4XIAA

Structures of d-xylose isomerase from arthrobacter strain b3728 containing the inhibitors xylitol and d-sorbitol at 2.5 angstroms and 2.3 angstroms resolution, respectively
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
393
structure length
393
Chain Sequence
VQPTPADHFTFGLWTVGWTGADPFGVATRANLDPVEAVHKLAELGAYGITFHDNDLIPFDATAAEREKILGDFNQALADTGLKVPMVTTNLFSHPVFKDGGFTSNDRSIRRFALAKVLHNIDLAAEMGAETFVMWGGREGSEYDGSKDLAAALDRMREGVDTAAGYIKDKGYNLRIALEPKPNEPRGDIFLPTVGHGLAFIEQLEHGDIVGLNPETGHEQMAGLNFTHGIAQALWAEKLFHIDLNGQRGIKYDQDLVFGHGDLTSAFFTVDLLENGFPNGGPKYTGPRHFDYKPSRTDGYDGVWDSAKANMSMYLLLKERALAFRADPEVQEAMKTSGVFELGETTLNAGESAADLMNDSASFAGFDAEAAAERNFAFIRLNQLAIEHLLGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of D-xylose isomerase from Arthrobacter strain B3728 containing the inhibitors xylitol and D-sorbitol at 2.5 A and 2.3 A resolution, respectively.
pubmed doi rcsb
source organism Arthrobacter sp.
molecule tags Isomerase(intramolecular oxidoreductase)
molecule keywords D-XYLOSE ISOMERASE
total genus 141
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 5.3.1.5: Xylose isomerase.
pdb deposition date 1989-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4xiaA00
4QDWA 9XIMA 2GLKA 3CQKA 1MNZA 1XLIA 3KBNA 1XIEA 4YTSA 2NQ9A 3XIMA 3QXBA 1DIDA 3C0QA 5FA5A 1OADA 4ZB5A 4QEEA 3IUHA 2I57A 2ZVRA 4DUOA 4Q7IA 1XYAA 4A8RA 3XISA 3N4AA 2QULA 1XLBA 3KBSA 4HNOA 4QE5A 1XP3A 3BWWA 4YTQA 4ZB2A 1XLHA 4X61A 5XIAA 2NQJA 5H1WA 2G0WA 3FVMA 9XIAA 4HHLA 4HGXA 3KTCA 3AYVA 4US6A 2GVEA 1XLMA 4GQBA 4XKMA 1XIMA 5H6HA 4EACA 2GUBA 4QDPA 5TNVA 3ITTA 1XIFA 1XLEA 3ITYA 3AAMA 4PGLA 3QYSA 3QZAA 3P14A 3UXIA 1S5NA 1XIBA 5EMKA 6XIMA 3M0YA 4XIMA 3KCJA 1A0DA 1XIJA 4PFHA 1XLLA 3KBMA 2GYIA 3NGFA 1DE5A 4K1GA 4KW2A 1GW9A 3KWSA 4YTRA 4X63A 2ZDSA 1XYMA 3M0HA 4QE1A 4XSLA 1QTWA 3BZGA 1XLAA 2QW5A 1XIDA 1XLCA 2QUNA 3M0MA 3VYLA 5B7YA 1I6NA 3UA3A 3LMZA 5EMJA 4EAYA 3U0HA 3CQIA 4J4KA 2XISA 3BANA 5B7ZA 1DXIA 2NQHA 3M0LA 4QEHA 3UA4A 3AYTA 5EMMA 3M0VA 4XSMA 4ZB0A 1BXBA 3DX5A 1QUMA 1XLJA 3CNYA 3IUDA 7XIMA 3ITVA 1S5MA 1XINA 4GJIA 2Q02A 2X7VA 5XINA 5J8LA 1I60A 1CLKA 3ITLA 5I7GA 2QUMA 5B80A 3BZJA 3VNJA 1O1HA 4XISA 3UU0A 4A8NA 4G56A 3CWHA 2XINA 3ITXA 1XIIA 1XIHA 3KCLA 4W4QA 5XIMA 8XIAA 4QE4A 4A8LA 1XLKA 1A0EA 5AVHA 4YTUA 1DE6A 4OVXA 3DBNA 2X7WA 3TC3A 3JU2A 4X60A 3KBWA 3BDKA 3CQJA 3KCOA 4LNCA 4XIAA 3VNIA 3C0LA 1XLGA 3KBJA 3CQHA 5C9ZA 3QC0A 1MUWA 1XISA 1XYCA 4K3ZA 5EMLA 3VNMA 3WQOA 3TVAA 3P6LA 4YTTA 3AALA 1K77A 3M0XA 1XICA 5AVNA 3XINA 3GNXA 1D8WA 2G4JA 3KBVA 2HCVA 3VNKA 2OU4A 1QT1A 1XIGA 1TZ9A 1DIEA 3U3HA 1XLFA 3VNLA 6XIAA 1BXCA 2HK0A 3C0SA 2J6VA 3OBEA 4ZBCA 1XLDA 2I56A 4GLEA 8XIMA 1XYLA 1A0CA 1XYBA 4HHMA 3ITOA 3IUIA 3L23A 4GJJA 1YX1A 4E3VA 2HK1A 3UVAA 4A8IA 4DVOA 2XIMA
chains in the Genus database with same CATH superfamily
5EFDA 5AHIA 1EHAA 1C90A 3W22A 3IUHA 3UZJA 4RE2A 3PANA 3IIXA 3B8WA 4H6RA 4D6GA 5ABGA 3T2PA 1IV8A 3SADA 2J9ZA 4UZSA 3E38A 2E6AA 1PIFA 4MIMA 2XDFA 3LNPA 4TUFA 4NRRA 5GVJA 4CN1A 4L4OA 1LOQA 4JKKA 2W27A 4MLRA 3IVSA 1L2UA 3RIKA 1OG6A 1EJTC 2INEA 1YKWA 2J8TA 4I8YA 3VPLA 4K37A 4S2BA 4AWUA 4GI6A 4HSHA 5AC4A 4N0RA 1P1XA 2BSLA 3MY9A 5FF7A 4JQ4A 1K8XA 4FNRA 4LPCA 3MI2A 3HG4A 4J35A 1EJXC 3ZJ8A 1QOXA 3DEQA 1TPEA 3KCLA 3NZRA 1X98A 5AVHA 1Z3NA 3V0SA 4AWTA 1O5XA 3UG3A 1R3YA 2Y7EA 3VNIA 4PUNA 1E1FA 4JEJA 1RK5A 1TPFA 3UPWA 3N25A 4M5PA 4RV8A 3PF3A 3KZSA 1XLFA 3EXSA 2WQPA 4EF9A 3SRKA 3AHVA 3P7YA 1T40A 5LIXX 1K3UA 3QKEA 1A5AA 4TMCA 3GS6A 3QRHA 3EWDA 4HPGA 2VZUA 3MBDA 3M07A 3LK6A 4WSHA 3TW9A 4FX6M 1KRCC 3GIPA 1J4EA 4C6MA 4GBDA 2VT0A 2ZRUA 2OLHA 4V27A 1BAGA 3T07A 3CM4A 3BOXA 3GXFA 1KNWA 5I3KA 2PGRA 4IQJA 4XG1A 1KTBA 3H12A 4OV9A 4US5A 4EWND 2CHNA 3O6CA 1PCKA 3GDBA 3BMXA 1I6NA 2PC4A 2VD9A 4O16A 2FPYA 2G96A 3V1PA 5BNKA 1W8GA 2Y2WA 4F66A 1R3QA 1TYGA 3AC0A 2V3DA 4S3JA 4PBFA 5E5CA 5HWNA 4GQQA 1TA3A 2VX7A 1D9EA 3IIZA 3B05A 3CAWA 1IEIA 4IUOA 1N8IA 1OT2A 1A5BA 1XKJA 4OVXA 1QVBA 4GMEA 2ONEA 1B4KA 4KIRA 2FVMA 1FWHC 2OYKA 1IGSA 3DFOA 5JBDA 3VNMA 4IISA 3MTWA 2CYGA 5FKYA 4PUDA 1BYDA 1XH2A 3N2MA 3SRFA 3H2FA 1T41A 2ZRVA 4PUWA 1QW7A 4M6UA 3TOPA 1FH9A 4M7SA 5KZMA 4E4UA 1KXHA 3VIPA 4GISA 1RA0A 3GFYA 3N04A 1R6WA 3WF0A 1JF6A 2VWTA 4JCMA 2D69A 3UT0A 5HBFA 1UYQA 3WQ8A 1E6QM 3CIXA 3DH7A 1KFKA 2C79A 4HU8A 5JU6A 1K4HA 1EGMA 2VZTA 2ACQA 3WELA 3H2AA 3ITYA 3S5YA 4Q4KA 3VX0A 2PWEA 3S6TA 1TG7A 1LF1A 3B3DA 1DE5A 1NWTA 3P5ZA 3C3UA 1TFVA 1UPMB 4GNVA 3M0MA 2DIKA 1XRTA 3HB9A 3VXGA 4H8VA 2YL5A 3P60A 3R10A 2Z4GA 1UUQA 3M0LA 3WX7A 3WLIA 3QY8A 1DVJA 4RPPA 2VGFA 3ARYA 3A3WA 1E43A 2VX5A 4Q4SA 2ZYFA 5FEZA 4WIWA 4A8NA 3H6OA 2O9TA 2Q6ZA 4XBJA 1FCUA 3TK7A 3RLVA 4IIBA 2A7NA 4DF0A 1FDJA 2DEPA 4E6MA 4UFHA 3BO9A 1DV7A 4YLWA 3TJXA 1RCOB 5AYXA 2PRMA 1EBGA 5A69A 3AFBA 3ZSSA 1OY0A 2GWNA 4B91A 2CLMA 1HTIA 3TFCA 3TOYA 4HK6A 1ML1A 4MWAD 2DSWA 3G6MA 1JCTA 5FA5A 5BROA 3PBUA 2IUZA 3DG6A 1JUBA 1JDAA 4G7FA 3TLQA 3WF1A 2WZEA 3FA5A 2GVLA 2UZ9A 5TF0A 3GIYA 5FJRA 1NDZA 1UUMA 3Q4DA 1FUYA 1W9XA 3HZ3A 2OTDA 1CECA 4ROQA 1KM2A 4EACA 3BICA 1EP2A 3B4UA 4QS5A 1QO5A 3O7UA 3GWQA 2PDKA 2J7BA 5F2LA 3KBMA 3BV7A 2GWGA 1KFEA 4XZ9A 4GGHA 5FD0A 