4XIAA

Structures of d-xylose isomerase from arthrobacter strain b3728 containing the inhibitors xylitol and d-sorbitol at 2.5 angstroms and 2.3 angstroms resolution, respectively
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
393
structure length
393
Chain Sequence
VQPTPADHFTFGLWTVGWTGADPFGVATRANLDPVEAVHKLAELGAYGITFHDNDLIPFDATAAEREKILGDFNQALADTGLKVPMVTTNLFSHPVFKDGGFTSNDRSIRRFALAKVLHNIDLAAEMGAETFVMWGGREGSEYDGSKDLAAALDRMREGVDTAAGYIKDKGYNLRIALEPKPNEPRGDIFLPTVGHGLAFIEQLEHGDIVGLNPETGHEQMAGLNFTHGIAQALWAEKLFHIDLNGQRGIKYDQDLVFGHGDLTSAFFTVDLLENGFPNGGPKYTGPRHFDYKPSRTDGYDGVWDSAKANMSMYLLLKERALAFRADPEVQEAMKTSGVFELGETTLNAGESAADLMNDSASFAGFDAEAAAERNFAFIRLNQLAIEHLLGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-XYLOSE ISOMERASE
publication title Structures of D-xylose isomerase from Arthrobacter strain B3728 containing the inhibitors xylitol and D-sorbitol at 2.5 A and 2.3 A resolution, respectively.
pubmed doi rcsb
source organism Arthrobacter sp.
molecule tags Isomerase(intramolecular oxidoreductase)
total genus 141
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 5.3.1.5: Xylose isomerase.
pdb deposition date 1989-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4xiaA00
4XKMA 1DE5A 5TNVA 3DX5A 2Q02A 4W4QA 3U0HA 3C0QA 2GYIA 4K1GA 3DBNA 5XINA 5B80A 4US6A 5C9ZA 3UA3A 3C0SA 3CWHA 4PFHA 4Q7IA 4PGLA 2QUNA 2X7WA 3M0YA 4A8NA 2QW5A 4J4KA 3BDKA 4DUOA 3KCJA 3ITVA 4EAYA 1OADA 1XIDA 3CQJA 3M0VA 1XICA 3VNLA 1YX1A 2X7VA 1XLMA 4HGXA 3CQIA 3AAMA 1CLKA 3M0XA 1XP3A 4QE5A 5FA5A 4QEEA 9XIAA 3CQHA 3BWWA 1XIIA 1XIBA 2QUMA 3CQKA 4QDPA 5EMJA 2I57A 8XIMA 1GW9A 2NQHA 3KBJA 1DE6A 3WQOA 1XYBA 2ZVRA 1XLFA 2HCVA 3IUDA 1XIHA 3BZJA 1K77A 3VNIA 4OVXA 3ITYA 5AVHA 1A0EA 3VNJA 3ITTA 5B7ZA 3L23A 1XLBA 3KCOA 4HHMA 1QUMA 5EMKA 1XLCA 3ITXA 2J6VA 3GNXA 3M0LA 5EMLA 1XINA 6XIMA 7XIMA 1DXIA 3KBMA 3NGFA 4G56A 3C0LA 4A8RA 2XISA 3KTCA 1XYCA 1TZ9A 3JU2A 3KCLA 4ZB2A 4QEHA 1XLGA 3QZAA 3QC0A 2NQJA 1XLLA 5XIMA 3M0MA 8XIAA 4A8LA 1MUWA 4GQBA 1XIFA 3KBSA 3AYVA 4GJJA 5H6HA 3IUHA 2I56A 3P6LA 2GUBA 5AVNA 4YTSA 1S5MA 3ITLA 2XIMA 1XYAA 1XLAA 3BZGA 3AYTA 3KBNA 4XSLA 1XIEA 5XIAA 2OU4A 4A8IA 3VNKA 3LMZA 3CNYA 3P14A 4YTUA 1XYLA 2GLKA 3ITOA 1A0CA 3KWSA 3UVAA 4QDWA 4E3VA 1XIMA 3IUIA 4X63A 4DVOA 1DIEA 1XIGA 4YTTA 3N4AA 1XLKA 4YTQA 3BANA 3XINA 1A0DA 4LNCA 2G4JA 4K3ZA 3UXIA 1XLIA 5I7GA 3M0HA 4GLEA 3QXBA 1BXBA 2GVEA 4ZBCA 1I6NA 1XISA 4XSMA 3AALA 2XINA 1QT1A 2ZDSA 1XYMA 1XLHA 4XIAA 2NQ9A 3VYLA 6XIAA 4ZB5A 5B7YA 3XIMA 3QYSA 4HNOA 1XIJA 4GJIA 4QE4A 5J8LA 3KBWA 1D8WA 4YTRA 3FVMA 5EMMA 1I60A 3KBVA 4QE1A 9XIMA 1XLDA 5H1WA 1BXCA 1XLJA 2HK0A 3TC3A 1DIDA 3U3HA 1XLEA 3UA4A 1O1HA 1QTWA 4X60A 3UU0A 4X61A 4HHLA 4XISA 4KW2A 4ZB0A 2HK1A 3XISA 1S5NA 4EACA 3VNMA 1MNZA 2G0WA 3TVAA 4XIMA 3OBEA 2QULA
chains in the Genus database with same CATH superfamily
3BAJA 4GXMA 2OZ8A 3RO6A 4MDPA 3OG3A 3L0GA 2DT0A 2XWEA 2VGIA 3P0WA 2D69A 3RR1A 3OLEA 3FJNA 1SW3A 3LZ3A 2FGBA 3ALGA 2ZADA 2CU0A 3VCCA 3W24A 3K1GA 1QRQA 3OLDA 2HPIA 3T44A 2WZEA 1EO7A 1HTIA 3WQOA 2Y1HA 3KTXA 2IQTA 3VIKA 3NL6A 1QHZA 4H2CA 3P82A 5E1QA 4PCTA 3A21A 5EMLA 4DPQA 1PKMA 2EJAA 4XG1A 3M5VA 1C29A 2NX9A 1SO3A 3OB8A 3CH9A 1GONA 5A3HA 2E1DA 3LLDA 4US5D 1ONRA 3HPZA 4MF4A 1EX1A 3VUSA 3MZ2A 3R58A 1LTDA 4F9JA 3B9AA 2XHYA 4KEUA 1FWTA 1A5UA 3HJZA 4WY0B 3NQ7A 1PL9A 1KFEA 4WUIA 4UZSA 3RILA 4H6RA 4HA3A 1QT1A 1M53A 2OLHA 3ARQA 3NIYA 1IF2A 2Z1WA 3P2VA 1F07A 3D3AA 5BRPA 1C3FA 5AFDA 3AXIA 3ORWA 3STEA 5EMMA 4GK8A 1S2TA 4LB4A 3CL7A 4OUEA 2IPGA 4AZHA 3DERA 2CKRA 4PE8A 2QCEA 1O60A 3CT7A 2VEKA 2ZFAA 3CIVA 5CG7A 5G1TA 4PRWA 4HNCA 5F2MA 1GZGA 1E6QM 4ERGA 2VVSA 4C6DA 3NZQA 1TPWA 3PPGA 1UWSA 2ZXBA 2X2GA 3NWRA 1KV8A 1E6PA 3BSGA 4JX6A 1GGOA 1M1BA 4DY1A 4JFSA 4PMZA 1RALA 1TV4A 3CC1A 1KA9F 3R4IA 5HK4A 4JIIX 3VM5A 3TMQA 2YW3A 3Q67A 5C6MA 3URNA 4NI8A 5E93A 1HJXA 1E51A 1DJXA 2INEA 4QP0A 2A3EA 2J13A 4JIEA 4KGJA 2OKTA 4DWSC 1XXXA 1GYNA 1ITUA 3VGFA 1EF2A 1MW1A 5CGQA 2QQ6A 3L2LA 1EX5A 5IFTA 5T9CE 1W3NA 2X8RA 3HGJA 2MANA 1W6TA 3ATZA 4DN1A 3OLIA 4O8AA 5TF0A 1RH9A 4K3ZA 3QXBA 3P84A 3AZSA 4BI7A 4ALDA 4KCUA 1XYFA 4LYRA 3F7JA 1BXCA 1E6RA 2BVDA 2J74A 3C2YA 1BYBA 1E5JA 1SO4A 4IIEA 3VKAA 1W3TA 3DHUA 4KW2A 1DJYA 3UWEA 3GH5A 4KETA 1J0ZA 4ZGYA 3WH9A 5BXSA 4JQ3A 3Q94A 3W7MA 5CXPA 3UYIA 1TX2A 3HA1A 5JVLA 3BQ5A 4WZHA 3WFAA 3T6CA 1MZRA 1XL9A 4AEFA 4QJ3B 1PHWA 4CLMA 3W74A 1BXNA 2VGFA 4YVPA 1PIIA 2XYLA 1U83A 3AXHA 1W1VA 3UWVA 2RH9A 4JCMA 2NQHA 5AYYA 1DE6A 2J6XA 1W31A 3LXAA 2QXWA 1KTBA 2OODA 1V08A 4CCZA 4H8UA 3ZVHB 1UIPA 4KWVA 1Q63A 4XAFA 1Z32X 4GY0A 4DELA 4MNJA 3L5AA 4N4QA 4C6QA 5LHEA 3GXNA 1EP3A 4GJJA 2Z4GA 4H7VA 3E0FA 1HVXA 3NQ6A 2D0FA 1V3IA 5AC7A 1JL8A 1K7FA 1U5VA 2VR2A 3CL6A 3ICJA 1GKQA 4C6KA 5DN1A 2JALA 3EXSA 4OUIA 1E4NA 3SQLA 1A5SA 2DQXA 3EWYA 1OZMA 2RJGA 4NKCA 3BXWA 4Z2IA 3GIYA 3CV6A 1JDCA 4Y96A 3MQTA 4K38A 1TREA 1EL3A 4LUTA 1SMDA 2DUAA 3ELFA 3LPPA 2PTYA 3IS4A 1QO5A 4FOKA 3MPGA 5E6YA 1T96A 3GNDA 4PR4A 2VKZG 2CKSA 4HPJA 4F79A 5LYRA 1EDGA 2Y2WA 3A13A 1CXHA 3VOJA 2VR5A 4C6CA 3WJZA 4GX8A 2VFEA 4RLIA 3OP2A 3DC8A 4R53A 4W84A 3PUEA 2GJXA 1TE1A 2J75A 2TSYA 1OF6A 2XIBA 3EKLA 1B57A 4P8WA 