3PZIA

Structure of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1 in complex with beta-d-glucose
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila
molecule tags Hydrolase
total genus 154
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pziA00
1J01A 2VR4A 3W82A 3RM4A 4J3TA 2YJQA 1QNRA 3SURA 4WSKA 4UQAA 3VM5A 3BC9A 2DSUA 2ESCA 5AYIA 4AD4A 1UR4A 3RCNA 4M24A 3ZT7A 3CMJA 3BAWA 5DT7A 4W7UA 1QNSA 5I23A 1EA9C 4PMQA 5A8NA 2D3LA 1BYAA 3WL0A 3F5JA 4KWUA 3O2LA 1CGUA 3AIUA 3BMVA 2WCSA 1JZ4A 1JYNA 3PTMA 4GIAA 3WBEA 3EDFA 4V28A 1C93A 1R7OA 4UFMA 3CZ8A 3K8LA 3VILA 1H11A 3MO4A 1E56A 4IM4A 3W81A 4D72A 1KR0A 5JBDA 1OIMA 2CERA 1G94A 2CITA 3MUZ1 4Q22A 2UY3A 4AZ6A 5HPOA 2WW5A 1W1PA 5D9OA 2VQUA 2IUZA 1WDPA 4PMXA 2NT0A 2TAAA 1HP5A 1B31A 4CUCA 2EPOA 2CETA 3KWXA 2WZEA 1PZ3A 1OIFA 1PIGA 1QHPA 3O9NA 4N42A 3NCOA 4KH2A 5A2BA 4MPKA 2JFEX 3ARZA 5I6SA 3RILA 5GQBA 3AISA 2HVMA 4A3HA 1LF1A 2BNJA 3SUUA 5BRPA 1E6SM 3AMKA 3WDIA 1KBKA 3VIGA 4CD7A 1W91A 1UYQA 2A3AA 5C71A 2WVTA 2ZE0A 3WN6A 5FOOA 3W53A 1JZ8A 4H04A 3MV11 1GOIA 4P7RA 1GQIA 1LQ0A 4PBGA 1W2PA 1C8YA 4D6EA 4H41A 1DHKA 1JD7A 5M5DA 2D0GA 4ATWA 1WCGA 1F4AA 5I24A 3SCUA 3O6AA 2V3GA 4QLLA 1NWUA 5BROA 1OINA 1L8NA 1HT6A 2W4XA 3ARVA 3FN9A 3GXMA 1KCLA 1IT0A 2VOTA 2VO5A 1CXIA 4Z2IA 1SYTA 3I3BA 4QLKA 2ZX7A 2D0HA 2J4GA 2D20A 1VFUA 1JDCA 4TTGA 4DUVA 1QI5A 1LJYA 4UQDA 3SCWA 1KGUA 3OA5A 2WHLA 3AS0A 3J7HA 1HVQA 3EMZA 1BLIA 1UR9A 1KQZA 2WM0A 2DIEA 3EMCA 3WH5A 4UFKA 2OWCA 4CCEA 4JKMA 1E3ZA 4MJ4A 4PSPA 1C8XA 1CNVA 4L4PA 2XTKA 2DDXA 2VX7A 2Y24A 3PZVA 4JL2A 1VJZA 1Q6EA 2VVNA 3AIBA 3GZAA 4H8UA 1TA3B 3BAJA 3CGTA 2WSKA 1J0KA 4N0RA 1UKQA 4W5ZA 2WC3A 3I3DA 3BLKA 1JZ6A 2PBOA 3VGEA 3VD5A 4RL3A 3NIYA 2WMIB 3VD4A 4WLCA 2MANA 3L4YA 3B9DA 3WENA 4WKAA 5D9NA 1BGAA 1CYGA 3EYPA 2VURA 1OGBA 3BAIA 1UWTA 3ZQ9A 1W9DM 3AIWA 3W4RA 2XUCA 1WNOA 1E6XM 2QHAA 3EBVA 5GNYA 1QW9A 1MFUA 4D6CA 3QHMA 2XGBA 4MNLA 1CGYA 3M7SA 3BSHA 5FIPA 3CUFA 3MS8A 4UFLA 2WC7A 3T0BA 1KXHA 3WSUA 1WP6A 2OWWA 1C7SA 2ZXBA 3TTSA 2D1ZA 1NM9A 5IDIA 4Z2LA 3QR3A 3ZSSA 1QBAA 4D6JA 1CGWA 3BSGA 5A8OA 1BAGA 2DSVA 4URIA 4PMNA 4HMCA 3MSGA 4OBSA 3WKZA 1TE1A 3CBWA 1UH2A 2GJRA 2VRJA 1E0WA 1ZJAA 1BYBA 2J47A 3WNKA 1FHDA 1V3JA 4XB3A 2E9MA 2C0HA 3N17A 3VIKA 3VDBA 4F9DA 1TUXA 2O9TA 3WDPP 1IV8A 4NF7A 1E6PA 2JF7A 4J7RA 1SFSA 2WMJA 3CIVA 1NWSA 4CCDA 3WUEA 1GOOA 3LMYA 1E6QM 1W1TA 1EHAA 1KXQA 4BQ2A 5C8BB 4U5KA 2JF6A 2VR5A 1J11A 3U7VA 3RM8A 1ITXA 3RO8A 2CHNA 3PBGA 1UUQA 3L4VA 3BMWA 1A47A 4D1IA 3CHCA 2EPKX 5E6YA 5HOSA 1BYCA 3U7BA 2EEXA 5M17A 1UA7A 1MQRA 1CGVA 4U2YA 2BHZA 4EE9A 2GVYA 4OJYA 1D7FA 2XFRA 1BGGA 3FY1A 1E72M 3EDJA 3QGVA 3WD1A 5A8MA 2ZUMA 2W91A 4DM2A 1JZ2A 3PN8A 1TA3A 4PUEA 2VI0A 1CZ1A 1JF5A 4J3UA 3CZJA 5I2UA 5CQ1A 1BTCA 2DT3A 2J8FA 3AXIA 1XGZA 3WQ8A 1HJUA 4A3YA 1J0HA 2WMIA 1BG4A 3DYPA 9CGTA 4MJ2A 2ZX6A 3VD7A 4B3KA 2CBIA 2FHCA 2A3EA 3K46A 2WMKA 2A3HA 3SUSA 3T2PA 4B16A 3K4DA 4U31A 1EQPA 3GYCA 2HISA 3ARSA 2WVVB 3MMUA 1UH4A 2E9LA 4X9YA 3JUGA 1Q6FA 2A3CA 2XWEA 5A6SA 1M04A 4DWSC 5DT5A 3OG2A 3SCOA 4MB3A 1HKMA 3RPMA 2WWDA 1LLOA 3MANA 5EBAA 3HJEA 4UNIA 2G3JA 4ZE5A 7CGTA 1CXLA 4W84A 3SCQA 4PTMA 3VDAA 3N18A 1HJSA 3G6MA 1NP0A 1I1WA 5E0CA 1AQHA 8CGTA 3FHAA 1JIBA 3WD2A 4ATDA 1GONA 4W7VA 5ABGA 2J8GA 1FHLA 1EQCA 3VVGA 3E1F1 1HL9A 2YBTA 2WVSA 3AMLA 2EPLX 2X09A 3W6LA 1UA3A 3OB8A 4UFJA 2D22A 3NJ3A 2VJXA 3PZUA 1V0NA 2YDRA 1GW1A 3ARUA 2NW0A 4TOQA 1OT1A 4KRTA 1V0KA 1H4PA 2FGLA 1E4NA 4X0VA 3L2LA 1LWJA 2PWEA 4AEFA 2V38A 3K4AA 3GBEA 3APGA 3CUJA 3FAWA 5FL1A 1RP9A 3WDHA 4WSJA 1ZS2A 2CIPA 2DT2A 3UEQA 1JAEA 1VJSA 3ZR5A 2ZUVA 1WDSA 3ZJ6A 1RP8A 4E8DA 1W9UA 1JZ7A 4FLQA 1V3LA 4TUFA 4PMYA 4HU8A 2PBGA 3ZJ7A 1BHGA 5I78A 2GK1B 4W8BA 2G3IA 1SR0A 5CPSA 2BVYA 4AD0A 4CVWA 4RE3A 1JNEA 1H1NA 2VZVA 4BQ5A 1XSIA 4BS0A 1UR1A 3VNZA 5D8WA 2XVGA 3VUPA 2GFTA 7TAAA 4BA0A 4UOJA 4E8CA 1UH3A 1VIWA 5CGTA 2EO7A 4FLSA 3ZJKA 2J7HA 4UQEA 4R27A 3ZO9A 4CU8A 2J7GA 2ZXDA 2YOCA 5AC4A 2DQXA 1FP8A 2QF8A 2VCAA 1KWKA 3WNNA 4BF7A 3HN3A 3GBDA 5A6BD 2ZX5A 1EO5A 1E0VA 1OM0A 3ALFA 2AMGA 5E6ZA 2CCRA 3WBAA 3AS3A 1JZ3A 3A4XA 3GDBA 3WIJA 3W38A 3CHFA 1UR0A 3DC0A 2ZWYA 4MNMA 4UFHA 2WANA 1XC6A 2JIWA 3VPLA 4CU6A 5F7UA 1OB0A 2G8ZA 5CG0A 1KXTA 4J28A 1TVNA 4M29A 4UFIA 3F5KA 2VX6A 3A3HA 4P8VA 1V08A 2O9PA 3POHA 1UD6A 1E4LA 1MW2A 3WNOA 4TX8A 4Z2HA 4U2ZA 3WMBA 1JG9A 1E5NA 3AZSA 2G3NA 3PZ9A 4P8UA 5HPCA 1HJXA 2VZUA 3T0DA 1J0ZA 3SCPA 3VNYA 2WVUA 2EPNA 3CZLA 5A1AA 1MWOA 3W0KA 4AISA 1EH9A 1E9LA 2J7EA 1CTNA 4XUYA 5A94A 4F8XA 4EK7A 2VQTA 2QPUA 4CD8A 4CU7A 4DUXA 1PZ2A 1OT2A 2CBVA 1MQPA 1DTUA 1J9YA 1H41A 3AJ7A 5A6AA 4KGJA 1JYVA 1WZMA 1ODUA 1C7TA 1ISXA 4GZIA 3BAXA 3OIHA 2J7BA 2YIHA 4W88A 5IFTA 3T09A 4B3LA 2EJ1A 2G41A 1JXKA 5JBFA 6TAAA 3ZMRA 2PC8A 2E9BA 4JCMA 2YA1A 3RMEA 2CBUA 4JAWA 1CECA 4U3CA 1E43A 4CD6A 5BRQA 4WIWA 2GK1A 2GJXB 5LA0A 4LQ1A 2BY0A 3DHUA 4C7GA 3N9KA 1E6RA 1ZBVA 3D3AA 4NRSA 1OD8A 2J79A 1DEDA 3VINA 5I3DA 4PUDA 3CUGA 4WKFA 1NOFA 1W3KA 3IJ9A 2BS9A 1XCXA 5E09A 2ZWZA 2X1IA 2OYLA 1UWIA 1UD5A 3MU7A 4KMQA 4PRWA 2Y4SA 1SMDA 5CSUA 3TP4A 1FA2A 