1R0MA 4JDBA 5HA7A 2LLEA 1GZJA 4D6JA 1HVXA 5M2FX 4P61A 2JKAA 1QNOA 4OOUA 3U57A 5HK4A 2X0HA 1QUMA 4XUGA 5C55A 3ONCA 1W54A 5KITA 4PYSA 4FOJA 3DYMA 1BSLA 2C8NA 2PWGA 3WQWA 4ZO9A 4X9SA 4ZXOA 4H19A 2BGNE 3GUGA 1IHIA 1P5BA 1ZP4A 2XSAA 1L9WA 1MW3A 1RQHA 1W2VA 2PDIA 3ANYA 3BAWA 3MVTA 3WCZA 4TV6A 2DUXA 4D6FA 5BXPA 3P2VA 3LG3A 3T42A 2FVKA 1CIUA 4LYPA 1F73A 1T7LA 3HA1A 4C5ZA 1KCXA 2WSKA 4Q8TA 1AQHA 3BK0A 5I23A 1GEHA 2V82A 1M9HA 3C2YA 1ZPTA 4Y96A 2AL2B 3LV6A 2WBKA 4JX5A 4CQAA 2VFIA 2I5QA 1Y5WA 4JY9A 2IKJA 5BZAA 4DJDA 1AMYA 4PMNA 4WEVX 1D7KA 1POKA 3RMJA 3T09A 1E3XA 2AAAA 1EDQA 4PODA 3M6YA 1T99A 3T0BA 1FP9A 2BVYA 2MNRA 1FCBA 1M5WA 3LSCA 2V2CA 5G1MA 4MSSA 1YQ2A 3AS2A 4RZ5A 2WMIB 4XAPA 3W1AA 3RRXA 4RDWA 3OHIA 3A5FA 2ADAA 1IXPA 3W2KA 3EMCA 2V5KA 4LRTA 1UWTA 2XU2A 2YGYA 4HNUA 1ZAIA 3L65A 1JCNA 1YDVA 1SJDA 2ZTJA 3QPYA 1HKJA 1Z41A 4RZ4A 1VBJA 3NOYA 4N4QA 3UETA 4GH1A 3QTPA 3QC0A 4TVCA 2BS9A 3VCCA 3GAKA 1CEOA 1DQUA 4NSBA 1VCVA 4MWAA 1CGTA 3OLGA 3C0SA 2J7HA 4PCNA 2EEXA 5FEXA 1SO4A 1UA7A 3CZ8A 4FX7A 5U7SA 3T44A 3ANUA 2WANA 2FLIA 3NXLA 3LZ5A 3W3OA 2BP1A 4TMBA 4IX0A 4JFWA 3MMWA 1RY0A 2WAGA 4UNIA 1R87A 1XYAA 4JYDA 2YZ5A 3WF4A 1GQNA 2D3NA 4YU1A 4ZO8A 2VGIA 4UQBA 4O57A 4N9CA 2FHFA 2H9AA 2DT0A 2QAPA 4HN8A 2JKPA 5FF4A 4H9UA 1TV2A 1QPOA 1M7PA 4K1GA 3EWXA 2ISWA 1E9LA 1RBAA 3ABSA 1C7TA 5AYIA 1R2SA 1AQ0A 2C6QA 1OFPA 1PSCA 3UNDA 3OBKA 3W2NA 5A2BA 4UFKA 1YTDA 2WZTA 5C7VA 1TIMA 4JNYA 2L5HA 1CXFA 3B0YA 4RNIA 2NQLA 2D2OA 4NG3A 1HX0A 2C1HA 3B04A 3C8NA 2R1NA 3IS4A 2YFNA 3M0JA 1KWKA 2JGYA 4RV3A 5LNRA 1RR2A 4JBRA 1WCGA 4V33A 3KTSA 4GY0A 1OFRA 5G2IA 1LLOA 3LLDA 4KCTA 2RJHA 3VUPA 2G50A 4S1FA 2CBUA 3BE7A 4BCEA 5KEZA 2BG5A 3U9IA 3NDYA 3Q2DA 3WMBA 1KGUA 4EE9A 1RLDA 5MF5A 4IL0A 2IPWA 3AZRA 3GFZA 1H3GA 1JDFA 3USBA 3ARSA 5FESA 1U22A 3U7VA 3O2LA 2A6LA 4HNOA 3DDMA 2PDHA 1IXQA 1KQZA 3MP3A 3DBPA 5KSWA 5BXRA 1JYNA 1CGWA 1IIHA 4WY0A 3T05A 3EEZA 1M1BA 4Z42C 3F2DA 5DN1A 3TN3A 1QDSA 4UTUA 4A22A 1QHOA 3STPA 3DKLA 3TXZA 3UR5A 2WVUA 2EBNA 2YW3A 3KWSA 1SFLA 1GVYA 3PG8A 4HOZA 5HNRA 3NPXA 3QBUA 4J4KA 3SIZA 3TYUA 4KCVA 3THAA 4Z1AA 4QJ4B 1UWIA 1S5MA 2DUZA 3GYCA 3LHWA 4MMWA 3WJSA 1BWKA 1YXDA 4QX4A 1QOQA 1RJPA 2NXIA 3COTA 3CZJA 2AL1A 3M0IA 3A4WA 4W5ZA 5JBEA 1QO2A 1JCLA 4JXCA 5HQMA 3G8EA 2J7DA 4V1XA 5LKYA 2FMOA 2XFYA 3WD3A 3MU7A 4PB3A 4PEKA 5KETA 1FFQA 4ZE5A 5CLTA 4EPDC 3NPWA 3TAOA 2GUUA 3HJEA 2PDFA 3TJIA 4AZHA 3EKZA 4ACYA 2E6YA 1A49A 1V4YA 4TOQA 3S3GA 2QDDA 4JQ2A 3LHVA 4GJJA 4GI8A 3LOTA 5EPDA 2BY1A 1LZOA 2BVTA 2XIMA 4UTMA 4F3HA 3CUFA 1B9BA 3W7OA 3AXXA 3NUKA 3SUUA 2QVHA 3D46A 3ZYZA 3QHNA 3LPGA 1O68A 3NO5A 3P0WA 4GQ0A 1E1CA 3ZXWA 2B7PA 4LVAA 2GUBA 1AD1A 3LXCA 5FJTA 3P14A 2GL5A 3TMLA 3OOQA 1A0DA 2VGBA 3WLTA 3UYCA 3MB9A 3WFAA 3W1XA 3S5OA 2OYLA 2INFA 1MQPA 4N4PA 2QCNA 2WXDM 1HGWA 3LMZA 3FXGA 4ERGA 2ZA1A 3UWVA 2BHUA 4WGHA 5HNUA 1ME9A 3N2OA 5CC7A 1EH9A 1SW7A 2J79A 5E0FA 5DT7A 2OMAA 5AC8A 3IJQA 5I7GA 4Y9MA 1EPVA 4AWEA 5EY5A 1GOKA 4GYKA 3VDGA 4IPJA 1RV8A 1TV7A 1SFJA 4XX6A 3SN4A 3DFPA 3W88A 4Q8VA 2ATSA 3PFRA 3NURA 3O1NA 1JZ3A 1F6PA 1I2QA 4BQ3A 3IJ6A 3UERA 1RBLA 5M5DA 2X0YA 5HQEA 5C8BB 4DWSB 2J6XA 2WJFA 4H04A 1IEXA 2Z27A 1W1VA 5I24A 2QUUA 4UQCA 1HJSA 1MWOA 3WQEA 4WSJA 3WF2A 3VC6A 3W7PA 3PY2A 3FAWA 3PG9A 3UCCA 3LGDA 3DI0A 4CEUC 4NY2A 2VFDA 2CKRA 6REQA 2P8BA 3W1QA 2YCEA 3RG6A 4ADTA 4OQVA 1KB3A 2WK2A 4MKVA 5E6YA 5DMYA 1TR9A 1F05A 2J9XA 4LEFA 1DHKA 2GK1A 1LRQA 1J5SA 1LJYA 4N02A 1FWNA 4XZBA 3UZZA 3W87A 1VRXA 4J5NA 4KRTA 3SCOA 4AUBA 3LGGA 5BWFA 1W3KA 2YPIA 3W1UA 3SECA 4IIGA 5G2WA 2QUVA 1VLIA 3G24A 1MYRA 1A53A 3VMPA 1GVRA 4MM1A 3NL3A 3A9BA 3FGCB 4HN4A 3TCSA 3BC9A 4IPPA 2ASHA 3OZMA 3RCYA 1KR0A 5I03A 1IR1A 1DKWA 3FW6A 5GPRA 3EPOA 4O18A 3THCA 3A12A 5AHEA 1LG2A 4G6CA 2E5CA 3MT1A 3UW6A 1ITUA 4YPJA 1R3WA 3BMWA 2YOCA 3XINA 3VIFA 3C86A 2PDMA 2FTPA 2Y4SA 5J5DA 4OIFA 2J6VA 3L5LA 2TMDA 1OM0A 3KOFA 3F5KA 3CUHA 3WH8A 2CERA 4M6QA 2J7CA 1GWJA 2VKZG 2YCIX 2XVKA 2Y8VA 1KKOA 3N4AA 1V93A 4UC5A 1Q6GA 1OZQA 2VMFA 4Q8OA 1ITXA 3TZNA 1L2QA 3PB2A 4MYXA 5H6HA 4EWJA 1RD6A 2PF0A 5EMKA 1IT0A 2ZZ5A 1PX4A 4TVDA 1T8QA 1ZBWA 2QDGA 5D03A 5KZ6A 4ZCWA 3S9IA 3K2GA 1DYSA 1ONXA 3BPWA 1SJBA 3CAKA 2I7GA 1XBXA 3BCJA 2A6NA 4QBXA 1WB0A 4ECLA 1TTQA 1UD2A 3TYDA 5DF0A 4HK5A 4WJXA 4PTVA 3WNNA 4U2ZA 7XIMA 3H24A 1KXQA 3HPZA 3L0NA 4P8UA 1W17A 4IUGA 4ORIA 4AWSA 1KBKA 1NELA 3HTWA 2YXGA 3MUXA 4HOWA 3ARPA 3P3BA 4FXSA 4IGSA 2OSWA 5FSEC 3GC5A 4DJDC 5KZDA 3R5EA 5IBXA 2XN0A 3O6DA 1KM0A 3CQHA 5BU6A 3NCOA 2DSKA 5DRCA 2WHMA 2YL8A 3GR7A 3FA3A 1S38A 4AIEA 2ZUTA 1GPFA 2WSYA 5IOBA 1JQXA 1GVQA 4P7QA 3DHPA 1A0CA 5GJPA 3EB3A 3VM5A 5L9FA 3GNNA 3R2GA 2POTA 4B3LA 5I3FA 1E6ZA 1Z48A 1U5HA 4AZGA 2A1YA 2CHRA 2QDEA 1VYPX 4D9PA 1ZJHA 5JH1A 1BQGA 1EUNA 2FGZA 5CC5A 2GJXB 2FDMA 1CPUA 1G4SA 3AUJA 1UCWA 1K9FA 2RFGA 2JF6A 4DBWA 1UPPA 1UWAA 2GJPA 1JZ8A 3DN5A 4R53A 1E0TA 1EA9C 3QFWA 4DJEC 4HPJA 5D38A 2Y5JA 1WBHA 1QNSA 4L6HA 4AMCA 1XR2A 1VB9A 3DZ1A 3OVPA 4HCLA 3RX3A 3V16A 1JCXA 3HGSA 5M3WA 2W66A 5GNYA 4LC6A 1XBVA 4W88A 3B8IA 4WY0B 3LV5A 1JAEA 3NQDA 2YIHA 4JIRA 1NEYA 1NQKA 2V2DA 4GJIA 4F0HA 2E1DA 1QK2A 2OZTA 1NARA 2A21A 3WK1A 3FA4A 4MFEA 1JD9A 2ZQ0A 3AIVA 2OPJA 4ZQMA 1LROA 1XW8A 