1XV8A

Crystal structure of human salivary alpha-amylase dimer
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase
publication title Crystal Structure of Human Salivary Alpha-Amylase Dimer
rcsb
molecule tags Hydrolase
total genus 160
structure length 496
sequence length 496
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xv8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xv8A01
4PMRA 1Q4NX 1KXHA 3VU2A 3GXIA 4CGTA 4OOUA 4GQQA 2WBKA 4FNPA 1A3HA 3BUDA 3AROA 4AISA 1UG6A 1V0LA 3KZSA 3EDDA 3BVTA 1D2KA 5A6MA 3AIUA 4AIEA 3VSVA 1JNEA 2WWCA 2VQUA 5BWFA 3WQ5A 4CCCA 4M80A 5I24A 4N42A 3TTYA 3W25A 1OB0A 1PBGA 1XSKA 1HT6A 4W85A 3WF0A 2D23A 1NARA 3LPOA 4DM1A 3ZT5A 2WAGA 5A2AA 3BAYA 1PAMA 1QW8A 2EPOA 1BFNA 3GXDA 3DX3A 3B9EA 3RJXA 1GPFA 4AZ6A 1MFUA 2PB1A 1SYTA 2GDVA 3VD4A 1W1VA 5CLTA 1AQ0A 3CZGA 4JL1A 2VT0A 1HX0A 3VIOA 3AS0A 3SCNA 4BF7A 2VNCA 4UNIA 1VBRA 2W63A 2XWDA 3ARVA 1KCKA 3ARSA 1HWWA 1HNYA 5CG0A 3VNZA 5D4YA 4Z2GA 3IJ9A 1DTUA 1VENA 3VSUA 3RMEA 3IJ7A 3NCOA 3VOCA 4WKFA 2WCAA 2QPSA 2WWDA 3ZJ8A 5I79A 2IUZA 3PZGA 2EPKX 2EO7A 3LRKA 3PZTA 1EXPA 2XFFA 4TXEA 4TOQA 4C7DA 3W27A 3II1A 1VEOA 4HZ8A 4DWSC 5A3HA 4GZJA 1FFRA 2FGZA 3ZO9A 1XC6A 1CGVA 4JKKA 1J9YA 4GO9A 3LX9A 4PSPA 4PMVA 1ZJAA 2W61A 1FH9A 4MADA 3KLKA 1WDPA 4N0RA 4WSJA 2BVYA 2CXGA 3ARXA 5E6ZA 1UA3A 3W0KA 4AEFA 1NOUA 3WQVA 3T2QA 1E6QM 4TVDA 4P7QA 4PCTA 3WDHA 1KWGA 5ECUA 2CBVA 1ZB5A 3SCRA 1E71M 1XYFA 4KWUA 3TTSA 1CXFA 3MSGA 2VURA 3KL5A 3VUPA 1VIWA 2J7GA 1H4PA 4JAWA 3BAKA 2CEQA 1OT1A 4D6EA 1SMDA 4PUDA 2BY1A 3BLPX 1CLXA 1GJWA 4NSBA 4ZE4A 2G3JA 1CLVA 3VD7A 3BSGA 2NT1A 3CUIA 2WVTA 5TD4A 4CD7A 3PZVA 4B3KA 3NIYA 1OBAA 3BH4A 1KXQA 3WNMA 1JGIA 2X2YA 2XWEA 1E43A 1KXTA 3VDAA 2VX4A 1BSIA 2XPKA 3BUIA 4NXKA 5HPOA 3OBAA 1BYAA 3MU7A 3LPGA 1DWHM 1CYGA 1BYCA 1V3HA 2G3MA 2RGMA 3RILA 4HZ6A 3M6DA 3S2CA 1V6YA 3WY2A 3ALFA 4UOQA 4UR9A 2E3ZA 2EABA 2W66A 1NWRA 3DC0A 2J77A 4L4OA 1JIBA 1DHKA 3QHOA 2IGTA 2CIPA 3POCA 3GNOA 3ZR6A 3RM8A 2ZXDA 3IJ8A 1M04A 4NZJA 2W4XA 2JEQA 1CPUA 2EAEA 2NSXA 1BVZA 1H49A 2VZTA 2WMIB 3VIKA 2OWWA 3GNRA 1R8LA 5DO8A 4Z2JA 4F9DA 4OZOA 3VTRA 3I3EA 3N13A 2X05A 3OLIA 2ZWZA 3MMDA 3UG3A 3AOFA 5CSUA 1E0XA 2UY2A 3NDZA 2J74A 4MNKA 1W1YA 3D52A 3MV01 2OYLA 1BYBA 2IXVA 2D2OA 1UR8A 4E8DA 1EHAA 1TVPA 4OIFA 3ZJ7A 3BMVA 4PTXA 1KTBA 5GNZA 3W26A 3DYOA 3W37A 3LXAA 3DHUA 3WBEA 1JZ8A 4ACYA 2BNJA 1RPKA 2WVUA 1LJYA 3IGUA 3OZPA 3ARRA 2EJ1A 2YDQA 3WH6A 2O9OA 2D22A 4QLKA 4X9YA 2ZIDA 4J7RA 1JD9A 1EGZA 1QBAA 1CXIA 3VX0A 2JIEA 3CMJA 2CKRA 5I78A 4GQRA 1GOQA 4CN6A 3GXFA 2VUYA 2YJQA 4MAZA 2QHAA 3RM9A 4AZCA 1H09A 5BROA 4U5IA 2GJPA 1R46A 4D6IA 5DT7A 2WKLA 5A6LA 2E40A 5JBDA 4TVUA 3E1F1 3G6MA 3CZLA 3A3HA 1H41A 4W87A 3WEOA 5FOOA 3SCTA 4CU7A 1TR1A 2C0HA 2VI0A 1DWJM 2V5DA 3VGHA 3WY3A 1GOIA 2E4TA 3K8LA 2BVTA 3M07A 4AEEA 3NSXA 5D8ZA 1QPKA 4QLJA 1TA3B 1A47A 5I0DA 3UR7A 2D0FA 1E6ZA 2XUCA 4P7RA 2GFTA 4J28A 1V02A 2J8GA 2VO5A 3ZR5A 1E40A 2YDSA 4Y7EA 3AZRA 1XHGA 1OSEA 5D9MA 1M53A 3BUQA 4D6JA 5HNNA 1AMYA 2DT1A 4GXPA 5LA0A 3HG2A 4U3CA 6TAAA 1GOMA 2YL6A 1V3MA 2ZE0A 4JL2A 1JI1A 2F8QA 4A4AA 2GVYA 4B9YA 4U5KA 2WLZA 4ZENA 4BS0A 4CD5A 4M82A 3M46A 1KR0A 4DO6A 2W91A 1HTYA 3OLEA 3N9KA 1V03A 3UETA 5BRQA 4UQEA 1B2YA 2BXZA 4FLRA 4PCSA 1XH2A 2W5FA 5DF0A 1VEMA 2BS9A 3BAIA 1RP9A 2PF0A 2DT3A 1H3GA 2IXUA 3ARQA 3W82A 3AICA 2YLAA 3D51A 2A3BA 5E70A 3VMPA 3VIJA 3OGVA 5CPQA 3PZNA 2GK1A 1VF8A 3H55A 3BAJA 3SUWA 1WPCA 2DH3A 2ZUVA 1E73M 3D4ZA 1KQZA 4MAVA 3PHAA 3A5VA 5CLWA 1ZL1A 2WMKA 1JZ6A 3CZNA 1UD3A 5F7UA 2QMKA 2Y2WA 1OGGA 1NWUA 4D1IA 3WD0A 4W5ZA 3PZQA 3VD9A 3HN3A 4BQ4A 5IDIA 4UFIA 4PTVA 4R5EA 3ZT6A 3QOKA 4AD2A 4ZFMA 1UWSA 2VX5A 4J3XA 1WAWA 1VB9A 1WCGA 1KGUA 2ALWA 3AMKA 3ARYA 1PEZA 3VSTA 1UASA 3K4DA 1VJSA 4AZIA 4V27A 1WZMA 1NP2A 3BVUA 4MB5A 1TFVA 3CPUA 2G3NA 5CZKA 4HOXA 3NJ3A 4OBSA 2WSPA 1OINA 4DUWA 5CJ5A 5E9AA 4HMEA 3PTMA 1JYVA 3AZSA 4ACZA 2DSKA 2V3GA 2J7EA 1HKJA 4TUFA 4UQDA 3F5KA 5GPRA 1EH9A 5FD0A 2VX6A 1UD5A 1UWRA 3HMCA 1DP0A 3VILA 3VIMA 1V3IA 4IISA 1W9PA 1CZ1A 4D6CA 2AAAA 1GZJA 4J3WA 6CGTA 4D6FA 4AMXA 1JZ5A 4W7WA 1CDGA 1E15A 5E0CA 4GKLA 1HL9A 1B3YA 1EOKA 1X1NA 2E9LA 3ZQ9A 1EQPA 4W8LA 2DH2A 4NRRA 5GNXA 1ISWA 4PMQA 4UOJA 1J01A 2J78A 3VDBA 3CZEA 3OG2A 1HKMA 3SCPA 1BQCA 3WQ8A 1U30A 5M03A 1MW0A 1LL4A 1E1FA 1C7SA 1JZ2A 3CMGA 3DECA 1TZ7A 3A4XA 3JUGA 3HZ3A 2WVVA 3WH7A 1W9UA 4W8BA 4PYSA 4AZBA 1H11A 3MV11 4IPNB 1QW9A 2XIBA 1ZU8A 4ML4A 2XN0A 3AIRA 5JBFA 4Q7NA 5CQ1A 4AC1X 3K8KA 3CTTA 3TP4A 1TQSA 2O9RA 4CD6A 3VGDA 3ALGA 1R33A 4FNQA 5M17A 5EBAA 4DWSA 2WYSA 4ZXLA 3U5UA 2E8YA 2J75A 3B9DA 1UOKA 1KB3A 3RJYA 5M3WA 2ESCA 3ZSSA 4UFHA 3FNDA 1V6UA 1HXJA 3K46A 5ABFA 2OWXA 4M1RA 3WEZA 1HJXA 2CITA 4C7FA 4PMXA 1GNXA 5GQBA 1R7AA 2WB5A 3SUTA 3GBEA 1NQ6A 3L4UA 1GORA 3DYPA 5A6JA 2CKSA 2EACA 4OGZA 3W24A 2JALA 2NW0A 1XV8A 4FNUA 1OD0A 2CCRA 2PWHA 4XZWA 1E4NA 4Z2LA 3AXHA 1MW3A 1HN1A 3TTOA 2PI6A 4W7UA 3RDKA 1GCYA 3O6AA 5EB8A 1PX8A 3HU7A 3SUUA 1E56A 2JIWA 3VO0A 2YLLA 1O7AA 2VQTA 3GDBA 1QX1A 4A3HA 1JAEA 3AS1A 3SCWA 1FHDA 1L0PA 1HXKA 3CV5A 2G4FA 1OD8A 3SCSA 1NWTA 3SCVA 1AQMA 4UCFA 