4XIAA

Structures of d-xylose isomerase from arthrobacter strain b3728 containing the inhibitors xylitol and d-sorbitol at 2.5 angstroms and 2.3 angstroms resolution, respectively
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
393
structure length
393
Chain Sequence
b'VQPTPADHFTFGLWTVGWTGADPFGVATRANLDPVEAVHKLAELGAYGITFHDNDLIPFDATAAEREKILGDFNQALADTGLKVPMVTTNLFSHPVFKDGGFTSNDRSIRRFALAKVLHNIDLAAEMGAETFVMWGGREGSEYDGSKDLAAALDRMREGVDTAAGYIKDKGYNLRIALEPKPNEPRGDIFLPTVGHGLAFIEQLEHGDIVGLNPETGHEQMAGLNFTHGIAQALWAEKLFHIDLNGQRGIKYDQDLVFGHGDLTSAFFTVDLLENGFPNGGPKYTGPRHFDYKPSRTDGYDGVWDSAKANMSMYLLLKERALAFRADPEVQEAMKTSGVFELGETTLNAGESAADLMNDSASFAGFDAEAAAERNFAFIRLNQLAIEHLLGSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-XYLOSE ISOMERASE
publication title Structures of D-xylose isomerase from Arthrobacter strain B3728 containing the inhibitors xylitol and D-sorbitol at 2.5 A and 2.3 A resolution, respectively.
pubmed doi rcsb
source organism Arthrobacter sp.
molecule tags Isomerase(intramolecular oxidoreductase)
total genus 141
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 5.3.1.5: Xylose isomerase.
pdb deposition date 1989-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4xiaA00
1XLMA 4K1GA 3CQJA 2XISA 3KBVA 3VNMA 4QDWA 4GQBA 4XIMA 5B80A 3VNJA 4YTTA 4OVXA 2XIMA 3ITXA 3IUHA 3KBJA 3KCJA 2QULA 3KBNA 3KWSA 1XIBA 2QW5A 1S5MA 1XYAA 3C0LA 3KCOA 3NGFA 4GJJA 4GJIA 2NQJA 1XIIA 3BZGA 5EMKA 4G56A 4EACA 2GUBA 5EMJA 1XIJA 1XIFA 4KW2A 3JU2A 2NQHA 1YX1A 1XLAA 1A0DA 1XLDA 3ITOA 4XISA 8XIAA 3KBWA 3KTCA 3TVAA 3IUIA 1MUWA 1XP3A 2Q02A 3C0SA 4ZB2A 3VYLA 1QUMA 1S5NA 4XSMA 1XISA 1XLGA 1XLBA 1OADA 3WQOA 4A8NA 6XIAA 5AVHA 3CQKA 4PGLA 1MNZA 2GVEA 3CQIA 2XINA 5AVNA 2G4JA 3U3HA 4PFHA 1XIDA 3IUDA 3GNXA 1DE6A 1QTWA 2ZVRA 3AALA 3ITTA 4K3ZA 4ZB0A 5XIAA 3UA3A 4GLEA 3M0XA 4US6A 2ZDSA 3N4AA 4HGXA 1XLHA 1XLKA 5XIMA 4DUOA 3LMZA 4X60A 1CLKA 1DIDA 3QYSA 2GLKA 4XSLA 3VNIA 1XYCA 3BANA 3C0QA 4X61A 5B7ZA 3TC3A 4QE1A 5TNVA 3DX5A 4YTUA 1XICA 2QUMA 3BZJA 5C9ZA 3BDKA 4HHMA 2I56A 3KCLA 3FVMA 1I6NA 8XIMA 4HNOA 3UA4A 4YTSA 1XYLA 3VNKA 4Q7IA 1BXCA 1XYBA 5H6HA 3ITYA 3L23A 4QE4A 4ZB5A 3BWWA 1XLEA 4QEEA 5B7YA 1K77A 2NQ9A 2QUNA 3AAMA 3M0YA 3P6LA 1I60A 3XIMA 4LNCA 3AYTA 3CNYA 3QZAA 4QEHA 1QT1A 1D8WA 5XINA 1XINA 1XYMA 3P14A 1O1HA 2HK1A 4E3VA 1A0EA 3CWHA 2HK0A 4A8RA 3UXIA 5I7GA 5EMLA 1XLLA 1XLJA 2X7WA 3M0LA 2G0WA 4HHLA 1XIEA 3OBEA 4J4KA 3XINA 1XIGA 1XLIA 1BXBA 3UU0A 1XIHA 3ITVA 4A8IA 4X63A 3M0HA 4XKMA 4QDPA 3VNLA 5H1WA 3ITLA 3M0MA 3AYVA 2I57A 2HCVA 1XLCA 9XIMA 2GYIA 4ZBCA 1TZ9A 3KBMA 1DXIA 4EAYA 3UVAA 2X7VA 1A0CA 7XIMA 5J8LA 3U0HA 3DBNA 3QC0A 1XIMA 2OU4A 6XIMA 5FA5A 4W4QA 1XLFA 4YTQA 4DVOA 1GW9A 4YTRA 4QE5A 1DE5A 3M0VA 4A8LA 1DIEA 2J6VA 3QXBA 3XISA 9XIAA 5EMMA 3KBSA 3CQHA 4XIAA
chains in the Genus database with same CATH superfamily
1OD8A 5AC5A 4MJ4A 2GZXA 3GVGA 3APGA 4MMWA 1MYRA 1PPIA 4GX9A 1KM5A 5D02A 5IFTA 3N9RA 1RCXB 1W9XA 3NL5A 4JFTA 1KCLA 1F6KA 1LRTA 5DELA 1EDGA 3K8KA 2IQDA 2VUNA 4BF5A 1DJIA 4HCLA 4J3TA 5C9XA 4GYKA 3MVTA 3UFYA 2NX9A 2W27A 1TTIA 2FHFA 1OADA 5LXXA 3MT1A 1JXJA 3BARA 3UNTA 2GGGA 3P0WA 4TMCA 7A3HA 3F4NA 4BHYA 4JAWA 3L2IA 4Q4QA 1UC5A 2FQIA 3UYIA 4Q7BA 1M04A 1E0TA 1GEQA 3CPRA 1ZU8A 4O1DA 4FALA 4IQLA 5D2TA 3P5YA 2QUNA 1UB3A 1EJSC 2QIIA 5FF7A 3VNZA 2Q3OA 4IMDA 1V0LA 5CC7A 3SFKA 5C5YA 1Q2RA 1SO5A 2I9UA 3OU8A 3Q37A 3RO6A 2VUYA 1YTKA 4L4OA 2Y5JA 1ONXA 1J5SA 2XU2A 4AWEA 2QVNA 4B91A 2OVLA 3LGDA 1ZJAA 4O0ZA 1NFGA 2RDUA 4PYSA 7XIMA 1HW6A 1J0HA 1ZALA 4I90A 3AICA 2PLJA 3M1ZA 1V3JA 5K2ZA 1CXKA 5E0FA 2IPFA 3M6YA 1K9TA 2OTDA 3F4CA 4TU1A 3CQJA 1PIGA 4QDWA 1EDQA 2D0GA 4UNLA 1Z42A 2X1TA 4G8TA 3KCOA 1QWGA 4MNLA 2BVDA 1XRVA 2R1MA 1XIFA 2YCIX 5H8PA 2FVLA 2UY4A 2PLCA 1V3LA 1WAUA 3PB2A 6ALDA 1E9YB 3GHUA 4QS5A 1P6BA 5U4NA 3SN1A 2YLLA 2OEKA 2Y8UA 3IK2A 2DZWA 1A47A 2VZSA 2IKGA 3OYXA 4KFNA 1AJZA 1FWDC 5HWMA 1SSDA 3P81A 4J9JA 4QHRA 1DOSA 1DWHM 3HQPA 5LHEA 2GVGA 2OO0A 5GNXA 1WQ5A 5AHEA 3XIMA 4C5ZA 4WQ6A 4UMBA 2CLOA 1F4AA 4AD5A 1EL3A 3UXLA 1W3JA 2RHGA 3BGJA 4LC6A 2YA2A 1AZ2A 1NWRA 2FLIA 1TPVA 5H1WA 3OTRA 1LZOA 3LENA 5HNNA 5J8LA 4Z1DA 1CXLA 1EQCA 1PTGA 3T6CA 3ZWSA 5EMMA 3ARVA 2QUVA 4HTYA 2Y62A 3EA2A 4JTTA 1KC7A 4RX0A 4YXGA 3GU1A 3NYZA 1S5MA 1EF3A 4UIOA 1CPUA 1R7AA 4G56A 2YB1A 2XVKA 2ZVIA 3OW1A 3R5EA 4IIHA 1OFOA 3QZ6A 4Z1YA 3ZZ1A 3WQOA 1ITCA 2IXVA 1KFKA 3AROA 5DRCA 3UWQA 1EJUC 4EVZA 4RNFA 5SWUA 2X41A 3I4EA 2JF6A 4DJFA 5FOOA 1LM1A 3U5UA 3VM5A 2WKGA 3VCRA 4AU0A 4FA3A 5CSRA 1JFXA 5A8PA 4B5SA 1WUEA 1CT5A 1E71M 4XAYA 3VKBA 3G1RA 1RPXA 2AGTA 4IUOA 2BVTA 3AIUA 1LRNA 3ZWTA 1GQJA 1C90A 1KLZA 2Z7GA 5L6UA 3S2JA 4D71A 1B2YA 3PR2A 4DZAA 1VBRA 4HPGA 4XZ9A 4QXIA 4F9JA 3AJXA 3SW6A 4ZBCA 3AQUA 3KBMA 2ZC1A 1ITXA 1M5WA 3FOKA 4B90A 3LY0A 4ZO7A 3NCOA 1W2PA 2XHYA 3T08A 4C7DA 1DE5A 1XC6A 2E3ZA 4UFMA 4LALA 2PURA 1J2WA 2BZNA 4DWSA 4NF7A 2EGZA 5LA2A 4XK2A 4GI4A 4NG3A 3WH7A 4S2CA 3ZOAA 2VQTA 1VPYA 4DO6A 5ABFA 1F2JA 2PTWA 2XFWA 4GNKB 3QPYA 4FK9A 3F4DA 3H55A 3H6OA 3HQ1A 3N6HA 3CHVA 1LOQA 1XPGA 4H01A 4GQGA 3S2NA 4R33A 1TE1A 4F3HA 1SJAA 4JTQA 4PTWA 2FJKA 3P3BA 2DSWA 1UR3M 2CHNA 2ZDSA 1W8SA 2HV5A 2W3ZA 2XIJA 