1K9EA

Crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with 4-o-methyl-glucuronic acid
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
676
structure length
671
Chain Sequence
b'GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAVVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRRWWKETAKRIYQYIPDFGGFVVKAPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-D-glucuronidase
publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 271
structure length 671
sequence length 676
ec nomenclature ec 3.2.1.131: Xylan alpha-1,2-glucuronosidase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1k9eA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1k9eA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1k9eA03
1ISXA 1V3IA 4AIOA 1M03A 1BG4A 5LYRA 3DYOA 3M7SA 3NJ3A 3WBEA 1QHPA 2WB5A 1V6YA 1UUQA 2DT1A 4W8AA 3AQUA 1H41A 3VINA 1WPCA 2EXOA 2EQDA 1RH9A 3K8LA 5EB8A 1UR8A 3CMJA 3WH5A 5CGTA 3GXMA 4HMCA 1W1VA 1KQZA 4UOJA 3K4DA 2WMGA 1K6AA 3WL1A 4CU7A 4E8CA 4B9ZA 3SCSA 1JDAA 3K8KA 1EH9A 3AIEA 2J78A 3WDRA 4MB4A 3U7VA 5A8QA 2CXGA 1ISVA 3PZ9A 2E9BA 1VIWA 2YBTA 3FXYA 1LL7A 1W9UA 3VDAA 1US3A 2C0HA 2X0YA 3VD7A 3THDA 1OINA 2JFEX 3NDZA 2XTKA 1A3HA 3EMZA 1XSJA 1EA9C 3N15A 2CKSA 4JL1A 3VIOA 3W25A 4GO8A 3VPLA 1FFQA 1BAGA 4ZFMA 2XVNA 1UH3A 3CPUA 3ZO9A 3CBWA 5FOOA 1N82A 2CERA 2VO5A 2OSYA 4MB1A 3PZMA 1CNVA 1ZB5A 1I1XA 3WD3A 4GZJA 4ACZA 2X0HA 4H41A 4U3AA 1H11A 2J7DA 1ODUA 1YQ2A 2PWDA 4MPKA 1E70M 1E6QM 1OSEA 2BXZA 1LJYA 2PWGA 2WVTA 4KGLA 4H04A 4P8UA 3RDKA 4TVCA 5ABFA 3GZAA 4U2YA 1UWSA 3CUHA 2DGAA 1Q6EA 4U5IA 3PZGA 4P8VA 3CZKA 2J8GA 2WXDM 3CUIA 2JE8A 1VFMA 4B3LA 1SFSA 3VKKA 3M07A 5LA0A 1W2PA 4GZIA 1R7AA 5C70A 1V03A 3AS0A 1E0XA 1DWFM 1HX0A 1CYGA 1JXJA 1RP8A 7A3HA 3WEOA 5I6SA 1BVNP 1HF6A 2UY3A 5AC4A 2A3AA 1JDDA 3VIKA 5AC5A 4CD6A 1CECA 1VJSA 8A3HA 4UFIA 5D4YA 2BVTA 2VRKA 2WC3A 3M46A 2E8ZA 1EXPA 4WJXA 4NSBA 1KFWA 4JKLA 3CHCA 4CKQA 3NSNA 3VX0A 1BGAA 4P7NA 1JI2A 3PN8A 1SYTA 2ESCA 2BNJA 5M3WA 2J7FA 1E6XM 3KL3A 2C7FA 3LPPA 4PTXA 3T2OA 1MXGA 1NQ6A 1UYQA 2GK1B 4W84A 2WC7A 1XSIA 3LPOA 3IAPA 5A8NA 4U3CA 4AZ6A 1JF6A 1QI0A 1HJVA 5GPRA 4FK9A 2V3FA 2DEPA 2WVUA 1JZ3A 2DT2A 3VIGA 4EE9A 2ZIDA 1OWQA 1CGVA 3VIIA 1JI1A 1U2YA 1JYWA 3CLWA 3AHZA 2E40A 1ISWA 4CUCA 5CLTA 4DUVA 1QNRA 3F5LA 1M7XA 1W1YA 2XM1A 3RM8A 2UY2A 3AIWA 3GXFA 4JFTA 3LMYA 5M03A 1V3MA 3DYMA 3OGVA 2D0GA 3AS3A 4PMNA 1XRVA 2D0FA 4F9JA 2CHNA 4EANA 1ITXA 1VBUA 3AZRA 4RE3A 1KWGA 3WD1A 4OIFA 3AYSA 4MDOA 2WKGA 1GOIA 2NT1A 3CUGA 3L4TA 1E72M 1EOKA 1K9FA 1WNOA 2VCBA 3DHUA 4QLJA 3NDYA 3ECQA 4U31A 4ZXOA 5A8PA 4W7UA 3GYCA 4AIEA 2XSAA 4U33A 1C91A 4WKHA 3WIJA 3WENA 2ZX8A 1L8NA 2E0PA 1J0JA 1GVYA 1ZBWA 2AOSA 1TUXA 1HJSA 3KL5A 1XYZA 2VR5A 3SUUA 3CTTA 1K9TA 4CVWA 4H2CA 2X05A 3FNDA 4UQBA 3NIYA 4W86A 2BY3A 1VJZA 4WKAA 2XG9A 1VAHA 1V3LA 1VRXA 2QPUA 2OLHA 2CHOA 4UQDA 3VIFA 2VQTA 4ZE4A 4Z2JA 4AC1X 1CEOA 1W9PA 3L2MA 3FN9A 4M82A 1VB9A 1WZAA 1X6NA 1J9YA 3QOKA 1GJUA 3BCDA 1TG7A 4C91A 1CWYA 5A69A 4AZCB 1ITCA 4DWSC 1H0IA 2ZXDA 2Z1SA 4PCSA 1WE5A 2EO7A 3UR8A 1SMDA 2WMKA 4HTYA 4P7RA 4V28A 3CMGA 1XV8A 3RO8A 3WQWA 3ARYA 4UQEA 5I23A 2GJPA 1W9DM 4IISA 1UWUA 3EBVA 4Z2IA 5CPQA 1C3FA 2F2HA 1GOMA 3ZT7A 3A4XA 4OUEA 1QI4A 2HVMA 1PX8A 3W6MA 2G3JA 1JFHA 1FH7A 4DWSA 5A95A 2G41A 1UD8A 4DM1A 2QV4A 4AWEA 3WD4A 4A4AA 1GPFA 2WMJA 5KZ6A 4GZEA 4D1IA 1XCXA 1E40A 4HP5A 5A6AA 2V3GA 5I0DA 2WBGA 3N11A 2O9OA 1W9BM 4P8XA 2WLZA 3VMPA 4PMVA 1AVAA 2W91A 4E4PA 1MW0A 3L4XA 5E9AA 3QOMA 1E5JA 3UETA 3VD5A 2DSVA 3LPFA 4PEEA 5FCZA 4WF7A 3AS2A 3WNMA 2XFFA 3ALFA 5A6JA 2X8RA 1PJ9A 1DWHM 1I1WA 2ZOXA 4DWSD 1QW9A 3UERA 3WF2A 3U57A 4MAZA 2EPKX 5A6LA 1PZ3A 4L4OA 3GTNA 1AQMA 1B3ZA 3RM4A 2ZICA 2JIEA 1BYAA 3MUY1 1LQ0A 3VGBA 2X09A 4GQRA 5FIPA 2CPUA 4AD1A 2WMHA 1H5VA 3EDFA 1QNSA 2WCSA 5JUVA 4UQCA 1O6IA 2VCAA 1WB0A 1V08A 4W8BA 3WF0A 2EPLX 1XH1A 1V0KA 2WLYA 4URIA 4HZ8A 3VD3A 3WDIA 2CESA 1JF5A 2GDUA 3MV11 3W26A 3PHAA 2D24A 3WMCA 4JAWA 2BVYA 5C71A 1MW1A 4JCMA 1JZ4A 4MDPA 3L2LA 3FAXA 4FLOA 3WNPA 4GO9A 1BYCA 4YHGA 1HJWA 5EFFA 1B3XA 4LPCA 1F4HA 3TONA 4JCLA 1B31A 1JZ8A 4W93A 4D6JA 2Z1KA 3WNNA 4D6IA 1W91A 3AICA 4FF5A 1Q4NX 3MKKA 3II1A 4S3KA 4BQ3A 5HOSA 4RE2A 1VBRA 4GI8A 3ARZA 2E9MA 1C92A 5CSUA 3VIHA 3TTSA 5IXEA 5D9NA 1HKMA 3WDHA 1UR2A 2ZE0A 1EO7A 4OZOA 4MNLA 1G01A 3VM7A 4H8UA 2D0HA 2PB1A 1JZ7A 5E6ZA 3W29A 1GW1A 1UWTA 1UKTA 2CBVA 4PRWA 3EDEA 3WNOA 4ACZB 3WH7A 1M53A 5F7UA 1OGGA 5CSYA 4NZCA 1JGIA 2WANA 1UR0A 1G1YA 3CO4A 5ABFB 4GXPA 3VGEA 1KBBA 4F66A 3BAXA 1BYBA 5CPSA 3CH9A 2Y24A 2VX7A 3AMDA 4Z2KA 3L4WA 2WM0A 3QHMA 5E70A 4F9DA 4X0VA 3PZUA 1GORA 4NRRA 3WBAA 3BMVA 6A3HA 3OBAA 5IHSA 1CXEA 1E3XA 3VMOA 4QCEA 2BXYA 1V02E 3ZR5A 4CD8A 1CGWA 4LYPA 1NOFA 4ZENA 1TE1A 1NOWA 2WW5A 1ODZA 1W2VA 2EJ1A 5A94A 2IXUA 3W28A 4D6HA 5BRQA 3HN3A 4PYSA 3DC0A 1CTNA 1ISYA 2ZX6A 4PMDA 2WBKA 3VIPA 3ZT5A 2W66A 1NP0A 2Q8XA 5E09A 3AHTA 4FLQA 4KRUA 3AZSA 2XJ7A 1QBAA 1GHRA 1H3GA 4MNKA 2QPSA 3F4VA 3SCNA 4FMVA 1GQKA 2JALA 1K9DA 1LF1A 1BHGA 3TTQA 3W82A 1F4AA 1NM9A 1SR0A 3BCFA 4P7QA 2DIEA 1MQPA 1GCYA 3BGAA 3NYDA 2WMIA 4W88A 5D8ZA 3RJYA 1PPIA 2X2YA 1LLOA 