3LHTA

Crystal structure of the mutant v201f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIFGRSIYLADNPAAAAAGIIESIKDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lhtA00
1JR1A 2VXNA 1FUYA 3K30A 1LDCA 4XUGA 1TYGA 1YDVA 2OT1A 3I7SA 1F5ZA 3STEA 4WZHA 1OX4B 1W3IA 1Q6LA 4YMZA 1IGSA 2YGYA 5I3JA 1SW7A 4JTTA 2CLEA 4Y6GA 3TJXA 3T44A 3PC0A 3SFKA 1I2PA 3W7CA 1NSJA 4UTKA 4EWND 1I45A 2P10A 2YPIA 4I7WA 1KFJA 4FNRA 4O50A 4O28A 5AHEA 1KV8A 3LCLA 2WOQA 1N7KA 3IIOA 1K03A 2FPYA 4NJGA 2TMDA 1G6CA 4H4IA 3NAVA 4GXMA 2NUYA 3M6YA 2EHHA 3FKKA 2V2HA 1W56A 1G4TA 1OX4A 2VOMA 1TPUA 4O15A 1JQXA 4N9EA 3M5XA 4C1LA 3MYPA 2R94A 4IOTA 4WY0B 5FEPA 3VE9A 4YCOA 4XQ6A 3TUUA 3IIPA 4M6VA 2PURA 4WD0A 3W7KA 4GJ1A 1N55A 5LNVA 4DO5A 2GJLA 5ABTA 3TJLA 1ZCOA 2E68A 4GUFA 4UIOA 4YLWA 4ADUA 3W1PA 2FLIA 4BK9A 1GG1A 3THQA 4Z1DA 1ZAJA 3W76A 2Y85A 4O1AA 1W5OA 3F1QA 5A8GA 2VEMA 2ZDRA 3NL3A 4EF9A 3W22A 4UR7A 4CNOA 1WOAA 3QFEA 4CNNA 1VGAA 1LBLA 4ADSA 1SFLA 1W0MA 1VHCA 4HSNA 5D02A 4UMBA 4AHPA 1F6KA 3C2OA 4TX9A 3GX9A 2AQWA 3FFSA 4UFJA 1I4NA 4QAIA 1TPWA 2X1SA 2BZNA 2C14A 3LRLA 1XM3A 2FIQA 2WV8A 1XC4A 3T55A 2QCNA 3NQDA 1GWJA 1JUEA 3CEPA 5LNWA 1UUOA 2C19A 3NO5A 1VZWA 3OA3A 3PUDA 3N14A 1VC4A 3G1XA 5F1UA 3TC7A 4RZ5A 4ZQMA 1FCVA 2Y7DA 2YFOA 3RLUA 1SUXA 3WFAA 1LBMA 3KX6A 1AW5A 1MEHA 1KFCA 3S42A 3UQNA 4MYXA 1LLZA 1AL8A 1O95A 1P5BA 4X3ZA 1R2RA 4MFDA 4UFIA 1GVOA 3BG9A 1RPXA 3HMJG 1X6UA 3BLIA 3FOKA 3GXTA 3W7OA 2ISVA 1ZNNA 2J9YA 3LV6A 2NXIA 3TXVA 4UXDA 2A21A 2VFIA 5K7JA 4WUIA 3NPXA 4DXVA 4ONVA 4A21A 1GPWA 2Y63A 2ZZ7A 3O15A 4U4MA 1Q45A 5AHMA 1A5SA 3ABOA 4ZQNA 1TCDA 3W1TA 4MZ8A 2HS6A 1FBAA 2QCDA 3OG3A 4Q33A 3UWVA 2QF7A 2Q3OA 3W1XA 3P80A 3HB9A 2NUWA 6ALDA 2CZFA 4HPJA 5CPMA 1XBYA 4KWVA 2B7OA 3N9SA 3GNNA 2GVGA 1T0OA 4XWUA 5FF4A 3C2FA 1L9WA 2QEZA 4O16A 1VS1A 5KZDA 3KVMA 2V2DA 1JRCA 3OBKA 3NXFA 3QMSA 3PUEA 4TO8A 1OYBA 4OHQA 1K7EA 1KTCA 5K3VA 1EUAA 2NWSA 4K38A 3FKRA 1NAL1 1QFEA 3EWYA 2DZWA 1QOPA 1ONRA 2P1FA 3V75A 1ZENA 2ZA1A 4A2RA 3W6YA 4DBEA 3M9YA 5EPDA 5D30A 1R30A 4PL2A 4MLRA 1IF2A 1W31A 1YDOA 3STFA 4XZ9A 4ORMA 2Y7EA 3NPWA 3TX9A 3TNOA 3F4NA 1PCWA 1TPVA 3P61A 1G7UA 3IV3A 1TB3A 3S0CA 1XFBA 3ABRA 2E5CA 3NEVA 3BG5A 2B7PA 5H91A 2E6AA 2DU2A 2XN0A 3QC3A 3L0GA 1HO4A 1EP2A 1AL7A 3OHIA 3G1YA 4RCXA 4E2BA 5C2XA 1TPH1 4LVFA 3I65A 2GVJA 1HG3A 1TREA 4M7SA 1GTHA 2W79A 2WNZA 2FPVA 1H50A 3S1XA 1X1ZA 4AVFA 3G1DA 2EGZA 3G1HA 1QPOA 4O18A 3KVJA 3PSWA 1DOSA 3HG3A 1D3HA 4A29A 3W7HA 3H53A 1DJQA 1FWRA 1H1ZA 5AHNA 1TPEA 2KZHA 2H8ZA 3QYQA 2VFDA 4GUIA 4DF2A 3CT7A 3I7RA 3IGSA 4HT3A 1XBXA 3W7RA 2QCGA 4LVGA 3PG8A 1SW3A 4FXSA 3ZR4A 1ME7A 1F05A 1THFD 4NXSA 3LXCA 1H7XA 1IXPA 1OHLA 4Z1BA 5F2GA 3MI6A 2QR6A 1JUBA 3LOTA 1FCUA 3EX2A 1XDMA 3BW2A 1OFDA 2E6DA 1NVMA 3S1VA 1QPQA 3L68A 1QNVA 5E1QA 1LOSA 4LUJA 4O52A 1H7PA 3CWNA 3C61A 3G3MA 5HUOA 4DO6A 2FPTA 3TROA 5G2HA 1ML1A 3QQ1A 5AN7A 5TQLA 2IQTA 3UNDA 4CCCA 1PVNA 3MI3A 4WX2A 2NX9A 5DY3A 2NLIA 1AMKA 3L2IA 5F4XA 4RJEA 3BGJA 4P2VA 2H3DA 2WSQA 4X2RA 3M5VA 1ZY9A 3LI1A 2E5DA 5FEWA 4O19A 4JN6A 1BTMA 1ZJIA 3UWQA 3W73A 3F03K 4DF1A 4NUWA 5EBUA 4YWIA 2A0NA 3NQAA 3DFTA 5AHIA 3OVQA 1X8FA 4QSHA 4RXGA 2VENA 1S5TA 2YYTA 1VR6A 2YX0A 1QOQA 5L9FA 3E9AA 5LHEA 2GJNA 5U4NA 1QR7A 3BW3A 2Y7GA 2GQAA 3LCFA 4MVAA 3N2XA 1SW0A 4MUZA 2XFWA 1DJNA 2E5BA 2GOUA 4B5NA 4LV4A 3UWWA 1ADOA 1H63A 3A21A 2D73A 4N6EA 5CG7A 1NEYA 3SJ3A 3UY7A 2JKAA 3WK3A 1IXQA 3HPZA 1GTEA 3EWUA 4HSOA 3W7MA 1VLWA 3W86A 2GQ9A 5AC7A 3R8RA 1DL3A 1TJPA 4GRSA 4AH7A 3T40A 4UTWA 3BV4A 4QIUA 3TK7A 1B4EA 2CLOA 3TXZA 3KOFA 5CGQA 4A3UA 4PODA 4KFOA 4S1FA 3NQFA 1Q6QA 2DZSA 5HULA 3EWZA 4AWUA 2OT0A 1W5MA 1SO3A 4KWWA 2ZRXA 1ALDA 5G4WA 3WJXA 1LP6A 2X1RA 3UZ5A 3DKLA 2QUTA 3VCRA 3HQ1A 3F4WA 3TH6A 2A6NA 3C3NA 1YXYA 2YSWA 1B57A 2FB3A 3L66A 2GVLA 2PCQA 2ZA3A 1YTEA 3FA5A 5CSSA 3C8FA 3NNTA 4HKPA 2Y89A 4WJEA 1QO5A 5AC8A 1FCQA 1KM4A 4JDBA 4XTDA 2G97A 1RZMA 2I1OA 3O05A 3GIYA 3U2OA 4NXKA 3KRUA 1JULA 3B03A 2V5BA 3G1AA 2NZLA 3U6WA 2C13A 4UMCA 1F76A 3G8EA 5HWMA 1WBJA 1WQ5A 3W3OA 2VFHA 3G1FA 1O5KA 3HG2A 3M5YA 2RDTA 2VFEA 2CWNA 5LNUA 1EEPA 2CLKA 4RZ4A 4BF9A 4BI6A 4HNUA 1UJPA 3R13A 3TFXA 3S1UA 2A6LA 1WDWA 3W72A 3S8HA 1FDYA 1UB3A 3QMTA 1U5JA 5BMXA 3KRSA 3Q58A 3PB2A 1LLWA 1P0NA 2DZPA 3NPUA 2QCMA 2ZRZA 2TPSA 4MLJA 3A23A 2Y88A 3W2LA 5HNRA 3RMJA 1JUKA 2QCHA 3LTYA 3E49A 3T7VA 1SU5A 1TMHA 1UASA 4I7VA 3W2MA 4FB7A 1AW1A 1CW2A 4WXZA 3LV5A 3H55A 1KBJA 5K4XA 3EXSA 4YL2A 1F7BA 2YDAA 1EA0A 5HMSA 4RR4A 2WNNA 4O4WA 3GLCA 3M47A 4AF0B 2E09A 5DLCA 3QW4B 4XBKA 4BR1A 1WA3A 3DAQA 4JDYA 1PE1A 1D3GA 4O0ZA 3C2EA 5CPLA 4WQ6A 3W88A 3BG3A 1I8JA 4O4VA 5KINA 1JCXA 2EPHA 2R91A 4ZMGA 3C4UA 3QM3A 4D2JA 3L21A 3SI9A 3O63A 1KLYA 3TSBA 3L65A 1H7WA 2ZRYA 1SPQA 2YW4A 3LHZA 4MOZA 4AWTA 3ZFHA 2G95A 1F6PA 5HINA 5DXXA 4IQLA 4OGZA 4K7YA 4AF0A 3QJAA 4IUOA 3DI1A 5A5WA 1FWSA 4R34A 3DBPA 1C29A 5IM51 4JTHA 4NT0A 5FF7A 5EA9A 3JR2A 3O07A 3HBLA 3MW7A 1A5BA 2A85A 4L4MA 3KFTA 4NNAA 4QJ1A 4K6AA 2RKXA 3EXTA 3Q94A 1U83A 1JVNA 3TQ0A 1SO6A 4UMAA 1H60A 3EX1A 2QCEA 3QF0A 4LV9A 1F2JA 1M6JA 3CLMA 