3OVPA

Crystal structure of hrpe
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
221
structure length
221
Chain Sequence
GCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of D-ribulose 5-phosphate to D-xylulose 5-phosphate: new insights from structural and biochemical studies on human RPE
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Ribulose-phosphate 3-epimerase
total genus 80
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2010-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ovpA00
1A5CA 2R8WA 3TJXA 1FBAA 2PRLA 4IPIA 4WUIA 3F1QA 2QKFA 3VE9A 3W2JA 4PL2A 1TQJA 3DKLA 4HNNA 3DFNA 2NX9A 4JYDA 4L4LA 1X8FA 4UNLA 4WXYA 4YWIA 4DF0A 3HG4A 2DJLA 3ABSA 3W07A 3W7KA 1R46A 3W1AA 1F6PA 2ZZ5A 3BGJA 4UR7A 4GUHA 3B0PA 1IF2A 1VYPX 1JCNA 4CNOA 4O0ZA 1EPXA 2NUXA 1KFLA 3W7DA 3A23A 4RKAA 3FJLA 3HF3A 1VPXA 5AC6A 4OV4A 4HNUA 4N9CA 1MEWA 1JRCA 4UFHA 2A6NA 4MZYA 3I7RA 1LROA 3TJLA 1FWSA 2GVLA 2Z0IA 3W2KA 1B3OA 1IIGA 3W7GA 3B8DA 3EX3A 1TSIA 3GR8A 1XXXA 3GB6A 1VQTA 3S6DA 1TRIA 1F74A 1KM5A 3MMTA 5DBTA 3H54A 1FWTA 3S1UA 1XC4A 5I3IA 3HIJA 3HGSA 5BRBA 4UFIA 3LXCA 1JCLA 2VEMA 5I3KA 4ADSA 2QAPA 2B0MA 3PAJA 2QF7A 1QAPA 3CTLA 4UMAA 3CT7A 2VFHA 4IX0A 5D05A 3ZWSA 1W31A 1A5SA 3T7VA 3MHFA 3LX9A 2RDWA 4O13A 5CZJA 3EWYA 1D3HA 4IXXA 1A53A 5HNRA 2CLIA 4LVBA 1GG0A 4UTTC 1VC4A 1HFBA 1THFD 1G4PA 2JKEA 2FPYA 3LXAA 5F2GA 1IIHA 4N02A 1VCGA 4ICNA 3UWZA 4LT9A 3W2LA 1WOAA 3G3DA 1IGSA 1XCFA 4JNMA 1OJXA 4NT0A 1EUAA 3EWBX 4I9AA 5SWUA 2QUTA 4WY0B 5HWJA 5FEWA 1DVJA 1ML1A 3WJSA 5TIMA 1J4EA 3HJZA 1TJPA 4UFKA 2ZYFA 3YPIA 2V82A 3NQGA 3THQA 4HKPA 3ZR4A 3W22A 5I3GA 1QFEA 3BK0A 3G1YA 4GRSA 5EY5A 4NU7A 1L6WA 4NNBA 4E0CA 5DY2A 3RF9A 4JYFA 1FCUA 4M5PA 1QDSA 2R94A 4JTTA 2A7RA 4UMCA 1W8SA 3TC6A 3TH6A 4QSHA 5LNSA 5G1YA 1SO5A 1P1XA 2E5CA 3GNDA 4I7VA 5EPDA 4R7JA 3C2RA 1BWLA 3TX9A 4A2SA 4N6EA 1RZMA 5G1TA 3W7IA 4XTDA 3LCLA 3STCA 1B4KA 2QR6A 3M47A 4LOCA 3S5OA 5CKSA 3GLCA 1W54A 2O7QA 4JGDA 3U2OA 4GFSA 3PUOA 2ISSA 1KFJA 2B4GA 3R5EA 4UTTA 4IMGA 1OG0A 4OWGA 4RZ5A 2ZCGA 3HOJA 4PTNA 1AL7A 5KZDA 4Q32A 1SU5A 1R30A 3NPUA 1ZALA 3RLVA 5FF4A 2I9EA 1R2RA 1KFEA 3SGUA 3OBKA 4GUGA 4RXGA 2J9YA 1U5JA 4MYAA 3JRKA 3EWZA 3LHVA 2D73A 5TBOA 4AHPA 3ZWTA 3FIGA 4Q4KA 3W74A 2P1FA 2DJXA 4CNPA 4A2RA 5FESA 4JN6A 3TQKA 4NJHA 2OT1A 1YDNA 1T99A 3N3MA 1TREA 1JJKA 2BLEA 2HS8A 4O16A 1KTBA 4MY1A 1I2NA 5AC8A 1NAL1 4LW7A 5EA9A 4AMAA 3NG3A 1JCYA 4MY9A 2GQAA 2A1YA 3UY8A 4W9TA 4LU0A 2I14A 2YSWA 4FXSA 4ML9A 2Z1BA 2RFGA 2RDTA 1VHCA 3O6DA 3FS2A 3WJWA 4MZ8A 3NQ7A 4GWEA 3JR2A 4TO8A 2RH9A 4DPQA 3IRDA 4AF0B 3EEGA 2EPHA 2FQIA 4DO5A 5HJLA 4KFPA 3C2EA 2DZTA 3P8JA 4PODA 3NQ2A 4DBDA 1XBZA 3A24A 4O54A 1Q6QA 4O8RA 1OX4A 4UXDA 1TPDA 2Y7DA 3MW7A 1WXJA 3LXBA 1WAUA 3L21A 3N2XA 1DBTA 1KV8A 1ZNNA 4O19A 3UWWA 4EVZA 3N19B 1JCXA 5L9FA 3P60A 2YPIA 4O4WA 3P5YA 4CCDA 2Y61A 3PULA 1TV5A 2WSYA 4JIQA 3O06A 2V2DA 5LNRA 1FY6A 2AAMA 3L68A 3KVMA 4K6AA 3ANYA 2E5DA 3IVTA 3P67A 3SJ3A 1YTDA 3PUEA 3GXTA 5KTLA 2V5LA 5ABTA 1TJRA 2F84A 3STGA 2A85A 3ABOA 3NQ8A 2J24A 1Z42A 1GG1A 1QPOA 3JS3A 3MI2A 1O95A 3SIZA 3FKKA 1IXPA 3O16A 4UUIA 4UFJA 1RVGA 1QMLA 1XL9A 4O11A 1GJPA 3NL5A 3CWOX 1I45A 1A5AA 3DZ1A 5FF2A 3TSBA 1G6CA 4O15A 1FCQA 2QCGA 1TPB1 1G4EA 1VYRA 3OEXA 1L9WA 1NEYA 3PB0A 1O5KA 5U4NA 2FJKA 5F2LA 5U7SA 4FIQA 2VFIA 3G22A 1B9BA 3IV3A 5K9CA 1HUVA 4LRTA 5T26A 2J9ZA 4JX6A 4HPJA 4O53A 5DN1A 1VS1A 3CQ0A 2Q3OA 3QW4B 1DOSA 4LV4A 4DF2A 3W1XA 1W3NA 1JCMP 3QMRA 3NAVA 2P10A 4TU1A 1I4NA 2QJHA 4UTMA 1PCWA 3INPA 1WV2A 1OF8A 4UFLA 1P4CA 3P5ZA 1QPRA 4JTSA 2BWGA 3H55A 5HWNA 4K38A 4AHOA 3S1WA 3LDVA 4FNUA 4MOZA 4G1KA 5C55A 5HUPA 3QH2A 4HHPA 3DKJA 3GNNA 3P7YA 5H2ZA 3WK3A 5F4SA 2DZVA 4C1KA 1H60A 2NWSA 3I65A 2DZUA 2JKPA 1GVFA 3R2GA 2H3DA 4N6FA 3FYOA 1PS9A 2YFNA 1JCJA 3VFLA 4FX7A 2C3ZA 4M19A 1ALDA 1YXCA 3EXRA 3TXZA 2TMDA 5F4XA 2GPTA 4MLRA 3W1LA 1CW2A 3PSWA 4RV8A 4LTSA 1F6KA 4Z1BA 3M43A 1YDVA 1W5PA 2VFFA 4UTHA 3W1TA 1H51A 3PM6A 4K7YA 3IIVA 2F7FA 4JX5A 1OFDA 4XQ6A 2JKAA 1C8VA 3C4UA 4JXCA 5H91A 2V30A 1VJIA 2V5BA 1TPUA 1G67A 2J88A 1T0OA 1TCDA 1LBMA 2P0OA 4LVDA 1VR6A 1EWEA 1P5BA 1MSSA 1JUKA 2FPTA 2NX1A 5AN7A 3PG9A 5CZTA 3G8RA 2A2IA 3L66A 1JVNA 3OIXA 4IMFA 3S5NA 3OHIA 1PCKA 3UXDA 5D38A 4Z1CA 2VEIA 3LLFA 2Z6IA 2ZRXA 7TIMA 2ZQ0A 1LRTA 1UJPA 1QPNA 3FA5A 3NPXA 4HSNA 2B7PA 2QJGA 3NZ1A 4D2JA 4KWVA 4JTIA 3PG8A 3DGRA 3N73A 3G1SA 3KVJA 2ZZ3A 3C3NA 3T55A 1Q3NA 3NQAA 1AL8A 1H63A 2XN1A 3W86A 1DQXA 1JQVA 4O1AA 3N9RA 5F2IA 3OVRA 3A21A 1J2WA 3NZRA 1GYLA 3EXTA 4IX2A 3SR7A 3DHFA 3PSVA 4WQ6A 4MVAA 4WOQA 4BI6A 3G1XA 3HGRA 3NDOA 4AB4A 1W3TA 2WJZA 3P8IA 2ZTJA 3EXSA 3ZS4A 1H7XA 3CIWA 1ME9A 4H4IA 1NSJA 4NJGA 3G1VA 2A7PA 5BNKA 1ZY9A 4GC4A 2ATMA 2QCHA 4KWWA 1IXNA 3TSMA 4OQVA 3TC7A 1FXPA 3C52A 2FIQA 1ME8A 1W1ZA 1LLWA 2YW3A 3OA3A 1LZOA 3BLFA 1S5VA 3M16A 3FLUA 3STFA 5D2TA 2AQWA 5DCEA 3GZ3A 2WSRA 3QEZA 4AWTA 4O14A 4MJMA 1ME7A 3NM3A 4A3UA 3BPWA 4U28A 3S5YA 3W73A 4O28A 4A22A 4H3DA 5KSWA 1Z44A 2W6RA 1SO6A 1ONRA 4BFAA 5LHEA 4JX4A 5HR7A 3DFQA 2OCZA 3BW3A 5G4EA 1K3UA 1KTNA 3W83A 1F5ZA 1GTEA 3IVUA 1VGAA 1EWDA 1VLIA 4NUWA 