5K3VA

Apo-pdx1.3 (arabidopsis)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
276
structure length
276
Chain Sequence
SPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGLGEAMVGINL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural definition of the lysine swing in Arabidopsis thaliana PDX1: Intermediate channeling facilitating vitamin B6 biosynthesis.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Biosynthetic protein
molecule keywords Pyridoxal 5'-phosphate synthase subunit PDX1.3
total genus 96
structure length 276
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2016-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5k3vA00
3IIZA 5AHFA 3BLEA 1GOXA 3NL2A 4MIMA 4HKPA 2V30A 3LCIA 3MO7A 2QCFA 3W74A 1JQXA 4UC5A 3RU6A 4OGZA 2FQIA 1W3TA 1LTDA 1VGAA 5DBTA 4NZJA 4UTMA 3N2MA 3MHFA 3C52A 3B04A 3TSMA 3WK2A 4YXGA 5KZDA 4E0CA 2OCZA 3MP3A 3GR7A 2KZHA 3MP4A 4A22A 2P0OA 2OT0A 4R34A 2YFOA 3INPA 3WJWA 3WJXA 1ONRA 1G7UA 3LHYA 3FA5A 5LGXA 3M43A 3GR8A 1OFEA 3QMSA 4LRTA 1UB3A 4JS3A 2B7OA 4K38A 3L5AA 1FCQA 2P1FA 1OFDA 3C2OA 4O12A 4XWUA 2C14A 1LOSA 4N4PA 1GVQA 1TQJA 1JRCA 1SO5A 2GOUA 5HWNA 2R94A 2ZTKA 4UFKA 3FOKA 1NVMA 2HS8A 1DJNA 4OT7A 3GYEA 3WJYA 2Y88A 4LY8A 2FTPA 5T26A 1E51A 2CLKA 1YXYA 1B3OA 1FDJA 2VEPA 1RQEA 5CPNA 5AOUA 4O4VA 3OVQA 4A2SA 4G1KA 1S5VA 3BW2A 1M7OA 1LOLA 4JTHA 2YGYA 1L6WA 4FEZA 5AB3A 4JGDA 4ADSA 2A6NA 3CPRA 4I7WA 3QM3A 2V0TA 4CQ8A 1JCNA 3BVJA 4WQ6A 1KM2A 4GBUA 1RVGA 3W7OA 3W7KA 3W2UA 3S8HA 4WY0A 4CQAA 4IPIA 5AC8A 1K7XA 4LVDA 2VFFA 1KM1A 4O54A 3RLVA 1VZWA 4IMFA 5EKYA 2G95A 3DFOA 3MMTA 2J88A 3N9RA 2OX1A 1TV5A 1OX5A 1KFEA 1HO4A 3MI3A 1SZEA 3B05A 1W37A 3O1NA 2H3BA 3NZRA 4IMCA 3EWUA 3W1NA 2QCNA 4GC4A 1R2SA 1DQWA 3S6DA 1EA0A 5LSMA 2WNZA 3EEGA 1A53A 1LCOA 4J9JA 3EX6A 1HL2A 3S5ZA 2X1SA 2Z6IA 3FEMA 2WV8A 2Z0IA 3LHWA 4OU1A 1TPWA 1XC4A 4UTWC 2YSWA 4D2JA 3DFQA 4O57A 1EP3A 1LP6A 1BTMA 5E0KA 5GVJA 3CTLA 5C2XA 1LZOA 3GDLA 4O16A 4UNLA 2E5CA 2Z6JA 1ML1A 2H8XA 3WFAA 5BOOA 4WOZA 3C3NA 3NQVA 5E93A 1B9BA 1VHNA 3O15A 3W7CA 4R53A 3UNDA 1QPQA 1W3IA 1ZAHA 2B0MA 5F2GA 3W72A 4BFAA 4OE7A 3LBCA 4Y96A 1TJRA 3M16A 5HR6A 3TQVA 5AFDA 2GJNA 1O5XA 1X7FA 1EP2A 1WBJA 4JTGA 3I65A 4LV9A 4MLRA 4ZVJA 2JKPA 4S2BA 4RR4A 2V5BA 3NQCA 3LRLA 4NNCA 5D33A 1BWLA 4LNYA 4ML9A 3UD6A 3EXTA 3OBKA 5BMWA 5EA9A 1DBTA 5H2ZA 4UNKA 2Y63A 3BLFA 3STEA 3P5YA 4JDYA 4UMAA 3ZWSA 1XI3A 1IXOA 3G22A 3NQGA 3CEPA 3W1XA 2FPTA 2CWNA 1XUZA 4N6FA 2RDWA 5AN7A 2UV8G 4TMCA 1GVSA 3MW7A 4H6KA 5I3FA 3TC6A 3W2KA 1FXQA 2HMCA 3UWYA 4PODA 1XFBA 4AH7A 3L65A 1ZFJA 2DORA 3NQFA 2NXIA 1EEPA 3W22A 2EGZA 3KAOA 3PAJA 3W71A 3WJZA 1ZY9A 2RKXA 1CI1A 2R8WA 3E9AA 4ORIA 3G3DA 2O7SA 4P61A 3QEZA 5HQEA 3P60A 4MOZA 3NAVA 1KLZA 3F1QA 4LTSA 3HG4A 3GIYA 3W87A 3CB8A 3NDOA 3W7RA 1LRQA 2YYUA 4DF1A 1FCUA 1W5PA 1G7VA 2V2CA 3M7WA 4MKNA 1SZGA 2QUTA 1TSIA 4AHPA 3HF3A 1FQ0A 1VLIA 3G18A 1F5ZA 4AWUA 1W0MA 1GYLA 1EWDA 1H61A 2XN1A 3FKRA 4N02A 4O52A 3G1YA 1TYGA 3G3MA 1GPWA 2QCCA 3GB6A 5CPOA 4E2BA 3TC7A 1R46A 1F6PA 1BWKA 5DBUA 2V9DA 3W7HA 3NO5A 3NQDA 1H7PA 4N9EA 3TAOA 5CZJA 4RXGA 5HR7A 5D05A 2YPIA 1D3HA 1NSJA 2CLLA 2X1UA 3F4WA 4Z1DA 3W88A 3QH2A 4FNUA 1GQNA 3A24A 1FX6A 1ADOA 3PG8A 2ALDA 2V8ZA 1YXDA 3QYQA 3ZR4A 3SECA 1DKWA 1F2JA 3W23A 1EWEA 3A9IA 1FDZA 4N2YA 1GG1A 4IXXA 3TCEA 2IQTA 1F74A 1YADA 3FJLA 1JUBA 3BGGA 1KTBA 2QDHA 1NAL1 3B0PA 3TJXA 1W5MA 1SZNA 4HNUA 3TU9A 3PC0A 2CZDA 1VHCA 3A5VA 1K03A 1YXCA 3DFTA 5G2IA 4HNTA 1TTIA 4U28A 3LHZA 3FLUA 3AJXA 1VJIA 2FJKA 4JIPA 5K4XA 3R12A 4FXRA 4BK9A 4FNTA 4XZ9A 1KFKA 1T0OA 4O1CA 2DZTA 3TROA 1OABA 3MYPA 4A2RA 1IIHA 3T78A 3M0ZA 1QAPA 1JJKA 5BW6A 2DZXA 5FEWA 1RD5A 4M7TA 5LNVA 3DI1A 1GT8A 4GXMA 3PBUA 1AG1O 3GKFA 3LRKA 2ZDRA 3TAKA 4QNEA 4ADUA 1LRTA 2NUXA 3LRMA 4JTIA 1VCGA 3E02A 3W7GA 2A6LA 4K8EA 2X2GA 3KX6A 5HWJA 4B5NA 1KV8A 1WAUA 1YPFA 4Z0SA 4X9SA 1XL9A 3UZ5A 5LKYA 1KW1A 1PV8A 2E6DA 3HPSA 3B0UX 3THAA 2A85A 4FX8A 2C3ZA 1I2PA 4DO4A 1OFBA 1SZFA 1OX4A 3LCXA 1QNVA 1SW0A 2ZTJA 3W7PA 3L2IA 1VC4A 2QCEA 1F05A 3G0XA 2V81A 4LV4A 4ADTA 4HNVA 5G4WA 2BTMA 2NXGA 3IIPA 2Q8LA 1KM5A 3FS2A 4LU0A 4UR8A 2H6RA 1FWSA 2GVGA 2VFIA 4PH6A 4JDBA 4MLJA 4TIMA 3W9ZA 3P67A 3KRSA 1T99A 3GXNA 4M6QA 3CM4A 5AHMA 3SY5A 3K30A 2ABAA 4BI7A 2LLEA 4LT9A 3G0SA 4JX6A 5CZ0A 1ZALA 1QPNA 3S1UA 1THFD 3MHGA 3QW3A 3I6RA 3L0KA 1KFBA 3NQ8A 4O18A 5FEPA 2NWRA 4XUGA 3O07A 3TE9A 4NJHA 3UWQA 3NL6A 1KFJA 2WOQA 4FX6M 3P8JA 2TPSA 2RH9A 3LXCA 1FCVA 5G2HA 1OFQA 2ZRZA 4IMEA 1EUNA 2X1TA 4Q32A 3R2GA 4MZ1A 4UTJA 4DPPA 1GYNA 4WD0A 3DFPA 2JGYA 2CLMA 3PB2A 1DOSA 5LGZA 3TIMA 1N55A 3ZWTA 1LBLA 3KXQA 3TSBA 4YCPA 1ZNNA 5LHEA 2J9XA 2ZRYA 1J4EA 3BG9A 5D32A 1KM6A 1H7XA 1EB3A 3W1AA 5D2WA 3N9SA 1VH7A 1MEHA 3CIXA 2BXVA 1N7KA 3ELFA 4JTKA 5L6UA 1QCWA 2C15A 4RV8A 2Q3RA 3PUDA 3W1UA 2OMAA 3G8EA 3HOJA 4MFDA 1X1OA 2OT1A 5A5WA 3NQEA 3MWAA 1K8YA 2ATMA 3HB9A 3GLCA 3SGUA 1KM0A 1S5WA 4JTEA 2WQPA 3HGSA 1M5WA 3O06A 4YMZA 1VLWA 3GDMA 4NUWA 3P82A 4NU7A 2QJHA 1FBAA 2CZFA 5I3HA 2H3DA 4M19A 1BEUA 5F2MA 3HG5A 5K9DA 3HJZA 4N9DA 1U5JA 3BK0A 2VFEA 3NQMA 6TIMA 3STFA 5SWUA 4K7YA 2DU2A 1VCFA 1RQBA 2YXGA 