1XV8A

Crystal structure of human salivary alpha-amylase dimer
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Human Salivary Alpha-Amylase Dimer
rcsb
molecule tags Hydrolase
molecule keywords Alpha-amylase
total genus 160
structure length 496
sequence length 496
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xv8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xv8A01
1W9VA 1YQ2A 1E70M 1HWWA 3VIKA 4OJYA 2GK1B 1CXIA 3K8LA 2CKSA 1ZU8A 3PZGA 5ABEA 1JZ7A 4ACYA 1UKTA 4YHGA 4CD4A 1UR0A 1VJZA 4DO5A 3F5JA 1OINA 5A8MA 3WMBA 2VCAA 1V08A 1JYNA 4MTVA 1VIWA 2WKGA 5E6ZA 3RCNA 3ZR6A 2F8QA 3FHQA 4J3VA 3AICA 3TTQA 1KBKA 2ZWZA 1ZB5A 2NT0A 2YDQA 1Q6DA 3RJXA 3BAWA 5LA0A 1ODUA 2DDXA 4WSKA 2CESA 1K9TA 1NOWA 1GVYA 3BVTA 3FAWA 1AVAA 1KXTA 5TD4A 1G94A 4P8UA 2WANA 4JFTA 1JFHA 1A3HA 1RP9A 4PUDA 3TTYA 4A4AA 1JL8A 1QNRA 3F5LA 4W8BA 4J7RA 1B3ZA 3A5VA 1VEMA 4GI8A 1R33A 1QNPA 2CCRA 3OA5A 2X8RA 3CPUA 1E71M 4H7VA 5FCZA 2WPGA 3NSNA 4UFMA 4NRRA 1BGAA 4JAWA 5FIPA 5D9PA 2D24A 1W1VA 1BAGA 3OB8A 4AZ5A 1QWUA 2EQDA 4HOZA 4AZGA 5CSYA 3VIFA 3WQWA 3WMSA 1E3XA 3VNYA 1W1PA 5BROA 3CH9A 4WLCA 4W7WA 3SURA 1UQZA 3A6OA 5FL1A 4QLKA 4AMCA 4GO9A 1TA3A 4UNIA 1HJWA 1P6WA 1GJWA 1E56A 4J27A 1G01A 4DUXA 3CHCA 3VIJA 2YLAA 1UD6A 2G41A 3NYDA 1E43A 4QDMA 1UKPA 1JZ6A 3T2QA 1MQPA 2WMGA 3VNZA 1KCKA 3SCOA 3U7VA 3AMLA 5FD0A 4P7LA 1V02A 4J28A 1LL7A 1GNXA 4H8HA 2OWXA 3N9KA 4C7GA 3VGFA 4KGJA 4QP0A 2ZX9A 2W91A 3KZSA 5E0CA 3N17A 1ECEA 1ZL1A 2BVTA 1DWGM 3MMUA 3AQUA 3MSDA 4JKKA 4D6DA 4W5UA 1W3JA 3CZNA 4FNPA 2MANA 5CPSA 1V3KA 3EYPA 3WD0A 5GPRA 3DYOA 3N15A 4U2ZA 3HN3A 4W7UA 1VRXA 1M01A 4UCFA 4GXPA 2DIJA 2ZXQA 1K6AA 3CIVA 3WBAA 4D6IA 4AZ6A 5AY7A 4KRTA 1W32A 1QI0A 4RL3A 1W91A 2UY5A 1X1NA 4M56A 5HDRA 1H2JA 4W85A 2WNWA 1XCXA 3EJUA 2GK1A 3DX0A 1QHZA 1H0IA 1ZBCA 3ARUA 1OIMA 1H41A 3LRMA 2VVSA 4TOQA 4D6CA 5A95A 1WZLA 1E3ZA 4UOZA 2XM1A 3THDA 1UUQA 3F4VA 4AZCB 4W87A 2Q8XA 1WKYA 2ALWA 1AQ0A 2D0GA 3WUGA 5CGTA 3N11A 5A6AA 3NCOA 3WN6A 3N13A 2W5FA 1TR1A 1E6PA 2YFOA 1NP0A 3VD3A 3NSMA 3CGTA 5I6SA 5JBEA 1CEOA 1E15A 4XZBA 1E4IA 3QOMA 1UYQA 3SCPA 3W38A 1W3KA 4CN1A 3BLPX 3ZM8A 5BCAA 4DUWA 4D6FA 4FNRA 3VIIA 4PCSA 4HP5A 2G3NA 2A3BA 3VDCA 1CIUA 3W0KA 1ZS2A 3WQ6A 4HA4A 3BXWA 2WVVB 3LPFA 3GM8A 4P7OA 4PCTA 3WMCA 3RJYA 1CDGA 2BXZA 2G3JA 3GXFA 7TAAA 1GUVA 3EJSA 4BQ4A 1E6ZA 2GFTA 4UQCA 3VVGA 1OB0A 3WNKA 2YL5A 2EPNA 3VGEA 2WYSA 4U2YA 2WZIA 4GQRA 4K68A 2DH2A 1LQ0A 2GDUA 4JKLA 2ZX7A 2YL6A 4JL2A 3VO0A 2XFRA 3WF3A 1BYDA 2WZHA 4ZFMA 1D3CA 4ATWA 4CD8A 1JGIA 2VRQA 4JCLA 2CHNA 2XTKA 4ZXLA 4FLRA 3VDAA 2OWCA 4L4PA 4PTXA 3AXHA 3OGVA 2PBGA 3CHEA 3CLWA 1UKOA 2FE0A 4F66A 3TTOA 2XVGA 4QCFA 5A6BA 1EDQA 3D52A 3L4TA 3W27A 3ZMRA 5DO8A 4AD3A 4Z2HA 1I1WA 1MW0A 3ZOAA 1OT1A 2CBJA 3D4ZA 4FMVA 4X0NA 5E6YA 2W4XA 5A6LA 2ZUVA 3JUGA 2CERA 3EJQA 2UY2A 2VVNA 1VF8A 4HTYA 3KLKA 2WCAA 2XVPA 3WH9A 2QHAA 1WZKA 3DECA 3BUBA 3BVXA 5CSUA 4IPLA 4PTWA 6TAAA 1UQYA 3ZJ6A 1E5JA 4UZUA 4J3SA 1UR4A 2XYLA 1PX3A 4HZ6A 3W81A 2WMKA 1CXLA 4DUVA 3NDYA 1GOKA 1PX4A 1V0NA 3SUTA 1BG4A 4S3JA 4YHEA 4XV0A 2CYGA 3WIJA 2PC8A 7A3HA 2E9BA 2DSWA 2AMGA 1EH9A 2VO5A 3BGAA 1UD2A 3N12A 2UY4A 3ZQ9A 3WEMA 3ARRA 4GZIA 5DMYA 3WEZA 1GW1A 1QPKA 2XFFA 4UFJA 5HPCA 1E0XA 4CU6A 3AXIA 1SFSA 2EAEA 2D73A 4EK7A 4QAWA 4PMZA 2ZUTA 1MYRA 5AC4A 2QLYA 3WDQA 1FFRA 1DP0A 2WC3A 2G8ZA 8CGTA 2O9PA 3VMOA 1JDDA 2WVUA 3NIYA 5GNYA 5M17A 4BA0A 3S5ZA 4HMDA 3O6AA 2IGTA 3D51A 2CBVA 3VGGA 4PSPA 2ZICA 1HP5A 4H8UA 1OT2A 1OIFA 3A22A 3CZEA 3W6MA 3ZR5A 5D9NA 2PF0A 3PTKA 2E9LA 4HZ7A 3POCA 4EANA 1MXDA 4UQBA 3UG5A 1E6QM 3CZGA 1WE5A 1VENA 3L4YA 4MDPA 4HU0A 1UWTA 3AS3A 5A6MA 1UWRA 2J62A 5JUVA 4B3KA 3N18A 4Q22A 4PMDA 5FL0A 2OYLA 1XH0A 4DWSA 2J7BA 4IPNB 1DWJM 1XHGA 3S6TA 1QNSA 1GQLA 3E1F1 2G3IA 3TTSA 2WMFA 3BUIA 3U57A 3FNDA 1O7DC 5D4YA 1H4PA 1TE1A 4ATLA 4BQ5A 1GCYA 1E4NA 2J7DA 1G5AA 2WLYA 1MFVA 4AEEA 1O7AA 1GOQA 1V6VA 1Q6EA 4CU7A 3AOFA 5M5DA 2XJ7A 2BY1A 4U33A 1HN1A 3FW6A 3WKZA 3M7SA 1TQUA 1CXEA 4JL1A 1ISWA 1KGUA 1LWJA 3NUKA 3SUWA 1E40A 2FYVA 2PBOA 4HZ8A 1DEDA 5HOSA 2ZUUA 2J7FA 3WNPA 4MNLA 2FH8A 4X0VA 3KL3A 2VX5A 1AMYA 1PPIA 2ZXBA 4R27A 1IZJA 3I3DA 3PZUA 3D4YA 1QHOA 4H8VA 2A3CA 2AOSA 4J3UA 1WDQA 1W2VA 1US2A 3BLKA 3WY4A 2OYKA 1V6WA 3HZ3A 1X6NA 1J0YA 3RIKA 3RM4A 2JF7A 3WH6A 3IJ9A 3ZJKA 2EJ1A 2PWEA 1IZKA 1MWOA 1HP4A 1B1YA 1OGGA 1HVXA 1AQHA 2V3FA 3DHUA 3VSTA 3WEOA 1HKJA 1KCLA 1CNVA 1HXJA 1V3HA 1XV8A 3GZAA 3PTQA 4IUGA 3WNMA 3BAJA 5JBFA 4L4OA 4U3AA 3MS8A 1UKQA 1CZ1A 2XGBA 1WDRA 5D9OA 2YA0A 3II1A 4OBSA 2Z1KA 2VMFA 4NXSA 1TFVA 1J0IA 4OIFA 3UG3A 1VFFA 3W25A 2VQUA 3AS2A 3CMJA 1CXKA 1UG6A 1RPKA 1PZ3A 1ODZA 3MMDA 4CUCA 2D0FA 3VX0A 2J7CA 1QBBA 1W1TA 4QLJA 4AD1A 1BFNA 4W89A 3KWXA 3IGUA 4MDOA 2XG9A 3CUGA 3ZIZA 1HJVA 3EMZA 5BXTA 4FK9A 4LXFA 2RGLA 2BV9A 1CXFA 3LRKA 1MXGA 1MQRA 1FA2A 3O9NA 2O9RA 4U5IA 2XVNA 2E8YA 4BQ3A 1JZ2A 2DT1A 3QOKA 3DX4A 3EBVA 1HNYA 1HJQA 2JIEA 1E72M 1B0IA 3LXAA 1US3A 3A4WA 1KR0A 2NT1A 3WENA 4M81A 4KGLA 4UTFA 3HG3A 5CXPA 2X2IA 2V3EA 2HISA 4JIEA 2XN0A 4AISA 3SCTA 3HG5A 1L0PA 2ZE0A 4JFSA 3WNOA 3A24A 2ESCA 1E4MM 2DT2A 2VL4A 