1K9EA

Crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with 4-o-methyl-glucuronic acid
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
676
structure length
671
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAVVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRRWWKETAKRIYQYIPDFGGFVVKAPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-D-glucuronidase
publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 271
structure length 671
sequence length 676
ec nomenclature ec 3.2.1.131: Xylan alpha-1,2-glucuronosidase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1k9eA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1k9eA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1k9eA03
2QF8A 3CZLA 3FAWA 3I3DA 4W5ZA 2PBGA 3TA9A 2J75A 2BY0A 5CJ5A 3CZKA 1BVNP 5GPRA 3WENA 3KL3A 1TMQA 4TVCA 3WDIA 1WZKA 1AQ0A 3VIHA 7TAAA 5A8MA 3PZ9A 1NWTA 3BC9A 1HL9A 3CZ8A 5DT5A 2CIPA 4PBGA 4NRSA 4C91A 2ESCA 1B90A 1FP9A 1VENA 1DWHM 4C7GA 2UY3A 3VDBA 5IHSA 4AIUA 4PMNA 1EHNA 3OGRA 1PBGA 1E0VA 3ZR6A 1O6IA 3O6AA 5C71A 1FFRA 3EYPA 3BMWA 1XGZA 3K8LA 2CBVA 1R87A 1J0YA 2OWCA 1F4AA 1B2YA 2G8ZA 4Q22A 2WLZA 3SCRA 2VURA 3K8MA 4URIA 4W7WA 3MS8A 6A3HA 1WCGA 2G4FA 4M1RA 3WMSA 1XH1A 3POCA 3DYPA 2WVUA 1X6NA 3VU2A 2WYSA 3W6LA 2WHJA 4DM2A 3WF1A 3ARWA 3GXIA 4BQ3A 1CGXA 2YBUA 4CN1A 1GONA 1CXKA 1HN1A 2V5DA 3NDZA 3KEHA 1EO5A 4J28A 2ZWYA 1TFVA 3VGBA 2JIEA 5IDIA 3VDHA 3WDPP 4W88A 1GJWA 3UEQA 3AYSA 1UZ1A 2VX5A 1FFQA 5C70A 2ZICA 3AZRA 3AIUA 1B31A 4AD1A 2D20A 4CD8A 1JD9A 3L2LA 1MQQA 4UFKA 1DP0A 3QHNA 5BXPA 4H7VA 4KRTA 5I24A 4DUXA 1K9TA 5E9AA 5ABGA 2XPKA 2ZUMA 4PN2A 2Z1SA 4A3YA 1JG9A 1KR0A 3TONA 4JCMA 2BS9A 3OLIA 1W91A 4OBSA 3WDJA 5DFAA 3L4YA 1W9XA 2ZE0A 3AZSA 1F4HA 5CPSA 2W5FA 4FLRA 3WH6A 1GOQA 2J78A 5FL0A 1MFUA 2F61A 4AD0A 5GNZA 4TVDA 5CLTA 1BYDA 3LPOA 4P8VA 3AXHA 1Q6CA 4AIOA 4M24A 2WVSA 3AHVA 3K4DA 5M03A 5ABHA 1JI2A 1Q6EA 3VINA 2GDUA 3VMNA 2YLAA 2E9LA 1WO2A 2PWGA 4DM1A 3T08A 3FNDA 5BWFA 3PTQA 2A3EA 3AIEA 1EDQA 3UETA 2FHBA 4CCDA 2PBOA 4CGTA 2FH8A 4UQDA 3WD0A 3ZR5A 3APGA 4NRRA 2WBGA 3D5HA 1KXHA 2J7BA 1UR0A 4UOJA 1ZBWA 2CCRA 3AIQA 4JKKA 1QI4A 4ZFMA 3K46A 1TZ7A 4QFUA 4JKMA 3QHOA 4ATWA 5C8BB 1B3WA 1PZ2A 1GVIA 3RM9A 1ISYA 1R7AA 3VMOA 3W29A 4HU0A 5A6KA 4S3JA 2WBKA 1J0ZA 2E8ZA 4H2CA 2XUCA 1AQHA 1JYXA 3AXIA 3VX1A 4P7QA 1UWUA 1JZ3A 2Y2WA 1MWOA 4ATDA 1X1NA 1ZU8A 2W4XA 1E4LA 2PC8A 1ZBVA 3F5LA 4RL3A 1EQCA 1VJSA 3VIJA 1OWQA 1WZMA 1EOMA 5I78A 3EBVA 1QI3A 1SMAA 1QI5A 1QNRA 3RPMA 2J7DA 3MV01 4DWSC 2D0HA 5ABFB 2UWFA 5A94A 1W3LA 2GUYA 4KGJA 4LQ1A 4AZ5A 4P8WA 2CXGA 1E6XM 1R8LA 5DO8A 3CUIA 3ZJKA 4JFUA 1JFXA 2WWCA 4RE3A 4UZUA 1HP4A 3WL0A 3NIYA 4N42A 1MFVA 1DEDA 2A3BA 1H41A 5EB8A 3FHAA 4J7RA 3VD5A 3II1A 3MSDA 2VX7A 3TTOA 3SEPA 1V3KA 3L4TA 3WH5A 3MUAA 3GXFA 5DEZA 5JBEA 1EQPA 1QHPA 2YDQA 1HL8A 1TE1A 3E1F1 5D8WA 2VI0A 1NQ6A 3QOMA 2DEPA 2GJXB 4GPNA 4AMCA 1MYRA 4V27A 1GOKA 2WC7A 2WHKA 1GJUA 4MB1A 3VGFA 4AZBA 1H1NA 1RP8A 3WH8A 4ZXLA 5D9MA 2XWDA 4BA0A 2OSWA 1NWRA 2E9MA 4R5EA 3VDAA 1JYNA 2Y4SA 1NP2A 2QPSA 4Q7NA 2XYLA 4U2ZA 1GOMA 4IPLA 5EMYA 5CQ1A 1LF1A 3GH5A 3WMCA 2WVVA 2WB5A 1U2YA 2OWXA 4D6IA 3OLEA 1BAGA 1XSJA 4UCFA 5E0FA 1LG1A 2BVYA 2VRKA 4D6CA 3KL5A 1NOFA 2X05A 3VILA 3I3BA 3WY1A 1JYVA 2W92A 1J12A 2Y8KA 5JBDA 1H11A 2EPOA 1DHKA 1IZKA 4ATLA 2WKLA 1H0GA 2ZUUA 3N1AA 1GQIA 4KWUA 1MXGA 3WUFA 4L4PA 1TCMA 5KEZA 4F66A 4R27A 3POHA 1M03A 4JCLA 2VCBA 3WIJA 5HDRA 3AHZA 2WC3A 4FK9A 4JFVA 4JL1A 1WDPA 5E70A 2CHNA 4AZGA 3WNPA 1C3FA 1HJWA 2WZHA 4DWSA 5GQBA 1PX4A 1W3HA 3WDQA 1V08A 2VR5A 3B9DA 3CZEA 3AMCA 1S46A 1M04A 2J7FA 3W27A 1J0IA 1Y7VA 1QOXA 4HOXA 3PTMA 2EQDA 1XYZA 3GM8A 4FMVA 3VGEA 3UR8A 3VIIA 1K9DA 3PZQA 3A4AA 4CCEA 1GNXA 1UKQA 1UR1A 1G1YA 1TVNA 3WUGA 3I3EA 1WDRA 2ZUVA 4X0VA 1EA9C 2NSXA 1V02A 3WDHA 3UG5A 1W3JA 2E40A 4W7UA 4UQAA 3CUJA 5M3WA 4AZCA 3L4ZA 1W9UA 2A3HA 4MNJA 2VCAA 1FHLA 2VJXA 2D2OA 1XHGA 5HXMA 3PZTA 1IV8A 1BG9A 4V2XA 3LMYA 1ZS2A 1N82A 1VF8A 1UWIA 3CHEA 1VBUA 5DMYA 1KQZA 1EHAA 5I23A 4PMXA 1BFNA 4TXEA 5CXPA 3FHQA 1ZL1A 5LA0A 3AOFA 1ISZA 4XZBA 3TTYA 2PWHA 3CZJA 2FHFA 4B9YA 4W93A 4F9DA 3A3HA 1XSKA 1R85A 2YDRA 5A3HA 3J7HA 3M7SA 5FCZA 2BHZA 2DSUA 3VD4A 1E5JA 3ARVA 4PSPA 3WMBA 1BG4A 1RD6A 2D3NA 3U57A 1CTNA 3HMCA 3CUFA 3FAXA 1W1VA 5E6YA 2GDVA 4DUWA 4MNLA 2XG9A 1Q6GA 4YPJA 3VIFA 1PIGA 3FY1A 3WUBA 3OZOA 1UYQA 4MADA 2CITA 4AISA 4BQ4A 1H0IA 3D3AA 3F4VA 4LPCA 1YHTA 4JKLA 3NCOA 3CBWA 3VGDA 1LLOA 3W28A 4CN4A 1JL8A 1OGGA 3G6LA 5HBFA 4RE2A 2WHLA 2YKKA 1K9FA 3AJ7A 3GXDA 3OGSA 2WMGA 4YN5A 1I1WA 3AIRA 3EDJA 1KGWA 5BRPA 2WMIA 4AZ6A 5CLWA 3WQWA 4CUCA 1GQKA 2PWDA 1L8NA 2FGZA 3WNMA 3GBDA 2D22A 4MNMA 2YL8A 1QNSA 1A3HA 1OT1A 3NDYA 2X1IA 1HT6A 4U5KA 3THCA 2XVPA 3CUHA 1XC6A 3SCUA 5D8ZA 1OD0A 3A6OA 3JUGA 1GZJA 5I0DA 3ZJ8A 3PZNA 5GNXA 4MJ2A 2WXDM 3EDKA 3W82A 2ZX7A 3O9NA 1X6LA 1Z32X 2RGMA 5CGTA 4J3VA 4U5IA 5LYRA 1FHDA 1TA3B 3BAKA 3ALGA 2DIEA 3CHDA 1QNOA 2G41A 4LGXA 4PTVA 5D4YA 3F5KA 1ZJAA 3ZJ6A 2VO5A 4HPGA 1V6UA 2EEXA 1E6QM 1I1XA 1JDCA 2E0PA 3SCWA 3VTRA 4F79A 2XVGA 1WZAA 3ZT6A 1QBAA 1SYTA 1CBGA 4HZ6A 1ECEA 1W9PA 3CUGA 3MU7A 4MB3A 1VFMA 