2O4MA 4KIRA 1QI2A 4JQ1A 4XSLA 1XFCA 3TZNA 3LUTA 1WDSA 4OTKA 1JDCA 3L7RA 1ME8A 1R3YA 2PWDA 5BYWA 1QNPA 1AQFA 2CLEA 2WM1A 1QNVA 2HRWA 1HKKA 3S9YA 3CHCA 3PAOA 1GVQA 2DP3A 3NQFA 3G1SA 3RYSA 4HMDA 3OGVA 4HOZA 1BFNA 3HMCA 2DZXA 1WZKA 3SCWA 2UY5A 3DZ1A 3TXVA 1YPXA 4MFDA 2PGEA 2C18A 2YDAA 3MI6A 1QHOA 4MAZA 4DZIA 3W7CA 1OJXA 1KTBA 1Z8AA 3DGBA 4RNJA 1IV8A 2UY3A 3KL0A 2VVSA 4D2JA 3IGHX 3LOTA 1QW8A 1N8FA 4OVXA 2CZDA 3O8AA 2W66A 2P0IA 4D6JA 1OIFA 3WL0A 3PJTA 3M9YA 1G7VA 4LFYA 2V3FA 3GXNA 4DWSD 4GBDA 5CZSA 4IMCA 2GK1A 3IWPA 3JZEA 3GZAA 2NVDA 1BVWA 3WK1A 4A3UA 5LIKX 5A8GA 4REQA 2GJPA 3PSVA 1AL8A 5HMSA 3AC0A 2E1WA 2VZOA 2HWGA 4JTFA 4C6CA 1E5JA 1T7LA 2OR2A 1R5YA 4UQAA 3A6OA 2ACQA 1H49A 5KINA 3GBDA 1VFFA 2P0OA 2ZBTA 2V5KA 4FNQA 5LIXX 2QJGA 3CM4A 5C2XA 2OCZA 3N2BA 4YWSA 2QJHA 1UR9A 2FJUB 3ZSSA 3T4CA 1A0EA 1OYAA 3R79A 2IKHA 1UYQA 1VFOA 3MHGA 3MBDA 1K02A 1W3KA 3DN5A 3STFA 3DHFA 5HNRA 3UR2A 2DIKA 3PZQA 1WXJA 4DJDC 4OHQA 2EHHA 2WLZA 1WKDA 1CECA 1PV8A 2PDKA 3VE7A 5HNUA 4DWSB 4MKSA 3WQVA 1LQ2A 1O66A 1K1DA 3P62A 1JCYA 2H8XA 2QAPA 5ABFB 3P67A 3QFWA 4S3JA 1UR2A 2TSYA 1LQAA 1UKPA 3KBNA 1AQHA 3C86A 2FIQA 3QSRA 3SQMA 1H41A 1GVEA 1OFDA 1VBJA 1QAPA 5G2WA 2PDWA 3II1A 4QLJA 3CV1A 4QNWA 1BHGA 2ZE3A 5D09A 3WUGA 1TJRA 2L5HA 3EB3A 3OA5A 3DAQA 4UTMA 1SVDA 5BXPA 4L61A 4US6A 3K30A 2QUTA 1FCBA 3W28A 1JAEA 4JIEA 3HTWA 1Z41A 3FKKA 3QHMA 2Y8VA 5AOUA 3ME3A 1C9DA 2BY3A 3I6EA 3H4XA 3NOEA 5H91A 1DWJM 1V6VA 1W5MA 5CJNA 4AYGA 5CPQA 4JQ4A 1NARA 1TB3A 3GTHA 7PTDA 2Z2AA 4H83A 2GPTA 2VD8A 5ABGA 4M29A 1RK5A 4ZTXA 4LNYA 5D8WA 2WMIA 3VDBA 5GPRA 4EXBA 3VINA 2OU4A 6XIMA 4NRSA 4U5KA 2J78A 4U2YA 1GYNA 2VVNA 3OQ8A 1TV7A 5JQ9A 1NF0A 2XPKA 1MDRA 4LOCA 5IFPA 4YL2A 5IXEA 1DJQA 1R3TA 4G9PA 2B7NA 2OWXA 1FWCC 2GK1B 3WBWA 2WCAA 3T44A 3WLMA 2CITA 1EX5A 2CBVA 2RUSA 3SGGA 4REQB 3LXCA 2NXIA 2AAAA 2WHMA 1EX1A 4GUIA 2JBMA 3LM3A 2JE8A 4LAMA 4DYEA 1Y5VA 2JGQA 2QV5A 1X7IA 1JCMP 5LSMA 1S2AA 3LLXA 4ZQRA 3SQLA 1XSKA 3IVTA 2C13A 3BXWA 2CLKA 1GG1A 2ZUSA 3TU9A 3JZUA 4K8GA 4CEUC 8XIMA 1V02A 5HUPA 4F2BA 4FOUA 1ALDA 5J04A 3LTPA 3RK8A 5C9WA 5AHLA 2YFNA 3HIJA 3DFSA 1J2BA 4JNMA 4P2VA 1E73M 2WQDA 4C60A 3Q2DA 1C8QA 3C61A 5T8GA 1VJZA 3WNMA 4M6UA 2E25A 1QCWA 4QSFA 3OG2A 1UIPA 1OFEA 4LYQA 4Q4KA 1X6LA 3B8VA 1TV3A 4B9ZA 3IJ7A 2PBGA 1JNDA 3SI9A 3ZLGA 1QDSA 3MKVA 3E38A 2FPTA 1S2CA 5DCDA 2Q8ZA 3HGJA 2PB1A 4HPNA 1L6GA 3ARZA 2FDMA 5CAHA 1RP9A 5CZJA 1AD1A 2V5LA 9RUBA 2CIPA 2PWFA 2BP1A 2PC4A 5I00A 1X97A 4B3ZA 2NWRA 1DPMA 4XZIA 4J3UA 3CHDA 2V3GA 1A4MA 4GOAA 4M7SA 1QOQA 3CZEA 4NX5A 4Z2KA 4GIAA 4WGHA 3M6DA 1Q85A 2OT0A 4GY7A 4LB3A 3K46A 1K77A 2C15A 2GGHA 4CQCA 2GDVA 3QQ1A 4GY1A 4S1FA 1G69A 1HVXA 3ID7A 2X0YA 4A8RA 1Z89A 1RCOB 3EWBX 2WMIB 1UD6A 3ONCA 1ZJBA 3QC3A 3VNLA 1S2TA 1QNOA 4EP8C 1SM9A 1MXSA 4UFJA 3V75A 4JEJA 2OOGA 1OGBA 2V68A 2NQ5A 2Z1WA 1XR2A 1ICSA 1OCJA 4YTRA 2BDQA 1EWEA 1AMKA 6TAAA 3AUOA 1UWTA 1TVPA 2X0HA 3SCTA 5F2MA 1UWUA 5AECA 2R1NA 2C3ZA 3SSJA 3KBJA 5F4SA 3PPGA 2WXDM 4AC7C 4ORIA 1CWYA 3BSMA 4BWLA 2FTWA 1M6JA 4DUVA 4O17A 2VZUA 1RD5A 2Q02A 2ZCGA 4OOUA 4E38A 1RHCA 1AG1O 3HPZA 1YE4A 2OYMA 4AHPA 2OG9A 4PFHA 3M0KA 4ZA0A 1QTWA 1TUXA 3QH2A 3KFTA 3TW7A 1S5TA 4BY3A 1XWYA 2AQVA 1F8MA 1W1ZA 4U28A 4HJFA 1V02E 2QCLA 3WLIA 3N15A 1D2KA 1TPFA 1ZBWA 4A29A 2CZEA 4A22A 5BOOA 3VTRA 1FP8A 2HNHA 1VHCA 3SJNA 1EKOA 2F6UA 2PD5A 2G0WA 2VELA 3M0HA 3SCPA 4HMNA 1XLCA 4R27A 4MJZA 5A1AA 2ASHA 3WMBA 2Z28A 5A8QA 3LHVA 2DQXA 2Y7EA 5FCZA 1EPXA 2PDCA 4X9SA 4RLIA 5FF0A 3MY9A 3EOOA 4R88A 4XUYA 5C71A 4JYFA 5C2CA 3S3GA 3BQ6A 3T42A 4K2SA 2QULA 4W5UA 1A49A 3T2OA 1QATA 1XD0A 4YMZA 1VD6A 5BOEA 2WC7A 3VKKA 4HNTA 1H60A 1C93A 4MZYA 3UP8A 1V7AA 3RRXA 4UWMA 3WJXA 4LYPA 4DHGA 2QJMA 5HMEA 3SIMA 1CZ1A 4WF7A 3NSNA 4D9PA 2Q3RA 3PN8A 3EPMA 4BQ4A 2V69A 3W86A 4MF4A 1SMDA 3BLDA 4JIHA 4AXNA 1BTMA 2A79A 1QI5A 1JIBA 2QDDA 4A2RA 3TQKA 2GUYA 4S38A 2YA1A 5M1TA 4XD4A 1Z32X 3WJZA 2XN1A 1XHGA 2PU0A 1V03A 4PB4A 1TV2A 1D8WA 1LWJA 2G96A 2PE4A 1I9CB 4NI8A 2DEPA 4HPHA 4FHAA 3U9IA 3OG3A 4YYCA 2O0TA 1VBGA 1GOOA 1K9DA 1WDPA 1EXPA 5G4HC 1X1ZA 3UCDA 2BODX 2C14A 2YDQA 3WH5A 2EPLX 2ACRA 3WNNA 2KZHA 3NO1A 3W6LA 1OCQA 4YTQA 3MUY1 4GFSA 4V15A 3M16A 2PDPA 3EBVA 4Q4OA 3WLLA 4MB1A 4E4PA 4CD6A 2A3LA 1H50A 4PN2A 1IXPA 3SECA 2V38A 3WQ5A 4FNSA 3S83A 2YCJA 1F3XA 4EWJA 5KITA 3MSRA 1JZ8A 2HVNA 4GVHA 5E6ZA 2DW6A 2FZMA 3P8JA 3GLCA 1TRIA 2BY0A 3F5KA 4QDMA 1D3HA 3HG3A 3DYMA 5DFAA 4NJIA 4O1EA 3A21A 1MDLA 3UT0A 2AMGA 1NWUA 4ZQMA 5BNKA 1U2YA 3GKFA 1A5MC 1PHQA 1PBGA 1SR9A 4DF2A 4BQ2A 1J4EA 3HPXA 4RE3A 1NJJA 4QEEA 3VZYA 4WCJA 4W7UA 3C2OA 1QO5A 3UY8A 5JBDA 1AMYA 1S38A 3N9SA 2ZA2A 1H62A 5REQA 3VDAA 1JZ6A 4PMUA 2W79A 1Q2SA 1CLVA 4YIWA 2TODA 3LV5A 1CDGA 3EDJA 5DCEA 4B3KA 3DFOA 1J10A 5I09A 1OCNA 4DJFC 1VIWA 2ZUUA 3PY2A 4QITA 1BWLA 2OOFA 2X40A 2B0MA 5KZMA 1E51A 4N02A 4NRRA 4D6IA 2DZVA 5I07A 1NTHA 4PODA 4YN5A 2RJGA 4HP5A 1YNYA 4HB7A 1LJYA 3DI1A 3L0NA 2J27A 4NXSA 3P8IA 2HE8A 4GYFA 2VL4A 1XBXA 4JHZA 4I5UA 3GXDA 4F0KA 3VYLA 1UWSA 1XLBA 3G8EA 4HOWA 3S2MA 2I5GA 1JYVA 2G8ZA 3S6DA 2O55A 1YXCA 1EWDA 4GLEA 3FA4A 3TTOA 1UC4A 3MV11 1ICPA 1E9LA 1PAMA 4WHBA 2OMAA 5BWAA 3R0UA 1PX8A 3SSZA 4AFYA 3UXAA 1XYLA 4Q7IA 1MUCA 5H6HA 