5BYWA

Crystal structure of engineered trifunctional ctcel5e
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
319
structure length
319
Chain Sequence
AVDPFEMVRKMGMGTNLGNTLEAPYEGSWSKSAMEYYFDDFKAAGYKNVRIPVRWDNHTMRTYPYTIDKAFLDRVEQVVDWSLSRGFVTIINSHHDDWIKEDYNGNIERFEKIWEQIAERFKNKSENLLFEIMNEPFGNITDEQIDDMNSRILKIIRKTNPTRIVIIGGGYWNSYNTLVNIKIPDDPYLIGTAHYYDPFEFTHQGAEWVEGSEKWLGRKWGTQEDMDTVVRVFDFVKSWSDRNNIPVYFGEFAVMAYADRTSRVKWYDFISDAALERGFACSVWDNGVFGSLDNDMAIYNRDTRTFDTEILNALFNPGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase H
publication title Crystal structure of engineered trifunctional CtCel5E
rcsb
source organism Clostridium thermocellum (strain atcc 27405 / dsm 1237 / nbrc 103400 / ncimb 106
total genus 135
structure length 319
sequence length 319
chains with identical sequence B, C, D, E
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5bywA00
3BMVA 3W53A 4MTVA 5E6YA 2WNWA 4F9JA 4DWSB 1HX0A 1TR1A 2EO7A 1KWKA 3AMGA 2CBJA 4GKLA 1QHPA 3VD9A 4W8AA 1EQPA 5I79A 4LYQA 2DQXA 3VGFA 2VZOA 4J3UA 2W91A 5CG0A 3VILA 5I5RA 2BY1A 1BGGA 4N0RA 2Y8KA 4AD2A 2X0YA 1G5AA 3KZSA 5DEZA 1EO5A 4OZOA 4UFMA 1JAKA 1H49A 2VMFA 5JIPA 3VGGA 5JBFA 4CN4A 2VR4A 2WKGA 3DHUA 1EDQA 4CU7A 2BXYA 3SCPA 1QNSA 1RP9A 3QHMA 2CBUA 1EOMA 1UA3A 1K9TA 4RL3A 4ATWA 2DSZA 1WDSA 1UUQA 1J10A 1MFVA 1V3MA 3K46A 3DYOA 1HIZA 1ZB5A 3BMWA 2G41A 3FXYA 1B9ZA 1XD1A 4KRTA 4XX6A 4AIEA 2DPEA 1CGXA 3PN8A 3ARZA 1JF6A 1JI1A 2YLLA 4PMOA 4PTXA 2J25A 3WBEA 3SCQA 5AC5A 3ZJKA 5IHSA 3TONA 4MNLA 1K9DA 5EBAA 3AHYA 4AC1X 4P7QA 3T2OA 3PBGA 3W26A 4KGLA 3SCUA 3GXDA 2IXVA 3IAPA 1AVAA 3WNMA 1HXJA 1JYWA 3A6OA 4HOXA 1VAHA 3CH9A 3ECQA 1OB0A 4PMDA 4GI8A 2IXUA 1SR0A 3KEHA 1MXGA 1JYXA 2O9RA 1UR2A 4CU8A 1HJXA 4U5IA 3W82A 4M80A 1CIUA 1XHGA 3L4UA 3WDJA 2VX4A 3AIQA 4B3KA 1HJQA 4IUGA 3HU7A 5I23A 3RPMA 2PF0A 4AD1A 1HJSA 1UD5A 1WZMA 2GJXB 1TE1A 1VEMA 3U7VA 1HN1A 4LYRA 1GQLA 1MW1A 4PUDA 2YJQA 4P7OA 2ZXQA 1GORA 4HMCA 2YOCA 3WQ4A 1WCGA 1B3WA 3AIWA 2Y4SA 1E6RA 1DWIM 1JF5A 1WDPA 4WJXA 2X0HA 4ACZA 4PTVA 3ZT7A 4ZE5A 1JZ4A 3IJ9A 4KH2A 1JZ2A 2WC4A 3WUGA 3OZPA 4C7GA 4LX4A 2GSJA 4GXPA 3CHCA 3GNPA 4D1IA 3WDPP 4CD5A 1XYFA 5FL1A 4WKAA 4IISA 3AXIA 1CYGA 4GZEA 2YA1A 4E4PA 3N11A 4V2XA 2VUYA 3BAIA 2RGMA 2JFEX 1V0LA 4UQEA 1S46A 4DWSA 2DGAA 2G3JA 3AHVA 1PX8A 5BYWA 3L4XA 3WD3A 2WANA 3HMCA 1NARA 3EDKA 4GPNA 3WH9A 1NM9A 1DWGM 2Y5EA 3F4VA 1UKPA 2A3CA 3J7HA 3B8SA 2GUYA 2QF8A 3M7SA 3WQWA 1QVBA 5ABHA 1BGAA 3VM5A 2E3ZA 4P7NA 4CD8A 2CERA 3E1F1 1UR9A 1UKOA 5CLWA 1HKKA 2ZUSA 1TMQA 4W85A 2YA2A 4QFUA 3RILA 2XSAA 3IANA 4EKJA 4IPLA 3BAYA 3MUZ1 5GNZA 3W4RA 2ZXAA 2VURA 4TTGA 1UR8A 2ZX6A 3ZOAA 2QPUA 4L4PA 1LG2A 2J8FA 2DEPA 2CIPA 4LXFA 5GQBA 3VIMA 3WL1A 2VVNA 5JBDA 1J0YA 3CUIA 1V6VA 3ARXA 4DM2A 1W9BM 4EK7A 3WUFA 4ATDA 3BCFA 1PIFA 1VENA 1DHKA 2G3MA 2G8ZA 4TX8A 1VFOA 2XVPA 3ALGA 1JDDA 2PWGA 1E3ZA 1WDQA 4AZHA 1UWTA 3OZOA 1NP2A 3OG2A 2NW0A 1VEOA 6CGTA 3N12A 1M01A 2ESCA 1H09A 1GONA 4B3LA 1UD6A 4JFUA 3OIHA 3EDDA 1KB3A 3OLEA 3SUVA 5M17A 3W6LA 3ZIZA 4QCEA 6A3HA 3WEMA 3VMOA 2V38A 3AS0A 2J77A 4HPGA 3W6MA 1YQ2A 2JE8A 7CGTA 4NRSA 1FOBA 2WSKA 4C7DA 3M07A 1BF2A 1C7TA 1OCQA 2WBKA 3WH6A 3KL0A 1LQ0A 4OOUA 2A3AA 4W7VA 1VEPA 4F9DA 3VIPA 2PI6A 1Q6EA 3RCNA 2XFYA 3CUHA 4C7FA 4PMVA 3MV11 3FAXA 1CBGA 1XRVA 1MWOA 1H0IA 2VZTA 5LA1A 1VB9A 3AS1A 4QLJA 4R27A 3TOPA 1KGXA 1AQ0A 3W37A 3QR3A 4OBSA 3ZSSA 4U2YA 1Q6DA 4A3YA 2HVMA 5E70A 5HNNA 5I3DA 1DEDA 4YN5A 2BHZA 2XM2A 5HPCA 2DDXA 3WMBA 1E5NA 5ABEA 1J12A 4AXNA 4UQ9A 2ZWZA 1BAGA 1CXFA 5A8OA 3AXXA 5BXTA 4YHGA 1HNYA 1BYDA 1BFNA 1CGVA 3WKZA 3ARQA 5A2BA 1Q6GA 2B31A 3BAKA 1I1XA 2BFGA 1K9EA 2GK1B 4UFLA 3VX1A 3NSMA 3PZTA 3K8LA 2PC8A 3CZKA 3GDBA 4DUXA 1O7AA 1JXJA 3WN6A 5A1AA 2F61A 3N1AA 1DWFM 3TTSA 3CTTA 2WC3A 1JZ8A 1R87A 1CPUA 2EPLX 3WF3A 5FL0A 5A2CA 3WF0A 4PSPA 4JL2A 4NI3A 1B31A 3N18A 3PTMA 1B3VA 3ZM8A 4PYSA 3B9AA 3UESA 1MVYA 3WQ5A 5DFAA 2GDUA 4XV0A 1H2JA 3BAJA 4MB4A 1PZ3A 1GJUA 4PMUA 1XC6A 3VGEA 3M6DA 1RPKA 1W1YA 3SCRA 2WVSA 3SCSA 2WHMA 1UD4A 1W1TA 2G4FA 2PBGA 5DMYA 1Q6FA 2MANA 2Y8VA 1V6XA 2CHNA 2VRKA 4ZEPA 2VX7A 3WFZA 3AHXA 5E6ZA 2DIJA 4ACYA 4JCMA 1J11A 1KFWA 5CJ5A 3W81A 2JF7A 3G6MA 1BVNP 4U2ZA 4AD5A 4WIWA 1ITCA 3T0BA 4AZBA 4CVUA 1EO7A 2FGZA 5EFDA 1E4NA 3RM9A 2FHFA 3ARYA 3VD5A 1UD3A 1CTNA 2OSYA 4P7LA 1NP0A 4MB5A 3N9KA 4MB1A 2A3BA 5DT5A 4WKHA 1EQCA 3AMKA 3ZT5A 3MSGA 2WWDA 1GOKA 1OWQA 2J74A 2VX6A 2X1IA 1B30A 3QGVA 3RDKA 1GCYA 4D6FA 1LL7A 2FDMA 1V08A 3EDFA 6TAAA 2J7EA 4P8WA 2XYLA 3AXHA 2QPSA 3PTKA 4W7WA 2WM0A 4M81A 4JAWA 2VZUA 4GI9A 1CZ1A 3FHQA 5JBEA 5A6BA 2WVUA 4J27A 3UR8A 8CGTA 1QBAA 3CZ8A 1E0XA 2ZUWA 3VU2A 4Z2IA 1SMDA 3ZJ6A 4FLOA 3BGAA 5CGTA 4HPHA 2D0HA 1E4IA 2WYSA 2WHLA 3RO8A 3U57A 1UYQA 3VIIA 1FHDA 4HA1A 1CGTA 1J0ZA 3EMCA 5DF0A 3WFLA 4MJ2A 3DYPA 3APGA 3MMUA 1BG9A 1GVIA 2D22A 1VFMA 3GH4A 4J3SA 1B3YA 3U7BA 1B0IA 4UQAA 1C92A 3WY1A 1NWTA 1E6QM 2HISA 2X8RA 2C7FA 1SYTA 9CGTA 2O9PA 1JZ3A 3GXFA 3GH5A 1TFVA 4FLQA 5CSYA 4D6CA 2EPNA 3K4DA 1MFUA 5BXPA 3U5YA 1HP5A 1QNRA 3ALFA 1QHOA 3D5HA 3CUJA 4HTYA 1GOOA 1XSKA 2D23A 2J7HA 1W9PA 4DUWA 2FH8A 4AZ7A 1BYCA 2OYLA 4DUVA 1KXHA 4TOQA 2F2HA 3WD0A 