4LC8A 4JTGA 1JQVA 4LNYA 1TTQA 2NXHA 5CPNA 3IIZA 1TPB1 2NX1A 2JBMA 2V8ZA 1Y0EA 5IBXA 3RK8A 1W1ZA 4JNMA 2DORA 4NJHA 3NG3A 4FX7A 5D04C 4AB4A 3PY2A 6TIMA 4NZFA 3INPA 3W2UA 5KZMA 4UFKA 2Q3RA 5HUPA 2C16A 3Q37A 3TR2A 3GZ3A 1UBSA 1XKYA 1EP1A 4JX5A 2ZFAA 3EXRA 3VI2A 4N4QA 3HGOA 4O1DA 4UNKA 2B7NA 4KFPA 1KM0A 3NQMA 2Y7FA 4UTIA 4RKAA 2FB2A 2RDWA 5D05A 4UTMA 2R8WA 5F4SA 1RQEA 2ABBA 3B0UX 1UUMA 2J88A 8TIMA 4NJJA 1YLVA 3C6CA 5D2YA 2ZYFA 3GDMA 3DFSA 4K8HA 3LLFA 1RV8A 4O1CA 3C0JA 3O6CA 3NQ6A 5KMYA 1KM3A 4IXHA 3STCA 3UY8A 3KXQA 3U8GA 5EY5A 4AXKA 3NQCA 3ANYA 1K3UA 4FXRA 2ZQ0A 3W7EA 1EP3A 5FEZA 3R12A 3VKJA 3PBVA 2WSRA 2CFFA 4DEFA 1SQ7A 4Z0JA 5T26A 2VFFA 2ZZ6A 3C52A 1KW1A 3HO8A 3S5YA 2A5HA 1T99A 1LRQA 3LXAA 2Z2UA 3PVFA 4EF8A 2FDSA 3GVGA 1TSIA 1YTDA 2ZZ3A 1Q6OA 3NOEA 3ZS4A 2PRHA 1LROA 3GR8A 1GQNA 4LT9A 3E0IA 2QCDB 2C15A 1VLIA 4Z1CA 1GOXA 1QDSA 5HWJA 4UFHA 4DO4A 1GG0A 1K7FA 2GUUA 3QSTA 2QCLA 1YXCA 3NQGA 1B4KA 3CTLA 5D2TA 1OABA 2ZZ1A 1G69A 1T8XA 3B04A 3PR2A 4IMCA 4UTWC 4M7TA 2C18A 4ZQCA 1XXXA 3CIWA 3W7IA 1TTJA 3P5ZA 5C55A 2V30A 1F74A 3W1UA 3M1ZA 1OF6A 3CB8A 4ZL1A 3DH7A 3HGSA 3NZ1A 2Z1BA 3O06A 2V0TA 3CM4A 1MZHA 2F84A 3SECA 3NL5A 3HF3A 3S5OA 3QZEA 5F2LA 4CNPA 1WX0A 1I2NA 2Y62A 4R33A 1DVJA 4PFMA 1GZGA 2YYUA 2OMAA 1HO1A 5AHFA 3PB0A 3DHDA 2YFNA 4H6KA 4LVDA 1A5AA 3FJLA 1DKWA 4NZJA 2QAFA 2NXGA 3GDLA 3R89A 1XBVA 2OJPA 2J6XA 3DI0A 1NF0A 1OFOA 2ZTKA 5FEXA 3M43A 3LRKA 4PA8A 1YDNA 3NL6A 4UUIA 4MFEA 4FNQA 3NR0A 3RNDA 5KTLA 2CLHA 4UTLA 1VJIA 2V9DA 4MIMA 2CLMA 1QO2A 4NNBA 2JK2A 3P67A 2WPBA 1XDLA 2HSAA 1N8FA 4LW7A 4ZQPA 5FF0A 2FQIA 3KVLA 3O8AA 2QJIA 4RXFA 3MJYA 1AW2A 3BW4A 2WJZA 1GEQA 1SO5A 4AMAA 5D09A 2XN2A 4LU0A 1ICQA 4OV9A 2GPTA 1HUVA 3E02A 3MP3A 4O10A 4FF7A 5DBUA 5FESA 5I3GA 2BX7A 5DCBA 3LCXA 4HNNA 3L5MA 4P61A 3GDKA 4UTHA 4XKYB 4UCGA 1X1OA 1Q6RA 4JTFA 3UXAA 3RFAA 3W85A 3QPZA 4DPQA 2X1TA 2QUVA 2WSYA 2EKCA 3PF3A 1TPC1 3UZJA 3FYOA 2BTMA 3DKJA 3DFOA 5LKYA 3O16A 1PIIA 1V7YA 2VEPA 4ZVJA 3SZ8A 5F2MA 4N9DA 5E93A 3QH2A 3N9RA 1XBZA 2VEIA 4XKYA 2TSYA 2YXGA 1WAUA 4RLIA 2B0MA 3TW6A 1P4CA 4NJKA 1C8VA 1KA9F 4FIQA 4DBDA 3GR7A 4K8EA 2P0OA 4ALDA 1W8SA 3W84A 3OVPA 2Z6IA 4UNLA 1VCGA 2ZTJA 2QUUA 2WO5A 5D2VA 4WY0F 4IPJA 5HQEA 1SFJA 3CQ0A 2QJHA 2G5WA 3PM6A 1OJXA 3MO7A 2CZEA 3W1NA 3UPWA 1D9EA 2ALDA 1GVRA 2E77A 4MY8A 1ME8A 1OK6A 3IRDA 3UYCA 4JTKA 2XN1A 2DJLA 2RDUA 2PRLA 1L2UA 1KLZA 2HMCA 4OE7A 5I3FA 2H6RA 3P8JA 1KTBA 4JTIA 1QPNA 4GUJA 4JY8A 3SSJA 2EAWA 2QAPA 4QNEA 1LOQA 2QJGA 1SZFA 2QKFA 4A22A 3A24A 3LERA 1G67A 2Y61A 3SGUA 1Z41A 5CKSA 3PBUA 5I3HA 4MZYA 3SIZA 1YTKA 2YR1A 3G1VA 4PEKA 2CZDA 3FS2A 5DY2A 3W71A 3P7YA 1JRBA 5IBXC 3ATZA 3W7GA 1B3OA 2CLLA 1OYCA 3LBMA 2JKEA 2YW3A 1Z44A 3STGA 4NNCA 3LCWA 1R2TA 4K7VA 4LS1A 3NPVA 1FY6A 4FNUA 4JR5A 3LHTA 5D2XA 2I14A 2DZVA 3T78A 3L0NA 1OYAA 5LGXA 2R14A 4MY1A 1H7OA 3LX9A 1XI3A 1SO4A 3W7LA 2ZRVA 3JS3A 3LHWA 4X9SA 4ML9A 3S5NA 3LRMA 1OX6A 1Z42A 5BOOA 4MY9A 4E38A 2I9EA 3G3DA 4O13A 1GVFA 3P82A 5DCEA 1E51A 3TQVA 4UR8A 3NL2A 4TR9A 3N3MA 1IIGA 4CCDA 4CQ9A 2FJKA 3N2MA 3A22A 5LNRA 3W1AA 4R53A 4FNSA 1SR9A 3FYPA 3GAYA 3S1WA 3QW3A 3YPIA 1KM5A 2A4AA 1B9BA 4TMBA 5LNSA 1A50A 3GYEA 1A53A 5K4ZA 1ZHAA 3IGUA 3WJWA 4Z0SA 4JTEA 2ZZ2A 2HS8A 1PV8A 1EB3A 4JTSA 3TSDA 2CU0A 1WYIA 1VCFA 1JCLA 4CQAA 3LCIA 3FEMA 3UPBA 4MYAA 5MHBA 3B05A 3HOJA 3RU6A 1SZEA 1EPXA 3ABSA 4UTTA 1JCMP 3KAOA 1FXPA 3IVSA 1OX5A 4O54A 2UV8G 3BLFA 1OFPA 3SGZA 3I6RA 2J9XA 3CC1A 3EKLA 5HJLA 1MEIA 4HNTA 4JTJA 4NU7A 5DCDA 3A5FA 4O53A 3I7QA 3MBDA 1DBTA 3GKFA 1LRNA 2CLFA 4M6QA 1QCWA 2DZTA 1TTIA 3LHVA 4UC5A 2DP3A 3AO0A 3NQVA 1GVQA 1XCFA 5G1TA 5SWUA 4AHQA 1VQTA 1NF7A 1FDJA 2RFGA 4RX0A 1CI1A 3QEZA 4UFLA 2X30A 1KFBA 1RD5A 5LHFA 5HR6A 4JYFA 3LHYA 5C54A 3PBWA 4JS3A 1VPXA 2A2IA 2Z6JA 2GQ8A 1ICPA 1I2OA 3W07A 1O5XA 3GDTA 4TMCA 2G96A 4LOCA 5EKYA 3L0KA 3W7NA 3S6DA 1AG1O 4O11A 1EX5A 3GAKA 3ZWTA 1TV7A 1DORA 3P84A 4HHPA 3WK0A 3IIXA 1AK5A 4E2DA 1LM1A 4LC6A 5AYZA 3G0SA 3QPYA 4N02A 4PCFA 4OV4A 4FX6M 4O17A 2W0UA 2EF9A 2PE4A 2E1DA 3CPRA 3W74A 7TIMA 1VYRA 2AAMA 3N34A 4CQ8A 2A7PA 5J5RA 1VRDA 1GYNA 4Y90A 3NQ8A 4GUGA 3T4CA 1QMLA 2V2CA 4IMFA 3KHJA 3M44A 5G1YA 1HTIA 1JCNA 2C0AA 4O1BA 3P8IA 2DZUA 1H5YA 4GWEA 1HL2A 3M16A 1OFRA 4Y8FA 4MKNA 3QRHA 2ISSA 1H7RA 3MP4A 3E96A 4LTSA 4O12A 3TC6A 1TQXA 3R2GA 3TDFA 3DFQA 4K36A 3TU9A 5F2IA 5CZ0A 5D2WA 1F73A 1VYPX 4N2YA 1W3TA 4JEQA 1PHWA 4H3DA 3CWOX 3GDRA 5BMWA 5K2ZA 2ZZ4A 1JCYA 1X7FA 5BW6A 4JTUA 3W75A 1EWEA 3PS7A 1KTNA 1L6WA 5HWNA 2JGQA 3LHUA 1TJRA 1RQBA 3B4UA 3EX4A 1YPFA 1SSGA 1FXQA 3BLEA 3C56A 1FWWA 5DELA 1W37A 4IPIA 1YPIA 1FQ0A 1DQWA 3CHVA 5I3IA 1KV5A 4LS0A 3L5LA 5G2WA 3RLVA 2NV1A 2ZA2A 2ZRUA 4N6FA 4NQ1A 2DJXA 4M5PA 5BRBA 3TFCA 3EWWA 1W54A 2E6FA 3ELFA 3IVTA 4N9BA 3EX3A 1LZOA 3BARA 5KSWA 3DXIA 3MP5A 5EMUA 3RF9A 2NWRA 3W1LA 4YCPA 3LGEA 1M5WA 4U28A 1FWTA 3W87A 1VYSX 3BK0A 3C2VA 3M5ZA 2VEKA 3W1MA 4BI7A 4WY0A 3UD6A 1TQJA 3MHFA 5D03A 2TRSA 4BI5A 1LTDA 5CSRA 3NM3A 5FF2A 4M19A 2RHGA 4K37A 1J5TA 4IXXA 1BWKA 3FJ6A 5AOUA 1GVSA 1PS9A 3GXPA 2BXVA 1EUNA 4GUHA 3LXBA 4FX8A 