1K9EA

Crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with 4-o-methyl-glucuronic acid
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
676
structure length
671
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAVVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRRWWKETAKRIYQYIPDFGGFVVKAPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords alpha-D-glucuronidase
total genus 271
structure length 671
sequence length 676
ec nomenclature ec 3.2.1.131: Xylan alpha-1,2-glucuronosidase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1k9eA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1k9eA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1k9eA03
4WKHA 2PWEA 2ZWYA 3GXIA 3CO4A 2YL8A 1O7AA 1E3XA 4ATWA 3N15A 3CPUA 1UA3A 1EDQA 1HJWA 3WNOA 3VD5A 1JD9A 2IUZA 2X05A 1HF6A 4DWSA 3K4DA 1KWKA 3OLEA 2E40A 4B9YA 1OWQA 1E71M 2DIJA 1CXLA 2JIWA 2FH8A 3L4UA 1C8XA 4PBGA 1GORA 1TVPA 2ZUMA 3SCRA 3BAIA 2AOSA 1ITXA 2YDSA 1VFMA 4JCMA 1QI3A 4E8CA 1CXKA 4U2ZA 5GPRA 4X9YA 1WDQA 1QW8A 1W9PA 3AZRA 4UZUA 5D9OA 3QR3A 3W4RA 3KEHA 2Y2WA 3KL5A 4P7NA 2DGAA 5AC5A 1E4IA 3VGGA 2ZX5A 1E4LA 3AICA 2WPGA 1I1WA 1TCMA 3EDKA 4HZ7A 4WKFA 3U5YA 1G01A 3AS2A 1XD0A 4ACZA 2OWWA 3MV11 4WIWA 3UEQA 3WH7A 3WH5A 1EXPA 3CBWA 2C0HA 1EDTA 2ZUTA 2YDRA 3BC9A 1K9EA 1EHNA 5M17A 5D9PA 4D6IA 1JI1A 3I3EA 4FK9A 1UUQA 5IDIA 5CPSA 2VZUA 4BZYA 2BNJA 1V3MA 3CTTA 5A6BD 2CHOA 4KGLA 2WMJA 1QNQA 3BSHA 3T0DA 2D0HA 1FH7A 1NWSA 1B3YA 4YHGA 1JGIA 3VMPA 3F5KA 3WEZA 4JFWA 3VPLA 1JFHA 3RM4A 3ZT5A 1V0MA 2XVPA 4WK9A 3VILA 2XVLA 3MKKA 4PEEA 2D1ZA 4HU8A 5LA0A 3AMKA 1KFWA 4PMYA 5LYRA 2PWGA 4M80A 1E56A 3AXXA 4Z2JA 2EBNA 2GJPA 3LPFA 5AYIA 1EO5A 2WCAA 4S3KA 1NP2A 2BXZA 3QGVA 1ITCA 4KH2A 2GFTA 1GZJA 1HP4A 4UQAA 3UR8A 4HA1A 4AD2A 3BXWA 1GQIA 3WDIA 3VD9A 1RPKA 1W91A 3VM7A 3WDHA 4P8VA 3J7HA 4A3YA 2PB1A 3GNRA 4K68A 1QOXA 3T0BA 3BLKA 2VZTA 1OT1A 5A6JA 2WMIB 2ZX6A 2WHJA 1NH6A 2W5FA 1HJQA 3PZOA 1HX0A 4XB3A 4HZ6A 3VGHA 2X0HA 4HZ8A 3VVGA 4AIUA 3VINA 2OSWA 3VIIA 2BVDA 4HMDA 2BY3A 2ZOXA 5EB8A 1DWJM 1C7SA 1QI4A 3L4XA 1ISVA 4PSRA 1YQ2A 1PIGA 1UWTA 3AS3A 4CGTA 2WCSA 5ECUA 4W5ZA 4CU6A 4ZEPA 1WZAA 2FGLA 2ZUVA 1QNSA 1H2JA 1UOKA 4PUDA 4MNKA 4CVUA 4UNIA 1AQ0A 5JIWA 3N12A 4PTWA 5M03A 1MW2A 4AXNA 4U3CA 5M3WA 2V5DA 4LQ1A 2EXOA 1BQCA 4HOXA 1QHZA 1H09A 4J3WA 3VDAA 4N42A 4OIFA 1Q4NX 4QLJA 3APGA 3FNDA 4P7LA 6A3HA 1HJUA 3AHTA 3EMQA 3KE0A 1BVNP 1E15A 1XC6A 3NIYA 2VZSA 3ARXA 2WKGA 3W27A 2O9TA 3ZJ7A 3QOKA 1JG9A 2CITA 2W4XA 3HN3A 1QNOA 1LWJA 4W88A 3T2OA 1EQPA 1M01A 2CEQA 5DO8A 3SUTA 4GI6A 2WHLA 5A6SA 5JUVA 4TXEA 3F5LA 2J8GA 2A3HA 2WC7A 3IAQA 3CMGA 2FHBA 4TVDA 3MS8A 3L4WA 1KBBA 1WAWA 2VR5A 1GCYA 2VQTA 1PPIA 3IJ9A 4CD4A 4MB5A 3PZTA 4W5UA 1JAEA 1XCXA 3VGBA 3OZPA 1UKPA 2X0YA 5A8MA 4AZ5A 1HN1A 5EMYA 1X6NA 1B3ZA 1H0IA 1XH0A 3W0KA 1GQJA 2WMFA 4EANA 2ZUNA 3L2MA 2WWCA 4JIEA 2YA1A 2Y24A 1JZ6A 3T08A 3BCFA 1JZ7A 1E6NA 1ISWA 4H41A 2DIEA 1W3KA 1WE5A 3SCSA 2QPSA 4IPNB 1VEMA 4AD3A 4CKQA 1VJZA 2VCCA 4LX4A 2YL5A 1GQKA 1D2KA 1R8LA 4KRTA 3N04A 3WQ4A 1XSJA 2G8ZA 3WH9A 3MMDA 1LG1A 4H8HA 1V6UA 3HMCA 5A6LA 3VU2A 1RD6A 3GM8A 4MNMA 2EEXA 4UFHA 2QMJA 5FCZA 3ARTA 3CLWA 5CLTA 1VAHA 5I23A 3AMGA 3VDBA 1XYZA 2UY5A 1JZ4A 2XFYA 1DWFM 3A6OA 4A4AA 4OZOA 1M53A 2BXYA 5I6SA 4CD8A 1GOMA 2E8YA 1WKYA 1UD2A 3GH5A 2VOTA 4HPGA 3DYMA 2D3NA 4MB1A 1FA2A 2G3IA 3RJXA 4UQCA 5EFFA 1GOKA 2WCGA 3PZ9A 1J18A 2ZUUA 2J7DA 4ACYA 2GDUA 1B3WA 1V6WA 4J3UA 3A3HA 2BFGA 1G5AA 4TTGA 1SYTA 3O2LA 3WQVA 1HXJA 4WKAA 3EBVA 3W37A 1ZBKA 3AYSA 3WD1A 2VURA 1E0XA 3PTMA 3EYPA 1HVQA 2VUYA 2CBUA 3PBGA 1QPKA 1DWGM 3A4WA 4W7WA 2WW5A 4MDOA 1V03A 2BVYA 2YBTA 3W26A 4X0NA 3EDDA 7CGTA 3TTOA 3ZMRA 1XSIA 2C8NA 3VOCA 1TVNA 1GJWA 4BS0A 3WNKA 1WDRA 4UCFA 2DT3A 3VKKA 3OZOA 1OD8A 4AZGA 2J74A 1NOUA 1UWIA 4MAZA 3BH4A 1J9YA 2A3AA 1DWAM 1XH2A 2GJRA 4HOWA 2DDXA 2NSXA 3KWXA 2BHZA 2O9OA 3AIEA 1HKIA 5D8ZA 1CENA 3N1AA 1E6ZA 2G3JA 1UWQA 3AIWA 5BWFA 1HIZA 2OSYA 4AY1A 3AIVA 3W6LA 3AMLA 3K4AA 1BPLB 1J0KA 4QDMA 4C7DA 1MYRA 4HPHA 1E1FA 3NSXA 1K9TA 1NWUA 1TR1A 4RE3A 4AIEA 2QLYA 1KXVA 1PEZA 1GPFA 3K1DA 3ZO9A 3WENA 2DSUA 1GQLA 1W2VA 3A47A 2WVUA 2XSBA 1FH9A 3SCUA 3ARZA 5ABFA 4W93A 2DSKA 5DT5A 3RM9A 4D6HA 3PHAA 1BG4A 1DP0A 5IXEA 3B8SA 2CIPA 5E0FA 4C90A 1R86A 3BAJA 1UA7A 4MNLA 3AIQA 4B16A 1NWRA 4GI9A 1CBGA 1ZL1A 2XVNA 4AIOA 1QI2A 3E1F1 3W29A 1BG9A 3WH8A 1W1VA 2VZVA 3VUPA 1H5VA 1TZ7A 5CPTA 5CGTA 2F2HA 3I3BA 5A3HA 1P6WA 2XPKA 2FH6A 1GOWA 1ZJBA 3RIKA 1MXDA 4Z2HA 1B2YA 4PCTA 4IM4A 1C8QA 3SUWA 4ACZB 2W61A 2VCAA 4ZXLA 4JHZA 5I79A 5ABGA 5A8OA 1RP9A 7TAAA 1VJSA 4TUFA 1LL6A 5E70A 2VO5A 2V3FA 4GZEA 1WB0A 2D3LA 4NZCA 4P8UA 3T2PA 2EO7A 4OUEA 2XG9A 3WDRA 4W84A 1XGZA 5ABEA 2D24A 2VR4A 1V3HA 2WB5A 2E9BA 3BGAA 1E9LA 3B9AA 3OLGA 3KL3A 1EDGA 1Q6GA 3GYCA 2XFRA 4YHEA 1UH3A 5A2CA 1KB3A 4ATLA 2CBIA 5FKYA 3ARRA 3RJYA 1C91A 3NUKA 1PZ3A 1GOQA 1H3GA 2Z1KA 4W87A 3CUIA 4N0RA 1IZKA 4CN4A 1E1EA 3M46A 4LGXA 2JEQA 2YL9A 1CXEA 1JZ5A 4OOZA 5A8NA 1EQCA 3GXDA 4DWSB 2YLLA 3N13A 2A3CA 2YL6A 1JXKA 3EDEA 2WZIA 4WF7A 5E9AA 3NSNA 1IV8A 3QHNA 5GNXA 2WC4A 4CD7A 5E6YA 1MQQA 2OLHA 1E72M 2VRQA 