3LHTA

Crystal structure of the mutant v201f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIFGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lhtA00
1SW0A 3TQVA 4FO4A 3WFAA 2Z0IA 1VCVA 2BXVA 3DBPA 3EWZA 1PCKA 1TTJA 4MZ8A 2F84A 4M6QA 1FUYA 5G2WA 3GZ3A 4RXFA 3F1QA 4AXKA 1XM3A 3BV4A 3P81A 5DY2A 4CCEA 2FPYA 2OJPA 4L4MA 3AJXA 1X1ZA 3UD6A 4XTDA 1BEUA 4DQWA 1TQJA 4BF9A 3SI9A 1VLWA 4FNSA 3P61A 3NL6A 4EF9A 2CLLA 2CLMA 5DBUA 3WJSA 3C4UA 1I2NA 1U5JA 1H63A 3VI2A 3QW4B 1JCLA 1RZMA 2V9DA 3YPIA 1YTEA 3KOFA 2VXNA 3G1FA 4DF2A 4O16A 3GAYA 5CG7A 1UASA 3KRZA 3W7HA 3DH7A 2YYTA 1LOSA 1MO0A 2VEPA 3P84A 3CEUA 1VCGA 1DBTA 4AHPA 5D38A 3ZWTA 1GYLA 4ONVA 3HB9A 4CCCA 5AHNA 1ZALA 3B05A 3O15A 3NQCA 5D2XA 3U8GA 3TMLA 2ATSA 4WY0B 3HG4A 3N9RA 3EX1A 3NNTA 1LDCA 3TC7A 1OHLA 1W5QA 3NQEA 3CWNA 2O7QA 3L66A 3QSTA 3RFAA 3B0VC 4MKNA 1QO5A 1HG3A 3EKLA 1XBYA 1T8XA 3W2LA 1C29A 3NG3A 3LRMA 3NQ2A 1C9DA 3GDKA 3L68A 5EPDA 2E1DA 4XUGA 5D02A 2PRLA 3QMTA 1JVNA 4EVZA 2C14A 5BMWA 4O12A 4MPQA 1VS1A 4X2RA 5KMYA 1OF6A 3JRKA 1VYSX 1PCWA 2W0UA 5I3JA 4A2SA 3W1TA 1VYRA 2C0AA 1MXSA 1G7UA 3BLFA 1TIMA 2ABAA 3IIZA 3U6WA 1TMHA 2GPTA 2X2GA 1IXNA 1NVMA 5KINA 4FNPA 3PG8A 3GXNA 4AMAA 2DZPA 3NVTA 3DZ1A 3M5YA 4TIMA 5HNRA 4NNCA 4DPQA 4GC4A 4FX8A 3S1WA 3FJLA 3L65A 1WOBA 3O6CA 4IXHA 1YLVA 1RQHA 3GAKA 3PB0A 3L21A 2KZHA 3W7CA 4EIVA 1YADA 4Y96A 1VJIA 1OK4A 4HHPA 4LVDA 1FWSA 3OVQA 3TV8A 3SW6A 2J9YA 3LHVA 4DO5A 2J9XA 3HGJA 1UCWA 1SZFA 4RJEA 2ISVA 1QCWA 2Y89A 4Z0JA 5KZMA 1P0NA 1A5BA 2ZZ7A 2V81A 4PEKA 3W7DA 3KVLA 1W5MA 2Y70A 1KTBA 4JY9A 1F74A 1FCUA 2QCNA 3NQVA 3UWYA 3W7QA 3O16A 4GBUA 1G6CA 3W1XA 4LWWA 3E02A 3PBWA 1QPNA 1O5XA 4ZQOA 2NZLA 5LHEA 5C6MA 1G7VA 4PCFA 3W7MA 3SFKA 1KFBA 3DHFA 4QSHA 5G1YA 4QISA 1KM2A 4JTSA 1GWJA 2A5HA 2NUYA 1P0KA 1OX5A 1K03A 2ZBTA 3ATZA 4IWWA 3W07A 3G0UA 3GR7A 2Q8LA 3MHGA 4AVFA 3CLMA 3M9YA 1W0MA 4K7YA 3DKJA 3A22A 3UWZA 4WQ6A 1DVJA 2GQ9A 2QJIA 4JTIA 5G2HA 1OFAA 4Z1CA 2A21A 4MYXA 2WSQA 3FYPA 5TBOA 1K3UA 2QDGA 5G2IA 4C1LA 4JTHA 2GVLA 1CX9A 3CC1A 5CZ0A 1KLYA 5AC8A 1SO5A 2ALDA 3UPBA 4MY8A 4BI6A 2A4AA 4HNTA 3PM6A 1F76A 4IMGA 1FWWA 4KWVA 5TIMA 3SSJA 2ZA2A 3M47A 4UMCA 3DXIA 1RVGA 2AQWA 1QPOA 2BLEA 2QF7A 1B9BA 4UFIA 4HKPA 4LS0A 1H7RA 3CQ0A 4O1AA 5C55A 3ZWSA 3LCGA 3QH2A 3G0XA 4N9BA 1XDLA 3T78A 3W71A 2ZZ4A 5EKYA 4IMFA 2H8XA 3G0SA 2DU2A 2WV8A 3BW3A 4JTLA 5AYYA 3W7NA 4AWTA 4H4IA 3TX9A 1RR2A 4WUIA 4HNVA 3BG5A 1T0OA 3KVKA 2NXGA 1XUUA 5CZTA 3O06A 3MMTA 1KLZA 4IX0A 2XN0A 1SO4A 4X22A 2YFOA 5SWUA 2NV2A 3C61A 4KFOA 4BWLA 3NZRA 1F6PA 4O50A 4OGZA 5D2VA 1GVFA 3RU6A 3SGZA 3PF3A 4UFLA 1H62A 5E1QA 4M6VA 3LXCA 4H6KA 1JCXA 3BLIA 3DFPA 2QCLA 1VRDA 4IMEA 5DXYA 4BWLC 4KWWA 1A5SA 2V0TA 5C5YA 4LNYA 2YDAA 4JS3A 3UYCA 5DN1A 1ML1A 3LTYA 2ABBA 3QMRA 3O07A 3W7JA 2DZVA 4DEFA 3FS2A 4Y90A 5FEPA 5DY3A 4HNNA 3O05A 3EX4A 1AW2A 2E77A 2C13A 1W56A 1NF7A 1QR7A 4NUWA 1QWGA 1HO1A 3NPXA 2QJHA 1KBIA 3NQ6A 3DFOA 1LTDA 3DFNA 4GE8A 3TR2A 4DF0A 1EPXA 3CEPA 4IX2A 1OX4B 5HUOA 3C2RA 3OEXA 3R8RA 3W2UA 3PUDA 5C54A 1KM5A 2JKAA 2R8WA 3BLEA 1MEHA 4JN6A 3N34A 4UMAA 3W7EA 4YMZA 4E2DA 4X3ZA 3B8DA 2NUXA 3G22A 5HWJA 3QPZA 4XBSA 1TREA 4O11A 1KV8A 3SGUA 1GOXA 1UUOA 1NFBA 2DZUA 1RQBA 3PG9A 3G3MA 1GQNA 1SFJA 4FNTA 1EUNA 4NZFA 4A22A 1LRQA 1XBZA 3MYPA 2QCDA 2OT0A 1JJKA 1SO3A 1ZFJA 4Q32A 2VELA 1Y0EA 4O0ZA 1ZHAA 5FEZA 1R2TA 5G5IA 3UWVA 3GLCA 4K8EA 4UTIA 1R30A 1JQVA 2YW4A 1XCFA 5F4XA 3HGOA 5F4SA 2YGYA 2CLEA 1IXOA 3CT7A 3EXTA 2CLOA 3MHUA 1KA9F 4YL2A 1DV7A 1YPIA 3LHUA 3RK8A 3S8HA 2R14A 4WOZA 5T26A 4Z1BA 3NO5A 5BNKA 3FEMA 4LOCA 4JYDA 4R7JA 4GUHA 5FF3A 2GOUA 4S2BA 1I2PA 3OVPA 4QNWA 3CU2A 4G1KA 4HNUA 4DF1A 1H60A 1LCOA 4DBEA 1SZNA 1H51A 4DPPA 3G18A 1MEWA 4HPXA 1EP2A 5CGQA 4NJHA 1H1ZA 2FPVA 1O60A 4NXKA 3L67A 1R2SA 1B57A 1SO6A 4TR9A 1W5PA 5LKYA 1KFLA 1FQ0A 1UUMA 4UMBA 3FYOA 3LGEA 2VEMA 1KV5A 3LV6A 2WNQA 2FIQA 1G4SA 3O8AA 4N9DA 2A7RA 3TFXA 4CLMA 2GJLA 2BSLA 2W79A 1YDVA 4PL2A 5EL1A 5L6UA 3LOTA 4UC5A 3HPXA 4TO8A 3HPSA 1I2RA 3DFQA 4NVTA 3V1PA 1UJPA 4D2JA 3INPA 5DLCA 1B4EA 4FHAA 3MI3A 1QNVA 2ZRUA 4K38A 3ZFHA 3E0IA 1LZOA 2J27A 1GEQA 4FF7A 3S9YA 3GK0A 4I9AA 1XBVA 3SJ3A 5HR6A 4RX0A 2EHHA 3MW7A 1FXQA 4OU1A 3GB6A 2C3ZA 2Z6IA 1GJPA 1A50A 3MP4A 4JXCA 4S2CA 3G8RA 3G3DA 4Y9AA 1KBJA 2E5CA 1X1OA 4UFHA 4NNAA 4JDBA 3KRSA 1GVRA 2J9ZA 2RDUA 4I7UA 1FY6A 1GTEA 4EOUA 4LUJA 1GT8A 2E6FA 3IEBA 4OBTA 5CZSA 1H5YA 3JS3A 3GR8A 2FTPA 4A2RA 4NXSA 3EB2A 1K7FA 4XQ6A 3UQNA 4M7TA 3LDVA 2WKJA 1GG1A 3T4CA 4XKYA 3T55A 5F2LA 3NPWA 5DCDA 1FDYA 3B06A 1JUKA 5HQEA 4EF8A 4UFKA 2BTMA 1TPUA 3USBA 3W3OA 3QQ1A 1ZNNA 3RLUA 4Z0SA 4M5PA 1L6YA 1P4CA 5D09A 3NQAA 1XUZA 2P1FA 2HMCA 3I7QA 3PY2A 1Q6RA 2NLIA 5FF0A 4KFPA 2FLIA 2V2DA 4JGDA 2B4GA 2E09A 1G4PA 4RCXA 3LTPA 5KSWA 5HR7A 2Y7EA 4OE7A 3VKJA 3TNOA 2VC6A 4IPIA 4O15A 4OQVA 3NQMA 3QC3A 4RZ6A 2ZYFA 3O1NA 3O6DA 1VCFA 3EWBX 3FKKA 2RDWA 1FDJA 3FJ6A 3NOEA 3HQ1A 3IIOA 3LTSA 3OG3A 4JX5A 3IVSA 1F05A 4LVAA 2RH9A 4AWUA 1SSGA 1EX5A 1SZEA 4R33A 2GJNA 1PHWA 4LV9A 3IGXA 4BK9A 3ELFA 3W22A 3PULA 1S3HA 3VE7A 2ZTKA 5CPMA 1K8ZA 1DQXA 