1OYAA

Old yellow enzyme at 2 angstroms resolution: overall structure, ligand binding and comparison with related flavoproteins
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (flavoprotein)
molecule keywords OLD YELLOW ENZYME
publication title Old yellow enzyme at 2 A resolution: overall structure, ligand binding, and comparison with related flavoproteins.
pubmed doi rcsb
source organism Saccharomyces pastorianus
total genus 147
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1oyaA00
1SQ7A 1OX4B 3NZRA 4OGZA 1OFAA 3HGSA 4DF2A 3RLVA 3LRMA 1K7EA 4S2BA 1SO4A 3TAKA 5KINA 3LCGA 2V2HA 2H6RA 1X6UA 1TRIA 3I7SA 4Z0SA 3W7CA 3BG9A 1D3GA 3INPA 1GJPA 1TCDA 3UXDA 4CNOA 4JTGA 2V5BA 3NA8A 2PURA 4PL2A 3MHUA 3TXVA 1K3UA 3EWYA 3QEZA 1TREA 4R7JA 5D2VA 1JCNA 4XQ6A 4AHQA 1KA9F 2CZ5A 3HBLA 5DCDA 2YX0A 3LCIA 1P0KA 3M6YA 4K7YA 4ZL1A 2CZDA 5KSWA 1XKYA 8TIMA 1H5YA 1ME7A 1LBMA 1QPRA 4HSNA 3STCA 3NXFA 4MKNA 3P81A 5HNRA 2VEIA 4IPIA 3TC7A 4E2DA 2AQWA 2CLHA 2HS6A 3EXSA 4CNNA 2ISVA 3E12A 1KM0A 1RD5A 4O1AA 2BWGA 2ZZ3A 3DAQA 1KFLA 4PH6A 5HINA 3W72A 1F2JA 1UBSA 3M41A 2C0AA 1IXQA 1C8VA 5AHFA 1VHCA 4DO5A 2GVLA 4IJBA 3P74A 4LNYA 5AYYA 2FB3A 2YGYA 3GXPA 3STGA 1M6JA 4UIOA 2YCEA 1OHLA 4HNUA 5AFDA 5K4ZA 1ZY9A 1EWEA 4ALDA 3T44A 2C16A 2QJHA 3UWZA 5CZJA 4GXMA 4GWEA 1NAL1 4JY8A 4S1FA 4DO4A 1KM6A 1JCJA 3L0GA 3PC0A 2ZCGA 5FF3A 1TPUA 3NL6A 3KRZA 1W3TA 1F5ZA 4DBDA 2Y7DA 5FF2A 1RQBA 4UFHA 1GVQA 1FDYA 2QCGA 1W1ZA 3UD6A 4QAIA 3IV3A 1O5KA 3P67A 4CCDA 2RKXA 1G69A 1TPB1 4P61A 1NEYA 2X2GA 2GVJA 3TSDA 1A53A 3HG3A 2ZFAA 1L6YA 5C2XA 1QNVA 4K6AA 2ZA3A 5AHMA 1MEWA 4NJGA 2G95A 1SO3A 1SW0A 3C0JA 4O15A 4LT9A 5U7SA 3SIZA 5I3JA 3B03A 2FFCA 4KFOA 3SW6A 2Y88A 1JJKA 3EWZA 2A6NA 2NX3A 2CLEA 1FDJA 1F73A 1GTEA 4UNLA 1SSDA 1TPFA 1LOLA 5HMSA 1H61A 4M6PA 4EOUA 4XBKA 4AF0B 3I6RA 1JVNA 4ORIA 3TFCA 5HR7A 2QF7A 3W2UA 3EXRA 3NQ6A 3UZ5A 4UTHA 3C2RA 2Z1BA 4HT3A 3DFSA 3W70A 2TSYA 2E09A 4Y6GA 5CPMA 3W3OA 1OG0A 3BO9A 1M7PA 4JN6A 3G1AA 4N9BA 3U6WA 1ADOA 4YWIA 3W7KA 2E68A 4LVFA 4NZFA 5DXXA 2ZBTA 2E6FA 2G97A 5EL1A 5AYXA 4UTTC 3P5YA 1LZOA 3PULA 4O13A 5G4WA 4DF1A 1HO1A 4O11A 1VHNA 4IX0A 5FI8A 1YDOA 5I3KA 3G3DA 4K7VA 1F7BA 3BG5A 2A1YA 1TIMA 4R53A 4HHPA 2V81A 3NQVA 1XM3A 5EPDA 3BV4A 5BOOA 3NPWA 4JTIA 3NR0A 1TPH1 2RDWA 3M44A 1FCVA 5FEXA 1GVFA 2XN2A 3HB9A 3LTPA 1H51A 1EIXA 1SUXA 1OFOA 4UR7A 3FS2A 2QAFA 2FIQA 2H3BA 3NM3A 3GR8A 3PAJA 4WY0B 4Y90A 2J88A 1BWKA 3C2EA 3LV5A 1EP3A 1AL7A 3SI9A 1VCFA 1JCLA 2NV1A 3TC6A 4LVBA 4LVDA 4IMDA 5FEZA 3NPVA 5DBUA 3O6CA 1WOBA 3LLFA 4DO6A 3JRKA 1OVDA 4RLIA 1GT8A 3CM4A 2VFDA 3LM7A 4FO4A 3TMQA 3M0ZA 5G1TA 1G6CA 2FDSA 1P1XA 4AMAA 2PRHA 3IIPA 1KFJA 5IM51 3HIJA 2BXVA 4LWWA 4BF9A 3I68A 4O1BA 1K03A 5AN7A 2QCDA 2A4AA 4MZ8A 1THFD 2H90A 3UQNA 5F4SA 5DBTA 3TW7A 4UTMA 2JKEA 3BARA 1HG3A 1WYIA 1B4EA 2H8XA 2EPHA 3ABQA 1FUYA 3P82A 4OWGA 1RPXA 2JGQA 3KXQA 2ZTJA 4TO8A 3C2FA 4IUOA 1OX5A 4BR1A 3JR2A 4A21A 3O16A 3NQMA 4UTUA 2FTPA 4E38A 3T40A 3G8EA 1Q3NA 1H7XA 1VRDA 3V75A 1OFBA 3W2JA 5KZEA 4A29A 3TQVA 2X1UA 5HWJA 3DKJA 3W2NA 1K8ZA 4Z1BA 1LYXA 4ZQCA 2CWNA 4N6EA 3E96A 5D05A 3NQ7A 4QQ3A 3CC1A 1O5XA 3FJLA 6ALDA 5DY2A 2A7NA 4RXGA 5K9DA 3O6YX 4JEQA 3I7RA 4AB4A 3LLDA 4AVFA 2ZZ6A 4OHQA 3MYPA 1FXPA 5DELA 4UNKA 3W85A 5LGXA 4H3DA 2QAPA 4MY1A 5L6UA 2J6XA 3S5ZA 1TPDA 3LHZA 2V9DA 3NQFA 3VNDA 2YW4A 4NQ1A 1GZGA 3HOJA 2UV8G 2AGKA 1PV8A 5BNKA 1D9EA 3AO0A 1W31A 3R13A 3W1RA 2QCCA 4QM1A 1JR1A 1G7VA 4UMBA 1H7OA 2B0MA 3HMJG 2V30A 1LOQA 2YPIA 4RXFA 4DBEA 3S5OA 2C6QA 1SSGA 2C18A 1XDMA 1I8JA 4WUIA 1OFPA 4L4MA 5CSSA 1Z48A 3B0PA 4QNWA 3LOTA 1VC4A 3I65A 5D2XA 2Y85A 1XC4A 3HPSA 1F6PA 3W1MA 4MYXA 3FIGA 4IMFA 3HG2A 3O15A 3F03K 2VFGA 2B4GA 1XBVA 5F4XA 3G1FA 4A22A 4ZMGA 1LP6A 3U8GA 1ZAHA 4WXYA 4HPXA 3FYPA 3EX2A 5I3IA 3FKKA 2HMCA 3PVFA 3ATYA 2GUUA 1ZAJA 4RR4A 6TIMA 2CLOA 4Z0JA 5F2LA 3QSRA 3W7PA 5H2ZA 4W9TA 3BGJA 3M16A 2RH9A 3NL3A 1H7WA 2QDGA 3QQ0A 4XWUA 3G1XA 1O4UA 3RU6A 3V1PA 4AWUA 4MY9A 3W7NA 1G4PA 2QUTA 4LU0A 2VEKA 2BX7A 3VE9A 3Q37A 1K7XA 3OVQA 2V5LA 3LCLA 5BMWA 4JTTA 5AOUA 3NQDA 3C4UA 4GUHA 4DQWA 1KFEA 4UTIA 1PHQA 2I1OA 1W8SA 2Q8ZA 4JYDA 4RZ5A 3GKAA 3PR2A 2ZDRA 3NYZA 7TIMA 4K39A 3S5NA 4YCPA 3AJXA 4WD0A 3UWUA 1TTIA 2O7SA 3UY7A 3R89A 2ZZ1A 4XBSA 1LRQA 1LM1A 1W5PA 1WA3A 2ISWA 4JDYA 4MJMA 4UTTA 1XDLA 4HNNA 4LY8A 1PCWA 3W88A 3NM1A 5HWNA 1TJRA 1DJNA 3A9IA 3DI1A 4IMGA 2TRSA 3G22A 2V82A 1VLWA 4NJKA 5EKYA 4N4QA 5SWUA 1YLVA 3W7MA 3G24A 3E49A 2OMAA 1S5WA 4O0ZA 1CI1A 2EGZA 4GFSA 4Z1AA 3QW3A 1JRCA 2W79A 3UY8A 3WJYA 1ZAIA 3R8RA 5IBXC 5LNWA 3CT7A 4QJ1A 4ZQMA 3G1YA 2Y63A 3GAYA 2DJXA 3IRDA 2DZPA 3W74A 1QFEA 5KMYA 1GPWA 1LDCA 1VPXA 3DHFA 1X8FA 1FWTA 3PBVA 3T4CA 3UPWA 5CZ0A 1QAPA 4NNAA 4G1KA 2Q8LA 4NJHA 4XUGA 3CWNA 2A2IA 3NL2A 1MEHA 2ABBA 3LXAA 3RK8A 1FWWA 2EF9A 4M19A 4KWWA 1R2TA 3EWWA 4PC8A 3S0CA 5HUOA 3MO7A 4KFPA 2RHGA 3PWAA 5LNUA 1Z42A 5AHNA 3QRHA 4GBUA 1K02A 4JX4A 4EIVA 2RFGA 4EVZA 1IGSA 3STEA 2VEPA 3H54A 2YXGA 4O4WA 2VFFA 3B0UX 1H1YA 1OF6A 3W84A 3HG4A 1WQ5A 5I3GA 4LOCA 2PE4A 3LXBA 1OK6A 3EKZA 3VCRA 5LNVA 4NNCA 3HPZA 1XUUA 4CLMA 1JCMP 5E0KA 3W1UA 