1K9EA

Crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with 4-o-methyl-glucuronic acid
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
676
structure length
671
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAVVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRRWWKETAKRIYQYIPDFGGFVVKAPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-D-glucuronidase
publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 271
structure length 671
sequence length 676
ec nomenclature ec 3.2.1.131: Xylan alpha-1,2-glucuronosidase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1k9eA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1k9eA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1k9eA03
1KFWA 2C8NA 1WZAA 4DM2A 4PYSA 4BQ4A 3CZKA 4UFJA 3PZTA 4JFVA 2XIBA 1TG7A 3ZT7A 3AZRA 4OIFA 1DHKA 1KBBA 4AYSA 2GJRA 2QMJA 2D24A 2VVNA 4IPLA 4Q22A 3W27A 4CD5A 3A47A 4OOZA 4JKMA 3ZJ6A 3AXHA 3WDHA 5A69A 4IISA 1EOKA 4WKFA 1JYWA 1JF6A 4PMQA 2VQUA 4W86A 4YN5A 4BF7A 2VVSA 5DT5A 2VR5A 5ABEA 4M8UA 4GI6A 1TVNA 3OA5A 3U57A 1KB3A 4MJ4A 3SCPA 3AS3A 4P8UA 2IXVA 1V03A 1V3JA 3WDQA 3NDZA 3IANA 3OGRA 2EO7A 1NWSA 4PTMA 2VZSA 3I3BA 4B9YA 3I3EA 5C71A 3CH9A 5ECUA 2ZUVA 1EIBA 2BVYA 2J7EA 1JYVA 3OLDA 2WLYA 3UG4A 1VFMA 1FP9A 4X0NA 2J7HA 2OSYA 3EDKA 5BWFA 3MKKA 3SCOA 1E4LA 5JUVA 1ISZA 3WNOA 3CLWA 3WIJA 4HA1A 2VT0A 1UOKA 4YPJA 2X2YA 1TA3B 3GDBA 3WMCA 1OIFA 1VIWA 1FH9A 1E56A 8CGTA 3RJYA 2WANA 3ARZA 1UD6A 3F5LA 4HMDA 3PZUA 1UD4A 1E4MM 2VCBA 4Z2LA 1LL4A 1XH0A 4JAWA 2DT2A 2CBIA 1W1TA 2CETA 3QGVA 3N18A 1GOMA 4XV0A 1HP4A 4H8HA 1W3LA 3ZIZA 3W53A 2XFFA 2J8GA 3ZO9A 4D6FA 3BLKA 4EK7A 5M3WA 2BV9A 1MW1A 1RD6A 2X1IA 1P6WA 5M03A 3SCNA 3EBVA 1E72M 4FLSA 4PMUA 2J4GA 1R85A 2CCRA 2OWXA 1L8NA 1UWUA 1UKQA 2CESA 3ARQA 4NF7A 3BC9A 1QOXA 4UOZA 3VINA 4LGXA 3SEPA 1B3YA 2VUYA 5A8PA 3WH6A 4AZCB 2XWDA 3UEQA 3KE0A 4PSRA 3AHYA 2OYLA 1QNQA 2ZXAA 3ZM8A 4RL3A 1YHTA 3PTMA 4MDPA 3U5UA 3WELA 3WUEA 3AIVA 1WDRA 2JALA 5DMYA 1JYNA 1QBAA 1SMAA 1W9DM 2FH8A 2FDMA 1W2PA 3GZAA 1EA9C 5GNZA 3CTTA 3CBWA 5CXPA 3WKZA 1AQMA 4HOZA 3O6AA 3NYDA 3UG3A 2G3NA 1B0IA 4JHZA 4MAVA 1BYBA 1KWKA 3T0BA 5LYRA 3EYPA 2XVGA 4CD7A 2WWCA 3E1F1 3G6MA 4XUYA 5C8BB 4PTWA 2NW0A 3AHVA 2ZX5A 1D3CA 1UKPA 4KWUA 1C7SA 4W89A 4F8XA 1JNDA 3MSDA 2WK2A 1JI1A 3CUGA 3BAIA 3MUAA 3WNKA 1JD9A 4W8BA 3FNDA 2RGLA 1CENA 1JZ6A 1NH6A 3THDA 2CBJA 1XSKA 1QI4A 4EKJA 4L4OA 1M04A 3VDBA 2WC3A 1H2JA 7TAAA 1Q6FA 3MANA 2ZIDA 3WL0A 3B9EA 3L4WA 2AAAA 1V3MA 3SUVA 1GVIA 3GNRA 2NSXA 1GOKA 3MUY1 5BRQA 5DFAA 1ZS2A 2O92A 1E4NA 4GZEA 1KCKA 1QPKA 2DIEA 4JL2A 5CLWA 2ZWYA 4X0VA 3A4AA 3WQWA 4M56A 5FL0A 1CGUA 2WKLA 3NSNA 1CLXA 2EJ1A 3AHTA 5CPQA 3TTQA 3WNLA 1JXKA 2WMFA 1ISYA 1W2VA 3RCNA 3L4UA 1G9HA 1GPFA 1UD5A 4MB4A 1C7TA 1CECA 4PCSA 3BSHA 5D9OA 4PMOA 4AZIA 4M1RA 2WHLA 4TX6A 1B3ZA 1VBRA 2VX7A 4A4AA 2BXYA 4F9DA 1R86A 1MVYA 2CPUA 1V0MA 1VFOA 1JDDA 2VZVA 1CEOA 3QHMA 1E4IA 1U2YA 3VGEA 1NWRA 1DWIM 1C92A 4TVDA 4W87A 2AMGA 1Q6GA 1ECEA 3OGSA 3PTKA 3NCOA 4AD2A 1G01A 4P7QA 1X6LA 3WQ4A 3OBAA 3VGHA 5FL1A 3O2LA 4AIEA 1LG1A 2EPLX 2VX6A 4WSJA 1KXHA 2VQTA 1W1VA 4HZ8A 1KXQA 2ZXQA 5BROA 3WEMA 2YL6A 3VM5A 4UQCA 3APGA 2YA1A 4N0RA 4F66A 4WJXA 3RIKA 1XRVA 4P7OA 3CHCA 4E8DA 3CUIA 1QHZA 3VX1A 3N13A 1KGUA 1GCYA 3ECQA 1E15A 2BHYA 2XIIA 4W5UA 3KEHA 4ZENA 4TX8A 3AIRA 4QFUA 5DT7A 1NARA 1UZ4A 4JKKA 1KBKA 4AW7A 4AZBA 1XCXA 2ESCA 1E71M 4C7FA 3SCQA 1PJ9A 3W81A 1WNOA 3PZMA 1BG9A 2XVNA 1GZJA 1Z32X 3WQ8A 3WSUA 4DUVA 2X09A 2XG9A 3ARPA 7CGTA 2EQDA 1JNEA 3VDCA 4KH2A 3BAJA 1JAKA 2EBNA 3W6MA 3OLEA 3L4VA 1UWRA 3SCUA 1E73M 3WDJA 4TTGA 2D3NA 4EAMA 2DH2A 4U5KA 2CKRA 3OG2A 4W93A 4UQEA 1UA3A 4GI9A 1LQ0A 3WF4A 3THCA 4CD6A 1WDPA 1B9ZA 1JL8A 1LJYA 3AXIA 4JHOA 3CMJA 1GHSA 2YLAA 1PZ2A 2YBUA 5FIPA 1KGWA 4NRRA 4UQDA 1M01A 2CHOA 3QOKA 2W4XA 5GNYA 3L4ZA 2YOCA 3A4WA 1WAWA 2VRQA 1RPKA 3F5JA 2ZUMA 3ZMRA 2G3MA 4JFTA 4P7RA 1UHVA 4M24A 5GNXA 3L4XA 4KRUA 3UR8A 4D6CA 4UQBA 2YL5A 3DHPA 3GH4A 4FF5A 3NSXA 9CGTA 3T2OA 3WQ6A 2EPKX 1V02A 5D9NA 1PIGA 5FKYA 1HJWA 2E9MA 3POHA 3WF2A 3RILA 3M6DA 3RO8A 5IHSA 1EO7A 3AS1A 5TD4A 1LL7A 3ARRA 1BVNP 4U3CA 1BGGA 2PC8A 2D3LA 1ZBWA 4HU0A 5IFPA 2BY1A 5IXEA 3L4YA 3EDEA 3MS8A 4J3TA 5A6SA 3U7VA 5I78A 1V6UA 3T09A 3W25A 3SIMA 1NWTA 3DYOA 3EMCA 5E9AA 1EQCA 1H0GA 3S6TA 4WK9A 3VKKA 2GK1A 4LPCA 4PN2A 4W7VA 5ABFB 4XB3A 3UETA 1DEDA 2WCSA 1UA7A 2WSKA 1DWJM 1D2KA 4J3XA 5I23A 4A3HA 1G0CA 1U33A 2VI0A 3WUGA 1VFUA 1QW8A 1BYDA 4AZGA 1E55A 3D5HA 1V3HA 1E43A 4U2YA 4LYQA 1NM9A 3VX0A 4C90A 2TAAA 4JCMA 1PAMA 1V6XA 3CUFA 3VGFA 3EDDA 3IAPA 1J0YA 1C93A 1H0IA 2DQXA 4C7GA 5IDIA 4V28A 3D3AA 2DGAA 5I6SA 1QHOA 3ZJ8A 1TUXA 3GXFA 3O9NA 1OGBA 2ZUSA 2WYSA 3VMNA 3M07A 4PCTA 1UQYA 1CXEA 1EH9A 1H09A 1B2YA 2IUZA 3L2LA 3EMQA 5AYIA 3WMSA 2DT0A 2XGIA 1NP0A 2BHZA 5LA0A 2WVVA 4QCEA 4AZ7A 3PZGA 4M80A 4GQQA 4KMQA 3VNZA 1GW1A 3CPUA 3PZIA 3PZNA 3WENA 4Q7NA 3UERA 3T2QA 2G3JA 3VVGA 1UUQA 5JBDA 2WXDM 1TR1A 2ZUTA 1LL6A 2GDVA 1XV8A 4OZOA 1WZLA 4UOJA 3G6LA 3ZT6A 2XSBA 4CCEA 5M5DA 1OGSA 1G1YA 1UR9A 1H3GA 1V0KA 1H11A 4UOQA 1H49A 1UWIA 2XM2A 3W24A 1HVXA 2PB1A 3AYRA 4W85A 5LA2A 3WMBA 