4K7VA

Oye1-w116a complexed with (r)-carvone
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLAVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 149
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4k7vA00
1SZEA 3PB0A 1W31A 4AHQA 3EWYA 4MY9A 3QZEA 4PCFA 1NSJA 4UTMA 3N34A 2Q3RA 4TR9A 4U28A 4JTLA 5HQEA 1SO4A 4QSHA 4O11A 4IUOA 3WJSA 1TPWA 1LBFA 4O4VA 1HO4A 1G4PA 3TAKA 2WNZA 4FHAA 3BV4A 4NT0A 5G4WA 3MP4A 1KM5A 2Y85A 3M7WA 3PC0A 1T0OA 1Q6RA 3E9AA 1ZY9A 4O15A 3LXBA 4DF2A 5AC7A 4ADSA 1KTCA 4NZJA 1WBHA 1LBLA 1SU5A 3DU0A 3DENA 3M1ZA 4IMFA 1TPFA 1W5OA 1G7UA 2V9DA 3TC6A 3DKLA 3FFSA 3JRKA 3T78A 3W2UA 3BO9A 2A21A 2A0NA 2NZLA 3OVRA 3EWXA 3L0KA 4NQ1A 1SZGA 2RFGA 3FJLA 1RZMA 4BWLA 4JD4A 4WJEA 1UUMA 4JYFA 4UTWC 3S42A 4LNYA 3HG2A 4A22A 3W7GA 1VLIA 1NAL1 5BW6A 4MJMA 1QO5A 1TTPA 2G97A 3PAJA 4LVFA 3TCEA 1O5XA 1JCXA 3TUUA 1RVGA 3UWYA 5IBXA 1OK4A 3KVJA 3EXSA 4N02A 1K8ZA 4XQ6A 2W0UA 4X22A 2I14A 4JY8A 5F4XA 2ZDRA 1YYAA 2J88A 3LBMA 3P82A 1CW2A 4IX2A 2X1TA 4AWTA 5CZTA 5MHBA 4UFJA 3MP5A 5FF0A 1X6UA 1KFBA 1J2WA 3DGRA 1MZHA 2WSRA 3LHZA 4C1KA 3BG9A 2VEKA 3FIGA 5A5WA 1P0NA 3R13A 2YZRA 3LHUA 2R94A 1I45A 2GOUA 1OX5A 3V75A 1VR6A 3M41A 5KZDA 3HG4A 2NX3A 3W1XA 1AK5A 3C2RA 4LW7A 1XUZA 3STEA 3DFQA 3QSRA 4LS0A 5DCBA 4QNWA 2GVGA 4WQ6A 3TSDA 2EGZA 5CPMA 2Q8LA 5A8GA 1YXDA 4DO5A 4A21A 4YCOA 3TW7A 1PHQA 3NPVA 4H3DA 1FWSA 4TX9A 5CZJA 3TKFA 1AL7A 3MBDA 3TXZA 3DZ1A 3BW2A 1AW5A 1OJXA 2YYUA 4FEZA 3SECA 4RXFA 1QPQA 3W22A 5LZLA 1H51A 4I7VA 4QM1A 4ZMGA 4JYEA 2A6NA 2G96A 3MUXA 3GVGA 1KM6A 1VHNA 1A53A 4OV9A 5I3KA 4LS1A 1Z48A 1W8SA 2TSYA 1LBMA 2ZZ1A 3A22A 1M7OA 3RNDA 2E5BA 2YW4A 1K7FA 2A1YA 4FX8A 5KINA 5BMXA 4I7WA 1K3UA 2NWSA 4JY9A 3DXIA 3LV5A 2C19A 1A5SA 3BPWA 3EWZA 3NQ7A 1QWGA 3B06A 1F5ZA 2VEPA 2GJNA 5K4ZA 5CG7A 5BNKA 3QW3A 1IXOA 1G7VA 1PHWA 1UUOA 3UZJA 4WD0A 5FEPA 3QMRA 3CT7A 3G3MA 2CLIA 5E0KA 5I3HA 3HO8A 2AAMA 3KRZA 2DJLA 3GR7A 4LUIA 1FBAA 3PS7A 1YLVA 4GUIA 1GEQA 4UTTC 1BWLA 1O5KA 3NPWA 4WY0A 3BLIA 4FNPA 3PBWA 2Y89A 4Y6GA 3LHVA 1B4EA 2FQIA 2NLIA 1X7FA 2E09A 1YTDA 1VQTA 2E6DA 3A5FA 3NOEA 2YFNA 4O1CA 3MW7A 2YDAA 3EWWA 3C4UA 1AL8A 5D04C 5HULA 1XBZA 2J27A 3W70A 4N6EA 4QISA 5K9CA 1TJPA 5FESA 5D03A 2OT0A 1TCDA 1HUVA 5I3GA 4FNRA 5EL1A 2AGKA 1JR1A 3R8RA 2ATSA 3HGRA 3B04A 3B05A 3WK1A 3M43A 3E02A 3VE7A 2FPYA 4E2BA 1RR2A 3QQ0A 2BTMA 1ME9A 1T99A 5G1YA 3W72A 4JXCA 5G2WA 1A5AA 5FEZA 1OX6A 3GX9A 3Q94A 4AF0A 3L67A 3L9CA 4WZHA 3ZWSA 1W5MA 2GVJA 3LRLA 4Z08A 1W54A 2E6YA 2V5LA 3E49A 1LYXA 2BLEA 1FXQA 1LORA 1UCWA 4JDYA 5J5RA 3STFA 1H7NA 2Q8ZA 5EPDA 4PFMA 4BK9A 3LX9A 2E68A 1Q6QA 5E1QA 4ORMA 2Y7FA 3QF0A 5KITA 1LOLA 1TMHA 4JTSA 4MY1A 2Z6JA 4PTNA 3LLDA 2VEMA 1LTDA 4IMGA 1IIGA 2X2GA 2J24A 1I2QA 2ZA2A 1F6KA 1H7OA 1DOSA 3W3OA 2P0OA 4HT3A 2CLHA 3G22A 3CQ0A 5HJLA 4WUIA 3TV8A 1OK6A 1ADOA 5EYWA 3KHJA 3VE9A 3LCWA 1O95A 2ABAA 3JS3A 4QAIA 1TQXA 2KZHA 5EKYA 5F1UA 1PCWA 1LLWA 3B4UA 3CTLA 4PEKA 1Q45A 3TQ0A 1YTEA 1DJQA 3OVQA 1XL9A 3TW6A 1F6PA 5J5DA 4K7VA 1ONRA 1QMLA 1RQEA 1LRTA 2BXVA 4O57A 3UWVA 2B7OA 3VI2A 1FXPA 4Q4KA 5F1VA 1VCGA 2QAFA 3W1UA 2Y88A 1LOQA 2XN0A 3TC7A 3BGGA 1SW7A 3TA6A 5H91A 2ZTKA 4UTKA 3EX4A 2QCNA 4JR5A 3IVUA 4UTIA 1VS1A 4WXYA 5DY3A 1KLZA 5D33A 4GNJA 4CQ8A 1GVRA 1XUUA 2WOQA 3W1MA 1JCJA 4N2YA 2ISWA 4MVAA 2G5WA 3TXVA 1B3OA 3W7IA 4ZQCA 1WOBA 1MSSA 3W7DA 5LNWA 4FNQA 5E93A 5D2YA 4FXRA 3N2MA 1KFLA 4RJEA 3LCIA 3FYPA 5G4EA 5HUPA 4DF1A 5KMYA 3CU2A 1R2RA 1ZHAA 3HG5A 2Y7EA 2A6LA 3U6WA 3ABOA 1LRNA 4KWWA 4A29A 4EWND 1VJIA 4MZ8A 4RX0A 4CLMA 4J9JA 2YCEA 4MLJA 2NXGA 5FF3A 4C1LA 3N3MA 1EWDA 1T96A 1LP6A 3M5ZA 2ZCGA 3NZRA 4LT9A 1WYIA 4JGDA 3A24A 2XN1A 4RZ5A 1L6SA 2B7QA 3WJXA 3OVPA 1M6JA 3W7OA 4LV9A 2Z2UA 3W7LA 1QPRA 3W2KA 3H53A 4FX6M 4QNEA 1GVOA 4JX6A 1DBTA 1HO1A 3N19B 3W1AA 5H2ZA 2ZZ4A 3ELFA 3PSWA 4TMCA 4QIUA 4HIBA 1SUXA 3IIZA 3CIWA 1F2JA 3UPWA 4I7UA 5I3IA 4K8EA 1RD5A 2WPBA 3M6YA 2OX1A 2ZZ2A 4NX5A 1H7XA 3W85A 3CHVA 1QPOA 3NL2A 1TPUA 2WV8A 4MFEA 4JIQA 1GQNA 4GWEA 3ABRA 4OGZA 4QITA 4UFHA 1TTJA 2ZZ3A 3M44A 2NV1A 1CI1A 3LLFA 2A4AA 4IPJA 2FDSA 5C6MA 5D2VA 1P0KA 1KFJA 3W71A 3N73A 2YYTA 1SPQA 2W6RA 4OV4A 1CX9A 3VFLA 1YPIA 4O50A 4DF0A 5K9DA 1FCQA 3QQ1A 4TIMA 1FWWA 5KTLA 3TX9A 4N9BA 2QCFA 2ZA1A 4G1KA 2ZZ6A 1MEWA 2NUXA 1A5BA 5I3FA 2ZA3A 3W2LA 1JUEA 2FJKA 1ZENA 1W3TA 1IGSA 5AHMA 3SJ3A 1TO3A 1PIIA 4XKYA 2QCHA 2G95A 3HJZA 4X2RA 3S5YA 1TTQA 3NZ1A 4ALDA 3TFXA 4IMEA 4UR8A 4PL2A 3W73A 2TRSA 3LERA 2H6RA 4AHOA 1FWNA 4XWUA 4UFKA 5AHNA 4LVBA 1AG1O 2JK2A 4K38A 3HB9A 3W23A 2CW6A 1OFQA 4TO8A 2VENA 5F4SA 1JQVA 5CSSA 1JJKA 4OHQA 3W76A 3EKLA 3SGZA 3S5NA 5G2HA 3IIVA 1ZNNA 4E38A 1NF0A 3QM3A 4WX2A 2Y61A 3L65A 1JCMP 1J4EA 4BF9A 4X9SA 3UWQA 5D30A 3FJ6A 1VZWA 4Y9AA 4EF8A 1A5CA 1X1OA 2YXGA 2VC6A 3QSTA 3VCRA 4XBSA 2GQ8A 2R8WA 3PR2A 3OA3A 3RF9A 2ZBTA 1XKYA 5LHFA 3WK0A 1NFBA 3HGOA 3LOTA 1OG0A 4P2VA 2Y62A 2YSWA 4GUGA 4GFSA 3EEGA 1EP2A 1SQ7A 2CFFA 1QAPA 3GDMA 4EF9A 2ZRXA 3TK7A 2WNQA 3MHGA 3G0XA 4ZQRA 4S1FA 3LDVA 4ICNA 3EX6A 3LRKA 1ZCOA 2C15A 5C55A 3SI9A 4LC6A 4UFIA 3KRUA 1VLWA 4TMBA 2B7PA 1VYRA 3CM4A 4K37A 