1PDYA 3V7PA 4DWSA 3HBLA 3L4UA 3NVDA 4U28A 1LQ2A 1QR7A 3P5ZA 2ZRZA 2NSXA 3W7QA 2POTA 4A3UA 5H8MA 2PGEA 4DPPA 1VQTA 3T2QA 1EBGA 2CW6A 2Z00A 1KQZA 3VKCA 2DVXA 2ISSA 8CGTA 5DT7A 2Y61A 3LMZA 3VIJA 2ZBTA 1TFVA 4S3CA 1HKKA 1KRAC 5MKGA 4Q4SA 2ZTJA 4IGMA 1XLIA 5I7GA 1J11A 3AHXA 4JTRA 1F8MA 3KZPA 4MWAD 2E6AA 3ERPA 1J9YA 2GOUA 1UKTA 4L65A 3LD5A 3W1NA 2IXVA 1VGAA 4X60A 3UG4A 1EUAA 3QTGA 5JU6A 4MHBA 1SYTA 1G4EA 4O1CA 3K5XA 1KFLA 2WZHA 3GG8A 4NNBA 2PTDA 3VDHA 4D8ZA 4QG8A 1CW2A 1B3VA 4WK9A 4O1DA 2O4QA 2QUTA 1SSGA 4MM1A 1EDQA 3P7YA 5HBFA 3W29A 4W5UA 3QZ6A 2ICSA 4D2JA 2YA2A 1DHPA 2BGQA 4GYKA 2YB1A 3BJFA 5C7VA 1R5YA 3S0CA 1PIFA 4GGHA 4AZ6A 3PBUA 4ONVA 4G56A 2EO7A 4AEEA 3KTCA 4ADUA 4PUJA 4NZFA 4U2YA 3QOMA 1HGWA 2CC0A 3L2MA 2GGEA 3W01A 1I8JA 3EEGA 2Q8ZA 2ZA2A 3W1QA 1IGSA 1UR4A 4HHPA 1M3UA 3TONA 2C91A 6REQB 4HU8A 3SCVA 2XN1A 4XAPA 2YJQA 2ZX8A 3R0DA 3WD3A 3LHYA 2AQOA 2TODA 4WOQA 3G3DA 2BGSA 1JXKA 4CCCA 4G7EB 4MKVA 3WN6A 3HG5A 4NJKA 4ACZA 4M3PA 3N6JA 3YPIA 5E0KA 3ZLHA 4HTBA 5BOEA 3A24A 1E6ZA 4JPGA 1V3LA 2PPGA 5D32A 3CUXA 4WSKA 5ECUA 2D2JA 3TJIA 1BHGA 3A9BA 3ZJ7A 5TIMA 2FH6A 1YRRA 3LQLA 4AVNA 3R11A 4KERA 1XM3A 2QUNA 4QROA 4QAIA 1OD8A 1L6FA 5LA0A 2PF8A 1G69A 1K9TA 2H6RA 4NT0A 4TX9A 4HVXA 5I07A 3N12A 3ES8A 1ME9A 5G1YA 3UPMA 4PN2A 5FACA 3VDGA 3H2FA 2YDSA 4NJJA 1I1WA 2UY5A 2C1IA 2EGZA 2EPKX 2Y5EA 3QSTA 5EMUA 1NOWA 4ZEPA 3OEXA 3LV5A 3PZTA 4XZMX 5J5RA 4YXGA 3T0AA 4IMFA 4FSAA 4CU7A 3MO4A 4RX0A 4IX0A 1UBPC 3USZA 4LV4A 3SCRA 4X9YA 1O7AA 2VVNA 4FEZA 1KLZA 5C7HA 1FWAC 4E38A 2XZ9A 1JPHA 4W86A 2UWFA 3PG9A 2IKHA 1Q7ZA 2Y7GA 1XLJA 3W88A 4UR9A 2WMGA 2OXNA 5CLWA 3JZEA 1J6PA 1NFPA 4UTFA 3KOWA 1DJQA 3IPWA 1EPVA 1IWBA 3PTDA 4Q8UA 2VM8A 1LROA 4GISA 2PGWA 3TYEA 2VL4A 5MF5A 3WLLA 4OHQA 2FGZA 1WBJA 3FGCA 5M17A 1BWLA 4EANA 2PBOA 3T8QA 1R3VA 2VR4A 1OZQA 4CCDA 3ES7A 3RNDA 1DJNA 3C2FA 1V6TA 1O4UA 1S2AA 2CZFA 3GR7A 1XH2A 3THQA 4J9JA 2DIEA 2YIHA 4LUTB 4CN1A 2Q71A 3W1LA 5DBTA 1FH7A 1ADOA 5A69A 3E0LA 3GTHA 3IK4A 4FB7A 3PPHA 1US2A 1QVBA 5AZ1A 2WWCA 3WNLA 1EIBA 3VABA 4WVXA 3TOYA 1ICQA 5H6HA 3R0KA 1B9ZA 3UBPC 2OU4A 3H2OA 1OYCA 4MFEA 1DWGM 3URBA 5C9WA 2GJXB 4H7CA 2YA1A 4ECLA 3NQAA 1DJZA 1WXYA 3QH2A 4AD5A 4DWSB 3GG1A 3UJSA 4JFUA 3V0UA 2VZTA 1VFLA 2QDGA 1LOSA 4GYFA 4AW7A 2PE4A 2RUSA 2YBTA 1KO0A 3STPA 4IMEA 3WF0A 1H0GA 4W89A 3RX4A 5HJLA 4TQTA 2NV2A 4ML4A 3NUKA 3MI3A 2V2HA 3SB0A 3FA5A 2Z1BA 2ZE0A 2VDIA 4B5NA 3M16A 3GDTA 2Y89A 5MKGB 4K1GA 4LT9A 1XDJA 1LRTA 3L67A 3MMDA 3JUGA 1F3TA 5BU6A 4LYQA 3RLGA 3HPSA 4UZUA 4PTXA 4ICCX 5FAGA 2YCLA 4BQ3A 2OKOA 1GOWA 3LRKA 3EPOA 2E09A 3E2SA 3W28A 4QAWA 4AMCA 1TTJA 4KQNA 2INZA 2G3IA 4OVXA 1UZHA 3RYSA 1KRMA 3OOQA 3SEPA 1Q45A 1SQ7A 3WKZA 3L7RA 4S3FA 5I6SA 1GKPA 3RLVA 3U57A 1VJIA 3W7RA 5A6LA 5A2BA 3ZYZA 3VKBA 1EC7A 4JQ2A 1PZ3A 3VGGA 4Y6GA 1B3YA 1VKFA 3SRHA 3U4FA 3SQMA 3WIJA 4GGBA 4Z0SA 1KR1A 3PNUA 4TVUA 3CO4A 4XKYA 3NZRA 5A6TC 4L61A 4TO8A 1UUMA 3KOZA 1UR2A 2HBVA 2XPKA 4WDXA 5I3IA 5FEZA 4H9UA 3OGVA 1BGAA 1A5AA 1TCDA 3G1XA 1RXOB 4G8TA 3H53A 4L7ZA 4XZNX 1H1YA 3AWNA 3B03A 1CZ1A 3TK7A 4UFMA 2Q02A 3D0CA 4W4QA 3NQBA 1RPKA 2ZQ0A 3DBPA 2CYGA 3IRSA 5BZAA 3VD7A 3TJXA 3QR1A 1FHDA 2G50A 3F4NA 3GBEA 2PU0A 1C8YA 4ACZB 1UASA 4ZSTA 3KLLA 1R7AA 1V02A 3CAKA 1G1YA 5DCBA 3FVDA 3CU2A 3C6CA 1JR1A 3PSVA 2QUVA 4DLMA 4UNIA 2I16A 3BVJA 4LY4A 4BJHA 3UXDA 4N6FA 3MCNA 3W71A 4QEHA 5GQBA 1AH3A 4WRHA 4Q8VA 1V93A 2CLHA 3U8GA 1E0TA 1WCGA 1V0MA 1BYCA 2V67A 2ON3A 1G01A 2Z25A 1IEVA 2HTMA 5M3WA 1VBJA 1RPXA 4M29A 2EG8A 3IV8A 3TX9A 1DIOA 3N4AA 4PH6A 4ML9A 4PUEA 3A64A 4NNCA 4M6VA 1H7OA 4JIHA 3WQFA 4QTGA 3G8RA 3WDRA 1LOLA 4LB3A 1B3ZA 1BGGA 4M6QA 2W27A 3LSCA 4GJIA 4NL1A 3W3OA 4D6DA 3AFBA 2CCRA 3EPNA 2A1YA 2VCAA 2DJXA 5HR6A 1ZRQA 1E6XM 4ZOEA 4EWND 2HWGA 1GNXA 1KBKA 4LGXA 4I6KA 2PWGA 3NDYA 1UH2A 1RCOB 4CD6A 3TFXA 2O9OA 2QULA 1MEHA 1TIMA 2PLJA 3NPXA 2W62A 1S2WA 4W8AA 1OCQA 5JIPA 1MVYA 5E5CA 1U33A 3BV4A 2J7CA 5RUBA 3VTRA 2D2GA 4HOXA 4IPLA 5D03A 1J5TA 3BOFA 1K6WA 2ZCGA 3O6CA 3AU2A 3LGGA 5HNTA 4JTFA 3VOGA 3GR8A 3MP3A 1SJCA 4ADTA 4Y9OA 1X39A 1YTKA 3ZJ8A 3BLOA 4D72A 2C18A 4GUIA 1YTDA 4DF0A 4HPHA 5BU9A 3S47A 4DJFC 4F4RA 1V6UA 1ZU8A 3I3BA 3GM8A 3WK0A 1VAHA 3P6LA 1PXGA 2YR1A 3GFXA 4CNSA 3T09A 5IHRA 3IIPA 3O2LA 4ADSA 2RAGA 3FCPA 1G94A 1JUKA 1QHPA 2GLKA 2GFTA 2J25A 1PB0A 4NNAA 1WB0A 1I0DA 5C9UA 2GVJA 3CWNA 4DZ5A 2HXTA 1OFDA 1VC4A 4XTDA 2IUZA 4UFKA 2ZZ3A 3NURA 1GZJA 4XIAA 1HO1A 3WDJA 1XG3A 5BROA 3GXFA 2BY1A 1BKSA 1RA5A 3REQA 3W7HA 2YFOA 3TYBA 2DZTA 1UB3A 3KTSA 2HE8A 3PANA 1O6IA 1OYAA 4GBDA 5JIWA 3DX5A 2Y7FA 4OGZA 4LC6A 4UTMA 3S2MA 3SADA 1F74A 4J2PA 4EVZA 1K4GA 4N02A 3LS9A 4U5IA 4Z08A 3QV7A 2GVGA 4LS2A 2Z0IA 3H4WA 4ZSUA 4S2CA 3N2OA 1LQAA 1TMQA 3KBJA 2XUCA 4OECA 2DVUA 3K4AA 2PP1A 1QWGA 1BVNP 2PUZA 2ZYFA 1HKJA 3DFTA 4B4FA 1TKKA 5K7JA 5CSSA 1U1HA 1BRLA 3ATYA 1LBMA 1R85A 1LWHA 3WJYA 3VKJA 5I06A 1XV8A 1HZYA 3BAIA 1DJWA 5K9CA 2CZDA 2YCLB 2O9TA 1X96A 3H55A 1HP4A 3UR8A 4GXPA 1BG9A 2PWHA 4FX7A 3GYCA 1GVQA 4AY7A 4B3LA 4OTKA 3OZPA 1BG4A 2ONEA 4L1XA 3T40A 4GZ7A 1K8YA 2NV1A 1QMLA 3WLJA 2ZXQA 1V3KA 3T0CA 5LNWA 5C54A 1HT6A 3UYCA 4RE0A 4B9ZA 1TELA 2BS9A 4KMQA 1GVSA 3CZLA 3VGDA 1MRQA 3KCOA 1F2JA 3C0QA 4WOZA 5AC6A 