1OYAA

Old yellow enzyme at 2 angstroms resolution: overall structure, ligand binding and comparison with related flavoproteins
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OLD YELLOW ENZYME
publication title Old yellow enzyme at 2 A resolution: overall structure, ligand binding, and comparison with related flavoproteins.
pubmed doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase (flavoprotein)
total genus 147
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1oyaA00
4M19A 3TQKA 1ME8A 1W1ZA 4KKXA 4RKAA 3RLVA 4IOTA 3M9YA 4TO8A 2PRHA 2W0UA 4RZ6A 3P82A 2G95A 3TNOA 1B57A 1TJRA 1EP3A 4JYEA 3W75A 3W7GA 3L66A 2PURA 5LZLA 4ZQPA 1UBSA 1OX5A 4ORMA 2VXNA 3VCRA 1JUEA 3WK2A 2E5BA 4AVFA 1H7OA 3SR7A 3RNDA 1KV8A 3SIZA 3T44A 3PSWA 2V2HA 2C3ZA 2QCDA 3NXFA 3LCIA 2V2CA 1XFBA 5D02A 1B9BA 3C3NA 1LDCA 1OX4B 3IV3A 1Y0EA 2V5LA 1W3TA 3A22A 1ICQA 1M7OA 2DZVA 3LERA 1K7FA 2CFFA 4I9AA 1BKSA 2JGQA 4O17A 1QOQA 1FDZA 2QUTA 3LTSA 5HQEA 1GVOA 2QDGA 4PEKA 4LVGA 3W07A 4FNTA 4HPXA 2VENA 4UFJA 1XKYA 3R12A 1EA0A 4O1CA 2TSYA 3A5VA 5CPNA 3IIOA 2BZNA 2NXHA 2ABAA 3OVPA 2PC4A 3PBWA 1HTIA 4TIMA 2X1UA 1LTDA 1FDYA 2BLEA 2GJNA 2ZRUA 1OYBA 4GRSA 4LU0A 1O4UA 2A0NA 3PS7A 4UNKA 3TW6A 1PHQA 3Q2DA 3N2XA 2B7OA 4O50A 4LS0A 3S5NA 2YW4A 2DZUA 3U8GA 4AH7A 4MJMA 5I3FA 2YX0A 1S5VA 1ME7A 5EY5A 4POCA 5DCDA 4TX9A 1P0KA 1XXXA 1M6JA 5AC7A 3I7RA 4JS3A 3W2LA 4N4PA 1XBXA 1JCNA 3SECA 1J4EA 1XBZA 5DN1A 2J9ZA 1W5OA 3LGEA 3FKRA 2WO5A 2A21A 5H2ZA 1H50A 5FF3A 4LUIA 1ZAIA 2P1FA 3NO5A 2X1RA 3CWNA 3RU6A 5FF0A 5D03A 1DKWA 2HTMA 2ABBA 4NJJA 2JBMA 3E9AA 3HG5A 3RMJA 3TXZA 3KRZA 5FEZA 3LHTA 3WK1A 3NQFA 1JQXA 3EX4A 4O11A 3T7VA 1YXDA 3MI2A 1QPOA 3RLUA 2FPTA 3DU0A 1SO3A 1RZMA 5AHIA 5AHFA 3THAA 5BMXA 2PRLA 4K36A 1N55A 1LBFA 2YFNA 4JYFA 3W1AA 2NUWA 3P5ZA 4MZ1A 1OFPA 3FIGA 1HO1A 5HUPA 2Q3RA 4ZVJA 4QISA 1ZHAA 3TA6A 4Q4KA 5G2IA 1SZNA 1ME9A 3DZ1A 3G1HA 4JN6A 5T26A 3DI1A 3G3DA 4UMCA 4DO6A 2G5WA 5CZJA 1MEHA 4JTJA 1QPRA 2EKCA 1XI3A 1C8VA 3KX6A 1T8XA 3ELFA 4JX6A 4PCFA 4PH6A 2Q3OA 1RR2A 3UWWA 1SZGA 4Z1CA 1OF6A 2A85A 1A53A 1NF0A 3CU2A 3GXNA 4EF8A 3TSMA 1PL9A 5G5IA 4UTTC 1G4TA 1AL7A 2QCNA 3W1MA 4MY9A 3A21A 4BF9A 3GXTA 4H3DA 3NPUA 2B7PA 2G97A 1TPFA 4NT0A 3QSTA 3UPBA 4CCCA 5D2TA 1KFKA 1TQXA 3LHVA 1FWRA 2Y62A 3HF3A 1UASA 3N3MA 3N14A 4NJGA 5DXYA 2J24A 4JEQA 1GVRA 2DZPA 2O7QA 2QAFA 1W5NA 5AHLA 5KZMA 3MUXA 3G0SA 1SUXA 3QRHA 5KZEA 3NNTA 1KM3A 3CPRA 2H3BA 4UFIA 3HB9A 3C2OA 1AMKA 1C29A 3G0UA 1YTDA 3N9SA 3GVGA 3PAJA 1JCYA 3LXAA 1T99A 4TMCA 5FEWA 3O6YX 3P84A 5F2MA 1LORA 2WSYA 1CI1A 2ZTJA 4O8RA 2V81A 1NF7A 1X7FA 3CIXA 2ZQ0A 4L4LA 4OV9A 2R14A 5F2IA 4O4VA 3BV4A 3LXCA 5GVJA 3IGUA 3GX9A 1W5PA 1QNVA 3VFLA 4NJHA 3WJWA 1QO2A 1TV8A 3G1VA 4DBEA 3PG8A 4NJKA 3P61A 3UQNA 3M5YA 4O19A 2QCDB 1UB3A 1AW1A 1ZCOA 1HUVA 2A7NA 4O1AA 3H55A 2X30A 3NL5A 3NA8A 2NX3A 2QUVA 3NL3A 2Z6IA 1TIMA 2QCFA 4KWVA 1G7VA 4NQ1A 3LHWA 2EF9A 4A29A 1ALDA 4FB7A 4GUIA 4LV4A 1DOSA 1UJPA 2ZZ5A 2C15A 4O14A 5KMYA 3W1PA 4OE7A 4M6VA 5C6MA 3EWUA 2YFOA 3HGJA 2QJIA 2QCEA 3G22A 3N2MA 2NV2A 1XBYA 4M6QA 4N9BA 1OHLA 1B4EA 2W79A 4HHPA 2BSLA 4EF9A 4QSHA 4RXFA 4B5NA 3EXSA 1WQ5A 4EOUA 2JKPA 5AFDA 3M44A 4JTFA 5LNRA 5LGZA 3SGZA 4O16A 4PA8A 5HR7A 1FX6A 1YTEA 4UTTA 1CX9A 3WFAA 3HMJG 4MJZA 3QYQA 1OX4A 2Y85A 5CZSA 1XCFA 1FWTA 3R5EA 1UCWA 3HGOA 3GZ3A 3PWAA 2OT1A 1KW1A 1M5WA 1LM1A 3JR2A 4K8EA 3HO8A 2CLHA 3VE9A 4HIBA 3VKJA 4X22A 2J88A 5IBXC 1H7WA 2RDUA 2OCZA 3TXVA 4UTMA 3STCA 3MO7A 1W5MA 3NQAA 1Q6RA 1PCWA 1Z42A 4MUZA 3JS3A 5BMWA 1SO5A 4Z0SA 4JICA 4FNUA 3S6DA 1W54A 1L6YA 3UWQA 1I2QA 1QOPA 3T78A 3CHVA 1EUAA 1SW3A 1GPWA 4NX0A 1QPNA 1L9WA 4P2VA 1SPQA 4XBSA 5A5WA 2ZBTA 1KBJA 3S42A 3NQCA 5LNSA 3HGSA 3ATYA 3E02A 4A2SA 4O10A 3TC6A 1ZAJA 1VPXA 2V5BA 3UWZA 1A5SA 3E12A 4O53A 4J9JA 3WJZA 3T40A 4ML9A 4O57A 3NVTA 5E1QA 2WSQA 3UPWA 2GOUA 4AWSA 4RXGA 4K37A 1G69A 3S1UA 3P62A 3USBA 3LCXA 4RV8A 4IXXA 4GWEA 3MMTA 5CZTA 3TSBA 3TUUA 1FWWA 1BTMA 4FX8A 3DHFA 5DXXA 2CU0A 5HWMA 3NG3A 3IVSA 3NPXA 1AW5A 1SW7A 3G24A 1R2SA 4DF2A 4YCPA 1D3GA 3W7EA 1WAUA 2FB2A 3TMQA 4H6KA 3ZR4A 3NPWA 1NVMA 1BEUA 4HN4A 2V30A 4IUOA 1H51A 3FJ6A 4RR4A 3BW3A 3HGRA 3KOFA 5EBUA 3QQ1A 4YL2A 4RJEA 3RFAA 3W2KA 3F1QA 3W7DA 4YXGA 3EX6A 5EA9A 1TPC1 1WA3A 2WQPA 1HL2A 3HG4A 4FHAA 1CW2A 1F2JA 4HSNA 2E5DA 4FO4A 5D32A 1A50A 4WJEA 4AHOA 3DI0A 3W2UA 1V5XA 2E5CA 5G4WA 1H7NA 3W1NA 1R30A 3GLCA 3U6WA 1QPQA 4IX0A 4ZMGA 3CB8A 4DF0A 3CT7A 2R8WA 1Q6LA 1FCBA 3MBDA 2G96A 2H8XA 6ALDA 3LV6A 3W23A 5LNUA 3WK3A 4C1KA 1DV7A 1Z41A 3TSDA 3DFSA 3L0GA 1XUUA 1KBIA 1THFD 4LRTA 1FXQA 3STGA 1FXPA 1RQBA 1TSIA 1TV7A 4JNMA 4JTTA 4XBKA 3TFCA 3EXRA 4LS1A 4H4IA 4NZFA 3N9RA 4N9CA 1KV5A 3LCWA 5EPDA 2P0OA 1W37A 1P5BA 1YXCA 1HO4A 2WV8A 3O6CA 2RKXA 3TKFA 1P4CA 3R8RA 3A24A 2QEZA 5IBXA 2DZTA 4WXZA 2NUXA 5G1YA 4IMDA 4MFDA 1OX6A 4JDBA 4ADSA 3NGJA 1LLWA 3LHUA 1B3OA 3DAQA 4R7JA 4IX2A 1RV8A 1EP1A 1EWDA 1TB3A 2I1OA 3IGXA 2EAWA 3YPIA 4OQVA 4S1FA 3HPSA 3DBPA 2Y88A 3PM6A 3UY8A 4YMZA 2FLIA 4IMEA 1TPVA 3CM4A 4O28A 1KFJA 3UXAA 1KM1A 3IRDA 2ZRWA 1WX0A 2EHHA 4UIOA 1WBHA 5EYWA 5AYYA 2NUYA 1J2WA 1I8JA 