4GWEA 3M9YA 1V3HA 5M03A 2WNWA 1GW1A 5I2UA 3DXIA 4CNOA 3M6DA 3MWCA 3PHAA 1ELSA 5I09A 1XYBA 3ENLA 2HROA 3WD4A 1QRQA 2B4GA 3S6OA 4O52A 3QR3A 3FVDA 2QF7A 4PCPA 4R7WA 3NEHA 3O06A 1ZSXA 1HFBA 1B3VA 4PMOA 2BTMA 3VZXA 4HKPA 5A8NA 3VD3A 3LBMA 2ZA2A 1V0LA 4HPXA 3UZ5A 5KZEA 4DLFA 1MZRA 4DYKA 3KRBA 1V6VA 3VDAA 5HINA 4KWOA 1G94A 1VBRA 3G1YA 4LT9A 3FGCA 1LRNA 3II1A 4O1DA 1UG6A 5FF2A 3A47A 1YYAA 4D8ZA 1Q13A 1BKSA 4FPSA 3BAJA 4YS1A 4K7VA 2DJLA 1VJZA 2WM1A 3VD7A 4HBKA 4W8AA 4F79A 1B2YA 2DVXA 3TC3A 1UR1A 2FPVA 1EDGA 2UY5A 3EX4A 4QQ3A 5D33A 4L80A 3QV8A 1XSIA 4R34A 1ZQ5A 1EDTA 4CNUA 1DWHM 3HG3A 4PCSA 1K8YA 1VFTA 2DW6A 5C9RA 3WH9A 4DM2A 3VKCA 4CEXC 5AHNA 3NSMA 3TTOA 3E2RA 1TWIA 1MW1A 4NL1A 1B1YA 1Y8BA 2OEKA 4GFIA 4QM1A 4QFUA 3TW6A 3GNPA 4Y9OA 1Z32X 3BL3A 2QJJA 1AODA 2WLZA 1RD5A 2GDVA 4L4PA 4CGTA 5HDRA 2YKKA 2W6RA 3P74A 4S39A 3KWXA 3U7BA 3UA3A 4C1NB 4DPPA 5TD4A 4QCEA 3B9OA 3NIYA 2HVOA 1JCJA 4JTHA 3RLHA 4DELA 4ES4A 3NQEA 3T1GA 3RPDA 4ZVJA 5A8GA 3VD5A 4UMBA 3ZS4A 4GUFA 4KRZA 2IPFA 3ZR5A 1PZ3A 4JL2A 4YIWA 1GJWA 3VGGA 4M80A 3PUDA 1TWSA 5BRQA 2WNQA 2WCSA 1C8XA 2ZUSA 1OHLA 1QWKA 2GUYA 1UZHA 4YNGA 3WLOA 2G4JA 1WOAA 4XAZA 1ZJIA 1R8LA 5HNNA 4TTGA 4BK9A 3DFSA 1J0YA 5HUOA 3OLDA 3M5VA 4FF7A 4UQDA 1ZJBA 4K6AA 1GYMA 4GIEA 2FTYA 3P62A 4GIAA 1HUVA 2PTZA 1IGWA 5LIKX 1EJRC 3NYZA 4O28A 2VCCA 2PB1A 1EC7A 3KTCA 3GO2A 2BB0A 5IXEA 3D3AA 4IG2A 4ZQNA 3IEBA 3VMOA 3C5QA 3I10A 3BW3A 4P7NA 5I78A 3S1XA 1E55A 4JX4A 2CXEA 2QV5A 3EWWA 2GSEA 3W2UA 3T6CA 1QNRA 3LENA 1EFZA 1DXIA 3VFLA 4IQLA 2H9AB 1ESWA 2Y7FA 4OKDA 3RLUA 4MVAA 3IUDA 4U4MA 1FWIC 4PUMA 5FJPA 1BRLB 3HQNA 1JUKA 4CCZA 3B0UX 5CPMA 1LQ0A 5A5WA 1BHGA 2PDCA 1AH0A 4RE4A 2PU0A 1CENA 3DKJA 2DW7A 3SDOA 4Y8EA 4L7ZA 4U2YA 4HNCA 5D05A 3MBFA 3RK8A 1E51A 4IP5A 4PMYA 2BXVA 4MGGA 1J0ZA 1ODUA 3MZ2A 2W91A 3EOEA 1B4EA 4QSFA 4X0NA 4QISA 4MOZA 1F76A 4DF1A 1JPHA 3W7JA 4LANA 1ZRQA 3GG8A 2I56A 3EB2A 3O15A 3HM7A 4LUSB 3MYOA 4YVVA 3CUZA 3HG5A 3LBOA 2UWFA 3AMKA 3LUTA 5FOOA 5HMFA 3L5AA 3RJYA 4WF7A 4DUOA 1CB7B 2R1PA 1WA3A 4C1LA 2OCZA 4YCOA 2QULA 3KX6A 3TX9A 2YA2A 1A4MA 3O8AA 1OYAA 3OU8A 5I3HA 3HPFA 2AQVA 4DUVA 5D09A 1H50A 3DESA 4AZ6A 1Q6DA 4DJFA 4G1NA 4FB7A 3T78A 1Z69A 2Q8XA 4AD1A 1UKTA 1ZNNA 4Y7EA 4YCPA 2GJNA 4OFCA 3ZQ9A 3D3FA 3R89A 3PZNA 4S23A 4D6CA 2GQ8A 2DIEA 4LFYA 3NNTA 1XIDA 2VUNA 1JDEA 3AISA 3UJ2A 3V5CA 1IWBA 2DPEA 1UR4A 3W01A 1TMHA 3SBFA 3IGUA 3PAOA 4KQNA 2W0UA 4EPKA 1HJXA 4XISA 3IAQA 3VKAA 3N4FA 5F7UA 1K02A 4FMVA 4JTDA 2VR4A 1CGXA 3EKGA 4UTWA 4LQ1A 3KL0A 1XYCA 1QNVA 5TQLA 1RPKA 2QPXA 4UNKA 1RSCA 3S2LA 4ATWA 2Y85A 3QFEA 3S5ZA 2E1WA 5DCEA 4AD2A 3BTNA 5DANA 7PTDA 1ONRA 3EDKA 3QR1A 1I4NA 4GHRA 2YCKX 4I6KA 3A3XA 3WUGA 1M01A 4EF8A 3UQNA 3T4CA 3WK3A 4AEEA 3PZGA 1QPQA 4DI9A 1GGOA 1NTHA 2XFRA 4FP1A 2GQ3A 4N9EA 1VHNA 2J78A 1H7WA 1VZWA 2WBGA 4J3XA 5EU9A 1G6CA 2E77A 2P3EA 2IW0A 4LYRA 3EPNA 3CK5A 4ILSA 5I06A 4IJBA 1ICSA 1FWAC 2C3ZA 3I3BA 1K7FA 4CU6A 3W74A 4ZENA 2VGGA 2DSZA 5A1AA 4KCUA 1KM3A 4O4VA 4PMZA 1AJ2A 6TAAA 1DJQA 3WNMA 2O9PA 1XGEA 3OG2A 4LVDA 4BI5A 1PKMA 4FOUA 2HMCA 4OBSA 2QYGA 1W3NA 3Q37A 3CLMA 4BY3A 3E2QA 3PN8A 3HPXA 1AH3A 3LXBA 4XKYB 4S3EA 4QGCA 1LOSA 2Z2BA 1WXJA 3CAQA 2WMFA 3PP7A 4H4IA 4PL2A 2PC8A 3V36A 3Q65A 4NZCA 4GNKB 3O6AA 1CYGA 3RN6A 3LHZA 3U8GA 3ITOA 1P0KA 3TTSA 2R1MA 3RM9A 3V7PA 4A29A 3E96A 2E9MA 1E6SM 4UOQA 2NUXA 1JULA 4Z17A 4G2DA 2CLPA 2YCJA 5SWUA 1JDCA 3CPRA 1PUDA 4QSHA 2Z2AA 4RKAA 2ZUVA 1VBHA 5D8ZA 4FX8A 5A6MA 4KWSA 4E2DA 4KBXA 1AH4A 3M47A 2E5BA 1QW9A 4DJDD 3FX4A 3E12A 3RCMA 2HXUA 4O1CA 4JYEA 3AAMA 1U1UA 4NJKA 4AH7A 4N6EA 1BEUA 6REQB 4I5XA 1BVNP 3PNUA 1MRQA 4RLIA 3L4ZA 2YYUA 4NXSA 3GXPA 4ERAA 5T91A 1NOUA 2E68A 2YCLB 1KKRA 3FFSA 1FCVA 3NDZA 3A22A 4GY7A 4MJ2A 2OLAA 3WFZA 4AF0A 3N6QA 3VD4A 3L7RA 4DUXA 5ABFB 2VQTA 1DE6A 5HATA 4NZ4A 3CV7A 4NU7A 1VFOA 5D2VA 1HJWA 1NOWA 2OO6A 4IHCA 1DOSA 1ZAHA 1LQAA 2X40A 3GBEA 4Q8WA 3OGSA 5JIPA 1DIEA 3GTHA 2WKGA 1XGDA 2E7FA 2RUSA 2XIOA 3GYEA 3S4TA 1KCKA 7TAAA 3N2CA 1FRBA 3LERA 3SY1A 3C2FA 1W31A 5EB8A 1OX4A 4I9TA 1JAKA 2ZVRA 3HURA 4HYWA 1XFBA 4JGDA 3T2OA 5TBOA 3D0CA 1XP3A 5L6UA 1ICQA 2C0AA 1JL8A 1WDWA 2X8RA 2VC9A 3S5NA 2F84A 1FWBC 4W87A 4Q33A 1D3GA 1HN1A 4IMDA 3W85A 3WLPA 4GQRA 4Y90A 4D71A 3BH4A 1EJ7L 2ZKMX 5RUBA 1PPIA 5EMMA 1TB3A 3REQA 3ERPA 3CV2A 1JPKA 2HBXA 3KP0A 2GQ9A 3CO8A 4GFSA 3CUIA 2DY3A 3W1TA 4F2UA 1W5QA 3ZJ7A 4GC4A 5LNWA 2A0NA 3UJEA 1TVNA 3U6WA 3OTRA 2GFTA 2WMIA 3EA2A 2OWXA 3ZJ6A 4HOXA 2WKLA 3TKFA 4JN8A 4AHPA 4CCDA 4N7QA 1GYNA 2I1OA 3G1HA 5AVNA 4BR1A 3N11A 3MANA 3PJTA 2BNJA 1JXKA 4FNQA 1KV5A 3NPUA 1DHPA 4GGBA 1HJVA 1IWAA 3GXMA 1XIEA 3T0TA 1Y7VA 3DG7A 3IK2A 7TIMA 1PIGA 3VKBA 1XLBA 2J7FA 3MSDA 3GXTA 4FNSA 3RFAA 2V6AA 3A21A 2R1KA 2X2YA 3AIWA 1E4MM 1P43A 3YPIA 3MS8A 3CZKA 1QK0A 1HL9A 4FF5A 2YDSA 1XLAA 3AXKA 2FFCA 4I7VA 1Y0EA 1UWRA 3C0JA 3L2LA 2JQXA 3H26A 3L5MA 3EAUA 3GXDA 1TWZA 4X0VA 5E9XA 1YBQB 4S3FA 3UU0A 4C65A 2ON3A 3W72A 2QNEA 5CAKA 5A3HA 4GVFA 4REQA 1LT8A 2DZPA 4R88A 4LNCA 1H63A 3JW7A 4XBSA 4UFIA 5EMUA 2D2JA 1V6TA 1XICA 1WYIA 4IT1A 1E6RA 3E0LA 2X42A 3G0UA 4JTSA 1K7XA 1UD4A 5FI8A 1WZAA 3WDHA 2PBGA 3NEVA 5FSDC 5FAGA 1WOBA 4DIAA 2PLMA 5DX7A 1UH4A 2RGLA 1F5ZA 4WUIA 4G8TA 1GG1A 