5K3VA

Apo-pdx1.3 (arabidopsis)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
276
structure length
276
Chain Sequence
SPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGLGEAMVGINL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxal 5'-phosphate synthase subunit PDX1.3
publication title Structural definition of the lysine swing in Arabidopsis thaliana PDX1: Intermediate channeling facilitating vitamin B6 biosynthesis.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Biosynthetic protein
total genus 96
structure length 276
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2016-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5k3vA00
1U5JA 2QUUA 1LLWA 4QJ1A 2PURA 4HN4A 3W84A 3S8HA 4LVGA 1TPC1 4UTJA 3W88A 5D05A 5HWMA 2YCEA 1FCUA 3MJYA 1W54A 4DO5A 4A3UA 3UPBA 1KM0A 4NZJA 5LNRA 3THAA 1WDWA 1FDZA 4HPJA 4NJHA 7TIMA 3WJZA 3O1NA 3O15A 3LHTA 3P8JA 1BWLA 3C2RA 4Q32A 1TSIA 2RFGA 2ZTKA 1QO5A 3W2UA 4TIMA 3TAOA 5K2ZA 5DLCA 3P5ZA 5CSRA 4R53A 3P7YA 5I3JA 1M5WA 4UTIA 3MYOA 3T7VA 2B4GA 1Y0EA 3LGEA 1AL8A 4O0KA 2EF9A 3DAQA 1WOBA 4WZHA 4AAJA 3W7OA 3T78A 2VFFA 5KITA 2E6DA 3KVMA 1TTQA 5I3FA 4UTUA 4K6AA 4LS2A 4A21A 1TJRA 3S1VA 3R12A 4XWUA 2XFWA 4IJBA 2Y62A 3NDOA 1JCXA 3TSDA 4OGZA 4Y6GA 1VH7A 3S5ZA 3W7RA 3KXQA 2ZDRA 2Q3OA 5G1TA 3EXSA 1UCWA 4JTEA 3R2GA 5HULA 4JTJA 1F6PA 3KRUA 1ZY9A 3E12A 1OFDA 3PG9A 3IEBA 3GYEA 3PBUA 2X1UA 2GVLA 3LHVA 4PC8A 1JQXA 5ABTA 1KA9F 1ZENA 1X6UA 3HGSA 3MHGA 3FIGA 2JBMA 3NL6A 1K8XA 1WOAA 3LCXA 3MHUA 2V82A 1OABA 1A5CA 1OFRA 1O5KA 3O6DA 5CZTA 3S1XA 2QCGA 3NZRA 1JVNA 3BLIA 3Q37A 3MYPA 3PUOA 3LDVA 4Z1BA 3MI6A 3NGJA 3NVTA 3VI2A 4TR9A 4AHOA 1UBSA 3L67A 1C8VA 3LRLA 4O15A 4XKYB 1F73A 3QQ1A 4XUGA 1J5TA 3M16A 4XBKA 2ZZ4A 1W5MA 4WD0A 4LRSA 1PHWA 2BWGA 4ICNA 2A6NA 2OJPA 2GQAA 4FNRA 3ELFA 1K7XA 5CPMA 4NJJA 4I7WA 4EIVA 4OE7A 2A7RA 2FLIA 4WQ6A 3TQ0A 3GR8A 3LV6A 1JCYA 3EEGA 3QW4B 3DFQA 3LCFA 4IMEA 5DCDA 2TSYA 4JEQA 2FTPA 2GQ8A 5CG7A 3DU0A 2DP3A 3TIMA 1F2JA 4JDYA 3QF0A 4DQWA 2WV8A 2QAFA 3W2JA 4OV4A 2NXHA 1L6SA 4EF8A 3M41A 2V8ZA 5HQEA 1FCVA 5EL1A 3STFA 2Y85A 2A2IA 1DQWA 1Q6QA 4L4LA 3GDTA 3NL5A 1WBJA 3N2MA 2VFHA 3STEA 1EP1A 4YMZA 3N73A 1CX9A 3BV4A 1ICSA 3PY2A 1G69A 3SY5A 1LBMA 2DJXA 3B06A 3MW7A 1VPXA 1FCBA 4BFAA 1QR7A 3KRSA 3UWZA 1I2NA 1KV5A 2J88A 3LTPA 4UFLA 1F7BA 2AAMA 2QAPA 3TKFA 1OX4A 3O6YX 5HMSA 2QCEA 3HF3A 3A23A 3NM1A 2HS8A 3NAVA 5G5IA 4JXCA 1VC4A 3A5FA 4LRTA 3UY7A 3FFSA 3NQ6A 4WX2A 3TQVA 1HUVA 4O8RA 3W7JA 3A22A 2VEPA 1GTEA 3NPUA 3ABOA 1YTKA 1JRBA 1GTHA 3PSVA 1IIHA 5LSMA 2CLOA 4LW7A 4UFJA 5CGQA 1OX6A 5D02A 3VNDA 3LHUA 1TTJA 2WNZA 3L21A 1KFBA 3NZ1A 3PSWA 2Z6IA 3GAKA 2XN1A 2X1RA 2DZTA 2OZ0A 4IX2A 4DPPA 3KVKA 5H2ZA 4ZQMA 2ZTJA 5FEXA 3BVJA 3GKFA 3MWAA 4HNUA 1W1ZA 3C52A 3EWYA 2DZVA 3DFTA 4JN6A 2ISVA 4Q33A 3IVSA 4ADTA 2ATMA 5K9XA 3TX9A 1BKSA 4K36A 4AWSA 1FWTA 3S1UA 1EB3A 1ADOA 3TR2A 2CW6A 3UPWA 1RR2A 2PRMA 2PRHA 2V5LA 4QNEA 1LCOA 4GNJA 4A29A 2NUWA 1OK4A 3NQGA 4PL2A 5HNRA 1SO4A 3C2EA 2ABAA 1OFOA 1TPVA 2FPTA 2X1TA 2YSWA 4N4PA 4MZYA 1IXNA 3IIOA 1K8YA 1YTDA 1LORA 4UTKA 3F4NA 4UNLA 5C54A 4EWND 3GDMA 5FF3A 3P67A 1R2TA 4A22A 3CEUA 1W5PA 1SW0A 3EX1A 3W2KA 3HQ1A 2V2HA 2DZWA 4OQVA 3G8RA 3NQCA 1YXDA 2NUYA 1G4PA 2E6FA 3MUXA 3WK0A 1W31A 4DXVA 4Z1CA 2NLIA 2JKEA 4AF0B 4H6KA 5AC7A 1FWWA 2FIQA 3SECA 5H91A 2CLLA 3HG2A 2VEKA 4UFIA 2Z1BA 1IF2A 3DXIA 3LX9A 2NX3A 4MYXA 4UNKA 1JCMP 2QDHA 4CQ9A 1RQEA 4JD4A 4UFKA 2DJLA 3I7SA 4QM1A 4TO8A 3NPVA 4DO4A 1G67A 2CZFA 5G2HA 3L0KA 3W7NA 1IXOA 1VR6A 1FWRA 2QCFA 3W1XA 2VOMA 1K7EA 1ZAJA 4O0ZA 2Q3RA 3UXAA 5L9FA 4K8EA 3BW3A 2FQIA 2X1SA 1KLYA 1L6YA 2NWRA 4RZ4A 4FNSA 3SI9A 3KX6A 4NX0A 1ICQA 3GLCA 3RU6A 3A24A 4A2SA 5G4WA 4NNAA 1VQTA 4RV8A 3EWZA 1L9WA 1T0OA 3DFSA 5TQLA 3GXNA 3EX2A 3GX9A 4WUIA 4WY0A 1EEPA 1VYSX 4Z08A 4W9TA 3LXCA 1JUKA 3USBA 1LOQA 1QPQA 2DZPA 1B57A 2A85A 3ABRA 2WSYA 5D2VA 3MP5A 1GVRA 4RLIA 3QFEA 5C55A 1KFCA 2EGZA 5AC8A 5AFDA 3VE9A 3R8RA 1GVFA 2FFCA 4BR1A 4PTNA 4BWLC 3GVGA 3TROA 5KMYA 2X30A 1P0NA 4N6FA 4FHAA 4NXKA 3W71A 2E5CA 4N9CA 3WJSA 1B4KA 4E2BA 1Z42A 3UQNA 4BWLA 4JICA 3O06A 1ML1A 2RH9A 2OMAA 1TRIA 1DBTA 2VXNA 1W3TA 3CM4A 3W7CA 1DVJA 5AHEA 3DI1A 4CNOA 1H50A 2RDUA 4JTGA 4M6QA 2DU2A 4O14A 3HGJA 4M5PA 1SO5A 3W3OA 4UMBA 3LLFA 4X2RA 3TUUA 1CI1A 2FJKA 1RZMA 4HHPA 1XCFA 3W7DA 2VFEA 2J27A 3C2FA 4M19A 3U8GA 4HT3A 2ZRVA 2G97A 1A53A 1DQXA 3SJ3A 5D33A 4QQ3A 5D03A 1D3GA 4Z0SA 4QISA 4Z1AA 3S9YA 3C56A 5E93A 1W5NA 1P0KA 4ALDA 3W76A 4NJKA 2QJIA 1THFD 4OHQA 4C1LA 1TTPA 3WK2A 1HG3A 3QPZA 2QCMA 3TCEA 4JTIA 2D73A 3MI2A 3B0UX 3TAKA 1TYGA 2OCZA 2R94A 3CWNA 4KFPA 1Q6LA 1TQXA 4E0CA 1MSSA 1NVMA 4ORMA 4IPIA 4FB7A 5KZMA 1SFLA 4Q4KA 1GQNA 3UZJA 3CHVA 3LHYA 1ZHAA 3OVRA 2YYUA 4BF9A 3QQ0A 1TPUA 5HJLA 3F1QA 3PULA 4WOZA 2NZLA 2BLEA 4NNCA 4AVFA 1GEQA 3IV3A 2CU0A 1PIIA 1DORA 1LDCA 3G1SA 4GUFA 3W7EA 3B04A 1H7OA 4UTWC 2A6LA 3S0CA 3L2IA 2GVJA 3N9SA 3SSJA 2YW4A 4YCPA 2A7NA 4FNQA 3P84A 3W2MA 2GJLA 3G1VA 4LOCA 4RK8A 4UTWA 4RX0A 1G6CA 1X8FA 2ZRZA 4AXKA 4AF0A 4C1KA 1N55A 4H3DA 3SIZA 3QC3A 2W6RA 4K37A 1FQ0A 4BI5A 3SGUA 3OIXA 3LTYA 1OG0A 2B7QA 1YADA 3NM3A 