4GJ1A 4JTSA 3W88A 1FY6A 5FEPA 1A5AA 2YGYA 2BX7A 2B7QA 1G6CA 3W9ZA 3C52A 3NQ7A 3ZS4A 2ZZ6A 2I14A 1WBJA 1RPXA 1PE1A 3BLEA 4UUIA 5K2ZA 4LUJA 1W31A 3KVJA 1L6WA 5AHNA 1W8SA 3QPYA 1PVNA 4K7VA 1IXPA 1XDLA 3W7MA 1F05A 2CLLA 2RH9A 1SW0A 3P81A 5AB3A 2X2GA 4KWWA 4EVZA 1WYIA 3LX9A 1H1YA 1HG3A 2GQ8A 2V82A 4UTLA 3STFA 4WD0A 4GUFA 3QMRA 1XM3A 1GVQA 5AYXA 5EMUA 3QH2A 2Y7FA 5K9DA 1OFOA 3LDVA 4CNPA 4M7TA 1FCQA 3W1RA 4DEFA 4CCDA 4KFOA 1XDMA 3PY2A 2E6AA 2NZLA 3O1NA 4NJIA 1A5CA 1R2TA 4HNUA 1GG0A 3NPVA 4DBDA 1VHCA 2NXGA 1LOLA 2YYUA 3W74A 4UR8A 2NWSA 3EWZA 2W6RA 4DPQA 1L2UA 2YR1A 3DENA 3TROA 3MHFA 3Q58A 2OMAA 4JXCA 1VLIA 2J9YA 4O1DA 3W86A 4FEZA 1C9DA 5D09A 4N6FA 4UR7A 4N6EA 3C6CA 3N19B 4CLMA 3M5XA 4DO5A 1TRIA 1LYXA 5MHBA 3DGRA 2VOMA 3B03A 1KTNA 3Q94A 8TIMA 1LBLA 1IF2A 3KHJA 3BLFA 2DZWA 4AWUA 1DJQA 4IWWA 3THQA 2YW3A 4O0KA 3EX1A 3H53A 5DY2A 1S5WA 1JCMP 4JR5A 1ZJIA 3TCEA 2C19A 2X1SA 4DPPA 4Y6GA 3LCFA 3E49A 2WNNA 3DFOA 3W1XA 1EB3A 3KXQA 3TU9A 3S5YA 4RCXA 2NV1A 1EIXA 1LCOA 4UMAA 1MO0A 2JKEA 5D04C 3TH6A 2YCEA 1YDVA 2X16A 2TMDA 5FESA 4LWWA 2C14A 2QAPA 5AC8A 5LSMA 3EWWA 4N9DA 3LTYA 5AC6A 1U83A 4JTIA 5HINA 2CZFA 2Y63A 1VJIA 2XFWA 2CLFA 3MYPA 5FI8A 4LS2A 5G4EA 3EEGA 1X8FA 1QFEA 3IIPA 4M5PA 3RF9A 3C2RA 2XN1A 1NEYA 4OBTA 1M7PA 2YYTA 1GVFA 5AHEA 5I3GA 3L0NA 1AL8A 1Q3NA 3W7KA 4BI6A 4ZQMA 1VLWA 1WDWA 3IVTA 2GPTA 5L6UA 4O0ZA 1VYSX 4MYXA 4NXKA 1KM5A 3MBFA 4WY0F 2FIQA 4Y8FA 2YPIA 1F74A 4MZ8A 2UV8G 1IXQA 3T4CA 3P8IA 3NZRA 2V9DA 5D2VA 2J6XA 2J9XA 2CZ5A 1H61A 5J5RA 2NX1A 3NL2A 2AGKA 3W84A 1K7XA 1WXJA 1SQ7A 1TV5A 1TTQA 4QIUA 3DFNA 3L68A 1GTHA 5K7JA 3NL6A 3BW2A 4O52A 5E0KA 5CPOA 1MXSA 3PB0A 3KVKA 3I7QA 4Z1DA 1GEQA 1S3HA 1RD5A 2A5HA 4FNSA 3O06A 3IGSA 5K4ZA 4R53A 2Q8LA 5CG7A 5HR6A 4CQAA 2KZHA 3SGUA 4UMBA 5IM51 3FEMA 1ML1A 5DLCA 3OIXA 1QWGA 2GVGA 5G1TA 4ZZ9A 2LLEA 3W7NA 4L4MA 3W71A 2A6NA 3NQ6A 2GQ9A 4LOCA 1KM4A 4FNQA 3TK7A 2VFIA 4FX6M 4XWUA 3TE9A 5H91A 3S1XA 3GNDA 4ADUA 2DJLA 5LGXA 3GDTA 4AB4A 1YYAA 1O5KA 4LVAA 3EWXA 3MJYA 1ZNNA 2NXIA 3G8EA 5C5YA 3KRUA 4LRSA 4K7YA 4PFMA 5L9FA 1H5YA 3LHYA 2E09A 4LV9A 4WOZA 5F1UA 3QFEA 2VEPA 1KA9F 4FXRA 2QCMA 3HIJA 1TPDA 1H63A 4UTUA 5CGQA 5D2WA 3CIWA 5DY3A 3W7CA 2WNQA 1P1XA 2CZEA 3DKJA 4G1KA 5FF2A 4OGZA 1QCWA 3QF0A 5C2XA 3NQDA 5KZDA 1ADOA 2GUUA 3C8FA 3GR8A 2QCGA 4U4MA 2ZFAA 1G4EA 3W1TA 5U7SA 3D0CA 3GAKA 1DORA 2Y7EA 4ALDA 3R13A 2QKFA 3PBUA 5AYZA 2C18A 4ZL1A 3S5ZA 1TO3A 3IVUA 1K8YA 5BNKA 4DO4A 2V2DA 3GR7A 3LCLA 2QDHA 1SSDA 4LTSA 5I3KA 2BXVA 4I7WA 3UYCA 3L5MA 4QAIA 1OABA 3VE7A 2ZZ2A 1VCVA 1JCXA 3G1AA 3M0ZA 4S2CA 1OG0A 3DXIA 5HWJA 3L5LA 4LNYA 1TTIA 3ABQA 3C4UA 3BG3A 3U2OA 2ZA1A 4X2RA 4WQ6A 3Q37A 1TQJA 3LI0A 5AHMA 4LC8A 1ONRA 4CQ8A 4PL1A 3W7HA 1UUOA 4HKPA 4MLRA 1TPUA 3M5ZA 1LOQA 3G1DA 4N02A 4Y9AA 3ANYA 1D9EA 2VC6A 1VYPX 4W9TA 3PUDA 3LOTA 2QCHA 1R47A 4WOQA 3EKZA 4UFLA 3DFPA 1X1OA 3LLFA 3DKLA 4NNBA 1FWNA 4GUHA 1JCLA 3NAVA 3IIVA 3MI6A 1R46A 1I2OA 2YXGA 3KVMA 3GB6A 2PCQA 3G1YA 3G8RA 2FQIA 3HPXA 2A7PA 2YSWA 3IIXA 4IJBA 1BWLA 3TAOA 2IQTA 1PV8A 3FS2A 1VQTA 2A2IA 1H7PA 3E96A 3M1ZA 5BW6A 3LI1A 3M7WA 5F4WA 1RQEA 5E93A 5K9XA 3MW7A 4EWND 4IPJA 2E68A 3SZ8A 2C1HA 1LROA 1TRDA 4XTIA 1U5JA 3PBVA 1LZOA 3EX2A 3P74A 4E38A 4FNPA 2CLIA 3P8JA 2Z2UA 2DP3A 3KFTA 3PSVA 3SY5A 1LOSA 1LP6A 1OYAA 2VFGA 1YXYA 4O18A 3EKLA 2R94A 4MZYA 1H62A 4AF0B 5LHFA 1LLZA 1Z44A 4N4QA 1ICPA 4XKYB 4DXVA 2VFEA 3C56A 3F4NA 4IXHA 5HUOA 2NWRA 2ISSA 1IIGA 1KM2A 3QW4B 4JDYA 1G4PA 1ZENA 2VEMA 5F2GA 2C6QA 1K8XA 1WOAA 4K39A 2VELA 4WUIA 3OHIA 2H6RA 3PB2A 3N73A 1O94A 1EX5A 3HG2A 3HQ1A 4R34A 4Y90A 5TIMA 5C55A 3S8HA 2F84A 4PODA 1YDOA 5I3HA 3K30A 3B8DA 3MYOA 2HS6A 4X9SA 2FTPA 1I2NA 4LVFA 3CWOX 3SJ3A 4QNEA 1ZAHA 3G0XA 1GG1A 1F5ZA 2FJKA 3L21A 3NOEA 1JJKA 3A9IA 1JUBA 1IXNA 3W72A 1H7XA 3B0VC 2WSRA 3W7RA 2CLKA 1QAPA 2GVJA 1W56A 4MYAA 2HSAA 4RK8A 3M47A 3I65A 5BOOA 3LLDA 3S0CA 4Z1AA 4CNOA 3O16A 5LHEA 3G3MA 3B06A 4MIMA 3LRLA 5LKYA 1W0MA 2WOQA 4XQ6A 3FJLA 2QR6A 4RX0A 2BWGA 4OHQA 1OK6A 2ZDRA 2Z0IA 4A21A 2EPHA 3ATZA 2CLOA 3B05A 3C61A 3HG3A 4KFPA 3TJXA 3O15A 3OBKA 3PC0A 4Z0JA 2QUUA 3QZEA 1T0OA 4I7UA 3GYEA 1RVGA 3R89A 3MHUA 2A1YA 3W2JA 1OFRA 4JTKA 5K9CA 3C0JA 4FNRA 3GKAA 4IPIA 2OZ0A 4Z1BA 4AMAA 3EX3A 1KFCA 3O6DA 4UTJA 3O05A 4AXKA 3NDOA 3W1UA 2ATSA 2DORA 1N7KA 1GYNA 1KFEA 4WY0B 1KFBA 5CPMA 2FFCA 3M6YA 3W7OA 1LBMA 5FEXA 2R91A 3LRKA 4CNNA 2E77A 2FB3A 3NM3A 5EL1A 3L9CA 5U4NA 3O63A 3UZ5A 1YADA 3PR2A 4JTLA 3TMLA 3V1PA 1VHNA 1E51A 4UTHA 4NXSA 4E0CA 2XN0A 3OVQA 3UWYA 1RQHA 4GE8A 2I9EA 1KM6A 4N9EA 2F7FA 3FOKA 3G18A 2Z1BA 5ABTA 1GQNA 3PUEA 3UWUA 1JCJA 3PVFA 4ZQRA 4GNJA 2Y70A 3QEZA 3QPZA 1TTPA 1Q6QA 3PBYA 4IQLA 3NQVA 1W5QA 3DFTA 5DCEA 2B7NA 4JTEA 5D2YA 4PL2A 5D38A 1Q45A 4JYDA 3GDRA 1OFEA 3UD6A 3W7QA 1LRNA 3TQVA 4JX5A 2TYSA 4M6PA 1GJPA 3BLIA 2ATMA 3O8AA 2Y89A 1GVSA 2QCLA 1EP2A 3S9YA 3QC3A 3KRSA 1GOXA 5LNWA 3BO9A 5DBTA 1WOBA 3HJZA 3I6RA 3BG9A 2CWNA 1S5TA 3NQMA 2E6YA 1N8FA 3NZ1A 4M7SA 4NU7A 5C54A 1G67A 5A8GA 3L2IA 1QDSA 2WPBA 4MLJA 3MHGA 4ZQNA 4D2JA 4DQWA 4HPJA 3DHDA 5D2XA 3TAKA 1OFQA 2CLMA 1T96A 1V7YA 1VH7A 1FCUA 3C2VA 1KTCA 3ABSA 