3OVPA

Crystal structure of hrpe
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
221
structure length
221
Chain Sequence
b'GCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose-phosphate 3-epimerase
publication title Conversion of D-ribulose 5-phosphate to D-xylulose 5-phosphate: new insights from structural and biochemical studies on human RPE
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 80
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2010-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ovpA00
2VELA 2JKAA 2YZRA 1PL9A 1A53A 1M5WA 2XN1A 2W79A 1L6SA 3Q37A 4DELA 1KLYA 3LXAA 2FTPA 1EP2A 5D05A 3W70A 1IIHA 1S5TA 1IF2A 3C8FA 1HFBA 5DXYA 5I3JA 3VCRA 4UTWC 2AQWA 5IBXC 3B04A 3B0UX 2BSLA 4LS2A 2FIQA 1VLWA 1T8XA 3W71A 2ZCGA 1DQXA 4JTUA 1W56A 4KFNA 1G4TA 4A21A 1GT8A 2YSWA 4O1DA 1O5XA 3GDKA 3OA3A 4OGZA 2ATSA 4RJEA 5K4ZA 1F5ZA 4BWLC 3NPUA 1C29A 4X3ZA 1QO2A 3YPIA 4ADTA 1ZCOA 1CX9A 1IXOA 3TH6A 1LBLA 1J4EA 1R30A 1ONRA 4NJGA 2ZRZA 3CWNA 4P2VA 4UXDA 3W7OA 3G3DA 2V5BA 1W3NA 4NNBA 1ZALA 3W1LA 1KFJA 3I6RA 5K3VA 5C55A 5D30A 3P61A 3I7QA 3TU9A 3TFXA 1KTNA 1FWSA 3UWUA 3OVRA 4HSNA 2G96A 3CWOX 3NO5A 1QR7A 1FY6A 1TREA 1KFCA 2B7QA 4MLRA 1LOLA 3N14A 2TMDA 3O15A 1HO1A 4LVAA 3KHJA 1OX4B 1ME7A 3L2IA 3ZS4A 4QNEA 2G95A 5DY3A 4HNNA 1EIXA 1UASA 2CZDA 2J27A 3B06A 3E12A 5KZMA 3LHYA 3DHDA 1LBFA 3FIGA 1WYIA 4OU1A 5DBTA 5D2YA 3DI1A 5AYZA 2XN0A 2JGYA 4DO6A 1GVOA 1X1ZA 3W74A 1SO3A 2BX7A 1H60A 3M5XA 4XZ9A 2HS6A 4UFMA 4X9SA 5AYXA 2YX0A 4PFMA 3TW6A 4WOQA 3WK3A 3BG3A 3S5OA 5AHNA 3CQ0A 2XN2A 1TPWA 3E0IA 4N4PA 2QCMA 2ZRVA 2YYTA 3PUOA 1J2WA 3JS3A 4PA8A 3IGUA 1K7EA 3LB0A 4NT0A 1VJIA 4L4MA 4FX6M 4RX0A 4UFLA 1LP6A 1X7FA 4LRSA 5FEZA 3ABQA 3S5ZA 3G8RA 3LCGA 5CGQA 1B3OA 3W83A 1UUOA 4LV4A 1EEPA 4XQ6A 5G4WA 1JQVA 2ATMA 1A5SA 3QW4B 1DVJA 4I9AA 3H54A 1OFAA 5LNRA 4AF0A 2EAWA 2GJNA 1TPH1 2ZRYA 1C8VA 3QQ0A 3TC6A 2E6FA 3W22A 1KM5A 1AMKA 3WK1A 1EUNA 3W1AA 2E6DA 3V1PA 3R2GA 2VXNA 1O94A 4IQLA 3E49A 1H51A 3F4NA 3NQDA 4JTIA 3TXZA 3PC0A 1R2SA 2NUXA 3OIXA 2CW6A 2FPVA 1CI1A 1VGAA 4WZHA 3O8AA 4EF9A 2D73A 3HG2A 2Q3OA 4DF1A 2PRLA 1X8FA 4IGHA 1THFD 1DHPA 4KWVA 2Y6ZA 1TPDA 4O16A 5EY5A 2PCQA 2FQIA 1NAL1 1DBTA 3MYPA 4I7WA 4PL1A 5AC7A 3EWZA 1YXDA 2Y7GA 3NQ7A 1NFBA 2QDGA 4WD0A 4IUOA 3IIXA 4GJ1A 5L9FA 2GOUA 4YL2A 5AOUA 1VZWA 1A50A 2X1TA 2B0MA 1W5OA 4OBTA 3L66A 4Y8FA 1TPUA 3LRLA 3ANYA 4UFKA 3FKRA 3I7RA 2WNQA 1VQTA 3G0SA 5I3KA 1OFDA 2Z1BA 1Z48A 1XBYA 3C0JA 4H4IA 2GQAA 1XCFA 2J24A 4Z1BA 4DBEA 1F76A 4NVTA 3LRMA 1R2TA 4QNWA 1RR2A 4KWWA 1PCKA 4AWTA 1OFEA 2QCDB 1R2RA 3IIZA 4Z1AA 3QMTA 3P7YA 1GJPA 3HPXA 5CZ0A 3UZJA 4Z0SA 3GK0A 2UV8G 1R47A 1OK6A 1FDYA 1H50A 2RKXA 4LUJA 3W7DA 2NXHA 1G4PA 4AMAA 4C1KA 2P10A 3QSRA 2WNZA 3CPRA 4RR4A 3EX1A 2H90A 3BW4A 1XM3A 5BOOA 4GXMA 2YW4A 3ABSA 5KINA 4TMCA 4QIUA 1SQ7A 1DORA 3RMJA 1OX6A 4GBUA 2OJPA 2QUUA 5LGZA 3L5MA 3NVTA 8TIMA 2BXVA 1VCGA 3FOKA 4NX0A 3P60A 1F6PA 3S1VA 4DPQA 1WXJA 3CM4A 4MJZA 2GUUA 2V2CA 4GUHA 4Y9AA 2X30A 3C2VA 1ME9A 4O0KA 3UWYA 2WSRA 2TRSA 1AW1A 4YWIA 1JR1A 1YDVA 3M43A 3H55A 3UPBA 1LLWA 3MWAA 1TRIA 2HMCA 1XI3A 2A6LA 4WJEA 3MYOA 3KVLA 3DKLA 5DELA 3QQ1A 1RQBA 2Z6JA 4IXHA 1TSIA 1GWJA 1U5JA 3UD6A 2BZNA 3I65A 1ZFJA 1H5YA 1TCDA 2C18A 4WY0B 4FNRA 4O18A 3QPYA 4JTSA 2NXIA 4X22A 4RV8A 3PG9A 4K36A 5E0KA 2QKFA 1QOPA 1SZEA 3SW6A 1F74A 4MUZA 5KITA 4R33A 5BW6A 3KVKA 4XTDA 3G1FA 3WJXA 4ZQPA 3O6YX 4AEOA 1TPFA 4O4WA 1J5TA 3CU2A 1ME8A 4MFEA 1YDOA 3QEZA 4HT3A 1LDCA 3C2FA 1QO5A 4PC8A 5U7SA 3VE7A 4WY0F 4UTKA 5F2MA 3TAKA 3GXNA 2OT0A 5J5DA 2ZZ2A 1OHLA 3TC7A 2QAFA 2ZYFA 4GUGA 1G7UA 2JBMA 1KW1A 1AG1O 4EVZA 3NQVA 1ICPA 4X2RA 2V2DA 3RFAA 5KMYA 1FXQA 3W76A 3S6DA 3NL2A 4MYAA 4FX7A 4M7TA 3W2KA 3RNDA 2A6NA 1OF6A 4O52A 1F05A 1JCNA 5A5WA 2VEKA 2NWRA 3GR8A 3W7CA 2G97A 3PSVA 2EKCA 3GZ3A 1GEQA 4OT7A 4JTFA 2OT1A 1VC4A 4LTSA 2C0AA 3W2UA 2QJIA 1ALDA 1XKYA 1K8YA 3STCA 5K7JA 3M5ZA 1SO6A 4ZQMA 3GVGA 3PS7A 4ORIA 1XFBA 3MW7A 5D09A 3ZR4A 4E2BA 2QJGA 4ICNA 4NUWA 3S8HA 2VKZG 4AWSA 5LNSA 2YFNA 4R7JA 3T7VA 3VKJA 3UNDA 3TNOA 2ZRUA 3UY8A 1D3HA 5C5YA 1AL7A 3HOJA 3S1UA 5AHMA 4DO4A 1N8FA 1IIGA 1PVNA 4JTKA 3F03K 2F7FA 5LNWA 5HMSA 4JX4A 2WJZA 4BF9A 1AK5A 2Y88A 4ZVJA 2H6RA 4HNTA 3FEMA 3W23A 4PCFA 3M47A 4TR9A 3G22A 3TROA 3W7QA 5CPOA 1S5WA 4UUIA 3NM1A 3UWZA 3E02A 1K7FA 4IWWA 1H7PA 1PV8A 1M6JA 2VC6A 3NEVA 3EXTA 2DZUA 4M6PA 4LW7A 3PR2A 5FEWA 3L0KA 1ZNNA 3K30A 1A5BA 3LV5A 1TO3A 5D32A 1Q3NA 1TTQA 3JR2A 4ALDA 3R8RA 2A85A 3CTLA 1GTEA 2C15A 3GAYA 5EPDA 3TJXA 1MO0A 2X1RA 2OZ0A 3NQGA 3NQCA 1K02A 1FCQA 5F4WA 6ALDA 4Q32A 4ML9A 5HR6A 3M0ZA 2ZZ7A 1FXPA 1JUBA 2PRHA 3TFCA 1VCFA 3G1DA 1SFLA 3QMSA 4BI7A 3EXRA 3KXQA 2O7QA 1C9DA 4JX6A 4HKPA 3D0CA 3PAJA 3BG5A 1XXXA 5G2IA 5I3HA 1KV5A 5G5IA 1FQ0A 4GFSA 5KZEA 3N2MA 4FNPA 4Y6GA 3P82A 3M1ZA 1OVDA 1B4EA 3S42A 3KVJA 2V9DA 4BK9A 2WKJA 1G4EA 5EBUA 1HO4A 5LNUA 5HNRA 3GB6A 3HJZA 1H7NA 1I2OA 2V82A 5F4SA 1FCBA 4RLIA 3IIVA 2NLIA 1NSJA 1PHWA 2P1FA 1W1ZA 1TMHA 3CHVA 2ZZ3A 3FYOA 2DZPA 1I2QA 3MHFA 2LLEA 4FNQA 5D02A 3NXFA 5F1VA 3LERA 3W86A 2W0UA 4IMFA 1PCWA 3KAOA 2J88A 1DL3A 3BV4A 3F4WA 