4XX6A 1NY1A 4AVOA 5AC4A 6ENLA 1YDVA 4Q7NA 2BBFA 1L6FA 4CVWA 1WZAA 4Y9MA 3TJLA 1YPIA 1HF6A 5HMDA 2QPUA 1PO9A 2YA0A 1CGXA 5GVJA 4AWUA 2Y7GA 2P10A 4CCDA 1QPKA 1MMFA 3C4UA 1RBOB 1XIHA 1XJBA 4U31A 4AD2A 2ZDRA 4QDPA 1C91A 4N0RA 4ZODA 1LL7A 3T8LA 3TOYA 1YMYA 1E56A 3VIPA 4B3LA 4MPQA 3TSBA 4M81A 1GT8A 2A6LA 2C79A 5AHMA 1FDZA 4N9DA 5DMNA 1RJPA 3LN3A 3L4VA 3NDOA 2WJEA 3THCA 3FDGA 4DI8A 1XKJA 3LEPA 2WVUA 3QGKC 1A80A 1YDYA 1VPXA 4AZCA 5DO8A 1RBAA 3TCSA 1T0OA 3AU2A 1TV4A 5IHRA 2EXOA 2MNRA 1NP2A 2JIEA 4DEFA 4ZXOA 1LF1A 1TE6A 3NGFA 1T5AA 3N13A 4QSHA 3RU8X 3SCUA 3T0BA 4KCUA 3VK5A 5CZ0A 4Y96A 2AL2B 3TKFA 2P8BA 3B05A 1DQWA 2PDGA 2Q6ZA 3ITOA 3EWYA 3CTLA 2PDXA 2Y24A 2FGLA 3S42A 4GI8A 4JY9A 5HULA 5CBJA 1H09A 3FHAA 5PTDA 3EWXA 3ORWA 3TYDA 4RKAA 4LWWA 5AC6A 3S47A 2V5DA 5XIMA 3LMZA 1UWRA 3J7HA 3EXTA 3PVFA 1ML1A 4XBSA 1XICA 1ECEA 2G4FA 4JFVA 4CN1A 2RDTA 3O3RA 3EAUA 4FNUA 1Z48A 1W6TA 2CWXA 4HCHA 3H7VA 5REQB 3S1XA 5CPTA 1VHNA 3QY7A 3OP2A 3TTEA 2GJRA 2YCKX 2CLFA 5DT7A 3VPLA 3UCQA 4ZGYA 3THUA 1HJVA 3W24A 2HE5A 1DEDA 1NDYA 2CKSA 3W2NA 1VFLA 3H4WA 2GSJA 1DTUA 4DN1A 2DQWA 1LL4A 2WSRA 1H7NA 4PUWA 4KWSA 5DT5A 1JCJA 1XGEA 4S3GA 1OX4A 1L9WA 3DI0A 4LUYA 1W54A 1V51A 1H7XA 4HZMA 8TIMA 4O28A 3AHXA 4QAWA 1BKSA 3MO4A 2PU1A 1GONA 1K70A 3K1DA 3VX1A 1Y0EA 1QOXA 3PSWA 1WPCA 3W7OA 2H3BA 4ADTA 2VC6A 2NQHA 4WY0A 3S6OA 4IL0A 4JTEA 1U1UA 1KM2A 1QBBA 1O60A 2HEJA 3C2YA 3QPZA 3CK5A 2G3FA 3FLUA 1XIDA 1XH0A 3U2EA 1LLZA 3RITA 4QQ3A 1BAGA 2VEFA 4HGXA 2A5HA 1SFTA 3W7LA 4PBGA 4PTXA 1R9ZA 3KVMA 3PG8A 2E4TA 1MEHA 2ABBA 3B9DA 3UGVA 2NQ9A 3TFCA 3UWVA 2XVGA 1KR0A 3MPGA 3D46A 3SADA 1GVOA 4WSHA 1SPQA 5XINA 2DUAA 2DVXA 1MW1A 1S39A 5FI8A 1PKMA 1NP0A 4S3DA 5EPDA 4NY2A 9CGTA 4QQUA 3DFPA 1W9PA 1XIEA 3AS1A 3L0KA 3UW6A 2RDXA 5A8NA 1JGIA 1IWBA 4RXFA 4WKFA 3WLKX 4WR3A 4Y9NA 4DPPA 5FA5A 3T7VA 3GKAA 3D5HA 1NOWA 4V1YA 3WKZA 4O15A 1SSGA 1DKWA 2W6RA 2E0PA 1N82A 3AIQA 5CG7A 1TSIA 5AB3A 5D05A 2V2DA 3SQSA 3T55A 2EBNA 4W7VA 3OHIA 1F7BA 2YBVA 3LXBA 2VENA 2XGZA 1NDWA 3G1DA 3BK0A 3HFYA 3RPMA 2Z29A 2Y89A 5I0DA 4FI4A 4D6CA 3KBWA 4BZYA 8CGTA 3E0VA 1VS1A 3AHZA 1XISA 1EO5A 1VQTA 3SUVA 3BL3A 4W93A 1JR1A 2ICSA 3V5FA 1EEPA 3ZXWA 4KRTA 1VFSA 4CEXC 4HJWA 2O7QA 1EJRC 3CASA 3CAWA 4JD4A 1PZ3A 1SJCA 3T9PA 4DXXA 1LBLA 3DHPA 3VNIA 3WLOA 4G7EA 4C5YA 1MQRA 4GYPA 3CJPA 4HNOA 2XJ7A 3CEPA 2G3MA 3BCFA 4H9TA 3PBWA 3N18A 1SZNA 1GOIA 2TYSA 2X09A 3KS6A 1HJQA 2YCEA 3OBEA 2VX4A 1IXOA 5CC5A 2ZA3A 3A22A 1OX4B 2DJLA 3NQCA 2OJPA 1LLOA 3EA1A 4JNYA 2E5CA 4J3XA 1OC6A 5BXSA 3WSUA 3V0TA 3RGTA 4XIMA 4PTVA 4ERGA 4PC8A 3RO8A 4LS0A 3W7PA 2YZ5A 1J0YA 1ZP3A 4AIBA 4IQJA 1LCOA 1B54A 3GNPA 4GXPA 1A5OC 1W8GA 1XLAA 3ARPA 5JMUA 1SO6A 3SRKA 3GTFA 4AWTA 4LV9A 1E9IA 1WB0A 4UR8A 5E0KA 2NV1A 2ZC8A 4S3AA 3WELA 2FHCA 1JPIA 2HS6A 3PUEA 3WLRA 3EWCA 3VFCA 4X60A 2WM0A 3GUGA 1MSSA 2NT1A 2VOTA 3RILA 2ZQ0A 1BG9A 3VNKA 3G3MA 3HPAA 2CLHA 3GH5A 5LYRA 3STCA 3B8WA 4QGCA 2MANA 1JZ4A 3A12A 3LNMA 2HMCA 3KVLA 3M07A 1V3MA 3BSHA 3HOJA 2ZTKA 3QJAA 4DBDA 3H24A 2YFOA 1VEPA 5FL0A 4AZHA 2VM8A 3U0HA 1VFHA 3LCFA 2WNZA 3L5LA 2P5NA 5LA0A 1RY0A 1GW9A 1REQA 3O63A 3A3XA 1W32A 3UR8A 1XH1A 2X8RA 4BJHA 1POKA 3OVQA 3FCPA 3MYOA 3S9IA 1PYMA 1XIBA 3Q65A 1M03A 1XIIA 4UR9A 1OGSA 2CHOA 2WMGA 2YXOA 3RUBL 2QDEA 2CBIA 1HGWA 1MUWA 4OOZA 3GG1A 2GQ8A 1HUVA 1PZ2A 3CUIA 4JQAA 3EA3A 3C0JA 4F9DA 2DZBA 1GVYA 4QRNA 2ZFAA 4G7EB 5XIAA 1D3GA 3CO8A 1BQGA 5CC3A 5A5WA 2JALA 4MLRA 5A6AA 3ERPA 2Q71A 2CKRA 2PLKA 4A3RA 1JGMA 3IJIA 3GXTA 2HVOA 2KX9A 3PUDA 4OU1A 4BWLC 2VR4A 3P82A 3SJ3A 1P5BA 5DCBA 2Z1VA 4PR4A 5AYXA 1OZMA 3GC5A 4FZIA 2F6KA 2ZOXA 3FS2A 4ICMA 2BHYA 1DWIM 1BXNA 2VFFA 4ADSA 1JCLA 5GNYA 2O56A 4NZCA 1E70M 1UKOA 3OYZA 5CPMA 3DFTA 4F40A 4QP0A 2WAGA 1XQLA 4W4QA 5AYIA 4CQ8A 3G0XA 2VEPA 3FJ4A 2ZX6A 3UZWA 2QZRA 4F8XA 1ZFJA 2DORA 2ZX8A 4FPSA 4EAMA 1DJNA 1N2VA 3HF3A 3PBYA 6CGTA 2EQDA 3D0CA 1VKFA 2A0NA 4M5PA 2FH8A 1S3HA 1SZEA 2Y4SA 1DJHA 4JCLA 4O1BA 2PDMA 1C8YA 3B0PA 3N17A 1JRBA 3LCXA 3BJTA 4P5UA 1KFBA 5A6TC 5GNZA 1FCUA 4UQCA 3QY8A 1HJWA 3N19B 1GTEA 4WSKA 1O5QA 4KBXA 1SW3A 2D3NA 4BI6A 1W3HA 4JFWA 3SGUA 3WDRA 1JCXA 1IIHA 5EMYA 4D6HA 1OK6A 1XC4A 4WX2A 4L7ZA 3O0KA 3KOYA 1XYCA 4LF2A 3C2EA 3WLTA 3EGJA 5E1QA 5IHSA 1TCMA 3H2NA 4NU7A 4HK7A 1A3XA 4JQ2A 1J11A 3WEOA 1WDWA 4MNKA 4E6MA 4JDYA 4E3VA 5KETA 3E0IA 2GVLA 4TOQA 1R85A 4RW3A 2ZRVA 4S3EA 1J18A 4QG8A 4GUHA 4GGHA 4LJ3A 1R87A 1REQB 4P7RA 2D2JA 1DJWA 1PKYA 3PAJA 4DAIA 4AC1X 4XUGA 3UXKA 2QCEA 3KLLA 3RAOA 3WL1A 3MWAA 1TVNA 1KRCC 2POZA 3CUHA 3W88A 2YIHA 4DM2A 1J93A 2WWCA 1SGJA 1TMQA 3SY5A 1MW3A 1L0PA 1DQUA 1DWAM 3CC1A 1M53A 3QGVA 3HGRA 2GFTA 3KOXA 4FS9A 4AMCA 5C70A 4KIEA 3WD0A 3WQGA 3ZYZA 3G8RA 3S5NA 4V2XA 3RPDA 3MP3A 5FESA 3H2FA 2DSZA 2E7FA 1OB0A 8XIAA 2E28A 4YHGA 4BEQA 3SRFA 3IPWA 1XLGA 1XYFA 3N2MA 3H2OA 1HL2A 1EP2A 1QPQA 1NDVA 4C6DA 2XVPA 2VDIA 2OQLA 3VIGA 3DEQA 3GIQA 4R9OA 4DBWA 4DO5A 2PTDA 4TTUA 4N9CA 2I7GA 1GK8A 3LQLA 2I56A 3KOFA 7REQA 3NEHA 3DH7A 4NZJA 1X7FA 1CXIA 1ODZA 2YYTA 4IP4A 1OC7A 2XUCA 4GC3A 1P1XA 5HOSA 3S1UA 3B8UA 4DBEA 1LBMA 1DIKA 1QPOA 4G5DA 1Q8AA 1WNOA 2VC9A 4ATLA 1XLIA 3VGHA 5CGQA 2I57A 2E1DA 1TJ1A 2DZSA 4IPNB 1UH4A 4FLSA 1LT8A 3UCCA 4HU4A 4IG2A 3HG4A 