3HG3A 1QNSA 4C7GA 2Y24A 3ZIZA 1JYXA 2WMJA 3W4RA 2DSZA 3CZKA 3AJ7A 4PTMA 2QPUA 3CUFA 5BXTA 2OW7A 4FNSA 3W81A 4GINA 1WZKA 1G5AA 3WNPA 3WL0A 5C8BB 2ZICA 3MUZ1 1E6SM 2WMHA 4TX6A 5E09A 1XSIA 3PZ9A 1JZ7A 2ZXBA 2WBGA 2X0HA 1XH0A 1GJUA 2WVSA 2WKGA 1CGWA 4A3YA 2DT0A 1OIMA 2A3AA 4D72A 1K9FA 1GONA 5DFAA 2O9TA 3AHYA 3WMSA 4AMCA 1L8NA 2J4GA 3WDIA 4WSKA 5HDRA 3RPMA 1HL8A 4DO4A 3VPLA 3DDGA 3UERA 3K1DA 4QDMA 2F7RA 1RD6A 3VKKA 3MO4A 1W1TA 4F66A 4H41A 2VZUA 1GQLA 4OUEA 3OLDA 3WFZA 3GZAA 2YOCA 1HP5A 5A8PA 1JXJA 3H54A 4MNJA 2EXOA 4P8UA 2J62A 3U57A 3EDJA 4HA4A 1NH6A 5A6KA 1US2A 1C3FA 3RM4A 2XJ7A 1E5JA 2OSXA 2JFEX 1C8YA 1CTNA 4UQ9A 1E0VA 3F4VA 4MJ4A 4XB3A 2D1ZA 1GOWA 4IUGA 4DWSD 3WMBA 2XTKA 8A3HA 1ODZA 3VDCA 1TMQA 1XH1A 2VJXA 2YDRA 4H8VA 3L4TA 1EIBA 2EPNA 3BVWA 4UFMA 1C92A 1LQ0A 3WUEA 4URIA 3CH9A 1UD8A 4UFKA 1IV8A 2EBNA 4H7VA 2JE8A 2O92A 3ZJKA 4DUVA 2Y4SA 3BUPA 2UWFA 3WD3A 4AIUA 1Q6GA 2YFOA 4BA0A 1HKIA 2PWEA 3DX1A 3PN8A 5A6SA 3MUAA 2W62A 3ZOAA 2DIJA 2J8FA 3ZSTA 5GNYA 3OIHA 4WJXA 1UWUA 4JFUA 4M56A 4LPCA 2YA0A 3O2LA 3VMNA 5AYIA 5FIPA 2XG9A 3WDJA 4WIWA 2XSBA 3DYMA 4P7OA 1JFXA 1ZS2A 2ZX9A 3A23A 1UYQA 4BQ3A 3CGTA 4PEEA 1XD1A 3WN6A 4S3JA 2YL8A 4HZ7A 2Z1KA 3EJUA 2UY4A 2FHBA 4YHGA 3TA9A 4H8UA 1ZJBA 1J12A 3LPFA 1UHVA 1RP8A 2VVSA 3EDEA 1O6IA 2Z1SA 4RE2A 4HOZA 4X0NA 4OJYA 3W53A 3WSUA 5E6YA 3GH5A 2CHNA 3CO4A 1KGWA 4QAWA 1YHTA 4HA3A 1MFVA 4NZFA 4J27A 1HJSA 4MB3A 3WH5A 2A3HA 4EE9A 7TAAA 4UQAA 1NOFA 1BGAA 4ZE5A 2E9BA 3HG5A 2QMJA 1G0CA 1W3KA 3AYSA 4AZHA 4PTWA 2GUYA 2WXDM 4PUEA 2XVLA 2WHJA 3T0AA 5I6SA 2CYGA 4GPNA 2CBIA 3FAXA 2X2HA 3QHNA 1KGXA 4UQBA 3A47A 1J11A 1FA2A 1FHLA 3WUGA 4FMVA 1BG4A 1VFUA 1QI5A 3F5LA 5AC5A 4JCLA 4NX0A 5A94A 2WMIA 1JDCA 4CN4A 1B30A 3SCOA 2OLHA 1C8XA 2F1BA 3TTQA 2J47A 3MI6A 2ZUWA 5A69A 1E0WA 1DWAM 2D3NA 2PBOA 4QCFA 1BYDA 1V02E 3WF2A 4Z2IA 1E4MM 3N04A 3UESA 2XVKA 1B9ZA 1QOXA 1AQHA 1V0NA 4J3SA 2J7CA 3NYDA 3WELA 2WK2A 4CCEA 1EDTA 1IZJA 1BF2A 3PZIA 4YN5A 2WSKA 3OGSA 3BSHA 2E8ZA 2O9PA 2BV9A 2VX7A 1N82A 2GJXA 1UKOA 4CVWA 3WQWA 5FCZA 2VCCA 4ZEPA 1OM0A 1ITCA 3LRLA 2QF8A 5JUVA 1R85A 2BY2A 1CWYA 4HPHA 2XN1A 2F18A 4PMUA 4TTUA 3WNOA 4PN2A 1G01A 2V3DA 3VD5A 4BZYA 3CHEA 3AI0A 1TQVA 3WFLA 3A22A 4U31A 4CD8A 4YPJA 2X8RA 1TQTA 3THCA 2ZXAA 3W6MA 2OYKA 4W86A 2D20A 3FW6A 4LYRA 2BHUA 2XVPA 2CBJA 1E6NA 3NSMA 4NRSA 1EOMA 1CIUA 1UD6A 5I77A 1XD0A 3WUBA 3MMUA 1QI3A 2J7BA 1V3LA 1UZ1A 4AD3A 2C8NA 3WDPP 4D71A 3GYCA 4XX6A 4JFTA 3EMQA 1PIGA 3D50A 1HJUA 3WQ6A 3D3AA 4P8XA 1WDRA 4H2CA 2EPLX 2ZXQA 1W3JA 3PBGA 1JDAA 5EMYA 4AY1A 4WKAA 1HVXA 1I1WA 3WEMA 2YL5A 4LGXA 3TONA 4OBRA 1PPIA 3WKZA 5A2CA 1C7TA 4U2YA 2YBTA 3EJSA 2V38A 1F4AA 3BUBA 4YHEA 1QWNA 3VGGA 1J0HA 4MNLA 1TA3A 3WNLA 4X0VA 5AYBA 4DUXA 1EDQA 1UQYA 3VM7A 2XFYA 3AZTA 3WBAA 1E72M 2W92A 3BLBA 4F9JA 3AHZA 5KZ6A 4D6HA 4GO8A 1H2JA 4HMDA 1OGSA 3EJQA 1H1NA 5CPTA 1VBUA 3RCNA 2XGIA 1AVAA 4AZ5A 2QLYA 5E1QA 2ZWYA 3L4ZA 4UFJA 5HOSA 1Y7VA 2DEPA 4HPGA 4HP5A 4MB1A 3PTQA 2UY3A 2E9MA 1CXKA 3FHAA 2CBUA 3QGVA 4GZEA 1PJ9A 3N15A 5EFDA 1UKPA 1T0OA 3AQUA 3L2LA 3A4WA 3WDQA 2WZEA 1B3VA 1DWFM 2BVDA 2ZUUA 7A3HA 3KWXA 4OOZA 1WB0A 1KFWA 2YFNA 3SUSA 4AWEA 4ZXOA 1OT2A 3VGEA 1TVNA 1KQYA 2VRQA 5M5DA 4MNMA 1UR2A 2VR5A 2GK1B 1JXKA 1O7DC 3U7BA 4WF7A 4F8XA 1BGGA 1YQ2A 4L4PA 4P7LA 4WLCA 2X09A 5EFFA 3OGRA 1CNVA 2Y8KA 1CBGA 1J0YA 1XGZA 3BVVA 4MDOA 1J0JA 1JDDA 5D9OA 2BXYA 4AD0A 2F7PA 1UD2A 3VIPA 1HJWA 3KL0A 2EPMX 1HIZA 4FLSA 4JFWA 5ABGA 4PSRA 5E0FA 1MXGA 1UD4A 1E4LA 1EQCA 3VVGA 3A4AA 1R87A 1EO7A 1TE1A 3VNYA 2WZHA 4W5UA 5CGTA 2D73A 1CGUA 1MW1A 5A8OA 2WANA 2JEPA 5D9NA 2EQDA 2G3IA 1J0ZA 2DSWA 3I3BA 4H8HA 1R47A 3SCQA 3WQ4A 1V6WA 1DWIM 1MVYA 1VRXA 3B9AA 1W2PA 1TUXA 5A8NA 3AXIA 1TQUA 5A6AA 2WC3A 3MANA 3ARWA 2D0GA 4J3VA 1PX4A 1Q6EA 2VZOA 1EDGA 3CIVA 3AMLA 1H0IA 2DPEA 3U7VA 3WH8A 2V5CA 1ISXA 1LG2A 4GI9A 2A3EA 3APGA 3G6LA 1I1XA 1B31A 3WH9A 2AOSA 4HTYA 2OYMA 4UFLA 2YA1A 1EHNA 3K8MA 4IPLA 3BCFA 2DGAA 4W8AA 3DX2A 5BXPA 3T2OA 2ZUNA 4LX4A 4W89A 3WNNA 3QR3A 2ZX5A 3U5YA 3ARPA 4LYQA 4JZ5A 4MB4A 4JFVA 1ZBWA 1W3LA 1MQQA 4B9ZA 1V6XA 3MUY1 1MQPA 1WP6A 3GXTA 1JZ3A 4MDPA 4GIAA 2FHCA 2XN2A 3KE0A 4AYSA 1B3ZA 4QP0A 1E70M 3I3DA 4P7NA 1C90A 2VCAA 3TV8A 2VZVA 1B1YA 1CGXA 3IK2A 1JG9A 2WMGA 1ZBKA 2XFRA 4ATWA 1XCWA 2FH6A 1VFMA 2WC7A 2FGLA 4P8VA 1DWGM 3LXBA 3NDYA 4V2XA 5BCAA 1LWHA 4DO5A 1E4IA 3J7HA 1HKKA 2FE0A 2CERA 1CXHA 4CN1A 3VM5A 5JBEA 2J7HA 4MTVA 1B0IA 3EJPA 2VTFA 1UR0A 3UEQA 4TTGA 2OW6A 1UUQA 3VIGA 1UZ4A 6A3HA 3N18A 4JKMA 1V6VA 1OGBA 1GHSA 1QBBA 1MQRA 1W3HA 4FF5A 2TAAA 1RH9A 5DEZA 1V0KA 1CENA 1D3CA 4PMZA 1WKYA 1ECEA 1QNPA 4U3AA 1I75A 1FP9A 4CKQA 3LMYA 3VINA 4HA1A 3S5ZA 2X1IA 3CC1A 1JD7A 2J79A 2GDUA 2X2JA 2FH8A 4JFSA 3RIKA 1MYRA 2XVNA 1JF6A 1QNQA 1OIFA 4RE4A 2WHLA 3KLLA 3TOPA 4R27A 1WZLA 3KL3A 1SZNA 4BCEA 2JF6A 3BMWA 1ZBVA 3WF1A 1UR1A 4NXSA 1M03A 3AIBA 1ISZA 3PZOA 1V3JA 2XSAA 4CU6A 3DHPA 2FDMA 2GSJA 2W67A 3THDA 1G94A 1LF1A 3VIIA 2XVGA 1WE5A 3T0DA 5HBFA 4KRUA 1LL6A 1QWUA 1W91A 4AD4A 3OZOA 3W28A 4EK7A 5IFTA 3POHA 1UWTA 4LYPA 1V3KA 5CXPA 5I3DA 4UQCA 2WNWA 3UG4A 1LLOA 1J0KA 1KR1A 4EKJA 