4K7VA

Oye1-w116a complexed with (r)-carvone
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLAVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 149
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4k7vA00
2YGYA 4DF2A 4UR7A 2Y63A 1QDSA 2ZA2A 2R94A 1S5WA 4LS2A 4NZFA 5D2TA 3S42A 1TPWA 2X1TA 3MP5A 1IXQA 5LZLA 4NXKA 1H5YA 1TB3A 2NX3A 3TUUA 4O1AA 3LCFA 2GQAA 1FX6A 3W7CA 2FPVA 2CWNA 4UTWC 5A8GA 3EKZA 3GK0A 1SUXA 2QEZA 3B8DA 4P2VA 5DN1A 4K7VA 2CLLA 5D33A 1ZAIA 2YFNA 3N9SA 4OQVA 1IF2A 2WOQA 1PCWA 1QPOA 3L67A 4EF8A 1GVOA 3E12A 3GKAA 1KBJA 1R46A 1LBLA 2RKXA 2H90A 4MZ8A 5F2GA 1PE1A 3W7KA 1OFOA 2QCCA 4MUZA 1N8FA 2XN1A 3NQ2A 3LI0A 2V5LA 2G96A 3FJLA 1WYIA 1YTEA 2VFEA 3OVPA 3BPWA 3TA6A 3L5MA 4IQLA 3STEA 5HUOA 1WBJA 1KFBA 2TPSA 3TR2A 3W1RA 1LP6A 3KRSA 3STFA 1KTBA 3HQ1A 3QFEA 3W6YA 3W7EA 3O6DA 2ZZ2A 3JRKA 1HL2A 2WO5A 1NEYA 4UFKA 3S1WA 3TH6A 3IEBA 3WFAA 2CZ5A 1QPRA 2E5DA 5A5WA 1WA3A 3LX9A 1W0MA 3NR0A 1P1XA 3M1ZA 2ABBA 1HFBA 1ICQA 4LS0A 3EB2A 3PSVA 2E5BA 5G1YA 1QR7A 4QIUA 1W3NA 3NZ1A 1Z41A 1OABA 2VKZG 2PRHA 5FEWA 2RDTA 2YW3A 4BK9A 3G1AA 3MJYA 4HPXA 2CZFA 4O1CA 4WOQA 1HO4A 3CPRA 4TR9A 1UJPA 3W2KA 1K8ZA 2V81A 4FX7A 4MLRA 3LCXA 3PB0A 1W37A 1L6SA 1R47A 2YYTA 5FF3A 2GOUA 1TQJA 1SO4A 3NO5A 3W1AA 4E2DA 5D38A 2J9YA 3LHWA 1HTIA 3P5YA 4FXSA 2A5HA 2YR1A 2G95A 4I7WA 1SFJA 3ZR4A 4M6VA 1L2UA 1RD5A 2WSRA 3LTYA 3DHDA 4UMCA 4JTLA 2YPIA 3C6CA 4M6PA 5KMYA 4UNKA 1X8FA 1VZWA 3L9CA 4JTIA 4LWWA 1YXCA 3FYOA 2BTMA 3QPYA 4S1FA 1GYNA 2A1YA 1WAUA 2C0AA 4WY0A 3TJLA 3FYPA 5K9CA 3Q94A 2P10A 1UUMA 3G1HA 5DY3A 4Z08A 3TQ0A 4HNUA 1JCMP 4FF7A 1CW2A 2A6NA 4MLJA 4O0KA 4RK8A 3LGEA 4IXHA 3G3MA 1G6CA 2DZSA 3RF9A 3MBDA 2OT0A 4Z0SA 3UXDA 1A5AA 1TPH1 3L2IA 4DQWA 5G4WA 4CQAA 1H7PA 4OBTA 2PRLA 2QCLA 4RLIA 4TO8A 3O06A 4ZMGA 5FEXA 3I7QA 5J5DA 2R8WA 4FO4A 2VFDA 2V2CA 3TKFA 3TMLA 1DL3A 2J9XA 5SWUA 3P82A 1EUNA 3G0SA 3NQVA 3R12A 1ZAHA 2QR6A 2NV2A 4O10A 2ZRVA 3PG9A 5HJLA 3W1NA 3TFCA 4JDYA 3NPUA 3QW3A 1JUEA 4LV4A 4XTIA 1TV5A 1B4KA 3B0UX 1W5NA 4JX4A 5G5IA 1G69A 3ZWSA 3TMQA 2FFCA 3W85A 4HNTA 2QUVA 3UYCA 3PSWA 4O4WA 1KFJA 3UWVA 1GG0A 5CG7A 5DLCA 1NFBA 4AH7A 1F5ZA 4YWIA 3QMSA 5AYZA 3W7PA 5AOUA 1MSSA 1F05A 1N7KA 3SIZA 3RLUA 4CCEA 4JYFA 1X1OA 5F1UA 4JIQA 5CZTA 2A7RA 3VI2A 2Y61A 1KM0A 3P7YA 3PBWA 1W31A 4O57A 3G1XA 4K36A 2YX0A 4GC4A 3H53A 4JTKA 4C1KA 2YCEA 3HGOA 1TTIA 1QO2A 4IPIA 4OV4A 4UTTC 2NXIA 1F7BA 2DZWA 2X1UA 1SO6A 7TIMA 4XQ6A 1G7VA 1G4EA 4CCDA 4H6KA 5EKYA 1OFQA 3GIYA 4DELA 1VLIA 5J5RA 5HR6A 3O8AA 4R34A 3UD6A 5CPLA 5DBUA 3LV6A 1U5JA 3IIZA 1Z44A 5AHMA 1TPVA 2ZZ6A 4UIOA 4JTFA 4XZ9A 3L5LA 3C3NA 4G1KA 4GUHA 2QCGA 2ZRYA 3B0PA 3NPWA 3ATYA 4AHPA 1YTDA 3NA8A 3AJXA 1T8XA 5D37A 3EXRA 1PHQA 3L21A 4O17A 2DZTA 1PL9A 4JD4A 1QOQA 3UY8A 4N02A 5DY2A 3W2NA 1JVNA 1EA0A 1O60A 3HGRA 1SW7A 3NQEA 1QAPA 1SPQA 5CPNA 1IXNA 4JDBA 3BLEA 2WV8A 4UFIA 3P60A 1I45A 3O15A 1EEPA 3KVLA 3INPA 1TPDA 1IIGA 1F2JA 2TRSA 2C13A 3R2GA 3HF3A 4FNSA 3QW4B 4LTSA 1DVJA 3EX1A 4IXXA 4OV9A 3F4NA 1Q6OA 2E6AA 1OFBA 3LI1A 4QM1A 4RKAA 4XBKA 3DGRA 3JS3A 2ZFAA 3TIMA 6ALDA 1VLWA 4Q4KA 3UZJA 3YPIA 3W7LA 1KLYA 4QITA 3LTPA 3WK2A 5D2WA 1OK6A 3HG2A 2GVJA 1EB3A 2PE4A 1R2SA 1G7UA 3W2MA 3P5ZA 3B0VC 2CW6A 4JTHA 4O18A 1Q3NA 4JYDA 4IOTA 4DPPA 1M5WA 4MPQA 3GDTA 1XUZA 3LTSA 2FQIA 1FXQA 5D03A 4LV9A 4MOZA 2P0OA 1MZHA 4K7YA 3IVTA 1PIIA 1ME8A 2CLOA 3PC0A 3NZRA 1RV8A 3C2OA 3FS2A 1YDNA 2BLEA 4Z1CA 3UPWA 3NQ6A 1B9BA 2HMCA 1YDVA 1S5TA 5LNSA 1NAL1 3GKFA 3JR2A 1M7PA 3QQ0A 3ABSA 1TO3A 2WPBA 4NT0A 5HWNA 2QUTA 1SW0A 3HG4A 3NM3A 4EWND 2ZZ4A 1SZGA 3LCWA 1SO3A 4LUIA 2DZVA 4GUJA 1ZY9A 4O52A 3C2RA 3C4UA 1TQXA 4R33A 1NF7A 3I7SA 5AHLA 4LVBA 1L9WA 1ME7A 8TIMA 2Z0IA 1UASA 4O1DA 1LBMA 2QCEA 1GJPA 3OBKA 5EYWA 3PBUA 1H61A 2G97A 3RLVA 1TPUA 3EX4A 1TV7A 3PBVA 4YL2A 1XKYA 3SECA 3WJWA 5F2MA 4L4MA 4X2RA 4A2RA 2QCNA 2NX1A 5F2IA 1VPXA 1XBXA 2JGQA 4CQ9A 3W1TA 2C3ZA 4Y8FA 3C52A 1TPC1 3TC7A 3LLDA 3N14A 1TYGA 1Y0EA 4Q33A 2Y7FA 1JCXA 1TPEA 3WJSA 4JXCA 5TBOA 2OX1A 3UZ5A 3OIXA 4PA8A 1FCUA 2V82A 1K03A 4UTKA 4M6QA 4MY8A 3QYQA 2NX9A 4YXGA 2J27A 4UTLA 3G1DA 4NVTA 4IUOA 1H1YA 1W5QA 1XUUA 3N3MA 4Q32A 4LC6A 4JTSA 3UXAA 1W1ZA 3QPZA 3EXTA 1LROA 2VFHA 2C1HA 4N4PA 3TE9A 4OHQA 4XBSA 3W7QA 3OVQA 4BR1A 2GPTA 4H3DA 2ATMA 2ISWA 1UCWA 3BO9A 3G8EA 1ZNNA 4ADSA 4DO4A 2FJKA 4Z1BA 1YDOA 1G67A 1KM1A 4FX6M 1R2TA 3BK0A 2FDSA 3NGJA 3GDLA 4FX8A 1XL9A 1MO0A 3O63A 3G22A 3QMRA 2E77A 3MW7A 1C9DA 1LOQA 2VEKA 2B7QA 5BMXA 1KTCA 5MHBA 1GOXA 3CEUA 5U7SA 3LB0A 2BWGA 2Y7DA 3KRUA 1LLWA 3W7NA 5AHEA 2OZ0A 4E0CA 3UWYA 4A29A 4TMCA 4YMZA 4EF9A 1K02A 4YCOA 3QC3A 1IXOA 2NXHA 2QUUA 3C0JA 2EF9A 1NVMA 2GQ8A 4IMDA 4L4LA 3LHUA 1Q6LA 3DAQA 1DKWA 3L68A 3IIPA 4RZ5A 4DXVA 2E09A 3M5ZA 1XCFA 1VJIA 4O16A 5FESA 4AF0B 4RJEA 3NQCA 2FPYA 2BSLA 4ADTA 4IMCA 3G0XA 4QISA 2NWRA 4K39A 4ZQNA 2WSYA 1GG1A 1W5OA 1VCFA 1XC4A 3OA3A 1VS1A 3W7DA 1QNVA 1FDZA 4M19A 1J4EA 3G3DA 3UWUA 4BF9A 1LBFA 3FKKA 3GDRA 1FUYA 2V2HA 4O11A 1FXPA 4NX5A 1QPQA 4TX9A 4MY1A 1H1ZA 2C14A 2PURA 2B7NA 1SR9A 2W79A 2C16A 1VC4A 2ABAA 5IM51 5DXXA 5L6UA 5HINA 1NSJA 