5K3VA

Apo-pdx1.3 (arabidopsis)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
276
structure length
276
Chain Sequence
SPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGLGEAMVGINL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Pyridoxal 5'-phosphate synthase subunit PDX1.3
publication title Structural definition of the lysine swing in Arabidopsis thaliana PDX1: Intermediate channeling facilitating vitamin B6 biosynthesis.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 96
structure length 276
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2016-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5k3vA00
5I3JA 3M1ZA 4XZ9A 1X7FA 2A2IA 4OV9A 1H62A 3FIGA 4FIQA 2A7RA 2DU2A 1MEIA 1ALDA 1GZGA 4LS0A 3DBPA 3TUUA 3OBKA 2B7QA 2NWSA 3FEMA 3NR0A 8TIMA 2QCFA 1D3GA 4WD0A 3U6WA 1TTPA 5C54A 2YR1A 3C0JA 2CLMA 1H7NA 3G22A 3HG5A 1F2JA 4MZ8A 1JQVA 4S2BA 2Q3RA 2BWGA 3M7WA 4O54A 3QMRA 3N9RA 1TPDA 3N14A 4XTIA 4UTWA 1OF6A 5F2GA 2X1RA 2Q8LA 4JTEA 5LHEA 1TCDA 3G1YA 4DF0A 3DAQA 2RFGA 3QYQA 3UQNA 3PWAA 4I9AA 2OT1A 4IMDA 2RDWA 3KRZA 3W7QA 5TBOA 4GJ1A 2ZDRA 3PB0A 1TQJA 1U83A 2CW6A 3UYCA 3TMQA 4E2DA 3V1PA 4NVTA 4K37A 3S9YA 4UFLA 1UBSA 1QOPA 5IBXA 3LXAA 3HG4A 3TW6A 2G95A 4LUIA 4ORMA 1JCMP 4IOTA 4OQVA 1FWTA 2YGYA 2YYTA 3A5VA 1YDVA 1SPQA 4WOZA 3VFLA 4LV9A 1L6SA 1VZWA 4TO8A 2Z0IA 2YFOA 2CU0A 1I2NA 1QCWA 4BWLA 1BEUA 3TCEA 3LB0A 2QJIA 3DFNA 1H60A 3VI2A 2VKZG 1EWEA 4ZQNA 3W70A 4HNUA 2GPTA 2E6YA 3MP4A 1YPFA 1W1ZA 2BLEA 3W88A 3HQ1A 2E77A 1RVGA 4LC8A 2EKCA 2E5CA 2Y7FA 3W1RA 4CQ9A 2ZA3A 1LDCA 4O0ZA 2PRMA 5CKSA 1DKWA 4FXSA 4CLMA 5C6MA 4DPQA 1GVOA 2DZXA 4L4MA 1AW5A 3TH6A 5I3HA 4PC8A 3RLVA 4JTFA 4DPPA 2GQ8A 1RPXA 2EF9A 3JR2A 2B4GA 1MEWA 3QM3A 4MY8A 4ORIA 4QSHA 5CZSA 3ZWTA 2XN1A 4ZZ9A 1PV8A 3S5ZA 3HO8A 3K30A 4O1CA 3HMJG 4MLJA 2BZNA 1VCFA 5KZMA 2VELA 3QZEA 4X2RA 2R94A 3D0CA 1KM6A 3WJYA 1EX5A 1EEPA 4O13A 1XM3A 4GNJA 4RX0A 3KVMA 2YXGA 4R53A 3UWYA 3NL3A 3MI2A 4ADSA 3S5OA 1JVNA 3VNDA 4RR4A 2FB2A 1I2RA 1JJKA 4Q4KA 3KHJA 1H7XA 2GJLA 1TTIA 4Q32A 4QNEA 3FJLA 3NGJA 3W07A 2QCMA 5F2IA 3QPZA 1K7XA 4O11A 4CCDA 2NXGA 4POCA 3B03A 4LC6A 3WJXA 5CZTA 4XKYB 1QMLA 2ALDA 3NXFA 3S8HA 3CIWA 3O6DA 2W0UA 1VYSX 1A5CA 1LP6A 4H3DA 4UIOA 3OIXA 2HMCA 1QR7A 1FCUA 1TPEA 3MI6A 3EKLA 1A5AA 3ZS4A 2A21A 4D2JA 3TK7A 3ZFHA 4UNKA 3G24A 1PVNA 2KZHA 3ZWSA 6TIMA 5EKYA 5F1VA 3TAKA 3P62A 3DFTA 4JTLA 4JDBA 3O63A 4JTHA 1KFEA 3NPWA 4O53A 1NAL1 4GRSA 3SSJA 4UR7A 2AAMA 4ADTA 5HMSA 2QCDB 4A22A 4HNTA 2NUWA 5CZJA 5FEPA 3VE7A 4JTUA 1YTEA 3GXNA 4MOZA 2CLHA 4LRTA 4CNPA 3GXPA 1L2UA 1G69A 1KFBA 3NYZA 3C2FA 1PHWA 4ZQRA 4WQ6A 2O7SA 3PM6A 3LTPA 4O57A 4MFDA 2ZZ6A 1B4KA 3UY8A 2G97A 2B0MA 1FXPA 3CIXA 3FKRA 1QWGA 1Z48A 3M9YA 1P1XA 1C9DA 2R8WA 5L6UA 3W75A 1JRCA 3PUDA 3QH2A 1YXCA 1S5VA 1MEHA 1R2RA 2VFHA 1NSJA 3TFXA 1G4SA 4I7UA 1FUYA 5BNKA 1J2WA 1FCBA 3LERA 3DFQA 3QPYA 3CU2A 5AYYA 1FBAA 2VXNA 1W5OA 4LY8A 4PFMA 4IX0A 1P0NA 4QAIA 1JQXA 5K9XA 1QPRA 1FX6A 1RQHA 3G1SA 3LI0A 4LRSA 2WNNA 3BARA 5EYWA 5KZDA 5T26A 1OFRA 1TPB1 4YMZA 3W72A 1LCOA 3HBLA 3BLEA 3NZ1A 3ANYA 1YDNA 1ZY9A 3UXAA 5F2LA 3STCA 1K02A 3PG9A 1ZAHA 3DH7A 1N55A 4LV4A 4DO6A 4I7VA 5EY5A 2Y7GA 5D32A 4CQ8A 3FKKA 2FTPA 1X6UA 1XC4A 1OABA 4WX2A 2GQAA 3W2MA 2AQWA 5IBXC 5LNRA 4TIMA 1YXDA 1KM1A 4UFHA 5D2YA 3DXIA 5HULA 3KXQA 4O28A 3RK8A 3I7SA 1DJNA 4YXGA 2NLIA 2V5LA 5G1YA 4EOUA 2QJGA 3GB6A 2UV8G 2Z2UA 3M47A 2ABBA 4GFSA 4BR1A 3LBMA 3IIOA 1I2QA 4EWND 3ATYA 5CGQA 2ZCGA 2ZRUA 2ZRZA 2J9YA 2EAWA 1AL8A 1HFBA 3EXRA 4CCEA 1DOSA 5CPMA 4C1LA 2CFFA 1HTIA 1VLWA 3LXCA 1AW2A 1UB3A 3L0KA 3LTSA 3TJLA 2EHHA 2VFEA 4IQLA 3TDFA 1K7FA 4A2SA 3HGSA 3W23A 3R2GA 2V9DA 5C55A 1LOSA 1IIGA 5I3GA 3TSDA 4QM1A 3LLFA 3TA6A 5HR6A 1YTDA 2B7NA 2X30A 4OHQA 3S42A 5CSSA 1BWLA 2IQTA 1HO1A 4GUIA 4OBTA 2CLEA 2JGYA 3W22A 2E5DA 4MLRA 3FYPA 4HNNA 4M7TA 1YTKA 3BV4A 1EP3A 1OHLA 4K38A 1OJXA 1ZAIA 5I3FA 1R30A 3EWBX 3BG3A 3MP3A 1FWWA 4QQ3A 3NL2A 3NL5A 1VQTA 3THQA 3FOKA 4UFKA 3CEUA 2NXIA 1FY6A 2YPIA 3NA8A 3BGJA 2DZVA 2WJZA 4HSOA 5A5WA 4N2YA 1KW1A 3JRKA 3EKZA 3LCFA 1OFOA 4M6VA 2TYSA 1EUNA 1W3NA 4O10A 1OG0A 1W56A 3N3MA 3A9IA 5F1UA 4NNCA 3UWUA 3BW4A 4NZFA 3M16A 1ME9A 1OYAA 1TIMA 3W84A 2ABAA 1X8FA 4YLWA 1BKSA 2H6RA 2CLOA 4JTJA 1EB3A 5CSRA 3T40A 3F03K 3LXBA 4R33A 3BVJA 1QDSA 3A22A 3NG3A 1QO2A 3PSVA 1W54A 1HUVA 4YL2A 3O05A 3C2EA 4U28A 1FWSA 1A53A 5FESA 3DHDA 4UTTA 4QIUA 3EXTA 2XN0A 4K7YA 1E51A 2QDHA 3GIYA 4XQ6A 2BX7A 3STFA 3F4WA 4K8HA 3M44A 1GVFA 4TU1A 1LRNA 4LVDA 4N6EA 1QNVA 2VFDA 1TPH1 2WOQA 5I3IA 3IIPA 3HF3A 1TO3A 5FEZA 3W7PA 2J6XA 2ISWA 4UNLA 2TPSA 4IMFA 1XDLA 3G18A 3KRSA 3SECA 4LS2A 4UTHA 3W85A 1S5WA 5BMXA 4Q33A 1VYRA 3GXTA 4FEZA 1BTMA 1SO6A 3PSWA 3ABRA 1O94A 4IMCA 3W1NA 1GVSA 1TV5A 3C6CA 1XBXA 1TJPA 4GXMA 4RXFA 3C56A 4CQAA 3QQ0A 3G8RA 5DCBA 1H1YA 2OT0A 4N9DA 2I14A 2ZZ2A 2QF7A 4OT7A 5AHLA 4RK8A 4FF7A 3C52A 2YX0A 2E5BA 4PL1A 4NJGA 4ZQMA 1W5MA 3ATZA 2E6AA 5CG7A 4Z0SA 1FCVA 3G1HA 3UXDA 1WXJA 2EPHA 2ZZ5A 5DLCA 2G5WA 1LOLA 4O52A 5KMYA 4CNOA 1VRDA 2C3ZA 1R2SA 2C16A 1XBVA 5CPOA 2TMDA 3N19B 3M6YA 3LCGA 4N02A 1YLVA 1OYCA 2X16A 3RLUA 4Z1AA 