3W1MA 4R53A 3DGRA 3W7HA 5HINA 4N9BA 3VI2A 1ICQA 4LVDA 1DKWA 1WAUA 3LTSA 1KFEA 4JGDA 5DY2A 4UMBA 1RQHA 2QUVA 2A4AA 3G18A 4B5NA 3CT7A 4UNLA 1Q6LA 2V30A 3DFNA 3PULA 3EWYA 4K6AA 4LWWA 4PODA 3WK2A 5I3FA 3W87A 3JRKA 1ZAJA 2R91A 3G3MA 1NF0A 4AXKA 2Q8LA 4GUJA 3LRKA 4QITA 3T4CA 2VFDA 4IX0A 1A5CA 5EKYA 2NX9A 2ZA2A 4NQ1A 2RFGA 3GDTA 2ZA1A 4EOUA 3ZFHA 3PWAA 1JCLA 1YXCA 3W3OA 3G24A 3O63A 5I3IA 2DU2A 2A1YA 3BLIA 4L4LA 1H7RA 3W9ZA 4ZQNA 3RLVA 5BMXA 1T0OA 3STEA 5HWJA 5K9CA 2Y7FA 1IGSA 2ZBTA 4UTLA 3SI9A 3NQ8A 3U8GA 1TTIA 1K8ZA 3NZ1A 1QMLA 2HS8A 4QJ1A 1SW0A 1M7OA 4JY9A 5C54A 1X6UA 2B7OA 1YDNA 3LXBA 2BWGA 1VHCA 3MBDA 2ISWA 5D33A 3M5YA 1MZHA 1SO5A 1ZJIA 1KTBA 3VFLA 3LCHA 1MEWA 4O1CA 1ZAHA 1MEIA 2A7PA 4O12A 1PHQA 3KFTA 1XBXA 1D9EA 3DAQA 4LS1A 1LRTA 3DH7A 4MZ1A 1LTDA 2X16A 1Z42A 5K9XA 1WDWA 2ZDRA 3W07A 3W7NA 4N4QA 5AB3A 1VRDA 5LHEA 3R89A 3LLDA 3HIJA 1JULA 1EUAA 1OYAA 1YTEA 3ABOA 3AO0A 3IVSA 4UTTC 1I2NA 1OFPA 2FPTA 1ICSA 3GDRA 3SGZA 3HGOA 5EMUA 3HO8A 4LOCA 4ZQCA 3S1WA 2E5BA 3IVTA 1JQXA 1O5KA 1VH7A 3QPZA 4CCDA 3IGXA 4IPIA 2WQPA 1Y0EA 1FWTA 3SFKA 3GIYA 2V2HA 1BEUA 3M9YA 4N2YA 4MY1A 2DP3A 3P84A 4GRSA 5BNKA 4DF2A 1SPQA 5H91A 2QJHA 3TV8A 4JD4A 1TRDA 1VR6A 4ONVA 2J9YA 3NQAA 4WXZA 3HQ1A 4K39A 4UFIA 3W7PA 3P67A 2ZFAA 1DV7A 3PY2A 1XDMA 3THAA 2E77A 4XBSA 3C6CA 4QM1A 4MY8A 4GUFA 1W3TA 3TMQA 4JEQA 3ABRA 1I2PA 1AW2A 1FDZA 5FI8A 1JJKA 1GVQA 5AN7A 3DENA 5KZDA 1KBJA 2RDWA 2DORA 4RZ4A 3PBYA 3DFQA 1XC4A 1N7KA 1UUMA 3LTPA 4JS3A 3U6WA 1OJXA 3N34A 3WJWA 1L9WA 4KFPA 2KZHA 5CSSA 4HPJA 4U4MA 4TU1A 1VYPX 2RH9A 5DLCA 4O54A 5AHEA 1R46A 1GPWA 4O0ZA 1FCUA 4KFOA 3KRZA 2B4GA 4XKYA 1W8SA 3TAOA 3N9RA 1IXQA 2FFCA 4LY8A 2FLIA 3MBFA 2ZTKA 3UWWA 1JRBA 2E5CA 3P8JA 3FFSA 4N9DA 4AVFA 3C2OA 3W2LA 3ZWSA 1W31A 4OHQA 5D03A 2FJKA 4GNJA 3CIWA 4DO5A 4QQ3A 1FBAA 2AGKA 1T99A 4RXGA 3LOTA 2FB2A 5A8GA 4BI5A 2YW3A 1KM0A 4LC6A 1BWLA 3NOEA 3W84A 1WOBA 4JR5A 2VFGA 1YXYA 1TIMA 2GVJA 1P4CA 2RHGA 2QCHA 2C13A 2C6QA 1W5QA 4K38A 2WSYA 3FYPA 4ZMGA 3FS2A 3PBVA 1YTKA 1OF8A 4HPXA 4N6FA 5F2LA 4EF8A 3M41A 3IRDA 4O53A 4ADSA 3WJSA 3C4UA 4GC4A 2HSAA 3L21A 3M6YA 3P8IA 5AC6A 3QFEA 3BLEA 5AHIA 3PM6A 5KTLA 2GPTA 4OV9A 1YTDA 1AW5A 4JTTA 1P0KA 2CZEA 2J9ZA 1EWEA 2CLHA 4JICA 5D2TA 4JTEA 3Q2DA 3UY7A 3HPZA 1Z44A 2NX1A 3SJ3A 3T44A 1LZOA 5K2ZA 5DXXA 4UC5A 3SECA 4O8RA 2WSQA 3EEGA 2A7NA 3UXDA 4FXRA 3BGJA 3VNDA 1ML1A 2OX1A 3LTYA 3LCWA 3U2OA 4GUIA 5LGXA 4O14A 1OG0A 3W1TA 4AHQA 3EXSA 3INPA 3B0PA 3W72A 1P5BA 1L6WA 2DZVA 2JKPA 3C61A 5E93A 4N02A 5CKSA 3FKKA 4NZFA 2VEPA 1M7PA 3NDOA 1K8XA 1GG0A 3BO9A 2C14A 3O05A 4LRTA 2CLMA 4PEKA 5G1YA 1H63A 1OFOA 4CQ8A 4DQWA 3LHVA 4XTIA 3NQFA 4XUGA 1O60A 1KM1A 2H8XA 2V5LA 5C6MA 3C52A 5HUPA 3T55A 2BLEA 3A5FA 2QUTA 3NPXA 1BWKA 3W2JA 5U4NA 2VOMA 3MP5A 1TPC1 4LT9A 1FWRA 3GKAA 2NZLA 1GVFA 4MLJA 2GVGA 3OHIA 4LUIA 1RPXA 5FF7A 3NA8A 2A5HA 4JTLA 1K03A 3WK0A 3W1NA 1WQ5A 1W5MA 2YYUA 1LBMA 1FCVA 3DKJA 2Z6IA 3R13A 2GJLA 3W85A 4NU7A 1TQXA 2OCZA 4O10A 3G0UA 1E51A 1G7VA 2QR6A 5D37A 2CLOA 2RDTA 3F1QA 3CB8A 2TYSA 4CNPA 3NQ6A 2QCDA 3E96A 1LM1A 4IOTA 2OMAA 2BTMA 3HG3A 3BARA 4UR7A 3LHTA 4O50A 5DBUA 1ZAIA 3GYEA 3S9YA 4K7VA 1L6YA 3TSDA 5F2GA 4YMZA 3W1XA 2X1SA 1WA3A 3CEPA 3LM7A 3RF9A 3EX6A 2Q8ZA 2VEIA 4E38A 4UIOA 4DXVA 1EPXA 3RLUA 3NQMA 2C16A 3W7KA 3IV3A 3GLCA 3TJLA 5D2XA 3P80A 4WX2A 3BPWA 2VFFA 4HIBA 3W1QA 2GQ9A 3NG3A 4UR8A 4IMDA 4BR1A 4FIRA 5FF2A 4LVFA 3S5NA 3EWUA 5D2VA 3HBLA 1QPNA 3BG9A 2Y61A 3SZ8A 1TYGA 4POCA 4M6VA 1H7WA 2EHHA 3EWWA 3PVFA 1OYCA 5HQEA 4ZZ9A 1S3HA 3LBMA 5AYYA 1KM4A 4FEZA 5D38A 3G1VA 3PBWA 4XWUA 1KTCA 3B0VC 5LKYA 3W88A 4UTMA 1JRCA 4NZJA 1N55A 3GNDA 4YXGA 3RK8A 1V7YA 4WY0A 2ISVA 2JKEA 2Y85A 1VHNA 1YYAA 4MPQA 2ZZ5A 3TMLA 3IEBA 1XL9A 3NL5A 2C1HA 4ORMA 4NNCA 1LORA 3W6YA 3O6DA 1U83A 3LCLA 4NJHA 1SZNA 4JIPA 2O7SA 3CEUA 2A2IA 4EWND 2CWNA 1KV8A 4UTWA 4O1BA 4PTNA 2B7NA 5IBXA 4Q33A 2YCEA 3P81A 3C3NA 3L67A 5CZTA 5DCBA 1O95A 4ZQOA 3W2NA 1WV2A 3OBKA 1D3GA 4M6QA 4AHPA 4Z1CA 1I8JA 2NXGA 1YLVA 2Y62A 2H3BA 2CLLA 2IQTA 3DI0A 5HWMA 4K8HA 1OFRA 4AH7A 1X1OA 1T96A 2QCGA 4N6EA 2ZTJA 4RCXA 4BWLA 3PBUA 4LVGA 1W3IA 4LC8A 4A22A 2QCEA 1SSDA 3BLFA 4O28A 2EGZA 4FNUA 3MI3A 3HMJG 2EF9A 3TXVA 3QRHA 4Q4KA 4OWGA 1B57A 2TPSA 1VYSX 4Z0JA 1UCWA 4JXCA 5LSMA 4QSHA 2PE4A 5D04C 3SSJA 2TSYA 3N73A 2X2GA 2CU0A 5EL1A 1F2JA 4O11A 1ZENA 2E09A 5TBOA 3KVMA 1KA9F 4JTJA 1I2RA 5G1TA 1IXPA 3TUUA 3UYCA 3PB0A 3DU0A 3LDVA 3NL6A 2ZZ4A 5BRBA 3ELFA 1VS1A 1H1YA 4MYXA 2NV1A 1OABA 4NJIA 1LYXA 2J6XA 4O17A 4DPPA 1AL8A 4YCOA 2YPIA 3GAKA 4MIMA 1TJRA 3W7LA 1LROA 4J9JA 2QDHA 2QCLA 5HJLA 2PC4A 1LOQA 1KM6A 3THQA 3FJ6A 4IXXA 2YGYA 4A2RA 1KFBA 3DFOA 1SW7A 2DJLA 3HB9A 4OV4A 5HWNA 3B05A 4NJJA 1IXNA 3QMRA 3EX2A 2CZ5A 2H8ZA 3L65A 3DFSA 4Z1DA 3HG5A 3L5LA 2CFFA 3HF3A 4JY8A 4MY9A 1WX0A 2R8WA 4IMEA 4AAJA 4A2SA 3S5YA 3MMTA 2DZWA 3C2EA 4D2JA 1Q6RA 5CZSA 4O57A 4AWUA 1OFQA 4AF0B 3TIMA 3O16A 3LHWA 3N3MA 1EP3A 4FX8A 4WXYA 2ISSA 3LCFA 3PSWA 3B03A 3G1AA 1MSSA 5EYWA 3SR7A 3GR7A 4HN4A 3UXAA 1QFEA 4CCCA 3HGJA 4FIQA 3WFAA 4JIQA 1Q6QA 4U28A 3TQVA 1SW3A 1TPEA 2VFHA 3O6CA 4H3DA 4JX5A 4O19A 3EX3A 3V75A 