1XV8A

Crystal structure of human salivary alpha-amylase dimer
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-amylase
publication title Crystal Structure of Human Salivary Alpha-Amylase Dimer
rcsb
total genus 160
structure length 496
sequence length 496
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xv8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xv8A01
1TE1A 1FH8A 2DH2A 5CPSA 3W53A 1KBKA 3T2QA 4NI3A 5KEZA 3K4DA 3D51A 4MAZA 3CLWA 3WDPP 2YL5A 2HISA 4XX6A 1CXKA 3AS0A 2DSUA 3T2PA 1TQVA 2FYVA 1UA3A 4JL2A 4X0VA 4CVUA 1C8XA 2BVTA 5JIWA 1PS3A 3E1F1 1UOKA 1GPFA 1CPUA 1MFVA 8A3HA 5FL0A 3AIRA 1ESWA 1BAGA 3BH4A 3F5JA 5CLWA 1R7OA 1H2JA 4JFVA 2VZOA 1UHVA 3SCVA 2HVMA 4P7QA 2BY1A 3K8MA 4GKLA 3MSDA 2J8GA 4P8WA 4Z2HA 3MKKA 1UWUA 2EPOA 2D23A 1SYTA 2W61A 3SUUA 2XYLA 1FHLA 1Q6EA 1E4IA 2X1IA 3VD7A 1AQ0A 1HIZA 4BA0A 2C8NA 2WLYA 2WK2A 1XV8A 2GK1B 1JG9A 2W4XA 5A6MA 3VUPA 3VX0A 1QW9A 2D1ZA 3A4AA 3ZOAA 1JD9A 3EMCA 3PZUA 3BUPA 3TA9A 1QI4A 4DO5A 1FA2A 1UZ1A 5A3HA 3W82A 5FKYA 2WKGA 2FE0A 4Z2IA 1HX0A 1JZ5A 1E15A 3AROA 5A6BA 4FNQA 4JCMA 3EJUA 3VSTA 2BY2A 1V3LA 3GTNA 3VGGA 4KGLA 1ODZA 2OYLA 1GQLA 3PZNA 4W7WA 1KXTA 2XWDA 4AZ6A 3ZJKA 3BAYA 1GQIA 3D3AA 2BHUA 4MPKA 1C91A 3AQUA 2WCSA 1GJUA 1YQ2A 4DO4A 1OBAA 4B9YA 3SCRA 4QP0A 3GBDA 5JUVA 2V3EA 5E1QA 5A8OA 2XN2A 4PTWA 3SCUA 3G6MA 1G94A 3PTKA 2ZUTA 3GH5A 4UFLA 4B3LA 4W7UA 3AFBA 1EIBA 1W9UA 4AYSA 2BHYA 2Y5EA 5I23A 3WD0A 1TFVA 1GONA 4UNIA 2X0YA 2DDXA 3NUKA 1VF8A 4RE4A 3GZAA 2V3GA 3OGRA 4MNKA 1OB0A 1B3VA 4MB3A 2GK1A 4J3XA 1B3WA 1FH9A 5E0CA 1WCGA 4AMWA 4DWSB 1OGBA 1KGXA 1B3ZA 5CSUA 1V6YA 2XHYA 2W5FA 1HWWA 3GXNA 4GZEA 4OOUA 2ZUMA 3L4YA 3A3HA 1HJXA 3ARZA 4MB5A 2GFTA 1NWUA 4EANA 1ITXA 3H54A 4HP5A 2VVSA 1G0CA 5A94A 5FCZA 1CGYA 1CXEA 4IUGA 3SCSA 4Z2LA 3WY4A 1RPKA 4P7LA 5CSYA 4Z2KA 1TR1A 1E56A 3VM7A 3ZSSA 3LX9A 3LPGA 5E0FA 1KBBA 2VCAA 5LA0A 1F4AA 1TA3B 4UFMA 4X9YA 3VNYA 3GXIA 2VRJA 3T2OA 4CU8A 4J3SA 3IJ7A 3ZQ9A 1E1EA 1PX8A 2OSYA 1JYVA 1K9DA 4TUFA 3HG5A 2CBVA 1TCMA 2EQDA 4MAVA 3WD3A 2WLZA 1E0XA 1MFUA 1TQSA 2G3NA 2JIEA 1GHRA 3GXTA 1CDGA 1XD0A 2IUZA 4HU0A 1WKYA 4EK7A 2CKSA 3HZ3A 2A3CA 4P7OA 3CC1A 4X0NA 3H55A 1K9EA 3U57A 1E6PA 4GZJA 4B9ZA 1WNOA 4W93A 3W6MA 4FNRA 3AJ7A 3DX1A 2PWFA 1PX4A 4AZHA 3SUSA 3T0DA 4DWSA 3I3DA 3VTRA 4LX4A 1TQUA 4V28A 5GNXA 2QPUA 1LL7A 2CYGA 2VQTA 3MANA 4P8XA 5JBEA 4BQ3A 4FNTA 4AZ5A 4DM1A 2FGLA 1QHOA 4KGJA 3HG3A 5AYBA 4PMNA 3WQVA 4MJ2A 3APGA 3W24A 2WBKA 2DT2A 3AMKA 1XRVA 4TX6A 2DEPA 1TVPA 1H4PA 1W3LA 1UKTA 3VIMA 3HMCA 5E9AA 3FN9A 1UD8A 1J11A 4PTVA 4PBGA 2ZX7A 1JYNA 3A4XA 2F1BA 2WMGA 3AZSA 1DWHM 4W7VA 4AEFA 1YHTA 1XH0A 1FFRA 3WQ5A 1AQMA 3FW6A 2VX7A 3F4VA 3BCFA 1UA7A 2CPUA 1TA3A 2RGLA 3WD2A 1BFNA 1C8QA 2XVNA 4H04A 1EOMA 2E8YA 1UZ4A 3OLDA 1W3KA 1IZJA 2YLAA 2WAGA 3DHUA 1VJSA 3BVXA 3CUIA 1BGAA 1N82A 1DEDA 4UQAA 3D50A 2VC9A 3EDDA 3BSGA 1SMDA 1JI2A 4M8UA 2E40A 1JIBA 2W67A 4HTYA 3WNKA 5A8QA 3IJ9A 3N13A 2J47A 3M6DA 3RPMA 1E6XM 4GI6A 1ISXA 3VVGA 1ZBWA 1GORA 2G41A 2CHOA 1JXKA 2XM1A 1HNYA 3WNNA 3HN3A 2DSVA 4AZBA 2XGIA 1UH3A 2W66A 2F7OA 2PF0A 4PTXA 4W8AA 2WMKA 4DUWA 2DT0A 1FP8A 3PZQA 2CXGA 4JFTA 4PYSA 5EBAA 3G6LA 1J18A 3RDKA 2EPNA 5LA1A 1OWQA 4TVUA 3W27A 1QX1A 1V0KA 5AC4A 4UR9A 3F5LA 2XSBA 4JAWA 5A8MA 2DT3A 4W86A 1O7DC 4D6IA 3MSGA 3N1AA 4CN1A 2J74A 2E3ZA 1QNPA 4AXNA 3WMSA 1GZJA 3L2LA 1GQJA 4NRSA 3WUGA 3A5VA 1EGZA 2VZUA 2NT1A 3WNPA 3LXAA 2WW5A 2EBNA 2OWCA 1OIMA 4GQRA 1O7AA 2ZWZA 3LXBA 3QHNA 3N9KA 1OINA 5DF0A 2JEQA 1XGZA 1I1XA 1EH9A 4ZFMA 1J0JA 4PCTA 1B3XA 4J28A 4M24A 1W3HA 2GJRA 3GXFA 3WH7A 3ARSA 3CUGA 3WDQA 1V03A 3VDHA 2OW6A 3VU2A 4MB4A 1BG4A 1QNRA 4YN5A 2XVLA 1QBBA 1D2KA 3BAWA 2WXDM 5A8PA 2GJPA 1JNEA 1D7FA 4HPHA 1B3YA 3ARPA 5E6YA 3K8KA 5M3WA 5HXMA 1MW0A 2EPKX 1BGGA 4FLQA 4NZFA 2X2JA 3UERA 3WH5A 3WQ6A 3EDEA 3KE0A 2ESCA 1HTYA 1C7TA 3BCDA 1UD6A 4PMYA 1UWSA 3PZGA 1UD2A 2F7PA 3S6TA 3BUQA 3CZEA 4P7RA 5BROA 1BVNP 1V6VA 3SUVA 3AIVA 2EADA 1RP9A 5CLTA 1JXJA 4JKMA 1A47A 2XFRA 4P8VA 1UWQA 5AYIA 3FHQA 2D0GA 3VM5A 2CITA 1QPKA 1UKSA 2C7FA 3AZTA 3N18A 3ZMRA 2WMIB 3BAJA 4OBSA 5A6KA 4M81A 1KCKA 5I78A 3ZT7A 3WD4A 1C7SA 1MW2A 4HZ7A 3WDIA 4MNMA 1ZB5A 1R33A 3EBVA 2J8FA 2OWWA 4GZIA 3VDCA 2V38A 1DHKA 1PJ9A 4PMUA 5D9NA 1QI0A 4CCEA 1NWTA 4DWSC 3SCWA 4H7VA 1VBRA 4U33A 4OOZA 4BZYA 4EE9A 1XH1A 4XUYA 4UFIA 1BPLB 3VD4A 3AOFA 4ATDA 1W91A 1WDRA 1U30A 1V02E 2UY4A 2BS9A 1G01A 3WFLA 1B90A 4BCEA 4UFJA 3AIQA 1UYQA 4NSBA 3IK2A 1KR0A 1V0MA 5FOOA 3WY2A 1V3JA 2ALWA 1XH2A 6CGTA 1EOKA 3WELA 4ZE5A 4HZ8A 3CZLA 2XIBA 1QNQA 1F4HA 1J12A 1R47A 4DM2A 1TQWA 3EJTA 2PWHA 2JALA 1OD0A 3AXHA 1BTCA 4CGTA 3UESA 2VR4A 3TV8A 3WENA 5BRPA 1E4NA 4U2YA 1C93A 1UD3A 1R86A 2PI6A 4D1JA 3GBEA 4HZ6A 5IFPA 2GJXB 3CMGA 2WVTA 2J79A 3CZJA 3HJEA 1UD4A 4W85A 4FNUA 1VRXA 5A2CA 1WP6A 3L4VA 4M29A 3BAKA 2BVDA 1W1VA 1V3HA 2WMIA 5BXTA 3NDYA 4JL1A 1E72M 4AW7A 1UR8A 1EO5A 3OBAA 4M56A 3W0KA 3BAXA 2WNWA 1E0VA 2VTFA 3AHXA 1CEOA 1PIGA 4QFUA 4QLLA 1UQZA 2EAEA 4GQQA 3MV11 5TD4A 5EB8A 1E6NA 4AIOA 3OZPA 5LYRA 2WPGA 2ZX5A 2DIEA 1XSKA 3UR7A 4UQ9A 2YOCA 1XSIA 2XJ7A 3UEQA 1QBAA 1VEPA 