3OVPA

Crystal structure of hrpe
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
221
structure length
221
Chain Sequence
GCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Ribulose-phosphate 3-epimerase
publication title Conversion of D-ribulose 5-phosphate to D-xylulose 5-phosphate: new insights from structural and biochemical studies on human RPE
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2010-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ovpA00
4JDYA 3R89A 3C56A 5C5YA 1V7YA 2NUWA 5FF3A 3THAA 4XBKA 5H2ZA 2OCZA 5D2VA 1DKWA 2CLFA 3UY8A 4HNUA 3NM3A 2RDWA 3UXAA 2AQWA 3CHVA 1LLZA 1XBXA 4CQ8A 1L9WA 2CLMA 4DBEA 3OHIA 3LI1A 2Y7EA 4Z1AA 1FX6A 3BLIA 4MY8A 3UNDA 5KTLA 3LDVA 2Y7DA 4XUGA 3BG3A 3L2IA 1MXSA 2DJXA 3O8AA 2Y7FA 3T44A 1TREA 1S5VA 4O50A 4N02A 1JJKA 1W3NA 4ICNA 1SPQA 1Q45A 1GQNA 3M16A 3TROA 5CKSA 1GG0A 1JUEA 2ZZ5A 3S1UA 1VCVA 1X6UA 3SJ3A 4LVGA 1OFEA 2X1RA 1ZJIA 3ANYA 5F2LA 3T40A 2WJZA 1LM1A 5EY5A 1EA0A 2ZTJA 3PG8A 4BF9A 3THQA 4Q32A 3A21A 3LCHA 4K6AA 3LCLA 3N73A 4XBSA 1PV8A 1WAUA 3EWBX 4LUJA 3GXPA 3VNDA 3UD6A 2CLIA 5HINA 1C29A 3DKLA 1TSIA 2GJNA 4RZ4A 5FF7A 1OABA 2J88A 3ABOA 3MJYA 1AW2A 3NQCA 1PVNA 1RQHA 3G0XA 4IWWA 3EX6A 1WDWA 5D37A 3EWWA 4HT3A 5KITA 1OFAA 3GR7A 5K2ZA 4IX0A 3PUDA 2WSQA 4XKYB 4KKXA 4ZMGA 4RXGA 3L67A 4EOUA 1SU5A 4MYAA 4OT7A 1FUYA 1AG1O 4HNVA 4JIPA 1NSJA 4RKAA 5CG7A 3MW7A 1WBJA 4JN6A 4LS2A 2EPHA 1PS9A 4K8EA 1DQWA 3W1AA 1DL3A 1M6JA 2VFIA 3C61A 5CPOA 2V5LA 4RCXA 3STCA 3LCGA 1H7PA 4PTNA 4NQ1A 2ABBA 4XTDA 5I3JA 5C55A 1EUNA 1YPFA 3LI0A 3EWUA 3TX9A 5C54A 3A22A 3LRLA 3PULA 1G69A 3PM6A 3W2KA 4O13A 6TIMA 3C2EA 3E49A 4Z08A 2NWSA 3MUXA 1LRTA 3CIXA 1SZFA 3DHFA 3QRHA 1M7PA 3GB6A 3LV6A 3AO0A 2Y85A 4DXVA 1Q6RA 2QJIA 4S1FA 1F5ZA 4AH7A 4WZHA 1KM6A 4Z1CA 2HSAA 4H6KA 3T4CA 3FYOA 5D02A 3NOEA 2O7QA 5HNRA 2NWRA 1VCFA 3G1YA 3A9IA 5CPLA 3LOTA 1SO5A 3E0IA 2WKJA 4LS1A 3UWZA 2GVLA 4N9DA 3R8RA 5CGQA 2BX7A 1H7XA 2VFHA 2FPVA 2JKAA 1I2NA 3QMTA 4LRSA 1FBAA 4GWEA 1I45A 3K30A 4FXSA 1VRDA 2GVGA 3LERA 4JX4A 3GDRA 1LP6A 4FNRA 5G5IA 4IX2A 4C1KA 1TJRA 1B4EA 2CLLA 1WYIA 5DN1A 5SWUA 4YCOA 4CCEA 3DXIA 3WJZA 2TYSA 4DO5A 4AF0B 5T26A 3TE9A 2E6DA 4AF0A 5TQLA 5DXYA 5HWNA 3TJXA 3IIXA 3RLVA 3DFSA 2BWGA 1W37A 3W1RA 3BGJA 3R5EA 2E1DA 1I2RA 3FKRA 1XDLA 4OV9A 4FX7A 3TSDA 2NUYA 1WX0A 2GOUA 4TR9A 2CLKA 4YL2A 2HTMA 3M41A 4WXZA 4KWWA 4PL1A 3UWWA 3GDMA 5C2XA 5AHEA 2X16A 2O7SA 3TW7A 5DBUA 1ADOA 4OQVA 3DENA 1IXOA 1YXYA 3BO9A 4TX9A 1G4PA 1GVOA 1ZAHA 3G3MA 3W1MA 1Q6QA 1AW5A 4JEQA 3SY5A 3HGRA 3TSBA 1X8FA 1J5TA 2B7OA 3CPRA 4XQ6A 3SIZA 4HNNA 3NL3A 2FB2A 1SFLA 4UFLA 3CT7A 5FI8A 4J9JA 1HFBA 1TPWA 1VGAA 3HPXA 4NJJA 3O16A 2E5DA 2YCEA 4PODA 2XN0A 4DBDA 3W1UA 4OBTA 2C14A 1UB3A 4JTFA 2EHHA 4H4IA 1H51A 4LY8A 1SSDA 4ZVJA 1IF2A 4O0ZA 5LGZA 1P1XA 3EWZA 4WJEA 1RPXA 2E09A 4PC8A 3NXFA 3UWQA 3VE9A 1GOXA 3EKLA 2V9DA 1F76A 1A50A 1F2JA 2FFCA 3GXTA 4POCA 3M5VA 5FF4A 4K39A 4LS0A 3KAOA 1SZGA 1R46A 2YXGA 2ZZ6A 3G1AA 4LV9A 2Y6ZA 3DAQA 3IGXA 3L9CA 1TMHA 4LUIA 4NUWA 3FFSA 1DHPA 3C52A 2FB3A 4FNPA 3ATZA 3EX1A 3VCRA 4UTTC 3BPWA 3GYEA 2CZFA 4CNPA 1JCLA 4MJMA 2A7RA 3DFOA 5AYXA 4A3UA 5LHFA 4PFMA 1I2OA 3LRKA 4FEZA 4ZZ9A 2RFGA 2ZDRA 1G6CA 2CZEA 3UWVA 2V2DA 4ZL1A 1R2TA 1TV7A 4O17A 1SW3A 3LHTA 4GRSA 1QMLA 1XFBA 4RR4A 4RJEA 2X1UA 2DZPA 1RV8A 3PY2A 4E2BA 3N19B 2YFOA 3P7YA 3M0ZA 3NNTA 1NVMA 3LTPA 1LTDA 4NJHA 5LNVA 4WUIA 4BI7A 3NGJA 4U28A 5FEPA 4GBUA 3FLUA 5F4XA 3QW3A 3T78A 1AW1A 1EP2A 4HHPA 4GUHA 3BG5A 4PL2A 1LOSA 3BV4A 2ZA3A 1JCMP 4OHQA 2CLHA 5D2WA 4ORMA 1TB3A 5LNUA 3DFNA 1SR9A 1W0MA 5KINA 4M6PA 3ABSA 2DU2A 4AB4A 1GEQA 2YW4A 4FF7A 2YGYA 2J9ZA 3ATYA 4X3ZA 4M6VA 2JGQA 5KZEA 2GUUA 1DVJA 1QO5A 3DHDA 4HPJA 3W86A 1JCJA 3SR7A 4CLMA 4JR5A 2XN1A 3QC3A 2AGKA 2X1TA 3L21A 5K7JA 3C4UA 1FCBA 4JY8A 3BW4A 4FNUA 3W1NA 1A5AA 1ZAIA 2QAFA 5BW6A 2Q3OA 4O14A 1EWEA 4Z1DA 3G22A 5AYYA 5LNSA 2WOQA 5EYWA 1Z48A 2ISSA 5LZLA 5EPDA 4DF0A 5LGXA 2VEKA 3C2VA 4PA8A 1TCDA 4DO4A 3JRKA 3NQ6A 2DZWA 4M5PA 1HUVA 4RLIA 1GTEA 2TMDA 3NG3A 1OX4B 1YYAA 4K38A 2F84A 3TQ0A 1OX4A 4QSHA 1BKSA 1GYNA 1KM5A 2Y88A 3FOKA 3TMLA 3P8JA 4Q4KA 3NPUA 3TA6A 3W71A 3UZJA 1B9BA 3P84A 3G1VA 4IMFA 2P0OA 2C15A 2A4AA 1VHNA 1JQXA 2Q8ZA 3W73A 2E77A 3CWOX 4JXCA 4O1CA 5AHIA 2QCEA 3JR2A 1TYGA 1H63A 5AHNA 4EF9A 4P61A 1OF6A 1JUBA 3S5ZA 3G8EA 3EXSA 2QCGA 3PBWA 1GPWA 3WK0A 3HGJA 3QMSA 3M43A 1TQJA 3ABRA 1QDSA 1RR2A 1N55A 2JKPA 1RQBA 1I2PA 4A29A 3TNOA 5I3IA 3WK3A 4WXYA 3LXCA 3PG9A 4FIQA 1L2UA 4ZQNA 1FXQA 4B5NA 2Y7GA 1QCWA 4IMEA 5CZSA 1TTJA 4JTKA 4UTUA 2GQAA 1QOQA 3OG3A 3S5YA 5K3VA 1KM3A 1YXCA 2A5HA 4BR1A 3LHWA 3HMJG 1Z41A 4A2RA 4UMCA 1J4EA 4JTGA 2QUTA 2I9EA 2B0MA 1JRBA 4KFOA 5CSSA 4CQAA 4MZ1A 4M19A 1H7OA 4NU7A 2PCQA 3I7QA 3WJXA 5EL1A 2A7PA 1FCQA 4ZQRA 1WOAA 1C8VA 1DJQA 3YPIA 1K03A 3KRUA 1T96A 1MZHA 4JD4A 1VR6A 1KFJA 3LCWA 4JTIA 1ME7A 2A6NA 1VPXA 2NX1A 3W2MA 3ZFHA 1ME8A 3KXQA 1IGSA 4UMBA 4IJBA 4JTHA 3TFCA 1DV7A 3LX9A 3LBMA 4O10A 4MJZA 2Z6IA 2VEIA 2F7FA 3IVSA 2WNNA 2OZ0A 1THFD 4O19A 1LCOA 2ABAA 3IIZA 1T0OA 1KA9F 1VLWA 3DI0A 3C0JA 1QAPA 3MBDA 1G4TA 3WK1A 3OVPA 2Z2UA 