4XIAA

Structures of d-xylose isomerase from arthrobacter strain b3728 containing the inhibitors xylitol and d-sorbitol at 2.5 angstroms and 2.3 angstroms resolution, respectively
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
393
structure length
393
Chain Sequence
VQPTPADHFTFGLWTVGWTGADPFGVATRANLDPVEAVHKLAELGAYGITFHDNDLIPFDATAAEREKILGDFNQALADTGLKVPMVTTNLFSHPVFKDGGFTSNDRSIRRFALAKVLHNIDLAAEMGAETFVMWGGREGSEYDGSKDLAAALDRMREGVDTAAGYIKDKGYNLRIALEPKPNEPRGDIFLPTVGHGLAFIEQLEHGDIVGLNPETGHEQMAGLNFTHGIAQALWAEKLFHIDLNGQRGIKYDQDLVFGHGDLTSAFFTVDLLENGFPNGGPKYTGPRHFDYKPSRTDGYDGVWDSAKANMSMYLLLKERALAFRADPEVQEAMKTSGVFELGETTLNAGESAADLMNDSASFAGFDAEAAAERNFAFIRLNQLAIEHLLGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of D-xylose isomerase from Arthrobacter strain B3728 containing the inhibitors xylitol and D-sorbitol at 2.5 A and 2.3 A resolution, respectively.
pubmed doi rcsb
source organism Arthrobacter sp.
molecule tags Isomerase(intramolecular oxidoreductase)
molecule keywords D-XYLOSE ISOMERASE
total genus 141
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 5.3.1.5: Xylose isomerase.
pdb deposition date 1989-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4xiaA00
3DBNA 4YTSA 2XISA 3L23A 4GQBA 4XISA 1XLFA 3XINA 2GVEA 4DVOA 4X63A 4XSLA 3UA3A 3C0SA 3KBJA 9XIAA 4YTUA 1XIEA 1XLCA 3AYTA 2XIMA 4A8LA 2QUMA 1CLKA 4YTRA 1XLHA 3NGFA 4A8RA 2QULA 3ITYA 5C9ZA 3JU2A 1QT1A 1DIDA 3AYVA 3N4AA 3P6LA 3XISA 6XIMA 1QTWA 4PFHA 3IUDA 4W4QA 3C0QA 3UXIA 2HK0A 3BZGA 3TC3A 4EAYA 5B7YA 2I57A 4X60A 3CNYA 4KW2A 3IUIA 2G4JA 4X61A 1BXBA 1MNZA 3CQKA 3C0LA 3M0LA 1XLBA 3M0XA 4HNOA 3ITXA 3KCLA 3LMZA 3UU0A 1XLIA 2G0WA 4QE5A 5B80A 3OBEA 4PGLA 4G56A 5AVNA 2OU4A 1S5NA 5EMJA 1XLKA 4XSMA 4QEEA 1XP3A 2GUBA 2QUNA 1BXCA 2GYIA 3KBVA 1DE5A 3QC0A 5I7GA 4ZBCA 3TVAA 4YTTA 8XIMA 1XYCA 4HHLA 4LNCA 1YX1A 4QDPA 3VYLA 9XIMA 1XIGA 1XLAA 4HGXA 3U3HA 4ZB0A 1XYBA 1XLEA 5H6HA 3VNLA 3XIMA 4Q7IA 3KBNA 5EMKA 1XIFA 1XYAA 3FVMA 5FA5A 2GLKA 1XLDA 1XIBA 3QXBA 4J4KA 3VNKA 1K77A 4GLEA 3WQOA 5XINA 1A0EA 1A0CA 1O1HA 5TNVA 5AVHA 1MUWA 4OVXA 3ITOA 1XIIA 4QDWA 1I60A 4K3ZA 3GNXA 1GW9A 1XYMA 2X7WA 6XIAA 1XISA 3QYSA 3DX5A 4GJIA 1XLGA 3BDKA 1XIHA 1S5MA 3BWWA 4DUOA 3UVAA 4QE4A 4YTQA 4QEHA 4QE1A 3AALA 3KWSA 3KCOA 4ZB2A 5J8LA 4ZB5A 4A8NA 7XIMA 4XKMA 3KCJA 2HCVA 1XLMA 1XICA 1DIEA 3VNIA 1I6NA 3ITTA 3CQJA 3KBWA 3QZAA 4US6A 1OADA 1XLJA 3BANA 3CQIA 4XIMA 2QW5A 5H1WA 2X7VA 3M0MA 2ZVRA 3M0VA 4E3VA 3ITLA 2I56A 2Q02A 1XLLA 1XYLA 1XIJA 1XIDA 2XINA 3M0YA 4K1GA 2J6VA 5B7ZA 3IUHA 1DXIA 2HK1A 2NQ9A 4XIAA 3P14A 1A0DA 1DE6A 3KBMA 1TZ9A 3U0HA 5EMLA 4EACA 5XIAA 1XINA 4A8IA 4HHMA 3VNJA 3M0HA 3CQHA 5EMMA 3KBSA 4GJJA 5XIMA 3ITVA 3UA4A 3BZJA 8XIAA 2NQJA 3VNMA 2NQHA 3KTCA 1XIMA 1QUMA 3CWHA 3AAMA 2ZDSA 1D8WA
chains in the Genus database with same CATH superfamily
3PTDA 3QVQA 1IGSA 5AKQA 1GVRA 3IRDA 3GY1A 3LQLA 1KLYA 1TPUA 4FX8A 3CB8A 5E0CA 1RCQA 3LHTA 1CECA 5HWNA 5B7YA 2B7NA 3FYYA 1DJQA 2W79A 4KW2A 3VVGA 3LGDA 4NZ4A 2X1TA 3NPWA 1KTBA 3B0XA 3IJIA 2XDFA 2YCJA 5D9NA 4I7VA 2VD8A 3UPBA 2WNNA 3W2NA 5KEZA 3SY5A 4L1WA 2PWFA 3R1ZA 3DFSA 4WR3A 4ZO8A 3FY1A 5H6HA 2D20A 1JZ8A 4IPJA 1VH7A 2YCLA 3VIPA 3CU2A 2X2YA 2X7WA 1NVMA 2GVLA 4P7RA 4FALA 1FFRA 3NZPA 3TFCA 1Z44A 1VRXA 3WLMA 1SVDA 2ZYFA 4OGZA 3DHDA 1J5SA 3R0DA 2AAAA 1YEYA 3SCTA 1SO6A 2Z1WA 3KRSA 4CQ8A 4QBXA 3GQYA 3GFXA 2CESA 1UUOA 4HNTA 3UZJA 3EMQA 3M0HA 4S23A 1AJZA 3W01A 1W3NA 5HXMA 2YXOA 5CZTA 4JEQA 3SCUA 1Z7AA 2EO7A 2GL5A 3LNMA 2VFGA 2XVNA 3W84A 1Q7MA 4IXHA 1V6XA 3JU2A 4Q6XA 3O9NA 2ZTKA 4AWSA 1UQZA 3HMJG 1TZZA 2J74A 4O1EA 3WO8A 5CC7A 1KB3A 4RE2A 1UC5A 3M0XA 3R12A 3LHVA 3G2GA 1HNYA 4BF7A 1TSIA 3NSNA 3TYBA 5I3JA 3UPWA 2ALRA 2HNEA 1PS9A 2O4MA 5KZMA 3K30A 1RQEA 4B5SA 1UD5A 5LGXA 3UETA 3BAJA 1PJ9A 2G37A 1GG0A 4EXAA 1TMHA 5AVHA 2IPGA 1BGGA 2BV9A 3I6RA 4C6JA 5A6MA 4G1NA 3MSDA 3GO2A 2BMBA 5LNRA 4LOCA 1E9ZB 1GOQA 4ZR8A 1NFPA 2B0MA 4EK7A 3IACA 1UW9A 4D8AA 1ITQA 4IMFA 4GUIA 1ZAJA 3RCNA 4GE8A 1AW5A 1ZPTA 3KTSA 1TELA 5BOFA 1OT2A 3QH2A 3DFQA 3NNTA 2I16A 5FEZA 3LRLA 4JTRA 3SFWA 4AD0A 4AVNA 1R3VA 3SO7A 2XISA 4H19A 3SJNA 2NV1A 4GD0A 4N9DA 4L9XA 2AOSA 5CEWA 4F79A 1NWTA 4CEXC 4YN5A 1DQUA 2BOGX 1B90A 1GOKA 1EIBA 3RM4A 4EX4A 3B0YA 1TMQA 1X7FA 3C0JA 2FQIA 2OLHA 1L2QA 5I0DA 3ITXA 1ADOA 1OK4A 1F3WA 1M65A 2J8TA 2J25A 4TTUA 2FVLA 3L4WA 1P7TA 4M6UA 1XD0A 2JKAA 3WLKX 1M7JA 2IPJA 1H1ZA 1UWQA 2BGNE 4C7FA 4F48A 2QCDB 3P7YA 5T9BG 1F8MA 1GTEA 1WUFA 3L2IA 4O57A 1UOZA 3QXBA 4J1OA 1KKRA 1TVNA 2BY1A 2DSUA 3ZWTA 2PU0A 1XFBA 3F4CA 2ZIDA 5DFAA 4G6CA 4QHRA 3POHA 4KF1A 1LP6A 2PDCA 3KL3A 1R9YA 3MUXA 3LCFA 2EBNA 1RH9A 1BF6A 3MVIA 3N17A 3UCCA 2GDVA 5D8WA 1HZYA 2ZOXA 5FJUA 1TPH1 3FKKA 3BGGA 4N6EA 4DJEC 5CZ0A 5DN1A 3BE7A 2QJNA 3REQA 4FNTA 4LCSA 4HD5A 3ZR4A 3DDMA 1LWIA 3CC1A 4GVGA 1I2RA 3CHCA 3EWCA 3ZT6A 2DH3A 2DZSA 1TFVA 3W1XA 1XBZA 3P6LA 3L7RA 4BI5A 1W17A 1SMAA 4HMCA 1J18A 3G3DA 1ZUAX 3W0KA 4RLIA 2VOTA 3K5XA 5FJJA 2G4JA 1JFHA 3KCLA 4AY8A 5CJ5A 4D6FA 3NM3A 2GUUA 4GQGA 4ZE4A 3W1NA 3R7MA 3BQ5A 1IIHA 3NDYA 5ABEA 2O4QA 3PANA 2A4AA 3TYAA 1CXLA 3BJTA 3B4YA 3K1GA 2GQ9A 2XU2A 2YCKX 4JQ3A 2DZXA 3LGEA 4LS1A 4OKDA 