3DYMA 1ZS2A 4JFSA 3PN8A 3AHZA 3WMBA 2VOTA 2ZE0A 3L4TA 2G8ZA 1FOBA 3ALFA 3BVVA 3A6OA 1HJQA 1WDPA 3N04A 3WY3A 1G1YA 2J7CA 1VFFA 1CGWA 1AMYA 2EXOA 4PUEA 4BF7A 2VURA 2D24A 2PWEA 5A95A 4DUVA 4E4PA 5A6JA 2A3BA 1MQRA 3M46A 1V6UA 1CZ1A 3RJYA 1JFHA 2WZIA 2GJXA 1BYBA 2AAAA 3IGUA 2EPLX 3W81A 4HMDA 2Y24A 5BXSA 3PTQA 3AHTA 4J3TA 3RJXA 1CXIA 3AMLA 5C70A 1NOFA 1JZ2A 2Y8KA 4V27A 1E73M 4UCFA 1UKOA 2YFNA 3MMDA 3MV01 3W37A 3OLIA 1HJUA 3S5ZA 3CUJA 4E8CA 2EABA 2XN0A 1Q6FA 4AD4A 2Y2WA 1SZNA 3VIPA 4ACYA 3J7HA 4B15A 1QWUA 2DH3A 1JDCA 1GW1A 3K1DA 2YL8A 3SURA 4BQ4A 4W5UA 3EMQA 4EKJA 1EDTA 1S46A 5E09A 3DX0A 1I75A 3GYCA 3W38A 1UR9A 3WUFA 3THCA 5IHRA 4AY1A 4W88A 3VDBA 1EQPA 2D2OA 3BXWA 4R5EA 3DHPA 2OWXA 4XV0A 2DSKA 1LLOA 3D52A 6TAAA 1Q6DA 5BYWA 3SIMA 1ODUA 1G5AA 4J27A 3DECA 4IM4A 2FH8A 4XZWA 1K9FA 4KH2A 3WN6A 4EAMA 2QF8A 5GNYA 3WUBA 3VDAA 3KZSA 2VCCA 4D71A 4IPNB 1NP2A 2XG9A 2E9BA 3CV5A 2ZWYA 1CBGA 3VOCA 1WZKA 5D8ZA 3KEHA 4JIEA 1H09A 3TOPA 1MXDA 2QMKA 4NXKA 4AD1A 1U33A 1EDGA 3CH9A 4AWEA 1W3JA 3W4RA 5EMYA 4U5KA 1TQTA 1SR0A 3WDJA 1QOXA 4TTUA 2PBOA 1CGUA 4H2CA 2CNCA 2O92A 1M04A 2VJXA 1W2VA 2JF6A 3WDRA 3GH7A 2D73A 3VIFA 2VQUA 3GXPA 4ATWA 5JIPA 3AHYA 4NF7A 3VIGA 3A4WA 3ECQA 2VT0A 1XYFA 3DX4A 5ABFB 1HKKA 2AMGA 2BNJA 4WF7A 1UR0A 4AZCB 3D4ZA 1H0GA 3PZMA 4J3VA 2WZEA 4V2XA 2VNCA 1BG9A 2ZXDA 1QVBA 1JZ3A 1JF5A 3AS2A 2VMFA 3CUFA 3CUHA 3ZM8A 2ZX8A 1UASA 1JGIA 1E43A 4UQCA 1H3GA 1R75A 4CCCA 1HT6A 5DMYA 4ZE4A 3W28A 3IJ8A 1VIWA 1OD8A 5ECUA 1CLXA 1FP9A 4OUEA 4W84A 4KWUA 4ACZB 3EMZA 3GXMA 2J78A 2XTKA 3AIWA 1OGSA 3DX2A 5HNNA 3DDGA 4GO9A 4AD0A 3BUBA 5A6SA 3A23A 1UR1A 2Z1SA 3SCQA 2EO7A 3M07A 3T0BA 2FH6A 4WK9A 1XCXA 1WZLA 4D6HA 1MW3A 1C90A 2WVSA 4FLRA 3IANA 4RL3A 2D3LA 2IXUA 5DT5A 4HMCA 3AYSA 1BSIA 1V6WA 4AEEA 2YDSA 4F9JA 1EHAA 2X8RA 4PSPA 2BXYA 3KL0A 3F5KA 3SEPA 4CD6A 1GHSA 3AXIA 3B9EA 3NSNA 3QGVA 1DWAM 4M1RA 1TUXA 3GNPA 4ZXOA 3SCTA 5I3DA 2BFGA 3POCA 2D3NA 3BLPX 1CECA 2CETA 3SCNA 5CZKA 1PZ3A 4AZCA 1CXFA 3AICA 2EEXA 2WHMA 3O2LA 1W32A 4FLSA 2A3EA 3DX3A 3WH6A 4D6FA 1B1YA 4CD7A 1JAKA 3NCOA 4UQBA 3ARUA 3ZIZA 3OB8A 4Y7EA 3ARQA 5CJ5A 3L4UA 2O9RA 3VD5A 3WMCA 4C7FA 1HVQA 2Q8XA 3BMVA 3L4ZA 3PBGA 1R8LA 2XVPA 3CHDA 3FNDA 4ACZA 4LYRA 1EXPA 3CBWA 3MO4A 3UR8A 3WH9A 3RM8A 1CXHA 4AISA 3LPFA 4F8XA 2UY5A 3BMWA 4R27A 2XN1A 2D22A 1W9PA 1GQKA 1WE5A 2Y4SA 4JKLA 1WZAA 3WD1A 2G3MA 1HP5A 4PMZA 5JBDA 5A8NA 3VD9A 3VGBA 5M03A 2X05A 1TZ7A 2WHKA 3WBEA 4HA1A 2E9LA 2DSZA 3WL1A 1ZBCA 3WH8A 1NM9A 3OGSA 1FH7A 3KLLA 2E9MA 1X6NA 1VENA 2ZXAA 4C7GA 1T0OA 4OIFA 2WMHA 1W9VA 3TTSA 1CWYA 3WSUA 2VR5A 4FNPA 3VMOA 4DO6A 4MNLA 1ISZA 5GQBA 4Q22A 2XM2A 4MDOA 3WKZA 2ZUNA 3L4WA 5CXPA 3AMDA 1EO7A 1JFXA 2CERA 4UFKA 3AIUA 1M7XA 1FHDA 4AIEA 2YJQA 3AYRA 5CGTA 3AS1A 1ISYA 2O9OA 4NX0A 3VPLA 1TMQA 1GOQA 5I2UA 3TTOA 1WZMA 5IDIA 1E70M 4PCSA 3SCOA 2J62A 1GNXA 1LJYA 1C3FA 2BVYA 1CLVA 4WLCA 2ZX6A 3BLKA 3CZ8A 5D9OA 3EJRA 4TXEA 4DUXA 3MS8A 1ZBKA 4D72A 4RE2A 3WF2A 2RGMA 2VCBA 2OLHA 1GOOA 2VVNA 1V3KA 5F7UA 4Z2GA 1CXLA 1LF1A 2OSWA 1V0NA 3AMGA 3EDFA 2VO5A 4JFUA 3DYPA 4OKDA 1CTNA 1RD6A 3DC0A 1V08A 3AIBA 5AY7A 1R87A 1QHPA 4CN4A 3PTMA 5DFAA 1KXVA 2ZUWA 3A21A 3N12A 1C8YA 4FNSA 4HOWA 1W1PA 4KRTA 2F1AA 1E3ZA 3WEMA 1J10A 1KGUA 4UZUA 4W89A 3UG5A 3RM9A 2CEQA 3FXYA 2CIPA 3N15A 5CPTA 2WWCA 1ISVA 1PZ2A 1MQPA 1XD1A 1J0ZA 2B31A 4BQ5A 1GOKA 2YIHA 4N42A 3EJPA 2PB1A 2XPKA 3VKKA 2VRKA 3UCQA 3MUY1 2XVGA 1BYAA 1WDSA 1GJWA 1R7AA 1Y7VA 1UR2A 4D6DA 1HVXA 2E4TA 2WZHA 1UD5A 1MXGA 3OIHA 5BWFA 4CUCA 3A22A 4WJXA 2GSJA 3HG4A 2E0PA 5HBFA 1KWKA 1E55A 1HJSA 4QCFA 2WHJA 4WSJA 2X0HA 2CBUA 3CHFA 1BYCA 2QPSA 3U7BA 3WF0A 4MTVA 1ISWA 1QNSA 3CTTA 1BVZA 3S5YA 1US2A 4LXFA 4NZCA 2VX6A 4QCEA 4S3KA 1OT1A 4D1IA 4F66A 1L0PA 2BY0A 1CIUA 5C8BB 4LYQA 4MB1A 1PIFA 3QOKA 4FK9A 2WBGA 3DDFA 1SFSA 4PMQA 1R34A 5EFDA 3KL5A 2J7GA 1Q6CA 1LQ0A 2PWGA 2GUYA 1H11A 4JKKA 1J01A 2FHBA 3GDBA 3TONA 5DEZA 1JYXA 2FHFA 4ML4A 1ZJAA 1WDQA 4MADA 1V02A 2WSPA 4PMOA 2CHNA 3VIJA 3WNOA 5HOSA 4H8UA 5E6ZA 1EDQA 5I0DA 3BVWA 2CCRA 4H8HA 5AC5A 1NWRA 2JF7A 3THDA 2QMJA 3RO8A 3T0AA 2F18A 4PMDA 1UWRA 4W8BA 4FF5A 4CVWA 3K4AA 2YDQA 1GOMA 4YHEA 3OLGA 5HPOA 4E8DA 2CESA 4GIAA 1E6ZA 4BS0A 2J25A 2YDRA 1HKIA 1XHGA 3ZJ7A 4C7DA 1L8NA 4KRUA 4PSRA 1H49A 1W2PA 4PMXA 1LL4A 1UUQA 3WF1A 2G4FA 2WM0A 2XGBA 3DYOA 4QLKA 1J9YA 4AYGA 4D6GA 1XCWA 5JBFA 2VUYA 3BGAA 2EACA 4WKAA 2J4GA 1XC6A 4QLJA 3I3EA 3AXXA 4M82A 2V3DA 3K46A 4NRRA 4Z2JA 1EHNA 1HL8A 1VAHA 3VX1A 3VGDA 2X09A 1QHZA 4LYPA 3A47A 3RMEA 1EA9C 1KWGA 5D9PA 4W87A 2CBIA 3QHMA 2W62A 2GVYA 7A3HA 2NW0A 3K8LA 4D6CA 1KFWA 4GI8A 3MUIA 1UKQA 2DIJA 3VILA 3RILA 2O9PA 1NOWA 1ITCA 2ZUSA 4AMCA 4U5IA 3VGFA 2AOSA 2DQXA 3LPOA 3VIKA 4CD5A 1UG6A 1U2YA 5ABGA 3VINA 3LRKA 1GVIA 4JFWA 1UWIA 1E5JA 1HP4A 2YBUA 2FHCA 3D5HA 4IISA 2YBTA 4UQDA 4AD3A 2Y8VA 3H53A 5HPCA 3QHOA 3WL0A 1VFMA 1HJWA 8CGTA 1CGTA 1CGXA 3VGEA 1HXKA 3W26A 5FL1A 1GVYA 7CGTA 1JZ7A 1JDAA 1QWNA 1OIFA 1OM0A 3IAPA 3LXCA 1KTCA 1KR1A 3AHVA 2YLLA 2PC8A 1Q4NX 3MUZ1 2WVUA 3NSMA 4W5ZA 2XWEA 4UFHA 2YA0A 2BY3A 3ZSTA 5D9MA 3SUTA 3TTYA 3II1A 1E40A 1KXHA 2OSXA 4OGZA 