3INPA 3GXPA 2ZCGA 3F03K 1L6SA 3TDFA 2Y6ZA 3P67A 1F7BA 3FA5A 2YDAA 4ORIA 1VGAA 2A4AA 2ZZ3A 4RZ4A 5FF4A 4PC8A 4QITA 1XBVA 1G7UA 2D73A 4JIQA 4KFNA 3F4WA 4JY8A 4UFHA 3KAOA 5I3IA 3STEA 2RDWA 5D05A 2NLIA 1D3HA 2P10A 3W85A 1TCDA 3HOJA 1F6PA 3CLMA 4CCEA 4CQ9A 2Q8ZA 1KLZA 2PE4A 3SW6A 1BWKA 3I68A 3CTLA 4DELA 1XUZA 1OF8A 4LT9A 3BGJA 3TFXA 2OX1A 3BARA 4AEOA 5TBOA 4O54A 4UCGA 4BI5A 1LRTA 1SFJA 2C13A 4JD4A 2EGZA 2ZZ7A 1FDJA 3QJAA 3UZJA 3WK0A 3G1SA 3IEBA 1KLYA 4FIQA 3T55A 3QMTA 2E6FA 3TQ0A 3TR2A 5BRBA 5LNVA 1K03A 5F4XA 3VI2A 4LW7A 3BK0A 3LCHA 4WXYA 3W1QA 3NQ8A 3CQ0A 1TPWA 1OYCA 3GKFA 3CEPA 3NQ2A 5HJLA 3E0IA 3BPWA 5EKYA 4X3ZA 4AAJA 3ABOA 3M43A 4GUJA 3NR0A 2BTMA 1PS9A 4Q32A 3ZWSA 1Z48A 3I7SA 4AF0A 2GJLA 1SZFA 3AJXA 2Y7DA 4GXMA 3ZWTA 4UFKA 1JQVA 4XKYA 2DZXA 4GFSA 1ZFJA 1GZGA 1I4NA 2JGYA 2DZSA 3NYZA 1OK4A 2FDSA 3W22A 4XZ9A 1OJXA 4OWGA 5DBUA 4BFAA 1DQWA 2CZDA 3FKKA 4N2YA 3P5YA 3DH7A 3TJLA 5HWNA 4U28A 3CEUA 1KTBA 4MY8A 1VCFA 2A7RA 3OG3A 4K38A 3W3OA 2RFGA 3GDLA 5CSSA 4BWLC 1YPIA 2WNZA 1IXOA 3FYOA 3BGGA 1GT8A 1W3IA 1DL3A 4Q33A 3TX9A 3LRMA 2OJPA 3ABRA 4MPQA 4NVTA 4NZJA 4YWIA 4LVDA 1JR1A 1OFDA 4ICNA 4QJ1A 4UXDA 1SO6A 4JX4A 1KM0A 3LM7A 4FX7A 3A5FA 1O95A 3M5VA 2TRSA 2DU2A 2HS8A 1PCKA 3W73A 3EWYA 2AAMA 1YDNA 1GTEA 2E6DA 4WZHA 1FBAA 1O60A 4RZ5A 4IGHA 5K4XA 1SR9A 1P0NA 2ZRXA 1IIHA 3EXTA 3QM3A 4PTNA 4OT7A 5DELA 1G4SA 5D37A 3TIMA 1KFLA 2VFDA 5KTLA 1SO4A 1ZY9A 4RLIA 1H60A 5K3VA 3LXBA 3H54A 1VRDA 2A6LA 3QQ0A 3W1LA 3W2NA 3M41A 3ZFHA 5J5DA 1I2RA 4E2DA 3EWBX 3QMSA 5HNRA 4EIVA 4NNAA 3R2GA 2VFFA 3PG9A 1H1ZA 3G1FA 4HT3A 2ALDA 2PRMA 4O15A 3B0PA 5G2WA 3W6YA 3WJYA 3W7IA 3TW7A 1VS1A 3TC7A 3FLUA 3AO0A 4O13A 2WJZA 1SSGA 5KINA 2O7SA 3B04A 1X6UA 7TIMA 1DBTA 4MVAA 1K3UA 1LRQA 1TYGA 3M16A 4WY0A 1AK5A 4UTWC 3P60A 5KITA 2ZZ1A 1ICSA 3FFSA 2E1DA 1DVJA 2ZZ4A 2CLEA 4UC5A 1ZALA 3GDMA 4AHQA 2H8ZA 4XUGA 4BI7A 3W70A 4QM1A 3SFKA 4UTIA 3GAYA 3UNDA 3LCGA 1YLVA 1HFBA 1JUKA 2FPVA 4HNNA 1MEWA 4DF1A 2NX9A 3SSJA 3V75A 4FXSA 3MP3A 4P61A 3C2EA 1XL9A 2YZRA 4JIPA 4R33A 2QJGA 3LBCA 4A22A 2FPYA 4O12A 1GWJA 4BWLA 4JGDA 2ZRVA 1QMLA 5DCBA 1JVNA 4WX2A 1J5TA 2VEKA 3B0UX 1VR6A 3L65A 5CPLA 1A5BA 3G1XA 5G2HA 4HSOA 2ZRZA 1YTKA 4O4WA 1PHWA 1TMHA 1NSJA 2H3DA 3OVRA 1FCVA 5TQLA 1F6KA 3B4UA 3L0KA 1I2PA 1SZEA 1H7RA 1I45A 5F4SA 3S1WA 4TR9A 3NM1A 2RHGA 4LY8A 3GIYA 3L5AA 3BG5A 3EB2A 2C0AA 3RK8A 2HMCA 4S2BA 5AOUA 1W3NA 1FWSA 2ZRYA 3W76A 3GNNA 4JY9A 5F1VA 2ISWA 6TIMA 1XC4A 1DQXA 1TJPA 2ZA3A 2X1TA 1AW2A 3SI9A 5F2LA 4IMFA 1JULA 2VKZG 3PF3A 1NFBA 4K6AA 5KSWA 1F76A 1QO5A 4YCOA 3WJXA 2JKAA 1EWEA 1TTJA 1VC4A 4UNLA 1OFAA 4ZQOA 3NQGA 2GVLA 3MWAA 3LHZA 3QSRA 1SU5A 1NAL1 4JTHA 4GBUA 1TREA 3N34A 3PULA 4LVBA 1OVDA 4MOZA 4FF7A 4OV4A 4C1LA 3GK0A 4GC4A 5FF7A 3JRKA 2WKJA 1MZHA 2Z6JA 2ISVA 4AHPA 2VFHA 1B4KA 3NQEA 5HULA 4NX5A 3A23A 2B0MA 3W7PA 2ZA2A 3OA3A 3C2FA 4FIRA 3PUOA 1EUNA 3GDKA 4MY1A 2B4GA 2J27A 1R2RA 3UXDA 4TMBA 3QW3A 4UTWA 2V0TA 3W83A 1IGSA 5CKSA 4YLWA 4QQ3A 3S5OA 3LB0A 3S1VA 1UUMA 1VCGA 2GQAA 4JTUA 1MEIA 3VNDA 1TPH1 4ADTA 1MSSA 1Q6OA 1K8ZA 1K02A 4ZQCA 1SFLA 4IMCA 3UY7A 1JRCA 3MI3A 3MP4A 3CC1A 1EPXA 3W2MA 4BK9A 5CSRA 3KVLA 1DJNA 1AG1O 1K7EA 1TPB1 2VEIA 4K8HA 2ZTKA 2C16A 1EEPA 1TPEA 2ZYFA 5D33A 1O5XA 4NNCA 2QCCA 3LBMA 4UTKA 1PIIA 3FYPA 4Z08A 3LV5A 4NUWA 4XTDA 2TPSA 3W87A 2RDTA 1QR7A 5CZ0A 3NEVA 3MP5A 3P80A 2Y7GA 4AWTA 4BR1A 4O1BA 3OEXA 3UWVA 2CW6A 3W7JA 3LTPA 3HPZA 1VYRA 4HNVA 3W7LA 4UFMA 4ONVA 1YPFA 2H90A 1DHPA 5I3JA 3IIZA 2QJHA 2DJXA 2V8ZA 2Y61A 4QNWA 5SWUA 4JTGA 4IMGA 1FQ0A 3O07A 4OU1A 1FUYA 1VZWA 3WJSA 4Y96A 2XN2A 4A3UA 3L67A 2QF7A 1F73A 2JK2A 4A2RA 5HMSA 3BW4A 4E2BA 2AQWA 3HBLA 4GUGA 4HNTA 1WV2A 3TV8A 3BVJA 4MKNA 4MFEA 1OFBA 5D30A 3P7YA 4TU1A 5AN7A 2OT0A 1GYLA 1JRBA 3DFQA 4LC6A 1X1ZA 4I7VA
chains in the Genus database with same CATH superfamily
2V3GA 3TQKA 3M9YA 4TO8A 2PBOA 3E0LA 3B97A 1HJUA 4HTYA 4RNHA 1ELSA 3C0LA 1EP3A 3WLNA 5HK4A 3T8QA 4X9YA 1H7OA 2Z7GA 4J4KA 3RNDA 1LL6A 2HBXA 4IIFA 5EMLA 4JFTA 1XFBA 1LDCA 1I0BA 5FJIA 1EXBA 4QBXA 5AYIA 1Y0EA 1BQCA 1W3TA 2CFFA 4H04A 2VRQA 2QGYA 1XGZA 4W88A 5HQEA 1GVOA 1V3MA 4FNTA 5A1AA 4UFJA 1XKYA 1EA0A 4O1CA 1U2YA 3M4HA 4XZWA 2PWGA 3DUGA 3I6EA 2VURA 2ZUMA 3K46A 4H6RA 2UY3A 5EGRA 1FDYA 1OYBA 5CG0A 2J47A 4LU0A 1O4UA 3GFYA 4WKAA 4DUXA 4UNIA 2Y24A 4LB4A 2D0HA 1XRVA 2C91A 4LS0A 2PAJA 1MW1A 4R7OA 3AMDA 2YX0A 3QTGA 4Y9PA 3FXYA 4IIGA 1P0KA 3QC0A 5AC7A 3I7RA 1AQHA 3C5QA 3MT1A 1KC7A 1IEWA 1YQ2A 1HIZA 2PDYA 5H2ZA 3RM9A 3DESA 3NO5A 3RU6A 5FF0A 5D03A 2ABBA 3EBVA 5C7VA 3RMJA 4AX7A 1JQXA 3ENLA 1E6NA 1YXDA 2WMKA 3RLUA 1QPOA 1XH0A 2FPTA 1W9VA 3PP7A 1XLEA 2ZICA 4GVHA 5JIPA 1LBFA 1YDYA 3UG8A 5CBJA 3QBUA 4MZ1A 3FIGA 5HUPA 3E2QA 4AIOA 4CQBA 5T26A 3G1HA 3VDCA 2C0HA 1JPKA 3KBWA 3WQ8A 4D6DA 5LIWX 4DO6A 2DT2A 2G5WA 4IP4A 1MEHA 2QVNA 4QR6A 4ZOAA 4E6MA 5AZ1A 2NQ5A 1W9PA 3KS6A 4KEVA 4LF2A 1T8XA 3ELFA 4JX6A 4C6CA 4LUSA 3UWWA 4Z1CA 4ICCX 1NDYA 1P7TB 5C9XA 2BOGX 1A53A 2ZVIA 4EF8A 4RW5A 1RUSA 4UTTC 4JCMA 1W1YA 4AX6A 3A21A 4FF5A 3NDZA 4LX4A 4XO7A 4W5UA 3B8IA 4H3DA 3RCMA 3PJWA 1TPFA 1CCWB 3QSTA 4CCCA 4H00A 1UZ4A 