2Y5SA 1DJIA 3E74A 1WB0A 1PO9A 4FIQA 3L4UA 4PTDA 1E0UA 5D38A 1WV2A 4AZ7A 1TQXA 4NT0A 4ZVJA 3W2KA 4PMNA 2PDIA 1ONXA 2C71A 1CDGA 1BWKA 1VZWA 3JR2A 4HPXA 3V36A 3MPGA 1SJCA 1XDJA 4XKMA 3TJLA 1JCJA 5AFDA 3RJYA 1UWTA 3PWAA 3MP4A 3WK2A 1FOBA 2XPKA 3BCFA 4MKNA 2PU1A 3RPTA 3F4DA 1JYXA 1TZ9A 5XIAA 3W2JA 4CN6A 2UY3A 2OSXA 2ESCA 1D9EA 1PAMA 2IKIA 2V2DA 4IPNB 3TH6A 2I14A 5TF0A 3NA8A 3VM7A 4RZBA 2BBFA 2JKPA 5EPDA 3FOKA 5AYIA 3BOFA 3B40A 4LYQA 4MF4A 5CCZA 1DXFA 4S38A 3LGGA 2QVHA 2ZUWA 5MF5A 3AU2A 4FS9A 3G1HA 4ICMA 4UFIA 3UR8A 3RLGA 4NZFA 3DEQA 5F2IA 3DG6A 4S3FA 2CBUA 4PUMA 3SZ8A 1PTAA 1TUXA 4U3AA 4US5D 2POZA 1X39A 3KAOA 4K7YA 3WDJA 4Y9NA 2ZWZA 5D32A 3GTNA 1TB3A 4HA0A 2ABBA 4PL1A 4U5KA 1PEZA 3P3BA 4FO4A 1JUEA 1KCZA 5H8MA 3QZEA 3GIPA 4GI8A 1Q45A 3C8NA 1RR2A 3BXWA 3NXLA 2BTMA 1ZB5A 2O9OA 3E0IA 3PG8A 5BNKA 1G69A 3QY8A 2ONEA 5C0QA 4Q8WA 2DV0A 4PRTA 4Z1YA 2VYOA 4AY7A 1CLVA 4P8UA 4OOUA 5FESA 5ECVA 1UZ4A 4PCSA 1HL9A 1XYLA 4DWSA 1G5AA 1BYAA 5E09A 3QR0A 1GQIA 4O18A 5DCEA 3FJ4A 4EACA 4Q8VA 3P62A 1BQCA 4JN6A 5M17A 1M53A 3PUEA 3FGCB 1AH0A 3SIZA 1OC6A 3W88A 3VE9A 3CIVA 2XFRA 3WQWA 1TQJA 3E5PA 3R0KA 4FOJA 1OX6A 1U5JA 2J7HA 4XTIA 3QEZA 2XIMA 3VKKA 5TBOA 3VMNA 4A8LA 4YTRA 1ITCA 1A3WA 3MZ2A 5JMUA 2Z2BA 2TSYA 4JTGA 1VCGA 2Y2WA 4XX6A 1EWEA 4I8YA 3TC3A 1EYWA 2CKSA 1T5AA 5DLCA 3BH4A 2F6XA 2OO0A 2ACSA 5CSYA 4F2BA 4JEJA 3VPLA 3FEQA 5A6SA 3WX7A 4TX6A 4XUYA 1S2VA 3QPYA 2VENA 1DWAM 2HVNA 2BX7A 1T40A 3B4UA 2XH2A 5K9DA 1H2JA 1VFUA 3SJ3A 1EL3A 4Q7IA 3C3UA 3AWOA 1JXKA 2BASA 5CC5A 4HYVA 3IGXA 3VNKA 2Z1KA 1F9CA 1WBJA 3AXXA 1EBHA 1DWJM 5TNVA 3QYQA 2WXDM 1J2BA 3TYDA 3VDHA 4ZA0A 3CZLA 1NWRA 2CZDA 3KWSA 3GDBA 1XC6A 3DU0A 4HIBA 3S2MA 3UCQA 2CKRA 4JIRA 3E0FA 3TK7A 3HQPA 4KGLA 2J62A 4J3ZA 3PJTA 5AHEA 1X97A 2Y24A 2VRQA 3THDA 1Q6FA 4QLJA 1VP5A 4MM1A 3UT0A 2VQUA 3W7CA 1XSKA 1H60A 3LY0A 3NPXA 2C18A 3MDUA 2PZ0A 3NPUA 1H50A 1RY0A 3OVQA 1KRMA 3NQ7A 4UTKA 2X42A 3KRBA 4Q7BA 4GIYA 4OJYA 2PZNA 1EC8A 1BG9A 4GY0A 1U33A 1BXBA 4OBTA 1SYTA 2V3GA 2DH2A 3QR1A 5E5CA 1PIGA 4HK5A 4FB7A 1MZRA 2W92A 2Q3OA 3MKKA 3NQDA 3W23A 4XKYA 3URAA 1BHGA 2GYIA 3C52A 4HHLA 4L61A 1ZJAA 2BB0A 2B4GA 3T42A 5A6LA 3VKAA 4Q4PA 4QLLA 1EJTC 1R3RA 3WFLA 1ITXA 4GOAA 2Z28A 3GTFA 5LKYA 4MZ1A 2GPTA 1F3TA 4LCRA 2XSAA 2GUYA 3WEMA 5D9PA 3APGA 4JTCA 4FF5A 2WQDA 4E4UA 3CZJA 3GXNA 4A3YA 2YFOA 1XICA 2WHJA 4B5TA 4R33A 5KSWA 1G94A 5CBBA 3AC0A 3A21A 1OX5A 1UD2A 4LY8A 2P3EA 1Z6KA 2ZUVA 4NXSA 3QY7A 4K37A 2XN1A 4QTGA 2XH0A 3OIHA 3UG8A 4JNZA 3ZQ9A 1CNVA 1L8PA 4W85A 1FWRA 3CH0A 2VX4A 1W3IA 4GI9A 1P43A 5D03A 3S2CA 3W27A 2JFEX 1LG2A 3F7JA 2V0TA 4WLCA 4UZUA 3D47A 1H7RA 3SUTA 2PBOA 2CNCA 3VOFA 1WKEA 2ZWYA 1V3LA 3FFSA 3HGSA 3JS3A 3MKVA 4IGHA 1KKOA 2VC9A 3G8EA 4ACZB 2E67A 2Y62A 1RJQA 5DXXA 2PUZA 5AHNA 3W7GA 1XKJA 2RDUA 3GH5A 2HS6A 3WELA 3HQ1A 4K36A 5HPOA 3W02A 4OVXA 3GDRA 3N25A 3AQUA 4HHPA 3KFTA 4ZQMA 5G5IA 2WSYA 3CEUA 1DWGM 3UVAA 4EPEC 3VGBA 5JH1A 2G3FA 1LUCA 5KZDA 1P0KA 4A8NA 2YBTA 2HCVA 3QQ1A 4NSBA 4ZENA 4NX5A 4UQEA 5EKYA 1XH1A 4I7WA 3CV2A 4LT9A 4POCA 4AF0B 1VKFA 1NOUA 5EGRA 3IRSA 3D5HA 1EC7A 4OBRA 4GNKB 5IXEA 1Z9AA 1E0WA 3WLHA 2ZC8A 2P88A 3S83A 4JXCA 1E43A 4X9SA 2PLMA 1O5XA 5L9FA 2JGYA 4E8CA 1VR6A 1EX5A 5I09A 1XLHA 2ZVIA 4L56A 1KCXA 2HVOA 3PZTA 2ZX5A 4HB7A 1KLZA 1YE6A 3GSMA 4GI4A 3UNDA 5LIUX 3EOOA 3ZM8A 1GEQA 1UJQA 1GT8A 3GHRA 1G67A 3RYSA 2OGJA 4GG9A 3CAQA 3RR1A 1S2CA 3VUPA 4DPQA 3HIJA 3T81A 2DIEA 1SU5A 4J3VA 1ZZMA 2WVUA 3AXKA 2OZTA 3UJFA 3WBYA 3K8KA 3BMVA 4C7DA 4JR5A 4MTVA 3WQOA 1QVBA 4M7TA 1DVJA 1Q6RA 1O94A 1B3YA 2QF7A 3C5QA 2BODX 3CL7A 1PBGA 3GHUA 1XIHA 4ZO9A 1O7AA 1XUZA 4QNEA 4CLMA 3ARPA 1ONWA 1EFZA 3PZQA 3QGVA 4P2VA 3M9YA 1HKWA 4IX2A 2PDYA 2MNRA 1M7OA 1LG1A 2ZC1A 1GYNA 3R94A 3RN6A 2XFFA 1THFD 3N9SA 2XVPA 2C13A 3ZYZA 3WLOA 2QJHA 4PFMA 4LYPA 1GW1A 3MMUA 4AQLA 2NVAA 3VOGA 4CN4A 3C0SA 4ERAA 3H8AA 3BQ6A 1UYQA 3D3AA 2WKLA 2VELA 1AQFA 1RK5A 1BFNA 1E73M 1TPVA 3VIJA 3OHIA 1WO2A 1MNZA 5EB8A 4CNNA 2PFHA 3UZYA 3AU6A 2YCIX 1LRQA 5DRCA 5CZKA 4Y9PA 3KOFA 1TVLA 3EWDA 4J28A 1KFBA 4OIFA 3UXAA 4GRSA 1WAUA 5EYWA 4PUUA 4HA3A 3GW3A 3H4GA 2QCEA 4JL2A 1U1UA 1VGAA 5CSRA 3PBUA 3CIWA 2HRWA 3BLEA 3CV7A 3BGAA 1IXPA 2YYTA 2I5IA 3NEVA 3VA8A 2UY2A 3O6AA 3UCDA 1QOXA 5HR7A 2QJIA 1RD6A 4IIBA 1ESWA 1K7EA 1PHQA 1J12A 2IQTA 3AALA 4DBWA 2FZBA 2YA2A 3LZ5A 1XLMA 1KXHA 5AC7A 3CQIA 4C6BA 1HJVA 3TZNA 1E6PA 4H7ZA 4LB3A 3LI0A 3HPAA 1W1TA 1BQGA 3O06A 1FH7A 2VM8A 2EG7A 2E8YA 2A1YA 3JUGA 2X09A 4FA3A 1JD9A 1Y0EA 1BRLB 3H7RA 3W6YA 5M03A 1E4IA 3O3RA 4X63A 1QU4A 2RUSA 2DGAA 1R3TA 4NF7A 4Y2WA 4LW7A 2QULA 4HP5A 1UPMB 1D3CA 1GKPA 1Y5WA 5CGMA 1TE6A 3GXDA 5T91A 1E1CB 2NX3A 1O5QA 2VZTA 1B5TA 3HPZA 1YPXA 4BQ5A 5LXXA 3K1DA 3UU0A 5F2GA 3TOPA 4WKHA 1YBQB 3T08A 4JTAA 3RIKA 5I78A 5REQA 2VX7A 1Q7QA 4H8NA 1YNYA 3S1VA 4H6RA 1BPLB 4UTJA 3KOZA 4Y96A 4Y8FA 4AZ6A 4D2JA 1E6ZA 1A0CA 2C91A 4K3ZA 4H8HA 3VCCA 3MUIA 3ENLA 1SO3A 2VFDA 4OV4A 1MWOA 3ABOA 4C6NA 4MY8A 3RITA 2X1IA 1KRBC 3UZXA 3W7IA 4ZGYA 1VD6A 3LI1A 2JEQA 3GVGA 3BV4A 2R1LA 2Y70A 2D0HA 4GUGA 2E8ZA 3WENA 1BRLA 3P14A 2VEGA 4RK8A 2ISWA 2WVSA 5E9XA 2YZ5A 3MP5A 1XH0A 1D8CA 2F6UA 4L4PA 2YLAA 1BXNA 4H00A 1AVAA 3M07A 1UWUA 3WLRA 3BG3A 3ZJKA 1JD7A 