5I79A 1X6LA 3EDKA 1BF2A 1PX3A 3MMUA 1TVNA 1X1NA 3ARYA 3AS3A 3WF3A 2PWDA 2WC3A 4HA3A 3CZSA 1QI2A 4TVCA 1OCQA 4PUDA 1WO2A 1VBUA 4GINA 2G3IA 3W29A 4W8LA 5A6LA 3B8SA 4M80A 5HDRA 2VX4A 4HA4A 3WBAA 1LG1A 1JD7A 4JHZA 4AZ7A 3EJQA 1I1WA 4WKFA 3ZJ8A 5A69A 1R46A 2IXVA 1UH2A 3BAIA 2O9TA 1A3HA 1UWTA 4PMVA 1GOIA 1NH6A 2WWDA 1DTUA 1AVAA 2F8QA 1NOUA 4CD4A 2WYSA 5A6BD 2ZXQA 2PBGA 4L4PA 1KXQA 3WF4A 5C71A 3LPPA 3WFZA 4YPJA 3BLBA 4ATLA 1KQZA 4GO8A 3UETA 2VI0A 3EYPA 2DT1A 3OA5A 3T08A 3OZOA 2DGAA 4UOZA 2JFEX 2ZOXA 3ZJ6A 1E3XA 3BVUA 2BXZA 4P8UA 2WB5A 4UZSA 3CPUA 4AIUA 1UH4A 1XYZA 3PZ9A 1VFOA 1DP0A 2ZUUA 1WPCA 3FAXA 3VIIA 2VZTA 2GDVA 4F79A 3AIEA 1E4LA 2NT0A 2GDUA 4LGXA 4IPLA 3AMCA 1XSJA 5GPRA 1EQCA 5ABHA 3ZR5A 1BLIA 3RCNA 4JHOA 4CD8A 4XB3A 1ZU8A 5ABEA 3HU7A 4JZ5A 3GH4A 1ZBVA 1H5VA 2BV9A 4N0RA 4Q7NA 3PZTA 4TTGA 1JZ6A 5GNZA 1MW1A 3ARTA 1KGWA 1JI1A 4P7NA 1D3CA 1KTBA 1W9XA 4ZXLA 5IXEA 1LL6A 1OT2A 1ZL1A 3ARXA 3WUEA 2XUCA 4U3CA 1J0IA 2D0FA 1JL8A 3M7SA 4WKHA 2JIWA 3CMJA 3WEOA 2YKKA 3FHAA 4NZJA 1BQCA 4TOQA 3CHCA 1DWFM 1PBGA 5A2AA 5IHSA 1HKMA 5BXPA 5I5RA 4GI9A 3A24A 1H0IA 2DPEA 1E0WA 3CZGA 4OZOA 1H1NA 1HXJA 2X2YA 1BYDA 5I24A 3PHAA 2XVKA 4U3AA 4J7RA 3BSHA 3WDHA 2A3AA 3EJSA 5DO8A 1JZ8A 3CZNA 4GXPA 2ZXBA 1W1YA 2ZIDA 1HN1A 1E6SM 3BUIA 1P6WA 2F2HA 1W1TA 3NYDA 2J77A 4A3HA 4UOQA 1B31A 1E4MM 4AZGA 3O6AA 5ABFA 1JAEA 3HG2A 4BQ2A 2ZUVA 1B0IA 3VSVA 3CO4A 1KB3A 1MYRA 3FY1A 3AI0A 3GXDA 5BXRA 3ARWA 3CHEA 4MDPA 1AQHA 2OW7A 3D4YA 2WCGA 3TTQA 1B2YA 1HL9A 3VSUA 1LWHA 5M5DA 3EDJA 2TAAA 2FGZA 4DWSD 2XIIA 2V3FA 3PZIA 3POHA 1HKJA 2F7QA 3WNMA 4QAWA 3B9DA 1PAMA 4UTFA 3VNZA 4F9DA 1JYWA 4KMQA 1ZJBA 2VRQA 1KCLA 4PRWA 3KWXA 1PPIA 4LQ1A 5BRQA 1LG2A 1Z32X 4HOZA 3NDZA 3MU7A 1JDDA 1NARA 3N17A 1DWJM 1NP0A 5LA2A 4K68A 1C92A 2W91A 3KLKA 1E5NA 4TX8A 2D0HA 3W6LA 2WVVB 4AD2A 3WY1A 3GNOA 1CNVA 1IZKA 3JUGA 3UG4A 1JZ4A 1QNOA 4U31A 4WSKA 3VD3A 1CENA 2YA2A 5A1AA 2A3HA 1OGGA 3GM8A 3SCPA 2J7DA 2EPMX 3B9AA 2YL9A 1MQQA 1IV8A 5DT7A 2JEPA 1WB0A 2J7FA 4D6JA 9CGTA 2WCAA 4OBRA 4CKQA 2WSKA 5I77A 4XZBA 3I3BA 1SMAA 4RE3A 1QI5A 1VB9A 2UWFA 3CIVA 3AZRA 1DWGM 3VO0A 5E70A 4YHGA 4ZEPA 5FD0A 3QOMA 4ZENA 1RH9A 5D4YA 5IFTA 3U5YA 3ZT6A 2X2IA 2WC7A 4PEEA 5CGMA 3ALGA 6A3HA 1QI3A 1B9ZA 1GCYA 3ZT5A 3OG2A 4B16A 1GOWA 2OYKA 2XFYA 2J7BA 4GPNA 2VZSA 2ZX9A 1E71M 1M03A 3WNLA 3L2MA 3U5UA 4WIWA 2OYMA 5D8WA 2XSAA 3KL3A 2IGTA 5FIPA 1G9HA 2JE8A 4UQEA 4U2ZA 2WMJA 1MVYA 1PEZA 2QLYA 2J7HA 1GUVA 1V3IA 4PN2A 3T09A 3PZOA 5BCAA 4FMVA 4CN6A 1V0LA 2E8ZA 2VZVA 3RIKA 3NSXA 3NIYA 1NQ6A 4CU7A 3UG3A 1TG7A 1M01A 3VIOA 4HOXA 2QHAA 2NSXA 2WVVA 2WHLA 1Q6GA 4AMXA 3TP4A 4A4AA 2WMFA 1JF6A 3MUAA 2XFFA 4J3WA 3OGVA 4OJYA 4L4OA 2J7EA 1CYGA 2V5DA 4UOJA 1HF6A 3W25A 2BHZA 1K9TA 1LWJA 4HMEA 1VFUA 4QDMA 1NWSA 4MJ4A 2W92A 3SUWA 1V6XA 3CGTA 3NJ3A 1OSEA 1R85A 2ZICA 1VEOA 2WANA 3CZKA 1W9BM 3LMYA 4URIA 2EJ1A 3WQ8A 3VIHA 7TAAA 1HJVA 1J0YA 1E1FA 1H41A 3BVTA 1QW8A 4AD5A 4A3YA 3LRLA 2UY3A 4NXSA 2J75A 2W63A 3N11A 3FAWA 1IT0A 1O6IA 4FLOA 3VMPA 2G3JA 1FFQA 4B3KA 1CGVA 5A6AA 2UY2A 1VJZA 4S3JA 2YFOA 1WAWA 3PZVA 1J0HA 4LPCA 3WQ4A 2F7RA 1UKPA 4E2OA 2F61A 2Z1KA 3ARRA 3GNRA 3MMWA 4AC1X 3MI6A 1JNDA 2DSWA 4CU6A 5I6SA 1E6QM 2MANA 5KZ6A 1E9LA 3VGHA 2CBJA 2C0HA 5CPQA 4MNJA 3WEZA 1K6AA 2WKLA 1M53A 2V5CA 3BC9A 2FDMA 5A2BA 5EFFA 4HU8A 4AZIA 1MWOA 1J0KA 1V3MA 4H8VA 3AISA 5CQ1A 3WIJA 1KQYA 3BUDA 4TVDA 3O9NA 2CKRA 4D6EA 1VEMA 3WQWA 3S2CA 1ECEA 2VL4A 3ZO9A 2WC4A 4CCDA 1E6RA 4H41A 1US3A 1DWIM 4PMRA 2YL6A 3OLEA 5M17A 3ZR6A 3RM4A 3LRMA 1BHGA 1B30A 2X2HA 3U7VA 3VMNA 2VX5A 1UQYA 2YA1A 4PTMA 3IAQA 1UR4A 4J3UA 2D20A 3L4XA 4HPGA 1W9DM 1RP8A 3ARVA 5CG0A 2QV4A 3QR3A 4JCLA
chains in the Genus database with same CATH superfamily
4PJIA 4MS8D 1YTDA 5CPSA 2EE9A 1A3LH 5GS1C 4L23A 3MR9A 4TSAH 5C07E 5KEZA 5DMMA 5ESAA 4A3RA 3SADA 4HULB 5C0JB 4Z7QB 2FEDD 1X7QB 1KIRB 2W79A 1DN2A 1UA3A 3R1GL 3IBEA 2UZYA 4C5ZA 5J12B 4Q3MA 4L3CB 4Y4HA 3K8MA 4GY0A 2X4PB 5KETA 4QQUA 1I1FB 1Q6EA 2KC0A 3S37L 4O02B 4QRRD 2D1ZA 3BGFB 2B4CL 1MRQA 2VDMB 4KKRA 2FR4B 3BUPA 5K3VA 4P3CH 1H3PL 5EOCJ 3N1MC 1ZMYA 3M7FB 1D9KC 1R3HA 4QNEA 5C55A 5CWSB 4FQJL 1RUMH 5FKAA 1E9OA 3GZPA 1OP5H 3B0XA 3MNZB 2BZ7A 3HS0C 3CK0H 3KBPA 1MI5A 2JFCA 1G9MH 4HN8A 1BWKA 3QEUB 4IFKA 2VLKE 3ARGA 5H94B 3VGGA 5L2JA 3PZNA 9XIAA 1QSEA 5LWYH 2AGJH 5GGVY 1LBFA 4OGYH 3QG7H 5DMIH 1RIHH 5JHLH 2HS6A 1UT1A 4PRHA 5CPLA 3GLEA 3LN5B 2EXWD 2V3EA 5HJ3B 2AJZA 7PCYA 5H4ZA 4H0HB 3SGJA 1P0KA 1T03L 2XETA 3KVKA 4UTIA 1DYSA 1QYGH 3MGTB 4NRZB 1EXUB 4W4NA 3WD0A 4PB3A 1X4YA 4IDJH 3UJJL 3C2EA 43C9A 3OGRA 3FUNA 3B7TA 5L8LB 1FX6A 3QLLA 3X2QB 3MRRA 1OVZA 6REQB 4HPYL 5HI5D 3LQZA 3A3HA 3KS0H 4Z7OF 5T1KA 4N87A 4I4WA 1OO2A 2VMEA 3GMQA 2CZ5A 3WQDA 1MCDA 1N0LA 2JKTM 3LH9A 2AXWA 2AQOA 1DSFH 3W57A 2LABA 2AAMA 3LPGA 4JTFA 4NPKA 1DQLH 4BGDA 2UWEA 4NHUB 4UTAA 3L13A 3V52L 4AEIL 4UDUB 2DL2A 2FGBA 3EZ8A 4L4JA 3GHUA 3FFOA 2C1PB 3AY2A 4U0RC 3WD3A 1WKYA 4JEJA 3EGXB 2H0EA 1XDMA 3SSGA 5HUPA 3ZKND 3L08A 1N2VA 4YHML 4XCEA 3DSNB 1JZDC 4X9HA 3IXAA 3T0DA 3LN4B 5JBEA 4XX1G 3TBYB 3WJXA 4KGJA 5TK4A 3HAEA 1O7VA 4X9GA 