1OD8A 2E4TA 3F5JA 1UKSA 1KXHA 1X6LA 1DWJM 2XGBA 3OG2A 4XZWA 2DDXA 2WVVA 1V0LA 1B3YA 2EPOA 4MB5A 4J28A 3RMEA 1BQCA 2VT0A 1JG9A 4ZXLA 1PEZA 3WF1A 1KR0A 1A47A 4GI6A 3WNLA 2GJXA 5DT7A 1MFVA 4P7LA 2WHLA 5EFDA 4M56A 3VDCA 1JD7A 3FHQA 1VEMA 4PCTA 1MQQA 1V6VA 1GOKA 2UY5A 5BCAA 2J75A 3POHA 3WUGA 2WZIA 5JBFA 1GJWA 4CN4A 3OGSA 2A3CA 1ZBCA 4H8VA 2YA0A 1TFVA 3MSGA 2VTFA 3N13A 4J3WA 1BVZA 1XYFA 3WH8A 1OB0A 1V6UA 4V27A 2V3DA 1E4MM 3WUFA 5C8BB 1BPLB 1KGUA 1ZL1A 2DQXA 4Q7NA 4AISA 4NF7A 3GXIA 4CD4A 1UR1A 3MUIA 3VO0A 3AISA 3WQ4A 1GNXA 1UD5A 1XH0A 3G6MA 2ZXAA 4PTMA 2VL4A 4KWUA 1CXFA 1E71M 3B9DA 2J77A 4C7GA 4QAWA 3SUTA 2J79A 2VURA 5CG0A 1JL8A 1PX4A 2D2OA 3RILA 5E0CA 1GQLA 3SEPA 2ZUSA 3T2PA 4Z2HA 2YOCA 2WHKA 1P6WA 1OBAA 2WNWA 1QNPA 1KCLA 2A3EA 2WYSA 2YDQA 2CYGA 4OKDA 3AFBA 2WVSA 3MSDA 1NWSA 3ARTA 4J3UA 3OLDA 1VFOA 3AIVA 3B9EA 1V02A 3W53A 4HZ6A 4TVDA 5I3DA 1B0IA 4ATLA 3UR7A 4UZUA 3PBGA 4W89A 4J3VA 2O9TA 1OIMA 2FH8A 1WCGA 1BTCA 3L4YA 1JZ2A 2YL8A 1DHKA 3JUGA 4BQ5A 2WCAA 1DWIM 5CQ1A 5D9OA 4M8UA 1E0WA 1PZ2A 2F61A 1GQJA 3AROA 3AXHA 3OIHA 2J7GA 2GFTA 1HIZA 3VNYA 1XC6A 4AD0A 2WHJA 3D3AA 3BAJA 1UD3A 2VX4A 4HOWA 1MFUA 2BY1A 1J0KA 4TOQA 4J3XA 2G4FA 2XHYA 4CN1A 5I2UA 2WWDA 1D3CA 2BY2A 1GUVA 2PF0A 1H4PA 2TAAA 3VIMA 1UWIA 2XWEA 5A2AA 1JZ6A 2VMFA 4F8XA 1C8QA 3PZTA 2GUYA 1VEOA 2WK2A 2VZSA 1B1YA 3QHNA 1ECEA 1WDSA 5E0FA 2DIJA 1EHNA 4XUYA 4D6GA 4GI9A 1QNQA 2J8FA 4RE4A 3RIKA 4OOUA 3VUPA 2CEQA 4PMUA 3EMCA 1C93A 4BQ2A 5JIWA 1CZ1A 3PTKA 5BXRA 5I77A 4DWSB 2CBIA 1NARA 2XWDA 3O9NA 2CITA 1HJUA 3PZIA 6TAAA 4PMXA 3N1AA 4LYRA 5GQBA 1LWHA 3BAIA 1JYXA 4PMQA 1C8XA 4AZ5A 2OWCA 1R8LA 3I3BA 4TTUA 1ZJBA 3SURA 1CDGA 4A3HA 4KMQA 5ABEA 4B16A 3WUBA 3T09A 2DSUA 2E3ZA 1V0NA 1CPUA 2EEXA 5A8OA 2CIPA 1WAWA 1HKIA 4AMCA 4KRTA 3L4ZA 3WF4A 2DH3A 1B2YA 4GPNA 4J27A 3W4RA 1UWRA 2OYKA 1R87A 2ZX5A 3IANA 1QHOA 3WN6A 1EDTA 4QLKA 3FY1A 3MUZ1 4FLSA 2W62A 2VVNA 4H8HA 3AXIA 4TXEA 4AZGA 3SCQA 4UFHA 4NRSA 3KZSA 1RP9A 4W85A 2W5FA 5BXSA 1ZBVA 1KXQA 3W0KA 4ZE5A 4B3KA 4CCEA 5A3HA 3UG4A 4XV0A 5FL0A 4CGTA 2WMFA 3ZJ7A 1HKKA 3CZJA 1MXDA 3T08A 1E4LA 2J7CA 5ECUA 1IZKA 3AIBA 4XZBA 1W1PA 3WQ6A 3WELA 1LL4A 1OD0A 2PWHA 4JFSA 4HA4A 4PMOA 4ML4A 1JXKA 4AEFA 1UZ4A 1CXIA 1OT1A 2VNCA 2Y5EA 2VRQA 2FGLA 1KXVA 1C7SA 4E2OA 1KR1A 1W1TA 2DT0A 3IK2A 4J3SA 2XVKA 2JIWA 4N42A 5DT5A 5E6YA 1GOOA 1L0PA 3ZT6A 3MMWA 4X9YA 4AZ7A 1V3HA 1XD1A 3VMNA 5BXTA 4DUWA 2E8YA 3ARUA 3UCQA 1GQIA 3B8SA 5AYIA 3CHFA 1MW2A 1HP5A 4WSJA 4HU0A 1EOMA 2Y8KA 1UA7A 4P8WA 3BC9A 1EQPA 5ABHA 3L4VA 1R85A 3F5KA 3D5HA 2JF7A 1UD2A 3EMQA 3RM9A 2G8ZA 1UG6A 5HDRA 2WWCA 3UESA 2UWFA 3OB8A 3OGRA 3IJ7A 1BYDA 3N17A 1E6SM 4GINA 3CUJA 1OGSA 3S2CA 3QHOA 1UHVA 2E9LA 3PZOA 5GNYA 2YDRA 3BMWA 5BRPA 4UFKA 4MADA 1E6PA 3GNPA 1WZKA 3W24A 4PSRA 1IV8A 1BLIA 2OWWA 1HXJA 2PI6A 2WPGA 4AXNA 3WQ8A 3HJEA 2J7HA 4BQ4A 5JBDA 2FH6A 3WH9A 4M29A 5BYWA 4LYQA 4AZHA 2OSXA 3AMGA 8CGTA 1V0MA 1NWUA 5AYBA 1QI2A 3MS8A 1EQCA 5BROA 4UCFA 4C7FA 1UKQA 2XFYA 1RD6A 1FP8A 1JZ5A 3NCOA 4K68A 5CPTA 2JEPA 1EDQA 3BAKA 2ZUTA 3LPGA 1U33A 3TTOA 4QDMA 4HMDA 1W3LA 2WSPA 3WQVA 3VD4A 3SCTA 3MU7A 3AMCA 2W67A 1HKJA 2YLAA 5EBAA 3B9AA 4UFLA 4GIAA 1UH2A 1UA3A 4LQ1A 5DEZA 4W87A 1LWJA 1U30A 1VFUA 2FHFA 3VTRA 3GXDA 1VENA 2ZX9A 4TX8A 2D3LA 2JEQA 4AEEA 5HBFA 1DWAM 2D20A 1E1EA 2BFGA 3SCPA 3ZM8A 3AMKA 1OM0A 4KGJA 5CJ5A 3GBEA 5GNZA 3O2LA 4J7RA 1FH9A 3KEHA 1WZMA 3MANA 1J0IA 1PBGA 1V3KA 2XYLA 1GONA 1CXLA 1H1NA 1QOXA 3BAYA 3SIMA 3CGTA 3SCWA 3ZSTA 2PWFA 4JL2A 3FAWA 1MWOA 3T0AA 1E5NA 4MJ2A 1UR4A 1UZ1A 2WMIB 4X0NA 1QPKA 1NWRA 2EBNA 1KB3A 1E15A 3ARPA 4MJ4A 4MNJA 2V38A 2XVPA 4EK7A 1R86A 2VZOA 1CXKA 4CD7A 1G9HA 3GNOA 1JDCA 5IHRA 2ZX7A 3IJ9A 4JHOA 2WVVB 4UR9A 1XH2A 1B30A 5A6SA 2VCCA 2GJXB 4XB3A 3EDDA 1XHGA 3SUVA 2GVYA 4BZYA 3TA9A 3ZSSA 4R5EA 4PMYA 3T0DA 3VGGA 4CCCA 4AZBA 4BF7A 4AIUA 1CLVA 1CLXA 1WO2A 2O92A 5LA1A 3WFLA 2QMKA 2WC4A 2V5CA 3GH4A 1Q6GA 3VNZA 3ARWA 4DUXA 2QHAA 1UH4A 4KH2A 3TP4A 4UFMA 2J47A 1KGXA 3TTYA 4JKMA 3ZOAA 5EMYA 3EYPA 1GOQA 4AW7A 4RL3A 1H09A 3PZNA 1C90A 3L4UA 1M04A 1XGZA 1UKPA 2J7BA 1E43A 4QP0A 5ABGA 3RCNA 3NUKA 4GQQA 5D8WA 1KCKA 4CU6A 1TCMA 1BG9A 2J25A 4PSPA 2YL9A 5D9PA 1TA3A 2YA1A 4CU8A 1G5AA 3BH4A 2PBGA 4UOQA 2VX6A 5M17A 1E3ZA 3BSHA 1WZLA 2OSWA 1OGBA 3K4AA 2BHZA 2OYLA 3BLKA 3VGDA 3WFZA 2CBJA 3KWXA 3VVGA 1W3KA 2FHBA 1SMAA 4EAMA 3I3EA 2W4XA 1VF8A 1J11A 1MQRA 1G0CA 4M81A 4D1JA 3OZPA 4QLLA 3VD9A 3OLGA 4ZEPA 2XGIA 4OBRA 3TOPA 3CIVA 3PTMA 1Q6DA 4B15A 2QF8A 3DYPA 3U7BA 1Q6FA 3ZR6A 1BSIA 2BY0A 4QCFA 1LL6A 2O9PA 1CGXA 3G6LA 1EHAA 2VZTA 4BCEA 3ALGA 1ZBKA 1WDRA 3OLIA 1J18A 2VUYA 1TMQA 2YLLA 1R7OA 1GVIA 1PAMA 2YKKA 1W9VA 1TVPA 1CBGA 5LA2A 2CBUA 3W81A 4BA0A 1UD4A 5IDIA 2A3BA 4ATDA 5FKYA 1UQZA 2GDVA 3WDQA 3SCVA 3N9KA 4MTVA 4PUDA 2CCRA 3WL0A 4HPHA 5BWFA 3AIRA 3A47A 3SUWA 4M1RA 4AD5A 4CN6A 3N18A 4CCDA 2QMJA 4M24A 2CETA 3A4AA 7TAAA 1E1FA 1CGYA 5A1AA 2XIBA 4UZSA 4PTVA 1HNYA 3AJ7A 5CLWA 1E4IA 1HJXA 1HVQA 2J74A 3VOCA 1C8YA 3VGFA 4HU8A 3WDJA 1UD6A 1JD9A 4YPJA 2XUCA 3KL0A 3CHDA 2ZWZA 3DHPA 1AMYA 2BHYA 1IZJA 2WAGA 2XPKA 4JFUA 4HMEA 2VR4A 1MVYA 2G3IA 1MW3A 5HNNA 4MAVA 4D72A 4HPGA 1FOBA 