4CN6A 3WSUA 1BF2A 4AZHA 1XSJA 2DSUA 3T0AA 5KEZA 4ZE4A 4P8VA 4U31A 5F7UA 2O9OA 4HMEA 3SCQA 3BC9A 1CBGA 3AIWA 3WD4A 1C93A 1V02E 3QHOA 2WVVA 1SMAA 1CYGA 3DHPA 1LLOA 4WKAA 2BFGA 3SCWA 2Y4SA 3PTMA 1Q6GA 4D72A 4PTVA 2XWDA 1HL9A 2CBIA 2WCGA 3T09A 1WP6A 2W66A 1JYXA 1XYZA 3CMGA 2PWHA 1CLVA 4CCCA 1U33A 3L4WA 3GXDA 4AMWA 1WDPA 1JXKA 4P7NA 2E9MA 3CZLA 3T2PA 1JAKA 3ZO9A 4HOXA 5E1QA 1E5NA 3D50A 3S5YA 1VJSA 3GNOA 1R8LA 5IDIA 1EIBA 2J8GA 5AYIA 1JNEA 2VJXA 1W9DM 2XIBA 2W63A 2J79A 2O92A 2J7HA 3CO4A 3QHNA 1UR2A 3WUFA 2QMJA 3B8SA 1H49A 2E8ZA 5IXEA 3FN9A 3BAIA 2WHLA 2YBUA 3GBEA 4AZBA 1HF6A 2E40A 1BLIA 3PZIA 2IXVA 1W3HA 2X09A 1MW1A 4AIOA 4UFHA 1C7SA 3EJRA 5A8QA 1EOMA 3AHZA 1CECA 1FHLA 3ZT7A 3WBEA 2BHZA 4HA3A 3ZSSA 1HTYA 3VD4A 4MAZA 4P8WA 4V2XA 4A3YA 3UR7A 1GJUA 2YOCA 3S2CA 2W61A 1D7FA 3AIVA 2J7GA 1VBRA 3OGRA 1OBAA 4BZYA 4CD5A 1KGWA 4CGTA 1ITCA 4LQ1A 1JF5A 4D1JA 3EDFA 2VZSA 1GOMA 1WPCA 2WBKA 3UETA 2QF8A 4UFKA 4MNMA 5A2BA 3OGSA 1MW3A 1MFUA 2YDRA 1PIGA 4AIEA 2B31A 3VD9A 2OW7A 1H3GA 4C7DA 2Y2WA 3GBDA 3RPMA 1E4LA 4LX4A 3FAXA 3SCNA 3VX1A 5IFTA 1M03A 3O2LA 3UEQA 1OWQA 5DT7A 3AIEA 1HKKA 4XZWA 3WDJA 3GNRA 3SCRA 2D3LA 2XVKA 5DF0A 2VCBA 4FNQA 2PWGA 1PX8A 3VINA 5IFPA 3GXIA 2BVYA 3CUFA 5LA1A 1JF6A 3SUSA 3J7HA 1JNDA 3I3BA 1BQCA 1H09A 5LYRA 3LRLA 4MAVA 2GVYA 4ZEPA 2X2JA 1C92A 1RP8A 3F5KA 1WO2A 2EPMX 4BCEA 4X9YA 3VM5A 3G6MA 3K8KA 3OLDA 4D6EA 1HJUA 1BPLB 4JCMA 3H55A 3CZ8A 3AISA 1RD6A 3WD2A 2OLHA 2EEXA 1V0KA 3W4RA 4AYGA 3ARZA 4W8AA 3K46A 3GNPA 3OG2A 1CGTA 4PUEA 3WDHA 3CUHA 4N0RA 4B9YA 2X05A 2XSBA 5D9MA 4FF5A 1PBGA 1XYFA 3A4XA 3WD1A 1KXQA 3EJTA 2J4GA 4CVUA 1GHRA 1QNOA 4PMQA 5HNNA 1PJ9A 1AQMA 1GVIA 3GDBA 3AMGA 3RMEA 2JIWA 1KBBA 2GSJA 2EO7A 2VR5A 3HMCA 1V3MA 3BMVA 4PMRA 5FOOA 1VFOA 4WK9A 1BG9A 3PZ9A 3QGVA 5C8BB 3ALGA 4FNTA 5EMYA 1TQWA 1LF1A 5HPOA 1VAHA 3WNNA 3GH7A 3ARWA 3ARVA 2XUCA 5I79A 5BXPA 1XH1A 2WBGA 3AHXA 1ZJBA 4JZ5A 4UFIA 3OZPA 2WLZA 2V38A 4IISA 1UD3A 1QVBA 1JG9A 3VSUA 3ARXA 2XGIA 2VOTA 5I24A 3TOPA 4UOJA 3GXPA 2X0HA 2ZX5A 2WMIB 2DSKA 3PBGA 5CPTA 4AMXA 3AIBA 2W62A 2F7PA 1R7AA 4F8XA 1B3XA 3QR3A 4TTUA 3WDPP 1Q6FA 1R75A 1CPUA 3IJ7A 2A3EA 1BVNP 3CUIA 1QI3A 4BS0A 1M53A 3KL0A 1GPFA 1DWAM 1R47A 4AW7A 3IAPA 2Y24A 3AHVA 2ZIDA 3ZJ8A 1FH7A 1R86A 3AS0A 3AXXA 4M80A 3AMKA 1J0JA 1UD5A 3UCQA 4U3CA 2FGLA 2IUZA 5I23A 1J10A 3GXMA 1CWYA 3WD3A 4RE3A 4TUFA 2ZUMA 3AFBA 1WAWA 3ARYA 3L4UA 2Y8VA 1G1YA 1HVQA 2VURA 4AIUA 3D3AA 2C0HA 4M1RA 2JFEX 1K9DA 1UOKA 2FH6A 1EDTA 1UD4A 2FHBA 4PMUA 1KTBA 1J0KA 3B9EA 3UESA 1CTNA 3M46A 1N82A 5I0DA 1E1EA 1U30A 3VILA 2WAGA 2D0HA 3WDIA 1L8NA 3WH7A 2YDSA 2C8NA 1TG7A 1MVYA 1XC6A 1R7OA 2DH3A 1BSIA 4W5ZA 4PTMA 4AD4A 1OGSA 6CGTA 1E73M 4CU8A 3OIHA 5A6SA 3GH4A 4MB4A 5CLTA 4TTGA 4GKLA 4NSBA 4Z2IA 4J3XA 4MB1A 5A8PA 3MUAA 3U5UA 2XWEA 3PZMA 4UZSA 3VIOA 4E4PA 2F7QA 4W84A 1NOFA 4HOWA 4C7FA 2WC7A 2F1BA 1EGZA 5CGMA 4JHOA 1CGVA 3EDKA 1TVPA 4TXEA 3H53A 2DT3A 2PI6A 4AD0A 4OOUA 2BXYA 2W67A 1H1NA 2F1AA 2YKKA 1B3WA 1S46A 2CBUA 5CJ5A 3WL1A 1NOUA 2EPKX 5JIPA 2XN2A 2XSAA 2WK2A 4D1IA 4YPJA 1QX1A 4Y7EA 4MJ2A 2GDVA 4P8XA 3BLBA 2JF6A 2AAAA 1WNOA 3OLEA 3W29A 2J7EA 1UA7A 3CZSA 3BCFA 1W1YA 3RILA 1YHTA 2GJRA 3L2MA 5M03A 1KQYA 4OGZA 2YL8A 3L4ZA 4P7QA 5KZ6A 4IM4A 3N04A 5EBAA 1BGGA 1OGBA 2Y8KA 4YN5A 3LXCA 1JFXA 1NP2A 2RGMA 4MJ4A 4JFVA 1GORA 2NW0A 4AY1A 3EDDA 1QNQA 1ZBVA 5AYBA 3MUIA 1QI4A 4ATDA 3A47A 3EMQA 4MB5A 3WY3A 1J01A 3T0BA 4GIAA 5ABFA 3VU2A 1SZNA 2JALA 1EA9C 2EXOA 4W86A 2CPUA 4PMXA 1M04A 2GUYA 2G4FA 4V27A 3ZJ7A 1C91A 2ZOXA 4KH2A 5BRPA 3LXBA 1QW9A 5I2UA 3BUPA 2F18A 5HBFA 1J0HA 1TQSA 1VBUA 4FNSA 2DIEA 2V5DA 3IK2A 1CXHA 2BNJA 2D23A 1JIBA 4WSJA 1ISZA 4KRUA 3UERA 3PZVA 2WW5A 3AI0A 3WF2A 2WKLA 2XIIA 3AJ7A 3H54A 1HJXA 2BHUA 3WF1A 4F9JA 4FNUA 2XN1A 5A1AA 4PYSA 2ZUNA 4W88A 1QI5A 3CTTA 1GONA 3W82A 3TP4A 1H0GA 3VOCA 3GTNA 1EHNA 4CCEA 3ZSTA 3M6DA 3VUPA 2OSYA 3ARPA 3DDFA 3AS1A 1SYTA 2EACA 1GQKA 1FP8A 4LPCA 5A69A 3EDJA 9CGTA 3BUQA 2ZUWA 4WIWA 2VX7A 3M07A 4AWEA 1B2YA 3SCVA 2JE8A 4AZIA 1VEOA 1V6YA 2CIPA 2J75A 3WF0A 3UG4A 2VZOA 4MB3A 2VC9A 4M24A 3L2LA 4NF7A 3MV01 3HU7A 3VDHA 2C7FA 1NH6A 1NQ6A 1J9YA 2X1IA 3OZOA 3NSXA 2WZEA 1ZJAA 4DM1A 1EOKA 1HKIA 1GQIA 3CZJA 4W93A 2EPLX 4D6JA 4OUEA 1JD9A 1JI1A 1KGXA 4QCEA 3VGBA 3VGDA 1V3IA 1KTCA 1NWTA 4MNJA 1E9LA 1UASA 2DGAA 4GO8A 1UWIA 3AMDA 4XB3A 3DYPA 3GXTA 4MPKA 4AZ7A 2CETA 2ZUSA 2QV4A 3ALFA 1LWHA 1OSEA 3AHYA 1HJSA 1B3YA 3MMWA 1MW2A 1IT0A 1C8XA 4R5EA 3AIUA 1ITXA 3AZSA 1LG2A 1HKMA 1WB0A 2EADA 2WWDA 2WMIA 4M29A 3WL0A 4D6GA 4RE2A 5BXSA 4H41A 1C8QA 1FOBA 5EFDA 4ZE5A 3DDGA 3N1AA 1J11A 2ZX6A 2CXGA 2G3MA 3DX2A 3LPGA 1CLXA 4HPHA 3PZTA 3SIMA 1JDAA 1BYAA 5I5RA 1I1XA 4QFUA 3NDZA 2YLLA 1W9PA 1T0OA 3DX3A 2DQXA 4UQ9A 1EHAA 3WUBA 1JYVA 1WZAA 4D71A 1E1FA 1GHSA 2VTFA 4TVDA 1RH9A 3HG2A 4LYRA 4PMOA 1J0ZA 1BVZA 2ZWYA 3TV8A 5A94A 1PZ2A 4WJXA 2F7RA 1DWHM 4FLQA 3WELA 1GZJA 2NSXA 5ECUA 2V5CA 3BAKA 1EQCA 2DSZA 1ESWA 4MNKA 4UOQA 2OSWA 2GJXB 4OBRA 3W37A 3VTRA 1XGZA 3ARQA 1UWSA 1DHKA 4PN2A 3K4AA 2WSPA 1W2PA 1FH8A 3PZQA 1VFMA 2D3NA 1QI2A 1PAMA 3VM7A 4GINA 2J74A 4GI9A 3K1DA 2D2OA 3AZRA 