3ZWSA 2JKPA 3LDVA 4CCEA 1TPDA 1G7VA 3DFPA 2TYSA 4BFAA 2Q8ZA 1HFBA 1KBIA 4IGHA 4LRSA 4S2CA 3EEGA 1FX6A 1R2SA 2QCCA 3W70A 2FTPA 3NGJA 4JICA 4JIQA 1MSSA 1XUZA 3LB0A 3LCGA 3TKFA 1DQXA 4MJMA 1H61A 1MO0A 4C1KA 1DV7A 4JGDA 3HPXA 3C2RA 1C9DA 4GNJA 4HPXA 3WK1A 3IVUA 1OF8A 3TAKA 3FLUA 4Z1AA 4XTIA 3DFNA 5BNKA 4UTUA 3TMQA 1FDZA 3TA6A 4N4PA 1H7NA 4X22A 4AEOA 4ICNA 4ZZ9A 1XL9A 4O0KA 5FF3A 5U7SA 3TIMA 2Y70A 5LSMA 1OFBA 3HGRA 4Q32A 1LYXA 1BWLA 3PSVA 4JD4A 1R47A 1SZGA 4FHAA 3WJSA 2VFGA 1LBFA 1RR2A 3GB6A 1VH7A 3TV8A 4Z08A 3B0PA 1YYAA 4IMEA 4OU1A 3N73A 3Q2DA 4POCA 5EYWA 4JYDA 4OBTA 4CLMA 1OK4A 1L6SA 4ADTA 4J9JA 3W2KA 1G4EA 4QQ3A 3B8DA 3M41A 1BKSA 1O4UA 3IIVA 3G1SA 5C5YA 3GNDA 4MZ1A 1W5NA 3IEBA 4QITA 2ZRWA 2AGKA 2BSLA 5CZSA 1SSDA 4KFNA 1FCBA 1TV5A 3I68A 2X1UA 4LVAA 3QQ0A 1BEUA 3MI2A 3TMLA 3CIXA 3NQEA 4RK8A 4NX5A 1OVDA 3AJXA 5I3KA 3W1RA 1KM2A 5DBTA 4LWWA 4FEZA 3HG4A 4UTTC 1DHPA 4A2SA 3W7PA 2C1HA 2ABAA 1O60A 4LVBA 3MHGA 1W5PA 2BLEA 4TU1A 1W3NA 4PC8A 3W2JA 4JY9A 4PL1A 4R7JA 1K8ZA 4JTLA 2ZBTA 1A5CA 4PTNA 4Y96A 2J24A 1OFEA 4WOQA 2V82A 1OFQA 3TSMA 3WJZA 4JIPA 5G2IA 3O1NA 1S3HA 5K9CA 4W9TA 2QCFA 4IMGA 2A7NA 3FIGA 3EX6A 4GBUA 1MXSA 5D37A 2ATMA 4N9CA 3L67A 1P0KA 2QDHA 3NZRA 3TAOA 4EVZA 1W5QA 3HPSA 3SR7A 3LM7A 1XUUA 3GK0A 3D0CA 1TPFA 3B06A 4ORIA 1VCVA 3DU0A 4KKXA 1KM1A 1RQHA 4AWSA 3R5EA 1G4PA 5K9DA 5AYYA 4O8RA 5J5DA 3KRZA 4G1KA 3SW6A 3TW7A 1K8XA 5F1VA 3BO9A 4BWLC 2LLEA 3USBA 3VFLA 1KFEA 5D38A 1M7PA 1M7OA 3QMRA 2A1YA 5EL1A 5G5IA 1ME9A 1QAPA 4YXGA 3HIJA 1IIHA 3L9CA 4GFSA 5HR7A 1TRIA 3ATYA 3SY5A 4OWGA 4FNPA 1RVGA 4FIRA 4I7UA 3IGXA 1LOLA 1EWDA 3PULA 2BWGA 3W23A 3JRKA 4LY8A 3P81A 1OG0A 1Q3NA 4IMDA 3B0VC 5DN1A 2C3ZA 4NX0A 1LORA 5D33A 2W6RA 5TIMA 3UWUA 3HG5A 3BVJA 3HGJA 4WOZA 4IWWA 4QM1A 3THAA 1PL9A 3MWAA 3PWAA 3UWYA 3W7QA 1TTPA 1LCOA 3LTPA 1VHNA 4HN4A 2C6QA 2B4GA 2O7QA 4XBSA 3W2NA 3LLDA 4PH6A 1NFBA 1WBHA 1ZFJA 2V81A 3LBCA 4RV8A 2FFCA 4MPQA 5KITA 1EIXA 4JYEA 3TE9A 3PBYA 5K9XA 1QPRA 3W7DA 3NDOA 4UTJA 3VE7A 3S5ZA 5H2ZA 3M7WA 4LUIA 2ZCGA 3G22A 4LS2A 3NVTA 1YXDA 2YZRA 1I2RA 3EB2A 2OX1A 1O94A 5CZTA 3V1PA 1J4EA 3N19B 3P5YA 3G0UA 1GJPA 3S9YA 2J27A 2ZZ5A 1FWNA 3NM1A 2WQPA 1TIMA 3BGGA 1JJKA 3H54A 3W9ZA 3DENA 4TIMA 4IX2A 3W1QA 4FNTA 3G18A 3HJZA 4I9AA 2E6YA 1K8YA 4K39A 3KVKA 3E12A 2F7FA 2V5LA 4O14A 4QISA 3DZ1A 1GYLA 3PUOA 1WV2A 2DZXA 2OCZA 3GXNA 1TRDA 1G4SA 4WXYA 1CX9A 3DHFA 5AC6A 3ABQA 3MHUA 5AYXA 4S2BA 2H8XA 1ZAIA 1IXNA 4NJIA 1YADA 5AFDA 4O57A 2Z0IA 3OVRA 4IJBA 3UXDA 2CZ5A 3NQ7A 1H1YA 4JX6A 4OQVA 3TCEA 3NQ2A 4Q4KA 1WOBA 3QSRA 4GC4A 3TQKA 1WXJA 3CEUA 5CPOA 3WK2A 3MBFA 3O6DA 4AAJA 2CW6A 3LTSA 4NVTA 1PCKA 2H90A 1I2QA 4JX4A 5F4WA 3BPWA 1H62A 1KM6A 1K02A 3DGRA 2RH9A 2PC4A 2H3BA 2O7SA 2ATSA 3EWBX 5AHLA 1PHQA 5G4EA 5L6UA 1JCJA 4MJZA 2PRMA 3LCHA 1QWGA 5E0KA 4DQWA 1GT8A 3A9IA 4E0CA 1S5WA 2HTMA 4AHOA 1IXOA 1ICSA 1LRTA 2CLIA 4GE8A 1Z48A 1TV8A 1K7XA 2NUXA 3PG9A 4DPPA 1S5VA 1H51A 3NA8A 3A5VA 1V5XA 2VKZG 3WJYA 3EWXA 3W83A 5CZJA 1UCWA 2X16A 4HNVA 3OIXA 4ZQOA 4L4LA 2VELA 4UFMA 1KFKA 3UWZA 2YCEA 3NYZA 1ZAHA 2X2GA 1KFLA 4OT7A 1OFAA 2Y6ZA 3G0XA 1L6YA 5TBOA 4EIVA 4HIBA 2JGYA 3PAJA 2J9ZA 2NV2A 1P1XA 3LI0A 3OEXA 4QNWA 1R46A 5LGZA 2Q8LA 4BWLA 2NX3A 2A7RA 1J2WA 3VNDA 2QDGA 1MEWA 1ZALA 3P74A 4RZ6A 3P62A 4JXCA 5AB3A 4FO4A 3O6YX 2WNQA 4M6PA 3P60A 4ZQRA 2VC6A 3EKZA 3MYOA 5C6MA 5KZEA 4LRTA 3M0ZA 4Y9AA 5FI8A 5LZLA 5GVJA 2OZ0A 4EOUA 3MMTA 2B7QA 5D32A 3L5AA 3W7JA 4DF0A 3G24A 3CU2A 1TO3A 5DXYA 4IX0A 1T96A 3G8RA 2WKJA 4DELA 2ISWA 3GKAA 1SZNA 3MUXA
chains in the Genus database with same CATH superfamily
3QY6A 1FUYA 2Y5EA 4AZ6A 1T5AA 5B7YA 3K30A 1Q6DA 1V6TA 2BHZA 3STEA 3UJRA 4WZHA 1W3IA 2GJXB 1HL9A 1O68A 4YMZA 2F6XA 1KRCC 1IGSA 1SW7A 2V68A 1GZ1A 2CLEA 3TJXA 1K9FA 3PC0A 3SFKA 3ZLGA 3CPUA 2GGGA 4TTGA 6REQA 1NSJA 3QXBA 2PDNA 4DWSD 1I45A 5BRQA 2P10A 4Y9OA 1HL8A 1B54A 3ZVIA 4L1GA 5AHEA 3BAWA 2WCSA 3GNPA 3ZQ9A 4MB1A 4GFIA 3FKKA 1OX4A 3VGGA 4O15A 2DIEA 4TUFA 1U5VA 8RUCA 2YB4A 3M5XA 2YXXA 2INEA 4C1LA 3VE9A 3VD3A 3AFBA 2Q71A 4INFA 4M6VA 2FH6A 4OJYA 4DO5A 2GJLA 1MW1A 3SN0A 2DSZA 5CBJA 4ADUA 2V5DA 1ZLPA 3QBUA 4BK9A 2XZ9A 2DSWA 3F1QA 4GYKA 4KWUA 2ZDRA 1O1ZA 3SAZA 4EF9A 4WSJA 4CNOA 1WOAA 1LBLA 1EJXC 3CK5A 2QS8A 1E55A 4ZR8A 1NDZA 2RDXA 1BRLA 1F6KA 5AY7A 3FFSA 3P93A 5JIPA 1TFVA 4C1NA 3E0VA 3NIYA 2V6AA 2OSYA 1XIGA 3TZFA 1Q65A 3K1GA 3GTNA 2WMHA 4CVWA 3OA3A 4ZO7A 4GO9A 1HKWA 1B2YA 4RZ5A 1IV8A 1FCVA 3KX6A 5A2AA 1V0KA 2Y8UA 3UQNA 1LLZA 3CHCA 1P5BA 2PSNA 4MFDA 1YX1A 4UQDA 4B91A 3BG9A 2DH2A 4TX8A 1R9YA 3EWDA 3FOKA 3PTKA 1ZNNA 2J9YA 4FLSA 5A8PA 2NXIA 3EOUA 1MQPA 1B3XA 4ONVA 4P7LA 4A21A 1GPWA 2ZZ7A 3LMZA 3O15A 3RJXA 4U4MA 3VX0A 4MWAD 2XH4A 4ZQNA 3ITVA 1R3VA 3BZGA 3W1TA 4MZ8A 1FBAA 4KIRA 1HJXA 2QCDA 3OG3A 2PMQA 3T2QA 2Q3OA 1DE5A 2CZFA 4HPJA 5CPMA 1XBYA 4KWVA 2I5QA 5FJTA 3NDYA 2GUYA 5CH9A 5KZDA 3OBKA 1NDYA 2D2OA 3Q45A 4NZ1A 3NURA 3A9BA 3LSBA 3V75A 3ZM8A 2JFEX 1ZENA 4A2RA 3CHEA 1F61A 3M9YA 3W25A 4DZHA 4MLRA 1JZ7A 4XZ9A 3OQEA 3NPWA 4ML4A 1IWAA 3AHVA 3S6OA 1CLKA 5CGTA 1FWIC 1G7UA 2VC5A 1XFBA 