2YR1A 3C0JA 4E38A 1H63A 2E5BA 1PE1A 1R2RA 2PRLA 4IX2A 3WK3A 3ZS4A 4DELA 1SR9A 4MJZA 1G4TA 2PURA 4HN4A 2VFHA 3LTSA 3PBVA 4EF8A 1XDLA 4GNJA 4LS1A 1ICPA 4UTTC 2ZZ6A 5IBXA 3OIXA 1Z44A 3W7NA 3SSJA 4FIQA 5F4WA 2HTMA 3IVUA 3M41A 1VQTA 2Y6ZA 3W7QA 2Y70A 3QJAA 4ZQPA 1WA3A 5K3VA 4JR5A 2WNNA 3EXRA 3L66A 3W2MA 2VXNA 1LLZA 3CC1A 3DGRA 5KITA 4S1FA 3Q37A 3G1VA 3Q94A 1P1XA 5E1QA 3ATYA 3DH7A 4N6EA 4RLIA 3MI6A 1FWNA 4WUIA 1C8VA 2PRMA 3G1XA 3IIOA 1A5SA 1LORA 1RR2A 2A1YA 1AL7A 2XFWA 1YYAA 1K7FA 4UTTA 4NQ1A 3LI0A 2JKEA 4XTDA 1MSSA 2BSLA 3FIGA 3L5LA 2TSYA 4YLWA 1VS1A 1R30A 5I3IA 3QQ1A 5D2XA 3N19B 2NX1A 3ABRA 4Z1CA 4UFLA 3W7DA 4IX0A 3IGUA 3BGJA 3DAQA 2QR6A 2ZRWA 3NPUA 3YPIA 4KWWA 1GZGA 2E68A 1OX6A 1Q6OA 2TYSA 3PM6A 3G0UA 1JUKA 5KTLA 1K7EA 1VYSX 4BI6A 2Q3OA 1MO0A 5J5RA 1GTHA 2FPVA 1DORA 2WSYA 4QSHA 2E5DA 4O0ZA 3UWUA 2QKFA 2ZZ1A 4MVAA 4POCA 1L9WA 4ZZ9A 1QDSA 1DV7A 3PULA 1LBFA 3PUOA 2WKJA 1FXPA 3M47A 4CCCA 5C54A 4RZ4A 1TRDA 4XBSA 3GDTA 1AK5A 1O60A 3TXZA 3VE7A 3A22A 1KBIA 4IOTA 1Q6LA 4PC8A 1IXPA 3W76A 4HIBA 3EXSA 4NJIA 4E2DA 1SO3A 1WXJA 3KVLA 3S1XA 1I4NA 4O0KA 4N9BA 1JCJA 1VRDA 1I8JA 1TPB1 1KV5A 4LRSA 4DQWA 5KZEA 5CPLA 2AGKA 4IMGA 3SW6A 1KM4A 4O13A 4DBEA 3CLMA 1C29A 2WSQA 1KTCA 1WYIA 3NOEA 4IWWA 3PG9A 2DJXA 4FX7A 4JIQA 4KFNA 2QJIA 6ALDA 1NF7A 3RF9A 5K9XA 4O10A 1X8FA 1G6CA 4IQLA 3DFNA 3RNDA 3W70A 1SPQA 3SGZA 4WXYA 4R7JA 5I3JA 3L5MA 3P62A 1UUMA 3CIWA 3MJYA 3DU0A 5D38A 3OA3A 3TDFA 1FDYA 1OFOA 4MY9A 2C13A 1PS9A 3EX2A 4PL2A 4JTUA 4JTLA 3PS7A 3N73A 1L6SA 1K3UA 5K9CA 1Y0EA 4IXHA 4Z1BA 3JS3A 4K36A 4QJ1A 4O1BA 1HG3A 1SUXA 2GQ9A 2RHGA 3E96A 1K8XA 4WOQA 3E12A 3B8DA 4O11A 4TU1A 2C1HA 2NXHA 3W1MA 4UXDA 5H91A 2X16A 5CPMA 4JD4A 4GUJA 4X22A 3QSRA 4TX9A 3W1QA 4UCGA 3W1RA 3P81A 3EKZA 3L0GA 4Z1AA 5DY3A 3BARA 1W5QA 1XBXA 5K2ZA 5C5YA 2VOMA 2JGQA 4UFMA 1SSDA 5LNRA 4UMCA 4S2CA 1KTNA 3NPXA 3TMQA 4H3DA 2ZYFA 3GXPA 4EOUA 1YPIA 5D37A 2CU0A 3MP5A 1FWWA 2A5HA 3C2VA 3QPZA 3PBYA 5L9FA 4PCFA 2DJLA 4K6AA 2JKAA 1K8ZA 4NJKA 1O94A 1WBHA 5U7SA 5TIMA 3N3MA 3OVPA 4HHPA 1FY6A 3IVTA 1CX9A 4PTNA 1OJXA 5FF7A 2J27A 1XDMA 3HPXA 3LLFA 3HPZA 3LHVA 4UFHA 2C0AA 2NX3A 4H4IA 4JICA 3IGXA 3W6YA 1S3HA 3DKLA 4WJEA 3DKJA 5F1UA 1H62A 1F76A 1EPXA 1TMHA 4AWSA 4JTTA 1OFAA 3SJ3A 1QMLA 1HO1A 5DXXA 1JCXA 3FYPA 4AVFA 1PHQA 3LCGA 4XQ6A 2DZSA 3NPVA 3DFSA 1WV2A 3LCWA 1GWJA 1ME9A 2E6FA 5C55A 3RLUA 5I3GA 3BLIA 4K8HA 3TMLA 2Z1BA 4WY0B 3TV8A 2QCLA 4AEOA 3T55A 4NJJA 5CG7A 3GX9A 4JYDA 1TV7A 3U6WA 1XBVA 1LLWA 1JULA 1LRNA 5DXYA 1CW2A 4MUZA 2ZZ4A 1OG0A 1V5XA 3TNOA 1OYCA 1H50A 3W07A 4AHQA 5K4ZA 1TPEA 3USBA 1YTEA 3LB0A 4FXSA 2PCQA 4GJ1A 4JXCA 4Q33A 3SI9A 4UTWA 4CQ9A 5FF4A 4JX4A 2W79A 5D04C 4I7UA 4KFPA 4GUGA 4LS0A 4ZQNA 3LXBA 5U4NA 4LUJA 3CQ0A 1GG0A 1ZAJA 1H51A 3GDRA 7TIMA 4R33A 5G1YA 2EAWA 4XBKA 1KLYA 3I7RA 4RCXA 2A21A 2D73A 4FF7A 1AL8A 5HINA 2X1RA 2I14A 5AHLA 4IMDA 4QM1A 2QCDA 4UTUA 4NZFA 4PFMA 4DPQA 1O4UA 3NL5A 4BI5A 3G8RA 5CSRA 5CGQA 2WSRA 4L4MA 2EKCA 4UMBA 4O19A 1YTDA 3BO9A 2P10A 4GE8A 3BG5A 5LNSA 4FB7A 3EWXA 2EHHA 1P4CA 1ZENA 4OHQA 4LVGA 2R14A 1TPFA 3MI2A 1WOAA 1TCDA 3JR2A 4MYAA 3HQ1A 4HSNA 3W7IA 3NYZA 4A29A 1B4KA 3W1LA 3PB0A 4O17A 3W73A 4JN6A 2HS6A 3QQ0A 4CCDA 1LM1A 2ZA3A 3OEXA 4CCEA 1SQ7A 1I2NA 3V1PA 3RMJA 1G69A 4Z08A 3LLDA 3PBWA 5HWMA 2PRHA 1OK4A 2NX9A 1TTPA 5BMXA 1AMKA 3QFEA 1JCYA 2QUUA 1OVDA 1JCLA 1FWTA 3TFXA 1OYBA 3STGA 5FF0A 3P8IA 3B03A 5EMUA 5EYWA 2QCMA 5D30A 1H7NA 1SFLA 3HBLA 3O6YX 2WNQA 2CZEA 3L67A 3G1AA 3I7QA 3A5FA 1B57A 2GQAA 5F1VA 3T7VA 3STCA 2WJZA 3BPWA 4DEFA 1DJQA 3UQNA 1GVOA 4UFIA 1A5AA 3S0CA 3TUUA 2NWSA 4NNBA 2GVJA 4M5PA 4NX5A 4Y6GA 5DCDA 4DO6A 1ALDA 3QC3A 4X3ZA 5FESA 2ZQ0A 1OF6A 2QCDB 3KVJA 3PVFA 5C6MA 1SSGA 4WZHA 5D2VA 3M6YA 4XKYB 4UTHA 1LBMA 3FKKA 3N2XA 3M9YA 4UUIA 4KFOA 3WK1A 3T4CA 1MZHA 1X1ZA 1T96A 4MY1A 3LV5A 5LNWA 2E6AA 3C56A 4FNRA 4IUOA 5LHFA 3N34A 1W5NA 5TQLA 3C2EA 3L21A 1L2UA 4Y8FA 1AW2A 1DQXA 2ZBTA 1SO6A 3ABOA 1H7RA 1TTQA 3CU2A 3HMJG 4HNNA 1TQXA 1UJPA 2C6QA 5HUPA 3I68A 1TV8A 4ZL1A 1DHPA 3H54A 2H8ZA 4FNSA 3HIJA 4UTIA 1KBJA 1TIMA 5EL1A 5DN1A 4GUHA 3EB2A 5G1TA 3NGJA 3UWVA 2ZZ5A 2CLFA 1D9EA 3C6CA 4PEKA 4ZQRA 3M5VA 5AYZA 3RFAA 5FF3A 2GQ8A 3G1SA 5LZLA 4NT0A 5AHEA 2CZ5A 2ISSA 3DHFA 1EX5A 4HT3A 2A7PA 2FIQA 2VFGA 1I45A 2CLIA 1SU5A 5DCEA 2E1DA 3UWZA 3W84A 4CLMA 2B7PA 4L4LA 2QJGA 3QZEA 3ATZA 4YWIA 5EBUA 1Q6QA 1H5YA 1L6YA 1VCVA 1PCWA 4LVBA 3MBDA 1SFJA 1Z48A 2GUUA 1F7BA 3C4UA 4PA8A 3GVGA 3W2NA 4HPJA 4YL2A 2FLIA 2B7QA 1MEWA 2CFFA 2ISWA 4JTSA 4CNPA 1TREA 3EWBX 4LC6A 4O1DA 2A4AA 4OV9A 3B0VC 2CW6A 1YDOA 2J24A 1KM3A 1JR1A 1GVRA 3DXIA 3LERA 1W3NA 4FNPA 1QPRA 1VYPX 2NUWA 3NM3A 1TPVA 5FEXA 2OZ0A 3TH6A 3GDKA 1NEYA 3GZ3A 1YTKA 5CZSA 4AAJA 2Y62A 5HNRA 3UXDA 3HGRA 3NQ7A 5EY5A 1H1ZA 1H1YA 3QPYA 3PWAA 3CT7A 3P7YA 2C16A 2ZZ7A 1XXXA 3LOTA 2G5WA 1BKSA 3V75A 3ABQA 4AMAA 2DZPA 3S9YA 4LS2A 2NV2A 4LVFA 1TPC1 3P74A 5FF2A 2GJLA 4C1LA 3OVRA 1T8XA 1A5BA 4DF2A 1G67A 4MZYA 2GPTA 4ZQOA 3EWYA 2O7QA 3NVTA 4GWEA 3EX3A 1UCWA 3KFTA 1XCFA 1NFBA 1N8FA 1NF0A 4AF0A 5TBOA 3T40A 2WO5A 1C9DA 2WPBA 3G1DA 2J9ZA 3L9CA 3QF0A 3SIZA 3UPWA 1J2WA 1Q6RA 1P0NA 2RFGA 2DZVA 3UY7A 