3V75A 1IIGA 3NA8A 1FXPA 3MP3A 3QZEA 1TPEA 3GR8A 3HQ1A 5D2TA 2J27A 2ATSA 4QIUA 5DCDA 1BEUA 1WOBA 4UIOA 1JUKA 4LT9A 2QUVA 4Z0SA 2G5WA 2CZ5A 4LVBA 2I1OA 1EB3A 2Z1BA 2ISWA 1OJXA 4X2RA 1W8SA 4R34A 2NX9A 1GVQA 4H3DA 1FCUA 1Z44A 3NDOA 1PL9A 3S1VA 1W5QA 1KV5A 3M44A 4NJGA 1LBLA 1E51A 1MO0A 3RFAA 2NUXA 1R47A 5AC7A 5AYZA 3STGA 3LGEA 1D3HA 1O94A 3I7SA 3OIXA 4Y96A 1K7EA 4GXMA 5E1QA 2ZCGA 3P5ZA 4DELA 2YW3A 4AHPA 1LLWA 2C18A 3M5ZA 3QSRA 3GLCA 1SZEA 2R8WA 2Z6JA 1XI3A 1KFLA 4WOQA 2A1YA 3F4WA 3NPVA 2PRMA 1FDZA 1O4UA 4BWLC 3W7PA 4N4QA 3HO8A 4CCDA 3B06A 1X1ZA 4N9EA 4UXDA 4M7TA 3P82A 3NPWA 1FWRA 2W0UA 2ZTKA 3V1PA 1TPH1 1H1ZA 4ADUA 2YYTA 4AVFA 3N9RA 4UNLA 4JNMA 1WXJA 4YCPA 1SO4A 3I7RA 1CW2A 4MZ8A 2QAPA 1OYBA 1KTCA 4XKYA 1W54A 3L5MA 4NT0A 4FHAA 4JYDA 4ZQOA 4O52A 2DJLA 3W2JA 2HS6A 3MP5A 1LBMA 1LOLA 2E5CA 5I3HA 3TC7A 1KTNA 1DQXA 1ME9A 5D2YA 4DO6A 3MYOA 4QM1A 1XUZA 3E12A 1W56A 2CU0A 3G18A 3GKFA 4AMAA 1W31A 4O16A 4OGZA 4FB7A 4RZ5A 3O06A 4OE7A 1XCFA 4NZJA 3FJ6A 2ZRUA 2OT1A 3SGZA 3C2FA 4AHQA 1SW7A 3MHFA 2Y63A 5F2GA 3OVQA 1LROA 2FIQA 3CEUA 5HJLA 2YPIA 5LNRA 1O5KA 2VENA 4I7VA 4RV8A 2OJPA 2OMAA 5E0KA 3W7HA 3QEZA 3W7NA 3S5OA 3GIYA 4NJIA 1YDVA 3T55A 3F1QA 3W72A 2WPBA 3HB9A 1FWTA 2ZRZA 3NQMA 3TAKA 1K3UA 1XBVA 1JRCA 3TC6A 3RK8A 1DOSA 3W22A 4FIRA 5AHMA 3ABQA 2WO5A 3W88A 2RHGA 3LXBA 4TU1A 3W2LA 4UTWA 4LVAA 4Y90A 4N2YA 4S2CA 3KVJA 4FNQA 4C1LA 2BSLA 3P60A 2NXIA 4KFPA 1OVDA 2VEMA 2ZRVA 3FYPA 1K8XA 1VYRA 1KV8A 1BTMA 4ML9A 1KM4A 3GDLA 1TO3A 4AAJA 3B0VC 1SQ7A 2TSYA 5HR6A 1W5MA 1QO2A 3VE7A 5DY2A 4M7SA 2BXVA 3NPXA 3W2NA 5LHEA 3LHZA 1OYAA 4JY9A 3FA5A 4KWVA 1KM1A 2QUUA 3KRZA 2Y70A 4UFMA 3NZ1A 4HKPA 1PCWA 5J5RA 5H91A 4MFDA 5LSMA 1MEHA 4JTTA 3L5LA 3GXNA 3O07A 1H61A 4IPJA 1PIIA 3TUUA 1TJPA 1GG1A 2YR1A 5F2IA 1P5BA 4UTHA 1ICPA 5G2HA 3G0UA 3HG2A 1N7KA 3IV3A 2C19A 2A7NA 1GVSA 3USBA 4XZ9A 4UFJA 1N8FA 1PHWA 3LBCA 2FPYA 4O57A 1W5OA 2QR6A 4GUIA 5BMWA 4LC8A 3TR2A 2CZDA 3TAOA 1H7RA 3C2OA 2XFWA 1LORA 4LW7A 2DZTA 4GFSA 3W7MA 3QPZA 4PCFA 3NVTA 1VLIA 2ZQ0A 4Z1BA 1XM3A 5F1UA 2FTPA 1W1ZA 4BFAA 3LLDA 3W1PA 5K9CA 4PEKA 5DY3A 2B7NA 1YXDA 4YMZA 1OFRA 3CTLA 3NQDA 3B05A 1TTQA 3A5VA 1X7FA 4N4PA 3DU0A 3WJYA 4O11A 4FX6M 4GJ1A 4LTSA 4X22A 1Z42A 3MMTA 1VCGA 2ZA1A 1KBIA 3P67A 3L5AA 4LVDA 3EKZA 2PRLA 3W7JA 4JX5A 1ZNNA 1OX5A 3Q37A 4JDBA 3KFTA 4O53A 2D73A 4QAIA 1HG3A 5E93A 4K36A 1F05A 1WV2A 1T99A 2PC4A 4JTSA 3P61A 5K9DA 2Y61A 2X30A 2V30A 1TV8A 1VH7A 1HO4A 2B4GA 1QPOA 4O0KA 1KFBA 4EWND 3O6DA 3CM4A 3O15A 1OHLA 1LBFA 2CLOA 2ZZ3A 3NQVA 4E0CA 3LCFA 1Q6LA 5AOUA 3O63A 5D32A 1F6KA 4FX8A 1SO6A 3W6YA 2ALDA 2VFEA 1OYCA 1VQTA 3GKAA 3OA3A 2FJKA 3TW6A 1RD5A 3MO7A 1EWDA 2GJLA 4MUZA 2J24A 2R91A 2VFFA 3I68A 5LNWA 2W79A 1G4SA 3OEXA 3UWYA 3WK2A 4NX0A 4XTIA 4AXKA 4QNWA 2Q8LA 4LC6A 4IXXA 2QKFA 1F7BA 2V8ZA 3W9ZA 1KLYA 3MI3A 3QYQA 3W7KA 1OK4A 5GVJA 1W5NA 4UR7A 4ZQCA 2RDUA 4RX0A 4TIMA 3UXDA 2TPSA 1B4KA 1JCXA 3HGSA 3W7IA 3PWAA 5CZJA 1ML1A 1F73A 2YYUA 3LCIA 5BMXA 1EX5A 3KVMA 5DCEA 2CWNA 3GDTA 3UPWA 3ZS4A 3L0GA 5ABTA 2GQ9A 5D03A 1P0NA 3P62A 3C2RA 1YDOA 3UWUA 4OWGA 2IQTA 1QPRA 1PCKA 4NZFA 2CW6A 2H3DA 3GZ3A 3KRSA 5F4WA 3FS2A 2GQ8A 1JR1A 3E96A 3N2MA 2A0NA 3LRMA 3QPYA 3BLFA 3HPSA 3O05A 3W7QA 2EF9A 1P4CA 2DZXA 1H7NA 3TFXA 1GT8A 4DEFA 3H53A 1EIXA 1NF0A 3DZ1A 4OV4A 3G1XA 4R53A 5I3FA 1M5WA 3BGGA 1CI1A 4JS3A 1T8XA 5CZTA 4BWLA 3WFAA 2P1FA 1C9DA 2AAMA 4LWWA 2Y62A 3PUOA 5EBUA 3TIMA 3P8IA 1DJNA 1H1YA 4P2VA 5G2IA 4O15A 3RLUA 3BLEA 1UUOA 3MP4A 3R12A 4QNEA 3SFKA 4LU0A 3LV5A 2FLIA 3KVLA 3LHYA 1V5XA 3DGRA 1EUAA 3LM7A 3D0CA 5CPNA 1H7WA 3DFTA 4O8RA 4MY1A 3FIGA 1AL8A 3W1TA 5HQEA 4G1KA 3W3OA 4MLRA 4OU1A 4JTJA 5MHBA 5F4SA 2ZZ4A 4MY9A 5CZ0A 2ZYFA 4IQLA 2J9YA 4MLJA 3TJLA 1VC4A 1J2WA 4E2DA 2DP3A 2Q3RA 1D9EA 1KTBA 4QITA 3NQGA 4X9SA 3TH6A 5D09A 4RZ6A 1KLZA 1L6YA 5BNKA 4TMBA 3ZWTA 3LTYA 1JCYA 3NO5A 5KSWA 4ORIA 3M5YA 1DBTA 1QPNA 4RK8A 1A5BA 3W74A 3QF0A 3M1ZA 3EEGA 3L0NA 5D33A 2QDGA 2GVJA 3DH7A 3HGOA 3LHUA 3U6WA 1F74A 4N6FA 1TRIA 2V2HA 2RH9A 1MEWA 2WNZA 3NL2A 5U7SA 3A23A 3LXAA 1YADA 4MFEA 1L6SA 4S2BA 4Y8FA 4WD0A 1TQXA 3CLMA 1XUUA 3Q94A 2XN2A 3TXZA 3W2UA 1FWNA 1OG0A 4ADTA 2VOMA 4XWUA 5CPMA 3AJXA 1KFCA 4O4VA 2JBMA 1ONRA 3C8FA 5K4ZA 3W1LA 1I4NA 1RQEA 3MI6A 4CQ9A 1SZNA 1LRNA 1JCNA 1PHQA 1QWGA 4O28A 1QR7A 4HN4A 3TV8A 3N9SA 1NF7A 4AWSA 1I2QA 3W87A 3A5FA 1L6WA 2I14A 1EP1A 2G97A 1WA3A 2V82A 1KM0A 3HG3A 3W7GA 3DKJA 1CX9A 4N9CA 1VZWA 3R2GA 3G1FA 3NL5A 3W75A 3GX9A 1KM2A 1Q6OA 2QCFA 3G0SA 4PH6A 4YXGA 3S42A 3N2XA 3CB8A 1GZGA 3HJZA 1AL7A 3NYZA 2X1SA 2DORA 1W5PA 3PUEA 1A53A 4K37A 2BZNA 3FEMA 3IIOA 4O1BA 4QQ3A 3STFA 3GAKA 1G4EA 4IMGA 3CQ0A 1G7UA 5AHLA 1OK6A 4O18A 2C6QA 1JQVA 2HS8A 2C3ZA 2PE4A 6ALDA 1XDMA 2YFNA 1FDYA 5HMSA 3F4NA 3GNDA 3RU6A 3S1WA 3EXRA 4JIQA 3TK7A 2VC6A 2X2GA 3UZ5A 1TIMA 3PVFA 1HTIA 3MWAA 4UTMA 3BW2A 1FCVA 3NM1A 3M47A 3W07A 1GJPA 5F2MA 1VYSX 1IXNA 4HPXA 2NX3A 3GAYA 3QW4B 4YWIA 1WQ5A 3TMQA 3PB2A 3BARA 2VFGA 5FF0A 5HUOA 4BK9A 3RNDA 2VEPA 3IGUA 4IGHA 4FXRA 3HG5A 5HUPA 1I8JA 4NNBA 3PBYA 2NXGA 3M6YA 4TMCA 3KX6A 5HR7A 3G3DA 5TBOA 4JX6A 4LNYA 2LLEA 3UPBA 4ALDA 