3L2MA 2WVTA 1V0LA 4MAZA 2WW5A 3SUWA 4P7NA 3GBDA 2X0HA 5E6YA 4AD5A 3WUFA 1EHNA 3T2PA 4PTVA 1M03A 3HJEA 2XSAA 4HOWA 2Y8VA 5HXMA 3WEOA 1OM0A 4LX4A 1HIZA 2OWCA 1PX3A 5M17A 3VMOA 1A3HA 4AZ6A 5BXSA 4PUEA 1WPCA 4WSKA 4AMCA 1B3VA 4AEEA 5A8QA 4D71A 3K8MA 3AS2A 2E8ZA 3CZ8A 6TAAA 1AQ0A 1O7AA 4WKAA 2ZX6A 1W9XA 5CGMA 2QV4A 3ARVA 2JE8A 1Y7VA 2JIEA 1UKTA 2E40A 4ACZB 4QCFA 1E0WA 1XD0A 8A3HA 1OD8A 2CEQA 1XSJA 3OZOA 2XM1A 1JZ4A 2WC4A 1XD1A 2BY2A 5CG0A 4UZSA 1M7XA 4OJYA 5IFTA 4ZFMA 1CZ1A 2WMHA 3WH9A 2GFTA 1D7FA 1PZ3A 3RM9A 3ZJ7A 4CGTA 1CGYA 1XH1A 5C70A 4EE9A 1B31A 2FHFA 1N82A 4QP0A 3AYSA 4AIOA 2WHMA 3A3HA 2W66A 1HX0A 2EPNA 1VAHA 2WMIA 1H41A 1PIFA 3WF1A 2JIWA 3K46A 1KQYA 1UR8A 3F4VA 3VDAA 2DT3A 1BPLB 1US2A 4AD3A 5FCZA 2VZTA 2EPOA 3BH4A 3WUBA 5EFDA 1PPIA 2MANA 2WVSA 4HTYA 2ZX7A 2JEPA 4TOQA 2G3IA 5E0FA 5KZ6A 3UCQA 3VGBA 3ARYA 4IPNB 1JFHA 1JZ2A 3ZSSA 3CHDA 2QPUA 4FLOA 2W62A 4AWEA 3WF0A 3VIGA 4E2OA 5BXRA 1PX8A 1H1NA 2W92A 3AHZA 3OLGA 2CBUA 5A2CA 3ZSTA 4ZE4A 2J7FA 4HPGA 2VX5A 4WKHA 1V0NA 4K68A 4UQAA 4B9ZA 1UD3A 5A8MA 1GQJA 1JZ7A 1WCGA 1OB0A 1CWYA 1BF2A 1W9BM 1K9FA 5EFFA 4TXEA 3VDHA 2WBGA 1EDGA 4M81A 4ZXOA 1LG2A 3N12A 2FHCA 1B3WA 5HOSA 5CJ5A 2WCAA 2WKGA 1JG9A 3TTOA 4Z2HA 2Y5EA 3VU2A 3AJ7A 1R7AA 1XHGA 2DH3A 1J0IA 3ARUA 2VURA 1JIBA 1NOUA 2GJPA 3WFLA 3SUUA 2WMIB 1QI3A 4HMCA 4JKLA 3IJ7A 2WB5A 4UCFA 1FOBA 1LF1A 2A3HA 4KRTA 4GPNA 4IUGA 4W8LA 1DWGM 1E6PA 5A94A 1QW9A 4PMDA 3BLPX 3WBAA 4D6JA 3WNPA 3GH7A 4U3AA 2WBKA 2J8FA 5KEZA 4PMVA 4AC1X 4GXPA 3HN3A 4NZCA 1E40A 1HJSA 4CVWA 4AY1A 2QF8A 4W84A 2GSJA 3T08A 2D20A 1W9VA 2VOTA 3I3DA 1OWQA 1J11A 5A6BD 2E4TA 4W7WA 2YDSA 4BZYA 1WKYA 4PSPA 4MNLA 3DC0A 4N42A 1Q4NX 4H04A 1HKJA 1HP5A 3WDPP 1FH8A 2PF0A 2X05A 2PI6A 3RJXA 2WSPA 3U7BA 3AXXA 1GJUA 4Z2KA 3SCVA 1XGZA 3K1DA 2E0PA 2D23A 2GJXA 2ZUNA 3ARSA 5HPCA 6CGTA 4HZ7A 2E8YA 3FHQA 4D6GA 2OLHA 3ZT5A 5JBEA 2UY2A 2A3BA 5I24A 3SCWA 2D2OA 2WNWA 4LYPA 1V6VA 1TVPA 1JD7A 2GDUA 2O9TA 1E6XM 3CGTA 4PTXA 1VJZA 2DIJA 2YL9A 3ALGA 2J7BA 3WD0A 1DWAM 4TVUA 1V02E 2BXZA 1CXLA 4ATWA 1RP9A 1GOWA 4D1JA 4B16A 2PBOA 1HKIA 1J0ZA 1J12A 1ZU8A 3PTQA 5E70A 2A3AA 1V08A 3A4XA 1X6NA 3BAKA 2DSVA 3BAYA 1WZMA 2DDXA 1J10A 1E5NA 4CD8A 4U31A 4W8AA 4J3SA 1GQIA 1PX4A 1UKOA 1CXIA 1FHDA 1DWFM 3WEZA 3VIOA 3CIVA 2JFEX 3W82A 2WVUA 4AIUA 3VD9A 2WZEA 2BHUA 2J7CA 1IZKA 1CGVA 5D8WA 2DSUA 3PZQA 1UR2A 3K8KA 1EQPA 4UFKA 4DWSD 1KQZA 3F5KA 4JL1A 4H8UA 1C90A 1UH4A 3L4TA 3OLIA 2Y4SA 2ZX9A 2PWHA 2Q8XA 2GJXB 3HMCA 4LYRA 5A6MA 1ODZA 2G8ZA 1CXFA 3VIJA 4JFSA 1V3LA 4MB1A 4S3KA 4DWSC 2D0GA 5A2BA 1W1PA 1HJVA 3GNPA 1BG4A 1X1NA 3CZLA 1E0XA 2YA0A 5LA1A 4QLLA 1ZJBA 4BQ3A 5IHRA 3AIBA 1IZJA 3VIPA 3CHEA 1M53A 1CGWA 4QLKA 5BRPA 3LPPA 2D0HA 4MTVA 3HU7A 1E5JA 2HVMA 1CYGA 2VTFA 1JI2A 2BVTA 3U5YA 2EXOA 3FY1A 4HU8A 5DF0A 4AZHA 5HBFA 3CUHA 2DSZA 4GIAA 1I1XA 3MV01 1I75A 1B3XA 3DYPA 1E0VA 3TTSA 5CSUA 4RE4A 3GXIA 1HN1A 5AYBA 1GOQA 4ZEPA 3FXYA 4A3YA 1R8LA 1W3HA 5JBFA 2AOSA 2O9OA 1BHGA 1HJUA 2E9BA 4URIA 5A6LA 1VENA 3CUJA 7A3HA 1E70M 1E6NA 3EDJA 3VIMA 4MB3A 1BTCA 3W29A 3WH7A 1C3FA 1PBGA 3QHNA 4PMYA 4KGLA 4AD0A 3NIYA 5E6ZA 1W91A 1JYXA 1KXTA 3OZPA 3VGGA 2D0FA 2WLZA 2WMJA 1QI2A 4AXNA 3UR7A 1TE1A 1YQ2A 3CO4A 4GI8A 1A47A 4H7VA 4UQ9A 2CHNA 2OYMA 3QHOA 4U2ZA 2O9PA 1MFUA 2XVKA 3ARXA 1TMQA 1KGXA 4AISA 3MMUA 2ZXDA 3TONA 2ZICA 2YA2A 2Y24A 3MMWA 1EXPA 3EMZA 4CU8A 4FLQA 2WMGA 2JF7A 1ZB5A 1NOWA 1B90A 5I79A 4AZ5A 2WM0A 1JDAA 1KR1A 5CQ1A 3W38A 4CKQA 2DEPA 4RE3A 2V3DA 3ZQ9A 5HNNA 1KCLA 5A6AA 2F2HA 2FGZA 1HL8A 2VZOA 4EANA 2CERA 5ABGA 1UR0A 2ZXBA 2C7FA 3K4DA 2OWWA 1SR0A 1W9UA 4J27A 2XVPA 3FN9A 4ZE5A 4Z2GA 2QPSA 3GYCA 3OIHA 3POCA 3WD1A 5D9MA 4PUDA 5D4YA 1UWSA 3OGVA 1I1WA 5GPRA 3LMYA 4CCCA 3ZOAA 1LLOA 1C8YA 4W5ZA 3AZSA 3VD3A 3W4RA 3WDIA 3ZR5A 4D72A 2QLYA 1XYFA 4CVUA 3KZSA 4ACYA 2BY3A 3VIKA 4MADA 1OT1A 2GK1B 4XZBA 4ATDA 1TA3A 1ZBCA 3AQUA 4UZUA 5A2AA 3AIUA 3T0AA 3GNOA 1LWJA 5A8OA 2XHYA 2CIPA 1VRXA 3VD5A 2YLLA 1F4HA 1ZBKA 4D6HA 1JXJA 2GUYA 4D6EA 1FHLA 1AQHA 1V6YA 2JF6A 1OT2A 4OKDA 3K8LA 1KWGA 2FHBA 2IXUA 1CBGA 4FK9A 3MO4A 1HKKA 4LXFA 3N11A 2ZUWA 4RE2A 1DP0A 1QNPA 1QI5A 1QNOA 2VZUA 5ABHA 2BFGA 1VF8A 2GVYA 4MPKA 3AI0A 4UR9A 1VEOA 5GQBA 3A6OA 3AISA 4QAWA 2WC7A 4W7UA 1VEMA 3KL0A 3WN6A 2XTKA 4F79A 3GM8A 3VILA 2VL4A 3WDRA 1UD8A 3PBGA 2D1ZA 2W5FA 3SCRA 1GOOA 1V3KA 3S2CA 3KL5A 4YHEA 4HOXA 1B30A 3GH5A 4AZCA 1E1EA 2WWDA 2DPEA 1VJSA 3FHAA 2WVVB 5A6JA 1RP8A 3B8SA 1JDCA 3PZOA 4PRWA 5CSYA 4ATLA 4DWSA 4MNMA 1UWTA 3UESA 3AFBA 2A3EA 1EDTA 3ZR6A 4MNKA 3WL1A 2F8QA 1ISWA 5BCAA 3ARWA 2NT1A 2YIHA 1JFXA 1R7OA 4V27A 1FFRA 1ESWA 3BAXA 1EDQA 3QR3A 4XX6A 5CZKA 3AIQA 4DUXA 3W26A 3IJ8A 2ZOXA 1W1YA 4BQ5A 1GHRA 3WNMA 4BA0A 2FH6A 4J3VA 1MW3A 2ZE0A 1CIUA 1W3JA 3SCSA 3ARTA 3M46A 5HPOA 1E6ZA 4FLRA 1GQLA 1BSIA 5A6KA 4OUEA 4PMZA 4C7DA 1VB9A 2E3ZA 3OB8A 1W3KA 3J7HA 3N17A 1NOFA 4P7LA 3W0KA 3WH8A 2ZX8A 1BAGA 1G94A 4UFMA 2VR4A 3W37A 1ITCA 1FH7A 3AMKA 1QVBA 1GQKA 1CDGA 4CN4A 5E09A 1GORA 2W67A 4JFUA 4JCLA 4TUFA 1IV8A 1OD0A 3CHFA 5E0CA 1E9LA 1QI0A 3ALFA 3DHUA 2UY3A 3RM8A 3KL3A 5I2UA 3MMDA 1MQQA 2WZHA 1FP8A 1H5VA 1UKSA 4AEFA 1RH9A 1C8XA 4D1IA 1BYCA 