2OYMA 3W53A 1CGWA 1JI2A 4Z2LA 1KXVA 1G0CA 4A3HA 2ZXAA 2BY0A 3VMNA 1KWKA 3CHDA 3EJPA 1LL4A 1E0VA 3CV5A 3GXNA 4B16A 3WH5A 1KQZA 3PZNA 3WDRA 1DTUA 5A2CA 3ARTA 1V3JA 4PMYA 2V3GA 2OSXA 3AYSA 4H04A 2YIHA 5GQBA 4FLSA 4GQQA 1B90A 1O6IA 3VIMA 2WXDM 5E0FA 5D8ZA 1JZ4A 1E6NA 1HX0A 2QPUA 1XSKA 4JHZA 1XH2A 4WF7A 2FDMA 4AZCA 3AROA 3WNLA 1V6UA 1ISYA 4F79A 1QW8A 3MI6A 2YJQA 2VR4A 4BF7A 4JFWA 4J3TA 3LPOA 3KLLA 1UA3A 1C7TA 1B30A 1F4AA 3MO4A 4E8DA 1OM0A 2UWFA 2Y5EA 3ZT5A 5LA2A 1VFUA 1E6SM 4E2OA 1WZMA 1GOOA 3IANA 3VD7A 3ARSA 5E09A 1E0WA 2VT0A 5BRQA 3VD5A 4EKJA 4F9DA 2EPOA 6A3HA 4JFUA 2VCCA 3OLIA 1UZ4A 4OOZA 5CLWA 1J18A 2E3ZA 1R87A 1EO5A 2E4TA 1WCGA 4Z2GA 1EXPA 5CG0A 3CC1A 3T0DA 3BAYA 4W8LA 1SR0A 1NWSA 3AMCA 2JEQA 1M7XA 1K9EA 3A23A 2XVLA 3VGHA 1TMQA 4NZJA 4GZJA 3U5YA 1W9BM 5FKYA 5CPQA 2VZUA 2D1ZA 3POHA 1GQJA 1UR1A 4CCDA 1JZ8A 3MSGA 4AC1X 2VNCA 4NZFA 1DWFM 3K8MA 4URIA 3BH4A 2J78A 2WMJA 4KWUA 3PHAA 1CENA 2J77A 4DWSD 1SMDA 2UY3A 4Q7NA 2EBNA 1C8YA 4HMCA 2WSKA 4LYPA 4DWSC 1EDGA 2F2HA 2BVDA 1X6LA 3VMPA 1UH2A 1TUXA 1EO7A 5GNXA 4PBGA 8A3HA 4DM2A 1R46A 2YA2A 5C71A 2YL9A 3BMWA 2VQTA 1ZBWA 4FLOA 3W6LA 3MUZ1 2WVSA 1W3LA 3TA9A 3VKKA 1B3VA 2CHOA 2WHMA 1MQQA 2XHYA 3CUJA 2CEQA 4HPGA 1GOWA 3LMYA 1TVNA 2IXUA 1LJYA 3I3EA 3WFZA 2JEPA 1H5VA 4LGXA 3MKKA 2WHKA 2VX6A 4WKHA 1E55A 1E6XM 5BWFA 3BVWA 2PWFA 3OLGA 1B31A 5GNZA 3BUDA 4PMNA 4GZEA 2W92A 1JZ5A 1XD1A 5I77A 1NWRA 1FH9A 1EQPA 4CD7A 5EFFA 2VX4A 2ZX8A 4Z2KA 3AIRA 4AD5A 2F61A 7CGTA 2HVMA 1VEPA 3L4XA 4E8CA 1LL6A 3WQVA 3RO8A 4MADA 3T2OA 3D5HA 1FFQA 4XX6A 2WMHA 3EMCA 4OKDA 1W9XA 1NM9A 3DX1A 1C90A 2YBTA 2OWWA 4V28A 3CBWA 5JIWA 2QMKA 4DO4A 1CGUA 1FHDA 1H11A 5AC5A 1QWNA 4CVWA 3GH5A 2CITA 1XRVA 2BY3A 2DPEA 4TX6A 5DT5A 2A3AA 3RM9A 5HXMA 1NARA 2ZXDA 3BSGA 4NXKA 3HJEA 4BQ2A 4M82A 1KFWA 4UR9A 2CNCA 1JDCA 3IAQA 1W9UA 1UR9A 3EDEA 3LX9A 1Q4NX 3AHTA 3PN8A 2V3DA 1BHGA 4NX0A 1WDSA 2PWDA 3W28A 4ZXOA 1JD7A 1ISXA 2F7OA 4U5KA 2DEPA 2WCSA 3VIHA 3BSHA 2WVTA 5IHSA 3VSVA 1JXJA 1OD8A 1UR8A 1V03A 3FXYA 1HT6A 3FHAA 3W24A 1TZ7A 5CZKA 1V6XA 1CGXA 3WY2A 5A3HA 2WWCA 5IHRA 3APGA 4KMQA 2QPSA 3HG4A 2GJXA 2D22A 2OW6A 4AYSA 1HIZA 1UKSA 4CKQA 3VPLA 3MU7A 4TVCA 3SEPA 4PEEA 3BVVA 4AEFA 5E70A 5A2AA 3WFLA 4GPNA 3AIQA 3T08A 1Z32X 1JZ3A 1JAEA 4W7VA 3BAXA 3A21A 1QOXA 2XPKA 1JYWA 1DWIM 1V3LA 4GI6A 4UQDA 2FGZA 2GJPA 2TAAA 3LPPA 4LYQA 1CGYA 1IV8A 3VIGA 1R34A 1TCMA 3WUEA 1UZ1A 3ZT6A 5C70A 1UH3A 4DO6A 1E6RA 3VIPA 2BS9A 2PB1A 4AD2A 3DYMA 5A8OA 3B9AA 2A3HA 4OZOA 1OCQA 2VUYA 4B15A 2YFNA 4B3LA 2FHFA 2X2HA 1HXKA 1V0LA 5BXRA 4RE4A 3KE0A 2CKRA 3WQ5A 2DT0A 4JKMA 3CHFA 1TQTA 1PIFA 4XUYA 5DFAA 3AZTA 2XFYA 3GYCA 2VI0A 3ECQA 2WB5A 5JBDA 5CQ1A 1PS3A 2WHJA 1UWUA 2J47A 4CD6A 4CN4A 1F4HA 3B9DA 4PRWA 2J25A 1OD0A 4B9ZA 5BYWA 1C3FA 1I75A 1LG1A 1BTCA 4PMVA 4N42A 4DWSB 1UWQA 1V0MA 5I3DA 1XSIA 3CZKA 2O9TA 4ML4A 2X2YA 4UQEA 4NZCA 4NRSA 4ACZB 1GOIA 1TQVA 1KR1A 3MUY1 3SUUA 1Y7VA 3WY1A 1XD0A 2YA1A 3L4VA 5ABGA 3KL5A 3TONA 4P7RA 3U7BA 1KWGA 2WC4A 2WM0A 1UD8A 5A6KA 3K4DA 2VRKA 1BYCA 5EB8A 2BHYA 4ZENA 4EAMA 3FY1A 4TVUA 5A8NA 1KXHA 1TA3B 2X0YA 4AXNA 2VZVA 4WKFA 5ABFB 1KB3A 1D2KA 3RDKA 5I78A 3WQ4A 5A6JA 4QLLA 2DSVA 1B9ZA 1FP9A 2VZTA 4J3WA 3AYRA 1U2YA 3SUVA 1UH4A 5D8WA 1ZBKA 2D20A 3THCA 1J12A 4HU8A 1NWUA 5DEZA 1K9FA 1ISVA 2Z1SA 5A6BD 4TX8A 1R85A 3A3HA 4ACZA 3BVUA 3DC0A 3KEHA 4H2CA 3BCDA 5E9AA 1UHVA 3OBAA 3G6LA 4S3KA 4UQAA 1G9HA 5M3WA 1PEZA 1Q6CA 1BYBA 2XM2A 3PZOA 2J8FA 4Z2JA 2VRJA 3A4AA 4NI3A 1A47A 1QHPA 3MANA 4M8UA 3WF4A 1HL8A 1VB9A 2E0PA 1XCWA 3WQ8A 4D6HA 3WH8A 1QBAA 3SCSA 3MV11 4HA1A 4EE9A 2EABA 3W26A 5ABHA 4PSRA 3IJ8A 2FHCA 3RM8A 3VDBA 4UFLA 3SCUA 3UR8A 2BY2A 3NJ3A 3QHMA
chains in the Genus database with same CATH superfamily
5BVPH 2CMRL 4IM8A 4JD4A 1YUHB 4G11A 1E70M 4OJYA 1CXIA 1SXCA 3CHPA 5MERA 1OAUL 2XFXA 4KQ4L 5D1QA 1K8XA 4KZCA 1ZU8A 3PZGA 2WXPA 3OR7B 3U82B 1H5YA 3NPSC 2FT7A 5G1YA 3QDJE 3LAFA 4QAMB 1UKTA 4CNIB 1TUPA 3BIKB 3S5LA 1HE7A 3MV7E 4U1IB 3NEHA 1LP9E 4JG0H 1CT5A 3AWGA 4EDWH 4CD4A 1N4XL 1UR0A 4GKZB 2OZ4L 3NA8A 1CWVA 4M6NH 2VCAA 1BJ1H 2OT1A 1J7VR 1MRCH 2H0FA 2VL5A 3AUWB 4XVTH 5J4MA 2FL5A 3WHXA 3H2WA 3QULB 1FAIH 2J1KA 4GFSA 4WUIA 3FHQA 5DUML 3TTQA 4MJID 2V69A 3TMQA 2QCLA 4DZIA 1OTTD 1XYLA 5AFAA 2QZQA 1ACXA 3M17B 5KVGH 3CVHL 4NNYA 3F7RA 4WQ6A 4TULL 2OMWB 5KVDE 3VOHA 4J4PA 4R4FL 5IVXB 3GNML 1MPAH 2NT0A 2NW3A 5CZXC 1X39A 2HNHA 2YDQA 4L6OA 3I9GH 3K2KA 2DZAA 2FCBA 3C5QA 3RR1A 1YTKA 3MDUA 2O5NA 1LO5A 4M1CC 4AE1A 1XBYA 2Q2LA 3IGAB 2DDXA 2CESA 4QXVA 3LGGA 5GJPA 1AJ0A 2IFGA 1NOWA 2NOYA 4DKFL 3QNYA 1KXTA 5E9DA 4LNRA 2IADB 5DFTA 3H0TB 1QVOB 3AW5A 1M3JA 3WFCL 2WM1A 2J8UA 4J1OA 2C79A 3D6NA 4X2PA 4KDTC 3FB6B 3W7HA 2WANA 5J5RA 4OAWB 2ZSVA 1A3HA 2J55A 2ZUXA 4QPEA 2J5LB 4PBXA 1JL8A 4YDMA 3E2SA 1SHSA 1F2XK 1G7PA 5D7JA 1B3ZA 1LRNA 4JCWA 5IQ7L 5IB3B 4HAFA 4HJEA 3TFCA 1T6VN 1BWVA 3UPRB 1MCSA 2OMYB 5CP3A 3S2LA 4DZ5A 2QQNH 3LHPH 4X6FA 1QNPA 1BVKA 2ZOKA 3BKJH 4RK8A 5HQMA 3KOWA 2P42B 5DZOA 4Z0XB 1XGTB 3CPUA 1XIWD 4RX4A 4ANXA 4TUOA 5CH9A 1E71M 1XL6A 5LXGL 3HHSA 4WFFD 4H7VA 5FCZA 5E8DH 2NNRA 4C83B 5LG6A 