3PZIA

Structure of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1 in complex with beta-d-glucose
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila
total genus 154
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pziA00
4MB3A 1LWJA 3RM4A 5FIPA 2WLYA 2FHCA 1C92A 3M46A 1ZBKA 2BXYA 1CXFA 3GH7A 2W61A 1B1YA 1U2YA 3PZVA 1WP6A 3NJ3A 3RJXA 1CZ1A 1JYWA 4HPGA 1JXJA 1UWTA 3FAWA 1JI2A 3ZMRA 4P8UA 2J7CA 2VX5A 1H49A 4JFSA 3BC9A 4J3XA 1R86A 1C93A 3VD3A 3D3AA 4J7RA 3SCQA 2GJPA 4JFVA 3T0DA 1R85A 4PTVA 3MUZ1 1CTNA 1JGIA 2CHOA 1WDRA 2BHZA 3FNDA 3OLDA 1LG2A 3OGVA 4DM1A 5DFAA 1JZ7A 5AC4A 2WKLA 2YL8A 1B3WA 2VVNA 3B8SA 5A6SA 3W37A 1VIWA 1B9ZA 1NP2A 3L4WA 4IPNB 9CGTA 5EBAA 2FH8A 1W32A 3QHNA 1W3KA 3VIFA 4E8CA 2G8ZA 3PZTA 1QHOA 3WFZA 4JIEA 1Q6CA 2XWDA 2OLHA 3JUGA 3ZJ8A 1WKYA 4WKFA 2W5FA 2XHYA 2YJQA 4OJYA 2WYSA 3A3HA 3CZJA 2BXZA 4S3KA 1OM0A 3VDCA 3UCQA 5FKYA 3ECQA 4D6CA 3FHAA 2WVUA 2VRKA 3VDBA 4BQ4A 4RE2A 5DMYA 1NWUA 5E0CA 4FMVA 2V5CA 3TONA 4W8LA 1GOIA 4ZXLA 4D6IA 3WNLA 2EJ1A 4CCEA 5E9AA 5M17A 2WMIB 1GQKA 2VRJA 4AZCA 3VUPA 5D4YA 4W7VA 4X9YA 5I6SA 2IUZA 2ZX8A 4NF7A 1GW1A 5JIWA 1V6UA 4Z2KA 3AZSA 4F9JA 2ZX9A 1J10A 1BLIA 3AZRA 2ESCA 3ZR6A 2GDVA 1W9UA 2GJXB 3CUFA 4CVWA 4IPLA 4XX6A 3QHOA 3W0KA 2EEXA 4PRWA 4AD1A 4QLJA 3RCNA 4EANA 2CCRA 3OGRA 5DF0A 3LPFA 1MQRA 1E43A 3WDHA 4CD5A 1V03A 1VJZA 4MB4A 1MW0A 5CG0A 3POHA 4Q7NA 1I1XA 2A3HA 2XVNA 5CJ5A 3ZO9A 3CZKA 4LQ1A 1UOKA 4D6FA 2W4XA 1ZB5A 1MWOA 2Y8KA 2BS9A 1OGSA 1R87A 1K9EA 1CGUA 4GO9A 3WY1A 1WDSA 4CN4A 4MAVA 1ZBVA 5AY7A 4AISA 3VO0A 2BY3A 3ZM8A 5D9OA 1V6VA 1G1YA 1OWQA 1GVIA 2DEPA 1FHDA 2ZXQA 2WMGA 2A3EA 4LYPA 1LJYA 1E0XA 3BLKA 4MB5A 2PWHA 1CEOA 3VIGA 4C7FA 1FP8A 5E6ZA 3CH9A 5IFTA 3T09A 1FH9A 2PI6A 2GDUA 3K8LA 1JFHA 4LYQA 2D1ZA 2YLLA 4PYSA 5I0DA 3ARXA 2A3BA 4TVCA 4Z2IA 2FHFA 2ZUWA 4ZE5A 4UZSA 1HF6A 1GOMA 2DIJA 3UERA 4B9ZA 1KCLA 2XVLA 3L2MA 2YLAA 1EIBA 1JDDA 2G41A 1Y7VA 4UQCA 1NOWA 3B9AA 4J3TA 2GSJA 4YHEA 2BY1A 4D6GA 1JZ5A 3ZJ6A 3ZQ9A 3VTRA 1TZ7A 3VIHA 5HDRA 3ZT7A 4ZE4A 2VT0A 1NWTA 1V3KA 1PIGA 2CBIA 2XWEA 4JCMA 4HPHA 2XVGA 1WE5A 1E4LA 4X0VA 2BVDA 4HA4A 2W92A 4W5UA 3SCVA 1XRVA 1M53A 1BGGA 4CGTA 1DWHM 2X05A 3ALGA 2D0FA 1BTCA 4OBRA 3WDPP 2WANA 3IJ8A 3MSGA 1JNDA 3N04A 2WC7A 1E4IA 5JBFA 3NUKA 1UR2A 1HNYA 3K4AA 2J7EA 3T2OA 4V27A 2J78A 4F8XA 4CCDA 3BXWA 4JFUA 1W91A 2GVYA 1VF8A 4PUDA 3PZIA 1C8XA 3UG3A 5I77A 4AC1X 5FD0A 1VFMA 2FHBA 2CERA 1HXJA 2WMJA 1MQPA 2PBOA 3AOFA 3W4RA 1ITCA 3NIYA 4MJ4A 3OLEA 2DT2A 2Z1SA 4GO8A 4DWSB 3WDQA 1E1EA 1VEOA 2YL6A 5I78A 3FAXA 1QW9A 2YDQA 1TCMA 4YN5A 2B31A 3T0BA 1PX4A 4R27A 1C7TA 3MUY1 4TX6A 3ZJKA 2YA1A 4HMEA 1QHPA 1C8QA 1MFUA 1JD9A 2A3AA 1X6NA 3AYSA 2BY2A 5CSYA 5A8NA 1KXVA 5LYRA 4QCEA 1W1TA 1H09A 4PMXA 3APGA 5D8ZA 1QOXA 1J0ZA 1PAMA 3AHXA 1YQ2A 3SCUA 3ZIZA 3RM9A 1CGTA 4EAMA 1H3GA 1MW2A 1B30A 2EBNA 3DECA 4KWUA 2VC9A 3OG2A 3WD2A 3CMGA 2PWDA 5C8BB 4AZIA 3MUAA 1BG9A 2WSPA 1UUQA 3RM8A 1JZ6A 2EPLX 2VMFA 5BYWA 4E2OA 1AQHA 1OD8A 2WKGA 4OOZA 3W26A 3RMEA 4P8WA 4FLOA 4PMRA 1WPCA 3PZMA 2GUYA 2QV4A 4GIAA 3AMDA 4GKLA 2YA2A 2ZX6A 1JZ2A 4JFWA 1W9VA 1UQYA 2FGLA 2VUYA 3ARRA 3T2QA 1V3MA 4ACZA 4W87A 3N15A 1HJVA 2J62A 1GHRA 4C7DA 5LA0A 1MQQA 1JZ4A 1I1WA 3W81A 5E6YA 4MDPA 4XV0A 1V6XA 4IISA 2WZEA 1PZ2A 3SCPA 4NZCA 4TTUA 1UWIA 1NQ6A 2WNWA 2BNJA 1QNSA 4TX8A 2YBTA 4URIA 4TVDA 1U33A 3W27A 2VZSA 1TA3A 1W2PA 3PZOA 1CECA 1UD3A 3W6MA 2J7BA 2DT0A 4AEFA 3AJ7A 2XG9A 2VZOA 1VFOA 1X1NA 4NRRA 5JBEA 1HJWA 2X1IA 1US3A 1IT0A 2Y8VA 2BHYA 1MW1A 2CITA 1AQMA 2ZOXA 3CUJA 4HZ6A 4PMYA 1QPKA 4UFKA 5KZ6A 2JIWA 4W89A 2JF7A 1EOMA 3CHFA 3CZ8A 3GXFA 4J3WA 3SCTA 1UD5A 5D9PA 2ZXBA 1E5NA 1WNOA 4AD5A 1FP9A 3EMQA 1UD4A 5LA1A 2V3EA 3AICA 2GJRA 1YHTA 1GVYA 5ABGA 3WH5A 2J7FA 2YL5A 1V6YA 5A6JA 1OB0A 5CGMA 1DWIM 1GHSA 2WVTA 1JF5A 3MANA 2VX4A 2YDRA 1OIMA 2XFYA 4M29A 2ZUUA 2E0PA 3AZTA 1XCXA 1HN1A 3VIKA 3N9KA 5D9NA 4CD6A 3GNPA 1MVYA 4ZEPA 1E40A 1OIFA 1E6SM 3U5YA 1F4AA 4ZXOA 1O7AA 3KL0A 1DWGM 2OYLA 2VCAA 1JYVA 1KQZA 1FFRA 3WF4A 1M03A 3TTOA 3QR3A 1IZJA 2HVMA 5CSUA 2WMHA 1HJUA 1K9DA 2WHLA 3AFBA 3F4VA 4MB1A 2QLYA 4MNLA 2CKSA 2ZUSA 3EDKA 1J0YA 3AYRA 2WVVA 3WEZA 4KH2A 1E6PA 3NDYA 4P7RA 2FGZA 4CU6A 2D24A 2VZVA 4LXFA 1GZJA 4U3CA 3RJYA 3M6DA 1CXKA 4UNIA 2XUCA 3EBVA 1QBBA 2WSKA 3BAIA 4N0RA 1ZU8A 3MV11 3FXYA 2E8YA 4D71A 3EDDA 2XFFA 1EH9A 2DSKA 3T2PA 5A95A 1XSKA 3VD4A 5M3WA 4AZ6A 3ARTA 4AW7A 1GJWA 4UCFA 1KXQA 3CHEA 6CGTA 1UR1A 3LPOA 1ISVA 4TTGA 3VKKA 1ISYA 3RILA 3EDEA 5DEZA 1NP0A 4U5KA 4TUFA 1V3IA 2XM2A 2QHAA 1Q6EA 3ZOAA 1HJSA 2EPNA 3AS3A 2DT3A 3WH7A 1QNPA 2W66A 1EXPA 3WF1A 1JI1A 2EXOA 4JHZA 1E9LA 4F9DA 4ATWA 3ARWA 1NH6A 3POCA 4PTXA 4OIFA 4B3LA 4L4PA 2G3NA 3CZLA 2WC4A 4U31A 1E6ZA 2ZWYA 2PWGA 3TTQA 1WB0A 2ZUNA 2EPOA 5HOSA 3GDBA 3WNPA 2NW0A 5BRQA 4B16A 5CZKA 1G0CA 2CETA 2WCGA 4HTYA 1E6NA 3DYOA 3RDKA 1HX0A 1PIFA 5CPQA 3GBDA 3BH4A 1A3HA 1D2KA 4JHOA 2EPMX 2HISA 1E6RA 1KCKA 1ISXA 3D5HA 4PN2A 2DSZA 4MADA 3WDRA 2W63A 5A6AA 4U5IA 3A47A 4QLLA 2C7FA 4H8UA 3U7BA 4ZFMA 4EK7A 3O9NA 5I79A 1W3JA 3AXHA 5CPTA 3SIMA 3G6LA 4AD4A 2Y5EA 1UH3A 1V0NA 