4HA3A 4OBSA 1DTUA 4X9YA 1US3A 1JZ5A 4R5EA 4H41A 1E6QM 2J7GA 4ZXLA 1SYTA 3AIWA 5BYWA 1MQRA 4M82A 1NWUA 3AZTA 5I3DA 1UWQA 4DWSB 3BMVA 1J01A 3RPMA 1J0HA 4H8VA 4UTFA 2CYGA 1EO5A 2WZIA 4XZWA 1MW2A 1NQ6A 1WDSA 4OOUA 1HXJA 3PZ9A 2W63A 1B1YA 3B9DA 2V3EA 3VPLA 4BCEA 5EB8A 5AC5A 1UR4A 1HL9A 2XJ7A 2XYLA 4D6DA 2UY5A 2CKSA 1J0JA 4BQ2A 2V38A 2UY4A 3TA9A 1VFFA 1CTNA 1BFNA 3ZJKA 2F61A 1ISXA 1GJWA 2WHJA 1PEZA 3VIFA 1GONA 3FAWA 5FD0A 5CPSA 1UH2A 1U30A 1E6RA 2ZUUA 1BGAA 3AS0A 4QDMA 2WAGA 3CZGA 2YJQA 5D9PA 1MYRA 4WF7A 3PN8A 1R87A 1E1FA 4PBGA 2VCCA 1HJXA 3W6LA 5EMYA 1JGIA 4UFLA 4TVCA 1C8QA 1J9YA 2YL8A 2G41A 3RDKA 3II1A 2NT0A 5HDRA 1OCQA 3MV11 1LWHA 3NSMA 3KWXA 1K9EA 2XGBA 1JZ3A 1FFQA 1CNVA 1XC6A 1MQPA 2Z1KA 2PBGA 1H4PA 4OBRA 3FW6A 4CUCA 6A3HA 3RMEA 4E8CA 3BMWA 4FMVA 3DYMA 4WLCA 5A95A 1GOIA 2VRJA 2Y2WA 4MNJA 1K9TA 1QHPA 1NP2A 1UR1A 4JZ5A 3GXMA 2YDRA 1ZJAA 3CZJA 1CXHA 4B15A 1DWHM 3AROA 4L4PA 2ZWZA 1HVQA 1VEPA 3MSGA 2V5DA 3LPFA 4WIWA 4DM1A 2DT1A 2V3FA 1BLIA 3WNNA 2VJXA 2YBTA 3JUGA 5DO8A 2VNCA 4Z2IA 4IM4A 1MXGA 2OSXA 1UZ1A 4U5IA 3WY1A 2BNJA 3WBEA 4C91A 1MW0A 1OGGA 3WF3A 1GUVA 1UQZA 1TCMA 3IAQA 3B9AA 3PHAA 3IJ9A 1ODUA 1XCWA 4HA4A 5BXTA 2Y8KA 4HP5A 3LPGA 3WD3A 1GVYA 1ISVA 3UG5A 1AVAA 4MDOA 1TFVA 4MB5A 1WE5A 2FGLA 5AY7A 4P8WA 3NUKA 3WQVA 1E6SM 3BCFA 1MFVA 1WO2A 1JZ8A 2WMKA 3BGAA 3FAXA 2J62A 3SUSA 3BAWA 2W61A 4CU6A 2OSWA 1TZ7A 2VX4A 4PEEA 4GO9A 2CBVA 2V5CA 2DSWA 4GQRA 1Q6EA 3VUPA 3AHXA 5CLTA 2PWDA 4AD1A 4CN6A 5AC4A 3VD7A 2YKKA 2J79A 2X8RA 1XSIA 3VIHA 4HPHA 2UWFA 2W91A 4U33A 2J77A 2XWEA 5ABFA 4HMEA 2BVDA 4P8VA 3VIIA 3SURA 2J47A 2WCGA 3WQ5A 1W9PA 2EEXA 3VMPA 1OSEA 4PMXA 3VNYA 4NRSA 2OYKA 4P8XA 3GTNA 4GO8A 5A1AA 2D22A 3MUIA 4CN1A 1SMDA 3VTRA 1WB0A 3AOFA 3MUZ1 5FOOA 1CPUA 2J75A 1ZL1A 3CZEA 1ITXA 3TP4A 1KXVA 2X0YA 4E4PA 4QLJA 5EBAA 2A3CA 2G4FA 4W88A 1CXKA 1ZBVA 1UH3A 4Z2JA 3VO0A 5CGTA 4AD4A 5JIWA 2XVLA 1EHAA 4D6IA 3N15A 4GINA 3AMCA 3AICA 1WP6A 3N9KA 2VMFA 1HKMA 1C91A 2J74A 1CGTA 5CPTA 2BS9A 4YHGA 3WD4A 1BVZA 2VRKA 3BXWA 1HJQA 1OIMA 1W32A 1XH2A 2XUCA 3VD4A 3EDFA 3QOMA 1HF6A 3AIEA 5D8ZA 2Z1SA 2C0HA 1UG6A 3AMGA 2J25A 5I5RA 1FA2A 5JIPA 3VM7A 3CMGA 4JIEA 3SCTA 3M7SA 2CXGA 4B3LA 1HNYA 4PMRA 1XYZA 4F9JA 1V3IA 2VO5A 1J18A 2WHKA 4CD4A 2XFYA 4J28A 1OBAA 4HZ6A 3K4AA 3GXDA 3WH5A 3LPOA 3SUTA 5I0DA 2E9LA 1WZKA 1Q6CA 2PWGA 1L0PA 1CGXA 4GZIA 4J3WA 4CCDA 1J0KA 4PMNA 2WPGA 1IT0A 1E3ZA 1Q6DA 4CU7A 5A3HA 2VCAA 3NJ3A 2BY0A 4JFWA 2PWEA 4M29A 2J78A 4J3UA 1AMYA 1O6IA 2PWFA 1EGZA 3N1AA 4V2XA 1JF5A 5BXPA 3T0DA 3RM4A 1MWOA 5DEZA 1VBUA 2CNCA 4UFHA 1K6AA 3BSGA 4GKLA 1BYAA 2XFRA 4NSBA 2QHAA 1K9DA 3DECA 3TTYA 1S46A 3BCDA 3N04A 2J7DA 1SFSA 2O9RA 1UD2A 1G5AA 2EPMX 5A8NA 4LQ1A 3WD2A 3MU7A 5A6BA 2V3GA 1E3XA 1GNXA 3AMDA 4H2CA 1BQCA 4MJ2A 4Y7EA 2DSKA 3VOCA 4DUWA 1MXDA 2JEQA 4UFIA 4KGJA 2VC9A 3VGDA 1OINA 3NDYA 1JAEA 3IK2A 1QNRA 4UNIA 1EOMA 4B3KA 4S3JA 2QMKA 2HISA 4ACZA 2XPKA 2YDQA 4R27A 1V6WA 5I77A 3PZVA 4J7RA 1HT6A 2B31A 4TTUA 5F7UA 2CITA 3TOPA 3AMLA 1CLVA 1WDQA 1QBBA 1KR0A 3WFZA 1F4AA 3W28A 3GBEA 1UYQA 1QNSA 4NI3A 4BS0A 4GZJA 4ML4A 2RGMA
chains in the Genus database with same CATH superfamily
2OOGA 1WZAA 5GJNA 3WQFA 4PYSA 4BQ4A 3QQ0A 3DX5A 1WUFA 4HK7A 4JFVA 1VS1A 1TG7A 3S5OA 4US5A 1DHKA 1SW3A 3A47A 4OOZA 1YIXA 4JKMA 1A0EA 4TU1A 3SSJA 3KS6A 4K3ZA 4WKFA 2PGWA 1JF6A 4GGHA 2QDDA 4YN5A 4BF7A 5K4ZA 4L9XA 5CZJA 5ABEA 8RUCA 3RYSA 4GI6A 3U57A 2C71A 3AS3A 1XLMA 3R58A 1V03A 3NDZA 1O5RA 3QGKC 3R79A 3GUWA 3L0KA 4PTMA 4GUGA 1HKWA 1US0A 1BKHA 4C6DA 2YCIX 1EIBA 2VFGA 4A8NA 2BVYA 4AWTA 3UG4A 4NL1A 1FXQA 4IMAA 5E93A 4N6FA 1E4LA 4O4WA 5JUVA 1ISZA 3WNOA 1XQLA 2Y89A 1TA3B 2VFHA 1OIFA 1FH9A 1GVOA 4Z42C 1O4UA 1UD6A 3IUDA 1D3GA 5AHNA 1UD4A 5HATA 4E4FA 1LL4A 1TPDA 3H6OA 1T40A 2CETA 3UGVA 5FESA 2VOMA 3QGVA 5LIYX 5GJPA 4AQLA 4H8HA 1G69A 4A3RA 1W3LA 2VDGA 3TXVA 3ZO9A 3L0NA 3BLKA 4DBEA 1MDLA 5JU6A 1MW1A 4MFEA 3MCOA 3EOSA 1S3HA 3NL6A 2POZA 4R7OA 3B8IA 1F9CA 3EBVA 3RRAA 1A5KC 1BKSA 4HNTA 1L8NA 4OV9A 3E2VA 4EF9A 1RJRA 1K70A 3BC9A 5FAJA 1Z7AA 1FWCC 4LGXA 3SEPA 3APTA 4A8RA 3UEQA 4KEVA 4Y9OA 3AHYA 3TYZA 1SFTA 4RL3A 1YHTA 4IPIA 2VEFA 1GKQA 3H8AA 3U5UA 2W9MA 2DZBA 1UBSA 1DQWA 1YPXA 3UWEA 2FDMA 1I8JA 3S46A 3TU9A 5GNZA 4UMCA 3LLXA 1SZFA 4XAFA 3NQ8A 1HL2A 3B9OA 5AYXA 3O6AA 3CM4A 4CNTA 3FX4A 4LUTA 1KWKA 4AHPA 1NEYA 4MZ8A 2OT0A 3EYPA 2VDHA 2PA6A 4WOQA 2QCCA 2ZX5A 3G1FA 1C7SA 3FGCA 4O1CA 1TZ9A 3MSDA 1JI1A 2PP1A 3NL5A 3FYPA 3MUAA 1WUEA 2PDJA 1AJ0A 4PFHA 4B5SA 2YFOA 4FXJA 2Q8LA 4W8BA 1R3YA 1GVFA 5DLCA 2RGLA 1JZ6A 2FMNA 3NPWA 3GG0A 3M4HA 3THDA 3P5ZA 2A6LA 1XSKA 1QI4A 1OK6A 2YZ5A 2NSOA 1OFOA 3VDBA 2WC3A 3NQBA 3SBFA 5CEWA 2ZIDA 3B0PA 3RCMA 2FYMA 3WL0A 1OADA 1ZS2A 4UR7A 2HRWA 2DIEA 3ABZA 3F4WA 4JL2A 4DPQA 5I3FA 1Y8BA 2A7NA 3PPHA 3W1MA 4F4RA 3GQYA 4M56A 4C1LA 1CGUA 3M43A 4LUJA 3BLLA 5EU9A 3NSNA 3OYZA 4K38A 3THAA 2WMFA 1ISYA 1EP2A 4YTQA 3L4UA 3W1LA 2CXEA 1XBVA 3G22A 2ACQA 2VUNA 1C7TA 5D04C 1HGWA 4WUIA 1KM4A 5AKQA 3VKCA 4TV6A 3BOLA 3ME3A 5KINA 1V0MA 1CEOA 3VC6A 2NX1A 3QHMA 3H24A 5HQLA 1MNSA 2GPTA 1DWIM 1X39A 3S6OA 3PTKA 4AD2A 2AKZA 1G01A 1XBXA 3LHZA 2GVGA 3PB0A 2P10A 1TMLA 