1IXQA 1X6UA 3LBMA 2ZZ2A 3MUXA 2TRSA 5I3KA 3CEUA 4RXFA 1FUYA 1JVNA 1W8SA 1SW3A 4MY8A 3VNDA 3UXAA 1QOQA 2RDTA 3S42A 2BLEA 2V82A 3SR7A 3KHJA 4I7VA 3W1TA 4JTJA 4XTIA 3P5ZA 1XBZA 1KA9F 2ZCGA 3NQ6A 3C2FA 3HG2A 3G1FA 4ORMA 3UWWA 3TK7A 3IEBA 4K7VA 3QRHA 2VENA 3A23A 1M7PA 3B4UA 2Y89A 4QQ3A 1QO2A 4GUIA 1QWGA 3O6CA 1D3GA 4NVTA 5D02A 1OF8A 1TPDA 2ATSA 3RK8A 3H55A 3VE9A 1PIIA 1OFPA 1WX0A 4PL1A 4LWWA 3LHTA 3SZ8A 4O50A 3TX9A 3PSVA 3PY2A 3O63A 3W7MA 1ZCOA 3FJ6A 1GVFA 3NZ1A 1FCBA 2Y85A 4BWLC 2FB2A 5KZMA 4EWND 3THQA 1IXNA 2GVLA 1MXSA 2AQWA 3KVMA 2I9EA 1ME8A 4ALDA 4O8RA 1O95A 2QAFA 2VELA 3CWOX 3NEVA 3QW4B 1I2OA 3P61A 4Q4KA 5F4SA 4YCOA 4IPJA 5DY2A 4FO4A 3EKLA 3W75A 1RZMA 1B4EA 2FB3A 3S5OA 2V2DA 1Z42A 2VFDA 5F2LA 4UIOA 1TB3A 2YX0A 3TW7A 2G96A 3GNNA 3O6DA 1RPXA 1FWRA 2J6XA 3TR2A 4OBTA 1EP1A 3IIXA 2EF9A 1G4SA 1MEIA 3PUEA 4JEQA 3IGSA 1F6KA 5FI8A 3N14A 4W9TA 3U2OA 2QEZA 1HTIA 4UTKA 1XM3A 2G97A 4ZQMA 2ZZ3A 1XUUA 1GEQA 2QDGA 3LDVA 1SO4A 2FFCA 4JNMA 3ABSA 3LTYA 2A0NA 1JCMP 5MHBA 3R13A 4O15A 3R8RA 3KRUA 1EUAA 5ABTA 1P5BA 4NX0A 3GK0A 1LOQA 3TKFA 3LXAA 4JTFA 2Y7FA 1PHWA 1U83A 1UUOA 3NQ2A 4WXZA 3LGEA 1S5TA 1K02A 5F4XA 2F7FA 2BWGA 4JX5A 2QCGA 2EPHA 3QMRA 4BF9A 1W5OA 4OQVA 4MPQA 4LOCA 3DI0A 5D03A 5KSWA 1OX4B 4UFJA 3W7EA 4KKXA 1QPOA 4MFEA 2W0UA 5AYXA 2FDSA 3W7JA 5HJLA 1OHLA 3TQ0A 2YCEA 4A21A 2DZWA 1WDWA 3BV4A 4ICNA 2A2IA 4U4MA 4WY0F 1TJPA 3GXTA 3EX1A 2R91A 3JRKA 3U8GA 1UASA 4BR1A 2QUVA 3CWNA 4M6PA 2C18A 4Y9AA 3LX9A 3EWWA 3NM1A 2NZLA 4RJEA 2VEMA 4KWVA 2B7NA 3C61A 4LVAA 4LUIA 2RDUA 1EIXA 3M1ZA 2AAMA 4JYFA 4O53A 3VI2A 4AF0B 5LNUA 3HO8A 2NLIA 1TO3A 4RK8A 1LROA 3S1WA 2TMDA 3BW4A 1AW5A 3LCHA 3O16A 2NV1A 4TMBA 3QMTA 4TR9A 1LYXA 1HUVA 3M44A 1WQ5A 3UZJA 3W86A 1DL3A 1LDCA 4Y90A 2PE4A 1TTJA 2Y7DA 3WK0A 3VCRA 2ISVA 3LCLA 5CSSA 4P2VA 3DBPA 2C19A 1SW7A 1I2RA 1WOBA 3NPWA 3EX4A 2Z2UA 3W2LA 2CLEA 3DHDA 5A8GA 4UR7A 3P84A 5BRBA 1OYAA 2QCHA 3FYOA 3NA8A 3OG3A 3GAYA 3GKAA 1AW1A 1JUEA 1DVJA 2Y61A 4QISA 1ME7A 1M6JA 1TRIA 2XN2A 3DENA 4EVZA 3EWZA 4K37A 2QAPA 3C8FA 3UPBA 2BX7A 3S5YA 5IBXC 4RZ6A 4QIUA 2YYTA 4UTLA 3W7LA 4FNQA 3W85A 2X30A 4LW7A 3H53A 5BNKA 4ONVA 3G1HA 4OWGA 3LCFA 5HMSA 2NUYA 4RX0A 2QF7A 2ZRXA 3L68A 5DLCA 4M7SA 1G4PA 4MZ8A 3D0CA 1QOPA 5AHNA 1ICSA 2E6YA 3WJSA 3W2JA 2VC6A 3I7SA 5FEZA 4ZMGA 2YW3A 1IF2A 1GTEA 2I1OA 4C1KA 4DO5A 1IIGA 3GNDA 4O4WA 3M5YA 2ZFAA 3F4NA 4IGHA 1Q3NA 3PF3A 1KFCA 2F84A 3AO0A 3TXVA 3PR2A 4O14A 1ZAIA 2ZRUA 3MBFA 1PVNA 1RQHA 3NG3A 4HSOA 3G24A 1A50A 4FHAA 2ZA2A 1KFLA 3F03K 4AHOA 4NXSA 5G5IA 1XBYA 5CZTA 3W3OA 4AWTA 3P80A 2A7NA 3W83A 1H60A 4IJBA 1IGSA 5AHIA 5G4EA 2J9YA 3LI1A 3GAKA 3TFCA 1P0KA 4DBDA 1H7OA 4GRSA 1Q45A 2OJPA 3B06A 3TQKA 5AC7A 4FIRA 3C2RA 1TPUA 4EIVA 3UYCA 1H7WA 1HFBA 1XKYA 3LTPA 3KRZA 4GUFA 1VYRA 5KINA 4AXKA 4JYEA 2B4GA 1I2QA 1UBSA 1VR6A 3DZ1A 3UY8A 4CNNA 3E49A 5J5DA 5CKSA 5IM51 1OFRA 3SFKA 4JY9A 1R47A 2Y7EA 4DF0A 5HUOA 4O1AA 4O28A 5K7JA 3KOFA 4WX2A 4HPXA 2DP3A 1F73A 1YLVA 3HGJA 4MJMA 5G2WA 3HGOA 4QITA 3NNTA 2CLOA 3KVKA 4OV4A 1PCKA 5KMYA 5D2YA 1YDVA 3ANYA 1JQVA 3LM7A 5F2IA 3L0NA 3VKJA 2W6RA 4I9AA 2YW4A 3W1PA 4K39A 8TIMA 1TPH1 4NJGA 4QAIA 2H90A 4GFSA 3NL3A 3E0IA 4N4QA 1O5KA 3VFLA 3BG3A 3ZFHA 4NXKA 2FPYA 5AC6A 3HG3A 2A7RA 5HULA 1JRBA 1Z41A 3IIVA 1G4EA 1OK6A 4N9CA 3FFSA 5D2TA 4RZ5A 5DCBA 1V7YA 3MHUA 2E09A 1A5CA 3Q2DA 5EPDA 4QNWA 1W54A 3OHIA 2VEIA 2VKZG 4RKAA 2XN0A 5AYYA 2JBMA 2PC4A 3IVSA 3TA6A 1W1ZA 1PL9A 4XKYA 4AB4A 2YDAA 1W31A 2ZRVA 4BWLA 3MYOA 5DELA 3O05A 1QFEA 3T44A 3LV6A 4TO8A 4LC8A 2ABBA 3S5NA 1GJPA 3M5ZA 3TW6A 2CLHA 3TSDA 3BW3A 2HSAA 1VPXA 4EF9A 2DZUA 4A3UA 3O8AA 3NR0A 2Y7GA 3CHVA 1RV8A 3R89A 2YFNA 1ZJIA 3NQAA 2YZRA 4JY8A 4Z0JA 3Q58A 1ICQA 3M5XA 4M6VA 4MYXA 1YDNA 1W56A 3IRDA 3NXFA 2ZA1A 2JK2A 5D09A 4DXVA 4X2RA 1QR7A 3IV3A 4ZQCA 2Q8ZA 3S1VA 2V2HA 1ZHAA 2V5LA 1QO5A 1R2TA 3TJLA 3R5EA 3PSWA 1J5TA 3QSTA 3LHUA 4CNOA 2E77A 2VEKA 2BZNA 4NNAA 3A21A
chains in the Genus database with same CATH superfamily
5AHFA 3CLWA 5I24A 1H2JA 3VKCA 1BSLA 1CLKA 1VFHA 3EMZA 4HYWA 4YJ5A 2NQJA 3VFCA 4LUTB 3MO7A 3MSGA 3W74A 3UG5A 3H2FA 4ROPA 1K1DA 5EFFA 3MJMA 2FQIA 1E5NA 2ZX6A 1VGAA 3N2MA 3MHFA 3ZIZA 3TSMA 2HVOA 1QRQA 1AH0A 1E73M 3NCOA 2KZHA 3N11A 3MP4A 5A8OA 4HOXA 1D8WA 5HQLA 1NWUA 3WJWA 4GVIA 4PCNA 1ZS2A 1ONRA 2OEMA 1H11A 3LHYA 3FA5A 6ENLA 3E0LA 1XYZA 4BKNA 2WMFA 2UWFA 3QKEA 3CBWA 4WDUA 5E5CA 1FFQA 4NYUA 3NOYA 2B7OA 1V3KA 3BZJA 5I79A 3PK7A 4O12A 1U30A 4XWUA 3TONA 3DECA 5AKQA 1LOSA 3SRDA 1TZ9A 1W1IE 3ZVIA 3OB8A 5HWNA 4UFKA 2HS8A 4OT7A 4KIRA 1T40A 2PU1A 1E51A 2CLKA 4Q4MA 4I5XA 1YXYA 2HVMA 1FDJA 5DX7A 4H9XA 5JU6A 1YQ2A 4F2TA 3BW2A 1M7OA 3LSBA 3FEQA 4AU0A 3SQMA 5C2GA 4FEZA 4KIEA 3CPRA 4V15A 3QM3A 2V0TA 1JCNA 4Q4RA 4AD5A 4IFKA 1SR0A 4L1GA 2BOFX 5DT5A 3W2UA 4UR9A 2QJJA 4S3DA 1L2QA 4IPIA 3G6MA 1K7XA 5BYWA 4ILSA 4LVDA 2VFFA 3CQKA 2G95A 2J88A 1W3HA 4RE4A 4GINA 3VD5A 1OX5A 1KFEA 5EGRA 4JIHA 1HO4A 3MI3A 1E5JA 2WWCA 3UVAA 4GC4A 4PR4A 2P5NA 1EA0A 4JTDA 1AZ2A 2VWSA 2HWGA 4IFKB 5C9UA 3F2CA 4U3CA 1ZBVA 4HNLA 3S5ZA 1W1VA 4L4PA 1JEZA 4HPNA 3BAWA 3LHWA 1RXOB 2UY2A 1YRRA 3QFWA 1XV8A 3VOJA 4MMWA 3FX4A 1TPWA 