2B31A 3W27A 3U5UA 5A6MA 3AHVA 5I78A 1J12A 2D23A 3BAWA 4LX4A 5I24A 3GDBA 2BHUA 2GJRA 3MMUA 3WUEA 3RPMA 2XFRA 4HZ7A 4UQAA 3J7HA 3N04A 2IUZA 1W32A 2DH2A 4JKKA 1DWGM 4AY1A 1MYRA 2J62A 3ARQA 1CXHA 4C7DA 4HA1A 1FH8A 2Y4SA 2G3MA 1AQHA 5I79A 1HL9A 1HL8A 5DF0A 1KXTA 4CVUA 4UQ9A 3FW6A 3ZMRA 1IT0A 2OYMA 1HP4A 2DSKA 2VRJA 1GOWA 1ZS2A 1NWTA 1B90A 3GBDA 1V3JA 1QI5A 3ARRA 4XX6A 3WEMA 2GSJA 1KQYA 1BGGA 3GNRA 2XVGA 1OT2A 4FLRA 4LXFA 3I3DA 4C90A 4TTGA 1PX3A 3GH5A 3WMBA 3QGVA 3A3HA 1D2KA 2VI0A 3A6OA 1QW8A 2W63A 1H2JA 3MV01 4N0RA 3RJXA 3WSUA 1S46A 3OLEA 1B9ZA 4JIEA 4D6EA 4IPNB 4OBSA 4Q22A 5HPCA 3A4WA 2ZUUA 4JFVA 2IXVA 4TUFA 2D22A 1K9EA 3QR3A 1JFXA 4JZ5A 5DFAA 4U2ZA 3MUAA 3APGA 3BLPX 2BS9A 3CUFA 2CKRA 1J0ZA 1GHSA 4MB3A 2XM2A 4PUEA 5CGMA 3VGHA 3CZ8A 2ZUNA 2BV9A 3KE0A 3NSXA 4IM4A 2WHMA 1H0GA 2EPNA 3SCUA 4YN5A 5IFPA 3WF3A 2YBUA 3VILA 3T2QA 4GKLA 4W8LA 1JNEA 3WD0A 4IPLA 3S6TA 1O7AA 1CENA 1NP2A 4V2XA 1QVBA 3ARVA 2VVSA 3O6AA 4OOZA 2XVLA 3FHAA 4L4PA 3IAQA 2ZUVA 4M80A 4UOZA 1HJQA 6CGTA 1Y7VA 5A2BA 2GK1A 3WKZA 2WZEA 4W5ZA 3ZQ9A 1VEPA 1XD0A 2C8NA 3AHXA 3PZVA 1QHZA 2YA2A 3WEZA 1E0VA 1E56A 4CD5A 1EIBA 4AZIA 4IUGA 3ZIZA 3GM8A 2AMGA 2VOTA 2J4GA 4D6DA 4U5KA 3UEQA 1QBBA 2W92A 3E1F1 4JFWA 2WZHA 2Y2WA 2YIHA 2WSKA 4F79A 3CZEA 2A3HA 1B3WA 3ARSA 3CHEA 2RGMA 2VX5A 3AS1A 4PTWA 4D6FA 4E8DA 1JAEA 2F8QA 1UKOA 5CZKA 5M5DA 4AD2A 1J10A 3OA5A 2FDMA 4BS0A 2XIIA 4UTFA 4AD3A 2ZWYA 1FHLA 2MANA 1GZJA 1WP6A 2QLYA 3BSGA 1DTUA 2FGZA 2YL5A 2RGLA 4HOZA 5A6BA 5I5RA 1J0YA 1W9XA 5KEZA 2VJXA 3HU7A 3ZJ8A 3VDBA 1TZ7A 1WDPA 2EPMX 1PIGA 3DECA 2O9RA 1NOUA 3AXXA 1JYNA 1EDGA 2NT0A 3W37A 2ZXBA 4Y7EA 1V6XA 1LG2A 3ZJ6A 1E4NA 3GH7A 3WDPP 4H7VA 3W6LA 5FL1A 4PN2A 2PWEA 3K1DA 1FP9A 1HT6A 2YJQA 3PTQA 1JAKA 2DT3A 1Z32X 3EDKA 5BXPA 3AIUA 1FFRA 4ACYA 3M6DA 1CGTA 1E6NA 1UQYA 2D3NA 1US2A 1ZU8A 1I75A 4S3JA 5CXPA 1JNDA 3WMSA 2W61A 2VC9A 5IFTA 5A6BD 1WDQA 1H49A 3POCA 4J3TA 4UNIA 5DO8A 2AAAA 2Y8VA 4WK9A 1VFFA 3AIQA 3IJ8A 1XSKA 2D1ZA 3W38A 1YHTA 1X1NA 3UG3A 3VIJA 1FA2A 2V3EA 3HMCA 4NI3A 5TD4A 3UG5A 4AZCA 4OJYA 4WLCA 1KGWA 2VZVA 4PMZA 2DSWA 4ATWA 3EDJA 3WH6A 5GNXA 2HISA 2YDSA 1NH6A 4W7WA 4Z2GA 1Q6CA 5A8MA 2BVDA 4PMRA 1TVNA 2J7EA 3VU2A 5JIPA 3AHYA 2DPEA 4MNMA 4PBGA 2VQUA 3SCRA 3NSMA 2ZUWA 3BXWA 5FD0A 1E73M 3OZOA 4WSKA 4QFUA 2WKLA 1QI3A 4W5UA 4WKFA 1E9LA 3K46A 2G3NA 3K8MA 4P7OA 4AD4A 1QNOA 3WY1A 1LG1A 3WQ5A 1E6RA 1EO5A 4A3YA 3ZJKA 2X1IA 1UOKA 4AYSA 9CGTA 4WIWA 4B9YA 1BF2A 1ZJAA 4UFJA 3T0BA 1KWKA 2FHCA 2UY4A 3VDHA 4Z2LA 4W7VA 3MO4A 1UWQA 2PBOA 5A6KA 1OIFA 1TR1A 3AI0A 3WNKA 1B3VA 1TA3B 3U5YA 1M01A 1W3HA 2V5DA 4HA3A 3AMLA 2NSXA 3PZQA 2OWXA 3CZGA 1CGUA 7CGTA 1C7TA 1RPKA 4HOXA 3WD2A 1ESWA 1J01A 5A2CA 2JF6A 1AQ0A 5JBEA 3CZLA 5HXMA 1HVXA 3VM5A 1JYVA 4TVUA 3N12A 5AY7A 1UR9A 3AOFA 5D9MA 5HPOA 1E6ZA 4JHZA 1OCQA 1E55A 1HN1A 5DMYA 1JIBA 3AZTA 2VZUA 1DEDA 3AYRA 1J0HA 1XCWA 4EKJA 2YL6A 1DP0A 1W3JA 2PC8A 2ZXQA 4LGXA 2WCGA 2XSBA 3SUSA 4D6CA 1WKYA 1D7FA 1KBKA 2CNCA 1G94A 1V6WA 1EGZA 1BFNA 3ARXA 4R27A 2DSZA 4D71A 1ISZA 1FHDA 1PIFA 4DM2A 1CIUA 2ZUMA 3MMDA 4TX6A 3VX1A 3SCOA 4YHEA 2NW0A 3THCA
chains in the Genus database with same CATH superfamily
3HFTA 1V3IA 1CLKA 2NQJA 5EGRA 4QR6A 3NQ2A 3GXNA 1BG4A 1XC4A 1TZZA 5AOUA 1W5PA 4MJMA 1L6SA 3XISA 3FXGA 2WZTA 2DT1A 2VHLA 4JOMA 3H54A 3TMLA 3G24A 3VINA 4JGDA 5FJIA 2EQDA 4Q33A 1RH9A 1F07A 2CZDA 5CGTA 4NP7A 1W1VA 1KQZA 4UOJA 4EPDC 2RJGA 2Q8LA 2J78A 3WDRA 3H2MA 2J6VA 3PZ9A 2YBTA 3FXYA 4Q4PA 3N4EA 3MSRA 1Q45A 2X0YA 3W6YA 3KBJA 3BOXA 3E0WA 3EWXA 2Y7DA 3NDZA 1A3HA 2O56A 3MP4A 2O0TA 4FNTA 1XSJA 1EA9C 3HGRA 2CKSA 5F4WA 3OZYA 1BD0A 5D03A 3VPLA 4AB4A 1FFQA 2XH4A 1BAGA 1P0NA 1UH3A 1OYBA 3CBWA 4I9AA 1X7FA 4H1ZA 1W37A 4LY8A 2OSYA 4YS1A 2R1PA 3NG3A 1ZB5A 2GLKA 2J6XA 4U3AA 3KTCA 3BQ5A 1EFZA 1X7IA 1E6QM 3WK0A 3L12A 3QLLA 4C6LA 2WVTA 4NI8A 1E1CB 1OY0A 2DGAA 1Q6EA 3O16A 3KM8A 4U5IA 3PZGA 4O28A 3KOXA 1VFMA 2XH0A 4MVAA 3M07A 4FX6M 1W2PA 4GZIA 5C70A 1ZAIA 4J40A 4HYVA 1XGDA 2JKEA 1LBLA 1XIGA 1E0XA 5L6UA 4OWGA 4CEUC 3TAKA 2ACSA 1CYGA 1RP8A 1D9EA 1BVNP 2A3AA 5AC5A 5H8PA 1EF3A 1CECA 3TNOA 4UFIA 4DN1A 2BVTA 4F48A 4F0KA 1XIJA 5AHNA 1X1OA 4NSBA 3NL6A 1KFWA 3NSNA 3VX0A 5J5RA 2KAUC 2AKZA 3PN8A 3G1XA 2C7FA 3LPPA 4DAFA 1ZLPA 3NA8A 1UYQA 2V0TA 3W76A 3SDOA 4W84A 4NX0A 3S8HA 2DUXA 4XWUA 3IAPA 4Y2WA 3V5OA 1JF6A 4LC6A 4XSMA 1T41A 2Y1HA 5FACA 1TX2A 3UCDA 2DEPA 1JZ3A 4QTGA 3VIGA 1OVDA 1VBGA 4EE9A 1OWQA 2XFWA 3VIIA 4PTDA 1ISWA 2EG8A 4OFCA 4CUCA 3FGCB 2DW6A 2C14A 4I7VA 3N9RA 5M03A 3DYMA 3OGVA 1XRVA 3S5YA 4GYJA 4F9JA 3KXQA 2VWSA 4IL2A 3QTPA 4WDWA 4JN8A 4RE3A 3PWGA 1KWGA 5C7HA 1A49A 3AYSA 2WKGA 2TPSA 2Y89A 3L4TA 2AGKA 2V9DA 3DG6A 2WJEA 2VCBA 2VXNA 3AXKA 3NDYA 2DIKA 4ZXOA 3VNDA 4W7UA 2Y70A 1OC5A 4U33A 1C91A 1TSIA 4WKHA 1S5MA 5HJXA 1ZBWA 1TUXA 3PFMA 1O66A 4FS9A 2OCZA 2XDFA 4FI4A 3CTTA 1K9TA 3LNMA 2X05A 3FNDA 5BMWA 4W86A 2C19A 4AVNA 3QPZA 1VJZA 1H1YA 4JTQA 4UQDA 5LSMA 1RLDA 3JR2A 2HJPA 3DCPA 1DHPA 1W9PA 1S2UA 4QGCA 1VB9A 1X6NA 1GJUA 1Z44A 1TG7A 1DQUA 5HR6A 1QPQA 4OV4A 1CI1A 1ITCA 4DWSC 3S5OA 5BOEA 3ABOA 3V4BA 3C52A 4CQDA 1J8VA 4UTHA 2QCLA 3MMTA 1NELA 1SMDA 2V5JA 3GTXA 