1A47A 2BHUA 4JKKA 1LWHA 1EGZA 2J79A 3AZTA 4TVUA 2BXZA 1BPLB 2GFTA 5KEZA 3WF2A 2XFFA 3UR7A 5D8WA 2ZUMA 4WF7A 1EH9A 3MUIA 3OA5A 4AW7A 4WK9A 2VZVA 5IFTA 3L4YA 2JF6A 4TX6A 3ARTA 3MS8A 2WHJA 1N82A 4DWSD 1BYAA 4N42A 3MSDA 1M03A 3CMGA 4AEEA 3KL5A 1XH1A 1OGSA 4D6EA 5IHRA 3AZSA 1W91A 5CLTA 3WL0A 1PPIA 4QCFA 1M53A 2VI0A 4H8VA 4X0VA 3S2CA 4AZGA 1JNEA 4UOQA 2VQTA 4NRRA 1E4LA 4UZUA 3WH5A 1WZLA 1GOQA 1C8QA 1VJSA 1CLXA 3N15A 2CNCA 3A3HA 4B9ZA 1LL4A 1G94A 4AZ6A 1H1NA 3NDZA 2OWWA 5A6AA 1CXLA 1JZ5A 1MQPA 3EDEA 1WKYA 1JYVA 1NOWA 1IZJA 3VD7A 4W89A 2WMIB 3FW6A 5DO8A 1RD6A 2XVGA 3SUUA 5CZKA 2OWCA 3I3EA 1D7FA 4AD4A 2XHYA 2FGLA 3AIVA 3WDRA 1CGUA 1SMAA 1LJYA 1TG7A 2D3LA 3BC9A 5DT7A 1ISYA 1PAMA 1W3KA 5A69A 4V27A 1MXDA 1OT1A 4JFTA 3THDA 1E1EA 1FH7A 1PZ2A 3THCA 1KBBA 3FNDA 3FY1A 1XSJA 3RMEA 1R85A 2J47A 2WW5A 2E8YA 2WMKA 2A3EA 4MDOA 3BLPX 1MQQA 1WP6A 3JUGA 5CXPA 3VO0A 3WNKA 1JXKA 2ZXDA 3UCQA 2W67A 4X9YA 1V6YA 4M29A 4UQBA 2O9TA 1E55A 4MJ4A 3WF4A 1L8NA 4WSJA 3NJ3A 1CGWA 2ZUNA 3HJEA 1EDGA 4D6GA 3CGTA 2C8NA 5A6MA 3WD4A 5JUVA 3OLDA 2XPKA 3FN9A 3NIYA 4PTWA 1CWYA 1UWUA 1U2YA 4PMNA 1QI3A 1GQJA 3WDHA 4RE3A 3PTQA 1GOIA 1V0KA 1BYBA 1PX4A 4QP0A 5A3HA 3PZMA 4AZ5A 3WQVA 5D9NA 1KGWA 3PHAA 4MNJA 2W62A 4TTUA 2G3NA 2WCGA 3ZJ8A 3WMSA 3AS3A 3O9NA 3W27A 3WQ8A 4WLCA 4CCCA 1FHLA 2J7FA 4BZYA 3F5KA 4UZSA 3AMLA 4CUCA 1VJZA 3KE0A 2OSWA 4J3XA 3GNOA 2WMJA 1V6UA 2YBTA 3NUKA 3NSNA 4LPCA 4OUEA 1V6WA 4QAWA 5BXRA 3VDAA 2W63A 4KGJA 3W38A 2VOTA 5JIWA 3UEQA 3IJ7A 2XVNA 1E6NA 2ZOXA 5M3WA 4E8CA 5A8MA 4JFSA 2ZIDA 1VIWA 3VIGA 1B3ZA 2X2YA 1JDAA 1OINA 4BCEA 3EDJA 4RE4A 3OGVA 2EQDA 3ARRA 4M1RA 1GZJA 4OBRA 2AOSA 2E9LA 2CESA 2DSWA 1UR1A 3M46A 2FH6A 4AEFA 4B16A 2OSXA 1OGGA 1G1YA 3ARVA 3T09A 1OBAA 1QI5A 4PSRA 1XH0A 3AI0A 1E6XM 1ODUA 1QW9A 1W3JA 1HP4A 1OIFA 2QV4A 2VR5A 4CD4A 2BVYA 3BLKA 3NCOA 4W86A 2PWEA 5BXSA 1OM0A 2J78A 3MU7A 4MADA 2BY2A 2QLYA 4UFHA 1W9XA 1AMYA 1E72M 2GJRA 1HL9A 2IUZA 3RM8A 4EAMA 1D3CA 1E0VA 2WMIA 1RH9A 4JHOA 1VFUA 3CLWA 5EMYA 3WDIA 2XGBA 4E2OA 2QHAA 2UY4A 1V03A 4B9YA 4GQRA 1Z32X 2VRJA 3GTNA 1UH4A 4GINA 1TZ7A 3IK2A 3SCTA 4L4OA 1JD9A 3GH7A 1WPCA 3IJ8A 2W61A 5BRQA 1HKIA 3CHFA 2D20A 3MMDA 3OBAA 2YL5A 3L4ZA 3LPFA 1UQZA 2UY2A 1E3XA 4W8BA 4FLRA 3PZOA 3A4WA 4LYPA 1EDTA 3VTRA 4JKMA 2PB1A 4PMQA 1W9UA 4UQCA 2WCAA 3WEOA 4UQDA 5A6JA 3UG3A 1CLVA 2VCCA 1HJUA 3OGRA 3LPPA 1YHTA 1VBUA 2YKKA 3N13A 4UNIA 1GOWA 2WVVB 4TUFA 3WEZA 1H3GA 1J9YA 1J0JA 2GVYA 1PX3A 1I75A 1X6NA 3ZSTA 2VL4A 1KGUA 4UOJA 2OLHA 3N17A 1TVNA 5LYRA 1XGZA 3CO4A 3WD2A 2YL6A 2X09A 4LGXA 1QI0A 3CUFA 3K8KA 1QOXA 2JEPA 3VX0A 4E8DA 1R7OA 3SEPA 3EBVA 2WBGA 1Q6CA 3VNYA 3VPLA 3SCWA 5ABFB 5E0FA 2DH3A 1WAWA 1CECA 5A6BD 2E4TA 1J01A 3GXMA 2BV9A 3MKKA 2J7CA 1PEZA 4UTFA 4JFVA 1JZ6A 1FP8A 3GNRA 3PZVA 4CD6A 4W7UA 1VFFA 1HKMA 2WZEA 4OIFA 1US3A 3AROA 3VIFA 1F4HA 2XTKA 1MW2A 2PWFA 3L4VA 1XD0A 4FMVA 4W8LA 1XH2A 4PRWA 4PCTA 2WLYA 4UFKA 2XIIA 4J3TA 2PWDA 2W4XA 3L4TA 4W84A 3WQ6A 3VM7A 2BY3A 1ZBKA 4S3KA 2DT3A 1KXVA 3WH8A 1EOKA 3EMZA 1IT0A 5AYBA 4ZXOA 3WNNA 2G3IA 2A3HA 5HDRA 2ZICA 1H41A 4DM1A 1W3HA 3SCNA 1BVZA 1UD2A 3WH7A 3L2MA 2WZIA 4TVCA 2NT0A 1GJWA 3AHTA 1JI2A 1JD7A 1W3LA 4Q22A 1PIGA 4PTMA 4AD3A 4NZCA 1J0KA 1FFQA 5D9MA 2PWHA 2QMJA 1JFHA 5C71A 1E5JA 4B15A 1EIBA 3WELA 3CHEA 3N04A 2XUCA 1UG6A 1W32A 1OGBA 2BHYA 1HJVA 3LPOA 4FF5A 4XZWA 2J7DA 4IPNB 2WMHA 4HP5A 3RIKA 1HT6A 2DT1A 4J3WA 4JHZA 3F5LA 4BQ4A 4UR9A 3L4WA 3W29A 3T0AA 4P8UA 2BVTA 2BY0A 4OOZA 4AY1A 3HN3A 1V3LA 4UFIA 1KQZA 2F8QA 1I1WA 4HA4A 3AS2A 3WF1A 3BSHA 5C8BB 1AQHA 4CVWA 5BWFA 5AY7A 2D3NA 4OKDA 3AIEA 2XVKA 5BROA 4BF7A 3BAXA 4UOZA 3W0KA 1B2YA 5F7UA 5BCAA 2UY3A 4XZBA 2YL9A 1GOMA 2TAAA 1HF6A 1A3HA 1E6PA 2ZXBA 1UKSA 3SUTA 5CQ1A 2D0FA 2CBVA 4YPJA 1C3FA 2WKLA 2XFRA 5BRPA 4Z2LA 4D72A 2BS9A 2V5DA 5IXEA 2WVVA 3BCDA 3A4AA 5FOOA 1BHGA 1NOFA 1VBRA 1UR4A 1CNVA 5I2UA 3GBDA 3CZLA 2YBUA 2WXDM 5A8QA 3SUSA 4AZIA 1QNOA 4J3VA 3GXIA 3T0DA 2YDRA 1ZJBA 2ZX9A 1KCKA 4D6IA 3VINA 2V3DA 2Z1SA 1XV8A 1GQKA 2DT0A 2J75A 5ABFA 1GHSA 5HOSA 2WWCA 1SFSA 4U5KA 4AISA 1HKJA 4H41A 1BQCA 1B1YA 2D1ZA 5GNYA 2DSKA 4OJYA 4AZCA 2VCAA 3VIHA 3I3DA 4GO8A 1J0IA 4ZE4A 2UWFA 3VGDA 1JZ7A 2Q8XA 1B3XA 1DWJM 4LQ1A 2CYGA 1W9DM 2W66A 3W25A 2WHKA 2WK2A 1W1VA 1KXQA 1CEOA 3A47A 1W2PA 1HJWA 2VT0A 3RM4A 2V3GA 1FFRA 4F66A 4JZ5A 4BA0A 3KL3A 3TTOA 4MPKA 2JEQA 1E6SM 2XGIA 2ZX7A 3ARPA 5LA0A 1E73M 5CPQA 1DWHM 3DHPA 3LMYA 4MAVA 2XG9A 3AZRA 1V3IA 4IM4A 1UD8A 2DT2A 2CPUA 2EJ1A 3VDBA 2V3FA 2C0HA 2XVLA 2ZUVA 4HMDA 2CETA 3AHZA 5I6SA 3VNZA 1H4PA 5A8NA 5I0DA 2OWXA 3W28A 1CGYA 1WDRA 5A94A 1UWRA 1V0MA 2WVTA 3MO4A 3GZAA 1J18A 3OLGA 2VRQA 3CMJA 2DSUA 2XIBA 1LG1A 1ITXA 2WZHA 1UA7A 1UWIA 4PUEA 4W5UA 4XB3A 5HXMA 1XYZA 5E0CA 3WIJA 3AYRA 4HOZA 4P8VA 1J0HA 4AIUA 3MV01 1QNPA 1ISWA 1DWAM 5HPOA 4X0NA 1V3HA 1OD8A 2VO5A 5A8PA 3NDYA 1C90A 1CDGA 2FHBA 4HMEA 1ISZA 3AMDA 4PN2A 4TXEA 2J8GA 4ZXLA 1JNDA 3CPUA 4PMXA 3FAWA 1QW8A 2VCBA 1WNOA 3K4AA 3DC0A 1V3KA 1HVXA 3AQUA 2CHOA 2VC9A 2CEQA 4TVDA 5A6KA 1UOKA 3B9DA 3I3BA 2XM1A 1UWQA 1UZ1A 1UHVA 3PZ9A 1X6LA 4R5EA 4BS0A 1EHAA 1B90A 4W93A 3UERA 5FCZA 4A3HA 1QNQA 4D1JA 1BSIA 5KZ6A 1GNXA 1KBKA 2FHCA 2E8ZA 