4RDYA 2VX6A 4MWAB 4FS9A 3LSCA 2ZXQA 3P81A 3WEMA 2YL6A 4JOMA 4P00B 1Z6KA 4PB3A 3VM5A 3ABOA 4K1WA 5F2GA 4WVXA 1T99A 3APGA 4IH3A 4N0RA 1IT7A 1K4HA 4L6OA 2B0MA 3VZYA 3RIKA 1XRVA 4P7OA 3CHCA 5CBJA 4IQLA 3N13A 1GCYA 4HU4A 5AFDA 4B5XA 4HNVA 2BHYA 2Z1WA 4XBSA 1WKFA 1ZFJA 4JQ4A 3KEHA 1ZAIA 4CQ9A 4JPGA 1NARA 2ZC8A 1XIGA 4AW7A 2Z2AA 3CL8A 3TK7A 3SCQA 3DI1A 1YDYA 2IKHA 1IR1A 5C9RA 3AYVA 2VGGA 2YCKX 4DUVA 2XG9A 4L5ZA 1UOZA 2EQDA 4EPDC 3VDCA 1DJYA 4AU0A 1JAKA 4GJIA 2J6VA 2QT3A 3OLEA 3SCUA 3WDJA 2D3NA 4AMAA 4PL1A 4UQEA 3VABA 1LQ0A 1H50A 4CD6A 3OHIA 3RR4A 4S3CA 1JL8A 3UWUA 2WZMA 4AB4A 3CMJA 1GHSA 1PZ2A 5FIPA 1J79A 2P88A 4UQDA 1M01A 2C1HA 1UB3A 3O05A 4QROA 3L4ZA 4F2BA 4R9OA 1RPKA 2PDHA 2ZZ2A 4P7RA 1UHVA 4RDVA 3SRHA 3L4XA 1RR2A 4K8EA 3DHPA 9CGTA 3NQMA 4NNCA 2YXGA 1PIGA 2ZE3A 3LK6A 3LLFA 3POHA 3RO8A 3F4CA 3N6HA 1FHUA 4NJJA 4WGXA 3ARRA 3TSMA 4IMFA 3QC3A 1YKWA 2D3LA 4QBXA 5IFPA 2DP3A 4UWMA 5KZDA 4LNCA 3UJRA 3PTDA 4O8AA 3W7GA 1IEQA 3NQVA 4OWGA 3GW3A 5A8GA 2CC0A 1WYIA 4UNKA 3S6TA 2FPYA 1IT8A 3VKKA 1XYLA 4W7VA 3GB6A 3DFSA 1W17A 1XDMA 5F4XA 1DEDA 2WCSA 1LBMA 1WA3A 1AJZA 1A5UA 3FDKA 4J3XA 3W85A 2RUSA 2VI0A 3PUOA 1VFUA 5REQA 1NFBA 1V3HA 1W8GA 3OVRA 1KRCC 3VX0A 3HGSA 4C90A 1J5TA 2TAAA 3PUGA 4KWVA 1EBHA 3EDDA 4GVIA 2GLKA 4PCPA 4OHQA 4HG6B 3MW7A 2DQXA 4KW2A 4V28A 2DGAA 3NZQA 1QHOA 1GW9A 4IFOA 3ZJ8A 3O9NA 3W1NA 1RUSA 5HJYA 3VMNA 3N25A 2FB3A 3M07A 2DVXA 1W5NA 3G1DA 4H00A 4Y2WA 2GGGA 3XISA 3L2LA 4YTTA 2DT0A 3KS5A 3AU2A 2DZTA 2BHZA 5LA0A 1D3HA 1Q7ZA 1TV3A 1KRAC 1N8IA 2WJFA 3I65A 3NVTA 1O95A 3S47A 4KMQA 3RHGA 1GW1A 3VNZA 3PZIA 2PF8A 3QMRA 2I56A 3UERA 3THQA 1V93A 5JBDA 3DKLA 2WXDM 2ZUTA 1LL6A 3V3WA 4OZOA 1T0OA 4UOJA 3ZT6A 1NELA 1I0BA 4CCEA 1E1CB 1ICPA 1LLWA 3G5EA 1V0KA 1H11A 1XGEA 3WQOA 1H49A 2XIOA 2XM2A 1QNVA 4W85A 2QF7A 2WVTA 3B0XA 2WW5A 3SUWA 1A5AA 5D37A 3BTNA 3VOGA 3P7YA 1VRDA 2XSAA 3VA8A 4D9PA 2UZ9A 1UR3M 4DF0A 4WR3A 1BD0A 3VNJA 1OM0A 3USBA 3O6DA 4LX4A 1DHPA 4AHOA 2DVTA 3JVAA 1PX3A 3NZRA 4PEKA 4MY1A 2ZZ1A 3HGOA 4WGHA 1U5VA 5AN7A 4NZ3A 4EXBA 1A0CA 3YPIA 2ZX6A 3BL3A 1EGVA 1K03A 2VM8A 2AAMA 2JIEA 4Z0SA 1T41A 4ACZB 4GD0A 1XD0A 8A3HA 1BEUA 1JZ4A 2BY2A 1GOXA 1DORA 5IFTA 5MKGA 3W7LA 3WH9A 2WMHA 1D7FA 3S1UA 5LNSA 4WSHA 5C70A 4P61A 3EPMA 5J04A 1GK8A 4ZFCA 3MP4A 1TWIA 1N82A 5AC8A 2VKZG 3LEPA 5H6HA 4PL2A 3HM7A 1VAHA 2JIWA 3QH2A 2P5NA 1KQYA 3VDAA 4RXGA 4AD3A 2PLCA 2EPOA 3BH4A 2YX0A 3P80A 3WUBA 1MMFA 5EFDA 1PPIA 1V8EA 3KBWA 4A3UA 2WVSA 4N9DA 2ZX7A 2DZWA 2JEPA 1TPWA 4IX0A 3SM0A 4DBWA 3FIGA 3ARYA 2FFCA 1BXCA 3TYCA 3CEUA 1ZP4A 3QQWA 4JNYA 2BZNA 1NU5A 3O15A 1L6GA 4FLOA 2RJHA 3WF0A 1JCYA 1XIMA 4LSBA 1I2PA 5C2XA 2QJJA 4E2OA 2W92A 3AHZA 3W1RA 4E8GA 1GPWA 2H90A 3I7SA 1Q4WA 3C3UA 4TMCA 4ZE4A 4ECLA 1O12A 4K68A 4B9ZA 5FAGA 1JZ7A 1OB0A 1BF2A 5BU6A 4KCWA 2WBGA 1AJ2A 5I09A 3U4FA 4ZXOA 4PRTA 1LG2A 2FHCA 2OCZA 4NT0A 3VE7A 5MHBA 2NXGA 3AJ7A 2X30A 3EB4A 1A5LC 2Y88A 4AH7A 1J0IA 1JIBA 2GJPA 3WFLA 3O06A 2R1MA 4HMCA 4UBPC 3IJ7A 1TQJA 4W8LA 2ZTJA 3VI2A 2QCHA 4W4QA 1S2WA 1NDYA 3GDMA 1QW9A 3VNKA 3NQ6A 3GTIA 2NUWA 1DKWA 2J8FA 4HB7A 1G7UA 1XX1A 1QDSA 4AY1A 4R53A 3RPTA 4OUIA 1GZGA 2GSJA 4NYUA 3QTGA 2G5WA 1J11A 1OQFA 4BZYA 2YDSA 3W1AA 4H83A 4NQ1A 1LYXA 1WKYA 3GFZA 2WJEA 3KOZA 4TIMA 1U5JA 4G7FA 4QRNA 2W6RA 2R82A 1P1MA 1RXOB 2EG8A 3W7IA 1FWBC 2PLKA 2PI6A 3AXXA 3SCVA 3BLEA 1U1JA 2E0PA 1O1ZA 2GJXA 2OPJA 5LIXX 2EPHA 4DF1A 3F2DA 4D6GA 1F3XA 1P48A 3MHGA 3KVKA 1KLYA 2I14A 2A3BA 2WNWA 4H3DA 2DUZA 4IQEA 2PDCA 1TVPA 2GDUA 1E6XM 3NO1A 4OE7A 5A5WA 3ALGA 1DWAM 4JYDA 1V02E 3GVQA 6XIAA 3BG9A 3DESA 3FGCB 2OOFA 1TYGA 2PBOA 3KOFA 2B7QA 1TJRA 1XC4A 3R6IA 1HKIA 1J12A 1TPUA 4PB4A 4H01A 3PTQA 2A3AA 3K5XA 3MVIA 3A4XA 4ALDA 3ELFA 2XIJA 4F3HA 1KV8A 4NVTA 1J10A 3IRDA 3PK7A 2ICSA 2HE5A 1XIBA 4H6KA 1GQIA 1RCOB 1ZHAA 4D2JA 1UKOA 3HOJA 3URNA 4B92A 1DWFM 3KBVA 4NZ5A 2JFEX 4DUOA 2G97A 1FY6A 4GWEA 4LB3A 5DN1A 1OYAA 3PZQA 4CNOA 3DFPA 1EQPA 4UFKA 1R3SA 3W84A 4WDTA 4KEZA 1G7VA 5IOBA 1QOPA 2X41A 3HO8A 1A3XA 5LIUX 3QN3A 3SY8A 1IEWA 1XKYA 3P82A 2Q8XA 1IWBA 1CXFA 4MMWA 1SW7A 4YU1A 1S5MA 2OX4A 4KPLA 1FWDC 2D0GA 1W3IA 3GK0A 1KBJA 1W1PA 1HJVA 5HR7A 3F2BA 4KIRA 4F48A 3LHTA 4BQ3A 5IHRA 5BOFA 4QQUA 5CSSA 4R85A 3W3OA 1GVEA 1CGWA 1GYMA 5FJRA 2FIQA 4QQ3A 4CCZA 3FFSA 1R47A 2V63A 4AZHA 1H1YA 2DUAA 4IIDA 4Q8QA 4HYRA 4H9XA 4KCTA 3MV01 2OKTA 3DYPA 1E0VA 4LEQA 4RE4A 4Y90A 2E7FA 2X1TA 5FEXA 5AYBA 3IJDA 5HINA 4X3ZA 4YWIA 1R6WA 4ZL1A 4A3YA 1JVNA 4PGLA 4JNZA 1KM2A 2AOSA 2GJLA 1HJUA 2E9BA 2BXVA 3NZ1A 4DJED 4IIHA 7A3HA 4GOAA 1E70M 4HQVA 3VIMA 3TZFA 3WH7A 3IIZA 4PMYA 4KGLA 2G3FA 3NIYA 1W3TA 3PY2A 1F6YA 3QY7A 3OZPA 3VGGA 2WMJA 2ACRA 2PDWA 3BV4A 4AXNA 3CO4A 3C0LA 1IIGA 1KTBA 1TWSA 3CYJA 4UQ9A 1RBAA 2QDEA 1MFUA 3WLQA 3BLFA 3WMLA 1YPFA 1KGXA 1TKKA 4AISA 3MMUA 4I5XA 2I57A 2Y7GA 3F7JA 2E68A 4GI4A 1M65A 1P6CA 2WMGA 4GIEA 4MY9A 3U2CA 1XLLA 5LXXA 3RU6A 2JQXA 3MSRA 5I79A 4AZ5A 1JDAA 3MJMA 1JULA 4RE3A 4MWAD 4GJJA 2ONEA 4RXFA 1EGMA 5A6AA 3O07A 1W56A 3HB9A 2OO6A 2FGZA 5JMUA 2QJHA 4EANA 3OODA 4JTKA 1JDFA 1UR0A 2ZXBA 1SU5A 4R33A 3HF3A 1RLCL 3SJ3A 5H8UA 1RA5A 3TA6A 2OEKA 3CQHA 4TMBA 2QPSA 3GYCA 