5TNVA 1PKQB 3OAWA 5DUBA 2WXKA 5E99H 4AL8L 32C2A 3L2NA 1IGTA 3Q9QA 4HWBH 1P69B 4Y4FD 5BXFB 1F86A 3F4VA 2W3ZA 5IF0A 2HXUA 3FUHA 3JQOB 1TUFA 2HN7A 1H7XA 2XX0A 3BSGA 3WBDA 1PDYA 4M8UA 1JIBA 4ICNA 4KZEH 3W9EA 2W67A 4HTYA 5IBXA 4G8TA 4WDUA 4ELMB 2D7TL 3U0TA 1GORA 1WBXA 2C5DC 3WNNA 4F57H 3TN0C 4ZTPH 4GKSB 1DQXA 3EA2A 5TAOA 2GW5A 5TE7L 4DUWA 5D05A 3G5VA 3RDKA 12E8H 1HZHH 2RAGA 2BOEX 1QBMH 1J9RA 5AN7A 1T2JA 2Q8BH 4DJFC 2K4WA 1OE2A 1JGUL 4L9LC 3PANA 1G7LB 1E28A 3N29A 3BLFA 1MFNA 1WFNA 2A0LC 4KO5A 3AQXA 4L3FA 1R17A 4MNQE 5FF2A 5AAMA 2WQDA 1CD9B 1JWSA 5F88B 2OWCA 1YYCA 1OIMA 4GQRA 1O7AA 3MOBL 3ZK0A 1KBVA 5DF0A 3L16A 4EN3B 1J1OL 3NIGF 5F0MB 2INEA 2V9QA 2GJRA 3WDQA 4MB4A 4IU3A 3PIQB 1ENUA 2V2TA 3NIGE 1AFVH 2XFXA 2AJSL 2FATH 3UP1A 4HPHA 3S6DA 1M7OA 1ECZA 5E6YA 4W4OC 1G7HB 4M5ZH 2JCCF 5AOKA 4P2AA 4PGCA 4XWGH 2NY1C 2CK2A 5EMMA 5FIEA 5EBMB 4MAUL 3QJFA 4DXKA 1PE1A 1DBAL 1EHLH 5J6SA 5ANMA 3FSZA 3HNSL 3EO1B 1U8LB 1Q94B 2F7PA 2J6EA 3CVHH 2P26A 3DX6B 4MQ7A 4JKMA 1A47A 2Y5QA 4Y9AA 4CQBA 3BEWB 2HUHA 1GY1A 3ZLQC 4Y1AB 4HNNA 1FVCB 3OPUA 4M81A 5DJYA 2HPMA 3OJDA 1B0GA 1SFDA 1KRAC 5E8DL 2AKRB 5ID0B 4JN2B 5TDNB 1S78D 4KXZH 1UCBL 5D1QE 1Z5LA 3ABGA 5I1GH 1KYUA 1WDRA 4WUUB 3LTYA 5CP3A 2FJHA 5FOOA 2F6XA 4MJMA 3KLHC 6CGTA 4ZE5A 4NC1E 4DN3H 3IFPB 4F4RA 1Q6OA 4PFMA 3SDDA 4EI6B 3CBJB 5I02A 6PCYA 1PG7W 3TU6A 3UTPE 1S7RA 4S3DA 4YXHL 4HT3A 4LALA 4NQED 4GPVA 3ITTA 2GTZA 1W1VA 2QUMA 1DVYA 4LHUB 1AACA 1UWYA 1QOKA 1REQA 1SJHA 4O18A 2OMZA 3BAXA 3CHRA 1RSCA 3MX0A 3G5ZA 2Z8SA 3CPLB 1F2QA 3BP6A 1FDZA 5HHMD 4AIOA 2Q01A 3FTZA 2IPKB 3SOTA 3QJAA 5DD6B 2OXNA 3EOOA 2YOCA 2B7PA 1PTZA 4FL4B 4BR1A 3RYSA 3NNTA 3OKDB 2C1HA 2NUTA 3UXIA 5DLCA 1YEHL 3A6OA 5DN1A 1HJQA 3V35A 4JZOA 2O0TA 1EZVY 1YQVL 4KMTL 3PQYE 1AMYA 3V3WA 3F7VA 5CP7B 4MGXA 4ZFZB 1YRRA 4ABWA 5A6JA 2A3BA 5C0AB 4BE5A 2LGNA 1S3TC 4Y1TA 1AR1B 4RGND 1TJ1A 1F1AA 1S7VB 3HMJG 1U95A 2A6IB 3UJIL 1HC1A 2FT8A 1HJUA 2YMTA 3PGDA 5ETUB 4PJ7E 4AD4A 3NSYA 1W0MA 2X53A 2Z4QA 2PDKA 3W76A 5IJVA 1KXVC 3OA3A 1X5JA 4BKNA 2CGYA 2D31A 5SWQA 2DMBA 3B37A 4ETQB 1J79A 4ODVL 3D18A 1HU8A 3MY9A 1G4EA 3OWEA 3LS4H 3KZ8A 1M7DB 5DK0B 3LKRB 3B83A 1TV4A 4IZGA 3EIFA 3VFPB 1LO3L 1C9DA 4ROPA 4XZWA 1SYVB 2OZ0A 3U1PA 3KZSA 4D71A 4QXGL 3GR7A 4IPNB 5GSVA 3G1VA 1YEIL 4DBWA 1Q9KB 3WBXA 4LEQA 3LNMA 1TMCB 3ZE0F 4XVOA 4R5VA 2X16A 4NC0B 2H45A 5LDUA 1LEIA 4OGAD 1ZCOA 5E23A 2QVHA 4MYXA 4NFCA 5CBAA 4JNXA 4KROD 2NUYA 2BNRA 3WS6C 1CICB 5D7JB 4NF7A 3HTLX 2CDGA 1JPTH 3INPA 5DRWB 4AZCB 3B4YA 3L3IB 4PIBA 4JRWA 2OX5B 3ZDYF 2PW2A 4EIZC 4CSZA 3F5WB 2EH8L 1F1GA 2G9HA 4P3DB 2IKHA 3RVUD 2VLJB 4ACZB 1YPZB 3BH9A 3SZ6A 5F21B 1OGSA 3CU1A 4XP9L 4TOYH 3N25A 1XGEA 1KJMB 5D2YA 3BQ5A 3GHEH 1F7BA 2NNCA 4F7CB 1WZLA 3NA9H 4X98B 2F9BT 3L1GA 2CR0A 3LKOA 3P9LA 4WHCA 5I76B 2Q6WB 2BXYA 4XXDA 2KS0A 4AB4A 4JBRA 4YSUA 4PB9L 4BWWA 4I9WD 1ND0A 3RUGB 2J8HA 3TASA 1MUJA 5TQ0H 2CETA 3KWWA 5I1EH 1ROWA 1IC5H 3B3IB 4P5MB 5KZDA 3KOZA 3TO4B 4PZVA 3DO7A 1JRBA 2BZNA 1XBDA 5MP6H 3L4UA 1MFAL 2B1HL 4Y5VC 3W86A 2NR6D 3VQ2C 3LEXB 1EKOA 4LYKA 1EXPA 5J57B 2LQRA 4FFVD 1L9OA 2IF7A 4PJHA 1XC4A 1BQHB 1L5GB 3QT2A 4RMBA 1TZ7A 3WBEA 4L3AA 2IH3A 3TEWA 4BI5A 4AG4L 3EXTA 3CD4A 3AUOA 2LV4A 5JQ9A 1HHGB 4HG4J 4PRPE 1FG2B 4DP7X 1W1IE 3SPGA 2E6FA 1BIIA 4PJ5A 3S42A 1J1XH 3MCLH 3NZQA 2XIJA 1IAIL 3ZGIA 2CBMA 4YGAB 2BERA 4D0CB 1FHDA 3EKCA 3AS1A 4BA8A 3UJ2A 2O9OA 2HKHH 3GGWB 5INDB 2XWTA 2J62A 5F1VA 3KH4A 1I7RA 1SY6A 3B8DA 1M9WA 4RE2A 2QGYA 4PS7A 2QTEA 4LPUA 1N0XL 4XO3A 1F4YH 2ZRZA 3F2LA 3VXUB 5IIEB 1SO5A 2X4SA 4HSOA 2IFGA 4G70B 2HRWA 4HPOH 2Y06L 3TOYA 1B88A 1TYRA 4HGWB 3H4HA 5EZPA 4ONFH 4PUMA 3CFMA 1FYTA 2ACQA 2W65A 3EJPA 3VKKA 2XVGA 4FX8A 5CJOL 5C6TH 3C2VA 5T5NF 1UR2A 2C9VA 4IIDA 1KPVB 2FWOB 1CT8B 1E55A 3WQFA 4WVRA 5SWZB 4LIQE 5JUEL 4Z1YA 4PJIB 2AEOA 4CMMB 5EBWA 2DQFB 1BM3L 3TURA 1ISWA 1M2VB 4PBWD 2J3SA 3GHRA 2BY0A 3SDCA 5I0ZA 3UA3A 4HGKC 4WFED 4J8QA 1TTGA 3KPLA 4PJ9C 5I15L 4YDJB 4XVTL 4Y4HB 2Y7GA 3GFYA 4MADA 2G5RA 3RG1C 4KHTL 3TC9A 4QTIL 2QL1A 2OOGA 4FZ8H 4S1QH 4PS4H 1GVEA 2JF7A 2XKNA 3TEXA 4PJCA 3CFJA 3H2AA 4IL2A 2O7SA 4WY0B 3KWTA 3OLGA 4RR4A 2DD8H 3LCFA 3M8OL 4NUWA 3ETBF 3PWAA 1LGVA 4N0UB 3WF1A 3A4DA 1E9OB 4EDXA 4U6HB 4QLKA 2YPVH 2E5DA 3RLUA 3KTXA 1SJAA 2VUYA 4RDBA 3O6YX 4KV5F 4MKNA 4HQQL 3GR4A 5L2JB 4QLJA 1QSEB 2E6DA 3ESMA 4Z7VB 2TYSA 1EHNA 2CWXA 1OAUH 2WD0A 3UBFA 3TT3H 2OOFA 1Z48A 4PRHB 3WLMA 4ZO7A 5KSBE 5CJQL 4ZPVA 3MC0A 2NW0A 2Z0UA 3QKZA 1SBSH 3U79A 4AX6A 1H7NA 1CYXA 3ECUA 3OJMB 4KU1A 3VGFA 1UG6A 5EV7A 4JFWA 4LAZA 3ROLA 3PWUA 2YBUA 5KINA 4PV1C 4TYUA 4NKOB 1EJFA 4ZG1A 4P8QA 4BZ1A 3W26A 3DURB 2Z8RA 3QORC 2Q09A 4ETYA 1JDAA 2MJWA 3RWIA 4A7GF 2VEGA 2PPDA 4D8PA 1FWIC 3N91A 3DV4B 1G9MC 4M93B 2HYMA 1FO0H 3MUZ1 5L4FA 2AQNA 2BY3A 1N0LB 1VRSA 4M7JH 4LWWA 4P2RD 5JHDE 1FORL 3W73A 1Q13A 3U36B 1BF2A 3U1SL 3ZYZA 2LVEA 3ZTDC 3N55A 3VXTA 5C2BH 3GJEA 3C09C 1YCSA 1MAJA 2X7LB 1SW0A 4JHZA 1NIEA 2YJLA 5I6NA 3V0AC 3W70A 5A69A 4H9VA 4KJPD 4H1LG 1FSKB 5A6BD 3DX8B 1NJ9A 1KBGL 3DPBA 1M1XA 5T5FA 4G9DA 2HBXA 4M7LH 2QGEA 1EJWC 3DG6A 1X9QA 4GRLC 3BVUA 4WGKA 1OSYA 