3WF3A 3DHPA 4PMOA 2GSJA 1W3LA 3VIFA 3W24A 3T08A 4NI3A 3WH9A 3EDKA 4QLJA 5E0FA 1E71M 1LWHA 4MB1A 4QAWA 2VCCA 3LPGA 2WHKA 5FKYA 1CXHA 1TCMA 3AMGA 3VIHA 4GQRA 3NSXA 4MNKA 1Z32X 2W5FA 4J3SA 2NT1A 4HTYA 4UOQA 3WMSA 3VX1A 1KWGA 1LG2A 3GXIA 1CLXA 5JUVA 3PZMA 3VM7A 3U57A 1CXFA 1V3IA 3ZSTA 3ARQA 4HA3A 1PJ9A 1HX0A 1WZLA 4J27A 3WH6A 3VU2A 2XIIA 5A2AA 4DWSB 3U5UA 2EBNA 1B2YA 4FK9A 4JFSA 3VD9A 2PF0A 4X0NA 2QMJA 4ACZB 2J7DA 3GXDA 5E70A 1VEMA 1BSIA 4UR9A 1M01A 3SCTA 3IJ7A 4BQ3A 4JKKA 1MXDA 1TG7A 1J0IA 3BXWA 6A3HA 1UKSA 2WPGA 2O92A 4MB5A 3GH4A 1Q4NX 3GNRA 3WEMA 3N04A 1H0GA 1UG6A 2CPUA 4U5IA 3VTRA 3MUIA 2YLLA 4OOUA 1CXEA 1XHGA 1QNPA 4QCEA 2X2YA 3L4UA 3BAKA 4PMUA 5D4YA 3II1A 4JFUA 4KRUA 1JXJA 3RIKA 3KE0A 4PYSA 1CGTA 2VCBA 1ZBWA 1VEOA 4LYRA 3AYRA 1HP4A 4BZYA 2ZIDA 4YHGA 3WD0A 4TXEA 1HIZA 1UKPA 2VTFA 4RE2A 1S46A 1HJQA 3CTTA 2GJXA 3VOCA 1MFVA 3BGAA 4AY1A 2J62A 4AZBA 4JFWA 1E40A 1HKKA 3PZIA 3ZM8A 4IPNB 2XFYA 4MAZA 5CZKA 1V6WA 3L2MA 4GXPA 3OLDA 1PX4A 1C92A 2DH3A 1JFHA 3WQ5A 4WJXA 4D6HA 1H09A 4D6DA 1W9BM 1J12A 2YDSA 1M03A 1WZKA 4M56A 2E3ZA 1K9TA 4B9YA 1QW8A 3A47A 3UR7A 3PZGA 2OYMA 1NOWA 1GJWA 2PI6A 1HVXA 4TTUA 4P8XA 4JHZA 4CD4A 2VNCA 2CKRA 1QVBA 1KQYA 1B3YA 3N13A 2FH6A 1GOMA 1V02E 1GHSA 1FH7A 3WNPA 3PTKA 3MUY1 3B8SA 5DF0A 4CKQA 2EQDA 1TR1A 2OSWA 5BXRA 4W93A 1EDTA 3VIOA 2YBUA 1JF6A 3GH7A 1HKJA 1JZ5A 1PPIA 1BVZA 1V6VA 2WBKA 4CCCA 4GPNA 3L4TA 2XG9A 4J3WA 1B3XA 7A3HA 4NZCA 4DWSA 3WH8A 3RM9A 1UR2A 2B31A 1JNDA 3OLIA 1PX8A 4ACZA 5IFPA 2WK2A 1BG9A 1X6LA 4WKHA 2J75A 4FLRA 3SCNA 4OUEA 3UG5A 3AZTA 3W27A 3CUIA 3EMQA 2VZTA 1VEPA 4QCFA 5A69A 1V6XA 3GTNA 1QI3A 4HOZA 3CHEA 1K9DA 5HBFA 1QNOA 4ATLA 1WZAA 2F8QA 2PWHA 5ABFB 3KL0A 1M53A 1EOKA 1UHVA 1GQJA 3THCA 4ZXOA 2O9OA 1MXGA 4KGLA 2WLYA 1NARA 4GKLA 4JCLA 1HF6A 5I5RA 2WCGA 3UETA 1ZL1A 3KEHA 2J78A 5M03A 2X0HA 4HMDA 3WD4A 1W32A 1VENA 3OBAA 4Z2GA 2XGIA 2D0FA 5I0DA 3WUGA 1QI4A 2IXUA 1GVYA 2XVPA 3L4XA 1WDQA 3OLEA 1L0PA 4P7LA 4PTXA 5IHRA 1TMQA 5BXTA 4CD5A 1VBUA 3WF2A 1KXVA 4W8AA 1QHOA 4U33A 1W9PA 5E9AA 3FHQA 3GM8A 3MUAA 4D6GA 1PBGA 1AMYA 4CVUA 1I75A 3VMPA 2XJ7A 2J77A 4XV0A 4QFUA 4W7WA 3WF0A 2E8ZA 3AHTA 3ARRA 1HL8A 1J10A 4MADA 1DWFM 2ZX8A 2GDUA 3AZRA 4XZBA 1NQ6A 2ZICA 1AQMA 3WQ6A 1K9EA 1EDGA 1RPKA 2FDMA 2BHUA 3VGFA 2WNWA 1QOXA 5JIWA 3TOPA 5DMYA 1BF2A 3ZJ8A 5D9MA 5CLTA 4F9JA 1BPLB 1B9ZA 1WB0A 5BXPA 3ZIZA 1EIBA 5HNNA 1E6NA 1H5VA 2Y5EA 1W1YA 1N82A 2YKKA 3VMOA 1VFMA 2D23A 1UR8A 4HOWA 4NSBA 2DT0A 4H8VA 4JFVA 1XSKA 1ODZA 1W9XA 1ISWA 2CESA 2DSZA 1OGSA 1GNXA 1HN1A 1V03A 2J7FA 4YPJA 3FNDA 2ZUTA 5BYWA 1XD1A 4GQQA 2XPKA 5GNXA 1FH8A 3CHDA 4AZCB 4MDOA 2OSYA 1P6WA 4AZ5A 2ZXAA 5GPRA 1GUVA 1BYDA 3NSNA 3TTQA 1FFRA 3KZSA 3KL3A 3WY1A 1D2KA 3WL1A 4AIUA 2JALA 3GNPA 5ABFA 2QV4A 1GJUA 1GOWA 3L4ZA 2WKLA 1B3WA 1WDRA 2UWFA 4AD3A 5ECUA 4BCEA 3AICA 1H2JA 4AZGA 2WXDM 4IPLA 1CPUA 2F2HA 1DWIM 3WF4A 1E70M 2AAAA 1MW3A 2WSPA 5I77A 2W66A 1UKTA 2BVDA 4PMRA 4LYQA 3VX0A 3S2CA 4AIEA 2Z1KA 1J18A 2J25A 3VIIA 5ABEA 2YL5A 1K6AA 1ZBCA 1ZBKA 3QOMA 1FP9A 2BHYA 3WEZA 2PWDA 1G0CA 1KGXA 3WD3A 4CN4A 5A2CA 5CLWA 3G6LA 4GI8A 1OWQA 3W6MA 1WAWA 3AS2A 4D6IA 1BVNP 3AIVA 1XV8A 5DFAA 3AHZA 1MW1A 3TONA 3MKKA 1E73M 3NDYA 3RJXA 1J0JA 2WVVA 1E15A 4YHEA 3WFLA 5HXMA 2VC9A 3B9AA 3NDZA 2VT0A 2YLAA 3K8KA 1YHTA 2ZUWA 1B30A 1G01A 3WQWA 3MMDA 2BFGA 3M07A 5AYBA 5EFFA 5AC5A 3UESA 2G3MA 3BCFA 3VD3A 4K68A 3SIMA 1MYRA 2VX4A 1PAMA 1UWQA 1X6NA 1B1YA 1M7XA 3FAXA 4H8HA 4B15A 3EDDA 3VGGA 4ZE4A 2JEQA 1GPFA 3LPFA 4XZWA 1Q6CA 2VMFA 4S3KA 3SUWA 1R87A 3AS1A 2FH8A 3K1DA 1DWHM 4GO8A 4EANA 4Z2JA 2BVTA 3SUVA 1XH1A 1J0YA 2RGMA 1C90A 3AFBA 4ZXLA 1GOQA 5LA1A 3N15A 2FHBA 2Y8VA 4J3XA 4AZCA 3N1AA 1RH9A 3W37A 2BY1A 3WUBA 1ISZA 4UTFA 3BAYA 2VRQA 2ZX9A 5KEZA 3LPPA 2YA2A 4EAMA 1K9FA 3VO0A 3CUHA 3GXFA 3AIRA 2V5CA 2JE8A 2XIBA 1HNYA 1V6UA 4P8WA 4UZUA 1HJVA 4UOZA 4F79A 2GUYA 2DH2A 1CIUA 2E4TA 1GORA 5A6KA 2XVLA 1U33A 2G4FA 1NWTA 5TD4A 4GINA 3AXXA 5DO8A 4B9ZA 3VKKA 4FMVA 2WWCA 4ML4A 1U2YA 2BY3A 3MSDA 5LA2A 2XSBA 4J3VA 2EPMX 1JFXA 4HPGA 2V3DA 1CXKA 2X8RA 3A6OA 3ARPA 1TFVA 2GDVA 2D3NA 4RE4A 5HDRA 4JZ5A 3N12A 4EKJA 2C8NA 5C70A 3W29A 2WHMA 1NP2A 4UZSA 1A3HA 4GZJA 3HU7A 1V3HA 2ZUNA 4MDPA 1KFWA 1LL4A 2WLZA 2X0YA 6CGTA 3ZT6A 3VGDA 4IISA 5CPQA 3THDA 4AZHA 3WMCA 4OKDA 4PSRA 4PMDA 3WFZA 1JI1A 3AMCA 1V3MA 4TVDA 5FD0A 3AQUA 1KR1A 4GZEA 4AIOA 3CZEA 1W2VA 1WO2A 2DEPA 4HU0A 3WEOA 4D1JA 3WDJA 1R8LA 3F4VA 2BY2A 4CGTA 4HZ6A 2W92A 3WDRA 4E4PA 5M3WA 3BH4A 1HKIA 5JBEA 4XX6A 1LL7A 4H7VA 3WNLA 4QP0A 1AVAA 4HZ7A 2QMKA 4A4AA 4AC1X 3AROA 4Y7EA 1GZJA 1QPKA 1GCYA 3TTOA 4AXNA 2WMGA 1G5AA 1NWRA 2VRKA 2O9RA 3CZGA 1QI2A 4GI9A 3T0AA 1F4HA 1CBGA 2CKSA 1RD6A 2VZOA 2XSAA 1AQ0A 3M46A 4ZEPA 3IK2A 1TVPA 1Q6GA 3WUFA 2ZOXA 3TTYA 3T2OA 1DWJM 4CN6A 1HJWA 2W67A 2CNCA 2ZXQA 1SMAA 3L4WA 1E0XA 4AYSA 2CYGA 2YL9A 3SCVA 1D3CA 1I1XA 3F5LA 1VF8A 2NSXA 2OWXA 5LYRA 4JL1A 3W25A 4PTWA 4AW7A 3SUTA 1B3VA 2CBJA 2WYSA 1CLVA 4CN1A 1CWYA 4JKLA 1GVIA 2WBGA 1B3ZA 3UERA 2XVKA 4OZOA 1VBRA 2ZUSA 2VX5A 1V0MA 5CSYA 4C7DA 4HA4A 4GI6A 2XM1A 4M81A 3CLWA 1E6ZA 2DSWA 1UQYA 