4MAZA 3VGEA 2UY5A 1UH4A 4PCSA 4W86A 1WZKA 1LQ0A 3MKKA 2DT1A 2FH6A 2VL4A 1BHGA 1MXGA 3MU7A 2UY3A 1V3HA 3KEHA 4D1JA 2D0HA 4AZ5A 1QW8A 2J8FA 6TAAA 5AYBA 1W1PA 3IAQA 3ARUA 4XZBA 4UFIA 5C71A 2RGLA 4B15A 3K8MA 1GONA 3NYDA 1TE1A 4U2YA 2ZICA 3FW6A 3WNKA 2PWEA 3EMZA 1JYNA 3EDJA 4E4PA 2YA0A 4UFHA 2JE8A 2XGIA 1ECEA 5BWFA 4P8XA 1U30A 2VJXA 2W91A 3PHAA 4HMDA 4AXNA 4QCFA 1XV8A 2CBUA 2C8NA 3WQ8A 1S46A 3L4XA 1HIZA 4PCTA 3N17A 2MANA 3VX0A 4M56A 8CGTA 1EHAA 1DTUA 2E3ZA 3BGAA 1DWFM 4U33A 3CIVA 4M81A 1CWYA 3IAPA 3AS0A 3GZAA 2Q8XA 2VNCA 1JL8A 1Z32X 5BCAA 2E8ZA 1ESWA 3WF0A 3WL1A 1CGWA 2F2HA 1WZAA 4BF7A 4F66A 2X2YA 1UZ1A 5A8QA 1UD6A 3DYPA 1UD8A 5M03A 3SCNA 1DWAM 3IK2A 3AMKA 2PC8A 4Q22A 3CHCA 3W28A 1SYTA 4HA1A 1B31A 4J3SA 4ACZB 4UOZA 4BA0A 4PSRA 5EB8A 3L2LA 2JFEX 4AIEA 1GQLA 1HT6A 3ZJ7A 2OWWA 3BAKA 3AROA 1ISZA 3TOPA 1JDAA 5A6LA 1C90A 4WJXA 1H2JA 4LX4A 4AD0A 4GQRA 1GPFA 3SUVA 2XSAA 3AIEA 1CGXA 2VQUA 3WF2A 5A2BA 1UG6A 1E0VA 4D6EA 4HU0A 5I5RA 4UQDA 1QNQA 1FH7A 4AZBA 2UY2A 2XM1A 4MDOA 2BFGA 4AY1A 4HP5A 3TP4A 1V02A 1E3ZA 4HOZA 1L8NA 2IXVA 2WZIA 4MJ2A 2O9OA 1B3ZA 3GH4A 3S2CA 1HKKA 1XH1A 4WIWA 1CGVA 2DDXA 3A4XA 4AZHA 5ECUA 3GNRA 4P7QA 1XSIA 3AHZA 4JFTA 2O9RA 1ZBCA 2XVKA 4H2CA 3SCWA 2VZTA 3IANA 2NT0A 3AQUA 3OLIA 1W3LA 1E73M 3SEPA 3OB8A 4NI3A 4UQ9A 1KGWA 1PX3A 3ARZA 3THCA 3L4TA 1NM9A 1VEMA 5A1AA 5I24A 3AS1A 3VDAA 1TMQA 2VTFA 4JKKA 1BG4A 1NWSA 4XZWA 2GK1A 4J28A 2QPUA 2J74A 1LF1A 3TTSA 3F5KA 4HA3A 5A69A 4CCCA 1KBKA 2CESA 2DPEA 3T0AA 1UD2A 2PWFA 2WHJA 4DUVA 1CXHA 5CGTA 1MYRA 2J7HA 3AIQA 5F7UA 2XYLA 3A4AA 3W24A 4UFMA 3VX1A 3MSDA 1DWJM 2ZWZA 1EDGA 5E0FA 5A3HA 3WQWA 5BXSA 1RH9A 3II1A 1TVNA 3WL0A 1CIUA 3LMYA 3W82A 3PTMA 1XGZA 4XB3A 2PF0A 3WSUA 4BQ2A 5D8WA 3F5JA 2X0HA 3A6OA 1W2VA 3GM8A 1VFUA 1VFFA 4W7WA 1BGAA 3WD1A 1O6IA 2V3FA 2BHUA 1CGYA 1M04A 2J4GA 2WVVB 3GYCA 3BAJA 1BF2A 1G94A 1HJQA 2FDMA 4OUEA 2X0YA 4B3KA 5CLWA 5FCZA 2AMGA 1OCQA 5ABFA 5CLTA 2PB1A 1US2A 1WZMA 1UYQA 1EDTA 2V5DA 4M1RA 1E15A 4YPJA 3VD7A 1FFQA 3AMCA 3WEOA 1BQCA 1HVQA 4QLKA 4ZENA 3DHUA 3VD5A 3AMLA 2XIBA 6A3HA 1KWKA 5AYIA 4PUEA 2DH2A 1H0GA 1UR0A 1EDQA 5HXMA 2J79A 4W88A 4DM2A 1IV8A 1RD6A 1CXIA 2OSYA 2VOTA 1Q6GA 1E6XM 4HMCA 2QPSA 4FLSA 4UTFA 3L4ZA 3ZR5A 3GNOA 3KL3A 8A3HA 3UEQA 3VGGA 3LPGA 2JEPA 3OLGA 1TR1A 3VIJA 3WFLA 4MPKA 4TVUA 4GI8A 1EO7A 4H41A 5GNXA 3UETA 2F61A 1HVXA 4BZYA 1OSEA 4M24A 2E9MA 3VINA 1KR1A 3AI0A 1NWRA 1CYGA 2UWFA 4Y7EA 4FLQA 1E72M 1JDCA 3CLWA 2X8RA 3EYPA 3I3DA 3WQ4A 1W9DM 4PTMA 5TD4A 5A94A 1TVPA 4GZJA 4PMZA 1TG7A 1WZLA 3IJ9A 3LPPA 2WZHA 1XYFA 4KRTA 4AIUA 7TAAA 2XPKA 4JKMA 1GOKA 2DSWA 1JF6A 1VB9A 3QGVA 5IDIA 1MW3A 4J27A 3WD3A 3OGSA 5DT7A 1R8LA 5GNYA 1BYCA 3WUGA 3N13A 3L4YA 3E1F1 2DSUA 2E4TA 1GOOA 3KZSA 1LWHA 2G4FA 3WD0A 3WQ6A 3OIHA 1CXEA 1X6LA 3PBGA 3TTYA 5DT5A 3WH9A 5E70A 3WNMA 2WPGA 1B3XA 2D2OA 1B90A 2ZUTA 2VO5A 1LG1A 5BXTA 2CHNA 1E1FA 4WLCA 1PJ9A 3NCOA 5D9MA 1V02E 1HP4A 4MNKA 1JXKA 3BCFA 1CBGA 1XSJA 1UR4A 3WDIA 4H8VA 4J3VA 1E5JA 4S3JA 3UR8A 4A3YA 2OYMA 4AZCB 2YDSA 3PZGA 2AOSA 4BS0A 5KEZA 4F79A 3WF3A 3I3EA 2J7DA 2WCSA 1J12A 3SUWA 5FL0A 1HKIA 2J25A 1H4PA 1JFXA 3VMPA 4OZOA 5CQ1A 2CKRA 2WW5A 2ZE0A 1QI2A 3MUIA 1JNEA 3DHPA 1Q6FA 5EMYA 4D6HA 2XIIA 3CUGA 1VBUA 2O9PA 4GZIA 3PZNA 2V3DA 4BCEA 3AIUA 2YIHA 4UOQA 4DWSA 1BYBA 4A3HA 2WHKA 4HU8A 4JL2A 4AD3A 4DUXA 2CBVA 4GQQA 1EHNA 4Z2GA 5HNNA 2VCBA 7CGTA 2QMJA 2DIEA 3WENA 3W53A 3NSNA 2QMKA 3CZGA 3K46A 1LLOA 4AD2A 1KBBA 1PPIA 3WUBA 4W8BA 3VGFA 2EQDA 2EPKX 2WLZA 4AWEA 2O92A 5AC5A 2BVTA 4M82A 3RO8A 4PBGA 3L4UA 4UR9A 2XGBA 1QNRA 3BMVA 3GXIA 4GZEA 1R7AA 4IUGA 1XD0A 1H1NA 2VRQA 1HP5A 4P8VA 2OWCA 5CPSA 1BVNP 2XSBA 7A3HA 3VDHA 1UKOA 1ITXA 1WDPA 3GXMA 3WEMA 5HPOA 1CDGA 3O6AA 3VNZA 1ZJAA 4ML4A 3K1DA 4FLRA 1HL9A 4X0NA 2A3CA 3QHMA 5EFDA 4LYRA 1ODUA 1EO5A 2VQTA 3AIVA 1V3JA 4W84A 1J0IA 3VM5A 5FOOA 1VRXA 2WM0A 4WSJA 1UA7A 2D20A 2NT1A 4D1IA 3BCDA 1KR0A 1KGXA 4GXPA 1AVAA 2GFTA 2Y2WA 4CUCA 3U57A 3WDJA 4H04A 1GQIA 3ARVA 1UZ4A 3VGBA 1PBGA 1EA9C 3MMDA 4V2XA 1DHKA 3FHQA 2WAGA 3ARSA 3W25A 3PN8A 1FHLA 4CKQA 1J9YA 3CO4A 3VGHA 1OD0A 1UKSA 4L4OA 1H41A 4KGLA 1BYAA 2ZIDA 1XH2A 3IJ7A 4EKJA 5BROA 2CEQA 4WF7A 1UKQA 4HOXA 4E8DA 5GQBA 4AEEA 3BMWA 1QI4A 1WCGA 2GK1B 4CU8A 4EE9A 4W85A 2OYKA 1CXLA 2G3JA 3PZ9A 2AAAA 3AIWA 3CGTA 3NSMA 4QP0A 2ZXDA 2W62A 3NSXA 1QBAA 4CD8A 2D0GA 4PMQA 4RE3A 4H8HA 3NDZA 4PMDA 3PTKA 5A2AA 2D3LA 1W9PA 1J18A 1W3HA 3UG4A 1WAWA 1ZS2A 5A2CA 2BV9A 4RE4A 3RIKA 3ARQA 1M7XA 1NOFA 3VD9A 3VIOA 2WC3A 1LL4A 4IM4A 4AZGA 1JZ3A 5BXRA 3WQ5A 2XVPA 4CN6A 1E3XA 1UA3A 4GPNA 1V0MA 3MMWA 3WQVA 1B3VA 4HOWA 4BQ5A 4H7VA 4WKHA 1D7FA 1E4NA 1GNXA 4JZ5A 1KFWA 4QDMA 3ZSSA 3AXIA 1NOUA 5ABFB 1XH0A 1GORA 2VX6A 5E09A 1FA2A 3A4WA 4FF5A 4UFLA 1LL6A 1G01A 3ARYA 1JAKA 1E70M 3VM7A 3KL5A 1V0LA 1QI3A 4TXEA 1WO2A 4XUYA 1F4HA 1VENA 2O9TA 2YOCA 3U7VA 1MFVA 1DEDA 3B9DA 1E0WA 5ABEA 1Q4NX 4AYSA 5A6KA 3VIPA 2YL9A 1ZBWA 3K8KA 4MNJA 1CLXA 3WH8A 1J0JA 2ZUMA 3CZEA 2ZXAA 1CLVA 3VIIA 2UY4A 1H5VA 5LA2A 4P7NA 4D6DA 3SUSA 5JUVA 1A47A 1B2YA 3WMCA 1E6QM 3OA5A 1JG9A 2YBUA 3WD4A 4NRSA 2XFRA 