1OYAA

Old yellow enzyme at 2 angstroms resolution: overall structure, ligand binding and comparison with related flavoproteins
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Old yellow enzyme at 2 A resolution: overall structure, ligand binding, and comparison with related flavoproteins.
pubmed doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase (flavoprotein)
molecule keywords OLD YELLOW ENZYME
total genus 147
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1oyaA00
4OE7A 1M7OA 4JTEA 4UFJA 3HPZA 5AHMA 3C56A 1KFLA 3MYPA 4MPQA 1OG0A 1KTBA 1CW2A 3MI6A 3O1NA 3LHZA 4BR1A 1SW3A 1YYAA 1SO4A 4ZQMA 3HG4A 1YPFA 1S3HA 3UNDA 2DZPA 1V5XA 2G5WA 4O53A 3GLCA 2Y7EA 1FXQA 1GG1A 4EWND 3IGUA 1F7BA 1KFEA 3NQGA 3R2GA 1GVOA 3LXBA 5CPOA 1Y0EA 1YTDA 2J24A 3FJLA 3W7CA 2J88A 2H8XA 2RDWA 1Z41A 3EX6A 3L65A 3OVPA 1AMKA 5AC7A 1VHCA 3H55A 4U4MA 1H1YA 4AF0A 1AL7A 1OJXA 3BW2A 2ISSA 1WAUA 3DKLA 5HR6A 1ADOA 1K02A 2VEPA 3TR2A 3TFXA 3TQVA 3KVKA 1DORA 1G7UA 4DEFA 1O5XA 4K7YA 2VEKA 1G4TA 4CNNA 3GIYA 4I7UA 3PG9A 4Y90A 5LHEA 3TV8A 3LXAA 3IIOA 1H63A 1F73A 3DHFA 3UY7A 3MJYA 2HS6A 1L6YA 4MFDA 2OJPA 2TSYA 2OCZA 1E51A 4C1LA 3ZS4A 1CI1A 1OF8A 3L68A 1WX0A 4XBSA 5AHIA 4MUZA 2F84A 5D03A 4JTFA 3V1PA 1TJPA 4ML9A 1JCNA 1SZEA 3NO5A 1GVQA 3QW3A 5FF7A 1K8YA 3O6DA 5G5IA 3LDVA 6TIMA 4Z1AA 3LHTA 1XUUA 4UUIA 3ATYA 2NX9A 3NM1A 3SR7A 4YCOA 3GB6A 4IWWA 1WOAA 3W1RA 3RLVA 8TIMA 3QRHA 3EX4A 2HSAA 3MWAA 1KFJA 2Y88A 1XCFA 1JCMP 1KM1A 4OBTA 1VZWA 4ORIA 1FWTA 3TC7A 3C2FA 4JTTA 4O8RA 4AWTA 2ZTJA 3W73A 4UFHA 1LTDA 4GUJA 5E93A 3W84A 5F2LA 3MW7A 3NQ6A 3W7HA 5D2YA 2DZTA 5E1QA 4PH6A 3FKKA 3LERA 2GQAA 1IGSA 4M5PA 3FOKA 1UUOA 3TNOA 4BI5A 2VFIA 2ZRWA 2V2CA 3G1HA 2A85A 4PA8A 5U4NA 3USBA 5T26A 2C18A 4N2YA 4N02A 3KOFA 3BGGA 1Q6QA 1XFBA 4TMBA 5I3JA 4LWWA 4LRTA 3S1UA 3NQ8A 4UTLA 1PHWA 5HULA 1X8FA 3FYOA 2NUYA 2ZYFA 4IMGA 1TPDA 3C4UA 3PB2A 4PODA 2D73A 4XQ6A 4KFNA 4HNVA 1TPUA 3QMSA 4R34A 1LBFA 4JTLA 4JYDA 4MYXA 3WJWA 2QUUA 4HHPA 3DI0A 4QIUA 1PIIA 2O7QA 2ISVA 3HOJA 3QJAA 5LKYA 4TR9A 3W1PA 2YDAA 4JR5A 4S1FA 1THFD 4E0CA 2WSQA 4QITA 3FLUA 3BARA 1AL8A 3WK1A 3AJXA 1OF6A 1EUNA 3E96A 2Y89A 4H3DA 4H6KA 1Q45A 1W5QA 3H53A 3T78A 4FX7A 4FB7A 5EL1A 1RZMA 3IIXA 4K37A 2CLMA 4OHQA 4RZ4A 3VE9A 3TH6A 5LGZA 3O6CA 2F7FA 2EF9A 4LW7A 1KM6A 4R53A 4K6AA 3T7VA 3U6WA 1KTCA 2ISWA 4OV9A 2QAPA 2YGYA 1XI3A 1GWJA 3CTLA 3GAYA 2BSLA 3LTSA 2IQTA 3HG3A 4M6PA 4XZ9A 1AG1O 3TQ0A 1WV2A 2P10A 3DENA 2PURA 4GWEA 3O07A 4JTUA 2PCQA 3UQNA 1TSIA 1AW5A 4BWLA 1QMLA 3IVTA 1ZALA 3QC3A 5IBXA 1NSJA 1JRCA 4NNCA 5EBUA 2W79A 2ZZ1A 4UMBA 3RFAA 7TIMA 3I7QA 3LV6A 3ABSA 4X2RA 5DELA 2BTMA 5CKSA 5HWNA 3VKJA 4LT9A 4XBKA 4LY8A 1K7XA 2QCGA 3F4WA 4ZQRA 3W2NA 2OZ0A 2X16A 2NWSA 1YXCA 3VI2A 1H7NA 2P0OA 4IUOA 4UFKA 4Z0JA 2ABBA 4IGHA 4YCPA 1ZJIA 1WDWA 1LDCA 1JJKA 1A5AA 1VS1A 3IVUA 3S8HA 3LCGA 3BG9A 3I7SA 5FESA 1OABA 2ZQ0A 4O17A 3S5YA 3ABOA 4E2BA 1RPXA 3WJSA 3CB8A 3LI0A 4JICA 3N9RA 3KVLA 4FNSA 4GBUA 4O18A 4DBEA 4GFSA 1GVRA 3FJ6A 3NG3A 5CPLA 3KAOA 3P7YA 4OU1A 4XTIA 1JCYA 1K03A 1DL3A 3P82A 5HR7A 3UD6A 2ZRVA 1U5JA 4O1AA 3LCXA 3W1MA 4FXSA 1KFCA 2XN0A 4LVDA 1DV7A 4H4IA 1FCUA 1TPH1 4HNNA 4UTWC 1KM5A 4AH7A 4LU0A 4O13A 5LNSA 4CQ8A 2C14A 5J5RA 1TB3A 1VQTA 4N4PA 3TX9A 3LCLA 2QEZA 3MBFA 5CZTA 1MO0A 3W87A 2VOMA 4FNPA 3T40A 5D02A 1DBTA 2RHGA 2YXGA 3HO8A 4S2CA 2AGKA 1TV8A 5BNKA 3LCFA 4O10A 4P2VA 4UIOA 3UPBA 4QSHA 1F76A 2X30A 3MI3A 5FEXA 2YW3A 3QSRA 5DBUA 4A2RA 1H61A 1FWSA 3INPA 2EGZA 3LCWA 3M1ZA 3NGJA 5HQEA 5LNWA 3STEA 3CEUA 2E09A 5DCEA 3W86A 4NJKA 3C6CA 3TSBA 1Z48A 4M7TA 3L0GA 4YLWA 3W7IA 1GTEA 2FFCA 1QOPA 3MUXA 5EA9A 3TMLA 4O14A 5LNVA 1TQJA 1ME7A 3QF0A 2WSYA 3W70A 3W7RA 4O0ZA 2J27A 3W1UA 3FA5A 1S5WA 3W88A 4FNTA 2HTMA 4MOZA 5F4XA 4CLMA 3LRMA 1EP3A 3PUDA 3NL5A 2A1YA 5AHFA 3CWOX 2W0UA 2R14A 3GXTA 1TV5A 4AXKA 4LUIA 1KW1A 2Y7DA 2J6XA 4JEQA 3FS2A 2GVLA 4JX4A 2V82A 3MHUA 1YDVA 5EKYA 1JQXA 1XKYA 3UWYA 2FPVA 2C3ZA 1QCWA 2PRLA 3GR8A 3L2IA 5DXXA 2C13A 4XTDA 1KA9F 4KFOA 4JTIA 3O8AA 3W22A 1H1ZA 1G69A 3W7QA 4GUFA 4LS1A 4LUJA 1N7KA 1Q6RA 1TV7A 4J9JA 2ZA3A 5CPMA 3GK0A 1G67A 2CLEA 2V81A 5G1YA 3HJZA 1O94A 3G1AA 5FEWA 4EF9A 3PWAA 2JK2A 3ZWTA 1LLWA 1IXOA 4O12A 5D2XA 1OX5A 1GEQA 3EX2A 2JGYA 1SSGA 3IEBA 4IJBA 4DO5A 3NOEA 1ME9A 2V8ZA 3NPXA 3KRUA 1KM0A 3PG8A 5K9CA 2NUXA 3N2MA 3PSVA 2C0AA 2VFDA 4FEZA 3KFTA 1SFJA 4LV4A 1K8XA 2KZHA 3NAVA 5I3IA 1L6SA 2ZRXA 4IMCA 2UV8G 1V7YA 4IOTA 4ICNA 3B8DA 5HJLA 1I4NA 3W1QA 3O6YX 2QKFA 2ZRUA 1TO3A 4K7VA 2GVGA 2A0NA 1ALDA 3IIVA 2CFFA 5HWJA 1K8ZA 4CQ9A 1H7RA 2DJXA 1P5BA 3RF9A 1W5NA 5EY5A 3W71A 3SZ8A 3G1FA 3STGA 4JTSA 2NXIA 4HKPA 2VENA 4HPJA 3TE9A 4AF0B 4I9AA 4W9TA 1LRNA 5F2MA 3PAJA 3R89A 3S1WA 2ZRZA 1QPRA 2WNQA 3PUEA 5BOOA 5AHLA 4MIMA 2WKJA 4EVZA 2E77A 1VYPX 4WX2A 4ZQNA 2JKPA 1IXNA 1JCXA 3QSTA 4UTWA 1Q6LA 2VFGA 3P5YA 2PC4A 2YZRA 3GR7A 4FXRA 1ZENA 3SGZA 4NT0A 3D0CA 1Z44A 3VE7A 4GUIA 4BFAA 2VFHA 4NJJA 3IIPA 3NQFA 4UXDA 1N55A 2FB2A 3W75A 3WJXA 4IXXA 3L67A 4UTIA 5AC6A 4MY1A 3ELFA 3A9IA 1EX5A 5D30A 2QCNA 3P8JA 3L21A 3QPZA 3A21A 1SZGA 3CIXA 1F6KA 2BX7A 3GX9A 3W72A 3IIZA 