4FQ1L 3IN2A 2I07B 5DUBB 2C13A 1ELSA 2IADA 4ATTA 4IPLA 1XG3A 32C2B 3B04A 2FZDA 1IGTB 2XPGA 4LP8A 1L6GA 5JMOC 4HCRH 4FNLH 5IF0B 4FZEH 4TTGA 1LMKA 4NWTL 1ALDA 4M4PA 1JP5A 1TPXC 5H37H 3IE9A 3PAJA 2GJ6A 3Q6GH 2AQSA 4GXVH 1NUDA 1MRFH 2QT3A 4XNAA 4GSDL 2A9DA 5RUBA 4JRLA 4MVBD 2FB4L 5DK2A 2YKKA 4B92A 4BINA 5F3BA 2W9EH 3PR2A 4E38A 2DPEA 3QUZC 1TNMA 2AZAA 5L4IA 2EEFA 3MBWB 1LD9A 1XXDC 4JO4H 35C8L 3CN0A 2WJDA 1LP6A 3HG1E 3C3UA 1FWNA 2P47B 2REQA 1TZ8A 1MPAH 3PBVA 1TV5A 3VSVA 5LHEA 1FIEA 1JNNL 5D4QA 3FQRB 2CMRH 1ZRQA 2UX6A 2NV2A 5A43C 3USBA 3BW2A 3WNMA 4YL4A 1E2VA 1RURL 3CFEA 5FHAL 3SN0A 3WI9A 4IU3B 2RDTA 3E0VA 3MU7A 1HEJC 3D4GA 3HA0A 1NCUA 1HFUA 3BD4A 3OHXC 3C2AH 3KXFB 4IRJA 3H8NA 1T1WA 2F54A 3UTTE 2WTRB 2YA2A 5BVJB 1XM3A 3QJFB 5FACA 4ZMQA 4XO6A 4ODSL 4YSSA 5ANMB 5C0BA 3CNYA 2ENQA 1HEHC 1TITA 5H8UA 3UYRL 4MA3A 1AZZC 4I9MA 1TZHA 3VH8B 2WYZA 3NEHA 4DI9A 2OKTA 4LVFA 3ATAA 1TU2B 3L17A 5DJYB 4R26H 3FTYA 3WNJA 1B0GB 4E41A 2ZX9A 3FT9A 4QXVA 1RUQH 5DS1A 3U5UA 2DJUA 2NY2D 1HKWA 4HGMA 4PJ8C 2HTLD 1CW2A 2Z29A 4WI4A 1IT8A 1W1ZA 4ICCX 1Z5LB 2HNEA 3AU2A 1FL5A 5ABDE 3VFMA 4KNUA 1XF2A 3M44A 1TG7A 3LOWA 1N59A 2FJHB 1RQ5A 4JPKL 3NJMA 3QR0A 3T77A 3NCEB 4H83A 1GW9A 5C3IA 2BHZA 4L37A 2QSVA 4MJ4A 1QT1A 2BCMA 3S4SA 2EDXA 2G5BB 1X1OA 2FBJH 1T96A 1NUFA 1NFDE 2AHIA 2IALB 3TXZA 2I17A 3K5SA 2GTZB 4E0CA 3D0CA 4ZB5A 4JGUA 2UY2A 4Q4PA 5EC2A 1QASA 2TSAA 1JNJA 1LO5A 4HIIB 4PN6A 4GVGA 1P4IL 5KZ6A 2WTOA 1SXAA 1D7BA 4PJXF 4PUJA 1RZKH 4LCCB 4MZYA 3GI8H 3QUMA 1HEZB 4N2AA 4K3HA 4KRPB 4HV8A 5F0JB 3WU1A 3NZPA 2XSXA 1T8QA 4EX4A 3CXFA 1S8DA 4DELA 4LY8A 4LSVH 2YEZA 1F1DA 3IKCB 2ZKWA 4RKAA 1VRDA 3PBMA 2Z91A 2A9AA 5DS2A 1M9HA 1HOCA 3DCPA 4N9OB 1XF0A 4GQ0A 3T0CA 4Z7WF 1QW7A 5B1KA 1HGWA 3LA4A 3PGDB 1UWGL 3FU3A 2Q3ZA 4MQTB 2X1QA 4D8OA 2H3DA 2JTYA 5IJVB 4H7ZA 2D31B 5SWQB 3ARBD 2PDYA 2DIAA 2IPUK 4MAYC 4LEEA 5LIYX 3S47A 5CLWA 3CFBB 2FVKA 4M8VA 3AREB 1AIFA 2EE6A 3I6LD 3MLSL 1UCTA 1XT5A 4HCHA 2GK1B 1ZOXA 3GRWL 4HD9A 2DBLL 2MOVA 1PXGA 1E1CA 3PWLA 4JHVA 1AIZA 1P0DA 5EU4A 1TG8A 3QIWD 1J96A 3KPRA 1KTDB 3CFCH 4UIMA 2Y89A 2HKAA 5JMRA 4AQOA 1UR3M 2X30A 3CG8A 3RITA 1NCTA 3MNVB 3AWNA 4WCYH 3P30H 3BWAB 3VSTA 4JIRA 2AK4D 5C0JA 5CBAB 1X7QA 4AZ6A 3F01A 2TSBA 3SCMB 1ZGLM 1UIOA 4N9DA 3GMPB 2BVQB 5AB2A 1G7JB 4X7EC 2YXXA 3NXFA 1XLIA 2PFHA 1ZAHA 1RUPH 2PW2B 4N2EA 3EJZD 4P46B 4P9HL 1I1FA 2HX7A 2GVLA 4K3JH 4HYVA 4OD1L 3SQLA 1KM1A 3NFSL 5IW3A 4O02A 2R7EB 3OZ9H 4KK6D 1QLEH 4N9BA 2XHYA 2FR4A 4GX8A 3THML 5CWSA 2W9LA 3FOMA 2HXAA 1SJCA 2DM3A 5FESA 3VG9C 3SPVB 2CE6A 1UVQB 4W9KC 5IFHH 1E27B 4XXDB 2AC0A 1UPMB 4LIQH 3QEUA 2AV7B 5H94A 4DETA 4WFHD 4Q8MA 4DJDC 4EQ3A 3KWWB 4KZDL 3LN5A 2OMTB 1PYMA 5HJ3A 2A7RA 1BFSA 4QOKA 1F11B 3NQ6A 3QDMB 4G2AA 2CBVA 1I9IL 5DZOA 3M0MA 3MGTA 1EXUA 4YWIA 1F9CA 3QK0A 1Z9NA 4X0NA 1JCXA 2I9LB 3FSTA 3QIUB 5D2TA 1GGTA 1AKJB 3NACH 4PULA 1R0AL 2X4NA 1JTOA 3C60C 3INUH 3SGGA 4MDJB 2Q8AH 6REQA 1SO4A 2YCIX 2J56A 4P5TB 3VK5A 3LZFL 2DT2A 4N0YL 4UNTA 2E3VA 1N67A 3B03A 4PJ5B 4ZO6A 4WTZG 4UINL 2ZX7A 1URIA 1ET7A 3LSOA 3WQ5A 5F7KC 3PFMA 4UT6A 1JHTA 1KBWA 4PJBF 1GL4B 4I7VA 4NHUA 2ENPA 3DKLA 1T2XA 25C8H 4UDUA 2BS71 2VC9A 3UCCA 1EEXA 2O1AA 5CH9A 4OSUH 4F0KA 5FDWB 3L48A 2YD3A 1G9EA 1I0BA 1QO2A 5BOZG 3EGXA 1KCVH 5IQNA 3UZXA 1PKMA 3ILPA 3U7AA 3BZGA 4E5XG 5D2NE 3JWNE 3DSNA 4LSBA 3D85A 4XP1H 3L4CA 4B2DD 4YHKL 2Y5SA 3PZQA 3EPNA 3LN4A 2X4SB 1XHHA 4XO7A 3RZCD 2UZIL 2A1YA 5E2JA 4JFPA 1PKQA 3EX3A 3FFSA 2ZYRA 3GBNH 5DT1H 3JTBA 3UQNA 1D5XB 4J3OD 4OM0H 4DNMA 4PRTA 1KDJA 1X5HA 4A8LA 1JTPA 4K1WA 3T8QA 1XIGA 2E56A 1AJ2A 2OO0A 4CQCA 1L6YA 1BGXL 2OZ8A 3IJQA 1F00I 1I1XA 4ZFMA 1IWAA 2PO6B 1WAEA 1W3IA 5EBWB 1LP9E 3GS0A 1V03A 4H4NA 4YXKL 4H26B 4MOZA 1MRCL 1G6RH 4ELMA 3CXOA 1OZUA 1KFLA 1D7FA 2RJMA 4YHLL 4GKSA 4OZGE 4MDRA 1PLBA 3T2NH 4ASTA 3EFOB 3KPLB 3KJ4C 4PS3A 4NNAA 5C1MB 4P2QD 4Z1DA 4NN6C 5DRXB 1P1XA 3BUVA 1G7LA 2HVJA 3V6ZB 3PZGA 1T20B 3RCMA 2H26B 1RP9A 2I7SA 2XKNB 4CGUB 1XICA 1OF2B 3W7QA 3GSVA 4G72B 5FS5A 4J23A 4YHPB 4QWWC 2EVGA 5F88A 5AVYB 3QR1A 3WD4A 3WDIA 3WIIH 1KYOK 4EN3A 1PJ9A 4S1FA 1T0MB 4OOZA 3UJTL 4EE9A 4XVSH 5KVFH 3AOFA 4RGOL 4OQTL 5HHVH 1HL4A 4Z3IA 1JCJA 1B90A 2ZCLL 4K3DH 2GPTA 4YSAA 2NY0D 4H13C 5ID1B 4HCGA 4NM8L 1IIIA 1HKFA 5EBMA 2PP8A 4OLZH 3F58L 1T66C 3EJCA 3MGAA 2H1PH 1Q94A 4V15A 3QRFM 2AQ3A 3ROLB 3PWUB 3DX6A 2GBUA 4E3VA 4F8LA 4NKMB 2WVTA 2RHEA 3BEWA 3IIZA 4Y1AA 3KHOA 2PS2A 3IIVA 1FVCA 3L4VA 4WKXA 2J1YA 1DZ0A 1BZ9A 5BXTA 1TJ2A 3O2DA 1AO7A 3UWUA 2AKRA 4RISH 3IRDA 3KRZA 1K3IA 1PIGA 2WJZA 4JN2A 3AACA 5TDNA 3A6CH 3L1OH 1NGZA 4G5DA 1O5RA 4H7CA 5FYJE 3RTQB 4ZO9A 1QFOA 1I8LA 3NSJA 4AKOA 3ZHNA 1CTMA 3TYCA 1AQFA 4GP4B 1F3EA 1U4EA 4EI6A 2QADC 5HYEA 1CLZL 3GDRA 4R33A 4XWUA 3MI3A 2GOUA 4S38A 5J8OA 5EOCL 4PE8A 2OX4A 1FWCC 2WZIA 5IB1B 2YMOA 3DPBB 3P61A 2NX9A 1WA3A 1FVPA 2WV8A 1KZQA 2QDHA 1E73M 1MRDL 2OCFD 4LHUA 3FRPB 2HWZL 3CPLA 4Q6IB 5E5UB 5BUAA 1GSMA 4TTDC 2IPKA 4E2VA 2YPKA 4G7FA 4ZMLA 5DD6A 2IADB 4PCFA 1EDTA 3DX0A 3LHYA 3D05A 4YDNA 2CHZA 1TF4A 3CASA 3PWPA 2GJLA 5LNVA 4U3HA 3OKDA 2PXYC 4HJ0C 3H42L 4W68A 3WN6A 4EAMA 5I19H 