3ZYJA 3NSNA 4NRRA 1IKFH 5A43C 4UFMA 3UT0A 4L8BA 3KCPB 2ABBA 2QQNL 1SGKA 3LHPL 5E6UB 1YEHH 3GHBH 2DJ4A 3S6CA 4RPQA 5HMEA 1DL7L 2IEPA 4NM8H 4AZ5A 2LW3A 3VI3E 3MROA 4Y19B 2EE0A 1A5SA 2EQDA 5E1AA 2GGHA 4HOZA 4D8AA 2XWTB 3RRAA 4AZGA 4XBMA 4R84A 5FOBA 5D7IE 3LNHA 3DJSA 2IKHA 3GW3A 2XG4B 5IM7A 1MFBH 5LXVA 2CC0A 2OZ3A 1RH8A 4WLCA 3D4CA 2VIRA 3CJJA 5D2VA 4A67A 1DJGA 5BOJA 1UQZA 3QHFL 4EEEA 5C0CB 2E5CA 5FL1A 4AENB 1JGUH 5F3BA 2Q20A 2G2PA 2APVA 2OLAA 2E09A 4DEPB 3KRUA 1VLXA 1BXCA 3LDBB 4JQIA 3ETBF 1GJWA 4ZX4A 1E67A 1E56A 3HPSA 1PG7L 1G01A 1Y07A 3LYRA 3RLSA 5EV7A 2CGZA 1P4BH 4MD4B 1TNMA 2JKWA 3B7TA 2Y89A 3KBSA 3PS7A 3SKOA 4ML9A 2WSRA 1YA5A 4H88L 2ICES 4QDMA 2X1TA 1BF6A 2PE4A 1NKGA 3CDGB 5EC2A 3EOEA 1PD6A 1S7TB 4YWSA 5I15L 2JKNA 2REQB 3T2QA 1P84J 3VNZA 3MSPA 1UIPA 2XZCL 3HHRB 3T6VA 3AMLA 4RCAA 2YW4A 4YHML 5D02A 1M1SA 4JYDA 1B6UA 1FKWA 4C6CA 1XXFC 1AZRA 1GNXA 3RKPA 4AYDC 2OWXA 1HOCA 5ADPH 4HJIA 1TJIL 4HQQH 4PQXA 5IB4A 4KKBD 4G8GB 4OJAA 2YD2A 4WCYL 4X8JA 1PKOA 1QSVA 5D2LF 1SVCP 3R0NA 4CC4A 1A5LC 1M3UA 2FFIA 1BP3B 2GPZA 1K72A 4PB4A 1PQZB 2WWOA 1TPC1 2FEEI 1F6LL 3KZSA 4OFYD 1S2CA 5KYWA 4PJCE 5JW3L 3UJTH 2X4SB 1I3GH 4K3DL 4NQSB 5GGTL 5LN4A 4GYBA 5BVPL 1QRKA 5TDOA 4OT1L 4RGOL 5AEAA 1KM3A 1LQ2A 5ERWB 3V4VB 4NEHB 2EF9A 1ZA6A 3MMUA 1SW7A 4D6DA 3U30C 4L3EE 2AL2A 4FI8A 5L8KB 2DW7A 1A1MB 1W3JA 2W79A 3A64A 4W5UA 3UZVB 2E9WA 3SGKA 4QXIA 3MNZB 3IACA 5CILH 1D5IL 1XGUB 4WOQA 3EYPA 5FJUA 1S9KC 3WD0A 5E8EB 3QF0A 3WO8A 2WZAA 7ENLA 2NSQA 2VUKA 4NRZA 3QCTL 1V77A 3O3UN 3DYOA 1GTFA 3M7OA 4U2ZA 3HLAA 1Z41A 4YNGA 1B3OA 4GXPA 1IE4A 1QWGA 4I0PC 4X3ZA 4AQOA 5FSDC 4JFDE 3THCA 2X5PA 3HAEG 4GSDH 4TRPL 3WBAA 5FUCC 4D6IA 5LNSA 4PJAA 1C29A 2F6XA 3KWTA 3MR9A 3CEPA 3DX6B 1Q0EA 1ZE3C 1ZT4B 5AZEH 5JQIB 2EVGA 4NIYE 1VPQA 1X1NA 5HDRA 2UY5A 3OO2A 3QO0A 5FX3A 3SM0A 3ZZ1A 1D3GA 3DFHA 3V6FB 4W85A 3K0YA 3D0CA 4DVRL 5EZLA 3V1HA 1OFRA 3W75A 1QHZA 1H0IA 3ZTCC 1FFNA 4Y9EA 4K3EL 2N7BA 4F9LC 5EF3A 1H41A 2VEPA 4U3SB 3C3UA 2YYTA 3LRMA 3ZK0A 4EI5D 2E77A 1ZLDA 2XU2A 1H3XA 4B2DA 4ZB2A 1GYCA 2GGJA 2GJLA 4TQTA 4JY4B 3T44A 2IPTL 1IBZA 4U1MB 4GCAA 5ESAA 4AQ1B 5BOZG 5D33A 3PWJA 4JO3H 3LN4B 3LS9A 3WIIL 2WSYA 4ZO6A 3LKPB 2YSTA 3KCOA 1MUMA 3S9ZA 1C12B 2E28A 1RI8A 2HQAA 5T3XE 3W9DA 4OCRL 3NAVA 2EDNA 3QUYA 3BAEL 4JPIA 2QCDA 4UINH 3V9FA 5DJ0A 2P3EA 3HFML 3H9SB 4JEGB 4KBPA 2D0GA 4FX6M 4IGBB 2ZKHL 1FORL 5CGTA 4TNFA 5A6AA 4N68A 2VLKE 3N13A 1PG7W 4H9TA 2W5FA 5EG6C 5IEHA 2GJZA 5DJ8B 3TBVA 1B4JH 1NP0A 4O9HH 2X6VA 4GP8B 3TBTA 3PFRA 1FSKB 1OD7A 4ICMA 5C5YA 1YN7A 3EZ8A 3CGTA 1RUPL 3LLFA 2P5EB 3SPJA 3CT7A 5JBEA 1H3PL 3LMJH 4ERSL 4N2EA 3CZUB 5K39B 2Q87A 3QOMA 3AQYA 4FYRA 4KCVA 5FB8A 1TPB1 4XRCB 1YY9C 4JFED 4KAQL 4XMXA 1XINA 1KYUA 5F9AC 2EDMA 2ATAA 4PJGE 5C0RL 3X3GL 4BI6A 1MNZA 3P9WB 4DUWA 2IW0A 1W8EA 3EOOA 4L61A 3Q44A 3GNMH 3INUL 2DIAA 3VIIA 2WN2A 3P3YA 2Q86B 2DZEA 3QO0B 1IAII 2ZP9A 3TO4C 5FHBH 3B2UC 1WT5C 3R1GH 4WFHD 5GZOC 4HA4A 5KZEA 2WBJD 4HKZB 3LPFA 2E4FA 2DI8A 4C5ZA 4WVRA 1DJQA 5JPNB 5B8CC 3K6NA 4LEEA 1DQML 4UV7L 3QJXA 1DVZA 1ZRQA 1XF4A 3ANVA 2KL6A 3ARDD 4KNSA 3EJJX 5D8JL 3P2TA 5B1JC 4XH2A 1QZ1A 3L1OH 3EBGA 3GXFA 2OYPA 2G0KA 3GINA 3NNTA 4ZB5A 5KSAC 2UZYB 4HCDA 3MV8B 5I7GA 3P1VA 4MSSA 2ZZ5A 4ALAH 4MDJB 3F62A 4MYPA 5IB5A 4UQCA 4LHQB 3BLEA 4MM1A 3E0WA 1OFPA 1LK3L 1IAOA 5I8KL 5ES4B 2HLAA 2REQA 2YL5A 5CN1A 2RAMA 5I18H 2WYSA 1SZRA 2F74A 1P0BA 3O6KH 4GQRA 4X5WA 2WZIA 4AY0A 3K7UA 5I19H 3MTRA 4R97B 3UJSA 5FHAL 1RQHA 1XFPA 1Z8AA 3EKGA 2ADJB 5JMOC 4P46A 5DJ2A 3GRWH 5I09A 2AGTA 3W0WB 4BRJA 4UILL 4MQXD 2VW6A 1DFXA 3VRJA 3WX7A 2Z1WA 1MHPH 2R1NA 5AZUA 4N2GA 3TYFA 4XZ4A 3TJEH 1PFOA 2FUQA 3WK0A 1T22B 3PGCA 1F3RB 3FU7A 4L4PA 4L56A 2OWCA 4ADSA 1H15A 1D7DA 2C7UA 1BJ1J 1M41A 2AAVA 3DGBA 4R0LA 4X4ME 3SY6A 4KKBC 3SYAA 3TA6A 1HILA 3QZLA 3ZW3A 5C3LD 2NY6C 2PBGA 3TCEA 4ZL1A 1DE6A 4A2EA 3TH3T 3GMQA 5F96H 1ZDQA 1ONQB 4LEOB 5T3XD 3UXFA 2FE0A 1FG9C 1QR4A 1LM8V 3L6FB 3U2ZA 1BOYA 5DLML 3TTOA 4YC2C 1EDQA 3ZMRA 4MWAC 1PY0A 3IJYA 4OF8A 3VXRE 3DOPA 1JVKA 3BEVA 1MW0A 4LPVA 2JKPA 1ZHBA 2CBJA 1J8HA 2OFJA 4FMVA 1XGYH 5GGTA 1X7QA 1PLCA 3EHBB 5E6YA 1QLFA 5I1IL 5JZ7C 1IYXA 1LLZA 4FHAA 3HN8A 1CI1A 1R38A 2X87A 2ZCZA 1HHKB 2V37A 1DQMH 4YHPB 1REQA 5HTSA 2DP3A 4O19A 5C0BB 1SLUA 1T7LA 1VF8A 2FZMA 4JRXD 3WE1A 4HTYA 5CCGE 4ABWA 2OL3L 3P9MA 2ADYA 2V5JA 4I1NB 1AY1H 1MELA 1H3UA 2CG9X 4LF1A 5IB5B 1MCQA 1A49A 5KVEE 2C1IA 4I9AA 1S9YB 4FXKA 5SWZE 4KI5E 3CNKA 4K8RC 2HSAA 1JZJA 1RUKL 2IV8A 4PY7B 4HUUB 3AALA 1IGYA 5I6KA 4XKMA 2QF7A 1NGXB 5CSUA 4X8GA 3B2PA 5AAPA 4GKZA 3V8OA 4IUOA 4PLOB 3DX7B 1VC4A 1SM3H 3RG6A 5I26A 3GB7A 4NDMB 1NCCH 3L9YA 1AR1D 1LEGA 3UAAA 1H60A 4EXAA 1BXNA 4YFEA 3D8MA 5IG7A 1AMKA 3D0AA 4LAOA 4UZUA 4JN1H 3O2DH 1V27A 4HZ6A 4YZFE 5E03A 3W9DB 3X13A 1E6JL 3LB6D 1AKJD 4WUUB 2X42A 3CO4A 2X9XA 3HE7A 4RQQB 1JTTA 4UILH 2FECL 3PWPB 4KHTL 5E8OA 4LRIA 4XWGL 5JU6A 4D8PA 1EWDA 4NN5B 5BVJB 1GOKA 1ZJIA 1LLAA 3D2UD 2HE5A 3LGEA 2R56L 3VB8A 3V0JA 1BG4A 5F7FA 2PDWA 4MHBA 1CF1A 4ORMA 2DYPB 3MFFA 2BNRA 4RFOH 5DD1H 5DJXA 4KCTA 3UZXA 1A53A 3WIJA 3WQFA 7A3HA 2E9BA 2ZZ7A 