1FXQA 1N7KA 4R34A 2GOUA 5DN1A 3NQ8A 4DBDA 2VFGA 2WNNA 2J6XA 2NV2A 5CZJA 1I2QA 3L66A 1RQHA 3LHZA 1QWGA 5BMWA 4MY1A 4UIOA 4N9EA 4K38A 1DJNA 3W85A 3AJXA 3A9IA 3RMJA 4MLRA 1EX5A 5CZ0A 3NPWA 3NQAA 3L5LA 3M7WA 1VGAA 1EWEA 3PBWA 5HUPA 4QIUA 3UZ5A 2KZHA 4JYDA 4UR8A 5FF2A 3P82A 5AYYA 1PVNA 1GWJA 3GXTA 1H7WA 3GDLA 1K3UA 3BPWA 4O53A 3NQMA 5HR7A 1GPWA 1OX5A 5EPDA 1A5BA 1YYAA 3IVTA 3BG5A 1LOSA 3LRMA 3W73A 1FXPA 1V5XA 1LM1A 2W79A 2NX9A 3KHJA 1BWKA 4TU1A 2E1DA 2NV1A 3EWXA 1G4SA 2QJGA 5C6MA 1SZFA 4R7JA 1VLWA 2AQWA 2B7OA 3TE9A 3EX4A 3OBKA 1PV8A 3PUDA 2H8ZA 1YDOA 4K7YA 1KW1A 4RKAA 1X1OA 4MFEA 5C2XA 4GUGA 4RZ5A 4JX4A 5F1VA 3M47A 1H7XA 4KWVA 5D09A 3W1AA 2DZXA 2FB3A 4JIPA 3LTSA 2F7FA 4NX5A 3ATYA 2CZDA 2G5WA 4UUIA 4QAIA 1RD5A 2E68A 4LUIA 3G18A 3RFAA 4IX0A 1HFBA 2RHGA 5K4XA 3TSMA 3FKRA 3KOFA 2R14A 1ME8A 4FX7A 2ISSA 2Y70A 1TPFA 2QCDB 1TQJA 1WBHA 2VC6A 3GR7A 4KFOA 2BX7A 1WA3A 2BTMA 3ABQA 1MEWA 1XFBA 1AW2A 2Y7FA 2C6QA 4NT0A 4OWGA 3TFXA 3W7MA 2YGYA 5EYWA 1KM3A 2ZZ7A 3S5NA 3E49A 1HO4A 1JJKA 3IIPA 4MOZA 5EBUA 4ZVJA 5AC6A 1W5OA 2H3DA 2XN0A 4HSOA 4I7UA 2ZFAA 3I7RA 2C19A 4POCA 5KSWA 4M6PA 2J9XA 3UYCA 1H1ZA 1NSJA 3GB6A 2HS6A 1Z44A 3M44A 5EKYA 4FX6M 1JCJA 3N2XA 5BOOA 1B9BA 4WJEA 3C2OA 2OT0A 4NJIA 3W7KA 3LCLA 5DBTA 2C0AA 2ZZ3A 1N8FA 3PAJA 3S5YA 3OVQA 1F6KA 5I3IA 4O1AA 3QSTA 1VZWA 4O1BA 1G4TA 3FEMA 3DENA 2A21A 2C14A 1SR9A 4S2CA 5F2GA 1I8JA 3IRDA 4ZQRA 4O18A 3HPSA 4UTTC 1H63A 2QDGA 3PG8A 1R2SA 2ZYFA 2YR1A 1ZALA 2QJHA 3EWUA 1W8SA 3FLUA 4R33A 3UWUA 2VEMA 3QRHA 1W5QA 4CCDA 4UTTA 1LRTA 1YXCA 3PC0A 1YPFA 5CPLA 4JNMA 2NXGA 2TPSA 3GIYA 3PB0A 4OT7A 3M43A 3ZWSA 2A0NA 3RK8A 4UTHA 2WSQA 3EWBX 2CLFA 4JTSA 3FOKA 1OYAA 5HWJA 3ATZA 1LP6A 2CLEA 1GG0A 3JRKA 1OYCA 4MVAA 3B0PA 2QF7A 3W87A 5FF4A 1L6WA 3O6CA 4CQAA 1XXXA 4J9JA 3KVJA 5L6UA 4CCCA 5SWUA 3H54A 2HSAA 3E02A 1WV2A 4WXZA 3TSBA 1IXQA 2C1HA 4FO4A 3QEZA 2LLEA 3ZS4A 4EOUA 3QMTA 3GDRA 4N9BA 3WJWA 3FS2A 1QAPA 3R89A 4AWUA 4GBUA 1Q3NA 1KLZA 2Y88A 1U83A 3LOTA 1KM2A 1KM4A 5AHFA 4LNYA 3TMLA 4XZ9A 5D30A 3SR7A 1D3HA 3DFOA 4O16A 1R46A 3T55A 1FUYA 3UWYA 2O7SA 2A7PA 1I4NA 4IPJA 3HGRA 4GWEA 2A5HA 1QMLA 4YL2A 1GYNA 2GQ9A 4ONVA 3NQ7A 3UWQA 2YFOA 2YXGA 3O07A 1RV8A 5LNUA 2PRLA 1XBVA 3NQDA 1LOLA 4O4VA 2V30A 1FDJA 1WQ5A 2GVGA 3MP4A 3P81A 1Q6RA 2ZRYA 2C3ZA 4HKPA 3P80A 4RR4A 1OFAA 4PCFA 1EUAA 4N2YA 1OFEA 2B0MA 4ORIA 3EXRA 3TC6A 2W0UA 3OEXA 4KFNA 3ZWTA 2QCCA 5F4WA 1KM6A 1LLZA 1KTCA 1NF0A 1S3HA 3TDFA 3OHIA 1KBJA 1VS1A 2H8XA 4IUOA 5A8GA 5FI8A 1AMKA 3GDKA 1TV7A 3GK0A 4PL1A 4H4IA 4LVAA 1G4EA 4ZQOA 2QCLA 2PCQA 1G7UA 1AW5A 4XTIA 5AHNA 3STCA 4IWWA 3TJLA 2WNQA 3T4CA 1FDYA 1WXJA 3A5VA 4QITA 3VKJA 3G22A 4GE8A 4O13A 1H7PA 4LC8A 5DY3A 4O54A 1PCKA 1LYXA 4MPQA 1TO3A 3CC1A 1WAUA 2J9ZA 5FEWA 4WXYA 1YDNA 1XUZA 3E9AA 3W1NA 4E2DA 2RDTA 2YX0A 2FPYA 3NXFA 4FX8A 5HWNA 4DF2A 3LBCA 3W9ZA 3WK1A 4XKYA 3RLUA 3L0NA 1HTIA 4AB4A 3NL3A 1JCLA 1NAL1 2PE4A 3LCIA 4E38A 4O1DA 5G2WA 1M7OA 3UD6A 3TC7A 3UWVA 1LRNA 1ALDA 2ATSA 1XUUA 4O19A 4GFSA 2NXIA 4OBTA 2DORA 1VLIA 5J5RA 1KFEA 4DEFA 3NG3A 5G4EA 3G1HA 3W7GA 2ZQ0A 3W23A 1ONRA 4AH7A 3HBLA 1JR1A 1ZFJA 3WFAA 3G0UA 1SQ7A 4HNTA 2H90A 3CIWA 5BMXA 3LM7A 4IMDA 3TFCA 1F5ZA 2JGYA 3PF3A 3QW3A 2E6AA 2JKPA 3GNNA 4FXSA 5E1QA 3E0IA 3M5VA 2YW3A 3KRZA 1TPB1 1UUOA 4CCEA 2A1YA 1ZAHA 2EKCA 3SFKA 3EX3A 3W7LA 3W7IA 2Z6JA 1P1XA 4U4MA 2WPBA 3W1PA 4XQ6A 5T26A 3IIXA 3DI0A 4JDBA 4O11A 1TPWA 3BARA 3RLVA 2R91A 3HG5A 3LCHA 3G1DA 4N4QA 4YXGA 1E51A 3LXAA 1FWNA 3KFTA 1WX0A 3GXPA 3DH7A 1C29A 1OF8A 2C13A 1ME7A 4GXMA 4O28A 1DHPA 3DKJA 4FNPA 4GUJA 4ADSA 4EF9A 1H7RA 1MZHA 1S5WA 1SO3A 2VENA 4CNPA 3DHDA 4UFMA 2A4AA 3EB2A 1Z48A 3N14A 1SZNA 1XI3A 3W75A 4K7VA 4AWTA 5CPOA 5IBXC 3PUEA 1LBLA 1SU5A 2E09A 4JYEA 4UTLA 4JX6A 4NU7A 3M1ZA 3L68A 5DCBA 3QYQA 4G1KA 2C18A 5IBXA 5F2IA 1DL3A 5HINA 4NJGA 3TMQA 3W07A 3NL2A 5KINA 1YLVA 2Y7EA 3FYPA 5KZEA 5FEZA 4MUZA 3M5YA 3PS7A 1WYIA 1M6JA 1EPXA 5BRBA 4RXFA 1BEUA 4PA8A 4MIMA 2ZA2A 2O7QA 2ZRUA 1OHLA 5F1UA 1XKYA 1W56A 4FNUA 4NXSA 3QZEA 5KTLA 3DZ1A 4UMAA 1H61A 1RPXA 4FXRA 4TX9A 5CZSA 1TPDA 1XL9A 3R13A 3M5XA 3QM3A 4HSNA 5CPNA 4IQLA 2V81A 3NR0A 1LBFA 4UFHA 3S6DA 5K3VA 5HUOA 2UV8G 4WY0F 2G96A 3P62A 4O12A 4K39A 1PL9A 5LHEA 3W7HA 2QKFA 2J9YA 1V7YA 1SSDA 3HG4A 3M9YA 1EP3A 4CLMA 3LXBA 3NQ2A 4LWWA 1TTIA 1VJIA 3C3NA 2P10A 3FJ6A 2BXVA 5K9DA 1H60A 2V5BA 2CZEA 3C61A 5D38A 1W37A 4I7VA 2OT1A 1A5SA 5IM51 2ZZ1A 1XDMA 3H55A 4YWIA 3P74A 1P5BA 4DO6A 1XBXA 2CWNA 1T96A 2QEZA 5DXYA 5DXXA 3AO0A 4JY9A 1SZGA 3G1XA 4RCXA 4MKNA 1KTBA 3IVUA 3NQEA 1QCWA 1T8XA 2ABBA 3TXVA 3B03A 1O5XA 4HNNA 1OX4B 3SZ8A 2Y7GA 2V0TA 4KWWA 1TV8A 1JUBA 3W1TA 4UR7A 1KV8A 4PFMA 5AHMA 3SGZA 4O52A 2XN2A 3FA5A 1AW1A 1GG1A 2EAWA 3N34A 2GJNA 4Y96A 2VFIA 1K02A 3W2LA 1VCVA 1S5TA 2CZ5A 5D2WA 3W7PA 1OFBA 4UMCA 1QOQA 6TIMA 1W3IA 2P1FA 4MJMA 2QCNA 3L5AA 4CNNA 3T40A 3IGUA 5FESA 3W70A 1VRDA 3PM6A 5EY5A 4FF7A 1PHQA 3C2VA 3STGA 3HO8A 3TJXA 1O4UA 4FIQA 1O95A 1M7PA 1TB3A 1QPOA 1YXYA 3W74A 5D2TA 2R8WA 5D37A 2EPHA 4NQ1A 2ZRXA 2WSRA 3UXDA 3EKZA 1AG1O 1PE1A 5F2LA 3BO9A 1OYBA 4MJZA 3MI3A 3N3MA 4JYFA 1XM3A 4N02A 4OU1A 5AB3A 4GRSA 4MZ8A 5AHIA 