4Y96A 3CMGA 1XV8A 4GXWA 3WQWA 4UQEA 1T0OA 4XKYA 4HVXA 2XZ9A 3VC5A 3RLUA 1K8CA 1SZFA 4LNCA 4Z2IA 4IFKB 3JS3A 3BLDA 4L61A 3A4XA 4OUEA 1FWHC 2IPWA 5I3GA 3FA5A 1UC4A 3DDMA 2PTWA 2V67A 1E0UA 2G3JA 3C8FA 3QLDA 1EF2A 1UD8A 3WD4A 3TWAA 5FF3A 5I02A 4QM1A 5KZ6A 1JJKA 4D1IA 1XCXA 5AYYA 1ZZMA 3KVLA 1Y0EA 3EX4A 3E02A 1ENUA 3CV1A 2WBGA 3R0KA 4B5XA 4CQAA 1M1BA 4HMNA 4P8XA 4E3TA 2RDUA 3PUOA 4F0RA 1WXJA 2GGJA 4MJZA 2W91A 4E4PA 5E9AA 2HV5A 1HW6A 2P5NA 1AH3A 3UETA 1K7FA 2OPJA 3CWNA 4O17A 4WQ6A 3AS2A 1ADSA 2XFFA 3SIZA 3NZPA 4MY8A 2X8RA 3W7RA 3GFZA 2H90A 4DWSD 3WF2A 1TWDA 1DIOA 2VEIA 2EPKX 1RZMA 2CLHA 4R9XA 2XU2A 3W75A 2QJJA 3L0KA 3SQMA 3HBLA 3MUY1 3VGBA 3PPFA 5IM51 1Q6QA 3N6JA 3G2GA 4A3UA 4ALDA 4K1GA 4IFKA 1EJTC 3EDFA 1P6CA 1QNSA 3WLRA 4RDZA 5LHEA 5HJYA 1N8WA 3UJEA 5C54A 1O6IA 2VCAA 4LBRA 2OGYA 4IICA 3TSDA 1RAKA 1KM4A 4EWND 2OEJA 4QROA 3T78A 3MKVA 3ZVHB 1PYMA 4URIA 2NQ5A 4US6A 3VD3A 1LBFA 3HURA 1KBLA 5FEWA 3NM3A 4YTTA 2CESA 2GDUA 2YDAA 5DELA 4FB7A 3UXLA 5G5IA 3LTSA 4L4LA 3URBA 4JAWA 2BVYA 1MW1A 3VI2A 1JZ4A 1IQ8A 2GVJA 4DEFA 4FLOA 5FAGA 1OFOA 4YHGA 4NAFA 1QFEA 1HJWA 4MWAB 5EFFA 3T7VA 4LPCA 4JCLA 1UWAA 2PTYA 1D8WA 2H3BA 1A5BA 4D6IA 3AICA 1Q4NX 1R9XA 2H8ZA 4BQ3A 4PL1A 5FEZA 1IHIA 4GI8A 4ZSUA 2H3DA 1PKMA 4N6FA 2VDHA 3VIHA 3PJUA 3EA3A 4FNSA 3SY8A 3TTSA 1OFPA 1Q2RA 1EO7A 4KEZA 4AWTA 4MNLA 4C6KA 3VM7A 3GU9A 4H8UA 3FJLA 1H51A 1K4GA 1ZGDA 1R3TA 3EDEA 3N2MA 2IW0A 5CSYA 4O8AA 3PBVA 1ICPA 2Z1XA 3MCOA 1POJA 4EXAA 1XS2A 4MFEA 3HGSA 2ZA3A 2XH7A 5DY3A 2HZGA 3PR2A 5FSDC 3A13A 3NWRA 3VGEA 3SR7A 3USZA 3W85A 4F66A 1BYBA 5CPSA 2Y88A 1AL8A 2QJIA 2VX7A 5E70A 4F9DA 1N8IA 4X0VA 4UTWA 4DIAA 4QEHA 3HPXA 3VMOA 2BXYA 3ZR5A 1YE4A 4YLWA 3WBWA 3B8VA 3NYZA 4LYPA 4B2DA 2I14A 3ONCA 3O8AA 4UUIA 4X63A 4JYFA 1ZALA 4DELA 2I57A 2FZMA 3DC0A 2FZ9A 2G95A 4IQDA 3BV4A 3G22A 5CG7A 4ZO9A 3ZZ1A 3VIPA 1K8XA 3ZS4A 1GG1A 1NP0A 3AHTA 4FLQA 5HMEA 4RW3A 3H4XA 5LNUA 4EVZA 3ONBA 1JCLA 4PH6A 2QKFA 2PU1A 3QW4B 2AL1A 3TTQA 1NM9A 3BCFA 4NAEA 2DIEA 1MQPA 1W5NA 4BI6A 1X38A 4C60A 4XAYA 3ICJA 1LLOA 2E4TA 1KXHA 8XIMA 1JUKA 4JQAA 3OG2A 1UZDA 4O8RA 3TJ4A 3W2UA 4J28A 2P53A 3I10A 3RMEA 1UOZA 3DXIA 1KR0A 4GI6A 1TTQA 3MDUA 4HQVA 2DZSA 1JD7A 1LRTA 4MYXA 1VEMA 1V6VA 3LGEA 2UY5A 4H9TA 1XG3A 1GGOA 2WSQA 1NY1A 2C71A 1YNQA 2J75A 3TZNA 2YA0A 3GDTA 1TQJA 5CJNA 4QS6A 4TMCA 2IKJA 3WUFA 1KGUA 3FDKA 1R0MA 2Q71A 2DQXA 1RCXB 3NFUA 3MUIA 4G6CA 5E1QA 2TRSA 3C5QA 1PTAA 2W6RA 1GNXA 3AISA 1A0EA 3WQ4A 4LVGA 2EAWA 1KLZA 1QPOA 2ZXAA 4QQ3A 1R38A 1CXFA 3VC6A 1E71M 4UIOA 4AFYA 2J77A 3SN1A 4JX5A 4V1YA 2J79A 2VURA 4RJEA 3SN0A 1FWEC 5CG0A 1RA5A 4OT7A 3BWWA 2VC6A 3MHUA 4GCXA 4C1LA 3M0KA 3EEZA 5E0CA 4OTKA 1GQLA 1TV5A 4KIEA 1WA3A 1JGMA 2WYSA 1QUMA 1QPNA 1DJHA 4K8HA 3RN6A 4MFDA 5EIYB 4LBUA 3OLDA 3GAYA 5I3JA 2WJZA 1IIHA 2YCLA 3AIVA 4C6DA 4NL1A 4GHRA 3FYOA 3F4DA 4TVDA 1B0IA 1ME8A 4P61A 1UBSA 3ZWTA 3UR7A 3PBGA 2YXXA 4M7TA 4J3VA 4W89A 1BTCA 3O0KA 3L4YA 4N4PA 1DHKA 4XIAA 3S83A 3AROA 3VNYA 1XC6A 4FR6A 4AD0A 3U2EA 2WHJA 3D3AA 4A8RA 3S2MA 4LCSA 4O53A 1J0KA 3QYQA 4J3XA 3PSWA 2XHYA 3EWDA 2Y62A 4XQ6A 1D3CA 4GNVA 1H4PA 5EMKA 3BOLA 1S2AA 2XWEA 1FWGC 3CU2A 4N9BA 4QX4A 3P5ZA 3PANA 1C8QA 3PZTA 2OLSA 2GUYA 1JCNA 2VZSA 1QATA 3QHNA 1WDSA 2DIJA 1K6WA 1W54A 4RE4A 3RIKA 1EUAA 3BG9A 1RK5A 4PMUA 3EMCA 2PDYA 3PTKA 6XIAA 2PS2A 4RPPA 1NIUA 2FGBA 2XGZA 1PDZA 1XL9A 4LUSA 1HJUA 3T81A 1TPUA 3ZLFA 1K3UA 3GG8A 2A4AA 3N1AA 3CQIA 3F2DA 2OWCA 3NQCA 1ZJBA 1XYLA 3NPVA 4A3HA 4KMQA 2WO5A 4G2DA 3O3RA 2Z6JA 3T09A 4KWOA 4Q4KA 3HM7A 1KTBA 5A8OA 4LSBA 4AMCA 4KRTA 5B7YA 2DH3A 2D2HA 3P84A 4MZ8A 3W4RA 2OYKA 1R87A 3IANA 3DFTA 2BOFX 3S5SA 2VDGA 2D2JA 2PDWA 3FY1A 3NQ6A 2W62A 3OODA 3AXIA 3E2QA 3C0SA 3B8WA 4AZGA 2PLMA 5TIMA 1A3WA 2ALDA 3KZSA 1VBJA 4QIUA 3QR0A 2A85A 3W0KA 1IGWA 4ZMGA 4ZE5A 3B0VC 2DJLA 4FXJA 4K37A 2CLPA 3TR9A 2YZ5A 5FL0A 5LXXA 3ZJ7A 3BO9A 1HKKA 1QT1A 1DJIA 1ZJHA 2QJNA 4ZZ9A 3T08A 1UJPA 1IZKA 5ECVA 4K7YA 4FOJA 3WELA 4JX4A 2PDCA 4AAJA 4HA4A 4ERAA 1OJXA 1CXIA 2VNCA 3LBCA 2Y5EA 3HIJA 4J5NA 2VRQA 3TYBA 3C2FA 2FGLA 1KXVA 4E2OA 4RCXA 1Y65A 3ES8A 2JIWA 5DT5A 1WX0A 1L0PA 1P5BA 3C2YA 1XD1A 2A6LA 5BXTA 3IPWA 2E8YA 5AHFA 1GQIA 3N2OA 4M5PA 4QJ1A 5D30A 4JN7A 1HP5A 5F2LA 3M16A 4HU0A 1WOAA 3TFXA 3V0SA 4GOAA 3BC9A 4ONVA 4GNKB 5BNKA 2PC4A 4LALA 3EMQA 3O07A 2G5WA 2PD5A 1RY0A 2G8ZA 2VGBA 2UWFA 3ABRA 5C6MA 3EGJA 3E74A 1E6SM 4L1GA 1EWDA 1OGSA 3OBEA 3NEVA 4UFKA 3WLIA 3OZMA 1WZKA 2GSHA 4IGMA 3NM1A 4PSRA 2DZWA 3RFAA 1HXJA 4AXNA 4BQ4A 3WQ8A 5HAOA 2J7HA 1OYAA 2FH6A 2GWGA 3EXSA 4LYQA 3AMGA 1V5XA 3Q67A 4E3VA 4DB7A 3F03K 5AYBA 7REQB 8XIAA 2QUNA 3MS8A 1EQCA 3GIQA 1SSGA 1UKQA 2XFYA 3Q4DA 5CPTA 2JEPA 2B7OA 2ZUTA 1DVJA 1U33A 1TREA 4XUGA 4GVIA 3WQVA 2YXOA 2W67A 3DG7A 1DPMA 4GIAA 4LQ1A 2RH9A 1VFUA 4ERGA 3GXDA 4IPIA 4O1FA 2P10A 2ACQA 4S3AA 2D3LA 4AEEA 2D20A 1QNVA 1JPKA 2I17A 2KX9A 4QAIA 3TVAA 3ITLA 2Y61A 1AQFA 5GNZA 2QCEA 3KBNA 3RUBL 4L4MA 1PBGA 4B90A 5C5YA 1CXLA 5DMLA 3BAYA 1SJCA 3SIMA 3SCWA 4YVXA 2PWFA 3UWYA 4YU1A 3S2LA 1AG1O 1LM1A 4LNYA 4C6JA 1I2NA 3BURA 1QPKA 1NWRA 3GG7A 4EK7A 2R8WA 1CXKA 1G9HA 1HZYA 5IHRA 3EOUA 4ASTA 3ABXA 1I2PA 1B30A 3VUSA 