3PZIA

Structure of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1 in complex with beta-d-glucose
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila
molecule tags Hydrolase
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
total genus 154
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pziA00
1HKJA 3MV11 1JAKA 1E6XM 1US2A 1V6UA 4QCFA 4JFWA 1CLVA 1L0PA 3AYSA 1EOMA 3AXHA 4H8UA 3UR8A 1G94A 5KZ6A 2CPUA 2GDUA 1CGTA 3NCOA 5CPSA 5D8ZA 3WDQA 3ARVA 2WHKA 4QAWA 1ISYA 1IT0A 1ODZA 3OZOA 1AQ0A 3F5JA 3HMCA 3OLGA 3A4XA 1X6LA 2WHLA 4AIOA 4KGLA 3CUGA 1GOWA 3A4AA 3GZAA 3WD1A 4CD4A 3K8LA 5GNZA 3CUIA 4E8DA 5CSYA 2V3EA 5CSUA 4LYRA 3TONA 1GOOA 3AHXA 3WUFA 3VIHA 1JFXA 1CXEA 3VIGA 4BQ4A 5AYIA 1OT2A 5A2CA 2EPKX 1OGSA 1NOUA 4OJYA 3AHTA 4C7GA 4JHOA 4OIFA 1A3HA 4XUYA 2X09A 4MB1A 1BYCA 1G5AA 2BY3A 4OOUA 2WMIB 4WKFA 1AVAA 3WDJA 3WH8A 3OIHA 3MS8A 3WH6A 5A2AA 4WK9A 4MAVA 4UFLA 4BF7A 1JZ3A 2CHOA 4KGJA 3GXMA 4W5UA 3BXWA 1D2KA 4TUFA 4PSRA 1DWHM 4U2YA 4W84A 4HA3A 2JF7A 5IHRA 3WMSA 3BSHA 3ZSSA 4HOXA 1KXTA 3NIYA 4UR9A 1BTCA 4J28A 3M6DA 1QPKA 4LPCA 3N1AA 2DSKA 5E70A 1US3A 2AAAA 3KL0A 1JZ6A 5DT7A 2Y24A 1BYDA 4JFVA 4H7VA 4TVUA 4GZJA 1CDGA 3ZT7A 3B9AA 1ISXA 1XH2A 1DWJM 1MVYA 4FMVA 3CHDA 1BHGA 1N82A 3VNYA 1E43A 3AHVA 1J01A 3AS2A 1ZJBA 2UY3A 1J11A 1ZL1A 3RM8A 3ZR6A 2XGBA 1R86A 3OLIA 3KWXA 3LPFA 2VR5A 2IXVA 3SCSA 4MB4A 3VD5A 2D2OA 3ZT5A 3HN3A 3CZKA 2PWHA 5A95A 1B3VA 4AZIA 3L4ZA 4W8AA 3T0AA 3I3EA 2DSVA 5F7UA 1J12A 4PMOA 4J3TA 5A6JA 4ZE4A 4BZYA 3WBEA 3F4VA 5FD0A 5EFFA 2G3IA 4FLQA 1E71M 2BXZA 1J0YA 1LLOA 1V6YA 3WQ6A 2OSYA 7TAAA 1W3JA 1KBBA 5I77A 3WDPP 1MQQA 3K8MA 3UEQA 1FH8A 2ZOXA 1SR0A 2CIPA 1OD0A 4M82A 3DYOA 3MV01 1GQJA 1QI0A 2D24A 1XH0A 1BPLB 2XVPA 3AIBA 4UOJA 1V6XA 2WYSA 2GJPA 4M56A 2PWFA 3TTOA 2G4FA 1UKSA 4W89A 4RE3A 1JFHA 3AMGA 2XFFA 2E9MA 3BMWA 4UFIA 4V2XA 3SCOA 3NSXA 5A6KA 8CGTA 1V0LA 4GZEA 3CZLA 2DT3A 4FF5A 2DSUA 2VNCA 4DUWA 2VVNA 2YA2A 4BQ5A 1GW1A 5CGMA 4V27A 4B9YA 3EMZA 3AYRA 1UD6A 1JNEA 3CH9A 3TTYA 3BAKA 5ABFB 2EPNA 1R7OA 2XUCA 7A3HA 1X1NA 1E73M 3WNOA 3B9DA 1OINA 1C93A 1OGBA 1Q6FA 4GI6A 3VD7A 4E2OA 2BVTA 2O9TA 6TAAA 2WZHA 1M7XA 4ZXLA 2XWDA 4TOQA 4CD8A 1OD8A 5I0DA 1H11A 1HF6A 3L4UA 4QLJA 1YQ2A 2ZUUA 3ZIZA 1M04A 2CXGA 4NZCA 3FHAA 4PMNA 4UFJA 4H8VA 4MDPA 2VOTA 1GCYA 4UFMA 1MXGA 4PEEA 4HMCA 5JIWA 4Z2HA 3W0KA 2F8QA 2MANA 2DGAA 2GK1A 3WUGA 3W4RA 2VCCA 2YOCA 4AWEA 3WF3A 1GOMA 1UZ4A 2XJ7A 3ALFA 1JIBA 3QOKA 3AMDA 1CEOA 3WF1A 2WMJA 1C92A 3VIMA 5A3HA 1E6SM 4GQQA 5A6LA 4CU8A 2XHYA 4W7VA 1OWQA 3I3DA 3MMWA 2V3GA 3VILA 4HTYA 2J47A 4DUVA 1ZBVA 4W93A 2VRQA 2E8YA 2ZUNA 3QR3A 1JZ4A 3VDHA 3RILA 1R8LA 4MADA 3L2LA 3GNPA 1HN1A 4JL1A 2E40A 3WQ4A 1W9DM 2CBUA 4WIWA 3QOMA 2GK1B 2VL4A 4CKQA 2ZX8A 4MNMA 3ZR5A 1E9LA 1WDQA 3ZJKA 1UG6A 3FAXA 4FLOA 5HXMA 1CYGA 3WQVA 1WE5A 3W27A 5I24A 2WB5A 4C7FA 5HBFA 4AY1A 1MW2A 3ARXA 2BY2A 4GPNA 1XYFA 2E3ZA 2X1IA 4JKLA 4Q22A 1CTNA 2PBGA 5TD4A 1R85A 3MMUA 4JCMA 2XSAA 2YA1A 1V3JA 1OIMA 4R27A 2ZXAA 3FHQA 4TTUA 4P8UA 2BVDA 3WDHA 4QLKA 1J9YA 4BS0A 3T0DA 1GORA 1C8QA 1PIGA 3WDIA 1UKPA 1UD8A 1HL9A 5BWFA 5I6SA 3GXIA 4PTMA 1JD9A 4NI3A 2OWWA 3WL1A 3AIEA 5M3WA 5I3DA 4TX8A 1Y7VA 1NM9A 3B9EA 2OSXA 3BAXA 2G3MA 1G9HA 2ZUTA 4AZ7A 3O6AA 2E9BA 1GNXA 4CD5A 1GVYA 3GTNA 4OKDA 1CIUA 2CKRA 2OWXA 3DHPA 4HU0A 4A3HA 2W63A 1NQ6A 4JHZA 1J10A 1GVIA 3TOPA 1PIFA 1TVNA 3GH5A 1W1VA 2J7FA 4MNKA 5A6AA 2XG9A 1KXQA 3MO4A 2UWFA 2B31A 2DIEA 5D9PA 5HDRA 1UD3A 4ML4A 5AY7A 1QNRA 1DWAM 2CERA 4UTFA 4MAZA 1HXJA 3CHEA 4UFKA 4QLLA 1VBRA 2W61A 1W91A 1UWIA 4AD3A 1ZBCA 1GQIA 1W3LA 3TTSA 2YBUA 1X6NA 3VMOA 1E0XA 2C0HA 2RGMA 1QI5A 4DWSB 5E6ZA 4GI8A 4PMDA 5BROA 5BRQA 1W2VA 1UKTA 4JKKA 4HU8A 4PMXA 1HVXA 2TAAA 1TR1A 4P8WA 1WZLA 3UG5A 3G6MA 3GXDA 1H49A 4HOZA 3AS1A 2EPLX 4ZE5A 4WLCA 1JI2A 2Y8KA 3ZM8A 1JZ5A 1VJSA 1JDDA 3MUY1 1EH9A 3BCFA 2WBGA 3E1F1 1QI3A 2Y8VA 4W88A 3MMDA 1UR2A 4M80A 1NOFA 4MB5A 1Q6CA 1U2YA 1J0KA 3IJ9A 3IJ7A 2C8NA 4NF7A 3LMYA 4HZ8A 3T09A 2NT0A 3PZOA 3VIPA 1H4PA 4UOZA 2VMFA 2FHBA 4UZSA 1NWSA 4UFHA 5A6BD 4B3KA 3WNMA 3DYPA 2J7DA 3KL5A 1WO2A 4XV0A 1PJ9A 1E3ZA 2HISA 4W5ZA 3BLKA 3N11A 2WKGA 2X0YA 4E4PA 3UESA 4QP0A 4D71A 3WMCA 4AIEA 2WMGA 3LPGA 2CNCA 1JNDA 3WNLA 1E0WA 3TTQA 4NSBA 3GBEA 1VENA 1JYWA 3T2OA 1ZB5A 1EDGA 1OSEA 1KFWA 5DFAA 1HL8A 2YDQA 1KB3A 1VFUA 4MB3A 3GYCA 5HNNA 1E4IA 5EMYA 1JZ2A 1NOWA 1F4AA 3WL0A 4PMVA 3GXFA 4AD2A 5CPQA 1E4LA 3SIMA 4P7OA 2WM0A 3RCNA 1QVBA 4Z2KA 2W91A 3TP4A 3WUEA 4CCEA 2VJXA 3AQUA 4GQRA 2VCAA 1B30A 2CBJA 2E0PA 4W87A 5GQBA 4BQ3A 3WQ8A 1V3IA 3GNOA 4QDMA 2J78A 5FIPA 3WN6A 3CHCA 5CLTA 3WUBA 4AZBA 2JIWA 1RD6A 4UQEA 4TXEA 5I5RA 4JL2A 5ABEA 4GINA 2DT0A 4U5KA 2XPKA 1E4MM 4OZOA 3NYDA 3NSNA 2QV4A 4XZWA 4FLSA 3WF4A 3II1A 4DUXA 3OB8A 2VT0A 4LXFA 3RJXA 2YA0A 5ABHA 1Q6GA 2NW0A 3EDFA 5A1AA 3AROA 4KRUA 2UY5A 2GSJA 1V3LA 2VI0A 1QNPA 3MANA 4FK9A 3AHZA 3AZTA 1QHOA 3GBDA 1KQZA 4EANA 1GUVA 2ZX7A 4N0RA 4J3UA 2QLYA 2CBIA 1H5VA 2VR4A 3RM9A 2BY0A 2A3BA 1NP2A 2A3EA 1HKKA 3AHYA 4DM1A 4WKHA 2VX5A 3U57A 3PTKA 3GH7A 2EPOA 2J7CA 4D6GA 3T2PA 3NJ3A 3AFBA 1HX0A 1J0HA 