4XIAA

Structures of d-xylose isomerase from arthrobacter strain b3728 containing the inhibitors xylitol and d-sorbitol at 2.5 angstroms and 2.3 angstroms resolution, respectively
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
393
structure length
393
Chain Sequence
VQPTPADHFTFGLWTVGWTGADPFGVATRANLDPVEAVHKLAELGAYGITFHDNDLIPFDATAAEREKILGDFNQALADTGLKVPMVTTNLFSHPVFKDGGFTSNDRSIRRFALAKVLHNIDLAAEMGAETFVMWGGREGSEYDGSKDLAAALDRMREGVDTAAGYIKDKGYNLRIALEPKPNEPRGDIFLPTVGHGLAFIEQLEHGDIVGLNPETGHEQMAGLNFTHGIAQALWAEKLFHIDLNGQRGIKYDQDLVFGHGDLTSAFFTVDLLENGFPNGGPKYTGPRHFDYKPSRTDGYDGVWDSAKANMSMYLLLKERALAFRADPEVQEAMKTSGVFELGETTLNAGESAADLMNDSASFAGFDAEAAAERNFAFIRLNQLAIEHLLGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase(intramolecular oxidoreductase)
molecule keywords D-XYLOSE ISOMERASE
publication title Structures of D-xylose isomerase from Arthrobacter strain B3728 containing the inhibitors xylitol and D-sorbitol at 2.5 A and 2.3 A resolution, respectively.
pubmed doi rcsb
source organism Arthrobacter sp.
total genus 141
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 5.3.1.5: Xylose isomerase.
pdb deposition date 1989-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4xiaA00
3XISA 1QTWA 3DX5A 5EMLA 3VNJA 2NQ9A 3AYVA 2G4JA 1XICA 3UA4A 2G0WA 5B7ZA 1QT1A 3KCOA 1XINA 1BXBA 4ZB0A 1XLEA 3U3HA 4QE5A 1XLJA 3KBWA 1XYAA 5I7GA 5C9ZA 1I6NA 3VNKA 1S5NA 4XIAA 3GNXA 4K1GA 1XYMA 3L23A 2XISA 2QW5A 4ZB5A 5H1WA 3CQIA 3M0HA 4J4KA 5XIAA 1DE6A 1XLGA 8XIAA 5H6HA 2GUBA 3CQJA 3KWSA 5XIMA 3C0QA 3VNLA 4X61A 2GVEA 4GJJA 4E3VA 5EMJA 1XLCA 3BDKA 4HHLA 1XLMA 4QEHA 2X7WA 1XIJA 3P6LA 4X60A 3KCJA 1A0EA 3KCLA 5EMMA 4LNCA 8XIMA 1XIDA 1XIHA 3KTCA 6XIAA 4GQBA 1XISA 3ITLA 3NGFA 4ZB2A 3ITYA 1XIGA 2HCVA 3BZGA 4A8IA 1BXCA 3IUDA 3ITXA 3LMZA 2HK0A 3M0YA 4YTSA 3C0SA 3ITVA 3N4AA 4QE4A 3VYLA 4YTTA 1QUMA 4G56A 3C0LA 6XIMA 1GW9A 1S5MA 2XINA 4KW2A 2XIMA 2QULA 3FVMA 5FA5A 3VNIA 1DIDA 4K3ZA 2QUMA 1CLKA 1DIEA 1DXIA 3DBNA 2J6VA 4PGLA 3UU0A 2GLKA 3U0HA 4XISA 1MNZA 3KBMA 4A8RA 1K77A 1XLKA 3IUIA 4GLEA 3CQHA 5AVHA 3AALA 3ITTA 1XYBA 3KBJA 4Q7IA 2HK1A 1XP3A 4QE1A 1A0DA 3M0LA 1A0CA 1DE5A 2GYIA 4XSMA 3QXBA 2OU4A 3KBVA 4HNOA 3M0MA 4XSLA 4QEEA 2I57A 2QUNA 1XLHA 4PFHA 3UA3A 3BZJA 3VNMA 3WQOA 4DUOA 3KBNA 3BWWA 4HHMA 1OADA 1XYLA 4ZBCA 3OBEA 2NQHA 4A8NA 9XIAA 3IUHA 1YX1A 3KBSA 1XIFA 1XLDA 3AYTA 4W4QA 3QYSA 4XIMA 1I60A 2ZDSA 4HGXA 3UXIA 5J8LA 2ZVRA 5B7YA 1XIMA 3BANA 3M0VA 3XIMA 4YTQA 4GJIA 4X63A 4DVOA 1XIBA 4YTRA 3CNYA 5XINA 1D8WA 1O1HA 3QZAA 5B80A 5EMKA 3TVAA 3JU2A 3P14A 4QDWA 4EAYA 3M0XA 4EACA 1XLFA 7XIMA 4US6A 1TZ9A 1XIEA 4XKMA 5AVNA 3CWHA 3ITOA 5TNVA 1XYCA 4OVXA 2Q02A 3XINA 9XIMA 2I56A 3TC3A 3AAMA 2X7VA 4QDPA 4A8LA 2NQJA 1XLAA 1XLLA 3UVAA 1XLIA 3CQKA 1XIIA 4YTUA 3QC0A 1MUWA 1XLBA
chains in the Genus database with same CATH superfamily
3BSHA 4DF1A 1R85A 2ADAA 1NFPA 1VB9A 3IPWA 4C1LA 3IRSA 2VR4A 2X1UA 2NT0A 3PR2A 2GGHA 1FUYA 4GINA 1WNOA 3W02A 4JQ3A 4FNPA 3L12A 3M16A 5I24A 4MNJA 3H26A 4MAVA 1OVDA 3FDKA 4E0CA 1TJ2A 3AXHA 1W2PA 3GFXA 1P0NA 3PWAA 4HN8A 2CZDA 3CK5A 4AF0B 1H3GA 5E5CA 2VO5A 2E6DA 1WBHA 3G24A 4AW7A 1EJRC 4DYJA 4TV6A 3EOEA 2DT3A 1V7AA 3A4JA 3PBGA 1ONEA 1VPXA 5HR6A 2ZRYA 5A94A 4DRSA 1W1B1 2PPGA 1XD1A 4I5UA 2FH6A 1J5SA 3EDFA 3DZ1A 3PK7A 1IIGA 3QZEA 4UR7A 4B3KA 4HN4A 3VM5A 5HQEA 4IFRA 2SFPA 3FGCA 5FF0A 3WLRA 5DCDA 4TUFA 4NUWA 5A6SA 4D1IA 3A21A 3N19B 2NX3A 1QT1A 1DTUA 2B31A 2BX7A 2H8XA 4NZJA 3NTYA 2V5LA 3DUGA 3UWEA 3ZVIA 4D6GA 3W82A 4C6MA 2PWFA 2VX4A 3VNLA 6CGTA 4B4FA 3U4AA 2JF6A 1B9ZA 2Z1VA 5EMYA 4F2TA 1XSJA 3QW3A 3QR1A 4YIWA 1F73A 3DBPA 4LBUA 2PDUA 1XIHA 1YHTA 2HDJA 1P5BA 4NXSA 2YL9A 5I6SA 1VBHA 2VGIA 2VXNA 3EWZA 4GZJA 4W7UA 5C5YA 1OC7A 3O7UA 5CCZA 3EKLA 4K3ZA 4HA1A 4QS5A 5A2AA 3VVGA 1KXHA 3PBMA 1SSDA 4HK6A 1B3ZA 4MB1A 1V03A 3E38A 1FHDA 4C1KA 3W00A 3WQCA 1UG6A 3OQ8A 1EJVC 1UD5A 4MB4A 2XN2A 4DZIA 3S47A 2ABAA 4GZEA 1RZMA 4W7VA 1XC6A 4XIMA 1J0JA 4YTQA 4MTVA 1OFBA 1MQRA 1TWZA 2OEJA 1O5QA 3OJGA 2WHMA 1F5ZA 1OWQA 3OG2A 4Z1BA 2C18A 3QVQA 4U5IA 4CD4A 3TJIA 4RDWA 4AZHA 1IZKA 1QASA 4PR4A 3FLUA 1QHZA 3QPYA 4H04A 5G5IA 3GBDA 1K9DA 3LNPA 4G5DA 3WCZA 4EAMA 3L4WA 4W89A 5REQA 1V51A 2IQDA 1GQKA 1U5VA 1JQXA 3KWSA 1O5KA 1PO9A 1QK0A 3PBUA 1NOWA 1EH9A 2EF9A 1KKRA 5H8UA 2E6FA 4UTWA 1CIUA 2C71A 2OQLA 1BXCA 1RCOB 5LNRA 1KTNA 1FA2A 5I79A 1N82A 2VQTA 1E73M 3N2MA 4QE4A 3T8QA 2F8QA 1WDSA 2ZRVA 2Y0FA 3MA8A 2Y4SA 5AZ0A 2H8ZA 2YA1A 3GTNA 2DH2A 3TUUA 3LY0A 2WKJA 3UZWA 3KOZA 4HTYA 3CQHA 3LLXA 1UKPA 3RCNA 2IPWA 1L6SA 3OA3A 3POCA 4X3ZA 3VD7A 3RLVA 2WPGA 3W4RA 3NO5A 4OHQA 1DVJA 4RCXA 1I0BA 2QLYA 3JZEA 3T2PA 3SRHA 2PDXA 1V3IA 1UWIA 2G50A 3HGSA 3HN3A 5G1MA 1FFRA 4MM1A 1YRRA 3H4XA 3BGGA 1SJCA 1EOMA 1ITUA 1Q2SA 4V1YA 2EBNA 1VCVA 3EWDA 1SO3A 3OEXA 3V36A 3MJMA 2YA2A 4HOZA 4MB3A 3ARYA 4WDUA 4PUKA 1KCZA 2J78A 2C1IA 4JHOA 1Q8JA 3L5MA 3VNKA 3STFA 3PS7A 5AY7A 1UPPA 3R0KA 3TOPA 3GHSA 1LDCA 4FA3A 3PBVA 1LBLA 3PSWA 3N12A 3BLFA 4QJ4B 4KWOA 2W67A 3BZGA 4ML4A 4K7YA 3ITXA 3L67A 1P0EA 4KETA 4UIOA 3RF9A 1XL9A 4YTTA 1P7TA 3B9EA 1GQJA 3CZKA 3B9NA 2E5DA 2HTMA 4DPQA 1A3XA 3I4EA 1HP4A 2F6XA 5CC5A 3B05A 3HIJA 2G4FA 3HURA 