5C55A 1MZHA 5LSMA 4ZZ9A 1A5CA 1FCUA 3DFTA 1UJPA 3WJXA 1OFRA 2RDUA 1Y0EA 2WSQA 3C52A 2JGYA 3BGGA 2C3ZA 5FF7A 1G67A 5FEWA 3B4UA 4MPQA 2DU2A 3CEUA 1DQWA 4Q4KA 3N73A 1YXCA 1P4CA 1KLZA 3SY5A 3ELFA 3N9SA 3THAA 4JX5A 4ONVA 2JK2A 1VQTA 2OX1A 2ZRVA 2C13A 3TA6A 3KVKA 5G1YA 1J5TA 1DOSA 1Q45A 4X3ZA 3UNDA 1A5AA 3L67A 2NV2A 2R8WA 2Z6JA 1GG0A 3UZJA 1DORA 5HWMA 1LLWA 4U28A 1EUNA 1IIGA 4DXVA 1XXXA 5AYZA 2NUWA 3MI6A 4WOQA 4A3UA 4CQ9A 4U4MA 2PC4A 3EWBX 2ZRWA 4P2VA 3GVGA 3S1VA 3W7DA 3DU0A 1EEPA 1G4SA 1W37A 2B7NA 3FFSA 5L9FA 2CZFA 3TKFA 1MSSA 5C54A 3TDFA 2CU0A 2Y7FA 4UR8A 1LLZA 3CTLA 2I14A 4AXKA 3TUUA 2HSAA 1HFBA 1W0MA 2QCFA 1W5NA 4XKYA 2PRMA 3HGOA 3TV8A 1E51A 3TQ0A 3W83A 5KZDA 3FKRA 2XN0A 1GEQA 3HO8A 3GIYA 4CCCA 1BWLA 5KTLA 3GNNA 2NXHA 2WSRA 4NX0A 5C5YA 3BG3A 3S9YA 3BK0A 4LS2A 4O8RA 3LRKA 2VFEA 3L0NA 2OCZA 4JTKA 2QJGA 1EB3A 1JQXA 3EX3A 4AWTA 1XBYA 2O7QA 1TQJA 1VJIA 4J9JA 4LVAA 4PEKA 4BI6A 2P10A 3PSWA 3W2KA 4C1KA 4TMBA 4A2SA 4HSOA 3P80A 3CEPA 5CKSA 4UTLA 1P0NA 3G0XA 3QMTA 1G4EA 1JRBA 2Z0IA 3FLUA 3LI1A 2P0OA 3IEBA 3VFLA 1LRNA 4O1CA 2F7FA 3WJZA 2TMDA 2H8ZA 5LZLA 3C56A 3UYCA 5EYWA 2DORA 4H4IA 4FNUA 1ME8A 2GVGA 4JXCA 2GJLA 2FJKA 2RDTA 2VKZG 4MLRA 1DKWA 4X22A 3KVMA 3NAVA 1J4EA 2IQTA 3GLCA 4PCFA 4OT7A 3M47A 3BW2A 1DBTA 1RZMA 4Y9AA 2XFWA 1F76A 1T8XA 5LHFA 4DF0A 1B3OA 5ABTA 3N9RA 1KLYA 4RCXA 2R14A 4LUJA 1QR7A 1EWDA 4FEZA 4TIMA 2BZNA 1WXJA 2DZUA 1RV8A 2V0TA 4QITA 3W1AA 2VC6A 1RQEA 3RMJA 4Z1CA 3N14A 4UTKA 5DCBA 2C14A 2CLKA 2GQ8A 4XZ9A 4MY8A 3TR2A 4UFLA 4HIBA 2F84A 4NXKA 1H62A 3G1DA 3MBDA 4HN4A 1KV8A 2QCDB 3Q2DA 3A24A 5D2TA 3WJWA 3NL5A 3PUEA 1WBHA 1QMLA 1LROA 3O07A 4OV4A 1QOQA 1F74A 4JICA 3EX1A 2WSYA 3LV6A 2NX9A 4OU1A 3L2IA 4HKPA 1H60A 3NQAA 4K8EA 4YCOA 2WQPA 1W3NA 3G0UA 3HQ1A 3DGRA 1ML1A 3D0CA 5F1UA 1GYLA 2QCNA 4WQ6A 2E6DA 2X1TA 1TPEA 4Y96A 4JIPA 4MLJA 5AB3A 2DP3A 3QZEA 3QQ1A 3UWWA 3DHDA 3OEXA 3S1UA 1UUOA 1XUZA 4D2JA 1W5OA 5IBXA 5D38A 3DZ1A 2I9EA 4FIRA 1NSJA 2QCLA 4PA8A 3CU2A 4ADTA 4JTUA 4NT0A 3S1XA 3GNDA 3G18A 4JX6A 1ZALA 2ZZ7A 4BI5A 1ICPA 3QM3A 3MW7A 4R34A 2QCHA 2VOMA 1R46A 2DJLA 4I7WA 1T99A 3EX4A 5D03A 2J24A 2LLEA 5CPOA 3UWYA 3GR7A 3PG9A 3WK0A 1WX0A 1FBAA 2G5WA 4JTLA 3MP3A 3QFEA 1ZCOA 1TSIA 4NZJA 1UUMA 4ZQPA 3WK3A 4M6QA 2JBMA 4KKXA 5F2MA 5LNRA 3NG3A 5FEPA 1ZNNA 2ZZ5A 3C8FA 3HJZA 4WZHA 4N02A 3MI2A 3P7YA 5LHEA 4LV9A 2QJIA 1WAUA 3KVLA 3CB8A 5CPLA 3LCXA 3LI0A 3P61A 2GQAA 4O0KA 3L5MA 2Q3OA 3IVTA 4HNVA 5K7JA 1H7PA 1XBZA 2A21A 1VS1A 2QUVA 3TH6A 2ZRUA 4M6VA 1GQNA 3TU9A 2WNQA 1TB3A 3W7OA 5D02A 4IMCA 3SJ3A 1SZFA 1SFJA 4MJZA 1YYAA 1GOXA 5EA9A 2CW6A 3SGZA 1I4NA 1O60A 4UFMA 3P8IA 1ZENA 2V2CA 3EB2A 4MVAA 4O19A 3STFA 2PCQA 3TMLA 4E0CA 3EXTA 1CW2A 2GQ9A 4GRSA 1VCGA 1AL8A 1KTCA 1Q6LA 2PRLA 4MFEA 3LBCA 3L0KA 4JYEA 5CGQA 3SGUA 3UWVA 2ZRXA 3SFKA 4KWVA 3S8HA 5DXYA 4O18A 4E2BA 1V5XA 2NX1A 2CLIA 1LTDA 3LHVA 3WJSA 1M7OA 4HPJA 1W5QA 1SZEA 3QF0A 3EWXA 1YDVA 3K30A 1JUBA 1LBFA 3H53A 2V2DA 3W7RA 3FJ6A 2KZHA 3N19B 4PFMA 2TYSA 1QWGA 1BEUA 3TSBA 1R30A 4X9SA 3QSTA 2A0NA 4IPJA 5HJLA 1GVSA 4IX2A 1B9BA 5DLCA 4GUJA 3LRLA 5BRBA 4NUWA 3Q94A 3W6YA 3R2GA 1WBJA 1OFEA 3H55A 5DN1A 1KTNA 2C1HA 3PBUA 2CFFA 4O1DA 4JTJA 1W56A 3EEGA 4ZQOA 2Y7GA 2X16A 4LW7A 4WOZA 1A50A 1FWRA 3BLEA 2YW3A 1G4TA 3ABSA 5K9CA 3LHYA 3GDLA 1EPXA 4XTIA 1EP2A 3TE9A 4OBTA 1K8YA 2ATSA 4QIUA 3NEVA 2E6AA 3GB6A 1NFBA 2A7PA 3P84A 3EWUA 4FNSA 3NQGA 3W87A 3LTSA 1JCXA 3OVRA 1KV5A 3NGJA 3USBA 4TX9A 4OQVA 5TIMA 3W71A 4S2CA 1S3HA 3NOEA 3DI0A 1R2SA 4OE7A 3SSJA 3L5AA 3N2XA 4M7SA 4GUFA 2WKJA 3KHJA 3PBWA 3WK2A 1ZJIA 2VENA 1H1ZA 3UWQA 4AHOA 3T7VA 1VR6A 1H63A 4O12A 3GDMA 3B8DA 3W1QA 1KM2A 3PM6A 2X1RA 4ZQRA 1YTDA 1IXNA 2E77A 4CNPA 3IIOA 2FPVA 3GZ3A 3W9ZA 4PODA 1P5BA 4JTFA 2FQIA 1ONRA 3UXAA 1HL2A 2WJZA 3MI3A 2R91A 3S1WA 4UFIA 3DFNA 4ORMA 1FDZA 3NPXA 4Z1DA 4JS3A 1VYSX 1FY6A 3GX9A 4FX8A 1L2UA 3A5FA 4OV9A 4O10A 1IIHA 4RV8A 5AHEA 4UTWC 3LHWA 1YPFA 2B7QA 1FCBA 4I7VA 3GDKA 3W73A 5AC7A 3KFTA 1ZHAA 3M5ZA 4UCGA 4K37A 3W7IA 3MYOA 1SPQA 1FQ0A 1S5TA 1L6SA 2NXGA 4RJEA 1YXDA 4AWSA 3ZFHA 3N2MA 3G1HA 1GTHA 3QJAA 5TQLA 3B04A 3IGUA 4UXDA 3BVJA 4A2RA 3B06A 4YMZA 2Z6IA 1TO3A 4IWWA 1IXOA 1L9WA 4MZYA 4RZ6A 3LCWA 1AG1O 2OT1A 3P62A 4JR5A 5K2ZA 2QEZA 1VZWA 2Y6ZA 1QPOA 1FXQA 1PVNA 3IVUA 3NNTA 3W1XA 3PBYA 1Z44A 3MWAA 3F4WA 5D04C 2JKPA 3GAKA 3NVTA 3W2MA 5K9XA 4XTDA 3LCFA 1V7YA 1IXPA 3TCEA 4FF7A 1ZFJA 3WK1A 2FPTA 1TPC1 2NUXA 1AW1A 2P1FA 3IVSA 3PY2A 1QPQA 2E5CA 3QH2A 2WO5A 1O95A 2VXNA 3EX6A 1PCKA 1AK5A 1FWSA 5U4NA 4QISA 3W1NA 2J9XA 1OFDA 2J9ZA 3SR7A 4JNMA 1LRTA 3CLMA 3O6DA 3YPIA 4FNQA 2DZWA 5J5DA 1PS9A 1FCQA 1UASA 4M5PA 5G5IA 1R2RA 1Q6RA 1OFQA 1OYCA 3VE7A 3MHFA 4MOZA 3FOKA 1OX4A 3PSVA 3RF9A 3LERA 3S6DA 4JY9A 3FYOA 3LHTA 1N55A 1XBXA 3R5EA 4Z08A 1KBIA 4GE8A 3HGJA 1YPIA 3Q58A 4O53A 1WDWA 2C15A 1ICQA 1SU5A 1OK4A 4NX5A 2BLEA 3N34A 1SW7A 5D33A 3BLIA 5LNSA 3DFPA 4XKYB 3FEMA 1VH7A 4O52A 3G1VA 2OT0A 1JULA 3GXTA 4FNRA 3ABRA 3TFXA 3NDOA 2ZRYA 3LBMA 4YLWA 1DVJA 2ZA1A 3BPWA 1U83A 2QR6A 2ALDA 2JKAA 4UFKA 3S42A 3PS7A 3WFAA 4N2YA 4AHPA 4WY0F 3W07A 4FIQA 5G4EA 4M7TA 3DFQA 2VFHA 3W1LA 2DZVA 