3VU2A 3BAWA 1CENA 4U2ZA 4PMZA 1MQPA 3VGGA 5BXTA 4AXNA 5IDIA 4R5EA 1B2YA 2FH8A 1H0GA 3BAYA 2WVTA 4PCSA 3CZGA 3ARSA 3VDAA 3OA5A 2BV9A 1V3MA 9CGTA 1MXDA 2WMFA 1FOBA 5IFPA 4IUGA 3OZPA 3WF0A 2ZXDA 1EO7A 4B16A 4ACZB 1B31A 3ARRA 1D3CA 4CUCA 1XD0A 1IV8A 3O2LA 3VD9A 4Q7NA 1HJWA 1UWQA 1W9XA 4M29A 3DYMA 1FP9A 4W7WA 2QPUA 4UQDA 1GOQA 1UOKA 1VIWA 4P7NA 3SUVA 5ABFA 4UQ9A 4PMUA 1TFVA 1W32A 1G0CA 5GNXA 3VGFA 4JFUA 1BF2A 2JF6A 5HPOA 2BNJA 4AMCA 3VMNA 3VUPA 3SUWA 2J75A 3AXIA 1TE1A 1ISZA 3VDBA 1FFRA 4WSKA 3FNDA 1V3KA 2JIEA 1E72M 3VNZA 1K9FA 2IXUA 1BSIA 2YKKA 1OB0A 1V6WA 3W6LA 2WZEA 5CLWA 5JIPA 2WLYA 3SCQA 2XVNA 1W9VA 5ECUA 1EO5A 4P7QA 4GO9A 1JDAA 1EGZA 4AD4A 4ATLA 3WBAA 3BLPX 1C91A 4AZCA 2Y4SA 2WW5A 5BXRA 2D23A 2D0FA 3OLDA 4F66A 4YHEA 1W9PA 4HP5A 3GNRA 3PZGA 1MW1A 1ODUA 1BGGA 2J4GA 4MNJA 1HJVA 3ARPA 4Y7EA 1EHNA 2UY4A 3PHAA 3GM8A 1QBBA 3MUZ1 5JBDA 3N17A 2OWCA 1ECEA 3EBVA 4IPNB 4CCDA 1R87A 4GI9A 3L4XA 3VGDA 1HKIA 1DHKA 1UUQA 2O9OA 1SMDA 3LPPA 1CBGA 3BGAA 1XSJA 1QBAA 3EDDA 1FHDA 1QHZA 3L4WA 5KEZA 2ZXQA 1M03A 1L8NA 1QI2A 3AZRA 4KH2A 4B9ZA 3RIKA 3AMLA 3PZVA 2G41A 2J7BA 4CU6A 4JAWA 4LGXA 3WIJA 1HT6A 2ZUMA 3LPOA 3ARWA 1QNQA 5A6BA 1TUXA 1MW3A 2DIJA 4IPLA 3VM5A 4JFTA 1E40A 1UWRA 4HMDA 2A3HA 4GIAA 4HA1A 4Z2LA 5BYWA 5EB8A 3WEZA 3VIJA 1UQYA 1MFUA 3K8KA 1VFOA 1UKQA 1I75A 2WVVB 1MW0A 3AS3A 3PZUA 1H09A 4WSJA 2FH6A 2X8RA 4D6DA 2PB1A 1CLXA 1C7SA 1RP8A 3ZJ7A 1CXHA 1E5JA 3OG2A 5ABGA 2DT2A 2VZVA 5A69A 4J3VA 2XYLA 5CZKA 4EK7A 4CD6A 4PTWA 4JKMA 3VIKA 2D0GA 3WD2A 4P8VA 1PZ3A 2C7FA 3BSGA 1OBAA 1LWHA 1V6VA 1LL6A 2E9LA 1W9UA 2JFEX 3PZNA 4L4OA 1BAGA 3WSUA 2J74A 1JDCA 4HZ7A 4PMRA 1WNOA 4AW7A 3AISA 4CVWA 4U31A 3EMQA 4PRWA 2VTFA 1JXKA 3OBAA 1WDSA 4AYSA 1QOXA 3VD3A 2NT1A 4X0NA 1K9DA 1Z32X 1BLIA 1B9ZA 1UH2A 3CUHA 2EPMX 3CMGA 5EFDA 5A6MA 1IZKA 1XRVA 1HIZA 1WCGA 1W1YA 4L4PA 1SYTA 2E8ZA 4OBRA 1VJZA 2ZX9A 1AQHA 1EXPA 1OM0A 1Q6EA 1KR1A 2QMKA 4PMYA 4TVDA 2F61A 5DMYA 3WH9A 3M46A 1DP0A 1E1FA 3FW6A 4S3KA 1I1WA 3VINA 1UWUA 3SCPA 3ARYA 2J79A 1HJQA 1E56A 2GFTA 2WSPA 2WVSA 2J8FA 4U3CA 5EBAA 2VURA 5D9MA 4AEEA 3WQ5A 1EQPA 1XHGA 4BA0A 3N9KA 5C8BB 2VCBA 1UD2A 2QHAA 1U33A 1KXVA 2ZE0A 2W62A 1Q6DA 2RGLA 5D8WA 3N18A 2XVLA 3F5LA 4LYPA 4UNIA 3ZMRA 4N42A 4CU7A 3BMVA 1UR9A 2CBVA 2VRJA 1EDTA 4UCFA 1UR1A 4AZHA 1LL4A 6A3HA 2WANA 3N12A 3VMPA 4RL3A 3THDA 2PWGA 3WFLA 1DWGM 3VX0A 3RO8A 3WEMA 3A3HA 1H0IA 4EAMA 1GONA 2VX6A 3K4DA 5BXPA 4PSPA 5D9NA 1OIFA 3PZIA 2ZIDA 4YN5A 3NDZA 2WWCA 1UWTA 2J25A 1ZS2A 1OT1A 2PWDA 3SUTA 1YHTA 2VC9A 2WKLA 1HVQA 4HOWA 4J3WA 1CGYA 1UR0A 3K4AA 1V02A 1I1XA 1PX3A 3KL3A 3D5HA 5FL1A 2G3NA 1O7AA 4MJ4A 1P6WA 3A47A 4E8CA 1V3HA 1HKMA 1XYZA 4S3JA 1K6AA 4K68A 3AXXA 3IK2A 1CGWA 4A3YA 1NWTA 4OBSA 3GDBA 4OUEA 4M8UA 1E0VA 2YL5A 1B3YA 1MYRA 5AC4A 3S6TA 3MSDA 5BXSA 2EO7A 1ZU8A 3W38A 1VEMA 1JL8A 3OGSA 2VZTA 3CIVA 1WPCA 4XX6A 5CPTA 3SEPA 3U7BA 1FA2A 4DWSD 4EE9A 4A4AA 2BXYA 4J3XA 1H2JA 2WC4A 3ECQA 4D6FA 4RE4A 1V08A 2A3AA 2DSWA 3VM7A 3MUAA 3PZMA 4J27A 3WNPA 1FP8A 1UH3A 2J7GA 2EQDA 3AJ7A 5A8OA 1V02E 1XCWA 1MWOA 1GPFA 1GQKA 1K9TA 4D6CA 2PC8A 2WXDM 4X0VA 7CGTA 3CZEA 4B3LA 4ZEPA 1ISWA 3A6OA 3CZJA 1JAEA 1XGZA 5C71A 3APGA 3O9NA 2XIBA 1E6NA 4RE2A 3IANA 5CG0A 3KE0A 3FAWA 1VF8A 1UHVA 4LX4A 2WMKA 1BVZA 4M24A 3MUIA 2ZXBA 3ZQ9A 2GDVA 4LYQA 3ZOAA 3W81A 1KCKA 4D1IA 5E6YA 1E6ZA 3CUJA 1W3KA 2O92A 5JUVA 1KXHA 2ZICA 2A3CA 3QGVA 2ZUVA 2FHCA 2EXOA 2WMHA 1BG4A 3IAQA 4UQBA 5FOOA 5E0FA 1IZJA 2BFGA 2ZX5A 1C8YA 2VO5A 1KWKA 1KCLA 4W8BA 3RDKA 3K1DA 1FHLA 1WB0A 4W86A 4H2CA 3PTMA 2YL8A 5LA1A 1PX8A 4DM2A 4WF7A 3UETA 2DPEA 3WDRA 3VKKA 3BC9A 2BHYA 3B8SA 2FDMA 3CTTA 1CXFA 2YDRA 1UR8A 2UY2A 3A4WA 1DTUA 2FHFA 3EDEA 1LQ0A 2VZUA 3WY1A 3VO0A 3VX1A 1RPKA 2W66A 2XFYA 4CGTA 2OSWA 3AI0A 1OCQA 1HJXA 2D3LA 2WCAA 3ARUA 3SCWA 3WH7A 1W1TA 1QW9A 4H8HA 1NWUA 4UQCA 1M01A 1TCMA 1NARA 4AZ5A 1DWIM 4JFSA 1WZMA 5DEZA 3L2MA 4OOZA 3VGEA 3VIFA 5FCZA 3T0BA 4DWSC 2O9RA 4PCTA 5LA2A 1NWRA 3K46A 4HMEA 4H04A 2HVMA 2DEPA 5M03A 1B90A 2W4XA 3W37A 1GQLA 4AD0A 3WENA 2CITA 2WZIA 1BFNA 2Y2WA 3VIIA 1JD7A 3G6LA 3DECA 2VX4A 2W92A 3W25A 4FLRA 5GPRA 1QHPA 1LL7A 1J0IA 1UWSA 2GVYA 3VDCA 4CD7A 4ATWA 1JG9A 1CPUA 4F9DA 2YJQA 4QCEA 1J0JA 1GJWA 2OLHA 3CO4A 1E6RA 4HPHA 2PWEA 1CXIA 2YIHA 1WZKA 1JYNA 3ARQA 1C3FA 4AEFA 1FH7A 3I3BA 1DWFM 1E6QM 1RP9A 2J8GA 1WP6A 1UA7A 3W82A 3AIUA 3VGBA 4IM4A 1TA3A 3DC0A 5CXPA 1ESWA 2ZUWA 4TTGA 5FKYA 3ZJ8A 1JI1A 1VEOA 1AMYA 1UQZA 1GZJA 1QW8A 1V0NA 2BHUA 4AIUA 1UKOA 4U3AA 3CPUA 3L4VA 1UYQA 3WD4A 3SCTA 4C7DA 4LQ1A 3WEOA 4X9YA 1PEZA 4PYSA 1LG2A 4MTVA 4CN1A 3ZO9A 2VZSA 2FGZA 1R7AA 4AZ6A 1QNOA 2VX7A 3VTRA 4J7RA 4NRSA 5AYBA 1DEDA 3M07A 4EKJA 4TVCA 4AC1X 4KRTA 1FFQA 5LA0A 2WWDA 4ZFMA 3AIQA 4Z2JA 2WVUA 1NH6A 3UERA 3RMEA 3GH4A 3HJEA 5E0CA 5A6SA 5E9AA 1GHSA 1E3XA 1EIBA 3SCRA 5DO8A 4URIA 4D72A 5IXEA 4PTVA 1KGWA 5A8NA 4PUEA 3RPMA 1EA9C 4M81A 5JBFA 1C90A 1E55A 1E5NA 3IJ8A 3BAIA 4GZIA 1NP0A 1VFMA 3ARZA 1LF1A 1HP5A 4CN4A 1SFSA 2J62A 2PI6A 2ZWYA 3QHOA 2PF0A 1WKYA 3UCQA 2D1ZA 1MQRA 1CXLA 4HZ6A 2JEPA 2G8ZA 2CHNA 4P7RA 3IAPA 1QI4A 2WLZA 3W26A 3EDKA 1D7FA 1W9BM 