3QFEA 4IMEA 1FQ0A 4FX8A 4MIMA 2VFGA 3SW6A 4AXKA 5G5IA 1TO3A 2V8ZA 2C15A 1S5TA 1LM1A 2GUUA 3QZEA 5F1VA 2E6AA 1XBXA 1ZENA 4ZQPA 3T44A 2GQ9A 3HPSA 1M6JA 3O6YX 5FF3A 1RR2A 3HMJG 1JQXA 2Y7GA 2XN2A 4S1FA 4M7TA 4FX6M 1UUMA 3HPXA 5I3FA 1F76A 4ORIA 1P0NA 2H8XA 3UXAA 4NQ1A 1XBVA 2TRSA 4ZQNA 4MUZA 3G8EA 5BMWA 1SZEA 4M6PA 4O0KA 3ATYA 3GKAA 3P82A 2VXNA 3N9SA 4RJEA 4JICA 2CZEA 4WX2A 2VELA 3GAKA 3HPZA 5BMXA 5K4ZA 5IM51 1GOXA 1L6SA 1ZCOA 4N9BA 3W72A 3GDMA 3MYOA 4O4VA 2YYTA 2QAFA 5E93A 4JTEA 4OV9A 3W7PA 1DQWA 1QR7A 4Z1AA 1PV8A 2UV8G 3TROA 2ZBTA 3NOEA 4QNEA 3G18A 3PWAA 2ZA1A 2BTMA 3O63A 1XFBA 1PE1A 5KMYA 2DZWA 4IXHA 4ZMGA 5EBUA 3M1ZA 3G0XA 2ZRWA 1FCVA 3GR7A 1KBJA 4IQLA 5LNUA 3B05A 3USBA 1QOQA 2BSLA 1TTQA 1KV5A 4Y90A 3W71A 1OX6A 1W37A 1G7UA 3CWNA 4YXGA 1PHWA 5DBUA 4ZVJA 3PVFA 2EGZA 1N7KA 4LUIA 4MJZA 4RK8A 5K9XA 5DXXA 3LCGA 4LVAA 1KLYA 1GWJA 4QITA 3G0UA 4NZFA 3B03A 5AOUA 2DZXA 2YZRA 4UTUA 2Q8ZA 1YXDA 3LHYA 3TQ0A 3CEUA 1O60A 1TPWA 3TU9A 3TR2A 3F03K 1VCFA 1W3IA 1X6UA 3C2OA 3LRMA 1TPFA 4QISA 1X7FA 1EP2A 1SPQA 1PIIA 3EKZA 4H6KA 2VFEA 4TIMA 4FO4A 3WFAA 4XWUA 5DLCA 4DPPA 4EIVA 3NVTA 4LVFA 2PRMA 3N2MA 1LRQA 1LORA 2E5BA 1TPEA 2WPBA 2ATSA 4JTKA 3E96A 5K4XA 3IIOA 3UD6A 1LOQA 2CW6A 4AWSA 1QNVA 2J9XA 5HULA 4PL1A 3O15A 1A50A 3SFKA 1MXSA 1AW5A 2GQ8A 3Q2DA 4MZ1A 5HMSA 2G96A 1JULA 4UTLA 1I2OA 3BVJA 2GOUA 1K7XA 1OFRA 2QCCA 2R91A 1IXQA 3NQEA 3S9YA 2A7NA 3DI1A 1FDZA 5HQEA 5D32A 1H7RA 3SY5A 3QQ0A 5AHFA 4WY0A 3W1QA 4O17A 1K7EA 4UTJA 4X2RA 2A5HA 4UMBA 3LHZA 4FXRA 5LNVA 1ICSA 3Q94A 3CB8A 1HTIA 5CSSA 5AHEA 2A0NA 3SZ8A 4CQ9A 2B7OA 3TW7A 5E0KA 1KM1A 2EHHA 4Y8FA 3MP5A 1TIMA 2BX7A 1HL2A 2YW4A 4ZQCA 1WA3A 4RX0A 4ZQMA 3DXIA 8TIMA 2V9DA 5FEXA 1H7OA 3A5VA 3B0UX 5TQLA 5G2IA 3W85A 3GYEA 2QCMA 3KOFA 2E68A 1W5MA 3KAOA 1SO4A 1OFOA 4NX5A 4O18A 4QJ1A 1VRDA 3HG3A 4JDBA 1SUXA 3C8FA 3NNTA 1U83A 2ZA2A 4DBEA 4HNTA 4JY9A 4ALDA 2WSQA 3W6YA 1WBJA 3TW6A 1Q6LA 3P62A 4M6QA 1AW1A 4X9SA 1KFCA 1JUBA 2PURA 2HMCA 3GKFA 1JUEA 4QM1A 3QPYA 1F7BA 4LS1A 1I2RA 1F73A 2O7SA 2Q8LA 3Q58A 2B7QA 3DHDA 1NF0A 3SSJA 2C0AA 5CPNA 5AFDA 2VKZG 1M7OA 1YXYA 4P61A 4HN4A 1O4UA 1N55A 4J9JA 5EMUA 1EUNA 2Y6ZA 3LCFA 3LV5A 4OHQA 2E6DA 3NPWA 2EAWA 1SQ7A 3UPBA 1ICQA 3TAOA 2E6YA 2XN0A 2H90A 4PFMA 2VOMA 3GIYA 4DEFA 3CEPA 2R14A 4PC8A 1H7NA 2LLEA 5F2MA 3ELFA 5D03A 4JTFA 2HSAA 3HO8A 4ZZ9A 2CZDA 5FEZA 3BLIA 1I8JA 2NXGA 4Q33A 1XDMA 3UWUA 4ZL1A 3BG9A 3EB2A 3PBVA 3GX9A 1OX4B 3STEA 3DFPA 2NUWA 2C6QA 1FWWA 2E09A 4K36A 3NPVA 2FPVA 2Z2UA 3AO0A 3PBUA 4Y6GA 3L67A 3WK1A 1GVOA 3H53A 3G1FA 5FEPA 3UWYA 2WOQA 2WV8A 1XUZA 4O10A 5AHLA 3B4UA 3FEMA 1A5BA 4EOUA 1TTIA 3TNOA 4DXVA 1FDJA 3LTSA 3PUDA 5D2WA 1YDOA 4UTWC 1J5TA 3C0JA 3I7SA 2ZRYA 1M5WA 1QO2A 2VC6A 3IGXA 2C18A 2VFDA 1R2TA 5GVJA 3ATZA 4LC6A 3DH7A 3PF3A 3M5VA 1ZJIA 5G2HA 4QQ3A 3C2VA 3WJXA 4MY8A 2H3BA 1C9DA 1BEUA 3E9AA 4RZ4A 1FXQA 1I2QA 3FFSA 3F4WA 1H1YA 1PVNA 3DFTA 2Y70A 2ZZ2A 1TYGA 3RK8A 3TFXA 3W1MA 2VEPA 4XTIA 4O57A 5LGZA 1YPIA 1PL9A 4HIBA 3RFAA 5KITA 4A21A 1JRBA 5EYWA 4IUOA 3W2UA 4GUIA 2ISWA 3IIZA 1R2SA 1W56A 4TMBA 1N8FA 4RCXA 3U8GA 1GVRA 3L0GA 3D0CA 2ZFAA 4HT3A 3QMSA 4JS3A 3W2MA 2YGYA 3W7MA 3MBFA 1WBHA 1TMHA 3UPWA 3W7JA 4YL2A 4IJBA 4ZQOA 3W7NA 1K8XA 4LS2A 4R53A 5HWMA 1GZGA 3DU0A 3TE9A 6TIMA 5AYYA 2RKXA 3EWUA 3GXNA 5AC7A 3FOKA 4JYEA 4XKYA 2Y89A 2JGYA 4FF7A 4NZJA 3PB2A 4K39A 1Z41A 1SO3A 2YYUA 2WO5A 2YR1A 4AWUA 1BTMA 4TX9A 2YCEA 2GVGA 3L2IA 4GBUA 4UFMA 1TQXA 2Q3RA 4BWLA 3C2FA 3WK0A 2IQTA 3QQ1A 5FF0A 3O6CA 3M5YA 2PRHA 5D04C 2ZZ4A 2CLLA 3IEBA 3OVPA 4ONVA 2FB2A 3KVKA 3W87A 1LDCA 3NA8A 3KX6A 1SZNA 3GDKA 2CLKA 3NQFA 4JD4A 1MEIA 1SW3A 5HUOA 4IOTA 1CI1A 3IGSA 1K8ZA 3E49A 3FKRA 3N34A 3TA6A 1LBLA 2PCQA 3OG3A 3DI0A 3NL2A 3S1XA 3W7LA 4NNCA 2G5WA 4EF8A 3W7OA 2GJNA 4FIRA 2WQPA 2NXHA 4K7VA 3WJYA 1LOSA 3QPZA 1W5NA 1ZAJA 2X2GA 5I3HA 3W75A 1C29A 1SR9A 5BOOA 3GVGA 1FCBA 4UTIA 1DJQA 4LC8A 5CPMA 3LGEA 4DO4A 4MYXA 1TPH1 1Q6OA 3N14A 3FYPA 3SGZA 4MLJA 2G95A 3QSRA 1W0MA 1MO0A 2X1UA 3MWAA 1LBFA 2CWNA 3UZJA 3C61A 4E38A 3EX2A 2ZRZA 3R89A 4O1BA 3CU2A 4XBKA 2FTPA 3KRZA 1BKSA 3C6CA 1EP3A 1OFPA 1X1OA 4YLWA 4RLIA 2OT0A 1FX6A 2X1TA 4I7WA 4DO6A 1MZHA 2W0UA 4GNJA 1E51A 5DCBA 5DELA 3THAA 3BO9A 2Y85A 2ALDA 3BLEA 2DZSA 4Z0SA 4LVGA 4N2YA 4O1CA 1GVQA 1H7PA 4XUGA 5D30A 1R47A 4UNKA 1ZAIA 3S8HA 4XZ9A 3O8AA 4N9DA 1BWKA 3EWWA 3A5FA 1H7WA 4FNTA 1IXOA 2YFOA 3TCEA 3LM7A 4N4QA 3LV6A 4NVTA 2CU0A 2TSYA 4UCGA 3G1AA 1QO5A 2VENA 3TMLA 3IGUA 1LLZA 2EKCA 3HG5A 3MYPA 4FNQA 3T40A 2TPSA 4AHQA 2VEKA 3I7QA 3TIMA 3LTYA 3MP4A 2A6LA 3LERA 1RQHA 3B04A 3BGGA 3SI9A 5CZSA 3CC1A 3LCXA 1GQNA 2JGQA 3LRKA 4PH6A 3UWVA 2V2HA 4OBTA 5L6UA 4NX0A 3CLMA 2HS6A 3BARA 4Z0JA 5FI8A 4C1LA 5MHBA 3M6YA 3B06A 3M44A 5D2YA 4JEQA 3IIPA 3O05A 3U6WA 1TV7A 1DL3A 3MI6A 2WNNA 2QUUA 1H5YA 1YPFA 1F2JA 1FWNA 4MFDA 3CPRA 4R34A 3A22A 3NL3A 2NUYA 3T78A 4FEZA 3G0SA 2C19A 4M7SA 5AHNA 1UBSA 3LHUA 4O12A 1WYIA 5J5RA 2ZRVA 3E02A 3V1PA 1OF6A 1LCOA 1YTEA 3GDRA 1JR1A 2RHGA 1FUYA 2CLMA 2OMAA 4YMZA 1TV8A 1G4TA 4WY0F 2Y7FA 2DORA 4HSOA 4KKXA 2A21A 2QCDB 2NV1A 3MHUA 3I6RA 2Y62A 2QDHA 2QCLA 4LUJA 4LV9A 4EWND 