1XV8A

Crystal structure of human salivary alpha-amylase dimer
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase
publication title Crystal Structure of Human Salivary Alpha-Amylase Dimer
rcsb
molecule tags Hydrolase
total genus 160
structure length 496
sequence length 496
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xv8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xv8A01
2XGIA 5A6LA 1BYCA 1ISZA 3M07A 3CV5A 4JFTA 4HMCA 8A3HA 2WVTA 3BSGA 3AQUA 2FH6A 4RL3A 4V28A 3OGSA 3VOCA 3BVVA 1JGIA 3F5JA 2D0HA 4W5ZA 3BC9A 3VIMA 2CEQA 3WIJA 2W61A 2BY3A 1QI3A 1JDAA 3L2LA 2ESCA 2O9RA 4EAMA 1GOQA 2RGMA 1UQYA 4KRTA 2VT0A 2CCRA 4ZXOA 3EDEA 1WZAA 4N42A 1UASA 2ZUMA 2QF8A 4KMQA 3I3BA 2G8ZA 3N11A 3SURA 3ZSTA 1PIGA 3GXDA 3WL0A 3WUEA 5LA0A 1NOUA 2XSAA 1V3LA 2YDQA 2OYKA 1AVAA 3AIUA 2GUYA 1KBBA 4UQCA 5A8MA 3ARXA 2DIJA 3DHUA 3BLKA 2X8RA 4J3UA 1ZBVA 1JDCA 2WZHA 1G01A 1HXJA 2VO5A 4D6DA 2JF6A 2EPOA 3OLGA 3CUHA 4QLJA 2Y4SA 3BMWA 2G3IA 3VKKA 4A3HA 1KQYA 3AS2A 1EA9C 1DWJM 1TVPA 1F4HA 2XVGA 4MNMA 3BVTA 2CERA 5HDRA 3AHXA 1CGTA 3WKZA 1AQ0A 3WNOA 4RE4A 1QW9A 1H2JA 3BAIA 1OM0A 3CZEA 3THDA 2AOSA 1UWIA 1JZ2A 4NXKA 4OOZA 3GBEA 2PWEA 2D3LA 3NUKA 2WW5A 1H5VA 4M29A 3N9KA 1L8NA 4E8CA 2EEXA 4PRWA 4JCLA 1M04A 1NP0A 1UD2A 1Q6GA 1WNOA 1BYAA 2EQDA 1WKYA 3W4RA 1HTYA 3VGFA 5F7UA 1MW1A 4F79A 2G3JA 1HWWA 1JXJA 1AQMA 4AIUA 3GXNA 1HJWA 5D9MA 5A6SA 1SMAA 4EE9A 4Q22A 3EJQA 2EJ1A 1Q6FA 1OD0A 3ZMRA 4S3JA 3PZ9A 1JFHA 3H54A 1KXQA 1PEZA 1W1PA 3CIVA 1OT2A 1CGVA 3QR3A 1VB9A 4FLQA 1E9LA 2ZUUA 3DX1A 1GQIA 1C92A 4CGTA 3WUBA 3DX3A 4LYPA 1J18A 3MSDA 4P8WA 3WF1A 4M24A 1MYRA 3IANA 4UOJA 2XIIA 3CZLA 3NIYA 3BAJA 1QNRA 1SZNA 4OIFA 4H7VA 2WC4A 2YDSA 4GO8A 2OWWA 2VURA 2FDMA 4LX4A 1V0LA 3ARYA 2DEPA 5A6AA 3GXIA 3ZQ9A 1KR1A 2DT1A 3AZSA 4GZJA 4W85A 2EAEA 3CMJA 2PWGA 1PX3A 4ZE4A 1NM9A 3AIRA 4IPNB 2ZOXA 3W29A 1E6NA 3ARPA 2F61A 4ATWA 1C8QA 4NZFA 4OBSA 2DGAA 4GZIA 1R7OA 1ZL1A 3N12A 1TG7A 5IXEA 1FHDA 2ZE0A 4MB1A 5I78A 2E8YA 3PZUA 3BGAA 5A8PA 1LLOA 3S5ZA 1QNOA 3AIBA 4DM1A 1V0NA 1H09A 2OYMA 1GPFA 4M82A 2YFOA 1XGZA 1C3FA 1CPUA 4B3LA 3WENA 2WCSA 4P8UA 4CD6A 4NZCA 1R47A 4NXSA 1JDDA 3MKKA 1WP6A 5DT7A 1JIBA 7A3HA 1KQZA 1E4IA 3T2PA 4LPCA 3WNPA 2FHCA 1B90A 4K68A 2FGZA 4AZCB 3EYPA 2NW0A 4Q7NA 3A22A 3KLLA 3EJTA 3CHFA 3GNOA 4J3XA 1LL6A 1IZKA 1VEOA 1FH8A 1PBGA 4UFLA 1V6WA 3U57A 5CSUA 3QHNA 3SCVA 3M46A 2ZWYA 3WSUA 2QMKA 2D73A 3VGBA 1QX1A 1R87A 5IFPA 1MXGA 2VZVA 1R34A 3ZO9A 1UQZA 4HOXA 1V3JA 4W86A 4TXEA 3PZVA 4L4PA 2DT0A 2BS9A 1ODUA 1QNPA 5CPQA 3GTNA 2WKGA 1ZBCA 1UKOA 3IJ7A 3WD4A 2E4TA 2C8NA 4AD2A 3ZSSA 4QLLA 1NOFA 1CNVA 1JZ4A 1SMDA 2JIEA 2DSKA 2WAGA 4B9ZA 3BAKA 2DT2A 4CN4A 1BG9A 4W5UA 4AZIA 5BXTA 3VSTA 5I77A 1QWNA 2PB1A 1ZJBA 1EDQA 2XYLA 5I5RA 1E72M 2ZXBA 4AMWA 1VJZA 5E6YA 3PHAA 4GI8A 4Z2LA 4RE2A 1GUVA 4DO5A 1NWSA 2J7DA 5LA2A 1OWQA 5M5DA 2PBGA 3W27A 1DHKA 1W9BM 1CXHA 1E3XA 2BHZA 1KR0A 3HN3A 3ZOAA 4JFUA 2WLZA 1V6UA 1W1TA 4P8VA 3OA5A 2X0HA 1XH0A 3W26A 1MQQA 4QP0A 1WAWA 2CIPA 4CD5A 3G6MA 5BWFA 1H0GA 3KE0A 1TCMA 1V3KA 4V27A 3BXWA 2QHAA 2DH3A 1JYNA 1JG9A 2XSBA 1IZJA 3WEZA 5CQ1A 3PTQA 4BQ2A 4AD0A 1J0JA 2GDUA 1JF5A 2XG9A 1VFMA 3ZJ7A 1A47A 4FMVA 3CZSA 2EPKX 1QI4A 1K9FA 5GNYA 1CTNA 1QBAA 1R86A 1JD9A 3AS1A 3O2LA 2VRJA 3EJSA 1AQHA 3UERA 1YHTA 1L0PA 3VSUA 1G9HA 1FP8A 3WEMA 3GYCA 4W7VA 4DWSA 3VM5A 3CMGA 1UA3A 1ZS2A 6A3HA 3A4XA 4J28A 3TP4A 2HVMA 3WMSA 2EO7A 2Y5EA 4LXFA 4LYQA 1WE5A 2WVVA 4AZ7A 5E0CA 4KH2A 2W91A 1WDPA 4IPLA 5HXMA 4YN5A 3SCTA 4GI9A 4WJXA 4HOZA 1UKQA 1C91A 4TUFA 3DDGA 2D0FA 1HKKA 1J0ZA 1UH4A 2V3EA 5D8ZA 2PI6A 1UH3A 4ML4A 1W2VA 3GH7A 3LPOA 3UR8A 3ARWA 2D2OA 1X1NA 1JYWA 4BS0A 1IT0A 1C93A 2J25A 5KEZA 4WSKA 2ZXAA 4DWSD 3AXHA 2VTFA 1MQRA 3MO4A 3VDHA 3NYDA 3VDAA 4PTWA 4Z2JA 2BV9A 2JIWA 4AIEA 2JALA 1W1YA 4AD3A 1BAGA 3UG4A 4U3AA 3WUGA 2WNWA 4WKFA 5JUVA 1LF1A 2XUCA 1KCKA 1TMQA 4H8UA 2WM0A 1NH6A 2QPUA 2QPSA 2PBOA 3QOKA 1FH7A 4DO4A 2CBVA 1OT1A 2D22A 1CENA 3OIHA 2VQUA 2XFYA 4J3VA 1DP0A 1JI1A 2V5DA 1HIZA 4AD4A 1CGYA 1JNDA 3WDJA 2WHMA 5CG0A 4W8LA 3OGRA 4MNLA 2WZEA 2YOCA 2F1AA 2D1ZA 1E6PA 1G0CA 4HZ6A 1QHZA 2DIEA 5A95A 4D1IA 4OJYA 3CZ8A 3NSMA 3EDDA 4PMVA 1MW0A 5FOOA 1QHOA 4PSPA 2OSXA 1PIFA 2E40A 3D5HA 3AFBA 1OBAA 2XVKA 1EQCA 1HJQA 3WY2A 3AHTA 4KWUA 2DSWA 3OLEA 4LQ1A 1E56A 4FNUA 2V3FA 2XFFA 1TZ7A 3CUJA 3BVUA 2J75A 4E2OA 4PBGA 3CZJA 2V3DA 3WF0A 3SUTA 3N04A 2W5FA 4X9YA 4PMYA 2WC3A 4XX6A 2ZUVA 1TA3B 3MU7A 1DTUA 2CKRA 2WMFA 3SCUA 3VNYA 3PZTA 