3OLIA 2JIEA 1L0PA 1EA9C 3KWXA 4M56A 1K6AA 1G9HA 3MUY1 4W87A 5ABGA 2JALA 2D2OA 2UY5A 4A4AA 2WMFA 3U5UA 3BH4A 3ZQ9A 1JYNA 1NH6A 5A6LA 2NT1A 1H5VA 1W1PA 5A6SA 1MQRA 1E56A 2CCRA 4H04A 3GBEA 1TA3B 1FH9A 2EPOA 3WENA 1TVPA 3VIKA 3T2PA 2DH2A 2EBNA 1V02A 5D8ZA 2YDSA 2E9BA 4Z2HA 3O2LA 1KXTA 1GW1A 1UKQA 4JCLA 2EPMX 2QMKA 3PZGA 5TD4A 2PBOA 2CKRA 1TUXA 2BNJA 1E71M 2E9MA 1C93A 2YA0A 2GJPA 2RGLA 1WO2A 3WNLA 5EFFA 2E40A 3BAWA 1UR0A 3UETA 3QOKA 3QOMA 3DECA 3W24A 1ZU8A 2WC7A 4JL1A 5CPSA 1ECEA 2WMGA 4CGTA 1NWUA 2BVDA 3F5JA 1E15A 4J28A 4WSKA 3WD1A 1P6WA 5EB8A 1V02E 2XWEA 2W5FA 4MDPA 1PJ9A 4D6HA 4PMZA 4EE9A 3BSGA 1XCXA 1E40A 2EPKX 3B9EA 1NWRA 1R86A 3VVGA 3UG5A 1CXHA 4ML4A 4GIAA 2VVSA 1ZBWA 4HU8A 1US2A 3AMCA 4H7VA 1DP0A 2ZE0A 4M82A 1XSIA 4HU0A 5LA2A 7A3HA 4CD7A 3CBWA 3WUEA 3MUAA 4M8UA 4UCFA 1GQIA 3WNPA 1CXEA 2D24A 1D2KA 1E70M 3AICA 2OYKA 1Y7VA 4ATLA 1M04A 3WDQA 1WB0A 1WZAA 4AYSA 1UKTA 4P8XA 4F79A 4YHEA 4H8HA 4QLLA 3RJXA 4RE2A 1DTUA 3VIJA 5CPTA 3LPGA 5D4YA 4Z2GA 1AQMA 3CZGA 3VUPA 3GYCA 5I77A 2VQUA 3VOCA 1VF8A 2D0GA 4GZIA 4BQ5A 5A95A 1JFXA 3RJYA 1O6IA 5I24A 2DSVA 2XWDA 2GJXA 4CCEA 3WBAA 4PBGA 3VMNA 3OGSA 1E1FA 1GUVA 1XCWA 4GI6A 3VKKA 2ZX5A 4FLSA 4PMRA 1OIMA 3ZO9A 5M03A 4MNMA 3ZR6A 1V3JA 2ZX8A 1GVYA 2WAGA 4ZENA 3ZJ7A 1MW3A 4W88A 1W9VA 2DIEA 3SCOA 1ZBCA 1CENA 2GDVA 3UG4A 1VRXA 1IV8A 1G01A 3WSUA 4CN6A 1LF1A 5ECUA 5GPRA 4GQQA 2WPGA 2YIHA 1QBBA 3D3AA 4CCDA 1ISXA 4URIA 5FD0A 1NOUA 2YLAA 3POCA 1C91A 2AAAA 4HOWA 3CZEA 4NSBA 5CSUA 1TA3A 4W5ZA 4D71A 1R7AA 3VD3A 4D6DA 1M7XA 5GNXA 4AZCB 3CZJA 2VJXA 2O92A 4MAZA 3SUWA 4MNKA 4H2CA 1KR0A 4HA3A 4CKQA 3ZR5A 3VMPA 3SCVA 3A4XA 2WCSA 1WZKA 1FP9A 1KCLA 2AMGA 2J62A 5HBFA 4AMCA 4JFWA 4AWEA 1UH2A 3PZQA 2X05A 1MYRA 3ARWA 1JGIA 2W92A 3S6TA 1E0WA 4HZ6A 2YDQA 4JIEA 2EXOA 4CU6A 3AIRA 4HZ7A 4WKFA 4M24A 3PZNA 2Y2WA 2ZUUA 1CXIA 3AJ7A 4H8UA 4FK9A 4NF7A 2O9OA 1H11A 3ARUA 1W2VA 1RP8A 4KMQA 4Y7EA 4BQ2A 2WSPA 1JAEA 3DYMA 4U3CA 3T2QA 3CHDA 1GHRA 3II1A 7TAAA 8A3HA 2V3EA 1HL8A 1KR1A 1R8LA 3VGBA 4PMYA 1QPKA 4QLKA 1OT2A 4GO9A 2WB5A 1ZBVA 1ZL1A 1JL8A 1UWSA 1BTCA 1V0NA 1WE5A 1U33A 2J4GA 2ZWYA 2NSXA 1NQ6A 1EHNA 4PCSA 1NWSA 4HZ8A 5CGMA 1FA2A 2Z1KA 2V5CA 3MANA 4U33A 3POHA 3AIBA 1U30A 1PBGA 4DWSC 1E9LA 3G6LA 2CITA 3TA9A 3NYDA 1QHZA 3ZT6A 5I78A 3OB8A 1JIBA 4AIOA 1OD0A 1C8YA 4K68A 3AFBA 1ZJAA 1LWJA 1OSEA 3IAQA 1KQYA 3WNOA 4J7RA 3AIUA 2VNCA 2ZUTA 3T08A 4AD0A 1H0GA 2VZSA 4JKLA 1QI4A 4D6JA 1GPFA 1CXKA 3PZIA 1HVQA 2OYMA 1K9FA 5D9OA 5IFPA 1E4MM 3WUBA 5C70A 4S3JA 4QDMA 1Q4NX 1E6ZA 3QHOA 3TTQA 4P7RA 3CIVA 1JG9A 3EYPA 1JDCA 3EMQA 5AC4A 2E0PA 3SIMA 3PZUA 1LL6A 3WMCA 5FIPA 5M5DA 1IZKA 3AYSA 3NSXA 3CUGA 1KWGA 1UH3A 5D9PA 3K1DA 3TP4A 1FH8A 4U31A 5FKYA 1UZ4A 4Q7NA 2VTFA 3ARSA 4F8XA 3MMWA 3O6AA 1E43A 4XUYA 1UQYA 3VIOA 4KWUA 3AOFA 1LLOA 3L2LA 5E09A 2JIWA 5A2AA 3TTYA 1C8XA 2YL8A 1ISVA 2XSBA 3BXWA 4GZJA 4Z2KA 1EXPA 1BLIA 3VDCA 2EEXA 2Y24A 1X1NA 3AISA 4BQ3A 1ESWA 1C7SA 1BG4A 1TCMA 2CKSA 4ACZB 3K8MA 1ODZA 3VGHA 3GM8A 4KRUA 2J7BA 3VD4A 3FHAA 1G0CA 4UFJA 2VX5A 1ZS2A 2WLZA 5E9AA 2GK1A 4EANA 4V28A 3ZMRA 5IDIA 2J7GA 3SURA 4PEEA 4ZFMA 2CBIA 2XJ7A 4Z2JA 1QI2A 1MW0A 3VDHA 4U3AA 3QHNA 4MB3A 2CXGA 5AYIA 4CN1A 1F4AA
chains in the Genus database with same CATH superfamily
3BMVA 4EF8A 3W53A 4QSHA 4MTVA 1EJRC 2QULA 1RK6A 2BWGA 3AYVA 4JIPA 2CBJA 2GL5A 3NL3A 4OHQA 4IMAA 4J4KA 4RNHA 1SJBA 4WSHA 3V5FA 4C1LA 5AB3A 5CG0A 5CCZA 4NHVA 3S0CA 4R9XA 1O1ZA 4JHMA 4GWEA 1PXGA 4UFMA 4JQ4A 4C6IA 1H49A 3CL6A 1XQKA 5JIPA 4H9YA 3DHUA 1N7KA 3HG5A 3W23A 3LI0A 4X2PA 1W5NA 1O66A 4DBSA 2FKPA 3B8VA 4MPQA 1HO4A 3A22A 1YYAA 1V3MA 1HIZA 3BMWA 3VKAA 3FXYA 3L0KA 2YLLA 4BR1A 1KKRA 5HWNA 3URNA 1DOSA 3HFTA 2Q8LA 3N25A 1YPIA 3WJWA 3AHYA 4AC1X 2QAPA 1RZMA 3W26A 4KGLA 2OU4A 4DYEA 4O15A 4O10A 2IXVA 4DB7A 2O55A 3IAPA 4IMCA 2Z1WA 1JUBA 3RG6A 3WNMA 1HXJA 2QCDB 3BDKA 4GI8A 3MI2A 4QE1A 3PWAA 3KEHA 4FALA 1MXGA 3UJEA 4CU8A 3S83A 1E1CA 1TV2A 1ALDA 4M80A 2Y7DA 4Q7BA 2VX4A 2VEKA 1K70A 3V5OA 2ODOA 3RPMA 2Y61A 2IW0A 1R3TA 3BQ5A 2GJXB 3U7VA 2IS7A 5FA5A 1K3UA 4XAFA 1MW1A 3I7QA 3WLPA 3B4UA 3P6LA 1RV8A 4WJ8A 2QKFA 2ZXQA 4A8LA 4C60A 2YOCA 3LHWA 3ABXA 4C6BA 4QEEA 1X97A 4PCPA 3H70A 4JEQA 3M47A 4DXVA 1X6UA 3LTSA 1JF5A 1XYAA 3RHGA 3ZT7A 3HF3A 3HPSA 4DEFA 2WC4A 3OZPA 2BSLA 3K1GA 3GDLA 2RH9A 4GXPA 3TJ4A 2YR1A 1Y5XA 3WDPP 5FL1A 1YE6A 4IISA 3L5LA 3AUJA 4TO8A 1CYGA 2CC0A 2ZRZA 3G8EA 4C6JA 2AL1A 3ZVHA 2Z2UA 2RGMA 3NQGA 1DJNA 1V0LA 1W1ZA 4UQEA 3TR9A 2F2KA 2G3JA 3TK7A 3ITYA 5BYWA 4JTQA 1NARA 1HKWA 3WH9A 1NM9A 2V81A 3S2NA 3F4VA 4R7WA 3SQMA 1Z7AA 2FJUB 3QQWA 1ZLPA 3WQWA 3ZLGA 5ABHA 3KCOA 2QYGA 2CERA 4RJEA 3UP8A 3L9CA 3UXLA 3FVDA 2ZUSA 5G4EA 1JDFA 3SJNA 4EKJA 5GNZA 3KUMA 4TTGA 4O0QA 4EWND 3ZOAA 1EJ7L 2QPUA 1R38A 1R2TA 2AL2B 1LG2A 5DRIA 3EOUA 3R25A 2NZLA 3MJYA 3SQLA 3IIVA 1MSSA 2A7RA 3AWOA 4O16A 3CV6A 3W73A 3L5AA 1W0MA 3EB2A 1LBFA 4PZVA 3WJXA 1DHKA 1EIXA 3CIXA 2PWGA 2PDWA 5HMFA 1UWTA 4GMEA 4AEOA 3N3MA 5G1MA 1I9CB 1NP2A 1TKKA 2PP3A 4IQDA 2XN2A 1M01A 4FX7A 1VIZA 4B3LA 1UD6A 3WQGA 4K36A 2V68A 2Y88A 1SFJA 1J93A 4B2DD 3ZIZA 3LRLA 3MQTA 4H3DA 4FA3A 4KT2A 2OT0A 7CGTA 1ZP3A 4DNHA 4FF7A 4C7DA 4K37A 