1I9IH 2E9GA 5B4MD 1IILE 3SPHA 2AMGA 5KBKA 2C19A 3ZDZB 3MO1A 4ZTYA 3UZWA 4A63A 3PB0A 1TETH 3QDME 3FCUB 4S10A 3CG8A 3WEMA 2KC0A 4PS3A 3QV8A 3FB6A 4E4UA 2ESVB 4GEIA 2MEJB 5JYLA 2BS8A 3BJFA 2Z0BA 4KJPC 5ENWB 4D7PA 5IW1B 3BQVA 2ADIA 3G6JE 4B97A 3DIFB 4IMEA 3O9WA 1F3DJ 4EDXA 2NVAA 4G8FA 4HUWA 4LUYA 1T5KA 3LH9A 2CHZA 4CQ9A 1AE6H 1YEJL 1FPTH 4UT9L 4V2CB 5D1ZC 3E2QA 1VPOL 4J4PC 5FF2A 4P23D 2GOKA 1JGDA 1F4XH 3TYGL 8CGTA 1XIMA 2WC3A 2O9PA 5FFOA 1RK0A 3J2PA 2BGQA 2BRQA 1FDZA 2WVUA 3NIYA 2EUWA 2J44A 5GNYA 5M17A 1HYSD 4EI5A 1HWHB 4OCSL 1LLWA 2GJNA 2IXQA 3IYLW 2IGTA 2WSQA 3O6AA 3KPOB 4XCEB 2A79A 4FXTA 3B34A 3VGGA 3MP3A 3UR2A 2ZICA 3AB0C 4LYKA 1T66D 5AHNA 1DE4A 1OT2A 1GMIA 1O4UA 4W6WB 4NUGL 1W5NA 2FDBP 3C0LA 3CZEA 3W6MA 3WLTA 2R1XA 3I9GL 2O61A 4Z7UB 2DQDH 1T2QH 1AODA 3L65A 3IDMA 3PWAA 1IIIA 3KM8A 5DD3L 3UJ2A 3MLSH 1EZUA 4ELMA 1E4WL 4CNIA 1SPQA 1MFCL 5J11C 3ULUF 4IT1A 5HANA 2BWIA 5DLLA 5LIKX 2Z00A 2B77A 3FO2B 2PO6C 1U5VA 4O2FB 4PJ7B 3LCXA 1CL7I 4R9XA 4UQBA 1B0GA 3UG5A 4LEQA 1MJ7H 3NT0A 3HIJA 4NO3B 3KYKL 5F44A 5EU5A 4YSSA 1IB5A 4JJ5A 1U8OB 1U0QA 4LAQL 4HWZB 4BFKA 2ZOOA 5CHNA 4HU0A 1UWTA 1X3DA 1ESOA 1QSZA 1KKRA 2UX6A 3AS3A 3KPSE 5KYYB 5AAMA 4JTRA 4RGMC 4Q6IA 4HU4A 4B3KA 3NN8B 4UT7L 3AAZB 5CPOA 1ED3B 4JTIA 5IESH 1MWAB 2UVFA 3QDGA 4X5XB 5HHMB 2VWEE 4APQA 1E5AA 2EDDA 1FYHB 4TV5A 2P8MA 3ILPA 4YVPA 1I2OA 3RCMA 1DVYA 1OCZB 1JHTA 3HMXH 4XMZA 4PJ8D 3UGEA 2C91A 3O9WB 1T3FB 4Y1SA 2VLRE 3ME0B 1XHGA 3FU9A 3S6TA 5LNDA 4XI5D 1WTGT 3FO9A 6REQB 1MCPL 3ULUL 2PO6B 5DBUA 4KW2A 3CD4A 4FQJL 1UB5A 4NWTL 4LLQB 2NNFA 1OFDA 1GGOA 2WMFA 4HHGA 1R6WA 3BUIA 1LYXA 4L8CB 1C08B 3F5WB 3DARA 5EU3B 2TRYA 1PWMA 2ZBTA 2WIMA 1CI5A 2WXIA 4BQ5A 1GCYA 1E4NA 1PHQA 1XGYL 3H9SE 3BRGC 1IBBA 2IAND 1O5XA 5C0BA 4Y2LA 4IBUA 3QRGL 2JCCA 1GOGA 4JDEB 4XTRC 4WK2B 5ABDE 2P3ZA 3IKCA 1RZPA 4WGXA 3GSUA 4ZO7A 4XN9A 2XA8L 5F7DB 3NR0A 5M5DA 4DFIA 3KZ8A 1F3JB 3AYVA 1BW8A 1U8QB 3UYCA 4DGYL 1L9TA 2NY3B 1NINA 3L5WB 3NCJL 2H32A 3P3TA 4HSCX 4JL1A 4LMQI 3BKCL 3BQ5A 1FVEB 2CO2A 5DK3A 3D3FA 4U10A 3L3DB 4K9JA 4LLAA 4UMGA 4ZUUA 3SUWA 1SJEA 1VERA 5FGCB 5KSAD 4K7FB 4O54A 1TZGH 1Y8BA 2H0PA 5BOFA 4V1DB 3LCHA 1U8PB 3QPXL 4QY8A 5FFGA 5FEZA 3TIEB 2PBOA 1S7QB 4XP9L 1CFNA 2XYCA 3UP6A 4Z0BH 1SJHB 1JPDX 1JGMA 3R0UA 1ADOA 1Z9MA 1K4CB 2ZUUA 4PU2A 1F76A 1L2QA 1TENA 3LERA 5KETA 3BG3A 5D30A 3KPRD 3GHTA 1MCBA 3KL3A 5D71H 1AMYA 3F12B 4Y5VA 1QJWA 2DQUL 1BYOA 3CXHJ 3QI9B 1HJCA 3VNMA 5CWSA 1H19A 4MZ2A 3VZZA 5IWLA 5TDNA 12E8H 5KG9A 3M5YA 4Q4OA 2ISWA 1GPOL 3SCMA 5IOKA 2PRLA 2AEIT 2ZA2A 2Y23A 1W2VA 1US2A 2AK1H 3F65A 4NZ8A 4ODXA 5ABTA 1DV7A 1XYAA 3MRKB 3TH4T 2Y3NA 4L4VB 5DYOB 3UGXA 1INDH 1V6WA 3TR9A 2PYEB 5F1VA 4FQLL 1BXUA 2YRZA 3S2JA 4BEIA 2PWEA 1RZMA 4WHCA 3GK8H 4ENEC 5M95B 1MWOA 2DI9A 3WLIA 4DY1A 2GGIA 2ADGA 1TMLA 4CMHC 2ICWJ 5IKCA 3BDKA 4BF5A 1HWGB 3QBTB 1SO4A 4EKXA 1LWIA 1KT2A 3VSTA 1JQXA 2I16A 1I6NA 4GUQA 1N7MH 4JJOA 3SYQA 4XPFH 1AAJA 2X70A 2R4RH 4J5NA 3I75B 3X3FL 1XV8A 2PABA 5LNGA 4BJHA 1K85A 1NGYB 2NTSP 2PTVA 4U3HA 1GZHA 3PK7A 1U3HB 3GFZA 4W6XB 3L9CA 3MS8A 5CPNA 1CZ1A 1EJOH 1SR0A 3BT2L 4X0KA 4XAYA 3D2TA 4QLRA 5LHDA 1YMMA 2BLFA 1D3HA 3NSJA 5CZTA 5K9OA 4GAGL 2YCLA 1RPXA 3ITOA 3PFQA 5D4QA 4JO2L 1M2OA 4UDTA 5D7EA 3DOSB 3BFWA 1HNFA 1IFHH 4MAYA 4Y19D 1KYAA 1XLDA 3RUGA 3WLQA 1QR7A 3CFCH 4HKJA 5D1ZD 1K6WA 2HT3D 5LGZA 1G43A 3OR6B 1LE9A 3QXVA 3CN0A 1A9EA 1UG6A 4ICXA 3B8TA 3FRPB 4PY8J 1MWAH 1PZ3A 3HG1A 4RBPH 1NEUA 5F7LB 1I9JH 4K0OA 5CEZL 4FSAA 1LT7A 1NDZA 4IGNA 1VHPA 4CUCA 2D0FA 1HEZB 2G5WA 3BVDB 5JORB 2ED6A 4JM2F 1OG0A 1V79A 1JR1A 4MWAB 3RPDA 4F48A 3E3QC 5DVKA 3JTSA 4YTQA 1R3LA 6PTDA 4UTIA 5E93A 5MEOA 3HS0A 3GSVA 3QZBA 4QRBA 5D71L 3QZOA 4GE8A 1A4JB 1TVBB 2EEFA 1E27B 5JOFA 1IQ8A 3DJRA 1UBPC 3B03A 3CUGA 2INFA 4FXFA 1AXTL 1CL7H 5H37G 3W11C 3WS6A 3PQYB 1JCLA 3DX6A 3L7EA 1WBXB 1A6ZB 3PWVA 4NP9A 4BHUA 3AO0A 3RU8X 2PYEA 3STZB 1CXFA 4OFQA 1EWEA 4FA6A 3LHTA 3MMTA 4NAMA 1AGCB 1R5VB 1FDJA 1MXGA 1QFWI 2GAZB 4GGBA 4CC4C 1TWZA 4RRPA 1I8UA 5DK0A 4FABH 1AQ8A 1FA2A 5C08D 4QE4A 4G5AA 1NTDA 1GSMA 2OCZA 1FQ0A 2O9RA 1ULVA 1AR1C 2F9BT 3HZKB 1T21A 1AKJB 2OTUB 1KENH 1NCWL 4KO9A 5K69A 1RLWA 5I3HA 3VCCA 1I8LA 1WT5A 4I9WD 3X12A 5LGHL 4LS1A 4N2NA 1JZ2A 3AREB 3ARDA 2DQTL 1XF1A 4I4WA 3DX4A 3T4AB 3P9LB 5E4EC 1CCWB 3W02A 5C9JB 3V0VB 1XRTA 2JIEA 4JFEB 3CIQA 3WJLC 1US3A 3NZ1A 2XN9A 4QE1A 4S3CA 3RUGB 5HWMA 1CFMA 1RV8A 2A4EA 3QIUC 3RK8A 4AXWB 4LVOB 2NT1A 3R2GA 3D3VB 1SXSA 4NYLB 5CJ8A 4ZS6D 2DY3A 1I9EA 2R7EB 2KLSA 4TNVK 5BQ7A 1WZ1L 3FKUS 3LCYA 2ESVD 1D6EA 2OKTA 4A29A 1A4LA 2X2IA 3UTPD 4H3DA 4PRID 1F3JA 1ASPA 2IGFH 4GG6E 4JIEA 2XN0A 1UGKA 4U28A 4ZFOA 5IJKA 3CSTA 3SCTA 2EIZB 4YMZA 5DBTA 1G7LA 2QADC 5FYLL 3S97C 3VCNA 3OXRA 3QUMA 1GZPA 4M5ZH 3C8FA 2J8HA 2BWDA 4CN6A 1FORH 4FOUA 4D9LH 3UBPC 1ZLVK 1H3WM 2J6WA 1AXIB 1SO6A 1AP2B 3RWFB 4ISVB 1XSJA 2DSUA 2NY4D 3UIYA 1MFEL 1MIEL 4HMEA 1KCVL 1GZ1A 3KVJA 3CL6A 4HG4K 3U4EB 1F6AA 3J27A 4NJAL 3JTTB 2NXYD 4X9HA 3MQTA 1RIUL 5BUGA 2NY2B 3V16A 2VR8A 5IDZA 5BRZA 4LWWA 3N85H 1MVFA 5T1KD 1EERB 1PZ1A 4XPBL 3GEFA 4PCNA 1G9ML 4PJDF 3SCWA 1NCBL 