2GGGA 1KFCA 1BF2A 1BGAA 5CC3A 3O16A 2REQA 1SO5A 4US6A 2E6FA 3KOZA 4Q4QA 2OOGA 3D47A 2YCLA 2ZZ7A 4BA0A 2PWDA 1J18A 1EO7A 5G4HC 2FZDA 4BF9A 1KM5A 3RPMA 4AZIA 1J8VA 4FXRA 5B7ZA 1AW5A 1JR1A 2BHZA 3CBWA 1VGAA 3M41A 3MV11 4LCQA 3W6MA 2ZADA 3ARZA 1KFBA 2Q01A 2FH8A 4PRTA 3POCA 4L65A 2Y6ZA 3PB0A 2OGJA 3EDEA 1J79A 4XO7A 1UC5A 4J3VA 4Q4PA 1H0IA 2JGQA 4I7UA 4JHOA 2G4FA 5G4WA 3LB0A 4OHQA 4GINA 4PTXA 5E09A 3TMQA 3QKZA 5C9ZA 1FHDA 3LCHA 4NILA 3UXDA 4IMCA 1WDSA 3NL2A 4AHQA 3UXAA 2YZRA 2FIQA 4JPGA 2DH3A 3W73A 3F4DA 4PFMA 2FGLA 2HV5A 4NP7A 1J2BA 3N34A 1O1ZA 1XCWA 3I3DA 4B4HA 4ML4A 9XIMA 3GC4A 3XIMA 3BVJA 1X97A 1PZ1A 3U2CA 1G0CA 4GG9A 1EC9A 2WHKA 3GTIA 7CGTA 3NQ7A 3DYOA 4TTUA 4DZIA 3EBVA 4ZXLA 4AZ5A 2D0FA 2G3IA 4QJ5B 2PTWA 3D6NA 1R3VA 5ABTA 3QQ0A 4UMCA 3W1NA 4UWMA 5T26A 4N9BA 1XUZA 2GGIA 2AKZA 3OVGA 1XIJA 2ZDSA 1GTEA 3PZOA 4H6QA 4R5EA 3ABQA 3KRUA 3LHYA 4D1IA 4RNJA 4B5XA 1UOZA 4LNYA 4UTIA 2BZNA 1SW3A 3S47A 5KMYA 2G3FA 2HNEA 1TVLA 3ZFHA 2DSVA 3IJIA 2BBFA 1QWGA 1Y5XA 1JZ5A 1HVQA 4IXHA 2F7FA 3UZWA 1Q8JA 1UR8A 3VDHA 1P0EA 3OB8A 4I6VA 3GW0A 2HZGA 1NF0A 2QEZA 3LHTA 4YYFA 4DLMA 2IKGA 1E73M 2HRWA 1AW2A 5LA1A 3UZYA 1PCWA 4BZYA 1S5VA 1GVFA 4EXQA 1JYXA 1GONA 4RX0A 1OYCA 4WKHA 1DWFM 2Y88A 3BG3A 1VIWA 4JN6A 1PKLA 4W7VA 1DIOA 4E3VA 4NI3A 4AVOA 2I5IA 3BAKA 4CD5A 1YEYA 1OIFA 2GLKA 4J2MA 2GJRA 3L2MA 1VFFA 4KEVA 3PTMA 5H2ZA 1EZ2A 4M8UA 3MA8A 3SUSA 7REQA 1G01A 3VABA 3KOWA 5IDIA 4P5UA 2PWHA 9XIAA 5H8UA 3MWAA 3O0KA 1IE7C 3C8FA 2Z00A 3QGVA 1I9CB 2CLIA 5G1TA 4BEUA 4B90A 4GJ1A 2OVLA 1RAKA 3E0WA 1CGUA 1EZWA 3UY7A 3QMRA 4EOUA 3NGJA 3ABXA 4PMRA 4AISA 2E67A 4RE3A 3SCQA 2EPHA 5BW6A 1KRBC 3EB4A 3P84A 5CXPA 1TTPA 1OINA 4GVHA 1E4IA 1W1B1 4KIEA 5A6BA 2HJPA 3EOSA 1FWRA 2E9LA 4KT2A 1XIIA 1W5MA 3TIMA 4CNSA 5CGMA 1DJGA 2XIJA 4JICA 1D2KA 3MDWA 4OUIA 1E6PA 4W93A 2HXTA 3W70A 3QC3A 3W7RA 8TIMA 1IT8A 1HKMA 2Y5EA 1DBTA 3ALGA 1ZBCA 3KBWA 3KCOA 3CV1A 2P8CA 1EEPA 1ICPA 1G69A 4G7EB 4J1OA 2WWDA 3A13A 1SW0A 1OCJA 2F61A 2D0HA 2G3MA 4R3UA 5CGTA 5G4EA 3F5LA 1RXOB 2AQWA 4C6PA 4JY8A 2WCAA 1KGWA 4P8WA 1JPIA 2RDUA 4GPNA 4IPLA 3OZOA 2Q8ZA 1RHCA 5G1YA 2CLOA 3C0QA 2B31A 1D3HA 5C6MA 1UZDA 2BFGA 3GKFA 1OF6A 4LSBA 5LGZA 1LL4A 1TIWA 4J3TA 3U2EA 5C5YA 1DL3A 4KH2A 4S3CA 4C6CA 2XFFA 1OGGA 3WQFA 1CDGA 3W7NA 2ZXQA 4W8BA 4PSRA 3MSYA 4R7JA 4I9JA 3OP2A 4KFNA 2XG9A 1XC6A 4BQ4A 4WXZA 2ZZ3A 3NSXA 1J12A 1W56A 4LBUA 1YDOA 4H7VA 2YR1A 3V35A 3N14A 4U5KA 4GXWA 1XCFA 4DXVA 3MZNA 3H55A 1XUUA 4S3DA 4I5RA 1LP6A 5EBAA 3BSHA 5D30A 3E49A 2OSYA 1R38A 4CVUA 3E2VA 4EANA 3IANA 3HOJA 1ENUA 2X1UA 2ISVA 1EGZA 1AMKA 4RDVA 4FS9A 3FNDA 3WENA 2TODA 3ZLGA 4AVNA 3B8TA 1N82A 3CL7A 3GR4A 4ZTXA 2CZVA 1KRAC 4AHOA 2VCBA 4LAKA 1S2AA 3ORWA 4Q8UA 2CLKA 1M41A 4ZSTA 1SO6A 3WUEA 5BOEA 2W4XA 1JPDX 3NVTA 2EQDA 4AY7A 1UD8A 3GU2A 3N3MA 4ZL1A 1ZHAA 3MMUA 3AMLA 4DY1A 4B5UA 3PTKA 2FTWA 3H21A 4NI8A 3SCSA 2WOQA 3HGOA 1VEMA 4DI8A 1JZ2A 4CQDA 2WQDA 2O4MA 1GKRA 4O10A 3H7VA 3EEGA 1M03A 4Z2LA 2ACRA 1GVOA 4S3KA 5FJJA 1F07A 3DI1A 1VFMA 1JI1A 2R8WA 4I90A 4KEZA 3UFYA 1TTJA 2J25A 2OOFA 4PMXA 4MWAE 1GG0A 4XSLA 4OU1A 4EPEC 1S5TA 2VR2A 2VRQA 4MY8A 2A7RA 2Z1XA 3QSRA 5C2CA 2Z2UA 1UQZA 2ZRZA 1MMFA 4Z1DA 1CBGA 1JRBA 1A80A 4B9ZA 2FKPA 4B92A 3MKKA 2RDTA 2DT3A 3VKDA 4LBRA 4JCLA 2HPIA 2GGJA 4GZIA 1I2RA 2XH4A 3APYA 2ZZ1A 1E9YB 4H83A 1VEPA 3AMGA 3W7QA 2Y61A 2PDUA 2HDJA 4FXJA 3THQA 3WLQA 2V2HA 1P6WA 2D1ZA 3FCPA 3LM7A 2HS6A 3NQ6A 4LB4A 2Z1VA 5HJLA 2CZEA 1XYLA 4HHMA 3AMDA 5D32A 3WUBA 1V79A 1XX1A 3L4WA 3PTQA 4MWAC 1OF8A 1H61A 1DXFA 4HZ7A 3W7EA 2Z1SA 4FEZA 4GH3A 2FB2A 4HJWA 3FVMA 3ZOAA 4ZO6A 5AN7A 5BRPA 4O12A 1TR1A 1VPYA 4X22A 4GO8A 1XLEA 1AZ1A 3UXIA 2O0TA 3MSRA 4QLLA 5FJOA 1TA3B 2C91A 1WP6A 4K1WA 2PEVA 3FDGA 1FWTA 3VC5A 1H60A 1QTWA 4AZBA 3ONBA 2IQDA 4JFVA 2PWFA 5CZJA 1CXEA 3BJFA 1V5XA 3DX5A 5DELA 3EX3A 5HNTA 1YNQA 4U28A 1XRFA 4Z1CA 2QCFA 4KETA 3RDKA 3BGAA 2WHLA 5AFDA 1VYRA 1E70M 1W1PA 1UP3A 1XFCA 4GCAA 3PBYA 1UR0A 4IMGA 2WNNA 2FJKA 4GD0A 1EB3A 3DU0A 4XWUA 3P8JA 3P6LA 2DORA 4C6FA 1E5NA 2W92A 4DYJA 3LM3A 3QN3A 3L66A 3W26A 4AF0B 2Y5SA 4C6DA 1Q8AA 4NZFA 4GYJA 3U4FA 5JIWA 3NVDA 1FKWA 3T40A 3FAXA 4KWWA 2F9RA 1OVDA 2ICSA 4ZQRA 3UXLA 1HG3A 4JS3A 4Q7IA 3ZVHB 5AECA 1S1RA 1OC5A 4MWAB 2VXNA 1U2YA 2Z28A 3NXFA 2AMXA 1ZJAA 1W32A 3W02A 1CB2A 3M5YA 4AZCB 1XPYA 1OD8A 4A3YA 3PBWA 2YL9A 3C2EA 4N2YA 3QTGA 3VGBA 4TQTA 3WQ6A 3AXMA 4C6KA 4QHRA 2X16A 4AXNA 1W91A 3AS3A 2WZHA 3CMFA 4IX2A 4M6VA 1QR7A 4X63A 3KS6A 3BMVA 1O94A 4ZGYA 1Q85A 3CWNA 4ZFMA 3USZA 2P88A 1JQVA 2CLHA 1EXBA 1VCGA 4G7EA 2OWCA 1KO0A 2AOSA 1Q65A 1EF2A 2DQWA 3O9NA 2PZ0A 5B80A 4HYRA 2WV8A 1ONEA 8XIAA 2NWRA 3CQJA 3LGEA 3A4XA 1PB0A 3E2SA 1EUAA 1E15A 1MUWA 4NX5A 2PE4A 3PSWA 1VF8A 4F0SA 3VNKA 5FF0A 3U5YA 3V0UA 3ANVA 3ABRA 1GHSA 4WOZA 5CAHA 1DWIM 2QHAA 2I5GA 1Q6FA 3FDKA 1W3TA 4XVEA 1PWLA 4KGLA 4GKLA 5F1UA 4DBDA 3B8UA 1JEZA 1F4AA 1EXPA 3XISA 1TELA 3F4CA 1NWSA 4B15A 1ZLPA 5DCBA 3R0UA 5HANA 3TR9A 1E56A 4Q6JA 3BLKA 4PUKA 2Q8LA 2P10A 3OVQA 1XIFA 3PTDA 3UJRA 1TMQA 1IEQA 2BGQA 2BXYA 2WZIA 3BSGA 3M44A 1BVZA 1NDYA 4P7OA 1RCQA 3RO6A 3NZQA 4IP7A 5KINA 3S1UA 1XL9A 1JGMA 2J47A 3SN1A 2CLLA 2NV1A 1JCMP 4Q6XA 2FDSA 3DERA 2WSQA 2QCDA 2XIIA 3ECQA 3B4YA 