4O54A 4S3CA 2GGEA 2VFDA 1OCQA 1GVEA 3WH6A 4DF1A 1UJQA 3ORWA 2A3AA 1OYBA 2PI6A 1FUYA 4XSMA 2J88A 3CUHA 3LUTA 3FAXA 1CBGA 1QDSA 3AS1A 3QRHA 1KGXA 4BEQA 3R2GA 1Q6DA 2HVMA 4F48A 4IQLA 3CLMA 3V75A 5HPCA 5BOOA 5M2FX 3CAQA 5AYXA 5HATA 1BAGA 1CXFA 2Z29A 3A21A 1FWWA 1BFNA 1CGVA 3N3TA 3S47A 1T5AA 1Q6GA 4IL0A 3UXAA 4UFLA 3QYSA 1ZENA 3VX1A 3NSMA 1M7PA 3PZTA 1OQFA 1UPMB 3KBWA 4MJMA 4QNEA 2G4JA 3LN3A 5DANA 4JTCA 3NA8A 2PAJA 2VDHA 1SW0A 1MEHA 3RLUA 4OQVA 4BEUA 4FSAA 4O0KA 1DWFM 4X22A 4IGMA 2OG9A 4Z1YA 4G8TA 1Z69A 1GEQA 4PGLA 2EPLX 2L5HA 1RLDA 2X1SA 4PSPA 4NI3A 1B31A 3UPWA 3N18A 1XIFA 2AL2A 4JDYA 4NL1A 3ITXA 2FB2A 2R82A 1MVYA 3UESA 5FACA 1XCFA 3UY8A 5FJUA 4XV0A 1L6GA 4GYKA 4PMUA 3BAJA 1GJUA 5ENLA 1XC6A 3E2VA 3NWRA 1PCWA 4S3FA 4CNSA 1ML1A 2NQ9A 3GO2A 2QCMA 2QDDA 1VRDA 2G4FA 5DMYA 1UJPA 2CHNA 3FK4A 3GG8A 3M5XA 1X8FA 2VRKA 4HK6A 2VX7A 3M0LA 3AHXA 4J1OA 4MZ1A 5HJXA 4ZTYA 1YRRA 4WOQA 1P6BA 1KFWA 3GNNA 3W81A 3G6MA 4IL2A 1BVNP 1K03A 4KFOA 3VOGA 2BGQA 3STPA 4AZBA 1PB0A 3MA8A 1EO7A 2FGZA 2QJHA 3W2NA 3HQOA 3TW7A 3T0CA 4O1AA 3TW6A 3MC5A 4KF1A 3N9KA 5DT5A 4H00A 1NDYA 1NF7A 2QCLA 4IHCA 2ZZ6A 3ZT5A 1OWQA 4Y9AA 4MLRA 1GCYA 4D6FA 4ADTA 1LL7A 6TAAA 3WLNA 4I7WA 2R14A 3AXHA 5F2LA 4IFOA 5JH1A 4NASA 3PG9A 4JAWA 2VZUA 1GYNA 2ZCGA 4GI9A 1CZ1A 1OABA 3UQNA 4H4IA 5A6BA 4M0XA 3VU2A 4Z2IA 2NQ5A 3PBUA 1E9YB 5CGTA 2V5KA 4JX6A 1XYLA 2D0HA 5F4WA 3W1NA 3DHDA 4FNQA 1GKRA 3RO8A 3OQ8A 1EWDA 1IXQA 1FHDA 3WFLA 4GQ0A 3IGUA 5D05A 3APGA 2BTMA 3FFSA 1BG9A 1GVIA 2D22A 3RX3A 3LI1A 1WKEA 1TMLA 3TYEA 4ZA0A 4CQDA 4LBRA 3IRSA 1B3YA 1V93A 1B0IA 2TODA 3EPNA 1K8ZA 2CLPA 3IWPA 1BKSA 1SR9A 1E6QM 2HISA 3Q4DA 2C7FA 9CGTA 2O9PA 1SJAA 3GH5A 3SJ3A 3QGKC 2YCIX 1HKVA 2EPNA 3K4DA 3UFYA 1MFUA 3NQ8A 3D5HA 4GK8A 4FNRA 1DJYA 1RAKA 2CLMA 1GOOA 2X1TA 2D23A 2J7HA 3UWUA 5CAKA 2IPGA 3MI6A 4WRHA 2ZFAA 1YDYA 4DUWA 3WLJA 1BYCA 4DUVA 2ZBTA 4CEXC 1FDYA 3W7OA 1SGJA 4H9UA 1R30A 3UCDA 2PDFA 2BXZA 2GJLA 3BUVA 3O6DA 2YCLB 3IACA 3WLRA 4WF7A 2DZWA 2PLMA 4L7ZA 1LQ2A 3MUIA 1LYXA 4FXFA 2FLIA 4AW7A 4WK9A 2VZVA 5K3VA 3ZXWA 3I6RA 1PV8A 4TX6A 2QCFA 3Q58A 2WHJA 1N82A 4DWSD 4JTDA 3RYSA 4MKVA 3TAOA 4BI5A 3CMGA 3B8UA 4O14A 4AEEA 1EJVC 1FKWA 2HV5A 3TA6A 5IHRA 3AZSA 1ZZMA 3BJTA 4NXKA 1M53A 1JNEA 1A5OC 1Z6KA 3TU9A 3WLSA 3N15A 4WOZA 3W70A 3MKCA 1G94A 4AZ6A 1H1NA 2OWWA 4KRZA 3LHYA 4JY8A 1SW7A 1AZ2A 1IZJA 4GABA 3TVAA 1B57A 1VPXA 2QCHA 2GVGA 7PTDA 1TTQA 3W1AA 4K8EA 3BC9A 1SPQA 1ISYA 1PAMA 4ECLA 5A69A 1PZ2A 4WXYA 3U9IA 2PZ0A 3CK5A 1KA9F 1PL9A 4LALA 1XSJA 1BEUA 1QCWA 4MDOA 1KM5A 1WP6A 5FJJA 3TEVA 1PKMA 2ZXDA 1K8CA 1FXQA 1YXCA 5U4NA 1V6YA 4LS0A 2NVAA 1L8NA 1RUSA 1ZAIA 1I6NA 2XIQA 3HJEA 1EDGA 4I6VA 4AHPA 2A79A 4HNTA 4E0CA 3T9PA 3CV1A 5A6MA 3WD4A 4GUIA 1UB3A 1PKYA 3M16A 1UWUA 4PMNA 1QI3A 3NOYA 4JNYA 1PKNA 1GOIA 1IQ8A 3NO3A 4J3ZA 4FNSA 1PX4A 1TVLA 4AZ5A 3TMLA 3E2QA 3DBPA 1F6YA 4WQ6A 3PHAA 2A6LA 4MNJA 2LLEA 2G3NA 3W74A 2WCGA 4H6EA 4JTUA 3WQ8A 1BXCA 4XAPA 1VYPX 1EA0A 4JEJA 4Q32A 5DELA 3F5KA 2CWXA 4E38A 3W7RA 2PDIA 3BARA 3LV6A 1O1HA 4J3XA 1V6UA 1V6WA 4QAWA 5BXRA 2YXGA 3JR2A 4KGJA 3H7RA 3OA3A 1E6NA 3MYPA 3VXGA 2AGKA 3NQDA 4E8CA 5M3WA 2Z1XA 3LNPA 3DDMA 3VKDA 4JFSA 2VUNA 5GJMA 4JQAA 1VIWA 3N19B 1G6CA 2X2YA 1OINA 3O6YX 3N2MA 4RE4A 3W7CA 3RITA 3SN1A 4UTMA 2EQDA 2OO0A 4HA0A 1QW7A 3JW7A 4OBRA 3H7VA 4KESA 3PAJA 2E9LA 4QDPA 2DSWA 4GOAA 3WCZA 1LDCA 1UWAA 2P5NA 4AEFA 4B16A 1OGGA 3T09A 4HT3A 3TAKA 1QI5A 4PSRA 5LGXA 1XH0A 1QW9A 1OIFA 1OCNA 4RV3A 1F6KA 3P93A 4LFYA 4M6PA 3WK0A 5AC6A 1FHVA 3MU7A 7TIMA 2BY2A 3OQEA 4IMFA 2GJRA 5EL1A 4EAMA 4XTDA 1RH9A 3A24A 3QFEA 4LF2A 2XGBA 1Z8AA 3LENA 4LVAA 4B9YA 1UH4A 2HNEA 3IK2A 1AD1A 4LCRA 3TJXA 3C2YA 2FZ9A 1J96A 2Z24A 1HKIA 1H1YA 2CZFA 3W7IA 2YL5A 4AMAA 1FQ0A 4KWSA 2UY2A 4G56A 4WJEA 3R6IA 3ZVIA 1M68A 1XFBA 2C18A 2XH0A 2XISA 3MWAA 4IPJA 5I06A 1Q6OA 2KX9A 4MY8A 1RQHA 3VI2A 4YVVA 3MP5A 1VBUA 3N13A 4S3DA 4AUBA 1Q7MA 5BU6A 4WDXA 1J9YA 2PWVA 4IZGA 4NZJA 2A7NA 1I75A 3GNXA 4HD5A 1W1B1 1PHQA 2XZ7A 5FJIA 4M51A 4R9OA 5LYRA 2Z00A 3BG9A 2YL6A 2X09A 3H53A 4LJ3A 3GY1A 4FHAA 3CUFA 3VX0A 3KOFA 1S2VA 4E8DA 2QS8A 3EBVA 3SEPA 4AVFA 3C3NA 3VPLA 1RCOB 1SJCA 2C6QA 4RE0A 3L0NA 1CECA 2E4TA 2HDJA 2IPWA 1J01A 1OC7A 3GXMA 4PL2A 4B5TA 1KFKA 3OIXA 1MRQA 1XLBA 5H91A 3EX2A 1YNQA 3QPEA 1U5JA 3GVWA 1VFFA 1HKMA 2WZEA 4OIFA 3VC6A 1F4HA 2XTKA 1MW2A 3L4VA 1XD0A 1XH2A 1A0DA 1IXPA 1TPFA 2XIIA 1U5HA 4J3TA 2VP8A 3L4TA 3WQ6A 1ZBKA 4L80A 2GOKA 2Z2AA 4DYKA 1EOKA 3PTDA 4WGXA 3BCJA 4OFCA 3KDNA 1AG1O 1PO9A 2A3HA 3IUDA 4I5UA 4HSOA 2WZIA 1GJWA 5C9WA 1A5UA 4Q22A 2D2GA 4REQA 1LRTA 2R91A 4NZCA 3U0HA 3W9ZA 3S42A 1IT7A 1E5JA 4J35A 4B15A 3CHEA 4AXKA 4EXBA 3GYEA 4IJRA 4XZWA 1IWBA 1TPB1 4XIAA 1Q7ZA 2G95A 2BGNE 4J3WA 4BQ4A 5BOFA 4A8RA 3W29A 4H19A 4F0RA 4RNFA 4ZQOA 3LERA 1KQZA 1XGDA 2XH2A 4IFKA 4HA4A 1SQ7A 4EPDC 3BTNA 3WF1A 4GA8A 3BSHA 4IIBA 4QGCA 2G96A 4JPGA 3E0FA 1KCXA 2ZC8A 1SZFA 3RR4A 1QK2A 1YW1A 2YL9A 1GOMA 5AYZA 4TQTA 1DJWA 4RUBA 1FTXA 3PAOA 3V1PA 2ZXBA 3L5MA 1EC7A 5DMMA 2CBVA 2PD9A 1EX5A 1R2RA 5D2TA 4Z2LA 4D72A 2V5DA 2H3DA 4PBFA 1VBRA 5HJLA 3VE9A 3UJ2A 3S2LA 5K2ZA 5J04A 1R3VA 3GVVA 1FDZA 3SI9A 3DN5A 2PDQA 3EXRA 2OQYA 4D6IA 