1Q6QA 1W3HA 2UY4A 4URIA 3GG8A 1SFTA 2B31A 3OBAA 1L6FA 1L6WA 2C1HA 3VE7A 5J5RA 3QSTA 1TTJA 4Q8UA 2E9MA 4BEQA 3IAPA 3M0LA 3ABRA 2O9RA 4JTKA 3W4RA 4R5EA 4MADA 1S2WA 2PTDA 5BW6A 5FD0A 1OHLA 3S42A 2OX4A 3MS8A 2E68A 1QHOA 4CU8A 2SFPA 5HMEA 5A6AA 2YX0A 1GZ1A 4MB3A 5G2WA 1FHVA 2E28A 3QTPA 2DIJA 3CJPA 2QCHA 2QIWA 3U5UA 1CXKA 1FWCC 3MTWA 3VIMA 3MUCA 1F3EA 4DHGA 1XYMA 3V7PA 2CFFA 3DKLA 5CBJA 3WF3A 1J79A 1Z69A 5FJIA 1R5YA 2WZHA 1DWFM 1JR1A 3KCJA 3GBEA 4H9MA 4R3UA 3AHTA 4US6A 1H09A 4O1BA 3E0LA 2NUXA 3VIHA 4ZQNA 2OTDA 3VZYA 3S5ZA 4LS0A 3NWRA 1TIWA 3WF4A 1BEUA 3LK6A 2RH9A 1QOPA 4Q4KA 4YCOA 2G4FA 2ZUSA 3M0KA 2Y5EA 3EEZA 1C93A 5FF0A 3TQKA 1OFQA 3EA2A 1QNPA 3T2QA 3UA3A 3RAOA 2NX1A 5FAGA 2H8XA 9RUBA 1TO3A 5D37A 2PTYA 3VNDA 1NARA 1CYGA 8CGTA 3DFHA 1EQCA 3VCRA 1EDTA 3CL6A 3LOTA 1FRBA 5HOSA 4WY0B 1XLBA 3F03K 3UXKA 4DM1A 3LMZA 4DO4A 1M01A 2PBGA 1VCVA 3EDEA 1FX6A 1PKNA 3QHOA 4W87A 1AH4A 3W2MA 4QSFA 4DZHA 2INFA 3TNBA 2ZXAA 3QBUA 5DO8A 2OEMA 3TMQA 2BWGA 4BQ4A 2J7CA 3MYPA 1XIBA 4IP7A 3GXIA 1A5AA 5T26A 1EHAA 5D2VA 2GQAA 2A2IA 4UTUA 1TWIA 3H2AA 4S3GA 5F4SA 1KM4A 1TX2A 1WYIA 1D7FA 3V4BA 4NYYA 2RAGA 3CQJA 4NYUA 1W5PA 3PM6A 3W22A 1OCQA 1VEPA 2IQDA 4XAPA 3NXFA 4A21A 2I17A 1KM2A 2PAJA 1K70A 1XDLA 5EY5A 4ROPA 4PUEA 1WXJA 3OIXA 4LBSA 3MT1A 4KWOA 2C1IA 4WDTA 4RJEA 1JDAA 1PWLA 2I9EA 2VCAA 4Q3MA 4R7JA 3JW7A 3CIXA 7ODCA 1JPDX 3RLVA 3UQNA 1XCFA 2CZ5A 2X0SA 2XM2A 3WDHA 3LCLA 3PTKA 4AISA 1OZMA 3R5EA 3MV01 4O1AA 3TA6A 4TVCA 2XGZA 1JFXA 3E2SA 2WCAA 3A3XA 4L65A 3WNMA 4JN8A 4PRWA 9CGTA 4ATWA 2REQA 2WKGA 3P82A 1GVEA 4KCTA 3DI0A 1NDYA 1UMLA 2WB5A 1E72M 1SO5A 3BAIA 1JYVA 4IMAA 4TMCA 3WDPP 2QUVA 2WSRA 1E4LA 4N02A 2IMRA 1ZCOA 4HKPA 5A6BD 3ITOA 2C7FA 3K4DA 3IAQA 3TAOA 5BYWA 3L4YA 4O1FA 4JZ5A 3BARA 3NO1A 4C5ZA 1VYPX 2FHCA 3MBFA 1U30A 1EO7A 4ZB2A 2RDTA 4JTLA 4AHOA 4ZFCA 1GZJA 2ASHA 2E9LA 2FZ9A 4H04A 3S6DA 1IYXA 1XLLA 3UJEA 1PIIA 2QCMA 3OHMB 3TSMA 2A6LA 3W73A 2H3DA 1MXDA 2W91A 4JIIX 5F4XA 2OLSA 4YHEA 2ZX7A 3DKJA 1QUMA 5F1UA 3WLJA 1KXVA 3QJAA 1ZJBA 4GISA 2O92A 4CCEA 3W71A 4N9EA 2JGQA 5HAOA 4JQ4A 1GVOA 1KFEA 2J4GA 4UMAA 1W9XA 3PJXA 3WNLA 4LNYA 3AUOA 1M7PA 3ABZA 4KEVA 4E8DA 3KL5A 3RLHA 2WVVB 5ABGA 4RV8A 4R53A 1UB3A 5I06A 2FDSA 5I3IA 2G0WA 4GWEA 1GQJA 3GE7A 1AFSA 5HJLA 4HU0A 1KQZA 2W61A 3WEOA 4JIPA 3OODA 2GUBA 2QQ6A 3PK7A 4DZAA 3DIPA 1K8XA 1IEXA 4HGXA 8TIMA 4P8XA 2GJLA 3B9NA 3ALFA 4M51A 3SBFA 2OQLA 3UW6A 1OFAA 4NJKA 4AZHA 4P7QA 2WMJA 4UNKA 3O6YX 3BLIA 3HQNA 1JYNA 5AZ1A 4ZB5A 1ZY9A 2PDGA 1Z42A 5H2ZA 4LAOA 1KCKA 4GNJA 1YXYA 4PUDA 4PUNA 2DSZA 3TW6A 1REQA 4CCZA 3THUA 2D0GA 1DKWA 4S3BA 4EPBC 1U22A 1Q66A 3WL1A 4R7OA 2A0NA 4CU6A 5CPMA 1ZBVA 1GGOA 2ISVA 3RG6A 3L0KA 3T6CA 2YXGA 4HNNA 2G96A 1XV8A 2FGLA 4UOQA 4EE9A 3AYVA 4DBDA 5A2CA 3QPEA 3O6DA 1B54A 4RDYA 2VO5A 2OXNA 2VEIA 3TW9A 1V03A 4UTTA 1J6OA 3RGTA 3LM7A 1LLOA 2PODA 4GABA 1UCWA 1AW2A 5F4WA 1NP0A 3SDOA 3WNNA 4WDUA 3O16A 2AQVA 4B4HA 1BLIA 2WHMA 4EF8A 1W3KA 3Q37A 1UH3A 3WBAA 1R3WA 4NZCA 1W0MA 2VEPA 4XO6A 4DBUA 3TFXA 3H2MA 2WANA 4LRTA 2ZXDA 3ARVA 2WJDA 5CC3A 3R8HA 4N6FA 2I56A 5IOBA 1UOKA 3STCA 1ZU8A 3GNNA 1K6WA 2XGIA 3W2UA 1UPPA 3RM8A 1B4KA 3IJ8A 2DORA 3AAMA 3GYCA 3B03A 4YVXA 3TP4A 4YYCA 4OTKA 5DCDA 2FVKA 5HQLA 2ZZ5A 3FDGA 2PMQA 4RE0A 2PDUA 3OA3A 1DJYA 2DSWA 4JTDA 3T8QA 2DIKA 5C9XA 6XIMA 1HW6A 4C90A 5DEZA 4QXIA 3W7DA 3PZUA 3R0UA 3BW3A 3VGGA 2UWFA 3EDFA 2Y4SA 3OGVA 1P6CA 4Z2IA 3W9ZA 4F8XA 2ZX8A 1WPCA 1LLWA 4QE5A 3STGA 1AG1O 2NZLA 1J93A 3DFPA 3GU9A 4PTWA 3W7MA 1VBGA 5LNSA 3M6DA 4P7LA 3E12A 1W1IE 4O17A 3WQDA 4PSPA 3ABQA 3QFEA 4NZ5A 2GSEA 1JZ5A 5A6JA 3OOQA 3F2BA 1YTDA 3C8FA 4N9CA 5C55A 4PMVA 4K8GA 3DFNA 3OVPA 2EF9A 3MANA 3TR9A 4GX9A 4WOQA 4QE1A 3F2CA 3VC6A 2G3NA 3V0TA 2QMKA 3SQMA 8A3HA 2QLYA 3L5LA 1CXFA 4WKAA 1EP1A 1ECQA 3LSCA 5DANA 4E5TA 3TJ4A 1EDGA 4BR1A 1T41A 1DOSA 3PR2A 4HPNA 3HQOA 4HTBA 3LYEA 4I6VA 1DJZA 5XIMA 4K2SA 2PGWA 3WD0A 4B5WA 4Z1CA 2D22A 2WCGA 6REQB 2HBXA 3TUUA 3H4WA 1VYSX 2QDHA 1T6MA 4EWND 1GK8A 3SN1A 3SCSA 3EOLA 4PMUA 4Z42C 4HK6A 4ORIA 2ALDA 1PIFA 1AQ0A 1FKWA 3MI6A 1EWDA 1AZ1A 2RDXA 1MVYA 4NVTA 5KETA 4GIEA 4E2VA 1J8VA 4F0RA 5LYRA 2IPWA 4B2DA 2ZTJA 1OFBA 1QWKA 2J78A 4X2PA 3AXMA 6REQA 1A3HA 4HPHA 3O15A 3UVIA 4MZ8A 3H4XA 3WBEA 1FWHC 1WDDA 1UIPA 3CQ0A 2WSPA 4BFAA 1IT8A 4YU1A 1H61A 4HOWA 4UTWC 1V7YA 3WQPA 1R7OA 4V1YA 1K4HA 2G5WA 1LOQA 4ADTA 5HA7A 3W6MA 4QS5A 1SZEA 4HNUA 3GDTA 2Y63A 4DAFA 1JI2A 1VFOA 7REQB 3B97A 3MCNA 3CH9A 4F9DA 5E0FA 3QGAC 1FHDA 4LAMA 1WNOA 2W27A 3VOIA 1VBUA 2J13A 3I3DA 4M5PA 4IMGA 1B57A 5HJYA 1UJPA 1KR1A 1UWRA 2YCEA 2QUUA 4XZLX 1KTNA 5LA0A 1O5KA 3PUDA 2ZDSA 4FNQA 2PC4A 4AXNA 2ZQ0A 2B7PA 1TWZA 3FXGA 1IZJA 4Q7NA 5DMNA 1OQFA 4KT2A 3IGSA 4LS2A 5ENLA 1C8XA 1TX0A 3W07A 3F5LA 4LC8A 3PZMA 1EJWC 3UESA 3U5YA 1W5NA 4RZ6A 3GH4A 2AL1A 4QDMA 2QPUA 3CAKA 1VIWA 4XO7A 3W1QA 3INPA 5CPTA 3CB3A 3S1WA 1C91A 3PBYA 1QMLA 1YX1A 4C6LA 2EGZA 4GFSA 4UQBA 4CQ9A 2CLPA 3W74A 3PF3A 3KHJA 2ZUUA 1ICPA 4PBEA 5HK4A 4IFKB 4DO7A 4Y6GA 1MUCA 1PDZA 4W8LA 2JKEA 3D0CA 3CWNA 2X2GA 1XRSA 1XYFA 1FCVA 3BJSA 4WJXA 3ITTA 1HGYA 1J6PA 2X8RA 4B4FA 3VX1A 1QI4A 4ZMGA 3M0YA 2ACUA 1TV8A 1FWTA 3AZTA 3ZJ7A 1QASA 2CLMA 2JF7A 1WX0A 4HHMA 1QNSA 1NU5A 4LBRA 