4K7VA

Oye1-w116a complexed with (r)-carvone
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLAVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
total genus 149
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4k7vA00
5CZSA 3RMJA 1FCBA 1H7RA 4PL1A 4OQVA 2X1SA 3UZ5A 2YYUA 5F4XA 4AB4A 1VYSX 5HJLA 1EIXA 3CWNA 3EWUA 1QOPA 4UCGA 4O4VA 1H50A 2ZYFA 3FYOA 3MHFA 2C3ZA 3SGZA 5CZTA 4MUZA 5HINA 4FEZA 3TA6A 4LWWA 4Q33A 2CZFA 4WY0A 3ZFHA 1W37A 3PB0A 5D38A 5CZ0A 5H2ZA 2TSYA 1KW1A 1O94A 4PC8A 3W84A 2W0UA 4O1AA 6TIMA 3CU2A 3STGA 3TQVA 4AHPA 3A21A 1WOAA 4E2BA 1VR6A 5BW6A 2EAWA 4MLJA 3CIWA 1TQJA 3RK8A 3W2JA 5CPMA 3TAOA 2QCMA 3HG3A 2CZ5A 3S5NA 3WFAA 5EL1A 4MZ8A 3L66A 4JDBA 3F4WA 3F03K 4UTWC 3RLVA 2HS8A 3HG2A 3HG4A 4UTHA 1DHPA 2FFCA 4HN4A 5H91A 2X1UA 4JTEA 1DL3A 4L4MA 1T8XA 3FLUA 3HGRA 5FF0A 4FNTA 4MPQA 4WD0A 1X1ZA 3OVRA 3QMTA 2ZZ6A 3PULA 2QCGA 1LBMA 3TW7A 2VEPA 4OE7A 1L6SA 2H3BA 3PUEA 3UPWA 3BW2A 2ALDA 4UTIA 1XUZA 4DBDA 1DQWA 3GZ3A 4FNPA 5L6UA 4LVGA 4NQ1A 3FKKA 2VEIA 4HHPA 4UTJA 3L9CA 2DZVA 5G2HA 3BLFA 2E6AA 4L4LA 4K8HA 3CIXA 2WSYA 1TPDA 2NUXA 4ZQRA 4Q4KA 2ZZ2A 1FXPA 4FX7A 1YPIA 3B0VC 2WNQA 4RZ5A 2NV2A 3KAOA 4HPXA 1AG1O 3PSVA 3CC1A 1YDOA 1J4EA 2QUTA 5F2MA 4IXXA 4GUHA 4IMFA 2HTMA 3RFAA 3UQNA 1UJPA 1FWNA 3W7NA 3H55A 3G3DA 2H8ZA 3N2MA 4I7WA 2J24A 3JS3A 1RQBA 3IGXA 2QDGA 4O10A 1VCFA 4YMZA 2J88A 3MI2A 5DBUA 3IIOA 4YWIA 1XC4A 4LVDA 3LHVA 3QW4B 1I2QA 3MP3A 2V9DA 2P0OA 5LGZA 1JVNA 4H4IA 3L21A 3LHYA 4XWUA 4KWVA 2J9XA 4LS0A 3VCRA 3MW7A 2FQIA 4AF0B 3O07A 1W5NA 3NXFA 1VCVA 3KX6A 3TFCA 3W7KA 3I7SA 4TMCA 4O14A 3MHUA 5AFDA 1BEUA 2GUUA 2GQ9A 3C52A 1TCDA 1FX6A 1QO5A 4XKYB 1R2RA 3KHJA 2QEZA 5FEXA 3DAQA 1QWGA 3DH7A 4FNRA 1YLVA 4R7JA 1TV7A 3V1PA 2V81A 1Z44A 3W85A 5EBUA 2J9YA 4O15A 2VFGA 3LXAA 2CWNA 1FDJA 1IIGA 3SY5A 2WNNA 4XBSA 4GC4A 1AMKA 1IGSA 3LHTA 3IVTA 2ZTKA 3LRMA 4RLIA 2QCDB 4MJZA 3HPZA 3TC7A 3JRKA 2VFFA 1KV8A 1KM2A 4ALDA 5D2WA 1OX4B 3BARA 1OFQA 3LHUA 3GX9A 3EXSA 2PRMA 3KVLA 4O19A 5FI8A 3R89A 2NX3A 1S5VA 1SW0A 1LP6A 4NJKA 3W1QA 2ZRXA 4JTSA 3I7RA 4JTGA 1VHNA 3NZ1A 1OFBA 3SJ3A 1AL7A 1XBVA 2VXNA 3W74A 2VENA 1KFJA 4K7YA 4FX6M 2PURA 1GZGA 1LBLA 4HT3A 1ME7A 2GQ8A 1ZENA 3A24A 3O6CA 1R46A 2BTMA 3UY8A 1UB3A 1OFDA 1EUNA 1GTEA 2E6DA 3SECA 2ZRYA 3YPIA 3TMLA 3HO8A 4BR1A 1F76A 5E93A 3NPXA 5G1YA 3P7YA 3T4CA 5KINA 1LROA 3LBMA 4DF0A 2QF7A 4M6PA 5LKYA 2QR6A 1NVMA 3GDTA 1OF6A 4N9DA 4ONVA 3QF0A 4MYXA 5HWMA 1SZEA 1JUEA 1XFBA 2TYSA 5FF2A 5AHEA 3PBWA 3MP5A 4JIPA 2DZSA 3TKFA 2YX0A 4RJEA 1EX5A 3PF3A 3EX2A 3NO5A 4X2RA 1TTPA 3O06A 1ALDA 1KM3A 3SR7A 5AYZA 3HPXA 2QCEA 1EPXA 3QSRA 3VFLA 3LHWA 1R2SA 3IEBA 1P1XA 5HUPA 5LNVA 1KTNA 2YW4A 1H62A 4GUFA 1RVGA 2DZXA 1GYNA 5K4ZA 4FNUA 4IWWA 1XDMA 3IVUA 3B05A 3LI0A 3G8RA 2OCZA 5DY3A 2G95A 3ATYA 2NLIA 2B0MA 2V0TA 2ZCGA 3LOTA 4MY9A 1QOQA 4Z1CA 3O6YX 4OGZA 5AOUA 1XXXA 1HL2A 3PY2A 4IUOA 4YCPA 3MYOA 1F6PA 4O0KA 1Q3NA 2JBMA 1VRDA 2FIQA 3ANYA 2YDAA 4QNWA 5EYWA 1WV2A 5D37A 4LUIA 3W7PA 3LCHA 3T44A 5HR6A 5TBOA 3T40A 4HNNA 3P8JA 1OFAA 2AQWA 3N9SA 3PBVA 1KA9F 1PCWA 1LYXA 3LDVA 2O7QA 1ME8A 5BMWA 1F05A 4K8EA 3U6WA 1G4SA 1AW1A 4JTJA 3D0CA 3STFA 3S5OA 1TPFA 1SW7A 1K8XA 3UWUA 2J6XA 1W3NA 2C19A 1M6JA 4RX0A 2A2IA 3B0UX 1GT8A 1Z48A 2F84A 1TTIA 1H7XA 2ZFAA 1DJQA 1A50A 2KZHA 1D9EA 1KM1A 1KFBA 2CU0A 3R2GA 4LW7A 1MO0A 1P0KA 1W56A 4MFEA 4GWEA 4IXHA 1H1YA 1N7KA 4UMBA 4WXZA 5CPLA 4PFMA 3HGJA 4E0CA 1KBJA 3SFKA 4A22A 3IRDA 5DXXA 3LCGA 1QAPA 3ABSA 1WXJA 1QCWA 1QMLA 4IQLA 2QUVA 3W23A 1KM6A 4HNVA 3MHGA 4NZFA 1KBIA 3EEGA 1K7FA 4GNJA 3O1NA 3QMSA 1ZALA 2E09A 3NAVA 3GDRA 5D03A 2B7PA 4DO4A 4CQ9A 2I1OA 1WAUA 2QJIA 3I7QA 5FF7A 2Z1BA 1QNVA 3TV8A 3NNTA 2ZZ4A 2R91A 4CCDA 4PCFA 4Y8FA 4HKPA 1L6WA 4XZ9A 3GVGA 3DHDA 3GXTA 4M6VA 2QCNA 4YXGA 2I9EA 3DZ1A 1Q6OA 3LXBA 2FPTA 2QAPA 3B8DA 1LM1A 4RV8A 4OV4A 1NF0A 5G4WA 3TQKA 4O11A 4LV4A 1OX5A 3FA5A 3TR2A 3W7RA 1TPC1 2VFHA 1VZWA 1C9DA 2NZLA 3WJYA 1HO4A 5E0KA 3WK1A 4NNBA 1AK5A 4M7TA 1WYIA 1XDLA 3WJXA 2ZTJA 1AW2A 1DVJA 3M0ZA 5BMXA 4O18A 3HPSA 5FF3A 1O60A 3N9RA 3PS7A 3B06A 4R53A 5U7SA 2WSRA 4LU0A 4S2CA 3C6CA 1TTJA 1O5KA 1OFPA 4LV9A 3S1WA 3TH6A 3E96A 1FWWA 4K7VA 4A29A 1FCVA 2PC4A 4LTSA 1W5MA 1VPXA 4N6FA 3RNDA 1L2UA 3QSTA 1XKYA 2RFGA 4CQ8A 3PG8A 2QKFA 4MJMA 3M41A 1KV5A 2Y85A 3N73A 1O5XA 3SIZA 2XN1A 2TRSA 3BG5A 1FBAA 2NV1A 2YSWA 3O15A 1X8FA 3T78A 1EEPA 1Q45A 5AC7A 3SW6A 3EWWA 2YYTA 1OABA 2W6RA 4P2VA 3NPUA 2E6YA 5T26A 5TQLA 1ZFJA 2HMCA 4EWND 4UR7A 4DELA 1TV8A 1H7PA 1Q6RA 2B4GA 3B4UA 1TRDA 3NOEA 3OHIA 4QISA 3NPWA 1JCXA 2BSLA 3MWAA 2OZ0A 4QAIA 2Z2UA 3W2LA 3GNNA 3GB6A 2QAFA 2E5CA 1D3GA 5HULA 3E12A 3STEA 4I9AA 3LGEA 2X2GA 4GUJA 5G2WA 4XTIA 2ZA1A 5DY2A 1AL8A 4QIUA 4K37A 3GKAA 4ADUA 1J5TA 2Y7DA 1FQ0A 4JDYA 2B7NA 3VE7A 1EWEA 3WJSA 1JUKA 4CCEA 4WY0B 3BG3A 3LB0A 5AHLA 4DPPA 4NXSA 1ZHAA 3DFTA 4DBEA 2DJXA 5D05A 1HFBA 4TU1A 2RHGA 1P4CA 1QPOA 4KFNA 5AB3A 1EWDA 3FIGA 4IOTA 4FXSA 1G6CA 3E0IA 4TO8A 3GIYA 1JCJA 1JR1A 6ALDA 1YTDA 4ADSA 5I3GA 5IM51 3NM3A 3IIVA 3C0JA 3HB9A 4O8RA 3L0NA 4J9JA 1GVSA 3W7LA 1RV8A 2EGZA 1PHQA 2CLOA 3ZWTA 