1K3UA 1SW3A 1W37A 3W7CA 2E1DA 2NLIA 3CIWA 4MY8A 1OVDA 2NXIA 1TPH1 1UUMA 4K36A 3FYPA 3E49A 4XTDA 5EPDA 3W2JA 2BTMA 1GVQA 2E5CA 1ALDA 3FEMA 3W7OA 1HO4A 1ADOA 1B4KA 4FXRA 2ZQ0A 1EA0A 5CSSA 2DZXA 1BWKA 2C0AA 4LWWA 3T44A 2J6XA 1KM1A 5D30A 2FDSA 1X1OA 4K39A 3O6CA 4ZQRA 3BPWA 1DKWA 2RKXA 2WV8A 3SSJA 1SZGA 1VHNA 2CWNA 2E6FA 1JULA 3MUXA 3C0JA 3LHYA 1XDMA 1EP2A 1TMHA 1KFJA 3MYPA 3L0GA 1VPXA 2YZRA 5U4NA 4AWUA 1TPB1 4WOQA 3TX9A 4BI7A 5KTLA 1G6CA 5F2LA 1QMLA 3LHTA 4N2YA 1H7RA 2CZ5A 3MI3A 3O07A 5I3KA 1SFJA 3W76A 4EWND 1PV8A 4M5PA 3EWYA 4N4QA 3IIXA 5F1VA 3GK0A 1QR7A 3W23A 4HT3A 4BI5A 4UR7A 1J5TA 4UFIA 3CHVA 4OHQA 4QAIA 1IXNA 2CW6A 3AJXA 1OK6A 1W5OA 5KINA 3LBMA 5BOOA 3PG9A 1LOSA 2F84A 5D2YA 1VJIA 3GZ3A 3TE9A 4HNVA 2HMCA 4B5NA 4YL2A 1JCLA 1L2UA 1EP3A 1H7NA 4BF9A 1SPQA 3LCWA 1K02A 1TTJA 3W1NA 1FY6A 5K4XA 1G67A 5T26A 3TJLA 3TU9A 5LNRA 3Q94A 1EEPA 1TCDA 3LHVA 1KTBA 1AW5A 2ZCGA 2R8WA 3F1QA 3LDVA 4O54A 4Z1BA 2JGQA 1LYXA 3CB8A 1KFBA 3BV4A 1P0NA 3BW3A 2NX1A 2Z0IA 2Y61A 4Z0JA 4Z1CA 3HBLA 4GNJA 1SSDA 1YYAA 2PURA 6TIMA 1F7BA 2H6RA 3QC3A 3FFSA 4S1FA 3SI9A 1H1ZA 1DHPA 3AO0A 2Y70A 2YYUA 1PE1A 1AK5A 1IXPA 1XXXA 1S5WA 1GTHA 3W1QA 3UWWA 3O63A 4AWSA 1XUZA 2OX1A 5EKYA 3BLEA 3TXVA 2V0TA 4MVAA 1JCNA 2YYTA 4MJZA 2QCNA 1JQVA 2PRLA 5FI8A 2J88A 3PUDA 1FWRA 3KRUA 4FNRA 4O52A 4N4PA 5DBUA 3W75A 3UPBA 1IXQA 1WOAA 3WJZA 2FPVA 2RDTA 1UB3A 3DFPA 2NWRA 1XKYA 4N9BA 4C1KA 4TR9A 2E68A 4HIBA 2ISWA 1WA3A 2H8XA 3PF3A 3DFOA 2QCDA 3S9YA 5IBXC 2WSQA 4HN4A 1XM3A 4R33A 3GDMA 4LNYA 3W1MA 2HS6A 5HUPA 4FNTA 1W3TA 1AL8A 1ZCOA 1NF7A 1BKSA 2NV1A 4ORMA 4E0CA 2B7QA 3RFAA 1H50A 2GVJA 1JCJA 3DKLA 1X6UA 3OVRA 4AHOA 3DBPA 3L5MA 4OGZA 1TPDA 3P74A 3B4UA 1T96A 2WSYA 4WXZA 3GYEA 1YDVA 3B06A 4DF0A 1L6YA 2X1SA 4O10A 5HWJA 3W1UA 1YXCA 2B4GA 3NQMA 3A23A 3C8FA 1D9EA 3MJYA 5LHEA 4OT7A 4O8RA 1A5CA 3KFTA 3IIPA 4IWWA 2YW4A 2GVLA 1O5KA 1TRIA 5CZTA 3M16A 1FWSA 5CKSA 1P5BA 4UFHA 1NF0A 5D2TA 4ZQPA 3QQ0A 4MJMA 3G8EA 3O06A 2CLMA 4LUJA 1S5VA 1N8FA 4O1AA 4AF0B 1DOSA 1OF8A 4ADTA 4UUIA 4RCXA 5LSMA 3LCFA 3M9YA 1XBXA 1DJQA 1X1ZA 1LDCA 3B04A 3IIOA 5I3HA 3HPSA 1T8XA 2C16A 4LOCA 4NJGA 3W7LA 1DQXA 2V5LA 3P67A 3GR8A 4AH7A 3H55A 4TO8A 1Z48A 1EX5A 4AHPA 5D02A 2QCEA 8TIMA 1R46A 4PH6A 3M5YA 2PCQA 2UV8G 5H91A 2ISVA 1OFOA 2B7NA 4FNQA 2ZZ3A 4IGHA 2JK2A 5A5WA 1KM3A 4LS1A 3R2GA 3OA3A 2Y88A 4O13A 3NA8A 1ML1A 5G4EA 5DCBA 2E09A 3ZWSA 4O1CA 4FX6M 2E6DA 4ALDA 4I7VA 1KBIA 5F2MA 4OBTA 3SJ3A 2VEIA 3MHFA 5CZ0A 4LU0A 2ZZ6A 3GR7A 1ME8A 4UTIA 4MYAA 4TU1A 5LGZA 3TC6A 2A2IA 1FXPA 2GJNA 1R2TA 3G1HA 4CNPA 3A21A 1FQ0A 2BX7A 1VZWA 1XBZA 1TV7A 1ZAHA 1OK4A 1IIGA 4LV4A 3GLCA 2AGKA 3NZ1A 1Q6RA 5CPLA 4X22A 3ANYA 4JTIA 4MIMA 3USBA 4WQ6A 1I2QA 2YCEA 2ZZ4A 2B7OA 3ATZA 4AXKA 1JQXA 5TIMA 3GKAA 1G7UA 2Q3OA 3W7GA 1TTQA 3FKRA 1W0MA 1QPRA 2C19A 4LTSA 5I3IA 2EKCA 3G0UA 1AW2A 3TMQA 4QIUA 3G8RA 5F2IA 6ALDA 1O5XA 2B7PA 2V9DA 2X2GA 4IOTA 4JD4A 1I45A 1ZJIA 4UC5A 1GVOA 3S5ZA 1B9BA 1Z41A 3HQ1A 4GC4A 1FCVA 1G7VA 3R8RA 2B0MA 4Q4KA 4WJEA 4O18A 1Q6OA 5I3GA 3HIJA 2Q8LA 3LX9A 1MO0A 3SFKA 1R2SA 3ZS4A 4BK9A 1JRCA 3KRSA 1VS1A 1B4EA 3R89A 3TA6A 1G4TA 3W1AA 1UUOA 5G4WA 3L2IA 1XC4A 3EX6A 3LRMA 4AF0A 3N34A 3THAA 3L68A 3NQEA 3NOEA 2VELA 3NPWA 1VRDA 2FLIA 5CGQA 1P1XA 2YR1A 3E9AA 2A0NA 4UFJA 3S5NA 3EXRA 1FWWA 4JTLA 1W5PA 1OG0A 3NPUA 2VOMA 4JY8A 1FDZA 4CQAA 3TKFA 1YTKA 2QKFA 3ABQA 5G1TA 3MP5A 3LLFA 3LRLA 5IM51 3R5EA 1AW1A 3BLIA 3NO5A 3R12A 4EVZA 4TIMA 1SW7A 2CLOA 3DU0A 1Y0EA 4E38A 5K9CA 3W7KA 3QQ1A 3W85A 5KITA 2HTMA 4IQLA 3W83A 3G3DA 3M6YA 3DHFA 4UR8A 5HWMA 3PM6A 4PEKA 3NQGA 3UZ5A 3CWOX 3SR7A 1WAUA 3MI2A 1YTDA 4WZHA 2EPHA 2H3BA 3W7RA 5L6UA 1K8XA 5I3JA 2FPTA 1RPXA 5K4ZA 4U28A 3C2EA 4WUIA 4XTIA 3PUEA 4YCOA 5D2VA 1EPXA 1A5SA 2AQWA 3SGUA 2I9EA 4QISA 2JBMA 3OVPA 4LVAA 1NFBA 3VCRA 4OQVA 3W74A 3N3MA 4LW7A 4J9JA 3G22A 4O53A 3N9RA 3ZWTA 3OEXA 3LXBA 1GZGA 5K2ZA 1H1YA 2C14A 1L9WA 3NR0A 4M7TA 4KWWA 4Y8FA 1HFBA 2VENA 1AG1O 1I2NA 5D2XA 1TPC1 1BWLA 5AYXA 5CZJA 1LLZA 3N2XA 3O16A 2ZYFA 3B0PA 3GNNA 2G5WA 4GUGA 4JTUA 1LP6A 4WY0B 3W6YA 3NZRA 5C55A 4DPPA 4M6QA 1SZEA 4Z1AA 3QSTA 5HULA 4EOUA 3G18A 4MLJA 