1K9EA

Crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with 4-o-methyl-glucuronic acid
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
676
structure length
671
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAVVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRRWWKETAKRIYQYIPDFGGFVVKAPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords alpha-D-glucuronidase
publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 271
structure length 671
sequence length 676
ec nomenclature ec 3.2.1.131: Xylan alpha-1,2-glucuronosidase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1k9eA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1k9eA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1k9eA03
4B15A 5A8QA 1G1YA 3GZAA 1ZBVA 1IZJA 4XX6A 2NT0A 4AEFA 1IT0A 3ZM8A 4BQ2A 1OT2A 4CD5A 3K46A 1KGXA 4QLJA 2QV4A 1QPKA 2W62A 1QOXA 1HP4A 2ZICA 3D3AA 1NOFA 4TX6A 4HU0A 3WMBA 4IUGA 4KRUA 1WCGA 3VGEA 2WM0A 1QW8A 4HMDA 3AIRA 4J3SA 2A3AA 1MW0A 2OSWA 2VJXA 3THCA 1V3LA 2WMIA 4PN2A 4HPGA 2CIPA 2ZXBA 2XFRA 3N9KA 3WUGA 1BF2A 4UOQA 1XV8A 2WLYA 3TTQA 3IAPA 1NQ6A 3CUGA 1G01A 3PHAA 3AZTA 4TOQA 4HU8A 2DT3A 1GOKA 3JUGA 3MSGA 3A4XA 1KR1A 1CZ1A 5GNXA 5HPCA 2JFEX 3B9DA 4U2ZA 1KR0A 2DH3A 4W86A 3HU7A 1PIGA 1TUXA 1A47A 4AIEA 3VD5A 4CVUA 4KGLA 1OWQA 4ZFMA 1GQLA 1F4HA 1A3HA 4MNLA 3BCFA 2D0HA 4F8XA 4DWSC 2J7FA 1E6PA 1H0GA 1UD6A 1UWSA 4DUVA 1EO7A 4B9YA 4MJ4A 4B3LA 2J78A 3SCUA 1QI5A 4QLKA 2VCBA 3A47A 3BAKA 2BNJA 2ZXAA 3VD7A 1EDGA 2VR4A 1E6SM 4GI6A 3KWXA 1J18A 5I2UA 1ISWA 2IXUA 5A95A 2Q8XA 1MFUA 4M81A 3CTTA 1R85A 4JFWA 4PTMA 3ZJ6A 3QR3A 2D2OA 2WKGA 1LWJA 1AQ0A 1GVYA 1Q6FA 1CGVA 4YHEA 2CBIA 3CIVA 1LF1A 3S2CA 3MV01 2OSXA 1J0IA 3G6MA 3OZPA 1ESWA 2WPGA 4M56A 1OD8A 1BG9A 4AD5A 3G6LA 3WD2A 3CHFA 1F4AA 3U57A 2DT0A 4Z2IA 1JZ3A 1TA3A 4GI8A 1CGWA 2BHYA 2JIWA 1JD7A 1CLXA 4AZ7A 4PMDA 4YHGA 4WF7A 4UQAA 3U7BA 3SIMA 1B31A 4WSJA 3OZOA 4P8XA 5LA2A 5A6LA 3EBVA 1W2VA 5EBAA 2XFYA 4MPKA 4WKAA 4CCEA 4TUFA 1ODZA 4X9YA 5C71A 4HA4A 5M5DA 1KXVA 3SCSA 5BXRA 2ZUVA 1B90A 3VIFA 2ZIDA 5GNYA 2WMIB 4WKHA 3OLEA 5BXTA 3AXIA 4EANA 1HJWA 2HVMA 2ZXQA 2W4XA 1NWSA 1QNSA 5I77A 4PMXA 4LX4A 1GOQA 4MNMA 1R7OA 1US2A 1UZ4A 1QI2A 3VGHA 5DEZA 3NDZA 2WC7A 2W5FA 2YBTA 3VM7A 1R8LA 3ZJ7A 5I24A 3CZGA 1CYGA 1H11A 1GNXA 3GNPA 4LPCA 3AROA 3WEZA 3NYDA 1JDAA 3MS8A 1GONA 1KQYA 1ZJBA 3GDBA 4XZWA 1XD1A 1ZBCA 4CU7A 4PMOA 1UA3A 2CHNA 2UY3A 5C70A 4GO8A 2VTFA 4U5IA 2XUCA 3MUY1 2XTKA 2PBGA 1TE1A 3PTQA 4TVUA 2VUYA 5ECUA 1EGZA 1J9YA 1GOIA 2ZUMA 3AYRA 1E4NA 1OIMA 2BHUA 2G3NA 3AIBA 2WWCA 3IJ8A 2EBNA 3N04A 4MADA 5DT7A 1RP9A 1QNPA 3AIVA 3BAYA 1QNOA 2YA1A 1US3A 4M8UA 3CGTA 4EAMA 3GH5A 2DT2A 3A6OA 3VGDA 3WNPA 3PZOA 1W2PA 4JAWA 3WF2A 1JFXA 3SUSA 1UOKA 1TA3B 1U33A 4PUDA 1I1WA 4GINA 3WD1A 1G9HA 4UFLA 1KFWA 4OKDA 2YL5A 3VIKA 5CLWA 3HMCA 4DUWA 4HA1A 4F9JA 4NI3A 2UY2A 2F8QA 5BXSA 3PZTA 1HVQA 2FHCA 1FA2A 1JL8A 2FH8A 4J7RA 3QGVA 4AYSA 9CGTA 1JZ6A 3WFLA 3VKKA 6TAAA 2F61A 1Q6CA 1XC6A 1BGAA 4GXPA 4FK9A 2G4FA 2DEPA 3VD4A 3TOPA 1HX0A 3PN8A 3L4WA 4M1RA 4P8UA 1H1NA 4HOZA 2XVLA 3EMZA 1GJUA 3OLGA 2WVTA 2D1ZA 1JIBA 2XWDA 3WELA 4S3JA 3DHPA 3N12A 1WZKA 3GNRA 3NSMA 4AZ5A 2J7DA 2WSKA 2CPUA 4QLLA 3RPMA 3SUVA 1EA9C 3KL5A 4E8DA 1H3GA 3LMYA 4V28A 4TTUA 1XYZA 1E6RA 3GM8A 5M17A 3QOMA 3RM9A 1L0PA 1WZMA 1AQMA 3POCA 2J75A 4D72A 3OA5A 1C3FA 1HKIA 1DHKA 4X0NA 1H09A 1NOWA 3ARPA 2OYKA 1OGBA 3AIEA 1W1PA 1GORA 3WDJA 4PTVA 4W8AA 1UD4A 3WDQA 1BYCA 1LLOA 1NWRA 1W9BM 4QP0A 2CITA 3K8MA 2VZVA 1V6XA 1B3ZA 5E70A 3VNYA 2A3CA 1MW3A 1N82A 5A6MA 3A4AA 1XYFA 3VO0A 3I3DA 4DUXA 4BQ5A 1VJSA 5TD4A 4GPNA 5CGTA 1WE5A 3BLKA 3W81A 1HNYA 1I75A 1V08A 3WD3A 4U33A 4BS0A 2VX7A 4Z2KA 3AS2A 3TTOA 7CGTA 4CD6A 3WQ5A 4UFKA 1BPLB 1BQCA 2J7CA 3W6LA 4FLSA 2F2HA 2ZUNA 3SCPA 3VIOA 3PZIA 3WFZA 1MXGA 1PJ9A 4ATLA 3K8KA 4P8VA 3RILA 3VDCA 4DM2A 3WF3A 1UR0A 5EFDA 3ARZA 1KCKA 3B9EA 1B3YA 4Z2LA 3APGA 1HJQA 1E55A 1QNRA 5A2BA 3S6TA 1GPFA 1SMAA 2WHKA 4KRTA 3ZT6A 1KBBA 4WLCA 1E6XM 4ZE4A 3GXFA 1BVNP 4M24A 1UR4A 4UQDA 2NW0A 2E3ZA 1KBKA 1S46A 1WP6A 1VEOA 4FLOA 2VZTA 3BAWA 1NH6A 2WVSA 5FKYA 3BSHA 4PUEA 1GHSA 1DWGM 2JF7A 5HBFA 3AZSA 1HL8A 2E9LA 4CVWA 4QAWA 1TCMA 1FH8A 3LPOA 1UQYA 2XGIA 4W7WA 1G94A 4P7OA 5D9NA 5A1AA 2QF8A 2D3LA 1V3KA 2UY5A 3HN3A 5DF0A 2WCAA 4W85A 3CUHA 3N11A 3MMWA 2GUYA 2Z1KA 1DWAM 5F7UA 4PTXA 5AYBA 3FAXA 1KXTA 1XHGA 3ARRA 1LWHA 3CMGA 4AD0A 4JCLA 2WZEA 3SCTA 1JF6A 4CCCA 1ZBWA 5KZ6A 3PZGA 4D1IA 4KMQA 2W61A 3ARQA 1UR9A 3AYSA 2YKKA 2GJRA 4AIUA 3KZSA 2EPNA 4AY1A 3SUTA 4UQBA 1MFVA 2O92A 4W93A 4OOUA 3CZ8A 5BYWA 2XG9A 1TG7A 2Z1SA 3ZOAA 1GOMA 2E8YA 2RGLA 3N13A 2BFGA 3I3EA 1E0VA 2WVUA 1WO2A 3SUWA 4AW7A 3CHCA 1LJYA 3VDAA 2JIEA 3WUEA 1UHVA 2WMFA 1ZS2A 2XVPA 5CPSA 2A3EA 3VIIA 2BVTA 1HJXA 3MKKA 4U3AA 1CGXA 2VVNA 4MB4A 2VZSA 1LL4A 1E72M 1B3VA 1H49A 3WDRA 1GUVA 3W4RA 4CD8A 1JYWA 3WUFA 3CZJA 1OSEA 1OGGA 2WBGA 2A3BA 3WDPP 2BXYA 2Y2WA 1KB3A 1SMDA 3NIYA 2ZWZA 1UKQA 4D6JA 4E2OA 5A6SA 4CN6A 3WQVA 3GH4A 1NOUA 3TA9A 1CWYA 1M7XA 5I0DA 2YDQA 2WANA 1JFHA 3WF0A 1QHZA 4J3UA 4MAZA 2CBVA 4K68A 3ZT5A 2WKLA 1OIFA 1HIZA 5D8WA 5EB8A 3GYCA 3BAXA 