5E1QA 3TUUA 3F4NA 4Y96A 3EX6A 3LTPA 3MJYA 5IBXC 1VH7A 2WNZA 1RQEA 3M0ZA 2OZ0A 1OK6A 1Z48A 3TFCA 5D02A 3MHGA 3BW2A 4PCFA 1UUOA 4NJIA 4WJEA 4FB7A 1YADA 3C56A 4E2BA 3LCHA 2CFFA 2OJPA 3AJXA 4CCCA 2ZZ1A 3VE7A 1EX5A 3M7WA 3M5ZA 1XKYA 5CGQA 4Z1DA 4TMCA 2V81A 3IVSA 4GUJA 4NJKA 3VNDA 3W2NA 3HBLA 3L5MA 5D2VA 2X30A 1ZHAA 2C1HA 1F05A 4ADUA 4N9EA 1G7VA 1NF7A 3KRSA 3TDFA 3GDTA 4UC5A 1Q45A 4X3ZA 1L6YA 4FNSA 4LNYA 2OX1A 1NFBA 3UYCA 3CIXA 2E77A 5J5DA 5LSMA 3RMJA 3TKFA 2PC4A 1AK5A 3LRLA 1K03A 2J27A 1W5QA 5AHIA 1RD5A 3VKJA 3QYQA 3NQDA 1W5OA 4DELA 1KBIA 3QF0A 3QC3A 1ZFJA 3KHJA 4E2DA 4PEKA 1V5XA 1OYCA 1DHPA 4BR1A 3V75A 5D33A 4UTWA 3Q37A 3QRHA 3S5ZA 1OYBA 1KA9F 3S0CA 2X16A 1VHNA 4JIPA 2PE4A 3MO7A 1SZGA 4BF9A 5C2XA 2CLOA 1VYSX 1TB3A 4LY8A 2TYSA 1GTHA 4DQWA 4FHAA 1OFEA 2BZNA 1NVMA 3G1HA 3TXVA 3W7RA 5DXYA 2BXVA 3O07A 1V7YA 1TTPA 1GEQA 5K2ZA 2Z6JA 2V0TA 4AAJA 3M41A 4RXFA 4O1DA 4ADTA 1EB3A 3QJAA 5I3JA 4MKNA 1LRNA 2G97A 1OVDA 1OFQA 1OX5A 2ZDRA 3R8RA 3W70A 1LYXA 3UY7A 2NX3A 1YYAA 2X1SA 3R13A 1QCWA 2I1OA 5K3VA 2XFWA 4QNWA 4LS0A 3I68A 2QUVA 4WZHA 1XUUA 4K8HA 4LRSA 1D3GA 1WX0A 3DBPA 3A9IA 3NGJA 2YDAA 1UCWA 4XBSA 1ICPA 5F4WA 3BG5A 3DAQA 3W7QA 4IPJA 3QM3A 5EKYA 3PS7A 4KFOA 4KFNA 2Y63A 5CSRA 4JR5A 2QCDA 2GJLA 2DU2A 1DORA 3NXFA 3NQ6A 3W84A 3W1NA 3P84A 1AW2A 3B0VC 2NXIA 4NJJA 4HPXA 3HQ1A 4CQ8A 1GVSA 4IMCA 2W79A 3CM4A 4JTUA 1DKWA 3MP3A 4JTHA 2QJIA 1EA0A 3SECA 5CPOA 3L5AA 4BI7A 4I7UA 2YX0A 1UB3A 1T96A 2DP3A 3LCWA 3S1VA 1H62A 5D2XA 1ADOA 1CX9A 3EX4A 3DENA 1G69A 3S42A 1HO4A 2ABBA 1SSGA 2GVJA 1KFBA 3L9CA 1O94A 3PBWA 3BG3A 3WK2A 4WOZA 4AH7A 3HGOA 1B57A 3LI1A 3LI0A 4K37A 4BK9A 1D9EA 3GAYA 4UIOA 3M9YA 5KZMA 1FWRA 1K8YA 2C16A 3TAKA 4S2BA 4TR9A 5LNWA 2RDUA 1ZAHA 5G4WA 5IBXA 3G3MA 3NR0A 3W88A 5LKYA 4GXMA 4FNRA 3TV8A 3W76A 1YTKA 4NXKA 3W7HA 5CG7A 3ABQA 5D09A 4UR8A 3NM1A 1VLWA 2J6XA 5K7JA 3W23A 1TTJA 2EF9A 3NL6A 5LGXA 2NV2A 4IGHA 5A8GA 5K9DA 2ISVA 3WJZA 3HGJA 3PY2A 1O5XA 2ZRUA 1LOLA 4YCPA 2ABAA 4JTLA 3PC0A 1X1ZA 4Y9AA 4WXZA 4RR4A 3GXPA 1KFKA 3W7CA 1RQBA 2X1RA 2ZZ6A 1XI3A 3LLDA 5G2WA 3K30A 4MFEA 1KW1A 3TK7A 3HG2A 4EF9A 1SW7A 3KVLA 2YXGA 2CLHA 4O50A 2JK2A 4ZQRA 3MUXA 2FB3A 2WKJA 3W3OA 4POCA 1TPC1 4JDYA 4WD0A 2C13A 1RV8A 4CCEA 1KM6A 3PR2A 3L0KA 3QW3A 4QAIA 3LB0A 5LZLA 3W1PA 4JTJA 1WOBA 4YCOA 2QCNA 4ORMA 5D37A 5A5WA 3DFOA 1OYAA 4L4MA 5C5YA 1XBYA 3NYZA 1OHLA 2B7NA 4AVFA 5AYZA 1TRDA 3QMTA 1HO1A 4OE7A 6ALDA 1KM2A 3UZ5A 1H1ZA 4AEOA 1SFJA 2WNQA 4MPQA 1GYNA 1OFBA 2JBMA 1Y0EA 3KRUA 4GUFA 3QSTA 3TQVA 3GDLA 2FDSA 1EP1A 2V2CA 2FLIA 1AG1O 4IMDA 3KXQA 3EKLA 3G24A 2E1DA 4JTGA 4OT7A 2A4AA 2DZPA 3RU6A 3T4CA 4O52A 2NZLA 3R12A 1GT8A 3P61A 4CNNA 4PA8A 4Z08A 4IWWA 3NQCA 3HB9A 3UNDA 1KM3A 4UTKA 3E12A 5BW6A 2HTMA 3GK0A 1OFAA 1SFLA 2QCEA 3NO5A 3P81A 4RZ6A 1KTCA 3DFSA 4HNVA 5EL1A 4P2VA 1SW0A 1XDLA 3EX1A 1L2UA 2CZ5A 4K8EA 1EEPA 3RLUA 5DCDA 2CLFA 3LHTA 5HR6A 1SZFA 4QIUA 4X22A 3VI2A 2Y7EA 1KM4A 5C54A 1XM3A 4M6VA 4GJ1A 1K7FA 5FF7A 2AGKA 4LWWA 2KZHA 5KINA 3RNDA 1WDWA 3LHWA 3M5XA 1UASA 2CZFA 5HINA 1QWGA 1DV7A 4U4MA 3NQMA 4OGZA 3LCIA 5CPLA 4GE8A 4NXSA 2QDGA 2NLIA 1I2PA 4NNAA 3IIXA 3P74A 2FFCA 1K02A 4B5NA 1G4SA 3LBMA 4R33A 3LOTA 1FDYA 1RPXA 3P80A 3BW4A 1T8XA 1Q6RA 1OK4A 4DF1A 3ZFHA 3PBYA 4A29A 3OVQA 5F1UA 1HG3A 1SSDA 1DJNA 5AHMA 5C6MA 2C14A 3CHVA 5LHFA 3O1NA 1OABA 2E6FA 1AMKA 5AB3A 4JY8A 2ZTKA 4N4PA 3KFTA 3E0IA 1M7PA 4S2CA 3W7EA 3LBCA 5CZ0A 1LTDA 1YLVA 3W1RA 2QCFA 4FNPA 1QPQA 1PHQA 3TMQA 4CQAA 4XKYB 3NQVA 4OU1A 4CLMA 4BWLC 1KM0A 3TSDA 3NEVA 3ABRA 1LP6A 1TPVA 3BV4A 3L5LA 3W1UA 1QOPA 2Y88A 2ZZ7A 3EWXA 2H6RA 3FJ6A 1S3HA 3W9ZA 1H61A 3G1DA 5AYXA 5DY3A 2ZA3A 3VCRA 3UQNA 1GPWA 1EIXA 3UWQA 1P0KA 3L65A 2H8ZA 1WQ5A 2NWRA 3MI3A 3MBDA 1KLZA 1H50A 2CLEA 1B4EA 2QEZA 4BI5A 5KZEA 1VCVA 1VZWA 1MEHA 3L0NA 1S5WA 4AF0A
chains in the Genus database with same CATH superfamily
2A3LA 2R8WA 1YNYA 4KETA 3LG3A 1XLCA 3F1QA 3VE9A 4PL2A 4HNNA 4CD6A 3HURA 1S2TA 1TV3A 5HNUA 3SRHA 1XRVA 1EJTC 3ABSA 3M4HA 3C0SA 1QNRA 1G0CA 1C90A 3B0PA 1OG6A 4B92A 2EG6A 4O0ZA 1MNZA 7ODCA 4KERA 4OV4A 4HNUA 4JIHA 4N9CA 3PZNA 3ZM8A 3I7RA 3VX1A 4PULA 4XIAA 3W2KA 3W7GA 3B8DA 1TSIA 4IP4A 4R85A 3S6DA 1FWTA 5I3IA 4K1WA 4UFIA 3VOHA 3LXCA 3OQEA 2EEXA 5AYIA 2QAPA 2B0MA 1HJUA 4L1GA 3H23A 3WD1A 2XGZA 3H6OA 1A5SA 1KKOA 3LX9A 2AL2B 2GGGA 4BCEA 3MY9A 4DBSA 1D3HA 5HNRA 1KXVA 4LVBA 3T6CA 1VC4A 1THFD 3M46A 3HZ3A 2HK0A 3PK7A 4N02A 3WLRA 1J18A 2XYLA 1WOAA 1BVWA 4JNMA 1OJXA 4NT0A 5HAOA 1SJCA 1UKSA 3VIIA 1H1NA 4LANA 4I9AA 3S2MA 1E6PA 4YHGA 5FEWA 3WJSA 2BOFX 4UFKA 2XH0A 1XH2A 1O66A 4OBRA 4HKPA 5HXMA 2GJPA 3W22A 4NU7A 1L6WA 2CWXA 3N25A 4E0CA 1E6SM 4UMCA 5C2CA 1W8SA 2OXNA 3TC6A 5CGMA 4NF7A 4ZBCA 2OEMA 1QI3A 2E5CA 3BAJA 3GNDA 3VK5A 2WC3A 4ZODA 4A2SA 1JF6A 4AIEA 3ITOA 3W7IA 2EPMX 3STCA 4Q6XA 3S5OA 4BKNA 5CKSA 4Z2HA 2WLYA 3PUOA 4AVOA 2WHMA 1PBGA 4E2VA 3LA4A 5HNNA 4OUIA 3RXZA 3KBJA 4IP7A 1XKJA 2B4GA 4IIFA 4UTTA 2OZ8A 5M2FX 3GG8A 4L61A 1SJAA 3VNJA 3ARRA 4PTNA 1UR3M 4TTUA 2QUNA 2O4MA 3OZMA 2J9YA 3FX4A 5I02A 3APTA 3B8SA 2J47A 4WCJA 2D0FA 3OO2A 3V5FA 2FJUB 4JQ3A 3GG1A 5FESA 3CPUA 1KGUA 4JN6A 