2HRWA 1MW3A 4H9XA 1H41A 3P93A 2EAWA 4Q4QA 2GYIA 3UQNA 3KBVA 3M0MA 4WVXA 5C9RA 1DPMA 4LAMA 1YX1A 3ZYZA 2V3GA 3G0SA 5LNUA 4LVFA 1H62A 3W2NA 3OYZA 3GDKA 1MW2A 4EOUA 1UR2A 2VWTA 4MZ8A 7XIMA 2CEQA 3NWRA 3KVKA 4A3YA 5ABEA 1W32A 3NURA 3LHZA 3QSTA 4GC4A 4GC3A 3T7VA 4CEUC 4XX6A 3LCLA 5CZSA 3UWYA 3W2JA 2ZCGA 3SI9A 3LHWA 5LIXX 4ZO6A 3SUWA 3KOWA 1Z42A 4J2PA 3H23A 1JZ4A 4RJEA 1R3YA 1EGZA 3G1SA 1KFLA 5EFFA 4PZVA 4P2VA 3FOKA 4RR4A 1VP5A 3G1XA 1MW0A 1UWRA 3SIMA 5I77A 4DNMA 1NQ6A 3CV6A 3M64A 1KM3A 4GYKA 3UPBA 4J27A 1FWCC 1L6WA 3B40A 4QGCA 4B16A 1ZCOA 3DENA 1HGYA 4PRTA 4O14A 1ZENA 2RHGA 4FEZA 3SCNA 4PUUA 4AB4A 1XPYA 3LZ5A 4H00A 2F2KA 1B4KA 3M0VA 1XW8A 1S2TA 2B7PA 3LCXA 1FH8A 3THDA 3EPOA 3M0KA 1H7PA 1WX0A 2ACQA 2B7QA 2Z0IA 4O54A 3PM6A 4JDBA 4B9ZA 5TNVA 2BGQA 1QWKA 4OOUA 3PTQA 3DFPA 4UQEA 1S1PA 1HF6A 1I1WA 1KM0A 4MJZA 5A6KA 3BE7A 1OK6A 1UD8A 3QM3A 3WJSA 1XYAA 1RUSA 4A22A 1ZRQA 4JNZA 2BOGX 1AFSA 4RX0A 4AD1A 1EL3A 3LXCA 3RO8A 3CQJA 3W1RA 3WLOA 1UJPA 3W72A 3VO0A 2VZVA 2QVHA 4WY0A 1M41A 3P84A 3NSMA 4YYCA 3JS3A 4GZ7A 2ISVA 5J04A 5MKGB 3VKJA 3RDKA 2GJLA 4OWGA 4F48A 2E5BA 4B5VA 1K02A 3WG6A 3ME3A 1UD4A 4XQ6A 1VJIA 1EBGA 2CERA 3NM1A 5JVLA 2EPKX 1QNPA 3AQUA 2GLKA 5E09A 1HL9A 4Q3MA 4DLMA 4PSPA 4QTGA 3EX4A 3WH7A 4AIUA 3HV8A 2ACUA 2R8WA 2QMJA 3N6HA 2BBFA 4OOZA 3ZIZA 3QYSA 4XO7A 1CXHA 1CT5A 4OV4A 4NAEB 4GI6A 1IV8A 2GVYA 1WZAA 5A8MA 1JXJA 1Q63A 4NY2A 5FKYA 1YXYA 4GYPA 4IHCA 1MQPA 3K4DA 4MFDA 5F4XA 3ZZ1A 4FLOA 1ISZA 2P88A 3DDMA 4AWTA 3QR3A 1I2OA 2BXYA 1LRNA 1WPCA 1L0PA 3NIYA 3XISA 2QPSA 1O7AA 1MRQA 4JKMA 1UH4A 3M43A 3BH4A 3BG3A 2YKKA 3S2MA 1A5UA 3M5YA 1L9WA 2CZ5A 2R82A 1Z3NA 1XYZA 4LGXA 1QWGA 2PA6A 1OFPA 1UR0A 3G1RA 4IL0A 3VOCA 1GQIA 3VFLA 3AMKA 3UJSA 4UZSA 3PUOA 3HB9A 1ZTVA 3RCYA 4ZA0A 1JCJA 3KCLA 1VEOA 3EX3A 1M01A 4CU8A 3ARTA 2XDFA 2J13A 2AQVA 3LCGA 4JTTA 4WKAA 4H9ZA 1R2RA 4TO8A 1DIDA 1H7XA 1N2VA 2B7NA 4XBSA 3FK4A 4B90A 1A0CA 2DZAA 4N9DA 7PTDA 2F2HA 3H6OA 4XUGA 5I0DA 3NQDA 1RBAA 2XN1A 3BG5A 4Z2KA 1J93A 4XV0A 3AOFA 3AU6A 3L7RA 3FSUA 1DQWA 4EE9A 3WLKX 3WH8A 3F4CA 1HVXA 1M53A 4BQ3A 3O8AA 3CL8A 4IX2A 2FH8A 4E3TA 3AI0A 3VDAA 1GZ1A 3O3RA 3NXLA 4CN4A 1XQKA 4H6QA 5RUBA 5IOBA 3GX9A 3NM3A 3VAVA 3K4WA 2Y61A 1G0CA 2YBTA 1IEQA 1OY0A 1US0A 4TVDA 1WE5A 3D0CA 3WDQA 2VJXA 5AYBA 3SCTA 2JBMA 3JRKA 4XAPA 4CLMA 3AJXA 3EX2A 3REQB 2Z24A 4DJDA 4GY7A 1DORA 1K03A 1NOFA 2PDWA 5CSUA 3LXBA 1F74A 2BSLA 1JAEA 4RL3A 5E1QA 1GPFA 2QQ6A 3GG0A 4IPNB 1FHUA 5IM51 1EPXA 1GKQA 1SW3A 1BKSA 2VGFA 4JX5A 4MFEA 1P0KA 6XIMA 4JTSA 1UR4A 4QJ5B 2HEJA 1RY0A 2C3ZA 3WUEA 1DJYA 1FP8A 3TYEA 3C3NA 2D73A 2V5DA 1GOQA 1UA3A 4H1ZA 4DY1A 1JQVA 2GJRA 3GSMA 2FPYA 4UMCA 4BI5A 5FOOA 2OOGA 2ZYFA 4JIRA 3NR0A 3AIRA 1HJXA 5TBOA 1IR2A 4B3LA 3P5ZA 1MEWA 2GVGA 3G1AA 3MO4A 1Q13A 4B2DD 2VFIA 4G7EA 4ZR8A 4PBEA 2VVNA 2PTYA 3OGRA 4EIVA 1B31A 3CNYA 3SCVA 1JL8A 3VKDA 3VKCA 3SSJA 2E9BA 3L2LA 1U83A 4DBSA 1KD0A 3T0TA 2X41A 3CTTA 1OFQA 1UIPA 3W37A 4L1XA 4Y2WA 1BVZA 1RPXA 3EXRA 1I1XA 1Z69A 1YTKA 5I2UA 4Y8EA 2WNNA 3NFUA 4LAUA 1B3OA 4AXNA 3W7OA 1CXKA 2WSPA 1QW8A 1DHPA 3MSYA 4GJJA 1EHAA 1HKMA 4KPLA 3CEUA 5CGQA 1Q2RA 1LBMA 1F2JA 4JZ5A 3VIOA 2WSRA 3TOYA 4AF0A 4KWWA 3II1A 3DFOA 3QQWA 4I6KA 3M6DA 3S2CA 4H3DA 4DJEA 3V1PA 4LRTA 1BF2A 1KKOA 1ZAHA 4FZIA 4HZMA 2QCMA 1FVPA 4I5RA 2A4AA 5DF0A 3VXGA 1OX4B 4I6VA 3PFRA 3NNTA 4QJ1A 4LUTA 4MHBA 1UMYA 1E51A 4XZHA 2CBJA 2E1WA 3W2MA 1Q5MA 4LUIA 3E2VA 3K2GA 1BKHA 5ABGA 1MDLA 2VEPA 4BJHA 3B8TA 4S3KA 1U22A 3W07A 4NASA 2GUYA 1ITQA 1QW7A 4RE4A 4MPKA 2IKIA 3DHPA 3PZQA 1HXJA 3PTMA 4H9TA 3HGOA 3M0XA 2DSZA 1RJRA 2ZUUA 4ORIA 4YXGA 4XKMA 1ZBCA 2BV9A 3NUKA 2BGSA 3UNDA 1ZU8A 2WZTA 1DQUA 5BU9A 5GPRA 1F7BA 1M04A 3VCRA 4KCUA 2GK1A 4ICCX 1XINA 3AZRA 2QIIA 1J10A 4MY9A 1UR3M 1ZBKA 2PLKA 4XAGA 1US2A 1VS1A 3SEPA 3S1VA 1FWAC 2EQDA 3W1MA 3V1HA 1C8VA 3HQ1A 4TU1A 4ZO9A 3BOFA 3PAOA 2JEQA 5A6MA 3TCSA 5HXMA 1PX4A 1FQ0A 1S3TC 3VMPA 1CI1A 2PODA 3IGXA 1BQGA 1GK8A 4UC5A 3LMZA 1X8CA 1Q6GA 4KEMA 1ADOA 1XUUA 2DJLA 3UWZA 4A21A 2VURA 5CG0A 3BMXA 3GG7A 2I5IA 1KBJA 2WMGA 3TSBA 3UPMA 2FB2A 1MNZA 2BS9A 4WLCA 2GQ3A 1WXYA 2O92A 4Q6JA 1XD0A 4S3CA 4I8DA 7REQA 3DG6A 1YDNA 4CVWA 3TMQA 1SR0A 2FQIA 3FCPA 1GVEA 5CZJA 2J25A 2EPHA 2JGYA 2E7FA 1XR2A 5XINA 3PPGA 1GVIA 1EA0A 1EX5A 3CIWA 2DZPA 3P14A 4JL2A 4JS3A 1FWBC 3IV8A 4L1WA 1T0OA 2TMDA 2XIIA 4JTLA 3CJPA 2JKPA 5JBFA 5F1UA 4DUXA 3ABXA 4RXGA 4KKXA 3S2LA 1E6SM 2A0NA 3VTRA 1BRLB 4IM4A 4HCHA 4BK9A 3BCFA 2QJJA 3GNXA 4EWJA 4UTMA 2P0IA 2TYSA 3KZPA 3PHAA 5MF5A 3PG9A 4J4KA 2E4TA 4K8EA 1NAL1 2BVWA 4KGLA 2JGQA 2E0PA 3S3GA 3SDOA 4ADSA 4XTDA 3QV7A 4IMEA 5D2VA 4N42A 1C9WA 5FEZA 4P5UA 4GXWA 1BQCA 2OYLA 3GYEA 3O6CA 1VGAA 4DF0A 1P0DA 3Q37A 3B0VC 4HNVA 2ZC1A 1IF2A 4PGLA 1GZGA 5DO8A 3E74A 2IXUA 2GDUA 1E6XM 3UD6A 1PV8A 2F6KA 1FWGC 4C1NB 1FCUA 4JQ4A 5I78A 1V0MA 3WMBA 1AK5A 3NOEA 4C60A 3GZ3A 1R0MA 3CUHA 2CLMA 1KBBA 3NCOA 3PUDA 1R3SA 3WQ8A 2YCJA 2QF8A 3ZJKA 2NZLA 3KP0A 2V3FA 2ATSA 3N9RA 1RALA 2IS7A 2PP3A 3FJ6A 5DY2A 4H8HA 5DMYA 2Y89A 4JIEA 4DELA 4WDXA 2Z2AA 4KH2A 3HG4A 3TC3A 4HBKA 3UVAA 3SJ3A 3WNKA 1JGIA 3PUGA 3TE9A 4RNJA 3WLQA 3R4IA 3IWPA 1BPLB 5HWJA 1W3LA 3E49A 3SFKA 4WDWA 3N3TA 4ZSTA 4K1GA 3PNUA 4DJFD 1VBGA 2FGZA 