4UFJA 2VX4A 4W5UA 2JE8A 1UH2A 1LG1A 2IUZA 3UG4A 2WMGA 1JZ5A 1XH1A 4LQ1A 1W32A 3A3HA 3TTSA 1E70M 1VAHA 1V6UA 3O9NA 3VGBA 4GQQA 3CZEA 3W37A 4MAVA 1JZ7A 1WDRA 3W25A 4AEEA 2BY1A 3AICA 3T08A 4AZ6A 4HTYA 1WZAA 1JYXA 2AAAA 3OLDA 3GTNA 3PZQA 4D71A 4EK7A 3W27A 4W7UA 2J25A 1NWTA 4B16A 1EDQA 1E4LA 1B30A 1PAMA 1V0MA 3AXXA 3M6DA 3UG5A 2TAAA 1KXHA 1LQ0A 4HMCA 1E0WA 1UQZA 2O9TA 1UWUA 1JXKA 1JAKA 5A2CA 4AD2A 1HJUA 4H04A 3WQ6A 3GXIA 2X2YA 1E5JA 3VIJA 5JBFA 1RH9A 3RJYA 3IANA 2OWXA 4ATWA 2PI6A 1ITCA 3MO4A 1KWGA 1QI4A 2G8ZA 3ZR6A 3M46A 1GZJA 5A6KA 2ZX5A 4PCTA 4GKLA 4UZUA 1MW1A 3NDYA 4EE9A 2X1IA 1E71M 6A3HA 3AMCA 1KXQA 1HN1A 2DPEA 1TZ7A 1IZKA 1FH9A 3ARVA 3A4WA 5E09A 4OJYA 1E4MM 2X8RA 2GVYA 1V6VA 3D5HA 4NRSA 1J12A 4P7LA 3WL1A 5E0FA 1UD5A 4QCEA 3MMUA 4D6FA 1LG2A 1LL7A 2X0HA 5M3WA 3OGRA 3UR7A 3WF1A 3WF4A 3MANA 1JI1A 2VI0A 4H8HA 4GZIA 3KL0A 3CZKA 4D1JA 1C91A 2ZUWA 2YLAA 1GHRA 2QMJA 3W6MA 3RCNA 2WHJA 3EMCA 4F9DA 3CLWA 2ZOXA 1Q6GA 3KEHA 4M82A 5FL1A 4WK9A 4J3TA 1ODUA 1XSKA 1UD2A 4XV0A 1I1XA 3WH7A 2XVKA 5D9MA 3L2MA 2GK1A 7TAAA 1JG9A 1CBGA 3MV11 2V3FA 2XSBA 5JBEA 4AZIA 1ISXA 4UNIA 1E56A 2Y8KA 3W28A 1ITXA 1BLIA 1JXJA 3BXWA 6CGTA 2DH2A 2NSXA 4CU8A 2Y8VA 4CKQA 4MB1A 4WIWA 5LA0A 4MDPA 1HJSA 1EXPA 5CG0A 1SYTA 1V0LA 3F5LA 3SCVA 2BS9A 3MUAA 5ABGA 4JHZA 2D0GA 3IJ9A 2CBJA 1VFMA 3UEQA 1HJVA 4X0VA 2VR5A 1H5VA 2VQTA 2JEQA 4PMUA 3WDHA 4P7RA 1UD8A 3UCQA 4H8UA 3SURA 2C7FA 1DTUA 5D9OA 4QDMA 4TVCA 5IXEA 1YQ2A 2CXGA 5HNNA 1MXDA 3FY1A 3BSGA 1AVAA 1V0KA 1C92A 5DFAA 3SCNA 1NP2A 1KWKA 1C8XA 1TVPA 4CU6A 1MQPA 2JALA 1W3HA 4IPNB 2GDUA 3DC0A 4HOWA 3GXDA 2WK2A 1V3IA 1UYQA 1E6NA 3TONA 4BF7A 3N18A 2D3NA 1UUQA 4NRRA 3K4AA 3WUBA 3L4YA 1JZ4A 1E1EA 1VEMA 3POHA 3BCDA 3WBAA 2V3DA 3SCQA 2J4GA 1JI2A 3DYMA 2PWFA 2CYGA 1NP0A 8CGTA 2VX5A 4ML4A 1BYBA 1PX8A 3CO4A 4CN1A 3PZVA 4ZXOA 3UG3A 1UH3A 3AXHA 3EDEA 3WEMA 4AMCA 2EXOA 2YL9A 3FN9A 2GK1B 2QPSA 1D2KA 1MQRA 3WNKA 3FAWA 5FL0A 3ZSSA 1H4PA 2B31A 1V03A 4AD4A 1QI3A 4MTVA 1ZU8A 4P8WA 4DWSD 3QHMA 4PRWA 1EOKA 1M53A 4F79A 5AC4A 3K8LA 2VC9A 2W66A 1BFNA 1CECA 1FP9A 4XZBA 2EO7A 1EDTA 2XJ7A 1VFOA 5I78A 2WMHA 3RMEA 5IFPA 4AWEA 2XHYA 4GO9A 4D6HA 1W1TA 1D7FA 5I5RA 2WW5A 1CXHA 3VVGA 4C7DA 1WDQA 2VT0A 2XM1A 5M03A 1V3HA 2YA2A 1GQKA 4JKMA 1OCQA 4W84A 3ZIZA 5AC5A 1JDCA 3RIKA 3DYPA 4BQ4A 3K1DA 1EIBA 3BH4A 2QLYA 5HDRA 5A6JA 4H2CA 2WC4A 1MW2A 3FW6A 3BGAA 3FXYA 3U5YA 4B3KA 1VFUA 1UKSA 3B9AA 3RO8A 1XSIA 2WAGA 4BQ3A 1DP0A 3ARTA 1UWQA 1L8NA 3AFBA 1B9ZA 3AIWA 2O9RA 1GOWA 2J7GA 4R27A 4A3YA 2DGAA 2VCAA 2W91A 2YL8A 2VZUA 3VX1A 5KEZA 1JZ8A 4U2YA 1VF8A 2EPMX 5CSYA 1M03A 1ZJAA 4QFUA 1R86A 4R5EA 1CDGA 3ZSTA 1ISYA 3FHQA 4UQ9A 1WB0A 4Y7EA 1V6YA 1Q4NX 2ZUUA 3WH9A 5A6BD 2FGZA 2WSPA 4P7QA 3AHZA 3NSNA 5IFTA 5LA1A 3NCOA 2OSYA 2J77A 2XSAA 5E9AA 2PBOA 2PWDA 3DECA 2YIHA 3GH7A 4GIAA 1XGZA 2EEXA 1H41A 3F5KA 1B0IA 5DMYA 5E0CA 3AMKA 1Z32X 3PZ9A 3WN6A 2XYLA 3WBEA 3THDA 5I79A 2PWHA 1TFVA 2CESA 3WENA 1E6QM 3AOFA 3WQ4A 4CCDA 2WZIA 1X6NA 3VGGA 1V0NA 1WNOA 4PEEA 1BGGA 3OGVA 3W82A 2RGMA 4W88A 2GJXA 3VD3A 1J0JA 1FFQA 1GQJA 4FF5A 2OYMA 3HJEA 2C8NA 4TXEA 5A2AA 4UTFA 4C7FA 1C7SA 1G5AA 1J0YA 1QNQA 1FHDA 1NARA 4OZOA 1OT1A 2HISA 3EMQA 4AZCA 1E6ZA 3RDKA 3IK2A 3J7HA 2OWCA 2NT1A 2X05A 2CCRA 3BAIA 1PIFA 3M07A 2WLZA 2FGLA 2PB1A 1QHOA 3NSXA 2OYLA 3KL3A 4PSPA 3ZMRA 4XB3A 1UH4A 5A94A 5CGMA 3AISA 2QPUA 4IISA 1BSIA 2YA0A 3IJ7A 3ZO9A 3VTRA 3DHUA 1C7TA 3AHTA 2WBKA 3IAQA 3L4UA 3VD9A 2BVYA 3CPUA 1CENA 3WNOA 1UWRA 3M7SA 3F5JA 2CHOA 3VIPA 4RL3A 4AD1A 1DEDA 1BYDA 2ZX9A 1HXJA 1HT6A 5AYIA 2V3GA 2X0YA 3BMWA 1TR1A 4JFVA 4U3CA 3ARXA 4GZJA 3T0DA 2DIEA 4U5KA 1B2YA 1HL9A 3AMDA 4WSKA 3CHEA 2W67A 3FNDA 3RJXA 5HPOA 2EPKX 3WMCA 1W9XA 4TVDA 3E1F1 4LGXA 3GNOA 3ARYA 4CD7A 1BTCA 3AHVA 1JNEA 1JYNA 2ESCA 1V3MA 4GQRA 1JZ2A 1EO5A 1VBUA 1W9VA 1U2YA 1Y7VA 2FH6A 3PZUA 3WY1A 2YL6A 2WMKA 4IPLA 4FLQA 3WQ8A 3DYOA 1HVXA 5BWFA 2QMKA 2G3JA 4S3KA 5DO8A 1GQIA 3CHDA 1UKPA 4D6CA 2GJXB 1GVIA 2D23A 3KE0A 1UR2A 2V38A 2WNWA 3PZMA 3QOKA 5BCAA 1XD0A 2WMJA 1C90A 4Z2GA 3CBWA 4UFHA 4UQEA 5IDIA 1KGWA 4WKFA 1MYRA 5JBDA 1AQHA 1WDSA 1J10A 1MWOA 3AI0A 4PMVA 4AZCB 1Q6EA 2PWGA 3AS1A 3L2LA 3VDBA 4NZCA 3AMGA 4M80A 2Y5EA 1WDPA 5D8ZA 1W3LA 2XGBA 2XIBA 3OBAA 1BHGA 4KWUA 2VMFA 5A6AA 3LPFA 1W9PA 4ACYA 4L4OA 4ACZA 4PMZA 4A4AA 4PTWA 2EQDA 4AC1X 5BXPA 3VMPA 2VL4A 2J8GA 1AMYA 4HA3A 2MANA 8A3HA 1Q6DA 1W3KA 1BAGA 1X6LA 3VILA 4JFSA 4MDOA 1W3JA 2WB5A 4H8VA 1G0CA 5GPRA 3BMVA 4ZEPA 1OD0A 4B9ZA 5ABEA 3BLPX 1PPIA 4DWSA 2BHZA 1PEZA 4PMQA 1ECEA 1NM9A 5A3HA 4H7VA 5HXMA 5DT5A 3WKZA 1JD9A 4J28A 2WZHA 2YJQA 2E9BA 3FHAA 3VX0A 3W29A 2V5CA 2QHAA 1TMQA 2W63A 1ZL1A 4W89A 2CETA 1UKOA 1EQCA 1HKJA 4CUCA 3AMLA 5ABFA 5IHRA 4PSRA 4Z2HA 5FIPA 2D20A 5CPTA 3EDFA 1CXEA 4UOJA 3OB8A 2ZUTA 4M29A 1GJWA 1E40A 3UR8A 2FHFA 4JFTA 4Z2JA 5CQ1A 3UESA 2JEPA 2X09A 4TTGA 5D9PA 5IHSA 4UFIA 3ZR5A 4D6GA 5CJ5A 5HOSA 1K9TA 2E0PA 3T2QA 3MUZ1 3QHNA 3N1AA 3ZJKA 1VFFA 3NJ3A 1PZ3A 5CLTA 1CXIA 1QBBA 3VOCA 1FP8A 1J11A 3VGFA 4Q7NA 4MNJA 1OGSA 1EH9A 3WNMA 1CGTA 4MB5A 1VBRA 4NF7A 2FDMA 1YHTA 3VIGA 4N0RA 4J27A 5JUVA 1M04A 1XCXA 1BG4A 3CZLA 2DSZA 3AJ7A 3OG2A 1JNDA 3VUPA 