5BNKA 1GQKA 1UZHA 1YX1A 3GE7A 2J75A 3TH6A 3E02A 3OP2A 3N2XA 4ICMA 4KW2A 2DSKA 4ZODA 4CQAA 4AZCA 4RDYA 5JMUA 3VIHA 3W02A 3NPVA 2UWFA 2DV0A 2Q8XA 2WPBA 1E9IA 3DFNA 2I57A 2YSWA 4RR4A 2WK2A 1W1VA 3QZ6A 1I8JA 4EAYA 3LX9A 4F0MA 1HJWA 1K4HA 1NIUA 2V3GA 4LBSA 2YB4A 2PDXA 1VFHA 3MSRA 4JZ5A 3W7EA 2OLAA 4WDTA 3S2JA 5CPQA 4C90A 2PEVA 1J2WA 1TX0A 4LUYA 4HZMA 3GR7A 2DT2A 4GYFA 5BZAA 1ZALA 1TELA 4NJGA 4A29A 2J6VA 2V3FA 3FJ6A 2ZUVA 1U1HA 2XVLA 1YEYA 4HMDA 3G1SA 4AQLA 1RVKA 3CU2A 4KEUA 3LBOA 3DCPA 1SZRA 3W28A 4NZ4A 3AU2A 3M5ZA 3KRSA 1UWRA 1V0MA 4IX2A 3G2GA 2WVTA 3MO4A 3QR0A 3KBSA 1J18A 4MZ8A 3DFOA 1ZHAA 2P0OA 3RFAA 1O68A 3HG4A 1XLKA 4W5UA 3JZUA 3VYLA 3CV7A 2WNNA 4HCHA 1GGOA 2V82A 1CX9A 1XWYA 3TKFA 4MIMA 4QJ3B 1ISWA 3HZ3A 1V3HA 2PDBA 1C90A 1RQEA 4HMEA 3HOJA 1Z9AA 4PN2A 3ANVA 1DJXA 4ZXLA 3FAWA 2HNHA 3S8HA 1LCOA 2A21A 3AQUA 3UPBA 1GOXA 1Z44A 1TPH1 1UOKA 1XS2A 2FPVA 2PA6A 3QW3A 3DESA 1REQB 3N2CA 4HTBA 1OYCA 2HWGA 4HJWA 4BS0A 4C6FA 3CAKA 4IIEA 3E0WA 3UERA 3HGSA 4Q8PA 3ZLFA 5EMLA 3SECA 1QNQA 1BSIA 4HU4A 1GNXA 3GKFA 4N2YA 3LLFA 1L0PA 1F07A 4AY7A 4RPQA 3NYZA 1LM1A 3AXMA 4GJIA 1G9HA 2JALA 3B03A 4WD0A 4ZVJA 2D2OA 1V77A 2WMFA 3NNTA 5K4XA 1H7NA 1I2RA 3ZQ9A 5C7HA 1FRBA 1NH6A 5HK4A 2PDCA 1C29A 3CAVA 1GWJA 5A6SA 3OVRA 2CCRA 2PUZA 4H04A 1DVJA 3SW6A 1WBHA 5I02A 3C2FA 1TA3B 3PUOA 3OYZA 3T07A 2EPOA 2X2GA 5FAJA 1I4NA 2DVUA 3T2PA 1S2WA 3BW2A 4K38A 3B0XA 5D8ZA 3B8TA 1FBAA 3OW1A 3G1HA 3RU6A 5KINA 2B7QA 4Z2HA 2H6RA 1GW1A 3V18A 3OODA 2EPMX 3PZGA 5TD4A 2CKRA 2BNJA 1E71M 2E9MA 1AH4A 3P8JA 5BOEA 2RGLA 3N6JA 2PWUA 3QOMA 4J9JA 6XIAA 4JL1A 2WMGA 1NWUA 4GNKB 2BVDA 1E15A 4J28A 2WOQA 4GVGA 3WD1A 1P6WA 1XRTA 2PTWA 4MDPA 1A5SA 4D6HA 3BSGA 1F8MA 1NWRA 4I9MA 2PDHA 4WY0B 2V2HA 1BQGA 4ML4A 1ZBWA 3I65A 5LIKX 4CNUA 1S1RA 9XIAA 1VKFA 3EXTA 1W3TA 2CLIA 1PTAA 3BMXA 2ZTKA 1XLMA 1TV3A 1E70M 3AICA 1Y7VA 2VEFA 1M04A 2DZAA 3CWNA 1MDLA 2AKMA 4G7EB 2VGIA 3RU8X 1SM9A 4H8HA 3SGZA 4RE2A 3VIJA 3KOWA 4Z2GA 4N9EA 3V1HA 3CZGA 1GVOA 1V7YA 2VQUA 5HANA 5DBUA 5D02A 2D0GA 3C3UA 2D73A 1JFXA 3NQ7A 4B5UA 2XWDA 3U2ZA 2BB0A 4S1FA 3SB0A 4EOUA 4GNJA 3W71A 2ZX5A 1FVPA 4PMRA 1F9CA 1R6WA 3GIQA 1V3JA 4A2RA 4ZENA 4A3QA 1W9VA 3N29A 1W8GA 1W3IA 5I3KA 1Y0EA 4IIGA 3H2FA 2B81A 3VOHA 2A5HA 3H21A 3UG4A 2WJZA 2RUSA 2DUAA 4O19A 1XYMA 3ANUA 3O16A 3KTCA 4QJ1A 4INFA 3D3AA 5CSRA 4Q4KA 4IIFA 5DY2A 1Q7QA 3W7MA 5FD0A 2GVEA 3NQBA 3POCA 2AAAA 1ZAJA 2WKJA 1TA3A 4W5ZA 4D71A 1R7AA 2DZTA 2QCEA 3P0XA 3UZWA 3SUWA 1S39A 3VMPA 5J5DA 1UCWA 3L7RA 1X7IA 1FP9A 1KCLA 4UTKA 2X30A 5HBFA 4WX2A 1UC5A 4JFWA 4D8LA 1W1IE 2V5LA 4AWEA 1WXJA 2W92A 1E0WA 2OT1A 3BLFA 4JIEA 1DE6A 3AIRA 3USBA 4WKFA 1KLYA 3KDOA 3SY1A 2Y2WA 2ZUUA 3YPIA 4NF7A 4XZNX 1UASA 2DVXA 4KMQA 4Y9OA 1I2PA 3WJYA 1FWTA 1KR1A 3R5EA 4OWGA 3WK1A 3VGBA 4PMYA 3T6CA 4QLKA 2WB5A 1ZBVA 1VFLA 1UWSA 3FIGA 1BTCA 4WY0A 1PYFA 3S9YA 1NQ6A 1EHNA 1GQNA 5MF5A 1NWSA 4HZ8A 5CGMA 3GW3A 4U33A 3POHA 4I3GA 1PBGA 2VOMA 3TA9A 4ALDA 1QHZA 3OB8A 1JIBA 4AIOA 1TV8A 3ATYA 2X1RA 1SZGA 4K68A 3SDOA 3AFBA 4GXMA 3N2BA 1RY8A 2VNCA 3T08A 4G7EA 2ISDA 3SRHA 3UNDA 2VZSA 1GVFA 3MT1A 1F76A 3TYUA 1OF8A 1GPFA 1HVQA 2PTZA 2YXXA 5D9OA 5IFPA 3ONCA 4N6EA 1MUCA 5C70A 3KOZA 4S3JA 2MUCA 1QXLA 3P61A 2OLSA 4LEQA 4QS6A 1VYRA 1BSLA 3QHOA 2GGHA 2DZVA 1JVNA 4KQNA 4UTJA 4LSBA 1JDCA 3EMQA 5AC4A 2E0PA 2XU2A 5G2WA 4EP8C 3EWDA 4WZHA 5M5DA 1ZJIA 4XSLA 3NQVA 3LEPA 3TLLA 3CUGA 3WBWA 4US5A 3TP4A 5FKYA 2BLEA 4QG8A 2VTFA 1EP2A 2CLFA 3T8QA 3K13A 1P0NA 3PWIA 3DH7A 4HK5A 3PBVA 4XBSA 2ZDRA 2VWSA 5KZEA 4GE8A 1OVDA 3A64A 2NUWA 4L9YA 3WLTA 2QJGA 5IBXA 5F1UA 2CKSA 1ODZA 4KRUA 3FHAA 3QBUA 2WLZA 4QE5A 3W1MA 4GG9A 4HNOA 1W17A 4PEEA 4ZFMA 3O15A 4JTHA 5I3HA 1MW0A 4X63A 2GGGA 4U3AA 3G1DA 3TCSA 2AQWA 2ADAA 4IGSA 4O4WA 3S5SA 5CZSA 1RCQA 2NLIA 1LZOA 4F9JA 1P0BA 1HX0A 3EEGA 3AMGA 4IG2B 3CASA 1VFTA 2AQOA 5I79A 5AZ1A 3VGFA 3NTYA 4J3UA 4TR9A 5AHNA 2Z7KA 1Q6RA 1TQJA 1Y5VA 3G0UA 1W6TA 3ELFA 5FSDC 1TRIA 2VMFA 1E0UA 4NVTA 4LAZA 3FKRA 2VR4A 2YBVA 1EDQA 4V1YA 4YL2A 3QHMA 4L6OA 1UA3A 4RL3A 4IX0A 2DSZA 1WDSA 3S1XA 4R7JA 1MFVA 3DYOA 1ZB5A 3DOPA 2ZDSA 2ZYFA 2Y7EA 3ARZA 1UUMA 3ZWSA 4PMOA 4PTXA 4DF0A 3SCQA 3E0IA 3VK5A 3B97A 3HQPA 5EBAA 4MF4A 1JRBA 3UXKA 4P7QA 4JTSA 1TJ2A 3PBGA 8XIAA 5F4SA 4E6MA 3GXDA 1QNVA 2HROA 2PRHA 3MCMA 3UGVA 3VNIA 3ITLA 1JYWA 1M65A 4HOXA 3CH9A 4ORMA 1OB0A 4RCXA 3C2VA 2VEIA 2GQ3A 1MZHA 2PRLA 4IOTA 4QE4A 1LT7A 1VYSX 3B0YA 4J2PA 3K30A 3W82A 1CIUA 1XHGA 3L4UA 4B3KA 4IUGA 4UBPC 1HUVA 5I23A 3DAQA 4C91A 1UD5A 4EX4A 3GB6A 2NX9A 1VCVA 4LYRA 2PTDA 1KNWA 4PA8A 4AB4A 1HZYA 1F05A 4OE7A 1GORA 2EGZA 3CXOA 3ZFHA 3WQ4A 4XD4A 2FZBA 1HGWA 4E4FA 5DXYA 2ZQ0A 2X0HA 1UUOA 1THFD 5HUOA 2UBPC 4UMAA 1JZ2A 1ZRQA 3C2RA 2XN1A 7REQB 2GLKA 1KTCA 4YU1A 3WUGA 1JCJA 1EF3A 3CHCA 3LCIA 4D1IA 5D33A 4CD5A 4WKAA 3AXIA 2E77A 2VDIA 2YA1A 2E25A 2SFPA 4HYRA 3W6YA 2JFEX 1S46A 1MNZA 3SN0A 3L4XA 3WD3A 2WANA 2XIOA 3WLIA 3GTXA 5FEZA 2QT3A 4Q8WA 3GKAA 1XBZA 4G7FA 1UKPA 2IMRA 1VP5A 3HGRA 1SSDA 3ZYZA 2QF8A 2W3ZA 3M7SA 1BGAA 1KC7A 2HE8A 4P7NA 3W1XA 1UBPC 4MFDA 1UKOA 4FEZA 3GAKA 5H2ZA 2P8BA 1A5CA 4LW7A 2Z7GA 4QFUA 4M6QA 1FWJC 1FWCC 9XIMA 2QGHA 1YBQB 4IPLA 3BAYA 3WLMA 