1XC4A 4S38A 3WUEA 2YSWA 1LWJA 1HW6A 3CTLA 4J40A 1B54A 2E5CA 4UNLA 2Z6JA 3WFAA 5BOOA 2WHKA 2VP8A 3NQVA 2VGIA 3CK5A 3W01A 1VHNA 3O15A 4R3UA 2B0MA 1ZAHA 3WF3A 4F2UA 3W72A 4OE7A 2DIKA 1Q6FA 3S2NA 1O5XA 1MDRA 2C0HA 1X7FA 3I6EA 4DJFD 1EP2A 1BHGA 1ENUA 1PPIA 1WBJA 4JTGA 3I65A 4LV9A 4MLRA 3ZZ1A 1KWGA 2IXVA 5D33A 3QHOA 4KWUA 5CAKA 4CQCA 3UD6A 3SN4A 3PZNA 5BMWA 1DBTA 2XWEA 1TV4A 2D2JA 3STEA 1PIFA 4JDYA 5I78A 3G22A 1XQKA 1WZAA 2XINA 3W1XA 1SJCA 3MW7A 1EC7A 1S38A 2XM1A 1JYNA 3W2KA 1FXQA 2E4TA 1HVQA 3TR9A 1RJPA 4NZCA 5M1TA 4JIIX 3WJZA 1ZY9A 4E4PA 3E9AA 4ORIA 4DI9A 4Q8MA 4XAGA 4P61A 1RK5A 3NAVA 3RITA 3F1QA 3GIYA 2WVVA 1XG4A 1BG4A 2BHZA 4KT2A 3ZVHA 2YYUA 1KB3A 4GVGA 1G7VA 3M7WA 2X7WA 4I8DA 4MKNA 1TSIA 4AHPA 1FQ0A 4AYGA 3OGSA 1H61A 1C7SA 1KNWA 3KOZA 3G1YA 2QCCA 4E2BA 1JAEA 3MVIA 4PMNA 4WLCA 3R58A 3SCRA 3ARUA 1F6PA 1WDQA 5DBUA 4M82A 4DUXA 1GQKA 4DI8A 3NO5A 4GYKA 1FOBA 1H7PA 3S47A 5CZJA 5D4YA 4UQ9A 4WIWA 5HR7A 2YPIA 5T9CE 1B2YA 2X1UA 4Z1DA 4Y9MA 1GHRA 4H04A 3N2CA 4FNUA 4YTSA 1FX6A 4S3BA 2DT2A 1UR9A 1UD8A 1DKWA 4MF4A 1WKFA 3K1DA 1GG1A 1RSCA 5GNXA 3UR8A 2PWVA 4S23A 4HJWA 4PN2A 1UQYA 3UG4A 2QDHA 1DJWA 3WQOA 2A3BA 1NAL1 1PDYA 1XGEA 4K1GA 1SZNA 4G6CA 3TU9A 1JXKA 4IPPA 2YDSA 1VHCA 4WDXA 1VJIA 1A5NC 5K4XA 3R12A 1WB0A 2WVTA 4FR6A 1OABA 1PKYA 1WXZA 4U31A 3T78A 1Y65A 2DZXA 5HANA 4ASTA 3L23A 1H1NA 3DI1A 1DJGA 3FHQA 1DTUA 5D9NA 1UD5A 3E02A 2A6LA 3QHNA 3BAJA 3MVTA 2OWCA 2OZ8A 1EF2A 3PFMA 1TUFA 4S39A 4PSRA 4RPQA 3B0UX 1WPCA 2C3ZA 3AIRA 5AZ1A 4CU7A 4MWAB 3N2OA 1UZDA 1OX4A 4RNFA 5JH2A 1AFSA 3W7PA 1DIOA 5LA2A 3WD1A 2OZTA 3L2IA 2DSKA 4LBRA 3URBA 3F2BA 3FSTA 3BCFA 3IJ7A 1R3QA 2BTMA 2NXGA 1XRSA 3PZVA 1BF6A 4UR8A 4U5IA 3NIYA 4S3GA 4UOQA 2VFIA 4PH6A 4JDBA 3A12A 3W9ZA 4AZ6A 2ABAA 3MZ2A 2LLEA 2PI6A 4MM1A 5CZ0A 1ZALA 1S2AA 4MWAA 4TX8A 3I6RA 2OPJA 1KFBA 1XH2A 2D24A 4XUGA 1KC7A 2POTA 4FA3A 4NJHA 4ICCX 3UWQA 1OIMA 2GLKA 1KFJA 2PAJA 4TTUA 2RH9A 5G2HA 1OFQA 1GKQA 1PIGA 3QLLA 4QDWA 3JZUA 3R2GA 4MZ1A 1GYNA 3KL5A 3DFPA 4H2CA 2KX9A 2JGYA 5BRQA 4NRSA 1DOSA 3UXKA 2FVLA 3PWGA 4RL3A 3ZWTA 1QPKA 5LHEA 2I5GA 3BG9A 5D32A 1KM6A 1EB3A 2G0WA 3W1AA 4B5UA 1VH7A 1MEHA 5BXTA 5FJTA 2WVUA 1Z89A 3GHUA 3ELFA 2ZE0A 2OG9A 2C15A 4HPHA 4RV8A 2Q3RA 1R85A 3W1UA 2OMAA 3G8EA 3EOOA 5H6HA 4QAWA 2OYMA 1X1OA 2OT1A 5A5WA 3WMLA 3MWAA 3HV8A 3HB9A 1XHGA 3EPNA 3WLRA 3CZJA 2GJRA 1J12A 4YMZA 3AHZA 1QI2A 5CPSA 2QJHA 2FDMA 2H3DA 3E5PA 5BCAA 2PDIA 3HG5A 3VNKA 3HJZA 4HK5A 2NQ5A 5CPQA 4CGTA 4PB4A 3NQMA 5T9BG 2YR1A 2PD9A 4E38A 4IX2A 1SR9A 4MJZA 3QV8A 7CGTA 3PBVA 1JZ7A 4UZSA 4UTTC 1P0DA 4YYFA 2E9LA 2ZZ6A 5IBXA 2QGYA 5F4WA 3IVUA 3M41A 1VQTA 3WF1A 4AEEA 1JFHA 4JR5A 4UQCA 3B9EA 1BFNA 3VOGA 1MQRA 3L66A 2VXNA 3CC1A 3UBPC 5IOBA 1WDPA 2BASA 3G1VA 5E1QA 2HNHA 2PRMA 4G8TA 1EYEA 3IIOA 3K4DA 1LORA 1AL7A 1YYAA 2WANA 2YCLB 5BXSA 1KRMA 1K7FA 4UTTA 7XIMA 4EXQA 3W0KA 4LUSA 3W4RA 3TYEA 3FIGA 2BSLA 1Q65A 3WNLA 1YE6A 3CZKA 3CPUA 2PS2A 1GW9A 3IGUA 2V67A 3DAQA 2QR6A 3TVAA 3CUJA 1L0PA 4LB3A 4QLJA 2EG6A 4TXEA 2TYSA 3BDKA 5JVLA 2D0HA 2VEGA 1EJRC 3F4VA 1K9DA 1MO0A 4EPKA 1DORA 4MSSA 4POCA 2WKJA 1FXPA 3M47A 4FLOA 3PFRA 4QE5A 4CCCA 4KBXA 1CENA 1SFTA 5JQ9A 1O60A 1U1UA 4Q3MA 3A22A 5FD0A 1H5VA 2ZC1A 1Q6LA 3DGBA 1IXPA 5CBJA 2RJHA 3EXSA 2ISDA 4MKSA 5MKGA 4NJIA 5BXRA 2IKJA 3TZFA 3E2RA 3U7VA 3CASA 1WXJA 1P43A 3S1XA 2HVNA 3AHXA 1I8JA 1TPB1 3HQNA 4LRSA 3ANUA 3MUAA 2PP0A 5CPLA 2AGKA 4IMGA 1E0TA 3SW6A 5BWAA 3VKDA 4H7ZA 2QIWA 3CLMA 3RCNA 1KRCC 1E56A 3AWOA 4WR3A 4JIQA 2G3IA 2P88A 2QJIA 3V35A 4XG1A 5K9XA 4OVXA 2V5KA 3EA1A 4AC7C 3DFNA 4CU8A 2VI0A 3NZPA 3ZSSA 1B3WA 1MW0A 1WP6A 1IT8A 4K1WA 3MJYA 1MRAA 3ZJKA 4Z2IA 1AVAA 5D38A 2P3EA 1U2YA 4D6EA 3TDFA 1E9LA 2C13A 3EX2A 2E40A 3TYZA 4JTUA 3PS7A 1L6SA 3L2LA 2C79A 1Y0EA 2PWGA 2QUMA 4IXHA 4QJ1A 1HG3A 2GQ9A 2RHGA 2VGBA 3RM8A 3BSHA 2GGJA 1W9VA 4WOQA 2IKGA 4O11A 4FK9A 2C1HA 1MMFA 5H91A 4XZBA 2X16A 5CPMA 1J0KA 4QJ3B 1S2VA 2J7CA 4D9PA 3L0GA 1W5QA 1XBXA 3GR4A 2INFA 1M01A 2VOMA 4FLSA 4GACA 2FGLA 3NPXA 3TMQA 3LENA 4NG3A 3O6AA 1R9YA 3SN0A 4W8AA 3MP5A 4KESA 3ARWA 3VNLA 3HQPA 4HU8A 1GOKA 2ZUWA 5BRPA 4L6DA 4ZO9A 3P14A 3C2VA 3PBYA 4P8WA 1XIDA 2UY4A 5L9FA 4PCFA 3WLJA 3RDKA 4XSLA 1O94A 1HIZA 2BXZA 2OXNA 4QXIA 4WKHA 5M5DA 4HHPA 1HKWA 1KQYA 2OOFA 1XDMA 2EO7A 3HPXA 2DH3A 1I9CB 2P8CA 3MMUA 3WNNA 1J0ZA 3HPZA 1YIXA 2BVYA 1OIFA 1XLCA 4JICA 4OBRA 3W6YA 3QTPA 3DKLA 1IQ8A 4JKKA 3BJFA 2FYMA 1E3ZA 5F1UA 1H62A 1EPXA 1OFAA 3L4YA 3MV11 4Z2JA 3GU1A 2J62A 3QVQA 4W7VA 3FYPA 4AVFA 5LA0A 3LCGA 3NPVA 1ZSXA 5AY7A 3LCWA 3ICJA 3PPGA 2E6FA 4QGCA 5I3GA 1HKIA 6REQB 3TMLA 1XCWA 5CH9A 4JL2A 2QCLA 2D0GA 4AEOA 3T55A 2V69A 3WLIA 4JYDA 1JULA 3WNOA 1GEHA 1LRNA 4W87A 1XS2A 4J3TA 3KBWA 3SEPA 1UH4A 3USBA 1MUCA 4NF7A 2J8TA 3LB0A 5IDIA 4QCEA 1OC5A 4Q33A 4DN1A 3AYTA 3ZT5A 4ACZA 4CQ9A 1V3MA 4JX4A 2WM1A 2W79A 4LS0A 3EOLA 2GJXB 1G5AA 3VD4A 4Z2HA 4H8NA 3S6TA 1XYAA 2IS7A 3A4JA 2D73A 4FF7A 4ERGA 3CXOA 2PZ0A 3QZ6A 2FZ9A 1UWTA 4E2OA 2WB5A 2OB3A 4WJXA 4DO7A 4QEEA 3UPMA 4DAFA 2PUZA 4BI5A 4AISA 4L4MA 1FWBC 3AHTA 2FHFA 4O19A 3VILA 1HGYA 2P10A 4NZ4A 2JF6A 3BG5A 3DIPA 4FB7A 3EWXA 4Z2KA 3REQB 3GIPA 2GJXA 