1MWOA 3WUBA 1A47A 3CZEA 4TX6A 1LF1A 3T0AA 3TOPA 3BMVA 3CZLA 1KGWA 1H11A 1CLVA 4JAWA 5BXRA 1ISYA 3SCQA 1H1NA 2YIHA 3AIUA 3HJEA 4D6CA 4W7UA 3BAXA 3WF1A 1BYBA 1LWHA 5A6BA 5I2UA 5HDRA 2OSXA 2D23A 2V3DA 4IUGA 4NRRA 5AY7A 3AOFA 1VF8A 4DM2A 3L2LA 3WNMA 2J62A 5E09A 1NM9A 3N11A 1UD3A 3W25A 1VBRA 4D6GA 3N17A 4Z2GA 4JFUA 1PIFA 3S6TA 1ODZA 3KL0A 3B9DA 1PJ9A 4E2OA 3WQ6A 1AQHA 3TONA 2YA2A 1UQYA 1UKQA 4OBSA 3W81A 1R7OA 5A1AA 2XUCA 3L4TA 2XWDA 2YOCA 2V5CA 5HPCA 4UFJA 5DMYA 1W3LA 4CVWA 2WYSA 2MANA 3VGEA 1CGTA 4D6FA 3AHVA 4H04A 1J0HA 2WC3A 2WSPA 4PMVA 1HJVA 3VDHA 4GZJA 1SFSA 3PZGA 3KZSA 3WF4A 3WIJA 4M24A 1E0VA 1E55A 2XGIA 3WFZA 4F9JA 1UG6A 1UZ1A 3CZKA 4FLSA 1BGAA 2DT1A 3NYDA 2VJXA 1XRVA 1Q6CA 4W8AA 3ALFA 4GINA 5CSUA 5D4YA 3AFBA 2EQDA 1UR9A 4URIA 1FHLA 5I77A 1LL4A 1Y7VA 3S2CA 1H4PA 2XM1A 1EOMA 4JFSA 1KXQA 1SMDA 1CGUA 3PZNA 1QI0A 3SCWA 1Q6FA 2G3MA 1OCQA 1M03A 1AVAA 3TTYA 4Z2LA 4J27A 2DEPA 4W8BA 4WLCA 2J7FA 3VM5A 4AZBA 5C8BB 2XVKA 4PUEA 4XV0A 6CGTA 2EPKX 3ARPA 3K8KA 3VIOA 1GHSA 2ZXQA 1BAGA 3CHDA 3RILA 3VMOA 4AMCA 2O9PA 2QPUA 3LPOA 3TTSA 2CNCA 1LL7A 5EBAA 2J7GA 2J7CA 1AQMA 5FL1A 1J11A 1JI2A 1SR0A 1LJYA 4HMEA 4W7VA 2DT0A 2OYKA 2E3ZA 4F8XA 2J47A 2GSJA 3UR7A 4Z2KA 1G0CA 4UFLA 5A69A 3VIMA 1EH9A 1Q6DA 3MMUA 1CZ1A 1GHRA 4WJXA 1A3HA 3M6DA 2VVNA 2C7FA 3VX1A 8CGTA 1B3XA 3CGTA 3MMWA 3W82A 2W63A 2NT0A 1CEOA 3ARVA 1CDGA 3ZSSA 3DC0A 1ODUA 4J7RA 4Z2IA 1XCWA 2DT2A 3UG3A 1ZJAA 2GK1B 1OGSA 3AI0A 1UWUA 3VIHA 2ZX9A 4E8DA 1W9XA 5I24A 4FLOA 3M07A 1FP8A 3IANA 3CZGA 1YHTA 3ZT6A 3DYPA 1MVYA 1E6SM 3T2QA 2UY4A 5DFAA 1G9HA 2PC8A 4NI3A 4PN2A 2ESCA 2ZICA 2VL4A 5BRQA 2Y8VA 2XM2A 3AZSA 2J7EA 1B30A 5JIPA 4LYQA 2WVVA 2DPEA 1PBGA 1MFUA 2GJXB 1BYCA 2W91A 3NSMA 1TA3A 2HVMA 4UTFA 4OKDA 1AMYA 4AZ6A 4HMCA 4AISA 5D9MA 1XV8A 2V38A 4OBRA 4GO9A 3WQ8A 3WD3A 1HP5A 1R87A 1KXHA 5IHRA 5GQBA 2F61A 4PMXA 3WDJA 4U2YA 1S46A 1OSEA 1WZKA 1LG2A 4H7VA 4EK7A 4PMNA 2X09A 4IPLA 2FDMA 4D6DA 3EDJA 2YJQA 3PZUA 4PMUA 2AMGA 1B90A 5A94A 2OYMA 4JCLA 3WEMA 1CYGA 1H49A 1V3KA 2E8ZA 2B31A 3SCTA 3L4VA 3F4VA 4D6EA 4PTXA 5E6ZA 1OBAA 2RGLA 3RCNA 4E4PA 3VO0A 3AROA 3BCDA 1UD6A 1GONA 3EMZA 3CH9A 2D0GA 1V0NA 3TA9A 1W9UA 4JFVA 3VGFA 5CJ5A 1ZBWA 1VIWA 1ZBCA 4DUVA 4PMDA 1JL8A 1KCKA 1V3LA 3MO4A 5BXSA 4M8UA 4ZE5A 1J0ZA 1TE1A 1QNPA 1VFOA 1XHGA 2J75A 1E4MM 3SUUA 4MTVA 4AZCB 1DHKA 4KRUA 4MJ2A 5HNNA 1VRXA 1PX4A 4XUYA 3VD3A 4F9DA 5CQ1A 2WHKA 4QFUA 4JL2A 2VC9A 1HJSA 5HXMA 4DUXA 1J0YA 2VVSA 2VX7A 3WMBA 2J25A 1VFUA 1LLOA 2WMKA 3PTKA 4QCEA 4FLRA 3CHEA 3FHQA 3AHYA 3MUZ1 4BA0A 1C7TA 1FHDA 1BTCA 3POHA 2BHUA 3GZAA 5I78A 4JZ5A 4J3VA 5E0CA 2WAGA 1FFQA 2Q8XA 3WUGA 1UWRA 3WBAA 1J12A 3WUFA 3WD2A 3VNZA 1KQYA 3OGRA 1GUVA 3BAWA 3OLDA 4HA3A 4P7RA 5ABHA 4UQDA 4PRWA 3SCNA 4B15A 4DWSD 1V6VA 1B0IA 2J78A 1C3FA 3W28A 1NARA 4C7GA 1PX3A 3K8LA 2CPUA 1E5JA 3QOMA 3DECA 4J3TA 1JYWA 4P7QA 3D3AA 3II1A 1FP9A 1GVYA 4D1IA 3CHCA 1KR0A 3UERA 1OINA 4RL3A 1WDSA 1QBAA 1K9FA 2JE8A 4GZIA 3VIPA 1U33A 4U31A 4AW7A 4AD5A 4X0VA 2D0FA 1KXTA 1E6XM 4M56A 1W1PA 1CXIA 5D9NA 1HJXA 1J0IA 3MSDA 3IJ8A 1JNEA 1JXJA 4XZWA 2VZOA 1DTUA 1E6QM 5LA2A 1VFFA 5EFDA 1UR8A 4CU8A 4AC1X 5JBEA 2PF0A 3WDQA 1E40A 3MU7A 1E70M 2JF7A 4TX8A 5CGMA 1U30A 2V3EA 5A6KA 1UR1A 1JYVA 1OT2A 2BV9A 3GH4A 3ARUA 4ATDA 3BSGA 2QF8A 3SIMA 3GTNA 1OIMA 2ZX7A 4KGJA 4CN1A 4PCSA 1VENA 3ALGA 2XVGA 1GOOA 4BQ4A 5FD0A 3PZVA 2IXUA 3GH7A 1H41A 6TAAA 2CKRA 2J7HA 1BVZA 2XIBA 4AZHA 1EHAA 2O92A 4JFTA 2TAAA 2VRKA 5FOOA 1KGXA 4GXPA 3MSGA 4HTYA 5C70A 1Q6EA 1CPUA 2O9RA 2VMFA 2WM0A 3LPGA 2XGBA 1J0JA 2VX5A 1VB9A 5FIPA 1IT0A 4QCFA 3VTRA 1CGYA 3FW6A 3MV01 4AYSA 3WNNA 2J8FA 2XHYA 3EDFA 2FHFA 4U33A 4Q22A 3MUAA 2WSKA 1G94A 4BQ5A 5A8QA 4U5KA 4C91A 3PZIA 4OOUA 4NF7A 1X1NA 1UKSA 3AS1A 4AD0A 2A3BA 5BROA 3ZQ9A 2J77A 2ZE0A 3LMYA 5HOSA 1XSKA 3OG2A 4W8LA 4AEEA 3UG5A 4J3XA 4M29A 2CHNA 4HA4A 3AMDA 3FXYA 2CYGA 2VT0A 2VNCA 1UR4A 5I0DA 5A95A 3SURA 1FH8A 3ZR6A 4EKJA 3K8MA 1WPCA 5FL0A 1J01A 2X1IA 5BYWA 1R7AA 4LYPA 1WZMA 3CUJA 1V3JA 2E9MA 4PMRA 3DHPA 4Y7EA 5ABFB 3EMCA 4UFMA 4UOJA 1EGZA 1W1TA 1GW1A 4WSKA 1R85A 1QNRA 5A6AA 1CXFA 3TTQA 4W85A 1UR0A 3O6AA 1NWTA 1U2YA 1E43A 3VGDA 2QHAA 3B9EA 1VEPA 2ZUWA 4R5EA 1C92A 3BMWA 4CCEA 3WN6A 2BVTA 1PX8A 1HL8A 4B3LA 2D20A 2UY3A 4AD1A 4CN6A 3OIHA 4JKKA 4J28A 4RE4A 3WELA 2J4GA 3BAYA 2UY2A 1XD1A 3FAWA 1E4NA 1KQZA 1JYNA 3OA5A 1JZ8A 1ECEA 2Z1SA 1OB0A 2XSAA 3OGVA 1W9VA 4KMQA 1CGVA 1VEOA 4PMOA 4PTMA 3PTQA 3PZMA 5CPQA 1ISZA 2CKSA 3W38A 4UFKA 1KGUA 4IISA 1UWSA 2CCRA 2FGZA 1WZLA 2GVYA 5TD4A 3U7VA 3UCQA 4V2XA 5GNZA 3UESA 1PZ2A 2PI6A 4MJ4A 3WMSA 1RP8A 4HP5A 4LPCA 1JD7A 2A3EA 1HKKA 1K6AA 2WLZA 2ZUSA 2G41A 3WF3A 3L4ZA 5M5DA 1V6YA 4MAVA 2DSWA 4DWSC 1JF5A 3GNPA 4EAMA 4FMVA 1KR1A 4MPKA 3POCA 5DT7A 1NOFA 4W89A 4GO8A 4GPNA 5CZKA 2DH3A 4AEFA 4D71A 2WZHA 3ARQA 3AIBA 2BS9A 5A2BA 4J3SA 1JZ2A 2VTFA 3WNPA 1EO7A 1SMAA 4ZFMA 4CD6A 4CU7A 5AYBA 4QAWA 1CECA 3WBEA 2YDQA 3WY1A 2WMHA 2GJXA 2XFFA 3W53A 1BHGA 1M04A 1WNOA 4JHOA 4GQQA 1M7XA 1CWYA 3ARSA 3THCA 3SCOA 3U5UA 3WNLA 3D5HA 4ML4A 3DYOA 3ZJKA 2YLAA 3AHZA 4DUWA 2VCBA 1JIBA 1UD5A 1K9DA 1MFVA 1W9DM 2PWHA 5F7UA 3VNYA 2WXDM 3AISA 7A3HA 