3VPLA 1LL7A 4UZUA 1C3FA 3N18A 3B9EA 3FY1A 3U5UA 5IFPA 3VIMA 3I3BA 1KQYA 4RL3A 3SUTA 5EFFA 2WMKA 3ZT5A 2E40A 4ACYA 1OINA 2X09A 3DC0A 1OBAA 1TA3B 2DSVA 3SURA 1W1VA 3WUFA 2WCAA 4P7LA 4A4AA 5I3DA 3AHYA 4PSPA 4V28A 4TOQA 1IZKA 1M01A 3J7HA 2Y4SA 1GOWA 2WXDM 3CHDA 3QOMA 3VVGA 2CYGA 2V38A 5A6MA 1UKTA 2CPUA 2WBGA 1RP9A 3RPMA 1OT1A 1C8YA 1K9FA 2NSXA 1P6WA 1SMAA 1C7SA 1WDQA 5DO8A 1EOKA 1K6AA 1MXDA 4CD4A 1E55A 2CIPA 4UQEA 3SCSA 3GTNA 1OGBA 5A8OA 5BRPA 1UKPA 2QF8A 4W93A 4JCLA 1B3YA 2D3NA 3PZUA 4JKLA 3EDFA 2OWXA 2RGMA 1HL8A 1VAHA 2J47A 3VNYA 3SUUA 1G5AA 4AZ7A 2VR4A 3N11A 2EO7A 2VR5A 1CPUA 1FH8A 1FOBA 4N42A 4Z2HA 2W67A 2OSXA 4P7OA 1ODZA 4JL1A 4UQAA 1SMDA 2VCCA 2E9LA 1C91A 3WNNA 3DYMA 1HKJA 2IXUA 4D72A 3ALFA 3K4DA 4DWSD 3TA9A 4LGXA 1KB3A 3GH5A 5HPCA 1BPLB 4FK9A 3VU2A 1OT2A 2WMIA 2D23A 1EQCA 2VX7A 5GNZA 2JEQA 3T08A 4PTWA 3BSGA 3G6MA 1B0IA 1J01A 4CU7A 1BFNA 3CUIA 3HJEA 3GXDA 4DUWA 1QVBA 3OZOA 2WWCA 5JBDA 1XHGA 5IHSA 3EMCA 1JD7A 2GJXA 3AMGA 2CBJA 3N1AA 2C0HA 1OGGA 1XD1A 2DQXA 4CD7A 1UR9A 4YHGA 3ZT6A 4M80A 2XJ7A 5IXEA 2VURA 5A6BD 2BY0A 1UHVA 1PX8A 1W9XA 4PEEA 3VMNA 3WMBA 1XCWA 1GJUA 2D22A 3M07A 3SCOA 1VEPA 3BLPX 4D6JA 4HZ7A 2YKKA 2ZX7A 1PEZA 4R5EA 4AIOA 1KXHA 3BAYA 1TFVA 4PMVA 4KGJA 1Q6DA 3CPUA 4W8AA 3VILA 3WBEA 4AMCA 3THDA 2WMFA 4OKDA 1G9HA 1UWQA 1BYDA 2E9BA 4CN1A 2JALA 1VJSA 3VGDA 2JIEA 4UQBA 4GI9A 3O2LA 2PBGA 2V3GA 3UG5A 1DP0A 3AIBA 1I75A 1QHZA 5GPRA 5I2UA 4QFUA 1W1YA 4LPCA 4WKAA 1JAEA 1JIBA 2J77A 4NSBA 4PMUA 3KWXA 4QAWA 1XYZA 4BQ3A 3KE0A 1XC6A 1QNOA 4M8UA 1J0KA 4Z2JA 4PMOA 4U3AA 3UESA 2WHMA 4ATDA 1H11A 3OZPA 4JAWA 3VOCA 3AHTA 3AIRA 4C7GA 3W38A 3MMUA 4MTVA 1KWGA 3AISA 4DWSC 3BAWA 3CBWA 3OBAA 1VBRA 4HZ8A 1TUXA 1ZJBA 2JF6A 2ZX5A 2ZUVA 1V6WA 1RPKA 1BSIA 1H0IA 1ZL1A 1E71M 4B9YA 5A8MA 4J3UA 3ARPA 3PTQA 3SCRA 1J0HA 3AS2A 3BSHA 2BVYA 4WK9A 2CNCA 1EGZA 2Y24A 2VI0A 2Z1KA 1CNVA 2DH3A 3HMCA 3S6TA 5BXPA 4KMQA 4ATLA 2G3IA 2WVSA 2WB5A 3MV01 1KXTA 1N82A 5ABHA 5FL1A 1L0PA 1K9TA 2DGAA 1RP8A 3HU7A 4OOUA 1V0KA 1BAGA 4KRUA 4WSKA 3WKZA 1QI0A 3AXXA 3AHVA 3WIJA 2J75A 1GUVA 1UH2A 1ISWA 1JZ8A 1R7OA 2WK2A 1QI5A 3WBAA 4OBSA 3ZSTA 2VVSA 1NARA 5JIPA 1JYXA 1SR0A 3FN9A 5I23A 4CVUA 4GI6A 1GOQA 5CXPA 1EQPA 4K68A 2G3MA 4PMNA 3L4VA 1HJXA 4GINA 3W6LA 1SFSA 3WN6A 4UOJA 1E4MM 3BAXA 2J8GA 1V3LA 2TAAA 3F5LA 3UR7A 3WH6A 2VZUA 3QOKA 2CXGA 1V08A 1GQJA 1CENA 1AQ0A 1UWSA 3W29A 3CTTA 1D3CA 3WMSA 4W5ZA 1BVZA 3CMJA 2OSWA 3WNOA 1AMYA 2J7GA 1UWRA 4MNMA 3WUEA 1UR8A 1UWUA 3CUHA 4U2ZA 3MS8A 4W7UA 5HBFA 1GCYA 1PZ3A 2F8QA 3M7SA 3HN3A 5C70A 1J11A 5A8PA 3MO4A 1HKMA 2WWDA 1W9BM 3PZQA 4Z2LA 1KGUA 5IHRA 1UQZA 3N12A 1E56A 5M5DA 2XTKA 5A6BA 3WELA 2WBKA 3VMOA 3GBEA 4UFJA
chains in the Genus database with same CATH superfamily
1LWJA 4GY0A 3NFUA 3IACA 4O1BA 1C92A 2BXYA 3GH7A 2Z1VA 3V5CA 3GFXA 3NWRA 1CZ1A 4JHMA 3A64A 4JTIA 1F3TA 3DH7A 3Q4DA 3NQ7A 1MI3A 3ZMRA 4NAEA 4TO8A 1AW2A 2CLPA 4FS9A 5J5DA 4YTRA 1DJXA 3RFAA 2GDQA 5C9ZA 3VD3A 1QK0A 4J7RA 3SCQA 4H9YA 3T0DA 3O06A 1ZAHA 3UCDA 2PEVA 3TR2A 3O1NA 1W8SA 3L0KA 1XC4A 2P1FA 3OLDA 3OGVA 1F8IA 4PR4A 1CB7B 4DZIA 1JZ7A 1WYIA 2VVNA 4DJEA 3B8SA 1B9ZA 3L4WA 4IPNB 3GTIA 3GDTA 3UWYA 3E6EA 3SSZA 3QHNA 1JRCA 3NQ8A 1KNWA 3WLJA 4B4HA 3NAVA 3WFZA 2ZZ5A 3GXTA 3MCNA 4HNVA 2XWDA 3DHDA 3GDMA 4NJJA 2PDNA 2V5LA 4M6PA 3M0YA 4XAGA 4LJ3A 2YB1A 3S2MA 2HSAA 2YJQA 3A3HA 2D2HA 4KKXA 4NX0A 4INFA 2E1WA 3VDCA 3UCQA 5FKYA 3FHAA 2WVUA 1UP2A 1FWBC 4K8GA 5E0CA 2AAMA 1YDOA 3CPRA 3AXKA 2Y1HA 1GOIA 4ZXLA 1EEXA 3IJLA 4OVXA 5E9AA 1PSCA 4I8YA 2VRJA 1RY8A 2ACUA 5HNTA 1EJSC 1YXYA 2V67A 4LOCA 2IUZA 1RJPA 2HXTA 4GJIA 2ZX8A 1M3UA 3RGTA 3KP1A 1O60A 2VD8A 5E93A 3VCCA 3R12A 3T44A 4F9JA 1FWNA 2ZX9A 3W84A 1BLIA 5F2MA 1BEUA 1W9UA 4BI6A 3CUFA 4RDVA 3W0KA 3K13A 4PRWA 4UTTA 3KRBA 1I60A 4NYYA 4DZHA 3OGRA 2VEKA 4Z1YA 1ZJIA 4IXHA 4ZOAA 3SY5A 3FDGA 4AFYA 3DGBA 5AZ0A 3P2VA 1VJZA 4UC5A 2OU4A 2WSQA 3RN6A 3POHA 4Q7NA 4B5WA 2XVNA 1H7NA 1GEHA 1UOKA 4D6FA 1M7OA 2W4XA 2BS9A 1J6PA 1OGSA 1UZHA 4L6OA 1CGUA 3WY1A 4A8NA 4AISA 3M5YA 2ACRA 4GFIA 5C2XA 1DJNA 1V6VA 4K3ZA 4WGHA 4HYWA 1FHDA 2ZDSA 2ASHA 1GVQA 4DY1A 2ANUA 2WMGA 2A3EA 3B0VC 5AZ1A 3UJ2A 4PGLA 3N2OA 4KWOA 1CEOA 4GUJA 4KPLA 2P3EA 1A5KC 5CZJA 4EOUA 1B9BA 4GE8A 5E6ZA 3T09A 2EKGA 1TTPA 1VZWA 4PYSA 5KTLA 5U4NA 1AQFA 4TVCA 4Y96A 1S5NA 3UERA 4P5UA 1KCLA 4L65A 2YLAA 1NDWA 5CZTA 4LU0A 2G41A 1Y7VA 1RAKA 3MVIA 4HK5A 1JCJA 3VTRA 3W7LA 4QEHA 3VIHA 4FXFA 1J8VA 1XG3A 2CBIA 1OX6A 1WE5A 4JTDA 3QV7A 1UOZA 3QY8A 3Q45A 1T96A 4AIBA 4DBUA 4ZOCA 2PDXA 4PUKA 1JRBA 2POTA 4CGTA 1DWHM 1AUSL 4GNJA 4NZFA 1GVFA 3E5PA 4Y8FA 2Q6ZA 3ABXA 2A4AA 3W87A 4WZHA 4MLRA 1W54A 4ONVA 2YSWA 3ANVA 3ID7A 2WANA 1WUEA 2QKFA 3IJ8A 4BY3A 2J7EA 5F2LA 3BXWA 2GVYA 4PUDA 4C6FA 4Q7IA 4PC8A 3COTA 1VRDA 1FWEC 2EKCA 4UNLA 1VFMA 2FHBA 1XUZA 4ZSTA 1VH7A 4IWWA 3BURA 3NIYA 2O56A 3NZPA 1KFCA 4JTCA 4ZGYA 4GO8A 1W3IA 2Y88A 3GU1A 2Y7GA 1E1EA 2YL6A 3FAXA 1TCMA 2B31A 3T0BA 2PDPA 1I8JA 3QV8A 1K7EA 4R27A 1SUXA 3ZJKA 4HMEA 3V0SA 4TU1A 1C8QA 1U5JA 4FIRA 5D2TA 5G2IA 5T8GA 3BGJA 2O4QA 1GKRA 5LYRA 1ITQA 4PMXA 3APGA 5D8ZA 