1WPCA 1DP0A 2J7CA 2WHJA 3DECA 1E4MM 3IAPA 5CGMA 1UD4A 4AD1A 1ZJBA 2VL4A 1BQCA 4AEEA 3VDCA 4IUGA 1EDQA 1E1EA 3ARYA 5IHSA 1IZKA 3AI0A 2E40A 2BV9A 1JGIA 3IANA 2BXZA 4U3AA 4PMZA 3WDQA 1OSEA 1E55A 1UD3A 2YL8A 3AIQA 3CPUA 4PCTA 4UQCA 1X1NA 1U30A 2VZSA 3M6DA 4W86A 1GOKA 4LGXA 1NH6A 4Q7NA 5GNZA 2GJPA 3VDHA 1OD0A 1E3XA 1VFFA 4P7OA 2VVSA 4AZ7A 1QNQA 2DSKA 5I79A 3PZNA 1G9HA 1W1VA 1W9VA 4AD2A 1JDAA 3DYOA 5BXSA 2FGZA 1KCKA 1KB3A 2WKGA 1C8QA 5BCAA 4AZIA 1PIFA 5A95A 3UG3A 1UZ4A 2YDQA 2FHFA 3ARTA 3WQ4A 4ACYA 3GNOA 4AD5A 3TA9A 3K8MA 3W28A 1PX3A 3KL5A 2RGLA 3PTQA 3AYSA 5EB8A 3RJYA 4JIEA 5A6MA 2W62A 3WF1A 3QHOA 2CXGA 2XVNA 1EOMA 3FXYA 3ZOAA 1OBAA 1FFQA 1QHZA 1VAHA 4JHOA 3PHAA 1UOKA 3LPOA 1HXJA 5EMYA 3CMGA 4MAVA 1C3FA 1BFNA 1UKOA 1O7AA 2Y2WA 3VIJA 1PEZA 1LG1A 2WB5A 1MVYA 1QI0A 2D2OA 5A3HA 4WF7A 4V27A 1KBBA 3OLGA 1XSJA 1Y7VA 2UY2A 4H2CA 4LX4A 5A8PA 4DWSD 3CO4A 1DWAM 2WMHA 1JL8A 1CENA 3W26A 2EXOA 1V6YA 2DIJA 1QBBA 3UCQA 2Z1SA 2V3FA 2Y8KA 1JYXA 3WH7A 3QHNA 5D8ZA 1LL6A 4YN5A 5CJ5A 5A6JA 3AXHA 3WELA 2V3EA 4P7NA 2F61A 2OLHA 4ZFMA 1G1YA 3FW6A 4M82A 3PZOA 4W87A 4Z2KA 4HOXA 8A3HA 5A6LA 4DUWA 1XH2A 2JIEA 4E2OA 4LXFA 1H3GA 1C91A 1XD0A 4NRRA 4PMVA 1E1FA 1MQQA 5A8QA 2XWDA 1VFOA 3IAQA 1CGXA 3A4WA 1JDDA 4HMEA 2OYKA 3BLPX 2WC4A 4TVCA 4DM1A 5EFDA 2WZIA 4GO9A 2J74A 5AY7A 2E0PA 2WAGA 2Q8XA 3A4AA 3D5HA 1GHRA 4M8UA 4MNJA 2CEQA 3ZR6A 3VIMA 1CDGA 1US3A 1ZU8A 1V0LA 3QOKA 2XM2A 3NYDA 1CEOA 4P7QA 1UZ1A 3PZQA 3VGBA 3MV01 1MW0A 3U5YA 5KZ6A 4OBRA 1W3HA 1IZJA 4MB4A 4PEEA 1OGGA 4QDMA 5FCZA 2IXVA 4W89A 3VMNA 3ARWA 3I3EA 1NOUA 2UY4A 3UG4A 4HA1A 1KGWA 3AHVA 4LPCA 2PB1A 3IJ8A 1V3KA 2QPSA 3S6TA 1XH0A 1EXPA 3AHXA 1FH9A 1FOBA 5ABHA 1B0IA 1VB9A 1ITCA 2D24A 3B9EA 3POCA 1W3JA 3OZPA 2YA0A 2BXYA 1H0IA 4L4OA 1TZ7A 5BWFA 4FLOA 1ECEA 3WNMA 5CXPA 1UD2A 4PN2A 5IXEA 3CZKA 2ZUUA 3AOFA 3BCDA 5DEZA 2XHYA 5A6BA 4TVUA 2X05A 4F66A 2CHOA 3SCSA 4D6FA 1ZB5A 1YQ2A 3N11A 4S3JA 1E4IA 4AWEA 4TX6A 3HMCA 3WQVA 1JD9A 4UQBA 2VUYA 1GQLA 1US2A 1V02A 4FF5A 4LYPA 4V2XA 3ECQA 1O6IA 2V5DA 3OZOA 3OGVA 2PWGA 1XYZA 2C7FA 3DYMA 2DGAA 1UWRA 1ISYA 1XCWA 1R86A 3OGRA 1WE5A 3UR8A 4R5EA 1OCQA 1JAKA 1JI2A 4HP5A 3AHYA 2E8YA 4HPHA 2A3BA 3EDEA 1E5JA 2AOSA 1ESWA 4PTVA 5CPTA 5FL0A 2WZHA 2DPEA 1XYFA 2XYLA 3ALGA 1VRXA 1Q6DA 3OGSA 1UWSA 3MMWA 4W85A 3SCRA 5JIPA 1GQKA 1WKYA 4WK9A 4W5UA 1B90A 2DT1A 4ZENA 3SEPA 3AIEA 3ZT5A 2JEPA 1UD8A 4OIFA 4PCSA 1EO7A 4BQ4A 2YL6A 1R7AA 4W8LA 3VGHA 1H49A 2UY5A 1R85A 3PZTA 3VIPA 4C7FA 1ISVA 2WMFA 3T2QA 4M1RA 3ARXA 2W61A 1UWUA 3NUKA 3NSMA 3RDKA 4M80A 5D9PA 2WCAA 2XFFA 2PWFA 3CH9A 2W63A 1UQZA 2OSXA 4AMCA 4D71A 1EGZA 4UCFA 1DWGM 2QLYA 4MTVA 3AMDA 4UQ9A 1EHNA 4OOZA 3GH5A 1XRVA 1JYWA 4HZ8A 4JFTA
chains in the Genus database with same CATH superfamily
3TNOA 2FQIA 4RX0A 4JHMA 4I9JA 3W7DA 3EPNA 1QNRA 3QGAC 3B40A 5EKYA 1ZLPA 4IFRA 3QKZA 2YCKX 4LC6A 3EZ4A 3DN5A 2XZ7A 2EJAA 2D3LA 4EWND 3W88A 1DV7A 2BXVA 1ONRA 1G4PA 3M0HA 1CGUA 1FTXA 1JZ4A 3PTMA 1C93A 1R7OA 3M47A 4HA0A 4UFMA 5BRBA 3K8LA 3VCRA 2YCLB 1H11A 5D04C 2YB4A 3W81A 4UTKA 3R6IA 1Z42A 5JBDA 4CNOA 3NDOA 4GYPC 2CITA 4Z0JA 1EP1A 1TREA 4Q22A 1W31A 1O60A 4JQAA 1HGYA 3G77A 2NT0A 3NQDA 4IXXA 3L0KA 1ME8A 3LBCA 3UWVA 1SU5A 5XIAA 3KWXA 1VD6A 3O9NA 2WJEA 4KH2A 2VWSA 4MPKA 2JFEX 4QSHA 3UZYA 5DLCA 4WXYA 3CWOX 2EF9A 1XRTA 3JR2A 2FPYA 2E6AA 3GVWA 5LIWX 1EJXC 3SUUA 3BOXA 4AWUA 1E6SM 3AMKA 3BJSA 4CD7A 5C71A 4NX5A 1K8ZA 1Q13A 4YVVA 5FOOA 3W53A 2A6NA 6REQA 3MV11 1GOIA 4Z42C 1X8CA 2CLPA 3MSYA 1W2PA 1ALDA 4EAYA 1DHKA 3S42A 1DIDA 3O6AA 3SCUA 2A0NA 1NWUA 5AC8A 1H7PA 1HT6A 3PR2A 3ARVA 3GXMA 1R3YA 5BNKA 3GTXA 5FACA 4M51A 2VOTA 1SYTA 3I3BA 2QJGA 3A24A 2FZMA 4Q4RA 3R8RA 5H6HA 1JDCA 4B5XA 4R88A 1QI5A 5H91A 5I02A 3DFOA 3OA5A 3N2XA 3MHFA 1V77A 2Y7EA 1ZALA 2O55A 1K7EA 4Q8PA 3QY6A 3F2DA 1UR9A 3EMCA 3WH5A 2DIEA 4UFKA 1PKMA 3GNXA 2OWCA 4JKMA 3KOWA 2R24A 4S2BA 3PB2A 2VX7A 4PMJA 3RU6A 1TA3B 1YTKA 3G1DA 2WSKA 2I17A 4MLRA 4XAPA 4RDYA 3VZZA 4V15A 4GIEA 2VYOA 1SZGA 4ERGA 3WO8A 2MANA 4ZTYA 3WZ0E 3DFPA 2E1WA 3B9DA 3L5LA 4C6MA 1BGAA 1DL3A 4DJEA 3EYPA 3HQOA 1UWTA 4G7EA 3AIWA 1NIUA 3KTSA 5D33A 2QHAA 3KXQA 1QW9A 1VYRA 4Y8FA 3QHMA 1WOBA 3K5XA 3W73A 4AIBA 3I68A 1BVWA 4UFLA 2WC7A 3TEVA 3N29A 1DQUA 3G0UA 1TJPA 3L65A 1DJXA 2OTDA 3MW7A 1FY6A 5AZ1A 1MUCA 5AFDA 4N2YA 2OR2A 3ITYA 4HJWA 3KTXA 4MG4A 1TWDA 4A8IA 1QBAA 2PWUA 1CGWA 3BSGA 2VFDA 1H7OA 3CU2A 1KFBA 1E0WA 3TR9A 2C71A 1LOLA 1OYBA 2FB2A 3W71A 3VIKA 4PBFA 4MOZA 4F9DA 1IV8A 2OLSA 1SFSA 3E02A 2PDPA 3S3GA 4OU1A 3B8TA 4O54A 3V75A 1W1TA 1KXQA 1IHIA 6PTDA 1E0TA 3L4VA 5F4SA 4UMBA 4XD3A 1A47A 3CHCA 3RRAA 5HOSA 5E6YA 3MKVA 2REQB 2EEXA 5M17A 1MQRA 1P0KA 2VEPA 2BHZA 2GVYA 3OTRA 1Z3NA 3QQ1A 4YYCA 4CEUC 1K8XA 4PUEA 1RQBA 1F8MA 2VI0A 2DZWA 2I5QA 4GBUA 1XGZA 3WQ8A 3PK7A 4A3YA 1BG4A 2RKXA 3BLOA 3CB8A 4K7VA 4IMFA 5DBUA 3WQPA 3EWXA 4IQLA 4M7TA 2UZ9A 1VYSX 2Q01A 5AZ0A 2E6DA 4JNMA 1A4LA 3GYCA 2HISA 3ARSA 2WVVB 1UH4A 2HEJA 5TAOA 1Q6FA 2FMNA 4PRRA 2ISDA 2XWEA 4DYKA 4H00A 4QX4A 2NLIA 4DWSC 5CAKA 2PDCA 1WV2A 1F3TA 4MB3A 5K3VA 1HKVA 4S3AA 1MSSA 1A0EA 3TC7A 3DX5A 