3TQKA 4NJHA 2NW0A 3B9NA 3GE7A 1YDNA 1T99A 1GJWA 2BLEA 1GKQA 2O9OA 4LAZA 1Q7MA 4MY1A 1I2NA 1C9WA 4LW7A 4AD4A 4AMAA 1QVBA 1B54A 1ZB5A 3ID7A 4ZB2A 4W9TA 4FXSA 3VPLA 2Z1BA 1HX0A 3CQKA 1CTNA 3WJWA 4GXWA 2H9AA 2F6XA 4DPQA 3V0TA 4LCSA 3V3WA 2NQ9A 4V27A 2EPHA 4F48A 5KEZA 5HJLA 3C2EA 2DZTA 3CV1A 5FL0A 3NQ2A 3A24A 5IDIA 3VC5A 1JDDA 1GZ1A 1RBOB 1DHKA 1TPDA 3MW7A 4QGCA 1WUFA 3L21A 3N2XA 1DBTA 1MRAA 2OR2A 3P5YA 4H7ZA 4GH3A 1EA9C 3WBWA 4Z2JA 2V2DA 2OO6A 3WH8A 2AGTA 3EMZA 4K6AA 2E5DA 4HCDA 3PTKA 4HZ7A 3VTRA 2IKGA 4GKTA 5ABTA 1TJRA 2NLYA 5C9XA 2BGQA 2JALA 4TVDA 4Q8MA 3ABOA 2HK1A 5I09A 3RPDA 1QK0A 3DC0A 2NQZA 3B9OA 3FY1A 3JS3A 4LAKA 2E8YA 1XX1A 1V3MA 2G4JA 3CASA 2O56A 1BGAA 1ZPTA 2WHJA 3KBMA 4O11A 3NL5A 1TX0A 3RCYA 1W1YA 2QCGA 1ODUA 2XUCA 4FIQA 3L4VA 5CC6A 3AS0A 6REQA 4JX6A 3VMNA 5FJPA 3CQ0A 3QW4B 4LV4A 1DXFA 1JPHA 2IQ0A 1JCMP 1JAEA 3NAVA 4TU1A 2F8QA 7TAAA 4P8WA 1I4NA 3QPEA 1HJWA 3CUXA 4EANA 4OOZA 1OF8A 3MV01 1ZSXA 3P5ZA 2PTXA 1QPRA 4DYJA 3PN8A 1M03A 1TA3A 3THDA 3S1WA 1Q4NX 3CAVA 5BZAA 1LUCA 4MOZA 4G1KA 3QH2A 3DKJA 3ES7A 4S3CA 3WK3A 3TVAA 2DZVA 1H60A 4YWSA 2VGIA 2JKPA 3LYEA 2H3DA 3PZQA 4H1ZA 4J3XA 4HPGA 5ABEA 1YXCA 3W1LA 1EJ7L 2E4TA 3IJDA 6A3HA 2UY3A 1UZHA 2R24A 3T05A 4J2MA 3AHXA 1RP8A 1YDVA 1W5PA 4H01A 2VFFA 3VAVA 1V51A 4UTHA 1LL4A 4NILA 5A1AA 3KTCA 3EA2A 3O6AA 5A6MA 3PM6A 4GCAA 1DP0A 4U31A 3FYYA 4IZGA 1OFDA 1Q6CA 3N29A 3LZ5A 5H91A 3DYPA 3H2EA 2V5BA 2G8ZA 5A8OA 2J88A 3SCQA 1LBMA 4GI4A 4W93A 1VR6A 5DRCA 1P5BA 1D7FA 3U57A 5ECUA 1JUKA 2NX1A 3W28A 2FH8A 5AN7A 1PZ1A 2A2IA 5FAGA 4IMFA 2E3ZA 8CGTA 3O0KA 3P2VA 3UXDA 3LLFA 2Z6IA 3BL3A 2V5JA 4XD6A 7TIMA 1SVDA 1V0MA 3FA5A 4GYJA 4IQDA 3O7UA 3DGRA 1JZ2A 4LB3A 3R0DA 2GFTA 3SCOA 1VAHA 4GABA 3WLNA 4JFSA 1IR2A 3OLDA 4IGNA 3NQAA 5D4YA 1H63A 4W8AA 1QASA 1DQXA 4C6FA 2PDPA 5F2IA 1DWGM 2HV5A 5FIPA 1J2WA 3U2EA 4J35A 4FLQA 4IX2A 1FKXA 3RPMA 4WQ6A 2VI0A 4ZOCA 2ZUNA 4MVAA 1W3TA 1O5QA 2NVCA 2BP1A 2ZTJA 3EXSA 5BRPA 1H7XA 3LNPA 5ABFB 2OYLA 3WMSA 4GA8A 3QXBA 4L9YA 4DJDC 4Z1YA 2ATMA 1JCTA 1IXNA 3I10A 4OQVA 4YPJA 3KLLA 3ARWA 3KL0A 1FXPA 1BLIA 4FALA 3TYAA 6REQB 1VPQA 1C91A 2VP8A 3AMKA 3DHPA 4MJMA 1ME7A 2FZ9A 2ZX8A 3LS9A 4OFCA 3S5YA 3EDJA 3CAKA 4O28A 2HQAA 4H3DA 3H7VA 2ACQA 5ABHA 3UCCA 3CPGA 1F5ZA 4CQCA 4TV6A 4NUWA 2HRWA 4MIMA 3UWEA 1S5TA 4KEMA 2E6AA 3VIHA 3BQ5A 1M6JA 5FF3A 1RR2A 4HP5A 1JQXA 2Y7GA 3QN3A 4S1FA 1UA7A 4FX6M 1C8QA 3WO8A 4Z2IA 1XLMA 5I3FA 1RLDA 3LENA 1POJA 1XH1A 2D3LA 2TRSA 4LBRA 4PMQA 2RDXA 3G8EA 1SZEA 3VIGA 2DSKA 4BY3A 5BMXA 4QTGA 1D8WA 1GOXA 1XGZA 1ZCOA 4N9BA 4KWSA 3MYOA 4O4VA 4ZOEA 5E70A 1S5NA 4OV9A 3W7PA 2UV8G 1MW1A 4LGXA 1FWFC 2D0HA 3FDGA 2ZA1A 1E4IA 1EO5A 3BCDA 1XFBA 1TVLA 4ZMGA 5EBUA 3G0XA 2P88A 2ZRWA 5AC5A 1GORA 2YBTA 1GW1A 4IQLA 3PZGA 3RAOA 3USBA 5I77A 4Y90A 5A2CA 1GONA 3WEMA 4PCNA 4YXGA 3F2BA 3F4CA 4V33A 4ZVJA 1EXBA 5DBUA 4LUIA 3ITVA 5A8PA 5K9XA 1E73M 1CGUA 3LCGA 1F8IA 1CDGA 1KLYA 5EMJA 2PLKA 4CNUA 5AOUA 2GJXA 2Q8ZA 3VUPA 3LHYA 5DMMA 4MG4A 2VJXA 4XZNX 1UPMB 1ZL1A 5BU6A 2WWCA 4FR1A 2GUYA 3TR2A 1X6UA 1X7FA 1EP2A 1PIIA 3EKZA 3SSZA 4NZ1A 4FO4A 3VDCA 4DPPA 3QOMA 1WKEA 3WBXA 5EMMA 4R9XA 4E8GA 2RGLA 1R5YA 2POTA 1WAWA 2ATSA 1F8MA 4JTKA 4ZE4A 2DPEA 4TX6A 3SCSA 3B0YA 3DX5A 1QNVA 1OZMA 3GXMA 5EU9A 3BLDA 3OB8A 4H7VA 2WNWA 2GQ8A 3PFRA 4NASA 4MZ1A 2F6KA 1UQYA 3BVJA 1EBGA 2QCCA 3UZZA 2R91A 3OBEA 3GU2A 1M7JA 4E8DA 1YEYA 4PB3A 4PUNA 2WJFA 1X8CA 1K7EA 1B31A 1GKRA 4X2RA 3THUA 2A5HA 4ENLA 5LA1A 4UMBA 3MUZ1 3Q94A 1HTIA 2XIQA 5AHEA 1K8CA 3SZ8A 2B7OA 5E0KA 5CBBA 1TWDA 4GACA 3XIMA 4QBXA 2EHHA 3QY6A 4Y8FA 1XRFA 2BX7A 3GVVA 4DB7A 4RX0A 3WLKX 8TIMA 5HBFA 5AZ1A 3QTPA 3B0UX 5TQLA 4DI8A 3LPGA 4NAEB 2QCMA 4PMDA 1FWAC 5E5CA 2E68A 2XTKA 5FKYA 3RYSA 2DZBA 4WF7A 3C8FA 1C8YA 4BA0A 5HA7A 4HNTA 3GZAA 1WBJA 3C8NA 1Q6LA 2Y2WA 1BF2A 1UWTA 4ROQA 1HKIA 3AIWA 4PUKA 1TFVA 2I9UA 2WSPA 3N4AA 1KFCA 1AH0A 4YU1A 2FFIA 4FS9A 3GXIA 1E15A 4AD5A 1F7BA 3D3AA 3D47A 1VBJA 1I2RA 2WC7A 5HPCA 2I5GA 3P14A 4NI3A 2B7QA 1PB0A 2C0AA 2XSXA 1LL7A 1M7OA 1DJIA 4P61A 1SJBA 4J9JA 3NTYA 5EMUA 3LCFA 4F40A 4GIEA 2X41A 3NPWA 2VEGA 1SR0A 1DWFM 1J01A 4EACA 3EKGA 3K4DA 3CEPA 5TF0A 3UG3A 2LLEA 4KRUA 2W27A 3ELFA 4XD3A 4MAVA 2W91A 5E9XA 3M0LA 1XLIA 4AEEA 2WZEA 5FEZA 4Q33A 3VGEA 3BJSA 5RUBA 3N2CA 3PBVA 5FCZA 1OX4B 2C6QA 3UZYA 1FWWA 4QG8A 3LSCA 3VIFA 4MUPA 3M0XA 3L67A 2Z1WA 3H53A 3G1FA 3F2DA 5EBAA 2WOQA 4O10A 4XZWA 4EOUA 1WDDA 4DXVA 1FDJA 2F61A 4HGXA 1BXNA 1WDRA 4L56A 3FVDA 3SCVA 5D2WA 1YDOA 4CD8A 4UTWC 1Z32X 2YCIX 3I7SA 1XINA 2ZRYA 1M5WA 4HMEA 2C18A 3WDRA 1YW1A 2DV0A 2X0YA 1B1YA 2UBPC 4ZSUA 4L4PA 4S3KA 1HIZA 1ITCA 1JDFA 2XZ7A 3TW9A 4QQ3A 3WJXA 2DIEA 3MUIA 1O68A 3S1GA 1IZCA 1C9DA 1F3XA 3FJ4A 1DIKA 4HD5A 1PVNA 3GNPA 4XZMX 2P0IA 4MHBA 3W1MA 4INFA 1ESWA 1R3TA 4XTIA 4O57A 1YPIA 2PDMA 1PL9A 2VCAA 5T8GA 1UP2A 1VFSA 5EYWA 4GUIA 2ISWA 1QHZA 3IIZA 5DFAA 1R2SA 2MUCA 1FP8A 4TMBA 1QNOA 1KNWA 4RCXA 1DTNA 4UB9A 1ISVA 1XIGA 3UPWA 3OLEA 4YL2A 4IJBA 4ZQOA 3W7NA 3OPSA 4LS2A 5HWMA 4QCEA 4KEZA 1JPDX 4KT2A 1QI2A 5AC7A 4JYEA 4XKYA 1QU4A 1OINA 3SAZA 3PB2A 4JFUA 2WZHA 2CESA 2V3EA 2GSHA 1NOUA 2IUZA 4PGLA 