5IBXC 1KBLA 1UR8A 1O5RA 4US6A 2V8ZA 2PP0A 2ABBA 2VVNA 3E12A 5JBDA 1J0YA 3CUIA 4DBWA 5CC6A 3SSZA 3G8RA 3ARXA 2CZVA 2WQPA 4DJFC 1QO5A 1TO3A 1KW1A 2F6XA 4LUIA 1VENA 1XRFA 3W2KA 4KFNA 1DJZA 2XVPA 3RCYA 1JDDA 3C2OA 4Z0SA 1E3ZA 1WDQA 3GTHA 4YMZA 3OZOA 1VEOA 4LV9A 2E09A 4CQCA 3N12A 3A3XA 3CT2A 3GD6A 2Z0IA 1KV8A 1EZ2A 4JFUA 3OIHA 3UU0A 5M17A 3S1UA 6A3HA 2V38A 1W31A 3IVUA 3IRDA 1YQ2A 1TREA 1FWHC 1IIGA 3GVQA 3LDVA 4NT0A 1BF2A 3QEZA 2WBKA 4O17A 3KL0A 1RA5A 2B4GA 3WQEA 4F9DA 3VIPA 3CYJA 2H3BA 5C7VA 4C7FA 4NJHA 1MWOA 1ONWA 3BLOA 3WQFA 2BOGX 4R27A 4JTRA 4R33A 4OBSA 5AOUA 5E5CA 3F4DA 1KFJA 1TPVA 2H9AA 5I3DA 1JCTA 2BHZA 3CNYA 4HNLA 2VR2A 4FOUA 4YTRA 4UTHA 3WMBA 1E5NA 2YDAA 1NAL1 4AXNA 3IGXA 4UQ9A 4LCQA 3R8HA 5A8OA 3EWBX 1TV5A 5E0KA 4YHGA 1HNYA 4JTAA 4Z1DA 1YADA 3NQAA 5TNVA 2CWNA 3KCJA 1K9EA 2GK1B 3TOYA 1V79A 1H7RA 1RBAA 2A2IA 3W86A 1JCYA 1TWIA 3SAZA 4ROPA 1OG6A 2X16A 2QCCA 1O7AA 1JXJA 5B7ZA 4C6PA 4GIYA 4HPNA 3GDMA 4YTSA 3N1AA 6REQA 3GDRA 1AJ2A 1G69A 1F61A 1JZ8A 4NI8A 5I07A 3KP0A 1OX4B 2DW7A 3QQ1A 3WF3A 5A2CA 1CCWB 1AW5A 4ZOBA 1YBQA 1RQBA 2Y70A 3PTMA 1B3VA 1XBYA 4I5RA 3CPGA 3G3DA 2C1HA 3B9AA 4AWTA 3ICJA 3S4TA 1JPMA 3G24A 5CAHA 3VA8A 1F7BA 2NQLA 1BWLA 2DIKA 1H2JA 1PZ3A 1YKWA 2ALDA 3SCSA 2VHLA 2WHMA 3NZ1A 1UD4A 1W1TA 1Q6FA 4JS3A 2MANA 2Y8VA 4ZOAA 4ZEPA 1IT8A 4NJKA 3GLCA 4A05A 4O57A 1TWZA 4UR7A 3MHUA 3LXAA 3GVGA 1IWPA 5TQLA 2Y8UA 4WIWA 4E8GA 4JD4A 1FWBC 3EA2A 3ID7A 1M3UA 1GEHA 1L6FA 5EFDA 3RM9A 2FHFA 3ARYA 3VD5A 1UD3A 1CTNA 2OSYA 4P7LA 5H8UA 3UYCA 1T7LA 3STFA 3G1VA 3KW3A 5FAGA 4GYJA 1BXNA 1RR2A 2VX6A 2X1IA 1B30A 3QGVA 4IUOA 5DRCA 3PR2A 2J7EA 5FESA 2OEJA 3JRKA 3FGCB 2HPMA 4P8WA 4IWWA 2QPSA 2Y89A 4W7WA 3O06A 5KETA 2ISWA 5JBEA 4J27A 2WO5A 3KFTA 1QBAA 3H4WA 3O6CA 4ZTXA 3B0PA 3BGAA 1KBJA 5LZLA 4HPHA 2OJPA 2WYSA 5LIYX 1J2BA 1RY0A 3VIIA 3EMCA 1LWIA 3GU1A 4EXAA 2RHGA 4MJ2A 3OVGA 1DIOA 3TZFA 3GHUA 3O8AA 4G1KA 2VFEA 1CI1A 3ZS4A 3DI1A 2E67A 3GH4A 4J3SA 1U22A 2XH7A 3U7BA 1XG3A 4MKSA 4UQAA 1C92A 4A8IA 2X8RA 1SYTA 1NJJA 1JZ3A 3GXPA 1US0A 4XZLX 1TFVA 4W4QA 3G0XA 3QZEA 5JVLA 2E7FA 7ENLA 3KLLA 3U5YA 1QNRA 1S5TA 4HMNA 1QHOA 1OX4A 3CUJA 4QNWA 4JDBA 1XSKA 4XAZA 4LUTA 4L4LA 5HNTA 2OVLA 2FH8A 2C1IA 4IFRA 1LRQA 2F2HA 1A47A 3OVPA 5G5IA 1A49A 1OZMA 1EGZA 3AZTA 2GFTA 3TLQA 1H7PA 1PDYA 2EG7A 2XFFA 5D8WA 4F0HA 1Z3NA 3QF0A 3QTPA 2QCNA 4DJDA 4XZHA 1L9WA 3R0KA 4R7OA 5D32A 3O63A 4XD5A 3W7KA 4UR8A 3T7VA 5IDZA 2GJNA 3MS8A 2NWRA 3IJQA 4NX5A 3CUZA 4DELA 1FCBA 5CGQA 4Q33A 1AUSL 1OGSA 1XH1A 1SW3A 2C0AA 4MUZA 4NAEB 3WBYA 3WL0A 4H8VA 3S2CA 2OGJA 4UOQA 2VQTA 1FWGC 2GUUA 1JR1A 4UZUA 1WZLA 1GOQA 3R94A 4Q4RA 3A3HA 2DORA 4B9ZA 5EGRA 1CB2A 3U4AA 1CXLA 1ZP4A 3NQ2A 3T78A 5BMXA 1JYVA 1A5BA 1NOWA 4TU1A 1QMLA 3LMZA 1RD6A 1KM3A 5CZKA 2OWCA 3I3EA 1D7FA 4UTTA 3WLQA 2FGLA 2XZ9A 3WDRA 2D3LA 2PDLA 1TV4A 1W3KA 1MXDA 2ACSA 1E1EA 1Q66A 3FA3A 4PULA 5D38A 3FNDA 1P0EA 4NZ5A 3RMEA 1R85A 2J47A 1F3XA 5HA7A 1GT8A 3BLPX 3TN4A 1NDWA 4ICCX 3JUGA 3VO0A 4XIMA 2RDXA 1JXKA 4A22A 3UCQA 4X9YA 4UQBA 1E55A 2I5IA 3NJ3A 2GQAA 4H9XA 4IMEA 3A13A 5D2XA 4ZB0A 4D6GA 1WXZA 5LIUX 2XPKA 3DBNA 4PTWA 5XIMA 3EWXA 3L65A 4GQGA 3HPXA 1V0KA 1BYBA 2QGYA 1UC4A 3PZMA 3C0SA 3WQVA 1ICQA 4E5TA 5D9NA 4ZQPA 2WJFA 4MY9A 2W62A 3LU2A 3TZNA 3O9NA 3QYQA 1EZWA 3ITCA 4CCCA 1K7EA 3AMLA 4LY8A 2Q71A 1XLCA 3KE0A 2GUBA 2OSWA 3GHSA 3V5CA 2WMJA 3W7DA 3NUKA 1EWEA 3TYDA 3NSNA 3EKZA 1X38A 4WUIA 2JQXA 3IGHX 2G3FA 2A4AA 2BP1A 5B80A 2VC6A 3UEQA 1OFDA 1FCUA 3IJ7A 1J5SA 4UB9A 3IIPA 1JCNA 4L6HA 4O1EA 1G4EA 4NP7A 2VGBA 4GIRA 5C9RA 1P7TB 4LU0A 5DCBA 1LBMA 3CQKA 3OGVA 5CC5A 3FDKA 2QQ6A 1Q45A 4S39A 3GQYA 3LCLA 1Q6QA 3M46A 2OSXA 3ARVA 3UCCA 1W3JA 4QQUA 3SRFA 2H8XA 2VR5A 2QV4A 4FO4A 1TTJA 4H83A 3ZR4A 2BVYA 4H9TA 2QIWA 3A3WA 2OKOA 2FQIA 1TJ0A 4B5NA 4ZO7A 3TJIA 1SZEA 4L64A 1W9XA 1AMYA 3H7UA 1E72M 4HNVA 2FPYA 2IUZA 3FDGA 2AQVA 1XLHA 1TWSA 1E0VA 1N8FA 4Y2WA 1FWFC 3GG1A 3N6HA 2CLLA 4B5WA 3CLWA 3M41A 1A4LA 2OXNA 4DJDC 1KFEA 5CG7A 2OELA 1XJBA 2CLOA 2UY4A 1Q63A 3RLVA 2I5QA 2VRJA 1VC4A 1MXSA 2BVWA 3C0JA 1IYXA 4L4OA 1JD9A 1L6WA 3URAA 5T26A 4JNMA 2VYOA 2BDQA 3CHFA 4QROA 5M1TA 4OV4A 2NV9A 4W8BA 1UPPA 4ZQNA 2Z28A 4M7TA 3VTRA 3HB9A 2P88A 1SU5A 2Y1HA 2WCAA 3QJAA 5DCEA 2UV8G 1GG1A 1X39A 3MVTA 3QSRA 3LPPA 1H3GA 1J0JA 2GVYA 1PX3A 4ICNA 8RUCA 1KFBA 4UOJA 2OLHA 3HV9A 2VFGA 5T91A 1TVNA 1XGZA 1SFLA 4ROQA 1JQVA 4O0ZA 2HXUA 3MW7A 2Y6ZA 3M6YA 3KVMA 4UTTC 1B4KA 4RZ4A 3SCWA 1WAWA 5U7SA 4D9PA 2X42A 2A6NA 2C1GA 1PTGA 3IARA 4NNBA 1PEZA 4MWAB 4JFVA 4K7VA 3GNRA 3PZVA 1LTDA 4QXIA 2Q01A 4QJ4B 2NXIA 1VBJA 1US3A 4JIRA 2HBXA 3MHGA 2PWFA 3EWUA 4PRWA 4PCTA 3RUBL 2V0TA 3CAWA 4JQ2A 2HMCA 3EKLA 3DX5A 2DT3A 4ZXOA 1P7TA 1YDVA 3A23A 1H41A 3WH7A 2OODA 3C52A 3MPGA 3VNJA 1W3LA 4DJFD 1J8VA 5I03A 3OHIA 1TPUA 2H8ZA 1Y5WA 2VGFA 2PWHA 1JDEA 4JGDA 3HQ1A 5I3FA 3FXGA 1EIBA 3U6WA 1M5WA 2XUCA 1W32A 5FSEC 1OGBA 2QR6A 1HJVA 4FF5A 1OK4A 2CU0A 4UCGA 3SY5A 1OFOA 4Z1AA 4HP5A 3RIKA 1HT6A 2DT1A 3TTEA 5KZDA 1KV5A 5TIMA 3N4AA 5KZMA 3SZ8A 2FIQA 3NO5A 1H50A 2FMOA 4YCPA 1Q85A 3HN3A 4OV9A 1MRAA 3H2EA 4ZB5A 4F4RA 1H62A 1I1WA 3AS2A 1XIIA 4L1GA 1AQHA 4U10A 2GZXA 1SFTA 1M7JA 5AY7A 2GQ9A 