3GDBA 4ZE5A 2X0HA 4ML4A 3LHVA 2PC8A 3WYZA 3HF3A 4D6CA 3N14A 2GDUA 2GSJA 1Z8AA 2O7QA 2QAFA 5JH1A 3G6LA 3MUXA 2Y5JA 4W86A 5KZEA 1DE5A 2RJHA 1KM3A 4UFIA 4NAFB 2F6UA 2J8FA 1UR2A 2O4MA 3G0UA 1YTDA 3GVGA 3LXAA 2VDIA 4L6HA 3S5SA 3O6YX 2ZUWA 2WSYA 4OUIA 4O8RA 1X7FA 1DJZA 2VX6A 5F2IA 1MW0A 2P8BA 3BV4A 4D1JA 3WZ0E 3G5EA 1GVIA 4ZGYA 1W5PA 4IT1A 4NJHA 3QKZA 1TV8A 3G1VA 2R1LA 3VIOA 3KLLA 2QCDB 5LA0A 3LY0A 4XZIA 1UQYA 4ZE4A 3M0VA 1ESWA 3KRBA 3KM8A 2HCVA 4JCLA 2P5NA 3NA8A 4QP0A 4W8BA 3WD2A 2QUVA 3NL3A 2Z6IA 4GY7A 1AQMA 1UQZA 2C1GA 2VM8A 2E67A 3LHWA 2CCRA 4L4PA 4FB7A 1OCNA 4LV4A 5CPQA 1DOSA 1UJPA 1QNSA 3W1PA 4PUWA 4OE7A 4M6VA 1NELA 1BTCA 3HGJA 2QCEA 2DQWA 1NFGA 2CYGA 5BROA 1XBYA 4M6QA 5TD4A 3QXBA 3UYIA 3O0FA 1B4EA 2W79A 1CEOA 4QSHA 1J0ZA 1TG7A 2CKRA 1VBUA 1KR1A 2V5KA 4IL2A 3TTQA 1TFVA 5B7YA 2E4TA 1A5MC 5LNRA 2AAAA 4MAVA 1E6PA 2IKHA 4Q6JA 3BMXA 4C1NB 2WVSA 1E71M 4G1NA 2OX4A 2OYLA 3SN1A 4UTTA 3SEPA 1UKOA 2Y85A 1XCFA 1FWTA 1UCWA 4QSFA 1M5WA 3JR2A 4ECLA 5GQBA 3HO8A 2J4GA 2CLHA 1A5KC 1J5SA 3AROA 3VE9A 3W27A 3ZO9A 2W61A 5IBXC 1H7WA 5A2CA 3AIQA 3L7RA 1Q6RA 1R3RA 3GXMA 3IJIA 5CGMA 1XCWA 5C9WA 3T4WA 3TTEA 1QOPA 1FHVA 8RUCA 5DMYA 3T78A 1EUAA 3OLDA 3CXOA 1F3TA 4XBSA 1SPQA 5A5WA 1OADA 3E02A 1AQFA 3QV9A 1TA3B 1SZRA 4A2SA 1UD4A 1XGDA 5EU9A 2Y8KA 3E12A 4O53A 2YXOA 4DUVA 2ADAA 2Y8VA 1RP8A 2GOUA 4AWSA 1R9YA 4RXGA 1AZ1A 5HBFA 2J13A 4DBSA 3P62A 3FV9A 3USBA 4IXXA 5CGTA 4DJFD 1JZ5A 4LYPA 3B8VA 5D9NA 5ABEA 2DY3A 5CZTA 1BTMA 4FX8A 2QV5A 5HWMA 3CAVA 3GC2A 3NPXA 3G24A 1R2SA 1G9HA 3N11A 1AZ2A 4H6KA 2V30A 4IUOA 4DUWA 4RR4A 2FFIA 3HGRA 1MQQA 4WSJA 4PUMA 4YL2A 1NWUA 4PSRA 3W2KA 1EF3A 1UIOA 4JTQA 5ABHA 3O0KA 3W7DA 4YXGA 1F4AA 2YA1A 2OWWA 4Q6XA 3HG4A 2GLKA 4G7EB 3H4XA 1CW2A 1F2JA 4HSNA 1J8VA 4FO4A 4X2PA 5D32A 3IAPA 3UPMA 2G8ZA 4AHOA 1V5XA 1H7NA 2V6AA 4IX0A 4NYYA 4PBFA 4AZCA 4ZMGA 2QDEA 3CT7A 2R8WA 2XFFA 1NWSA 1C8YA 1MXDA 3GBDA 3UR5A 3H7UA 2XIMA 2YA2A 3DFSA 3H7RA 2Q02A 2CKSA 3L0GA 1KBIA 1THFD 4LRTA 1E5JA 1M53A 4GXWA 1TSIA 4JTTA 4XBKA 3VTRA 4AU0A 2V67A 3PZIA 4NZFA 3N9RA 3RN6A 2P53A 2CEQA 4N9CA 5CC7A 5EPDA 3SN4A 1P5BA 4H9YA 4JKMA 5DANA 1MNZA 3W24A 4EK7A 3A24A 2QEZA 2VRKA 4CUCA 5IBXA 3WFZA 3VIGA 3VUPA 4WXZA 1JI1A 2ZWZA 4MWAB 3WDRA 4IX2A 2YDQA 4RDZA 3GFZA 4WJXA 5EMKA 3HPSA 3E2SA 1MMFA 1QBBA 3CM4A 4O28A 3UXAA 2FZNA 4C5YA 2WVVB 4R9XA 2BVYA 1J2WA 2QVHA 1EJWC 3W88A 3WDQA 2WCSA 4RL3A 1GK8A 1G6CA 4IGMA 4HHHA 4WRHA 3BLEA 1W31A 3KVJA 5A6SA 3RHGA 1NY1A 3ARYA 2AOSA 4GVGA 3KOYA 3CBWA 1RLDA 1PVNA 3A3HA 2WJEA 3DHUA 2XVGA 1KBBA 2OOGA 1K6AA 1U22A 1A5LC 2FTWA 4HMDA 3B9NA 4KWWA 1QWKA 2DSZA 3LX9A 4CNTA 3FDKA 2GQ8A 3ZQ9A 3PZQA 3V16A 1QTWA 1Q65A 9CGTA 4UTLA 5HMEA 4WD0A 3SUSA 3KS5A 1FWHC 5C9ZA 1GVQA 1J12A 1GNXA 2Y7FA 5K9DA 3WF0A 1OFOA 3BMVA 1OT2A 4M7TA 5CBBA 4DEFA 2HVNA 2IXVA 1XDMA 4QLJA 1R2TA 1V3JA 3KTCA 3EOEA 3KWSA 1LOLA 3W74A 1JZ4A 3FJNA 4UCFA 3VD7A 2DV0A 2I57A 4PMVA 3BLDA 1B2YA 3Q58A 1E1FA 1JF5A 3ZVHA 1S2WA 1DPMA 4WDTA 3GUWA 3F7JA 1C9DA 4PBEA 4RZBA 1RH9A 4CLMA 4DO5A 1TRIA 1XYFA 4HOZA 1LBLA 3DHPA 1E56A 3PN8A 4RE0A 3QY7A 1J0HA 4QS6A 2WLYA 3O6AA 4HCDA 4JNYA 3EX1A 3PZVA 3KZSA 4Y6GA 2VGFA 3TYEA 2WNNA 4H7ZA 3W1XA 3TU9A 1BLIA 2W66A 1F3EA 2Z1KA 2NV1A 4KGLA 1EIXA 1R8LA 4D6JA 1LCOA 4EPEC 5CH9A 1MO0A 1HJVA 3W01A 2HE5A 1YDVA 3NOYA 2QAPA 3WG6A 4N9DA 3QR3A 2R82A 4A3HA 1KXQA 4HPHA 3D3FA 1FRBA 1U83A 4Z42C 3WLQA 1N8IA 2XFWA 3MYPA 1RK5A 1XPGA 3N2OA 1DWIM 4GIEA 2D2JA 3FGCB 3QHOA 1GVFA 4M6UA 2J79A 4D71A 4FOKA 3W7KA 5JBFA 4ZQMA 1NWRA 1WDWA 2BASA 5L6UA 4O0ZA 1VYSX 4NXKA 4ZSTA 4WY0F 2FIQA 1EDGA 4PULA 3L4YA 3AIEA 4QX4A 3CPUA 2Y2WA 1E70M 3KTXA 3GNPA 4AXNA 3NL2A 1WXJA 5DT7A 4QIUA 3L68A 4I9JA 5K7JA 4O52A 3TA9A 1WDDA 4PBGA 3WO8A 2HVOA 4Z1DA 1RD5A 2A5HA 2YDRA 3MMDA 1EQPA 5HR6A 5IM51 4KRTA 2IPJA 3CGTA 1ZS2A 3UT0A 1VBGA 1S2UA 2P8CA 3W71A 4DZAA 2A6NA 1XG3A 3NQ6A 2EBNA 1DWFM 3EA2A 3HM7A 3TK7A 3B9AA 4XWUA 4NHVA 1U5VA 2PGWA 4F0KA 1XF0A 1ZGDA 2DJLA 3M0YA 5LGXA 1J0KA 1UD8A 4H9UA 3EWXA 1ZNNA 2NXIA 1KXHA 1ZP3A 2XVNA 3QLDA 2Z28A 4WOZA 2AL2B 3UP8A 4YNGA 1PJ9A 2QCMA 1R5YA 2ACRA 3XISA 4LYRA 4UTUA 4WIWA 2WNQA 2CZEA 1Y5VA 4KRUA 3DKJA 4OGZA 1R9XA 5I07A 2WCGA 1BFNA 1I9CB 2GUUA 3RG6A 3AFBA 4AWEA 2G3MA 3QY8A 3JVAA 2QKFA 3GHSA 3RYSA 2C18A 3C3UA 5CJMA 4LFYA 1V4YA 1CZ1A 1CXFA 3GR7A 1YIXA 5KETA 4RNFA 1OABA 4XK2A 4TVDA 2PTYA 2WC3A 3A3XA 4MJ4A 1MDLA 1EGMA 4PMNA 3RMEA 3DXIA 3WLPA 2Q8XA 4LNYA 1ECQA 1O66A 3ABQA 5BRQA 2ZA1A 1RPKA 4S3AA 1MXGA 1CBGA 3LI0A 1V3HA 1F4HA 1VFTA 4CQ8A 1K9DA 1AUSL 3TTOA 3H4WA 4MLRA 1TPUA 1LOQA 3ANYA 3RU8X 4U2YA 2W5FA 1P6BA 4WKFA 1R47A 3BDKA 3EKZA 1A47A 1E73M 2QGHA 3DFPA 4NNBA 1FWNA 4JQ3A 1T6MA 2OLAA 4YTRA 3WN6A 3AI0A 3NAVA 1R46A 3DX5A 6PTDA 2YXGA 4FOUA 4UB9A 3G8RA 1KBKA 1UR9A 4IPLA 3DG3A 3HPXA 4L6OA 2J7FA 1BWLA 3PZGA 5EMYA 4A35A 4DM1A 4RUBA 2ISFA 2VQTA 3FS2A 3CZLA 5BW6A 3LI1A 3E6EA 2Y1HA 5F4WA 1RQEA 5E93A 3DIPA 2VHLA 2PDFA 4MHBA 3VO0A 3SZ8A 1GGOA 1F9CA 3PBVA 1EBGA 3N13A 4R5EA 4ZTXA 4MAZA 1VIZA 3SB0A 4FNPA 3VCCA 2WHMA 4AUBA 4N7QA 2Z2UA 1HJQA 2DP3A 3KFTA 1CGWA 2QPUA 4E4FA 1UMLA 1R86A 1F61A 4MKVA 1K9EA 3N4FA 5HAOA 4DAIA 4AD5A 