3SECA 3I65A 1L6WA 3OEXA 2RDUA 1FQ0A 4Z08A 3IVSA 5G4WA 3SSJA 2BWGA 4OWGA 4K36A 2Z0IA 3G1DA 4N4QA 4PEKA 4WQ6A 3TJLA 3LV5A 1OHLA 1TIMA 4UMCA 1XC4A 1QWGA 4HT3A 2V5BA 3L0NA 2ZZ2A 1XL9A 3O06A 1QR7A 4GXMA 1FUYA 1X1ZA 2FJKA 2Z6IA 1FBAA 3PR2A 4Z1CA 4IX2A 1OFEA 5K3VA 3NYZA 3EWWA 4Q33A 4IPIA 1H7XA 3B0PA 5HINA 3HPXA 1QPNA 3S1XA 3O16A 1I2QA 2BLEA 3TIMA 1OFRA 5D09A 3BW4A 3L66A 2QCMA 1H7PA 5KTLA 2ALDA 3CQ0A 3TMQA 1SR9A 3IV3A 4M6VA 3WJZA 2OT1A 1MEHA 1P1XA 3NQMA 1DQWA 3QYQA 4XUGA 2QDHA 2TPSA 3S0CA 1DQXA 4AVFA 2ZRYA 1YLVA 4ONVA 1GPWA 3IGSA 3P61A 1W3IA 4Y9AA 4UTJA 1W37A 1IXPA 4O19A 1GYLA 4CCCA 4M7SA 5AHNA 2V2DA 1VGAA 1KLZA 2C15A 3KHJA 1OX4B 1D3HA 3G24A 3TXVA 1FDJA 2I14A 3GZ3A 2Y63A 1A5SA 2Q3RA 1D9EA 1NEYA 1TPFA 4N9DA 2CLKA 4JD4A 4O1CA 3GKAA 5CSSA 5CZ0A 2ZTKA 3NPUA 3QH2A 2W6RA 4CNOA 2YYTA 2NV2A 3S42A 3A23A 1QO2A 1OYBA 4ZMGA 4WXYA 4P61A 3N2XA 1OFBA 2V2HA 1EP1A 4FO4A 3M5YA 3SW6A 4UTHA 3W7DA 2I1OA 4E38A 3BO9A 3SGUA 1QPOA 4LC6A 5AYZA 3N14A 3NQ7A 4O16A 2A7RA 3NL3A 1PHQA 2CZEA 4WY0A 2TMDA 3G1YA 3I7RA 2GQ8A 3G8EA 5A5WA 1W1ZA 1WYIA 3THQA 2WNNA 4HSNA 1DJQA 1M6JA 3GAKA 5AOUA 3LOTA 5C55A 1EA0A 2E5CA 1RR2A 3KX6A 1M5WA 3N19B 4BF9A 4PC8A 4DF2A 1MEIA 4O50A 3EB2A 3L5LA 3RU6A 1FWNA 5AHEA 2QCFA 4O52A 4KFPA 2RFGA 4YMZA 3G0UA 1HG3A 3PUOA 2E68A 3CWNA 4GUHA 4RV8A 2X2GA 3M5ZA 4TO8A 5BW6A 1Q3NA 2ZZ3A 1B3OA 4A2SA 1KBIA 1O5KA 2XFWA 5F1UA 3BLIA 3LRKA 4UTKA 1T0OA 3KRSA 2FB3A 1BWKA 4JYFA 3UY8A 4ZL1A 2RKXA 4I7WA 3MHFA 1F05A 1OX4A 5CGQA 4RJEA 4LV9A 4MLJA 3W3OA 2B7OA 3P81A 1G4PA 4NU7A 3SJ3A 3WFAA 3TSDA 5D2WA 4DPQA 4YXGA 5DY2A 4IPJA 3KVJA 3U2OA 3LCHA 3WJYA 3NQEA 3VNDA 2QCHA 2H8ZA 5DLCA 3HIJA 3M47A 1TPC1 3LBCA 3C8FA 3W23A 4YWIA 3W7OA 1G4EA 3EWUA 3ABQA 1B4EA 4O57A 3TFCA 4GRSA 5LSMA 3NQCA 3RK8A 4JS3A 1DJNA 1HL2A 2Y6ZA 3ATZA 3S5OA 4GE8A 2CW6A 3W6YA 4WY0B 2QAFA 2ZZ6A 3E12A 4IX0A 5LHFA 2DZSA 3CC1A 2I9EA 3W07A 1MXSA 3BG3A 4NX5A 1K7FA 4JTHA 3BPWA 4ZQPA 2H90A 3LXCA 5C54A 2X1RA 4AHPA 3OVQA 3NR0A 4RZ5A 1VR6A 3FKRA 4NJHA 1H60A 3HPSA 3CM4A 4WD0A 1ICPA 4MFEA 1KFBA 2WOQA 1FWRA 1SO5A 1PS9A 3SY5A 1VCVA 3A22A 3C0JA 2Z1BA 1P0KA 1GOXA 3UPWA 3C3NA 3L9CA 1GQNA 1W54A 3GDKA 1QO5A 5D32A 3EWYA 3O05A 2PE4A 1T99A 2EPHA 2Y62A 2J9YA 2V30A 5L6UA 3EEGA 1RV8A 4AAJA 3M0ZA 3STFA 3B0UX 2CLFA 2WV8A 1W0MA 3KXQA 1VJIA 3O15A 2E1DA 1LRTA 1HO4A 4ALDA 4RKAA 2NX1A 1W5PA 3R5EA 3L0KA 3QQ1A 2R8WA 3FFSA 1R2SA 2OT0A 4ADTA 3PC0A 4RXGA 5KITA 1GYNA 1R30A 5D2VA 4X9SA 2P1FA 1UASA 3LLFA 4DO4A 2DORA 4QAIA 4WXZA 3R12A 3W74A 3RMJA 3LTPA 1FDZA 4QM1A 4Z1BA 5AFDA 2A7NA 2RDTA 4PL2A 5H91A 1LROA 2X1SA 5I3KA 2NUWA 5A8GA 1FX6A 1H5YA 3P84A 1H51A 1W5MA 5D33A 1X1OA 2HMCA 1R2TA 2G97A 3NZ1A 4O4VA 2YFNA 4NJGA 3M9YA 3S9YA 1KTNA 3QZEA 4DO6A 1LM1A 4YL2A 1VH7A 3EKZA 2WSRA 4KKXA 4BWLC 1AK5A 3L5MA 3TQKA 1SU5A 3F03K 2WO5A 1HTIA 3NXFA 2RH9A 2VC6A 3W7EA 2QDGA 3YPIA 1XUZA 1LP6A 3B04A 3TA6A 1TRDA 4G1KA 4UNKA 2CLHA 4QNEA 1SZNA 2AQWA 1LRQA 3M43A 2XN2A 4Z1DA 1M7PA 1OYCA 5HUPA 3GYEA 3CEPA 4N6FA 1SZFA 1XBVA 4L4MA 1A53A 3EKLA 4XWUA 1BKSA 2VXNA 1F2JA 3NPWA 5D04C 3CU2A 4LC8A 3AO0A 3M41A 3W1XA 4A21A 4AHQA 4RR4A 5D05A 4LNYA 1YXYA 3GNDA 3LLDA 3EXSA 4MJMA 4O28A 1NF7A 3W7PA 3P62A 3PBYA 5FEPA 3SI9A 3W1TA 4NVTA 2LLEA 3MMTA 3NL2A 2DZVA 1UB3A 3GDTA 1DHPA 4MZ1A 1I2RA 3NPVA 3DAQA 1R47A 4I7VA 1QNVA 4MKNA 1JUKA 3PVFA 3E0IA 1OYAA 2AAMA 2DZWA 3S6DA 3HB9A 1RQBA 1IIGA 1O95A 1ZNNA 3LBMA 3G1VA 3W1NA 3TAOA 3S1VA 4D2JA 1XM3A 2TYSA 3TCEA 1JULA 2C16A 1UBSA 3E49A 5DY3A 1ZAIA 1EWDA 1LORA 4DXVA 3HGJA 5G4EA 4IMFA 3JR2A 1RQHA 3W83A 2Q3OA 4X22A 4WUIA 3IRDA 4MVAA 1SW7A 3FIGA 2ZA1A 3ZFHA 5KINA 2CZDA 1R2RA 5TIMA 5IM51 5LNRA 1FCQA 3GXNA 4HNTA 4HNUA 2A6LA 5G1TA 2QJHA 2E6AA 5AYXA 3DHDA 1BEUA 3PBUA 5K4ZA 3U8GA 1YTKA 3TAKA 3Q94A 5C5YA 1OFPA 2JBMA 1OFAA 3PSWA 3W9ZA 1LOSA 3UXAA 1TREA 2CLOA 2CZ5A 3SIZA 3LGEA 1VC4A 4IQLA 1TTJA 2B4GA 3C2RA 3G0SA 3M6YA 3TDFA 4LVBA 1LBLA 3CLMA 4A3UA 4NXSA 1EEPA 2JGQA 3NQ2A 4NJIA 2WNZA 1U83A 3DFNA 2FIQA 1I2NA 6ALDA 3T55A 5KMYA 3BLEA 3GXPA 2EHHA 2OMAA 4EF8A 4MZ8A 1GVFA 1YDNA 2QCDA 2Y85A 3EXRA 3HGRA 1LYXA 2CU0A 1RQEA 1OFQA 5D2TA 3M7WA 1NFBA 3HGSA 3P8IA 1ZY9A 3RLUA 4NXKA 5D37A 4C1KA 1GJPA 5KZEA 1C29A 3MO7A 3PULA 4FHAA 1LBMA 2A7PA 2X1TA 4R33A 1F5ZA 1VPXA 5AC8A 1KBJA 1F74A 4XKYB 1P0NA 4JIPA 3PF3A 4O1DA 3N34A 1JVNA 2E6FA 2NZLA 3T4CA 3DFOA 2DP3A 2ZZ4A 4KWVA 3W7GA 3UWUA 4A29A 1RD5A 4JDBA 2FPYA 1AW2A 2WQPA 1JUEA 1F6PA 4ZVJA 2FPTA 4FIRA 4ZZ9A 4HSOA 3VFLA 3N3MA 4K39A 3W76A 4KWWA 5FF0A 1PV8A 4AWSA 3C61A 2WPBA 3QMRA 1W56A 1OVDA 3EX3A 2QUVA 3BW3A 3P5ZA 4QJ1A 3A5VA 5FF2A 3FYPA 4N9EA 2VFEA 5K9XA 2V5LA 1VLIA 2GPTA 3HG5A 3NNTA 1EP2A 1JCJA 2A6NA 3LHUA 3DZ1A 3QEZA 1SO6A 4AWUA 3NL6A 4A22A 4N6EA 4NQ1A 2FLIA 3BG5A 1X7FA 4TU1A 1YTEA 3UWVA 1W3TA 1KM3A 1I45A 2G95A 4DBDA 3K30A 4WOZA 5I3HA 2E6DA 3C2VA 4N9BA 1OK6A 3HG2A 5G2IA 4AHOA 2YX0A 2ZZ7A 1GVSA 3HBLA 4JN6A 3LHYA 4DQWA 4LS2A 1QDSA 4RXFA 2J9XA 3W2JA 1WBHA 4ORMA 3WK0A 4FIQA 5BRBA 3NQVA 3H54A 5BMXA 5DN1A 1EIXA 3MBDA 3MI2A 4IMDA 1UCWA 1EPXA 2ZZ5A 1YPIA 5EYWA 4N9CA 1SFLA 3GVGA 1O4UA 3UWQA 3G1SA 3ZWSA 1FY6A 5I3GA 3NA8A 4R7JA 4Y8FA 3W1LA 5FF4A 5K2ZA 3B4UA 