4K2SA 4DRSA 1AQFA 3TASA 1U91B 3HKZA 1VFHA 4MQXC 1NGXA 2Y5TA 2HKFL 1Q6GA 1IM9B 4HAKA 4F58H 2AL1A 2EEBA 1CLOH 3THMH 2OTUA 3K1KC 4HIXL 2GB2A 4IMGA 4PCPA 2WCGA 1VZWA 1XXXA 5FGCE 2DORA 1TYRA 3BPOB 4JFXA 2P44B 2W66A 3BARA 3ICJA 3LM3A 4B2DD 1JYXA 4IP4A 1JMZA 3CMGA 2WO5A 4Y5YB 2PWHA 1E1CB 2QBWA 3P3UA 3IDXL 4BZ2A 5F0MB 3L4WA 4JIQA 2AJVL 2GABA 2R2CA 3GXDA 3CFMA 3PFUA 2HWZL 1EEZA 1TU2A 1M6OA 4XOAA 1E8XA 3L3KA 5DD6B 5GS0C 5CJBA 2XXFA 2ZWSA 3VWKC 4YX2H 5J6HA 2IALB 5BJTA 4PL1A 1XGTA 1GA2A 1DCEA 2BC4B 1HFUA 2P49B 3RY4A 4G70B 4HOXA 3L12A 4EDWL 3CSBA 4FQ1H 3CB8A 1WOBA 3P3BA 3S5YA 4NL1A 2G9KA 2Z1PA 4DXVA 1F5WA 3T8VA 2R0KL 1BQUA 3LH2L 3CYJA 3QY6A 3TH6A 4HJJH 3CHQA 5AVSB 2HLFC 1EIBA 1UA6H 1I31A 3GJEB 4N3TA 1RZJL 4RWHA 4CW1B 1RA5A 3H22A 4PUNA 4IFKA 3TNBA 5AYIA 4C56D 3PUGA 2LU4A 1OY0A 4I5RA 2EC9T 4P05A 5C2BH 2XIBA 5JQHC 4IXXA 1F1DA 4NGHL 4E41A 2J7HA 1AP2A 3RWFA 4LCIH 3B8SA 1N8ZA 3ULVL 1H49A 2DW6A 2V33A 1E8WA 2WTPA 3G5XA 4JFFA 4L2LA 1NC4D 1G9NC 4LCUA 4ELMF 1AD9A 1ZTVA 3VGAC 3FN9A 4LIQL 5AW7B 1BWWA 4JE0A 3LN9A 3BAIA 2A9MH 4HDIA 1TTBA 2JB6B 1MQ8A 5IQ9A 5C9WA 2NYYD 3FU8A 3OSKA 1BFSA 3MBWB 5EZLB 4HPXA 1EDYA 2X12A 1NU5A 1IX2A 2AEQH 3S48A 1ZGLA 4QXGH 1HU8A 1LBMA 1SFHA 2NYKA 2ONEA 1BLIA 2ZNWA 3ITLA 4JQ2A 3S3GA 1CN4A 2HH0H 1Q7MA 2JKEA 3DG6A 2HG5A 3BQUC 3LN5A 3PZIA 4S1RH 1GR7A 3UAJA 2VR2A 3GW0A 3BGGA 4EWND 2VDRL 2DEYX 5M1TA 4PRIE 2W38A 1IWPA 3KWSA 3ES7A 2BIHA 5GRJL 4AGMA 3LKPA 3R12A 5HHOE 4UFHA 3DC8A 1C7SA 1ORSB 1K5NB 5CMAA 4Z7AA 1S3HA 1XX9C 2BOCA 4MBOA 3N44B 2J1WA 1E1CA 1MUJB 4G8EB 1EOMA 4IMKC 5GGRA 4DW2H 2PCYA 2I7GA 3KOXA 2DEWX 3W07A 2GSGB 1FHLA 1HW6A 3W23A 1HCZA 2BHZA 2AXWA 4HA3A 1HTYA 4WSHA 3FUNA 1G7VA 3MI3A 3TNNB 4LAJH 4AL8L 4LHUA 4KTYA 4YC2B 3MUUA 4EN2A 2ON3A 4NO3A 4P2OD 4LH8A 2X4NA 3V75A 4XN1A 2BS71 4Y9MA 2YOCA 4G6MH 4X6CE 4RDBA 2W61A 4HCLA 4J2QA 5F1NB 4Q52A 4X8XA 1MCFA 3F7VA 4G56A 4HIIB 2J2ZB 1TFPA 2OL3H 2XPGB 3SDDD 1G4SA 3OGRA 1OBAA 4WUUA 3KLAA 4OZGA 2GYIA 3MMEA 3H4FA 4C55A 4JRLA 5LVEA 3VVVA 4AQ1C 3KLHC 4KS0A 2ABAA 2YSWA 5DX7A 3L23A 4C56A 3QJSB 1LL1A 3TN0A 3QBUA 2VQ1A 3P4MA 2Y07H 2CFFA 3EDFA 1MCHA 4IRSC 1GOMA 5JXAL 3NO5A 2DJXA 4MUPA 4YHYC 5B3NA 4MJMA 1S3RA 1MW3A 1UYWL 2B59B 3OQ3B 3PL6D 2AXHA 1XLGA 4HJFA 5PCYA 4LFYA 4YR6A 5J56B 1NAMA 3APFA 2XH2A 5E94B 2VKWA 3CAVA 3CC5A 4WFEE 1F6PA 3PAVA 4R3SB 4PRPA 3SHSA 3GC3A 4J9JA 3CU1A 3OP2A 4P2RA 4LLQA 3W1AA 3VYLA 1KJVB 1AI1H 4QQUA 3R8HA 5GGUB 1M9WA 2F15A 4X2RA 4EXQA 5IFTA 4OLXH 1MRAA 5K59E 4QHKI 5DT7A 2ADIB 1QPPA 3VUSA 3QWRD 2YQBA 3A6BL 4DQAA 4Q3MA 1QRNB 1ZPLA 5CJXA 4UR8A 5E7FA 4Q4EA 1CE1L 1PX8A 3GLAA 1FWFC 1MWAL 2BVYA 2QDEA 2WLLA 4IICA 2YMTA 2QSVA 4PV8B 4APQC 1F3XA 1K1DA 4UU9A 1K4DB 4K5MA 3F2BA 3QUML 4Y9NA 5BOPA 3OB0H 1C92A 3PJXA 3RVTC 5CAYB 3VXSE 2UUDH 4J3OD 4QGTA 1WO2A 2ARJB 4BCEA 3GUWA 4X9YA 3IFOA 4ZBCA 3CVDA 5DSCA 2Q3OA 3K8KA 4PRRA 1ZGLM 1BAFL 1A6UH 4NHCH 4L1LA 2G4GA 4OH2A 1J5DA 5EOCL 2RR3A 3P4OB 4XXDA 5AYZA 4HXAH 1RJCA 1WAAA 2H1XA 1B0RA 3P4NB 4NUQA 4OZHF 1F4XL 1V0KA 4XBGB 4YBQC 2FVKA 3FJNA 4NUPA 4PL2A 2JXMB 3K46A 4MKTA 2Z8SA 3FX4A 4HNNA 5CD3B 4U1LA 3QV7A 2B4GA 2E7CA 1D2OA 3L3KB 2WQRA 1HGYA 3L5LA 4PUWA 3V8CA 3MJ7A 1K8DB 2VD8A 2X05A 2Z25A 2ODOA 4A2SA 1WGOA 3OGCA 2ASHA 5D9MA 3QXDA 4FF5A 3U79A 2IKJA 3WQCA 1EJUC 1TKKA 1PBGA 3SCMB 3R19A 1XYFA 2VFDA 5SWSB 2APTA 5CEZD 4JO4H 4CVUA 3D47A 4DBSA 2MKLC 5E6RB 1XP3A 3BJTA 1UROA 3S5OA 3LD8C 4WGVB 4H19A 2VDLL 5KSBB 1PJ9A 4M7LL 1TR9A 5E99H 5GJMA 4NFBA 1LEKA 2WLMA 1Y0LA 4F37K 3OPZL 3GDBA 4LVOC 5FB8B 1I7ZB 2W0PA 1QDSA 2XI9A 4JB9L 4QTHB 4ALDA 2GSJA 4GYFA 2HUHA 4V2XA 1WSST 2PYED 3M0MA 2C1PB 3CZFB 2OMZA 5FOOA 1E9QB 4XKYB 4PR4A 3WLPA 3BSZL 3QUZD 4OCWL 4Z78B 1NDYA 3SDAC 4PP2A 3II2A 4C6KA 2NY7L 4LSQL 4WDUA 5ILTH 3L3OB 2IPWA 3H4GA 4BK9A 3EWYA 2XFGB 3QNFA 4FNTA 1FAKT 1TO3A 4BFGA 1RPUA 4YN3A 3EEGA 2EKCA 5I19L 4RIRB 1VAHA 2Z24A 3ASOB 3GKWH 3ARVA 4PHXA 2XUCA 5BXPA 4K8RD 1G7JB 4M3JA 4ZUTB 1M9HA 3LKOA 1QWHA 3S36H 4UFIA 5J13C 4JFEE 4XP6L 3DBNA 4JRYE 4XBEL 4HZLB 2PPAA 1KUMA 4UB0H 3RWJA 1W0MA 3ARXA 3WG7B 2VDRB 3MNZA 5LWYH 3X13B 2B7OA 4ZFZA 4M4PA 4DN3L 1VDGA 4WNQA 2WMIB 2E6QA 4HT1L 2DSKA 3PBGA 4H00A 2QUUA 1XHHA 4LBEA 4IDLA 2A9CA 4JG1L 3UFIA 4YDKH 4HIHA 3MAWA 4F27A 5EO0B 3AIBA 1M2VB 2EILB 3VXRA 3NTCH 2Y72A 4PGEA 1AACA 1DCLA 2B4CC 1ZLWH 2VDKL 4NAQA 3OQRA 4WU7B 3TYEA 1BQHB 4NNPH 3T3MF 4DJFD 2BNQD 4JZOA 1PW3A 1JK8B 4JG5A 3UYRH 3BZFB 2DV0A 4TTUA 4DQWA 3EOBA 3QYMA 1BM3L 4ILDA 3A4EA 1FWXA 1DYZA 4C6LA 2YKLL 1IKNC 5IM7B 4ZAKA 2C13A 3OF6A 1CPUA 4B9JA 4B9CA 1XLBA 2BW5A 4WSGA 2P26A 1CBJA 4JFHE 4PIRF 1GCFA 3SQBA 4C90A 1N59A 4YHLH 5I1IH 4LEFA 1XGQA 3D1MC 1QI3A 5EZJB 3G0SA 4ZTXA 3BW9A 2EDQA 4W9FC 1I82A 2VDOH 3HCVA 3KL0A 3KW7A 5HJGA 2ENJA 3VXUE 3GK0A 2HRHA 4LCWE 4WNSA 2Y70A 3DI0A 4X5QA 1JNLL 1P9MC 3AXXA 4KPLA 1RULL 2F8XC 4QXWA 2NQCA 1SUJA 4M6VA 1UXMA 3ROLB 1LO3H 3RWDB 1XLCA 4H0IA 1UD5A 5LG1A 1TZHA 1BLNA 4Z7UE 1RALA 2FGLA 1AQDA 3BZ4B 1ADQA 4U1SB 2IUZA 2VGGA 1J5CA 3FH5A 4A7UA 4UT6H 1LO0H 2G2RA 4Y5XB 3WN5A 3GSRB 3NQ7A 3GXMA 4X60A 4RE3A 4RZ5A 1RVFH 1P0DA 3AFBA 5I3IA 3B0YA 1EGJL 1FNEB 3ARYA 5C9JA 2CDEA 