1VB9A 2TRSA 4N6EA 4X9SA 4XKYB 2IPFA 5ABEA 7TIMA 1YX1A 4F2BA 5DCEA 3K8MA 1PE1A 4R88A 2YCEA 4LAKA 1YYAA 2O9RA 2ZVRA 3BJTA 2YLLA 3IGHX 4DJFA 2DSZA 3NJ3A 4GACA 3L9CA 1LORA 2JEPA 1RY8A 3PNZA 4OWGA 5FJJA 3J7HA 2OGYA 3PAOA 1IGWA 5BOFA 5F4XA 2GGJA 3LBCA 3DKJA 3VIOA 3DI0A 3H2NA 1MUWA 3FJ6A 2FJKA 1PZ1A 3B8DA 2ZA1A 2W3ZA 2JKPA 4DNHA 3AICA 3CMFA 1WZLA 3DENA 4O4VA 3GD6A 3TC6A 1SMAA 1W1YA 1NWUA 1C8VA 1WDWA 4JTLA 1RY0A 3XINA 3KZSA 3O15A 2IQDA 3VNDA 1FTXA 1GVYA 1EHNA 3ZZ1A 3N2BA 1UHVA 3FVMA 4YTRA 3E0VA 3C86A 3P8IA 2G3NA 4M80A 3WSUA 2NQZA 2NSOA 4JCLA 5AHEA 4YWSA 2CNCA 3GC2A 3OTRA 1GOKA 1GTEA 1VLWA 1F3WA 3AS1A 4N9EA 4DAIA 4DUVA 3NYDA 2R82A 4GI4A 4LU0A 3QV6A 4QJ4B 3VINA 5C9ZA 4O28A 3MZNA 4S3DA 3RIKA 4ZO6A 3WEMA 4QQUA 1ODZA 1XWYA 1X7FA 1KM4A 1Q85A 1US0A 4R7JA 1G67A 2VQUA 5F2LA 4BKNA 2FTYA 5AECA 3C3NA 3K30A 2WMJA 7TAAA 4LVBA 4ZL1A 4LPCA 3L5MA 3ALFA 1Q6GA 1XKJA 3VMOA 1TJ0A 4UTWC 1K9EA 2V63A 1SSDA 3NL5A 3FHQA 3S1GA 3N15A 4IJBA 2ZZ7A 3KLKA 4AB4A 2BY0A 4N4PA 4KCTA 3LZ5A 3N25A 1HKMA 4UR7A 3QEZA 5KETA 3CV2A 1H7XA 1R3SA 3CPUA 5D9NA 6TAAA 4S2BA 1TX0A 1OYBA 2P0IA 4RNFA 2J8FA 2WVVA 1O1HA 4R27A 3CZ8A 3VAVA 3VGEA 3RCMA 3DI1A 1K9DA 2RDUA 2EQDA 3CWOX 1CI1A 1AZ1A 1ONWA 4ZE5A 1TUXA 1ZB5A 3SN1A 3BMXA 1V7AA 3B9DA 3P74A 4GO9A 4DI8A 3R43A 1Q6CA 1IT7A 3FSTA 1CECA 1U1JA 4GG9A 5CC3A 1Z48A 3KRSA 4EOUA 4XVEA 2HZGA 5CKSA 3VC5A 3BK0A 3REQB 4KKXA 3UZ5A 1KCLA 2OR2A 3W7IA 3CTTA 4JL1A 3SGGA 4PCSA 3HV9A 5EB8A 4G7FA 2QJNA 3PWIA 3T78A 3B04A 3MY9A 2F6KA 2DVTA 4AHPA 3EXTA 2TYSA 4C6LA 3THUA 2GJRA 4GIEA 1GYMA 4W5ZA 3S2LA 1ISXA 2X09A 4QDMA 8XIAA 2OCZA 1FWFC 3VZZA 5CC5A 4JTCA 1C9DA 4LYPA 2J7EA 1PSCA 3W2UA 4A8IA 4C1NA 1GKRA 5LHFA 3UFYA 2YL8A 4CQAA 3V36A 3VIMA 2GWNA 2OO6A 1AK5A 1JULA 3JRKA 4M81A 3WLKX 4ATDA 2PDFA 3G1RA 2J9YA 4GD0A 2VUNA 3KBWA 5CC7A 3OBKA 4Q4MA 1BRLB 1X8FA 3ZQ9A 2R14A 4WSJA 1VP5A 2NVCA 3PZOA 1MW0A 5DFAA 2C19A 3HQ1A 2WJEA 4GVHA 4C6JA 4YHEA 4UTIA 2Z1VA 2QCGA 1JZ8A 2QVNA 2PRMA 3SY5A 4H8NA 5AOUA 1A47A 1X6LA 4H01A 3UG5A 4MIMA 4GI6A 1ZBKA 4JHMA 1UA3A 2G8ZA 4I9TA 4C60A 4HN8A 1L8NA 7ENLA 1Y5WA 4B5VA 2FB2A 1K77A 1WO2A 2D3LA 3OU8A 4UTWA 3OO2A 4XUYA 3L68A 3FS2A 2OPJA 2H3DA 3NQEA 1ISYA 3ITXA 4LBSA 2W6RA 1VBUA 3PHAA 4F0RA 2RDXA 4HTYA 1FX6A 2POZA 3F4WA 2OT0A 1PCWA 1SR0A 1DORA 2BTMA 1OY0A 2VURA 3EGJA 3GH4A 3M1ZA 5CPMA 4GVFA 1XUZA 2NV9A 3WLNA 2A3HA 2J4GA 5A6AA 1OIMA 2OOFA 3NZGA 3EYPA 1L6YA 3U5UA 4CD8A 2C6QA 1OC5A 4PL1A 4KWUA 2KAUC 4JFWA 3SY1A 4HN4A 5I78A 4TU1A 3HG4A 4UWMA 3WY1A 1US3A 3T8LA 3O9NA 4CNNA 1TCMA 3QMTA 3FY1A 1W5OA 5F1UA 2WPGA 3ABRA 2G0WA 1OD0A 2FH8A 3PFRA 3QGKC 2WNZA 2ABBA 4GY7A 1S2UA 4UMCA 3AHTA 4MB1A 4LCRA 2C1GA 2X7WA 3PZGA 1XCFA 3AYRA 5CEWA 1ZS2A 2C71A 3UCQA 1REQA 2PZ0A 4IXXA 3EX1A 4DJDD 2OOGA 1GVIA 3GG0A 1LG1A 4Q22A 3L23A 1GTHA 4QNWA 2EBNA 4FA3A 1EJVC 4HYRA 1E55A 3CHVA 4Z42C 5H8UA 3SGZA 4A8RA 4URIA 1RQBA 1QPNA 4K6AA 3QC0A 2BASA 2DIJA 4PFMA 3LM3A 1ITXA 4NI3A 3IUHA 5DXYA 1G4PA 4Q6JA 5LKYA 1XDLA 3BMVA 3B0PA 3ITLA 1XYAA 5BXRA 4ZZ9A 2XWDA 1W5PA 3S2CA 1MXGA 3A23A 3NEVA 5GNYA 1VYRA 1OX4A 4PUKA 1H7WA 4E8GA 4RW3A 1QPOA 4ZVJA 3BG3A 4CQ9A 4UUIA 4MNLA 4DM2A 3NQDA 1XYMA 3LENA 4WIWA 3W2MA 1Y5XA 3A5FA 1IZKA 1DKWA 2A4AA 4H9TA 2BHZA 1OHLA 3W9ZA 1QTWA 3WMCA 5IDZA 1UKOA 1KGWA 2Y24A 3GIQA 4EXBA 4EACA 1YKWA 2ZXAA 4C5YA 4E5TA 4LC8A 3DG3A 2OLSA 2NUXA 1OJXA 3D6NA 4Q4KA 1DJHA 2VX5A 2J7FA 3C0SA 3TN5A 2DU2A 2CITA 2DZVA 5I24A 5I23A 2HNEA 2NZLA 3WQVA 4AD4A 2WVVB 5LNRA 1XIBA 1P6WA 4LBUA 2UV8G 1AODA 4HYWA 4JN6A 4CGTA 4AWUA 3AIRA 3WYZA 1JPMA 3IEBA 1FWGC 3ARYA 1CX9A 4WR3A 1JQVA 1W9XA 5C8BB 3WG6A 3WQ6A 2FHBA 3N2XA 4A6GA 4ZXLA 4Z2HA 2C7FA 4Z1AA 3C2RA 2XVPA 2PDLA 4L6DA 4P61A 3GXTA 3C56A 2XM1A 5DXXA 3A4XA 1L6GA 2E9BA 3UZYA 3WLQA 3ITOA 1B31A 2E77A 4J28A 2G3MA 1PWLA 4E4FA 3GW3A 1GW1A 1KQYA 3BLDA 2WSRA 3O16A 3BJSA 5G4EA 1XGDA 4I9JA 2X0YA 2CBJA 2L5HA 3RN6A 2GVLA 4AY8A 1E3XA 3OQEA 3PG8A 2WO5A 4AIEA 2HISA 1NP0A 4BQ4A 4FHAA 1NWSA 3M0IA 3N13A 4IISA 2F2HA 3U3HA 3GZ3A 4ZODA 1RHCA 3GXPA 1TSIA 4EIVA 3U7BA 2ALDA 3IJQA 4JTTA 2Y0FA 4JTJA 1P5BA 1Z8AA 3EZ4A 1UR3M 3PN8A 2OO0A 4DYJA 5DF0A 4J1OA 3PJUA 2VQTA 3DFOA 3QKZA 3KVJA 4OOUA 4GC3A 4HU4A 3UGRA 3WEZA 2VX7A 4CQBA 4D6JA 2V69A 9XIAA 5HNUA 4H83A 1WDPA 1ITQA 3WLMA 3B8IA 4CVWA 1YE6A 3CEPA 3QBUA 2D2OA 4Q8OA 1BSIA 1M65A 1ZJHA 1NU5A 2CZ5A 3AIVA 4GX9A 4NHVA 1I4NA 1B3OA 4GVIA 2VFDA 3IV3A 4UXDA 3EWBX 4XD5A 4O18A 3APYA 1I2PA 2EF9A 4OBSA 4PEEA 1TPB1 1B3XA 3G8EA 3RM8A 1CIUA 1R2SA 4UOJA 5FSEC 1S2VA 4O17A 1GEHA 3QHOA 5M03A 3L4WA 4M8UA 1O12A 1VJZA 1FWBC 2ZUWA 1XBVA 3NM3A 2GSHA 4FALA 1KLYA 1P0KA 2PDXA 4PEKA 1GPWA 2V8ZA 4Z1BA 5LXEA 1ZBVA 1P4CA 2SFPA 3FYOA 2XSAA 1TQXA 2C1HA 1SPQA 2PCQA 4RDVA 2ZUNA 1W91A 1ENUA 1DIDA 1JDDA 2WKGA 4NY2A 4Z2GA 2Z2UA 3O6AA 5MHBA 1PCKA 1UQZA 4JHOA 3LPOA 4ICMA 1K4HA 3FLUA 5G2IA 1XQKA 4O1BA 3QMSA 4IJRA 3II1A 4I90A 1F8IA 4RZ4A 3P60A 1Q2RA 5CSRA 3EMQA 2V3EA 4D9PA 4DUOA 1UCWA 1K6AA 3WDHA 3ITVA 4QFUA 3DFYA 3UNDA 4INFA 1XBXA 1V79A 2OQLA 3WUBA 2G4FA 4PMVA 1ISVA 3CQHA 1XHGA 3VOIA 1JUBA 5HJYA 2IMRA 4BEQA 4QITA 5CPLA 5L6UA 1ZNNA 3EWCA 2DH3A 4LJ3A 3Q58A 1F7BA 2Z24A 3GTXA 3DHFA 3EOOA 4AD2A 3SY8A 3EDKA 1K02A 2PWVA 3ARWA 3F5JA 1X1ZA 1Q13A 4MB5A 3PC0A 3WFLA 2DEPA 