3OG3A 2QCCA 4LNYA 1BKSA 3AJXA 3LHUA 1NEYA 3UQNA 1EX5A 3EX4A 4IX2A 2QCNA 1TV5A 1BTMA 1SR9A 1EWDA 1ZHAA 1W5PA 3S1XA 4O13A 2F84A 2VENA 3BGGA 3SGUA 3EWXA 5E1QA 1SSGA 3FA5A 2QF7A 1GG1A 1PE1A 3MJYA 1B9BA 4XKYB 3QSTA 4UFHA 3NGJA 3EKZA 3L68A 2A7RA 3MI2A 1DOSA 4JN6A 3EWBX 2ZRXA 4MZ8A 4LVBA 2YFOA 4N9EA 1O4UA 3L9CA 1GVSA 5CSRA 2JK2A 2G5WA 1VPXA 3A22A 4UTJA 2V81A 1OK4A 1W37A 4A29A 4S2BA 4HHPA 3QH2A 4FNSA 4A3UA 4YCPA 2RDUA 3LI0A 1TV8A 1ADOA 2B7PA 4NXKA 1YADA 3G1XA 4KKXA 1LRQA 3SIZA 3LCIA 3TDFA 3PG8A 2C3ZA 4MJMA 1SZFA 3EB2A 1LLZA 3TQKA 1G4SA 3DFTA 3RU6A 1MEHA 4I7UA 4M19A 4Y96A 3IVUA 3SY5A 1RD5A 1KLZA 3LX9A 3TE9A 3GDMA 3UWQA 1FDJA 3P5YA 3NR0A 2Y89A 2E68A 1XDLA 4S2CA 1W54A 4IJBA 4AB4A 2J9XA 1TV7A 2NUYA 2GQ8A 1SZGA 1PS9A 1RZMA 4PH6A 1ZY9A 3UWVA 4K7YA 2WPBA 1TPB1 1QPOA 4CQ9A 4BFAA 3S0CA 2WV8A 1Z41A 1QNVA 3BW3A 3G1SA 3QC3A 5L6UA 1QWGA 3R5EA 1WOAA 2JGQA 3N9SA 1K7XA 4CCEA 1XUZA 1FWNA 4JNMA 3HPSA 1OX5A 2CZFA 5KSWA 2VFEA 3TR2A 5AHLA 5GVJA 3QZEA 4ADUA 5DN1A 5FF4A 5T26A 5TQLA 5HR7A 4W9TA 2H3DA 4JDYA 1JVNA 1W0MA 3STFA 4CLMA 3NAVA 3NZRA 3W2MA 3A24A 3B8DA 4K8EA 1EB3A 1L2UA 1TQJA 1WBJA 2QEZA 1OX4A 2PRMA 2YR1A 5LNVA 1F73A 1JCXA 1HTIA 2A21A 2CLIA 1H7XA 1H62A 1G67A 3MI6A 4NX5A 3TX9A 3LGEA 1WBHA 4IMCA 4JDBA 3KOFA 1SUXA 3UZ5A 1PIIA 2ZA3A 5J5RA 2ZZ6A 2NWSA 3MP4A 3NYZA 3NNTA 4NJKA 1FX6A 4LU0A 4O15A 1TTPA 1LCOA 4IMGA 4FF7A 4LV9A 3NL3A 2EPHA 3CC1A 4C1LA 1Q6OA 1TB3A 1OYBA 1Q45A 3I68A 1GYNA 2Z2UA 3L0GA 4QISA 2VFIA 2E5DA 4JTHA 2R94A 2A0NA 3TCEA 3MP3A 5FEPA 5HULA 3EKLA 1SU5A 3ATYA 4S1FA 1I4NA 5AC8A 3KX6A 4MOZA 3PUEA 3USBA 4LS0A 1H1ZA 4XBKA 2NX3A 3C2RA 4DEFA 1KBIA 5D2WA 4HNVA 3WJYA 3MHGA 4NXSA 5AFDA 4MFDA 1XUUA 6TIMA 4OQVA 3NQ2A 4E2DA 2E6AA 4CQAA 1GVRA 4WQ6A 2Q3RA 3TQ0A 5AHFA 5ABTA 3FLUA 1UBSA 2ZQ0A 1G69A 3W7MA 4DF0A 3P62A 1QCWA 3L5AA 5HUOA 3TA6A 7TIMA 4NNAA 5G2WA 2WO5A 3O1NA 3ATZA 1YPIA 4TO8A 1QOQA 4CNOA 3GXTA 2PURA 3KRSA 4OE7A 3LXCA 5FF3A 3G8EA 4R34A 4ZL1A 1DQWA 3W7RA 3OVQA 2E6YA 3M44A 4JYDA 1JUKA 3CLMA 5MHBA 4RXFA 2ZZ1A 5CZJA 4EIVA 4PL2A 4WUIA 1MXSA 5F2IA 4TX9A 1H7OA 3NPWA 4IPJA 4AHOA 4UTIA 5I3GA 3TSBA 3MO7A 4HSOA 1FWWA 3B4UA 1YPFA 1B4KA 3MUXA 5H2ZA 2ALDA 5EA9A 2YXGA 3R12A 1KFLA 2HTMA 2NUWA 4M7SA 3W1UA 1NF7A 4FB7A 1W5NA 3W7IA 2DZSA 4N9CA 1JCJA 3QM3A 3GDLA 5TIMA 1TPVA 3OEXA 2ZRWA 5DCDA 4O4VA 4BI6A 1XBZA 4RZ5A 1LOSA 1GQNA 5K9DA 3LBCA 2I14A 3IIOA 2VEMA 5LHFA 3N19B 4WOZA 4UMAA 4UTUA 3WJZA 1KFKA 3DZ1A 3PF3A 4QAIA 3Q94A 1XBVA 1SO4A 3H53A 3LHZA 1EP1A 3BK0A 2DZTA 3FJLA 5DCEA 3BVJA 2Y63A 5SWUA 1VYRA 1TJPA 4HNUA 3VE9A 4P61A 2ABBA 2X1UA 4JTGA 1LRNA 1QPRA 1EA0A 3QYQA 2I1OA 2QAPA 4MKNA 3TSMA 3HG4A 3STGA 1KM2A 3PB2A 2FB3A 1GZGA 4E0CA 3A5VA 1GOXA 4TIMA 4I7VA 5C2XA 1JCYA 2XFWA 3HGSA 4GWEA 3NPVA 4UNKA 5F1UA 4MVAA 4H6KA 4ZQRA 3OVPA 1H61A 3NM3A 5FESA 5K4XA 2W6RA 1KM3A 3A23A 1QPQA 3M16A 3N2XA 3DHFA 4TMBA 1NVMA 4UCGA 2YDAA 1V5XA 4GE8A 2CLEA 5FF0A 1VLIA 1I45A 1GTHA 2WOQA 3A21A 3E9AA 3UPWA 2WNNA 1P1XA 1DJQA 2QCFA 3M5VA 4FO4A 3P5ZA 3W7EA 1QDSA 3LV6A 2CLFA 3HGRA 2DJXA 3I7SA 1SFJA 3DBPA 3T40A 3M7WA 2FDSA 2Y70A 1K3UA 1F7BA 4UMCA 2FPYA 4Z08A 3C56A 4FXSA 2Z0IA 3W73A 3LLFA 3TK7A 2I9EA 2V0TA 3W7JA 2V8ZA 4YLWA 4O1AA 5G4EA 1HL2A 1OFBA 4RKAA 3W7GA 4FNTA 4RK8A 5CPLA 4G1KA 1A5AA 5IM51 1RVGA 3G0XA 1QAPA 1UJPA 4DBDA 4CNNA 1CW2A 2Y7DA 1P0NA 2NV2A 3ZWTA 3W75A 1VCVA 5LZLA 3G1HA 5F4XA 2R14A 3TKFA 4UFJA 3CIXA 1JCMP 4UTHA 3BW2A 4MZYA 5BMWA 3QW3A 4RZ6A 3TW7A 3L0NA 3LCXA 5G2HA 2ABAA 3GXPA 3O06A 2Y7EA 3A9IA 1F6KA 3P74A 4K37A 3GNNA 5CPNA 1HG3A 2P0OA 1UB3A 2GVLA 2CLKA 1G6CA 1JUEA 3QJAA 3DFPA 1TTJA 2E1DA 5FEXA 1S5VA 4JYFA 3IIPA 3GX9A 3T78A 3NQEA 1GYLA 1RV8A 3Q58A 1DJNA 3DXIA 3W1PA 3KRUA 1HUVA 3IGSA 5CPMA 3GKFA 3QF0A 1RQEA 4FHAA 2C19A 3MHUA 4Y90A 3O07A 3W1RA 4UTTA 2AAMA 2DZXA 3PUDA 3LI1A 5CG7A 3G1YA 1FUYA 4JYEA 4M5PA
chains in the Genus database with same CATH superfamily
3TTSA 2XVGA 3LM3A 1PAMA 4RDVA 2YZRA 5HA7A 1M5WA 1L6SA 1JPHA 3Q37A 4V1YA 3U57A 3MKCA 1HFBA 1UR3M 3B0UX 2HROA 2BSLA 3VA8A 1VLWA 5FJTA 2QS8A 3TYEA 3K13A 5A6BD 1PZ0A 4KFNA 4D71A 4A21A 1GT8A 2YSWA 2QMKA 3VKDA 2VEFA 3GDKA 2GJXB 2ZX7A 4WSKA 5BRPA 3OA3A 3LLXA 1FHDA 4RJEA 3VIFA 5A94A 4BWLC 3NPUA 2PEVA 1QO2A 3KRBA 3Q67A 1J4EA 1V6VA 1ONRA 4NJGA 2ZRZA 4NF7A 3B3DA 2V5BA 1T40A 1W3NA 1ZALA 5K3VA 2BOFX 2OVLA 3I7QA 3TFXA 3Q65A 3VFCA 1PPIA 3OVRA 1Z7AA 3C86A 2B7QA 4L1WA 5AECA 4HOZA 2AMGA 3N14A 4NZ3A 3KWSA 2WHMA 1XFCA 1VIWA 3KHJA 4PMZA 3VKBA 4QNEA 3E12A 3IK4A 4ZTYA 3FIGA 1WYIA 1GEHA 2XYLA 2PWGA 1ZS2A 2XN0A 2JGYA 3W74A 4S23A 1KGXA 1QI2A 3OYXA 1RHCA 1AH4A 3R1ZA 3RDKA 5AYXA 2HK1A 2BG5A 3TW6A 1GHRA 4WOQA 4L4PA 3S5OA 5AHNA 3V36A 2XN2A 4ZTXA 2ZX8A 2ZRVA 5GQBA 2C0HA 3JS3A 2VJXA 1VBRA 4RW3A 2J7FA 2WWCA 1X96A 1ZJBA 1XYFA 3CZ8A 1FWIC 2VX4A 5I6SA 3GG1A 5FEZA 3EA2A 4DWSA 4JN7A 1B3OA 3VOHA 4LV4A 4XB3A 1EEPA 4XQ6A 4UQ9A 2ATMA 4I9AA 1OFAA 4AF0A 2ZX9A 3G2GA 3WK1A 1CENA 1TZ9A 5D9OA 1ISVA 3OZOA 3F4NA 1XPGA 2XIBA 4G7EA 2NUXA 3WDJA 3VM5A 4AIEA 5AZ1A 2A3HA 3HG2A 4PSPA 2PDNA 3WENA 3PZ9A 4IIEA 2Y6ZA 3B8WA 1NAL1 1OCNA 3ICJA 4ACYA 1JAKA 2XDFA 2VQUA 3NQ7A 1NFBA 4RDYA 4FK9A 4WD0A 3IIXA 4XAFA 