5I3GA 3LLDA 3PVFA 3EWWA 3KVLA 3UNDA 1H7NA 1RVGA 5FF7A 1SPQA 2PC4A 1OVDA 1DV7A 4HIBA 3GKAA 5F2MA 4LV9A 3HG3A 2JK2A 3TW6A 4IMGA 1KFKA 3B0VC 5TIMA 1JRCA 6ALDA 1OF6A 3TH6A 2WQPA 1R30A 2Q8ZA 3NQFA 4B5NA 4QSHA 1QOPA 4D2JA 3EXTA 1J4EA 3BG9A 1TRDA 2CLMA 2C16A 3G8EA 4GC4A 3M6YA 4K8HA 4ZL1A 1UJPA 1ZCOA 1JCNA 4HNVA 5BW6A 2I1OA 1W3NA 3OG3A 3LRKA 3S42A 2E77A 3H53A 3S1WA 3C4UA 2YPIA 2NUXA 3F4WA 2Y61A 4GJ1A 1FCQA 2YYTA 4LS0A 2WO5A 1SW7A 1J2WA 2I9EA 2YDAA 3N19B 4JTFA 4LVFA 3LHWA 5K9CA 5MHBA 5LNWA 3C6CA 3G0SA 1BTMA 3LERA 3F03K 3G0XA 4X9SA 2J24A 3LBMA 1YDVA 3DHFA 2FPVA 4RJEA 1IGSA 4LV4A 1LRQA 3O05A 1TV5A 1VYPX 1Z41A 3Q2DA 3W2NA 3BW2A 3HB9A 3LCWA 4O17A 3DGRA 4O10A 5C5YA 1F76A 3W83A 1VHCA 2WJZA 4MZ1A 3RNDA 1I2OA 3HPZA 3L0GA 4AEOA 5D32A 4WY0B 1MEHA 4IXXA 1ZJIA 3P60A 5LGZA 3MBDA 4IMFA 3O63A 1HL2A 5D2YA 3MO7A 5FF0A 4JTTA 3NQVA 1OK6A 4RZ6A 5E0KA 2I14A 4NZFA 1QFEA 3I65A 8TIMA 3TXZA 1B4EA 3PBVA 3C8FA 4IGHA 3V75A 1QPRA 3Q94A 2VFDA 1DKWA 5EA9A 3W7QA 4LC6A 2X2GA 3OVPA 2QR6A 4Z1DA 5CKSA 1IIGA 1GVQA 1C9DA 4LU0A 4MY9A 1F05A 4FEZA 4JTHA 4RXGA 4IXHA 5CSSA 3CIXA 3VFLA 1SO6A 3W1MA 1NEYA 3NYZA 4LT9A 3TA6A 3ANYA 1H62A 3BLEA 1XDLA 1D9EA 3A21A 3NEVA 3JS3A 3PB2A 1OFPA 4ADUA 1FY6A 4ML9A 4JX5A 4UXDA 3N9RA 5DELA 1F74A 3LI0A 4P2VA 1GVSA 3CQ0A 2CLIA 1GOXA 1QNVA 3M5ZA 2E6YA 3CPRA 3TV8A 1TREA 3QH2A 1TIMA 1YPIA 3HMJG 4Y90A 3VE7A 3OA3A 3UY8A 4N9DA 5AN7A 2TMDA 3NOEA 5EMUA 2DZUA 1QPNA 2B7PA 1GT8A 3P61A 3QPYA 3P8IA 4U28A 5TBOA 3IIZA 1ZNNA 1AK5A 3LV5A 3R5EA 3WJXA 3SW6A 1KBIA 2C15A 1X1ZA 1PS9A 3CEPA 3UWWA 3W86A 1TCDA 3WJYA 5LHFA 2G95A 2H6RA 2ZBTA 3BG3A 5G1YA 1NFBA 3MP3A 2EHHA 1XBZA 5D04C 4BK9A 2Z0IA 2V2DA 1S5VA 2Y89A 4MLJA 3LI1A 3NPXA 3THQA 3VCRA 5F4SA 5D2XA 3TW7A 3P5YA 2HMCA 2QUVA 4FNTA 4MY8A 3GNDA 3C0JA 3DKLA 1SSGA 2QCDA 1XC4A 1I45A 4L4MA 1B3OA 1R47A 3IGSA 1DJQA 3HOJA 3IGXA 5I3HA 4ZQNA 3GZ3A 1EUNA 4JIQA 1NF7A 3INPA 2ZZ6A 1TMHA 4A2RA 3TNOA 2FDSA 1ZAIA 4Y9AA 2CFFA 3U2OA 3G24A 1OFQA 1X7FA 4LUJA 4LS1A 4M7TA 4NUWA 1Q45A 1GVOA 4UCGA 4ZQPA 4NNBA 5J5DA 1EWDA 1W0MA 4JTKA 2ZRWA 2ZZ2A 2E5DA 4JR5A 1T99A 2YFNA 2RKXA 1GJPA 3L5MA 4O4WA 5HR6A 5LNVA 3ZR4A 3G3DA 1TPH1 2ISWA 1A50A 5DBUA 3CLMA 4TMBA 4IMCA 5AYXA 2VKZG 3MBFA 2FB2A 2H3BA 3ABSA 3CWOX 4UC5A 5LZLA 2V2CA 3I68A 3DFNA 1EIXA 3G1AA 1KM5A 4DBEA 1GZGA 3EKLA 3KAOA 4GUHA 4JTUA 5A5WA 4PH6A 4O57A 2V9DA 1PCWA 5DY2A 4TMCA 3BGGA 3CTLA 1H5YA 3NNTA 4FIRA 4N6EA 3M0ZA 2ZCGA 1QO2A 2Y7DA 4M7SA 3V1PA 3BGJA 2VELA 3HPXA 1LROA 1I2PA 2ZA1A 3QSRA 3G1FA 3W72A 1H1YA 3CT7A 2NX1A 2JGQA 1LZOA 1QDSA 4X3ZA 1H51A 2Q8LA 5AYZA 1UB3A 5I3KA 1I2RA 5F4XA 4BI6A 3W22A 3O16A 1UASA 3L65A 4NVTA 5K7JA 4DELA 4BI7A 1AL7A 2BZNA 4JTLA 4LVBA 3W1LA 5K4ZA 3L9CA 2Z2UA 5KZDA 2RDWA 1OJXA 3WK3A 3TU9A 2AGKA 1FX6A 2JKAA 3ZFHA 3W1QA 3DBPA 4LY8A 4O1CA 4JGDA 1RQBA 3G3MA 3PWAA 2IQTA 3O8AA 1G7VA 1YTEA 5BNKA 3BW4A 3NA8A 4ZQCA 3JR2A 3BLFA 1O60A 2VEIA 1IXPA 4AHQA 1DOSA 1JULA 3BK0A 3G1YA 5U7SA 3DFPA 4I9AA 3RF9A 1MXSA 4IOTA 5AOUA 4DF0A 3W1UA 1P4CA 2WOQA 3B8DA 3Q58A 4Y8FA 3HJZA 2DZSA 2F84A 1K7FA 5U4NA 3TK7A 2CLHA 2TRSA 3HIJA 3LB0A 3QJAA 1VYRA 1VHNA 3CU2A 3W1RA 3PBYA 4YCOA 1KFLA 1VCFA 3FJLA 4S1FA 1LTDA 1SUXA 2OX1A 5G2IA 4DPQA 1MO0A 2QCHA 1KM1A 1Q6OA 4CQ8A 1JUEA 3CB8A 4LTSA 1EP2A 3W6YA 2P0OA 2BSLA 1TPEA 3S5OA 4EVZA 3HGOA 5LGXA 2TYSA 3GAYA 3NO5A 1MEIA 1ICPA 1A5AA 2NWSA 4M6VA 4HPXA 1GYLA 3I7QA 4DF1A 2ZZ5A 4JS3A 1FWSA 2B7NA 5AHLA 3U6WA 4AMAA 4LVDA 3B05A 4WOQA 4Z0JA 1VCGA 3I6RA 2X16A 4MFDA 4O50A 4OV9A 1EA0A 1SW3A 4XBSA 4XTDA 4S2BA 2E5BA 4X22A 3MHFA 3T44A 1K8ZA 4GUIA 4ZMGA 2ZA3A 2QUTA 1XBYA 2Y63A 1KTNA 3EX6A 4PODA 3MMTA 3K30A 4P61A 1SFJA 3FYOA 1ME9A 3LCGA 5DCEA 3B4UA 4ZZ9A 2ALDA 1HO1A 1SZEA 3QMRA 1R2RA 2HTMA 5GVJA 3E96A 1FBAA 2YZRA 4JY8A 5LKYA 1O94A 3D0CA 4MYAA 1CW2A 2Y6ZA 4UTMA 4YLWA 3IIVA 2GPTA 1TJPA 1L2UA 4PEKA 3PR2A 3TQKA 5LNSA 3QMSA 2GUUA 2WKJA 4KKXA 4QNWA 2CLKA 1K03A 3YPIA 1JQVA 1UUMA 3FKKA 5FEPA 4AHPA 1KFJA
chains in the Genus database with same CATH superfamily
1K77A 1LLWA 5PTDA 3V5OA 3BSHA 3WD3A 1Q7QA 1KXHA 3WQCA 5CC5A 4LVGA 3W88A 3SCTA 5HWMA 3MJYA 1FCUA 3GFXA 1W54A 4PR4A 1KM0A 3POHA 1KBKA 3WMSA 2FGBA 3GVWA 7TIMA 3UR8A 3WJZA 4HZ6A 2PDKA 2RJGA 3PFMA 2X05A 1TSIA 4XO6A 2ZTKA 3W2UA 5EMJA 3GU9A 3TAOA 5K2ZA 2PTWA 5DLCA 2C71A 4R53A 1RA5A 2VEGA 3NGFA 4UTIA 1UD4A 3A12A 4UR9A 4CQDA 4LX4A 3UP8A 3MYOA 3PWIA 1Y0EA 2PWHA 1QNQA 4UQDA 4I3GA 1AL8A 3GQYA 3OBEA 1WOBA 3N13A 4WZHA 4AAJA 3IUHA 2Z26A 1S3TC 2INFA 3IK2A 4MAZA 2POZA 1HKJA 3OVGA 5ECUA 4LS2A 1NARA 4IIHA 3ARPA 4J40A 4NKCA 3DESA 2Y62A 3K1DA 2WMJA 4OGZA 3ZVHA 4F79A 1XG3A 4WSHA 2CKRA 2PTZA 1KGXA 3LMYA 1QATA 3APYA 3EXSA 3WUEA 4R9XA 3QFWA 5HULA 2DY3A 4HPHA 4ZODA 4F48A 3PG9A 1OFDA 4UOJA 1XYFA 3GYEA 1JQXA 1SGJA 3OQ8A 4Y2WA 3AYSA 3MHGA 2JBMA 3NL6A 4AZBA 4Q8NA 2DSZA 3MHUA 3MUCA 1A5CA 3GHTA 5CZTA 3I10A 1F61A 1JVNA 2FH6A 3GVVA 1J0JA 3PTQA 4R27A 3AS3A 3MI6A 3WLLA 4LUTB 4AD0A 3NGJA 3NVTA 4TR9A 4X61A 4AHOA 1VEOA 3SM0A 1GOMA 4O15A 1JFHA 3GS6A 3VOGA 4D6FA 3MC5A 1XICA 1T7LA 2BWGA 3V4BA 4C7FA 4CGTA 4DLMA 4FNRA 1XLDA 1CB7B 4EIVA 1UIPA 1YE4A 4ZE5A 1HKWA 1MFUA 3TQ0A 4GYKA 3NVDA 3LV6A 5REQB 3OZOA 4XZHA 