4M81A 1GQKA 2FH8A 3EDKA 1KGUA 1KXHA 3WY4A 3II1A 3WD1A 4AIOA 4PMRA 4HPGA 2BHUA 1EHNA 3NDYA 4E4PA 1C8XA 4S3KA 1YQ2A 1VFOA 3BUPA 3B9AA 5I79A 4CN6A 3OB8A 4AZHA 3KEHA 2YL8A 2D0GA 1CGUA 3S5YA 1R33A 3W38A 3LRLA 3BUIA 2J62A 3APGA 3RO8A 3CGTA 4HP5A 1I1XA 3RCNA 3DX2A 4CCEA 2UY5A 2V38A 4D6JA 4ZE5A 3WH9A 1ISVA 4GINA 1GOKA 3WD0A 1KGWA 1RPKA 3CUGA 1UWRA 4H41A 1LJYA 4JAWA 4CKQA 4A3YA 2ZWZA 3SUWA 2J8GA 4JKMA 6CGTA 3VIPA 1V02A 4Z2IA 1UWTA 3H55A 1HP5A 1QNSA 5BRPA 1E3ZA 3ZT5A 1E0VA 1B3YA 1F4AA 2HISA 2YL9A 2CITA 4UFHA 1B30A 2CHNA 3VIGA 1RP9A 3F4VA 4FLOA 1CXEA 3MUY1 2X09A 2XTKA 3MMWA 2XM1A 3QHMA 4UQ9A 4NSBA 4CD7A 3WL1A 1KXVA 3VGEA 2WMIA 4UFKA 3L2MA 2EPMX 4NX0A 3M6DA 4UTFA 2BY2A 1VAHA 4KGLA 4EK7A 3O6AA 2A3CA 2VCCA 2VZUA 3RM8A 4MAVA 1TVNA 2ZX5A 1E4MM 3D52A 5D9OA 3WDIA 3WH7A 4DUWA 5DMYA 5JBFA 1JZ3A 2EABA 4UR9A 1W3JA 4AD5A 5I3DA 5A3HA 2VR4A 4WLCA 2NT0A 3T08A 2F8QA 1GJUA 3VDCA 4MTVA 3AJ7A 3W6MA 3ARVA 2YFNA 1KTCA 1VIWA 5FL1A 3WD3A 2WMGA 1BGGA 5JBEA 1HT6A 4JKKA 2VC9A 2FHBA 1EDTA 4PMZA 4MNKA 4MB5A 3ZR5A 2XFRA 1FA2A 2QLYA 3DYPA 5BYWA 3W82A 2NSXA 1MFVA 1DWHM 4IM4A 3FY1A 2OW6A 1TQVA 1SYTA 2OWCA 3RM9A 2E9MA 3N13A 1RH9A 3BUBA 5IDIA 4UFJA 3GXTA 3ALFA 1LL7A 1UWUA 2VI0A 3TTQA 2F7RA 3ZM8A 1UD8A 3CO4A 3QHOA 3GH4A 1LL4A 5I23A 1XCWA 5CPSA 1WO2A 5A2AA 4GO9A 2CHOA 2OLHA 1A3HA 1CXIA 5CZKA 5BXSA 4AZGA 2VOTA 1XSJA 2XGBA 2XVLA 2QMJA 1C7TA 2E0PA 1UR1A 1E0WA 1EQPA 1IV8A 1R85A 4XZBA 3THCA 2YL5A 3ARSA 1MQPA 1CEOA 3AS0A 4AW7A 2FHFA 3KL0A 5EB8A 4HTYA 1PPIA 1TA3A 5BXPA 1KB3A 4R5EA 4GPNA 4DWSB 2NT1A 3VIIA 3N18A 4HA3A 1QWUA 4DWSC 2E3ZA 2WVVB 2WHJA 4BZYA 1GVYA 2GJXA 1PAMA 5EBAA 5I24A 1WDRA 4MJ4A 4KGJA 4GZEA 1DWIM 1H11A 4FF5A 3MUAA 2XM2A 2XPKA 1HKMA 3IK2A 2JF7A 2VUYA 2OW7A 1XRVA 3WFLA 4PYSA 2VMFA 4PMXA 1CECA 2A3AA 4ACZA 4AC1X 2B31A 1QI0A 1JZ5A 3SUSA 5LA1A 1JYVA 1EDGA 1DWFM 4UFMA 4B15A 1E73M 1UUQA 3WBEA 1E70M 5CLWA 5HNNA 3SUVA 1E4LA 2X0YA 3L4WA 3WH6A 1UD3A 3DC0A 3W6LA 3BH4A 2VZTA 4AZBA 4MDOA 3WY3A 5E6ZA 3W24A 2UY3A 4W8BA 4W7UA 2PWFA 3QGVA 5A8NA 4PEEA 2F18A 1HJVA 3IAQA 1VBUA 3PZMA 4JCMA 3OZOA 1CLVA 3WDQA 5BROA 1HL9A 1CGWA 2W67A 1GOMA 3AZTA 1W3LA 2X2IA 1XSIA 1HVXA 1OGGA 1TQTA 3OLDA 3D4ZA 3WD2A 3A47A 3ARTA 3WELA 5C70A 3L4TA 2Z1KA 1HJXA 4OBRA 1M53A 4Y7EA 5E70A 5I6SA 4BA0A 3GH5A 2DH2A 2WBKA 2WK2A 2A3HA 1ZJAA 1RD6A 4F66A 4PMOA 1C7SA 2CESA 3VU2A 3RJYA 8CGTA 5AY7A 3CPUA 4FNRA 1Z32X 3VDBA 4HMEA 1BVNP 3T09A 5M3WA 4CUCA 3DDFA 3W81A 1W9XA 3A3HA 1TQWA 1UD6A 3HU7A 1UWQA 2CKSA 1BVZA 5CGTA 2MANA 3ALGA 4JHOA 4W84A 3K1DA 2C7FA 3H53A 1RP8A 4UZSA 3GNPA 1Q6CA 3MV01 4C7DA 4UCFA 1PX4A 2ZXQA 3ECQA 2CYGA 1ISYA 2Y8VA 3FAWA 2AMGA 1UWSA 4J3TA 4W93A 4HA4A 1O6IA 3VNZA 4F9DA 2PF0A 1UR8A 2O92A 3CC1A 1E5JA 4X0NA 3MUIA 1ZB5A 2JFEX 4U2YA 3WNMA 1WPCA 2IGTA 1QVBA 3GZAA 3DX4A 1EO5A 2VQTA 1M01A 2XN0A 3S2CA 1ITXA 2JE8A 4D6EA 3A23A 5IHRA 3I3DA 1C8YA 2X05A 1JXKA 3E1F1 1UOKA 4Z2KA 4NRRA 4DM2A 2OSYA 1FP9A 5DO8A 3WDRA 4D72A 3SCSA 2C0HA 3CLWA 1J10A 5I0DA 5ABHA 1CXFA 1W9DM 3WQVA 3SCNA 2YDRA 1OIMA 2GJRA 2J7BA 5CPTA 1QI5A 3I3EA 1HVQA 3D51A 4GI6A 3RILA 4BQ3A 1NQ6A 4CU6A 4WKHA 2VL4A 3DHPA 2EBNA 2D24A 4MADA 2CNCA 1XV8A 3OG2A 3SCRA 4QFUA 4BF7A 1AMYA 5GNZA 4E8DA 3U5UA 3CUIA 2E9BA 2BVYA 3N15A 4JFVA 3AZRA 4QDMA 1GOOA 2GVYA 2WZIA 3TOPA 4AYSA 1UR4A 2GK1A 3AROA 5A6JA 3U7BA 3W28A 4PMQA 3PTMA 1XCXA 3L4VA 1E6ZA 3ARZA 2VJXA 5DFAA 2J7FA 2X2HA 2Y2WA 3OGVA 4CD4A 2WMIB 5A6KA 1KWGA 1HL8A 2GSJA 3PZGA 4J27A 3K8KA 5BXRA 3ARRA 4TTGA 3VIJA 3GBDA 4M80A 1E6RA 2J7EA 1OSEA 2CXGA 4D71A 4D6GA 2VX6A 3WQ8A 1V0KA 1BQCA 1LG1A 3HJEA 3RJXA 2UY4A 1GONA 4PMDA 2J8FA 3BAXA 3OZPA 2WCGA 4FNSA 5GPRA 2X1IA 5CGMA 4HU8A 4UQAA 1M03A 2DSVA 2WWDA 1K9TA 3CUFA 3AMDA 2Z1SA 3DX0A 1BSIA 3AMKA 5ABEA 1J11A 5GQBA 1XYZA 5JBDA 1JZ7A 1VFFA 3A4WA 1JYXA 3VO0A 1CXKA 3EMZA 1KFWA 2CBUA 1HKJA 1ITCA 3LPGA 4P7NA 1W3KA 1TFVA 3WNNA 4UZUA 3FNDA 1HX0A 3UETA 3SCQA 1LWHA 3LX9A 2DPEA 3W0KA 2IUZA 2IXUA 1GHRA 4TVDA 1UR0A 4WKAA 1PS3A 3HG5A 3GDBA 1GNXA 1MVYA 1SR0A 3IAPA 3T2QA 3B9EA 2YA0A 2F7QA 1UH2A 3WUFA 1CIUA 1U33A 2DSUA 7TAAA 4QCEA 1EGZA 3MANA 3ZIZA 3N1AA 3KLKA 4J7RA 1H41A 1WCGA 4B9YA 2WLYA 3EBVA 2Y8KA 3GXMA 1BGAA 3NJ3A 4TX6A 1ISWA 5LYRA 3WQ6A 1GJWA 4H2CA 3LPFA 1V3MA 2OYLA 2VVNA 3BUDA 5CXPA 4AEEA 3VVGA 1V08A 1E6QM 3NSNA 3GXFA 1H1NA 1CBGA 4FK9A 2BY1A 4TTUA 4HMDA 3LRMA 4P7OA 5JIWA 1XH1A 1K9DA 1OCQA 1EHAA 4UOZA 1PZ3A 4ATDA 5IFTA 3A21A 1E40A 2J7HA 3ZJ8A 2WHLA 2RGLA 2VVSA 3RDKA 3MV11 1K6AA 2J74A 5D9PA 1XC6A 1JNEA 1BPLB 5DF0A 