1OFDA 1NAL1 5D38A 3RF9A 5IBXC 3CU2A 1IIHA 4UTIA 1YTDA 2E5BA 2ZZ2A 4MYXA 4EF8A 2J9XA 3BVJA 4HIBA 4UTTA 2E6FA 4ONVA 5LKYA 1YTEA 4AWUA 2DZUA 1M7OA 3ELFA 3DI1A 3PC0A 5DXXA 1W3IA 2QJGA 4BI6A 3LTSA 1U83A 1PE1A 1BWKA 1JVNA 3PB0A 1P0KA 3O6CA 2FPTA 3W70A 2QDHA 4O12A 2G95A 4HSOA 4QISA 1Y0EA 1GVFA 4GNJA 3I6RA 2WSYA 2JKEA 4K8HA 5FESA 1LDCA 4AEOA 3NL6A 3HBLA 5I3GA 2ZFAA 1K7XA 3Q2DA 3VI2A 4UCGA 3NQ2A 4MPQA 1A5SA 4A2SA 1MSSA 3S1XA 1XBYA 3CIWA 3TXVA 2VELA 1TPVA 3SGUA 1FWSA 1ZCOA 3HIJA 5KMYA 5HULA 1B57A 1YTKA 2UV8G 3O1NA 1U5JA 4TO8A 5L6UA 3EWXA 4UTJA 4AWTA 2C0AA 1OF8A 2BLEA 2H90A 3N3MA 4WX2A 3IIPA 1SUXA 4KFNA 2FQIA 4WOZA 1UJPA 3UY7A 1ZAJA 3W23A 4JYFA 4CCCA 4UR8A 1TPDA 3KOFA 3HG4A 4YLWA 1SW0A 3LCXA 5D04C 3W7EA 2WNQA 2WQPA 2CFFA 3KHJA 3QSTA 2ISVA 1G67A 1OFPA 1QFEA 4E38A 1K8YA 3S6DA 1XBZA 3KVKA 4N9BA 4IOTA 4LOCA 3FJLA 4A22A 1B3OA 3L68A 2Y89A 3DBPA 2TRSA 3CC1A 4Y9AA 1KFKA 4I9AA 2A85A 2C16A 1O95A 4Y6GA 3B8DA 4ZQPA 1OFQA 3L66A 2B7PA 3M9YA 7TIMA 3M5XA 4NXSA 1OX6A 4L4MA 2H8ZA 3IGSA 4UMAA 2NLIA 4LVFA 3VFLA 2CLEA 5EKYA 3NQ7A 3C6CA 2QCDB 3H55A 5KZDA 3NAVA 3GK0A 2QCDA 5AHFA 5AFDA 3R13A 2YDAA 3W7DA 1UCWA 3IVTA 1R2SA 3HF3A 5BOOA 2QCHA 3W76A 4LRTA 3DFPA 3QJAA 3EX2A 4WY0F 5I3KA 1XC4A 2WSRA 3TKFA 4NXKA 3DFQA 3B03A 1AK5A 4UFHA 3G24A 1K8ZA 2ATMA 4UNKA 5TIMA 4EVZA 2R14A 4WY0B 1ALDA 1SO3A 4UTLA 1QPQA 4WY0A 3EX3A 1GYLA 3HPZA 1K02A 3EX4A 5KZMA 4JTUA 2ZRWA 3MHUA 1SSGA 4GUJA 2QCNA 1R30A 2YSWA 4GC4A 5G1TA 2PURA 1FY6A 3P81A 3CEPA 4DPQA 2QCCA 4O4WA 4L4LA 3S0CA 3NQEA 4ADSA 1BWLA 2P10A 4GUGA 1S3HA 1QOPA 1ZY9A 1HO1A 2OX1A 5D30A 1TTIA 4JYEA 3TU9A 3CWNA 2W6RA 3INPA 4FNSA 2C13A 3HOJA 4K7YA 3B0UX 3U2OA 3UYCA 4DF2A 3P80A 1XL9A 5D05A 2QCLA 1ZFJA 3PSWA 5L9FA 4HSNA 4FO4A 1DORA 5DELA 3EB2A 4NNCA 4R7JA 4U4MA 2VKZG 4MZYA 3TCEA 3JS3A 1TPC1 5DBTA 3QQ1A 4GE8A 4DPPA 1JULA 3QH2A 2G96A 1ZALA 1ZHAA 2ZBTA 1LRQA 3NEVA 2VFDA 1EPXA 2ZRYA 1SFJA 2ZRXA 5DLCA 1ICQA 1LYXA 5FEZA 3N34A 3F03K 3MI2A 5FEXA 1H60A 5FEWA 1XXXA 3IIVA 1VS1A 4UFKA 1TRDA 3TSMA 3NQAA 3W1QA 2V2CA 1MEIA 3G1SA 2NV2A 3QM3A 1RVGA 4MKNA 4CNNA 1LZOA 3SW6A 3MBFA 2DZVA 4IMCA 3FKKA 3B4UA 3QMRA 5HWMA 2NZLA 3PBUA 2A21A 1VJIA 2HMCA 2R94A 1F6PA 1H50A 2ZA2A 3QFEA 3NZRA 1S5TA 1YDNA 2YZRA 3B0PA 3H54A 5HWJA 3GDKA 2FDSA 5CSRA 4JTEA 1OFBA 3SI9A 1O60A 3W1XA 2WV8A 1S5WA 3PF3A 3PSVA 1QNVA 2DZSA 2QEZA 4FNTA 2A2IA 4I7UA 3E02A 4EIVA 2KZHA 4NX5A 4IXHA 2QCMA 1W3TA 1A5CA 3NR0A 3Q58A 2EKCA 2E6YA 2NXHA 2V0TA 4D2JA 1KBJA 3WJSA 3OVRA 2Z0IA 5G1YA 3T7VA 2JGYA 3C3NA 5BRBA 3MYPA 3MHGA 3LB0A 2JK2A 2VXNA 1UBSA 3S9YA 4UTWC 3STEA 4A21A 2H8XA 3ZR4A 2H3BA 4ZQMA 4UTKA 4MOZA 3TQVA 1HL2A 1NFBA 5G2WA 2QJHA 4K7VA 3VKJA 3PS7A 2RDTA 5EMUA 4IUOA 4M6QA 3SZ8A 4W9TA 3L0KA 4LV4A 3S8HA 1OFOA 3LHVA 5AC6A 5A8GA 2V5BA 3OBKA 3S5NA 2C1HA 4RXFA 2E68A 5D2XA 3PAJA 5K9XA 3W7RA 3TDFA 1WBHA 3G1HA 4Q33A 5C6MA 5FF2A 2A6LA 5AN7A 3O6YX 4O1DA 3GVGA 4IPIA 2PRHA 1G7VA 4JGDA 4UUIA 1GTHA 1LOQA 1TV5A 2B7QA 1KW1A 5IBXA 1H62A 1VYPX 3BW3A 1FWWA 3GNNA 4NNAA 4O54A 3NQFA 4UFIA 2YX0A 3PBVA 1GWJA 3M7WA 4IMDA 1EEPA 4Z0JA 3QQ0A 3G8RA 4QJ1A 1ZENA 2EAWA 4DF1A 2NV1A 5DCBA 5F1VA 3L65A 5AB3A 1TPB1 4UC5A 5AC8A 3W7OA 3BK0A 1YPIA 3TQKA 3BG9A 1TPFA 1Q3NA 3PR2A 4NVTA 1D3GA 3EWYA 3B04A 1UUMA 3ZWSA 3LLFA 4MVAA 3W84A 3SSJA 1RZMA 1TTPA 1KFEA 5G4EA 4O1AA 3UQNA 2GPTA 5IM51 1IXQA 3IEBA 4GUFA 5G4WA 3P74A 1K7FA 3P5YA 5EA9A 1H5YA 5U4NA 2H6RA 4JICA 4NJKA 4AHOA 5K4XA 1XKYA 2RKXA 3WJWA 4N6EA 4R33A 3E9AA 3NQ8A 4DQWA 4HNTA 8TIMA 3IRDA 4WQ6A 2J6XA 1FDJA 2ZZ7A 2QF7A 1VHCA 5J5DA 1O5XA 3G1DA 3U8GA 1AMKA 2E6AA 1X1OA 3W85A 1NEYA 3W83A 1R2RA 3W7CA 3A24A 4BI5A 4JTLA 2V81A 3I65A 1TPUA 3RMJA 1EP3A 3EXTA 4MIMA 1YLVA 2BTMA 1ICSA 2EGZA 3SECA 4I7WA 1UASA 2ZZ1A 3N14A 5A5WA 4CNOA 1GVRA 2OT0A 3W7LA 1IXPA 1FQ0A 3IVUA
chains in the Genus database with same CATH superfamily
5C0QA 3ES7A 5FF3A 4XBKA 1R7AA 1RALA 2QT3A 3LPPA 3M0MA 5CBBA 4K8GA 2X1IA 2YB4A 1RP8A 2WQDA 4AZIA 4R7OA 3OLIA 6REQB 2FH6A 3C2YA 4QQUA 3CHVA 2VDGA 4FOJA 4DBEA 4AD0A 4UTFA 1KB3A 1NFGA 2Y7EA 3ARVA 3VIIA 1WZKA 3BLIA 4WJXA 4L61A 3UNDA 5KTLA 2I5IA 1CB7B 2Y7DA 3L2IA 2PGRA 1JXKA 1TREA 1S5VA 1C90A 4HTYA 2JE8A 4ZXOA 1VBHA 1SPQA 4JEJA 3BH4A 3GHSA 1M04A 5I7GA 3M16A 3TROA 1KGXA 4MKSA 1JUEA 1CCWB 1UYQA 3TN4A 2X0HA 1RK5A 3VOIA 3T40A 2EPMX 3V1HA 1LM1A 4MHBA 1EA0A 1XH1A 2VEGA 3MSGA 3VD5A 1JI1A 4XBSA 1WAUA 5CJMA 3EWBX 5EGRA 4LUJA 3WLJA 4IP7A 1J18A 3CAWA 2RJHA 5EMJA 3DKLA 2GJNA 4ZB2A 3WL0A 1AW2A 3NQCA 4I5UA 3FAXA 1PVNA 4J7RA 2INEA 1PAMA 5C70A 4H9UA 4ZMGA 2P0IA 4RNJA 4OUIA 5HPCA 2WZEA 1CZ1A 1TE6A 4HZMA 3PZVA 4U5KA 5AVHA 3BLOA 3GXDA 4KEUA 4HNVA 2OKOA 1UWQA 2EPHA 1WUEA 4IIBA 2VHLA 2A3AA 4GINA 2DSWA 3C61A 2PLJA 3CHEA 2IKJA 4TUFA 1CYGA 4B3ZA 1H7PA 2CYGA 3NZGA 4CD6A 3WBXA 1YPFA 1RP9A 3RX3A 4LAMA 3LRLA 4HA4A 2G37A 2VZSA 3M0XA 6TIMA 3BAKA 2BOEX 2NWSA 3AIBA 1M7JA 1M7PA 2VT0A 4GI4A 4WGXA 2WMFA 1V6TA 1Q6RA 2QJIA 4S1FA 1HJVA 1JIBA 1NFPA 3VGGA 1KM6A 4H6KA 1QI5A 2O7QA 5HATA 4GG9A 1WCGA 3LOTA 1SO5A 1CIUA 2WKJA 1BTCA 4N9DA 2ADAA 3R8RA 3AHZA 4A6GA 2YZ5A 3T6CA 4P8XA 2JKAA 3MV11 1G01A 1I45A 4Q7IA 2GVGA 3LERA 3GDRA 4S3BA 