5BMXA 1WBHA 3IIXA 2VOMA 4A3UA 2ATMA 1WX0A 3I65A 5AHEA 5K7JA 3TAOA 4AWSA 3NL2A 1ZAJA 3R12A 1DHPA 3LB0A 4WXZA 1OFQA 1OJXA 3DU0A 3ABOA 3G1YA 1OVDA 3TQKA 2ZZ5A 2NWSA 3GDTA 5HINA 4ZQNA 3PSVA 1PE1A 4NJGA 3W75A 1DJQA 5FF7A 3UY7A 4UTUA 2FDSA 2P10A 1LRTA 3WK2A 3NPVA 2E6YA 4NU7A 2XN2A 4NQ1A 1PS9A 2CZDA 1G67A 1J2WA 3LRLA 4N4PA 3M43A 3OIXA 2CW6A 1F6KA 5DCEA 2NV1A 1AW1A 1TJRA 5CPOA 5E0KA 3PBUA 2J24A 4E2BA 4PA8A 1AW5A 1AK5A 3QQ0A 4OT7A 1NEYA 1RD5A 4JYFA 3LLDA 1I8JA 1ME8A 5D05A 1ICQA 1W1ZA 1SR9A 2CLIA 4WX2A 4NJJA 1JUBA 2X1SA 4FNUA 4X9SA 1R2RA 3NYZA 4IUOA 4UTLA 3TFCA 4J9JA 2OX1A 3EEGA 2VFIA 1VZWA 3N19B 5CSRA 4YCPA 3F4WA 3W70A 2QUTA 1PIIA 3F4NA 1S5VA 3HPZA 5AHFA 3M0ZA 4C1KA 3NPUA 1KFCA 1RPXA 3ANYA 1TYGA 4ADUA 4NJKA 5A8GA 4FXRA 4UR8A 2DORA 1K8XA 1QMLA 1XXXA 1WYIA 2ZA1A 4QQ3A 5TQLA 1YDNA 4TMCA 2DJXA 5G1TA 2ZRYA 3OA3A 3MBDA 3W83A 5D37A 5U4NA 2D73A 3A9IA 4EWND 4FB7A 2CZEA 1AL7A 4HN4A 1XBXA 4JD4A 3TK7A 3PWAA 3CB8A 1DL3A 1JULA 2OZ0A 2B7NA 4M6PA 5AOUA 2G5WA 3QMSA 3PBVA 1GVQA 4L4LA 5EY5A 4Y6GA 5KITA 5L9FA 1JCMP 3IVUA 2JK2A 3R5EA 2X1TA 2ZA3A 1KFJA 4FNRA 1I2QA 3CTLA 4IPJA 3KX6A 4MFDA 2BWGA 5J5DA 4WJEA 2A6NA 2JKPA 3B4UA 2AGKA 3UWQA 2J6XA 5K9XA 3DFTA 2YW3A 3FKRA 1IIGA 1DOSA 3NQ7A 3IVTA 4M19A 3PR2A 5IM51 4O1BA 3VE9A 4FEZA 3TW7A 4YWIA 4O53A 5D2TA 3TC6A 2RDTA 4LU0A 3P5YA 4PC8A 2Q8ZA 3G1SA 1AL8A 5KTLA 1T99A 4A29A 3W76A 1VC4A 2WJZA 3BVJA 5EBUA 3EWWA 3LCIA 1W3NA 5D30A 4MZYA 1NSJA 4MLJA 4UFJA 1KM1A 3LCFA 5CPLA 1GVOA 3ZS4A 3MUXA 3C0JA 1FWNA 2QAPA 1FX6A 5K4ZA 3P8JA 2Y61A 2TRSA 1OFOA 2R91A 4UTMA 4FX7A 1X7FA 2YYUA 5ABTA 4OV4A 3TA6A 3M5XA 4GXMA 4MIMA 5F2IA 2EF9A 1B4KA 4QM1A 7TIMA 3SECA 1EB3A 1ME7A 3FA5A 2NX1A 2TYSA 2NWRA 3NZ1A 3GKAA 3A23A 1XFBA 4WY0F 1YPFA 3EWYA 4MUZA 5EMUA 3LXBA 3THAA 1VH7A 3P5ZA 4MFEA 2CWNA 3B0UX 1TJPA 3GNNA 3Q37A 1N55A 1Q6OA 3GVGA 3S5ZA 1JRBA 4YCOA 3TE9A 4N6EA 3UZ5A 4ZQCA 2C1HA 4GWEA 2VEKA 5GVJA 4RR4A 3TQ0A 3OHIA 1BKSA 3TCEA 1IGSA 3W1UA 3W7GA 3W1AA 2DZTA 5I3IA 5HWNA 3I68A 1DORA 5HJLA 4FXSA 2YZRA 5CSSA 4ZZ9A 2GUUA 1KW1A 5EYWA 1OABA 2QCDB 3BGGA 4BI5A 1TV7A 3U2OA 2GVJA 4GFSA 4LC6A 2FQIA 4IOTA 1LLZA 4UTTA 2QJGA 4JNMA 1HFBA 3MP3A 4LS2A 3S6DA 4DO4A 3OBKA 4RXGA 5C2XA 2TMDA 5LGXA 4JTTA 4JIPA 4NT0A 5F1UA 1M6JA 4UR7A 2G97A 5AN7A 1BWKA 5LGZA 1TPWA 4U4MA 1TTIA 3W7OA 2V5LA 1YYAA 1VR6A 3LI0A 2RHGA 4RKAA 4CNOA 1JCYA 2C19A 2XN1A 3R13A 1KM0A 1F73A 2C18A 4LC8A 1FXPA 3HGSA 1SSDA 5LNVA 3L5LA 4JX4A 4MYAA 3QYQA 2E5DA 3L0GA 1EP1A 4QJ1A 4BFAA 1VYPX 3W1RA 3VNDA 1SU5A 4OWGA 4UCGA 1MSSA 4RZ5A 4W9TA 2GQAA 3HJZA 3NAVA 2Q3OA 2QR6A 2X16A 4JTKA 1Z41A 3TU9A 1QOQA 4RV8A 3S5YA 2YSWA 1NAL1 3W2JA 4PH6A 3PSWA 2H3DA 2VFDA 4JTUA 2WNZA 5F2MA 3CM4A 3W85A 2Y7GA 1QOPA 5IBXA 4Z08A 4GNJA 4HPJA 1IIHA 3FFSA 3NL3A 3NL5A 4XWUA 1SZGA 4O54A 3UWWA 4I7WA 1VHCA 3UZJA 2NX3A 4JTFA 5I3HA 3S1UA 1AG1O 4AF0A 4DBDA 4O17A 1TPB1 3EXRA 1C8VA 2QKFA 1YTDA 2YXGA 3BW2A 4UTJA 1TPEA 3HOJA 4CNPA 2A0NA 5IBXC 4TU1A 3I7RA 4ICNA 2EKCA 4NX0A 3HMJG 3MO7A 1IXQA 1LRNA 2IQTA 2QCFA 1LOLA 3W74A 3IRDA 2WOQA 3R2GA 3W7IA 4KKXA 1YXYA 3FOKA 4DELA 3P7YA 4QIUA 1H7WA 4B5NA 3WK3A 1RQEA 1H1YA 2BZNA 1W37A 3LHWA 3DI0A 3W7PA 2DZWA 4CNNA 1VLIA 2EGZA 2C6QA 5FI8A 3LV5A 2TSYA 4E0CA 5FEWA 4LT9A 5CPNA 5I3KA 3VFLA 1HO4A 1PV8A 3GNDA 3NQ8A 3CPRA 3M5ZA 3W1LA 5FEXA 3F03K 3MYOA 2DP3A 2AAMA 3NR0A 4H3DA 2OCZA 2YPIA 2UV8G 1QAPA 4ZMGA 4QNEA 2EAWA 4UTHA 1JCJA 3EX2A 2JGQA 3Q2DA 4O14A 2H90A 4R53A 2NUWA 4O28A 5DCBA 2DZXA 4E38A 1J4EA 4K36A 2Y63A 1D3GA 3G1AA 1BTMA 1IF2A 4XKYB 4N6FA 1ZY9A 4XTIA 2E5BA 3HG3A 1OG0A 5E93A 2C16A 3TSDA 1S5WA 3ATYA 3TH6A 3MI6A 3STCA 3A21A 3BK0A 2EPHA 1OYBA 3DGRA 1OK6A 1BWLA 2VFEA 4IQLA 2PE4A 2CLHA 4O18A 3GDLA 3LHTA 5LHFA 4PODA 4O19A 2FB2A 3IV3A 1S5TA 1O95A 4O4WA 1DQWA 5F2GA 3TMQA 4Z1AA 1OFDA 4RK8A 1QPRA 6TIMA 3EX3A 2E68A 1MZHA 1TQXA 4ALDA 2VFFA 3L0NA 3W88A 3CIXA 3W2KA 1JR1A 1YTKA 1CI1A 1LBLA 1JQXA 3LI1A 3PUOA 1X6UA 4YXGA 5J5RA 1SPQA 3EWUA 1OFPA 2QAFA 4WD0A 1YDOA 5H2ZA 1KM4A 3E96A 1TO3A 1O5KA 1KM3A 4MJMA 3RMJA 3W1NA 3MI2A 2FJKA 5AC6A 3B04A 5CKSA 3BG3A 1SW3A 1T96A 2ZTJA 3EXSA 2ZZ2A 5FF2A 5G4WA 1SFLA 3BO9A 3SIZA 4AEOA 5U7SA 1R46A 1W54A 1W3IA 1SW7A 3DENA 1JCNA 3C3NA 4Z1DA 3S42A 3EKZA 3W6YA 3WJXA 5AC7A 1QFEA 3LHYA 1K8YA 1EWEA 4O52A 4O57A 1WA3A 1IXPA 2V2HA 4O4VA 1K7XA 1H7OA 1O4UA 3NQFA 4IMCA 3W2MA 3LCHA 4CQ9A 1JUEA 1PVNA 2PRHA 3A5VA 4GRSA 4UXDA 1Z48A 2QCCA 2X1UA 4JTGA 1HTIA 4PFMA 4NZJA 1HUVA 2CFFA 4Y8FA 1UB3A 3S1XA 4PTNA 4K7VA 2I1OA 1W31A 2QCHA 5A5WA 1TPDA 4K39A 4XBKA 2A85A 5AFDA 4CQAA 3MBFA 1VGAA 2A7PA 1XDMA 2ZFAA 1FWRA 1K7EA 3AO0A 4O10A 3PAJA 4R34A 3LHZA 1I45A 5DBTA 6ALDA 1DKWA 3W73A 3NQDA 3QPYA 5LSMA 1XKYA 3N2MA 1L9WA 3PC0A 3HF3A 1LM1A 4ORMA 2CZFA 3UXDA 1VPXA 3W87A 2XFWA 4JTJA 2ZZ3A 4I7VA 2F7FA 4LVBA 3M7WA 4ZVJA 4LUIA 1A53A 5D2WA 2A7NA 3GX9A 1FBAA 4NJIA 3M6YA 3KVJA 1LYXA 2HS6A 4MOZA 4HSOA 2V5BA 3KAOA 2YCEA 5LNRA 1GTHA 2ZQ0A 5HULA 2DZSA 3JR2A 3O6YX 5DXXA 2X1RA 3M44A 5AHIA 5BRBA 3L0KA 4AHOA 3TIMA 1U83A 2TPSA 1F2JA 1XI3A 1Q6LA 3DAQA 3V75A 3I7SA 2PRMA 4YLWA 3ABRA 4WOQA 3P74A 3WJWA 5LNWA 2ZRZA 3H53A 