3OG3A 4GRSA 5D05A 3IGSA 3KVLA 4IMDA 1FWRA 1H61A 3PUOA 2Y63A 5DCEA 4IWWA 1HTIA 4EOUA 4BI5A 3NQEA 4CQ9A 5DN1A 5D32A 3GXPA 3IV3A 1XDMA 3WK3A 4NXKA 2DZXA 2ZZ5A 3TROA 2C18A 4KWVA 5SWUA 1A50A 2FLIA 2QJHA 1QFEA 3IEBA 4L4MA 4NJKA 3PWAA 4YL2A 2DZSA 5CGQA 2E1DA 5D37A 3EXRA 3IGXA 4N9EA 3W88A 4IXXA 2C1HA 3CIXA 4O13A 5FF4A 2C14A 4K36A 3I7RA 1XDLA 4YCPA 3TNOA 3PUEA 1TQJA 3GYEA 3PM6A 4CNOA 3LGEA 1XBYA 2H8ZA 2C3ZA 1O4UA 1EWEA 3EKZA 3LB0A 4UTTA 1G6CA 1WAUA 4R34A 4UIOA 4JTIA 1N55A 1XBXA 4HPJA 1GTHA 3G1XA 1KBIA 5TQLA 4GBUA 1ME8A 5DBUA 3EX1A 4O0ZA 2ALDA 3BW3A 1IXPA 4ORIA 4N4PA 4OWGA 4AWUA 5FF2A 1K8YA 1TV5A 3SIZA 3DHFA 2DZTA 2C16A 3L68A 4BFAA 1ZALA 1LZOA 2PURA 1O94A 2NUWA 4QQ3A 1SFLA 4ZQMA 3SZ8A 5AOUA 5AHFA 4BWLC 5AYXA 3P84A 3S8HA 3TAOA 2VFIA 1TTIA 2X1RA 5D09A 2A85A 1TIMA 5K4XA 3YPIA 4UNKA 3A21A 2EAWA 3QMTA 1RV8A 4HHPA 4K6AA 4MKNA 5C5YA 2FFCA 2XN2A 3OEXA 3UWUA 1H5YA 3S1WA 4JICA 3QC3A 1QR7A 1TRDA 3LCHA 3LHYA 1ICQA 2HS6A 5IBXC 4JEQA 1LCOA 3RK8A 3EWBX 1SW0A 4EIVA 1N7KA 4HPXA 2ZFAA 1VRDA 5FI8A 3W6YA 3Q2DA 1YXCA 2IQTA 1UJPA 5G5IA 2QUTA 1OVDA 3KFTA 4WY0B 2V2CA 3GIYA 1YDNA 5CPLA 1N8FA 1V5XA 3O8AA 3W1RA 1IXNA 1QOPA 2FB3A 3G1SA 5CSRA 3TJXA 3W7HA 4UTHA 5HWNA 4LVDA 4UCGA 4MYAA 1KM1A 1VYPX 3ABSA 4R7JA 4PODA 4A3UA 1DKWA 4OT7A 2WO5A 4KFOA 3S9YA 4ZQNA 2OCZA 3E0IA 3KAOA 3OBKA 3SSJA 3NL6A 4AXKA 1OF8A 1D9EA 4AB4A 1RQHA 5F2MA 2ISSA 3MMTA 3GZ3A 4N9DA 4NJGA 3WJWA 2ZZ7A 4Z1CA 1DHPA 1P4CA 3S5ZA 3NQDA 5D02A 3GDTA 3NVTA 2H8XA 3DFSA 1Q6LA 3MO7A 3HG3A 3KXQA 2NX9A 3R89A 2DZUA 3G1DA 1FX6A 2JBMA 3Q37A 3LCGA 3THAA 3NQ6A 3DBPA 5BRBA 4MIMA 5LNVA 1W37A 5DY2A 5F2IA 5D2WA 3W2MA 3R2GA 4HNVA 4UC5A 4AHPA 1TPH1 1FY6A 5AC8A 4POCA 5AB3A 2RDUA 4BI6A 4NZFA 2F84A 2QDHA 3ATYA 2TMDA 2YGYA 3WK2A 2BX7A 2E5CA 3BG3A 1TJRA 2OZ0A 1G4EA 2V0TA 3SR7A 4DBEA 4HNTA 1WXJA 2QJGA 1L6YA 4DPQA 4O14A 2A2IA 1W0MA 3C61A 3PBYA 4NU7A 2Z1BA 3W07A 4GUFA 2C13A 3BG5A 5FF7A 4GC4A 3FLUA 4M19A 1PVNA 4JTFA 1G4SA 2NX1A 3LTYA 3MHFA 3PBVA 3W1PA 1M5WA 4NNAA 4MFDA 3O6YX 3M0ZA 2QDGA 1Z41A 4CCCA 2YW3A 3FKKA 1I2RA 2B7NA 2Z6IA 1H50A 2WQPA 3LI0A 2V2HA 4E0CA 3GNNA 4WY0F 1DQXA 2CLFA 7TIMA 3PY2A 4LOCA 2QCEA 5AN7A 4BI7A 5LGZA 3KRSA 4LY8A 2QUVA 4FXSA 3NDOA 4FO4A 5EBUA 1T8XA 1E51A 3GKAA 2YX0A 3S1VA 3NR0A 3BLFA 2O7SA 3FYOA 3P60A 5U7SA 4ZL1A 3EXTA 3MYOA 3VKJA 1GYLA 2LLEA 1KBJA 3A9IA 3BGJA 3PG9A 4JN6A 1XC4A 3FOKA 3QPYA 4MJZA 3NL5A 3M5XA 1TPC1 4D2JA 3UD6A 2VFEA 1I2NA 1VPXA 4KFPA 4K8HA 3TE9A 1DVJA 1GOXA 4UMBA 2V30A 2P10A 5F4WA 3T55A 2GQ9A 4Y8FA 3HPZA 3RLUA 3LXAA 4IGHA 2NXHA 2FTPA 4O19A 3LI1A 1VCVA 1W5PA 4AVFA 3O07A 4ONVA 2CZ5A 2PC4A 1KM3A 1S5TA 4JTKA 2FB2A 3ABQA 2Q3OA 4M7SA 1NF7A 3NEVA 4XTIA 3R12A 2A7RA 3L5MA 3HMJG 4Q33A 1KM2A 3DFTA 4HKPA 4WXZA 4UFMA 5AFDA 1LOSA 4HSNA 1BWKA 4RKAA 1JCLA 3NAVA 3W87A 2J9ZA 3R5EA 1R2TA 1SZFA 3M9YA 1Z44A 4MZ1A 1PL9A 5DCDA 2BWGA 3O6CA 4P61A 3C2EA 1GYNA 1P1XA 3E12A 3TDFA 2FIQA 2F7FA 1EX5A 3E96A 4LRSA 5HUOA 2DP3A 3C8FA 3U8GA 1I4NA 2W79A 3GDRA 2H90A 3QJAA 3O1NA 4UXDA 1J5TA 3KVMA 2QCGA 4OE7A 1OFBA 2WKJA 2JKAA 4JTEA 2QAPA 1W3NA 1Q6OA 4QJ1A 3TSBA 3F4WA 3GDKA 5DXXA 3GXNA 2ATMA 3QFEA 3L21A 3RMJA 3UY7A 1YPFA 4XZ9A 5AYYA 1GT8A 3H54A 3C2VA 4UNLA 2RDTA 4FF7A 1GZGA 3LBCA 8TIMA 4ZVJA 3MYPA 3CC1A 3N14A 1H7WA 1B57A 3ZFHA 3NYZA 1KTBA 5DELA 4FIQA 3DI1A 3LTPA 2QCDA 5FEXA 2WSQA 2CLMA 3N2XA 3UXDA 4FNUA 4O4WA 3MI3A 4AMAA 1JCNA 3BARA 3SGUA 5T26A 4O52A 1H7RA 1GPWA 1SZNA 1W5QA 2ISVA 1Q3NA 3EB2A 5L6UA 3NG3A 1ZFJA 1OX4A 3U2OA 2YR1A 2VKZG 4FIRA 2EHHA 2RKXA 4JS3A 3NPXA 5AYZA 5HINA 1THFD 4FNSA 5F2LA 1KFKA 1U83A 3QH2A 1GJPA 1FDYA 4FNTA 4LVGA 4DEFA 3S6DA 4PC8A 5LGXA 3UWZA 4O1AA 3IIPA 1TPVA 3L0GA 3GAKA 1Z42A 4NUWA 4PL1A 1ICSA 5K2ZA 1MEHA 1S5VA 3WJZA 4GUHA 2CLLA 2EF9A 4DELA 2E6FA 2PRLA 4UTWA 3B8DA 4JTHA 5IM51 3MWAA 3PSVA 2TYSA 1EEPA 1L6WA 4UUIA 3BW4A 4UTJA 1XFBA 1UBSA 3UY8A 2OMAA 2ABBA 1MEIA 3ZR4A 2GVLA 2DJXA 1YDVA 4OU1A 2Y7GA 4LRTA 1ME7A 2VFGA 1LROA 3S1UA 4JTGA 1TSIA 3W75A 2VOMA 4E2DA 2X1UA 4CCEA 3TQKA 2A7PA 4FX7A 4OQVA 5G2IA 4IQLA 1TRIA 4IJBA 4UTUA 3A23A 2RH9A 5LKYA 3G8RA 4O8RA 3I6RA 4YLWA 2VFHA 3MI6A 5HR7A 1TPEA 3QRHA 4RV8A 2B0MA 2NV2A 2PRHA 1MO0A 3UYCA 2H3DA 4UMCA 3FA5A 3CWOX 3I68A 1EIXA 3W1TA 2QF7A 1Y0EA 1RQBA 1VH7A 3DFOA 1C9DA 4O16A 1JUBA 1GVFA 2NWRA 4U4MA 3S0CA 1KM0A 3NQAA 1FQ0A 4NVTA 1DJNA 1WBJA 1OFRA 2AQWA 4H4IA 2JGQA 1EUAA 2CU0A 3K30A 1OYCA 2EKCA 3C2FA 3G1VA 3W7CA 1SR9A 4EVZA 5LNUA 1AMKA 1KFCA 4AAJA 3DFPA 3CPRA 1SW3A 3S5OA 2JGYA 3F4NA 3EX2A 3IIXA 2Z0IA 1K02A 3NQ2A 4GE8A 4HSOA 3W1LA 3W7KA 1JUKA 2CZEA 1IXQA 2C0AA 2OJPA 4RCXA 1H60A 6TIMA 5LNSA 4GXMA 3HPXA 2VEIA 4LTSA 5HNRA 3G1YA 3I65A 3P74A 3SW6A 4MZYA 2X30A 1DQWA 1SO6A 2VELA 4JTJA 2QEZA 3I7SA 4RZ6A 4NJJA 2ZRWA 3GAYA 4O0KA 3MP3A 4S2BA 4ZQPA 1QDSA 2Y6ZA 3TMQA 6ALDA 1F76A 3N9RA 1NVMA 3W83A 1TV8A 1R47A 4JTTA 2GJLA 4HNNA 3LTSA 1XCFA 2JKEA 4Z1DA 3F1QA 1W5NA 3W9ZA 3O05A 4LS2A 3B0VC 3UWWA 3NA8A 3W7PA 5CZ0A 1I8JA 3GNDA 3ATZA 4O12A 1ZAJA 2V5BA 3O6DA 1BEUA 2Y70A 1FWTA 1X8FA 4IPIA 4UMAA 4NJHA 4Y90A 3RU6A 3P80A 1ML1A 3PB2A 3UPBA 2X1SA 2E77A 3LRMA 3TQVA 4JDBA 1SO3A 