1J0ZA 1I6NA 3N34A 3VZXA 4LCQA 3ZIZA 2EBNA 2VC9A 3WD2A 5C8BB 3HV9A 3MUAA 5HK4A 3UBPC 2PLKA 4E5TA 3UXLA 2VMFA 1OK6A 4PFMA 3I4KA 4E2OA 2CU0A 1AQHA 1E51A 3W26A 2FPYA 1XXXA 3Q65A 1DVJA 2ZBTA 4YIWA 4GKLA 2OO0A 3S2JA 1W6TA 3NM1A 4CQDA 2VHLA 2NQZA 1PDYA 3ARRA 3GTHA 3G3DA 1KM6A 1GZ1A 3GHRA 4C7DA 2LLEA 3U8GA 4AU0A 4D9PA 4Q6XA 4UR8A 1DYSA 1TPFA 4O1AA 4IOTA 4IISA 5HR6A 1PZ2A 4Q6JA 2IW0A 2IQDA 3GR7A 1YIXA 1FWFC 6ALDA 2TODA 2WNWA 4IMAA 3L12A 1QW7A 2GYIA 1GGOA 1XINA 2YBTA 4TVDA 4NJKA 2XINA 1QNVA 1U33A 3TC3A 3W27A 3I7QA 3BTNA 2RJHA 2J7BA 1T99A 1XIFA 4AEFA 4TMCA 1VFOA 2RH9A 4E2BA 1HJWA 1NSJA 4FEZA 4HMNA 1E9YB 4ZOBA 1AQMA 2ZOXA 1QPKA 3MBDA 2J13A 4XKYB 1NDYA 2CLEA 3B8IA 3I65A 1AJ0A 1O5RA 3T1GA 2D2GA 1MSSA 4J3WA 2JGQA 1TX2A 1UD5A 3W7IA 2QAPA 3VK5A 2QT3A 4AD5A 1SZFA 3PPFA 4O52A 1UD4A 3EMQA 3AICA 3WH5A 2YL5A 2PRHA 5A6JA 3WQCA 3KBSA 4HCHA 3NQ2A 1HZYA 3MANA 3M6YA 4KFPA 3W2JA 2XFYA 3EOUA 3AZTA 4IL2A 2NXHA 1MVYA 1E40A 1P6CA 3CB3A 5IBXA 3F2BA 3OVRA 4ZXOA 3TQ0A 5MKGB 2PRMA 2DIKA 2WQPA 4C90A 1W5OA 2NUYA 2HVMA 5CSUA 4LSBA 3LYEA 1K9DA 3AFBA 3MW7A 4MNLA 4AH7A 1I0BA 4GABA 2YR1A 1R9XA 3ANUA 3AYRA 1K77A 3LHYA 3WEZA 1L6GA 4US5D 3NDYA 4CU6A 2VZVA 3IUDA 3MKVA 4A22A 4U3CA 3M6DA 2PC4A 3LTYA 3QQ0A 4FNRA 3ABQA 3BLOA 3LGEA 3BAIA 4OV9A 2GUBA 4N0RA 3UP8A 1ZU8A 2IPJA 4D71A 3EDDA 3B0PA 3EZ4A 4XISA 2Z1XA 3UZZA 3RNDA 5M3WA 6CGTA 3G1HA 1TV2A 3P80A 3PY2A 4IQEA 3VKKA 4X22A 4AVFA 3RILA 5T9CE 3H55A 4TUFA 4QR6A 4OBTA 1OZMA 1RPXA 2R1NA 2O55A 3T8QA 1HJSA 2P8CA 1I0DA 3WH7A 4JD4A 1QNPA 4QAIA 2QVNA 3UXIA 3W1PA 2EXOA 3HBLA 3IIZA 1OYBA 5EMMA 4FX6M 3LHVA 4F9DA 3ARWA 3BUVA 4PTXA 1PVNA 4OIFA 3C8NA 5REQB 4F0LA 3E12A 2EG8A 2ZWYA 2PWGA 7REQA 5HOSA 3W7PA 3OOQA 3WQGA 2QCCA 4N2YA 1W1A1 5BRQA 2ZRUA 1CX9A 1U83A 1E6NA 3RDKA 3H2MA 3GBDA 4KCTA 3V1HA 6REQA 1A4LA 1XR2A 3LZ5A 5BZAA 1P0EA 1AZ1A 2EPMX 2HBXA 4MG4A 3TZNA 3O0FA 2FB3A 3D5HA 3KRZA 4DN1A 1TCDA 4LUYA 4U5IA 3A47A 4XD3A 2C7FA 4H8UA 2P8BA 3KBWA 1TJ0A 7XIMA 1E0UA 1KM3A 3FYPA 3AXHA 3DIPA 3A24A 2E25A 4L1WA 1E1CA 3QF0A 1WZKA 1H50A 2BSLA 4G9PA 4MWAC 1GT8A 4AXKA 3L67A 3NM3A 3H7RA 1QW8A 5JH1A 1H1YA 2J8FA 5AYBA 3R58A 1W1PA 3EKLA 4RNHA 4JIIX 3BQ6A 3CQHA 5C71A 4B15A 2QIIA 1GONA 4IMFA 1TE1A 1J2BA 1VGAA 4U2YA 4JNZA 3FW6A 2P50A 3VOHA 1I2PA 4BK9A 1YNYA 4IJCA 3KS5A 2YA0A 1VPXA 2JE8A 4M0XA 2PMQA 2VJXA 3OQ8A 4HMDA 4AXNA 4BKNA 3OBKA 1OCJA 2CBUA 1WUFA 4FHAA 1L8PA 1MRAA 4FP1A 1S46A 2GGGA 1HIZA 3N17A 3QH2A 1K8YA 3VX0A 3M0LA 8CGTA 3L66A 1XISA 4U33A 5CAKA 3W70A 1RD5A 1CWYA 3TN3A 1X98A 1IXNA 4UMCA 1PO9A 1JL8A 1Z32X 4WX2A 4US5A 1EZWA 1EP1A 2YPIA 1CGWA 3GHUA 1DXIA 1KFBA 3R79A 4KW2A 2X2YA 1UZ1A 4G1NA 1UD6A 1HTIA 2PGFA 1DWAM 2PC8A 3G0XA 4IGNA 3W28A 4J3SA 2FZ9A 5LHEA 5F4SA 1SSDA 5LIKX 1EF2A 1W1ZA 4HIBA 1YYAA 3KBMA 4X2RA 3TOPA 5A6LA 3TZFA 4WJXA 4LX4A 4GQRA 4LNCA 4A6GA 3AIEA 3PULA 1CGXA 1PB0A 3WF2A 4IFOA 1PKMA 2OLSA 2OGYA 4PUNA 4MDOA 2BFGA 2W3ZA 1V02A 1E3ZA 2WZIA 1JR1A 1FHUA 1MZHA 3GH4A 3LCGA 1HKKA 4LC6A 3LQLA 2PLCA 3A4XA 4HCDA 1IEQA 4ZMGA 2ZDRA 4FNTA 5HANA 1TSIA 2OTDA 1XLHA 1TR9A 3IANA 1TE6A 1W3LA 1EX1A 3SEPA 3A23A 4NAFB 3QW3A 2G5WA 1IYXA 4OTKA 4QITA 1A5NC 2I5IA 1VEMA 4WHBA 1SGJA 2VTFA 3UYCA 4JKKA 4C5YA 1LF1A 1UUMA 7ODCA 1RA5A 1KBKA 3NQAA 1MYRA 1LBMA 1JQXA 5F7UA 1V51A 2XYLA 5F1VA 1TB3A 3VX1A 4GCXA 2ZWZA 1FCVA 1EDGA 5BXSA 1Q8JA 1A5LC 1C9DA 1CIUA 2OO6A 3LMYA 4YYCA 3FJ4A 3W82A 4XB3A 3L5AA 2ZA3A 4UTKA 4AVOA 4MSSA 4J40A 3IEBA 4H2HA 4JEJA 1R0MA 1QATA 2CZDA 1VPQA 3TMLA 1BGAA 3CQIA 3YPIA 4DRSA 1TTJA 1TPB1 1SJAA 1M04A 2WVVB 1SO3A 3W1XA 1LQ2A 3UPBA 1XIHA 4L6DA 4JBRA 2GQ3A 3G77A 4JIPA 1US2A 4UTWA 3SGUA 1EDTA 2V5DA 4XAFA 1E15A 4WDUA 4YPJA 3GX9A 3ITXA 1D8WA 1L6YA 3WEOA 4O0KA 3R0KA 3AMLA 4GYPC 1XLDA 6XIMA 1AG1O 2DH2A 3CL7A 5HXMA 2Y7EA 2J79A 3S1VA 3QKZA 1IV8A 1RD6A 4C6DA 5EMLA 3W7JA 1EA0A 5G2WA 4BWLC 4XSLA 3TX9A 5J04A 1Q6GA 2G96A 5G2HA 1Q5MA 1SZNA 4UTFA 3ZR5A 3LTSA 1Y5VA 1W3TA 3VGGA 2JEPA 4K6AA 4Q4RA 1TR1A 1Y0EA 2HQAA 3VIJA 4JTAA 4C65A 3LERA 1UP0A 2GVEA 4GI8A 1EO7A 3BJSA 2F61A 2E9MA 3VINA 1NWRA 1CYGA 1O5XA 2OVLA 5I07A 4FLQA 1JPDX 1BRLB 3CLWA 4E4UA 3EYPA 4QTGA 3REQB 3DAQA 1K3UA 4IX2A 1EPVA 1Y8BA 4PMZA 2HCVA 1WZLA 5M1TA 3B05A 1M7PA 4JTJA 2NXGA 4I90A 3GC2A 4AIUA 2XPKA 1GOKA 3P8JA 5DELA 4LAMA 4E8GA 3QBUA 4LRSA 4EWJA 5GNYA 3WUGA 3UU0A 1PXGA 3H2OA 3SJ3A 1V93A 1QDSA 3VAVA 3XINA 1DKWA 2VC6A 2NSOA 1CXEA 1G69A 3WLHA 2H9AA 1LOLA 3N6QA 3PUOA 3MHFA 4GK8A 1Q2SA 5LXEA 1LG1A 3W2KA 1E1FA 4WLCA 1SQ7A 4EWND 2ZZ6A 5D9MA 1HP4A 3FIGA 4MNKA 2Z24A 2XFWA 1E5JA 4S3JA 3BW4A 3UR8A 4DO4A 3ICJA 4AZCB 2YDSA 2V2DA 3URQA 3W1AA 2F2KA 3W6YA 4C6JA 3I7SA 4EP8C 3GXPA 1W1IE 1TV4A 2PAJA 3SUWA 5FL0A 4OZOA 2WW5A 2ZE0A 2QS8A 1TZZA 3IGXA 4X2PA 1Q6FA 4LEQA 2QDEA 2XIIA 3MZ2A 2OLAA 1NEYA 3U9IA 2O9PA 3KOFA 1KFLA 1KKOA 1UPMB 2PTYA 4BCEA 2YIHA 1AODA 3SY1A 4A3HA 4JL2A 2V2CA 3QSTA 1FUYA 1OCNA 2PLJA 4ZL1A 3WLRA 3H7VA 2Z00A 1O4UA 1KCXA 3DX5A 1RLDA 4LV9A 3CZGA 5FF7A 3K46A 4E6MA 3H6OA 4XIAA 4MUPA 4QSFA 2X40A 1DXEA 3WUBA 3VGFA 2EQDA 2WLZA 2O92A 1AW1A 4YTQA 4RPPA 4L1XA 4S3BA 2DZVA 3N3TA 1YPFA 4UR9A 3U2EA 1QNRA 3MDWA 1YRRA 