4B16A 3CZ8A 5BRPA 4JHZA 1JAKA 1R86A 2CESA 4E8CA 5CGMA 2XYLA 2GJRA 4FNTA 4RL3A 3UG5A 4TX8A 2D24A 1XSJA 1BAGA 3O9NA 4JIEA 1R75A 5FL0A 3GH7A 1BG9A 2WPGA 2F1AA 4JKLA 1G9HA 1C91A 1W32A 2DSVA 4AIOA 3H53A 3EBVA 4M81A 1G1YA 4BQ5A 1W9XA 3A24A 4B15A 1R7OA 1MXDA 2WHKA 4W93A 3F5JA 4D1JA 1FP8A 1GOKA 3GXNA 3DDFA 3CUHA 3MS8A 2F61A 4J3TA 4GI6A 1Q6FA 1QHOA 2DT2A 3BCDA 4NZCA 5A1AA 4HMCA 1WNOA 4WKHA 1GVIA 2CPUA 4MPKA 3T2PA 2HISA 3VX1A 4HOWA 1W1PA 2D3LA 1X6LA 2VR4A 3GXPA 1J0IA 1GQIA 2OWCA 3OA5A 1FFQA 1ESWA 4PMOA 5IHRA 5CSYA 8CGTA 3N1AA 2ZX6A 1OWQA 2YL9A 2OSYA 4KMQA 5A95A 1CEOA 1PX3A 1GW1A 5HPCA 1W9DM 2NT0A 5ABHA 4CVUA 3EMZA 1XCXA 1SFSA 2B31A 3IAPA 2C7FA 2WW5A 2PWGA 3WY4A 2Y5EA 1HF6A 1QI2A 2DDXA 2PWFA 1HJVA 1VFFA 3AIWA 2ZOXA 3HG4A 4EAMA 4HU0A 1UKSA 1Z32X 3SEPA 1TQWA 4ATLA 5BYWA 2G41A 1SR0A 1K6AA 2WLYA 3FXYA 3PZUA 5KEZA 4JCMA 5D8WA 1J18A 2VL4A 3GNPA 3BAWA 3CUGA 5A6BA 3FY1A 1Q6CA 1V08A 4AXNA 4PBGA 3L4XA 4W88A 3QOMA 3VDHA 2J7FA 3DX0A 4KGJA 1UQZA 2PWDA 4UZUA 4D6GA 4W7VA 2VOTA 2XM2A 1E5NA 1KCLA 4Z2KA 1B90A 1TCMA 1HVQA 2V3FA 3SCUA 4M8UA 2VRJA 3B8SA 2FHFA 3AS2A 1B3WA 1KBBA 4LQ1A 2FYVA 1ISYA 4XZBA 5IHSA 1E55A 2YA2A 1LWJA 1PS3A 3CHDA 3SUVA 4MJ2A 3N11A 2WMFA 4PRWA 4AW7A 4PMYA 5C70A 3ARTA 5ABEA 4OKDA 4D6DA 1VAHA 3GM8A 4XV0A 2CNCA 1V0MA 2GJXB 2PBGA 3CHCA 3EJRA 1Q6DA 1W9VA 4CCDA 3CZSA 1UR9A 1X6NA 1P6WA 3IAQA 2A3CA 3BAXA 4WK9A 4UOZA 5C71A 4Z2HA 4LXFA 4GZIA 1EO5A 2F7OA 2E0PA 3SIMA 1TG7A 4AZGA 4EANA 2WCGA 3AHXA 1KBKA 1QNOA 1VJZA 3ZM8A 9CGTA 4AZCB 3AYRA 3D5HA 2CETA 3S6TA 1E3XA 1UKQA 1GOOA 5A8QA 3ARUA 3CHFA 1B3XA 3UR8A 3AS3A 3EDFA 2YIHA 3A6OA 2AMGA 4U33A 3W29A 1BPLB 2VZSA 1MW2A 5LA2A 2X2IA 1ZBCA 5HXMA 1U2YA 3VIHA 1JL8A 3AMCA 3VD3A 3WF4A 4Q22A 1F4HA 1WZAA 3BGAA 4CUCA 3CZJA 3CBWA 3FN9A 3ARZA 3GH4A 5D9PA 1LG1A 4B3LA 5DMYA 2UY5A 4HU8A 1ISVA 1KXVA 3CUJA 4IM4A 3L2MA 3ZMRA 4GI8A 2ZX7A 5LA1A 3GTNA 3AXXA 5A6BD 4AD5A 3ZT7A 3WMCA 5A2BA 2VMFA 3AMGA 1UH3A 2V3EA 5I2UA 4JHOA 1WDSA 3BC9A 3AMDA 1CGTA 3PTKA 4V28A 1JYWA 3D4YA 4PMNA 4E4PA 4M29A 1QVBA 4KH2A 3NSNA 1JFHA 4AYGA 1CGYA 1DEDA 1BVNP 2WM0A 1W9BM 1GHRA 3L4VA 5IFPA 1PZ3A 1K9EA 4NI3A 4FLQA 1MWOA 1VEPA 3OB8A 1E6RA 4P8WA 4BQ2A 4FK9A 3AHVA 1BHGA 3CLWA 3ECQA 3VIFA 3MKKA 4K68A 1UKTA 1K9DA 4QLLA 1U33A 4ATDA 3DX4A 1JZ4A 2J7DA 4AMWA 1QHPA 1JYNA 5AC4A 2Q8XA 1OCQA 4AD1A 3T09A 4TVCA 1UA7A 3SURA 1BTCA 2J25A 4F79A 1J10A 1FH8A 1C93A 2VRKA 1C8QA 1E9LA 5FL1A 3WY1A 3WDRA 4UZSA 1QNRA 3AFBA 3L4YA 1JI2A 1GVYA 3AIEA 2ZUMA 3MSDA 1JF5A 2XHYA 5CPSA 3MUIA 4M24A 1HJQA 3T08A 3WENA 1QI4A 3WD2A 4S3KA 2ZUTA 4UTFA 4U2ZA 2MANA 2VVNA 2VC9A 4DM2A 3N17A 3LPPA 1XRVA 3HJEA 4AZ7A 4NF7A 3FAWA 1VFOA 2YKKA 4ACZB 4E2OA 1BLIA 4KGLA 4CU8A 3ZJ6A 3GXMA 1K9TA 3WIJA 5BXRA 1R34A 3KEHA 3A21A 1E6XM 1QHZA 2XM1A 1PIFA 1NOWA 4RE3A 5JIPA 5LYRA 1M7XA 2EEXA 3BLKA 3S5YA 1LL7A 1H0GA 2WC4A 4W84A 1UH4A 1H5VA 3AIVA 4KRTA 1UH2A 1US3A 3EMCA 5AY7A 5IXEA 3LXCA 3N12A 2BY0A 1M01A 2PC8A 3OLGA 2DQXA 1NWSA 3VMOA 3WNKA 2BHZA 3VGFA 1CXLA 1D7FA 3L4WA 3RO8A 3FHQA 1IZKA 1ITXA 3W6LA 2ZX8A 3VGBA 3AHTA 5JIWA 4QCEA 1S46A 2QV4A 1WO2A 1E1EA 2CHOA 3AIQA 2WZIA 1E3ZA 1IT0A 2WVVB 4FLOA 1XYZA 1ODUA 3M7SA 2ZUSA 2Y8VA 3BXWA 1FH7A 2XIIA 1KWKA 3QHMA 3EJTA 3IANA 5I23A 1UWQA 1E6PA 1GQJA 1JNDA 3WUFA 5I5RA 5FKYA 1NM9A 1GQKA 1CXEA 4QFUA 2X0YA 2YBUA 4H04A 7CGTA 4XUYA 5DT5A 1CECA 4J3UA 1EA9C 2WHMA 1UWIA 3AISA 1KTCA 2BHYA 3LRMA 5A8MA 4DWSB 2F7QA 2DSUA 3W38A 3UCQA 1HP4A 3K4AA 2VCBA 2BFGA 5ABFB 2XGBA 3WD4A 3WD1A 4CD4A 3T0BA 2F2HA 3PZMA 2G8ZA 1SMAA 1QI0A 2DIEA 3EDKA 4PMDA 3WL1A 3WF3A 2OSWA 3MMWA 2D0HA 2BY3A 4FNRA 1NP0A 2HVMA 2RGLA 2WCSA 1GUVA 3EYPA 2EADA 1FOBA 1PZ2A 3GBDA 1W2VA 2JF7A 1WDQA 3NUKA 5BXSA 3BVXA 1UR4A
chains in the Genus database with same CATH superfamily
4TSBH 2GSGB 5E8DL 4PJEA 2O5NA 3ESUF 1NLBH 3O6FA 3FH7A 3KZSA 2HZGA 3U9IA 3P40A 2OK0L 1WC7A 5KTEL 1U92A 3VSVA 3O3AB 4N2LA 3L0NA 4N42A 2PDNA 3MHUA 1NOAA 1OB0A 1HT6A 4JR9H 4TMBA 1JHLL 1RZJL 3NIGB 4L8BA 5INCA 1XGDA 3MUGB 5JHLH 1BFNA 2PEVA 3HZVB 3HBGA 2NUTA 1K85A 2CKBA 3N34A 5DVNA 3LV3A 3CB8A 4N02A 4L23A 3VXNA 4NOBA 2VXUL 5IMMB 4F3HA 4FOKA 5I1DB 1OJXA 2W63A 4OIAA 1Z8AA 1HKLH 3CBKB 1LUCA 2GW5A 1KFAH 3WFBL 4BCXA 3TJEH 3EW3B 2WQAA 4OZGF 3VSUA 2CQVA 4OTXL 5C0RL 1FWBC 1T96A 2NNAB 3H7LA 3TH2T 3ZQWA 2AJZB 4WI5A 1JRBA 1FWGC 5C0BD 2Y1ZA 2XFFA 4Y1AD 1LHZA 2AJXL 5A3HA 3AO0A 4LVHB 3RLGA 4PSPA 1MI5A 3AXKA 4QSHA 1XGUB 1WDPA 3LTPA 2OP4H 1I8IB 1IGIL 1UWGL 1UQSB 1D2OA 3REVA 3RX8A 4XN7A 3QC3A 4XOBA 1K7FA 2E7LC 4IS6A 1AD1A 2G5UA 3QA3B 3MGOA 1AZVA 1A5MC 4F20A 4PUDA 4Z8FL 2WIIB 5FB8A 4LVBA 2NT1A 3CUIA 3O9WC 3PZVA 4B3KA 4XSLA 4OH2A 4NP7A 4S3DA 3BV4A 3KCPB 4WZ9A 3SD5A 1M05A 3P0VH 3HRZA 1JN6B 3R94A 3HG0A 1QSEA 5ICXA 1QYGL 3MBXL 1W72A 3D07A 2BNRE 4NM4L 4BFIB 4PUBH 4F58H 1S2EA 3HC2A 3G3MA 1BFTA 1J1XL 5DD3L 3VXTA 1DDHA 3RZCA 2AGJH 4MAYC 2WMIB 4WGKA 5F3BB 1SEBA 3L95A 5G55A 1S2WA 3FK4A 2R0ZH 3N2XA 3FA3A 4XX5A 4HPJA 1BQHB 2EDKA 4OZFH 3AOFA 5AZ2H 5HDBE 5DMGD 2TRYA 4LUSB 2X40A 1RUML 3W0WE 3KPOB 4E68A 1BQKA 2JKLA 4LRSA 4JO3H 3CH1A 4HWBA 1VZGA 1EV2E 4WY7H 2VDRB 5F2GA 2WQVA 3W37A 2F08A 3WBEA 5FEBA 