3DKLA 4WY0A 2HSAA 2E6DA 2CZ5A 2QDHA 2PURA 2V82A 1XC4A 2OT1A 1GVSA 3E49A 1D9EA 2VENA 1EWDA 4ML9A 5D32A 3G1HA 3BPWA 2B7PA 3B0PA 3P80A 3S1VA 3H55A 3HIJA 3M41A 3TW6A 2Q3RA 1NF0A 2HS8A 1G4TA 1KFKA 2B7QA 1OX6A 2HTMA 3LX9A 1A5CA 3RLVA 1GG0A 2Z6JA 3W84A 5I3FA 2V2CA 1W3TA 5K4XA 1B3OA 3KRUA 3LLFA 4AAJA 3UXAA 5KZDA 3WJZA 1TTQA 3W2NA 2WQPA 2VKZG 3HO8A 2CLFA 5LZLA 1QPQA 1ZCOA 4RZ4A 4GUGA 3DI1A 5D2YA 3N73A 1M7PA 4JEQA 4GUIA 5K2ZA 5DELA 3C2VA 4GUJA 3NM3A 4QAIA 3GXPA 4ZQRA 1YXDA 2V30A 3LBCA 1WDWA 3S5NA 4FX6M 4PL1A 4U28A 3C6CA 1FCQA 3VCRA 1OFBA 1TPFA 1KTNA 1AMKA 3HG2A 1SQ7A 2G95A 3HGRA 2QCGA 3UWUA 3ABQA 4ZQPA 1LOQA 3S0CA 3QZEA 4MJZA 4MLRA 3RF9A 3IGSA 4JTEA 3NDOA 3QF0A 3Q94A 3TDFA 3H54A 2YR1A 1WXJA 1ICPA 3A5FA 2I9EA 4GUFA 1R47A 4O8RA 3QM3A 4UTWA 3N2XA 4LRTA 2ISWA 3EWXA 2Y62A 3GIYA 2FPTA 1K02A 2P0OA 4IJBA 1H61A 3FLUA 4Q33A 5FESA 3NGJA 1Q6QA 2J88A 4O1DA 5H91A 4N2YA 1ONRA 3MP5A 4NNBA 1JRCA 2QCMA 2FB3A 4TX9A 4MY1A 1Q45A 4K6AA 2NXHA 5KZEA 4UTWC 3LBMA 4K8HA 1FWTA 3W1PA 1GZGA 1OFEA 2BX7A 3W7KA 1EEPA 4JICA 1Q3NA 1KFEA 4IXXA 2V8ZA 2E6AA 1L6SA 4OV9A 5G4EA 3SY5A 1LBMA 1TTPA 1ICSA 1TRIA 3G8EA 1TB3A 1M5WA 1VQTA 4ADTA 3LCLA 5K3VA 2CU0A 5MHBA 1EUAA 1LORA 2WSRA 5LNUA 4LS1A 3NM1A 3LRKA 3C52A 3STGA 5HUPA 4CCDA 4UFMA 1V5XA 2WPBA 1PHQA 3DFSA 5K9CA 1J5TA 3W72A 2WNNA 1I2OA 3BG9A 1TRDA 1H7NA 3QEZA 1QDSA 1H50A 1P1XA 1RV8A 2WSYA 3E9AA 3MJYA 3G1DA 1ALDA 4BI7A 3N14A 3HG5A 1KM6A 1D3HA 4FIQA 5AHMA 4JR5A 4JYEA 3G24A 3P8IA 5K9DA 3C56A 2NXIA 1ZENA 1E51A 2OMAA 4WXYA 1EIXA 1GPWA 4UUIA 4JDYA 5CZJA 3PS7A 1LBFA 3GXTA 3THQA 3M5VA 1FCBA 1XL9A 3G1VA 3IIPA 3L5AA 4ORIA 2H8ZA 4DXVA 4IGHA 5BW6A 4DO6A 2ZRXA 4JIQA 2RKXA 2H3BA 2YX0A 2VFHA 4ZQMA 4CQ8A 3TAKA 5D04C 3GYEA 5BOOA 1I4NA 4IMDA 1FCVA 2GVGA 1TPC1 3L5MA 2JBMA 5FF4A 1GYNA 4P2VA 1VHNA 3UPWA 1ME9A 4K37A 2QEZA 4MVAA 3TJXA 3P82A 4HSNA 3LERA 3PB2A 4O13A 3L9CA 5AYZA 4AHQA 4UTTC 3R89A 2ZRVA 3M1ZA 4MY9A 5EA9A 3Q58A 3PBYA 1TSIA 4LV4A 3D0CA 3T7VA 5I3GA 3HBLA 2Y7FA 2CLKA 2FFCA 2Y7DA 3TSMA 4AF0B 3W1QA 3I6RA 1WQ5A 4POCA 4XZ9A 4M7SA 1LLWA 4UNLA 3L2IA 3STEA 5AB3A 3QRHA 2QCEA 3C2OA 1TV5A 3CWOX 4LRSA 4AB4A 2WO5A 3IIVA 5HMSA 3QSRA 1LROA 3C8FA 2YFNA 1L6WA 1OX4A 2W6RA 3TJLA 1OFRA 3W9ZA 3MWAA 4TMBA 3WJYA 3NEVA 3GKFA 2RFGA 1UBSA 1M7OA 2B7OA 3A24A 3WK0A 3TUUA 4S1FA 1TCDA 3QJAA 1P5BA 5HWMA 3RNDA 2I14A 1G69A 3P60A 3C2FA 2QUVA 1ZAIA 3NQGA 3N3MA 4HIBA 1N8FA 3LM7A 2R94A 3KVMA 4ZL1A 3S5OA 1EA0A 5D33A 1W5OA 3W1MA 8TIMA 1WOAA 3TXVA 1V7YA 3CIWA 3GDRA 3TKFA 1YXCA 3E12A 1Z42A 1H7PA 4LY8A 5F4WA 1Z44A 2ISSA 1W8SA 2Z2UA 1FDZA 4HT3A 3WK1A 3STFA 1TPVA 4JX6A 5F1VA 3LCWA 2DJLA 1OYCA 2QUUA 4LTSA 1ADOA 3SZ8A 1ZJIA 3GDMA 3P62A 4OHQA 4O0KA 2H6RA 3K30A 1A5AA 2GQ8A 1HL2A 4O1CA 1KTCA 3TROA 2ZRWA 1F5ZA 3NA8A 3NXFA 1OYAA 1EP3A 3QW3A 2ZDRA 3N9SA 3KFTA 1QO2A 1THFD 3LCXA 3M16A 3DHDA 1W5NA 1DJNA 2Y85A 1TV8A 4QITA 3T40A 3C2EA 3W7LA 1F7BA 2C15A 3OVRA 4NX5A 1WBJA 4FNQA 1L2UA 2LLEA 2PC4A 1PL9A 2X30A 2ZZ6A 3LXAA 4MZ1A 4RLIA 4LVFA 4N4QA 3P67A 1H7XA 3MHFA 4A21A 2VFGA 2A2IA 2A6LA 3FIGA 4LW7A 3UY8A 3G1XA 1OF8A 3W86A 3B03A 2NX9A 2JKEA 2Y88A 3PUEA 2G96A 2ZCGA 4UTKA 3ABSA 3QFEA 3PVFA 3TSBA 2Y6ZA 5AHLA 4GJ1A 1LP6A 1ZAHA 3BARA 2A1YA 1N7KA 1CW2A 4N9CA 3W23A 4ADSA 3T44A 3W7RA 4AH7A 4WZHA 2Z1BA 3IGUA 5D03A 3KHJA 1WV2A 2O7SA 1G4EA 5AYXA 1O94A 4UIOA 2ZZ1A 3SR7A 3ZR4A 3KXQA 3UNDA 2B0MA 4JY8A 4N9EA 5LNSA 3O63A 3BGJA 2PCQA 1SUXA 4UNKA 3CHVA 4BR1A 3EX6A 4LVGA 4N02A 4P61A 4KFNA 4FIRA 1X8FA 3TXZA 1TPH1 1MEIA 3BW4A 1WAUA 4Q4KA 2JGYA 2VEIA
chains in the Genus database with same CATH superfamily
3WFAA 3S2MA 2BXVA 1PDZA 3L2LA 2OXNA 1PCKA 1EIBA 3EKGA 2F84A 2O9OA 3MTWA 4M6QA 4RXFA 3GH7A 3VDCA 1Q66A 4TTGA 3V16A 4YWSA 4L4MA 3AJXA 3BLOA 3ARTA 1TR1A 3WDRA 2CIPA 4S3FA 1FWAC 2XSXA 3UVAA 1BEUA 4RNHA 4DQWA 3ONCA 2CLLA 2VT0A 3WJSA 4GD0A 1EH9A 1X6LA 5LXXA 3VI2A 3QW4B 2GUYA 2DSKA 4RW3A 4ZEPA 4XB3A 2HISA 3KRZA 3VM7A 3DH7A 3MWCA 4GH3A 4J3UA 3P84A 4JFUA 3CUXA 3VIHA 1XC6A 3ZWTA 3O0KA 3GNOA 3P6LA 4RDVA 2QUMA 3O15A 1H11A 4CN1A 1A3WA 3CS2A 2XM1A 1W2VA 2IPWA 1OHLA 1KGXA 1OCBA 3B0VC 1HG3A 4WDUA 3EKLA 3W2LA 3GDKA 1P7TB 3L68A 2E1DA 4P7LA 4XUGA 3T05A 3RCYA 4EVZA 2C14A 5BMWA 4L1WA 4O12A 4MPQA 3DHUA 5CH9A 1VYSX 4PMZA 3W1TA 4YVVA 3BLFA 2ABAA 1DPMA 1TMHA 2PB1A 2GPTA 3CYJA 4NKCA 3TZFA 3GHSA 3GXNA 1V6TA 3DDMA 3DZ1A 3M5YA 4PUKA 3RGTA 5HNRA 1Q7MA 4QCFA 2VGFA 3FJLA 4Q8PA 5MKGA 4S23A 4F2UA 4CD4A 3ME3A 1YADA 2WHJA 3T6CA 5I79A 1VF8A 3RILA 3VILA 4C6BA 1FWSA 2X8RA 2J9YA 4DO5A 2ZUMA 1OD8A 2JQXA 4C6CA 2BHYA 2VD8A 4M51A 2VGIA 3AOFA 1R5YA 2O9PA 1UP3A 4FOKA 2I16A 4WF7A 2QCNA 4I8YA 5JBEA 3O16A 4GBUA 2V63A 1TA3B 3E02A 3PBWA 1O5XA 5LHEA 4NYYA 3U48A 1G7VA 4PCFA 3W7MA 4JTAA 5C9WA 5BXSA 1GWJA 1P0KA 3GVRA 3ATZA 3W07A 4HMDA 2VR5A 1XIEA 4AC7C 4AVFA 3EDEA 4FLRA 4NASA 3RHGA 4CNUA 2QJIA 2WNWA 5HXMA 2AMXA 3OO2A 3FSTA 4D72A 4MYXA 2Z2BA 3OYXA 2J7DA 2WSQA 3FYPA 4TXEA 2GVLA 2GOKA 4V27A 5CZ0A 4WDWA 2C71A 5AC8A 4LX4A 4GVIA 1R86A 4HP5A 4ZODA 3UR5A 2XVKA 1RVGA 3THCA 1BVWA 1H7RA 1OBAA 3PBGA 1E4IA 3CQ0A 1E0VA 3SUSA 1Z89A 4TVDA 3K4DA 