1HP5A 2OWCA 5CPSA 4B90A 2FDSA 3G5EA 4LS2A 1UKOA 4HVXA 2CLLA 3S8HA 3RU8X 5G1MA 3O6AA 5I3KA 1A4MA 3UZYA 1BTMA 3HPXA 4R7OA 3NEHA 3QMRA 1HGWA 3QHMA 4Q32A 1EUAA 1PV8A 5K9CA 4Q4QA 2G0WA 2A6LA 4W84A 3VM5A 5FOOA 3C56A 1OFRA 1VRXA 4Q8OA 5DQPA 4C91A 4DF1A 2Z1WA 2WJEA 1Q66A 2NT1A 4D1IA 3BCDA 3PPGA 1AVAA 2GFTA 2Y2WA 4UTTC 4Z0SA 4LCSA 1GQIA 1UZ4A 1PBGA 1EA9C 4AWUA 3ARSA 3W25A 1V7AA 1ZY9A 2DZUA 3KVJA 1KRCC 4CKQA 3KDOA 2X1RA 4L4OA 1H41A 1BYAA 3O8AA 3BVJA 4EKJA 5BROA 4WF7A 1X38A 1PTAA 1QI4A 2GK1B 3E0VA 3W23A 4RX0A 2VC5A 3GD6A 4ZQPA 4CQBA 2G3JA 2A7RA 3GWQA 4O13A 1O5QA 1C8VA 2OEMA 4CD8A 2D0GA 4JXCA 3S42A 4JTTA 4H8HA 2Z29A 1W9PA 3UG4A 1WAWA 1ZS2A 5A2CA 2VDGA 2V5KA 3M4HA 2E6AA 2V63A 1NOFA 2I1OA 5G4HC 1LL4A 3CT2A 4FOKA 5BXRA 1XI3A 4ADSA 4WGXA 4YCPA 1E3XA 2QEZA 3N14A 3QW4B 3WQVA 4GPNA 4BQ5A 1HKVA 3H2CA 4Q4SA 1GNXA 3ZFHA 3KOWA 4QDMA 1KV5A 3ZSSA 2GPTA 5LIWX 1NOUA 2VX6A 4MFEA 5E09A 5T91A 4H8NA 1LL6A 5CGQA 4LUSB 3ARYA 3CH0A 3S9IA 1JAKA 1E70M 3CK5A 3KL5A 1XYLA 1Y5WA 3SQMA 1WO2A 4POCA 3R8RA 1FWGC 4KQNA 3WK3A 4H9UA 2UV8G 3MDUA 1MFVA 3SN4A 3B9DA 2O4MA 1E0WA 4JNYA 3JVAA 4AYSA 4JX5A 4JDBA 3BE7A 3SY8A 1JVNA 3OP2A 1CLVA 3HF3A 3CAVA 3ITCA 1Q3NA 3GVRA 3GNNA 2FLIA 3SUSA 3CM4A 1A47A 3W7QA 4QX4A 4XTIA 1VFTA 2PTXA 3OA5A 3HGOA 2XFRA 1LL7A 1RK6A 4UZUA 3GU9A 2XH0A 1C3FA 3TYEA 3B9EA 3U5UA 5IFPA 1HUVA 1QASA 3VIMA 2C1IA 1XBVA 3D6NA 3Q37A 1F07A 4ZQOA 3GY1A 3M5XA 1OBAA 3FGCA 4GNVA 4WDTA 2EGZA 4OWGA 4JGDA 3VNMA 4PEKA 5I3DA 3AHYA 2BOFX 3QZEA 4V28A 1EEPA 1IZKA 1PUDA 5REQA 4IMDA 3W7HA 2WXDM 5D04C 2V38A 3RAOA 4Z0JA 4LVAA 1RP9A 5M2FX 1OT1A 2C19A 2XN1A 1P6WA 1SMAA 4UMAA 3WJWA 3GG0A 3HMJG 2E7FA 2V69A 2AQOA 1E55A 3SCSA 3GTNA 5DMNA 3GNXA 3EGJA 1OGBA 4WY0B 3VZZA 4GYKA 4DNHA 3PWAA 5BRPA 3A5VA 2WSRA 1I45A 2D3NA 4B4FA 4JKLA 2OWXA 2RGMA 2J47A 3SUUA 1MNSA 4Z2HA 3OYXA 2OSXA 2VM8A 2PDYA 4M6UA 4TMBA 1HKJA 2IXUA 3T81A 1NY1A 1KB3A 5FJRA 2XH7A 3B9OA 4FK9A 4OFCA 3AC0A 3T08A 3T0CA 4PTWA 2C79A 3G6MA 1J01A 4CU7A 3IWPA 3HJEA 2OG9A 3JR2A 3SDOA 4DUWA 3S5ZA 4AHQA 2WWCA 4GMEA 2QUUA 1XHGA 4DUOA 1TPC1 1YTDA 1XD1A 2C0HA 4CD7A 4YHGA 4O17A 2XJ7A 1EC7A 5HATA 2Q71A 1ZP4A 1UHVA 3QMSA 3INPA 2X1UA 4PBFA 3KOXA 2BDQA 4HCLA 4O28A 1BKSA 1YMYA 4YTTA 4QDPA 3BAYA 4GVFA 4WOZA 3NEVA 3B8DA 1Q6DA 5CC5A 1RK5A 1YW1A 1UW9A 3B40A 3QR1A 3RCMA 1WAUA 2WMFA 4OKDA 2E9BA 3KWSA 2Y63A 3S2NA 3TQKA 1RCXB 4UQBA 1UWAA 1WA3A 3O2LA 4K7VA 3EWZA 3ITLA 3LMZA 2F6KA 2WQDA 4QFUA 1W1YA 1P7TB 4JTEA 4NHVA 4S2BA 2WNNA 4BI7A 4XD6A 5JQ9A 1A5CA 3R43A 3C61A 3FJ6A 4PMOA 4DBEA 1Q4WA 5K4ZA 1H11A 4JAWA 1WBHA 2WZTA 3AIRA 3MMUA 3NGJA 4Z17A 1XGEA 3L5LA 1YKWA 3MP4A 3AISA 3TTEA 4JNMA 1JPIA 4UXDA 3OBAA 5K9XA 2QXWA 4HZ8A 3CEPA 1TUXA 1R46A 2ZX5A 5BMWA 1E71M 4ENLA 4DYKA 3OZYA 4QJ4B 3PTQA 4ROQA 4GYJA 2FPVA 2G3FA 2RFGA 3BSHA 1Z89A 1XWYA 5LIXX 1IE7C 1KA9F 1VP5A 2HBVA 2AKZA 3ELFA 2PZNA 5AVNA 1VFHA 2Z1KA 3W1UA 4S3FA 4OECA 3EWWA 2WVSA 4G7EB 2A2IA 3BWWA 5L6UA 3GDLA 2ODOA 1AJ2A 5FL1A 5TQLA 3QQ1A 3PG8A 4FR1A 1U22A 3BOXA 3FA4A 4PTDA 1V0KA 1BAGA 4WSKA 3TCSA 3LDVA 3W73A 1RJQA 3PF3A 4IIFA 2OT1A 4P61A 2WK2A 5JIPA 1TPVA 1SR0A 5FA5A 3PP7A 1EQPA 4K8HA 3BLDA 3FLUA 2EF9A 3W6LA 3BLEA 5HQLA 1S5TA 1V3LA 3BV7A 2TAAA 3S6DA 3UR7A 2XU2A 1DIDA 1R3YA 3RCYA 4E2VA 3KRUA 2QF7A 3W29A 3KTSA 4KEZA 5EPDA 1D3CA 3WMSA 4W5ZA 1HG3A 3WUEA 4GBDA 1UWUA 2O7SA 3IIXA 4H1ZA 5HBFA 3QVQA 3GS6A 3PAJA 1P1MA 4C60A 1B3OA 3JU2A 3UVAA 4HU3A 2PODA 4B5TA 3GB6A 3BW2A 5C70A 1TIWA 1J11A 5FEZA 5A8PA 1LZOA 4Z2LA 1KGUA 4JICA 2VEFA 5M5DA 1ZTVA 4ICNA 2GGIA 5LIYX 4QM1A 3RM4A 2FHCA 3M46A 1ELSA 1CXFA 4Q8TA 3PZVA 4HNNA 4E2DA 1WQ5A 5LNRA 5HR7A 3DXIA 1JXJA 1K7FA 1UWTA 4HNLA 5G1YA 4B5VA 2QUMA 4I8DA 2DUXA 2VX5A 4HPNA 5AHMA 4ZTXA 5FF2A 2QGHA 4FA3A 1R86A 3I4EA 3C6CA 3D3AA 1RBLA 4DI9A 2V0TA 4PTVA 3W72A 3EKZA 1CTNA 1WDRA 1BRLA 2BHZA 3CTLA 5AB3A 4JQ3A 3REQA 4B2DD 3FNDA 2MNRA 1LG2A 2H8XA 4IIBA 2OCZA 1TJ2A 2GGHA 3KCOA 4DM1A 5DFAA 1FXQA 2WKLA 5AC4A 2YL8A 5A6SA 5C9RA 3GG1A 2FH8A 1K1DA 1W32A 4RZBA 1NU5A 1W3KA 3APTA 4R33A 1OYAA 4NJIA 1ZZMA 1XLBA 3PZTA 5HMSA 2ATMA 4CEXC 2PDBA 2OLHA 2QCEA 3RLUA 1XIIA 2QJMA 4WKFA 5RUBA 3W7RA 2XHYA 1JCXA 3HJZA 3I10A 1XLIA 4DJDD 4OJYA 1IHIA 2WYSA 1HW6A 3G8RA 3HQNA 4J2PA 3PFMA 3ECQA 3UWUA 4GIRA 2NQLA 2VRKA 3VNLA 4BQ4A 4RE2A 4FMVA 2V5CA 2PTWA 4W8LA 1LBFA 3WNLA 2EJ1A 4CCEA 2WMIB 1BWVA 4AZCA 3ATZA 4W7VA 4X9YA 1OF8A 3VCRA 4F48A 1FKXA 2QCLA 4NF7A 3UF9A 1GW1A 4XVEA 4Z2KA 2F6XA 4IQDA 3BQ5A 4C1NA 4K39A 3HQPA 2V2HA 2G95A 3WLQA 5LGXA 3IV8A 4O18A 5DXYA 5H8PA 4QLJA 4EANA 1P48A 4DZ5A 1TV8A 3LPFA 1K4HA 1PTDA 4C6NA 3IVSA 1Z48A 5T9BG 1V03A 3GLCA 4DF2A 4MB4A 3ABRA 3T40A 5CG0A 4IUOA 3PSWA 3ZO9A 3ZR4A 4ORIA 1VPYA 3FYYA 4FALA 3MVTA 3RLHA 1ZB5A 1MWOA 3TIMA 2AQWA 3KW3A 3I7RA 1WDSA 2DZAA 4MAVA 4LC8A 3KRSA 2XN0A 3W1RA 4AG0A 5LGZA 1UIOA 1G1YA 1OWQA 1EIXA 2Y61A 4KEMA 1QO5A 2ZXQA 3TJIA 1DL3A 3LSBA 3F1QA 3BLKA 3KP0A 3W1QA 4MB5A 7PTDA 2BOEX 4GGHA 2I57A 3VIGA 3RR1A 3S2LA 4O16A 4F2UA 5C9UA 3CH9A 5IFTA 3SFWA 4C5ZA 2PI6A 1X7IA 4Y90A 2GDUA 1JFHA 2YLLA 3U2CA 3ARXA 1EBGA 3DFTA 1UC5A 2FHFA 5BU9A 2ZUWA 1RSCA 4UZSA 2DIJA 1KV8A 