4C1KA 1B4EA 2Y8KA 1NARA 3W24A 3L4VA 3TVAA 1IV8A 1WDQA 5DN1A 1P43A 4N0RA 1XPGA 4RE0A 3DXIA 3WJZA 3WLLA 4MTVA 1GK8A 3I10A 4AF0B 3PTKA 1DWHM 4DUXA 2E6DA 5HWNA 2PFHA 4JNZA 5FL0A 1NOFA 1W37A 1VJSA 3W1RA 3R5EA 1UW9A 3ENLA 1I2RA 1VKFA 4AFYA 2PWUA 4HYRA 3TSDA 2ZUWA 1MXGA 3GU2A 2J25A 1TR9A 2FZNA 1S2AA 4XZHA 2JF6A 3GDMA 5C2XA 3UCCA 4XAZA 2Z2AA 1G4PA 3CH0A 3DG6A 3G3MA 4DUOA 4LYPA 4FAMA 1X8CA 1HW6A 3KOWA 5C9XA 4F48A 4S3FA 4V33A 4HZ7A 2B7OA 4QEHA 3NL3A 2Z25A 4HPHA 4UFLA 2I17A 4F4RA 1R3RA 1IR1A 4URIA 4PODA 3SCQA 3ARQA 4PCSA 4JTFA 1BAGA 3P3BA 2EHHA 3BC9A 1GCYA 3SEPA 4W4QA 5LGZA 4XB3A 1UIOA 3TTSA 2NVAA 1XP3A 3HQOA 4UOJA 3NXFA 3UWQA 3VE9A 3EKLA 1TWDA 4GOAA 5REQA 1XSKA 3EPOA 2HBVA 1A50A 1F2JA 2VR4A 1E0VA 4LV9A 3DAQA 4LUIA 4RDWA 3EX1A 1XD1A 3N04A 3BAJA 2CZFA 3GYEA 3MKVA 1UWTA 2BXZA 2J13A 4RUBA 4HU4A 1S1PA 2OSXA 4MJ4A 4CQBA 1IEQA 1I2OA 3LRKA 3Q67A 3MS8A 3WQGA 1TV7A 1FWCC 4HCLA 3DESA 1XFBA 1SJCA 1V0KA 2YFOA 3NNTA 2GYIA 1TKKA 3TTQA 2XPKA 2ESCA 5F4XA 1PPIA 3V36A 1AW1A 4HHPA 4EXAA 3BG5A 3GG8A 3QTPA 1FHDA 3UG5A 3VILA 4MNJA 2QLYA 4S3AA 1SR9A 4M6PA 3MJMA 4JAWA 1GEQA 2YW4A 1RVKA 5C8BB 1FWBC 4X3ZA 4R5EA 3GHTA 3NEHA 1DVJA 4HPJA 2FVLA 3W86A 3WD1A 4CLMA 2V5JA 4MB5A 1ZBCA 4DX3A 2X1TA 2OODA 4AZGA 4K3ZA 4JY8A 3W1NA 1GEHA 2PDNA 1H41A 1BYDA 4FLSA 4JBRA 5AYYA 3TYAA 5LNSA 4ATDA 5EPDA 4GYPC 3C2VA 4GNKB 4PA8A 3A9BA 3LLXA 1UR0A 3IK4A 4UQEA 3HV8A 4K2SA 1AQ0A 1GTEA 3AWOA 4K38A 5BOEA 4QSHA 2Y88A 3ABXA 5AVNA 3P8JA 4H04A 4Q4KA 5A2BA 1B9BA 1Z9AA 2XVNA 4KIEA 2RDXA 1LT8A 3HM7A 1VHNA 1JQXA 3W73A 3S9IA 4I8DA 3BJTA 3OZMA 3CWOX 2YIHA 3VX1A 1ZS2A 1TYGA 4FLRA 4KWSA 4J3UA 3R94A 3S5ZA 3EXSA 2QCGA 3PPCA 3ABRA 1QW9A 5E9AA 1QDSA 1N55A 4OOZA 2PTDA 3TNOA 3WSUA 3WK3A 1V6UA 2EO7A 1EZWA 3AXKA 3PG9A 1EBHA 5JBFA 1VFMA 4IFKA 5EFFA 1TTJA 4JTKA 1IEVA 4UTUA 5AYBA 1QOQA 3S5YA 3ARWA 4LY4A 1YXCA 4G7EB 4BR1A 1V3HA 4MM1A 1J0YA 4P8UA 1E9LA 1Z41A 4MDOA 2A3EA 1J4EA 2CITA 3AS2A 1JDDA 1X1NA 1H7OA 2PCQA 1ZP3A 3WJXA 1RLCL 2Z1SA 4XZBA 1E6ZA 1K1DA 4QCEA 2EPKX 5ABEA 1WOAA 1XG3A 2OZTA 3YPIA 2DFAA 3FEQA 4F0LA 2DVUA 4KERA 1ME7A 2A6NA 1JZ6A 1VPXA 1IT8A 4JTHA 1LG2A 1DV7A 2QJJA 3ICJA 3CUZA 1YE6A 4UNIA 2F7FA 1XLLA 5FAJA 2OZ0A 4O19A 1LCOA 4WIWA 1KA9F 2PBGA 3OVPA 4PTDA 3MP3A 1UWIA 3GR8A 1V77A 3AMGA 3HQ1A 2J27A 2WJEA 3D3FA 2PTZA 3H7VA 1BEUA 4UIOA 4Z0SA 4LT9A 3WD0A 4JFSA 4GYKA 2Z7GA 4GI8A 4CEUC 4CUCA 1OJXA 1ENUA 3U7BA 3PK7A 4R34A 1FCUA 1Z44A 3S1VA 3M44A 5AC7A 1EKOA 5CAHA 2HNHA 1O94A 4JL1A 4Y96A 1GJWA 4GXMA 4I3GA 1ITUA 4ZBCA 3P5ZA 4DELA 4AHPA 1LLWA 1GORA 3EOEA 1XC6A 1KXTA 3PJTA 1E72M 5C2GA 4BWLC 1O4UA 3GG7A 1K70A 2BASA 1BVWA 4N9EA 2V69A 1UPMB 4CNTA 3LMYA 3RPMA 2ZTKA 3H2MA 3TZNA 3LEPA 7REQA 1DXEA 3N9RA 4UNLA 1WKDA 1WXJA 1JGMA 3I7RA 1XQKA 2QAPA 1FWDC 1C3FA 4HJFA 2J74A 3MMUA 4NT0A 4ZQOA 3RMEA 4Q8MA 5JXQA 4UB9A 5D2YA 1EOMA 4DO6A 4E8GA 3CUIA 3WQEA 4DM2A 3IJ6A 1W56A 3RLHA 3FHAA 3P2VA 2IMRA 4RZ5A 1J8VA 1XSIA 4NZJA 1XLDA 2OT1A 2XHYA 3SGZA 3WEOA 2WVVB 3O9NA 2Z1XA 3SCPA 4BA0A 4GGHA 2Y63A 5F2GA 1EJVC 5HJLA 3CEUA 4PRRA 1XH0A 2YPIA 1TZZA 2PTXA 4I7VA 4RV8A 1DYSA 4W7WA 1H49A 1HL9A 4YNGA 1IT7A 3W7HA 1W9PA 4MWAA 4H6QA 2XSBA 4NJIA 1SGJA 1YDVA 1E6QM 1HJUA 1YX1A 3HB9A 3TAKA 4JN7A 3NQMA 1Y5WA 2GSJA 3BLLA 1XBVA 5TD4A 2DIJA 3TC6A 3UA3A 6XIAA 3RK8A 2WO5A 3TTYA 1D8CA 3LXBA 1QBBA 4HHLA 1D8WA 3KWSA 1U33A 4B4FA 5C9ZA 4DWDA 3ITLA 3RUBL 2YLLA 2QJMA 1NTHA 1UD2A 2VOTA 5CCZA 3ZSSA 5HK4A 2FH8A 4AAJA 1SQ7A 9RUBA 3TA9A 1MZRA 4M7SA 5CLTA 2XH0A 2NV9A 3LHZA 1EH9A 1OYAA 3FA5A 4IH3A 2QUUA 3KRZA 4GY7A 5BROA 2Y70A 4AW7A 4HOZA 2PODA 2DW7A 1PCWA 5J5RA 1R3YA 4JTTA 4W93A 4GQGA 3L5LA 1A3XA 1HJWA 2FZDA 2YR1A 4CVUA 1P0DA 4G1NA 3E3HA 5IDIA 4UTHA 1ICPA 4HK7A 3G0UA 5G2HA 3VOJA 3GM8A 3IV3A 2C19A 4HCDA 2A7NA 4GISA 3USBA 4XZ9A 1MW0A 3PZOA 1PHWA 2Y8UA 3LBCA 1WDSA 2CWXA 4JIEA 2NT0A 2Z28A 3WY1A 2W9MA 2ZX8A 4CD4A 3FVMA 3GSMA 3TR2A 5E5CA 4PCTA 1OSEA 4MSSA 3C2OA 2XFWA 1LORA 1E4LA 1EHNA 3TP4A 1UD5A 3W7MA 4HNOA 1UBPC 4MDPA 4P7QA 4Z1BA 3U57A 5F1UA 4BFAA 3LLDA 4R9OA 4PEKA 4PFHA 3PBMA 4JTQA 3BSGA 1IEXA 4O1EA 1DTUA 4B3LA 4PRWA 3GFYA 3N1AA 2OLAA 1X7FA 2PF8A 2BHZA 3CV6A 1US3A 4HHHA 4KQNA 4FX6M 1HZYA 4G56A 1L2QA 2ZA1A 3I6EA 3EKZA 4KRUA 1VPQA 1JG9A 2W66A 1ZNNA 4JTAA 3CAKA 3MA8A 3H8AA 4JDBA 2D73A 5E93A 3B9AA 4X2PA 1R87A 5K9DA 2X30A 1TV8A 2B4GA 4EWND 3O6DA 3SRFA 4QP0A 3APYA 3NQVA 1VFFA 1IZCA 3CMJA 3GW3A 1YMYA 3URAA 2PP1A 3DC0A 5AOUA 4QLLA 5BXRA 4B4HA 3DDMA 1JDCA 3WLMA 3GXMA 1E6RA 1RLDA 5FACA 2J24A 4ERAA 3K8KA 1E40A 3I68A 2Q09A 1H0GA 5LNWA 2GK1A 4QG9A 4NX0A 1UH3A 2PTWA 4IJRA 5CBIA 1F7BA 2G3MA 3QYQA 2D3NA 4AD3A 4RX0A 2AQVA 3ERPA 4CCZA 5CZJA 4J1OA 1XPYA 4MNMA 1F73A 2P76A 2XGIA 1W1B1 1WPCA 4DJEC 3GDTA 4W85A 4NAEA 2QDEA 1WNOA 4BY3A 3GTHA 5C7HA 1MI3A 1BWVA 1ZJAA 5F4WA 3VMNA 2GQ8A 1ZGDA 4E2VA 3CUHA 1W9UA 4TQTA 3HPSA 3O05A 3MDUA 1TVNA 3F7JA 1XFCA 2FTWA 3TFXA 4QG8A 1IE7C 1ZRQA 1O6IA 2XU2A 5AZ0A 3U4FA 1W1A1 4IQJA 1XYAA 4AZHA 3UVIA 3Q4DA 3VNJA 2QYGA 3IAQA 3UXIA 1WDRA 1FWEC 5G2IA 3RLUA 1DJYA 3BLEA 3MP4A 3PJWA 3GE7A 3KVLA 3LHYA 2QJNA 3D0CA 3DFTA 3AU2A 1UR2A 1EDGA 3TLQA 1IHIA 2XIIA 4RPPA 2DY3A 3AMKA 