1EKOA 3POCA 3BWWA 2RKXA 1YLVA 4PUDA 3N29A 1KTNA 4LUYA 4E2BA 3DFYA 1I1WA 3QJAA 4EVZA 5GPRA 4MFDA 1X98A 4CCCA 3ZOAA 1IHIA 1LLOA 1R2TA 4F0HA 5K2ZA 3WDIA 3QW3A 1F3EA 1A80A 3OW1A 3VIKA 4MADA 3IIPA 2IQDA 4P2VA 1ZBCA 3DN5A 4OU1A 1FCVA 3GIPA 3AQUA 4A29A 3S6DA 1EP1A 4UZUA 4BF5A 3M9YA 2JGQA 3NZPA 1VRXA 4PUWA 3ABQA 3VD5A 1EB3A 1F4HA 2YYTA 1SO5A 2PWVA 4NNAA 1UP3A 4J35A 1AQHA 4YVVA 4JTCA 3EB3A 1XLKA 3MO4A 4FK9A 2FMOA 1PCKA 1Q6LA 4RE2A 4S2CA 1QNPA 1HGYA 3N14A 1H7OA 4G7EA 2RDWA 5TAOA 4CNNA 2V30A 3QY6A 3MQTA 2I16A 3PF3A 4WZHA 2GVYA 4MPKA 4HSHA 2FZDA 3HV8A 1F76A 4W7UA 1PKMA 3KP0A 2H8XA 1LDCA 3VILA 4DI8A 3QLLA 3CNYA 3PBGA 4PE8A 4JX6A 4C6JA 4U10A 2W5FA 2PDXA 4YIWA 3S2CA 3KL5A 4HOXA 4JDBA 3PPFA 2WWDA 1NF0A 2DZUA 3V0SA 4DJFC 1JCXA 3FHAA 1F61A 1EJVC 3B8SA 4XD6A 3B0UX 3V1PA 3WLHA 3T0TA 1JUEA 4ATLA 3CIXA 3D3FA 2VWSA 3NXFA 1Q3NA 3HPXA 1TTPA 3ZR6A 1VC4A 5DCBA 5CG7A 1ZZMA 4V27A 1VPXA 3EAUA 1WQ5A 3EOEA 1OFPA 4LBRA 4ZO7A 3GC5A 1POJA 2FH6A 1UZDA 5HPOA 4XSLA 1R3QA 5LSMA 4BKNA 3AUOA 4HTBA 3Q2DA 3OB8A 1XM3A 3CH0A 3WLTA 4P7LA 3SDOA 4HN8A 1MRQA 1ITCA 4LAMA 4MKVA 2FFIA 4KERA 3C5QA 1P0BA 4JCLA 3V18A 1NY1A 3ZLHA 3ALFA 3DHUA 2UY3A 1B4KA 3RM8A 4GFIA 1LOLA 1FP8A 1H5VA 5LIWX 4AEFA 1T96A 3PPGA 1C8XA 2G95A 1QWKA 4OBSA 1PIIA 1DTUA 4I9TA 1DPMA 1KTCA 4GX9A 4GH3A 4R5EA 3GNXA 4LJ3A 1OX5A 3TFCA 1FWFC 3TEVA 4DWSB 4ERIA 2ZQ0A 3MCMA 4JD4A 4FNPA 4H8VA 1ADDA 1EJ7L 1EO5A 4ZQRA 4GMEA 4ZA0A 3GZ3A 1MW2A 3PZ9A 3B9DA 2V3EA 5EB8A 3SQLA 5I7GA 5AC5A 4ZB5A 5LGXA 1HL9A 4FOKA 1LOSA 4D6DA 3FYOA 2CKSA 3UY8A 3ITGA 4WEVX 3TA9A 2W0UA 3H7UA 1CTNA 1BFNA 1LOQA 3ZJKA 1ISXA 1GJWA 1PEZA 3VIFA 5FD0A 3IIOA 1U30A 1BGAA 3CQKA 3P67A 2PDBA 1YYAA 5D9PA 4WF7A 2CW6A 4PBGA 3PN8A 1E1FA 2NLYA 1VFLA 4ORIA 4S3EA 1X8FA 1PO9A 3MDWA 2INFA 1I0DA 3KCJA 4QS6A 4RW3A 2YL8A 1R3VA 1TPH1 3A64A 3TYBA 2G41A 2Z24A 1RVKA 3TQ0A 1OCQA 3RLHA 1DJHA 3NQFA 2QCEA 1FFQA 3P60A 2QNEA 1H4PA 3MCNA 1K77A 3WQPA 4HPNA 1G6CA 4E8CA 1RVGA 1XW8A 4PC8A 2PDQA 3DYMA 4WLCA 4JY9A 1S5VA 2Y2WA 4I5RA 5F2LA 3F2CA 1WOBA 1QHPA 1NP2A 2QYGA 4GBUA 4K8GA 5K7JA 1ZJAA 3E0VA 3CZJA 3N34A 4NZ4A 3RUBL 2X1UA 1VEPA 4US5D 2V5DA 5E1QA 2IPFA 1U22A 2VJXA 3RU8X 1VLIA 1MXGA 4S3AA 4L6DA 5DMMA 3VAVA 3C2OA 1CT5A 3WBEA 3KBNA 1MW0A 4R88A 5HWNA 2YCEA 4LANA 3ZWSA 1DVJA 3NFUA 1ODUA 2FJUB 4HA4A 4IGNA 7ODCA 5BXTA 2Y8KA 4HP5A 1LROA 3WD3A 3ZYZA 3UG5A 3BURA 5AHMA 3TW9A 2I17A 1LRQA 4MB5A 3BLOA 4O14A 1W5PA 4M1BA 3P0WA 4P8WA 3D46A 1EZWA 1I4NA 2OMAA 1F5ZA 3BGAA 3CAQA 3FAXA 1VHNA 4WHBA 3GU2A 1L9WA 3LCFA 1HW6A 4CU6A 2OSWA 3NM1A 4PEEA 3FYYA 3MUXA 4RX0A 1I60A 1Q6EA 3VUPA 5CLTA 2PMQA 1PKLA 4CN6A 3MI2A 4DXKA 3M5VA 3ENLA 3OO2A 4HPHA 2UWFA 2GDQA 2XWEA 3W88A 2R14A 3N6JA 4P8VA 1E9YB 3SURA 2J47A 1AFSA 1W9PA 1JPHA 3B9NA 1VD6A 1GJPA 1KLZA 2OYKA 4P8XA 2H9AA 4PTDA 4UB9A 1QOQA 1FX6A 3FV9A 1SMDA 1P7TA 3MUZ1 3PFMA 4DZ5A 1CPUA 2J75A 4DNHA 4O1AA 3FS2A 3DBPA 3B97A 5AHEA 1XLFA 2E6FA 4RDWA 4E4PA 1I2OA 4UTLA 3SRDA 4W88A 4HPXA 4J5NA 3IGUA 3V1HA 1H7PA 1TX2A 1JCJA 1T5AA 3AMCA 3QYQA 2VMFA 5EL1A 2PGEA 3ANYA 2PRLA 5CPTA 2BS9A 4M3PA 2VRKA 4KS0A 1K8YA 1OIMA 1W32A 3EDFA 1VPYA 1NF7A 2Z1SA 1QR7A 2C0HA 3AMGA 5JIPA 4RNFA 4KEUA 4JIEA 4M7TA 1MEHA 3OP2A 2QCNA 3TFXA 3BQ5A 3M0JA 1VLWA 4DLFA 1K4GA 4F0LA 1XICA 2P1FA 2QUNA 3G3MA 1H1ZA 1Z8AA 1V3IA 1J18A 3BSMA 2CZ5A 3TQVA 4HPJA 4ROPA 2J13A 2ZRZA 3LPOA 3K1GA 1R5YA 4YYCA 1WZKA 3LBMA 4IGHA 4DJDC 2CWNA 2PWGA 4GZIA 4J3WA 3L65A 4PMNA 1A5CA 4CU7A 1XLEA 3PUEA 5A3HA 3UCDA 4JFWA 5D02A 2BWGA 3CL7A 4J3UA 1O6IA 5DCEA 3T44A 1UBPC 4JX4A 4HHPA 4XBJA 4ZBCA 1BRLA 5DEZA 2ZFAA 1TE6A 1K6AA 5C2GA 2R24A 3LCGA 3V75A 2PAJA 4U28A 2BTMA 1A3WA 1R38A 3MU7A 5A6BA 3KBMA 2V3GA 4GUJA 3AMDA 4H2CA 4MJ2A 3H22A 4UFIA 5D30A 2VC9A 1LRTA 4ZSUA 1MRAA 3IK2A 3W7HA 4DHGA 4I9MA 3EB2A 2HISA 1UUOA 2A3LA 5I77A 3PZVA 5F7UA 3BW3A 3AMLA 4AIBA 3R12A 5FF0A 1F4AA 3QPEA 4L56A 1QNSA 2FPVA 3ABRA 3QV6A 3TMLA 4DM2A 5DMNA 4C6OA 4B2DD 3PZTA 3UNDA 3ZT7A 2A6NA 3KP1A 2HSAA 3AZRA 4YWSA 3D6NA 3GIQA 1KBBA 2BMBA 4AYSA 4H6QA 4Q22A 3ZJ6A 3AXHA 4IISA 3KOWA 1JYWA 2Y7EA 4Q33A 4KEMA 4L65A 3MTWA 1X1OA 2NX3A 2VQUA 3UZJA 1ONXA 1XPYA 2VR5A 3JR2A 5TNVA 4RNJA 2XINA 4P8UA 3WX7A 2IXVA 1V3JA 3P14A 3OGRA 1NWSA 4XKMA 3A21A 5C71A 3CH9A 5ECUA 5TBOA 1FVPA 1TV8A 4MY8A 2WLYA 1VFMA 1SW0A 5EKYA 3UU0A 3EDKA 3KDNA 1KD0A 2F7FA 3W9ZA 1H7RA 1M1BA 2VT0A 4YL2A 5AHFA 1UOKA 2GQ8A 3LV6A 3DU0A 2ZZ7A 1VIWA 1E56A 5C2CA 4HNLA 4EWJA 2WQPA 3F5LA 1OABA 4B5UA 1E4MM 1QWGA 4Z2LA 4JAWA 3QPZA 2ALDA 2DT2A 2CBIA 3HMJG 2PSNA 1X6UA 3OU8A 1KCXA 1OC5A 5GJMA 5KZEA 3C61A 1XG3A 3ZIZA 2C79A 2GOKA 3QC0A 2X42A 4D6FA 4G7EB 4LVAA 5M3WA 1R0MA 5CH9A 1P6WA 3TN5A 5M03A 1WXZA 3IIXA 1TWWA 1XWYA 2NV9A 1E72M 3DIPA 2DVUA 2WV8A 2XH7A 1UKQA 3ARQA 4NF7A 4QE4A 3ZVHA 5FACA 2IW0A 7PTDA 3IS4A 4ZTYA 5D38A 2VUYA 3EWZA 1GTEA 2GVLA 5H1WA 2AKMA 3QY8A 4XZIA 3KUMA 2NLIA 2OYLA 1EF3A 1G4SA 2G0WA 1TELA 3O1NA 4MDPA 2YCJA 3WELA 3AIVA 1WDRA 2JALA 5DMYA 5D2YA 1JYNA 3UPBA 1EUAA 3N4FA 3PVFA 3BJSA 2FH8A 2FZNA 3C86A 3CTTA 1PUDA 5C6MA 4HOZA 5IRPA 3DI0A 1RQEA 4WDWA 4I9AA 1TX0A 1BYBA 1OCBA 1TRDA 1FUYA 1YPIA 3SFWA 5LYRA 5FJTA 4PH6A 3QR1A 3GY1A 4YNGA 3EA2A 3LENA 1A5MC 1D3CA 1UKPA 