5D38A 3C2VA 1QO2A 4FO4A 4JGDA 4BWLA 1FBAA 2OT0A 4JX4A 3GX9A 5G2HA 1TPFA 3K30A 3MBFA 3NG3A 5CZSA 3LXAA 4YWIA 4LS2A 1RVGA 1V5XA 1PHQA 3FKKA 4R34A 4P2VA 3FJ6A 3L21A 2ABBA 2P10A 2I14A 3PC0A 3MHUA 3KHJA 3KAOA 3IGXA 3RU6A 5HWNA 4DELA 1LZOA 2P1FA 4S2BA 1O94A 1J2WA 4MY1A 3S0CA 4JIPA 1GOXA 4MLRA 3JR2A 1TYGA 2EF9A 3C6CA 1MEIA 5E1QA 3E96A 3TSDA 4MPQA 3A5FA 3T78A 1O4UA 3NQCA 1OFRA 3W9ZA 4FNSA 3GDTA 1VHCA 4FXSA 1TO3A 1K8YA 4UTKA 4N9CA 4XUGA 1PVNA 3TROA 2NUXA 3NQ8A 2H8ZA 2YSWA 4H6KA 2FPYA 1PCKA 3GDRA 1MXSA 4UTLA 4JYDA 1KM4A 1RZMA 2QUTA 3NQFA 4NJKA 3PAJA 2GQ9A 1WBHA 5AOUA 3UZJA 2TRSA 2QAPA 4GUIA 1Q6QA 4O50A 2EGZA 2WSRA 3PSVA 3O6DA 1YPFA 1CI1A 1VC4A 3M5ZA 3TH6A 1JCYA 4GXMA 4IXXA 4O12A 1OYAA 3H54A 2GQAA 3IVTA 2RFGA 4HPJA 4TMBA 4FIRA 1KFKA 1D3HA 3TR2A 2X1RA 4JTFA 3W71A 3R13A 1H7XA 4MYXA 1SO6A 1TV8A 3IIZA 4NX5A 1JR1A 4CNOA 3T4CA 3TQ0A 1CX9A 2C6QA 3HJZA 4R7JA 4WXYA 1TRDA 2ZRXA 4N9DA 3W3OA 2GPTA 4NJJA 1VCFA 3BG5A 3U6WA 3TXZA 2X16A 2ZRWA 3GIYA 4UTHA 2TSYA 3EWXA 5U7SA 1MZHA 5AHEA 3N2MA 3P62A 3LXCA 2V5BA 3W1LA 2CLEA 3P8IA 3PBVA 3EWUA 4MZ8A 3GXTA 3EXSA 1G4EA 2QCLA 3W2LA 4HPXA 4LS0A 2JKPA 3P7YA 4JTJA 4ZQOA 4DBDA 3NL3A 3W7MA 4K6AA 1XUUA 1G4PA 3A9IA 1AL7A 3DI1A 3PG8A 3WJWA 1KM0A 4PL2A 2C13A 5MHBA 5AHNA 1KFLA 5BMXA 1OFDA 1GG0A 1GYLA 3I7QA 1W31A 3A5VA 3CLMA 2BSLA 3CM4A 3NM1A 4PCFA 2A85A 1THFD 3QMTA 3I7SA 2A5HA 1ONRA 3S6DA 2NUYA 1QOPA 3CQ0A 3PBWA 3G3MA 4IMEA 4OV4A 2Y7EA 4DBEA 1I4NA 1VCGA 1YPIA 4ADUA 3I65A 4OE7A 5F4SA 5G1YA 1KW1A 5HJLA 1LBFA 3T55A 4UNKA 3UXAA 5KSWA 3TNOA 1KM2A 2FQIA 3KRZA 1VYPX 1T0OA 1GT8A 4JR5A 1NSJA 1VR6A 3P82A 4HHPA 4LRTA 1F74A 1BEUA 1PS9A 1YDNA 4M7SA 4IX0A 1ZHAA 4LVGA 4O0KA 5DBTA 3NXFA 1QNVA 4KFNA 5AC6A 4BWLC 3LCXA 4HKPA 2YXGA 5AFDA 5KZMA 4P61A 3U2OA 5K3VA 4X2RA 3INPA 4GE8A 4NNBA 1QWGA 4FHAA 4CCEA 3TC7A 1NAL1 2QJGA 3L5LA 4NU7A 1JVNA 3WK0A 3W07A 1W1ZA 3LV5A 2ZTKA 2Z2UA 1F2JA 3DENA 1N7KA 5AB3A 1PCWA 1SO5A 4AVFA 2CLKA 5HUOA 4GJ1A 1KTCA 5HINA 1LRTA 3WJYA 4H4IA 4YLWA 5HNRA 4QITA 2Q3RA
chains in the Genus database with same CATH superfamily
3VDAA 4LEFA 3VAVA 3UETA 1QPQA 3SRDA 4EXAA 4B91A 1XSJA 1HJVA 2A1YA 1K7EA 2CLIA 4JHOA 2ZXAA 3DFHA 3KVJA 1X1NA 1XRSA 1VFSA 4KKXA 1ICPA 3P60A 3EDKA 3PR2A 5TQLA 1K6WA 2V2CA 4G7EB 1I2OA 3P5ZA 1UHVA 3JW7A 4Z2IA 3KBMA 3FVMA 4KRUA 4XBSA 3I6TA 3GHUA 3PBUA 1ENUA 4M1BA 2DZVA 4M51A 3S5OA 1JIBA 4G8TA 3O0FA 1KQZA 4PFHA 3CHDA 5BWAA 2VDIA 1P1MA 3G0XA 3MW7A 1TX0A 2UY4A 3W2NA 1WDDA 3T05A 3VXGA 2PGEA 3OZMA 2P76A 1OJXA 1X8FA 4EPDC 2ISSA 2ZZ2A 1E72M 1PDYA 4QTGA 2ACUA 2VKZG 1S2WA 4GBDA 2ZIDA 5DFAA 1W54A 4UMAA 1XLDA 3FJLA 1H60A 2YB4A 3LQLA 2AGTA 4UCGA 3KRBA 4QJ4B 4HTBA 1QVBA 1HJXA 3OG3A 1GW9A 4IUOA 3DC0A 1A4MA 4RZ4A 3KVKA 3TTQA 1LWIA 4QQ3A 1DIDA 7REQA 2A3CA 1XYCA 1KKRA 3UD6A 1VBGA 1EF3A 5HANA 1AD4A 3PS7A 3V75A 2E9MA 1IT8A 3LMZA 3STFA 3S2LA 3B8VA 3H23A 2AQVA 4J3TA 5LYRA 5AC4A 2FGZA 4GO8A 1A5AA 1NWUA 1GWJA 2WVVA 3DYPA 1HGWA 1SSGA 1LQAA 2J4GA 1X96A 2DJLA 2HE8A 2XFYA 4D2JA 4QE5A 4GQ0A 4NRRA 3UF9A 4QDPA 1T40A 1J93A 3F2CA 2BOEX 3LI1A 3DZ1A 1PZ3A 4W84A 4GZIA 3W70A 5GPRA 2DFAA 3JZEA 4JQAA 4UTTA 3G1YA 2PDNA 4Q8VA 2ZWYA 2ZA1A 1C7SA 1Y65A 1I1WA 3PBYA 4RJEA 1M7OA 3BAWA 1K6AA 1Q8JA 3XINA 5H2ZA 1FWNA 4LXFA 2FGBA 1GVRA 2ZRZA 3WLPA 1TFVA 4IPLA 1XLMA 2VJXA 4BI6A 4QR6A 1QAPA 2JKEA 4UOJA 3QMRA 2WJZA 1F6KA 2OQLA 2BXYA 1NQKA 2VC6A 3MHGA 1VYSX 1D2KA 2CERA 2HSAA 2OGJA 1WPCA 4NAEB 2VP8A 1UZ1A 2XH4A 3ITVA 4IFKB 2VTFA 2QYGA 3HGRA 1M7PA 2Q8XA 3E2QA 1Z32X 4YU1A 2FFCA 1TR9A 1ZP4A 3LRKA 1U5JA 4IUGA 3EA1A 1GQLA 1TV4A 4AWEA 2XYLA 1BD0A 1EWDA 4DQWA 1SO3A 2GWNA 4AAJA 2J79A 4WY0A 4CCCA 2A6NA 4TX9A 4X0VA 4BA0A 1BQGA 2W0UA 1XD1A 4AZ7A 3EX1A 1TTPA 4IG2A 4D6EA 4TVDA 2P3EA 3VGHA 4WDXA 3STCA 1W5NA 1C8VA 2HEJA 2DORA 4IQJA 4GYPA 3UJFA 3CTTA 3OLDA 1VKFA 2AL1A 4LBUA 2DEPA 4RE3A 1Q13A 4OTKA 3H12A 4Q22A 3MV11 3IK4A 5D37A 4ZXOA 1VBJA 2FZBA 1UWQA 2R94A 1TA3A 4HK7A 1CGWA 5BRBA 3BCJA 3MSDA 4JFSA 1KD0A 1YTEA 4OWGA 3P0XA 1XWYA 2QDHA 2EHHA 3TN3A 2HNEA 1H63A 3IEBA 1UD8A 1O6IA 1QK0A 2OSXA 4DJFC 4O4VA 4RXFA 1F6PA 4TVUA 4UNLA 1TTIA 1DORA 3WBYA 5CGMA 5FACA 3IANA 2Z1SA 4UB9A 3A24A 