4CCCA 4AD4A 1H0GA 2WMIA 1D3CA 4P8WA 2OWCA 3SCPA 2EPNA 2JEPA 2Y4SA 1TMQA 2J7BA 1I1XA 1N82A 3VIKA 4CD5A 3GDBA 3JUGA 3K46A 1XH1A 4BQ3A 1BLIA 3BAKA 4UR9A 3DHUA 2Y5EA 3WDPP 1HKJA 2G4FA 2VQUA 1G1YA 1JNDA 1E3ZA 3TP4A 4D72A 4S3JA 1OGBA 2ZWZA 5JBDA 1UQZA 4V28A 1DWIM 2OWXA 5BRPA 1KWGA 1L8NA 5A2AA 1MQRA 2Y8KA 5I5RA 2ZXBA 1NQ6A 2W67A 1OD0A 1V0KA 1OGGA 3T09A 3SUVA 4MNJA 5DEZA 2WHMA 2E9LA 3BLPX 4PTVA 1OM0A 4F66A 1Z32X 3CHFA 1W3HA 2X8RA 1ZU8A 3THDA 2WBKA 2QMKA 4YN5A 4H8UA 3CUFA 1BYAA 3N18A 3MANA 3WH6A 3AYRA 3WMCA 1WCGA 2VX4A 4UQ9A 2NW0A 1CLXA 1EA9C 2D2OA 3ARWA 3FAXA 4D6JA 2WANA 1TFVA 2GDVA 2VI0A 1WO2A 5A6MA 5CLWA 4H2CA 1TG7A 2WVSA 4UQEA 2WZEA 3PZQA 2JIEA 4BCEA 2ZXAA 1JDCA 1C8YA 1XYFA 2BHYA 1CGXA 3ZM8A 5IFTA 1QBBA 5KEZA 1US3A 5AC4A 1X6LA 4FLQA 1V08A 1B3VA 1B31A 2JFEX 3WQWA 4DM1A 4V27A 1HT6A 4UOZA 1US2A 3SCVA 4WSJA 3VDCA 4PMQA 3W24A 3AZTA 3ZIZA 3AXHA 1CTNA 5KZ6A 4F79A 4JKMA 4UZSA 4EE9A 3VX0A 3WL0A 3GNOA 3AXIA 2CETA 1E73M 3ARYA 1B9ZA 2J79A 1NP0A 1E6PA 1PAMA 5BXTA 2AAAA 5BCAA 1F4AA 2IXVA 3O9NA 1JF6A 4BF7A 1UKTA 2WVVB 4MB3A 2W66A 3RMEA 3NCOA 2UWFA 2OYLA 2W92A 2WKLA 1C93A 3UG4A 8A3HA 3ZJ8A 5IHSA 3ZT7A 1FFRA 4GIAA 1JAKA 3OB8A 3MUIA 4NSBA 3G6LA 2EPOA 3VIGA 4AZCA 2W62A 1JFXA 1V6XA 3L4YA 1VBUA 1O6IA 2VRJA 4BQ2A 3SUSA 4B3KA 2JF6A 3G6MA 1EOKA 1L0PA 4PYSA 3VMNA 1W32A 1MW0A 4AWEA 4MB4A 1V02E 1GVIA 1W3JA 3F5JA 4TTUA 1BSIA 5GNYA 1TUXA 4AZ7A 1FOBA 1D7FA 2CBJA 3HU7A 1UD4A 1BGGA 2WK2A 5CSYA 1CIUA 4AZIA 2GUYA 1LQ0A 1QI5A 2DH2A 2V3GA 4JL1A 4QLLA 5LA1A 4MDPA 1UKOA 4UQBA 3WFLA 3CZ8A 5D8WA 4P8XA 1JZ3A 1W1YA 2PBGA 1ZB5A 4M1RA 2JALA 3FN9A 5IFPA 1GJUA 4ZXOA 3I3DA 5I3DA 4YPJA 3WQ5A 5BXPA 3VIFA 1NOWA 1MW3A 2XWEA 1CNVA 2DSVA 2EJ1A 2VX6A 5A8PA 1RH9A 5CXPA 4HU0A 3A4AA 3AMCA 4LXFA 3AS0A 2F8QA 2BY0A 2YBUA 1QVBA 4D1JA 4W86A 4C7FA 1J10A 2YKKA 3WEOA 1QHPA 4PSPA 3WL1A 1JDAA 3VD7A 1HL9A 1QW9A 1UZ4A 3WKZA 1UD8A 2XJ7A 1WP6A 3IK2A 1MW1A 2EPMX 3WD4A 3CIVA 2WBGA 3AJ7A 3CUHA 3WD0A 2FHCA 1JYXA 3WUEA 4M81A 1ISXA 1V0LA 1E6RA 4FF5A 2QV4A 1EIBA 1CGWA 4MADA 1ZS2A 1HVXA 1F4HA 2WMGA 3A4XA 2D22A 1ZBVA 3GXMA 5C71A 4QLKA 2GK1A 3QHMA 4L4OA 1E0WA 5HPOA 1HKMA 3LPPA 1W9BM 2E4TA 2PWDA 2ZX8A 4H8VA 2X2YA 3ZSTA 1QHOA 4GKLA 3UETA 5HBFA 3NDYA 3VIJA 3WF0A 4TVCA 3ECQA 1V02A 3QHOA 4TOQA 1HNYA 2WNWA 4U3AA 4QP0A 3RPMA 1BF2A 4ZENA 1UYQA 2RGMA 2YA0A 3ZOAA 3W6MA 1V3IA 3OBAA 3MUY1 1IZJA 4R27A 1DWHM 3CUGA 3IJ7A 9CGTA 4PMZA 4Q7NA 2CERA 4NRSA 4UFIA 4A3HA 2ZIDA 3OLIA 3ZJ6A 4M82A 3ZR5A 4GQRA 1C90A 4L4PA 3NDZA 3CMJA 2XYLA 3OGSA 3FHAA 4RE2A 5JBFA 5DF0A 3U7BA 1UH2A 3GBDA 3WF2A 3RO8A 2XTKA 4KWUA 3M7SA 1DEDA 4U5IA 2CESA 4XX6A 4JKLA 4LYRA 1OIFA 2ZXDA 1MQPA 2WVTA 4ZE4A 4UOQA 4B9ZA 1E5NA 2EPLX 3RDKA 2NT1A 1B1YA 2HISA 5CG0A 3VD4A 2BY2A 2DQXA 3GBEA 3N9KA 3RM8A 1I75A 1W2PA 4XZBA 2WLYA 1GNXA 1UR2A 3AHXA 2G3NA 1MXGA 1ESWA 2XIIA 4OJYA 1CXHA 2PWFA 3GXFA 1GOIA 3CZJA 3SEPA 3IAPA 1WDPA 3PN8A 2WWDA 2CBVA 3AIRA 3WSUA 2BY1A 1UH4A 4CCDA 1BYDA 4GI8A 4TVUA 1KBKA 4P7OA 1KCLA 1JDDA 3U57A 3AQUA 2E0PA 3NJ3A 1TA3B 3FY1A 1UHVA 4HOZA 1BFNA 4CUCA 2DSZA 2CXGA 2PBOA
chains in the Genus database with same CATH superfamily
4WKHA 4WUIA 1E3XA 6REQA 1NDZA 3N6QA 1EA0A 3CPUA 1S5NA 5BU9A 1J6PA 3WNOA 1ML1A 2PSNA 3C2VA 3M0VA 4DWSA 1NDWA 3OLEA 3NOYA 3LHUA 1GOXA 2CZVA 3G1RA 1AW1A 1IWPA 3PG9A 1KV5A 1PSCA 2HXUA 4WXYA 4PBGA 1WA3A 3H2CA 3SCRA 1EP3A 2AOSA 5DBTA 1KM3A 1EFZA 3U0HA 3HIJA 1UUOA 2W9MA 1NU5A 3S5OA 1CXKA 4U2ZA 1FKXA 1YRRA 1YMYA 1WDQA 3LHVA 4P2VA 1AFSA 1BEUA 1H7RA 4JD4A 4XG1A 1AD1A 4H9YA 1UP2A 3P14A 2Y2WA 4LVBA 1P43A 5BU6A 4W4QA 2DGAA 2FLIA 3S8HA 2JBMA 5EJ1B 3EPNA 3R6IA 3PTDA 3TAOA 1PS9A 1I1WA 1TCMA 1G01A 2YGYA 3GG1A 3IRDA 3U4FA 4ERIA 5EMKA 4O8AA 1P4CA 3WH5A 1EXPA 3EWDA 1ZAHA 1RY0A 2CLOA 2ZUTA 2YDRA 4X2RA 4L5ZA 5FJOA 1K9EA 4NZ3A 2PGWA 2FZMA 4DZAA 1S2AA 5D9PA 3PJWA 4FK9A 3T44A 3SADA 1OC6A 5A6BD 3NGFA 1JUEA 1Y0EA 2HK1A 1B3YA 4YHGA 2P1FA 2VYOA 3ZT5A 1V0MA 4OU1A 5KETA 5DRCA 3VILA 3GG0A 1HZYA 3QR0A 2D1ZA 3AMKA 4PMYA 4FIQA 5LYRA 3F2DA 4UTJA 4Y2WA 1A5UA 3G0XA 1DE6A 2A1YA 3NWRA 3VNMA 3LQLA 1NDVA 2WKJA 4F2TA 1HP4A 4HA1A 2VFEA 3PWAA 4QG9A 3EOLA 3NPVA 5IBXA 3LHYA 4P8VA 3J7HA 1QOXA 3SECA 1OT1A 3V75A 4S3GA 5A6JA 2ZX6A 3EXRA 1SO6A 3P82A 3UXIA 3VOFA 3T4WA 3PZOA 1HX0A 1TJPA 4HZ6A 2WNZA 5A5WA 3VGHA 2ALRA 3F1QA 1TIWA 3VINA 2VC6A 3VIIA 4HMDA 1DWJM 1QI4A 3TQ0A 3URBA 3LDVA 2D2HA 2QS8A 3L4XA 1ISVA 2H6RA 3HB9A 4GYPA 4I9MA 3Q37A 2WCSA 2V0TA 3R5EA 2PP3A 4TO8A 3R11A 2V5KA 1S2TA 1WZAA 1UOKA 3GU1A 3GTIA 3R25A 2BDQA 1ICSA 4NAEA 3TQVA 1YE4A 2R14A 2GSHA 4ZO7A 2V5DA 1SM9A 5EJZB 1BQCA 5TAOA 4N42A 4PUNA 3UPWA 4B3ZA 1HJUA 3DFQA 3A3XA 2BOGX 2J9XA 3VXGA 4QGCA 2PDMA 2O9TA 4JNYA 1NVMA 3ZJ7A 4AHOA 2CITA 1LWJA 1YDVA 4LVAA 4W88A 5CJNA 2DZBA 2CEQA 5DO8A 1PUDA 1R9ZA 3R1ZA 3SUTA 4GI6A 2F84A 5JUVA 3G0SA 2A3HA 2WC7A 3IAQA 1SJAA 1VBJA 2RDWA 4JTTA 1LT7A 1JCTA 2VD8A 3S47A 3B8VA 1NFGA 1GCYA 1OX6A 2OOFA 1TWSA 1GQNA 4HNUA 1JAEA 1XCXA 1J2WA 4GYKA 3W22A 1X6NA 4JTIA 4NG3A 2J9ZA 5REQA 4KIRA 2YA1A 2Y24A 3LOTA 3T08A 1JZ6A 3W75A 3LN3A 3QFWA 3DX5A 3IWPA 3MCNA 4IPNB 4CKQA 4LF2A 4WD0A 5LHEA 3NQGA 4LX4A 1D2KA 1R8LA 2CFFA 4B2DD 3N04A 3WQ4A 