1IWAA 4OVXA 2OEKA 4IMEA 3ARXA 3KTXA 3U3HA 1AVAA 4JEQA 2GL5A 2FTPA 3FN9A 1ZB5A 2CHNA 3DU0A 1F2JA 1V3MA 5CC7A 1TV3A 4DQWA 1LWIA 3W2JA 3UVIA 3BAYA 2V8ZA 1NWSA 3VK5A 5EL1A 1XH0A 2A2IA 1BGAA 4L4LA 4JFWA 2VFHA 1EP1A 4YMZA 2XFRA 3N73A 3GHRA 3W4RA 1ICSA 3SY5A 3B06A 4E3VA 3MW7A 3FEQA 4K2SA 4DY1A 2GFTA 3AOFA 2AL1A 3PJXA 3UW6A 3WBYA 2PDFA 4F2UA 3P93A 4KH2A 3NAVA 3V0SA 2V5DA 1U1UA 4Q4PA 5HATA 3A5FA 4LRTA 4DJEA 1HUVA 2CHRA 3CUJA 5FJPA 4L9XA 3PSVA 4FXFA 1MW3A 5BXRA 4CU8A 3H2MA 2WC7A 4UFJA 5D02A 1EH9A 2P53A 4QX4A 2WNZA 4GINA 2Z6IA 5A6LA 5MKGB 3POCA 4OFCA 4V2XA 2ZVIA 3H4XA 5DMYA 4IX2A 1UA7A 4ZQMA 5FEXA 2OEJA 3AYVA 4G56A 3KOWA 5CQ1A 1R3SA 1W3JA 1ESWA 2DZVA 4JN6A 2X0HA 4ADTA 5K9XA 2REQB 3RX4A 4K36A 3S1UA 1EB3A 3AUJA 2CW6A 4G6CA 4XK2A 2V5LA 4GIEA 1LCOA 1TWWA 3TN6A 4PL2A 3C2EA 1OFOA 1FP8A 5CJ5A 4C6EA 4MZYA 1YTDA 1LORA 4V1YA 3GDMA 5FF3A 3MUAA 3IJQA 1A4MA 3NSXA 3CEUA 3MMUA 3EX1A 3W2KA 4QG9A 1UD2A 1GOWA 2QV5A 1IEVA 3DYPA 3RJYA 3G8RA 3NQCA 3LENA 2E6FA 1NDYA 2BHZA 1CGWA 3WK0A 2QJNA 3MMWA 1W31A 4B15A 2GK1A 4JL2A 5AC7A 2WVUA 2VR2A 2EKGA 2O55A 2VGGA 1ZLPA 3PANA 3LX9A 4V15A 4YVVA 5I24A 1C92A 4QDMA 1EJVC 4Q4OA 4QM1A 4TO8A 4DO4A 3U57A 4UCFA 4L4PA 1FWRA 1HF6A 2QCFA 4A35A 1OCJA 1XR2A 5DO8A 3UXAA 2PDNA 5L9FA 1UP3A 4M0XA 1EDGA 1Q4WA 1EC8A 3ZLFA 1DIEA 1QNOA 5IFTA 1HGYA 4H6EA 1REQB 2D24A 3HJEA 3EOLA 1DXEA 4NNAA 1VQTA 4RV8A 3NOYA 1FWBC 3UR2A 5CLWA 5TQLA 2IUZA 4OZOA 3AS0A 2I5GA 3WBAA 4Z2GA 5M5DA 4DNMA 4B2DA 1C3FA 5HBFA 1V3IA 2XVGA 2BDQA 3WUBA 1XGEA 4HTYA 1RCXB 2IQDA 1RJPA 4H2HA 2VR5A 2EGZA 1V6TA 3N2TA 3QGAC 4ZOAA 2XIMA 1GVFA 3UG8A 4C6CA 2INEA 3GFYA 3N04A 2FFCA 1UWRA 3BURA 1XH2A 3TROA 2F6UA 4DZ5A 1E0VA 1Q85A 3AXIA 7TAAA 4BCEA 5H6HA 3EA3A 2BNJA 2E5CA 2YXOA 4JICA 2OGJA 3B9EA 4ECLA 3O06A 2YDQA 2RH9A 1TRIA 1M7JA 1ISVA 1E70M 1W3TA 3W7CA 1GVIA 1DVJA 3VD3A 5AHEA 3N2OA 3DI1A 2MANA 2Y8KA 3TVAA 4CNOA 2OZ3A 2OEMA 3TJIA 3HGJA 1W8GA 3LLFA 2G4JA 2ODOA 1EQCA 1RZMA 2D0GA 4HHPA 1KB3A 1XCFA 3W7DA 2J27A 4Q8MA 1FHDA 4TUFA 1B5TA 1ENUA 2V63A 1A53A 3HFYA 3VOHA 3WG6A 5D03A 1UH3A 3CQHA 5E93A 9XIAA 1UHVA 2WVTA 3H26A 3URBA 3W76A 1UIOA 4L7ZA 4DYJA 4HA3A 1TTPA 4RDVA 2QCMA 3AC0A 2OSXA 4W87A 3MI2A 3B0UX 4XIAA 3EYPA 1RVKA 1TYGA 2BVYA 2OCZA 3TAKA 2R94A 1GPFA 4M3PA 4E0CA 3B8WA 4ORMA 4FB7A 3UZJA 4S3AA 3L4XA 3RUBL 1JZ6A 1ZHAA 3SUUA 3URAA 4H9MA 1GOOA 1L6GA 1TPUA 2AGTA 4PB3A 2IPJA 1S46A 4NNCA 3GXIA 4HVXA 1EOKA 1DORA 4AIUA 2A6LA 5LXEA 3L2IA 3E0WA 2YW4A 1RLDA 3PWGA 4XAYA 3MTWA 4FNQA 1I9CB 4LALA 4RK8A 4UTWA 1E0UA 4RX0A 1VPYA 4AXKA 1N55A 2GJXA 3W82A 3SIZA 2JIWA 4CNSA 2Z27A 3OIXA 4PMUA 2DUXA 2J7HA 1N7KA 4F0HA 5DEZA 2PPGA 1J18A 1QK0A 3GO2A 5I6SA 2J6XA 3CHEA 2NV2A 3PPCA 4DI8A 4MY1A 1QRQA 4WJ8A 4ZO9A 1R7AA 4MLRA 2ZUTA 3CBWA 3K8KA 3M7WA 4R7WA 3PBWA 5HUPA 3UZ5A 2ZIDA 2KZHA 4JYDA 3PZIA 1C8YA 1EYEA 1ECQA 5CLTA 1GWJA 4HNLA 1S39A 5HR7A 4NAFA 1GPWA 3OPSA 3E2SA 3S2CA 1OX5A 1A5BA 3IVTA 2UY3A 3LYEA 4TU1A 4UZSA 3EWXA 1G4SA 3WQVA 1GW1A 3FW6A 3OBKA 3SCWA 1PV8A 2H8ZA 4HTBA 4K7YA 4GI6A 1KW1A 1HP5A 3QGKC 2V3EA 1X1OA 4MFEA 5C2XA 4S3FA 1EGZA 1RD6A 3CUZA 4F0LA 1EHNA 3JZEA 1ZPTA 3WNPA 3LTSA 2WJDA 2A3EA 1WO2A 1VD6A 1OWQA 1RD5A 3QTGA 3G18A 3EOEA 4DB7A 2RHGA 5K4XA 3WKZA 3BJFA 4EKJA 4AQLA 1H11A 2ISSA 2Y70A 1TPFA 4GX9A 3D47A 2QCDB 3ORWA 1TQJA 1WBHA 2VC6A 4KFOA 5D38A 1MEWA 2DSKA 1S2AA 2I56A 4U3CA 1E73M 3JVAA 1KM3A 3AU2A 3S5NA 3E49A 1HO4A 5BROA 3R0DA 5TD4A 1W5OA 2H3DA 4US6A 4HSOA 4I7UA 1B3WA 4PCNA 4YYFA 2C19A 4POCA 3QR3A 2J9XA 3SUSA 4DBUA 3ANUA 4WKFA 1WKDA 1HJQA 2HS6A 3M44A 5CJNA 5EKYA 1DHKA 4NG3A 4WJEA 4NJIA 3LCLA 4DZIA 1UMLA 3PAJA 1OGBA 3OVQA 3QSTA 4Q6XA 2YBVA 3E1F1 3N25A 4O1BA 3FEMA 3WH9A 3DENA 4S2CA 3SCUA 3SN1A 4J35A 5E70A 1R3RA 4UTTC 1H63A 2JF7A 5A8QA 2VX4A 1R2SA 3MCMA 2PGEA 3DFHA 3QRHA 1OIFA 4CCDA 1LRTA 1Z3NA 1X6LA 1HL9A 4UQCA 4NY2A 3M43A 3RK8A 2WSQA 2CLFA 2Y1HA 3AZTA 1FWAC 2OX4A 1Z7AA 3ITGA 3B4YA 3WD0A 2NQZA 5CPSA 1LP6A 2CLEA 3N3TA 3B0PA 4HP5A 1L6WA 1JCTA 1XGZA 1U2YA 5SWUA 1X38A 3UBPC 3GXMA 4C6LA 3BZJA 4UBPC 2HPIA 3FHQA 2LLEA 1TVLA 3GDRA 4N9BA 1QAPA 3R89A 3RX2A 2WJFA 2OG9A 1Q3NA 1ZSXA 2XIIA 4US5D 5AHFA 3E0LA 4LNYA 1PBGA 5T8GA 3SR7A 2P3EA 2W66A 5M3WA 3PNZA 3TTEA 3CAKA 4GWEA 3QV8A 3GNRA 2YFOA 3O07A 4G8TA 4Q7NA 1TR1A 5LNUA 4AEEA 1JYVA 4DJED 1NOUA 1LOLA 3VC5A 3LBOA 2Y8UA 3MCOA 3SCRA 3OZPA 3LSBA 2XVKA 3P81A 1TWZA 1WZLA 3DG6A 1VBJA 3EXRA 2WZHA 1TCMA 4ZO7A 5A95A 4MM1A 3CO4A 2QCCA 1DP0A 2WQDA 5A3HA 1KM6A 1V7AA 1LLZA 1KTCA 2ANUA 2SFPA 3LD5A 1KBJA 2VRQA 3AICA 4LY4A 4I5RA 1UZHA 1T5AA 3RU8X 3ZO9A 5ABHA 4H4IA 1IZJA 4LVAA 3SCSA 6XIMA 3WQFA 3KL0A 1AH3A 1AW5A 1YNPA 5BU9A 3WQDA 5HMDA 1CGVA 2DSUA 1KBLA 1A5KC 1KFWA 4QITA 1H7PA 1LJYA 4LC8A 1DWHM 5DY3A 1BYBA 1UZDA 4O54A 1PCKA 4F0MA 5GQBA 3FSTA 3VNIA 1ONXA 4LUTA 3GUWA 4WXYA 2CZVA 2FVKA 5E6ZA 3KUMA 2YX0A 4GPNA 4JOMA 3W9ZA 3RLUA 4LAUA 3WD4A 3DBNA 1JCLA 3CV6A 4J4KA 3CL6A 1LT8A 3GIQA 2ON3A 3UWVA 4Z2KA 1ALDA 2FTWA 4GO8A 3VDAA 1E6PA 2QMKA 3MUIA 4OBTA 3CPGA 4GY7A 5CZKA 5G4EA 3G1HA 3K8MA 3P3BA 3F4CA 3PPFA 5REQA 3WFAA 4JIEA 2BASA 4PGLA 3LA4A 4RNIA 5BMXA 2GJRA 3LM7A 2OWWA 1JPIA 2GGEA 3MANA 3QW3A 2O0TA 1B3XA 3E0IA 4Q4RA 1OY0A 