4D6CA 2XHYA 3PZIA 4P7LA 2HNEA 1HUVA 1VEPA 1LF1A 4HTBA 3T42A 4RZ6A 3MCNA 2NV9A 3TC6A 3GXFA 1OCNA 1KB3A 4QP0A 4RW5A 1DKWA 4K36A 2C15A 1BXNA 4RE2A 5M1TA 1B4EA 1UQYA 4E4UA 1ZL1A 2D0HA 3ORWA 1JZ8A 3JR2A 1EBHA 2IPFA 2EPLX 2XIMA 4FO4A 5A6LA 2PF0A 3AIBA 2DP3A 1AQFA 4QDMA 1DIEA 3PJUA 5AHEA 5FEXA 1YTDA 4OE7A 3UU0A 3ZXWA 5BYWA 3U6WA 3PPHA 3DG3A 4WJXA 4GD0A 1N8WA 4HZ6A 3VNMA 3VGDA 3U57A 2BB0A 3QFEA 1ONRA 4IPLA 4W4QA 1UQZA 1RQBA 4QX4A 2VKZG 3ES8A 2DPEA 4Y8FA 1C90A 3LS9A 4FX8A 5EYWA 2FYMA 2PB1A 4N0RA 2V81A 3BLOA 2WANA 1DXEA 4CKQA 2Z6IA 1B57A 2HXTA 3WQVA 1EC8A 4C6KA 1KLZA 3GC5A 4ZOAA 3POHA 4ORMA 3EX1A 2W61A 2XFRA 1GOIA 4M0XA 1M1BA 3MC5A 5B7ZA 3N9SA 1V5XA 5FL0A 4HQVA 4JQ2A 1P4CA 4L4LA 2PTXA 2D69A 2JQXA 4CCDA 1UD6A 1KGUA 4KCTA 1Z89A 1H49A 1W9XA 3H2AA 4MWAE 1F61A 3CQIA 3C8NA 4O13A 3GDTA 3MSDA 3E3HA 3B04A 4DWSB 1ZAIA 1XI3A 1XLCA 4P7OA 4GO8A 4JICA 4A2RA 3WIJA 3HFTA 1B5TA 5LZLA 3GHRA 1F76A 1W91A 1N8FA 1K9EA 2XU2A 4Z1AA 2HK0A 2I9UA 4CNPA 2OZ0A 2J6VA 3GNNA 5TAOA 2DSVA 4P61A 2WVVB 5AVHA 1TQXA 3M07A 1XRFA 3B03A 1FXPA 2QUNA 2YOCA 3TC7A 5CJNA 1WCGA 5LHFA 5AHLA 1P1XA 1JCLA 1FWNA 1Q66A 3UJRA 4Q8PA 1OFDA 1Q7ZA 4IPJA 2ATMA 1LJYA 3EDDA 5E9XA 5K7JA 1Q4WA 4LW7A 1LM1A 4MGGA 5HJLA 2VZUA 5C71A 1A5NC 4JIIX 4Q8VA 4Q8QA 3PFMA 5AHFA 5DMMA 1M5WA 2RDXA 3GR4A 2FJKA 3HTWA 1XLJA 1TPH1 3SGZA 1XKJA 2BXVA 3UEQA 1XBVA 3AC0A 5MKGA 4DBEA 3BAKA 1NOUA 3I4KA 2B81A 1WUFA 5BRQA 4LX4A 3V0SA 4J3SA 1QO2A 2X2GA 3STCA 3SUSA 4QM1A 3VOHA 2AAAA 2UZ9A 4XTIA 1U2YA 2PDGA 2CZFA 3AIEA 1WQ5A 4RV8A 3I68A 5EKYA 2XFYA 2VZTA 3ZS4A 5BNKA 4XKYB 1XGDA 2E40A 2NUXA 3M0IA 3TJ4A 3LK6A 4DBUA 1GOXA 3P60A 1TPUA 5EGRA 1CB7B 4MNKA 3GHUA 3HG5A 1EEXA 4XISA 2YXGA 4Q8WA 3M46A 1XYBA 3ZT5A 4TIMA 5D2YA 5M17A 3PY2A 3HGJA 3V3WA 3TX9A 4DI8A 4Z17A 2RDTA 2VD9A 5CC3A 1W0MA 1RPKA 1NF0A 2QXWA 3HPFA 4JEJA 4MZ1A 1B3VA 3RLHA 2YL5A 2BXZA 3FYPA 3WQPA 1PWLA 4YTRA 1L6GA 4CCEA 3OA5A 2INEA 1TA3B 3O6AA 4Y96A 1HW6A 4L5ZA 4WSHA 3O07A 4JXCA 1M65A 2CXGA 4FAMA 1K7FA 4MWAC 4E2OA 4NG3A 4YWIA 4EXAA 4JX6A 3UVIA 3F4NA 1S5WA 1J5TA 2PWUA 4RDVA 3DYMA 2NQZA 3KL3A 3ANYA 3KW3A 2WVTA 3KDNA 4W87A 3TJXA 4JYDA 1NDZA 3DN5A 1Q85A 1JFXA 3W2UA 2WJEA 4GWEA 1R47A 1FDYA 2FZ8A 1UP0A 2VGGA 3I6RA 3OQEA 2P3EA 4Y9AA 1O95A 3O0KA 2AMGA 3CWNA 2W63A 4QJ3B 2BHYA 3VOFA 4DQWA 2Y70A 3HQNA 2P53A 3MP3A 4MOZA 4NX0A 1WB0A 2FZ9A 1V02E 3CZ8A 3EWYA 1QNOA 2VRQA 4Z42C 2QCDB 4GYPC 3QF0A 4ZTYA 4GQGA 5C2GA 3U9IA 3NXFA 3ATYA 2QEZA 5EY5A 4Z1CA 2TAAA 4RLIA 4GOAA 1TPVA 3DFQA 5LIWX 2W79A 1XH2A 1PSCA 4I9TA 3OVGA 2BG5A 3T4CA 5CPQA 4WSJA 2OG9A 1L8PA 3LCIA 1WO2A 3HG3A 4KS0A 3LTSA 5GNZA 5J8LA 2O0TA 4NNBA 3RHGA 3GXIA 2YBUA 4DZHA 4F0HA 5I02A 4POCA 4JY8A 1J0IA 2R91A 1TR1A 3V5OA 1LOQA 3CPGA 3WEOA 5A2CA 4QDWA 4IP4A 1K4HA 1YXDA 3DFTA 4QFUA 1A5KC 5A6AA 1CGXA 3O1NA 3TYZA 4JIQA 1KRAC 3R1ZA 1TJ0A 1P0BA 3NDZA 1W5PA 1WZLA 2EKCA 3WX7A 3TONA 2WC7A 3W27A 4HB7A 2HZGA 4PH6A 4UZUA 3VIJA 1O4UA 1I2RA 1UUOA 3OTRA 1PTGA 3SO7A 4PCFA 3GLCA 4CGTA 1RCQA 2GVEA 2YW4A 3MDWA 1Q6DA 3WLPA 2PURA 1FCBA 1QI5A 4D8LA 3OYXA 4LEQA 3MS8A 1JCYA 3VZZA 1YNYA 3EWUA 3S5YA 4HSOA 2FZBA 3E2RA 1E0XA 3OPSA 4LUJA 3U7VA 3TV8A 4RXFA 1JEZA 2G95A 4R85A 2Q09A 4DXKA 2QAFA 1E6ZA 2YDQA 4OKDA 3ONCA 3PWGA 3DYPA 4M51A 1YLVA 2PLJA 5AYIA 2QCEA 1EWEA 3TYUA 3M0JA 3WBEA 1FFQA 3BJFA 3S8HA 2R1LA 3GVGA 3GG8A 2RFGA 5C55A 3IAQA 2GOKA 3SCPA 4IUGA 3NDYA 5A1AA 1BAGA 4DJDC 1V6YA 4DVOA 4CCCA 1JD7A 1RA0A 3BSMA 4D6FA 1EZ2A 2CLLA 1BWVA 2OSYA 1UP3A 2WLZA 1QPOA 3B8WA 1KQYA 3WLHA 3OZOA 2ZUWA 1FWJC 1EP2A 4FR1A 5DT5A 4ACZB 4GKLA 1NFBA 4GVFA 2NV2A 1QR7A 4HCDA 4PB3A 2FVKA 3A23A 3WLSA 2CFFA 5MHBA 2YCKX 3A64A 4PTWA 4RPQA 3RRXA 2QIWA 2RDUA 3LENA 5LA0A 5CLWA 3GWQA 4GYJA 5C2CA 2PWDA 4UQBA 3FIGA 2GDVA 3TKFA 4TQTA 3C61A 1JCXA 3BCDA 1XIGA 1OX4A 2XVNA 4MNLA 2Z1SA 3NSNA 2ACSA 5I06A 4EXBA 3U2EA 1AL8A 2PC8A 1FHVA 4HA0A 4JTIA 1A5MC 4FB7A 1FRBA 2BTMA 4LB4A 1SO4A 2ZE3A 1SR9A 4F4RA 4U28A 2WQDA 3QQ1A 4H9UA 4LANA 1OC5A 2AGTA 4RK8A 3QXBA 4UTUA 1DJWA 1TIWA 2UWFA 3S5SA 3OBKA 4IGSA 3P67A 3MANA 1XYLA 4D8AA 2HE8A 1XIFA 1ZB5A 1QK2A 4B4HA 3UCCA 1M03A 4HGXA 1OD8A 2GOUA 3DOPA 2QJNA 5FJPA 1T5AA 1KGWA 3FDGA 4AHPA 3W25A 3ITOA 4L4MA 4W7WA 4IUOA 5AYZA 2VEIA 2Z1XA 4DJEC 4GO9A 3UR2A 1YDOA 1VF8A 4IMGA 2EPNA 1PUDA 3QHOA 4XZ9A 3WUBA 5ECUA 1E3XA 1UWUA 2BY1A 3CHFA 1UP2A 3LLFA 1KFEA 2BY3A 5FL1A 1GZJA 1KV8A 5IXEA 1IEVA 4UMAA 1XM3A 5DBUA 4ZB5A 4O8RA 4DM2A 2D22A 3LRKA 5LKYA 4H4IA 4XZLX 1G5AA 4IMFA 3S1GA 4WKHA 3PSVA 2G8ZA 3EWWA 3NQ6A 3SFWA 2OJPA 4PB4A 2E28A 3FA5A 1TJPA 3O9NA 3UPWA 3DHUA 2QULA 4ALDA 8RUCA 1YBQB 1F3WA 3SZ8A 3QLLA 3H7VA 2PBGA 3WNMA 3TR2A 1ECEA 3TJLA 4F8XA 4ZO8A 4TR9A 1H11A 1TZZA 4NIRA 4N9EA 3CL6A 3RX3A 5DMLA 4NRRA 2Z29A 1JNDA 4F0KA 2C79A 3PZMA 5K9XA 1HKKA 3RR1A 1VFFA 4S2BA 3ECQA 4Q8OA 3K46A 4UNIA 3AWNA 3BTNA 4QSFA 2XPKA 2ODOA 1DJIA 2A6LA 1GEQA 1IXNA 2CXEA 4L1GA 1BRLA 2ZRWA 4KRUA 3OVPA 4B5WA 1BD0A 1J2WA 3AZSA 2PP0A 3CQKA 3RR4A 2MNRA 1GOWA 1DWAM 2XFFA 3SCQA 1DWHM 3B9AA 2XGIA 4LWWA 2C1GA 2H3BA 1B9BA 1JPKA 3RN6A 1HKIA 3UXKA 4DWDA 3MJYA 4HNLA 2P1FA 5XIAA 8XIAA 3MWCA 2ZWZA 5D09A 5GJNA 1WKDA 3C0QA 3TA6A 3GRIA 3QY7A 5EMJA 4C90A 5HANA 4LNCA 3LCWA 5I09A 4FLSA 2VD8A 2A1YA 5F4WA 2VC6A 2VFGA 2PRHA 3GU1A 