3U2OA 1FFRA 5I3HA 3W84A 1XKYA 5C55A 4HZ7A 1XUZA 3S1WA 4B5TA 1F9CA 3DFHA 2EPNA 2IQTA 1DJZA 3GK0A 5HXMA 3FGCB 4L6OA 4M0XA 3AIRA 4O1CA 4KW2A 1WA3A 3STGA 3ARXA 4Q8QA 4TIMA 6PTDA 1C3FA 4RPPA 1UUMA 3W02A 3KTCA 1NSJA 3S2LA 4XSMA 1JULA 1PE1A 4ML9A 2DSVA 1UR4A 4LAOA 4JX4A 1EC9A 2QPXA 3C2FA 1G9HA 1BYCA 1MEIA 2EKCA 3PBUA 3MU7A 3NQEA 1US0A 3NA8A 5D33A 4AQLA 2ZUNA 4YTUA 1KV5A 3TTSA 4EPEC 1GQKA 4IMFA 3STEA 3W81A 3N73A 1OC5A 1L2QA 1IQ8A 2E67A 3W00A 3RR1A 2WHKA 1IHIA 2ODOA 2YYUA 1CB2A 4M6VA 3PJWA 3CWOX 4IPIA 1KBKA 2POTA 1FP9A 4B15A 4AIEA 2J4GA 1E4LA 4IJRA 4Y9OA 5TD4A 1F3EA 1F07A 4QJ3B 2TPSA 2HCVA 5A6MA 1P0EA 4N2YA 2J8TA 3T78A 1EIBA 3CQ0A 4FF5A 1X6UA 4CKQA 4L1XA 1FHLA 4O54A 3VCNA 1CXHA 4H00A 1IR2A 2A3EA 4DZ5A 2Z00A 1FCQA 1QR7A 4K1GA 4A05A 2O9TA 4Y7EA 1B4KA 1TVLA 1U1JA 1E55A 1EO7A 1RSCA 4XAZA 4Y6GA 7ENLA 2WSKA 3ZS4A 5CAKA 3G0UA 4YWIA 1EJ7L 1FY6A 4WOZA 2OPJA 5FJUA 4PTDA 3PZUA 3VOJA 3IJDA 1G67A 1H2JA 2AKMA 2R14A 1EQPA 3W27A 4LV4A 3UZ5A 3RLGA 3MYPA 3P93A 4PMNA 5EA9A 4IGNA 3GDTA 4TVDA 4PCNA 4RV3A 4WY0F 3OOQA 4PUUA 4BQ5A 1YXDA 2DJXA 4H6KA 7REQB 2D69A 2PPGA 4GUGA 5IDZA 3VD7A 2JKPA 2TMDA 1SZGA 2VC5A 4D8LA 3GUWA 1JD7A 3PJUA 2XIBA 4H9ZA 2V63A 2GJXA 3L2LA 3BGGA 2PDYA 1B3ZA 4OE7A 4AB4A 1WKFA 4NAFA 1K4HA 4Q6JA 5DMLA 4H3DA 2HNEA 4FIQA 3XINA 4IG2B 4O14A 2QMKA 4K8HA 2R1KA 2W4XA 1NM9A 4GY0A 2VTFA 3CUXA 3UETA 3W71A 1H7PA 1IXNA 1OINA 3NZRA 3MSYA 4ZZ9A 2IQ0A 2ZRZA 3WQ8A 3DDMA 1GUVA 2PDJA 2V3EA 3QW4B 1WUFA 4DAFA 3GO2A 4OFCA 2CHRA 5LA1A 3BLPX 3S6TA 4NJHA 4R5EA 4MKVA 3KL3A 3NQAA 1XPYA 3O6YX 2PMQA 2ZZ7A 2NWSA 4Q8UA 2A4AA 1Q7QA 2F2KA 1Y5WA 3MP4A 2AMXA 1EIXA 1I2NA 4C6IA 3A4JA 4G1NA 4I5RA 3NURA 2OXNA 1HKWA 1WDDA 3GC2A 3EX1A 4A8NA 4TXEA 3A5FA 5AVHA 3A4XA 4FLRA 1E0VA 2D2OA 3S9ZA 3HA1A 3Q45A 1TYGA 4X3ZA 1LUCA 2Q8XA 3DCPA 2J7EA 1GNXA 4LRTA 4KESA 2BASA 4M7TA 1GKPA 4NI3A 3CZ8A 3POCA 1HO4A 3ARWA 1W3TA 2FB3A 3WY1A 2VC7A 5E70A 5B7YA 4AYSA 4JZ5A 3LCWA 3C5QA 3EMQA 1T96A 4ZOAA 1RV8A 1KXVA 3GH4A 1H5VA 2CXGA 1OZQA 1UJQA 1AH3A 5JH1A 3S5SA 3DGRA 1W3LA 3FYPA 1LQ0A 3SCQA 3NAVA 3WDQA 1VBHA 3EMZA 4WZHA 4XAFA 4O4VA 3AISA 2QEZA 2A7RA 3LHYA 4JX6A 4JIQA 2CETA 4ZSTA 3SCVA 4QCFA 1M41A 4UCFA 2PF0A 4LUSA 5LXEA 4R85A 3BMVA 2ZUVA 4PMZA 4AH7A 4MY8A 2R1PA 1I4NA 2ISSA 5AKQA 2DZTA 1GVIA 2DU2A 1CNVA 1XLMA 5ENLA 4FX6M 3ANVA 2A3CA 3HN3A 1UASA 5F2IA 5DBUA 5F2GA 3FA5A 1FXPA 1RBLA 1UKTA 1XYAA 3PWIA 4O13A 2CEQA 3GXPA 1L8PA 4NJJA 4H19A 2EJAA 3MUZ1 4O50A 5BROA 4ZMGA 3BO9A 1UBPC 4XVDA 3W0KA 3S4TA 1AK5A 4GZEA 4MADA 3NVTA 3MP5A 3R7MA 4X0NA 3TLLA 1R2SA 4NILA 1QWKA 3WNLA 3B0XA 3W2LA 2GDUA 4MLJA 3WO8A 4M3PA 1UKSA 2WSYA 5C9ZA 2GJXB 2ZWYA 1K8ZA 2ZUTA 3ZJ7A 1WKYA 2C6QA 4NAFB 1UBSA 1IE7C 5FEWA 4I3GA 2QXWA 3VDCA 1R9YA 2JK2A 3IAQA 2WYSA 1SJBA 1BG4A 2AGKA 4F48A 2QF8A 4Z0JA 3KRUA 2Y63A 3UJSA 2J25A 5G1TA 2Q01A 4EAYA 3WEMA 1RA5A 2J8GA 4LBUA 4Y9AA 4OBTA 8A3HA 4GG9A 3B06A 2QCDA 3M43A 1BYDA 2E5DA 1I0DA 1O5XA 4AWSA 2PCQA 3WBXA 5CSSA 3W7RA 4TV6A 3WUEA 5A2BA 4DJDA 3QV9A 3AU6A 3K4AA 2WLYA 4TUFA 1ZCCA 1QO2A 2NXGA 4QR6A 4AG0A 1ZAIA 4X2PA 4IIFA 2ISWA 4JTCA 3TQVA 1LUCB 4D6DA 3HQNA 4ICCX 2CU0A 4XZNX 3MUIA 2NVCA 2GWNA 4Q3MA 3MJMA 4X2RA 2FYMA 2VD9A 3FYYA 4LUTB 1UR1A 4HSOA 4UXDA 2YOCA 1AL7A 4KRZA 4AX6A 2BB0A 4QJ4B 2ZRUA 2WANA 5M03A 4GUFA 3MUXA 4I9AA 3NQBA 4NHVA 3RMJA 4MTVA 4R53A 4UMCA 4Z1BA 3TDFA 4DO4A 1RP8A 3L5AA 1KB3A 4ACZA 2O9OA 4LUSB 2V0TA 1V3HA 5I2UA 3A13A 3CIXA 4LVDA 2R6OA 3VUPA 3TWAA 1NU5A 3GIYA 4MY9A 5E0CA 3EDKA 2KAUC 2PDIA 4JTUA 3O6CA 3CL8A 1O4UA 2PDBA 1GHRA 1PKLA 4C6LA 2BLEA 4PEEA 1MNSA 3NWRA 1EEXA 3KX6A 1SYTA 3JVAA 4MYAA 1PX3A 2WVTA 1XCXA 2A3AA 3L0GA 1D3CA 1UG6A 2OLHA 2BGSA 1YX1A 2Z1SA 2ZTJA 2A85A 3KTXA 1U83A 4DJDD 5D9OA 3NZ1A 2EO7A 1E1CA 4JS3A 1R47A 4NNBA 1H0GA 2P3EA 3ZVHA 3BV4A 1PHWA 2NSXA 1O68A 3ITTA 3T2QA 2PEVA 4GQ0A 3FHQA 4BI5A 1N55A 4IICA 3H53A 2WWDA 3OVRA 4HPJA 2QYGA 2ZICA 5AHNA 3TC3A 3DX5A 2BXZA 3BZJA 3O7UA 1K6WA 3FVMA 3QEZA 1H0IA 3U48A 4MJ2A 3F5JA 1KM6A 3RX3A 1KNWA 3L65A 1CXFA 4F0MA 3QZAA 4O1FA 3VIHA 4CCZA 5EMLA 2DUXA 3W53A 1UR8A 2E8ZA 5AZ0A 1W9DM 1RQHA 2X0SA 4M24A 3UWEA 2X1UA 1JRCA 2QCMA 1GGOA 5CSUA 2HDJA 1YW1A 3PHAA 4H8VA 1EGZA 2QCDB 4CNPA 1PS9A 3V5CA 3D6NA 4JIRA 3SY8A 4F4RA 4E5TA 1UW9A 2PWUA 4ADUA 4XD3A 1UZ4A 4J3WA 1Q4NX 3FV9A 2NLYA 3WLQA 4Z2LA 1JL8A 1KFEA 1KGUA 4QROA 2GUUA 4AD1A 4RE2A 4EACA 3O16A 3OHMB 5ECVA 4XB3A 1TWDA 1JPMA 4XISA 2F9RA 2WV8A 5D8ZA 3DYPA 4B5WA 1FHDA 3KRBA 1CTNA 2VRJA 3TZFA 2XH0A 1XYZA 3VD4A 1I2QA 3E2RA 2PZNA 2ZVRA 4KQNA 2PDLA 3IIOA 4NVTA 4AZGA 2QJJA 4K39A 3PFMA 3QYSA 1N8IA 3QRHA 1PUDA 5HK4A 4MZ8A 2CZ5A 3SUWA 3FK4A 2RGMA 3KCLA 1FWRA 1XYBA 3W7GA 1CIUA 1M68A 1MW0A 4GVGA 3TN5A 3QF0A 2Z25A 3WQPA 1X1OA 4ACZB 3SY1A 1VENA 1UWQA 2F38A 5BU6A 1AJ0A 2J88A 2VFEA 2X2GA 5HQLA 5JVLA 4UZUA 3NYDA 1BXBA 3UU0A 3OODA 3W7JA 2EPKX 3QMTA 4DRSA 1UUOA 4LUIA 5G4WA 3PTDA 1GCYA 1HL9A 4ZO9A 4IIBA 1KW1A 1UH2A 4PB5A 3WUFA 4RUBA 1MW2A 2VFIA 3B03A 4A8IA 2HJPA 4K68A 3VNDA 3FJLA 3ZR5A 4FF7A 2PLMA 1TZZA 2OQYA 1E43A 1OFAA 1AW5A 3IACA 3VC5A 3VIIA 3SURA 1IF2A 4CU8A 1ONEA 4DYKA 2VCBA 1S5VA 2GWGA 3GG0A 4KERA 3TMLA 3IUIA 3ZVHB 2R24A 4LT9A 4O8RA 4ZFMA 2I9EA 3MO7A 1TMHA 2YZRA 1P0NA 2Z4GA 3IUDA 3CT7A 4IOTA 3EKGA 3ZJKA 4MY1A 