1LLZA 1Z44A 2P88A 3WH8A 1V6WA 5H6HA 3AOFA 5HUOA 3QVQA 4WK9A 3HA1A 1YX1A 3QW4B 1JPMA 4NY2A 3AXXA 1UP3A 1QI4A 1K8XA 1WOAA 2VELA 3WMCA 3OHIA 2V38A 3MCNA 3PB2A 1O94A 1EX5A 2E9MA 3HG2A 1RLCL 1XSJA 5TIMA 1PYFA 5C55A 2BG5A 4GIAA 2YBUA 2F84A 1FHUA 4PODA 3GBEA 3WMLA 5I3HA 4DYKA 5BXTA 3B8DA 1XC6A 1I2NA 2JIWA 2E7FA 2UBPC 1KRAC 4YPJA 3SJ3A 2ZX6A 1OEPA 1FHLA 1XJBA 4PMZA 3L21A 1W9BM 4PCSA 3KOXA 3WENA 3ITLA 3P3BA 2A3HA 2G3JA 5BOEA 4YVPA 2FDMA 2YBTA 1JDEA 2HSAA 2PWVA 1I1XA 4GH3A 1VKFA 1WUEA 2Y5EA 4P8XA 3FJLA 2QR6A 1US2A 3EEZA 4OHQA 3RGTA 2ZDRA 1EA9C 3ATZA 1C9WA 3B05A 1CGTA 4KFPA 3CAWA 3PC0A 2QUUA 4I7UA 1FTXA 1BRLB 3CUJA 1DE6A 4Z2LA 3PFRA 3MHUA 2FZ8A 3OA5A 4V1YA 1U1UA 1GVYA 2ACQA 4UQ9A 1R0MA 3GKAA 4Z1BA 2WKLA 4AMAA 1XSIA 3O05A 4AXKA 4A6GA 4ROQA 1KFBA 4GA8A 2FFCA 1UJQA 3KWXA 2BS9A 3NM3A 2FB3A 5EL1A 5U4NA 3O63A 2XHYA 4BJHA 3V1PA 2HWGA 1UPPA 4QDPA 1E51A 3SRHA 3ITXA 4UTHA 2XN0A 1WDQA 1JDCA 5T91A 2I9EA 4AD0A 1KM6A 1XIFA 1K4HA 5JBEA 4Q4RA 1GQNA 4PZVA 2PDLA 5C2CA 3PBYA 2OB3A 1W5QA 3CHFA 5M2FX 4PL2A 1R9ZA 4HB7A 5D38A 4ZSUA 3CV7A 3GDRA 4U5KA 3VAVA 4S3CA 3TQVA 2OU4A 3VOFA 3U48A 3WQFA 2Z1XA 3NIYA 2YLAA 4WSHA 1WAWA 3TEVA 3RCNA 1Y8BA 2QCLA 2DH3A 3QC3A 2XFRA 5ECVA 4Q8OA 5LNWA 1POJA 1WOBA 3BG9A 4GYFA 3I6RA 3NQMA 2E6YA 3NZ1A 4M7SA 5A8GA 3GXFA 3UBPC 3MHGA 4ZQNA 3ZIZA 3ME3A 3TWAA 1LQAA 3VGDA 2VZSA 5IDIA 1Q13A 1V7YA 3C2VA 5FSDC 2OG9A 4IP7A 3F03K 1L6SA 4E8GA 4ORIA 2ZZ3A 4PMUA 4RZ4A 4S3FA 4XIMA 4F0SA 4PC8A 4YVVA 1XBVA 4GQQA 1PZ1A 2CHOA 4MB5A 5XINA 2CZVA 4UFHA 1I1WA 5I3IA 2J74A 2DSKA 1XH1A 5D05A 1D3HA 3IK2A 3W85A 1HJSA 1W6TA 2P3ZA 4HOWA 3MSGA 5C9UA 3CLMA 3EOOA 3SY8A 1BWKA 3CTLA 3UCDA 1T40A 1XUZA 3BGJA 3BARA 5CC6A 4BI5A 5TBOA 2C7FA 4HJWA 3BC9A 3QPEA 5HDRA 1LRTA 1SFJA 2C13A 1ITUA 2EGZA 2QUMA 2ZZ7A 2HXTA 4DO7A 1GOOA 3IEBA 1KLYA 2JE8A 3C8NA 2PBGA 3AYRA 5FKYA 3CH9A 1K03A 3H2NA 5F4XA 3QGAC 1KCZA 3HFTA 4WXYA 1E0TA 3GKFA 2EG7A 1XSKA 3S2JA 5EKYA 1F6YA 3ABOA 3M43A 1PTGA 3UETA 1PS9A 4Q32A 3OGSA 4UQCA 4ATWA 3I7SA 2GJLA 4AMCA 3AJXA 1XLGA 1Y65A 1E1EA 3ZWTA 1JQVA 4GFSA 3RPDA 2JGYA 4EPDC 1UWTA 2D2HA 4XZ9A 2Z2AA 2WC7A 5DBUA 1B0IA 1HNYA 8A3HA 2PTZA 4N2YA 3CTTA 2Q01A 5H8PA 4R9OA 1QNRA 1SGJA 3MKKA 1MQPA 1UD2A 1VJSA 3E5BA 2VX5A 1YPIA 4OBSA 1O5QA 1LG2A 1HVQA 3IGHX 2PUZA 4C6FA 4KRZA 3H2AA 4Q33A 1Q7ZA 3LRMA 2OJPA 3ABRA 4MPQA 4YWIA 1BSLA 1K8CA 4GX9A 2DT0A 2INEA 2Y8UA 2YB4A 4TOQA 2WSKA 3KBNA 4ICNA 4QJ1A 4JX4A 3EDJA 4D72A 2ICSA 3THCA 4M56A 3PTMA 4FAMA 2YL5A 3HJEA 4KIEA 3NSNA 6REQA 4S3BA 1DEDA 3UA4A 2E6DA 2PWUA 4WZHA 4RZ5A 1HF6A 4IGHA 5K4XA 3RCYA 4PUUA 3GD6A 1YNYA 1IIHA 4K2SA 3QM3A 1Q7MA 4J3SA 3ARPA 3TIMA 1E72M 5CQ1A 3V5FA 1KQZA 1DWGM 3LXBA 3QQWA 2YXXA 3ZFHA 2W3ZA 4G56A 4DY1A 4E2DA 1FFQA 4NASA 3EWBX 5HNRA 4CD4A 2PLCA 2VFFA 2XH4A 2QJJA 4B5SA 1CENA 3B0PA 1BXCA 3S47A 3TC3A 3TVAA 1QASA 3TW7A 3FHQA 1K1DA 1VS1A 1CGVA 3EMQA 3FLUA 1HGYA 1TV4A 1W17A 4MDOA 2WJFA 4CU6A 3BURA 5I03A 3B04A 2X42A 1DBTA 3GC5A 2HNHA 4E5TA 1K3UA 3ZZ1A 3S9ZA 1TYGA 1V6UA 2PLKA 1XLLA 4WY0A 2GYIA 1ICSA 3FFSA 2E1DA 3K2GA 2WNWA 4HCLA 4FI4A 2CLEA 4V33A 1EF2A 2H8ZA 3DG7A 2GQ3A 3W70A 3CZJA 3GAYA 3UNDA 3LCGA 2W4XA 4HNNA 5HMDA 4DF1A 2NX9A 3ZLHA 3BTNA 3OU8A 4FOJA 4FXSA 2VWTA 3P0XA 4J35A 4AYGA 3NZGA 3NO3A 3W29A 4JGDA 4H9MA 1UH3A 4LJ3A 2GVEA 1OT1A 2YL8A 2PA6A 1R3WA 3GQYA 5LA1A 1VR6A 3L65A 1V6TA 4ZXOA 4GY0A 1QI5A 1GW9A 3PJXA 1TVNA 1TMHA 1F8IA 1UD5A 3A12A 3HV9A 4U33A 3R79A 4NZ4A 3O3RA 2RJGA 3VIIA 1SZEA 3OO2A 1WDSA 3S1WA 4TR9A 2XU2A 3GNRA 4H8HA 4H7VA 4B92A 2YOCA 4PMYA 3WF3A 1P6WA 4DNHA 2ACUA 2J7HA 2JALA 3HV8A 3CO8A 3EAUA 2X1TA 1AW2A 4HPNA 5F2LA 4HPGA 5ABGA 3WD4A 3VGHA 1JULA 4GH1A 2ALRA 1C3FA 3ZJ6A 1EKOA 1F76A 1UOZA 2JKAA 5C7HA 1OFAA 4LYQA 3MWAA 2GSHA 4YYFA 4Y2WA 5LIKX 4LVBA 3OLIA 4MOZA 3RJYA 4W84A 5FJRA 3GHUA 3W26A 3GK0A 1HN1A 4LUSB 4C1LA 5JMUA 3H8AA 3BL3A 2VEFA 4GGBA 4ZENA 3W82A 3GVQA 3M07A 3NQEA 4MNLA 2B0MA 3W7PA 3BLPX 4IM4A 3H2EA 1OSEA 1KRBC 3LZ3A 1R2RA 3QW3A 3CV2A 4QRNA 2V0TA 1R38A 1IGSA 3VU2A 1EZWA 1K6WA 1NQKA 5CKSA 4A05A 4YLWA 2ZDSA 1UUMA 4JN8A 1VCGA 3SCPA 2I17A 1MEIA 3VNDA 4ADTA 4IQJA 5GJPA 1Q6OA 1JXKA 2CBIA 1GUVA 1CXLA 4WF7A 2XWDA 4J5NA 3CUFA 4K1WA 5CSRA 1NP2A 2XM2A 3W2MA 4W4QA 3KVLA 4H01A 3GU1A 1AG1O 5BRPA 4LNCA 2Z1VA 2QHAA 1EEPA 1TPEA 4PE8A 3BMWA 5A6BA 4NNCA 3SCWA 1UG6A 3UXIA 4RW3A 1IZCA 4UTKA 3FYPA 1Q6CA 4W89A 2VT0A 4NUWA 1NDWA 4XTDA 5A8NA 2HK0A 4HD5A 3NEVA 3P80A 4KMQA 4S39A 3WNLA 2VGIA 3NTYA 5HNUA 4JL2A 3LTPA 4L64A 1IR2A 1IQ8A 2YLLA 3W7LA 3FVMA 2QJHA 2ZUTA 4QNWA 4HK7A 3T2QA 1FQ0A 3FSUA 1VZWA 2FMNA 1UIPA 2CETA 4NKCA 4GKTA 3HBLA 1WV2A 3TV8A 1JYNA 4MKNA 2QW5A 4QJ3B 4TU1A 2WK2A 1GYLA 4CU7A 1JZ7A 3SJNA 4LH8A 4PSPA 3OLGA 2EPOA 2DQXA 4EWJA 1ME8A 3HTWA 4R85A 4RKAA 2CPUA 3RLVA 4IOTA 5AZ0A 4L7ZA 3HPAA 3E1F1 2JEQA 4EXAA 4W8AA 5I3DA 4Q22A 2PURA 1UBSA 4ORMA 2P0IA 2VXNA 2XISA 1TV2A 2XINA 2WMHA 3KUMA 4HA3A 4AVFA 2OWXA 1PXGA 1KV8A 3F2BA 1QW7A 1BYCA 4IIHA 1KQYA 2BHYA 3T44A 2C3ZA 2QCDA 1HJWA 4XVEA 5JU6A 1HVXA 1KWGA 1US3A 2V5LA 2HROA 4GXPA 1M7OA 3LERA 1K7FA 5G4HC 1E4NA 2JGQA 2NSXA 4O17A 2VZUA 2IQDA 2XIQA 3EB3A 2KX9A 4RDYA 4JN7A 2O4QA 4HPXA 4JFWA 