2E5CA 3NEVA 1ISWA 2PTXA 4WHBA 4Q8PA 2B7PA 2XN0A 4L6DA 4RW5A 4J3TA 3G1YA 3QKEA 4LUSA 4LAKA 3H4GA 3RU8X 2OGJA 3PTMA 3EMZA 1X1ZA 1X7IA 5JH1A 4AVFA 3G1DA 4A8IA 3N13A 1FH9A 3G1HA 1QPOA 3NSNA 4JFWA 1DOSA 4WKAA 4KCUA 4FLOA 3GVWA 1DJQA 1FWRA 2R82A 3BSGA 2VD8A 4QG9A 3I7RA 1QK2A 3IGSA 1S1PA 4Q7NA 3W7RA 3EMCA 3PG8A 1SW3A 4LPCA 3ZT5A 3ANVA 1QHOA 1H7XA 4JEJA 3PZMA 1S3TC 1TMLA 4LUTA 3CAKA 1MYRA 3MWCA 4QDMA 1M53A 3EX2A 1OFDA 1NVMA 3S1VA 1J12A 1QPQA 1B1YA 3BMWA 1RBAA 4LUJA 3TZNA 3CH9A 5HUOA 2FPTA 1LG2A 3AMDA 3ARUA 5TQLA 4QG6A 2IQTA 4JIEA 5HMFA 1FHVA 1SMDA 4QAWA 2NLIA 3QKZA 1WUFA 3N11A 3F2CA 3T0DA 5LA1A 2PTZA 3WELA 1BG9A 1VFOA 2P76A 1S2WA 3DECA 2DY3A 4O19A 3V18A 1BTMA 1ZJIA 3N4AA 4IIBA 1UP0A 4NZ4A 2D22A 5AZ0A 2PLJA 4S3EA 5EBUA 1CXKA 1EXPA 1RA0A 4HK6A 4YWIA 2P0IA 3OVQA 3W53A 3QHNA 4RXGA 2EPOA 3CZEA 3IARA 3L4VA 3VOHA 4U5KA 3UGVA 2Y7GA 3REQB 3LUTA 1SW0A 4MUZA 3URQA 1DJNA 3CUFA 5CEWA 1DIOA 4Z2GA 3TJIA 2E5BA 1B3YA 4B5NA 3BICA 3A64A 3QHOA 4EP8C 1QI5A 4N6EA 3A21A 2D73A 1E4IA 5CG7A 3WK3A 1FKXA 3LNMA 3OG2A 3W7MA 3W86A 5HNTA 4RNIA 1RH9A 1DL3A 1GOKA 1TJPA 4AH7A 1JZ8A 4MDOA 3BV4A 1F07A 1P6CA 2BGNE 5CGQA 2WJEA 4RDVA 4S1FA 3GXMA 2BHYA 2DVXA 1Q6QA 2DGAA 4AWUA 1QUMA 1A49A 4CD4A 4KWWA 3WJXA 3P0XA 1QI0A 3UZ5A 3VCRA 1JZ5A 2FVKA 3TH6A 2PDFA 3GUWA 2OB3A 3L66A 3CZGA 2ZA3A 5CSSA 3NNTA 3S46A 4HN8A 4U2YA 3T4WA 1TV2A 4AISA 1XSKA 3IUHA 2OR2A 4IISA 3TOYA 1FCQA 4L5ZA 4XTDA 3GIYA 8CGTA 3KRUA 3UJ2A 3B03A 3FGCB 4Y7EA 7REQA 1YQ2A 3TC3A 3TN3A 3WLSA 3G1AA 3VIGA 2DDXA 2FZMA 1JZ6A 3B9AA 3U6WA 2C13A 4UMCA 1KQZA 3FHQA 4RE3A 1WBJA 1T6MA 3AIBA 1JFXA 4HOWA 1WQ5A 3CH0A 3N6JA 5EMMA 4P8WA 4BF7A 3T07A 2RDTA 1CWYA 4NAEB 5LNUA 1MRAA 2CLKA 4IL2A 4BI6A 5LIUX 4OBRA 1UJPA 3ARYA 3UJSA 2FDMA 1IHIA 2F2KA 3S8HA 4ZE5A 1FDYA 3QMTA 1RJRA 4GNKB 1LLWA 2DZPA 2ZRZA 3W2LA 1ZJBA 2FZ8A 2QCHA 1CT5A 3L7RA 3MV11 1SU5A 1TMHA 1UASA 4AEEA 1FWJC 2FHBA 3W2MA 5A6BD 3L4YA 4HJFA 4NHVA 1F7BA 1EA0A 5XIMA 3M47A 4AF0B 3O0FA 3EOSA 3WF3A 2NQJA 1ZJAA 4ZOBA 3LGGA 1PX4A 1M7JA 3ITOA 3OLDA 4WRHA 3T1GA 1PEZA 1OD0A 1HXJA 2A3HA 2C71A 3W88A 3AZRA 3WNMA 1XCXA 1XLDA 3QM3A 1V0NA 1C93A 3O63A 4ZOCA 3TSBA 2ZRYA 4MOZA 3O2LA 3AMLA 5DXXA 2J8GA 1HKIA 3H4WA 4K7YA 1OINA 3QJAA 1K4GA 5A5WA 2QNEA 1C29A 4DHGA 4H8NA 2VR5A 3CV7A 1EQCA 4RV3A 4ACZB 4WSKA 5EA9A 4R3UA 2P8BA 3MW7A 2PDHA 3H12A 4L4MA 4NNAA 4QJ1A 2FKPA 1PWLA 3V5OA 1NWRA 3QF0A 1F2JA 1M6JA 4HYRA 4JTGA 4LNYA 1TTQA 5CPNA 2A3LA 3CZLA 4TV6A 1XRFA 3ABXA 2DORA 1MDLA 1BYCA 1MUCA 4TTUA 5FJUA 2YCKX 5D04C 1W9VA 2EG7A 2VR4A 4IIHA 3WDIA 6TIMA 1RJPA 3D3AA 1W1IE 1NELA 2BV9A 3VGBA 2PF0A 5HUPA 2PLMA 1F6YA 4E4UA 3ARTA 3E2SA 1FHDA 1QNRA 2ZFAA 3DESA 3EXRA 3PK7A 3VI2A 4UNKA 1KM0A 2DZAA 2Y7FA 4RKAA 3QQWA 2X8RA 4H9XA 2R8WA 3M46A 2OKOA 5F4SA 2ABBA 5FACA 5FA5A 3B0UX 1X6LA 8TIMA 3ZVHA 4XZIA 2J25A 4B5SA 3C6CA 3CO8A 4HA0A 4H00A 3GDMA 3DFSA 2BVTA 3W82A 4EANA 2FHCA 4K8HA 4E8DA 3C0JA 3AXKA 1ECEA 4IXHA 3HV8A 3ITXA 5EY5A 3WQEA 4O0QA 1EF3A 3ANYA 2DT1A 3NQCA 4R88A 2P50A 4PEEA 2BOEX 1KW1A 1DXFA 4UB9A 3OZPA 3O9NA 3B8SA 2YL5A 1CECA 1AZ1A 1XLMA 3OLIA 4FS9A 5DEZA 4ERGA 1TSIA 3EPNA 4BS0A 3NOEA 2R9RA 3ZS4A 5I77A 3QGAC 2REQA 1R3WA 2X40A 3E0IA 3WQ8A 1Q7QA 2CIPA 4AIBA 4QLKA 1XGDA 1PB0A 2G3NA 4M80A 4DO4A 1O12A 1ZBCA 3QSTA 1YXCA 1L8PA 3CTLA 3GG8A 3M7SA 1Y7VA 1G69A 3SN4A 3PR2A 4H8VA 1DHKA 3GR4A 3NUKA 4M7TA 1ITXA 3IJ8A 4ZQCA 5B80A 2YDSA 3CIWA 5D9MA 5A6SA 4BEQA 4BA0A 3P5ZA 3TA9A 3W1UA 4CN4A 1JL8A 5M3WA 3NZ1A 3FN9A 2Z1BA 2HROA 3NL5A 2YZ5A 2XVPA 1UQZA 3C0LA 1QW9A 4MADA 5ABGA 1YIXA 2XINA 2YYUA 3VIPA 2OMAA 5EU9A 3PB0A 2YFNA 1BXBA 3FJLA 2YL8A 1M9HA 2VWTA 3MQTA 2NQ5A 1OFOA 5I03A 2BS9A 2GQ3A 3FA3A 3WH5A 3QC0A 4GPNA 3RR1A 3A3XA 4MFEA 1GPFA 3AJ7A 1VEPA 1DXEA 2CLMA 3AWOA 3TTSA 2VVNA 3P67A 3U57A 4YHGA 1XDLA 4ZQPA 3IJDA 2WPGA 2QJIA 4XAPA 2R1NA 1GEQA 2I16A 3FNDA 4M6UA 5D09A 1ICQA 2W61A 4OV9A 4B3ZA 1YEYA 3MP3A 4DAFA 5FESA 2OZ8A 3U0HA 3EOLA 2INZA 2BB0A 4IP5A 1V6VA 4JTFA 1ONWA 4FOJA 4AZCB 2HVMA 3TP4A 3PF3A 1TPC1 3UZJA 3FYOA 2BTMA 2R1LA 2PS2A 2WVTA 3DKJA 3U9IA 3O16A 4M8UA 5F2MA 1DWJM 5JUVA 3CAQA 4DBSA 3QR1A 2NLYA 1XV8A 3GXFA 4JIHA 3BH4A 1GW9A 1XG3A 4RLIA 2A3AA 1XHGA 4NJKA 1Y5WA 3BGAA 1KA9F 3GNOA 4I6VA 3F5JA 4K8EA 1QNSA 1JIBA 3LENA 1LWJA 1KCLA 3WL0A 2DPEA 2QUUA 4IPJA 2X41A 1KR0A 2NT1A 4DI9A 1HJUA 5J04A 1OJXA 3W81A 1X6NA 1VAHA 3WN6A 3I4KA 4JTKA 2XN1A 4QE1A 2RDUA 3Q67A 4OE7A 1GEHA 4JTIA 3T05A 1UH2A 4GX9A 4QNEA 3KW3A 2QJGA 3R0UA 4XAYA 1FH7A 1Z69A 4DWDA 4NL1A 3A24A 2PP0A 4C6EA 3SGUA 4J2MA 1Z41A 2OQLA 3UR2A 2NVCA 3QTGA 1WZKA 2XVLA 1E6PA 3OVGA 1CLVA 1A5NC 2TAAA 5DY2A 3TVAA 3W71A 3CYJA 3P7YA 2PBOA 4DO7A 3RUBL 4IZGA 3WD0A 3B8VA 4W4QA 2JKEA 3STGA 1NQ6A 4JHOA 5EFFA 1FFRA 3G2GA 4FNUA 5G4HC 3UZXA 4JR5A 3PZIA 3LHTA 3SN1A 1SFTA 4KEUA 4HHLA 1UOKA 4QRNA 5M1TA 3L12A 1XI3A 5CQ1A 4LBRA 2WNWA 3LHWA 4PRRA 4X9SA 3S5NA 1K77A 1Z42A 4GNVA 2I9EA 4CD6A 3WFZA 2J7GA 4O13A 2YLAA 2CBUA 5HPOA 1F3XA 1E51A 1NFPA 3SCWA 2PWFA 4TR9A 4CCDA 1Y5VA 3QFWA 2XYLA 3N12A 2DFAA 3N2MA 1FWDC 1QT1A 4FNSA 1SR9A 3UA3A 3S1WA 3QW3A 3OQ8A 3EDJA 1I9CB 3GYEA 4K2SA 4UNIA 