3WQ6A 1X97A 3ITVA 5G2WA 4JTQA 2DZUA 5C54A 1SZGA 1QI3A 2ZOXA 4PL2A 1CEOA 1PIFA 8TIMA 4EANA 3WJYA 4KWSA 1B54A 3A47A 4HMDA 3IUIA 4W93A 2OKTA 2HVNA 5ENLA 4Q7IA 5FJIA 5BXTA 3HV9A 3S1XA 2V3DA 1JULA 1PCWA 4ZOCA 1WKYA 5ABHA 2BGNE 2QCNA 3VZYA 3SY5A 3B8SA 3LBMA 3VGEA 3NZRA 1LWJA 2YDSA 1V6XA 3ABQA 5I3FA 1SM9A 3STEA 3TW9A 3A4XA 1CENA 3OW1A 2CNCA 4ICMA 2ON3A 1EO5A 2PWEA 4E4PA 4MLJA 4FNRA 4BI6A 2RJHA 2Y24A 3GZAA 2HBXA 5EPDA 1XIEA 3OOQA 3U2OA 3UJ2A 3BK0A 5HOSA 3LX9A 2O7SA 4DI9A 2NSOA 5CZKA 5A5WA 1OG0A 4Z2LA 3B4YA 1ICSA 3WF4A 5A6BD 1G01A 4FNQA 5H8PA 3SCRA 5G1TA 3TW6A 1MYRA 1R6WA 4JN7A 4PMNA 1PKYA 1UZ1A 1V0KA 4PTDA 4C6BA 4WR3A 4MJ2A 3WBWA 2JEPA 3R25A 1QVBA 3S46A 4AEOA 1M68A 3RJXA 4IISA 5C7HA 4LFYA 3FS2A 2VRKA 2R14A 1MXSA 3ALGA 4XVEA 3H53A 4A35A 2F9RA 1EC9A 5FAGA 4GXMA 3RX4A 4W8LA 3MSGA 4O4VA 1J0KA 3RXZA 2V6AA 2P50A 5AFDA 3HM7A 4O18A 3AYSA 3WBAA 1WZKA 4B9YA 1AD4A 3SRKA 1IE7C 1XRTA 3W74A 4HU3A 2EG7A 2J75A 3RO6A 3E12A 1JYNA 3S1WA 3M6YA 5HQLA 3W24A 5BOOA 3WN6A 2VX7A 5TF0A 1TV7A 1VEMA 3IJ6A 1PYFA 3A4AA 3BXWA 2PGFA 1PZ2A 3DXIA 2CETA 5CH9A 1Q6OA 3WNPA 2ZA1A 4MADA 4US6A 3AIQA 1JRBA 1JR1A 3GVWA 3AXXA 1CTNA 1F8IA 3WMCA 1XLIA 5A8OA 5K9DA 3MI6A 1UB3A 3R2GA 1LROA 3BC9A 4PULA 4DWSA 7TAAA 4LUSA 4QE5A 4AQLA 4NZ5A 4GA8A 1JF5A 1OFOA 3MZ2A 1KBIA 1FKXA 4L4PA 4GACA 4WOQA 1GWJA 6REQB 4X0NA 3N17A 4UFMA 1LOSA 3ARQA 1J96A 4R3UA 3A4WA 3KOXA 3A12A 1FWFC 8XIMA 3MV01 3AXIA 2FZNA 5DXXA 2HV5A 2PAJA 4ZSUA 3TR9A 3KDOA 1BGAA 4M82A 2WM0A 2ZRZA 2ZADA 1WBJA 1OT2A 1FWDC 3KBMA 3P0XA 4JFTA 3MUAA 3WLMA 5D37A 2VVSA 3V7PA 1KWGA 2OSXA 2NV1A 4NKCA 2B0MA 4XSLA 1QU4A 3L2IA 5FI8A 1PEZA 4ZZ9A 2V82A 4M1BA 1TR9A 3W73A 3UP8A 4XAFA 2PFHA 3F2BA 4JTCA 3ITGA 2OZ8A 2PLCA 1KNWA 1LORA 2O55A 1LQ2A 2NSXA 1SU5A 1ZP4A 2TSYA 3UZXA 1UH2A 3LM3A 3TQKA 3BOLA 2WCAA 1K8ZA 3IGUA 4IIHA 3QOKA 1RR2A 3CMFA 3GO2A 4IQLA 3QW4B 3BLKA 4PYSA 1VBJA 2OTDA 2PDMA 3VC6A 1GG0A 1I9CB 1P48A 3AICA 4LSBA 3INPA 2XISA 4DXVA 3RK8A 1UKOA 4BR1A 3CB3A 1VQTA 4MDPA 4PC8A 3C2YA 3WLJA 2ZXQA 2BASA 4JTDA 1K1DA 4URIA 2FPTA 4YNGA 3VOIA 3U48A 5C7VA 2HVMA 3LGEA 5D2XA 1I2NA 1HZYA 2QZRA 3BUVA 5CSYA 3H70A 3E2SA 2PDFA 3FW6A 4IIEA 2ZZ5A 1FHLA 3VUSA 1JPIA 1WAWA 3MCMA 1UUQA 3G3DA 2ZWYA 5F7UA 4XZBA 3PZUA 3PF3A 4JL1A 1J2BA 1WXZA 2QYGA 2F7FA 4XUYA 3KP1A 2VRJA 1H0GA 4Y9MA 1R2SA 1ISWA 1GVRA 1VCFA 3OLDA 4RE3A 1E4NA 2X16A 3RILA 2DZWA 4JKKA 1GUVA 3QV8A 3NQ8A 1MVYA 2A7RA 5AHMA 3VA8A 3W7GA 5FACA 4OUIA 1HIZA 2CLKA 4M80A 3VGHA 1K8YA 5G4WA 3TW7A 3UGVA 3WF2A 1QW9A 1YADA 2X0HA 4LALA 3XINA 3UF9A 4OFCA 5KTLA 2QUVA 3S9YA 2MANA 1TV8A 1WA3A 1M7JA 2ZUSA 3W87A 1EJSC 4CNTA 3I7RA 3LMYA 5C6MA 3GAYA 4MYAA 3LHTA 4IFKA 1B1YA 4OJYA 2O9TA 2HSAA 2ZUNA 3ONBA 2AOSA 5I5RA 5CPTA 5I23A 4PUWA 1C8XA 3GD6A 4QEHA 3T44A 3W2LA 2ZDRA 1Q6RA 1P7TB 2QCDA 1QOXA 4GQBA 1E9YB 1N8IA 2GQ8A 4I8YA 1JDDA 2NXGA 3AIUA 2AKZA 3GDLA 4GH3A 1HP5A 3SM0A 4L4OA 1NEYA 1S5MA 3WD2A 2XVLA 2W4XA 2UY3A 1NWRA 4U33A 4FX7A 3GIQA 3WUFA 3AALA 4MKVA 3PN8A 3CQ0A 3LPGA 2J8GA 3IK4A 1IGWA 1KGXA 1QAPA 3LBCA 3ZM8A 1PX8A 4JD4A 2I5QA 1EJUC 5LNSA 2V3EA 1EA9C 3C4UA 2Z1BA 2YCIX 4QCEA 3PBYA 1KCKA 1EFZA 2Y7FA 1A5SA 2ZZ4A 4TVCA 1FOBA 1IT7A 1E4LA 1Y5WA 5HNNA 1LUCA 2ZTKA 5AHIA 2B4GA 1K8CA 4TTGA 4GNKB 1NH6A 2YSWA 3GKAA 3PUEA 3UR5A 4IJCA 4NAFB 2ZFAA 4K6AA 2WXDM 4IPPA 3S9IA 4O8AA 4GUHA 5CAKA 2V5CA 4LRSA 2WBKA 4Y6GA 1D9EA 4B3ZA 3ZVHB 1CZ1A 2Y5JA 2P76A 2VMFA 4PMUA 1KRMA 4OQVA 4LAKA 1S5TA 3VPLA 4A4AA 3TFXA 2ESCA 3BG9A 4E4FA 4Q7BA 1UWTA 2V2DA 5FJOA 3ID7A 4RNIA 2VFFA 2WO5A 5HULA 3N73A 3W84A 2GGGA 2A6NA 3IACA 3KHDA 4W88A 1TFVA 4HU8A 1X1OA 1RH9A 1OZMA 4R33A 2P5NA 4WJEA 3VCNA 4M6QA 1BSIA 1QI4A 4MUZA 4BHYA 2Z1KA 4UFIA 4UBPC 3F5LA 4O10A 3WF3A 1UYQA 3IK2A 4ACZA 2VQUA 3VDGA 4IMAA 1DYSA 3NQ2A 1VKFA 3MTWA 4V15A 1Y5XA 4REQA 1VBUA 1LWHA 4WJ8A 1OFEA 3E2QA 3WZ0E 5E93A 1OB0A 2Y1HA 1R30A 3W7MA 1PYMA 3NJ3A 1P6BA 5G4HC 3GK0A 1XRSA 2ZZ6A 4RNFA 4GZIA 5BCAA 3AO0A 1W5NA 3OGVA 2XG9A 2VENA 3NZGA 3ZR4A 1W9DM 3TU9A 3VOGA 1XF0A 4ATWA 1EO7A 2ACRA 3CV2A 5HBFA 4S23A 1IHIA 2DVUA 4B5UA 1V3JA 3NQCA 3TDFA 3S4TA 2VR5A 3W7JA 3BW3A 1ZGDA 1IXPA 2ZZ2A 4ZXLA 1MEHA 3R10A 1KFCA 1QI0A 1QOQA 4L7ZA 2XINA 3G6LA 3RAOA 1XRVA 3RPTA 2IKHA 3U0HA 2Q3RA 1Y0EA 1GYLA 3M0LA 2WMFA 2YA0A 2ZQ0A 1JPDX 2XFWA 1FDJA 4JFWA 3D3AA 3A3HA 3T2QA 2L5HA 5E0KA 5KZEA 1W1A1 5LA2A 4AAJA 2YBVA 5DMNA 3DFSA 4BY3A 2WV8A 3NPVA 5JIWA 2FHCA 1EYWA 3FEQA 4UOZA 5FF7A 2VUNA 3URNA 2QDGA 1D8WA 1FWRA 1A47A 5CC6A 1C3FA 3EDKA 5EL1A 5JMUA 3F4DA 1WOBA 4M8UA 1GPWA 1L6FA 3GQYA 4AD5A 2A3EA 4PFMA 1O68A 5K4XA 1M9HA 3OHMB 5EB8A 3NQEA 1M6JA 3VNJA 4IOTA 3BJTA 5JUVA 3TFCA 1E5NA 3KBWA 3AMLA 4QAIA 2YDRA 2P0OA 2VZSA 4PODA 1JNEA 4ASTA 4NXKA 3NA8A 2V9DA 3GXNA 3L0NA 2JKEA 3SUVA 4F2BA 3I3BA 2I9EA 3C6CA 4S3BA 1VYSX 3SGGA 3AUJA 3CAWA 3SJNA 3CZJA 4UTLA 1TV2A 4B5NA 4J3TA 3B0YA 4J3ZA 2X1IA 4RW3A 1DWIM 4S3AA 4JFUA 4P7QA 3B4UA 1ZALA 3H8AA 3MMDA 1MDRA 4AEFA 3WD4A 3VDBA 1Y8BA 3E6EA 1B3WA 3PB0A 4GUFA 4GVHA 3GHTA 1AH3A 5LYRA 3R94A 2PRLA 3CH9A 1XFBA 2W0UA 1G69A 3GC2A 2YYTA 3QZAA 3QPZA 3TQPA 1JVNA 4N4PA 2ZIDA 1SSGA 3V35A 1FWTA 4F66A 4JHMA 2LLEA 3W83A 2REQA 2XSXA 2FDSA 1OF8A 1K9TA 2GSHA 1JI1A 3RJYA 3APYA 3ANUA 3R0UA 1JZ3A 1GOMA 2Q8ZA 4H7VA 2FMOA 2E8ZA 