3G1AA 1C29A 3BO9A 4QLKA 4JTGA 1E9IA 2YGYA 1CTNA 1J6OA 1MRQA 1JI1A 2BXZA 1B3ZA 1E1FA 2A21A 2VX5A 4PSRA 4AMAA 5BXTA 3WLJA 4HZ6A 4IP5A 3KOWA 1ZJHA 1V0KA 3VGDA 3AAMA 2ZTJA 1E6QM 3W7PA 1YX1A 4QJ1A 1CXLA 3WLKX 2YDSA 4HA3A 2QIIA 1M03A 3NAVA 3WUEA 3OLIA 2YL8A 1BRLA 1U30A 2G3IA 3D0CA 3D5HA 1XHGA 3M1ZA 3KWSA 2GVGA 1POKA 1YXYA 3FK4A 4WDWA 2J78A 5G5IA 3WLIA 5C2XA 3PSWA 3SAZA 5F4XA 3H2OA 3WEZA 3SEPA 4TXEA 4YVPA 2QEZA 1KGWA 1TV3A 9XIAA 1Q6GA 4MJ4A 3WH9A 4S3CA 2ALDA 4O11A 4IMDA 1ELSA 2QHAA 5A8QA 3WJXA 2XUCA 4Y6GA 4E5TA 4ZQCA 4R53A 2PRMA 1KA9F 3POHA 4NI3A 4XKYB 2Y0FA 1XRTA 3UZWA 3EWBX 4BFAA 3RLUA 2CHNA 3LCIA 1HZYA 4DO6A 4H83A 1OFPA 1V4YA 4Q4OA 1B0IA 3FA4A 4MUZA 4MOZA 4JCLA 2QVNA 4F79A 1KXHA 3D3FA 1XGEA 3H21A 1ESWA 3G6LA 1JPHA 2Q71A 2G96A 3W1RA 1BVWA 2X42A 1UWSA 4PMJA 3Q2DA 1K03A 3C2FA 3VMPA 3GHTA 3N13A 1IE7C 5A3HA 4F9DA 1WYIA 3UNTA 4WSHA 3GRIA 1LOQA 2QUUA 3HQPA 1J0IA 4LCSA 4H6EA 4Q8QA 5E9XA 5BOEA 4XV0A 2W27A 3LCLA 1IR2A 1P6CA 4RX0A 2H3DA 4MDOA 2E8ZA 3IUDA 2PE4A 1KCXA 5C2GA 1M53A 3UPMA 4MY9A 1F4HA 3OHMB 1E5NA 4KF1A 3LD5A 2X1UA 3E5BA 3W7NA 5H6HA 1P48A 1AJZA 2OB3A 3WH7A 5DXXA 4HZ7A 2GSEA 4GNVA 4QS5A 3QHOA 3SGZA 2AL2B 5A6BA 2F7FA 1U83A 4B5TA 2IMRA 1NM9A 1EUNA 1OCQA 1Q6DA 3T1GA 5A6JA 5AN7A 1T6MA 4R9XA 1QO5A 4IMFA 2ZA3A 4LVFA 3UR5A 1TZZA 1HVQA 3S1XA 2WC3A 3O8AA 2VFHA 4GISA 5DCEA 3PZIA 3EOLA 4L7ZA 3LPPA 2VFGA 3DFNA 3QPYA 7REQB 5G1MA 4TOQA 4BEUA 3M0VA 4LV9A 2X0SA 2UY2A 1HJUA 2W91A 1AJ0A 3V18A 3ISIX 4XQ6A 1MEWA 3NCOA 4RZ6A 2QCMA 4FF5A 1J0KA 4ICCX 4ZENA 3GTHA 4XAGA 3SB0A 3B8IA 5G2IA 3SGGA 5B7ZA 2C3ZA 3EEZA 1A3XA 1TG7A 3SQMA 4KETA 1ZP3A 5H8UA 3VVGA 2XIIA 2Y8UA 3ARYA 3M7SA 4DXVA 4H2HA 2CEQA 4FF7A 3BLLA 4NAFA 5FSDC 1DJZA 1VEPA 1Q3NA 1QI4A 2Y1HA 4AVNA 3UA4A 4J2PA 1P0BA 1E6SM 1ZU8A 1G9HA 1Z69A 3BSHA 1F5ZA 4UBPC 1QI2A 3LCGA 4LT9A 1CLVA 3WUFA 1E40A 2CZFA 3GG7A 2HVMA 4QSHA 2E5BA 5C54A 4XWUA 3GU1A 4RZ5A 1A53A 3CEUA 1GJUA 1ADDA 1OX4A 4IIDA 3R79A 4P7RA 1LCOA 4QDWA 4AZBA 4Y96A 2W79A 2XIBA 2NQHA 3AICA 3TNBA 4A2SA 4B5UA 3F5JA 3CZKA 3QW4B 3BK0A 1QI5A 3N73A 1SVDA 4X3ZA 2DGAA 3LHWA 4MAZA 1MYRA 1CB2A 2EO7A 1ZY9A 1I6NA 3OG2A 2E25A 3WK1A 3K8KA 4HN8A 2IPJA 1RQBA 3RU8X 1XKJA 3CUFA 4GJJA 3C86A 1JL8A 1GQKA 4F0LA 3ARPA 3B0UX 2OWCA 3TR9A 1YADA 1J0ZA 2PWUA 4N7QA 4KEZA 4US6A 2QCHA 3CZEA 2C18A 2WHKA 4Z2JA 3M64A 2E6AA 3L23A 3SUUA 1NQ6A 3FGCB 3DYOA 3IVUA 2FHFA 4WOZA 3STEA 5F4WA 4JQ2A 2GSHA 1QFEA 2DW7A 3QV8A 4EE9A 1XIFA 2E77A 2QCGA 5LIKX 4P8VA 3EMQA 3TFCA 1UR3M 1VQTA 1LOLA 3SZ8A 4B5WA 1ZSXA 1VAHA 4MKNA 2FH6A 1QOQA 2O9RA 5AHIA 5DMLA 3AIWA 1KM6A 2NQZA 4IMCA 1M6JA 3KVMA 1W32A 1NDYA 3QF0A 2VURA 3R8HA 1R9ZA 4DZAA 3GNPA 3R11A 3TWBA 1XR2A 1C91A 3TN4A 2BDQA 3VNLA 4ML9A 2DY3A 4KBXA 3WDPP 3L67A 1C9DA 3MWAA 4MGGA 3Q37A 4GQQA 3HO8A 1B3OA 3PANA 1GTEA 3DH7A 4ZOBA 4F8XA 3RJXA 5AC5A 4N6EA 2XSBA 1HUVA 4IX2A 4DO5A 4MSSA 2XN1A 3W84A 1KWGA 3KEHA 5K9DA 3WL0A 1ECQA 3ZIZA 3LQGA 3QZEA 2A4AA 5FF4A 4WCJA 3GVRA 3MC5A 1NH6A 4TX8A 4F0SA 3LV6A 1ZTVA 3VNIA 3WD3A 1V3IA 1OFBA 1ZAJA 4IMGA 4GACA 3CPRA 1Z44A 4R5EA 1H7PA 1PX8A 4X63A 4OOZA 4O15A 3MUZ1 1V6UA 2WHMA 5DN1A 2G8ZA 3QLDA 4C5ZA 1JNEA 4QHRA 4NQ1A 3QGVA 4OBSA 2WMGA 3NSNA 3W7EA 2ACQA 1EIXA 1TQJA 1EXBA 1PZ2A 1VCVA 4D72A 5HNTA 2Z7GA 1ONEA 1YNYA 3KZPA 4MTVA 2CZEA 4Z2KA 4M0XA 4RV3A 3CASA 1ZPTA 4EPBC 1JYNA 3LLXA 3E6EA 3TTEA 2IQ0A 1MNSA 4GQRA 4N9EA 4PTXA 3EZ4A 3MO7A 3BZJA 2YDQA 1SZNA 2EPLX 4GUJA 1SM9A 3T2PA 3IJQA 1OD0A 3CPGA 4Z0SA 1B3YA 3NQ2A 1TJPA 5FAGA 3QH2A 3VGBA 3GUGA 1JUKA 1EWEA 5DLCA 5DXYA 4C1NA 3QW3A 5D2WA 5H1WA 5BXPA 3BCDA 4LC6A 5J5RA 5BYWA 2CHRA 3NNTA 3U7VA 3D3AA 3ARXA 3ANUA 2XVNA 3RIKA 1EJ7L 2VFEA 1ZL1A 1WZLA 1XPYA 5AHLA 3CU2A 4PB4A 4MFEA 2GVYA 1SW3A 1UZDA 3W7CA 1CZ1A 1K9TA 2D2HA 2NLIA 2X7WA 2E9LA 3CIWA 1TPH1 4QRNA 3U0HA 3RG6A 1XYAA 3AHXA 4LAUA 1DWGM 1UZ4A 3W7OA 1ADOA 1FWFC 3KP0A 1XIEA 1HKVA 3VIPA 3DHPA 5CSSA 2DZXA 3T44A 2J6XA 4L64A 1P7TB 4JIRA 5D30A 4A3HA 3O6CA 4GMEA 2XH7A 1XS2A 4JQ3A 4U10A 3VA8A 4PCTA 3SSJA 1SZGA 1JULA 2PWEA 3QHNA 2ONEA 1EZWA 3LHYA 1EP2A 4S3DA 6XIAA 1UWAA 4GQGA 4XIMA 5U4NA 3B0YA 4F3HA 1U33A 4AWUA 4NZ3A 4L9XA 2IXUA 1C3FA 1G6CA 1QMLA 