5AYXA 1VS1A 3LCIA 1O95A 4QITA 2G96A 4EF9A 5LNUA 2X2GA 4JTIA 1K7EA 3INPA 4JR5A 4XWUA 2H90A 1MSSA 5A8GA 4WY0A 3FFSA 5BW6A 1AW1A 2WSYA 3LHTA 2HTMA 3KRUA 3EX6A 3W1AA 5H2ZA 3NAVA 4AAJA 1CI1A 1P5BA 1JCLA 4WXYA 2FQIA 2H3BA 5D05A 2QKFA 4MY1A 4Y8FA 3L21A 3E02A 2W79A 5G2IA 1OF8A 1WOBA 3F4NA 3EWWA 3PF3A 3S6DA 3W76A 1DQWA 2GVLA 3EWZA 1KFLA 4JN6A 1FQ0A 2V82A 2GJNA 3L2IA 2NZLA 4UTLA 3UWVA 2ZZ1A 1Q45A 3OA3A 4ML9A 5U4NA 3IGXA 2YCEA 4JIPA 1W3TA 2ZZ4A 2Y85A 4RZ4A 3W87A 1DQXA 3Q94A 1XBYA 4N9EA 5GVJA 3U2OA 5C5YA 1T0OA 1TQXA 4H4IA 1OX4A 2CLKA 3O06A 2Y6ZA 3BLIA 3NM1A 5F4XA 1TTJA 3E49A 2ZRYA 3CT7A 5HINA 1AG1O 2ZRVA 3CHVA 1IXNA 3QC3A 3LBCA 4UFIA 4U4MA 1H7WA 2XFWA 1KLZA 4JTKA 2DZSA 4MKNA 3IV3A 5L9FA 1ADOA 5TIMA 3NQCA 1P4CA 5LSMA 1GTHA 4AXKA 3P61A 2J88A 4LUJA 4FX6M 5F4SA 3E9AA 1FDYA 3ABOA 1GWJA 3KVKA 3O15A 3MHFA 4RKAA 3IRDA 1KV8A 1B9BA 4KFOA 3TQKA 4WJEA 3A24A 2BXVA 1SW0A 4NJIA 3GNDA 4X9SA 3GAKA 4UMAA 3CM4A 4GWEA 4XTDA 3W2UA 2NX9A 3LDVA 1TREA 4K7VA 3EX3A 3S1VA 2H8XA 1QO5A 3M41A 4JTTA 5LHFA 3GNNA 1QPQA 3HGJA 3G1DA 4NU7A 3PR2A 4MYAA 4O50A 4AB4A 1FDJA 3BW2A 2J9XA 4UFJA 3UWZA 3NO5A 2P0OA 2Z6JA 5EL1A 3OHIA 2Q3OA 2NV2A 3WJSA 1YADA 1C8VA 1L6YA 3C2VA 3L68A 3T7VA 1PE1A 2ZRWA 3QF0A 3QSRA 3IGUA 4NJJA 4O14A 4TX9A 3W7IA 4UTMA 3SIZA 3BPWA 1EP1A 4G1KA 2YFNA 1M5WA 1KM3A 3NQ6A 4JX4A 4Z1CA 3W2JA 3LHYA 4AWSA 3PULA 5D33A 4W9TA 3MO7A 3O6YX 5FEXA 5G1TA 1I4NA 1ZHAA 1OK6A 1J5TA 1GG1A 1LRTA 5FF7A 4TMBA 2VFGA 1H50A 2E6FA 3HIJA 3W1LA 2E1DA 1AMKA 4UC5A 2QCGA 3TMLA 4FNPA 2V81A 1KLYA 1OFAA 4UUIA 3A21A 4AWTA 1I2PA 2V5BA 1Q3NA 3B0PA 2RDUA 1C29A 2CZDA 3H55A 3IVUA 3E12A 5D2WA 3W73A 4FX8A 3MI3A 1HL2A 1WA3A 1KBIA 1KM0A 2PCQA 5D02A 1JUKA 3WK0A 3T4CA 3QMTA 5F2MA 3W7HA 1V5XA 2VEKA 3W7NA 3MW7A 2DZUA 1PL9A 1PCWA 3P80A 4XUGA 4QNWA 2CWNA 4JDYA 4Z08A 3L9CA 1P0KA 4NX5A 4S1FA 2FLIA 5E0KA 4EIVA 1TV8A 1TRIA 1JRBA 4MPQA 1NF0A 3HJZA 3G3DA 1KFKA 4LVBA 1SW7A 2J9ZA 1K3UA 3C61A 5FF3A 1XXXA 3H53A 4UTUA 2PURA 2H8ZA 2Q8ZA 4RV8A 5DCEA 1W37A 1L9WA 5BRBA 4MZYA 2A5HA 3WK3A 3G8EA 1XI3A 3MYPA 3LTYA 1OYBA 2E6DA 3CC1A 1GJPA 3SFKA 1F6KA 3CQ0A 5KITA 1M6JA 1PIIA 4JTGA 2A1YA 3N73A 5TQLA 1SSGA 1W5PA 4A21A 3EX4A 3KAOA 1ZAJA 4JEQA 3TSMA 4UTWC 4JNMA 3ABSA 5G2HA 3B04A 1THFD 3PS7A 3NQEA 3R89A 1RR2A 2I9EA 1T8XA 1SUXA 3F1QA 3PVFA 3USBA 3L67A 4YCOA 1VJIA 2YW3A 4RCXA 2DZTA 3EWYA 5F4WA 1T99A 2JKEA 2ZZ3A 4LTSA 4NZJA 2RHGA 1RZMA 5G5IA 2NXHA 1SFLA 5K4XA 1IXOA 3NQ8A 2C14A 2NUYA 4O15A 2B7PA 5KINA 4FNRA 4OE7A 3L0NA 1ONRA 3W3OA 1KBJA 1VLIA 2ZBTA 1TRDA 3PB2A 1EIXA 3QRHA 3DFPA 3W83A 3KVLA 1I45A 4BWLC 1VGAA 1WQ5A 5ABTA 4DO5A 4IX2A 1F7BA 1G6CA 2Y7DA 2ZA2A 3U8GA 1Q6LA 3KVJA 1B3OA 2D73A 1H51A 1EPXA 2FFCA 1R47A 4N4QA 2FPYA 2WSQA 5K3VA 3DU0A 4FXRA 4UFMA 1XKYA 3B0VC 1RV8A 1NF7A 1M7PA 1F05A 3W6YA 1SZGA 4RZ6A 3TQ0A 1SZNA 1B4EA 3B0UX 4PODA 2ZYFA 2OZ0A 4WY0B 1L6WA 4TMCA 2Y70A 2NV1A 5LZLA 3P8IA 2PRHA 2Y88A 2F84A 1VCVA 1G4PA 1W8SA 1JCJA 3GDMA 3P81A 2X1UA 3CLMA 5SWUA 3R13A 2WNQA 3L65A 2V2DA 3LHZA 4RLIA 1ZENA 2JKAA 4BF9A 3EWXA 3P82A 4P61A 3MUXA 3G1VA 3OVPA 4DBEA 3PY2A 4B5NA 1VPXA 3HGRA 2QCEA 4LT9A 3JS3A 4DF2A 4FHAA 4PTNA 3LOTA 3O07A 3C3NA 4UCGA 4NX0A 4MVAA 1SSDA 1R2TA 2FJKA 2ZQ0A 2ISSA 1KTCA 3LCXA 4NJKA 3LGEA 5MHBA 5D30A 4KFNA 1X1ZA 1OX4B 3LX9A 5AHFA 2CZ5A 3W1MA 5C2XA 4I7WA 1OVDA 1VHCA 4IUOA 4MZ1A 4FX7A 2QUTA 4FNQA 3DENA 3H54A 5DCDA 3BW3A 5BOOA 1BWKA 3I68A 1DBTA 4MIMA 1MZHA 1WX0A 1UUOA 2NWRA 3W9ZA 5D37A 1DVJA 3BGGA 3KOFA 5LNVA 3TAOA 1WBJA 3DKJA 4HIBA 4GBUA 3DFOA 1W3IA 4R7JA 3W7CA 3GKAA 4M19A 2CZEA 5K9CA 1ME7A 3KFTA 3TROA 1Q6QA 1H7OA 2OJPA 1LZOA 3GR7A 3LHWA 3TR2A 3M5ZA 4WUIA 3G0XA 5AYZA 2PC4A 5K4ZA 2WSRA 4O1BA 2FIQA 2W6RA 4AHOA 5HWNA 1D9EA 5HNRA 3TU9A 3ELFA 1KM2A 1TJRA 2HS6A 2F7FA 3TXZA 1IF2A 6ALDA 3EX1A 5E93A 3EX2A 4A3UA 1WAUA 1NVMA 3BG9A 4A29A 3B06A 3M5YA 4N9BA 2X1SA 1EA0A 4MY9A 3W1UA 1O5XA 4O19A 3GAYA 1LORA 1JR1A 2YDAA 2A7NA 4RJEA 5D2XA 3WJZA 3O8AA 4HT3A 3UWQA 3WK2A 4YWIA 1WYIA 1RD5A 3QW4B 3IEBA 3UNDA 1FWRA 2ISVA 3DI0A 3TV8A 1ME8A 1KTNA 2DJLA 3QMSA 1ZFJA 1JUBA 2GVJA 1U5JA 1GQNA 4NXKA 4NXSA 4DO4A 5AC8A 2RKXA 4MUZA 2DZPA 4E38A 1KM4A 5G2WA 4HHPA 1KA9F 3W7MA 1H7RA 4YCPA 2DZWA 3SZ8A 1X1OA 5HJLA 1H5YA 1XDMA 2DP3A 3LCWA 4WXZA 3UWWA 1G4EA 1SU5A 3RNDA 2GOUA 2QAFA 1N8FA 1GG0A 4KKXA 4OGZA 5D03A 4NJHA 5J5RA 4M6QA 2YZRA 4E0CA 1IXPA 4HN4A 3TIMA 4FO4A 5AB3A 5D38A 3EXSA 2GUUA 3I6RA 4BK9A 1IGSA 4MJZA 1UJPA 3W7LA 2NX3A 4O8RA 2ZFAA 4XBKA 1LTDA 4FNUA 3O16A 5AHMA 3I7QA 4UTJA 1B57A 4IWWA 3LM7A 1IXQA 4JTSA 4Y96A 5FF4A 1ZJIA 3BLFA 3TW7A 2QCCA 3A23A 2FPVA 4ZQOA 4O18A 1TPFA 4IXHA 4ZMGA 3GDKA 1TB3A 2AGKA 3BO9A 4O12A 5HR7A 1V7YA 2WO5A 3TE9A 1IIHA 4O4VA 3GX9A 3I7RA 1DL3A 1EWDA 2QR6A 4O16A 3PBVA 1LROA 4JICA 2ZTJA 1GVRA 7TIMA 3GDTA 3GLCA 2C15A 2VC6A 4N4PA 4RZ5A 1Q6OA 3M0ZA 3MJYA 4IJBA 1QPOA 2QDGA 3HG3A 1UUMA 2R14A 2Y7EA 3SI9A 3TNOA 3T55A 2QCLA 2YW4A 4NQ1A 4BI5A 3LCHA 1QOQA 5AC6A 5G4WA 3OEXA 1S3HA 1LRQA 3LRMA 4Y9AA 2WQPA 4C1KA 3CPRA 3EEGA 4ZQPA 3HPSA 4FB7A 3VE9A 1WOAA 2ZRXA 1VR6A 3E0IA 5DXXA 3N2MA 1XCFA 2TSYA 5DY2A 1SW3A 2EGZA 3Q2DA 1M7OA 3W1XA 4KWVA 1YPIA 1K8YA 3NQVA 3TQVA 1FWNA 2CLFA 3N9SA 3S1XA 