1XF0A 4Q3MA 2PWUA 1NOWA 4XK2A 4J3TA 4HHMA 1IWAA 3A4JA 3ZJ6A 3RO6A 5G1TA 1FCBA 8RUCA 2QV5A 1DPMA 1PIGA 4HPHA 2XWEA 4O50A 1RV8A 2R8WA 3CQ0A 2QCDB 4B2DA 4IG2A 5BOFA 5AHEA 4W5UA 4I6KA 1XRVA 1BGGA 2ZE3A 1LUCB 5JMUA 6XIAA 5LZLA 4B3ZA 4LAZA 4DIAA 3WDPP 1XS2A 1SO4A 3TMQA 3LS9A 1ALDA 4F0KA 3MSGA 1GQNA 3WJYA 3N04A 4RNIA 3OO2A 3WK0A 1J5SA 1E4IA 4ERGA 1F6PA 5I00A 1MDLA 4JFUA 3ME3A 2X16A 5H8UA 1G4EA 4DJDA 4XG1A 1HGYA 1FWAC 5H6HA 1HXJA 2PBOA 2C71A 1ITCA 1S39A 1L2QA 4M3PA 2DT2A 3G1FA 5HUPA 1VBHA 3B04A 3H2NA 4DWSB 4PBEA 1QW9A 4N9BA 1AFSA 5EY5A 1PX4A 3NQEA 2YA1A 3BV4A 1TPWA 1QHPA 2AL1A 2DU2A 1MFUA 2OELA 4FOJA 5CBBA 2QAFA 1GTEA 2W79A 4DO5A 1LRNA 2BY2A 1J93A 2D73A 4IJBA 5JH2A 1XIBA 4QCEA 1W1TA 1FWJC 4H9TA 1QOXA 4JTRA 3DI0A 1YQ2A 2ALDA 1KTCA 3RM9A 1CGTA 2OB3A 1MW2A 1B30A 3DECA 4KWUA 1F6YA 3TLLA 4K37A 1BG9A 1JZ6A 2EPLX 3DOPA 4OOZA 4QQ3A 4P8WA 4FLOA 4PMRA 1WPCA 5DCDA 3DI1A 1YBQB 4O19A 4ZTYA 1M1BA 1H7RA 3M0ZA 4CNNA 2V8ZA 2YA2A 3H2FA 1IR2A 4LUTB 3AWOA 4ZB2A 4DWDA 4C6MA 1UQYA 1S5MA 3FCPA 5DXXA 1V3MA 4ACZA 4XTDA 1O12A 4H3DA 4QBXA 5DMLA 4NAEB 2J62A 3CQJA 1OFBA 3C2OA 4FNPA 1I1WA 3GC5A 3W81A 4XV0A 2HS6A 3LCIA 1V6XA 3DFNA 3SN0A 3OW1A 2WZEA 4MKVA 4F2TA 4TTUA 1UWIA 4Q7BA 3TN4A 4XKMA 2Z2UA 3BZGA 4O0QA 4TX8A 1QJWA 1UMYA 3SO7A 5DY2A 2PGRA 2VZSA 2IS7A 4LY8A 5D2VA 3W6MA 1DV7A 4ORMA 3LZ3A 2XG9A 2OR2A 1X1NA 3FXGA 3GG7A 3LHZA 1JCYA 3FJNA 3GTFA 4NZ4A 4HNUA 2BHYA 1MW1A 4HZ6A 5K9DA 3CUJA 4PMYA 4UFKA 3FKKA 4H6QA 5KZ6A 1J96A 1EOMA 2YB4A 1WNOA 1FP9A 1XUUA 4JTHA 2FQIA 2VR2A 3UR5A 4FNSA 4XO6A 3LY0A 1G7VA 1YHTA 1K8CA 5CGMA 2J7FA 2OOGA 3EB3A 3R8GA 4M29A 2ZUUA 1SZEA 3TCEA 1XCXA 1HN1A 3VIKA 4CD6A 3KBVA 3UXDA 3GNPA 3WLNA 2QJGA 2YCKX 4BF5A 4QE4A 1OIFA 4PRRA 3S1XA 1GJPA 3KL0A 5MHBA 2Q8LA 2OYLA 2WJZA 4AWTA 1K4GA 5JU6A 2ZZ4A 1FFRA 4IX0A 3QR3A 1IZJA 4E3VA 4C6QA 2WMHA 3F4VA 2QLYA 5KZDA 4QQUA 3VE9A 4QS6A 4P7RA 1MZRA 3W2LA 1ICPA 2FGZA 2D24A 1GZJA 5KMYA 4HA0A 4EPEC 1TIMA 1A0EA 3TSDA 2XUCA 3EBVA 4GYFA 3DFQA 4F3HA 2A7PA 2ZC1A 5D30A 2G4JA 1P0KA 3FXYA 3G22A 2E8YA 3WJSA 1IWPA 3T2PA 3VD4A 3LBOA 2A7NA 5LIUX 3M16A 1GJWA 3WLTA 1XRTA 2GUUA 3CHEA 5XINA 3M41A 1UR1A 1ISVA 4GCAA 3NQMA 2Y0FA 9RUBA 2JQXA 4CQCA 5I09A 1NP0A 5G5IA 2QZRA 4LEFA 4A3UA 4REQA 4RV8A 5F2GA 3S83A 2PDLA 1W3NA 3DCPA 4GA8A 4YL2A 2CLHA 3WF1A 4NNCA 4Y2WA 1K03A 4B3LA 4L4PA 2OKTA 3CZLA 3MUXA 1W56A 4IH3A 4U31A 2PDMA 3FSUA 1PIIA 3I6TA 2ZUNA 2EPOA 5HWNA 4K2SA 3MJMA 4RUBA 2NW0A 1G0CA 1ZLPA 2CETA 2GQ8A 2WCGA 4U4MA 4HTYA 1HX0A 5CPQA 3BH4A 5XIMA 4JHOA 1XYMA 3I68A 1E6RA 2PLMA 1EGMA 1P0BA 4PN2A 4HBKA 1WOAA 4Q8WA 3N29A 3WDRA 2W63A 3GXNA 1S2UA 2XDFA 2ZQ0A 1XLAA 3C0SA 2FPTA 2P53A 3BCJA 3RLGA 1W3JA 4NASA 5CPMA 2QULA 1UH3A 1V0NA 2NLYA 2Y5EA 4JY8A 3VGEA 3PBMA 1VS1A 5KITA 3BOLA 1LQ0A 2ZRZA 3MKKA 1LM1A 4RDYA 1GG1A 1BF6A 3CL8A 1BHGA 3GR8A 4JIRA 3P60A 2UY3A 1ADDA 4D1JA 1XL9A 2NWSA 4LS0A 6TAAA 4Q33A 3NR0A 3IAQA 4DO6A 4GISA 3KCLA 3OIXA 3NYDA 3OPSA 3VKCA 3B8WA 3KVMA 4NXKA 1JYNA 3CIWA 4LRTA 1RHCA 3F2CA 2DQWA 1ECEA 5BWFA 2W91A 4QCFA 3WQ8A 2QIWA 1XRFA 4MLJA 4TR9A 3L4XA 4M56A 4PH6A 4UTLA 1EHAA 1DTUA 3UPWA 2HWGA 3O6DA 1X6UA 3S3GA 4ZO7A 3SAZA 4NYUA 2VNCA 3MA8A 3G3MA 3O05A 1H62A 4ZO8A 1RBAA 2RDTA 1WZAA 2RDWA 3AJXA 1L2UA 1L9WA 3W22A 3DYPA 3B8UA 1SJBA 2L5HA 2QR6A 3IK2A 2D69A 4MMWA 3JS3A 4MPQA 4FB7A 2PTZA 4Q22A 4PSRA 2B7PA 2JFEX 4AIEA 1HT6A 3WLIA 1S2VA 2I56A 3L0NA 2CC0A 1H2JA 1DJQA 4UTUA 2PDGA 3BL3A 3SUVA 3DBPA 2JKAA 3P3BA 4BEQA 7ENLA 4DEFA 2VQUA 5A2BA 1UG6A 3ANYA 5CSSA 4F0MA 5I5RA 3W07A 2UY2A 4JTFA 4NI8A 4KCVA 1AMKA 3N9RA 3GAKA 4MJ2A 1B3ZA 5FJOA 3S2CA 3PBUA 1KTNA 1IR1A 4IMEA 2DDXA 3QPEA 2PD5A 2PGWA 1XSIA 3OU8A 3AHZA 2O9RA 1RVKA 1ZBCA 2XVKA 4CNSA 1XFBA 2VZTA 3AQUA 3RHGA 1DJYA 2YYTA 1E73M 3AYVA 1LT8A 4UQ9A 1JCNA 5K2ZA 1KGWA 1GVEA 1PX3A 3V1PA 3TW6A 4JTUA 3THCA 4PCNA 5HINA 3UR2A 4BFAA 3S9ZA 5I24A 3MHUA 3VDAA 3LRLA 4J28A 2J74A 2QPUA 3TTSA 3F5KA 4I9MA 1GK8A 1M6JA 2CESA 2DPEA 4DUVA 3WZ0E 4QSHA 3W01A 1VBJA 4G1KA 2CLIA 3LEPA 4NZ5A 3WX7A 4LUJA 5E0FA 5A3HA 4GBUA 4L9XA 4BEUA 1TVNA 3WL0A 2NLIA 1A3WA 3C0LA 4LY4A 4K7YA 5B80A 1PE1A 3TNOA 3WSUA 5D8WA 3F5JA 3MI3A 3W2NA 3GM8A 1QPNA 1W31A 2PDIA 5C54A 2BHUA 4GI4A 1F73A 4DX3A 1VD6A 2CXEA 4Q4MA 4JQ1A 2Y5SA 1BF2A 2FDMA 3QGKC 4OUEA 2X0YA 4B3KA 5FCZA 3LG3A 1OCQA 2FVLA 5ABFA 1WZMA 1UYQA 4RR4A 4N6FA 3VD5A 1TMHA 4NG3A 3KOYA 1J5TA 4QS5A 4H9XA 4B92A 4L1GA 2HPMA 1H0GA 1EDQA 4IGMA 3UWZA 4W88A 1SVDA 3IIVA 1TV7A 4WDWA 1EBHA 2VFIA 1XIGA 3NXFA 1CXIA 1FWIC 5EKYA 1EL3A 2VOTA 3R4IA 4HMCA 2QPSA 4FLSA 3KL3A 8A3HA 4XZLX 3CWNA 3U0HA 4WDXA 3KVLA 3A22A 2C91A 4TVUA 1XM3A 1TUFA 3UETA 3VC6A 1A5MC 4BZYA 1OSEA 3RG6A 3AI0A 4N9EA 5I3FA 4I6VA 8TIMA 1K02A 3M0XA 3I3DA 4PTMA 5A94A 4NZ3A 4G56A 2CLOA 5FF3A 1TVPA 3C2RA 2WOQA 3SM0A 5LXXA 3LPPA 3CQKA 5CBJA 3HO8A 1A50A 3TYCA 2VGGA 2DSWA 4I7VA 1ZJHA 5IDIA 2PD9A 1SFJA 3RXZA 3WD3A 3OGSA 4V33A 3O6CA 3U4FA 6REQB 1R8LA 1LTDA 3GDKA 4KESA 3L4YA 3E1F1 1FVPA 1FWSA 1LWHA 2G4FA 5DBUA 3OIHA 5TAOA 4S39A 3P0WA 3PBGA 3TTYA 4UCGA 4MOZA 3NO5A 1PKLA 5DMMA 3AAMA 2CHNA 1EJTC 4WOQA 3OHIA 4HTBA 1PJ9A 2RDUA 4S23A 2GWNA 3DFPA 