4LVGA 4JYFA 1N8FA 3SECA 5CPNA 2OZ0A 3W7HA 5BMXA 3TSMA 1TTPA 4X2RA 4QSHA 2ZRZA 2W0UA 1C9DA 1TRDA 1DV7A 3OA3A 1LOSA 1TPVA 3GYEA 3CWOX 3L65A 5E1QA 1VCVA 4IQLA 5D2WA 5K4XA 4BWLC 1T0OA 4CCEA 1LORA 3HF3A 5J5RA 4UTJA 1JQVA 4N9DA 2BTMA 3SZ8A 2DZSA 4WXZA 3GK0A 1GG1A 5EMUA 2GJNA 5D09A 3LX9A 1UB3A 4MFDA 1RQHA 4JD4A 2TPSA 1EX5A 4BK9A 1GVRA 4MIMA 3TNOA 3PB2A 4L4LA 3BLFA 1SR9A 2ZTKA 3NQCA 3CQ0A 1S5VA 4IXHA 1SO6A 4DEFA 3P60A 1N7KA 3TAOA 3JS3A 4TU1A 5A8GA 5K3VA 4FNPA 4R33A 3LB0A 4NXSA 3UPBA 3T55A 1EUAA 3M5YA 1TV5A 3QC3A 4FX7A 3RLUA 1DL3A 2QDHA 1TJPA 3C6CA 2X1SA 5AC8A 2AAMA 3L5LA 3W75A 3O05A 5TBOA 5AHIA 3DENA 3HG5A 4MYAA 3A22A 4O54A 2DZTA 5F2GA 3F1QA 2E1DA 3GDRA 4ML9A 3S5YA 1KFCA 3DXIA 3L21A 4JIQA 1W3IA 3PUOA 4LRTA 1R47A 2G96A 4EWND 4TMCA 2YSWA 1AMKA 4LS0A 2C19A 4ADSA 3QMSA 3KX6A 1RVGA 1D3HA 4BFAA 4ICNA 3G0SA 4LC8A 2NLIA 2ZYFA 4JGDA 3W86A 5AC6A 1VLIA 3VKJA 1OYAA 5KZMA 3F4NA 4AF0A 3O8AA 1MXSA 1DHPA 3OHIA 1DJQA 2VFIA 4WJEA 3DH7A 2ISSA 4UMCA 3LCHA 1W5MA 1Q6QA 4FXRA 4RZ4A 1VGAA 5G2WA 3G1SA 5H91A 1B4KA 1ICSA 3DFOA 1IF2A 2EAWA 3O1NA 3U2OA 3TX9A 3QPYA 1F05A 4AAJA 5LGZA 2CLLA 4CQ8A 3KRSA 3NQ8A 1KFBA 5CZTA 4LUIA 4UTWA 1KTBA 3HPXA 1NVMA 2VELA 3OVPA 5D32A 4H6KA 4Q32A 1YADA 3W7QA 5KITA 4K8HA 1JUEA 3MHGA 5HR6A 1GVOA 3OIXA 3B0VC 3C2VA 5F2IA 1U5JA 5HQEA 2E5DA 1SZGA 2E6YA 4WY0A 3ZS4A 3M7WA 4UMAA 2A6LA 1YXYA 3E02A 3O63A 4FXSA 4K36A 3T78A 1RR2A 4Q33A 3TJXA 1KM5A 3TROA 4EF9A 3NZ1A 2B7OA 3W7GA 4TR9A 4HNTA 1BKSA 3IGXA 4WX2A 1KBJA 4RKAA 3G8RA 1TV8A 1YTEA 5I3FA 3BW3A 2GPTA 1T96A 2QKFA 2YDAA 2J9YA 4NJJA 3KAOA 1LCOA 1PE1A 1X1ZA 1QCWA 1I2OA 1C29A 2EHHA 5HULA 1KM4A 3M5VA 4NJIA 3ZWSA 4ZVJA 3CPRA 3W23A 3TJLA 4IOTA 4DPPA 3KVJA 3LDVA 1OJXA 3A5VA 4JDBA 2Y61A 4O14A 5GVJA 5CSRA 2Y70A 4O17A 3GXNA 2D73A 4DELA 4FNTA 4UFJA 1FWNA 2NZLA 5CG7A 3RNDA 3KRUA 2A7RA 1Q6OA 3E0IA 4YL2A 4CQAA 2EKCA 1ME9A 1HUVA 1M5WA 2FB2A 5CZSA 1OF8A 1H50A 3OG3A 3G3MA 5FESA 4N9CA 1A5SA 4O50A 1VYPX 4UUIA 1AW5A 3P5ZA 4IGHA 5MHBA 2WV8A 1H7NA 4KFNA 1VYRA 3NO5A 2VEMA 1SZNA 1TMHA 2DZXA 4O16A 3TXZA 1K8XA 2B7PA 2R94A 4ADUA 3PF3A 5D2YA 2E5BA 3THQA 2Y7EA 5HUPA 3ZR4A 3LGEA 4JTSA 1SO5A 3W22A 2NXIA 3W7LA 3DBPA 3PG8A 4IMEA 3M43A 2OJPA 1EA0A 1QO5A 4ZQNA 3B05A 1JCYA 2WPBA 4LC6A 5F1VA 2YR1A 3A21A 3VI2A 1QDSA 3LTYA 4C1LA 2YYTA 3ZWTA 5G2HA 2NWSA 2X30A 1I2QA 3I7QA 2FLIA 3W7EA 1QPNA 1QOPA 5BW6A 3FA5A 1XCFA 4PTNA 1HTIA 3NQ2A 3W1PA 1NF7A 3DKLA 1K7FA 2J27A 2QCEA 4EF8A 2WOQA 2CLFA 2FPYA 5DCEA 1PL9A 3M9YA 4I9AA 1O94A 1KFKA 1TV7A 5LKYA 4NVTA 1KM1A 2Q3RA 3ABOA 3HGRA 4GNJA 1KM3A 1WOAA 1Z41A 1MO0A 4LRSA 5EY5A 4BWLA 1G7UA 2WNZA 2ATMA 2Y89A 1H7RA 1PIIA 3MBFA 2XN1A 5C6MA 5DY3A 3L66A 3CIWA 2Y62A 2YFNA 3CIXA 3L9CA 3E9AA 3R12A 3C2OA 1YDNA 2Z2UA 3MJYA 4LS1A 4BI7A 3QPZA 1XFBA 1ALDA 3RFAA 1I2NA 1CX9A 3QYQA 3PB0A 1QO2A 1LBLA 4AEOA 1J2WA 1FX6A 2WNNA 5G2IA 2ZA2A 1I2RA 2YZRA 1MEIA 4GUIA 3ATZA 2YYUA 4N6FA 4FX6M 1OX6A 5FF0A 3MP5A 3IIVA 3TK7A 2YFOA 3MUXA 3GDTA 3BW4A 1XI3A 1BTMA 2NWRA 3L68A 2HTMA 2W6RA 1TTQA 3IIZA 1EP1A 1SW3A 2A85A 2QCMA 2BSLA 3MMTA 4JTEA 3PUDA 2GOUA 3TIMA 3W1TA 1WV2A 1X1OA 3W7JA 1I45A 4O4VA 5EBUA 1OYBA 3OBKA 1NF0A 3GKFA 2ABAA 1GYNA 1GWJA 4LV4A 4JTHA 1W54A 2NUYA 4FB7A 5FF4A 5E93A 4RX0A 2H3DA 1TYGA 3NQEA 3TQKA 1PHWA 4B5NA 3QMRA 1YTKA 3M1ZA 4I7UA 4K38A 4PL1A 4GJ1A 1A5BA 1SFLA 1HO4A 1TPWA 2ZQ0A 2V8ZA 3NPUA 5T26A 4MUZA 3CHVA 4GC4A 3C61A 3LXCA 3W76A 4QNEA 3IGSA 4MZ1A 1L6WA 4GUGA 5F4WA 1TTJA 2HS8A 1F6KA 4N9EA 4AH7A 1XL9A 1B57A 3ANYA 4O57A 4O28A 4UC5A 4LTSA 3O06A 5I3HA 2QUUA 4IXXA 5D30A 2A5HA 2ZZ4A 1KW1A 1OABA 3LHUA 4FHAA 3N3MA 4NNBA 3A23A 1X7FA 5AHLA 2CZEA 4N4PA 4Y8FA 3W2LA 1UCWA 4RK8A 2ZZ2A 1TQXA 3P8JA 1JUKA 4NU7A 3M5XA 4POCA 4YXGA 3EKLA 5D37A 3KOFA 3QW4B 1I2PA 1AW2A 3MP4A 5A5WA 3TW6A 3IIXA 4DPQA 1DQXA 3C3NA 2CLMA
chains in the Genus database with same CATH superfamily
1OFAA 3HGSA 2PA6A 3LRMA 4QP0A 3I6TA 4I8DA 3OQ8A 4S3JA 4AEEA 4TTGA 1SGJA 3WN6A 2VR2A 3LCGA 3MMUA 1K1DA 4NAEB 4Z0SA 2EPNA 3W7CA 1TA3A 2X0SA 1TCDA 1UP0A 1ZZMA 1V3LA 3NA8A 3N3TA 1UWQA 3MHUA 3GU2A 1K3UA 3GC2A 1HJWA 1TREA 5I79A 5D2VA 1JCNA 1JDAA 4DJEC 3SUUA 4AHQA 1KA9F 2CZ5A 4ZR8A 2OVLA 4OJYA 2HBVA 1RK6A 3LCIA 4KCTA 3UETA 2J7GA 2CZDA 8TIMA 2JF7A 2VEFA 3U7VA 3WDIA 3STCA 3RPMA 3ARWA 3P81A 1L0PA 2E9MA 2WC3A 1UIOA 3K8KA 2ZC1A 2GQ3A 1C9WA 1GOQA 3U3HA 4E4FA 2ZZ3A 4LY4A 4PH6A 1OD8A 1LWJA 2C0AA 3UWEA 1HJSA 4LAZA 4CD8A 1VHCA 4DO5A 2GVLA 4LNYA 4TQTA 3RM9A 2PGWA 1HJUA 2B31A 3S6OA 1OHLA 5K4ZA 4GVHA 1JGIA 2QJHA 3S2LA 1JFHA 1NAL1 1UD3A 4H6QA 2PDLA 4DO4A 3NURA 1KM6A 2ZCGA 1UC4A 4IFRA 1W3TA 1F5ZA 1FH7A 4W4QA 1EQPA 1RQBA 4QSFA 1E9IA 3D47A 3A6OA 3LEPA 3DUGA 3DYOA 1FDYA 4G7EB 4MB3A 1L8PA 1E0UA 4A05A 4CCDA 1TPB1 1NEYA 1FVPA 2G4JA 1M1BA 4PFHA 3HG3A 1OIFA 5C2XA 1L6YA 3BLPX 4NJGA 2G95A 1SO3A 3C0JA 4W89A 3MV11 2HXUA 3GIPA 3WMBA 5GQBA 2GSJA 4C5ZA 3EWZA 1IZJA 3VNIA 4AC1X 3WNOA 3UESA 4EP8C 4NZ3A 2CZVA 3UZZA 3V35A 3UG4A 4W7VA 4AF0B 4HMNA 4ORIA 4GQBA 3W2UA 5I24A 1CLXA 2Z1BA 2JEQA 1A4LA 4W8LA 2OQYA 4OIFA 5JH2A 5CPMA 3ITVA 4LPCA 3G1AA 4N9BA 2W63A 4H7VA 2ZBTA 1E0XA 5AYXA 5MKGA 3UJSA 3P5YA 4WSKA 3AYRA 2YJQA 