3SUVA 4A3HA 3DYPA 3PWGA 4JTJA 4WKHA 4B9YA 2X05A 1CXKA 4MY9A 2ZYFA 3PP7A 4L6DA 1GOMA 4YVXA 2QV4A 3EB3A 4HPGA 2PA6A 3JZEA 1NU5A 4WK9A 1XYFA 3MVTA 3NIYA 2WKLA 4D72A 1VBGA 3VDHA 4XVDA 2R1LA 1OY0A 2JEQA 3AC0A 4BS0A 1HKMA 1EA9C 3ZWTA 2E4TA 2ZIDA 5KSWA 3LY0A 2NQ5A 3M5YA 3QOMA 2EQDA 4WSHA 2OR2A 3W74A 1Z8AA 1WZMA 2UY3A 3REQA 3M1ZA 3IJIA 4UWMA 1JCTA 4FZIA 4DJFD 3EEGA 2HVMA 5D33A 2VUNA 4C65A 3HGOA 1F74A 5FOOA 1MEWA 1W6TA 2NQHA 3A23A 3A47A 4PUEA 1OGSA 1XUUA 2XN2A 1FWNA 3H7RA 2E40A 3CL7A 4XWUA 3MSRA 1QNOA 2EEXA 1LL6A 4RZBA 1GOOA 4O4VA 1ONRA 3UGVA 2HCVA 1E1CA 3R10A 3UZZA 5I0DA 4CQ9A 1JCNA 2E7FA 5A1AA 3H2NA 1GUVA 1QWGA 2E9BA 1D7KA 1QR7A 2J7GA 2VQTA 5FSDC 2JIWA 1L6WA 2I14A 2NSOA 5DFAA 4HJWA 1Y7VA 1KKRA 1YNQA 3HG3A 3IWPA 3D46A 4J3ZA 1U2YA 3NL5A 4GKLA 2PDCA 4RDYA 2UBPC 4ICMA 1T5AA 3KEHA 4YXGA 1Z89A 2J7DA 4OUEA 3M0VA 3M4HA 4W8AA 3CB8A 3N6HA 1P48A 4K37A 3FEMA 3O0KA 2IS7A 4NHVA 3CZJA 5GNZA 4BEUA 4Q8WA 3SB0A 1DJXA 5AHLA 3T05A 4FA3A 3WFZA 2PDFA 1I6NA 1HQTA 3UZYA 5DQPA 4DIAA 2PE4A 1XDMA 3WQPA 1S2UA 1JZ5A 5A8OA 5HMSA 3QOKA 2ACSA 1ADDA 3KUMA 4RE4A 4W7UA 1Q65A 1JYXA 4I90A 3ZSTA 3VMPA 2VC6A 3UZ5A 1TIMA 3MWAA 3C0QA 1DJZA 3BW2A 3L4ZA 3WL1A 4AZ6A 5GQBA 3TEVA 4C6CA 3AUJA 1DWAM 1E0TA 1WQ5A 2VFGA 3CUFA 1TUFA 4BK9A 1W3KA 2WZIA 2VEPA 5HUPA 1W1TA 1REQB 2DUXA 3PBYA 1OCNA 3M6YA 5HR7A 3FX4A 3G3DA 2QV5A 4JNYA 1HT6A 4J4KA 1R3TA 1OFDA 1Q6FA 5D38A 3MC5A 3CH9A 1Y5VA 3UR7A 4UTIA 2E5BA 1TVPA 4MYXA 3CT2A 5CJ5A 4UTTA 3C5QA 3GQYA 4AWUA 4BI6A 2C91A 4LAOA 4XD4A 1JVNA 3PB0A 3D47A 4TVUA 5HNUA 1TA3B 3UG3A 2G95A 1HVXA 3Q45A 1LWJA 2GDQA 4OBRA 1GVFA 2F8QA 4GNJA 1UUQA 2WSYA 1LDCA 4AEOA 3PZMA 1V7AA 4XAFA 3D3AA 1YHTA 2XJ7A 3NQ2A 2PDPA 1A5SA 3AI0A 5HJXA 1TPVA 3VIGA 4E3VA 2Z2BA 5AECA 1ZJHA 4I5XA 2V3GA 4AU0A 1TZ9A 3QZAA 5L6UA 4MB1A 1H0IA 4W5ZA 3EA3A 1OF8A 3DERA 3K1DA 4HP5A 4JOMA 3B9OA 4WOZA 1QHZA 1ZAJA 4JIHA 4HPNA 5I3DA 1I75A 2OGYA 1E3XA 4HB7A 4ZODA 3COTA 3AMDA 4NP7A 2WQPA 5I2UA 3XISA 1DPMA 3QSTA 2CKRA 3LENA 1PTDA 1CGUA 4IOTA 3VKBA 4LOCA 1JNDA 3DYOA 1SMDA 4Y9AA 1KFKA 4I9AA 4ZO7A 5JUVA 3GC2A 1NOWA 3B8DA 4IPPA 6ENLA 4WKAA 3B8UA 3GRIA 3F4CA 1OFQA 3LNPA 7TIMA 1OX6A 3SRHA 2XGZA 4M82A 1JAEA 1W2VA 4C1NA 3C6CA 2QCDB 3H55A 3NAVA 3GK0A 2FVMA 3ALGA 4AZCB 3HF3A 5BOOA 2QCHA 1Q13A 4RV3A 3JVAA 5MKGB 1P0BA 3GUWA 2FFIA 3PANA 1KCLA 3KWXA 3AS0A 1AK5A 1JF6A 2D0FA 3G24A 4UNKA 2R14A 1ALDA 1QPQA 4WY0A 3HPZA 4IL0A 1K02A 3EX4A 4UOZA 3PJUA 3VC5A 5KZMA 2O56A 3EMZA 1JGIA 1MDRA 2WCGA 5C71A 1R30A 4GC4A 3NSXA 4F2BA 4FS9A 3APTA 1HN1A 4O4WA 1BWLA 2YB1A 3QYSA 4GUGA 1S3HA 3XINA 3ZVHB 3WLPA 2OX1A 5ABFB 4IJCA 1DIEA 1Y8BA 5IFPA 3U5YA 5CC3A 3WH8A 3B0UX 4QG6A 2AMXA 3BV7A 3KP1A 3C86A 3UYCA 2CBUA 4NKCA 4YYFA 1V3IA 4IQEA 3BOXA 5D05A 2ZC1A 5L9FA 4HZ6A 1MW3A 3BUVA 5D9NA 1UIPA 1LJYA 3BDKA 2J6VA 4AIEA 1TPC1 3QQ1A 4GE8A 2VWSA 2WLYA 5A8NA 2ZBTA 2CCRA 3TYUA 4M8UA 2ZRXA 3GC5A 3P6LA 4B92A 3WH9A 3QLLA 1H60A 1O5QA 1XXXA 2YDRA 1VS1A 1TRDA 4IQDA 3EA1A 3AROA 2NV2A 3QM3A 1J0IA 2DZVA 3GD6A 3QMRA 4MADA 3PN8A 3M0JA 2HMCA 1VJIA 2R94A 1B5TA 3HPFA 4A35A 1MWOA 3L2MA 4K1WA 2ZA2A 1Q2SA 3H54A 2INFA 3GDKA 5CSRA 4C6QA 1VFHA 3G5EA 1S5WA 3PF3A 4AY8A 4JQ3A 2FVKA 1ISXA 3UP8A 2RJGA 1A5CA 3H6OA 3Q58A 4DWSA 2KAUC 1Z7AA 1NDVA 4D2JA 1KBJA 3PZUA 3OVRA 3T7VA 5FJRA 3GZAA 3LB0A 2JK2A 3KBMA 1UZDA 4PE8A 1XIEA 2Y4SA 3KDOA 1GOWA 1TJ2A 4A21A 4E8DA 1ZLPA 3IJ8A 4MOZA 1HL2A 4XIAA 1FWIC 5G2WA 2QJHA 4AXNA 3SADA 3LG3A 4HQVA 5EMUA 1FHLA 1XDJA 4M6QA 3T1GA 4KESA 3RX4A 3LHVA 5AC6A 1J96A 2OSYA 4RXFA 5D2XA 1EJSC 2V68A 3W7RA 3TDFA 4Q33A 4YS1A 5FF2A 2A6LA 5AN7A 4IPIA 1KRAC 4D6GA 4IICA 1TV5A 2B7QA 5IBXA 3RG6A 2PPGA 1VYPX 3RILA 3BW3A 1FWWA 3CIVA 5DF0A 1C8YA 2OYKA 4L64A 1HKJA 5EBAA 4IFRA 4O54A 3ITOA 2VCAA 2YX0A 3SRKA 1GWJA 3M7WA 3ZJ7A 1TX2A 2IKIA 4Z0JA 3D6NA 3QQ0A 3G8RA 1QK2A 2EAWA 4JL2A 1RY8A 5DCBA 2DT1A 1BSLA 5B7YA 5F1VA 5AB3A 1M9HA 3DHPA 5AC8A 3W7OA 2VC7A 3BK0A 4R7WA 4WDWA 3BG9A 1DWFM 1TPFA 4NVTA 1PDZA 1D3GA 4AZBA 3LLFA 2VZOA 2I5QA 4D6DA 4HCHA 3KCLA 3E0LA 5IM51 3BMVA 3MPGA 2FZ9A 1MVYA 2WWCA 5DMNA 2V3DA 4DYEA 4ICCX 4N6EA 2PWHA 3AJ7A 4R33A 3E9AA 4KEVA 1QI4A 3WFLA 1BRLA 3EZ4A 1XH2A 4HGXA 3TOYA 1XINA 1XRVA 5IOBA 3F4VA 1VHCA 3G1DA 2E6AA 4F79A 3L12A 4Q8UA 2ZXAA 1OCQA 4QGCA 3A24A 2ACRA 3IUHA 1VPYA 1JF5A 5HPOA 4OVXA 2QNEA 1ODZA 4JKMA 3I3BA 1HJXA 2J8GA 5FJTA 4NYUA 4I7WA 2ZZ1A 4H1ZA 1AQFA 3W7LA 2XWEA 1IXPA 2PDGA 1FQ0A 1VIWA 1XIJA 3C56A 4UQDA 4M29A 2OTDA 2NUWA 4IIGA 3MUZ1 3QN3A 5H2ZA 4PUWA 2OCZA 3AZTA 3CS2A 3HA1A 5D2VA 3SIMA 4HNUA 4C6PA 3UXAA 5FCZA 2AQWA 3N2TA 3RR4A 2WHJA 1XBXA 4CQ8A 3EKGA 3HZ3A 1V6VA 1Q8JA 2VTFA 3JW7A 4PCPA 1B2YA 4DBUA 1TELA 2Y7FA 2P8CA 1G94A 4GGBA 3B8IA 4N02A 4Y9PA 1JJKA 4ICNA 1OD8A 1GQNA 4GIAA 1GG0A 1FHUA 1VCVA 4WDUA 1X6LA 2X1RA 3ANYA 5F2LA 4QXIA 4HNCA 1OADA 3KHDA 3THQA 1WXZA 4V2XA 3LCHA 3W00A 4S3JA 3F2CA 3ORWA 4NAFA 3GXPA 4JPGA 5TAOA 3UD6A 4REQA 1WDDA 4M3PA 4H01A 1B54A 3FV9A 5FF7A 2J88A 1GONA 1WDWA 2PDYA 3EWWA 4HT3A 2NVDA 3WMCA 5KITA 1OFAA 1NDYA 1RCOB 3WQDA 4HU0A 4XKYB 2ZE3A 4NASA 1RAKA 5A3HA 4EOUA 4MYAA 1XISA 1DIOA 4QDPA 4WDTA 4OT7A 4X63A 1FUYA 4LYRA 4CNUA 2EXOA 3MW7A 4AY7A 