5BWFA 1OCJA 3VNLA 5T8GA 2E6YA 4JNZA 5BROA 3BAXA 4UOZA 1Q2SA 5LNVA 5BCAA 4XZBA 3SBFA 1HF6A 1A3HA 4IXHA 4NIRA 3SGGA 1G67A 3SUTA 3OG3A 1WOBA 2WKLA 3TWBA 4HNCA 4LRTA 1EEXA 3D47A 3BCDA 4PC8A 1Q65A 5SWUA 4A3UA 1BHGA 4PR4A 1UIOA 3TJLA 4Q4OA 1FHUA 2AMXA 4K1GA 3GBDA 4F2UA 2RAGA 2PF8A 1VLWA 3H22A 4AZIA 4J3VA 3T0DA 1J6OA 1AW1A 1HTIA 2HVNA 2NQHA 2Z1SA 3S5YA 1XV8A 3H2NA 2DT0A 4CNPA 4XD6A 3VZZA 3P74A 2WWCA 4RDWA 4U5KA 3LXBA 3NG3A 4AISA 2D1ZA 1PVNA 4OJYA 3EZ4A 3QR1A 4MWAA 2P10A 3BW4A 1XP3A 2JKEA 3INPA 3S2MA 1CW2A 1W9DM 4GVFA 4ZOCA 2WHKA 1P48A 1KXQA 1TMHA 3A47A 3I4KA 1W2PA 1YTDA 3O07A 3TYAA 2NX1A 3KL3A 4MPKA 2JEQA 5LA0A 1PDZA 1AJ0A 2JKPA 3IVTA 1FKXA 4IM4A 1QTWA 1UD8A 2EJ1A 2Y7FA 3G5EA 1O12A 3W72A 1OZQA 1XIMA 2FVLA 3W1QA 5I6SA 4MWAE 5FF3A 1OC6A 4MYAA 4B5VA 1TCDA 4XTIA 3E0LA 2GVJA 3NZPA 3CQ0A 3CO8A 3NQMA 2Q6ZA 4HHHA 5L6UA 1WDRA 1B5TA 5LGZA 3PANA 4GBUA 3GZAA 4O50A 1TRDA 3OLGA 2VRQA 2ZA3A 2E6DA 3CMJA 3CPRA 1TTIA 3SIZA 4L9XA 1ITXA 1UA7A 3V3WA 1UWIA 3REQB 4PUEA 4QIUA 2X7WA 3WIJA 3KBJA 3AYRA 4HOZA 3B8WA 4AIUA 3CJPA 4UUIA 3ISIX 5AC7A 3HPFA 4J2MA 4YXGA 5DY3A 3UZ5A 4X0NA 1B9BA 3KRUA 5A8PA 3NDYA 1IEXA 4L1XA 1Z42A 2FHBA 1R47A 3G1YA 3HJZA 4Y9MA 4FZIA 3Q37A 3G0SA 4JIQA 4OT7A 3NURA 4TXEA 1JNDA 3K5XA 1QW8A 4IIHA 3RAOA 1GYMA 1HVXA 2ISVA 4A35A 5A6KA 1PUDA 3B9DA 4S3BA 2HVOA 2PP1A 3N14A 4UTWA 3BANA 1TIWA 1EHAA 1PSCA 1R9YA 1B90A 3BJSA 3HPZA 3PWGA 2NXHA 2PCQA 2FHCA 3OLIA 1O5KA 3LM3A 4TV5A 1K6AA 1I0BA 2V67A 3MUY1 5ABGA 5ABTA 4NUWA 4XWUA 4A4AA 5EKYA 4IGNA 4DJED 3M0MA 2WZTA 3BH4A 3IPWA 3W76A 2RJGA 4O12A 1GG0A 5A6LA 1XPYA 3EWWA 3DGBA 1MDRA 1JEZA 1CLKA 1DQWA 4NJJA 3WJZA 1GVQA 2P50A 4YNGA 3GBEA 3A5FA 1FH9A 2G37A 3M0VA 2C91A 1V02A 3PB2A 5AKQA 1KRAC 4L9ZA 1PKLA 5K9XA 1UKQA 1ITUA 2QMKA 2NLYA 2PBOA 1C93A 4DHGA 2VD8A 2YA0A 2GJPA 2OO6A 1WO2A 4M6VA 5J5RA 4PFMA 1L6SA 2E40A 4FR1A 3LLXA 3QOKA 1A5AA 3DECA 2A85A 3BWWA 4TIMA 2CLKA 3F5JA 1GKPA 4MG4A 4PE8A 1QO2A 2J13A 5EB8A 2Q8ZA 1V02E 2XWEA 2W5FA 2OEKA 1EF2A 4PMZA 4EE9A 3SN4A 3MB9A 4A21A 4MWAC 1E40A 2PPGA 3TROA 1R86A 4GIEA 3REQA 1S2UA 1VHCA 4GIAA 4HU8A 1QAPA 4BJHA 5MKGB 1DP0A 2Z1BA 4CQBA 2AAMA 5LA2A 4IJCA 1ONEA 3UVIA 4NYUA 3MUAA 4V1XA 1GQIA 4V15A 1D2KA 5LHEA 1RLCL 3S1WA 1W5PA 2QCDA 4N4QA 3XIMA 3GAYA 1TQXA 1ADDA 4AX6A 3QMTA 1DTUA 2B7OA 2A3LA 3I10A 3LK6A 3KHJA 4ZSUA 3GYCA 2Y63A 3VOJA 3VOCA 1KM0A 1VF8A 4GZIA 5FJPA 3QTGA 1SVDA 2ACQA 3R8GA 5GJNA 1C9WA 3VABA 2DSVA 2GJXA 4CCEA 5TBOA 2C15A 3VMNA 3PSVA 2I9EA 1UZDA 1XCWA 3PJUA 2ZVRA 3VKKA 2ACUA 4CLMA 2FZMA 3ZR6A 5G4WA 2ZX8A 4QTGA 4DWDA 3EB3A 1RSCA 1MW3A 1ADSA 4W88A 2INZA 2DIEA 2FGBA 4LF1A 3NPWA 1VRXA 3TX9A 4U28A 1LF1A 1PZ1A 5GPRA 3P60A 4GQQA 2WPGA 4FXSA 1QBBA 4C6EA 4CCDA 4ES4A 1ISXA 4URIA 3SR7A 1C91A 4HOWA 5CSUA 2X41A 4KIEA 3RPTA 3VD3A 2INFA 4TV6A 4D6DA 4WGHA 3TXZA 4UTWC 3PS7A 3A9BA 4MAZA 2V2CA 2VEGA 2NXGA 3PVFA 4MNKA 3W2UA 1KR0A 2WJDA 4ZQCA 2ZRUA 3SCVA 4DI9A 1FWSA 2QW5A 1FWEC 1DORA 3T1GA 4NU7A 1IF2A 2AMGA 2J62A 2Z2BA 2QXWA 3DG6A 3N6QA 1UH2A 3ARWA 4GH3A 1JGIA 3LHVA 2QJNA 4WHBA 5C2XA 5HINA 4UWMA 3S6TA 2OCZA 1R3SA 2EXOA 4LAKA 4B2DA 4E3VA 2O9OA 1VBGA 3AWNA 5FI8A 3T05A 1RP8A 2ZVIA 2FMNA 5D03A 3T2QA 2PURA 8A3HA 2V3EA 1R8LA 2QVNA 3UJRA 1QPKA 4HQVA 4GO9A 1ZL1A 1JL8A 1V0NA 1PS9A 5JU6A 1DHPA 3LCWA 2ZWYA 2E6AA 2KZHA 1OC5A 2GSEA 3B0UX 2V5CA 1Q8JA 4HBKA 3PF3A 3AIBA 2FZDA 4WEVX 3S6OA 3G6LA 2J8TA 3ES7A 4YWIA 1OFRA 3ZT6A 3R0UA 4JQ1A 2ZKMX 1C8YA 2OEMA 4RPPA 5BU9A 1OFBA 1OSEA 2PLJA 2XINA 4Q8OA 4XAYA 3S5ZA 4AD0A 2VC7A 3F4NA 4LUSB 3KBMA 1E4MM 4NKCA 3H2OA 1S2AA 1QATA 5AZ0A 4QDMA 1XDLA 5D09A 4Y96A 3W1UA 5EU9A 4GH1A 4P7RA 1DE5A 1KRBC 3EYPA 1S2TA 3IJDA 3NEVA 2AGTA 3PZUA 2GSHA 1XC4A 1A5KC 4JOMA 2VFFA 2PE4A 1IZKA 3KZPA 1KWGA 2NUYA 3LCHA 2YGYA 2R1NA 3AXKA 1FH8A 1UZ4A 4Q7NA 3ARSA 4AG0A 4F8XA 4JTJA 2WNQA 1E43A 1JUEA 1UQYA 5CPNA 3VIOA 4IICA 1K02A 3VZYA 3V4BA 4MYXA 3BURA 4DBUA 1EB3A 3P3BA 4B4FA 5C9ZA 3EOLA 2QUNA 3QPYA 1EXPA 3FYYA 3VDCA 2EEXA 2QNEA 1SSGA 3NVDA 1F8IA 1C7SA 3HQNA 1BG4A 1TCMA 1IZCA 2PDMA 2NVDA 3LYEA 3GIPA 4AVNA 4H6KA 1D7KA 2VX5A 3WYZA 4V28A 1QPQA 3IIZA 3FYPA 3TYBA 3QHNA 3PPFA 3CMFA 3LM7A 4CN1A 2HJPA 3N9SA 2QV5A 5E6YA 4DWSB 3A4JA 1TR1A 2EO7A 1KWKA 4GQBA 3VD9A 1D9EA 4W8AA 1EQPA 4IIDA 4GUGA 3D46A 4LYQA 1HO1A 3ITTA 3BV4A 2W91A 3VILA 5I5RA 5JQ9A 1BGGA 1W5QA 2Y8KA 4JTLA 4KEMA 4DIAA 6ALDA 1EO5A 3GG7A 4ERAA 2PU1A 1JAKA 2V69A 4ADUA 1K8XA 1BKHA 3VGGA 5JBFA 1IEVA 4CN4A 2WKGA 4K8HA 1IR1A 4OECA 1S5NA 2F84A 1P4CA 1RP9A 1PYMA 3KS5A 1EOMA 1K9TA 4D8AA 2ZZ7A 1J10A 2C16A 1A53A 3VZXA 2VFIA 1VHNA 4K6AA 1B9ZA 1N8WA 4KRTA 4XX6A 2X7VA 4AIEA 3VDGA 3EX1A 5F4XA 3RRAA 1CGXA 3CL7A 3PN8A 3WG6A 2J25A 3SRKA 2ZA2A 5IHSA 2QUVA 3IS4A 4LUSA 3SCUA 3PUDA 3F4CA 3DENA 4JTGA 4ZO9A 2BOEX 3UXIA 1LOLA 3B9NA 2HTMA 4PRRA 3GX9A 2G97A 2OOFA 1FXPA 5L9FA 3ECQA 4PMDA 5EPDA 4C6OA 2EG6A 5C0QA 1JYXA 2O9RA 1HJXA 3AO0A 1RBLA 2NUXA 1YXYA 3CYVA 5G4HC 4GACA 2EKGA 5H8PA 2PU0A 2Y62A 3AIQA 1HJSA 1P6CA 1XDJA 5AN7A 4FPSA 4RW3A 1TE1A 1HN1A 3QLDA 2XDFA 4PFHA 2E28A 4PUDA 4B3ZA 2YJQA 1FCQA 4OGZA 4HMCA 1WCGA 1B3WA 4UMBA 2Y4SA 1XYCA 1E6RA 1DWIM 4PUUA 2J24A 4WJXA 1TIMA 4GYPA 4PTVA 1SJDA 4ZE5A 4GHRA 2FZ8A 1L8PA 1VPQA 1DXIA 