4AYGA 1BKHA 4PUKA 3VIFA 3MI3A 2EKGA 3O07A 1SFJA 1PV8A 2DVTA 3DGBA 4AIEA 4N4QA 3IIXA 5MF5A 5D9PA 2EEXA 4HT3A 1V3LA 2DDXA 3MB9A 1Q7ZA 2ESCA 4UR7A 3WUBA 1J5TA 1S3TC 4HMNA 4ZO7A 4UFIA 3WQDA 4QAIA 1IXNA 2HPMA 4XKMA 3LBMA 5BOOA 1LT7A 3PG9A 3OBAA 3GZ3A 3TE9A 5A6SA 2C91A 2P5NA 1H7NA 1SPQA 2NSXA 4XVEA 3U2EA 2CNCA 3VNJA 5CLWA 5FL0A 3RPMA 4OUEA 4Z2LA 2IKHA 3Q94A 5JH1A 4IIBA 3F1QA 2R8WA 3LDVA 4O54A 1KGUA 2WM1A 2F38A 3BV4A 4ZB2A 1UKOA 2F2KA 3BW3A 9RUBA 3OJGA 1UWTA 4Z0JA 5DT5A 1DWJM 3QPEA 5HK4A 4QQUA 1SSDA 2PURA 3GXIA 3JVAA 3VGEA 4ILSA 4KIRA 2EQDA 3JU2A 4H7ZA 4B5SA 3NFUA 4JHZA 1S5WA 5KEZA 3W1QA 3UWWA 2HE5A 3A4AA 3BV7A 1CGYA 2KX9A 3FSTA 4EANA 3TLLA 1ZGDA 5HMFA 2OYKA 2PRLA 2J88A 2XG9A 3FAXA 4FNRA 4O52A 4F2TA 4DZHA 5DBUA 1QRQA 3T8QA 2REQA 4A3YA 5A8OA 4XSLA 4ATWA 1V7AA 4Q4PA 2H8XA 4XVDA 3E5PA 3DFOA 2QCDA 2WMHA 4HN4A 1BLIA 1KXQA 2P0IA 3W1MA 4FNTA 1P6WA 4DBSA 2X0HA 3EDJA 3P0WA 4GYJA 4W5UA 1JCJA 2QV5A 1KR0A 5CC6A 1QNSA 4OGZA 3P74A 4JHMA 1GJWA 1VFLA 1HIZA 2WSYA 2VX7A 1YDVA 3UCCA 1L6YA 4QEEA 3NQMA 3A23A 1D9EA 3ITYA 5LHEA 3FNDA 4UQBA 1A5CA 3KFTA 2PD9A 4IWWA 1TRIA 2HXUA 1FWSA 4UFHA 1NF0A 2ZC1A 3G2GA 2CBUA 3G8EA 1HGYA 4LUJA 2QUNA 4U3AA 7ENLA 3R10A 5LSMA 3M9YA 1XBXA 4PUUA 4CN6A 1DJQA 3WIJA 2DVXA 3TJIA 3B04A 1MI3A 3W29A 1IEQA 3IS4A 1TA3B 2C16A 2OYMA 4B15A 3H55A 1EX5A 4PMUA 5D02A 3UVIA 3F7JA 2ISVA 4MNJA 1OFOA 2X7VA 3MCNA 3VNYA 4IGHA 3NIYA 2Y88A 3WD2A 1ML1A 5G4EA 2E09A 2E6DA 3ALFA 3E38A 3BMXA 1XDJA 1Z3NA 4OBTA 3SJ3A 4WKHA 2VEIA 3MHFA 3PP7A 2CCRA 3GR7A 1ME8A 2G4FA 3IJ8A 4TU1A 3OZPA 5LGZA 3TC6A 2HK0A 2J47A 4KWSA 1R2TA 3G1HA 4CNPA 4IGNA 3N2OA 1FQ0A 3WNLA 1XBZA 1TV7A 5REQA 1ZAHA 5C71A 3NZ1A 2BOGX 4J3WA 3USBA 2OFJA 1LWHA 1RP8A 3IJLA 4AXKA 1V03A 3DG7A 3SUSA 3GKAA 3N4AA 1UC4A 2CITA 1Q4NX 4HMCA 4IT1A 1QPRA 2C19A 1UPPA 5I0DA 1V0LA 3G8RA 3L2LA 4JIHA 2X2GA 1AJ2A 2EXOA 3AJ7A 1DTUA 1A3WA 5DMMA 1FFRA 1B9BA 1Z41A 1EOMA 1G7VA 3W0KA 3R8RA 4Q4KA 3GH4A 2YJQA 3ABXA 3T2QA 3RDKA 1R2SA 4NYUA 3GW3A 1JRCA 4PGLA 1ZUAX 1MQQA 1JI2A 4RE0A 1VS1A 5I24A 3TA6A 3W1AA 1XC4A 3LRMA 1UMLA 4YVXA 1H41A 3L68A 3H26A 3NQEA 5ECUA 2FLIA 3S5NA 2FJUB 4IFKA 1AH3A 1XLEA 1FDZA 4CQAA 1WDPA 4PE8A 5D9MA 1P43A 1VEMA 3MP5A 4LSBA 4JCMA 1X8CA 3R5EA 2V67A 1GUVA 2DSKA 4GLEA 2CLOA 2G4JA 3FHQA 5GNYA 3W7KA 3W85A 1NOFA 1KO0A 3DHFA 4PEKA 3BAXA 3URNA 3DERA 4K68A 3CWOX 5C2CA 7TAAA 4X9YA 1YTDA 1UOKA 2XDFA 4GI4A 4YTUA 4ERAA 1LG1A 2H3BA 3W7RA 3OLGA 4DZ5A 3GFXA 3WLTA 2DH2A 3C2EA 3PUEA 1E6PA 4YCOA 6CGTA 5D2VA 2WCAA 5C9WA 3NDZA 1TIWA 3AWNA 4LVAA 1NFBA 3VCRA 1ZBVA 3W74A 8CGTA 4A6GA 4NILA 4INFA 1QWKA 4AY1A 1KRAC 1R85A 4NZ5A 3W01A 2PDKA 3DN5A 1I2NA 4KESA 3AS0A 5D2XA 1CXFA 5CZJA 1LLZA 1GKRA 3N2XA 2CWXA 3O16A 3B0PA 2C8NA 4C5YA 3QR1A 3AZSA 3QQWA 3R25A 4JTUA 3LS9A 2VVNA 3BJSA 5FCZA 3NZRA 1FOBA 4P5UA 4DPPA 1SZEA 1H5VA 1IEWA 4B2DA 4EOUA 1K9DA 2QGYA 1C8YA 1FBAA 1XIJA 5A8MA 4QG6A 3NDYA 2VWTA 1V8EA 1HF6A 3NG3A 3ZVHA 3A3XA 5CSYA 4YWIA 4LS2A 1F3EA 4ZA0A 4TTGA 3AMDA 1Z7AA 2P10A 3N11A 5GQBA 4PMNA 3ONCA 3RM8A 1FWBC 3GVWA 5HWNA 1CNVA 4YTSA 2P1FA 4S2BA 1O94A 4ZO8A 2DUZA 4MY1A 1FVPA 4MNKA 1GOXA 1IGWA 4MLRA 1Q7QA 3JR2A 1F07A 1POJA 1TYGA 2ALRA 4YTQA 1K8CA 4ASTA 3CJPA 3M0YA 3T78A 7CGTA 5EMLA 4FNSA 1VHCA 4Y7EA 3R0KA 1EJTC 1RY0A 1YHTA 3TROA 2NUXA 2ZUWA 4GHRA 5CCZA 4H6KA 4GYKA 1PCKA 2J8TA 4D6FA 4E8DA 1KM4A 3BLPX 3NQFA 4PN2A 3VKKA 3SRFA 2VRQA 3AXXA 3FXYA 4UR9A 5JU6A 2XM2A 1TVLA 2PSNA 3M6DA 2QAPA 1PYFA 3P6LA 2XZ9A 2OO6A 1VC4A 3M5ZA 3TH6A 4GXMA 3V4BA 2OELA 2AKMA 3PPHA 3H54A 4HZ8A 4TMBA 3THCA 4FIRA 1D3HA 2X1RA 4PMOA 1DXFA 1CXKA 4IG2B 1H7XA 1SO6A 4N42A 4PTMA 2VRJA 5JUVA 4IJRA 4GK8A 3TQ0A 1ZCCA 3BANA 2OZTA 4R7JA 1TRDA 4N9DA 3W3OA 1DPMA 1DEDA 1GZ1A 1YW1A 3VM7A 5G4HC 4L4PA 4BF5A 4HYWA 3TYBA 4UTHA 5U7SA 4IQEA 2OGYA 1MZHA 3N2MA 3LXCA 4JTDA 2I16A 3PPFA 3P8IA 4XBJA 2GDVA 1EXPA 3VPLA 2WMFA 1MUCA 2ZUMA 1F3WA 3N6HA 2JKPA 3P7YA 1B3VA 3GHRA 3W7MA 4GXWA 4K6AA 2OODA 1XUUA 1G4PA 1OGGA 3U9IA 1RPKA 3T07A 2QJNA 3PG8A 7A3HA 2YLAA 5MHBA 2YCLA 2O92A 1GG0A 4Y9MA 4P8WA 1GYLA 3I7QA 1T8QA 1W31A 2YBTA 3A5VA 3CM4A 1FHVA 2A85A 2P50A 3I7SA 4GFIA 3NOYA 1QOPA 3WMLA 1QASA 1P6BA 