3WZ0E 5C55A 3VNZA 2ZUTA 3KWSA 4UWMA 1MYRA 1O12A 1XDLA 4TOQA 2ZZ4A 4BHYA 4IMFA 4EAMA 2DU2A 4OZOA 3NUKA 2WV8A 3BW3A 2PDGA 1EJSC 4WUIA 4HNVA 2YA1A 3BG5A 4AIOA 3SGGA 3EDFA 5CZTA 4TX8A 2WJDA 1KLZA 4GKTA 5BWFA 4L7ZA 3D3AA 3G2GA 1K1DA 1UKTA 4LBRA 3NZRA 3S3GA 2XIBA 2R1LA 3PPCA 3SGZA 2OEMA 5EMMA 5LIUX 5E1QA 3V0UA 5KETA 3AQUA 3LXCA 4YYCA 4H6KA 3MUY1 2QCLA 1W1B1 1NARA 3MKCA 4BWLC 4KWWA 4H8VA 1GOMA 1ML1A 1HKKA 4BQ4A 4HNNA 1A49A 3VNLA 4AY7A 3O05A 1AW2A 2WWDA 4AY8A 3DFNA 1K6AA 3OIHA 4IX2A 4KH2A 4MADA 5HUOA 3R8RA 1PB0A 3LA4A 5C54A 4NZ3A 1KM5A 1RLDA 2R8WA 5HNTA 3BLEA 1MEHA 1E4MM 3A47A 4CNTA 1UG6A 4YMZA 4E2DA 2QIIA 1BXBA 3B8DA 3L4TA 3UG5A 5HWJA 4XBSA 4O11A 4ERIA 4LUSB 1MXGA 1NWRA 1GOXA 4CVUA 1RQBA 3DERA 4ICMA 3K8MA 1K8CA 2VX4A 3SN4A 3RM8A 2WCSA 1JJKA 4GYFA 1SO3A 2QW5A 2VELA 2PDWA 2BVTA 1JQVA 1S38A 2YW4A 4YTQA 3KDNA 3HGOA 1EJUC 1RH9A 5T26A 1IGWA 1ITQA 1TELA 3BCFA 2ZUUA 4IICA 3FEMA 5BNKA 1KXTA 4S2BA 3F5LA 1V6XA 2WZTA 2Y0FA 3CU2A 4G1KA 4JIRA 1CDGA 1DJZA 3H4GA 1UD5A 2D22A 5CBBA 1GOWA 3G18A 4IIFA 2OVLA 1UH3A 4X0NA 3AZRA 3L67A 1R2SA 4E5TA 1B57A 1W5PA 1FQ0A 4JEJA 4UMBA 3AHZA 1F3XA 1KV5A 1XLEA 2FIQA 3WF3A 3AS0A 4YU1A 3H4WA 3I6TA 3PBMA 4HYWA 3AJ7A 4EPDC 2DSZA 2BSLA 2WVSA 2FZDA 2HCVA 5L6UA 4NSBA 4A3YA 2P8CA 3U2EA 3H2OA 4EANA 5LIWX 3V1PA 2FJUB 2V3GA 4DYKA 4NG3A 2EKGA 4FHAA 3IV8A 3ZFHA 1TVPA 2XWDA 2D0FA 3QYSA 4CN6A 4IHCA 1YHTA 2J27A 1GEQA 1QK2A 4P7OA 5CC5A 5G1MA 4V28A 1KR1A 5HR6A 1XIIA 3MW7A 1FXQA 4OU1A 1XR2A 3GB6A 4PRRA 4KBXA 5I77A 1GJPA 4C60A 4S2CA 3G3DA 4RDZA 5CC3A 2JEQA 1X1OA 1X98A 4H83A 3WLIA 2QDEA 1RSCA 1FY6A 3HU7A 1GTEA 2NT1A 4KT2A 3WDIA 4EOUA 3R8GA 4HB7A 3HTWA 1WXYA 1TX0A 3AIVA 2ODOA 5D8ZA 3GR8A 1A0CA 3NWRA 1JPDX 5CZKA 4FS9A 4M7TA 1CYGA 2PDIA 1KBKA 2WKJA 1UKPA 4GQBA 3T4CA 3BXWA 1XYZA 4HNLA 3BURA 3TN6A 1TPUA 4KWOA 3VMPA 2QUNA 3USBA 2YCJA 3E2QA 5BU6A 3KEHA 1UWIA 3AS1A 4M5PA 5D09A 3ECQA 3II1A 3GXDA 3QV9A 4GVGA 2VUYA 3D3FA 3PY2A 2PF8A 2W66A 1Q6RA 2O92A 4QQUA 5HOSA 2VRQA 2V2DA 3GDBA 3UVIA 1RJPA 4BY3A 2XH0A 3VAVA 2VWSA 2WM1A 2XGIA 2Y7EA 2ZC8A 1HJWA 1GPFA 4B9ZA 4RE2A 2VC6A 3IJIA 1XWYA 3GIQA 1GQJA 1MMFA 4LNCA 4L56A 3VOIA 4RZ6A 3LEPA 1VCFA 3IK4A 4I90A 3WQEA 1FDJA 1NJJA 1I60A 3RR4A 3IIOA 1F05A 4YIWA 1TJ2A 5DFAA 2PDYA 1SSGA 3U4AA 3PPHA 1PHWA 4XIMA 4BK9A 2GGIA 4TVUA 4LF1A 3LENA 1JDFA 4R88A 4LH8A 3QLLA 1JNEA 5E6ZA 5BMXA 1ISYA 3SDOA 3TTQA 4B5UA 4OOUA 4PCTA 2J7GA 3I65A 4G5DA 2X0SA 3TAOA 2IKIA 1K9DA 1DHPA 1OFQA 4QDWA 4CU8A 1OJXA 3ARWA 3ABOA 3TQKA 4ZO7A 2WMFA 4JHOA 3S1GA 3WH6A 4JHZA 1PAMA 4IIBA 3H2CA 4JNYA 1DJQA 2VZVA 3UY7A 3SURA 5T8GA 2EJ1A 4GXPA 3VDBA 3WK2A 2JFEX 3W53A 2XN2A 3MA8A 1IQ8A 1PS9A 4P8WA 5LXEA 1Q7ZA 2CBJA 3KZSA 1KCKA 3CAQA 1JPIA 4HZ8A 5C2CA 3M43A 3OIXA 2NV1A 5CPOA 2V5CA 1IR2A 3H2NA 3ZMRA 4E2BA 4M1BA 2PLJA 5KZ6A 2DDXA 3QQ0A 1W1ZA 4PYSA 3UU0A 4P7NA 1JUBA 4C7GA 3NYZA 4M56A 3IUIA 4GZIA 2VFIA 3TJ4A 1VZWA 1IYXA 1I75A 1EJXC 1Y7VA 5A8QA 2QUTA 1S5VA 2PPGA 1EF2A 1NDWA 3GG1A 3Q67A 5CCZA 1BYDA 3NPUA 3ANYA 1NY1A 1TYGA 3DGBA 5A8GA 5HQMA 1E5NA 1K8XA 1XRSA 4GX8A 4AWEA 4DJDA 3GRIA 4XD6A 1WYIA 1BF6A 1J6PA 4KRUA 1SJAA 2DJXA 2TODA 5I78A 2V6AA 5D37A 2QPUA 5U4NA 2D73A 3AUJA 3VKBA 2VDIA 1CGVA 4F0RA 4PUMA 3D47A 4HN4A 3ARQA 3QVQA 4W5ZA 2VTFA 4JD4A 4PZVA 1DL3A 5AOUA 4BQ2A 5EY5A 4Y6GA 3CNYA 2X1TA 1A3XA 1AQFA 4FNRA 1US2A 3QOMA 3CTLA 4MFDA 3OYZA 3VNYA 4IJCA 2GJXB 1W1A1 3A4XA 4WJ8A 3BSGA 3MANA 1LUCA 2J6XA 1Q6GA 1XIBA 1A3HA 1R9XA 3IVTA 2ACUA 3DFYA 3WH5A 3EPNA 3EWCA 4FEZA 1ITXA 1WDPA 2BB0A 1E6ZA 3CO4A 5D2TA 3VGFA 1EPVA 4CGTA 2WAGA 4LSBA 3P5YA 3GYCA 1VC4A 2WJZA 3NSMA 2BXYA 3U9IA 5FJUA 3EWWA 1YDYA 4AZCB 4D6CA 1NSJA 3L4WA 1O6IA 2XVPA 5DO8A 4HTYA 1NWUA 1FWNA 1UUQA 4Z2LA 4L1GA 2TRSA 4F0SA 1VFLA 2R91A 4B3LA 3FVMA 4OV4A 4D8LA 1OGSA 3SCPA 4MIMA 4QM1A 7TIMA 4JHMA 1B30A 3CAKA 4IFKB 1ME7A 2TYSA 4B4HA 4TUFA 1HP5A 3CZJA 3UGVA 4WRHA 1AUSL 3LY0A 5EMLA 2NW0A 3P5ZA 2CWNA 3B0UX 1WPCA 2Y5EA 1ODZA 3GVGA 4YCOA 1GZ1A 3B3DA 1BTCA 3PUGA 3CV6A 2VJXA 3R6IA 1IGSA 2HBXA 2OEKA 3A3XA 1HVXA 5HWNA 4INFA 3I68A 1XH0A 4FXSA 3E38A 1W17A 2GUUA 3ZZ1A 5EYWA 9CGTA 2PDPA 2YBTA 3U2OA 4GFSA 1FHUA 4LC6A 4IOTA 4UTTA 2QJGA 1EJRC 4DO4A 3OBKA 3KBVA 4RXGA 4A3QA 1YNYA 5F1UA 1IV8A 2G97A 1RCXB 5HATA 1TPWA 3W7OA 3LI0A 4CNOA 2C19A 1S2CA 1PO9A 1KM0A 2DIJA 1F73A 1MVYA 1PEZA 4QBXA 2BHUA 1R7AA 2C18A 4IH3A 5FCZA 4GHRA 1XRFA 2J47A 3HGSA 3SIMA 5LNVA 1VBRA 3L5LA 3R11A 2VX5A 3KZPA 1JGIA 3VNDA 1W32A 5ENLA 3ABZA 1MSSA 2PLKA 4RZ5A 4ZENA 2OGYA 2BGSA 4HMNA 4DAFA 2PF0A 7TAAA 3GC2A 1Z41A 3TU9A 1M7XA 1XLHA 3W2JA 4W7UA 5A6BA 1V8EA 5EMKA 5GNXA 2H3DA 1J12A 1MFUA 3GR4A 2QJJA 3ZLFA 2WNZA 3CM4A 3W85A 2Y7GA 4ERAA 4Z08A 4GNJA 1LQ0A 3NL5A 4C6EA 1S1RA 4QAWA 5E6YA 4AD1A 1RCQA 5I3HA 3EXRA 4MKSA 2YXGA 3AXHA 3MCOA 1ADDA 4QRNA 3BW2A 4Y8EA 2VMFA 1B3WA 2A0NA 2PDFA 1BKHA 3A6OA 1QHOA 3MT1A 4PRWA 3W74A 4FXFA 2WOQA 1YXYA 1XGZA 2OODA 3PJTA 2OPJA 3KP0A 4QIUA 4ZCWA 4B5NA 3GHTA 1UC4A 2OOFA 3DI0A 4MDOA 2P8BA 1J01A 4CNNA 3ITXA 2C6QA 3CTTA 4E0CA 2TSYA 4A3HA 3FGCA 4LT9A 1HO4A 3A4WA 2Y4SA 1E43A 2DZAA 1DHKA 3W1LA 2FFIA 2DP3A 2AAMA 