3B4UA 3PBWA 2WPBA 1K8XA 3W7DA 2Y63A 3NOEA 1Q6RA 1TPUA 2PE4A 4UXDA 4PEKA 3TC6A 1AL7A 4JX6A 1PS9A 2C19A 5U7SA 4K39A 4BI7A 3R12A 4EVZA 1EP2A 5I3KA 3WFAA 1GYNA 3SJ3A 5DN1A 3SGZA 4DELA 4X3ZA 4K8EA 3A5FA 4PH6A 4JXCA 3FS2A 4IMEA 3PBUA 4UTKA 3PC0A 4BFAA 1FCQA 3UZJA 4LNYA 1LBMA 3DHFA 3NEVA 3QFEA 3GR8A 4O4WA 3W7JA 2FPTA 1W0MA 3MBDA 1ZNNA 1ICPA 4QISA 1GVQA 3GDLA 4LVAA 4FNTA 3V75A 1ICSA 2TRSA 3W7GA 3TKFA 2WKJA 2A4AA 2X1TA 1MO0A 1TPWA 2XN2A 2VFFA 3RU6A 4A2RA 1O4UA 1TPVA 3RF9A 4M6PA 3TC7A 2RH9A 3B05A 1TTQA 3SW6A 1TV7A 4JX5A 3IIXA 3TSBA 4UR8A 3NL6A 4AF0A 3LRLA 5AFDA 4NUWA 4JD4A 3GKFA 2DJXA 2OMAA 5D04C 5AN7A 1F5ZA 1KTBA 3L66A 3MWAA 1NEYA 5LGZA 4AHPA 3C2RA 4GUFA 2NUXA 1OFQA 4UTTC 3G0UA 3NDOA 4LS1A 4UMCA 3Q37A 4M7SA 1SZEA 1K03A 2QEZA 3NVTA 3N34A 4LVGA 5DY3A 2OCZA 3GDRA 4ICNA 1FXQA 1ZALA 1I2OA 2BTMA 1GT8A 5DXYA 1YYAA 4P2VA 4JIQA 3UPWA 1OK4A 3PUEA 3LCLA 3VCRA 2WV8A 5CPNA 3FJ6A 2QCNA 4IXXA 1WBHA 2JK2A 4K36A 4GE8A 1EUAA 3OVRA 5DELA 4PL2A 2J24A 3PG8A 4HKPA 4M5PA 3S5NA 3UZ5A 1W5NA 5FF2A 3LHVA 4Y6GA 4L4LA 1XL9A 3G1FA 3S1UA 1JCYA 2ATMA 1HO4A 4X22A 5DBUA 5FI8A 4ZL1A 1A50A 4HSNA 3GK0A 3DGRA 3W1TA 4LVFA 1SO5A 1N7KA 3L0GA 2A6LA 3PAJA 1G4TA 2E68A 1QPNA 3STGA 3M43A 2GVGA 3W2LA 1SO3A 3W7OA 1CW2A 2ATSA 4XBSA 3RMJA 3GYEA 3G3MA 1VHNA 3AJXA 3HG2A 4AEOA 1A5BA 2HSAA 1YDOA 5G4EA 3P74A 3PBYA 2PRLA 3DKLA 3T78A 5E1QA 3EB2A 2ZTKA 3IGSA 3TX9A 3L5LA 2JKPA 3R8RA 3AO0A 1MXSA 4CCCA 3DI1A 4ADUA 4EF8A 3HPZA 2QUUA 1T96A 3PUOA 4KWWA 4AH7A 1S5TA 4RXGA 3ZR4A 3HPXA 1ML1A 4JYEA 3NQGA 1SQ7A 2C13A 5HQEA 4IGHA 1CX9A 4FIRA 3IVSA 2B7OA 2R91A 3NQMA 4NNAA 1J4EA 5H91A 4DEFA 2A85A 4AMAA 2Y61A 3W1QA 4JY8A 1F6PA 2OX1A 5KSWA 4K6AA 3CTLA 1SFJA 3P84A 4ZQCA 3NNTA 1TMHA 5HUPA 3S1WA 5HWMA 3R5EA 4AHQA 3SY5A 1JULA 3T44A 4OU1A 4E2BA 1KFCA 1H1ZA 2A7PA 3MYOA 3MHUA 3NM3A 5BMWA 2V2CA 1JCXA 1G7UA 4OV4A 1LYXA 3QEZA 5DBTA 1PHQA 2CLIA 3QW3A 2JGQA 3HB9A 4LW7A 3I65A 3S5YA 1NFBA 2V0TA 1WDWA 1VCGA 3P7YA 3WK1A 1JUEA 4ZVJA 3LV6A 4UMBA 1QAPA 3W71A 1HG3A 3QQ1A 3NPVA 1H63A 2CZFA 3UD6A 4AVFA 4MFEA 3YPIA 1QFEA 3UPBA 2VOMA 3LLDA 1TYGA 2YYUA 4NNBA 2FDSA 2V30A 1VYPX 5AHNA 3NQ7A 2V2HA 3GZ3A 1RQBA 2P1FA 5CPLA 3ABQA 4UTIA 1LLZA 5HUOA 4CNNA 3O6CA 1LLWA 3SR7A 1K8ZA 5D2VA 5KZEA 4N6FA 1VC4A 4FNSA 3G0SA 3O1NA 3N2XA 1W31A 3G1AA 3HGOA 1OFEA 1UCWA 1DV7A 4JGDA 1WV2A 3E96A 5K2ZA 2J27A 3W7RA 3STEA 3W2KA 4HPXA 2ZZ7A 3W2NA 3W86A 3S0CA 3NQFA 4LU0A 3LHUA 1AK5A 2QJHA 2GQ9A 5EA9A 3UY7A 1XFBA 3CB8A 3LRKA 4GUJA 3IIVA 3EWUA 1GEQA 3DZ1A 1DJQA 2QAPA 3GVGA 1Y0EA 3RFAA 1OFPA 3MP5A 3MMTA 4XKYA 5KTLA 2C0AA 1H7PA 4H6KA 2RDTA 4JY9A 1F74A 4HNVA 2E09A 5J5DA 5AOUA 1OFBA 4WY0F 1XUUA 1KM5A 4IPJA 3SGUA 4ONVA 1SZFA 3P8JA 1JCNA 3NQDA 1XUZA 2VENA 1KFJA 5CZ0A 2A6NA 4MYXA 4DF1A 3G1XA 2QCHA 2I1OA 3P67A 1TSIA 3NQ2A 1LBFA 1H61A 3W7KA 5FEWA 4GC4A 5LGXA 1GYLA 4AWUA 4J9JA 2VEPA 2Y62A 3VKJA 3MBFA 1G67A 1OX5A 1ZCOA 2Z6IA 3LV5A 3HOJA 2NX1A 3BG5A 2LLEA 3OG3A 4DQWA 5AHIA 2HS8A 4S2CA 4IPIA 2QCDA 2C1HA 5HWJA 3M5XA 4IMGA 4MJMA 3QSTA 4WOQA 4NT0A 1Z41A 4O0KA 1RQEA 1GTEA 4PCFA 1F73A 2P10A 2VEIA 5K9DA 2CLLA 1XBZA 4JS3A 1A5SA 5FF0A 5EMUA 4HPJA 3WJWA 2C6QA 1KV5A 5D2TA 2WNZA 2DORA 5AHEA 3FA5A 3CWOX 3NPUA 2O7QA 3CWNA 1LOQA 1Z42A 5LNWA 4KFPA 4Z1DA 4JYDA 3TJXA 4QJ1A 3W7EA 2ZA1A 3C2OA 1FDZA 3M5VA 1GPWA 2VEMA 1D3HA 3NPXA 1I8JA 5LKYA 1LBLA 1G7VA 1PCKA 3THAA 4PA8A 1F76A 2JBMA 3L5MA 4O1AA 4R34A 3IVTA 3TXVA 3C8FA 3KX6A 1VH7A 4Z0JA 1O5KA 3TFCA 3P5YA 4Y90A 1DHPA 3L5AA 3P5ZA 3MHGA 1R46A 1UASA 3C4UA 3NZRA 4O1DA 3QJAA 1OX6A 3FYOA 1SO4A 5EPDA 4OWGA 3P60A 4DBDA 4O17A 4ALDA 4AF0B 4Z1BA 2A0NA 5D09A 2QUVA 2V8ZA 1GOXA 3DFSA 3FLUA 5LNSA 1W5QA 3Q58A 3OVQA 4GUGA 5AC7A 3B8DA 1O60A 2VFIA 2Y89A 3W1PA 3BK0A 2C18A 3IIZA 4LOCA 1LM1A 5IM51 1SR9A 4LWWA 2YSWA 5K7JA 5EBUA 4GUHA 1TPC1 4N9CA 1ICQA 4WZHA 4DXVA 2BSLA 4TR9A 1YXYA 3CEPA 2FB3A 3NQAA 4BI6A 3W74A 1DORA 3LI1A 2H3DA 1OFDA 4JYFA 1Z44A 2Z1BA
chains in the Genus database with same CATH superfamily
2PDQA 4YU1A 3HV9A 4FIQA 4MUPA 1VP5A 2A7RA 3KWSA 4DRSA 1CDGA 3GHRA 3VDCA 2EPLX 4G56A 2UY3A 4LS0A 1MNSA 3DBPA 3OBKA 1PZ3A 1TX2A 1VIWA 4RUBA 8TIMA 2QCFA 5HMEA 3BLPX 2BS9A 3G22A 3M0LA 1UBPC 5HBFA 2MUCA 1CXKA 2CBIA 1EIBA 3GVQA 2DV0A 3C0QA 4OFCA 2O56A 3M7WA 4CVUA 3QMRA 3VNMA 3VOFA 1TPDA 1A4LA 2AMGA 2QF8A 4UTWA 1OF6A 4DYJA 2Q8LA 3R8GA 4JTEA 1MYRA 1TCDA 3G1YA 2AKMA 5EMJA 5TNVA 1E4IA 2RFGA 3IRSA 2ADAA 4IMDA 5HAOA 3RUBL 3H7RA 2EPMX 3W7QA 1YNQA 2YLLA 4GKTA 2JF6A 5TBOA 1H4PA 2ZDRA 4PFHA 1NOFA 3TMQA 1UBSA 3LXAA 2WQDA 2IKIA 1OB0A 4LUIA 3SN0A 4D71A 1JCMP 4OQVA 3VIKA 1FWTA 9XIMA 3LU2A 2YGYA 4GNKB 3QBUA 1YDVA 4X63A 2XIBA 1J18A 4TO8A 3QKEA 2Z0IA 3K5XA 1QCWA 1HKJA 4BWLA 1YDYA 1K4HA 3LB0A 4S3GA 3DFNA 3WFZA 1H60A 3B8TA 3CV6A 4ZR8A 3OGVA 5GQBA 4LB3A 1VBGA 4ZO6A 4AD2A 2E6YA 3MP4A 2BLEA 2OTDA 3W88A 2WMHA 3OQEA 4H9TA 4PB5A 2DVUA 1UZ4A 3N25A 1E6QM 1TV2A 3VNZA 1GHSA 3LA4A 3PJWA 1E4LA 1GVOA 1UZHA 2DZXA 1AW5A 3KM8A 3GD6A 3RLVA 4JTFA 1HT6A 3AI0A 1MEWA 1Y5XA 5CZSA 3ZWTA 4CEXC 4HP5A 1MUMA 3S5ZA 2Z7KA 3K30A 3FJNA 3AU2A 1T6MA 3QZEA 4ZTXA 1J79A 2R94A 4OBRA 3BLKA 2YIHA 4A3YA 4RPQA 1ITXA 4GNJA 4HYWA 3KVMA 3TTYA 2YXGA 