3WF2A 3ARUA 1GVIA 3UG5A 1XYFA 3SCPA 1E0XA 2VX5A 1UR9A 4D6HA 1V6YA 3GXPA 4PMNA 2ZUTA 2GJXB 2W66A 1PJ9A 1CLXA 4DO6A 2UY2A 3ZJKA 2CETA 4N0RA 3WDHA 3VILA 5C71A 3AHYA 3VTRA 3CHDA 1BTCA 3HG2A 3WF4A 3SIMA 4XZWA 1J12A 4MB3A 1U30A 4OKDA 1X6NA 1B9ZA 1E6SM 4ACZB 5FKYA 2XN1A 2DDXA 4QAWA 1BYDA 3AS3A 2WSKA 4OZOA 3K8LA 2WMHA 1MWOA 1EOMA 3UR7A 1E4NA 1H49A 2XJ7A 1B3ZA 2ZX6A 4NF7A 2UWFA 2O9TA 1D2KA 3FAXA 1GHSA 4TOQA 1GW1A 4GIAA 3D3AA 4B16A 4MPKA 4JFWA 4PCTA 2V3GA 3VIFA 2GDVA 9CGTA 1KWKA 1C90A 5A8QA 4GXPA 2BFGA 3L4UA 3TONA 2X2YA 4FNTA 3TTYA 1B31A 1NWRA 4KRUA 4FNPA 4NZJA 1BF2A 4PSRA 1W1VA 3PTKA 5C8BB 3N17A 2A3BA 3TTOA 1J01A 4M8UA 3AXIA 4TVUA 3WEOA 1W2PA 5EMYA 1JZ8A 4X0VA 4DUVA 5BRQA 4HA1A 2XHYA 3LPPA 2VNCA 3VMNA 3AMCA 1FOBA 3WFZA 2WMJA 3TA9A 3WNKA 1BLIA 4W88A 3WNLA 3WMBA 2ZUSA 3BLPX 2JEQA 3UEQA 4AMCA 2WPGA 1OGSA 3KL5A 2W92A 3F5LA 5A69A 1BYBA 5HOSA 1XD0A 3PN8A 4JL2A 3AMLA 4AY1A 3CZKA 3AXXA 2BXYA 3RM4A 3CZNA 2WBGA 4OOUA 1UHVA 1EH9A 3SCWA 2XVNA 1Q6EA 2OSWA 4L4OA 1V02E 1XSKA 1XHGA 3GNRA 3IGUA 1GCYA 4ZFMA 1Q4NX 4XV0A 1HKIA 3A5VA 1EO7A 1M7XA 1U2YA 4ACYA 3A6OA 3AYRA 1BFNA 1P6WA 5EFFA 4PCSA 4EKJA 3PZIA 2J79A 1QI2A 3CBWA 3KL3A 4JL1A 1FH9A 4YHEA 2PWDA 1KBKA 1QOXA 1R46A 1BHGA 4RE3A 2J7GA 2EXOA 2WANA 4U5IA 1JFXA 1W32A 3VGGA 3HMCA 2EACA 3A4AA 2WWCA 2CBJA 3EDJA 1GZJA 2WVSA 4C7FA 3TV8A 4H8HA 1GORA 4P8XA 2CPUA 3WDPP 2BXZA 2DQXA 3WH5A 1QW8A 3RMEA 3S6TA 3WMCA 4H8VA 5A8OA 3FHQA 1D7FA 4PN2A 1WDSA 5FCZA 1HJUA 1UD5A 1E6XM 1Q6DA 1CGXA 4AZ5A 3NCOA 5IHSA 4U31A 5ABFB 1B3XA 3FN9A 3DYMA 1VJSA 3K8MA 3LXCA 1UYQA 3RPMA 1I75A 2W62A 3WQWA 3T0AA 1J0IA 3LXBA 5M03A 3VMPA 3L4YA 3AIQA 1TR1A 2OWXA 2YA1A 4D6FA 2E9LA 1OINA 5HPOA 1V6XA 5FD0A 2GK1B 4CVWA 1W9UA 1UZ1A 2WHKA 3VUPA 4Z2GA 1FFRA 4D6IA 1GOWA 4YPJA 1ODZA 1V3IA 4U3CA 3BSHA 4JIEA 2YIHA 3GM8A 2ZX7A 3CTTA 3HG4A 1GQLA 5CJ5A 3EJRA 3VIHA 3A24A 2W63A 4BQ4A 4QLKA 4BQ5A 2WYSA 3BMVA 1W9PA 3AHZA 2ZIDA 2BY0A 2PC8A 2D23A 7CGTA 1MW3A 2VRKA 3VD7A 2VZSA 1E43A 2EADA 5JIPA 1UKSA 4U33A 1H4PA 3T0DA 3T2OA 3UESA 4AZ6A 1HP4A 1PX8A 2BVTA 3AIWA 3AIEA 3VD9A 2J78A 4GQQA 4DUXA 1I1WA 1T0OA 3AOFA 1ISXA 1GOIA 4HOWA 2BNJA 2FE0A 2J4GA 4TX8A 2EPLX 3BCFA 1HF6A 4A4AA 1VFUA 5EFDA 5CSYA 4WK9A 1O7AA 1OD8A 1OGBA 3VM7A 3ZJ6A 5A94A 3CH9A 1K9EA 1KGXA 4UOQA 4ZEPA 4YHGA 4H04A 4W8AA 4OUEA 1NWTA 3FW6A 1R8LA 1WZLA 2QV4A 4M56A 1SFSA 2XWDA 3ZT7A 3AHVA 4M1RA 4PTVA 4FLSA 2GFTA 5A2CA 2ZX9A 3VX1A 3NSXA 1OB0A 1V03A 1TQUA 4P7LA 1HNYA 5FIPA 2YKKA 2WMKA 2DT3A 1QNQA 3D50A 2ZUNA 4PTMA 4CN1A 2VR5A 2F7PA 3BCDA 2J77A 4PTXA 2ZX8A 3VD4A 1VEMA 3EJPA 1VRXA 3WY1A 4WSJA 1CZ1A 4R27A 5I2UA 3K4DA 3ZR6A 2JEPA 3K4AA 4MB4A 2EPNA 3WH8A 1B3WA 1DWGM 4HPHA 1G5AA 1TQSA 4NI3A 1WDQA 4AEFA 4EANA 1UR2A 2IXVA 3B9DA 3MS8A 3LXAA 4TVCA 3WQ4A 3W25A 3F5KA 4AWEA 1US2A 3VD3A 3M7SA 4FNQA 1NP2A 4GKLA 4JKLA 2FYVA 4F9JA 2Q8XA 3T0BA 1W9VA 3AMGA 3VIKA 3POCA 1VF8A 4ZXLA 4GQRA 4QCFA 1W91A 2TAAA 5E9AA 1TUXA 3AISA 5E09A 1MW2A 1B3VA 3PZQA 4AISA 5AYIA 2BHYA 1X6LA 5AYBA 3KWXA 3WBAA 4FLRA 2F2HA 4U2ZA 3MMDA 3PZNA 4ZENA 3SCOA 5HPCA 3MUZ1 1S46A 1ZU8A 2XIBA 4C7GA 3VSVA 1R7AA 4LGXA 4CCDA 1E5NA 1NWUA 3HZ3A 1NOWA 1KTBA 5E1QA 1LG2A 3U5YA 3CHCA 4PUDA 5A6BA 3JUGA 3EJUA 4BCEA 5ABFA 2VX7A 4PUEA 3WF3A 3DYOA 3VD5A 2O9PA 1JZ6A 1E55A 2G4FA 3UCQA 1NARA 3AIVA 3W37A 1KCLA 5ABGA 1QPKA 1UG6A 2DSZA 2YBTA 1JD7A 1EXPA 4U5KA 1B2YA 1HJSA 1CWYA 2VZOA 2J7CA 5FL0A 3QOMA 5A2BA 2YLAA 4CVUA 5E0FA 1VEPA 2VRQA 1VBRA 4MJ2A 5TD4A 3O9NA 1ECEA 2F1BA 4CCCA 2E8ZA 3AI0A 5ECUA 3WQ5A 4AD1A 3BVWA 2W4XA 4P7QA 4OGZA 2ZXDA 2VCBA 4MDPA 5AC4A 3VIOA 5GNXA 1E1EA 2X2JA 1MXDA 4CU7A 2Y24A 1CDGA 2YL6A 3AYSA 3VMOA 5A6BD 3J7HA 4AMXA 3OBAA 3BUQA 4PMUA 1B1YA 1E15A 1WZKA 4J3WA 2AAAA 3IJ8A 1H3GA 1FFQA 4W7WA 2ZUWA 3SEPA 1J0HA 1V6VA 1ESWA 2ALWA 2WSPA 4IISA 3ZT6A 1B0IA 1EOKA 4UQBA 1G94A 3U7VA 1PZ2A 4AXNA 1Y7VA 2BVDA 1EIBA 2D3NA 3BVXA 5CLTA 2V5CA 3MSGA 2CBIA 2GJPA 3EDFA 1G1YA 4XUYA 3MI6A 3AICA 3IJ9A 4F8XA 4V2XA 1J9YA 1GQJA 5DT5A 3W53A 1UZ4A 1JAKA 1UKPA 2YJQA 3POHA 3ARQA 1R75A 2F7OA 3SUUA 1J0YA 4HZ7A 5KZ6A 3BAYA 1N82A 3MMUA 1JAEA 1FHLA 5A1AA 2G3MA 2YA2A 1J0KA 2G3NA 2WC7A 2XVPA 4J3SA 1CYGA 3TTSA 3D4YA 4AZCA 4W87A 3PBGA 1JL8A 1XD1A 6TAAA 4W89A 1ZBKA 3L4ZA 3LMYA 1VENA 4CD8A 3LRKA 3DECA 2VCAA 1O7DC 2PWHA 4AYGA 1HXKA 2YLLA 2XWEA 4LYRA 1WZMA 1XH2A 1JF6A 1CXLA 2XN2A 1DEDA 1UD4A 5HBFA 4JHZA 4ATLA 2FGLA 3KZSA 3K46A 4JFSA 3FHAA 3WN6A 2WVUA 1US3A 1BG4A 4URIA 3CHEA 1E71M 1E1FA 4UQEA 4XB3A 5A6MA 5AC5A 1V3HA 1KXTA 4JZ5A 2ZICA 4P7RA 5BCAA 5D4YA 1OIFA 1LQ0A 1W3HA 4HU0A 3L4XA 2J47A 4WF7A 5DEZA 3BAWA 4UQDA 4D1JA 2O9OA 2G41A 2WKLA 3BLBA 2WCAA 3G6LA 1MFUA 4Z2HA 1QBBA 3UG3A 2YBUA 3B8SA 5D9NA 1LWJA 4MAZA 3EMCA 3VGDA 2WXDM 3VPLA 1ZBWA 1H0IA 1HN1A 4D6CA 3CZGA 4WIWA 5M17A 4NRSA 4IUGA 4UFIA 2WB5A 1DWAM 1JI2A 3NDZA 3PZOA 4UNIA 2A3EA 2D20A 1D3CA 3HG3A 2VX4A 1WB0A 4B3KA 1QHPA 3VGHA 3VX0A 3VINA 1UKTA 3FXYA 3EMQA 1UA7A 3OLIA 4MNJA 1TE1A 3RIKA 5D8WA 4CU8A 4HZ8A 1V0MA