2ZKMX 5XIMA 1KBJA 2Y1HA 5AC8A 5M2FX 5CZJA 2QUMA 3HMCA 5A6LA 3GTHA 3S2MA 1Z6KA 1CLKA 4JPGA 1RQHA 3UFYA 2AQWA 3DFYA 4JEJA 1XYZA 3M44A 3A6OA 4OZOA 3BVJA 1EF3A 5I6SA 2E8YA 1FWDC 4NAFA 3SO7A 1LT8A 4WJ8A 3QV9A 5H2ZA 1WKYA 2FMOA 5G2HA 4HPGA 5AYYA 3DEQA 4XIAA 1AJ0A 4QEEA 1L9WA 4MB1A 4GVGA 2WM1A 3RJXA 5EFFA 6XIAA 3T8LA 3FLUA 4IFOA 1HKWA 2OFJA 3IVSA 5FF0A 5J5DA 4TTGA 3HZ3A 3WJSA 1KLZA 1TJ2A 3WD1A 3PTMA 5JH1A 3VZYA 3GFXA 1DWGM 4W7WA 3SM0A 3LA4A 1QASA 1Z89A 3L5AA 1I8JA 4WR3A 4X0NA 3UGRA 3TTOA 1BSLA 3ZMRA 3N6HA 3KW3A 3WNKA 5DELA 1OD8A 3O7UA 1F5ZA 1NOUA 3W76A 3BH4A 1DWAM 1XH2A 3R43A 1VZWA 2HVNA 4GXWA 1QR7A 2OR2A 1L6FA 1DYSA 3AIEA 1JPDX 1R47A 1OF6A 3OVRA 3S6OA 3NGJA 3QEZA 3ORWA 3ATZA 4ZMGA 1EBHA 1UASA 4LCRA 3K4AA 1KM1A 3T8QA 2AGTA 2XU2A 3HGOA 3VNLA 4QG6A 4C7DA 4HPHA 3MHUA 1K9TA 4RE3A 2QLYA 1PEZA 1GPFA 2JKAA 3A5VA 1OFBA 4K8EA 3WENA 3ZO9A 3FA3A 2DSUA 2A7PA 2NQZA 2PODA 3LUTA 2GGHA 4XAGA 3P8IA 4RZ6A 4DF2A 4B5TA 1DL3A 3SCUA 1D3HA 1V79A 3P7YA 2OGJA 1O12A 1IXNA 5IXEA 1PDYA 2VEKA 3GE7A 4IUOA 3B8SA 1OX5A 4S3EA 4C90A 2ZZ3A 1R86A 1U83A 2YCEA 4B16A 3QZ6A 2XVNA 4GI9A 1PDZA 3E1F1 1BG9A 3W29A 3WH8A 1TZ7A 3MO7A 3LRKA 2ZC8A 4N9DA 1VKFA 1TPEA 3LG3A 3RIKA 3V5OA 4ZTXA 4Z2HA 1B2YA 1NDYA 2PP0A 1RCQA 1T99A 4IM4A 3S9IA 4PCFA 4GHRA 4CNTA 3SUWA 2EKGA 1YDNA 1T40A 4ZXLA 5I79A 1RP9A 1TMLA 7TAAA 1VJSA 4TUFA 2VO5A 3NR0A 4NZCA 2Z2AA 2PDWA 5T26A 4A29A 3H55A 3T2PA 1US0A 2AAMA 2EO7A 1HFBA 1XLHA 1MRAA 1W1ZA 4CQBA 5CC3A 2D24A 2WB5A 2E9BA 4LUSB 4GZ7A 2PDIA 4HCHA 4Z08A 2IKJA 1Q6GA 2O4MA 2XFRA 2HE8A 4WX2A 2IKHA 3T55A 2WNNA 4G7EB 3SJNA 4E2DA 1KB3A 4ATLA 4Z1BA 3RJYA 4HHLA 2C19A 1C91A 4PUUA 3NUKA 4LB3A 1PZ3A 1GOQA 1H3GA 1GK8A 4WDUA 2DZXA 1IWAA 4W87A 4N0RA 1IZKA 4CN4A 5LXXA 1UOZA 4JN7A 3M46A 3AALA 3RAOA 3HQ1A 2YL9A 3C2YA 4LCQA 4DWSB 2NQ5A 3W7LA 3TTEA 2WZIA 3NSNA 3BZJA 2PTXA 1R9XA 1IV8A 1SO4A 3QHNA 5GNXA 4B5SA 2OLHA 1E72M 3WUBA 1ZGDA 5EKYA 1LF1A 4PTNA 1I6NA 4F48A 1KGWA 1H11A 2XSXA 3MUXA 3Q67A 2YXXA 4X9SA 3KOZA 3EOUA 2BOFX 1J79A 4WY0A 1TTJA 5A6BA 5HDRA 5F1VA 2V3DA 1SJBA 3AOFA 1VF8A 1EP2A 2PLCA 4K3ZA 3FJLA 1K4GA 1PHWA 2G96A 4O28A 1GKRA 3W83A 2BGNE 1K6WA 4M1BA 4Z2GA 3KOWA 1PIFA 4JFUA 3S6TA 2QVNA 3MCMA 4UBPC 4WDXA 3TONA 3BLFA 2ZZ2A 3KBVA 1QWGA 4LB4A 2HJPA 2WSRA 2XWDA 2YOCA 4ICNA 1H7XA 4O57A 5DMYA 1DIDA 3NPUA 1KFKA 3AHVA 2WSPA 4XSMA 4DX3A 4H9VA 5DN1A 2Y70A 4GXMA 3FCPA 1X98A 4B92A 1J8VA 1GEQA 2FZNA 3WF4A 1W5MA 4A8NA 3PG8A 1K03A 1XUZA 4MWAD 4F9JA 2QIIA 4A3RA 1UB3A 1N2VA 3CZKA 2DT1A 2NX3A 4FX7A 5FEXA 3ELFA 1TJRA 1KW1A 1NFPA 2B0MA 1DOSA 3FSTA 5CSUA 4DBSA 5C9WA 5I77A 4ZZ9A 2NQLA 4PRTA 1Y7VA 1JGMA 4DYKA 1H4PA 2I5IA 4JFSA 3VZXA 3E6EA 2REQA 1QI0A 3F7JA 3BJFA 1MDRA 2G3MA 1OCQA 4JICA 3FJ4A 2X7WA 2IPJA 3TN5A 4LAKA 3HQPA 3EX3A 2PCQA 2VP8A 4JY9A 4W8BA 3EKLA 1IXOA 4AZBA 1I45A 1AL7A 4PUEA 2ZE3A 3GC2A 5C0QA 4DJFD 2GSEA 1FCVA 3NQFA 3ARPA 4V15A 1RK6A 4I8DA 1T7LA 3VMOA 4AMCA 2CNCA 1LL7A 1AQMA 3H7VA 1OC7A 3STCA 1JI2A 1AW5A 4DYEA 1EPVA 3WJXA 4O53A 4HD5A 2DT0A 3I6EA 1A80A 2E3ZA 3LI0A 2J47A 2F7FA 3XINA 1G0CA 1UBPC 4H00A 3GB6A 1Q6DA 3MMUA 3DESA 2FPTA 3T9PA 3O15A 1K8CA 1A3HA 3M6DA 2Z2UA 3GIYA 3KDOA 5K9CA 1EJVC 3VX1A 1Q2SA 8CGTA 1Q7QA 3CGTA 1RLDA 4ZOEA 1E9YB 3RRAA 3M6YA 1CDGA 3CASA 4YYFA 3UG3A 4FXJA 3N2XA 2WJDA 4XKMA 4ECLA 4DJDC 3SN4A 3NPWA 4XKYB 1S3HA 3IEBA 3MCOA 3W3OA 3UXAA 3KRSA 3RPDA 3ZT6A 2VFFA 1L2QA 3CAWA 2TMDA 1MVYA 4XTDA 4F2BA 4KEMA 1NQKA 4AMAA 1RSCA 3I4KA 3RFAA 5BOEA 2Q02A 3AZSA 2J7EA 1B30A 5JIPA 4LYQA 4LUIA 1BYCA 1OFAA 3NSMA 2HVMA 1WOBA 2FGBA 3W7KA 3WQCA 4C5ZA 3UNTA 3CPGA 4KWOA 1XIHA 4IIFA 1XV8A 2AGKA 3INPA 2R1PA 2DORA 4FIRA 3V18A 4S3BA 1KXHA 3N14A 1Z3NA 5IHRA 2EG7A 2QJMA 4LUTA 3WDJA 3T40A 4U2YA 2FPVA 1RVGA 4H7VA 1VS1A 4D6DA 3EDJA 4QXIA 2NVDA 1RZMA 1RVKA 4JQ2A 3VNKA 1B90A 1IGSA 4X2PA 1R3RA 1CYGA 3ZLGA 2INEA 4ADTA 3S1UA 1FWSA 2OQLA 4HN4A 1BVWA 3N9RA 2JKEA 2BLEA 1ZUAX 4XISA 1GONA 4DZHA 1V0NA 3TA9A 4JFVA 3VGFA 3A64A 4DF0A 4IJRA 3HA1A 5CJ5A 1EF2A 1VIWA 5FESA 5JMUA 3VOHA 4PMDA 1KCKA 1XBZA 5BXSA 2R1MA 2Z6JA 2HWGA 4DWDA 1QNPA 2ZBTA 3DI0A 4GIEA 5SWUA 2A2IA 2I17A 1J96A 1VGAA 2WHKA 4JL2A 3O6DA 2VC9A 1HJSA 1TPUA 2F6KA 3STGA 4GFIA 3ID7A 2IKGA 1J0YA 3UU0A 2Z4GA 5AOUA 4AVOA 5E0KA 3WMBA 1QJWA 1VFUA 2DZWA 2QF7A 5DBUA 2JGQA 4QCEA 3CHEA 3M4HA 3FHQA 4BF9A 3TR9A 1C7TA 1FHDA 2BHUA 3THQA 3C52A 3MYOA 4J3VA 3NPXA 4UTIA 2GUBA 2WAGA 4DI8A 4PUMA 4DAFA 3GSMA 4LEFA 2CZEA 4TQTA 4JR5A 1TX2A 1KQYA 2CLEA 4WOQA 3S42A 4P7RA 3QXBA 4PRWA 4BI6A 3EGJA 1V6VA 4RW5A 3RR4A 3U2ZA 1B0IA 3KVMA 2YYUA 3PFMA 5CPLA 3LCXA 1E51A 2PLKA 3C0LA 3V5FA 1FP9A 4NNAA 3EWZA 3V36A 1Z7AA 3AU2A 1JPMA 1DKWA 4RL3A 2YCJA 4GZIA 3C0QA 3DFOA 4AW7A 2ICSA 5LGXA 4XD4A 4OQVA 1KXTA 3HM7A 1Q63A 1CXIA 3M0HA 1J0IA 3IJ8A 3RX4A 2PTZA 1A4LA 1DTUA 5LA2A 5EFDA 2HPIA 4AC1X 1OEPA 2ZDSA 1R3VA 2OT0A 1E40A 3WDQA 3TMQA 4ZQNA 4XAFA 1NIUA 1S2UA 1XFBA 5CGMA 5A6KA 1JYVA 3ARUA 2NLYA 3W2LA 4QJ4B 3NL6A 3CYJA 3PR2A 5FI8A 1NSJA 4YL2A 4YWSA 3OU8A 1OHLA 1FWWA 5G1MA 3EWWA 4IIGA 1HGYA 3GH7A 1IEVA 3ABRA 3SB0A 2J7HA 4AZHA 3PWGA 3V7PA 4BK9A 3K4WA 2VRKA 2QIWA 5C70A 2XDFA 2VMFA 4HCDA 4OHQA 3FW6A 2QCNA 1UC4A 2FHFA 4U33A 4IHCA 3MUAA 