5HPCA 1ITCA 1JYXA 3U5YA 2WHJA 4ZENA 2XWEA 3ARTA 2O9PA 3T08A 2WPGA 3AIRA 1A47A 3BCDA 4UZUA 2BHZA 2WBKA 4M1RA 3N13A 4F79A 2OYKA 3KEHA 1UA3A 4Z2IA 3HU7A 3EDJA 5AC5A 3AMCA 1BYAA 3WNKA 3SURA 2WK2A 1BYBA 2DT1A 2BS9A 2WMIA 2V3DA 1TVPA 3CBWA 1CGXA 4D6HA 4AD5A 1XD1A 2YLAA 2CCRA 5M17A 2J77A 2XTKA 3CLWA 2OYLA 1C8XA 2XVKA 5E09A 1LWJA 5CJ5A 3UR7A 1LJYA 1VBUA 3ZSTA 1HP4A 1VAHA 2VUYA 1KBKA 3WFZA 3PZQA 1ZJAA 1CGUA 1PAMA 1EQCA 5I79A 2X05A 1GJUA 1PX4A 1XSKA 3U7VA 6CGTA 4B15A 2QF8A 3CUFA 3CZ8A 5JBEA 2YLLA 4MDOA 3QHNA 4XZBA 1CNVA 3TA9A 4F9JA 1HNYA 3SCNA 1VB9A 2D20A 4CVUA 1V0KA 4ACZA 1ZBWA 5BCAA 2JE8A 2GUYA 5D9OA 4D6EA 4P7LA 3FN9A 2V38A 3OGVA 3VPLA 1JYVA 1GOIA 4PBGA 3AS0A 5M5DA 1HJUA 1TMQA 2WHMA 2FGLA 2W67A 1GHRA 2CKSA 1RH9A 3OLEA 1WAWA 3SCUA 3WKZA 4ZXOA 5D4YA 2YDSA 1ZBKA 3W6MA 4W7UA 3RM4A 3DHUA 1C7TA 1VFFA 2DDXA 2J7HA 3PZ9A 1F4HA 3AICA 4PTXA 3VD4A 2XSBA 2QMJA 4CN6A 1TZ7A 1XCXA 2JEQA 1JF5A 4WKAA 1JF6A 2XFRA 4IISA 3J7HA 3VVGA 1B3WA 2CETA 3NSMA 1UZ1A 1BG9A 2NSXA 3JUGA 1H41A 2WAGA 5HOSA 2CYGA 3MKKA 1ISVA 2EEXA 2J7EA 4JIEA 1XH1A 2VZOA 4AZCB 1CZ1A 3NUKA 2WCGA 2W5FA 3MU7A 1AQMA 3WELA 2D22A 2V3FA 3F5KA 2WC7A 3U5UA 3FXYA 4PMQA 1W3HA 1WDRA 1JGIA 4YHGA 4HPGA 4D6IA 1W2PA 3MSGA 4U5IA 5I2UA 5A94A 1BVNP 1UH4A 1V03A 1CECA 5DF0A 1LG1A 1G1YA 2WSKA 2XIIA 2EJ1A 3S2CA 4PN2A 1CWYA 1CGVA 3EMCA 2DH3A 1E70M 1S46A 3WF2A 5FL0A 3THCA 1PBGA 4JZ5A 2F2HA 4V28A 4XB3A 1BGAA 1JZ7A 3AIVA 4J3SA 3W29A 1OGGA 1H1NA 1JZ8A 2DQXA 3CHFA 3L4YA 5C70A 1B1YA 2XVGA 1XC6A 3EYPA 2JALA 2PBOA 1WZAA 1W1PA 1QNSA 3ZJ6A 1O6IA 1PPIA 1B3ZA 2WVVA 1Q4NX 4P8XA 1E6PA 4D6JA 2AOSA 3VGHA 4ACYA 1J0ZA 1VRXA 1B3XA 2DH2A 1KQYA 4MJ2A 3L4TA 1BQCA 2VRKA 2BVYA 1ITXA 1B0IA 1TG7A 1H3GA 4DWSA 4WJXA 2XGIA 3N04A 1U30A 1E1EA 2YBTA 3M7SA 2WCSA 1UR4A 1FH9A 1JXJA 3POCA 4U33A 2V5DA 2AMGA 3PZTA 5A8QA 2ZWZA 4AISA 1WDPA 2EBNA 3AZSA 4NRRA 2ESCA 2ZX6A 3WD0A 3RJYA 1E15A 1EDQA 4UQAA 3SUUA 2WNWA 3WMBA 3ZT6A 5IHSA 1HJSA 2CESA 3VOCA 4KWUA 1UD5A 2Y5EA 5IFTA 3WD3A 4D1JA 2E4TA 5I78A 2BY1A 5A8PA 1K9EA 2WC3A 3N15A 1EHAA 2VQUA 3WH5A 4MNLA 4QFUA 2Z1SA 8A3HA 3T2QA 4BQ2A 3AOFA 2QPSA 2CEQA 4F8XA 3ALGA 4HA4A 3W53A 2ZUSA 4W85A 1M53A 5I23A 1XV8A 3FY1A 4W8LA 3PTQA 1MFVA 1V0MA 2X2YA 3NDYA 3WNNA 1VEPA 5BRPA 4GXPA 3UG4A 3CMJA 3AMKA 5GNYA 1TA3B 1GOKA 3OGRA 3W24A 1PZ2A 2Z1KA 5CQ1A 4JCLA 2X0HA 1EOKA 3SUSA 1J18A 2GJXA 2D0HA 4H41A 4YPJA 4Z2GA 2V5CA 2D3NA 3BAJA 4MPKA 2XM2A 5CGTA 1KGUA 3BH4A 3VIOA 1SMAA 4AZGA 4KMQA 5A2BA 1XSIA 2OYMA 4BCEA 3D3AA 2VQTA 4AD1A 1G01A 5DT5A 4ATDA 3W28A 3POHA 3KZSA 3CGTA 5A8MA 4PUDA 2DSZA 3QHMA 2IUZA 2VVSA 3PN8A 4UOQA 3WQWA 3PBGA 3UG3A 2GJXB 4CCCA 2YL9A 1KWGA 4TX6A 5LYRA 1KR0A 2GJRA 3AIWA 2Q8XA 3SCVA 1E4NA 1KGXA 1UD4A 2G3JA 2XM1A 4GKLA 2YL6A 1CXKA 4GO8A
chains in the Genus database with same CATH superfamily
2PU1A 4KCUA 1JAKA 1XINA 3VAVA 1KFBA 1CLVA 3AYSA 1EOMA 3P84A 3G5EA 3GIPA 1G94A 2J6VA 3FKKA 3LY0A 3NCOA 5D8ZA 3SR7A 3WDQA 1WUFA 3ARVA 4QAWA 2UZ9A 3O6YX 1VYPX 3HMCA 2WHLA 3BCJA 4D9PA 4KGLA 3CUGA 4MWAC 3A4AA 3WD1A 3FJ4A 1EGMA 5H91A 2FZNA 3WLMA 4OT7A 3CUIA 5CSYA 4LYRA 1GOOA 3WUFA 1JFXA 4K38A 5LIWX 1OT2A 5LNWA 4IG2A 1EA0A 1NOUA 2FJKA 3WJXA 2RUSA 4HMNA 3EXSA 1A3HA 2I56A 3MVIA 2X09A 3FYYA 3QFEA 2ZVIA 5C2GA 1QOPA 1I60A 1FWRA 1SZEA 1VPXA 4OOUA 4KCTA 3RHGA 3UXLA 2RDUA 3OIHA 3FYOA 2Y62A 5A2AA 4DVOA 1JZ3A 2WNZA 4GCAA 1LRTA 4JX5A 3ZLHA 3UPWA 1OFOA 1TJ1A 1LLZA 2Z0IA 1D2KA 4JTTA 4TUFA 4PSRA 3NGJA 1DWHM 3QSTA 4NILA 4XD4A 4HA3A 4QJ3B 5IHRA 3WMSA 1T0OA 3BSHA 3ZSSA 1AODA 1KXTA 1PKYA 4J28A 3M6DA 3T9PA 1QPKA 4NZ5A 2GGGA 1US3A 4AQLA 3OEXA 1WDWA 3VC5A 1TR9A 2AAAA 1BVWA 3KL0A 3W3OA 2Y24A 3NQ2A 1BYDA 4H7VA 2A6LA 3I4KA 3UZXA 4GZJA 3B9AA 1EC7A 1MVYA 2I7GA 3CHDA 3O07A 3AHVA 1HKWA 2UY3A 3FA4A 3RO6A 1N2VA 1FTXA 1SGJA 4BY3A 4GVIA 2IXVA 3SCSA 5FJPA 3RLVA 3ZT5A 1ONWA 4EOUA 2PWHA 5A95A 2QCLA 2FVLA 4AZIA 3NTYA 3L4ZA 2FKPA 4LC6A 2DZUA 4Q8PA 1TTIA 3GDMA 1J12A 4N2YA 4ZE4A 4BZYA 3N2XA 5EFFA 2WOQA 1YTKA 5L9FA 3S4TA 5C6MA 2E5DA 4FLQA 1E71M 1YEYA 3VKBA 4AHOA 3STPA 5DCEA 4F2TA 1VZWA 2GUUA 4UMCA 5AN7A 3P80A 1W3JA 4GZ7A 1XIJA 1KBBA 3TJXA 3QGAC 5CPOA 3SRDA 3EA1A 1YXDA 1PV8A 1FH8A 1OZMA 3DYOA 1A5OC 3MV01 3MT1A 1KFJA 1GQJA 2D24A 1GOXA 5HATA 3E2QA 1ITUA 3E2VA 1EJXC 4FB7A 3IJQA 4X60A 3SB0A 3Q37A 1AFSA 1JFHA 5CC5A 2Z6JA 1TV3A 1BWKA 4O1DA 1XLLA 1DOSA 4MWAB 4JEQA 5BOEA 2XZ9A 5F2GA 4FF5A 2VNCA 4DUWA 3F2CA 2YA2A 5CGMA 4B9YA 4Y96A 3N2MA 1SR9A 1RQEA 3A3XA 2EPNA 2XUCA 3IJLA 2KZHA 1RV8A 3WNOA 1A49A 1OINA 4HCDA 4TR9A 3GG7A 2PWVA 1OGBA 2F2KA 1Q6FA 3C61A 4E2OA 4IFKA 2ZZ6A 4ZXLA 4QG8A 1OD8A 5ABTA 1U83A 1DVJA 2ZUUA 1TMHA 5F4XA 4ROQA 4G8TA 2HE8A 5I07A 3UR5A 3DESA 1UMLA 2VOTA 3NQAA 2QJJA 5I3IA 5JIWA 3M47A 4MUPA 4Z2HA 2F8QA 2DGAA 1UP0A 4LVGA 1HW6A 3BQ5A 1VR6A 3WF3A 3U3HA 2YGYA 1YNQA 3D47A 4RZBA 1EP2A 3GR4A 1JIBA 3QOKA 3KHJA 1FDZA 2DZXA 4H7ZA 1F3XA 1KO0A 4MVAA 3G1HA 2RJGA 3CB3A 4PUUA 3I3DA 3QJAA 4LUJA 2ATSA 2CXEA 2J47A 1T5AA 3UW6A 4W93A 3E96A 2ZUNA 2Y89A 3QR3A 4O17A 3TLLA 3CO8A 4B90A 3L2LA 2XIJA 4JL1A 2HROA 4IFRA 2Z27A 4WIWA 4CKQA 3ONBA 4DELA 2DZBA 1JEZA 1PYMA 1WE5A 2VXNA 