2XN1A 4RLIA 3TW6A 4XKYA 5F2GA 3S5ZA 3LRLA 4EOUA 4UFIA 5EPDA 3TW7A 1XBZA 5C6MA 5F2IA 2H3BA 1EB3A 4BI6A 2A4AA 2NWRA 4ZQOA 1EWEA 5GVJA 4POCA 3G22A 3UWZA 4MY8A 3NZRA 4NZJA 1WQ5A 1G6CA 1XDMA 3G3DA 5CG7A 4O4WA 3P74A 4NZFA 1XXXA 2ABAA 4DF1A 4MYAA 5H2ZA 5ABTA 1MSSA 4LRSA 3GDLA 4BI7A 4PL1A 3EWZA 2YPIA 1ONRA 3ZR4A 3EXTA 2FQIA 2J9ZA 4HN4A 1FXPA 3VCRA 4K8HA 1VCFA 3V75A 3F4NA 3EWXA 4UCGA 1AW1A 3THAA 1KV8A 2VEMA 4RX0A 5AN7A 3LB0A 3OG3A 3TKFA 3DBPA 2CWNA 1VHNA 2Y61A 4FX8A 1LCOA 4IXHA 5TQLA 4O54A 4JX6A 2E5DA 2JKAA 3A24A 1BTMA 4O15A 3UYCA 1TTIA 1JRBA 1TRIA 3W7KA 1ML1A 4WOQA 3W2UA 2YYUA 2YW4A 4FNUA 1R46A 1H62A 2Q8ZA 4PFMA 1SSDA 3LI1A 1NF0A 1W8SA 4QNWA 1BWLA 3N9SA 1B57A 4U28A 2ZBTA 2QCEA 4TMCA 1WBJA 3EX1A 3DI1A 4OQVA 3QFEA 5CZSA 2DZXA 3MP4A 2ATSA 4RCXA 2NV1A 3BLFA 3DXIA 5CZJA 4PTNA 1VLWA 4FNQA 1UJPA 3LTYA 5FEZA 3STCA 4O11A 4FNRA 1MEWA 2ZCGA 1P4CA 1JR1A 4UR7A 1C9DA 3BV4A 2NX3A 1KLYA 1GG0A 1ICSA 3MP5A 4FF7A 4AB4A 1EUAA 5AYYA 2X1UA 3Q37A 5HUOA 4AMAA 5CPNA 5C2XA 4JXCA 3G3MA 1TPVA 4UTTA 4HIBA 1YADA 3LM7A 3R8RA 2V0TA 4JYEA 4NX0A 3E02A 5AB3A 3T44A 2YSWA 3LHVA 3OA3A 1TMHA 2GJNA 1TTPA 3W2LA 3LHWA 5BMWA 1PL9A 3BGJA 1VYRA 2ZA2A 2Z2UA 4CNPA 5EMUA 1OFDA 2QCDB 1S5TA 4UTTC 3C2EA 3TK7A 2NXGA 3DFPA 3B03A 3IGXA 3I6RA 4CQAA 1FCBA 3HGOA 1SUXA 5MHBA 4L4LA 1I2OA 2DJLA 2O7SA 4JNMA 1FCVA 1XBXA 1NAL1 2NXHA 1G4SA 3F1QA 4JDYA 4QISA 1ICQA 4LVAA 2HS8A 4BK9A 2GVJA 1W5OA 5LGXA 1J2WA 3W7JA 4TIMA 1PVNA 4B5NA 2E5BA 4NNBA 4Y6GA 4UFMA 1JUBA 1OFOA 1WA3A 3NQAA 4E2DA 2GOUA 2GUUA 1I2PA 4CCDA 1Z42A 1GTHA 4LS0A 1YDOA 2B7PA 1KM4A 2B7QA 3DFSA 2EAWA 3ABRA 1HUVA 2CZFA 4DF0A 1CX9A 2GQ9A 5HMSA 1TPEA 3DGRA 1HO1A 5K9DA 1NVMA 2QCCA 3PB0A 3OIXA 1JQVA 1SQ7A 3GDRA 4JTGA 5LNUA 3A5FA 3ANYA 3UXDA 3P67A 5CSRA 4UC5A 3W2KA 1VYSX 2CLLA 1PCKA 1IIHA 1K7EA 1DKWA 5G2WA 5TBOA 1PE1A 1I8JA 1TCDA 4DELA 3B0VC 1GT8A 1N8FA 2BZNA 4MY9A 4WY0F 4MJZA 3GNNA 1DOSA 3G18A 4HPXA 3L5AA 2QF7A 3DU0A 3DFTA 3TC6A 3M44A 3WK3A 3PM6A 4NNAA 3NM3A 4PCFA 3M16A 3LCIA 4Q4KA 5J5DA 3E9AA 3TJXA 2YFOA 4OV4A 5KZMA 1QOQA 2NLIA 2CLIA 1KM2A 2QUTA 5I3FA 1LOLA 3W7LA 2A21A 4JTKA 1FWWA 1L2UA 2C19A 5U7SA 4UTMA 2Q8LA 4DPPA 1KV5A 2C1HA 3EWBX 4IMEA 3W1AA 1X6UA 3CPRA 4O1BA 4AEOA 3PY2A 1XDLA 1SO3A 3CT7A 5F4WA 1ZFJA 4JIQA 3DFQA 4LTSA 1UUMA 5DBTA 3HQ1A 5D38A 4QQ3A 2Y70A 1K3UA 1XBYA 1H50A 3NDOA 5KSWA 3KRZA 3NEVA 4LVGA 4TX9A 3B06A 3N73A 4WZHA 3W7MA 3M5XA 2QJGA 4X3ZA 4ZQCA 4UMAA 4GUGA 5E0KA 3HF3A 1ZAJA 4K8EA 2QR6A 5DCBA 4Z0SA 3QQ0A 4O0KA 2R94A 3W85A 3I68A 4UFLA 3HMJG 1QPQA 1A50A 4MLRA 3B05A 3UZJA 2R91A 2VKZG 4JX5A 1OX6A 3P80A 1IXQA 3TXZA 4FX6M 3W7NA 1TPB1 1SPQA 3G0XA 4ADSA 1J4EA 2G96A 2VELA 5FI8A 4Y96A 3QW4B 1TJRA 1VRDA 2YR1A 1ZAHA 3DH7A 1QFEA 3NQDA 1RVGA 4JGDA 3CHVA 3DKJA 3SFKA 3OBKA 3M5VA 1T96A 1TQXA 2OX1A 3MP3A 2WJZA 2C6QA 3P60A 4K38A 1ZHAA 3G8RA 5K7JA 1MZHA 4S2BA 2B7NA 1FDYA 2PRMA 1TYGA 3CIWA 4EIVA 3TU9A 3TUUA 1O60A 3TROA 1JCLA 3BK0A 2H3DA 3FEMA 3R13A 1A5CA 4JY9A 2E6YA 1S5VA 4GC4A 5IBXC 2FDSA 1B4KA 3LX9A 1G7VA 5SWUA 5HWMA 3MHGA 3Q2DA 5DCDA 2TRSA 1C8VA 4M19A 5KZDA 4M6QA 3JRKA 3G1XA 3W2MA 1T8XA 1L9WA 4UTUA 5LZLA 2VFFA 4Q32A 2A5HA 2QJIA 3UWWA 1Q6OA 3C52A 5L9FA 2DZUA 1LLZA 5HNRA 3JS3A 1HFBA 3O63A 4OT7A 5FF3A 3OHIA 1D3GA 2B0MA 4ADUA 1DVJA 2Y7GA 4JTJA 2EKCA 3PBVA 1WOBA 2H6RA 4JY8A 4LOCA 3PS7A 1H7OA 3NVTA 2ZFAA 1A5BA 2ATMA 2ZDRA 2QCLA 3C2OA 3QPYA 4GNJA 4UR8A 5F4SA 3PBWA 1TTQA 5DXYA 2Y7FA 1VCGA 1SW0A 2FTPA 3GKFA 4WJEA 4MZYA 3UZ5A 1WXJA 2JKEA 4OGZA 3GDMA 1B9BA 2DU2A 4GJ1A 2V9DA 2PRHA 5F1VA 2VEIA 5K4XA 2A2IA 4LVFA 5G2HA 1KFKA 3BVJA 4NUWA 2GJLA 1IF2A 4UNLA 3OVRA 4CCEA 2YCEA 1H7WA 3MYOA 4RZ6A 1W3NA 1LOQA 3QMTA 1QAPA 3WK2A 3S5NA 1OK4A 1LZOA 2Z6JA 1J5TA 4RK8A 1ZCOA 3QM3A 1TPWA 1W31A 3KVMA 3RNDA 1GZGA 3Q58A 1PCWA 2BXVA 1YXDA 3TSMA 1ME8A
chains in the Genus database with same CATH superfamily
4JTEA 4UFJA 2VR4A 3HPZA 3EA3A 1KFLA 4MPQA 3BSHA 1OG0A 2E9MA 1KTBA 4NZ4A 1HJVA 4WR3A 3WX7A 4BR1A 1FWCC 1YPFA 4G7EA 2GSHA 4W8BA 4EWND 5M5DA 1KFEA 1CGVA 1XRVA 1MW3A 3LXBA 3RX4A 5CPOA 4F66A 4W89A 2C8NA 1A0EA 2J8GA 3URAA 1Z41A 1QXLA 2AQVA 5D8WA 3OVPA 1AMKA 3H26A 1TWDA 3SRDA 1VHCA 3PFRA 2GDVA 1H1YA 3T2OA 1WE5A 1GQIA 1O1ZA 5JBFA 1ADOA 4QE4A 3TR2A 3WDQA 3TFXA 3TQVA 4QRNA 4XZMX 3KVKA 4U5IA 4GKLA 3UW6A 4A8IA 4CCZA 4DEFA 4TVCA 4K7YA 1HGWA 2QF8A 3GIYA 3FGCA 4Y90A 5LHEA 4XZIA 2NSXA 3KBNA 2YZ5A 4PSPA 2J77A 1N8WA 3UY7A 3MJYA 2HS6A 1L6YA 4PMDA 2TSYA 1HNYA 1E51A 4V15A 5CBJA 1OF8A 3L68A 1GQKA 1A47A 4QCEA 1X97A 4S3GA 2F84A 3BCJA 1JCNA 1JAKA 4W7VA 1JF6A 3B8UA 6TIMA 2VGBA 3LHTA 1XLLA 5CPQA 3ATYA 4QP0A 3GB6A 1WOAA 1KCKA 1DP0A 4MB1A 4DYJA 3EX4A 2EPLX 4HHHA 2Z25A 2DSUA 2Y88A 1KM1A 2ACQA 3ES8A 2G37A 3PJTA 4UFHA 4GGHA 5F2LA 1W1IE 2DZTA 3CHCA 3H2OA 3LERA 4DWSD 3ITOA 3AUOA 3G6MA 3V5FA 1NY1A 3W24A 5I3JA 4GBDA 3UBPC 2PLCA 2WVVB 4YHEA 1PHWA 1PKLA 3IV8A 2C0HA 2ZYFA 4UZUA 4G8TA 4IMGA 4YTRA 4ICCX 1I75A 4D6FA 4MKVA 2PWVA 1QK2A 1WZLA 4F0HA 1S46A 4NKCA 4RNFA 3H8AA 4EANA 4R34A 7ODCA 1G0CA 2BGQA 3MUAA 5E70A 1KRAC 3WJWA 4HHPA 1CGUA 2FGZA 3QJAA 3NDZA 4JR5A 1KXTA 4IQJA 1AL8A 1LL6A 2YDRA 4H3DA 3RRAA 4F0LA 3CMJA 1GZJA 