2GK1A 1T5AA 2YDQA 4LYPA 4PTXA 3SRKA 5T91A 4S3JA 2QJNA 4A29A 4GFIA 3W73A 4JN6A 2NVAA 3T1GA 3OEXA 4DWSC 5LIWX 2VZSA 4CCEA 3LN3A 4B5VA 3KCOA 2VCAA 1KXQA 5CJNA 1OK4A 4YYCA 2D20A 1XLMA 5BMXA 3SCTA 1AMKA 4G5DA 2OR2A 1OVDA 1JCLA 1TZ7A 1XLEA 1GZJA 3THUA 1S3TC 5D30A 2J7DA 3WDPP 1MW3A 2TODA 3A5FA 2GQAA 5F1VA 3T7VA 2WJZA 1W3KA 1DJQA 1KXVA 3H6OA 1A5AA 2V6AA 3M0IA 2O0TA 4H9ZA 4YIWA 3NXLA 5DCDA 4DO6A 5FESA 3QC3A 1OF6A 5D2VA 2QLYA 4UTHA 3UYIA 2Y4SA 4U33A 3M9YA 3WK1A 1MZHA 3GVVA 1MXDA 3LEPA 1ECQA 4FNRA 4IUOA 5LHFA 4Z42C 3N34A 1L2UA 2GDVA 1K6AA 5BXPA 4L1WA 1SO6A 1XLFA 3ABOA 1BYAA 1UJPA 2VQTA 3UETA 4GD0A 1AQFA 3UP8A 3H54A 3R8GA 1Q8JA 1EJSC 4JKLA 3NGJA 2Q02A 2CLFA 3K8KA 3C6CA 1RHCA 4AZ7A 2XVPA 3WNMA 4LF2A 2QHAA 5LZLA 2AAAA 1XIBA 3GTFA 5AHEA 3MKCA 2CZ5A 4CVUA 1EX5A 4LUSB 5A6MA 2J7HA 4QP0A 2VFGA 1I45A 4ZSTA 4D8LA 1R7OA 4CLMA 4L4LA 1VFOA 3FYYA 4C7DA 2DSVA 1L6YA 1VCVA 1DJHA 1PCWA 1F7BA 4PA8A 3AXMA 3W2NA 1XPYA 2P76A 3EKGA 2ISWA 3EWBX 1DTNA 2QPUA 3T6CA 4LC6A 2VYOA 2CW6A 1YDOA 3BL3A 4HA1A 3LERA 1YBQB 2XSXA 2OZ0A 3TH6A 1NEYA 2XTKA 4AVOA 1ZTVA 4EPDC 1W1B1 4AZIA 4JCMA 4XD3A 5A2BA 3PWAA 3Q45A 2BGNE 1XD0A 1JI2A 2WZIA 4D6HA 1XIGA 2C1IA 4Y8EA 2C16A 1XXXA 3VNMA 2G5WA 4DJEC 2V5DA 1M65A 3V18A 3V75A 4AMAA 2DZPA 4YTRA 3S9YA 4LS2A 2NV2A 1ZBWA 2BVWA 4XISA 4OECA 3BSGA 2J13A 1CXIA 1PWMA 4GO8A 3F7JA 4WSHA 1UOZA 2WJEA 3OQ8A 3EWYA 1OEPA 3M0MA 2WCGA 2HPIA 3EX3A 1FWFC 1MFUA 1ITQA 3BOXA 3RO6A 3VMOA 4PTVA 1IHIA 1PWLA 1K70A 1Q6RA 2H9AA 3CHFA 2ZVIA 2ZZ2A 4IFOA 3WMCA 2DT1A 4REQA 2YBUA 5AC5A 3CEUA 1FWEC 3AYVA 4MY8A 1SVDA 3UXAA 1LT7A 1HKVA 3WDQA 4CVWA 4M3PA 1XIEA 3SR7A 1F07A 2G4JA 2Y2WA 3KHJA 3M64A 3FGCA 4ZE5A 4XTIA 3P5ZA 1XBZA 3LPFA 1KA9F 1E6PA 4QE1A 3HG2A 1UBPC 3G1FA 4P8XA 2ZWZA 2UBPC 2PBGA 2HROA 3EB4A 3E2QA 4RNHA 1HQTA 4PMOA 3QRHA 4C6OA 1UC5A 3IV8A 3B4UA 2PSNA 3VZXA 3ITLA 1W1PA 1QHPA 2Y89A 1QO2A 2INEA 3O6CA 1E0UA 3MSRA 3GE7A 3A6OA 2O9OA 1PIIA 3QBUA 3VUPA 1OFPA 2XFYA 4PL1A 1Y5XA 4JQ2A 3F5JA 3M46A 2ZX7A 3PSVA 1EBHA 1FKXA 3PY2A 4R27A 2Y85A 1POJA 4XO7A 3FA4A 4EXAA 1OADA 3THQA 3AYSA 4XSMA 1IXNA 1FKWA 3T2PA 3EA2A 2CXEA 1TE1A 3PZMA 4DM2A 3QW4B 4C6IA 4PBFA 4M29A 4Q4KA 3IUHA 5D9MA 4C7FA 4YCOA 1S2TA 1ISZA 5DY2A 3EKLA 2FB3A 1NDZA 4J3ZA 2V2DA 1Z42A 3PPFA 1G1YA 3CUFA 1TB3A 2CXGA 4HOZA 3TW7A 2O9RA 3VX0A 3VNZA 3M0VA 1RPXA 1FWRA 3L4WA 3HM7A 4TV6A 1QHOA 4OBTA 1EP1A 1M68A 4FS9A 4ZODA 1WZMA 3H2MA 4UTKA 2NSXA 4JIRA 4ZQMA 5JUVA 1VBHA 4GQQA 3LDVA 3GFZA 2W67A 4JNMA 4H7VA 2A0NA 1P6BA 4L9XA 1TZZA 3V4BA 1P5BA 3DC0A 4J2MA 3TKFA 2WW5A 1VEOA 3LXAA 2A3AA 2HZGA 2WSKA 4WXZA 3LGEA 5F4XA 4MPKA 2F7FA 2BWGA 9XIAA 1PJ9A 1NOWA 4I9JA 4PTDA 4GJJA 3DI0A 1AMYA 1XX1A 4E8CA 1RD6A 3N04A 3W7EA 4KKXA 4MFEA 2W0UA 1UP2A 3ZR5A 4DNHA 1TVLA 3SURA 1QI0A 2YCEA 4AIUA 4A21A 2DZWA 3A3XA 4AMCA 3NVDA 4WY0F 4ZTYA 1TJPA 1O68A 2OSYA 3EX1A 2I9UA 2QIIA 1UASA 4BR1A 4WDWA 4M6PA 2QUVA 1UZ1A 3AAMA 3CWNA 1FWAC 1DP0A 3I6TA 4RJEA 4ATLA 3PAOA 4KWVA 4D1IA 3D3FA 4LUIA 4C6MA 2RDUA 2XUCA 3M1ZA 1PTDA 4IP4A 4HBKA 4Q4PA 4AF0B 4HTYA 5LNUA 3VKKA 2BVDA 2NLIA 5D9OA 3KE0A 4MNLA 3LCHA 4TOQA 3DBNA 4TMBA 2GGHA 4LCSA 4AIOA 3LM3A 4F0RA 1DL3A 3UXIA 1KKOA 2D2GA 4L7ZA 5BZAA 3CMFA 1TTJA 3HPFA 2IPJA 4XV0A 2DPEA 4XB3A 2Y7DA 4NAFB 3ZXWA 3VCRA 2ISVA 1UWIA 3OO2A 3DBPA 2C19A 1UWUA 4A3RA 4UOJA 3NPWA 4Q8VA 4QTGA 2XVGA 3VA8A 2CLEA 4DLMA 3PN8A 1M41A 2QCHA 3FYOA 2BGQA 4S3FA 3GAYA 1AW1A 1PBGA 4V1XA 2C1GA 3HV9A 2Y61A 4QISA 1JZ2A 1HN1A 1V03A 1M6JA 4EVZA 4NAEA 2PP3A 2MNRA 2QAPA 2B31A 5EFDA 3UZWA 3OGRA 5I7GA 4B16A 1XLGA 6REQA 1CGWA 3MC5A 4ONVA 5HMSA 1KR1A 2NUYA 5DLCA 4MZ8A 4QLKA 3WUGA 4EPEC 5AHNA 4ES4A 1IF2A 2WLYA 1IIGA 1UWAA 3GNDA 4OTKA 3M5YA 3F4NA 4N7QA 3PF3A 4FF5A 3RLHA 2BNJA 4O14A 3THDA 3BUVA 3GC4A 4HSHA 4AY8A 1Y5VA 1J18A 2ZA2A 3AI0A 3M0LA 4GQBA 1XBYA 5CZTA 3W3OA 3GH4A 2HXUA 4IJBA 5G4EA 5HJXA 1TELA 3GAKA 3LQGA 3TFCA 1Q45A 3B06A 4DYEA 2YCLA 1MYRA 4EIVA 1E6QM 3IK4A 2J4GA 1XKYA 4GUFA 4JYEA 1XRVA 3TTYA 2B4GA 4PBGA 3DZ1A 5AVHA 5CKSA 1UWSA 2AL1A 1X6LA 1OFRA 3SFKA 4JY9A 4INFA 4JN8A 3BQ5A 5HUOA 5T8GA 2NT0A 1EDGA 4WX2A 1I75A 3F5KA 4QITA 2VRQA 4GX9A 3PZOA 3R8HA 2VRJA 1JQVA 3FA3A 4YVPA 2W6RA 4PRWA 2YW4A 3W1PA 4K39A 4NJGA 4GVFA 4PMVA 3D6NA 4N4QA 4B3KA 1V6VA 1E9ZB 3HG3A 5HULA 3UZYA 2ON3A 3IIVA 1PZ3A 4RZ5A 1QNPA 2VL4A 3GC2A 2E09A 2YLLA 3Q2DA 1S39A 2J6VA 4ZO7A 5ENLA 2PC4A 2Y8UA 3UJFA 2YDAA 1W31A 3AIQA 3LV6A 4LC8A 4HZ7A 2PFHA 3M5ZA 4HU0A 1KCKA 2CLHA 4IIHA 3VGBA 3AS0A 4EF9A 3K8MA 3UERA 2GSJA 1POKA 3NR0A 3CHVA 1RV8A 3CV2A 5AECA 1VFTA 3NQAA 4JY8A 1ICQA 3IJQA 3M5XA 3GG0A 3SJNA 3NXFA 2ZA1A 2PGRA 2JK2A 3TW9A 3S5SA 4XZWA 5D09A 2Q8ZA 1XYFA 1ZHAA 5A95A 5XINA 5AVNA 1R2TA 1ELSA 3R5EA 1Y7VA 3LHUA 2E77A 1C7TA 3C86A 3TTSA 4DWSB 4NNAA 3IIZA 3BLEA 1W9PA 2P50A 4OJYA 3SUSA 4GKTA 5FCZA 3BSMA 5J8LA 3T42A 3VPLA 3WZ0E 1JQXA 2J77A 4Z2LA 3RU6A 4OGZA 4D1JA 4UTMA 3SRHA 5I5RA 1DWIM 4GGHA 3V5OA 4E0CA 1GOQA 2OCZA 1W3JA 2VURA 3GQYA 1CDGA 1AH4A 2YA2A 2FTYA 3WJXA 2OYLA 7ODCA 4CCZA 1HJQA 3KZPA 4IGSA 4IGMA 3M43A 3SY8A 4LRTA 4JS3A 2Y5JA 3L5AA 2P1FA 3IS4A 5G1MA 5I06A 2INZA 1EL3A 1NFGA 5D8WA 1SO5A 4XVEA 1JI1A 2R94A 3OIHA 2ZTKA 3FOKA 4ZOEA 2R9RA 