4MM1A 2G37A 1IEVA 3IARA 3EDDA 1Q7MA 2GVYA 3TA9A 4R5EA 4CCCA 4BF7A 5LNVA 5K3VA 4RPQA 3RYSA 5D04C 1YTDA 2L5HA 2WC4A 3VNZA 2QDHA 2QHAA 4JQ2A 4N9EA 1PKYA 3NQMA 2QUUA 1KGXA 3ZOAA 5EMYA 3K30A 4FHAA 4AW7A 4GYPC 3L4UA 2J7BA 1Q66A 3NUKA 3LHZA 3IACA 1UMYA 3H6OA 1EX1A 2PA6A 4PSPA 2YL9A 4JDYA 2YA1A 4CU8A 1DTNA 1BKHA 3BH4A 2DVTA 4RDWA 3L68A 5B7ZA 1I0DA 3BVJA 1YPXA 2ISDA 2OSWA 2QCHA 1OGBA 1SUXA 1Q6OA 2BHZA 3F2BA 4EOUA 3OP2A 1YBQA 2P76A 4NY2A 2OYLA 3W1TA 1DORA 4JEQA 2QEZA 5EYWA 1NU5A 3W7JA 3VVGA 1W3KA 1RQEA 1MQRA 4M81A 4QLLA 1Z69A 1B54A 2NQZA 3TOPA 1Q6DA 2OB3A 1Q6FA 1YDOA 1EJVC 1BSIA 3M43A 2O9PA 4IIGA 1N7KA 3G6LA 4JBRA 4BCEA 1TPC1 1XBXA 2QW5A 1J18A 2VUYA 3OOQA 3P8IA 2YLLA 1FWIC 3TYZA 1GVIA 1PAMA 2DFAA 2YKKA 2YCJA 1FWFC 2C1HA 3I4EA 2A3BA 3TCEA 2CCRA 1SU5A 3T0TA 1N8FA 3AIRA 3A47A 4S3EA 4CN6A 1X8FA 4AD5A 1DJZA 3N18A 4JD4A 5TBOA 4LAMA 4GGBA 3L67A 3R79A 4BKNA 2CETA 1RQHA 7TAAA 4F2UA 5A1AA 3WQGA 4Q32A 5CC6A 2NWRA 3O06A 3AJ7A 4MMWA 1E4IA 1HVQA 2J74A 1C8YA 4HCLA 2DUAA 1EYWA 1TWIA 1OQFA 4KWVA 3D46A 3DBPA 2PP1A 2I56A 3OQ8A 2BHYA 1IZJA 4JFUA 2XPKA 4HMEA 3IRDA 2VR4A 3F4NA 1MW3A 3U8GA 1O5QA 3DAQA 3M0VA 4EWJA 2B31A 5A6MA 1KW1A 3O05A 3CIWA 3STFA 2BHUA 2XFRA 3ZWSA 3KOWA 3J7HA 3HV8A 3UW6A 4JKKA 1MYRA 2J62A 3GU1A 3E6EA 3CPRA 5I7GA 3QV7A 4C7DA 3VFLA 4CNPA 5I79A 1HL9A 4I8DA 1HL8A 1I2RA 4CVUA 4UQ9A 3FW6A 3UU0A 1IT0A 1SFLA 2QCDB 4DBDA 4ML9A 2VRJA 1S2VA 1V3JA 2YB1A 1QI5A 4MHBA 4TV6A 3ARRA 4XX6A 4H4IA 3N14A 1JDEA 5AZ1A 2Y0FA 3UBPC 2GGIA 1QW7A 4F4RA 1HKVA 3BLLA 4GMEA 4XG1A 3FX4A 2BVWA 4FNQA 3GH5A 4I5RA 2PGFA 3A3HA 1J79A 5G2WA 2W63A 3MV01 2GWNA 4GX8A 3OLEA 1K4HA 1ZRQA 1B9ZA 4A05A 2NV1A 4IPNB 4Q22A 1RBAA 3A4WA 4QG8A 3GTHA 3DFPA 3G1FA 4GC4A 4Q4OA 3QR3A 4S2CA 5CAHA 4U2ZA 2IMRA 3MUAA 2DW7A 3TN5A 4IF2A 4GLEA 1Y5VA 1GHSA 3ES7A 4WGXA 5C2CA 1JPHA 2ZUNA 1RUSA 3NSXA 5LNSA 2Z2BA 4RNJA 5IFPA 3N2BA 2Y7EA 1JNEA 3WD0A 5C9XA 4IPLA 4C5ZA 3T40A 4M6UA 1FDYA 3NPXA 5EL1A 5F4SA 2Q6ZA 4W4QA 2YZRA 4OOZA 4OBTA 1BTMA 1TPDA 4LW7A 2OZ0A 6CGTA 5A2BA 3M0MA 2GK1A 2PDUA 3ITGA 4Q8OA 3W1MA 2ISSA 4W5ZA 5KZDA 1VEPA 4NJGA 3W83A 3FVDA 3H12A 3WEZA 3T4WA 3W1PA 1E56A 5K9DA 4AZIA 5C7VA 3ZIZA 2PDQA 4K38A 3OW1A 3UEQA 2ZE3A 2FIQA 2W92A 3R94A 4IUOA 2YIHA 5D32A 2WSKA 1BWLA 4Y9NA 5ENLA 4E8DA 1ZP3A 1JAEA 2DQWA 3P2VA 3WLKX 1Q63A 4AD2A 4PCPA 2FDMA 2XIIA 4AD3A 2ZWYA 1VP5A 1FHLA 1GZJA 5E9XA 2VM8A 3CJPA 2YL5A 5G2IA 3A5VA 1A0CA 3HQOA 4JTFA 3BV7A 5LKYA 5KEZA 2E6DA 2VJXA 3HU7A 5KITA 4Z0JA 4DQWA 2PTXA 1LYXA 1TZ7A 1PIGA 1W5OA 1R9YA 1VJIA 2PDNA 3H23A 4IJCA 4QHRA 1V6XA 1F61A 3GW0A 3KRZA 1E4NA 4GUHA 3W6LA 4PC8A 4PN2A 2PGWA 3K1DA 1FP9A 4MGGA 4J2PA 2YJQA 3P8JA 2PD9A 3UPMA 1N55A 1JAKA 4RLIA 1PB0A 3UD6A 4WDUA 1LT7A 1XLIA 4RKAA 1E6NA 2ANUA 1VS1A 1RJQA 1J4EA 2W61A 5DX7A 1VFLA 5JQ9A 1IEQA 1M7JA 3HF3A 3POCA 1TMLA 4DO4A 2PDHA 4AEOA 3F7JA 1CCWB 3AIQA 1S2WA 1ZHAA 4HSHA 2VFEA 1YHTA 3UG3A 1FA2A 3R8GA 4NI3A 5TD4A 3UG5A 4OJYA 1MNZA 1SW3A 2D2GA 3PF3A 4PMZA 2DSWA 3WH6A 5GNXA 2HISA 3CT2A 4QSFA 4HGXA 3LS9A 2J7EA 4MWAE 5JIPA 3AHYA 2DPEA 3M44A 3G1SA 3FVMA 1SO5A 1MI3A 3MB9A 1E73M 3OZOA 3OEXA 3RPTA 1LDCA 4L64A 4QFUA 2WKLA 4US5A 1V79A 3LK6A 3GU2A 4NJIA 4E6MA 1R9ZA 1A5OC 2G3NA 3ENLA 1Q13A 5DRIA 4AD4A 4X60A 4REQA 1E6RA 1F3XA 1M68A 3BJTA 3P3BA 2PU0A 2PLCA 5D05A 4O1BA 1PDYA 2ISFA 2X1IA 3PS7A 4WIWA 2R14A 5TF0A 3E96A 3TSBA 4V33A 1ZJAA 4UFJA 3T0BA 2XZ7A 2FPTA 1GEHA 1UWQA 4H9UA 5A6KA 3EEGA 3GLCA 3ZYZA 5L9FA 4GC3A 3AI0A 1TA3B 3U5YA 1M01A 3HG2A 4C1NA 2FZBA 2GQAA 2V5DA 1XR2A 4HA3A 2NSOA 3AMLA 1JPIA 2NSXA 2A7PA 3QV9A 1C7TA 1HGYA 1J01A 4DI8A 5A2CA 3NVTA 4AF0A 1PYFA 6REQB 2VKZG 1PS9A 3A21A 1C29A 3AOFA 3ITTA 4UTWC 4JHZA 1OCQA 4Y9PA 5DMYA 2HS8A 1DEDA 4H6EA 3TDFA 2HXUA 1XCWA 3EPNA 4I3GA 4R53A 1GJPA 2PC8A 3AALA 1US0A 1EA0A 3VOFA 2PDXA 4MWAC 3SUSA 3QQ1A 1WKYA 2DV0A 1V6WA 1Q85A 1EGZA 2AQWA 1FCQA 4D71A 5I07A 4M7SA 4TX6A 2GQ9A 1F3TA 3THCA 2EG6A 5CEWA 4H9ZA 5JMUA 3TCSA 3VABA 3WBEA 3PC0A 2AKMA 1QHPA 2VC7A 1UUQA 1I8JA 3BZJA 4W8AA 3AQUA 3W1LA 3SM0A 5DCDA 4A3RA 3HQNA 1MNSA 3IWPA 4RK8A 3ITVA 3WH5A 4OECA 3T4CA 2FVKA 2H9AA 4MF4A 2D73A 4C6CA 5MKGB 4H6QA 3W1NA 4XZLX 4E8CA 4B9ZA 3GG0A 2GUUA 1EH9A 3AIEA 3HPSA 1KC7A 3CH0A 2BOEX 4MB4A 2CXGA 2OKTA 1ISVA 3VKJA 1VCFA 2E9BA 3SB0A 1LL7A 4HJFA 3R0UA 3VD7A 3THDA 3IGHX 3L9CA 1R47A 2XTKA 2NWSA 4XD4A 6REQA 1NVMA 4JL1A 2X7WA 3B04A 1MMFA 5CZJA 3UG8A 1U5JA 4DPQA 4ZFMA 2QUTA 5KSWA 5JH1A 1BXNA 5FA5A 3JVAA 5FOOA 1T6MA 4HA0A 4JN6A 3QMRA 2RFGA 3PZMA 1QO2A 1CNVA 3GVGA 4ACZA 4GZJA 2HK1A 4B2DD 2X0HA 4H41A 4KIRA 1H11A 2J7DA 3GVQA 4DJFC 2PWDA 4FAMA 3QC0A 1OSEA 4MWAD 2ATSA 4DF0A 3SGZA 3RDKA 4TVCA 8RUCA 4CNTA 4HZMA 4LS1A 3VAVA 4P8VA 2WXDM 1I0BA 1FY6A 3M5YA 4HNCA 1Q8JA 5AHEA 4O0QA 1R7AA 2J9XA 2ATMA 2NX1A 1XIIA 4MZYA 1P7TA 1V03A 1K7XA 1ZNNA 2D69A 5JXQA 3BQ6A 3M1ZA 1PZ0A 3AS0A 4C6IA 4LVAA 3QSTA 1B5TA 7A3HA 3WEOA 1TIMA 1HF6A 5AC4A 1BXBA 2P88A 4JQ1A 4PB4A 3VIKA 4GJIA 4CD6A 2V63A 1EJ7L 8A3HA 3P6LA 3E0IA 5D4YA 4HU3A 3QVQA 1IR2A 2VRKA 4AX6A 3PBUA 4BF9A 3DESA 2WC3A 3M46A 2YSWA 5LXEA 3B40A 3HPFA 2BG5A 1QCWA 1Q4WA 4WJXA 4X61A 4JKLA 3CHCA 4PBFA 4CKQA 1TJRA 1BGAA 4P7NA 3Q37A 1JI2A 1EZWA 2BNJA 4NQ1A 