4DI8A 1WBJA 2IPFA 4JN6A 4LS2A 4XZMX 4ML4A 1DXIA 1MRAA 1PS9A 3IJLA 1DQWA 2UY2A 1M6JA 3N6QA 4AD2A 3STCA 4H9YA 3VC6A 3TYEA 1E71M 1L0PA 3H2AA 4XTDA 5I3JA 5C55A 3ARXA 4Q8QA 4QHRA 5C9RA 8A3HA 3EWUA 4QS5A 4CQCA 1OWQA 4W84A 3TX9A 3A22A 4MF4A 1QI0A 3OBEA 3DUGA 3E49A 4GNVA 3CIXA 2BVTA 3GB6A 3LV6A 2Y85A 3T4WA 3UR5A 2ACUA 2R1MA 2GZXA 2JFEX 3FYOA 1GKRA 1WO2A 2NWRA 1VCFA 3CL8A 1V79A 2WC4A 3LSCA 4DHGA 4LS1A 4LBRA 5CGQA 2BX7A 1H7XA 2VFHA 4L1WA 4LRSA 1FBAA 1POJA 3VK5A 1RBAA 3HURA 3VVGA 4JX4A 4PMOA 1LP6A 3W02A 3LNMA 5G5IA 1UP0A 1XLAA 1QBAA 2CLLA 1SR0A 3UW6A 4GI9A 3NGFA 1AQMA 4PMYA 3VOCA 1RXOB 4MNKA 4YVVA 5TQLA 5DXYA 3CUXA 1X6NA 4DAFA 3SBFA 3VAVA 4ACZA 5CGTA 4RE2A 3BGJA 2DDXA 1A5OC 3GVQA 4OV9A 1M03A 1FRBA 1V4YA 4YL2A 2HTMA 4HU8A 1BLIA 1HX0A 4PL1A 3UWWA 3EYPA 4QJ5B 2X16A 2O7SA 3TW7A 5A2AA 1ADOA 4OQVA 3DENA 3BO9A 3LM3A 4TX9A 2BODX 1CB2A 1GVOA 1ZAHA 4OECA 3T0BA 1Q6QA 1FFRA 2A79A 4JEQA 3KZPA 1QHPA 5FA5A 1QPKA 1KGWA 5E6YA 4XQ6A 4HNNA 2FB2A 5A8PA 1J93A 3CT7A 5FIPA 4WJ8A 2Y8VA 3BMXA 2E5DA 3VIFA 4AZ7A 5T9BG 3WD2A 3W1UA 4OBTA 3MU7A 1V8EA 2OLHA 4H4IA 2BY2A 3H24A 1QW8A 5REQB 2ISFA 1GOXA 1XWYA 2GDUA 2WVUA 3WD3A 1VF8A 2A3BA 4F3HA 3GXTA 3Q65A 1U22A 3CYJA 4K39A 4GQBA 4GMEA 3FDKA 1CLKA 3T0AA 2PEVA 4B5XA 2ZZ6A 3GNPA 3G1AA 3SCUA 4NUWA 1DHPA 3C52A 3K13A 3KBNA 2FB3A 4FNPA 3ATZA 3EBVA 1CGTA 1R8LA 3M0HA 4MJMA 1QNRA 3DFOA 3QLDA 3I4EA 3PZNA 4PUJA 5LHFA 4RL3A 2NQJA 2NT1A 3HQNA 4R9XA 4B5WA 3W82A 1AJZA 4FEZA 2DIKA 3IRSA 1VAHA 2RFGA 3ME3A 1G6CA 2CZEA 3UWVA 1R2TA 2Y24A 5D8ZA 4JQ4A 3LHTA 4GRSA 1AZ2A 1QMLA 1I60A 3PZIA 4HVXA 2X1UA 1RV8A 1EGMA 4E2BA 2EG8A 2Z00A 3P7YA 3M0ZA 4DJED 5D4YA 3LTPA 3IACA 2RGLA 5LNVA 4WUIA 1AQHA 1M41A 3N9KA 1Q6CA 5FEPA 2RAGA 3FLUA 1GNXA 2Y2WA 4XD6A 1EP2A 1EZ2A 3RAOA 1LOSA 3H70A 3HMCA 1Q4NX 3T9PA 4DN1A 2CLHA 4L65A 1TMQA 4PTXA 5GNXA 2DU2A 4GXWA 3FSTA 1VRXA 3EOLA 4FF7A 4ZB0A 1ZUAX 2YGYA 2Q01A 2JGQA 4AIUA 3S46A 1QO5A 3KCJA 3I3EA 4I6VA 1AA1B 4UBPC 2AGKA 1OB0A 3W53A 3WBEA 1FCBA 2BNJA 4PUDA 4FNUA 4XVEA 1ZAIA 2ZUMA 5BW6A 1BKHA 4O14A 1CENA 1EWEA 3G22A 5A6KA 2XIQA 2WOQA 1RHCA 1PWLA 2ISSA 4DF0A 1XCWA 2IQDA 2VEKA 5LGXA 4L1XA 2XH4A 2X40A 1JPDX 3JRKA 5D9PA 2DZWA 4M5PA 5BU6A 1HUVA 4B5SA 4D6CA 2TMDA 4AVNA 3NG3A 2QZRA 4W8LA 1JYWA 2Z27A 3TQ0A 1BKSA 4GD0A 1KM5A 3TMLA 2B31A 3NPUA 1UKQA 3UZJA 1L8NA 3WQFA 2JEPA 3P84A 5HBFA 2C15A 4I5RA 1V0MA 3BTNA 4L6OA 2PLCA 3UVAA 1DJGA 5T91A 1EJRC 4QBXA 4O1CA 4IIHA 1NWTA 1J6OA 2FGLA 2QCEA 1B1YA 1H63A 5AHNA 2RGMA 1OF6A 5DO8A 1YRRA 3QV6A 3G8EA 3PBWA 1GPWA 3VKCA 2HV5A 1RR2A 4NL1A 3VNIA 1S5MA 1XGDA 1MW2A 2JKPA 3GHUA 4M56A 2WKGA 1I2PA 5I3IA 3NQBA 4J28A 1R3SA 4Q8VA 1XHGA 4ZQNA 7TAAA 1FXQA 4IFKB 2Y7GA 3NXLA 2WANA 3WDRA 5CZSA 5CPTA 2R24A 2GQAA 4QJ3B 4BKNA 3OG3A 4C91A 3RYSA 4MNLA 3RPDA 1ZU8A 3LHWA 3P93A 1UOKA 2E25A 4DBWA 4HA1A 4A2RA 4JTGA 5JBEA 2RUSA 1JRBA 4KFOA 4W5UA 4IP5A 4HMCA 4XD5A 1IWPA 1CXLA 2EBNA 3TZFA 2A7PA 4H00A 3W6LA 1A5MC 1DJQA 1E55A 1SJAA 2G8ZA 1WKEA 3KRUA 1KNWA 1XIIA 4ES4A 4L6HA 3LCWA 5B7ZA 4P7LA 2NX1A 3N2BA 3W2MA 2GJPA 2MNRA 3ZFHA 3CZ8A 4UMBA 4IJBA 4A8IA 3LX9A 4YTRA 3QY6A 1UD6A 2GUYA 2Z6IA 4B91A 3IVSA 3W6MA 3OYZA 1T0OA 1VLWA 3DOPA 1MNSA 1QAPA 3WK1A 1ECQA 2I9UA 2Z2UA 4MB3A 3V75A 1A0CA 4DB7A 1PYFA 3ABZA 5D2TA 1MUCA 4JCLA 5DCDA 2IQ0A 4PMNA 4US5D 2ZUTA 2QUVA 1EJXC 1U1UA 3DFYA 3AMCA 3ZR5A 4ZOBA 2WB5A 1KRBC 9XIMA 5A6BA 2W5FA 3WENA 4H3DA 2D69A 1FP9A 8XIMA 1PL9A 1W5QA 1KV5A 1B0IA 1R47A 5AYZA 3WLQA 1K7EA 4DLFA 1W1IE 4L4OA 1A4MA 3WLNA 3M5ZA 4HMDA 3GLCA 4S3GA 2Z6JA 6XIMA 1AUSL 2HNEA 2A1YA 3NPVA 1FDZA 3W7PA 4US6A 3VM5A 3H2FA 5E9XA 3P82A 1VBRA 3CHCA 3VNLA 7REQB 1PZ0A 2QPUA 3WF3A 3WNNA 4JNMA 1PB0A 1CGXA 1SO4A 1CW2A 1ISVA 4LEFA 1KTCA 3QHOA 1W54A 3L5MA 3VOGA 1E6NA 4YPJA 4PB4A 4LNCA 4BZYA 2XZ7A 5HDRA 3W2JA 4H41A 3TC7A 1LOLA 3S2NA 2HZGA 4ZSUA 3FVDA 2HVOA 1PJ9A 3MYOA 4N7QA 1XUZA 3E12A 2CU0A 3G18A 3GKFA 4AMAA 2V38A 4O16A 4OE7A 4U2YA 1XCFA 1VFOA 1U30A 3AYSA 3N17A 4GKTA 3C2FA 3MHFA 4Q8TA 3TR9A 1NQ6A 3BURA 2OZ8A 3CL6A 4LBSA 1PTAA 2X42A 5LNRA 2P3EA 5G4HC 4IISA 2W91A 3S2MA 3WX7A 3UBPC 5E0KA 3MT1A 1P1MA 5BRQA 4MWAB 1KWGA 3LGDA 3GIYA 5HANA 3A12A 2PDJA 2Y5SA 3NSMA 3GY1A 3TN6A 1QI3A 3W72A 3S3GA 2CBIA 1FWTA 1B30A 1JRCA 4GIEA 3MB9A 1DOSA 3W22A 5AHMA 2XVGA 1GVYA 4XAPA 1G0CA 3OZPA 1L6GA 3FDGA 3AICA 3MQTA 2XUCA 4LVAA 5LA0A 2BMBA 2IKGA 4HK5A 3E5PA 4S2CA 3OHMB 4I9TA 2BSLA 2X7VA 1ISZA 1V3LA 4F0HA 1S39A 5BXTA 3FYPA 2BVDA 3LS9A 1KV8A 4FOKA 2VI0A 1RJPA 1P6BA 2DQXA 3TYDA 3T0DA 1QO2A 1I1WA 3VE7A 4DYJA 4CN4A 2FHFA 4JY9A 4HKPA 3KL5A 1ELSA 3RM4A 4AIBA 4MFDA 3E2RA 2QGYA 2I16A 3TUUA 1PIIA 2ONEA 4LCSA 3PAOA 4AX7A 1AH3A 2DVTA 3MKCA 4JHZA 3KBVA 4AC1X 3UJEA 2Z1WA 4M0XA 1D7FA 2VC5A 1YQ2A 3K5XA 1W5OA 2V6AA 3G6LA 4CKQA 5BMWA 3CAVA 4GVGA 2PU0A 4Z2JA 2BY1A 1H7RA 2PCEA 1AJ0A 3EPMA 4P8WA 4LYQA 3CBWA 3RN6A 2PTYA 2G41A 4LW7A 1WZAA 3U2ZA 4PCFA 3VZXA 1VLIA 2VYOA 2QUNA 4UQ9A 3DG7A 4L9ZA 3QQWA 4H7CA 5I07A 4CNSA 3FN9A 1W1ZA 5I79A 4IG2A 2PDMA 1V02A 3KOZA 3W1PA 5K9CA 2PWFA 3FCPA 3LZ3A 5DY3A 2ZKMX 2B7NA 4YMZA 4GO9A 3H4GA 1BF6A 2J79A 3GYCA 2VD9A 2J8TA 4HN8A 4YHGA 1XF0A 2XIMA 4ATWA 1W3LA 1Y65A 