1X96A 4TMBA 4M5PA 1CECA 2WHKA 5FAJA 2WZMA 4WY0F 2ISSA 5U7SA 2UV8G 3NGJA 1TB3A 1R7AA 5F4SA 4NQ1A 4L9XA 3C8FA 2A79A 2PMQA 5JBEA 3W1PA 3H4GA 1T8QA 4HCLA 4AX7A 1Z9AA 4AXKA 1U5HA 2OPJA 1ZP3A 1B3YA 3I3EA 4ZE4A 2CKRA 1SW0A 3EA3A 3KRSA 1SMDA 3M7SA 4W8BA 3IAPA 3LTPA 4MDOA 2Y88A 2V0TA 3KUMA 4G7FA 4L61A 4P8XA 4PUNA 3MUZ1 3W1UA 5AC7A 1S38A 5FEPA 3WFZA 3MP4A 2DIKA 1RP8A 3B06A 1EXPA 4WGXA 3WQOA 1XYFA 3AU2A 1UPMB 3WLNA 1TKKA 5D03A 1NIUA 1MXDA 1ZJHA 1S5VA 2FPVA 4TV5A 3JU2A 2ZTJA 3ERPA 2DQWA 3H7RA 1JFHA 5KZDA 3R5EA 5CPMA 4D6IA 3HZ3A 1DWGM 2PWGA 4NJGA 1VIZA 2QT3A 4CNNA 1AQ0A 4D6JA 5AHNA 1ZLPA 3UESA 3CMJA 4GBDA 3BJSA 5C9ZA 4XK2A 5LIKX 5HJXA 1UWQA 3UJFA 3UFYA 4MJ4A 1JYVA 5D9PA 2IPGA 4IG2A 2JIEA 2CW6A 2KAUC 5AN7A 4KQNA 2G41A 4G9PA 3AIWA 3LGDA 1J6OA 4US5A 3EGJA 2EPMX 2HWGA 5EMMA 3CTLA 3IIVA 1UC5A 1RJQA 1LL7A 4G6CA 3OIHA 1GQNA 4LUTB 2XVPA 1F07A 3FNDA 3MZNA 1BYBA 3EOLA 5EMUA 1OIFA 1FWEC 3BAWA 4YHEA 1SPQA 1D7KA 4K2SA 2EPOA 1XP3A 2GJNA 1ZCCA 3VNDA 4LXFA 1Q6EA 3AIVA 2YLAA 1E1CA 2HPIA 2YR1A 4W86A 1OX6A 2P10A 3B8IA 3CT2A 4LBRA 1OD0A 3WQ5A 5FF4A 1R87A 3MUY1 2ZDSA 4PEEA 3OHIA 3SQMA 1XIMA 3W71A 1I75A 4NHVA 2VC5A 4PTNA 3OU8A 4LT9A 2G37A 3WQ4A 1KM2A 3TA9A 1AJ2A 3RRAA 2W6RA 4F0RA 2GK1B 3LSBA 1XDLA 4KFOA 3OIXA 2FVMA 1M7XA 4FSAA 3QGVA 2Z27A 1FCVA 2D0GA 6REQA 4PEKA 4HSHA 1LT7A 5AZ1A 1FKWA 1VIWA 2JALA 4NZ4A 1FTXA 1W5OA 1G7VA 3ARPA 1V6WA 1GVQA 4Q8TA 3LG3A 2OGYA 3M0HA 4QQ3A 4PL1A 1BYDA 5HK4A 2H9AA 2ICSA 4FS9A 2P8BA 3BVJA 2HE5A 1TMLA 4MWAD 4MYXA 5GJMA 2J77A 4C7DA 4Z0SA 4A8IA 1RK6A 2QCGA 4JN6A 1GEHA 3RFAA 3EKGA 2OLSA 1TMQA 3N15A 4HZ7A 2WMIA 4PMOA 3DBNA 4XD6A 5A2BA 3H12A 3TWBA 7REQB 3UZYA 3VIFA 4GI9A 1ZBWA 4UTTA 4GQRA 1EKOA 3CUXA 4DWSC 4CU7A 2WJDA 2GGEA 1HNYA 5JXQA 2ZRUA 5CZTA 2ZX8A 2XSBA 1V93A 2YX0A 4PSRA 1R86A 1G94A 3YPIA 3RNDA 1QHPA 1J0YA 3TVAA 3JVAA 2WC4A 3LBOA 4LAOA 2PU0A 3VNYA 1PHQA 3WQGA 2PDLA 2DVTA 1R2TA 3LB0A 3T78A 3PC0A 1JUKA 3KVLA 5E6ZA 1GOOA 3P5YA 2J7EA 3SN4A 3QV9A 2OT0A 3Q94A 4UTKA 1D3HA 1E40A 2OLHA 1GKRA 2Y7GA 2Z25A 4O50A 4ONVA 2VEGA 3TH6A 5HINA 3Q67A 3GTHA 4UB9A 3N4FA 3KCJA 3OG3A 3MT1A 4B91A 2QKFA 1CLXA 4WXZA 2NW0A 4L80A 4B92A 6TIMA 4LYQA 1VYRA 1CW2A 3GR7A 4CCZA 2GL5A 3NYZA 5L9FA 3ARSA 5FD0A 1SUXA 2VELA 5D8WA 3THAA 5M2FX 4HHPA 1T8XA 3SBFA 1YPIA 4K7VA 4KWVA 1XBZA 5LIYX 1MQQA 4JFSA 2CBVA 1CGUA 5I00A 1J0ZA 4XSMA 3T09A 1CGVA 1OHLA 1ZQ5A 1U1JA 3CV7A 3STPA 3R8GA 2GUUA 1FXQA 1LWIA 3EMQA 3N2CA 3SUUA 2CLOA 1E55A 1TPDA 4K68A 1V0NA 1XIBA 4WQ6A 4LY4A 2H90A 1RV8A 4L9YA 4R7OA 4U2ZA 2A3BA 4YL2A 1K6AA 1JCMP 3BV7A 1FWWA 4XBJA 1QXLA 2ZA2A 4BA0A 3P62A 3WH5A 4J3VA 3USBA 4H9MA 1LLOA 1NTHA 3WK3A 3W9ZA 3UWVA 1QCWA 3G1FA 4DJDD 1UZ4A 4O28A 1O6IA 1ISXA 2OR2A 1UKTA 3BW4A 5LNWA 1FWHC 1DE6A 4U31A 3R11A 4HMEA 2YB1A 4D6DA 5EBAA 2VFHA 3WYZA 3W53A 4TX8A 4XD5A 8CGTA 2AL1A 3UYCA 4IGNA 1FBAA 4ZB2A 4O1DA 4AY7A 5C8BB 4TTUA 3IARA 3W38A 4FXRA 1J12A 1EGMA 3MYOA 4R5EA 1TWWA 3UR8A 2J7FA 5ABFA 4G2DA 2QCHA 4PMVA 5ABTA 1TTIA 4HKPA 2PWHA 4UMBA 5F2GA 2E5CA 3WD0A 3HJZA 1V79A 3LD5A 3LCFA 1D7FA 1HTIA 4DB7A 3CB8A 5A69A 4O4WA 4MY8A 1BSLA 1AW1A 1PHWA 1D3CA 3B8DA 1EIBA 7A3HA 5CBJA 4PMZA 1PWMA 1U5JA 1PDZA 4W84A 2CLIA 3IUHA 4QS6A 1HKWA 3W22A 4O17A 1EXBA 1SYTA 3ZLHA 1DJGA 4X22A 5TQLA 1E6NA 4CNOA 3KL5A 1TV5A 2J88A 4I9JA 3WNNA 4AYSA 1PKLA 3ES7A 3HFYA 3HMCA 4AZBA 3L4UA 3W7PA 2FKPA 4JTUA 4KEZA 1G4TA 3SURA 3E0IA 1XLLA 4NAFA 3KTSA 3V0UA 3DKLA 5GVJA 1A5OC 3PBWA 1VLWA 3C3UA 3M1ZA 1IEWA 4M6VA 4HOWA 1UOKA 4EXQA 3QJAA 1A5BA 3ZVHA 1LLWA 1CB2A 5JBDA 3CO4A 3Q45A 3HQPA 3VKKA 1CPUA 1TMHA 4I5XA 2PCQA 2EJAA 5M03A 2OX4A 4KRZA 4DJED 2YZ5A 2X8RA 3NYDA 4ERIA 3ANVA 4XVDA 1ITXA 1DJZA 5D30A 3LHVA 3ABZA 3N34A 4RE0A 3ZWTA 3AS2A 2G5WA 3VNIA 3R89A 3FX4A 3IRDA 3BCJA 2EG8A 2QF7A 4DN1A 1W54A 1ADDA 2HS8A 1OYAA 5D38A 2GWNA 1SJAA 4IIFA 3SCOA 5M3WA 1NFGA 2J47A 2Y2WA 3GXMA 3APTA 1EDGA 4X9YA 4JOMA 4DAIA 4ZQPA 2A2IA 4O0KA 3WK2A 5LNVA 1CYGA 4R34A 1TE1A 3LV6A 4N9CA 4MY1A 4IT1A 4JCMA 2FTPA 4GRSA 2Z4GA 3IANA 2P3ZA 1C8YA 3N6QA 3I7QA 3FN9A 4J7RA 1QTWA 1OFAA 3TTEA 3KCOA 4DYKA 2QGHA 4WD0A 4HPNA 3TTQA 4DX3A 3ZQ9A 1O5RA 3N18A 3F4WA 5H8MA 3EAUA 1DJXA 1WZMA 3MKCA 1LOLA 3CASA 4QLJA 1TRIA 1X8FA 3VNZA 2E77A 4V2XA 3OP2A 3P6LA 2CU0A 1ADSA 1UR8A 2GVJA 4MPQA 1HN1A 2WJZA 3UWWA 3L4ZA 2OODA 4H8UA 1VYPX 3DH7A 3MCOA 4YLWA 4C6PA 5GQBA 4S1FA 4UR9A 1JCTA 4H9YA 2HK1A 2V2HA 5E9AA 2VT0A 4KWUA 4GH1A 4U3AA 1PAMA 2XWEA 1H60A 4JQAA 2NVAA 3BAJA 4OUEA 3PZ9A 4X0VA 3WJWA 3AHZA 1H61A 1V4YA 5K2ZA 1UW9A 2BY0A 2FGLA 3LQGA 3SQSA 2WQPA 4JN8A 3G0UA 1NJJA 3LZ3A 4QNWA 1UBSA 2PE4A 3EXSA 2BNJA 3IJ8A 3N14A 4QRNA 3VD4A 4YTUA 1T40A 1OYBA 3NL2A 4DUVA 4LYKA 5AC5A 1SZEA 4HPGA 3VD3A 4C91A 4AC7C 1QNVA 1CLVA 1ONXA 2X0SA 4E5TA 4DNHA 2QUTA 4AISA 1SQ7A 3BAIA 3CS2A 4ZQMA 1ZHAA 4Q33A 4ENLA 2OLAA 4NYYA 1WKEA 3N2XA 4WZHA 1ME7A 2OZ3A 4M7TA 2AAMA 3NPWA 1GJPA 3A9BA 3QGKC 4D72A 2DIJA 1DP0A 1VENA 3CGTA 2EXOA 1ZNNA 2DVXA 2OO0A 1H7WA 4ZQOA 5A6BA 3THQA 3IV3A 1GW9A 3UY7A 3LTYA 3EMCA 4BQ5A 1RBLA 1EF3A 1SGJA 4XBKA 1C7TA 3CM4A 4LVGA 3KZSA 5G1YA 1ZSXA 2VTFA 4BI7A 3MU7A 4EVZA 4HP5A 1TVNA 2XIQA 3KLLA 3GC4A 4IQJA 2VCCA 1CDGA 4HHHA 3WBXA 3PZTA 2Z2UA 3COTA 3W75A 3RITA 2INFA 1B2YA 3LEPA 3VKAA 3URQA 1PS9A 2DFAA 2HNHA 