4X2PA 3SIKA 5CP7A 4ZFZA 1NP2A 3KM1A 1FXPA 4IK7A 5B8CA 4M6VA 2D4DA 4I3RH 4F2UA 4LAOA 1HS6A 5D72L 1LD9B 4GUQA 1S7VA 4MX7B 2A6IA 3U0WH 3RBSA 1DBBH 2CNCA 5CZJA 4QS6A 2NSMA 3EOUA 4FQLH 4ABVA 3VIGA 3ECQA 4K7PX 3MKGA 1A6UL 1EGJH 3MUUA 1RJCA 5FPIA 4ETQA 3D4ZA 3VFGH 2FUTA 4PGBA 4PRNA 4FHBD 1EXGA 3G1RA 3Q2NA 3CUHA 2A83A 1RK0B 3GO2A 4UQCA 1VCGA 5DK0A 2QVKA 2OPCA 2XZ9A 4AIXA 2YARA 4NC1C 4ZD3L 4XC1H 2EDHA 3GXMA 3V55A 1SYVA 5GHWL 3CFEB 1EJXC 3CLMA 1Q9KA 1MNZA 2BSTB 3TVMD 3IANA 1T1WB 4RL3A 1SF3A 5EUKB 4JM2F 1S9KC 5HAOA 1GEHA 5BU6A 4ZXOA 1UM4H 1CICA 4KKXA 4C60A 5D7JA 4KEMA 4IL0A 4WW2F 1MG3C 3PP3K 3ATYA 3G3LA 1TZHB 1PZ3A 4R7XA 1KBIA 5DRWA 2J6XA 4XXCA 4AZCA 5J04A 3PSVA 2HAZA 4OZIE 1TPB1 3REQA 3L3IA 2A3EA 3WH6A 4G6KH 1MCOH 4FKEA 2OX5A 3S6CA 5FW6A 4QNPF 4WNJA 3F5WA 4DAIA 3FDWA 4P3DA 4M43H 5FKPB 1ADQL 1PSKL 2VLJA 4ACZA 3RE0A 5A3IC 3WH9A 3AXLB 3RM8A 1CXHA 3OAZK 2HT2C 1FWEC 2OG9A 4BWLC 3LPFA 3PJSA 4GAAA 1XZWA 2UY5A 1ZAGA 1TCRA 3W01A 1KJMA 4F92B 5JBDA 4KWSA 4QRPD 4F7CA 3VFUB 2K3HA 1FL5B 3FJ4A 3MACL 4ZFOB 3VFMB 5BOPA 4X98A 4K39A 4IU2B 5I76A 2XZCL 1YNLH 2R15A 4JG0L 2JGYA 2KI6A 2VXUL 3T77B 4UZGA 1KN2H 3L3DA 3W2NA 1EO7A 4QITA 3S4SB 5B7YA 4K5LA 2YJQA 1T7VA 1W54A 3H2EA 5CD5D 2V9UA 2P48B 1O6VA 1E70M 4UBDD 3B3IA 4P5MA 5ESQB 3M1BB 3TO4A 5HJXA 3O3DB 3LMJH 3ISIX 3RDJA 5AW7B 5GZNA 3NJKA 2RGMA 2P49B 2Y07L 3C9NB 3UTQB 3LEXA 2W60B 2BSRB 2XH0A 3P0WA 3IS0X 1AH3A 2VO5A 4ZO8A 4X4YA 1CTNA 3AIBA 3I9IA 4FG6C 1YN7A 1BQHA 3TEVA 3MFGB 2QHRL 1C8YA 4EO5A 3LHUA 1HHGA 3WEMA 3W7OA 2FX9L 2MPAH 2V2DA 1SJXA 1AOHA 3LB6C 1YEJH 2NLIA 3QCUL 5D7IB 3DXIA 5GGTH 4BQ5A 3VNLA 4HJIA 1Q5MA 4NQEE 1TIUA 3QAQA 1S8DB 3QBTB 4MA8L 5AW5B 4D0CA 3VZXA 4P2YA 3P93A 5FYLL 5INDA 3W7RA 5GGSB 2YEZB 1KWKA 4G1MB 5HNUA 1HJSA 4QCFA 1UWAA 3KPNA 1GCFA 4LF1A 4Z6AT 5HHME 3UDWC 1HOCB 4CEXC 4XAKE 4X3ZA 5LBSL 3QWOB 3ZUNC 5CGQA 1A2YA 3TSBA 3MLVH 2XV6B 4O13A 4JRYB 2AQQA 3OG4B 3TCSA 1RUKH 1SFSA 5EFDA 1ZCRA 2H9GB 3VXUA 2ZKHH 2IPJA 4JNMA 5IIEA 1RZKC 3G6AA 1H11A 1YXCA 1XR8A 4X6CF 4ANKA 3NZHH 3BPNB 4HGWA 2JV6A 4EAYA 2VM9A 3VIJA 3I2CH 3PGFH 5ALCL 2RKXA 3ZKXC 4FGMA 1FLRL 3SRKA 3CFUA 4W8BA 5HYJA 5B39G 1BECA 1MCNA 1J8SA 4ZW6A 1E1CB 4EF3A 3PWLB 3LS5L 3WZ0E 1KPVA 5FF3A 5SWZA 3M0XA 3KPRB 1F58H 3D0LB 4HISA 1CFVH 4CMMA 3BJSA 2P24B 3JZEA 2DQFA 1M2VA 4V1DD 2AQRA 3MJ6A 5AZ0A 1PZAA 2BVUA 1EX0A 4NERA 2FVLA 1T80A 3UO1L 3VX1A 3DC8A 1UM6H 4C6DA 4EPDC 3H23A 3U2IA 5D9PA 3JWNH 1IF2A 3KD4A 1A5BA 2GVYA 3SDXB 4B53A 4YDJA 5F7AA 5FJJA 4GP8B 3O6LL 1M6UA 2I24N 4IOFC 4CD5A 4EOWH 4IISA 2BW4A 3O7UA 4UQDA 4WEMB 4WY0A 4I2XA 5C6MA 4MYPA 4FFZA 4OF8A 2A2IA 4JX0A 1SUXA 2J4WH 2RCSL 2ISWA 5EBLA 4N0UA 3OYZA 3FOMB 1I9JL 1FAKT 2PC8A 4U6HA 5GSRA 1KEMH 4JO2L 2YA0A 3HI5L 3II1A 1MNNA 4JO1H 4K23L 2TODA 4HPXA 2QDGA 4YYFA 5J6GB 3EDKA 4KH9A 4Z7VA 4IMDA 2B16A 5TQ2L 1ETJA 5JZ7D 4G7EB 1GZQA 1C5BL 4OCXL 2Y3AA 1I53A 4QOKB 2VX4A 1BBDL 2B1AH 4B95C 3HI6L 3R8BB 2O9TA 3FULA 4IRSB 2IWFA 2PBGA 4F8QA 4NKOA 3WEXB 1RJQA 3M45A 3DURA 2P5NA 2ZOXA 2X4NB 5F70A 3X3FL 1I2NA 1UM5L 1J8HB 1DBKH 5I66B 1YA5A 4P23A 4I9WE 3QXUA 3DV4A 1OP3H 3LPWA 4WV1B 2XICA 2YK1L 4QM1A 4RBPH 4Z7OE 2WQAA 1BZEA 3LSOB 3U36A 2ZWKA 5F6IC 4XN5A 5LJYH 1ZTVA 1JHTB 4WTQA 4LC6A 5T1MB 1F3JB 3OQRA 5E8NB 2Y63A 3ARTA 2X7LA 4S2CA 3RGHA 1O12A 5JHBA 4H9YA 2A38A 3SDAC 1E7VA 1JL8A 1L7TL 4B5ZA 3FHAA 2H8PB 3PJXA 1IIGA 4KRZA 1UWXK 1HKMA 5BXPA 3ILPB 3DX8A 3KCPB 4GIRA 2GJJA 1I8UA 3PABB 2DQTL 4AVOA 4OZOA 5EMKA 3D85B 4GJIA 4AEHH 3PHAA 2XVKA 2OXGB 3EJSA 2YD1A 4POZC 1I2RA 4MLSA 5F2IA 2I07A 4JFPB 4U1SB 2F2HA 4XCFH 2BWGA 1ED3A 1DSWA 2XBDA 4AZGA 3O6AA 1OAKL 5ABFA 2C9XA 3CO4A 1KB3A 2Q8ZA 4PBDA 1XQKA 1HL9A 1V7NL 4FX7A 5FYJH 2EZ0C 2AJUL 4AK2A 4QXUL 4R8WL 1UZHA 1HHIA 2DQEH 1SZEA 1U5JA 4ZAKC 3TU9A 1KCLA 1CI5A 1K5WA 1ACYL 3EOBA 3MV8B 2XTJB 1XP3A 1VKFA 3MBWA 2L7JA 3NGBB 1JZ4A 2OQLA 1B4JL 2FDSA 1TZAA 1KEGH 2PRMA 3R0UA 3PUDA 2HVJB 3QW3A 4L8BB 2XACC 4GKZB 1IE4A 4ES8A 2UXTA 1S4IA 5KOMC 1TDQA 2GDQA 5F0PB 4OLVL 3FQRA 3GSVB 4U1HB 1KY6A 1IE5A 4F5CE 3SOBH 3MBDA 3NSFA 1GCYA 3BG3A 3ZT5A 4A2RA 5AYQA 4JM2D 3KTSA 2YBVA 1ILUA 3IJLA 1KYFA 4G7QB 1NMAH 2ICWI 4TULL 5D8WA 3RGVB 4UQEA 2WMJA 2ZKXA 1GUVA 5AFAA 1OARH 3MODH 1JE6A 3RU6A 3KXFA 4OLYL 5C08E 2PDQA 2WTRA 4X2UA 3CX5K 1U3HB 3UMNA 5BVJA 4IKNA 4L4OA 1G7VA 2QBWA 3BPLB 2JCCE 4HMEA 4Q8UA 4JTJA 1R85A 1BYOA 4JY4B 3RDTD 4Y8DC 3VH8A 3QZWG 1A7RL 5CIPH 4QHPA 1XRFA 3MBEB 1BZ9B 1TU2A 5C0IA 4FI8A 5BPPA 5A6AA 4NFDA 1U8IB 4LLYB 3B8TA 3FU0A 1AO7B 3WQ4A 4F37K 5JXED 4E2OA 2F61A 5DJXB 3PB2A 3FQ2A 1NGZB 5IW1B 3W72A 5PCYA 3BGGA 1TWIA 4ZFCA 1SVZA 1OY0A 1V3MA 1GGOA 4D6EA 1ZZMA 1IGMH 1JUBA 2K1MA 4Q8VA 1YAIA 4GFXA 2G5BA 4BF5A 3NH7L 4E0RB 4XTRC 4DF9A 1LDPH 3E2QA 5CSSA 4C56E 1RP8A 1OVDA 1N18A 4FQCL 2IALA 2B7QA 5K9DA 1TENA 5IQ7H 1KTJA 3KCWA 3MLWL 4P2RE 3VC6A 4PREA 4LAKA 2X40A 5JW3H 3KHDA 1BJ1J 4HIIA 2EDBA 2VITB 2YPKB 1SHMA 4D3CL 4AHPA 1OP9A 1Q1JH 5AVHA 3V5OA 4NAJA 8A3HA 2QPFA 1KB5L 4Z5RB 1QU4A 4R9OA 4LCCA 1UEMA 3XINA 3PWPB 1HEZA 3QZNA 4LRNH 3VD7A 1SQ7A 2QZQA 1I6NA 4B60A 1VR6A 1VA9A 4XCNB 3N85L 3M0YA 3BO8B 1NBQA 2PUZA 4BZ2H 2NY4C 3PZUA 