5JH2A 1YQ2A 2X0SA 2OWXA 4C1KA 1FHUA 2DZWA 1XIFA 4G6CA 3PWGA 1TPFA 2J7DA 1OBAA 1OFOA 1REQB 1I9CB 3CZGA 3VNKA 3K13A 3A5VA 3PK7A 3KRZA 3OVQA 3BCJA 5FF7A 3E2VA 1E0VA 3POHA 1IEXA 2DFAA 4PMUA 4D6GA 1JG9A 1XCWA 4ZBCA 1I6NA 1OG6A 3EOEA 1LLWA 1G4TA 1KD0A 2IXUA 5EFFA 1UR1A 3TEVA 4Z1DA 3UXAA 4RDYA 1CGYA 4IWWA 3M64A 4JTEA 4WQ6A 3KOXA 1XLDA 5BOOA 5A8GA 3HTWA 4GI9A 3ZR6A 1EFZA 1H5YA 4ERAA 1WV2A 1TV8A 1KBIA 3NZ1A 1ZALA 4D6FA 3N4EA 4EF9A 4EAMA 1GOIA 3KEHA 4ZQOA 3W7DA 3IJ8A 2PTZA 4M1BA 2BNJA 2A3AA 1ECQA 1EH9A 6ALDA 1T8XA 4OU1A 4Q7IA 2BOGX 7CGTA 4OOZA 2F84A 3KVLA 2X7VA 4J7RA 3F2CA 3M0KA 3FDGA 4FNSA 4W9TA 4CQCA 4WXZA 5FF2A 3BW3A 3KM8A 3CHCA 3EWXA 2Z2AA 1WQ5A 5IFPA 2CHRA 2WQPA 3NOEA 3TW6A 1QHOA 3BAWA 3LU2A 3P81A 4DUWA 2VC6A 5FAJA 2E25A 2WVUA 1XCXA 4KGLA 3L2IA 2PP0A 3VE7A 4GQBA 5CBBA 4D6CA 1K1DA 1CGXA 4WKHA 1NF0A 4KFOA 1T6MA 1MFVA 1JEZA 2DPEA 3GUWA 2EPMX 1SGJA 3SURA 1RV8A 1FFRA 1DIEA 1GUVA 4JD4A 3UPWA 2ZE3A 3W02A 1P1MA 2A0NA 4MDOA 4NU7A 3VD3A 1Y5VA 4M7SA 1GORA 4HMCA 1EOMA 4HT3A 4UTTC 1ME8A 1M9HA 1YPFA 7REQA 4LAOA 4FI4A 3TQPA 5D02A 1UOKA 3IAQA 4GO8A 3GVRA 4JTAA 1RCXB 2RFGA 1E1CA 1ZP4A 3HMJG 2X0HA 4JGDA 4HPXA 2ATMA 4KS0A 4IF2A 1L2QA 3VA8A 3LBOA 5IBXC 3NNTA 2PEVA 3DFPA 2W5FA 3R79A 2Y70A 2YBUA 2QCDB 3TQKA 2DGAA 4E2VA 2INFA 4FIRA 3MMTA 4DI9A 3D3FA 4HGXA 5DELA 3U7VA 5A94A 3BAKA 4QLLA 3KXQA 5CPTA 2QMJA 2J9ZA 1XIIA 2WMIA 4POCA 1LLZA 3BGGA 3C2EA 3QHMA 4AC1X 3S5ZA 2RKXA 3B0VC 1LG2A 3TSMA 3S9ZA 4HU0A 4HNNA 1K7EA 5DCDA 2FTWA 3QR0A 2V5BA 1TTIA 1QOXA 5CZJA 1N8FA 1LL4A 2OG9A 1IWPA 4S38A 1DPMA 4EE9A 3BMWA 3HO8A 1UZ1A 3U9IA 4F66A 1RBAA 2AL2B 4AHOA 4NG3A 3C8FA 4ZFMA 3LPFA 4W85A 3MDUA 4Y8EA 1XF0A 1KC7A 3NG3A 5I3DA 1AQFA 4JIRA 4R7OA 4JTHA 1IWAA 2DZXA 1QW7A 3UWQA 2DSKA 4UTHA 4EPEC 3CUHA 3KRBA 4US5A 1SFLA 1E4IA 3FX4A 4CN4A 3GR4A 2QDHA 1UWQA 1XUUA 4TX6A 4R34A 4I5XA 3WUGA 4GZEA 4CN6A 4H8HA 1PV8A 2BV9A 3I6EA 3TN4A 4DZHA 4MAZA 3SCNA 2WHJA 3UY8A 2BG5A 1JGIA 3QV8A 4R9XA 3UETA 5CC6A 2W9MA 3L66A 3V1PA 3U2OA 4XTIA 3QYQA 4IICA 3DH7A 3NXLA 3PPCA 1R38A 3W85A 3EA2A 1XPGA 2GUUA 2Z26A 3KP0A 1EA0A 1IR2A 1JZ7A 1JI1A 3TTEA 3WF2A 3GXIA 3MI6A 3IACA 1EOKA 3LSBA 4Q7NA 4QSHA 3BCFA 3V4BA 1BWVA 4LV9A 2PODA 2J8TA 1V3MA 1L2UA 2QR6A 2E8YA 1ALDA 3CNYA 2BHYA 4JKLA 4Y9AA 4YTQA 4UTTA 4I6VA 2AKMA 3R25A 4TV5A 2XINA 1W32A 4YYCA 3T08A 2QAFA 3MYPA 4IXHA 3UR2A 2NX3A 2FYMA 2P5NA 3B8VA 2W67A 2ZXDA 2PDQA 4QX4A 4V33A 2HK0A 4H00A 2Y6ZA 5DX7A 5IBXA 4B91A 2WJFA 3T4WA 5DT5A 1O5XA 3G6MA 1GQLA 4PB5A 2YGYA 3EEZA 2GWGA 1DQWA 4JYEA 4XIMA 4BHYA 1TIWA 3N2CA 1XPYA 2IKJA 3WLPA 2VEFA 2FMNA 4Q8TA 3CWHA 4TMCA 1AH0A 1POKA 1DJGA 4C5ZA 4AZCB 3O05A 1KGUA 5A8QA 4UQCA 3IVUA 2RGMA 2E67A 5T9BG 2BMBA 5KINA 3AJXA 4E0CA 3JVAA 4MWAC 4OJYA 1ISWA 3WJWA 3AMGA 4I9MA 1YNQA 3QHNA 4Z2JA 2DZSA 1AQHA 1T8QA 3B8WA 2WMHA 4JOMA 3S42A 4XK2A 1WKEA 2CBVA 4C91A 4HSHA 4JTIA 4YPJA 2PGRA 5FEPA 4DWDA 4YNGA 3ABZA 4KH2A 5HR7A 4FPSA 3TSDA 4O19A 1L6WA 5EGRA 1YBQA 2WMFA 1QBAA 2NX1A 2ZDSA 4CNPA 4LQ1A 4O11A 2REQA 5GJMA 1VFMA 1QI2A 1GJPA 5IM51 3WEOA 2PDNA 2V3DA 4PYSA 4UIOA 3KAOA 5FJOA 2QCNA 1J8VA 4J3VA 4H19A 2WC4A 3SW6A 2J8GA 1YIXA 3NQCA 5I3FA 2GGGA 3MCOA 2W63A 4GQGA 4JX5A 4BS0A 3DYPA 4GMEA 2BP1A 3PZQA 3CAVA 2V82A 3MSRA 4DJED 4QISA 4G5DA 1KKRA 1I2RA 3PZVA 4UNKA 4O10A 4A3QA 4C6BA 1G6CA 2CIPA 3WD1A 1LP6A 1V3HA 1R47A 7REQB 8TIMA 3ECQA 4M5PA 4C6IA 1EWDA 3SGUA 3VGBA 4AF0B 4PCNA 1HJUA 3L0KA 1E1CB 1FDJA 1XS2A 1DTUA 1OK6A 3HF3A 2ZRUA 1JYXA 1FCBA 1BSLA 5DBUA 2VDHA 3BPWA 4LAZA 3N11A 3PUDA 3CS2A 1VBGA 2B7QA 3QFEA 3LY0A 4NJGA 1V6YA 1JCYA 3E0IA 3TNBA 3CIWA 2R1LA 1KM1A 2VGBA 1WDQA 2QYGA 1ZJBA 5I3GA 3D47A 3IANA 1OCNA 4QDWA 1H09A 3HGSA 2QV5A 2Z7KA 4PTMA 1H41A 1NSJA 1VS1A 2HXUA 4PC8A 1TB3A 3VNYA 4FNTA 1DWAM 1ZLPA 1MEWA 2XIQA 2IPWA 2PP3A 3BV7A 1R9YA 3UA4A 3U2ZA 1BPLB 1ML1A 1FFQA 2GGHA 3AMDA 3EB2A 3XISA 1U5HA 1QFEA 5REQB 1NDZA 1JD7A 3MVTA 4OE7A 3ZR5A 3QSRA 4UCGA 1GT8A 1Z3NA 4DUXA 1MMFA 3W6LA 1Q6RA 3RX2A 3TOPA 2BB0A 4ZQPA 2O9PA 3RK8A 4V1XA 2OSYA 4MWAA 4R9OA 4I7WA 1I2OA 4LCSA 4TUFA 3VO0A 4HNTA 2G3JA 3QLLA 3E6EA 3VDBA 3NPVA 4OFCA 4ZCWA 1AW1A 3WLTA 2QGHA 3WQCA 3A4AA 2VTFA 1QNSA 1CGWA 3CXOA 3RM4A 3KVKA 1A5OC 1SZNA 3H12A 4N2YA 4TXEA 2VEGA 4OV4A 4PCFA 1Y0EA 3C2VA 1NDVA 4NX0A 3KBNA 3SCPA 3TYCA 3OIHA 2WCAA 4E3VA 2RDTA 1PAMA 2ZZ1A 1IIGA 2EPNA 4CCEA 3R8GA 2G4JA 2ABAA 4IG2A 1J0IA 1LDCA 1R2TA 3H22A 4NVTA 1R3RA 4X0VA 1R7OA 4PZVA 2XN0A 2X1IA 3CHEA 1VFHA 4W7UA 9XIMA 4JR5A 1E0WA 5FD0A 1KM3A 1UP2A 3R8HA 3WNPA 2E4TA 3RMEA 2QEZA 1EHAA 3FSUA 2V0TA 1C92A 1LT7A 4QQ3A 3G0XA 2OJPA 4LRSA 1R30A 1WBHA 4JTDA 1G0CA 5DANA 2WWDA 2B7OA 2DZBA 1SO6A 3BDKA 2OWWA 1TR1A 2G41A 2XG9A 2A7PA 3FYYA 1RUSA 1QU4A 4S3KA 2XGIA 2DUZA 4QEEA 2ZWZA 1NF7A 1P0BA 2QIWA 3CQKA 3MKVA 3GY1A 2VD9A 1Q5MA 1E9LA 3IUDA 2PDHA 2OLAA 3T0TA 1VFFA 3KFTA 5I3HA 3TTSA 1NARA 3GXMA 3M9YA 1B54A 1R3TA 2YDAA 2ZUMA 1C7SA 4NZJA 1W17A 4P8UA 2WNWA 2F38A 5ENLA 1TPUA 3G22A 1CLXA 4JNZA 2YDRA 4NRSA 3WBAA 4NAEA 5AHIA 1GYLA 3CB3A 1E1EA 3MP4A 4R3UA 3KE0A 4IFRA 1G5AA 4OZOA 3AC0A 1K8ZA 4K7VA 3TC3A 4LOCA 4GCXA 2ESCA 4AZBA 2HPMA 1NJJA 3AJ7A 4MJZA 5LIWX 1ME7A 1BEUA 1BF2A 2BX7A 3TN6A 3B06A 3TXVA 3UWYA 1E5NA 2WLZA 4YHGA 4LUYA 5AC4A 3S6OA 4A8NA 3CHDA 1YBQB 