1EJ7L 3WNPA 1BKHA 4JTFA 1CWYA 4UB9A 1WAWA 2KAUC 3K8LA 3HPSA 4ZSUA 3L23A 4DNHA 1C7SA 3ZWSA 2X41A 1JPKA 4F66A 1ZJHA 5A2AA 2BVWA 3IK2A 2WJZA 4I9TA 6TAAA 4JOMA 1TR1A 5FEWA 7A3HA 1H1YA 4TU1A 1CXHA 1JVNA 3W6LA 2J27A 1OINA 3EX6A 1RJRA 2A3CA 1KBKA 4NX0A 4RNFA 1SUXA 4ZQPA 4UTLA 1W91A 2QJJA 4IISA 2W6RA 5I7GA 4L64A 1R8LA 2VUNA 1TIMA 2NSOA 4Q4RA 3EPMA 3EDKA 3WNKA 4OQVA 1GHSA 3C6CA 4K39A 1UZ1A 3GG7A 1LQ0A 1ZHAA 5FAJA 4XWUA 1J2WA 1GNXA 4GGHA 2A7RA 3WLSA 3APTA 4QEHA 1J11A 2DT0A 2QGHA 3U2OA 5DF0A 4FIRA 3WJXA 4Q6JA 3T44A 1W1A1 3VNIA 4WGXA 4MYXA 4GMEA 3V5FA 2QW5A 1TRIA 2VFFA 1ISXA 3HG3A 2VDHA 7PTDA 3LM3A 2AGTA 4I8DA 1OC5A 2NQJA 2GJPA 1ODUA 3G0UA 1XIMA 3GVVA 1JRBA 4PBGA 3SUVA 4I7UA 1BTCA 3ANUA 4KQNA 3DH7A 4L6OA 5D30A 3CWOX 3VDAA 2FPVA 3N2CA 1JPMA 3ARWA 2DT1A 3GR8A 4UMCA 5I3GA 3DYPA 3NQEA 1SGJA 4RCXA 5DMMA 3DI1A 3EMCA 2X1SA 4UFJA 4O14A 1TV5A 1O4UA 1RALA 4GXPA 3DZ1A 1S2AA 3QV9A 2P8CA 3WY1A 1VAHA 2YBUA 2HNHA 4ZXOA 5ABTA 3L2MA 4HMEA 3VZXA 4ZE5A 2J47A 7TAAA 4C6CA 2Y85A 3ABXA 2VJXA 2W66A 3WN6A 3GHSA 3E9AA 1W2VA 5HUPA 3OVGA 1XW8A 3G0SA 4D6DA 1ISYA 3S9IA 2QDDA 4S3DA 1XFCA 2D73A 1R0MA 4XD4A 1PX4A 1U1HA 3W00A 3B8WA 1V3MA 3WH6A 1V6VA 1CX9A 2TYSA 1SPQA 4ZO6A 3SADA 3VDCA 3WDIA 3RCMA 1BKSA 2XN0A 3IGUA 2C16A 1TV4A 2OEJA 5D04C 4IQDA 4TTGA 1XINA 2YA1A 4Q4MA 2PWUA 3ITVA 2VUYA 1FCQA 2WHKA 3MUZ1 2HE5A 3WQEA 2O9PA 4YTSA 3UD6A 2MUCA 1EF2A 3SW6A 4ADUA 1LOLA 2ZICA 1RY8A 3PZIA 4YTUA 3W7NA 3WKZA 2BY3A 2Z4GA 3EDJA 2Z29A 3IUDA 3A24A 1WQ5A 1JXJA 4TR9A 2YKKA 4Q4QA 3R6IA 3G0XA 1XL9A 2OU4A 5LNUA 1UASA 1FWWA 2GVYA 1W31A 1FTXA 1BSIA 1CGXA 2QPXA 3ID7A 3UERA 1MZHA 3VNLA 2V68A 1XIFA 3FVMA 1ZSXA 4G5DA 3HPFA 4AWUA 1OCBA 4LEQA 1GYMA 3ZVHB 2QUTA 4QDWA 1OYCA 1JI1A 3C2VA 3MDWA 3DESA 4GPNA 1PZ1A 1GOXA 2R1KA 4DJFC 2OFJA 4L6DA 4XVDA 3RXZA 2JALA 3CPUA 5JBEA 3FW6A 3A12A 3N11A 4IIDA 3AIRA 1B3OA 5B7ZA 3PBVA 2DZAA 4ROQA 1M9HA 3L67A 1KNWA 1KBJA 4MNKA 4LPCA 4XZIA 4H4IA 4IUOA 2Z24A 4JYEA 3GR7A 3MUAA 3WLQA 1ZBWA 3CUZA 3M0ZA 3L0NA 5AYYA 3NJ3A 3AUJA 2HISA 2QYGA 3BG9A 3NIYA 2GGIA 4C6EA 2V3DA 1VFTA 5IDIA 1AK5A 3C2OA 3HFTA 4O1CA 3ZMRA 3AMGA 4DJFA 3LPFA 3QKZA 4NUWA 1RA0A 4LVAA 4U5IA 2OCZA 1GONA 3OTRA 3E49A 6PTDA 3GIYA 1W56A 3TTOA 4HZ7A 5IBXA 2BOEX 3LHZA 3W83A 3HU7A 3R13A 2VDIA 2D3LA 4U10A 4O8AA 3KBNA 2CLFA 4R85A 1R3SA 3KOXA 4UMBA 4GKTA 1U2YA 3B9EA 5FKYA 5HMSA 4E3TA 4UTFA 3CHDA 2NUYA 1M03A 4CNOA 4UFKA 2X05A 1Q6EA 3G1YA 3HGOA 1LM1A 3KWXA 2R1MA 2Z1BA 1IWBA 3WF0A 3EAUA 1HO1A 2X40A 3UJ2A 1H49A 4A8IA 1ZAHA 3VNJA 3SCQA 1MW0A 4DNMA 3R2GA 2CBIA 2W5FA 3NVDA 1P6WA 1W3TA 3QGKC 4HJWA 3GC2A 3W7KA 3MU7A 3DG3A 3U8GA 3USBA 5AHIA 3FSUA 1HP4A 2WNQA 3LV6A 1FWAC 3W2LA 5CPSA 4LB4A 3N4AA 3PZGA 2DT2A 2WKJA 5FJOA 4RDWA 4WX2A 3SRHA 3L0GA 5CG0A 2ZUNA 4PMDA 3W1PA 3KTXA 4B3KA 4B5XA 2CCRA 2ZE0A 4ZOAA 1SSDA 1UWSA 4BQ3A 5LNVA 3IARA 1NP2A 2QGYA 1E51A 4OHQA 1XBYA 2HPIA 4AD5A 4ICCX 3NQCA 4XZMX 3W7HA 3N2TA 4NG3A 1N55A 4KIRA 3TYEA 3IPWA 3EKZA 1P48A 4PRRA 4IGNA 4DEFA 4GO8A 1US3A 1DJNA 1K77A 4XZBA 3ME3A 2J7GA 2DJXA 4G8TA 1QI0A 2W62A 5KMYA 4KEMA 3WH8A 3KXQA 2OR2A 4K1WA 2CZFA 3KDNA 4DJDA 3OVRA 3KVJA 2XH4A 1LQAA 3NL3A 1J9YA 1S3TC 4LAUA 1H62A 3QMSA 1QXLA 1UKTA 2QCLA 4E0CA 4AU0A 3IVSA 2PGFA 1UKPA 5EFFA 1S39A 4W9TA 3PBWA 3G1VA 4QQ3A 2ICSA 1R47A 1BGAA 3HA1A 4FNPA 2TAAA 1QWGA 3E2QA 1MEWA 3N34A 3LBMA 1RHCA 3W53A 1SSGA 1OGGA 1EKOA 4DWSB 4LCQA 3DN5A 4LX4A 5CG7A 3GWQA 1DP0A 4ECLA 2VR4A 1YADA 1X8CA 2J7DA 3SIMA 3AXHA 6ALDA 4JX6A 3TQ0A 2G8ZA 2GQ8A 1WCGA 2CLOA 3TLLA 4MJ4A 3PJWA 4MGGA 3EWYA 1Q2SA 1UHVA 3OW1A 1M3UA 3VZZA 3F5KA 1QNQA 1JDDA 1HKIA 3QSRA 2IXUA 3XIMA 4UFLA 2F84A 5EMKA 3W1TA 4WSHA 3SGUA 1BVZA 1A50A 4GLEA 1IWAA 1NDVA 3M46A 5JQ9A 1V3IA 4A3UA 1R2TA 3G1FA 4GQ0A 4NQ1A 2E5DA 2NT1A 3PTQA 3GK0A 3MBDA 3GYEA 2FB2A 3KE0A 1G0CA 3VDGA 1OY0A 3W7LA 4Q8MA 8RUCA 2Y7FA 4I3GA 3B05A 1FBAA 4NZJA 3KLKA 4HMNA 3ZLFA 1J0KA 3B9AA 4UZSA 4M80A 4DM2A 4WKFA 3MZNA 2FZNA 2WLYA 1VF8A 2C19A 2ZUMA 4MUZA 1AMYA 5EMMA 2HBVA 1E40A 3CGTA 1OX4A 3KDOA 4XKYB 3W26A 5GVJA 2Z25A 2ZA1A 2HZGA 4AD1A 5K4ZA 1KM0A 2HV5A 5JIWA 2A3EA 3N19B 4KCUA 3EXSA 1DBTA 3GC5A 1CIUA 5GQBA 3LN3A 3KRZA 1GKQA 3P61A 3AIUA 1OWQA 3QC3A 3R8GA 3W1MA 4IP5A 4QR6A 2ZX6A 1E0TA 5BXTA 3AS0A 2CW6A 5LNWA 1R46A 1EOMA 4GACA 1CTNA 3UEQA 4A2SA 2YL5A 1MI3A 1ONRA 1E3XA 1VCFA 4M1BA 3IJ9A 4NAFA 1QDSA 4RV3A 2J6XA 4RW5A 4TVDA 4B90A 3PPFA 2ZX9A 1KM3A 3N2MA 1SR9A 2X30A 1KTCA 2EHHA 5J8LA 4EPKA 1OT1A 2FZDA 3WQ8A 1XLJA 2OQHA 1LT8A 3FEMA 5D9MA 1XIDA 2ZZ6A 1KD0A 2J8FA 2O7SA 3CK5A 3MCMA 3T0CA 1XJBA 1JZ3A 3ORWA 1K1DA 3CQHA 5JU6A 4RDVA 1O95A 3ZFHA 1DJGA 4C1LA 4EIVA 4D6GA 5I00A 3W7RA 1HKKA 4P7NA 1AL7A 2VZVA 1XR2A 2HDJA 4KRUA 1I2QA 4GA8A 3IIZA 1AODA 2PTZA 4IF2A 3QLLA 4GBUA 2ZA2A 1ZTVA 4C6KA 4AG0A 1W8SA 1MSSA 3PSVA 5A8OA 3T0DA 1PPIA 1ZS2A 1PZ2A 2HVMA 1TE1A 1D2KA 2AAMA 3THCA 4PGLA 1XGEA 2XH7A 3RPDA 2EPKX 3BV7A 2PDBA 3QN3A 2G3MA 1YW1A 3GKAA 3W28A 4YTTA 4MFEA 3SUWA 3U2EA 4IH3A 3CHEA 3W3OA 3NL5A 4DPPA 2V38A 3PN8A 1YDYA 4IMEA 3N9KA 3PSWA 5BXPA 1P1MA 1YNQA 3PAJA 4ZEPA 1FH8A 3RO8A 3FJ6A 3UGVA 4FLOA 1YDNA 3MB9A 4E8GA 4AIEA 4YWIA 2W0UA 4ATLA 4NJHA 5AN7A 3WH5A 2Q02A 3ES7A 3SGZA 2XINA 4DX3A 3COTA 2E1WA 4LV4A 2VR2A 4LRSA 3LB0A 2XIJA 2QCDA 3TC7A 