3HPZA 3WKYA 4NQSB 3IKCA 5B8CB 2BO0A 3W82A 4JM4L 4B5TA 4YS1A 3KBJA 4NIRA 4DQAA 4AIZB 2KZKA 2VABA 1NKGA 3CXHK 1DXEA 4JKPL 1PVNA 3GTNA 2WBJD 4DOHB 2NYYD 4DAFA 2K6WA 4G6JL 4J1UB 3QZLA 1P5UA 4ZS7H 4XAGA 3HGOA 3VI2A 4CSPA 2NCEA 5JUVA 4R7OA 5E1QA 3PBWA 4PGBB 3CFBA 4PRNB 2N7SA 5LGHH 2A83B 4LASL 3BKCL 1W15A 3AREA 4M1CC 2X0YA 3GZAA 4XPHL 1B3VA 1L6ZA 3CO8A 2GK1A 5K33A 4JREB 1SW7A 1FIGH 1LMIA 2DW5A 1JCNA 4Q4MA 5PAZA 1KTDA 1HJXA 2GFTA 5DBTA 1ETA1 2BCKB 3MNVA 3F3HA 1QTWA 3KOXA 4D8ZA 1L4IA 3BWAA 5A94A 3ZE0E 4HK7A 2FO4A 3UFIA 3LZNA 4O4WA 2IO5A 2VMDA 4ELDA 1TA3B 3SCMA 1A0QL 3HB3C 5CGBA 1KGJA 3SJVD 3GMPA 2BVQA 4FQ2L 1G7JA 3I9AA 3REQB 2FL5A 2QPXA 2WLZA 1AMXA 2F5AH 4HUVA 3R13A 3ELFA 1MFUA 2G3NA 4P46A 2VLRD 3MNDA 1DEEA 1NFAA 3CC1A 4O8AA 3N42F 5GS1B 3AJ7A 3DX1A 2R7EA 2QPDB 3ZDYE 5LIWX 3PJSB 5DLML 1TCRB 5AOIA 2BLEA 2CYGA 1MLBB 3MANA 3DMMC 3CFQA 3LRGA 3X3GL 3QV9A 1F73A 3SPVA 4FTVE 1XF1A 1VZGA 3VIMA 1UVQA 3CC5A 1E27A 4KO7A 4JFOA 2YWYA 4W6XB 3S5NA 2WY3B 2AV7A 5LGZA 4UT9H 3AZSA 1NIDA 4W7VA 3H9SD 3L3DB 5J0BA 3DFYA 5LQBL 3FA5A 3ZIYA 5D1ZC 1HZYA 2EDWA 2OMTA 4M3JA 3UZEC 1YEEH 1EXHA 1F11A 3QDMA 1JCMP 3EYFA 1L8PA 1RCQA 1D9KB 4HH8A 3LRHA 1FDYA 5HI4C 5ISZE 3HS0B 4M4RB 3RPMA 2I9LA 2ZZ6A 3QIUA 5F9DC 3D3VB 2CHOA 4Z7NB 3P0YH 3H85A 1DTNA 4I13B 4DGIL 4X4YB 1AKJA 2VJ8A 4DSYA 1NKOA 4JFTA 1X5ZA 1YN7B 5AW2B 4D9LL 1J18A 4NJGA 1OWQA 4MDJA 2AVGA 1C08B 2C3XA 4P5TA 2AQPA 4HMNA 4EOUA 2NVCA 4XP5L 4W86A 2PODA 3OB0H 4IOIB 1WD9A 1SNRA 3WMSA 1GZJA 2PDBA 3H4WA 4F2MB 4NJ9H 3BV7A 1G4MA 4WWKD 4DQWA 4EXQA 3LXBA 4X5LA 3UAJA 4HAGA 3NO5A 4APQA 3KPNB 3TYFB 3HA1A 5FDWA 2XXGA 4WY7H 4IK6A 1D2KA 4PD4J 1A2YB 5IWLA 4GG6F 4LVDA 4AKQA 2NWRA 5BV7B 2KZBA 3CWNA 3NM3A 1KFAH 3G6AB 3ZDXB 4B9CA 2NV9A 3G1DA 1XR8B 1AYOA 3GDCA 1HTYA 4F2TA 1PHQA 2YLHA 2CU0A 5EU7C 4U0RB 3WLIA 1D5XA 2QCLA 3BH8A 2QZ5A 1BD2B 1QZNA 4NSKB 3SUVA 1Z6KA 5J13B 4R3SB 5HYJB 4WO4C 4O54A 3N18A 1VD6A 3BAJA 3VDCA 2WNGA 2NVDA 4PLKC 4CNTA 2HT4C 3US0A 2PO6A 1BP3B 3B97A 4YHYC 4H26A 4J4PD 2JMRA 3VW3L 1NTHA 1FVEA 3PF2A 2H9AB 5E9NA 3BYTA 4GUFA 3I6LE 3S8WA 3CZLA 5I7GA 1E90A 2CHRA 3EFOA 1QNQA 4AGPA 4DERA 4G8AC 3PUGA 5DRXA 2AI0L 4DW2H 1NAKH 2VR4A 3V6ZA 4XNYH 1WCBA 1T20A 3M9YA 2H26A 3FONA 1UC4A 4Y2OB 4Y9EA 1WCQA 1OF2A 4XMWA 2E9WA 4YHPA 1BEUA 4I2XB 1P0SE 4JHUA 9RUBA 3TN0B 2AK4E 2GWGA 4HSHA 3OBAA 1EO5A 2FZ8A 4ANVA 1MJ8H 5EBLB 2V5TA 4QLLA 4RSVA 1T0MA 4LNYA 4MY9A 1FRGL 5GSRB 1OSPH 2AEQH 4L9LB 1S5IH 4UQ9A 1UP2A 4HWBA 3EJYC 4R7JA 5ID1A 5D2NC 3JWNC 3RR1A 5C9KA 4KV5E 2VERA 1GZQB 3AQYA 4TUKL 1O9ZA 3BVVA 1IT9L 4XZHA 1GS7A 3TZVD 2J7CA 4FJYA 4LOUC 3L9BA 2PR4H 2FWSA 2F38A 4PVMA 1NICA 3GTVA 4JJ5B 4NKMA 3CHPA 4JHWL 3D48R 1N8ZB 3CDZB 3PTQA 5HVGB 4Z95H 2R0KL 1NSJA 4LSSH 1UEYA 4P23B 4QTFA 3CUJA 2HLFC 1A5CA 3VIPA 1QBLH 3QDJD 5AYTA 3L8QA 4N2HA 2IVFC 2DVTA 2QQKL 2V69A 3ESPA 3RTQA 2BASA 4E3TA 4NYYA 5IHRA 1GPOH 3W11C 1J5SA 4AY1A 1E5UI 4KTDL 2J8TA 1HXMA 4L5FE 6TAAA 4JM0A 2FTYA 3UWVA 4IM4A 1YEGL 2CA4A 2R69L 3N41F 5EDXA 2A4EA 2EYTB 2YAOA 3G04B 1UIPA 2QCDB 4L9ZA 1WXZA 5IQ9A 3P9MA 1G4PA 5IB1A 1W3JA 4XB7A 4K94C 4Q6YA 2ZDRA 1FWRA 1UJQA 3FRPA 1WX0A 5D93B 2P0IA 5ECJE 5FV1L 3JW7A 4Q6IA 2FEDC 2A79A 2PABA 3P7YA 1ED3B 2VUKA 3GPEA 4AJWA 2OA9A 4ZS6C 5ABFB 5IBUB 1YDVA 1FNSH 1CI3M 4BEQA 4MWAD 4JFEB 4DLFA 2CGRL 5B3NA 3QIBD 1NCBL 3CUFA 3QCVL 3AYVA 1H3GA 5KTLA 3VCRA 1HT6A 4ZE4A 1N8WA 1Y5WA 1N7MH 3SKNA 5GS3A 1CLXA 1HHIB 4FI6A 3TH6A 4Y9PA 1FHUA 6XIAA 3SPHA 3KLQA 2PPAA 1TO4A 4J3OF 3EOBB 4M6UA 2GVEA 3VKDA 1XCXA 3H2OA 5D38A 3CVIL 4OKVA 2IXUA 2ZYFA 4IXHA 2X1SA 4MX7A 1F8MA 2DIKA 3B9EA 5MEND 3CVDA 3L23A 2XT1B 4BCZA 4QIRA 1RCXB 3MLPA 2UX7A 2LFGA 1RZJL 1WFTA 2Z64C 3RPIA 3QJSB 1RK0A 2NXHA 3ARUA 1CBJA 4KNSA 1OX6A 1P0NA 2FT6A 2QXWA 5IZ7A 5FEWA 4MXQC 2AJYH 3TV3H 3C6LC 2PPEA 1WIOA 5DQDL 3BDKA 1DQWA 5E7FA 4YBHA 2BSTA 2BK8A 4WX2A 2Z34A 5HI5C 1FNHA 4C7GA 5LAPA 2ICWJ 5ADOH 5EUKA 4FNPA 3ONCA 1GKPA 4NNPH 5I1LB 2VEMA 5CXPA 3MBFA 1YSOA 4BK8A 4IFRA 1Y0LB 4P06A 2Z6FA 3GU2A 2VD8A 4LBEB 1MCWW 1OFAA 4AH2B 1DL3A 5C0IB 2HVNA 2L7EA 3TT1L 3OKEB 3NVTA 5FKPA 5KITA 3AXLA 1CXLA 4PJFB 4XN1A 3ZKNC 4APXA 3SKJH 1N8FA 1KTRL 3AMGA 2F15A 4JFUA 2ACUA 1T5XA 1JRHH 1PL3A 1QHPA 1YHPA 3VFUA 4ZFOA 1W1PA 1A80A 4WEBL 2OMBA 4UZUA 1SM3L 4IU2A 4LVHB 2XINA 4DY1A 5GRYA 1XXXA 1UP3A 4LCWD 3V1HA 4UU9B 2N1KA 4Y4FC 4JFZH 5GGVL 4I88A 1UJ3C 1MLCA 1CDHA 4I7ZC 5ESQA 1ETZB 3M1BA 3O3DA 4WK4B 2X28A 4KKBC 5AVXB 3RAJL 1OCOB 3FB7A 3W9DB 5AD0B 3C9NA 4NZRL 3UTQA 3MLYH 1US2A 4PREB 2XG4A 3LGDA 4TVSa 2W60A 2BSRA 3NPXA 5MHSE 4MB1A 3F00A 2JELH 2PWGA 1NAML 1UPPA 4XPBH 3MB9A 3ARDD 3BARA 4ZQMA 1IC1A 4HJSA 1E5ZA 1RHHB 1V02A 4PJXE 5D7IA 1CVSC 3DOSA 4H8HA 1NWRA 1ZGLP 3HFYA 4PMDA 4Y5VB 2CJTA 3V0JA 1GKOA 2P42B 1U1UA 1QR4A 3ZJ7A 2MCAA 5GGSA 3V4VH 4G1MA 2YAPA 1H49A 1XGRB 2ZP0T 4PMXA 1LL4A 2KAUC 4LARL 1SXBA 2F6AA 4FHKA 4HD5A 5C2XA 2VABB 3UR2A 2C34A 4DI8A 4HXBL 3HGJA 2ZJSH 4J2MA 3DUUA 3QWOA 3PS6A 5C09A 2AVFA 3I3EA 3TWYA 4JRYA 1P9MC 1S3KL 1MHHB 2GGEA 1T7ZA 1P5UB 4PWHA 2R1MA 3DHJA 2H9GA 1GTFA 4Z7WE 1H8NA 1WV2A 3TN5A 4ONGH 3CV2A 1PY9A 1Z9MA 1O5PA 2ZUSA 3GRIA 5MEPA 1AXTL 2DUXA 