2J7FA 3MP5A 2RAGA 5I09A 1U22A 3NPWA 1V77A 2WC7A 4JTLA 5I3HA 1XSIA 2GUBA 1JPDX 2JGQA 4U3CA 4WD0A 4O1AA 4DJFD 2C1GA 4YL2A 1EC9A 2DT2A 3EKGA 4N2YA 1CGVA 1JI1A 3CEUA 1GYLA 2E40A 4IMEA 1D8CA 1WDWA 4DUVA 5BU9A 3ELFA 2ICSA 3F5LA 1Q65A 1M7XA 1I9CB 3AIWA 4JFTA 4JR5A 3VE9A 4A8NA 2QAPA 5DMMA 1X39A 2D0GA 2REQB 1AW5A 1QDSA 3M47A 2A6NA 2PDKA 5CZTA 4PMNA 2CHNA 1VBUA 3AZRA 5CSRA 2FPYA 4MDOA 3WX7A 2EPHA 2EKCA 3VNJA 2OZ8A 1EOKA 2A2IA 2OU4A 3NQEA 1BRLB 1VFSA 1F74A 1N2VA 3ABQA 3H7UA 3KOFA 4U31A 3LTPA 4YYCA 2XSAA 9XIAA 4JTUA 2ZX8A 1L8NA 2E0PA 3FK4A 1I2QA 3BLEA 2AOSA 2WV8A 4ZGYA 3SUUA 4CVWA 1WUFA 1FWRA 4UQBA 3NIYA 2HPIA 2IPFA 3N2CA 4WKAA 2XG9A 3R8RA 1YXCA 3ATZA 3N29A 2OLHA 1S5TA 5LNRA 4HPJA 3RCYA 4ZE4A 1FWDC 4Z2JA 4AC1X 1IIGA 2QJHA 3L65A 3UWQA 4CLMA 1PL9A 4M82A 2ZZ1A 1RHCA 1X6UA 3QZ6A 5LIXX 3NO1A 3QOKA 3W84A 3W7EA 4QJ3B 4DO6A 4PFMA 5T9CE 1FUYA 1RBOB 2DORA 2P50A 4D8AA 5HWMA 3OPSA 2Z1SA 4PCSA 2WMKA 4HTYA 4P7RA 4BWLC 2UV8G 4V28A 3ARYA 3TYEA 4QSHA 1BVWA 3H2OA 1B57A 1TB3A 1VHNA 3O63A 4WY0F 1BRLA 1J5TA 2XINA 3EBVA 3M5XA 5IOBA 2FTWA 1IXOA 5KZEA 5CPQA 1VPQA 2F2HA 2DZTA 1WXZA 1QI4A 2BOGX 1W56A 2ZDSA 2RJHA 3TFCA 1RQBA 4DWSA 2G41A 1EZ2A 3E38A 3ZR4A 4DM1A 1HQTA 4AWEA 1GPFA 6ENLA 3WJWA 4X2PA 3LXBA 2WMJA 3G77A 5EKYA 3W70A 1YXYA 2Y7FA 1YIXA 2QDGA 4HP5A 5A6AA 3N2TA 1J6PA 1Q7QA 3W7MA 1RSCA 4ZO8A 5BW6A 1FXQA 1GKQA 5G4EA 2VEKA 1MW0A 4ZCWA 1VIZA 2DSVA 4PEEA 5FCZA 3P14A 3WNMA 3UNTA 1PJ9A 4RZ5A 3LN3A 1I1WA 2VGIA 2ZFAA 3LD5A 2PGEA 3O15A 3GHTA 1KM1A 5D38A 3U57A 3W7DA 3M0YA 3NNTA 1PZ3A 4XBKA 4IIFA 3GTNA 4MPQA 3DFOA 3S9YA 1IWAA 4GK8A 1LQ0A 4E0CA 1SJBA 2X09A 1KFBA 3H53A 1FWWA 3EOLA 1DKWA 2WMHA 1E9YB 5DBUA 4R7JA 1BQGA 4UQCA 1XIBA 4LS0A 3LY0A 1WB0A 1V08A 4W8BA 4IQLA 4F0LA 4LS2A 2WLYA 3B4UA 3WZ0E 1O4UA 3W26A 1OX5A 2D24A 3OIXA 3HG3A 4O10A 3S3GA 3WMCA 1OF8A 2C1IA 4E2DA 1VKFA 3T05A 3UFYA 4MDPA 5IDZA 2PPGA 1MZHA 5H6HA 3FAXA 3NL2A 4GO9A 3BW2A 1MEHA 1BYCA 3GIPA 3QMTA 4JHMA 1F4HA 1B31A 1FCVA 2JKPA 4D6JA 3KTSA 3VNKA 4MIMA 1PWLA 3G0SA 4S3KA 5HOSA 3S4TA 3I4KA 1NDZA 2Z1BA 1MDRA 1C92A 4IL0A 1RCQA 4Q8UA 3I65A 1TV8A 5HQMA 1HKMA 3ANUA 1YNYA 4J4KA 1YNPA 4HN4A 5D2WA 3UPWA 1G01A 3MY9A 4I90A 3LZ5A 2D0HA 2PB1A 4IG2B 2NLYA 1JZ7A 1DE6A 2QJMA 3OYXA 3BW3A 1O12A 1UKTA 1O5KA 1XI3A 1QJWA 3IIXA 3WH7A 3N3TA 3E0FA 1KNWA 4K36A 2X40A 4MUZA 1UR0A 3MUXA 1SW0A 2DVUA 5ABFB 1OFAA 3ITOA 3CH9A 1BWKA 2ZZ4A 3KHJA 3PUGA 1OC7A 1ITQA 4IJRA 3CTLA 1FHVA 5FJPA 3UY8A 1IXQA 1XUUA 4Z2KA 3CL7A 2WM0A 3EB4A 3QHMA 5F2GA 4UTMA 3PZUA 2V5BA 4OVXA 2PRMA 2R9RA 2RUSA 5IHSA 1E3XA 2H6RA 1V02E 4YTUA 1TE1A 1F05A 3L23A 3P7YA 1XYCA 1EBHA 3H7VA 1AJ2A 3PPCA 1OK6A 1CTNA 1AJ0A 2PFHA 3LB0A 1O94A 2WQPA 3HQPA 3GNNA 1UPPA 4XTDA 4HHHA 5H8UA 3MT1A 3ZT5A 5E09A 4KRUA 2JK2A 2XJ7A 1QBAA 1VPYA 4M51A 1KM3A 4X22A 3CQKA 3GDMA 1P0EA 3SCNA 1F9CA 3EPMA 5U4NA 2JALA 1DQWA 3GG1A 1K9DA 3FJ4A 3U2ZA 1SR0A 2G97A 3HFYA 3GXPA 2WMIA 4E4FA 1PPIA 1IEIA 1RJPA 4X9SA 1X6LA 4OHQA 4XZWA 3MHFA 4GY0A 3DFQA 3PAOA 1T40A 2CFFA 1WYIA 2VT0A 4O1EA 4KW2A 2GJXA 3RU6A 4P7LA 1KCZA 4IFRA 4NIRA 1MQQA 4LB3A 1GOKA 4IFOA 3IV3A 4KESA 5HNRA 5BCAA 4RV8A 4RUBA 3POHA 1QAPA 3NQFA 4CN4A 5CH9A 1EYEA 3KS6A 1TFVA 1UCWA 2VTFA 1D3GA 1F3WA 4KEMA 3WH8A 1V6UA 3RPDA 1ZL1A 1R46A 3O6YX 1AMKA 4R33A 3XINA 2FB3A 4XZIA 4WZHA 1UD5A 3GIYA 4PTMA 2X0SA 2VL4A 3KAOA 4XVEA 2B7PA 1LUCB 3B9DA 2I9EA 3RR4A 2YFOA 3TROA 3WFAA 1PWMA 3S1UA 3RILA 4HNLA 1KM5A 2ZUSA 4OQVA 4M3PA 2PDIA 2BGSA 4TO8A 4TIMA 4IP7A 2ZTKA 4Q7IA 1P6WA 3HTWA 4WDXA 4OKDA 4U4MA 3FOKA 4D2JA 2QV5A 3ARTA 2P0OA 1VFOA 4S3GA 1Q8AA 3WLOA 4HZ6A 5F2MA 3CT7A 4ATLA 4UZUA 3BPWA 2OKOA 4XD5A 4Q4QA 1WCGA 3FA3A 4KRZA 3JUGA 4XBSA 4DBSA 5CQ1A 1PZ2A 4GVGA 2F61A 5HJLA 3GHRA 3OIHA 2J7GA 1F73A 1EX5A 2Y85A 3NQ7A 2VX4A 2ZADA 4DY1A 3SZ8A 1NDWA 4PUKA 2G4FA 3P67A 4CN1A 5I2UA 1GUVA 3ORWA 3CYJA 4WRHA 5A5WA 5A2AA 1UC5A 2VMFA 4ICNA 4HHMA 2WK2A 2A7NA 1W0MA 2CWNA 5AYZA 1ZPTA 3VDGA 3N25A 2Y5JA 1U5HA 1QNQA 2J8FA 1WKEA 4OOUA 2ZRUA 2PZ0A 1ELSA 3HG4A 1U5VA 4EACA 5BXRA 5I77A 2QPXA 1SFTA 3EB2A 4HG6B 2XWDA 1OZMA 3RLGA 3A3XA 3PZIA 4LYRA 4GJJA 1LWHA 3TKFA 4DJEC 2O7SA 5K7JA 1IEWA 5CGQA 2ABAA 3B8IA 2Z28A 3PULA 2POZA 1E9ZB 3WQOA 2E3ZA 4NJJA 1V0NA 2EEXA 4L1WA 1CB7B 3IV8A 1HKIA 1HO4A 3LQLA 4BI5A 1A80A 4E5TA 3L4ZA 3DI1A 1T5AA 4J27A 4NJKA 3LOTA 1MUWA 3W7PA 2UZ9A 2YBVA 2Y5SA 3QC3A 2X1TA 1M65A 1EDTA 3MUZ1 1EJUC 2VVNA 1JCYA 3C2VA 4H8HA 2Z27A 5LIYX 1AK5A 4HNNA 3EOEA 3SCQA 5I06A 4UFHA 1ZENA 2Y7GA 2W5FA 1GVQA 4R7WA 4AWSA 1OEPA 4B3KA 3KUMA 5A3HA 4XV0A 1TPB1 2GZXA 4CGTA 1A53A 1P6BA 4BI7A 3CZJA 4WJEA 1EEXA 3W7HA 5DANA 1W1PA 3KX6A 2PRLA 3WQ6A 1XIHA 1LL4A 3DEQA 3D47A 4G9PA 3KP0A 4PMOA 4LB4A 1EL3A 1UZ4A 1OT1A 2HXTA 2FZNA 4GXMA 1XLCA 1OFDA 2OR2A 1XISA 2IQ0A 5AC7A 1WKDA 3IK2A 4J3SA 4N42A 2ZC1A 4X9YA 4AZ7A 5FF0A 4LOCA 4DUWA 3U4AA 3ARUA 1JRBA 2NUYA 2VWTA 1Q6LA 4DJED 3CHFA 4WSJA 3KBWA 3EX3A 4NG3A 3I6RA 3W7QA 2WKJA 4BFAA 4P8WA 3MJMA 3NZ1A 1OFBA 3L4VA 1EXBA 3MP3A 1R85A 3IIVA 3TJLA 4HPXA 1KV8A 4AY8A 5FF7A 3T8LA 3QRHA 1DJWA 2ZA2A 3IJ7A 2ZDRA 3N17A 1EGMA 4GABA 3S2CA 2E9LA 4I9TA 3BMWA 5BRPA 3OO2A 4MADA 3GNPA 2J66A 3LEPA 2AL2B 4M0XA 4ZO6A 2OWWA 1WXYA 2WPGA 3B06A 