2DP3A 3S5YA 1ICSA 3G1DA 3EWZA 2P1FA 4LVAA 3Q2DA 4C1LA 2V82A 5K2ZA 5HQEA 5D04C 2A7PA 5MHBA 2CLFA 4JYDA 1TPVA 3HGOA 3G18A 3P62A 1VH7A 1D3HA 4GXMA 5FEPA 5CSRA 1LRNA 3W86A 2YGYA 3M6YA 4P61A 4R33A 3NL2A 4UMCA 4U28A 3NQCA 2FLIA 5HUOA 1O95A 1LRQA 2NXGA 1DQXA 4QNEA 4WUIA 3S0CA 1F73A 1X7FA 1UCWA 5G2IA 2CLIA 1TMHA 1SZNA 4U4MA 4HNUA 3IGSA 3N14A 3N3MA 2A7RA 2VKZG 2FTPA 4YLWA 1FWRA 2CLKA 4Z08A 2A85A 2NX9A 3W7CA 5I3IA 3OG3A 1GVOA 1BWKA 1PV8A 2CW6A 1DORA 4DEFA 2A1YA 3UZJA 3TJLA 3UXAA 4AHQA 3M5ZA 1G69A 4AHOA 1FY6A 3DXIA 5LNRA 5I3HA 4UTTA 1VYPX 3ZWSA 2DZUA 4HIBA 4N2YA 3PR2A 1TPUA 4NX0A 4N02A 3P80A 3W3OA 3KVKA 5DXYA 3HGSA 2QCFA 3W1PA 3NDOA 4O1DA 2C16A 1N55A 2Y61A 5TIMA 4LS2A 1XI3A 2CFFA 2YFOA 2ZA2A 2JGYA 4UXDA 4FHAA 2Y70A 3PG9A 2YZRA 2ZRUA 4Z0JA 3DFNA 1SFJA 3B04A 1BTMA 1TQXA 4XUGA 3M16A 5EPDA 4EOUA 1GG1A 2NUWA 1SR9A 4IJBA 2A21A 3T55A 1M5WA 1DV7A 4N4QA 4JEQA 3R12A 1DOSA 1I2RA 3G1VA 1V7YA 1P5BA 5A8GA 4Y6GA 2DZPA 4JICA 3W83A 2GJLA 3L5AA 4PTNA 1LRTA 1TO3A 2Y62A 1H7NA 2OT1A 4HSOA 1JCMP 1K8YA 3TX9A 2ATSA 4IX2A 3OIXA 3TUUA 3LCWA 5AHFA 4NX5A 2FPYA 3QEZA 3A9IA 3C2EA 2RKXA 5C55A 4QITA 3W1TA 3STCA 1EP1A 1EUAA 4XTDA 3QH2A 1H7OA 2X1RA 3PAJA 3QYQA 3P61A 2H3DA 3PVFA 4NVTA 2ZQ0A 4O52A 4AMAA 4DF2A 3L5LA 5LZLA 3A23A 1Q6QA 3C2RA 3P84A 5AYYA 3G0XA 3KRSA 5G4EA 1KTCA 3SSJA 4ZQNA 3M9YA 4A2RA 5F2LA 3W7EA 4UIOA 4KWWA 2AGKA 2PRLA 5D33A 1G4EA 1I4NA 3SGUA 3NG3A 5F2GA 1DJNA 3LV5A 3QPYA 4DO5A 3DKJA 1PS9A 3RU6A 4GFSA 3PM6A 4IMCA 1W0MA 3G24A 3R13A 3TCEA 1VLWA 3W7IA 5D09A 1DBTA 3IVSA 4R34A 1T0OA 1TRIA 1W3TA 3C61A 1XM3A 3LLDA 5KITA 1SFLA 3F1QA 3KFTA 1I2PA 2R14A 3EWBX 3FJLA 5IBXA 4MY1A 2BLEA 4PODA 4RKAA 1IXNA 3DFQA 4TIMA 3TSDA 5D02A 2EHHA 1IF2A 3NL6A 4NJJA 4MVAA 5D2YA 4AWSA 5CGQA 1W54A 4JS3A 4OV9A 1TV5A 4WJEA 3BW4A 4AEOA 3UWVA 2ZRWA 1LOQA 1ICPA 2YFNA 3TK7A 2GVGA 5E1QA 4NU7A 4FB7A 3S5ZA 3LTSA 4B5NA 2A7NA 1WOBA 3W76A 1R47A 3IIPA 1GOXA 3LHZA 4O28A 5DBTA 2OT0A 1S5WA 2CZEA 1QPQA 4NZJA 1OYBA 2NWRA 4MFDA 3N2XA 4CQAA 4Y90A 3TDFA 5F4SA 1YTKA 3M5VA 3LXCA 5FEWA 4CNPA 5C2XA 3NQ6A 4PL2A 1NF7A 1OK6A 5J5RA 4OBTA 5LNUA 1K03A 1M7OA 3QRHA 5A5WA 1DKWA 3DFOA 4X22A 1EA0A 4JYFA 2Y7EA 1TJRA 1TPH1 3DHFA 1YPFA 3GXNA 3GR8A 3NR0A 2E1DA 1S5TA 4TR9A 4UMAA 4LVFA 4ORMA 3UXDA 4BWLA 4ICNA 1QDSA 1OF8A 1JUBA 3R8RA 5F2IA 3M5XA 4FIQA 3W6YA 5CPOA 1YADA 1BWLA 2Q3OA 5HR7A 3L68A 4JYEA 1SZGA 3EX4A 2I14A 4CCCA 3MYPA 3ATZA 4LVBA 4O54A 2ISVA 1PL9A 4Z0SA 3TNOA 2Y63A 4WXYA 1YXCA 2BWGA 4S1FA 4H6KA 4NT0A 3MI3A 1MEHA 3DKLA 1YDNA 2OX1A 4RXFA 4FXRA 3P82A 1I8JA 3CWOX 1VJIA 5I3KA 1TJPA 2ZRVA 4DPQA 4ZMGA 5FEZA 3L67A 3CTLA 2XN2A 4Z1BA 3C4UA 1C8VA 3WK2A 2JKAA 4JTKA 1IXOA 4YCOA 1Z42A 4IX0A 4CNNA 3MUXA 4UTTC 2RDTA 3NQ8A 4N9EA 5KSWA 1ICQA 3G1HA 3W1AA 1WBJA 1X1OA 3LCLA 2A6NA 2G96A 3BG9A 4H3DA 3TXVA 5J5DA 1QPNA 3W1MA 4A2SA 2E68A 1CI1A 1OX6A 2Z0IA 2O7SA 3TU9A 3CLMA 2DORA 1MSSA 3MJYA 1OYCA 1HG3A 3OEXA 5LHFA 3H54A 3ABRA 3G1XA 3G1FA 4UR8A 1JCLA 2V5LA 3P5YA 2WQPA 5U4NA 2NX1A 4JTFA 2EF9A 4Y9AA 1H51A 3DGRA 4OU1A 4UFJA 1JQVA 5FESA 2WPBA 3H53A 3CQ0A 1ZCOA 2JKPA 3FKRA 4WX2A 5KZEA 1TREA 4YL2A 3GAKA 3M47A 3TJXA 2GPTA 3FJ6A 4FX8A 1OFOA 4JIQA 3W7JA 2QUUA 2C14A 2C13A 1W31A 3KRUA 3WK0A 1LOSA 1W1ZA 3EX3A 2DZTA 2E5BA 8TIMA 4JGDA 4O57A 5L9FA 2FB2A 1WQ5A 4IMEA 3NQMA 4W9TA 1G7VA 1KFCA 2V5BA 1FCUA 4WQ6A 5AC6A 2VFDA 3BVJA 5KTLA 3W1RA 1QR7A 2J27A 3R5EA 1KM5A 4MIMA 3TMQA 4OT7A 1JRBA 1M7PA 5EA9A 1YXYA 3NL5A 1ZAHA 4N6EA 2RDUA 3GDMA 4Z1DA 4UFIA 3W1XA 1KFLA 4QM1A 2V2DA 3W7QA 1U5JA 4IPIA 4JTIA 3NQ2A 3TE9A 2F7FA 2BZNA 2ZZ7A 5CG7A 3DI1A 3W7GA 1L6YA 2VOMA 5I3FA 1OHLA 5D2XA 2ZZ3A 3G3MA 3HOJA 3EWYA 3G0SA 3FFSA 1H7WA 3A22A 1ME9A 2NXHA 1L9WA 3WJZA 4JTTA 3EWXA 1TPB1 2B7OA 3GK0A 5HWJA 2JK2A 1G67A 3TSMA 1LTDA 4JR5A 3C3NA 2V30A 4O16A 1AW5A 1K7EA 2OMAA 4I7UA 4LT9A 4ML9A 3MBDA 1F74A 1H61A 1OYAA 1TYGA 3C2VA 4BI5A 1MEWA 3G1YA 1P0NA 2DZWA 3LBCA 3ZR4A 5HNRA 3NL3A 1GTHA 4LNYA 2HS6A 1JULA 4ZQOA 3G22A 2QJHA 1SO3A 2GVJA 3NQVA 4PEKA 4GUIA 3W1NA 3Q37A 1IXQA 2G97A 3LRKA 3TQ0A 4JX5A 4LC8A 2X1TA 3SI9A 2E5DA 1RQHA 3M43A 5HWNA 1TSIA 3LV6A 4JNMA 3W71A 2CLHA 2ZZ5A 1YDVA 3W2UA 3O16A 3UNDA 2CZDA 1GVQA 3EKZA 1FDZA 4N4PA 3G0UA 1KLZA 4RK8A 4ZQPA 2PRHA 1KTBA 3HBLA 2H8XA 3ZS4A 4JX4A 3GAYA 3CEPA 1SO4A 3W2NA 3IGUA 3AJXA 1X6UA 1A5SA 2VFEA 4UFHA 3E9AA 3P67A 4QSHA 3MP4A 4JTLA 1VS1A 1NFBA 1SUXA 3VNDA 2QCLA 4RCXA 5CZJA 1ZY9A 5EMUA 3A5FA 1FDYA 4ZZ9A 5DLCA 3OA3A 3C8FA 1A5AA 3W2KA 4BWLC 5K9XA 3TXZA 1JQXA 1PCKA 1SO5A 7TIMA 1UASA 2D73A 4MLRA 1OFEA 1KM0A 2LLEA 3LCIA 3NQAA 4KFOA 1PVNA 4Q32A 4UTMA 2VEMA 5D32A 2FDSA 4N9BA 5C54A 5K9DA 1VHCA 3NQ7A 2C1HA 4O1BA 3PUDA 5F1VA 3TSBA 2C0AA 1PE1A 3W7HA 4DXVA 4IGHA 1MEIA 4RXGA 3M1ZA 4O50A 3N34A 3TFXA 1VYRA 3KXQA 1EB3A 1XBXA 5EKYA 3UWZA 2ZDRA 3W1UA 2EPHA 1KM4A 4NNCA 3O63A 3EXTA 2QCCA 1HUVA 1GYLA 3ABOA 3W1LA 4AAJA 2J9ZA 3NVTA 1OFRA 2TMDA 3U2OA 3B03A 2A5HA 3LRLA 4DQWA 4N9CA 3K30A 3P5ZA 5LSMA 5D2VA 4O0ZA 4TMBA 2DJLA 3O05A 3UYCA 3UD6A 3L5MA 3QJAA 3ELFA 2RH9A 5AN7A 1W5PA 2ISWA 1WA3A 1I2OA 2FPVA 4UTLA 4ORIA 5DCDA 3UWYA 2OJPA 1SZFA 3IIXA 5G1TA 3NQDA 3MMTA 