4ZCWA 4I5UA 5FI8A 3ZVHA 5A2AA 1UYQA 1Q7MA 1S2CA 3W26A 1MYRA 1AJZA 4W87A 4IFOA 1W1YA 1QXLA 1OCJA 1VFLA 5BRPA 1UZ1A 3RU8X 3E2RA 4ZXLA 2RDWA 2VX7A 1TKKA 3LTPA 1SUXA 3FS2A 3PUGA 2FIQA 1V6XA 2QV4A 4WY0B 3T2PA 3A4WA 5HQMA 3LV5A 1RVKA 3T05A 1AL7A 3SI9A 1EHNA 4TVDA 1VCFA 3KBVA 3WF4A 2NV1A 4LVDA 4US6A 4Q4OA 3NPVA 2WC4A 4DO6A 1OVDA 4DWSB 2VFDA 3C86A 4FO4A 3AROA 5G1TA 4NG3A 1MUMA 2FDSA 4AMAA 2PRHA 1KFJA 4M6UA 3HIJA 4Z2HA 2BXVA 2W4XA 1TELA 3I68A 4RNFA 5AN7A 3TW7A 1AQFA 5CLTA 3ARXA 4XD5A 4GBDA 2JKEA 3BARA 5HJXA 1HG3A 1A0DA 4IP4A 3TP4A 1FUYA 3QOMA 1RPXA 9RUBA 3C2FA 1VF8A 4AFYA 1OY0A 4QEHA 5A95A 4E38A 3T40A 5FAGA 1FWDC 2PU0A 5DX7A 2AGTA 4TOQA 4EPDC 3G2GA 1MMFA 4W88A 4UOJA 3WLKX 2X1UA 5HWJA 3DKJA 1K8ZA 3BZJA 4Z1BA 5A1AA 1XF0A 2CWNA 4N6EA 1UH4A 1W8GA 1YBQA 3KS6A 5D05A 3ARUA 2QDEA 5DY2A 4DXXA 2A7NA 3VOCA 2VUNA 1XIMA 3E74A 4HPGA 2ZZ6A 1FXPA 1NWTA 4UNKA 1LLOA 2FZ9A 1OC5A 1CDGA 1L8NA 1OINA 3WO8A 4H3DA 1ZBWA 1VENA 4MY1A 3EOSA 4Q6JA 5CZKA 2CETA 3AZTA 3BJFA 1EC8A 3A3WA 3AIWA 4R9XA 1FTXA 1V77A 2YW4A 1GZGA 5CGMA 2UV8G 2X09A 2VZTA 2WMHA 3AO0A 3CJPA 1JR1A 2WBGA 2WMJA 2V30A 4WIWA 2BDQA 3FHQA 1SJAA 4DZAA 1WCGA 3NZQA 2C18A 4YJ5A 3PFMA 4U2YA 1WKEA 4L4MA 1CXKA 5CSSA 4QNWA 3I65A 1VC4A 3BMXA 1XC4A 3PZQA 3CO8A 3HPSA 3W1MA 3GC5A 1DWHM 4IMFA 3HG2A 3F03K 5BOEA 1AZ2A 1LP6A 3WEZA 4AZCB 3CUZA 3U8GA 1ZAHA 4WXYA 4HPXA 4Z2KA 3TWAA 3FYPA 3FKKA 3CBWA 3GWQA 3MMDA 3WEOA 2VL4A 1OIMA 2C71A 1SJDA 2F9RA 4DRSA 5BXPA 6TIMA 3QSRA 1FFQA 2Z26A 4ZB0A 3RUBL 1Z9AA 2FGZA 3EOLA 3VIPA 2RH9A 1H7WA 1X39A 3PNUA 1NELA 4D9PA 3LN3A 4MWAB 1MXDA 3G1XA 3MVIA 3LK6A 2VEKA 4UWMA 2YXOA 5FJJA 1K7XA 4CQDA 3WNPA 5BMWA 5GNYA 5AOUA 1X6LA 4L6DA 2VRKA 2VURA 1OQFA 4RZ5A 2RGMA 1DTUA 3S5NA 3IJLA 2QVNA 1UR9A 4WD0A 4US5A 4HCDA 3M64A 3GFZA 4KCVA 4XBSA 1J96A 1VFTA 3C5QA 3A47A 4JDYA 4UTTA 3SURA 4JCLA 3GTXA 1PCWA 1TJRA 4IMGA 1B90A 3ZOAA 4N4QA 3W4RA 3VAVA 3K4DA 1YLVA 3WDPP 2ADAA 4F0LA 1NDZA 2FVMA 1CI1A 1US0A 1R9XA 2PDWA 2Z4GA 3WF3A 3CAKA 1UD2A 4GZ7A 5IBXC 3G1YA 4L6OA 1GHRA 3GAYA 2DZPA 3UT0A 2VCCA 2QJJA 2HK1A 1ISVA 3VTRA 1WXZA 2XH0A 1FWTA 1NJJA 3BAKA 4MNMA 5CZ0A 1QAPA 4QTGA 2C1IA 3CWNA 2ABBA 1GQKA 4WDUA 3OU8A 1JIBA 2QYGA 3UG3A 2XSBA 1XPYA 1QHPA 4Q8PA 9CGTA 5M5DA 4C6EA 2XZ9A 2QZRA 3GVWA 4JAWA 3TA9A 5LNUA 3ALFA 3AICA 1PJ9A 2QIIA 1H41A 2F8QA 3KLLA 3VX0A 2NQJA 2VZUA 3TJ4A 4EIVA 3ITOA 3LGGA 4EE9A 1IGSA 3STEA 3R58A 1V4YA 3VGEA 1H1YA 2EPMX 3HFYA 1FWCC 4DJDD 3KM8A 4LOCA 1MW1A 2PE4A 3AS3A 5JVLA 1VFOA 3LXBA 5FJPA 3T0CA 7REQA 5M3WA 1OK6A 3K1GA 3PPCA 2FVKA 1RY8A 1XUUA 4MNKA 5AYBA 1OFRA 1G1YA 1Y0EA 2WSQA 3C52A 3FNDA 4GQRA 1Z8AA 5CH9A 2C3ZA 5FEWA 3A4XA 3B4UA 1W1IE 2V5DA 1DQWA 4Q4KA 1KLZA 2HRWA 3E2VA 3SY5A 1QRQA 4U5KA 3SY1A 1VQTA 2C13A 3P6LA 1PKYA 3ARPA 3LM3A 3IPWA 5G1YA 1NDWA 3OZPA 3UNDA 1A5AA 3L67A 2NQHA 4IPLA 1XXXA 5C7HA 1Q66A 3MI6A 2J7HA 2ZVIA 1FA2A 4A3UA 2C8NA 4DYKA 3RX4A 3OVGA 2PDHA 3KCOA 5CG0A 4IMAA 3FY1A 5BWAA 3TOPA 3NEHA 2G50A 3TKFA 2YDQA 1NOFA 1H0IA 1JPKA 5J8LA 4YTUA 3TDFA 1IR1A 4UR8A 1V02A 3OLEA 3W02A 3HTWA 4R5EA 1BXBA 1EL3A 5EBAA 3WLNA 2X40A 1DPMA 3L12A 2DZBA 2PRMA 3TQ0A 5KZDA 3S9IA 3AXMA 2PDUA 4J40A 5I77A 3CQHA 4CCCA 5KTLA 1HF6A 2WSRA 1DEDA 4DUXA 4NILA 5C5YA 3R11A 3MCMA 4NRRA 3N18A 4JTKA 2QJGA 1EB3A 1JQXA 3EX3A 3GM8A 5BU6A 1ODZA 5ABFA 2P10A 1CGYA 1YHTA 4C1KA 3S2NA 2P8CA 3P80A 1DJWA 3CEPA 2QXWA 4UTLA 6REQA 3AI0A 4KWOA 4HZ6A 3ITTA 1AQ0A 3U4AA 3N6QA 5D8WA 3LI1A 4AW7A 2P0OA 4B5SA 1LRNA 1PUDA 1EC7A 3N2BA 2H8ZA 3FVDA 1KGXA 1QNOA 3CUFA 4QG8A 5HMFA 3QHMA 5CJ5A 1XW8A 2VKZG 4MLRA 2XFRA 3SADA 4X22A 3KVMA 4MNLA 3NAVA 4DJFA 2W5FA 1AVAA 2WHLA 4PCFA 1J12A 4OT7A 3PTQA 3BW2A 1XLGA 1RZMA 5LHFA 5E9AA 4HHMA 5ABTA 2OO0A 4RNHA 1CTNA 4ZTXA 1RV8A 4DXKA 4X2PA 3FA4A 3TZNA 5EU9A 2OEJA 3R79A 1TWSA 2FVLA 1H5VA 3TR2A 2EKGA 2PP0A 4QX4A 2Y5JA 1H11A 5CJNA 2QCDB 2XHYA 3A24A 5D2TA 1K9EA 5FA5A 4Z2IA 3WL0A 1XSJA 4PUMA 4F0KA 2F6KA 4V15A 4M56A 1LROA 3O07A 1WDRA 5E9XA 1RUSA 3EX1A 2ACRA 3PTMA 2NX9A 4CVWA 4OU1A 3NQAA 4K8EA 4YCOA 3DG7A 1W3NA 2O56A 3G0UA 5EFDA 3DGRA 4CCZA 3GNRA 4WF7A 3GG0A 1GYLA 4WQ6A 3IJIA 5AB3A 5B7YA 3UFYA 3QQ1A 2IW0A 4HMDA 1W5OA 5D38A 3WUGA 3DZ1A 1XLBA 2O55A 4FIRA 1IT7A 4NT0A 5HPCA 1CENA 1GQIA 4JN7A 1ZALA 3QM3A 3MW7A 2VOMA 2ZXQA 3EX4A 3Q65A 1O68A 1M04A 3GR7A 5D9OA 1FBAA 4JTLA 3V5FA 2VDGA 3CHCA 2KX9A 4C6IA 3DHUA 1ZNNA 5I02A 3EZ4A 3C8FA 4FR6A 3HJZA 3UXLA 4WZHA 3AIRA 4N02A 2OU4A 1IWAA 3DX5A 3MI2A 4NHVA 3P7YA 1KR1A 2QJIA 1YDYA 1WAUA 3CZLA 4O0KA 3IVTA 1TCMA 4ICCX 4M6VA 3RX3A 4AY7A 2WNQA 3B9EA 1EX1A 4IUGA 3QPEA 1MW3A 3P93A 4J3UA 3SGZA 4PMDA 3UA3A 1B2YA 3EXTA 4INFA 2DH3A 4HZ7A 3VC6A 1AL8A 2G41A 2BGQA 4B3KA 3LBCA 3UWVA 5CGQA 5MF5A 2XIQA 3SCRA 4MSSA 5DXYA 1GVYA 5G1MA 1W3JA 1V5XA 1N2VA 4GKTA 3WJSA 3BCDA 1W5QA 3WH5A 3EWXA 4HK6A 1C8YA 3ALGA 1YDVA 3K30A 1JUBA 3H53A 4D6EA 2WHKA 4ZO8A 4RDZA 1BEUA 2P76A 4DUVA 1QI3A 4P8WA 1Q6CA 3I4KA 4BKNA 2HK0A 3WH9A 1VPYA 1W9DM 3HFTA 3WLMA 5BRBA 4JQ4A 4NUWA 3R2GA 3H55A 4W85A 5DN1A 3PBUA 3HQNA 1FHVA 3UERA 3VIFA 4JTJA 4AU0A 2Y7GA 1FRBA 1ELSA 3BLEA 4PMUA 4D8AA 1E15A 4QBXA 5GPRA 5K9CA 3SRDA 3DIPA 1EPXA 3KL3A 3VD7A 3T81A 1DYSA 