3DFYA 1EJVC 4QSFA 4IMEA 1IEXA 1YPIA 3ZOAA 3I65A 1M01A 3VINA 1KBKA 5F4SA 5LIUX 1KW1A 3E74A 1IWBA 4C6FA 3TP4A 5KSWA 2ZUUA 1KM2A 1GT8A 1NSJA 1VR6A 4YVVA 1PYMA 4HHPA 2GJXA 2PGFA 4XAZA 4DUXA 4AFYA 1BEUA 4NZ4A 4M7SA 1YDNA 4EXQA 4QG9A 1JGMA 1ZHAA 4KFNA 4TVCA 2YXGA 1AUSL 2PP1A 4GI6A 3MS8A 3INPA 4CCEA 3TC7A 1FWAC 4ZODA 1OIMA 3L5LA 1DP0A 4NU7A 4V1XA 3GIQA 4W87A 1KXTA 2IW0A 1F2JA 2R1LA 4ES4A 2FYMA 3BLOA 3EB4A 4DNMA 1NY1A 3WJYA 4H4IA 2OEKA 3LGEA 1EO5A 4ZOEA 2Z2AA 1IGSA 3QVQA 4NXSA 1F9CA 2GUYA 5HJYA 3EGJA 3G24A 3EXTA 4U2ZA 4YYCA 2V68A 4UTJA 2V3EA 1IWAA 4BZYA 1PIGA 4NF7A 4AD5A 1DL3A 2J66A 3BGGA 2EJ1A 3S2MA 3MWCA 3VIOA 3FA5A 4ZZ9A 3NEVA 3C52A 3PPCA 2CLFA 3GNOA 4MAVA 1R3YA 4EKJA 3B9EA 4J3VA 2GWGA 4LB3A 1K8ZA 4CUCA 5A6MA 4HNNA 3HV9A 5A94A 3H8AA 4NAEA 1UIOA 1IIHA 1XIGA 4D8ZA 3WQPA 4JTKA 4NZCA 4P7OA 3IGUA 1QHZA 3WF0A 1LL6A 1H61A 1RHCA 3EX3A 1UG6A 2Z25A 3UEQA 2GDUA 4NKCA 3W2MA 4J2MA 4F2UA 1Y8BA 1PX3A 3GC2A 1BXBA 4LUYA 1BF6A 3QM3A 2HVOA 4ICMA 2PF0A 1N82A 3MZ2A 3H2AA 1BVNP 3W86A 1SFLA 4RW5A 2WPBA 2PP3A 3PB0A 3TW6A 2HRWA 3WDHA 4GUHA 5LNUA 2QCFA 2GGHA 3TWAA 1OCBA 3TJ4A 4DY1A 3FV9A 1KTNA 1IV8A 2NLYA 1Q7MA 1BTCA 1V08A 5CXPA 4GFSA 4NP7A 3BXWA 1UH3A 2WPGA 3M0HA 1BPLB 5D09A 4TMCA 3GAYA 1ADSA 4REQA 2QULA 2ZRYA 2OLHA 2ACRA 2VGBA 2F61A 3NSXA 4XBKA 2CZDA 4QEHA 1FHUA 4HSNA 3RX4A 2QS8A 2XVLA 3EOSA 2Z26A 2XSAA 5FF2A 1CGXA 1E43A 1KFCA 3N17A 3QBUA 3OA5A 3UFYA 4FI4A 4ZBCA 3M7WA 3F5LA 4ZMGA 3B8WA 1B57A 2NQLA 1F05A 4HYRA 1MW0A 4P7NA 1OYBA 4K1WA 4N6FA 4D8AA 2CC0A 3FJNA 1S5TA 4ORIA 2VX4A 2O9OA 3P3BA 2WNQA 2GOKA 5IFTA 4YIWA 4B3LA 2VR2A 2BGSA 2G3FA 3G6MA 2ZUNA 4L6DA 3QOMA 1G4SA 3M5VA 4E4PA 4H3DA 5EMUA 1MUMA 1VBRA 4HNOA 4JXCA 1S38A 3MVIA 4G1NA 1XBYA 1LBLA 3EAUA 2ATMA 4H04A 2XJ7A 3WQ4A 4RDZA 1PIFA 2QXWA 3NM3A 4PL1A 5FOOA 4MB4A 4K8EA 1YDOA 3HGSA 1UR1A 3PNZA 1PZ0A 2EPNA 3W2KA 2XIMA 4JTQA 4RZBA 4A2RA 3TV8A 4DM2A 4QDMA 5EBUA 2NXHA 5LGXA 1XGZA 1HXJA 3GXPA 3VFLA 1E6ZA 3S8HA 3B97A 1U5HA 2DP3A 4POCA 1OYCA 1WV2A 3PN8A 1B30A 2YZ5A 3UCQA 3PPGA 2O7SA 1W3HA 1H51A 3G1FA 5D4YA 1JUEA 1J0JA 1XSIA 4PSPA 3ABSA 3W38A 4B90A 3FAWA 4HCDA 3DHDA 3FIGA 5CAHA 1GW1A 4WJ8A 2VI0A 4UWMA 5CQ1A 4F0RA 4FZIA 1P4CA 4WD0A 3F4WA 4RDWA 6REQB 3ARSA 1HKMA 1VPYA 4XZWA 1D8WA 4NNAA 4JTTA 1MW3A 3VMOA 3BQ5A 4RPPA 7TIMA 4KGJA 3WQGA 1YXDA 3A22A 2YB1A 1TVNA 4CQ9A 1TWWA 4MF4A 3ZYZA 2D3LA 3LCHA 1WDWA 1OG6A 4A8NA 1M9HA 4KFOA 3HGOA 4FA3A 4H7VA 2WANA 4HA0A 5ABTA 1V0NA 1XYZA 4H8VA 3UGVA 3MTWA 4Q33A 5KZDA 3W7HA 2XVKA 3W72A 3VE7A 3BLFA 2PDGA 3SRHA 2A7PA 2XGBA 2BVDA 1DXEA 1HJSA 3RCMA 1JRBA 2Z6IA 3B8TA 1ME9A 1J4EA 3PBGA 1LLOA 2A7RA 4JPGA 1TV5A 2C7FA 3CL8A 4O17A 1R47A 1HW6A 1KNWA 4NZJA 4MUPA 1JDEA 4Q4MA 4DUWA 3WEOA 3P84A 1XRFA 1TPEA 4NRSA 4LF2A 3V1PA 1UJPA 3BW2A 3WZ0E 3PHAA 3SCSA 3BJTA 2FTYA 1JG9A 2Y63A 2NVAA 2XIOA 2JQXA 4FEZA 1XFCA 1EC7A 2XTKA 4I5XA 3P14A 1NP0A 1OX5A 1DXIA 3R94A 2YBVA 3W1XA 3HOJA 3Q58A 1E0XA 1D8CA 3GIPA 2PODA 3NZQA 2QJHA 1BSIA 1PB0A 4CVUA 4NZFA 1UW9A 4JTSA 3EWWA 4L4LA 1W17A 3SCTA 5IFPA 2OKOA 1BGGA 3CAWA 1KLZA 3E0FA 2VEGA 3IACA 2OCZA 3WEMA 1VIWA 2QMKA 4R3UA 3T81A 2Y5EA 3VUPA 2F2HA 2J24A 4A3UA 2Z28A 3BSMA 1TWZA 2YDAA 2R91A 5AC7A 1EJWC 1VF8A 2ZA2A 3LZ5A 3RUBL 1RJQA 5ABGA 2PU1A 3CV7A 1FDJA 5A1AA 3RXZA 3VIJA 5ABFB 4DN1A 4UFKA 4HA4A 4A29A 5TF0A 3S1UA 5D03A 2VEMA 4RNFA 4ZEPA 3FCPA 1C8XA 1R7AA 3NTYA 3L4YA 3QEZA 1QBBA 1CW2A 3N12A 5M17A 1HKWA 1O5QA 1AZ1A 1KGXA 4WIWA 4NX0A 2BODX 1F8IA 2G3JA 1EBHA 5C9UA 3CYVA 4QM1A 3UP8A 3LOTA 2OJPA 3Q45A 1Z9AA 1XG4A 2PEVA 1U5VA 3SY5A 4CN1A 3F2BA 1SZFA 2OVLA 2VGGA 2WYSA 4LAZA 1RV8A 4CQ8A 4XKYA 2R1PA 3MUY1 3QV7A 4CU6A 5BNKA 1PWMA 1ICQA 3WNKA 1NDVA 3CC1A 2PDIA 2OG9A 4UTUA 3EMCA 4X61A 5F2GA 3OO2A 1XCFA 1UA7A 2J7GA 2OQYA 4IM4A 4O1DA 5AVHA 2XFFA 2I9UA 3G0SA 3LENA 3V5FA 2V2HA 3VOJA 2XPKA 2INFA 2FH8A 1US3A 5BRPA 3HV8A 5B80A 1S5MA 1TSIA 4FNPA 2QCCA 2PTDA 1WXYA 4WSKA 1V93A 3W81A 4ZB0A 5L9FA 2AAAA 4ZQMA 2VFFA 3F5KA 4Q32A 5LNWA 2QDDA 5E0CA 2HZGA 2V5JA 2IQTA 3I7RA 3T8LA 2WHJA 1W1YA 5EL1A 2ON3A 2BASA 1H7OA 2Z29A 4PBEA 1JZ4A 1WDQA 1VGAA 4K2SA 4URIA 4JDBA 1W9XA 4U33A 2YFOA 2E8YA 3QKEA 1CIUA 4DJDD 