4PB4A 2XSAA 2YW3A 1TPB1 1UUOA 4CCEA 2A1YA 4B4HA 1IR1A 2XIOA 4QAWA 3SFKA 4ACZB 4C6QA 3KE0A 3W1PA 4KEMA 5T26A 3WNKA 2WZTA 3ZJ6A 4INFA 1FWNA 4V27A 3VCNA 4UQAA 4C91A 3ECQA 2ZDSA 1UW9A 1EC9A 4GXMA 1J6PA 3U2CA 3COTA 4JQ4A 4B2DD 1MZHA 2VENA 4GZJA 2WZMA 1Z48A 3VD9A 5JXQA 3PZQA 3KZPA 5BCAA 1SU5A 1VBUA 1V3KA 1YHTA 3H7UA 2WW5A 3U4AA 4NU7A 1AFSA 3M1ZA 3VD5A 3QYQA 1DL3A 6A3HA 4NJGA 1QASA 3KBVA 1YLVA 3CUHA 1CCWB 1E71M 2WZEA 5KZEA 4MADA 5E9XA 1M6JA 1P0DA 2BVTA 5MKGA 1BEUA 1JXJA 4KMQA 1XKYA 2L5HA 1QU4A 1H61A 3CHCA 2FZ9A 3CQJA 1S2UA 4TX9A 1TPDA 3R13A 2PTYA 2REQA 5CPNA 3PJWA 2ASHA 5LXXA 1FA2A 1QHZA 5HUOA 2UV8G 4WY0F 1J79A 2G96A 4O12A 3WYZA 4MG4A 4I90A 4KWSA 2D2GA 1V7YA 3KLLA 3M9YA 1OZMA 3LXBA 3NQ2A 3B97A 1TTIA 2A3CA 1VJIA 3FJ6A 4XZLX 3KP0A 3QZAA 3DYMA 1U33A 3T0TA 3IARA 2ZADA 5CC6A 4I7VA 1KKOA 1DIDA 3T0AA 1QTWA 3WL0A 5M17A 1YMYA 2GSEA 1QI0A 3PZVA 4YWIA 2CWNA 1T96A 5DXYA 3VDCA 4AW7A 1E6RA 1ZP4A 3G1XA 2QUNA 3D6NA 1T8XA 3TXVA 2JEPA 2TAAA 3SN0A 1OX4B 3BTNA 4KWWA 1IZCA 1TV8A 4GJIA 2HBVA 1JZ3A 4F40A 1KV8A 5FJIA 5A8OA 4LEQA 2YCIX 2OGYA 4Y96A 2VFIA 1K02A 3W2LA 1JEZA 3GH4A 4DJFA 1W3IA 3W27A 1REQA 1PZ2A 1J12A 2DT3A 2YDRA 4JIIX 3IV8A 4E8DA 1VFOA 1E0TA 4J3UA 3BQ6A 1CTNA 3VGDA 4H8NA 5C2CA 3RRAA 1W3HA 3VYLA 2A79A 2QPUA 2HXUA 3KBNA 1UROA 3C2VA 4H9VA 3ENLA 4JCMA 2P8BA 5HAOA 1E40A 1IEWA 4BF7A 4AG0A 1LQAA 3KEHA 1NDVA 1H4PA 3BLPX 5D2TA 1X98A 2WHLA 1VJSA 3UXDA 2QV4A 3DC8A 4ASTA 1VF8A 1UKOA 4B5XA 4YTQA 5AB3A 4IIGA 4MZ8A 5A2AA 3LLDA 1RVGA 4E4PA 1SPQA 1OVDA 4BS0A 4PMQA 1DV7A 1XLJA 4PMRA 1EGVA 3DN5A 3NJ3A 4LV9A 3FNDA 3T8QA 4WDWA 1MQRA 4I9MA 4HYWA 5AZ1A 2PA6A 1JRCA 4MJ2A 3TH6A 3M0YA 3WF3A 4HPNA 5HJXA 2FTYA 3S6OA 4KCTA 1EO5A 3BAIA 4WSJA 2Q8XA 1QXLA 3GG8A 5D9MA 3UA4A 4UQBA 2CLMA 3G8EA 3ZLHA 3H70A 4EK7A 2ZWZA 4BA0A 4ZL1A 1UJPA 1QK2A 2AQOA 3N1AA 3A3XA 1GHSA 1W3NA 2E77A 1VB9A 4EPKA 3C4UA 4L1GA 4GJ1A 3VOCA 1FCQA 1D3CA 4NAEB 1WKFA 2FH8A 2NSXA 3N19B 2ZXBA 4PUUA 3LHWA 5LNWA 3B40A 3PZUA 3F03K 3G0XA 1WDDA 1IT7A 3DHFA 2EJ1A 2FPVA 4L5ZA 3CUFA 4DZHA 1IGSA 1FFRA 2A3AA 1US2A 3THCA 3DGRA 1UZ1A 1F76A 4Q8WA 2D22A 2G3FA 4YN5A 2E8ZA 4P5UA 2YB1A 1RLCL 5H1WA 5BXTA 1ZJIA 1GNXA 3TWAA 4GZIA 3O63A 1LG1A 2PDBA 4RZ6A 4TVDA 4NZFA 1DKWA 4PMVA 2WM0A 1IIGA 3R0KA 3ZT5A 4MY9A 2Z24A 4FEZA 3CZKA 3L4ZA 4RXGA 4LAOA 3CV1A 3T0BA 2RDXA 3NYZA 1KNWA 1H62A 3ZZ1A 1XDLA 1D9EA 1YRRA 2O56A 1UR1A 3JS3A 3CK5A 4UNIA 3W26A 4ADUA 2VDIA 3S9IA 4ML9A 1JYNA 1ITUA 1E6QM 3NDZA 4WRHA 2Y5EA 4B3KA 3N9RA 2BBFA 2DSVA 2CLIA 2QULA 5CXPA 3IUIA 2E6YA 3R10A 1PDYA 4LYPA 4AWEA 1TIMA 1YPIA 4ILSA 2Q02A 3UPMA 3OA3A 2Z2BA 4HGXA 4Q8QA 2TMDA 3NOEA 3WH8A 5XINA 2CYGA 2DZUA 3N4AA 4KCUA 1EKOA 3P61A 5TBOA 3UWEA 3WY1A 4L9ZA 1KGUA 4EX4A 2WMKA 3R5EA 3WJXA 1P48A 5FD0A 3L4WA 3CEPA 3E0VA 3WLPA 1S1RA 1K9FA 5LHFA 4JL1A 3MP3A 2PDUA 3K5XA 2CETA 1JPHA 3N4EA 2WLZA 5D04C 1H49A 2CXEA 1PKMA 2Y89A 4GJJA 4P7RA 3OW1A 1VENA 1JZ8A 5F4SA 2GDQA 3ITCA 2R1KA 1W91A 1XIJA 3P5YA 4PBEA 4FNTA 3C0JA 3DKLA 1SSGA 2QCDA 1I1WA 2J47A 2IS7A 1I45A 4RV3A 3IGSA 1F3EA 5E5CA 1KWGA 1G5AA 2QW5A 4ERGA 2HK1A 4JIQA 1SZRA 1M68A 2ZZ6A 1JYXA 4QHRA 2Z29A 4UZUA 5LIXX 4Y9AA 1OFQA 3KP1A 4RDZA 4LUJA 4BJHA 5M1TA 1GQLA 1Q45A 4NNBA 5HANA 1QI5A 3B8IA 2E5DA 4D6IA 1T99A 1TIWA 1FWJC 3G3DA 3MVIA 2VRKA 1A50A 4E6MA 4DXKA 1AJ2A 3MBFA 3HFTA 1FWIC 2BGQA 1R3QA 2H3BA 4UC5A 3NFUA 4BF5A 1Q66A 1ITQA 1EIXA 4DBEA 4PH6A 4O57A 1PCWA 4TMCA 2G8ZA 4N6EA 3TN5A 3GIPA 3OYZA 1QO2A 5HPOA 1T41A 2YCJA 3UJEA 1ZBVA 3CT7A 1FWFC 2NX1A 1UD8A 1LZOA 1UWTA 1QDSA 2Q8LA 3H21A 1J93A 4BI6A 5JBEA 4R7OA 2D0HA 1C93A 2X7VA 4EAMA 5K7JA 2BZNA 4LVBA 3W1LA 1QT1A 2WJEA 2Z2UA 2OYKA 2RDWA 2P0IA 2HK0A 4DO7A 4JGDA 3IPWA 3SY8A 2D2OA 3CAQA 1M1BA 5BNKA 5FOOA 1WB0A 3J7HA 6TAAA 5FAGA 3BLFA 3N17A 1O60A 4CU7A 1Q6DA 1JULA 3BK0A 1DEDA 1OC6A 1MXSA 4IOTA 5AOUA 1GKRA 3W1UA 2WOQA 3HJZA 3GWQA 2F84A 1K7FA 4Q4MA 1C9WA 1XV8A 3LB0A 4PUDA 1VHNA 1CXIA 3W1RA 2BXYA 1KFLA 2PDPA 1D7KA 2OX1A 4GACA 3S2JA 2FZNA 4DPQA 4TTUA 1KM1A 4CQ8A 1JUEA 2HE8A 4RZBA 4WKHA 4YVXA 3WMBA 1Q8AA 1YKWA 3W6YA 3MWCA 4EVZA 3F5KA 4HOXA 2TYSA 4WEVX 1YNQA 1GYLA 3M0XA 4BEQA 2ZZ5A 3UXKA 1A0EA 4XZMX 4O50A 2E25A 3BAKA 2QGYA 4XBSA 2HNEA 3F4DA 3OLDA 3QXBA 3ITOA 5FIPA 2G4FA 1XBYA 1HVXA 3EX6A 2OZTA 3AQUA 3FYOA 4W88A 4ZZ9A 4W8LA 2ALDA 2EJAA 5GVJA 4KPLA 5AYBA 4ZR8A 1CW2A 3IIVA 1TUXA 1DIOA 1K4HA 2GPTA 1JZ2A 1J96A 1P1MA 3WUFA 1AODA 4J3SA 3TQKA 2RJHA 2GUUA 2CLKA 3FYYA 3IUDA 1JQVA 3WEZA 4AZIA 4AHPA 3CHFA 1KFJA 1U5JA 1MVYA 3II1A 3SUVA 4PTWA 3MKKA 1WZAA 1IR2A 2WWCA 4QJ1A 2PURA 1BXNA 1A80A 1TPC1 2PWGA 4R3UA 1POJA 3UPBA 1R9YA 2WHMA 1HZYA 1E9LA 5LNRA 3THAA 3ZJKA 1WDWA 1FDZA 4KEUA 2XG9A 1WKYA 1H0IA 2V38A 3H8AA 1E1EA 3O15A 1RP8A 2XFYA 1GKQA 3LHTA 2WMFA 3VA8A 5EMYA 3C2RA 4Q32A 4FMVA 1YDYA 4TIMA 4HQVA 3P5ZA 5FJJA 1XRFA 5I3JA 4K8GA 3WD1A 2I17A 1W1TA 5JMUA 3RRXA 2VGFA 2HCVA 3GFZA 4S39A 3DAQA 1XLAA 4ZB5A 3CQIA 4TX8A 2E3ZA 2VFFA 5KITA 1TTQA 3U7VA 4DJFD 4ACZA 2PDWA 2W3ZA 3R12A 2XFWA 4IJBA 5BWFA 3NDOA 3P0WA 4E5TA 3UG5A 3TSDA 4H2CA 1R38A 3S5ZA 3W7RA 4DBSA 1NOWA 4DUXA 1UCWA 4JTEA 3R2GA 1M41A 4NZ4A 4DNHA 2POTA 4HU8A 4JTJA 1F6PA 3KRUA 1ZY9A 3IEBA 3DG7A 1TWDA 