1JCLA 2E6YA 5I3KA 3W7GA 4BWLA 2Z6JA 4ONVA 4HNNA 1IIHA 3I65A 4BFAA 4NJHA 4CNPA 1MEWA 2VELA 3DZ1A 3HGJA 4WX2A 4QAIA 3WJZA 2DJLA 2VEIA 3IV3A 1VH7A 3LLFA 3U8GA 3O6CA 2X30A 5LNRA 3M7WA 1ML1A 5K9XA 3W7OA 4LVGA 4XTDA 1OX4B 3RK8A 2B0MA 1LM1A 1SSGA 5FF2A 5T26A 4AWUA 4PODA 5KZDA 4QNWA 3LDVA 3LXAA 4JYEA 4RV8A 3CQ0A 4IX0A 5TQLA 2TYSA 4OU1A 1VCGA 4RXFA 1JR1A 2AQWA 4HIBA 3NXFA 2TMDA 3LERA 4RR4A 4E2BA 3RMJA 3CHVA 1EWEA 4X3ZA 1AW2A 4WXZA 2NUWA 4JN6A 3OVRA 1I4NA 5EA9A 3V1PA 3M5XA 5I3FA 2V8ZA 1KFKA 3LXCA 4WD0A 3NL2A 3IIVA 3KVJA 1Q6RA 1S3HA 4X22A 4BWLC 1Z48A 3N2MA 2WNNA 5D09A 2QCDB 4U28A 3TX9A 3I7RA 1GPWA 1VCVA 1JCJA 3A24A 1XBYA 4Z1DA 5EMUA 5I3IA 2OCZA 3BGGA 5AHNA 4MFDA 4UTMA 4LRSA 3GAYA 4I7UA 2V2DA 3VFLA 4TU1A 2GJNA 1YXYA 2FTPA 4N9EA 4ORIA 1VHNA 1VR6A 4AMAA 3FIGA 3F4WA 3MYPA 3A22A 1DV7A 2I9EA 2VFIA 3W7IA 4DF0A 3IVUA 1WOAA 2ZTJA 3PY2A 4JTGA 1KM5A 4XKYB 4M7SA 5CGQA 4LOCA 2OT1A 2PC4A 1V5XA 3EKLA 4AB4A 2ZCGA 4AHOA 2ZRUA 5CZ0A 1PHWA 3M5VA 2EPHA 1TMHA 4O15A 2B4GA 2XFWA 3LV5A 5I3JA 3FLUA 3LOTA 1F74A 4HSNA 1G4SA 1YPFA 1VHCA 2J9ZA 1KM4A 3GX9A 3NQ8A 1H51A 3E49A 2F84A 2JKAA 2YZRA 1M7OA 3S8HA 1GVRA 3IIXA 3C2VA 5KZEA 1O4UA 1PS9A 4A2SA 4O19A 2P1FA 1ZFJA 3CWNA 4QNEA 2AGKA 1BKSA 3BV4A 3D0CA 3MO7A 4AEOA 1G4PA 5AB3A 3ZWTA 2PCQA 5DCEA 3IGXA 4O53A 3LCHA 4UTJA 1FCBA 3PVFA 1GZGA 2NUYA 3DKJA 2QJHA 4LY8A 3F1QA 3TJXA 4O0ZA 5CSRA 4FNTA 5CPMA 2A7NA 1J2WA 4GUIA 1OYCA 3M43A 1XM3A 4FNUA 2W6RA 5HMSA 4S2CA 3S5ZA 2CLEA 1RPXA 1TREA 4JX6A 4FXRA 1KV5A 2ZA1A 4JTUA 3MMTA 1ME9A 1K3UA 1AW1A 3U6WA 3A9IA 2Q8ZA 1OFRA 2Z2UA 4JTEA 2NWSA 4UTHA 1L6YA 3GVGA 5AYYA 2J88A 3LXBA 1RQHA 1BWKA 2ZZ1A 1SSDA 1XBVA 1X6UA 3GDMA 4QSHA 3TXZA 1FDYA 3C56A 1F76A 2Y7GA 5G2HA 3Q37A 1O95A 4GUFA 1IGSA 4BI6A 4BI7A 4CNOA 4IWWA 2IQTA 2RDWA 3TSBA 2DP3A 4Y90A 4AF0A 5D02A 4NNBA 5KZMA 5FEPA 3ELFA 5FF4A 3L0KA 1EP2A 3CLMA 3MHUA 3MHFA 2B7OA 5F1VA 1B3OA 4UUIA 1N55A 2Q3RA 1GT8A 1T96A 5LHFA 3STGA 3W83A 5G2WA 3RNDA 3SJ3A 4WXYA 2EGZA 1LLZA 3R13A 3DI0A 3HB9A 3NYZA 1AW5A 5EY5A 2WJZA 1MEHA 3S0CA 1EUAA 5C2XA 3MI3A 2OJPA 1EIXA 1OX5A 2WKJA 3PUDA 3TROA 3TNOA 3W23A 4AXKA 1LTDA 3USBA 3G1VA 2A7PA 3IGSA 3MWAA 3VNDA 3W1UA 1GWJA 4K8EA 4BI5A 1H60A 3LBCA 2A6LA 5BNKA 3NEVA 5GVJA 4R7JA 5FF7A 1QPNA 3QSRA 2NV1A 3EWBX 1LDCA 5AYXA 2Y7EA 2CZEA 3ATZA 2YFOA 3GXTA 3MP3A 2JGYA 4N6FA 3KVMA 1KFLA 4GNJA 4N9CA 1OX4A 4WUIA 1PVNA 3SFKA 3B03A 1P0KA 3TAOA 4A3UA 3LRMA 3CT7A 1MXSA 2H8XA 3G24A 4KWWA 4X9SA 5KITA 5EPDA 4N6EA 3LHTA 3HO8A 4AAJA 1SW3A 2HS8A 3L66A 3THQA 3O16A 3BW2A 2RH9A 4LVDA 1I2OA 3AO0A 2CU0A 3DFOA 1ZCOA 5CZSA 3QRHA 3RFAA 2H8ZA 3DFTA 1H50A 2ZDRA 2V30A 3UWZA 3EX6A 1YYAA 2QCDA 1ICSA 2C18A 4JEQA 3MI2A 3QQ1A 1OYBA 2JKPA 4AWTA 4HN4A 4JNMA 2NUXA 3PB2A 2FLIA 1AK5A 4PL2A 3HIJA 1KW1A 2RHGA 4K37A 3B04A 3HGSA 2E5CA 1DORA 3FKRA 3NL6A 3TK7A 2Y88A 2QDHA 3NOEA 3WK0A 5H2ZA 3NL5A 3W2LA 3W2JA 1LRQA 3ZS4A 1TPFA 1T99A 3ABOA 1F6KA 5K4XA 2DU2A 2WNZA 4Z1AA 5LGXA 4UCGA 3UWQA 2Y62A 1SU5A 2R91A 5HR7A 3MYOA 5LKYA 1RQEA 2DZUA 3S5YA 3MBFA 1OK4A 1PV8A 1ADOA 3WJYA 3M5YA 4UTIA 1A5CA 1V7YA 5D05A 4ZVJA 1FBAA 1KV8A 3G1YA 4C1LA 3IIOA 2GVLA 4Z0JA 2JKEA 3G8RA 4JIPA 1EP3A 1WXJA 2QAFA 2ZZ5A 3W7HA 3B05A 3E0IA 1TCDA 1NF0A 4NJJA 3W72A 3P67A 4LRTA 4RZ6A 1TIMA 3CIXA 4ZQOA 3GZ3A 4KKXA 5BRBA 1TV8A 1SO5A 1I2RA 2QCHA 5D2XA 3EX3A 3PUEA 1HUVA 3HPZA 3UY7A 6TIMA 4LNYA 1RR2A 2I14A 4KFNA 5HULA 1L6WA 4WOZA 1WDWA 2ZZ3A 3KOFA 1P4CA 3B4UA 2CZDA 4TIMA 3W1MA 3VE9A 4NJGA 4LU0A 2ZRXA 3Q2DA 2RFGA 1OFDA 4AHQA 4LC8A 5K2ZA 2Y85A 1I8JA 2GJLA 3A21A 4NNAA 3FEMA 4UXDA 4ALDA 1GTEA 3TV8A 1JUBA 1RQBA 3EEGA 4ML9A 5LNWA 4LW7A 4DPQA 3ANYA 4GXMA 4DBDA 3LHYA 3W1XA 1W8SA 3HG5A 5CPOA 2JBMA 4O12A 3SSJA 1A5BA 3N73A 1VYSX 3H55A 5F4WA 3KXQA 1ZENA 2H3DA 1BEUA 5I3HA 4O8RA 1CI1A 4O50A 5E0KA 3W1PA 3C61A 1JRCA 5LGZA 4FNQA 1THFD 4LS1A 1LOLA 2Y6ZA 4NNCA 4POCA 4N9DA 3W07A 3PM6A 5HWMA 4ZQPA 4HPJA 5IBXA 3EWXA 3T55A 2CLKA 3EWZA 2NLIA 4YCPA 1LYXA 3W70A 3L5AA 4MYXA 1LRTA 1FWNA 2G5WA 2X16A 3KAOA 3N34A 5AC8A 2V0TA 1UBSA 4OWGA 4W9TA 1OJXA 4UTWA 1GTHA 4RZ4A 1BTMA 2BX7A 3NPXA 3W88A 1H7OA 1SZFA 3C8FA 2BZNA 5CKSA 5F4SA 3W22A 2D73A 3W7JA 3OHIA 3ZFHA 2DJXA 4NQ1A 3Q58A 4NJIA 5L9FA 2LLEA 4RX0A 1ZJIA 4OT7A 3I6RA 1FCVA 1W54A 4P61A 2VC6A 1XDMA 2WSQA 3CM4A 2EAWA 2CLMA 3TC6A 5D04C 4FNPA 3W74A 1WV2A 2NZLA 2B7PA 3SR7A 1O94A 3NQDA 3TDFA 3BLIA 5IBXC 3QF0A 4JY9A 1LCOA 3R8RA 1TJPA 4PEKA 2TSYA 5AHIA 2XN2A 4MFEA 1X1ZA 3T78A 2FIQA 1U83A 2E68A 3MHGA 4MVAA 3E96A 2ISVA 2OMAA 3BG9A 4FB7A 4D2JA 4K8HA 5BMWA 5D2VA 2VEPA 4PL1A 2AAMA 5AC7A 4HKPA 4AVFA 4IMFA 4RXGA 3HG3A 1DQXA 1XFBA 3PBYA 3TW7A 1R30A 1YXDA 4H4IA 5ABTA 1H7RA 2WQPA 4PTNA 2EKCA 3SZ8A 3NQMA 4O1BA 3W7MA 5F4XA 1LORA 2WNQA 1QO5A 3GNDA 1QCWA 3OEXA 5LNVA 1E51A 1WX0A 1OFAA 1XI3A 1Q45A 4ZQRA 1F73A 3TU9A 3MI6A 3GDKA 1OFPA 3GYEA 2FB2A 3CU2A 1TPB1 1AL7A 1JULA 4I7VA 1WQ5A 3QEZA 4J9JA 1D3HA 2I1OA 5D2YA 1FQ0A 4TMBA 3DFQA 3LBMA 4LT9A 4WY0F 5K3VA 3L0NA 3TAKA 4O54A 5HUPA 1K8XA 4PCFA 3W7RA 4DF1A 1HG3A 3LRKA 2UV8G 4UNLA 3TFXA 3KVKA 4HNVA 3G0UA 1VGAA 3O07A 1AL8A 3P8JA 4FIRA 3TW6A 3VE7A 2H6RA 4N9BA 