3UWZA 2AQVA 5AC8A 3O8AA 3GC4A 4AZ7A 1VZWA 3CAQA 3MP5A 3NXFA 3W1UA 4EKJA 2REQB 1DVJA 2CBIA 2QAPA 4PUUA 5F2IA 1J0YA 2YL9A 5AZ0A 1OQFA 4JEQA 2DZUA 3VIIA 4KT2A 4CNTA 1TZZA 3MV01 3GO2A 2JKAA 3FYPA 1WZKA 1FWWA 2PDJA 1WNOA 5I02A 5JXQA 1GJWA 3WBYA 2NUYA 4G1NA 1UR8A 3ARUA 3BZGA 4P7OA 4HK6A 4TVDA 2ZX9A 3S5NA 3BICA 3ZM8A 3EWWA 5AYXA 1QBBA 1U22A 3ABOA 3F4CA 1E6SM 2XIOA 4FLOA 1NH6A 1Z44A 1L9WA 2CLKA 1KCKA 4CU6A 2HVOA 1UMYA 1OFAA 4Q8PA 3CO8A 3MW7A 3W25A 3S83A 1N7KA 3LCGA 3GU2A 4UOQA 5KZMA 1NDWA 3LCHA 1JFXA 2VELA 1NFGA 3EOSA 1VPYA 3NZPA 2A2IA 4LFYA 2F8QA 3QY6A 1QW8A 1J4EA 3W7KA 4E3TA 4IQLA 1KNWA 4U3AA 2DIKA 1TJPA 3M07A 5HXMA 1VEMA 4X2PA 3LHUA 3D5HA 3MI2A 2GQ3A 3OLGA 4E2BA 3LRLA 4YCOA 3ID7A 1W3LA 4RUBA 1BKHA 4Q6XA 4US6A 3NO3A 1C9WA 3QJAA 4BI5A 3RJXA 3GIPA 4RZ6A 3W82A 3WQDA 2QGYA 3NPWA 3OZYA 2I5IA 4WD0A 4H4IA 3CQIA 4RKAA 4Q33A 3SUVA 2X42A 2OX1A 3C3UA 3DFQA 4X22A 3VD4A 3N6HA 1O66A 1M7OA 5DRCA 3W26A 5DMNA 4GZIA 1JPDX 5D30A 3GNXA 1TWSA 1WUEA 1OGSA 3ONBA 1DJIA 4XD4A 1NTHA 1PHQA 2CLLA 3RX3A 3SECA 1V5XA 2ISDA 1SR9A 2ACUA 4MWAB 3GRIA 3VZXA 1Q7QA 1X7IA 4J35A 1BWKA 4QS5A 1S38A 5CJNA 1LOQA 4HA4A 3F5LA 5C0QA 1ZSXA 5I2UA 1XC6A 2VZSA 4C6NA 5D2XA 4L64A 1H51A 1PBGA 1W9BM 3SFKA 3WLOA 1ZHAA 2H9AB 5E70A 3THCA 3CLMA 3W75A 3FHAA 4V15A 3OVRA 3E2QA 1T41A 1U1UA 2HK1A 2WVSA 3F4VA 4JBRA 3GX9A 4HMNA 4LEFA 5T26A 3T4CA 2C14A 1K8CA 2J27A 3IIOA 3I7SA 4DO4A 1WDDA 2WBGA 1T0OA 2HE5A 3W1RA 3W2JA 4IG2B 4PBFA 4KFNA 1ODUA 3CQJA 1C91A 2PI6A 5ABFB 1B30A 2EPLX 1ADSA 1CGVA 2J9XA 5FL0A 2X05A 3ARVA 3ITYA 3U48A 3DEQA 2AMXA 3ITTA 1XLBA 4QLJA 4MSSA 1H63A 2PLKA 5HMEA 4O0QA 3LTPA 2QJMA 3T42A 1R9ZA 1FWDC 3ZS4A 4PB3A 5CSYA 3APGA 1XLLA 1V8EA 4M51A 4L4MA 4JS3A 5AVNA 4YTSA 2WZMA 1D3GA 2AAAA 2FDSA 3BH4A 3PF3A 1M7JA 1WXZA 3WF3A 1XLKA 4UNLA 3CM4A 2BFGA 9CGTA 4PB4A 1I1XA 2H3BA 4E6MA 2GDUA 6XIAA 4UCFA 4GRSA 2PA6A 1QPQA 3QGAC 3W07A 1GG1A 2V5DA 1E0UA 4U10A 2VT0A 3OBEA 1TA3A 1WZAA 2PZNA 2X40A 3P80A 1ESWA 5A1AA 1ZAJA 3TR9A 2G5WA 1KM6A 1AJZA 2HQAA 2WYSA 3NAVA 3GDLA 2BWGA 4LBRA 3SRFA 3SIZA 4LNYA 4I5RA 4L9ZA 2WC3A 3B4UA 3S1UA 1FWSA 2PWDA 2WHLA 1YEYA 2FQIA 1O68A 1H2JA 3SJNA 1M7PA 3RPMA 1KTNA 1E70M 2J88A 2XIIA 1TTQA 1XINA 4IPPA 3W6MA 4O14A 2PDYA 4LUSB 1HIZA 3QVQA 1WPCA 3APTA 3CZEA 3O6YX 3GXDA 1OFBA 1GOMA 2R1NA 2OYKA 3TQVA 2E6YA 3V16A 5XIAA 4QS6A 1WE5A 3L0NA 3DXIA 2ZIDA 3COTA 3VUPA 3USBA 2VC7A 4BFAA 3BARA 4AH7A 2BZNA 1AW5A 3DAQA 4HIBA 3WJXA 5AYZA 4GFSA 2HDJA 1J0JA 5HMFA 1W54A 1GVFA 4Q4RA 1JCXA 1CB2A 1D8WA 3ARSA 5H1WA 3V0TA 5JUVA 2GGIA 2E5CA 3UF9A 3SN4A 2Z1KA 4YIWA 1DWIM 1DWHM 2KZHA 4MJ4A 2A85A 1PX8A 5KZEA 4HCLA 3URQA 4CD5A 1J18A 4A35A 2FDMA 4GNVA 1UD5A 4FNPA 2BODX 1HJSA 5TD4A 1E0XA 4ORMA 2ALRA 3BO9A 2PURA 1QPKA 2QDDA 3ZXWA 1UH4A 3DOPA 1A53A 3N73A 3AU6A 4GQ0A 2Y5JA 3UJRA 5GJPA 3MANA 1W2VA 3NO1A 3DKLA 3N3MA 3UJ2A 4K8EA 3ZSTA 3E5PA 3WBXA 3U2EA 1IV8A 4O16A 1LUCA 1PZ0A 4DBUA 3WMSA 1V7YA 3LLFA 3N9SA 2FIQA 3UCDA 1N82A 2CLFA 3GLCA 1T5AA 2O7SA 4CU8A 3G3MA 5H2ZA 3UZWA 2YW4A 2VJXA 3PTMA 3MUZ1 4H8VA 1J0KA 2YZ5A 3TW7A 5M5DA 3OGRA 5C2CA 2BOEX 3OA5A 2IQ0A 3QR3A 2PDIA 4XD6A 1FWJC 2V81A 5EMYA 1TZ7A 5CAKA 2O55A 3IJIA 3DGBA 1TMLA 2YYTA 5KZDA 1BAGA 3BLKA 3GU1A 4ROPA 4GVGA 2J62A 1GQNA 3H4XA 4S3EA 1FDYA 5G2HA 2X2YA 1KFJA 3CBWA 3QZEA 1XIJA 1UWIA 2V2CA 3G1DA 3B40A 1E3ZA 3M0ZA 3I10A 1MXSA 2BXYA 1MNSA 2NXHA 1H50A 2NVAA 2VRQA 2HROA 1Z9AA 4H9ZA 4JQ4A 2XH2A 1JZ5A 4AUBA 4IIFA 3GFZA 1KXVA 2WQDA 2YFNA 4F0SA 5JH1A 4DBWA 1KGXA 2Y8UA 2WXDM 3QM3A 2YL5A 2D22A 1Y8BA 5AYBA 1FCVA 2E40A 4PA8A 3UP8A 4FXSA 4IPIA 1W9UA 2ISWA 4NF7A 1L6SA 3OJGA 3GNRA 3CTLA 4RJEA 5AY7A 4W7VA 8A3HA 2I7GA 1L8PA 3WMBA 3B3DA 3LCLA 4GZJA 1NM9A 1E9ZB 4E2DA 5D2VA 5JBEA 4AWEA 3G1AA 3AHZA 1QW9A 3LQGA 2FZBA 3E49A 1GWJA 3DHPA 2XFFA 3ARZA 1GOXA 3O3RA 2Q3RA 2JFEX 3QOKA 4B5UA 2BOFX 2Z27A 3WBEA 1FOBA 4A05A 3KUMA 3FAXA 2OEJA 3Q37A 1E9IA 4AXNA 4HNOA 3RU8X 3N4FA 1SJDA 3VILA 4IUOA 1EO5A 4UC5A 3MUCA 3VM7A 4DBEA 3UR5A 4O13A 1E9YB 1JVNA 3M6DA 1TWZA 3CUFA 1TV3A 2YPIA 3MMUA 2X1TA 1KBLA 1OCJA 1EZWA 3M0YA 5A95A 5JBFA 2CZEA 1L0PA 4RL3A 2D0GA 4GPNA 4F3HA 3OGSA 2GSEA 3VE9A 4QE5A 4QSFA 3SJ3A 1C7TA 2VMFA 3GK0A 3SBFA 1GVRA 1AW2A 4WDWA 3DYMA 3F03K 3IAPA 5FESA 3EWZA 2Z29A 1V77A 2ZDRA 2ZICA 2NQLA 4JQAA 3TQ0A 3UG3A 1A3HA 3P8JA 4S39A 4WKFA 5E9XA 3TCSA 4UTUA 3KHJA 1TA3B 1W2PA 3WLRA 1H49A 3JU2A 3LPGA 3WH7A 3OW1A 3BW2A 4DQWA 5KEZA 1JDFA 1TVLA 1MXDA 5FCZA 2UY4A 4G2DA 2C13A 1H11A 1HP5A 4B3ZA 2D2HA 3GDMA 3KX6A 3NO5A 2E3ZA 3FOKA 3VIPA 3WD2A 3I3DA 4HKPA 3VPLA 2E5BA 2YXGA 4AD0A 1A5BA 1S5VA 4WLCA 2X1UA 5K9XA 4JL2A 1ECEA 1GVEA 3LG3A 1K8XA 4GIRA 3HQNA 3E38A 3UY7A 1GK8A 4LS0A 1EXPA 3ARTA 1J93A 1EQCA 4HNLA 5HQLA 3FIGA 3LTSA 4FLRA 1SJBA 3BG5A 4GUFA 4Q8QA 1DXEA 1FRBA 2VEPA 1YPXA 3EPMA 3NQ2A 4MLRA 3VNLA 4WDUA 3CH0A 3CUIA 4M1RA 1NFBA 5DRIA 1WKYA 2VCBA 1VHCA 3AI0A 3OG2A 1UD3A 1EJ7L 2XSBA 4IJCA 3ZVIA 3M46A 1A0EA 2V5KA 4AVOA 2HBXA 2J77A 1MEIA 1TWIA 1M7XA 4C6FA 3N9RA 5FKYA 1W0MA 1PTGA 3PPFA 3HOJA 1VD6A 3HG2A 1DQUA 1LQ0A 2GJLA 4UQEA 4O50A 7ODCA 2TPSA 3H26A 3RM9A 2ATSA 2ZRWA 1XIMA 2V5JA 2YB4A 3H7VA 3P62A 1THFD 1XIGA 3V5CA 1KBJA 3AXMA 3V5FA 2XGZA 3ZT7A 1LUCB 4H9MA 1G4SA 3SIMA 1B1YA 2MUCA 1U2YA 1YADA 3VD9A 4MJ2A 