4J3VA 2D22A 4HOXA 4PBGA 1W9UA 4U31A 4HZ6A 4N42A 1CLVA 2VURA 3EDKA 2CBUA 2XFFA 1C8YA 3VNZA 2JF6A 3AIQA 3WQWA 1TVNA 4RE2A 3SEPA 3MSDA 4V2XA 3T2PA 4CN4A 1UZ1A 4D6EA 2ZE0A 3AQUA 2C0HA 1DWFM 4UOZA 3UETA 3CUJA 3AHXA 3WSUA 4C90A 1WAWA 2VCCA 1HKMA 4F66A 5A6BA 5JIPA 3EDJA 3WMSA 4ACZB 1V6WA 1XSJA 2DIJA 1WPCA 1GOOA 4JZ5A 1QHPA 1FH7A 1ZB5A 3AS0A 5AY7A 5GQBA 3ARSA 3VDHA 3AIUA 5BROA 3UERA 2ZXDA 3U7VA 5CZKA 1RP8A 1B1YA 4DWSB 2OWWA 2VNCA 5BRPA 1VEPA 3W53A 1UR8A 1E4IA 1B3WA 3LPGA 2VRQA 2UY4A 2VO5A 3ZQ9A 1PX4A 4ATDA 2CKRA 1QBAA 2J7EA 4A3HA 1C8QA 4WJXA 2V3EA 4D6IA 3F4VA 2GDVA 1H2JA 1CXKA 5ABFB 2XWEA 3WEOA 4BZYA 5LYRA 2ZWYA 4W7VA 4C91A 1JAEA 1E43A 5A8NA 1UR1A 2BY2A 4AZGA 4HPHA 1U30A 2DDXA 3N17A 1J0ZA 2O9PA 2VZOA 3EYPA 4OBRA 2D0FA 3WH5A 2J8FA 1UA7A 3T0BA 2EJ1A 1J0HA 2E9MA 3VMOA 1JDDA 1RPKA 1EOMA 3NUKA 1E5NA 2GJPA 1IV8A 2WCGA 1OM0A 2EPLX 3L4TA 1GCYA 2E4TA 2ZX8A 1OBAA 4W87A 2XM2A 1EHAA 5C8BB 2XVNA 4JFUA 1W91A 3MU7A 1MQQA 4TX8A 3WD0A 2FHBA 1HF6A 1KGUA 3CUFA 5FD0A 3SCOA 2YDRA 5JIWA 2YLLA 3PBGA 1QVBA 5E6ZA 1K9EA 1JGIA 5CXPA 1BYAA 2VRKA 2BXZA 4LYRA 2XVGA 1KQZA 1M01A 3VU2A 3T09A 1E73M 1UWTA 2EPOA 3GXMA 2Y24A 3O6AA 4OBSA 3T2OA 2DSUA 4FLRA 1X1NA 3PTMA 4UFMA 3SCWA 2IXVA 2J79A 1SR0A 3L4ZA 5I6SA 4E4PA 1E9LA 4UQCA 4HZ7A 5A8OA 1E3XA 1JF5A 4MNKA 1JYVA 1FHLA 1UKTA 2XIIA 5ABHA 1LL6A 3VM5A 4ZENA 2ZUSA 1B3XA 3VIMA 1O7AA 4RE3A 4EKJA 1WZLA 2AOSA 1R87A 5D4YA 3ECQA 1XH2A 5A69A 3OIHA 4L4PA 4KGJA 3PZNA 1OB0A 2V5DA 4XUYA 5FOOA 4JHOA 1WKYA 4AZHA 5CSUA 4AZBA 3WH8A 3MMDA 2PWEA 1FOBA 2J7BA 2WWDA 2CNCA 2BY3A 2DSKA 4PMRA 2GFTA 3W24A 4GI9A 1W1VA 1VJZA 1UWIA 5I3DA 3RM8A 4PMYA 4JKKA 4OOZA 2E40A 5EMYA 2XPKA 4FMVA 4BCEA 4D6DA 1ISZA 2WVVA 2J62A 1CNVA 1QW9A 1P6WA 1OINA 4JL2A 1E15A 3BC9A 3SCRA 2BVDA 1VENA 1E3ZA 1XRVA 2G41A 1D3CA 5A8PA 3OLIA 1NWUA 4BA0A 4NSBA 4ZXLA 1V3JA 3WNNA 1CXLA 4UR9A 4GZEA 4YN5A 5BRQA 3PTKA 2WXDM 5EFFA 2G3IA 3L4VA 4W8LA 4YPJA 4J3WA 1PX3A 1GW1A 4AXNA 4LYQA 4MJ2A 1PBGA 2AMGA 3WH6A 2ZX7A 1CIUA 2VVSA 4ZE5A 2G3MA 4Q22A 4HP5A 1O6IA 3N15A 4PMNA 1C93A 3OGSA 4C7GA 1HP5A 1VRXA 2OLHA 2DT1A 4PCSA 1E1FA 1XH0A 1V02E 4W5ZA 1BVZA 1V02A 3I3BA 4J3XA 1VIWA 3AZRA 3W38A 3AHYA 4QCFA 2WCSA 3CH9A 3VMNA 3ALGA 5E6YA 3T0AA 4URIA 2E8ZA 4UCFA 4MB3A 3U5UA 1SFSA 3ZT7A 3AS3A 1CGUA 1W9DM 3VIHA 1K6AA 3LPPA 2WHMA 4PYSA 1DWHM 4AD3A 5I23A 4JCMA 2CKSA 3ARUA 2A3HA 1KCLA 4UZSA 3WL0A 3BAJA 1QI0A 2VX6A 3EDDA 3WD4A 5CPQA 2YBUA 2BV9A 1EHNA 1FFRA 2YDSA 1CXFA 3WNLA 3CMJA 4HZ8A 4JKLA 2VRJA 3SUUA 3ALFA 2WHLA 1H0IA 5A8MA 3ZJ8A 3O2LA 1UG6A 5FCZA 2J7HA 1W1YA 2VOTA 2PF0A 1ZBKA 4V27A 1HKKA 7A3HA 1DWJM 4AISA 3W0KA 3MUIA 1R7AA 1J0KA 3K4DA 2J47A 2WVVB 3TP4A 3VPLA 1CEOA 1CTNA 3WDIA 3VINA 2WC3A 4P7NA 1DWIM 1K9DA 2CEQA 2J74A 1RD6A 2WYSA 1ISVA 4LXFA 2O9OA 4RE4A 1E0XA 1VB9A 3RM4A 1UD3A 3L4XA 2W92A 4IM4A 2ZX6A 1CPUA 4LYPA 4W8BA 1J01A 2YOCA 1EQPA 2GSJA 2BY0A 3ARWA 5GNZA 1MVYA 4CD4A 4H41A 2DSVA 4OUEA 4AIOA 2VQUA 3GBEA 3TTYA 3WIJA 4KH2A 4DM1A 4OIFA 1PZ2A 2DQXA 1K9FA 3B8SA 2PC8A 3CUIA 3QHOA 2D24A 1XCWA 4E8CA 4HMEA 4CGTA 2DSWA 1CGYA 3II1A 2UWFA 4JIEA 2Y4SA 3W26A 3GBDA 4JL1A 2CERA
chains in the Genus database with same CATH superfamily
3D46A 1ZBVA 3NM1A 3HPFA 2INFA 1IT0A 2BWGA 3ZM8A 3TQPA 4B90A 3EPMA 1Q6LA 2QV4A 2OJPA 1QPKA 1QR7A 1OX6A 1PKMA 2DUAA 5DANA 1QOXA 1RR2A 4JIPA 3VE7A 3D3AA 4IMCA 3A4JA 3BLFA 4H6KA 2VGIA 5HANA 4IT1A 3AIRA 5M2FX 1MW0A 4Q8MA 2WMIA 4L61A 3RX4A 2XFRA 2EJAA 3WUGA 4JBRA 1EL3A 2WLYA 3NWRA 1NQ6A 5EY5A 3AZTA 3LDVA 1GKQA 2WQDA 4HU8A 3MSGA 3A4XA 4O13A 3JRKA 1YE6A 3BTNA 3B9DA 2PU1A 1KR0A 4S38A 1PL9A 4NKCA 3HU7A 4FNUA 4NZ3A 5C7VA 1A47A 4GFSA 1CT5A 2RHGA 3HGOA 3KVLA 4PC8A 4ZFMA 1F4HA 2FFIA 3BCFA 2OQLA 2NX9A 4JX6A 2PRHA 2C19A 4DI9A 4DUVA 3HQPA 3TCEA 1RK6A 5C0QA 2QEZA 2BNJA 1A3XA 3VD7A 1Z3NA 5AHIA 5FJOA 4GI6A 3CXOA 3UZXA 1ISWA 4R9OA 1FKWA 5A95A 3S8HA 3C8NA 3GX9A 2QQ6A 4JFWA 4PTMA 1P7TB 1UZDA 3G1AA 1MXSA 1TV4A 1AQ0A 4CQ8A 4YHEA 3R6IA 4M56A 3G18A 3NEHA 3CQ0A 3G6LA 1SZFA 3NO3A 3LRMA 2NQZA 4GI8A 4ZMGA 3C8FA 1JD7A 3GNXA 1W3IA 4CQCA 4YHGA 1V6TA 4WF7A 5AHFA 3U7BA 4M1BA 3SIMA 1OX5A 4L9YA 1B31A 3W1TA 3M0HA 1T96A 4XZNX 2Z28A 3NQEA 3LLDA 1W2VA 2XFYA 4PBFA 4Q8UA 1R2RA 4TUFA 4X9YA 4GRSA 4MUPA 5BXRA 3TU9A 5PTDA 1B90A 2YW4A 1BWLA 3M0ZA 2WMIB 3WJXA 5BXTA 4EANA 4YWSA 3W7PA 2ISWA 1K6WA 1GOQA 1I0BA 4AG0A 5KMYA 1US2A 3WQPA 1AJ0A 3DEQA 1U5JA 4GX9A 3WBXA 2YXOA 4FR1A 1BF6A 3G2GA 4WCJA 4LPCA 4HNUA 3WEZA 3NYDA 1JDAA 1J93A 3MS8A 2B7QA 4JTDA 3HMJG 3GDBA 1ZBCA 4CU7A 4PMOA 1UA3A 2CHNA 2UY3A 4ZB5A 5C70A 4M0XA 4H4IA 1M9HA 4H9TA 3MUY1 2PBGA 4FS9A 2PDBA 1TPEA 4FXSA 2VUYA 3WK3A 1TJRA 4PULA 1CLKA 5ECUA 1ZTVA 3FFSA 3PJUA 2WWCA 1BWVA 2XIQA 4BWLC 4HGXA 5DT7A 4C6KA 3AU6A 1RP9A 4EAMA 1K8CA 1Y5VA 3MCNA 2QCEA 4YCOA 4ZA0A 3PZOA 3T9PA 3GUWA 4K8EA 2DP3A 1XYBA 5K9CA 1U33A 1AUSL 4BHYA 4GINA 2A6NA 5CLWA 4JTFA 3MB9A 3ZVIA 5G5IA 4HA1A 1A5LC 3O05A 4F9JA 4NI3A 4RV3A 3SADA 2W27A 3UR5A 2J88A 1HVQA 2GWNA 3A22A 1QK0A 4ADTA 2FHCA 1B4EA 3GTIA 4N2YA 9CGTA 1ZAHA 1C29A 3WK2A 5H6HA 1P0BA 1XGDA 1XIFA 2PFHA 4GXPA 2G4FA 2DEPA 4IGHA 1HX0A 3PN8A 1NAL1 3LLFA 4A8LA 3EMZA 5L6UA 2QUNA 5FF7A 2XWDA 3KVJA 3WELA 5BMXA 3N12A 