1S2CA 4KWUA 2QCMA 1TPC1 4QR6A 3UG8A 3TC3A 1EJTC 1PKYA 3CUGA 3BAIA 2FZMA 3PWGA 1SZGA 3S83A 3W7QA 1UPPA 2ZKMX 3FNDA 4K39A 4C6CA 1W1ZA 3ITYA 1CENA 3EOUA 3GR7A 2J8TA 2P8CA 1M04A 3IIVA 1F6PA 2RDXA 4AWSA 4I9JA 5LGZA 3G1AA 1H2JA 3M0IA 4WRHA 3L4WA 1F07A 2AAAA 5AHIA 3GNRA 4LVFA 2NSXA 1GOKA 4NG3A 2QCDA 2EG7A 5DFAA 3MZNA 3FA4A 1KCKA 2ZWYA 3PBYA 1ZTVA 2PTZA 4JEJA 1V7YA 5FL0A 4O57A 4M51A 2WKLA 3P84A 1CLXA 4PCNA 5CPQA 3TTQA 1K6WA 3WNLA 1N55A 9RUBA 2CLOA 2PDNA 5FJPA 1W2VA 4DAFA 3RCNA 1AL8A 1GPFA 2Y7DA 3C2RA 4PCSA 5D9OA 3GWQA 1S2AA 3BW2A 3LG3A 2WHLA 4AZIA 3QFWA 4DO6A 1LORA 4TX6A 4A4AA 4F9DA 1R86A 4JS3A 4PUKA 1CLKA 3UXLA 2CPUA 2PGRA 2QAFA 1JDDA 3PB2A 1ZY9A 2L5HA 2R6OA 1V4YA 3L9CA 5HULA 3CV6A 1TPB1 2ZBTA 3NURA 4J3ZA 4W87A 1VYSX 2AMGA 4Q8MA 5JVLA 1O5KA 1X6LA 3BQ6A 3FJLA 3QW4B 3WQ4A 3OBAA 3VGHA 1OCNA 3O2LA 3E74A 4AIEA 1K3UA 1LG1A 4X9SA 2VQTA 4HZ8A 3SFKA 5BROA 3RR1A 2V5KA 3SY5A 2FJKA 4FP1A 4UQCA 3CJPA 1YBQA 5E9XA 4WJXA 4GC3A 2GQAA 3ID7A 3EA3A 3CUIA 3VX1A 2Z27A 3GO2A 5IBXC 2CU0A 3URBA 2XIIA 3A12A 1UJPA 4IL0A 1L6YA 3BV7A 3AIRA 1A5NC 5DT7A 6REQB 3BZGA 1KBKA 3GFYA 4AZBA 4C7FA 4PZVA 4LH8A 4LCQA 2INEA 4N7QA 3FVMA 2Z7GA 2AQVA 1GZJA 3WQ8A 3WSUA 3A3WA 4ICMA 2X09A 2CLEA 2HXUA 2OU4A 3ARPA 2X16A 4GCAA 1DJZA 1QFEA 3AYTA 3BAJA 2EBNA 3RCYA 2Q6ZA 3W6MA 1TQXA 5ECVA 4W93A 3WF4A 2Q3RA 2RH9A 4LUSA 1LJYA 2PWUA 3AXIA 4IQJA 4DX3A 2YBUA 5FF3A 4O0QA 2CHOA 2YOCA 3LRMA 4JTHA 3G1HA 2VRQA 1X1ZA 4LNYA 4XAZA 2ZUMA 4C5YA 1W8SA 4M24A 3UR8A 1IGWA 1FWIC 1UCWA 3FCPA 3WLLA 3GH4A 3NSXA 3SJNA 2Z26A 4FNTA 1TV7A 3P6LA 3PFRA 2YSWA 2CLHA 1QT1A 3WYZA 3H2AA 5I3HA 1ONRA 2NWRA 5TD4A 3H2OA 3H4XA 1BVNP 2YPIA 2FDSA 4U3CA 4E3VA 1IEXA 2PC8A 4WY0F 3M0MA 3ERPA 4M7SA 4XZHA 4QSHA 3EDEA 5I3JA 5A6SA 3GG7A 4K7VA 2DUXA 4ADUA 3BOFA 3DYOA 1R3RA 4WK9A 4NI8A 2Q8ZA 4LPCA 5E5CA 2ZZ5A 4XB3A 1DE5A 5HANA 3RLVA 1UA7A 5C7VA 4O1EA 2H9AB 1OY0A 3H4WA 4KWSA 4NJKA 1U33A 3IWPA 3WUGA 5C9UA 1P7TB 3KW3A 4OTKA 4U2YA 3CK5A 4LYQA 1XLBA 4UTTA 1FHVA 1PAMA 2QVNA 3VGFA 4RE0A 3IAPA 2XZ9A 4LVGA 1C93A 3NL3A 1WBJA 2Z6IA 5HJXA 1G67A 4DAIA 3E0IA 5I6SA 1TUXA 1J6OA 3W87A 3T4CA 1S1RA 2PCEA 1UQYA 2NVAA 1E9IA 3IJLA 3HFTA 4IMGA 1EH9A 4MJMA 4AX6A 2IUZA 4UTJA 3WMSA 2XGIA 2IPJA 1IXQA 3MKCA 3S5NA 4O0ZA 4Q8WA 1K7EA 2A79A 2WVVA 4AZ7A 4M80A 1KM3A 3CPUA 3PZNA 3SW6A 1FWJC 1PWMA 3T2QA 4MYAA 2VR2A 3BANA 2V81A 1XV8A 4RZ4A 3C3NA 3GE7A 3VNIA 3G1YA 1XYAA 3BUVA 4GXMA 4ZQPA 5M5DA 2Z1VA 1PKNA 1G1YA 3QFEA 4JYFA 1IF2A 3ZFHA 4QITA 1RCXB 2PB1A 1S38A 2Y1HA 3IV8A 3DBNA 3OPSA 4P7NA 3GBDA 4AY7A 1BRLB 3ATZA 5AC7A 1EHNA 4O28A 4PTVA 4B90A 1Z42A 4HOWA 8XIAA 2Y8VA 1TCDA 5HXMA 3BARA 3Q58A 1FXPA 3WEOA 5B7YA 4B5TA 1BWVA 1FCUA 4E6MA 2OWCA 3NVDA 3HJZA 1A3HA 1MUCA 4FXSA 2ISDA 4AZ6A 2X2GA 5BXSA 1WPCA 1ZENA 3B05A 3R0DA 3VZXA 3CLMA 4Q32A 3N3MA 4GISA 4WY0A 4FO4A 3LLDA 5AOUA 3MO7A 4D71A 4QXIA 3DEQA 3K8MA 4L9ZA 3AS2A 3CZ8A 6TAAA 1OG0A 5AVNA 3SSZA 2YCLA 2QV4A 3EXRA 3ARVA 2JE8A 4UMAA 1Y7VA 1UKTA 4QCFA 4EWND 2XM1A 2WC4A 3L67A 3D0CA 1EWDA 1Z9AA 5CG0A 4Z17A 3AU6A 3STCA 2VENA 3DENA 1CZ1A 2GFTA 3ZJ7A 1XH1A 1B31A 2FHFA 2Q3OA 3TQKA 2X7WA 3O63A 3W1TA 4AIOA 1OEPA 2WMIA 1SJDA 1PIFA 3MPGA 1HG3A 2P50A 3BVJA 3W75A 1UR8A 1QTWA 5AZ0A 3IUHA 3NEVA 5FCZA 3IPWA 2BBFA 5D2WA 3VDGA 3OQ8A 2MANA 5DMLA 2A1YA 3IGXA 3T81A 2E5BA 5E0FA 5KZ6A 3CV1A 4MG4A 1JZ2A 2R1NA 3ZSSA 3EWBX 4GJ1A 3H2FA 3UQNA 1DXFA 1TR9A 5TIMA 2WNNA 4GLEA 3UJSA 3ZWTA 4DO5A 4LF2A 1XJBA 1KFKA 4QE5A 4L9YA 2HS6A 5BMWA 5A2CA 1FWRA 1D7KA 1YTKA 3NG3A 1PVNA 2FPTA 2J7FA 2VX5A 4PULA 1V0NA 4UQAA 3S2NA 1GQJA 2X1RA 4M5PA 4TXEA 4GQBA 3VDHA 3I6RA 3PAOA 4HD5A 4BWLA 4K37A 2PE4A 1PZ0A 4IJBA 1JG9A 4B5VA 1H7XA 1FBAA 3RGTA 4JTAA 2QAPA 4O52A 3DDMA 2A7RA 4XQ6A 4Q8NA 3ZXWA 3QBUA 4KFNA 4JKLA 5HJLA 2GJNA 1KO0A 3LHVA 2YZRA 2WB5A 1J96A 1FOBA 1XXXA 5BNKA 2DIKA 2XIQA 1ZCCA 2ZA1A 1DWGM 1M9HA 1SFLA 4GY0A 3P61A 4QJ5B 2O0TA 3WNPA 3GH7A 1OFAA 1JUBA 4PMVA 1FKWA 2E1WA 3HN3A 3E02A 3ZVHB 2QF8A 4W84A 3T08A 1XRSA 4TR9A 2PPGA 2E4TA 1QW7A 3AJXA 4W7WA 3M16A 3P8JA 1YX1A 3IACA 3DC0A 4JN6A 4N42A 1HKJA 1HP5A 3NTYA 3WDPP 1IEIA 3BGGA 4GY7A 3VYLA 1B3OA 3K1DA 3CQJA 2DW6A 3ARSA 5BOEA 4Q8OA 5HPCA 6CGTA 5BW6A 4M19A 3LBOA 1XIEA 3R8GA 3A4JA 1V51A 3QZ6A 2UY2A 5I24A 3SCWA 1EBGA 1RD5A 4YCPA 2O9TA 1V77A 4IIGA 3CUXA 4QS5A 4TVUA 1RP9A 1GOWA 3MA8A 2NUXA 3M44A 3W6YA 5LIKX 2JGYA 1RLDA 3MWAA 1U5HA 4REQA 4HCHA 1LT7A 4XO6A 3RK8A 3C6CA 3EPOA 3BAKA 2DSVA 1WZMA 4C6MA 1F8MA 2ZVIA 3DHFA 3DFHA 4W8AA 4LBSA 1SM9A 3ONBA 2V6AA 1PX4A 1O5XA 3GAKA 3PUDA 2TYSA 4AXKA 3H54A 1CXIA 5FI8A 4Q8UA 4I3GA 3TLLA 1OZQA 3W74A 3VD9A 2BHUA 1FWHC 4MIMA 2QCDB 4A21A 1JPDX 3P0XA 1OC7A 3KRZA 3UPWA 3K8KA 4HA0A 4B4FA 1KQZA 3RNDA 2C3ZA 3F5KA 4DNMA 1C90A 1UH4A 2J6XA 4RUBA 3M64A 3LCXA 4BFAA 1SO3A 3I6TA 4GNJA 4O4VA 3R0UA 4LYRA 3EOOA 5A6MA 2QS8A 1LUCA 3TYUA 4RPPA 1XLGA 3VIJA 1V3LA 3QSTA 3LGEA 5DXYA 3R94A 1HO1A 4LVBA 4A8IA 5HMSA 2FLIA 3M0VA 1BG4A 1X1NA 4JTIA 3CZLA 2OGYA 1KC7A 5LA1A 1OYBA 3AIBA 3N2CA 1BXNA 2UV8G 4XWUA 3KBJA 3LPPA 4LT9A 4XD4A 3U6WA 4M6UA 2PD5A 2OQHA 1KM6A 4ASTA 2QIIA 4HU8A 3W7JA 5BWAA 3TJIA 4L80A 4S3FA 3K4WA 3CL6A 1GYNA 1H61A 3T8QA 3NQAA 1I75A 1B3XA 3OJGA 3TTSA 3WLPA 