2ZA3A 1VQTA 2CLHA 4KFPA 3TSDA 2X1RA 3PULA 1M6JA 4KFOA 5KTLA 1C29A 1GVFA 3SGZA 3LHVA 3MUXA 3IGUA 4ZQMA 3GNNA 4UTUA 1O5KA 2ZZ7A 1B4EA 1B57A 4MJZA 4GFSA 4B5NA 3L0GA 3A5FA 2QDGA 4IMGA 1XXXA 1ZAJA 3V75A 2NXGA 3T4CA 2QF7A 2C15A 3P84A 2XN0A 3W71A 2QJIA 1WOBA 3P62A 1JQXA 2O7QA 3PUOA 4O4VA 2DZPA 1T0OA 4HSOA 3S5NA 1H7NA 5CSSA 3SY5A 3LRLA 4MZYA 1OYAA 4MZ1A 1ICPA 4QQ3A 4OE7A 1Z42A 2HS6A 1GVSA 2GQ9A 4IGHA 3NNTA 1SQ7A 3S1VA 3HOJA 2H3BA 4NUWA 4NZJA 5C6MA 4HHPA 4YLWA 3U2OA 4O13A 4N2YA 3BG5A 2YSWA 2F7FA 4EIVA 1SFLA 5G1TA 3SW6A 3WK3A 3DHFA 3M9YA 1FWRA 2FPTA 5C55A 1OFEA 3KHJA 3P81A 1DBTA 1QWGA 1S5VA 1K7XA 3QSTA 1CX9A 2VENA 2ISSA 3FA5A 3W84A 3C2FA 1KFEA 3W86A 3O05A 4K6AA 4FNRA 4FHAA 4IJBA 4HT3A 1WBHA 1ONRA 1X7FA 3S9YA 2Y89A 4UTTA 3SI9A 1YTKA 3THAA 4KWVA 3GB6A 2JK2A 5K7JA 5G4EA 3G1FA 1ZALA 5G2IA 3BLFA 3NQAA 2Z6IA 5DCBA 3T7VA 1DHPA 3EWUA 1FWSA 1KLZA 2FB3A 2GVGA 3FJ6A 3NQGA 1FWWA 1KFCA 3DBPA 3P8IA 4JGDA 3PG8A 2Q8LA 1Q6QA 3DU0A 1YPIA 1YLVA 1PCKA 1RZMA 4U4MA 2E6DA 4JTTA 3T44A 3CWOX 3CEPA 2CLFA 4MJMA 3N9RA 3O1NA 3W87A 2C19A 3HMJG 4AWSA 1W5MA 5C54A 1OHLA 3KFTA 2V9DA 3NVTA 5TIMA 4ZZ9A 1FY6A 3DFNA 2YDAA 4UFHA 4ZQCA 5FF0A 5KINA 3GLCA 1W56A 3M44A 4GUGA 1JUKA 3P61A 2GUUA 3IVSA 5DXYA 3FFSA 4JY8A 3KRZA 4UFJA 3W76A 3GR7A 4MKNA 5EL1A 4IX2A 3PR2A 5LHEA 5K4ZA 4GWEA 2A85A 4OGZA 1JQVA 5LNUA 1DOSA 4A21A 3DH7A 3G18A 2CFFA 4ADUA 1LZOA 4NJKA 3W9ZA 3H54A 4K38A 1QMLA 3F03K 5D32A 5E1QA 2CLIA 3IRDA 1DJQA 3WJXA 1OF8A 2QCMA 4XUGA 1H63A 2O7SA 3DKLA 3CTLA 4WZHA 2ZTKA 3QMTA 2R14A 1LRNA 3BW3A 3WK1A 2ZBTA 3EWYA 2X1SA 1SZEA 2HTMA 3EWWA 1ZHAA 3CB8A 2RDUA 5F2LA 3LCIA 3LHZA 3NQFA 1TRDA 3TQVA 4O28A 3HJZA 3BARA 1I2NA 2J24A 3BGJA 4ORMA 2QKFA 2ZYFA 4LUJA 2A2IA 3K30A 2V5BA 2W0UA 3GAKA 4Y96A 2YW4A 3NL3A 1EX5A 5HQEA 1XBZA 1UB3A 3CIWA 1K8YA 2ALDA 3W1LA 3L65A 3LCGA 3PS7A 3BG3A 2QJGA 2E1DA 4UC5A 3TCEA 3M6YA 4JS3A 1VYRA 1QFEA 2EHHA 1YADA 1XDLA 2ZQ0A 3BVJA 5FEZA 4MIMA 3NAVA 4PC8A 1LOSA 3DFPA 3QJAA 5EBUA 1O5XA 1EPXA 1HO1A 3HBLA 4XWUA 4R53A 3CC1A 3MP4A 1TTJA 1W5PA 4CNNA 3W3OA 1OF6A 5AN7A 4XKYA 1P0NA 1BWLA 2J6XA 3KX6A 4S2BA 3UNDA 3C2EA 3GXNA 4MYAA 3TSMA 4FIQA 1IXPA 5AC6A 1RVGA 2QCFA 1FWTA 3DI1A 1GYLA 5H91A 3N2XA 1EWDA 1R2RA 3S6DA 4UMBA 5HNRA 4O14A 1C8VA 3HPXA 2QAPA 3UPBA 5FI8A 4IMEA 1J5TA 1OX6A 3NG3A 3A5VA 4RCXA 3I68A 1F6PA 2YXGA 3RU6A 5KSWA 1AG1O 1H7WA 3P80A 5HWJA 1JJKA 5E93A 4E38A 3NPVA 1A50A 3E02A 3M16A 3N19B 1JCYA 4GE8A 2VXNA 3VCRA 1H7XA 1SZNA 4Y6GA 4UFLA 1OVDA 4NXSA 1KTNA 3NM1A 3A23A 1TJRA 2Z1BA 3R5EA 3ABRA 4GRSA 3S5OA 3QM3A 1OG0A 3R89A 1KM2A 1DJNA 1KA9F 4IPJA 1H62A 3M47A 2BXVA 2ZRZA 3BW4A 3M41A 5CZJA 3W1QA 4M7TA 4DO6A 2A0NA 3VKJA 5C5YA 4EOUA 2VFFA 5DELA 1I2QA 4JICA 1KM6A 4JR5A 1KM3A 1TSIA 4NX0A 3EX2A 3TQKA 1QOPA 4UFMA 2HSAA 4CCCA 3NQ7A 3GXPA 1ALDA 5AFDA 2X2GA 3QH2A 4JTJA 1FCQA 3E9AA 4WY0B 4CQ8A 3P74A 1FDJA 3LM7A 4Y9AA 4LVAA 1GQNA 4N4QA 3W75A 1EP1A 4M5PA 1VYPX 1GEQA 2A21A 2A4AA 1A5SA 1K7EA 3SGUA 4PFMA 3LCLA 4WJEA 3O6YX 3S1XA 5LSMA 1JCNA 3DXIA 3T40A 3S1UA 3ABQA 2ZRWA 1W3TA 3STCA 1VRDA 2Y70A 4CLMA 4ICNA 1D9EA 4A22A 2Q3OA 2KZHA 2VFGA 3GR8A 5U4NA 1I2PA 4GBUA 5D30A 1AMKA 1KBIA 3DENA 4GJ1A 3W73A 2E6FA 1W3IA 1JRBA 4I9AA 5BOOA 3W2UA 4DO5A 4JX5A 2VEMA 2DZXA 4QJ1A 4ZL1A 2C6QA 4LVFA 3OG3A 4DEFA 1DQWA 3M0ZA 5DBTA 1A53A 1MEIA 4FEZA 4MY9A 4DBEA 1K7FA 3PAJA 4NU7A 4PH6A 5I3GA 1TTQA 3QZEA 4EVZA 5K9DA 4UMAA 5BW6A 1GVQA 3G1SA 4WQ6A 3NDOA 1UUOA 1D3GA 3UQNA 3FOKA 2YYUA 3UWWA 3EXSA 2VOMA 3B06A 1P5BA 2PRMA 3DFSA 2ATSA 4UR8A 5DCDA 3TXVA 3PWAA 1G4TA 1TTPA 3HPSA 5AHFA 1TRIA 3PF3A 2DORA
chains in the Genus database with same CATH superfamily
1S3TC 2DT2A 4C6LA 2Y63A 1QDSA 3AUJA 1JD7A 2EPLX 4LS2A 4HMCA 1TPWA 6A3HA 1IXQA 1CTNA 1F3WA 4NXKA 1IZKA 4BJHA 1TB3A 3PTDA 3LCFA 4AYSA 1U1UA 1QBBA 4DXKA 2BY2A 4GY0A 1FX6A 4WLCA 3GQYA 1B3ZA 2G4FA 4NY2A 4B9ZA 2PDBA 2CLLA 1ZAIA 1C9WA 2YFNA 3VOGA 3A4JA 1WXYA 5C9ZA 3GTXA 1CB2A 1J11A 1XLIA 2OGYA 1LBLA 3WEZA 2RKXA 1YPXA 3VDHA 2QCCA 2VDIA 1P0DA 1N8FA 1P6CA 1TA3A 3NQ2A 2J7HA 2V5LA 3H21A 4LF2A 3OVPA 3VZYA 4ERGA 3STEA 2R1NA 4JHOA 4M29A 3EDKA 4HNLA 3ALGA 1WBJA 2XZ9A 5FOOA 3TR2A 2OZTA 3UT0A 7REQA 3KEHA 2ZXAA 1M1BA 3O6DA 2ZZ2A 1HL2A 2C1IA 3VIFA 4UFKA 3CUHA 6REQB 2ZX8A 5B7ZA 1W0MA 1LT8A 2QGHA 2VHLA 3Q4DA 4G6CA 4Q7BA 2WVUA 1HFBA 3KE0A 5JBEA 4MNLA 1R9YA 2WZIA 4QIUA 3WQPA 3M6DA 2PRHA 2YW3A 5FJRA 3TVAA 4HPXA 1V6WA 2JQXA 1DIEA 1P6WA 4TR9A 3AICA 3EYPA 1VEMA 2PDGA 1W37A 2YYTA 5AC5A 4DM2A 1VEPA 4GLEA 1E40A 1TQJA 4K1GA 2WWDA 4JN7A 4E2DA 5D38A 3LHWA 1W1PA 2GZXA 3VUSA 1XD1A 2WPGA 4EK7A 1S39A 4FXSA 1AZ2A 2CBJA 3ABZA 3OA5A 1K9FA 4C6QA 1SFJA 1HKWA 3NIYA 1RD5A 4I8DA 4WCJA 1MDRA 3M0MA 5KMYA 4X9YA 1X8FA 2XHYA 5CPSA 3SCRA 3BAJA 3TYDA 3ITOA 1GYNA 2C0AA 4LUYA 4Y9PA 5K9CA 1OGBA 2BMBA 2PPGA 1TG7A 4NP7A 3CZKA 5AYIA 3V5OA 1NWTA 4FF7A 1P48A 1CW2A 1XYLA 2XGBA 3WN6A 3G3MA 1G6CA 3RF9A 2OT0A 6TAAA 3TLQA 5G4WA 2WZEA 1UIPA 1S1PA 3O06A 5FEXA 5J5DA 3QVQA 4FMVA 2R8WA 1XIIA 4K1WA 3TMLA 3WUFA 3FXYA 5SWUA 4GKTA 3R12A 2WZHA 3OQEA 2W66A 3M7SA 3QW3A 4LV4A 1UQZA 1G69A 3TMQA 3C86A 4IJRA 3W85A 2J4GA 4HNTA 