3NEVA 4CLMA 4UUIA 3GR7A 4NUWA 1H1ZA 3LLFA 3I68A 3Q58A 1W8SA 1R2TA 3TIMA 3NQEA 2Q3RA 1GQNA 3CPRA 1W3IA 3ABQA 3NA8A 3A5VA 1YXDA 5ABTA 3CT7A 2YPIA 1QO2A 4BI7A 1B57A 4NJHA 2H90A 4Z1AA 1K7XA 5KZMA 5LNWA 1SSGA 1B3OA 3QZEA 2ZRZA 4LS1A 1JCNA 4UFMA 2B7QA 3P81A 4MY8A 1WBHA 3IV3A 3NQGA 1B4EA 1BKSA 1RZMA 5DELA 3L0GA 3BW3A 4XBKA 3VE9A 4UTUA 1ZAJA 4WY0F 3JR2A 1FCQA 3HG5A 3KOFA 4UC5A 5CKSA 2Y88A 1LOLA 1TB3A 1HTIA 3HIJA 4JTUA 1RR2A 1LLZA 3UY7A 2ZA3A 3Q94A 4LY8A 3SZ8A 3EB2A 3HF3A 4GBUA 1ZJIA 3QQ1A 2WNZA 4EF8A 2Q8LA 2ZBTA 3B0PA 5KZDA 3BLIA 4QJ1A 3DFSA 3MBFA 2GJNA 3BK0A 3L2IA 4GJ1A 5AHMA 5AHIA 2CLLA 1JRCA 4JD4A 4ZQCA 1O4UA 1TPWA 3S1VA 3I6RA 4AF0A 1WX0A 2X30A 1SSDA 4C1KA 3CM4A 4BI6A 3HJZA 2X16A 5D30A 4LOCA 3NGJA 1E51A 4NNAA 4M5PA 4O53A 3W88A 1HO1A 3BO9A 3RLUA 3TW6A 4TX9A 3S1UA 1H5YA 2R8WA 3BGJA 3GKFA 2VFIA 4O12A 4XKYA 3DFPA 3C56A 4IMDA 1CX9A 1NSJA 4IMGA 3QQ0A 3FEMA 1H63A 3PC0A 4M7SA 3E49A 4KFPA 4RZ6A 1TTQA 3PWAA 5C6MA 1PHWA 3V75A 4K39A 2QCDA 3GXPA 1LZOA 1A53A 5KMYA 1UUMA 5G5IA 5DCBA 1N8FA 1OX4A 1G4PA 4FO4A 1F5ZA 4OHQA 4BFAA 2W79A 3QFEA 1K8ZA 3S6DA 5AHNA 2QJGA 4QQ3A 3LCFA 3I65A 4ZQMA 3PBYA 5K4XA 2GQAA 3TC6A 4LUJA 4Y96A 4G1KA 3P8IA 4LRTA 4M6QA 1KFEA 1A5CA 4RR4A 1T99A 1MZHA 4UTKA 2CLMA 3NYZA 1ML1A 5LNSA 4GUGA 2YCEA 4JY9A 4I7VA 1QPRA 1QFEA 4O17A 3T7VA 2QCHA 3S8HA 4FF7A 4A21A 1SPQA 3QMRA 4S2BA 5K3VA 3NPVA 2BXVA 4WZHA 3LERA 3QPZA 2A0NA 2GOUA 3UWQA 1A5BA 2VC6A 3KVMA 2IQTA 2CLEA 3QM3A 4MYAA 2JKEA 2A4AA 2EKCA 2Y7GA 3C2OA 1K3UA 3VI2A 5K9CA 4E38A 3W75A 3QC3A 2R94A 3L0KA 1XBZA 4M19A 2ABAA 1LCOA 5SWUA 4O1CA 5HMSA 1CW2A 1B9BA 1FXQA 1W5OA 1F7BA 3HQ1A 1T96A 3THQA 1SO6A 1YTEA 1RQEA 3DBPA 1SW3A 2H6RA 3W22A 1I2NA 2WV8A 3CHVA 3GYEA 1VQTA 3W7MA 4DF1A 4JTHA 1OK4A 1GWJA 3OVPA 4ADTA 4UNKA 3C2FA 3TAKA 5GVJA 1LLWA 1OVDA 4IPJA 3W87A 3QW3A 5F4WA 1SQ7A 3EX1A 4X3ZA 4PH6A 3S1XA 1GVRA 4NXKA 5AC8A 1GG0A 5K7JA 4MZYA 4O13A 1FUYA 1NEYA 3DENA 3FOKA 1V5XA 4NJGA 1LDCA 1ONRA 2WKJA 4AWTA 2C18A 2WSQA 5C5YA 3DI0A 5CPNA 2YR1A 2V8ZA 1VCGA 1JCYA 5BNKA 3CB8A 1THFD 4E2DA 3FS2A 4GE8A 4UTWA 2Z6JA 2ISSA 1F2JA 3KRZA 3GDKA 3TROA 4CNOA 4ZL1A 2YW3A 3G8EA 1VC4A 4D2JA 1I45A 4AVFA 4MKNA 3MO7A 4WOZA 3P74A 4FNQA 1R30A 3WJWA 1J2WA 3LTYA 1YYAA 2P10A 3BPWA 5D2TA 3U8GA 3F4NA 4RZ4A 1JJKA 4HNTA 5LGXA 3W9ZA 1VGAA 2WJZA 2E77A 4MOZA 3KVJA 1SU5A 3NZRA 4K38A 1IIHA 1F6KA 1XL9A 3M44A 1LBFA 3P60A 4BK9A 1RPXA 3OBKA 5FF4A 2PCQA 3PBUA 2FB3A 1GPWA 4X9SA 3O8AA 3M5YA 5LHEA 3L65A 3THAA 4ZVJA 4HSNA 2TPSA 3WK3A 3NM1A 3USBA 3N19B 1UUOA 4WOQA 3CEUA 3LCXA 4K6AA 4UFKA 2C15A 3W70A 5F1UA 1LORA 3S9YA 4JY8A 1WDWA 2JGQA 2V2HA 1TPEA 3LM7A 3W7DA 1KFKA 1XBYA 4EIVA 4HPJA 3G1AA 3W72A 4EF9A 2C6QA 1Q6LA 2QDHA 1TIMA 3S42A 3UWWA 4AXKA 2WO5A 4LC6A 3UPBA 4POCA 1U83A 1GJPA 4JN6A 2PE4A 2VEKA 4A3UA 4LRSA 4UNLA 2WOQA 3BGGA 5DCEA 1EP3A 4OWGA 2V2CA 1RD5A 1K02A 3PSWA 3IIZA 5EY5A 3W73A 4GRSA 1ZAIA 1Z41A 3DU0A 4K36A 1NAL1 2E6FA 2YXGA 1IXPA 2Z6IA 3LTPA 1EP2A 1XCFA 3GLCA 3OVQA 3RF9A 3INPA 2A6LA 2XFWA 1G4TA 1PIIA 2NXIA 1S3HA 2DU2A 3NQFA 3HMJG 3VKJA 3W7OA 5IBXC 2XN0A 4XQ6A 4MZ1A 3BV4A 4JX6A 5I3JA 2GVLA 5CSSA 4EVZA 1UBSA 4AWUA 1MXSA 3GDLA 3MI6A 1H60A 3LI1A 1FWSA 2Y6ZA 3O6DA 1GVFA 3W2MA 1B4KA 2Q8ZA 2G5WA 3G1SA 5BOOA 2RDWA 1OJXA 1XUUA 3EX6A 5DN1A 2VELA 3M7WA 3FYPA 4PA8A 1G7UA 1FWTA 1ADOA 4O4WA 1W5QA 1KLYA 2HSAA 3EKLA 2UV8G 3EXRA 2Y89A 3E02A 4FIRA 4FNSA 1GEQA 2AAMA 2NWSA 3PB2A 3W07A 1Y0EA 3BLEA 2Y7FA 1ZNNA 2BX7A 4JXCA 2FJKA 4NJIA 4AH7A 3GNDA 5BRBA 4UFLA 2ABBA 1C29A 4BF9A 4DO6A 5AYXA 1VLIA 2ATMA 3PUOA 3LX9A 2ZZ1A 3AO0A 2NUYA 1OG0A 4KKXA
chains in the Genus database with same CATH superfamily
2YKKA 2P8CA 5CZSA 4IT1A 4PL1A 4PUWA 3GDBA 3DHPA 1EPVA 4XV0A 4PMQA 1VYSX 1OD8A 5HJLA 2XGZA 4UCGA 4XVEA 2Z2BA 1EKOA 4O4VA 4HQVA 2C3ZA 3RHGA 3SGZA 4EPBC 2VR2A 5HINA 4HK5A 4FEZA 1VB9A 1CIUA 1XQLA 4QEHA 4KBXA 4BQ5A 1L8NA 5D38A 4C7DA 1FA2A 3AS3A 1B3ZA 1AUSL 3IARA 1M1BA 4YPJA 3TQVA 4WF7A 1PTAA 1WUEA 3A21A 1WOAA 4J3VA 3I3EA 4E2BA 1VR6A 4UR9A 3K8MA 2ZX7A 1PEZA 5CPMA 3TAOA 2OO0A 4GIRA 4OBSA 1MRAA 1UQYA 2WM0A 3L66A 1VPYA 2VC9A 3F2BA 3F4WA 2YCLA 2OFJA 3SCUA 3UW6A 2KX9A 1JPDX 3HG4A 4AD3A 1JZ2A 4HN4A 4IIGA 4KT2A 4JFVA 4AD2A 4JTEA 3P0WA 1DL3A 2Z00A 5FF0A 1LLOA 3W27A 5KETA 4IUGA 3G6MA 3OZOA 1OCQA 3TW7A 2YCIX 4I3GA 1E72M 2PZNA 2UZ9A 2YA1A 3GC4A 4MNJA 1DQWA 4HA0A 2DT0A 3IUHA 3QZAA 3GG1A 2DIKA 5L6UA 1GOOA 4QLLA 2J4GA 2V3GA 3CUGA 5G2HA 2WSYA 6REQA 4GQ0A 1KRMA 2NUXA 4ZQRA 1XRFA 2Y8VA 1QOXA 4J4KA 2QUTA 1MNZA 5F2MA 4IXXA 1UP3A 4GUHA 3TEVA 3V18A 2MNRA 5HXMA 1TR9A 1ZBCA 4HU4A 1V03A 4MTVA 3N4AA 4A8IA 4O10A 3B8SA 5DBUA 3IIOA 1XC4A 4XD5A 4CNUA 2OG9A 3LHVA 3OZYA 5I0DA 2V9DA 4H4IA 3L21A 3LHYA 4M8UA 4KWVA 3GTXA 1FHUA 3MW7A 3FXGA 3NXFA 3KX6A 3FA3A 4NF7A 4OJYA 4PMUA 4QLKA 3TFCA 3U5UA 3RCYA 2J7BA 4ZO6A 5DFAA 4L1GA 1UWQA 4O14A 5AFDA 1ADDA 4A4AA 5CQ1A 1V77A 4MWAD 1DWIM 2I56A 3DYMA 3HQPA 4P8UA 1R2RA 5FEXA 5E0FA 1QWGA 1BVNP 3V1PA 1CPUA 3GVQA 4Q4MA 1OBAA 4F9DA 3GFYA 4O15A 2VFGA 3RXZA 2CWNA 3SY5A 4W84A 3V5FA 4GC4A 2D23A 4U2ZA 5TNVA 1FH7A 3CYJA 1U5HA 3S9ZA 3HPZA 3TC7A 1HP4A 2VX4A 