3RXZA 4FAMA 4NIRA 3SCQA 4PTMA 3VDAA 4O14A 1OC6A 4LNCA 4GJ1A 1NP0A 2P3ZA 5E0CA 1OZMA 2CZDA 1OFPA 1JIBA 2NLYA 4ATDA 5ABGA 1FHLA 1OFQA 3VVGA 1Y5VA 3EB3A 2WVSA 3M0XA 2V2HA 1EIXA 2P5NA 4PGLA 5IBXC 1UA3A 4UFJA 4R85A 2D22A 3TLQA 3UU0A 3PZUA 2YDRA 2V6AA 4D2JA 1OJXA 4HCLA 3FA3A 1H4PA 1E4NA 1LWJA 4M1BA 4RLIA 3BWWA 3MHUA 3K4AA 1W3IA 4N4PA 4FR6A 2CIPA 2YCEA 5G2IA 1U1HA 1I2QA 1RP8A 1GWJA 4H1ZA 4W8BA 1NELA 1JPKA 2BVYA 3ME3A 4C6JA 7TIMA 3LXAA 1HUVA 3W1XA 2CWXA 1XSIA 2H3DA 3VNZA 4BA0A 2HWGA 4E8CA 2CXEA 4DI9A 1WUEA 4UQEA 4WR3A 2YOCA 2NXGA 5AC4A 4FP1A 2NSOA 1KWKA 5A6BD 3VKBA 2AMGA 5E6ZA 4PCFA 1OF8A 1KFJA 3A4XA 3GDBA 3WIJA 3DC0A 4LEFA 3NOYA 5LZLA 1RJRA 5RUBA 1XIMA 3U4FA 2JIWA 2R1LA 4CU6A 1TE6A 4X63A 2BDQA 4JDBA 2RHGA 3HQNA 1KXTA 2G97A 3A3XA 4YMZA 2R14A 3UPWA 4O19A 3LM7A 3AU6A 2VX6A 3CMFA 4JDYA 1DTNA 3U2EA 1I0BA 3POHA 4JN8A 2VKZG 1UD6A 1E4LA 3WNOA 4M0XA 3GR4A 2JQXA 1JG9A 3UNTA 1D9EA 3WJZA 2XN2A 4S3BA 2EPNA 5A1AA 1KM1A 4AISA 4Z0SA 3SRDA 3T1GA 4HN4A 2J7EA 1VCFA 1CTNA 4PEKA 5A94A 3LDVA 1YKWA 4EK7A 1PCWA 1J6OA 1ADDA 1FKWA 3P61A 5HMFA 1VPXA 1GOXA 1VPYA 2PDBA 4LW7A 1YE6A 1YRRA 2Y61A 1KFKA 1IE7C 5BZAA 1ODUA 1C7TA 1XLEA 3BAXA 2GOUA 4GXWA 5HNRA 3GB6A 3OIHA 4ZFCA 2YIHA 4W88A 2WO5A 1RALA 1HKWA 4NY2A 1IYXA 2DFAA 4G7FA 2PC8A 3K2GA 4Y8EA 4JCMA 2YA1A 1S5MA 3SN1A 1E43A 5DRCA 4WIWA 4O8RA 4LVGA 4LQ1A 2BY0A 3D0CA 3LOTA 2QCDA 1HTIA 3D3AA 3RX3A 2NV1A 1OD8A 2J79A 5CBIA 1PWLA 4PUDA 4H19A 3M0KA 2BS9A 1XCXA 5E09A 2ZWZA 1GVQA 1UWIA 2OYLA 1RCQA 3MU7A 4H6KA 1KC7A 2Y4SA 1SMDA 2CZFA 1BWLA 3OPSA 3RPDA 1H1YA 2GSJA 2V30A 2RDUA 3DBPA 2Z27A 3TXVA 4O0KA 2Y70A 4NI3A 1OVDA 5D2WA 3WH9A 4QLJA 2BP1A 1E71M 3PPHA 1VYPX 3UXKA 4MB1A 2VGFA 2HCVA 3EXSA 3MZ2A 4KEVA 3WBXA 3AMGA 1QK2A 4YVXA 5B80A 3O0KA 4C91A 4AX6A 4HTYA 4IP5A 3EX4A 2QDGA 3SW6A 1LG2A 4EX4A 1CLXA 3HTWA 5JUVA 3W23A 3VM7A 4GG9A 1CXFA 1AA1B 3ARQA 1UB3A 4KW2A 1WZLA 4J27A 4XUGA 5A2AA 1VJIA 4DWSB 3DFHA 3ITLA 3IV8A 9XIMA 4JFSA 2AGTA 4X0NA 5H8MA 2GGIA 3RCYA 2HE8A 1VEMA 4A8NA 1YDOA 1M01A 4BQ3A 2C13A 3VCNA 1DXIA 1J0IA 4I7UA 6A3HA 1GEQA 2WPGA 3L23A 4MB5A 3GH4A 3WEMA 1UG6A 3MO7A 3MUIA 4C65A 3PUGA 2J6VA 3LB0A 1CXEA 1XHGA 4QCEA 1A5UA 1R2SA 4EXAA 3II1A 3GVGA 4GABA 1JXJA 4KRUA 1P43A 3KE0A 1IT7A 1FKXA 1XICA 5CZJA 1CGTA 4A35A 4IMCA 1LT7A 2VCBA 3GXPA 1VEOA 4LYRA 4BZYA 3ABSA 3TDFA 4RV8A 3SZ8A 3WK0A 5DY2A 3RX4A 1OYCA 2FZBA 1YXCA 3NQ2A 4NXKA 3B0VC 3LBOA 2PDMA 2X1SA 2VTFA 4M6VA 1HJQA 3KRUA 3CTTA 2GJXA 3VOCA 3WK3A 3BGAA 2J62A 4AZBA 4JFWA 4IP7A 3JW7A 1Q6QA 3Q67A 3H12A 2C19A 4KCWA 5CZKA 3L2MA 1S2VA 3W83A 4Y9NA 5LHEA 2PLMA 2DH3A 3FDGA 3I7SA 1JFHA 1AD4A 3A9IA 4D6HA 2PU1A 5FEZA 1H09A 3SB0A 3LZ3A 1W9BM 1F6PA 3G1YA 4XSMA 3SJ3A 1M03A 2E3ZA 3M0MA 5AVNA 1K9TA 2X41A 3EWZA 4B9YA 1QW8A 4MJZA 3A47A 2OT1A 1T99A 2C15A 5HQEA 1W56A 3QXBA 5LHFA 4NJIA 1GJWA 3RN6A 1DIEA 1KQYA 1W1IE 3EOEA 1ZFJA 3PTKA 3MUY1 4YWIA 4PCPA 3HF3A 2HSAA 3OA3A 2FLIA 2W79A 4B2DA 2VFIA 4DJFA 2ZTKA 2O4QA 2RJHA 1HKJA 3QTGA 2WNQA 3EX1A 2WBKA 3QFWA 4CCCA 4GPNA 3B06A 1TPB1 2XG9A 4FI4A 4JIIX 4RZ6A 5D38A 2V0TA 2C91A 3C0QA 3B9OA 2E6YA 4GYKA 3A23A 4B5VA 3WH8A 4YCOA 5K4ZA 1U5HA 3RM9A 1UR2A 2B31A 3OLIA 3OP2A 5IFPA 3ZS4A 2X16A 4WKHA 4FLRA 4AUBA 2CHRA 3COTA 1XJBA 4I90A 3HQPA 4LTSA 2CLFA 4R9OA 3CUIA 3EMQA 1Q66A 3ICJA 5I3KA 3SM0A 1V6XA 1MZHA 3GTNA 3PWGA 3CHEA 5HBFA 3CL8A 2Y6ZA 4FSAA 1FDYA 1A50A 3KUMA 4UTTC 4JN7A 1RLCL 5LNRA 3BPWA 2O9OA 4KGLA 2NXIA 2BGQA 1FCQA 2V69A 4YTTA 2WCGA 1V6TA 4UCGA 4F3HA 1J96A 1S1PA 5M03A 2HJPA 5FJTA 4KRZA 4DN1A 3OBAA 1GVEA 3GG8A 4DJEC 3KS6A 1XLAA 2D0FA 1QI4A 5F1UA 2XVPA 3L4XA 3D46A 4AF0A 1WDQA 2J9YA 1L0PA 4E5TA 5IHRA 3URAA 1K3UA 3GIQA 3LQGA 3WF2A 2PGRA 1BRLB 4DNMA 1YDYA 1QHOA 4U33A 5E9AA 3MUAA 4D6GA 3HV8A 1PKYA 2XJ7A 1JPIA 2J77A 1E0UA 1S2CA 1G4EA 3WQ6A 1K9EA 1Z41A 2PDQA 1TYGA 2GGGA 1RPKA 5FJUA 1U1UA 2HE5A 2HRWA 1RD5A 2D69A 4JX5A 5JIWA 3TOPA 2NZLA 1DE6A 4DXVA 5CLTA 1BPLB 1B9ZA 4DPPA 5IOBA 3GIPA 1M3UA 5BXPA 3I65A 3ZIZA 1E6NA 1EWEA 2EG7A 4A2RA 3KAOA 1N82A 2YKKA 2PDLA 2AMXA 4PTNA 1XSKA 1ISWA 4I9TA 1GNXA 2J7FA 4YPJA 1XD1A 3Q2DA 1JCNA 2XPKA 5H8UA 3M0VA 4MDOA 2SFPA 3T55A 3NSNA 1S3TC 3MDUA 3KZSA 3KBVA 3KL3A 1EX1A 3KRSA 4D8ZA 3MWCA 4AIUA 4Z1BA 4IG2B 1KBIA 3B4YA 4KESA 3L4ZA 2WKLA 4V1XA 2ZKMX 3AWNA 3E2VA 2HQAA 4E4FA 2B7OA 2GVGA 1L2QA 2POTA 2WXDM 1PYMA 3FXGA 3WF4A 1E70M 2AAAA 4WDTA 4H6EA 1XLBA 3VX0A 3B9NA 1M68A 4B92A 3S2CA 3PF3A 4GHRA 4POCA 2A3LA 4WUIA 3PUEA 1FCBA 5F2GA 1K6AA 1ZBKA 1U5VA 3QOMA 2ALRA 1H7RA 4DXXA 5CLWA 3G6LA 1OWQA 3W6MA 3U6WA 1MRAA 3AS2A 3N2OA 4PRTA 3FFSA 1JCXA 3AHZA 3TONA 4FO4A 1P7TA 3M0IA 3WK1A 1XPYA 3RJXA 5LGXA 4QITA 5CEWA 3WFLA 3S1VA 4NZ5A 2VC9A 1I4NA 4AU0A 3B9AA 3W1RA 2VT0A 3CV6A 3TTEA 2Z6IA 3K8KA 2ZUWA 3S1GA 3BQ6A 4PB3A 4Q33A 2BFGA 4MJMA 4PUKA 5AYBA 4XWUA 3UESA 3TN4A 4DF1A 4UBPC 3E96A 1FDZA 2NWSA 2VX4A 1UWQA 3G3MA 2GVJA 4IF2A 3MMTA 3C2VA 4B15A 1BEUA 1GPFA 1XLGA 2C3ZA 3LPFA 5AKQA 4L61A 4S3KA 5HR7A 2Z4GA 1DWHM 1LUCA 1UBSA 3UGRA 2Y8VA 3N1AA 3TC6A 3W37A 4OBTA 4DEFA 2VRQA 3TMLA 4HHPA 3CH0A 2YA2A 3O3RA 3CUHA 3AIRA 4OV9A 1HNYA 1V6UA 4P8WA 3DFYA 4UZUA 1ZPTA 1HJVA 