3W27A 1TIMA 3A13A 4S39A 3QY7A 3KS6A 5HBFA 3DG6A 3EWDA 3FA3A 1TPC1 3PBVA 5CBBA 2E1WA 5C7VA 1AD1A 1YBQB 1SFLA 5TD4A 3MMUA 2XSAA 1RJPA 3H24A 1OIMA 1SM9A 4R27A 3G8EA 4IFOA 3DFSA 3FHQA 1XKJA 5F1VA 3VA8A 3DFOA 1TZZA 1YLVA 2BVDA 1I2RA 2GWNA 4Q6XA 5LHEA 1FCVA 4QITA 1C8QA 2V5LA 3W01A 4MKNA 2EPHA 5XIAA 1HL9A 5I6SA 3DG3A 1H7NA 3DEQA 1JD9A 4DWDA 1TPWA 1RSCA 5I3DA 3ITLA 2OSXA 5JVLA 2HQAA 1US0A 4IPPA 3SW6A 1XCFA 3GHUA 1GVYA 4KKXA 1XBVA 1CIUA 4HU0A 2C1IA 1NQ6A 2RDWA 4ILSA 3TOPA 3SN1A 1PIFA 1T99A 1VHCA 1AH3A 1ZNNA 3W1XA 1M6JA 2J7FA 8XIAA 2YSWA 1OC6A 4JDBA 1XUZA 1R3QA 4CEUC 2DIEA 5D9PA 4AIBA 1W8GA 2ABBA 3ABXA 1DWAM 4UTFA 2J27A 4UFKA 1MEIA 4QLLA 2ANUA 1VBRA 1W3LA 4GYFA 2C3ZA 4MLJA 1QI5A 5BROA 3L12A 4JKKA 3UWQA 4HU8A 3GVGA 2PE4A 3GC5A 1XPGA 3L5LA 1H49A 2PTZA 4H6RA 3BOLA 4ZE5A 4WLCA 2Y8KA 3TOYA 4JQ3A 4O8RA 4B91A 3BCFA 1QI3A 2Y8VA 5FEXA 2VP8A 1LZOA 3MMDA 4GNJA 4N4PA 3I6TA 1NOFA 4MB5A 4B3ZA 1Q6CA 3TR9A 4HZ8A 1XDMA 3VIPA 4UOZA 3C5QA 2E6YA 2DVTA 3AALA 4HCHA 3R89A 3DYPA 2J7DA 3WNMA 4MY8A 1WO2A 4XV0A 1PJ9A 5DELA 3LRKA 1IXPA 3KBSA 2BVWA 3BLKA 4UTKA 2X0YA 3CUXA 3T55A 3B0PA 3TW7A 3TAOA 4AIEA 2J9ZA 2CNCA 3E0WA 4CQCA 3P6LA 2ACUA 1EDGA 1OSEA 4C90A 4JX6A 5DFAA 1KB3A 1TELA 5EMYA 2YYUA 2V69A 2PMQA 4NAEB 3WL0A 3GXFA 4AC7C 1E4LA 1O1HA 4POCA 1QVBA 4HIBA 2VHLA 5DQPA 4RW3A 4CCEA 4DZAA 2VJXA 3RU8X 4GQRA 4BQ3A 5GQBA 2E0PA 4O0ZA 3GNOA 1CCWB 3WQGA 1RD6A 4JL2A 3BJSA 4XD3A 4U5KA 6TIMA 2VFGA 4UIOA 2FPVA 3NYDA 1R47A 3LM7A 3MUCA 1ZRQA 5CAKA 4KWOA 4LXFA 8TIMA 4FOKA 4JHMA 1OFRA 1H60A 5DANA 3C6CA 1ZAIA 1XP3A 1NFBA 3AHZA 3AZTA 2DVXA 1TV8A 4H6EA 3EOLA 2HPMA 2P0IA 4J3UA 4NUWA 4OE7A 4JX4A 1EIXA 1FKWA 4O8AA 3LTPA 4DM1A 2QCDB 3N4AA 4ZA0A 3M0VA 4S2BA 4D6GA 2I5GA 3T2PA 3V5OA 2TPSA 3VU2A 2OO0A 4U2ZA 4S3CA 4J40A 2A21A 5IDIA 1B2YA 3S5ZA 5K4XA 3TROA 1EX1A 3ES8A 3OA5A 4JQ1A 3GHTA 1VD6A 1MXSA 1FCUA 2RAGA 1S3TC 1Y8BA 3RLUA 4IUGA 2ZXDA 3KHDA 2J88A 1B31A 1LOQA 1WV2A 3LCFA 1MDRA 1IV8A 5LGZA 1EUNA 4JTQA 1YPFA 1HJWA 1JDEA 2DFAA 3DYMA 1FP9A 4JTEA 4UQDA 1KFKA 4G1NA 1VIWA 2QUTA 4IQEA 4ZODA 4P7NA 1F6PA 3KBMA 3MZNA 1YNYA 4FX8A 4DRSA 1G0CA 3R94A 4N02A 2JF6A 5HPOA 3VUPA 4UBPC 3R13A 1E9ZB 2H9AA 3VDBA 1FFRA 3FNDA 1V3KA 1F3EA 3DZ1A 2PDKA 2E6FA 1E72M 2JIEA 4JQAA 4RXGA 3VNZA 4OGZA 1K9FA 1BSIA 1EGVA 1FWAC 1HFBA 4A05A 2O7SA 3W7QA 4GJJA 1KM1A 3F7JA 3GU2A 1O5RA 3PUGA 4J5NA 3SY8A 3AC0A 4K36A 5JIPA 4JEJA 3KLLA 2XVNA 1W9VA 4FXSA 3W7NA 4DNHA 4M1BA 3UJEA 2FTPA 4Q4SA 3IGHX 3O8AA 7ODCA 4ATLA 4O0KA 4AZCA 2Y4SA 4HGXA 5D05A 5BXRA 5IBXC 4DAIA 4NZJA 1QK0A 1ODUA 1BGGA 3LSCA 4NJIA 4DBWA 4LW7A 3UY8A 2UY4A 4F4RA 3TLQA 1OX4B 4UXDA 4HHPA 1W5MA 4KEVA 2OWCA 4IPNB 4CCDA 5FESA 1R87A 4XO6A 3ABRA 3VXGA 4MOZA 2OGYA 3PBYA 4H2HA 1CBGA 5IOBA 3R0UA 1FHDA 1BSLA 3OYXA 2JGQA 4LEFA 1M03A 1V4YA 1L8NA 3AZRA 3TN6A 3RIKA 3PZVA 2J7BA 4CU6A 1HT6A 3LPOA 3NPWA 4HK5A 3ARWA 3SFKA 4E0CA 5A6BA 1TUXA 4US5D 1UUMA 4QE4A 1TPFA 2VENA 2A3HA 4TMBA 3REQB 4ZQMA 1VFOA 1UKQA 5DMMA 5H6HA 3VCCA 3PZUA 3CPGA 2C18A 3DBNA 2FH6A 3ZR4A 4LWWA 3ZJ7A 1CXHA 1X7IA 1J6PA 2YFOA 2H90A 3WLOA 1RJRA 5ABGA 2UBPC 5A69A 5HQEA 5CJMA 3VIKA 2D0GA 4IUOA 4ZQNA 1PZ3A 5HWJA 4UTUA 1W9UA 3PZNA 4LBSA 1BAGA 4B5TA 5DY2A 3A4JA 4LCQA 3EPNA 1DQXA 4PRWA 2VTFA 4ZGYA 1P6BA 5EKYA 1QOXA 3R6IA 3A21A 1A5BA 1KA9F 1EYWA 5EFDA 2HVOA 4ALDA 4WVXA 4L4PA 4WR3A 4TU1A 2POZA 1T6MA 5D2YA 3GG0A 4ONVA 4FNRA 3B03A 4RPQA 1Q6EA 3GVRA 5CZSA 2FMNA 1M7PA 2V67A 3QPZA 3HFYA 4NXKA 5DMYA 3M46A 1DP0A 4GC3A 1E1FA 4J4KA 3VINA 1I1WA 2CLKA 2Y5SA 3FVDA 4UC5A 3KBWA 1B57A 2J79A 3M6YA 1O66A 4IIEA 3W07A 2J8FA 1PKNA 5EBAA 4KFNA 5D9MA 4AEEA 1Y5XA 1XHGA 3N9KA 3GHRA 5C8BB 3WJYA 2ZE0A 3CH0A 1J2WA 2ZBTA 3N3MA 3TEVA 1PCKA 4O10A 2ADAA 4KS0A 3L9CA 4IIFA 3FOKA 3ZMRA 5AVNA 4LY4A 1AK5A 5HR7A 2J24A 4GWEA 3B04A 2WANA 3L68A 1PWLA 2PDCA 4WZHA 4LB4A 4L4MA 3T40A 3WFLA 2PTYA 4NZ1A 4QM1A 3WEMA 3A3HA 1H0IA 2VX6A 3GDTA 4PSPA 4MYAA 3S2LA 2ZIDA 3LLFA 4IQLA 3JZUA 1GT8A 4LH8A 2Z25A 1J96A 4REQB 3SO7A 2VOMA 3LBOA 3RU6A 2V68A 3BG5A 4GY1A 4HOWA 1CGYA 1O68A 3MC5A 3GW0A 3N19B 5FL1A 4E8CA 3R8HA 3AU2A 4JTUA 5JH1A 4O1EA 3CL7A 3AXXA 1RZMA 4A3YA 4WDTA 4KCVA 1F5ZA 3GDBA 4OUEA 2YL5A 4KCWA 5H8MA 1EZWA 4FAMA 1HGWA 4R88A 3W38A 2GYIA 4QJ1A 2VZTA 1LRNA 3CIVA 3W7IA 1EUAA 4FSAA 2XIMA 1DIDA 3Q45A 2WC4A 5DXYA 1H7XA 4RE4A 4M51A 3TCSA 3W1AA 1MMFA 1M41A 5D2TA 3VM7A 1Z89A 4J27A 4Z0SA 2PDMA 3AU6A 2PGRA 4ZO9A 3NQCA 4DYJA 1EC9A 1K9TA 4G5DA 2PC8A 4X0VA 6ALDA 3RG6A 2QVNA 5CKSA 2QDHA 4K7YA 2PZ0A 3O9NA 4ADSA 4RE2A 5CG0A 4QDPA 1S3HA 4DIAA 1VF8A 1UHVA 4NVTA 3UD6A 2ZZ2A 5C7HA 1BVZA 4LS0A 2Z28A 4J2MA 2GDVA 4OUIA 2OQYA 5B80A 4C1LA 1X6UA 4S3AA 4QAIA 1X38A 3W81A 4ZB5A 5E6YA 3UJ2A 1PB0A 2GLKA 5JUVA 2HV5A 3SDOA 1I9CB 1QOQA 1YDYA 5E0FA 4X3ZA 2ZX5A 4GX8A 2C16A 3H4WA 1X98A 3C0JA 1TRIA 4W9TA 5D2VA 1LT8A 4W8BA 1EX5A 1FHLA 2QF7A 4W86A 2X42A 1PX8A 4WF7A 3UETA 1PS9A 1IT7A 3G1YA 3UA3A 3VKKA 3WDRA 2BHYA 2ZADA 2FDMA 5AHLA 1RD5A 1UR8A 3A4WA 1DTUA 1FWJC 4AU0A 3EDEA 3VO0A 2XFYA 1GG0A 2YFNA 3QV7A 2FQIA 2D3LA 3SCWA 4IMDA 4LSBA 1W1TA 2YPIA 1GVSA 1L2QA 4H8HA 4UQCA 4C6FA 1TCMA 3G0UA 4KQNA 4AZ5A 4WEVX 3N2TA 