2XVNA 1A3WA 4IQDA 1FHLA 4FNTA 2X7VA 4L1WA 1TZZA 3RU8X 3WH6A 3MKVA 3LTYA 3TSDA 2VM8A 3A4AA 4ONVA 4K36A 1TJ0A 3CMJA 3I6EA 1V03A 3DC0A 1Q45A 2ZUUA 2E40A 5E70A 4ZO7A 2Z26A 5JXQA 2YB4A 1TV8A 3FLUA 1TPC1 3GTXA 3KOYA 3MUZ1 3W86A 3KBJA 4CNNA 4EXAA 3NL6A 3GG0A 2PDNA 2J88A 4Y9AA 4HQVA 3QM3A 3L67A 3NSNA 4TXEA 1N2VA 1RQBA 3CXOA 4KRUA 3GXIA 3CHDA 2V5DA 3L4XA 1YE6A 2VJXA 4JDYA 1JRCA 5BMXA 2KZHA 2IS7A 3QGKC 1SYTA 4P7LA 4CUCA 4ZB5A 3K8KA 3B9AA 1FXPA 1XQLA 3H54A 4UCFA 2WMHA 4MNKA 2QS8A 3GNOA 4HHLA 3TCEA 4PCTA 3OGVA 2R82A 1RJQA 3ITTA 3CT2A 4WXYA 2ISFA 4C7DA 1RVGA 1TSIA 3NGFA 1FVPA 1RP8A 1YHTA 1EQCA 3WDIA 1XLCA 4DQWA 4B5NA 1J5TA 1KV8A 3BANA 1V3IA 3DAQA 3AYTA 3ES8A 3PPFA 4E8GA 5BYWA 1N7KA 1TREA 3ITVA 1A47A 5AYZA 4C5YA 2C15A 1MXSA 3IIVA 5JMUA 4O1BA 3B0PA 4E0CA 1ADSA 2XPKA 4BF7A 3N19B 3PZ9A 1R9YA 4AIBA 3DG3A 1DEDA 1EJWC 3QOMA 3NQVA 3GAYA 1EJSC 5EBUA 4CKQA 1FA2A 3QF0A 3S8HA 3W83A 3GTFA 2EPMX 3NQCA 1TPVA 4CQBA 4MB3A 5CG7A 1UIOA 2WVVA 3C61A 2VX4A 1V0MA 1XDLA 1UKOA 5LNVA 1OADA 1DWGM 3L21A 3MW7A 1H1ZA 1Q2SA 4J7RA 1XV8A 1M7JA 5AYBA 4BQ5A 4NKCA 1RJRA 3HG2A 1VBGA 1EX1A 4C6IA 1VCFA 1MQQA 1FHVA 4EPBC 4CNPA 1TO3A 4M1BA 3FJLA 3LMYA 1HXJA 3PUGA 4B3KA 3KL5A 2R94A 4XV0A 2OG9A 3UWQA 3WLJA 4D2JA 5JQ9A 5AHLA 4MNLA 3CUGA 2OZ8A 3EDDA 2Z1BA 3KTXA 3SW6A 4K2SA 1L8NA 4ZFCA 2PLCA 3SRHA 1MFUA 2Y8UA 3I4EA 3IJ7A 2X1IA 1ZGDA 2PI6A 4IH3A 3TJLA 3S2NA 4ZQCA 3AMCA 1V8EA 1XIHA 1R46A 1LOLA 1RALA 4L1GA 2B7NA 5E0CA 4NJJA 2NXHA 2CIPA 4DO7A 1TJPA 4XBKA 1DQXA 2ZUNA 1EOKA 3WY1A 3V0TA 2ZX9A 1OWQA 3GHTA 5DLCA 2E4TA 3TVAA 1XGZA 4B9YA 3ARRA 6PTDA 2ZTKA 1QI5A 4QTGA 4ZQPA 4J28A 3G18A 1JGIA 3OA3A 2OO0A 3N12A 4GX8A 3ZO9A 3GHRA 3LRLA 3UCDA 3S9YA 1GZ1A 4CQ8A 1MNZA 5A2AA 1XQKA 3QR0A 3ZSTA 2V38A 2J4GA 1VFLA 2GVYA 1JNEA 2CITA 2GOKA 4MAZA 5H1WA 3VTRA 1NH6A 3BJSA 3GDMA 2YLLA 3AZTA 3VCNA 2BX7A 3WN6A 4ACZB 4AQLA 1K6WA 1V3MA 1CXHA 4NAEA 3EZ4A 1D8CA 1VBUA 3WDPP 1YTEA 3N6JA 3T7VA 1CW2A 2HE5A 1GNXA 4XTDA 7REQB 3PULA 3AYRA 1E71M 3LPOA 1O7AA 3W7IA 2D24A 1ONWA 4QQUA 2VEFA 1IQ8A 1O66A 1YPFA 5CJMA 2ZX7A 3CU2A 3C4UA 3WJXA 4PEEA 5I07A 2AKMA 1SZGA 1OC6A 3L0GA 4CLMA 1ITCA 4ZOEA 6TIMA 3I7QA 3UWWA 3CHEA 3TQVA 1FHUA 3HV9A 3BCDA 5A94A 1J10A 1H5VA 7ODCA 4HZ8A 4HD5A 4YWIA 1M3UA 4XD5A 1TRDA 4JN7A 4WDWA 3GZ3A 2PAJA 3SCTA 3H2MA 3OBEA 3BLEA 4ASTA 4EAMA 3BW2A 4HTBA 4YVPA 4F8XA 1EOMA 1TX2A 3FYYA 1I0DA 4E8CA 3ZR6A 1ZTVA 1AZ2A 3RPTA 1JZ7A 5CSYA 1QI3A 3VNDA 2J27A 3UG8A 1F4HA 2W79A 4W89A 1EEXA 4XD3A 3GXNA 4B5SA 2CFFA 1LL7A 3M1ZA 4GRSA 1J96A 2PFHA 1GUVA 1OGBA 1NFBA 1FX6A 3BGGA 4CD7A 4U3AA 2C18A 3ZT6A 1C29A 4PMQA 1LLZA 3AO0A 5FL1A 4GE8A 3G0SA 1YNPA 1HKWA 4XO6A 1GVSA 2GYIA 1XH1A 2VZOA 4O13A 1YBQA 1J93A 1U30A 1HNYA 3IGXA 3W1MA 3ME3A 4C6EA 5C71A 4NAFA 5PTDA 2RAGA 2QT3A 1W5PA 4DX3A 3RM4A 4AD4A 3NZGA 2A5HA 1X7IA 3W7CA 1VFSA 1E3ZA 2R6OA 1UP0A 4W5UA 4HPNA 1XM3A 1O1HA 5FJUA 2EPKX 1B5TA 2XH7A 4YL2A 5CSUA 3G1DA 4E4PA 1S39A 3R4IA 5G5IA 3I6RA 3WLRA 1BG4A 4A2SA 1R85A 2NT0A 4HSOA 2RKXA 4YTTA 1S5WA 1US0A 3BG5A 5AHMA 2FZ8A 3LQLA 3R0KA 4NYYA 3EMQA 4K7YA 4AMAA 3AIQA 3N2XA 4I7WA 5AYYA 1QOPA 3QLLA 1HQTA 3NJ3A 3GX9A 1OFBA 2CKSA 4OBRA 3N9RA 3SFKA 4YTSA 2NQ9A 5DMNA 4A35A 4YXGA 4QP0A 4RK8A 2WC3A 4MUZA 1W5OA 2G97A 5BWAA 1VJIA 1ECQA 3BUVA 4A2RA 1N8WA 2DVUA 4H7CA 2OX4A 1E40A 2BHYA 2VI0A 3H23A 3BAYA 2X2GA 2KX9A 2VC6A 5F2IA 4BKNA 1I8JA 4HMDA 3LTSA 1E1CB 4HVXA 1TMLA 1MXDA 4TIMA 2XISA 2YA1A 4GY1A 2PD9A 4WD0A 3V3WA 1GK8A 4HNNA 3WL1A 5C7HA 3L9CA 4A6GA 3NQ8A 2Q02A 2VD8A 3W1RA 3CH9A 1REQB 3K30A 1F61A 1Z9AA 1FTXA 2CXGA 4JTTA 3PPGA 3UGVA 1MRAA 3SM0A 3DBNA 1LTDA 3JU2A 2VELA 3CIVA 4XIAA 3RHGA 4IPIA 1BSIA 2XVPA 3W76A 3H2OA 2P76A 1GOWA 2PPGA 4PRRA 1QHZA 3AOFA 1LUCA 1SSGA 2FQIA 4O53A 2WLYA 3I7SA 3ELFA 4YYCA 2KAUC 2DP3A 2VQUA 1KQYA 1IF2A 5A2CA 3SI9A 2XH0A 2Z1KA 1AK5A 3KL3A 4QEEA 3I3EA 3IRSA 3AROA 4MUPA 2CBIA 3P61A 3L12A 1V51A 1X1OA 4O1FA 3BLFA 1MXGA 1RP9A 4HK7A 4HU3A 1AL8A 1PVNA 1W1A1 4L5ZA 3G1FA 2PDBA 3Q94A 1UWQA 1ECEA 1KBBA 2WVVB 4PGLA 3QYSA 4KF1A 1KBJA 3P93A 1SJAA 2JKEA 4AYSA 1E6NA 3EA1A 9CGTA 2PP3A 3QZ6A 2QJHA 2XGIA 1TQJA 4MHBA 3AIUA 4MJZA 2WJEA 5HULA 4U10A 4FNUA 4JTEA 2IQTA 4I3GA 3STFA 3S9ZA 4LBSA 1FWJC 4QS6A 2OQHA 2Z7GA 2WVTA 5IRPA 2PDXA 4S3GA 1KFJA 1LORA 3VX1A 1H62A 4LAOA 3OIHA 3MVIA 1AW1A 3VVGA 2X41A 5GJMA 2D20A 4LH8A 2XIBA 5DRIA 1OK6A 3OHMB 3SGZA 4HPHA 1PX8A 1G4EA 2Q71A 3BOLA 1BKHA 3KVMA 4RNHA 1DJXA 3U3HA 2HK0A 2J66A 1AD4A 2PLKA 1CI1A 3H2EA 1UR3M 4NHVA 2ZC1A 3M7SA 4O14A 3DFHA 3HQOA 3O0FA 2VEKA 4RJEA 2A7PA 1K9TA 4E8DA 3BWWA 4FLRA 4I5UA 4POCA 3GVVA 2YSWA 1GJUA 1XLMA 3W2LA 3SCRA 1MDLA 4JFUA 2ZE3A 1CLVA 1K8ZA 4HT3A 1VEOA 3OPSA 4PBEA 2PP1A 1QAPA 2HSAA 2GPTA 2JBMA 4CNTA 3THDA 2DDXA 3W2MA 3HQPA 1W3IA 1I75A 4FZIA 5F2MA 2RJGA 3EOOA 2VNCA 4AAJA 2A3BA 1TPH1 5A6BD 1J6PA 1XD1A 4JZ5A 5FAJA 1CLKA 2IPGA 4H9TA 3CUJA 4UTJA 2DZXA 3IIPA 3A9IA 5LHEA 4LS0A 1P48A 3GBDA 3W27A 3FEQA 3UBPC 4F0RA 1E9ZB 1VHCA 2QVNA 3PWAA 3B8SA 3M5XA 4CCCA 3QOKA 1TX0A 1I2NA 5CBIA 4EKJA 3TH6A 1ADDA 3OJGA 3SZ8A 3F1QA 1KCZA 1KM4A 4NZJA 4QG8A 4ROPA 1B57A 1T5AA 1PJ9A 3EDJA 4WRHA 1OBAA 4K39A 4AY1A 1JCYA 1ISZA 2DFAA 3CYVA 2I57A 3RXZA 4RZ6A 2E25A 4IGHA 2HE8A 1PBGA 2VFHA 2OKOA 3GK0A 2PGEA 2TSYA 4ZB2A 