chains in the Genus database with same CATH superfamily
4A22A 5IG7A 5G2HA 1SEBB 4XCNB 4JE4B 3KTSA 1RHHB 4RDZA 3WIJA 1FCGA 2GTWB 5EORL 1HOCB 2GSGB 4G8IB 5E6IC 2GT9B 4BHYA 3W73A 1AG6A 1UASA 2ERJB 3WLLA 3V0WL 4MD4A 4NL1A 1PIGA 3WCYA 2NRDA 1FC1A 4LDOB 3WQFA 1RJZA 5CU5A 5F1IA 3WLBA 1BVOA 3ELAT 4Y8FA 2VW7A 4FL4B 4M8QA 1QSFA 2GOKA 5C0DB 2EDTA 1G0YR 1N0LA 4A2MA 4X4XB 1CGTA 4U3SA 4JYDA 5F2MA 4PC8A 4FQIL 2CNYA 4XNYH 3ISRA 5CAKA 4ZW5A 4WW2F 2AK4E 2QIWA 3KS0H 1Q6GA 5K9KB 4P2OB 4CDHA 1BP3B 1TV8A 1JXJA 1ONQA 3S9DB 1SMAA 4KWVA 5CKAA 1VSCA 3GMRB 4F8LA 4UIOA 3B2MA 3RDTC 4ZMXA 5CUSL 3CU7A 4NO5A 3RE0A 3QR3A 2PDUA 2AXFB 5D7IF 5DJZB 6FABL 2Y7QA 5EB9A 4WJG3 3TVMA 4H8WC 2QKSA 3O6FD 3RX8A 4OCWL 2F19L 5BOPA 4GO8A 2DM2A 2FDMA 5KYYB 4KRZA 1YY9D 2NNXA 5DX7A 4WX2A 3EAKA 3V0VB 3L9RA 1Q1JH 1P0KA 3ZRSA 3W74A 1HYRC 1FO0B 3LIZH 2RBLA 3B0VC 2OQYA 2CE6A 2F6KA 4ABUA 2GHZA 1EC8A 4PEKA 3GC2A 4NAQA 4FFYL 3WQOA 3CIXA 3LRSA 5FHAL 4IG2A 2E5DA 4K6AA 3TH2T 5IKCB 3V0FA 3GNNA 2YQ2A 4X9GA 1JXDA 5T9BG 3V4BA 2VIRB 5CAYB 4O5LL 2G60L 2PN5A 1TLMA 4UMAA 1UJPA 1TR9A 1XF1A 2XWJB 5LNEA 1IGWA 1AGFB 3HN8A 3PB2A 3Q9QA 4H2AA 2V2HA 1R87A 5IFPA 4GHRA 3PP4L 4ADIA 4ODVL 4XXDB 4FXTA 3GTNA 3NFSL 3QGKC 4M7JH 2YPLD 2C8NA 4L4TA 2I9TB 3PDGA 2XRAL 4P3DA 2IPKA 3GF8A 3GFZA 2DSKA 3VXMD 4XAZA 3NNTA 2EILB 4FZ8L 4CN4A 1D6VH 3UJEA 2C7UA 4PS4H 1HESA 1EDQA 3VG9C 4OTXH 2DMBA 3NVDA 4R83A 3SY5A 1E27A 3QCTH 1UWEH 3EG9A 4PG2C 1NWSA 3WO4B 1OWQA 2L7JA 1Q9LB 4PJBA 1W9BM 4HUWB 3VZZA 4POYA 2Y07L 2FR4B 2YGVA 3UQNA 1S7WB 2X0HA 4IXHA 5AYYA 4QP0A 1YNPA 4O18A 4OV6F 4LLWB 4M5ZH 1O4UA 1F5WA 3DX6B 2XSBA 3SRKA 2HJLB 3FB5A 1PZSA 4ZFQA 3UJSA 3MRHA 1KIPA 4WO4B 5AB9A 2AZAA 2BOLA 1LBLA 3R1ZA 5LGJB 1MVUB 4U6XB 3IIVA 3VI3F 5JIKA 3UGXA 2ITDB 3UTPD 3BH9A 5GGRB 1FN4B 2XZ9A 4KH2A 1WDPA 5IW6A 1WFUA 3EO1B 4X9SA 3SCTA 4G43B 5HHOD 5FKAB 5T3ZH 1KW1A 4RWYH 1NCJA 1AGDB 3GT6A 3WUWB 4LAQL 2AGTA 3PULA 1ET7A 2XV6B 3PGCA 2VC2B 3KXFB 1MEIA 1VHNA 2DTSA 2QXWA 4H8WH 4LCYA 4WGVB 4PTWA 5TFSH 2NNAA 4PMJA 2R0KH 3PCYA 2W8CA 1OFAA 5AVUB 3KPRB 3KNBA 3ECVA 3QRBA 4YN3A 4QAIA 4G6AD 5MENE 1X5ZA 4AD4A 3WDJA 3DC8A 5K3VA 3ABSA 1G4MA 2F1AA 4OJAA 4B2DD 1EB3A 2W6RA 3QEGH 1S2VA 1DKWA 4XO5A 1ADOA 5G5DA 1HJQA 2LVEA 3WY2A 1FLTX 1VFLA 4FNUA 4J40A 4PJHA 4BWWA 4RZ5A 3FN0L 1UYWH 3CZJA 2PLMA 5GS1B 4EPKA 4GSRA 4K7PX 1INEH 4JRXD 3LTYA 1KSRA 3EHBC 3OAZH 1Q9WA 4PY8J 3EPNA 1A9VA 1XIHA 4P5TA 1T03H 3MCOA 2UUDK 1SZEA 3IN2A 3X12B 5FACA 1LOLA 5BRBA 4PJXA 3KEHA 1V54B 3WHE1 3OAYK 2P44B 4EOUA 4GBXB 4MQTB 1I8MA 3XIMA 4MHBA 2VDKL 5IOKA 4C56D 1OP5K 2V8MA 1DIDA 1TTAA 3VRLF 4HB7A 5LBSH 3C2OA 3LS5L 5ABTA 4Z2IA 4FJ6A 4Z8FH 5F6HJ 1E3ZA 1C8PA 4G72B 1KFCA 2A73A 2FMNA 5KVDE 3W7KA 3PUEA 3N0AA 2X1UA 1E8YA 3LEYL 5SWSB 5CJ8A 3I84A 4XMWA 3FDWA 5H35A 2Y23A 3MXVL 4CSSA 5CJBA 3RHWF 1EPXA 4ZTPL 5ECGA 1CLKA 2FBJH 4R7XA 5DS1A 5IB4B 5EU7C 4E4UA 2HFEB 5I16B 4EACA 5H37G 1HZHL 4N9BA 5TE4H 3LZFL 2A9AA 3TZVC 1DQJB 3TR9A 1EJ6A 4WO0A 5ICUA 3TIEA 2BVUA 3DETD 1CVRA 4BHUI 5DZNA 4IBVA 4DK5A 3RPIA 1EBGA 1NF7A 2FHBA 2H1PL 5C9KA 1OANA 1GVFA 4MNKA 5L2KB 4D8PB 1COBA 3NQMA 3QUXC 1XKYA 4JZOA 4KPHL 1SDAB 4IGHA 4FA8A 5DZVA 3E8UL 1BBDH 2RCSL 5CGBA 2ARJQ 2R56L 1KCVL 3KPPA 4JZNA 1MNUL 4P2QA 1QSFE 4KHXL 2IWFA 1OL0A 3MROB 4FERA 1UR1A 4JDVB 2P47B 5ENWA 3PUCA 3AS0A 5KYWA 1XZ0A 1PPIA 1E4WL 4TPRH 1JHKL 1JGVH 4PRIB 4XNXH 4GPNA 4QWWD 2CJUH 3N2CA 4DLMA 4IMEA 1F97A 5G2WA 4FF5A 3U48A 2JF7A 3TN0A 2UX6A 5B7MA 1ZK5A 3H2EA 2B31A 4Z7VB 1DSWA 1M2VA 4QYOB 4OIIH 4QXTA 3WBEA 2VXUH 1E70M 3TSBA 2A9ML 4BY3A 5H8MA 3BPOB 3LMZA 1A6VH 2IAAC 4C65A 4Z5RB 3S34H 5BZAA 1SQ2N 4DX3A 2WBWB 2ZYRA 4UM9A 3TBVA 1TENA 3PRZA 3EOTH 1V10A 3O9WC 2HT3D 3OKOA 5JQ9A 4OUUA 1ZSDB 3OLDA 1MLBA 3FTZA 1E4XL 3WIHH 2A2QT 5CINL 4F24A 1OB1A 2QGDA 4Z76A 3D85B 2WBKA 2RUSA 4XNMB 4JFFD 1M41A 4DKEH 2NY2D 2Y6SC 4GMEA 4GG8A 3GIYA 5DURB 1TYGA 5JNYB 3OODA 5CZVH 5IHWA 3W1PA 2MANA 3KG5A 3CDYA 1G84A 3K1DA 2WQDA 2CJ3A 2IAMC 3CSPA 2BVOA 1T6BX 3RA7L 4JFEA 4PLJD 2Z35A 1CE1L 3E6EA 2WOBA 5BMXA 3ZFHA 