4XQ6A 5EMUA 4ZO8A 2A3LA 4DWSC 1DQWA 2ZRZA 2O9RA 5B7ZA 5LA2A 1NWRA 1SJAA 1SUXA 2HVMA 2OTDA 5M03A 1ONEA 1TPEA 2W4XA 3QW3A 2YZ5A 2CITA 1VBJA 3LZ3A 4YVVA 1A5CA 3VIIA 4YL2A 3EX6A 3MMTA 3DECA 4TV5A 5GPRA 3MBFA 2R8WA 2B4GA 4CD7A 3EKLA 1CPUA 3RCYA 1XR2A 1F8MA 5CGQA 1XJBA 2XGZA 3ZLGA 1F2JA 1U22A 1J0JA 1D3HA 2OLHA 1E6RA 4HPHA 2R1MA 2QCEA 2YIHA 1JYNA 2XSXA 1ZHAA 1FWFC 1VYSX 3GR8A 1F8IA 1E6QM 3MTWA 4XKYB 2P5NA 4IM4A 5K2ZA 1TA3A 3BLIA 2ZUWA 3ZFHA 9XIAA 5CEWA 3M0ZA 1QW8A 3M44A 1V0NA 3TSMA 1UKOA 3STCA 4HN4A 3TVAA 1JULA 4LQ1A 2B7NA 3WEOA 4XZNX 4PYSA 2DUAA 3C3NA 1LG2A 3NYZA 2A7RA 3CL6A 1RR2A 3STFA 2VZSA 2FGZA 4AZ6A 1VIZA 3P93A 1PZ0A 4TVCA 3P7YA 1AL7A 2KAUC 1JUKA 2BGQA 4AC1X 4KRTA 4ZFMA 2WVUA 1NH6A 4DJEA 5CPMA 4WOQA 4G1KA 1XKYA 3DERA 1R30A 4KW2A 1IF2A 4URIA 3CPRA 5IXEA 3UP8A 4ZFCA 1KGWA 3VKDA 4E3VA 3B3DA 4M81A 4AVOA 5JBFA 3QY8A 1KW1A 3LXCA 4HNVA 1NP0A 1VFMA 1LF1A 1W31A 1HP5A 1Q63A 4CN4A 2J62A 2PF0A 1UZHA 3UCQA 1M7OA 1J5TA 1GQNA 1CXLA 3W71A 5CZTA 4NKCA 3LBMA 4K6AA 1S2AA 1SJBA 2OZ8A 3GTFA 1QI4A 1YDOA 3EDKA 1TB3A 1W9BM 1NU5A 1JYXA 1FDJA 1U5HA 2PURA 2OPJA 3PBMA 4M1RA 3S5YA 4AF0A 3E38A 3KEHA 4QG6A 1DHPA 2E7FA 3EDJA 5AC5A 1A5UA 2PLKA 3WNKA 2WK2A 3QKEA 4QSHA 1R3YA 2ICSA 3CBWA 1TVPA 2XH0A 3RN6A 1XD1A 3PUEA 3AWNA 3P74A 2J77A 1I2PA 2OYLA 3WO8A 3WLHA 3H2CA 1C8XA 3S42A 2ODOA 3H2MA 1AG1O 4Q7BA 2DUZA 3W88A 3OP2A 4JYFA 1ZJAA 4S3FA 2PGWA 3NEVA 3SGUA 2PDIA 3WMLA 1PAMA 3U7VA 4GIEA 3T44A 5JBEA 2YLLA 4MDOA 4XZBA 1IE7C 3UWUA 4BJHA 4CVUA 1V0KA 2Z1XA 1GTHA 2EHHA 1UPPA 1O1ZA 5D9OA 3NQ6A 2JBMA 2ZA3A 4GUIA 1WYIA 2DY3A 4HZMA 4LUSA 9XIMA 5M5DA 3BLEA 1FWSA 3K1GA 2NXIA 4XVDA 1DXIA 3GHSA 1W3TA 4ZXOA 5D4YA 2YDSA 4JICA 2RKXA 4W7UA 3RM4A 3NO3A 3QPYA 1EWEA 2DDXA 2J7HA 3AICA 2PAJA 1SZNA 1JCXA 3VKCA 4CN6A 5LNVA 3CAKA 1NELA 4PTDA 3CT2A 3E2RA 3QQ1A 1JF6A 2FTYA 4NAEA 5FJRA 3VVGA 1B3WA 2CETA 1W37A 2VUNA 1UZ1A 4GE8A 4WSHA 5HOSA 3MKKA 3K2GA 3VZZA 4INFA 4L9XA 4WHBA 4DO6A 3HV9A 3SBFA 2WCGA 1W5NA 1AQMA 4DPQA 4WXZA 5BWAA 4LB3A 3M0MA 3VCRA 3RLGA 4JTKA 1W0MA 4PMQA 3CIXA 1W3HA 1XRSA 1WDRA 3RPDA 4YHGA 2GQ3A 4FO4A 4HPGA 1UASA 2C15A 3ZLFA 3PY2A 2PTDA 5I02A 1BVNP 3TMLA 4KT2A 3S9ZA 1TPB1 4O11A 3COTA 4GUFA 2WSKA 4TIMA 3H12A 3W1PA 5HULA 2DH3A 1E70M 3WF2A 1AJ2A 1MRAA 5KMYA 3ZVIA 2G95A 4K8HA 4ICNA 1L8PA 2F2HA 2IPFA 1BGAA 2HRWA 5FEZA 3S6OA 4Q8TA 3UVAA 4QG9A 4HNCA 1H1NA 4FNPA 4L65A 3L4YA 3E02A 5C70A 3WFAA 3EYPA 1H62A 1WZAA 2OLAA 3REQA 1KCXA 1XL9A 5EMMA 1KFCA 1PPIA 1JCJA 1TJ2A 4LC8A 2RH9A 3DGBA 5M2FX 4BKNA 3OG3A 2GL5A 1XYAA 4IP5A 4DBSA 1KQYA 4MJ2A 3QQWA 4I5RA 5HMFA 1ZAHA 2BVYA 1KM5A 1P0BA 2Q8ZA 1BF6A 3DOPA 3ATZA 5DMLA 1U30A 3HGRA 1UR4A 3A12A 2ZC1A 5K3VA 2E67A 2AMGA 4AISA 1VP5A 3AZSA 3RJYA 1E15A 4LUTB 4Q4PA 4MGGA 3SRHA 2BOGX 3QC3A 4RR4A 2CESA 3VOCA 3SECA 2WPBA 5IFTA 2A4AA 3WD3A 3IUHA 1TKKA 2BY1A 5I78A 5E1QA 4CQDA 1FXQA 4LAZA 4GNVA 1J5SA 3CEUA 4ZZ9A 3N15A 3EXRA 4MNLA 1THFD 3T2QA 1Z48A 3AOFA 4S38A 4F0HA 2BZNA 2ZUSA 4W85A 4W8LA 1TPDA 3NDYA 1VEPA 4LAOA 5BRPA 1W1A1 3F1QA 3QTPA 3NA8A 1GOKA 3W24A 4EF9A 2IPGA 5D03A 4FF7A 3SUSA 1LBFA 2GJXA 2D0HA 4YPJA 4MPKA 2XM2A 4EPDC 2NQLA 1KGUA 2ZZ7A 3KXQA 1A5KC 1S1PA 3BTNA 1CT5A 2ASHA 2O0TA 3FSTA 4HNOA 4BCEA 3ITCA 3ABZA 1EJ7L 3IGXA 5FSEC 3RGTA 4QS5A 3MCOA 1JCYA 1Q6OA 1YW1A 3GTXA 2VVSA 3BG9A 3PN8A 4UOQA 3WQWA 1W3IA 4DQWA 2PSNA 2GJXB 4GG9A 2BX7A 1KWGA 4TX6A 4IICA 1KR0A 3AIWA 2Q8XA 4ES4A 3O16A 2ZZ4A 1E4NA 4DI8A 4FI4A 4UTLA 4KWSA 3GW3A 3TIMA 3ZWSA 1W1B1 5AHIA 4GO8A 1SFTA 1HKJA 4L9YA 4A3QA 3MV11 1OABA 1ZZMA 2JQXA 1RY8A 2CLMA 3ZZ1A 1US2A 5M1TA 4REQA 2Z7KA 3PUDA 1XI3A 3AXHA 4H8UA 5KZ6A 1GJPA 2VM8A 5HNRA 1DKWA 3LCLA 2CLEA 1IEXA 1Q7ZA 4GGBA 5D09A 3MKCA 3GU9A 3PP7A 1IT0A 3OZOA 5CG7A 3KOYA 1WA3A 2HWGA 4N9CA 3A4XA 1X6LA 3W1TA 4MM1A 5RUBA 4PE8A 4F0MA 3MPGA 1BTMA 3KOFA 5CSUA 1XRFA 3LV5A 3TONA 3QF0A 4BQ4A 4NJHA 2BP1A 3NPVA 4ZQRA 2EPKX 2FZ9A 3SSZA 2NV2A 3PJXA 3RUBL 4OJYA 3R43A 3LDVA 1PDYA 3BZGA 1RVKA 4XUYA 2VGFA 3KTXA 4WJEA 2Y7EA 2MNRA 1V8EA 4I8YA 3ICJA 1ZQ5A 4A8NA 1UBPC 2JKPA 2ACQA 3W2MA 2BY3A 4LVDA 1AVAA 2GSEA 3EB4A 2H8ZA 4JTSA 2ZRVA 2NLYA 4ZQCA 3C0LA 4ZQOA 4NYYA 4IG2B 5HMDA 3XISA 4B5XA 3GXMA 4V15A 5CAHA 4C6IA 3H2EA 2GPTA 4U2YA 4W84A 5EMLA 2F6KA 2I57A 2PDFA 4LPCA 3HGOA 4D8LA 5PTDA 3N1AA 2DSKA 4KEMA 2WSRA 3IJDA 1HO4A 5G4HC 3VOIA 5DT7A 1FWHC 3BW4A 4JFVA 1KRCC 4TVUA 4LEQA 3ZT7A 4L80A 2A2IA 3H23A 2GGIA 3DUGA 4FMVA 1BHGA 4JYDA 2E25A 3PWGA 4AUBA 3OQ8A 5C2CA 3AS2A 1ZJBA 2SFPA 3UVIA 1J11A 1ZL1A 3GYEA 3UT0A 3OLIA 3LPFA 3OZYA 4ZSUA 5H8PA 5DY3A 3E49A 2D2OA 4M7TA 4O28A 1GZGA 4TO8A 2QQ6A 3VKJA 5HJXA 2NLIA 1XLKA 1IXOA 4W8AA 8XIMA 2OR2A 4PMOA 3N6HA 5A6JA 1SPQA 4JTLA 2G3IA 4GUGA 1NJJA 3C0QA 1J0YA 1V6YA 1WXJA 1OK4A 5EU9A 3AO0A 4UTHA 3A5FA 1D9EA 1QPNA 3TYDA 3SM0A 3K8MA 4AVNA 3LV6A 3UEQA 1VCFA 4NHVA 2D2GA 4Z17A 3HBLA 2D73A 3O1NA 4XAGA 2IKHA 1BPLB 1POJA 2ISFA 4LNYA 5T26A 3WG6A 3A23A 3TV8A 1V6XA 4H9XA 3AXMA 5FA5A 3SI9A 2GJPA 4DHGA 1G6CA 2PWFA 3TTOA 4EACA 3EA3A 1LYXA 4NNAA 2CU0A 2E9MA 3RX4A 2B7QA 4V2XA 3VZYA 1NDYA 3NSXA 3TZFA 1F7BA 4AAJA 1ZP4A 4B5SA 2OODA 2GGHA 2VVNA 3PBUA 2HE5A 3LERA 5E5CA 4NJJA 