2LR4A 4L1GA 1VFAA 2D4FA 2VWTA 3X3GL 3HI5L 5I76B 4RMWA 2BVWA 2VKZG 5EZJB 1Z7JA 4XAZA 5EF1A 3LMJL 5FEZA 5FO8A 3TW9A 3SKMB 2FIKB 3GXFA 1FZMA 4WSGA 2IQAA 3RM9A 1A2YB 3K71B 5C7XL 4RCAA 5IOBA 2APWA 1R3YA 4PJHA 5FDYA 3FOLA 3TXVA 2VI0A 2OZ4L 4Q7IA 1CLYH 2W27A 4FI4A 1XBXA 1TKWB 3TA6A 1DVFC 4RDBA 5IUSA 1TA3B 4N2YA 2OPCA 1FZOB 3SD2A 2QDHA 4FZEL 3T8QA 2R1WA 1KNWA 4AF0B 5HNNA 3HO8A 2ZTJA 4R0LA 1GOMA 3FQRA 2XQBL 4JY6A 3PSVA 3ALPA 3G6AB 2C1OB 5GSRA 5TQLA 2H1PL 3A3WA 4HHAA 5D7JA 5KG9A 3G1HA 2WNQA 4I1RA 5I1JL 5JDSB 5BUPA 3DGGA 3DTUB 3APFA 3HLAB 3VIJA 3OGVA 2VN3A 1OAXL 5GRYA 4X50A 2QGHA 3BSZH 1T1ZA 2KDYA 3P30L 1PCKA 4L3AA 3DX6A 4X98A 2YD4A 4YHKL 3ZT6A 4Z7UE 4KBPA 4AG0A 4KEZA 3LNGA 5JOEA 1K2DB 4B9JA 4XPBL 2IGLA 3VSTA 3F58L 5IVNA 3IGXA 1CD0A 5LGHH 3OAZK 4MASA 4H2HA 1TQJA 1QLFB 1WUEA 4OCRH 5KVDH 3W1NA 3MU3A 2QV2A 2FYYA 3WI9A 1ZGLM 3BGMB 4Q2ZA 3SE9L 4K8RL 3PBMA 1HXYB 2KLSA 2GPZA 1MFEL 4WVRA 4JDBA 2LU4A 5GNXA 1KBWA 4UOJA 1J01A 3OG2A 3DUUB 3QFJD 2B1OA 1BQCA 3WQ8A 5T8GA 1LL4A 3A4XA 1IM3A 1S38A 3FB8B 5DYOB 4P5UA 5IVZB 1TPWA 1MHEA 5DI8A 3S96A 1DFXA 4JFEE 5F6HJ 4YL2A 2ODOA 3BO8A 3WFDL 1QTYT 3QZOA 3ZE0F 1N0XL 3R8HA 3S2AA 4NGHH 1JNLH 3ILDA 2D2GA 2VITA 4Q56A 5K9QI 3AG1B 1R7AA 2CRIA 4LNCA 4NC1C 2ZP8A 3WS6A 4IKJA 1IL1A 1K1DA 2YAQA 4KKQA 5D32A 4XVTH 1BAFH 4JGMA 2PDQA 5DXWA 1DQWA 5K1NA 1XGRB 2H90A 5DEGB 2LAGB 4KETA 2JIWA 2VQTA 1QX1A 1RL1A 4XP4L 5CEXA 1N2VA 4RZ6A 2X1XR 5GJTH 1NWTA 2VFDA 4ENLA 3W4RA 1LOSA 4YQXH 2DI7A 3WNPA 2K6YA 1O75A 4ZOEA 1T8XA 4HCRH 2QCMA 2LU5A 3COOA 2XN9D 5DK3A 3WTUA 1IUZA 4L8CA 4G59C 2YX0A 4EDXB 1YE4A 3O3EA 1KPUA 3LNFA 3Q2DA 2W0LA 1V93A 1V7NL 4JFDA 3MO4A 3OKKB 1W1TA 3KLDA 1E9ZB 3OLDA 2XC8A 3UBXI 3EBAA 3H2AA 3MNWB 2IQ0A 3NSFA 3SPVA 2WZPD 4RW3A 4GACA 5DK0B 1QWHA 3DFQA 4XAFA 4KWOA 4MJ4A 5C0FB 2X7WA 4OCXH 1KJ2A 4YDZA 1HHKA 1ODZA 1S9WA 3V79C 3L4TA 1QLRA 1EIBA 4J8RB 4UFMA 3Q6FB 4WQOA 1R3HB 1ZHLA 1UT2A 1BD0A 4Y9FA 5H4ZA 4K2UH 1OE3A 2YFOA 4QIRA 4BA0A 4ZVJA 4HNNA 4ZS6D 1SPDA 2DIJA 2J8FA 3RBSA 4JFUA 3LHWA 5FIPA 5GGRY 3DBXB 1GTHA 3CGTA 4PEEA 5T3ZL 5DUBA 3PVFA 3TA9A 1C1EL 2B9AA 4PJAB 3MBEA 4FP8L 1YPZB 2C4XA 4PJ7E 3ITYA 3CAWA 3FO1B 1VR6A 5F97E 1BKSA 3NZRA 4XOEA 1WCQA 2E9BA 3WGVB 1VCBC 4QHRA 2J9YA 3HE7C 3ZDZB 5H37G 3FGCA 2WXDM 4PUEA 4MY1A 3T0AA 1E5CA 1QDSA 5I16B 3GR7A 4LNYA 1J1OL 1C16B 4N2HA 4QKXB 3TBWA 1BG4A 2INFA 4A6YH 3HS0A 4I3RH 3EOAB 3EOOA 3N42F 4L3ED 4NCC2 2OX5B 5A5WA 1U36A 3NYDA 4FKKA 2X12A 1CTMA 3DFYA 2WSKA 3OGSA 2ED6A 1QXLA 5FUOL 1Q66A 3F01A 2EC8A 1ASPA 3RDTC 3MLRH 12E8H 3SJVB 5JHMA 2XN1A 4TTUA 1FBAA 3WNOA 2IEPA 3OKYA 4CD8A 2D20A 4XZIA 2XVPA 4WUUE 4NRSA 2IH8A 2DWEB 1PKQE 2R2BA 3LIZH 5FJIA 3ECWA 1V3LA 1UZ1A 1I7RA 3B8VA 3L5MA 1IBFA 4N0FB 3ZHLA 4IMDA 3IPEA 1JCYA 4RZ5A 3PQYD 4LBEB 5KSBB 5DJ0A 4XNUL 4J1OA 3FQTB 3S3JA 4U2YA 5G4EA 1S9VB 4FQXB 3EJSA 1FXQA 2UY7A 1J0HA 2VXTL 3W5NA 4N2EA 3VM7A 1OAZH 4REQA 4ERIA 4KFOA 2CO2A 3PDGA 4GAYB 1OGSA 1H1NA 5L2KE 4KJYA 3C0QA 1VZWA 5CC3A 5ERWA 3W0WA 5GJMA 1IGTA 3DUSB 4G8FB 4YVPA 5FC9A 4HGWB 5D4IA 1AFVL 1OCWL 1TLKA 1OSZB 1DQMH 1INEL 1FCVA 2P80D 1P4UA 1WB0A 3FB6B 4QOKA 3NQBA 2JCCA 4IBZA 3ASOB 1RBAA 3X14A 2W3ZA 3UQNA 4L4PA 4ZFOL 3MACH 1HHGA 3GXUB 3R1ZA 1AHWC 3OZLA 1F6AA 1GY1A 1F58L 4NY2A 3FTZA 3QZBA 4I0PD 5GGSA 2PDKA 1R9YA 5CZSA 5KSVA 2Y1HA 3NVQA 1OK0A 5FUCE 3QPKA 4B90A 3PUGA 1SBSL 4E2DA 3BCJA 5CGTA 5A8OA 1FLRH 5FHAL 5DS1A 3PR2A 3MMTA 1CLCA 3Q9PA 3FSOA 2ZRWA 5EU6D 4N5ED 4IHOB 1AJ7H 1H8NA 4NJAH 3ML9A 4ODHH 4NRXB 4FF9A 1WKDA 3UZEA 3FZUD 1SQ2N 3P2TA 1NGYA 1DL7H 2ENSA 5FF6B 2D7OA 1A5UA 1XF2B 4IBLT 4H6EA 3SN0A 4RFOL 2CIIB 1LG2A 2WQUA 3W9DA 3D2TA 5ETUA 3LBOA 4UFLA 1QMUA 2OYMA 3BOLA 4FX6M 1JK8B 1NLDL 3TO4D 3GMPA 4C55A 2B7NA 3FK3A 1NF0A 5DS8B 1SVZA 1BYPA 1Q9OB 2IV8A 2NV9A 5FJOA 1MQPA 1EJFA 5LCVA 1R38A 3IGAA 1MUCA 2WZMA 3PWGA 3U7WL 1ZHBA 4ZXBC 3TV8A 1QBMH 2WMGA 3IXAA 4XKYA 2UV8G 3AXLA 4ZMTA 2VLRA 2ISVA 1E4HA 3N91A 4JN1H 4QRRA 4JHUA 4FTVD 1LDPH 3FA5A 4BCZA 3GR8A 1XYBA 4K94C 5D33A 2JIXA 2ENYA 2XI9A 1ZXKA 1XYMA 2EILB 1RJYA 4GBXA 4NCDA 1VGKA 3DRTA 4WI8A 1D3CA 2BW4A 1W37A 2GBVA 5C0NC 3NGBB 2YD2A 3U9WA 4HA1A 4CILA 2H8PA 1I85A 1OYCA 4L1HA 4NAEA 2PCPA 1NA8A 4Z7NB 2APVA 2BOGX 3PB2A 2WHLA 2J57A 1B0RA 4K73A 2JF6A 5H37H 1NLBL 1LVEA 1JPSL 4MJZA 3DHPA 4QCIA 4WY0B 1JXFA 3NCBB 5HBFA 4OKVA 1QJWA 2Q3OA 5CSZA 2BCKB 4JR9L 1LLOA 1V5JA 5HNRA 3GLDA 3LKNA 3DTXB 1BAGA 3O9NA 7XIMA 1NBCA 1VLXA 4G6CA 2O6PA 3SOBL 2Q86B 2JJSA 1XHHA 4LS0A 4JKLA 3LBCA 2J6EL 3DETC 2WWMC 3H53A 3IPWA 1F3JA 1HKLL 4M8VA 1KFAL 4J3TA 3TJEL 1YQVH 3CUPB 1I8MB 4DXKA 1U42A 4X4ME 2LE9A 4PLJD 2XH7A 3CAQA 2IWFA 2V9TA 3U0PA 4PRHB 4PVMA 2EYSB 1S7WB 3EGXB 3ILQD 4A7GF 3BE7A 1XIWD 3EYOA 5CSYA 1JHKL 3GC3A 3IJYB 1KBLA 1XZWA 2CBOA 4X42A 2CXEA 2A6KA 2OP4L 3ECBB 5LKNA 2DZXA 2PPEA 3QIBA 3MSPA 4K8RD 5I6LA 1HF6A 1HJVA 2BX5A 4EAMA 3WEBA 1BZ7A 3WFHA 4B0MM 3O2WH 4PRNA 2DWXA 3BZDA 2RALA 4PCYA 2CO7A 2BDNL 2WQWA 3G8RA 3WCYA 3L4XA 2KC0A 4KK9C 2A74A 2IMNA 2X2GA 3SE4C 3FUDA 1T0NB 1DXIA 4G72B 1GG1A 2R29A 1FVDA 3P0VL 2KT6A 2NXYD 1PV8A 3RRQA 3IFLL 4QO1B 3GRIA 3MRCA 4OLEA 4PUBL 4F58L 1E65A 3X12A 1KB5A 2HLFD 