3GXDA 3PAOA 3UYCA 1TZ7A 1E4MM 3PSWA 3QBUA 4O4WA 4YS1A 1JGMA 4HA1A 3LZ3A 1GOQA 1GG0A 1FHLA 3GH4A 4FS9A 3Q67A 1UP0A 2OOFA 1NFBA 1F5ZA 3QMSA 5AYZA 3W7PA 3P0WA 3AHVA 3DERA 1J0IA 3RLUA 2PWFA 3S4TA 1QI0A 1BG4A 5F1UA 1XLJA 4JIQA 2PB1A 3AROA 2Y61A 3PBWA 1M01A 2XIQA 1EJRC 1F3TA 3LSBA 4ZOEA 4R9OA 3HGOA 3GHUA 3H26A 2NXIA 2X1UA 1GQJA 1G4EA 4H6KA 4H9ZA 1WZLA 4AMCA 4DBSA 1W6TA 1ZTVA 1VLIA 3E6EA 1Q2RA 5CPLA 5DBUA 2W4XA 4L7ZA 3OG2A 1HKMA 3U2CA 3SCUA 2BBFA 3OP2A 2A3CA 3BTNA 1ZB5A 4GACA 3GBDA 2GUBA 2FZ9A 3EXRA 1PHQA 3L21A 3WF3A 1PL9A 4JD4A 4AY8A 5CSYA 1UR3M 1C93A 1PWMA 2PGEA 3L12A 3R7MA 2CKSA 1UOZA 4XO6A 3CUFA 4ICMA 4IIEA 1QAPA 1SPQA 5M5DA 5I00A 3AWNA 4UFIA 3MWCA 5JU6A 1TPDA 4LUTB 1PYFA 1E72M 3APYA 1Q6OA 2QGYA 2QJJA 1RY0A 3SCNA 1TKKA 4DO7A 3TIMA 6ALDA 2O55A 3VNJA 4Q4KA 3YPIA 5D2WA 4AEEA 6REQA 3ARZA 1VFMA 3B0VC 4A3HA 2CW6A 4B3ZA 2E7FA 2G4JA 1PPIA 1RHCA 3CJPA 4RDYA 5DQPA 3FY1A 3UXLA 1DXIA 3R58A 4Y7EA 1M5WA 4AVNA 1TVLA 4JCLA 1VBRA 1L6GA 2POZA 4Y2WA 4K7YA 3IVTA 4V2XA 1POKA 3PC0A 1L0PA 4AVOA 1FWFC 2BLEA 4Z1CA 1CGYA 5CG0A 5I2UA 2QNEA 3GKFA 2WHJA 2HE8A 1M7PA 1WKEA 1YE6A 1TO3A 5AVNA 2WPBA 3PPFA 4V27A 2QUTA 2X40A 3C8NA 4GQQA 5JQ9A 1IR1A 3VFCA 4NYYA 2VI0A 1JCTA 1ZY9A 3QZ6A 3CH9A 1TQXA 4R33A 1RBOB 2Z0IA 2QCEA 5A2BA 1UR2A 3OBKA 4Y9OA 5EYWA 3PBUA 1H61A 3RLVA 1JZ8A 4CD6A 3VVGA 1BXCA 1I0DA 3SECA 1XKYA 5RUBA 3GTIA 3WO8A 3I3DA 4A2RA 1K1DA 3UR7A 2X09A 3MDUA 1Z9AA 2CLPA 1TPC1 3OW1A 2VUYA 1JYNA 1TYGA 2DT0A 1S1RA 3MMWA 1R3RA 4MMWA 4UNIA 1KC7A 5CBBA 5C9RA 4NVTA 4IUOA 1ONXA 1W5QA 3ICJA 4Q32A 4LC6A 3QPZA 3EXTA 1W9DM 1JPIA 4N4PA 3ZYZA 1T6MA 2XISA 1SFTA 2GPTA 3BO9A 3ZQ9A 4DO4A 4MKSA 1IEVA 3L7RA 4FX6M 4F3HA 4H8UA 2UY4A 3BK0A 2ANUA 1VKFA 3GDLA 4H9YA 3OZYA 3UCCA 3CV1A 1MO0A 5LA1A 4LB4A 1BGAA 3G22A 2FVMA 2NQLA 3UU0A 4F8XA 5CJNA 1GHSA 2JEQA 2VYOA 2E77A 3WNLA 2QHAA 4GD0A 1LOQA 2VEKA 4PTMA 5GNYA 2V5DA 1RJRA 3LB0A 3KRUA 1O5RA 1LLWA 2OZ0A 3CQJA 3PZVA 4A29A 3C0JA 2EF9A 4NZ1A 1UD5A 3VCCA 4DRSA 1V02A 2CHNA 2PDXA 2Q02A 4IMDA 3SGGA 4IF2A 2XGIA 3SAZA 4LAZA 3DAQA 2E09A 3M5ZA 3F4CA 4J3TA 4J3XA 1UG6A 4AF0B 4KF1A 3NQCA 1HF6A 2BSLA 1F9CA 3SIMA 2NSOA 4P8UA 3G0XA 2X42A 4PB4A 2DEPA 2WSYA 4UTFA 4HA4A 1XC4A 4C7FA 1QNVA 2XVNA 4BF9A 1LBFA 4G5DA 1FXPA 1Y5VA 4NX5A 1TMLA 4HB7A 1GOWA 4BEUA 1PEZA 3UVIA 3WG6A 4RUBA 2W79A 2C16A 2J7EA 3VOHA 5D9NA 3AXMA 1V51A 4LUTA 2O9TA 4ONVA 2DIEA 4D6DA 3K4DA 1Z32X 4NJHA 1MEWA 3DZ1A 1BVNP 2PLCA 2DJLA 4GYPA 2X30A 2OKTA 4GIYA 4AIEA 4LVGA 3E2VA 2B0MA 1LM1A 1SSGA 3D47A 4U5KA 5FF2A 3STPA 3ITYA 4JYEA 4RV8A 3F4DA 5TQLA 1K9TA 2VC7A 2AQWA 4HIBA 5C7HA 1W32A 1EWEA 4X3ZA 1RLCL 4JTAA 2CCRA 3DGBA 1SJAA 3IK2A 2FH6A 5EA9A 5I3FA 1KFKA 4WD0A 1GVYA 4B16A 3UJEA 4ZSUA 1E5NA 2NQJA 1Q6RA 1OQFA 3AZTA 3V0TA 1Z48A 3N2MA 5HXMA 3E0FA 2QCDB 4U28A 1VCVA 2BOGX 4AX6A 5EGRA 3FDKA 4MFDA 2ZWZA 1RH9A 3EA3A 2INEA 4TU1A 4QS6A 1YXYA 2I9UA 4J5NA 4N9EA 1X6NA 5LYRA 3F4WA 3BLPX 1DV7A 1V8EA 4HU4A 2ZTJA 3PY2A 1KCZA 2GJXA 4EACA 3SADA 5CGQA 2OT1A 3PWGA 4AHOA 2X7WA 5CZ0A 3APGA 5AZ1A 2J7DA 3VNKA 4HSNA 1F74A 3LQLA 3AS3A 1RP8A 2HJPA 1C7SA 3T08A 3S8HA 3C2VA 5KZEA 1FFQA 1PS9A 1F8IA 2P1FA 4H9VA 1O1HA 3RLHA 4QNEA 2OLAA 1XLEA 1GW9A 3IGXA 3VDBA 4E8CA 2EPMX 2F38A 2QV5A 4A8NA 3UXKA 3QV9A 1UA7A 4LY8A 4XB3A 2QS8A 3H12A 4O0ZA 2F9RA 3VNIA 5CPMA 2A7NA 3H70A 3FDGA 4J28A 4A8LA 5LIYX 1Q63A 4PUKA 2W6RA 5HMSA 1GHRA 5EMJA 2CLEA 9RUBA 3DECA 1X8CA 2VO5A 1BFNA 1O68A 3CV7A 2ZA1A 4CEUC 3MMTA 2QQ6A 2VCCA 3QYSA 1E73M 2VCBA 2Z2UA 2YA1A 4UTHA 4QEHA 3CUZA 4D9PA 5TF0A 3AUOA 1RQHA 1TE1A 3T05A 3C56A 3APTA 2WJFA 1EEXA 5G2HA 2YL9A 4ROQA 3VU2A 4Q8QA 1V0NA 5CLWA 3UR8A 1E9YB 1IGSA 4BI7A 1KGWA 4Y90A 4PUMA 4AF0A 4NNBA 1NP0A 4TX8A 4LYQA 5DRCA 4JFVA 2PDPA 1TV4A 3L0KA 1EP2A 2XWDA 5F1VA 3FEQA 1B3OA 1D3CA 4CCZA 1T96A 1NWRA 2J47A 4US5D 4MJ2A 3UBPC 4WKFA 2EGZA 1TZZA 3DI0A 3WF0A 1AH4A 4W7UA 4GJIA 2WJZA 2RGLA 1OC5A 3RUBL 1O1ZA 4KWOA 5C2XA 2OJPA 1EIXA 2VZTA 2FMOA 1NIUA 2DIKA 1LTDA 3WENA 1LWJA 3VNDA 4BI5A 3OZOA 5FKYA 4R7JA 3RAOA 3WX7A 2E25A 4JNYA 3QSRA 4U2YA 3EWBX 4N6FA 1KFLA 1PVNA 2PEVA 2H8XA 5A2CA 3RPMA 1Q65A 3VGEA 1E5JA 3AXKA 1V3MA 1XC6A 2Z7KA 3HO8A 2ZXQA 4AAJA 2FMNA 3THQA 3O16A 4PTVA 1HJUA 2ZX6A 3N2CA 2X0YA 4LVDA 5D8WA 1I2OA 4DJDC 1GQKA 3QRHA 1ITUA 4B3LA 2CWXA 4D6EA 4PUUA 2V30A 1IR2A 5ABEA 2QCDA 2HWGA 2Z1WA 2C18A 3MI2A 3QQ1A 2JKPA 5H1WA 4GNKB 1MDLA 5EFDA 1EA9C 3EPMA 3MY9A 3M0YA 4PL2A 1AK5A 5BXSA 2RHGA 2XVPA 3PZIA 1G01A 2DW7A 2ZUNA 4IZGA 2Y88A 1GYMA 1CECA 1PYMA 3ZS4A 4WDXA 3RO8A 4EWJA 3PTKA 4V1XA 1GKRA 5LGXA 4JQ2A 1SU5A 2DZUA 3MBFA 4GQ0A 1PV8A 1KRMA 2EPOA 1A5CA 1V7YA 5CLTA 5D05A 2NQ9A 1KV8A 3ZR5A 4C1LA 4FLOA 3WNKA 1QW7A 7TAAA 3G8RA 4JIPA 4DJFC 2QAFA 3W7HA 1EHNA 3S2MA 2FHCA 1GOMA 3FVMA 1JDFA 3AZSA 2PUZA 1TIMA 4M80A 1L2QA 4CD5A 4KKXA 4AW7A 1GCYA 1SO5A 1FFRA 2QCHA 1PTDA 5HOSA 4L9ZA 4JPGA 4FXFA 4ZODA 1IE7C 4CVWA 2I14A 5HULA 3H2OA 2ZZ3A 7ENLA 1P4CA 3B4UA 3EOLA 3U7BA 4KESA 3W37A 2VOTA 1MUWA 4LU0A 5AZ0A 4JBRA 2ZRXA 2RFGA 2PP0A 5D9MA 2Y85A 1I8JA 4J3WA 3GU2A 1RCQA 3UP8A 1W3KA 1GTEA 3FX4A 1KXQA 3TW9A 2XH0A 3ANYA 1RLDA 4GXMA 3PJTA 3CO4A 