3REQA 2PGWA 2PGRA 4ERIA 4LBRA 1GKQA 4RR4A 5IFTA 3TYCA 3SSZA 3WMLA 1UD5A 1CENA 3QV7A 3CUXA 2E8YA 3AIVA 3NGJA 5F2IA 3QPZA 5GNXA 4O11A 4DY1A 2NXGA 5J8LA 3PPCA 2D3NA 3LK6A 1OY0A 3ZM8A 3WJXA 4XD4A 4HU4A 1QMLA 1UKPA 2ALDA 2BOFX 5BROA 4PSRA 1U1JA 2ZIDA 2BDQA 3CIWA 2O9TA 5ECUA 4W4QA 1VYSX 3I6TA 4H3DA 5LIXX 2HMCA 1QR7A 1CLVA 5CPQA 1FCUA 5A6LA 1MNZA 3MI6A 4FALA 3EKLA 3RR1A 2A21A 1OSEA 4XX6A 1X1NA 4RZBA 5EKYA 2FFIA 5F1VA 1L6FA 1UROA 2PDJA 1R7OA 1GOWA 4O53A 1NAL1 3U0HA 1FTXA 4UR7A 2QCDB 4AZCA 4HNTA 1EC7A 3DEQA 5FEPA 3VE7A 3BDKA 3H70A 2BHUA 4LRTA 2E3ZA 3OIHA 2ZC1A 4HK5A 3BTNA 3NYZA 1PHWA 4ZQRA 4ERGA 2O7SA 4XIAA 4O57A 1B3VA 2XPKA 3ZQ9A 1E9LA 3AMLA 1YQ2A 1B4KA 1FXPA 2BOGX 3SDOA 3M9YA 4JHZA 1C9DA 4EE9A 3SFWA 1E0VA 1PWMA 5L6UA 1POJA 1YXCA 1R2RA 1CGXA 3AC0A 3TFXA 1EEXA 1G4SA 3PFRA 1FUYA 4ACZA 1J2WA 3VC5A 3DFQA 2BHZA 3RM9A 3BV7A 3HQPA 3MMUA 3APGA 1W5OA 5M1TA 4IX0A 1XRFA 4GYKA 1XLIA 4B5UA 1K1DA 1XYLA 2R82A 1RQHA 3RAOA 5FSDC 5FJIA 1GHRA 1UKQA 5T26A 1WKYA 1KRBC 4A6GA 3G77A 1QK0A 1YDNA 3CGTA 1ZUAX 3CHCA 2OLAA 3AHYA 3N6HA 2IW0A 1HKVA 5EY5A 4HB7A 3FK4A 2FTPA 3KBMA 1X6UA 1IZCA 1OABA 4JOMA 4WX2A 2GQAA 3W2MA 1VEPA 2IKHA 2OEJA 4GXPA 2WBKA 5D2YA 5D9MA 1QW7A 3DXIA 5HULA 1HJSA 4UNIA 1CBGA 4EK7A 3QLDA 2F38A 4JIRA 1OCQA 4BR1A 3WLLA 2GQ3A 4PBEA 4BQ5A 5HNTA 2ZRZA 4ZFCA 4I3GA 4H9VA 2EAWA 5C2GA 1AW2A 3L0KA 3LTSA 1XCXA 1JYWA 1OZMA 3HGSA 4TOQA 5C55A 5CBIA 2VWTA 1IIGA 4H7ZA 3GG0A 1XRSA 1VAHA 4QM1A 4OZOA 2OQYA 2W92A 3RGTA 1EQCA 2B7NA 4OHQA 2FZ8A 5CSSA 4CN4A 2JGYA 4F8XA 4CCZA 1E0UA 4MLRA 4HNNA 4M7TA 1YTKA 1BYBA 1Y7VA 1JDCA 1OJXA 1KWGA 1UHVA 3H2MA 3EWBX 2OSWA 1BYCA 3NL5A 2NVDA 1XD1A 1UKSA 3WF0A 3NA8A 3BGJA 5A5WA 4GGHA 3V1HA 1KW1A 3JRKA 3EKZA 3VMNA 2ZUVA 1OFOA 2OYMA 3B8SA 4M6VA 1DXEA 3SUTA 4Y9MA 4TV6A 3OLDA 3CB3A 1L8NA 4UQAA 1V03A 3VDGA 1KD0A 4GG9A 4WIWA 4NNCA 3BW4A 5AKQA 1TIMA 4W7UA 2OQLA 3FA3A 3WMCA 2H6RA 3THDA 3T40A 3F03K 3N6JA 1QDSA 3NG3A 4INFA 3PSVA 1W54A 4K8GA 1HUVA 4S3CA 3O05A 4Q4PA 4XZBA 4QRNA 4JTRA 4FS9A 4YVVA 2XN0A 4QLLA 5A8NA 2QDHA 3GIYA 4WDXA 1XYBA 3ZYZA 3STFA 2PPGA 2J4GA 2VX6A 4N6EA 3ZVHA 7PTDA 4Q8QA 3LG3A 3MZNA 1GZ1A 1WKFA 1Q8JA 1JD9A 2WOQA 3WQCA 3IIPA 3WLNA 2J6XA 2ISWA 4FLRA 1H49A 4DLFA 3G18A 4LCRA 5XIAA 1E1FA 4UTHA 4H6RA 4ZSTA 2DDXA 5BMXA 4BQ3A 2GSJA 4Q33A 1VYRA 1A80A 1BTMA 1SO6A 1IEVA 4P7NA 2PP0A 3FN9A 1XBXA 4JEJA 3MS8A 2CETA 3ES7A 3PFMA 5FJJA 2YDSA 1XKJA 3FAXA 5DCBA 5C9ZA 4P8WA 2QF7A 3NOYA 4XD5A 3BAJA 2YX0A 3A4WA 4HZ7A 1T8QA 2HBVA 2E5BA 4PL1A 2R1MA 4ZXOA 1GQKA 2BVWA 3UXDA 3HTWA 3W82A 3POCA 5DLCA 4O52A 3FNDA 4B9YA 3E2VA 1MXDA 2TMDA 3LCGA 2DY3A 1OYCA 4Z1AA 3H7UA 3EZ4A 1O95A 2G96A 4JTIA 3DFHA 4JR5A 5A8MA 3VX1A 1AUSL 5FCZA 2WSYA 3EX6A 5H2ZA 3WUEA 5BZAA 1W2PA 3H21A 3DC0A 3W26A 3HPFA 2HCVA 1PAMA 3S83A 2ZUTA 5D05A 2QKFA 4Q7BA 1XLAA 5G1MA 3S2CA 4DIAA 3EOSA 3E02A 3PZMA 4MB3A 4FLOA 1WOBA 3B40A 1DQWA 4KESA 1A0DA 2DW7A 4H8HA 3WH9A 2NZLA 3WF2A 2B81A 1QTWA 4ML9A 5U4NA 2YCEA 2ZZ4A 1JAEA 1AFSA 3W87A 5DX7A 5BXTA 1CGUA 4N9EA 4GVIA 1H2JA 5C5YA 2WSKA 1T0OA 4A8IA 3AYTA 1OX4A 3O06A 2PDGA 3BLIA 2HJPA 3CAWA 2R1KA 4URIA 3OPSA 2FKPA 1UWSA 1AG1O 4FF5A 4LSBA 5FAGA 1QK2A 3BAYA 1IXNA 3QC3A 4OKDA 5AYIA 2DZSA 3L23A 2YXOA 4AMCA 4AXKA 1ODUA 2J88A 4MM1A 4HA3A 3E9AA 1M53A 3GNOA 3TTOA 2Q02A 1KRCC 2YCJA 2FZBA 1B9BA 5C71A 3KCLA 2BXVA 2X09A 1SW0A 4ICMA 2Z1VA 4TX6A 3VMPA 4X9SA 1NELA 1HP4A 1WXYA 1K8CA 4XTDA 1B3YA 4JPGA 1TREA 3GYCA 3UW6A 1ZGDA 3S1VA 1P6WA 2PTDA 3GNNA 5B80A 1QPQA 5XIMA 3TEVA 1ZP4A 5M2FX 2IUZA 1LJYA 3OGSA 4O50A 4AB4A 1JZ7A 1AQHA 3BW2A 3ARZA 4UFJA 4AEEA 3NO5A 1Q65A 5T91A 1V0NA 2Q3OA 1DJHA 1UR0A 2VDGA 1B3WA 4AU0A 3L68A 3T7VA 2QVHA 1EO7A 2ZRWA 2PTYA 3IGUA 3O6AA 4QXIA 1GCYA 4UTMA 4S23A 1Z6KA 4M24A 4XG1A 2YFNA 1M5WA 4Z1CA 2DPEA 4US6A 3A4AA 3CTTA 2Z1KA 4AWSA 1P6CA 3AOFA 4MB4A 2J7HA 3WBWA 4FR1A 1BLIA 6A3HA 3LM3A 1CNVA 1W9DM 1XF0A 3S46A 3VPLA 4TMBA 1IGWA 4NZ1A 3HIJA 1TVPA 1AMKA 2E1DA 4UC5A 3TMLA 3U7VA 4FNPA 2V81A 3VM5A 1KLYA 1IYXA 1E55A 1UOKA 2ZICA 2RUSA 3B0PA 1C29A 1W3LA 3MI3A 3FHAA 1J0JA 1KBIA 2Y8VA 3QMTA 3OLGA 3QTPA 4KT2A 3MW7A 2DZUA 2G37A 2PDWA 4AD3A 3CZJA 3L9CA 2F61A 4IQDA 1TV8A 5CPTA 1XGDA 2NSXA 1NF0A 3FY1A 3UGRA 5I09A 2PBOA 4C1NA 1K3UA 3C61A 5FF3A 1XXXA 1TELA 1SYTA 2CLPA 2Q8ZA 7ODCA 5DCEA 1W37A 3WCZA 1L9WA 3LD5A 3SUSA 3CC1A 5KITA 3CQ0A 1XLLA 2OYKA 2A1YA 3FXGA 1E43A 1SSGA 4A21A 1RAKA 5DEZA 4F2TA 1JFHA 4ZSUA 3R43A 2X0HA 3F5JA 1JNDA 5CEWA 4J3SA 3R89A 3W02A 2EPOA 1T8XA 2D0HA 3CV2A 3F1QA 2NSOA 3HV8A 3UJRA 4YCOA 1VJIA 2DT1A 2XIMA 4AIEA 2ZZ3A 5C8BB 3PZTA 1RZMA 2OR2A 5G5IA 2NXHA 5JH2A 1IXOA 4I5UA 2V5KA 3CUZA 5I0DA 3VD4A 4B2DD 2Z1XA 2ZUSA 3M0YA 2B7PA 2QJMA 5KINA 1E9ZB 1H3GA 4FNRA 3WMBA 3L0NA 1Z3NA 7ENLA 1UUQA 5CZKA 1TRDA 4UQDA 1VIZA 5C2CA 3QRHA 1QW8A 3W83A 4H8VA 1VGAA 1WQ5A 2WLZA 1ZL1A 1XV8A 1A49A 2Y7DA 1OD8A 3I3DA 2VP8A 3KVJA 2FFCA 1X98A 1Q7QA 1Z32X 3U5UA 2ZX5A 1XKYA 1XIMA 4JIEA 1NF7A 3AXMA 3QOKA 2POZA 4RZ6A 4PODA 4Z2JA 2ZYFA 2VC7A 1EDGA 4MAVA 1K9DA 4E3TA 2AQVA 2WVVB 1E9IA 1D8CA 1G4PA 1W8SA 3SRDA 3AIUA 3P81A 2X1UA 3CLMA 5SWUA 3R13A 1LLOA 2GGEA 2JKAA 4QROA 1EO5A 1JF6A 3GVVA 4B5NA 4R7OA 1JD7A 1PTDA 