5AW4B 4I5XA 4A2RA 5KBKA 2YARA 2IGTA 1M7IB 1GTFA 4IGBA 1NFDF 2R29H 3UTTD 4DZBA 1DANU 1X5KA 5CSBA 4M5YL 1DLHA 1M6OA 1WDWA 2R1PA 2OSYA 1FP9A 3CLWA 5I0DA 3P3BA 2N56A 3SCNA 1TZGH 4GUIA 2CLEA 1NIFA 2J7BA 2OMZB 5L9DL 4AZ8B 5A16B 2VMCA 1KPVB 3UWZA 3DO7B 4DZIA 2PYFA 1YDPB 3Q2NA 4XZLX 3HI6H 1WUEA 4FFZA 4NNPH 2B20A 3PAYA 3VWJB 2WP3T 3N55A 3L1EA 4PB9H 2PDXA 4PJBE 2IGFL 4F93B 4TS6A 2WTRA 3QIBC 2HH0H 2Z92A 2HJPA 4HBCL 4X6EA 1H6TA 4NM4H 3FVDA 1V0KA 5C7VA 5T1LA 3E0VA 2UY4A 1EJTC 1AJ0A 2R1WB 4H44C 2BX7A 3UG8A 4D0BA 4HEMA 3FO0L 2CLIA 3V9EA 2YGOA 1J11A 1J6PA 5HDLA 3L5WB 4GUQA 1NMBL 5G1TA 2QCFA 1GYUA 3V6FA 3VXRD 4LLQB 2C19A 5E95B 1K7EA 5HWJA 1KM4A 4GXFA 4YHYB 3QPKA 4KK9C 4DP4X 1NCGA 1VPOL 1GNXA 2NDFA 4KHTL 5J0BA 2IBGA 3B9EA 1XYAA 4FOMA 2E6YA 4LVDA 1NSJA 1U83A 3ZLHA 4L4JA 4ZXBA 3GXMA 3ANUA 1I0BA 3LPFA 1H60A 1J5TA 2I60H 4QRFA 4TUOB 2UZXA 4GS7C 4XNBA 3SBWA 1EEZB 3N42F 4PGEA 4NQ1A 4Q74A 2XYCA 3ZJ8A 1FDLL 3QQ3A 5HDBE 2ZZUT 4UIKL 4ZUUB 2Q0ZX 3UY8A 1V6YA 3V7PA 3S8GB 1ZHBA 1V4YA 3DZ1A 1Q90A 3C6LC 5L2JB 5LGXA 3QEQD 4N0RA 1TMLA 4B9KC 4DGIL 4PRHA 5EUKA 4AUUA 3WF4A 4I5BB 1KGCE 4XZWA 5CCZA 3C60D 4OWGA 1W1IE 1CQYA 1T0MA 5DHMC 3L3JB 3TV3L 1ALDA 4GT7A 2IPTH 1AAJA 1EAPA 3P0WA 1CLYL 3PWJA 2LLLA 1T5AA 2O9TA 4B16A 1MFCH 4PJHE 3E9TA 4GXPA 4Z0XA 4M62L 1RIUL 3HN5A 1OFPA 4E41D 2DLFL 4KAQL 3CPLA 2HRHA 1MUJA 5CO1A 1G7PA 4LQFL 1N64L 1YLBB 3KVKA 4G2AA 2DQMA 2A3BA 1CI3M 3O6YX 4AV5A 1RBOB 1RZ7H 5F2LA 3H1ZA 2A4CA 3FKRA 1ZAIA 4PH6A 3FXIC 4AMCA 2WPGA 2Z1WA 1IQDB 1FWWA 4MYXA 2VDPH 5C55A 5E99H 4NDMB 2FYMA 3E9UA 4RX4D 5DXWA 4YEFA 4OCNC 1X7FA 3TWYA 4IQLA 4OGAD 4C6EA 1U95B 3ULAB 5TDNA 5CWSA 4O9HH 1I9JH 1FO0L 3PZIA 2A7BA 1GZ1A 3ZLFA 4ZYKB 3WMPA 1O5KA 5GJTL 5EFIB 1OGTA 1BHGA 5M2FX 5HYJB 5CN2A 3OHXB 2WWCA 3ROLA 4QTIH 3P0VL 4P8XA 4XODA 3V4UH 2DQXA 4WV1B 5D2NB 3HR5A 1AJ7H 3GTVA 1DIKA 2Y1HA 3D06A 4N4YB 4U31A 3BKCH 3TT3H 4PJAA 5EEUA 5DLLA 3CXDH 3PHOB 3FRUB 1KPRA 1MMFA 3NGFA 5GZNA 2WQXA 1CTMA 2PU1A 4M1CC 3LCXA 4YSOA 3H4XA 4B7LA 1ZSXA 4D9QD 3CTTA 4S3FA 1MQKH 3Q2WA 1XLIA 4W6XB 3OM3B 2QIIA 1Z41A 1MEXL 2Z93A 1OHQA 1AK5A 4LJ3A 1SSGA 1TITA 4GD0A 4P2QE 2E6DA 4H1LG 1DL7L 3SI9A 4NKQB 3VD9A 2HPMA 5DRZA 4NQCA 2WM1A 1CFQB 4C6CA 1U8PA 2ENPA 4LEEA 1TWIA 4H4NA 1BMZA 2FX7L 5E9NA 1UENA 3FO2A 2GBAA 3W88A 5DJDB 1X7TA 4XVJL 4HYRA 1MRCL 4Z0BH 1BZDA 4US6A 2XWDA 1A7PL 4PTVA 4HHHA 1IQWL 4Z9KB 1KEGL 4QJ4B 5CZJA 2JGYA 4DN3H 1ET5A 1WDDA 1LE9A 4PTMA 3RL1A 4CGUB 4O00A 5DJ6A 3GZPA 4BFOA 3K4DA 1M7PA 4I9TA 1UM4L 3SE9H 3FTVA 4L4VD 3O7UA 4ERSL 4NI3A 1A5AA 4AEFA 5HNRA 1XBYA 2FUQA 4MGGA 1KIUA 4XNZC 3NJIA 3T71A 1ZUAX 4RZ4A 3Q8FA 1V7AA 3VYLA 2YQ3A 3GRWL 3AMGA 5DS8B 3CDFA 4FZEH 1S2UA 2I07B 2QHLA 3UVIA 4OJCA 4YNYA 2OZ4A 3AAMA 2YPVA 3U4EA 2I56A 3QDJB 5AYBA 2VC2L 3U82B 3CWNA 5E94A 1LNUB 4FG4A 1QLRB 3VFUA 3RDTA 3STEA 3D39B 2G95A 3KS5A 4KX8A 3W2MA 4C1NA 3CCHA 2IFFL 4P9HC 2NXYC 3N25A 4TSCL 4MF4A 3GSNB 4KTDH 5AYUL 1BVWA 4DEPC 1ZIAA 3HV9A 4YXKL 3AJXA 2C9PA 5AFDA 4QR6A 4JFEE 3WBXA 1IC1A 1AFVH 4NN6B 1XLCA 1BBJA 2YLAA 2C4FU 3BVNA 3GLDA 2RACA 1XWYA 1ICPA 2VLJD 2VKXA 1A0EA 4NWUH 5K7JA 2G50A 2QF7A 1JR1A 3II2A 3CUPA 3VIOA 3BQUD 5EORH 1U8CA 1OTTC 1SHMA 3Q2LA 3N06B 5J9PB 1FL3B 4JM4L 4IMFA 4LP4A 1ZA3A 4Y4KB 1UCTA 1UGKA 1XC4A 1RZPA 3GNMH 3V0WH 4Q6JA 5JIQA 3ISIX 3WK2A 3KCPA 1KCSH 3P5ZA 2VB5A 4BZ2L 4ABWA 1ZGLB 4V2XA 2MIZA 2VDOH 1UZ4A 1X3DA 2IS7A 1HZYA 5LNUA 1J0YA 3DJZA 1U8NA 3C5QA 2XY2A 3DMMB 1DVFD 3L3KA 2EUXA 1IFHL 1I3UA 4Q3MA 2CUIA 1DJQA 4R33A 4CNTA 3BKJL 4KFNA 2A1WL 3DECA 3DUUB 3BDYH 2XWEA 2G2RB 4R0LB 1DEDA 3VFPB 2OK0L 2Y36H 1OK6A 1XLJA 3KZSA 1I9EA 4AE1A 4HEME 1RK5A 1IT7A 4C55A 1N8ZA 5LBSA 1I1RA 4LSQH 2WGNB 1AR2A 4EXKA 4XB3A 4W9IC 5JIDA 3F6IA 4Z3EA 3ZY7A 4M3JA 3L5JA 3RJDA 2L0DA 4GUJA 2VJ0A 4PG2A 4G8EA 5IQ9B 2WCAA 4M6VA 1ZS8B 2A83B 1E0UA 4L80A 1WFIA 4JPQA 4HQQL 1EO8L 5I75C 6FABH 4XNQB 4DP1X 4WY0A 2Z26A 5F0JB 4YFDB 5FW7A 4C6FA 3FHEA 1D3CA 4OLYH 3UZQA 3VX0A 3CXFA 4ELMB 3TMLA 4PJ8B 4FYTA 4HZ8A 3RUGB 5DANA 5BNXD 2CO2A 8A3HA 3AQUA 4OLZL 4H7CA 3F5JA 1HHHB 4O4YH 2HPOA 4G9FA 4TV6A 2X7LB 4Z42C 5KVDH 2IKIA 3HPAA 2P5EB 4L1WA 3QUHA 5E00A 2QR0A 4JTFA 4PRHE 3MDUA 4P9HH 4EOWH 4PGBA 2C1PA 4HNVA 1JDCA 2WZHA 2VO5A 4Y1AB 5A8GA 4X7CC 3BMWA 2QEJA 4UT9L 4IIGA 4BFAA 2DQTL 1AQ0A 1NF0A 1DYZA 1WC7A 3BAIA 5E03A 3THDA 6REQB 3L3HA 3PP4H 4XPGL 4ODVH 4HC1L 1ZTXL 1A21A 1DQIA 3NFSH 5JXED 2DLTA 1L8NA 3TFCA 2EEXA 3EYQD 4NBZB 2F6UA 4PRWA 1M04A 5F9DC 2C1HA 2J5LB 1HWWA 1XDMA 2X5PA 1PLGL 1EJOL 3QJAA 