4XG1A 1UH2A 3WNOA 3E3HA 1ZBCA 3BSGA 1CGYA 4GVHA 2EBNA 3HGSA 4ZTYA 1W9BM 3WNMA 4DWSC 1K8XA 1W9DM 3A3HA 1NFPA 1OABA 4G1NA 2WSPA 1OFRA 1JNDA 3R8HA 3ABZA 4J3TA 2QCGA 3KRBA 3MYPA 3PUOA 2HVMA 1MW0A 5FL1A 2HQAA 4KWUA 1BD0A 3R6IA 4XKYB 1F73A 3QQ1A 4XUGA 3VKBA 2ZZ4A 3T81A 3V18A 2XM2A 3VPLA 1E4LA 2A6NA 1PIGA 2XJ7A 3MB9A 4E8GA 1K7XA 3AXKA 5DF0A 1X1NA 2FLIA 2VD9A 1RPKA 1G0CA 5I79A 4H9UA 4H8UA 3EEGA 3DFQA 3LCFA 4WR3A 3ZJ8A 2QYGA 2GQ8A 1EZWA 3BH4A 5CG7A 2GYIA 2ZXAA 3TIMA 1FHLA 1DTUA 1W3LA 1GUVA 2QAFA 1IZKA 1FCVA 3TNBA 2Y85A 3GVRA 1Q6QA 3KM8A 5CSYA 4IM4A 3EOOA 3STEA 3V0TA 3FXGA 4Y9PA 3WSUA 1CX9A 1EBGA 3PY2A 1G69A 1XQLA 1XLGA 1FCBA 1E6NA 4BFAA 1B3YA 5LA2A 4HD5A 1XIMA 3PP7A 3UWZA 1I2NA 2J88A 3W00A 4UFLA 1ZJBA 2QIIA 3S6TA 3TKFA 1OX4A 4CQBA 5HMSA 4HK6A 4WHBA 3WN6A 5JQ9A 2HS8A 3RJXA 2TODA 5G5IA 4QCEA 3CB3A 4FOKA 4ZTXA 3FFSA 1W6TA 3TQVA 4LF2A 3W7JA 3A22A 2E9BA 1H3GA 3NPUA 1YTKA 1JRBA 1GTHA 3VIFA 1E3ZA 1UQYA 1UQZA 3APTA 3AS1A 1VBGA 2EG8A 3Q67A 3UR5A 5CBJA 1IV8A 2C91A 3BJTA 5C7HA 4QTGA 3V3WA 3GKFA 4W8BA 1POKA 1AMYA 3M46A 3C52A 3EWYA 2O4QA 2ATMA 3TX9A 1BKSA 2D23A 2P88A 1Y65A 1ADOA 2OYMA 3VDGA 3CMGA 2CEQA 2YL8A 4QNEA 5AYIA 5FJOA 5HNRA 2ABAA 3EB3A 1XX1A 2QGHA 1GOKA 4CNUA 4KEVA 3R4IA 1A5LC 5C54A 1I6NA 1OCBA 2OPJA 2FYMA 1KKRA 3S1GA 4C6OA 2PUZA 3GR4A 3A4WA 4HNCA 3KOXA 2DZWA 4OQVA 3MVTA 4X0VA 1LQ2A 3RR4A 1UKPA 3V7PA 3VNKA 1BWVA 4DXVA 2QXWA 4AF0B 4H6KA 2YLAA 2FIQA 1ISYA 3HG2A 4UFIA 1XLKA 1IF2A 2NX3A 4MYXA 3VTRA 3MO4A 3QVQA 2QDHA 4CQ9A 3AHXA 4LBSA 2DJLA 2VX5A 4QR6A 1DTNA 6ENLA 4NAEA 4CEXC 4AFYA 2WHJA 4EXBA 4DI9A 5CEWA 1ZAJA 2IMRA 4K8EA 1O12A 4GVFA 3T9PA 4XAPA 4DZAA 1RCOB 5GNZA 4FNSA 3KX6A 1ICQA 3WQ8A 3A24A 1G01A 5A2CA 2XVPA 4XAGA 2NT0A 1L9WA 3WLTA 3DFSA 2JIEA 4H04A 3RYSA 3GXNA 3M4HA 3GX9A 4P8UA 1V03A 3WLIA 3GD6A 1PTGA 4Z08A 5CH9A 3USBA 4WF7A 4CU6A 2NSOA 1L8PA 1Q6EA 1EPVA 3CV2A 3W02A 3MP5A 1AZ1A 3AXXA 5C55A 3VKDA 1XPYA 3TN3A 3SCOA 3R8RA 3RM9A 5I3DA 1Z89A 5GNYA 4PTNA 3GVGA 5FA5A 5JBFA 4L80A 2J8GA 2X30A 2XPKA 1P0NA 2OR2A 3S2MA 4FHAA 4N9CA 4E2BA 4JIRA 4R88A 3PUGA 1Z42A 1JD9A 3H2EA 3AZRA 1FP9A 2VXNA 4V1XA 3CM4A 1OD0A 1LWHA 1G1YA 1H50A 2D0FA 5AKQA 2RDUA 3E6EA 4JTGA 3IACA 4M6QA 2DU2A 4MB3A 3CUGA 4Z2LA 2BB0A 2XISA 3URQA 4UMBA 4X2RA 3OYXA 1CI1A 4U3AA 2FJKA 2WK2A 3WQ4A 1MYRA 2XSBA 3P0XA 3AFBA 3U8GA 2ZRVA 2GVYA 4HA0A 2GUYA 5D33A 3F2DA 3ITTA 3S9YA 3C56A 5HXMA 4DUWA 3NZPA 4DJDC 2V68A 4FR1A 2BVWA 2XGZA 2QJIA 4OHQA 3TWBA 3L12A 4XD4A 3TCEA 3U2EA 2VD8A 2ISDA 1JPDX 4E2OA 3DUGA 2Z7GA 3SUWA 1NVMA 1TJ2A 3RX3A 1GQNA 4LBRA 3A4AA 4OOZA 2FHCA 3B8UA 4MNKA 3QQ0A 5HJLA 3V5FA 3C5QA 2D3NA 3F1QA 3ICJA 4DM2A 3PULA 1EQPA 1MRAA 2EG6A 2CU0A 1LDCA 3TQPA 3DEQA 3VNYA 3W7EA 2E1WA 3UCDA 4GYPC 3ARRA 4IGMA 2QDDA 3W6MA 4R5EA 3SRKA 2GJLA 3G1VA 4MB4A 7ENLA 3OB8A 4C1KA 3R79A 8A3HA 2W6RA 1ADDA 1VFSA 4GQ0A 4BI5A 2VL4A 2CNCA 2D3LA 4C7GA 4BQ2A 3LTYA 2B7QA 1YADA 3NM3A 5HA7A 1FXQA 4R34A 2GOUA 5DN1A 3NQ8A 3AWOA 1E5NA 2VFGA 3HM7A 3ITLA 4JN7A 3PTMA 3L66A 4TXEA 4ZFCA 2Y0FA 3F4VA 3SAZA 1P7TB 2W61A 3URNA 1EWEA 3VNJA 1W1PA 3LU2A 3P82A 5CSUA 3W25A 1HP4A 4J3WA 1PVNA 2BP1A 3SDOA 1H7WA 3KS6A 1R9ZA 3GDLA 5XIAA 3AISA 1K3UA 3BPWA 3M0MA 4O53A 4K1GA 1YYAA 2OWCA 1LOSA 1FXPA 1LM1A 4AD4A 3KHJA 1O6IA 4PTDA 3KTSA 2ZUMA 4L56A 4EXAA 1GJUA 4QCFA 4GK8A 2ISFA 1SZFA 1ISZA 3WNNA 4XBJA 3TE9A 2B7OA 2XWEA 1B30A 4AZ7A 4QJ5B 3KWXA 4Z2JA 4RKAA 2QS8A 5AC5A 4GNVA 4M24A 4RZ5A 4JX4A 3BAJA 5D09A 1DWFM 4ZO6A 4KIEA 4IJCA 3ATYA 2CZDA 4NSBA 3PZGA 4FS9A 4LUIA 4IX0A 3EMQA 4I6VA 1TUFA 3TSMA 3M07A 1YE6A 1HKVA 4JQ2A 4GI4A 2R14A 3M0IA 3MZ2A 1GORA 4ZSTA 3AHZA 3EPNA 1Z9AA 1RXOB 4OUEA 3ABQA 3USZA 1ZBKA 3FDKA 5CPQA 2CPUA 1EDTA 2RAGA 3W29A 3W7MA 2YGYA 1K9DA 2Y4SA 4PULA 2ZZ7A 4B91A 3KDNA 4C5ZA 1JJKA 3IIPA 5EBUA 2ZFAA 3VOJA 4JAWA 3LPGA 6PTDA 4QE5A 1H1ZA 1BVZA 7PTDA 3GB6A 2HEJA 3BMWA 3T8LA 4FX6M 1JCJA 1GEHA 4M56A 4N7QA 2YA1A 1H2JA 3CH0A 2C0AA 2ZZ3A 1N8FA 3UYIA 3S5YA 3VINA 5ABEA 3QV7A 5I3IA 1PPIA 3QHNA 2DVUA 5I7GA 4JZ5A 3PJUA 3W24A 3MU7A 1R3TA 1MDLA 5F2GA 1I8JA 3IRDA 2YL9A 3EWDA 1SMAA 4ZQRA 1E6XM 1CLXA 1HXJA 1XLFA 4GI8A 3STPA 1EJUC 1W32A 2QJHA 3EWUA 3FLUA 4LCRA 3BLLA 4R33A 4KQNA 1FRBA 1RCQA 4H9TA 4UTTA 1YXCA 4JNMA 3CO8A 4YVPA 3GIYA 5G4HC 1OCNA 1QHOA 4M8UA 2A0NA 1XINA 3OGVA 3V35A 4JTSA 2EPNA 1HQTA 1GG0A 4IIFA 1OYCA 2ZXDA 1EA9C 4G7EB 1KCKA 1MXDA 5LA1A 3O6CA 1BSLA 4CQAA 1XXXA 4J9JA 1JF6A 1CLVA 4FXJA 4GZEA 3IJIA 1AQHA 1EL3A 3EPOA 1FHUA 1SMDA 2J77A 5I06A 3TSBA 2C1HA 4IQDA 4FO4A 3QMTA 1VEMA 2VZVA 4GBUA 2AKZA 1LL4A 1JD7A 3TMLA 3DFOA 2VCBA 2A5HA 4IJRA 4KCWA 1QMLA 4YL2A 4ONVA 3H2OA 3UWQA 2WVVB 3NQ7A 3BLOA 4FLQA 3DCPA 1F07A 1XBVA 1O1ZA 2QNEA 2V30A 1TV4A 1WQ5A 3RM4A 3RDKA 3MP4A 4MDPA 4I8YA 2BMBA 1OFAA 4PCFA 1EUAA 3XIMA 3HTWA 2YJQA 1OFEA 1BF6A 4LUSB 1ODZA 2PCEA 3TC6A 3LGDA 4J5NA 4JPGA 2W0UA 3OEXA 3ARVA 3N6HA 3BE7A 3VILA 1DXFA 1WDSA 2NLYA 3ARZA 2JALA 4AC1X 2HZGA 1KR0A 2H8XA 4IUOA 3HQNA 4MJ4A 3TLLA 1V93A 5EMMA 3GK0A 3S3GA 3OTRA 1G4EA 3WQPA 3VKCA 1I60A 3W0KA 5DMMA 2R1PA 1MI3A 3T4CA 5IRPA 1BKHA 1FDYA 3NZQA 3VKJA 4GE8A 1JZ4A 3W6LA 1SR0A 3IK4A 1WPCA 3NO3A 4MPQA 3CC1A 2O92A 2ZX6A 3V5CA 3WQ5A 3LSCA 1YDNA 