1QASA 4KFOA 1GOQA 3CAWA 1X7FA 2HBXA 1YBQB 1K7FA 2X40A 2NWSA 2O9OA 4URIA 5A6LA 1VENA 1AD4A 1BTCA 5KITA 1WKEA 1C3FA 1PBGA 3IUIA 1XINA 4AD0A 2ADAA 2HWGA 4GX8A 1E51A 4DIAA 4N02A 3VOIA 1UMYA 4N9BA 5G2WA 1DJIA 3GTXA 4GI8A 2P3ZA 5HNUA 2W3ZA 4H7VA 2CHNA 1W3NA 1UUMA 2HNHA 3G0UA 2CZVA 4EAYA 3LRLA 4QDPA 1JCLA 1EJSC 2ZICA 4IX2A 4HYVA 2ATMA 3OVQA 4CU8A 1SZRA 4FLQA 4NXSA 1THFD 1NOWA 4UUIA 4Q4KA 4LUSB 1DIKA 1CB7B 2MNRA 4BI6A 3W38A 4PBEA 2DEPA 2ATSA 4DPPA 3GU1A 3W83A 4CQ8A 4Y9MA 2V3DA 3QM3A 5HQMA 4F0SA 5CCZA 5XIAA 1UZHA 1KCLA 1QK0A 4L61A 4AYGA 3BZJA 1VCVA 3NGFA 1BTMA 2CERA 3LTYA 1EZ2A 1NIUA 3UZYA 3L68A 1ELSA 1GZ1A 3K4DA 1XL9A 3INPA 2OWWA 3FJ4A 2IS7A 3PP7A 4J27A 4PUNA 5EMMA 1WDWA 1R3TA 4Z2GA 5H8PA 3OIHA 4TO8A 2QKFA 3WD1A 1Y5WA 4OGZA 5D9MA 3V0TA 5D4YA 5EMLA 1UWSA 3OGVA 1ME9A 2HROA 2BSLA 2BODX 3EKLA 1C8YA 1XUUA 2YR1A 3RLUA 3VCCA 1QXLA 2NQ9A 4CVUA 4JHMA 4ACYA 2E5DA 4RCXA 4XAYA 2GZXA 4O12A 1OT1A 4ZB2A 5CC5A 2G4JA 1R9XA 5DXXA 5A2AA 3LTSA 3AIUA 3T0AA 1Q5MA 3GNOA 5EJZB 1LWJA 2WOQA 2XHYA 3XINA 2XZ7A 4NAEA 1FWTA 3EXSA 1ZBKA 1JXJA 2EG6A 1IXOA 3K8LA 2OZ3A 1CBGA 2GUBA 4RNIA 4XK2A 4LXFA 1TSIA 2ZUWA 3OZYA 3UVIA 1XIDA 2VYOA 5EBUA 2NZLA 1TIWA 3PBUA 4NASA 2BFGA 4AHQA 1A5OC 3B8TA 1VF8A 4EOUA 3WJWA 4ZR8A 1MEWA 3NAVA 5GQBA 3AISA 4QAWA 4JIHA 3W1UA 3WN6A 3E9AA 4AF0A 3GM8A 2VL4A 1VHCA 1ADSA 5I06A 1GOOA 1V3KA 1N8WA 4LAUA 1B30A 4AZCA 1EF2A 1QU4A 4JTQA 3GYEA 4L7ZA 2WVVB 5A6JA 4A22A 5KETA 4JTEA 4MNMA 1UWTA 4OBTA 3UESA 3AFBA 2PS2A 4MNKA 4HT3A 5AHLA 3WL1A 4E2DA 1GEHA 3ARWA 1QO2A 3LGDA 5A6TC 1ESWA 3FKRA 3BAXA 5CZKA 1KFCA 2RDTA 4ROQA 2DZXA 3HPSA 3Q45A 1F74A 3CYVA 3EWCA 2X0SA 1SR9A 3LMZA 3V4BA 3SGZA 2ZE0A 1W3JA 5D09A 4Z1AA 4V1YA 3M46A 3VNLA 4EXQA 2ZRYA 5CSRA 2ZZ4A 1GQLA 1BSIA 5A6KA 1W3KA 2X1SA 3J7HA 4Y8FA 3N17A 4ICCX 4O17A 1NOFA 3W0KA 1G94A 2VR4A 3QMSA 3AMKA 4CN4A 5DQPA 4FPSA 4FAMA 1OD0A 3CHFA 5E0CA 4K7YA 2F84A 2Z1BA 3T40A 4B5NA 2VGBA 2V2CA 4LU0A 2IKGA 4PBFA 2YCLB 1UKSA 5HQEA 1VYPX 1AH3A 1R3WA 4HA3A 3DKJA 4X9YA 5T9CE 4MZYA 1UROA 1VQTA 1E6QM 3RX2A 1SYTA 2XN1A 4M82A 3L23A 1NWUA 1XBYA 5CBIA 3R25A 3BMVA 3IK4A 2A2IA 3Q37A 2CYGA 5HK4A 3R4IA 5C9WA 4OOUA 1HXJA 1XF0A 3QR0A 4JQ2A 2EGZA 3WQGA 2UY5A 1GYLA 1I2RA 1GGOA 1DV7A 1VFFA 4IIBA 1M7JA 6ENLA 2DJXA 2WHJA 3VZZA 5CPSA 2Q71A 1G4PA 3CB8A 2A85A 4V1XA 1KRMA 4QDMA 3RX3A 2XN2A 5JH1A 1UJQA 3WLMA 3VKJA 1DTNA 5C0QA 2OZ8A 3IV3A 4WDXA 3DG6A 4UFLA 3H12A 2ZRWA 2NT0A 2BASA 3JZUA 3MV11 2WQDA 1JZ3A 3TR9A 1UIPA 1NDWA 3RMEA 5LHEA 3KLLA 4BI5A 2HJPA 4QEEA 3RMJA 2OODA 4H7CA 3NQ7A 4FMVA 4AC7C 3T1GA 1EJRC 2FVLA 3A5VA 3TSDA 2VRJA 3BW4A 4MNJA 1EWEA 4GYPC 1K9TA 1UR1A 4R9XA 3W2LA 4B15A 2QJMA 1DWHM 1KNWA 2ZWZA 4H9TA 4N4QA 1JRCA 1KRBC 4HSNA 2CLPA 3W7CA 3TIMA 2HEJA 3C8FA 1BLIA 3JUGA 1L2UA 5DO8A 2VNCA 2A7PA 3FJNA 3GTHA 4Z2IA 4IM4A 4LOCA 1UZ1A 3EKGA 1UC4A 4U5IA 2A4AA 1HUVA 1EX5A 4C91A 3M6YA 3TR2A 1UQZA 1TCMA 3IAQA 3B9AA 4XAPA 3L0GA 3AC0A 1SJBA 4XKYA 5HA7A 2HDJA 2Z1XA 3QRHA 4UTWC 2XIMA 5PTDA 5CJMA 3UT0A 5G1TA 5KZMA 3FEMA 2FGLA 2HCVA 1OFDA 3TX9A 3GDTA 4IGSA 2OQLA 1P0KA 4LTSA 3OHMB 3NUKA 3U4AA 4AWUA 4PCFA 3BCFA 1DL3A 2G96A 2WMKA 4GIRA 3UA4A 3BAWA 1X7IA 2QCGA 3W07A 2CBVA 1AH0A 1OX4A 2V5CA 2DSWA 3N19B 4ZZ9A 2Z29A 4Z1YA 2AMXA 4I7WA 3ITLA 2PWDA 3G8EA 1KA9F 2AL1A 4A05A 3D47A 4NY2A 4X61A 3VIHA 2DFAA 2W91A 1PTAA 4U33A 5ABFA 1SJAA 4HMEA 2PTYA 3M0HA 3G18A 1OSEA 2OZTA 3LQLA 2VGFA 4HSOA 3GTNA 3MUIA 3TZNA 4CN1A 2DZSA 5ABTA 3E6EA 1KM1A 4IIFA 1ZL1A 3CZEA 1EL3A 3DGRA 1ITXA 2ABAA 4IZGA 1LQAA 2X0YA 1FTXA 1CXKA 1UH3A 5HAOA 4ZTXA 3HPAA 1W5MA 3K2GA 1MZRA 5JIWA 1BWLA 3Q67A 5I3KA 2XVLA 4D6IA 4NAFA 2GGJA 2J74A 5HR6A 4RPQA 3S5ZA 3WD4A 1HJQA 3UVAA 1XH2A 3VD4A 3UW6A 3W7MA 4DJEC 1HF6A 3URQA 1LUCB 2J25A 3GHTA 3LNPA 3EWUA 2GUUA 1PTGA 2CXGA 3M7SA 4B3LA 3GC4A 1HNYA 1QMLA 4LRSA 1VH7A 3UZZA 4PMRA 1XLCA 3TJLA 4XBKA 3QLDA 1XLIA 3MT1A 1R46A 3RLGA 3FJ6A 1OBAA 4H9VA 3UJ2A 3K4AA 3F4NA 5C55A 1H63A 3GXDA 4GABA 5I0DA 3WJSA 4FX7A 4NJHA 4H9UA 2EKCA 4LCRA 1J0KA 2WPGA 1Q6DA 3B40A 4X60A 2PWEA 2YW3A 3KVJA 3NO3A 3BG5A 3ABSA 1JF5A 4FSAA 5BXPA 4MWAC 3RF9A 3GNDA 1MWOA 3I10A 4AUBA 4UFHA 4GKLA 4OQVA 4Q8PA 2YB1A 4GG9A 4NSBA 3DECA 3W7KA 3N3TA 1S46A 2E1DA 3MSYA 4Q7IA 2PD9A 3N04A 4DBSA 1AD1A 2D2JA 5HUPA 4KBXA 4LQ1A 3BG3A 1GNXA 3VOCA 1TUFA 4KGJA 1OINA 3ORWA 4OT7A 1JAEA 1EOMA 4B3KA 2WJZA 2LLEA 3EWWA 4DWDA 2YDQA 3AWOA 1V6WA 2YDAA 4J7RA 3LRKA 3AAMA 1HT6A 4TTUA 1KM5A 1PTDA 5ENLA 1YXCA 1WDQA 1QBBA 2EKGA 3W28A 3GBEA 3S8HA 1GVSA 2G50A 2RGMA 1YNQA 4BY3A 2C8NA 3W7PA 3HA1A 3FA5A 3COTA 2HTMA 3GS6A 3KCOA 3CZKA 4DXVA 1BSLA 2XIBA 4IPPA 5SWUA 1AH4A 3CASA 2D24A 2VVNA 3UA3A 3W27A 2ZDSA 5A69A 4A3QA 3SN4A 3GSMA 2PCQA 3HV9A 1MNZA 5TF0A 2VVSA 3CV2A 4RV8A 5DT5A 5DY2A 3EGJA 3TN6A 5FF7A 3SCPA 2I5QA 2EO7A 5LXEA 3C56A 3JW7A 2VZSA 3I3BA 4GXWA 3T8LA 2XGZA 5KTLA 3G0XA 2OXNA 2ZUVA 4IP5A 1JYVA 4Q4SA 2OSYA 5BWFA 3KRUA 4HU3A 3SCOA 3HIJA 4XSMA 1CCWB 4HA1A 5LNUA 4YPJA 3GDBA 4LS1A 1J93A 4Z1BA 4MWAE 8CGTA 2PDMA 4LAKA 3RJYA 3H2MA 1ZQ5A 4HMDA 4RDZA 4L1WA 4C6IA 4JTSA 1XH0A 2HMCA 1XLHA 3QV7A 1VPQA 5CZSA 3GVWA 3N18A 1EC7A 1HP4A 5I3GA 4Y9NA 3G8RA 4MLJA 3T78A 3W53A 4A2RA 2XFFA 2J8GA 1JDEA 