4ZXOA 5I02A 4ZO9A 1P7TA 3MV11 2CLMA 4UQ9A 3RR1A 5FAJA 3LN3A 4LW7A 1KM6A 2X2YA 3AIRA 3RN6A 3PZIA 5I7GA 2NQZA 3B97A 1UYQA 2BMBA 2QAPA 1XI3A 1GWJA 2BSLA 4U5KA 1DIKA 3FV9A 2POZA 3TQ0A 2P10A 4ZB2A 1XLEA 4LQ1A 4LAZA 4L9YA 2P5NA 1ZU8A 1I1XA 4R3UA 4BWLA 3IVTA 3EOOA 3W81A 4NY2A 3WL1A 4GY7A 1FH8A 1E55A 3EOLA 4D9PA 2QS8A 5XIMA 4X2RA 3VILA 4U2ZA 2V38A 3R43A 3SFWA 3WQDA 3UR5A 4LT9A 2VDHA 4QDMA 4N0RA 5FIPA 1TFVA 2NT0A 4I8DA 2X16A 2J7DA 4HZ7A 1K9EA 3MUZ1 1D3CA 3NO3A 1VS1A 3LCGA 1C9WA 3SADA 1R3VA 4O17A 2EBNA 3S5YA 3ABOA 2ZXQA 4BF7A 1Z69A 3JUGA 2BY0A 4JICA 3N9RA 1WP6A 4DM2A 3ORWA 5JIPA 3VDBA 2HRWA 5CPLA 3KAOA 2BASA 1JCYA 3BWWA 3HPAA 3MKKA 2OPJA 4AVNA 3WLHA 2ZRVA 4Y8EA 3GU9A 4O1AA 1I9CB 4EXQA 1C93A 3LEPA 1GOMA 3WQPA 1WKYA 4LVDA 4XAGA 4XZWA 1KXVA 4JTRA 4AU0A 4I5RA 4HNNA 4UTWC 3FDKA 4LU0A 1KR1A 4NAFA 4HTYA 1UUQA 4N4PA 4AY1A 4HNOA 2ODOA 2VOMA 2WXDM 3GVWA 5D02A 1RP9A 1DBTA 3GY1A 3HO8A 1BXCA 1TV8A 1GW9A 4O10A 4UIOA 4KS0A 4HBKA 4E6MA 1UC4A 3UPBA 3CZEA 4ZGYA 2RGLA 3VKKA 1XCXA 1H61A 3LCWA 3N15A 5EFFA 3M1ZA 3E2SA 1PWMA 4JCLA 5LNWA 2E09A 3WH5A 1FWFC 1XR2A 3WNMA 4IG2A 4DJED 1Z48A 3TYUA 4M7TA 3W7IA 3GHUA 1GTEA 2J7HA 3AFBA 3N25A 3CL8A 3G2GA 3AXKA 3REQB 1TQJA 1ME7A 5LNVA 4WGXA 2J27A 3W1UA 3FA5A 4FNTA 1UKSA 2HTMA 5F4XA 3TW9A 4FLSA 3BCFA 1ZJAA 3PUDA 3NL5A 3MQTA 3ZT7A 5AHFA 3CWOX 3AHVA 1EHAA 1J18A 1KFWA 3OB8A 3TTEA 4LUIA 1N8IA 1KW1A 2VTFA 3QTGA 3T0DA 2Y7DA 3AIVA 3FS2A 2GVLA 4OUIA 2QJMA 4JX4A 2TODA 5EKYA 3B8IA 1JQXA 1XKYA 2REQA 3MZNA 2FGLA 4NIRA 5HAOA 2PRLA 3L2IA 4MNLA 1KXQA 1B90A 1E3ZA 1HVXA 2PTWA 2F61A 1KA9F 4JTIA 3VGEA 1H1ZA 1KWGA 1G69A 4IJRA 4GUFA 3MT1A 4UOQA 2HBVA 3DX5A 4WDXA 5ECUA 3WLPA 4J9JA 4AY7A 3QY8A 1IR2A 1QT1A 2XSBA 4PYSA 1IXOA 1DIOA 3TLLA 3TZNA 1V02A 4O12A 3F5KA 1EHNA 1V4YA 1EL3A 1OX5A 1GEQA 2I17A 1SSGA 1F3XA 2V8ZA 4ATDA 3PG8A 2VGIA 3BZJA 4GYJA 2W61A 3B0XA 3VGDA 5BRQA 1A3HA 4AISA 2KZHA 4BY3A 2ZRXA 3OU8A 2FTYA 2WMIA 1M04A 1V7YA 1PAMA 2G3FA 5BYWA 5HNTA 4ICNA 5IFTA 4GZ7A 4JTAA 5HJLA 1I4NA 3W1QA 2QKFA 2ZRUA 2CIPA 1K8ZA 1R9ZA 3V3WA 3RF9A 1W5NA 2RJGA 4UQEA 3G1FA 4WEVX 1DJIA 4AD4A 5A6MA 2VENA 2VX5A 2ZUWA 3UESA 3EEZA 4W9TA 4FF5A 1LRNA 4ES4A 2OX4A 3VKDA 1UP0A 8A3HA 4MJ4A 5F2MA 4C6NA 1G01A 4X61A 2ZRZA 5ABHA 5AHLA 4AZCA 2E77A 3H7UA 3P5YA 5GJMA 1UWTA 3ANVA 3SGZA 3CH0A 2BG5A 3IIPA 1GHRA 3ES7A 1KKRA 4DZHA 1N55A 1RUSA 3OLEA 3W75A 4IXXA 1OCJA 2FFIA 2QCNA 3EGJA 3GW0A 1EQPA 2XH2A 1UZHA 2DIJA 3K4WA 2DZAA 1CLVA 3OEXA 1FQ0A 5G4WA 2IS7A 1XP3A 3LENA 3AC0A 3G1DA 2ZUSA 4BS0A 1UP3A 3BZGA 5A6BA 3TN6A 4PZVA 3LV5A 3FAXA 1OHLA 4WJ8A 3MCNA 1QWGA 1KWKA 4IIHA 4W5ZA 1P6CA 1XL9A 3WQ8A 3O06A 4LSBA 1HVQA 5G1MA 4GXMA 1J6OA 1VD6A 2VQUA 3UYIA 3ZLGA 3WQEA 3UETA 3VIJA 4Q33A 1WNOA 1WKEA 4PUUA 1XYAA 3SQLA 4HU8A 3B0PA 5HINA 4DJDD 5DF0A 2BOGX 4UOJA 2HK1A 3TIMA 1S5MA 3GVQA 3MSYA 3UF9A 2FKPA 2JIWA 2QCMA 5KTLA 3PJUA 3IV3A 4W7WA 5EU9A 4DWSA 1WZMA 2NQ5A 1DQWA 2UZ9A 3MVTA 4H9UA 3S6OA 2TPSA 4HVXA 1QI5A 3KWSA 4G1NA 3IGSA 2YA0A 1W3IA 4UTJA 1XG4A 2EPMX 4UOZA 4ZE5A 1NOUA 4PTDA 1IXPA 4IFOA 3GHTA 5FJPA 1M53A 1VGAA 1GKQA 1UD3A 1B3XA 3KHJA 4BCEA 3TXVA 4BF5A 1BLIA 4U2YA 1FDJA 2YOCA 4M1BA 2BDQA 4C5YA 3GZ3A 2P76A 1Q65A 1FWBC 3SN4A 4N9DA 1VBHA 4MWAA 5CSSA 3GKAA 3M0YA 1LG2A 3TTQA 2ZTKA 3QH2A 4XAZA 2YYTA 2IKJA 1EC7A 4QDWA 1OFBA 5CC7A 5CQ1A 4GI4A 4UTHA 5A2BA 1RBOB 3LPFA 4LC6A 2Y8VA 3NSNA 3N14A 1RHCA 3NEHA 2X0SA 2TMDA 3AJ7A 5A5WA 1W1ZA 4H2HA 2OWCA 3LOTA 5C55A 4Y9OA 4PUEA 1IEQA 2Y5EA 4YN5A 4K68A 3WCZA 2VMFA 1XLDA 3CMGA 1IZJA 1MEIA 4LCRA 4O50A 4C91A 2FVMA 3APGA 4FI4A 3EB2A 3L5LA 2YCIX 2Y5SA 4BHYA 2QCFA 4KFPA 3F4VA 3BAYA 4FXFA 5T8GA 4ACYA 3G0UA 2X7VA 2HCVA 3CWNA 4K8GA 3A4AA 4GIYA 4TO8A 2ZZ3A 4A2SA 1XINA 3XINA 1BVZA 1PKMA 4UTKA 2BXZA 1O68A 1BWKA 1FWHC 1JNEA 2E28A 1Q8AA 5CGQA 4NI8A 1VBGA 2CXGA 1DE5A 1X98A 3DERA 5DY2A 2E9BA 1LF1A 4IPJA 3U2OA 3NQEA 1WAWA 3VNDA 3VKBA 1X96A 3V16A 3GFZA 2OKTA 3HIJA 1JZ5A 1RAKA 4ZTXA 1G4EA 3LA4A 4M3PA 3CGTA 4ROPA 1B4EA 4F0SA 4O57A 3DG7A 4JS3A 4YWSA 1KGUA 4GE8A 4QE1A 3QVQA 3HJEA 4REQB 2OOGA 2CKRA 1F9CA 2ZX6A 1VFUA 2DZSA 2I9EA 5ABFA 5CBBA 3A64A 4LANA 3W28A 3CUZA 1IWPA 3OVQA 4KCVA 4B2DA 1LUCA 2EQDA 1A5NC 1B0IA 3TR9A 4F9DA 3UERA 2QMJA 3KTCA 3AU2A 3A22A 2Z1BA 3DBNA 1GOXA 1DJHA 3AS0A 8XIAA 1W54A 1TVPA 3O05A 1YMYA 2PE4A 4V27A 2XGZA 3H7VA 3M0ZA 3MMUA 1NQ6A 1UA7A 2Q6ZA 4HPNA 3EOEA 4UWMA 4PCTA 4RKAA 4IP5A 1W5PA 2DPEA 2MUCA 3QQ1A 5J8LA 3AZTA 5KITA 4C5ZA 4F0KA 2CBIA 3AUJA 3LLFA 1BQGA 4J3VA 1A3XA 2FH6A 3LTPA 2J7CA 2I56A 4C65A 2BVTA 1W3JA 2PUZA 2R1KA 1H51A 2WWCA 1X1OA 2HMCA 1DTUA 4J7RA 5HPCA 1E73M 1FHLA 3QZEA 1X39A 5EGRA 4YL2A 4XB3A 1KNWA 3SB0A 3A6OA 3B9NA 2BVYA 1XRSA 2BOFX 1SU5A 3GXMA 5A8OA 3VIPA 1H0IA 1MQRA 1BF2A 1QRQA 2VC6A 2WMJA 2QDGA 2AKMA 3W25A 4GC3A 3VIFA 4G1KA 2CLHA 3VXGA 4QNEA 1SZNA 1JL8A 2XVGA 1LRQA 3M43A 2XN2A 4Z1DA 3VUPA 1QASA 5HUPA 3EA2A 1E4NA 1ZTVA 1A53A 4ZFMA 2CPUA 4HK6A 1QI3A 1F2JA 3NPWA 3T0TA 3CU2A 1CB7B 4A21A 4RR4A 5JUVA 2NQJA 1YXYA 3ERPA 3CUJA 1ITCA 2PD5A 3C0QA 4O28A 1NF7A 3W7PA 3DOPA 3CHFA 4H8NA 3SI9A 2PBGA 2GK1A 3MMTA 4R9XA 2VQTA 2F9RA 1UZ4A 4GVGA 2DZVA 3KTXA 2DT2A 4UQAA 5A6JA 1J8VA 