5M1TA 3RNDA 1ZENA 2H8ZA 4I9MA 1F8IA 3EWZA 1BVWA 4IMEA 1C7SA 4CQCA 1H11A 1V08A 4BEQA 3PZUA 1KFWA 1SUXA 4CU8A 4RCXA 3DHDA 4HA1A 3PM6A 3S83A 4V28A 2C16A 1XIBA 3UJFA 1V6XA 4RDZA 4FAMA 3GDKA 2V68A 1EJVC 2NX3A 5GNZA 3PS7A 1XYMA 2XWEA 4PN2A 5B7YA 5EMJA 4OBTA 3WZ0E 3V5FA 2TYSA 3SUWA 1ZCOA 1LWIA 4GBUA 2GOUA 1OFAA 3AQUA 1SFTA 5D9MA 4RUBA 1NP2A 4GI9A 1FFRA 1JD7A 4ERIA 1QU4A 5CZ0A 1WDPA 2PDQA 1KC7A 1A5MC 1GOQA 3A23A 3ZIZA 5IBXC 3UWEA 3W53A 3TUUA 4OJYA 2HS8A 4DJFC 4GUJA 2O56A 4NZ3A 1W2PA 3M5ZA 3VNYA 2DZAA 5HR6A 1GJPA 3L4UA 4C91A 3W1PA 2QLYA 1PDZA 2HQAA 2WPBA 2A79A 3CHVA 4PA8A 5BOOA 1BYAA 2OXNA 4DO5A 3SEPA 4TVUA 3W07A 3WQCA 6A3HA 4FALA 3PZQA 1YXCA 5A8PA 4LF2A 2X0SA 3FSUA 3OVRA 3AU2A 4PH6A 2YW4A 5LSMA 5I02A 4NNBA 3FN9A 1S2TA 4Q4MA 1LCOA 4XZMX 1HL2A 1UKQA 3KRZA 2VEGA 2OB3A 2DV0A 1E4NA 2IPJA 3DFNA 2UV8G 5T9BG 2O92A 4KMQA 4DPQA 3AIEA 3TC6A 2Y24A 4MJMA 2QUTA 2ZX6A 3E5BA 4L9XA 4E2OA 2QUNA 4BI7A 1A5SA 5M17A 3TN5A 4JX6A 1OGSA 3BLIA 4H8NA 2F8QA 3BAIA 5AC5A 1K6AA 5D9NA 4A4AA 3ATZA 2VEPA 1RK6A 1ZCCA 4V1YA 5HWJA 3W23A 2VZVA 2AQOA 4A3HA 5DT5A 3VKKA 2YBVA 2BY2A 1J6OA 1F9CA 1AUSL 4Y6GA 2G3NA 4WHBA 4IQEA 4P2VA 2J7EA 2EG8A 1Q6CA 5FEWA 2XWDA 4E4FA 4K8HA 5CJ5A 1M6JA 1E5JA 3PZIA 4UUIA 1CX9A 3HO8A 1GPWA 1BPLB 2CESA 1RLCL 4AZCA 4F9DA 4IIFA 3QV6A 3OQEA 4A8IA 1YNYA 1W0MA 1Q6LA 3TYBA 3T55A 5GJNA 1XS2A 4LUJA 2EPNA 3CZLA 1WKDA 4QE5A 3VU2A 4D6EA 2Z29A 1DWJM 2GQAA 3LXAA 3WNLA 5DY2A 4LV9A 2ZWZA 4FO4A 2J7GA 1V6WA 1XH0A 3LU2A 1NWRA 4PTMA 1BYCA 3LZ3A 3C56A 3ARWA 3AZSA 1V3LA 1TCDA 4UBPC 3WQ4A 1ZALA 4MLJA 5DCDA 5JBFA 2XM1A 4FIQA 1R9XA 5FACA 2DU2A 1DJZA 3IJ8A 5F1VA 3W6YA 2FFIA 5LHFA 3HGJA 3GD6A 4WDTA 3WBAA 2WB5A 3TA6A 4AX7A 2YDQA 3G3MA 4ZE4A 3K4AA 1UROA 4MYAA 4KESA 1Z44A 3MI3A 4UTHA 4O8AA 2E5DA 3VNJA 1GT8A 2INZA 5HUPA 2XINA 2QCGA 1B30A 2GZXA 2BASA 3URAA 1I1XA 1F7BA 1V6YA 1GKQA 1HJQA 4DO4A 4FR6A 1MSSA 4D6IA 3L4VA 1ALDA 2Z7KA 1ZU8A 3HN3A 5LGXA 3URBA 2AMGA 1M65A 3CC1A 1G4PA 3GKAA 2BLEA 3GNXA 4JNZA 3LCWA 5C70A 3FYPA 3VAVA 4HHHA 4Q7NA 5D02A 4Q4RA 2J13A 4FLQA 1LQ2A 1OC7A 4Q8NA 3ZT5A 1TV3A 3NQBA 4H6KA 4F0MA 2PMQA 3RITA 3AWNA 5ABEA 2FH6A 4I9AA 4NQ1A 4UR7A 1OCQA 1GHRA 2XJ7A 1DXEA 4TO8A 4HCHA 4DBUA 3LEPA 4H01A 2PDLA 4JTUA 4DO6A 2CC0A 5E1QA 4NZ5A 4R9XA 3T81A 4ATDA 4C6OA 1MDRA 2PTYA 1Q7QA 1XSKA 1WUEA 1QI2A 4D72A 4JTKA 1GVIA 1TVPA 4JTCA 3SSZA 2AAMA 2E28A 1JI2A 1L8PA 2VCAA 5D8WA 1BYBA 2NQZA 4BHYA 1R5YA 1OT1A 4F0LA 4NAEB 3V18A 3STCA 2QMKA 5LYRA 1B3WA 3SURA 3IGSA 3DECA 2C71A 1UMYA 2WWCA 3CJPA 4DN1A 3WLKX 4NASA 3W81A 3KHDA 3R58A 5CKSA 3SR7A 4L4LA 1QNPA 3W6LA 4LWWA 2DH2A 3I4KA 3UYIA 2XGZA 5FJIA 3AYSA 2QCEA 4KWVA 4CU7A 2VDGA 1D8WA 1AQFA 2OSXA 4D6HA 1QT1A 4GC3A 4V15A 4PB4A 4J3WA 1W1YA 2OKTA 5ABHA 5HOSA 3TQKA 3FOKA 4UTFA 4GYFA 3R7MA 4LX4A 1YDNA 3GE7A 4HNTA 3TE9A 5LZLA 5BXTA 2POZA 4C60A 1KBIA 1PEZA 4IPNB 4IL2A 1XYZA 4Z08A 2V67A 1V3JA 4YTQA 2QKFA 1IZCA 1U5VA 4MNMA 2D23A 2J75A 4HYVA 1FBAA 4PL1A 1XIMA 4LB3A 3VIJA 1SMDA 5DO8A 1GORA 3MP4A 1C9WA 1KWGA 1OEPA 2X30A 4JAWA 3RRAA 1F8MA 5MHBA 4H2CA 4HA4A 3GNDA 2NXGA 1ZS2A 4OECA 5K9CA 5AOUA 1M68A 4DNHA 2PCQA 1XLJA 2JE8A 3TSMA 1K70A 2FHBA 3N4EA 4YHGA 1WX0A 3LA4A 2OQYA 1RBOB 4W4QA 2DZUA 4CN4A 2QR6A 3CIWA 2D2HA 4V2XA 2VRJA 4YTUA 4Z0SA 3G1SA 3A64A 2PDGA 3CT7A 1JIBA 1B31A 1X39A 2QPSA 4DUWA 1R2RA 3NM1A 2WM0A 1F74A 1E0VA 4ZA0A 4J2PA 4PRWA 2WYSA 3SY8A 1QPNA 1XG4A 4RDYA 4XAYA 1FWWA 2PU1A 4G5DA 4UOJA 3LCXA 3MP5A 2E8YA 1JF5A 3LLXA 4WR3A 3PWGA 3SIMA 5J04A 3AXIA 4AY8A 3M0ZA 3BG9A 2GVJA 1ISXA 1W8SA 3UR8A 1G7UA 3VZZA 1MQRA 1C8YA 2ODOA 2ESCA 3NQAA 4HU4A 3GSMA 5AY7A 4C1NA 1ISWA 3P81A 3CEUA 2PRLA 3GUWA 4DWSC 1LLWA 3BARA 2DZBA 2MANA 2OZ0A 3MCMA 1LWHA 6XIMA 2P50A 3VOIA 5K4ZA 4B5VA 4DNMA 4KW2A 5H8MA 3HFTA 3L2IA 4IOTA 4O8RA 2A2IA 1KTNA 2P0OA 3EOLA 3WYZA 3GM8A 3WK0A 3UCQA 1CXIA 2PGWA 1JYWA 3SQMA 3UJSA 3FS2A 4QJ1A 2QJIA 3IJDA 3C2VA 1SGJA 2W9MA 3TNOA 4RXFA 2G5WA 4GUIA 3T8QA 2QJNA 2G8ZA 4MNJA 5IDZA 2IMRA 3G1AA 3LNMA 7A3HA 2X7WA 2UY3A 3ABOA 2QIIA 1MZHA 4MPQA 3U4AA 2QCDB 9RUBA 3R11A 2PZNA 4L56A 3BURA 4PMJA 1A5OC 5HJYA 5CPSA 4HMCA 2QQ6A 4Z0JA 5AB3A 1ITQA 1X38A 4MDPA 4QDWA 3DFQA 4H9ZA 1WPCA 5A95A 3BOFA 3TXVA 4QDMA 2WC7A 3N73A 3QV7A 3SFWA 2ABAA 2DT1A 4GUHA 3GH4A 1ZL1A 1VLWA 2R9RA 4LS2A 2DJXA 4DWSA 4BFAA 1ISYA 1XDJA 1Z89A 3QPZA 3CASA 3VOGA 4O0ZA 4QNEA 3EX6A 3ARTA 4MZ1A 4FI4A 4TU1A 1WZKA 1YW1A 1U1HA 3JVAA 1QXLA 2VR5A 1JDDA 2P5NA 1O5KA 3K8MA 1OFOA 1QATA 4Y9PA 4UB9A 1FWDC 2X1SA 4G1KA 5CG0A 1K9DA 5CEWA 5DBUA 3EX1A 2A3HA 3E02A 1SZRA 3AU6A 3VK5A 2HVNA 3E1F1 1XF0A 2FYMA 3W37A 4OGZA 3MO4A 4IJRA 1EWEA 4GNJA 3DUGA 3SO7A 5CPNA 1JPMA 3PFMA 1LBLA 1CXKA 1WDRA 3G1RA 4LC8A 5I5RA 3EOUA 3U48A 3FKRA 3NQFA 1Q3NA 2FVLA 3UWYA 3NFUA 4B5WA 1J9YA 4UTKA 3T9PA 3NQGA 3NAVA 3VCRA 3MKCA 3AS0A 1C92A 1BQCA 4S3AA 3URNA 3W7DA 3V1HA 4PTNA 3HIJA 1B3YA 1GVEA 5A6KA 4R33A 3WQGA 3PC0A 1HP4A 1LRTA 1PYFA 3RO8A 4K8GA 4O19A 3SGGA 1QCWA 2ZXAA 2J74A 1OIMA 2XUCA 4QLJA 1B3OA 3VDCA 2QPUA 2WMGA 2O4QA 2RDWA 1DQWA 2JFEX 4U5IA 4NXKA 4EP8C 1T6MA 5IM51 3SRDA 4C7GA 3NWRA 4QAWA 5T8GA 3RCNA 3ZWSA 3MDUA 3HMCA 4UQEA 4M0XA 1PX3A 1TPDA 3ISIX 5D2WA 3W00A 2F2HA 1K8CA 3PSVA 4HNVA 4W84A 3G77A 2DZTA 4KEMA 2OEMA 3WF3A 1QMLA 1GOXA 3HQ1A 