2FGBA 5AOUA 1VZWA 2X1TA 2OWXA 2W3ZA 3L66A 3MUCA 4Y8FA 3ANYA 3I7RA 1Z48A 3C0JA 4H4IA 3DFYA 4Z1BA 4DBEA 1F76A 3RGTA 2F6KA 3WLPA 3MVTA 1PCKA 4AWTA 1BTCA 3LUTA 4LNCA 3VIGA 3QMTA 3WBXA 2BVWA 4AD1A 4Z0SA 4P8XA 1JI2A 1OK6A 1FDYA 3B8TA 4P8VA 1G4PA 1NJJA 3HTWA 4MJ2A 1K6AA 2WNZA 2X8RA 3EX1A 1KRBC 3UETA 3SRHA 2YW4A 4TX8A 1ZUAX 4DNMA 1JXJA 2QPUA 1DE6A 4B5XA 4GH3A 1C7TA 3BCFA 3FOKA 4NX0A 1HXJA 1A5LC 1F6PA 1S38A 1UH2A 4MJZA 2VT0A 4Y9AA 5C2CA 2CKSA 2GDVA 4IGNA 3VIIA 2TRSA 4YU1A 4ZO7A 1CXFA 3KZPA 4WJEA 3QQ1A 4IXHA 1TSIA 1VF8A 1ZFJA 1XLDA 1TCDA 2EG8A 4WY0B 1Q6EA 4O18A 3QPYA 4JTSA 1QW7A 2NXIA 4X22A 4AQLA 5I3DA 3R8HA 3NVDA 3LQLA 4JZ5A 1G1YA 1XIHA 5KITA 3DC0A 1KKOA 4HVXA 3KVKA 4XTDA 4QCFA 1OQFA 3D47A 4G6CA 1PDZA 3RJXA 1DEDA 1TPFA 4D8LA 4WSHA 3CU2A 1Z8AA 1XKJA 1YDOA 3QEZA 5LYRA 3C2FA 2D0GA 5F2MA 2OT0A 2ZZ2A 1JI1A 1HW6A 4R5EA 1G7UA 3WLMA 1KW1A 2FGZA 4KWUA 1BSIA 3KLKA 1ICPA 3BLOA 4J28A 4HB7A 2Q8XA 4M7TA 3RNDA 1CWYA 2VEKA 4ZB5A 4QHRA 4IJCA 2G97A 5CG0A 1J93A 3GZ3A 1IEWA 1VC4A 1MXDA 3WEZA 1XKYA 3M5ZA 1XFBA 4G2DA 6XIAA 3UCCA 1CTNA 2WANA 4ICNA 1FH9A 5CCZA 5LNSA 2YFNA 1ITXA 1TA3A 2ZOXA 3F5KA 4JNYA 3T7VA 1XYCA 3KBNA 2ZRUA 5C5YA 1AL7A 3HOJA 2RGMA 2ACRA 3VZZA 4CN6A 1PVNA 4ZOCA 3M0KA 1OG6A 4PCTA 1S2CA 1EL3A 5HMSA 2WJZA 5BXRA 4GYPC 4KT2A 4KCVA 1LJYA 4ZVJA 1NM9A 2HVMA 3FEMA 3TJ4A 1JDFA 3M47A 3G22A 4R7WA 4CU6A 2A3CA 1H7PA 1X6LA 5AKQA 1EO5A 1S2UA 2OODA 3F4VA 2E28A 5FEWA 5D32A 1Q3NA 2XH2A 3PNZA 3VYLA 1SFSA 2A85A 1GTEA 1IEVA 3LMZA 3BLPX 1P0EA 1W2VA 5HR6A 3M0ZA 2ZZ7A 2PTXA 1JUBA 2J7HA 2PRHA 2QJMA 2WJFA 1C8QA 3QMSA 1SM9A 3KL0A 2WK2A 3KS6A 4BI7A 3O3RA 1V02A 4JX6A 2Z24A 4HKPA 3PAJA 5A1AA 1VENA 1UD4A 1AD1A 3BG5A 1XXXA 5I3HA 3QBUA 4H6EA 4MPKA 3PWIA 5FKYA 1N8WA 3P82A 4BK9A 1ZZMA 5EBUA 4KRZA 4C6QA 1D2KA 3BICA 3WFLA 3GD6A 1FCBA 5F4SA 1NSJA 1PHWA 3OLIA 2P1FA 4EACA 2QYGA 2ZZ3A 3QHOA 5I00A 1I2QA 3MHFA 4FNQA 1BQCA 4MTVA 2DZBA 4GI6A 1V93A 2PWFA 3W86A 4E3VA 2W0UA 4IMFA 1PCWA 2J88A 1EYEA 1UC4A 4US5D 2E8YA 4AD0A 2G37A 1T7LA 4S39A 1KRCC 3W7HA 1GKPA 4Q8OA 3DESA 1ICQA 3SFWA 4V27A 1WKDA 3PBGA 3KDNA 1KFEA 3PAOA 5M3WA 2WYSA 4B5NA 3CT7A 1YDYA 3SURA 3PULA 3W6LA 1Z32X 3WK2A 5I3FA 3JRKA 4H1ZA 1ZAJA 2R91A 3G3MA 1SVDA 3OVGA 2HNHA 4S3FA 2WMKA 2D20A 3KP0A 2RFGA 4J3WA 4A3QA 1KR0A 4C6DA 1YXCA 3RX2A 2DU2A 3BLIA 2AKMA 4ZQNA 4C7DA 3CUFA 4KWOA 1IGSA 3K2GA 2ZBTA 1UZ1A 4L6HA 3U8GA 1TTIA 2PBGA 1DIEA 1D7FA 1K8ZA 2HS8A 2XGBA 1X6UA 3B9DA 5A6MA 3JW7A 3LXBA 1E1FA 1MZHA 3PTDA 1LQ2A 3L4UA 3SCQA 3CS2A 1EBHA 1E0TA 1HNYA 3FVMA 2XM2A 4WDTA 3LCHA 1MEWA 1ZAHA 3VIKA 2BVYA 2XM1A 1D9EA 3DAQA 3IJ6A 3WX7A 4KERA 1KBLA 1A47A 1WDWA 1BF6A 3W07A 3UXIA 2PWEA 4N4QA 4LQ1A 4BQ2A 4ZO8A 1JULA 3ABOA 3IVSA 4UTTC 1XSIA 4MAVA 4U2YA 3HGOA 3PUGA 1UA7A 5EMUA 1TV2A 3HO8A 2NSOA 2E5BA 5A6TC 1XLIA 1JQXA 1UWRA 2DUZA 4IPIA 3ARSA 4ENLA 6XIMA 3SFKA 4GCAA 4N2YA 1DJXA 4F48A 3S2MA 5BNKA 1U33A 1HGWA 4LUSA 2A3EA 1TRDA 4F9JA 3NQAA 3RR4A 4QDMA 4UFIA 2Z2AA 4RW5A 3U4FA 2J6VA 3W7PA 3P67A 1CYGA 1DWHM 2ZFAA 3AIUA 1IR1A 2PLCA 4XBSA 4QM1A 4MY8A 4RE4A 1E6QM 4Z2HA 3TMQA 3ABRA 1GVQA 3NDZA 3N9KA 1V3JA 1KBJA 3MKVA 2DORA 3W24A 3MPGA 4WDUA 3D5HA 3PBYA 1EJVC 2REQA 5A6AA 1UROA 1UUMA 4CGTA 3LTPA 4H7ZA 1JAEA 3WJWA 2KZHA 4HPJA 4U4MA 4TU1A 3B8SA 2RH9A 3W6MA 1E0XA 4TUFA 2OEMA 3N17A 1IV8A 3GRIA 3DFHA 1OEPA 4O0ZA 1FCUA 1UP0A 4L64A 4KFOA 3KRZA 2B4GA 7REQB 3TAOA 4AEFA 3GU9A 3PPCA 1EX1A 1IXQA 2FFCA 3MBFA 2ZTKA 3UWWA 1JRBA 2E5CA 4BY3A 4FLQA 1VFLA 4WKFA 3TTEA 5AY7A 4GNJA 3EOSA 4DO5A 3F5JA 4RE3A 1PTGA 1KRAC 3LOTA 4M24A 3RR1A 3V0UA 1EPVA 5A8PA 3OGVA 1KM0A 2QGHA 1BWLA 3NOEA 1YXYA 5FJRA 2BGNE 1REQB 1TX0A 2QV4A 2QCHA 4K38A 2WSYA 3PBVA 1OF8A 4HYWA 3V35A 2E3ZA 1Q65A 4O53A 1WXZA 1WKFA 3KCJA 3IJQA 3FVDA 3C4UA 4DAFA 3M6YA 3P8IA 5I23A 3BLEA 4REQA 4XD3A 3W02A 2GPTA 4MNKA 4LAZA 3WMBA 1Q6CA 4GJIA 3B0XA 4I9MA 3WNLA 2CZEA 1I75A 4AW7A 3AXHA 4JICA 1R3RA 3MSDA 4HMDA 2YA0A 1HJUA 1Z44A 3SJ3A 5K2ZA 3UJEA 2OPJA 3PZTA 4O8RA 1PTDA 3UXDA 3UCQA 3LTYA 1RY8A 3U2OA 4AD3A 1ONWA 5LGXA 4O14A 3W1TA 2JKPA 3C61A 4N02A 3WLKX 5CKSA 3AS0A 2BP1A 4JKLA 9CGTA 1K8XA 3O05A 3M4HA 4LRTA 4PEKA 1ODZA 3NQFA 2VRQA 3A4WA 2V5LA 5HUPA 4QG6A 2ZWYA 1KGUA 2PTWA 1NDWA 2VOMA 3ZLHA 3MP5A 1FWRA 1KCLA 2XIMA 1BLIA 2GVGA 3OHIA 5EB8A 1MUMA 2H9AB 3NA8A 2A5HA 4GABA 3WQGA 1H4PA 1Q4NX 2FZNA 5BXTA 2PTYA 2GDQA 3W1NA 1W5MA 1J0ZA 3I4EA 3UR8A 3T6CA 2OSXA 3ANUA 4YVPA 3G0UA 3U48A 4DBSA 5D37A 3IWPA 2RDTA 2QCDA 3NGFA 3VD7A 3WLJA 1ZSXA 4WHBA 3HG3A 1A4LA 3BARA 1OINA 4UR7A 3H70A 4O50A 5DBUA 1ZAIA 2HNEA 1BYCA 3TSDA 1ZBWA 6TAAA 1T5AA 3EX6A 5EMKA 4XAPA 4HGXA 1EPXA 4DUXA 1ZBVA 3W53A 3W7KA 3IV3A 3FA3A 4FLOA 4J2PA 3CPUA 1QVBA 3VPLA 2GL5A 3GH7A 2GQ9A 4I6KA 4UR8A 4IMDA 4FIRA 3RXZA 4LVFA 4OUEA 2ZUSA 2FKPA 1E0UA 4PZVA 1Y5WA 1I0BA 4H8VA 2EHHA 3SCTA 3AU6A 3BC9A 1EC7A 3LBMA 5AYYA 1XWYA 4J2MA 4GGHA 1BKHA 4D9PA 4AC7C 3B0VC 5LKYA 2PBOA 3W88A 1JRCA 1UD2A 2CESA 2YLLA 2ZE3A 4JL1A 2CERA 4MPQA 3IEBA 2GDUA 4RDZA 4DYKA 3VUPA 5CC7A 4ORMA 3N2CA 3W6YA 1U83A 3WIJA 1E1EA 1JYNA 4OECA 3GXFA 2VRJA 1FKWA 3IRSA 2A2IA 3ITLA 1KV8A 4O1BA 5IBXA 1KO0A 4Q33A 4LAMA 4B90A 1LWIA 5I0DA 3P81A 3BAYA 3C3NA 