1XR2A 3N73A 1VYSX 3BURA 3CO8A 3KXQA 1ZENA 1NDVA 3N1AA 1CI1A 5LGZA 4QR6A 3UERA 1THFD 2RUSA 5ABGA 3W07A 4LFYA 4ZQPA 3DHPA 3VZXA 4HPJA 5IBXA 3EWDA 4XUYA 3WQ4A 1A5MC 1HJXA 3BLDA 3L4TA 4PCPA 2ZIDA 3A64A 4KIEA 1S2CA 2C91A 3NO1A 4R27A 4DXXA 3VNYA 4W93A 4XBJA 1XGZA 1QHPA 3B9EA 4W9TA 5A8NA 4UTWA 4RZ4A 1BTMA 5H8PA 5H8MA 4O8AA 1X38A 3MV11 4S3DA 2BZNA 3UVAA 3W7JA 4R88A 3SRHA 1SMDA 3DC8A 3K8KA 4NQ1A 1VBGA 4OZOA 5JXQA 2FTYA 2LLEA 4OIFA 1ZJIA 1EGZA 3NURA 1JZ4A 1PIFA 4FNPA 1XKJA 1F6YA 3BZJA 2NZLA 3SR7A 3SN1A 2E0PA 1QI3A 3NQDA 5I3DA 2I17A 4IM4A 4JY9A 2JIWA 3R8RA 4LYKA 1Z6KA 2XN2A 6CGTA 3ZT7A 1U5HA 3BG9A 3EA1A 2WMKA 4D2JA 4PUEA 5BMWA 4JTQA 2ZADA 2AQOA 1WKYA 5BYWA 2IPWA 1NY1A 4DJED 1C8QA 1T40A 1UKQA 5AC7A 3R0DA 1HP5A 3SM0A 4AVFA 4IIBA 4E4PA 3VD7A 1YXDA 4JZ5A 4X2PA 4NIRA 3EKGA 3MQTA 3V16A 1J0ZA 4PTNA 2XWEA 3NQMA 5F4XA 3U48A 3KBJA 5LNVA 2OYLA 4DLMA 1A4MA 1XI3A 3IJQA 4ZQRA 4J1OA 1LQ2A 1R7AA 3MI6A 3GYEA 3D6NA 3R0UA 1CT5A 2CBVA 3NYDA 4XO7A 1AL7A 1JULA 4M8UA 4XD6A 3WDRA 4NKCA 3AHTA 4IQEA 3CZ8A 2I1OA 3OLGA 5D2YA 2ACQA 8XIMA 3NEHA 4OECA 4WY0F 1UMLA 4FR1A 1K8XA 4PCFA 4AIUA 3THCA 1I6NA 2UV8G 4UNLA 3KVKA 3O07A 2HPIA 1VEOA 2XIJA 3TW6A 2XUCA 3VE7A 1FH9A 4AZBA 2ZA3A 3GTFA 3KOXA 3TSDA 3H22A 6XIMA 3CS2A 5M1TA 4PBFA 5FJTA 3A3HA 1GVFA 3WH5A 4WKAA 3HTWA 3SRDA 4QG9A 3WNOA 2WK2A 3IUIA 2YZ5A 1B9ZA 1AODA 4GFSA 1OZQA 3MSYA 3L0GA 3ZJ7A 3ITTA 1XXXA 3UF9A 3GH7A 3MVIA 3MCOA 3BAIA 3P84A 3FYYA 1XQKA 3R0KA 2QJIA 4UZUA 1R6WA 1I75A 2O7QA 3EPOA 4RV3A 3PUOA 4QP0A 4XZMX 3R6IA 4DB7A 3DDMA 1NFGA 4MZ1A 5EFFA 1A3XA 4OE7A 2OXNA 4IGHA 4H7ZA 3NNTA 4PCNA 3S1VA 4WVXA 4CNSA 4YLWA 4TV6A 4O13A 5A6KA 3BG5A 4F0SA 2F7FA 3HFYA 4IL2A 4EIVA 4KEZA 1SFLA 3SW6A 4JFTA 4KEUA 5I78A 4N42A 2FPTA 1PX3A 4QEEA 1PKYA 3V36A 2BNJA 4XSLA 2J7FA 1CX9A 4IQDA 3NXLA 5A6TC 3AOFA 4CQDA 1GONA 4FHAA 4IJBA 3B4YA 1X7FA 2HCVA 3S9YA 1LF1A 4UTTA 1GGOA 4L56A 1K9DA 4ZTXA 4KWVA 2JK2A 2P8BA 4DZAA 4NZ5A 4AZ6A 5JBFA 1IT0A 2QUMA 2Z6IA 3NUKA 2Q8XA 3KS6A 2XSAA 3EWUA 1FWSA 4GOAA 1AD1A 5M03A 1KFCA 3QXBA 1UD8A 3LMZA 3PG8A 2Q8LA 9CGTA 2NLYA 1XYCA 1YLVA 1RZMA 1WKFA 2E6DA 4I5UA 3CWOX 3CEPA 2CLFA 4L5ZA 1DJIA 4GH1A 1UBPC 4MJMA 3HMJG 4AWSA 2V9DA 3WMCA 5FF0A 5KINA 3M44A 3IVSA 5DXYA 4JY8A 3QKEA 3AISA 3T0AA 3TTYA 5EL1A 3PR2A 1ADDA 3AXXA 1D7FA 3P6LA 1XYFA 2PD5A 4FP1A 4A21A 1MFUA 3N25A 4PMOA 4Q4MA 4WKHA 1E70M 3H54A 4K38A 4ZTYA 5A95A 1QMLA 2CLIA 3WJXA 1OF8A 1R5YA 4UB9A 1UW9A 4HD5A 3PBMA 2ZTKA 4XZNX 3GNXA 3ONCA 2D23A 3BW3A 3EWYA 1ZHAA 3CB8A 3GW3A 1X7IA 5F2LA 3LCIA 3LHZA 2PDNA 1DEDA 1TRDA 5CCZA 1QJWA 2J24A 2ZYFA 4LUJA 2FFIA 2W0UA 1KWGA 2YW4A 1KNWA 1XBZA 4G7EB 1J96A 4MAZA 3CYVA 4LYPA 3L65A 3SY8A 4PUJA 1RXOB 3N18A 4UC5A 4ACZB 3M6YA 2NSXA 3WY1A 2C7FA 2EHHA 5HJYA 2PDLA 1Z7AA 5EBUA 5A6BA 2SFPA 4CU8A 4XWUA 4C65A 1PX4A 2E9BA 3FK4A 3MV01 3MP4A 1W5PA 2GWGA 2D20A 1MUMA 5CC6A 3H2AA 1OF6A 4YU1A 2J6XA 4S2BA 3NCOA 3C2EA 4E8GA 3BUVA 1KWKA 2BODX 1RVGA 2P53A 3WDPP 2QCFA 1FWTA 4R5EA 5D8ZA 1GYLA 1EWDA 3BANA 2VWTA 4GA8A 1C8VA 2BFGA 2PP1A 4IP5A 5FI8A 4P7QA 1OX6A 3H4XA 3NG3A 4RCXA 1F6PA 4HPHA 2YXGA 1AG1O 1H7WA 3P80A 5HWJA 2R1PA 2Z2BA 5E93A 3CIVA 3NSMA 4QDPA 5PTDA 1HX0A 4XG1A 3H2MA 3A47A 2VXNA 4Y6GA 4UFLA 4DAFA 3IK4A 1KTNA 4DZHA 4DBWA 3A23A 4NAEB 1YE4A 4ATDA 2Z1BA 4P7RA 1XSJA 5HNUA 1VAHA 4P8WA 1SM9A 1ONEA 1KQZA 4LEFA 1KA9F 1M3UA 2ZRZA 2W5FA 2C1GA 1JEZA 3AZRA 2J74A 5DELA 1UD3A 1TSIA 3EX2A 2UY2A 1EFZA 1WDSA 3RCYA 2X2GA 3QH2A 4JTJA 4DUXA 3ZOAA 3E9AA 1E71M 3VMPA 4IIHA 3A3XA 1FDJA 3LM7A 2F6UA 1GQNA 4N4QA 4M5PA 1CLXA 1A5SA 1K7EA 5EMKA 4J2MA 3S1XA 1DWIM 1BTCA 3IAPA 3S1UA 2ZRWA 2Y70A 1JDCA 4NL1A 4JQ1A 2KZHA 2PBGA 5U4NA 2FTWA 3OVGA 2YXOA 1KBIA 3BE7A 2NQ5A 3W73A 3E0LA 1IQ8A 3E38A 2ZXBA 2B81A 4HCDA 3W2UA 4B2DD 2VEMA 3MKKA 4PMJA 1DQWA 4KIRA 5DBTA 1A53A 2OZ3A 2PGRA 3HM7A 4F0RA 1A0DA 2XIIA 3ES7A 4IGNA 4NAFB 3GDBA 5K9DA 2G41A 1GVQA 1J9YA 4A3QA 4DZ5A 1D3GA 3UQNA 2YYUA 1XV8A 4REQB 1S2VA 1NWUA 2VOMA 2PRMA 1E55A 3EA2A 2ZUSA 1TUFA 4FXJA 2NVAA 2REQB 4GI4A 4E2OA 2W91A 1QOXA 1SFSA 3PF3A 2ZX9A 5E09A 2DORA 5AVHA 2PZ0A 4QX4A 1B5TA 5HNNA 1UH2A 3NZPA 3KBMA 1AZ1A 1IWBA 2BP1A 4NZFA 5D2TA 3S42A 2X05A 1H5YA 1WDDA 3EDDA 2NX3A 3TUUA 1XLHA 2OODA 4JHZA 4ZCWA 2CWNA 1FHUA 1ODUA 1W9VA 2CEQA 2XIOA 3AJ7A 3F7JA 4P2VA 1YRRA 4ZXLA 1IF2A 2WOQA 4G7EA 3D3AA 1PCWA 5CBJA 3L67A 3ITVA 2FH8A 1XRSA 3GKAA 2H9AB 1R46A 2ZUMA 4ACZA 3W7KA 4LANA 2VQUA 4MUZA 4FOKA 4ML4A 2XN1A 2OFJA 1ZL1A 4ATWA 2G96A 1WYIA 3P93A 2GVEA 4YIWA 4GO9A 4H2CA 2VX6A 4PULA 2Y24A 5A69A 1ZCCA 1QHZA 5CXPA 2QMJA 2DZBA 4IQLA 4XZIA 1EO7A 1U2YA 4XD5A 5HUOA 1KFBA 3U2EA 2YL5A 1KR0A 3KDOA 4H8HA 1LP6A 3FV9A 3KRSA 3H7UA 3PN8A 5C70A 1AA1B 2WYSA 3HQ1A 3QFEA 2Z2AA 3A4AA 3W7EA 5BWFA 4UCFA 1XIHA 1NEYA 1GKQA 3TH6A 2HISA 1QPRA 1XLMA 4HOXA 4F79A 3M1ZA 2GJPA 3VNZA 4YPJA 1KRCC 2ZC8A 4LS0A 1A5OC 4Z2JA 2V69A 5G1YA 1V6YA 3IANA 1OABA 4PMQA 2E4TA 2RDTA 3AMDA 3BWWA 1XLFA 1UJPA 4Z2GA 3W2KA 2V81A 4NAEA 1ISVA 3QGVA 4Z42C 3RX2A 1OCBA 2YCLB 1L6SA 3I6EA 1R47A 2VX4A 3QLDA 2PWEA 5FF3A 4J4KA 1SO4A 4HNOA 4JOMA 1NWSA 2J9YA 3N6QA 2YL8A 3P5YA 4YYCA 3N3TA 2PF8A 1DWAM 