3R1ZA 4YVPA 1ZNNA 5FJPA 4V1XA 1XSJA 4J3VA 1AL7A 4YS1A 3EOOA 3F7JA 2AOSA 2REQA 2QCGA 2VD9A 2QUTA 3UZ5A 1WXZA 1HKIA 2J25A 1H4PA 5EGRA 1Z44A 5CQ1A 4HHLA 4IMCA 1XLFA 3GKFA 5EMYA 4QDWA 1U1HA 4OHQA 9XIMA 1KRBC 3CUGA 2YCLB 2X1TA 4GZIA 2XIOA 3PZNA 4DWSA 1BYBA 1LQAA 1XLJA 3IS4A 2Y85A 1EHNA 2IPFA 1YTKA 3BG3A 1MUWA 2QMJA 2DIEA 4YWIA 2IMRA 3AALA 3SECA 1XIDA 3PK7A 1LLOA 1LBLA 3SZ8A 2ZA2A 4YLWA 3FOKA 4JPGA 2R14A 3HGJA 2FVMA 3R7MA 5AC5A 5CZSA 3R5EA 3QRHA 4M82A 4DJFA 1QFEA 4JIHA 2PUZA 4X61A 1UPPA 1YBQA 1R7AA 3BLLA 3VNKA 1R30A 1XD0A 1H1NA 3GKAA 1X1OA 4O1DA 4LUTA 2PDFA 1BVNP 4S2CA 4A35A 1ZP3A 7A3HA 3UA3A 2OFJA 1ITXA 3GXMA 3WEMA 2ZTJA 4HN8A 3VNZA 2X0SA 1YPIA 2A3CA 4LBUA 2Y5JA 1Z6KA 2GOUA 1U5HA 1XQLA 3VFCA 4L9YA 1KD0A 3E0WA 3LM3A 5K7JA 2AMXA 3QTGA 2OZ8A 1KR0A 1XDJA 1EFZA 3DKLA 1ICSA 2QGYA 1LOSA 1WXYA 3ARVA 3SBFA 1NDVA 3MMDA 1DHKA 3B0YA 2WAGA 3W74A 3UD6A 4EIVA 1DHPA 1RJRA 4GQGA 5AHNA 4NY2A 2ZRXA 1N7KA 2NVDA 1UKQA 5AC8A 4AEEA 2QW5A 3BMWA 3FKRA 1DJIA 3GHSA 4CU8A 4EE9A 1QO2A 3N4EA 4W85A 1CXLA 1W5NA 3PZ9A 3AIWA 4NVTA 3CGTA 4QP0A 1VCGA 2DUAA 2PSNA 2OQLA 2ZXDA 3CLMA 2W62A 3UG8A 1E9ZB 5CPNA 1R47A 1VLIA 4RE0A 5A2AA 3RX4A 1VJIA 1NFBA 3LCFA 5A6TC 2BV9A 3LCHA 4Z1AA 3L9CA 3TQVA 4IM4A 3OG3A 1ME7A 3HGSA 1ME9A 3WQ5A 1IEIA 4CN6A 1UA3A 1DIOA 1CLKA 5DX7A 1E4NA 4JZ5A 1KFWA 2BWGA 4PRTA 4ZOEA 3CWHA 3WJZA 1A5AA 3AXIA 1GORA 2PFHA 2FZDA 5C9XA 3HG3A 1R3TA 1JUBA 4JQAA 4MGGA 3SGZA 1V0LA 1F3WA 3EWBX 1MMFA 2O9TA 1Q7ZA 2VYOA 3U7VA 4PB3A 4QJ3B 1QPOA 2G50A 5ABEA 4R53A 1PS9A 5A6KA 2YL9A 3GVWA 1OX5A 2J6XA 1RQHA 3D47A 4Q8QA 4WXZA 3L2IA 2UY4A 4D6DA 3M5VA 5JUVA 4MVAA 1IEXA 2INEA 1SPQA 3KBNA 2H6RA 2BG5A 3WD4A 3IJ6A 3VPLA 5JXQA 4NX5A 4FAMA 1EPXA 3I3BA 3AXMA 4AVNA 1KQYA 4ERIA 3ZLHA 2VWSA 3SUTA 3H8AA 2ABAA 3E2RA 4HB7A 4XD5A 4ACYA 1B57A 2X09A 1TA3B 3TJ4A 2DSVA 1KFJA 2WCAA 4P7LA 4PSPA 1XDLA 3LNMA 1KM0A 1OFAA 1YX1A 3CHDA 3R6IA 1P1XA 3NGFA 5A6MA 1UKTA 3SSJA 2WBGA 3RPMA 1YADA 1I2OA 2ZYFA 2NSXA 1JGMA 3V5FA 1WDQA 5DO8A 1XX1A 1LLWA 3A12A 4DELA 4ICMA 2VWTA 3TYZA 1EJUC 2H9AB 3HB9A 1R5YA 2CIPA 3PTDA 3CYJA 1UKPA 3FEMA 1B3YA 3VI2A 2YZRA 2BTMA 3THUA 3H4WA 1VAHA 3VNYA 2J27A 4AZ7A 4F4RA 2EO7A 3KDNA 5H2ZA 3W7KA 4AX6A 1XICA 1UUOA 4PL2A 3MCMA 4UQAA 3EA2A 1SMDA 2VCCA 5LNWA 1HO1A 4WXYA 4MF4A 4K1WA 3EPMA 2NX9A 3K4DA 3CC1A 2GGJA 4MZYA 4UNKA 4LGXA 4KWWA 3BPWA 3GH5A 4RNFA 5HPCA 4DXXA 3VU2A 1OT2A 3FS2A 3THAA 3D3FA 1SZRA 1EQCA 2VX7A 1TREA 1B0IA 3Q58A 3TW9A 3BLIA 2FJUB 3MTWA 3GXDA 5DANA 4DAFA 3NQGA 4D8LA 1YDNA 3EMCA 1V77A 2GJXA 3AMGA 3QPZA 2Q02A 1OGGA 4XUGA 4R9OA 4M80A 2FFCA 3IK4A 4C1KA 3A13A 1W9XA 1PX8A 4QE5A 1O94A 3WMBA 4GH3A 2VELA 3M07A 3SCOA 1OC7A 3SIZA 3RF9A 2R82A 1S38A 2YKKA 2ZKMX 4R5EA 3TYDA 2DZWA 3CV7A 4HN4A 4AY7A 4KGJA 1SFLA 4W8AA 4AWSA 3CV2A 5DN1A 2OZ3A 3RYSA 3LOTA 2CZEA 1ZUAX 4HNCA 3G8EA 1UWQA 1AA1B 4YNGA 1VJSA 3MMTA 4ES4A 2JIEA 3UXKA 2PS2A 3UG5A 3DEQA 1DP0A 3XIMA 1I75A 1QHZA 2GVGA 5I2UA 2J77A 3ZZ1A 5KETA 4NSBA 1ZALA 4PMUA 3N73A 2A79A 3KE0A 3WLKX 3LENA 1A53A 1QNOA 4Z2JA 1IXOA 4LBSA 4WQ6A 3UESA 3P74A 4ATDA 4GG9A 1XLGA 4JTKA 2P0OA 3MYPA 4US6A 3LCWA 4GHRA 4C7GA 3W38A 1JPKA 4MTVA 2OQYA 8XIAA 1I4NA 2C3ZA 3TSMA 1VCVA 1ZJBA 2I14A 4CCZA 1FWDC 1V6WA 1RPKA 1BSIA 1H0IA 1OVDA 3M0VA 4J3UA 2ISWA 1ZENA 3E2SA 3AS2A 1BKHA 3IGSA 3VKAA 4WK9A 5AFDA 3K1GA 2BODX 1IGWA 3EX2A 4OUIA 4R7WA 3G18A 1EUNA 3LU2A 3GFYA 1WBJA 1CNVA 2VFEA 2DH3A 5BXPA 3S6TA 1F74A 2G3IA 6ENLA 1U5VA 3ITYA 1KXTA 1AK5A 3DUGA 5B7ZA 1K9TA 2DGAA 2ACSA 1EC8A 2FTYA 3QPYA 3WKZA 3H2EA 2BGSA 3AHVA 3IGUA 1QWKA 2J75A 3T07A 3WMLA 3GQYA 4DQWA 1JYXA 4LCRA 4I3GA 5I23A 3C5QA 3FA5A 4GI6A 1G4PA 3OQEA 3V36A 1SJCA 4NIRA 3PPCA 5CXPA 1BXNA 4MYAA 3L4VA 4IIGA 4GINA 2V6AA 1SFSA 2X1SA 4UOJA 5CG7A 3BAXA 1X8CA 3WH6A 3USBA 5F4XA 5C55A 2OOFA 1V08A 1CENA 4S3EA 1SJDA 2Y6ZA 3VXGA 3NVDA 3PBVA 1UWRA 3TJXA 4U2ZA 3GYEA 4MKSA 1PDZA 2HMCA 1GCYA 4G7FA 2HRWA 1XYAA 1J4EA 2SFPA 2YXXA 4MY1A 4EACA 4H9MA 3M7SA 4B5UA 3TVAA 3MO4A 4AYGA 3E3HA 3PZQA 3A21A 1KM1A 3IARA 4RZ5A 5TBOA 2E6DA 3C86A 2WBKA 4MWAD 3TN5A 3H21A 4K8EA 3LUTA 2YDAA 3TK7A 4MB3A 1Z3NA 3N2XA 4XZ9A 3H26A 2FKPA 2WLYA 2FGBA 3EWXA 3HIJA 1ZBKA 5L9FA 1IIHA 1JJKA 1NAL1 2W61A 3ITTA 5D2YA 3W7MA 4ZB0A 1U2YA 4M7SA 1WP6A 3WLPA 4GUFA 4R3UA 4I9JA 5TF0A 4EF9A 3DGRA 3P7YA 3G24A 3FAWA 1JI2A 4DZAA 3DZ1A 4P8UA 2J7CA 2JKEA 2R94A 3PUEA 2RKXA 2VXNA 1PHWA 4QIUA 4J3XA 3FGCB 1C93A 2OZ0A 4Q8NA 1V4YA 1N8FA 2GJPA 1R85A 5IDZA 3DFHA 3FSTA 1QPQA 1TTQA 2CHOA 3W83A 4RCXA 4ERAA 2BZNA 2OEKA 2MUCA 3P81A 4OU1A 3C52A 5HULA 1XBYA 3T7VA 2V82A 3WQDA 1B3WA 4G8TA 1NP2A 3B03A 5EBAA 1A0DA 5I7GA 3CYVA 1T8XA 3ENLA 4G6CA 4E8CA 2G8ZA 3NDOA 3C0JA 4Q4KA 1HO4A 4BF9A 1AD1A 3QR0A 3IJIA 3JUGA 3ZJ8A 2W5FA 4ZO6A 3NPXA 1R38A 3TFCA 4QNWA 4O1CA 3CZJA 4S3KA 1OM0A 3OVGA 4O14A 2NUWA 3LXAA 4PB5A 3VDBA 4AF0B 4I9TA 3VDGA 2H3BA 3G1YA 3N6HA 2A5HA 3LLDA 1BWLA 2HV5A 1DBTA 1UASA 5M17A 1OYCA 3NQDA 3VUPA 3W7OA 3PSVA 5A8GA 5I6SA 4O57A 3P8IA 1GG0A 1XP3A 1V6UA 3F4CA 2A0NA 4L7ZA 1FXPA 2Z0IA 4JDYA 2ESCA 3ZR6A 3NL3A 2BBFA 3TU9A 2YCLA 3B8TA 4CVWA 3QHOA 4AC7C 2KAUC 3BW3A 2EEXA 5FF0A 3CNYA 