1AW1A 1HGYA 2MUCA 2ANUA 2J7DA 3MKCA 2WSKA 2CPUA 4ZR8A 3VNLA 1KW1A 4IIBA 4CEXC 1XL9A 3IGXA 5AZ0A 1IT8A 3KL5A 5LIXX 3RX3A 3PANA 4V28A 4CQAA 1OYBA 3QOMA 2G97A 4IMGA 4WR3A 3UPWA 1AQMA 3POCA 2VXNA 2ZTKA 3DENA 1DHKA 4X0NA 1ITQA 1H09A 2OYKA 3AIEA 1XYMA 2I5IA 1GORA 1EF2A 2POZA 4LUIA 4AVNA 1GVQA 3QR1A 4GJJA 3ABZA 1XDJA 2AKMA 4D9PA 2YXGA 4R88A 1W9BM 3K8MA 1THFD 4GVGA 4LF2A 1PTDA 3LHVA 3KLKA 3PB0A 1XLFA 3GVVA 4DUXA 4BQ5A 4JPGA 2F84A 3R5EA 1KV5A 1VJSA 1W5PA 3QW3A 3AWNA 4Z08A 3MY9A 2OR2A 3BLKA 3GNNA 1HNYA 3IWPA 4Z2KA 4ZOBA 1H1YA 3MDUA 4X2PA 1MDLA 1XIEA 3DIPA 4CD6A 1BPLB 1ML1A 2PU0A 3WJYA 3WLSA 1X1OA 2F2HA 2KAUC 2V67A 2C13A 1XLHA 3L5LA 5BWAA 5C2CA 5C7HA 3K8KA 4P8VA 3VDCA 3FKRA 3B0UX 3ARZA 2Z00A 1T8QA 3B9EA 2WNQA 2P5NA 4UTWA 1RPXA 1HJQA 1EJ7L 3ITTA 1KFEA 4L7ZA 3WFAA 1XW8A 1GPFA 1SMAA 4KRTA 3LCHA 3RLUA 1LBFA 1HO4A 3WJSA 1J6PA 3VKCA 2ISSA 4ZE4A 1XIMA 5IBXC 3FEQA 1BVNP 1UR4A 1Z41A 1KBKA 3WLHA 1VEOA 3H4GA 3V35A 2X1UA 3BAWA 1T40A 4TO8A 4TQTA 1U83A 2BLEA 3AZSA 3HFYA 1KCZA 2RJHA 3M64A 1TCMA 2XGIA 4MM1A 3EAUA 3OTRA 5A1AA 1FUYA 1B4KA 1WYIA 3S5NA 2QF7A 4GGHA 1PKNA 3WQOA 4E2DA 5LNWA 3VYLA 1LRQA 4IX0A 1TVLA 3YPIA 4QG8A 5AYBA 1KXTA 1FHUA 3L21A 4IXHA 3SCTA 2C1HA 1ZBWA 3LCGA 5KZ6A 4D1IA 3LCIA 4V1XA 3AYSA 4YTSA 1PZ1A 1TUFA 1SQ7A 4LVDA 5I06A 5F2LA 3KZSA 2EPNA 2R1PA 3SUTA 1YEYA 2HNEA 2Q01A 1TG7A 2Z1SA 1GOMA 1CB2A 2BFGA 2EAWA 4K2SA 3KRBA 1E0VA 4BY3A 3V7PA 2WVUA 3N14A 4AW7A 3URBA 3W7MA 2ABAA 3ABRA 4PUJA 2INEA 1YXCA 1UHVA 3GYEA 1UPPA 4U3AA 5AN7A 1LL4A 1B3VA 2E6AA 1H49A 3WDRA 1GUVA 4KBXA 5K7JA 4DJDC 4P5UA 3W4RA 1JYWA 1ZALA 1IIHA 1OGGA 2A3BA 2BXYA 3WLTA 4ZQOA 1SMDA 4I7WA 3SGZA 2ZWZA 3GG8A 4JQ3A 2R1LA 4CN6A 3WQVA 1R3QA 1VRDA 5D2WA 1XIBA 1V51A 1EEXA 2X7WA 5I0DA 4HD5A 1DQUA 4DAIA 3RPDA 4WY0F 2QJHA 4J3UA 4A8RA 3ZT5A 2ZA2A 5ENLA 4R7WA 3S2MA 1OK6A 2VKZG 1W8GA 2VX4A 3FX4A 3W02A 3K5XA 2Q3OA 2Z2AA 4LQ1A 2NVCA 1IWAA 3A3HA 3TTSA 1U5HA 2H9AB 4KCVA 3IGHX 1P0KA 3VK5A 1R9ZA 3GQYA 2C16A 3GWQA 2PP1A 3W1QA 1XQKA 3DG3A 3B0XA 2Z1WA 5TBOA 3W25A 4FNQA 4HTYA 1Z7AA 3PK7A 1JCXA 5BOEA 3W27A 4B16A 3C4UA 1E4LA 1A0DA 4B5VA 4OECA 1UMYA 4HMCA 3U2OA 1UQZA 4K37A 2O9TA 2OKOA 3WLPA 3U4FA 1N8WA 1F07A 1JAKA 1P0DA 5C9XA 1HJUA 4H04A 2QXWA 5DCDA 2V2DA 3W88A 1I2QA 2X2YA 3HURA 1FCBA 5EBUA 1IZCA 4MY9A 2UZ9A 1L6GA 3RJYA 4AB4A 2OWXA 5I02A 1ITCA 1ZSXA 4GH1A 3LI0A 3QY8A 1KWGA 4GGBA 1QI4A 3KS5A 5MKGA 1VH7A 3JZUA 4NZFA 3V5OA 3ME3A 2IW0A 1XIDA 5A6KA 1YXYA 3IARA 1RHCA 3R0UA 1PVNA 4L64A 3T07A 2DPEA 1QPNA 2OKTA 3CUZA 3NEVA 3MYOA 3N2BA 2GVYA 1V6VA 4DELA 3O1NA 3G1XA 3NL3A 3CT7A 1LG2A 3N4EA 5H2ZA 3OGRA 3WF1A 3EZ4A 5LZLA 1RAKA 4GNVA 2VEKA 1LROA 1C91A 2PDJA 2VWTA 2DW7A 2GOKA 3EMCA 9RUBA 3LRLA 3QC0A 1Q6GA 3KEHA 4M82A 1HGWA 1TPDA 3SN0A 1SW3A 4XV0A 3WH7A 3L2MA 4AU0A 1Q6RA 3N6HA 2OELA 1XJBA 2EG6A 3IVUA 4F3HA 3H2EA 1O68A 3H2CA 4S23A 1E56A 1RVKA 3HTWA 2CHRA 4A05A 3ZLFA 1DPMA 4O8RA 3BXWA 5CG7A 3Q65A 3LCLA 4TV6A 4FNPA 3GLCA 2YCJA 2NSXA 3UJEA 4I9JA 1CI1A 3H4WA 4MDPA 3S0CA 4IZGA 2CLKA 3MP4A 5CG0A 1V0LA 3CC1A 2E25A 5F2MA 1TQXA 1XUZA 5ABGA 3T78A 3GSMA 2P88A 1TPFA 3TLQA 2CBJA 2OU4A 4LS1A 3UEQA 2V8ZA 3IK4A 2VR5A 2VQTA 1AH0A 1TKKA 3BJTA 1MUCA 4NXSA 3VNIA 4L56A 1R9XA 3GAYA 1ZFJA 1UD8A 2C7FA 1UIOA 4LCRA 3LMZA 5MKGB 5HNNA 5HWJA 4GIEA 1MXDA 4PFMA 3CL8A 1AVAA 1V0KA 1C92A 3M4HA 1W31A 1YTEA 1KWKA 1TVPA 1YNPA 3LB0A 2GDUA 4IIHA 4LNYA 3DC0A 4ENLA 3GC2A 3P0WA 3UWZA 2BOFX 3GXDA 3K30A 2WK2A 3B40A 2J9XA 2ZADA 3P61A 1M1BA 4YXGA 3B97A 3NQMA 4ADSA 4Q3MA 3K4AA 2XH4A 4L6DA 3KDOA 3L4YA 2Q8LA 1KV8A 3S42A 3RXZA 3BMXA 2CYGA 2VX5A 4ML4A 4DBUA 1PX8A 1SJCA 1I45A 2E5CA 4NAEA 5KZDA 4MMWA 1FWEC 3I7QA 3WEMA 3NQFA 4JX4A 1F3WA 2OT0A 1BRLA 2QPSA 4ZTXA 3CJPA 3C2OA 4GHRA 3ZSSA 1H4PA 2B31A 3A24A 3S83A 3RG6A 2R24A 3P5YA 4EF9A 4XD4A 3NYZA 1EOKA 1MRAA 2NXIA 3ZFHA 4F79A 3OPSA 4A3QA 2Z29A 1IEIA 3HZ3A 1XLLA 3VKJA 2VC9A 4JTJA 1BFNA 1CECA 3LV6A 4AXKA 3T81A 1EDTA 2PS2A 3EWYA 3NOEA 1RJQA 1CXHA 1ZP3A 3VVGA 1WDQA 2VT0A 4L65A 1LRNA 4S3CA 3VCRA 1KM1A 3QFEA 1OCQA 3ZIZA 3MW7A 5AC5A 3RIKA 3SECA 3V0TA 2X1TA 1MW2A 3FW6A 3CQJA 5T91A 3RO8A 1XSIA 2DV0A 3PBWA 3A12A 5KZMA 2OQHA 4UTKA 3AFBA 2CU0A 5D2XA 2O9RA 1GOWA 2G96A 4G6CA 1OYAA 2VDGA 2VCAA 3N2CA 3UXLA 1UUOA 4U2YA 3LXAA 5D03A 1YTDA 2EPMX 1M03A 4C5ZA 4ZGYA 4C65A 3DBNA 3KOYA 3HM7A 2E5DA 1NF0A 4JDBA 1Q4NX 4NAEB 3EEGA 2ZUUA 4IFKA 3GIQA 3KTXA 1BRLB 5IFTA 5LA1A 3D3FA 4OU1A 3DECA 1RSCA 2YIHA 3PS7A 1OF6A 5DMYA 4J1OA 4WDTA 2XH2A 3IJLA 3PZ9A 2XYLA 2Z0IA 1QATA 3DFHA 2PWHA 2ZDSA 4Q8QA 1E6QM 3M5XA 1DJHA 4JTGA 1QOQA 1G7UA 4CCDA 3VGGA 4C6OA 1WNOA 1CX9A 4EPEC 1BXCA 5LNVA 1XRFA 1J0JA 3MMTA 1P4CA 2OYMA 3TX9A 4PFHA 4DWDA 4C7FA 4Q8PA 1NU5A 1H7NA 1J0YA 4JYFA 2AQVA 3M0YA 3FGCA 2JGQA 2HQAA 3H23A 4WUIA 3IK2A 1RK5A 3EWDA 4ZQMA 2IMRA 2XSXA 4FHAA 1FWCC 4NXKA 5GJNA 2WLZA 2FGLA 4NYYA 5CPOA 1G7VA 2GDQA 5H91A 1RALA 3G24A 2OYLA 3KL3A 4PSPA 2Z27A 3ZMRA 1UH4A 4PL1A 3C52A 4F0KA 4S1FA 1GZGA 3TZNA 5HJYA 4D8ZA 2I56A 2JBMA 2P76A 4GY1A 2QKFA 2V2CA 4DYJA 3WMLA 2BVYA 3QPEA 5CJNA 1PV8A 2EG8A 4G56A 2CHOA 4JEQA 1BYDA 2CLFA 4YWIA 1RLCL 1GYMA 1HXJA 3P74A 4IFKB 4UXDA 4GZJA 3HA1A 3T0DA 1TTQA 4U5KA 3B8TA 1DV7A 