4DUOA 5HJYA 1WKEA 3VAVA 1XRSA 5EGRA 4UTTA 1DXFA 3MDWA 4AEEA 2P50A 4QJ1A 5BXTA 1OCBA 1ZBVA 2FVKA 3WQFA 4LC8A 3DC8A 4LCQA 1TWSA 2YL8A 1YTDA 2VURA 2QQ6A 4Z17A 1XS2A 4GUJA 5LHFA 5G1YA 3GW3A 2HK0A 1E0WA 3HG2A 1OEPA 1F6YA 4O1AA 3URQA 3VMOA 3E2QA 2PI6A 2UBPC 4UNKA 3REQA 1V77A 1ISWA 1SW7A 1G4SA 4D1IA 1FRBA 3T0AA 4O11A 1O6IA 1TPB1 1ZUAX 3TONA 1P7TA 3LA4A 4ZOCA 2WHJA 4LEQA 3O2LA 1RJQA 1R46A 2NX1A 3VOHA 5MF5A 4MSSA 2WZIA 3EXSA 4NYUA 2GL5A 2QCGA 2J66A 4UUIA 1KBBA 3AWNA 1Q63A 3SUTA 2DIJA 3LYEA 1NWTA 1R6WA 4X9YA 3RU6A 3NUKA 4QX4A 3IJ6A 1C8XA 4EWND 4FNRA 4J35A 1QK2A 1IT7A 1ZJIA 1VFUA 4GIRA 4GCAA 2Z24A 3BVJA 1Q45A 3M64A 4LS2A 3W2UA 1ODUA 3GDLA 1DP0A 4WDWA 3SO7A 1GKQA 1WYIA 1TMLA 5FF2A 5DF0A 5H2ZA 3C0QA 5C9RA 4PL2A 4CD7A 4HVXA 1J79A 3KRZA 4PMVA 2QKFA 3TMQA 2YSWA 5ECUA 2GGIA 3A24A 1HZYA 2REQA 4ATDA 5I3DA 3MSGA 3G3DA 4LNCA 1QFEA 4IISA 4M6PA 3CBWA 4JTDA 4KGJA 1ZP4A 4DPQA 2VNCA 1U1HA 2OSYA 4GRSA 1AQMA 4IJCA 3LLFA 1TZ9A 1TA3B 1U5JA 4D1JA 4HYRA 4CNOA 1EUNA 3HURA 5D03A 2OSXA 2GJNA 3H23A 5C7HA 1SZRA 1NOUA 1XBZA 2V30A 4U3AA 2FKPA 4OT7A 1H51A 2BMBA 1YIXA 2DT1A 5J5RA 3DESA 1GEHA 3NQGA 3B04A 3SCSA 1OK4A 1VLIA 1XP3A 4ZB2A 3SB0A 3WBYA 1Q6DA 3AUJA 2E6YA 1KWGA 4Y90A 2J8FA 1EZ2A 2OSWA 3WFAA 4B5VA 3PZVA 3N14A 3DFQA 4AUBA 1ELSA 2CLMA 3QLLA 1MQPA 2XZ7A 3W01A 4AD4A 4CN6A 2ZXDA 1YADA 1NIUA 5TNVA 2WVVA 1UOKA 1E3XA 1UQZA 1BXCA 2BVWA 2FMNA 5CSYA 4JOMA 1PX4A 2OWWA 3AYTA 1KFJA 4QEHA 4JTKA 3REQB 3LV6A 1LYXA 1FDJA 3ECQA 2G37A 4MM1A 2P8CA 1Q7ZA 5GJPA 1EOKA 2D23A 2H8ZA 3BAJA 1P7TB 3S5ZA 3NQVA 4W87A 3ABRA 4FR6A 3HJEA 2AAMA 3QTPA 3UVAA 5BW6A 3WLNA 5EFDA 1UHVA 4KH2A 2WQPA 2AQWA 4HA1A 3A4WA 2ZRYA 4IJBA 3VIFA 4XIAA 1I2PA 1XW8A 3UZYA 3WG6A 2Z1BA 3M47A 1DL3A 5RUBA 5LGXA 2XTKA 4XD6A 1NEYA 2F8QA 4A21A 3E9AA 1BGGA 3W1LA 2YLAA 1T8QA 1K9FA 4CGTA 4UOJA 3PF3A 3E49A 3VGBA 4Q22A 3NDZA 3W26A 1J0KA 3H7UA 4WDXA 2G4JA 5AVNA 1VZWA 4OQVA 2XDFA 1V08A 4KEMA 1IEQA 3LCIA 1B30A 1SZFA 1XDLA 2F2HA 4TQTA 1L6SA 1CLKA 3EDDA 4W88A 2YBUA 4L4MA 5B7ZA 2REQB 4BF9A 3DXIA 1FWWA 1HO1A 2VR2A 3UG5A 1EOMA 3ZR6A 4GJ1A 2VHLA 3NZGA 1Z44A 2Y2WA 4O16A 2FPVA 3UZZA 3GG7A 4DI9A 1KRAC 2ZZ2A 2NX3A 4AZ5A 2C0AA 4O52A 2DW7A 5HNTA 3W75A 1XI3A 2XFYA 3GNOA 3G1FA 4I7VA 3RN6A 4GE8A 2CBUA 2QAFA 2FDSA 4G2DA 4QM1A 1KQYA 1HGYA 3AZSA 2BSLA 3AOFA 1TTQA 4IFKA 3LTYA 4B2DA 1DIEA 3RDKA 2GOKA 1Z9AA 1Y5XA 3MSDA 1WV2A 4FLQA 2PZ0A 4DLFA 3QR3A 2GDQA 3ARSA 1XIJA 1PWMA 1KGWA 4HN4A 3EOEA 3ALGA 3GXMA 4M8UA 4UTWA 2W67A 2OB3A 4C1NA 1BKHA 1GKRA 3NPXA 5HA7A 4DJFD 1KTCA 3AHVA 3OO2A 2VX7A 2WVVB 2PRMA 2G41A 3T1GA 1VP5A 4MWAA 3NM1A 1DIDA 2OFJA 4CD4A 1OM0A 1P1MA 1XRTA 3WYZA 3BLFA 3KLKA 3BGAA 5FJOA 4FNTA 2JEQA 2VR5A 2DT0A 4JIIX 2WMHA 3MHUA 3LS9A 1OG0A 2PP0A 2Z27A 1XINA 2NSOA 4POCA 3MCMA 2P88A 2NV9A 3M4HA 1KXHA 4E3TA 3TN6A 3WH8A 1RUSA 3ITLA 2WKLA 3ARQA 3UQNA 4LEFA 1IR1A 3MQTA 1V8EA 1IYXA 4NKCA 4LANA 3TJIA 4DUWA 4GVIA 1K7XA 1GORA 4JFSA 5MKGA 4XO6A 2BOGX 2WHLA 3LPFA 3LRLA 4IGMA 1IT0A 4B2DD 2W0UA 2YL9A 3LPPA 3BOXA 3VKCA 2SFPA 3PG9A 5ABHA 1G5AA 4B5XA 3DYOA 3LI1A 3URAA 2WOQA 4W8AA 4RR4A 1Y8BA 3FAWA 3RM4A 4CUCA 3W76A 3F4WA 3ONBA 1E6SM 2BOFX 4NZ1A 4O12A 4CNTA 2QUUA 4QS6A 2QCHA 4OZOA 5I3KA 2FZ8A 4Y2WA 4WJ8A 1Z6KA 1YLVA 3GYCA 2GLKA 4KPLA 5AC7A 1X38A 4DUXA 2HQAA 2C1IA 2QF7A 1IEXA 4KWUA 3ZMRA 4K7YA 3AIBA 3MMWA 4MWAD 1YRRA 5FAGA 3PWGA 2YJQA 3KRSA 3ZIZA 1VAHA 3WZ0E 4J2MA 1FWAC 3EMCA 4JL1A 1TPUA 3WK0A 5HPCA 3APTA 3V5OA 3RXZA 4Q8VA 5G5IA 5CLTA 1P6WA 3SDOA 3DC0A 1OX6A 4HNLA 3C52A 1ZSXA 3UWZA 1FX6A 2BHUA 4H9YA 1LRQA 4PMOA 2ATSA 1QBAA 1WBHA 3EX2A 1R3SA 1ADDA 2GGJA 1S3TC 3NIYA 2VP8A 2AL1A 3CHEA 4XAGA 1SR0A 5GJNA 3TEVA 4J40A 5F1UA 4XZMX 5B80A 2NT0A 2QVHA 3VNJA 3KP0A 5HR6A 3OBKA 5EFFA 1F76A 2Z7KA 4HKPA 1BSLA 2BVYA 3OGRA 4C1NB 4C6EA 1J01A 4MPKA 4GHRA 2PC8A 2PWVA 3GC4A 4XG1A 2NUWA 2V67A 1QUMA 3TK7A 2IMRA 4L4PA 4W5ZA 2JFEX 3DG6A 4ATWA 2J47A 4WDTA 5FJTA 1S2WA 3MZNA 2NLIA 3P74A 4MWAB 4ASTA 2IKIA 1OF6A 3PTKA 3NO5A 3GNNA 4MWAE 3F03K 2PP3A 2RDWA 3O6DA 4RCXA 4JCMA 3TW6A 1JZ7A 1A5NC 3L9CA 3AFBA 4R34A 4LCSA 5HDRA 1Z69A 3UA4A 1BVNP 4XBKA 4DBSA 4H8HA 4LCRA 1GWJA 4HYVA 3P6LA 1BWVA 5JIWA 3V3WA 3LHZA 1CENA 1UWIA 1E4IA 3N9KA 4WKHA 3W1NA 3WFZA 2YL5A 1G6CA 4BF7A 1KGXA 3EZ4A 2JKEA 2FZDA 1SO3A 5MKGB 3RX4A 1GVSA 1F6PA 5HR7A 3GS6A 4EPBC 4DVOA 1VFTA 1THFD 7TIMA 1PSCA 4C6PA 4GQBA 3WF0A 4XZBA 2X1IA 5F4WA 3R2GA 3W3OA 1RQEA 3W82A 3GZ3A 5FF3A 4D6GA 2GUBA 4YYFA 1EFZA 4J3VA 4Q8PA 3QHNA 5HQMA 1S46A 3CB3A 4S3KA 2RH9A 3BAXA 3W07A 4JTGA 1CX9A 3HU7A 5MHBA 4K3ZA 5BRQA 3L12A 1YBQA 3UF9A 4U4MA 1CGTA 3MMUA 4Q8OA 1R9XA 3BH4A 1XL9A 4GIEA 3BANA 4IL2A 2QUMA 1BLIA 3QQ0A 4CNUA 3NXFA 4ZB5A 1ZNNA 1E6QM 3K2GA 2ZRXA 2WVSA 3A5VA 4PTMA 5FJPA 3W7DA 3LTSA 3B97A 2UV8G 1YKWA 2D1ZA 4PL1A 1E6PA 2EPOA 5CGMA 1PZ1A 3LLDA 3NQMA 3R0DA 2VRKA 3C8FA 3HB9A 1TPEA 3F1QA 3NEVA 1VJIA 3NZQA 3PNZA 5A94A 2DSUA 1SO4A 4UTKA 4GBUA 4IPJA 2X7VA 4PMJA 1DJYA 3ABSA 3WMSA 3ABQA 4PMQA 4P7LA 1OYBA 3D47A 1Q6RA 3LCGA 2Z26A 3VOFA 4INFA 1V0NA 4PMYA 4QCEA 4OJYA 3LU2A 3TV8A 5FJRA 1LWIA 1YDNA 2VX6A 4XO7A 1KRMA 3KCJA 4GPNA 2VYOA 2W91A 2CBJA 4AEFA 1JYXA 4GO8A 2R8WA 1JYWA 3K1GA 4GKLA 2NQZA 3TA9A 2AQOA 1GOMA 5M3WA 1GG0A 2VWTA 3EOUA 4GX8A 5BRPA 3N04A 1NWSA 