2WO5A 1F4HA 2GVGA 3NWRA 3W81A 1YHTA 3PPFA 1TQXA 1RH9A 4G56A 1H0IA 2JIWA 1EOMA 3M5YA 5D04C 2ZZ4A 5CAHA 3RRXA 4B4FA 2PDUA 3GDKA 1MEIA 1XRTA 3DERA 4AFYA 3IJ9A 5HUOA 1CI1A 4QROA 1FH8A 3E49A 1LBLA 3HV8A 3OG3A 1W1B1 4OECA 4EF8A 2GJNA 3MC5A 1NQ6A 3ZLHA 2VR5A 3MZNA 4L65A 4A3HA 1S2WA 1P0DA 1VFHA 2DEPA 3RU8X 4B3LA 1I9CB 4MYXA 2X7VA 1XW8A 3FYPA 3SGZA 1US3A 3UZXA 1HNYA 1E5NA 3GVQA 2W3ZA 2IXUA 1XYLA 2CWNA 3C61A 1IYXA 3EX2A 3R89A 5D9MA 4YHEA 1EP3A 1OFPA 4YLWA 1ZJHA 5IOBA 1MZHA 5DCBA 5DELA 1H11A 3GTIA 2D20A 3W38A 2ALDA 1VEMA 3BLEA 1VFUA 4GQGA 1QNPA 4LVGA 3XINA 4N2YA 1XYAA 1QBBA 4XUGA 5D30A 1FHDA 3S8HA 2Z2BA 1FWBC 3QVQA 2IPJA 1EOKA 4IG2A 2XDFA 4HHHA 4N9DA 1BWKA 1NTHA 3VABA 4HOZA 4I5UA 3WX7A 4FNTA 3SQLA 1IXOA 2YFOA 3TCEA 2EBNA 4NVTA 5AECA 3KCLA 1QO5A 3E2RA 3UR7A 2ZDSA 2EKCA 3HG5A 4D1IA 4Q8PA 3APYA 3I7QA 3TIMA 3MP4A 3ALFA 1RQHA 3JVAA 3EAUA 4H8UA 3CC1A 1GQNA 2WCAA 3H2MA 2YL9A 3UWVA 4JQAA 4X9YA 1Q6DA 4J28A 3OOQA 2HS6A 2V3GA 3LNMA 3T09A 5FI8A 4KCWA 2CBIA 1UZ1A 4W5ZA 5G4HC 3M44A 1E1CA 4JEQA 2I57A 4H04A 4KCTA 2O9TA 1TJ0A 2X1IA 3OBAA 4C6DA 1AJZA 1EJWC 2VVSA 3FHQA 1XLBA 3CV2A 3TJ4A 4PE8A 4O12A 4Q7NA 2ZRVA 3GSMA 4DWSB 3GDRA 2YL6A 1A5OC 4YMZA 3MDUA 4WY0F 4GXPA 3ANVA 2QCDB 3S83A 4AX7A 4LV9A 4EWND 5E1QA 3TTQA 3F4NA 4M80A 1L2QA 1R3WA 1P48A 3QLLA 1VH7A 1BRLA 4AZ7A 1OK6A 1Q4WA 3CL8A 2RUSA 2YDQA 3TFCA 3GUWA 4PCFA 5LA2A 1NFGA 4WJEA 1K6WA 4AZIA 1QI5A 1C3FA 3AUOA 1M3UA 1EX5A 1XKYA 1LG1A 1PUDA 3PBGA 2ISFA 3IVSA 3U2ZA 3TLQA 1EHAA 5D2VA 4BS0A 2PZNA 1UQZA 5DX7A 4ADUA 4B16A 5HNTA 1UD8A 1G7VA 1XP3A 3ZZ1A 4GO8A 2OWCA 1GK8A 1E3XA 2REQA 3CIXA 4XIMA 5J5DA 2G50A 5HQLA 1AK5A 2B31A 4HU4A 1UH4A 3KBWA 3ONBA 4HOXA 3AMLA 1W5QA 1RD5A 3QY7A 3NQDA 1KGXA 3WQCA 4NY2A 1V08A 1ISZA 3TCSA 3CO8A 1NWRA 2P3ZA 1UR1A 4PMUA 4GGBA 2OLSA 3GFYA 4KIRA 4C91A 3PUGA 1OYBA 3S0CA 1VHNA 5A6TC 4JIPA 1EZWA 4XK2A 1JI2A 2VURA 1SZGA 4BF9A 3CHCA 1FWDC 5C2XA 3LMZA 1TB3A 4F0MA 2TYSA 1EJXC 3TJIA 1EBHA 2BZNA 1HKMA 2BXVA 3R43A 4GFIA 4P8UA 5K2ZA 3ARXA 4DRSA 1E71M 4DY1A 3TYUA 4AAJA 3M41A 4O1DA 5I79A 2VD9A 4C6OA 3OA5A 5E6YA 4F9DA 4RPPA 1OVDA 2O0TA 1XV8A 3VDGA 2QGYA 3V0UA 2ZDRA 1NWUA 3UY7A 4W89A 1FHUA 2X1SA 3R13A 1NM9A 1ISWA 1GQIA 4LX4A 2X42A 4XD5A 1VFMA 4CVWA 2PBGA 4LRSA 3WLMA 2V3FA 3A9IA 1O6IA 2AMXA 3A3HA 5F4WA 3AISA 2Z1KA 2ZIDA 4G2DA 1OCNA 2Y63A 3IJ8A 2PWGA 4CU6A 3B0VC 2NXIA 2PWVA 4TQTA 1OGSA 4I6KA 4AZBA 4CQ8A 1GVSA 4IMCA 2W79A 1NP0A 2PDJA 3M0KA 4JTHA 2P53A 4DLFA 1EKOA 4D6JA 5CEWA 5CPOA 4I7UA 3TYBA 1MVYA 1UB3A 1UYQA 3R1ZA 3S1VA 1H62A 4E3TA 3ZVIA 1Y5WA 2GVJA 3L9CA 1O94A 3PBWA 1JFXA 3ERPA 4J4KA 1TA3B 4UIOA 2JFEX 1UWAA 1E40A 5LNWA 4MWAB 2FMOA 2RDUA 1ZAHA 1QATA 5TNVA 3ENLA 4GXMA 3W76A 1UD3A 3ABQA 4HMDA 1VLWA 3ITXA 3RITA 4EXBA 1TTJA 4JIRA 3NZGA 4H9ZA 3N9KA 1H3GA 4HB7A 5K9DA 3L4UA 3RJYA 5C9WA 3UR5A 1X1ZA 6ENLA 4WXZA 5M3WA 1TWZA 2ALRA 1K1DA 1KFKA 4YS1A 1DYSA 3TYEA 1JZ4A 4EF9A 2I17A 4B4HA 2WKJA 2PMQA 4JDYA 3NO3A 3PR2A 3B8UA 3L0KA 4QAIA 3AIVA 4F4RA 1NU5A 1BVZA 1VIZA 4D6GA 2PODA 3VFCA 5C5YA 4IQEA 4WDWA 3NYZA 4HNCA 2QJMA 2EPOA 1R3SA 1SFTA 2G3FA 4L9XA 1EL3A 2YL8A 4AD0A 3C2YA 1H1ZA 3KOWA 3OTRA 1GYNA 2GWNA 2OEJA 1R38A 1Y0EA 1ISYA 3QSTA 3TQVA 4C7GA 5IFPA 2V2CA 2FLIA 2X09A 4GZJA 1YNPA 4JTGA 2A4AA 1X7IA 2GDVA 1UIOA 1GQLA 3R12A 1GT8A 3BSHA 3F7JA 5I24A 3W27A 3EOUA 1J9YA 1KM3A 4WDUA 4Q4MA 3PTDA 3NO5A 2J7FA 1KTCA 5EL1A 4MB4A 4YVVA 1L2UA 5FJRA 7PTDA 1MQPA 5DCDA 2GSEA 4IT1A 2CYGA 1WKFA 4X22A 4C1NA 4KIEA 1W32A 5C54A 4GJ1A 3SB0A 5FF7A 2AGKA 2HBXA 3DG3A 3M5XA 2OTDA 1DV7A 1LLOA 4RDZA 1OCBA 2IQDA 1KCXA 4GE8A 1OC7A 4NNAA 2C1GA 4FLOA 2G41A 4R33A 2D2OA 5CSUA 2ZXQA 3P80A 1CCWB 3OGSA 3UXKA 1S38A 1AQMA 4MNJA 1Q6RA 2OKTA 3ICJA 1X97A 4PMOA 4WJ8A 1SGJA 1TIWA 4A29A 3TN6A 2XIOA 5F1UA 1HL9A 3B9AA 2C14A 3CHVA 3WLJA 1OABA 1KRCC 3SRFA 3DDMA 5LXEA 3UFYA 1AMKA 3WDHA 1K4HA 4I8YA 3KFTA 4N4PA 4KMQA 1M7PA 3ZXWA 3LBCA 3MV11 3DG7A 2FH6A 2VQUA 1VEOA 5I7GA 1VJSA 5KETA 2PDKA 2QCFA 4FNPA 3EBVA 1A5MC 2OQLA 2BOGX 4OU1A 3TSDA 4F3HA 2Z4GA 1W9DM 4WR3A 1BQGA 1TPVA 4S23A 1M9HA 3IUIA 2CERA 2WZIA 2H6RA 1S3HA 1XYCA 2PU0A 3SN0A 5DY3A 2ZA3A 1VFOA 4DAIA 3GHRA 3UWQA 2VHLA 5BXRA 1Z9AA 2NWRA 1KLZA 4BI5A 1MEHA 1E43A 1A0DA 4P5UA 1A5CA 3K4AA 2ZX7A 3TJXA 4YTSA 3OGRA 1CPUA 1W1PA 1TQJA 2CEQA 3DKLA 2I16A 4DUOA 3DFNA 4JYDA 1GOQA 2QPSA 1O1HA 1X8FA 4IMAA 4LAMA 4UNLA 1UP3A 2OYMA 2YIHA 4WXYA 5BWFA 3DGBA 4DF0A 1C8XA 4QE4A 3W7KA 3W07A 1XLHA 4O0QA 3W1AA 1F6PA 2ZZ5A 4UR7A 5D8ZA 3KZSA 2DVTA 3A3XA 5TAOA 4RKAA 1JNEA 1MEWA 1XLLA 4HYRA 4QSFA 1FWGC 2VQTA 2D2GA 1IIGA 1XXXA 3GB6A 3HMCA 3TN4A 3F5LA 4M3PA 3S1UA 3HGSA 2XG9A 1S5MA 1JCLA 2OYKA 2VEMA 1POKA 3UA3A 3PAJA 3CTLA 2VFHA 4LJ3A 4AIBA 2CPUA 3UCQA 3ZWSA 1W31A 3T7VA 5D9NA 5XIMA 2RDWA 5CZJA 3ZR6A 1A53A 1CENA 2RAGA 2VEFA 2DVXA 1UW9A 2JKEA 4PMJA 2FPYA 5M03A 3TYCA 3LXAA 4JIIX 3G3DA 1XCFA 2RJHA 1JZ5A 1FTXA 3EWBX 5SWUA 2QUTA 4WY0B 3A13A 2Y0FA 4BF7A 1XSJA 1DVJA 3GVRA 5TIMA 4GI8A 4DN1A 1J4EA 2Q8XA 1TJPA 3HJZA 2ZYFA 1YE4A 3IANA 5J04A 2D3NA 1M41A 5I3GA 1PEZA 1QFEA 3TWAA 3BH4A 1VF8A 1YNQA 5CGTA 4JYFA 4M5PA 3FGCA 2R94A 1OGBA 4IP5A 3UCDA 4QSHA 1A5KC 5G1YA 1SO5A 1PDYA 