3EDDA 1J0KA 2V5CA 4W7VA 2CNCA 3AS2A 4YHEA 1PAMA 1HNYA 3DYOA 4IISA 5A6LA 1BLIA 4AD2A 3AXXA 2XGIA 5IFPA 1MVYA 4U3AA 3K8KA 2XFYA 3BXWA 1UA3A 1H3GA 4Z2IA 2DSZA 1HJXA 5I77A 1TVPA 1HKJA 4PEEA 4W8AA 2A3AA 3HJEA 1A47A 2YA1A 4AC1X 3AMDA 2YDSA 4CVWA 3CPUA 2PWEA 2B31A 3AROA 4HTYA 3W26A 1WP6A 3T0BA 4PMYA 5HPCA 5LA2A 1W9VA 2VX6A 1KBBA 2XGBA 3WQVA 5FIPA 2A3CA 2X2YA 5FL1A 4NZCA 4N0RA 3RJYA 4HOWA 2EO7A 1W2VA 2WCSA 1QHOA 1OB0A 1KXVA 2XFFA 2DSWA 4PYSA 1H2JA 3K4AA 1SMDA 1DWJM 2XFRA 2EPNA 4PMVA 3AQUA 3UERA 4HMCA 1UH2A 2VZOA 2ZUNA 4CD5A 1XYFA 2V3EA 1SR0A 1M01A 1W32A 2ZUTA 2EPLX 1V0LA 2DGAA 1WAWA 4IUGA 1GOOA 1G94A 1C8XA 4AZHA 4LYPA 4MAZA 3BCDA 4GO8A 2O9TA 2YIHA 1XCXA 4AD3A 2YA0A 2CERA 2CESA 2BXYA 4D6JA 1CDGA 1DTUA 3MUZ1 4ZENA 1CXHA 1JZ7A 3GNPA 3T2PA 3WELA 3ZMRA 3IJ8A 1J10A 3WF3A 3DC0A 3WBEA 3MSGA 4HZ7A 3EMZA 1G5AA 4MNKA 1CYGA 5HPOA 1JGIA 1HJUA 3AMLA 1B9ZA 1V3JA 3S6TA 5D9PA 3VM7A 2EPMX 2D0FA 3MMUA 3L4UA 1JFHA 4EANA 1JAEA 2CHOA 1J9YA 2W66A 4PUEA 2J4GA 1TR1A 2VR4A 4L4OA 1AVAA 3BAIA 1EXPA 1ODUA 2XWEA 3UCQA 1XH0A 3MMWA 1KR1A 2MANA 5HNNA 2G3MA 2DT1A 1AMYA 4JHZA 3GH4A 3CHCA 1RH9A 1GQJA 4M56A 3M07A 2YJQA 2OYMA 1BYBA 1CZ1A 1U33A 2G3JA 4AD4A 3PZOA 5E0CA 3W4RA 5IFTA 4MPKA 1WDQA 2OYKA 3QR3A 4GI8A 3QHMA 2VCCA 4Z2GA 1QW8A 2RGLA 4WKHA 4P7OA 2WANA 1CXLA 1Q6DA 2Y24A 4HA1A 3PHAA 3SIMA 5A8PA 5TD4A 1FA2A 2GFTA 2XM2A 4AZCB 1VAHA 1HXJA 2WC4A 5A6AA 3ARZA 3WF0A 2TAAA 1GW1A 4GZJA 3W6MA 1G0CA 5CZKA 1H49A 1OM0A 3WQ5A 2XIBA 5BROA 3LPGA 4GQQA 1EIBA 1KCKA 5AC4A 4MAVA 1M53A 3TP4A 5A6MA 1CXFA 4M81A 1EOKA 2X0YA 3RIKA 3GXMA 1HVQA 1E9LA 1G9HA 2C0HA 4PMRA 3CMGA 1GHSA 5I6SA 2JE8A 4K68A 1UHVA 1FH7A 2BFGA 2F8QA 1JYWA 1XD1A 3PBGA 3VGHA 4QLLA 3WBAA 3ECQA 2AMGA 1IZJA 4JHOA 2ZOXA 4OBRA 3VIKA 1PIFA 5AC5A 1XCWA 1UH4A 4UOQA 2VNCA 1UWRA 1V3LA 1KWKA 3VIMA 1B30A 3RCNA 4JFTA 3VM5A 4PTXA 4FLSA 1JZ5A 2X8RA 4W89A 3ARTA 2WPGA 2NT0A 4JL2A 3CIVA 4EK7A 3G6MA 2PWFA 3VUPA 4IPNB 3KWXA 2J7EA 4JAWA 2ZX6A 7CGTA 1BGGA 1V6WA 3VVGA 2DT2A 3ZM8A 1MW0A 1C90A 1R7OA 2XSBA 2QMJA 1SFSA 1LQ0A 2YL9A 4QLKA 2WZEA 4UOZA 5A2AA 4W87A 1UR2A 3L4VA 4Z2LA 3WF4A 1JZ2A 1CECA 1H5VA 4P7LA 5M17A 1C8QA 3MUIA 4B15A 4UFHA 3MKKA 1JXJA 2Z1KA 4GZIA 3WF2A 2WZIA 4PMDA 3VD3A 2YOCA 1AQMA 1EO7A 2XTKA 1HIZA 2W67A 1BYAA 1CGWA 1Q4NX 2XHYA 4D6EA 3VIGA 4U2YA 3CHFA 2HVMA 1JI1A 4UFMA 4HA3A 2J62A 1LL6A 1L0PA 5FKYA 1NWSA 2O9OA 3RILA 4CD7A 4MDOA 4OOUA 2O9RA 4PTMA 2J25A 3AMGA 1UUQA 4F9JA 2F2HA 3EDFA 1ZJBA 3OG2A 1XV8A 1NH6A 1QVBA 4PCSA 3GBEA 2J47A 4XB3A 1V6YA 3AS3A 1CGYA 1WB0A 4MB4A 2DIJA 4HU8A 3FXYA 1M7XA 1KXQA 3F5JA 2XM1A 4P8UA 1BHGA 1E70M 1VB9A 3ARXA 3WD3A 1V6VA 4D1JA 4P8XA 4CCCA 2JEPA 2JFEX 3M6DA 2WK2A 3ARPA 1UKOA 3ZJ7A 3BSGA 4HZ8A 5CSUA 5E6ZA 3WEZA 3OB8A 4HA4A 1W9BM 1US3A 5ABEA 2HISA 3MMDA 1E72M 3RM8A 4D6FA 4BF7A 3GNOA 4AD5A 3WUEA 3IK2A 1QNQA 2VVNA 2EJ1A 4C7FA 3ARSA 2BNJA 4M29A 1HJQA 5LA1A 3WNKA 2DH3A 1J0JA 1LWHA 1NWUA 3N9KA 1U30A 3WH9A 3FN9A 4D1IA 6TAAA 5EFFA 3IJ7A 1ISWA 4AXNA 3N04A 2VMFA 2D23A 1EDTA 2ZWZA 4W84A 4PSRA 2C8NA 2QLYA 3BAYA 4QAWA 4PRWA 4HOZA 1EDGA 5CGMA 2VT0A 1Q6FA 1UR8A 4C7DA 2EPKX 2GJRA 2CKRA 1E55A 2NT1A 4A3HA 2VZSA 5CSYA 1CENA 1VEPA 4ZXOA 5D9NA 2WLYA 3THDA 5CG0A 4H8HA 2WMFA 3W38A 1VFOA 1CGTA 3W53A 1KWGA 2BHYA 4ML4A 1WE5A 1GORA 1E0XA 4LYRA 1E6PA 1NP0A 1VRXA 4TX8A 2D1ZA 4ZEPA 1E1FA 1W1TA 4TTGA 1WZLA 4XV0A 2CBIA 1DWIM 2YLLA 2C7FA 1C8YA 2AAAA 2UY5A 1JIBA 3KZSA 1BQCA 4W5UA 3T0DA 4CD4A 3WD1A 3MUY1 4UQBA 1VEMA 3AHTA 4DWSD 3A4XA 3IAQA 4KRUA 1PJ9A 3BLPX 3VKKA 1E4NA 5A6SA 3CH9A 1HF6A 2CKSA 4WKAA 3LPFA 3BAXA 1ODZA 1VBRA 4EKJA 2FDMA 1D7FA 1TG7A 3AIVA 3TTQA 3AHYA 2J8FA 3SUSA 3SCTA 2J7GA 3ZSSA 3PZMA 4MJ4A 2DPEA 3WQ8A 1GOWA 1MW3A 4JFWA 4XX6A 3WNLA 1UKTA 1KGUA 2XVKA 3VD9A 2ZX8A 2VRJA 4BQ2A 1WPCA 3SUVA 1BYCA 3QGVA 1R86A 1B3ZA 1KQYA 2J74A 2WWDA 1RP9A 5CPQA 3BAWA 4UFIA 4Z2KA 4HPHA 2WCAA 4TTUA 1UD8A 2ZXAA 4H41A 4W8LA 4Z2HA 3CO4A 1MW1A 4ZE5A 1G01A 4FF5A 4AEEA 3AHXA 3NSXA 2GSJA 2ZX5A 3S2CA 4UFJA 1OBAA 1VFFA 1IT0A 5BCAA 1UD5A 3EDEA 1CWYA 5IHRA 1WNOA 1CLVA 3AS1A 5EFDA 2BY1A 3VMPA 4IM4A 3ZOAA 5A95A 2JEQA 4TUFA 3RJXA 3W0KA 4GKLA 3KE0A 1NM9A 1ISVA 1GUVA 3VPLA 2O92A 5FOOA 5A1AA 2BVDA 1MXDA 1E40A 2XVLA 5DF0A 3CZGA 3WH7A 3WN6A 2FH6A 3VD7A 2XSAA 2UY2A 4EAMA 1UD3A 2VC9A 3NSNA 2DT0A 3MANA 1V02E 2ZXBA 2Q8XA 5JIPA 2OWWA 2IXUA 1MW2A 1CPUA 3EMQA 4X9YA 1W9DM 3M46A 2X09A 1C92A 3OIHA 2CBUA 3PN8A 3W25A 1ZBCA 2XVNA 3N11A 2W91A 1WKYA 3T2OA 3VOCA 4H04A 1KGXA 4W86A 3WQ4A 4UR9A 1B3VA 2W62A 7A3HA 4CU6A 2Y5EA 4X0NA 3SUUA 4ACZA 4D6GA 3PZVA 3SURA 1E6SM 1OGSA 2VRQA 4PTWA 2VZVA 1JNDA 3IAPA 4A4AA 1ZB5A 3OBAA 1E3XA 4C90A 3ARUA 5EBAA 1K6AA 4WJXA 5A2BA 2V3DA 1KB3A 3DHUA 3NYDA 3WDRA 1JNEA 1ITCA 3AI0A 1UWTA 2D0GA 2DDXA 4KH2A 2VQTA 1JDDA 4CN6A 2EXOA 1RPKA 3PTKA 3A4WA 2IXVA 1PPIA 1LWJA 1C91A 1B3XA 1V3IA 2VZUA 2ZXDA 4P7RA 2WVVB 1ITXA 3OA5A 5A2CA 4V28A 3SUTA 2J8GA 1O7AA 1OT2A 4HMEA 1ESWA 1NOWA 3GYCA 2GK1A 4OOZA 3ARYA 1OIFA 2WSKA 4D6HA 2YL5A 2VOTA 2VVSA 4M82A 3MV11 3VIOA 3CGTA 4FLOA 3DECA 1GVYA 2J77A 3DYMA 3NJ3A 4UQEA 3BGAA 4MDPA 3WL1A 3ZSTA 1UD6A 5ECUA 4U3CA 3BCFA 5BRQA 1DWFM 4QDMA 4ACYA 2X0HA 2J7CA 1P6WA 4CVUA 1D2KA 