3G0XA 3HJEA 2R1NA 3PVFA 3W72A 1MO0A 2DU2A 2V69A 4DYKA 4R7OA 3R13A 3PB2A 5BROA 4UCFA 4C7FA 3LLXA 4ZODA 1FP8A 1XIFA 3N6HA 1XX1A 2VFFA 3TTOA 2B0MA 4GQ0A 3VOIA 4QDMA 4AVOA 1EUNA 1W3LA 3VD4A 3AMCA 3S1GA 4GKTA 2YLAA 3B9AA 4UFLA 3IVUA 5DEZA 5H1WA 3CIXA 3G1VA 3VTRA 2YPIA 1IYXA 3C86A 1S38A 5TAOA 4DBUA 4KGJA 2XSXA 3QQ0A 3C2EA 4AHPA 2OT1A 3Q2DA 3QW3A 3O2LA 1I2OA 3GVVA 3XIMA 1J0IA 2Z7KA 2XYLA 1GONA 2BP1A 1KO0A 5CPOA 3CGTA 3KBSA 1UP3A 3CWOX 3OHIA 1XIMA 2WPBA 2MUCA 3NZRA 4CCZA 1UR4A 4X0NA 2HVOA 3UWVA 1KB3A 3W1UA 2V38A 1EP1A 2XVPA 3WJSA 4FR1A 2NLIA 1JDCA 3E2VA 2WVVB 4YMZA 3BMXA 2W0UA 3FKRA 1EWEA 3AAMA 5G4HC 4XB3A 3DH7A 3L21A 1XHGA 4Q8TA 1KKOA 4BZYA 1VLIA 3ZSSA 3T6CA 4PMYA 1IR1A 1R2RA 3T0DA 4LBSA 3QTGA 3VGGA 4AZBA 1CLVA 4L6HA 3GH4A 3G1AA 4JTSA 3A9BA 1JVNA 4DUXA 1UH4A 4KH2A 3TP4A 4UFMA 2WM1A 3AXMA 3HMJG 3GUGA 3TTYA 4F0SA 1H09A 3PZNA 3TSMA 1C90A 1UKPA 4QP0A 3F4CA 2ADAA 3DG3A 3UYIA 4Q4MA 4AH7A 3IJ6A 3LUTA 4HKPA 2PBGA 3M41A 4UOQA 4O19A 3SY5A 5M17A 6PTDA 3BSHA 2GOKA 1WZLA 2INZA 1REQB 4LFYA 3N4FA 4JTEA 3BLKA 3CEPA 3KWXA 1C9DA 1SMAA 2B81A 4EAMA 1L6WA 3UR2A 1G0CA 1WUEA 3P0WA 2DZBA 3VD9A 3AU6A 3B9OA 4MY9A 2HVNA 3CIVA 1TJ1A 5REQB 4GYPA 3U7BA 1XINA 3GVRA 3RX4A 3FEMA 4QCFA 1LL6A 2E6AA 4DI9A 4QQUA 2QR6A 4NXSA 1EHAA 3DGBA 2FKPA 2FLIA 3TOYA 4WR3A 1RVKA 1WDRA 3OLIA 5FJRA 4JTGA 1TMQA 4F2BA 1W9VA 1CBGA 1DE5A 3UZZA 4BA0A 1O60A 2VFHA 5IDIA 1H60A 4O52A 5FKYA 1UQZA 4MTVA 4PUDA 1TO3A 4HPHA 1BF6A 3G8RA 3WYZA 3SUWA 4OUIA 3CWHA 4UMCA 3KRUA 4IMCA 4DPPA 2QMJA 1F6KA 3WQPA 3A4AA 1E1FA 3EWYA 2XIBA 4ADSA 3MW7A 3V16A 5CLWA 3M6YA 1HJXA 3VOCA 4AX7A 3IJIA 4YCOA 2ABBA 4AQLA 3GB6A 3W2LA 3WDJA 3KDOA 4GY7A 3H4GA 1DYSA 4RXGA 2O55A 3BG5A 2XUCA 5C0QA 1ZFJA 3UJFA 2EF9A 1W17A 1OK4A 3DHPA 2WAGA 4H9XA 1YXDA 2G3IA 5DY2A 3NVDA 2C13A 4MAVA 5CBIA 1DV7A 1KFEA 4HPGA 3AHVA 5I78A 3DI0A 4G1NA 5I24A 3GDBA 2GJRA 3MMUA 1LWIA 3WUEA 2HTMA 1FWJC 4UQAA 3N04A 3TE9A 3LG3A 1U1UA 3ARQA 5EMMA 2VD8A 4I7WA 1KLYA 9XIMA 3EAUA 1M9HA 1QR7A 1AQHA 1W1A1 1XIEA 5DF0A 1LRQA 1KXTA 2Z2AA 1ME7A 2OYMA 1HP4A 1XGEA 1XRTA 1ZS2A 1NWTA 1B90A 2HWGA 3BJFA 2E68A 4IPJA 1FVPA 1ZY9A 2TMDA 1E1CA 1MRAA 1BGGA 3BCJA 3CMFA 3FSTA 1TPWA 2OMAA 2YX0A 1PX3A 3FIGA 3WMBA 3MYPA 3DFNA 1D2KA 2VI0A 3A6OA 1QW8A 1H2JA 3RJXA 1S46A 5JU6A 3U9IA 4D6EA 4E2VA 4OBSA 2ZUUA 1MZRA 2D22A 1K9EA 4HNOA 1JFXA 4JZ5A 3H2CA 4O14A 4FOKA 4Q8WA 2C15A 3CUFA 3TTEA 3V7PA 2CKRA 5E0KA 3KE0A 2WHMA 4JEJA 4YN5A 3WF3A 3LI1A 2YBUA 3VILA 4GKLA 2W27A 5FJOA 3KCOA 2F6XA 2BLEA 1UJQA 4PUUA 3HQ1A 1VH7A 2IQTA 2G3FA 2VVSA 3NOEA 3O6AA 3P62A 4IPPA 5U7SA 2XVLA 3CQJA 2PTZA 1NDYA 3H8AA 3R43A 3PG9A 4M80A 5D02A 1O1HA 1Y7VA 3EWUA 2WSYA 4GIRA 4Z17A 1XPGA 2P3EA 2FPVA 4RNFA 3LV5A 4DXXA 3W1XA 1XD0A 2P0IA 3PZVA 4Q7BA 2GGHA 1QHZA 2V5LA 2YA2A 5I03A 4XZ9A 5A8GA 1E0VA 3OVGA 4CD5A 1EIBA 3M7WA 3L5LA 2VOTA 3FJNA 2J4GA 3CB8A 1MEIA 3LHTA 4ZVJA 1QBBA 1XQLA 4JFWA 3HA1A 2HPMA 3FGCA 5AFDA 4F79A 2VOMA 2A3HA 1Y5WA 1GW9A 2RGMA 3AS1A 3N2XA 1ZCCA 3SECA 2CLFA 3K5XA 3RO6A 5M5DA 4BS0A 3RRAA 2MNRA 1F6YA 2MANA 3PUEA 1FCBA 2QLYA 1DTUA 3QY6A 4HOZA 4DNMA 4I6KA 1J0YA 1W9XA 3D0CA 1XYAA 3ZJ8A 3VDBA 3W74A 4HU4A 2BXVA 3D6NA 2O9RA 1H7PA 4H2HA 3EWBX 1XJBA 1NOUA 3AXXA 4A2SA 1JYNA 3W86A 1EDGA 2E7FA 1LG2A 3A24A 4H00A 3ZJ6A 4XZHA 1XF0A 3GH7A 4LC8A 3WDPP 1HT6A 4GGHA 3PTQA 2HEJA 2DT3A 4WOZA 3R89A 1P43A 3P60A 4H7CA 4ERIA 1OFRA 1FFRA 1CGTA 1SJAA 4A2RA 1US2A 3M5ZA 3WMSA 2VC9A 2QAFA 2TSYA 3A22A 1H49A 1TPFA 1A5LC 4J3TA 4JY9A 1XM3A 4FXSA 2AAAA 4R3UA 4WK9A 1VFFA 3F1QA 4KCVA 3IJ8A 3KZPA 2NQLA 1G4EA 4NILA 2VENA 1XLGA 3HMCA 3NAVA 4R34A 4BEUA 4JTHA 1XRFA 1KGWA 1NEYA 4N02A 1NQKA 2GGGA 3VCNA 1IXNA 3EDJA 2OT0A 4PUWA 4LUTB 2YDSA 1TTIA 1XLEA 2BVDA 3L0GA 3VU2A 2RDXA 1X1ZA 4MNMA 4PBGA 5JVLA 3SCRA 3TC7A 1R2TA 1W1ZA 1J2WA 1K02A 3KHDA 3UJRA 1RR2A 4H9VA 2JQXA 3WLJA 1A5CA 1F7BA 4MKNA 3WY1A 4JTTA 2OG9A 3JZUA 1EO5A 4A3YA 3U2CA 2PDJA 1BF2A 2EHHA 3TW6A 3W7NA 3TYDA 2ZA1A 4IMFA 2UY4A 1L6FA 2ASHA 2FZ8A 4GWEA 4A35A 5K9CA 1OIFA 1YE6A 3UF9A 3NO5A 4XO7A 4KPLA 4BEQA 6XIMA 5HA7A 3ABSA 4GI4A 1CGUA 3L2IA 3I6TA 4HOXA 1ESWA 2JF6A 4L7ZA 5JBEA 5TNVA 4GQBA 3M4HA 5DRCA 2A5HA 1L8PA 2HNHA 4TVUA 4AG0A 4NUWA 2Q3RA 1OX4B 5D9MA 3QFWA 4M1BA 1E55A 1JIBA 1FQ0A 4DZAA 3DUGA 3AYRA 4EKJA 4Z0SA 2F6KA 1W3JA 2ZXQA 2I9UA 4LGXA 3WLQA 1TYGA 2WCGA 4GISA 3I68A 5FEPA 1XKYA 3P80A 1KRBC 2J27A 3IEBA 4IWWA 1KBKA 3ARXA 2DSZA 3KBMA 1FHDA 3LGDA 1PIFA 4UNLA 3KDNA 4DM2A 1S3TC 1KM6A 3V3WA 3VKBA 4E4UA 3GC2A 2BWGA 5LHFA 1VC4A 1I4NA 4FALA 1ISXA 1XBZA 3E0LA 2ZRVA 2KZHA 3R4IA 4D8ZA 3ZVHA 3PBWA 1M03A 1S39A 3DYOA 3NJ3A 5B80A 1JRCA 1PE1A 5GJNA 1P48A 6ALDA 2QCMA 1H41A 4QISA 1WPCA 2YCEA 3N3MA 1UR8A 3CMJA 3GXMA 2BX7A 4HMCA 3HV9A 1EP3A 3KOYA 2WMGA 1K6AA 2JKAA 2FZDA 3WL1A 3E5PA 4AMAA 3SCSA 4HT3A 2WOQA 3PTDA 4AHOA 3K8KA 4MWAA 2QQ6A 2FFIA 3U7VA 3RK8A 5A8QA 1WDDA 3TC6A 3CL8A 4A29A 3VKCA 3WLPA 4P5UA 2CU0A 1V8EA 1PVNA 3VOHA 2J13A 2JFEX 1H7XA 3EMZA 3N15A 3FLUA 3VIOA 5BZAA 3W25A 4GO8A 4LAOA 3CV2A 4B4FA 2QS8A 1VR6A 1NFBA 1VYPX 2H8XA 2WNQA 4QDWA 3GX9A 4ADUA 4H9YA 4MB1A 1I1XA 3WD3A 3WO8A 1ODUA 1YQ2A 3GDLA 3QPEA 5HANA 4UTTA 1LJYA 2F9RA 4KGLA 4P8UA 3R8HA 4A21A 3GZAA 