3UG5A 4WKFA 1TR9A 4WGXA 4Z0SA 4MWAA 4PMJA 2ZZ2A 3RX4A 1CGYA 1EB3A 4JTSA 3TSDA 2CU0A 4K1GA 3PFMA 1L6FA 4CQAA 3H2CA 3LZ3A 3B05A 3WO8A 4HU3A 3RU6A 3CAWA 2V69A 2YCLA 2GDQA 4AW7A 3WQ6A 4EXAA 2Y8KA 3BLFA 2O9PA 3I6RA 4L6HA 2J9XA 3EKLA 3A3HA 5HJLA 3GH5A 4GK8A 3A5FA 3ZSTA 3I7QA 3GFXA 3C86A 1GYMA 1LRNA 2CLFA 4J3ZA 3LHVA 2JQXA 4B5TA 3LN3A 3B40A 2PWUA 3NQVA 3LGDA 3MSYA 4P7NA 4XZNX 3AUJA 2DSVA 1VQTA 1NF7A 1FDJA 1AMYA 3PZQA 1KBKA 1EGZA 3HA1A 3WYZA 1CI1A 2OSWA 4UFLA 4R7WA 1BPLB 1KFBA 1E40A 3UCDA 3LHYA 3SUTA 5A6KA 4YWSA 3DN5A 4YYCA 1J2BA 2Z6JA 3BOXA 1I2OA 2WB5A 4L56A 4DZ5A 2GDVA 4QEEA 4TV5A 2G96A 2DVUA 5EKYA 4GVIA 3L0KA 3SRKA 3VIHA 1E43A 2WANA 1HT6A 3P84A 3SCTA 5I06A 1S1RA 4XB3A 1ZS2A 4E2DA 3N29A 1E6XM 4ES4A 2OO0A 3SRDA 2HISA 3QPYA 4N02A 3E0WA 2W0UA 1W3LA 2PE4A 2E1DA 3VD5A 2F2HA 4JCMA 3W74A 4H8HA 4CQ8A 2A7PA 1KRMA 3VMNA 2P3EA 3VIKA 4W5UA 2X09A 3NQ8A 4GUGA 4HD5A 3T4CA 2V2CA 3KHJA 2QMKA 2G37A 3TTOA 1TA3B 2DZUA 3N4FA 4C60A 1ZBKA 1HL2A 1OFRA 1H7RA 5CG0A 4GZEA 2J7CA 3MTWA 4HMNA 3TU9A 5D9NA 5MKGB 4PCPA 4DYKA 3QVQA 4PUWA 4N2YA 3EKGA 1E56A 3N2TA 4KMQA 5K2ZA 2QV5A 1JCYA 1SJBA 2QV4A 4JTUA 4ATWA 1EWEA 1KTNA 6ENLA 5JIWA 2PGRA 4L4OA 5HDRA 3LHUA 3EX4A 1S5MA 2O0TA 3C56A 1C8XA 1VIWA 5DELA 3GNXA 1V51A 4IPIA 4PMQA 1UZ1A 3MDUA 1N8WA 3OA5A 3VOJA 1J11A 3AXIA 2ZA2A 1BD0A 3U4AA 5BRBA 3TFCA 3IVTA 4N9BA 1X38A 3EX3A 1LZOA 5KSWA 5EMUA 1HKJA 2NWRA 4JCLA 4QJ3B 4FLRA 3LGEA 4DY1A 3CAVA 1HX0A 4U28A 1VYSX 3KTSA 3BK0A 1VFTA 4F40A 4Q7IA 3MPGA 1TQJA 3MHFA 4Z2LA 1R7OA 4BCEA 3NM3A 4YTQA 1UWAA 4O8AA 1BWKA 2XTKA 4H04A 3GUGA 1A80A 2VZTA 1PDYA 2BXVA 2R24A 1EUNA 4ENLA 2D2HA 3W01A 3DFPA 3VDAA 2BP1A 3EEGA 1R2SA 5GJPA 2FTPA 4JIQA 3NGJA 3CUZA 1PKYA 1J6PA 1XUZA 1E73M 3ZLFA 1DQXA 3U7VA 1H61A 2E9BA 1C9DA 2PZ0A 1K6WA 1FWAC 2VDIA 3WK1A 4DXXA 1IWPA 1OF8A 4PE8A 2PWDA 4L1XA 3FLUA 4QSFA 3WBYA 4PR4A 1R9XA 1FDZA 1XLLA 3R8GA 4E2OA 1JYNA 2X0YA 3MVIA 4ZZ9A 4O0KA 2WYSA 2Y70A 3BLPX 3HGRA 4JTCA 5A69A 1A4MA 3HZ3A 4B3LA 3UJFA 3DG7A 1SZGA 2DVTA 1LT7A 4ACYA 4S3FA 4L6OA 3I3BA 1CZ1A 3DHUA 1KD0A 3TV8A 4I5XA 1E15A 2A3EA 4PBFA 3BL3A 4KEZA 4IP4A 3L4UA 4O1EA 3WKZA 4POCA 1BVNP 3OW1A 3M0KA 4REQA 5IFTA 1L6SA 4J9JA 1G4EA 1A5MC 1OT2A 1QHPA 4GYPA 8XIMA 1GKQA 2IKHA 1UMYA 5A6BA 4MZ1A 1KO0A 3IEBA 3KBNA 4QITA 4MWAC 4YNGA 2WHKA 4QG8A 4KFNA 2X1UA 3MUCA 3QQ0A 4DLFA 3C0QA 3GG7A 4X0NA 2V38A 3CIXA 1J5SA 3NQEA 3H2MA 2Y2WA 5C8BB 1TVLA 1UBPC 3GVVA 3ARXA 4FEZA 4A2SA 3W7PA 4JZ5A 1BXCA 4AFYA 1O60A 4ECLA 4TU1A 1OSEA 1GOOA 4J27A 1CXIA 4PC8A 3W2JA 4JY9A 1TX0A 2CHOA 1K8ZA 4PTNA 5I00A 1A5CA 2J24A 2IKJA 3KTXA 1XYZA 3WSUA 3O1NA 1CDGA 4IMGA 4Q8QA 3FIGA 4FK9A 4GBUA 5HNUA 1MXSA 3TEVA 4S3KA 2ATMA 4N9CA 5EB8A 2R1MA 2PD5A 3NZRA 1TJ1A 3KZPA 3TOPA 5I23A 1W5QA 1ZTVA 3OB8A 1O1HA 3B06A 1AH0A 7A3HA 3SCNA 4Z17A 4KKXA 2Z24A 1XX1A 1MFUA 4PTWA 1UKTA 1NDWA 2VZOA 5HK4A 1QNQA 1K8XA 2QF8A 4PRWA 2LLEA 5E0FA 1UH3A 3J7HA 1MQRA 4HTBA 4W8LA 3GY1A 4CD7A 5A8NA 3VGFA 4US6A 3BLDA 4YXGA 4GFSA 5HR7A 1V08A 3DDMA 4OWGA 3CHFA 3PZUA 3QR0A 2WVUA 5FJPA 3IGXA 1LOLA 3PULA 3AHZA 3B0VC 1XLHA 5DN1A 1XISA 1KXVA 1LORA 1L2QA 3UWUA 1RP9A 4TVDA 4ZENA 1XH1A 3WDHA 2EQDA 2YCJA 1PL9A 3MWAA 3FXYA 4HN4A 4W86A 3OU8A 1KB3A 4QLLA 4XBSA 3LLDA 4PH6A 3GZAA 5HAOA 2DT0A 1ZFJA 2GJRA 4MPQA 4ZXOA 4C6NA 3MCMA 4UTJA 5H2ZA 3ZT6A 1TV4A 1P0BA 1LQAA 4FAMA 1PTAA 2ZCGA 4LS2A 1IEIA 3K4DA 1YXDA 2OX1A 2E9MA 1W1YA 3G0UA 4Q8WA 4S3GA 4GZIA 1FWNA 3NM1A 2W5FA 2HPIA 1JJKA 3U2EA 3DENA 1CLXA 2B31A 3G18A 1JGIA 4I9AA 4K39A 1FP8A 3AIQA 4PB5A 2F7FA 2OOGA 4O14A 3T42A 4QISA 3B97A 4D6FA 2WLZA 2OCZA 1V02A 2FTWA 3DHFA 2IPFA 5AFDA 4KH2A 2H9AB 2Z0IA 2AL2B 1XLFA 1R6WA 4MUPA 4PCNA 2J66A 3DEQA 1A5KC 4GX8A 1FVPA 4XAGA 3SBFA 3UF9A 3NQ2A 1R86A 4Q4KA 5A6TC 1W9XA 3TQKA 3WMLA 4IIFA 3CEUA 1G9HA 2CERA 3RRAA 1SFSA 4NVTA 1PCKA 3IK2A 3TYEA 1UD6A 1YKWA 4K1WA 5C70A 4NKCA 2Y1HA 3VILA 5G4EA 1IZKA 4HTYA 3FGCA 2WK2A 3NOYA 4TVCA 1IXOA 2QPUA 1GNXA 1MDRA 1K7XA 2NUXA 1H51A 1V5XA 3MU7A 1JZ4A 2AMGA 2UBPC 1UCWA 5BRPA 2X16A 4ZQOA 4HA4A 1I6NA 2BVYA 4CCZA 1HGWA 2X2GA 1KFLA 1L6YA 5TBOA 4EIVA 4HIBA 1Z7AA 2Q8XA 2WCAA 3KOWA 2ZICA 2HZGA 3OEXA 3M0MA 5LGZA 2ZKMX 3UXKA 4PZVA 3H7VA 4FA3A 3SY8A 2PTDA 2W91A 1RLCL 4JXCA 4KGJA 3PP7A 4M6PA 3NZQA 3MYOA 3H2AA 4C6JA 3B9DA 1XSIA 5FI8A 3L4ZA 2OZ0A 4EOUA 1UW9A 2GDUA 4GYPC 4I3GA 1UWRA 4DF0A 1Y8BA 3CU2A 6REQB 3MVTA 3G8RA 3CQJA 4E5TA 3GDBA 4PUJA 2OGYA 3CQIA 4A29A 5D9PA 1PYFA 4XUGA 1TYGA 2E7FA 2OT1A 1FWGC 3B8TA 1OX4B 3PANA 1Q5MA 1Q6LA 3MANA 1MUWA 1OC6A 3G6LA 1EYWA 2WMGA 3W7CA 4EWND 5DMMA 2YPIA 2ON3A 4O50A 3ITGA 4O28A 4IP7A 4IFRA 4F9DA 3IIOA 5AVNA 4NZ3A 3ZYZA 3NAVA 4GXMA 1XW8A 2NUYA 1H4PA 3IJQA 4CNUA 4QR6A 1E70M 1POJA 4N9EA 4GKLA 3MYPA 3LZ5A 4IOTA 4I8YA 4XQ6A 1KXQA 1ONXA 1BRLB 3IIPA 4WD0A 3W7KA 1KCKA 1N55A 2NSOA 2IPJA 1RHCA 3VINA 1BYAA 5LXEA 3TJLA 4GGHA 3ITYA 1JCTA 3W76A 4O1AA 2BDQA 1P0EA 3MKKA 2VEMA 3ARVA 3AICA 4LALA 5BYWA 3W22A 1D2KA 4ADSA 2ZUWA 1SFLA 1W0MA 1VHCA 5B7ZA 2D3NA 3NFUA 5D02A 4AHPA 4TX9A 1A0CA 2X1SA 2J78A 2C14A 3LRLA 1E6SM 2WV8A 3IJ7A 3NQDA 3URAA 2AKZA 1UUOA 3NO5A 3KOYA 4W93A 4DJED 