3EMZA 1L6WA 4BK9A 4RXFA 1M1BA 3CH9A 2DP3A 1F05A 3BAKA 5ABFB 3JZEA 1MEHA 5BNKA 1X1NA 3O6CA 2Y70A 3E2SA 3PR2A 4DJFA 3OYZA 5JH2A 2J8TA 5EY5A 4YTQA 2ZCGA 2OQLA 4DBDA 4TOQA 5I0DA 3L4UA 5I3KA 2YW4A 4QLJA 4MWAA 1V79A 2CXGA 4NZCA 3FHAA 2TSYA 4Q7IA 7XIMA 1Q65A 1G4PA 5JQ9A 1PCWA 2W27A 1GCYA 5GJNA 3H7RA 1G4SA 3N6JA 1MXGA 4PUWA 1TWWA 3ZS4A 3T05A 1JVNA 3WUGA 2GK1A 2VCCA 3HB9A 5DCDA 3GUWA 3DBPA 1Q4WA 3N3TA 4OV4A 1UZ4A 2XJ7A 3ALFA 3UXAA 4PEKA 4NNBA 3OO2A 5AYXA 1GEQA 4K1WA 3WF1A 4GX9A 3NL6A 4JTIA 1E6SM 4CU8A 1OWQA 2V3GA 4HTYA 1ZBVA 3EX3A 2IQDA 3IIOA 4XSLA 1UJQA 2VRQA 4RNFA 1JZ4A 1KRBC 3VDHA 1R8LA 3GNPA 1HN1A 2ZZ5A 1S38A 4DPPA 3WQ4A 1NY1A 4A35A 4KEUA 1WDQA 1CYGA 4HD5A 5I24A 3V0SA 2VC7A 1GKPA 1MW2A 3GKFA 1C29A 4GPNA 1PE1A 4RDWA 1XYFA 2E3ZA 3MWCA 3F4NA 3B4UA 4XZ9A 2X40A 2PCEA 4LVFA 4GY7A 4JCMA 1V3JA 3A9BA 1F6KA 2PLJA 3SADA 4JTDA 1F07A 3O63A 3P0XA 3WDHA 1C9WA 3WDIA 1UD8A 2OXNA 3F03K 3PPGA 4CNPA 4PTMA 2OWWA 3NOEA 1B5TA 3DFPA 4TX8A 2ZDSA 3NEHA 2GJNA 4HBKA 4MY1A 2PDPA 2Y5JA 1OCJA 4AZ7A 3O6AA 1JPHA 2CKRA 1UPMB 2W63A 2IKIA 3ENLA 1J10A 4DJFD 2EG8A 2PRLA 3LX9A 3GH5A 4NXSA 4RZ5A 5A6AA 1KXQA 3MO4A 2I16A 2XINA 1IGWA 2DVUA 5AY7A 1QNRA 1RCXB 4XUGA 3VI2A 4MAZA 1HXJA 2BWGA 3CHEA 1ICPA 3NGFA 4C6OA 1XUUA 1W91A 3FXGA 1UWIA 1OK6A 2WSQA 1SQ7A 2HNHA 4C6MA 3IUDA 2FB3A 4C65A 1O5XA 3LI1A 5E6ZA 3W02A 3IVTA 4H9VA 4JNYA 3PTDA 1TR1A 3CNYA 1UMYA 4P8WA 1J2BA 1B54A 5FEPA 2X41A 3T4WA 2R9RA 3A64A 1SO6A 2EPLX 3BGGA 1JI2A 3GE7A 4V33A 4E2DA 1JDDA 4OQVA 3TUUA 1HQTA 1W6TA 4XKYA 4UMBA 1WOAA 3LGEA 3W9ZA 1J0KA 1XIGA 2C8NA 1OFPA 2CC0A 3T09A 2POTA 3CJPA 3PZOA 5TQLA 1DJXA 1EWDA 3GVWA 3BZJA 3WQPA 4UFHA 2RJHA 3KL5A 1E3ZA 1GWJA 1AW1A 3GQYA 1XC4A 2HISA 2QUVA 4JXCA 1U5VA 4E4PA 3UESA 4DJFC 3UWYA 4IP7A 3RXZA 4D71A 3WMCA 3QLDA 1M3UA 2QJNA 3TTQA 4R7OA 1OCBA 1VENA 3KRUA 3TNOA 1JYWA 2OEJA 1KFWA 4AX7A 4WQ6A 3R0KA 4Q4RA 4MB3A 5HNNA 1CB2A 3M0LA 1E4IA 1KLZA 3TSDA 3E0FA 1JZ2A 1K77A 2KX9A 2YXXA 3LS9A 4AD2A 1VLWA 2Y63A 4P7OA 2WM0A 1H50A 2HK1A 4Z2KA 1Y65A 1KBLA 3NVDA 5I7GA 3ISIX 3W1RA 3IIXA 2CBJA 5HAOA 3GG1A 2C6QA 4CCZA 3WN6A 4QISA 3DHDA 4UQEA 5I5RA 1GVRA 1DJIA 4QIUA 3G1XA 4GINA 3GB6A 1HL2A 2E28A 3MCMA 2XPKA 4OZOA 4C6DA 5C5YA 4H7CA 3V16A 1FDYA 4FLSA 1N8WA 1K02A 3RJXA 3C2RA 5J5DA 3CEPA 3B0XA 1KFLA 1WKDA 3NM1A 3AROA 4JY9A 1V3LA 3VE9A 1XLBA 4AF0B 4RKAA 1A4LA 2QLYA 1QAPA 5ENLA 4E3TA 1QO2A 3H70A 3RM9A 2VR4A 2V8ZA 3B8UA 2A3BA 4Y90A 4LAUA 2BLEA 3AHYA 4LV4A 2F38A 3MP4A 1PL9A 4O57A 4IMFA 1E9YB 3U57A 2OU4A 3PTKA 4KIEA 1ZCCA 3JW7A 2J7CA 4LRSA 3NJ3A 4ORMA 1HX0A 3WJSA 1J0HA 4NP7A 2VEIA 2ISWA 3DXIA 1VC4A 5BXTA 2OLSA 4AXNA 3BAYA 4KWVA 3B9NA 3G0XA 3CV2A 4IJCA 3QYQA 1O60A 4H6KA 4QQUA 2WMFA 4ICMA 3OZPA 2FGBA 1XBXA 3K30A 3BK0A 4CUCA 3H26A 3ITTA 3GU1A 1K4HA 1Q7MA 1W9XA 4RCXA 3UPBA 2X7VA 3TN3A 5H8UA 4G7FA 4FNQA 1JCTA 3MSRA 4MMWA 3OHIA 4HNTA 1A50A 2PD5A 3O6DA 2P76A 1VBHA 2YCIX 3VGFA 4JFUA 3L0KA 4AMCA 3VMNA 3W7GA 3VYLA 1TE1A 1FXPA 2X1RA 4WSKA 4UMAA 5DCBA 2CLIA 2G0WA 3PJUA 4QNWA 3P14A 3KCOA 2YKKA 1OB0A 3HIJA 4N6FA 5MF5A 4NIRA 3W7OA 4DAFA 1XLFA 2ZZ3A 1EF3A 3QN3A 3K13A 4KESA 4QDWA 4LTSA 3C2EA 1TUFA 4HPXA 1X96A 2CLPA 4GO9A 4AFYA 3LXAA 4XVEA 1C91A 3W7DA 4US6A 2D23A 2D0FA 4F66A 3W7PA 2G96A 4I5XA 2BSLA 3BJFA 4MNJA 1EHNA 3S6DA 3T0TA 3B8WA 2QS8A 1QBBA 5JBDA 4A8LA 3N17A 4IMAA 3UA4A 3A5VA 3G1DA 1HKIA 1UUQA 2I9UA 2O9OA 2VFFA 2PLMA 1XSJA 3RRXA 3ZVHB 1YBQA 4B2DA 5KEZA 1R9YA 3HMJG 1QCWA 4C6EA 4KH2A 3MBDA 4FZIA 3AMLA 3QC0A 2VGGA 4C6CA 2G41A 4G6CA 4JAWA 3WIJA 2ZUMA 4JPGA 1Q13A 1MW3A 2OJPA 3HQOA 1P5BA 4GUHA 3D0CA 5D02A 2INZA 2XISA 4HA1A 5LXXA 3WEZA 1UQYA 4E2BA 4GYPA 4GK8A 3AS3A 1VS1A 1GYNA 3IARA 2V30A 2ZRXA 3WLPA 1MNSA 4I90A 1CLXA 1E5JA 3QY6A 1R3RA 1B3OA 2BDQA 3NXFA 2VZVA 4J3VA 2XYLA 1SW7A 3WD2A 1OC5A 2C7FA 3N14A 1OBAA 3IVUA 4M0XA 1LWHA 3LK6A 4MG4A 4DI9A 2JFEX 2H3BA 4Q4QA 3WSUA 2CZ5A 1WNOA 3PWAA 4AW7A 2NV9A 4U31A 3EX4A 2P3EA 2FZMA 5DN1A 1FHUA 4N7QA 5FJOA 3TJLA 4X0NA 4MF4A 4DZHA 4QX4A 1Z32X 3S5NA 2OKOA 3CUHA 3CMGA 4KETA 1XRVA 3NZQA 5LIUX 3P82A 1IIGA 1EXPA 1OM0A 2GUBA 1KR1A 4ZO6A 4GH1A 4F40A 4PMYA 3QXBA 4GHRA 4Y9MA 3FW6A 3NR0A 3SCPA 3TW6A 4P61A 5CZ0A 1HJQA 5E0KA 1E56A 2WSPA 2WVSA 3LLXA 2NVAA 4XAFA 1EQPA 3QVQA 3KRZA 4AH7A 4N9BA 1Q6DA 2RGLA 4MPQA 2C71A 3N18A 4P5UA 4QS6A 2R14A 5AVHA 1RK5A 4UNIA 2WQDA 4I7WA 4CU7A 4HYVA 2FMOA 2CBVA 1EDTA 5T8GA 4KIRA 3LA4A 1IWAA 3V1PA 5I3FA 3B05A 4S2CA 4JTHA 2FVMA 3VMPA 4G7EA 4F0LA 4ZMGA 2PWGA 1GVFA 2PODA 2XU2A 1PKMA 1ZSXA 3L2IA 3BOFA 2YXGA 2QNEA 3VZXA 3W00A 2ZFAA 4BWLA 4HU4A 3B40A 3NDZA 5IBXA 3DDMA 3RITA 5I09A 3QV9A 2ATMA 1DQUA 3RAOA 1GVQA 4DB7A 3GDLA 3GFXA 4LVBA 1HVQA 4G7EB 4J3WA 5CC6A 2V2DA 4AEOA 2G3NA 2A85A 1O7AA 3GUGA 4MJ4A 3WK0A 1V3HA 3BLFA 1VQTA 3QEZA 1LUCB 4EVZA 1K6AA 3TXVA 4K68A 3P67A 4GY0A 1FHVA 4M8UA 2C79A 1H1ZA 1S5NA 4QHRA 3U2ZA 4WXYA 1RPXA 2EO7A 3W2JA 1JL8A 4Q4MA 1SZRA 1Q8JA 2HXUA 3SEPA 1FA2A 3U7BA 4CQBA 3ITVA 1T40A 1K8YA 1EP3A 2XFWA 3B0UX 2BXYA 1TX2A 1LUCA 4ASTA 2Z2BA 4WUIA 4XBJA 1V08A 1FWEC 2A3AA 2DSWA 3EEZA 3KOWA 3LENA 1AJZA 3MUAA 3WNPA 1G4EA 1FP8A 1R0MA 2EQDA 3DH7A 1IEVA 4YNGA 3OZMA 