3R8RA 2XGZA 3KRZA 1LG2A 3T55A 1KXVA 4NYUA 4AVFA 2PRMA 1LP6A 3AS0A 4AD2A 1W9UA 5I3HA 2J8TA 2PDPA 3M5VA 4IQDA 4DIAA 4GBUA 4MNMA 1NF7A 3OODA 5J5DA 4L6OA 1H51A 3ZJ8A 1SFJA 4Q4MA 3EWXA 2I16A 1RJPA 3H2CA 2Q01A 4H41A 3S5OA 2D2JA 5KEZA 1OGSA 4K37A 1SFLA 4WK9A 3AS3A 5IRPA 1EX1A 3EDEA 1AODA 3I3DA 1UZHA 3HBLA 5AECA 3OLIA 4UUIA 3GE7A 1HGWA 2EKGA 4KEVA 2VX6A 2Z26A 3G1YA 3VGGA 1YTEA 3HF3A 5FJRA 3VYLA 3TXZA 3HJEA 1EWDA 1EUAA 3GU9A 1KV5A 4OBTA 5HA7A 2E67A 3SIZA 3PWIA 3CH0A 3GDMA 2GGJA 2VUYA 4JTJA 3NO1A 2G3NA 2Z6JA 3SAZA 2PCEA 4FF7A 2FMNA 4W9TA 1I2PA 1JXKA 1A3HA 1GJWA 2VGBA 1ENUA 4CN1A 2CBIA 4OIFA 1AH4A 4DZAA 5LGXA 2Y7EA 2WC3A 1MUCA 3RM4A 6PTDA 3KRUA 3USZA 2VP8A 2IKGA 4PMDA 3SRFA 3BLDA 3L5LA 4JGDA 3DHFA 1RA5A 4Q32A 1CWYA 1XLAA 3A24A 2D3LA 1MMFA 1KO0A 2Y8KA 3ZR6A 2A7PA 1H1NA 9CGTA 3Q4DA 1TJRA 4O1CA 1ZJIA 4Z2IA 4O15A 1JRCA 3ZR5A 1XIJA 3GU2A 2VCAA 4FNTA 5AKQA 3QMTA 3TAKA 2WB5A 3ARXA 1IIHA 4F3HA 1C29A 2HJPA 4IXHA 4YTSA 4HNTA 3DI0A 3HMJG 2ZKMX 4ZODA 3BLLA 4LVBA 3P82A 4R27A 5K9CA 3N2BA 3KE0A 2QPXA 3A22A 4AEEA 1KM5A 1QMLA 1FH9A 4LAZA 1KR0A 5CPSA 1SZFA 2OCZA 3TTYA 2Z00A 5T9CE 2FB3A 4PCSA 1RD5A 2J9YA 4QEEA 3U8GA 4PBGA 4WRHA 5DT7A 4IJRA 4BCEA 1TPWA 1UA7A 2QCCA 4YVXA 5CAHA 2VHLA 4PRWA 5CPOA 4AVNA 5LA1A 1F8MA 3URAA 2XZ9A 2C7FA 4H01A 1QO5A 1NY1A 4GNJA 4MLRA 3VIPA 3WDRA 1WDWA 4OVXA 2IUZA 4QXIA 3K1DA 3GG1A 3OZMA 1EB3A 5CLTA 1R38A 5D04C 2UY2A 1BXBA 3S42A 3NO3A 1KFWA 3LHUA 3IVUA 1AA1B 1KRBC 3ELFA 1UC4A 5H91A 2J66A 3J7HA 1GORA 1H09A 5F1VA 2V5BA 3NEVA 4OT7A 3KS5A 5HAOA 3NZPA 3MYPA 3PG8A 1XS2A 3IJLA 2J9ZA 1XCWA 3EEGA 3S1UA 3APGA 2E9MA 1WDDA 1VFOA 3C0SA 1WV2A 3QC3A 5BROA 3W7HA 4W5ZA 2QHAA 3B97A 3U4FA 1S1RA 3W7QA 3EX6A 1UH3A 2VYOA 3BURA 1JGMA 2DZXA 4DEFA 1EJWC 4MVAA 4JPGA 3CZGA 4GXPA 1C8QA 3WFAA 3NL6A 1VRXA 3SR7A 1G6CA 4GUJA 3BZJA 4CEXC 5C9WA 1Z6KA 1PPIA 3GBEA 2O9RA 5I07A 1MO0A 1RP9A 1K4GA 4K39A 1FWIC 4JNYA 1VRDA 2W66A 4R7JA 4JAWA 3MVIA 3P3BA 1JI2A 3CWHA 3RPMA 2I7GA 2MUCA 2ANUA 4N4QA 3FVDA 1MUWA 4YVPA 4M7SA 1XGEA 3C2RA 4GUGA 1KRCC 3P2VA 3H4WA 3K8KA 1CX9A 1J79A 1XJBA 4Z1YA 2VDHA 5KSWA 1LRTA 4OBRA 2E6AA 1EUNA 4AHQA 4DF2A 1SZNA 1C9DA 1RQEA 1VPYA 3DG7A 1ALDA 4WF7A 3ABSA 3CMGA 2J7GA 1ECQA 3FKRA 2C6QA 4UTTC 3W3OA 1KWKA 1U30A 4I7WA 1YXCA 5BW6A 4LJ3A 1XDJA 1E3ZA 5I3GA 3UZZA 1UJQA 3BW2A 4HYRA 4PUMA 1AG1O 2J62A 4R7WA 4S3FA 2PZNA 1PCKA 3LN3A 1K70A 1UWAA 3L5AA 2R1NA 4IJBA 2WMHA 2XUCA 3NQBA 3AXKA 2QAPA 1CLKA 1TE6A 4FX6M 1E6QM 4EF9A 4AD4A 7ODCA 4X2PA 4AZ7A 1W5MA 5CGMA 4UTWC 1QBAA 3LA4A 3TNBA 1X98A 5EU9A 1SMAA 4DUOA 3T81A 1R3RA 2V30A 3WO8A 1OGGA 2FZMA 4NNCA 3PTKA 3TLQA 1PZ3A 2QCFA 4W5UA 4GYFA 1BTMA 4RKAA 4XO6A 3DGRA 4H6KA 4K8GA 1KFJA 4AZCB 4UFJA 3GIPA 2CCRA 3LRLA 1XYCA 4YYFA 3VM7A 3AAMA 3BL3A 3AMGA 3UCQA 3RU6A 3R6IA 4UQDA 3SY1A 4NJHA 4ZB0A 3TP4A 4Z0JA 1J4EA 1V3MA 4M81A 3SCUA 2GFTA 4CVUA 4C6JA 1I8JA 1KTCA 1R9YA 1XHGA 4RUBA 3W1XA 2BHZA 4HK5A 4IGMA 4Q22A 4JKLA 2J8FA 2WNWA 1JDEA 4JEQA 1O94A 4GFSA 3KTCA 6XIAA 1F6PA 3A13A 1JPMA 2H3DA 3Q2DA 4GIYA 1Q6FA 4S3GA 3MKVA 3AHXA 3ZSTA 1VFTA 1LYXA 4E2DA 3QKZA 1TREA 3EA2A 4Y90A 1DV7A 2V5JA 4QITA 4FOKA 3CC1A 3NAVA 2WNQA 1Z8AA 3EB2A 1AW2A 2NUYA 3L4YA 1HJQA 1IGSA 4QHRA 3GYCA 4QISA 3L4XA 2TODA 2V38A 3BO9A 1SW7A 4LB3A 3WKZA 2DGAA 4MIMA 1AZ2A 5IFPA 3HGRA 1E1FA 2Y8VA 4JYFA 3QH2A 2E6YA 6A3HA 1YNQA 4HNNA 4AH7A 3W26A 3V5FA 3WL0A 1NP0A 3TEVA 5DQPA 5DX7A 4LUSB 4V1XA 1E15A 3DC8A 3B3DA 4XG1A 3F2DA 4IQEA 3DX5A 1Q65A 3R7MA 1EC7A 3MY9A 2E8YA 4J2MA 1MZRA 1W56A 6ENLA 4PE8A 1E9IA 1ICQA 5G2HA 1DIOA 5I7GA 3NDOA 2WVSA 3N13A 4XIAA 2QMKA 1VH7A 5FIPA 2WPBA 2QV5A 2BOFX 1IYXA 4GG9A 2OKOA 1MRAA 4A05A 3LQLA 1J11A 3KTXA 4GX8A 1X6LA 5DANA 3CUJA 1TX0A 4R9OA 5E6YA 2E9LA 1K7EA 5I3DA 2BFGA 1BG4A 2G97A 4GPNA 3PAJA 3W7RA 2NVCA 4A3QA 2XJ7A 1UROA 3BARA 1RAKA 5A8NA 2VFDA 3MI2A 4HD5A 1EOKA 5BWFA 2BY2A 3CYVA 4H19A 1DE5A 3EA1A 3W0KA 2I57A 1KM6A 3NQMA 2ISDA 2NXIA 4HIBA 3IJ7A 1POKA 4CU6A 4OZOA 2DDXA 1ME8A 3XIMA 3DU0A 3M44A 1AMYA 4LNYA 4KGJA 2R9RA 4F0LA 5IHRA 3TSMA 2J7HA 3NL5A 4GJ1A 4R88A 2FTWA 4YWSA 5HDRA 1OCBA 4EK7A 1GQLA 3QV6A 4NI8A 4WKFA 4UQAA 2GJXB 4C6IA 1YW1A 1RHCA 3ARZA 1F3TA 2DJXA 3VDHA 1I6NA 4BF9A 1BVWA 5KINA 4IIGA 5CSRA 1E0UA 4HPHA 3T07A 4M24A 3E02A 2O9PA 3H22A 4Z08A 2Y85A 1E6RA 1TIMA 4AFYA 3O2LA 4FALA 4AIOA 1G4SA 3WD3A 4YU1A 4PMQA 2WZIA 3L2MA 4UOJA 3SUTA 4CQDA 5D9NA 2X42A 3AMCA 2ZZ3A 1HJWA 3VX0A 5JQ9A 1TV3A 4JYEA 4JR5A 3QFWA 2VOTA 4ZTXA 4F9DA 2CIPA 4HU4A 4KT2A 1ISVA 3ZT6A 1HKJA 1F9CA 4OTKA 1WDQA 4L64A 1SFTA 3T8LA 2P8CA 4E8GA 4GI8A 3OZPA 4I7UA 3GH4A 3DI1A 3T9PA 1O1HA 5E0FA 2O9OA 1YYAA 4TMCA 1P6WA 2QCLA 1R46A 1AVAA 1GYMA 5JIPA 1ZZMA 2GWGA 5F2MA 4DZ5A 1V08A 1PL9A 1TWIA 3W1LA 3ARVA 2OB3A 1LQ0A 3GXDA 4IFKB 2WM1A 1E56A 2JFEX 2J7CA 4XAYA 3VX1A 1HG3A 3EOUA 3UG5A 4BS0A 3B9OA 1ESWA 1XYMA 3FV9A 3C2OA 1JYWA 4JNMA 4YPJA 4S3EA 4L65A 4ML9A 3UW6A 3PTDA 1BLIA 4TOQA 3N25A 3MVTA 1T6MA 2A5HA 5A8GA 4NZ1A 1DEDA 2XH2A 1XH1A 5D9OA 3G77A 5CZ0A 3U2ZA 3QOMA 4YVVA 3BLIA 3LSCA 3C0LA 3D5HA 5IHSA 4AU0A 4PMJA 5E0CA 4YHGA 3L21A 4ILSA 3PP7A 2YW3A 2R1MA 1KXQA 4H7ZA 3UZ5A 1ZJBA 3DFYA 3NZQA 2XIJA 1UD2A 2E1DA 2I5GA 4HK7A 2VEMA 2PDQA 4UCFA 2GQAA 3EXTA 4HOXA 3WQWA 4C7FA 4IL2A 1XLHA 2DEPA 3ABOA 4I7VA 