2QF7A 1Q6LA 2H90A 4LANA 5EGRA 2ICSA 1CIUA 1DJQA 3E9AA 2NQLA 2XVLA 4Q8MA 3PANA 1U33A 1XYAA 4XZMX 4GINA 2QVNA 2WWCA 1J8VA 1U2YA 4Q4KA 3E74A 5LA2A 4MZYA 4EPEC 4H9ZA 1JFXA 1F3EA 3A6OA 3ARPA 4WDUA 4G5DA 4QG6A 4FXRA 5HDRA 4JZ5A 3N12A 3GC2A 5HWMA 2FYMA 3WBWA 1QK0A 4LB3A 3C56A 4KFOA 2WHMA 1IIHA 5HJLA 1A3HA 3GE7A 4GZJA 4L1XA 4GVGA 1R9XA 2X0YA 6CGTA 3VGDA 1VLWA 2QCMA 5CPQA 4AZHA 1TPWA 1XWYA 1JI1A 3AMCA 4K36A 4IPPA 1WO2A 3W2KA 1R8LA 2PD5A 4PUUA 4CGTA 4LF2A 3WDRA 1I60A 1EF3A 1XISA 3W1NA 5CAHA 3OEXA 4JTTA 4H7VA 3O6YX 1AVAA 4HZ7A 3ZR4A 2CC0A 3O07A 3XIMA 4JQ2A 1S38A 4LY8A 3S4TA 4LT9A 4ADSA 3RLGA 1GZJA 4XZNX 1GCYA 4NZ1A 3C8NA 2PRLA 1TPUA 1CBGA 3VKJA 5I7GA 1AQ0A 4ZEPA 1TVPA 1Q6GA 1V93A 3KOZA 3TTYA 1JCLA 3T2OA 3UA4A 1DWJM 4XKMA 5KSWA 4FALA 4E3TA 2YL9A 3SCVA 1I1XA 3F5LA 1VF8A 3TQKA 4JL1A 3W25A 3SUTA 4ENLA 3VKAA 3R89A 2EG8A 1PTAA 1WKEA 1GVIA 4MY9A 1K77A 1EJRC 3QV6A 5D02A 4OZOA 1V0MA 5CSYA 3W7CA 3MA8A 3W7HA 1FX6A 3H7VA 3PFRA 3WLOA 4G8TA 2NWRA 4UTWA 2J7CA 1Q6OA 1UC5A 4P61A 2FZDA 1FBAA 5J8LA 3TZFA 4US5A 1Q8JA 4QISA 1BQCA 1RK5A 3UVIA 4ZO9A 4IJRA 3AI0A 2BV9A 2WZTA 1JGIA 1KBJA 3IANA 4PMZA 5EYWA 1NF0A 1OSEA 1E55A 4H6QA 3AIQA 3CPUA 2PGFA 4DELA 2R91A 1X1NA 3M6YA 3M6DA 4TMBA 1J5SA 3QPEA 4HB7A 3URQA 1NH6A 3S83A 1YBQB 2CLHA 5GNZA 2GJPA 1E3XA 4XIAA 4EPKA 4F0SA 5I79A 1SO4A 1Z9AA 1GK8A 2NUYA 1M65A 4L6DA 4Y6GA 2OCZA 5T9BG 1LLWA 4O53A 1H63A 4LAZA 3GU1A 4ACYA 3SJNA 3G24A 3TAKA 4DLFA 1D3HA 4QJ4B 3IV3A 3NA8A 4J9JA 3KL5A 3RF9A 2PAJA 3PTQA 3AYSA 5EB8A 2F9RA 1TVLA 3CEPA 4DF0A 1UOZA 4FR1A 5FAJA 1FFQA 5EU9A 2VWTA 3DUGA 4JHOA 3GS6A 2R6OA 4KWSA 5BU9A 1HXJA 2ANUA 5I3HA 3L7RA 3UFYA 3IS4A 4C1KA 3RX2A 1C3FA 2PCQA 2DP3A 4FZIA 4QDPA 2OEJA 2CLIA 5LNWA 3VIJA 2YXXA 2WB5A 4L6HA 3LLFA 1IT8A 3O05A 2PDWA 4LAOA 3ITGA 2V2DA 3MUCA 3MI6A 4H2CA 3NURA 4LX4A 5A8PA 1TCDA 1DWAM 1DKWA 2V3FA 4WY0A 4BWLA 4GVIA 3UYCA 3QHNA 5D8ZA 5A6JA 3AXHA 3ITVA 1U1JA 4P7NA 5AYZA 2OLHA 2ON3A 4ZFMA 3RFAA 1G1YA 3FA5A 1IEIA 2WQDA 4OFCA 5A6LA 8A3HA 2I5GA 7ODCA 3Q4DA 4DUWA 3T4WA 3HB9A 1E1FA 5A8QA 2XWDA 2WPBA 4IGMA 5D2YA 1CGXA 1ME7A 5C7HA 4H9VA 4ONVA 5D05A 4KETA 3UWUA 1P48A 1T5AA 3GHSA 1TR9A 2VEKA 3LQLA 5DCBA 3SR7A 2Z1XA 3IJLA 4DJFC 1IR2A 2P1FA 4MSSA 2WZIA 1W1B1 3IJ6A 4FS9A 4BJHA 4BI7A 3D5HA 3ONBA 2R94A 5DBTA 3F2BA 4I9MA 1G67A 3B8IA 4Y96A 4AHPA 3UCCA 4R3UA 5M1TA 3C86A 4P7QA 1UZ1A 3THUA 1VIZA 4DBEA 3LTSA 4XAGA 1MW0A 2VFEA 3U5YA 5KZ6A 5T8GA 2IXVA 5SWUA 3CYVA 2PUZA 3SGZA 4GQBA 5CH9A 1DOSA 1YYAA 5IRPA 3KVKA 4JPGA 1TWIA 1V3KA 3S6TA 1XH0A 1VB9A 1KCZA 3G1SA 1H0IA 1E1CA 4L4OA 3TR2A 4LCSA 1GVFA 3USZA 1W3NA 1YMYA 4HNVA 2QJHA 3H7UA 3CZKA 4QG9A 3KVLA 2X05A 4WQ6A 4QTGA 4I7WA 4DJDC 3SCSA 4D6FA 1YQ2A 4JQ1A 3N11A 1P6CA 5G4WA 1E4IA 1SJDA 2FTWA 3BLIA 1RCOB 2QDHA 4GQGA 5FJIA 3AJXA 3CPGA 3N34A 1RQEA 7ENLA 3U9IA 3L12A 1RZMA 3DYMA 3CTLA 3RLUA 1SW3A 3SQMA 4LUYA 1IZCA 1WE5A 3VZXA 4IOTA 1JAKA 5BOFA 2A3BA 4M6UA 5K9XA 3EDEA 3ANYA 5CJMA 3QMRA 1OFDA 1DJIA 2OLAA 3BSMA 5CPTA 5FL0A 2QCEA 3ALGA 4GH3A 4GY0A 1Q6DA 4KCUA 3SCRA 1PTGA 3R0DA 1IWAA 4LVDA 2J88A 1B90A 2DT1A 2WZMA 4IPIA 5DY3A 3RMJA 1QPRA 1XIHA 4KCTA 5XINA 2ACQA 2I16A 2YL6A 2TRSA 1EPVA 3ABOA 1H49A 5K9CA 4RJEA 4C7FA 3SQLA 1B4KA 3MP3A 1UWUA 4MPQA 4GACA 3BMXA 3RDKA 3UXLA 4L56A 5FF3A 2W63A 2YXOA 1TPH1 3GWQA 4AMCA 4XZ9A 4UCFA 2QLYA 4OOZA 4RK8A 3GH5A 3NTYA 1DJGA 3W6YA 4IXHA 3W82A 3S2LA 4J3TA 3H2MA 4CQCA 4TMCA 3LLDA 1V5XA 4AD4A 4GISA 1UR4A 3RLVA 1O1ZA 2PA6A 2MUCA 3STCA 5DT7A 4W7UA 3NVTA 4QROA 5I23A 2YFNA 4PMQA 2P88A 4KIEA 3GDTA 1XKJA 3VNLA 3HO8A 2E77A 1F6YA 1LRQA 1PKLA 3F5JA 4KWUA 3O2LA 3P62A 4M5PA 3KTCA 1EJSC 4Y9OA 3WBEA 1EP3A 3VILA 3MO4A 1E56A 3GRIA 1WDWA 4YNGA 3M0ZA 1KR0A 1UZDA 3V5CA 2CERA 3ABRA 1P0DA 4HK7A 2YR1A 3PJTA 4GNJA 3UA3A 4AZ6A 1W1PA 5D9OA 2G50A 2VQUA 4PMXA 2TAAA 2DZAA 1HP5A 1Z48A 4CUCA 4MGGA 2EPOA 3OYXA 2CETA 4IFKB 3WLHA 2WZEA 2DZBA 3OG3A 1T6MA 1QHPA 4QNEA 2HROA 3TA6A 1AUSL 4N42A 5A2BA 3BGGA 2ZA2A 3KS5A 3QY7A 3NZQA 1LF1A 5BRPA 5FF4A 3NL5A 3FYYA 2ZVRA 1TUFA 1W91A 2A3AA 2DVXA 3B0XA 3NEHA 2Y85A 3PBUA 1QOQA 1HO4A 4O10A 4P7RA 4OUIA 3C2RA 3ZVHB 1Q4WA 3E2SA 4N9DA 2V3GA 3KOXA 5AHNA 1AJ2A 3TWBA 1PB0A 3V36A 4FOUA 5CZSA 2W4XA 2BMBA 3H22A 4K8HA 3PNUA 3QZEA 4Q8TA 4NI8A 1GVSA 2VO5A 4B4HA 4Z2IA 3NO5A 3IJQA 3WX7A 2R82A 2D0HA 3TAOA 4Q8OA 1VFUA 4XO7A 4GFIA 4N9BA 4ILSA 1KA9F 3LGDA 2Z29A 3SCWA 4CQAA 1KGUA 1BLIA 2Y0FA 5CZ0A 1KQZA 2WM0A 1GGOA 1C8XA 3IGHX 3HPSA 4L4PA 1XBXA 3DFQA 3PZVA 5GJPA 4H8UA 3TSMA 2Z6JA 1J0KA 4H9XA 4N0RA 1UKQA 4W5ZA 2GQ8A 3A9BA 1JZ6A 2PBOA 3CM4A 2WMIB 3VD4A 3GO2A 2E09A 1TMHA 5TQLA 3W1AA 4NYYA 4S23A 2HVOA 1SFLA 1OGBA 4LOCA 2PURA 2XIQA 3W4RA 1LBFA 4Q8UA 2IKHA 1WNOA 3E3HA 3RPTA 1E6XM 3DOPA 5AHFA 1MFUA 4JTSA 3UVAA 1SO6A 1DQXA 3ELFA 1UROA 4KKXA 3BSHA 1O94A 3KOFA 4NUWA 3MS8A 4LFYA 4ZO6A 1UP3A 1ZAHA 2OWWA 5E9XA 2RDXA 4LS1A 2IMRA 2TPSA 5C5YA 4E38A 4MWAA 3ORWA 1NM9A 4FA3A 4DBWA 3S1WA 4OT7A 2I7GA 3B04A 4Z2LA 1S5WA 3ZSSA 4Q4PA 4DAFA 3LA4A 4JTCA 1NSJA 2O7SA 2DSVA 1K02A 3H8AA 4PMNA 4HMCA 4OBSA 1BWVA 1ZUAX 3CQIA 1ZJAA 1KO0A 1PDYA 1BYBA 3WNKA 3LS9A 2QV5A 3MDWA 3MP5A 2FDSA 4XB3A 