4UTFA 4DWSB 4J3TA 1UKPA 1UWSA 1WDSA 4AW7A 4BS0A 3SCSA 3VO0A 3AISA 1E4MM 4BCEA 1HKKA 1E4IA 4QCEA 1W1PA 3AMKA 4Y7EA 1C7TA 1PX3A 2VUYA 4GXPA 3T0AA 1W2PA 1CNVA 3B8SA 4NSBA 4OKDA 4PCTA 4W85A 4BQ5A 4KMQA 1E6ZA 3WEOA 5I79A 3AICA 1HKIA 3L4WA 5AYIA 4HP5A 1W3KA 1V0NA 1VFUA 8CGTA 1OINA 2W63A 5A8OA 2WVTA 3RDKA 2AOSA 2XIIA 2EBNA 1E56A 2OLHA 4S3KA 3WNNA 3RO8A 4PMUA 4QP0A 1E15A 3ZT5A 1OIMA 2J7HA 3VDCA 4LX4A 5A6BA 1UQZA 3ZO9A 4U33A 1XH2A 1DWAM 2DH2A 3CLWA 4JFSA 4HMDA 3WSUA 5E09A 1C93A 1XSIA 3TTSA 3AS0A 4WSJA 4EE9A 1JAKA 4B3LA 1OCQA 4GI9A 3RMEA 2FHCA 1E6RA 4GZEA 2QMKA 2QHAA 3W37A 5A69A 4U31A 4WK9A 2D24A 2J79A 3UG4A 2WW5A 2WNWA 4D72A 3GTNA 1TA3A 1BSIA 2O9PA 4J3SA 5FD0A 2VX4A 2G3IA 4CU8A 1QI0A 1E0WA 4W8BA 2JALA 2BHUA 1UOKA 1FP8A 2E8YA 4PUDA 1JZ4A 5M5DA 4PMOA 1H4PA 3B9AA 1H09A 2E9BA 1HVXA 3OGVA 5GNYA 1YQ2A 4GINA 4TOQA 3RM4A 2WAGA 2BY3A 1BVZA 4NF7A 1JZ6A 4ZE4A 4GIAA 4MB5A 1D3CA 1K9EA 1OSEA 1B3YA 1J18A 3AYRA 3CMJA 2CBJA 2WSPA 3NUKA 1QBBA 1UD2A 1KCLA 3WQ6A 5BXSA 3PZIA 2WMKA 3TOPA 4OUEA 3EMCA 3SCQA 1NOUA 4M8UA 3DHPA 4E4PA 2JF6A 3IJ9A 5F7UA 3OZPA 5A6JA 4BZYA 3SCPA 2VL4A 2ZIDA 3VX0A 1HKMA 4E8DA 3QOKA 4XUYA 1GHRA 1PZ3A 3N17A 1LJYA 4GI6A 2WMIB 1V6XA 2CYGA 3UG3A 1JDAA 4PMZA 4OJYA 2VQUA 1NARA 1CXEA 1UWQA 2VTFA 4H8VA 4AY1A 2D3LA 4LXFA 2OYLA 1JZ8A 2V3GA 4B3KA 1J11A 1J0HA 5D9OA 2PF0A 1MQRA 4WF7A 5JBFA 4UFLA 1E1EA 4XZWA 1B1YA 2CEQA 8A3HA 4LYQA 5A6BD 2WMHA 3L4XA 1QPKA 3IANA 2UY4A 5BYWA 1GQLA 1HJVA 1HX0A 2GJPA 1XRVA 2WKGA 1BF2A 4CKQA 3AFBA 2V38A 4WLCA 5A8QA 2DSVA 4H8UA 1V0MA 4D6DA 5DT7A 5JUVA 1KXTA 1QW9A 1LL4A 3HN3A 4J3XA 1CGUA 4MTVA 5BXRA 5I2UA 4AYSA 2BY2A 1KBKA 2E4TA 5CPTA 1J01A 3BAJA 2WM0A 2JF7A 4J27A 1CXIA 4GO9A 4OZOA 4QCFA 2VZTA 4TVUA 3OLGA 3VGGA 4AWEA 4KGLA 3GH7A 1UR4A 2G3NA 4WIWA 4GQRA 3FW6A 3WFZA 3AZTA 4F8XA 1E73M 1V0KA 1UA7A 4UQ9A 1UD4A 1VIWA 1CIUA 2BVTA 1FOBA 4J3WA 1LG2A 4DUVA 3N15A 3VNYA 1DWGM 1QHZA 1V3HA 1FH9A 2PB1A 1E5NA 3OLDA 1GCYA 4YHGA 4E8CA 4ACZB 1BPLB 5JIWA 1UR9A 3BLKA 3GZAA 3U7BA 2WHMA 2DQXA 1E43A 1CEOA 3MO4A 2W61A 3L2MA 1PX8A 1ISXA 1CGVA 3ZQ9A 2YBTA 2BXZA 2OSYA 4WSKA 1I75A 2QPUA 1FH8A 3N18A 4M80A 3ZT7A 3SUWA 4AIEA 1UH3A 2JIWA 3BSHA 2Y8VA 5I5RA 1E3ZA 3WD2A 4AZIA 1QNPA 3HU7A 3UESA 5AY7A 3N13A 2ZXQA 1E6NA 4CD6A 4JZ5A 2IUZA 3WNOA 5A8NA 2DSKA 9CGTA 3SCOA 1GOIA 1BGAA 4B9ZA 1UQYA 5IXEA 1GPFA 1US2A 3ARQA 4CU7A 3WD4A 1JF6A 5KZ6A 3SCNA 3AIBA 5BXTA 2GK1B 4FLQA 2YA2A 4NI3A 1LL7A 3BH4A 3K1DA 3U5YA 1VEOA 2YL6A 1KFWA 2ZX9A 1HJSA 4JIEA 5ABFA 4P7NA 3GNRA 4Z2JA 3PZGA 2OSXA 3A47A 5HOSA 2BV9A 4UZSA 2E3ZA 4TX6A 1V03A 3ARRA 1JXKA 1TUXA 4J3UA 1EH9A 4WKFA 3W81A 3WEMA 4OIFA 2ZUSA 3BMVA 3CTTA 2V3FA 1OD8A 1OGBA 1E71M 1ZBKA 2QV4A 3T2QA 3WFLA 3SCVA 1MQPA 4RE4A 2ZUWA 1EGZA 3W24A 3T09A 2PI6A 1V3MA 4AEFA 3UR7A 4B16A 2WCGA 4QLJA 1JD7A 3KL0A 2XJ7A 3PZUA 1XD0A 1UKSA 2FGLA 3U5UA 1UZ4A 3ALFA 2GJXA 1HP5A 3LPPA 3N12A 2GVYA 1B0IA 1C7SA 1QI2A 5AYBA 3NSMA 4AZ7A 1W1YA 2CPUA 4E2OA 1CLXA 1JF5A 5I3DA 3VIPA 3O2LA 3GDBA 3VNZA 2DT3A 3B9EA 3U7VA 4UNIA 3ZIZA 1BTCA 3AIWA 3WKZA 6CGTA 4UQCA 2WMJA 2NW0A 1PEZA 4PMQA 1UG6A 2CETA 1VJZA 4D71A
chains in the Genus database with same CATH superfamily
2QV5A 5LNWA 2NQ9A 2BVWA 1UPPA 2PBGA 4MJZA 2FZ8A 4J5NA 3H2OA 5GPRA 2OCZA 1DJNA 4XWUA 3V4BA 1BQGA 1WZKA 1IR1A 1D3HA 1Q2SA 4TMBA 3KBNA 3DFNA 3NL3A 1KBJA 4AEOA 1GVQA 3QV8A 5AFDA 1TPH1 3UWWA 4JIRA 1KA9F 1ICQA 1A5KC 3GVWA 1ZENA 3P67A 4C7GA 2CLLA 3VDBA 3R8RA 5FJOA 1FDZA 1EHNA 4L9YA 4O12A 1OFBA 5FEZA 5MF5A 2G5WA 1JR1A 3BMWA 1XGZA 1Y0EA 3K8LA 4INFA 3FSTA 4CQ9A 2C79A 3SJ3A 2P88A 3K8MA 4Y6GA 1P1XA 2ZRUA 3POCA 3VU2A 3FXGA 3WF1A 1W1A1 4CN1A 3TFCA 2G37A 1HN1A 3BG9A 1J96A 4JNZA 2JBMA 3W86A 3KEHA 1EO5A 5DBUA 5IDIA 1AW2A 4R53A 5E0KA 4W88A 5CZSA 2YXGA 2XFWA 3FSUA 1S2WA 3QXBA 1UZ1A 2VX5A 1FFQA 1K7FA 3P14A 4H8NA 1D9EA 4AD1A 3PULA 2D20A 2XSXA 1W1IE 3L2LA 3OHIA 1JCMP 4KRTA 3ZFHA 2YCLA 4K38A 2XPKA 1TV5A 3V0TA 3F1QA 1O12A 4OBSA 3KBWA 5DFAA 3L4YA 2ZE0A 4DIAA 3H26A 1QATA 2J78A 4RUBA 1O94A 2VEFA 5RUBA 3W84A 4WGHA 3H4GA 3BW3A 4LALA 1FDJA 3NQDA 4GH3A 5CLTA 1BYDA 4GJJA 5XIAA 3AXHA 3C8NA 3JU2A 4M7TA 3T44A 3K4DA 5ABHA 3UWEA 4EPKA 1SZEA 3GTHA 1OEPA 5DX7A 1EZ2A 3ITXA 4IX0A 4LUSB 3OZMA 5LKYA 1PZ0A 4NVTA 3W2LA 3AIEA 4IXXA 2FHBA 1DXIA 4HPXA 1YEYA 3WD0A 1FHUA 1TSIA 2A1YA 3TEVA 3L9CA 1V51A 4HTBA 2WPBA 3FCPA 2INZA 3HQ1A 4YVPA 1PHQA 2BZNA 1V6TA 1KM6A 1EIXA 2UV8G 3P0XA 2R1KA 2BOGX 4QFUA 1I2OA 5J5RA 5K9XA 1FCUA 4RZ4A 4R88A 4B4FA 1GVIA 3T0TA 3KTSA 4O50A 1A50A 3CEPA 5A6KA 3BZGA 1J0ZA 4C6MA 5H8PA 2QR6A 2XUCA 4LEFA 3PR2A 4WJ8A 5EGRA 2RDUA 1IXOA 1JZ3A 2Y2WA 1TJPA 1X1NA 4MWAE 1KM1A 2W4XA 2PC8A 1ZBVA 3F5LA 2ABBA 1WZMA 3EBVA 3R6IA 3PBWA 1RJPA 1O95A 4A8RA 1H7OA 5F1VA 4LS0A 2UWFA 1U1HA 3MMTA 3GXPA 4AZ5A 4P8WA 4HKPA 1E6XM 5DO8A 4WXYA 3ZJKA 3VOFA 3WL0A 1MFVA 3ONBA 1K8YA 1B4EA 2A3BA 3TZFA 5CSRA 3VD5A 5FSDC 5KZEA 3II1A 5I3JA 2OOGA 2VX7A 4S38A 3G0XA 4HU3A 3WH5A 5TIMA 1TO3A 3CYJA 4GNJA 4LF1A 4JBRA 3UZJA 5D8WA 4ICCX 2BOEX 6TIMA 1BWLA 4GPNA 4AMCA 1BKSA 3IIPA 1EP1A 1KKOA 4ZXLA 4PUJA 1QFEA 4AG0A 2WJDA 1NWRA 3LY0A 2E6YA 3OZYA 3TC7A 3CV1A 1NP2A 2H6RA 4JTTA 2QPSA 2XYLA 3M9YA 5EMYA 1J5SA 4WJEA 4JTUA 