4IGNA 4BQ5A 5A8QA 2X16A 2QDGA 3QTGA 4OOUA 3TJIA 1G7VA 2FVMA 1UKSA 4KEZA 2HK0A 1XDLA 4AD0A 2A3BA 3LMYA 3NZ1A 3P8JA 5HOSA 1XSKA 3OG2A 4AU0A 1VHCA 5H1WA 4LJ3A 5HQMA 2Y0FA 4M29A 4GVFA 3PK7A 5LNRA 1JCJA 5BW6A 1OVDA 4FPSA 4L4LA 3LZ3A 3SURA 2WJFA 3F2BA 2OZ8A 3K8MA 1J01A 1EYWA 2OPJA 1SGJA 1KRMA 2Y8UA 1W3NA 3WLJA 1XIFA 1MDLA 2E9MA 1YE6A 3G1XA 4UFMA 3S2LA 4LVGA 3BJTA 3ABXA 1S5WA 1XGEA 3P6LA 4HIBA 1NWTA 1U2YA 4MGGA 2H8XA 1PWLA 2PA6A 5HANA 3V35A 1LLZA 4R5EA 1S2CA 2DP3A 4FALA 3T1GA 3WN6A 1VFSA 2CLLA 3IIVA 3GC4A 1PX8A 1AJZA 3SFKA 2UY3A 2DJXA 3EEZA 4JKKA 3SDOA 4RE4A 3WELA 2J4GA 4GX8A 5G2WA 3QY8A 1DE5A 3PPHA 1WYIA 3ES8A 1JZ8A 2VEPA 1KO0A 1XLEA 4LALA 1VEOA 1M7OA 2H3BA 4LU0A 3Q2DA 3SGZA 3W38A 3S4TA 4IISA 3GHUA 3U7VA 3USZA 1WZLA 5MKGB 5GNZA 2ONEA 4ZB2A 4GUHA 4HP5A 4LPCA 2A3EA 2C1GA 2ZUSA 3A22A 1K8YA 3L4ZA 1V6YA 4MAVA 2DSWA 4DWSC 5PTDA 4MFEA 2QAFA 4MPKA 4NKCA 4W89A 4K1GA 1VLWA 1FWEC 4EF8A 2WZHA 5AZ1A 3AU6A 2BS9A 3BMXA 4J3SA 2V30A 4HU3A 3W85A 3DXIA 4ZFMA 4J2MA 4CU7A 1JUBA 1DPMA 4UTUA 3MWCA 4E3TA 8TIMA 4QAWA 4GLEA 3BCJA 2WMHA 2XFFA 3W53A 3LBCA 1M04A 4JHOA 1TV4A 1N7KA 3E2RA 3ARSA 1Z44A 3WNLA 3GRIA 4Q4RA 1W1B1 3F2CA 3M0IA 4MWAB 1OFQA 1V8EA 4IGSA 2ALDA 2O7SA 1P7TB 3W86A 1W9DM 2PWHA 4N7QA 3FGCB 4JTLA 1DORA 3M5VA 7A3HA 2Y7GA 4P8WA 4O1AA 1D3CA 3A5FA 2JEPA 2Y4SA 2Q8LA 2J7BA 1I1XA 3PAOA 1VLIA 3UNDA 4A3QA 5FA5A 5KITA 3K46A 2DZVA 2G95A 3SGGA 1RJRA 2PAJA 3CV7A 4M19A 1HKJA 3BURA 2VQUA 1SJCA 4N2YA 3RCYA 1MMFA 2OLAA 3KVKA 3CU2A 3L7RA 4V28A 2OWXA 1KWGA 1L8NA 4AHPA 5A2AA 3IUHA 2Y8KA 5I5RA 2PZNA 2ZXBA 1NQ6A 3MHFA 3ES7A 2W67A 4FHAA 1OGGA 3T09A 3D0CA 3M5XA 3SUVA 4MNJA 4CLMA 3CHFA 1X39A 3TYUA 1ZU8A 3THDA 4WZHA 3RX2A 3CUFA 3VNJA 3L5MA 2VX4A 3CYVA 3EXSA 3S5YA 1CLXA 3KRZA 2D2OA 3UXDA 1TFVA 2FDSA 1WO2A 3MKCA 4MY9A 5CLWA 2V5LA 5LKYA 2WZEA 3PZQA 4RX0A 3BV7A 5C7HA 3WMLA 2BHYA 1KC7A 2CLPA 1QBBA 1X6LA 1WXJA 4X60A 2JFEX 3QPZA 4UOZA 1IR2A 3SBFA 4CEUC 2ABAA 4WSJA 1GVQA 4PMQA 2OVLA 3RR1A 3H2OA 1XICA 4UZSA 3KCJA 3ARYA 4RW3A 2PDLA 1E6PA 3BV4A 3LRLA 1D9EA 3RO6A 2AL1A 4AX6A 5H8MA 1R6WA 1XP3A 1UBSA 4ORMA 3GQYA 1UKTA 1ICPA 4KCTA 5HJYA 4HKPA 3RMEA 2J6VA 2UWFA 2OYLA 4PUJA 2W92A 1KRAC 3VCCA 4ONVA 2V2CA 3UJEA 4L65A 3UG4A 5IHSA 4DO4A 3LCIA 3OB8A 3VOIA 2Y63A 2XIMA 4NSBA 5IBXC 1D7KA 4OECA 3NQ2A 3R10A 3VE9A 3JVAA 3ZZ1A 4MJMA 3LEPA 4IMFA 2YFOA 4L56A 4WDWA 2DZTA 4PYSA 4Z0JA 5TF0A 1EEXA 5C9ZA 4GNJA 3LGGA 3QQ1A 4ENLA 4D2JA 2QUTA 1FOBA 1QPRA 1DXEA 4LS0A 2WK2A 2QR6A 1J2BA 4WRHA 2PGFA 5LIWX 1WXYA 2QW5A 4K1WA 4GISA 4Z1AA 4QLLA 4HHMA 3MVTA 3I10A 3OBEA 5ECVA 2P50A 1ZB5A 4G9PA 1AW2A 3WYZA 4ZXOA 3I3DA 4Z1DA 3HGJA 3FDKA 3GWQA 3LXBA 3B8IA 5A8PA 1S5VA 1CB2A 2HV5A 3AMCA 1VR6A 1LOSA 3K2GA 3QC0A 4W86A 4IQJA 5AHLA 3WEOA 1QHPA 3WL1A 1Q66A 2OTDA 1UD8A 3IK2A 2W27A 4ZGYA 2E28A 1GTHA 2HNEA 2PP1A 2Z27A 3REQA 1EB3A 4JTRA 3ENLA 3WBWA 2FYMA 4QJ3B 3WUEA 1ISXA 1TWWA 3EX2A 1J4EA 4Q8TA 2QV4A 4NP7A 1EIBA 1CGWA 5FSDC 2W79A 1F4HA 2WMGA 2D22A 3CAVA 4GVIA 2PDQA 4QLKA 1BD0A 4WEVX 6XIMA 3TYDA 1W9BM 4RZ4A 3ZSTA 4GK8A 4GKLA 3B9OA 3UETA 1SJDA 3NDYA 1MO0A 4TVCA 1V02A 3QHOA 8RUCA 1HNYA 4IOTA 4QP0A 1BF2A 2YA0A 3BDKA 4GY7A 3MUY1 1IZJA 4R27A 2C71A 4BI5A 4PMZA 1M65A 1JDEA 4UMBA 3MDUA 4FI4A 3OLIA 4M82A 2ZFAA 1W6TA 4UTKA 4QTGA 3M1ZA 3CMJA 1Q45A 4HNOA 4EACA 1M7PA 1XW8A 3GBDA 3TIMA 1I2QA 4DQWA 1YYAA 5DLCA 3DHFA 1S1RA 4U5IA 4DJFC 4XX6A 1D3GA 3I65A 2E1WA 1MQPA 4UOQA 2GYIA 3V0SA 1E5NA 5C9XA 3FFSA 3EA1A 1J5TA 1TYGA 3UJRA 4I5UA 2W0UA 2BY2A 3N4FA 1H7WA 3GBEA 3N9KA 4JN6A 3IV3A 5EMJA 2PC4A 1XXXA 1SFLA 2G3NA 4XAYA 3B8DA 4IG2B 1Q7MA 5E1QA 1KLYA 1CXHA 2UV8G 2GOUA 2PWFA 4LV4A 1EWEA 3GXFA 4RV3A 5BNKA 3IUDA 5H8PA 3G1VA 3WSUA 2BY1A 4QEHA 3R89A 1QDSA 3H2FA 4ROPA 3C8NA 3LGEA 2E0PA 3FY1A 3QMTA 2VWSA 1SZNA 3IS4A 2CXGA 4I9JA 2QCFA 3CO4A 3PAJA 1FRBA 1DJGA 1ZNNA 1HJWA 3VD5A 4AG0A 1JD9A 2OQHA 1T41A 3DAQA 1KWKA 3CL6A 2E40A 4B9YA 2ZZ4A 2DIJA 1T5AA 2I5QA 2A7RA 2FH8A 3L4UA 5TBOA 1H7OA 3PUDA 1XI3A 3BAIA 2YDSA 1Y5VA 4H2HA 2KX9A 1RAKA 5HUOA 3MBFA 2QCDA 1EJTC 3MJYA 4H6KA 1EJSC 1W9PA 1REQA 4UZUA 5D9OA 1SFJA 3QR3A 3W4RA 1V77A 1K7EA 1FCUA 4NYUA 5CAKA 1LDCA 4H7ZA 3EDKA 3NQ6A 4O14A 3AS2A 3BWWA 1QPNA 4ZBCA 2YXGA 3MTWA 3WH7A 4ADUA 2C0HA 1ELSA 1EDTA 1W5NA 3CIXA 1ZAIA 3BC9A 1EHNA 5M17A 1JI1A 3V4BA 3B9NA 5IDIA 5CPSA 2VZUA 4A8RA 4J3ZA 4NZ5A 3W70A 1FWGC 2Y5JA 2WMJA 4WQ6A 1DQWA 3N25A 1R0MA 1LWIA 1TV8A 3VPLA 3DFPA 3RM4A 4WK9A 2ISWA 2Z28A 5KZMA 3LK6A 1ALDA 4EWND 1K8XA 2EBNA 2GJPA 4KBXA 3LPFA 4S3KA 2C13A 1NP2A 1TX0A 2BXZA 4GCXA 1XLCA 4GIRA 3F4NA 3LCGA 4H4IA 1L8PA 3TLLA 3UR8A 4RZ5A 5H8UA 2A3LA 1W91A 3VNDA 2PB1A 3GNRA 3I7SA 3CM4A 3BLKA 2VZTA 3HTWA 1TZ9A 1G4SA 4QM1A 3BGJA 1D8CA 1I2RA 2WMIB 1AQFA 5HMEA 4HT3A 2W5FA 4HPXA 1Q7ZA 3MUCA 4RV8A 3TVAA 2MUCA 1M3UA 3W87A 4E0CA 2EF9A 1AUSL 4XB3A 4K36A 1U5HA 3N2OA 1ZTVA 4AIUA 1HKVA 2ZRVA 5EB8A 5EGRA 1YQ2A 1PIGA 3NXFA 4QS6A 1UIOA 2OLSA 2PWUA 5ECUA 2NLIA 2R8WA 1PXGA 5I03A 3DCPA 3EWCA 4EXBA 2FGLA 5L6UA 4PUDA 1OX4B 3SSZA 3G8EA 4V1XA 3BOXA 4UNIA 4LAMA 5JIWA 5M03A 1XJBA 4AXNA 4U3CA 5M3WA 5GJPA 2VDGA 4LQ1A 1FX6A 4QLJA 1VHNA 4P7LA 3MKVA 3EMQA 3KE0A 4MJZA 1BVNP 3A4JA 3UWQA 3T78A 3IJLA 