1CGWA 5D2WA 5LIKX 3GX9A 2QULA 5HMFA 3MSDA 3W1QA 4DJEA 2GJXA 3BCFA 1AL7A 2VXNA 1GZGA 1LBLA 1Q6EA 2GQ8A 4DJFA 4TX8A 4QS5A 1R46A 2BTMA 1B1YA 2PD5A 5FL1A 1WP6A 4HK7A 2PMQA 1F76A 2WWCA 3T4CA 1LROA 3LBMA 4PRTA 4DF0A 1UROA 4XZWA 3GH4A 3GG8A 4MYXA 1SZEA 1MUMA 4HOZA 3PBWA 1TZ7A 3LMYA 1A0CA 2RDXA 1M04A 2IUZA 5BXPA 2NQHA 1XSKA 3MCOA 1KBBA 1TTPA 1C7TA 3SR7A 3NIYA 2G3MA 3BOLA 4PTDA 2QCEA 3W26A 2CITA 2QVNA 1V3MA 1FP8A 5HUPA 5LNVA 1KTNA 1QI0A 4FNUA 4E8GA 1RALA 3WLPA 3VD4A 4AW7A 4B4FA 2ZCGA 4Z1CA 1NQKA 2ZUWA 1XH2A 4OGZA 4AD1A 4KCWA 2EPLX 2CESA 3VM7A 1K9DA 4RDWA 1Q3NA 1DJWA 3TVAA 3ALGA 4QNWA 5EYWA 5FSEC 3VIJA 4ZFMA 1M01A 5HR6A 2XIJA 1K9EA 4B2DD 4HU8A 4HNNA 1W9DM 3P8JA 9XIAA 4KWSA 1FHDA 4BF5A 5J04A 1JZ4A 1G4SA 5AZ1A 1M7XA 1XINA 3STFA 1YKWA 3FSUA 3S5OA 4ZA0A 5CC7A 3ZOAA 2WJFA 2PF8A 1UP0A 3S4TA 4JQ3A 1M6JA 1TTIA 1JYXA 1FH9A 3LPFA 2W66A 1D9EA 3VOGA 3WDJA 7XIMA 1KM1A 2CU0A 1CLKA 1MYRA 1MO0A 4LUTA 3N3TA 4GWEA 1TG7A 1QHZA 3V4BA 1ITXA 5CPLA 4P8VA 1XIDA 2CKRA 3WBXA 2F61A 1QAPA 4QG8A 1UPPA 3CMGA 1E9LA 1WXJA 1QCWA 3U7VA 1QMLA 3W23A 2QLYA 3MHGA 4NZFA 2UY2A 3SCPA 1KBIA 3N2BA 2AMGA 1K7FA 1GK8A 1ZALA 3SN1A 1ZGDA 3WQ5A 4DO4A 4FLRA 2XVLA 3CMJA 4M81A 1ZBKA 2HJPA 1TJ2A 3FAWA 4ML4A 2R91A 1SYTA 1CYGA 1HT6A 1L6WA 5DRIA 3GVGA 4E2VA 2QCNA 3PP7A 1QTWA 2I9EA 3SDOA 2X7WA 1LF1A 3GNXA 2E8YA 1RVKA 1FVPA 2ZXBA 4HGXA 4DWSD 3PZ9A 4OV4A 1NF0A 4QGCA 4LB4A 4LV4A 3DFHA 1OX5A 3TR2A 5HAOA 3WQCA 2VFHA 4WGXA 1VZWA 3GRIA 3WJYA 4WLCA 1FTXA 1JZ6A 1AK5A 4YNGA 4M7TA 2BGSA 4WR3A 2ZTJA 4D8LA 4FP1A 3OLDA 4UOQA 3HPSA 4Z42C 5FJJA 3PS7A 1XW8A 1YX1A 2A79A 3B06A 2WSRA 4LU0A 1TTJA 4LV9A 4D8AA 4GVIA 1XFCA 1A47A 1X38A 3C0SA 1L2UA 3WUGA 1QPKA 4AZ7A 2RFGA 3PG8A 3E6EA 5FJTA 3M41A 1KV5A 5I7GA 3ITCA 2XN1A 4O0QA 2NV1A 3VGHA 3O15A 3FA4A 3C5QA 3EEZA 1EEPA 3TTEA 1OC7A 2GUBA 3NPUA 1B3XA 2O9PA 2DT1A 4HZ6A 1UC5A 3BICA 1TV8A 3ZM8A 1ADSA 2PS2A 4JKKA 4U5KA 2IQ0A 2XSBA 3GQYA 5A6SA 2GVYA 3LGEA 1H09A 2PBGA 3ARQA 4DYEA 3EPOA 4GUJA 5G2WA 2ZA1A 4K37A 2GGGA 1QBAA 3ITVA 2OTDA 1TE6A 1HJWA 3BG3A 1A3HA 3LB0A 5CLTA 4FR6A 2GWNA 3TTOA 5FOOA 4ZSTA 9RUBA 1P4CA 1UUQA 1LG2A 1XDJA 1EGMA 1XIJA 2GFTA 2OPJA 3E0IA 4PCTA 2Z24A 3WLJA 2JF7A 3RITA 5IM51 3QXBA 3NM3A 1JCTA 1E6NA 4O8RA 3L0NA 3W7LA 3NYDA 1EBGA 3WBWA 4DM2A 2DIEA 5A6BA 5D04C 2CLFA 2AL2B 1C91A 4H8NA 4XD6A 1D3HA 2HK1A 3NSNA 5FEPA 3WH5A 1RH9A 2FFIA 4MNKA 3EA3A 4JFWA 1E0VA 2YGYA 3A4AA 1EO5A 2YDQA 1JZ3A 1RP9A 3NQCA 2FLIA 1IZCA 2BHZA 3VOHA 5LIWX 3S0CA 1X7FA 4V1XA 1UCWA 3RUBL 3H23A 3TR9A 2J79A 4W4QA 3QR3A 4HNUA 4OECA 3IGSA 3B8VA 2A7RA 2VKZG 4QDWA 4Z08A 3ZVIA 3K2GA 1BWKA 2CW6A 3W28A 2A1YA 1JIBA 5CPSA 3UZJA 4F0LA 5LXEA 4Y7EA 3T2PA 2VGBA 4AHQA 3KCLA 3M5ZA 4AHOA 5EB8A 3DXIA 4LUYA 4UTTA 1AD1A 1BG4A 4HIBA 2FH8A 1WDQA 1E56A 4L4PA 2BY1A 1H0IA 4A3RA 3KBMA 3V16A 4O1DA 5I07A 1CCWB 2CFFA 2XUCA 2YFOA 2JGYA 2F2KA 1D2KA 4M82A 1WKDA 4B15A 2PF0A 1SFJA 3BLLA 2DQXA 4XUGA 5EPDA 4XX6A 3WEZA 1GG1A 2YA2A 1HJQA 1KCZA 1H4PA 1M5WA 2VD9A 1I2RA 5IFTA 3REQA 5A8GA 4Y6GA 2GJLA 2OGJA 2VRQA 4QQUA 4HSOA 1AH4A 2ATSA 4IX2A 3TUUA 1U33A 4R27A 1ESWA 3S47A 2FPYA 3A9IA 1PKMA 3W24A 2ZXAA 2JEPA 3V36A 4QITA 3NXLA 4IGMA 4UBPC 1EP1A 4XTDA 1H7OA 3P61A 2H3DA 2QGYA 3LNPA 3ES8A 5AYYA 4J3WA 4ATWA 1ECEA 3SSJA 2Z7GA 1NIUA 3POHA 4A2RA 4UIOA 4BQ4A 2PRLA 1G4EA 4KCVA 4CGTA 4HPNA 4US5A 5LA0A 4LNCA 3SGUA 5TF0A 3NG3A 2I9UA 3QPYA 1YBQA 3DKJA 4YYFA 3TCEA 3GU2A 3IVSA 4KRUA 1R3YA 3QOMA 5KITA 3T08A 2FZ9A 3LYEA 4MY1A 1R3QA 3KP0A 4TXEA 2VI0A 3STPA 2IW0A 2OKOA 4OTKA 4DHGA 1A3XA 4M80A 3JU2A 1W54A 2CERA 4JS3A 4OV9A 7ENLA 4JN7A 3E0VA 3BOFA 4PSRA 1CECA 1LOQA 1ICPA 1VFFA 3S5ZA 2ON3A 1WOBA 3W76A 3IJIA 3I6TA 3BUVA 4Q8WA 3U4FA 3AYRA 4XZLX 1VFOA 2OELA 3N2XA 4Y90A 4JTDA 3TDFA 1YTKA 3FNDA 4LCRA 3A6OA 2ZE0A 5C2XA 3NQ6A 4PL2A 1S1RA 1OK6A 3BMXA 2O4QA 5EU9A 5LNUA 5E09A 1LWIA 3QRHA 1M53A 5DF0A 2V3DA 3O0FA 2O9OA 3DFOA 2NVCA 4JYFA 4GQRA 4CU7A 1TPH1 1J79A 3DHFA 1YPFA 4LEQA 2V67A 3GXNA 1RUSA 3FYYA 4CEUC 2CEQA 2E1DA 4HVXA 3UXDA 1B30A 4ORMA 3N25A 4AD4A 4ICNA 6PTDA 3RM4A 1FWAC 1OF8A 4Q8OA 1JUBA 3R8RA 1PWMA 4FIQA 1WO2A 2Q09A 5CPOA 3LU2A 3BE7A 1UKOA 3L68A 4JYEA 2PWFA 4EE9A 6A3HA 4O54A 1TELA 3DYOA 1NQ6A 5EMLA 3TNOA 2YBUA 2BWGA 1T7LA 5IDZA 4H6KA 2J47A 2F6UA 3MI3A 4ACYA 4W89A 3WQGA 4Z1YA 1V0MA 5LIUX 4KF1A 2OX1A 4RXFA 1CXHA 3VGBA 4JCLA 2RGLA 3P82A 1QI5A 4KRTA 1VJIA 2C0HA 2ZRVA 3KOZA 2CXGA 1XC6A 4ZMGA 3MO4A 9XIMA 3WK2A 2JKAA 1POKA 4CNNA 3UG5A 1YRRA 3MUXA 3NQ8A 4ROQA 3G1HA 3D46A 1LL6A 2A6NA 2E9MA 2G96A 4Q22A 4H3DA 2GOKA 2PDYA 3W1MA 3WH9A 2O7SA 2E3ZA 2DORA 4CU6A 3DFYA 3MJYA 4GX8A 2Z27A 3KTCA 5LHFA 1B54A 1BWVA 3SRHA 1E6RA 3ABRA 1FWFC 4XAYA 4UR8A 1O1HA 1EBHA 3VNZA 3M64A 3UVAA 2PTZA 1KBKA 3PWGA 4JTFA 7TAAA 4UFJA 3CQ0A 4QCEA 3SUWA 1TREA 3THUA 2D1ZA 4HMDA 1NFGA 3KRUA 3MMDA 8TIMA 2ZE3A 1XLBA 4O57A 3VGGA 2HISA 1EJUC 3WQPA 5A2CA 2X0HA 3RO8A 2V5BA 3RX4A 4WSJA 4WCJA 3HFYA 1VP5A 2VFDA 3TMQA 1EGVA 4HP5A 4NRSA 1M7PA 1YXYA 4B92A 3ZR6A 2ADAA 1PZ3A 5M03A 1UA3A 4UWMA 3W7QA 1U5JA 5CJNA 2BZNA 3W7GA 3U5YA 3ZXWA 4YYCA 3RO6A 2ZZ3A 1XYLA 3A22A 3WJZA 2D0HA 4F40A 4JTTA 