4LTSA 3R94A 2OT0A 3NAVA 2WVVA 2WB5A 3UJRA 2VR2A 5KZMA 1XSJA 3S8HA 2VOMA 3XINA 3KL5A 3AYTA 3VILA 3I3BA 4QAIA 4JDBA 5JBDA 1YDNA 4Q32A 4H6RA 4OTKA 2XINA 2ZQ0A 4RDVA 1DXFA 2E77A 2P0OA 3IJ6A 3IJQA 4AU0A 4IIDA 1H5YA 2X1SA 1M03A 2FZ9A 3T9PA 4GUHA 4M6UA 3VC6A 2INFA 5I3GA 4JFVA 5E70A 5FJUA 2QS8A 3TW7A 2PUZA 1XIIA 4ZOCA 1DVJA 3WDQA 3LX9A 3RLVA 3WQOA 2VR5A 3CZEA 3AMCA 1IEWA 3GB6A 3P61A 3C0LA 5DRCA 4HOXA 3VFCA 3GC4A 3CQ0A 4OU1A 3GHUA 4FMVA 3GM8A 3UR8A 3G1DA 3ITGA 2FPYA 3A23A 1UKQA 1UR1A 2R8WA 4JGDA 2HROA 2OG9A 1TV7A 4X9SA 1EPVA 1PS9A 2V2CA 1L6WA 4P00B 3AUJA 3U4FA 3KCJA 4DJEC 3A3WA 3CUJA 1WBJA 5LGZA 4Q8PA 2OGYA 1LT8A 3PNUA 2DJXA 1XKYA 2VXNA 4F0LA 4NUWA 3A12A 1UB3A 4X22A 3BW4A 1HGYA 3M0LA 1MEHA 1NSJA 3UT0A 2NQZA 4V2XA 3GAYA 3VNMA 4E3VA 4JQ1A 2P50A 2PZ0A 4QEEA 1HUVA 3MZNA 2V67A 4GC3A 1BFNA 1QO2A 3R2GA 3FHQA 1ZL1A 3AOFA 4JQ4A 4B4HA 2QCDB 1YTEA 1DIKA 2FHFA 2YW3A 3RAOA 2XU2A 4F9DA 4DF1A 1EYEA 3PBYA 1R85A 1KC7A 5FCZA 2BHZA 3VD4A 4PSPA 2QNEA 3HMCA 3GNXA 4MYXA 5E6YA 2GDVA 4DUWA 4IG2B 4O16A 4IFKB 4Q4QA 4KCUA 2XG9A 4NZ1A 4AISA 1UYQA 4MADA 2CITA 3F4VA 4LPCA 1W5MA 3GVRA 4PGLA 3NCOA 4QQUA 3VGDA 3QPYA 4IUOA 4ICNA 2YKKA 2XIOA 1TJ0A 3AJ7A 3OGSA 1EFZA 1WKFA 4YN5A 2PGFA 3P80A 2WMIA 2WSRA 5CLWA 1BXCA 3H55A 2ACRA 4JYFA 1L8NA 3TWBA 3WNMA 4IMDA 3GBDA 4GC4A 3GIYA 1TV4A 1I45A 1H51A 1HT6A 4AQLA 4B5VA 4U5KA 1A80A 4MKNA 3CXOA 1R6WA 5C2CA 3CUHA 1XC6A 4H83A 5D8ZA 3UR5A 3W73A 3G18A 4PTDA 5I0DA 2E5DA 3GU2A 1RAKA 3PZNA 3QM3A 2REQA 4YJ5A 2TODA 3EDKA 4O1EA 3O9NA 4U5IA 1FHDA 2XH7A 3GVVA 4GH1A 4UNLA 4CNOA 4QE5A 1X8CA 1XIFA 3HPXA 4LGXA 3QSRA 4R7WA 4PE8A 2VO5A 4Z1YA 1X39A 2EEXA 1JPDX 4PA8A 3QTPA 1CI1A 1TPEA 1QBAA 4BI7A 4HZ6A 1AA1B 3MU7A 4MB3A 1VFMA 4XD5A 1QW7A 4MYAA 2CNCA 4GK8A 3I68A 4IISA 4AD2A 2QCMA 5IFPA 3KVLA 3QVQA 4RDYA 3QW4B 1VKFA 2YCIX 1CB2A 1UA3A 1H3GA 4Z2IA 1HJXA 1U83A 1TVPA 4AWSA 3KBJA 3HJEA 4LCRA 1TUFA 4GXMA 3A64A 2YDSA 4N4QA 2PWEA 4JS3A 3AROA 3IVUA 4HTYA 3SRKA 1OX6A 1W9VA 3QMTA 3HZ3A 3UWVA 2VELA 3HFYA 2X2YA 5FL1A 4R33A 1XM3A 2V81A 4HOWA 2EO7A 4G9PA 1QHOA 4GCAA 4CNSA 3NM3A 3LHUA 1KRMA 1R3QA 1DWJM 1YPFA 4F4RA 2XFRA 1LP6A 3H2AA 3UERA 2G4JA 4HMCA 4JQAA 1SR0A 1M01A 2SFPA 2NUWA 4A3UA 2DGAA 4G56A 4KKXA 3AU6A 4IICA 2VGBA 3S9IA 1GOOA 3TQKA 1C8XA 4H6EA 1LRQA 4HJWA 4LYPA 3BCDA 5TBOA 1N8WA 4GO8A 2O9TA 4AD3A 1ZCOA 2E25A 3EX6A 3AYVA 4B3ZA 1XWYA 2CESA 4LEQA 3PJWA 4D6JA 1DTUA 3MUZ1 2R6OA 3GNPA 3T2PA 1X97A 5FACA 1P0NA 3E2SA 5E93A 3WF3A 3MZ2A 3BQ5A 3MSGA 4ICMA 2Y5JA 2ISSA 5HPOA 2D73A 1XLBA 4JTEA 4GBUA 4LF2A 3PUEA 3VM7A 4ILSA 3L21A 3TYUA 3ERPA 1JFHA 3NO5A 3DI1A 1JAEA 4JPGA 2CHOA 2J4GA 1TR1A 2VR4A 4L4OA 3BAIA 2NV2A 3KP0A 1EXPA 3UCQA 1P43A 1KR1A 4JD4A 3IS4A 4Q4RA 4BY3A 1RH9A 4QQ3A 3C56A 4Y90A 1DJQA 1S1RA 3VAVA 4UTWA 4OFCA 1DQUA 2BGQA 3KXQA 1VFTA 1ONXA 3N4EA 3WLQA 5T9CE 3L0GA 4AD4A 2B7NA 4S3CA 3TFXA 4FNUA 1N7KA 2ZBTA 1WDQA 4GI8A 3ABQA 5GJPA 4NNCA 3L5MA 4Z2GA 4WKHA 3C6CA 2WANA 1AH3A 1Q6DA 3MCNA 1RQHA 5K4XA 4Y9NA 5A8PA 5TD4A 1JDFA 4I90A 6PTDA 1UW9A 1FA2A 2GFTA 2XM2A 4JN8A 3HPFA 4A29A 1UIPA 1LOSA 3ARZA 3HA1A 2TAAA 4GZJA 3HV9A 1SU5A 4DZAA 1ONEA 1KRBC 2FGBA 3KZPA 4H2HA 3C2OA 2E1WA 4GQQA 1PB0A 3TP4A 5F2MA 5A6MA 1I60A 3PVFA 3W7JA 3HURA 3SDOA 4FXSA 3CMGA 3WLSA 4LBUA 4DQWA 3ZWTA 2OGJA 4FPSA 5BU9A 1FY6A 4QDPA 3ECQA 3TROA 5IDZA 1IZJA 4Q8UA 4KWSA 4EWND 1PIFA 3IRDA 1XCWA 3LGDA 1HW6A 4NNBA 1UH4A 4UOQA 1RHCA 3GDRA 1YDOA 1B30A 2PDPA 3W87A 3A5VA 1LOQA 2A79A 3BVJA 1XUZA 2WNZA 4JFTA 3NQ2A 2GQ9A 4D9PA 3GDMA 3W1QA 4HNLA 1RQBA 2X8RA 3WLOA 2WPGA 1IWBA 2X1RA 4IWWA 3EAUA 4EK7A 4NILA 4EIVA 4IZGA 3UZ5A 3R8GA 3GG7A 2ZCGA 3C52A 2J7EA 1RLDA 3VVGA 4E4FA 4K36A 4D8ZA 2DT2A 5AHIA 3ZM8A 3NPXA 1C90A 1R7OA 3Q45A 2QMJA 4K1WA 5KMYA 1R38A 2YL9A 4QLKA 3YPIA 4L1WA 1RPXA 4JQ2A 4RZBA 5FI8A 1DTNA 3L4VA 3MDWA 1JEZA 2A7PA 2PDQA 3GWQA 5M17A 1C8QA 5LSMA 4YLWA 4LB4A 5FJPA 4Q4SA 4GZIA 4GKTA 4KWWA 1XP3A 4PMDA 1PZ1A 2GL5A 2XTKA 1HIZA 3PPHA 3WK0A 2W67A 2V2HA 1BYAA 1CGWA 4IMAA 2VD9A 3LHTA 3K4WA 1JI1A 4CQBA 1A53A 2POTA 5FKYA 1M6JA 4LY8A 4LC6A 4IMEA 4MDOA 3VABA 4OOUA 3AMGA 2F2HA 2QJJA 2O55A 3GBEA 4M7SA 2C71A 5K3VA 2RH9A 2QZRA 3EB3A 5LHEA 4IP5A 1V6YA 3AS3A 2DIJA 3LCFA 1M7XA 3THQA 1KXQA 1RA0A 1DIDA 3UA4A 1BHGA 3TK7A 1OG6A 3FEMA 3WD3A 2VKZG 4P8XA 5KETA 4CCCA 1XG3A 4E3TA 3M6DA 1FXQA 3T8LA 3F2DA 2D2GA 3VC5A 1DXEA 4HZ8A 3NZRA 5CSUA 7XIMA 1YBQB 4HK7A 5XIMA 3NTYA 4HA4A 1W9BM 1US3A 5ABEA 4ZCWA 4D6FA 3P5YA 4S3EA 4G6CA 4S1FA 3IK2A 1QNQA 1C9WA 2NWSA 1NY1A 1A0EA 2X16A 4GYPA 3NM1A 3CS2A 4F0SA 1J0JA 1TCDA 3STPA 5FESA 1YPIA 5EFFA 4Y8EA 1ISWA 1X38A 1EDTA 3NGJA 1HFBA 1K7XA 1OC6A 2DW7A 2EKCA 4KERA 1UR8A 3C0QA 4C7DA 2EPKX 2GJRA 5F2IA 1REQA 3PUGA 1NQKA 4AY7A 1CENA 3KX6A 5T91A 3VZYA 4ZXOA 3T40A 3DKLA 2FZNA 1KWGA 4ML4A 1E0XA 3A21A 3MYOA 2C0AA 4G2DA 1AQFA 2YCEA 1O66A 2NXGA 3GTIA 5B80A 4TX8A 1E1FA 1QNVA 1W1TA 4NP7A 2A85A 2ISWA 2C7FA 3E2QA 2AAAA 2UY5A 4OECA 2QPXA 3MUY1 4UQBA 4QG8A 3W1TA 1PJ9A 1E4NA 2E09A 3UJSA 3W7KA 4GLEA 3ANVA 5C6MA 4WKAA 1ODZA 2FDMA 5JH2A 3V1PA 3GDTA 4BEQA 3SUSA 4IMFA 3SCTA 2J7GA 2NX3A 2YPIA 4MJ4A 3OVQA 3WQ8A 5B7ZA 3WLIA 1GOWA 4JFWA 4XX6A 2A7RA 3PJUA 3W2KA 3VOJA 2VRJA 