2A5HA 2YR1A 1Y8BA 2NV9A 1L2UA 1V02E 2WSRA 4L6OA 2YPIA 3T2QA 4UNKA 3CQKA 1REQA 4G56A 3WQ5A 4YTTA 3QV7A 3L9CA 3FNDA 4S1FA 4U31A 3TYEA 4GABA 4C6JA 3TJLA 3MUY1 1JD9A 3K4WA 5AYBA 1J10A 1EGVA 3CPGA 4ROPA 1JYVA 3G1HA 1JXJA 1TWDA 1XLBA 5DY3A 2D2HA 5I79A 1JCMP 3MSRA 5BOEA 3MC5A 3FSTA 4IXHA 4F4RA 5A6MA 2DZSA 3MBDA 1A5AA 4Q8VA 1VFHA 1TPH1 3L2IA 3UW6A 4AWEA 2QCLA 3GVWA 1H3GA 3VNLA 2WB5A 2V2CA 2J9XA 1BF2A 4PCSA 3G0SA 5IFPA 2J6VA 3TFCA 4JDYA 3CQHA 3T0CA 4XTIA 1TV5A 1B4KA 3B0UX 1W5NA 2FFCA 4KQNA 1JAKA 1GZ1A 4UQBA 4Z1YA 5E9XA 1KFJA 3BAKA 3UWVA 4UQDA 4YJ5A 4YWIA 1QI4A 3JUGA 4EXQA 1N7KA 1ZBVA 3SIZA 2QDEA 4JYFA 3THUA 1X1OA 4S3KA 5CZTA 3NGFA 2RGMA 1NJJA 4S3EA 2WXDM 2YX0A 4UBPC 3B40A 2Q6ZA 3OGSA 1CIUA 3IWPA 4C1KA 2YCEA 4V1YA 3KM8A 4IPIA 5XIMA 2C79A 3N6HA 3AS0A 1F7BA 4XQ6A 1BSLA 1ZSXA 4CCDA 1K6WA 1OFQA 5CC7A 2PGFA 5HR6A 3O8AA 4R34A 4NG3A 2VZVA 3UG5A 1J0HA 3IIZA 1Z44A 3VCNA 3SO7A 1MW0A 1TPVA 1OINA 4UIOA 4L65A 1CXFA 4JTFA 1MI3A 3L5LA 3F2CA 1W1YA 4G1KA 1S2TA 3B0PA 3NPWA 4AHPA 1YTDA 2H9AA 1RALA 3LSCA 1GOKA 4PB3A 1QOQA 3UY8A 5DY2A 4GVGA 1JVNA 2WCAA 1O60A 3HGRA 3ZLFA 4PMUA 3DG3A 2EPNA 3NQEA 2JEPA 4GGBA 5CPNA 1IXNA 4JDBA 4JTCA 1EEPA 4LCSA 1OD8A 2TRSA 3R2GA 3HF3A 1SVDA 3W29A 3EX1A 3IUHA 3WH8A 1NFPA 3DGRA 3JS3A 3AYRA 1VIZA 1YIXA 3MTWA 3CAKA 4GNVA 4HA3A 1OK6A 3HG2A 3VABA 4PEEA 2DVTA 1G7UA 3W2MA 2PWHA 4M24A 1ELSA 1IZJA 4O18A 1Q3NA 4JYDA 1BPLB 2JF6A 1PWLA 3HQPA 1GEHA 1DWJM 1XUZA 3LTSA 3A3WA 5D03A 2FKPA 2DVUA 4LV9A 3A4WA 2J8FA 4ZSTA 3WEOA 2E8YA 1QT1A 1PIIA 2WBKA 1ME8A 3E74A 2JF7A 1YDNA 2YCLA 2WHKA 3MANA 1B9BA 4QG8A 1UP2A 3ZVIA 4HK7A 2EXOA 2Z1XA 1VRXA 2Z24A 3QQ0A 3OGRA 6ENLA 1DJGA 3S47A 5HWNA 5HATA 2ZZ4A 2INFA 1SO3A 4LUIA 4DN1A 1XYAA 5CGMA 3W6LA 3SJNA 4O52A 3WELA 3C2RA 4HZ8A 4XV0A 4HHHA 3I7SA 8TIMA 1L9WA 1ME7A 1KXVA 1ECEA 1UASA 4L4PA 2G97A 4KH2A 3JU2A 3PBVA 1XLLA 4YL2A 1NU5A 3WJWA 4L4MA 4GPNA 2NX1A 1Q6EA 3RJYA 3RX4A 1QW9A 1JZ7A 4EPEC 3C52A 4JFSA 3RGTA 5I07A 5DANA 3TC7A 5JBDA 3OLDA 2ONEA 1KXHA 1Y0EA 1UWQA 5MKGB 4JXCA 5TBOA 2OX1A 5BRPA 1FHDA 3TEVA 4PA8A 2YKKA 4UTKA 4MY8A 3QYQA 1DJHA 3BOXA 2GOKA 4D72A 5EU9A 2J27A 4UTLA 3GG0A 3G1DA 1H1YA 1XUUA 4JTSA 1IEXA 1W1ZA 4KGJA 1LROA 3V5CA 3RM4A 4FA3A 4OHQA 3S9ZA 3W7QA 3OVQA 2OSXA 2PAJA 3L4VA 3RXZA 1UCWA 1UQYA 1ZNNA 3AIQA 3B8IA 4GKLA 3BAXA 3PNZA 4H01A 3TA9A 1XL9A 4D8LA 3OYZA 4A35A 1W9PA 2J25A 3MW7A 1G9HA 1S38A 5KZ6A 2B7QA 3KBWA 4NSBA 4KCTA 4EPKA 4G8TA 1W1VA 1KRBC 3A13A 4JKLA 4GXWA 3W7NA 1ITCA 3CPUA 3UWYA 4YMZA 1B3YA 4GYJA 1IXOA 5HAOA 3HQNA 4B90A 1NVMA 1OBAA 2GQ8A 3N13A 4L4LA 1Q6LA 1PBGA 1R3QA 3WLSA 3GU1A 3IIPA 4RZ5A 4DXVA 2ZUTA 3LUTA 3LLXA 1XCFA 4P5UA 2G3FA 1K6AA 1BRLB 4ADTA 3PJXA 1E3XA 1AFSA 4GYKA 3AXHA 1K4GA 4ZQNA 1GG1A 5I24A 1W5OA 1CYGA 3MUIA 3UJRA 1FDZA 3G3DA 3WUGA 3OJGA 3GDRA 5I23A 3WIJA 2POTA 3BV7A 3J7HA 3KOWA 4NHVA 5GPRA 4U3AA 1PTAA 2C8NA 1H1ZA 1T7LA 5FJIA 2UWFA 3AC0A 1SR9A 8CGTA 5DMLA 3LU2A 5TNVA 4OVXA 3EAUA 1OWQA 3FHAA 4EE9A 1FWJC 1W3JA 5I3KA 3AWOA 4ZO8A 4HNNA 1FA2A 3WNPA 4M51A 3WQOA 4GVFA 1GKPA 4BFAA 4CQBA 2V3EA 4HPGA 1CCWB 1Q6FA 1QNSA 3AXIA 1PJ9A 3O6CA 4LYRA 4EAYA 3VM5A 5LNRA 1XIFA 1CWYA 1VIWA 1OX4B 1WUFA 4AIOA 4QNWA 3LDVA 5AKQA 3VGBA 4S3CA 2YLAA 4IX0A 1V6TA 1SMAA 1CZ1A 1VCGA 2TMDA 2V5CA 4RR4A 4HZ7A 4WXZA 1BXBA 2PF0A 1A5NC 1B1YA 4ZXOA 3UNTA 3IJDA 1I4NA 3M5XA 3ARUA 1UJQA 2ISFA 1QU4A 1HGWA 1S3HA 1HJSA 5D09A 2J75A 3TX9A 1OZMA 4PMVA 3FW6A 2D24A 4Q7NA 4KCWA 5AHNA 3WBXA 4LRSA 4QE4A 4IP4A 2FTPA 4ORIA 4PUWA 3FIGA 1Z8AA 4WSKA 3GD6A 4IMAA 1E56A 4H7VA 4NI8A 3W7IA 4DF0A 3IVUA 1OCNA 1RCXB 1KM5A 1IEWA 2G8ZA 2PC4A 4F0HA 2ZCGA 4HN8A 1PHWA 1O6IA 3M5VA 1TMHA 2B4GA 2XFWA 3LV5A 5HPOA 1Z89A 3AMKA 5I3JA 1A49A 1OSEA 3REQB 2J9ZA 5CC5A 2YIHA 5ENLA 1JL8A 5LA0A 3BCJA 4FAMA 2GLKA 1VP5A 4O19A 2AOSA 1ZFJA 4PMYA 3N4AA 1GK8A 3LG3A 3BV4A 3D0CA 3MO7A 1G4PA 1FWEC 5AB3A 3ZWTA 1B3VA 3EEZA 5DCEA 3PVFA 3ARTA 4Q7IA 1R7OA 3F1QA 3OU8A 4FZIA 2YBTA 1J2WA 4GUIA 1OYCA 5IDIA 1EZWA 2XTKA 4S2CA 1CXIA 3S5ZA 5I03A 1TREA 4FXRA 1NQKA 1DTUA 4JTUA 4C6CA 3WQWA 4A05A 5DEZA 4ZBCA 3B3DA 3U6WA 1OFRA 4YNGA 2NWSA 1L6YA 1GZJA 4WK9A 3WQGA 2YA0A 5AYYA 2J77A 1HJWA 4FALA 5DX7A 1BGGA 4HMNA 1TVNA 4DY1A 1DWGM 3GDMA 2OQLA 4QSHA 4KCVA 1PZ2A 3A12A 4XAYA 4DJEC 5C2CA 3MJMA 3Q37A 4OUIA 4JCMA 3WFZA 3GVVA 3TN3A 3KHDA 4BI6A 1KBKA 1Q6DA 2RDWA 2WQDA 4C1NA 3O6AA 3DIPA 5I0DA 1FH8A 4JIEA 1BRLA 3E2QA 1MRAA 3I4EA 5CQ1A 3KL5A 2B7OA 4K3ZA 4CQCA 1D2KA 1N55A 2Q3RA 3DFHA 3WUBA 3VDCA 1XIMA 3BICA 3VKDA 4PMNA 3ME3A 2Y5JA 1UPPA 4AQLA 1RSCA 3F5LA 3E2RA 5JVLA 3NYZA 3WF1A 1MEHA 2VGBA 1TJ2A 1EUAA 4ZB2A 2VTFA 3MI3A 4B15A 4Q4RA 3ERPA 2WKJA 3TNOA 4DJDA 3S6TA 2P5NA 3RIKA 4H7CA 1F07A 1GWJA 3TNBA 2YDQA 3BLOA 1H60A 3LBCA 3NEVA 1E0VA 1QPNA 1UC4A 2E9MA 2VZSA 3CUIA 5MF5A 1EKOA 2CZEA 2YFOA 3GXTA 4BEQA 3MP3A 4GNJA 1OX4A 3SFKA 1O7AA 2VX5A 1P0KA 3TAOA 3LRMA 1R9XA 4V28A 1U33A 5KITA 1R87A 4N6EA 3LHTA 1QVBA 1SW3A 2XVKA 1AMYA 4KRTA 4NILA 1Q85A 2ZICA 2CU0A 3DFOA 2XU2A 5CZSA 3LY0A 2BVYA 3ITGA 3N11A 2H8ZA 3EX6A 1YYAA 2VX7A 2VM8A 2AMXA 1EL3A 1EHAA 2HZGA 2XH2A 4AWTA 3LMYA 1YQ2A 2Z27A 3VMOA 3LENA 