3WMCA 5BMWA 1SQ7A 3VGFA 3KDOA 1GZGA 4MFDA 2NVDA 1GKPA 2CHOA 3LN3A 1HP5A 2ZX8A 4OV4A 3JS3A 4H6EA 1QI4A 5E6ZA 4DWDA 2DT2A 3CZEA 1K7EA 3N1AA 3NTYA 2BY3A 1H1YA 3WFLA 2H6RA 3UWUA 5EMLA 1L6GA 4I8DA 1RUSA 2QCHA 4MY9A 1PTGA 2ZXBA 4OZOA 1YTKA 1LM1A 4L6DA 1QPKA 2WHJA 2HISA 2QGHA 1CNVA 4ZOBA 1TJRA 1JVNA 2ZXDA 4NYUA 3DGBA 1A5NC 2NQ5A 3TR2A 4F2BA 4Z2IA 1W9UA 4JR5A 3W38A 2PDJA 4AVFA 5CBJA 4FIRA 3IARA 3E0VA 2OR2A 3A24A 4A21A 1XSJA 1GOMA 3LCFA 3BGJA 1NJJA 5LNUA 4JTFA 5EFFA 3WD2A 1TUXA 3NL5A 2XZ9A 3CHCA 3GU1A 3OLEA 1X6NA 2NLYA 2OT1A 3S42A 3FKKA 2CEQA 1H7RA 5AZ0A 1WBJA 1ZAJA 5BOFA 1CWYA 2CBVA 4O0QA 3HF3A 3CS2A 4MZ8A 1XDMA 5A8OA 4XZHA 3P8IA 4E38A 1T96A 5D2XA 1F3EA 3GH7A 1V77A 4XAFA 5XIMA 2Y7DA 3SCUA 3LCLA 2C1IA 4WLCA 2VVNA 3NDOA 1THFD 2EGZA 3WO8A 3I6TA 2NSXA 3M7WA 4BJHA 1Z8AA 3HU7A 4UTWC 3WJZA 4US5D 2VZSA 2WO5A 1QPRA 3T08A 6XIAA 3UZXA 1MEHA 3SJNA 4R85A 3WUFA 2V0TA 3SGUA 3IV3A 1BG9A 8CGTA 5BXSA 3VMNA 3R0DA 4C1KA 3JUGA 1X8CA 2C0HA 1ZFJA 4ATLA 2OQLA 1W1ZA 4EXBA 5HPOA 4GYPA 3EXTA 4LUSA 2PURA 4IF2A 3TN6A 1WAUA 3VKJA 2ANUA 4ZEPA 1KA9F 1OABA 4XD4A 4EVZA 4JQ1A 3TFXA 4PR4A 1P0BA 5CC6A 1VH7A 4YTRA 2VURA 1SVDA 3J7HA 1NIUA 3H22A 2ATMA 2DUAA 4AB4A 4CD8A 3TLLA 1VAHA 5I3DA 4Q8PA 2RHGA 5HAOA 2WC4A 1EKOA 3SY5A 4L64A 3WSUA 1GTHA 4G56A 2UY4A 3TONA 2OLSA 3GVQA 2VUYA 2FZMA 1H7NA 3PJXA 4LV4A 3GVWA 4XZNX 4YHEA 1W9DM 3OYZA 3Q58A 2ACSA 1X1ZA 3GC2A 1TV5A 4JEQA 3AIRA 2AGTA 3AALA 2AGKA 3H2NA 4XZIA 4KFOA 1XPGA 3UGRA 3LDVA 3GTNA 3VNLA 1BXCA 3N15A 3CB3A 1TJ2A 4PMVA 2RGMA 3N9KA 3W7GA 1O95A 1H7XA 3IUIA 4H8UA 1T0OA 3TYAA 4ZR8A 2QAFA 1A5LC 5DFAA 4MKNA 4WDXA 3BLLA 4M51A 2BOFX 4E2BA 3RF9A 4DZ5A 3WNKA 3SCVA 4F2TA 1TPB1 2PRHA 4PC8A 5DEZA 3TEVA 3TN4A 3LLFA 4HNLA 4B5TA 2J62A 1EL3A 3JZEA 2O7QA 5A6JA 2FB3A 3QW3A 4QDPA 4QJ3B 3B8VA 1DP0A 4H8HA 4GO9A 1GQLA 2OYMA 1R7OA 4PULA 2V5BA 3QZEA 3KZPA 3TYCA 4GABA 2GJLA 1NOFA 2VWSA 1H2JA 4CN6A 4LUTA 1FY6A 2FPTA 4UCGA 3B06A 4GQGA 3KRSA 1U33A 1MEWA 1UC4A 4Q32A 5CSRA 4LVBA 2VFGA 2W61A 2FJUB 2E8ZA 4IIDA 4M29A 5LIUX 5F4WA 1R3RA 1VKFA 1UR9A 3BZJA 3PK7A 4JIQA 3S0CA 5LIYX 4IGMA 3SB0A 1XXXA 1PWMA 5FEPA 1VS1A 3CGTA 4Y2WA 2YDAA 4DAIA 4Q8QA 3GFXA 2ZX5A 3TTQA 3TA9A 2FZ9A 4ZZ9A 2ZVIA 3B9DA 4M24A 4IMAA 5EMYA 1XYFA 3W7MA 3KW3A 3CL6A 2W67A 2JIEA 2P1FA 5EKYA 3FY1A 1N8FA 1LL6A 1IZJA 2PWUA 4JL1A 4AZ7A 5CCZA 3P0XA 1X6LA 1DIDA 3W7LA 4JTGA 1HZYA 4D8LA 1W1TA 3A4JA 2XZ7A 4FHAA 4IFRA 3KLLA 1OK4A 1UOKA 1MW0A 4HGXA 4UMAA 1EX5A 2IQ0A 3IWPA 1R47A 1H4PA 2VENA 2Y1HA 1HF6A 4PCFA 1MVYA 3WIJA 1BD0A 4H00A 1JUEA 1BTMA 3QH2A 4UTTC 1Q66A 3VIMA 1NFPA 1AVAA 4C6BA 1R30A 3N2TA 5HMSA 5LA0A 4M81A 3O05A 4ZOCA 2B0MA 3M0VA 4HP5A 4NF7A 1NAL1 5D2TA 3ITCA 1B3ZA 3ZLFA 3CEPA 4W85A 1FP8A 5I0DA 1R9ZA 4CD6A 4MB4A 1T8XA 1ODZA 1FWFC 1VQTA 1A0EA 1ZB5A 2FGBA 2Y63A 1GEQA 1QBBA 2V5CA 1BGGA 3ES7A 2ZCGA 1GOIA 1PTDA 2ZC8A 1P4CA 2PCEA 1W3LA 3UD6A 3GG7A 3KDNA 4U3CA 1JNDA 1XC4A 2YB1A 4BWLA 3G2GA 1KLYA 2E9BA 3GIQA 1U5JA 3KVKA 2ZRXA 3KHJA 2BWGA 3WH7A 3QY7A 1XRSA 1EO5A 4U33A 4GIRA 4QRNA 1US3A 1SPQA 1DJNA 4GZEA 4X61A 2IXVA 2ZBTA 3EA3A 4C7FA 1W9PA 4NJGA 2ZWYA 4XD6A 2VVSA 1P6CA 2NSOA 3C2RA 2FHCA 3SUTA 4CQ9A 4MG4A 5FIPA 1DJHA 3LRMA 3WEZA 3ZVHA 3RU6A 3KE0A 2YFOA 2VEMA 4LW7A 3TWAA 1UA3A 4A3RA 1H5YA 1WE5A 2QIWA 4IZGA 2GVGA 2Y0FA 2PUZA 3C2OA 3VIIA 4O1AA 4H9YA 5LA2A 1PIIA 3G1VA 2DQXA 5C9WA 5DXXA 3UG5A 5I3GA 2E09A 1WKYA 2CU0A 3VE7A 2A3CA 4TV5A 1U83A 1CCWB 3W29A 4TX9A 1K03A 1JXJA 1WKEA 1OCBA 3JRKA 4DM1A 1VPQA 3F5JA 1X1NA 3G22A 3F4WA 3T2QA 2JEQA 3GW3A 1R2TA 1DJWA 4W86A 4ADUA 3WH5A 4KEUA 2BMBA 2ZUMA 4JKMA 1V6UA 3N13A 1GCYA 3SUVA 4N6FA 4JKLA 3W4RA 1JZ6A 2Y70A 3P67A 3TWBA 1CXLA 1PZ0A 2WMKA 4MJ4A 1EPXA 2A85A 3DCPA 2C19A 4R27A 3ZR4A 2NUWA 3WQVA 3LI1A 2GK1B 3U5UA 1IT7A 1W3HA 2NVAA 3MC5A 3UF9A 1DORA 4L9ZA 1ADOA 3CMGA 4F4RA 1FOBA 3VOJA 1WKFA 3GDTA 4UOZA 1TTIA 4U31A 3GLCA 5CH9A 4LALA 3DFTA 4B3ZA 3M0YA 1Q4NX 3KCJA 2PF8A 1WZLA 2VDIA 3QLDA 4H9XA 2ACUA 1B9ZA 3AUOA 4MB1A 4QE1A 3S2MA 2CCRA 5BRBA 5CLWA 3S2CA 1DIKA 2V81A 4DEFA 1SM9A 4MPKA 2E3ZA 1KD0A 3S1VA 5CPLA 1V0KA 3VI2A 4H1ZA 4QNWA 3STEA 1BLIA 4YMZA 2DZWA 1NU5A 2XYLA 2H8XA 2DIJA 1YXYA 1UQYA 1VD6A 5I3IA 3NQMA 4RPQA 1H1NA 3KOXA 4F40A 3W24A 1WQ5A 3VOCA 1F3TA 1HO1A 1BFNA 3GH5A 3LPPA 4AD3A 3TP4A 3T0DA 3GQYA 1G5AA 1OX5A 3IVTA 1M04A 1MI3A 1BWVA 1S46A 2PP0A 3DYPA 4HMNA 1CGYA 3EWUA 1YPIA 3ZT7A 3W25A 2PD5A 4GCXA 1IXOA 5AC7A 2JALA 3EWCA 4LUTB 3QJAA 4JFSA 3S1WA 2P53A 3PVFA 1WO2A 4HMEA 3APTA 1EJUC 3CUXA 5IFTA 3K1DA 3LCIA 4FK9A 3IRDA 5FL0A 2GDUA 4ICMA 1QFEA 3VGEA 1Q6EA 4LVGA 1L6WA 3RX4A 4GX9A 4GZ7A 3U2ZA 5HQLA 4MB5A 4HU0A 4NJIA 3QYQA 1I0BA 4B2DA 2VC7A 1V7YA 1FDZA 4Q7BA 1X8FA 3NZ1A 2JEPA 2NQHA 4HB7A 2V3EA 4FR1A 1JJKA 3KFTA 1POJA 3FV9A 1E4LA 1V0NA 3K4DA 2BY0A 3TTYA 2EKCA 1WXZA 1B3XA 1VYSX 3F03K 5E0KA 4TX6A 3RX2A 1A4LA 1S2WA 3ICJA 3WLSA 2NLIA 3VINA 4OWGA 8A3HA 3CZGA 4AEOA 2HCVA 3GDLA 3KEHA 2NV2A 1PHWA 4C6JA 3ATYA 2XGBA 2XN1A 1W9VA 4ZOAA 1UWSA 1Z7AA 4XQ6A 3WJWA 1N55A 1KGXA 1FXQA 6ALDA 2EXOA 3L4YA 3RR4A 3N6HA 4KS0A 4M7TA 3G5EA 2EPOA 1EF3A 4IIHA 2HNHA 1JYVA 4NAFB 2NQJA 1L0PA 2G0WA 3L0KA 3FYOA 3W84A 3NO3A 3W0KA 2I9EA 1WXYA 5G2HA 3MO7A 1GOOA 4F0KA 3QY6A 3AS1A 5I3JA 2OX1A 3Q67A 3VGHA 2I14A 4Q4OA 