4O1CA 2QCHA 1AMKA 3BJFA 4K2SA 3P80A 3JZEA 3KBJA 3WDPP 1FWSA 4RDZA 3RG6A 4U10A 1AFSA 2JF7A 1GJPA 3UR2A 4J7RA 3PC0A 4WOZA 3CIVA 2OZ8A 4CCDA 3WUEA 3BW2A 4FOJA 1E6QM 1EHAA 4DQWA 2IPFA 4U5KA 2VR5A 2EGZA 2CHNA 2YPIA 3PBGA 4UTWC 3QR0A 1NTHA 3ABZA 1UR3M 2EPKX 1XIJA 4HNOA 3U7BA 4U2YA 2BWGA 4EE9A 4PTDA 3ONCA 3FY1A 2PWVA 5A8MA 2W91A 4DM2A 3W7MA 1JZ2A 1TA3A 4DO6A 2OG9A 1JF5A 4J3UA 3NG3A 1PL9A 4MVAA 3KHDA 4QJ1A 3VOGA 2DT3A 1VFTA 4EVZA 3AXIA 4TO8A 4X2PA 1J0HA 2J66A 2PLKA 1O5XA 1SO5A 3DYPA 4MJ2A 9CGTA 3VD7A 4B3KA 1F05A 3M44A 3PBYA 3HMJG 2CBIA 2KX9A 1UPPA 2A3EA 1VC4A 2WMKA 5EL1A 2A3HA 3K4DA 3JU2A 4U31A 2Z0IA 4Y9AA 4L1GA 3BLFA 2C0AA 1OG0A 2H8ZA 3JUGA 2A3CA 3UWQA 5A6SA 4YXGA 1M04A 3QW3A 4IIDA 1F8IA 1AL8A 1Y0EA 3C2EA 2DUZA 3QF0A 3OG2A 3SCOA 4RE0A 3R0KA 3MANA 4H9TA 1KM4A 1EC9A 3HJEA 4ASTA 2G3JA 3TZNA 4K8GA 3THQA 4S3GA 3M5ZA 2PRMA 1HJSA 3TUUA 4RNIA 2HK1A 1AQHA 3BE7A 4PFMA 2Q3RA 3R8HA 2C16A 4WEVX 1CW2A 3PBWA 1FWWA 1EQCA 4V1YA 3AMLA 2EPLX 2GGHA 2X09A 3R13A 4ZR8A 3WFAA 2OX4A 3KFTA 3NJ3A 1V0NA 4RPPA 1CT5A 3AALA 2NW0A 1V0KA 3FEMA 5J5DA 1C9DA 2FGLA 3L2LA 2YCJA 4DNHA 3GG0A 2NX9A 3FIGA 4AEFA 1BWKA 3FSTA 1BTMA 3I4EA 3GBEA 4XO6A 1RP9A 3WDHA 1YIXA 3HGRA 2PDHA 2DT2A 1VJSA 3APTA 1T8QA 3BCJA 1IIGA 2XINA 5I00A 3ZJ6A 1SZFA 1JZ7A 4FLQA 4HU8A 4PMYA 1R38A 2REQA 2GK1B 1EL3A 3E0IA 3ZFHA 4RCXA 3IUHA 4XTIA 5FF7A 2I57A 5HWJA 2QS8A 1GZ1A 5DCDA 3TW6A 1H1NA 3E5BA 1RUSA 4BS0A 1MZRA 5D8WA 2XVGA 3UJFA 5G1MA 3E12A 1VIWA 3MUXA 3FS2A 2X0SA 5ABTA 2VHLA 3FV9A 3NNTA 4EXQA 5JU6A 2J7HA 2ZXDA 3N6JA 3LY0A 2WJFA 3CQ0A 2VCAA 1ONXA 3W7GA 2ZX5A 1EO5A 2OKTA 3R2GA 4MLJA 3QLLA 1OM0A 3ALFA 1W0MA 1A80A 2CCRA 1ZCCA 4ICMA 1JZ3A 4Q8WA 4GC3A 2PTWA 5LIYX 3CHFA 4JIPA 4MNMA 2A7PA 2WANA 2XGZA 4GYPA 5F7UA 3VNIA 1I0DA 4UMAA 3LSBA 2YXGA 4P8VA 4I5RA 3A4JA 1V08A 3FJ6A 3GYEA 4JX4A 1MW2A 2EG6A 4TX8A 3PSWA 3S9ZA 1XC4A 1E5NA 4US6A 3UY7A 4MZ1A 3S5SA 4XAZA 4HBKA 2VZUA 3KZPA 3T0DA 1J0ZA 1B5TA 3G18A 3CZLA 4GH1A 5J04A 3VFLA 1E9LA 4XUYA 3PUDA 4GOAA 1OX5A 4S3DA 4CD8A 4CU7A 2B0MA 2RUSA 1F3XA 1VFHA 4QE1A 2CBVA 3PJWA 1MQPA 4OHQA 4QJ5B 4QIUA 3TJ4A 2VXNA 1H41A 2VDHA 3AJ7A 4MYAA 3OODA 1ISXA 4LVAA 1AH3A 4GZIA 1X6UA 1X97A 4QS5A 2J7BA 4C5ZA 3L66A 3W1TA 4LVFA 5JBFA 5BOOA 2E9BA 1XG4A 3WCZA 3WLTA 3GC4A 3N9KA 1E6RA 1ZBVA 4Y9MA 3VINA 4HPJA 3CUGA 4WKFA 1NOFA 2QVHA 4O12A 3LBMA 1FWDC 4D9PA 2Y89A 3H2OA 1AW5A 4DRSA 3PJUA 2ONEA 1WYIA 1EEXA 4ZO7A 4LAKA 1W3LA 4UTUA 3W24A 2VFFA 3B0UX 3AYVA 1SZEA 1R3VA 1NFBA 3EDKA 2OB3A 5E0FA 4PUNA 3LZ5A 1LWHA 2VCCA 3LPGA 1L6FA 1H7XA 1CXHA 1KM5A 3IIVA 3R25A 4JTEA 2RDTA 3VIHA 4GQRA 4MNKA 3KHJA 1R3WA 2PC4A 5BU6A 4UOQA 2OZ3A 4G56A 4QE4A 4UTIA 3DGBA 3LRMA 3W7PA 2Y7DA 4HA3A 4FXFA 1P0NA 3KBSA 2Z25A 3VU2A 2Q8LA 4RKAA 2WSQA 2EBNA 3TKFA 4GKTA 2QMJA 4ACZB 3UY8A 3GXDA 3NQVA 4UUIA 5E70A 1MNSA 5LKYA 4JKKA 4HMNA 1TG7A 3DU0A 5G4EA 1UKSA 3B97A 3T0CA 3TN5A 2O92A 1MEWA 1QJWA 4U5IA 4HSOA 5HINA 4YTUA 1A5CA 4OOUA 4JY8A 3FDKA 3BO9A 2PF8A 3L4UA 2J13A 3V5OA 4UB9A 4HYVA 4PYSA 4MIMA 1NEYA 4ZO8A 1ZBWA 4PUJA 4YHGA 3GU9A 3UZXA 5LIXX 3ABXA 3QLDA 2GVLA 4GIYA 4M3PA 3WD0A 2Z1VA 5JVLA 1UKPA 3ID7A 3LMZA 2J8TA 1NDWA 4JIRA 5I09A 1TTJA 2NV2A 1S46A 1BKSA 3MT1A 4FNSA 3H6OA 4LH8A 4C6DA 1D7KA 2Y7FA 4AY1A 1TMLA 1SZRA 2OMAA 5KTLA 1A0DA 3LRKA 2IPJA 3PZIA 1EC8A 4U28A 1G6CA 2B4GA 3QYSA 3ZM8A 2INZA 1EBGA 2WJDA 4JTDA 4MAZA 3QFEA 3L0NA 1V6WA 4L65A 4MUPA 2W9MA 2Z28A 1UUOA 3OLDA 1A4MA 5TF0A 1PX4A 1BF6A 4D6DA 4KQNA 2BBFA 3N4FA 1WZKA 4JTGA 3UR7A 1JCMP 3WLPA 3KCOA 4MZ8A 4TTUA 3TYAA 1QUMA 2G4JA 1QVBA 4NQ1A 2FH6A 4GIRA 1UP0A 3FVMA 3STPA 5A5WA 5T26A 1N55A 4FHAA 4CKQA 5C54A 4AB4A 4W93A 1EDTA 3VIOA 3LNPA 3LSCA 4FX7A 4UXDA 3GH7A 3EKGA 4K7YA 3QV7A 3E38A 1W54A 2QKFA 1BVZA 4EF9A 1EFZA 4X9SA 1DXEA 4DJED 1B3XA 4NVTA 4JYDA 2F84A 2CU0A 3GD6A 1H51A 4NZCA 1P5BA 4DWSA 4DBSA 1EUNA 3V7PA 3ATZA 3OHIA 3NQAA 2D2HA 4R9XA 3GDKA 2IKIA 2WK2A 3H4XA 5I3IA 1BG9A 4KEZA 2FZNA 4K1WA 3SCNA 1W1ZA 4DUOA 3AZTA 2A85A 2NQ5A 4DVOA 3KDNA 2PDXA 3W02A 4A29A 1VEPA 4QCFA 4HOZA 3Q58A 1K9DA 3TYCA 4ATLA 4DZ5A 1TQJA 2PWHA 3RNDA 1DJHA 2ZC8A 5ABFB 3KL0A 1M53A 4AVFA 1EJ7L 1EGVA 1EOKA 3RO6A 1UHVA 4HNUA 1GQJA 1K70A 1EJUC 4FNPA 1KM6A 5I5RA 1MUMA 1YPXA 4IWWA 1FUYA 4GLEA 4ZB2A 3UD6A 4F2TA 4GK8A 3MZNA 1LYXA 9XIAA 4B91A 2X0HA 1QU4A 4DO7A 5CSRA 3BANA 1F61A 3CAQA 1RY8A 4ES4A 3W7QA 2Z2AA 2C1IA 1IXPA 1I2NA 3GTHA 3OLEA 4JNZA 4XBJA 1REQB 2F6KA 3VNJA 4PTXA 2GJLA 3EPMA 4UMCA 3W01A 1TMQA 2PP3A 2P0IA 5ENLA 4YYFA 1TQXA 1NDYA 1PBGA 5LNUA 1XF0A 1QR7A 4HU4A 4W7WA 2DZXA 3AHTA 5CKSA 4BI5A 1JEZA 1FWIC 3WJWA 4MWAC 4XZBA 2X7WA 2YGYA 2PS2A 1EDGA 4EWJA 1DPMA 2FDMA 2BHUA 3ERPA 3ZJ8A 5D9MA 1PWMA 4F9JA 3UJ2A 1J5TA 5DCEA 2QAPA 3DAQA 3OVRA 2P0OA 2R1NA 3SN0A 2DY3A 1AJZA 2DW7A 1P0EA 3VMOA 2D23A 1FWEC 3GHRA 4H8VA 1SM9A 1OGSA 2ZUTA 3RGTA 2A1YA 5BYWA 3FNDA 1EXBA 1LOSA 1HL2A 3BURA 3GFYA 4GQQA 4C6NA 5GNXA 3B8UA 4D8AA 1P6WA 1S3HA 5MF5A 3JS3A 4FF7A 3S8HA 4OV4A 4IJBA 1BYDA 3N14A 3PPFA 1FFRA 3QN3A 3HFYA 2V63A 3M7WA 1D2KA 1YDVA 1RY0A 1XLDA 2B81A 2QV4A 3G8EA 3TN3A 1GJUA 3UNDA 4MY8A 2PZNA 2PDYA 2UWFA 3UXAA 2QYGA 3GAKA 4ZVJA 1H2JA 