1UR2A 3DAQA 1T41A 3LPOA 4I7VA 4NAFB 1JUKA 1SR0A 3E0IA 2WVSA 2PBOA 5AC4A 3E0FA 3LBMA 3G1VA 1W1YA 3ZMRA 1UQYA 1JULA 2AGTA 2IPFA 4L61A 4ZB5A 1ZAIA 4FR1A 3VOIA 5G4EA 3IRDA 2WSPA 3BAKA 1SW7A 5KINA 4IISA 3OGRA 1R2RA 2POTA 7TAAA 4JIHA 2HV5A 3QGVA 3UR8A 4WHBA 3PBUA 1BEUA 1Q7ZA 1ISWA 4I8YA 3U8GA 1B5TA 3AMKA 1YTKA 4YU1A 2OGYA 5E09A 3O2LA 3TAKA 5C5YA 3VD5A 4IP7A 2QNEA 3VGHA 4BQ3A 1X38A 1PX8A 1JGIA 3SIZA 1KD0A 4IQLA 2B4GA 2NV9A 4PB3A 1CBGA 3TDFA 1IEWA 3ONCA 4GLEA 1TVNA 2JGQA 2PGWA 1IGWA 4NJIA 5A8MA 1SJBA 3AXMA 3D5HA 4O1FA 3WQVA 3GXPA 4EF8A 2UY5A 2XHYA 3HGRA 4F2BA 3W6LA 2XZ7A 1XIMA 2RDXA 1V3LA 5D2TA 3HGSA 3QYSA 3W29A 1ZY9A 4NXKA 1TR9A 4S3AA 3WFLA 2DUXA 2WLYA 2WANA 3N4FA 5D37A 4C1KA 1J6PA 3RYSA 3MSRA 4PCSA 1CXFA 4GXPA 1NDZA 4XAFA 4L1WA 3C5QA 1LBMA 1W2VA 2X1TA 4NYYA 1F74A 4XKYB 3BUVA 4JIPA 1EX1A 3N34A 4EWJA 1JVNA 2NZLA 3T4CA 5C70A 2ZZ4A 2GUYA 4E3VA 4B9ZA 1RD5A 4L9XA 1AW2A 1XX1A 1F6PA 2DT0A 4HSOA 2CYGA 3N3MA 3WBXA 3W76A 4L64A 2AQOA 2WPBA 1W56A 4Q3MA 3P5ZA 3GS6A 2IQ0A 3FN9A 2V5LA 2V69A 2GPTA 1EP2A 3WEOA 3GG7A 3NL6A 2FVLA 4MGGA 5LA0A 5C2CA 1YTEA 1J0YA 2DSZA 4Z2LA 1KM3A 3OLGA 5CBIA 3E74A 2V3EA 1EA9C 3QKZA 4LPCA 3VD4A 2E6DA 1M3UA 3HG2A 4AHOA 3HBLA 2GVEA 4Q4PA 2V5DA 4DQWA 1QDSA 2GOKA 4FIQA 3WNPA 1Q6EA 5BXRA 2W5FA 2CHOA 4PMVA 3LPPA 5I3DA 3DFYA 4LY4A 5DN1A 3U4AA 1YPIA 5B80A 2JIEA 1Y5WA 5EYWA 3GVGA 3G1SA 3ZWSA 5I3GA 2FZDA 2YL9A 2WMFA 4OVXA 4ZOEA 1V6TA 2ZX5A 2EPNA 4QFUA 2DIEA 3H4GA 4DO7A 3TW6A 3S5ZA 3LRLA 4QROA 5C6MA 5F2IA 5LXXA 1YW1A 1XIEA 3DC0A 1V6YA 3VK5A 3MSGA 4ZQOA 1BXBA 3RO6A 5GVJA 3U7BA 3W37A 4NZJA 4U3CA 1XDMA 3G3DA 5CG7A 4A4AA 4TVUA 2Y0FA 1IR1A 4LAKA 3KZPA 4LRSA 3WF2A 2DSWA 3QV8A 3VIOA 2ICSA 1SFSA 4WDWA 1XKJA 3II1A 4HZ6A 2D2OA 1MQPA 1W1TA 4PMJA 5AN7A 3UA3A 3UXIA 2Y61A 1CGTA 5CXPA 4IXHA 3VGGA 5TQLA 1KCZA 3ZVIA 4DUOA 4XAPA 1U1UA 3UU0A 1MYRA 4JFTA 4O15A 1TRIA 1ZS2A 2YYUA 1Q4NX 1TWSA 3LI1A 1WO2A 5DO8A 1F61A 1R3WA 2ZBTA 3ITLA 2QCEA 3EX1A 1UROA 4GJJA 4IFKB 1EJXC 3GR4A 2QV5A 3NFUA 4L4OA 3WUEA 4PTNA 1VLWA 1PJ9A 2CKSA 2L5HA 2YL8A 3LTYA 3WF3A 1UD2A 1MEWA 4MDOA 1P4CA 2BGNE 4E4UA 2QIIA 3ARYA 1EDGA 4UR7A 1C9DA 3BV4A 3VOGA 2NX3A 4E2OA 2CNCA 1S1RA 1GG0A 3MP5A 4AC7C 3OG2A 3FW6A 5AYYA 3Q37A 5HUOA 2GFTA 1E6XM 5CPNA 5A8QA 5C2XA 1TPVA 3TA9A 1J0IA 4NX0A 3E02A 3RILA 4A05A 5EMYA 1F3EA 2O4MA 1OQFA 1L8NA 1BAGA 1VYRA 5C7VA 1UKOA 3UJFA 3T05A 1JF5A 3HMCA 3PNUA 2OTDA 3A4JA 1S5TA 1US2A 3C2EA 4RE2A 3WEZA 4C60A 4CQAA 1FCBA 1SUXA 4JEJA 1I2OA 2O7SA 4JNMA 2HISA 4JDYA 1DWJM 3WBYA 2MNRA 3PNZA 3CQKA 1V79A 4KWUA 1XLGA 2ZXAA 1DWFM 3W7JA 3CJPA 1E43A 4TIMA 4B5NA 1R8LA 4K3ZA 1H49A 1Q6FA 4JPGA 4DJFC 4PFHA 1QW9A 3NIYA 3NQAA 4E2DA 5FL1A 4L9ZA 2WSKA 4IL0A 4CCDA 1Z42A 4C6OA 5DMNA 3K5XA 2I9UA 2B7PA 2B7QA 3DFSA 1HJUA 2CZFA 2GQ9A 4GXWA 3PB0A 3H22A 1XQLA 3GW3A 4ASTA 5TBOA 1M41A 1TCDA 1NWSA 3SQSA 3RLGA 3B0VC 1MW1A 2CEQA 3CAQA 5CLWA 3KCJA 3RM4A 4GVFA 5CGTA 1UD8A 1DOSA 5HMDA 2QF7A 3DU0A 3NDYA 4NNAA 3GU1A 4DVOA 1QOQA 2OYMA 1QVBA 4US5D 2A21A 2C19A 3VKCA 3E2RA 3MCOA 4W93A 4KWOA 3WLNA 1NELA 1X6UA 4O1BA 4CD4A 3AS3A 3SGGA 5F4WA 3SCVA 2FTWA 2GSEA 1UW9A 3HQ1A 2OZ3A 4EXAA 4QQ3A 1BGAA 1EO5A 3ZXWA 4IIDA 3NDOA 3KRZA 3B06A 3NO1A 4ZQCA 4UMAA 2PB1A 4YS1A 4GUGA 1ZAJA 4K8EA 2QGYA 3QQ0A 1XRFA 5IFPA 2R94A 3W85A 1K4HA 3GDBA 1U33A 3QLLA 4EACA 1XV8A 2Y8UA 4M6UA 5I2UA 3HQOA 4MLRA 1BD0A 1I0DA 3JU2A 2VKZG 3CLWA 4QE5A 3IK4A 1CIUA 1KBKA 4FX6M 1AJ0A 4Q4OA 2OU4A 2ZC1A 3WLTA 2QPSA 2VELA 2PDKA 4DX3A 5CAKA 3FXGA 1BWVA 3G1RA 3EOSA 1TJ2A 3OZYA 4YVPA 1PB0A 3DH7A 1NDVA 5HQLA 1NU5A 2XZ9A 1FHDA 4TTUA 3DKJA 3M5VA 4O1EA 1S2CA 3POCA 3R79A 1JIBA 1ZP3A 5JBDA 2QPUA 1PKYA 1Q6CA 4PUNA 1TYGA 4EIVA 3TU9A 1VFLA 3TUUA 4GJIA 1JCLA 3FEMA 2XWDA 1A5CA 1M7JA 2HROA 2W66A 3KRBA 1B30A 4GC4A 5C71A 3LX9A 1G7VA 1JD7A 3MHGA 1XSKA 3JZEA 1C8VA 3IUDA 4M19A 2FHCA 3JRKA 2V5KA 3W2MA 1L9WA 1TZ7A 3N6HA 3UWWA 1Q6OA 4IGMA 1JDCA 3DG6A 4FLQA 3PBVA 4LOCA 4JY8A 2PGRA 1CGYA 3LNMA 3OGVA 3AOFA 4EPEC 1A5BA 3S4TA 2QCLA 1HW6A 3QV9A 1VCGA 4J3WA 3VIHA 4MZYA 3UZ5A 2PMQA 2JKEA 4PRWA 4JHZA 3VNIA 3RM9A 3BTNA 2A2IA 1A49A 2NVAA 1JXJA 1IQ8A 1OC7A 2WAGA 3C3UA 4EXBA 2YCEA 4RZ6A 4CU8A 3WK2A 1ODUA 2YLLA 3H6OA 2BB0A 4MTVA 5HMFA 4L65A 2FVKA 4F2TA 1LZOA 3SJNA 1J5TA 1EJVC 1TKKA 3CO8A 1TPWA 1W31A 1GZGA 4KCWA 3WF1A 2BXVA 2C79A 2OEMA 1S38A 1FWEC 3PPCA 3L4UA 3WL0A 4JL1A 3PBMA 1Y5VA 3T1GA 3MUY1 3LHZA 4ACZB 1SW3A 1YYAA 1GHSA 1SO4A 3HG4A 2DZPA 3C0SA 1V5XA 3IGUA 1LT7A 3NQGA 4H9TA 1RY8A 4ILSA 2BP1A 4AIEA 3UJ2A 2XJ7A 1OC6A 3E6EA 3FJLA 1BG9A 3W7CA 3VGBA 3N9KA 4LYRA 4AX6A 4B92A 2E3ZA 2OFJA 2HBXA 4ERAA 2B81A 2PTXA 1UQZA 3ZIZA 5AC7A 1MQQA 4HOXA 4U4MA 1S2AA 1AL7A 4AF0A 4HOWA 1T8QA 4HD5A 1EXPA 4I3GA 3BW2A 2ISSA 3DKLA 2QMKA 1IT8A 3PHAA 1G7UA 1M7XA 4C6BA 2QQ6A 1RBAA 2WC4A 4B90A 1EGVA 2VEKA 1RLCL 1YNPA 5LIYX 4I7UA 4YTQA 4Q8NA 1RCOB 1B31A 3RUBL 3BAXA 3WZ0E 1LQ2A 3L4TA 3IIOA 1PZ2A 1ADSA 2D20A 4IQEA 2OCZA 2YIHA 1AJ2A 3ZS4A 2IPWA 3ZJ6A 1U5VA 4OJYA 1YX1A 4XBSA 1FA2A 2XIJA 4JTFA 3V1PA 1RD6A 1TJPA 1TA3B 4ML9A 3ARQA 1UD4A 1MMFA 1T40A 3QW3A 4LCSA 3QGAC 4EK7A 4QXIA 3NM1A 4GI8A 3A3HA 1N2VA 1MUWA 3GH7A 3RLVA 8TIMA 1VPYA 