2QJMA 1DJNA 3MSYA 4LY8A 2FTPA 2RGMA 3WMSA 5T26A 3UW6A 1ZJBA 1A5UA 1MQQA 4O4VA 3WF4A 1UIOA 4G1KA 1S5VA 1LOLA 4JTHA 2YGYA 2E28A 4ADSA 4V2XA 3BVJA 4WQ6A 2XWDA 2P3ZA 4YU1A 4GY0A 3LPOA 2GWNA 5C9ZA 4M24A 3SGGA 3RLVA 3RGTA 4JIEA 4IMFA 4E3VA 2OX1A 3V7PA 2OQLA 3PBMA 4NKCA 1VBGA 1W17A 3N9KA 3LU2A 1SZEA 3WLNA 2ZUSA 2G3MA 3NDZA 2H3BA 3O1NA 3AISA 3NZRA 4IMCA 1TA3B 1V77A 3I10A 2PF8A 1R2SA 1DQWA 5C0QA 2WNZA 3EEGA 5KZ6A 2W66A 4Y9OA 3SSZA 4F66A 4W85A 3EX6A 2X1SA 2WV8A 5DO8A 1UH2A 4AX7A 1VBUA 1UZHA 4O57A 1FHVA 3NDYA 1BTMA 5E0KA 3SAZA 3KTCA 3L4TA 3C0SA 2EG8A 2H8XA 3BAYA 4WOZA 5ABEA 4NYYA 5E93A 4C6CA 1UA3A 2PDGA 4A8NA 4DLFA 3UNDA 1W3IA 5F2GA 1HJWA 4BFAA 2NQZA 1TJRA 4AZ5A 5HR6A 3TQVA 1NWSA 3S2JA 1OQFA 4KF1A 3TJ4A 1AQHA 3DYMA 3AZRA 4GQGA 4GCAA 4XZIA 4NRRA 1FHLA 3NQCA 3LRLA 4NNCA 1JDEA 4ATDA 2WZHA 3GFYA 3VZYA 3MQTA 3EXTA 3OBKA 5EA9A 4JN7A 1IR2A 1AA1B 4RE3A 4HK7A 3BLFA 5CQ1A 3HZ3A 1IXOA 3NQGA 3GTXA 2E8YA 3CEPA 3B0YA 2CWNA 2VT0A 4N6FA 4HVXA 2RDWA 5AN7A 2UV8G 4TMCA 4PMJA 1EGZA 1EJXC 4H6KA 3UWYA 2SFPA 1HJSA 1XFBA 3NYDA 4AH7A 2GVYA 1QUMA 1ZFJA 2DORA 1DWFM 2Z26A 3W22A 3ZYZA 2EGZA 3KAOA 2PD5A 4IQJA 4R9XA 1DIEA 5DRIA 1CI1A 1VEPA 4DY1A 2ZX5A 3P60A 1JYWA 4MOZA 3FGCB 1KLZA 3HG4A 3W87A 3CB8A 1G01A 1IV8A 1LRQA 8RUCA 1FCUA 2EPNA 1W5PA 3VD9A 1NOFA 2V2CA 1DWHM 4AWUA 1W0MA 5TAOA 1EWDA 7REQA 4O52A 3G3MA 3GB6A 3EOUA 2VNCA 1R46A 2QVNA 4CNUA 1TFVA 1ZBKA 3W7HA 4RXGA 3FAXA 5D05A 3POHA 1D3HA 4PUDA 5AYIA 3QH2A 2X42A 3TLLA 1P0BA 3PG8A 3DDMA 2V3DA 2YXXA 3SECA 3WEMA 1VPYA 3W23A 4N2YA 4LFYA 1J0HA 1R3TA 3U48A 2CHNA 4GPNA 4WRHA 2WM0A 3W25A 1O1ZA 1JUBA 1KTBA 5FAGA 4ZOAA 3WENA 4RDYA 1QWKA 4PCTA 2Z7KA 4HNUA 1W32A 4Q4SA 5G2IA 4U28A 1JGMA 3AJXA 3RG6A 2FJKA 1ZPTA 4JIPA 4BK9A 1KFKA 2ZE3A 3GSMA 1V6WA 3SIMA 2IQ0A 1T0OA 4A2RA 1A3XA 4GYJA 2VUNA 4K68A 5BW6A 3P0XA 4S3KA 2BS9A 4I9TA 5LNVA 3U3HA 1LQ0A 4LQ1A 4GXMA 3I3BA 1A3WA 2ZDRA 1RCQA 3TAKA 1C90A 4QNEA 4ADUA 1F3TA 1LRTA 1J0YA 2NUXA 3LRMA 4JTIA 4F4RA 4B5NA 4GLEA 5HWJA 1TX2A 4X9SA 1XL9A 3UZ5A 5LKYA 1KW1A 1PV8A 4LYRA 2E6DA 1MRQA 3THAA 3BC9A 1CYGA 2XGBA 4FX8A 1I2PA 2XVNA 3LCXA 1SZFA 3OW1A 2XGZA 4KRTA 1Q66A 1W1A1 3QC0A 5IHRA 1VC4A 3OLGA 4U2YA 3PPCA 4LV4A 4HNVA 3WD3A 3T2QA 2OEJA 3FS2A 3FJ4A 2XYLA 4QHRA 1Z8AA 2D2HA 2GVGA 1DIKA 4I3GA 4MLJA 2BHYA 5AHMA 4RNJA 4IPNB 5FJIA 4RPPA 4R85A 1QPNA 4D71A 3QW3A 2ASHA 3EA3A 4O18A 2OOGA 1XG3A 4PUMA 4LNCA 5C71A 3F4CA 2Y5SA 3NL6A 2CIPA 1FTXA 5A6BD 3P8JA 1FCVA 4U2ZA 5HNTA 1DE5A 1EUNA 5KEZA 1HL9A 4J1OA 5A6SA 3VABA 3U2CA 4NAFA 2EQDA 3FDGA 4TQTA 1ZNNA 1F3WA 1MWOA 2J9XA 2ZRYA 1H7XA 1UYQA 5M03A 3JZEA 4B15A 3N9SA 2PDWA 3CIXA 1S5NA 4ZEPA 4UQEA 4QDPA 1JDAA 4JTKA 2WXDM 2CEQA 1QCWA 2DW6A 3DG6A 3KOYA 2GGGA 5CLWA 4ZO8A 1W2VA 4V33A 3QXBA 4IH3A 4MFDA 3NQEA 4J2PA 4JTEA 3OTRA 3AWNA 3KBNA 3RCYA 1M5WA 2PCEA 1VLWA 3GHRA 3HU7A 2AQOA 2CZFA 4GI4A 2QW5A 5I3HA 2XSAA 3CWHA 4PEEA 1BEUA 2DVXA 4GI6A 1U5JA 5A8QA 2VFEA 1CB2A 1Y5WA 4KWSA 1RQBA 3RM9A 1JZ4A 4P7QA 2YXGA 4L5ZA 2E5BA 3RR1A 1PE1A 1R2RA 3WK3A 3ARPA 3GYCA 2OEKA 4UB9A 2PURA 3LMYA 2KAUC 3DYPA 1XDLA 2QS8A 4DBWA 1NM9A 1M7XA 3OLEA 1WA3A 4GX8A 1OCQA 3DGRA 5KITA 3B8WA 1FWDC 3UGVA 3CH0A 1HT6A 1US3A 3DHPA 4N6EA 5J04A 1DHKA 4J3XA 3MI6A 3LNPA 3G1XA 3H22A 2JEPA 1A5SA 1IT0A 1O7AA 3EMQA 4IISA 4L1XA 2DGAA 3OGVA 3B97A 1J6OA 3VO0A 3A13A 3LI0A 2JKEA 4XTDA 2TSYA 3EGJA 1R30A 1JCTA 2DSUA 1JXJA 1PYFA 3ABRA 4Q8WA 4RDVA 4HPGA 4IX0A 3CAVA 3BGJA 3MSDA 3H2NA 3NPUA 5I0DA 4H2HA 2AKZA 1CXFA 3EPMA 3KL0A 3R6IA 3PM6A 4NAEB 1EDQA 4F0SA 1Q6CA 3LLXA 4M8UA 5J5RA 4QSHA 4O0ZA 4GMEA 2ZZ1A 4MVAA 4GZ7A 1QDSA 1DV7A 1LBFA 3SN1A 1J11A 5C54A 1XLHA 3GDTA 2CZVA 1AK5A 4IQEA 1OCBA 2IKHA 2XDFA 3AXIA 1KBIA 3W76A 4HIBA 1XIJA 1RK6A 3ITVA 3OHMB 3DFHA 1D3CA 3CAKA 4W86A 4D6IA 2IKIA 4HGXA 2OGJA 4DBEA 3NOEA 1WYIA 3CV6A 1PKLA 1BVNP 4H7CA 3B9DA 3QY7A 3T0BA 1V51A 2PDBA 3RF9A 3QY6A 3TTOA 2VX5A 4IQLA 4FALA 3SGZA 4H41A 2DFAA 4I6KA 4PE8A 2W9MA 3RUBL 3VNYA 4GY1A 1PZ0A 1OT2A 3OA3A 1FDYA 5IHSA 2R1NA 4PL2A 1K3UA 5IDZA 2ZXDA 1PTAA 3TTEA 1BF2A 1DXIA 1SUXA 1HX0A 1EFZA 1XIFA 1XRFA 1K8XA 1RBAA 1Y8BA 3E12A 5A8NA 2CNCA 4XX6A 1MZRA 1JD7A 3DN5A 2VR2A 4M51A 2HCVA 3W1MA 5AC4A 3W1QA 3KM8A 1ITUA 3W1RA 4F0HA 4IIFA 4PULA 4Z1AA 2XIIA 1TV2A 5DY3A 4RE0A 2VC9A 5K2ZA 4UWMA 4RE2A 1WKEA 3CJPA 4UMCA 4EACA 1KTNA 1PYMA 1SZRA 4JL1A 3TA9A 5D37A 2CU0A 1E9YB 2GZXA 2WJFA 4M56A 1FWWA 2A5HA 1FFRA 3UZZA 2YL5A 3WLSA 1CGVA 1K8ZA 1TCMA 4HA3A 5U7SA 3VOFA 1ZQ5A 1KBKA 1NOUA 3U4AA 4PTNA 4DRSA 1OJXA 2W62A 1A5KC 1EA9C 3URNA 1PXGA 3DKJA 1F76A 4L56A 2WC4A 3SJ3A 5XIAA 3BH4A 4BF7A 3OYZA 1EPVA 2VZTA 4CD4A 3C2YA 2AGTA 4XQ6A 3DFSA 1JNEA 1GWJA 3GXIA 3RO8A 1ME9A 5C55A 3KTXA 3SCPA 2YB4A 2GQ3A 5A6JA 1WDDA 1TIWA 2FZDA 1XBVA 4S3AA 3UGRA 3P0WA 1CW2A 1QNQA 4MUZA 2ZZ4A 4CD6A 5LXEA 4H9YA 4AHQA 4J3VA 3L4VA 3LMZA 1WE5A 4GGBA 4DJDA 3QR1A 1CT5A 3SI9A 3WF0A 3FW6A 2XVKA 3URQA 3GDRA 1ZLPA 9RUBA 1CPUA 4XBKA 1KLYA 4XKMA 3I7RA 2WCSA 3AIBA 4D6GA 3TEVA 3CYJA 2BY0A 5HINA 1PX4A 1Z32X 3AIEA 4J35A 2I14A 4QDMA 2Z2BA 3MANA 4IMDA 5FSEC 2QCDA 3UR7A 4UTUA 1HNYA 5I3DA 4DPQA 4R5EA 1O4UA 3NL5A 3E74A 3G8RA 5CGQA 4PMXA 1M7JA 4PUEA 1R9ZA 4DJED 2EKCA 4UMBA 