2A4AA 3BJTA 2DZVA 3GZAA 4L1XA 2FZBA 2GSHA 4P8XA 5T9CE 1TPWA 3I65A 2IKIA 5JVLA 2PSNA 5LIWX 4GIYA 5EGRA 3E0FA 3P82A 2F38A 1OZMA 1S2CA 2H3DA 2WCGA 4O54A 1HL8A 3GNRA 3UXKA 1YDYA 3I68A 2VTFA 3BQ5A 2QCLA 3TYEA 2J9YA 3RAOA 2XHYA 3AICA 2YA0A 4LS1A 2R1LA 2VL4A 3WDQA 1L6FA 3NOEA 3VILA 5CBBA 4D1JA 1FWEC 1LBMA 3GHSA 3R1ZA 1K1DA 1PAMA 1XIGA 2YLAA 1F6YA 1GQIA 1F2JA 2YL6A 3OW1A 4HCDA 1VIZA 2O9RA 5EL1A 4AIUA 1TKKA 2HK1A 3WBXA 2RH9A 2ZRWA 4R7OA 3OG3A 3MMDA 3T4WA 4YN5A 4UQAA 3TNBA 4C6NA 5HXMA 3QXBA 2QJGA 3WQDA 1WDQA 3QEZA 1WAWA 1V02E 5K4XA 2ALRA 3Q45A 1CLXA 3PZVA 3L4TA 4GYPC 5IFPA 2V8ZA 4J40A 2GVEA 3ARUA 3CWOX 4Y8FA 4ZQOA 2BXZA 4GVGA 4JFTA 4XZLX 2WJDA 1FWGC 5DXYA 4O1EA 1QW8A 1DJIA 3VGDA 3HV8A 4JIHA 3LTPA 4JIIX 1XLLA 2NWSA 5MKGB 2EG6A 2I16A 5HR7A 4PB5A 1I2OA 1XI3A 3B0VC 3BW4A 1W9BM 2BVDA 4A05A 3PUOA 4YJ5A 3M16A 1S3TC 2V30A 1P7TA 2YDRA 1XINA 1M53A 5XINA 5CZSA 1V02A 3PWIA 1FWSA 1ZUAX 3HMJG 1VPXA 1UB3A 3IPWA 3PZMA 4F9JA 3QQWA 3KVLA 3P80A 1PL9A 2A3LA 4X60A 1SSDA 4JTLA 2BV9A 3VDBA 3IVUA 4PMUA 2R14A 3QSTA 4XVDA 3VNZA 4QR6A 4GLEA 1NDVA 1P6BA 3SN0A 1A5UA 1J0IA 1UMLA 3GRIA 4HSNA 1PV8A 4HA0A 3UPMA 1SR9A 4LCRA 3PZTA 4LYQA 4AC1X 3EGJA 2W3ZA 2DZSA 3NR0A 4LUYA 4PBGA 3CHFA 5FCZA 1UD6A 1NDWA 2ZE0A 4DJFD 4ZSUA 2GSJA 1W6TA 2OELA 2F6UA 2NX9A 3LI0A 3VIKA 1J01A 1D3CA 1U1JA 4XKMA 4MKSA 1TE6A 1E0XA 3DHFA 1OG0A 1EP1A 3MQTA 2ISDA 3F2CA 2W62A 3I7RA 1UD5A 4XB3A 2PDWA 2YYTA 1WDDA 1QNQA 2ZZ4A 1DWAM 3E5PA 3H8AA 3PJWA 2PDYA 3NQ2A 3ARXA 1Y65A 1R86A 1TWDA 4TX8A 1QHPA 3SCNA 1AJ0A 4XKYA 3R12A 4MF4A 5CSSA 3MHGA 3WBWA 1WZMA 4J3ZA 3DOPA 1EIBA 2QMJA 3WK2A 2PODA 4P7RA 2QUMA 4JD4A 3NYDA 4W7UA 4E5TA 4W7WA 3UPBA 4QXIA 5JUVA 3MHUA 3DFYA 1M7OA 4JQAA 1CT5A 1OSEA 2PLJA 4WKFA 2R24A 2SFPA 5ECVA 3RUBL 2AL2A 3C52A 4HTYA 4WGXA 1G1YA 2OU4A 1DJYA 1Q6OA 3ZLHA 1UASA 3GU9A 1KRMA 1S3HA 8XIMA 5I6SA 3MCOA 1PS9A 1KR1A 1YADA 4Q3MA 3RJXA 1O5RA 3AJ7A 1XRVA 3HBLA 4B4FA 1MFVA 4IFOA 4DXKA 2X1TA 4AEFA 5J5RA 2VP8A 1J0KA 1NP0A 1IIGA 2HEJA 4DBEA 3R79A 4O15A 4LU0A 4CCEA 3AXHA 4JTAA 3WJYA 3QVQA 4Z2HA 1ZP3A 4UTTA 2QV4A 1OD0A 4A3QA 1DTUA 4M1RA 4PFHA 2O9OA 4L6OA 1CTNA 1FCQA 3WQ5A 3OBAA 3QMSA 2QW5A 2WKJA 5LXXA 1EP3A 2XFWA 3PBVA 4UR9A 4EAYA 1A50A 3CQIA 2Y7GA 1W5NA 5EYWA 4PZVA 2B7OA 2VHLA 1AFSA 3UVIA 1H7PA 1XJBA 3GR8A 3PNZA 1AA1B 3BLDA 1LG1A 2X05A 3B8DA 3WLLA 4GACA 4BF5A 5C54A 1UR2A 1YMYA 1OFEA 1FH8A 4ZMGA 1YPXA 3G1XA 3QPEA 4GI4A 4DBSA 2EHHA 3S6DA 4NNAA 4B16A 2BVWA 3DENA 3EMZA 3UR2A 2PTXA 4NNCA 1OX4B 3EKLA 4JIEA 3PAJA 1C8VA 3WQOA 4LEQA 4X9YA 3AHZA 5I77A 2F6KA 3KBVA 4UTLA 3UP8A 4JTRA 1B54A 3C3NA 2XVLA 4ZBCA 3PBMA 1IR2A 3QV9A 1UD3A 2QF8A 3L23A 4GOAA 3QQ1A 4L61A 3V4BA 3E3HA 2CBJA 5GQBA 4OT7A 3VM7A 3AHYA 2EJ1A 4O0KA 1TJ1A 2OWWA 1Z6KA 3K46A 3QHMA 2CWNA 1UZ4A 2ZRYA 1XG3A 2WNZA 3B97A 3KBSA 2JK2A 3NPVA 3OZPA 1Q4WA 3RMEA 4E2VA 3RR1A 1O60A 4AFYA 3GB6A 4A3UA 4O4WA 1UP2A 4JTIA 4UNLA 2UY2A 2V3GA 3S1GA 3W2JA 5KTLA 3OEXA 3HJZA 4F48A 3B03A 2WSRA 4RNFA 1EIXA 1RZMA 4M82A 2WJZA 2NZLA 3LD5A 1NFGA 3G0XA 1MW2A 1WNOA 2Q3OA 3WQPA 5IHRA 4O11A 4QEHA 1TV4A 3OQ8A 4WJ8A 3MJMA 2Y62A 2VC5A 5C9UA 4ML9A 3MHFA 3NG3A 2W63A 3BAXA 3VUSA 4D8AA 3H2CA 5C9XA 1UBSA 1SZNA 5F4SA 1NWUA 4JHMA 2Q3RA 2PDPA 5AC6A 3MSGA 2DVTA 4PTWA 3WL0A 3NM3A 4NJHA 4OTKA 5LNSA 1BRLA 1SMAA 1EYEA 3VO0A 1LWJA 1X6UA 4WSKA 5K9DA 1TZ9A 3MUIA 2QGYA 1XLDA 3PPCA 4IP4A 4JHZA 4LCSA 2CZDA 4MDOA 3UVAA 2Z0IA 3TDFA 1V7AA 1RQEA 1R3SA 2Y89A 3H4XA 1DPMA 1VJSA 4MADA 4PUUA 1EHNA 4LF1A 4OUEA 1KFLA 2EJAA 4ICNA 2A3AA 1EWDA 1VFUA 4X3ZA 3S5SA 2C1GA 4JQ3A 3GHUA 1JG9A 1L6YA 3WD0A 5REQA 3SCWA 1A3HA 4ZODA 2OEJA 1MUMA 4LY8A 2EF9A 1RA5A 2I9UA 4QROA 1IYXA 1YRRA 1VC4A 3VIHA 1W3JA 1K4GA 3ITLA 1A5CA 1S2UA 2BODX 4Z2JA 1RH9A 1XHGA 4ZTYA 2PS2A 3RYSA 2V3FA 2XIQA 3MPGA 5ENLA 1VRDA 1PZ2A 3LPFA 4NT0A 2CZFA 3R8GA 1P7TB 3IV8A 6ENLA 1IEVA 3IK4A 5K7JA 1O12A 4WCJA 1WV2A 3VOFA 1A3XA 3AJXA 3BXWA 1G9HA 4PSPA 4REQB 2HBVA 2REQB 4RW5A 3CTTA 3MUAA 4CVWA 2G3JA 4C6LA 1EBHA 2B7QA 2OFJA 4W9TA 3CL8A 1TQXA 4KGJA 3GDRA 3ZVIA 4ALDA 1MUCA 4LTSA 2GGEA 4GA8A 5HJXA 3O07A 5HMEA 3W9ZA 1XLHA 4FLOA 1H0GA 3R25A 3BLOA 3AYVA 4GQBA 5DQPA 4KCWA 1BTCA 2PA6A 3W75A 4J3UA 4LAUA 4N9DA 3JZUA 1OQFA 3MV01 4Q8MA 1PO9A 1HO4A 2D22A 4QG9A 4G9PA 4ORMA 3SJ3A 4HZMA 3VZYA 4L4MA 4WJEA 5I79A 4HHPA 1HW6A 4HA3A 3WMSA 1I1WA 1PKNA 3B40A 4ZB0A 1RVKA 2CWXA 4H9MA 6CGTA 2G41A 1IZKA 1TCMA 4N42A 5D37A 3FK4A 3LY0A 4IGNA 4Z1YA 2QZRA 3ITGA 4UFMA 1RCXB 4LRSA 1E72M 3K1GA 1XLGA 4BS0A 1TWWA 3STGA 2R91A 3CH0A 2O7SA 2ABBA 5HWMA 1REQA 1FDYA 4Y9NA 2NW0A 2Z6IA 3ZWTA 5F2GA 3CAVA 2HPMA 3TQ0A 3UR7A 3GVGA 7ENLA 4H7ZA 1OB0A 4LXFA 2J24A 3CQKA 4R9OA 1C8QA 2DSUA 4RZBA 2ZA3A 2YBUA 2BDQA 1O6IA 4A8RA 5BCAA 1HJUA 2OT0A 3C6CA 3HPSA 3V5OA 4UFJA 3AHTA 4JIPA 4UFLA 3M0KA 2QCCA 1KM1A 1ZZMA 3QZAA 4GZJA 1S2VA 1S5NA 4DJED 2ZIDA 2J77A 3H70A 1XBYA 2RDXA 1S1PA 1CZ1A 1J2WA 3T8LA 5HMDA 3K5XA 3BLPX 3CPGA 4YVXA 4IWWA 3MUCA 2CETA 2QJMA 2BOGX 1SZFA 4BQ2A 2GGHA 3E6EA 3B9NA 4DRSA 1HT6A 3O3RA 4NUWA 3WG6A 2ZICA 5A8MA 1OJXA 3P5YA 5TAOA 1R3TA 4DHGA 4OE7A 4UXDA 2HTMA 1A5KC 1NQ6A 4XK2A 5FF3A 3DC8A 3AHXA 3N3TA 2ALDA 3QHOA 4JOMA 5A6SA 1IEWA 4K3ZA 4NX0A 4PUJA 3ZZ1A 2MUCA 4IIEA 3CB8A 4WVXA 1H09A 3MYPA 3WLMA 3THUA 5AKQA