1WKEA 4UCGA 1R2TA 4IF2A 2FJKA 5REQA 2DT2A 3UCCA 3ZVIA 2ISSA 3WUGA 1R3VA 2WLYA 4M6UA 3EA2A 2XZ7A 1U30A 1X1ZA 2VVSA 5C2XA 3VINA 4S3KA 4GKLA 3AYVA 4H2HA 4IGMA 4UOJA 4W8BA 1KXHA 4ZENA 3I68A 4HPGA 3W53A 1WX0A 3R1ZA 2MNRA 5LNVA 2CC0A 2REQA 1N2VA 4M19A 3EOEA 3CMFA 1ME7A 2XVNA 1Q6QA 1H7OA 3K2GA 4J7RA 1LZOA 1V79A 4KPLA 1XIFA 3M5ZA 1WUEA 3G0XA 5AYZA 4E8GA 2GFTA 2YL9A 3KP1A 4PTXA 2EKGA 4W7WA 1KM2A 1TJRA 2BGSA 8XIAA 3H4XA 3PZVA 3TXZA 5LIWX 6ALDA 5E93A 2C0HA 2VQUA 3EX2A 2OZTA 5E09A 3CV7A 1K70A 4N9BA 4XZMX 3ZT5A 3VD9A 3E6EA 3JZUA 4PUJA 4Y2WA 2PWGA 4NIRA 2A7NA 4RJEA 3PJTA 2DQXA 3UWQA 1KQZA 2Q71A 4MDPA 4U2ZA 2J47A 2Y2WA 4YWIA 1RD5A 4JL2A 3FGCB 3ZT6A 3TV8A 2O9OA 4GVHA 1M9HA 2DJLA 1JUBA 5MKGA 2GVJA 2RKXA 4ZCWA 4HHPA 2OELA 1H7RA 1LL6A 2DZWA 3VAVA 1NH6A 1DJXA 4WXZA 4BZYA 2G50A 3SADA 1XLEA 2J79A 1U5VA 5J5RA 3LPOA 1ISVA 4IIFA 4E0CA 3TIMA 4FO4A 5PTDA 2NQ5A 2G4JA 3N04A 1XLBA 4BK9A 3APYA 2FZNA 2VR4A 3QOMA 4FNUA 5AHMA 1PX8A 3I7QA 1J6OA 4PTMA 2PS2A 5A95A 4IWWA 1IXQA 4JTSA 3WQDA 3BLFA 3J7HA 4AYSA 3QGAC 3A23A 2XVPA 4ZEPA 1KCXA 2VVNA 4ZQOA 3T09A 4O18A 1TPFA 3VYLA 2GDVA 2PLCA 1OC5A 1A5MC 1TWZA 2PTZA 2XH7A 7REQB 5FD0A 4O16A 4JICA 1AQFA 3G1RA 3RHGA 3GDTA 3CPGA 2VCBA 2QDGA 1HW6A 5I02A 3WL0A 1PO9A 2R14A 3EOLA 3M4HA 3CUHA 4UB9A 3GHTA 3TNOA 5FACA 2W27A 1C8XA 2PDMA 3T55A 1SFTA 2QCLA 3LCHA 5G4WA 3OEXA 1QWKA 4GACA 4Y9AA 2E1WA 3BJSA 1B3ZA 5CBBA 3VE9A 4PCTA 4QDPA 1VR6A 3E0IA 5DY2A 1SW3A 5M17A 3WEMA 2GK1B 3AMCA 4AISA 2EGZA 2P5NA 4HD5A 4QEHA 1E72M 4KWVA 1OT1A 1WDQA 3S1XA 3B4UA 2RGMA 4JCLA 1V77A 3EGJA 3GY1A 4J28A 1TPUA 2PE4A 3CNYA 4PUNA 2FVLA 4J3WA 4JX6A 3WD0A 2W62A 2PZNA 4BI7A 4XAPA 1S46A 1MQQA 4TUFA 5DN1A 3N13A 4X3ZA 4NKCA 1B0IA 5AECA 4DJFC 3AXKA 4JXCA 1G0CA 5D9OA 3FSTA 4RNJA 2VO5A 2VZOA 3PC0A 1L8PA 3NEVA 3GR8A 3W7JA 4D6FA 1W0MA 3BAWA 3MBDA 1GVQA 2G3NA 3OVGA 2DFAA 1A3XA 2JEPA 5A6BD 1J0KA 5KETA 2TRSA 3W7GA 1MO0A 1TPWA 7A3HA 4DAIA 2VFFA 3RU6A 4AIUA 3TYEA 3V7PA 1E40A 1TTQA 2DIJA 4GXWA 1EZWA 3IIXA 3QPEA 4GIEA 4JX5A 4UR8A 3NL6A 3LRLA 3A6OA 4NUWA 1BVZA 1GOIA 2DJXA 2R1NA 5D04C 5AN7A 3EDDA 1NEYA 5LGZA 3BOXA 3GBDA 5KEZA 4AQLA 3NDOA 4KIEA 5I5RA 4UMCA 3L7RA 4A3HA 2Z24A 4D9PA 1GK8A 1EC9A 3N34A 1ITCA 4LVGA 1V8EA 3H26A 2GUYA 5DQPA 3CH9A 4NI8A 5DXYA 3UPWA 2ZDSA 3ORWA 3VCRA 1XD0A 3W4RA 2ZXAA 2GVEA 5CPNA 4IXXA 5JQ9A 1EUAA 4J1OA 4P7LA 3CJPA 1RJQA 2X40A 2OEKA 5DELA 3P14A 4HKPA 4M5PA 1MMFA 1EJUC 1W5NA 4A4AA 1HZYA 4L4LA 2FTYA 4V1XA 3G1FA 1GQJA 2R1LA 1A5UA 1ZU8A 5FI8A 3DX5A 3BLOA 2WZTA 4HHHA 1JGMA 3PAJA 4LBSA 1CLXA 4KIRA 3AALA 3T1GA 1SO3A 2A79A 4XBSA 3M0HA 4I9JA 1EZ2A 3U57A 3VMOA 2QZRA 3WENA 1TWSA 5H8MA 3TX9A 3L5LA 5I78A 1J0ZA 1SVDA 1KO0A 1FFRA 5I79A 2QUMA 1VEMA 2VRQA 2VDIA 1NTHA 4CN6A 4YTQA 3K8MA 1S5TA 1ML1A 2UZ9A 3LUTA 3ZJKA 3OZYA 4KCVA 3NQGA 4RNIA 2C13A 1Z89A 3GW3A 2D2GA 5HQEA 3HURA 1CX9A 3IVSA 3NQMA 4GISA 3XIMA 5H91A 4CQCA 3GTFA 5HWMA 3W37A 1Q6EA 3BOFA 1JULA 3S9IA 1UZ1A 2V3FA 1KFCA 3MSRA 3WLTA 4HOZA 1H1ZA 1J11A 3OLEA 2V2CA 1FKXA 2CLIA 2OOFA 3H2NA 3QW3A 2JGQA 5CGTA 4LW7A 3S5YA 1ZBKA 4JN8A 1BFNA 3B4YA 4GBDA 3RPDA 2GLKA 1KGUA 4UMBA 1QAPA 3KHDA 3W71A 4Y9NA 4NILA 3QQ1A 1W3KA 3CZKA 1JNEA 3NPVA 3W27A 2CZFA 4AVFA 1DYSA 4K1GA 4O0QA 2VOMA 2PA6A 3MUZ1 2V30A 3NQ7A 1OEPA 3R7MA 3GZ3A 1TCMA 5CPLA 3ABQA 4UTIA 4ERAA 4CNNA 1LLWA 3SR7A 4ZA0A 5D2VA 4PR4A 4CD4A 4KEMA 2PLKA 1M7XA 1TFVA 3E96A 1K9EA 3S0CA 3IGHX 4LU0A 3D46A 3WDIA 5E70A 1XYFA 2INEA 1CXFA 4G6CA 5EA9A 1XFBA 3UY7A 4IIGA 4GUJA 1M1BA 1WNOA 4FK9A 3IIVA 1ONEA 3A47A 5JIWA 3MP5A 2WAGA 1H7PA 2BNJA 4H6KA 4JHOA 3MV01 2NV9A 1LL4A 3ZOAA 3SJNA 4PBGA 2CERA 3SGUA 2OB3A 1JCNA 2PDHA 1OGSA 2VENA 4TVUA 2QCHA 3NQ2A 1D8WA 4FPSA 1H61A 3W7KA 2DSWA 5ABGA 4FAMA 2IXVA 3SCOA 2XSXA 1S1PA 3MBFA 3N2OA 1OX5A 3EPOA 4TTUA 1F4AA 3UPMA 3I4KA 4DQWA 2E4TA 5AHIA 3WNOA 4S2CA 1W32A 4IPIA 4FZIA 2NQ9A 5C9WA 2QCDA 5CG0A 5HWJA 3M5XA 4IMGA 1Z41A 4O0KA 3N9KA 3GU9A 4E4UA 2P10A 4S39A 1R9ZA 1EJVC 1XBZA 4JAWA 5FF0A 3GC4A 3UA4A 3EDJA 3WLKX 3WJWA 4Y7EA 4ZOBA 1Q4NX 3FA5A 2F2KA 3QY8A 4JYDA 3H2FA 4QJ1A 3CS2A 4FMVA 2POTA 1OQFA 4KCUA 3GNRA 3EWDA 5KZ6A 3SIMA 2NT0A 1PCKA 3BCDA 3L5MA 3SGGA 4BKNA 3TXVA 2OZ3A 4KH2A 3KL3A 3KX6A 2GGJA 2I7GA 2V3DA 4MSSA 5EMMA 3UA3A 1A5NC 1FWEC 4MPKA 5FL1A 1NDWA 3FYOA 2VRJA 4B5TA 3ZSTA 3DYMA 1UQYA 1QI2A 4LH8A 1LWIA 1B9ZA 3SCVA 4R7WA 1A5OC 4ZBCA 2UWFA 5LIYX 3IIZA 3KBNA 3KDNA 1VFOA 3BAXA 4QX4A 4F9JA 3ALFA 1ICQA 4DXVA 5CC5A 4TR9A 4U5KA 3ZJ8A 1YXYA 3CEPA 4K68A 2E67A 1N8IA 3UXIA 4XSMA 3UG8A 1CT5A 3LI1A 3VGEA 3M64A 3PJUA 4JKMA 4Z2GA 3LQLA 5I3JA 4XAYA 4U33A 3RO6A 4QTGA 4OV9A 1H62A 1WDRA 1KKOA 1EJSC 5BU9A 5FKYA 4AG0A 4KW2A 3TUUA 3JVAA 4IPNB 3VIGA 1IEXA 3NR0A 1Q6FA 3U6WA 1TTPA 2YR1A 1H7NA 3OZOA 4QGCA 1UP3A 1XPYA 3CZGA 1J10A 5HMFA 3V4BA 2WK2A 1S2CA 4XTIA 4GVGA 4L65A 2HE8A 3S6OA 5AVHA 1H09A 4J3TA 5F2GA 4AIBA 2OPJA 4XAGA 1JDEA 3DAQA 3UQNA 2FH6A 3R25A 2QDDA 1TUXA 3PB0A 4FR6A 3IV8A 4BQ4A 3S9YA 4ORMA 2J7CA 1AD4A 4IOTA 1KB3A 4HNCA 1J0IA 1SPQA 1V6UA 4WOZA 2GGGA 4LV9A 4JTAA 2RJHA 3FV9A 1MW2A 2YFOA 1I2NA 1BEUA 4HCHA 1I1WA 2VD8A 2XH2A 1MFVA 2WNWA 3VI2A 4RDZA 4KCWA 1EWEA 1W1ZA 4M29A 2EKCA 2E5CA 4CQ9A 2ZA3A 1LDCA 