3GNNA 2FWSA 1GTFA 2A3CA 2AGJL 4XMZA 4LS2A 4GZIA 1JVLA 2R0ZL 2B08A 1WUZA 2DFAA 5B8CB 5AZ2L 3O6LH 2AJ3A 2B9BA 1CICB 3PDOA 1W5QA 5MHBA 2VFHA 3EYSH 3GYEA 1DKWA 4JO3L 1HO4A 5DSCA 4R7JA 4AFYA 4WY7L 3GSNL 4Z7IA 2K9FB 2WJFA 1PNCA 1FI8C 4PJDB 5T5FA 1JL8A 1L9NA 4JYEA 1BVNT 4J4KA 4RMQA 2XIJA 1F0LA 3SDXB 2Z1VA 3IF1A 4Z7OB 2HN7A 2AEPH 2CGZA 4EI5D 1NIAA 4H8NA 2FTWA 2Z4GA 4PMNA 4TUOB 4BH7B 1PYMA 1T0PB 4NN5C 2VEKA 4AYDC 2OB3A 1CLYL 4AHQA 1MZRA 3IDJA 4PYHA 4APQA 3QQXA 3JQOB 4BIKA 3C60C 1E6RA 2BNUB 3T81A 3BD4A 4CGUB 1RJPA 5F4WA 4LBRA 4UM9B 4MMYB 2DZPA 4WUUA 1TZGH 3OF6D 1RZGB 1PKQA 3KDNA 4WJ8A 5HANA 3MJ9A 1NCIA 3BARA 1B3IA 1LDCA 2R1LA 2NQDA 4KRLB 2XH4A 3IVUA 1NANI 3C2FA 1BKHA 1XINA 4KKAC 5T3ZD 4S3KA 5HDLA 3LQLA 3TYGH 2ZOTA 1CD9B 4CNPA 3DARA 4F2MA 2QPDB 1RULH 4P2RB 3ZDYB 1AXIB 4V1DA 1NGPH 5J11C 1QHZA 4L7ZA 1MELA 3LZ5A 3TV3H 1MY7A 4HMNA 1H5VA 1B4EA 2BOFX 2BHZA 3QJTB 2ETWA 1I4FB 1CXLA 1R3KA 1D7FA 3NQKA 4WI6A 4TLKA 3W6LA 2IBBA 2R0WH 1V54B 4HZAA 2Z31C 3L3HA 1XYZA 1OGTB 4OCRL 5KVDL 4BE6A 1JGDA 3EJTA 4G8TA 4OSUH 1RCXB 3CN3A 4Q7BA 7CGTA 3S7GA 5DT5A 4N68A 2BHYA 1U8PA 2DSUA 8RUCA 3UCQA 1YDOA 4DGWC 4F7PB 4NZDA 1EHXA 3NZUA 2I16A 3WD1A 1N10A 4KKCD 3UWWA 1EXGA 4XI5D 4WU7A 3MMWA 2W0KA 1FOBA 3GBDA 2JF7A 4WDIA 3K7UA 2R24A 2LABA 3IRZA 3VU2A 4M4RB 4GY0A 2ZUXA 1EZUA 1TVHA 1QO5A 1JNLL 3O9WB 3KBVA 3MV7E 1G1OA 5FGRA 4LEOA 3R0KA 3FRUB 1I7UA 2C0AA 1I9IL 4CCZA 1QFUH 3H2NA 5GZNC 1BVLB 5IT2L 2CKNA 4I2XB 1N9PA 4YLWA 3HKFA 4WENB 4PJIA 3LCIA 4ADSA 3VD4A 3GX9A 1W1VA 5GJTL 4MAYB 2Y6ZA 5BWAA 1K5NA 3ARVA 4YQXL 3ARSA 4KBXA 2C1PA 4G9FB 3I7RA 2VQ1B 1I8KA 4MFDA 2QSQA 3MV8B 3BQ6A 4L65A 4HCRL 4UV4L 3OGCB 2P5ED 1E28B 3VOCA 2QPSA 4TS6A 1NMCC 1ED3B 2DQJH 5K1VA 3TQKA 4C83B 4ODXA 1SXBA 4YGVA 1NSNH 4GZJA 3DURB 3DN5A 3QJAA 2AZUA 1MRCH 3KLKA 4AWUA 1XJBA 4US6A 2VAAA 4BWTA 1U93B 1NOUA 3WV0A 2J88A 1MFDH 2CBVA 2YSTA 2G5BA 5C0CD 4ONHA 4OCXL 1H51A 2GLKA 5AW5B 4RZKA 4YDKH 4M6OH 5CEWA 4NSBA 1JDEA 5TD4A 3GRBA 3WNMA 4PWEA 4JDTL 2W1NA 1E43A 1F2QA 1DVFB 2ZXEB 4UIMA 3LPGA 3AUOA 5IW1B 1V3HA 4U1HA 4N7QA 4HYRA 2WJDA 2IPUK 1XCQB 3POCA 4JJHA 3EFFB 3N73A 1YAIA 3TVMA 5HUPA 1DVUA 2W4XA 5IEHB 5JPMC 2X4NB 4NVTA 2X4UB 2X53A 4CNTA 1F1AA 2QGCA 3P3RA 4MNKA 4G83A 2DYPA 1MFAH 3VC6A 3ZJ7A 5EPDA 2ABBA 5I1LA 5DD6A 2YB4A 5IHHA 1NL0H 4P4KD 4A6YL 1LEIB 4I3RL 4RMBA 3M5YA 5C55A 5C0AA 1HSAA 1S5NA 5ACZB 4QI3A 4BSVA 4GG6B 1EGZA 4UQ3A 1WFOA 2Q7NA 5PTDA 2AITA 2IADA 1H09A 2WKLA 4LZKA 4HKBA 5I28A 5CCKH 1E4XI 3IXTA 3OB0K 3E0IA 5FAGA 2ADFL 3MLRL 3QWRD 3RGHA 4PS8A 5KWYC 2IANA 4DY1A 5EPMA 2ZYIA 1I1FA 1JVOA 4C56B 4P7RA 3TBTB 3LIZL 1OSEA 1W5NA 5D9MA 1R5IA 4DP1X 2YDAA 3H23A 3ABOA 2CLPA 5L6UA 1UM5H 1V3MA 4UDTA 3QYQA 5A16A 2G60H 4U5KA 3EAUA 4M82A 4G70B 5PCYA 3A4JA 3RU6A 2W91A 1HTYA 5CILL 3N9KA 2WBWB 5BRQA 1GYUA 1S39A 2XIOA 3PUCA 3MLXH 4AGMA 1YPXA 2FJKA 3CIQA 4B53A 1J5SA 2ICEA 1OAZL 1UACH 1E73M 4PCKA 3ABZA 4PR5B 3O3DB 5IVXF 3QYCA 3F4DA 1WKFA 4Q8NA 4Y19A 1ZUAX 1XMEB 2LLLA 1JZJA 1IARB 1PG7H 3OKNB 2A1YA 5DHYA 1ERNA 5DMNA 3PHQB 3P1VA 5FF7A 2E46A 2AANA 3ABXA 1UWSA 3GKFA 1WAWA 1VB9A 5EU5B 1M7DA 1ZGLP 2J4WH 2R83A 2UWEF 5FKPB 3TO2B 1TFVA 2G3NA 5I66B 1M7UA 2V5JA 5F3HB 4WV1C 4LLMB 3P9MB 5IHZA 3D87B 3SBWA 1JPGB 2V7NA 4I7VA 2XIQA 5ICUA 4ACTA 3VILA 2P5WA 3MACL 4PV8B 4M3KB 3DKLA 3OKLB 3BQ5A 3U46A 2YPKB 3F4CA 3QUMB 3NOIA 1EOKA 4KUCF 2BK8A 3WLNA 2DH2A 4MJHA 4JZOA 1JPEA 4IGBA 5MI0B 3H8AA 3SCPA 2QCCA 3VFTB 5E6UB 1FWDC 1FLRL 3HZ3A 1AQDB 3SGJA 1GHFL 2VLMD 4LVOC 3RWJA 1CFNA 1QW9A 4QKTA 1AJ7L 4NJAL 3SRHA 4ODHL 1AH3A 1TPEA 4KRZA 2I17A 4K3GA 5EMUA 3D39B 1R33A 3WEXA 3QQ9C 1FUYA 2WYSA 3N3EA 2W79A 1RLCL 2NLJA 2QQLH 4A21A 3MRIB 4GMTH 2WB5A 1DVQA 2BSRB 1YADA 5F1IB 3KR3H 4J2QA 3F8UB 2KBGA 4P4RB 4J3OF 2PWHA 4ANWA 5GGTL 4I89A 5D2YA 1XCFA 1WD8A 3FB7A 3HPLB 3OSKA 4KKNA 2E9JA 1RK5A 2I07B 1HOCB 2G4FA 3C61A 3D05A 1MI5E 1KV8A 1X44A 5BW7A 1QBML 3DI2B 5DXXA 1IXPA 2NMSA 4LHUD 2OW7A 4PQXA 1AZUA 3TYZA 2J6XA 3UXKA 1M1XA 4Q14A 3G04B 2YR3A 3IFPA 4L37A 4JBRA 4ZW5A 4FL4B 3ABRA 3MOBH 4HJ1A 3WTYA 3HE7B 4ELMA 1TJHH 2R9HC 4HIJA 4NQDA 4N85A 4DIAA 5C7HA 1IR2A 3VK5A 4JN1L 1L8NA 1TYEB 1Z7AA 5F7DB 5F9AC 1YBQA 1NFPA 3XINA 5CSRA 3UERA 2C9XA 4EVNA 4ZGYA 1PKOA 1Z9AA 4OUEA 3WFZA 2CJ3A 5CIPB 4ANXA 3UADA 4J1UB 3TEXA 2ZWKA 4HA4A 1CFVL 2C3WA 1IFRA 2OQJA 1QSEE 1Q9WA 1EAOA 2MPVA 3B37A 4IUGA 1GKPA 4KK8D 4F8PA 2K4AA 4Y2NA 1FG9C 2X0UA 1U8MA 4PBEA 3RDTB 1L9MA 4DVBA 4OVXA 4AY0A 4BFRA 1H3WM 3QN3A 3OM3B 3U79A 1ZOXA 2X38A 2PWEA 1EWDA 5IOPA 2X9XA 4GW5A 2NQ3A 3L7FA 4JM2D 4V2CB 2HT4D 3MV7A 4ES9A 3WFAA 1BQHG 4PL2A 4PJEF 3OMAB 1J12A 2VVSA 1SZGA 4XN2A 5E6YA 1ZMYA 2IH3A 2CHNA 3KPSD 4MA7H 1JUKA 3U1PA 3VVVA 2PXYA 1FTXA 3ES6B 3AY4C 3IVTA 1WFTA 3V35A 4H1LB 1BGAA 4XMLH 1ML0A 5CBEB 4POYA 4EDWH 1TZOA 2CUIA 4GX9A 4PJHE 3BOVA 3LCLA 4GEJA 4JCLA 1KIUA 2OLHA 1V27A 1U5VA 4G8IB 2XQYK 1MVFA 4W9DC 1E4MM 1AIFA 5JYMA 1V0NA 1XFPA 5D4QA 4N2DA 2HX9A 4XHJD 4X4YB 4ZEPA 3GB7B 3O2WL 4Q4OA 4GK8A 1GZQA 1AHWB 2G2NA 3CHEA 3AI0A 1TQVA 4C6KA 5D1ZC 3MRPA 3EX4A 1TQTA 2ZZ5A 1CT8A 3INOA 1DLHA 1OX4B 2J9ZA 4HUUB 1KCZA 1XH3B 4PV9A 4UT7H 2DDQL 1ZE3C 3H9SD 