1VJSA 2Z00A 3ZT7A 4PUJA 1MEHA 3O1NA 4ZOCA 2QJIA 1ONWA 5HR7A 3FHAA 1XLFA 4A05A 3W22A 5BCAA 5A69A 3F03K 1I2RA 2ICSA 3VM5A 4XZBA 5AC8A 1XLAA 1AH4A 2VVSA 4LBSA 2PWDA 4Q8MA 3TN5A 1EEXA 3JS3A 3TDFA 4WDUA 3XISA 1W9VA 3UG5A 3O15A 4K37A 3K5XA 2OXNA 3TJXA 2ZKMX 4XD3A 3VTRA 1J9YA 2DJXA 3G1SA 9CGTA 3TCEA 3HPXA 2W92A 2CLPA 2W9MA 1F3XA 2OMAA 3CIXA 1ISXA 3A9BA 4CD5A 4DO7A 4PUNA 3EKZA 4PFMA 1EDTA 4IPNB 1NJJA 4UTFA 3M0ZA 3C2RA 3ARVA 4CKQA 2VEFA 3TFXA 4I9AA 3R6IA 1XJBA 1OCNA 5J8LA 2PWVA 2YLLA 2O56A 1W56A 2CXEA 4KWVA 3GU9A 4XSMA 3SECA 3WH5A 3M5XA 1OY0A 2ZUSA 1TX2A 2WO5A 1VFFA 1V3JA 3WFZA 1UUQA 2W62A 1GVFA 3O9NA 5D9OA 3T40A 2AOSA 1QU4A 1AFSA 1Y5VA 3ITOA 3THQA 3CAVA 3UY8A 3UERA 2DSUA 5C7VA 2G0WA 3GG1A 1FP8A 2CIPA 3P5YA 4DI9A 4EX4A 4B92A 2WQDA 1HJWA 2PWHA 2G3NA 1UBSA 2BS9A 1RD5A 3HG3A 1TJRA 3RRAA 3UWQA 3W27A 3HA1A 2C79A 3WLRA 3SCNA 1B2YA 2NX3A 3WQFA 1GONA 2ZZ7A 3CUJA 4GUFA 1M04A 3W37A 1V6VA 5LKYA 1R2RA 2QW5A 2OSWA 2VCAA 4KERA 3CV6A 2Q09A 4LY8A 2Z24A 2OYLA 4D6DA 2A7NA 1CYGA 3NL5A 2QCDB 1J96A 3AC0A 5A6KA 2V5KA 2QDEA 3DIPA 4AZCA 5HNNA 3EBVA 3PWIA 1IXOA 2ZE0A 5FF3A 4M24A 1CXIA 1XP3A 2E6YA 2C1HA 1KBBA 4AVOA 1QCWA 2PU0A 2VZSA 3LBOA 4X60A 4PTWA 2BZNA 2FZNA 2YW3A 3MUIA 3APTA 4PBFA 2PBOA 4I8DA 3SRKA 3GZAA 4UXDA 1SGJA 5HPCA 3VDBA 4R27A 2DZTA 3BAYA 2G97A 2CPUA 2QUVA 4Q7IA 4YYFA 4MB5A 3TK7A 3V1HA 1PPIA 5C6MA 5DY3A 4WEVX 3ZJKA 3MI6A 4A22A 4LF1A 4KEUA 1PXGA 5FL1A 3DX5A 3GDKA 1DTNA 3I6RA 2VMFA 5EB8A 3AISA 3GB6A 3WQVA 4KEVA 4AW7A 2Y7GA 4ZFMA 4JFUA 4N02A 1PWLA 3KBVA 4DUVA 2J27A 4RNHA 3IGSA 1IQ8A 5ABFA 1KCLA 4AEOA 5BW6A 3EPOA 1NTHA 4W9TA 5LNSA 1L8PA 1VPQA 5HDRA 3TQVA 4H41A 1WBJA 4PCNA 2HBXA 2Z1BA 3TCSA 1NWRA 3IK2A 3L0KA 3DG6A 1TJ2A 3CT7A 4DEFA 4MWAA 4KGLA 2VUNA 5D32A 4O0ZA 2D73A 3PB2A 3TIMA 1H49A 4HSOA 1MSSA 3IV3A 2I56A 3UYIA 2H90A 1WXJA 3U5UA 2J9YA 4XZNX 2RDWA 3IVSA 5KZEA 3CYJA 3AS1A 1XLHA 5I78A 4M80A 5DQPA 5CLTA 5F7UA 1ZS2A 3F4DA 2OPJA 3TAOA 4FX8A 4H6RA 4MKSA 3FDKA 4I6VA 3S9IA 1OC7A 4O19A 3QFWA 3ITXA 2WZEA 3NPXA 3CV2A 3UXDA 3GBEA 5C9ZA 4O1BA 3WKZA 1C90A 3MBDA 3ZVIA 4C60A 4TX6A 4MWAC 1XBVA 1NFGA 3E02A 3ZO9A 1TR1A 1I60A 4R7WA 3SIZA 1HTIA 4GCXA 1VLIA 1UH2A 4RV8A 2VXNA 1ZNNA 2DT0A 2Z1VA 4PODA 5J04A 4GBUA 3LHZA 2CU0A 4M8UA 3RMJA 1W5QA 4UTWC 4Y9PA 4B2DD 4UIOA 3AIQA 3QY7A 1PO9A 4FNUA 2VHLA 1K3UA 3WD0A 1W37A 4D9PA 2C1IA 1OVDA 1UUMA 2I5IA 4K36A 4U3CA 3M0IA 3W2JA 2HISA 3WY1A 4XB3A 1GVQA 4JL2A 1B4KA 2QGHA 2ZQ0A 4UQCA 1S39A 3II1A 1EA0A 2V3GA 1BWKA 4LWWA 1SJAA 3OGSA 1J11A 1X1OA 1B90A 4K39A 1V3MA 5DMNA 2VGFA 3BPWA 3TA9A 3GH7A 2RKXA 1E9YB 4DWSC 2E6FA 4AC7C 4AU0A 1XQKA 2WMIB 4L80A 1XDMA 1TMHA 3MYPA 3BLKA 1HP5A 1ISWA 2YZRA 3U4FA 4GIAA 3THUA 3SQLA 3VU2A 5F2LA 1F6YA 4N2YA 4MB3A 4M5PA 3V36A 5F1VA 3GK0A 4DZIA 3W23A 4AD1A 4H9VA 1FHDA 3NZPA 3CHVA 3UU0A 2YCJA 4CQDA 3D46A 1W5OA 5KINA 3PWGA 4W8BA 4DJFD 1VJIA 4UQAA 2HMCA 4B5NA 1JCLA 4A35A 2J77A 1W2VA 4HSHA 4MKVA 4GKTA 1Q63A 4KQNA 1TTJA 3W1NA 3ARZA 5K4XA 1EIBA 1G67A 1MXGA 1NDWA 2WB5A 1JDFA 3N4EA 3CWHA 4G7EA 3TU9A 3CL6A 1TCDA 4W8LA 1YBQA 1R0MA 2DIKA 3ITTA 1LYXA 4E8GA 3S2NA 3CB8A 1KFBA 3SBFA 1RK5A 3HQOA 1P0NA 4XD6A 1ZBKA 3VOHA 3HBLA 4ZSTA 3OW1A 1YYAA 1FWCC 6TIMA 3G1RA 4HBKA 2H6RA 3VKAA 1H1ZA 2GZXA 3H2FA 4AZHA 4GGBA 3WF2A 1XXXA 3WNNA 4GKLA 3O63A 4AWSA 1XUZA 2OX1A 1QW7A 5EKYA 3BLEA 2Y4SA 2WJFA 4MJZA 1DIOA 2VD8A 2VOTA 3BSGA 1G1YA 4W5ZA 3PUDA 3RO6A 3KRUA 4LEQA 3UXKA 3W75A 3GQYA 3WJZA 4TQTA 1XQLA 1ISYA 2RDTA 4E3VA 1F8MA 2G50A 3DFPA 5CC7A 4N9BA 2QLYA 1Q66A 1W3JA 1XD0A 4TR9A 2E68A 2O9TA 1TWDA 3ARUA 3H6OA 3W53A 1YNPA 5IBXC 1XM3A 4LNYA 4YHGA 3KTXA 5HUPA 2FDMA 1WKEA 1ZCOA 1NF7A 4FLRA 4JEJA 1QPKA 1GKPA 3M0LA 5BRQA 4ORMA 3T0AA 1QOXA 4EAYA 1UPMB 4V28A 5CPQA 4C7GA 4AHOA 2CKSA 1JEZA 3K8MA 4WXZA 3GYEA 4HPGA 5HWJA 1YXCA 4PUWA 5E70A 3MJYA 4UZSA 1J2BA 1XLKA 4O8RA 5T91A 4E2VA 5LIWX 1O5KA 3M16A 5XIAA 2PFHA 3QTGA 4GOAA 5D2TA 3WDIA 3RYSA 4ZQPA 5I23A 4XZIA 2VC7A 3O06A 2CLMA 1DYSA 4EK7A 4AF0B 4IICA 2XWDA 1KFWA 1GZJA 4UUIA 4HTYA 4AY7A 3B9NA 3ZJ7A 5JBFA 1VFTA 3MV01 4C6BA 3IIOA 5I3HA 4IIFA 2D0GA 2AMXA 1E1EA 3CBWA 3GNXA 2JE8A 4AISA 4D6GA 1B9ZA 1GQIA 5DO8A 1CLKA 