3KBSA 1B3VA 1JNDA 1H5YA 2WJFA 3VMOA 3HMCA 1AQHA 1YMYA 3GW0A 3K8MA 2QCCA 2ISSA 4UNLA 5LSMA 3FX4A 4WZHA 1AD4A 1JQXA 2Q8LA 2F38A 3VO0A 4U2YA 4MPKA 4J7RA 1ZAIA 3PNUA 2QDGA 3QOKA 2VT0A 3A6OA 4AWEA 2Y8KA 2Q71A 4JQ1A 3EPNA 1H1NA 1RP8A 3NCOA 1RP9A 3RU6A 3EA1A 3QOMA 3VX0A 5EMJA 4GYPA 4D72A 4JTSA 5AECA 3KZPA 3EDDA 5AB3A 2WCSA 4QLKA 4B9ZA 2VC5A 4HSOA 4E2DA 1EA0A 2R82A 2G95A 3PB0A 2ODOA 4ZB0A 3CLWA 4FXFA 3ZZ1A 4WSKA 1JCXA 4GH3A 4M81A 4QP0A 1RJPA 1ZBCA 5DT5A 4H3DA 1KM6A 3BG5A 2XHYA 3VIFA 3TEVA 2CU0A 3T4WA 5C9RA 1XF0A 4AH7A 5CLTA 3G1DA 3TA9A 3SN4A 4H41A 4MB5A 2VP8A 1QI5A 3W37A 1EF3A 4XIMA 1CGTA 1PZ3A 1EOKA 3UF9A 4XAFA 1DXIA 3IK4A 1A0DA 4ZOCA 1V0KA 1D3GA 2FTPA 2GJRA 4JY8A 4NRSA 1OK6A 3VNMA 2FJUB 5IRPA 3DENA 3ONCA 3NZGA 1E3ZA 2GGGA 2V5LA 2DU2A 4QG8A 4A8RA 1TR9A 1S5WA 3S3GA 2VEFA 3P93A 1C8YA 3FKRA 1EJXC 4O0ZA 3TE9A 5HUOA 5I79A 3V1PA 3Q58A 2A7NA 1LT7A 2X1RA 1O6IA 4C6OA 2GK1A 3II1A 1F74A 4GHRA 3H22A 1N7KA 1UD4A 2WK2A 1WZMA 1RQBA 1W3JA 3TSDA 4D9PA 3P8JA 1WBHA 4PMXA 1SR0A 3TVAA 2E0PA 1HJUA 4F9JA 3M5VA 3H7VA 3B8VA 2G3JA 1YKWA 4FAMA 2POTA 2ZRXA 3SCOA 3V1HA 2MANA 3E2RA 4D6IA 4AIUA 1TJ1A 4MJZA 4F3HA 3KS6A 1XCWA 1H7NA 3CXOA 1UWIA 3N9RA 4ILSA 2C79A 4R9XA 1XPGA 4X3ZA 5DY2A 3VXGA 2BHUA 2VURA 3FDKA 3PWIA 2J66A 2WC7A 4DYJA 5FL1A 2AGKA 1KC7A 4B92A 2VC6A 3KVMA 1UWAA 4V15A 4UCFA 3W82A 3BLKA 2WNZA 4IPIA 3NQ8A 1UKQA 1ODZA 4JBRA 4C60A 1OFRA 3CUFA 4GZ7A 3VU2A 4J2PA 3VI2A 3CT7A 4LVFA 3CZKA 3G8RA 4U3CA 1QNOA 3H2EA 3MQTA 1M5WA 3BUVA 1IHIA 3AISA 2C15A 4HNOA 3U6WA 4ES4A 4WJEA 5BXSA 1I4NA 3B0UX 4NU7A 2TODA 2WNWA 3EWZA 3PC0A 2J9ZA 1A5LC 4MDPA 4A3QA 4N0RA 1G01A 1QFEA 4GYFA 1XG4A 1LROA 2ZRVA 1RPKA 3P74A 4LSBA 4RE4A 2WMIB 3IJ6A 3I7RA 5REQB 3QYSA 1LJYA 2EKGA 4GXWA 3TYUA 3UG4A 1YBQA 2XN2A 4KCWA 2QJGA 4MNJA 3MA8A 3JZEA 3DCPA 2R8WA 1WKDA 3L4XA 3B9OA 3WD3A 4WRHA 5FCZA 2CZEA 1KFWA 3AFBA 4U4MA 3PHAA 4H9YA 2PF0A 4GIRA 1QNVA 1I1WA 2PGEA 2ZZ1A 5HQMA 2QIIA 3C86A 1ICQA 3GKFA 1ADSA 4ZQRA 3QKEA 2DVUA 2E4TA 3EZ4A 5BWAA 5LGZA 3L68A 5GJPA 2PDQA 3P60A 3UWEA 3UXDA 6ENLA 5AC6A 4UFMA 2HS8A 4DXKA 3THQA 3LPOA 5LIYX 1EEPA 4KIEA 1DHKA 1O60A 2E1DA 3AJXA 3CMFA 4O50A 1LDCA 4UQAA 4FEZA 3TCEA 2OJPA 3O1NA 4C1NA 4W7UA 2PDFA 4OT7A 1LYXA 2WSQA 1H5VA 2PDWA 3A4WA 5AVNA 2F2HA 3CEPA 3LMYA 1PE1A 5EMYA 4AVFA 4YIWA 3CT2A 2PDPA 1GQKA 3PJUA 1OIMA 3H21A 2ADAA 2R24A 3MYOA 2DUAA 2EPNA 3VABA 2H9AA 1G1YA 1S5VA 4MG4A 2E7FA 4Z1AA 4PMRA 3ARRA 3KRUA 5HWJA 1NTHA 4W89A 4A22A 2EPHA 3MUY1 5C5YA 4GVFA 3FS2A 1UKSA 2VTFA 1L2UA 1IWPA 4IWWA 1V79A 4K38A 4HN4A 2V5KA 4GGBA 2PLCA 4Q22A 3WQ5A 1I2NA 1S1RA 2RGMA 4CD6A 4OUEA 5AC8A 5G4HC 4ADSA 1Z32X 2PRHA 3GLCA 4MJ2A 1IEQA 3LCXA 1I75A 3AMLA 4O0QA 5CZJA 1JG9A 1PL9A 1F3XA 1HL8A 2WM0A 1O68A 5HDRA 3TJIA 4K6AA 1QT1A 4US5A 4GVIA 2AL2B 3R25A 2XIOA 3PWGA 2KZHA 4UOJA 1XRFA 3IEBA 1DHPA 3G1RA 3RX2A 1FDZA 3GFZA 5HJXA 3UXLA 3OZYA 4GK8A 5HWMA 5GNZA 3FSTA 3NEHA 1PXGA 4CQCA 2CXEA 3SECA 4AF0A 4W8AA 1R6WA 1J5TA 4GO9A 3PBMA 4FF7A 2R1PA 3S1XA 2V6AA 1KBLA 2PC8A 3VK5A 5BMWA 4O15A 1IGWA 1XG3A 1AUSL 3BO9A 2E6YA 3WIJA 4HA1A 4I6KA 1Q6DA 1CLXA 3OGSA 4PH6A 2RJHA 2J7BA 2Q8ZA 1O66A 3BW2A 1WOAA 2VCCA 3ZR5A 1K8ZA 2C1GA 3BJFA 5EA9A 5TAOA 4N42A 1TV3A 1FWJC 4OZOA 1S5TA 5J04A 1IZKA 3VDBA 2A3HA 1F6KA 4J5NA 1NELA 3EX2A 3I3BA 3KOWA 3I65A 4NASA 1MW2A 1C8VA 4JIQA 3IVTA 3L66A 3CUGA 4IIHA 2GSJA 1ZCCA 2OWWA 3TTEA 2Q3RA 3Q67A 4LAZA 1OZQA 4NZ1A 1EUNA 1OM0A 4BZYA 4ZCWA 2OSYA 3NTYA 1H4PA 5AHMA 3WMSA 3A4JA 4MOZA 3UXIA 2WW5A 1JCYA 4FLSA 3A4AA 4ERIA 4X61A 1DJXA 2E9BA 4BF5A 3RDKA 1YYAA 1ZQ5A 3EEGA 3KZSA 4ZODA 1RAKA 3NQVA 2CITA 1XXXA 3N4FA 2WZEA 3MMDA 4KCVA 5CBIA 1C90A 2XZ7A 2WOQA 2HXUA 3ARQA 1GHRA 5EL1A 3GXMA 1AJ2A 2BVYA 4LYKA 3M64A 5B80A 1HFBA 2DZTA 5LIWX 2GWGA 5JBDA 3LPPA 2YB4A 1KFCA 3ARTA 1VPYA 3MCOA 1RPXA 3MSRA 3N13A 1ZP4A 3S1UA 1EEXA 5EBAA 1B3WA 1E55A 4WY0A 1LL4A 5HMFA 3KCOA 4OU1A 4ZTYA 4HYWA 5I07A 2A3AA 1VFFA 3EKGA 1GTHA 2WMHA 3AZSA 3C2RA 1JCNA 1QRQA 3VIIA 3GU1A 5SWUA 2NQ9A 5G4WA 4LFYA 5CAKA 2CZVA 1K9TA 3S4TA 3T0BA 2ZZ3A 5I3DA 2NQLA 2OQYA 2QF8A 4GYKA 3CZEA 1A53A 4JHMA 3CV1A 3KVLA 5LIKX 4C7GA 1F61A 4JQ2A 3LX9A 5BMXA 3L5MA 3AYTA 1TYGA 5A8NA 5CPOA 4Y8EA 3WLNA 3GG0A 3WH7A 1YQ2A 3WD2A 3O0FA 3VNZA 1Q4NX 2PRMA 3N14A 4C6FA 3FA3A 5HNUA 2HTMA 3IWPA 1V08A 3U48A 3OBEA 2EPMX 5BCAA 4WCJA 2XFYA 4LUIA 3TCSA 3GH7A 4NNBA 2A6NA 3NL6A 1E6XM 4LF1A 4DAIA 3TN4A 1GKRA 1U5HA 1JAKA 5EU9A 1DTUA 3F1QA 2AKZA 5CPLA 2ZFAA 1KWGA 1W5OA 2DSKA 4L1GA 3NYZA 4N2YA 3SM0A 1GW9A 3NAVA 2XFWA 3RCYA 1F6YA 3TNOA 3VFCA 3RX3A 1MQRA 4G2DA 2CHOA 2UV8G 1CGUA 2H8ZA 1V0NA 3EWBX 4GZJA 2WO5A 3N73A 1C29A 1QATA 4X9YA 3VGDA 4FZIA 5E70A 4N7QA 5BRQA 1VB9A 2PI6A 4OE7A 3SFKA 3A3WA 3LHUA 4GC4A 4RXGA 3I68A 2HK1A 3SCRA 1Q3NA 3IJQA 4JFUA 1OX4B 2REQB 1AD1A 2NT0A 2VNCA 4KEZA 3S1GA 1JRCA 1FWBC 1GPWA 3GR4A 3HV8A 1SZFA 1M6JA 2GVEA 4Q4OA 3AMDA 1LQ2A 4AXKA 4UXDA 4ONVA 2BXYA 3B0PA 1KV5A 4W5ZA 2DQXA 4GVHA 3D3FA 4YS1A 2ZRZA 4CD7A 3IIXA 3T07A 4GY7A 5MKGB 4KFPA 3UWZA 3CQKA 4LXFA 1Z41A 2HJPA 1WE5A 2QS8A 1E70M 3WFAA 4BY3A 2A5HA 5C8BB 3VGFA 5KZ6A 1TWDA 5K4XA 5TD4A 3LTPA 3E38A 1MEHA 1JGIA 2BNJA 2GJXA 3HV9A 1A5BA 3H2FA 3RRAA 5I03A 3GVWA 1XLDA 3CM4A 1POKA 1J0YA 4KS0A 2W63A 3EOEA 3L4VA 4HYRA 3SCPA 