4O0ZA 4XB3A 1BHGA 2HS6A 2PD9A 4CD7A 2JKAA 4EPDC 4UNLA 4AG0A 1XKYA 3W70A 1KW1A 1QPQA 4ZE5A 2G3FA 2WOQA 2ASHA 2CLEA 1LUCB 5GNXA 3AZTA 5DRIA 4NU7A 1H2JA 2EG6A 2VC9A 1E4MM 3U2CA 3WMLA 5T9BG 1BEUA 1OCQA 1QBBA 4GMEA 3S6OA 2PTWA 2G0WA 1Q8AA 3GVVA 2R24A 4PTVA 1X39A 3TQVA 3QLDA 1S46A 4LS2A 1W8SA 5DCBA 3QQ0A 1EPVA 2A85A 3IJ9A 4FXJA 4O52A 3T0DA 4N9BA 5AC6A 3GW0A 3CV1A 3IJDA 2RAGA 5JU6A 3AWOA 4FXSA 1GVOA 2J79A 1W1YA 4LCSA 2FJUB 3PPFA 5CEWA 1DQXA 4OU1A 2GZXA 4H2CA 3NQ7A 2IXVA 1XGZA 3THCA 1NU5A 4KFNA 4WOZA 4S3DA 3ZFHA 2GSJA 1OGBA 4A3RA 1XLKA 3C52A 4DM1A 1H50A 3SW6A 4AMCA 2D3NA 2PD5A 4MWAA 2D2HA 1F4AA 1XBXA 3CHDA 4FNUA 3WF0A 4PMRA 2ISFA 3UETA 1SVDA 3B9DA 1WYIA 1TVPA 4JX4A 2AQOA 3TTSA 3G5EA 3KOFA 4JTRA 4D6EA 5HMFA 3LCHA 4REQB 3SY8A 1Y65A 4U10A 3Q65A 1YPXA 4NJIA 4M6PA 1W3HA 4DWSD 4O1FA 1E9LA 2PDCA 1H5VA 1EJ7L 3V18A 1B0IA 2PZ0A 1DJHA 2Z7GA 1QNSA 1VZWA 1XDMA 2OXNA 1W3TA 4HMNA 2CPUA 1SZRA 3GFYA 1ELSA 2JK2A 1RQHA 1IEIA 5C0QA 2DZBA 1ODUA 4DO5A 2GUBA 2VWSA 5LXEA 3VE9A 1NDWA 1EQCA 3BDKA 4Z2GA 1A3WA 4BWLA 1S2UA 1AW5A 3F7JA 1OG6A 3UG4A 2WVUA 3VDCA 2OYMA 4J3UA 1EZWA 4O16A 2WBGA 1N55A 1KA9F 1CGWA 4N6FA 4PA8A 1EDQA 3W2KA 3TYCA 2QGYA 5DELA 5AC8A 4LF1A 5BWAA 4Q8NA 2NWSA 3IIPA 3OZYA 1GKPA 5GNYA 2PLMA 3ARRA 1HO4A 1QDSA 3TN4A 3S2NA 2X0YA 1S3HA 3I6EA 3UBPC 4AY1A 2ZXDA 2XM2A 2NQHA 3H2EA 5CXPA 4KF1A 3ZLFA 4I3GA 4GJIA 1V3LA 8A3HA 2HMCA 2DZVA 1P6CA 4HMCA 2OWWA 1TZ7A 2ZA3A 5BXPA 3THUA 1TCDA 4UTHA 1JZ5A 1EP1A 4IGHA 2ZUTA 1V8EA 3IJIA 4HSNA 3RCMA 4ATDA 3PULA 1K6WA 4U2YA 1U33A 2CBUA 1SO5A 4YMZA 4ZVJA 4HT3A 4B15A 3G22A 1VR6A 2AGKA 4RNHA 2C8NA 4ZQNA 3WK0A 1KBKA 2ZXBA 2WSYA 3E0WA 3F5KA 5C9XA 3AISA 1QJWA 2XYLA 1REQA 2D2GA 3IIOA 2YXOA 4Y7EA 3A5VA 1W37A 2X40A 2ZC8A 1ZUAX 5BU6A 2WJFA 3TXVA 3V0TA 1GTHA 5A3HA 2XVKA 4GX9A 4HNOA 2I1OA 3GVRA 4FIRA 2B7OA 2XSAA 2QPUA 1TSIA 4NILA 4WX2A 3ZMRA 1TG7A 1KBLA 5AB3A 4IMDA 3HO8A 5HUPA 4W8AA 4RDYA 4M1RA 2REQB 1QNRA 4LH8A 2G3JA 5EMKA 5BZAA 1IWPA 3IGHX 1V02A 5CG7A 4BQ2A 3W28A 2POTA 4L6DA 4ACYA 2G3MA 9XIMA 2NQJA 1H5YA 4UFLA 1MEIA 1A4LA 2YZRA 3AHVA 1OIMA 2C0AA 1HJSA 1O12A 4RZBA 1NP2A 3H2FA 4IF2A 2C13A 2QJIA 1TX2A 4GIEA 2QNEA 1RCXB 2ALRA 3T4WA 1BG9A 5A8QA 1V3KA 2G96A 3HG2A 4NZCA 1Q6CA 4GHRA 4JFVA 2VNCA 4KRTA 1HX0A 4PCNA 3C2FA 3WUGA 3CBWA 4GCXA 3MUIA 1Z44A 2GJPA 1A4MA 2OELA 1L6YA 4FK9A 5PTDA 3DC0A 4RZ5A 1LL6A 1KFBA 4XZMX 3KWXA 3VFCA 1A80A 5FA5A 4ZFMA 4S2CA 1A5CA 2XIOA 1FDZA 4CD5A 3NG3A 1G9HA 3W1QA 1V77A 1GTEA 7TIMA 1CGYA 3C2VA 4UR8A 5D32A 5DRCA 4H9VA 4M56A 1H4PA 2PWVA 1QRQA 4V33A 2DW7A 1IXQA 4AZCA 1V7YA 3RLUA 3S9ZA 4UCGA 1HVQA 2X1RA 4C6FA 2J27A 3MDUA 2DH3A 5FF3A 1GJUA 4XWUA 3KFTA 4QIUA 4C6LA 3W85A 4J3XA 2DT2A 1RXOB 4AUBA 1A5LC 4RPPA 2BP1A 3AROA 3CHCA 2D0FA 3H24A 5DFAA 5C2XA 3A9IA 4IG2B 3P7YA 1GONA 4GY0A 4J40A 3WELA 1GG1A 1UCWA 3TK7A 2POZA 4DYEA 3QHNA 4CNSA 4IWWA 3ZT7A 3DIPA 5HNUA 4PMXA 4QG8A 3LLDA 1VBRA 5AYYA 1EHNA 3CPUA 2TPSA 3W6MA 6TAAA 3S6DA 4H83A 5IBXA 1QUMA 1GOKA 2VX5A 3G1HA 3MI3A 3HPAA 1XSKA 3PPCA 3B0UX 4MKNA 1UASA 3M41A 4UWMA 3WDJA 1E1CB 1QHOA 4Z2HA 1X7FA 5HPCA 1JPHA 3LM7A 3Q58A 5FCZA 5SWUA 1XX1A 1R9ZA 4KEUA 2GVLA 3QSRA 4Q4OA 4YCPA 4FI4A 9XIAA 4K8HA 4JBRA 1EGVA 5FJUA 4F0MA 1XQLA 1NARA 2WLYA 2HQAA 1YEYA 3W7KA 2I17A 3G6MA 2DZTA 4NX5A 2YL6A 1O5XA 4JHZA 3AFBA 2WZEA 3VINA 1B3XA 1GGOA 1XPGA 4R9XA 4AD0A 5DXYA 3T0AA 3N2TA 3QC0A 1XLBA 1E71M 3UA4A 3OO2A 5DLCA 2CLHA 4ZMGA 2CLFA 3FJNA 4KERA 2H9AB 1W5QA 2X09A 1MFUA 2Y6ZA 2D2OA 2J7BA 4UTFA 5EFDA 4FOJA 4NF7A 1IR1A 2PDBA 1JCNA 5T91A 3CZEA 1KQZA 2RGMA 3B8VA 1VC4A 2OZTA 4P7NA 1BFNA 3WJXA 4DHGA 1HO1A 3B8UA 5LHEA 4GQ0A 2XGBA 3O6DA 1UIOA 2VEFA 2WMIB 2UY4A 1J8VA 4H8NA 3RU8X 1NVMA 2DQXA 1OEPA 4BEUA 1O1ZA 2A3HA 3JZUA 4ES4A 4LCQA 1OJXA 1SFSA 4EWND 3NQAA 3MBFA 2CWXA 4WEVX 1PKNA 3CAKA 2NLIA 2JE8A 4ZOEA 4FIQA 2PTDA 1Q7QA 4QLKA 5K3VA 4M6UA 3L65A 1HL2A 3IEBA 4QG6A 3G2GA 3D6NA 2OEKA 1KFKA 2GDQA 3B0XA 4DPPA 1TJ1A 1VD6A 2F6UA 2XH4A 1W9PA 1HJUA 1PDYA 2GJXA 4EAYA 3AUOA 3NQGA 1HT6A 4TX6A 1XV8A 3BLPX 2DUZA 1W1TA 2X7VA 1H7NA 1HL8A 1GT8A 3EOOA 4E38A 5EMLA 1XXXA 3GIYA 3S2JA 3E5PA 3K8LA 4ERGA 3BOXA 4I9AA 3FYOA 4FLRA 4GUIA 3ZLGA 3W76A 3EZ4A 4EPKA 2CC0A 3HU7A 3L23A 1X6UA 1FY6A 1UMLA 1BGGA 1C93A 2FFCA 3CXOA 4J9JA 2V8ZA 1E5JA 4EF8A 4I90A 1IZCA 4NSBA 4PN2A 1A0EA 4E2BA 2EEXA 2V5KA 4PTXA 1W17A 1DJNA 1I2QA 4ZO7A 3IUDA 5I3KA 4H8VA 3TWAA 1TPEA 4GY1A 2F84A 4FR6A 3PZGA 3NQFA 3F03K 4LCRA 4BKNA 1Q4NX 3SGUA 2DW6A 1UUMA 5M5DA 3HPSA 1PE1A 4NJKA 1PZ0A 1K77A 5CJMA 1UHVA 3OLGA 4IICA 3RM9A 3QYQA 4WXYA 1XG3A 1W3NA 3VKBA 4WCJA 4S3JA 3N2OA 4O1AA 2PGEA 3FY1A 3W6YA 3UA3A 3QTPA 4MAZA 4LU0A 3OB8A 1YNPA 1J18A 1IWBA 3BPWA 2Y7DA 1Y5VA 2VDGA 1XLDA 1MW1A 3O05A 4AHOA 5LXXA 3C56A 3TZNA 5LGZA 2X05A 4B2DA 4AZ5A 4G1KA 4N2YA 5B80A 1GCYA 4EACA 5T26A 3VIKA 3G8RA 1WOAA 2VDIA 2XZ7A 4ZL1A 4ZQRA 4XZNX 1PIIA 1M7PA 1PB0A 3W6LA 2NX9A 3C5QA 2PSNA 4Q4SA 4HZ8A 4U3CA 2CITA 1ZJAA 1WXJA 3NVDA 1VAHA 1KM1A 4Q6XA 3AJ7A 2HXUA 4KIRA 3TQ0A 1MFVA 2PDKA 2ZICA 2AQWA 3BV4A 2ZUMA 1KLYA 5ABFB 2FHFA 3E9AA 2DV0A 3GVQA 3GH7A 1AZ1A 4ZXOA 4DBWA 3M0ZA 3QN3A 1PIGA 2H6RA 2ZRXA 4ZEPA 1K7XA 4E8CA 2Q8LA 3FXGA 3W7NA 4UXDA 4IZGA 1L2QA 1U1UA 1DWJM 4A3HA 4U5KA 3E1F1 5K4ZA 3WLTA 3GKFA 3KBJA 