5LA2A 4QIUA 3O2LA 2V5KA 3FHAA 2AMGA 3W87A 3APTA 1TJ1A 3H2EA 3UBPC 2V3DA 4TX9A 2VD9A 3W71A 2Z1KA 4S2CA 3NOEA 3SSJA 2D20A 4M7SA 3I10A 3V0UA 2VENA 1H1ZA 3FGCA 2YBVA 1EDGA 3E38A 1VR6A 1NTHA 3LNPA 2X1RA 2PDBA 3CMGA 2VTFA 3GZ3A 3W9ZA 4PODA 4CQBA 4L80A 4IQEA 4A35A 1ONRA 2ZICA 2WJZA 4MWAA 2CITA 4W5UA 4ORMA 7ENLA 1R3QA 1E55A 3GX9A 1E5NA 3ITYA 1L2UA 4OV9A 3E0FA 5IXEA 1IIHA 5AHEA 4NYYA 4DZHA 3LHWA 1AH0A 5E6ZA 1YPFA 1RLCL 4C6PA 5A3HA 2B7QA 3APGA 4KBXA 3FV9A 3GDKA 3W73A 3CHFA 4CNUA 1B3ZA 3MYOA 1SPQA 1S5TA 2XU2A 1L6SA 4HOZA 2H9AA 1YXDA 3L23A 1JNEA 4UQDA 3EAUA 3W27A 4AXNA 1TO3A 4MZYA 4RZ6A 5K2ZA 1VZWA 5HJYA 3BQ6A 3VNZA 1Y7VA 3PBYA 4M29A 1Z44A 4MTVA 4LNCA 1REQB 3MWAA 1XGEA 5K9XA 3RCMA 1KWGA 1V7YA 4C60A 3VIMA 3T9PA 4DWSC 3QR0A 4FF7A 3WK1A 6TAAA 3GU1A 4PMYA 3IVSA 2HEJA 4AMCA 4UB9A 1RSCA 4GVIA 3FX4A 1FWSA 2INZA 4QISA 4DB7A 1GOOA 2J7EA 2J9ZA 5BCAA 1LRTA 3CLMA 5J5DA 4EK7A 1PS9A 2VX4A 1UASA 5I23A 5CPTA 1OYCA 2FZMA 4HPHA 2WKLA 2JIEA 2PWHA 3OO2A 5A6BD 2JIWA 4Z08A 3R5EA 3HGJA 4ERIA 5BXTA 2VO5A 1B54A 1WDWA 5JXQA 1ICQA 2NT1A 1DWJM 4L9XA 5H6HA 2OSYA 4C6FA 2OEKA 5D33A 1NU5A 3BLIA 4Y8EA 4XKYB 4MKVA 1VH7A 5HBFA 3GXTA 3ABRA 3PJUA 3KW3A 3NDOA 4DJDC 4JOMA 4YLWA 1D2KA 4OBRA 1UMYA 3WYZA 2UWFA 4DN1A 1JZ7A 2JKAA 3S42A 3BAWA 3WFAA 4AHPA 1XLJA 4ZO9A 4AD5A 2DZVA 1C92A 3CAWA 4KETA 2OELA 5A6MA 3SN0A 3DYMA 2OFJA 4I5XA 5CC5A 4QSHA 4GH3A 5AVNA 1DV7A 3OA3A 2R1MA 4XZLX 2OLAA 5AC4A 2REQB 5D2WA 5BYWA 1ECEA 2R1NA 5LA1A 4GISA 2BTMA 3UNTA 2FMNA 4JTRA 3GK0A 1GG1A 2FKPA 3DCPA 2Y2WA 3WBAA 4MFDA 4JD4A 2IPJA 1W1PA 3TNOA 1C8XA 4GGHA 1ZRQA 1MVYA 3BLFA 2Y24A 1JG9A 1S5VA 3GFYA 1TZZA 4JTCA 1N7KA 3TAOA 5DRCA 2QW5A 3EOUA 2PDPA 4NXSA 3TYDA 2DQXA 3M5YA 3HPFA 1L2QA 3U0HA 3GTHA 2VR4A 2QDHA 2PFHA 1D7KA 1JPMA 3EPNA 3W75A 3O05A 1JEZA 2OZ8A 4DYEA 3RO6A 2DZTA 4BCEA 2PU1A 3F1QA 1E6XM 3GDRA 1W1TA 3DXIA 5DT7A 4Q8VA 4ZENA 4EWND 4TMCA 1RBOB 1XINA 4PMOA 1AMKA 3UR2A 3T42A 1OGBA 1GONA 3KX6A 1D3HA 4BFAA 3P14A 2ZYFA 3W86A 1VLIA 2ZUTA 3M0LA 1OYAA 2GOKA 4IFKA 1A4MA 3F4NA 3SCTA 3O8AA 3OHIA 2QMKA 2VC9A 2DPEA 4ZE4A 1QASA 5EMLA 1GJUA 3VD5A 5H91A 1B4KA 2PLCA 2XZ7A 1IF2A 5HPOA 3QPYA 2G8ZA 1F05A 1RY0A 5LGZA 2CLLA 2CBUA 1KFBA 4B3ZA 1VBRA 1RA0A 1SJBA 4UTWA 3LS9A 1GK8A 3ZLGA 2BXZA 3HPXA 2EXOA 3KBWA 3L4XA 4IG2A 2CEQA 4FSAA 5LIXX 3ORWA 2ISFA 1WZAA 3W7QA 3BAYA 4A3YA 1JUEA 5BRQA 4JEJA 4B15A 2VHLA 3CV6A 1U5JA 5HQEA 4BF5A 1QI0A 1HKWA 1IR2A 2W9MA 4B92A 3CMFA 3H21A 1S5MA 4FXSA 3GUGA 2A3AA 3T78A 3N17A 4EF9A 4KF1A 1E5JA 2B7OA 1JF6A 1BKSA 2NSXA 1QUMA 1YTEA 2YDAA 1AJ2A 3OGRA 5JMUA 1PE1A 2IKGA 1C29A 4JFWA 1QNSA 1U30A 3M5VA 3NFUA 2QQ6A 2WMGA 4DAFA 5EFFA 4C7GA 5M03A 3KVJA 3VNYA 4WEVX 3VD9A 2GGJA 1UKTA 1HZYA 2Y61A 5GVJA 1TG7A 4C6NA 2Y70A 4O17A 3N11A 4UFJA 1ISYA 1FWNA 2NZLA 1SMAA 3L7RA 1Q6OA 4YL2A 3O7UA 3WLRA 1M5WA 2FB2A 2OWCA 1UWTA 4AX6A 1OF8A 2V38A 1H50A 4H8UA 3G3MA 2DY3A 1AW5A 2EPOA 2WVSA 2HVNA 4KFNA 2VEMA 1V0NA 3V1HA 2DVXA 1H49A 1S2VA 4S3GA 3RCYA 3KDNA 4PUKA 1DHKA 4TVCA 2WSKA 3SCNA 3ZR4A 3BJSA 1M53A 1YNPA 3PG8A 2P8BA 4GFIA 4IMEA 2X41A 1TV2A 2WPBA 4LC6A 2AOSA 4F0RA 5A6KA 4C6OA 5C9WA 1GW1A 2FMOA 3GH5A 3GQYA 2YYTA 1MQPA 2XUCA 3ZWTA 1UD5A 1UW9A 1KKOA 2FLIA 2V3EA 1QOPA 3SCVA 1XRFA 3WQWA 1DE5A 2GDVA 1K7FA 4EF8A 1TVNA 4UNIA 1J2BA 1MW0A 2WOQA 2CLFA 4QJ4B 1R3VA 3ITGA 1EZWA 4GOAA 3G6LA 1TV7A 5LKYA 4NVTA 1DIEA 3HGRA 4FAMA 4G7FA 4GO9A 1V3MA 3REQB 2HJPA 1R5YA 1YNQA 2WCGA 1G7UA 2WNZA 2QNEA 2ATMA 4AD2A 1TWDA 3AHYA 3QR1A 2WBKA 1DIKA 2YFNA 4R9OA 5LIKX 5HNNA 1R87A 1QU4A 4URIA 1OC7A 4H1ZA 3R12A 3HN3A 1YDNA 2Z2UA 4M3PA 1JGMA 3E3HA 4HU4A 2WXDM 3QYQA 3PB0A 4RE0A 1QO2A 4AC7C 1U1HA 4B9ZA 3STPA 1BRLA 1E1CB 5G2IA 1R9YA 4DWDA 3ATZA 1SFTA 4N6FA 1J10A 1XIBA 5A8MA 3MP5A 3SQMA 1JZ2A 3TK7A 1FWEC 2YFOA 1Q7QA 3BW4A 5JBDA 2HTMA 4Y2WA 3IIZA 1SW3A 3ZXWA 3GNOA 2GOUA 4HYWA 3TIMA 3LPPA 3T08A 2Z1WA 1WV2A 3IRSA 3W7JA 1I45A 4O4VA 3TYCA 3BV7A 3GKFA 1M7XA 6ENLA 4LV4A 2I5QA 1W54A 3ZJKA 3CUIA 1R86A 3A64A 2ODOA 3CAVA 3NQEA 2PP1A 1PHWA 3CS2A 3AU6A 2WM1A 5RUBA 3CZJA 2GJXB 3QMRA 1ADDA 4K38A 1J0JA 2X2YA 2V8ZA 4TX8A 5T26A 2PWDA 3C61A 2D0FA 1CXHA 1KCZA 4GUGA 2AQVA 2PCEA 1TTJA 1U22A 2WHJA 4N9EA 3DN5A 3S4TA 2GGGA 2IPGA 3ANYA 2YXXA 3ISIX 4LTSA 4P8XA 5D30A 2YCIX 1EJWC 4AVNA 3GTIA 3LHUA 4FHAA 1V51A 3A23A 1W1A1 3V16A 2XVPA 2PODA 4J28A 2PWGA 2CZEA 3DC0A 4A8NA 1OG6A 4KEMA 2E7FA 4NU7A 3IUIA 3M5XA 1NY1A 1X38A 3SUTA 1HL9A 2PDKA 1YRRA 2VGBA 1I2PA 1AW2A 3KOYA 4PMXA 3TW6A 3IIXA 4DPQA 3C3NA 1TWZA 4HOWA 1SQ7A 3I4EA 3RLVA 3RITA 3GG7A 1SO4A 3TAKA 5KINA 4M51A 1R9ZA 2V2HA 2YL8A 3ARRA 1KXTA 1E9YB 3BG9A 1D3GA 3GH4A 2O9RA 3INPA 4PSRA 3UXDA 4JTGA 3A9BA 2V5BA 4PL2A 3LPGA 5HAOA 3LMZA 4DY1A 2YOCA 1XFCA 2YL9A 2YX0A 1P0KA 2WCAA 4AZBA 1YNYA 4GI4A 4L56A 1HKJA 1ME7A 3QY8A 1LBMA 2DT2A 3MC5A 3IK4A 4LXFA 4EX4A 1NP0A 2HS6A 3EXSA 3E12A 4O1AA 1ZBCA 2BWGA 4M81A 1EF2A 4GGBA 2Q02A 1UBSA 3M41A 3USZA 1LT8A 1IXQA 1C8VA 1G0CA 1BG9A 1X1NA 2FH8A 3KHDA 4I5RA 4I6KA 5AYYA 4BZYA 3VUPA 5CBIA 1M6JA 4UIOA 2FZNA 3WFLA 5CZJA 4GXMA 4W7WA 4GQ0A 2PZ0A 2ZX6A 1DTNA 1E9LA 3FVMA 2VWTA 5FF3A 3NL6A 3KRZA 3CGTA 5AZ1A 1CLKA 1JDCA 4DBDA 2Y7DA 3TLQA 