4U2YA 3CUHA 1I45A 3SFKA 4GUFA 2Q01A 3SSZA 1SVDA 4JNYA 3CUIA 4O0KA 2JE8A 2QDDA 2PP3A 1SFSA 3VCCA 5LA0A 5CJMA 3W2MA 2PDLA 1UB3A 4WUIA 3FCPA 1ZSXA 4H19A 4P02B 3WJZA 3U4FA 3P5YA 3W87A 3GHSA 5I6SA 3BOFA 4BF5A 1DIEA 3R7MA 1XG4A 4DJDD 2ZZ2A 4DJFA 1VJSA 4QE1A 4LAKA 4OV9A 5CAKA 4IJBA 2X30A 3REQB 4LVBA 4YIWA 2E8ZA 1EXPA 4WDTA 3C61A 3IGUA 1MSSA 3S5ZA 1XBYA 5M3WA 4FX7A 3U48A 3W2NA 1TRIA 1NQ6A 2DUZA 5DLCA 4LU0A 1UW9A 2Z00A 3PJTA 3LPOA 1WV2A 1XCFA 1MEWA 3DHDA 3M0HA 1HJVA 1NF7A 1SO3A 4TV5A 5GPRA 3MVTA 4FK9A 5AKQA 2V3FA 4KS0A 3GXTA 3K1GA 3SFWA 3EX6A 2ZIDA 1U2YA 3WLMA 3CUXA 2IKIA 5CLTA 4P2VA 3THUA 4L9ZA 1MXSA 2XM1A 3RM8A 1C8VA 1D3HA 1V3MA 3FJ6A 5C9WA 2G0WA 2PDMA 2NQ9A 1JEZA 4YNGA 2D0FA 2WZMA 4QE5A 4EANA 1ITXA 2E77A 2NZLA 3GE7A 3MO7A 2NV2A 1TTPA 5M1TA 5I00A 3WD1A 4OIFA 3RG6A 1GOIA 2NT1A 4IP4A 1KFCA 2DVXA 1E72M 3DHUA 2ZYFA 4QLJA 4CNOA 3ECQA 1DJXA 5LZLA 3RHGA 1Q2SA 4AIEA 3GYCA 4EIVA 1F8MA 1J0JA 1GVYA 3AO0A 3KLKA 4QS5A 4IP5A 3VOJA 3KL5A 2VR5A 3W7KA 4H2CA 4AVFA 3STEA 4AU0A 4U10A 1SJDA 1V3LA 4NYUA 3W7IA 2VEFA 2QPUA 2CXEA 3OG3A 1LROA 4HB7A 3HPAA 2CHOA 4ZA0A 1YLVA 2VQTA 1QWGA 2DP3A 4B5VA 2ZZ6A 3L2MA 3FN9A 3LHUA 2OO0A 4ENLA 2JBMA 3BCDA 2I16A 3LRLA 1CWYA 5A69A 4AZCB 1XFBA 1OC6A 3RX3A 2RDTA 4M19A 3CAQA 1FRBA 2ZXDA 4B5UA 4J3ZA 1ONXA 3GFYA 5EMLA 3SJ3A 3UR8A 1LORA 3QH2A 2ZVRA 3IIPA 5CC5A 4WHBA 1LQAA 3DU0A 2GYIA 2GVEA 2YFNA 1W9DM 2XN1A 3A9IA 2FTYA 4HPNA 4IISA 4ZOAA 2OODA 4O18A 1C3FA 3MQTA 3R10A 2HVMA 4Q6JA 3VYLA 1PX8A 4NZJA 3WK1A 1JFHA 1FH7A 5A95A 3GS6A 3PFRA 3GR7A 4DLFA 3C0LA 3NXFA 3TQ0A 4C5YA 3H70A 2AQVA 4BWLA 1W1B1 2BODX 2HCVA 2PDBA 4QITA 2V3GA 4A3QA 4K7VA 3IVTA 3N11A 4UCGA 2O9OA 2C18A 3SADA 2WLZA 3VMPA 2A79A 5C2GA 1AVAA 4AY7A 3L4XA 1ZCOA 2QT3A 1E5JA 3IRSA 3VD5A 3ANVA 5J5DA 3LPFA 3RITA 3LHYA 1XLDA 1PKNA 4WF7A 1YPIA 4QDPA 3M0JA 3JZEA 4IQEA 1DWHM 4GNJA 2ZOXA 1QW9A 5AYXA 1GG0A 3LLDA 2GVLA 5A6LA 1SO4A 1XLBA 1T7LA 4P00B 3BK0A 2QVNA 3RM4A 1XYBA 1QWKA 2CW6A 2JIEA 2ZICA 1BYAA 4DF2A 3BLIA 3SRFA 4GQRA 3S1VA 2CPUA 5EPDA 1RPXA 2PURA 1R3RA 4AD1A 1HO1A 3EWZA 1H5VA 3P61A 5JUVA 2C0AA 2EPLX 1XH1A 3KCJA 2TYSA 4FA3A 3A3WA 4IOTA 4PBEA 1AH0A 3WDIA 1JF5A 2PMQA 1PUDA 3ZVIA 4JTRA 3DN5A 4GFIA 1B4EA 5C71A 2QF7A 2OX4A 3LHVA 4YXGA 3Q45A 3WNPA 4YJ5A 4W9TA 3TONA 4M6PA 1TR9A 2OZTA 4W93A 4X3ZA 1CT5A 4LEFA 5KTLA 2Z1KA 3WNNA 1SR9A 4FF5A 1XDJA 3MKKA 4RE2A 4MLRA 3P81A 3ARZA 5CSUA 3UQNA 3HZ3A 4WCJA 2Q3OA 4CQCA 5D9NA 2ZE0A 3C0JA 2CLOA 5HNUA 2OEMA 1Q7ZA 5E6ZA 3W29A 5I3FA 1GW1A 3WNOA 1M53A 4O4VA 2GJNA 1OFQA 2OGJA 4NZCA 1JGIA 3LCFA 3TN3A 2WANA 1KFJA 3H2AA 4YWSA 4N7QA 3NR0A 3CO4A 1W3NA 4ZO7A 3E49A 4LT9A 3BAXA 1P1XA 3K13A 7REQA 4LRTA 3LU2A 3WG6A 2CZEA 3B97A 4PULA 3L4WA 1Q6RA 3EOSA 4JTCA 3M9YA 1A5AA 6A3HA 3LI0A 1CX9A 3C4UA 3OBAA 2I5GA 1CXEA 1BXCA 4CD8A 3CQHA 4HTBA 5HMSA 1NOWA 2WW5A 4IXHA 3TMQA 2I5IA 1W2VA 5FEXA 2IXUA 3W28A 4D6HA 3KTXA 1XLLA 3TYAA 5BRQA 3HN3A 4PYSA 2FYMA 4KCUA 2OFJA 4PMDA 2WBKA 2W66A 4ADTA 3A4JA 3URQA 1GHRA 1IEXA 1SW7A 4MNKA 4PCNA 2Z1VA 3H24A 3W82A 1F4AA 2F2KA 4B91A 1S5VA 4Q4SA 1XW8A 2OTDA 3NYDA 3BGAA 3S46A 5EBUA 2X2YA 1OHLA 2A0NA 1BSLA 1KBIA 1UKSA 1HL2A 5HMDA 1YX1A 2XGBA 4DX3A 2DDXA 2QJGA 3GNDA 1B3YA 2EPOA 3NEHA 4MB5A 4LAZA 1BQCA 1H7OA 3LENA 4ZB2A 4ZXLA 1A47A 3R6IA 1MFVA 3TXVA 1POKA 4M56A 3VDCA 1S3HA 3FHQA 3TH6A 1GVRA 3SGGA 3QEZA 1H7RA 4TR9A 3EKZA 4PB3A 2WZIA 5JBFA 1GJWA 3OGSA 4S23A 4Q8PA 1XLFA 1WAUA 3MSGA 4NYYA 5T9BG 4AC7C 3PUDA 1SM9A 2E67A 4J3WA 1XYFA 4TQTA 4V27A 2V3DA 1E4MM 5C8BB 1BPLB 4Q7NA 4AISA 3GXIA 4CD4A 4H3DA 1TQXA 5KINA 4DNHA 4RE0A 3MWCA 4IIEA 4LRSA 3FYPA 2IQDA 1H7WA 2DZPA 4K3ZA 4E2BA 1OX6A 1VHCA 3ZLHA 1PX4A 3UT0A 1TWWA 2ZBTA 2Y6ZA 4ZQRA 3B8DA 1KRCC 3VZYA 2V8ZA 3N73A 2AQOA 3H26A 3R12A 3LCXA 3T2PA 7ODCA 2YOCA 2WHKA 4ZB0A 2I7GA 5DN1A 2A3EA 2YDQA 3PM6A 5C9ZA 1YEYA 4ORMA 3WLHA 1Z48A 5CC7A 3MSDA 1NWSA 2Z2UA 3TZFA 4QNWA 1FHUA 5DQPA 1O95A 3B9EA 3RXZA 4L56A 3CPGA 1V02A 3W53A 4PR4A 4F0HA 2O9TA 4LF1A 1OIMA 3SI9A 2FH8A 4ZBCA 4S38A 4XISA 3G18A 3KWSA 2YL8A 3MKCA 5K2ZA 4B5SA 1EIXA 4BQ5A 1DWIM 1SZNA 3THQA 4WX2A 1Z8AA 4M8UA 2VUNA 1GQJA 5FESA 1QXLA 3E9AA 3AXHA 3O6CA 4A8IA 2GFTA 3C2OA 3R25A 3WK3A 1Y5XA 1KM2A 1UD3A 3BAJA 2VGFA 3UA4A 1MFUA 3S6DA 4DLMA 1VYRA 4TOQA 2PE4A 3IS4A 4XKYB 4XSLA 2BY2A 3VIMA 1TE6A 2CWXA 4UC5A 3AC0A 1RA0A 1K77A 1JZ6A 3UNDA 3URAA 1VEOA 2X1UA 3GDKA 1B1YA 1ECEA 4F2TA 3KVKA 5E0FA 2Y63A 4BY3A 5IRPA 4UTUA 4GI9A 4PCFA 1C9WA 3COTA 3VUPA 2CEQA 2QNEA 1UBPC 1C93A 4BQ2A 5JIWA 2CBIA 1IT8A 4F3HA 2VD9A 5G2HA 3O9NA 2Q09A 2CITA 1AA1B 2QZRA 2WQDA 3GZ3A 3QR1A 6TAAA 5BRBA 1JYXA 4PMQA 4AZ5A 4HK5A 2BTMA 1R8LA 1H5YA 1E9IA 3SURA 1CDGA 1VQTA 3A23A 4WXYA 2HK0A 2RKXA 4B16A 3WUBA 3MI6A 2DSUA 2ISWA 1CPUA 1H1ZA 2BBFA 1AFSA 4UR8A 5K9XA 4AIBA 2QCDA 5AC8A 4XO6A 1RY8A 4GPNA 4GX9A 4S3BA 4XZNX 2E28A 2BDQA 4AYGA 3PP7A 2FTPA 2GJLA 1GYNA 1LBMA 1X97A 3B3DA 3WN6A 3WLSA 4L1XA 4Y6GA 2VR2A 4FLSA 2F6UA 3QV8A 5XIAA 4TXEA 1IGSA 2FDSA 4NRSA 4XIMA 5DBTA 1XBVA 1OFEA 4X2RA 1KXQA 4C6OA 5EJZB 4DJEA 4JTKA 2PAJA 1H61A 1VRDA 4WGHA 4NASA 2YW4A 3BG3A 4M6QA 1MXDA 4I8YA 1E4LA 2J7CA 4XZBA 4FEZA 4ZQOA 3I7RA 1OD0A 4NZ3A 2PWHA 4JFSA 4Q4RA 4OU1A 4NNCA 5AN7A