3EWXA 1TPB1 1R9XA 3WELA 1JPHA 3WMLA 2CCRA 4MUPA 5DEZA 4PGLA 3NZGA 5BXSA 4JR5A 2XVGA 3C3NA 3WLNA 4O16A 1XX1A 4I7UA 2EQDA 3SRFA 1H61A 1TYGA 1XLAA 4BI5A 1MEWA 3AYTA 3BLKA 4IP5A 4ZBCA 5ABHA 2DZWA 2XH7A 3IJ9A 1SO3A 4PEKA 4AZCA 3VCNA 3A4JA 4EAMA 3TQ0A 2X1TA 3MB9A 1IT0A 3WLMA 1YDVA 2VQUA 4DBUA 2CZDA 3VAVA 2PRHA 4C6EA 1A5SA 4UFHA 4QSHA 4JTLA 1VS1A 1LL7A 2J74A 5DLCA 3QR1A 3OA3A 3ES7A 5K9XA 4B5TA 1JQXA 2C8NA 1PCKA 7TIMA 4GY1A 1E6SM 1UASA 1UP2A 1IZKA 1OFEA 4QE1A 4IMAA 4KFOA 2UY4A 3L2MA 4N9BA 3NQ7A 3VX0A 4O1BA 5F1VA 1OZQA 3ISIX 1EO7A 1MEIA 4HHMA 3N34A 1E15A 1VYRA 1EB3A 1BG9A 5EKYA 2ZDRA 1JZ5A 3ARRA 2EPHA 1NP2A 3VNLA 1DE6A 3EXTA 1KR1A 2QCCA 3H70A 1HUVA 3W1LA 1E6PA 1KXTA 3BJFA 2BBFA 3NVTA 3PTDA 2A5HA 4KEUA 3VIOA 4CU8A 2ONEA 3AHZA 2DJLA 3O05A 3UYCA 3L5MA 5AN7A 4AQLA 3EZ4A 3MZNA 3B9OA 5T9CE 2FPVA 4UTLA 4ORIA 1SZFA 3FW6A 3WEMA 3MMTA 3NEVA 4QE5A 4UUIA 4YVXA 2WSPA 4FALA 4AIEA 3VOCA 3B0XA 1N2VA 5CC6A 3MUY1 3WKZA 1JD9A 1QNOA 1UHVA 3UGRA 1FRBA 1LUCB 1W8SA 3KCJA 1VFTA 1GQNA 4ZFCA 5ABFA 3NA8A 3A5VA 5ABTA 2YPIA 4BI7A 3UCQA 4NJHA 3H7VA 1Q2RA 2J7FA 4FS9A 1S3TC 2EG8A 4FOUA 1JCNA 1U22A 4PTMA 3NQGA 3PPFA 4B9ZA 2RJGA 3E74A 1RZMA 3L0GA 4JFSA 4XO6A 1HKVA 4FPSA 1VF8A 3F5KA 1D8WA 3BW3A 3ITXA 3LZ5A 1ZAJA 4WY0F 1V6VA 3KP1A 3MDWA 1NM9A 1PYFA 4HA4A 1AODA 2PDMA 3MVIA 3KLLA 3HF3A 4EPDC 5CEWA 2Q8LA 3CT2A 3FVDA 1JDAA 5KZDA 4YU1A 3EDEA 1G9HA 4Z2IA 3DFSA 3MBFA 2GJNA 3BK0A 3B8UA 3IAPA 2CNCA 2CLLA 1TWZA 2HNHA 3C3UA 2D2OA 1OC6A 3OGRA 4P8WA 3NDYA 4AF0A 1WX0A 1JG9A 4C1KA 2GGJA 4KRZA 5DMLA 3BAXA 4HCDA 4BI6A 2NQ9A 3HJZA 4LOCA 5FIPA 2E40A 3CAKA 3GYCA 4NNAA 4S3KA 5REQB 3RLUA 3TW6A 4TX9A 4REQA 1VEOA 2VTFA 2BNJA 1GQJA 2PDIA 4XKYA 3WQEA 1C92A 3DFPA 1GOIA 2XTKA 1E0TA 4IMDA 3QKEA 4BCEA 1CX9A 1NSJA 3MV11 3UR8A 1H63A 1EHAA 1RPKA 4KFPA 4WSKA 1EJTC 2GK1B 1MI3A 1PHWA 5FJRA 3V75A 8XIAA 3XISA 3IJLA 4QG6A 3GXPA 4IIBA 1LZOA 1RLDA 3WF4A 5E9XA 1PZ0A 1K1DA 5A94A 1OX4A 3QPEA 1VIZA 4OHQA 4LY4A 3QFEA 2DUXA 4IFKB 3TW9A 2RGMA 2QJGA 3IK2A 1MRQA 3EOSA 1R7AA 3N17A 1GHSA 1DTNA 1J0JA 1UR8A 3S2LA 1S46A 4RV3A 3KW3A 1EJWC 5FJPA 4RR4A 5H6HA 4G5DA 4DXXA 2Q6ZA 3VXGA 4JY9A 2WVVB 2Y2WA 2REQB 1QPRA 3VFCA 4J7RA 1QFEA 1YMYA 3PZUA 1C8YA 2QCHA 1R9YA 4FF7A 3FGCB 3QMRA 2EJAA 4W5ZA 3D6NA 3NOYA 2IQTA 2JIWA 3THDA 2G3IA 4W8BA 4E38A 2PPGA 2DSWA 5SWUA 4O1CA 5HMSA 2OYMA 1B9BA 2BDQA 1NTHA 6XIAA 4PUMA 1ZP3A 3THQA 1SO6A 4LFYA 1SW3A 2D69A 3WQFA 4JTHA 1B31A 2EEXA 2OSYA 3VIMA 4Q3MA 5IXEA 3AIUA 1Q13A 3WDPP 3C2FA 1S2UA 4KEMA 3TYCA 3UPMA 5EMKA 3H2EA 4GD0A 1UD2A 3NUKA 3HM7A 4IICA 3QFWA 1VBGA 2G37A 3KOYA 2DZAA 5HMEA 5K7JA 1NEYA 4PTWA 3AIBA 1ONRA 3PUGA 4EANA 2HROA 2C18A 4HMEA 2V8ZA 3ARSA 2XVKA 3AMGA 3FS2A 1OC5A 2ISSA 1EA9C 4IL0A 3RRXA 1YNYA 1J0ZA 2ZWZA 4NAFB 1VC4A 4CQDA 3W6MA 2PLCA 3P74A 1J2WA 1EJSC 1RY0A 2J8FA 2P10A 2DVXA 4I6KA 3ICJA 3VPLA 4RZ4A 2CXEA 4NYUA 1VGAA 3DIPA 4I9MA 3R8GA 4MOZA 3V0SA 4K38A 1LBFA 3I10A 4BA0A 5B7ZA 1RPXA 5FF4A 3NJ3A 4QJ5B 4DY1A 3M5YA 3THAA 4GZJA 3UF9A 4C6PA 2DY3A 4MWAE 1YE4A 4C5YA 3SO7A 4KW2A 2DPEA 4H19A 2GQ3A 4H6RA 3WENA 3IACA 4G7FA 4J1OA 2IXVA 3LCXA 4UFKA 3C2YA 3AHYA 4AX6A 1LORA 3QV9A 3K13A 1WDWA 2V2HA 4W86A 1VEMA 4KPLA 1J5SA 2VHLA 2V6AA 3RLHA 4ZENA 1TIMA 5I78A 3UWWA 1NY1A 4AXKA 2WO5A 1WPCA 1DIOA 1PUDA 3LNMA 4POCA 1PDYA 4WDUA 3FCPA 4H9XA 4NI8A 2G8ZA 4J3TA 2OXNA 3WLOA 1MUWA 1Q63A 4LRSA 4FR1A 5DCEA 4UTFA 1M9HA 2OLAA 5CH9A 4GQGA 1F8MA 3BOXA 4IG2B 4GRSA 1GCYA 1XCWA 2NW0A 3ZT5A 3IUIA 3EOOA 2YXGA 1IXPA 1QK2A 1XCFA 3OVQA 1RHCA 4TV5A 4TTUA 3E3HA 3JVAA 1V6TA 1YEYA 1O66A 1PIIA 1OSEA 4EKJA 3S5SA 3HMJG 1C7SA 1V08A 5IBXC 1GOQA 3QGKC 4GCAA 2OX4A 3AFBA 2FMNA 1OM0A 1MXSA 3MI6A 1NWTA 3QBUA 5BYWA 1H60A 4P8XA 5ABGA 3W2MA 2ACUA 2G5WA 2I5QA 1XUUA 3BXWA 2XVNA 3CV7A 5DN1A 3PZMA 3B3DA 1LWJA 2HBVA 4CD8A 2E7FA 3SUTA 3EKLA 5BOEA 4JIIX 1DJXA 3S2JA 2NWSA 4QSFA 4HOWA 3W07A 1Y0EA 3CGTA 1V02E 1REQB 1ZSXA 1US0A 1XYAA 3N6QA 5EGRA 5CZKA 3GBDA 2FH6A 3WYZA 4N0RA 1QI2A 4US6A 2ABBA 1F8IA 5AYXA 2ATMA 5BRQA 2ZZ1A 1JFXA 1IZJA 4DZIA 1FCBA 1Y5VA 2QQ6A 1QNPA 3M46A 1Q4WA 4L6OA 4OQVA 2Z1WA 4B9YA 1EIXA 2VMFA 3EWUA 3Q4DA 4PRWA 1KWGA 3U48A 2ZYFA 3FYOA 3MHFA 3C86A 5CZTA 2DDXA 4AISA 4V27A 3TA6A 3UGVA 4DJDA 4LWWA 3T9PA 4KMQA 1W37A 4YTTA 5CZ0A 3K1GA 1KW1A 3AALA 1O94A 2IPJA 2DQWA 2V63A 4O1AA 1CXKA 1WCGA 3STGA 1UD5A 4CUCA 4AHPA 2O56A 2A3BA 3HMCA 3KWSA 3VO0A 2EAWA 3GVWA 1TQJA 3RK8A 2WVUA 2NQLA 3WFAA 3AMCA 4TTGA 5EL1A 4MZ8A 1R6WA 2WCSA 1MXGA 3CPGA 4PTXA 3M0YA 2VRJA 3HG2A 4UTHA 1DHPA 3WBEA 2GDUA 5CSYA 4Q8UA 1BRLA 3HV9A 2F6KA 3VIIA 5AYBA 4V33A 3E2VA 4L4MA 3FLUA 2J7DA 4MPQA 4HNOA 3OVRA 1WKEA 3NTYA 2QCGA 2HV5A 1LBMA 3EPNA 5HQMA 2PWHA 2VEPA 1L6SA 3PUEA 3KL0A 1NELA 5BROA 4UTIA 1AH0A 4NZ5A 1XUZA 1UH2A 4HCHA 3AHXA 3GZ3A 2DW7A 3CH0A 3WD1A 3G5EA 3VIPA 4LVGA 1NDYA 4OBRA 3FKKA 1M7JA 3CZKA 5ECUA 2Q71A 1BLIA 3BCDA 2FTYA 3H12A 2VX5A 2O9RA 4K8HA 3CIXA 5BWAA 4HMNA 1RY8A 1PB0A 4Q8MA 2ZZ2A 4FX7A 1YPIA 5BWFA 3KAOA 2I16A 4S23A 3PSVA 3CC1A 1YDOA 3I3DA 1E9ZB 1J4EA 2D3LA 1R3RA 4GABA 1J12A 4AY1A 1FWNA 3W7NA 1P6CA 1CGXA 1ZCCA 2IQDA 2J24A 3JS3A 4IPNB 3H2CA 5AYIA 