4ZOAA 2Z7KA 1OCBA 5HPOA 4M6UA 4YTUA 3E1F1 3IUDA 1KM2A 4LGXA 2HVNA 2Y0FA 5E9XA 4BI7A 2ESCA 3P82A 4QJ4B 3CM4A 4UNLA 1A5AA 3KP0A 3PZUA 3EWZA 4BF9A 4IPLA 3W1UA 3W70A 4FLQA 3WQ8A 1IEWA 4E8GA 4HA0A 4MWAD 1AFSA 3RPTA 1I2PA 4D6CA 4Q4QA 3DH7A 3PZMA 3FJLA 4M6VA 4QS5A 4QXIA 4EPDC 3CBWA 2QPXA 4UFHA 3E0FA 2RAGA 4N6EA 3B8WA 3FGCB 1X39A 2PWGA 3LS9A 3SO7A 3I6TA 3VDBA 3FIGA 3VOJA 4DLMA 1WDPA 3BURA 1W3LA 2P3EA 2ISFA 4MZ1A 1VHNA 3KBWA 1JUKA 3LPFA 1W9PA 4EAYA 2EQDA 3VMPA 3N6JA 5GJMA 1OX4A 4HPJA 8A3HA 3OQ8A 4MVAA 2V63A 1DHPA 1MSSA 4UMBA 4A8IA 2NQHA 4GUHA 1BAGA 3UJFA 3VILA 1TV2A 1FWAC 3H7VA 3MT1A 3KBMA 4ZEPA 3T55A 1VZWA 2NLIA 3BLPX 1PPIA 4LWWA 2QCNA 4FX8A 1PEZA 4A8NA 1LBLA 5DT5A 1GVFA 1IWBA 4J28A 1YPFA 3ANYA 2YJQA 4JN7A 3EA3A 2QHAA 4E38A 1ZL1A 3EWCA 3UNTA 2VGFA 1WDWA 1S1PA 4M5PA 6ALDA 5CPTA 2ZUTA 3OB8A 4QHRA 3R12A 4M29A 1E40A 3IPWA 2X09A 1AD4A 5AC6A 3C61A 2HBVA 3N9SA 1K9TA 4XAGA 3TQ0A 2QGHA 3QHNA 3GB6A 1PZ3A 3MI2A 1QBBA 4JTCA 3KOWA 4AWUA 4DI8A 1OGSA 2I9EA 4MB5A 2AQOA 2ZZ6A 2QCFA 4YS1A 1RQHA 3UXKA 4HHHA 3ZZ1A 4JICA 1XCXA 1BG4A 2DSZA 3OG2A 2ABBA 4UCGA 2D22A 2F9RA 4PBGA 3UGVA 4U31A 2VURA 3R13A 2CBUA 1IE7C 1LWIA 2XFFA 3AIQA 3PSVA 5BU6A 1TVNA 4RE2A 4DZIA 1EPXA 3T2PA 4CN4A 2VEGA 2ZE0A 3AQUA 3DGRA 3BGJA 5F2GA 2A1YA 4DJFD 4E3TA 2WM1A 4UOZA 4Q7BA 2IS7A 4GNKB 4S2CA 3WG6A 2VCCA 2P0OA 2FZDA 4RXGA 3M9YA 4H7ZA 1GOOA 1OX4B 1BSLA 4RE0A 3TNBA 5FJJA 1QHPA 4Q4PA 3F7JA 3BL3A 3ARSA 2FZBA 2J9ZA 4DAFA 1EJRC 4QE4A 1K77A 2OWWA 2VNCA 1FDJA 3GHSA 4IJBA 2YZ5A 4O19A 2C71A 1E4IA 3CWHA 3ZQ9A 1TJ2A 5I3GA 1QBAA 4MJMA 1C8QA 1OJXA 1Q7QA 3GUGA 3U0HA 3E2RA 4LB4A 4DNMA 2OO0A 3WEOA 5LYRA 3CV7A 2Y7EA 3L2IA 4WVXA 5KITA 4O1BA 3M0LA 5A8NA 3FJ4A 4HPHA 2R6OA 3N17A 2O9PA 2VZOA 2W3ZA 2D0FA 3WH5A 3N4FA 4O1EA 1JDDA 4JTAA 1RPKA 1EOMA 1E5NA 1QWKA 2QCHA 3LCWA 3W9ZA 3GO2A 4WDUA 4IPJA 1OBAA 1ICSA 4MLJA 2NWRA 5C8BB 2PLKA 3W74A 1UP0A 3QQWA 3LQLA 1MQQA 4TX8A 3IJDA 3WD0A 4O53A 4RR4A 1HF6A 4AEOA 1KGUA 1EB3A 5FD0A 1UWAA 4O4WA 3WZ0E 4IL0A 5C5YA 2YLLA 4HB7A 2QGYA 3DZ1A 4KIEA 4EACA 1JGIA 2OMAA 3C0SA 2VRKA 3GAKA 4CLMA 2XVGA 1Y0EA 1X97A 3QV7A 3DKLA 2Y24A 1GKPA 3ID7A 3T2OA 1IGWA 2DSUA 3PUGA 1OFOA 3U4AA 2IXVA 2YGYA 5LXXA 3FK4A 1M7JA 2XH0A 3URNA 1IIGA 1JF5A 1UKTA 2XIIA 4EVZA 5ABHA 2B7OA 2PDMA 1B3XA 1KLZA 3VIMA 4Q4MA 4ASTA 5D4YA 2VENA 5C54A 3OIHA 4O8AA 3PZNA 4GC3A 3TWAA 2R91A 4MWAA 1C9DA 3NQ8A 1QU4A 4TIMA 4AZHA 1PS9A 4AZBA 1YE4A 2PWEA 1IYXA 3S1UA 3W2NA 2CNCA 3KLLA 3U6WA 2QJGA 3WQDA 1VJZA 4JX5A 4ZQPA 1A0CA 2F6UA 4OOZA 1RA0A 1R46A 2V30A 4BCEA 2IPGA 2WVVA 2DZBA 1CNVA 5D32A 4K8HA 3W7QA 4EWND 4F2UA 1RCQA 4Y8FA 5TNVA 4C6LA 1E3ZA 3BSMA 1XRVA 3LXBA 1VCVA 5A5WA 3E38A 5CJMA 1AMKA 3OLIA 1IXOA 4ZXLA 1VLIA 2QCMA 1CXLA 3UWEA 3PTKA 2Q09A 1P5BA 1TJ1A 4L6HA 5EFFA 4W8LA 3FXGA 4RV8A 3BPWA 4AXNA 4MJ2A 1PBGA 1MO0A 5AHLA 2ZX7A 3GRIA 2VVSA 4ZE5A 5FEWA 4Q22A 3PSWA 2A79A 3UWVA 4LS2A 1C93A 4PUNA 1TV7A 2Z24A 1QPOA 1ADOA 2P1FA 4PCSA 4HN4A 1GEQA 4W5ZA 5JXQA 4J3XA 4QCFA 4X63A 3QKZA 3QQ0A 1PKLA 3H22A 5J04A 3U5UA 3AS3A 1ECQA 3LPPA 3OU8A 4JCMA 4H9MA 2CKSA 1KCLA 2E6YA 1XS2A 2OVLA 1QI0A 2ZRVA 3WD4A 2YDSA 1R47A 2FQIA 2OEMA 3U8GA 3CMJA 1BTMA 4HZ8A 4MWAB 4JKLA 2VRJA 3SUUA 3ALFA 4KCTA 2WHLA 2YYUA 3ZJ8A 1UG6A 4WDWA 4JTTA 3O0KA 1XUUA 2VOTA 4RK8A 1DJWA 1GG1A 4O11A 1ZBKA 4Y96A 3R58A 3KRUA 2J13A 7A3HA 1W1ZA 2HS6A 1TWIA 4Q4KA 1MNSA 4D8AA 3HQOA 5CPLA 1J0KA 3CEPA 2J47A 2NX1A 2WVVB 1RJRA 3PP7A 1T5AA 3FKKA 1QAPA 3QBUA 1YYAA 1IWPA 4DJFA 3IIZA 2C79A 4IQEA 2Y8UA 3OOQA 2GVEA 1YKWA 1D8CA 4R9XA 4QX4A 1AA1B 4DIAA 1NELA 2J74A 1ISVA 1KBJA 1KM0A 5XIMA 4RE4A 4IM4A 3GIPA 4W8BA 4XAZA 3DHFA 3MI3A 3FS2A 2YOCA 1S2AA 3ARWA 5GNZA 1KM3A 3E2QA 4K3ZA 1UMLA 2DSVA 3B0VC 4AIOA 3NPUA 3R8HA 3IGSA 3GBEA 3TTYA 3WIJA 1FX6A 4GI4A 1TZ9A 5AKQA 3B8SA 2QJIA 3CUIA 3LGDA 4E8CA 4HMEA 5LSMA 3G1VA 3II1A 3W26A 3WLNA 4ADUA 4DBEA 2XZ7A 3TDFA 4JTEA 1G1YA 2QUTA 1E0TA 2NT0A 1XPGA 5EYWA 2OLSA 3L67A 5LIKX 1OT2A 3BV4A 4IMFA 2ZC1A 2W62A 1HP4A 2ZICA 1YRRA 4TX6A 4IUGA 4B5NA 3QC3A 2JKPA 2A3AA 5B80A 3QM3A 4P00B 3TOYA 3SRKA 5FAJA 2ZXBA 1Q5MA 4UOQA 1XV8A 2CWNA 1J2BA 3IAPA 3PHAA 1GOKA 1IR1A 3NL5A 4QS6A 3BG5A 3G1HA 3L68A 5GNXA 5HPCA 4C1NA 3KOXA 5CGQA 2VOMA 3GVQA 2P0IA 2HVOA 4W86A 2PGRA 4AY7A 2L5HA 3R43A 1TUXA 2AAMA 5H8UA 4QTGA 5AYZA 1JCNA 4US6A 4CVUA 3S5OA 1V4YA 1GQLA 3OJGA 1A3HA 2VP8A 3DI1A 1K1DA 2J7FA 4N7QA 1E6PA 1H0GA 1UD6A 3MSRA 2VDHA 1UWSA 1DXEA 1KCXA 3GY1A 4OT7A 2DVXA 2J78A 3SCUA 4QLKA 3XINA 3A47A 1X6UA 5DRIA 2ZXAA 3QSRA 3VXGA 2VR4A 1MZHA 3ZVHA 4XZIA 3UZYA 1RQEA 2IXUA 3MCOA 3RAOA 3CTTA 3PFRA 4DPQA 1LWJA 1Q6FA 1CGVA 2FKPA 3P8IA 3MV01 2OSXA 4AD5A 3OZPA 1ESWA 2WPGA 4HPNA 1OD8A 3R8GA 1UOZA 3WD2A 4Z2IA 1WKEA 3W7GA 4O0KA 1CLXA 3BJSA 1EX1A 2J9YA 1TCDA 3W1PA 2FIQA 3OZOA 4P8XA 4MY8A 4Q8TA 2V9DA 3EBVA 5EBAA 2BGQA 2C3ZA 5EPDA 4ZBCA 4JEJA 1YNQA 1KXVA 3TMQA 1PXGA 3VIFA 3M7WA 5DY2A 2FB2A 3SR7A 2ZXQA 1NWSA 5I77A 1OCJA 4MNMA 4XAPA 5BOOA 1QI2A 4ZB2A 4DO7A 3DOPA 5DEZA 1SFLA 4JN6A 4C1NB 3VM7A 3ZJ7A 1JGMA 3PULA 2V82A 1GNXA 2NV2A 2ZQ0A 1KKRA 4H1ZA 3F2DA 4NHVA 3BARA 1KQYA 1ZJBA 4XZWA 2HSAA 1W1IE 1XD1A 2VTFA 4U5IA 2XUCA 3TVAA 3HF3A 4JIQA 3N2MA 1YDOA 3N2OA 4HCHA 