1ZPTA 4NT0A 4AHPA 2QYGA 2AGKA 1QT1A 5DF0A 2P76A 3WDHA 5CJNA 4FZIA 2X41A 1OFPA 1TJPA 4MHBA 1MW0A 4UMBA 1I1XA 5AYZA 5CJ5A 1R2TA 3B97A 1R87A 4MKNA 1K9EA 4GO9A 4NL1A 4HQVA 1FCUA 2V5JA 1SO6A 3PM6A 5AY7A 3VO0A 2BY3A 4GACA 3VUSA 3H12A 5D9OA 1GVIA 2DEPA 1DJWA 2P0IA 3L7RA 3ERPA 4LYPA 4UIOA 1PKNA 1E0XA 4V15A 3CPGA 2VEPA 3FYOA 1QOPA 4O15A 4C7FA 3N6JA 1FP8A 4HT3A 1V8EA 3CL6A 2G97A 5I03A 1FH9A 2OPJA 2D1ZA 5I0DA 3R0DA 2A3BA 1OABA 4Z2IA 1XPYA 4FNUA 3UPMA 4ZE5A 1HF6A 1GOMA 4B9ZA 4JYDA 1W37A 1JDDA 4A2RA 4UQCA 3O15A 2WNQA 3C3UA 4NJHA 3S1WA 1JZ5A 3ISIX 3ZQ9A 3N25A 2Q09A 4FX8A 4GIEA 3ZT7A 1K8XA 3S9YA 1NWTA 1Q85A 4JCMA 2XVGA 4YJ5A 1E4LA 1UP3A 4X0VA 2BVDA 4HA4A 1V79A 2W92A 3SCVA 4UR7A 1K70A 3VKBA 2X05A 1GVSA 2DZTA 4HJWA 2Z26A 1BTCA 2NUXA 4FXJA 3PVFA 2H8ZA 1Q8AA 1XPGA 3PBWA 1OJXA 2WC7A 3K4AA 2E28A 1S2AA 3T2OA 2J78A 4F8XA 4FF7A 1VF8A 4WSHA 4EX4A 3PZIA 5FI8A 4DLFA 3BJTA 1C8XA 4RZ6A 3UG3A 3M47A 2J88A 3WJXA 5FD0A 2CERA 4KWVA 2WMJA 3W4RA 1MQPA 5FEPA 5CZ0A 3OLEA 2PP3A 3S47A 3SI9A 3HPFA 2XSXA 4E0CA 2Z1SA 2ZA1A 1VEOA 3DHFA 5I78A 4HSOA 2YDQA 4YN5A 1XW8A 1KCZA 3DBNA 4TX6A 1VBGA 4FIQA 4W9TA 5G4EA 2E1DA 3PJUA 4IT1A 2A3AA 3AYSA 3GE7A 5CSYA 1MEIA 5A8NA 1KXVA 1POJA 4PULA 4KEVA 3SR7A 1H09A 2PU0A 2YW3A 1PAMA 3TNBA 2OT0A 1C9WA 4EAMA 3G1AA 3ITOA 3CMGA 5D37A 4AZIA 3QYSA 4GJJA 2WSPA 1UUQA 2E5DA 2VFFA 2UZ9A 5BYWA 3E96A 1OD8A 2WKGA 1TX0A 2PCEA 3PZMA 4RXGA 4GIAA 3UQNA 8XIMA 1J79A 3UW6A 3MWAA 2F38A 2DVUA 4JFWA 2KX9A 2FGLA 1I2NA 1YLVA 4NNBA 3RPDA 3E0FA 4W87A 5C5YA 3B4UA 3N15A 5HWJA 3HG5A 1GHRA 2B7QA 1MQQA 4H7CA 1UBSA 2XH4A 4JN7A 1D9EA 1Z7AA 3SCPA 4NZCA 1NQ6A 3P84A 2E5BA 3UJSA 4DPPA 2YXGA 2NV1A 3M44A 3SQSA 1TA3A 3PZOA 1ONXA 3QSRA 1CECA 1UD3A 3E02A 2OKOA 1C29A 3BOFA 3VYLA 2NVAA 1FWHC 2VZOA 1NFGA 2YZ5A 4NRRA 1DQUA 2OZTA 1US3A 2X1IA 1MEWA 1IT0A 1IWBA 5CBIA 2CITA 2V68A 1XBXA 4YMZA 4NILA 3QC3A 5H8MA 2NX1A 2XIMA 4GYPA 1O68A 4JQ2A 4W89A 5CH9A 3CHFA 3CZ8A 4DJFC 4QJ5B 5T26A 4GJ1A 3TAOA 3GXFA 3SCTA 5D9PA 2ZXBA 1AH0A 3V35A 4DXVA 1E5NA 1OFOA 2RJGA 4GKTA 1K6WA 3JZEA 1VQTA 2QJHA 1SW0A 2V3EA 2GJRA 1GVYA 1EP3A 3P82A 1V6YA 1DQWA 1DWIM 2ON3A 4TX9A 1GHSA 3UJEA 4BWLA 1RZMA 2YDRA 1OIMA 1OFDA 3DFSA 1EJ7L 4PUMA 5MF5A 2Z2AA 5FAJA 1E6SM 3U5YA 1W17A 1O7AA 1DWGM 4LAOA 1EGVA 1H7XA 2Q01A 3URBA 1KQZA 1WOBA 2ISFA 3B9NA 1WDWA 4C1NB 4ILSA 5C0QA 1HJUA 4MB1A 2WHLA 4O54A 4AX7A 3EDKA 1Q7MA 3QZAA 3GFZA 3QFWA 3QLDA 3EXTA 2FMOA 4KH2A 4DJEC 3N3MA 4LXFA 3P93A 3EWCA 2DVXA 4AB4A 1S2WA 5AHFA 1QBBA 5BW6A 1IF2A 1P0NA 3N9SA 5K3VA 3A3XA 2J9YA 2G37A 4HNOA 3T6CA 3EEGA 3R89A 3CAQA 5D32A 3WYZA 2AL2A 1EH9A 2DSKA 5A95A 1L6FA 2WSYA 1XSKA 2IKJA 2NZLA 4O4VA 4AZ6A 4D8AA 5H1WA 5FJJA 4AW7A 4S3CA 5D09A 2Y62A 3UZXA 2GOKA 2WKJA 3LPOA 1ISYA 4MY9A 4DNMA 3EDEA 2PDJA 5DEZA 1OFQA 5TIMA 1TWWA 1CI1A 1I2QA 2XM2A 2QHAA 1Q6EA 3MZNA 3ZOAA 2EPNA 1R9ZA 1EXPA 1TPEA 3WO8A 1JI1A 2E77A 3LLFA 4JHZA 1E9LA 1TPUA 3TR9A 4FXRA 3HG2A 1NH6A 3POCA 4K38A 3QYQA 2G3NA 3RX3A 4XWUA 3T0TA 1JDFA 4B5SA 1E6ZA 1WB0A 3PUGA 1GZGA 3GDBA 2FTPA 4H9ZA 4HU4A 3M5ZA 5CC3A 4B16A 1KW1A 5CZKA 3TYUA 3DYOA 1PIFA 5HMDA 2C16A 4GQBA 4IG2B 1A3HA 3PAOA 2AGTA 3R11A 1V6TA 3V4BA 2HISA 4HGXA 1EC9A 1ISXA 1KCKA 4KWSA 4A3RA 1YXDA 1JUEA 4MADA 5A6AA 4J3ZA 3HG4A 4QLLA 5C6MA 4K1GA 3U7BA 4ZFMA 3O9NA 1SW3A 3T4WA 1M41A 5AHIA 3SIMA 4RDWA 3G6LA 4AD4A 3EX1A 4MAZA 3O7UA 2UY5A 3N4AA 4M5PA 4W86A 3MUCA 2DT1A 1EWDA 1MDRA 2PDWA 3KEHA 4GC4A 3UY8A 5I3GA 3UGVA 5KSWA 1UJQA 5AKQA 2F7FA 2GL5A 3CV6A 1OG0A 4GQ0A 3GR4A 4KETA 4CNOA 3WBXA 5FACA 3K8MA 1RA0A 1HL2A 2PWEA 1O66A 1TVLA 4IGHA 3EDJA 4E4PA 3KX6A 4ZBCA 1SU5A 5IM51 1XV8A 2C8NA 3UWVA 2OX1A 4PCTA 5BRBA 2MANA 2I5GA 2HK1A 5FEXA 4IFKB 4Z1BA 3CIVA 4M81A 4HNTA 1JQVA 3IAPA 1AW5A 3AS0A 3EWDA 4OE7A 3TKFA 3EOLA 4FX7A 1REQB 5HQMA 3VOIA 3GK0A 3OHMB 5BCAA 1ESWA 3WF0A 3WLMA 3WL1A 1J6OA 9XIAA 2OGJA 4BF7A 2HPIA 4F66A 2ADAA 2R24A 5M03A 2XIJA 3SCNA 1D3GA 3C2EA 4L6HA 3CHCA 2XIQA 4ACZB 1B31A 4BA0A 2HTMA 1GPWA 2H90A 1FDJA 3T9PA 3UNDA 3BAKA 3AROA 1ISZA 4LALA 1LWIA 1M9HA 2FVKA 2O0TA 2Q3RA 1K8ZA 4GWEA 4M1BA 2GVJA 2XSAA 4GH1A 1IEWA 3ITGA 3VFLA 1A80A 4TIMA 1DE5A 3TWAA 5D02A 1UROA 4DI8A 4D6EA 3KAOA 4HU0A 4UQDA 4DBSA 1QNQA 3T42A 4LW7A 2XM1A 3L68A 4HP5A 2GZXA 1UJPA 2BLEA 1L8NA 5ABTA 4BHYA 4GY1A 1W5QA 4LVFA 1RCOB 4QHRA 3EX6A 4Q8VA 1W5MA 5CAHA 3U6WA 3GNRA 1OG6A 4JFTA 1TV3A 4H2CA 4R34A 3SCWA 5AN7A 2E09A 3OLIA 4J5NA 2C15A 3VA8A 2DW6A 2GQ9A 2B7OA 1ZCCA 1FCQA 3ARZA 2EAWA 4DBDA 2V30A 3L4TA 1NM9A 5A1AA 3AS1A 1TMQA 4J35A 2AKMA 2BP1A 4HA3A 2NV9A 1GKQA 4CCCA 3T0AA 1UD2A 2PWFA 4ECLA 4Z08A 4PA8A 3W24A 4UFMA 2PU1A 3PC0A 4AF0A 4PUWA 1RH9A 3EPOA 1FRBA 3II1A 2A85A 3UJFA 3LI1A 1U1UA 3E74A 3H23A 3PTMA 4DXKA 2PF0A 3OODA 4BQ2A 2DUZA 3A6OA 1W2VA 4R85A 3HFTA 4J9JA 4W7WA 3ES7A 3WD1A 1O6IA 4DYEA 1XLEA 3SRFA 1CGYA 4GX8A 2DY3A 4L4MA 2VEMA 4FPSA 1D7KA 3M0IA 3GYCA 1G94A 1HJQA 4JIQA 4RW5A 3PS7A 1IZCA 2PB1A 4AAJA 3VD7A 1JCMP 4LS1A 1FFQA 3AMCA 3U48A 1XLMA 1O95A 3DHUA 2BXVA 3FDKA 3VNDA 3S5SA 1ENUA 3F4WA 1A5SA 3MQTA 6A3HA 1KWKA 3GG8A 4PUEA 5D38A 4DM2A 4IHCA 4KFNA 4NXSA 1D3HA 3KHJA 3S0CA 1XYBA 1E6XM 3IV3A