3S5YA 3SUVA 3MWCA 3NVDA 2JKPA 1BYCA 1KQYA 2WWDA 5CPQA 1FWNA 3OOQA 4Z2KA 2DZXA 1A5NC 1XYAA 1QDSA 4R3UA 4JEQA 3UXLA 3G77A 2PD5A 1Z69A 4DO4A 3RPDA 1UASA 5G4HC 1Q63A 2ZX5A 4UFJA 1VFFA 1QR7A 1ICPA 5G1MA 1CWYA 2PDFA 1WNOA 3USBA 2BY1A 2CZ5A 3VMPA 2YZ5A 3ZOAA 4JTSA 3RHGA 1CCWB 1BSLA 2EHHA 3KE0A 1QK2A 4G7EB 4MOZA 2CZEA 2O92A 4O0ZA 2PRMA 2Y88A 1YMYA 5CBIA 2YW4A 4GA8A 5DF0A 3F03K 3TA6A 2OZ8A 3VFLA 1WOAA 4JOMA 3CASA 2UY2A 2VC9A 4OWGA 3TR9A 1AD4A 3MANA 3D46A 1J79A 1TKKA 2Q8XA 1XISA 3S2MA 4MUZA 4X9YA 3KVMA 2IQDA 3RPTA 2DVTA 3BWWA 2E6FA 2W91A 1QPRA 3UYCA 4H6QA 3T2OA 3NR0A 4UR9A 2W62A 4MWAA 3P74A 1FKWA 1IXQA 3QMSA 3GU9A 3SUUA 1VFHA 4ACZA 3LCHA 1XI3A 3CM4A 1ALDA 3PAJA 4W9TA 2QCLA 1LROA 4A4AA 1IIHA 3GXNA 1K3UA 4C90A 4JYDA 2PRHA 5EBAA 4DVOA 1EP3A 4TV6A 1KB3A 3FA5A 4I7VA 3TN6A 2AMXA 4E2VA 2I5GA 3PTKA 5FEWA 4I9TA 1Q65A 1Q6LA 1V3IA 1DOSA 4P7RA 3MHGA 1ITXA 4WUIA 3TCSA 3C5QA 1KW1A 1ESWA 4L7ZA 4N02A 3M41A 2VWTA 1W5OA 5FJTA 3W6YA 1EYWA 4K6AA 4IPJA 3ARYA 1RVGA 3GS6A 4DJED 1EF3A 2VFGA 2VVSA 3HBLA 5A5WA 4M82A 3MV11 2GLKA 3CGTA 2YBVA 1GVYA 3DYMA 3NJ3A 4HYWA 4K7VA 3ZSTA 4KEZA 3PM6A 4PZVA 5BRQA 1OQFA 2AL2A 3RCMA 4ACYA 3NL6A 4PL1A 1GYLA 3BZJA 3E96A 4DX3A 1D2KA 4FF7A 1BWKA 1ONRA 4DWSB 4YTUA 1Z9AA 5DMLA 1UKPA 3GUWA 2PP1A 3VO0A 2F6KA 4R7JA 2D69A 1HKKA 4QCEA 5EMMA 1C7TA 1CNVA 2O4QA 1A5AA 4W85A 2X42A 3CIXA 3GDLA 3WEOA 4K39A 1HKIA 1PKNA 1W3KA 8CGTA 1FXPA 1OINA 2VC5A 2EBNA 3WNNA 1MNSA 1OIMA 3VDCA 2Y8UA 1I4NA 3BURA 1J8VA 1R9YA 4GIYA 4AC7C 3URAA 2DH2A 4F3HA 2PGRA 2OMAA 5D04C 3WSUA 3CIWA 5E09A 4AWUA 1JAKA 3I6RA 3MJYA 4B3LA 1SFTA 4DJFA 3S5ZA 3R0DA 3AU2A 2QMKA 4C6NA 5A69A 4NX5A 1UP3A 3RK8A 2NUXA 2D24A 3UG4A 1TA3A 1BSIA 3ES7A 2PTZA 2WOQA 1B57A 3O0FA 4J3SA 4CU8A 3UZZA 1OX4A 1ZQ5A 4PUDA 2BHUA 4KCVA 2E8YA 4NKCA 1JZ4A 3NWRA 4DEFA 4QE4A 3B9AA 1H09A 4RK8A 2FVMA 4EXBA 3OGVA 3RM4A 4DB7A 4QG9A 2PD9A 1JZ6A 3N4FA 4ASTA 3RO6A 1OSEA 2PU1A 1B3YA 2V5BA 1U1UA 1ML1A 4LUTB 1OABA 2HV5A 3AYRA 3ENLA 3NUKA 1BRLB 3TOPA 2F2KA 3IGUA 3CV2A 2ONEA 1ZHAA 4M8UA 3SI9A 3RU6A 2JF6A 3WO8A 1KV8A 3TH6A 2QVHA 4DXVA 3IGHX 3EWCA 4NXKA 4Q8TA 2H8ZA 2NUYA 4E8DA 5CC7A 3QOKA 4HNOA 4UR8A 5CJNA 4DF2A 6XIMA 1Z6KA 1LJYA 1ME9A 2PDCA 1B54A 4ZBCA 4FA3A 3ABSA 4XAYA 1JDAA 5FSEC 1JPMA 4XBJA 3PG8A 2D3LA 4B5TA 2V3GA 1ZGDA 3RYSA 3O6CA 2PF0A 2G0WA 5JBFA 4XZWA 3MI3A 4ORMA 3GFYA 3WQCA 2F6UA 5REQB 5A6BD 3WLKX 1TTQA 1QPKA 2W3ZA 1GQLA 3VNIA 4Y2WA 1XRVA 2HJPA 2HNHA 2Z26A 2F84A 3IV3A 1KXTA 1QW9A 1A4MA 2DW6A 5HATA 1V7YA 4J3XA 1A49A 3VKAA 4NHVA 1EP2A 3IWPA 4AYSA 2X7WA 2E67A 5BOFA 3R0UA 1GKPA 3BAJA 2WM0A 3STGA 4D8AA 4GO9A 4OZOA 3AXMA 3DZ1A 1RQEA 3WJZA 4KGLA 2G3NA 4GQRA 4L5ZA 3P6LA 4ZZ9A 4LUSA 5F4WA 4Z0SA 4JTLA 3QY6A 4O1DA 2GZXA 3HMJG 4HNNA 2BVTA 1FOBA 2CWNA 4BK9A 3TX9A 2DFAA 3N15A 4GISA 1QHZA 1V3HA 1E5NA 5ABTA 1BPLB 1WXJA 3BLKA 4IMCA 4N9CA 3GZAA 3U7BA 4B5XA 3RX3A 1CEOA 3MO4A 1PX8A 1ISXA 3QR1A 4R9OA 2BXZA 4BR1A 4Q8WA 4WSKA 2G3FA 2QPUA 2JKEA 3N18A 3W3OA 2CWXA 3T4WA 4AF0B 2JIWA 3E0VA 4LAUA 4AZIA 1NDVA 1QNPA 5AVHA 3UESA 5HNUA 2PDJA 2VEIA 4H9VA 2A5HA 3G1XA 2IKIA 4ZOEA 2DSKA 4DBSA 3PFMA 3SCOA 1GOIA 5EPDA 1XR2A 3MSRA 1UQYA 1VGAA 4CU7A 5H8UA 3DHDA 1FWHC 4H6KA 4B2DA 2X1UA 4GWEA 2CZFA 3RUBL 6ALDA 3FX4A 3BH4A 1OHLA 3G1RA 1ZCCA 2ZX9A 2PRLA 4RXGA 2PDMA 4JIEA 3N6HA 4JIIX 4U10A 4JNYA 5HOSA 1IQ8A 4UZSA 5AKQA 2E3ZA 1V03A 1JXKA 3LI1A 4WKFA 1TWSA 2C18A 1P6BA 3CTTA 4LV4A 1TV2A 3NPWA 3T2QA 4XQ6A 3P3BA 1LBMA 3W24A 4GZ7A 2PI6A 1L8PA 2HK1A 3UR7A 2WCGA 3PF3A 1JD7A 1XD0A 4EVZA 1IHIA 1A0DA 3U5UA 4MPQA 1TQJA 4WZHA 1XF0A 4E5TA 2WNNA 1XRSA 1ELSA 1NF0A 4JY8A 5LIYX 1LM1A 5C55A 2CLOA 4BWLC 4PCNA 2GVYA 2CZVA 1OK6A 4QE1A 1Q5MA 4S3AA 3E0LA 1AL8A 1ZUAX 3NURA 3CMFA 3SR7A 3F7JA 4KEMA 1XG4A 3B9EA 3U7VA 4UNIA 4PH6A 1BTCA 2YCKX 2ZZ4A 1YXCA 1M7PA 2OU4A 4JTAA 1B5TA 3ZR4A 1UG6A 4GQGA 3UGRA 4GUIA 3FA3A 2Z00A 4LJ3A 2PSNA 4D71A 4NX0A 2EPHA 2OQYA 3CZLA 3FAWA 3I3DA 2O7QA 3CWNA 3LHWA 3TA9A 2VEPA 2BY0A 3R11A 5CBBA 4ECLA 1VS1A 1W1ZA 3PG9A 3MI6A 4TVCA 5K7JA 1S5WA 3LMZA 3VIHA 4L9XA 3PZ9A 3BC9A 3CO8A 5DT5A 3EX3A 3ANYA 3KBVA 1UUOA 1ICSA 1DKWA 4PBGA 2B81A 1F2JA 1HKVA 5FEXA 2ESCA 1VENA 3HOJA 1PBGA 1E0VA 1TPC1 3O6AA 4QNEA 1FFRA 1IEIA 3K1GA 2A0NA 4M6QA 2TRSA 1A5CA 3SY8A 2C91A 3CB3A 1L9WA 3WJSA 1B2YA 4FNSA 4Q22A 2NVAA 2A6NA 1TPVA 2VURA 3MS8A 6A3HA 3W2UA 1VQTA 1WCGA 2TYSA 3ELFA 1TMHA 4YWSA 3SB0A 1RA5A 2WVUA 2WYSA 4S3BA 2WHJA 3W6LA 3GXIA 4BQ3A 2FMOA 3IGXA 3JRKA 1Z8AA 2OZ0A 1CXKA 2VGIA 1D7KA 5C9ZA 1RK6A 3LHVA 1YNPA 1T6MA 3QMRA 3EB4A 2C1IA 2ZWYA 2C14A 3B8VA 4GCXA 2JIEA 3VDHA 4GJIA 3WDPP 1E51A 1V8EA 3E2VA 4NAEB 2J66A 1MZRA 2BG5A 5HMDA 1R30A 3AZRA 2F9RA 3CT7A 4A8LA 4X63A 1JD9A 5M2FX 1MQQA 4UFKA 1FWJC 1TREA 1DP0A 3QHNA 3W7CA 1K6WA 5D37A 4C6EA 4DUXA 1PXGA 4PN2A 4FNPA 2HPMA 3OLIA 2Z24A 1W9XA 2QCDA 2R1LA 4XZMX 5FL0A 3CB8A 4FX6M 2GYIA 4WX2A 1NELA 5AZ1A 4Z17A 4PTNA 3UY8A 4XBSA 3DFOA 3LPOA 2ADAA 3REQB 4P8VA 3QQ0A 1ADSA 3QYQA 2CLIA 1YKWA 4M24A 2WVSA 4AIOA 4XO6A 2HDJA 4IG2A 4IFKA 1Q6EA 3QRHA 2AKZA 2E9LA 1OK4A 1DPMA 3KOFA 3FNDA 3R1ZA 3GNDA 1TPDA 3UETA 3H12A 4ERIA 1YDYA 3HGRA 2ZC1A 3D5HA 3WLHA 3O6DA 4XUGA 5D2WA 2CCRA 3QGKC 1GGOA 3RLGA 3K46A 