1OK0A 4PJ9B 4ZUTA 5CBBA 1G9MC 1NM4A 3HFMH 4WWID 1Z89A 4DP6X 2R6OA 4LAZA 1A6PA 1O75A 1UOKA 5F7WC 1MI5E 3IBOA 3EX4A 1KLUB 4MQ7B 4UU9B 5BV7C 4HVXA 4RNHA 2FHBA 4PMUA 4N86A 4W1TA 4H1LG 4NQEB 4E4FA 1CTNA 3MRBA 3FVDA 3O45B 1IC4H 3V4PL 2VXSL 4L4TE 1U30A 4WU7A 1QASA 3WTSA 4HKJB 3PPEA 1L8NA 3BP7B 4UTAA 1OLLA 1U41A 2X4OA 1P69B 3WXVH 4UTBA 1N2RB 1AD4A 2YDSA 2IKGA 1TG7A 1FNGA 1AH3A 1W2KT 4PJFB 1BSIA 3R10A 1YEKH 1H3TA 4W5ZA 1H5BB 1DFBH 3SO7A 2B1HL 5C0CE 2PUZA 1PVHA 4PTNA 4AD4A 2FTWA 1CDYA 5JDJA 5MHSD 4QDPA 3EA2A 1J1PH 6CGTA 4X4KA 2CDGA 5KAQG 1SJCA 5E6ID 1E73M 1R17A 1INQA 3T5WA 4AUUA 4CU8A 1V4YA 4N2DA 3TPUA 2H3DA 4NX5A 1THAA 1XF4B 4A7GF 2Y7SA 4D2NA 3MP5A 2J88H 4XK2A 4WO0A 6PAZA 4YQXH 3AISA 5H8UA 5AECA 4MB4A 4HVBA 3ZTJG 4KEZA 4S2BA 1WLHA 5CLTA 5DS1A 3X1GA 4BFFA 4DJED 1FVDB 4Z2IA 1YTEA 1ROWA 5L0QB 1TZHB 5E1IA 3V6FA 5JW4N 2MSPA 1E4XL 4X80H 3GC5A 3IGXA 4QIUA 4E9QA 3MUAA 4P2QA 2BSRA 4RE0A 4BI7A 1OGAA 4LSVH 3V3WA 2OI9B 2YAMA 3P0VH 5L6UA 4Z1PA 4HOWA 3NZPA 2G5BB 4QF1B 4XVJL 1OO2A 2WC7A 3NA9H 1EEZB 1TU2B 2JJTA 2K1MA 4HIPA 4KHTH 5AENA 5KS9E 1S5MA 1EVUA 5HMDA 3FU3A 5GGSB 2K6WA 2VM8A 3VW3L 2OQHA 1WS8A 1B0WA 1UB6B 3WNJA 4P57B 3DFYA 5HYSG 2J4WH 2JQAA 2JTYA 3H53A 2DT3A 1Z3RA 2H8PB 3WLWC 4JEQA 3SFKA 4XX5A 1QW7A 4Y4KC 3IIOA 3ZDZF 3KPSA 4NCDA 3HA0A 3PQYE 1URLA 5GGTH 1XIBA 1A6WH 4N9BA 3O6FB 1M05A 4ROPA 5FC9A 4CBZA 1B3WA 1EP3A 1WC7A 1LOLA 4Y8FA 1PHWA 2RHEA 1RFDH 1RXLA 3KUMA 4N02A 2AK4E 5JOPE 3W6YA 2ZYSA 3KXFD 1LO5B 3APTA 1FL5A 4K7FA 4MDIB 5AB0A 3FUKA 4JJHA 3VRIB 2EPKX 4O4VA 1LRQA 3B4NA 4ELMB 1CICC 5D7JC 3STCA 2EG7A 3BVNB 1WKFA 4NJGA 3RX4A 1FWNA 1XGPA 1UZ6E 4WIQA 1XLKA 3IS1X 4GLRH 4M61A 4LAKA 4ZODA 1UP3A 2RDWA 5IBXC 2EE9A 1AGEB 2LV4A 4F15C 3KRBA 3GZQA 3UP1A 4JREC 1NMAH 4JM2C 3JWNG 4LHJB 4X2UA 3W2DL 1ET7A 2BZ7A 3F58H 4DKTA 4WJ5A 1IVTA 1S9WA 5TIMA 3OLEA 2G37A 1DLHA 1PYWA 4HUXA 2J7EA 1JV2B 4CGUB 3B2VH 4PWIA 5CHNB 3VXPA 1G6RH 1NC2B 2GJRA 2W07A 3L2MA 1KQYA 2OA9A 5ESVB 3IM1A 5BU9A 5EOCH 1U8CA 4Q8UA 4OGZA 3ZVVA 1OVZA 1RZKL 4P7QA 2XDFA 3HRZB 3L13A 3N44F 4Z7OF 3DRTA 4GUCA 1P0EA 3H2EA 2HVNA 4YHIA 1MHHB 1UPPA 4E41D 1FAIL 3U6XA 5KSUA 2Y8KA 5LIXX 1WAPA 4GQ9H 4WRHA 3T2NH 3LXCA 1KIRA 4PJBA 3ALWA 4OF6A 3FQNA 4ZK8A 3FUHA 4GG6B 4KTDL 1GORA 1KKOA 5IOBA 4NJIA 5K4XA 3EDDA 3QJFA 1FE8L 2MNWA 3ME0A 2YAPA 4E9WA 3L9RA 2I60H 2OCCB 2X0WA 3NRQA 3EMQA 3HAEB 2ZKXA 4ATDA 4AZUA 2RFXA 1JGLL 3PWJB 2WXGA 4N6RB 3OR7A 1J01A 1UVQB 3T0BA 1GS7A 4GIAA 4PJ8A 4ANUA 4RGNC 4WWNA 1OSPL 2BZNA 5BNXD 6ALDA 3VFSA 3V7AG 2WXHA 4W86A 3R94A 3MLRL 3RDTA 1XI3A 4FQHB 4OFCA 1BXAA 4PJ5A 3GMNA 3MLPA 1TPEA 4ZUSA 3TJXA 3WLHA 3KFTA 2NY1C 4I5BB 5I5MA 1H50A 1IMHC 2H26B 4QNPF 1C91A 4KH2A 2DZSA 2QGBA 1T6BX 1TPXC 1W72B 2A9ML 4N25A 2GUBA 1EHKB 2FBOJ 4PWJA 3H1ZA 2F18A 1J0HA 1E2VA 1TG8A 2ITEA 1EEPA 3UBFA 4F7CA 3WHE1 3P2BA 4KVPA 2DIEA 4XAWH 1IEWA 3IK2A 3NFSL 5G2NA 1DTNA 4LK4A 2CBMA 1M7PA 2V5DA 3CAQA 3WIIH 3A13A 1YEGH 2D23A 3QJAA 1FL3B 1I9IL 2R51A 2X9ZA 2P76A 2PN5A 5HYQA 4AQAA 1L6SA 5JBDA 1JPFA 1Z9SA 3PZVA 3L5WA 1ZP3A 3KYKH 1H8NA 5B1CA 3CFNA 3QM3A 1U42A 2NY5L 4PW3A 2A83A 1R4XA 2C9QA 1Y5VA 3NEOA 4PYSA 2VISA 4W88A 3MLZH 2IPKA 4BWLA 5C6PB 5HY9A 1CS6A 3SGJC 1XB6A 2EH8L 5I6NA 3C8KB 2ZTKA 5TE7L 4Z7OE 2IBBA 2KPWA 3AUVA 3WFBH 3FV9A 1Z42A 3GTNA 3P84A 4PJFA 4IRZL 3T2LA 3ZSTA 3RVTD 4S1SH 4TSCH 2PLCA 3L7RA 2AJXH 3SDDB 2QULA 3ARPA 4OLUH 2Q6WA 2ZSVB 3IRDA 5CZSA 4PJDA 4LUSB 4G59C 2ZRUA 1IXOA 2EACA 1UENA 4HBKA 5U4NA 1R1CA 2XXMB 1VS1A 4AEHL 5T9BG 3FQNB 4WWOA 3KXFE 1ZAJA 4KY2A 3FRUB 1F11B 1E51A 2WJEA 1KGJA 5JHBA 1K7XA 4I7UA 1SOQA 2DL2A 1GOFA 4O02A 4OIIL 1UC6A 4NQSA 3RE0A 5MEPA 2QCNA 3CPRA 3G1HA 3P7YA 1NICA 2BERA 3BUQA 3O9WD 1KC7A 1T7XA 3RUGE 4WIWA 2WGNB 1BEYH 1FGNH 3QJRB 4Q4QA 1OB1A 3VOJA 3CK0H 1GYAA 1QFEA 1P7TB 4GXVH 4NUWA 5DZNA 3SCVA 1S6NA 4RESB 4K5LA 1KGYE 4YH6A 1JPSH 1V6YA 2CIPA 3KBMA 2J75A 2X7VA 5TE6H 2XZQH 1QA9A 3Q3GA 3QYCA 4IOFC 1EEUA 5JIQA 1B0GB 2YB4A 5C0EA 3UG4A 2VZOA 4FA3A 2BP0B 2BPBA 3MBXH 3MROB 4Y19A 4A8LA 3MGOA 5HINA 4M24A 3L2LA 4TUUA 1TJMA 1EKOA 4NF7A 4OUUB 4HWZA 2ICWA 1SY6L 2C7FA 1GGBL 3L7FA 3V5HA 1QO5A 2NCEA 1NQ6A 4GX8A 4POZD 3NSXA 2QSTA 4L37B 3QW4B 5FO9A 5DQPA 4F0MA 5HNTA 3CVIL 3PWPA 4IU3A 5E8NB 3WFHA 5AG9A 1U6AH 1RCQA 4QEEA 4OCNC 4DM1A 2EBNA 3CZJA 3O0RL 4HIQA 4W93A 1EJ7L 2FT8A 2EPLX 1QSFE 3QUHA 3W57A 4N9DA 4OUEA 2B5IC 3BIAX 4WWKA 4BXVA 1HYSC 4QCEA 3JV0A 3HC0A 4F80A 4FE9A 3PBUA 4ML4A 3ABXA 1TEGA 4H7ZA 3PIQB 1GTEA 4E5XA 3N2TA 1IFGA 2J71A 2A5HA 3QIBD 3GMLA 3BP5A 3ABKB 4OCMC 2DM4A 1DORA 1VKFA 5C86A 3ESOA 4NAJA 1HEZA 5CFAA 1UASA 4HH9A 1HHGB 5DHVA 1HI6A 1OSYA 3ISWA 2R4RL 4PWKA 2CXEA 4MS8C 4HC1L 3RLHA 3SGEI 3AMDA 3PWNA 4KWSA 3DYPA 1KRCC 1LNUB 3ET9F 3DLQR 1L8PA 4I9MA 1JGUL 3JVFC 4R4BA 5DANA 1XPYA 1U91A 2QV4A 1ZHNA 3VCLB 4WGWB 4HK3N 3OZ9H 5HYSB 3WJJC 4WFFE 3KYMA 3QYSA 4YHPA 1REQB 3U4BL 4XZIA 4PRAA 1BF8A 5I74C 3D33A 4LC6A 2A74B 4G9FB 2XN9E 4ORGA 4NVTA 1LWRA 4IYKA 5EF0A 2ADFL 3AZSA 2CO7B 3FT3B 1EV2E 3N9GH 1RUML 1FWIC 1HDMA 2WWDA 4M29A 2WMIA 3WL0A 4JZNB 2YPVH 43CAA 5FAJA 1EAJA 4XN7A 1FOBA 3LH8A 4P5MA 1J11A 2ZX6A 3DI2B 4IBQA 2HT4D 3ZKMD 