4OCRH 4X5XA 5AB0A 5LNRA 1FVCB 4KJWD 3K2IA 1M2OA 1J8HD 2PR9A 1A4JB 1JFHA 4G8GD 1KXQA 4BI5A 4HNUA 2Y07H 4DF1A 2R82A 4X7DC 4PJ5E 2QGCA 3WUBA 1Z66A 5DC4B 3QUKA 3IJHB 5CP7B 4ROPA 2PRHA 4WCYL 4EUPG 3LZLA 4JFDB 1FYTA 1QO3B 3SADA 3CZLA 5FSDC 4QGTA 3P0GB 4U1SB 2NXIA 2OWWA 3BIBX 5E4EC 4ADGA 2DYRB 5KINA 1JN6B 5JIHA 2QGYA 1NL0H 1LO3L 2EAEA 1PX3A 4JHBA 3CAFA 1Z3GH 4H88L 5TQ2L 4GZIA 1ZL1A 3G9VA 3CXHK 5D2LB 5BS0D 2OSLA 4MB1A 2SFPA 1HINH 4DTGH 4NJ9H 2W38A 3JVAA 2NQ9A 1GY2A 4QXVA 3FC8A 3BE1H 1A1MB 4DP5X 1TQCB 3SFKA 3KPNB 3VOFA 4G8FB 7ENLA 2APXA 4CD6A 1MRFH 3S4SG 1UXWA 5MEQB 1JIBA 1XIWB 3KR3H 3WNPA 1TOXA 2I14A 2DP3A 3W70A 5LN4A 4Q7NA 3KLLA 5DUML 4J3XA 3H4GA 1FHNA 1FNAA 5DR5L 4MS6A 1FWXA 4B97A 2P53A 3TZVA 5EOTB 2AF2A 3FB7B 3DHDA 5CC7A 4W86A 3PZVA 3FQXB 3E5BA 2DWEB 2CRMA 3H0TA 1AGBB 4NQCE 1F6YA 4ODXA 1P7HL 4FXRA 3FYOA 5A2IH 4DYEA 2WXQA 3QUXA 4XIMA 4ZR8A 3DAQA 2O5XL 4BDVB 2AV7B 2J7DA 4BFIB 3VKJA 3KCLA 3MLSH 1EV2E 3HN3A 4JFUA 4PHZA 2GPZA 4FZIA 3ZKQD 3DGGA 2BOCB 4UILL 3HUJA 3ULVL 2I9UA 3T0EC 1I1AD 1A3QA 4AK2A 5MP6H 2HLAA 5C9JB 5DMKA 4AQ8C 2BS8A 4AQLA 5EIVA 1F8TL 5T1JA 5F6IB 2QSVA 1M1SA 2X6AA 4PMEA 1SYSB 4XO9A 2MNUA 4YEEA 3WJYA 1XYBA 12E8H 2FVMA 1ZS2A 4I6VA 3QULB 3VW3H 3BGFB 2EO7A 2YXGA 2EXWD 2BWGA 3EXRA 1QVOB 5AKTA 3P3YA 3FUKA 2G3FA 4AQ1A 5T3ZE 2C1OA 2EKGA 1TRDA 4RRPG 3DDGA 3CU2A 1SFTA 4P59H 2X89A 3SJVA 3HAEB 4BS0A 2DWTA 1AD4A 1PDZA 1L3NA 3GXUB 2PDHA 2WQRA 4Z2JA 4WJKB 2ALAA 4XAGA 4E9QA 4XB7A 3WUGA 3RGVD 1RURH 4PJEB 3ARDC 4R2GD 1OIOA 1ZJIA 3UA3A 3QOKA 3WNIA 2CBPA 4UTJA 1DP0A 1CGYA 3WFEL 3NQEA 1S39A 3ABLB 1XDTT 4PL1A 5GGSA 3IGFA 4D1IA 1TQBB 2DQGL 3NSMA 2IOIA 4OH2A 3G5VB 2Y5JA 5FOOA 2WGXA 4NO0A 1N7ML 3E8UH 2IAMA 2XPGA 2IDUA 1AD9A 3RTQB 2VLLA 4AV4A 4KU1A 3NZQA 4FFTA 2NV1A 1RUKH 3LDBB 4Y9EA 4YZFE 3OVQA 4Y16B 2NY1D 4KHXH 1NBCA 5HJLA 2CKRA 5E8DL 5E2WH 1UZDA 4KKRA 2Y7EA 1EK3A 1QMUA 3W0WB 1GVEA 2V5KA 1C8XA 3LENA 4N0CD 3MRNA 5DWUH 2ZZ1A 2IH1B 1J5HA 3H2PA 2YR3A 3W00A 4PY7A 4LB4A 4UCGA 4Y9PA 5HHPB 3OC5A 1YBQA 3MVSA 3TN0C 2OOGA 1N19A 1Q6QA 2V7HA 2VLRA 4BFGA 4U1GB 4FOUA 4JAWA 2JELL 3OPSA 1MHEB 1MCFA 1FCBA 5EH1A 3H55A 1QNSA 2BIHA 1B4JL 4UT7L 2A9MH 4A6YA 1PTZA 2C71A 3TA6A 3F4VA 3MUY1 1Z7JA 3G1RA 5EIQA 3QIBA 2INFA 1F3XA 2WMIA 5D7LA 2JTDA 3DI3B 3HC2A 4NX0A 4JS3A 3BAEL 2HRPL 2BY2A 1VAHA 1LEIA 1KF9B 3JV6A 2CA4A 4HPYL 1E4MM 5LIXX 3D52A 3FQ4A 2F53B 4DUWA 1Z5YD 5IHBA 3UBXI 5CINH 5B4MD 4HN4A 2XWBA 1KGJA 1QMLA 4GOSA 1AHWB 1E9PA 3SHSA 2G97A 1TVBA 4LDCA 1OHZA 1VIWA 1J9RA 5DMGD 3XISA 3OAZK 2R1KA 3NXLA 4G9FE 2BDNH 4OR1A 5BZDA 2XFRA 3DYPA 5CM1A 3LTVA 3ZTNH 3RA7H 2QELA 3GLZA 5LNGA 1K1DA 4PP1D 4JTRA 1TPXC 1UWUA 4MFDA 2DL9A 5F7LB 2NW2B 2NY4B 4JGNA 4IGBC 1S2WA 5D70L 5AOIA 1BZOA 3NZHH 4U1HB 3GFUA 5J6GA 3IDJB 4S3GA 4M5YH 1EQPA 1D9KD 2E9IA 1IBDA 2ESVB 3F7QA 4A68A 4LEOB 3N6HA 5IFHH 2YSSB 1MCOH 4OD2B 3ABZA 5HHMB 1CE6B 3IPBA 2WYTA 3LA4A 3C6LA 3FH8A 4FLHA 2VOMA 4PJIB 1GTEA 2AQOA 2G75B 5EN2B 1XO8A 3Q48A 4XCYB 2OW7A 1SFLA 2NY0B 5I8EA 1CECA 4BQCA 1O66A 4AKPA 4HWNA 3SYOA 1KXQE 4HS3B 3MRIB 5IJDC 1A1OA 1GOXA 5E6ZA 4OZFG 3D4CA 1LLWA 4XP4L 1ORQB 4KUCF 2DBLH 4EI5D 5J3HD 1FYTE 4QHKI 1RZGA 4XVEA 2IBZX 4POZD 1ME8A 3WTXA 3EWZA 1G7MA 1G6RB 5F44A 1FRBA 1ZV9A 4U1NB 2E67A 4I1PA 1BSLA 1HJXA 3D12B 2FJFB 5D1XC 4RDWA 1UB5B 2DH2A 4TVPD 2A3HA 4R7NB 2IDCA 3D0LA 3U79A 2WJFA 3ENEA 4TYUA 3PWLA 3V5DB 3ML8A 3CPUA 3C8KA 1LK3L 2H8PB 3P8IA 3CWHA 5EUOB 2X6BA 3OKYA 4JO4H 1Y6MR 4UCFA 3M7FB 1YDYA 2AMGA 5JHDB 1FG2B 1PO9A 4W93A 4O58H 4RZCA 1LBMA 1LUCA 2DQHL 5D2YA 5EBWA 5F97E 3QZEA 1U8IB 3ARFB 4YFEA 2GCYB 4KRPD 1S78D 4HWZB 2YD9A 3DX4A 2VR2A 5EU7E 4CA4A 3GPEA 4KQ4H 5GGVH 4KI5C 1QBLH 1X5LA 4NZ1A 2QDEA 4NO3A 5DJYA 2BWIA 2FLMA 3F00A 5AB2A 3I4KA 3QW3A 3QW4B 1I1FA 4HH9B 1FWTA 3JTSB 5KJ7E 3FK3A 3VRIA 5I6MA 4DPPA 3MBEC 1GZQA 2PW2A 3GGWB 3N15A 1IKNA 2NZ9D 2UV8G 2EEAA 1K6WA 3I6KB 1UVQA 4XTRD 5JVLA 3L17A 1E6ZA 4F27A 3G1XA 4HJ0D 4E9TA 2FZBA 1JPTH 3ZVHA 2WZPD 4M62H 4E5XG 2PKDA 5BXRA 1E1CB 4FTVA 4LQFH 1N64H 3HUJE 3EEZA 5I02A 1T66D 3D33A 2J8FA 2X1IA 4UQAA 3W07A 3VKBA 5IVZB 1S7QB 4JS7A 4EXQA 5JBDA 1CXKA 3KPSA 1KFWA 2OI9C 5CGYD 4DGYH 2WPBA 1SN2A 2IDQA 4LUSB 3HA0A 2BRRL 3CM4A 3UJIL 2YXVA 4FFZH 4Q2ZB 3PDDA 3DBSA 2OO0A 4UXDA 1JUBA 3NIFE 4IMDA 2JNZA 3ZE2B 2QUTA 1T7WA 5C8JB 3ZIZA 4M4PA 5CIPA 3DTUB 5FW6A 4GXVH 3HG0A 1KLYA 1QPNA 3FT2A 1V3MA 3SJVE 2AJXH 2FJGB 1Z9OA 3LRMA 3SDDD 3QHFL 1OCQA 3FCTB 1X7QB 1N59A 1YEGH 4RISL 1KY7A 2IDTA 3GS7A 5EDXA 4K55A 2XXMB 4EWND 4FFYA 