1W56A 1OFOA 3CLMA 3P61A 1MXSA 4GUJA 3NQFA 4M5PA 3MHUA 4CCDA 1AW1A 3O16A 2QCCA 2YFOA 4N6FA 1W1ZA 1OFDA 3DHDA 1KM4A 4O17A 4DPPA 4H6KA 3AO0A 3DFNA 2QCLA 3BK0A 2GQAA 3T7VA 4Z1AA 4O18A 4ZQOA 3CWNA 4R33A 4WOQA 1KW1A 3NQ8A 5LSMA 3OHIA 3C52A 2QJIA 3LXCA 1FCUA 3G8EA 3NGJA 3STCA 5G1TA 4DO6A 1AW2A 3L5LA 3O06A 1QCWA 5L9FA 1WX0A 3TIMA 2JKPA 3B03A 3MI2A 2I9EA 3P81A 2FPVA 2VFDA 5DXYA 1DV7A 4MOZA 5CPOA 1SSDA 1IF2A 4M6PA 2HMCA 1UB3A 5HR6A 5LHEA 4AEOA 2O7QA 2PRMA 1JVNA 3L2IA 3B0UX 3W74A 3VNDA 5EMUA 3G0SA 4O1DA 3ANYA 3HIJA 3RFAA 3O63A 4N4QA 2CZFA 1XI3A 3KOFA 2QCMA 4JTUA 1QO2A 1KV8A 4M7TA 1LDCA 3NXFA 3PBUA 5K7JA 4A2RA 4HN4A 3EX3A 1QNVA 3WFAA 5F2GA 4KFNA 3P5YA 4JYDA 4O54A 3B0PA 1YADA 1F73A 2FPTA 4RR4A 2ZRVA 1NEYA 2J9XA 4FB7A 4LUJA 2DU2A 4WOZA 3SFKA 3W1QA 4LU0A 4RXGA 4MY8A 1ICPA 1M7PA 3LV6A 4JX4A 4AF0B 3FEMA 1KTNA 4Z0SA 3CEUA 2DZPA 1H7PA 4LVAA 1YXYA 1JRBA 3GK0A 2J9YA 3W84A 3CB8A 3GR8A 2VFFA 5BMWA 2E6AA 1JCYA 4UTLA 1TPDA 1G67A 1RPXA 5I3JA 2P1FA 4S2CA 4NNCA 1GG0A 2NXIA 4JX5A 4MYXA 3GKFA 3PF3A 2HS8A 3P8IA 3KVKA 5AC6A 2BZNA 4Z0JA 3LM7A 5TIMA 5CZSA 4YXGA 1TV7A 3L0NA 4O53A 3L66A 3TFCA 3ZWTA 1H1ZA 1SSGA 1F7BA 2HTMA 3INPA 3OIXA 1L9WA 4Z1BA 1U5JA 4NX0A 3TMLA 4UR7A 3USBA 5DBTA 3LHTA 1VHCA 1OHLA 5FEWA 3W1NA 3Q58A 3W7RA 2RDWA 3GB6A 3PG8A 3WJYA 5HWMA 3V1PA 3N9SA 5HMSA 3HPSA 4LWWA 2CZDA 2BSLA 4M6VA 3UNDA 1O60A 4MUZA 1XXXA 4R53A 1EUNA 3H55A 3UZ5A 4NJIA 2GUUA 1KFEA 4O1BA 1C29A 2B4GA 3HF3A 1LM1A 1DL3A 3QMSA 3MJYA 2CLEA 5DLCA 4CNNA 1FCVA 2PCQA 3W2NA 4RZ4A 4ZZ9A 3TSMA 2QKFA 4YMZA 1TB3A 2DZWA 3HGJA 4LV4A 1S5WA 3NM3A 5EY5A 5ABTA 4YWIA 3FS2A 1VYSX 3UQNA 1D3HA 1XM3A 5TBOA 5GVJA 1FCBA 2A5HA 1R46A 4O10A 3QYQA 5K9XA 3IGUA 2C6QA 4GJ1A 1B9BA 3W2JA 1H1YA 4W9TA 3TU9A 1FDJA 4I9AA 3M5VA 3I7QA 1K7XA 2ZYFA 3NNTA 5K3VA 2GPTA 2ZRUA 3W7QA 2TPSA 2DORA 3G0UA 1X1ZA 3W7JA 4NXSA 4RK8A 1L2UA 4CNPA 3HQ1A 1JQXA 4OBTA 4PH6A 3P5ZA 2HSAA 3QEZA 3C2OA 1TYGA 3CEPA 3T4CA 3W7MA 2WJZA 4DO4A 4LC8A 4Q32A 4KKXA 3QW4B 4CQAA 5BOOA 2XFWA 2UV8G 5AHLA 3M47A 4DBDA 1VC4A 3TJLA 2NUYA 3LCXA 4IXHA 4AWSA 4TU1A 1YTKA 1LRQA 3W7EA 1VCFA 3G1HA 5CKSA 1B4KA 1FDZA 3D0CA 3S1XA 3G24A 3ZS4A 1KA9F 1I2OA 3G1AA 3NQVA 3THQA 2ZTJA 2EPHA 3UXAA 1BTMA 3LCLA 5C54A 3IIOA 3HGSA 4ADUA 1EP1A 3A5VA 4DXVA 3T44A 1HL2A 3C0JA 1WOAA 4XUGA 3G1FA 1GVSA 1JULA 1V7YA 2D73A 2WNNA 1R2SA 3NPUA 2WSYA 1DORA 3DH7A 3DAQA 2CWNA 3P62A 1OABA 1KLYA 5D2TA 1FUYA 4K39A 3LHWA 1TREA 3F03K 3C3NA 3M5YA 1GG1A 1H62A 1EP3A 1OFPA 2CLOA 2DZVA 1W3IA 1P5BA 3PUDA 1PCKA 5LNRA 4HNUA 1R30A 2RHGA 5KZEA 1G69A 3GDLA 1GTEA 2YPIA 1ALDA 5U4NA 1BKSA 3W86A 2QCDB 1I2PA 3RLVA 1EPXA 3TH6A 1K03A 4ADTA 2Y7DA 1GVQA 3IVSA 4PA8A 3LCFA 3GLCA 3NM1A 4A2SA 1D3GA 1WA3A 1OF6A 1SO5A 1HG3A 3G18A 1F05A 1ZJIA 3BLEA 5AHEA 2X16A 2QR6A 1OX4B 1ZAIA 4MLRA 2R91A 2PE4A 5HWJA 5CPNA 5EA9A 4RLIA 3EWUA 3M16A 4IMCA 3PULA 4XKYB 3AJXA 1XBVA 4AH7A 4B5NA 2ZRYA 3QPZA 3G3DA 4N9CA 4IOTA 1SFJA 3DKJA 1TPB1 4UFLA 5D38A 3NL3A 3FKRA 3NQGA 1QOQA 1VGAA 1H63A 3P8JA 4K7YA 1PV8A 3O15A 1OFEA 4M6QA 2V82A 1GWJA 4MPQA 3JR2A 1PS9A 3DI0A 2V81A 1OYAA 2J6XA 4Y96A 1PE1A 3TR2A 3P7YA 1K7EA 3T40A 4BR1A 5AHIA 1LLZA 3NQCA 5KSWA 4XTDA 4DQWA 3GXTA 1WDWA 2QUUA 1OFAA 1WQ5A 1HFBA 2R14A 3C56A 4ML9A 4IX0A 4XBKA 1JRCA 2A7NA 3KX6A 5D2XA 1OYBA 1YDOA 4L4LA 3IVTA 3STGA 1ZAHA 1G4TA 2ZRZA 3W7NA 2E5DA 3L5AA 1QPNA 3HBLA 1EA0A 3NQMA 1EB3A 1S3HA 1KV5A 3HOJA 2V2DA 2VXNA 1C8VA 1K8XA 3MBFA 2I1OA 1UASA 3BVJA 1WV2A 3PVFA 4O28A 4NNBA 3P67A 3NO5A 2H3BA 1F74A 3IRDA 1IIHA 4JIPA 5C2XA 2CLKA 2OT1A 2ZQ0A 5KZMA 3C6CA 4X3ZA 3SY5A 2V8ZA 4JNMA
chains in the Genus database with same CATH superfamily
1SZEA 1E5JA 3N4EA 3UA4A 1SFSA 4QSHA 2G41A 1XYZA 5JMUA 3WQFA 4O4VA 3BSHA 2WCSA 4LCRA 4FHAA 4KQNA 2XIBA 2ANUA 4X9YA 2XZ9A 3M7WA 3THDA 3RDKA 1ZY9A 1WXZA 4ADSA 4GQRA 4AFYA 4DJDA 4U10A 4H8VA 4NZJA 4AVOA 1KXVA 2I17A 4WSKA 4S3GA 2NLYA 3M1ZA 4IMFA 1W5OA 4L61A 4NG3A 3XISA 2HVOA 1XIMA 4NASA 2ON3A 2FGZA 1UR3M 2AMGA 2NZLA 4IP4A 2RFGA 3EAUA 4RE2A 1YX1A 3BSMA 4CD5A 2O9PA 1GUVA 3HG2A 3W7GA 1VLIA 1ZJBA 4L6HA 1NAL1 4WVXA 4UZSA 3BAKA 3QXBA 2Z27A 3TUUA 4WKHA 4B3KA 4AZ5A 1E6XM 3MB9A 3NIYA 3OGSA 1KRMA 3JU2A 1KGXA 4YTTA 2VQTA 2BP1A 3VC6A 1J11A 4IX2A 1XYAA 2X1TA 1NWTA 4KRUA 2PBGA 4AWTA 5CZTA 4UFJA 1LT8A 4PUEA 5FF0A 3VOJA 4H9ZA 3V16A 1J2WA 1V0MA 2W62A 4LUTA 1YKWA 2WSRA 4F0MA 4Y9PA 2YZRA 1GKPA 2DZBA 2Z1SA 3V75A 2Z1XA 2NQHA 2YCIX 4E5TA 1WKEA 3TCSA 2NX3A 3W1XA 3STEA 3DFQA 3QSRA 1M53A 4LS0A 4QNWA 2GVGA 2DQXA 4IF2A 3RRAA 2Q8LA 4HN8A 4DO5A 4A21A 4YCOA 2DGAA 2G50A 4PTMA 4DLMA 1RA5A 3TXZA 4V33A 3SECA 3IARA 4XZIA 3W22A 1TIWA 3GHRA 3W29A 1AH3A 2E3ZA 2A6NA 1VP5A 2G96A 2OOGA 4ECLA 4LAKA 1A53A 3MKCA 4OV9A 1C7TA 1FRBA 5I3KA 4LS1A 4PMJA 1LBMA 1M7OA 3NO3A 3EDDA 4JHOA 3NTYA 4CN6A 5KINA 1PDYA 1K3UA 1ZRQA 3ITXA 3WF1A 1A5SA 5HPCA 3KLKA 1QWGA 2X1IA 2G0WA 2VEPA 2GJNA 5K4ZA 3DCPA 5CG7A 2E40A 3RU8X 3QW3A 4WD0A 4MNJA 1BXCA 5FEPA 1C8QA 2CLIA 3SAZA 2NSXA 4L9YA 5C71A 3PS7A 1YLVA 1UKOA 4H7ZA 4J3VA 5E9XA 1O5KA 3NPWA 5ABHA 3EPOA 4IP7A 2FVLA 1J2BA 2FZ9A 3PBWA 3UGVA 4Y6GA 4B9YA 3J7HA 2FQIA 2E09A 1VQTA 