1QHOA 2GGHA 3SIMA 3W01A 1EJUC 4R7JA 2FTYA 2VCCA 2WBKA 4JNZA 4N6EA 1WZMA 1RZMA 2OLAA 4XTDA 1B4KA 3S9ZA 3M47A 4LOCA 1N82A 3WH7A 3CV7A 3G1RA 4JGDA 3U2OA 5JH1A 2R1PA 4ZOBA 3R5EA 4OWGA 1OG0A 4RZ5A 3HOJA 4PCSA 1AL7A 2ADAA 3CHEA 4Q32A 3NPUA 5DO8A 3H4GA 5FF4A 4ZXOA 3SGUA 1E1FA 5I07A 3VKKA 4RXGA 1ZQ5A 4MYAA 3EWZA 1C93A 3BURA 1WE5A 3LHVA 3WD3A 5TBOA 3NXLA 4AHPA 3FIGA 4Q4KA 3W74A 3ZR5A 3AROA 3OP2A 2DJXA 1XIIA 4A2RA 4C6NA 1V3LA 2OT1A 1J12A 3KOYA 4QLKA 4W8LA 2DQWA 1S2AA 4JZ5A 4JHZA 4O16A 3HTWA 5BRQA 1UKQA 3G77A 3SUWA 5AC8A 1NAL1 3SRDA 3TTYA 5EA9A 1JCYA 5EMKA 4MY9A 2GQAA 1V3IA 2WVVB 1GOIA 2HVOA 4LU0A 2RFGA 2RDTA 1VHCA 3EMQA 2HISA 3VMPA 4UQAA 1EPVA 2GOKA 3RCNA 4TO8A 2BVDA 2RH9A 5IRPA 3IRDA 3BC9A 3WD2A 2FGBA 4AF0B 3VINA 3EEGA 4QJ3B 4RDWA 3MCOA 4DO5A 4KFPA 4C6CA 1W1VA 3T2QA 4PODA 4H83A 2XGIA 4O54A 4UXDA 1RPKA 4C6PA 2XFYA 3LXBA 1BYCA 1ZNNA 3RX4A 4XO6A 1OY0A 1HZYA 3P60A 3W4RA 1S3TC 4O4WA 5MKGA 4CCDA 3BICA 2Y61A 1PYMA 4LUSB 2WSYA 5LNRA 1FY6A 4TX8A 4NZ4A 2AAMA 3PTMA 1K9FA 3KVMA 3SJ3A 1YTDA 3PUEA 1KFWA 4WDTA 3CQJA 1CGWA 4M1RA 1VIWA 2F84A 3MUCA 3STGA 2A85A 3MVIA 5A6BA 2J24A 2PLMA 3KS6A 3CHDA 1QPOA 3MI2A 4Y9MA 3WDQA 3O16A 3LUTA 1QMLA 1A4LA 1RVGA 1GJPA 4UZSA 3NQBA 1A5AA 4GGHA 4AEFA 1G6CA 4O15A 4WEVX 1FCQA 4W7UA 5I5RA 4ZOAA 1V6UA 1TPB1 1G4EA 3OEXA 5AVNA 5U4NA 2FJKA 1E0XA 5F2LA 2VFIA 2BG5A 3IV3A 4BJHA 1UD4A 1M65A 5K9CA 3AIQA 1HUVA 2MANA 2DZAA 2J9ZA 3AS1A 4HPJA 5DN1A 4US6A 2EJ1A 1FH7A 2DW6A 2PWEA 4HU0A 3CAWA 2QJHA 1WV2A 4UFLA 1P4CA 3AUJA 2XFRA 3WBAA 2OSYA 3MB9A 4REQA 2BGNE 3BOFA 1TR1A 5HMDA 4GISA 1HQTA 4V2XA 3N6JA 3FV9A 3O3RA 3LDVA 4HHPA 3LPFA 3WL1A 5F4SA 4C1KA 1W9PA 3CQHA 3I65A 2DZUA 3CXOA 8XIMA 9CGTA 1HGYA 2WAGA 3AWNA 3FYOA 2YLLA 2YFNA 1JZ3A 1QHPA 4QAWA 3MUAA 4YTTA 3QOKA 3EXRA 3GG0A 2TMDA 4ZO9A 3G2GA 4R7WA 4ACYA 3R6IA 4BQ5A 1F6KA 4PBFA 4M82A 4KPLA 4Y9NA 4HN8A 1A3XA 3U4AA 5F7UA 3W1TA 2O4QA 3ZSSA 3H70A 3WNKA 1AQHA 3EB3A 4UQBA 3IIVA 4LF1A 1E4MM 4XQ6A 2JKAA 2ZKMX 1VJIA 1NDZA 1TMQA 4PUUA 3PPHA 4Z2GA 4LB4A 4MB3A 1TCDA 2P0OA 3OYZA 4LVDA 3BTNA 3UU0A 1AQFA 2DUXA 2FPTA 3PG9A 5CZTA 1V0KA 3L66A 1O5RA 1JVNA 1UG6A 3S5NA 2CNCA 1BXBA 2YBUA 3R10A 5GPRA 2VC9A 2VYOA 2ZRXA 2QPUA 4ATWA 3NPXA 2QJGA 3GS6A 2X40A 3PG8A 5A3HA 3N73A 3AXHA 1XLEA 4C6JA 3C0LA 4E5TA 4DVOA 2EPKX 4JPGA 4DWSD 4LPCA 2VNCA 2XN1A 3BXWA 1JQVA 1UPPA 4LY4A 3OVRA 3CUGA 3QR3A 1GYLA 3CZLA 3DHFA 1V3HA 2D0GA 3G1XA 5JUVA 4AB4A 3AS2A 2WJZA 2XINA 3ARPA 3P0XA 3ZS4A 1ME9A 1MXDA 1NSJA 2A7PA 5BNKA 4P7QA 2VVNA 1US0A 1CXKA 2YW3A 3OA3A 1LZOA 1UWUA 3BLFA 1ECEA 1E6ZA 3STFA 2DUZA 3FLUA 3TOYA 1VB9A 2J7CA 1PZ3A 3GQYA 2WSRA 3QEZA 5M5DA 4Y8EA 1JFHA 4EPEC 3BPWA 3LM3A 4PTDA 2YA0A 4ATDA 1ONRA 1BWVA 5D8WA 5LHEA 5HR7A 2EXOA 1Z3NA 1K3UA 3W83A 1GTEA 3QHNA 3UZWA 1HGWA 4OUEA 5B80A 1EWDA 4Z2KA 1FQ0A 5JIPA 3APGA 2PD9A 3LY0A 2GUUA 1LM1A 3REQA 2WVTA 3T44A 3SY1A 1CYGA 3CTTA 1V02E 1GOOA 1DJZA 1PIGA 1JYXA 4M7TA 1Q13A 3HPXA 4ORIA 3N4FA 1ODZA 1P0NA 2H8XA 2IW0A 3UXAA 4NQ1A 1X39A 1XBVA 4OKDA 1V0NA 4HZ6A 2BMBA 1R9ZA 2HVNA 3GKAA 4RJEA 3VNKA 1UBPC 4LCQA 2CZEA 3GAKA 1XPYA 4JTRA 3UBPC 3LPOA 4OZOA 1L6SA 4X2PA 1DJHA 3GXFA 1E6RA 2YYTA 2QAFA 3BMVA 4U5KA 1KO0A 4GVHA 2BY0A 3SUUA 4QRNA 4Z1AA 2VRKA 4IM4A 4CQBA 3NOEA 3WY1A 4QNEA 3PWAA 2BTMA 3O63A 3ZYZA 1ZBCA 4GIYA 1PE1A 3ITYA 1G1YA 3G6LA 1IEQA 1ZLPA 2PLCA 4MWAE 1LWHA 1CLVA 5LNUA 1OT1A 1VRXA 2RGMA 3NOYA 1EYWA 1OX6A 3VM7A 4FPSA 1UHVA 2ODOA 3HJEA 3IUHA 1N7KA 4U3CA 1JXJA 2AOSA 4RK8A 4E4FA 3VGHA 3WQFA 2VGGA 1GWJA 4QITA 3B03A 2NQHA 1PXGA 2YZRA 1ISXA 3GO2A 1YXDA 3TQ0A 1NY1A 1JAKA 1BXCA 5I03A 1O60A 2VZUA 2Z00A 5ABFA 4C6KA 4JFWA 2JEQA 3LRMA 4QISA 3RHGA 4TIMA 4DJFC 3WFAA 4FLRA 4WSKA 3ARSA 2ACSA 3MPGA 4EIVA 3ANUA 4NZ3A 3NVTA 1J79A 2PRMA 3RIKA 4KGLA 3SM0A 1LORA 4CU7A 2ZUUA 1TCMA 4U2ZA 3RUBL 2WPBA 2VGFA 1FHLA 3E96A 3BAIA 3IIOA 4HBKA 2CW6A 4AWSA 2J9XA 1R8LA 1KXTA 3WCZA 4GVGA 4BEUA 4JTDA 4J3WA 5M1TA 4XO7A 1A50A 2QUMA 5FAJA 4GY1A 3K46A 1L6FA 1AW5A 4FF5A 3Q2DA 1PKYA 1I2OA 1UMLA 1K7XA 1OFRA 1MI3A 3QZAA 4KF1A 1HXJA 1IXQA 3NQEA 5D32A 4EPKA 1H7RA 3SY5A 2ZUVA 5AHFA 1TX2A 3W1QA 4O17A 1WXYA 4MF4A 4US5D 1WXZA 1XLFA 2PDNA 1HVXA 3VIKA 2GGJA 3I3EA 2I7GA 5A69A 3ZLGA 1CGVA 3TW7A 2JF6A 1R3QA 1KM1A 3MP5A 4F0LA 5DRIA 2ZVIA 2XWDA 1AZ2A 1XISA 3VVGA 1W2PA 1H7OA 4GIAA 1W17A 2ZXDA 4NAEA 1Y7VA 1LQAA 1SO4A 2ZE0A 2QXWA 4TOQA 3LPPA 2BDQA 2WMIA 4QJ1A 2BB0A 1VRDA 1QXLA 4LSBA 1SUXA 1JF5A 4XVEA 1BG9A 5J8LA 1FWHC 3NNTA 1U83A 3UG8A 1YBQA 4DBEA 4JY9A 2Z24A 3B8IA 1WKDA 1ZRQA 4AG0A 2CETA 2PEVA 4M6QA 5IXEA 1U1HA 2QT3A 1X6LA 4Z42C 2ZUTA 1HJSA 4GCXA 4HCHA 3OQ8A 4UQDA 4AQLA 4AW7A 3TYDA 3TTEA 3QPYA 2DSVA 4F66A 4AIUA 1OWQA 1XGDA 3Q58A 1XPGA 3SSJA 5AFDA 3QBUA 2QQ6A 2Y5SA 1IZJA 1XR2A 4HN4A 4TV5A 1EUNA 2Z29A 3O2LA 4F0KA 2EAWA 3PWIA 1SQ7A 2YB1A 2YBVA 3TAOA 2E6YA 4G5DA 2VOMA 3GIYA 4DEFA 4F8XA 3WLOA 1H7NA 1BD0A 5D03A 4ZCWA 4JTFA 4I90A 3FXGA 4S3GA 1JDEA 2CZDA 5A6KA 1BFNA 1I8JA 2H9AB 1XDMA 2KAUC 3EB2A 4A8LA 4G1NA 3STEA 4GZIA 3DFPA 2NUWA 2X8RA 1G5AA 2VC5A 3ARTA 4MDOA 3QLDA 5B7ZA 3MSGA 3WK1A 1XIJA 3WD0A 2WV8A 1XUZA 3WLQA 4GQRA 4PSPA 1OM0A 3R8GA 3WL0A 3N2TA 3S2LA 4DYEA 4HNLA 