3CASA 4DJDC 2CHNA 4JX4A 1NOFA 3P67A 4MY9A 3ZO9A 1JJKA 4LALA 2NWSA 2UY2A 3LRMA 2WSPA 2FPVA 2V30A 1SUXA 1Z69A 2OX4A 1KR0A 4E8CA 1LRQA 4I8YA 3PBGA 5XINA 4H6QA 3M43A 5CPNA 4A2RA 2D24A 2Y88A 5CBJA 3PJWA 3STCA 3THAA 5D2YA 5K3VA 3MUXA 1B4KA 1Y7VA 4YU1A 3LXBA 2WKJA 3EX4A 4GUHA 1RQHA 2ISVA 3EMCA 4U5KA 3WK2A 2EPOA 4B92A 2GVYA 3OA3A 1O1ZA 1EKOA 1TV5A 1AUSL 5FJIA 4A22A 1JGMA 3W84A 1OABA 1SZEA 3O06A 3M0MA 1UOZA 5K4ZA 1QASA 3AMCA 1DBTA 4KIEA 2QZRA 3GAKA 1G9HA 5C71A 1FXQA 1LRNA 4GFIA 4GE8A 5EBUA 4YJ5A 2YCJA 3VX0A 3N6QA 2HMCA 5HWJA 5BW6A 5CSUA 3R8RA 3GNPA 4RK8A 3NYZA 3IIVA 5CQ1A 1EJUC 5JBDA 4HQVA 1I60A 3FV9A 4GWEA 5FF0A 1GQJA 4QLKA 4IUGA 3T7VA 3BW4A 4AFYA 3PB0A 1UWAA 3KP1A 7A3HA 2OEMA 1EGVA 4GIYA 4U4MA 2FPTA 4KESA 2RGLA 3VCNA 4XZ9A 1S1PA 4P7LA 1QNRA 1UP3A 4IQDA 2VENA 2YXXA 3M0VA 3KRUA 2NW0A 1S46A 1XLMA 4Q8MA 2WV8A 3LA4A 5HNNA 3C52A 5FA5A 1E56A 2I57A 1UUOA 4YN5A 1XYBA 1QATA 1UW9A 2QPXA 3L4XA 5G1MA 5B7ZA 4NIRA 1IT8A 3OHIA 4H9VA 4QM1A 1XLCA 2QHAA 2DSVA 2JK2A 3RGTA 4Q8WA 1TPVA 3RUBL 4GKTA 1IYXA 1LWJA 2GDVA 4WKAA 3DFHA 1ZL1A 4IQJA 4IIHA 3S9YA 5A2AA 1DTNA 1HF6A 1VRDA 2FFIA 1FP8A 1TQJA 4C65A 4MTVA 5D38A 2DP3A 3PB2A 1NAL1 5FSDC 2BVYA 4QGCA 4YTTA 1EP2A 4DJDA 4JN8A 5U4NA 2XVKA 4B2DD 2NT1A 5U7SA 4XSMA 3TA6A 1EBHA 2PC8A 2JEQA 3BOXA 3CZJA 4NILA 3FJ4A 2QMKA 3TLQA 2XGBA 2VWSA 4F0HA 3EBVA 2ZRVA 3BAXA 1CXFA 3F2DA 3KL5A 1P7TA 3IRDA 3LERA 4YL2A 2PWFA 3W2LA 2Z1XA 2XIJA 3VOHA 4O53A 3ZLFA 4S3BA 4K8GA 1J2WA 4N0RA 3ENLA 2PLMA 1B4EA 2ZZ5A 5HANA 3M0XA 3S1VA 1D7KA 1R86A 3BUVA 1C93A 1TPDA 3FGCB 3SO7A 2QUMA 3V35A 2OGJA 2Y7EA 1IT0A 1EWEA 3VNIA 4LEQA 3HG3A 2I1OA 1UR9A 3G2GA 1XBZA 2A3BA 2A79A 1V03A 1RAKA 1HJQA 1V6VA 1Z6KA 3WF4A 4CEUC 1GOOA 1W9VA 3VFLA 3DHDA 5LIKX 3M44A 5A5WA 1H5VA 3TSBA 3QQWA 3K4WA 5I77A 1HX0A 4DNMA 4FP1A 3O7UA 3DDMA 1VYSX 2XFYA 3PBWA 2PDCA 4W7WA 2E28A 4JY9A 2VNCA 4BK9A 2W0UA 1WA3A 2E0PA 4HPNA 5CJ5A 1FA2A 1RVGA 1TMHA 2F6UA 2ZUVA 4XBKA 1W1TA 1IXPA 3LI1A 2E68A 5DMMA 4AX6A 1EGMA 4PODA 2YX0A 1JPIA 1FWHC 4F8XA 3UVIA 4TX8A 3T2PA 2NUWA 6CGTA 3N18A 3AUOA 3S1WA 2I9EA 2Y85A 3A3XA 2OYMA 1OADA 3WNKA 3M41A 3MJYA 3BTNA 1HW6A 4AWSA 2GSJA 3BLLA 3IJDA 1GPFA 1A5CA 1LYXA 3W81A 1KXQA 3VXGA 4JYDA 1AMKA 1H62A 4GH1A 2NLIA 4LVFA 3HFYA 2C16A 3K1DA 4B5WA 4RNHA 2PLCA 3ITCA 5T91A 5EPDA 1H4PA 1ZBWA 3P5YA 3H7UA 3H23A 4KEVA 3M6YA 1FBAA 4MKSA 5LNVA 3MHFA 1T40A 3LMYA 3GHRA 2CXGA 3KWSA 2DT3A 3N9KA 1HO4A 4ERIA 3T0DA 3SSJA 4J3XA 4TTUA 4Z1CA 1OGGA 1PKNA 4DHGA 1Q7MA 5DQPA 4P8XA 2B81A 3CT2A 1JF5A 2Q09A 4FIQA 3QYSA 1CXIA 1WYIA 1E40A 1X8CA 3B0XA 1W9PA 4P5UA 4XX6A 2X41A 3H2EA 3G1HA 3HMCA 3EWUA 3GBDA 2Q01A 2XH0A 4B90A 3N1AA 2WSYA 1BVWA 1YPIA 1GOQA 1UBSA 3OZMA 3L4YA 1DV7A 1RK6A 1V0KA 4ZQCA 1N8WA 4I8DA 3QLDA 1YXDA 2DV0A 4HNUA 3UPBA 3SUWA 3A4JA 5CJMA 4BF5A 4FZIA 3MV11 2UBPC 1IEQA 4MNMA 3UJFA 3Q4DA 4JQ1A 3I4KA 1ZY9A 1VR6A 3T55A 3BZJA 3DESA 3BGJA 1SFTA 4MOZA 4ROQA 1UD6A 4D71A 2QJJA 1FKWA 2A6LA 2EPHA 3M0LA 5CPQA 1WDSA 2D1ZA 1V02E 4UB9A 1VIWA 3G77A 4HMDA 6REQA 4C7FA 1GJUA 3NL2A 4MG4A 1GZ1A 3LOTA 2XSXA 1DWFM 3SR7A 2WPBA 5EA9A 2EJ1A 1KXHA 4MY1A 5BNKA 1GHRA 4PMJA 1BYAA 4K2SA 5DMLA 4G7EA 4GJ1A 4JNMA 4FOJA 2BDQA 2QJIA 1Q6EA 4CD7A 4J3UA 3M47A 2VFHA 3EDFA 3B97A 4B5TA 5CGTA 1C90A 4RZBA 1TRIA 4WGXA 3L4VA 2ZUSA 3CK5A 4AIOA 1O94A 1HKIA 4HOZA 1SJAA 2B4GA 1UWUA 3SFWA 1JD9A 3FW6A 2GUYA 1LT8A 2LLEA 4GKLA 5C70A 1KW1A 2H8XA 4KEZA 4NYUA 2P50A 3PJTA 3UZXA 3TYDA 3S46A 2QCLA 3WDQA 2FVLA 3QRHA 1VHNA 1UMLA 2BBFA 1XFCA 2YCIX 4B5SA 2F6XA 3RDKA 2OB3A 2HVNA 2QDEA 3SCUA 3GDBA 3WJSA 3EOUA 1VBRA 2E7FA 2QLYA 1D9EA 2V5LA 4PUNA 3T05A 2Y62A 1CXEA 4HZ7A 4H9YA 1XI3A 2BXZA 3MHUA 1QOPA 4JTQA 2GQ9A 4C7DA 3AIQA 3T9PA 1XD1A 3TW9A 3ITGA 4IP4A 3PZMA 3PM6A 4FAMA 3NL3A 2VOMA 1P7TB 1R6WA 4WY0F 3KS5A 3C0LA 1FHVA 4DO6A 3QZAA 4PL2A 1J2BA 2NXIA 2R24A 3WUEA 3DGRA 4WJEA 4CVUA 2GUBA 3DG6A 4MMWA 1JCMP 4GH3A 5GVJA 4WJ8A 3B05A 4KCVA 1KM2A 1QDSA 5CZKA 1FY6A 3H2CA 3ZLGA 3T07A 3IJ9A 4QJ5B 3W4RA 4C6MA 2I5GA 3HGRA 3UXIA 4W87A 3KVMA 1C8QA 1OFEA 3VIFA 2O56A 3W1AA 1AVAA 4LTSA 1BD0A 1IQ8A 5G4WA 1SW7A 3MA8A 1UD8A 1DL3A 5DEZA 3SUUA 1KXTA 3MMWA 1HL8A 3L21A 1QAPA 3MO7A 3VCRA 1H7PA 3DFNA 1CGTA 3WNOA 4JFTA 4BZYA 3GVVA 4MB4A 4WGHA 4NZ4A 4LY8A 3C5QA 5C2XA 5LZLA 5GJNA 4FXRA 4XWUA 1K3UA 1NELA 3M0JA 5CPSA 2X1RA 1FWCC 4OV9A 1YDNA 4MYAA 3IGUA 3KDOA 4NASA 3N2TA 1NWTA 3QW4B 3UXKA 3NM1A 4AYSA 1X98A 5FJTA 3PZIA 3WK1A 3MWAA 1X6UA 1E1FA 1YDVA 3AOFA 4QJ1A 1CDGA 4YLWA 1BFNA 5D37A 3AISA 3W7EA 4HD5A 3TC7A 3LB0A 3AYTA 1OT2A 1JYVA 3W00A 1TWWA 2DJLA 1V6WA 1JNDA 4AD3A 2VRJA 3QGVA 2DQWA 3UWUA 4XBJA 4H41A 2QCMA 3P93A 3L65A 3XIMA 5LIUX 3S3GA 3WQPA 1XRSA 4IL2A 3NEHA 5EYWA 5A2CA 3GVGA 9RUBA 2PD5A 4F0KA 3W7PA 4HJFA 3S2NA 2E6DA 3MSYA 2VZVA 4AZIA 1FKXA 4CQDA 3WDPP 2FZ9A 4LANA 1ZGDA 1MQRA 3TP4A 1VEOA 3T81A 1HXJA 2Q3OA 4FF7A 1NQ6A 4S3JA 3CMGA 5CGMA 3CZKA 4RZ5A 1Z42A 2CLMA 1R87A 1P0NA 3W83A 4Z0JA 5I03A 4K39A 3RITA 3TTOA 1EYEA 1EJWC 3FFSA 3KWXA 2PWEA 3QV9A 3MUY1 2QVHA 5ABGA 1J01A 5AB3A 4D1IA 3UEQA 2ZRYA 1D3CA 1XLFA 2Z7GA 4XZWA 4WDTA 1IR1A 4P8VA 5AVHA 3CV7A 4C90A 3A9IA 4JZ5A 4DX3A 2G96A 3QMRA 1T7LA 1F3EA 3H8AA 3W1TA 3NR0A 4YWIA 2IKIA 4DM1A 1TO3A 4HNVA 3P0XA 4HBKA 3WQ5A 4ORIA 4CEXC 3N04A 4XZIA 