2E6DA 1OQFA 2YDAA 3EWWA 1MYRA 1AL8A 1RALA 2J27A 4C60A 4MB5A 4N6EA 1OB0A 5XINA 5I79A 3U2CA 1TJPA 3SUTA 5K9CA 5FESA 4FSAA 5IOBA 2Y4SA 3QOKA 5D03A 2OT0A 4D72A 5I3GA 3R8RA 1J18A 2JEQA 3VE7A 4JFTA 3N18A 3E0VA 5G1YA 2BVYA 2ZUNA 3GM8A 1OX6A 2HXUA 4W7WA 4AF0A 3L67A 4GYFA 4WZHA 3LRLA 1R3SA 2FHCA 4NI3A 2HISA 1KXTA 1LYXA 4S3BA 1MQRA 1UCWA 5I7GA 1TA3A 4UOJA 1MRQA 4PB5A 1H7NA 2GSHA 1A80A 2P53A 4PFMA 4BK9A 2E68A 3ZJ7A 1Q6QA 4ORMA 3DFYA 5B7ZA 4F48A 4W5ZA 4H9MA 1DXFA 1TMHA 4QE1A 4MY1A 3WLTA 4PTNA 2QZRA 3WQOA 4AX7A 3FA3A 5REQA 1F6KA 1H7OA 2P0OA 4HT3A 2CLHA 3OLIA 1T8QA 3MCNA 3K4WA 1OK6A 3IWPA 4IPNB 5EYWA 5FD0A 3SB0A 1LWJA 1QW8A 2OB3A 1PSCA 1UWQA 1TZ7A 2YA1A 3MKKA 1M68A 3WBYA 4KH2A 4QAIA 5EKYA 1VBRA 3U4FA 1XIHA 2VEFA 1WE5A 4DVOA 2R6OA 1XRSA 1YTEA 1AA1B 3GH7A 2XUCA 1J79A 1EX1A 1QWKA 1RA0A 1F6PA 5J5DA 3DBNA 3OB8A 3BV7A 3QZ6A 4O57A 1V02E 2B7OA 1FKWA 4LEFA 4Q4KA 5F1VA 1FWIC 3OPSA 2PC8A 3BDKA 4DJEA 1LOQA 3WH5A 3TC7A 1XCWA 3BGGA 2P88A 1SW7A 4LAUA 3TA6A 5H91A 2ZTKA 3V7PA 1OWQA 2P50A 5CZKA 1EGVA 1PTGA 2WNWA 2D0FA 2HK1A 4K2SA 3G5EA 1VS1A 1ISVA 1X1NA 2PDJA 3AMDA 4AC1X 1YNPA 3ZOAA 4CQ8A 1GVRA 1LWIA 4W85A 4H6QA 1V79A 3VNYA 3ALFA 4LEQA 4MVAA 3TXVA 4ZQCA 1WOBA 1B9ZA 3WNNA 1HL8A 4HB7A 3ARYA 4FNQA 5D2YA 2AAAA 3ABXA 1XIIA 5E0CA 4DF1A 5KMYA 3PWGA 4H9TA 1R85A 1ZL1A 2A6LA 3CWHA 4DB7A 4A29A 4EWND 1VJIA 4MZ8A 4RX0A 4CLMA 2XJ7A 4NAEB 1U5HA 3PTMA 1LP6A 3NZRA 4LT9A 3FN9A 4JGDA 1E6PA 4W7UA 3T08A 2XN1A 2VGBA 4LV9A 5DEZA 3W25A 4RDZA 1XRVA 3W7LA 1S1RA 1QPRA 1B3ZA 1GVOA 4JX6A 3N19B 2PD9A 4CGTA 1KWKA 2I5IA 4QIUA 3H6OA 1OD8A 5I3IA 3AALA 4ERAA 1L8PA 3OYXA 1W1IE 1QPOA 3NL2A 4D71A 1TPUA 1E73M 2FTWA 1GQNA 5FL1A 4UFHA 1TTJA 4ZFMA 3M44A 2WVVA 1JPMA 4JHMA 1CI1A 3EWCA 5C6MA 1JL8A 3EGJA 2WPGA 1KFJA 1TV3A 3VDGA 4F0KA 3LQGA 4UQEA 2YYTA 2W6RA 2ZVRA 3VFLA 4O50A 2WHJA 5KTLA 2OQHA 1FWWA 2ZA1A 3MY9A 2FHFA 1MEWA 2X2YA 2ZZ6A 3M07A 5HMDA 4XIAA 2OZTA 3B4YA 3RO6A 3W2LA 2GQ3A 4QXIA 2OG9A 1ZENA 4DWSA 1PX4A 2YBTA 3AMCA 3FDKA 4G9PA 3VKDA 1F8IA 1PIIA 3N12A 5GJPA 3LPPA 4XKYA 2ZVIA 3K1DA 3AQUA 1Q85A 4PR4A 4PUNA 1AJ0A 1W3KA 3S5YA 1TTQA 5EFDA 4PL2A 3RHGA 4AHOA 1TMLA 4XO6A 1DWHM 4LVBA 1YNQA 2NW0A 2CW6A 1OFQA 3QHMA 1HGYA 4C5ZA 2VENA 3UWEA 2GSEA 3KS5A 1GQKA 1VPYA 4HA3A 4BQ3A 1OCBA 2Y61A 3MKVA 1RBAA 4H2CA 4D6CA 2X7VA 1PKYA 1UPPA 4EF8A 1A5CA 1RK5A 5HMFA 2D23A 2YXGA 2VC6A 3QSTA 3MDWA 1E6RA 4PMNA 4XBSA 2J7DA 3PR2A 1KCZA 5IDZA 2O9TA 4CQDA 2OKTA 2PGRA 5LHFA 1GQIA 3QR1A 4QLLA 3LOTA 1J5SA 3T2QA 2IKJA 4GY1A 3CBWA 3EEGA 1VB9A 4S38A 1EDGA 1QAPA 1XR2A 2J79A 1T7LA 3TK7A 1D7FA 2DEPA 3MHGA 3OYZA 3G0XA 4S1FA 5FACA 3STPA 2C15A 2OX4A 5JH2A 3CUHA 2CBVA 3CM4A 1UD8A 3QGAC 1BKHA 3AS3A 1BYBA 3WH6A 4IWWA 5D9NA 1ISXA 3NVDA 2VR2A 1HJUA 1XDMA 4LF1A 1EH9A 4ROPA 3OODA 1XICA 4KWVA 4HD5A 3RIKA 4Z2LA 2FLIA 2OQYA 1WKYA 4E8CA 1M03A 2VJXA 4YL2A 2DZSA 1G5AA 4NL1A 5D37A 3UGRA 1YHTA 4N9EA 3VC5A 1XDLA 3MU7A 3PUEA 1GZ1A 1HX0A 1DJIA 1G94A 3GW0A 4XG1A 3NUKA 1O4UA 2C1IA 1FHUA 3CUXA 4GI6A 3REQA 4R34A 1K8CA 4BHYA 4X60A 3OBEA 1XBXA 1GTHA 4GYPC 2ZWZA 1KBIA 1IGWA 2UY2A 1QI5A 4JTAA 3BW3A 4UOQA 4YVXA 3FDGA 5FIPA 3SIZA 1TV5A 3DHFA 2DZTA 3BLPX 4JIHA 3B0YA 3OG2A 1ZALA 1LZOA 1E6ZA 4ZGYA 4QP0A 5AHFA 4BWLC 2VC7A 4GVIA 1Q6CA 1JIBA 3NCOA 1VIWA 4DJFA 1CXHA 5K4XA 3ONBA 2EAWA 2DVUA 2FZNA 3VMPA 2FFCA 3BOXA 4AZIA 4JICA 1F6YA 1TRDA 1ICQA 3C0SA 3PZTA 5DF0A 4JEQA 3GHSA 3RK8A 1SW0A 1N7KA 4KEUA 5FI8A 3Q2DA 2R82A 3T0CA 2IQTA 2QS8A 3SRFA 3KFTA 3GWQA 2ZUVA 1BG4A 1IXNA 1QOPA 3JUGA 2X41A 3AIUA 5CSRA 2FH6A 3FYYA 3GG1A 5HWNA 3UZZA 4MYAA 5ABFB 4WRHA 1Z32X 3VNZA 4A3UA 1DKWA 5IHRA 4KFOA 4EPEC 4ZQNA 3E0IA 3VIOA 1M7XA 1CBGA 4AB4A 2ISSA 2DPEA 3DDMA 3GZ3A 1TELA 4NJGA 2ZZ7A 1DHPA 1R8LA 5DO8A 2PAJA 2VZVA 3GDTA 3NVTA 2H8XA 4LF2A 4GIRA 3KXQA 2NX9A 1FH7A 3NJ3A 1GORA 1YEYA 2QUMA 3RN6A 3RITA 1UUQA 5T9BG 2E9MA 3NQ6A 3DBPA 4NY2A 2CHOA 5LNVA 1RHCA 2HXTA 3W2MA 4UC5A 4L6DA 2VX6A 1I6NA 1VEPA 4AHPA 2RDUA 1RUSA 3TONA 3ATYA 2QVHA 2TMDA 5DMYA 3S2MA 2BX7A 2E5CA 3BG3A 1TJRA 3IRSA 1JD9A 3CZLA 2V0TA 4JIIX 4MB4A 2A2IA 3CYVA 2CC0A 3VD4A 1TUFA 4JKMA 3PBYA 3N6QA 3BG5A 4IFRA 4LCQA 4D9PA 2VHLA 4PCNA 2GL5A 1QK2A 1XLCA 4JTFA 2XFRA 3MHFA 3TYZA 1UH4A 3WLHA 1WP6A 2PTWA 3AYVA 3L2LA 4PBEA 3TYUA 2OWCA 1JEZA 1XYFA 3TTOA 4QJ5B 1H50A 1XIEA 4GVGA 3GNNA 5A95A 1DQXA 3PY2A 3NOYA 5LGZA 3KRSA 4LY8A 4FXSA 1ENUA 3NDOA 4H8NA 4D6IA 4FO4A 5EBUA 5TF0A 3ARXA 4R7OA 2YX0A 1Q2SA 1V93A 1Q2RA 4Q4RA 4GVHA 3S1VA 4LBUA 3NSMA 4YHEA 3P60A 5U7SA 5CPQA 4DUWA 3MYOA 3QGVA 2LLEA 3BGJA 4JN6A 4W5UA 1WO2A 1MQPA 4RW3A 5CC7A 4MJZA 4HK6A 4Q8UA 3M5XA 3UD6A 3DGBA 1VPXA 2HV5A 4OTKA 2QGYA 3TE9A 2V30A 7REQA 2WMKA 3T55A 4Y8FA 2YL5A 2AQOA 3HPZA 1SJAA 1W9XA 1RY0A 1DJXA 4O19A 4ONVA 4L7ZA 2PC4A 1S5TA 4FI4A 4WK9A 3PTDA 1DIOA 3S2JA 2NVCA 5FJRA 2CETA 4MWAB 4WXZA 3ARQA 4PMVA 4B3LA 2WMGA 1CIUA 3DHPA 4B9ZA 3KDNA 3VGBA 4OBRA 1FHLA 3PNUA 1WKFA 1DTUA 3MTWA 1OIFA 4IIHA 5CPSA 1MI3A 1PL9A 4AG0A 4GY0A 3WUBA 1XYCA 3FAWA 1E6NA 2R1PA 3KS6A 1DXIA 3S3GA 3TDFA 1NOWA 3WQGA 7XIMA 2EEXA 5HUOA 1XIGA 2DP3A 3U8GA 4GFIA 2W79A 4DYEA 3MMDA 3RPTA 1JZ4A 2BXZA 