1B9ZA 3FA4A 3TZFA 1RAKA 3ZQ9A 2Y8VA 3M5VA 1ZJIA 2JIEA 5G2HA 4H6RA 1T41A 3VOCA 1JZ6A 1VP5A 5C9UA 4HZ8A 2R1KA 2FGLA 4XSMA 3A9BA 1FXQA 3FFSA 3CNYA 3QTGA 3WFZA 1KQZA 1CXHA 1TYGA 5I2UA 3TFXA 2E1WA 4DNMA 4DZHA 3BE7A 2VEPA 3WQDA 4EE9A 4WKFA 3VKAA 5LGZA 1V79A 4HIBA 3RFAA 4A21A 2ASHA 4LAUA 4IUOA 3URNA 1E6QM 2ISDA 1N8FA 3GNXA 1EXPA 1BGGA 3VNLA 3L0GA 3W2MA 3KDNA 1WBHA 1TMHA 5FL1A 4PFHA 1K8XA 2PP3A 1GZGA 4J5NA 3BQ6A 3TE9A 4MTVA 2Q71A 3EWUA 4GG9A 3FOKA 5D9PA 1YRRA 2Y89A 3WIJA 2JGYA 3LSBA 1Z41A 1SO3A 3B9DA 4HK7A 1HKWA 4AWUA 5H1WA 3L2IA 1LJYA 4GBUA 2Z28A 4JKMA 3CLWA 1VFLA 2FTWA 3AC0A 2IQTA 2J75A 3IEBA 2FB2A 1RA0A 3KX6A 1CLKA 3NQFA 3IGSA 1K8ZA 1OADA 4GLEA 3ITTA 3ZMRA 3TA6A 3DI0A 3OODA 3S1XA 1U5VA 4NNCA 3L7RA 3H22A 1UOKA 3B4YA 1TG7A 1LOSA 1UZDA 3VIPA 5HMFA 5I3HA 2PTYA 4JL2A 3W75A 4LC8A 5CPMA 1IE7C 3LGEA 4DO4A 4DYKA 3N14A 4AZCB 1ZP3A 2G95A 2X1UA 3MWAA 4JFTA 3ZT6A 3GH7A 3PFMA 2R9RA 1LBFA 4E38A 3UZJA 1UR9A 4O1BA 1J6PA 3CU2A 2XU2A 3UW6A 3BOLA 4XBKA 1UA3A 2J25A 1CEOA 5I3DA 5HDRA 1X1OA 1DJXA 4RLIA 3W53A 4I7WA 4DM1A 3HM7A 3THAA 4Q4RA 4Z0SA 4B9ZA 4O1CA 1XYBA 1GVQA 2Z1XA 5DT7A 2ZX5A 3EPMA 1ZUAX 3KBNA 2AL2A 4Y2WA 3TC3A 1BSLA 3NZQA 2CBJA 4J3UA 3LM7A 1Q85A 1UMYA 3LV6A 1TE1A 4UCGA 5A6JA 3TMLA 3IGUA 1J0HA 3MYPA 3CWHA 5EMLA 1UWSA 1IZKA 4D8AA 3URAA 2OWXA 1DE6A 3B04A 3TNBA 4CQDA 3LCXA 2IXVA 2SFPA 5I6SA 2V67A 4HA3A 2BHUA 5L6UA 1RK6A 4PTVA 2UY5A 3BARA 4Z0JA 1E5JA 4C1LA 5MHBA 4A05A 2BV9A 3LZ3A 5D2YA 2DQXA 3IIPA 3U4FA 3O05A 1DL3A 3MI6A 3EDDA 2QUUA 1YPFA 4YVPA 2PDGA 4YYFA 4Q3MA 1YIXA 3A22A 1XRSA 2F38A 5DF0A 2C19A 4LUSA 4B90A 2AQOA 2IKJA 2P3EA 4B5VA 4NZCA 2DT2A 1LCOA 1YTEA 2RHGA 1FUYA 5CLTA 5IHRA 2XVGA 5FSDC 3E5PA 1TV8A 5I00A 1CWYA 2OSXA 5JBEA 5IHSA 1A5LC 3M0IA 4HSOA 5DQPA 5JU6A 3QGAC 2A21A 2V5CA 5HJYA 4D6IA 1P6WA 4GYPC 2QDHA 3QZ6A 1J0JA 4IL2A 5IBXC 1P0BA 1RQEA 3WD4A 3WQEA 1S46A 5D02A 3MDWA 1LT8A 2BVYA 4EPBC 3QHMA 1UUOA 4B5TA 3UR8A 1RA5A 4B5UA 2CFFA 3AJXA 3WF3A 2KX9A 3VE7A 3M7WA 3FJNA 5CGQA 4Z1DA 2V81A 4GUJA 4I6VA 3W2NA 3L5MA 1QRQA 3EMCA 3SN4A 1ZHAA 4YYCA 3FSTA 3P6LA 3T42A 2C1HA 2GDUA 4PTWA 4LYQA 3URBA 3RM9A 4UC5A 1Q45A 3UVAA 1A47A 4LNYA 1NFBA 4RPQA 3UYCA 2E77A 5LSMA 3RMJA 4IIBA 2O92A 3L2MA 3I3DA 1VKFA 2WCGA 2DDXA 4R27A 3WF4A 5GJNA 3UG5A 3QYQA 5C0QA 1WNOA 5C70A 4DELA 4KCUA 4HVXA 4E2DA 4PEKA 2YB4A 1X96A 1J0YA 1OCJA 2WHKA 2ZX9A 5AYBA 1J0ZA 4ZE5A 3W00A 1DTUA 1VYSX 3JW7A 4DQWA 1T5AA 4FHAA 1NVMA 3G1HA 5DXYA 4Q7BA 1BYBA 4WKHA 1GEQA 5FD0A 2HXTA 3OW1A 1TUFA 1WUEA 4RXFA 3LLXA 4MKNA 1LRNA 1W1A1 1OFQA 3PAOA 1OX5A 3W70A 1LYXA 3CZEA 2OODA 5CSYA 1CBGA 1SZRA 1QCWA 2I1OA 4LS0A 2QUVA 3JZUA 5E09A 4Q7IA 4PBGA 4RNFA 1WX0A 3DBPA 1LG2A 3U48A 3H2NA 4XBSA 2ZX6A 1R9XA 2VX7A 3DAQA 3E5BA 3QM3A 3PS7A 3UETA 3ONCA 3A4XA 5CSRA 4JR5A 2QCDA 3WUFA 4PB5A 1R6WA 4B2DD 3HQPA 3NQ6A 2MNRA 5XIAA 3RMEA 4HPXA 3EA1A 3CUIA 3MANA 1V3KA 2YJQA 1DKWA 2C0HA 2HWGA 2WMFA 4UOZA 1I75A 1V77A 1EA0A 4AYGA 4BI7A 2XIBA 2PDFA 2ZUMA 2DP3A 5D2XA 3DN5A 3W0KA 3DENA 1E6XM 1E9ZB 1HO4A 3GC4A 2ABBA 3K4WA 3M07A 1K9DA 2WCSA 5ECVA 1FHVA 5A95A 3HGOA 4ACZB 1CGXA 4M1BA 4L64A 3U2CA 3LI1A 4BK9A 1P43A 2OGJA 1FWRA 1WP6A 1ZBVA 3H26A 3IACA 5FJTA 3AZRA 5A8MA 2GL5A 4FP1A 1F3EA 1K77A 3NR0A 1GOMA 3W88A 2B81A 4FOUA 4H19A 3F4DA 3TV8A 2GK1A 4NXKA 4GVFA 5CG7A 5D09A 4CD7A 5K7JA 5EFFA 2WKGA 3UG4A 3ZVHB 2EF9A 3N04A 1EDGA 3NL6A 1UP0A 1FFQA 5C8BB 4YTRA 3FN9A 4XB3A 5T9CE 3AU2A 1O5XA 3FSUA 4YCPA 2ABAA 2PGRA 3WN6A 5CAKA 5CQ1A 3MMDA 4RR4A 3IJ7A 1B3ZA 1O1ZA 4DX3A 5E0FA 3W7CA 2ZZ6A 3CZGA 1EGZA 3K30A 3WKZA 4MFEA 4WDXA 1J8VA 3TK7A 3MCMA 3U5UA 2YXGA 1QWKA 4CN4A 5A6AA 2JK2A 4ZQRA 4POCA 4N42A 3MWCA 2C13A 1BRLB 4CCEA 2YA1A 2VO5A 1KBBA 5LZLA 3W1PA 3SUVA 4JTJA 1WOBA 5CPTA 3VIOA 4WVXA 3ITLA 1MUCA 2INEA 5D37A 5A5WA 4PCTA 1AA1B 4PMZA 2F9RA 3GTXA 1OD8A 4A8RA 1TZZA 2E9LA 2B7NA 1SMDA 2BS9A 3QMTA 1HO1A 4DJFA 1KM2A 4CVUA 1SFJA 4MPQA 1OFBA 3UERA 3WLSA 1Z89A 4DUXA 4WJXA 4R5EA 1PX3A 2YKKA 3WMLA 1IWAA 3AIUA 2FDSA 3KXQA 1XYZA 3QV9A 4EXAA 1P0EA 3AXXA 2BVWA 4CNNA 2OELA 4Z08A 3NQCA 3HB9A 3UNDA 1GVYA 4UTKA 4LAOA 5BW6A 1RY8A 1ZGDA 3GK0A 1OFAA 3P81A 5HOSA 4L7ZA 3PP7A 1OSEA 4K1GA 3UT0A 1SW0A 2VOTA 2JQXA 2Z7GA 3P0WA 2CLFA 3LHTA 5HR6A 4ERAA 2V69A 1SZFA 4QIUA 2XIIA 2GLKA 2Y7EA 4DHGA 2CXEA 4H9YA 2DSZA 2YL5A 5KINA 3RNDA 4C6EA 1UASA 2CZFA 9XIAA 3VX0A 3WQ6A 4E3VA 3SN1A 4U4MA 3NQMA 2ANUA 3VD4A 3MT1A 2QDGA 5M17A 1I2PA 4MWAA 2XZ9A 3IIXA 2FFCA 3TZNA 4S38A 5LYRA 4DZIA 2PC8A 1RPXA 2VR4A 6XIMA 4LBSA 2OEKA 1T8XA 3CV6A 4H8HA 3VO0A 3D5HA 3MKVA 4O8AA 5BWAA 4DF1A 3PBYA 4IISA 2X2YA 1SSDA 3Q65A 4J40A 3GU1A 1PWMA 4ACZA 2E6FA 3R0KA 3DFHA 3LEPA 4HA4A 3REQB 2W63A 1NOWA 1RVKA 4S2CA 1CLXA 3GWQA 5CH9A 1MQQA 1V3JA 3CH9A 1LTDA 2HNHA 3TP4A 3E6EA 4OJYA 2J13A 3ABXA 4TVCA 3BOXA 4ZFCA 4CQAA 3NQVA 4CLMA 2YCKX 1KM0A 1YKWA 2ZWYA 2QHAA 2XJ7A 2OPJA 3FGCB 2QIWA 3W1UA 4Y9PA 4US5A 2Y88A 3EWXA 3FJ6A 1R3VA 3M7SA 4IGSA 4PCPA 4D6DA 1Y8BA 1P0KA 4H7CA 1N8WA 3PZIA 2C71A 3N13A 4H6QA 4V1XA 2CLEA 1H50A 1LUCB 3SDOA 1LQ0A 1NOFA 3ZT5A 2WK2A 4AF0A 1TWSA 1FBAA 2PRLA 4HQVA 1JYWA 2QKFA 3R8HA 4AD2A 1RJQA 4L4LA 4D71A 3K2GA 3AQUA 4P7NA 4YWIA 3VGDA 3R25A 