2VEMA 4NXSA 4AZGA 4DO4A 4IPLA 3WG6A 2R1KA 3VK5A 1WOAA 2ACSA 3OVGA 4PMRA 4LYQA 1V7YA 1J18A 1S39A 1TTPA 4JTFA 2GJNA 4AY7A 2NQZA 5ABEA 1FP9A 2PWDA 1UMLA 3UGVA 3OZYA 4PB4A 2FGBA 3AAMA 5A2CA 4M6QA 1Q2RA 1UW9A 1DORA 1JR1A 3AIVA 4Z1YA 3FA4A 3DI0A 2IKGA 1XV8A 2OKOA 1CLKA 3W1QA 1BRLA 2F6XA 3S6DA 1MDLA 1E15A 1IR1A 3NXFA 2ZRVA 1YHTA 1FHUA 1G01A 4H9UA 5AC5A 1GG1A 3VD3A 4UWMA 3SIMA 3L0GA 1DJYA 3LTYA 1RA5A 1M7XA 4S39A 4H8HA 2QPXA 3VGGA 2JEQA 1PKNA 1Q6CA 2VMFA 3AS1A 4H8NA 2FH8A 4EANA 3TLLA 1J0YA 4KFPA 4ZCWA 2XISA 4ZXLA 2B7QA 3NAVA 3ZWSA 5LA1A 4J3XA 1HZYA 1KTBA 2OT0A 3WUBA 1R6WA 4UTFA 4KFNA 2ZX9A 5KEZA 3LPPA 1FVPA 1XDLA 2OGJA 3VO0A 5H1WA 2V5CA 1EC7A 4GVFA 1W1A1 2YYUA 4IG2A 4F79A 1H7NA 1L6WA 3C61A 4LC8A 2DH2A 4GYJA 3ZLHA 3N3MA 5K4XA 1M7PA 4GMEA 3CL6A 5DO8A 1VCGA 4XD6A 2BY3A 3AUOA 2XSBA 4J3VA 3C8FA 3CIWA 2EPMX 4HPGA 2X8RA 3P5ZA 4PA8A 2D3NA 4RE4A 4EKJA 2C8NA 3GR8A 5CPOA 5C70A 4LF1A 4RZBA 4C1NB 1NP2A 1R5YA 4UZSA 1FDJA 4ICNA 4F0KA 4N02A 3HU7A 1V3HA 3KCLA 3K1GA 4ZBCA 4B5WA 1LROA 1KFWA 1LL4A 3B05A 2XN0A 3O1NA 4HSHA 3VNMA 5HK4A 3BICA 3ZT6A 3EA1A 4FNUA 3SSJA 3SY8A 4A21A 4PUMA 3THDA 1UWAA 3WMCA 1NDVA 4K6AA 1K4HA 3LCGA 4YTRA 1J79A 4TVDA 1OABA 3CZEA 4IIHA 1AJ0A 4IPJA 1BKHA 2PDFA 2W27A 4MF4A 4O16A 3F4VA 3JVAA 3IUIA 3TJLA 5M3WA 3CNYA 2EKCA 4KWVA 4LBRA 1HO1A 2D73A 3A13A 1Q7ZA 3WNLA 4IIFA 2HS8A 1S2AA 2ISSA 4AC1X 5CPMA 2QUNA 1YADA 4MWAB 2ACUA 3T9PA 4WOQA 2ZZ5A 1G5AA 2DV0A 1NWRA 2VRKA 5A8GA 4O1DA 1QFEA 3TQ0A 2CKSA 2XSAA 3IK2A 7REQB 4LY4A 4GCXA 1Q65A 4GGBA 5EMUA 3AO0A 1Y65A 4LVBA 3LU2A 5ECVA 1KFCA 2W67A 1AQFA 1SMAA 3G0XA 4KT2A 3E0FA 1FHVA 2E28A 2CYGA 4AYSA 1D3CA 1C8VA 3TW9A 4Q4MA 2NSXA 5C9RA 1RPXA 3R8GA 5LYRA 3S5ZA 3QPZA 3NVDA 2VC6A 4PCNA 1ENUA 1KM2A 3IARA 3P81A 4JKLA 1B3ZA 1FWNA 2ZUSA 2GOKA 3VFCA 1C29A 3W2LA 3MPGA 4C7DA 4GI6A 4QRNA 4B5SA 2XM1A 1E6ZA 2IQ0A 4C6EA 1UQYA 4ZOEA 4UTTA 4NP7A 3DECA 1M6JA 1E4MM 3IAPA 4LUTB 1QAPA 5CGMA 2FZ9A 1ZJBA 4KWWA 1TPDA 3OJGA 4AEEA 5D2TA 4I7VA 1EDQA 1E1EA 1AODA 5IHSA 2OODA 5E93A 3TYDA 5KETA 2E40A 4U3AA 3WDQA 2HXTA 5H8PA 2YL8A 5GVJA 1M1BA 2P50A 2VZSA 4TV5A 4W86A 4JYFA 5C55A 1TV4A 4JOMA 1EYWA 4LGXA 2ISFA 4A22A 1VRDA 3L2IA 1GKRA 3V4BA 3FJNA 3ZVIA 2IPGA 4QSFA 3OOQA 2VVSA 2DSKA 2NQ9A 1W9VA 4MYXA 1JDAA 3DDMA 3CT7A 2V2CA 4GX8A 4ZOAA 2D2JA 1C8QA 2IQTA 3MHGA 3QSRA 4RDWA 4JTHA 1UZ4A 2YDQA 1ICPA 3ITTA 3GNOA 3TA9A 3K8MA 2AL2B 3P8IA 4C5YA 2PP1A 3RJYA 2W62A 1K7FA 3QHOA 4MMWA 1POKA 3FXYA 1OBAA 2J9XA 1VAHA 3PHAA 1KKRA 3LPOA 3T40A 3W22A 3TW7A 4XBSA 1FWFC 5EMYA 2PP0A 1YX1A 4MAVA 1BFNA 2Q6ZA 4B2DD 4DJFD 1O7AA 2Y2WA 4DBUA 1PHQA 3LM3A 1D8WA 5CBJA 8XIMA 2D2OA 2Z2UA 1TSIA 1EYEA 1KBBA 3MQTA 2NQHA 3OLGA 1ZSXA 1P0BA 2UY2A 3W7IA 3VKDA 5HMSA 1X1OA 1CENA 2NVCA 4H7CA 2DIJA 2Z1SA 5BMWA 4I5XA 4PB5A 1XLJA 1I45A 1LM1A 4KCVA 4L6OA 4W87A 4GQ0A 1W5QA 4Z2KA 4Q6XA 1FWHC 2JIEA 4X60A 1JRCA 3IIXA 1VZWA 1H3GA 4G9PA 4NT0A 3T44A 5M2FX 4IQJA 2GUUA 2RDWA 4L64A 4G1NA 3H4GA 2PGEA 4NL1A 2OYKA 3BLPX 3IWPA 4LUSB 2XSXA 3V35A 2ZRXA 4NAFB 1XPGA 4LB4A 2QJJA 4H7ZA 3STFA 4TVCA 4DM1A 5EFDA 4S38A 4GO9A 1VGAA 3NGFA 1YBQA 2WAGA 2Q8XA 4Z1AA 4CQ9A 1GHRA 4I8DA 2DZTA 3NZ1A 1US3A 3P74A 3BV4A 3LD5A 3R1ZA 3H2EA 4DJDD 1M9HA 3LGEA 3UF9A 5HNUA 3NM1A 3MV01 4OBRA 3MJMA 2IKJA 1IZJA 4MB4A 1YDNA 3A3WA 1A5LC 5FCZA 1F07A 2ATMA 3SECA 4NAEB 4F0HA 3EWDA 4G1KA 3VMNA 3Q94A 1SFTA 5FEWA 3H4WA 1NOUA 3GY1A 1XBYA 2UY4A 3UG4A 3KVMA 1KGWA 1PDZA 3IJ8A 3NYZA 1RCXB 4IGSA 3MSRA 3CEUA 4ZODA 1M7JA 3HG2A 2IW0A 3WNMA 4PN2A 5IXEA 1AW1A 3E2RA 3R0UA 3NOEA 4C6CA 1TX0A 3EAUA 1LBLA 3LCLA 2CHOA 3VNDA 4S3JA 4C6QA 1UUMA 3S9YA 3IRDA 4AWEA 1TPC1 4TX6A 3HMCA 2XIOA 4XSLA 3SRHA 4XAYA 1EZWA 4ZQOA 1F73A 3DFNA 1GQLA 3EB2A 4OQVA 4FF5A 4Q7BA 4FPSA 1UWRA 1F2JA 1ISYA 1XCWA 3NPWA 5BOEA 4DZAA 3OGRA 3CQJA 1I6NA 3UR8A 1OCQA 3ATYA 1ZENA 2E8YA 4NILA 4HPHA 3VDGA 1ESWA 1ZNNA 5D2VA 3KX6A 5EY5A 4MFDA 4UNKA 3QM3A 2WZHA 2WJZA 3RRXA 3M5VA 2XYLA 1EJWC 3GKAA 4HHHA 1OFBA 4DF2A 2E5DA 1RBOB 4IIGA 4ZENA 4HD5A 1GQNA 3BK0A 3G1AA 3GUGA 2JEPA 2YDAA 4EACA 2YW3A 1SJCA 3FEQA 1XR2A 4PCSA 1EO7A 1R7AA 5I3JA 2OO0A 1FQ0A 2UY5A 2HBXA 3CQHA 1ISVA 1NJJA 4HK6A 3NWRA 2WMFA 4M1RA 4LCRA 3N2MA 3NM3A 3BG9A 2Z1BA 3NSMA 2QIIA 3B0YA 2WCAA 3C0SA 3CH9A 3AWOA 3TIMA 2AQVA 3PG8A 1UQZA 3N19B 4C6OA 4D71A 3GK0A 1EGZA 1VH7A 3R4IA 2P3EA 1OF6A 5AVHA 2AQWA 4HZ8A 5KZDA 1J01A 2VR4A 3R5EA 4XAFA 4G6CA 3RM4A 4QBXA 3V18A 2ZZ1A 5KMYA 1ML1A 3SURA 4WSKA 4UQAA 5FEXA 4RNJA 2ESCA 3RCNA 4M24A 4PC8A 3ZT7A 3T4CA 4F48A 2W6RA 2WOQA 3KRZA 3CMJA 3BAWA 1QNSA 1EA9C 1N8FA 2VM8A 1QPNA 5A8NA 3HG3A 3LCHA 3T78A 2DUXA 5L9FA 1MEHA 2WCSA 1JYNA 4GIAA 1XFBA 3EDFA 4V28A 4WGHA 3CZ8A 4R7OA 4IM4A 3JRKA 3HPAA 4D72A 4AC7C 1G94A 2NQJA 1X7IA 3MI3A 1RJQA 1HGWA 3I7QA 1GVOA 1A5KC 2QUTA 6XIAA 3O0FA 2IUZA 3VYLA 2VDGA 2QCGA 3BUVA 2PTXA 4Z17A 5FA5A 5CBBA 1PIGA 3GW0A 3FK4A 3ARZA 4HJFA 3MC5A 3TCSA 3AISA 4X61A 1UZHA 2RH9A 2BNJA 1R0MA 3WJXA 3WDIA 3RK8A 1KBKA 5FJRA 3VIGA 2ZE0A 4GXMA 5EMLA 3WN6A 3NR0A 1J4EA 1JZ8A 4NZ4A 1L6SA 5I06A 1LZOA 3CV1A 1GQIA 4R34A 1LQ0A 4PBGA 1ONWA 4H41A 1JD7A 2VUNA 1SR9A 2X1TA 2D0GA 3FJLA 4IGNA 5M5DA 