1QI3A 4AD3A 3QEGH 3CSBA 5K9KA 3DX8A 3GU1A 2UXTA 2UUDH 3QIWD 3I02A 1IRAY 1T4KA 4IIEA 1R3JA 4QTIH 5MP6L 4JN6A 3D46A 4X7DC 3SDCC 3V5DB 3TONA 3IFOA 5A2CA 3EA3A 5DMMA 1F4AA 5F96H 2ARJB 4GUGA 4I8YA 5IZ7A 3O6LL 3BLBA 3VWKA 3EYSL 2XGIA 4MCNA 5AW9B 1AXSA 2Y0FA 3LKOB 4P8QA 5E6SB 3FUMA 3L2IA 2NQ5A 3G5WA 2UY3A 2PUQT 4K4KA 3RNKB 2OMWA 1A6PA 3DG7A 3L6FB 3ARBA 4FYQA 1T0MB 3DOPA 1FFPB 1B3VA 4ZMPA 2ZUUA 1EFQA 2FVKA 1FVEA 3LQAL 3VGEA 1KQYA 2Y6TE 4YDVB 3ULVF 4KJQD 3W7RA 4FA8A 4B7LA 4Y5XA 4PRAB 4E4UA 3RY6C 3QRGH 3MLVH 4HKZB 4MNGA 2OMTA 3GSWB 5K4ZA 3QDJD 3Q2LA 5DHVA 2Z93A 2FAUA 1MDRA 5ABGA 5IHUL 2NVAA 3KPRB 1JP5A 4RDWA 3D85D 4OD1H 1HI6B 2HMCA 3C8DA 4MZRA 3GI9H 2UZXA 1WDDA 3PAZA 4NP4H 5ISZA 2VE6B 1OAQH 1OYBA 2XFXB 1YLBB 2VGIA 4GJIA 1TZGL 1TITA 1T3FA 1RR2A 1G1KA 1MVYA 2E9IA 1VRXA 2RBLA 1BZDA 1K7XA 2GYSA 1BBDL 4TUJA 1OT4A 2BO0A 5FJTA 5DLMH 3BISA 1BM7A 2H9AA 2V5CA 3ZVVA 2VL5B 2PTTB 3TYGL 2YA1A 3K8MA 3Q5TA 1VFBA 4GWEA 2DORA 1RULL 1TCRB 2IOMA 1WFUA 4G5ZH 4K07A 2Z0IA 2QKIC 5J06A 1FIGH 1P7QB 4HBCH 1OK6A 1AKJA 3RA7H 4A2GA 3TV3L 1HH6B 1LXMA 3UWEA 4YNYB 4YCPA 4CQBA 4JFDE 5AC7A 2XOTA 1EUNA 3VE9A 3GSRA 3NZQA 1MHCA 2YPVL 2GJZB 2YCJA 1JG9A 2W95A 4G6AD 3BHBB 2WC7A 5J5RA 2DJSA 2VDQB 4YSDA 2R0WL 4IQEA 3IMUA 3O1NA 4BFKA 3T6XA 3ID7A 1FC1A 3VFNA 4V2XA 1A0QH 5EF0A 4F33B 3L7EB 3W2KA 2J7HA 4OSUL 1K8IA 3F5WA 4FXLA 1KTLB 3ZUNC 3PAYA 2LVCA 4LCRA 3WQEA 3HN8A 4GSUA 3WK1A 4GYKA 2IPKB 2EXTA 3QCTH 2TAAA 3V0VB 2K4WA 3DGDA 5D38A 3SGUA 4H88H 4BCYA 3HMXA 1XIDA 4DK5A 3EHBD 1FWCC 3DAQA 5CBIA 1B3OA 1FCGA 1SJEA 1YDYA 2VDRH 2Q2EB 3GZKA 1CFTA 1MYRA 3VYLA 3MC5A 3RJQB 4JTFA 1PO9A 3FO0H 4DF2A 4FQ2L 3MVTA 4NXSA 3FEQA 3OKMB 1AGBA 1AZ2A 3VE7A 1V5XA 4TL5A 3VIIA 5F88B 1LL6A 5J9PA 1H3VA 2H7WA 4PTTA 3FSWA 5DC4B 1QFUL 1TYGA 3SIZA 3CZ8A 3INUL 3LKQA 5ID0B 5LGZA 4W6WB 3QNZA 2CESA 5DHMC 1LQBC 4HCGA 2FB2A 2B1AL 3PAOA 3PJTA 3D2UB 4AM0A 4HISA 4PUUA 4Y8FA 1O68A 2ERJC 5ELIA 4X5LA 4AVIA 2A0LC 1WQ5A 4AIOA 4AM0Q 2V17H 4B15A 1R7OA 3V6BR 5IJDC 1A6WH 3BPWA 1I1AA 1SR9A 4Z17A 2ZC8A 2FATL 1YEJH 5F6IC 2FDBP 1OB1A 4IRSC 3UMNA 3NL2A 2DQJL 3T6QC 4O1AA 2R8WA 4BFBD 1J5CA 3II3A 3SOTA 1VCFA 3VFVA 1NSNL 4MXQC 1X96A 2GKIA 2E86A 2QADD 3RPKA 3KPTA 1MRCL 3HNTH 4RJEA 3C52A 2NT0A 4F3FA 5BZWA 4LDOB 4FHAA 4CW1B 4GIYA 1QI2A 4XKMA 4X6DE 1MFDL 4HU0A 5CS7A 4HXBL 4R5VA 1H50A 4Z5RB 4JCMA 3EZ8A 1J18A 4YDKL 4M6OL 1EGVA 4NN5B 2QSTA 5F2LA 4W88A 5E7FA 1N5AB 4C6BA 4W9ZA 4KNSA 1OF2A 2VOTA 4DQAA 3CMFA 3CG8A 3QFDB 4M51A 3C60B 3C8KB 2B3IA 4XCYB 4GKZA 3M0IA 3PS7A 2JGQA 3S36L 1J05A 2E5EA 1MSSA 3GHRA 5FYJU 5AG8A 1PS3A 1ZJIA 3WLBB 4MJ2A 5EIVA 1F6FB 4Z7QB 1N7MH 5C9JB 4MYAA 1NCWL 1NAMB 1A65A 1D9EA 1UJPA 4IHCA 4WK9A 4UOZA 3O8AA 4QOKE 4AZGA 2JCCE 5B1KA 4EANA 2WLKA 3V4BA 3HGOA 4QE5A 5HGDB 3AYRA 1H1ZA 3EO1A 3VFMB 4TULH 1UKQA 4IMAA 5J11B 1J86A 3B1TA 1B3XA 2AAVA 1NL0L 4QXTA 2KLTA 4U33A 4HHPA 5LA2A 3HKZA 5H94B 1TPXC 3VFGH 5LIWX 3NRQA 2GJJA 1JF1A 3OZ9H 4H8WL 4MNQD 1DO6A 1KBJA 4CUCA 3CZJA 5E8EA 2R51A 5HJ3B 4TQTA 3RGVA 3L3OC 3SYOA 1L5GB 4MCZB 3BKMH 4Y5VC 2Z31B 4AG4H 3PC0A 5BZXA 4C57C 4UI2A 4HDIB 4C6PA 1FLTX 5IESH 3ZY7A 5TH2A 1MCJA 1ZLWK 2RR3A 5GGVH 4AYGA 3HN5A 2TYSA 4HN4A 4LCYA 4MX7A 4JPSA 3VFUB 4PWFA 2HTLD 3QWNA 4M3JA 4C58B 4RMUA 2PCFB 5FOBA 4P06A 4L4TB 3ZE2E 4P46A 3FQUB 2QCDA 3GSUA 1ZHNA 2Z28A 4PGZA 4YFDB 3MO1A 1UM5L 3QDMA 1L6SA 4GKSA 2G60L 5ESQB 2BSCA 1LT7A 1R3RA 3AIEA 1S7QA 2YEQA 4RAUA 2NCEA 4LEBA 5DFVC 4TR9A 3KM8A 2GOKA 2NY5L 4IQJA 2DD8H 3KFTA 1UACL 4BKNA 2VLRE 5FA3A 5DA4A 3MCKA 4TNGA 3T9PA 4LQFH 1C8VA 1ZJHA 2DLEA 2VABB 4QRRE 3DJRA 1PBYA 3GZ3A 4GC3A 1A25A 3FVDA 4TNWK 4R5XA 4ANUA 2CZDA 2J4WL 5HNUA 3ZL2A 4YIQB 5HDBF 4DFHA 4N28A 3UP8A 3GIYA 1UXWA 2VMJA 1GKQA 5G2HA 2PZ0A 3I6TA 2IF7A 4LL9A 2R59A 2MOVA 1E6PA 3E2VA 1NMCB 5H4YA 3KAAA 3B1UA 3LN9A 4Q89A 2WHMA 3UX9B 1JEZA 5K9JH 2N7SA 2XLLA 3PGDB 2WN2A 1M9WA 4CD4A 5ID1A 4Y90A 4JG1H 1JZHA 3GO2A 4D0BA 2GIYA 2JSFA 5E8OB 1FO0B 2B15A 2V7HB 4QRQB 3D30A 2GHZA 3V6ZA 4GQQA 1TQCC 1UG6A 3MTWA 1R9XA 4S3EA 2QQLL 1GIGL 2QNEA 4CCCA 3PWPD 1NCOA 3KR3L 4AVOA 2EKSA 4UNLA 2FSDA 3TZVA 2EPOA 3ULUE 3B9EA 4NZ8A 3UTOA 3HJZA 5I3IA 5BS0D 4ZTOH 1YJDC 1WAAA 1PZSA 1AQ0A 3K72B 1ZAHA 5JPMB 3NM3A 1IWPA 2HK1A 5ITBL 1VBRA 4M7LH 3B56A 1P1VA 5T1MB 1H9DA 1QSFB 1YDVA 3VWJC 1VENA 3MOBL 1TTAA 2W5PA 4DP5X 2ATSA 4WFFD 2FPVA 4GSDH 4Z7UF 4TXEA 3V9CA 4HZ8A 1TIUA 4AIBA 1NEYA 5AYXA 1RLBA 3TCEA 5CLYA 4BK4A 1UA3A 2VXQA 3Q8FA 1ZAIA 2CR0A 1E6QM 1R2TA 4PJ9D 2ZZ7A 4PW4A 4BFJA 2NZIA 4H26B 1E71M 3NCJH 3MP5A 1CXFA 2Z24A 4D6EA 3MMEA 3Q8BA 3GM0A 4UBDC 3HZKB 4J5VA 3PK7A 3V6OC 4ILSA 4YLBA 1OW0C 1KXQA 3C75A 1JGIA 3CSPA 2OXHB 5I02A 4AQAB 1CB7B 2WGXA 2XRAH 2QS8A 3ES8A 3IACA 2DICA 1EGMA 1S2VA 4EXAA 1XIMA 4NO0A 1NWRA 2J77A 1G7IB 3ZR6A 4KRPD 2R23A 2XCMC 4A3UA 2VWEC 2JEQA 4MA7L 1NC2B 4PRBA 4OZOA 4GP5B 3EJYC 2MMXA 4F37K 1LM1A 4GRMB 2E75C 4EDWL 3IJDA 3SE3A 4HUXA 5AFAA 1OIOA 5CN1A 2ZSVA 3ZE1E 3C8FA 3ARRA 4E9QA 3PLYA 2DJXA 1W6WA 2A9MH 5I15H 3S3BB 2RCSH 1M7JA 1JE6A 3ZS4A 3V5KB 3SAZA 5F7NC 1M7IA 3QZMA 1H6FA 1JD9A 4Z23A 1SZFA 2X4QB 3DU0A 3B5HA 1E9PB 2N56A 1GOQA 2XZ7A 2NRDA 4MA3B 2BZCA 4X6DA 