3L4TA 1GKRA 2VENA 2TSYA 3AIRA 3VMNA 3A5VA 1UHVA 5A69A 3OVPA 1B9ZA 1DTNA 5CLWA 4TIMA 4IICA 3DERA 1XYBA 1LTDA 4LPCA 2OLHA 1JPHA 3CMFA 2GJNA 4XSLA 4Q4MA 4GRSA 3ONCA 4XG1A 1PPIA 3PS7A 2DSUA 1PHQA 4O50A 1JYXA 2XVPA 4MTVA 1AA1B 3U8GA 4C1NA 1J79A 4MJMA 1I0DA 5I3FA 1S5VA 4J40A 4DZIA 1BG4A 2BY3A 1RD6A 1CECA 4U10A 4TX9A 1M6JA 1E40A 3CO4A 1OIMA 5IFPA 3MUY1 4GVFA 3SECA 1XBZA 1W2PA 4PMDA 1CLXA 2Z24A 3LGEA 2WO5A 1TKKA 4DN1A 1ZAIA 1UROA 2FYMA 1J6OA 3CWNA 1ODZA 1DKWA 1X39A 3E9AA 4UZUA 3NQFA 3EX4A 3T7VA 3MI2A 1KKOA 3DU0A 3ARZA 1SO3A 3NJ3A 1P6CA 3V0TA 1JCTA 2FGBA 1QXLA 3KE0A 3P5ZA 1H2JA 3M7SA 3AS0A 3BLOA 4AZCB 1HO1A 2Q3RA 1ZHAA 1S39A 5G2IA 3DZ1A 5FJOA 3DI1A 4UMCA 3WY1A 4LBSA 5CZJA 2NVDA 4J3UA 4IFOA 1QW8A 2MUCA 4ENLA 1XI3A 4HZ8A 3RJXA 5AYBA 3KX6A 4DJDC 4PCFA 1V79A 4XAGA 3UVIA 1SZGA 1OF6A 3OVGA 5GNZA 3WDHA 6TAAA 1BG9A 3CU2A 3GXNA 1UWUA 1MUWA 4DM2A 3W37A 5G5IA 1RCQA 4NAEA 4JQ2A 3EMCA 4HMEA 4OJYA 3A4AA 4P7NA 4O0QA 1JF6A 2G4FA 2B7PA 4IG2A 2QZRA 1SVDA 4GLEA 3UPBA 4IUGA 1TQXA 2AQOA 3AHVA 4J2MA 4JEQA 1W5NA 1KGXA 1KFWA 3QRHA 1E6RA 4WKHA 3TYBA 1XIGA 2WLZA 3PAJA 5LIXX 1GOKA 4TMCA 5FEWA 5A8OA 4IIEA 1BYDA 2V81A 3ANUA 3ITTA 2PLMA 1NF7A 2ZQ0A 2R14A 1OCJA 1H4PA 1T7LA 3VFLA 1QNVA 4WJ8A 2HVMA 4KPLA 4A8LA 1UB3A 3VMPA 4RNIA 2I5GA 3D5HA 1AW1A 1HUVA 1W9UA 3BGAA 4O1AA 3ZOAA 3URNA 2PDWA 3EPMA 3SUVA 1EJRC 4CD6A 1TUXA 5IFTA 1TIMA 3R8GA 2QCFA 4KWVA 1ITCA 2FH8A 4A29A 4PMRA 1QVBA 3MS8A 3WNMA 4E4PA 5HPCA 4O14A 4BQ5A 1X7IA 2YFOA 3THUA 3KCOA 4GPNA 3V36A 2QJIA 3G22A 3R10A 5JBDA 1GJWA 4L9ZA 3STPA 1NJJA 3IS4A 2BSLA 4EF9A 1RBOB 4RXFA 4LUYA 5XIMA 2H9AA 2ON3A 3NURA 4DJDA 2GUBA 8XIMA 3VD4A 4IH3A 4QDWA 3ZVHB 4LF1A 5LGZA 2QJMA 3AUOA 4GQBA 1AODA 3K4WA 2GFTA 3GR4A 3WFAA 4ZFMA 8CGTA 5CZSA 3HGOA 3GZ3A 3PWAA 5TF0A 1LM1A 2AMXA 4NG3A 1D8CA 3HQNA 2F8QA 3S83A 2J88A 4IMAA 3K5XA 2RDUA 2OCZA 3TXVA 4AQLA 3RPMA 3GFXA 4OFCA 1CT5A 3MO7A 3NQAA 1Z42A 4MUZA 5BMWA 3FNDA 4FNUA 5FA5A 1L6YA 1VEPA 4YTUA 4LBUA 3CHVA 1OCBA 1GPWA 4JHMA 2PMQA 1QPNA 2P76A 2ZBTA 4X0NA 4Y9MA 3HGSA 3WQWA 5IRPA 3ATYA 3KP0A 3H21A 1TE6A 2V5BA 2DUAA 1V0NA 4ZODA 1AVAA 3WJZA 2QYGA 4ML9A 4O57A 4EAMA 3SUWA 2WSQA 3UPWA 1UH2A 4XB3A 1G69A 3I3EA 1IWAA 3E0VA 4REQA 4ZCWA 3MMTA 3BZGA 3TUUA 4M0XA 2DW7A 5DRCA 3IUDA 4C6QA 1HQTA 1SW7A 3PTQA 3UERA 1Q85A 3WLJA 3H23A 3CMJA 3ZR4A 4HN4A 5DMMA 3FJ6A 1DXFA 3BW3A 3KOFA 1Z6KA 1HX0A 3EZ4A 3QQ1A 2O9TA 4QLKA 1Q66A 2FH6A 2XWEA 1TPC1 2WQPA 2DW6A 1HL2A 4FHAA 3VKBA 2E5DA 3URAA 4WJEA 3VFCA 1UP0A 3DI0A 3W2UA 1EL3A 5EMJA 1R30A 3GLCA 3AICA 4QG6A 4DF0A 3EDFA 1Q6LA 2H8XA 3HQPA 6ALDA 3UWEA 1TMQA 4C1KA 3PTKA 4XZLX 4S3EA 3ITOA 2CC0A 4ZB0A 4A3QA 1TV7A 2XDFA 3FCPA 2Z25A 4GJIA 2XH7A 3CZGA 3VOCA 4H2HA 1FWGC 1HO4A 2D69A 1GZ1A 3O6CA 5FJUA 3TKFA 3R8RA 1WUFA 2DZTA 2PDXA 2NUXA 2CHNA 2WVUA 4IMDA 4F0LA 5DT5A 3LHUA 3AZRA 3DAQA 4NI3A 1EP1A 1TZ9A 1M7JA 3MA8A 3YPIA 3QN3A 3KOWA 4X63A 4S1FA 2Y88A 3T0AA 1W3KA 4A3YA 2HNEA 1XV8A 2FLIA 4GYKA 1TPVA 1KFJA 3QOMA 1KM1A 2ZRWA 1WX0A 3M0LA 2PGFA 1I8JA 4JTSA 4GZIA 4HHMA 3F5JA 2X0YA 2PFHA 1A5AA 2DZBA 3W9ZA 3G6MA 4EE9A 3AAMA 5K2ZA 4LUJA 5AHNA 3SQSA 1W8SA 4G2DA 4LALA 4KIRA 4NSBA 1E0XA 1XDLA 3ICJA 4GQ0A 1F05A 2CLLA 3NWRA 2B31A 5AB3A 4EVZA 4TV5A 3VXGA 1V6VA 5FIPA 1H1YA 2JEPA 2DUXA 1XRSA 1WPCA 1IV8A 3ARVA 2V82A 2VRJA 1BD0A 3STFA 2VD9A 2HJPA 3RR4A 5EMMA 4KWOA 4Q3MA 5H1WA 1J0IA 3ES7A 4D8ZA 4L56A 2VCBA 4CCDA 2BGNE 4KCUA 1UA7A 2E6AA 9XIMA 1R3SA 3O1NA 4NJIA 3U7VA 2XG9A 4P8VA 1GG0A 3NPVA 2VNCA 3ZT5A 4C7DA 2J25A 3H2MA 3EWZA 3IPWA 3HMCA 4GYPC 1L2UA 3H70A 1TZ7A 3MHFA 1MUCA 3OGRA 2VC5A 1EFZA 1VLIA 3GVRA 2RDXA 4O1DA 2PLJA 4DB7A 4FEZA 2EKGA 4N6EA 4HU0A 2OFJA 4M1BA 2VP8A 1FP9A 1W1A1 1Q5MA 2R24A 1XLMA 5D4YA 4G9PA 3KHJA 2D1ZA 3THQA 1GOQA 1G0CA 1RALA 3EA1A 3NDYA 3R6IA 4AD3A 4UQBA 1JCMP 3H24A 4C91A 2X1SA 3VZZA 1QU4A 3OB8A 2YCJA 2ZKMX 1YE6A 5AVHA 3DFOA 3GE7A 1U1HA 3KXQA 4LAUA 2OOFA 5C9RA 1B31A 4KGJA 3OOQA 2JKEA 2VC7A 2X16A 3S6OA 5FESA 4LWWA 5AC8A 3A3WA 1QPKA 4TX6A 1L8NA 5HINA 2XJ7A 4Y9NA 4KEUA 5FI8A 3IWPA 1QK2A 3EEGA 3ZLGA 2BGSA 3RF9A 2XN1A 3PPHA 4HN8A 3E38A 4E8DA 3UJEA 4OBTA 4NILA 3Q4DA 2WJDA 5AHEA 1Q3NA 2R1NA 3FYYA 1VP5A 3S3GA 5A8QA 2A3EA 3APTA 3MBFA 2A79A 2YPIA 1A3WA 2XSAA 1IT8A 3T4CA 4LCSA 1ODUA 5D2VA 2J6XA 3PJTA 1IZKA 2CZ5A 3UJRA 2GDQA 2NX1A 3ABZA 1WKYA 3F2DA 4DJDD 1GTHA 1XYLA 2IUZA 3BW2A 2X2YA 3PB0A 3BAXA 3WMSA 4Y9OA 1GEQA 4FNSA 3O06A 5K4ZA 1J2BA 4R53A 2Q8LA 5CG7A 4CQAA 2KZHA 4C90A 3SGUA 2JQXA 1HT6A 4BF5A 1QWGA 2GVGA 4GYPA 3KL3A 3T0DA 4ACZA 4ZZ9A 1AJZA 3DECA 3KZPA 1X38A 1GQLA 4GISA 9RUBA 1KM4A 2RGMA 3SO7A 4IFRA 5H91A 1UMYA 4XBJA 3GNDA 4JOMA 3AXKA 5AY7A 4AB4A 1YYAA 1O5KA 3MJYA 3AIWA 3M46A 5BZAA 2DEPA 7XIMA 3WFLA 2PDJA 4JKLA 2E09A 4LV9A 4L9XA 4FPSA 1KA9F 5I79A 3HIJA 3LA4A 1H63A 4TUFA 3MVIA 5CGQA 3CIWA 1YHTA 5DY3A 3W7CA 1P1XA 3CAQA 4AG0A 2E40A 1PYMA 5KZDA 2OODA 1G4EA 5HATA 2BY0A 3GAKA 5DO8A 1DORA 5D9OA 2Y7EA 1GQKA 4ALDA 4GJJA 3PBUA 2A3LA 4ZL1A 1TO3A 1X8CA 3V7PA 1PZ3A 3BUVA 4AFYA 2V2DA 1HL8A 2QDHA 3UYCA 5DRIA 4FR6A 1BF6A 1JCXA 3G1AA 2V5CA 4S2CA 1LQ0A 1OG0A 4BQ3A 1CB2A 3C4UA 3BG3A 3U2OA 2PDKA 1Z89A 4WQ6A 3Q37A 1HP5A 