1BVWA 2X7VA 3W70A 4EK7A 2BV9A 5FF4A 2X1IA 3E0LA 1HO4A 5J8LA 1R2RA 2CZEA 2H3DA 2HS8A 1MO0A 3SCNA 5DX7A 1L6SA 4LRTA 9XIMA 3A9IA 2J4GA 2BGSA 1R85A 2OWXA 3B04A 3LB0A 2CLIA 2CESA 1F7BA 4AF0B 4I6VA 3NPUA 1QOXA 3W1PA 1ADOA 4UOZA 1S5TA 1REQA 1B3YA 1PXGA 2PTWA 5A8PA 4MM1A 3LXAA 3WH6A 4AZCB 2XWDA 3KE0A 4PSRA 3TWAA 3ZM8A 2VC5A 1HKVA 3PTMA 4PTNA 2DJLA 2XN0A 3WUEA 2B7NA 4O16A 2C18A 4JNMA 3QV9A 1TWDA 1QBAA 3S2LA 1O60A 1PZ1A 3W76A 1EA9C 5FJJA 3VK5A 1T8QA 1F3WA 3W2UA 1XIFA 3GU9A 5CXPA 3RX4A 2QUVA 4YYFA 1XBZA 2QXWA 3UG3A 2G3NA 4ADSA 4Q4PA 3PULA 3MKVA 3L21A 3G24A 3UD6A 4CD7A 4H2HA 3G6MA 4XUYA 4PTWA 4L4MA 2NW0A 3OVGA 1PS9A 2YFNA 4I90A 4PR4A 4W89A 3W86A 3WQDA 2OEMA 3B03A 1A4MA 3EXTA 3QKZA 1ZAJA 3A13A 4G1KA 3NQ2A 3UZWA 3HBLA 1SZNA 2C19A 3OBEA 2CBJA 1OHLA 3RN6A 4DRSA 4EKJA 4L4OA 3TVAA 1C9WA 5CPMA 7TAAA 3MANA 4WCJA 3VCRA 2Y70A 2D73A 3OYXA 1TREA 3PBMA 3SUVA 4LW7A 4EP8C 1PB0A 3MUY1 5BRQA 3MVTA 2O92A 1Z3NA 4FIRA 4GZEA 3WK1A 3A4AA 4LYKA 4AX7A 3L66A 2HPIA 1YE4A 2Q01A 5EMKA 4IFKA 3GTFA 3WLOA 2RJGA 3F03K 2OR2A 4AEOA 5KMYA 3C2VA 4MB4A 1F05A 1CECA 2QZRA 4MUZA 4C60A 4LUTB 1VBRA 1ZCOA 2BXYA 3STFA 3LS9A 5CC3A 2WJDA 4G5DA 5I07A 1VFOA 3TSBA 1LLZA 2J9ZA 2V68A 1M3UA 5H8MA 1C92A 4TVDA 2PFHA 1S3TC 1Q6GA 1ECEA 3OGSA 3NCOA 4YTUA 3E3HA 4IG2A 3HG4A 3LUTA 4WSJA 4S3BA 1KXQA 4JN7A 1RV8A 5FSDC 1RCQA 4EACA 4F66A 5EGRA 1WXYA 1F73A 4HK5A 1QJWA 2DZVA 1W5QA 1QHZA 3TTEA 1KGUA 5G4WA 3ECQA 1P0DA 3LCIA 3QKEA 1CI1A 5BRBA 4W5UA 1KW1A 4TX8A 5T8GA 5I3IA 3WLNA 1C29A 3GR4A 1MUWA 4Z0JA 2NXHA 2ESCA 3WK3A 1OK4A 2NQ5A 3I68A 1PJ9A 3W81A 1WNOA 2HNEA 3GW0A 1A50A 1M68A 4BK9A 7CGTA 1AW5A 1NFGA 1KKOA 4KH2A 4FALA 4DF2A 2O56A 1A0DA 4IJCA 1UWRA 4DVOA 4IJRA 3TE9A 4EIVA 4U5KA 3G2GA 3IEBA 3OG2A 1UA3A 3THCA 4HZMA 2I7GA 1B9ZA 4JHOA 4GK8A 4ZQOA 3QOKA 2EAWA 2IQ0A 3UYCA 3A4WA 1WAWA 4POCA 3ZMRA 2G3MA 1K1DA 3E5PA 4JFTA 1L8PA 5GNXA 3IJIA 1EJXC 4UQBA 5EA9A 5LKYA 4FF5A 3WQ6A 3EPNA 5LNWA 4QNEA 2OLSA 1N7KA 2NQLA 1V02A 3KLKA 1AW2A 3KCLA 5D9NA 5FKYA 3HG3A 2E9MA 3WF2A 3RILA 3A23A 3M6DA 3GDLA 4PMJA 1RK6A 1EO7A 3Q4DA 5IHSA 3AS1A 1LL7A 3LHWA 3GXNA 1KFBA 1BGGA 4HU0A 2OVLA 3LV5A 2BY1A 4IL2A 4IICA 1V6UA 3T09A 3W25A 3SIMA 1NWTA 3SGGA 1W1IE 4FXFA 2O55A 2P53A 4PN2A 1M7PA 4IFRA 3C2FA 1EP3A 5ABFB 3UETA 4UTHA 4K6AA 1AW1A 1Z48A 3PNUA 1E1CA 2WSKA 1FRBA 3BDKA 1AODA 1D2KA 4Q4OA 2NQHA 2EJAA 4BEUA 4GVFA 5I23A 1ME8A 3CQ0A 1G0CA 1QW8A 1BYDA 1E55A 3S2JA 2GVJA 3D5HA 2OZ0A 4XZ9A 5L6UA 2O4MA 1J2BA 1JPMA 1V6XA 3LHYA 2ZADA 3C0QA 4UNLA 1JJKA 4XO7A 3W7DA 2YXXA 1GKPA 1Q6RA 5CZTA 4C7GA 3D3AA 3MC5A 3LGGA 3MBFA 4NAFB 4MF4A 2P8BA 1Q13A 4D8AA 3GXFA 3N2XA 2ZUSA 1S39A 4F2TA 2WYSA 4GZ7A 4PCTA 4HNNA 1CXEA 2QUMA 2E5CA 1H7NA 1A49A 4O13A 1H09A 1DYSA 3NA8A 5T91A 5AYIA 2IPGA 1HTIA 3FEQA 1TJPA 2DZAA 2Z25A 3KHJA 1FDJA 5G5IA 3PZGA 3NQCA 1EC9A 1YNYA 3NXLA 1PE1A 1XISA 4Q7NA 2G3JA 3VVGA 4MYXA 2ON3A 4IMDA 1TR1A 3LX9A 4US6A 3T6CA 1VBHA 3G6LA 2PEVA 2XSBA 1OGSA 1K8XA 1H3GA 3HG5A 4Q8TA 4JTLA 1UWIA 3DUGA 3EX4A 1HVXA 5REQB 4WD0A 3WMBA 3L2MA 1DXIA 4HK6A 1ZJHA 1V0LA 3RG6A 2CZFA 3E5BA 3BICA 4AD5A 3WUFA 3HQOA 1M03A 5G4HC 1PHQA 1GG1A 2GSEA 1GTHA 1AUSL 1M7OA 5D2TA 5M17A 4JX5A 4PUEA 4WSKA 4Z1DA 4AMCA 1SSDA 4KWOA 5A8QA 2E67A 2R91A 1S2UA 2E8ZA 1SSGA 1DIOA 1O7AA 4WKAA 3I7RA 4JR5A 4MZ1A 1W9XA 5CGMA 5LZLA 4NZFA 3WJZA 4GFSA 3V35A 1R9YA 4A6GA 1IWPA 4PUMA 7ENLA 1HQTA 1VCFA 2AQOA 3RITA 3LTPA 4UZSA 4JTFA 2OELA 4K36A 1M7XA 4J4KA 4QG8A 4ZFMA 3M0LA 1RPXA 3N2TA 1V6TA 3EWYA 3W73A 5HMDA 2Q02A 4HJWA 2P3EA 4PODA 4XIAA 3EX2A 3KXQA 2YB4A 1FWWA 1S2TA 3AYSA 3C8NA 4GA8A 3R8RA 2WHMA 3A3HA 1H41A 1O5QA 2DT3A 1BPLB 4FZIA 3R1ZA 5T9BG 1KBIA 2E6DA 1FWGC 1EXBA 3M7WA 3U2OA 3BJFA 5IM51 3LOTA 4TOQA 4M6VA 2G3IA 3UCQA 3VGBA 1JFHA 3DOPA 3VFLA 4EPBC 3CHDA 3M41A 5CPLA 2Y62A 3TJ4A 4DLMA 3VIGA 5BXRA 4ZB0A 1H1NA 2XFWA 3PANA 1SVDA 4DQWA 3UXIA 3ZSTA 3BE7A 1B57A 3L7RA 4WKHA 4RR4A 4YJ5A 3TLQA 5A8MA 1CWYA 1W9BM 3IVUA 1K9FA 5EFFA 3O6YX 2J9YA 3NO5A 3HPZA 2XSXA 3QQ1A 4M81A 1I9CB 1XFCA 1VR6A 1B3WA 5HUOA 5MKGB 2VFEA 2WKGA 3TW7A 4Z2HA 1ICQA 1SFJA 1EIXA 3ONCA 2Y5EA 3VU2A 2J9XA 4QEHA 3W01A 1EC8A 3CEPA 1XHGA 2DH3A 4FXRA 3MI6A 4RJEA 2VURA 1NOUA 3QXBA 3AUJA 3SUUA 3PBWA 1LF1A 2A3HA 4YTRA 4KRTA 3PJWA 4GPNA 4IUGA 5A94A 4CQAA 1KFJA 1RZMA 1P6BA 1GVQA 1PYMA 1OFEA 5EYWA 4U3AA 2WBKA 3KRBA 4GXPA 1AA1B 2EHHA 1HJSA 4CVWA 5BU9A 2QPXA 1REQB 2D20A 1W9VA 2VOTA 3SN1A 4UMBA 5I02A 3CT2A 4ZO6A 4PSPA 1YNPA 5F4SA 4H04A 2OLAA 5EY5A 2QGHA 3OVPA 3TYAA 2WSPA 2Z2UA 4RV3A 4Z2KA 1XGZA 2D23A 7XIMA 3IARA 2BOEX 1TWZA 3C2EA 4HZ7A 3FHQA 3SRFA 1OX6A 3ZT5A 4B4HA 2D2OA 3CV7A 3CT7A 5DELA 4BEQA 1PYFA 3CWOX 3CGTA 2YL9A 1CXLA 3FKKA 4ATWA 4AG0A 4B16A 3QZAA 5AZ1A 1J0ZA 2CLFA 3BJTA 2D69A 5E70A 4KQNA 3S1GA 4B2DA 3BAYA 1EPVA 2DDXA 3MUCA 3W7EA 2A21A 3O0KA 3R8HA 2BGQA 1E5NA 1SO6A 5CGQA 4CD8A 3WK0A 4J3SA 3GC2A 3AXMA 3STGA 1S2VA 2BOGX 2WNQA 2ZA3A 4OFCA 3W82A 5MF5A 1HFBA 2J7CA 1IZKA 2DSUA 1K8ZA 3IJQA 5CKSA 3WLKX 4JL1A 1A5SA 1GT8A 3CC1A 1FWNA 2NV1A 4I8DA 3TH6A 1XYBA 4DJFA 4E0CA 4IFKB 4GYFA 3UGRA 2GJXB 1POKA 3TNOA 4E4UA 4R3UA 4JFSA 3HPFA 4DWSC 4S3KA 3UF9A 1WOAA 1BQGA 5FEZA 2ALRA 3NNTA 5AYZA 2Z2BA 1E0XA 3MB9A 2YA0A