3B9KC 4W87A 1M5WA 1XLLA 2N1TE 4CU7A 3OBEA 4PJ8A 1G4MA 5CZJA 4DTGH 3LZFL 3PWVA 4Q4SA 1YNLH 1FL6A 4F2ME 2CRZA 4YL4A 3BGGA 4UT7L 3SFWA 2WXIA 3DHDA 3QEGL 4V1DE 5MEPB 2HMIC 3V52L 1ZFJA 4AC7C 4LVOB 2GVYA 4WNQA 2AV7A 5DD5H 4MVBC 1DE5A 1GPWA 4QTIL 2BODX 1P2CB 1WDAA 3TWCH 2NY6B 3V4VL 4BQ9A 1VEMA 3QV7A 1RP9A 1EC8A 3CFNA 2JKNA 2H2SC 5F96L 3QO0B 3QJXA 2W60B 1P43A 3KJ4C 2BTMA 3WTVA 3KW7A 1Q6OA 3PZQA 3OD3A 4PTVA 1GRWA 3U3HA 4YZWA 4PJ7F 3QOKA 4UOW1 4JQVC 3THUA 4O28A 5HY9A 5MKGB 1OVZA 5DGRA 1WZMA 1BSLA 2BOBA 2QL1A 1VF5C 3H56A 4OI7A 3AT8A 5ESAB 3W01A 3ARGC 3CFIC 2WSPA 4ZDHA 1RU9H 3PYCA 1NGZA 1A3ZA 5SX4I 5AHMA 3QRGL 3MLVL 1DO5A 3L3KA 3LDBC 2XBDA 4LRIC 4JTJA 3QORA 4X7FC 4W7WA 3BJSA 4O1FA 3MY9A 1HL9A 2KQMA 1BZ9A 4OD1L 1JHTB 2J12B 1U8OB 3GI9L 1P0SE 4I7WA 2XNAA 3TBSA 1MW0A 4LSUL 5BOZG 1OAQL 1IKFH 3RRAA 3WH7A 5EEWA 4OUUB 3GVQA 5CNHA 4GKOA 4DQWA 4PJIE 3DPBB 4AC1X 1IBBA 1Z6KA 2O30A 4PGDA 2H2PC 4CMMB 3VGDA 3VRIA 3ALGA 4OV9A 3B05A 3D33A 5HATA 1NINA 1AGCB 5DLML 4ERAA 1EC7A 3SDDD 1UOVA 5JW3H 3P02A 4HYTB 1UP2A 3MLPA 4C6MA 4GCXA 3GMLA 4OFCA 2QKSA 1OP4A 4U1GC 4KKPA 3EKGA 3WG6A 3LS5H 1FIGL 4HBCL 1MW3A 4H9YA 3RA7L 5LIYX 3O6AA 1HH9B 1EGJA 4PCPA 1GW9A 1ROCA 3AS1A 3PXLA 3OR7A 5DYFA 1FZKB 3TASA 2MRYA 1AQMA 4UCFA 4ZD3H 4M3PA 4O50A 3P3YA 5IR1A 5DO2D 3HGSA 4KWWA 4LF3B 1WZKA 1QUNB 3IDNA 4PBVC 1A0QL 4AJVA 3GTXA 2YN5A 3H4HA 5AEAA 2NR6D 4A3YA 5KVFH 2DT0A 2YBGA 1S2AA 2GGGA 2A3AA 4O51A 3WLLA 2VSMB 2O9TA 3IJSA 3E1ZA 3MVSA 4EN3D 1NFIA 4TSBL 3K1DA 5D7LD 2OSLA 5EBMA 4JS3A 4F66A 1Y07A 4UCGA 3WHE1 1U83A 1OALA 3QCTL 3RIAK 4MNJA 2EDFA 4H88L 4GQBA 1A5KC 2XA3A 2WJ7A 1CTNA 3FS9A 4BHYA 4G5AA 1ZVHA 3DMMD 1U3HC 3VI4A 2I60H 3B0VC 4DGYH 3L9RB 5JHLL 4ZQKA 5DX7A 4S3CA 3DLQR 1A8ZA 2VWSA 3BVWA 3FO0L 3RVTC 3W2JA 3AWGA 4UNKA 3MNVA 4AIUA 4OFYA 3NJNA 1IMHC 1Z89A 2W62A 2HJKA 1ELSA 5LIXX 3BZ4B 1OTUC 3PL6A 4NKIH 3VXMB 2J55A 3VRJA 1ZT4B 4BKLB 5KYXA 3OAWA 3NIFE 4Z42C 1GA2A 4LCCC 2HRGA 1I8UA 4OJCA 3SDCB 5MEND 5C0AE 2HCVA 3K4ZA 4D9RE 2BVEA 1VFSA 4YO0B 2V17L 3ELAT 5F7BA 4PVNA 2QMJA 4XGZB 1A6WL 3F84A 1T5XA 5KVEE 1YEJL 1UB6B 4YHNB 5EC2A 3K1GA 5I6SA 5TAOA 3QR1A 3HG1A 1P7KA 2GBTA 3Q48A 2A6JA 5GZOD 3GLEA 2X1WL 5G5DA 1AGDA 5D1QC 2IANE 1VSCA 4K55A 3RG1C 2C9SA 4AGPA 2DIKA 5IV2B 4IOFD 3DX9A 3Q44A 5FESA 1IZJA 4AYEC 4QRFA 1SN2A 2H6PA 2DVXA 2VDPH 5DGQA 2XWTA 1MUJA 5DA0B 3QJQB 3N41F 3CWGA 1LRTA 4YTQA 2Q8AH 3THCA 3AWFA 2XYBA 3DIPA 2CBJA 3W7JA 2FO4B 1YEHH 3ROOA 2V5KA 3E9AA 4AUYA 4Y19E 1NMAH 1EP3A 3R7QA 2OTWB 2XY2A 1H0DB 1TJRA 3K6FA 4XUGA 3U48A 2K1MA 4WKAA 1N7ML 4M7SA 3PM6A 3BZGA 3GSQB 4OBRA 4DF0A 5KSUA 4US5D 3TWBA 4X0VA 4DUXA 4MDJA 1R3LA 4U0RC 3ZHDA 1MNSA 1CWVA 3VXRA 2CDFA 1XPGA 3TX4A 1ZAGA 1CX9A 4TULL 4LDCA 2P5WE 2E9MA 1CXKA 2GJ6D 3PWNB 3VVWA 1EUAA 3DVFA 2HRPH 1JWUB 3VFGL 1GVEA 2DQUH 1J8HD 3WDQA 5F7AA 3OZ9L 1X5XA 3QC0A 2C3GA 4MNMA 2VR5A 3I4EA 2APSA 4RDYA 5C0DA 4Y2LA 3BKML 4QHMA 2DQHH 5KJ4A 4AG4L 4M1BA 5EFFA 3GPSA 3BOFA 3TIMA 1JNNH 2OMYA 5IESL 4JEQA 5GGVL 3KPLA 3NSDA 2NY4D 3Q2WA 1K8XA 4BEQA 4QRPD 1E4LA 3OU8A 3BW3A 4GSXA 3DO4A 4JDZB 4ZSTA 1JPFA 4UV7H 2HAZA 1IEBA 4B9PA 2CUHA 1MW1A 3DJZA 5D9NA 1MNZA 3RWCB 1GSMA 1Q7ZA 3SCQA 4WUKH 3WQ4A 3BSZL 3AXIA 5E4AA 3ROLB 2WC3A 3V5FA 3DVGA 5LXGH 3O07A 3U7VA 5HYQA 2EEAA 1TJ0A 3APGA 3RX9A 5J6SA 2DD8L 5LGHL 4NUQA 2HT3C 5H35B 4ELME 4LQFL 2GSEA 1XF3A 4WZHA 3U5YA 4RKAA 4NQDE 4MB4A 2ICWI 4OZGB 3VCRA 3Q1EA 3MUY1 2PU0A 3D4GA 3IWVA 1IE5A 3T0VA 4IG2B 4FFVC 1MQ8A 4HJGA 2ZRYA 2MQCA 1CC3A 3WUWG 2QQNH 1RJLA 3KPQA 5F6IB 3J7HA 3TBBA 1KV5A 4IRSB 5DQJA 1LE9B 3FJLA 3T71A 3JZ7A 3D9AH 3UBXA 4IP4A 4G8GB 4ZSOB 5A8GA 1ZA6B 4PJ5A 1W6LA 2VLKA 1QMLA 5AC6A 4PWJA 4NGHL 5CP7B 1RH9A 1LO0H 2JK5A 3ULSA 1V77A 1P4BH 4MWFA 4DP7X 2QUNA 2GFBA 4JG1L 2YD9A 3GJEA 1X7QB 3RIKA 4DJMA 4XVTL 5DRZB 1BAFL 1E90A 2PYEA 3KLLA 3P62A 4U3SA 3NQGA 3ZO0A 3NZ1A 2Y2TA 2O6FA 1QASA 3UAJD 3F12A 3F4NA 1JZFA 2YPLA 1OP9A 5B7ZA 4IBQA 3BG9A 1C9DA 1UWTA 2G95A 1V3KA 4L9LA 1J0KA 5FEWA 4EKJA 4H1LG 2YBRB 3U2ZA 1MIEH 2XBZA 2L5HA 1TUFA 3DGCR 3URQA 1JBJA 2ISFA 4HYWA 5FAJA 5JIHA 4ZTOL 3N9GH 3DXIA 4EXQA 3W74A 3Q8AA 1WBZB 1TJ1A 4GA8A 2XYCA 2IKGA 5HVFB 4M7LL 4Q6XA 3S8GB 1G1YA 4QIUA 2FGWH 3BRFA 4MS8D 3HPXA 3CHOA 1BOGA 4RA0C 2FLIA 1ORQB 4G9PA 4ZMZA 3W9ZA 4NI6A 4PRRA 4KV5E 3CNYA 4R97C 1PAZA 1D7CA 2PDPA 5I5IA 3C4UA 4QQUA 3MYOA 4F24A 4GSDL 3IWPA 2E6DA 3QYNA 4BR1A 1FVPA 4LYKA 1C29A 2A99A 1HNFA 1FFQA 4AL8C 1ESWA 2XJKA 1TPXB 1WBHA 2YL9A 4BQ8A 3OMIB 2EXYC 5FYKH 3EMZA 2B31A 2HJLA 4K2UL 4LSTH 3V0EA 5KANI 4LTSA 3L3OB 2Z1XA 3O8XC 5KYWB 4L1BA 3NCJL 2Q9OA 4Y5VB 1LBMA 3EJZD 3S0CA 1ZLPA 1ZP3A 3B2UD 3FY1A 1Q6CA 4JFOA 2ZRZA 2A0NA 4B9KC 4QSFA 5C7ZA 1YN6A 1KTKE 4WAFA 1EKOA 2GIXA 1BD2B 3G08A 1VPYA 2V3FA 3V0GA 1A3WA 2XRAL 3QYSA 1E55A 4LOFA 9PCYA 2E7FA 2YA2A 1N12A 4XBGB 5E23A 4OE7A 4L0PB 1XCTB 5C70A 1WIOA 4D6DA 4ETYA 2QTEA 3HZYB 4JTSA 4POZD 4HHLA 2GJXB 3BLDA 5DCCA 4X80H 1W8OA 3QUMH 2JI3A 4N90E 3D3VA 2NY2C 5IIEB 1Z3RA 2J27A 4Z2HA 2Z7UA 4DESA 1YMHB 5BJTB 2DWYA 3MKVA 4IGSA 3T3PE 4Y9PA 4O2FA 1VGEH 3DOHA 4DKEH 2HKHH 3JV4B 4S1DD 3UVIA 4DEFA 2F84A 1E3XA 4MNGE 4DBEA 3CDZB 3L5WA 3FNKA 