4JY9A 1F4AA 5I24A 4O0ZA 2L5HA 3EPOA 2XH0A 4JYEA 5BROA 2QCNA 1OINA 1L8NA 4K8EA 4XZHA 3NQBA 1KCLA 3MB9A 1IT0A 3WLQA 1CXIA 4Z1CA 3VAVA 4O15A 1V51A 2YZRA 3I4KA 4QLKA 2J4GA 3G1XA 2D20A 4TTGA 1XBVA 4MUZA 2XDFA 3TC3A 1E3ZA 4MJ4A 4A2SA 2J9ZA 1IXQA 1K7XA 3LERA 1AL7A 2XTKA 4AEOA 2DDXA 1UIPA 2Y24A 4GYFA 4JL2A 1VJZA 1Q6EA 2VVNA 3AIBA 2YYTA 3GZAA 5AHLA 4DB7A 2CFFA 5HNTA 4GZ7A 3I3DA 4XVDA 3VGEA 3VABA 3VD5A 4BFAA 2ZE3A 4RL3A 3NIYA 3IIOA 4JEJA 4WLCA 3L4YA 4K37A 1X39A 3VA8A 2OELA 3NQ8A 1EPXA 3WENA 1TJ1A 4WKAA 5D9NA 2I1OA 1CYGA 2Y63A 2VURA 3AXMA 3D3FA 4ADUA 5KITA 4JGDA 1XQLA 3TNBA 1N2VA 3RYSA 4H9MA 2XUCA 4O4WA 3EBVA 2FTYA 4L9YA 4MNLA 2F6UA 5AYXA 1XS2A 5FIPA 1TV3A 1Q63A 3D6NA 4IFKA 4DAIA 1ZAIA 3B4UA 3WSUA 3B8WA 3UXDA 4US5D 5CZTA 1Q7MA 3ZLFA 3TTSA 3A12A 2WNZA 1OCNA 4RV3A 1UC4A 4CCZA 4RDVA 4EOUA 1VFSA 2QIWA 3VUSA 4AYGA 3KDOA 5EPDA 1TE1A 3WBYA 2C79A 3ZVHA 6ALDA 2VP8A 5AYYA 3T0TA 4I8YA 2C0HA 2RAGA 1GTHA 3G1VA 1TUXA 2O9TA 4XZLX 4NF7A 5EA9A 1N7KA 4RW5A 2PPGA 1XW8A 4UIOA 1KNWA 4LAMA 1NWSA 1EB3A 3MBFA 1GOOA 2HS6A 1S5NA 1MI3A 3HPZA 3STEA 5C8BB 1J11A 4HIBA 3RM8A 1ITXA 3M0YA 4A8LA 1UUQA 2HV5A 2BGSA 5AC6A 3BMWA 4D1IA 1UPMB 2QCLA 4DWDA 1BYCA 4LWWA 3LN3A 1CGVA 1LTDA 2HNEA 1BGGA 1E72M 1VHCA 3EDJA 3QGVA 4GE8A 3PN8A 1XXXA 4YWSA 1R46A 3CZJA 1OEPA 4DBDA 5I2UA 2J8FA 1HJUA 2WMIA 1ITUA 3USBA 4DJDA 1Z8AA 3F4DA 2FHCA 1Y5WA 3MVIA 1DIOA 1JULA 4X3ZA 1S2TA 3TE9A 1E9IA 2E9LA 4OVXA 1ZAJA 2B7PA 1MMFA 3G5EA 5DT5A 2WWDA 1LLOA 4FNQA 1GYNA 7CGTA 4W84A 2UBPC 4J35A 3W2MA 4I5UA 4EPDC 1ZRQA 1I1WA 3U4AA 1A5MC 3NQMA 4GUFA 1H61A 3S1XA 2HPIA 1KW1A 3EEZA 3HOJA 1HL9A 2YBTA 5HMDA 3QSTA 3LXBA 5FEPA 5MKGB 4E2VA 3NL3A 3OB8A 3THAA 3W7JA 4XIMA 1RHCA 2GYIA 1GW1A 1KM3A 3MP4A 3ARUA 3SIZA 1OT1A 4O4VA 4N6FA 3WQCA 4LBUA 4IZGA 1B9BA 1Q7QA 4QAIA 4O8AA 1AZ2A 4W9TA 1CCWB 2Q71A 4O57A 3RAOA 2ZRUA 4Q8NA 3E0VA 3CUJA 3FAWA 5FL1A 3N4AA 3BL3A 3WQGA 2PTDA 3RR4A 1DXFA 2J24A 1FWRA 2ZUVA 3PWIA 1WDSA 3SN4A 5D03A 2E7FA 1W9UA 5IM51 3M64A 3DHDA 3ZJ7A 3GNDA 1X96A 4MKVA 3LG3A 4E2DA 5JMUA 3PWAA 4CVWA 3QV9A 1UJQA 4BF5A 1JNEA 1SUXA 3TYEA 4BQ5A 1UR1A 4HNLA 3IVSA 3VUPA 2JKEA 3P60A 1UH3A 5REQB 5CGTA 3O8AA 4Q7IA 2EO7A 4FLSA 1XIBA 3ZJKA 3G22A 5K9DA 4DI8A 1XKYA 3AUJA 4JTIA 3WNNA 3HN3A 4LRTA 2A2IA 1Z7AA 1GYLA 3WBAA 3AS3A 1F7BA 5FF2A 2XFWA 3W38A 2ZWYA 4Z08A 2QUVA 4UFHA 3VPLA 1OB0A 3F03K 3WQOA 2G8ZA 4EPBC 3N9RA 1O5KA 3TSBA 1SO3A 1XGDA 3CPRA 1OX4B 2O9PA 3KRBA 3E6EA 3OZMA 4O11A 3WMBA 5C6MA 4AQLA 2G3NA 1XYBA 4P8UA 2GGEA 3U8GA 3VOFA 1HJXA 4ZL1A 4ORIA 1MWOA 5FJOA 2AL1A 1EH9A 3NL2A 1MRQA 2HBVA 4LYKA 4F2UA 2VQTA 3IVTA 3N9SA 3UWWA 2C18A 2QPUA 4ICCX 4XZIA 1QT1A 2EHHA 2JGYA 1PZ2A 1OT2A 1DTUA 2W3ZA 1J9YA 3VOJA 4L4MA 4GY1A 4KGJA 3TCEA 1H5YA 3I7RA 3L5MA 4GC4A 2Y62A 2E5BA 1EWDA 1XRSA 1C9WA 3P7YA 4B3LA 2EJ1A 2G41A 3VXGA 3ZMRA 1PHWA 1XIGA 4CD6A 4AY8A 4L5ZA 2GK1A 4NRSA 1DEDA 5I3DA 3E0LA 3NPUA 1W3KA 3GVVA 4NNAA 2BOGX 3C3NA 4NZ3A 1UD5A 2ASHA 3I6EA 4PRWA 5AN7A 2NXHA 5CSUA 3W07A 1RK6A 1XP3A 1FA2A 2XH2A 3WF3A 1R9YA 4IX0A 3BARA 1EEPA 4WVXA 4IGHA 2ABBA 4I3GA 3VIFA 5HJYA 2QZRA 5DMLA 5DXYA 4QG8A 3QZ6A 3CQKA 3W70A 3BLLA 3K13A 4XD4A 2E6FA 1W8GA 5FKYA 1TCMA 3VNKA 3NSXA 3TQPA 2W5FA 3BG3A 4J3SA 1SVDA 2DJLA 1TX2A 3ZWTA 3LCIA 3WMLA 3WMSA 1A5BA 3LV5A 3GXIA 3LLXA 4D8LA 1TWZA 1B57A 3PZMA 1V3IA 2XH7A 5B7YA 1HX0A 3TQVA 2XIIA 2WQPA 4FK9A 3VI2A 3VD9A 2PF0A 1YPFA 1VPQA 3SI9A 2J7DA 3NQ6A 1BSIA 3SCTA 3IJ7A 1MXDA 3BXWA 1VQTA 3PSVA 4N9CA 1H7WA 4O28A 4X2RA 4HNTA 3HGSA 3S47A 1Q4NX 3N04A 1H0GA 2QXWA 4F2BA 3VTRA 2QEZA 2ZRWA 3PULA 1TV5A 5D4YA 1I9CB 4JFUA 4F4RA 5B7ZA 3SDOA 4R7WA 2O4MA 3V5FA 1T41A 4HQVA 3W1UA 1HP4A 1RXOB 1ELSA 2OGYA 1TPVA 4TXEA 4L9ZA 4DYEA 3B8DA 1S2WA 5TNVA 2PTYA 1LT8A 1MFVA 4B5TA 1G7VA 3CAKA 4FB7A 1PXGA 1QW7A 3QYQA 4IPNB 2XFYA 4GXPA 3KM8A 5LSMA 5AECA 3W1LA 1C92A 4M7SA 1GTEA 4FNTA 4WJXA 5CC7A 3R10A 4IMEA 4KBXA 3PZGA 4BEQA 2A6LA 3EOOA 1Y8BA 1NOWA 1OFRA 3F7JA 3H26A 1TIWA 4ZB0A 4JHZA 2ADAA 4CD4A 2VNCA 1B3YA 3N13A 1GOMA 1V02E 1FH7A 3GFZA 3WNPA 3BQ5A 2ODOA 1I2PA 2EQDA 2QDEA 1TR1A 2ABAA 3EEGA 3UYIA 3G3DA 2YBUA 3FSUA 2G96A 3W2JA 4P2VA 3OU8A 1PPIA 5C9UA 3IVUA 1OCJA 3L4TA 4J3WA 3FLUA 2Y5SA 5CC5A 3WLLA 7A3HA 2AKMA 1FRBA 3VE9A 2DZVA 4YVPA 3GC5A 1SPQA 2G37A 1JNDA 1PX8A 4ACZA 2VEGA 3M0LA 3QVQA 3GDRA 1QPOA 1X6LA 2EAWA 3R58A 3UG5A 3UXIA 1BQGA 3W27A 2VZTA 1IEWA 2R1MA 5A69A 1S2UA 4AVNA 2I9UA 5HQLA 1EZ2A 3CL7A 2VEFA 4MWAD 4REQB 1IGWA 3THCA 4GJJA 4ECLA 3GFXA 1X1ZA 2WLYA 1NARA 1WUFA 4GJIA 1HF6A 2IQDA 1QO5A 4IQEA 5C0QA 3UETA 5JH1A 4FIQA 3KEHA 2J78A 3QJAA 3B3DA 1M5WA 3BZGA 3DBNA 1H62A 5C7VA 4DO5A 1MEIA 1VENA 1W32A 2F7FA 2P76A 5CG7A 3WUGA 5I0DA 1XX1A 4WX2A 1GVYA 2DORA 3UJEA 3NZPA 2JBMA 3HJZA 4IMGA 1TELA 5BXTA 1VBUA 2PTZA 1RVKA 3AU2A 4WDWA 1ZJIA 4W8AA 4A3QA 4ZA0A 3RITA 4UTLA 3WQEA 3GM8A 3LUTA 1XQKA 1AMYA 2FIQA 4NZFA 1JCJA 1NVMA 4WJEA 3VMPA 4XV0A 1HL8A 1DWFM 2GDUA 3AZRA 3ENLA 4E2BA 4DZIA 5HWNA 2ZICA 3GDLA 1CB2A 4LRSA 9RUBA 1XYCA 5D09A 1QOXA 3QMSA 3W7KA 1BF2A 4TU1A 1FWBC 4GUJA 4NJHA 5G5IA 2FVLA 6ENLA 5HNNA 1XIEA 3NGJA 4R7JA 3CUXA 2Y5EA 2OU4A 5FJJA 2V81A 4DHGA 5CC6A