1A49A 1CT5A 4XB3A 4XZBA 2G37A 2NVDA 2JF7A 3VKKA 4O8RA 4M19A 3LN3A 3AXKA 5DY3A 4XAYA 4L1GA 3RR4A 3WO8A 3DZ1A 4NP7A 5FOOA 4DJEC 1ZAHA 4PMXA 3PSWA 2VFFA 3MC5A 4ILSA 3W0KA 2W4XA 3MUIA 3HPAA 3WD4A 2CLPA 4E4PA 5M2FX 3N34A 2GOKA 4V28A 1UZDA 1XR2A 3PZUA 3SUTA 4RDZA 2UY3A 4LX4A 3CQ0A 4UTLA 5CPOA 5G4HC 4F2TA 3VX1A 4NJIA 3BLFA 1OC6A 3O0KA 3JW7A 3VGHA 3EX3A 4UR8A 2O92A 3JZUA 3RCNA 4AVFA 2A3CA 1R46A 5C5YA 1QNPA 3VNZA 4YYFA 4JDBA 5ABHA 3TYAA 1DOSA 3UA3A 4BY3A 3T2OA 4BQ5A 1BYDA 1P0DA 1N55A 4C6EA 1ZPTA 4F2UA 1NVMA 4R33A 4B5XA 1PZ2A 3GG7A 3UG8A 4KF1A 1ZJIA 4A21A 3O07A 3KOFA 1H60A 3OBAA 3IIXA 4M24A 1ZCCA 2WJDA 3UJEA 4L6HA 2PD9A 3LGDA 3WQ4A 1KB3A 2C0AA 3LLXA 4ZENA 4DRSA 3B0YA 5A6SA 3KBMA 1OIFA 5LIYX 3TDFA 1CTNA 4KEMA 3AS3A 4Y2WA 3T1GA 1OB0A 1J10A 1ICPA 1XG4A 1MFUA 2W91A 2A7RA 4IFKA 4E8DA 3LHWA 4NZCA 5E0CA 1VCVA 3INPA 4YTUA 3ZR4A 4RDWA 1PX3A 1KCXA 4UTJA 1XSIA 3V3WA 4D6IA 4KWSA 2GVEA 2OZTA 4MPKA 3ZJKA 3GS6A 3TIMA 4IH3A 1FVPA 5C9RA 4DXKA 2FZMA 1JFHA 1WP6A 1JPKA 4QE1A 2FGLA 3G0SA 1YHTA 4AIUA 4MNKA 3WNMA 2VWTA 4WEVX 5HATA 1Q6LA 2HS8A 2JQXA 4ZOAA 4JTKA 4Y9PA 3BLPX 4PBEA 3QFWA 3R89A 4KRTA 5FEXA 2YSWA 1E6NA 2W79A 4ICNA 3E3HA 1ONXA 4MB3A 3PR2A 3VOCA 1H0IA 1XH0A 1IE7C 2AGTA 2D3NA 5JQ9A 1K70A 1M41A 1CLKA 1PJ9A 3AROA 1W8SA 4KRZA 3U5YA 2P53A 3S9IA 1A5NC 4ZTYA 3C0JA 5E0FA 2FLIA 5I3JA 1E72M 2OYLA 5HINA 4ZA0A 2V2DA 4XUGA 1SZRA 3EA3A 4BF7A 1PS9A 3GTNA 5SWUA 4LAMA 1VRXA 4BQ2A 4BR1A 3OYZA 3BG9A 4DJEA 3K4DA 3GTIA 2I9UA 3QN3A 2XIMA 3AYSA 5DLCA 1XD0A 5BMWA 3WENA 4RW5A 3IUIA 4ZXOA 4H2HA 4LCQA 4L4PA 4C1NB 4W8LA 3MS8A 4IZGA 1W5NA 1F3XA 3DU0A 1EEXA 3SDOA 3A4WA 4TV6A 3NDZA 6TIMA 3K8LA 3CUGA 1JRBA 4PMRA 4UQAA 2ACSA 5FF4A 1WDRA 2GL5A 4HZ8A 4AISA 4Z2KA 5KZ6A 1MO0A 1R2RA 3RU6A 2PS2A 1E43A 2BXVA 3NOYA 2J79A 4M7TA 1BTMA 3W70A 1OFRA 3B8TA 4KIRA 4JTUA 3G6LA 3TH6A 2R1KA 3M7SA 3ABSA 4L56A 4OKDA 2C3ZA 5A8OA 2VUYA 4N9DA 1XICA 2ZKMX 3EAUA 1JAKA 2E5DA 5FI8A 3GUGA 2OTDA 1D7FA 2CLOA 3ZFHA 2ZZ6A 2P1FA 3W53A 1PUDA 3PTKA 4PMOA 4EWJA 2ZA3A 2CERA 3E96A 1FH8A 3QQ0A 5AHFA 1OCBA 4XO7A 2GJNA 4F9DA 3EX6A 4GIAA 1DYSA 1F05A 4AZ5A 2J24A 1BQGA 3LNPA 4AY1A 3NGFA 1H61A 3MCMA 1J12A 4GYPC 3PP7A 1MW2A 1VH7A 2XN2A 2OSWA 3LHVA 4O15A 1CENA 2H90A 3IJLA 4ZO7A 2ZVIA 1EIXA 4J3ZA 2WC7A 1B0IA 1V51A 5H91A 4DVOA 1HNYA 4GOAA 5BWAA 3TE9A 4BEUA 3ARXA 2NXGA 5HPCA 1RCQA 1M6JA 2A5HA 4I7UA 3TROA 4V27A 3CYVA 4PBGA 1B3WA 1GCYA 3QKEA 3WDIA 2BVWA 1F5ZA 1EJRC 5CZTA 1H7NA 4JFVA 5CH9A 5M1TA 1YDOA 1JZ6A 3EKZA 4GABA 3SCSA 2CWNA 3FA4A 1LJYA 4FNRA 5IOBA 1S3HA 4NSBA 4D1JA 2QNEA 2VP8A 4TTGA 3AIEA 5BCAA 5E09A 4J4KA 2J7GA 2PFHA 1K7XA 4WJXA 4E2OA 3AIWA 2E9MA 1W1ZA 1JZ3A 1G7VA 3ME3A 2ZRXA 5D2TA 2Y63A 2HCVA 4R85A 4M0XA 4AXKA 1F61A 3DUGA 1TPEA 3DG7A 1A5KC 4DF2A 4K1WA 1GEQA 2J6VA 1CEOA 4NZ3A 4ZQMA 4J3TA 5I09A 4BF9A 1XW8A 1AQ0A 1KFWA 4JHZA 6ENLA 4EPKA 4P7NA 1CBGA 4JAWA 3WH6A 2PTXA 4HCDA 2Y7DA 4AHQA 1VFSA 4O1EA 1W5QA 3RF9A 1V0LA 1WUFA 2Z2BA 2WB5A 5DO8A 3HM7A 3MDWA 1RJRA 4HMEA 1OX4B 3AMKA 1ADDA 2JIEA 1UJQA 2WK2A 3NVTA 4N42A 3ONCA 1FH9A 1TR9A 3U2CA 1W3HA 2R94A 2DT1A 4Q4QA 1NEYA 3S5SA 3RAOA 2VEMA 4V2XA 4IFKB 1PTDA 3HU7A 2PGFA 1RD6A 2Q6ZA 3SCWA 1N8IA 1YE4A 2TAAA 1EA9C 1HKWA 2QJGA 1XSKA 4JDYA 3ZJ6A 4LSBA 3AZRA 3AZTA 3WELA 3TJLA 5I0DA 3EB4A 2C79A 5I5RA 1YDYA 3VZYA 2WZIA 2XVLA 1FWNA 4GYPA 4H6EA 4RXFA 3RRXA 4H1ZA 3W23A 2EXOA 5HNRA 3FEMA 1QUMA 3ANYA 1IEWA 1UWTA 3RPTA 2ZUTA 3PS7A 2JE8A 1G7UA 2O0TA 4Y9MA 3H4GA 4DEFA 2PDUA 3N29A 4RV8A 4IHCA 4UFHA 5I3KA 4ES4A 3AO0A 1CXLA 5AHLA 3RO8A 2CBUA 2R9RA 2C8NA 2BHUA 3U4AA 2QS8A 1KKOA 3HPFA 1S5TA 1X1NA 3G1FA 3SRKA 1A50A 3GKFA 1A0DA 1QXLA 3NGJA 5JMUA 1H3GA 4ATLA 4L4OA 3IARA 3HIJA 4NXKA 3RG6A 1YNYA 3V1HA 1V4YA 3ABQA 3KBVA 3POCA 4GINA 3TU9A 2P3EA 3A3WA 4IPJA 1ZQ5A 4JEJA 2JBMA 4DWSD 4NRRA 1JI2A 2FPYA 4DB7A 1FWRA 1NY1A 1KV5A 3LTYA 2PDKA 4D8LA 1JCJA 4GYJA 1PKLA 3R0UA 3CL8A 3ZT5A 2GJPA 1VBHA 1UP0A 4PGLA 1FXPA 5HQEA 2ADAA 3VMPA 2AQWA 3CB8A 1HQTA 1XYZA 3CJPA 1DIKA 3N14A 3STFA 2VX4A 4RV3A 1V6XA 3HURA 5D33A 4NX5A 1VENA 1LLOA 3LEPA 4A2SA 4Q3MA 3GVQA 1I2NA 4Q8NA 2HNHA 2ZZ2A 2NWRA 3GKAA 3QPYA 4UQ9A 4GC4A 2FZDA 4XVDA 3LHTA 3BGAA 3Q45A 5D9PA 2PWUA 3ISIX 2WNNA 1RVKA 1EPXA 4RXGA 5TAOA 1CYGA 1TYGA 5A6BA 1VIZA 3CEUA 2W61A 4PMNA 4EXQA 1QO2A 1UC5A 1XRFA 1PIGA 2QCCA 4CNUA 3G18A 5H8PA 2YCKX 2YA0A 4X61A 1PYMA 3N3TA 4AC7C 3FDKA 1BF6A 4LH8A 1W5MA 4PTWA 3W27A 2VFIA 1Q8JA 5I00A 4YS1A 5EKYA 1IXNA 1JYNA 1A4MA 3GZAA 2VOTA 2GYIA 3W7CA 3MWCA 3W37A 1ELSA 3UW6A 4JY8A 4KPLA 2R1MA 3P3BA 2P10A 3W7LA 5GNZA 3ZSSA 3AHVA 2CLEA 3E9AA 1XP3A 1VFTA 3G1VA 1ZP3A 1S39A 1X97A 4CKQA 3ZWTA 3IK2A 1H1ZA 1SFSA 2WHKA 4M82A 3W6YA 4AU0A 1A5MC 1H1NA 1TRDA 4AX7A 1JRCA 4PCPA 3BLIA 1XRTA 4HHMA 4GNJA 3UD6A 5CG0A 2CLIA 1J96A 3EX2A 4NZ1A 3MT1A 1ZCOA 1DXIA 2PDBA 3A22A 3WQWA 2RHGA 1RD5A 2Z6IA 3PAJA 4ACYA 4I7VA 3WQEA 3NSNA 4MADA 2ACRA 3B4YA 3G1SA 3QY8A 3FA3A 4FLSA 1SFJA 2PDGA 2F9RA 1CNVA 5AHMA 1IEIA 2EKCA 2VZUA 1ZTVA 3I7QA 1UH3A 3BQ6A 5F4SA 1NP2A 2QCFA 1EXBA 3FNDA 4LVGA 1EC9A 1HFBA 2VC9A 3CAWA 5A8MA 3TAOA 2G95A 2QCHA 1KWKA 3R2GA 4JKKA 4NYYA 3ZT6A 3JR2A 4LS1A 4ZB0A 1WOBA 4MGGA 4TVCA 2PRHA 3I65A 4LUJA 3TZFA 3V75A 1EJSC 3WFZA 1FWIC 3F4DA 3GHSA 3GWQA 3RRAA 4JN7A 2D0HA 