3MMTA 3IVUA 3RM9A 3CXOA 3NQ8A 1GOWA 3TW9A 3TAKA 2BTMA 2BX7A 3W7NA 2WK2A 1LORA 1MRQA 3AIWA 3FIGA 4X61A 1M7PA 1EA0A 3V1PA 2DY3A 5CBBA 2VZVA 4KKXA 1A5SA 2Y6ZA 1A4LA 5HPOA 3CLMA 5H8UA 2YKKA 3PNUA 4AY8A 3M7SA 1DIOA 2OEJA 3VKDA 1GOXA 3ATZA 4J5NA 3H2MA 2ESCA 2WC3A 4GC4A 1P0BA 4C6JA 1JI1A 3N4EA 4H6QA 3I7RA 2WNQA 3WDPP 3M7WA 1V0KA 1ITQA 1F8IA 1M65A 2C91A 4GVFA 3C3UA 3TR9A 1W5QA 3QYQA 1ADOA 1H1YA 1L2UA 2WJZA 3WNOA 4UTTC 3L4TA 5HUOA 3QSTA 1AZ1A 1EJTC 1OT1A 3SM0A 1TWIA 1U30A 1DJXA 1GQNA 1VFMA 4IT1A 2VEMA 4KS0A 2QW5A 1ME9A 1CGUA 4PMDA 4S23A 4ES4A 1KKRA 3T40A 1JZ3A 1JDEA 5T9BG 3IARA 2EPHA 1Q4WA 4H41A 3W72A 2FTPA 3TIMA 3UD6A 4HBKA 3B9EA 3ZT6A 2J75A 3FYOA 2OX1A 1VRDA 1WAWA 3HQOA 3W74A 2A3HA 4AMAA 3CH0A 1AW1A 3UA3A 3I7QA 1HQTA 2WB5A 2I16A 1HKJA 5JBFA 2ZZ5A 4Y8FA 4TMBA 4NZ5A 3OVPA 4C1LA 3E12A 1XRFA 3I6RA 4IQDA 1Q6OA 3RG6A 3W22A 1OD0A 4C6MA 2XH4A 1CEOA 3G24A 3VZXA 3SGZA 1PDZA 2PCEA 3AMDA 1GZJA 4BEUA 3G1HA 3IIVA 3LBOA 4WJXA 4L64A 5FAJA 3UWUA 3K4DA 1XLLA 4ZOBA 5CJ5A 3T0CA 3UR7A 2UWFA 1OX5A 3A23A 3VDGA 2HROA 3ALFA 2DH3A 1V0MA 1SW0A 1Q6QA 5AC8A 5BCAA 1UKQA 4ZE4A 5DEZA 5M5DA 3L68A 3PJXA 1XQKA 3NXLA 4EOUA 1NFBA 3N1AA 2Q09A 3S0CA 1IEIA 1TREA 4ICNA 1EGVA 1V6UA 3A3HA 4YTTA 1JUBA 4HZ6A 1JDDA 4H2HA 2LLEA 2Y85A 2XGIA 3RJXA 4JEQA 1VCFA 2EG7A 5C8BB 2CYGA 3M5ZA 4PBEA 5DQPA 3G1YA 1RY8A 1B3WA 1ZPTA 3RJYA 4EXAA 3I68A 3O9NA 3P60A 3GU2A 6XIAA 4IHCA 1US2A 3HFTA 1S2UA 1UD4A 4M1RA 3GNXA 2ON3A 3D3AA 4B5UA 4GZIA 2BS9A 3B0VC 3CZGA 3AMKA 4HOXA 1W1PA 3VD5A 1GOQA 1IZCA 1ISYA 3G18A 3WK3A 1U5VA 1HL8A 4PCFA 3FXGA 4CLMA 3GXFA 5DMMA 1NQ6A 3WFLA 4AAJA 2WJFA 2DT2A 3WMCA 3WF4A 1R0MA 2OYKA 5FJIA 3TN3A 1XF0A 2VGFA 3WF3A 5CPSA 2WBGA 1JYNA 1LG2A 2PTYA 2PWGA 1RALA 3QQWA 3BMWA 1IZJA 1PCKA 2C16A 3QR1A 4M51A 4Z0SA 3R94A 3Q4DA 4R7OA 2V8ZA 3R13A 2UZ9A 4OIFA 5LIWX 2AOSA 1ZENA 3KZPA 4EF9A 5AHFA 1LT7A 1ZL1A 4DX3A 3LM7A 4GI6A 3AHYA 3SBFA 4MUZA 3BLIA 5E6YA 4DLMA 2PDUA 2ADAA 1VCGA 2D3LA 1DXEA 1G94A 1BSIA 2A2IA 3CV7A 1W3IA 4GXWA 2NQJA 3B8DA 5EMUA 5CLWA 2RGLA 4MIMA 3WBEA 4KWOA 2C0HA 1TPDA 1KCKA 1ZZMA 4Q4RA 3OEXA 3NQ6A 4UFHA 3VGGA 4Q4MA 3WDHA 2NZLA 5A6KA 1HFBA 1QW9A 5CGTA 1H7WA 3UG8A 1LP6A 3WJWA 1S2VA 3U7VA 4I5XA 4D72A 1FXQA 1RK6A 1V4YA 4GQQA 3I65A 4PZVA 4AF0A 3N6QA 4IMGA 3TYZA 3VZZA 1JQVA 2A21A 4P7QA 1VCVA 5AYYA 3ZFHA 1R38A 3H4GA 3PB0A 2Y7DA 4I8DA 2J7CA 1V7YA 1W9VA 1E9ZB 4A3QA 1UWAA 4UMAA 4H9MA 4DZHA 3W25A 1XCFA 3LBMA 2OEMA 3M0YA 1I60A 1PCWA 3RMEA 4QFUA 5K3VA 1UH3A 4C6NA 1PYFA 3WUBA 2VCCA 3ZQ9A 1VRXA 2PA6A 1DBTA 3M0LA 4HHLA 3PPHA 1HJUA 3DHDA 3EB2A 2Y88A 4M80A 3W2KA 1OBAA 2PGWA 4DJEA 3B9AA 1EBHA 1UD5A 2BXYA 3AS3A 3M0VA 1YTEA 4KF1A 5CH9A 1KO0A 2XISA 1GOKA 4LVFA 2XVLA 3EWUA 2YBTA 1UPMB 4EX4A 1CGVA 1AUSL 3HPSA 4UQDA 4NJGA 4OGZA 2G50A 5EMKA 4YS1A 1IEWA 1M3UA 3AXIA 5BRBA 4XWUA 3P84A 1XXXA 3B8TA 2CW6A 2CERA 3CYJA 1LTDA 4YU1A 1FWSA 5TIMA 1IWAA 3NFUA 1HJXA 2WPBA 4GNVA 1EJVC 1XBYA 1GQIA 1DV7A 4EF8A 1AVAA 1FH9A 3KDNA 2YW3A 4PMXA 3VOIA 4AW7A 2DPEA 2PDNA 3OA3A 3N4FA 3IIZA 5I23A 3HGOA 2J7HA 1WZLA 5CXPA 4F0HA 3GE7A 5BWFA 3MKKA 1VPQA 3KL5A 3GTIA 1QNSA 3W7IA 4JXCA 4UTWC 2J77A 4DIAA 1VF8A 4IFOA 1GYMA 4S39A 4UFKA 1GPWA 1FWGC 3UR5A 1K7EA 2D2HA 5CG0A 1EPVA 3ITVA 1SUXA 1W0MA 4PRRA 4MWAC 3EEZA 4IIEA 1FOBA 2B81A 1QI0A 1E1FA 1Q65A 1R7OA 1F3TA 2ZA1A 2ZZ3A 1CXEA 3TE9A 5K4XA 4KFOA 1WDQA 1B3YA 1ONWA 4WK9A 2VGGA 4DJED 3UY7A 2FVMA 2GJLA 3GAKA 1TPC1 3P61A 1HIZA 3ZVIA 4DF0A 3ITXA 1J6OA 4GJJA 2GQ9A 1K7FA 3G0SA 1FDYA 3VC6A 1HKMA 1TX2A 1B3VA 2XIIA 3AXHA 5D9PA 2G5WA 3B8IA 2HSAA 5I3GA 4P8UA 3FKRA 4TTGA 3LRKA 4AF0B 3CQKA 2QGHA 3P5ZA 2XN0A 3AZRA 3U3HA 1QASA 4WKAA 3AI0A 4E4FA 3QN3A 3GNDA 3P2VA 4BR1A 5ABEA 2A3BA 2RFGA 1Q6EA 1J96A 1O5RA 2FTYA 3WIJA 3W23A 5KZDA 1Q3NA 3E02A 1EXBA 4KMQA 2YB4A 3KWXA 4QAIA 1IZKA 3LERA 3PM6A 3TH6A 4QLKA 1W56A 4H1ZA 3GU9A 1JQXA 1P4CA 5TQLA 1NAL1 1PDYA 1GTHA 5D2WA 1UP3A 5E9XA 3OZPA 1MWOA 1UPPA 1FWBC 2E9BA 3UWWA 3GFZA 2GYIA 1JZ2A 2V6AA 3WQEA 2VFHA 3BMXA 2ONEA 3ARYA 1EC7A 5L9FA 1UD8A 1ADSA 4A8LA 4ZENA 1B57A 2TRSA 3QTGA 2VOMA 1N7KA 3VOCA 4OV4A 1R3RA 4L9ZA 3N6JA 1HXJA 4U10A 3GD6A 4B5NA 2XGBA 3FJ6A 4R3UA 3ANUA 2VX5A 2ZWZA 1HG3A 3N3MA 4KFPA 3FSUA 1JFHA 2OELA 1UUQA 4M19A 3LPOA 4J3ZA 1EYEA 1FKWA 1J0IA 1DYSA 3SCNA 4JICA 3L5MA 1V3IA 3RPTA 1G1YA 4PUJA 5E09A 1PEZA 3ICJA 3CMJA 3FVDA 2PS2A 1XCWA 2P3ZA 4WVXA 1A5LC 3MB9A 1US3A 4NP7A 4EK7A 5F2LA 5KZEA 4EE9A 4MJMA 3L23A 4QE4A 3C2RA 3MVIA 3E0WA 3PPFA 2BXVA 4AZCB 2Z6JA 5LIUX 2D73A 2HK1A 4C6OA 3KS5A 4RV8A 1TELA 5I7GA 3USBA 3V36A 3WLHA 4C7GA 4Y9PA 1XIGA 3F2BA 3CGTA 1C7SA 4C1KA 1QHZA 1NDZA 2HZGA 4WGXA 3N11A 4M56A 4L80A 2XFFA 3QV8A 2Y1HA 2CLIA 3BC9A 3AO0A 3E3HA 5HJXA 3SFWA 4KGLA 2GQ3A 4UCGA 2QCFA 4RDYA 4UTLA 3CB8A 1QMLA 1W1B1 2DV0A 3WX7A 1I75A 3VCCA 1B1YA 2VCAA 1VB9A 5FSDC 5H8MA 3CV6A 3NDYA 4MYXA 1E6ZA 2QT3A 3GRIA 5KEZA 2BV9A 3UG3A 3W7HA 2DDXA 1BVZA 4AZIA 5CEWA 4TV5A 5ABTA 2OKTA 3EEGA 5I03A 1OSEA 2E9MA 3BTNA 1HP5A 1DTNA 2CLLA 4EKJA 5KMYA 1FWJC 5D9NA 1E6XM 4NIRA 4GQRA 4MGGA 4MOZA 1ME7A 1JPDX 1W1YA 2XM2A 3H2CA 4IP5A 2WJDA 2JQXA 1E15A 2X30A 1RZMA 2BY2A 3ZR4A 3FXYA 3P14A 4AEOA 3VIJA 1UZHA 3O15A 4IPLA 4WSJA 2JIWA 5GQBA 4LY4A 1ISXA 1S1PA 2CCRA 3RHGA 4LS1A 4WY0B 1EH9A 3E2SA 