3MI2A 3B9EA 4YWIA 1U30A 3PAOA 3ZSTA 4LVDA 4TVCA 1V4YA 1FH8A 1JVNA 4XWUA 2J9XA 4PMNA 2OZ8A 3VCRA 3SCWA 3F4VA 3G6LA 1W5NA 4KIRA 1UKQA 4AY8A 1VCVA 5CC5A 1PIFA 3I7SA 1XGZA 1BEUA 1K6AA 2GUUA 3MU7A 1E0UA 3C52A 4IP4A 2QEZA 1C90A 4INFA 3DAQA 3RN6A 3DDMA 1D7FA 2AL1A 2QT3A 2QMJA 3EYPA 2XZ7A 3PJWA 2WKLA 4XBSA 3GTIA 3M7SA 1IGSA 3IVTA 2Y4SA 3OJGA 3LRMA 2QCDB 1E0WA 4MWAB 2UBPC 2VFFA 3KZPA 3CAWA 4ALDA 1MW0A 2E25A 4H6EA 2OQHA 5D9PA 3BARA 3KWXA 1OFQA 1UD8A 3EXSA 3NURA 5FI8A 2NX3A 1S5VA 1LP6A 1E6XM 4E4UA 3NSXA 2HPIA 4JTGA 1VHNA 3WQVA 1W1VA 1XBVA 2PWGA 3W74A 2PWEA 4K7YA 2WPGA 4Q8QA 1HKIA 2FJUB 4AU0A 8XIMA 2CHOA 5IHSA 3A24A 3CZJA 3VYLA 4AIBA 1UB3A 1OFDA 4H01A 4XZIA 5MF5A 1X1NA 1EUNA 4NSBA 4P7LA 1GTEA 2E6DA 4RW3A 3SECA 4AYSA 2ZRYA 2AAAA 3TMLA 4U5IA 1XIGA 5E93A 2X8RA 1Z3NA 4M6PA 4R5EA 5LKYA 2QR6A 2A3EA 3GDTA 1TX0A 1AA1B 1W1PA 1XFBA 4AEEA 5FF2A 4M24A 5AHEA 3MP5A 3S2CA 4XSLA 2DIJA 3WFZA 2G3FA 2YX0A 3PZTA 5A6KA 4HTBA 3WIJA 1T5AA 3OQEA 1H41A 1V6YA 4X2RA 1ALDA 3CXOA 1EPXA 1CXEA 2HPMA 2PTXA 3S6TA 1R2SA 4YTSA 1HKKA 3IEBA 1P1XA 3RGTA 2YW4A 1H62A 4GUFA 1GYNA 5BXTA 1Q8JA 3IVUA 3LI0A 2QZRA 3WFLA 4L9YA 4IIDA 3ATYA 2B0MA 1V93A 3SN0A 1BYDA 5JBEA 3QY6A 3V3WA 3VD5A 4O0KA 4C6KA 4IGSA 4W8LA 3ARPA 5D37A 4LUIA 3JW7A 3SIMA 3M4HA 1OFAA 2AQWA 1HL9A 3N9SA 3PBVA 5BOFA 4YTRA 1ITCA 1ME8A 1F05A 4JCMA 2DV0A 1V3LA 4AZGA 3H2OA 2ISDA 1RK5A 1HJVA 1K8XA 1BVZA 3UWUA 4JIEA 3K46A 1W3NA 2C19A 2A2IA 3URBA 2G3NA 5GNXA 3VGFA 4F2TA 3T0AA 1XG4A 2CZVA 4BKNA 3LY0A 1DJQA 1XG3A 1J0IA 3WLKX 1TZ9A 1XLDA 1UD4A 1Z89A 1EC8A 4MFEA 4ZODA 4H8VA 4IXHA 1DPMA 1N7KA 4UMBA 1QXLA 4RPQA 3ERPA 3HGJA 4E0CA 1KBJA 3SFKA 1GONA 5CJMA 5DXXA 3LCGA 1IWPA 4UQEA 2QUVA 3G77A 3DYPA 3QLLA 1WXZA 4HMCA 1KM6A 3RCMA 2H9AB 3EEGA 3WQ6A 3QMSA 2E09A 1AJ0A 4G9PA 3GDRA 4IFRA 4GYJA 5D03A 5FJOA 4CQ9A 2I1OA 1WAUA 1EX1A 1PAMA 3UETA 1FFRA 3KBVA 3I7QA 2WB5A 4HJWA 2E0PA 4W87A 3ZMRA 2Z1BA 1QNVA 1S2CA 1U1HA 2ZZ4A 1W91A 2P0IA 3EMZA 5M3WA 4XZ9A 1ISZA 3GXTA 5BCAA 3DZ1A 3HJEA 1BGGA 1UMYA 2O4MA 3B8DA 3WDRA 5HA7A 3H22A 3QC0A 1TPC1 3V0UA 4I8DA 3QOKA 1C9DA 2NZLA 1HO4A 1P43A 1Z69A 2BXZA 3WK1A 3UCCA 1HF6A 2X05A 1WYIA 1XLLA 2CC0A 3WJXA 4W7WA 4HU0A 4MWAC 5BMXA 5M5DA 1V3KA 3D5HA 4B16A 2GYIA 2YXXA 2ZX6A 7REQB 1ITUA 1O5KA 3S1WA 3TH6A 1FWWA 4K7VA 3APGA 1FCVA 2PC4A 4Q8PA 3FJ4A 2WZEA 4N6FA 2Z1VA 2YCJA 5J8LA 1WUFA 4MJMA 2BHYA 3VNKA 3WF2A 3NO1A 3SQMA 4B5VA 1EZWA 4ES4A 5AC7A 3VTRA 3K8LA 2J8GA 2YYTA 4S3AA 3PZIA 3B9DA 4EWND 4I9TA 4UR7A 1C93A 1Q6RA 3D47A 4DJDD 1TRDA 3AXHA 4ZXOA 4QISA 3NPWA 2BSLA 1DJZA 4DRSA 2OZ0A 2Z2UA 2PP1A 4GKTA 3M6DA 1V0NA 3STEA 2G50A 3S6OA 1Q4NX 1K4GA 3JZUA 2X2GA 4XTIA 4QIUA 5H1WA 2Y5EA 4AC1X 4ADUA 3O7UA 1JAEA 3CAVA 1FQ0A 4JDYA 2B7NA 1XRSA 4JTQA 3UG3A 1EC9A 3VMOA 4DPPA 4NXSA 3W25A 2INEA 1HFBA 4TU1A 2BG5A 1QPOA 2PWDA 3UA4A 3ZO9A 2WM1A 4IOTA 3SADA 5BZAA 4R7OA 1YTDA 3H2FA 1JI2A 4C6IA 3Q45A 1RV8A 2EGZA 1PHQA 4XAFA 2YCLB 2DP3A 1NOUA 3S5YA 1K77A 4RE3A 4LVAA 3Q2DA 2XM2A 5K2ZA 5HQEA 2FHCA 5MHBA 1D7KA 1J0HA 3CO4A 3HGOA 3G18A 1VH7A 2VCCA 1ZU8A 1LRNA 2ZICA 5DO8A 1DIEA 3TLLA 3M6YA 4JKMA 4R33A 3CZEA 3T8QA 4U28A 3LQGA 2PUZA 5HUOA 2QHAA 1AFSA 4JTRA 5A8OA 3LENA 2R82A 2Z4GA 3R58A 4B3LA 1XYBA 2DSKA 4LBUA 5G2IA 4H9ZA 2CLIA 1S1PA 3AMKA 3U2CA 3N14A 3VGEA 3N3MA 4LX4A 3W7CA 1GVOA 4DBWA 1I9CB 1DORA 3MQTA 1R3SA 1W2PA 1OIFA 4XZHA 6REQB 1IE7C 1FY6A 3TYZA 4A8LA 3T0DA 1UR2A 1TA3A 1VYPX 1DJHA 2XVPA 2DZUA 2IS7A 4J40A 1VKFA 3PR2A 1TPUA 1H49A 1XSJA 1K70A 4LYKA 2FHBA 3KVKA 3W02A 5DXYA 1Q5MA 3W1PA 3NDOA 4LS2A 4BEQA 1Q65A 1HNYA 2P3EA 1A5OC 1X6NA 2PFHA 2P53A 2YZRA 2ZRUA 2PDUA 3DFNA 3RLGA 3B04A 2ALRA 3PNZA 1SGJA 2QPUA 2XM1A 3OLIA 1BD0A 1Z9AA 4B5WA 4GI6A 3OG2A 2A21A 1C8QA 2J66A 4N4QA 4U31A 3OBAA 3G1VA 1V7YA 2FMOA 1U5VA 2DZPA 3FY1A 3W83A 1NDZA 1E43A 1OGGA 3GS6A 4G1NA 1KGUA 4ZO8A 5T91A 4BQ2A 3WLHA 1GVYA 4NX5A 2RKXA 3VINA 2DH3A 4GYPA 3STCA 3ARYA 4Q8TA 4D6FA 3QYQA 4DWSC 4NVTA 1M65A 2ZQ0A 1HQTA 4DF2A 3C2RA 4DX3A 3P84A 2HK0A 3KRSA 4P7NA 5ABEA 5HJXA 5IRPA 4QXIA 4ZQNA 3M9YA 5D33A 1ELSA 1SFTA 4W7VA 1DJNA 4DO5A 4XVDA 4IF2A 1Y8BA 3PM6A 3OHMB 2GJXB 4IMCA 4DAFA 4O1FA 1PKNA 3L2LA 3AUJA 4YN5A 3K4WA 4G6CA 5BU9A 1M41A 5HK4A 1XM3A 2WMHA 3LLDA 4IZGA 3F1QA 2R14A 3PZGA 3RU8X 2BLEA 4PODA 3TSDA 1IF2A 1A0DA 4NJJA 4MVAA 2V5KA 4QG9A 1XP3A 3MKKA 5CGQA 5C0QA 1TV2A 1W9UA 2GVEA 1WDDA 3RR4A 1VFSA 3LMZA 5E1QA 4NU7A 2YDSA 1DTUA 4FB7A 4B5NA 2A7NA 3H7UA 4JHZA 1R47A 1GOXA 1B0IA 1TVPA 5DBTA 2OT0A 1S5WA 4CNTA 1QPQA 1OYBA 1CB2A 4D6GA 1JXJA 5F4SA 4X61A 1E1EA 2FTWA 3M5VA 3LXCA 1UKTA 1CTNA 1EXPA 3MUAA 2EPKX 4LEFA 1J18A 3GW3A 4Q8NA 5J5RA 4C6OA 4D8ZA 3VIHA 2YBTA 1IV8A 1Q6CA 4BHYA 4HK6A 1TJRA 2C7FA 3WDQA 2MUCA 2NLYA 4TR9A 4V1YA 5JH1A 4QRNA 4UMAA 1QATA 3E5PA 2WZMA 2QPSA 1HZYA 1QDSA 4FOJA 3W6YA 3MPGA 1MFUA 1IWBA 1YADA 1VJSA 4QJ4B 1AH3A 5JBFA 3LZ3A 4E3VA 3B9AA 3PPHA 4PUDA 2WHKA 2BOEX 1SZGA 2I14A 2HBXA 4CCCA 2ISVA 3W01A 1GOMA 4Z0SA 2FZNA 4OFCA 2Y63A 1YXCA 4M56A 1MEHA 2G3JA 4W88A 1KFWA 1AVAA 1WB0A 3WDHA 4KGJA 1TJPA 4H9UA 3BAYA 3R7MA 2XN2A 5GJPA 4Z1BA 3N9KA 1C8VA 1V02A 4JTKA 2JALA 4GVGA 1IXOA 4GPNA 