3E2RA 3F5LA 4XVDA 1ZU8A 2Q6ZA 4OE7A 3AOFA 1E9IA 2WKJA 4JTEA 5CC5A 1M01A 2QAPA 1W3NA 1Q6OA 1W3HA 4WSHA 4A05A 4QEEA 3QFEA 3L21A 4XZ9A 3A64A 3SCWA 3H22A 1Q65A 1LG2A 5JIPA 4HTYA 4UNLA 2EPNA 2RJGA 2RDTA 4R88A 3MZ2A 1A3WA 2BOFX 4C6LA 8TIMA 4CD7A 5C7VA 3WQWA 1H7WA 3KW3A 2XINA 4PMUA 4BQ2A 1HNYA 4L5ZA 3NYZA 2PDMA 3LTPA 3E2QA 4ICCX 5FEXA 2CLMA 4GC3A 3HN3A 3BARA 5CC6A 1EL3A 5TD4A 1GPWA 3EB2A 5L6UA 3CZJA 4K1GA 1OX4A 4D1IA 4RL3A 4CQCA 2VUNA 2EPKX 2Q02A 1UD4A 1Q7MA 5FSDC 1U83A 2PPGA 3QH2A 1I1XA 4LVGA 3S6DA 4PC8A 3C8NA 1LQAA 4IFKB 1RD6A 4NUWA 1ICSA 1V6XA 3IS4A 1US3A 1MEHA 2IMRA 1MDLA 3PZNA 3ITOA 4DELA 2PRLA 3KTCA 1AJZA 4IIEA 3Q65A 1KCKA 1XFCA 1HJSA 3SCOA 1L6WA 3WUFA 3WG6A 2DIEA 3BOFA 1A5UA 2OMAA 3MSRA 3ZR4A 1EGZA 4DYKA 4OU1A 2NVAA 4EK7A 4XISA 1LROA 3S1UA 4JTGA 3S2CA 3W75A 3VD3A 1XINA 1XWYA 4IJCA 4LAOA 4I3GA 2BY2A 1BLIA 3WH8A 1I9CB 3A23A 1Q6GA 4EXQA 3T0TA 1W2PA 4D6HA 2VFHA 2G4FA 3UW6A 2B0MA 4Y9NA 5FAGA 3SRKA 3W1TA 2QF7A 1EBHA 1JNEA 2DUXA 1QHZA 1C9DA 1Q13A 1JUBA 1RCXB 3K13A 1AODA 3WKZA 3DG6A 3NQAA 4NVTA 1WBJA 1R3YA 4TVDA 4H4IA 4A4AA 2GUYA 2JGQA 2PDCA 1GQLA 4DNHA 1EOKA 2EKCA 3VKCA 4H9VA 3AIBA 3W7CA 1EJRC 4A8RA 1SR9A 4EVZA 3HM7A 1KFCA 1SW3A 2V3EA 4UZUA 3VCNA 1UR2A 3OLGA 1CCWB 3KOWA 3APGA 3KTXA 3U57A 1RP8A 1CT5A 4MKSA 5D8WA 5LNSA 1R7AA 5I02A 1AVAA 3SW6A 4I90A 4MZYA 3VOIA 4XZMX 3SN1A 4LUTB 3I7SA 1E70M 2IQ0A 2IQDA 3ICJA 1QDSA 3N11A 2D22A 3TMQA 1ADSA 1F76A 3N9RA 2QMJA 4JQ4A 1UR8A 1TV8A 4EACA 4JTTA 1UD3A 2PDXA 2JKEA 2I5QA 2W92A 3WUEA 3O05A 4LS2A 1JXJA 4NZ5A 2CYGA 5CZ0A 3BE7A 3W7PA 1I8JA 3ATZA 4H41A 4O12A 4OOZA 5FOOA 2V5BA 1DE5A 4UCFA 4Y90A 3PB2A 1ML1A 2XGIA 3LRMA 3TQVA 4KT2A 1JDCA 1SO3A 3P61A 3AZTA 4GUJA 3CLMA 3WLIA 2GVYA 3NQFA 4AY7A 2E9BA 1V08A 2XWEA 2YFOA 4ZE5A 4PUJA 3QV6A 2CERA 3DHDA 4D6EA 1W9BM 4H6KA 4GQ0A 3AXXA 3RJXA 4CNSA 2QCLA 4KWSA 2Z28A 1AFSA 3QGKC 4Z1AA 1GVIA 4ZQOA 5GQBA 2OWXA 5A3HA 2VTFA 1X96A 1LL6A 4H7VA 1NDYA 5D9PA 2QJIA 3A3WA 3DYOA 3OBAA 3STCA 4LUSA 3L5LA 4L9ZA 4YHGA 1V6YA 3GO2A 3B03A 2FPVA 5CPOA 1SSDA 2XGBA 4M6PA 2I7GA 3NZGA 1ITXA 3UVAA 4Z2KA 3R0DA 3VGEA 4CNTA 4HCHA 3F5KA 3GIPA 2PODA 3RFAA 5CLTA 5I07A 1C92A 2KX9A 5LIUX 4DZIA 2J62A 4JTUA 1ISYA 1KV8A 3HQNA 3NXFA 4A2RA 4R9XA 1HKMA 5F2GA 1E3XA 4GH1A 1ADDA 3P5YA 1JZ2A 4QE4A 1H09A 1YADA 1OY0A 1EQPA 2I9UA 2DU2A 4RXGA 3SN0A 2VL4A 1J0KA 4AF0B 3FEMA 7PTDA 4HYVA 3GTNA 2WW5A 3N6JA 4NZCA 1TR1A 1H7PA 4RPPA 2AMXA 4LVAA 5LIYX 3TN5A 4QG9A 4RE4A 3BLDA 4XAGA 2J9YA 2HPIA 3MCOA 1IWAA 3NWRA 5I3JA 2P1FA 4NNCA 4QJ3B 3FA4A 2NXIA 3LMZA 3PFMA 3GKFA 5JUVA 2HS8A 2QF8A 5CSYA 5AC6A 1XISA 4HPGA 2GK1B 1P7TA 4YXGA 3L66A 1F7BA 2V3GA 1L9WA 5HA7A 4AU0A 3VGHA 5CGMA 3AYTA 2QDEA 5FEWA 4CNUA 5E6ZA 4CEXC 3Q58A 1V0LA 3WJYA 5HWMA 2VGIA 5A8OA 3BURA 2GVEA 4LWWA 2BSLA 2PEVA 1O60A 3AHTA 4R53A 3QPEA 3H55A 1GOIA 4NJIA 1CWYA 1BYDA 1O5QA 4OVXA 2YLLA 2CLEA 5DLCA 3T4WA 2FFIA 5EBAA 1ODUA 4XZBA 2QXWA 2DZWA 2PTDA 1H4PA 2XH4A 1SZRA 4NAFA 3SCSA 1GJWA 4ZR8A 3TJIA 1XM3A 5TBOA 1A4MA 1EPVA 1XGZA 4HMNA 2C6QA 3E5BA 3UJRA 1EZWA 4MG4A 4W9TA 3TU9A 1P0DA 4B16A 3UR8A 5K3VA 2AQVA 2PDBA 2NT1A 3W7QA 1E1CA 1AH4A 3WLMA 2INFA 4ZO8A 2A3LA 1S1PA 1X1ZA 3K8KA 4TX8A 1E4IA 3ME3A 1GHSA 1H2JA 4KERA 1L2UA 4GVFA 4OBTA 3P5ZA 3RX4A 3OGVA 3UCQA 1L0PA 4GNKB 3CEPA 1Z8AA 4IG2B 4Q32A 5BOOA 3ZSTA 4F0HA 9CGTA 5AHLA 3M47A 4B5XA 3ECQA 5CC3A 3K4AA 4BA0A 4HYWA 1YTKA 2PCEA 2A3HA 3G77A 1FDZA 1GZJA 3D0CA 1K1DA 3THQA 3NQVA 3Q4DA 2ZTJA 2YL8A 2EPHA 3UFYA 2GJXA 3VD9A 3HGSA 4ADUA 1EP1A 4XSMA 1NIUA 2EPMX 1E9YB 2G3FA 3ANUA 1VFHA 1WOAA 1JULA 5AVHA 2WHLA 2WSYA 3DH7A 1KLYA 1XYBA 2G3MA 2VR5A 3EMCA 4PFHA 5I0DA 4FF5A 2JEPA 2VCBA 1TREA 4PRTA 3WLRA 3AIEA 1H62A 1OFPA 5FJJA 3MPGA 4P5UA 3AMKA 2WVVB 1P5BA 2OYKA 6XIAA 4UNIA 3ZJKA 1PCKA 4DJEC 2X05A 5LNRA 4LXFA 1G69A 4HZ6A 4O1FA 3KM8A 2IUZA 1I2PA 3CL7A 4QFUA 4G6CA 1GVQA 4M6UA 4B90A 4XD3A 1D3GA 1WA3A 2JFEX 2YCLA 1SO5A 1M7JA 3WNPA 3AFBA 4HA0A 3G18A 2QR6A 1MUCA 4O0QA 1R38A 3BJSA 3PZOA 1SMAA 4C6PA 1ZJHA 4UBPC 5CPNA 5EA9A 3SCVA 4ZTXA 5M5DA 3GHTA 4W84A 1ITUA 2PWUA 3PULA 4XKYB 3AJXA 1XBVA 4AY8A 2X0SA 1EKOA 3OHMB 3TA9A 2AL2A 2XVLA 4N9CA 4Q4SA 4PE8A 4UFLA 3VYLA 4H6EA 4BKNA 1H63A 3N17A 3P8JA 4K7YA 3IJ9A 3O15A 4M6QA 2XSAA 4MPQA 1UIOA 1PS9A 3CUJA 1OYAA 4J4KA 2O92A 1V3MA 4CU8A 1KRAC 1I0DA 4Y96A 3TR2A 3P7YA 1BRLB 3PPFA 1PB0A 2VO5A 3T40A 3F5JA 1EC7A 3BLLA 4BR1A 2PF8A 1F3WA 1LLZA 1QVBA 3WDQA 4DQWA 3GXTA 2PDQA 2BGQA 4ZOBA 1EDQA 1OFAA 3C56A 2R14A 3CJPA 4AZBA 2DUAA 2GUBA 4GZIA 3AICA 1VEOA 3W02A 6TAAA 2BGNE 3STGA 4US5A 3GU9A 1ZAHA 1QPNA 4QBXA 1S3HA 3AI0A 2ISDA 3UG3A 1C8VA 3FGCB 2I1OA 3EZ4A 1TX0A 4NP7A 1HW6A 1UASA 3BVJA 3PVFA 4HU3A 1RLDA 4LX4A 3IGHX 4C6JA 1E72M 3IJIA 1EJWC 1C7SA 2VEGA 1PKLA 3OP2A 3C6CA 1FFRA 4LUYA 4UTMA 3N34A 2PUZA 2Z1KA 1XH0A 1SO4A 2ZXBA 3HZ3A 4O11A 4IUOA 4LYQA 4IFOA 3HA1A 1I60A 1HGWA 1HO4A 3DHUA 3SDOA 4OBSA 2WCGA 4IPPA 3BV4A 2YLAA 4JZ5A 4XX6A 5G4WA 1KM5A 3ENLA 3E9AA 4O15A 4DF2A 3LXBA 4GGBA 5AC7A 1US2A 1RCOB 4JCLA 2ZDSA 4DWSC 3H23A 1LBLA 1S2WA 1SU5A 3OQEA 1JF5A 2QV4A 1Q63A 3B8TA 1TPFA 2V9DA 5FJIA 5BOFA 4CVWA 3T78A 2OOFA 4DHGA 