4GJ1A 1IR2A 4PUUA 1BFNA 3CHDA 1IEWA 2WCSA 3T0TA 3PZ9A 4YTTA 4ZE5A 2ZX9A 2X7WA 2PRLA 2YJQA 3W7JA 1Q2RA 4LCRA 4O53A 4C6NA 3OVGA 2VD8A 5A6MA 2YCKX 4JTSA 3P61A 2OYMA 2Y61A 4W8BA 2Z26A 2W67A 1VH7A 1HO4A 2HVNA 1J0JA 3AYRA 2HE5A 4E0CA 1Q6LA 2ALDA 2VFEA 1MFVA 1OYCA 4AVOA 1VQTA 5HXMA 1RD5A 3E74A 1ZPTA 4M6UA 2VZUA 1TMLA 1XRFA 1XIHA 2GK1B 3K8MA 3WK2A 3WNLA 4XTIA 3B97A 4AXKA 2Q8LA 2QKFA 3ITVA 3W9ZA 3MI3A 2WPGA 1NQKA 5M03A 1OK4A 3K1GA 1E1FA 2GWNA 2RDUA 1B3ZA 4P5UA 4NRSA 3HGSA 2BGQA 3KZSA 1ML1A 1JPIA 4Q4MA 3USZA 2GJXA 3F2BA 2G3FA 3LCIA 3KVMA 4NAEB 5DCEA 3DC8A 3UXLA 3ARPA 5ABTA 5CPQA 3PHAA 2OOFA 4J3SA 3VKAA 4OWGA 4S3CA 1NOUA 2CW6A 2H3DA 3SURA 3GZ3A 3KRSA 1SFSA 1Q66A 2W4XA 4DUWA 2XM1A 3FS2A 3VD4A 5A6JA 1JR1A 3QBUA 2QUMA 3N2MA 1KXQA 3LRMA 1EXBA 2EF9A 1P4CA 1H7NA 3WBWA 1NDWA 4OV4A 3G1XA 1EXPA 1WE5A 1CI1A 5CZTA 2AKZA 3WFAA 3MTWA 2GL5A 4NYYA 4NRRA 4QE1A 3PUOA 3BAXA 2YL5A 3P8IA 2WCAA 1JYVA 1OC6A 3UXKA 1UUOA 3R12A 4S3EA 3U2CA 3TYZA 5HJYA 1EUAA 3LM7A 5ECUA 1H7WA 4MY1A 2VO5A 2NQZA 2PDKA 3WUFA 2E0PA 2O4MA 1QW7A 3W1TA 1RD6A 4C7FA 2XINA 5HQEA 2FJUB 2R1PA 2BB0A 2QW5A 5F4SA 2ZZ4A 1KCXA 1Q6GA 4IQLA 2J9YA 4MLJA 3TJLA 3BAIA 1L8PA 3OZOA 1JDFA 5I23A 1KTBA 4QITA 4GCAA 1CXEA 4X9SA 4RZ6A 1KLZA 4IGMA 1L6YA 1JCYA 3NO5A 4GZ7A 4ORIA 1DJWA 5RUBA 3B8SA 1QPNA 1J11A 3RITA 3REQB 8RUCA 1E9ZB 3QF0A 3MY9A 3MMWA 2P8BA 4G6CA 4F2TA 2QDGA 2GVJA 3DH7A 5JIWA 1XLJA 2CERA 4D8LA 4EAYA 3LXAA 9CGTA 2WC3A 1VENA 4TVCA 1L6SA 4S2BA 1FVPA 4S38A 3CLMA 4B5VA 1BHGA 4X0VA 1OG0A 4DJFC 1RCXB 1ZBKA 4NF7A 1J10A 3KS5A 4WF7A 3ZLFA 1EJWC 1E1CB 5EMKA 1I4NA 5LA2A 3QR0A 4EWJA 4MKVA 8XIAA 4Z17A 1RPKA 1PHQA 2VURA 3VIOA 4HN4A 3TV8A 4QCFA 4INFA 1XLFA 3A5FA 1P6WA 1HKKA 2G97A 2V82A 3DKJA 1J79A 1EJTC 2P5NA 3R2GA 2Y5EA 3O0FA 1K4HA 5XIMA 4IFOA 1ZCCA 3G0SA 4PH6A 1A4LA 3S42A 1MW1A 1AL7A 1R7OA 1W5PA 4XK2A 1O68A 3N13A 4Z2GA 3R6IA 4FI4A 3NJ3A 4JZ5A 3GAKA 1G4EA 4IMGA 3CQ0A 4JHOA 1KBBA 1K4GA 1G7UA 3WQ6A 4KETA 1XD0A 2R9RA 3GW0A 1OQFA 2ACQA 6ALDA 1C91A 2DPEA 3C8NA 3EMQA 3RJXA 3F4NA 3RU6A 3IK2A 2VEFA 3EXRA 3BJSA 4C60A 4C6DA 2X2GA 1HTIA 1GQKA 1FCVA 4AIOA 1GJPA 1VYSX 3M46A 1S3TC 3PB2A 1SM9A 2POTA 3URBA 2R6OA 3SSZA 3RNDA 4IGHA 4FXRA 1DQUA 1O7AA 3G2GA 3W01A 1JYNA 4A05A 3KX6A 5TBOA 4JX6A 4LNYA 1ITCA 5IBXC 3CU2A 2BS9A 1R3WA 4HIBA 2IXVA 4ZB5A 5LKYA 1YTEA 2WJDA 2DZUA 3ELFA 1KFWA 3DI1A 1W3IA 1XLBA 2DT2A 3L4TA 1PE1A 2J8FA 3KBJA 3PPHA 3CZKA 1BYAA 3GR4A 3KS6A 2QDHA 1ECEA 2WHMA 1IZJA 1T41A 4JFTA 4WSJA 5FESA 2CHNA 2ZFAA 3KOYA 5LXXA 3ES8A 1HJQA 1KRCC 3Q2DA 3VI2A 4MPQA 4MMWA 2HWGA 3B8WA 1S5NA 2OPJA 3CIWA 3U3HA 4TX6A 4FP1A 3SGUA 3KTXA 5KMYA 3VDCA 3WN6A 1IEIA 2ZE0A 5HULA 1YTKA 1FKWA 2UV8G 1V6XA 4A3QA 3SAZA 4JTCA 3CQKA 3KLLA 2BLEA 4E6MA 4ATLA 3N3MA 1V0NA 2PDUA 2DV0A 4JYFA 4UR8A 1GHSA 3GG1A 3HG4A 2P53A 4YLWA 4H7ZA 3VX0A 2WNQA 4CGTA 4ZCWA 3GU9A 4F2UA 5B80A 3T0CA 2GGJA 1ZZMA 1K8YA 3CZEA 1XBZA 4DJDA 2OEKA 1QK0A 3L68A 3C3UA 4Y7EA 4Y9NA 2VCBA 4A8NA 3MDWA 3H22A 1O95A 4Y6GA 1JZ2A 4PZVA 2W27A 1V3KA 3M9YA 3M5XA 1LF1A 4NXSA 4GZIA 1E5NA 4C6OA 3IGSA 4ZOAA 4C1NB 2YBUA 2OQLA 5AHFA 5AFDA 3U7VA 3WUBA 2YDAA 1UCWA 4OOUA 1KKOA 2REQA 3AIWA 3QR1A 2WC7A 3UNTA 4QTGA 3CPGA 3DFPA 2GWGA 1KXVA 1GQIA 4UZUA 3DFQA 4HYVA 2HEJA 1UR4A 4PBEA 3B03A 4UFHA 3U5UA 1CECA 4LXFA 4WY0B 4UTLA 2HPMA 3B9DA 4EK7A 4C6BA 2ZRWA 1KD0A 3MHUA 5FJPA 4IF2A 2YSWA 2YXOA 5G1TA 3B9NA 1FY6A 2WMGA 3CEPA 4F40A 4F0RA 3PUGA 4L7ZA 3NQEA 4ADSA 1A0DA 3WQ5A 1QVBA 2VX5A 1QOXA 4MJ2A 1QOPA 3NDZA 4KIRA 2OFJA 5D30A 5CH9A 1UMYA 2W6RA 1XGZA 4FNSA 3MCMA 3HOJA 4Q4QA 3RRAA 3I3DA 4PBGA 1UWUA 4HZ8A 3EA2A 3VU2A 5H1WA 4JCMA 3DX5A 1JPKA 4EXBA 4HSNA 4S39A 4FO4A 1A49A 5DELA 3EB2A 4JFWA 4R7JA 4MZYA 3TCEA 4DPPA 1JULA 2V5KA 3QH2A 2G96A 1J2BA 4OIFA 1UA7A 1LRQA 1JNEA 2VFDA 3ZIZA 2HK1A 5DLCA 4KF1A 2OSWA 1ICQA 1LYXA 3OLDA 3N34A 3MI2A 3GC4A 5FEWA 2OG9A 3IIVA 4UFKA 3NQAA 5HMDA 1MEIA 4MWAD 3G1SA 1RVGA 4L4PA 1JDAA 1Q4WA 3MBFA 4UZSA 3BMWA 2A21A 3NZRA 1YDNA 1E6SM 5M2FX 1OFBA 4Q8OA 1C93A 1WB0A 2G50A 3SI9A 1QNVA 2QEZA 4I7UA 2A2IA 3VKDA 1AFSA 3UYIA 4EIVA 2KZHA 3M64A 5C9WA 3NR0A 3NCOA 1NM9A 3AS1A 2QPXA 3WJSA 1U5VA 3SQSA 1WP6A 4EACA 2UY5A 3C3NA 4B90A 3MYPA 3MHGA 4K1GA 3A3HA 2HROA 4AD5A 2DQWA 1UBSA 4KCWA 4UTWC 4Z2LA 4PB5A 4PUMA 3B8TA 2W63A 4FALA 3SM0A 1ITXA 4DM1A 1KCZA 4K7VA 3VKJA 3PS7A 2RDTA 3BXWA 1UWSA 1OC5A 4D1IA 3L0KA 3S8HA 3VUSA 2E68A 3PAJA 5I06A 4XZLX 5F7UA 1SVDA 4YTSA 1FWAC 1WBHA 3G1HA 4DNHA 3H21A 3O6YX 4O1DA 2Z24A 2E28A 3V4BA 1GTHA 2PDBA 1LOQA 2WLZA 4U31A 1KW1A 1H62A 2PDHA 2R1KA 4NNAA 1M1BA 5HQMA 3PTQA 3R1ZA 4ZEPA 3LYEA 3GTFA 1EO5A 3PBVA 2DUZA 2OYLA 1CXHA 2QHAA 4XIMA 5D9MA 4QJ1A 1ZENA 1E4MM 4TXEA 3L65A 4UC5A 5DEZA 5LIXX 3A4XA 1W9BM 4CD5A 3QGVA 4XSLA 3EWYA 3B04A 2GGEA 1NH6A 1PZ2A 5FJOA 3EOSA 4C5YA 1UD8A 3SSJA 4L9XA 4M51A 5G4EA 3THCA 2PWVA 1IXQA 3KL0A 3NWRA 4J27A 4JQ2A 5EA9A 1ZBWA 3ZJ6A 3A3WA 1XKYA 2RKXA 7ENLA 3CTTA 4FXFA 3VDGA 2B81A 1FA2A 3GVWA 4PTWA 4HNTA 2PB1A 1BRLB 3IAPA 4ROPA 3UJ2A 2J6XA 3WCZA 2V67A 2BGNE 5EMYA 1X1OA 1NEYA 3VDBA 3W83A 4GIRA 3SCWA 4KGJA 3W27A 4JTLA 1UPPA 4LPCA 2DVXA 2V81A 1QHOA 2AGTA 3I65A 3GIPA 2XGBA 1TPUA 