1ITQA 5C8BB 1DQXA 3WQEA 2Z27A 3UGVA 3BOFA 1ISYA 4BF5A 4KEVA 4S3JA 4DY1A 3DG3A 2P8CA 3LV6A 2PP0A 4MZ1A 1AQHA 1JYXA 2FJUB 3HQOA 3U2EA 1TMLA 1PCWA 1LTDA 2YYTA 1MWOA 3HG4A 4ATDA 3O1NA 2I9EA 4LANA 4NXSA 3B8UA 4HNUA 3VNKA 4RL3A 1VJSA 5I78A 5AB3A 1JCLA 1SMAA 1QI5A 1QNRA 3EA1A 3SJNA 4UTMA 4YTRA 3O3RA 3LLFA 2D0HA 4DBEA 3CPRA 5U4NA 4LQ1A 1Q6QA 4CNTA 1R8LA 4I8YA 3UNDA 3CUIA 3ME3A 2UZ9A 3TAOA 4UZUA 4REQB 1N8IA 4K8HA 3EEGA 1G67A 2XH4A 2UBPC 3P84A 1I2QA 3VNDA 4B5WA 3SEPA 3L4TA 5JBEA 1B3OA 1EQPA 1QHPA 1HL8A 3E1F1 3GY1A 3EWWA 6REQB 1O5XA 3SADA 3NEVA 2GJXB 2C1HA 1GOKA 5FF3A 3VGFA 2WKJA 1RP8A 4UTHA 2PDWA 4PUWA 1P6CA 1LORA 2OSWA 4GYPC 3W02A 3DFHA 3MCMA 3GHTA 5AVNA 3DG7A 3GR7A 5CPMA 4WSHA 1GOMA 3RF9A 1LF1A 4A2SA 3GSMA 3D47A 3EPMA 1Y65A 1U2YA 2ZZ2A 2XGZA 2OWXA 4D6IA 1S38A 1X6UA 3TMQA 1LG1A 2DQWA 2V2DA 4DLMA 1G4PA 4D6CA 4V1YA 1NOFA 3N9SA 3WY1A 1J12A 2XZ9A 4MY1A 3FGCB 4ATLA 3BLFA 2WKLA 3B40A 3KFTA 3F2BA 4ZOAA 3HTWA 1TCMA 1H1YA 4F66A 4R27A 3POHA 4FAMA 2VCBA 1OYCA 3EOEA 2WC3A 2WQPA 4JL1A 1KTNA 4HBKA 3W75A 3B8IA 3CTLA 2NQHA 3R12A 3N6QA 3SSZA 1IEVA 3MCOA 1M04A 3UD6A 3W27A 1Y7VA 1QOXA 1Z42A 4MF4A 2EQDA 1XYZA 1YIXA 3CT2A 3CAQA 3PZQA 4KPLA 5D03A 2BOFX 4CCEA 5EMUA 4RZ5A 3AUOA 3A9BA 3VOIA 2ZRYA 1X1OA 3I3EA 4DAFA 1XQLA 5TF0A 4X0VA 1TWIA 4D2JA 2QJMA 3WDHA 2E40A 3ZXWA 3G5EA 4GUJA 3N2CA 2PF8A 3BPWA 5IRPA 3M0XA 4UQAA 5HJYA 4L64A 2NQ5A 3L4ZA 1W9UA 4HN8A 2VCAA 4UNKA 5DQPA 2D2OA 3VCCA 3U0HA 3S5OA 3IUHA 4QBXA 1BG9A 2EG6A 1Y5XA 3OA3A 4O1CA 1VBUA 2EGZA 5DMYA 1KQZA 4W4QA 1DJHA 3LRLA 1W3TA 1XLLA 1C8VA 1AH4A 4TXEA 5CXPA 5LA0A 4QJ4B 4E6MA 2PWHA 3FK4A 3B4UA 9XIAA 3CZJA 3W7PA 3UVAA 2ZRXA 2YDRA 1HZYA 3CV7A 2Q71A 3EKGA 1XJBA 3R5EA 3HFTA 4LV9A 1LUCB 3KCLA 2PDUA 1W1VA 2XH2A 3RX4A 4DAIA 1SUXA 4MWAC 1Q6GA 1ZFJA 4RV8A 3VIFA 2PDKA 3HPZA 3FY1A 5AYXA 3D3AA 3DG6A 4JKLA 3SY1A 3CBWA 4JN6A 4CN4A 5C5YA 3UU0A 2WHLA 1UJPA 1FRBA 2PTYA 2QAPA 5FF2A 1XPYA 4NG3A 5BRPA 3T05A 3RU8X 3G1YA 3WQWA 4CUCA 2ZRZA 1GQKA 4B5NA 2KZHA 2VDIA 2D22A 4R9XA 5CC3A 4N9DA 4J9JA 3THCA 1ZAJA 4G1NA 4K8GA 1HTIA 2ZDRA 1QK0A 2HS6A 3M44A 3WCZA 2I17A 3JUGA 1EJVC 3ZJ8A 3I7QA 3R7MA 2WXDM 1QU4A 2ZX7A 4XG1A 3E0WA 3BAKA 5LNSA 3KOXA 1HO4A 1W56A 3BICA 1MZHA 1QNOA 4LBRA 3UA3A 3DFQA 4PTVA 3TE9A 1ZJAA 2GOKA 2IQTA 3ZJ6A 3M5VA 4HPGA 1V6UA 4DF0A 3P7YA 4EP8C 1JDCA 2VEMA 3VTRA 4JIPA 4ZTXA 3ZT6A 4IIBA 3L7RA 4WY0B 3RFAA 3CL7A 3CUGA 2GGGA 4GXWA 3B06A 4XKYB 3V36A 2QDGA 3FEQA 4TMCA 3B03A 4ADTA 2ATMA 3T4CA 2XGIA 1R46A 1K02A 3ZS4A 2RFGA 3BXWA 2DSZA 2A3AA 1A47A 2PURA 1YBQA 3NZ1A 1OFDA 4LYKA 4OGZA 3W26A 2BLEA 4HK5A 1WP6A 3SY5A 2VX6A 2XGBA 3OO2A 2A3CA 3IIVA 2IKJA 3DX5A 3AAMA 1OB0A 2XFFA 4PYSA 4MLJA 1H2JA 3K4AA 1C29A 4ZR8A 1FWEC 4PMVA 4DJFC 2JKAA 4ZO8A 3E6EA 2V3EA 4GNVA 2XH0A 1TQXA 1EPXA 2EPLX 2XN0A 2NZLA 4IUGA 1G94A 3INPA 3R4IA 4C1LA 4AZHA 2R82A 3Q65A 1RBLA 4LCSA 3M0VA 1WX0A 4H9MA 1XCXA 5LZLA 3PTDA 4C6JA 1AFSA 2Y0FA 4AX7A 2CERA 2J8TA 4IIEA 1EWDA 4LUIA 1JZ7A 3B0XA 4IP4A 1J10A 3DC0A 5I3HA 4DJDC 2ACUA 3RR4A 2ALDA 4RNIA 3QN3A 1B9ZA 1V3JA 3KUMA 1EUAA 1T7LA 1WXZA 1W31A 3L4UA 4NI8A 4RXFA 1AVAA 2H90A 1ODUA 3TZNA 1XH0A 3MMWA 4TX9A 5CG7A 2YCJA 5IBXC 3ITVA 2G3MA 4JHZA 3GH4A 1W5PA 1XRTA 2QJGA 4M6PA 4M56A 4MG4A 1EC7A 1OFRA 3W23A 4DZHA 3FKRA 4EF9A 4PCPA 3PZOA 3HG3A 3W4RA 4TIMA 7REQB 2PE4A 2CLHA 3H21A 3NVTA 1QW8A 4MLRA 4P7OA 5K2ZA 2NXIA 2Y24A 1GYMA 4HA1A 3SIMA 2PZNA 2HMCA 2OZTA 4AZCB 2WC4A 3H2MA 1GW1A 4GY7A 3W6MA 1X1ZA 1G0CA 3MP4A 3WQ5A 5BROA 3NQCA 1IWAA 4G7EA 5JVLA 3LPGA 1EIBA 1KCKA 5AC4A 3C2YA 4UTKA 2WJEA 4IQJA 3B0UX 1EOKA 2QF7A 1TE6A 3FDKA 1K8ZA 1DJIA 1M9HA 4MM1A 3U4AA 1E9LA 1G9HA 4LUYA 1GHSA 4RDWA 4WY0F 5I03A 3SZ8A 1JYWA 1XD1A 3PBGA 4QLLA 1EEPA 3GR4A 4KCTA 2BXVA 4AVNA 1TRIA 4OBRA 4L80A 4DZ5A 4DUOA 1VP5A 4OE7A 5DRIA 3G3MA 2NVDA 5C0QA 4LUJA 1DJWA 3GW0A 3VIMA 4KWOA 2PDBA 1W3NA 3M5YA 3ZVHA 2EF9A 2QAFA 4CQAA 1JZ5A 4W89A 3DFTA 2NT0A 4V1XA 2VFIA 3XIMA 3NGFA 3LNMA 2FFIA 3IVSA 3KWXA 5F4SA 4JAWA 7CGTA 1V6WA 1F3EA 3WJYA 1UZHA 4DLFA 3H7VA 1NU5A 2XSBA 4I5RA 4PFHA 2H8XA 4O1AA 4PRRA 5A2AA 4W87A 3PJTA 1XFCA 1SO3A 4Z1DA 3SGUA 1I8JA 3WF4A 3Q58A 5HWNA 1GJPA 4MZYA 4P7LA 1W0MA 3MUIA 2WZMA 2Z1KA 3WF2A 1LLWA 2WZIA 5U7SA 5EL1A 1L6YA 3FJ4A 3ZWSA 4MIMA 1AQMA 1EO7A 3H24A 1Q4NX 2XHYA 4RLIA 3VIGA 1JQVA 4U2YA 3AJXA 4XK2A 1WUFA 1RY8A 1OY0A 4UFMA 5H2ZA 1M7JA 1L0PA 1TYGA 1PWLA 4A22A 1UCWA 4CNNA 4MSSA 3KTCA 2O9RA 4HZMA 2J25A 3LLDA 4O13A 3ATZA 4BI5A 3EOLA 3OG2A 3GDKA 4AX6A 1NH6A 2I5QA 3QBUA 1OZQA 2QT3A 1CGYA 3SM0A 1AH0A 4HU8A 1ZPTA 4LS1A 2ZA3A 3SGGA 3GX9A 2QGHA 1B4KA 3D3FA 1V6VA 5EYWA 1FCQA 2DUAA 1VH7A 2YB4A 4WCJA 2JFEX 1Q45A 4O1FA 3ARPA 1UKOA 1WV2A 4XAGA 3TR2A 4IL2A 3ZZ1A 1JCYA 3BSGA 4JR5A 3T7VA 5E6ZA 4J2PA 3WEZA 2X2GA 3MO7A 4WDWA 1K1DA 3S1UA 3PP7A 5AC6A 3WUEA 3L2IA 3QV6A 2EJ1A 3ARSA 3HB9A 3BARA 2DP3A 5LA1A 3WNKA 2HE5A 4LS2A 1LWHA 1NWUA 1U30A 2GGIA 4KETA 3FN9A 4XIAA 1SJAA 3BE7A 2CW6A 3PPGA 2VMFA 2ZWZA 1TV8A 3HV8A 4PSRA 4AHQA 4GE8A 3TC3A 2C8NA 5E9XA 4AIBA 3U9IA 1EDGA 1ADDA 2VT0A 3CK5A 1EUNA 4A3HA 1E55A 1TWWA 5T8GA 4GNKB 2Y70A 2DVUA 2WLYA 1ZJIA 1OFOA 2G95A 4H19A 1SW0A 4WDUA 4KESA 5CZJA 1CLKA 4LYRA 4S3FA 3PY2A 1NP0A 4UMBA 