3UYIA 2XVGA 1JDCA 4QG9A 3N11A 1RVKA 2XTKA 1EEPA 3EWCA 3WMSA 1TPC1 1G4PA 2W27A 5FJTA 1S2AA 4HHMA 2YFNA 2DZSA 4OECA 3TCEA 3KBSA 3WJZA 4WUIA 1GYNA 2GGIA 4HPXA 1RK5A 3UNTA 2BLEA 4JTHA 2E3ZA 3KXQA 2R94A 4XZIA 1ZY9A 2OT1A 4KIEA 3VUPA 1DIKA 2DIEA 3NSXA 4KFPA 3TYAA 1F4HA 3DAQA 3T40A 4TVUA 3RPDA 3R58A 5FEWA 1Y7VA 3AYVA 1ODZA 3LOTA 2ZE0A 2CZVA 3F4VA 2YCLB 3BAYA 1NWTA 1Q6LA 1RLDA 2PDYA 5JH2A 2EJ1A 3HOJA 3DFNA 3SECA 4AMAA 4Q4KA 4Q8MA 4US5D 1TCMA 3G3MA 3CLWA 3FJLA 3WNOA 3DGBA 4GGBA 3BSGA 4H6RA 3VMOA 2ZX7A 1WP6A 2X7WA 4LEFA 2FIQA 2FTYA 3TSDA 3T6CA 3ZWSA 5D02A 2W5FA 3RYSA 4NZFA 4A2SA 1W1PA 2O56A 3VIIA 3G8EA 2QDHA 3RUBL 5T8GA 4HJWA 4D1JA 3R13A 5D2WA 4WIWA 3FVMA 1DJQA 4XD4A 1TPB1 3BGJA 3H55A 3LI0A 1EYEA 1OINA 1TELA 2QJHA 2OEMA 1NELA 5DY3A 3H7UA 1WDRA 3NPXA 2BVTA 3NVTA 3SCWA 1IEXA 4OGZA 3F5JA 3W7IA 1VHCA 3A5FA 4EPEC 3ZSSA 1AJZA 3UXIA 1H63A 5HMSA 1XC4A 3BANA 3WY1A 2OWCA 1R8LA 3ENLA 2HPMA 4JTGA 1G4EA 5HMDA 4NAEA 3RLGA 5CSSA 3V4BA 1ZAJA 2Q02A 1UR1A 3UZJA 1E43A 2OYKA 3R8HA 3RMEA 3RIKA 3T0BA 4GISA 3V75A 2NQ9A 1X7IA 2XH7A 3GNPA 3CZLA 3TIMA 3EMZA 4PCPA 1GVSA 1VFSA 2WMJA 1J0HA 1OX5A 1V6TA 3HPZA 1MI3A 3CUGA 1A50A 4CQAA 2VL4A 4E3VA 4AWSA 2HISA 3DYOA 4UTJA 4XD3A 5HR7A 4MZYA 3ITLA 3O16A 3AXMA 5FSDC 3V16A 1AMKA 1C91A 3W1NA 3M7WA 4CQBA 3EPNA 5KZ6A 3I7SA 4KBXA 1GHRA 3EKZA 2WNZA 3VIGA 3DHDA 1K3UA 1CXIA 2V69A 1JZ7A 4QR6A 3UT0A 1YDVA 5CBBA 1T41A 4KESA 2IKJA 3W1AA 2XWDA 4MF4A 4FMVA 3KVJA 1EP3A 1OF6A 4L9ZA 4JTKA 2CHNA 1US3A 1A5AA 2VM8A 2WZHA 3O6YX 4AZIA 3AYTA 4M19A 4WSKA 1MSSA 1RSCA 4GABA 1FH7A 2J4GA 4AYGA 1KR1A 3LERA 4JTFA 3QR0A 3L0GA 1ME9A 4BWLC 1S2WA 4HA3A 1XCXA 4WHBA 5I3IA 1SJDA 1ZS2A 3W29A 4UOQA 1NWUA 2V63A 2E09A 3QTGA 4UFHA 2I56A 2XH0A 4FNSA 1R3WA 1XIIA 4C6QA 3M5ZA 3ARWA 2YGYA 1T99A 1XICA 3GFZA 1HFBA 1XLEA 1OABA 1S39A 4ROQA 4C7GA 2E25A 1MXGA 1S5NA 1R7OA 2YB4A 1X1NA 3VCCA 5G4EA 3CIVA 3VZXA 4CQCA 1T7LA 3KL0A 1H0IA 4IIDA 1S2VA 6ALDA 3GDRA 1L2UA 3GW3A 4DJFA 3KAOA 4BF7A 3VU2A 4NI3A 4P8WA 4ROPA 3REQA 1I0DA 1A49A 2NT1A 3ITYA 1BWLA 1DTNA 4NNAA 2Z7KA 3WQDA 1KCLA 3MV11 3N6JA 3VK5A 3QGAC 5EA9A 2PUZA 1E6PA 3H2NA 4KMQA 2FFIA 3VILA 4LQ1A 5BRPA 2XIBA 1M7OA 7ENLA 3FHAA 3NQVA 3DKJA 3WL1A 1DXFA 4DBDA 4AIBA 1EQPA 2BWGA 1JJKA 4AWEA 3BWWA 4UFKA 2NQ5A 1OFRA 1OADA 1LRQA 3PJTA 4X9SA 1RLCL 1CNVA 5D4YA 3O15A 1GHSA 3UY8A 5I3JA 1PKMA 1LG1A 3BMVA 3BQ6A 1TZ9A 4CD6A 1JIBA 3R12A 3CAQA 3NOYA 1W8GA 2GPTA 4LVAA 4QSHA 2W92A 5HJYA 2ALDA 1QOPA 3E5BA 3GXPA 1EIXA 1BTCA 1JUEA 4ZFCA 2G4JA 3MMUA 3UJEA 4E8DA 3UXLA 2VR2A 3QBUA 3ISIX 1Q7MA 1VFUA 1KCXA 4WGHA 5FF2A 4K38A 3VC5A 3CUIA 2J9XA 1YMYA 3WEMA 3ZJ7A 1LZOA 3C2EA 3QPEA 3TMLA 1RBOB 1E72M 3FXYA 1TTQA 2PI6A 1TRDA 2AL2B 5HNTA 2VEKA 1B90A 1ISYA 3GAKA 1W6TA 3EBVA 4F40A 5CGTA 4ERAA 1MWOA 4Y9NA 2OOFA 5FSEC 2R1KA 4BQ4A 5HPOA 3D46A 4BZYA 4G56A 4HJFA 2PDHA 4LS0A 4C6CA 1TWSA 2CWNA 5A6TC 4A8RA 4UNKA 4V28A 4M3PA 1QPKA 3CUZA 4F9JA 4Q4RA 2F38A 2WSKA 2OU4A 1Z48A 2RH9A 2CKSA 3EB3A 4UTIA 3GR8A 1XG4A 3M9YA 3T0CA 4FHAA 2XN0A 4Z1DA 4KCVA 3MWAA 4E2VA 4TXEA 4PMYA 1KC7A 5IDIA 1J9YA 3CU2A 2J7DA 3L0KA 3BLEA 1CXLA 3KVMA 3AHYA 4JY9A 3W86A 4QQUA 3PJXA 4PUJA 4QBXA 4IPIA 4DAFA 4D71A 2CHRA 2FLIA 1EF2A 3RX2A 3WSUA 1SJBA 3G1DA 3N29A 4KCWA 3EPMA 2OSWA 4N6EA 4BFAA 2A3AA 3BQ5A 4AVOA 1AUSL 4EP8C 1E1EA 3ITCA 4B5TA 3EB4A 3CYJA 1BYAA 3TYBA 1DL3A 4ZCWA 1UOZA 1CCWB 1W3IA 2X2YA 2RGLA 4NZ3A 4X61A 5A8PA 4OBSA 1H1YA 3FA4A 3N1AA 2YL8A 2HROA 3CHEA 2QS8A 3CLMA 2DUXA 2WCSA 2DU2A 4J35A 2VOMA 1XIDA 5F2IA 3BMWA 2WW5A 1OT1A 4G1NA 3MMWA 5BRBA 3LPOA 2VFEA 4MJMA 4JTAA 2UY5A 2R1PA 2PBOA 4AC1X 3WD1A 4IX0A 5F2LA 1WUEA 1JZ2A 1PZ1A 1IXOA 1IQ8A 4NVTA 3A3WA 3WEZA 3WQFA 5FESA 2C91A 3WLLA 1W3KA 5KETA 2J74A 3LYEA 2O4QA 2ONEA 4RZ4A 1NSJA 1TV4A 4D8ZA 1LT8A 2CESA 5I03A 3TAOA 3IIZA 4X63A 1N7KA 3C0JA 2WHLA 4IMCA 3GS6A 3N9KA 3UXDA 3MHFA 2D1ZA 3ABRA 3U5YA 3E0FA 4RV3A 3VGBA 2Y5SA 1V0LA 4HNCA 5IBXC 5C9UA 1RY8A 1ONWA 2YDAA 4ATLA 2V2CA 2W91A 4ZOBA 3R43A 1UZDA 4JDYA 2NWRA 3K4AA 1VHNA 3JW7A 2Y62A 1AL7A 2CHOA 3WH6A 2QW5A 1UKSA 4A3UA 4LC6A 2Z2BA 4L56A 2RKXA 5D2TA 2IQ0A 3I65A 2NLYA 1YPFA 4DLFA 3WNLA 2C14A 2WWDA 1OZQA 5TD4A 1IT0A 1G7UA 2QUUA 4C5ZA 1K8XA 4FP1A 4IP5A 1GW1A 4KW2A 3P61A 4PRRA 3R79A 1F3EA 4YN5A 4EPBC 1XUZA 1XWYA 1F05A 1CXFA 2AMXA 1TTPA 3ITTA 2BOEX 3KX6A 4DXXA 5D05A 4ZQCA 4UQCA 1VPQA 2OFJA 3B0PA 1F6KA 2ISWA 4GCAA 5CKSA 2GSEA 5BXSA 4IP7A 4C1NA 2C0HA 4ZBCA 5CBIA 1R3VA 1EJXC 1I60A 2KX9A 1D8CA 4Y9OA 5HATA 1LQAA 3KHJA 4GVGA 2WYSA 5HWNA 4P8VA 1PJ9A 2ZX6A 3VE7A 3N3MA 3QY8A 4MB5A 4PTMA 3PB2A 1J6PA 2A3CA 3UG8A 1Q45A 1W1ZA 4GE8A 4QDPA 3FAXA 2BHUA 3BICA 4NJJA 4K1WA 1UKQA 3OBEA 1TUFA 4QCFA 2F61A 2VZOA 4N7QA 3GXTA 4ZGYA 5EBUA 5KITA 3P81A 3D3FA 3FYYA 4CNUA 2JIWA 2OVLA 1E0TA 3PJWA 3W1TA 4H7CA 2PU1A 2W62A 3UR7A 1A53A 2OWXA 2C19A 2Z1WA 1TUXA 4WDTA 1TPFA 1K9FA 3OGSA 3O0FA 3K8MA 1Z41A 3E0VA 4X60A 4FF5A 4Q8UA 1SO6A 4I9MA 3UGRA 4PUEA 1YE6A 2V67A 3LGGA 3AYRA 2Y5EA 4ECLA 2A3LA 3N4AA 4ICNA 5BMXA 1QNQA 4GIAA 5C70A 1PTDA 4O0QA 2DUAA 3H2OA 1FWSA 4Q4PA 4R53A 2DORA 3OVRA 4LYPA 4LOCA 1JAKA 1XH0A 3KLKA 3RG6A 3HQOA 3LI1A 1U1HA 3G0XA 2ZUVA 2PEVA 4D9PA 2YXXA 4PFHA 1YKWA 9RUBA 3TTOA 3S5NA 1O66A 4RDZA 3CT7A 4O11A 3E0LA 3I10A 4YS1A 4GVIA<