4PEEA 2RDTA 2ZADA 3VDAA 4N9EA 5TAOA 1GKRA 3LCLA 1TMLA 3BG9A 1HJXA 3TXVA 5I5RA 1W6TA 1OX6A 1MWOA 2Z0IA 2XINA 1CB7B 5JUVA 3W4RA 3H54A 3ARTA 3G1XA 4H9VA 3G1FA 1JCLA 2V5LA 2JF6A 2EF9A 3E38A 1XSIA 3BGAA 5FESA 3WLQA 2C1GA 2XGBA 1ZCOA 2JKPA 3WMBA 5KZEA 4EP8C 1HXJA 3POCA 3AISA 3GAKA 3UVIA 1E40A 1EFZA 4JIQA 3W7JA 2QUUA 3K5XA 1L6FA 2C14A 3GNRA 4BQ3A 4PCSA 3B0YA 3ZVHA 1ZJAA 2DZTA 2E5BA 4JGDA 1GQLA 3M0IA 1EIBA 1YE6A 3NQMA 1G7VA 1KFCA 3TWAA 4DM1A 3QKZA 3U7BA 5AC6A 5FACA 5C9WA 3BVJA 2J27A 4U3CA 1KM5A 1E0XA 1JRBA 3QV7A 4NILA 2RDUA 3GDMA 5GQBA 4MGGA 3HZ3A 4UFIA 2BGQA 2V2DA 4IPIA 3VUPA 1XGDA 1VPQA 4AC7C 1J9YA 3B40A 4PMZA 4FSAA 5I3FA 4I9JA 3G3MA 3HOJA 5LIXX 3EWYA 3UR2A 3FFSA 3AWNA 3GK0A 1P0BA 2JK2A 4I6VA 1OINA 1G67A 5CGTA 1GGOA 5EFFA 2OGYA 4AXNA 1LTDA 1K9TA 5HPCA 2V30A 2KAUC 3BL3A 3TTQA 4Q4QA 1F74A 2QS8A 2NVDA 3UZXA 1BQGA 3G1YA 3EMQA 5HNRA 1KRBC 4LNYA 6TAAA 1JULA 1R9ZA 2OODA 1W3HA 4ZQOA 1U1UA 3FHQA 3GUGA 3UR5A 3CH9A 3W1NA 3Q37A 1IXQA 3PN8A 2J62A 3LRKA 3OW1A 2YIHA 1FWJC 3KHDA 3VKCA 5HWNA 3LV6A 4AVOA 4C1NB 4B5XA 4JQ4A 4JNMA 3AS0A 4JTCA 2Y5JA 1N8IA 2VNCA 1GYMA 2ICSA 4CQBA 1GVQA 3EKZA 1FDZA 4W5UA 3VC6A 5G1MA 1KTBA 3HBLA 2XH0A 4D9PA 4JX4A 1SZRA 1SO4A 3W2NA 2VFEA 3MP4A 4GZEA 4IPLA 4S3FA 2QCLA 5EMUA 1XRVA 4BEUA 1A5AA 4GVHA 1NOWA 4GMEA 2IPWA 1DJGA 1FWGC 4MLRA 3QHMA 4H6QA 3LCIA 3DHUA 1X96A 1UWTA 2ZVIA 1GZJA 4Z17A 3MKVA 3S2MA 3GUWA 4NZCA 2PDHA 2GZXA 2HE8A 3TSBA 4QAWA 1CGUA 2C0AA 4X60A 4IGHA 1PWLA 4DXVA 4K1GA 3FDKA 2DSVA 3M1ZA 4O50A 3KXQA 1MW3A 4XG1A 1KM4A 4NNCA 4WKFA 4JBRA 3O63A 3V7PA 3CIVA 3WNOA 4AYGA 1XRTA 2TMDA 3E0FA 2Z2AA 2POTA 3OLEA 2VURA 1CLVA 3A4XA 4JZ5A 3B03A 4GACA 3LRLA 3K30A 3AQUA 3WY1A 1WNOA 4IJCA 1EJRC 2XFRA 2Q02A 1KR0A 3OB8A 2ISWA 3LSCA 1I2OA 2CYGA 3H4GA 5DCDA 3ZZ1A 1GVEA 4GY0A 2OJPA 3IIXA 3AS2A 3DECA 5I00A 4URIA 4AZBA 3MJMA 3GIQA 1OT1A 3GR7A 2CLPA 4NUWA 3I4KA 3LLFA 3E0WA 4E2OA 3Q58A 2NT1A 1NP0A 2CBIA 1ECQA 3ABQA 1YXDA 1SJCA 2H90A 4Z1AA 4KESA 1B3OA 2OSWA 1JDCA 2B7QA 1E55A 2INFA 3IV3A 1B4EA 2IKIA 2WJEA 3RJYA 3A3WA 3KCOA 2AMXA 1QHOA 5DELA 1UKSA 2NQ5A 3CL7A 3B8WA 4S38A 4KWOA 3UG8A 5JXQA 3VD7A 3SUSA 3JR2A 1FCQA 5E70A 4UC5A 1OCBA 3E2SA 1MNSA 3B8TA 2Y88A 3CUJA 1I60A 3REQB 3QLDA 2WSKA 3TNBA 3CMFA 4LY8A 5C8BB 4GBUA 3VKAA 3PANA 2PC8A 1BFNA 1FWEC 3B0PA 3G2GA 4QJ1A 4D6IA 5AHIA 1OGBA 4BZYA 1JRCA 1TWSA 2I17A 4JD4A 3R94A 2C79A 1PDZA 3S1VA 5C71A 2X30A 1Q8AA 3CZLA 2X42A 3NCOA 5A6JA 1ISXA 1E51A 2AQVA 2XH2A 1AQHA 3GWQA 5I09A 1H5YA 2R8WA 4E4PA 3GKFA 1IR2A 4MKVA 3M0JA 2JEQA 4GIEA 1PZ2A 4QS6A 2F38A 1YBQB 6XIMA 1L0PA 4ERGA 2EG7A 4WIWA 1J10A 3FEMA 3MSRA 1LT8A 3PC0A 4M7SA 3BC9A 2JIEA 1P7TA 3CB3A 3PPCA 1C9WA 1RBLA 1A53A 5GJNA 2GDVA 1UUMA 1GOKA 1JPKA 4LCSA 1N8FA 1XH1A 3EDFA 2WWDA 4AZ6A 1F5ZA 4QBXA 1X8CA 4XK2A 4BFAA 1K8ZA 3RX3A 1S5MA 4QQ3A 3BJSA 4ZQMA 4CQCA 3UG4A 2GQAA 3NDZA 4Y96A 1T41A 1JGIA 4G1KA 4LRTA 4C6QA 1SMDA 2PGFA 2XSXA 1JNEA 3IANA 1GW9A 1B3VA 2CLMA 2O92A 3NYZA 1VFLA 1RJRA 3W37A 4GUGA 2YCEA 4I7VA 3TYAA 1BSLA 4O17A 5RUBA 1KQYA 3SBFA 3T7VA 4NAEA 4D6DA 2WVVA 3S8HA 1SPQA 2BXVA 3W0KA 4WZHA 4H8UA 2GOUA 4DUOA 1A5BA 1GOWA 3VNMA 3EBVA 4Q4PA 3C2OA 3VI2A 3AXKA 2V5DA 4NASA 1J6PA 3MCNA 3L0KA 1XBZA 1LCOA 1UBPC 4I90A 3WNKA 1CW2A 1UZ4A 1W5OA 1PKLA 3HQ1A 1T96A 4LCQA 5AECA 3DBNA 4YVVA 3E2RA 3OQ8A 3KDOA 3V1HA 3DBPA 1W1YA 1RQEA 5FD0A 5A8MA 1VQTA 3W7MA 4DF1A 4F48A 1DYSA 4Q6JA 1Q6DA 4UNKA 3VK5A 1J2BA 1RBOB 4L1XA 1VBHA 5A8PA 3AMDA 4GFIA 4IPJA 1RJPA 3W87A 1SQ7A 4GI4A 1UQZA 2VDGA 2NVAA 1X7IA 3VZYA 2HVNA 3CS2A 2DEPA 4MZYA 4O13A 4ZE5A 1G1YA 1FUYA 3D3FA 1XD0A 3FOKA 4EX4A 1LDCA 3TZFA 4I8YA 1FHLA 3UA3A 5B80A 4GIYA 2QVHA 4WRHA 5CPNA 5AY7A 1V51A 3PNUA 5C9XA 4PCPA 5BNKA 3GG0A 3CB8A 3H4XA 2Z6JA 3KRZA 3GDKA 3TROA 5IFPA 4H7VA 3WQOA 1BF6A 2YW3A 4LB3A 5GNYA 2DGAA 1I45A 4HHHA 3MO7A 3CUZA 3DC8A 3WJWA 3T0CA 1YQ2A 3RRAA 2VVNA 3H21A 3MTWA 4AG0A 3U8GA 1QW8A 2X41A 3UFYA 2VT0A 4HNTA 2WJZA 1PTDA 4DLMA 1SU5A 2HWGA 1IIHA 7CGTA 2NSOA 1F6KA 3P60A 1HGYA 2PDJA 4BK9A 3OBKA 2FB3A 2VGIA 1GPWA 5MKGA 3O8AA 1Q2SA 2AQOA 1I0BA 2BVWA 3WK3A 2V68A 1EL3A 3CEUA 4OKDA 3U0HA 4LSBA 3AZSA 2C15A 2OWXA 5F1UA 2PP0A 3S9YA 4HCLA 5EMYA 4HPGA 3WQ4A 1UD3A 3WCZA 1KFKA 4U10A 4XBJA 1JYNA 1Q6LA 2QDHA 4IM4A 3S42A 4OOZA 2ESCA 1JXKA 4LC6A 3WLTA 2CHNA 1U83A 4H41A 4PUNA 2PE4A 3WF1A 3DERA 2Z1KA 2VEKA 3I4EA 4UNLA 3BGGA 2V2CA 1B5TA 1RD5A 5D8ZA 1K02A 4NY2A 4LUSA 1QASA 2O55A 4DUVA 5EY5A 4AD0A 1C8XA 1ZAIA 4S3GA 4K36A 2WAGA 1BHGA 2OR2A 1NAL1 4KETA 4DXKA 3OZMA 5GJMA 5HOSA 3L4VA 4S3DA 4A35A 2FZ8A 1G4TA 2HQAA 1PX4A 1S3HA 1IEXA 2OYLA 3VKJA 3W7OA 1QHPA 1V7AA 4A8RA 3AROA 1ZQ5A 1E9IA 2PDGA 3N4FA 2W63A 3NZPA 5I3JA 2HNEA 2ZVRA 3LQLA 2GVLA 4AWUA 2BV9A 4GO9A 1QNSA 3GDLA 4PMVA 1KGXA 1FWSA 1GVFA 3L12A 4PFHA 3TLQA 3G1SA 4AZCB 4L65A 1XQKA 1OJXA 3EX6A 3QV6A 1P6WA 1DWFM 4Q7BA 2FGLA 3FYPA 2PA6A 1FWTA 1EYWA 1ADOA 4O4WA 2UV8G 1TV3A 2Q01A 1VBJA 4MB1A 2BY0A 3E02A 4FNSA 3CQIA 3PB2A 2VDIA 4N7QA 2Y7FA 4P7OA 2PP3A 1MQQA 2PDXA 4NHVA 5C2GA 3CK5A 2BVTA 5BRBA 2IMRA 3LX9A 4S39A 1DEDA 1MW2A 1F3EA 2JQXA 3UZ5A 2YYUA 5F4XA 5HMDA 3CWNA 4I5XA 4Z2GA 