1Q5MA 4NSBA 4BQ3A 4ZQOA 3E0VA 1JF5A 2GUYA 1E9LA 3T0BA 1TKKA 2FZMA 2VNCA 2QVHA 2JIWA 3GTNA 3OODA 1GVEA 5HWMA 4K8HA 1OFRA 5D8ZA 3HFYA 3K4AA 1R3TA 2QPXA 2ZTJA 3QR3A 3H21A 3PBUA 3H4XA 1NWTA 3O7UA 4O28A 1BGAA 1R3VA 3CQJA 3SO7A 4Q4KA 1B57A 3UG5A 3V5OA 2J7CA 3IJ9A 1XW8A 5BU9A 2DUAA 3UPMA 2GGIA 2VCBA 3WUBA 1ZENA 4MWAE 4OVXA 1IXPA 4GMEA 3TUUA 3UGVA 3U0HA 3LDVA 4IP7A 4MAZA 2GSHA 1LG2A 3EDKA 4NJIA 4O17A 2YPIA 4MIMA 1TJRA 3W7LA 2QDHA 2QCLA 1IYXA 1LOQA 4Z1YA 5E70A 3SUVA 2XH4A 2DY3A 4A2RA 5HWNA 4NJJA 3QMRA 5DANA 3PZIA 2V5CA 1EXPA 4N0RA 3MB9A 4DWSD 4OKDA 4MSSA 3UU0A 2CFFA 5D4YA 3CL6A 4HTYA 4PMVA 2PWHA 2R8WA 3IAQA 2RJHA 1XYLA 4IMEA 4AAJA 3I3BA 3N11A 3MMTA 4GIYA 4O57A 4AWUA 3TIMA 1XDJA 1GVYA 4WXYA 3LCFA 3PSWA 3B03A 3G1AA 5EYWA 4HN4A 5J8LA 5JBFA 2EKGA 1C91A 1W1B1 4JIQA 1MFUA 2HXTA 1Q6QA 4KIRA 5HDRA 3TQVA 3BOXA 1A4MA 4CD4A 2E0PA 3SGGA 3V75A 3OG3A 2QCCA 3MJMA 3AJXA 4U5KA 3UCDA 3EMQA 1ZHAA 3BGGA 4DJDA 1R3YA 5LA2A 1GG1A 1PE1A 2WKGA 1BYAA 4XKYB 3QSTA 2Y1HA 3NGJA 2G3NA 4YVVA 3CUHA 1AA1B 2Z1VA 4A6GA 3MZNA 3EWBX 2ZRXA 3IS4A 3L9CA 1GVSA 3T2PA 2B31A 4YTQA 4HZ8A 4MG4A 5JU6A 1FRBA 2HK0A 3VNZA 1RAKA 2V81A 1W37A 4IPPA 1S5MA 2XVLA 4NXKA 5I24A 1RK5A 2W4XA 1YKWA 1W3KA 3G1XA 3GC2A 4QSFA 4KKXA 3WD0A 3DYPA 1LRQA 3A3HA 3SIZA 3RLHA 4EPKA 3VKCA 4B4FA 2PTZA 4S3KA 3PG8A 2C3ZA 4MJMA 4WVXA 3U7BA 4DUVA 4YN5A 1G4SA 5DRIA 4L56A 1BYBA 1KBKA 4M19A 4GQRA 4CCZA 1J9YA 2PODA 3A47A 2BHUA 4F0HA 1RJPA 3KL3A 5DO8A 4JFVA 3AIBA 1S5NA 3P5YA 3S2CA 3NR0A 2Y89A 2E68A 1XDLA 1W54A 5DF0A 4GBDA 3L4ZA 4JFSA 3PJUA 2NUYA 2GQ8A 3BLKA 1SZGA 4LBRA 1UWIA 3USZA 1A5UA 5REQB 4BFAA 1SYTA 3MMUA 4UTFA 3G1SA 3AAMA 2WC3A 1GPFA 3SSZA 1QWGA 3R5EA 1WOAA 4GG9A 5KZ6A 2JGQA 4US6A 1FWNA 3GG0A 5A8MA 4HYRA 3I6EA 3SN1A 1R86A 4W84A 3OGSA 2VFEA 3K1DA 4IGMA 5GVJA 3TR2A 4OOZA 1AQ0A 4ADUA 3IJ8A 5FF4A 4MJ4A 3UR5A 3NXLA 2WHLA 1GJWA 2J66A 3A24A 3H2OA 1JZ4A 4QQUA 3V0TA 4F9DA 2PRMA 4JOMA 3VAVA 3P0XA 1JZ6A 2A21A 2CLIA 3GH4A 4MDOA 3LGEA 1WBHA 4IMCA 5J5RA 2ZZ6A 2O9PA 3S5SA 4FA3A 4CU8A 4TXEA 1QBBA 5T8GA 3NNTA 1FX6A 4LU0A 1RD6A 1PZ1A 1UZHA 3CC1A 1Q6OA 1OYBA 4PMRA 2Z2UA 4QISA 3NJ3A 2A0NA 5FEPA 5HULA 1NWUA 1SU5A 3ATYA 4S1FA 3DGBA 3GHSA 4E5TA 1O68A 5HQMA 3USBA 3VZXA 2ON3A 4LS0A 3QV6A 4XBKA 3CYJA 3QOKA 3NDYA 2GQ3A 3L12A 4W93A 3MHGA 1S2VA 4RV3A 3OBAA 5D9NA 6TIMA 4E2DA 1J01A 5IHSA 2OYKA 4F2TA 4DXKA 1PYMA 4GY7A 4EANA 1TR1A 4H8UA 3FLUA 1UBSA 4DY1A 1XLEA 2ZQ0A 2HVNA 3TZNA 4XO7A 3W7MA 1H0GA 5PTDA 2INEA 3ZVIA 1D7KA 2VZTA 1QCWA 2J13A 1UYQA 5M1TA 3ME3A 3MC5A 2EJ1A 3TA6A 3MKKA 1GKQA 2L5HA 3O1NA 1XIGA 1QOQA 3LXCA 2XUCA 3RO6A 4ZL1A 1QNSA 2QULA 3W7RA 3STPA 5H8PA 1QNOA 4M6UA 1JUKA 4Q22A 4ZSTA 3HPFA 1ONEA 3MSYA 1MXSA 3WF1A 1K8CA 4HZ6A 4TX9A 5GJMA 4AHOA 4ASTA 1IZKA 1FKXA 4HSOA 1FWWA 1YPFA 1B4KA 2V3EA 5H2ZA 1UH3A 3R12A 1KFLA 4KCTA 4FB7A 3WD2A 1XLLA 2AKZA 1RPKA 4NILA 3UT0A 3CZJA 4N9CA 2IKIA 3R10A 3GDLA 1JDEA 1J0KA 4H00A 5TIMA 3OEXA 3UZXA 3BANA 1R3SA 4IHCA 4PGLA 1E55A 1UZ4A 2I14A 3IIOA 1ZP3A 1UMLA 2VEMA 2WMHA 3IJ7A 4UMAA 2ZVRA 2V63A 4C60A 4UTUA 1KFKA 3PF3A 4QAIA 1ZBCA 1SO4A 3WBWA 1XG3A 3BK0A 3WLLA 5DCEA 3BVJA 2Y63A 1BPLB 5SWUA 1RA5A 2Q71A 2OKOA 1TJPA 5H6HA 3SCUA 3VE9A 4CU7A 1EA0A 1K9EA 3QYQA 2QAPA 3TLQA 1M04A 2O92A 5CAKA 1X98A 1GZGA 4GINA 1GOXA 3HMCA 3T09A 1JCYA 3WBYA 4HTBA 4UNKA 5F1UA 3BMWA 3GYCA 3TCSA 4FLRA 2V5DA 5FESA 3C0LA 4QJ3B 1FWFC 4ZO9A 3CZKA 4ZEPA 5TNVA 2W6RA 2FZ8A 2QIWA 1OCJA 8A3HA 2GUBA 1P43A 1DXFA 1O5RA 1J0JA 3CAVA 4EK7A 1PBGA 3RAOA 1TMQA 2DSZA 3MSGA 4U10A 1F3TA 3WYZA 3EYPA 1NOUA 1EZ2A 1WZMA 3HGRA 2DJXA 4PYSA 1SFJA 3IARA 1J0HA 3UFYA 1K3UA 4Z08A 1HZYA 2VC9A 4DJFC 4C91A 3E74A 2V8ZA 3M0XA 2G50A 4NKCA 3W7GA 3VM7A 2OYLA 1R5YA 5IM51 5CXPA 2DFAA 2I17A 2V3GA 1UJPA 1P0NA 4PEEA 4CVWA 1VCVA 2R14A 3GU2A 3LPOA 3CIXA 1ENUA 1JCMP 3BW2A 3QW3A 3TW7A 3VO0A 3L0NA 4PB5A 2DH3A 2OO0A 1RP8A 2ABAA 2CZVA 2Y7EA 1JFHA 3BV7A 5CPNA 2F6XA 1UB3A 5DMNA 2GVLA 4CD6A 5GNXA 4LY4A 1JYXA 1C93A 2E1DA 4H7CA 3IIPA 2EPKX 3GX9A 3NQEA 3GG8A 1GYLA 2JIEA 3CYVA 4QAWA 3OZYA 3BE7A 5B7ZA 4AIBA 4I5UA 2ZDSA 1RQEA 1G01A 3VOCA 1E4LA 1GNXA 1KFWA 3W1RA 3HN3A 2RAGA 2AAMA 2DZXA 4S3DA 4TVCA 3WELA 2QIIA 4JYEA 4WRHA 4BHYA 2CKRA 4U33A 1KLYA 2YKKA 1CGXA 1EP2A 5D05A 3W70A 1B3XA 2W61A 1H3GA 1Z89A 2J78A 4XSLA 4PTDA 2D0HA 3SJNA 3W71A 2PDIA 2O0TA 1W56A 2WVUA 4JIEA 3DDMA 4O1DA 1TMLA 3BGAA 1GOIA 4O1EA 3W26A 1F5ZA 3EZ4A 4IIDA 1C29A 4X3ZA 4NAFA 4ADTA 2CEQA 4FOUA 4TTGA 2V3FA 1IXOA 3TH6A 1UD8A 1VFTA 3NQBA 1GZ1A 1G9HA 3W7OA 7XIMA 1WCGA 2GGJA 1KFJA 1H49A 3AICA 1X1NA 4HHHA 2XSXA 1Z3NA 2UBPC 1ISXA 1K9DA 1JDCA 1RBOB 3ZLGA 1FWSA 2PZNA 2G96A 3CWOX 2A79A 1XCWA 3E0FA 4B5TA 4G56A 1QR7A 3DEQA 2PD9A 3DG7A 1KFCA 2DEPA 3VDCA 3LMYA 2TMDA 1DIOA 3O15A 2XGZA 1ME7A 3L2IA 2YCLB 2ADAA 3EA1A 1EIXA 2CZDA 4D6DA 1EDGA 3LHYA 4JHOA 5DBTA 5I07A 3UXKA 5AYZA 2NVCA 4X60A 4XAYA 5CC3A 4AY8A 3EDJA 1X1ZA 4UQEA 4V15A 2HS6A 2EBNA 3EDEA 1J11A 3M64A 3R4IA 3WK3A 1DTNA 1TPWA 4AZHA 4N4PA 3CZLA 4CEUC 1Z6KA 4CNSA 5HK4A 4XIAA 4FX6M 4UFLA 1UR0A 3K4WA 1X7FA 3RCYA 2CLPA 4ATLA 3G8RA 1DJGA 1W1A1 1XYAA 1TG7A 5IXEA 1DVJA 3RX3A 3CMFA 4Y9NA 1EC9A 3BLLA 1TV3A 3QQ0A 