4L6HA 5C70A 1ELSA 4E2DA 2E67A 2RDTA 2FPYA 3K4DA 4DF2A 5M2FX 4PMYA 3WK1A 4XKYA 2W92A 3JU2A 3VCCA 5GNXA 4AB4A 3PZOA 4LCSA 3LCIA 2CIPA 2UWFA 4O1DA 5E0CA 3BC9A 2J74A 3UD6A 1AA1B 2KAUC 2PU1A 4O19A 2NXIA 2DORA 5A1AA 4DEFA 4PUNA 3HZ3A 4H1ZA 3HBLA 2DV0A 2FMOA 1RBLA 3P6LA 4AMCA 4DYKA 3C0SA 2JGYA 4GXPA 3GTFA 4WGHA 3WDIA 4XISA 2JKPA 3FX4A 2VZUA 4AYSA 4B90A 4GLEA 4O8AA 2PTXA 3W7LA 3EX3A 3BGAA 3L4TA 2VZTA 3IIXA 3PTDA 3DI0A 2ZUUA 2OTDA 3VC6A 2R91A 3G1DA 3ARQA 3WQGA 1QUMA 3TCSA 1SJAA 3FJNA 2V5KA 1OF8A 4A3YA 2OQYA 3I3DA 4JHMA 4HOWA 1JPKA 3BV7A 3KBWA 3K46A 4EF9A 4CNPA 2A4AA 1PB0A 1SZNA 4W5ZA 4S3CA 4AWTA 5HJYA 5IBXC 4PSRA 4D6DA 1LBLA 2E09A 4LNCA 1XSKA 4JYEA 4GX8A 3L68A 4HJWA 1SFSA 1HKKA 4G1KA 3WDJA 3W07A 3VIHA 4DWSB 2DW7A 1E4IA 1ZU8A 4QJ4B 4MUZA 1XF0A 3M5YA 1NP0A 1WYIA 5BRBA 1Z6KA 4RXFA 1R0MA 3FA4A 4MIMA 2VQUA 4X63A 3QZEA 3T0DA 5KTLA 3H23A 1UWAA 3D46A 3HURA 3QGVA 5JVLA 1GOQA 3CJPA 3RGTA 5DQPA 5CZSA 1BXCA 1XHGA 2W63A 2ZKMX 5ECVA 1EJRC 3WX7A 3M6DA 3NR0A 4UFHA 3MCNA 3IJDA 3S6DA 5K3VA 2BG5A 1CZ1A 1UZ4A 3H4GA 3EDEA 1UR3M 3AXMA 3BAXA 3HU7A 1YEYA 1TWSA 1E43A 3UXIA 4LWWA 3WQEA 3AHVA 4MNLA 3SJNA 3C3NA 3WDHA 2PLCA 2FZDA 1H60A 1N82A 2V5BA 3GU2A 3VUPA 2NQJA 4E8CA 2OT1A 5IM51 2ZZ1A 3VNZA 3B8VA 2OLHA 1UP2A 3H55A 1V3JA 4O0QA 3SQMA 1HIZA 4JY9A 4GIRA 1KRMA 2IQ0A 1SZGA 4RCXA 5D8WA 3VOIA 5H8UA 4M51A 1I0DA 2D2HA 2Z1KA 3BANA 1O5XA 2F38A 3S2LA 3SZ8A 3FGCB 2WYSA 2WWDA 3THUA 1MUCA 2R9RA 3WQOA 2X40A 4ZXLA 5FJRA 3SGZA 1W1YA 4GZ7A 1GG1A 2EAWA 4TQTA 2PGFA 3N34A 5EFDA 2NVDA 4RDWA 5D2WA 3W7PA 3C86A 1QOQA 6TIMA 2FMNA 4IGNA 4EACA 1UG6A 4B9YA 2QCNA 1PWLA 3EDKA 3L5AA 4CNNA 1PX8A 3T40A 2QVHA 2WANA 3ONCA 3WBWA 1UR4A 8CGTA 3HO8A 3TJXA 1LWJA 2XHYA 2WNWA 4IFKB 3HQPA 4EANA 2IKHA 3CZGA 3VGBA 3MS8A 3EKZA 1MXGA 1PE1A 5DFAA 5BZAA 4JHOA 1DWJM 4RL3A 4MJZA 3VNLA 1XM3A 2VURA 3H2AA 5AHIA 5I3GA 3SO7A 3PVFA 3EWWA 1BYCA 1H7NA 1TMQA 5I5RA 2YKKA 3S83A 2PP1A 5I09A 3B0XA 1WE5A 2BHUA 3IAQA 1OF6A 1S1PA 4AISA 3BSMA 4W7WA 2WQPA 3FSUA 4A05A 4W5UA 3VAVA 4D71A 1QOPA 4D2JA 2BY1A 4J27A 1BYDA 3EXTA 4H9YA 5A6AA 1R7OA 1PZ1A 2ZC1A 3AXHA 3TTSA 2VC5A 1D2KA 2C16A 5GJNA 3M6YA 1HW6A 1KXQA 4U5KA 1EIBA 2GGGA 5BW6A 3BCFA 5FKYA 2CITA 4H83A 1E55A 4QFUA 2NUXA 2Y61A 5HPCA 2DUAA 2WO5A 1B3ZA 3A64A 4LVFA 2DGAA 3RO6A 1MW1A 2Z25A 3C8NA 1BTMA 4DN1A 3BUVA 4X9SA 3QY6A 5B80A 1YDVA 2V3DA 3GW0A 4FLRA 4LV4A 1LRQA 1EHAA 3OHMB 1VYPX 3Q2DA 5F7UA 1P0EA 3BW2A 3MSGA 3WMCA 1M03A 2BOGX 4IL2A 1V79A 1HKMA 5C5YA 1TG7A 4XB3A 2VYOA 2PP0A 1R5YA 5AVNA 1I2OA 3L0GA 5I00A 1DJIA 4AEOA 3GHUA 4S38A 5D32A 4WY0B 1JGIA 1MEHA 1XLHA 5I0DA 1B54A 2X41A 3P60A 3RPTA 2QDEA 3MBDA 1XLEA 3AS2A 2HBXA 4Q8UA 2I14A 1AD1A 3CUXA 3NO1A 4NI8A 3I65A 3MPGA 8TIMA 3M0JA 1Q6GA 4B3ZA 1TA3B 2PWFA 3N12A 1YQ2A 3ZSSA 1V02E 4Z1DA 3TTYA 5CKSA 4F66A 1AQFA 4US5A 1F05A 4JTHA 2J8FA 5CSSA 3W1MA 5C9RA 4KS0A 2VVNA 1NEYA 2QJJA 3TA6A 1RBOB 1HX0A 3VX1A 2OQLA 4HSHA 1JAEA 3A21A 1V8EA 4JCLA 5XIMA 2GVEA 5JUVA 2E28A 1OFPA 3UCQA 4XVEA 2NQHA 1FY6A 3UA3A 3VU2A 1P7TA 4UXDA 4XZIA 1VFUA 4AY1A 1Y7VA 1GVSA 3AMGA 1V3LA 2EPKX 3ZR6A 2DEPA 3CT2A 1QNVA 3K13A 1R86A 4HK7A 2X8RA 3QH2A 3HMJG 1KCZA 1XCXA 3FAWA 4Y90A 3AI0A 3QN3A 2HNHA 3M0HA 1QPNA 3N29A 3WQ6A 3P2VA 3R0UA 4U28A 1ZTVA 3SW6A 3KCOA 1OC5A 1KGWA 1X1ZA 4JN8A 1HL8A 3MQTA 5I2UA 1KCLA 3ISIX 2H6RA 3VD7A 4HHHA 3LEPA 1KQYA 1XG4A 1RJRA 1XBZA 4PB5A 2VGIA 5BRQA 4LXFA 3VDHA 2F2KA 4BK9A 4ML4A 4MLJA 2G37A 3ITXA 1XYAA 3GC5A 3VCRA 3GXFA 5D2XA 4REQB 3APGA 1PKNA 5AVHA 1FH8A 5FSEC 3GNDA 3OIHA 3LM3A 3BWWA 1W2VA 3VIPA 3E74A 1B3OA 1R47A 3VGEA 3KDOA 1UPMB 2CLPA 4E3TA 2P50A 3GZ3A 1EUNA 4RNJA 4RNFA 3INPA 3BOXA 3MJMA 1JZ7A 3WUGA 1PEZA 4I5XA 3TNOA 2FDSA 3G24A 4D9PA 3VIKA 3BL3A 5I07A 4UCGA 5J5DA 1EWDA 4B5VA 4NZCA 4JR5A 4IICA 3SQSA 2RKXA 3ZQ9A 1F3TA 3QHOA 3ZR4A 3PZMA 1JNEA 4HBKA 1TPH1 3GHSA 4TMBA 1UD5A 1J9YA 4D8ZA 7CGTA 2EQDA 3CWOX 4QS6A 3MT1A 1W2PA 4QP0A 3CMJA 3EEZA 3G1AA 4A8NA 3G5EA 1GZGA 5A5WA 3BGGA 3CH9A 4FIRA 3V1PA 3BGJA 3HPXA 1LROA 1I2PA 2ZA1A 3XINA 4BEUA 1OADA 2JE8A 2JGQA 3TA9A 4X3ZA 1H51A 1R85A 1UB3A 3LNMA 4MKVA 5A8MA 3W53A 1QW9A 2G3JA 4NVTA 3L65A 4IP7A 5K4ZA 4G7EA 3I3EA 3TU9A 4ACYA 1FX6A 3W1QA 1TVPA 2IQTA 4E4FA 2HV5A 3O8AA 1G7VA 3K1GA 3OOQA 1ITCA 1V6UA 2PZ0A 3NYDA 5RUBA 1DOSA 3CIVA 2V69A 4CN6A 4ERIA 1E1CB 1UMYA 1GONA 4Y8FA 1OM0A 4PMXA 3CU2A 2J7EA 4GO9A 4WSKA 1Q6OA 3UJ2A 3CB8A 3SN4A 4MHBA 2WVVA 1EFZA 1TPEA 3S5OA 3HGOA 5LGXA 1MEIA 4MGGA 1ICPA 3GH5A 5ENLA 5EFFA 2NWSA 4M6VA 4JKKA 1SJDA 4GISA 4AMAA 3B05A 2QPSA 3WH6A 4WLCA 1VCGA 1F3XA 2DIEA 2X16A 3I6RA 4MFDA 1EA0A 2PF8A 5BYWA 5J8LA 3NSNA 4S23A 3WEMA 4S2BA 3MHFA 3T44A 1DE5A 1K8ZA 2WMHA 2YL5A 2ZA3A 3D3AA 3AMDA 3MMDA 2AOSA 4PODA 3K30A 2XZ7A 1GKPA 4LB4A 4IPNB 1CXLA 5E6YA 3EGJA 1HO1A 2WLYA 2GSJA 2HTMA 3E96A 3GM8A 3AU6A 1TJPA 4PEKA 3PR2A 4TV5A 4ROQA 3ZR5A 5B7ZA 2WKJA 4KKXA 3LPFA 2YCKX 2Y24A 4H01A 2J25A 1DJXA 5DX7A 5B7YA 2QUUA 2P76A 4HN4A 3W84A 3S8HA 1G94A 1B31A 4LAMA 3LQLA 1SJCA 2OVLA 3MSDA 4UTJA 5D05A 1LF1A 5IOBA 1R3WA 1IHIA 4NZJA 3OLIA 3WNLA 4IQJA 2VX7A 3HPFA 4PFHA 1L8NA 3I6TA 4FSAA 4NJHA 3O1NA 1BVWA 2DT0A 4Q4QA 3IJ8A 3P8JA 3QHMA 1BWLA 4QLKA 2RFGA 1ONWA 