3FEQA 3GW0A 2V5JA 2D24A 3ZT6A 3UR7A 2CZFA 4WY0A 1UOKA 2YB4A 3PB0A 2BFGA 4PC8A 3DC0A 2ZDSA 1HKJA 2GJRA 3QR0A 3B4YA 2NV9A 1H3GA 3LPPA 1UD6A 5BW6A 4D72A 4DIAA 2QCMA 1Z8AA 2CZ5A 3S5NA 2WNWA 4JDBA 2WYSA 3N12A 1R3VA 1EOMA 5JQ9A 4CD6A 2HS8A 3GC5A 3EA2A 4XAPA 4L1WA 3QTGA 1MW1A 5H91A 1RAKA 3N11A 2VZTA 3BSMA 1T8XA 1UWRA 3N2TA 1X1ZA 3PULA 1F61A 3ITGA 5HNNA 3VIGA 1JPMA 2H3BA 5ABFB 3UPWA 1BXBA 3BW2A 4DN1A 2ALDA 2WCGA 1RK6A 1V0KA 2PI6A 2P76A 4G2DA 4DBDA 3T6CA 4IH3A 2INZA 1UG6A 2PAJA 2OOFA 4NQ1A 2V3FA 1NFPA 3ZJ7A 1QU4A 1UA7A 4HHPA 3UJSA 2E6AA 4L4LA 3GE7A 1TPDA 4UQDA 4Q4KA 2D2JA 3B0VC 4RZ5A 2B31A 2NV2A 4HPXA 1AG1O 1UZ1A 3UNTA 4LQ1A 2HTMA 3RFAA 3UQNA 3ITOA 3MDUA 5AVNA 3G3DA 2WMIA 2ZUNA 3UU0A 1RQBA 2QDGA 1VCFA 3VMNA 4B5UA 4X0VA 4YMZA 4V2XA 3TOYA 3QW4B 1I2QA 2P0OA 5LGZA 4E6MA 3F5LA 4HZ7A 2FQIA 4AF0B 1O68A 5EMJA 3RIKA 3W7KA 4IFOA 4H1ZA 4TMCA 3O3RA 2GGEA 3GZAA 1O12A 4REQB 2GQ9A 1M68A 2W67A 4D71A 4XKYB 1QO5A 3KHJA 4AEFA 3DH7A 4FNRA 1YLVA 5HANA 2V81A 3E2QA 5A6MA 5BXRA 4DJED 1R3TA 1FDJA 1IIGA 4WHBA 1AMKA 2Y24A 4C65A 4DJFD 3FAXA 3JRKA 3VIFA 1KV8A 2VO5A 1KM2A 3IJQA 4LYPA 1T8QA 3CNYA 1OX4B 3RM9A 1XLEA 2IKJA 2PRMA 3KVLA 4KS0A 5D9NA 3T42A 3ITTA 4AFYA 1SW0A 3GG7A 4NJKA 4GC3A 4JTSA 3NZ1A 6CGTA 1RCXB 2VENA 1KFJA 4FX6M 1G5AA 2PURA 3PJXA 3U4AA 1ZENA 4KCTA 4ATLA 4L64A 3TJ4A 3UY8A 4FLOA 2PDFA 4L61A 3OGSA 3NFUA 3PZVA 1XJBA 2PDWA 2DT2A 5LYRA 3WNLA 3HO8A 1KQZA 4BR1A 4OUEA 5G1YA 4GZ7A 3P7YA 1IWAA 3N29A 3F4DA 3MV01 4RDYA 5HBFA 4QCFA 1NVMA 2O9TA 2BVYA 1OF6A 3I3BA 4N9DA 3S3GA 2E28A 4GOAA 5C7VA 3KL3A 3FSTA 4AY7A 3MSGA 4GVFA 3H26A 3AOFA 1CT5A 2VM8A 3WD2A 1GEHA 4RJEA 1CZ1A 3QGAC 1Y7VA 3O06A 2YOCA 2Z1XA 1A4LA 3VFLA 1RVGA 2OU4A 5K4ZA 2J75A 2DSUA 4IWWA 3AYSA 1NOFA 3KTSA 4MMWA 1XDMA 3B05A 2OCZA 5DY3A 4WDWA 2NLIA 5A6AA 2V0TA 2P8BA 3LOTA 1E3XA 3O6YX 1QI4A 1EZ2A 1WDPA 4IUOA 1F6PA 5HNUA 3NGFA 3PTQA 3ANYA 2YDAA 3GR4A 4LPCA 3VD9A 5TBOA 1E3ZA 1PCWA 3FV9A 3ZJ6A 5BMWA 4K8EA 3U6WA 3TQPA 1HVXA 1ZP4A 4JTJA 1EDTA 3D0CA 2FZMA 5A3HA 1TPFA 2QUMA 1S5NA 3ZLGA 1XYCA 2EPOA 4GIAA 3P0XA 2J6XA 2NQZA 4F0HA 2Z25A 3B0UX 1GT8A 1Z48A 2DT3A 3UXLA 2OLSA 4GYFA 1J96A 1A5UA 1BYBA 2VCBA 4OIFA 3H2MA 3AYVA 4ZB0A 2AOSA 1A50A 2KZHA 4XD4A 3TCSA 2HXUA 3ZIZA 3PK7A 3APYA 4JFTA 4LW7A 1W56A 1P0KA 3OGVA 1AQ0A 4WXZA 1A49A 1P48A 4R7WA 1Q85A 4A22A 3IRDA 1ZRQA 4G7EA 4PUJA 2FHFA 2BOGX 4GA8A 3ABSA 4Q4SA 2F6XA 2BS9A 4GG9A 2GUYA 3ECQA 3PJUA 4GNJA 3O1NA 4MADA 1HJUA 3ANVA 5ECVA 4W93A 5C9ZA 2B7PA 3IRSA 1SJAA 3KBSA 3S83A 4RE0A 3CWHA 4DZ5A 3TV8A 2ZUMA 3NNTA 4CCDA 3Q67A 4PMOA 2P50A 3WDIA 5A95A 3DHDA 1VIWA 1DJYA 1KGWA 4EACA 2GWGA 4YXGA 3FN9A 1Q6OA 3LXBA 2FPTA 3SCNA 5GPRA 2WZTA 4RV8A 2W27A 3N6HA 2J7GA 3DESA 2E4TA 4O11A 3HURA 3FA5A 3W7RA 4NNBA 1IT8A 1BSIA 4U2YA 5FA5A 1OD0A 1XDLA 4C6LA 3XINA 4C90A 1DVJA 1R38A 4O18A 3N04A 5FF3A 3O6AA 4GGBA 2ZXQA 1TE1A 5EFDA 3CUIA 3OIHA 4S2CA 4DWSA 4CVWA 1OFPA 4TV6A 3E96A 4AIUA 1SJBA 4EXQA 4A29A 1GNXA 1XGEA 7PTDA 3OA5A 3RNDA 3QSTA 4NI3A 4WGHA 3TN5A 1UC4A 3OVGA 2Y85A 1E4LA 1O5XA 3SIZA 1PX8A 2TRSA 1B3YA 3BZJA 4F2UA 3BG5A 1F9CA 3URQA 2VRKA 1X8FA 3T78A 3V35A 3OOQA 3EWWA 1OABA 1GJUA 3CAQA 4P2VA 2E6YA 2XWDA 5T26A 5TQLA 4KEVA 1JYWA 2HMCA 4NYYA 4FK9A 4DELA 5A1AA 1FWHC 1H7PA 3VDCA 2HVMA 2P5NA 1JCXA 3MWAA 5CPQA 3ZJKA 1FWCC 2IPFA 3W2LA 4AWEA 3GNNA 3GM8A 2E5CA 3E12A 1TCMA 4L4OA 1BTCA 3DX5A 4I9AA 1E71M 1SVDA 1LJYA 3IJ7A 3T09A 5DY2A 3U2ZA 4NG3A 2GL5A 2EBNA 4GQQA 2W61A 3VE7A 3WJSA 4C7FA 1EWEA 2J6VA 1ISWA 1JUKA 4X63A 4BF7A 4CCEA 4XAGA 4Q4RA 4ZTXA 1ZHAA 4DBEA 1VFMA 2DJXA 1IYXA 1E1CA 5A6BD 4KFNA 3A64A 1EWDA 3WNPA 1JGMA 4FXSA 2D2HA 1K4HA 2VUNA 1G6CA 1YPXA 1JR1A 2WBKA 4ADSA 5I3GA 3URAA 5FAGA 1A4MA 2ISFA 3IIVA 1T40A 3C0JA 3HB9A 2DVTA 1GVSA 2HEJA 2CLOA 2BB0A 1AMYA 1ICSA 1W9XA 1JF6A 1X6LA 3EWZA 3NVDA 4HZMA 4HB7A 4C1LA 2BHUA 1QW7A 3P93A 2A7PA 1BRLB 2F9RA 1TPVA 3GD6A 2VC7A 4PE8A 2CETA 5CSRA 1GQKA 3W86A 4P61A 4MDPA 1M03A 4UMCA 3NSMA 3SCVA 1FOBA 1LRQA 4ERIA 2NXGA 4GZIA 1CBGA 2VDHA 1IGWA 3JUGA 3L4UA 1KRAC 3J7HA 1TMHA 3CTTA 1SZNA 4LANA 5IHRA 1AQMA 1E9YB 1KWKA 2A3CA 5M2FX 2FTPA 3OPSA 4YLWA 1FWRA 2CLKA 1V3IA 2A85A 2NX9A 4B91A 3OG3A 2BVDA 3PFRA 4D6HA 3UXAA 3KRBA 2ZX9A 3UWEA 3GH7A 1VFHA 5I3HA 1CGYA 1JL8A 1I0DA 4N2YA 3P80A 3W3OA 4JOMA 2XDFA 1Y65A 4XD3A 4P7QA 5HATA 2QCFA 4R3UA 4GINA 1N55A 2OWWA 2VEFA 5TIMA 4IHCA 2ZA2A 4UXDA 4FHAA 3NQBA 2Y70A 3C0QA 4YJ5A 1BTMA 2D22A 2AGTA 3MCMA 3M16A 4PR4A 1EEXA 3CZGA 2J7HA 4MNLA 2I5GA 3L5AA 1DE5A 1XLHA 4D6CA 1LRTA 1W3KA 1TO3A 4IQEA 1JCMP 4E8DA 4JNYA 3GFZA 4RZBA 4YHEA 5E5CA 1MMFA 1ODZA 3CV6A 3QEZA 1TR1A 4US5D 3W1TA 1R5YA 2VD8A 4MF4A 1EUAA 4C6BA 2X1RA 3PAJA 3MMUA 3PVFA 4AMAA 3L5LA 2XIIA 4PMRA 5LZLA 3A23A 1OQFA 2I57A 1EJVC 1K9FA 5G4EA 2DVUA 1KTCA 3VKBA 3EAUA 3W7EA 4L80A 4KWWA 2AGKA 3APTA 3A9BA 1EJ7L 1I4NA 4HN8A 1WZMA 5F2GA 3RCNA 3RU6A 1W0MA 3ABXA 3VDGA 5D09A 1VLWA 4LAUA 3BMWA 1DBTA 4R34A 1YW1A 3AIVA 1T0OA 3WUEA 1MVYA 3C61A 1RLCL 5E6ZA 2W4XA 4F0RA 4KEZA 1XS2A 1L2QA 3KFTA 4IPPA 4PCNA 1E4MM 3FJLA 3F2DA 2QNEA 2WW5A 1NJJA 1IXNA 3DFQA 4TIMA 4CNSA 2EHHA 3UJFA 1MDRA 1U2YA 4AWSA 1TV5A