4K8GA 4ZMGA 4QNEA 2YXOA 3WIJA 4DUVA 3AALA 3EX2A 4K2SA 4R53A 1LWHA 4B2DD 5DCBA 4E38A 4K36A 1ZLPA 1MUMA 2JIWA 3G1AA 1BTMA 3VZXA 4AZBA 3DOPA 3BAWA 3H22A 3ZM8A 2NQ9A 1IF2A 2REQB 4XTIA 3O3RA 1KXQA 3TSDA 1R6WA 1Z9AA 3G6LA 3FA3A 1NOWA 1EZ2A 2VHLA 2B81A 2DT3A 3STCA 1DIKA 3CK5A 1IEXA 2WCGA 3IJQA 4PEEA 1M03A 3DGRA 1A4LA 1OK6A 1BWLA 1F9CA 1O1HA 2CLHA 4M1RA 2ZX9A 3FDKA 3UCCA 3I6EA 4MMWA 4O19A 4UOJA 1R3TA 2ISFA 2WZEA 3TMQA 4DN1A 4LQ1A 1QPRA 6TIMA 3EX3A 1MZHA 4ALDA 1PBGA 2VFFA 3W88A 1AD1A 3RLHA 1YTKA 2D3NA 2A3EA 4GYPA 1AZ2A 1TO3A 4JTQA 3GXIA 1EC8A 3W1NA 3MI2A 4QX4A 2J8TA 4EP8C 2G0WA 3EB3A 3WEOA 2CPUA 1SFLA 3I4EA 4JIEA 2R6OA 3SIZA 2CKSA 2D24A 4JPGA 3S42A 3W6YA 3S9ZA 3DBNA 1OD0A 3CQIA 1B3YA 3LHYA 1EWEA 4AISA 1WA3A 1H7OA 4IMCA 4PMNA 3MVIA 4UXDA 2PRHA 3VIKA 1CLKA 2IPGA 4JTGA 3RG6A 4E6MA 3N12A 4NZJA 1IZJA 1UB3A 2W63A 3S1XA 3COTA 3OOQA 1W31A 5JU6A 2A85A 3WLHA 4UTFA 4HA3A 5AFDA 3VNIA 2HPIA 4DB7A 5CC6A 2BOEX 3LHZA 1D7KA 1GOKA 3QPYA 3USZA 1LT8A 3WENA 4PFHA 4I6KA 5LSMA 3UG4A 4PUNA 3C5QA 3V36A 3PC0A 2YLAA 5EU9A 2CZFA 3T1GA 3L4YA 1BRLB 2WVVA 1UR4A 1QPKA 2ZZ3A 4OOZA 4FI4A 2F7FA 3M7WA 1A53A 2A7NA 1FBAA 1IEVA 3B9AA 2HWGA 1E0TA 4L4OA 3MC5A 2HS6A 3UJFA 4B90A 1GTHA 3MSRA 3O6YX 1ZBWA 4QHRA 1VRXA 2X1RA 1CXHA 1WUFA 2QPXA 3TIMA 4KPLA 7XIMA 3WX7A 4U3AA 3H53A 1HGYA 1LG1A 3DKLA 1W3JA 4EE9A 3GW3A 1FH9A 2CZ5A 2W92A 3AS2A 1FH8A 2PZ0A 4GIAA 3VKAA 4GCXA 4JFWA 1ONXA 1K4HA 4KF1A 3OGRA 3M41A 3R4IA 3TW6A 4LY4A 2Q3RA 1NF0A 4KGLA 4JKMA 2HS8A 1G4TA 2B7QA 3CL7A 4NAEA 4QROA 2HTMA 2VCAA 3LX9A 4H8UA 1NH6A 4MJ4A 2V2CA 1KCLA 5K4XA 4I9MA 3PTKA 3W25A 3LLFA 3UXIA 3AAMA 3GC5A 1WO2A 2VURA 3OZOA 2BASA 4M81A 2VKZG 3KCJA 4R3UA 1ZCOA 4DVOA 1EDGA 1QK0A 1VBHA 2ZXBA 3DI1A 4JEQA 4DBUA 3NJ3A 2V69A 5JIWA 1NFPA 4QAIA 3LNPA 3UESA 1HKJA 4UQAA 1F8IA 3CB3A 2VZSA 1E6QM 4FX6M 4PL1A 4U28A 4Q8TA 3ARXA 4H04A 1KTNA 1BYAA 2ACSA 4WJXA 3UWUA 1TWWA 3S0CA 1ECEA 4JTEA 1XD1A 4BS0A 3EDDA 3TDFA 3H54A 3WQVA 1R47A 3QM3A 1UWRA 2ISWA 5FD0A 1H1NA 1K02A 3S47A 1BG9A 1H61A 4GJIA 1SMAA 1QNRA 1W9DM 4GY7A 1ZPTA 3OP2A 5LIKX 1F3WA 3U5YA 5FESA 3NGJA 1W91A 3BSHA 3S9IA 5H91A 4KEZA 1R7OA 3MP5A 4NNBA 1MRQA 1Q45A 4UTWC 3GG7A 1HJQA 4K8HA 1FWTA 1WZAA 2BX7A 1JDCA 3W7KA 1EEPA 4JICA 2FGBA 3RM4A 4IXXA 2V8ZA 3B8VA 3F5KA 4AYGA 1IWBA 3POCA 3G8EA 1Z69A 4WHBA 4PMDA 4XIAA 2DSWA 1DEDA 2OO0A 2Y5SA 4LS1A 4XD5A 3STGA 4KW2A 2WPBA 1UWTA 4V2XA 2WNNA 3BAYA 4H6RA 2NSOA 3HV8A 2IXUA 3N6JA 4KCVA 1TRDA 2WMIA 1QDSA 3QY7A 3THDA 4KEUA 2J7CA 2PUZA 3E9AA 3IACA 1AZ1A 1V02A 5FACA 4BI7A 4K1WA 2B31A 4FIQA 5AHMA 1N8WA 4K68A 1RP8A 3RITA 3GIPA 1WDRA 4S3BA 2ACQA 5A6TC 3UBPC 1ZENA 4Z1YA 4WXYA 4ZXOA 1FWIC 3P14A 2FVLA 4IG2A 1C8XA 4UUIA 4RNIA 5A6JA 7PTDA 3GXTA 3THQA 3KTSA 1FCBA 2VR2A 2BOGX 2V3FA 4C7DA 1XDJA 3L5AA 4DXVA 5BW6A 3NGFA 3MO4A 2H3BA 4ZQMA 5D04C 5BOOA 3WBXA 4EXQA 3BJSA 2VRJA 4MWAB 3CHFA 4LPCA 4J2MA 1VFHA 1J0HA 1VEOA 3F4DA 1MFVA 4MVAA 4IGMA 5LYRA 3QXBA 2WLYA 4AXNA 2D69A 3SQLA 4D6HA 3R89A 2ZRVA 2XSAA 2DT1A 4MY9A 4LV4A 3ITGA 5HAOA 4L6DA 5CJMA 3TSMA 4H6EA 2WB5A 1TZ9A 3L2IA 3STEA 3QRHA 3W01A 4AB4A 3ORWA 2XVNA 1J5SA 2GWNA 5HMSA 2YFNA 1IWAA 3NYDA 5FJIA 1V3IA 1HIZA 3M07A 4ACZB 4FMVA 4PGLA 3GKFA 1UKOA 3ERPA 4DY1A 3WK0A 2A3CA 3TUUA 3XINA 4ZOBA 4S1FA 4U31A 3RNDA 2GGJA 2BDQA 4N42A 2I14A 3N6QA 3C2FA 1ZAIA 3NQGA 2J66A 2R94A 4H8HA 3W1MA 3H12A 4J40A 3TXVA 3E5BA 3U2ZA 5BXPA 3GDRA 5FAGA 2PLMA 4H9VA 1DWAM 1Z42A 2E9LA 4J35A 1H7PA 4QLKA 3NOYA 2ISSA 1NDYA 3H70A 1W8SA 4Y9NA 3IJ8A 1JFHA 3UETA 3CHEA 5JBDA 5F1VA 2DJLA 2QUUA 1P0DA 2H6RA 2XG9A 1JYNA 1V3HA 1I1WA 4TV6A 1EP3A 3DUGA 1W9XA 2XGZA 5HJXA 2ZDRA 2X1IA 1QO2A 1THFD 3A4AA 2VZOA 5BXTA 3OJGA 3NEHA 1W5NA 1TV8A 2DW7A 3T40A 5M2FX 3W7LA 5ABFA 2GYIA 2IS7A 4D1IA 1ZGDA 2GUBA 1PL9A 4MZ1A 4RLIA 3GD6A 3QTGA 4QXIA 2VM8A 4A21A 4PCPA 9XIAA 3FIGA 6XIAA 1IWPA 4Q8VA 1OF8A 3B8TA 3W86A 1PX8A 4GNVA 2E0PA 4L6OA 3PUEA 3FAWA 3CWHA 2XH2A 1PSCA 3QFEA 2PP3A 1FH7A 3LM3A 3M0MA 3EOEA 1TV4A 1UW9A 2XFRA 3OBAA 4ADSA 1PDYA 2DVUA 3HQOA 3T44A 1HKVA 2PU1A 1Q7QA 5FJRA 4AD2A 2Z1BA 4XZWA 2MANA 4PULA 1TFVA 2O7SA 5AZ0A 3VOFA 3ZR4A 1A5NC 4E4PA 1BYBA 3QLDA 4N9EA 4V1YA 1FHDA 4UNKA 1JI2A 4FIRA 1GKPA 2VZTA 1EO5A 2QZRA 4P8UA 1SW0A 3TQVA 1BVZA 1JZ6A 3OBEA 2HVMA 1MDLA 3MCMA 1FUYA 1E9IA 1XQLA 3B9EA 4AMCA 1XYMA 4D8AA 4QSFA 2XIQA 4Z2HA 5J04A 4F8XA 2PDQA 1YMYA 4C6LA 3UD6A 2UY5A 4DJEC 5CLWA 3SI9A 1VLWA 4FNSA 2WMJA 4KRZA 1YKWA 1OCJA 2CLMA 1I2NA 1RBOB 2VC5A 4B91A 1SZRA 7ODCA 1JCLA 3GFXA 1W9PA 2EPMX 3ALGA 2V9DA 1YPXA 1RVKA 2VXNA 4P8VA 4O16A 1W3LA 3SSZA 3K1GA 1LOSA 3TOPA 4ZB0A 5ECVA 5D38A 4U33A 1ZB5A 4QJ3B 3HB9A 4CCCA 3HZ3A 3R1ZA 2OZ8A 4B3ZA 1CT5A 1B0IA 2WANA 5AZ1A 3PN8A 3WL1A 3C86A 1V77A 2ATSA 2WBKA 4WY0B 3HG4A 2AKMA 3N9RA 7A3HA 3EX1A 1RPKA 4ZFCA 1HKWA 3PZGA 3L66A 3RFAA 4JL2A 2OEJA 1U1JA 4WKFA 4B9YA 1U30A 2A3BA 1RA5A 1XBYA 1T8XA 3S2LA 4MB4A 5EBAA 4A05A 2YBUA 5D02A 4KWSA 4ZE5A 1KBLA 1VS1A 2D20A 1C90A 1OF6A 1PCWA 4IIEA 5I3JA 1AH0A 4KCTA 2QGYA 1VYRA 2C0AA 1MXSA 4XG1A 4HHMA 1TIMA 3IIZA 5C9RA 2F2HA 4FNPA 3CQKA 3NVTA 1EQPA 2PAJA 3MSGA 3WNLA 4NNCA 4O1EA 3POHA 