1CLXA 1FWFC 1F9CA 5BRZD 4OKDA 5C1MB 1B9ZA 4A8LA 5FYLL 4X6DA 2ZTJA 4CEXC 1K8DA 3B9NA 3S9YA 1EOMA 3WTTA 5F2IA 3TO2A 4FQXD 3WS6C 2QQLH 1D2KA 1UBSA 3LZQA 4QYAA 1DL7H 4Y8DC 1B31A 4U3HA 2H7WA 1D3HA 1RCXB 5I0XA 3NCFB 4NHVA 4YAQB 1J01A 4ERAA 1KTDA 4NRYB 3EYFB 4K71C 4F37K 4XOBA 3OAUL 1IL1B 1MRCH 3QAZB 1MEWA 1JPKA 1E28B 4F2FA 2FSEB 3QF0A 4BQ9A 2ABAA 2ZUSA 4N1CA 5IIEA 3I68A 1KEGH 4WTZA 2YKLL 2MCPL 1IEWA 1CMOA 1XL4A 2VLRE 4Q4OA 2DJXA 2QCGA 3RM4A 3FFDB 1GPOH 1UHVA 1E5AA 1BXCA 1BM3L 2OSWA 2JKEA 2QQNL 2ZXEB 4YSUA 4ERSH 5DRWA 4PLNC 2IG2H 3LOWA 1KPUB 4AYDC 1QI2A 4JL1A 1FH9A 3GHEL 3OKKB 3W1UA 3EFFB 5D7LE 2XLLA 3A6CH 3GRWH 3WUZA 3QXWA 3VA8A 2MKWA 4AGLA 4MA7L 5E1HB 4LU5H 5J12C 1GGIL 2GGHA 4EMZA 43C9A 4ADJA 2XWZA 5HD8C 3SJ3A 2VFDA 3DYMA 4LGRB 4WHCA 2ZPKL 2P28B 1J0IA 2IFFH 4GRLC 3DCPA 4APXB 4HIEA 1XRSA 5I76B 4C6KA 1W9UA 1UZ1A 4GX9A 3TESA 5H94A 4YXKH 2G9KA 2ADJA 1V3IA 5K39B 4JIEA 3KZPA 1TPFA 4M7SA 1XVSA 1D5XA 3W7MA 5DK0A 2FBOJ 4UDTB 2VZSA 1AFSA 5GRUL 2EADA 4BQ6A 3W87A 3T2OA 3P69A 2V63A 3HMXL 2LU7A 3R0DA 1A7NL 4JM4H 6PAZA 3AZUA 3IRPX 3FUNA 1HF6A 5ERWB 1NJ9B 4Z7UF 4LVHC 4YHPA 1M65A 3THAA 2D31B 4V1DB 3AHVA 2JJTC 4XGZB 4GQPH 3NSXA 4ZUTB 1OB0A 4GKTA 4JX0A 3STLB 3OR7B 5G1YA 3GE7A 3ZHDA 1E8XA 4GMSH 2A7NA 3B06A 5D6CB 5J8OA 3IDNA 4HSNA 1HSAA 4QOKA 1KCBA 1WDQA 3SIKA 1SRDA 2DKUA 1XCTB 4DKTA 1P84J 5DA0B 3B9OA 4JG5A 5HYEA 4XAYA 4F9JA 3AU1B 4LWWA 4A3QA 3X14A 2CLRB 7REQA 3I6SA 4LB3A 1TUXA 1Z9NA 5FO8B 3FUIA 4NKDB 2R2EB 4ZPVA 2B59A 3L1OL 5DQDL 3WTVA 4ONFH 1TETL 4Q8PA 2HVOA 3TURA 2Q76A 1ZU8A 1LQ2A 3AACA 4YXHH 1UT9A 4C7GA 4CC0A 4CCDA 3W1ZA 1KTBA 3VKAA 1TX0A 3GIQA 1JEZA 4ICWA 3UP8A 1NEZA 1QPKA 4ALAL 3REWB 1UG6A 1EWDA 4FO4A 4DPQA 3J2PA 1HJSA 1F2XK 3NOYA 1PHWA 4FXLA 4YCOA 3ZE1F 5DJCB 3NCMA 4TQ8A 4ZDHA 2W4XA 2FX9H 4MXWL 4P7QA 5GZOC 3IT8D 1SF3A 3VYNA 1YMMA 4MDPA 5AC4A 2OZ4H 3EH1A 2YPVH 4OM0H 3J7HA 3HQNA 1HNGA 4F57L 1FNGB 3QQDA 4KEMA 5SX4I 3FTXA 1OD9A 1FFQA 2ZUWA 4JTDA 4BUQA 1T5WB 5FC9A 4IQJA 4GW5A 4XC3L 5BOFA 4ORGB 2DYSB 4MTMA 5CLTA 5IM7B 3GJFB 3NCWA 4RE0A 1AJZA 1FE8H 2V5JA 3QORD 1ZHKB 3IJ9A 2WKOF 4IOSA 1MAKA 3SDCB 1YMHB 3ES6A 3ULVC 3ARQA 1DEEB 1RV6X 5FUOL 4WK0B 4GBDA 3QCUL 3IJDA 3D07A 2G3MA 3L1GA 2ARWA 2P80A 4AM0B 3B3DA 4RMTA 3GKWL 3CL7A 1JL8A 6TAAA 2BSRA 4W89A 2EYTA 1ZTXH 5FOJA 3MY9A 1A6AB 3IRSA 4Y9CA 4CQBA 3Q6FB 3SODB 4I18C 2YLLA 4LYRA 1XH2A 1PWMA 3EWYA 4HF5L 4NT6A 2J8UE 4NJKA 5DBUA 3ML9A 1LTXA 4ZW6A 3G3MA 3ARGA 2DD8H 1VZGA 4ZUWB 1A80A 2GTQA 3QH2A 1FCVA 4JZ5A 1T1XB 3KPSE 1G6VK 3DRQB 3L4XA 3SPHA 4UQDA 1F4XH 1Y6KR 2WKLA 3BLBA 3R1GL 3IWVA 3RX2A 3UG3A 4QRTA 4GAYA 1ZBWA 2AI0L 4N5EC 1HN1A 5M17A 2EIMB 3ATEA 4UFIA 3QC3A 3GMPB 3T0EA 1WB0A 2AL2B 3ULUL 1FHUA 1YAZA 3FXYA 4C90A 1Z44A 4AQ8A 2AV1A 2GWGA 3V4PL 1H3VA 1V0MA 1M9WA 4LL9A 3O6LH 5DO2C 1LO3H 4MZIA 3BSGA 1H5YA 3V0AC 2AZUA 4QAMB 1OAYL 1BCIA 2IKHA 2FTPA 3BTNA 2R69L 4JAMB 2O9RA 3PG9A 1V6TA 4KRTA 1TV3A 1XF5B 1HXYB 3NIDF 2KX9A 4WI0B 4OFDA 2AC0A 5EU5A 4RMUA 2XSAA 4PRPD 3E2VA 1DVSA 5B22A 6XIMA 1A5OC 5A8MA 1E9OA 3QUYC 3KVMA 4X6DE 2JF6A 5I07A 1OAJA 2X4TA 1GZGA 3BDKA 4PTTA 1QW9A 3T0XA 2WXKA 3ARDA 1UWIA 1VLWA 4XAFA 4HHWA 3C2RA 5DD3L 2OKMA 5HWMA 3C6SB 4M29A 4D0CA 4TLUA 2VDLH 2GQ3A 1HTYA 5F7UA 4F79A 2WNGA 2EE9A 2WNNA 5E9XA 5DCBA 4KEUA 2FVLA 4CNIA 3EJYC 5DQ9B 1JF1B 1XG4A 1QSEA 1CGVA 4N2IA 3KWSA 5IOBA 4UILH 2ISVA 5MI0B 1CFMA 1RPUA 3ULVH 5REQA 4M24A 5IQLA 1CFSB 2EEFA 2J2ZB 2X88A 9XIMA 3WS3B 1CUOA 2FD6L 2YEQA 1AW5A 2VURA 4G83A 4YSSA 3KJ4B 4IDJH 5E4IA 3B43A 2DQJH 2JBMA 1QATA 3MUXA 2UZIH 2I7SA 1H3XA 2BSBA 3K3QA 1KV3A 3PDOB 2V5TA 5F3BB 4AQ1C 1SEBA 1D5BB 1EF2A 3W72A 1FHDA 2R7EB 2ZE0A 4XBEH 5KSBB 2CKBB 1R3LA 1NDWA 4JO5A 3S5ZA 1ZZMA 3S83A 2GTWA 2JSFA 1U3YA 4FP8L 2XFXB 5KSVB 3DXAA 1O9ZA 3KOWA 1ETB1 5C0RH 1L6WA 1THCA 2PXYB 1XF4A 1EANA 4UINH 1E0OB 3O6MH 3ORWA 2D7PA 2C18A 5F2GA 1YECH 3L9YA 2E27H 4HYVA 4X50A 3QEHB 1MXGA 4J3ZA 2YBRA 4PWGA 4IKLA 2WQSA 1C08B 2WKGA 2F8XC 3IJIA 3GSOB 4TV3A 1T3FA 2IADA 1VZIA 4M6AA 1WX0A 4W5UA 2P8LB 2DU2A 1IBBA 1LK2A 1RZ8A 1R2RA 3TLQA 3S3GA 3EOYG 4PJFF 2M26A 3KRSA 1YTDA 3E2QA 4HBKA 3KGRA 4ZX4A 3G6MA 3VVWA 2QHAA 2X70B 2AXFA 4QOKE 4W9TA 2R9HC 5G4WA 4K9EC 1EBHA 5IEHA 1CTNA 3L4CA 3UP1A 1MCDA 2QQQA 4L4TE 4S1QH 5TNVA 1L0PA 1EZLA 1NSNL 4UNUA 4JDBA 1UA3A 4P23C 1LDPL 1RI8A 2JJVA 3H26A 4JN8A 4HUVB 3V0VA 3HZYA 1RXLA 4A8IA 3QG6A 4WJXA 4UT7H 1C91A 2QKFA 1FO0A 1BD2D 1NIDA 3WBYA 3KJ6L 3HLAA 1NEUA 4G1MB 2WLLB 2D2OA 3G1SA 3BAEH 1Q0XL 2NLJB 2W0FB 2KZBA 5KEZA 