1RCQA 2PRMA 5CKSA 5T9BG 3OJGA 4CLMA 5EBAA 5HK4A 3WG6A 1V02A 3OYXA 4JZ5A 5I3HA 5A8QA 3SCPA 2G4FA 6XIAA 2B4GA 4HYVA 3QM3A 4ORIA 4MY8A 5I6SA 4QSHA 4ZTYA 1B31A 4JBRA 3VUSA 1NARA 1IT8A 4HHMA 1SJAA 4Z42C 5FL0A 4UR9A 4X2RA 3UG3A 5DMNA 3UERA 2EO7A 1DE6A 1JGIA 3D0CA 4ZB5A 1BGGA 1KM6A 1EX5A 1EEPA 1XM3A 4DX3A 4G2DA 2I56A 1BSLA 4R53A 2WHLA 3UWYA 1TZZA 3MI2A 4ADSA 3R0DA 2WXDM 4C6NA 2O0TA 1AJ0A 3M0XA 1JJKA 4Q4KA 3VGHA 4EX4A 2P50A 2GJLA 3WF3A 1JPKA 4R9XA 1HNYA 3FJLA 1LQ2A 4AD4A 4V2XA 2G8ZA 2QCMA 3A12A 2Y24A 3QZ6A 1K7XA 4CCDA 2DQWA 1DXIA 3OW1A 2GYIA 3HJEA 4LC6A 2QQ6A 5CZTA 4XKYB 1KXQA 3IWPA 1TJ2A 4H2CA 1EGVA 3MWCA 1P1MA 5M3WA 4PCNA 1BVWA 4Q7NA 2QVNA 1JYNA 3O6DA 1LF1A 1A5CA 1LP6A 3AWNA 4UOZA 3OIXA 1B90A 3UJFA 1EF2A 1CIUA 2AL1A 3AROA 1PVNA 3ZWSA 6TIMA 3ITLA 4KEZA 3TAKA 5LIKX 4QS5A 3P62A 4AD0A 1XYCA 2XINA 2WMFA 4BF7A 3M0JA 4GJIA 4JTHA 3L4VA 1IWAA 4JKLA 3SSJA 5BYWA 3NO1A 4FXFA 1VFTA 3EWCA 5HPCA 5CZJA 3T2QA 3GH4A 4MOZA 4Q8PA 2CLHA 4KWUA 1Q2SA 1L2UA 1W1VA 4MFDA 2ZZ6A 5I77A 1FA2A 4MAZA 2B0MA 1F3TA 1IR1A 1Q6GA 3FKRA 1QWGA 1UA7A 4KEVA 3W75A 2ZOXA 1S5VA 1MEHA 2W3ZA 3L2LA 4I7UA 4L1WA 3LERA 3VX0A 3URNA 4PMVA 3N2CA 1QRQA 2XDFA 1UD8A 1FKWA 3IJIA 1P0NA 5GNYA 1NFGA 3VGBA 3E38A 1RBLA 2BVTA 3BARA 5EYWA 3OHMB 5KZDA 3KOWA 4QG9A 1ISWA 3UT0A 3WEOA 2FMOA 1V6YA 1KRMA 4IZGA 3BLEA 4PMRA 3WBEA 3NZ1A 3L4XA 5A6KA 4HZMA 3DG3A 4DLMA 3R4IA 4AX7A 1K02A 3PG9A 4LCSA 1ZAHA 4BF5A 1N55A 4LV4A 3VNJA 1GW9A 4I7VA 3KBJA 3TYDA 4PMOA 4IPLA 1XC4A 1S38A 2VGGA 1CCWB 2AQWA 1GOQA 4CQBA 4MDOA 4TIMA 1YXDA 1S5MA 3MUAA 3BAIA 3XINA 2QV5A 5JH1A 3N12A 5A6SA 4O28A 3RK8A 1YKWA 1TG7A 1DJNA 1S2WA 4B5VA 1QHOA 2WJFA 4DUXA 3SQLA 3KS6A 4H83A 4F0HA 1V51A 2NLIA 4HSHA 3M47A 4GQQA 4DJDA 4GFSA 3LBMA 3IIOA 4EWND 3GIPA 1TE6A 5CGQA 2Z25A 1BVNP 3EXRA 1HTIA 4MMWA 3B3DA 1UB3A 4E8DA 2DSUA 2DH3A 3U2CA 2Q8XA 5HXMA 1XLCA 3EEZA 3Q65A 1LOSA 3CQHA 4IP7A 1WUFA 3C86A 3LLFA 3TA6A 5HR6A 4UOQA 3W0KA 3RJXA 1HX0A 2AKZA 2X30A 1JPHA 5ABFB 3WDHA 2CLEA 1US2A 2E5DA 5FA5A 1EF3A 3UJSA 4K38A 1E6RA 3RCMA 4L61A 3T0BA 1PXGA 4ECLA 1XQLA 2VEFA 1W6TA 1FWWA 4QQ3A 3THQA 2NVAA 2ZE3A 4UFKA 3CEUA 2NXIA 4TX8A 2WJZA 4I5RA 3KOZA 1VFUA 1OCJA 1EUNA 4GJJA 4O10A 1W56A 4R9OA 3UWUA 4J3VA 3NZQA 3M16A 7CGTA 1ME9A 2IQ0A 1X38A 1QNPA 5IFPA 3TN3A 2CLOA 4JTJA 2PEVA 2VL4A 3GE7A 3BVJA 1PUDA 2YCLB 1QO2A 4QHRA 1HVXA 2OO0A 2EG7A 2CCRA 1GOMA 4GLEA 3TR9A 3QKZA 4UTTA 2O4QA 1O6IA 9XIAA 2YCKX 4DYKA 2BXZA 1EGMA 3OYZA 1C3FA 4LVDA 5H8UA 2PWDA 1PSCA 4F0LA 1TPH1 2WZHA 3DUGA 3WDRA 1LG2A 3RITA 2ZXQA 1F8MA 1Y5WA 3W7PA 2QT3A 4N42A 4UNLA 3AWOA 2VYOA 4IMFA 4QSFA 4TVDA 4CD5A 1F3EA 4TXEA 3SECA 4LS2A 2XHYA 3V5CA 2VD9A 3GXDA 1KGWA 3NJ3A 8XIMA 2GWNA 1Q66A 3AZTA 2XSBA 1GVSA 1TJPA 4NI3A 3UF9A 3C56A 1IV8A 2YXXA 2PI6A 4CQAA 4H8UA 1H1YA 4RE4A 1J0YA 2ZZ2A 2PGEA 3SURA 1FH8A 2X1IA 1CEOA 4Y8EA 3U4AA 4REQB 2ACUA 3ATZA 2E6AA 4Z0SA 1FCVA 1CB7B 2OOGA 3B8VA 2YA2A 3VKBA 4XD3A 2G5WA 1LOLA 4UQ9A 3W25A 4CNOA 1VRDA 3WQWA 3M6YA 3RLUA 2EJAA 4PMYA 1VS1A 4XZIA 1W2VA 3LNPA 1FWGC 4PTDA 5LNUA 3W28A 4JCMA 1K7EA 4KGJA 4XWUA 2H90A 5A8GA 3AZRA 2YJQA 3FFSA 4GGBA 2IKGA 2WVVA 5BW6A 3LHTA 2HTMA 3NAVA 3VKDA 1CXLA 1P5BA 1JCLA 2GUBA 4QE1A 2H3BA 4MY1A 2OQHA 4Y8FA 3L21A 3M0KA 2QMJA 3NURA 5G2IA 3MUY1 3PF3A 3EWWA 5XINA 1V93A 2GVLA 1KFLA 3VOCA 1VFLA 3IUIA 5IDIA 1FQ0A 2V82A 4C90A 5LYRA 5I7GA 2BGNE 2GJNA 3L2IA 2PDCA 4UTLA 3UWVA 2ZZ1A 3IGXA 3WY1A 1W3TA 2Y85A 1PKMA 3E0LA 3PK7A 4RZ4A 4DJDC 4C91A 1XBYA 5GVJA 4M3PA 3ZJ6A 4V15A 2F9RA 5LA1A 4QBXA 4PCPA 5A2BA 2QMKA 1OGBA 3VNYA 2GJPA 3E49A 2A3LA 5HINA 4JNZA 4OOUA 4HCDA 3CHVA 2DSKA 3S5SA 3D3FA 4UTFA 2XFWA 1KLZA 1Y65A 2I9UA 1D7FA 3NQCA 5LSMA 1CLKA 3KP0A 4M1BA 4LUJA 3N17A 1HIZA 5DRIA 3UEQA 4NL1A 2OKOA 3ABOA 1KC7A 2WZIA 3L4WA 3L2MA 1TA3B 3KVKA 3NFUA 3IRDA 1XIHA 4G7EB 4DJFD 2WCGA 4XKMA 3H2AA 2YOCA 3KBVA 1ELSA 1MQRA 1UD2A 2PDBA 4GWEA 5JU6A 4K3ZA 2NLYA 1A5LC 2EG6A 3HGJA 2AL2B 3II1A 2FZ9A 3G1DA 4NU7A 3IUDA 3PR2A 4MYAA 3H12A 2QS8A 1ZPTA 1VFMA 1FDJA 3RPMA 3FGCA 2V67A 2J9XA 3AS3A 4M82A 4M8UA 2J7GA 3AS2A 3S2JA 4IGSA 3V5OA 1XG3A 1C8VA 4CVWA 2WVSA 5M03A 4Q8MA 3WD4A 3QF0A 5C70A 3T2PA 3VVGA 4NJJA 4TX9A 3VOHA 2BY3A 3SIZA 2GJRA 2BFGA 3LBOA 2BASA 4D8AA 1BXBA 1UD4A 2Q6ZA 2YBUA 1VD6A 1QI3A 4HMNA 4ES4A 2XVKA 3MO7A 5G1TA 3CH0A 1QATA 3MCNA 3PP7A 3R0UA 1GG1A 1ZLPA 5FF7A 2E6FA 3W1LA 4DWDA 1OFAA 2C79A 4AWTA 2V5BA 1Q3NA 2Z28A 3IVUA 3E12A 7REQA 3QHMA 4CNTA 3SRKA 1WA3A 2E0PA 3HN3A 3BCJA 3SCSA 3XISA 1JUKA 4EXQA 3GRIA 3T4CA 5F2MA 1W1A1 4HOWA 3VCNA 4LY4A 5HATA 3AIRA 1HJXA 1WDSA 3PJXA 4NYYA 5CJ5A 4AX6A 3CUIA 4FOKA 1P0KA 1QBAA 2FLIA 1TR9A 3TJ4A 1XRTA 5E0KA 5E5CA 2J74A 2PDIA 4CU8A 4C6LA 1PWLA 4PB3A 4Q8NA 3NDZA 2GK1A 1SW7A 2J9ZA 1NM9A 2D69A 4W5UA 3ARUA 2H8ZA 4RV8A 3GVWA 3VGFA 3QHOA 3G8EA 3LTYA 2RDXA 3MB9A 3FEQA 1LWHA 3WQ5A 3PANA 1KBBA 1PIIA 1EDTA 4GYFA 4L5ZA 3T4WA 1W5PA 1W9BM 2XIOA 3QZAA 3KAOA 4JEQA 1TUFA 4YVXA 3ABSA 3EKGA 3OO2A 5G2HA 3OA5A 1AH3A 3ARQA 2CBUA 2XGBA 3KL0A 3NQEA 1RR2A 4ZGYA 2I9EA 3QV8A 1SUXA 1UWQA 3TN6A 1G01A 1UYQA 1ZBCA 3LNMA 2DZTA 1E3XA 1B2YA 3GXIA 4PCSA 1K9TA 2JKEA 5C7HA 1IQ8A 4NY2A 1ZP3A 5MKGB 3EOOA 2IS7A 1XWYA 1EX1A 1OCNA 