1QI4A 3KM8A 2JALA 4FX8A 3S1WA 5BRQA 3O6CA 2YCKX 2EPLX 1YLVA 1RQHA 3PB0A 3L21A 4B5TA 3W7CA 4EIVA 4MNKA 2VI0A 4Y96A 3LD5A 1P48A 3HMCA 4JIIX 3IAPA 1GKQA 3LHVA 1RAKA 1TZ7A 2J9XA 3HGJA 1UCWA 1RK5A 1C91A 2Z1KA 1NQ6A 1P0NA 3LGGA 1A5BA 4ZOEA 5G4HC 2V81A 3LUTA 3LS9A 1KTBA 1VP5A 1JZ2A 5B7ZA 1O1ZA 3WQGA 1TVNA 1CLVA 3ZLGA 1ISZA 1GW9A 3NZQA 1G6CA 3ARZA 3BUVA 1QPNA 5MF5A 1BD0A 5FKYA 2VL4A 3R43A 1J79A 1KFBA 3DHFA 3KDOA 3TR9A 2YIHA 4HU8A 1L2QA 3E2VA 1J2BA 2NUYA 2VQTA 1EGZA 3SCWA 4IGSA 2AQVA 1OINA 4OTKA 1EDTA 2Q8XA 1CXEA 3RCNA 3QR0A 3FJNA 3SCOA 3DKJA 3A22A 4AYSA 1JPMA 2GQ9A 4JTIA 5G2HA 1OFAA 1EC9A 4OFCA 4PE8A 1BYCA 1V08A 4AY1A 1ISXA 2PGRA 4C1LA 3CC1A 4DWSC 1ZUAX 1KD0A 1KGWA 1KLYA 1SO5A 1EGMA 2ALDA 1HJVA 3AROA 4BI6A 4HNTA 1FWWA 1XYAA 2CC0A 5TIMA 1VJZA 5AKQA 2GGHA 1K70A 1X97A 3AZTA 3DXIA 4ECLA 1QHPA 2XINA 2DZBA 4H00A 3WD2A 1QPOA 2INZA 1B9BA 3NCOA 4HKPA 4LS0A 4YPJA 1GK8A 4O1AA 2Z7KA 4DM1A 5DEZA 3UJSA 3NZGA 2XIIA 1JZ5A 5CPQA 3U4FA 3T78A 2FVMA 4G6CA 3UP8A 4U2YA 4URIA 1IEQA 4JTLA 4HA4A 5AYYA 4AWTA 4JCLA 1WKFA 3B9OA 3M0HA 4ZSUA 2R1MA 4J3WA 1T0OA 3ARPA 4O0QA 4D1JA 2NXGA 1XUUA 2FZMA 3N4AA 4IX0A 4LAKA 2D2GA 2YFOA 2NV2A 1OSEA 3N15A 4Q22A 4QE5A 1NOUA 4KFOA 5IFTA 4BWLA 4RPQA 4OGZA 1GVFA 1MQQA 3PF3A 2UY3A 4UFLA 4PB3A 3DFPA 5HNNA 1BPLB 2O4QA 3H2AA 1FWHC 2WZMA 3RPTA 2V0TA 4LNYA 2FH6A 2NVDA 1VFSA 3QMRA 1B5TA 2DZVA 2UZ9A 4IFRA 3FS2A 1PKLA 4Y90A 3UT0A 3VMOA 2E77A 4OUIA 4WDXA 1W56A 2O9TA 4NUWA 4NAFA 1QWGA 2QJHA 4Z42C 4Q4QA 4BF5A 1KBIA 3NQ6A 4DJFC 3TR2A 3CEPA 3IGHX 3PAOA 1E56A 2OSWA 1FWCC 3FCPA 2DUXA 4JN6A 3VD4A 3N34A 3P2VA 3QKZA 4UMAA 3W7EA 4L6HA 2PBGA 1U5HA 3QPZA 1NELA 1ECQA 1CECA 1KV8A 3RJXA 2PA6A 3A4JA 7REQB 2E8ZA 1XBZA 2QCDA 1DWIM 1YNPA 4LBUA 5A95A 5A1AA 3CPUA 5FEZA 5G5IA 3UWVA 3GLCA 4K8EA 1R30A 2HK0A 3H24A 2YB4A 4FR6A 3VIJA 5IDIA 1IXOA 5BXRA 3EXTA 3KBMA 3MHUA 1QNPA 4YL2A 5GJMA 1DV7A 1YPIA 3LHUA 2I5GA 1XLGA 3HQPA 3RK8A 2R14A 2WSKA 3S8HA 3AMLA 4GI8A 3PZVA 2DVXA 3WFZA 3NDYA 4Z1BA 4D6FA 3SN0A 2J62A 2WHLA 1DE6A 3NO5A 1W9UA 4JYDA 4GUHA 3PTDA 5FF3A 2GOUA 4MB3A 1JGMA 1I2PA 4U2ZA 4QNWA 1FWBC 4DF1A 1H60A 1SZNA 1H51A 2ONEA 4DPPA 1MEWA 4E2OA 8CGTA 2I5QA 3PZMA 5D9MA 3WQCA 2CHNA 1S5MA 4XKMA 5CSUA 2Z1VA 1O60A 3SCSA 4IZGA 1SO6A 3HPFA 4TR9A 4UQCA 3C2YA 3FYOA 2VEMA 4YTRA 5IDZA 3NIYA 5LA2A 1G4SA 4M29A 1E15A 4H7VA 3PWGA 3GNRA 4CLMA 2HQAA 2GJLA 3TYDA 2GL5A 3ENLA 1UD3A 2BXZA 1YDVA 4PL2A 2KX9A 4UC5A 3HPXA 3AXIA 4TO8A 3AIEA 3V3WA 1UJPA 2X42A 4Y7EA 3HA1A 3INPA 1XQKA 3EA2A 3SCVA 3WDPP 4D6IA 3LMYA 4K38A 3E0IA 1LZOA 2GSJA 3WUBA 1MDRA 3LN3A 4I9AA 3BZGA 1XBVA 3MMDA 3SJNA 3EOOA 3BTNA 3A64A 1BF2A 3MP4A 3G8RA 2PDXA 4Y9AA 3OZPA 1CBGA 3R8HA 5HMFA 1GVRA 3QHOA 5FL1A 4V1XA 2PP0A 3H4XA 3F2BA 1PX3A 1VKFA 3AIUA 1UR0A 4J7RA 4DBWA 4E4FA 4WR3A 3TVAA 2YDRA 2I57A 4LUTA 1VBJA 3EOSA 3EB2A 1K7FA 3UQNA 1TMLA 1GG1A 4XKYA 3T55A 4GA8A 4XVEA 5F2LA 4DZIA 3NPWA 1FDYA 3DECA 3B06A 1E1FA 1JUKA 1FFRA 4Z2IA 3JW7A 1ZNNA 3QQ1A 4UR9A 1L6FA 4KIEA 2ICSA 4AZ5A 3I7QA 1JL8A 4QLLA 1P6BA 1XKJA 3S5SA 4B5XA 3WLNA 5A2CA 2V5DA 2YDSA 3LTPA 4RCXA 5KSWA 5HR7A 3NFUA 4HK7A 3TNOA 1V7AA 3ZR5A 2WKGA 3QC3A 4UQBA 2PTWA 1NP0A 4AVOA 4D8ZA 3EWBX 3B9NA 3V1HA 4W88A 3FJ6A 4R27A 3LTSA 3IVSA 2KAUC 3NZPA 2PTZA 1UQZA 4TQTA 3RRAA 2OYMA 5GQBA 2FHCA 4KMQA 3IGXA 4HZMA 4AZIA 1WKYA 3W22A 1FFQA 3WNMA 5IRPA 4FLQA 5HBFA 5CPMA 2TAAA 1DQXA 3MQTA 1WBHA 5IXEA 1TG7A 2D0GA 5FA5A 1UR2A 2ATMA 1WX0A 3CUHA 5K7JA 1HL8A 5EGRA 1TE6A 1Q6DA 4B92A 7ENLA 3R12A 4YTTA 3LB0A 3WUFA 3DU0A 1OVDA 2XIOA 2NWSA 3DIPA 4ZQNA 2VQUA 3PSVA 1V4YA 2Q09A 4UTUA 3EYPA 3SCQA 2FDSA 2P10A 3HURA 1M68A 4NU7A 1G67A 1J2WA 3OGVA 4LAZA 3TN3A 4XX6A 3IJ6A 3TN5A 4DZAA 3GXMA 2CW6A 2HE8A 4HYVA 1AW1A 4H1ZA 1BSIA 3UA3A 6PTDA 1SGJA 2J24A 3L2MA 4WSKA 4PA8A 1AK5A 1PTDA 2BBFA 2XH4A 3NQBA 5A2AA 4HK6A 4XISA 3WF2A 1L8NA 4OECA 4X9SA 4Q4PA 4UTLA 3K2GA 3TFCA 2PDCA 1G01A 2OQYA 5A6LA 3IJLA 3CGTA 1CGTA 3W70A 2WW5A 3M7SA 4E2VA 4QR6A 2HZGA 4LAMA 4US5D 2Z1XA 2BGNE 4NJKA 4FXRA 2WMKA 2WWCA 3EBVA 1J11A 2WK2A 4L1XA 1AQHA 2P3EA 2HROA 2GWGA 4QQ3A 1YDNA 2J7EA 2OYLA 2R1KA 4TMCA 3RJYA 1J0YA 3REQA 5G1TA 2A3HA 2HE5A 3OA3A 3MBDA 3W83A 1QW9A 4KEVA 2C1GA 2QGHA 4M6PA 5BU9A 1D3CA 3PBVA 3WH8A 5L9FA 3IVUA 2JK2A 3R5EA 1KFJA 2JE8A 4XSMA 4RUBA 2EG7A 1R3QA 5J5DA 4WJEA 3T81A 3UWQA 4ES4A 2DSVA 1DIOA 4G8TA 2YW3A 2G37A 3SEPA 3PR2A 5IM51 4O1BA 4YTSA 3UYIA 2AL2B 3TW7A 1UROA 3UG3A 4YWIA 3AUOA 2XU2A 4AX6A 2RUSA 4LXFA 3U3HA 3UWEA 1MI3A 1KB3A 1T99A 2IQ0A 3W76A 2WBGA 2Q6ZA 1PZ2A 3L12A 3TTSA 4C6FA 1OY0A 4GMEA 5D30A 2A79A 4ZB2A 1KM1A 4AX7A 1GVOA 5HDRA 3MUXA 3UZZA 3IJ7A 1ZBKA 3PZNA 4GINA 2QVHA 5HPCA 1FX6A 1GVIA 2WJEA 4WEVX 5K4ZA 1OFOA 1TZZA 4CEUC 2YYUA 3M5XA 5F2IA 1B4KA 3SECA 2JF7A 3E0VA 1SM9A 3SBFA 1N2VA 3MDUA 4UOZA 3AYTA 1HL9A 4WY0F 4MUZA 5EMUA 3PANA 4I9JA 3W6MA 1VH7A 4MFEA 3U7BA 4ENLA 3Q37A 1N55A 4BEUA 1Q6OA 3OQEA 3TE9A 4ZQCA 2F61A 2I5IA 2VEKA 3KUMA 1OT2A 1VFOA 2RAGA 3W1UA 3TQPA 3W7GA 3TONA 2DZTA 3TWBA 4J2PA 1EKOA 4CNSA 3SN1A 2YZRA 4GI6A 4ZZ9A 4DYJA 1KW1A 2EG6A 1OABA 2GJRA 2WC3A 2FQIA 1FWEC 1XLLA 1LLZA 1E1EA 1R38A 