1YXCA 2BY2A 2R91A 1CLVA 4IIDA 4Q7BA 5AYIA 2BVTA 3MBFA 4L6OA 3C8NA 2HVMA 2WKLA 3IVSA 2C15A 5BRQA 5DY2A 4ZO8A 3ZMRA 3AIBA 1VCGA 3PY2A 3S8HA 5HOSA 2JKEA 3A3HA 4EX4A 3DN5A 2FHCA 3C2OA 4LW7A 3OYXA 4A29A 4ZE4A 1DHKA 2ZOXA 4B15A 4HU3A 3FK4A 3LDVA 1TPH1 2WANA 1YTEA 4MUZA 3WNNA 1F6KA 2W66A 3ARRA 1ISZA 1LWIA 1HN1A 3NQGA 5CLTA 1S5MA 1JDEA 1AG1O 3W7JA 3TYUA 1MWOA 5J5DA 4Z1YA 4K68A 4GBUA 3NQ8A 1FCQA 1PKYA 1EQPA 1XLHA 3FEQA 4HZ6A 2NQ9A 3TA9A 3STGA 5CZ0A 3TZNA 3UNTA 3AWOA 1LZOA 3WL0A 1W1A1 3AQUA 2QT3A 1MUCA 3I68A 1HGYA 3CGTA 2GZXA 2NLYA 1RLCL 4ZOCA 5CAHA 3OODA 1W9DM 1PVNA 2PCEA 1W37A 5GPRA 5FJPA 4MFDA 1AJ0A 2V38A 3KCJA 2OVLA 1OSEA 3CPRA 2OELA 3V18A 1W8GA 3UQNA 4UMAA 3L12A 4NZ5A 2X16A 1GW9A 1TJRA 1UKQA 1VPXA 3S4TA 3CMJA 3GTFA 2PAJA 3NSXA 3UZZA 1JZ4A 2GK1A 5F1VA 1Q4WA 5IHSA 1OC7A 1IZCA 2WMIB 1MUMA 2FFCA 4MYXA 7XIMA 4FS9A 6A3HA 2YYUA 5J04A 2QKFA 3HPXA 3IIZA 1ZENA 3WLSA 4N9BA 1A3WA 2IPJA 2A21A 1JUEA 3W73A 1V0NA 1A0CA 1AFSA 3G24A 4GXWA 4LF2A 4G9PA 3R12A 5LA1A 4W93A 1XGEA 5D05A 3EDDA 3OZOA 3SCTA 4H3DA 2A3LA 3WLHA 3IGSA 4XQ6A 1UA7A 2VYOA 4D8AA 3CUJA 3H24A 3VKDA 1F6PA 3UERA 3UXLA 1I0BA 3SCQA 3QQ1A 1JZ2A 1XLEA 1Z89A 4M56A 5LSMA 3C4UA 3DYOA 4XISA 2ODOA 3TTYA 1P1XA 1RSCA 1A4LA 4LUIA 3MHGA 4HK7A 4LAUA 3GFYA 3MSGA 3LBMA 4XKMA 2FKPA 4FR6A 1UKSA 2PDMA 2WOQA 3V0SA 3NQMA 4JYFA 2AL1A 2DZAA 3GHUA 2F7FA 3AXXA 1WOAA 4PTNA 4N7QA 3E1F1 5C2GA 1AD4A 1IXQA 3BSHA 2EG6A 4U3CA 8RUCA 4HCHA 2HRWA 4XV0A 5ABTA 3CIXA 3VU2A 4UOZA 3CLWA 4MLJA 4O54A 3IJ7A 4FLQA 1UYQA 2E8ZA 3K2GA 1TJ2A 2I14A 3E0WA 3GDRA 2YDQA 4HYVA 1OK4A 1P6BA 4S1FA 4RPQA 1AJ2A 1SM9A 1S2CA 3PBYA 2QF7A 3BE7A 4BCEA 4RCXA 4PUDA 1XYCA 1TZ9A 5ECVA 1OX5A 1YLVA 3NSMA 1AMYA 1DQXA 2DH2A 1W1PA 3L4ZA 4ZO9A 3LV6A 2WMKA 2NT0A 4QNEA 2QV4A 6PTDA 3ZIZA 3GDKA 2FHFA 3SAZA 3K46A 1RP9A 4WF7A 4ZTXA 1GG0A 3TNOA 2BGNE 3H2AA 1QI4A 1AA1B 4H6KA 3GVWA 1AH4A 3H6OA 3V5OA 1QNOA 2CESA 4QR6A 3LCXA 4YVVA 5F7UA 3VNMA 1E71M 4RE3A 2WBKA 3NCOA 2ZX7A 4IPNB 4Q32A 2RDWA 1NQKA 3VVGA 2BSLA 4IT1A 4UFIA 4LRTA 5AN7A 4DO7A 2XH7A 1W3IA 3W87A 5CBIA 2QUUA 1HUVA 4GA8A 1IIHA 4KFPA 4P7QA 2D20A 1JNEA 3WD0A 2VGGA 1QJWA 4AG0A 3NQVA 3MKCA 2A6NA 2V9DA 4DBSA 2XFRA 3WCZA 3W1PA 4PSPA 4F0MA 1ZUAX 3BL3A 3OVPA 4MKNA 2XH4A 5A6MA 2W92A 3FKRA 7PTDA 3WL1A 1TV2A 1OFPA 2ZTKA 2TMDA 2YL6A 2CZVA 2HJPA 1POJA 3MBDA 3KS6A 1B90A 5D2WA 3HB9A 2B7NA 1RBOB 2F61A 2PU1A 5FEWA 1HKVA 4QRNA 4OQVA 5D9OA 4TR9A 1PTAA 3RLUA 3CPGA 2PSNA 3A12A 1TV7A 3M5XA 4IOTA 2PB1A 4G1KA 2G3FA 4RPPA 1X38A 4DF1A 3C61A 4CQ8A 1EZ2A 1RZMA 1VCFA 4BWLC 2YBVA 3UZJA 4F48A 1MNZA 5FJRA 5CCZA 4IL0A 1XSJA 3LHZA 3DC0A 1E4LA 3TV8A 1AL8A 3WH8A 3NPUA 3GYEA 2CPUA 4KWWA 5D4YA 1P43A 2P8BA 4P7RA 2JIWA 5L9FA 1OX6A 1XGZA 3TN3A 1D2KA 3RPDA 3WLIA 3HN3A 5LXXA 3B8SA 1EYWA 2P3ZA 2OWCA 4O52A 1FUYA 3WQ8A 1LL6A 3AS0A 1S3TC 1XLGA 4LF1A 1AQMA 5LGXA 3FXGA 3SN0A 3PZ9A 1JAEA 4FR1A 1FP9A 3QTPA 3W7OA 3P14A 4HK5A 4UTKA 4JXCA 3M7WA 1NWRA 2Z6JA 4HP5A 2F2KA 2VFGA 4V1YA 3LI0A 1U5JA 5BXTA 1EUNA 4PSRA 4IM4A 4DYEA 2GK1B 2ZWYA 2DSWA 3AALA 4GHRA 1TVPA 2VHLA 2QPUA 3B9EA 1ITCA 4H04A 5LA2A 3UWWA 3B0UX 1P6CA 4Z2LA 1MDLA 2YOCA 3W76A 3Q2DA 5FL1A 3LXCA 1Q6OA 3UR7A 3EOLA 1XH1A 2VO5A 1E73M 4OBRA 5HULA 3BURA 2QCDA 2X1SA 4RNJA 1EC8A 4K37A 4LXFA 2FTPA 4HPGA 4GQRA 4WSHA 1OM0A 5A6BD 1XJBA 3SQSA 3PBMA 4BI6A 3TXZA 3EXRA 3WZ0E 2DSUA 4YVXA 2FVKA 3HQOA 1R0MA 2UZ9A 1VEPA 5LIXX 1PWMA 5IRPA 5LNUA 3PUGA 3VNJA 4MWAE 3WK3A 2QJHA 1GQIA 2V6AA 3I6RA 2V3GA 1MZHA 1ZBCA 4OBTA 2PRLA 2CETA 2AL2A 4OT7A 4DIAA 3KCLA 4QHRA 2QIIA 4ZB2A 2WSQA 1EJTC 1DXFA 1M03A 3KBSA 3RFAA 3RHGA 3THDA 5KMYA 4WX2A 3ABXA 3Q65A 2RJHA 4B4HA 4QCEA 1S5WA 1YNPA 4YCPA 1BLIA 3GQYA 2P8CA 1NDYA 3QPEA 1IZJA 4O4WA 5K9DA 4FX8A 4TIMA 2EHHA 1R3WA 4UMBA 4DZIA 2ZX5A 1CB7B 4BWLA 1VFOA 5BYWA 2P0OA 3MU7A 1KFBA 3EB3A 2FZ8A 2ZX6A 1KBBA 1FWEC 2WSKA 4DJFD 5HWMA 5AKQA 3A6OA 4HHLA 1R8LA 4QIUA 3H7RA 2ANUA 3ARPA 5BWFA 4XAGA 1TPC1 2E1WA 3LCFA 3UESA 1A80A 1Q4NX 3DECA 4PFHA 2J66A 2PTWA 5BRBA 5AC5A 1HVQA 1LM1A 1ONEA 4I5UA 2XM2A 3ZOAA 1B9BA 1N2VA 1JDAA 8XIMA 3WX7A 1XIHA 1JCNA 3WH5A 4S3GA 5EMKA 2PC4A 3LM7A 4PUMA 3EWDA 3PTQA 1DWJM 1ZFJA 3UT0A 2OT1A 1FQ0A 1D3HA 1RR2A 5IXEA 5DMYA 2I56A 4IGNA 3QY7A 4C6OA 4XSLA 4J2MA 3S5OA 1IHIA 2ZC8A 4RE2A 3UVAA 4X63A 4EP8C 5K2ZA 3F1QA 4RNIA 1TVNA 2EAWA 4XAZA 5EY5A 4W88A 3MUAA 3LUTA 1R9XA 1UKPA 2HV5A 1RK5A 3KW3A 3W38A 4NXSA 4I9AA 3RXZA 5KSWA 4AMAA 1FHLA 1E15A 1UPPA 5I79A 2HEJA 4NAEB 2WZTA 2ZUUA 2DDXA 3EKGA 3TJ4A 1RJPA 4WXYA 3UCCA 1RBLA 2CHOA 4FF5A 3OVGA 1A5LC 3TVAA 4AZCA 3VC6A 2VXNA 5TNVA 4O57A 1UC4A 2GQAA 4WHBA 4UFLA 2WHMA 4QXIA 3LGEA 3OQ8A 2H8ZA 4B2DA 2X30A 1VLIA 4J3SA 2DORA 2XU2A 1UZ4A 3PULA 3BWWA 4QDPA 3CHFA 3W1XA 1V3JA 4UQBA 3N2MA 1Q66A 2OQHA 4JIQA 3OPSA 1B5TA 1UQYA 2Q8LA 1GVOA 5BXPA 3MKKA 4PTVA 4MVAA 2WM1A 1VJSA 3GSMA 1FCUA 3TTQA 1WKDA 3QW3A 2J78A 3EA1A 4Y8FA 1UUQA 4L9XA 1W3KA 4W8BA 5D8WA 1UR0A 4KBXA 5G5IA 2VD8A 3H2MA 1Z41A 1XC4A 1NOUA 1EJXC 3EDJA 4ZOBA 1I45A 2Q8XA 2PMQA 5A6JA 2V68A 3VYLA 3KOYA 2OZ3A 1OF8A 1XX1A 1MSSA 4HHHA 3AIUA 1OINA 3VMNA 3PVFA 1QNVA 4A3RA 4J5NA 2PDWA 3LYEA 2D23A 4FXJA 1LL7A 2AOSA 1DE5A 4EK7A 2HS6A 1UG6A 1F6YA 1PYFA 3DBNA 1A3XA 2JGYA 4A4AA 3VOFA 3BOLA 4MJMA 4U31A 3LX9A 4AF0A