2Q71A 3DKJA 4EAYA 1F74A 4AUBA 2J9YA 3WG6A 4GGBA 1XIJA 5F2IA 5A6TC 3F5LA 4KESA 3U4AA 1QATA 2FHBA 1L6SA 1XDJA 1W8GA 2Z29A 1YEYA 1XG4A 2NUWA 4W5UA 2WZTA 4S39A 1ZCCA 1Y5WA 1TMHA 1HN1A 1M7JA 1B3ZA 3VKDA 3O6CA 3PSWA 4JNZA 4J35A 2Y7EA 1P0DA 4QX4A 1W5QA 4IJBA 2PTDA 3L67A 1OFRA 4BEQA 1IWBA 4HJFA 4KWWA 4AD3A 1HUVA 3G3DA 4QHRA 2YL5A 3NQEA 1LOQA 4GI4A 2Y62A 3T0CA 3SR7A 3AUOA 3M5ZA 1PZ1A 1V6UA 3GM8A 4UFHA 4R3UA 3CLWA 4JXCA 4L6OA 3VDBA 5FJIA 3L21A 5I09A 1DWFM 4LT9A 4A4AA 1M53A 2PU1A 4S3FA 4CD8A 1GOMA 2PGRA 2Y5SA 4C6DA 1S39A 5LIKX 3QMRA 1ONWA 2PDXA 3B8TA 3DUGA 3DYMA 3L66A 2D3NA 4O1BA 3HJZA 3VA8A 2TSYA 4ACYA 2ZUUA 2J7DA 2GDUA 1B3WA 3A3HA 4IH3A 4B90A 1GGOA 1SYTA 1HXJA 1VPQA 3EBVA 1MUWA 4CNOA 4OT7A 1QWKA 3EYPA 4IWWA 1YW1A 2CBUA 4POCA 1QPKA 4NZFA 4MDOA 3BG3A 3LMZA 2KZHA 2EGZA 2IKIA 3EDDA 1XS2A 7CGTA 3DZ1A 4DI9A 1XSIA 2C8NA 3WLIA 3GKFA 1TVNA 3CV6A 1WX0A 4AZGA 1UMLA 2BTMA 2J74A 3NO1A 1IEWA 4WXZA 4FOJA 4B4HA 2R82A 4OUIA 2GJRA 3GO2A 4GRSA 4QAIA 1W3TA 3TH6A 1IEXA 2NSXA 4FNUA 2V5JA 2O9OA 5DRIA 1OX4A 3TUUA 1HKIA 2OX4A 5D8ZA 1CENA 3N1AA 1UWQA 4L4MA 3W1MA 3AIWA 1HIZA 3EA3A 1F9CA 2C18A 2C1IA 2XIQA 2P8CA 1FWIC 3TEVA 3BQ6A 1OG0A 3NSXA 4XUGA 1NWUA 1TR1A 1VYSX 4OWGA 3K1DA 1W2VA 1K7FA 4MY8A 1BRLB 1F6KA 5AVNA 2VD9A 4JTQA 4B5XA 2ISVA 4NHVA 3RM9A 3H2AA 3PHAA 4Z0SA 3ZVHB 2XIJA 2YFNA 4XZMX 3B0XA 1KRBC 1V51A 4YCOA 4K6AA 5K4ZA 4Z1YA 4M3PA 1W1VA 3B40A 1ZALA 4HN8A 5AECA 3I3BA 4UB9A 2CLKA 1K77A 2FH6A 1GOWA 1LUCB 4C6CA 3ANYA 5T91A 4O15A 4KF1A 4WVXA 2ASHA 5U4NA 1VJIA 4YJ5A 2QDHA 3NDOA 4FR1A 4I8YA 2P5NA 2EPHA 3FA5A 4P8UA 2J66A 5LIUX 3O16A 1CW2A 1B9BA 2HNHA 3K1GA 4W84A 5ABEA 2VR4A 1V3HA 1JCYA 1R2SA 3Q58A 3IJ6A 3VFLA 2CBIA 3QKEA 4A35A 2VGGA 4UC5A 2Z1KA 1KBLA 3CUIA 1WKFA 4YLWA 4CNSA 3U2OA 4LGXA 2JEQA 5I3FA 2E5CA 4LNCA 4O17A 5AZ0A 2BX7A 1ONRA 1GW9A 2YL6A 4LV9A 3FVMA 4WF7A 5E9AA 2PFHA 3TCSA 4NZ1A 2XH2A 2G4JA 4GUGA 1LORA 4CD7A 5BZAA 1MQQA 2GJLA 1MWOA 3TOPA 3BMVA 1RBOB 3MP3A 1CLVA 4JAWA 4OVXA 1TCDA 1ISYA 2XZ7A 4FF7A 1H1NA 2P10A 2YIHA 3M16A 1GWJA 4W7UA 1LWHA 1AZ1A 2R91A 2OSXA 1PIIA 4IUGA 4O1EA 4NRRA 4Q8QA 3MT1A 3L2LA 4GX9A 5G5IA 2VEIA 5E09A 3N11A 2W6RA 1VBRA 4D6GA 3N17A 3LSBA 3KL0A 4ZQRA 4D8AA 4L7ZA 3OTRA 4DBUA 3WQ6A 2PZ0A 1VYPX 4RZBA 1YKWA 3OQEA 1F73A 3AYVA 1R7OA 3DFTA 6REQB 1CB7B 1PZ0A 1JCNA 3P80A 5HPCA 4UFJA 4UTHA 4O0QA 3SRHA 2MANA 3CQIA 3R12A 4D6FA 3CHVA 1MSSA 3CT2A 3VDHA 3S83A 4WDTA 4MFDA 3KZSA 2FJUB 3KHJA 3ABQA 1E0VA 4ERAA 1YPFA 4CQCA 1UZ1A 2ZADA 4FLSA 1BGAA 3NYDA 4UXDA 4GBDA 3QYQA 3PB2A 4H6QA 3SN0A 3ITTA 4G7EA 1Q6CA 2AQOA 5D4YA 1OF8A 2QCMA 2VR2A 4RR4A 3HFYA 2PF8A 3WO8A 2RFGA 3S5ZA 3S2CA 3VYLA 5M1TA 3WLQA 1OYAA 4HA0A 1SMDA 4ZA0A 1Q6FA 2QGHA 2DZAA 4R33A 2Z6IA 3NVTA 4LC8A 1FHUA 3LLXA 3PPCA 4Z2LA 4DN1A 4A8IA 2EAWA 4WLCA 5C8BB 2XVKA 1GZ1A 2I14A 3K8KA 3VIOA 2BOEX 3W7PA 2YZRA 2TYSA 1BAGA 2ZXQA 2A7NA 2OZ3A 3F03K 2O9PA 2QPUA 3LPOA 3TTSA 5EBAA 3SY1A 4IF2A 2J7GA 1QTWA 3V3WA 3TW6A 2GL5A 1LJYA 3DHDA 1AL8A 2C6QA 5C6MA 5C7VA 2OYKA 4F8XA 3WLMA 2GSJA 4C6FA 3UR7A 3O0KA 4Z2KA 3QY7A 5A69A 5DCBA 3VIMA 1EH9A 1CZ1A 4IIHA 1BXCA 4MLJA 3N73A 3N34A 2VVNA 2C7FA 1SVDA 2H9AA 1I9CB 1ECQA 3MMWA 2Z1BA 2Z24A 2VHLA 3DFHA 1U1HA 2QDDA 3DC0A 4U28A 1XCWA 2GK1B 3I7QA 3AI0A 5REQB 1LTDA 4E8DA 5I24A 3GU9A 3UA4A 3CPRA 3M07A 4MWAA 1FP8A 5CKSA 3D47A 4PL1A 1A53A 3ISIX 3DYPA 4EVZA 5J04A 5DFAA 1G9HA 4O11A 3UJ2A 2ESCA 5DMMA 1BXBA 2ZICA 2VL4A 2Y8VA 3G24A 2DPEA 3W7JA 2GJXB 3BG5A 3VUSA 3GIQA 4LVDA 3KWSA 2W91A 4MMWA 4AZ6A 4HMCA 3HGRA 5HNUA 3EOSA 3TOYA 3C4UA 3QSRA 1H1ZA 3WLNA 2V38A 1I4NA 3S5NA 3BARA 3ANUA 3WD3A 5D2VA 4RDVA 1QAPA 3NL5A 2EG8A 3WQOA 3LBOA 5GQBA 2F61A 2J13A 1O5KA 2TRSA 1OSEA 5AHEA 4HQVA 1S38A 4M7SA 1LG2A 1N8FA 4PMNA 2X09A 2FDMA 4LAUA 1I2OA 1PKYA 2XISA 3PZUA 1U5VA 2B81A 4JCLA 1IE7C 3FOKA 4LUSA 1X8CA 1TQJA 4QRNA 4C6OA 3C3UA 2O55A 5AB3A 3L4VA 3LYEA 4D6EA 3TX9A 1OBAA 2RGLA 3KXQA 2XFWA 3QQWA 1XBVA 2UZ9A 1GVEA 1O4UA 3GVWA 4MIMA 4K37A 4MPQA 1VBHA 4DRSA 5LNVA 1C8VA 5CC7A 4PFMA 5G4HC 1B57A 1VBGA 1YBQB 1LRQA 1RCOB 1Q85A 3CB8A 3CUXA 1TE1A 3MQTA 1YBQA 2J75A 1NF7A 1E4MM 4MTVA 4MJ2A 1VRXA 2YB1A 3XIMA 3S1XA 4F9DA 5EA9A 2B7NA 5CQ1A 3D3FA 4QFUA 2HDJA 3M0ZA 3R79A 2W3ZA 5RUBA 1EUNA 1F3TA 3LQGA 3M0MA 4PMJA 1LUCA 1W54A 3G1SA 3PTKA 4JX5A 4M0XA 4BA0A 3M0XA 2V68A 3WLSA 2E7FA 2PEVA 5I78A 1TRDA 4Q4MA 3NEVA 3FX4A 3WUGA 3HPXA 1UWRA 1J12A 2Y61A 2Z1VA 4H6RA 3WJYA 4HA3A 3OLDA 4GWEA 3G1AA 5ABHA 4B15A 2R6OA 5HNTA 2F6XA 1A5NC 3UVAA 1GEHA 4J3TA 5DX7A 4TU1A 3D3AA 3II1A 1SR9A 1RLCL 1KR0A 3E3HA 1RA0A 1WDSA 3VIPA 4U31A 5B7ZA 2OO0A 2E67A 4ZQOA 2QT3A 4Q4KA 4MYXA 2D0FA 3KBJA 3B4UA 4XBJA 3P62A 3MSDA 1PL9A 4LFYA 3NQDA 4N6EA 4XZWA 4YVVA 3L5LA 4XD5A 1UR8A 4RCXA 1LBMA 2FPYA 3MU7A 1J6OA 3B8UA 2JF7A 2HE5A 1U30A 1UR1A 5F4WA 3WQDA 5LHFA 4PZVA 3UCCA 2Y6ZA 3KBNA 4JQ1A 1EP1A 3SIMA 3GTNA 1OIMA 3GVGA 4CN1A 3ALGA 1GOOA 4JEQA 3PZVA 2OGYA 1SW7A 2J27A 1PYMA 1DV7A 6TAAA 5MHBA 1IXPA 1BVZA 3VK5A 3IIZA 2TAAA 1KGXA 6ALDA 4GXPA 6PTDA 1B54A 4LW7A 1Q6EA 2NX1A 2O9RA 3I4EA 2Y7DA 3IIXA 2VX5A 1IT0A 2VEMA 3VTRA 3HOJA 3MV01 1KFJA 2XHYA 1Q5MA 3TQPA 5CBIA 2WSKA 1QFEA 4REQA 3PZIA 2OO6A 3GG8A 4NF7A 1KFCA 1X1NA 