4WOQA 4TVUA 1N55A 2GGEA 3ZVHB 1J9YA 1GOIA 2GJNA 3AYRA 1E4NA 3O0FA 4J3ZA 3AIBA 1PHQA 3RRAA 3ITXA 4MADA 2DZUA 4Y9MA 1POJA 3AIVA 3BAYA 3CUXA 1QNOA 4FI4A 4M8UA 1LTDA 3F4NA 1Q7ZA 1TTPA 3LHWA 2HDJA 2E77A 3WF2A 3WLKX 4PUDA 1TMHA 1JUEA 1VBGA 1G9HA 2CLEA 1TX2A 3H7RA 2ASHA 4L1XA 3TC7A 2VD9A 4FXRA 5BXSA 3NDOA 1R5YA 3PZTA 1ONWA 3CTLA 1V79A 1UZHA 3W1RA 3PM6A 4M7SA 2A3LA 3CPGA 2FH8A 4J7RA 4W4QA 1AZ2A 1JZ6A 1KFLA 4R33A 3W86A 2F61A 4NX0A 4AVOA 3IEBA 4DBSA 3NOYA 4FK9A 3LY0A 1KD0A 3TOPA 1Q8AA 4O17A 4LEFA 2R1KA 3OZMA 3UYIA 3SRFA 1VCGA 1F5ZA 2WVTA 2D1ZA 1JIBA 3FSUA 1G6CA 5CAHA 1WZKA 1XLMA 4JQAA 3NSMA 3W7RA 3T42A 3NGJA 2BOGX 4QLLA 3JVAA 2PCEA 3NQ7A 4JQ1A 1YTKA 4E8DA 1H3GA 4IJRA 4TMBA 5M17A 3GIYA 2Y61A 3EPNA 2J6XA 5H1WA 3GTHA 5HULA 2J75A 1XICA 2GUBA 4NASA 1WV2A 1LLZA 1C3FA 1HKIA 1JDFA 1SZGA 4Z1BA 1RQBA 2PCQA 1XLBA 1NOWA 5B7YA 1E9IA 1JPKA 3BOFA 3DFQA 4W8AA 1VKFA 3WDQA 2BDQA 1QRQA 4NJKA 1R9YA 4QP0A 1XCFA 4ICCX 1V6XA 4GQGA 1B3ZA 1EGMA 4IP4A 2ICSA 3QZ6A 1L8PA 3A4AA 4GXWA 3I3DA 1IXNA 2D69A 1MRQA 5TD4A 3TN4A 1QW7A 3ES7A 2E6DA 3WJWA 1POKA 4HNOA 3H55A 3L7RA 1JCTA 3HG2A 4GK8A 1ZP4A 3M44A 4U33A 2VX7A 4ZSTA 3WD3A 4BS0A 4GXMA 5AVHA 3TTOA 2X42A 3L23A 3W6LA 4IQLA 1ICPA 4F0SA 1A49A 2Y63A 2RUSA 3R2GA 3W1NA 3W1MA 3NPWA 3QPYA 3CAKA 5HWNA 1ZLPA 4G7EA 3SFKA 5HAOA 4INFA 1NEYA 3BO9A 5AECA 4BJHA 4GISA 2Y89A 3JZEA 3ZT6A 1LZOA 1QO5A 1J8VA 3CQIA 2NW0A 4LBRA 1S46A 3VOHA 3UBPC 2R1NA 3NZ1A 1WKFA 1DQXA 1TIWA 1SU5A 2WVSA 3TNOA 1VHCA 4B4FA 4KEMA 1DWGM 3GC4A 1HL8A 4KFPA 3M5YA 3LM7A 2E1DA 4CQBA 3DKJA 4FOJA 2JK2A 4PRTA 1FH8A 3SQLA 5MF5A 1UQYA 4W7WA 2VWSA 3HPAA 1Q6OA 2OFJA 5D9NA 2H3BA 3I10A 3TYZA 1V3KA 2UY5A 3HN3A 2WCAA 4W85A 1M7OA 1XKJA 4XSMA 3EX4A 3BVJA 1O95A 3ARRA 1R2SA 1LWHA 3CMGA 2WZEA 1F8MA 1JF6A 4YL2A 1TPUA 1GGOA 3PZGA 3GFXA 3W7DA 4M3PA 3ISIX 1R3RA 4KMQA 2W61A 1QJWA 5I7GA 4ZOEA 5I3FA 1I2RA 1VQTA 2RH9A 4AY1A 4W93A 2A21A 1H7PA 4FA3A 4GYPC 3ZOAA 3QMRA 3CAVA 1XC4A 3I3EA 3N2XA 3DFOA 2ZVRA 1UC4A 3GKFA 3U48A 1WO2A 5G4EA 1TV5A 3B4YA 1LJYA 2B7NA 2B4GA 2JIEA 3BOLA 4GQBA 3WUEA 2ZE3A 3VIIA 1HJXA 1XBZA 2NX3A 1CGXA 4MHBA 4IFOA 2VZSA 3NO1A 2VEPA 3MDWA 5IM51 4DJDA 3CZJA 4FALA 2HCVA 3H6OA 5I3KA 4UTHA 3OHIA 4G7EB 4IGMA 1KB3A 5CSRA 4Y2WA 3KZPA 3LV5A 4UMCA 3STPA 4D6JA 4Z1DA 2GGGA 1V93A 5A6SA 3E2SA 5FJIA 5LGZA 3GH4A 3QTGA 1HKWA 4OVXA 4MGGA 4HVXA 4POCA 1OVDA 2YDQA 3WF0A 4MAZA 1QHZA 3DGBA 2VFDA 2WKLA 1QNVA 1OIFA 1HIZA 5D8WA 5EB8A 3GYCA 7PTDA 4UFJA 3VNDA 4L5ZA 2QJMA 3MI6A 3QYSA 3MC5A 4FP1A 3LENA 4S3AA 3W1XA 1V6UA 3O9NA 4GCXA 1EBHA 3CZEA 3LUTA 4Q8WA 3CYJA 4MAVA 3V4BA 3KHDA 2V81A 3T7VA 3T08A 3V75A 4ONVA 1NWTA 1B3OA 2GJLA 2ZRUA 2ATSA 3KFTA 2NSOA 4CNSA 1B30A 1PAMA 4F4RA 1V0MA 3AXXA 2DW6A 1XBYA 4H8NA 3M6DA 4KEUA 3V1HA 2TAAA 3SRDA 3VFLA 5HJXA 4QROA 3SW6A 2GQ3A 3OBEA 1JXKA 4O1AA 3WQ6A 3C0LA 3K2GA 3BOXA 4RW3A 3VIJA 4GY0A 1V5XA 3HV9A 3VCCA 1QK2A 5FF3A 2PI6A 5AHNA 4OQVA 2PTXA 2UBPC 1TX0A 5HJLA 3LBOA 2ZX5A 5FJTA 3NDYA 4EE9A 1E71M 1IEQA 6A3HA 4JYEA 3TUUA 1HN1A 3JS3A 3AXMA 5E09A 3EOOA 3GVRA 3P5ZA 2X8RA 4Z0SA 4NRSA 2PWVA 5E0FA 3IIOA 3QV8A 3A3WA 2POTA 3DFYA 4HSHA 3CYVA 3UR7A 3PJTA 5HNRA 3DDMA 3TZFA 3UA3A 5I09A 1QOPA 2ZUWA 3C2EA 2WHJA 3CQHA 3TSDA 2Z25A 2Y5SA 3E96A 4FO4A 3MVTA 1I1XA 3QZAA 5D9MA 1UROA 2GK1A 2ALDA 3E74A 2HK0A 4LTSA 3H8AA 4YYFA 2VGBA 5JBEA 4JXCA 3KM8A 1ISXA 2ATMA 3SSJA 4GVFA 4YTTA 2Y8KA 2PZNA 3W28A 2Q02A 1EX5A 3OYZA 1BLIA 1JXJA 6CGTA 1LUCA 4GJ1A 3WLMA 1ME7A 4H3DA 1VBJA 2Y8VA 3BLDA 4MB1A 4LRTA 1FWBC 3V36A 1HJSA 4DN1A 3GFYA 3F5LA 5AHMA 2BS9A 1AQFA 3CT2A 4RPQA 2D0GA 1O4UA 1H60A 4ZO9A 1UBSA 3TSBA 1MMFA 4X0VA 4M7TA 3T6CA 2JEQA 3LNPA 1ZPTA 4P7RA 4H8UA 3FA3A 4W9TA 5I3HA 1YQ2A 3LBCA 3LSCA 4HMNA 4LYKA 1RBOB 3BSGA 3BUVA 5LHEA 4XAFA 2HS8A 4DO4A 3UZ5A 1OY0A 3C56A 4KT2A 3U2CA 4PZVA 3I7SA 1GYLA 2G4JA 2IPWA 1E6NA 4C6MA 3TN5A 2D3NA 1UUQA 3IV8A 3WUBA 3E9AA 1E1EA 2V3DA 2J4GA 4G1KA 4GG9A 1JI2A 3QRHA 1SO5A 2PWFA 3OZYA 1NP0A 3WQFA 8CGTA 4I9AA 1BYBA 4M6QA 4AX6A 3UG3A 3QPZA 2PRMA 3EDEA 4LOCA 4FIRA 4KWWA 2AQWA 2GK1B 1D2KA 2WO5A 3MQTA 4I5RA 3FAWA 2OTDA 4YVPA 5FL0A 2FFCA 4AD4A 2PDXA 1QI3A 4REQA 3O7UA 2R8WA 4MTVA 4DWSD 3CK5A 3QHMA 4UBPC 1RUSA 4PRWA 5JVLA 1LUCB 3LZ3A 2P53A 5AC4A 3DERA 3APYA 2R82A 3H21A 4XG1A 1KRAC 4N9DA 3RMEA 1EF3A 1W1TA 1EYWA 2I57A 2H6RA 4HHMA 1VPXA 5LNUA 3URAA 5M03A 1V3HA 4M6PA 1DIEA 4A29A 1GQKA 2V69A 1LQ2A 2HE8A 2QUVA 1JDCA 3DYPA 2PZ0A 1XKYA 2GQAA 4HNCA 1EIBA 1M6JA 4MPQA 2OODA 4Y9AA 4IMEA 2WC4A 5A6JA 3A13A 1L9WA 3FXYA 3UT0A 5AZ1A 3GU9A 3KVMA 1FDYA 4IP7A 5DLCA 3B9AA 3MP5A 4GYKA 3UGRA 4RDVA 4IICA 4P61A 5D02A 3M6YA 3L5AA 3AIWA 2J7GA 3MZ2A 4R27A 4A3YA 1MDRA 2VZUA 3VX1A 4GX8A 1U1HA 4NNAA 4L9ZA 3TYBA 1AW5A 3S2LA 3RFAA 3SRHA 1R86A 2J27A 1C9WA 4R5EA 3URQA 1CDGA 1EJTC 1ISYA 4DRSA 3FHQA 4UQ9A 4PB3A 4E4UA 1WB0A 4C6NA 1V6YA 2OGYA 4XBJA 5E0KA 3WH9A 5A6BD 4ZQRA 3N9RA 4KS0A 1K7FA 1KA9F 1Q6QA 3RU6A 1E9ZB 3NCOA 2J77A 2XSAA 4LY4A 4UTWC 2PBOA 2QVNA 1W8SA 3GH7A 3AYVA 2BASA 5HQLA 2EEXA 1W0MA 1SUXA 1H41A 4REQB 1B0IA 2P8CA 4V15A 3UD6A 3NQBA 2AGTA 1P1MA 4FZIA 4YLWA 1YBQA 2CESA 3WENA 1RVGA 3DU0A 4W88A 1NFBA 2C8NA 4PTDA 2PDWA 1C7SA 1G5AA 4O57A 1QNQA 1EC7A 4NY2A 