3BGJA 3W25A 4D8LA 2XGBA 2I5QA 1FVPA 3WF2A 1IF2A 1J11A 1RCQA 1R3RA 4CNOA 1EPXA 4P7OA 1GHRA 1KFLA 3W7DA 3A23A 3FJLA 5AC6A 4MZYA 1FWSA 3TQPA 3V16A 4XV0A 3LQLA 3WQVA 3EX3A 2W66A 1VQTA 1TRIA 1F74A 1KM5A 2C8NA 3MMTA 3H54A 5DBTA 1XC4A 3K8LA 3HIJA 3N3TA 2OQHA 3RRAA 5JQ9A 3IGHX 2CLPA 1TV2A 1P6CA 4AVNA 3RPTA 5I3KA 4ADSA 2YLAA 1QAPA 3CT7A 4IX0A 3ITGA 4MKSA 1IT8A 5D05A 5KZ6A 3MHFA 4O13A 3EWYA 4IXXA 2GJRA 2QJJA 1HFBA 5F2GA 3T8QA 1VCGA 4G6CA 4ICNA 3N2BA 2X05A 2J74A 3W2LA 3EGJA 1B90A 1IGSA 4MDPA 1RJRA 1ELSA 1EUAA 4JOMA 2QDDA 3OVGA 1ML1A 3RDKA 2P8BA 2V82A 1MZRA 2PDIA 1JIBA 1XG3A 4PYSA 3UXIA 3THQA 3ZR4A 3BK0A 1QK2A 1ZJAA 3VD3A 4NNBA 5DY2A 4RDVA 1FCUA 2E9MA 4JTTA 2A7RA 3VIMA 1BTCA 4NAFA 3TH6A 5LNSA 3DESA 1HJVA 2BHZA 4BQ4A 4I7VA 3LGDA 5EPDA 3C2RA 3KCOA 4M0XA 4U2YA 5CPSA 3AWOA 5G1TA 3ZJ8A 1F3WA 3ORWA 2QR6A 3EDEA 4AZHA 3GLCA 1EJVC 3MA8A 4Q8NA 4QDWA 1FWIC 3WQGA 1BF6A 3W6LA 1EQCA 4PUJA 4GD0A 4PUMA 3OLGA 2F2HA 3CJPA 4C6BA 1REQB 3IK2A 1R30A 1ZALA 2I9EA 4MKVA 1XIEA 1R2RA 2V63A 1KCLA 2ZE3A 1U5JA 3JRKA 1CXFA 2PSNA 1V6WA 1U22A 4I5RA 2D73A 3AIRA 4DAFA 4D1JA 4I9TA 3S5SA 3TWBA 3ZIZA 3ZWTA 2P1FA 4ROPA 4GQBA 3PJUA 2J79A 3E2SA 3N3MA 1V03A 1JJKA 4Q4OA 4PN2A 2HS8A 3D6NA 1M68A 3NG3A 4JCMA 2E40A 3AHVA 4F79A 3UY8A 5B7YA 3OIHA 2YSWA 4NRSA 4J27A 1CXEA 1XD0A 3NQ7A 1K70A 1BAGA 4AU0A 3KBVA 2FQIA 4I9MA 3MKCA 3P8JA 1UKOA 4DBDA 1XLKA 1XBZA 1ZTVA 5H8UA 1J93A 4O8RA 3K5XA 3N2OA 1OX4A 1AVAA 1R3YA 2Y7DA 1OEPA 1A3HA 1WAUA 6CGTA 3LMYA 4JCLA 3K8MA 1KV8A 4O19A 3UWWA 2XSBA 2EO7A 1CXLA 4EVZA 1JCXA 1XDJA 4D6EA 4JIQA 1G9HA 2BASA 4KBXA 3V7PA 2PUZA 3L68A 2ZXBA 1B3XA 4GI6A 3GXTA 5KTLA 5H8PA 4C1NB 1TZ9A 1QI0A 1U30A 1JL8A 2YCLA 3H4XA 3W24A 1JZ8A 4B15A 4X63A 3NQ8A 3EOLA 1NIUA 2VTFA 1Z42A 1GG1A 1AJ2A 3A6OA 4H00A 4XX6A 3MCNA 4PSRA 1IXPA 4UUIA 3GTFA 1XL9A 1KC7A 1I45A 3DZ1A 3W26A 2A3CA 4G9PA 3BMWA 1KBLA 4UTFA 3N15A 2E8ZA 1VYRA 1NEYA 3PB0A 1O5KA 3AYSA 3MSRA 1B9BA 1EO7A 2PWHA 1Q2RA 3T0TA 4LRTA 4JN7A 3VDHA 1VS1A 2Q3OA 1DOSA 4NAFB 3WQOA 4DF2A 3W1XA 2X0HA 3BSMA 3QMRA 2P10A 2XWEA 3KRBA 4UTMA 1DEDA 1PCWA 1PZ2A 4QHRA 1PX4A 1Y5XA 3BMXA 3VGBA 3SJNA 1OD0A 4JTSA 2IPGA 1YX1A 3KP1A 4AIOA 5HWNA 4K38A 4AHOA 4XAZA 5C55A 5HUPA 4RNJA 3HN3A 3WQ8A 3M6DA 2BVTA 2GWGA 4Q4SA 4NYYA 1BHGA 3E0WA 1GVFA 3R2GA 4WLCA 3NDYA 2J4GA 5XINA 4N6FA 1PS9A 2C79A 1IR1A 3DEQA 1JCJA 1K6AA 3VFLA 3WH9A 4FX7A 1MMFA 1AD1A 3TXZA 3GIQA 2GPTA 2G37A 1CW2A 3ALGA 2HVMA 3PSWA 3HQNA 4LTSA 4RV8A 3UF9A 4Z1BA 4H9TA 1Q8JA 2FYMA 2HEJA 3M64A 4Q8UA 5AVHA 2GUBA 3MZ2A 4I5XA 2R1NA 2DT0A 3SCNA 5T91A 1H51A 4S3EA 4YTQA 1E9LA 4JX5A 4AISA 1ZCCA 1C8VA 3C4UA 4F2UA 4EP8C 2V30A 2QULA 5DANA 4LBUA 2JEPA 1T0OA 3AMCA 1EWEA 4JBRA 3M0YA 3KL3A 2HCVA 1FOBA 1DXIA 3OHIA 4KW2A 1PCKA 2XH7A 4JHMA 5D38A 4JL1A 1OQFA 1LRTA 1TUXA 4V15A 4XAFA 1UJPA 4HSNA 3NGFA 2BXZA 2A79A 2B7PA 4QXIA 2PDWA 3RM4A 1AMYA 4MB5A 3I3BA 3G1SA 1C7SA 1IEIA 3F5KA 2WQDA 1TVNA 3C3NA 3T55A 1Q3NA 3ZO9A 2OFJA 1J2BA 3H2FA 4C65A 4S3FA 4O1AA 1I1XA 3S6OA 2OOGA 4ZENA 3NZRA 2FVMA 1R7OA 4BHYA 3ES8A 3EXTA 2HE5A 2UY4A 4F0SA 1EC7A 4AD3A 3NJ3A 3AZTA 4BI6A 1F61A 3NDOA 2J78A 1ZBKA 3P8IA 1PKMA 2HJPA 2GVYA 1E1CB 3CIWA 3KEHA 4QFUA 4F0RA 2VRQA 3FA3A 4DM2A 3G1VA 1VJZA 1ZY9A 2PI6A 4GC4A 1W9BM 2QCHA 2XFFA 4KWWA 3TSMA 5FA5A 3TC7A 3VYLA 4H41A 1AQ0A 4TVUA 2FIQA 4TTGA 1ME8A 2Q09A 1BYDA 1W1ZA 4MPKA 4ZEPA 3A47A 2WZMA 2AQWA 5DCEA 4B5SA 4RE2A 2WMJA 3GZ3A 1HP4A 2Z27A 4AWTA 8RUCA 4A3UA 3LN3A 4U28A 1I6NA 4A22A 4LFYA 5GNZA 1SO6A 3FCPA 1I0BA 4BFAA 1DWHM 1JG9A 4JX4A 1LT7A 2OCZA 1KTNA 3IVUA 1FFRA 3KLKA 2TODA 4NYUA 1VLIA 4AWEA 1XLJA 1XD1A 2NT1A 4FX8A 4GKLA 2VFGA 4NRRA 3SW6A 3MKKA 4URIA 1TO3A 2V8ZA 2C15A 3QZEA 1MFVA 1UZ4A 3O6YX 2FHBA 2NT0A 4GY0A 2XN2A 1RUSA 5A8QA 3U7BA 1NQKA 3KDOA 1XGEA 4PTXA 1F76A 3CL6A 1DXEA 2VX4A 3P3BA 4KWUA 4ZQNA 5BMWA 1L8NA 2W62A 4HA1A 4O0KA 3VXGA 4WX2A 4KQNA 1N2VA 2Z2AA 1ADDA 3GDMA 4JTEA 3N18A 1QR7A 3WUBA 4CCZA 3TROA 1I0DA 2ZBTA 3EPOA 3KHDA 4FK9A 5GQBA 3SFWA 3G18A 1EJRC 1PTAA 4Z2LA 3B3DA 3OG2A 4IXHA 3UEQA 2XM2A 1FCVA 1KBJA 1QOQA 4WSHA 1TTQA 3RLGA 3W71A 1TV4A 1XJBA 1EC8A 1RXOB 1G7UA 1ZU8A 3GIPA 1PHWA 3NEHA 2FZMA 1QW8A 1JD9A 3IJQA 4MJZA 4X61A 1PIFA 3G0UA 4NZFA 5JH2A 4UTUA 1E72M 2GJXB 5GNYA 3CEUA 4DI9A 2QMKA 2VC7A 3TU9A 3LGGA 2I56A 3MSDA 2XVLA 1PPIA 4F2TA 3IV8A 2OWWA 2DW7A 2D22A 3MU7A 4XWUA 4WGHA 3NURA 2OVLA 3GYCA 5CCZA 1KD0A 4JKKA 3IS4A 4D72A 2Z25A 3HFYA 1E9IA 1RY0A 4D6FA 3NSMA 1GKPA 1HF6A 3UD6A 1LOQA 1E1EA 3ARQA 5A6SA 5H6HA 1XH0A 3O15A 3ZT7A 1MXSA 4LEQA 1IV8A 4GNVA 2WPGA 2INFA 5FOOA 4ICCX 1WDPA 2VD8A 2GOUA 2VRJA 5HMEA 3WMCA 4XISA 3S9YA 4C6MA 1GHSA 4LEFA 4XAGA 4WY0A 4DNHA 1G94A 1EYEA 4UTJA 2IKHA 4QQUA 4IFKB 4M56A 4FXRA 4NP7A 4AC7C 1Q7QA 2A0NA 4NG3A 1W3HA 3VNMA 1MW0A 1OC6A 4J1OA 2YW4A 3E3HA 4QS5A 2V9DA 5FEXA 1IHIA 1XC6A 3AIEA 1B0IA 5G2IA 1VPYA 3W85A 2FHCA 1R86A 1EHNA 1HJQA 4IIGA 1TR9A 3KAOA 5CC3A 4O18A 3WF0A 1C92A 6PTDA 3GXDA 2VUNA 1XWYA 3DFYA 3M0VA 2WSQA 2P8CA 4YTUA 2CITA 5A6LA 3TEVA 2DUAA 3P62A 4NSBA 5PTDA 1AW1A 1KWKA 2NVDA 2HMCA 3DC8A 3TONA 1JUEA 4QM1A 3CL7A 4XSLA 1XICA 4LS1A 4IL0A 1LWIA 1F73A 1YDYA 3AICA 2O7SA 2Q8LA 5IFTA 1U1JA