4JNMA 3MP3A 4LS2A 1QT1A 4Q8NA 3K4WA 5C2XA 1S5NA 2TMDA 3CV1A 5LGXA 4JIPA 1SVDA 5AN7A 4U4MA 1TTIA 3RPMA 2V5LA 1JCYA 1JEZA 3N04A 2XN1A 3MPGA 3LSCA 2VEFA 3H23A 2Y8VA 4WGXA 1DJXA 4MYAA 2E5DA 3L0GA 1EP1A 4QJ1A 3BGAA 3BAXA 3ZOAA 2OELA 3CV7A 3QKEA 3AIWA 3NAVA 2Q3OA 3KRBA 2O56A 3N4FA 3B8WA 1NAL1 3QPEA 4PH6A 3VOCA 3UZXA 3DESA 2QV4A 3MCNA 2OSYA 4Z2KA 5FIPA 1X8CA 3KCOA 1QOPA 3V18A 3MV11 1V0MA 1S2UA 3RDKA 4MWAC 1J0JA 2PS2A 3UWWA 1V3LA 4I7WA 1VHCA 3UZJA 2X41A 5D9OA 3IWPA 1UR9A 1TPB1 3VKKA 3NSNA 2QKFA 3KTCA 1J0IA 4JQ4A 3QBUA 1ISVA 5CQ1A 4UTJA 2W4XA 3HOJA 2NQJA 5IBXC 3I7RA 3GTFA 1IXQA 1LRNA 4L64A 1LOLA 4J27A 1O66A 3GHRA 2W3ZA 4KKXA 4DELA 5XIAA 3K1DA 2ZVRA 2QT3A 1RQEA 1H1YA 1ONEA 2PWEA 3OA5A 3VU2A 2DZWA 4XAGA 3DHPA 2YDQA 3CZ8A 4NZ4A 3TCSA 2BHZA 3VFLA 1UBPC 1C8YA 5HK4A 3NQ8A 1FKXA 3M5ZA 4GFIA 1PUDA 2XJ7A 3SRKA 4CD6A 1GONA 3NR0A 4H3DA 2OCZA 2IPFA 2QYGA 5CSYA 4MGGA 1JCJA 4EWJA 4A6GA 3VK5A 4CQBA 4O14A 2JGQA 4MB5A 2NUWA 3RM9A 3AHTA 7CGTA 1R3WA 2ZE3A 2DZXA 1M53A 2Y63A 4H9XA 2ZXAA 4AIEA 4N6FA 3VGBA 1OG0A 5E93A 3GNPA 1S5WA 3ATYA 4GZ7A 3I3BA 4PCSA 1GVYA 3A21A 2EPHA 4Q4SA 2VFEA 3SFWA 4IQLA 4LB4A 1PZ3A 2WC7A 1JD9A 2PWFA 1J93A 2CETA 3E1F1 3PK7A 3ZSSA 3CH0A 4Z1AA 2X7VA 4RK8A 3WEMA 3MDWA 1TQXA 3CIXA 3W2KA 3ITLA 5EFDA 1DWHM 1JQXA 1QASA 3PUOA 1X6UA 1SPQA 3EWUA 4KS0A 1OFPA 1YDOA 1E55A 5A6SA 1A47A 1O5KA 1FWGC 3OVGA 4QFUA 4QDMA 2FJKA 1HX0A 2GZXA 3B04A 2HNEA 5CKSA 5CJNA 4YYFA 2PEVA 1SW3A 1T96A 1HQTA 5BZAA 3EXSA 2DY3A 4RNFA 3TLLA 2XYLA 3WLTA 2ZZ2A 3FV9A 5FF2A 3BO9A 5U7SA 1R46A 1W54A 3DENA 4Z1DA 4S3KA 4GLEA 1AJ0A 3LBOA 2ISDA 1K8YA 5I00A 1TR9A 2V2HA 4PMUA 1Q6CA 2X1UA 4PFMA 1I0DA 2CBVA 2CFFA 4K7VA 2QCHA 4K39A 2OLHA 2PMQA 4CQAA 1VGAA 3I3EA 1FWRA 2CYGA 1K7EA 3VZYA 4R34A 3RX3A 3WF0A 2ZX5A 4PCNA 4UB9A 4IF2A 4X60A 3W73A 3UCDA 3A3WA 4F48A 3BAJA 3P0XA 3KOZA 1A5KC 1LM1A 1GCYA 3MUAA 3FNDA 1T6MA 4GVFA 1Q5MA 4R5EA 4JTJA 3A9BA 4I7VA 4L4PA 4X9YA 3VIMA 2C0HA 4ZVJA 4LUIA 4E4UA 1JDDA 4F40A 1H0GA 2PI6A 1LYXA 2IQDA 4MOZA 4D71A 4AD3A 3EPOA 2YCEA 3N25A 3JR2A 4C91A 3VIFA 2X7WA 2R82A 1QTWA 3L0KA 1DIDA 1QW8A 1B9ZA 1IT7A 3I7SA 4K3ZA 3WJWA 1B3XA 3GY1A 1WXZA 3KOWA 1KO0A 2CXGA 2QDHA 5LA1A 2V82A 3GU2A 2OT1A 1MZRA 1GVSA 2E8YA 2VENA 3BCJA 3VGDA 1EWDA 1F61A 1H09A 4LFYA 3G1HA 3A12A 1P7TA 2OZ3A 1W1IE 3H55A 3VGEA 3HIJA 1NM9A 3SADA 3ICJA 4P7QA 3T0CA 3IPWA 2HRWA 5AC5A 4WIWA 1AMYA 2AQOA 4ATWA 3UJEA 3SUVA 3RLVA 1GG0A 3SCUA 3GNXA 3W84A 5I3FA 2AAAA 3QGKC 2W91A 2MUCA 4IQEA 3KRUA 3OHMB 1A80A 4AAJA 1S1PA 2XIMA 2OR2A 5KZDA 3S83A 3PZQA 3WJZA 1TTQA 1JFXA 3CAWA 4FXJA 1GOIA 5FJOA 3Q45A 3CMGA 3QV8A 3WY1A 1RY8A 1MNZA 3R0UA 4GUIA 4A8IA 4OVXA 4FR1A 1HKIA 2V30A 3LBCA 1V6VA 2FHFA 4DIAA 5CGMA 4ROQA 3U57A 2YB1A 5E0FA 4DJDC 3K8KA 4PN2A 3IS4A 3RRXA 3HGRA 4DHGA 3QZEA 4MJZA 1JD7A 4NL1A 3RF9A 3IGSA 3UERA 4I5RA 3NDOA 4M3PA 3T2PA 4O8RA 4UTWA 4LRTA 3EWXA 3OLEA 3TNBA 2FPTA 3WMCA 1DXIA 4IJBA 1TA3A 4BQ5A 3FLUA 1PPIA 3AMKA 4O1DA 4ZFMA 1JRCA 4MY1A 4K6AA 2NXHA 1J0ZA 1GZGA 4Q8WA 1R85A 4RDYA 1Q3NA 2VCCA 2GJPA 1F4AA 1CXLA 1CB2A 3M0YA 1UJQA 4IUGA 3ZVHB 4HMCA 5K3VA 2CU0A 3GW0A 1EUAA 2WSRA 4S3JA 2PDUA 5JXQA 4L65A 1CCWB 4GIRA 1V5XA 5K9CA 4LGXA 1RJQA 4NY2A 3BG9A 2D2HA 3VX0A 1REQB 1EBGA 1QJWA 3F2DA 1H50A 4C6JA 1RV8A 2WSYA 3MJYA 3VXGA 3G1DA 1ZU8A 1UIOA 3WQ4A 1E72M 1D3HA 1OZMA 3AXKA 3H2EA 5I3DA 4JIHA 3P8IA 3C56A 2NXIA 1IT0A 2UY2A 3GWQA 2AL1A 3BWWA 3NVDA 1EIXA 3VPLA 5CZJA 1LBFA 2GVEA 2H9AB 3WQOA 3MVTA 4F0MA 3G1VA 3IIPA 4ORIA 2H8ZA 4NZ5A 4IGHA 5T91A 2ZRXA 2YX0A 2VFHA 4CQ8A 5FOOA 2G3MA 3SRFA 2GVGA 1TPC1 1E6RA 2JBMA 1GYNA 3JVAA 1P6CA 1VHNA 4K37A 4PB4A 1VFTA 2DIKA 3RX2A 3BE7A 4I3GA 2P5NA 3P0WA 2QXWA 4UTTC 3M1ZA 1XPGA 1K4GA 3VNJA 2XM2A 3KLKA 1TSIA 3D0CA 4GQGA 3HBLA 1KQYA 4M0XA 1I9CB 2CLKA 5REQB 3M46A 4OBSA 4AF0B 2PDNA 4C6DA 3U5UA 3VGHA 3I6RA 4POCA 1OB0A 3UPMA 1CGYA 5AB3A 2QCEA 3C2OA 3CWOX 2P76A 2C91A 2WO5A 2BVYA 4MDPA 3W9ZA 3GHUA 1OFRA 3BJTA 4TMBA 5BROA 3NEVA 2RFGA 3WLSA 1WP6A 2B7OA 3A24A 4R7WA 3Q4DA 2QIWA 2V3EA 4UNIA 1YW1A 1P5BA 2QMJA 2QUVA 4AD0A 3A3HA 1QVBA 3WDQA 1N8FA 1UOZA 4ZL1A 3KVMA 1EA0A 3AC0A 1WOAA 2YCLB 2WYSA 1V7YA 4LUSA 4GIYA 3WNKA 1EC7A 3CIWA 1YXCA 2HEJA 4JOMA 5F4WA 1Z44A 3GU1A 4HT3A 4I6VA 1NP2A 1L8PA 5FSDC 3SZ8A 1BXNA 4OHQA 3WLRA 4F3HA 1LG2A 3K30A 3VABA 2GQ8A 3S46A 6ENLA 4LALA 4O1CA 2XUCA 2O9RA 3FW6A 3J7HA 3NXFA 2F9RA 3CZLA 3QW3A 3AXXA 5CG0A 3KFTA 4E3TA 4P5UA 1B2YA 4DLMA 3C2EA 4XZLX 2C15A 2YOCA 5C71A 4FLOA 4NX5A 5GJPA 4XUYA 2Z28A 4GQQA 4HPGA 4ZSTA 4N4QA 1H7XA 3UGRA 2ZXQA 2VFGA 2A2IA 2W9MA 4LW7A 3WNOA 2X2YA 2Y88A 1V79A 3WMBA 3AZSA 3N3TA 4UTKA 3F2CA 3ABSA 1XIDA 1WAWA 3PVFA 1QNSA 2Y6ZA 1XPYA 2OWCA 1AFSA 1BVNP 3UEQA 4JFSA 2IUZA 3BARA 1F07A 2PBOA 1N7KA 4XZHA 2P0IA 2PTDA 3KOYA 3WYZA 3UR7A 3W7RA 4DUWA 4AH7A 4DXXA 1E3ZA 4HZ6A 3IGUA 5D03A 3KHJA 5AYXA 4UIOA 3KXQA 2DPEA 1EZWA 5CAKA 4JY8A 4ZBCA 4R9OA 3BGJA 2PCQA 1HNYA 4W87A 3CHVA 5I2UA 3QY8A 4G7EB 3TXZA 3MZNA 1MEIA 2VVSA 4Q4KA 2JGYA 1A5AA 2VEIA 2ZX6A 4FO4A 1TKKA 1OM0A 1H2JA 3BAIA 3DFHA 3EWZA 3LZ3A 1TTJA 3I4KA 4W5UA 3GZ3A 3F1QA 4AXKA 1UZDA 3P81A 3HM7A 