2CIPA 4LC8A 4AW7A 3KL0A 3CS2A 3SY1A 1ZB5A 1OY0A 1XLFA 4Y9AA 1D9EA 1YW1A 3PUDA 1TR1A 2O56A 2PWEA 4WOQA 4UFLA 2E9BA 1X1OA 2WM1A 1EH9A 1EQCA 1JCLA 3MI6A 2G41A 3FAXA 5BWAA 3CL6A 3SFWA 3KVMA 2FZBA 1DWJM 2HEJA 4HOXA 2A7PA 2IQTA 3FDGA 2AMGA 3E96A 3M1ZA 5MF5A 4H41A 3M7WA 1NIUA 1R87A 5E6YA 1QI3A 3QYSA 4F4RA 3MW7A 4J3VA 4IPJA 2E68A 2VVSA 2QPSA 3W6MA 4ICMA 1LROA 1UD3A 1TRDA 4BY3A 3GSMA 4B2DA 3BH4A 4Q8VA 2HQAA 2CXEA 1EDTA 4KS0A 1E1CA 1LP6A 2PSNA 1FWFC 2VGBA 4DXVA 2VFEA 4XISA 3UZYA 1XRTA 1KM2A 1G5AA 1ZENA 2VEMA 1PKNA 1JGMA 4BF7A 1H5VA 2H6RA 5BXRA 4CNUA 3NSXA 4R34A 1XISA 5CPSA 3QZAA 1YDOA 2HS6A 4X9SA 3TW9A 4A8NA 3KBMA 3UESA 2OYMA 2HXUA 5I78A 3W02A 4QNEA 1ZAHA 1DJYA 3MZNA 1KKRA 3W0KA 3T08A 3BSHA 4PUNA 4B3LA 2XTKA 1V7AA 3GH4A 1JJKA 3W72A 2DSWA 6REQB 4C6LA 3B3DA 3BV7A 3WBAA 3LUTA 3AMLA 4U5IA 4YU1A 4ERGA 5E6ZA 2W62A 4GABA 3I65A 3LLDA 3WLHA 1ADDA 4MF4A 1XINA 5LHEA 3C2YA 4G7FA 3G3MA 4MIMA 2E25A 1ONWA 3OODA 3AHTA 3SCVA 4I8DA 2X7VA 3B40A 4A21A 4QQUA 2CLOA 3C61A 2DZAA 3HG3A 2YCIX 1OGGA 3OBKA 3OP2A 4Z0JA 3CUHA 1J0YA 3GYEA 5I00A 4FNRA 1H3GA 1FA2A 3EKGA 5CJNA 2RUSA 1UKPA 3EX3A 3O6DA 4UTJA 4ACYA 1OGSA 1OZMA 1TJ1A 1JD9A 4DYJA 3RDKA 1GYNA 4WY0B 1MZRA 3OBAA 5B80A 2YKKA 3M6YA 3U7BA 1OB0A 1LBMA 1XD1A 4H8UA 1V51A 5DMNA 1CXHA 4TVCA 4AZ6A 4I6KA 1PUDA 2WMGA 4D8AA 4BEUA 3PZOA 4GYJA 3BCJA 5ABFA 3UWYA 3OZYA 4GE8A 2F7FA 3QR1A 4PTDA 3FOKA 3G18A 2BODX 1NDVA 2PPGA 2Z1BA 4NYUA 2VOTA 3UWUA 1JCJA 2Y70A 3QPZA 1RHCA 1TE1A 3VVGA 5GJNA 3WQVA 1GCYA 2B7NA 3CWHA 2G3FA 3SCTA 1Q45A 3EWCA 1XDJA 3T0CA 1UZDA 3K1GA 3W7QA 2DT1A 4AISA 3ITVA 1V6YA 3W28A 4M6PA 2BHZA 2Y89A 3VDGA 4PMJA 1QHZA 4IPPA 1EP2A 1IEIA 4PTWA 3S9YA 1HKIA 4S3KA 4GX8A 3KRSA 4B16A 3W38A 4GIRA 5E70A 3HJZA 3KHDA 2ZX9A 1G67A 1QDSA 4MLJA 4HNLA 4AY7A 2PGRA 2ODOA 1T8QA 3S2CA 3ZSTA 1A5UA 1OFQA 1X98A 1VB9A 2PD5A 1EC9A 1K77A 4EXBA 3ABSA 3ZT7A 4F0RA 3P67A 2O55A 1DQUA 3FA5A 3VINA 3WBWA 1O68A 1LWHA 5FF4A 1FHDA 1UP2A 4QJ4B 1G7UA 2DVUA 4KFNA 3F4WA 3AHZA 5EBAA 1TCDA 3HOJA 3WLMA 4CQ9A 3CT2A 3GHRA 2PE4A 5BU9A 3K8LA 2VVNA 1OF8A 4Q4QA 2CWXA 2YZ5A 4N42A 3TFXA 4AY1A 4UCGA 2GWNA 3ZVIA 4JD4A 3LYEA 3WK0A 3G1SA 3FAWA 4L80A 3V4BA 1VJZA 3QMTA 2G0WA 3OBEA 3IRSA 3TR2A 1S38A 2IPWA 4WR3A 3TN5A 5BRBA 3ORWA 4JIEA 3VI2A 3SGGA 3LCHA 3GH7A 1TPWA 1GVEA 3NQ2A 3CEPA 3S4TA 4LAZA 2WM0A 3E0IA 1IEVA 3BPWA 3MPGA 4ES4A 4GUJA 3NR0A 1REQA 1XGEA 1UD6A 3MSRA 1J0JA 1Z48A 1VD6A 3PJUA 1V03A 4UQDA 1ZLPA 4UFKA 1W1VA 2DZXA 3GG8A 1XHGA 4C6KA 2FDSA 4OWGA 1EGZA 1A0EA 4HQVA 3FKKA 2VYOA 3AUJA 3FSTA 3BLLA 3PPFA 1KTBA 1OZQA 4MY8A 1VCFA 4K38A 3W3OA 5AC5A 3CUIA 1IXOA 1UUQA 4KCWA 1GT8A 1XP3A 1DL3A 3TX9A 2OSWA 4ZO6A 4CNSA 4NVTA 4Q8UA 2BXYA 4LVDA 4ZB5A 1GOMA 4JFUA 3CV6A 2ZXAA 4UXDA 3LM7A 3IANA 4GFIA 3GXDA 4LEQA 2TRSA 1FOBA 3WQPA 3LZ5A 3O9NA 2Z1SA 4XZMX 3W73A 2Z26A 3S2NA 3EWYA 2AAMA 1ZP4A 1ZRQA 1OBAA 1J96A 3QFWA 4DX3A 1PKYA 3DYMA 1GYMA 1KGUA 2ZRXA 3EXTA 4PTNA 4W8LA 4OT7A 5DELA 4M81A 1RBLA 1G4SA 5FAJA 2NVAA 1KFLA 5KTLA 4RLIA 1H60A 3A13A 4J7RA 3VABA 4B2DD 3LG3A 3CQHA 3VNKA 1IT7A 3L12A 1ISYA 1I2RA 2WSPA 3VDAA 2IKIA 4DAFA 4B91A 1XR2A 4HT3A 4PUEA 3B8TA 4GI4A 3TC7A 4WDUA 1SSGA 2BOFX 1EC7A 2X1IA 4DIAA 4MVAA 1V77A 4PRRA 3OTRA 3CH0A 1CYGA 3M16A 4GGHA 4FR1A 2PDQA 3DOPA 4JNZA 2UY2A 4PUKA 4BI7A 3SFKA 4UTIA 4MDPA 2ZXQA 1YLVA 4GMEA 3SRKA 4H6QA 1IWPA 1MEWA 5FCZA 2I7GA 3NEHA 1W2VA 3MWCA 3MP3A 1S2TA 3C2EA 2YZRA 1C92A 3BCDA 3L4VA 2QJGA 3LBCA 3WDPP 4O12A 1GWJA 1QMLA 5DCBA 2NQJA 1JVNA 2QDDA 1J5TA 2VEKA 1RCOB 1BKHA 2ZE3A 3OZMA 4ZO9A 5CPLA 1QNOA 3NXLA 2Z00A 2PZNA 5G2HA 4HSOA 4XD4A 2ZRZA 3MUIA 4O4WA 3ONBA 2UY4A 3VNZA 1F6KA 1I2PA 1IR1A 4NP7A 3U5UA 4LY8A 4MMWA 3B0YA 3BAWA 1OC6A 2C0AA 1H0GA 2XGBA 5AOUA 3N6JA 4W7UA 4IFKA 4JY9A 5F1VA 1XC4A 1DQXA 4HK5A 4MSSA 3PF3A 1NFBA 3WBYA 2D2OA 3D6NA 2V3FA 3BQ6A 3LSCA 4YS1A 3N15A 1NQ6A 3CQKA 4JTHA 3TLQA 4GBUA 1TREA 5HJYA 2VZOA 3N34A 3DFHA 4LBRA 5MKGA 1GOIA 4FF7A 5I0DA 2EPLX 4AEEA 2WKJA 2ISVA 1ISVA 2VFHA 4AHPA 1M04A 4FXFA 2ZA2A 2GJXA 4K3ZA 1EUNA 3GDKA 3WUFA 4NAEB 2ZX5A 4TMBA 3CZKA 2BB0A 5C8BB 5BYWA 2GWGA 4L1XA 4IG2B 4PEEA 3S5OA 4XD3A 3UZXA 3TONA 4JTUA 1WZLA 4GG9A 1MSSA 1VBHA 1XG4A 1VPYA 4D1IA 3PNZA 5CBIA 1R3YA 3MI3A 3CC1A 4BK9A 2VEIA 5BOFA 3T2OA 2C16A 4UZSA 4Z2KA 1O5XA 2QXWA 2QCCA 1DIEA 4EACA 1RA0A 3WNKA 4HU8A 3LV5A 1L6GA 1HKWA 1VFUA 4L9YA 1S1PA 3W87A 2RDTA 1A3XA 3GTIA 1QR7A 2OYKA 3ZR5A 5CZ0A 3OZPA 4D6GA 4M82A 3MP5A 4AWTA 3BQ5A 1PAMA 3UWVA 3T6CA 2NQHA 3W7JA 2NVCA 1W91A 3HPZA 1VYRA 3NZQA 3ZLFA 4LXFA 3VOHA 1JXJA 2FZDA 4UFMA 5D9MA 1YPFA 3LM3A 2IMRA 4W87A 1PZ2A 1DHPA 3ES8A 3IIZA 3HFYA 2Y61A 1WXZA 3AJ7A 4JTGA 2GGGA 3WJSA 3CMGA 4J3ZA 3L67A 1T41A 2QF7A 3U3HA 3LMZA 4IGNA 3ISIX 3U4FA 4MFEA 5D30A 4D6EA 4HTBA 2VD8A 4LC6A 3W25A 1X1ZA 4I7VA 3CAKA 3ALGA 1TWIA 4HZ6A 4TTUA 1UR8A 1GONA 1I6NA 3VC5A 3AHXA 2W0UA 7ODCA 2F6KA 4RZ6A 2QMKA 3P82A 2G95A 3ZXWA 3RX3A 1TJRA 4LGXA 4ZXLA 4JYEA 3W75A 2H9AB 3EOUA 3T05A 5LZLA 4ZQPA 4FA3A 1U5HA 1F3XA 1ISZA 1JUEA 4RDWA 2E5BA 3SR7A 1FWEC 1E4LA 5CEWA 2TAAA 5EFFA 2V5DA 3NXFA 3LCIA 5E0FA 4AIEA 2V2CA 3C3NA 3IV3A 5E0CA 1TVPA 2XZ9A 1VBJA 2GGJA 3A22A 1ICQA 2DZVA 4I9AA 