1SFLA 4YN5A 3WLHA 2NUYA 3BJFA 2P8BA 4OE7A 3VIJA 1ONRA 1KBJA 2BVDA 1VLIA 2ZBTA 3PB2A 4WLCA 2CITA 4ZB0A 3DFPA 1VPYA 3R8HA 2D0FA 4RPPA 1I45A 2ACQA 3OTRA 4IX2A 4DO5A 3BMVA 1EYWA 1MDRA 1EPXA 1ISYA 4BCEA 2WSQA 5K3VA 4AZ7A 1WO2A 2OVLA 4FXRA 4Q8OA 1RV8A 1HQTA 1BKHA 1SZGA 3TQ0A 1B4EA 3GZAA 5B7ZA 4WY0B 1KGXA 3CBWA 3K1DA 1AVAA 4NHVA 2F84A 3T2OA 1FHUA 3ARSA 2ANUA 2DIEA 3MUIA 2C91A 3KS5A 3MVIA 3LHZA 4Q22A 1ZENA 1MRAA 4P61A 3MUXA 1AJ2A 4DBEA 1S39A 5JUVA 1N82A 3RX3A 1Z8AA 1FWCC 3FVDA 4XIMA 3PZIA 3S47A 4CNUA 1ISZA 3H24A 3LOTA 5A6BA 4MF4A 4L6HA 4GIYA 4NX0A 3WLMA 1FHVA 2PWHA 4IH3A 3M07A 3LCXA 3ZT7A 3LGEA 4GI9A 5MHBA 5D30A 2CZ5A 3BMXA 6ENLA 2A3BA 4IUOA 4MZ1A 2MANA 5F7UA 1LWJA 4QDWA 1PB0A 1UKOA 1UUOA 3W9ZA 5D37A 1LQ0A 1WBJA 4HIBA 6CGTA 3QTGA 2VQTA 2VUYA 4NSBA 5K9CA 2BOEX 3KFTA 3EDFA 4FP1A 3TR2A 3LHWA 3IJ8A 2PC4A 3EMCA 2J7EA 1RCOB 4O1BA 1PIFA 2OXNA 3TU9A 2HV5A 2P0IA 2HS6A 2E25A 4H9ZA 3EX1A 3KEHA 1WAUA 3B06A 3QGVA 3T08A 2X1SA 5BXSA 4MY9A 1O5XA 3VU2A 4PULA 2QIIA 3WK2A 3HQNA 3BE7A 1ZRQA 1WYIA 1Z69A 3QW4B 2JIEA 3IEBA 3MT1A 4EANA 1XPGA 2DZBA 4FOUA 2PWVA 1KTNA 2VI0A 1GQNA 4DO4A 5AC8A 2DZPA 3MDUA 2J75A 1XYZA 1KM4A 4QS6A 2OODA 1B3XA 3MDWA 1XDMA 1K4GA 1PX4A 1SU5A 2GOUA 5A2CA 4P7RA 4KKXA 2WZEA 8CGTA 4M6QA 2YZRA 2HE5A 4HN4A 4HU3A 1TKKA 3LSBA 5AC4A 3EXSA 2GUUA 1I1XA 4GZ7A 2X42A 3TN5A 1IGSA 4MJZA 2NX3A 4WSHA 1YNPA 1LTDA 1HVQA 4LPCA 3LM7A 3UR2A 1DTNA 3SBFA 1TMLA 4GPNA 2QCCA 3RU8X 3F2CA 1V02E 2FPVA 1FOBA 4L6OA 2R6OA 4ZMGA 2PF0A 1TB3A 3LN3A 4N0RA 3BO9A 4IQEA 2VEGA 1V7YA 2PODA 3TE9A 4O4VA 3GX9A 3I7RA 1DL3A 3ZIZA 4ZO9A 3UFYA 3TNBA 3RJYA 2PUZA 4N4PA 5I2UA 1Q6OA 3M0ZA 1E1CB 3AIBA 4IJBA 1PKLA 1M03A 3LENA 3SCQA 1UUMA 3SI9A 5A2AA 1QNRA 2O4MA 3WQPA 3CWHA 2J78A 4ASTA 2YW4A 1QOQA 2OSYA 3RIKA 1LRQA 3LRMA 2W5FA 2NQHA 3EEGA 4FB7A 4RE2A 4B3KA 1MI3A 2ZRXA 1BRLB 1X7IA 5EB8A 5DXXA 2TSYA 2R1PA 3SUVA 1XIBA 5JBEA 1MVYA 1ZBWA 4RV3A 4GINA 1K9FA 3W1XA 1K8YA 3NQVA 3TQVA 1FWNA 4C7FA 3E2QA 4P7QA 3UYIA 3PBWA 1C7SA 1K8XA 2ZX9A 3NOEA 4U3AA 4RW5A 2DVXA 4LANA 3EAUA 4UXDA 4V27A 1PS9A 2C19A 1HL8A 3GTIA 4LAUA 4D6JA 1BQCA 1EP2A 1QXLA 1UP0A 5I3KA 3SJ3A 1H0IA 1XICA 3CQIA 3VKAA 1M65A 1A47A 3FS2A 3PBUA 2PCEA 4W8AA 1CGYA 1FCQA 1TWDA 1TV4A 4LNYA 3UZJA 4UCFA 1LBMA 2CHOA 5TD4A 3IJQA 2FHBA 2FPTA 3MZ2A 1ZNNA 1ICPA 1NDVA 1WAWA 2QGHA 1J2BA 3DBNA 2JALA 4C5YA 4LVAA 4FNTA 2J7FA 1R8LA 3EA3A 1BXNA 3V75A 1BYDA 3WH8A 5EFDA 1JYVA 1FP8A 4HA4A 2WKJA 4H19A 3IACA 1X39A 2XISA 1BAGA 3PPFA 2HK0A 4WKHA 3WUBA 1KQYA 2RH9A 2PF8A 4RE0A 1MFUA 4XBJA 3WLPA 2OLSA 3HQOA 2DW6A 4RW3A 1F5ZA 1KTBA 5J04A 4GUFA 4WKAA 1W8GA 1ZTVA 3W38A 3WQOA 3QY6A 5EGRA 3N29A 3EPMA 1SZEA 2ZXBA 4NZ4A 3UG5A 4M56A 2X41A 1HJUA 3N2BA 3W24A 5DY3A 3KCOA 3AS0A 2UY2A 3N1AA 1MRQA 1FXQA 2XIJA 2WMGA 3O0FA 3T0TA 3HMCA 4G1NA 1E0WA 1SMAA 2IPFA 1V0MA 2Z1SA 5BU6A 2JK2A 1VBJA 4J3UA 3OVRA 2A3EA 2PD5A 4CD6A 1I75A 5FF2A 3LHVA 1IZKA 3WNPA 1XL9A 2ATMA 4X22A 5DBUA 4C6CA 3CPUA 4HSNA 3GK0A 3F7JA 4PMUA 3M0IA 2WM1A 3ARRA 1SO5A 3LS9A 1HKKA 1QPNA 3RMJA 3G3MA 1VHNA 2CBJA 1IEWA 2HSAA 3CV1A 3V0TA 3GNPA 3IK2A 3NDYA 3WQVA 1XGEA 1RK6A 3R8RA 4FSAA 4CCCA 3BQ6A 3DI1A 1M68A 5E6YA 2D2OA 1HGWA 1SGJA 1D3CA 1EFZA 4KWWA 5C9RA 4RXGA 3HPXA 3LPPA 4G5DA 2VZVA 1QHPA 4ICCX 4FIRA 1DE5A 2B7OA 2R91A 3F2DA 1P48A 2XFRA 4JY8A 1F6PA 5KSWA 5HDRA 5GJNA 4ZQCA 1H0GA 1WB0A 3OLIA 1NOWA 4AHQA 3MYOA 5DMMA 4AYGA 4ZOCA 3KTCA 1G7UA 4OV4A 3UXKA 5JBDA 3PPHA 3CO8A 1GQLA 3HB9A 2YDQA 1BQGA 1PTGA 4NF7A 3W29A 1DP0A 4H9YA 4B5XA 1JUEA 4WCJA 1C8YA 2D22A 1V6WA 3QR0A 3A9BA 1M01A 1PYFA 2WZMA 3YPIA 1QFEA 3GG8A 5AVNA 3RX2A 1RK5A 4NNBA 3Q45A 5AHNA 3N4EA 3ABZA 2P1FA 4DUWA 2EPKX 4LNCA 1LLZA 5HUOA 4B92A 5KZEA 4GD0A 1W31A 1T40A 3HGOA 1OFEA 3K4DA 1UCWA 4JGDA 1VEOA 1KWKA 2BY2A 2BY0A 2J27A 3LZ3A 1PIGA 3LHUA 4HU0A 3ITTA 5EFFA 1B30A 3UWEA 2V3EA 3AISA 3EWUA 1GEQA 7XIMA 5ENLA 1Y0EA 2Z26A 3VIPA 4XKYA 3R94A 4JY9A 3GFXA 4HNVA 5AOUA 2OEMA 4WY0F 1XUUA 1QBBA 2CKSA 4ONVA 1SZFA 4X0VA 4W86A 2A6NA 4Q8VA 4FOJA 3P67A 4GQRA 4FA3A 1TSIA 1MW1A 5TF0A 4A35A 1KR0A 1RBOB 1R3WA 1RLDA 1MZRA 1JL8A 4YYFA 1AZ1A 2W9MA 1CZ1A 2Z6IA 4LFYA 1E73M 3CZ8A 2WW5A 2LLEA 3F5LA 3GQYA 3OG3A 3RMEA 2HS8A 2OSXA 2C1HA 1BD0A 4S3AA 4MJMA 3AZSA 3QSTA 4NT0A 1RQEA 3GXMA 3DECA 3WBXA 3WQ6A 2VEIA 4IIBA 3EB3A 4B5WA 4BQ2A 5CC7A 3VNIA 1A5SA 2XSAA 5EMUA 3UXLA 3N4AA 4LQ1A 4HPJA 4MNKA 3VD7A 2C6QA 5BXPA 3DIPA 2DIKA 3U48A 5AHEA 5A8OA 2X7VA 1X8CA 1XS2A 2EBNA 2O7QA 3CIVA 1Z42A 3RG6A 1FP9A 3CUFA 1BGAA 2ZA1A 2WBGA 3R6IA 4AZGA 1GPWA 2UY4A 1I8JA 1GJUA 2H9AB 4HTBA 2V69A 3MTWA 4LUSB 5CGMA 3WD1A 3FW6A 3W00A 4J40A 3T42A 5CC6A 4WDUA 4ML4A 3CAQA 2ODOA 2OFJA 3P5YA 1DHPA 3P5ZA 1UWTA 1DJGA 4ZE5A 4A05A 3QJAA 1OX6A 1SO4A 2QJNA 1D7KA 4AF0B 1EOKA 1UIOA 4DUVA 4GH3A 3DFSA 2DT0A 2XVLA 1RALA 4R88A 4W88A 4PZVA 1W5QA 3Q58A 4AWEA 5AC7A 2DUXA 2ZKMX 1O60A 4H00A 1LM1A 4LWWA 5K7JA 4DWSA 5D4YA 3A3XA 4HMDA 3WD2A 3NQAA 4BI6A 3W74A 1J6PA 2QULA 3DDMA 1EJTC 2WC4A 1M3UA 1GPFA 2Z1BA 4DVOA 3M1ZA 3UJ2A 1X7FA 4Q8WA 1XCWA 2G3MA 4LAZA 1XDJA 1KXTA 2A2IA 1UOZA 1XHGA 4HN8A 2DU2A 1ALDA 1GZGA 1TV3A 4GX8A 5A6AA 3TP4A 1WP6A 3R0KA 2B7QA 2JQXA 2NWSA 2HVMA 2NVCA 4H6QA 