1UKOA 4G9PA 4W7VA 3NZRA 6XIAA 2I9UA 4MNLA 4PE8A 3QQ0A 3FHAA 3MHUA 4XTDA 1YHTA 3LPGA 2B7OA 1TMLA 4DQWA 3RM9A 4R34A 3ISIX 1W1ZA 2EXOA 3N12A 3LBCA 3TYZA 1IT0A 1SQ7A 3QZ6A 3MO4A 1W8GA 4JTUA 4IX0A 4W7WA 4LUJA 4AHPA 1FFQA 4D1JA 2VL4A 2XJ7A 1CI1A 4OV9A 2ZRYA 2ZBTA 5CGTA 3A9BA 5K9CA 1SFSA 2CEQA 1Q6LA 2DY3A 3PULA 2GDQA 5H91A 4HA4A 3VD9A 4QRNA 1OGSA 4ZQCA 4O4WA 4EPDC 3NO5A 4HU4A 5ABHA 5FJPA 4IG2B 1IXQA 2CXGA 4RR4A 1TA3A 1H0IA 4QFUA 3UBPC 4AZ5A 3WBXA 4P61A 4UUIA 4DWSD 3ARZA 3LTYA 4UNIA 2BFGA 1PHWA 1X1ZA 1P5BA 4WIWA 5M5DA 1ZALA 4DJDC 1GOMA 2Y1HA 1PYFA 3ITCA 1C9WA 1VJIA 3NUKA 4YXGA 3LZ3A 4X2RA 3U7VA 5T9CE 2PDKA 3G1SA 2E40A 4S3EA 1E1FA 2FPYA 3P84A 1XYAA 4AZCB 4Z2GA 3BICA 3A64A 3DGBA 1N82A 4GKLA 1SJAA 5E6ZA 4DLFA 5BWFA 3OU8A 4JYDA 5G1TA 2PWDA 3VIOA 2NV2A 4FR6A 3F4WA 4AW7A 2YYUA 4AY1A 1DORA 2G50A 3GX9A 1MW1A 2J9XA 1JJKA 3GRIA 3G5EA 3BTNA 2OSWA 3OPSA 4WEVX 3GZAA 4L1XA 4M7SA 3UWUA 5C54A 2E25A 3H23A 1WDPA 1UC4A 1W37A 3E96A 5C6MA 3TLQA 4AEEA 3STFA 3WUEA 3U2CA 5E93A 1OD8A 4M1RA 9XIAA 1Q8AA 5A94A 3P81A 2GGJA 3NGFA 2DDXA 2VFEA 4CCCA 3P8IA 1C8QA 3SAZA 4W93A 1LOSA 3E2VA 4MB1A 4NZ3A 4C1NB 3CNYA 1NOWA 1V5XA 3NQ2A 4JIEA 3SN0A 5JXQA 2VR5A 4XAZA 5C70A 1XLIA 3ANYA 2PDLA 1F7BA 1SJBA 4LUSB 2VEKA 3KP1A 4YWSA 2UY5A 1UR2A 3KBVA 4QROA 1MRAA 1F2JA 3U9IA 3RILA 3W81A 2W67A 3NSMA 1VJSA 2NV9A 3CUHA 4Z08A 1TVPA 5AYZA 5D4YA 4WDWA 3BCJA 1EGMA 1CXEA 4HU3A 4NI8A 1XYZA 3BW4A 5DCBA 3TTYA 3DX5A 2GSHA 2FB3A 5F7UA 1A5NC 1W54A 5LHFA 4MAZA 2TPSA 3NQFA 3UG3A 5A6KA 2D23A 1KXQA 4BCEA 4UQDA 3LUTA 4FXSA 3CV6A 2J6VA 3KUMA 3O05A 4NHVA 3GDKA 2ZE3A 1XCXA 3TN3A 4CU7A 1TJRA 1I2PA 2VFHA 2OKOA 1CEOA 3IS4A 4L9YA 5L6UA 1H7WA 4MB4A 4PMZA 2FZ8A 3MC5A 1Q85A 2CBJA 1TKKA 2E6FA 1G4PA 3E1F1 3ATZA 3DFOA 1TJ0A 3QV8A 3LG3A 4O10A 1B3XA 1OVDA 1JCLA 1ZP3A 3MWAA 5D02A 2WC3A 1EGVA 2R9RA 3G77A 1H3GA 4NAEA 5CQ1A 1W5QA 2RFGA 3CUIA 4JDBA 5D2WA 4B5NA 5KITA 3DHUA 1UR9A 3OYZA 4IJBA 3IIVA 1TCDA 2V67A 1OG6A 2V3EA 3V35A 2Z7GA 3ZVHA 2NXGA 1V0MA 4MUPA 3RNDA 2YW3A 4RNJA 4GCXA 1ISZA 4X22A 4D8LA 1RV8A 3H2NA 1MUWA 1ITUA 1VS1A 3FHQA 2OOFA 3LU2A 1BYBA 2EPLX 2OEKA 1E9LA 3T0AA 4O4VA 4ZTXA 1XRVA 4DRSA 3J7HA 2D2JA 1MXGA 3NOEA 2VXNA 4FI4A 1JUKA 3KOYA 1A3XA 2VVSA 3URQA 3HG4A 4B15A 2D3NA 4B5VA 2R1NA 3ZIZA 2PB1A 1G9HA 2WHLA 1XIJA 3GHTA 4REQA 3WEZA 4PMJA 4JFSA 4JDYA 1EO5A 5FJRA 2JEPA 1FDYA 4YNGA 2FZMA 4F2UA 3FJLA 2CETA 1EC9A 4AEOA 1J10A 1R86A 4KWSA 4D71A 3B0VC 2DVXA 2FLIA 4HZMA 3O07A 3O63A 3PZNA 4DO6A 1HJWA 2GFTA 2QUMA 3NM1A 3W24A 3OZOA 1NQKA 3M5ZA 5E6YA 1YRRA 3M0JA 1DIDA 2PP1A 1F76A 1QTWA 2BXVA 4HTYA 5HNTA 4EAYA 4X60A 1G4SA 3LCGA 1LTDA 5KINA 2P0IA 4F4RA 2OODA 3M6YA 1UBSA 3FNDA 3NOYA 3NR0A 1IEWA 4Q33A 4MIMA 5K7JA 1KXTA 1GOWA 3UWVA 1I2OA 4A6GA 1ELSA 2VZUA 5CJNA 4ZFMA 2DW6A 4BHYA 4LJ3A 1WDSA 3V5OA 4WSJA 3VD3A 1ZL1A 1UMYA 1V6TA 2QV5A 1G7VA 4J4KA 4NRRA 3TROA 4JFVA 3UYCA 4PMQA 1VPXA 1DEDA 1KFKA 3OZPA 4RKAA 5BRPA 5LHEA 4IZGA 5I3FA 4GJIA 1SZGA 3FIGA 2Z0IA 2R91A 4XBKA 4ACZA 4GC3A 2WVVA 4ML9A 3PVFA 3GC4A 4I5XA 1PVNA 4V28A 3WSUA 1WKFA 1I0BA 3SCWA 5A8GA 4JKKA 4U31A 2C0AA 3LTSA 1OSEA 2ZVRA 3A23A 3RMJA 4QJ3B 4XZ9A 1DJWA 1QHPA 4DXVA 2YXXA 3U0HA 1MEIA 5AYBA 1OB0A 1W1VA 1GEHA 1UA3A 4J27A 3N04A 3AYRA 1G7UA 4C5YA 2V3FA 2Z6JA 1HQTA 1WXZA 3WJZA 1A5KC 3R79A 3S9YA 1HVXA 4AMAA 4TV6A 3E0WA 4MY1A 2Y89A 1CXIA 1FP9A 3OZMA 1N8WA 3N18A 4MWAE 1XHGA 2Y8UA 4XD5A 3BCDA 1HIZA 2OKTA 2QKFA 1LWJA 2PE4A 4H1ZA 2DT3A 4HPJA 3CS2A 3LDVA 1IT7A 1EJRC 1ME9A 4P7OA 3S5NA 1R2RA 2YOCA 4QAIA 1RBLA 3B04A 3BSHA 4M6VA 3AMKA 1JPIA 3EPOA 1HP5A 5I24A 2NWSA 3U3HA 1XLEA 1ZGDA 4LU0A 3GXFA 1CENA 5D2TA 1P1XA 3TV8A 3ICJA 2ZZ2A 4XBJA 1EBGA 3FVDA 1JZ4A 2XZ9A 4IMDA 4JHZA 3BVJA 3UJRA 3MSYA 4BS0A 1FUYA 1YXDA 4WUIA 1Q6CA 1QJWA 3PZ9A 3GFYA 1OIFA 1ZRQA 4YL2A 2ZCGA 3P5ZA 1X96A 2CLLA 2YZRA 1CGWA 1RUSA 4AUBA 3DGRA 4PC8A 2JE8A 1JPHA 1VQTA 1US2A 3ZSTA 4H83A 4DBSA 3ZR6A 4RE3A 2I5GA 3C2EA 3SURA 5C71A 4WD0A 5GJNA 2Z27A 3EB2A 3W75A 4IIGA 4O54A 1UROA 4DWDA 1JNEA 2AKMA 2DUXA 1F6PA 7CGTA 3A3HA 3AMCA 3VOHA 3B8DA 1JDEA 1YXCA 3EWUA 5DX7A 3AS2A 5EBUA 4JFTA 2TMDA 3ES8A 5AOUA 1TPB1 2Y0FA 4G7EB 4BWLA 5CGQA 3LLXA 3BSMA 4QCEA 1XQLA 1F8IA 1QI2A 2PRLA 1OCJA 3SR7A 1TTPA 2YLLA 5AHFA 5J5DA 1J4EA 3DFTA 5D09A 1WZLA 4N9BA 2NVCA 3SCVA 3U7BA 1HKMA 5E9AA 2P5NA 4H7VA 1R3QA 1XX1A 4XQ6A 1VBHA 1GZGA 3Q2DA 4EVZA 4J3TA 3W25A 1SM9A 4LV9A 3WDQA 3OQ8A 4LUSA 2VEMA 4YYFA 3EKLA 3RF9A 1K9FA 4GY1A 3L9CA 4HVXA 1UD6A 4DUOA 5F2MA 5FL0A 1QW8A 2BGQA 5A6TC 1PKMA 3GM8A 1EGZA 1GJPA 3B8IA 2GDUA 1EPXA 3ABSA 2X16A 4DF2A 1DV7A 1BG4A 3W76A 3APYA 1TUFA 2W9MA 2OZ3A 3FAXA 4DUVA 3MHGA 4I9AA 3U2ZA 1PUDA 2XG9A 2V81A 1JZ7A 4YVVA 5LA2A 5A3HA 4O19A 5HR6A 3AHZA 4L7ZA 4QNWA 3WUGA 4Z2KA 1MRQA 2G3IA 3S0CA 3L4ZA 4K7VA 1EP3A 3DHFA 5DBUA 3EYPA 1N8IA 4LANA 3UGRA 3CYJA 3RHGA 4ZQOA 1F73A 4PB5A 3TTQA 3WZ0E 3B8SA 3OB8A 4LALA 4XBSA 4LGXA 1JF6A 3MI3A 4GH1A 3TU9A 3MWCA 3WQVA 2V30A 4QEEA 1JQVA 1DE5A 3OLIA 1IEIA 1OC7A 3TC6A 4J2MA 1HT6A 3IGHX 1L6GA 4O28A 1AQMA 4JIHA 5A8MA 3R10A 4Z2LA 1UBPC 4GUHA 5D2YA 4JTIA 3WMLA 3BPWA 2H6RA 1ZBKA 4NI3A 3DC0A 3FYPA 2J77A 5JH2A 2PTWA 3WK0A 3S47A 4CNSA 1WKYA 1KO0A 3IANA 2XVKA 4DXXA 6A3HA 4QE4A 3I4EA 5CSUA 2BHYA 3NZQA 4QJ4B 1A5UA 4HU8A 