3PZUA 5JIWA 2PWFA 1Y5VA 4HPHA 2A21A 3EWXA 3L0KA 4I9TA 3UU0A 3QBUA 3FJLA 4WJEA 4OUEA 3VOGA 3L4YA 3MSYA 4YTRA 2DVXA 4A22A 3EBVA 2CESA 1TV4A 3BAIA 1QO5A 2G97A 3PAJA 2XDFA 4LVFA 4GCXA 2FTYA 5F7UA 1DQUA 1K4HA 3UWYA 5IBXA 3LM3A 2RGMA 2XIQA 2OZ3A 3MSGA 2WBGA 3UG4A 4JY8A 3GNXA 2J88A 3P82A 4H8UA 1CW2A 2PZ0A 3UPMA 3F7JA 1EXBA 2PLCA 2V5DA 1KBBA 4YTSA 1VD6A 3RPMA 1GNXA 1X6UA 4A8IA 1H0IA 4WJXA 3LHZA 4C1KA 2XVPA 4FZIA 3FIGA 5A5WA 1F9CA 1EYEA 2R94A 1I45A 1OX5A 2J7FA 3FK4A 3OA5A 3EA2A 4IMAA 1XH2A 5KZDA 3HG4A 4MWAD 1AK5A 3C2RA 3B8IA 4LW7A 3WNKA 1TX2A 1GOWA 2BNJA 3TSDA 2EGZA 5A8GA 1YXDA 1E6QM 3TW7A 1PHQA 3CQKA 3NPVA 4H3DA 3IAPA 4L4OA 5CZJA 3TKFA 1VAHA 3B97A 2VZSA 3MBDA 4J35A 1AW5A 1OJXA 3WMCA 3FJ4A 4J40A 5LZLA 3N29A 4M56A 4QM1A 4I7VA 2DIJA 2E67A 3MUXA 5E9AA 2IW0A 1KM6A 1VHNA 5FJUA 5ECVA 1IT7A 4JFVA 1Z48A 2TSYA 1OC7A 4KGLA 4IUGA 4ZB0A 2GWGA 3RNDA 1C9WA 1K7FA 2A1YA 3AXMA 4MAZA 1SJBA 2F9RA 4LCSA 4JY9A 3KBVA 4GMEA 4HNCA 1PHWA 1G7VA 3H24A 2DSWA 3TYBA 2GWNA 3S9IA 3CZ8A 3GFYA 5I3HA 3HO8A 5RUBA 4LUIA 1K6WA 4GUIA 1R3WA 1TWDA 4WY0A 3BLIA 2R9RA 4WKAA 3WD1A 3DECA 1X7FA 2HROA 1NP2A 3MA8A 1EHAA 4HBKA 1XBZA 2WYSA 1NJJA 1RAKA 4IL0A 4RNHA 1R9YA 4DJFC 5EL1A 2A3BA 3SCRA 1JR1A 2ATSA 1Q6FA 3HGRA 1XF0A 3B04A 3B05A 3WK1A 3M43A 4LH8A 1ODZA 3MMWA 3RX3A 3QQ0A 2J8TA 2BTMA 1ME9A 1T99A 4Q4MA 3VKKA 4JXCA 4A3RA 1A5AA 4UWMA 3A6OA 4DRSA 4W8AA 3Q94A 1TJ1A 2QHAA 1NY1A 1W5MA 2GVJA 2WJEA 1OINA 4P8VA 3E49A 1LORA 4PMZA 4XUYA 4L1WA 1PX3A 5AY7A 1UA7A 3CL8A 3W24A 4FR6A 4MB1A 1H3GA 4AD2A 1UD2A 5EPDA 1O66A 3CNYA 3TVAA 2OWWA 3LX9A 1Z3NA 5E1QA 4KW2A 1FWHC 2DSVA 3B8VA 2P3EA 1LOLA 1ONEA 4JTSA 3LLDA 4IMGA 2UY3A 1I2QA 1VFOA 3GNOA 1HN1A 1DOSA 3W3OA 4I5XA 4RNIA 1BYCA 5HJLA 4WUIA 2XWDA 4PBFA 2XTKA 3GXIA 4Z2JA 4W4QA 3TNBA 3VE9A 4BCEA 2XIMA 3SY1A 1RH9A 2PDNA 1TQXA 2KZHA 4ERGA 3B4UA 3CTLA 3ZJ6A 5I06A 1Q45A 1QU4A 1NELA 1QJWA 4AIUA 1K70A 3TW6A 3EDJA 4BQ4A 1RXOB 4K7VA 1P48A 1WZLA 3VI2A 1X8CA 2FGBA 3KZSA 3W1UA 4KCTA 1WZMA 2BXYA 1YE6A 2HZGA 4WCJA 4HOZA 1S2TA 2YXXA 1WPCA 2WJFA 2QCNA 4AZCB 3IVUA 2YBVA 5LA0A 4WXYA 4Z1YA 1B2YA 3M0MA 4B5SA 1F61A 4GNJA 4GXWA 4QCEA 4U2ZA 2WOQA 1UYQA 2CBUA 1UOZA 2ISWA 4NZ3A 1B3OA 3W7IA 4FOKA 3NO1A 1DEDA 2WMIB 4XVEA 3BMVA 3W7DA 2VX7A 4Z17A 4RJEA 3FYPA 5G4EA 3NSNA 3CYJA 2VCAA 3AUOA 3W37A 2OU4A 1UQZA 1ZHAA 3HG5A 1LRNA 4KWWA 2Y5EA 2YZ5A 5CCZA 3I3BA 4J9JA 1QXLA 4MLJA 4C6EA 1TE6A 4WEVX 3HMCA 1BF2A 3WN6A 2HK0A 1GVEA 2YL9A 1M1BA 3A24A 3C0QA 4RZ5A 1L6SA 3R79A 1M6JA 1LQ2A 4QNEA 4F9JA 4M24A 4Y8EA 3VILA 4NILA 3F4DA 3KOZA 1NU5A 3W1AA 5H2ZA 3C0LA 2ZZ4A 1G0CA 3PSWA 1SUXA 3IIZA 5I78A 2ZOXA 4I7UA 3KEHA 1RD5A 2OODA 1JXKA 5ECUA 3M6YA 1LUCB 3OZOA 5IXEA 5H8UA 3CHVA 4J3XA 3MC5A 4IZGA 4MADA 1JDDA 2W63A 3MVTA 4Q3MA 4MMWA 3ABRA 4LYKA 2NV1A 4V15A 3F2CA 5A6BA 3LLFA 3AZRA 4AC7C 3V35A 3E5PA 4IPJA 4HNLA 4PMDA 2D24A 3GU2A 3N73A 3PTKA 1QPKA 1FCQA 3QQ1A 4TIMA 3DIPA 4N9BA 3LEPA 1UP0A 1SR0A 2PDGA 2ZA3A 2PB1A 3H2MA 3AWOA 5AECA 1AQHA 3VO0A 1D2KA 4QE5A 4J1OA 3BL3A 2G95A 3EDEA 3O6AA 3CLWA 4IMEA 1VPQA 4UR8A 3PPGA 2YDRA 4HCDA 4KIEA 3W73A 4IQJA 1UD6A 4IT1A 4LSBA 3LERA 1CYGA 4HU4A 1A0EA 1FWNA 5A6MA 4IIDA 1AG1O 3UJ2A 3AROA 3HB9A 3T81A 3L23A 4XO7A 4KETA 3GY1A 1GCYA 1R86A 2WZMA 1J0IA 1OZQA 4GLEA 2J8GA 1YBQB 1U1UA 4OHQA 5CSSA 4D6FA 3I10A 5DT5A 3EPNA 4PZVA 4M8UA 4RPQA 2VDIA 1J4EA 2W27A 3POHA 4BF9A 3GH5A 1TWSA 4YJ5A 1EDTA 1UZ1A 4Y9AA 5PTDA 4GKLA 4E4UA 1XYMA 4ICMA 1MNZA 4ZO7A 4ZFCA 1DP0A 1F4HA 2FDMA 2R8WA 2CBIA 3OA3A 4EWJA 3WQPA 2PP1A 1NFBA 4QG6A 5C9WA 5LXEA 2W66A 1CLVA 4GX8A 2YSWA 4GUGA 1R87A 4S23A 4RZBA 5A94A 1W32A 1QI4A 1SQ7A 3MUZ1 2CFFA 1UHVA 2GLKA 3GDMA 2ZRXA 1NFGA 3WYZA 3LRKA 3SI9A 4Z2IA 3KRUA 4PMQA 3W28A 3PJTA 1AH0A 2V5JA 4ZOAA 3EDFA 5D05A 3ALGA 3KVLA 4IMDA 1H61A 3V0UA 1EJVC 1HTIA 4BI5A 4CQ9A 2ASHA 1XCXA 3WK3A 4JEJA 2C18A 1V3HA 1A50A 2GYIA 3URQA 1JAEA 2J25A 2PGEA 1YRRA 3IEBA 4L4MA 1EEXA 2CWXA 5J8LA 4BJHA 2E1DA 3EXRA 3BLOA 3QR0A 2DT0A 2C1HA 3CIXA 1JDEA 4HOXA 4L64A 3AC0A 4OOUA 1CEOA 3CQHA 4YCPA 2PLJA 3A47A 1OIMA 2BOEX 2V68A 3ARZA 3ARUA 3LGEA 4E8GA 4I8YA 1XBYA 2REQA 3WNOA 1IEVA 4JQ3A 1EWEA 3EKZA 1PBGA 1XIJA 4H6RA 4D6GA 4HPJA 4ZO6A 3AZSA 1MXGA 3OO2A 4GBUA 4GA8A 4AWUA 2C16A 5BYWA 3ZVHB 5H6HA 3MZNA 2ESCA 3TLQA 1O94A 1SFLA 2GDQA 4JOMA 1KGWA 3M0LA 3CUFA 4PTVA 3S8HA 1TTIA 2ACUA 3V36A 5A6AA 3WLNA 5A6SA 3SSZA 1PYMA 2R1KA 1BTCA 1QRQA 3TW9A 3S1WA 1H5YA 3AAMA 4KMQA 6CGTA 3WZ0E 8A3HA 3PPCA 2POZA 1LCOA 3UG8A 3A4AA 2ZFAA 3GC5A 1FWFC 1OVDA 2ACSA 4GIYA 4LFYA 4A6GA 1YDNA 5CPLA 1V5XA 3O8AA 3UZYA 2Z7KA 2BHYA 3G1SA 2VVNA 3W7HA 3W4RA 4UCGA 3VNIA 3ITYA 1VYPX 1ISWA 3NZQA 4OT7A 2NV9A 2OCZA 3KAOA 3OBKA 3VNKA 1D9EA 1RQHA 1NP0A 4Z1CA 2Z25A 1V02A 1P4CA 3RR1A 3S5ZA 3RM4A 4H9YA 2HEJA 2WLYA 1KKRA 1WUEA 1IZJA 4H9XA 4B91A 2DZUA 3HQOA 2HPMA 1AD4A 1P7TB 3C3UA 1MNSA 2MNRA 3KDOA 3TJ4A 2X8RA 4MIMA 3CO4A 4HNVA 1TPH1 2CXGA 4US5D 4BI6A 4NZFA 1MZRA 2F84A 4TVUA 1B1YA 2YGYA 4TV6A 3E74A 4PYSA 4R85A 4BF7A 3SR7A 4DBEA 4HNTA 4LBRA 4O14A 1S38A 3RLGA 4QCFA 4X0NA 3GTHA 2C13A 5A2AA 3S46A 4J3SA 2PDFA 3FLUA 5I6SA 2Z24A 5CEWA 3WLOA 4W7VA 