1VZWA 3MA8A 4HPGA 1AJZA 1XIEA 3G1XA 1QWKA 5F1UA 1S2UA 3OZYA 4ZQMA 3RLUA 1SUXA 3RM8A 4JIIX 4MYXA 1AL8A 4X3ZA 1R2RA 1C3FA 4UFIA 4RUBA 5LIKX 1RPXA 1EFZA 4AQLA 1J18A 2HVNA 3M0YA 4UQBA 2Z2BA 4CGTA 2VFIA 2WMIA 3E2QA 5K7JA 2ALRA 4XAFA 1MXGA 5AHMA 3KOXA 4MJ4A 3FSTA 2HS6A 2WMJA 1TIWA 2J62A 1LL7A 3UWVA 1UZHA 1GQJA 3W1XA 1E5JA 2NUWA 1WUEA 2VQUA 6ALDA 5I07A 2C1GA 3GNNA 2RAGA 3OHMB 3VKCA 5FF4A 2GGJA 3VUPA 1L9WA 4O16A 1MWOA 1G1YA 1VS1A 1DTNA 3KVMA 4J2PA 4B2DD 3NXFA 4GHRA 3PUEA 1TX2A 4TO8A 5EBAA 1K7EA 5K3VA 1EUAA 1KNWA 2QT3A 1Q4NX 4QBXA 1NAL1 4X63A 4U2ZA 4LUSB 1QOPA 2P1FA 2ZA1A 3NO3A 2WW5A 4P8VA 1FHLA 3W6YA 4DBEA 5EPDA 3N2OA 5D30A 1W31A 4GGBA 2XIJA 1P6BA 1JXJA 3F4NA 1PCWA 1TPVA 2HK0A 2QUMA 2ZVRA 1TB3A 1YW1A 4OKDA 3CTTA 1IQ8A 3FHAA 2E6AA 2YLLA 4AZGA 4F0MA 3L0GA 1HO4A 4D6IA 2J6VA 3OHIA 5HATA 3I3DA 4RCXA 4E2BA 1TPH1 3I65A 4TQTA 1IZCA 1HG3A 3S1GA 1BVWA 3THDA 2W79A 1R85A 1H50A 3S1XA 4BEUA 3LK6A 2BXYA 4HYWA 2WKLA 3KVJA 3PSWA 4IHCA 3H53A 4JKKA 1H1ZA 5AHNA 1ZZMA 2KZHA 2H8ZA 3QYQA 1XLJA 2VFDA 4GUIA 4DF2A 3WNOA 5A8QA 4HT3A 3U5UA 2QCGA 5DMNA 1BYBA 4CUCA 3ZR4A 4LYPA 1F05A 3R0KA 3LXCA 4B9YA 1FWFC 1IXPA 5C9RA 4C7GA 3UR8A 1NIUA 2QLYA 4Z1BA 3MI6A 3UCCA 4GC3A 1FCUA 1XDMA 1Q6FA 2E6DA 3LYEA 2X1IA 3TLQA 5IHSA 5E1QA 4OOUA 3C61A 3W02A 1S2TA 4ZTYA 2V5KA 4LYRA 4NILA 1ML1A 1KC7A 4BHYA 4CCCA 1HGYA 1RJQA 4UZSA 3L2IA 2NV9A 4IQEA 2OU4A 4F0KA 2H3DA 1ZY9A 3LI1A 4B3KA 5FEWA 1CPUA 4JN6A 3UWQA 3F03K 4NUWA 2OZ3A 1HQTA 1E9IA 2HE8A 3R1ZA 2WKGA 3NQAA 2ZDSA 4UOZA 2VENA 1S5TA 4BQ5A 2PDPA 3BAXA 5LHEA 5U4NA 1HP5A 4PULA 1LQ2A 2GQAA 1GKPA 3N2XA 4RPQA 3A12A 2WC7A 3ITLA 2PWGA 3SJ3A 1ODUA 2ODOA 1P48A 3N2CA 1PKMA 3EWUA 2GQ9A 4KW2A 5AC7A 3UJEA 3R8RA 4AY8A 4U31A 3APYA 3PBMA 4HNLA 3MZNA 2ZX9A 4NASA 4GH3A 3KOFA 5AYBA 4A3UA 3ZIZA 2JEQA 3NQFA 4P8XA 5HULA 3KL3A 3O7UA 1ZP4A 3QN3A 2ZRXA 3AZTA 4DX3A 1ALDA 2X1RA 3OGRA 3DKLA 2QYGA 3F4DA 3R10A 4H6EA 1YXYA 3BCDA 3ORWA 2QGHA 1PYMA 2FB3A 4MNLA 2PCQA 2VDGA 4W88A 3ARPA 1QO5A 4JDBA 2G97A 3CL7A 2I1OA 3O05A 4NF7A 3U2OA 1GZJA 1D7KA 4NXKA 1JULA 2CWXA 5HNNA 5EMKA 1XQKA 3AS1A 3WLTA 3WEOA 1R5YA 1ZL1A 1DTUA 1NOWA 1PAMA 1KGWA 5HWMA 1E9YB 2BY3A 3ARWA 4S3DA 3KE0A 4HP5A 3G1FA 1O5KA 1N2VA 4DM2A 2EPLX 2PU0A 4PUUA 2CWNA 4MNJA 4BF9A 5CPTA 3G6MA 4HNUA 4IG2A 2OEJA 2A6LA 1WDWA 1WDRA 3QY7A 1QVBA 1EKOA 3MUIA 1XDJA 3ZOAA 2G4JA 3OO2A 1I0BA 5BMXA 3Q58A 1P0NA 2YDQA 2QCMA 1JPHA 4MLJA 3A23A 4KF1A 3MMWA 3LTYA 4JNYA 1NOFA 1VFMA 2I17A 4I7VA 4FB7A 1BXNA 3G1RA 1U1UA 5A95A 2BXZA 1CW2A 1QI2A 3EXSA 4YL2A 3WG6A 3UGRA 4XBKA 2Z1WA 2ONEA 3CQKA 4CVUA 1WO2A 4JDYA 1PIGA 4O0ZA 1QTWA 4FXFA 4BJHA 4H83A 3BG3A 2GVEA 4UZUA 1JCXA 3K8LA 2EPHA 4G7FA 4QXIA 3C4UA 3LS9A 3L65A 1H7WA 1XD0A 1SPQA 2QXWA 2ZC8A 5HINA 4IQLA 1CNVA 3DI1A 1FWSA 3DBPA 1N82A 1EZWA 2HQAA 4ASTA 4JTHA 2WHLA 5FF7A 3N15A 3JR2A 3O07A 1LUCA 2A85A 3T0TA 1OCNA 4W84A 3PPHA 4YN5A 4M1BA 3EXTA 3EEZA 5AZ1A 3EDFA 1JI2A 1JVNA 1SO6A 1EGMA 5HMEA 3SGGA 1H60A 2QCEA 1A5OC 1QHZA 1JQVA 2NXHA 1B30A 3TCSA 2NX1A 2JBMA 3SUVA 3KTCA 1Y0EA 4JBRA 3RK8A 3C5QA 4PYSA 2D1ZA 4I6KA 1QOXA 2PDQA 4NJHA 3NG3A 1W9PA 4FX7A 3OYZA 4L64A 5KZMA 1ITUA 2OYLA 2C16A 3TR2A 1XKYA 3TTQA 4JX5A 4JFVA 1DJHA 4J1OA 5ECUA 1AH4A 3ES7A 3S2NA 4LEFA 3BQ6A 4CN6A 1QBAA 3RM4A 1I0DA 2RDWA 1AQMA 4DYJA 4UTMA 3F4CA 2GYIA 4LANA 5GNXA 1TA3A 2ISDA 2DQXA 2Q01A 5LIXX 2J88A 2Z27A 3WDJA 2G0WA 3KOZA 1HJSA 3OTRA 4AU0A 2PDJA 4C6KA 4QE4A 5C9XA 3NQ6A 5KMYA 4A8NA 3KXQA 5CLTA 1J0HA 2PF8A 4U5IA 3RR4A 1K3UA 4FXRA 1UR9A 2ZQ0A 2REQB 4NYUA 1PWMA 5FOOA 2XIOA 4Z0JA 5T26A 3BJTA 3HO8A 4ZSUA 2A5HA 2W9MA 4M0XA 3RO8A 3WIJA 2INFA 1AFSA 4QE5A 1YTDA 3VXGA 1DP0A 3GHTA 1KGXA 1LROA 1GQNA 3KEHA 2YDRA 1UP2A 1ZBWA 3CB3A 4FPSA 4LQ1A 5FSEC 1GOXA 4UFHA 2GUUA 1MXDA 4E4PA 1D8CA 2ZZ1A 1T8XA 2WWDA 5EMJA 3GU9A 3DC0A 4XIMA 3UETA 2HPMA 1AH3A 2MUCA 1GVYA 2OLHA 5FD0A 4QHRA 3FSUA 5HBFA 1OF6A 3CB8A 3I10A 2DZBA 4M51A 4K3ZA 3WCZA 2XU2A 3TNBA 5CSYA 1MZHA 4X2PA 3SECA 5BWFA 3HF3A 1D8WA 3GG1A 4AD0A 4CNPA 1WX0A 2WSPA 2Y62A 2VT0A 1GZGA 4AX7A 5CBBA 3DHDA 5I02A 4NZJA 4C6QA 2NXGA 4AC7C 1V3HA 4AVOA 1XRVA 2GWNA 2J6XA 2XM2A 1NF0A 5IRPA 2ZTKA 4CD8A 4I5UA 4H01A 2D20A 2JIEA 3LRKA 1YDNA 2FH8A 2PGEA 4UUIA 1GCYA 5BXRA 4FNQA 5DMLA 2CLHA 3RCYA 1VJIA 5HMDA 4LB3A 3OGSA 4NNBA 2JK2A 1ADDA 1Y5XA 3BE7A 2BODX 3KVLA 4RXFA 3TJ4A 3MJYA 4BZYA 1AW2A 2WJZA 4HNOA 1UQYA 3ECQA 2VRJA 4O10A 3E02A 5DBUA 5HOSA 3ENLA 1A47A 5DCBA 4ICMA 2FMNA 1R0MA 2Z7KA 2Q02A 4UCGA 3TONA 4U10A 1X1OA 1BTCA 1KRBC 2XSAA 2PU1A 4NRSA 3RFAA 3FJ4A 1E9LA 4DPQA 2WSYA 2EKCA 3AS3A 5M17A 1J0YA 5HQMA 5CJ5A 5JXQA 1U2YA 3VKBA 3DFOA 4P7QA 1PIIA 1V7YA 2J7DA 4N9DA 4C6BA 3PZVA 5E93A 3R11A 3N9RA 3B0XA 2XIIA 1O6IA 4XKYA 2YXGA 1WAUA 2B0MA 5IFPA 4GABA 3AS2A 1ZBVA 3SM0A 2OODA 3AMGA 3U2CA 1W8SA 1Q4WA 5CPQA 2Z6IA 3P14A 1T8QA 1E0TA 4UNLA 4WY0F 1R3TA 2VD9A 3MC5A 1VRXA 4CEUC 1SFJA 9XIAA 5KZ6A 5C9ZA 2A3CA 2CZEA 3EDDA 2DT2A 3UPWA 5A6LA 4KESA 1OK6A 3UYCA 2HMCA 2HE5A 2PWEA 2H6RA 1E4LA 1KCZA 1QPNA 2GK1B 1W17A 3OOQA 1LOQA 2HRWA 2UY2A 2QKFA 4A22A 3DIPA 1TMQA 4GQBA 3W6LA 3LERA 3WLRA 1RA5A 1K6AA 1G67A 1XS2A 