2OU4A 2E6FA 3W22A 3WD1A 1KM5A 1AJ2A 4KGLA 6ENLA 2WVSA 2E25A 3WEMA 1TE6A 3R2GA 1HKJA 1TVNA 3M0HA 1BVWA 1GORA 3FA4A 1M1BA 1XIIA 3NO3A 1XLCA 1R2SA 1XIEA 2IQDA 1CI1A 3QXBA 3FNDA 3F2CA 4AD5A 1VGAA 1VFOA 2D73A 1ITQA 1TUFA 1LQAA 1CZ1A 3WLSA 1DHPA 5DQPA 4KWVA 4A3YA 1TPDA 5EY5A 2AQOA 1M68A 1L0PA 3MYPA 4GKLA 4PL1A 4HA3A 4L7ZA 1XJBA 3EWZA 4JCLA 1YXDA 1ZRQA 2GJPA 3VC6A 4L4OA 1UP3A 4GJ1A 5L9FA 3EA3A 2B0MA 2D24A 2BBFA 1TPUA 3LRLA 3VIHA 1I6NA 2WNQA 1XLHA 1GONA 2QV5A 2GQAA 1XCFA 2J24A 1VBJA 1ISZA 4EXQA 2BODX 2GOKA 2INZA 4KWWA 3IIZA 1H11A 3TW9A 3CAKA 1GJPA 1SR0A 3UZJA 5CZ0A 1EGZA 3RN6A 3GK0A 1YPXA 1R47A 2NQHA 3VOJA 3W7DA 4DZHA 1SJAA 1BWVA 2P10A 4Q7BA 5JIPA 3WQDA 5BOOA 4GXMA 1V3HA 3M0VA 4E4UA 3M0JA 5LGZA 3L5MA 8TIMA 1MVYA 2BY1A 2WZEA 2BXVA 3N4FA 3O0FA 4MWAA 4DPQA 3OU8A 4H19A 1WXJA 1JGIA 2V2CA 3CMJA 4O0KA 2J7GA 1SJCA 1AW1A 4YWIA 1DWGM 3WQEA 1EF3A 1OZMA 3MWAA 2PDXA 1XI3A 1W91A 4LSBA 5DELA 3UD6A 3AFBA 1OIMA 3LQGA 4PMYA 1VP5A 2C18A 7REQA 5LIKX 3WSUA 3PG9A 5E0KA 2QKFA 4HQVA 1QOPA 1OSEA 4V1XA 4JTQA 1SZEA 2D22A 1F74A 4MUZA 3NURA 4WK9A 1I9CB 1UA3A 1BG4A 2VZOA 4ZQPA 3O6YX 4IL2A 2YBTA 4LX4A 1OC7A 4P5UA 2XH7A 2R1NA 4BQ4A 2V6AA 1QO5A 4PC8A 3VE7A 4Y2WA 4UTKA 1UW9A 5CSYA 2QAFA 4DBWA 4GUGA 2VCCA 2E8ZA 3TYDA 1AG1O 4EVZA 3E1F1 1VAHA 5HATA 4LEQA 4P7RA 3GXIA 4X2RA 3URAA 2XVNA 5KMYA 3KCOA 4XZLX 4NZ1A 4I90A 4XKMA 1JGMA 1OC5A 4MYAA 4QG8A 1ZPTA 1OD8A 3CH9A 1OF6A 3GQYA 4O52A 4B9ZA 1F05A 3GG7A 5JIWA 2PAJA 3W7CA 1GJUA 2POTA 4LAKA 4OT7A 4AZIA 1XP3A 3W2UA 2R1MA 4MUPA 2YL5A 3MDWA 1K8YA 3AIRA 4RNFA 4KCWA 3GVGA 1YNPA 1C92A 3PS7A 5ECUA 2PLMA 4E2BA 2QJGA 4DXXA 2PDYA 1AODA 1T6MA 4UNIA 2VVSA 3TN3A 4R7JA 5FIPA 3UY8A 1UR4A 3H7RA 2DSVA 2HDJA 2QMJA 1ZU8A 4DX3A 4PRWA 1N8FA 1IIGA 1YBQB 1JDAA 4D6EA 4Q4OA 3F03K 2F7FA 4DZ5A 1UQZA 1CGVA 3XIMA 2H6RA 4EX4A 3CHDA 3N13A 3V1HA 3TROA 3W7QA 4IPNB 5CPOA 4UUIA 4WSJA 3E02A 4TVDA 2WLYA 3CH0A 1PV8A 2R6OA 1LG1A 3EXTA 2DW7A 1WE5A 1FOBA 4IG2B 3LD5A 4M6PA 3UBPC 3DBNA 4MHBA 1ESWA 3F2DA 1FP9A 4HPNA 1JDDA 4H9YA 1L2QA 1XGEA 3U4AA 4ALDA 4IT1A 4HCLA 3CTLA 2C15A 1EQPA 1UKTA 2OZ0A 4JIIX 5C9XA 4XBJA 3VD3A 3NQCA 1K02A 1FCQA 6ALDA 1YIXA 3KCLA 4ML9A 2VC5A 8RUCA 3TFCA 5EFDA 1FHVA 1JCTA 4KCUA 2PUZA 2O7QA 3HQOA 5CLTA 3A3XA 4DO7A 1KV5A 5G5IA 1FQ0A 4GFSA 4J35A 5KZEA 4Q8WA 2VHLA 4FNPA 4MNJA 3UG8A 3ZVHA 2CC0A 4PR4A 1B4EA 3S42A 3A12A 1DJHA 3OZPA 5HJYA 1CLXA 1G4EA 3ARUA 4X61A 4PUMA 2QLYA 5HNRA 1WPCA 3GB6A 3HJZA 2V82A 4P7NA 5IDZA 2NLIA 3B9OA 2Z2BA 1W1ZA 3CHVA 1WZKA 2Z00A 5D02A 2P76A 1UP2A 3LERA 2VDGA 3H4GA 3IUHA 1YRRA 3QPEA 3KAOA 9XIAA 3L4YA 3BV4A 4C6KA 3F4WA 3AS3A 1RJRA 1XLGA 3DGRA 3WQ4A 5HINA 3VI2A 1OB0A 2BB0A 7PTDA 4JGDA 5DY2A 4UMBA 3VOIA 2QUVA 1F9CA 4IIGA 3G18A 1MW0A 3ZMRA 4UNLA 2V30A 3VGGA 3EWYA 4PODA 5HPOA 4WDXA 4PMDA 3E0WA 4PSRA 1NF0A 2XWDA 4AXKA 5I79A 4J3XA 4Q8PA 2Q8LA 4QITA 3T4CA 4PUJA 2P88A 3MT1A 4FI4A 2ZA2A 4NQ1A 6PTDA 4S38A 1UKPA 4HP5A 3PTQA 2OX4A 2TAAA 1H7RA 3BCDA 4M56A 1PB0A 1T0OA 1V6YA 5HWJA 5K9CA 2OYMA 1KCKA 3SI9A 3ZZ1A 2J4GA 3NQ8A 1PZ2A 4UOJA 2PI6A 3S4TA 3OPSA 4QJ1A 2ALRA 1M7OA 4JY9A 2CBIA 4HHMA 1QI5A 2PDHA 2ISWA 1NFGA 1K77A 1SO5A 3ONCA 1O66A 3WFZA 1IT0A 1ZJIA 2CIPA 3GBDA 6REQA 2GVEA 1CPUA 3VNYA 4O1CA 2A7PA 1K70A 1PHQA 1UR2A 4JPGA 3PZQA 4LS1A 4F4RA 2BS9A 1LL6A 1E9IA 2X16A 4B5WA 2ZDRA 3AO0A 3TYBA 1Q6GA 1FWDC 2Y4SA 4LYRA 3WH6A 3OJGA 2BHYA 3WF3A 1L8NA 4B5VA 2V3DA 4KRTA 4ZQCA 4DVOA 2KAUC 3S1WA 4X2PA 1E0VA 1HJSA 1PKNA 4CD8A 1O5KA 3PJWA 3UJRA 2QHAA 3BURA 1Y0EA 5G1MA 4QGCA 3GIYA 1BEUA 4JIHA 3M9YA 4MY1A 4R27A 3CL7A 3PANA 3P84A 4GRSA 3BMVA 4DF2A 5BYWA 1MW2A 4K39A 3NYDA 2OEJA 3V4BA 1J0YA 1HKMA 1GOOA 1DV7A 1ZB5A 3VMPA 3V7PA 1OCBA 1XLAA 1I2PA 1FDZA 1YE4A 1JJKA 3DENA 2F8QA 1S1RA 3UA3A 2VP8A 4B5SA 2FJUB 2R82A 5ABFB 1T41A 1XC4A 4Q4PA 1TWZA 1NH6A 1L9WA 3VD5A 4J1OA 4O54A 1R46A 1L6GA 1GPWA 1EJUC 1V6UA 2VMFA 3PK7A 4QDWA 4XKYA 1EDTA 3KHDA 5A6LA 4LY8A 1M7XA 3COTA 1RLCL 3P8JA 4N9DA 4AVFA 3KDOA 3CV6A 3IGHX 4OHQA 3TYAA 4Q8QA 4QQ3A 1FBAA 4UBPC 4WIWA 3BQ6A 3KS5A 4RXGA 3UA4A 8XIAA 3W84A 4PBFA 3WNPA 5HAOA 4XIMA 1TIMA 4S3JA 1E6ZA 3HQPA 3JU2A 3RCMA 1SMDA 3KTSA 2C6QA 4GYFA 4GIRA 3FYPA 4ZMGA 2WMIA 4N7QA 1Q4WA 1YTKA 3G6LA 3G77A 4N6FA 2GJRA 3U7VA 2X7WA 4EF8A 3M41A 4PE8A 4JCMA 2FVMA 4DWSC 3GM8A 1W1TA 1C8YA 1NARA 3L21A 5AC6A 5AHIA 3PM6A 3QKEA 1CEOA 2W62A 3QV7A 2Y2WA 3EMZA 1XYBA 4KW2A 4IL0A 3F4CA 3PFMA 2PTDA 3Q2DA 5J04A 3AWNA 4G1NA 3T44A 2DIKA 3P2VA 5AC4A 2G3FA 5REQA 2A7NA 1SGJA 1XRVA 2E9BA 4EPDC 4GUIA 1EGVA 3MQTA 2XGIA 4GK8A 4AHQA 1V8EA 3B0PA 3W72A 1P5BA 4LCSA 4URIA 5E93A 3FKKA 4J3ZA 4LAOA 5JQ9A 3NDOA 1S2AA 1GG0A 4H01A 5FSEC 3WN6A 5G1YA 1H63A 4W7WA 4LB3A 4CQ8A 4DQWA 4FXFA 3TOPA 5M2FX 2H8XA 8XIMA 3GIQA 2XHYA 2VZVA 1DJZA 1B31A 2G8ZA 1BWKA 2NQ5A 3SUWA 3W2JA 3J7HA 1QPKA 3GKAA 4A4AA 4ZA0A 5I03A 4LUIA 5FF7A 1XISA 1J12A 4TX6A 1X7IA 1K03A 3QGAC 1VFFA 1LBMA 4JQ3A 4GX9A 3W85A 1TQXA 1DTUA 4D6FA 2QR6A 2CLOA 1U22A 3CB8A 3LZ3A 3NQ6A 1LM1A 4QE1A 3O0KA 4YS1A 3G1RA 1H1NA 1PZ3A 3LHTA 4PB4A 2PCEA 1QI3A 1R85A 1L6YA 1XIDA 3BOFA 5LIYX 5XINA 3R7MA 1HVQA 2Q8ZA 3PHAA 2VEIA 4E38A 1B3YA 4UIOA 3CUIA 3NQMA 1P7TB 3VX0A 4YVXA 