5MKGB 2NX3A 2J9YA 3UZZA 4PR4A 3SQSA 2EF9A 2WXDM 3CZEA 4B3LA 4ZEPA 3A6OA 2VFEA 5C71A 3M64A 3APGA 1V7YA 3IANA 3FAWA 5BU6A 2XIOA 2WMKA 3FJLA 4QJ4B 4ZTYA 5FF2A 1HGYA 4DYEA 3GFYA 4M24A 2VGBA 2ZXBA 3TQKA 4S3EA 1CI1A 3IGUA 1RA0A 4JY8A 1UIPA 5G2IA 4LALA 4LYQA 3ZOAA 1KCKA 3CAVA 1E6ZA 3CUJA 3G77A 3PSWA 1YTDA 2V81A 4PB5A 3L21A 3QGVA 2ZUVA 1AW5A 2WMHA 4NZ4A 5H2ZA 4Y6GA 5DXXA 2NX1A 4V1XA 4I6KA 4LUYA 4LNCA 5G1TA 3ZWTA 4H9YA 1KCLA 4XSMA 3K4WA 4O1CA 3KTSA 3GR7A 3QZ6A 1WB0A 2YL8A 5LA1A 4PL1A 4DM2A 4B4FA 5HNTA 4I5UA 4FNTA 3GIQA 3B8SA 3RYSA 4H9ZA 3LCHA 3DIPA 4OFCA 3VX1A 1RPKA 1O5QA 1BXNA 3Q94A 5CH9A 3AI0A 1OCQA 4BFAA 4L9ZA 2WCAA 3ARUA 4IH3A 1K8CA 3HG3A 4PUJA 3OODA 3C4UA 3IJ6A 1QW9A 5HA7A 1M01A 1O95A 1E1CB 3C2YA 4JFSA 1BKSA 1IEIA 5DEZA 2RDTA 4OOZA 2BG5A 3OPSA 4NT0A 3Q65A 1A5SA 4PCTA 3IVSA 3WQCA 3K46A 5FF3A 4HMEA 5DX7A 2YCEA 4PODA 3PFMA 3MI2A 3PJWA 4AD0A 3KVMA 1LBLA 1TV4A 5LGXA 1ZFJA 1ZPTA 2QYGA 4RUBA 3SFWA 1JD7A 1EBHA 3HQ1A 4C1NB 2VX4A 3W25A 1LL7A 1J0IA 1UWSA 2GVYA 1X39A 3VDCA 3HURA 1KD0A 4ATWA 3LN3A 3R4IA 5KZDA 1H7RA 1K8ZA 1GJWA 2PWEA 4YIWA 3UBPC 1V5XA 4PB3A 3KWSA 3R8GA 5AYYA 3R5EA 5FAGA 1NEYA 3I3BA 2J8GA 4YCOA 3S9IA 1WUEA 1XYBA 3DC0A 1ESWA 3EZ4A 4HYWA 5FKYA 4JYEA 4D8AA 1D3GA 2Y7GA 1JI1A 1VEOA 4XWUA 4Q8NA 1UQZA 3HPXA 3H7UA 1GZJA 1P43A 2BHUA 3QZAA 4L6OA 4E5TA 3WQFA 1QMLA 5HQLA 3WD4A 3SCTA 1ME8A 3IRSA 4K37A 3UJRA 1T8XA 1P0NA 2QXWA 2D69A 5EGRA 2ISDA 3EPOA 1R7AA 1WBHA 2VX7A 3I7QA 3VTRA 3B8VA 3M7WA 5AYBA 3NZRA 4MJMA 4EKJA 3VNJA 3WBXA 2V9DA 4H3DA 3B4YA 3OBKA 5LA0A 2GQAA 2WWDA 3UERA 3GH4A 3G2GA 3HJEA 5E9AA 1GHSA 1P4CA 2QDGA 1EIBA 4GRSA 5A8NA 4EWND 5C2XA 4HPJA 3NPXA 2ALRA 2GVEA 1EA9C 3RPMA 4FPSA 3O0FA 1E55A 3MP5A 2YZRA 3ARZA 2XH7A 1SFSA 2PI6A 2ZWYA 3QHOA 2QJHA 3ATYA 3S5SA 4HZ6A 4X2RA 3LGGA 2WM1A 4P7RA 3CUZA 4DY1A 2YX0A 3W26A 1D7FA 3M0YA 2VDGA 1BXBA 2XWEA 2O9PA 4F0SA 3BCDA 3G24A 1V51A 4EXAA 4IIHA 4DXKA 3C8FA 3NURA 4Z2IA 4FP1A 3NO5A 4GGHA 4L6DA 1ECQA 2BS9A 3FS2A 1D8CA 4D6HA 1O94A 2PRMA 5M17A 2C13A 5G2WA 2YCKX 1RUSA 5E09A 5CJ5A 4YWSA 1CX9A 2V2HA 4GD0A 3T7VA 4Y8EA 4PGLA 1VAHA 4FR1A 2ZDRA 3RRAA 3WFZA 3PZQA 4JDYA 1UZDA 4YLWA 1R38A 3TYUA 3HQNA 2X05A 3W23A 2QF8A 3PPFA 3CZ8A 3LMZA 5EMJA 1BKHA 1Q85A 4IXHA 3QKZA 2R91A 1VB9A 2D20A 3HPZA 1DL3A 5BCAA 3NXLA 2OELA 5F2LA 1TWIA 4D6EA 3T8QA 4JQ4A 4CNOA 4AB4A 4PMJA 4HHHA 1JYVA 4PBGA 2HCVA 3GNDA 3DFQA 2FGLA 5G4EA 3WLKX 3PM6A 1GHRA 2CKSA 1AH4A 2NQHA 4I8DA 3WKZA 2A6NA 1ZBKA 3W6MA 4GFIA 1FWNA 2A0NA 4GI4A 1QDSA 3S2MA 2XSBA 1XWYA 3RR4A 2QMJA 3GXNA 1TZ7A 1W5OA 2ZTJA 2JEQA 5J8LA 2PGEA 2PDYA 1WBJA 2I9EA 4H6QA 3LHZA 3SRKA 3CYVA 3R7MA 3NSMA 4DO7A 1XLJA 3JUGA 2QZRA 3UNDA 2EEXA 1XLHA 2J7EA 4JIEA 4ZCWA 3W7EA 4YTRA 3M0HA 2NQJA 3MU7A 1VRDA 2D22A 2HBVA 3FXYA 2BOFX 1J93A 1YDNA 1XDLA 2PP3A 1JGIA 4LCRA 1PZ1A 4D6IA 1W2PA 4U5IA 5I2UA 2CHRA 5A94A 1UH4A 4I6VA 1EPVA 1CECA 1KM6A 3GVQA 1F73A 1G1YA 1YADA 2ISSA 2EJ1A 1GKQA 4R7WA 2ZRUA 1CWYA 2Z1BA 4EPEC 7ENLA 3T1GA 5FL0A 4GVGA 2WJDA 3NQDA 1Z42A 4XB3A 1F3TA 4WDUA 4IFKB 2H6RA 3PG9A 3R8RA 3AIVA 4EPKA 1UIOA 2H8XA 4YCPA 3KUMA 2QAFA 3L65A 1XC6A 2JALA 2PBOA 1W1PA 1QNSA 3ZJ6A 4GC4A 3M5VA 1H7PA 4O53A 3HGJA 1FBAA 2XIQA 4K2SA 4GIRA 1J0ZA 1TJPA 3UFYA 1EEXA 2DH2A 4EPBC 4JNMA 3L4TA 3MJYA 2P10A 4Q33A 2ZVRA 3UWWA 2VRKA 1MNZA 8RUCA 3HPAA 4WJXA 2OOFA 3EOUA 2WCSA 3UCDA 4DJDD 3TXZA 1JXJA 4Z1DA 4U33A 3PZTA 1K4GA 2ZWZA 2A7PA 1WDPA 2EBNA 3S47A 2ESCA 2ZX6A 2X30A 3SUUA 2E1DA 1NFPA 3UWZA 3ZT6A 3HF3A 1IIHA 2Y5EA 3THAA 3TR2A 3SY5A 1AMKA 5A8PA 5HUPA 3LZ5A 2HTMA 5AC8A 3LRLA 3WH5A 1N8FA 1QR7A 2Z1SA 4L5ZA 4C6BA 2VWTA 3TQVA 1FWWA 2QPSA 4F8XA 3W53A 1TPUA 2Z2AA 3ITGA 3LHYA 3LBCA 4R9OA 1M53A 3FY1A 4UTTC 2QGHA 2P3ZA 3M0JA 1ZCOA 4YU1A 1CB7B 2Z2UA 5DRIA 3NDOA 3BLLA 3R10A 1JRCA 2OX1A 2NV1A 4Q4KA 1TA3B 3OGRA 5HWNA 2Z1KA 3HZ3A 3L0NA 5CQ1A 3N73A 1A5LC 4GABA 5CC3A 5AHEA 1FY6A 3SQLA 2Q3OA 1WKEA 3O0KA 5CGTA 1EL3A 3VOGA 3MQTA 2OYMA 4AYGA 4IPJA 3VK5A 1IEWA 1S5VA 3KZSA 3CGTA 3PK7A 1XFCA 4PUDA 4KRZA 1B9BA 3ELFA 2E6AA 3BOXA 5TBOA 3UG3A 4CCCA 3E0IA 5LYRA 5BOFA 1RQBA 2Z6IA 5FJIA 4XZLX 3ORWA 1REQA 5C9ZA 4GKLA 2YL6A 2PTXA 4O12A 1CXKA 4Q8QA 3VFLA 1TWSA 1H5YA 1V6UA 3MHGA 3TYCA 4QCFA 3GG8A 1L0PA 2C91A 2CPUA 1MRQA 2GDUA 2BXVA 5LKYA 1CGTA 2QJMA 1ADOA 4WDXA 4ZTXA 1ODZA 4CNUA 1AQ0A 3KS5A 3F5JA 3IUIA 4OU1A 4A2SA 4FA3A 2GOKA 4AIOA 1GOWA 2IMRA 3K8LA 2PDWA 3W74A 5XINA 3HG4A 5GNZA 4E8DA 5D37A 1JUEA 2V3EA 3TW9A 3PNZA 3AHXA 3SSJA 1SFJA 1CXEA 1U5JA 3EB3A 3SJNA 1QPOA 5A2CA 3N25A 4QBXA 3AHTA 3UR2A 4C7GA 4JHOA 1Q45A 4OVXA 4OIFA 3IGSA 1QJWA 5BRBA 3N2BA 4AX6A 5D2XA 1AD4A 1OADA 1G5AA 1WXZA 1DJZA 3KRSA 2WMIB 4DO5A 3WH8A 3MS8A 1SSDA 3WH6A 4WD0A 4WK9A 5K9XA 4MAVA 3P8JA 3UPMA 4BF7A 2AL2B 5C54A 1A3WA 1FVPA 3RCMA 1WQ5A 1OCNA 2CHOA 3QMTA 1NQKA 4RDZA 3EGJA 3BXWA 2E5BA 2D2JA 2OO6A 5HANA 1SJCA 1PUDA 3KBVA 2JF7A 3CAWA 4UR9A 2NWRA 1OVDA 4B5VA 1KTBA 5E70A 3FEQA 4LF2A 2NWSA 3RX3A 2H9AB 3FV9A 1EFZA 3AAMA 5CBIA 1SVDA 4MUZA 3GRIA 1CDGA 1FCQA 2TODA 1ISXA 1M65A 3UWVA 4MZ1A 1N82A 3VNYA 5AYZA 5AZ1A 3EKZA 1J01A 3URNA 3RM8A 3H54A 1XIFA 3KWXA 2VR5A 3VD5A 2Q6ZA 1Q6QA 4GISA 3TX9A 