2Y61A 3KS6A 5JH2A 5CKSA 5CAKA 3PBUA 2YR1A 3DYPA 3KL0A 4PEKA 4DBUA 3CPGA 1K8CA 1JRBA 3W29A 2GGIA 3ATZA 3W7GA 4GJJA 1B3OA 3A4JA 3UT0A 3AHXA 2Z7GA 1R2TA 2WXDM 2VUNA 4K7VA 3ZJKA 1C7SA 1VFHA 4B5UA 2VQTA 3QOMA 3V35A 2I14A 1TWSA 3IAQA 1FFQA 4XSMA 1LF1A 1SO4A 5FJOA 5ABFA 3W7LA 3JS3A 4ML9A 2VCBA 4DJEA 1OX6A 3M0XA 4MY9A 4E38A 5FSDC 2Z25A 4UOJA 4GA8A 4MWAB 4J3UA 5CCZA 2HJPA 1VBUA 4GVGA 5BXTA 3NL2A 2XISA 2NT0A 4RDYA 2NW0A 2YBVA 1JF6A 2GSHA 4NZCA 2F38A 3A22A 4R53A 3QYSA 3FYPA 4AG0A 4XAZA 4CQBA 4UQ9A 2O9OA 2A4AA 1NOUA 1ZHAA 1EIBA 4FOKA 1G94A 2JALA 1NJJA 4JHMA 4L1WA 3L2MA 1JCLA 1Q63A 1QW7A 2GZXA 3LCIA 1XYCA 3FEMA 1O5RA 4GOAA 4MYAA 1V0MA 3F4VA 1EPXA 3MO4A 3ABSA 4UTTA 1FXPA 4MHBA 4IPPA 2PWVA 1SJDA 1YMYA 3SGZA 4HSHA 3OBEA 3T8QA 1B5TA 2DW6A 2ESCA 1MEIA 4XSLA 1H0GA 3TYBA 4F9JA 3GKFA 4M6QA 2I5IA 2G8ZA 1NWTA 4OIFA 4GVFA 2DP3A 1XCFA 1ITQA 5G1TA 3NSMA 3HU7A 4RDWA 4A05A 3OBAA 4AHQA 4AYGA 3LQLA 2D2GA 2RFGA 2CZVA 2G3MA 3QEZA 2X30A 4IGSA 1RD5A 2YXOA 5BXPA 3PBWA 2D0GA 1J01A 4JS3A 1VPXA 2FJUB 3GSMA 1BHGA 1ICPA 3E6EA 4WF7A 3K4WA 4CKQA 4C6MA 3U3HA 3ITCA 3W00A 3GDTA 5M2FX 4LOCA 1US2A 3S6DA 1YPXA 3BLKA 1AG1O 4IT1A 1EX5A 2ZC1A 3ZWTA 2XFYA 3IV8A 4HHPA 4HNCA 1FRBA 2KAUC 1AK5A 3T08A 4LC6A 2D69A 3G0SA 4PCFA 1UD3A 1TUXA 3W24A 3VIJA 2AAAA 1ISVA 2Y4SA 3S9IA 3N34A 3WBWA 4BF5A 2OOFA 4Y90A 2VZSA 2C0AA 3FV9A 4O1BA 3P8IA 4Q6JA 4GWEA 4HCLA 1EGVA 2ISSA 3MP4A 2VVSA 4O12A 3TC6A 1TQXA 4CU8A 3DFQA 4K36A 3PZGA 4MB3A 1UR8A 2J74A 1H3GA 2WBKA 5D2WA 1VYPX 1IEQA 1W3TA 1R3QA 4H3DA 1ZQ5A 3PZOA 5BW6A 2ZUMA 4XZLX 3W75A 3PS7A 1L6WA 1PKNA 2VYOA 3MB9A 2BASA 1JAKA 1FXQA 4PUDA 2CYGA 3VPLA 3SUSA 1MQQA 3WBAA 1FQ0A 4MTVA 5I3IA 1CGXA 2HEJA 3FX4A 4NG3A 1RK5A 3SUUA 4N6FA 2WMKA 4CEXC 4CN1A 1HKKA 1XGEA 2QDEA 1XYAA 4EKJA 4M5PA 3ELFA 3DXIA 2VGGA 4Z2IA 1WNOA 1M5WA 3THUA 3HJEA 3WDQA 7ENLA 3GIQA 1E72M 1OCBA 5GNZA 2VNCA 3R79A 3C2VA 3M5ZA 1TKKA 3EPOA 2VEKA 3W1MA 4C6PA 4BI7A 1D7FA 2PLKA 1A3WA 3CZKA 4P7OA 3H7RA 5D03A 4PTVA 3O0KA 2TRSA 1LTDA 4IQDA 4JHZA 4H6QA 4I5RA 3UU0A 2RHGA 3M64A 1WB0A 4IXXA 1BG4A 4GKTA 1GVSA 1E0WA 3VO0A 1PS9A 1XH0A 4FX8A 2VC9A 2Q8ZA 4I9TA 4Y9PA 3SCPA 1KBIA 4IH3A 2P88A 2QCCA 2G3IA 1W91A 3W70A 5AC4A 1EJVC 4M56A 4EE9A 2IKGA 1PDZA 6A3HA 4F4RA 3T0CA 4D71A 3TKFA 3HPXA 1ODZA 4WLCA 3GE7A 4JFTA 1XR2A 3TAKA 5BNKA 3WX7A 1EOMA 1W1A1 7PTDA 3GTIA 5FAGA 3CL6A 1CGVA 4FR1A 4N4PA 1GORA 4A3YA 4REQB 4Q32A 2IS7A 3RPMA 3W6MA 4CNSA 4KBXA 4YTUA 5D8ZA 4FHAA 3N2BA 4DJEC 4HU0A 1RR2A 1B3ZA 1VH7A 9CGTA 1IEWA 5H8UA 1YYAA 3NZPA 2XWDA 1WE5A 1EC9A 4JYDA 1M04A 2PDWA 1HJVA 4IGNA 2ZUVA 1OK4A 3VZXA 3W2KA 2GLKA 4QQ3A 3MSGA 4JTRA 5I7GA 2QJJA 1O4UA 4HCHA 4LY4A 3EBVA 1W5NA 1NFGA 2OYMA 4GACA 2ZRWA 2W3ZA 2AGKA 2WVVA 2BSLA 5CZSA 4NSBA 3I68A 3HQNA 2FGLA 3TMLA 1EO7A 4RK8A 1OVDA 5I3KA 5ABHA 4DUXA 3RJYA 2PDMA 1KM2A 3CUXA 5DBTA 4C6OA 1VENA 2PWHA 4UTTC 3TYZA 3MS8A 1UA3A 2C1HA 5I78A 5LA0A 2QJMA 4LVBA 3MHGA 1PX3A 1W5PA 2BLEA 3EDKA 1VPQA 4C5ZA 1C7TA 4PL1A 4R7JA 4WCJA 4YIWA 1XIBA 2D3LA 1AQ0A 1RPKA 4PRTA 4HMDA 4J3XA 1P0KA 3MCNA 3TAOA 1JD7A 3T8LA 3NO1A 1E1EA 3LM7A 3D0CA 4ORIA 1R3YA 3SO7A 4QLJA 1KM1A 3R43A 4EWJA 1RQHA 4AWSA 1S38A 4GQGA 1JPDX 1JDDA 1G4PA 3CMJA 1OC5A 4O8RA 1EJRC 3KRZA 4G1KA 1X97A 1E6QM 4Q22A 3VFLA 1SR0A 1BSLA 1M7PA 5A3HA 5CSUA 3QMRA 2A1YA 1PO9A 5G5IA 2Z1XA 3HIJA 1QI4A 3L9CA 1TRIA 5PTDA 1UH4A 4FNPA 3RG6A 1TWIA 5IDZA 4FIRA 4I7UA 2BWGA 1OG0A 1Q3NA 3WQFA 1UKPA 4W8BA 5C9WA 3SCQA 3WD2A 4NX0A 5TIMA 1W2PA 2O55A 3HG5A 3HGJA 2XIBA 4WOZA 5T8GA 1SVDA 4E6MA 3UWYA 1EC8A 2C6QA 2B4GA 5BROA 2AOSA 1DWIM 3W2NA 2PDXA 3AC0A 4KRUA 3UZWA 5KITA 1EIXA 5KEZA 3TE9A 3PBYA 4H9VA 1LLOA 1QPRA 3W7DA 3BAYA 3NDOA 3VE7A 1V7AA 3WUGA 3UP8A 1UR1A 3VNIA 3M7WA 3QR3A 2PPGA 3G22A 1W1TA 3IWPA 3WH6A 1IGWA 3EB2A 2V5CA 3SIMA 5HANA 3WQWA 3N19B 1P6WA 3L4WA 3AIEA 3CL8A 4Z2KA 4L61A 2OVLA 1SJCA 1XPYA 3PBGA 1MNZA 4PUKA 1YNPA 4FSAA 1TIMA 2PC8A 2QULA 3UZYA 3GO2A 1TWDA 3GXIA 4XKMA 1K8YA 2PODA 2X7WA 3E12A 2VURA 2V5LA 1Q2RA 4US5A 2VDHA 3ARSA 4HK5A 5I09A 1WV2A 2BMBA 4R9XA 3NZGA 4MKVA 3WF4A 2W66A 3CGTA 2E67A 4AZIA 2J7HA 1G4SA 1CX9A 4D1IA 3GG0A 4XVDA 2H8XA 4NJIA 3OVRA 4IJBA 1M68A 2CZ5A 3PNUA 4LB4A 4OQVA 3WQCA 3KBJA 3QPEA 1ZU8A 3QSRA 2PAJA 5E5CA 2YB1A 3F5KA 3WK2A 5I79A 4WGHA 2BFGA 2ASHA 1G0CA 2H90A 1I2QA 1FP9A 3HFYA 3BPWA 1KM6A 1V6YA 1OGBA 4MF4A 5AHLA 2WM1A 3LCHA 1QWGA 4IPLA 3AIWA 1QXLA 3CZJA 1GT8A 1J9YA 3A9IA 4E0CA 3BOLA 1E3ZA 3RHGA 1ICSA 4GE8A 5JBFA 3WQ5A 3A5VA 3WJYA 2BVWA 2WC3A 2J7BA 3Q65A 1WKDA 2OXNA 5A6AA 3RDKA 4WIWA 4IFKB 4HNVA 3OIXA 2FZNA 4EACA 2ZVIA 4J28A 4EAMA 4WR3A 3QGVA 4AIUA 2YCEA 3NYZA 4B9ZA 2RJHA 2Y8VA 4PB3A 3LPGA 2JGYA 1UUQA 3LI0A 3EPMA 2Q8LA 4BWLA 2NX3A 2CBVA 4R7OA 1ENUA 2QDGA 2Y24A 2PTYA 1MEWA 4IMAA 4IICA 3P74A 4RZ6A 4HPHA 1GVIA 2V63A 5AB3A 3FVDA 3EKZA 5EMYA 3SUWA 2IW0A 5KZEA 4LRTA 3M0ZA 4XK2A 1JD9A 3MSRA 4Y9AA 4DN1A 4PFHA 4DNHA 5DT5A 3M0HA 3PPGA 1AUSL 2QQ6A 5D32A 3L5AA 5BU6A 3G24A 2ZX8A 1IT8A 1V79A 2IXUA 1V03A 2CCRA 2WKJA 4DELA 4OOZA 5CC7A 4C65A 2ZIDA 3JUGA 3G5EA 4RE4A 1JR1A 2XM1A 4L4PA 1YDVA 3I7SA 1A3HA 1DYSA 3DG3A 5LIYX 3FAWA 