3WSUA 1UD6A 1E4IA 3IV3A 1O5KA 2JEPA 3UU0A 3CYJA 2GVJA 2RJGA 1A53A 3MSGA 4IGSA 2IKHA 2RAGA 1MEWA 1WAWA 1KXHA 1SW0A 5GNZA 4L61A 2VUYA 4GLEA 3GDBA 1FWFC 1XGDA 4F66A 3GD6A 1FWJC 1HKKA 1EBHA 3VOHA 3UJRA 1JJKA 3IACA 1XIGA 1IZCA 2CLEA 2NX3A 1FDJA 2J78A 4UNLA 4D6JA 3WQVA 4LBUA 4Z17A 4DUOA 4M6PA 4XBKA 4QAWA 2REQA 3TFCA 5HR7A 2C91A 3EXRA 3NQ6A 3UZ5A 1PZ0A 3BOXA 3GRIA 1M7PA 4JN6A 3WMSA 4JFTA 5EL1A 3KCJA 4PTVA 2NVAA 1OT2A 4IX0A 5I3KA 4PRWA 1X98A 4WKAA 5H8UA 1JPDX 2GGHA 3EMZA 1BQCA 3AOFA 3Q45A 5JIPA 3WQCA 1E4NA 1F7BA 3BG5A 2A1YA 1BTCA 4R53A 4HHPA 3QGKC 5G4HC 2V81A 3NQVA 2JFEX 5EPDA 3LLXA 4JTIA 3NR0A 1FCVA 1MUCA 1XH0A 1GVFA 2XN2A 2V67A 5FSEC 4BQ5A 2FZBA 1OFOA 3OBEA 4UR7A 3LG3A 3FDKA 3LYEA 1BVWA 1P6WA 1VAHA 4C1NA 2X0HA 3PAJA 5T8GA 1BWKA 4MGGA 1W9UA 5B7ZA 3CZGA 1JCLA 3TC6A 4LVBA 4QROA 3WF2A 3ARQA 3DC8A 5DBUA 1WOBA 3LLFA 5BXSA 4RLIA 1GT8A 1R3RA 1G9HA 3E0WA 3TMQA 1R6WA 3C0SA 1G6CA 5IM51 5C7VA 3UQNA 1OCBA 5DBTA 3SCUA 1WYIA 1B4EA 1TWWA 1UR2A 2EPHA 3P82A 4OWGA 2JGQA 2ZTJA 3JZEA 2HVOA 2C1GA 2FZDA 3SIMA 2ZVRA 4UTUA 1PIFA 2Z2BA 3R6IA 1B1YA 1HVQA 1PZ2A 4YVVA 1W32A 2CWXA 3BUVA 1AD1A 3SCSA 3G8EA 2J7CA 2WJDA 1VRDA 4FXFA 5KZEA 1NOWA 4AIBA 5CC6A 2AL2B 4ZQCA 3E96A 4F4RA 3KCLA 4QQ3A 4P7LA 1KXQA 5XIMA 2PDJA 3C2YA 3EWCA 3FJLA 1R8LA 1E71M 1A5OC 3O6YX 3CHEA 4U2ZA 1LQ0A 2HVMA 2OOGA 5DELA 3ICJA 4UBPC 2CLPA 1CGVA 8CGTA 2DVTA 1DJZA 1B0IA 1TPDA 3WDHA 3TTSA 3NQFA 1E0WA 3EEZA 3ZT7A 4NQ1A 4KGJA 3RLHA 4AD3A 3HOJA 1FKWA 3BCFA 4IPNB 1D9EA 4AWEA 2VQTA 5I2UA 1W31A 1I0BA 4UMBA 3M0XA 2B0MA 3XIMA 5FJTA 4RXFA 2G4FA 4DBEA 5C2CA 5EMKA 3KTCA 2J4GA 1OT1A 3VDHA 2WWCA 1OFPA 1EXBA 3LOTA 5D2XA 4Q8MA 4GK8A 3FIGA 5CBJA 1XLEA 2VFGA 4ZMGA 1XBVA 3WEMA 4C90A 4JTAA 3PPGA 1E70M 2HMCA 2BHUA 1OB0A 2W62A 3U9IA 2Y5EA 1A3XA 3WBXA 1ZJBA 2HQAA 3SBFA 2DEPA 4JIIX 3PTDA 3V0SA 1UZDA 1ONXA 4W9TA 2WNWA 3M16A 1TE6A 1CIUA 5DMMA 1XP3A 1XKJA 4E5TA 1O4UA 3V1PA 3RR1A 1M03A 4LU0A 2BX7A 3VE9A 1KBBA 3WLPA 1Q13A 2BVYA 3OVQA 1CB2A 3B9DA 3J7HA 1L6GA 1W3HA 2I7GA 4JCMA 3ARSA 2J66A 3NQDA 4DQWA 4CNTA 3HURA 1KFEA 2B81A 2I1OA 2ESCA 1MUWA 4JYDA 1QWKA 4YTSA 5CC7A 4ECLA 3GG1A 3LPFA 5DMNA 1UROA 5LA0A 3TN6A 2ICSA 2ZXAA 2O7SA 1E0VA 8XIAA 3UY7A 2INFA 1VJSA 4DNMA 4JL1A 1Q6FA 3EPOA 4UZUA 4MJMA 4DI8A 4B2DA 3FW6A 1SVDA 1DJNA 3A9IA 3WLOA 1V0MA 1W1VA 4REQB 3W7MA 4B3LA 3ZR5A 1UKOA 1S39A 1P0EA 1S5WA 2BB0A 1UC5A 4AUBA 4PMQA 2VZSA 4GFSA 1EJTC 3N2TA 4JFVA 1WZKA 3WJYA 1ZAIA 1BGGA 3CT7A 4GIRA 4QGCA 2F38A 2BHZA 3ITLA 1GPWA 1LDCA 1VPXA 1TA3B 3DHFA 1M01A 5BZAA 2GUYA 3L4VA 5FJRA 1JI1A 2BP1A 4NNAA 1BWVA 4GIEA 1ADSA 1K70A 1TX2A 3WMCA 2I9UA 4O1EA 4H6RA 4DJED 4GY1A 3CQJA 1MEHA 3LXAA 3RK8A 2EF9A 4M19A 4KWWA 1P43A 1HL8A 1R2TA 4PC8A 5HXMA 5HUOA 2ZUVA 3PWAA 1XLAA 1Z42A 5AHNA 1CECA 2JE8A 4RE3A 1XV8A 1XYAA 2RFGA 4EVZA 2VEPA 4NRSA 1QHOA 3QTPA 4PUJA 4XZIA 3VDBA 3B0UX 1GCYA 4HP5A 1KQYA 3W84A 3HG4A 4DM2A 2CCRA 3KTXA 3MA8A 4PR4A 4H9XA 3O0KA 3ENLA 2ZOXA 2D2JA 4ASTA 4I9JA 5PTDA 3W1UA 2XFFA 3TC3A 3DFTA 1IZKA 1UJPA 3XISA 1KNWA 1HW6A 2JGYA 1VPQA 3VNJA 1AH4A 1P4CA 3K2GA 3VU2A 4JHZA 3TA6A 2Z1VA 1B3WA 2UY2A 1J5TA 1DOSA 1Q45A 4CEUC 4X3ZA 4YHGA 1GQJA 3EOEA 2Z6JA 3R7MA 4DXVA 1EUNA 3SUSA 2NUWA 4H8VA 4NSBA 3EWBX 4P2VA 3GVGA 3BCJA 3LSBA 1EEPA 3FFSA 3P0XA 1T8QA 3PANA 4XD6A 2CZFA 3UYIA 5C54A 3G5EA 3DERA 4G6CA 1XLKA 1RP9A 2CU0A 1BXNA 2DIKA 3CTLA 2I14A 4AXKA 8RUCA 1XISA 2XYLA 2QCFA 2XSAA 3N4EA 3T4WA 1EXPA 1PTGA 3HGOA 4PMZA 1LG2A 3FKRA 4UOZA 4C5YA 3GIYA 4IP7A 5IDZA 2NXHA 3AZRA 1RJRA 2WK2A 3BG3A 2VGFA 3LRKA 2VFEA 2NSOA 4KT2A 2JF6A 3RO8A 3U2CA 1XBYA 1E56A 1VIZA 5MKGB 3IJQA 4C6CA 1UH3A 4A2SA 5CKSA 1FKXA 3KBSA 2XVLA 2Q6ZA 3AS1A 3ZVHB 3OOQA 3FLUA 1K9DA 3IEBA 3F7JA 2F7FA 4F2UA 2QDDA 3WJZA 2TMDA 3C56A 3CZ8A 4RW3A 1LL4A 2DORA 4H4IA 3LPOA 3S2CA 2GVGA 4NZCA 3TTQA 4LYQA 4AZ5A 2P3EA 1DKWA 3B8TA 3HJEA 4PEEA 2IQTA 3GLCA 3M47A 3ZJ7A 1F76A 4FOUA 1S2WA 3ZT5A 1B3OA 1DJGA 4U3AA 3N9RA 2JQXA 3MSDA 1QR7A 3HMCA 2BS9A 1J01A 2RUSA 1WXJA 2E25A 4QDMA 2C0HA 2V0TA 2Y8VA 3W1AA 2VC6A 2C79A 1V6UA 3RMJA 4YWSA 4FLQA 3PZ9A 1KRCC 4JKKA 2WAGA 4MY8A 3IWPA 3I6EA 1O6IA 4NXKA 1H62A 2PTXA 4FF5A 2HV5A 1KV8A 3WLHA 4LAKA 3AIBA 1J79A 1V0KA 3DESA 5C9ZA 1US3A 5E5CA 4DI9A 3WJWA 1WBHA 3GYCA 1HKVA 3JUGA 1LUCB 2R1KA 2PTZA 3L2IA 4HKPA 4AIOA 5ABHA 2WQPA 1ZQ5A 2WVVA 4NL1A 4Q4RA 3IJ7A 1QATA 1U33A 2E0PA 2QCNA 1BYDA 4JIPA 4MLJA 2DP3A 3QZEA 2O9PA 1Q6DA 3UWWA 3S1UA 4D6FA 4D2JA 3F5LA 1KRBC 3VMNA 3WNMA 3PBMA 1XDJA 4HMEA 4FS9A 1JPHA 4QQUA 3QC0A 1GZJA 1YBQB 3CYVA 3G18A 2ZZ7A 4BI5A 4G1NA 3RLGA 3VM7A 2DJLA 1O12A 4I7WA 1T99A 3N29A 5CPOA 1WX0A 3CUGA 4PTDA 1KCKA 2PUZA 4LB4A 3MP3A 1TSIA 3SEPA 4ZQPA 2JBMA 2QGYA 5LNRA 4UQCA 2NVCA 2GSEA 1W9BM 2ZZ5A 1EGMA 1WZLA 5LHEA 3CB8A 3LCXA 1UA3A 1D7FA 3LGDA 4HNVA 2VDHA 4NKCA 4RNJA 1VS1A 2GVEA 3TH6A 4LBSA 1GQNA 3TU9A 2F2HA 2EBNA 2VZOA 3OJGA 3V0TA 3SJ3A 1GOXA 5T9CE 1FOBA 2D0HA 2Z25A 1QW7A 1O60A 4AD0A 2V2CA 4O19A 2PCQA 3TMLA 3IK2A 4E0CA 3M0KA 4GRSA 2GGIA 1VCGA 1KTCA 1TIWA 2BOEX 2Z1SA 3L0KA 4JYEA 4LBRA 2ZRXA 1BXCA 3SFKA 3ONCA 4Y9PA 3S47A 4RNIA 2DQWA 4X61A 2WZIA 4HYRA 1CXIA 4E2BA 2I16A 3L4ZA 2CLIA 1LTDA 1O1ZA 3MT1A 