2XVLA 5A94A 4DIAA 5CSRA 4NI3A 5I23A 3MUZ1 2OZ8A 1M5WA 4HPGA 3T7VA 4NZ3A 2B4GA 2ZICA 3LGEA 1N2VA 3HQOA 4DHGA 2EEXA 4O0KA 2Z1WA 2EF9A 2UY4A 3GNPA 3ARSA 1EF3A 3T78A 4DUOA 2OB3A 2B81A 4I6KA 4IIBA 3SQLA 5I3FA 4UTUA 4N0RA 1TJRA 2XGIA 4QRNA 4DAFA 3AIEA 3CMFA 4JBRA 3V1HA 4W7VA 1B1YA 3RMEA 3TZFA 4JHZA 3VM5A 3IJ9A 2ZDRA 1Q13A 2VDHA 1XYLA 4G5DA 4AD1A 2PTDA 4MMWA 4RPPA 2PWUA 3GC4A 3UETA 2VM8A 3PBUA 3MV11 1W9XA 3LHVA 4PC8A 1YBQB 1KA9F 2C79A 1OG6A 1OT1A 1X6UA 4RE4A 4Q8TA 1O5QA 2Y5JA 2YLLA 1WOAA 1BYAA 3LCXA 3MSYA 2XIBA 2QIWA 2GGIA 3CS2A 2DFAA 3OODA 1X6NA 4Q7BA 3DX5A 2WHKA 4PTXA 1GYMA 1O5KA 3M0KA 5KETA 1J8VA 3S1XA 3NZRA 1MRQA 3QR1A 3BLIA 3Q37A 4DWSA 1XIDA 5I77A 1FOBA 1UBSA 1QW7A 2GDVA 3K4AA 1X7IA 3L67A 3LRLA 1WXZA 2V6AA 4CEUC 3M16A 1W5MA 4WD0A 1PHWA 2XGBA 4ICNA 2GQAA 3ELFA 3GZAA 5T9CE 4NJJA 4I7WA 4WQ6A 3GR8A 4KGJA 1BQCA 1JDAA 1GHRA 3U5YA 2TSYA 4F0RA 5JIWA 3ZMRA 1BTCA 1R9XA 4XX6A 4H00A 4YU1A 4JDYA 4C6MA 1PXGA 4W93A 1L6SA 3S4TA 3KW3A 5HQEA 1BXBA 4IZGA 1Z32X 1WBJA 4MDOA 4L1XA 1CEOA 3CYVA 4LSBA 2OFJA 1LUCB 3VD4A 5DT7A 1LBMA 3RITA 2DJXA 5I78A 1QR7A 1W9PA 1NY1A 2PLMA 1PKLA 1F7BA 1JIBA 2AAMA 2QAPA 3R25A 3VO0A 3FGCA 3QLLA 3HF3A 3A23A 3NM1A 4J3ZA 2XZ9A 4JXCA 3MUY1 3UY7A 4AY7A 3NQ6A 4O8RA 2VEPA 1GTEA 3GSMA 4N42A 1J2BA 2Q09A 1UYQA 3ZOAA 4LW7A 5CGQA 1NP2A 1OX6A 2DH2A 3LHUA 1TTJA 3VKKA 3CV7A 3FAXA 3L21A 1KFBA 1V4YA 1D7FA 3T42A 3GAKA 2XN1A 2X1RA 2OZ0A 4LYRA 4DPPA 2ZX5A 3KVKA 5H2ZA 3O2LA 3BVJA 5A6MA 3MWAA 3GTNA 1W1ZA 2QHAA 4JTAA 2ZUNA 3DFTA 2DIKA 4GABA 2ISVA 4Q33A 2CWXA 4OBSA 4ZO8A 4AWSA 1FWTA 4NP7A 3BAWA 3CWHA 1UWQA 4A29A 2NUWA 1K6AA 4IF2A 4QROA 4S3BA 1SO4A 1TPVA 4Z2HA 4LBUA 2FPTA 3LS9A 1BHGA 2YSWA 3NXLA 5AC4A 1PYMA 5BOEA 4YPJA 4N4PA 4AVOA 1EJ7L 1XYZA 3VIJA 1BF2A 1K8YA 3IIOA 4AYGA 2OQHA 4UTKA 1PZ0A 1TJ1A 4EWND 4YTRA 4XAZA 1PTDA 4XKMA 1KC7A 1DWGM 1R2TA 1XLCA 3A9BA 4IG2B 4A22A 1Z69A 2Q01A 3CGTA 3HQ1A 1UKTA 1VAHA 4GC3A 3OP2A 4NZ1A 1YXDA 3OBAA 3TYBA 2NUYA 2GJPA 4F0KA 3MUXA 5CBIA 4J2PA 4RDYA 1V51A 4Z1CA 1QWKA 5JH1A 3N15A 1FWWA 5H91A 2CLLA 2VEKA 1H09A 4UNKA 1QVBA 2IXVA 1MNZA 1RQEA 4JD4A 3CZJA 4UFKA 1HJXA 1ZBWA 4K3ZA 3BQ5A 1YNYA 2X2YA 2CZFA 4PCPA 2W91A 1SM9A 3REQB 1VR6A 5HNUA 5FSDC 1V0MA 3W1XA 2VOMA 1K7EA 1FVPA 2Q3RA 2XFFA 2VRJA 2OLAA 2FQIA 3IGHX 1KLYA 1L6YA 3FY1A 5HQLA 4OOUA 2NWRA 3SI9A 1TJ0A 3LQGA 3GLCA 4D1JA 4A2SA 3GBDA 5G4WA 2X1IA 1FKXA 3GW3A 1FWHC 2VUYA 4WY0A 2YIHA 1E9YB 1B2YA 1VYSX 2VCCA 1P6WA 4JQ1A 3M0LA 2JFEX 3LXCA 4Y8EA 1QPQA 1A3WA 3VMNA 2DZPA 1B57A 1UR9A 3CHDA 1EDQA 4IISA 1EOMA 4FALA 3CAWA 5D2VA 1GVRA 1ISXA 4FAMA 5AC8A 5AFDA 1TA3A 3VE9A 3T6CA 2O9RA 3IS4A 3QZ6A 3AIRA 4PRWA 4BWLC 4CVWA 1G9HA 1TWIA 2AL2B 2E8YA 5KMYA 2PMQA 4N6FA 4C6FA 1B4KA 1NELA 4D6GA 3UQNA 3A13A 1ML1A 1RK5A 2ZC8A 4QGCA 4AEFA 1XC6A 1DBTA 2AMXA 2WC3A 3AAMA 2BHYA 3TP4A 2HPMA 4Q4SA 1KBBA 3BOFA 2YCLB 2D1ZA 2R1LA 4WIWA 2YL6A 1JF5A 4YTTA 2ZUVA 1AUSL 3W3OA 1QI2A 2XH4A 1PDZA 2VFEA 4KERA 1E9ZB 8XIMA 4GOAA 4MKSA 2G97A 3FJ4A 2WB5A 3AROA 1XWYA 4Z0SA 2JF6A 2VC9A 4CCZA 1XGDA 3AWNA 2YXXA 4ALDA 4WCJA 3KBSA 1A5MC 3QTPA 3TOPA 3VGGA 4MWAC 2GQ3A 3SCQA 2PWEA 4DJDA 2CKSA 2PLJA 3QV9A 1ISWA 1M53A 4GFIA 1IWPA 3CWNA 4KFPA 1Q6LA 4IPIA 5KZMA 1F3WA 1MUWA 1VPQA 2GGHA 1TX2A 3EDFA 4D1IA 3BXWA 4YS1A 4HOZA 1CGTA 2BLEA 4AVFA 2J7FA 1RHCA 3IV3A 4REQA 2V5CA 3G1SA 3KBJA 4GUFA 4CD5A 2G3NA 3B04A 4OJYA 4JTQA 1H7OA 2VNCA 3QR0A 1XD0A 3N9SA 4A8RA 2WKGA 3ANVA 3VM7A 3P84A 3ES8A 4DWDA 1PX3A 4JTDA 4LOCA 2X09A 1JDFA 3H24A 1UD6A 2ZRZA 3PPGA 4GYPA 3UERA 3JUGA 3QC3A 2DW6A 1K1DA 4Y7EA 1FQ0A 4GA8A 3DHPA 1RY8A 1EXBA 4NRSA 4NILA 4WDXA 4DVOA 2QQ6A 4DBDA 4D6CA 3NZGA 4WKAA 2WNNA 3C0LA 5CZJA 1I2QA 1Q6CA 1QWGA 5BMWA 1XKJA 4UIOA 4N9EA 4K38A 3W85A 2OKTA 3A9IA 3RMJA 1VIZA 3TYAA 3TYEA 2CC0A 5CZ0A 4HZ7A 4NIRA 3NQAA 1VGAA 4L64A 1KRAC 1TKKA 4QIUA 4KGLA 1XDJA 1FFQA 4PMOA 5A8PA 3T09A 3GXTA 3QOMA 1DJGA 1F8MA 2INZA 4GY1A 4M6UA 1SVDA 3NQMA 1M3UA 4YWSA 3H7VA 2CERA 3BG5A 1Q4NX 4U33A 3LRMA 3W73A 3D3FA 4RE3A 4OTKA 4L6OA 4ZB0A 1QBBA 2NV1A 3EDJA 3EBVA 5C6MA 1XIBA 4R7JA 3G1RA 3SEPA 2WBGA 3EX4A 4YIWA 5T9BG 1FWGC 3CPUA 4NZ5A 3V0UA 7REQB 1XIFA 3GU1A 5F1VA 3M47A 4LJ3A 1H7XA 1VJZA 1V6XA 3W1AA 2PD9A 4U10A 2FB3A 1XYCA 3I4KA 3WLQA 3KLKA 2AAAA 3F5JA 2FVLA 3RFAA 3FKRA 1JYWA 4HZ8A 1WUEA 3RPDA 3QC0A 2PDMA 1ME8A 3PBMA 4FX7A 1E1CA 1I75A 4D6EA 1AJZA 4U31A 3ZM8A 3RHGA 2BX7A 5JU6A 3PZNA 4KESA 2Y7FA 3TFXA 1ZP3A 5GPRA 4LB3A 3LPPA 4GKLA 5EYWA 2J66A 1NWUA 4HHLA 4MOZA 4ZVJA 1TE1A 3I7RA 4B5TA 3WDRA 4M6PA 2H9AB 3UYCA 3PJTA 3UZYA 1NSJA 4WK9A 5C2GA 4UB9A 4Q8VA 1Z44A 1B9BA 1J10A 3B9OA 4C1NB 1TELA 1O7AA 2VMFA 2OT0A 4P7LA 5DBTA 4DWSD 2WZIA 1VZWA 1XSIA 2A21A 2C14A 1SR9A 4AZHA 3L4YA 4IQEA 4O18A 2GDUA 1WXYA 4D6HA 5EB8A 2ZYFA 2F61A 5ABFB 4CD7A 2YR1A 1W8SA 3ZLGA 3UWUA 1XIIA 1ZGDA 2B31A 4X2PA 3PB0A 2JQXA 1Q5MA 4CD6A 3H2CA 1OYAA 4ZB2A 5HWJA 1V0NA 3N2BA 2W5FA 1VRXA 1TX0A 3L2MA 5HMFA 4FOJA 1UJQA 3OU8A 2OSYA 1W1B1 2QF7A 2J4GA 3W87A 4X60A 2RGLA 3R11A 1BFNA 3KVJA 5L6UA 4CCCA 1UH4A 2HSAA 1U5VA 4F9JA 1EJWC 3E02A 3QQWA 4JNYA 1A49A 1WV2A 5DMLA 4WXZA 1IXQA 3AIWA 3NSMA 1YX1A 3QEZA 1JAKA 4EOUA 3WJWA 3FS2A 4Y9NA 4AWUA 1QNPA 3CL8A