3KDOA 1YTDA 3BO9A 4GE8A 5LNSA 1CCWB 2EHHA 1P4CA 1WOAA 2ZKMX 3AC0A 4HSNA 2G41A 2Y5EA 1JGIA 3ARSA 1XP3A 5LIXX 2J25A 3W7IA 3NYZA 4B91A 3UESA 1GNXA 1W3LA 1B4KA 2V5JA 3PB0A 4O17A 4I90A 2HS6A 2ZA3A 3WDRA 1F3EA 3DFYA 3V1PA 1I2NA 3RMJA 3IWPA 4G56A 1HKKA 3LLDA 3VIGA 2VR5A 3VVGA 3H26A 4JTRA 2PRHA 4AZCB 4Q6JA 4PZVA 3VDGA 2NX9A 3KBSA 3CHDA 3CMJA 3GWQA 3WBYA 3WL0A 1CLXA 1OYBA 5FF0A 1F3XA 4L9ZA 4OKDA 2QCMA 3SCVA 5A8PA 2YXOA 3PP7A 3HBLA 3L67A 4W7UA 1YNPA 1UQZA 3BPWA 4DEFA 4C6EA 3WH6A 1GVOA 4UFIA 1O12A 3EOSA 3U9IA 3ARYA 3TUUA 2NWSA 1VKFA 1LL4A 3NGFA 4LJ3A 4Y6GA 1ALDA 1S1RA 5C6MA 1ONXA 1V4YA 2POZA 3UR5A 4UUIA 4KFOA 1T96A 3KS6A 4MY1A 3LV5A 2GJPA 3QHMA 4YTUA 1S2UA 1AW2A 3T05A 1TR1A 2E1WA 3BCJA 3WQGA 1KGXA 1H7RA 4HNNA 1TQXA 8XIMA 1XYMA 3I68A 4ZL1A 1EGMA 3PZ9A 4FNSA 3WLPA 4IQDA 1O5RA 1CGXA 1KBJA 4GIAA 5EL1A 5DN1A 1QNOA 1LUCA 4GYPA 1JPKA 3CQHA 4XZNX 2ALRA 1NARA 2G3JA 3RFAA 4D6JA 5FF3A 3N4AA 4NT0A 3JW7A 2A7PA 1QHZA 2CLIA 4E8DA 5DCEA 2E1DA 3L4UA 3OG2A 1Q8AA 4MJ2A 4IHCA 2B7PA 1IZJA 3QZEA 3CUXA 4RZBA 5FSDC 3GVGA 4HPJA 4KERA 4HCDA 1MEWA 1QW7A 5HQMA 1JDFA 2OKTA 3B0VC 1KM3A 4K3ZA 4DJFA 4LX4A 3WL1A 1OGBA 4FNPA 1VYPX 4XD6A 4XAZA 3ZT7A 4KEZA 1C9WA 3B9NA 3UCCA 3GDKA 1F61A 4ERAA 1FH8A 2NVCA 4AAJA 2Y62A 3M4HA 5HNRA 3NQ7A 4ATWA 3P7YA 5C8BB 4HA0A 3W27A 3R25A 1BKSA 3WO8A 3ABQA 3MMWA 4F0LA 2PLMA 4DF2A 1ZP4A 3BURA 1UCWA 3KFTA 1NFBA 2XHYA 1N8IA 4NP7A 4MDOA 1S1PA 1DQUA 4KQNA 2WPBA 3LY0A 3VTRA 3OBEA 3QF0A 3K4AA 5E9AA 3SIZA 4LYKA 2RFGA 3JVAA 1IXQA 1UR2A 1HJXA 5F7UA 1BXBA 2TRSA 2VZVA 3BV7A 4LSBA 4AG0A 5I3KA 3ZSTA 1FUYA 3MA8A 1W8SA 2PDCA 3MU7A 1SW3A 3S4TA 4PMRA 1PAMA 3S42A 4E2VA 4AEFA 1WNOA 4I7VA 3K5XA 1X7IA 5LIYX 4G2DA 4JTJA 3BTNA 2CKSA 5GJMA 3NQ6A 3GH7A 3UWWA 1TA3A 2ADAA 4TX6A 3TK7A 1E4LA 1LJYA 3BCDA 4H01A 2VENA 2HV5A 2XZ7A 2CYGA 4HD5A 3P6LA 1WO2A 3WDHA 1FP8A 3SM0A 2NSOA 4GUIA 2A3CA 1OF8A 2CESA 3WQWA 2ATSA 4E4FA 1MDLA 3LHTA 5DMLA 1J0IA 5EMYA 3KOWA 1VBJA 1IZCA 5PTDA 4XAYA 3STPA 1GVFA 1XLJA 3L12A 3AXXA 4BWLC 1KBBA 2PDQA 2QULA 4EWND 2Z25A 4JHMA 2HBXA 1MXSA 2Q8XA 4ALDA 3GXDA 2QAFA 2VELA 3CWOX 2QXWA 3NEVA 5GNYA 3S46A 2O9PA 3S2LA 1FP9A 1GOOA 5B7ZA 1EF3A 1IWPA 3W75A 3URAA 1HF6A 1RZMA 1B4EA 3I3EA 3M0XA 1JPIA 4UIOA 2G96A 4J7RA 3O6DA 4W5UA 1C91A 2J6XA 4HU3A 3A4XA 2VQUA 2DIJA 3DC8A 5E0CA 5C9XA 2YCKX 4W9TA 1LL7A 3U2OA 4EE9A 1XUUA 2QF8A 4X60A 1GEQA 4X0NA 1F8IA 5CBBA 1OGGA 1SO4A 2DSWA 3LTYA 4O1FA 5MHBA 3R13A 3GO2A 5ABTA 5DMNA 3R0UA 3CO8A 3RXZA 1Z69A 1PHWA 3MUZ1 2OU4A 3NQ2A 3MDUA 4JCLA 2ZUVA 2EPHA 3VXGA 3AMCA 4NY2A 2WJDA 4LOCA 1OY0A 3K8LA 1DWJM 2V68A 5AYXA 2FDSA 3W7JA 4ZB5A 3AMLA 1MW2A 5HJLA 3TQ0A 1XICA 2ZWYA 1WDWA 2IPFA 2WBKA 2A2IA 1Q5MA 2BODX 5FOOA 3QGAC 1OSEA 2R91A 3GFXA 1XYLA 1K4HA 2PDNA 3T0TA 3LX9A 3EWWA 2VEMA 1XF0A 3UG3A 2B7NA 1R3SA 3HFTA 1V02E 4LVAA 4RDZA 1B3ZA 4C6PA 2CLPA 3BLLA 3PZQA 3VDAA 5BU9A 4AD2A 4X0VA 5CGMA 3RU8X 3MCMA 3DX5A 4CD5A 4RW5A 1EZWA 1AW5A 3O16A 3KHDA 3PTQA 3QMTA 3B8IA 2HXTA 5E6ZA 3M44A 1LQAA 3W86A 1LDCA 4Y90A 4NHVA 7ENLA 1W9BM 4A8IA 4P2VA 3MWCA 1UKSA 4ROQA 3PTMA 3BAKA 4GNKB 1SW7A 2RAGA 3ZLFA 2Z2UA 4GZEA 3VC6A 3W2LA 4Q8PA 3EDKA 5A8GA 4UR7A 3E1F1 4M80A 4MWAC 2OSXA 3WCZA 3AZSA 4FP1A 4IT1A 3GKAA 2ZXAA 4S3EA 1VFFA 4IUGA 2ODOA 3B8VA 2XN2A 1FWIC 4PMUA 1V02A 2DW7A 3CT2A 4K37A 3BQ6A 4IIBA 4W84A 3MMDA 5HDRA 2J79A 3S5YA 2ISFA 5B80A 2XG9A 2JE8A 1V6YA 4RZ6A 3N18A 3W7LA 4UTLA 4FMVA 4TUFA 1EJWC 4FNQA 4DBUA 3DESA 2XIOA 2CBJA 3VGGA 4OWGA 4ICMA 2FHCA 1UKOA 2QF7A 3IANA 1L8PA 3D0CA 2I57A 4OOUA 1OZMA 3WJSA 3W2JA 2VC6A 5FEZA 4MADA 4ZMGA 2PGEA 4RW3A 2OKOA 1GTEA 2I1OA 2PDXA 4C1KA 4DO5A 2V3GA 4O4WA 2ZFAA 4YVVA 1XISA 1Q3NA 1V8EA 2BFGA 3T4WA 1ZAIA 1VFLA 1V0MA 1RQHA 2X2YA 2E25A 1A50A 2HISA 4FHAA 3F03K 4C6KA 5G5IA 4B9ZA 4AWTA 2YOCA 3VGFA 4U5KA 2VD9A 3LG3A 3PZIA 4F0KA 3GW0A 3LI1A 1EEXA 1P0KA 3TQKA 2X41A 2GDQA 3C2RA 1SJAA 1XQLA 4D6DA 3FJNA 1QI3A 4I5RA 3KRZA 2G3FA 4Q7BA 4AXKA 2AQVA 3TYBA 1GJUA 1VR6A 4PUJA 3UY8A 4CD8A 1EH9A 4KEUA 3SUWA 1WZKA 4AZBA 5IM51 4X61A 3IGHX 1R47A 4O1AA 2J78A 4O28A 3RYSA 1KKRA 1WUFA 2NQHA 2CBIA 6CGTA 2DP3A 4K8GA 5G2WA 2CLOA 3KVKA 1XLIA 5KMYA 4EAMA 3APYA 3UR2A 4IICA 1LF1A 4MAVA 1YDVA 3G1RA 3ANYA 1OINA 2Q01A 3TOPA 3L0NA 4RDWA 3VOCA 1WXYA 3NWRA 1TPH1 4AVNA 1JF5A 1UA7A 1XYBA 3V36A 4QAIA 4DIAA 1O5KA 3VFLA 3BG3A 4AXNA 4B3ZA 2RDXA 2YJQA 4NXKA 5A6LA 3W29A 3D3AA 1A5OC 1E72M 3ONBA 3FFSA 4AY1A 2GGEA 5D2TA 5M3WA 4JQAA 5D9PA 2EG7A 3OHIA 2VEIA 2WHLA 4EPBC 5AYYA 3SCSA 4A3QA 1E40A 2ZDSA 4AB4A 2ZRVA 3FK4A 2OLSA 2FHBA 5DELA 3O05A 1QFEA 2ACUA 1CTNA 1XKJA 4TO8A 5I23A 2DT0A 2CERA 3TW6A 3CUIA 3F5LA 5JIWA 2B81A 4LY4A 4BQ3A 4DUOA 2YL8A 4LUYA 4DWSD 2FZ8A 2FTWA 4GBDA 1US2A 2WQDA 2DH2A 1GHSA 3GU9A 3M0KA 4Z0JA 4MGGA 3Q58A 3P93A 4O0QA 2DUXA 3S3GA 3VIKA 4M6VA 4XUYA 4MYXA 1W56A 1JG9A 3ME3A 4M6UA 2Z1VA 3GS6A 4DXVA 4X2RA 3ITOA 1QR7A 3IV3A 2V2HA 3PUGA 1NU5A 2QDEA 1EYWA 3RX2A 1RY0A 2WKGA 4B5WA 3WBWA 3LBOA 1K9TA 2BZNA 1GOXA 4HKPA 2X0HA 1EGVA 2FJUB 1X38A 2V30A 2W61A 4RV3A 3LCIA 3BANA 4US5D 3XINA 1X96A 1GONA 5DT7A 4C5YA 3GG1A 2WK2A 3WX7A 1R8LA 2OO0A 1W3TA 1E71M 1LTDA 4LF1A 3WQ5A 3AIUA 5DBTA 4B5SA 3AHVA 3B04A 3EEZA 5KZDA 4F0MA 