4BKNA 2JF6A 2VFFA 4HIBA 4CD7A 3ZJ6A 3NG3A 2QVNA 4BR1A 5H1WA 4FP1A 1YX1A 3S5NA 3ENLA 3F4DA 5D2VA 1QPNA 2Y61A 1RUSA 4B92A 1TYGA 3VD4A 1H7WA 1B3VA 3PVFA 3M0MA 3VCNA 4ZZ9A 1S3HA 1VBUA 1JEZA 1KM4A 4LBUA 3FDGA 3G1VA 2VO5A 3PBWA 3QY7A 3ARRA 2YDQA 3GNDA 3QY6A 3RK8A 2VYOA 3KLLA 2GLKA 4KEUA 2ISVA 4ICCX 1VHNA 3KBJA 3SY8A 1V0KA 4XUYA 1LORA 3C0SA 4ZSUA 3HJEA 1V6TA 4AZ5A 4CVUA 1RCQA 5GNZA 9RUBA 2CWNA 4F79A 1CXLA 4UTWA 3ERPA 3L67A 5A8QA 1O95A 2I57A 4IIBA 4GY0A 5CPTA 4JTCA 1F3EA 1D3GA 4AHPA 3H2FA 1YLVA 1VFHA 1E73M 4BQ5A 3I6TA 1UMYA 4AH7A 2QCGA 5HMEA 1EGMA 4ZBCA 3QKZA 5BU6A 4LVGA 3WDRA 1SSDA 5RUBA 1JXKA 4LCQA 4LALA 4FNUA 4MKVA 2VC7A 3TXVA 3PJXA 2TPSA 3KM8A 4FR6A 4Z0JA 4A8IA 4JXCA 5LSMA 2PE4A 5E5CA 1RK6A 3SCWA 3AHVA 4Q4RA 2TSYA 3U2CA 2W5FA 4DWDA 2OR2A 1KA9F 1I2RA 2UY2A 3R0DA 4A05A 2FYMA 1WDDA 3C2YA 2ZZ4A 1VS1A 1H1YA 4MYXA 2NV1A 1OABA 5LIWX 1AL8A 4YCOA 1HJXA 3VGDA 1LROA 3ONBA 2A3BA 3GNRA 5DT7A 3FJ6A 2XWEA 3DFOA 2P8BA 3RPTA 1IXNA 5HNNA 2H8ZA 2R24A 4R9XA 1TWIA 4NYYA 3BAXA 3DFSA 1XV8A 4Z1DA 3HG5A 3T8QA 1LT7A 2V5JA 1TE1A 1E72M 3HF3A 4DWSB 4JY8A 2DIEA 1DXIA 1KXTA 4KS0A 2V5KA 1M41A 4A2SA 3S5YA 5M5DA 2VI0A 3C2EA 3T1GA 5CZSA 2Y5EA 4AF0B 3O16A 3LHWA 3N3MA 4PBEA 1BGGA 1EP3A 4FX8A 1AH0A 2ISSA 4HU0A 4UQBA 3QZ6A 3GR7A 4JQ4A 5EMYA 3WNMA 4FIQA 3WFAA 1UR1A 1F3WA 2X40A 4HU4A 3BZGA 4B15A 3CXOA 4P8UA 5A95A 3EX3A 3AXXA 2WC4A 3LHUA 2VVNA 3T08A 4DN1A 1NEYA 1E1CB 3S6TA 3UQNA 4A3HA 3BL3A 1HKKA 1EC8A 4JFUA 4L1GA 4F0MA 1SSGA 3VGBA 2QF7A 1VEMA 3GWQA 4Y9MA 2WSKA 1W2PA 4BJHA 4IF2A 2OLAA 1JNDA 3L68A 2A7RA 1DOSA 2CXEA 4LVBA 1O4UA 3MO4A 5CSRA 2JK2A 3KEHA 5I06A 2XZ9A 1XCXA 4KIEA 5HQLA 4A29A 4HHPA 3QH2A 2VRKA 4YCPA 4IFKA 2B7PA 4NZ5A 2EEXA 1LL7A 1KGWA 4GX8A 3TDFA 3PFRA 1EJSC 3SRDA 1SZFA 1LLZA 2GSJA 4AIOA 3DFTA 2YA2A 4QDPA 2DVXA 3WEOA 4MADA 4Y96A 1KLZA 3UNTA 1US0A 2QQ6A 2VUNA 1HL9A 3H26A 2ZXAA 1CB2A 3FAWA 1U30A 4ZE5A 3MUY1 4IJBA 2Q02A 4AB4A 2J9XA 3AZSA 4MWAD 3TONA 4PH6A 1ZY9A 4QLJA 3UWVA 3AIEA 3GNOA 4C90A 3DERA 1QPOA 1IWBA 1B3WA 2WV8A 3ITXA 5B7YA 1Z41A 1QNVA 4IFRA 1RBAA 2I5QA 1J6PA 5L6UA 2VR2A 1XIJA 1XUZA 3Q45A 4JNMA 3HPSA 3PZMA 1Q8AA 1VB9A 4F40A 4F0KA 2CZFA 2NVDA 3LZ5A 1Q7QA 4ZOEA 3WF0A 3QZEA 1WAWA 1FH7A 3MZ2A 3WBEA 1MUWA 1TWSA 4JDYA 1W0MA 3STFA 4CLMA 1R8LA 1A80A 1YHTA 3MSRA 4K8EA 1TQJA 2QEZA 4ZB0A 1VFUA 2YR1A 3DHPA 1EBGA 1G67A 4NX5A 4JDBA 3UZ5A 1SUXA 3T0CA 3MP4A 4ZXOA 3NYZA 4I6VA 4I5XA 3LENA 5ABHA 4DJFD 1JYWA 4IMGA 4FF7A 3RRXA 3CUGA 1Q45A 3I68A 3VNKA 3L0GA 4ZFCA 2XISA 2DVTA 4JTHA 2R94A 1U1HA 1TJ2A 2J7EA 2IKGA 3MP3A 3DHUA 4D8ZA 3EKLA 1JG9A 3I10A 1I4NA 4E4FA 4MOZA 1DIKA 3DYOA 3U3HA 1S2WA 1H1ZA 2NX3A 5AC5A 4DEFA 4HA1A 1J6OA 4GZ7A 3RUBL 4GIAA 5AFDA 1MNSA 4OQVA 3NQ2A 3DG3A 1RALA 2E6AA 4Q8MA 4CQAA 3AYTA 2EPOA 3BSGA 1ECQA 2DT3A 3AMKA 1JPMA 4DF0A 4YTTA 5HBFA 1GYMA 1H0IA 3A4AA 5HUOA 2Z1WA 4PB3A 2WO5A 4YNGA 1YPIA 2XVPA 3GXTA 3KRSA 3IPWA 3G8EA 5A2CA 2ZUMA 4R34A 4F2UA 1DQWA 3OVQA 1TV4A 3L2MA 2Q6ZA 4S3GA 4NHVA 3H8AA 5MHBA 1EFZA 1ISWA 4PL2A 1DJYA 3NPWA 4UTIA 5I3GA 3TTYA 1XX1A 5EA9A 1PUDA 2YXGA 2BGSA 1XRSA 4YYFA 4M7SA 1UWSA 1NF7A 3KBVA 2PDMA 1VPYA 3AZTA 5CZKA 4HCDA 4P7QA 4TV6A 1PDYA 1T8QA 4B3KA 3OHMB 1TPVA 3TNBA 5DCDA 4C6NA 4RZ5A 1GUVA 4HYVA 3ARZA 3LBCA 5LHFA 2Q09A 3N19B 5FAJA 3K8LA 3POCA 2GVYA 3WLIA 4GH1A 1Z69A 1W9XA 3H53A 3WQWA 3MMDA 4S3EA 2OEKA 1MMFA 3MCOA 4HNUA 4YYCA 4JTGA 3OZMA 4ILSA 3ZXWA 3VOFA 3VIMA 4W87A 3F7JA 3WQOA 3PB2A 2FB3A 3OLGA 3RPDA 1HX0A 1EZWA 3A5VA 4CN4A 1M65A 4TIMA 4I7VA 1IGWA 2XFWA 3G6MA 2Z28A 3OVPA 4I8DA 2AQVA 1H5VA 1H61A 3IV8A 4JFTA 3A23A 3HZ3A 1QPQA 3M16A 2FMOA 3DHFA 1NVMA 1LWHA 4UCGA 1V51A 3C5QA 2WNNA 3N25A 1P1XA 1XD1A 1UD3A 5DMLA 2X0SA 4HA0A 2FHBA 3W7EA 5H8UA 3T42A 2J62A 2Y70A 4JKKA 2FPYA 3CZEA 3T8LA 1W6TA 1X38A 2NV9A 2WVVA 4O1AA 2P8CA 2W27A 5G4EA 4RKAA 1CGTA 1TIWA 3PWGA 1ODUA 1RVGA 2RDXA 1IQ8A 4PULA 5DMYA 3CHEA 5CEWA 1MQPA 1BQGA 3ZWTA 2GFTA 4RL3A 5LZLA 1TZZA 3NTYA 4C7GA 3NSNA 4NG3A 3UESA 4UFJA 1HN1A 3ZIZA 4UTHA 6CGTA 2NT0A 2EG7A 2DIJA 4R9OA 3EOUA 2EPLX 2E4TA 2IPWA 3O06A 3A9IA 2PDFA 4ZFMA 7CGTA 1R6WA 2P0OA 1BAGA 3FHAA 2VR5A 2QDEA 3TC3A 2FGLA 3QV8A 3I3DA 2WQDA 1TTJA 3DC8A 1SZRA 1YBQA 4UOQA 3Q58A 3DXIA 1EJWC 3W1PA 1FH8A 1IWAA 2E67A 1HUVA 3Q4DA 1VBHA 5CPMA 3QF0A 4FHAA 1N82A 1R9ZA 5FJUA 3SUTA 2FTWA 4K1GA 3PUDA 1US3A 3LI1A 3UP8A 1QK0A 1FUYA 2PPGA 1GW9A 5C8BB 3KUMA 4UR9A 4BZYA 4LUSB 3NFUA 3C0QA 2VELA 2JKAA 1AUSL 4M1BA 3TVAA 2XN1A 2W79A 4AYSA 4DELA 2QDDA 5CBIA 3LXAA 1S5TA 1XIFA 1IF2A 5I3JA 3VCRA 2ZXBA 5IBXC 1K9FA 2FIQA 1QHZA 1GOWA 1V3LA 5DMMA 2ZCGA 1DQXA 2NQLA 1ZCCA 2B81A 4JTUA 3DECA 3SBFA 1L8PA 4QRNA 1FTXA 3KWXA 4Q8TA 1QOXA 4A8RA 4I3GA 3CV1A 2PWUA 1GQIA 4R3UA 2YXXA 2QW5A 4OGZA 2ATSA 1V3KA 1Z9AA 1LBLA 3ZQ9A 1YMYA 1R30A 2YL9A 4F3HA 3CWNA 4LBSA 3VDBA 4NI3A 4UXDA 1DWJM 3G3DA 4C6IA 1MXGA 4NNBA 3REQA 3C3UA 1IHIA 3I6RA 5CJ5A 5C55A 1BD0A 5C9RA 5C2GA 1V79A 1FHLA 4YTUA 4HSNA 3V16A 2OOGA 2HXUA 2WSPA 4HU8A 2DSWA 4NIRA 2ZUNA 1FY6A 4RDWA 2ZICA 1RH9A 1HO1A 3OG2A 4LVAA 4D1IA 3OOQA 1OX4B 3CUZA 4QBXA 2OO6A 1UASA 3ITOA 2J27A 3E5BA 1G5AA 3EB4A 2GGGA 4RNHA 4C1NA 1MI3A 3AI0A 2X09A 5D2YA 3DI1A 