1HQTA 1XDMA 2REQB 5J8LA 4KFOA 3ZYZA 4IQEA 5BROA 3ZQ9A 3E5PA 2J77A 4ZTYA 1BWVA 1A5CA 3G1YA 2DU2A 1AODA 1XLKA 4W8LA 4IMEA 3THAA 4LS1A 2CHNA 5FACA 3FXYA 5LZLA 1UR4A 1OCBA 4A8LA 1PKLA 2QJGA 3KTSA 4IQDA 1SSGA 3FXGA 3UWYA 3FIGA 2X1IA 4IX2A 3HV9A 5BYWA 1TE6A 1WZMA 1R2TA 3CUJA 4BI7A 1WAUA 3N4EA 3IJIA 5CEWA 4PMRA 4Y7EA 5ABFB 1EUAA 3VZZA 4J5NA 1GW1A 4AXKA 3A24A 3TTQA 4W85A 2GGIA 3UJFA 3GD6A 3GUGA 3MP5A 3SRKA 2PU0A 3BLOA 1FY6A 7PTDA 5D2XA 1E43A 3UWVA 2QHAA 1GYNA 3MSRA 3B9EA 1VEPA 4XQ6A 1C92A 3BJSA 4CCEA 5E5CA 2BVTA 1QPOA 1KFLA 2C15A 4XVDA 4R34A 4QDPA 1X38A 4IZGA 4J28A 5I3GA 2BMBA 3W7CA 3UXKA 1E4NA 2WO5A 2G0WA 2AL2B 2Z1SA 1OB0A 2IS7A 7ODCA 3GDLA 3OP2A 4PMOA 4DPQA 4I5RA 4P02B 3PTQA 4KRZA 4PB4A 3GDMA 1B4KA 4C65A 3B0UX 2CCRA 2GVYA 4ZO9A 4ROQA 5TD4A 3W7HA 4IMCA 4LUTB 1M68A 1HKKA 1NAL1 3T7VA 2WLZA 4KERA 5FF7A 2G41A 5M5DA 4KW2A 4JQ4A 1KR1A 3MPGA 1FWNA 1NOFA 2OG9A 1XR2A 3TKFA 4D71A 3ARQA 1KFBA 5CPOA 2BODX 3MBDA 3EPMA 4MKSA 3W2UA 4TX9A 3GHTA 3WNPA 1EO7A 3AWOA 4XIMA 1XLMA 3LCFA 5AYBA 4OTKA 2J88A 4EPKA 2GJXA 2ZCGA 4Q33A 1OC5A 4DEFA 4R7WA 5CC5A 4GQQA 3N4AA 3THCA 3U5UA 3HO8A 2XN1A 3DYOA 3PBWA 3GDKA 4DUWA 3CEUA 3WK1A 1FWTA 1W3IA 3IGXA 1K9DA 1MFVA 5HMDA 3HG2A 3TE9A 4DXXA 4AD4A 2WMIA 1A5LC 3W01A 2EPNA 4B5VA 1N82A 3JUGA 2WJZA 1XH1A 3TLQA 1BLIA 4NZ4A 3NL3A 2RDUA 4UR9A 1UJQA 3ZWTA 3WDPP 2G4FA 4JTSA 3PJTA 2QV5A 1JNDA 3KBSA 1K1DA 1ZP4A 3SFWA 1JCMP 2P88A 4RK8A 4D72A 4S3JA 5FF2A 3QGAC 5JBDA 3OVPA 2DVUA 3C2RA 4HVXA 5BRPA 2O56A 1WUEA 3NO3A 4GJJA 3RMJA 4IL2A 1V0KA 3FYYA 1CCWB 4PTVA 3QBUA 4WGHA 1OM0A 1W3HA 4L6DA 3VE7A 3PWIA 5FAGA 4YN5A 5KMYA 3N18A 3MANA 2ZRWA 1W31A 3WMCA 1RALA 4UIOA 4HYVA 1ZAJA 2C16A 5DXYA 4BWLC 4LNYA 5A6MA 4FNSA 1VIZA 1N8WA 1TG7A 2WVSA 1UR3M 4UQEA 2QCCA 4BCEA 3IUIA 2ZXAA 3GXNA 4WGXA 1ZLPA 4UUIA 4Q8NA 1A4MA 5IFTA 5KEZA 5AC4A 4INFA 1V08A 3FEMA 1B31A 2ZZ6A 4AY7A 4DM1A 4V27A 3ZXWA 3T81A 4ZQMA 2IPGA 3CK5A 3PF3A 4F79A 3IVTA 3VX0A 4R88A 2CETA 1E73M 1LZOA 1B9ZA 3CWNA 3HV8A 2J79A 4F0SA 4M6VA 1F4AA 1IXQA 3O9NA 4BF7A 1OZQA 4C6JA 4NJHA 1EX1A 1AD4A 4IJCA 4N4PA 4OGZA 3H70A 3PP7A 4H9ZA 3ZT7A 4QNEA 1LRTA 4MF4A 3MUIA 3E2VA 3VIGA 4O1FA 3WLKX 5BRBA 5K9DA 1FBAA 2NVCA 2YPIA 1VBUA 1O5XA 2E5DA 2QCDB 3HG5A 5FJTA 2VRJA 3H7RA 5AHMA 1PKNA 3L23A 2PRHA 1L0PA 2XGZA 1MW0A 2D69A 3O05A 2PRMA 2L5HA 5AHNA 1W3JA 3GW3A 4DZ5A 3F5JA 1SQ7A 1BSIA 3W23A 3C6CA 1IZCA 1JUKA 1TUXA 1R3SA 1D7FA 3C2OA 1XYAA 4LVFA 5CSYA 5F2MA 1CIUA 4BWLA 1PWMA 2G3FA 4UTWA 3BZGA 4YTTA 3T0TA 3TW9A 4UQBA 4LOCA 3WFLA 2Z1WA 5D30A 5D8WA 1DXIA 4NIRA 2PD9A 3KLLA 3O3RA 2PBGA 4WY0B 9XIAA 4MKNA 4M1RA 5K7JA 3GU2A 3OVGA 1QRQA 3W1NA 1UROA 3ITXA 3WQ5A 2OXNA 1WOAA 4NJGA 4AQLA 1MW3A 4R9XA 2HPMA 5K3VA 1RH9A 3A4AA 5CZ0A 3PFRA 2YBUA 4D1JA 4QJ1A 2PUZA 3KDNA 4C7FA 1F2JA 2Q01A 3TYEA 4N6FA 3WBYA 4QQUA 4RXFA 3KX6A 2CWXA 1VCVA 4HPJA 3TYCA 1MW1A 3WFAA 4DJEC 1I0BA 1TREA 2IPWA 3BO9A 3SW6A 2WBGA 3CUHA 3WD0A 3UY7A 3UF9A 1JYXA 5LNWA 1LQ2A 2KAUC 4MADA 1ZS2A 1S2WA 1VFTA 3GXMA 2OT1A 5G1YA 2HTMA 4DXVA 2GVJA 4C6PA 4JYEA 7XIMA 2QNEA 1OK6A 3LPPA 3P93A 2E4TA 1G7UA 1SO5A 2PWDA 2ZX8A 4H8VA 3TFCA 4MZYA 5I7GA 2WSYA 1PTAA 1J93A 1I0DA 5HWMA 3RPMA 1W5PA 1UYQA 4LRTA 3W6MA 2FVKA 2FTPA 2GDQA 1S2VA 5DXXA 3CUGA 4C6LA 1FKWA 2CERA 2GPTA 2A21A 3A9BA 1KRCC 3GHSA 4Y8EA 1TPVA 3U9IA 1HG3A 3ZR5A 2V6AA 1K02A 5JQ9A 4F0RA 2FZ9A 1F7BA 1C90A 4JIRA 3FHAA 4TMBA 3H53A 1DQUA 3RO8A 4Y8FA 1O94A 2WQDA 4C5YA 4LYRA 3E0VA 1OIFA 2J24A 2WVTA 4M5PA 3LX9A 3GZ3A 3PM6A 3P5ZA 1KCZA 1KCXA 5CG0A 4NJKA 4CQAA 3VD4A 3SIZA 3RM8A 1I75A 4PC8A 3W7IA 4L9ZA 3BW2A 2XIIA 4ADSA 4R53A 1H51A 3KLKA 1A5OC 3NM1A 1UUMA 3SEPA 5DCDA 3B0PA 1DIOA 3PN8A 1FWBC 2RHGA 1UH4A 3UG8A 4Y9MA 3I6RA 1KBKA 3PVFA 4O4WA 1JDDA 3AQUA 1TA3B 4HOZA 1EKOA 4CUCA 4C1NB 3NZQA 1RY8A 2PBOA 2PWEA 3TC7A 3GXIA 4S23A 4QITA 3EX6A 1M41A 4ATWA 1VD6A 3USBA 2OB3A 4RNHA 3LNMA 1F8IA 2ZVRA 1HF6A 3K4DA 4O0ZA 1FDYA 1OWQA 1E71M 3E2SA 1XKJA 4O12A 3F4DA 4C6IA 1DIEA 1MI3A 1TVPA 1ZP3A 4TIMA 3WLRA 1SZGA 3Q4DA 1VFMA 4JCMA 2DUZA 3FKKA 4BFAA 1QI3A 3GUWA 4C6MA 1SW0A 1KTBA 5GPRA 4ZO8A 4JX4A 4O0KA 1QW8A 3AZRA 1XWYA 3KL5A 4IFKB 1DJNA 1E4LA 3RN6A 4HZ7A 2R1LA 2ISSA 1XD0A 3QVQA 2OWWA 3ITOA 3MV11 4WIWA 3UEQA 1W1IE 4K8HA 4NI8A 4D6IA 4X61A 3I3EA 2IPFA 1UUQA 1TRIA 3ZS4A 4BZYA 1H63A 2BNJA 2CXEA 5EBUA 1QNQA 3BSHA 4IMDA 2D0HA 1L6WA 1NWSA 2PDKA 3TJ4A 1JGIA 1MEWA 1Z41A 3VMPA 3F5KA 3WEZA 1UMYA 3DERA 5HWJA 1T0OA 2XVPA 3S1WA 4ZCWA 3HPAA 3LD5A 2BB0A 4PEEA 2VENA 5HR6A 4HU8A 2PMQA 3S9ZA 1TVLA 1WUFA 4KETA 4M80A 1E56A 5D38A 3AXXA 4F40A 1Q3NA 4L61A 2PDJA 1X8FA 1EO5A 2WCAA 3UXLA 1YNYA 3ATYA 3LS9A 1ITCA 1YDOA 4KH2A 1EGVA 3LRMA 4LYKA 3M5YA 1GZJA 4UQAA 4AD2A 4OFCA 3BXWA 1JPKA 3WDIA 1JCXA 3LM3A 4ZOCA 3B8WA 4JTEA 1RPKA 5HJXA 2Q3OA 3WDHA 3PSVA 3UYCA 3C8FA 2WHJA 4US5D 1NH6A 1H60A 2YSWA 4HNTA 4XBSA 2BP1A 1XGDA 1EC9A 4H01A 4M6UA 4DHGA 1QUMA 2I57A 2X0HA 4HZ8A 1GVFA 3VVGA 2OEKA 4PB5A 3UA3A 2OSWA 2ZOXA 1C7SA 3OHMB 4FP1A 1UWTA 3AS3A 3QRHA 3BSMA 3TA6A 3EXTA 4YCPA 5HNRA 3ANVA 1FVPA 1QNSA 4PBFA 4MVAA 1XRFA 1EJ7L 1VFHA 4CVUA 3W1RA 5K4XA 3CV1A 4JHMA 1A5BA 2QPXA 4IG2A 3OODA 4MHBA 4CNNA 1MEIA 4DJDA 1XLAA 2EXOA 4HOXA 4J3WA 3VDAA 