3S2NA 1YW1A 3MQTA 3PN8A 3LTYA 3PBVA 2JIWA 1HJXA 3O6YX 3FSTA 3OU8A 3KCLA 3WD4A 3M0ZA 2QDGA 1Z41A 4CCCA 3FKKA 1MQQA 3LI0A 4LAMA 1POKA 4IIBA 4E0CA 3GXDA 5MF5A 2CLFA 4LOCA 4LAZA 4BI7A 3L7RA 2V63A 2Y1HA 4FOUA 1HVQA 3KOYA 5H8MA 5HOSA 1EF2A 1ZP4A 1ZBWA 1E51A 3CQJA 4JKKA 4HP5A 5AYIA 3FYOA 3GG0A 1E0UA 2VGFA 3GG8A 1JYNA 1KCLA 5KETA 1KBJA 3PG9A 1XC4A 5DX7A 3FOKA 1H0GA 3QPYA 2PF0A 1E4MM 5EFFA 1QUMA 1E56A 3VU2A 1SVDA 3VKAA 1TPC1 4PCPA 2VFEA 1X98A 3POCA 1DVJA 3LNPA 4UMBA 4GZ7A 1AQFA 3UG5A 4E6MA 3RLUA 5A6KA 5HQMA 2ZC1A 2NXHA 2FTPA 1HKWA 4AVFA 2GJXB 1QBBA 1N82A 4JTKA 4DWDA 2VZTA 1FWBC 2FB2A 3TN3A 3ZMRA 4X61A 2A7RA 3L5MA 3HMJG 3ES7A 1JGIA 1REQB 2R1LA 4L56A 3DFTA 3RXZA 4HYRA 4UFMA 1LT7A 1LOSA 4HSNA 4RKAA 1V3KA 1W1YA 1I1WA 4C91A 2INZA 3BANA 3SGGA 4E3VA 3M9YA 4MZ1A 4V1YA 2D69A 1LJYA 5A2BA 3C2EA 4H19A 2FZBA 1TVPA 1GYNA 1H49A 1NOFA 4ZO9A 1EX5A 3WL1A 3C8FA 1I4NA 1E6SM 3QJAA 4UXDA 4H1ZA 4JFUA 2QCGA 1OFBA 4INFA 2JKAA 1BF6A 2BASA 4H00A 2F8QA 4YYCA 4DI9A 1V6VA 1QHOA 5DXXA 3RMJA 3UY7A 3H54A 1J9YA 3C2VA 1L8NA 4Q6JA 3GIQA 1XPGA 4J5NA 5CQ1A 4XB3A 4M29A 2GFTA 3CC1A 4ZCWA 5G1MA 1B3VA 1PXGA 3VTRA 1C8YA 1BQCA 3DI1A 2VRKA 4S3JA 2ZUTA 3WMSA 2WSQA 4B4HA 1K9EA 3T6CA 3UXDA 4FNUA 3MI3A 2PDHA 3H2EA 1H7RA 2D2HA 1ONWA 3NG3A 3LSBA 1L6FA 4G1NA 7ODCA 1BYAA 2VKZG 1GKQA 3FX4A 5AYZA 5HINA 1KFKA 1GJPA 1FDYA 5LGXA 3UWZA 2YJQA 3IK2A 3VNLA 3AIVA 3L0GA 3GAKA 5JBDA 1Z42A 3KWSA 3V0TA 4ZE4A 5BWAA 3WJZA 1NTHA 2CLLA 2I56A 3SUSA 4PUUA 1TG7A 4JTHA 2PWDA 4V2XA 1VFUA 3EKGA 3PSVA 4GQGA 4UTJA 3RMEA 3UY8A 1MEIA 4W87A 1YDVA 5EMLA 4MPKA 2VFGA 4YNGA 2QVNA 3UERA 3VINA 3THUA 2VOMA 4E2DA 4CCEA 1VBGA 3CV2A 2NT0A 4IQLA 4IJBA 3ISIX 3G8RA 3MI6A 3R10A 1TPEA 3QRHA 4AEFA 3A12A 5I5RA 2XU2A 3N1AA 4UMCA 2DIKA 4O16A 1JZ7A 3VDBA 1GVFA 2NWRA 3S0CA 2GGIA 4F9DA 2XHYA 4AZHA 1OFRA 3H2CA 2AQWA 1XSKA 3A9BA 4JL1A 3U0HA 1OYCA 3G1VA 1J96A 3OZMA 3SJNA 1UW9A 1XGEA 3CPRA 3F4NA 3BICA 1KXQA 1US0A 3PUGA 2OSYA 4DIAA 4AYGA 1K02A 3IANA 4GE8A 3P6LA 1J01A 3W7KA 3FCPA 2C0AA 3WF4A 3OQ8A 1H60A 5E09A 3BAWA 5HNRA 2VEIA 3G1YA 3I65A 4G7EB 4B2DA 3P74A 1SO6A 3SUVA 2DVTA 4JTJA 4JFWA 4CU7A 4HQVA 1D8CA 2NQJA 4WHBA 3CAQA 4ZQPA 2P0IA 1IT8A 3LSCA 1ZTVA 6ALDA 1IWPA 4W88A 3W83A 4U3AA 1QNQA 4HZ7A 4LGXA 3WNMA 1XCFA 4NSBA 4Z1DA 2OLAA 1K9DA 2YCKX 3B0VC 4KCUA 3UWWA 1ZAJA 4S3KA 3O6DA 2V5KA 1FWTA 1X8FA 4ACYA 3PZQA 1JFXA 4NJHA 4FMVA 3P80A 3BAYA 2P8CA 2E77A 3ORWA 1W56A 4GISA 4M5PA 3MHUA 1GOQA 4CCDA 1AW1A 3O16A 1JDFA 3LU2A 3TR9A 2FKPA 1PX8A 4S3FA 4UQCA 4O17A 1JF6A 3CMJA 4UB9A 3MMUA 4FLSA 1DXEA 3BK0A 5HAOA 3T7VA 4KPLA 3M64A 1JAKA 3U7BA 3LXCA 3KLLA 3NGJA 3O0FA 4YYFA 3O06A 3MI2A 4CUCA 4GOAA 2QPXA 1UC4A 1IF2A 3LZ5A 3UJEA 2HMCA 1TUXA 5HR6A 2PRMA 1UIPA 5CJNA 2XSBA 1GOKA 4S3DA 4EKJA 3G0SA 5A6BD 3ANYA 5E70A 3HIJA 4MDOA 4QDMA 5DT7A 1M9HA 4WDUA 4PMRA 3WDRA 1XI3A 1QO2A 3L4VA 3PBUA 3BLKA 1IEQA 3WFAA 4FK9A 2IPWA 4KFNA 5A8PA 4X63A 3E6EA 3TZNA 2XH2A 1F73A 2FPTA 2D20A 2PP0A 1W3JA 3CO8A 3WDJA 3Q67A 2HE8A 1U1HA 4MY8A 3UF9A 1EFZA 1OG6A 2VYOA 3KCOA 4JX4A 3VX1A 4U3CA 2DH2A 1E5NA 1YXYA 1KQZA 4C6IA 3W84A 1JCYA 4K1WA 5CG0A 3C2YA 4UTLA 1TPDA 1RPXA 4S2CA 4GCAA 2J13A 1GG0A 1ESWA 4MYXA 4EPKA 6ENLA 4F2BA 2ZIDA 1GVYA 2BZNA 1PTDA 3LM7A 3SUUA 4RDVA 2ZXAA 1SSGA 3INPA 2PMQA 3BZGA 4Z1BA 4NX0A 3WDHA 4UR7A 2POTA 3W1NA 2OEJA 4WKFA 3PG8A 2BB0A 4R27A 3IJ8A 3V1PA 4B4FA 3N9SA 5HMSA 3UNDA 3VIPA 4P8WA 4MUZA 3V0SA 2NQ9A 3R0UA 4JN7A 3QVQA 1XLDA 4O1BA 2HCVA 1DL3A 3MJYA 2BMBA 4CNNA 1IZCA 1KQYA 3W2NA 2QKFA 4YMZA 3CXOA 2PDKA 5EY5A 1S5WA 1B90A 4TV5A 2F61A 4YWIA 3FS2A 1H41A 2QJMA 1D3HA 4IIGA 1W9UA 2V5CA 4NZ1A 1PTAA 3IGUA 1UBPC 4ATDA 4AIOA 1B9BA 1H1YA 1Q8JA 3MJMA 3EPMA 4C6KA 4I9AA 1BVZA 5DMLA 3CH0A 2D0GA 1K7XA 3A3HA 4TX6A 2FJUB 4ZOCA 2GPTA 3WBWA 1O68A 2ONEA 3K1GA 3AXKA 2WB5A 2AGTA 3VMNA 3CTTA 5LXXA 3G0UA 1LWHA 4IJRA 4PGLA 1J0JA 1PYFA 3K46A 5FSEC 1JQXA 2WVSA 3SUWA 1UA3A 4XAZA 3T4CA 4B5WA 4LC8A 3QW4B 2C71A 4E4FA 6REQB 2UV8G 1BXBA 1Q8AA 2Z2AA 5JH1A 3II1A 3ZSSA 1XLIA 3GH4A 4AWSA 4IHCA 3CB3A 1Z7AA 4YVPA 1LRQA 3WF2A 2A3AA 1VCFA 1B4KA 3CS2A 3S1XA 1IE7C 2E0PA 3EB4A 3ZS4A 1GW1A 1I2OA 3UXAA 5C9RA 3IIOA 4C1NB 2WC7A 2GSJA 3T44A 1HL2A 4GYJA 3FVDA 4OIFA 2D73A 2WNNA 3WENA 4BS0A 3WUGA 1DORA 2EG7A 2CWNA 3P62A 2OXNA 2J8FA 3AS2A 3PBMA 3MCMA 3VNMA 3LHWA 5JBEA 2XM2A 3F03K 4L1XA 1P0BA 4JTCA 1W3IA 1RY8A 3K8LA 5ABGA 4HNUA 3SY8A 2RHGA 4DXXA 3SO7A 3E38A 2XVGA 2QCDB 3GVVA 2O4MA 2FYMA 4ADTA 3ZQ9A 3UT0A 4J3WA 3GLCA 3NM1A 3H70A 1UKSA 1CGWA 3PBGA 1OF6A 2X16A 2D2GA 4BEQA 4MLRA 3U5UA 2PE4A 5HWJA 3EOOA 2DDXA 3BSGA 3WQEA 3ZLFA 3FEQA 2QPUA 3M16A 1EIBA 4IMCA 3RYSA 4TXEA 1EF3A 2ZRYA 1IT0A 4IOTA 1R9XA 2PTXA 3VIMA 3DKJA 5D38A 1DWAM 2J47A 1PV8A 5GPRA 1GWJA 5AVNA 4YN5A 1TWIA 5M1TA 3AXIA 1PE1A 1S3TC 1V0KA 3KBSA 2YCJA 4TTUA 3AS0A 5AHIA 2VRQA 3R94A 3R4IA 1OEPA 1OT2A 1UWAA 4WF7A 1RP9A 2OZ8A 3VIJA 1TCMA 1WQ5A 4S3CA 1FP8A 1Z69A 1OYBA 2E9LA 1Z89A 3WD2A 1G4TA 2ZRZA 3W7NA 3LG3A 3NQMA 4F0LA 3QLDA 3MBFA 4NYYA 4JTRA 1NWSA 1SYTA 3AWNA 4RE3A 2OEMA 1PUDA 3IRDA 1IIHA 3TYDA 1UPMB 5C2XA 3APTA 2CLKA 2ZQ0A 3KL5A 4X3ZA 2WM1A 3UXKA 