3MWAA 2D2JA 1KFJA 5JBEA 3KW3A 3WBAA 4OBTA 1UHVA 1G9HA 3TC7A 4O8RA 1TR1A 4AWTA 1UWRA 3BQ6A 5E93A 2A3CA 3NQ6A 2PDWA 5D2YA 4PMQA 1IGSA 1MWOA 3CHDA 1S2UA 3TNOA 3G1HA 1A5OC 4C6PA 2A85A 4PA8A 5U4NA 1OCBA 1Q6QA 3BV7A 4H9VA 1ECEA 3AMLA 4LRTA 4UTLA 1X8FA 1XQKA 3FYOA 4S3EA 3C4UA 4A8LA 3VOFA 5DX7A 2D73A 2NLYA 1FRBA 1K8CA 4KFNA 4HNVA 4QDPA 1TPUA 2FHFA 3R94A 4JYDA 4GPNA 2O7QA 3SCRA 4DZIA 2RUSA 5LKYA 5HMEA 3R6IA 2IPJA 4E0CA 3QR3A 3FLUA 1OD8A 2J62A 3BH4A 3AJXA 1OF6A 3AI0A 1EUNA 5CC5A 3O3RA 4FB7A 4V28A 1RZMA 3IIXA 4K37A 4JTQA 7REQB 3TH6A 3O6CA 5FJIA 3OBEA 4R53A 4LAUA 1J0KA 3N12A 4GCAA 4P8XA 5HBFA 4OV9A 5AECA 3ZJ8A 3KWXA 4M29A 3CTLA 3WQ5A 3SCPA 4CD6A 2IQTA 4XZ9A 3A4XA 4M8UA 1B54A 1W17A 3O07A 2A3BA 3MMWA 1TSIA 1XIFA 1ZALA 3QC3A 1KQZA 4NNCA 1S3TC 2W79A 4UMBA 3WELA 3R0UA 1C8XA 1W9BM 1LT8A 3I7QA 5A94A 3N4AA 2BTMA 2E4TA 4H7VA 2QUNA 2ZUUA 1AH3A 4YJ5A 1PUDA 4J2PA 3UG4A 2QCGA 3F4WA 1AD1A 3W2NA 2ZVRA 2NWSA 1YXCA 1H7NA 2P0OA 4PE8A 2ABBA 4IGHA 3NYDA 3IUIA 4R5EA 1XC6A 2OVLA 1A5AA 3A3WA 4EAMA 1EGZA 3BG9A 1E0UA 3I7SA 3T42A 4K1WA 1E5JA 1AH4A 1RALA 2ZQ0A 3TLQA 2XYLA 3WD0A 1DIEA 3SN1A 1HL8A 3WJSA 3CB8A 3RJYA 5DT5A 4FNSA 4GBUA 4O18A 1RXOB 4OFCA 1F6YA 3ALGA 3CAWA 3FXYA 3UZWA 3HFYA 4EKJA 2P50A 2Z1VA 2KAUC 1K03A 1U5JA 2XISA 4W7UA 4FLOA 1GKPA 4Z2GA 3DCPA 2GDQA 4FXSA 1CYGA 3W01A 3NCOA 2XN0A 4Q8QA 2PDXA 4ZXLA 2VC5A 2XGIA 4H4IA 1ZRQA 3W0KA 6XIMA 2OG9A 1J2BA 3QC0A 2C14A 5J5RA 1TB3A 2QEZA 3ZQ9A 2DSVA 2G3JA 2Z1SA 5C7HA 3I4KA 3VIMA 4DUXA 2X41A 4Q4RA 1EZWA 1F76A 2PEVA 3WLJA 5I77A 1YBQA 2X30A 2YW3A 1MI3A 5DBUA 1R7OA 1FWSA 3T8QA 1QNOA 2EGZA 2WWDA 2X0YA 4GQRA 2I16A 4GGBA 5HQEA 3W86A 4NJKA 4AD5A 3EDFA 3NGFA 4MWAB 2FFCA 4IP4A 3CNYA 1E1EA 3TMLA 3CL7A 4O14A 4MB5A 4F48A 4EAYA 4H41A 4QR6A 3W70A 3REQA 4FK9A 2Z7GA 3LG3A 4C6KA 3W88A 2GWGA 1EP3A 5D9MA 1KKOA 2A1YA 2W0UA 3N4EA 1DJXA 3AXHA 1IV8A 1XG3A 3VDHA 3ARTA 4JEQA 4CVUA 3QLDA 3MHUA 3UWYA 3FA3A 2WPGA 2FPVA 4INFA 2C3ZA 3GR8A 4KFOA 3W22A 5ABGA 4O8AA 5C9WA 2FYMA 4L1GA 1SGJA 1S5NA 4LS1A 5I78A 4IH3A 5BROA 1TV7A 4ZO6A 1E6SM 2ZA3A 5CPMA 1W3KA 2VX7A 1G67A 2V81A 2G4FA 3KBJA 1O94A 3G1AA 3PWIA 3PWAA 3ZWTA 1VP5A 1LLWA 4FOUA 4D6EA 3PBGA 2JGYA 4W86A 2BY2A 5GNXA 4DO5A 1F4AA 1ME9A 2GSJA 3RPMA 4LAMA 2FZ8A 1CGWA 3GFYA 2F2KA 4HMCA 4MB3A 4J3UA 2ASHA 4FEZA 1SFJA 3I4EA 1IWBA 2AMGA 1L6SA 4D8ZA 3EA1A 3LBOA 3R0KA 1UH2A 4W88A 3O6YX 1TO3A 3HQNA 4FALA 2GVGA 2I5IA 3CL6A 1ALDA 3IIVA 2CFFA 1FFQA 2PDGA 5HWJA 2DJXA 4C6DA 3ONBA 1FWDC 2VURA 4HKPA 4HPJA 1A5KC 4AF0B 3AIWA 3DGBA 4XD6A 2J79A 5FKYA 3PAJA 3R89A 3FSTA 3WH8A 3VAVA 3S1WA 1QPRA 3PUEA 5BOOA 2WKJA 3SUVA 1CLXA 1D7FA 3LZ5A 2VFGA 3GR7A 4WKHA 4FXRA 1A0CA 4NT0A 1Z44A 3IWPA 3FNDA 3N2BA 3TYDA 3NQFA 2WHLA 4MAZA 4MWAC 5AC6A 3L67A 3VNZA 3RM8A 1NP2A 1CDGA 3L21A 3A21A 1F6KA 2X1IA 3GX9A 3W72A 3I65A 2PZ0A 3ITXA 3SSJA 2IUZA 3IJDA 3GC5A 4OWGA 4K36A 5IHSA 3PN8A 3B8VA 4JBRA 4N4QA 1GOQA 3CQIA 1E71M 3L0NA 2ZZ2A 1JYVA 1QHPA 3FSUA 1EC9A 1VPQA 3EDDA 1YQ2A 3GU2A 1NTHA 3THCA 1W8GA 3R1ZA 1CTNA 4L6OA 4Z1CA 2QYGA 5AC5A 1OFEA 1I0BA 3NYZA 3EWWA 2QZRA 5BU6A 3SCTA 5JMUA 3PUGA 3S1XA 1I2QA 2PFHA 2BLEA 1PXGA 5A2AA 1OFRA 3VC5A 3BW4A 5CLTA 3ZJ7A 4X0NA 4M6VA 3WJZA 1MEHA 4AG0A 2J74A 1FH9A 3NQMA 4YIWA 4GO9A 5I6SA 3QYQA 4XUGA 2QDHA 3S0CA 2YKKA 2JFEX 3BOLA 4N42A 1YLVA 1GPWA 1JZ2A 3C86A 4Z2HA 3OW1A 1GYLA 4CCCA 5AHNA 3H24A 4H1ZA 3TOPA 5JH1A 1MW0A 4PBFA 3G24A 4DM1A 2I14A 5DFAA 2Y63A 3VGFA 2W27A 2Q3RA 4I6KA 3QY6A 4O1CA 5CZ0A 4MADA 5CC3A 2PAJA 2W6RA 3S42A 1UD5A 4KF1A 2W91A 1Y7VA 3GH5A 4Q8VA 1B3YA 1P6WA 3VD3A 3W7DA 4IJCA 1ISVA 2D2HA 3QR1A 4OOUA 1OT2A 2P0IA 2XVKA 4HK5A 4B5SA 1EBHA 2OWXA 4O16A 3NQ7A 2CZEA 3C8NA 3A4WA 3G1YA 4KEMA 1X7IA 1OC5A 3THQA 1DJQA 4AD3A 5E5CA 5AOUA 2PDLA 1FWIC 1EA0A 3WLOA 3T09A 1WUFA 1TX2A 2FHBA 3QKEA 3LGGA 1P7TB 4BF9A 4JFUA 4PC8A 4DF2A 1IEIA 4GINA 2WHJA 2WZHA 3V7PA 1UR0A 1FWNA 3S2MA 3F2DA 4YMZA 3QZAA 2ZOXA 1HG3A 1T5AA 2GJXA 2E68A 1JAEA 1AZ2A 2EO7A 4DB7A 4V33A 3M5ZA 4MKSA 3GRIA 5H8UA 1OGBA 3SUWA 1OCQA 2FB3A 1E6NA 4JYFA 9XIMA 3EMZA 2ZKMX 5FAGA 1A3WA 5B7ZA 3KBWA 1F05A 3MHFA 1OX4A 3IS4A 1OY0A 4RJEA 2B7OA 4FPSA 3GYCA 1AZ1A 3BSMA 3TSDA 4DPQA 4YXGA 3I6EA 3AIQA 3AYTA 4HCHA 1ADDA 1ZQ5A 1Q13A 3ITTA 4DN1A 2H8ZA 3EPNA 4US5A 1R3QA 3LBCA 3W23A 4YWIA 5GNZA 1NARA 2GGIA 3EWUA 3ABQA 4AWEA 1GONA 3UCQA 1Z7AA 5DMLA 1EJ7L 3S5OA 2CW6A 4A3RA 1TE6A 2VGGA 1SYTA 4E2VA 1EO7A 4WK9A 3AYSA 4IX0A 3VDCA 1ECQA 5LIKX 3V36A 3CC1A 3K2GA 1DJWA 1MXSA 1FWAC 3U3HA 5M17A 5D4YA 1K7FA 2A3HA 4UNIA 2H90A 3LXCA 5C54A 4ZB0A 1PDZA 1H60A 3A47A 4PMOA 3S2NA 4H7ZA 1SVDA 1PS9A 3RU8X 1VCVA 1HQTA 1P0KA 3QN3A 4LUYA 4D71A 1QNRA 4GX9A 2J4GA 4Q6JA 3UPWA 1ZSXA 5IDIA 2DW6A 1E9LA 3IAQA 3GDKA 4W8AA 5D32A 1JZ7A 4QHRA 5DANA 4Y9NA 1T99A 2VD9A 3N2CA 1A5LC 4HN8A 2WCSA 2BOEX 4ZA0A 3STFA 5JU6A 3I10A 1G5AA 2QXWA 4F79A 1W3HA 4AD2A 2DT3A 4FOKA 1JZ3A 1JXKA 1VJIA 1LWJA 1Q8JA 4ALDA 3R5EA 4M56A 1E0TA 1QTWA 2AAAA 1FWGC 3PC0A 1B2YA 1AVAA 1R30A 3U9IA 3E3HA 3UEQA 2P1FA 2QJJA 4WRHA 1W6TA 2VEGA 4DO4A 1IHIA 4D8AA 3T0CA 3R12A 3W74A 1AD4A 4PL2A 5H91A 2ZX8A 4MHBA 4FAMA 2NUWA 1FX6A 4MJ2A 1H5YA 2VO5A 1KRCC 3EPMA 2XSXA 