5EB8A 2NSXA 3WLHA 4E4PA 1GVEA 1YLVA 1Q5MA 2CETA 4WCJA 2EGZA 3SECA 5JH1A 3S2LA 3BWWA 2OO6A 2WMHA 5LIWX 2GGIA 3IJQA 3BJFA 2QQ6A 1NJJA 3FW6A 3IVUA 4JDYA 2OVLA 2PGFA 5C5YA 1V7YA 1Q7MA 3RCMA 1OC7A 4XAGA 1DHKA 1DKWA 3UY8A 3RO8A 1SZRA 2RDWA 3I4KA 4UOQA 4Q8NA 4H8VA 3IGHX 3UPMA 1LLZA 2CLMA 3NO3A 3OHIA 5AYIA 4MY8A 1MXSA 1LWHA 1P7TA 1P0EA 3CUGA 3AU6A 1E4IA 1BG9A 1OZMA 1W3NA 2HDJA 3M0YA 4GHRA 2CZVA 4PUKA 5CKSA 2ZZ5A 3S1UA 1X6UA 3SJ3A 3EOOA 3PZQA 3KCOA 4FR1A 1V6WA 1MYRA 5JQ9A 2WJZA 5EY5A 2E9MA 4BF9A 4Q32A 3UA4A 4K6AA 3LCLA 3R79A 1PV8A 4NAFB 4REQB 4J40A 4ZA0A 1C29A 1J0HA 1TSIA 4RZ4A 2DSUA 4L80A 3MJYA 4MPKA 3VOHA 2XM2A 1LG1A 3LUTA 3EX6A 3MUY1 6A3HA 1Q85A 3ZMRA 3GR7A 3PUDA 2WSQA 1LL4A 1SU5A 2EKGA 2PP0A 1F8MA 1AG1O 3V35A 4JIPA 1NSJA 3VYLA 5LIUX 5IHRA 4X60A 2YKKA 3WLTA 4J3XA 4S3KA 2PD5A 1JZ7A 2V5LA 1YKWA 1NWSA 4D1JA 4PTNA 4NQ1A 2VP8A 2WWDA 1IYXA 3LI0A 2VGIA 1RSCA 1G69A 4GQQA 3W2KA 1E0WA 3V7PA 3CMFA 3C2EA 1EJUC 3MUXA 1LRTA 3H23A 1LLOA 1WUFA 3QRHA 3PNUA 3AMLA 3AO0A 5BRPA 4DXVA 4AY1A 1C9WA 3P14A 5J8LA 2WSKA 1XLCA 4AH7A 4WZHA 1DXFA 5HNRA 2J4GA 2YA2A 3G1YA 5CPLA 3BQ5A 1CNVA 4DO7A 3UWZA 2FPVA 3A3XA 4H2CA 2E8YA 2YDQA 3K30A 4D8ZA 2X41A 4IM4A 1VRDA 2D0HA 2ZWYA 3W4RA 1FWJC 3FXGA 3EDEA 3BSHA 4YCOA 2Q6ZA 4CCEA 5IHSA 3UU0A 3EMCA 1PX3A 3UR2A 4ACZB 3RLVA 3CGTA 4ZO9A 1QASA 2BWGA 5C9UA 2E1DA 4DNMA 3HQPA 2O4QA 4C7DA 4EKJA 1M68A 4XAYA 2NUYA 1GKQA 3IS4A 1C8QA 3M41A 3TC3A 1W91A 5DBUA 1IXOA 1HP5A 1T8QA 3PWIA 1O5RA 4LSBA 1AW5A 1XYMA 2HK0A 3TSBA 4IPLA 1X8FA 1W32A 1J5TA 3SIZA 4IZGA 3V0UA 4BHYA 5FI8A 4J9JA 1HFBA 1TPWA 1VGAA 1UQZA 3WQWA 3O16A 2YCEA 2E1WA 2XN0A 2J47A 4UR9A 2GVEA 1F07A 3ANUA 5I03A 2F9RA 4GCXA 1SSDA 3LBOA 2D2HA 3EWZA 4GFIA 2IW0A 1RPXA 2E09A 4PC8A 2V9DA 3E1F1 4NZ3A 2PLKA 4LUTA 2J66A 5DMLA 4LS0A 3KAOA 1SZGA 2HQAA 1R46A 4JFVA 3IGXA 1TMHA 3WEZA 3FFSA 2C8NA 3VCRA 4CNPA 1JCLA 1H4PA 1XRSA 3BICA 2GVYA 3MUCA 5A95A 2A7RA 1B3WA 4QE5A 4A3UA 3ZT6A 1XIFA 1ISWA 1VD6A 1EDTA 2EPOA 4AQLA 3OP2A 1T40A 2Q71A 3THDA 2PLMA 2ZDRA 3CASA 1L6FA 4O17A 3QC0A 1BF2A 2VMFA 2VM8A 4RR4A 1AZ1A 2QVNA 2WK2A 3PY2A 5CEWA 4UQCA 1TJ0A 1NVMA 1LTDA 1MUMA 4Z2IA 4BEQA 4NJHA 3VZYA 3A4WA 2PD9A 4DRSA 4BI7A 4U28A 1YBQA 2CXEA 1E15A 4ACYA 3QW3A 2BVWA 1QI2A 1RY0A 3F5JA 4GUHA 1E56A 3BV4A 1JCMP 4OHQA 5D2WA 1KGUA 1ZL1A 5LNUA 3GDBA 4PMXA 4L56A 4GO8A 3ABSA 4AB4A 5KEZA 3ATYA 1JCJA 3SR7A 4JR5A 4S23A 2XN1A 2WMJA 3L21A 5CSYA 4H83A 5K7JA 3C4UA 4IL2A 3UWEA 1A5AA 8CGTA 2Q3OA 1LQ0A 5CLWA 4Z1DA 4F8XA 3GTXA 2D1ZA 5EYWA 4HMNA 1TCDA 4DO4A 4J5NA 4B15A 3PPGA 2UZ9A 1YYAA 1OX4A 4KW2A 5I5RA 1GYNA 3FOKA 1PKYA 4ZFMA 3PTDA 3NDYA 5C7VA 1J5SA 3W71A 2OQYA 4IMFA 5I00A 4IGNA 4QR6A 1VFTA 2XZ9A 3B0YA 4YTQA 5M17A 2Q8ZA 3WDHA 4OBSA 3BLKA 5AHIA 2VX6A 4AYGA 4EF9A 4GC3A 3W37A 4ASTA 1XJBA 1JUBA 2PWGA 3UJRA 4HD5A 5JIPA 4QE4A 1UA3A 3QMSA 3FK4A 1BVZA 1TVLA 2PSNA 3SUTA 2CESA 3CNYA 1WKYA 2BBFA 2HXUA 5J04A 4QFUA 2UWFA 1TJ1A 3LXCA 1HGYA 1K6AA 1L2UA 2CKSA 4LAZA 4DYKA 1QCWA 2VC9A 4IMEA 4Y9OA 2CBVA 4LFYA 2QIWA 2V5CA 3WF4A 3SFWA 2D20A 3SO7A 4MGGA 2AAAA 3MVIA 1A5UA 1F3TA 3HMJG 4YJ5A 4LJ3A 1TIWA 1ESWA 2VRJA 2VZTA 4RNIA 4C7GA 3CK5A 4AEFA 3EDJA 3I7QA 4G2DA 4KMQA 4FF5A 4NI3A 1UMLA 1ONEA 4XD3A 3FGCA 2FGZA 3RIKA 2I57A 1OD0A 1C8VA 4QSFA 4UQBA 1T96A 3WDPP 1KFJA 1Q7ZA 1NWUA 3AYVA 1KBLA 2E67A 1ME8A 3KXQA 1RH9A 4MJZA 2VEIA 3DI0A 3C0JA 3KM8A 4EE9A 3NA8A 4DWSD 3QZEA 3VIHA 1EL3A 2ATSA 2F2HA 2W62A 3LQGA 2PF0A 1X96A 1CDGA 2H9AA 1JI2A 2CZ5A 5DMYA 4LVBA 2I1OA 4FLQA 3SRDA 2ISWA 2NQ9A 2OX4A 1CTNA 1UZHA 1Z32X 2DH3A 2NX9A 1GVQA 3NDOA 4NJGA 1MO0A 1E51A 3AHVA 3STGA 4GH1A 7PTDA 3N18A 3I7SA 1T6MA 3VABA 5E1QA 2ZCGA 2AL2A 5LIKX 4YIWA 2MUCA 3B3DA 4PBFA 1YEYA 3UETA 3UZXA 3GBEA 1KFLA 3QTGA 4WOQA 5FJUA 2BGSA 2PRMA 2A3CA 4N4QA 4PB3A 4EAMA 1X1ZA 3AQUA 4UXDA 4M7TA 1PKLA 3NPWA 1TPH1 1R9ZA 4RPQA 2YYTA 1XLHA 4KCTA 4QEEA 4AVFA 1SYTA 4YCPA 1NP2A 2WYSA 3K4DA 3DCPA 3W29A 4CEXC 4XKYA 1GJUA 3S2CA 2CLPA 4FHAA 4JYDA 4LAKA 1C8XA 1XSJA 2HS6A 5A69A 1XGEA 5I3HA 1KTNA 2JIEA 3KDNA 1ME9A 2IPGA 4NY2A 1K9EA 1PBGA 5EU9A 1EDQA 1W31A 4FB7A 4XZWA 2CHRA 4Q4PA 1R86A 2WHLA 3CV2A 1AVAA 1EHAA 2ZRUA 3BAYA 4C6EA 4V15A 1KXHA 4AHQA 1SW7A 3ZLGA 1VFLA 1GPFA 1VEPA 1MQRA 2ZADA 5I78A 1O5KA 4CD8A 2VENA 1XLGA 4RNHA 4D9PA 2OJPA 2OMAA 4KRZA 3JU2A 4L9YA 1TZ7A 3W7NA 1EF2A 3S5OA 2J77A 2DEPA 3I6TA 3T55A 3BCJA 3F1QA 4Q8PA 3T2QA 4ZFCA 2WPBA 2VGGA 2ZRZA 1I9CB 1K3UA 1JPMA 3ISIX 1XYZA 1LL7A 3B8VA 4C6KA 3ABQA 3W88A 3E38A 2ZX6A 1DE5A 2ON3A 1UR9A 2QIIA 1BXBA 3LU2A 5JU6A 3KVJA 4U3AA 4C1LA 3P60A 3QR3A 4CVWA 3QZ6A 1GGOA 1OVDA 1UR1A 2VEMA 4PRTA 1DWJM 3SCOA 2ZRVA 3KOXA 3EGJA 4IIDA 4WVXA 4M1RA 2VZVA 2ISDA 1K8XA 3TCSA 1BTMA 2XSAA 4XBJA 4HOWA 3GDLA 1TO3A 2DSZA 3KTSA 1E1EA 3OGSA 4LBUA 3AHYA 3LPFA 3NPXA 3W2NA 1KM1A 1FH7A 3CHFA 2FZBA 2GJRA 1E0XA 1VEMA 1PKMA 4UFMA 2WBKA 3LZ5A 2QMKA 1G1YA 3T09A 4QAWA 2PBOA 4PSPA 3GXNA 1H61A 2PDWA 3GTIA 2Z4GA 3EPNA 1P5BA 4GZJA 4D6JA 3WF1A 1N8FA 3MZNA 1SFTA 1VP5A 2ZC8A 4O57A 4CN1A 1KR1A 5CC7A 4LC8A 3AHXA 3FAWA 2CZDA 3TAOA 3BOFA 4U33A 3OOQA 2G3NA 1TV2A 1T7LA 3QPZA 4WEVX 3NVTA 4JN8A 1ITQA 4WR3A 2F38A 1JL8A 3ITXA 4IG2B 3V16A