4OVXA 1OSZA 2ZZ2A 2G3MA 3LPGA 4EZMA 4KKNA 1M7JA 4NUJB 1CLXA 1RHFA 3PZTA 4N8VA 5DYFA 1BYAA 3M1OA 4H9MA 5B8CA 4Q9RL 3ZTJH 4X7CC 5GRWA 3FUMA 3WTWA 5TH2B 4RAVB 4YXHH 3GNDA 4S1QL 3CLFL 2DQXA 4NN6C 1KTLB 4O58H 2OTDA 3KM1A 2VKXA 2QT3A 1EHAA 4NQVA 1ZK5A 3P0VL 3UA4A 4WQOA 4B0MB 4EQ2A 1JYVA 4D71A 1HL4A 4AXWA 5TDNB 4RBPK 5HHQB 3JT0A 5F1IB 5FYJE 2DJMA 2FQIA 2GQHA 2F8VA 2LU7A 4M8QA 4TVDA 3E6HB 3G5XB 1LOQA 1CO1A 3N0AA 1RH9A 3GIPA 3BESR 3KPNA 4LAQH 2BM3A 3C4UA 3Q8CA 3UCRA 3WKQA 2D7TH 3TV8A 1PZ2A 5A94A 1AGFA 2F7RA 4UQIM 3IETB 1R3IH 3VI3B 2NSXA 2XQBL 2QAFA 4UDUB 4MDJA 4BH8A 3HGRA 1ICSA 2V5CA 3MJ8A 1CFSB 2DFAA 1FFNB 2DSZA 4G6CA 2OR7A 4LT9A 3VFOA 4UOQA 4AY8A 1FWJC 2F53E 2ATPA 1A6VH 4OU1A 4OBRA 2GJXB 1ITQA 3IUDA 4JZJB 3VTRA 1NLBL 1AC0A 1UWSA 3US9A 4A1RA 2ARWA 3KD4A 2R1WB 2WSPA 4HFUH 4JO4L 5DZAA 4KXBA 5IF0B 3V0DA 4CVXB 4Z78A 2EG6A 4JDVA 3W84A 3IJ6A 1X5ZA 3O3BB 2BVOA 1JERA 2Q3AA 3CMOH 5JOEA 4N2YA 5DRXA 2OQJA 4GINA 5SWSE 4MWFB 4TPRL 3IDIA 2GSGA 3AVEA 4I88A 4M6NL 1R24B 3TFKC 1XIIA 2OYMA 5IJVA 9XIMA 3GWQA 1CGWA 1XH3B 3HZMA 3UZJA 2GOUA 4P5MB 1JI2A 2W95A 5AW0B 4BI5A 1EXHA 2C0HA 3EH5B 3LQLA 1NLDH 3F1QA 1DDTA 2I7SA 4ZQMA 1KWKA 2JFEX 4S0TD 2ZG3A 4GIPD 5IK3B 1KRBC 4D9PA 5L4JA 1QNZL 2RDUA 5JA9A 3ERPA 1KCRH 1JFQL 1TFHA 4XP1H 4FG6D 3V0WL 3V6OA 1P7TA 4GSDL 5AOIA 1O9WA 2JQXA 4JFFE 4F7PB 3BE1H 3RXZA 3VNJA 1F58H 1R9ZA 2KYIA 5CKGA 5JW4R 4TUKL 8FABA 4ZCWA 1HKLH 1SDAB 5LBSL 5D6DA 1MNSA 2B7DT 4YNYB 3IRSA 3L3DA 3ZS4A 1GPWA 1MFNA 3U7YL 1G69A 4EVNA 5I2IA 2H8ZA 4URKA 5LLIC 3HGOA 5GQBA 2XWXA 3UWWA 3FOMA 1JGLH 4QRSA 1SFJA 3HF3A 1DBAH 3W9ZA 3BXNA 3PAOA 1KIUA 3VIMA 3S3PA 3TXVA 2EDEA 2YW3A 5KYYA 5BWAA 4V2BA 5GRVK 1AGFB 1SFDA 3OKEB 5E4AA 2HBXA 2PDMA 3CS2A 4C91A 2ITCA 3GO2A 4AYMC 1U6AL 2DKUA 1NL0H 4UTBH 4X9GA 1V6UA 4NAFA 5I03A 4OVUA 2OLHA 5ILTL 2J43A 1FWTA 1UWFA 4Y9CA 5L4FA 3MI6A 2YXOA 3BLLA 1JHKH 4ZOAA 2VR4A 4L9YA 1FLTX 1CK0L 4OGAC 4U7MA 1GGCH 3JZ7A 1B2WH 3MLTB 2E7LA 4QNWA 3QXBA 1II4E 4HWEL 2R1WA 1UA3A 4JQIL 2Y1VA 4GLRI 2R8SL 3DGRA 2MWCA 3DPBB 3ROLA 2CBOA 1JZDC 3RWDA 3U1SH 4IK6A 5IG7B 2UWFA 3SE8H 5HWNA 2X3AA 4EVZA 1PFCA 5D7IA 2GIXA 5AUMB 3K4WA 3RNKB 3QUZA 4E2OA 4IG2B 2RD0A 3TE9A 4GUPA 3IDYB 1CUOA 2V9DA 1YEKL 2DTSA 2R0KH 1HESA 3K80A 3QDAA 4JPVH 3C2AL 4MXWH 3T65B 1QSFB 3U1SL 3ZGIA 3U0PA 1E0WA 4C56E 3O2WL 2CKNA 5HGHA 3EWBX 4F9DA 4O53A 4BFIA 1YNTA 1Q3NA 3OZKA 4R7XA 3W39B 1AS6A 3PV6B 1ONXA 1A5AA 4LSRH 1T1YA 5C07B 2VCCA 4GISA 3SGZA 1UZ4A 1RL1A 1BA9A 4AWSA 5GRXG 2FWOB 4U6XA 4ZSOE 3IU4L 1Q8AA 3NTYA 4Y8EA 2E3ZA 4ZS7L 2AMXA 4B4FA 1EO5A 1S7WA 2E4TA 1WCGA 2NW2B 3D34A 5LB1A 1EXPA 1PO9A 1X9LA 3GI8H 4Z1DA 3VGAB 4P2RE 4GS7B 4QRNA 3RJQB 2OBGA 4MQTB 3UJRA 3BLFA 3RDTC 1GTHA 4WFHE 3UGVA 2N3JA 1S7VA 5EEZA 4YFLF 3DO7A 1K9EA 3F7VB 3CMFA 1GYUA 4F7EB 2WBXA 3DUUA 3BPNC 4R7OA 4BQ6A 1TMQA 2ITDB 2X6BA 3NA9L 3L6FA 4JLRA 1S7RB 2RB8A 5AAWC 2FBJH 2BVUA 3V4UH 5FF6B 4E8GA 1SN0A 3V55A 2ORBH 1ECQA 4RKAA 1SJXA 2ZYHA 1ACYH 4WO4B 2V8MA 4P99A 4KRPB 1GYNA 1EXUA 2H5UA 4O58L 4Z7WE 3W9EA 4JTJA 1D8CA 4NJHA 4E3VA 5LNVA 1KPUA 4MMXC 3EBHA 1TWWA 2GTZA 1YX1A 4EACA 5C0QA 1MAJA 1HKVA 5D4HA 1E6JH 1XF5B 1GQJA 1UR1A 1KIPB 3ARGD 1UWGH 4LFHD 4GACA 4R33A 4G7YL 2VNCA 3S47A 1TIWA 1CLZH 3K8MA 3GY1A 3FYIB 1TPXB 4HMNA 5I1LA 3K1GA 5LNWA 5IVZB 4FAMA 2HJLA 1KCBA 3BH4A 2J78A 2UWEB 4JQAA 1A0DA 3SY0A 3SY5A 4G3YL 4Z77B 3VRLE 2VWEC 2OMTB 3MXVL 3PHAA 3FUJA 1PF3A 1XBDA 2R2HB 3PHOA 4K2UH 1SJDA 2ZRWA 4GQGA 4DWSD 1OV8A 5GGVY 2UY3A 3VI4B 3BPWA 4HMCA 3P0GB 1S5VA 2WSKA 4TYUA 1RHCA 1EDGA 1K3UA 5FUOL 4ZFGH 1OOAA 2XWBB 3EXTA 3VMPA 3U4KA 5DJ6B 1P4CA 2Z34A 4UV4L 1NC2D 1UH2A 1WS7A 2K4AA 4HHHA 3VFCA 2WV3A 3C6LD 3C2AH 4MXWL 3W39A 3FJTA 1R0AL 1FY6A 5JXAH 1A14L 3CFEA 3GRWA 4QOKA 2E59A 4DM2A 3ARDB 4YFDB 4K3JL 1R46A 2R82A 1N8OE 4KNQA 4LVGA 1JNNH 2YA2A 3FQTA 2WWNA 3CMOL 1J9CT 4H9XA 4O2EA 2IH8A 3AQZA 5IJKC 1KIQB 4R4NC 3TA3D 4GBXA 3QLDA 4NNXA 3EO0A 3L5IA 4AIXA 5KWYC 1XLIA 1FZJA 3MV8E 2QPXA 3TA9A 4JPQA 1BGXL 1DBMH 4B53A 2AL2B 2CHOA 1FGVL 1QBMH 4F8OA 5HPMB 3S42A 3Q6FA 4QHKJ 3UEZA 2OMNA 5I1HH 1EGMA 4RGMB 4XBGA 1TVNA 4DJEC 3MODL 1E42A 3RVXD 1HCVA 4MJIA 4X50A 5SX5K 5KTLA 1U8IB 3EOLA 3RWEA 5KANG 3O16A 3SDDA 1JZFA 4NKIL 4PD4K 1IJ9A 5F9JB 5BW7A 5IQ9B 4WUKL 3WFZA 2H41A 3JTSB 4HUVA 3G1FA 3NPZB 5I8EB 4FCAA 4R96A 3MKKA 4QG6A 3RZCC 5A8GA 2VGIA 3AWNA 4RDWA 4EIZC 3AYTA 4AGLA 4A39A 2R14A 1FZOA 3C6SB 5BJTB 5J11B 3FSTA 3VDGA 1GKPA 3GRWL 1Y5XA 2N7SA 4Y4HB 4ZNEE 2ZCKL 1I2PA 3LUTA 5H91A 3FSOA 1ZV2A 3VYPA 1MZHA 3BISA 5F6IC 1ONEA 4L0PB 2P80A 4PLKC 4TMPA 3HFYA 4ZXBD 4DT2A 3BUDA 3H85A 3PV7A 5KSUB 4P2RD 2BFVH 1Q85A 2W92A 1XD1A 2K9UA 3GMRA 5BZWB 4CD7A 5EFFA 4POZC 4A66A 3QJFB 1IC7H 5IQOA 1XGRB 1C5CL 2A9AA 1NAMH 3RWIB 2P9RA 1U8KB 3FB7A 5I9QB 3ZE2B 4AGPA 5AOMA 4F2ME 1W72H 4H2AA 5AZ1A 2WUCH 2HVMA 3DN5A 4POCA 4OUUA 4J2PA 4IIDA 4E8CA 1X7FA 2GTWB 3GIVA 3U9UA 2VXVH 3VXMB 1FWEC 5GS0L 1LL6A 4BY3A 1XXDC 4M6OH 3CUXA 3H21A 4B5SA 1U21A 3H3PL 4LBAA 3VYNA 5DC0A 4RA0C 4ZMAT 3TN0B 3IDXH 3UVAA 3LKOB 3UZZA 3CV6A 3QORB 2E86A 2XTJC 1CDUA 4DEWA 2BGSA 5KZDA 4AQLA 3S0CA 4HXAL 2N01B 5EU5B 4ZFFB 3EMCA 1GG1A 5I1DB