4C6MA 1GPFA 1TREA 3NFUA 2RGLA 1BAGA 4NY2A 1FCUA 1ZNNA 1L0PA 4PTVA 4BEUA 1BYDA 3WQFA 3RO6A 3SUSA 2DJLA 1YIXA 4H9UA 3V16A 4K68A 4S1FA 3QRHA 4E2OA 3QM3A 1V51A 3URBA 2DEPA 4NKCA 1T7LA 4NNAA 2CYGA 1UR8A 4DVOA 1IV8A 4Q4SA 3W1UA 4XZHA 1X8FA 1UH2A 3H26A 3FA5A 1A4MA 4AYGA 4GJ1A 1PYMA 1QPQA 5HNNA 2DPEA 1DPMA 4R9OA 4XB3A 3GB6A 1Y7VA 4W86A 4YHGA 3U4AA 1F5ZA 3SSZA 3SY8A 4O11A 1WDRA 2E6DA 1XDMA 1IZCA 3QC0A 3M5XA 4RXFA 4O52A 4B3LA 4AZIA 1SO4A 3CUJA 3TX9A 1JGMA 1RK6A 4W88A 3NQAA 1OYBA 4R27A 5IHSA 2A21A 4QM1A 1Q5MA 2YB1A 1DIKA 5C7HA 3GDLA 3LBOA 3HOJA 3RMEA 2AQWA 4M6QA 1LF1A 3SQSA 1PB0A 1QO5A 1HG3A 1MDRA 4HMDA 4IOTA 2FTYA 2WC4A 2PF8A 5LXEA 1TPWA 3YPIA 3SB0A 4EKJA 2D0FA 4KERA 2FKPA 3GNOA 7TIMA 1W9PA 4C91A 4LBUA 4MZYA 2FGZA 4LQ1A 3OG3A 1FCBA 4PB3A 3WMBA 4DYKA 1JCMP 4OWGA 1FWIC 3DOPA 3SGGA 1KW1A 3STPA 3UZ5A 3H12A 3UZWA 5MKGA 3N2BA 1KGWA 4U28A 3S5YA 5IFPA 3M16A 4IJCA 4DZ5A 1EZ2A 1OF8A 4NAEB 3WFZA 1EJUC 2OPJA 1E4NA 4YPJA 1RD5A 3I7SA 3I10A 3W87A 4H8VA 1V3KA 4G56A 3OLDA 3BC9A 4XSMA 4YJ5A 1Q7ZA 1VYRA 4A4AA 1KFJA 3LXBA 3RRXA 4UWMA 3VUSA 1Q6GA 1XIGA 3BLDA 3BAYA 3GU2A 4V33A 1SFJA 1KWKA 2GJXB 3LRMA 1B4EA 4HZ6A 5CH9A 2B81A 5TIMA 4CUCA 3I4KA 2YPIA 3R11A 5H8PA 5CC6A 3W7PA 1GVQA 1CB7B 3O0KA 3L5AA 1MNSA 5D9OA 7XIMA 1V6YA 4YMZA 3G1AA 1K4GA 1NF7A 2X7VA 1K9DA 4KFOA 5I02A 1OGBA 3GVRA 3LXAA 2QZRA 3IUHA 1B3ZA 2DZBA 4WQ6A 1P6BA 3G24A 1LBMA 2H90A 4V1XA 1V02A 3N6HA 3CZ8A 4CN1A 4XSLA 3DBPA 5U4NA 3LCWA 4FMVA 3TIMA 3L65A 3PPCA 1VC4A 3H53A 1HL2A 2PD5A 4O53A 1RVGA 1K3UA 4CQDA 4LUYA 1QO2A 2BS9A 2PWGA 3NZ1A 4DO5A 4UCGA 2H3BA 2NLIA 4X0VA 2GOUA 2XVGA 2HSAA 4PA8A 3RLUA 4JKLA 4NAFB 3ZOAA 2FFCA 4UFHA 4PCNA 2IUZA 4DN1A 1FXQA 3N6JA 3M47A 2FGBA 3KW3A 3PUGA 3TOYA 2YDSA 1Y5XA 3T55A 3LRKA 1NSJA 1PKLA 4HBKA 1VEOA 1FA2A 1VENA 4IFKA 1QCWA 1ADDA 4IM4A 3PB2A 2PWHA 3VGEA 3VD7A 1SW0A 4WGHA 1VFMA 5DT7A 1Z89A 3QZAA 4MKSA 4JTJA 3GTHA 4XZNX 3PG9A 2BXZA 4I9MA 3KHDA 3V75A 4K1GA 1YTKA 4ZO7A 1LRTA 1CPUA 4JFWA 1IR2A 4MSSA 2Y6ZA 3VKJA 3ZT5A 4S3AA 5AC5A 1U5VA 1OF6A 3RX4A 2VHLA 2E09A 1SFLA 3LXCA 4XUGA 1TZ7A 3PFRA 1FVPA 4AB4A 1LBFA 3O6CA 1HKJA 2F6KA 1P0BA 4PR4A 3ZSSA 5LZLA 4W4QA 1LL7A 3T2OA 2I57A 4S3CA 1B0IA 4AD2A 2Z7KA 4L80A 4TXEA 3THAA 4XAGA 5IM51 3AYSA 4E4PA 1D3HA 1UG6A 4L9ZA 2PPGA 1GVIA 3BGJA 3HJEA 4HCLA 4PCPA 2YA0A 3K4WA 1TCMA 3PPGA 2IKHA 4WF7A 3GTIA 4ZZ9A 1E5JA 4PCFA 4LTSA 1E6SM 3TXVA 2XWDA 1UP0A 1LUCB 3G6MA 2P0OA 2JQXA 4FNUA 4GINA 2WWCA 3UJSA 2AMGA 4UOZA 1JYWA 1BWLA 1QHZA 1GVFA 1EQPA 5HBFA 1WXYA 3DYMA 2FDMA 3QY6A 3QHNA 4IIFA 1YPFA 3HGRA 3D6NA 3W70A 1Y5VA 1YDOA 3CWHA 1CW2A 2BVTA 3N2OA 3WJYA 1R3YA 3VFLA 4B9YA 2IPFA 3TSBA 1BF2A 2PTXA 3VD4A 1E4MM 3NYDA 2ACRA 5BROA 3K2GA 2P10A 1UP3A 2I5QA 4MWAD 3AHYA 5BZAA 1K02A 1QPOA 2C8NA 3IUIA 3CMGA 3VOCA 2QHAA 1E56A 4JTEA 3Q45A 4WK9A 3DHPA 2XIBA 4BF9A 2HMCA 4QGCA 1VHCA 4ATDA 4IJRA 2QUNA 4OUIA 3VILA 8XIMA 1MQQA 1VBRA 2Y88A 3H54A 3WL0A 3ZLHA 3GZ3A 4ENLA 4R7WA 1LWHA 4Y7EA 3LHYA 2YL8A 1C92A 4KH2A 2O0TA 1QPRA 1E5NA 4UTTC 3STEA 3MY9A 1IEVA 2WMGA 4BJHA 4GXMA 5DXYA 2J7FA 5GNXA 2QNEA 1ML1A 3SEPA 2OG9A 1R7AA 4J3XA 3V0UA 1S38A 1UQYA 2VRJA 2YCLB 4Q8TA 2QAFA 2XWEA 4IFRA 2OMAA 2H9AB 2Q01A 1W32A 3DYOA 4ZSTA 1VEMA 1R9ZA 3M0IA 5EMLA 2HEJA 4GQQA 2VZSA 4NJIA 2OYMA 1RLCL 4KKXA 4FLRA 3CL8A 3E5BA 1Q65A 4CD5A 3BLPX 3CHFA 4XISA 4WDXA 5JBFA 3SY1A 4JAWA 1XIEA 2Z1VA 3I6EA 1Z3NA 4RNIA 4C6IA 1UH4A 4GZIA 3DERA 3RPMA 1JEZA 4FOKA 1I0DA 3ZXWA 1R87A 1VHNA 3WUBA 2Z26A 2DP3A 2G41A 4DUXA 1GUVA 3VNYA 4WY0F 4IL2A 1UUMA 2PP0A 1XPYA 2D1ZA 1GG1A 2WJEA 3S46A 1W9DM 4PMYA 5CZSA 4O0KA 4FX7A 4P8WA 3SCNA 1ZENA 2GLKA 4J3SA 2DZWA 5G4EA 1EJSC 1T8QA 1M68A 2L5HA 3WYZA 3MMTA 1FDJA 4YVPA 3UR2A 1M1BA 3BWWA 3N6QA 2FVMA 5I5RA 2P8BA 4Q8OA 1E0VA 3VIGA 2CIPA 3WJWA 1FHUA 4TUFA 3TJXA 1G6CA 3QMRA 3F4NA 1QBAA 3TXZA 3TAKA 1GOOA 3OG2A 2ZDRA 4G1KA 4XV0A 4XIAA 1MW3A 3BL3A 3HF3A 3IJDA 3SRFA 1H7PA 5K9XA 1NM9A 3GS6A 2YFNA 1NOFA 3WF2A 4EXQA 4CQBA 2NVDA 2WV8A 4Z1BA 4XK2A 1RVKA 2E5CA 3EX1A 1N2VA 4FPSA 2KX9A 4FOUA 1W9UA 3W7QA 5BXRA 5AHLA 2WPBA 4TVUA 3A5FA 4PFHA 5K2ZA 4EANA 3DG7A 3WQ6A 3B8UA 3SRKA 4HPGA 1IIGA 1Q13A 4WVXA 3QW3A 3GAYA 3VIKA 4C6PA 1V6WA 5C9UA 1W1B1 4JHOA 1A5CA 4NL1A 1BVWA 2YR1A 3QHMA 4IPLA 4ORMA 3FGCA 1KM5A 1OEPA 4EXBA 4BQ2A 2FTWA 2B7QA 3EX3A 9XIMA 3QV7A 3AJ7A 1EZWA 2TRSA 4R88A 1REQB 3OLGA 2Y7EA 2WLZA 4PTXA 3LQGA 3VTRA 1EHNA 1U1JA 5FF2A 3ZJ8A 1PZ0A 3LV5A 4F0SA 3ARXA 1ONEA 5A6BA 3TN5A 1NDZA 2J88A 5EMUA 2X1UA 2F61A 2VGFA 1W1PA 2BZNA 4F0LA 1WZAA 5HQEA 5C7VA 3UWWA 4B3ZA 3U4FA 1DWHM 1MUMA 1A49A 4GUFA 5HMDA 1F07A 2OO6A 5G2IA 1HJQA 4I9JA 2FMNA 1L9WA 4RZ4A 1E9IA 4HNCA 3EX4A 2IQ0A 4OFCA 3P0XA 2IW0A 4CD8A 2YIHA 4C6QA 3HG2A 4QIUA 3IIPA 5TQLA 4N4PA 3XISA 5BOOA 1J96A 1V02E 1JDCA 3C0QA 1XBVA 1E15A 3G6LA 3JZUA 2CPUA 3PY2A 1M7XA 3AWNA 2C6QA 4QJ5B 4UTHA 2WZIA 1EJVC 1MQPA 4UTMA 5HATA 1KV8A 2VI0A 5ABFB 1R9XA 1LRNA 4LNCA 2Q09A 4KETA 4XZWA 2GVJA 1GOIA 2QAPA 3B06A 4JTTA 1DQXA 5EFDA 1K7FA 5FA5A 1IR1A 3GUGA 2VDGA 2YBVA 2P76A 4GBDA 1V7AA 4HJFA 3FV9A 1T96A 1K7XA 1RA5A 1XWYA 4OOZA 3KEHA 1YDVA 1TV2A 4YTQA 5KTLA 4QITA 1SW3A 1TA3B 3CASA 3ERPA 3T78A 1I9CB 4E3VA 4PYSA 1JUBA 3R8RA 4FNRA 1E9YB 2YW4A 3NGJA 4NXKA 4O13A 3K46A 1O5RA 3NQMA 1LL6A 