4O4VA 1A4MA 1BHGA 3ZLHA 3M9YA 3H2CA 3S9YA 1KTNA 4DO6A 4QG6A 2ANUA 2WSRA 4BWLC 2FDMA 1AK5A 4DYEA 4DJEA 1I6NA 3F03K 3WQ4A 1CGXA 4W8LA 4QGCA 3W7EA 4FSAA 3YPIA 3BLPX 1BKHA 1W9XA 1XUZA 1LP6A 3KE0A 3TA6A 2BVDA 1VIZA 3VVGA 3BLDA 1P6BA 3M4HA 1YRRA 2WVTA 3TCSA 3DYOA 1WDQA 5D04C 3SUSA 3RO8A 3M41A 3W1XA 1X6NA 4AHQA 5D05A 4CNUA 3WD1A 4LB3A 3EXSA 1HJSA 2PSNA 1XDJA 1SMAA 2VCCA 3RMEA 3W1TA 1U5HA 4Q7BA 3NL2A 4JQ1A 5E0FA 1UB3A 3GDTA 1UOKA 4MZ1A 1ITXA 2EG6A 2E1WA 1DWHM 3NPVA 2E40A 4HA1A 4MKNA 3URNA 2AAMA 1NH6A 2WJEA 1IIGA 3LMYA 4HMDA 1KRMA 1E4IA 1TWWA 5C9UA 3W1NA 3DUGA 2TYSA 1R0MA 4DXVA 3BQ5A 1JPHA 1CZ1A 1RQHA 2INZA 3JR2A 3W83A 1FHUA 5CJNA 1Z9AA 2OEJA 2DH3A 3FIGA 3CHEA 3AS2A 4F4RA 1IZCA 4M82A 3VU2A 3U5UA 3TYZA 1FCQA 4HNTA 2R82A 2A6LA 4EPKA 5JIWA 4W84A 3Q45A 2JF7A 3WDIA 4KERA 1L8PA 2CBUA 1RH9A 4PMRA 4H6EA 1ZB5A 3Q94A 1OFPA 4Z2JA 2JBMA 3R11A 1OFAA 4Q8UA 3W9ZA 5CG0A 3UXAA 1E3XA 3PJXA 2PDQA 1H11A 5M1TA 3LGEA 1VB9A 3NJ3A 3POHA 1ITQA 1BG4A 1UH3A 1VEMA 3M6YA 3QHNA 4A3HA 3CLMA 4A3UA 3RJXA 2XIMA 4HA4A 4O0QA 1S2VA 4DBUA 5BRPA 1KB3A 1S2WA 3IPWA 3QOKA 3VNKA 1C90A 4HB7A 1NDYA 2V5CA 5BOEA 3DFNA 2FIQA 4W5UA 1I2NA 3VNYA 6ALDA 2CITA 5KMYA 2EHHA 4MZ8A 4HJFA 1YDNA 2QCDA 2Y85A 3DEQA 4AZ5A 2QT3A 4E8CA 2D1ZA 2NSOA 1WZKA 1OFQA 3WMBA 3QHMA 2W67A 1XPGA 5AYIA 1U1HA 4GA8A 3LQLA 3PULA 4C6FA 1F5ZA 3FVDA 3IJQA 2VVNA 2E6FA 2DP3A 4KWVA 2ISFA 2FPYA 3L2MA 2WCGA 4FIRA 3N29A 3KM8A 4K39A 1RVKA 4AWSA 1W9DM 3C61A 3PWGA 3QMRA 1MRQA 2PLJA 3M0KA 2ZX7A 1MRAA 5FF2A 1W1PA 3FYPA 4PUKA 2VFEA 1VLIA 2WC3A 4MNMA 2A6NA 3LHUA 3QEZA 3LMZA 1SO6A 1D2KA 5HJXA 4DLMA 3KL3A 7ENLA 4NQ1A 3PTKA 3V0UA 2PC8A 4TU1A 4QEHA 2FJUB 1HX0A 2DH2A 4DBDA 3EDEA 3SCSA 3K30A 1Z32X 5FJUA 5I3HA 3C2VA 2O55A 4N9BA 1V77A 4JN6A 1GVSA 3LHYA 4GABA 1FKWA 4F40A 4PMXA 3WK0A 1IEXA 1WDSA 5BMXA 4ATWA 3MBDA 3ICJA 4IMDA 5BXTA 4S3BA 2ZZ5A 1O4UA 4UQCA 3K8MA 4NYUA 3UWQA 1C8YA 4GMEA 4RW5A 4H9XA 1IYXA 2E8ZA 5A3HA 2GGGA 2PF8A 1PX4A 3NA8A 5GJPA 3W1LA 3LZ3A 1LWHA 1Y5XA 3ISIX 4MG4A 4EOUA 4UFIA 5EPDA 1AMYA 2ZUTA 5A8PA 4S3CA 4REQA 4C6IA 2H3BA 3NZGA 3VC6A 2Q02A 1EB3A 2A4AA 2NWRA 2YLAA 3F5JA 5MKGB 3AROA 1LLOA 4QG8A 3UWZA 2G3IA 1WQ5A 2W9MA 1XH2A 2PDIA 2CHNA 4O4WA 4A6GA 4NZFA 3CPGA 3NWRA 4DWDA 4DF1A 1Q63A 3MU7A 5H2ZA 3BLOA 3GDLA 4WKAA 4RZBA 1R9YA 3OBAA 1ONRA 2VRKA 1H09A 3ZR4A 5IRPA 2NVCA 2WZEA 4HN4A 1FXPA 3GXFA 4Z17A 1AW1A 3THAA 1KV8A 3WD4A 2Q09A 2XIOA 5TAOA 4UQDA 2DEPA 3GTFA 2OB3A 4O54A 1YNQA 3RCNA 2NQ9A 4JX6A 4H7CA 5DEZA 2JKAA 2BS9A 3RPDA 4HSHA 3UYCA 4R85A 1E1CB 1ML1A 3W7KA 4WOQA 3RRXA 2BHUA 3UA4A 1K6AA 1OWQA 2PWFA 2PTYA 1JGMA 4WCJA 3UXKA 4KQNA 1QNQA 3N9SA 3WMLA 3HN3A 4CGTA 5FJOA 2ACRA 3QFEA 2XINA 1GEHA 2ATSA 3L4ZA 3VTRA 1A0DA 1RK6A 3DXIA 4PB5A 3CTTA 4FNQA 1RSCA 3VD7A 4PCPA 5FEZA 4O11A 3ZR6A 3P93A 4FF7A 2D24A 1EUAA 1E40A 4F3HA 2FZ9A 5E6YA 4JYEA 4JTDA 1E1FA 5AB3A 2YSWA 3LHVA 4TV6A 3W2LA 1TTPA 4M1RA 1WXYA 4JKKA 3QHOA 5BMWA 4U3AA 1PL9A 1OEPA 3CK5A 2WMHA 1E9ZB 2Z2UA 4D6DA 1EJSC 1RCXB 3RIKA 4NZ3A 4F8XA 3TN4A 2NXGA 1JYNA 3IGXA 3GNXA 5MHBA 4L4LA 1OSEA 1V51A 1Z6KA 2DJLA 4QCFA 2NXHA 3F1QA 2GGJA 1LQAA 1TJ1A 4QISA 1XGEA 3EMCA 4J5NA 3UCDA 4B15A 2GJRA 3RITA 4C6QA 4Y6GA 3DC8A 4UFMA 1D8CA 1I60A 1JUBA 3B0YA 5DMYA 1Z3NA 2OGJA 4QS5A 1XICA 3PZ9A 4Y7EA 5A6SA 1TZ9A 2XFFA 4DF0A 1CX9A 1JDAA 4AC1X 3PTMA 5K9DA 2QCCA 1JQVA 3GDRA 3WIJA 5LNUA 2GJXB 2YL5A 2HVOA 1RA0A 4UC5A 3MPGA 4Y2WA 1BPLB 3W2KA 1VYSX 3AXXA 1K7EA 1DKWA 3U2CA 1CXIA 3SM0A 1GT8A 1PSCA 1PIFA 1T6MA 2HNHA 3T0BA 4MJZA 3HU7A 3ZR5A 1POKA 3WNLA 4AUBA 2WBGA 4RDYA 2PWUA 3TJXA 5KZMA 4P7RA 1IT0A 4RE3A 4PUDA 3D46A 5I3FA 1LOLA 2OSYA 1SJAA 1J0HA 3TONA 3KHDA 3S2CA 4UTMA 4N7QA 3NURA 3ZVHA 1OIMA 4IMEA 2OZTA 3CPRA 1LL7A 3PY2A 1XDLA 1BSIA 1EZ2A 1ZFJA 3URBA 5I09A 2PP0A 3BJTA 1UUMA 5D38A 3TZFA 3PFMA 5KSWA 1E4MM 4LVGA 3MB9A 3N73A 1UD6A 2E67A 4WZHA 4G7FA 1KO0A 1MZRA 3UP8A 5E0KA 1Q7MA 2BY1A 4B3KA 2QR6A 4TQTA 5H1WA 1DIDA 3MKVA 3PK7A 2OO0A 3OQ8A 3HMJG 3O6AA 1QPQA 2CERA 1F4HA 3W02A 4GY0A 3GVRA 2OSXA 1TPB1 3W7NA 1SPQA 4D6HA 1PKNA 4ADSA 4U33A 1J4EA 1HP4A 2PDYA 4XZNX 2R9RA 3QW4B 5KEZA 2J8FA 1ZAHA 2HWGA 5I0DA 1RVGA 2VHLA 3FK4A 4NL1A 4GK8A 4KEUA 4B5XA 3CHVA 9CGTA 4LNCA 4GH1A 2ESCA 1T96A 2OX1A 4K38A 4JKLA 4D1IA 3U7VA 2PRMA 5FOOA 2PGFA 3HM7A 3TROA 3ZT6A 2NW0A 2Z00A 5FL0A 3BK0A 4RNJA 4JY9A 1US0A 4A3QA 4HPHA 1S5VA 2IW0A 3KBMA 1UWAA 1B4KA 4GISA 5FJTA 2R24A 4HCLA 1Q4WA 3Q2DA 2EXOA 2HDJA 4GIAA 5DCDA 3WDPP 3B8SA 4M6QA 3WN6A 3G1XA 4GD0A 1REQB 3VNMA 4Q32A 2A5HA 2QJIA 3MVIA 2PTDA 5L9FA 2O56A 3MZ2A 2DQWA 4EPDC 3IANA 4XVEA 3JS3A 3O63A 1BQCA 3ZJKA 1D3GA 1K70A 3QR0A 1DVJA 1UR4A 3ZVHB 2WCAA 2H6RA 4HCDA 3PS7A 3LY0A 3UVIA 3WLKX 4J3TA 3UJSA 1HKIA 3NVTA 2WMGA 2ATMA 2ZDRA 3C2OA 4UR8A 4TXEA 1MDRA 1CLKA 2VGFA 2Y7FA 2CHRA 1TJ0A 3NOYA 1J79A 1WXJA 1B9BA 3GVVA 1JYWA 2V9DA 2J78A 5F1VA 2VEIA 3BOXA 2W4XA 3GIQA 4LVFA 3LLXA 5G2HA 4IT1A 1K6WA 3WQCA 3WNKA 1HJQA 3UGVA 3BVJA 4PRRA 3FHAA 4NUWA 3SEPA 1IF2A 3ZSSA 3WDRA 3MYOA 1H7WA 1NWTA 3URQA 1UR1A 4J28A 1OK4A 2Z6JA 1ZCOA 3QM3A 3MKCA 3BGAA 3KVMA 3Q58A 2WJDA 1ME8A 4OE7A 1M7OA 3VINA 3KS6A 3C56A 2DVXA 3E0VA 3KBSA 4L80A 3TYAA 4C6MA 