1QOPA 2D1ZA 3C2VA 2PCEA 3T07A 1SFJA 1WZLA 1BRLA 4GIRA 4YU1A 2CBIA 2DZBA 2HS8A 2Z0IA 4H4IA 1VYRA 2POZA 3LBMA 1C8YA 5LIUX 3W83A 1JIBA 1BQCA 3R10A 1OADA 4KRUA 3S42A 3VKKA 4US6A 4GIEA 2FB3A 2BODX 3EZ4A 3NOEA 3NDOA 5G1TA 4Q7IA 1VIZA 1VBRA 1D7FA 3KAOA 1EJUC 3F4CA 1EJWC 3AIVA 2J8FA 1RZMA 1Y8BA 4Q8OA 3WQDA 3ZSSA 3PZMA 4I3GA 1MW3A 3UCDA 1W3IA 3LDVA 1R9XA 3E02A 4ZO6A 3VD9A 1G6CA 3ISIX 4BQ2A 1MUMA 1WBHA 1U1JA 3BAWA 4HPHA 3S5NA 4DXXA 2ZXAA 3EA2A 4H41A 4W8LA 2PDYA 1EBGA 3CL6A 5REQA 3CO4A 2HBXA 4ZE5A 1XXXA 2XZ7A 3BO9A 3M7WA 1NVMA 3EOSA 3AHXA 4AHPA 3NSXA 3H22A 2BWGA 1VR6A 4H9ZA 3S2CA 1OBAA 1IT0A 5BCAA 1UD5A 3EDEA 3QZAA 1VCGA 1CLVA 3WLLA 1XL9A 4IM4A 4XTDA 5A95A 3O05A 1PCKA 4GKLA 3VPLA 1FWWA 1QRQA 5A1AA 5CPNA 1VHNA 4DPPA 4DELA 5A8GA 1E40A 2XVLA 3ABZA 2J9XA 3CZGA 2VC7A 3WH7A 2FH6A 4L1GA 4EAMA 2CLPA 2DT0A 3F4DA 1V02E 2ZXBA 2OWWA 2QGYA 1MW2A 1IE7C 3L68A 1J2WA 2X09A 3PN8A 3W25A 2DUZA 2EG7A 5C7VA 4UWMA 4H04A 1KGXA 3WQ4A 4C6QA 1B3VA 3TJLA 4F2TA 3PBUA 4LNCA 8TIMA 3GUGA 5MHBA 2Y5EA 3HQNA 5I3KA 1K4GA 3PZVA 4TU1A 1UMYA 1OGSA 5A6TC 2VRQA 3ORWA 2GVGA 3GC2A 1JNDA 4UIOA 3HG5A 5EKYA 2QW5A 1JPIA 5A2BA 4Z1CA 1VLWA 4HNTA 1JNEA 3CV6A 1UWTA 4GGBA 5AN7A 4CN6A 1RPKA 3ZLGA 2AQOA 2Z6JA 1LWJA 3LYEA 2ZRVA 3V5FA 3TJIA 2ZXDA 3FJNA 2WVVB 4XD4A 3UBPC 2J8GA 3I4EA 4L56A 2OO6A 4QJ1A 3ITOA 2ZVRA 1F6YA 3CH0A 1IGWA 4KWVA 4OT7A 4OOZA 3G3DA 1O4UA 4GQ0A 2QEZA 1OIFA 1PTAA 4NZ5A 2WSKA 3U8GA 4D6HA 3VIOA 3BGJA 3GYEA 3MVIA 3BGAA 5HNRA 4QR6A 4ONVA 1F73A 4Y9OA 1UD6A 2XN1A 1KM5A 4U3CA 3BCFA 3M43A 1DWFM 3S4TA 4AY8A 2L5HA 2J7CA 1P6WA 4CVUA 4KFOA 4UTFA 4J3TA 4PB5A 3H4XA 3SCSA 3AISA 3HG2A 1H60A 2I14A 4OV4A 2ISDA 1W1PA 4RZ6A 3I7RA 4Y7EA 1PX3A 2ISVA 2VUYA 2DZTA 5DXYA 3T0AA 4ZO9A 4NL1A 4OKDA 4AMAA 4A8NA 4BQ5A 4AB4A 1E6ZA 1KM2A 2C1GA 3AICA 4FHAA 3L4WA 3ID7A 5AYIA 2P3ZA 4DYEA 1GQNA 1V0NA 2WVTA 2XIIA 4HD5A 4MWAD 3GG1A 1XLGA 4QP0A 1GVFA 1VRDA 1WXYA 3UXAA 3WYZA 1TELA 1UQZA 3VA8A 3ZO9A 4U33A 4Y9AA 1XH2A 3LTYA 1KTCA 3EXRA 3R79A 2ON3A 3DEQA 3UY7A 2ZZ6A 1C93A 1XSIA 3SQMA 1W6TA 3TTSA 3URNA 4EE9A 4OHQA 3VNJA 4U28A 4E38A 2FHCA 1A5MC 5KZDA 1JUBA 1VBGA 4RR4A 4D72A 3SW6A 5FD0A 2VX4A 2G3IA 2ZTJA 1E0WA 1FP8A 3MHFA 1DIEA 4RPPA 4XZ9A 5HUPA 1XIHA 4GYFA 3ABXA 3BMXA 3W7NA 5HK4A 1G4SA 2BY3A 4GY0A 4NY2A 4IT1A 4NF7A 3FKKA 4GVFA 1K9EA 3W1LA 1ECQA 1J18A 3CMJA 2P5NA 4IH3A 1KCLA 3H70A 1WKEA 4OUEA 3CU2A 3EMCA 3SCQA 1NOUA 5MKGA 4E4PA 3SRHA 2GWGA 3VKDA 3E5BA 3TC6A 3SCPA 3VX0A 1HKMA 5T9BG 2Z1XA 2I9UA 4PB3A 1PZ3A 5LHFA 3TU9A 2WMIB 1Y5VA 3UG3A 4PMZA 1MEIA 3BTNA 4H8VA 1CXEA 1UWQA 3I6EA 1EB3A 4WOZA 1YTKA 4B3KA 4NAEA 4GY1A 1J0HA 3KVKA 4GD0A 1E1EA 2DUXA 3UF9A 3NQ7A 3ZLFA 1KCXA 4LYQA 4NZFA 3L4XA 1ZRQA 2REQB 2UY4A 1HJVA 1HX0A 1IWPA 2J13A 2PLJA 4A05A 4CKQA 3LBCA 2PLCA 1M3UA 4WLCA 1TWDA 1GKRA 4BFAA 1U5HA 3TYAA 1HQTA 1T5AA 1LL4A 3R58A 3H23A 3BLOA 4DJFD 5I02A 3V75A 3HN3A 4B5UA 3IIZA 3LNPA 4O57A 5BXRA 1PIIA 3UFYA 3TYBA 5CPTA 4DPQA 2E6DA 4QJ5B 1H62A 4J27A 1DL3A 4QCFA 4FO4A 2QYGA 3KW3A 3OLGA 4GBDA 4Z1BA 3VGGA 3AC0A 1UR4A 3LI0A 1LQAA 3WFZA 2C19A 2ZFAA 3TXVA 4XVDA 3GE7A 2QQ6A 1E73M 1UD4A 1KV5A 3KHJA 2IPWA 4DJDD 1BWVA 2OXNA 3OODA 3NQEA 2ZZ3A 4MMWA 3OLDA 1GCYA 5HQMA 3VDGA 3GXTA 2WHMA 2VHLA 2DQXA 1E43A 4C1NA 1SW7A 1Q4WA 4IIGA 1CGVA 3W1MA 2FJKA 4IGNA 1X7FA 1FH8A 1M7OA 2IPFA 3ZT7A 4UR7A 1XIJA 2TSYA 3OIXA 4AIEA 3BSHA 5I5RA 2GVEA 2FTPA 2GUBA 1E3ZA 4GRSA 3W71A 3HU7A 2C3ZA 3FYPA 3IIOA 2ZXQA 1E6NA 4CD6A 5JQ9A 2IUZA 2VDGA 3WNOA 1A5OC 3H53A 4N9BA 5IXEA 1US2A 3ARQA 4O17A 3WD4A 4QXIA 3W1NA 4UB9A 3SCNA 3AIBA 2GK1B 1S5TA 1XLIA 5C9RA 4FLQA 1OJXA 1LRNA 2YL6A 1TR9A 1HJSA 4IX2A 4YTQA 4Q4OA 4QNWA 4I9JA 4Z2JA 4PODA 1IIGA 1FHVA 3PZGA 5F2GA 2YGYA 2BV9A 4G5DA 3ARRA 3B0PA 1QJWA 1R3SA 4REQA 3N25A 1EH9A 1AMKA 2ZUSA 4OIFA 2HBVA 2V3FA 2YSWA 4MGGA 4K7YA 1PHWA 2ACSA 3H2CA 1XDLA 2ZUWA 3T09A 1MRQA 4AEFA 4B16A 1Z41A 3PZUA 4LW7A 2XISA 1UZ4A 3DN5A 1GVEA 2GJXA 4PR4A 3LPPA 2OKTA 2GJNA 1C7SA 2XIMA 4ZB2A 3LN3A 2J6VA 3NSMA 1PSCA 2ZTKA 4AZ7A 1W1YA 2CPUA 1F74A 3S1GA 1OCBA 1LDCA 2I7GA 4ERAA 5I3DA 4NZ4A 4YVXA 1MUCA 4KW2A 3GDBA 5DCEA 3VNZA 5I06A 3HO8A 1VJIA 4DN1A 3ZIZA 3UJEA 6CGTA 4UQCA 3B04A 1KRCC 1PEZA 3QC0A 2IPJA 3W88A 3LERA 1GVRA 1PE1A 3PSVA 4PFMA 4IJRA 2DZPA 3T81A 3OEXA 4W5ZA 4M19A 5DMMA 2J75A 1H7PA 4NJGA 5CJ5A 2PLMA 3CZKA 1BVNP 2DIKA 4YVVA 3KL3A 3WENA 2EJAA 2FZDA 2PP3A 3WDIA 2HNEA 3G1SA 7TAAA 5A8MA 3G22A 1HL9A 3S1VA 4FIRA 4PULA 4DNMA 4B2DD 1OCJA 1PTGA 2A7NA 4KQNA 4NRSA 3GTXA 3VNLA 3CQHA 5HJLA 1VC4A 3V35A 4LAOA 1DWHM 1R9ZA 2CFFA 5IHSA 4PMNA 1K70A 3VXGA 1Y5WA 2HVOA 3QF0A 3OGRA 4EXAA 3IJLA 1O6IA 5EIYB 2FZBA 2Q6ZA 5C71A 3EYPA 3C8FA 2Q8ZA 4XSLA 3HM7A 3NZGA 1R87A 3EWUA 5HULA 1TPB1 2OWCA 2G8ZA 2WLZA 4URIA 4W7WA 1HO1A 1C9DA 4M1RA 1TX0A 1XH1A 2P76A 3DYPA 1XYLA 3TMLA 1X6NA 1NFPA 1MDRA 2YXXA 4DM2A 3ARWA 2PGEA 3KRBA 4GHRA 4IFRA 2RDTA 2VC6A 2YBUA 1GONA 4HU4A 4NAFB 2VYOA 1SO4A 2V5DA 1M5WA 5C7HA 4I9MA 3GVGA 4P2VA 4BWLA 4J28A 3N3TA 1UIOA 1VFLA 4ZQNA 5FA5A 1UR3M 4JEJA 3JZUA 3N3MA 3UEQA 4IHCA 3A24A 4MFEA 2PDXA 5C70A 3AIUA 3HPSA 3FVMA 4CD8A 3G1FA 4Q8QA 4GFSA 4KIRA 4S23A 5BXPA 3E38A 4YTSA 4H7VA 1TJ2A 4NQ1A 5I24A 1RCXB 4GACA 