2NUXA 4MKVA 1RJQA 4MHBA 3DOPA 2IW0A 2XPKA 3HIJA 1VFUA 4OTKA 5BXTA 3B8WA 2XINA 4K37A 3B04A 1F3XA 4F66A 1DJZA 2E5CA 2P88A 2VL4A 2V67A 3TTSA 3IACA 1DORA 3NOEA 2AMGA 1MW3A 3CL7A 2OU4A 4AZHA 1F6KA 3IJ8A 7REQB 1UPMB 3VUPA 1PIGA 3KL0A 1ODZA 2R91A 4M6UA 4E6MA 4Q8OA 1YNYA 5LKYA 1RQEA 3S5YA 2IPJA 5FL0A 1JDDA 3QY7A 3REQA 2GSHA 3G1YA 2EKGA 2IPGA 2BXZA 2JKEA 1EP3A 1WXJA 3TTQA 3B05A 3E0IA 3S2NA 2Z7GA 3W72A 4C7GA 1KGUA 4RZ6A 4B5TA 3TTEA 1E0XA 3CIXA 4RNJA 4WF7A 3GZ3A 4MADA 1I2RA 2PWUA 2ZWYA 5D2XA 3CZJA 4N7QA 1IGWA 1HUVA 3HPZA 5G1MA 4RPQA 4Q4QA 3SSZA 4NZ4A 4LNYA 1RR2A 1L6WA 3MDWA 2DY3A 1US3A 2D2JA 1QW8A 3W1MA 4TIMA 4U2ZA 2WC3A 2DGAA 3VE9A 4NJGA 3N29A 1V08A 2YDRA 3Q2DA 1P0BA 3NQBA 1OFDA 5JH1A 4LC8A 5K2ZA 4I6KA 2GJLA 3A21A 4NNAA 3FEMA 1B3WA 4ALDA 4JL1A 2PS2A 3EEGA 2QIWA 5LNWA 4DPQA 4RPPA 3BOLA 4K2SA 1E3ZA 1PKMA 3I3EA 1EJTC 4O12A 3SSJA 3CUGA 2BGSA 3W4RA 4QLJA 2CXEA 3EDEA 2DT1A 1B54A 4O8RA 3TOYA 3S9IA 3MA8A 5E0KA 3W1PA 1LG2A 2ZVRA 3ES8A 1FWAC 4B9YA 5ECVA 8RUCA 1EF3A 3BSGA 4GINA 3VGHA 2G3JA 4PMDA 5A3HA 3T55A 3EWZA 2NLIA 4MYXA 2O0TA 2X16A 5EMLA 1CXKA 4WR3A 4LQ1A 1XDJA 3QV8A 1A5LC 1OJXA 2BX7A 3NPXA 3W88A 2CYGA 2HNHA 3W22A 2D73A 1W1TA 4ZO9A 2DJXA 2WWCA 5L9FA 2VEFA 1XIJA 3ITCA 4RX0A 3I6RA 2XG9A 1V93A 2VC6A 2WSQA 3TC6A 4PSPA 1KD0A 2B7PA 1GOIA 1OCJA 2Z26A 4Q8TA 1H49A 3FXGA 2GWNA 1KR1A 3QF0A 1VFTA 2EJAA 3LYEA 2TSYA 1K9EA 5AHIA 4E5TA 3UGRA 4C5YA 4MFEA 1OB0A 1X1ZA 3M46A 5I09A 1RD6A 2FIQA 1U83A 2E68A 2ZDSA 4HU0A 5I5RA 2R1KA 2NQZA 3VKAA 3BDKA 4AXNA 3QTGA 3KS5A 3TJ4A 2WNWA 2FVKA 3ZSSA 5BXRA 4LPCA 4AC1X 1R8LA 2WSPA 4DUVA 4HKPA 4HMEA 5C9WA 2I5QA 3WFLA 3HG3A 1DQXA 1XFBA 5HMFA 4AD4A 5DFAA 4HNCA 3WZ0E 4H4IA 4GI8A 1JZ6A 3LNMA 2WQPA 4TTGA 1GVEA 4CGTA 4O1BA 2V63A 1HQTA 1QCWA 1B90A 2WVTA 4ZOBA 1WX0A 3KW3A 5FL1A 1F73A 4D6FA 3AU2A 1CNVA 3PNUA 1FH7A 2YJQA 1TPB1 3PZNA 2WMFA 4I7VA 3W81A 1W17A 3ZXWA 3AMCA 4PMRA 4TMBA 2UZ9A 3DFQA 3DFYA 3DYMA 3KP1A 1FTXA 3C0QA 1CGXA 5K3VA 1MZRA 3TFXA 2RJGA 3GG7A 3MSDA 1NQ6A 3LGGA 2V3DA 2VGFA 5JUVA 4N9BA 5DMYA 4GZJA 2QVNA 4YVPA 3AMGA 1UD4A 3LHVA 3EB4A 3MUXA 4ZQMA 1HT6A 3RRAA 3I4KA 1B4EA 1DJXA 1J6PA 4MJZA 2OSWA 3VGGA 3A5FA 3IJ6A 1XLAA 3QOMA 3H2NA 5HPCA 2OZ8A 3G6MA 3KWSA 4QDMA 2FGLA 2WC7A 4HTYA 3UG4A 2C15A 2ZOXA 2XN0A 1XX1A 1OM0A 3NWRA 3MUZ1 2AQVA 2VJXA 2PD9A 1WOBA 3P62A 4IL0A 4QROA 4DNHA 1JI1A 4HSOA 3SY5A 2DQWA 4FF5A 3LRLA 2J79A 2HS6A 1B30A 1GVSA 4HSHA 3N2BA 1FHVA 1SQ7A 3OBAA 4E2VA 1Q7MA 2F2KA 4GG9A 4NZJA 4HHPA 3B9DA 1EQPA 2PDCA 4D8ZA 3M4HA 1UOKA 4EPBC 4GHRA 3N2TA 2W61A 3DHFA 5C55A 1OFEA 4R3UA 2XFYA 1DBTA 1S5VA 1QK2A 3CHEA 1UKTA 2VENA 3FA5A 3C2FA 3EZ4A 1W9XA 4K6AA 1BXNA 2PDWA 3O0KA 4HT3A 3L4YA 3SY1A 3T4WA 1ONRA 3B8VA 1G1YA 1AJ2A 3SI9A 1YTKA 3GB6A 3UG8A 4Q6XA 5K7JA 2Y2WA 3G1FA 4W5ZA 2HPMA 1ZALA 2FVLA 3GHSA 1FP8A 1L8NA 5DCBA 2WMHA 4WSJA 1E9ZB 2WKLA 4QGCA 4X61A 3BCFA 4ZB5A 4JGDA 3MCNA 2YOCA 3AHZA 3G6LA 3DU0A 4CNUA 2Y5EA 1JZ3A 3LBOA 3GNPA 5HBFA 2VD8A 1XW8A 3N9RA 3W87A 3CAWA 5C54A 3KFTA 4ZZ9A 4HA0A 3DFNA 3MVTA 4CD7A 3RPTA 1PZ3A 1JZ5A 2G0WA 2CHOA 1CXHA 3AYTA 3FJ4A 2QMKA 3P61A 2DFAA 3FFSA 4FLRA 1V3IA 3KRZA 2YCJA 3N12A 1US0A 4UR9A 3W0KA 4F0LA 3W25A 3T2PA 1CEOA 4OOUA 2A85A 1WB0A 3EB3A 3HFTA 2OWWA 1JQVA 5IRPA 3QZAA 5C71A 1ITQA 4W86A 1LZOA 4NJKA 5DT5A 3CB3A 2VR5A 3F03K 5E1QA 3K2GA 3LD5A 1JPDX 3IRDA 4AD2A 3N4EA 1DJQA 4J2PA 3QGKC 3KRBA 2O7SA 3FN9A 4FI4A 2ZXDA 3DN5A 2V5JA 3CTLA 3WQDA 2I57A 1VFLA 4UQCA 2HTMA 4W8AA 4ERAA 4KWSA 3NQFA 2WCSA 5CGTA 1I2NA 3BGJA 4ORMA 4ZA0A 3VD5A 1MYRA 3NL3A 3OQ8A 3BSMA 1UB3A 3CIWA 1K8YA 3MS8A 4H6RA 3LCGA 3MB9A 4JFWA 3BG3A 4TUFA 1EO5A 1J79A 2QJGA 4M1BA 2Y8VA 4JS3A 1FWDC 3R8GA 5C8BB 4H00A 1XDLA 4B5UA 3BVJA 3E2SA 4S39A 1LOSA 1CLVA 1NDYA 1V3LA 2BASA 3L4XA 1O5XA 3H2EA 1EPXA 1HO1A 4GQGA 1OIFA 4D6GA 3CC1A 3GG8A 1TTJA 1UYQA 1TIWA 4OKDA 3QLLA 2BS9A 4XKYA 3H2FA 1P0NA 4J35A 4MYAA 3TSMA 2XIBA 1QHOA 3P14A 1RA0A 4ASTA 4C6EA 1PSCA 1E6SM 3XIMA 3N2XA 3QKZA 4PTXA 1NOWA 3HV8A 4C7DA 1UKOA 5FD0A 5HNRA 3B97A 3WDJA 3GNOA 4MWAB 3VOJA 4I3GA 1J5TA 2O4QA 3A5VA 3NVDA 3RRXA 3W28A 4IFOA 1XYZA 3WLQA 3LPFA 4ZO7A 1QNOA 4S3JA 1UKSA 1UWSA 2ZUUA 1TV3A 4E38A 3N19B 1A50A 4GE8A 3VCRA 1SZNA 2QLYA 1OVDA 4NXSA 3OIHA 3NM1A 3GG1A 3R5EA 4BQ4A 3ABRA 2WZTA 2PGWA 5JIWA 2GJXB 3AIWA 2I56A 1DJNA 3M41A 5CZJA 3W1QA 4M7TA 4DO6A 1DXFA 4RNIA 2VFFA 4JR5A 4NX0A 2DH2A 1QOPA 4UFMA 2HSAA 3GXPA 5AFDA 3Q45A 1TZ9A 1QASA 4WY0B 4CQ8A 1WAWA 3R4IA 4JNZA 4LVAA 2FHFA 3LS9A 4X0VA 1GEQA 3B8SA 2E28A 3H4WA 1AJ0A 1XH0A 4MGGA 3O6YX 5LIXX 3CTTA 5A6SA 3DXIA 2F61A 3T40A 1E9LA 4C91A 1TJ1A 3K5XA 1GVIA 3STCA 2PDQA 2DUAA 4YHGA 4CLMA 5DT7A 1DE6A 4HP5A 3GR8A 3S5SA 1I2PA 3R94A 1AMKA 3SRKA 4BY3A 5BOOA 2ZKMX 4DO5A 4ZL1A 3POHA 2C6QA 2QDDA 1XSKA 4PN2A 3M0ZA 2RAGA 4DBEA 3S2CA 1I1WA 3RR1A 3PAJA 3KOZA 3QZEA 5BW6A 2OEKA 3OGVA 2VZUA 4WQ6A 5AECA 3KLKA 3CZGA 4IQJA 1P5BA 4HJFA 1CGWA 1BSIA 3D3FA 1X39A 3UYIA 4F2BA 1JZ2A 5HA7A 3WUEA 1JFXA 3WNMA 1EOKA 1V0KA 3SUWA 4UR7A 3H6OA 2ZA2A 1AQ0A 2XYLA 4QE5A 1FWGC 3CL6A 2X1TA 1BYAA 2HEJA 4U33A 2WVVA 4UTWC 3EKZA 3GK0A 3WLLA 1SUXA 4LXFA 5DN1A 5CZKA 3MUCA 