1E0XA 1TWWA 4RNHA 3HTWA 1SZNA 4UR8A 4V27A 2W4XA 4WJ8A 1C7TA 1NF0A 2X0HA 1MO0A 4U33A 1A4LA 3LCIA 3HG5A 4Z0JA 3HPXA 4QAWA 4TQTA 3H55A 3TWAA 4PSRA 3BMXA 5G1YA 1N8FA 2Q6ZA 4JNMA 2E6AA 4PTNA 1ISWA 3ARUA 4YCPA 1W2PA 2PWEA 2FFIA 1WP6A 1U83A 5DBTA 2D2GA 3VINA 3W86A 4FLQA 4RZ5A 5DQPA 1S5NA 4GX8A 4F0KA 1FWSA 1BXCA 2O55A 1JZ2A 3E0VA 3DECA 3CO8A 4X0NA 1EYEA 4QG9A 3V18A 3FXYA 1FH9A 2BOFX 4IQLA 2Y7DA 5RUBA 1P7TB 5IFTA 1UD8A 3LLFA 5CPNA 2CLKA 5U7SA 2OELA 2OZ0A 2PDMA 5LIXX 3WQGA 2FHFA 1QPKA 1P4CA 3T40A 1HUVA 3W85A 2JBMA 3URNA 3ITLA 4Y90A 3C61A 4Z2HA 1V4YA 1XGZA 4TX9A 3N4EA 3UY8A 2XVLA 2ZXQA 2V63A 2DZVA 3LD5A 2A85A 1F4AA 4GUJA 4ML4A 2R14A 3E6EA 3GDMA 4MMWA 1RBAA 4LH8A 4I5UA 3EXTA 3XINA 3DAQA 4J3UA 5E1QA 4AAJA 3M7WA 4XVEA 2VGBA 1OFOA 4AFYA 3REQB 2VZOA 3UFYA 4UTWA 4CNTA 3ITYA 7REQA 4MFDA 2EKCA 1OABA 4JNYA 3NG3A 4M19A 3CHVA 3ITGA 3U57A 1TJ2A 1DQWA 3VKCA 5CJMA 3VC5A 1HXJA 1OFDA 1B2YA 3F2DA 1WZKA 4DZIA 2CERA 1JAEA 2UZ9A 5CPQA 4HOXA 1XLAA 2DW7A 1PDYA 2ZZ4A 2XIQA 3ATYA 1KR0A 4DJED 1AH3A 4IMCA 3P80A 5CAHA 1V77A 1VFLA 2ZKMX 4B16A 4DYEA 1H7OA 3PZVA 3VGHA 5FACA 4K8HA 5FOOA 1PSCA 2QJMA 1H41A 4Q8NA 1NH6A 1C3FA 4DY1A 5AC4A 2YDAA 1J0HA 1WA3A 4FXJA 2VMFA 5H1WA 4TO8A 2P53A 2XUCA 1Z8AA 3IV8A 2JIEA 1GJWA 5C9WA 4AZCA 3N29A 2P50A 3KBMA 3AO0A 1V0LA 1FQ0A 2PA6A 3BZJA 4HN8A 5ECUA 4EOUA 1L6YA 1ECEA 4IQEA 4O1DA 4AIBA 4KWUA 3JRKA 2JK2A 2CLEA 2RJGA 4PL2A 3M4HA 5C2GA 4NP7A 4JD4A 2V8ZA 3GNRA 3HBLA 5AY7A 2ZUTA 2NQZA 1IE7C 4PZVA 3SRDA 5I77A 5AYXA 3KL0A 2Z2UA 3AIBA 4BK9A 1ICSA 3T8LA 1TV7A 3PZOA 2V9DA 4P5UA 4IP4A 2YDRA 4DF0A 2ON3A 4KESA 1RQHA 2CHNA 3T4CA 4GYJA 2PSNA 1KM1A 4QDPA 2V82A 3RJXA 1WDQA 4BA0A 3LSBA 4FXRA 3A13A 3WUFA 2VQTA 2A3LA 3EOUA 4DJEA 4PODA 2VFIA 2R94A 1K03A 3EA3A 4Q8QA 1UR3M 3I6TA 3W1RA 2VD9A 1VJZA 1GCYA 1W1YA 3FJNA 1HKVA 2J75A 1VBJA 4Y9AA 1K8YA 1QW9A 3S8HA 4NIRA 4AWTA 1FWGC 1QI3A 4PBFA 4Z0SA 4FNSA 5FSEC 1CB2A 3T09A 1I6NA 1KQYA 1POJA 3N3TA 1OADA 1LBLA 4ZOEA 3USZA 3W29A 2FH8A 4PUWA 1AL8A 2P3ZA 3AS1A 1IXNA 3CPGA 5HNRA 2PD9A 3JVAA 4GJJA 3CTTA 2F2KA 4HK7A 8XIAA 3SSJA 3HFYA 3TTSA 1AJ0A 3EXRA 2NXHA 4UBPC 1NDWA 1W3LA 5HULA 3FK4A 4KFNA 4JYFA 4GQBA 4RL3A 4KRTA 2G97A 4GQRA 3SQLA 2VWSA 4S3KA 3HO8A 4ZOBA 1V8EA 1A5SA 4OECA 1X98A 4AD3A 2IXVA 4TX8A 5GPRA 2XM1A 5A69A 1QBBA 1RCXB 5JUVA 3AICA 5M1TA 3NQ6A 4KBXA 1DTNA 4IT1A 2ATSA 3AHVA 4LUTB 1FWDC 3B8TA 4PUKA 3NDOA 2XIIA 3K4AA 1V6UA 3QQWA 4A2RA 1Y8BA 4PTMA 4BKNA 2O9TA 5A95A 1H0GA 3WBWA 2CWXA 2ZRWA 2X0YA 4AC7C 4W84A 2XSXA 2PDNA 1SJDA 4JL1A 4XD3A 1JZ6A 3WD4A 1HVQA 4HSHA 4MLRA 3EB4A 1UD3A 1ISVA 1E6NA 2BVDA 3VMPA 1JULA 3PS7A 4W5UA 4L5ZA 1IQ8A 2YSWA 3W1LA 4JN7A 3ZT7A 4XG1A 1J0IA 3IIOA 4HZ8A 3DC8A 1X1NA 3CTLA 3HGJA 3M5YA 4B2DD 4G7EA 3PNZA 1H63A 2NQ5A 1CT5A 1H11A 1OCNA 4PB4A 2VVNA 3B3DA 4JGDA 4AZGA 2Z1XA 1EPVA 3FN9A 3AIEA 3ALGA 3LEPA 1S2UA 1TPDA 3S2NA 4CNPA 3NQBA 5I23A 2OT0A 3PBGA 3H2CA 3UWYA 1O1ZA 3DFYA 3F5JA 4J40A 4PUJA 2AQOA 3R89A 4JKMA 3V5CA 4IUGA 2GGEA 1FWEC 3TW7A 3PPHA 3HN3A 2EJ1A 4HCHA 1KRAC 2FYMA 2QV4A 1R2SA 1YE4A 2PWVA 1G4EA 2DSVA 3WK1A 1W6TA 3TONA 1JF5A 1XP3A 2IKGA 5DMYA 4B5UA 4ZBCA 3FA4A 3GIQA 3MP3A 3OEXA 3OGRA 3WK3A 4AZBA 4MYAA 2GWNA 3BSGA 4CNUA 2VGIA 2QDEA 1A0EA 3CMJA 3OP2A 3V3WA 1OJXA 4UQCA 2OZ8A 1XIIA 1XUUA 5I3KA 1AW1A 1CGVA 3GVQA 3GD6A 3R4IA 5HPCA 3CAWA 3BDKA 1E1EA 5FEXA 5A8PA 4IPPA 4LEFA 4HNLA 2HE8A 3BOXA 4H2CA 1TPEA 2FPTA 2QR6A 4IL0A 1DIEA 4FK9A 1F05A 1HX0A 3BANA 4JX5A 3M0MA 1XSIA 3UP8A 2YDQA 1JIBA 5BOEA 2D69A 1R38A 1Q63A 2PDXA 2Y7GA 3QR3A 4AC1X 4UIOA 4TV5A 3KS5A 5KZEA 1W5MA 4LYRA 1XD1A 5FSDC 5I6SA 2DFAA 2GZXA 3GNDA 5IBXC 2C0HA 4BI7A 2EG8A 3QLDA 2V69A 3EB3A 3M43A 4J35A 1EXPA 3O8AA 1X6LA 3FLUA 2VCBA 2D2OA 2CBVA 3C56A 2NSXA 4IXXA 5FF4A 2BGSA 4H9TA 3KX6A 3T7VA 3ZS4A 3RK8A 2YJQA 1PCKA 3NPVA 3PP7A 4CD4A 4NNCA 4IGMA 2YL6A 4M24A 1VLIA 4C1KA 4DLMA 2J7EA 2ATMA 4TMBA 3T05A 4MVAA 1PX8A 4D6JA 1V3JA 3A5VA 3VKDA 2HWGA 1PTDA 3WLPA 4MLJA 4H6KA 2INEA 3ARYA 4H6EA 2EG6A 4CQAA 4WOZA 4F40A 1D7KA 1O1HA 3NO3A 2BY0A 3ZVIA 1GQNA 3TYCA 3QTGA 3MO7A 4MWAC 3GTXA 1X1OA 4LF2A 1LZOA 1IF2A 3L21A 4Z2JA 1TPC1 1RXOB 2ACQA 4C6DA 4CKQA 4RDZA 1BD0A 4CCDA 4LVGA 4KEUA 2WZMA 2RDWA 3UR7A 2WM1A 3S2JA 4MDOA 1FY6A 3NURA 1LLZA 3CBWA 3T2PA 1X6UA 2QT3A 3NL2A 2QVNA 3ANVA 1YNPA 3LERA 2Z00A 1B30A 1Q6OA 3TWBA 4UR7A 1DYSA 3KP0A 1NJJA 2C14A 1W9VA 3P5YA 3PAOA 4A35A 1XLFA 4GZEA 1JL8A 2PS2A 3W38A 3UYIA 1XC4A 1QAPA 2FH6A 1BVNP 1CLKA 2OX1A 3W7JA 4M6PA 2J9YA 3S6TA 3ARSA 1RLDA 1V3HA 4NJJA 4M0XA 1UA7A 1R30A 3V0SA 4EWJA 2WZTA 3MHFA 3LLDA 2E3ZA 3AIQA 1QOQA 1FKXA 3H2OA 2EAWA 1NIUA 4AIOA 3S5OA 2HROA 3BURA 2BSLA 1V93A 6TIMA 2I7GA 4N4QA 3L12A 1NWUA 4JX4A 1VFHA 5D2XA 1WOBA 1Z48A 3VM5A 4NJGA 3BLOA 1I60A 3GNXA 2OGYA 3W7OA 5F1VA 3PTMA 3TZFA 2VC7A 3N3MA 4LUTA 2HPMA 3CZGA 4A05A 3ONBA 1OYAA 5FJTA 1P0NA 1M41A 3CO4A 3B9DA 4AD4A 2QCFA 1BYCA 3BAXA 3WQ4A 1EA9C 1XSJA 3A47A 3WNOA 2Z1SA 1FWFC 3HZ3A 2PLKA 4NILA 2VRKA 2A7PA 3P2VA 4BWLC 1YPIA 4JTQA 4JPGA 2OB3A 2ANUA 3VCNA 2IS7A 3R58A 4MWAA 1HTIA 4QSHA 5FF3A 2IKJA 1MMFA 4DF1A 5CSSA 1ZJIA 1H7XA 1UZHA 5C9ZA 2BY2A 4E4FA 4CGTA 1VFSA 3CUXA 1PTGA 5D8ZA 1P0DA 3MI2A 2WAGA 4RUBA 1UIOA 5CLWA 1GVSA 3WLIA 3HURA 2OYKA 3M1ZA 1KRCC 2BLEA 4CVWA 3G18A