4GQGA 1VFOA 1CW2A 1Q5MA 4DAIA 2VCAA 3KCOA 2W62A 4S39A 4ZQMA 1S3HA 3UNDA 2G5WA 4O53A 3GLCA 2Y7EA 2G0WA 4KRZA 1FXQA 1GG1A 3T0AA 4MM1A 4V1XA 4DJFA 1GVOA 3LK6A 2G3NA 4CEUC 2QIWA 5EFDA 1Y0EA 4KETA 1YTDA 1PZ3A 2J24A 1R86A 5REQA 2ADAA 3PTQA 3EX6A 3L65A 3SQMA 4S3JA 2WYSA 3H55A 4WJXA 3U2ZA 2Y2WA 3N1AA 1OJXA 3LPGA 2VEPA 3CB3A 1DORA 3HZ3A 3JVAA 2XU2A 1WPCA 5TF0A 1LG1A 1SM9A 2YB1A 1G4TA 5EMMA 3TV8A 3LXAA 1YE6A 2B31A 2EEXA 5M03A 1F73A 2IKIA 2O9RA 2OO6A 4ROQA 3USZA 5E9XA 1DHKA 4LEFA 4MFDA 2OJPA 3KL0A 3W38A 3A9BA 5FCZA 1CI1A 3SCUA 2IPGA 5AHIA 4MUZA 5D03A 2PPGA 4DJEC 4JQ4A 1SZEA 1WDDA 3UNTA 4BJHA 5FF7A 1K8YA 3LDVA 2WC7A 4Z1AA 4I90A 4NZCA 4R27A 3SR7A 4YCOA 5DRCA 4IWWA 3PZGA 2HSAA 4E8GA 1XCFA 1JCMP 3VMNA 1VZWA 3APYA 4ORIA 1FWTA 4OTKA 1GZ1A 3FGCB 4NRRA 3S6TA 2ZTJA 1LTDA 4WGHA 3W7HA 4PH6A 1AQFA 2EG8A 4M5PA 3THUA 3FOKA 4X2PA 2ISDA 2ZRWA 3AYRA 4CQBA 4AMCA 2C18A 2VUYA 2UBPC 4TMBA 1HJXA 4LWWA 3S1UA 1YPXA 3CT2A 3G5EA 3CUHA 1TPDA 3PB2A 4RE4A 4PMUA 4XSMA 1XYBA 3KP1A 1BVNP 5I03A 4JTLA 3IJ6A 3L4VA 4NG3A 2QUUA 5C2GA 1PIIA 2ISVA 2HQAA 2YDAA 3OLDA 3OZOA 3WK1A 1DJYA 4H6KA 3H53A 1TCMA 5EL1A 4PGLA 3E38A 4RZ4A 3GXIA 3OYZA 1PZ1A 2F7FA 4JTCA 2EF9A 4KEVA 2ACSA 3T7VA 3U6WA 2ISWA 4C1NB 1XCWA 3BICA 2YGYA 2BY3A 3GAYA 4HMEA 3LTSA 5CPSA 3ABZA 4XK2A 1AG1O 1BYDA 2PURA 4GWEA 2PCQA 2PDBA 1MVYA 1PPIA 3R8HA 3UQNA 1QMLA 4RW3A 4XSLA 5IBXA 1NSJA 1JRCA 4PTXA 5EBUA 5FACA 7TIMA 3LV6A 2Z28A 4IGSA 5CKSA 3N13A 3K13A 5HWNA 3VKJA 3CZLA 4XBKA 4LY8A 4NZ5A 1K7XA 2YA1A 4ZQRA 3RDKA 4GIEA 2OZ0A 2YJQA 2VI0A 4IUOA 2D23A 3FAWA 1TX0A 4IZGA 9XIAA 2CBJA 4GIRA 1ZJIA 4R88A 2NVDA 1WDWA 5A6TC 1LDCA 3IVUA 3S8HA 3HV8A 4AQLA 5FESA 4QAWA 4D6IA 3VPLA 3UR2A 3BJSA 1F8IA 1VFMA 1NM9A 3WDHA 5HATA 2E7FA 4DBEA 1GVRA 3FJ6A 3GO2A 1Q2RA 3P7YA 3RXZA 5I00A 1DL3A 3OO2A 5HR7A 4AZGA 3D6NA 1RBLA 3KCLA 3LCXA 1Y65A 2EKGA 5I23A 4B2DD 1DV7A 3OIHA 4CD5A 1ESWA 1HKMA 2J47A 1KCXA 1TPH1 1PYMA 1CB2A 4AH7A 4O13A 3AMCA 5LNSA 4DYKA 2YL6A 3LCLA 3UZXA 5A6KA 1MO0A 5H6HA 3HPFA 1F3WA 3WQGA 3T40A 4WKFA 3KP0A 2RHGA 2YXGA 4WDTA 1E6ZA 2AGKA 5BNKA 3LCFA 4LBUA 1NJJA 4P2VA 3VDAA 4QSHA 1Z89A 4JHMA 2FMNA 5FEXA 4I9TA 5LIWX 3QSRA 1XIIA 3INPA 3S9IA 4BQ4A 3CEUA 3BLLA 3C6CA 3N17A 2WB5A 3TSBA 4C6CA 1HZYA 1QOPA 3MUXA 6ENLA 1HXJA 5EA9A 4J3ZA 1V8EA 4O0ZA 1UG6A 4XD3A 4MOZA 3W82A 1KXHA 4P7QA 3LRMA 4J40A 1DXEA 5GQBA 3O0KA 4ENLA 3GXTA 3SRHA 3BMWA 3QQWA 4D6JA 3UG5A 2V82A 3VM5A 1EYWA 4PUJA 5MKGA 3SBFA 3HTWA 2DDXA 4HYWA 1QCWA 2C13A 4Q4QA 4S38A 3CV1A 3RCYA 3P0XA 4Q8OA 3O8AA 4LUJA 3UVAA 1E72M 4KW2A 2D0HA 2XSAA 3FHQA 3OYXA 1R85A 1TMQA 4B91A 3DN5A 1TG7A 1OT1A 3GK0A 4XIMA 4B4FA 4ZE4A 5G1YA 1O66A 3AALA 2JK2A 4ZBCA 1QK0A 4G2DA 3N2OA 5D2XA 3CS2A 3EX2A 2Z7KA 3NPXA 3H2NA 1GCYA 1DWGM 1KM0A 5K9CA 1RJRA 2HXUA 1XW8A 1W2PA 1F8MA 2VFDA 3SCOA 1GQJA 4XAYA 3KFTA 3EDJA 5FJRA 4JQAA 2J13A 3S5SA 3NAVA 5I3IA 1S39A 4IMCA 1DTNA 3B8DA 3QPEA 3GBDA 4CN4A 3GE7A 1E9IA 4K7VA 1XIDA 2A0NA 1QW7A 2IXUA 1I1WA 3AISA 4CQ9A 1H7RA 3B9DA 4ZO8A 3W71A 3SZ8A 3STGA 1BFNA 2GWNA 1PTGA 3P6LA 4XO7A 4NAEB 3TE9A 3ZO9A 1JZ4A 4I9AA 1VF8A 8RUCA 4CNSA 1GNXA 2EG7A 1G1YA 1V93A 3MDWA 2WNQA 1GJWA 4WX2A 3QSTA 3R4IA 4GYKA 1HKJA 4IUGA 4G6CA 1LJYA 2PC4A 2YZRA 3F4DA 1ZENA 3TEVA 1BYCA 2IXVA 3D0CA 5BZAA 3VE7A 3ARXA 4GUIA 4YVXA 1XSIA 4NJJA 4BFAA 4JKMA 2VYOA 3E0WA 5E9AA 2FB2A 1IZKA 3OLIA 4MY1A 3A9IA 3AZRA 5D30A 3P8JA 3QPZA 5A2CA 1CENA 4IPNB 4QX4A 1XPYA 2BX7A 4LGXA 3SECA 1L6WA 2QLYA 2PDJA 3IVSA 3VIIA 4AIUA 3OODA 2BWGA 1O5RA 4URIA 3T8LA 4WVXA 3M0JA 4Z1YA 3QGKC 3DYMA 4JAWA 3TJLA 2F8QA 1TIMA 4UMCA 1UP2A 4UTFA 2YB4A 1PWLA 1FUYA 5IHRA 3PANA 1HT6A 2Z6IA 4Y9MA 3ID7A 3PR2A 5K3VA 3WYZA 1JCTA 4IPIA 4LXFA 1H7XA 3HPXA 4GYPA 3GNRA 3VOCA 1QPNA 1JPMA 1N82A 2WMKA 2Z4GA 3O16A 3VOHA 4ZO7A 3KDOA 5RUBA 3CQ0A 4L6DA 3TMQA 3UGRA 2E8YA 1FVPA 1EXBA 1P1XA 4GI6A 4AY8A 1LQ0A 2V6AA 3GBEA 1V6WA 4NP7A 2YXXA 2ZRYA 1A5MC 3CZKA 4ONVA 4MB4A 2VEFA 1L2QA 2EJAA 2XDFA 3I3BA 4OIFA 4O19A 4LEQA 2E9LA 4M7SA 4A3YA 3SRFA 2V2DA 3FCPA 1KLZA 2C15A 4E8DA 1OX4B 4DWSB 1D3HA 4AZBA 1V02E 4I5XA 3MDUA 4IM4A 5I5RA 5AZ0A 3SO7A 3RX3A 3NPUA 4HJWA 3S3GA 1V0MA 1UKPA 3WMCA 4CNOA 1MFVA 1JPIA 2CESA 2NV2A 3DESA 3Q4DA 4ZMGA 2GDUA 4WXYA 4P61A 3N2XA 2V2HA 1EP1A 3K4AA 2OODA 3SW6A 4E38A 4F9JA 3SGUA 1QPOA 3AMGA 4WSJA 5AYZA 1JDFA 4P5UA 3L7RA 1J96A 3VKAA 2A7RA 1PHQA 4WY0A 3NL3A 2GQ8A 3I7RA 2E5CA 1RR2A 3KX6A 3VZXA 4KPLA 2FMOA 4ZENA 5CH9A 3WMSA 1E4LA 3WH6A 3OHMB 4S3KA 3RU6A 1HGYA 2AL2B 2YA2A 5AHEA 4IMAA 3M0IA 4MNKA 4PSRA 3WSUA 4Z42C 4JL2A 1J0JA 2PP3A 3VO0A 4GUHA 2QV4A 3TTYA 1R3SA 1Q3NA 5IDZA 5LIXX 3BLIA 3AWOA 3LRKA 3M0LA 3M64A 1T0OA 3GXDA 3UY8A 4L1XA 4I7WA 4UR9A 2OEKA 2OQHA 1U2YA 3S47A 1RPKA 3H2FA 5C9RA 2GGHA 4LV9A 4MLJA 4A8NA 1G4PA 2BXYA 3SJ3A 3WFAA 3TWBA 2G41A 5D2WA 4KBXA 3STPA 1QWKA 2ACUA 3LCHA 4X0VA 3RGTA 3WJYA 4LBRA 1GW1A 3AIUA 2CZVA 4DUVA 5DLCA 4XIAA 1SMDA 3W7OA 1VJSA 7XIMA 2Q71A 1GQLA 1HN1A 4GRSA 3RK8A 4MWAD 2PODA 5FSDC 1X1NA 2Y6ZA 1HL2A 3ATZA 3AIEA 3TYEA 4I6VA 3W6YA 5J04A 2PDCA 2QAFA 2ZZ6A 3E12A 3IACA 5LHFA 3W07A 3CV2A 2GUBA 4M0XA 1W9VA 3O7UA 4JTHA 3BPWA 1OINA 4AHPA 4H6QA 2PDUA 3BAJA 3V35A 1VR6A