3CZKA 3ZXWA 1B3VA 2XN0A 1LTDA 3T0AA 4KWWA 2DSVA 3UJFA 3TWAA 3U48A 4X63A 5FD0A 4M6VA 5FAJA 2BXZA 5K7JA 4MZ8A 2E5CA 3H53A 3LB0A 1LROA 1AUSL 2FIQA 4QE1A 1MQQA 2ZOXA 2QGYA 5FJTA 2DJLA 3KM8A 3W6YA 1QI0A 1XH0A 3AIBA 3W7KA 4RV3A 4AVFA 4ERIA 4LAMA 3BPWA 3CU2A 2GOUA 4FNSA 2G4FA 1UKSA 3KFTA 4W89A 2BGNE 3C0SA 3AMGA 3L5MA 3T42A 2QCGA 3BMWA 4UFIA 5A6KA 8CGTA 3DGRA 4GZEA 3P8IA 1AH0A 2Q01A 2REQB 2DT3A 1K70A 4V27A 1I2NA 3AYRA 1UD6A 3S1XA 1JNEA 3TTYA 1E73M 2JK2A 2QCFA 1YDVA 1RK6A 3W76A 3MW7A 1C93A 3N2CA 4F3HA 3VD7A 2WZHA 1M7XA 2Q09A 4I9MA 1XIBA 4CD8A 1HF6A 2IW0A 3G1VA 2Z1WA 5G1YA 1GVOA 4PMNA 4H8VA 4MDPA 3EAUA 3T07A 3F4CA 4UFMA 2ON3A 2V0TA 3GNXA 2W6RA 4YMZA 3G1SA 3W4RA 4MWAE 3EWWA 4Q8VA 1GOMA 2YYTA 3BG3A 3AMDA 2WMJA 1C92A 3DAQA 2V63A 3VIMA 4GQQA 5A6LA 5A3HA 5LNRA 1E51A 3MMWA 3VILA 2Q02A 4OWGA 4IP4A 4XKMA 4F48A 2QPXA 2E40A 3HJZA 4JIHA 1W9DM 1ONRA 2GK1B 2VL4A 4MNMA 1E9LA 3ZJKA 4FLOA 1JPIA 3CASA 3P5ZA 4HN8A 1OQFA 3UF9A 3VDGA 1Z41A 4C7FA 4RV8A 3WZ0E 2DJXA 3W1QA 2HVNA 4AY1A 3ARXA 4M6PA 4QXIA 3GC4A 3HV8A 5HINA 3KX6A 4JKLA 4Q22A 1CTNA 3B0YA 1R85A 1S5WA 1IR2A 3E6EA 4GUJA 4P8UA 4QLKA 3USZA 1PIGA 1UKPA 1MDLA 1XIMA 1XQKA 2BASA 4NI3A 3WL1A 1JPKA 1LOSA 1GYMA 1RVGA 5M3WA 1X97A 1JUBA 3STGA 1Y7VA 3B9EA 4IPIA 1E9IA 2X7WA 2G3MA 3I10A 3IS4A 1A0EA 2ZC8A 4ZBCA 2ZUTA 1GEHA 2E9BA 1U1UA 1GNXA 1QWGA 4CD5A 2OZ3A 3IV3A 4O0QA 2GWGA 3DHPA 3DKLA 2PFHA 4JHZA 4K3ZA 1GVIA 4GXWA 2X1UA 3STEA 1BD0A 3TA6A 2FPTA 2I17A 1W1VA 1LT7A 2XG9A 3A24A 5HDRA 4A29A 1SO4A 1UD3A 3B0VC 1LDCA 4FXRA 4ML4A 3LTSA 4NX0A 5U7SA 1YE4A 2DW7A 3B06A 2CLHA 3MVTA 5B7YA 1XISA 3QYSA 3N29A 1BWVA 1GQIA 4IJRA 3GTIA 5D33A 3RFAA 1X6NA 3E9AA 3AXKA 2C0HA 2G3FA 2RGMA 1ALDA 3KVLA 3P3BA 5CSRA 3V7PA 4DWSB 1Q3NA 4PMDA 1UKTA 3UQNA 4DUOA 4PMXA 1HVXA 1JDFA 1WZLA 2GJLA 3MYOA 3G6MA 4HOZA 1R6WA 4K8EA 3AS1A 3ZM8A 3H7VA 3GTHA 4WDWA 1NF7A 3E1F1 1JCLA 3DFHA 4W88A 3H4XA 4IL0A 1BQGA 4NF7A 5MKGA 1VGAA 2NT0A 4H83A 2VMFA 1PYFA 2FHBA 4UZSA 1T8QA 3GC2A 3LCGA 2DZPA 1I6NA 2NUXA 4BEUA 3DFYA 4FX6M 5EL1A 3WX7A 3ID7A 1H51A 2WKGA 4L64A 3EX1A 1N55A 4QP0A 2PU0A 1BEUA 3P62A 1K7FA 3MHUA 4DF0A 2I5QA 1TMLA 1JNDA 3G8RA 1E0WA 4AWSA 4EF8A 4NSBA 1F74A 2VR2A 1DXEA 1HL8A 2YDQA 2DORA 1VFUA 3GYCA 4RPPA 3W70A 5FI8A 4KEZA 4LBRA 3CAQA 3T81A 1YXYA 2HZGA 4PMVA 4G56A 3RCNA 2QIWA 4JIPA 3TP4A 3WUEA 4BI7A 4LFYA 3VABA 2O55A 3T8LA 4MYXA 3Q58A 4RK8A 3AQUA 1B30A 2VCAA 3WQ8A 4Q8MA 4RW5A 4QDMA 1S2TA 3D3FA 4I7UA 4QROA 3CHCA 5GVJA 3WUBA 4AZBA 2JIWA 4H1ZA 2QDEA 3M0KA 5HMEA 5ABEA 4HTBA 2NQ9A 2Y61A 2ZE3A 4O4WA 2QV4A 4XZWA 1M68A 1OX5A 3INPA 3SQMA 1BXCA 3WF4A 3II1A 3OB8A 2VT0A 2HPIA 1LM1A 2OT1A 1UUOA 4XISA 5ABHA 2NW0A 4IQJA 4KRUA 3LTYA 3H6OA 2VI0A 1UJPA 3MANA 4FK9A 4CLMA 4PRTA 1GUVA 2ZX7A 5CZJA 1E0TA 4MLRA 1XICA 3UWEA 3M9YA 1H5VA 2V5KA 4GXMA 2A3EA 1XYCA 4HJFA 4OTKA 4WKHA 4TMCA 3CQIA 4FALA 5D2WA 2EPOA 4F2UA 4RDYA 1G67A 4GJ1A 3W7HA 4OHQA 1CENA 1MQPA 3C8NA 2FH8A 1K7EA 1DV7A 3U0HA 3G3MA 3TYZA 1C8VA 1YXCA 3VDAA 2QV5A 1EJRC 1H7OA 1O5KA 2E68A 5F4SA 3SRFA 3NQGA 3D46A 4A2RA 1TQJA 5HJLA 1SZFA 3ARRA 3CQHA 1WKFA 3O2LA 1DBTA 4Q7NA 5IRPA 3MDUA 3E5PA 4W7WA 2QPUA 1UOKA 3EWUA 1EJWC 4DLFA 2IPWA 4Q8WA 3W1LA 5ABFA 4QR6A 4PMUA 1TFVA 1W32A 2DQWA 5GNXA 3SIZA 2PDXA 1QATA 3TYEA 4I7VA 4B4HA 4H00A 3IWPA 2BNJA 2V5JA 1P7TB 2BB0A 4R3UA 3G3DA 4YJ5A 3THQA 1ISZA 2O4MA 4JBRA 4XG1A 3FKRA 3EWCA 1ZTVA 4E2VA 5A8GA 3E12A 2ACSA 2EKGA 3WBWA 2XH2A 1DORA 1X8CA 4PA8A 1DJGA 1UC5A 1EB3A 1Y5WA 3SCQA 2R1PA 1R2SA 1EO5A 1L6YA 4P7QA 3QMSA 4AD4A 5CPLA 1W5PA 3BLPX 3R1ZA 4XZIA 2WW5A 1PTAA 3S1WA 3NL2A 4Z42C 3OLDA 4HT3A 1W9PA 3GNRA 1A0DA 1Q6LA 3CT7A 5G2HA 3XINA 2ZTKA 4LVAA 3LNPA 3ARPA 3S83A 1KFEA 3PHAA 1DYSA 2PDLA 3P5YA 4IZGA 4N9EA 3NQMA 1ECEA 3V75A 3EBVA 3L4XA 2W3ZA 1DHKA 4IGHA 4W4QA 2CZVA 4I9AA 3LPPA 2EAWA 3BGAA 3CB8A 1UWAA 3EDDA 2YR1A 4C91A 3KVKA 3E74A 3L4WA 2IS7A 4LRTA 3R2GA 1QI2A 4GLEA 4IIDA 3FA5A 1ZGDA 1AQFA 3HFTA 3THUA 4CNNA 4XAYA 4XIAA 3VM5A 1QFEA 4JFTA 1UWRA 2OT0A 2Z7GA 4E4FA 4GIAA 4HMDA 1MUMA 1Q2RA 3NQFA 3DHFA 3VIJA 1XYMA 1MFUA 4JTCA 3K8KA 2X16A 1KC7A 4Y9NA 1I75A 4WJ8A 3WK2A 2GSHA 4DEFA 2X8RA 3WCZA 1ZAJA 3KBNA 2PB1A 4UTTA 1RP8A 1MO0A 1R3VA 3OG2A 3EXTA 6PTDA 2DT2A 3OA3A 3V1HA 5CZKA 4HK6A 4CD6A 4C5ZA 3I65A 3PWIA 1AJ0A 3TC6A 1XFBA 3AJXA 2E9LA 1LL6A 5AZ0A 4L4OA 3WLSA 1JPMA 2J74A 1B4EA 1JDCA 4HZ7A 4PMRA 3SJ3A 3N34A 3GO2A 1GK8A 3N9RA 3AISA 4CVWA 1ME9A 2WJZA 4BR1A 4PRRA 1JXKA 3R0DA 3CS2A 1WDSA 3HG2A 4AYSA 3VD3A 2NT1A 3OJGA 1NFGA 3GAYA 5K9CA 1UH2A 2VD9A 3PJTA 3W1UA 2HK0A 1IZKA 1W1YA 1SYTA 4L4LA 3TQPA 4OBRA 1R2TA 4O1AA 3UZYA 1VJZA 1AQHA 3QMRA 3RNDA 2QMKA 1KV8A 3W85A 3UCCA 1VBGA 3PB2A 2VEKA 4TVDA 3WH9A 5FF4A 1VPQA 3ARYA 4CQAA 4B2DD 3G1FA 1GTEA 2E09A 4E38A 4X2PA 2GFTA 4S1FA 2GQ9A 2R94A 2VURA 4J9JA 5C0QA 4PFHA 3VC6A 1ZJHA 1H7WA 2AMXA 2VCBA 3KDOA 3KAOA 3O3RA 1I0BA 4GYKA 1U33A 1KXVA 4M3PA 3VE7A 3CQ0A 2W62A 2P8BA 5D8WA 3H2OA 4H19A 3LQLA 4N42A 1OZQA 4BF9A 2PDHA 4ZOEA 1NDWA 1OG0A 2VDIA 1HO1A 3KOXA 6A3HA 4RL3A 3FDGA 1L6GA 3THDA 2GVLA 1UBSA 3VNKA 4HSHA 2RDXA 1KRAC 3VX0A 5BMWA 3RO8A 2HSAA 4EAMA 1GONA 1REQB 5BXPA 4X9SA 4Z1CA