1BKSA 1VBRA 2PTXA 2L5HA 3B8UA 1FDZA 1NARA 3B0XA 3LTSA 3MQTA 1J10A 4JBRA 3WLOA 1S3TC 2EPMX 3W07A 2XUCA 4ZB2A 3SQMA 2O9RA 3R12A 3R0KA 1FVPA 1WZMA 3WEMA 3IIOA 2BZNA 2NXHA 2ABAA 4JZ5A 2PWFA 5GNXA 1HTIA 1Q7QA 4TQTA 2X8RA 3AALA 3VIMA 1K9FA 2ZRUA 5RUBA 4R88A 3TW6A 3COTA 3N1AA 2B7OA 3M64A 1AQ0A 3IJDA 1JDFA 3VKDA 4GI9A 2G50A 1ME7A 3C0SA 4REQB 3VX0A 3USZA 4LAKA 4GIYA 2X09A 2XPKA 4LEFA 4JS3A 2BV9A 4AZIA 3W2LA 4I5RA 1V6XA 1XBXA 4NRRA 1JCNA 5B7ZA 4ZTYA 7ENLA 3R25A 2I5IA 2A21A 1H50A 1FH7A 5FF3A 4CN4A 3VIHA 3K4DA 3R7MA 3PBGA 3POHA 2Y5SA 3AMKA 3A6OA 3H26A 3HG5A 4GI8A 3B4YA 1A3HA 3KRZA 3LHTA 5FEZA 3WK1A 4UOJA 4DLMA 4EX4A 4O11A 2V69A 5D8WA 3BSGA 5FL0A 2INFA 4HU3A 4M29A 5AHFA 1WDPA 3RO6A 3UG5A 4IZGA 4CD8A 1N55A 2YFNA 3W1AA 2ZUVA 1XLCA 3L23A 3LS9A 2NUWA 1QJWA 3OHMB 4L6DA 2POZA 1PO9A 4HYVA 3PZMA 2IW0A 2MANA 4JN6A 3G3DA 4JTJA 3FJ4A 2EKCA 3LPFA 3ARRA 1BXNA 4B3KA 2DT3A 3CIVA 5EB8A 4XD5A 1LWJA 1RR2A 4P8WA 1KB3A 3HN3A 4QEEA 1UA3A 2A85A 4XKMA 3GG1A 3A47A 1YBQA 2P3EA 3TSMA 1PL9A 1P1MA 1AL7A 4PYSA 1MW3A 3FHAA 1A0CA 4BF9A 3T42A 3GXTA 3GNOA 3BOXA 3NPUA 1W32A 3CK5A 3DGBA 4IQDA 3GHTA 1FWIC 3L4XA 3WBXA 5D2TA 1QW9A 2NT0A 1KFKA 1FWRA 1UASA 3NSMA 3N25A 2R1MA 4PRWA 1GVRA 1C8QA 2FMOA 5AHLA 5KZMA 5FJPA 2C71A 3CPRA 2H3BA 3HB9A 1RP9A 2ZUSA 1C29A 1JPIA 3N9SA 4JL1A 4NZ1A 3BAKA 4F9JA 4IJRA 3P84A 5F2MA 1LORA 1CI1A 1TJ0A 4XVDA 3URBA 1ZL1A 5PTDA 5FJTA 3CIXA 4DI9A 2VCAA 3WQDA 2GGIA 3GIPA 1JPDX 4OV9A 2NV9A 4O4VA 3LXCA 5GVJA 3IGUA 4DBEA 2BVDA 4NJKA 3TN3A 2EJAA 3M5YA 4W5ZA 1EJXC 3T09A 2FKPA 1P48A 3H7VA 4JHZA 1ZCOA 2A7NA 4AD2A 1RK6A 2DGAA 2IS7A 1WO2A 4OTKA 2EJ1A 2NX3A 4GOAA 5BCAA 4NQ1A 1SM9A 3VKKA 1LLOA 1MI3A 1TWDA 5A95A 4GUIA 3VNJA 1J93A 4GI6A 1ECEA 1ZCCA 2W9MA 2PP0A 1VF8A 2I56A 1BGGA 4DZHA 3N2MA 4XAZA 2NV2A 4AD4A 3EDEA 4ERIA 3T0TA 5A2AA 1OHLA 5G1MA 4B5NA 3V35A 1P0DA 5H8UA 1JGIA 1JIBA 1FFRA 3OLEA 3I3BA 1CDGA 4TXEA 4JTFA 3DG6A 5I24A 3SGZA 3A64A 2R1PA 4O16A 1R7OA 1E6SM 1XLJA 2OSYA 1FX6A 3MUAA 1M41A 4Q4PA 2XGZA 1OX4A 3JZUA 2OTDA 4UOZA 4ZEPA 2BNJA 4K8EA 3KBSA 4HIBA 4X22A 2WYSA 1M65A 1E4IA 4GO8A 3GVWA 4BQ2A 4PMXA 3IACA 6CGTA 2J62A 4DBWA 1PCWA 2C1IA 3JS3A 3BLKA 1Y5WA 1SO5A 5FD0A 4Z0SA 3RITA 4E3TA 1PWLA 3SIMA 1R3VA 3UWQA 1I2QA 4D9PA 2TODA 3MKCA 1SW3A 3MCMA 4PTXA 3UR8A 1C93A 4NX0A 4HNCA 1PBGA 1KBJA 3S42A 4P7LA 3SDOA 3T07A 4I9MA 4KETA 1ZAJA 2ZOXA 1A5SA 2R1KA 1CGXA 1RAKA 1Q8AA 2VL4A 4GO9A 2PF0A 4XD6A 3U2CA 4HGXA 4DWSC 3DHFA 5DXXA 3GU9A 2CU0A 3NG3A 1UKSA 3L2LA 3BAJA 3MUZ1 4DF2A 4K68A 4ZOEA 4UTFA 3ARXA 1D3GA 3W7EA 1B3WA 4HYWA 4KCVA 4C6OA 3E3HA 1PEZA 4Z2GA 3T9PA 4JTCA 1NVMA 1BEUA 2WMJA 1GKPA 2CESA 1XRFA 5CLTA 3RFAA 4F40A 3KCJA 4ZA0A 2YDSA 3K13A 5JUVA 3WH5A 1VFOA 5LIYX 3FXGA 3NYDA 2DUZA 1V3KA 5G4WA 1KR0A 4ACZB 1W9XA 3SCNA 4GZ7A 3U6WA 4GZEA 1FCBA 1U30A 4PCTA 1DV7A 1Z41A 3TSDA 4HMNA 1FXQA 3ZM8A 4F9DA 3STGA 1FXPA 1RQBA 3DEQA 3TFCA 1XLIA 3MCOA 4LS1A 3GW0A 3Q67A 1KV5A 3BOLA 2OQHA 4IGSA 1LWIA 1W1TA 1W37A 2XIIA 1YXCA 1KWKA 2RKXA 1P4CA 1XIIA 1JZ2A 4F0MA 1EO7A 4JFSA 3C0QA 1OX6A 4DHGA 2GVYA 4TVUA 4IP5A 1EOMA 2ZIDA 1LLWA 2CXGA 1RV8A 1EOKA 1LL4A 1TB3A 1JL8A 3HU7A 5HQLA 4EKJA 3DBPA 4EANA 3WUBA 3PM6A 3UEQA 3UY8A 4H7CA 4YMZA 4A4AA 4IMEA 3KTSA 4U31A 2XIOA 1VRXA 2RGLA 1WBHA 1IEQA 4XAFA 3HURA 1FY6A 5FEPA 2B7QA 1UWRA 1TZZA 3L4ZA 2WZHA 3NQ7A 2ZZ6A 2I14A 1WBJA 1RPXA 4QS5A 3MKVA 2HBVA 2XSBA 1S5MA 4I8YA 1S46A 4K8GA 4JTDA 4DWSA 3AMCA 1MVYA 2ZWYA 3BJSA 3UR7A 4GQRA 3VIKA 1DYSA 1IXPA 7REQA 4L1WA 3UGRA 7A3HA 1KXVA 3UVAA 1NOWA 7CGTA 3TTSA 4INFA 2D3LA 2Q09A 3MC5A 2WHKA 1CNVA 3ZMRA 4B15A 1POKA 1FP8A 4GCAA 3S1GA 1LUCA 2PWHA 2XIBA 4GUFA 3QMRA 1XM3A 3F4DA 5EMUA 3QH2A 1B54A 4PMOA 2QNEA 1SYTA 1WCGA 3LDVA 1IT0A 2VZTA 1YEYA 3MV01 3W1RA 2NZLA 4KBXA 3VNLA 4HNUA 2POTA 4DBDA 3WL0A 2NXGA 1OD8A 4UR8A 1NP0A 3P93A 2NWSA 2W6RA 1U33A 3DYPA 3VMOA 3D46A 4DRSA 3WH6A 3DENA 4NZ3A 3TROA 1YMYA 4KH2A 1GQJA 2OMAA 1TX0A 2J9YA 1H41A 3MANA 2CERA 2PEVA 5CAHA 2PB1A 4W85A 5D09A 4N6FA 1E1CB 3C6CA 3E0FA 5A94A 1LYXA 3TZFA 1VEOA 1EO5A 3DGRA 2VOMA 3B03A 1KTNA 1B3VA 3Q94A 8TIMA 2J77A 1IF2A 3BLFA 2DZWA 1ZBVA 4AWUA 4B3ZA 3REQA 4IWWA 4NIRA 4RPPA 4HSHA 3LPOA 3QZ6A 2YW3A 3FN9A 3PZUA 4O0KA 2ZXDA 4BQ4A 4JR5A 3TCEA 2C19A 1ZJBA 4E2OA 1LF1A 4GNKB 4YN5A 1Q2SA 1M7XA 3SURA 3WF1A 2BGQA 4UMAA 1QUMA 2AQVA 1AJ2A 5BWFA 3TH6A 5CC5A 3RXZA 3EWWA 1KGWA 3RO8A 3LTYA 2FZMA 3WH7A 3MY9A 5AC6A 4JTIA 3BXWA 1VJIA 3LGGA 1N82A 4U3AA 1QFEA 3IIPA 3C2RA 3ITCA 1NEYA 1DXEA 1M7PA 4QGCA 2F9RA 2YYTA 1KCKA 1ZBKA 3L0NA 3M6DA 3BICA 1CPUA 2J7DA 2GPTA 3SCRA 2DDXA 3RM4A 1KM5A 1E9IA 4Y8FA 3R58A 4QXIA 2WB5A 1E3ZA 1F74A 4I5XA 1EZ2A 4MZ8A 2UV8G 2WAGA 1IXQA 3ABXA 3PNUA 2V9DA 3WUGA 2J9XA 3KEHA 4GC3A 3MDUA 2DVXA 3I4EA 3W84A 1K7XA 3GNXA 3DFNA 3TJ4A 3GTFA 3NL6A 5E0KA 5CPOA 2ZX7A 1MXSA 3I3DA 3APGA 3IAQA 3IGSA 3R8HA 4G8TA 2NLYA 1ML1A 3FEMA 4CVWA 5DLCA 3OIXA 4J27A 2AL1A 2NT1A 3IUHA 1MWOA 1OIFA 4XZNX 3W7NA 4L4MA 2J66A 1SFSA 2GQ9A 2BOEX 1EHNA 2IPFA 2XH2A 3MZ2A 3TQPA 2WZEA 4FNQA 4S38A 3TE9A 3GZAA 1Z9AA 3QR0A 3S1XA 1CXEA 4FALA 1RXOB 4ADUA 4C6EA 2FJUB 4CEXC 4Z2IA 1PWMA 4MB1A 4PB3A 4LVAA 1T5AA 2C8NA 1XD0A 2ZXBA 5ABFB