2OXGB 2VZSA 1QPNA 12E8L 5I15L 1QABA 2WWNA 3VD3A 2ESVE 8FABB 4R96B 1PTAA 2IC2A 4HJ0C 5G4WA 1X7FA 4HIEB 5ISZE 1NEZA 4R3SA 3M86A 1KO0A 4HK7A 5F9JA 5HD8C 4JDYA 1D5BB 3D0LB 1OGAB 1UH3A 4RGOH 5C0JB 1PQZA 4ODSH 4I1PA 4GFTB 1LYQA 3S5SA 4Q4KA 4E4PA 4U1NA 5KMYA 3D0VB 4GYJA 3FULA 3RURA 3BLFA 2OR2A 3CHXA 4DTGL 1G6RA 3ZE0B 2HV5A 3M0VA 2YMOA 3MP3A 1JJUA 1YNLL 1XLAA 1Y6MR 3PIQA 3U4EB 1TX2A 1PKMA 3ZXAC 1UKTA 3P9LA 3TWYA 1US0A 4R7DB 3PWAA 2C18A 4RIRA 2XXGA 2PKDA 4JIQA 4C6EA 3EGDB 1MDTA 3UGVA 3AFBA 5I17A 3TWCL 3N9RA 1DZBA 2PW2B 3C09C 2PW1A 5CIPH 1TQCB 3C2AH 1ONQA 3TUUA 1QI4A 1EFXB 5D7HA 4GAJH 1DQML 1UB5B 2MCG1 3QXDA 3KGUA 3GKWH 3SIKA 4FHKA 5AENA 3WFEH 1XTMA 5BXRA 1F11A 1S7XB 4IRZH 3S5YA 2B5IC 3ISWA 1KM2A 3N9SA 2CSPA 3LKPA 3U9UA 1JGEA 1G87A 3C6SB 1YUKB 2ZX8A 1BVKB 2X6CA 1W0VA 3VWJB 1RU9L 4XXDB 2OT1A 1KWKA 1J88A 3M17B 4DZ8B 2DU2A 3UYPB 3LEXA 5HYJD 1EBPA 4C90A 3SZKC 1J8KA 5DR5H 1XG3A 3V4PA 1UWIA 1EX1A 3ML8A 4G8AC 3VG9C 1DL7L 4OV5A 4H1LH 4Q74A 2GVLA 1EJUC 4JN2B 2XGBA 3QR2A 1ZTXH 5JR1H 3T0BA 3KBNA 3TLRA 5BZDB 1IKFL 1DSWA 1SPQA 4LPWA 2YC1B 2BGSA 4KJWC 3B8YA 5HHOE 1W2VA 4J3OC 3BVXA 4G9DA 5DRNA 4PMRA 2WXFA 1JVKA 5AYQA 3KP1A 3LKSA 3V9EA 3LD8C 2WBKA 5IKCB 3UTTA 4ICWA 1PZAA 4AY8A 1ZS8B 1UOLA 4OJEH 3U2CA 1Z9OA 3RU8X 1PJWA 5AHFA 3PBYA 1DQTA 3N55A 3C5QA 3BAYA 1LNUB 4DEUA 2DEWX 5HI4D 3LS5L 2O6DA 3TYBA 1Y0LA 3S6CA 5AVWB 3L3GA 2J24A 4I48B 1LDPL 2L7QA 4XNBA 4ZD3L 3LZ3A 5EO9B 2EINB 4JOMA 2BVQB 1H5BA 4MGGA 4TNEA 4M5PA 5CG0A 2H3NA 1ETB1 3V55A 1DTUA 2B1HH 4FXGA 3DV6B 5FYJE 3HFFA 4KOCA 3DBSA 2WCAA 5C9WA 5J3HD 3ZJ8A 4F8NA 5KVFL 2EUZA 3L3JB 1EXPA 1ITBB 1JCLA 4TOQA 1N26A 2EE2A 4IDJH 1VEOA 1EXUA 1Z6JT 4MAUH 1PD6A 2AQ3A 3BVNB 3SBQA 3BWSA 2YMXH 4S0SD 2CZNA 2QDGA 3M1BB 3RQ3A 4L4VA 3T2QA 4FP1A 1A1MB 3NJKA 5LAPA 2I60L 2BSTB 4KWUA 3CPLA 1VIWA 3NPVA 2CEQA 3QR0A 4ZFGH 4NSKB 3SCMA 3U30C 1SGKA 2A7RA 1IT7A 3EKLA 2ATPB 1F1GA 2PO6A 2YEZB 5G1TA 2WMPB 3YPIA 3B3DA 2XWEA 5CEZH 3TH4T 4FG6C 4NXKA 3VUAA 2Y9RT 5TBOA 4LFHD 1GGTA 1BYCA 3M5ZA 5JUEH 4LESA 4TSCH 2RGMA 3M6DA 3K2GA 1YQVL 1ZLSH 1G7QB 4K7PX 4NHVA 2YZ8A 2AERT 3T42A 3Q06A 2GUOA 4MKMA 4K94H 2R1KA 2DBLH 1OVDA 4UTHA 1TTBA 2BP8A 3EYUH 3W11D 3QXAB 3CZUB 3LDVA 1I9JH 2D7PA 1ZLVK 3MRHA 3OLIA 3ZKND 3LH2H 4O2EB 1E0XA 2J74A 3P4OA 3UPRB 5ECJE 5K7JA 2D2OA 5EBLB 4QJ3B 1WTGT 4QYOA 1A0CA 1EEPA 2AKRB 3LS9A 3LEYH 3LXAA 2GY7B 2F19H 1RPKA 4G1MB 2EJ1A 5AAMA 5JZ7D 1M2OA 1Q65A 2J1XA 2FR4B 2O9OA 5ABDE 5IRPA 5HHMB 5CJQH 2JIEA 4Z7WA 5F7HA 4GQRA 4OGAC 3LNPA 2ZXCA 3ARGB 2F53B 4LEQA 3O16A 1RZKH 4DKFH 4U5IA 4AC4A 4W6YB 4I9MA 5PAZA 4W9CC 3QDME 3EYFB 3O2DH 4YSSA 2E1WA 1H41A 3A3HA 3UU0A 1EZ2A 5I0ZA 5JQ9A 2FEDD 2VDPL 3LDBB 2PR9A 4Q58C 1OWWA 2R39A 4N2KA 2EYTA 4ENED 2V5DA 4L2YA 1DXFA 4XMKH 3JWNG 2Q8AL 3FT4A 2E6AA 3M07A 3NSXA 4MQXD 3QW3A 1Q9LA 2D0FA 1JSYA 2VDQH 2AVGA 1YEHL 2VO5A 1E40A 2E5DA 4GVFA 3C5JA 3H6JA 6FABH 4U1JA 2WLZA 4XO6A 3RZCC 1Q90A 4Z3JA 1UZDA 4C6IA 5J6GB 4C4BA 2NY0C 4R9XA 5LNUA 2ADAA 3WIAA 4IMLB 3MRRA 5HSFA 4NENB 2DT3A 2CDEA 2H6OA 3WLOA 3AICA 1REIA 3CXHJ 1NUFA 1E30A 4GXVH 3K81A 1D5MA 3SJVD 5FW6A 3BUYB 3MUUA 4ZXBB 5FEPA 1JCKA 3BLOA 3T8XB 1S7VB 5LSMA 5I82A 5JORB 3IJEA 3ULVC 1AMXA 3IIVA 3CU1A 4OM0H 4U1GB 5IY5B 1OFEA 3KHQA 4M4PA 4AVFA 5I8KH 4DX3A 2AEPL 4Z7VA 5BNXD 4I18C 2X4PB 3DJTA 2CU0A 2HRPL 3OWEA 1GMIA 1IM9A 2OZ3A 3VJ6A 4XMVA 3BVUA 1TWDA 4HLZG 3CPUA 4Z78B 4DF1A 4AUJA 1I8AA 2ESVA 1WHOA 1VDGA 3N06B 5CJ5A 5A7BA 4PJHF 2ZONA 1HKJA 5T5NG 1Q7QA 4N9EA 3WKNA 4NUJA 2DQHL 3RWEB 2H32A 2GOUA 5GJNA 2DPKA 4UM8A 4X5RA 1XDTT 4GP4B 2HCZX 2Z4QB 1JNNL 3WLJA 1HSBA 2X6BA 5I6PA 4N0UB 3U0HA 4KKRA 4X6BA 2A83B 1GSKA 3B4NA 5KS9A 1TFHA 4GQ9H 4M7JH 3FT3B 5AVYB 1MCBA 3MRJB 1UWAA 4HOMA 1G7HA 4RBPK 3CZEA 2W0FB 2F9BT 3DECA 1IT8A 1TZ7A 3JUGA 2BP3A 3VCLB 1DIEA 4WUKL 4XO8A 1XLHA 4NKMA 4FYSA 4KFZC 1DUYA 3NFPA 2NDGA 2CHDA 1NGPL 4D0CB 5IROA 1WAAE 1B4JH 2I85A 2EH8H 2VDMB 3QV9A 4I8DA 2J75A 3MXWH 1V7YA 2YCIX 1ODAA 3GWQA 3O41B 4P99A 4AYFB 3I6EA 3QPQC 4Z77B 4OGZA 4JNZA 3X13A 4U1LA 3HB9A 2ATKA 3SGGA 3TTOA 1R2SA 1SQ7A 2WTOA 4LCCB 4X60A 4QXGH 2OJZH 3HU7A 5EG6C 1KTJA 1OD8A 3SCSA 1XGPA 4MKTA 4ODUA 3AAZB 3NAAH 3MX0A 2QQNL 3EWDA 4TNVF 1SXSA 4WD0A 2Q3XA 4KO6A 2OLAA 3SN4A 1ZALA 1ZPUA 3B2MA 4HEPA 2WKGA 3MCOA 4Y4KA 2JKPA 1JZDC 1CQKA 3D9AL 3W07A 3NIDB 1NAMH 2Z7GA 3A6CH 2PF6A 1XXFC 1JPDX 5IJCC 1KXQE 4E6MA 1GQLA 4LANA 1Q94A 4CNIB 5T1KB 3JVGC 4ATTA 2P7TA 1LO0L 1KM6A 4TUKH 3U57A 1SFTA 1PE1A 2XJ7A 4Q8BA 2GITB 5GSVB 1XIJA 5SWQA 1QRND 3P69A 4BZ1A 4OF8A 3L1GA 4PB5A 3CLFH 1DYZA 5HHOA 3CZFB 3KXFD 4J4PC 2O0TA 5EU7C 1UWFA 1NFDB 4F80A 1T21A 1C92A 3IN2A 1MCWM 2PP7A 1UD8A 2WXMA 4EUPB 4QHLB 4FKHA 4J2PA 3UZQB 3AREA 1R0AH 2NQZA 3F7JA 2ZADA 3SPGA 4KO7A 5LDSA 3EH4B 4HWNA 1UWUA 3R11A 1JK9B 3ILEA 3KTCA 4QT5B 1G0YR 4PGCB 2ZX9A 1UYQA 3VI3A 1MIEL 1JERA 2ICCA 3NWRA 2FECI 4X0NA 4A7VA 4XMUA 4JX6A 1G7JB 3BICA 2XT1B 1KJVA 5GIRA 2FGWL 4YTUA 3PTDA 4KQ3H 4WHBA 3O45B 1D5ZB 1LMKA 3ORJA 5MERB 1CDBA 3O4LB 3TA3C 4ZPTA 4WXZA 3X1BA 3JWNH 1FHLA 1UIOA 2VMEA 1SNRA 5CCGE 1VFUA 4ZUWA 3OPSA 3AYTA 1TPDA 4JS7A 1ORSA 2WBJC 5ECVA 2J47A 2C3XA 4QR7A 4NFBA