3TYAA 1X1ZA 1H0IA 1EOKA 4HOXA 3P61A 1VIZA 1HJXA 4EF9A 4Y2WA 3C4UA 3WQDA 4I9TA 1U22A 4KESA 1U5JA 1H63A 1GOQA 4IPLA 3TYBA 3ALFA 1RZMA 1W1PA 4HHHA 1NDVA 5CXPA 1YTEA 3KOFA 3G1FA 4DF2A 3TWAA 1JF5A 3N13A 3WD4A 2ZUVA 3W7HA 2YYTA 1QI5A 4DUXA 2VEPA 3CEUA 4AUBA 1JAKA 4HNCA 1BQCA 3UJ2A 1F3TA 2EEXA 5AECA 1XF0A 2Z1SA 1H41A 1W1YA 1ZALA 3ARRA 3ZQ9A 4LYKA 3BLPX 3U8GA 4CN4A 3NNTA 3M64A 4ML4A 4TVCA 1JYWA 5JH2A 3BJFA 4PTMA 1DYSA 4PTWA 3QSTA 2W5FA 3BLKA 1M1BA 4MKNA 1SJBA 4MPKA 1MQPA 4REQB 1IE7C 3W81A 2ALRA 3AU6A 1C29A 3NQ2A 1C9DA 3CH9A 4LBSA 3LG3A 1UZHA 4GQRA 3JU2A 3QMTA 1JVNA 3DG7A 1DE5A 3CJPA 4F66A 3SO7A 4X2RA 3OB8A 3JRKA 4N0RA 4A2SA 3ZJKA 1EO7A 3CZGA 1PZ0A 4W4QA 1G7UA 5J8LA 2BY1A 3WL0A 1EF3A 4QDPA 9XIMA 2X2GA 1NVMA 1PIFA 1P43A 5KINA 3PG8A 2DZPA 4GI4A 3OU8A 3FAXA 4Q6JA 4GC4A 3L65A 1WOBA 4IXHA 3DX5A 1EQCA 3GAKA 2INEA 4BQ3A 3ISIX 2YJQA 3E0LA 2OQHA 4AZGA 1VJIA 4HHPA 4LVDA 4Y9MA 4A8NA 1B90A 3OVQA 3UFYA 4QE4A 3E0WA 3STPA 3OGSA 2C1IA 1SZFA 5E09A 1E1CB 5ECUA 2YLLA 1QCWA 1OC6A 2Y89A 3VX1A 5KZMA 4DWSB 3PNZA 4PEKA 3KVLA 1W5MA 1J10A 3LMZA 3VIPA 3GU9A 3PJUA 4QG8A 3URQA 2D2OA 3V7PA 3UWYA 4H7ZA 3W1XA 1RBAA 6REQB 2DSUA 3K5XA 1XLCA 2NZLA 4O1FA 3C0SA 2X05A 4Q7IA 4IM4A 5G1YA 4QISA 1RJRA 2OU4A 3NO3A 3BV7A 4RDWA 2HV5A 2J74A 1OX5A 1K03A 2W61A 2ZBTA 3SM0A 5E9XA 4IWWA 5I5RA 3G0UA 4HBKA 1WDDA 4RZBA 2Q8LA 3GVQA 4BJHA 1CGUA 3CLMA 3M9YA 4S3DA 3L23A 3FA4A 3UWZA 4GYKA 3IARA 1LQAA 3RR1A 3NDZA 1XIGA 4Z1CA 1QW7A 2CLPA 4J3ZA 3M0VA 3M0XA 2XZ9A 4QJ5B 1M01A 1WDQA 2YL5A 5FJPA 4AC1X 3UPBA 4MY8A 3PM6A 3GFYA 5I7GA 1F76A 4KWVA 1MRAA 1HN1A 3SSJA 2ZA2A 3M47A 3TYUA 4UMCA 2BLEA 2QF7A 1XYCA 4W89A 5ABEA 1XLFA 3RXZA 2QQ6A 1EHAA 4US5A 2WMHA 3ZWSA 4CU6A 4UZSA 3G0XA 4HCDA 3W71A 5EKYA 3CLWA 5I09A 1W2PA 3G0SA 4W86A 1ZZMA 1EA9C 2CHOA 3W7NA 4H4IA 1R9ZA 2GJXA 3KVKA 1PZ1A 1XS2A 2XH7A 3WSUA 2FTWA 2XN0A 2PCEA 3O0FA 1SO4A 1CXFA 4IPNB 2QVNA 3URBA 2Y8KA 1F6PA 2PZNA 1E4NA 2GK1B 4KQNA 5M5DA 1QXLA 1H62A 2DT0A 3BLLA 4L61A 4J28A 1VRDA 4AZCA 3GSMA 1OIMA 2VCBA 5DXYA 4QTGA 4QEHA 4UQDA 4HU4A 1A5SA 2VUNA 4ZO8A 2QF8A 4MM1A 5C5YA 4JN7A 3W7JA 2ABBA 1CGXA 3O07A 4DJFA 2NT0A 5IOBA 4MF4A 4DEFA 4JQAA 3QGAC 3K13A 4I5XA 5FEPA 3ITOA 2HVOA 3KL0A 3HFTA 2C13A 3WH9A 4H9YA 3NPXA 1XLKA 4IFKA 3DFOA 1ADSA 4GE8A 4DF0A 1UP0A 1OX4B 3RU8X 1EJTC 4CCZA 3C2RA 1FRBA 3TYCA 2GSHA 5CGTA 3WLQA 2JKAA 1C3FA 1Q63A 2BMBA 4A8LA 1TWZA 2OB3A 3C0LA 1ONWA 4R9XA 2J77A 1M04A 4PSPA 3SGUA 1UUOA 3UG8A 3E2RA 4F9JA 2CERA 1GQNA 2Y24A 1EUNA 4NZFA 4UCFA 4BEQA 1BQGA 5D9PA 2OT0A 4H19A 4O0ZA 1ZHAA 4UTIA 4E8CA 4AFYA 2VGBA 5F4XA 3FY1A 5F4SA 1WZKA 1U33A 3CT7A 1BGAA 2EG8A 2CLOA 3NSXA 2ZWYA 1DQUA 4D6EA 3ANUA 4QG6A 2E9BA 1SYTA 3WBWA 4JTRA 3WD1A 1C7TA 4R7JA 2L5HA 2Q02A 3OVPA 1K9TA 1EFZA 1RBLA 2C8NA 3HPAA 2R1PA 1OEPA 1LCOA 4DBEA 3CXOA 1OZQA 3WLKX 3WLJA 4US6A 4Q7NA 3LZ5A 5CGQA 2BY0A 4NJHA 1UC5A 3WQ5A 4BKNA 5LKYA 2QDDA 1KFLA 1PXGA 1FA2A 3LGEA 4Q8UA 3LV6A 2WNQA 3ABXA 2A7RA 4PB5A 2G4JA 4HD5A 5BYWA 3F4CA 3GS6A 1UMLA 4EPBC 3CMFA 2W79A 4XO7A 1VEPA 1W9VA 3PPGA 1XLBA 2ZDSA 3SAZA 3HPSA 3R94A 4NVTA 4D2JA 1E70M 4DX3A 3GUGA 1UZ4A 4LJ3A 2Y1HA 3MI3A 3BC9A 2OTDA 3CIVA 4HSHA 1DXFA 4UBPC 1F6YA 3ARVA 4FF7A 2V3DA 3S9YA 3GK0A 3FXYA 3ZT5A 4CU7A 1UKSA 2EHHA 3AYSA 3EB4A 2Z6IA 3T9PA 4JXCA 3CASA 1EJVC 3LPOA 4PBEA 1AA1B 1YIXA 2W67A 4I7UA 1UD8A 3BL3A 1GKRA 2E6FA 3IEBA 4OBTA 4A3RA 5TD4A 5XINA 4W7WA 5CZSA 1H5YA 1HT6A 2FKPA 1ZJAA 1R3SA 3C3UA 2EJAA 2WCAA 4XQ6A 1RLCL 3CUZA 3APGA 2I17A 3LDVA 2FTYA 3IK2A 5A69A 4B15A 2REQA 5FJTA 5DCDA 5HQEA 3AIRA 4I5UA 4PUDA 4M24A 4ZGYA 2XISA 1LWIA 3W3OA 2DGAA 2DW6A 3T07A 1L6YA 1LL6A 1Q65A 3NQAA 1XUZA 1CWYA 2P1FA 2HMCA 2P50A 4JCMA 4KFPA 2PWHA 4JGDA 1VPQA 1XG4A 2B4GA 3QGVA 1S2AA 4H01A 2OQLA 4FZIA 1LQ2A 1HJSA 3FK4A 2G41A 2F38A 3KBNA 3ZYZA 8A3HA 3W00A 4N7QA 3S2NA 3LU2A 3NQMA 1Z8AA 1D8WA 1IT8A 4GYJA 2ZYFA 3BOXA 2ZWZA 3O6DA 1BHGA 4GX9A 5EB8A 4A8RA 3TTOA 3FKKA 5C7HA 3EEZA 3TC3A 3HQ1A 1T5AA 4LVAA 1J9YA 4AVNA 1EX5A 1ISWA 1SZEA 4R33A 1Q85A 2GJNA 4RE3A 1JZ4A 4LV9A 3LPPA 4MB1A 1MXDA 3ELFA 1Z6KA 1K8ZA 1QNOA 1OWQA 3IIXA 1JCTA 2VOMA 4AD5A 4GY0A 1QRQA 5AHEA 1ZQ5A 1PTGA 4WVXA 5MKGB 4WXZA 1GW1A 2EXOA 4B5WA 3AHXA 5KEZA 3EMQA 1XIHA 1M7JA 2ZZ5A 3GDTA 2IKJA 3NXLA 1S2WA 4NJGA 3O2LA 1V0LA 3NPVA 2E6YA 4YHEA 4NQ1A 3KL5A 5FSEC 1KFWA 4Y9PA 3LRLA 2G3FA 4N4PA 3N2CA 1TMQA 2ZX8A 1LF1A 3FN9A 1BRLA 3L4VA 1FHVA 5DCEA 1FVPA 4H8NA 1UR3M 1V02E 5AY7A 2GFTA 5E0KA 4H6QA 3PBUA 5C70A 1RHCA 3BANA 1W9BM 1NEYA 1BWVA 1RD5A 4ZE4A 4JYFA 3LLDA 1ME8A 1XCXA 5D05A 5CPTA 1ICQA 1SR9A 3KBJA 4NJJA 1GUVA 2X1SA 3XIMA 1E9LA 3KBSA 1FWDC 1R2RA 4IUOA 2OZTA 2XFFA 4J9JA 2OX1A 3EEGA 4XD3A 1O5RA 4Q4OA 1GVEA 1VIWA 3HPZA 5AHFA 3ARSA 2OG9A 2Z1WA 1XIFA 1QOXA 4ADUA 4HQVA 4XAFA 5DT5A 4UR8A 4XK2A 1E40A 2F2KA 1QMLA 4G7FA 2VRKA 1HGWA 4DYEA 1XICA 5TQLA 1BLIA 2OO6A 2ZRYA 4XO6A 1TUFA 3MS8A 4C5YA 4EWND 3OODA 4FB7A 5FAJA 4C6PA 4AEFA 2AOSA 1XBXA 3TK7A 3PWAA 5C7VA 1ZP4A 5DMNA 2OZ0A 2ZXDA 2Z24A 3QMSA 1GVQA 2QULA 1JCMP 4MWAE 1JG9A 4IPJA 2BWGA 2A6NA 3B4UA 2AGKA 2WXDM 3T42A 4DNHA 1GYMA 1X6NA 3FKRA 1MUCA 1DOSA 5CBJA