2Z2UA 1QRQA 4W89A 2Y0FA 3MJYA 3PS7A 3SEPA 3NGJA 3KOZA 3YPIA 1JCTA 3MV01 4RDWA 3S46A 4QJ5B 1WXYA 4UNIA 1TJ0A 1JPHA 1W3NA 1VYRA 2EKGA 4IX2A 1RCQA 1I2OA 5HJLA 4GWEA 3AJ7A 4FEZA 2XN2A 4NNCA 2G95A 4PRWA 1KCXA 4NZFA 4GINA 2FFCA 1QXLA 3LGEA 3R0KA 1A0DA 5DLCA 1ZHAA 1OVDA 4NZ4A 3COTA 2YGYA 3NSXA 5HANA 3W1MA 3W1XA 3IRDA 3TYEA 3TLQA 4WUIA 3F7JA 4RL3A 2XWDA 4CQAA 3W2MA 1LDCA 2J74A 2GQAA 3PBVA 4O8AA 2R9RA 4L9YA 5F7UA 1RQBA 1J12A 3WQWA 5DMYA 3IAPA 4OV9A 1WOAA 1F5ZA 4AIOA 3ITGA 3QKZA 4FO4A 5HBFA 1BWKA 3W1QA 4O57A 2DSKA 4V27A 1LOLA 4MB5A 3QMSA 4S2BA 3VIKA 4E2OA 1BYAA 4MVAA 4DNMA 1A3HA 3FJNA 1M9HA 3GAYA 3RIKA 4NYYA 3BAIA 4GISA 2D0HA 5DXXA 4CQBA 4O10A 1FQ0A 1Y65A 1TO3A 2ZZ1A 1GQLA 4RPQA 2J79A 2WZHA 1JCNA 3I3DA 2J6VA 1C92A 3VNYA 4IH3A 3UG4A 1BF2A 3G2GA 4HMCA 3THDA 2R94A 1W5NA 2W9MA 1KBIA 1V79A 2PAJA 4EIVA 1I1WA 3U6WA 3MC5A 1H7RA 3NSMA 3K8LA 1FCVA 3I4KA 3BZGA 4JYEA 3CAVA 3VGDA 3L66A 3QFEA 4PRTA 3FFSA 1WX0A 3C0SA 4OBRA 3TFXA 3CT2A 6A3HA 1KRBC 1AH4A 2BNJA 4YVPA 4O4WA 3AZTA 4FX7A 4R7WA 2C19A 4Q33A 3DIPA 4L6HA 4JHMA 1D7FA 3LCLA 3V4BA 4ZOEA 2CZFA 1VH7A 3UNDA 1F3WA 4YLWA 3GDKA 4RNHA 4DNHA 2YW4A 4HNCA 2PODA 3QPEA 4C6FA 4M1BA 4QE1A 1UP2A 1MVYA 4GNJA 1S5WA 1L8NA 2CNCA 1PJ9A 3EB4A 4UZSA 5HINA 4F66A 4XVEA 2RAGA 3EOSA 1WDRA 3VIOA 2YDRA 4JN6A 1XM3A 1ZAHA 3ENLA 2Z2BA 1FWEC 4JGDA 5D37A 3TAOA 5I3FA 1R2TA 3JW7A 4UOZA 2VJXA 2PGRA 3AMLA 4QNEA 3H22A 1E40A 3KM8A 1CB7B 3I7SA 1QU4A 1BEUA 2CFFA 1JDFA 3OZMA 1Q13A 2P76A 2F7FA 3QKEA 4C65A 1A3WA 3LMYA 4W8BA 2DZUA 2EG8A 4JKMA 2WZEA 4GKTA 4Q8WA 2ALDA 3A47A 3G1XA 3PZIA 1F74A 3PUGA 3UGRA 4I8YA 2P1FA 1B9ZA 3SCRA 4MHBA 4I7UA 2FPYA 5EB8A 4AXKA 3A3WA 3N2TA 3CQIA 3PFRA 3U5YA 3KVJA 3FSTA 3KHDA 4RXGA 2CXEA 4FX8A 4G1KA 1J0ZA 1YNPA 1RR2A 2PRHA 1EZWA 3KEHA 3GY1A 1A53A 3WQCA 3CMGA 1H4PA 5FIPA 3OIHA 4PUEA 1U5HA 3T05A 1OF8A 2ZX5A 1FWIC 5M17A 2ZX9A 4JL2A 2E40A 2XSXA 1TRDA 3BLOA 1AD4A 4MDOA 2ACUA 2WC4A 4GCXA 3VMPA 4NSBA 1H7OA 3BJSA 3C8NA 1E72M 1IIGA 4EPKA 3LGGA 1PWLA 5I5RA 3GTNA 4UTHA 1H5YA 4UTIA 3M0MA 3R8HA 3DU0A 1ZS2A 2ZX7A 1A0CA 1SQ7A 2DIEA 4I9MA 3T8QA 3W6YA 2W61A 1RAKA 2E9LA 1B9BA 4U5IA 4FIRA 3BW2A 3PK7A 5HQEA 3XISA 4KRUA 3GDRA 1FWHC 1XGDA 3BLEA 1W9BM 3CLWA 3K13A 5A3HA 3AIVA 1GVRA 2CC0A 4A3HA 1O94A 3E5PA 1A5KC 4Z42C 5BXRA 3KTSA 3Q67A 4XZWA 4KEZA 3U2CA 3CUJA 3CZJA 1XLDA 3R12A 4H9VA 1L6WA 3LRMA 5EU9A 2OQHA 2PBOA 2OZ8A 5C54A 5A69A 4XKYA 1RLDA 5DRIA 3U4AA 1EJXC 4Z2HA 4EPDC 4X22A 3L4WA 3C56A 4DXVA 2OYLA 3BJFA 1ZQ5A 3GSMA 3UYCA 1XLHA 4ACYA 3BOLA 1TV8A 1EF2A 1AODA 4HCDA 3EDFA 4IP7A 2QS8A 1JZ5A 4GZJA 2WW5A 1ZGDA 4HU8A 1JUEA 5EBAA 3NQ7A 3SAZA 4ZTYA 1I2RA 3NPUA 2PDFA 3H21A 3NZPA 3K4WA 6REQA 1DHKA 3KVKA 4GZ7A 1HNYA 3CEUA 3PZMA 4JN8A 2ZXBA 3UPBA 3ES7A 2G3NA 1Q6FA 3H70A 3GYEA 1M7XA 1JJKA 4DBUA 4HSNA 4WDUA 2DZPA 4J1OA 3MW7A 3DFYA 4R9XA 3HPFA 2OLAA 1MZHA 4AZ7A 1J9YA 4RE0A 3N2OA 4QIUA 5JIPA 4MB3A 4IPPA 5K9CA 4JX5A 1ISVA 4V28A 1F61A 1X98A 3UZJA 1UMYA 3RCYA 4GA8A 2I1OA 3BURA 3WD4A 3RLVA 4ECLA 2EJ1A 2DZAA 3PANA 1RJRA 2D2GA 1H11A 2FB2A 5K7JA 2J7GA 3CU2A 3U2ZA 2YX0A 3WLPA 5JU6A 2QDHA 4GABA 3L4UA 2HPMA 2DT3A 4DJEC 4I9TA 3MKCA 3THAA 5CPNA 4O0KA 3V35A 3M5XA 2WMFA 3BW4A 1DE6A 3GDMA 4JTSA 3ARUA 2YXXA 5CQ1A 3BE7A 3O07A 1HX0A 2GVYA 4PUNA 1GVFA 2E77A 4MAVA 5F4XA 2V5BA 3BAWA 4YJ5A 2NUYA 3W70A 2E5BA 1SU5A 1OQFA 3K5XA 1JUKA 3A9IA 4K37A 2VEGA 4HA3A 4IGHA 3QVQA 3EDEA 2B31A 4PE8A 3NO3A 4XQ6A 1MQQA 3V0SA 3V0UA 4HD5A 1RPKA 1MO0A 1B5TA 3AHTA 3BW3A 3U4FA 4M6QA 3B4UA 2O7SA 5IRPA 4O0QA 3LSCA 3CS2A 1J0JA 3LNPA 3UJFA 2C7FA 4GH1A 4IF2A 1ZLPA 3KE0A 5EL1A 3CQHA 1E3ZA 1XG4A 4YVXA 3ZLFA 1P0DA 4P8WA 3VE9A 4PCSA 4JHOA 1ZJHA 1DQXA 3ABZA 2VGBA 1XBVA 1B3XA 3KWSA 3WDIA 4F2TA 3ABOA 4UC5A 4XKYB 3WH9A 1SFSA 1O12A 4K7VA 2IUZA 5I79A 4F2UA 3HZ3A 1VC4A 2QGYA 4YCOA 3C3NA 2GVJA 5CJMA 2GSHA 4FLOA 4PGLA 4H4IA 5G1MA 1I0BA 4AVFA 3JRKA 4TX9A 2QPSA 5AYZA 1JI2A 1XLKA 4PUKA 3IJLA 3T0TA 3EPNA 3AXMA 4Q32A 1PB0A 3BDKA 6REQB 3LCHA 3TA6A 4YTSA 2AL2A 3IV8A 2HVMA 5E9AA 1Q5MA 2X1RA 4Z08A 3AAMA 1QW7A 1H61A 3GH7A 1QJWA 1OYCA 1T40A 3ANYA 4LRSA 5TBOA 3VMNA 1OY0A 2PGFA 1XLJA 3Q94A 4LYRA 2BOEX 4DM1A 4TVCA 1W37A 3W6MA 3R58A 1PVNA 2Q8LA 2WNNA 3U7BA 1TZ7A 3RM8A 3GWQA 4AD3A 4KETA 3QR0A 3NM3A 3BAYA 4HK6A 4LSBA 3T0DA 2WSQA 2JGYA 2XSBA 3VD9A 3F5LA 4FP1A 1Q8JA 2HXTA 3OIXA 3RNDA 4OUEA 2HXUA 4PEKA 1HKVA 3B40A 3PUOA 4P7OA 2WBKA 4GYJA 3VIMA 3VO0A 1CYGA 1NFPA 4RZ5A 2VFDA 5EMJA 3ZSTA 1QNQA 3G77A 2HBXA 2DGAA 1KTNA 4AVNA 1XSJA 3RFAA 3RLUA 1TTPA 3BLLA 3NPWA 1KD0A 1X8FA 1YE6A 1ZRQA 2E6FA 5HATA 3CZKA 3HM7A 4UB9A 4ZR8A 2DVTA 4GI9A 1TWWA 4L6DA 2PWEA 1VEMA 2ZXAA 3ZJ6A 3TSMA 4HU0A 1XLEA 3DOPA 4JY8A 3A4AA 4FNPA 4CD5A 4O53A 3DG7A 1E0UA 1QT1A 4PUDA 4FSAA 2PSNA 4DWSC 3O0FA 5F1VA 5CCZA 3KP1A 1OIMA 3CWNA 2V5JA 4KCVA 5G4EA 3WEZA 4LVAA 4K38A 3RCNA 2EPMX 4ZVJA 1HTIA 5DXYA 3L21A 2PWHA 3V18A 3H8AA 1AH0A 1KM1A 3T07A 2JKAA 3BCDA 5G2HA 2P53A 4HHHA 1XX1A 1QPRA 4ERIA 3R8RA 3CAQA 1L6YA 4RK8A 4IX0A 4LAZA 4L65A 5C7VA 2ZZ6A 1SJDA 4LXFA 4JPGA 3S5YA 3PC0A 3IIPA 4FOJA 4IXXA 1ZAJA 2J9XA 3IGSA 5T9CE 1VYSX 1WO2A 3WH6A 3TQPA 3NPVA 4IMEA 3CYVA 1DWFM 4D8ZA 1Q7MA 5JXQA 2GSEA 4N4QA 3B8SA 2J62A 2OODA 3BAKA 3VA8A 1AJ2A 1HVQA 3W38A 4JR5A 4H04A 1TJ2A 1UA7A 4ROQA 