2AKZA 3RDKA 4S3BA 5J8LA 5F4XA 3UY7A 3J7HA 1PB0A 1LOSA 3VA8A 3G8EA 4DZAA 2NT1A 2F6XA 2X05A 3EA2A 3M07A 1ZHAA 3LQGA 5DQPA 5HMDA 5A94A 4LS0A 1OG0A 3AISA 3ONCA 3FEMA 4IISA 4PUWA 1BSIA 3F1QA 2I9UA 3ZO9A 3VTRA 3DHUA 4Q7IA 3AHTA 1VC4A 3CPUA 2W9MA 3WNOA 1SZEA 1EP3A 3KW3A 4MG4A 3F5JA 3CLMA 1DOSA 1VFTA 3NM3A 3OVQA 1HT6A 3K1GA 2QIIA 1LQAA 3MWCA 1T8XA 2DIEA 1HL9A 4PUMA 4WSKA 3CHEA 2W67A 1FCUA 4EPKA 3RU8X 1XFBA 3BG3A 2EPKX 1W6TA 1W9XA 5XIAA 4H83A 3NQ2A 3LSBA 5G4WA 4IF2A 2OEJA 5DMLA 2CXEA 3H54A 4DO5A 4JQ4A 4IIEA 4NJIA 4NQ1A 4QSHA 4GQRA 3LCFA 1JZ2A 2HXTA 3THAA 3AUOA 2WMKA 3I6EA 4I9MA 1CB7B 4LANA 1YBQB 1PUDA 3LI1A 5I07A 3DYOA 5BWFA 1S5WA 3LEPA 4S3KA 2A2IA 4NNCA 4NZ1A 1OFBA 3KE0A 1GVIA 3F2BA 1JRBA 2V38A 2WNWA 3QOKA 5BW6A 2VGGA 1XD0A 1C90A 2WZTA 3HG4A 4UQEA 2PTWA 1VR6A 5IDIA 1XINA 1KGWA 1JUBA 1S38A 1MYRA 1WDSA 5A6TC 1WBHA 1J4EA 3CAWA 3HIJA 3AS1A 3CV1A 3L2LA 4PE8A 2I17A 3NFUA 4IOTA 4M80A 4HQVA 3T05A 4G2DA 3MHFA 3OBAA 3KTCA 3FSTA 1TPWA 3P6LA 1ME9A 1SZNA 3MTWA 1PCKA 5D33A 4AC1X 3IV3A 4M51A 4FXJA 1W3KA 4Y9PA 2DZXA 4WGXA 4WJ8A 4MDOA 2QZRA 1W3JA 3LBMA 4FNTA 5KTLA 3S9ZA 2WKJA 2E09A 1TMLA 3LGEA 4DWSA 3LGGA 1ECEA 1EA0A 1IXQA 1NM9A 1XYAA 2CC0A 3GG7A 5D2TA 5HR7A 3T40A 4HCLA 4Q4RA 5C2XA 3FHAA 1I6NA 2V5CA 3MA8A 3D0CA 2W63A 1TMQA 2CETA 3G5EA 1EQCA 9XIAA 4PSRA 5FIPA 2D20A 3EDFA 4PEKA 1GJWA 5CBBA 4IIGA 4Z2JA 3MHGA 1Z69A 1BEUA 1SSGA 2JEPA 5AHEA 4TTGA 5D9PA 5IHSA 4UFIA 4D6GA 2VFHA 5HOSA 2E0PA 5G2IA 3B8DA 4GBUA 1W1B1 4WXYA 1CXIA 3VOCA 1FP8A 2INZA 3ABQA 1EH9A 2FPYA 2NQLA 4NF7A 1VBRA 5DCEA 4CNTA 3VIGA 3I68A 1DE6A 7REQA 1W54A 4Q4OA 3LK6A 4TMCA 2PLMA 3QLDA 3CZLA 1JNDA 4J3VA 3ERPA 1ZUAX 2NUXA 4UTLA 3RHGA 1W9UA 4N42A 1CLVA 4GYFA 5D04C 4R85A 1C8YA 4BEQA 3CB8A 2HJPA 3WQWA 4BI6A 4D8LA 2ON3A 3SEPA 3TYCA 3EOUA 4D6EA 3KVKA 2WSYA 2Y70A 3GXTA 3THQA 3SDOA 1J96A 1MUMA 2C0HA 3EKGA 3NXLA 3UETA 5LIWX 4OFCA 1WBJA 3W7HA 4F66A 5A6BA 2HBXA 3EDJA 3WMSA 4XD6A 3W7EA 4GJIA 3HG3A 3LXCA 1H7WA 1XSJA 2DIJA 4JZ5A 4B5XA 2G37A 1FH7A 4HKPA 1W5NA 4UIOA 5GQBA 3VDHA 1GZ1A 4UTJA 3R79A 3UERA 2WOQA 3U7VA 3SZ8A 1B1YA 4DWSB 5K4XA 5BRPA 1VEPA 3W53A 4XZ9A 1UR8A 5LIYX 1Z44A 3LPGA 2UY4A 1MZRA 2VO5A 2C91A 5ABTA 4ATDA 5BNKA 3DESA 3GFZA 2J7EA 4XSLA 3FOKA 4P02B 3LTYA 4Z17A 1OZMA 1H2JA 2YPIA 2XWEA 3SGUA 4W7VA 1E43A 5RUBA 1UR1A 4TR9A 1SW7A 5K2ZA 2DDXA 3QV6A 1RBAA 4PB4A 3KOFA 1AJ2A 4OBRA 4H2HA 3DFTA 3INPA 3BDKA 2E6FA 4I8YA 3HPZA 3B0YA 3USBA 2YR1A 3LNMA 1OM0A 2EPLX 2CW6A 1XXXA 3PC0A 7REQB 1EHAA 1SW0A 1VFHA 2XVNA 1XLAA 4ZL1A 2FVKA 4HU3A 4IQDA 3QLLA 1TB3A 4IUOA 3SCOA 3PBGA 1PYFA 1ZNNA 1UJPA 3OYXA 3DN5A 3I65A 5K9XA 1OCNA 1KQZA 3QMTA 3T09A 1DIDA 2UV8G 2EPOA 1D8WA 3O6AA 3IRDA 2NLYA 3UNDA 3PTMA 3Q4DA 3TV8A 2J79A 4L80A 1SR0A 3L4ZA 4H9VA 2NXHA 4E4PA 1E9LA 4UQCA 4HZ7A 1IR2A 5F2IA 1FHLA 3VM5A 4ZENA 2ZUSA 4RE3A 2AOSA 1R87A 1XF0A 3ECQA 5A69A 4L4PA 2Z1BA 2V5DA 4XUYA 1FWGC 3SM0A 3VKAA 2Z1VA 5CSUA 5DBTA 3WH8A 3MMDA 1WUEA 3LA4A 2J7BA 1SJBA 3PY2A 4H9UA 3TIMA 3CL6A 2E68A 4GI9A 1W1VA 3JW7A 3B8IA 3M43A 3W3OA 1XDMA 4B2DD 1M65A 4FMVA 4D6DA 3PAOA 1QW9A 3BG9A 4HN8A 1E15A 1FWJC 1ZAJA 2FLIA 3PBYA 1VENA 4DYEA 1UUMA 5FJRA 2G41A 4O1FA 4GUIA 1PZ0A 1F2JA 3GW0A 3SSZA 3PUEA 3HGJA 4GZEA 3LLXA 2WXDM 5K9DA 4S3EA 4QGCA 2G3IA 2ZRWA 3L4VA 4L9XA 2IQ0A 4FIQA 5FESA 5DBUA 1NTHA 3M41A 1ZAIA 1PE1A 1CIUA 2F38A 1GEHA 3GZ3A 2OLAA 3LG3A 2GLKA 3K4WA 3N15A 4PMNA 2HWGA 1VS1A 2BZNA 3JR2A 4RNHA 4HYVA 1HP5A 1Z89A 2GVJA 3LHUA 5HWMA 1E1FA 1GKRA 5GJPA 1IT7A 3AHYA 2DZSA 3FA5A 3VMNA 3ALGA 1OFRA 3ITLA 4XD3A 1SFSA 4DX3A 4BR1A 1W9DM 3VIHA 1QWGA 2Z6IA 1K6AA 1DWHM 4MJZA 3KCLA 4C60A 1XLKA 4PTNA 3S47A 3BAJA 1R6WA 3TK7A 2VX6A 3WLIA 4JIIX 3EDDA 1P0EA 2V5KA 1FFRA 2QCLA 3VKBA 2H9AA 3N3MA 2PP3A 4HJFA 3O2LA 1FWDC 2Z26A 3SJNA 1W1YA 4LVFA 5G4HC 1O66A 2AMXA 4IMDA 1VGAA 3PG8A 1DWJM 3DFSA 4AISA 3NR0A 2XIJA 1Q2RA 3W0KA 1R3TA 2PLCA 3UVIA 4JTLA 4AHOA 3K4DA 3TAOA 3TP4A 2Q8ZA 3VPLA 1CEOA 1FHVA 1CTNA 3PPCA 1H50A 1FWWA 3VINA 4ZODA 3P84A 1DXIA 2OZ0A 3W22A 1XISA 3VCNA 2CEQA 5I00A 4QSFA 1SM9A 2EPHA 3L4XA 2W92A 2GSJA 1JQVA 1RCXB 1TTIA 4A2RA 3TN6A 5HK4A 3UJRA 1A5SA 1EWDA 4DPPA 3PR2A 4DM1A 3HO8A 4OIFA 3BWWA 1PZ2A 3WK0A 3PB2A 5AC7A 4LBUA 2VHLA 1EUNA 4IG2A 1K3UA 3QHOA 4RZBA 4IGNA 2QCGA 3FJ6A 4CGTA 2DSWA 1JVNA 1F9CA 3GDKA 4B15A 2QS8A 4AEFA 4HU4A 2AL2A 3QR0A 1Q65A 4CD5A 1KGXA 2VYOA 5E1QA 4DO6A 4JNYA 1X38A 2CLMA 4HU0A 3WMBA 5G1MA 2ZA3A 4HMDA 1YXDA 2BOEX 2OSWA 4QG6A 4UTIA 2VJXA 3C2YA 4PN2A 3F4DA 2A6LA 3V0SA 2FVMA 3O3RA 1BF2A 3TTQA 3B8UA 1TV8A 4RDWA 3TQKA 3CUGA 4TOQA 7XIMA 1AW2A 2DT3A 3OBKA 7ENLA 3JUGA 1AL8A 4WHBA 1D9EA 1R38A 1CZ1A 4CNPA 4LVGA 4O12A 3KTSA 1LCOA 3RNDA 2QNEA 3VD5A 4UR8A 1KLYA 4MNLA 3MHUA 3NPXA 2Y7FA 3SIZA 3OVRA 4B9YA 4B3LA 4U28A 1F05A 2IPJA 2VCBA 4GABA 4Y8EA 5LNRA 3BAKA 4JGDA 1K02A 1GJPA 1GTHA 1E6SM 2GQ9A 1KBIA 1J18A 5I2UA 4F2TA 3UJSA 4PODA 1MFUA 3N6QA 1R85A 2D2OA 2WKGA 3HBLA 1GVYA 3IJIA 4ROQA 2ZA1A 2HNHA 2CBIA 1LF1A 4IG2B 4EIVA 1J0IA 3G6MA 1DE5A 1FCVA 1BG9A 4I7UA 1FDZA 2PDGA 4MZYA 1F4AA 5CSSA 2DT0A 3E0LA 1VPYA 1CGWA 2JIWA 1DQWA 4AZ7A 3NL6A 3QQ1A 4UQAA 1A3WA 4WSJA 3W2MA 3C2FA 4CEUC 2AL2B 5LA2A 3C3UA 1RLDA 1NJJA 5A6LA 3CAQA 