1IT8A 1EIBA 5D8ZA 1M7OA 4GVFA 4ZEPA 3QF0A 4ZE5A 1QI5A 3R10A 1LBFA 3WQEA 1XIEA 3OQEA 1J18A 3TOYA 1N82A 3N19B 2AKMA 4DHGA 1WNOA 1QWGA 2PDIA 4JQ1A 1R30A 4X9SA 5A6BA 2A0NA 4IPJA 5HJLA 1GVSA 1NWRA 4O8AA 5DLCA 3H6OA 4GUJA 3LRLA 1FHDA 1XQLA 4WJXA 3W6YA 1WBJA 4NI3A 3N2CA 3W6MA 1KTNA 3GS6A 4J3SA 1W56A 3EEGA 4OOUA 4ZQOA 2X16A 4LW7A 4ZSTA 1TZ7A 4ZXOA 4ENLA 1HT6A 1UWUA 2ZKMX 3WD4A 1XYBA 4XTIA 1EP2A 5JUVA 1BAGA 1XH1A 3GR4A 5GNXA 2E6AA 5E0CA 1NFBA 2A7PA 1E72M 3LTSA 5I78A 1JCXA 3QGAC 2BOFX 3USBA 3MSRA 3IAQA 3DI0A 5KETA 1G01A 3L5AA 2D23A 3KHJA 3PBWA 2VEGA 4PUNA 3CL8A 4AHOA 3G6MA 3T7VA 1V0LA 3DOPA 2WMKA 6XIAA 3B8DA 4MPKA 3PM6A 2E77A 6PTDA 1BFNA 4JTFA 4U5IA 1TV3A 1HL2A 4L65A 1FDZA 3A3HA 4O10A 3OTRA 3WDQA 3WQ6A 4OBSA 1R38A 3LQLA 4LALA 3SRHA 2JALA 3RM8A 4I7VA 3KFTA 1ITUA 4OECA 4K37A 3W7IA 3OPSA 1B3XA 1J0ZA 8A3HA 3BLDA 3PZGA 1WP6A 1QNQA 4AWSA 5HA7A 3N2MA 2W91A 3IGUA 1EC9A 4UXDA 3OLDA 3BVJA 1PWLA 3S1GA 2CNCA 2Z6IA 3QZ6A 1UR8A 3E5PA 3LCWA 4L9YA 1XCXA 4JR5A 2QEZA 4KH2A 1JZ5A 1JDFA 3CHDA 3BAXA 3TVAA 4NZ4A 3F4WA 3D6NA 5D04C 3S5SA 3W2MA 7REQB 3ZVIA 4GD0A 1IXPA 4QFUA 1T7LA 3TCEA 1SR0A 1ZFJA 2FPTA 1TPC1 2NUXA 4JQ2A 5AECA 1IHIA 3UVIA 3QH2A 2VMFA 1O95A 3EDKA 2BVWA 1Z89A 1UR4A 1QNRA 4Q22A 3AFBA 2PLJA 4B5XA 2DSZA 4MKSA 1XLCA 4JNMA 3SCWA 3O6DA 4FNQA 2ZX8A 1FH8A 1BYCA 1GOWA 5G5IA 1R2RA 2FHBA 4MOZA 3GXDA 2CYGA 4E2OA 2P5NA 3FOKA 4QE5A 1OX4A 1DQUA 3GH7A 4JY9A 3PBGA 4HNOA 1E73M 1YPIA 1WO2A 2J7DA 4O53A 3WFZA 1OZMA 2Z2AA 1R3WA 1SU5A 2OWWA 2UY5A 4HD5A 1SW7A 3KOXA 4E6MA 3WLTA 4PRRA 3FEMA 4G9PA 3TFXA 4CD5A 4H8NA 1JZ4A 3VIIA 4RPQA 3BPWA 2WLYA 3AC0A 2ALDA 2DFAA 4UFKA 1TFVA 4N2YA 1VBJA 4M80A 8XIMA 4LVGA 2BY2A 4JYFA 4GXPA 2INEA 5ABFB 2OZ0A 5XINA 2CPUA 2D1ZA 2CXGA 6REQB 4X2RA 2BVTA 1B30A 2W0UA 3KZSA 3F4VA 3RX2A 4CU8A 2D2OA 3N12A 3CWOX 3L65A 4IQLA 4BWLC 3GXMA 4QJ5B 1UZ4A 4N9DA 4CN6A 4XK2A 2BNJA 5FJOA 2QPSA 3PK7A 3LX9A 1UB3A 3K4AA 4QRNA 1RQHA 2TPSA 4L64A 4BK9A 1Z69A 3PB2A 2PWEA 2J8GA 1SR9A 2I5IA 3NQCA 4K1WA 3NIYA 3CQ0A 3SB0A 3N6JA 1P7TB 3PZTA 4I6VA 4OZOA 3JS3A 4TU1A 3VNKA 4FNPA 3UPBA 4CD6A 4QR6A 1EUAA 4CU7A 1Y5VA 1TV5A 3BANA 2ZUNA 3RLUA 3C0QA 3M0MA 2X1SA 5AVHA 5AC8A 3L5LA 4LUTA 2HNHA 2ACSA 3PP7A 3SN4A 4O54A 3L4UA 5H1WA 5F2GA 2E1DA 1P6CA 4JIQA 1E3XA 4LH8A 2DVUA 3XINA 4ML4A 2O9OA 2C19A 3QMSA 4LYPA 1RJQA 4ICNA 2NQZA 4LC8A 2NLIA 4XBJA 3M0JA 4JGDA 1E1FA 3CH9A 1XYMA 3TONA 2DSUA 5XIAA 1DJQA 4WJEA 3H7RA 2ISSA 4UMCA 4YVXA 3U2ZA 3LCHA 4RZ4A 1VGAA 1SJCA 3DFOA 5LIWX 4TV5A 4AAJA 2VRJA 3O3RA 3NQ8A 4ERGA 1XRTA 5CZTA 4XZBA 3LD5A 2R24A 4LUIA 4MDOA 3UG5A 2PS2A 4H19A 4YTRA 1NVMA 3K8MA 2WYSA 2VELA 3OVPA 5D32A 2ZC8A 1CWYA 4KQNA 4YU1A 3WD0A 5M17A 1QK2A 4Q32A 1YADA 4U31A 4HK7A 2XVNA 3MHGA 2YDSA 4EACA 3B0VC 3C2VA 3RRAA 4B5UA 4D6DA 4IL2A 2QPUA 1SZGA 1E6NA 3HV9A 1W9PA 4XVDA 4WCJA 2O92A 5DF0A 4UMAA 7A3HA 5J04A 2WANA 3E02A 3MZNA 3O63A 3QLLA 1BSLA 2ANUA 1LUCA 4H2HA 1KM5A 2WB5A 2YBTA 3IGXA 3MCOA 3FDGA 3BLKA 5I3FA 1JAKA 1PX3A 1X1ZA 1J11A 3ZSTA 5KEZA 1QCWA 3WLQA 1JXKA 1I2OA 3W81A 1KM4A 4BEUA 3ID7A 4M1BA 2YA1A 1XRVA 1A49A 4J4KA 4PUWA 3AXHA 3THCA 3MUY1 2FH6A 2WCSA 1B3VA 1YPXA 1EJ7L 3OZOA 2D73A 3CT2A 2NQLA 3CQKA 4NAFA 5CG7A 4CQAA 3KWXA 1HP4A 2DZAA 1ME9A 1HGYA 4HU8A 4LUSA 4LCQA 3F4DA 5FESA 3S9ZA 4O50A 1VYPX 5FD0A 3GU9A 3WIJA 3RRXA 3WUEA 1BQGA 5MHBA 1H7NA 1VYRA 4HCLA 1SZNA 4M1RA 3EPMA 2DZXA 2CHRA 2B7PA 2R94A 4ADUA 1WXYA 4F0HA 2E5BA 3W7LA 3DBPA 3ZM8A 2Y8UA 3VABA 3NTYA 1EA0A 1V03A 3B05A 3B8VA 1JCYA 1BPLB 5I5RA 2YR1A 4GXWA 3GO2A 3SAZA 3I7QA 1YE6A 3FA5A 4PTNA 1HTIA 3KOWA 1NF7A 2J27A 2TODA 3KLKA 2PF8A 1L6FA 2WMIB 4PMNA 3AMDA 3TTOA 4HOXA 3VKBA 2Q3RA 3H2FA 4IPPA 1WOAA 4YTQA 1E40A 1EOMA 2YL6A 3GBDA 1MO0A 1RAKA 3ARTA 3S2MA 1H7RA 3FGCB 3CL6A 3L66A 3CIWA 3QKEA 2Y62A 3DG6A 3L9CA 3E9AA 1B31A 3AHVA 4BI7A 1XFBA 5CSYA 1FP8A 3RFAA 1I2NA 1CX9A 2E8ZA 4A4AA 4AEOA 1AODA 2ZA2A 1I2RA 1MEIA 4NIRA 4FX6M 3UG8A 4HTYA 4ZODA 1XI3A 3AIVA 1Q63A 2NWRA 2W6RA 1JYXA 2A85A 2BSLA 2OQLA 3PUDA 2GFTA 3AYTA 4Z42C 1QBBA 1CXLA 2H9AB 1WKYA 2PGRA 4FA3A 4GI6A 3GUWA 4IL0A 4H9TA 3QV7A 4FB7A 5CAKA 5E93A 2R9RA 2PD5A 2VM8A 3TQKA 4BQ3A 1EJSC 1AFSA 1ZCCA 4GHRA 4O1FA 1GZ1A 4PMJA 2UY3A 4PL1A 4GJ1A 1SFLA 2QT3A 2PPGA 3URQA 4CUCA 3GXIA 4MUZA 1XIFA 4GC4A 3W76A 2FZ8A 4DLFA 1TWIA 4Q8OA 2HS8A 4DWSD 4QE4A 5TAOA 2VR5A 3O06A 2R82A 4PCSA 4IXXA 2VT0A 2OO6A 1KW1A 1RCOB 3N3MA 2Q09A 4KEZA 3UPMA 1ITXA 3PWIA 1UCWA 2Z27A 3RILA 1AD4A 5DT5A 1JUKA 1XYLA 4POCA 2UZ9A 4GYPA 1ZJAA 3H2OA 3CIVA 3KOFA 2XGZA 4KIEA 4J27A 3RR4A 3MP4A 4DAIA 1HP5A 1RH9A 3BICA 1CB7B 1F07A 2MANA 3RYSA 2V3GA 3K13A 3UGVA 1P48A 1UBPC 2OSWA 3FXYA 4DZ5A 1R3YA 3LENA 3CL7A 2WZHA 3LBOA 4YYCA 1TRIA 3I7SA 1HKMA 3WZ0E 1FH9A 4CNOA 2PURA 3EWYA 5I7GA 4XQ6A 1PIGA 5LIUX 1I75A 3APYA 5BU9A 3VGGA 3E0VA 5DCDA 3M6YA 1NWSA 6A3HA 3MWCA 4B5TA 5KSWA 1UR1A 3W24A 1UKQA 1Z3NA 3M0VA 4HSNA 1QPRA 1VFMA 3NXFA 1XIJA 4MKNA 3KS5A 4GINA 4V33A 5HNRA 2VEIA 3TC7A 1EHAA 3IUHA 1QBAA 4S3CA 4C6QA 4RV3A 1RBLA 1KM0A 1PBGA 1UIPA 5HINA 1F2JA 1HN1A 5AHFA 4ES4A 4QDWA 1I9CB 3P74A 4IJBA 2FB3A 2YGYA 1KRAC 3GXPA 2ACQA 5C9XA 2EPLX 3AXIA 3STGA 4G2DA 1RA5A 4PBFA 4KWSA 