4IMAA 4AH7A 4TO8A 2XVGA 4JQ4A 4AHPA 1R46A 4JN8A 3TYDA 3FW6A 3M5YA 2J8GA 5CC3A 5M2FX 1DJYA 1H4PA 2PUZA 4HOWA 1W1VA 7ODCA 4TTUA 3ZWSA 1V0MA 2PBGA 1Q8AA 1DJGA 4F40A 3A4XA 3LNPA 4OJYA 5CZ0A 4LU0A 2BGNE 2KAUC 4O1FA 2A2IA 4WF7A 3A21A 1VZWA 3FA3A 1OK4A 2PLJA 4LV4A 4DWDA 4IIHA 3KZSA 5A95A 2AL2A 4MIMA 4F0HA 4WQ6A 2INEA 3ATZA 1S46A 5CJ5A 2D0FA 3LGGA 2Q3OA 3E0LA 2YBUA 5FJJA 3FKRA 2FZ8A 1RK6A 1W0MA 5I3IA 4LTSA 4Q6JA 1O5XA 2B7PA 1V6WA 1U1JA 3AIUA 4P8UA 1I45A 1NWTA 1PUDA 1ZJIA 4EAMA 4AEEA 4D6HA 2OTDA 2B0MA 3GE7A 4CD8A 1C93A 2HBVA 5I3GA 3GC4A 1XV8A 3CNYA 2DIEA 3LX9A 3NSMA 3ORWA 3SFKA 3ZM8A 1TUXA 3H7UA 3R89A 3SN1A 1G4TA 5G4WA 4A3RA 5I09A 1AVAA 1CXHA 3EPNA 5FSEC 5CGQA 2YR1A 1EPVA 4FALA 3EXRA 1FWWA 4JTLA 4HZMA 2VOMA 1AA1B 3N2TA 3TKFA 2PWFA 3A4WA 3LLFA 1EA9C 3ALGA 3AOFA 2QZRA 1MZRA 3WD4A 4EVZA 4QLLA 3DU0A 1JDAA 3T42A 2PDCA 5KITA 2HTMA 4IQLA 3W83A 4GVGA 4BCEA 2FMOA 3G3DA 1MMFA 2HNHA 4UR8A 2X41A 3PM6A 3UZ5A 3SR7A 4WZHA 4XAYA 4C6PA 3LY0A 1XLGA 5L6UA 5K4ZA 1VBHA 1UMYA 3NXLA 3C3UA 1K9EA 2B81A 3MJMA 3LU2A 2A3BA 2BHZA 2AQWA 3N4FA 3VD9A 4R7OA 2JBMA 4I3GA 2PDXA 3N3MA 4LW7A 4J9JA 4RE4A 2D3NA 1Q65A 3ZWTA 1YEYA 3LXBA 2FZDA 1E4IA 3AZRA 1L9WA 3WMBA 5CG0A 4KWWA 4Y8FA 1HFBA 2CESA 2E28A 3AHVA 1XYMA 4J3SA 1E6RA 1BWLA 3SY8A 3WCZA 1B31A 5FJPA 2FTWA 4L65A 4GY1A 4MB1A 1VB9A 3M0XA 1SJBA 3G18A 1FH7A 4MLJA 5D38A 3BAKA 4IGMA 3MMUA 4FO4A 4JGDA 4MMWA 4BWLA 3WYZA 1ZQ5A 3QY8A 2OT0A 1KCKA 1E73M 1TPFA 1QK2A 3K30A 4YS1A 3MBFA 1BAGA 4IZGA 3QLLA 1ISVA 1PHQA 3FKKA 3HPAA 4P2VA 1BQCA 2I14A 1UD3A 3MHUA 3CT2A 3IGXA 2R6OA 2Q02A 5AYBA 2PDFA 2UWFA 4DELA 1LZOA 1ODUA 1J2WA 3V5CA 1AQMA 3NYDA 4JIPA 4Q8OA 5FKYA 2X1IA 2EF9A 3C6CA 1MEIA 1FWIC 3E96A 3TSDA 3SURA 1D3CA 3VMNA 5LIYX 4MPQA 3A5FA 3S83A 1CGUA 4QROA 3NQCA 1Q4WA 3RITA 3GTNA 4FXSA 1WDRA 4C6JA 4N9CA 4XUGA 2ZUVA 2RGMA 1SJDA 1O1HA 3BAJA 3LA4A 1EDQA 3Q67A 3GDRA 4FXJA 1PKYA 4DI8A 3N18A 1M65A 1JFXA 2GGGA 6PTDA 1XLIA 3BTNA 3T4WA 4NJKA 1WBHA 5CZKA 2VR4A 2TRSA 4GUIA 2J74A 4DBUA 4O50A 3CMJA 3WENA 3O6DA 4Q8TA 4WKAA 1CI1A 4Q8NA 1JCYA 3NO3A 4O12A 9XIMA 4HPJA 4JKMA 4GY0A 1E0WA 4LYPA 1CEOA 3W71A 5FJRA 1UROA 4IIEA 1UP3A 2WWDA 4MYXA 1WXZA 4NX5A 4JNZA 1JR1A 4CNOA 4H8UA 1CX9A 3PTMA 2PF8A 4PTVA 3AXKA 3CZLA 1FKWA 3JZUA 1EQCA 3AS2A 1VRXA 2GPTA 3CUXA 4Z2GA 2E9BA 1XYLA 2F6KA 3BG5A 3U6WA 1MUWA 2ZRWA 3GIYA 4KEMA 3EWXA 4KWUA 1W8GA 5AHEA 3OYZA 3P62A 3M0JA 2V5BA 4H00A 3IJDA 4GO9A 4XG1A 3I3DA 1I1XA 4HPXA 4LS0A 4JTJA 1X98A 2ZXDA 4G7FA 3HURA 1K9FA 1EJSC 1LUCA 3S5SA 1W1A1 3DI1A 2C13A 1KFLA 4GIEA 3UJRA 1S2UA 2Y8KA 2YCIX 1OFDA 3AMKA 4U5IA 4WVXA 3CLMA 5ENLA 1VENA 1JYWA 4FP1A 2NUYA 3AMGA 1PZ1A 3DCPA 3J7HA 2PA6A 1GQJA 1PKNA 4DBEA 5EMKA 1VCGA 1PKMA 4ADUA 3FGCA 2PLMA 5G1YA 3T55A 4UNKA 4C6KA 5A6BD 2ZX9A 3TNOA 3DYMA 2FQIA 4PULA 4JR5A 5CH9A 3AIVA 3P82A 1F74A 3VO0A 3SN0A 1PS9A 1RAKA 4IX0A 4MM1A 4S3FA 4O0KA 4DYEA 4G2DA 3AQUA 3LCXA 5AFDA 1WCGA 2WBKA 5KZMA 3VKDA 5K3VA 3ENLA 3SFWA 1TZ7A 1JVNA 4HCLA 3MVTA 4LBRA 1N7KA 3KWXA 5AB3A 4FMVA 3MMDA 4AVFA 2CLKA 4L5ZA 4BQ3A 4DWSB 3CUZA 3BMVA 3FN9A 1OZQA 3S6TA 2Q3RA 1GJPA 1AMKA 3BLDA 5HATA 4A8LA 4JEQA 5G2WA 2WOQA 2NSOA 1FCQA 2QMJA 1NVMA 4C6IA 3W28A 2ZDRA 2Y5JA 4C6CA 1SQ7A 4DJEA 1E4LA 2TMDA 1W6TA 4L1GA 1GYMA 1FXQA 1RJRA 5JVLA 1E9LA 4LVDA 4JOMA 2Q01A 1XW8A 3IV8A 5LA0A 4O14A 1NWSA 4DM1A 3VC5A 4JYFA 3CL7A 1XRVA 1EOKA 1TIMA 1A5MC 3TYUA 1ZBWA 1DE6A 3NL2A 1MFUA 4QJ5B 3MKVA 4LUIA 3UZYA 3NL6A 1WE5A 3P61A 3MSGA 2ZDSA 1IEIA 3KLLA 3TN6A 3UR2A 3CK5A 1SO4A 4RR4A 3ABRA 2WZIA 1DE5A 1WX0A 4MWAD 2PDQA 4O8AA 4UFLA 1IF2A 1JUBA 1EGZA 4KT2A 3WH8A 4JL1A 2ABAA 2DT3A 5C9XA 8XIAA 3UPWA 4HP5A 3ARTA 1W9DM 3TTYA 3WQ5A 1VFUA 2IKGA 2ZZ5A 3B9DA 4YN5A 1F76A 1GOOA 1UOZA 4CEUC 2DZSA 2GK1B 2WC4A 4S3BA 2GGJA 3BDKA 3G1VA 3O6AA 3VDHA 2EG7A 1F73A 4WDTA 4G6CA 3W7QA 3HF3A 3T2OA 4DF1A 4HA1A 2QIWA 4MHBA 5LZLA 3GFYA 2NXGA 4HNCA 1TPVA 3SCPA 3P80A 1SZRA 1TREA 3NUKA 2Z1KA 2DPEA 3SCVA 1S3HA 1WKFA 1W9UA 2YPIA 4I7UA 3KS6A 3U3HA 4BR1A 1OFAA 3LHUA 1ZB5A 3H22A 3EX2A 1JCXA 2PC4A 3WFLA 3DXIA 4JICA 5AHMA 4MNMA 2DZBA 4AX7A 3VNDA 3EPMA 2UY3A 4M82A 3LBCA 3TOPA 3L65A 4I6KA 1EUAA 3B8UA 3AIEA 3VILA 