4OQVA 5M3WA 3SEPA 1QPOA 4EF8A 1ECQA 2QPSA 3SCQA 3E12A 1XF0A 3RDKA 4CU7A 1E43A 2H90A 3W27A 5F2GA 1PE1A 2IKIA 1OT1A 3VINA 3A9BA 4O1EA 3FJLA 3ID7A 1YTEA 1E1EA 4V15A 2VFEA 5T91A 3TYBA 3BPWA 4QCEA 4PTWA 3QC0A 3L5MA 4B92A 2G3IA 2TPSA 4WSHA 4Q22A 2P0IA 3QHMA 3STFA 1KTBA 1R3YA 3W6YA 2Z1VA 4H6QA 2YCKX 3IJLA 3JRKA 2ZVIA 1EDGA 2WO5A 5LIKX 2O9OA 2Y5SA 3WFAA 2CZ5A 4HOWA 5A5WA 1WA3A 5F7UA 3PANA 3NR0A 3LPPA 1P1XA 4MWAA 4BCEA 2QVHA 1ICQA 1ZLPA 1HXJA 1VPYA 2X0HA 3EB2A 3PSVA 2E5BA 1XYBA 5ABFB 2VKZG 5FEWA 4BK9A 1H4PA 2WBGA 3MJYA 1HO4A 3CPRA 2GQ3A 1K8ZA 3P0XA 4MLRA 1UWAA 3EBVA 2GOUA 3NO5A 1E4LA 1FWBC 3KOYA 1HTIA 4XISA 1CLKA 1C7TA 3ZR4A 4C5ZA 4M6VA 2XZ7A 4GQBA 1FOBA 4CU6A 3DHDA 4UMCA 1YW1A 4JTLA 1JFHA 4M81A 1BQCA 4LAKA 1VZWA 4LCQA 1OC7A 4JTIA 1YXCA 3EMQA 2R1MA 2BTMA 3QPYA 2A1YA 3WLMA 4AG0A 4WY0A 3SQLA 3FYPA 4FOUA 2P10A 3E0WA 1UUMA 1XSIA 3E3HA 4QE1A 2PC8A 3TQ0A 4HNUA 1VF8A 1XFCA 2CXGA 1WZKA 2O92A 1U5VA 4MLJA 4O0KA 1FWHC 3LGEA 2QULA 4GQRA 4Z0SA 2R9RA 1EYWA 3UXDA 4DQWA 4OBTA 2PRLA 4LBSA 1HJVA 4ZMGA 3SCPA 5GNZA 4IGMA 4FO4A 3N15A 3URBA 3TKFA 3RO6A 3BQ6A 2DIJA 3P82A 1EUNA 1ZU8A 1Y5XA 3NQVA 5HJLA 2E8ZA 1GJUA 1R0MA 3NPUA 3EMCA 3QR0A 1JUEA 3ANUA 4JX4A 3ZWSA 1HKKA 5HJXA 2QUVA 1WZMA 3A4XA 3VIPA 1NOUA 3GXFA 1VJSA 5DLCA 3VAVA 4AH7A 5AOUA 1UP3A 2OR2A 2E67A 4GJJA 3VO0A 2OWXA 4CCEA 4QAWA 1XG3A 4BZYA 5E0FA 2V68A 2A7RA 1KM0A 3P7YA 4Q4PA 4QJ3B 4O57A 3G1XA 4TX6A 1W9UA 3MKVA 4LUSB 3H53A 4GCXA 1RUSA 1QO2A 4QQUA 2XH7A 4UTTC 3AIRA 3RN6A 7TIMA 1UH3A 1G7VA 2WLZA 2OO0A 1RBLA 4MNJA 3GIYA 5J5RA 3UD6A 3LV6A 2J7BA 3T81A 1N8IA 2J78A 1KBBA 4PE8A 1HNYA 4EPDC 5BOFA 2XIMA 3C3NA 2QCGA 3FA4A 2R82A 3CXOA 3NA8A 3ARVA 1JI2A 3AJXA 4R7WA 2E9LA 5D37A 1P0EA 2PDYA 4O17A 2DZTA 3QN3A 1AQMA 1OIMA 1XRTA 3W2NA 5G4HC 1UR1A 2WVSA 1EA0A 1DWFM 4QLKA 2WV8A 2PA6A 3BZGA 3P60A 1I45A 1TE6A 2WC4A 3O15A 3RPDA 1EH9A 3B8TA 3KVLA 3INPA 1W91A 2C13A 4FNSA 3QW4B 4LTSA 4OV9A 3F4NA 4D71A 1OFBA 4UWMA 4QM1A 4XBKA 4WDUA 3VIIA 1VLWA 4CN4A 3W7LA 3LTPA 2PDHA 5M2FX 2GVJA 4C6FA 2PE4A 1R85A 3BC9A 3P5ZA 2DUZA 4JTHA 4RL3A 3ZMRA 1J93A 4IOTA 4DPPA 4HU8A 4MPQA 5ABFA 3GDTA 2FQIA 3O9NA 3LK6A 4MOZA 2P0OA 2OEMA 4H9MA 3H24A 5LA2A 3SQSA 3OLIA 3NZRA 3SCTA 3B0YA 3RG6A 3L4WA 5D4YA 1DJWA 1MMFA 3NQ6A 1VFOA 1YDVA 3URQA 3M0KA 4DWSD 1NAL1 1D8CA 4US5A 3ZT5A 1JPHA 3JR2A 4GY1A 2NVCA 1XLDA 4K8GA 2Q01A 4EAMA 4NT0A 5C2GA 1SW0A 2PODA 3HG4A 3N4FA 3NM3A 4EWND 4RNFA 4LGXA 1SZGA 3LCWA 2HVMA 5A8PA 2JALA 1U22A 1GNXA 2I7GA 2O4MA 3BMVA 3H7VA 3QHOA 1IWPA 2R6OA 4ZFCA 3U7VA 1TPUA 3EX4A 1TV7A 4IHCA 1QATA 4EANA 4X2RA 2QCNA 2WHMA 4PRRA 5F2IA 3H8AA 2WHLA 1VPXA 1E0WA 3W1TA 2C3ZA 1FP9A 2VGGA 4PCTA 2FZBA 3UCDA 4S3FA 3H2CA 2Y7FA 1TPEA 3WJSA 1WZAA 3UZ5A 4GC3A 3B9OA 2V82A 4PBEA 4YXGA 2WAGA 1IEIA 1YEYA 1VBJA 3U3HA 1AQFA 1F4AA 3N3MA 1EX1A 2G3NA 5E70A 5HMDA 3OPSA 3BCDA 1E6RA 2GDQA 2C1HA 3TE9A 4XBSA 3UJSA 3ENLA 4OJYA 1TX2A 3TYCA 4BR1A 4H3DA 2V6AA 2WSKA 2ATMA 2ISWA 5FJOA 3G8EA 1W3HA 4ADSA 2FJKA 4Z1BA 1G67A 1KM1A 1V3JA 3AS1A 2FDSA 3L2LA 4FX8A 1C92A 3KZSA 2FGBA 3QMRA 4EKJA 1SR0A 5TD4A 3V0SA 3ZT6A 5BMXA 5LIUX 3WKZA 5MHBA 1GOXA 3CEUA 2F2HA 4LUSA 5U7SA 3NO3A 3ECQA 2BWGA 2Y7DA 4TMCA 3TN6A 3QC3A 4C6OA 4YTRA 4IPLA 4URIA 1DKWA 3L68A 3MKCA 4ATLA 3URNA 1PZ0A 3ZVHB 3RHGA 1H0GA 4O16A 3WLIA 3EOOA 1XLKA 2PU0A 2FPYA 3WLNA 4FK9A 4IMCA 1DYSA 2VGIA 3FGCB 4QISA 3TZFA 2NWRA 4K39A 2X2YA 1UUQA 1VS1A 1RP9A 1LUCA 5CSUA 3VKKA 1J4EA 4WJXA 3CAQA 1W8GA 3UWUA 3FKKA 9XIAA 1FUYA 3DX5A 4HMDA 3UFYA 4O11A 4H8VA 5FACA 4MY1A 3UESA 2C14A 4PFHA 3GW0A 4RE3A 3V35A 1JPMA 2ABAA 5L6UA 3BGAA 1NSJA 2XVLA 1JCLA 2E6YA 4DVOA 3IAQA 4I9JA 1EC7A 3W7GA 2NT0A 1IIHA 3I65A 1M41A 1ITXA 1HVXA 2VELA 4WX2A 3HGJA 4QAIA 3WJZA 3NJ3A 2VEIA 2FYMA 3IV3A 4NRSA 1VH7A 3LLFA 3U8GA 3QR1A 2E40A 3M7WA 4GZEA 5K9XA 3W7OA 4W4QA 1KGXA 3DUGA 3RK8A 2PTXA 5T26A 4AWUA 4PODA 4HJWA 3LXAA 3CQ0A 5FJUA 4BF5A 4W7WA 1YNQA 3WQ8A 1IEQA 4RXFA 1JR1A 3LERA 3HU7A 4E2BA 3RMJA 3CHVA 3GUGA 1R3TA 1AW2A 5FJJA 1R3SA 3CK5A 3C0SA 5ABHA 1Q5MA 3AYVA 4XAPA 2V8ZA 1XGEA 3LXCA 1BYCA 1E6XM 3NL2A 3IIVA 3ARRA 3IARA 4IPNB 2WMIB 5E9AA 4BWLC 4KRUA 2WNNA 4BHYA 3CH0A 4TV5A 2ADAA 1GPWA 1RJPA 3BL3A 3KTSA 1JCJA 3WYZA 3A24A 1XBYA 4Z1DA 2OCZA 1NP2A 4OFCA 4HYWA 3GAYA 2V38A 3R43A 3MU7A 3SUTA 2YXXA 3IJIA 2OELA 2MUCA 1VR6A 4AMAA 3GSMA 1AVAA 3A22A 3MSGA 2I9EA 1CXEA 1UWTA 2VFIA 5TAOA 4AX7A 1WOAA 4JTGA 3TONA 1N8WA 4M7SA 1D7KA 3LEPA 4HGXA 4LOCA 5FSEC 1CXLA 1EDQA 1V5XA 3EKLA 3DYPA 4ILSA 3UZXA 2ZRUA 3OB8A 4XD3A 4ACYA 3WF2A 3ARYA 1DIDA 4O15A 1YX1A 3T6CA 3WNNA 3AMLA 1G4SA 1YPFA 2D22A 1KM4A 3NQ8A 1H51A 3E49A 1GUVA 3WLPA 5AY7A 2JKAA 3PPCA 3V5FA 2YZRA 3IIXA 1V6XA 2D1ZA 2Q09A 1H41A 4DJEA 2DSZA 2AL1A 5HANA 4E8DA 1KBLA 3BJSA 3GFXA 4LX4A 5KETA 1QI5A 4CEXC 4O53A 3LCHA 4KMQA 1FCBA 3K46A 1Z3NA 3FVDA 1GZGA 3GUWA 4O1FA 3GHRA 4H9TA 4B4HA 1CGTA 3L23A 5CSRA 1K70A 3CASA 3PZMA 4FNTA 4ZE5A 5CPQA 3M43A 1XM3A 2OB3A 4H41A 3W01A 1PDYA 2Y0FA 3CMJA 1RPXA 3BJTA 3AU6A 4JX6A 1R3WA 1KV5A 3QGAC 3VIHA 2CETA 3BAWA 3P2VA 1AW1A 3A9IA 2CBUA 3WH6A 1W9BM 3CMGA 2WW5A 4F0KA 3ITXA 1EJXC 3LXBA 4UQEA 3MCMA 3IV8A