4KPLA 4H7ZA 4C7GA 5HWMA 3P84A 2GSJA 3VE7A 2VM8A 2V2DA 3GNPA 1XYFA 4R85A 1HQTA 3V16A 3QXBA 3N11A 1Z41A 4V2XA 2VUYA 3BAIA 3IVSA 4HYVA 1EC9A 3PJTA 3QSTA 3QKZA 4DWSA 2DGAA 3AHVA 3W1PA 1PWMA 4PB4A 1TTPA 3HMCA 3EDKA 3DGRA 4GPNA 1JUKA 2Y5EA 1XF0A 1XL9A 5AC8A 1A3WA 4N9CA 3EWZA 1QVBA 3IEBA 3VM5A 2E3ZA 3TV8A 1UR9A 3W7HA 1HKKA 4BY3A 1TMQA 3RILA 3IANA 5T9CE 3TQVA 4UC5A 3GWQA 4XK2A 4HHPA 1ENUA 2YCLA 2ZC1A 3R58A 2J8FA 4LXFA 5GQBA 4GJJA 3VIMA 1GZGA 1N2VA 4B92A 1TWDA 4DM2A 4YTUA 4EK7A 1WKFA 3G22A 4QS5A 2G3MA 2G8ZA 1OFPA 1VFOA 3ALGA 3CIWA 4AZHA 2BMBA 2F6UA 4UNKA 4YYCA 4S3AA 2ESCA 1H09A 1AJZA 1W54A 3LSCA 2PRMA 3SUVA 2C3ZA 1W56A 4QCEA 3TW9A 4B90A 3VMOA 5CPOA 2J77A 3W6MA 3NL5A 2PDNA 4C1NB 2JE8A 4NRSA 2WSKA 5A8GA 3O05A 3OJGA 1VGAA 1BD0A 4LVDA 3M07A 3TIMA 1BRLB 3PJWA 4Q4MA 3GR8A 3QV8A 3IUIA 1HG3A 2IPFA 3HA1A 2PGFA 1U83A 4FS9A 2XFYA 3K4WA 4H6RA 3MV11 1XRVA 2FB3A 2VZTA 1VB9A 4RDZA 4GZ7A 4QLJA 5FEXA 5HMDA 3TOPA 3DFHA 1TJRA 4R34A 1LQAA 3KX6A 4PODA 4U2YA 4A3YA 4Q8MA 2OTDA 1DEDA 4YN5A 1F73A 4ZMGA 2FJKA 4LNYA 1UMYA 4O1BA 1J12A 5H6HA 3EWCA 3W2LA 3DKLA 1B3OA 1RCXB 1BYDA 3WKZA 3ARQA 3PB0A 2C79A 1VQTA 5A2BA 3BAKA 1I1XA 2BFGA 3URBA 4RKAA 4PCNA 3SGUA 3CZKA 1X1ZA 3PK7A 1T8QA 4F0SA 1EC8A 5D37A 3BL3A 3UWEA 3M0IA 3KVKA 3NAVA 5A1AA 4LVBA 4I8YA 1OADA 2F61A 4S2BA 3WK3A 3H12A 3CTTA 2WC3A 4RZ6A 1WQ5A 4FXRA 4IQJA 1CPUA 4QJ5B 3WF0A 3GZ3A 2OZ0A 4JL2A 2FTYA 5I3JA 4GYPC 4Y8FA 4PYSA 4G6CA 3H2CA 5DFAA 4UMCA 3NEHA 3W83A 4MB4A 3RGTA 1P0KA 3EKGA 3GC5A 2WVSA 2E5CA 2HPIA 1R5YA 3LHUA 4HNNA 3BZGA 1V6XA 4JBRA 3DIPA 1DIEA 3DI0A 4JYFA 1GJPA 2F6KA 5E6ZA 1T0OA 2DZXA 2DIJA 4JCMA 3FCPA 2QJIA 4Z08A 3AC0A 4UTUA 5I3GA 3OTRA 3P5YA 2JF7A 5HQLA 2V5JA 3C6CA 4U2ZA 4JTTA 4GI4A 4AD5A 5C5YA 1ITCA 5DMNA 3LSBA 1XUUA 4CVUA 5FF4A 1TSIA 1E4NA 4Q8VA 4S2CA 1U1JA 1VD6A 3DG3A 1SO3A 4MB5A 1YLVA 3T55A 4MB1A 2A3BA 5EMKA 1BRLA 4WKHA 1IXNA 3MSGA 1GOKA 3DFTA 5A5WA 4DPQA 3RDKA 2FDMA 3EDFA 1WBJA 1DTNA 5C2CA 3PM6A 3PTKA 3G18A 2WM0A 4M81A 4JTKA 4KBXA 3GC4A 1DQXA 2WVUA 1Z48A 1TJ1A 3CC1A 3CZ8A 1E0XA 2Y85A 3PBMA 4LEFA 4DRSA 1E4IA 4RX0A 3U57A 1UYQA 1TUFA 2KAUC 3DEQA 3EPOA 2Q02A 4GC4A 5HMEA 3E49A 4S23A 3F4WA 3MCNA 3UGRA 5LHFA 3DYPA 3MMUA 1QPNA 1S1PA 2YXOA 2X40A 1XLEA 2I16A 4JR5A 2D2JA 1ZFJA 1UBSA 4ZL1A 3WY1A 1NWTA 2Z6JA 1IEWA 4RZBA 3F2CA 3ZVHB 1H7WA 3GXFA 4LAUA 4AHQA 5CSYA 2V6AA 1NU5A 5BXPA 1HP5A 1L6YA 1XIDA 3AALA 1H51A 5FJOA 4GLEA 1DJQA 1TE6A 2YB1A 4NQ1A 5D2VA 3TN5A 4EWJA 2CZDA 1P1XA 1GVRA 1R3RA 3F1QA 2WSQA 2ZRXA 2OYLA 2ZZ1A 1YPXA 1WA3A 4TOQA 2BHUA 4YYFA 1VFSA 2PC4A 1LWHA 4I9JA 2J79A 4TVUA 5F1VA 5KEZA 2J9XA 1FWRA 3QW4B 3OHMB 5DX7A 5HJYA 2ZUMA 4MJZA 3OA5A 3O0FA 3P67A 3C86A 3MI3A 4B5XA 1UOZA 2JF6A 3ARTA 2WQDA 1VS1A 1DXFA 1BYAA 4N42A 1A5MC 3KL5A 3GS6A 1L2QA 4D6EA 2RDWA 3PY2A 2I5GA 2HRWA 3LCXA 1PPIA 4QCFA 2QF7A 2VI0A 3IUHA 4AZGA 1NDZA 4NRRA 1E4LA 3WH5A 1C8QA 2DU2A 1CLXA 3BG5A 2CNCA 3QKEA 1B54A 9RUBA 3NDZA 1SO6A 3FJLA 5A6AA 1AH3A 1JZ5A 1MQPA 3CQIA 1IIHA 4KFPA 1T41A 1WKYA 4HPXA 4UNLA 1WOAA 2Q3OA 3VD7A 2WMIB 2XVGA 1LLZA 1DIKA 3TUUA 4C5ZA 4C65A 5AHFA 1ITQA 4IPIA 1CGUA 5G2HA 1OHLA 1LJYA 1TG7A 3MBDA 4GGHA 4K7YA 4A8NA 5DT7A 1XBVA 3W1RA 3TC7A 1W8SA 3THCA 4I7VA 3FY1A 5DLCA 1HW6A 5HWJA 4KIRA 3MP4A 3GVRA 2E8YA 2WMKA 2A3EA 1AD4A 7XIMA 1G4TA 3WNKA 1W3NA 4IJBA 2BOFX 1XW8A 2YW3A 2PTXA 2W67A 4MVAA 3P80A 2O9TA 1GKQA 3MDWA 3TCEA 4WSJA 4NY2A 1CGWA 2ZUNA 4FX8A 3FN9A 2ATSA 3NIYA 2A7PA 1U2YA 5LKYA 3WDHA 4DLFA 5RUBA 4AIBA 4QP0A 5A3HA 1KGWA 4DI8A 5CJMA 1WAUA 2VC5A 4YS1A 2YZRA 2ZTJA 1C9DA 3WMSA 1LRNA 3AS3A 5BWAA 4WLCA 4NNAA 1FHLA 3UA3A 4UZSA 2INEA 5EYWA 1VJZA 2PCEA 1XG4A 1VLIA 4LPCA 5HUPA 2QUTA 3EEZA 3H4GA 2VD9A 3N73A 3VNMA 2QJMA 1IEQA 1OEPA 3W38A 2VOTA 1ME8A 4LS1A 3URQA 3CH0A 1H5YA 5A8MA 3KTSA 2ZZ3A 3IIXA 1B3ZA 4Q8QA 1JDAA 1Q2RA 4GJ1A 1LUCB 2PD5A 5CZ0A 4BCEA 1BWKA 2QDGA 1WDDA 5LNWA 3B06A 1GZJA 2AOSA 4E2DA 3R89A 1ZSXA 1G1YA 3FSTA 1OBAA 3AI0A 1ODUA 5T9BG 1BTMA 3KHDA 2R1LA 4PUJA 3QFWA 3NCOA 2PWEA 1EP3A 3SQSA 4YTTA 2XIJA 2C14A 1R3YA 4MY1A 2QLYA 3GK0A 3DHFA 3GW0A 4Z17A 3NGFA 1YPFA 1HL9A 2QDHA 4PEKA 3CQHA 3RM8A 1D3CA 2WMIA 4JHOA 1D8CA 4E2OA 2QHAA 3C56A 4GQRA 1Z32X 3L66A 3M0YA 4ZR8A 4GINA 4TX9A 2PMQA 3SCTA 3M7WA 1REQA 3G1RA 5C6MA 3TMQA 3FS2A 3IJ8A 2D20A 2B7PA 1K77A 3OBAA 3LPFA 1NF0A 1XLAA 3PZOA 4PBEA 3RPDA 4ZO8A 4LYPA 3S3GA 3JU2A 2PB1A 4GNVA 4PMQA 1W9UA 4UQCA 1OFEA 4HVXA 3WEOA 1G4SA 4UQDA 3UG3A 1NY1A 1CLVA 2VCCA 3QH2A 2TYSA 1YHTA 2YKKA 4UNIA 3U48A 4D2JA 1EFZA 1GOWA 4HSNA 4DF2A 1H63A 3I6EA 4PTNA 3ZWTA 2WNZA 4F0LA 1XXXA 3BICA 3WK2A 4M5PA 1KLZA 2VL4A 1KGUA 5AYYA 4EPKA 3N34A 4ILSA 3N17A 3DFSA 1XLFA 3WD2A 4IMGA 1XISA 4LGXA 4C5YA 1EGMA 1MZRA 3UXDA 4LB3A 1TB3A 1R7OA 1ADOA 2ASHA 5AECA 2WBGA 3L23A 3H4XA 5ABFB 2DH3A 2O0TA 4M19A 5A6BD 4CNTA 2J7CA 3Q2DA 4UTFA 1JZ6A 1FP8A 3H54A 3UT0A 1XLIA 3P2VA 1LP6A 1MEWA 5KMYA 4FMVA 1M41A 1V51A 1IHIA 3NR0A 2WLYA 1ZPTA 1G4PA 1Q5MA 2W4XA 4S3KA 3U8GA 3WH8A 1IT0A 3WNNA 2G3IA 4XO6A 1LUCA 4MM1A 2ZICA 3KOYA 4DM1A 1W3HA 1WXYA 1UD2A 3L2MA 4TVCA 2NT0A 1KBIA 1ZCOA 3AHTA 3E74A 1JI2A 1JD7A 3WX7A 4XUGA 1EKOA 3E6EA 3R1ZA 4AF0B 3KAOA 4YWSA 1SZNA 4ORIA 3WELA 3W7GA 3N04A 2V5BA 2XFWA 2G0WA 3LD5A