4C6FA 2DY3A 3COTA 3QSTA 3EWBX 4B2DA 4CCEA 2PPGA 1ODZA 5C71A 3CPRA 1SJAA 1R3YA 3SCSA 4K7YA 1DTNA 2ISVA 4X22A 2O56A 2ZIDA 3TROA 4EXQA 2WSRA 3OLEA 3AXIA 1HJWA 4XO7A 5KZEA 2W4XA 1F74A 3LD5A 4PMXA 3ZLHA 4LX4A 4HZMA 1R7OA 1W3NA 3W73A 2WC7A 1A5BA 2YFNA 1I4NA 2YBTA 5I24A 3CZGA 3O07A 3G77A 1CYGA 1K7XA 1H11A 4ERIA 3AROA 1Q13A 3MBDA 3QY7A 3BCJA 3EKZA 4EP8C 3HGSA 2W0UA 4R34A 1QDSA 4C6CA 1OEPA 4DJED 4K38A 1VIZA 4F48A 4FEZA 4GO8A 2TRSA 1TPB1 2NVAA 2VEFA 1TE1A 2O55A 3DBPA 3EXSA 3PTQA 5U7SA 1K4HA 3SJ3A 3TR9A 3MSYA 1PCWA 5FSDC 1EC9A 3W1LA 4DZHA 2EBNA 4HHLA 1FWHC 3VNJA 3BJFA 3Q58A 2V2HA 5EMJA 3SFWA 4LEQA 9XIMA 2YA1A 3NZRA 1JRCA 1US3A 2PDLA 3GH5A 3NQAA 2DT2A 3WNPA 4NYUA 5DMNA 2XINA 1ZQ5A 4BKNA 4FR6A 2CLOA 5U4NA 3WD1A 1T99A 1BKSA 4OKDA 3VIKA 2A85A 4NP7A 1HL2A 1FKXA 2F8QA 4JN8A 1BKHA 3KRZA 2VD8A 4MSSA 4A6GA 4E2BA 2DJLA 4I5XA 1JL8A 4AYSA 3GDMA 3WX7A 4S3DA 4F0RA 3DUGA 2NV1A 1XC6A 1BGAA 3BZJA 4E5TA 4UB9A 2X7VA 3TJXA 3VD4A 4AH7A 4YNGA 2FMOA 3DCPA 4M1RA 5JH1A 3S46A 5EMLA 3NURA 3PJXA 1GJUA 3UWWA 5E5CA 2G3FA 3ABSA 4S3JA 5JU6A 3GNRA 5F1VA 5FACA 3S1VA 4AZ5A 3M0JA 2A4AA 1SPQA 2WJFA 1NVMA 1FY6A 3BICA 4K1GA 3SUVA 1EA9C 3CHVA 3LMYA 4TTUA 3QW4B 1E6RA 4C1LA 4XZHA 3RM9A 1WZMA 4MWAC 4MWAE 1D7KA 3S5ZA 4O50A 4D72A 3ZXWA 4WZHA 1Q66A 3ARPA 2NZLA 1IGSA 2I16A 1VFLA 4PTVA 1UD4A 2FTYA 3R89A 4GWEA 4LNCA 1LLOA 4WY0A 3TJIA 1HKVA 1EP2A 4DF2A 2P3ZA 4AF0A 3PPGA 3RR1A 2XDFA 1UBPC 4XVDA 1MW3A 3BW3A 1FWFC 2E1WA 1F3TA 1XYFA 1AJZA 2AL1A 4H9YA 1RBLA 4B5WA 4GPNA 4HNVA 3F4WA 2YCEA 4Y9OA 3W81A 3UFYA 4ZTYA 1NIUA 1I75A 1V08A 1KM4A 3GDTA 2MNRA 2OT1A 3AS2A 2PSNA 4HBKA 2YZRA 7CGTA 2BX7A 1KFJA 3BLLA 5CAKA 3WQ5A 4UFKA 3VNMA 4ZZ9A 1BQCA 4FLSA 3MJMA 1U1UA 1S2UA 3GU2A 3VIOA 1QFEA 3PZIA 1PJ9A 1PWLA 4B4HA 4LALA 4ATLA 3RILA 2ZFAA 4WEVX 3QGKC 3WF3A 1UR0A 5EFDA 1KCKA 2CLHA 5JQ9A 5CH9A 8RUCA 1A5NC 2BP1A 1Z6KA 1E55A 1QNRA 5C9RA 3KP1A 5A2BA 4O18A 1REQA 2G95A 1KBBA 4WLCA 4GLEA 4I3GA 1E6XM 3PBUA 1EZ2A 1M41A 3NQGA 3GXFA 3P62A 4O15A 5C2GA 2YB1A 4M24A 4UQDA 1JCYA 4N6FA 1XI3A 1WP6A 2AGKA 4LF1A 2R14A 1NH6A 1ITUA 3BSHA 2H90A 2GQ8A 2ISDA 4UTUA 2JF7A 5HBFA 1A50A 3SQMA 1SO3A 4NU7A 1AZ1A 1DJNA 2GSEA 1LORA 2PURA 3LPOA 2DUZA 3EB3A 1G94A 2PDNA 1N8FA 1U1JA 2D3LA 4GD0A 2XN1A 3KBVA 5DF0A 3UZZA 3CUHA 3N11A 3MMWA 2GUYA 1EP1A 5XINA 1DWAM 2ONEA 5F7UA 4QR6A 1W5MA 3FAXA 1XHGA 3HG5A 4WY0B 4DYKA 4CCCA 4AF0B 2J66A 4KRZA 3W07A 1TPC1 4DJFC 2EKCA 3ARQA 1UR9A 3B4UA 5C9UA 2GJRA 4AIUA 3MO7A 5TQLA 2EG7A 3WJZA 1MFVA 3ICJA 4OOUA 3CZ8A 1FQ0A 3A9BA 1PDZA 3TTEA 3N13A 2QDEA 5EGRA 4RZ6A 4XIMA 1O1ZA 3U3HA 1TPVA 5EIYB 3SUWA 3CHCA 4Y9NA 4LCSA 3VDAA 1X8CA 3T0CA 2WSQA 1ZS2A 2LLEA 2A3EA 3TLLA 4ILSA 4PBEA 1KO0A 1H62A 4GQ0A 2Z2BA 4JDYA 4DJEA 4N02A 1BVWA 3QYQA 3RMJA 3WUFA 1QUMA 2RJGA 5CC5A 5KSWA 2OCZA 2WBGA 4HK5A 1KNWA 3NIYA 1DXFA 1UKQA 4E2OA 2QW5A 3KXQA 4DVOA 1NOUA 2ZZ3A 3N3TA 1REQB 3TA9A 1CWYA 2WNZA 3C3NA 1FXQA 4QQ3A 2WANA 4MLRA 1JFHA 4ROPA 2HK1A 3FVMA 5LXEA 4GE8A 3G1DA 3R0DA 3W7OA 3EEZA 2CBVA 1VJIA 3MPGA 3CASA 3TR2A 3H2FA 1XYLA 3BAXA 1YX1A 4W5UA 2JE8A 2WMGA 1JZ5A 1L6WA 1XH1A 2FJUB 4H6EA 1W32A 1E70M 4E6MA 4ZVJA 2Y5JA 1VAHA 3OA3A 4R53A 3VGBA 4YMZA 4YJ5A 4NZ5A 1JZ7A 1E51A 4DBWA 2BY1A 3AICA 1S1RA 4KEZA 2Z7GA 2OX1A 1TSIA 2FTWA 3GTNA 3G3MA 3PZQA 4EK7A 2CZVA 4W7UA 2PGWA 2Y62A 2YFOA 1DIOA 3FLUA 4TX9A 4YVXA 4WQ6A 3LHTA 1KXHA 4XTIA 1HO1A 1LQ0A 6PTDA 1A5CA 3GXPA 4AMAA 1Z42A 1UWUA 3IVSA 4QEHA 2XN0A 2X1RA 5A2CA 3B06A 3E12A 5HMFA 3L0KA 1E5JA 2HE5A 3EB4A 3WLOA 3CQKA 3TW6A 5JBFA 3UWUA 5D05A 3UZWA 4EX4A 4HPXA 3IUIA 3IANA 2OOFA 4ATWA 5IOBA 3MO4A 3QTPA 1OFDA 2G8ZA 2RDUA 1FWIC 1FTXA 1GZJA 2O7SA 4GKLA 3UWQA 1MW1A 4RKAA 4IPIA 5CCZA 2QV5A 4WX2A 4S2BA 3V5CA 3AMCA 1O60A 4K39A 3FVDA 2D2GA 4QJ3B 1TZ7A 1IZKA 1FH9A 3ARVA 5DXXA 4HSOA 4GA8A 4LV4A 1E4MM 4MKNA 3IRSA 1J12A 4P7LA 3QMSA 3WL1A 3G0UA 4ZQCA 1IF2A 3TW7A 3UF9A 4QCEA 2H8XA 4NG3A 4D6FA 1YDYA 1LL7A 2X0HA 2V6AA 3WF4A 1JI1A 4H8HA 4GZIA 4C1KA 3CZKA 1GHRA 2QMJA 3W6MA 3RCNA 4F9DA 2CZEA 4XZLX 2ZOXA 3MCMA 3M16A 3NAVA 3STCA 1OG6A 4QQUA 2ZTJA 3BZGA 4J3TA 3E0WA 1ODUA 3Q2DA 4LU0A 2XVKA 3OP2A 1JG9A 1IQ8A 1CBGA 1RY8A 3MV11 3KS6A 2V3FA 2JKEA 4AZIA 1PWMA 1EC8A 4IFRA 2BGNE 5C9ZA 2DH2A 3PWIA 3RLVA 1ALDA 3W85A 4E3VA 2TODA 3W83A 5EJ1B 3LX9A 1XIHA 1CCWB 4WIWA 5LA0A 4DXXA 3N29A 2ZZ7A 3ZYZA 1R3WA 4US5D 5C9WA 5CPNA 3MUAA 2V5LA 4LV9A 3WQEA 4JHZA 4NJGA 3STFA 3BQ6A 3CO8A 2CZDA 1H5VA 4PMUA 3KBNA 3FCPA 2Z2UA 2QAFA 3SURA 3G1RA 1DTUA 4QDMA 3HQNA 1YW1A 1R3SA 1NFPA 3FY1A 2OZ3A 2XISA 2C15A 2A7NA 5J5RA 3SCNA 1NP2A 4HT3A 3EKLA 1W3HA 4LUJA 5BOFA 2TPSA 3W71A 1V3IA 3TONA 4Q8OA 3TC3A 4IGSA 1JZ4A 4NVTA 1VEMA 4NUWA 3POHA 3BCDA 4RNFA 3TYUA 2HTMA 4AC7C 4O1CA 1V7YA 3DYMA 3QZEA 1G4SA 2R94A 2BVWA 4KKXA 2DZAA 3CO4A 4BEUA 4ZXOA 1HTIA 4WOZA 1YDVA 2CLLA 5AYYA 3P8JA 2NQ9A 1GOXA 3A5FA 3B8VA 3AJXA 5CC7A 1ZJIA 1MQRA 3THUA 3WNKA 4JS3A 2C1IA 3PJWA 4MFDA 4OUIA 3S2JA 1KM5A 1OFQA 4NJHA 1AK5A 2I14A 3I4EA 3O15A 1M53A 3QH2A 4U10A 2XZ9A 1XDLA 2NWSA 3K8LA 1D3HA 3VAVA 2XN2A 2W66A 1A0EA 4MF4A 2EO7A 3DG7A 2XJ7A 1VFOA 4IQJA 3KCOA 4AWEA 2XHYA 4HJWA 4D6HA 4LAZA 2HROA 1D7FA 5B7ZA 4GC4A 2GOUA 2XM1A 2YA2A 3G1FA 3QF0A 2GSHA