1K9TA 1NDZA 5ABGA 2Z1SA 1JG9A 1KR0A 4HHPA 4JCMA 2BS9A 1W91A 3N34A 3WDJA 2Q8LA 2BB0A 4C1KA 3BLLA 2P10A 1F4HA 4O11A 5CPSA 2W5FA 4FLRA 1TPUA 1GOQA 5AHNA 1FWFC 2PODA 1WDWA 3W07A 3BLIA 2VENA 3B3DA 8XIAA 3ONCA 1BVWA 1XQKA 3OU8A 1Q6CA 3KOYA 4XZHA 3T1GA 4JXCA 1N8FA 4S3DA 1JI2A 1QXLA 3PBVA 3QR0A 2GDUA 3NQGA 4JIHA 3VMNA 5C2GA 2PWGA 3M0JA 3TN5A 4LAMA 4EPDC 5BWFA 3CWOX 4MUPA 2A3EA 3GG8A 1EDQA 4CCDA 2PBOA 4CGTA 3EX4A 2FH8A 3A13A 4UQDA 3N2OA 1I9CB 2WBGA 3EWDA 4G1KA 1KXHA 2Z2UA 4FOKA 2J7BA 3KM8A 1NAL1 5CPLA 1R0MA 4UOJA 3GNNA 1R3TA 3FDGA 1ENUA 1VPYA 3NYZA 1YE4A 4ZFMA 3ATYA 1E9ZB 4LAZA 2PWVA 2FTYA 1H7RA 1PZ2A 5K9CA 1UWAA 2B4GA 3SQSA 1GTEA 1R7AA 3VMOA 3W29A 4HU0A 5J8LA 4YXGA 1KD0A 5I3FA 4NZ3A 4H2CA 1LZOA 4FALA 5HUOA 4FNQA 1XLJA 3CAVA 1O5RA 3URQA 1H7WA 3E0IA 4PUMA 3EXSA 4HPJA 3QFEA 2Z1BA 3GIPA 3VIJA 3EWYA 2PS2A 5D2TA 3W74A 1QI3A 3APTA 1Z7AA 3UXDA 2BGSA 3RPMA 5D32A 4QDWA 1SO5A 4DWSC 2IW0A 5ABFB 4WY0A 1RLCL 2ZZ5A 5PTDA 1JPHA 2GUYA 4XKYA 4KGJA 1G69A 3M6YA 1I6NA 5HANA 4JFUA 2WWCA 4RE3A 4C6LA 3IV8A 1HP4A 1NEYA 3WBXA 3NIYA 1YNQA 1QMLA 1H41A 4L9ZA 3FHAA 3MSDA 4OQVA 1P0KA 3GXFA 5DEZA 4S3GA 1VYSX 5FF0A 3UZWA 4EPBC 1NQ6A 3M0IA 2OEKA 3QOMA 1XYBA 2DEPA 1MYRA 4V27A 2CLKA 2WC7A 1GJUA 3IRSA 4EPEC 1JVNA 3WH8A 3MP3A 2XWDA 4BA0A 4ZA0A 4H01A 2E9MA 2AQVA 3WLMA 1OFAA 1RD5A 2QJIA 1AJ0A 1JYNA 3THUA 4QX4A 2NX1A 2NX9A 1QOQA 1XPGA 2Z4GA 4AH7A 1NDYA 2RAGA 4IPLA 4DI9A 5CQ1A 1JCXA 4IIHA 4GX9A 1J6OA 4Z0JA 3OLEA 2PMQA 3NL2A 5E0FA 4UCFA 4C5YA 2BVYA 3AO0A 4R7OA 2OOFA 5BOEA 1JYVA 3CUXA 1XCFA 1L6GA 1SM9A 3WJWA 3RRAA 1VFSA 3B0VC 1H11A 2EPOA 1DHKA 4PUUA 2NXHA 3QEZA 1IZKA 4K37A 3VK5A 3CEUA 2EAWA 3VE7A 2ZUUA 1MXGA 2PU0A 2WNQA 5KEZA 4JCLA 2OFJA 4ENLA 3S6DA 3AHZA 4JTQA 4GG9A 3ABRA 2CHNA 4AZGA 3WNPA 1HJWA 2WZHA 3DGRA 4FZIA 5GQBA 5AYZA 3S6OA 4YTTA 1FWCC 4JTGA 1PX4A 4ML9A 4A35A 1Q6OA 2R94A 5HJXA 4FR1A 1J0IA 1Q8AA 2PAJA 1FDYA 4UTUA 3QYSA 3P2VA 3U2CA 3PTMA 3VIIA 1K9DA 3CNYA 1MDLA 4IQEA 3WK2A 1J93A 4HIBA 1G1YA 1NFGA 7REQA 1TVNA 1RV8A 3WUGA 1WDRA 4YCOA 2Z7GA 1EA9C 2ZA1A 4HJFA 1F5ZA 3ICJA 2NSXA 2NQJA 1V02A 3UG5A 3TYCA 4O4VA 1OVDA 4NNAA 3H7RA 2HRWA 5M3WA 4AZCA 2BASA 3MVTA 3S2LA 1FHLA 3APYA 1XBXA 5HXMA 3PZTA 2X40A 3UWQA 1M65A 1N2VA 1GG1A 3LMYA 4GFIA 5CZ0A 1SVDA 3H2FA 3RGTA 5KSWA 5CAHA 3C2RA 4OBTA 4GI4A 1EHAA 3PB2A 1JPKA 4PMXA 3KRZA 3NZQA 1FWAC 3BUVA 1F6PA 1A5BA 4B9YA 3QQ1A 3GLCA 2AL2B 1OF6A 1XSKA 2NQLA 1SZGA 3S1WA 1GVOA 3STCA 2DSUA 1ZSXA 1E5JA 3ARVA 3WMBA 1BG4A 3U57A 1U5JA 2OZ3A 4HK6A 3W7OA 3CUFA 3FAXA 3NFUA 5GVJA 3HGOA 2CHRA 1V4YA 2OTDA 3L65A 3UPMA 1SZNA 4HG6B 1PIGA 1VD6A 3A4JA 2CC0A 1O1HA 4GUGA 1YHTA 1M68A 1HGWA 3W28A 1LLOA 3GHSA 1XLEA 1MMFA 3G6LA 3NOYA 3O7UA 4RE2A 3B9NA 1K9FA 9RUBA 4K1GA 3GXDA 3CQJA 2WMGA 3E49A 1I1WA 3EDJA 1KGWA 1RUSA 1GZGA 2VGGA 4AZ6A 1WAUA 2PTXA 4ZO7A 2PWDA 3PPCA 4MNMA 4GABA 1XLAA 1QNSA 1A3HA 3H8AA 3NDYA 3STEA 4FS9A 2XVPA 2GVLA 3SCUA 1DJXA 1GZJA 3RN6A 3MI2A 1S2TA 3M1ZA 4PBEA 1XX1A 2NVCA 4JX5A 3W82A 1IXNA 1X6LA 4CQDA 5CGTA 2RGMA 5HAOA 2HTMA 2IQ0A 3TSBA 3SAZA 3S2NA 1TA3B 3L0NA 1OX4B 3ALGA 2QIWA 4WVXA 3H6OA 3F5KA 1XGEA 1V79A 3UZYA 1A5SA 4ZB5A 1E6QM 1I1XA 2E0PA 2XVGA 2H9AB 4US5A 2P1FA 4C6OA 1XBZA 1SYTA 1CBGA 1ECEA 5HINA 1VLIA 5CCZA 1J5TA 4IQLA 1OFEA 1OC5A 2V5CA 2V8ZA 3UWUA 4H9XA 4CCZA 3AS2A 5G5IA 1YW1A 3DYOA 2GPTA 1MVYA 3K8KA 2XFYA 5HWJA 5D30A 4JTHA 4JN7A 2YXOA 5HMSA 2QUNA 5D2YA 1HKJA 4PEEA 4W8AA 5EY5A 5BW6A 2OKOA 2YA1A 4AC1X 1SJDA 3GK0A 4CVWA 1FQ0A 4C6FA 1QT1A 4FXRA 3QSTA 5CC6A 1XYMA 4PMYA 5LA2A 1X98A 1KBBA 3GTFA 3R0KA 4JTFA 4N0RA 3RJYA 2WJZA 3TN4A 1W2VA 1SSDA 1KXVA 4NJKA 1AUSL 3FFSA 1YADA 3DGBA 3AQUA 3IVTA 5B7YA 1UH2A 2VZOA 1UC5A 4CD5A 5D09A 1W32A 4WOQA 1O60A 1IXPA 1NTHA 3WQFA 3TUUA 2B7OA 3WLRA 2Y7EA 4Q8NA 3JS3A 3PC0A 4MAZA 2YIHA 3DFSA 3W7QA 4QIUA 2ZA2A 4H7CA 1OZMA 2YA0A 2BSLA 1QCWA 4KRZA 2BXYA 2YB1A 3QZEA 1WDDA 4ZENA 1CXHA 4XD6A 3WELA 3IJ8A 1S2AA 3K13A 5EMKA 5SWUA 3LQGA 4I6VA 2BGNE 2P0IA 4RE0A 4Q4PA 3FYOA 4F0HA 3MP5A 4HZ7A 1AK5A 1G5AA 4M3PA 3AMLA 3C3NA 2WZTA 3S6TA 3MMUA 2Y89A 3LD5A 4C6BA 5FEPA 1J9YA 2W66A 4PUEA 3RLHA 3MC5A 2XWEA 1XBYA 2MANA 5HNNA 3GU1A 3BOLA 3CHCA 4XVEA 3MT1A 4CNUA 5G1YA 2YJQA 3KDOA 4XAPA 4WR3A 5DBTA 1CZ1A 3CJPA 1U33A 1W17A 3RG6A 4PCFA 5IM51 1XIMA 2QJHA 3ITLA 3W22A 4ZGYA 3RITA 2QIIA 4MPKA 2IS7A 4GVHA 3BSMA 1YYAA 4TR9A 3WQPA 2RGLA 4U4MA 1CXLA 4K2SA 1XDJA 3PHAA 3GRIA 2OQLA 2EKGA 4RNHA 5BMXA 5A6AA 1KFLA 1S2UA 2Z2BA 3N73A 2DZAA 4KFPA 1OM0A 4QROA 4FXJA 1OYBA 1M53A 4XAZA 1CXFA 3DHFA 3GO2A 4WGXA 2X0YA 3RIKA 3L5AA 4HGXA 4PMRA 2C0HA 1LBLA 5I6SA 2JE8A 1IR2A 1UHVA 5H8MA 1VBHA 2BFGA 2F8QA 1UP0A 3BQ6A 3VGHA 5CH9A 4ZFCA 5F4XA 1KBIA 4DWDA 5I07A 1WKDA 3BANA 4HSNA 1D8WA 3LK6A 4F0KA 1GWJA 4FEZA 4IGMA 5AHLA 4DJDA 2VNCA 1UWRA 3LZ3A 4ERGA 2QCGA 1V3LA 3KRSA 4HNVA 3C86A 2IKGA 2YDAA 1Q7ZA 1K03A 2GGHA 3VM5A 4AYGA 4PTXA 1XRFA 2E7FA 4QS6A 1Q7MA 2R1NA 3G6MA 3OVPA 2VUNA 3DXIA 4IPNB 5EU9A 5IBXA 4N6FA 2ZX6A 3UZXA 3EPNA 1SGJA 3KCOA 1MW0A 3T55A 1UMLA 1VBJA 1LQ0A 4ADUA 3CLMA 3A22A 5FF7A 1XLKA 1KFJA 3P62A 2X7VA 4Z2LA 1JZ2A 5AHEA 1CECA 1H5VA 4B15A 4UFHA 2Z1WA 3BV4A 4EXQA 3QPEA 1IF2A 4IJCA 4Y9PA 2D2JA 3VD3A 2YOCA 1S5MA