4Z2JA 5I78A 1GQKA 1POKA 4DO6A 1GVOA 4GFIA 3M5XA 4XZ9A 4X9SA 3CBWA 4PFMA 1UPMB 3BG3A 2F38A 3CQ0A 5FACA 4L9ZA 2YCJA 2QCMA 4G7FA 2YYTA 2Z29A 1J2WA 5FJPA 2P50A 4PA8A 2FZ9A 3LB0A 4RX0A 5I2UA 4FXJA 1UC5A 5A6JA 3S5ZA 3AC0A 3LCGA 3VCCA 4V2XA 1EF2A 5G4WA 2D3NA 4F0SA 2EAWA 2Y8KA 5FCZA 4IISA 2YXOA 2GJNA 1F07A 1TPH1 1C8VA 4J40A 3TC6A 4D6JA 1EUNA 4LFYA 3BZJA 3L4VA 3NUKA 1E5NA 1O94A 1QWKA 3KOZA 3LNMA 4JTIA 1E56A 3PC0A 4DJDC 2WM1A 1WZAA 3B9EA 1JPKA 3UERA 2CW6A 3FEQA 3WMLA 4WZHA 3FYYA 4EF9A 2EJAA 2PRLA 1X8FA 1HKIA 1THFD 2ISDA 1KD0A 3KOYA 1P1MA 3FN9A 1BVZA 3CAWA 2VZSA 2PCQA 2FQIA 3AYVA 3QTPA 2QNEA 2ZX6A 3GSMA 2WBKA 5CJNA 2Y7GA 5D9MA 1Y5VA 1ZJHA 1ZL1A 3U9IA 1WZLA 1P6CA 2GOUA 4M82A 3K46A 4QFUA 3H12A 3AHZA 3A6OA 1BG9A 1S1PA 4OBTA 1VKFA 2AMXA 4UFKA 3FKRA 3UVAA 1VQTA 4MF4A 2YBVA 3G0SA 2HE5A 3GFXA 2Z1BA 3WH8A 1XBYA 4C6LA 3WO8A 4NVTA 1YQ2A 4Y9OA 3T2QA 3LRMA 1R2TA 4QNWA 3K4DA 4OTKA 2QCDB 1XG4A 4AZCA 5GPRA 4Z1AA 1GVIA 2GK1A 3E2QA 3HPXA 2A3LA 1Q13A 2WW5A 2UV8G 1HJQA 2FZDA 4TQTA 4KGJA 1OY0A 2RKXA 2YOCA 5G4HC 4LUJA 5IFTA 4AMAA 4C1KA 2J47A 4G9PA 4HMEA 4YIWA 4H9MA 5IHRA 2DUXA 3R8GA 3VKAA 3CPRA 4RR4A 1QBAA 5CPQA 1M9HA 2H90A 5B80A 3BW4A 1A5KC 1XM3A 3E2VA 3AWOA 1PKLA 3AYRA 1LL4A 2JE8A 4QIUA 3H6OA 5MF5A 3RMJA 1OX6A 4GBUA 2OJPA 3NVTA 3W4RA 1XYMA 5CGTA 2G3JA 3S1VA 4S3BA 1M3UA 2PGWA 3CM4A 2GUUA 4GUHA 2X30A 3C2VA 4QJ5B 4XAZA 2QZRA 4OBRA 3RLGA 4YTRA 4JQ2A 2G4JA 4JEJA 3H55A 3UPBA 2WJDA 1TRIA 4P7LA 2A6LA 1O5QA 1XH2A 2ZXQA 3KVLA 1Q6FA 3AUJA 1QW8A 1RQBA 3IUIA 1GWJA 3CLWA 5LXEA 2WCGA 1EYWA 4FNRA 4GOAA 2QGYA 4RV8A 1VBGA 4RUBA 1X8CA 5JVLA 1P0DA 4HJWA 3SW6A 2OOFA 1RCOB 5BW6A 2O9OA 3G1FA 3KTXA 4ATWA 4AEOA 2J7BA 3QQWA 1CBGA 4O4WA 4IMAA 4ZO6A 4MM1A 3CQIA 5J5DA 3SUSA 2DH2A 3TC7A 2WPGA 5CH9A 2NQ9A 4QXIA 3N6JA 5A2AA 4LGXA 4PRRA 3MWCA 1CIUA 1KWGA 3NQVA 4GJJA 2C79A 4DUWA 3W25A 3H2AA 3RFAA 4M3PA 4CNUA 3E0LA 3KL5A 3QR0A 1OD0A 3T05A 1OGBA 3UR2A 5LIXX 4XAGA 3V5CA 2C7FA 1MQQA 4QLKA 1AFSA 1GEQA 4JTFA 2OT1A 4LTSA 2C0AA 1S46A 1V0MA 5K7JA 3BH4A 1SO6A 4MGGA 3IANA 5D09A 3MW7A 3ZR4A 3QYSA 2D1ZA 4C6BA 3S8HA 4AWSA 1JPDX 1W3LA 4LYKA 1BRLB 3MV01 3TNOA 3M7SA 2PDQA 4JNZA 4LUTA 1HKVA 2PA6A 1W9UA 4HK6A 3S9IA 3GVVA 3H24A 3ZOAA 1KXVA 4NI8A 5LNWA 1N2VA 1B9ZA 2RUSA 1JZ3A 2ZC1A 4JX4A 2IUZA 1TWDA 4WF7A 5AVHA 1TR9A 1W9PA 2CHNA 2PFHA 2Y88A 3GVRA 3GTHA 4HNTA 3LPGA 1GQLA 3W23A 4PCFA 2AL2A 4PTVA 1RXOB 2YL8A 1K7FA 4AVOA 3MANA 3FJ4A 5FL0A 1M6JA 4GVGA 2Z27A 3NEVA 2DZUA 2WLZA 1EKOA 1MYRA 2JEQA 4LW7A 1ZNNA 3K30A 1A5BA 4HMCA 4YHEA 1TO3A 2IXVA 1MRAA 3R8RA 1W1VA 4ACZA 3TTOA 2X1RA 3NQGA 2ZADA 5HNUA 4GCXA 1SFLA 3S6OA 2J74A 1EJTC 1TCMA 1C9DA 5FD0A 4XG1A 3WQ5A 5LA0A 2YLAA 3D0CA 3NOYA 5G2IA 4Q4SA 1IT8A 5JH2A 3GU1A 4Y6GA 4W8LA 3QC0A 3M1ZA 5A6KA 1E3XA 4GQ0A 4PBGA 3GY1A 5DEZA 3VDAA 2R1PA 2WKJA 3P93A 4W88A 1EOKA 1H7NA 1I2OA 4C7FA 1E4IA 3IIVA 2P3EA 2AAAA 3MDUA 1TMHA 3A4JA 3SQSA 4GVIA 2NQZA 2GWGA 3E5PA 2DZPA 3IJIA 2LLEA 3RMEA 3NXFA 4QLLA 2J8GA 3N6QA 3WKZA 2PP1A 1DL3A 2A3AA 4R53A 2EQDA 4WLCA 4J7RA 3B9NA 3AALA 3FCPA 4HHLA 4N9BA 2E1WA 1UOZA 3MTWA 4HNOA 4ERIA 3LTSA 4AEEA 3HQNA 4C6OA 2A4AA 4W89A 3EBVA 4Q7IA 5H8MA 4OIFA 2ZC8A 1BSLA 3N6HA 1XHGA 2PD5A 4EXAA 4NL1A 3V18A 1XR2A 3UXLA 3VIPA 2POZA 4GUJA 3VNMA 3VTRA 4G8TA 4IX0A 1E3ZA 4IQDA 4H6QA 3XINA 5CPSA 4QJ4B 3CO8A 2ZA1A 1JIBA 3BSMA 3GUWA 3ZFHA 1JCLA 3O63A 3FK4A 4L4LA 3W9ZA 2ZVIA 5BMXA 2Y7FA 4EPEC 2IQ0A 4UTLA 3S2NA 1FWGC 3ZT7A 4I5RA 4HCHA 2DSKA 4GXPA 5BOFA 2BGQA 3NZ1A 1QMLA 1MWOA 1SW0A 3UZZA 2CCRA 3VNLA 2BWGA 4PUKA 3MBDA 4F0RA 2YL6A 5HNTA 1OT1A 3ZT6A 2D2JA 3M5YA 1W1PA 5D33A 2CETA 4GPNA 1KTBA 4PN2A 1X6NA 1VJSA 4QG9A 2PDKA 2R1LA 2Q01A 3KFTA 1XBXA 5LA1A 3WMCA 1LRTA 2XJ7A 1LTDA 4JIRA 1Z42A 5K9XA 3FSUA 3HA1A 3HFTA 4BEUA 5EFFA 5AB3A 2DT2A 5LHEA 2VDHA 3HIJA 1OYAA 1YTEA 3MCMA 2INFA 3VD9A 1I2NA 1OFPA 3GDRA 3N1AA 5FJOA 1TX2A 1VRXA 4LOCA 4U2ZA 3ITGA 3IVTA 1IT7A 1UWQA 1I60A 1OWQA 1VH7A 1GKRA 3VGEA 3QPZA 4CCDA 3IGXA 2SFPA 4H7VA 3LY0A 3W38A 3GTIA 4WR3A 4S3AA 5BXPA 4KMQA 1SPQA 1MNZA 5H91A 1W32A 1M03A 3TV8A 1PX3A 4ONVA 3KE0A 3RYSA 3HQ1A 2CNCA 2YZ5A 2ZXDA 4LYQA 2DT1A 1XDMA 3THAA 3PTKA 4GUFA 3U2ZA 1AW2A 3OQ8A 5FI8A 2ZUWA 1EOMA 4Z17A 2XFRA 2JF7A 5KZDA 3EAUA 4RZ4A 3UYIA 3MCNA 2GJXA 3GC4A 1KNWA 1KRMA 2HE8A 1HJWA 1J2BA 3VC5A 1Q85A 1N7KA 3ITCA 4JS3A 3U6WA 3WLOA 1OJXA 3N34A 4FOKA 4AG0A 5CSSA 4M51A 1E1CA 3BSHA 4WGXA 4D6CA 4IIFA 3CAQA 4PTWA 1QHPA 3TQPA 3E6EA 2OZTA 3MUZ1 2BHZA 2F2KA 4J3SA 5C71A 1J18A 4JL2A 3TR9A 4QR6A 1PWLA 3W2LA 5AYIA 3ZWSA 3AHYA 2D0FA 1AZ1A 1W31A 2FJKA 3HU7A 3CIWA 3H2MA 1CGYA 2IPFA 3EOLA 1F61A 3S83A 3WDPP 2YW3A 3II1A 4UQCA 1EXBA 4JR5A 1VIZA 1IWPA 3M0IA 1P4CA 1MFVA 3L7RA 3N12A 1G0CA 1ZP4A 1W5QA 4DJEA 1E15A 4ZOBA 2PF8A 4HPXA 5F2LA 1BXNA 1E5JA 4V33A 4AVNA 1PWMA 3WJSA 4BCEA 2HWGA 3QFEA 3O2LA 2IMRA 2C8NA 2IW0A 5KTLA 3URNA 3FXYA 1YTDA 2X05A 2QJNA 5EGRA 4JTTA 3A64A 4AY1A 1P0KA 2J9ZA 3DCPA 5D2TA 4FR1A 3HPZA 3KBMA 1MDRA 1OCQA 2VX5A 1IEQA 1LZOA 4B2DA 3FAXA 5DXXA 4UC5A 4P7OA 1AZ2A 3SECA 3TP4A 3AXKA 4AFYA 2WSQA 3CL8A 3EEGA 3AISA 5DRCA 4FXRA 3BGJA 3WCZA 4HU3A 2OX1A 3LCWA 3WQPA 4H83A 4JTDA 4Q7NA 2GWNA 1OG0A 1XRTA