3VKAA 3RR4A 4WEVX 3SN0A 2ZKMX 2J9ZA 4E2BA 3JR2A 1J8VA 5D38A 3VM7A 1XG3A 4U2ZA 4RNIA 1O7AA 4IIDA 1M01A 1ECQA 4HYWA 3L4YA 3SUSA 1WE5A 3URBA 1R3VA 3U8GA 2C1GA 1TR1A 4PSPA 1W1VA 4WD0A 3WNPA 2NV2A 3A64A 1FHUA 3GHTA 1X1NA 4CVUA 2PP1A 1NF7A 4AHOA 1TTJA 1FA2A 4P8VA 3OPSA 4PCPA 1UMLA 1TCDA 5M2FX 3W85A 3TJXA 4PB3A 2A1YA 1KFCA 2QLYA 3SRDA 1ZY9A 3UESA 4WXZA 1Q6GA 5DN1A 1QHPA 1KXQA 1VR6A 3W7EA 2O92A 4N6FA 2VKZG 2WZMA 4I6VA 4N9BA 1W17A 1CCWB 3EOLA 4QTGA 3HBLA 3GQYA 1LBFA 1GJUA 3AXKA 4W9TA 1P43A 5A6SA 4Z2JA 1C29A 3O06A 1LOSA 4J3SA 4LVBA 5D4YA 3NQDA 5LGZA 1DWGM 4D6FA 5I02A 1P0KA 3WF1A 2GVEA 4Z1AA 4LY8A 4TX8A 1FH7A 4CQDA 2VI0A 1B4EA 3BV7A 4FOKA 2OZTA 2PTZA 3QGAC 3W7KA 4JTIA 5D30A 3WQDA 5AFDA 3SUUA 1ONRA 3PZTA 3BG9A 2OGJA 3GDBA 3W1PA 1N8WA 2H6RA 1LL6A 4CCEA 1K03A 2OKOA 1W1TA 2FFIA 2XIQA 4FXFA 5FD0A 4UTJA 3ARRA 3GHSA 4HNUA 3SR7A 3AYSA 1OWQA 3P80A 5AHIA 1LROA 3ELFA 4P7NA 1X96A 1UP0A 4A35A 1F4HA 4RDZA 1ITUA 1QOPA 1UROA 1Z3NA 3M5YA 4OWGA 4LU0A 4JBRA 2I5QA 3ZO9A 3ISIX 3M46A 3DENA 4JQ3A 1RVKA 2ACSA 2G3JA 4LAUA 1M7JA 3BICA 1R86A 1OGGA 3TYBA 1KCZA 5AZ1A 3MUAA 5LIYX 3AXXA 1GZGA 3E2VA 4AHQA 4KEUA 3IUHA 4RW5A 4J7RA 5C9UA 2ATMA 2BGQA 3TC7A 5IBXA 2HS8A 4JKLA 1LG1A 3LPGA 3JU2A 1TWZA 5FACA 2WPGA 4HNVA 3LBCA 4A4AA 2OX4A 3APYA 3WN6A 4DY1A 1J6PA 4DYJA 2VEKA 3W9ZA 3BPWA 3WF2A 1SFJA 4A3YA 3BLKA 3NL6A 2QMJA 4LVGA 5D2VA 2QJNA 2V2HA 1K3UA 5JUVA 3TSDA 5TF0A 3LXAA 4JIPA 4BFAA 3R25A 2O4QA 4U33A 3FEMA 1PKNA 1HT6A 2D24A 3OLEA 4WJEA 1V93A 4Q4PA 1RH9A 4H7VA 4H9UA 4F79A 4JTHA 2CWNA 1EC8A 2Y61A 3EX4A 2YPIA 3WDJA 2PTXA 2O9RA 3WQ4A 2INEA 4EXQA 1B0IA 1M7OA 4HPXA 4W7WA 4N6EA 1FHVA 1BF6A 1D7KA 3LZ5A 3TROA 1VJSA 3MUCA 1BTCA 4XZHA 5C6MA 4UTUA 4BK9A 1DJGA 3POHA 5DBTA 4UR7A 4A2SA 4Z2IA 1BRLA 5LNWA 1OT2A 4BQ3A 4QISA 3TNBA 2W5FA 2OLSA 1TQJA 1NELA 1UQYA 4XD5A 1QNRA 3LHTA 4HT3A 2IPJA 2VO5A 3C2VA 3B0YA 4ZB0A 3TP4A 4UFIA 5IM51 4HN8A 3MZ2A 3UWYA 3TN4A 2DFAA 5G2IA 1YHTA 4FB7A 4DELA 3KW3A 1WXZA 3DFNA 4OECA 1EBGA 2CZVA 1W1A1 4QLLA 3VI2A 3VGFA 4BCEA 4GACA 4E8DA 4FXSA 3GVQA 4ZSUA 1HN1A 5HWNA 3E6EA 4LH8A 1FVPA 3W1TA 3QMRA 3ZJ8A 3MBFA 4ROPA 1W5OA 4B4HA 4B4FA 4RE4A 2PF8A 4L9XA 3RLHA 1PIIA 3LB0A 1XLFA 4UOQA 3IEBA 1YDOA 3QOKA 6TIMA 1E1CB 3S1VA 4ZQOA 1B31A 3KBVA 1C8VA 3I6TA 5I24A 2XIMA 1OHLA 1PTAA 5A2CA 2Y5EA 2BFGA 4M82A 3DHUA 4C6QA 2NQLA 2C8NA 1R30A 1PXGA 4K36A 1C7TA 7CGTA 2I17A 3KAOA 5I06A 5BMXA 1S5NA 2YL6A 5FEPA 3BOFA 2VFGA 5A95A 3R43A 1ZCOA 2VDGA 2XSAA 2XINA 1KKOA 3JS3A 4IIGA 3S8HA 4OKDA 1JD9A 4NZ3A 2VQUA 4N9EA 1XFBA 1XH2A 1XD1A 3O1NA 4HHMA 1Z7AA 4QG9A 1DVJA 3MWCA 5EKYA 3N29A 1MUMA 3DECA 4MG4A 3R11A 1JAKA 2B7OA 4R7JA 3T2PA 2HPIA 4W8LA 2W92A 3QW3A 3F2CA 3A9BA 3AMGA 3MANA 1FWFC 3CL6A 2Z1XA 5KTLA 4L4LA 2B7PA 5BMWA 1IWPA 3FAXA 3VUSA 3WLJA 4LTSA 4AZBA 3B0UX 3OLGA 4IM4A 3E0LA 1YXYA 2A7PA 1MI3A 5DANA 4JTLA 3VFLA 5FL1A 2V81A 2ZE0A 3R8GA 5FSEC 3PWAA 2ZRWA 1TIWA 3GFYA 2Y8KA 4LGXA 1BRLB 1KFWA 3ATYA 2FGBA 3E96A 3VKJA 4TR9A 3BSGA 3C0LA 4AY7A 4E4UA 4K6AA 2QJIA 2ZXQA 4E0CA 4XAPA 3W4RA 1TPWA 3H12A 1KM0A 2DH2A 3PBMA 2G97A 1OFQA 1MFVA 4DO7A 3G22A 2XZ9A 4JTJA 3PTQA 3GX9A 3AS2A 1VBUA 3MMDA 4GGBA 2H3DA 4ORMA 1XUUA 1X6NA 3OZYA 3QHOA 3FGCA 2ALRA 3P0XA 5J5DA 1EHAA 1K4GA 4K1WA 4LF1A 5KZ6A 2F61A 3P7YA 2Y5SA 3KUMA 3OJGA 5EY5A 5EYWA 4US5A 2X05A 4H7ZA 3TYCA 3V7PA 1I1XA 3PULA 4ZQNA 4W84A 1CGYA 3DKLA 3UVIA 4HZ8A 2OO6A 3AWOA 3S1GA 4S3CA 4MNJA 3CHFA 2YXGA 5U7SA 4F0LA 3QC0A 3PZNA 1HJSA 1OG6A 3LK6A 1OFRA 3EWWA 3E0FA 3N34A 3BG5A 3CAKA 1NH6A 4Q6XA 3GR7A 3M0JA 3KHJA 1UD3A 1JPKA 4NXKA 5FEZA 2XIOA 3WJYA 4WXYA 3USZA 2YDSA 2PFHA 2XYLA 4MB4A 4D6EA 2I14A 1H63A 3BG3A 4JTRA 3ZLHA 2FH6A 1P48A 3TWBA 3LHUA 3VD3A 1Q6LA 1GJWA 2QR6A 4FR1A 2ABAA 4MUPA 2BGNE 3GHRA 1ENUA 1OFPA 3CTTA 4UBPC 1TQXA 4I7WA 4LAKA 1OABA 4L56A 4PSRA 4ILSA 1BPLB 1IEVA 1TV5A 2G3IA 1AW2A 5IDIA 1KV8A 1K8XA 1GJPA 4F0SA 3B4YA 1VGAA 3BCJA 4DB7A 3NR0A 3G6MA 3THQA 5I3IA 2BHZA 4ZQPA 3AMCA 4HQVA 3U57A 1O1HA 4H2CA 3IIXA 3NJ3A 2FZ9A 4GFIA 3GVWA 3VGEA 3EWDA 3IVSA 3UBPC 4US5D 3MCNA 1V3KA 2F84A 3GBEA 4WRHA 3URNA 2H9AA 3IGUA 5CBIA 5A8MA 4E2VA 3O05A 4QE5A 4I9JA 5FJJA 3B9NA 4A6GA 1XDMA 1A5CA 1EUAA 3R4IA 3LG3A 1R3WA 5AYBA 2J7FA 2VEIA 3QBUA 3S2CA 2I5IA 3ZM8A 3HV8A 1G0CA 5I3JA 2PDHA 4H6RA 1JNEA 1A5UA 3EWZA 3AIEA 2VGIA 1YYAA 4LX4A 4HTBA 3PZGA 5CPLA 3IS4A 3QLDA 1VYPX 3CUGA 1JF5A 3W83A 1KR1A 1IT8A 1HKIA 4E8GA 1YEYA 5A6JA 3N2XA 3N4AA 1MEWA 3INPA 1EJWC 3MA8A 1EB3A 1MXDA 3S5OA 4DXKA 2BWGA 1IGWA 3O6AA 3GNRA 3IRSA 4IGSA 4GIYA 4V33A 1R3QA 3PTMA 3IJ8A 3V1HA 3G1AA 3OGSA 3DG3A 3PZ9A 2R91A 2ISFA 3TQ0A 4LBSA 2FMOA 1YQ2A 3L2MA 3ZT5A 1UD2A 4N42A 3NL3A 3LI0A 1K8CA 3K8MA 3UZXA 3W1UA 3E5BA 3NQ2A 2X7WA 4FAMA 3NG3A 4H9XA 2ZZ4A 4X63A 1W2VA 4XKMA 5CPOA 3EKLA 3PZOA 2EF9A 3NTYA 1K6AA 2HTMA 2YCLA 2OT1A 3IJ9A 1UIOA 5JBEA 3I3EA 1UOZA 5CKSA 1T8XA 4ZO8A 2BY1A 4PBFA 3HV9A 2IW0A 4JN7A 1E1EA 4DWDA 3LQGA 2DUZA 3HO8A 3F4VA 4XTIA 4NQ1A 1ICQA 1XSIA 4PH6A 1TJPA 5LNRA 5AN7A 1PL9A 3FNDA 1W91A 4RZBA 1H1NA 4LUJA 3SRHA 4AY1A 1W31A 4I6KA 5T26A 3HMJG 2GOUA 1F05A 1T41A 3GFXA 1BD0A 4Q8TA 2HISA 1PIFA 3N3TA 5DX7A 4BS0A 1EA9C 3WENA 2XFRA 5LNSA 1CI1A 4E8CA 2VWSA 4MDPA 3LDVA 1KQZA 3LSBA 1Y7VA 2QNEA 1VLWA 2FZNA 1I6NA 1GHSA 1RA0A