4HNUA 5AFDA 1KXVA 1ZY9A 2AAAA 4ALDA 1Y5XA 7TAAA 2C16A 3UWZA 4AD1A 5KZ6A 4IIEA 4JY8A 1JI2A 2V5CA 1K4GA 1ITQA 3WLIA 1WDDA 3L0GA 3PC0A 3PJWA 3C0LA 3T07A 3ME3A 1F3EA 3F5JA 4XAGA 2D3LA 3CH0A 4UFHA 1GVQA 4AIUA 5FACA 3RCNA 4D8LA 1W1ZA 4MM1A 5HANA 4H8HA 3TEVA 2PF0A 3TSDA 1KC7A 3RDKA 5AHMA 4E3VA 1NP2A 4MWAD 5CCZA 2XIMA 4LT9A 5BOFA 3VOGA 4RDWA 3CMJA 3R4IA 3SIZA 5I3JA 4BS0A 5FCZA 2FFCA 2IS7A 4UZSA 1E1EA 1QNPA 4KFOA 3SW6A 1AQHA 2Y88A 1WE5A 4RPPA 2A6NA 5M2FX 1KBKA 2A79A 1SSDA 1TPFA 2X8RA 2VI0A 1LOLA 4IFKB 1H61A 4EOUA 4EXAA 1J0IA 1JVNA 4GCXA 4Q4PA 2QF7A 4UTHA 3EOOA 5C0QA 3C2RA 2FTYA 4C6DA 3W70A 4DBSA 2VCAA 4ACZA 4Y6GA 2GVYA 1X8CA 1V3KA 4GNKB 3HA1A 3NWRA 3U6WA 4YWIA 4LVFA 2E6FA 2G97A 4UTTC 3RG6A 1LZOA 4O13A 4C6BA 1LWHA 4PGLA 4O11A 1VHNA 2CBIA 3JVAA 1RCQA 5LIYX 1P7TA 1EF3A 3G3DA 3V7PA 4IG2B 4K7VA 3AXXA 3T0DA 2DIJA 3LQGA 5CGTA 4S3FA 1TIMA 2DT1A 3B9OA 1KO0A 4AY1A 1XM3A 4IGNA 3VXGA 3NZPA 5BOOA 2CBVA 2RDXA 4PUUA 3M44A 1H51A 1EIXA 3TCSA 2OLHA 4Z1YA 1ZUAX 3VNMA 5ECVA 2CHOA 1RLDA 4Y90A 4S3AA 1Q65A 3BL3A 3PZIA 3PAOA 1XICA 3AUOA 4PRTA 2CHNA 2GL5A 3NSMA 2OB3A 3ZIZA 4HVXA 4WGHA 2ZWZA 1FWHC 3AS2A 5FEZA 4ATDA 5IFTA 3GFXA 1YQ2A 3CM4A 3LM7A 4I8YA 3L4YA 4HNLA 1P1XA 1KFWA 3T09A 3VVGA 4LWWA 2E9BA 1K03A 2BXYA 3THUA 3BMWA 3CV2A 2A4AA 2XJ7A 4MZ8A 3CV1A 3T6CA 3CWHA 3GG8A 1UP2A 3ZYZA 3URBA 2H8XA 1J0YA 5IHRA 2YCLA 3A4JA 4I9TA 3ABQA 2QIWA 1XHGA 3KXQA 4TO8A 3WQPA 4IUOA 1OX5A 4DZIA 2OZTA 1H4PA 3GVQA 4EANA 4A21A 3NQMA 2FTPA 3QFWA 3V18A 3WDJA 4FK9A 4GI9A 3H2MA 4AEFA 1F4HA 3TR9A 5FL1A 1H7XA 4CD7A 5REQA 3W2JA 4A29A 4D72A 2DSKA 9XIAA 4XV0A 2IPWA 2VD8A 3CC1A 3PZVA 1O5XA 2QGHA 1XC6A 4GYKA 4RXGA 3H2AA 4JEQA 3I7RA 4AVFA 5A8NA 3WY1A 2P88A 3MYPA 3WLSA 4DJEA 1MRAA 3BOLA 1BYAA 1JXJA 5LGXA 5HMEA 5A6AA 2G3IA 3SSZA 1U1JA 1XPGA 2DSVA 3FJ4A 2PC8A 4IJRA 3LHZA 2V9DA 1HX0A 2G0WA 4R7WA 3W38A 1XCWA 3MS8A 2AGKA 1PV8A 3LZ3A 1P6BA 4TV6A 1XGZA 3R13A 2PDXA 2QCCA 4QM1A 1G7VA 3NUKA 3OGVA 4W84A 4M0XA 3UGRA 1Q8AA 4AZHA 3S5OA 4U33A 1J5SA 1I8JA 1X97A 5FJUA 4WUIA 4MWAE 4IIHA 3PTKA 3FCPA 3B0PA 4G8TA 1Z7AA 3VZZA 3W25A 4MMWA 4MYXA 3MY9A 1W6TA 1S1RA 4QS5A 3O15A 4Q7NA 2QV5A 3VC5A 3G1FA 4A22A 1KQZA 4E4PA 1BRLB 1SYTA 5I3IA 7ODCA 4ZTYA 2PI6A 3VIOA 4IP5A 4J3ZA 3ATYA 2F6UA 5HATA 2GUUA 1C93A 1A5UA 3UXKA 4Z0JA 4BA0A 3DBNA 5H2ZA 3EDFA 4V1YA 4GG9A 4KPLA 1AUSL 1CEOA 3BGJA 4JIHA 3H26A 3W0KA 4AY8A 3M07A 3R0DA 1R3SA 3QQ0A 4DJFC 3RU6A 3W7NA 1FWIC 1G4PA 4XIAA 3MKVA 2ONEA 1MXGA 2V5LA 3ZLHA 4JTTA 1MFUA 3C4UA 2WMIA 3KL0A 4V1XA 4GC3A 1PHQA 3HQPA 1W8SA 2Q8ZA 4FXJA 1KD0A 6CGTA 4K39A 3QY6A 3UA4A 3UWUA 1TTIA 3VNLA 3R89A 2ZZ1A 4AISA 1A0EA 4PB5A 1LRQA 1LM1A 2BG5A 2WQDA 2ZE0A 4U3CA 4JFSA 4F48A 1XDLA 4HNNA 3W88A 3VA8A 1UR3M 3DI1A 2TRSA 2V82A 1VLWA 4NJKA 1EDQA 3DYPA 2R1LA 5SWUA 2GK1A 4B9YA 3EA2A 4WLCA 1X96A 4F9DA 3A3XA 2EGZA 4Z1AA 3QW3A 3NQBA 2WZEA 1JRCA 4DM1A 2W79A 3UY8A 4MB1A 1FWBC 2IKIA 5DRIA 2DJXA 2EJAA 3W74A 2BFGA 3ERPA 4C7FA 1XLHA 1MDRA 3EBVA 4J2MA 3PBVA 3T4CA 3MU7A 5CXPA 3WENA 3MUZ1 3CPUA 3K8LA 2Q8LA 2YB1A 4NJHA 4XUGA 2DUZA 2PTYA 3WNNA 2A2IA 1XLIA 3H7VA 3VGFA 1FWWA 4P5UA 3ZQ9A 3CB3A 3EWWA 2NQ5A 3S0CA 3MO7A 3MMWA 1XG3A 3D3FA 3QHOA 4X60A 3RN6A 1NDVA 4HB7A 1VBUA 4BQ2A 4P7NA 4IQJA 4JX4A 3CASA 3SO7A 3OGSA 3H54A 2YXGA 1LQAA 4O4WA 3EKGA 3NCOA 2VFFA 2Y5SA 1OF6A 3B4YA 3BH4A 3AWOA 3VIGA 1DJXA 2OR2A 3VCRA 3EKZA 4AX7A 4GCAA 3HPZA 5CPQA 1DIOA 5TD4A 3C3UA 1R3TA 1JCMP 5E0KA 5C55A 1MZHA 4AIEA 1FCUA 2RDUA 1GJWA 1MNSA 3QN3A 3B3DA 3BGGA 4JNYA 1OSEA 4YHEA 5FF7A 3WCZA 2PDNA 3ZLFA 1G67A 2F61A 4MPQA 3CEUA 3N73A 1YXCA 1WB0A 4I3GA 4XZNX 2BY3A 4KRZA 3ELFA 3IS4A 3N9SA 4JN8A 4MJ4A 3RPTA 4ONVA 2OX1A 3T2QA 4Y7EA 4QLLA 3WLJA 2OEMA 1GG0A 3SQLA 2WKGA 5HWMA 1HNYA 3UJEA 4K2SA 2PTDA 4WOQA 3QV6A 4R27A 1LF1A 3BXWA 5GJPA 1KWKA 2ZX9A 2PC4A 3TZFA 1M3UA 1T41A 1EKOA 2G37A 4WJ8A 1W37A 2B7NA 1UUQA 4KRTA 1LLZA 3TUUA 2HSAA 4MB5A 1W0MA 4CNSA 1Y8BA 2OKTA 3TV8A 1E51A 3WQ8A 3N4AA 1U2YA 3GNNA 4NX0A 3ZSSA 5C9RA 4LS2A 2OCZA 2Z00A 3DECA 4HJFA 1TQJA 1VJIA 3UZYA 4LVAA 2J77A 2VX6A 4ROPA 3K1DA 3LA4A 4HSOA 3TYBA 2PBGA 1V7AA 1P0NA 1CGUA 3EDEA 3QMTA 1G4EA 4NI8A 1O5QA 1JRBA 2Z0IA 1EYEA 1HJVA 5C2GA 2E28A 4YTTA 3VFLA 3WG6A 4O1CA 1HKIA 4IIDA 1IQ8A 5EYWA 1NFGA 4FNUA 1ME8A 3UJFA 2GJLA 2FJKA 3OZYA 3PHAA 1VEOA 2W66A 4PTWA 1J4EA 4OOZA 2FDMA 4YNGA 3CUJA 4MWAC 4C1NB 1WDPA 4F40A 4DF0A 2J8FA 2R14A 1EWDA 4FEZA 2BZNA 4KCWA 3WDRA 3B0XA 4QITA 1RQEA 3MDWA 2QUNA 4WK9A 4UTKA 4UFLA 4HIBA 2F84A 2J25A 1FHLA 3AHXA 1XSKA 4AYGA 3G1DA 3MBDA 1I1WA 4ATWA 3Q2DA 2POZA 4GZIA 3NL5A 1VEMA 3PUEA 4XAZA 1Z6KA 4YVPA 1QMLA 1OBAA 4OV4A 1PKMA 1QOQA 1F74A 4PMVA 2X7VA 3OB8A 2WSYA 3N1AA 1Y5WA 3VIJA 1H60A 3HQ1A 1ML1A 1J8VA 3A4AA 3BLOA 3D0CA 5F1UA 4LSBA 2X1TA 1XD1A 1JYNA 3DHDA 3OEXA 2ISDA 1UUOA 1W91A 1XUZA 1K9TA 2QULA 5IBXA 3KL5A 2VQUA 1IWBA 2I9EA 1NSJA 3KBNA 4NZ5A 2QCLA 4PA8A 2HNEA 3S1XA 3GNDA 4JX6A 1JNDA 1ICPA 3B8WA 4R34A 4PBGA 3BE7A 1R46A 3HPAA 1E43A 4HBKA 4LEQA 2J79A 3TW9A 3TTEA 3BDKA 4PB4A 1H1NA 1UQZA 3QFEA 4NZJA 4A6GA 1UUMA 1R0MA 2VVNA 5F2MA 2PWVA 3NG3A 3K4WA 3U48A 4O0QA 5BROA 4EPKA 4Q4MA 1UJQA 3KVLA 5CPLA 1JDEA 1US2A 2XVKA