5H6HA 1E6SM 3C0JA 2CLMA 3NSNA 1W1B1 1F2JA 2F6KA 3O3RA 1JQVA 4S2BA 4WVXA 2Q3RA 3R79A 2BWGA 2PWFA 2HZGA 5ABFA 2F6UA 3N9RA 4F66A 1BHGA 4AD5A 2IKJA 3IPWA 4AY1A 3PWGA 3E2SA 4IP4A 1O1HA 3C5QA 1P43A 5LHEA 1ECQA 1PZ0A 3LLXA 4AUBA 4DF0A 3QYQA 3DFYA 2HEJA 2OT1A 3CUGA 5CQ1A 3KRZA 3D47A 4IHCA 1V3LA 5FJPA 4GJ1A 1TQJA 1U83A 1U33A 2CW6A 3UYCA 4E2DA 3V1PA 4NVTA 4K37A 1YX1A 3OQ8A 1QOPA 2XFFA 4UFLA 1GVIA 4Z17A 1WDDA 3TW6A 4DJDD 2QPUA 4NP7A 2Y5JA 1V3JA 2YYTA 3A5VA 3L4TA 1XX1A 1HGYA 1I0BA 4BEUA 3PNZA 3ARPA 3VK5A 1S1RA 2YCLA 4JQ2A 3I10A 2CU0A 3B0XA 1J96A 1J5SA 3NEHA 1M04A 1YBQB 2GVYA 2XYLA 2GDUA 1EBHA 3V16A 1VBRA 4AZ6A 4ZQNA 3W70A 4O8AA 2J8GA 5T8GA 5CAHA 2PB1A 1NFPA 1RVGA 3W1RA 3PBGA 2QXWA 5HNUA 3VTRA 5LXXA 4HU8A 3DG7A 4GNVA 3PPGA 4GQ0A 4PB4A 4A8RA 2GQ8A 3JR2A 1C8QA 3AAMA 1VBUA 3CMJA 3KUMA 4MNLA 4ZZ9A 3UCQA 1PV8A 2PDKA 3HO8A 3HMJG 4AW7A 4MLJA 2VTFA 1VCFA 5KZMA 2VELA 4U3CA 4OOZA 4AVOA 3U2ZA 3WJYA 1TZ9A 4OUEA 1UD3A 4XAZA 4MJ4A 3NL3A 3IJLA 1JVNA 3VNDA 2PTXA 3VILA 2FB2A 2PDPA 3SRHA 4QNEA 2QPXA 2XG9A 3ZXWA 1XLDA 2CXEA 1O5QA 3SUWA 4REQA 4F0MA 2FHFA 1BG9A 4DUOA 3QY7A 4P5UA 1EA9C 3MPGA 1IWBA 3VGDA 3MY9A 1QT1A 3NXFA 3S8HA 4LXFA 3GVRA 2WMIA 2VC5A 2XWEA 4J3XA 3WD3A 3AIEA 3GUWA 4UIOA 1TPEA 4W8LA 3QXBA 2ZUWA 5BRPA 1A5AA 1JDAA 4O1FA 1KR1A 1Q63A 4KGLA 3LPGA 4UNKA 3G24A 2KZHA 4JQ3A 4LAKA 4DBUA 1IE7C 3UZYA 3SO7A 5DRCA 3GG1A 3OP2A 4H9UA 3WNLA 3ME3A 2ACSA 3ANUA 2W4XA 3H4GA 4XD6A 4DNMA 4DWSC 2CHNA 1TVLA 2NUWA 3BAKA 2V3GA 4HVXA 3GTXA 1L2QA 4CNPA 3DYOA 1QNQA 1KFBA 2AQOA 5BXRA 3C2FA 2P3ZA 3VIMA 1UD6A 1NQ6A 3PM6A 3LTPA 1NP2A 4NG3A 4D72A 4L56A 2FH8A 2PU0A 3PNUA 3DHPA 5RUBA 5T9CE 5A6MA 1JRCA 2VFHA 3H2EA 1NSJA 3P3BA 4LYRA 5BNKA 1FCBA 3QPYA 3CU2A 3UESA 5AYYA 2XZ9A 3L4UA 1UR8A 3K8LA 4QAIA 2NQLA 4CU7A 4WKFA 5K9XA 3AHVA 1QPRA 3OBAA 3G1SA 3LI0A 4LRSA 5HMDA 1EJWC 3PTQA 1FVPA 1TA3A 2CBVA 3BURA 4YMZA 4G7EA 2HBXA 4LUYA 3HBLA 4DNHA 1PDYA 3VGGA 1XH0A 3VIHA 3UXAA 5F2LA 3STCA 3IJ9A 4L9XA 2XIIA 4QE5A 4DO6A 4QG8A 1JF5A 4ZOEA 4CQ8A 5EMLA 3FKKA 5FJOA 4UQEA 1DJZA 5H8PA 2AL2A 2CNCA 4MGGA 1VF8A 1B54A 1F4HA 1XIJA 1XGZA 3H2OA 4OJYA 5I07A 1P6BA 1KM1A 4DZIA 1TVNA 2J66A 1TIWA 3I7SA 3FX4A 3CASA 4H7VA 2V5LA 3UNTA 4DAFA 4EPEC 4YPJA 5M5DA 2X7WA 5G1YA 3GB6A 1SJDA 4EOUA 1BXCA 1E1EA 4HJWA 1I2QA 3A64A 2WM0A 1REQA 2ZCGA 2ZRUA 3K4AA 5HQMA 1AL8A 2W67A 1DOSA 1HN1A 5CPMA 4C1LA 2CFFA 2FMNA 4KRZA 3TJLA 4IQLA 2VFEA 2FVKA 3ARTA 3LMZA 4ACYA 1XLHA 4JNYA 1I9CB 4LF1A 3W23A 2V9DA 4ENLA 4H7CA 5I3GA 4BA0A 1TX0A 4Q3MA 3B9OA 5DF0A 2D23A 3KRBA 1BWLA 1E5NA 1I0DA 2IQTA 1HO1A 3THUA 1RP8A 1JCTA 4XV0A 3W22A 3FA4A 3BV4A 1EP3A 1OHLA 4DJFA 3P0XA 1ZAIA 1DTUA 3MSYA 1RSCA 5I3FA 1R30A 3MP3A 1FH9A 3BG3A 1VQTA 2PAJA 1DJWA 2PDLA 3FOKA 4XVDA 2YPIA 4PMDA 3VXGA 4PMZA 2DZVA 1RCXB 2YL5A 2CPUA 3NTYA 4HCLA 3BZGA 3LCFA 4PRWA 3SB0A 4PUDA 1W3NA 1CB2A 2AAAA 2Z2BA 5A6JA 5F1UA 1DHKA 4NZFA 3WX7A 1OYAA 3W84A 2ABAA 1X8FA 4QJ3B 4YLWA 1BKSA 4D8LA 1V08A 1EB3A 5CSRA 3ZR6A 4JHMA 2ZWYA 3LXBA 3A22A 3UZWA 4MWAA 4IICA 1QUMA 2ON3A 4YL2A 1E71M 3C2EA 2EXOA 4AC7C 4GZJA 4U28A 4W89A 3DHDA 1CXIA 4F0SA 3HFTA 3K4WA 4LUTB 4D8ZA 4K7YA 4OVXA 4XZHA 3E1F1 3F4WA 3D5HA 2Q01A 4DXKA 1GVFA 4RNHA 4TU1A 4IG2B 3RO8A 1SJBA 2ZUUA 1DPMA 4C6DA 4UZUA 2J6VA 2WHJA 4MTVA 1TO3A 2GGIA 5FEZA 4PUKA 3NSMA 4UZSA 2TPSA 1XDLA 3C3UA 2VCAA 1S5WA 2Y5SA 3USZA 1YE4A 3GXTA 3IAQA 3NZGA 3RX4A 3PSWA 3ABRA 4IMCA 3W1NA 3H23A 1TV5A 1RH9A 2EPNA 4GXMA 3ZZ1A 1W9VA 3QQ0A 4WGHA 3AHZA 3SQMA 2I14A 3T07A 3DCPA 1HXJA 5AHLA 3F4DA 2WANA 4RK8A 4FF7A 2ACRA 4EXBA 4NJGA 4NZCA 4ZQMA 6REQB 1W5MA 3ITYA 1YW1A 4GVFA 3G1HA 3N18A 4BY3A 2EPHA 4HJFA 3RR4A 2BMBA 3TW9A 2ZADA 2C3ZA 2FYMA 1R2SA 1WZAA 3HU7A 1FWFC 1SR0A 2C16A 5CPOA 4N02A 4DXXA 1DQUA 3W6MA 4QCFA 2X16A 1B5TA 3QR3A 5AYXA 1F9CA 3EBVA 3IANA 3AHTA 4QJ5B 3VKKA 4EF9A 2X2GA 1PTAA 2TAAA 3INPA 4J3ZA 2OX4A 4WY0A 4W5ZA 1AW1A 3W1AA 3WLOA 4WXYA 3TTSA 2FQIA 2QUNA 2ONEA 2D24A 1RY8A 1E6ZA 3VDAA 3W76A 2ZUNA 4JN6A 3K13A 1U22A 4RDWA 1OIMA 2XFYA 2L5HA 3ID7A 1I60A 2J25A 1Q45A 3U5YA 4JIPA 2OU4A 3BH4A 4HMCA 3Q94A 1QASA 1N8WA 3MQTA 1YE6A 4R27A 4IJCA 2Y4SA 2CLKA 2E9LA 1FWBC 3NM1A 1JPIA 1U1HA 4L9ZA 3VA8A 3GG7A 3MKVA 4CUCA 3TQPA 2WB5A 1WPCA 3LBCA 3NSXA 4UFIA 4U4MA 3EMQA 5BRQA 3WLSA 4JTKA 1E4NA 2E7FA 1TJ0A 3IV3A 4MKNA 4IM4A 1ADOA 5TIMA 1GTHA 5CSUA 4WJXA 1E6XM 3P61A 4DI9A 2GSEA 1FDYA 4DB7A 1PJ9A 3AMGA 3CAVA 3B9DA 3O15A 3MHFA 4Q6JA 3WSUA 4GCAA 3TQKA 4WJEA 5D9NA 1AQ0A 3DERA 3ANVA 3AJ7A 3GNDA 4NRSA 1V6VA 4DM1A 3VCCA 1Y8BA 3W2UA 2ZE0A 2NX9A 1LL7A 4K7VA 3W81A 1QO5A 4KBXA 1BPLB 1PEZA 4JTTA 5LHFA 4YHEA 5HNNA 3VD3A 1S2UA 1JZ5A 4A3QA 3QV6A 3S2MA 3BANA 4IGNA 3I3EA 4M51A 2BGQA 3VD5A 4RE3A 2P0OA 2WJEA 2Z6JA 5EL1A 4IIHA 4HBKA 3TC3A 1T41A 4GI4A 2FTWA 5E0FA 1L6YA 2IQDA 1GQIA 2VM8A 4MWAC 4P7OA 3UCDA 1PE1A 4IT1A 3QSRA 3RRXA 4LGXA 3SEPA 2ISDA 3W7IA 3CHEA 1RUSA 3TTEA 4U2YA 3JZEA 2ISFA 1KM3A 5HANA 3JU2A 1UC4A 4JX4A 1MUCA 2ZX8A 2WCSA 4E4FA 3W2JA 3LHYA 1TZ7A 1YEYA 2X8RA 5D33A 3ZJ7A 4XAFA 3WQFA 2B31A 4W9TA 5IXEA 5FEXA 3WNKA 1I4NA 2WKLA 1NWTA 2V5JA 1ITUA 1J5TA 1LRTA 3MCOA 5A94A 1UJQA 2QCGA 2GWGA 4UUIA 1EOMA 4JL1A 3U9IA 1I2PA 1JZ4A 2I5GA 2RDUA