2V5DA 2VC5A 1RLDA 5C9RA 2J7EA 3QJAA 1UASA 4JKLA 1W1TA 4XZ9A 4IHCA 1O1ZA 3URAA 4FSAA 1ZFJA 1UR2A 4M56A 3QC0A 3REQB 1SYTA 3N14A 1UIPA 2WVUA 1I8JA 1WKDA 1HO1A 2PDUA 4MFDA 3N1AA 2IKJA 3K8LA 3CWNA 3LB0A 3U8GA 3KX6A 4HPHA 3MA8A 5FD0A 3VOGA 2FIQA 3TQKA 3PZ9A 6A3HA 5MKGB 1XICA 1GOKA 4ZVJA 4J3UA 4PYSA 4OVXA 3N2BA 4AMCA 4D8LA 5IRPA 2BMBA 3OIXA 2BG5A 3S9ZA 3B0XA 1L2QA 5DF0A 3BVJA 4E4UA 4Q4RA 3RILA 2VM8A 1EH9A 4X2PA 2V5CA 3VD4A 5JIWA 3ZR4A 3FYOA 4ZO6A 1K4HA 1OT1A 1RA0A 3L0NA 1ZBCA 4AG0A 4GVIA 4PCPA 3V3WA 4H9MA 3AXMA 4XO6A 1IEVA 1RUSA 4HYVA 2PTZA 2BWGA 4L4MA 1KRCC 1OD8A 1NIUA 1SU5A 3QTPA 4FS9A 3POCA 1EF2A 2CHOA 2JFEX 5CPNA 4RNJA 2GOUA 4GD0A 3E0VA 4BY3A 3LN3A 2FMNA 3NGJA 5I2UA 2P88A 2P3ZA 5I5RA 3CB3A 5GJPA 3GXMA 4CLMA 1EP1A 3DKJA 3BAIA 4EF9A 1W1B1 4MDPA 3HB9A 5BMWA 1JPIA 3BW4A 4H19A 1X6LA 5LHFA 3W1PA 2NT0A 3L4ZA 4H01A 4P8XA 1YNQA 2X2YA 2XFWA 4Z1DA 2RAGA 2BOFX 4Z08A 3M47A 4TV6A 4ZO9A 3PJTA 3LPGA 1G5AA 1UBPC 4LUSB 2E0PA 1LM1A 1RQEA 5FF7A 3BGJA 1UKPA 3E12A 3GXNA 4CNNA 2Y89A 1NOUA 1W1IE 3RPTA 2DQXA 1FCBA 1CB7B 2X0YA 3EYPA 4RL3A 5A8NA 1C92A 1E71M 1A5NC 2HPIA 4AY8A 3OP2A 5EY5A 2OLSA 2MUCA 2WKJA 3DI0A 3MP4A 3QFEA 3ZXWA 1EYWA 3OGVA 4I8YA 2G41A 4H9TA 3W24A 3EOUA 2XHYA 3WJSA 3CMFA 1XDLA 1HQTA 1EJXC 3CIVA 4OFCA 4J3ZA 1KB3A 2D2GA 2YA0A 1GG1A 1IHIA 3MKCA 4B3ZA 3NQDA 1DQWA 1LORA 5IDIA 4DIAA 4ZB5A 3UY7A 4W7VA 4N0RA 4D1JA 3VZXA 1IZJA 3N15A 1GVYA 4PMDA 1W8SA 5F1UA 3UQNA 4AC1X 4DX3A 1ZALA 3PTKA 4HOXA 2PAJA 2EPMX 4HGXA 2CLLA 1MDLA 4NXKA 1RJPA 1DWFM 1Z89A 3SCQA 1GNXA 4OECA 2H9AA 3SQSA 5HR6A 1CT5A 3GY1A 4JNMA 5CEWA 1GEQA 4JN7A 3S2CA 5D05A 3PTQA 2V82A 4E2BA 3TW7A 2CBIA 1GVIA 2NZLA 4IH3A 4MG4A 3KDOA 1KRBC 2CBVA 4Z17A 3VD3A 4QAWA 2L5HA 4NIRA 2ZBTA 4K7VA 1H7WA 1JJKA 4YHEA 1E4NA 2Z1XA 5ABHA 3H4XA 5FJTA 3T08A 3UWVA 1QDSA 2LLEA 2BHUA 2ZOXA 1DIKA 3E0IA 3C2OA 1FH8A 1TUFA 2ZRVA 1SR0A 1SR9A 3H2EA 2ATSA 1SMAA 5AVNA 5DRCA 2JIWA 1E6NA 2I5GA 1V7YA 5ABEA 4H8HA 4NUWA 2WQPA 2Z27A 2X8RA 1CECA 5EYWA 4JS3A 3ECQA 3VI2A 3ELFA 4W85A 2BBFA 4QCFA 1J8VA 4A4AA 1NEYA 3GHSA 4B4FA 4GVFA 2XIQA 1J12A 1XI3A 1W3NA 2YA1A 3TC3A 3IARA 5HQMA 2IS7A 2Q8ZA 2VZTA 4L6HA 1IZCA 3N19B 4F0KA 4M6VA 2WMJA 4FX7A 4RK8A 5DANA 3AMLA 3VE9A 4HB7A 2ZADA 4ZQNA 1TMLA 3KOFA 3ZLHA 4US5D 3U4AA 2UY5A 3N9KA 5D33A 1BYAA 1E1CB 3QPZA 1FDYA 4H9XA 4O57A 4ECLA 3NO1A 4AD3A 2HVNA 1VFHA 1GVSA 3EEGA 3DESA 1RVKA 3NJ3A 4B16A 3F4NA 4JYEA 3R1ZA 4IPIA 4FB7A 1GHSA 4K7YA 4JKKA 3C0LA 4DF2A 2Q6ZA 3WSUA 2J9XA 3DOPA 4X0NA 1LQ2A 5CJMA 4RDVA 5FEWA 2BGQA 4JTEA 2O4QA 5FIPA 4H9ZA 3K1GA 2VL4A 5I79A 3H70A 2WWCA 2VQTA 3WQCA 4EWJA 3ZZ1A 4IPPA 4V15A 3PUOA 3WG6A 3HGJA 3WDQA 4YPJA 3HMCA 1OFQA 3HPZA 3GDLA 3BARA 4L9ZA 2OT1A 4B9ZA 2CBJA 3QRHA 4PTNA 3QSRA 4HK5A 3MT1A 3QMSA 3OZYA 2JKAA 1ZRQA 4NY2A 3ZR6A 4ONVA 1MQRA 3KTCA 3W1TA 3MCMA 1K7FA 1JD9A 1FUYA 4BKNA 3VOCA 5E0KA 6TAAA 2JF6A 1V51A 2VFIA 4HOZA 4S38A 1NFPA 1X97A 4NNCA 1XPGA 3L4XA 1US2A 3M0MA 4S3AA 3M41A 4W7WA 5FJIA 1YIXA 3ERPA 3LTPA 2I1OA 3B0VC 1OX6A 3THDA 2JGYA 4HMEA 2FJKA 1YBQB 2DZWA 2DZUA 5CAKA 5HMSA 3SCRA 1MQPA 1ECEA 2GUUA 4ZCWA 4LFYA 4C6OA 1HJQA 1LWJA 3WF3A 3UJ2A 3ABOA 4WKFA 4V33A 3ZVHB 2WKGA 5CBIA 3VIKA 1HN1A 1UR8A 2X30A 3PBMA 4XD5A 3S1VA 2PDJA 1ITUA 3UXLA 1YLVA 3STPA 4U5KA 3E1F1 3OU8A 5EA9A 3KOZA 3PZVA 5M1TA 3T0BA 4UZUA 1S2VA 3LNMA 2NQ5A 5JBDA 4DO4A 2FKPA 3I10A 5AYZA 2FZ9A 2PI6A 3ITCA 2QR6A 4UQDA 1T7LA 2W6RA 5FEXA 3CAKA 1ISZA 3B9AA 4GNKB 2J9ZA 3BG3A 2VEKA 5CSRA 4GXPA 2Y62A 2YCLB 4C6NA 4W88A 1RA5A 5CPMA 3UT0A 1G94A 4LVBA 1V02E 3UESA 4ZSUA 3DC8A 2A6LA 3H53A 4LJ3A 3ZJ6A 4C65A 2YOCA 4OBRA 4A8IA 4JFWA 2WVSA 4QNEA 4U2YA 2RUSA 4GRSA 1DWHM 5J5DA 1JPKA 6ENLA 3L5AA 3WQOA 5JBEA 1R38A 3URBA 2OO0A 2ZZ1A 3S1GA 1NDZA 1VBUA 3F4CA 3S6OA 3E2SA 1A50A 5DCDA 1C7TA 2ZX7A 2PRHA 1MNZA 3S2JA 1D7FA 4QBXA 3K4WA 3AIRA 4JFTA 3HG5A 3ARQA 5EBAA 3QYQA 1SFSA 4FPSA 5TD4A 3PY2A 2IXVA 3MYOA 4I9JA 1W9PA 1TQXA 3KBNA 3C56A 2RDUA 1ME7A 3SO7A 3AYRA 1GKQA 4I90A 2PMQA 2Z6JA 5HXMA 4PC8A 1CDGA 3EX4A 1YDYA 4HU0A 2VZVA 4REQB 4FIQA 4B9YA 3BE7A 4HNUA 4DJDA 1SMDA 1FWTA 3FOKA 4M6PA 3P8JA 4GWEA 4UCFA 1OX4B 2GUBA 1LRNA 5E09A 1E9ZB 1FWHC 4LANA