3QNFA 3VFCA 1E5JA 1HP4A 1ITUA 2YBTA 3H53A 2V17H 3B9OA 3K30A 1WITA 5FL1A 1DJQA 4RZKA 3NTCL 1YW1A 3BX7C 1JF1B 3SDYL 1OHLA 4U1NA 2VUNA 3D0LA 2XA8H 4H8NA 5KYXB 2VFDA 3KX6A 1GGIL 2XWEA 2P24A 3SUTA 5LNDA 3BHBB 2ZG2A 4FXTA 3NPZB 1RZPA 4JK0D 2FO4B 2EDNA 1L7IL 3O45B 3AS3A 5IESL 4LEXH 1FAIL 5HK4A 4BFFA 2Z3FA 2R94A 3EGJA 3SDXA 5E9DB 4JGNA 1CGSH 2FL5B 4PPTA 4ZMOA 2ZCGA 4HUVB 5GJTL 5F7HA 3EXJA 1DEEB 3W56A 3FQ1A 2X3BA 4YPJA 4OM1H 1Q63A 3KG5A 2WW8A 2JFEX 2YGPA 1LM8V 1TSRA 1XTMA 1JGLL 4PJ9B 3IRSA 1MZYA 3FKRA 2NT0A 3CC5B 4X50A 4JFOB 5ABHA 3BAEH 2WZTA 4XZMX 3CNKA 5J6GA 3TZFA 4IBWA 1YYMH 4PL2A 2OEMA 2ZBTA 5BWAA 2A9MH 3NBNA 5HY9B 4HJJL 2O5ZH 1URLA 1MW1A 4G7EA 1KGWA 4ZXLA 2ORBL 4JYEA 3EYFB 2X6MA 1J0IA 2Y7FA 4F37F 3M6YA 1BQCA 3QEGL 3SE4A 1Z9SB 4QRPE 4IRSA 3ZUCA 5I5RA 4F7KA 4P2OC 4XD6A 4HUKB 3OM3B 4NZ8A 2DKMA 2ICEA 4JRXA 3WEXA 1EERB 5EIIG 5G5DA 3LU2A 1Q7ZA 1X3DA 2VDKL 1P7KB 4YR6B 2A3AA 3IPWA 1AW1A 3A64A 1J8HA 5I66A 3ZE2B 4JXCA 1ZNNA 4A3HA 4WV1A 1K6QH 1T6WA 3PPCA 2AMUA 4BQ2A 4PRIB 2DZUA 4Q7DA 2P3ZA 4WK0B 2FFCA 3WLHA 1V77A 5AC7A 5GZOC 4TQEL 3KDOA 1AQHA 2VSCA 3ULUL 4I0PC 5T1MA 1F3JA 1BQLH 5M5DA 3EDJA 5EF2A 3A13A 4JR9H 3PJTA 1F8TL 4X7SH 5E8NA 3K6IA 2GLKA 2E6QA 4APQB 4PJBE 4GAYB 2ZRUA 4Y16A 5AW3B 1UJTA 4AQ8A 4O1AA 3TQ0A 1EJ8A 2H8PA 1BD0A 1X5KA 4OCWL 3KCPA 3TJEH 3LEVL 3Q65A 3PABA 4ORGB 5EKYA 4QNWA 2OXGA 3HV9A 2Y72A 4OGAC 3MDJA 1WB0A 1Q3NA 2OJEB 1ZV2A 4U1SA 3C09B 3LQLA 4IH3A 1VYPX 5SX4I 2ONEA 3F2DA 3BH8B 5HDQH 4X5PA 2J1KA 2GBTA 5JIIA 2HMCA 3P2DA 3T0XA 3ZT6A 3GFUA 1Q45A 1N6QH 2OLAA 1PY0A 4IIQC 4NENB 2BZDA 4KTGA 3TUUA 1M03A 1R19A 3PHSA 2JI3A 4XOCA 3RVUC 3VNKA 4L5FH 4HETA 4XBGB 5EY5A 1FO0A 5I1HH 4QLRA 4MJIA 5ALBH 3DBSA 4UI2A 1W6LA 4CN6A 1AXIB 1FVEB 3RIKA 3S9ZA 3MV8A 2XWJA 1XIJA 3CPGA 2NLYA 2Z1VA 2DQCL 5C0EB 3P2TA 4JQXC 3DFOA 1JF6A 3NTYA 4KBXA 1NBCA 2WXRA 3OQ3B 1BX2B 4NRXA 1UWEH 4WWOA 4TQIA 1HCZA 1TPXB 1HF6A 1JVKA 4L8BA 2OI9B 1WCBB 3MTXA 4GKZA 3FONB 3LRLA 3KPOA 5DJZA 1A50A 3W7DA 5D30A 3E0WA 4U1HA 4BDVB 3MLZH 3QUZB 4FLOA 5HGDB 1E9YB 1IFHH 3O6FD 1XX1A 1GR7A 4V1DE 2A77L 1VJZA 1JCVA 4XNUL 4FEZA 2NR6C 3NZGA 3GNRA 3RGVA 4YXLL 5T3ZL 2K70A 1DVTA 3DO3A 1WUFA 3N3TA 4FQXC 1P6FA 3T0VA 2QGDA 3GLAA 4ANWA 2F74B 3ABMB 1W5OA 4HCRA 1BKSA 3VOGA 1DUYB 1T6BX 2B1OA 3V4BA 2O93L 1U3HA 4DEUA 5I8KH 5D7SL 3OZMA 3WL9A 1DORA 1KLUB 3VXNB 3FQWA 2VDNH 4QRRE 3GAKA 4H41A 4I9XA 1SGKA 2MCG1 1PLGH 4JY4A 4JDTH 3QXVA 3WE6B 2CD0A 1E51A 3MBEA 3QR3A 1FH8A 4RNJA 3OHXB 4H8WL 4TLUA 2IFFH 2GC7C 2WSDA 1U8IA 5CJNA 3NZRA 4LLYA 2F84A 2HISA 5DJXA 1A0CA 2DSUA 4X0VA 1D6VL 4QISA 4UTBL 1M4KA 2EIKB 3FK3A 5IW1A 1MFVA 1S3RA 3ZYOA 3VZYA 2QZRA 3AY4A 2G60L 1E67A 4ZUSA 2EXTA 1U1JA 1HXMB 3UNTA 3K2KA 1R38A 1CZ8L 1XKJA 2WK2A 4DKEH 1O0VA 5TTRA 3KR3H 3H3PH 4HUNB 1JG9A 4QSFA 4OZFH 4LCRA 5DUJA 1K7EA 4AEOA 2Y6SC 3O2WL 3CL7A 2YQBA 4E0RA 2ZTJA 4PJ8B 4KKPA 5IQ9B 4I5XA 2YXOA 2GHZA 3P9MB 4V33A 4HJTA 1XB3A 4QTGA 2J57A 5F2GA 1X5IA 1ODAA 5F8QC 2AEWA 3S5OA 4XNXH 3ZJKA 1WQ5A 5FF0A 1V5XA 4AJ0A 2BHUA 1FZJB 2VITA 3L66A 2HJLB 2B9AA 2Z2AA 3CVHB 4PY7A 4PUBH 3IVUA 2WLLB 1V8EA 3DX9B 4Z5RA 2YMXL 1XS2A 3T1FB 4PJGB 2DU2A 2XTSA 4B3LA 7REQA 5IBTH 2HRPL 3QNZB 1ZLWK 1TFVA 3GY1A 3BSZL 3HW7A 2QGCA 3SKNB 2YRBA 3BG5A 4O9HH 4XCNA 1Q38A 2HTKC 4O1CA 3BO8A 3HR5A 4N2CA 1GTEA 4NQSA 4OZHB 4GZEA 5L8KB 4DCQB 5EHFA 5G1MA 4MB5A 4XN9A 5LCVH 2I27N 4OKVB 1ITXA 1CB7B 4AIZA 2YB4A 2QKIC 3ANVA 4OLUH 4FDWA 2P8LA 5GXBB 3WBWA 4IUGA 4MNGE 1I2OA 3SCSA 2QQ6A 3BKJH 4P7LA 3VSQA 2Z24A 3UIZA 3MP5A 4J1UA 2E7LA 1AQDA 4DB7A 3VNYA 3N44F 4KXCA 2VRJA 3EOEA 3N73A 3IJ7A 1E1EA 3MJ9L 1JYVA 3IUHA 3W23A 1K8YA 2R4SL 3HAEG 5D1QC 3RPIB 4EWND 3CFNA 3BRFA 1RY8A 3WFCH 5TE6H 4MAVA 4YDKL 2WWOA 2C3GA 4GZJA 3WKQA 3B5TA 5FJOA 4JTHA 4UBPC 5GNXA 1B2WL 1R3IH 1TWDA 2YD8A 2FGLA 4UMBA 1A0DA 3FB6B 4XSLA 2BCKA 4NZTH 1XAUA 1XF5B 3GR8A 3R8QA 2WMGA 3OIXA 3U46B 1RI8A 1AGEA 4JJOA 1WOAA 1TA3A 4X7FC 1WHPA 2XVNA 1ONXA 1F3DJ 2QJNA 3FN0L 1OAXH 5I17B 4JTKA 3HBQA 5A8QA 4FFYH 2BRQA 3GSNL 3LHAA 2HFFA 5GS1A 3QB7C 2VXQA 2EDEA 4APXB 2DSVA 1XX9C 4QNPE 1T5XB 4PTXA 2ASHA 3GHBH 1MLBA 4AOFA 2Z92B 3JXAA 4GSXA 2C19A 5KUKA 2IW0A 4HVBA 2WQPA 3PHQB 3AG2B 2CQVA 5DD5L 2K6ZA 4FERA 15C8L 4OJAA 5GRJL 1YEKL 4MY1A 2I60L 3O6MH 1XGTB 3U4AA 4N2MA 1F4XL 5DUMH 5FW7A 3HJZA 1X5GA 5HVHB 1MLCB 2A6DB 5DZAA 4ZQKA 1DIDA 3H7VA 2NDFA 1D9KA 4PCTA 2YPLD 4XMLH 3FB7B 3VU2A 1BG4A 3HS0A 4M4RA 3VG9B 2G4GA 3D3VA 2XG4B 2QSCH 1E8YA 4AGNA 2P1YA 2AQTA 1ZIAA 2X2JA 3AGVA 1C08A 2J5LC 3N2CA 3EOYG 5GJNA 5FUZH 1BA9A 3HQNA 4JTGA 4PMYA 4OE7A 4IOIA 1PUDA 2XQBH 3DOSB 4F2MA 3NWRA 5F1IB 3BI9X 4RPQA 1UWQA 3WBYA 4ZX5A 2EG6A 1WYIA 1E4HA 1PY4A 1R3VA 2ZAGA 5E03A 4WJ8A 1IXNA 4XP6L 1HAWA 1MW2A 4KRLB 3CB8A 1ZB5A 2V38A 5D9NA 3TYFA 1U8MB 2R27A 2MTAA 4EIGB 2OR9L 4K8RH 3VD0A 2DAVA 1JNLH 1YY8B 4OECA 3DUUB 4B91A 5C09B 2IPTL 1DQMH 4M1DH 3KS5A 2Q8LA 3MDUA 1PIIA 2JLLA 1HQ4B 4B3EA 2P9RA 1B54A 1OM9A 4PI2A 5JQHC 5KZEA 2NXYB 4HVXA 1FUNA 4DM2A 5IMMA 3IVSA 5MEPB 1I0DA 2VXSH 3KPPB 3OZYA 1BD2A 4NSKA 2B8OT 4X6CE 3GBEA 3RJDA 4R3SA 1UD4A 4W85A 3QZBA 5A2CA 4P4KD 4RGNE 2DLEA 4TRPL 4AUYA 1M41A 4E2BA 5JIMA