1WDDA 2V8ZA 2QGHA 4NYUA 3VM7A 2PWEA 4AHQA 3EWYA 3QZEA 4PCFA 1NSJA 4W93A 3T42A 3W81A 2Q3RA 4TR9A 1CXFA 4U28A 5HQEA 2BY0A 2HE5A 5E6YA 4F0SA 1TPWA 3TAKA 2ZC8A 2D2JA 2WNZA 4NT0A 4QLJA 2Y85A 2G3JA 1ITCA 4U5IA 4G2DA 2GGEA 4GNVA 1KTCA 3QOMA 1A5LC 3WFZA 3DU0A 4GYPA 3DENA 3S9ZA 1XG3A 3ARWA 1LLOA 1G7UA 3QN3A 2ZXDA 4GINA 3DKLA 3FFSA 1DPMA 3SIMA 3FXGA 3BO9A 4PTWA 2A0NA 3OVRA 4NQ1A 1BQGA 1CENA 1B54A 3HPFA 4GI8A 1RZMA 3ZXWA 4BWLA 2EBNA 1UUMA 4AY1A 3WH9A 3TYAA 4UTWC 3S42A 1HP4A 4LNYA 3M6DA 3DOPA 1QASA 4TQTA 2NVDA 1V4YA 3D47A 5BW6A 4MJMA 3BAXA 3W27A 2WHKA 3TCEA 1E9ZB 3SCNA 4C7GA 1X38A 4XZHA 5A1AA 2DSZA 3P2VA 1K8ZA 1MFVA 2PDLA 4CN1A 4AIEA 2IKIA 3CT2A 2F2KA 5F4XA 2ZDRA 1YYAA 3QQWA 3V4BA 4FAMA 3H4XA 2BG5A 1OZMA 4GI4A 5MHBA 1MFUA 4GZEA 1XLGA 2CXEA 1KFBA 3DX5A 4F2TA 4HK7A 4D1JA 3D46A 4O1EA 3B9AA 4FA3A 1P0NA 3R13A 3LHUA 1WDPA 1BPLB 3AHVA 2ADAA 1VR6A 2HQAA 1EQCA 4AZ6A 1MW0A 2ALRA 2V69A 1TKKA 1OC6A 1FWSA 2QMKA 2RGLA 3SQLA 3DZ1A 2HVNA 3BW2A 3CHDA 4FEZA 2C8NA 4RXFA 4K8GA 7TAAA 1H51A 1KBLA 3GVGA 3DN5A 1QW7A 3I6TA 2AOSA 4QGCA 2EO7A 4V27A 3LY0A 1W8SA 2P5NA 1JI2A 2XYLA 2E5BA 2YW4A 4FX8A 5BMXA 4I7WA 3BPWA 2J7CA 1BHGA 1F5ZA 5I2UA 1A5KC 4DNMA 4ILSA 4GZJA 3BUVA 3EEZA 3QMRA 3CT7A 3G3MA 3VNJA 2WVTA 2YIHA 5E0KA 4Q8OA 2IS7A 1DJYA 1FBAA 1UQYA 2GZXA 1GEQA 1RJRA 4M3PA 1BWLA 5HBFA 3H4GA 4LPCA 4ASTA 3LPFA 4KCWA 4KWUA 4NI8A 1UWIA 2HJPA 2H9AB 3LHVA 1EHNA 1DJGA 5ABFA 1OM0A 1YTDA 3S1GA 1I75A 3TN4A 2YFNA 4O1CA 3C4UA 3D5HA 2XH7A 5HULA 3W70A 4NKCA 4M80A 3GFZA 5C2CA 1XDJA 2PDWA 4REQB 4C6QA 1BFNA 2W4XA 2AGKA 5GJNA 2VC9A 4C6DA 1V3IA 4FALA 4EP8C 4GO8A 1XPYA 3IJQA 3ONCA 3E02A 2FPYA 4E2BA 1RR2A 4QTGA 4W8BA 8XIMA 3UR7A 1DIDA 3W72A 4ZODA 4CU6A 3M46A 3WSUA 4WGHA 5FEZA 3W0KA 4NF7A 2J4GA 3GX9A 3L9CA 3ZWSA 4XAPA 4Q8QA 4Z08A 1W54A 1RSCA 2E6YA 1K9FA 3H7RA 1FXQA 2EJAA 4JDYA 5J5RA 3STFA 1UR0A 2Q8ZA 4XV0A 1C90A 3EDKA 2DUZA 5KITA 3VIFA 3AIQA 4OFCA 1C3FA 3PANA 3ZJ8A 2VEMA 1LTDA 3AXHA 2FZ8A 2X2GA 3VOFA 5BZAA 3NZPA 3G22A 3OZPA 2QQ6A 1ZBCA 2P8BA 3KE0A 5LA1A 4C6OA 2HWGA 3LCWA 1O95A 4F8XA 1XG4A 4I5RA 4DLFA 2X42A 3JS3A 3M4HA 5F1UA 3IAQA 3H7VA 3CUIA 5MKGB 1LLWA 4GIAA 4PMOA 2BVDA 1P1MA 2PFHA 4PEKA 3TQ0A 1ZP3A 4FLRA 4F79A 2PA6A 1PO9A 2HDJA 1ONRA 4PRWA 3UWVA 1VCGA 4BZYA 2QAFA 2Y88A 3GHUA 4B2DD 2DSKA 2XN0A 1P0EA 1BSIA 1KR0A 2VP8A 3EX4A 4O8AA 4JR5A 1TFVA 2VX5A 2JALA 2PTZA 3U5YA 4MB3A 3W82A 2G4JA 1ECQA 7ENLA 2A79A 2CKSA 3GZAA 1FHVA 1K9TA 5D33A 2YB4A 4KGJA 3K2GA 1XUUA 3W1MA 3WQ5A 1CGVA 2G5WA 1UZDA 1V3JA 1JPKA 4FXRA 1KFLA 1H1NA 3LCIA 1XHGA 3TP4A 2WANA 3VGDA 5HUPA 5FKYA 5C70A 1R2RA 3BJTA 2Y7EA 3U6WA 3E0WA 2XIOA 3ABOA 5JU6A 4GG9A 5GNZA 1PDZA 2NXGA 1F8MA 5FF3A 3N3MA 3N2BA 1EWDA 4MWAA 3N2CA 5HANA 3M5ZA 1HVXA 4IIFA 2ZCGA 3S83A 4PUWA 1WYIA 3OVPA 2MANA 3W7OA 4ACZB 3ARPA 2DSUA 3W2KA 3H53A 4QS5A 2HRWA 3BCFA 1DBTA 1HO1A 1SMDA 2OSWA 1A47A 1XH1A 3ELFA 1UWTA 4ZENA 4GQQA 3LNMA 3UPWA 4K8EA 3DEQA 3B3DA 2WPBA 4NX5A 1D8WA 1H7XA 3W85A 2AKMA 1EXPA 4UQAA 1JD7A 1T41A 3LYEA 4GWEA 4OGZA 2ZZ3A 3NURA 2ZUWA 4LJ3A 2A4AA 4C6NA 4EAYA 5DFAA 3W71A 1SPQA 1JZ8A 4K3ZA 3WEZA 4G1KA 5HDRA 3H4WA 1XV8A 2NUXA 1A5BA 1S2UA 2YA0A 2ZWYA 4CKQA 4MJ2A 4UQDA 2FJKA 3NXLA 5CGTA 4CD6A 1IGSA 2OKOA 3CH9A 3GW3A 4PSPA 1E0TA 3HJZA 4X2RA 2W67A 4ALDA 4CD4A 1EC9A 4DZ5A 1FWCC 5GJMA 4OZOA 3CHFA 3VABA 1G01A 1EJUC 1X39A 3WDIA 2C0HA 3W00A 1C93A 2VGGA 4IFKA 1RBLA 5F4SA 3JZUA 3W76A 2CITA 3EKLA 1E40A 5BRPA 1K6AA 1N2VA 4HJFA 1W9PA 3S5NA 2GJPA 2WLZA 1KXHA 3AUJA 3IIVA 5TAOA 1ZNNA 4E38A 1QNPA 4WX2A 3L65A 3FV9A 1XC6A 4X9SA 3UWQA 4KEVA 5BU9A 3FJ6A 1M3UA 4FXFA 3I4EA 2EXOA 1U30A 9XIMA 4C7DA 1EC8A 3E0LA 4AD4A 4MNLA 1X1OA 1A5NC 4HZMA 4YS1A 3VCRA 3ZT5A 3T8LA 2Z26A 1VRXA 1WB0A 2ZBTA 1W1B1 2TODA 4JTQA 3WK0A 1DJWA 1PZ3A 3HGOA 1V0NA 2AL1A 1GGOA 2JQXA 1FP9A 3DC8A 4P2VA 2Y62A 1J0ZA 4R3UA 2I57A 1EP2A 2FH8A 1RPKA 2WBKA 3P14A 1CPUA 1POJA 2HNEA 4I5UA 4XK2A 3EX6A 3EWDA 5C55A 5XIAA 4ZTYA 1UJQA 1VFMA 4LBSA 2BS9A 3HTWA 7A3HA 4GRSA 3IGSA 1HL9A 2Y63A 4ROQA 5AKQA 4EOUA 3NQEA 5DN1A 1IEIA 3GXPA 2ZX7A 2EG8A 3K4DA 4Q8MA 1JZ6A 2PD5A 1FTXA 4ZBCA 1PWMA 3ZVIA 5SWUA 2G8ZA 4MNMA 2QJHA 1QFEA 3PWAA 4B5VA 3B9EA 3DUGA 2OO6A 5HJXA 2DW6A 3S6TA 1KNWA 4B15A 2OVLA 3W88A 2XGZA 3BGAA 1IEWA 4GO9A 2XFYA 3RM9A 4K36A 2YA2A 2DV0A 1TQJA 3GYEA 4J3TA 4CNOA 3GG7A 2EPLX 1E4NA 2H8ZA 3A13A 2FZMA 4P7LA 3LB0A 4UTTA 2XISA 1WAUA 1VJSA 4DJDC 3S6OA 3FHQA 4JTIA 1Z6KA 4P8UA 1N55A 4KEMA 1XIBA 1J6OA 5I09A 5DBUA 3I3EA 3U3HA 3H21A 4HPNA 4OWGA 1K8YA 5TNVA 3N2TA 3L68A 1HT6A 5H1WA 3KL0A 1JGMA 4Q6XA 4QQ3A 4ZQMA 5I03A 2DW7A 3GD6A 2BY1A 1W1PA 2X1RA 5D09A 1TIMA 3M0KA 3YPIA 2VM8A 3A21A 5A8QA 1QNRA 4GYKA 2PDUA 4K6AA 4MKNA 5C5YA 3OEXA 3UWUA 1N8WA 4GD0A 3QC3A 1QR7A 3LCHA 1WDSA 3PK7A 3WD3A 4DO7A 1EO5A 3W6YA 3LGDA 3IPWA 3T9PA 1YXCA 1K77A 4I6KA 2Y2WA 5G5IA 2QUTA 1J12A 2V2CA 3BZJA 1N8FA 2XIJA 3VUSA 4BEUA 2Q09A 4PUDA 4R9OA 5XIMA 1KM1A 3ABSA 2DT1A 4PODA 1Y65A 2WO5A 3S9YA 7CGTA 3NL6A 4XD4A 3RX2A 1OF8A 2GOKA 3CQIA 1A3XA 2J7EA 2SFPA 3MMTA 4EE9A 5KZ6A 4N9DA 1HIZA 3WJWA 2YL6A 3PWIA 1S46A 4V28A 3HG3A 4WLCA 2NQLA 2J66A 3RO8A 4L65A 2HBXA