4OIFA 3APGA 4MKVA 3FNDA 1M1BA 2I9EA 3CH0A 3GAYA 1H1YA 2ZA3A 3TXZA 2OQYA 3PJXA 1E15A 3WQFA 2J8TA 4D9PA 2QCHA 2VZSA 3ARXA 3W27A 2QJIA 1JG9A 3S1VA 2W4XA 3HN3A 4RJEA 1O60A 4IIBA 1W37A 3UW6A 1XIMA 1LLWA 4FA3A 1PYFA 3UVIA 5A6SA 1GZGA 3HG4A 3IJQA 4TXEA 2X1SA 2J8GA 4M6QA 4QNWA 4LUYA 4TVDA 3L4WA 2QZRA 1KBBA 3P81A 1WAWA 2VR5A 4H9TA 3WLHA 4CD4A 2HS6A 4DXKA 1XRTA 3MW7A 3V1HA 5B7YA 3PZTA 3VI2A 3FSUA 1IEQA 1TPC1 2B7QA 4GYFA 3FJ6A 1UKPA 2PRLA 5A8MA 3W7EA 2WMFA 3OBKA 1X1ZA 4MYAA 4AH7A 4NILA 3L2MA 4M6PA 4JTCA 3BCFA 3R8RA 1JZ7A 1E6NA 1ISWA 4H41A 2DIEA 4N4QA 1W3KA 1WE5A 1VEMA 1TZZA 1VJZA 4XVEA 4B5UA 4C6BA 4KRTA 2YZ5A 3QJAA 4MWAC 3ITCA 4YS1A 3GFYA 3WH9A 1EZ2A 1P1MA 1LG1A 4AHQA 1U22A 3RCMA 1RD6A 4QBXA 4MNMA 2EEXA 4N9BA 1VAHA 3KS5A 1KTNA 3QY6A 4RPQA 4YU1A 5I23A 2CZFA 2UY5A 1AMKA 2XFYA 3RRXA 3TC3A 5H91A 2BXYA 3L2IA 3DG3A 1V7AA 3N9SA 3APYA 3C2EA 2GZXA 1KNWA 3GH5A 2VOTA 3GC5A 1I2NA 1YLVA 2C1HA 2G3IA 2ACRA 4UQCA 2WCGA 1J18A 3ZWSA 1Q6LA 1ZFJA 4GH1A 1V6WA 4J3UA 3AWNA 3EKZA 4MZ1A 2BFGA 3IGSA 3O2LA 3WQVA 4WKAA 1JR1A 3W37A 1ZBKA 1E0XA 5AHIA 2HS8A 2VUYA 4U4MA 3P60A 3PBGA 3UCDA 1DQXA 3W2NA 4HK7A 4PULA 2SFPA 4YYCA 4XAPA 2BVYA 5I00A 2YBTA 1LYXA 4PR4A 4NAFB 1F3XA 1IHIA 1FWRA 5LIXX 1KM5A 2I7GA 5GVJA 3AXKA 4QE4A 3APTA 3VOCA 3QQ0A 4BS0A 4DY1A 1WDRA 3B4YA 5FEWA 2DT3A 3M43A 3M47A 4PB3A 1UWIA 4MAZA 3GHRA 1P48A 6ENLA 2ZDRA 2ZRUA 1V93A 1MUMA 3SY5A 4O10A 3NTYA 4HOWA 2DDXA 1OG6A 3KWXA 5C55A 3PUEA 3YPIA 4FXSA 5LNUA 5FAJA 1WDWA 2OMAA 2G3JA 3B97A 2E6FA 5TQLA 3KZPA 3AIVA 4JTJA 3AMLA 1BPLB 2RAGA 2INZA 1MYRA 3P0XA 5A8GA 4Y9PA 3VNIA 3GS6A 4AIEA 3SI9A 2P8BA 1KXVA 1HL2A 3LHZA 2RUSA 3A47A 2WVUA 4JN8A 3AUJA 1XLJA 2ZRZA 1BWLA 3S6DA 3ARZA 5ABFA 4W93A 2DSKA 3COTA 5DT5A 4D6HA 4XO7A 2P3ZA 1DP0A 2NSOA 5HR7A 3SZ8A 2CIPA 4G7FA 3W6YA 3B04A 3BAJA 4IP5A 2NX9A 3P61A 3K30A 5CG7A 1ZL1A 1AH3A 2VZVA 3KS6A 2PDCA 3VUPA 4IICA 4ILSA 1H5VA 3I7RA 2AL2A 4Q8PA 4ML9A 5AKQA 5LGZA 2F2HA 3TYAA 5A3HA 1THFD 2XPKA 1ZJBA 3IPWA 4HB7A 4PCTA 3N29A 4AVNA 1C8QA 4A2RA 4ACZB 2W61A 2VCAA 4JHZA 5A8OA 1CT5A 1LL6A 5E70A 2IQDA 4E4FA 3TU9A 2V3FA 1WB0A 2FTYA 2D3LA 4AF0B 4LEQA 4GYPC 4FB7A 3ABOA 5BOFA 3THUA 1OCJA 4OUEA 4YNGA 2EJAA 4O54A 1FCBA 2VFIA 3JRKA 2QJJA 3ITYA 2VGFA 3ABZA 3GNNA 3OLGA 5G4EA 1TJ1A 4YHEA 4DO7A 2CLFA 3AC0A 3W7DA 1JEZA 1K4HA 3C86A 5FKYA 3WLTA 3RXZA 4XZNX 3U48A 3RG6A 5D05A 3WK2A 1OZMA 5T9BG 2POZA 2CWNA 2QUUA 1XM3A 1C29A 1E1EA 1RJPA 1F76A 3I68A 1JCLA 1CXEA 3KTXA 1JZ5A 5A8NA 1EQCA 3GTXA 3NVDA 3H4GA 4DAIA 5FSEC 2YCIX 3GX9A 2GQ3A 5FJJA 3KM8A 2PLJA 3EDEA 1OFDA 2VGIA 3H4WA 2Y88A 2I5GA 3RPTA 4XZHA 4IGMA 1KKRA 4GUJA 1XYLA 2WC4A 5E6YA 5D33A 2FZ8A 1ITUA 4TX6A 3CZLA 2TPSA 1Q13A 1O1ZA 1NTHA 1SUXA 3SCQA 4ASTA 1OABA 2ZA1A 4JY8A 4I3GA 2YDAA 1BYBA 3A9IA 4TV5A 3WF1A 1LCOA 4RPPA 5I2UA 1GKPA 1WKDA 3DBPA 1YDYA 5MKGA 4DM2A 3LCLA 3WNMA 2J62A 4L9YA 4QE1A 3R8HA 1SW3A 5C2GA 2ACQA 3TCEA 1NM9A 4EXAA 1UD3A 1L6YA 3W25A 3H22A 2ZZ7A 2HSAA 1GKQA 2DUXA 1ODZA 3MYPA 1DJYA 2BGQA 3B9DA 5HUPA 4FNTA 3ITLA 4ZQCA 1UKQA 1EJRC 4OBSA 3W81A 4JYDA 4KFNA 4GJ1A 3L4TA 2DJLA 3L12A 2V5CA 3A21A 4QS5A 3FGCA 5K2ZA 2BVWA 3VGEA 4JTHA 2IQTA 4HZMA 4PA8A 4P00B 5EY5A 1G67A 1P5BA 4Y9NA 2VWTA 3DOPA 4RDWA 3U2EA 4PODA 2NWSA 3QLLA 3WIJA 2FKPA 1Q65A 4LAZA 2F38A 2NQJA 1NF0A 4KT2A 3WFZA 1UG6A 2VJXA 3GK0A 3DGBA 2QCLA 4ORIA 3TJLA 2VUNA 2DY3A 5HA7A 1XRVA 4W8AA 2PE4A 2ODOA 2Z2BA 4URIA 1RPXA 3UY8A 5BWAA 4ES4A 1O1HA 2XM1A 2FQIA 4JS3A 1CGUA 3BLDA 3PZNA 4TMCA 1XX1A 4NNBA 2ZRXA 2PDUA 1BXNA 1M03A 1AVAA 3PUOA 2QXWA 3KCOA 5C9RA 4Q7IA 3VM5A 3TROA 3UWUA 5DANA 4XV0A 6CGTA 1W1A1 2EPKX 3S2NA 1YPXA 1RA5A 4YTRA 3FKRA 5AC7A 2X1UA 1J11A 1Q6RA 2D2JA 4HMEA 4W7VA 4RNJA 4JIPA 4MWAE 3ICJA 4IGHA 3TSDA 5CSRA 4UFLA 4Y90A 1TPFA 2A4AA 4UWMA 4DLFA 1Y8BA 1GHRA 4WJXA 3HURA 3RLUA 1XIDA 4B91A 3LB0A 1B3XA 2W63A 3ZSSA 1ODUA 4HYRA 1XYCA 2DW6A 4EPBC 4Z2IA 2DT2A 1ZJAA 2DW7A 3V5CA 1UWUA 1ME8A 1PVNA 2O7QA 4IP4A 1W9XA 4FLOA 3V0UA 4KWVA 5D32A 2H3DA 3IANA 4EX4A 4IL0A 3CZGA 1EC8A 4CCZA 3OEXA 4UMCA 3DKLA 2PC8A 4NI3A 3NURA 3QZAA 1GVSA 4LUJA 3ZR4A 3G2GA 5I3HA 5EIYB 3CO8A 2RH9A 2WVVA 1QO2A 4ALDA 4HHPA 5ENLA 3W2KA 7TIMA 4XWUA 4GCAA 3W7NA 4OKDA 5F2LA 2I9UA 4I7VA 1GVRA 4FEZA 3TSBA 4HSNA 4GO9A 1D8WA 1EJXC 2ADAA 4A22A 3EEGA 3RLGA 1XLLA 1TIMA 4PMXA 1MXSA 3MSYA 1S46A 1EX5A 1WZKA 4I6VA 4EK7A 2JK2A 1S1PA 2I56A 1Z8AA 3EB2A 4LRSA 2WV8A 2AMGA 4PEKA 3NXLA 1H49A 3LSCA 4LH8A 1V3KA 4JBRA 4LY8A 2E8ZA 2B31A 3SCTA 2B7PA 3R0KA 3F4VA 5E6ZA 3HQNA 3KP0A 3AROA 3OVQA 2YR1A 3BCDA 3EMZA 3TN6A 1AZ2A 3CH9A 2D0GA 3BW3A 1MZRA 4US6A 3U3HA 2CZ5A 3OOQA 4Z1CA 4QJ5B 1ZBCA 4DUVA 2RDTA 1V3LA 3MO4A 1AK5A 2H8ZA 2QQ6A 4M8UA 4L9XA 3HBLA 3MI3A 1VFOA 3SUUA 3H26A 3G22A 2CHRA 1PX4A 3UZYA 4XUYA 2NQHA 3VD3A 1F3EA 2XH0A 2JGYA 1R38A 4DO6A 4AWUA 4LC6A 5FJPA 5HXMA 2PTYA 4DUXA 2VVSA 3QKZA 3B0YA 2QAPA 2VX7A 2J25A 2A6NA 3W7RA 1LLOA 5HMFA 3PULA 3GVQA 1ZJHA 4L64A 2ATMA 4FLRA 5FEPA 1KKOA 1K7XA 5HATA 4Q3MA 5BMWA 3POHA 4JZ5A 3CLMA 1FFQA 2Q8XA 1PCKA 3WBAA 2JQXA 4KEVA 3WD2A 2RDXA 1GUVA 3BAWA 1XQLA 3V0TA 4UQDA 3LV6A 3DGRA 3SQLA 2ZVIA 4DWSD 2J78A 3RYSA 1NARA 4C7GA 4ZB0A 4E8GA 4IXHA 5IM51 1Q8JA 2CPUA 1E5JA 3QOMA