3BLOA 3K4WA 3GR7A 1TVNA 2JQXA 1E4IA 2P0OA 4KCVA 1WKDA 2OT0A 2YFOA 4FOJA 1J96A 5LYRA 1ZJAA 3BZGA 4UCFA 3GUWA 3T0DA 3GR8A 2WKLA 3QMSA 3KW3A 3AROA 2W63A 1EXPA 1UKTA 1X6NA 2HBVA 3IJ6A 4K38A 3C2OA 1ZRQA 1E55A 2C14A 4N4PA 2CHOA 4GIRA 5CBIA 4PMQA 3CQIA 1VPQA 4HJFA 1CXKA 1FHUA 4PCSA 1B3OA 5FL0A 3KCLA 2VEPA 1RQEA 2PODA 2OLAA 3RAOA 5AOUA 3WEZA 3OVQA 4A2SA 4ZB2A 3VIJA 2ZC8A 3RR4A 3AALA 4DNMA 2PU0A 1GVIA 1BGGA 1AQ0A 2A6NA 2TAAA 4I7WA 4CQ8A 3VIFA 1KM2A 1V79A 4E5TA 3HN3A 3S8HA 4CQAA 2YKKA 5C2CA 4PB3A 5C9WA 5AC8A 2FGZA 1IT7A 1E1CB 3CMGA 1KM1A 4O54A 3ITGA 3WQDA 3DFOA 3MMTA 3N9RA 3B0XA 4Y2WA 1OWQA 1QASA 1TV5A 3ZO9A 2FFIA 1TX0A 3B05A 3USZA 4KCTA 3UA4A 2QCNA 1NJJA 3PZUA 4DAIA 2BOGX 3ECQA 3S6DA 2FZNA 5LSMA 4FLRA 1HL2A 3O3RA 3CL8A 4HZMA 2Z0IA 4J4KA 1W6TA 4KRZA 5JBDA 4UTWC 4D2JA 3DFQA 3QV7A 2QVHA 1EHAA 1M1BA 1LP6A 5CGTA 1M04A 2PDUA 1E70M 3CGTA 5C2XA 3R7MA 1LZOA 4O16A 1ML1A 3NO3A 3R0KA 2C71A 1B9BA 3FV9A 1KO0A 3W7CA 4R53A 4C6NA 4WJ8A 1QPQA 3ZJ8A 5ABHA 4IJCA 4HMDA 3T81A 2WZEA 1SMDA 3LBCA 4Y96A 3TLQA 3M16A 2AL2B 4AZGA 3WBXA 3TOYA 5AFDA 4AFYA 2CPUA 4C6FA 4ZVJA 4WHBA 4RR4A 2V5BA 3H4WA 1QT1A 4GC3A 2WZMA 3SCNA 2PGFA 1RA5A 1V3LA 2OQYA 4REQB 4UMAA 2GWGA 3ZWSA 1XI3A 1FWJC 2GFTA 2FVMA 2VMFA 1XUZA 1GVSA 1NH6A 5I3FA 4UZUA 2HMCA 2OO6A 4PODA 3GXFA 3NQFA 1EEPA 4B9YA 1BVWA 3W71A 3WQVA 1TUXA 1HZYA 3V0SA 1GW1A 2RKXA 2GUBA 2O7SA 2CHRA 2VX7A 3DEQA 1ZUAX 1IWAA 2QMJA 5M17A 3PJUA 1RCXB 3NDOA 3CB3A 4H19A 2V3FA 4DF1A 3MB9A 1ZU8A 1L6FA 2QUTA 2OELA 2Q09A 1GYLA 3COTA 1O5QA 4JFWA 3WQ6A 1A5LC 2ZXBA 4LANA 1TYGA 2XZ9A 3WG6A 2NQLA 3WBAA 1BWKA 4WKFA 4DYKA 3EWDA 3NQDA 1UW9A 3TAOA 4B4FA 5DANA 4GZJA 1NSJA 2CLLA 1UR0A 3Q67A 4EKJA 1ADOA 3TN5A 3CUGA 4L61A 1F2JA 1XYCA 4IXXA 3H4XA 5BWFA 4BF5A 4JZ5A 3VKAA 3FJLA 4GXWA 2JEQA 2Z1XA 3H24A 3QLDA 2ZIDA 1AH3A 3RLGA 3B0PA 3C3UA 3V1HA 3N12A 4XIMA 4J5NA 3S1GA 2CZDA 3A5VA 1YXCA 4HNTA 3LHZA 3ZLGA 3FLUA 1UJQA 1JD9A 2Y24A 1SYTA 4FXRA 4AUBA 3WLKX 4XZ9A 1QK2A 3NZQA 3PZTA 4O1CA 2DZTA 3TROA 1QAPA 1JJKA 1GVEA 4CD7A 1MNSA 5FEWA 1RD5A 4M7TA 1PKMA 4AIBA 1LL6A 3PBUA 1AG1O 3LRKA 2OTDA 3I4EA 3H21A 6A3HA 3UG8A 3WNKA 4K8EA 3KX6A 3MUY1 3H2AA 1KV8A 1YPFA 3TYCA 1TJ2A 1ZZMA 3HPSA 4L64A 2DIEA 5A1AA 3CL7A 2A85A 3PNZA 3W38A 1OFBA 2PPGA 1FRBA 2PGWA 1RLCL 3PHAA 1EKOA 2DV0A 1QK0A 3PJXA 3VCNA 1F05A 2BVTA 1NIUA 3N3TA 3DOPA 2WYSA 5G4WA 4LU0A 1UP0A 2PWDA 4XK2A 5DF0A 1FWSA 2YBTA 4HTBA 4XD4A 4AIEA 1W9XA 1JAKA 5A8MA 2F38A 1T99A 3CM4A 4BI7A 1XIHA 2PDPA 4LT9A 3G0SA 4JX6A 5H8MA 4FAMA 1AJ0A 4XZLX 1THFD 1UG6A 3L0KA 5BOEA 3NQ8A 1SFSA 2NWRA 1BRLA 3SCUA 5FJJA 3O07A 1UKPA 5A2AA 2E7FA 2WOQA 4FX6M 4DBSA 1GQLA 5GPRA 4JNZA 3G77A 4IMEA 3H23A 3W53A 2X1TA 4Q32A 4KCWA 4UTJA 4DPPA 5FKYA 1IEIA 4ZXLA 2YIHA 2YZ5A 3PB2A 3GNOA 4H8HA 3TIMA 3E2SA 4ACZB 4F48A 3KXQA 4L6HA 1J4EA 1D8CA 1ESWA 2DZAA 4AY7A 3CZ8A 1EDTA 2R24A 3L4ZA 4FOKA 3AMKA 1PKNA 1B3VA 1T6MA 1QJWA 1BD0A 3UCDA 4YHEA 6XIAA 1FVPA 3RPTA 4MJ4A 3BAIA 3NJ3A 3GLCA 1O6IA 3SGUA 1KM0A 1K77A 2WQPA 1AD1A 4FPSA 3HGSA 4R7WA 2DVUA 3BXWA 2BMBA 4NUWA 3P82A 4NU7A 3BAXA 5CSUA 2GDUA 1HKJA 4US5A 4M19A 1R3RA 4A3HA 3UVIA 2WBGA 4N9DA 4W4QA 2PWHA 2WCAA 3GTIA 5SWUA 1YBQA 2VDHA 2DU2A 1VCFA 4WGXA 4AWEA 5CC6A 1N82A 5DMMA 1RUSA 3D5HA 3C0JA 1AQMA 3GTNA 3KDNA 3ZS4A 2PRLA 3N2BA 1G4TA 4HN4A 3LTSA 4MWAE 2BB0A 4EF8A 4Q7NA 2Q71A 4GNJA 4YWSA 1EO5A 2PDKA 1WDSA 1ZP3A 1Z44A 4HCHA 2F6XA 3W7NA 3SSJA 4FIQA 3WNPA 2HTMA 2BGSA 2Y6ZA 2Y70A 3QJAA 3R43A 4W88A 2NV9A 2ZX8A 3V16A 2JIEA 3EXRA 3GIQA 3AQUA 3VM7A 3VM5A 5REQA 1LLZA 3R79A 4S1FA 3MKKA 4PSPA 3BLDA 3ATYA 2WMHA 4ZTXA 1NQKA 1C8VA 2FZMA 3TCSA 2IXUA 1RR2A 2A1YA 4UQDA 4WDTA 7PTDA 4B4HA 2CCRA 3NUKA 1K4GA 3C0QA 2BY1A 3S2CA 3LGDA 4B5TA 4NQ1A 1XIMA 3GU2A 4Z17A 1F9CA 3L5LA 5I3IA 3QQ1A 5D2XA 1JZ3A 4QJ5B 1Z3NA 1ADSA 3H70A 4Z1CA 4CEXC 4BZYA 4LEFA 4UFLA 4KH2A 4D72A 2E68A 1E4MM 2DEPA 2EKGA 1B30A 3Q65A 3ARXA 3ALFA 1KWKA 1K7EA 1VYSX 1XLLA 3TYUA 4BI6A 2D69A 2WSYA 2E5DA 2QKFA 1L9WA 3PULA 3B8TA 3PUOA 3GBDA 4DHGA 1J5SA 1TRDA 3II1A 4RZ4A 1PX3A 4QX4A 2YA1A 5I03A 2WZTA 4IOTA 4PC8A 1J2BA 4G7EB 3QOKA 4H9VA 1SO3A 3KVLA 1I4NA 4O0KA 4P7NA 3PWIA 4N9BA 5CCZA 4HMNA 1VRDA 2PTZA 4DQWA 1XD1A 5KZEA 2R1KA 2WSQA 2DZBA 2DJXA 4FX7A 4G7FA 1NF7A 3QY8A 1G6CA 1UOKA 1GK8A 3RNDA 3KS5A 1RJQA 3M0HA 4R7JA 1RPKA 4RNIA 4CU6A 3L5MA 5LIUX 3P62A 1U1HA 1IE7C 3B8UA 3CIWA 1CECA 3DU0A 1RP8A 3GH5A 1H41A 1OFOA 1KCLA 1PS9A 3T2OA 3GHTA 1OCJA 3JS3A 4K36A 4O1BA 1E1EA 1E0VA 2VUYA 2WHMA 3B8DA 2ZX9A 4TU1A 5IFPA 2NXHA 4M81A 5JH1A 1R3YA 1M03A 4JD4A 4X22A 4GUJA 4TX9A 3P81A 4ZCWA 1ZGDA 1F6YA 4R7OA 4YHGA 1H4PA 5CJMA 5C5YA 5A6AA 1SSDA 1JZ5A 3PJTA 3VNJA 4H3DA 3TJIA 2XIQA 2XH7A 3GXPA 1YPIA 1NY1A 2CKRA 1UZ4A 3FXYA 3RHGA 4K6AA 5FJPA 4NJKA 3IRSA 1WBHA 5TIMA 3H7UA 1RBOB 3N3MA 3OVPA 1HVXA 1FY6A 1JPMA 3IVTA 3EAUA 3L2MA 4QS6A 2MANA 5FF7A 2J27A 3LLFA 1LG1A 3VIMA 4AD0A 1ZB5A 4UFHA 2C0AA 2OWWA 4H4IA 4C60A 2OSWA 3IGXA 1S3HA 2WHJA 4WJEA 2WMJA 4DZ5A 4JTTA 4Q4OA 5DXXA 1QMLA 1HO1A 3ZJ7A 2W92A 1JCXA 4B2DA 1KGUA 3E0VA 5GNZA 2DZSA 3F2DA 1VD6A 3JUGA 1G9HA 5EMKA 2VCBA 4GK8A 4W8LA 4OZOA 4WY0B 3U2ZA 4NJJA 2WMGA 4GG9A 1NQ6A 3GX9A 4ZSUA 1TV7A 1LLWA 2QPSA