4A3HA 4C7DA 3CZ8A 5I2UA 4W7UA 1NWSA 4Y6GA 3T44A 3D5HA 3A4AA 1I2PA 3SJNA 3BMXA 4UTKA 3CLWA 1EJUC 1A5UA 4FNRA 1MVYA 3V1HA 2R1PA 1KV8A 3MMUA 1N7KA 4NJGA 2TMDA 1NP0A 3CS2A 4H4IA 4DUOA 3DCPA 2XFRA 3M6YA 2EHHA 2WZTA 4OECA 1TPUA 4OFCA 5F7UA 1JQXA 3S5SA 1DPMA 4NP7A 2QPSA 3I4EA 4WY0B 2DW7A 4MNKA 5FEPA 4YCOA 1T40A 4AX6A 3TUUA 1JZ3A 1X96A 2PURA 4GJ1A 3EOOA 5LNVA 1KKRA 5DMYA 1O5QA 4D6HA 1ZCOA 2E68A 4GUFA 4UIOA 4YLWA 3W1PA 2X42A 1GG1A 2Y85A 2PDGA 3T09A 1F3WA 4QGCA 5A8GA 5H1WA 3NL3A 1XGZA 3KRBA 3B8IA 1BLIA 3QFEA 1OQFA 1VGAA 3UWEA 1BQCA 4BQ3A 1EDTA 1KRAC 4CQCA 2CETA 3UXIA 3C2OA 1OM0A 2AQWA 4UFJA 3OODA 1I4NA 4QAIA 1TPWA 4Q8UA 4GG9A 2SFPA 2FIQA 1XC4A 4H2CA 3VNZA 2QCNA 5HQLA 3CEPA 3MKCA 5LNWA 4LEQA 2AMXA 3K2GA 3QZ6A 4HZ8A 2WMIB 4F0RA 1FWCC 3DOPA 3PUDA 3N14A 4DZIA 2VCCA 3SQMA 3FK4A 4PN2A 3WFAA 3S42A 1IR1A 4PB4A 4XIAA 3SQSA 3CYVA 1MI3A 3HMJG 3NWRA 4YTSA 2WSKA 3W7OA 3TXVA 2A21A 4DXVA 1GUVA 4MJ2A 2QMJA 4KQNA 2GWGA 3ABOA 3JZUA 2CNCA 1TCDA 4QS6A 2PDBA 2RUSA 2X2YA 3P80A 3ZR5A 3N9SA 2GVGA 1T0OA 4XWUA 3KL5A 3GHSA 4W89A 3W38A 2UY4A 5E9AA 2QEZA 1EA9C 4NIRA 3F2BA 1WKFA 3FA4A 2V2DA 1B90A 1OYBA 5CGMA 2CKSA 4K38A 3AXHA 3EWYA 1ONRA 1HN1A 1YNQA 2IKIA 4PL2A 3BSHA 3VM7A 1IF2A 1YDOA 4ORMA 2Y7EA 3TX9A 3TNOA 4OUEA 4F66A 3U5YA 2WJDA 1D3CA 2VHLA 3VA8A 3BG5A 4ZEPA 3WLJA 1A4LA 3W0KA 3MUAA 3QC3A 1DWAM 1EP2A 3AYSA 3FAXA 1U22A 5C2XA 3LSCA 4LVFA 3KBWA 1TREA 5IOBA 3H2FA 1GTHA 2NQLA 3TWBA 2VX4A 1BWVA 1IE7C 3S2CA 4U3CA 5M03A 2EGZA 4GY0A 3TN5A 1RK6A 2XSBA 4O18A 1D3HA 2Z1VA 1TPEA 4IJCA 3CT7A 5CJNA 1XBXA 3VD4A 3ZZ1A 4LVGA 3RGTA 4ZCWA 1SJAA 1EDGA 4FXSA 3ZXWA 4HHHA 1ME7A 3XIMA 1THFD 3A4XA 4ZO9A 1OHLA 2FFIA 1AJ2A 3OLEA 5F2GA 2QR6A 1JUBA 3LOTA 1XYBA 4L80A 1XYFA 3BW2A 3QTPA 3L68A 5FAJA 4YS1A 5JVLA 1MRQA 5D9OA 3AMCA 4C6CA 3CWNA 3TROA 5G2HA 3L23A 2PD9A 3N25A 3TW9A 3MI3A 4WX2A 4A4AA 1CXLA 3BGJA 2IQDA 2ZOXA 3KCLA 2WSQA 1XYMA 4X2RA 3SCRA 1XIFA 3M5VA 1H41A 1XICA 3UVAA 4DUVA 2Y5JA 1J0JA 1SYTA 4DF1A 1EYEA 4WDXA 1WDQA 3XINA 1NTHA 2A0NA 3DFTA 5AHIA 1VIZA 4AIEA 1X8FA 4PUEA 1RALA 1VR6A 1Z6KA 5L9FA 3DGBA 1QBBA 3IUDA 1QR7A 4S3BA 3LCFA 4MVAA 4GJIA 2XFWA 3BAKA 1TZZA 3PTQA 4PMXA 4LV4A 3UWWA 1ADOA 1XINA 1H63A 1HW6A 2FGBA 3JVAA 1NEYA 3MZ2A 3QY8A 3UY7A 3HPZA 1GTEA 2C79A 1VLWA 4GRSA 3T40A 2GK1A 4QIUA 2HBVA 5FJIA 2CBJA 1B4EA 3TYDA 3TXZA 3WY1A 4BQ2A 5E70A 3PZ9A 2DZSA 4WJ8A 3P6LA 2OT0A 4IFOA 1UWTA 3S83A 3PHAA 1SO3A 1PUDA 1LL6A 1GQLA 1H2JA 3A47A 4J5NA 2UZ9A 3F4WA 2A6NA 1GOMA 5JMUA 3C3NA 3H6OA 4QCEA 1RBOB 2YSWA 1B57A 2ANUA 1X8CA 2O4QA 1TR1A 3OGVA 4WJEA 2D2JA 1EPVA 1KM4A 3PNZA 1RZMA 5JU6A 3GVRA 2XH2A 4NAFA 2DUXA 4IG2B 3B9EA 3M4HA 2KX9A 2Z29A 3A4WA 3PZNA 4AD5A 2D23A 4PGLA 4KWOA 5REQA 4J3VA 1F76A 3G8EA 1DWHM 3AUOA 1X98A 3HG2A 3M5YA 3VC6A 3ME3A 2VFEA 2OSXA 3VNJA 3CUHA 1EEPA 3U7BA 1E0UA 4H9YA 3WF1A 3VIMA 2AQVA 1U5JA 3RAOA 1VJZA 1UWUA 6CGTA 4MM1A 1I1WA 3NPUA 4GLEA 7CGTA 2TPSA 4I9JA 4V28A 2RGMA 2V3DA 3RMJA 3VNMA 4NYYA 2ACUA 1CGUA 2Z26A 3E49A 5J8LA 3T7VA 1WAWA 5I3DA 3VOIA 3UR5A 5HPCA 4DB7A 2L5HA 2WHMA 4O1FA 3LV5A 4UR9A 1KBJA 4XX6A 5K4XA 3L4XA 4F48A 3VD9A 1MFVA 2OEKA 2YDAA 5HMSA 2FYMA 4MG4A 4O4WA 3GLCA 4ZFCA 1RCOB 2E09A 4ZA0A 3N6QA 3F7JA 4JQ4A 4LCQA 2QW5A 4I8DA 4BR1A 1WA3A 3DAQA 9XIMA 4L9YA 3RLGA 1VFLA 2IPWA 4NI8A 1LUCB 1C8YA 2BBFA 5CPLA 4WQ6A 1I8JA 4O4VA 4KIEA 3JZEA 4ZMGA 3HMCA 4ATDA 3WEMA 2OPJA 2YW4A 3LHZA 4AWTA 3BQ5A 1F6PA 2VGFA 8XIAA 1YDYA 4AUBA 5IM51 2OZTA 2R1KA 4NT0A 3BTNA 1H49A 1UYQA 1A5BA 1NARA 3V5CA 3BJFA 4K6AA 3Q94A 3WUBA 1Q66A 1U83A 2EPNA 3EOEA 4S3JA 1OB0A 3TWAA 1UIPA 2D0FA 3EX1A 4D6DA 4LV9A 3CLMA 4LC8A 4J3WA 3IIZA 1TPB1 1XCWA 2V8ZA 1OZMA 1W1ZA 4JNMA 3TLLA 4AB4A 3PY2A 4NZFA 2DH3A 1IEVA 3DUGA 3VDGA 4UFKA 2OLAA 4M1RA 1W6TA 3GZ3A 1UBSA 1S39A 2B81A 3R94A 4O1DA 3GBEA 2B7NA 3DFHA 4KFPA 3NQMA 1F4AA 1HVQA 2FB2A 3IUIA 3CXOA 4NJJA 3UERA 4EPBC 2FVMA 1KQYA 1I1XA 1YNYA 5D2YA 2ZYFA 4ZBCA 2PFHA 4FZIA 3AIVA 4PCTA 2PLCA 4YVXA 4PTXA 2GSJA 3LLFA 4H8UA 2VL4A 3ALGA 2CITA 1ESWA 3U8GA 1VBJA 1UWSA 3GXDA 4AXKA 3VUSA 3RYSA 4JN8A 3ZJ6A 4KPLA 1EP3A 2WBGA 1JPKA 4DJFA 2ZX5A 1Q13A 2J13A 1VJSA 3R12A 3VKJA 2PDIA 2WSRA 2CFFA 3PBVA 2VFFA 2ZZ6A 3C52A 3UR7A 4GINA 1T99A 2ZUSA 3N18A 2Z2UA 4D6JA 3PVFA 3LD5A 4QDWA 2XVGA 3GVGA 4PUMA 1XLBA 2ZZ3A 1Q6OA 1TE1A 3V0TA 2PRHA 5FCZA 4H7CA 1AODA 3GR8A 1C8QA 2C15A 3IACA 1VLIA 4Z1CA 1QDSA 2P8CA 1GG0A 1K7FA 3K5XA 3K8KA 4UWMA 1DWGM 3NQGA 1B4KA 5D2TA 4F2BA 1TG7A 2ZWZA 2C18A 1XXXA 3W7IA 5BCAA 3P3BA 2V30A 5C55A 1F74A 3AHTA 4JQAA 3O06A 4WDWA 4LUYA 4JKMA 1ZSXA 2F84A 3VU2A 4RDZA 3EGJA 3BCFA 3S5OA 3SCOA 1JFHA 1J0KA 2RGLA 1I2NA 4N42A 1DVJA 1HO1A 4H6KA 3D47A 4LVDA 4GQ0A 1E4NA 2QAFA 2IPGA 4MKSA 3R89A 2OJPA 3MKVA 3DI0A 3S2MA 3G77A 5FEXA 3KBSA 1CXFA 5GQBA 4KS0A 3VGDA 1W3HA 3RNDA 5KTLA 1E1CA 2ADAA 4UTLA 1FA2A 1QNOA 4MIMA 1NWUA 4MPKA 2WPBA 1TJ2A 2C91A 2Q09A 2HSAA 5CBIA 5FF0A 1O7AA 2P3ZA 4KEVA 2FQIA 3O8AA 1SO5A 4GXWA 2E28A 4H2HA 1B3WA 3T2OA 2XN2A 1E6RA 4LU0A 3PWIA 2QUNA 2OWXA 1HKMA 1NM9A 2GPTA 1HUVA 3IS4A 4WDUA 4FF7A 3O3RA 5I3GA 2BG5A 2DSUA 1AD1A 3RXZA 3FJNA 3GDKA 5GJNA 4UTHA 4XKYB