1EEXA 5FEPA 2FIKA 1TTBA 4KNTA 1BAGA 1LF1A 3ZE0E 1TREA 3P93A 1U8KB 4I0PD 3UTSA 2WIIB 3BLEA 1MHPL 1XGEA 5D1XA 1BV8A 1S7XB 4N2GA 4XP5H 1YMME 2XWJA 4N25A 4E3VA 4HK3N 2PGFA 1M71B 1E6PA 5CD5C 4LARH 1QHZA 2B08A 3LKOB 3TEXA 2WOYA 3T0WA 3V55A 2I9TA 5FCSH 4GG6B 2Y2TA 3G6JB 5TJWK 4LQ1A 3V0DA 4HKXB 4CVZA 3WF0A 3KEDA 3FS2A 4KVCH 3ATDA 5D70H 3TEUA 3FCSA 4S3CA 3MU7A 3VJ6A 1Q9LA 5IB1B 3B37A 2ORBL 4DJDD 5RUBA 2YD3A 1DDHB 1S7WA 3T3PB 4QEGA 3B83A 3GI8L 3PHQB 3X13A 3TFXA 4KIEA 1T89C 4ZFZB 2XN9B 2K1MA 1NCHA 4L3CA 3A4JA 2NNRA 5FYJD 2NLYA 4NHUB 3OXRA 2ADYA 1ISVA 5AQ0A 3P5YA 4Z95L 1RPKA 3NGJA 2EYRB 4MG4A 3MBEA 3SUWA 3QZMA 5LGJA 2HTKD 1W8SA 2Y0SA 3WFCL 1L8PA 1TCDA 2OQHA 5CEXB 1Z7AA 2CITA 2ITDA 1HWGB 1WISA 1CT5A 3O8XC 5GGRA 4MBRA 4BYHA 5IMMA 3EXJA 3EO1A 4U7SA 4G43A 1KC5L 5FKAA 1R24B 3GRWA 3WX7A 3M6DA 2CBOA 3WUWA 3O6AA 2XXCB 3T0EE 1E7UA 4NZDA 3U4BH 4PJXE 2ZX5A 1R5VB 5CLZA 2ACUA 3F4WA 1IT9H 4A35A 4K9EH 1W3JA 2A6KA 2FX8H 4I1RA 3ZMEA 3R7MA 3B5HA 5HBBA 3CVIL 1NVMA 2WXFA 3KPRA 1LK3H 4AGOA 1IAII 4ZPTB 1CDJA 4A6YH 3NQIA 4LSVL 1U8MB 4NRZB 3G5XA 4ZGYA 3HZMB 2DQHH 2C5DC 5IMOA 1SVCP 3ZM8A 2X6CA 5JHMA 5I23A 1XCWA 2AGJL 1F90H 2R27A 4V33A 1A5MC 3FK4A 2CHOA 1Q2RA 4WDUA 4P4KD 2CA3A 1H15B 3E7JA 1UUSA 4YVUA 1MJJA 3MFFA 2H8XA 3C4UA 3E96A 3W71A 4MCYB 5G4HC 4QG8A 5C2BL 3O4OC 3S2JA 2OR8A 1R9FA 4BZ2A 3WXVL 2YZRA 1QWUA 1C5CL 2WVVB 1L6SA 1GVYA 1NAMB 1IKNC 5FCUH 1WDRA 1B9BA 3QGAC 2VUKA 1RU9H 4PI2A 1HKMA 5E1AB 4HU2A 4IRJC 3OSKA 5ACMA 3HQOA 5LA1A 1CICB 3WS6A 2PLKA 4N90E 1L5GB 4ZI8A 1UG9A 3GHBL 3QRFM 3GU2A 3ONCA 4WJ5B 5EZOL 1QSEE 4MA8L 5H6HA 1HZKA 2I27N 4MNHA 4W7UA 3CS2A 3BKML 5IMKB 1VBUA 1LQSR 1TQCC 1X38A 1VYSX 3GFXA 2W67A 5SWSA 4RGMB 2HV5A 5I18L 3MCLH 1OGGA 3QDAA 3OR6B 4YUEL 2AVFA 3D4ZA 3KYOB 1BOYA 2V7NB 3WELA 1R3HA 3AQDA 2YUXA 5HMEA 1T6VN 3MC5A 2XZCH 3F6LA 4S1DC 4ZQMA 5I16A 1A4KA 2CESA 3K5SA 4JBRA 5BWAA 3BI9X 4MMZB 5LIWX 4E42B 2FB2A 4QS5A 3BVDB 4MRCA 3GMMA 4HDIA 1YAIA 2HROA 2BX5A 1LE5B 1O6SA 2JQMA 3VTTA 5CGTA 4YXLL 5T26A 4MNQA 4KQNA 2C7FA 1OF8A 3H53A 4ZQPA 1W0VB 4YJ5A 4YE4L 3DXAE 3FAWA 2Q1EA 4D8PA 4O8AA 3TROA 4F9DA 3CC1A 3PLYA 3OJ2C 3FO1B 1FIEA 1TWZA 2XA3A 1WPCA 2ZP8A 3MLZL 3QHFH 1IARB 1EO5A 3KTXA 3QIUD 3IDYC 1JTOA 5DLCA 3KVPA 3NACH 5AB3A 4RISH 1UIOA 1UOKA 4B9PA 1DQMH 3E3HA 3V5OA 4L1HA 2H6PB 3MROA 2NTSP 1CXFA 4JDVA 2YDRA 4GYPC 2OTDA 2YXMA 3G6DH 4GIOA 3LKPB 3DTXA 4OQVA 5JOPE 1KM5A 3GRIA 4KKAD 4GRLA 2DVUA 5C07A 4PRIA 4X61A 3U5UA 4ACTA 2GY5A 2BOBA 1AXIB 4JFVA 1BD0A 4YL2A 3K2MC 5L88H 4LO9A 4Z7AA 5EBLB 2XC8A 1GEHA 5JDSA 2CLOA 4WSHA 3BXNA 5FK9B 2X2HA 4N6FA 4HC1A 2F8OA 4F2MA 2HP4A 4UTIA 2Q7YB 4XX5A 1Y6NR 4KQ0A 3EWBX 3A67L 4D71A 5DEFA 1IAIM 4WWKD 3RJXA 1Q9KB 2BO0A 2Z2UA 1QK2A 3OZPA 3H21A 4Z6AT 2DSVA 4Z5RA 5HUPA 1EZ2A 3RLUA 1XYZA 1T8QA 1EJVC 1JZ7A 2E7LA 3T1WA 3T4WA 1HKJA 1QBML 5B8CC 3DX8B 1H19A 2YKLH 2QBWA 2JJTA 4TLKA 3SCMD 3GHPA 2ZZ5A 3ZYJA 2IXUA 4ZQNA 3VU1A 3D85A 4RMQA 4ALAC 1F1AA 2CIKB 3LQMA 3HB3B 4FQIH 3GHEH 5JNYA 4K3GA 4X6CB 2ATAA 2W0KA 4TX6A 4YDJB 3IM1A 4K5OA 2I24N 3JRKA 2VVNA 1OW0C 5HJGA 4K94L 2BY1A 1XH1A 1GGIH 2O7SA 3GSXB 4OZIF 1MCSA 2WHLA 4GZ7A 5AEAA 2ZSVA 5CUSH 3UTSE 3T4YA 1WAAF 5BZZA 1OAZL 3GMQA 4Z3TA 5EO9A 2W65B 1FWIC 5D1XE 3TASA 3S0CA 2CK2A 2TRYA 4RCXA 3AHYA 3QLDA 1GYNA 5KSAB 1MI3A 4OCWH 1ORSB 1AIFA 2BNQD 2F19H 3V79C 2UZPA 2E28A 3QQ4A 3AS3A 1YEDB 2OMZA 5DRNB 5CIPH 2LFEA 3DO7A 1H9DA 2CDEB 3UR5A 1YDPA 1C9SA 1T20B 2A4AA 4WWOA 4MDIA 3TTYA 1NWRA 4ZQCA 3HMXH 2P10A 2CGRL 5GZOA 4YJZL 3NQGA 2FFIA 1O1ZA 2OO6A 5ANHA 2Y5QA 3N17A 3MNZB 3TTOA 3HNTL 2C9VA 4KI5E 3IUHA 5FV1L 1VJIA 4FFYH 3A0OA 3WEOA 3QQ9D 4X0VA 2VM8A 3JUZA 1M1XB 5FHAH 5BRQA 4FX6M 4LH8A 3FN3A 1HNFA 3AMCA 3WFZA 4AWSA 1IGJA 4FXKB 5AC8A 5IK3A 3M0LA 3RN6A 2VGBA 3WXWL 2WO5A 4O5LH 2G60H 1BLNB 1W72B 2O7QA 2WBGA 1UFGA 1ZALA 4LLQA 1MHHB 4WHTB 3ULUC 4DFHA 3RZCB 4ACYA 4PCSA 3D2UB 3E74A 2HX8A 4JO8A 1R46A 2XRAH 2CKBL 4LP8A 4I18A 1GZJA 2H3KA 3VGAC 2I5IA 3GLCA 1E5YA 2MEJB 4FZ8H 3TV8A 1GORA 2I7OA 4AXWA 2HFTA 3WH5A 2VR6A 1M42A 3R2GA 2C3VB 3IDXL 2Y7GA 3CHRA 1TIMA 3V9FA 3NABL 1VC4A 4U1IA 3VCNA 4LS2A 2FZ9A 4E2VA 4JDEA 1NGPL 3T0AA 2ZWLT 3KPRE 4L29B 3PG8A 1OTSD 3L6FB 4HSAC 1QEWB 3AUVA 2GK1B 4ALAH 2WLNA 4H8NA 1EZVX 2ETWA 3EWUA 1Q7QA 3AU2A 2XV2A 3VXUD 3GM8A 4QPEA 2Q86B 3NIGE 3WL9A 2YZ5A 2GTZA 3L3JA 5EPMB 4BQ5A 5AUMA 3N40P 3VD7A 3RVXD 1NMAL 4NAFA 3T0DA 2A7RA 1RJYB 1T0PB 2AJZB 1PCWA 4N2YA 1KFGA 4F57H 3HGRA 2J1ZA 4YZWA 2FE0A 1S1RA 3FTWA 1VERA 3GMNA 4PJAE 3ZDYF 4LAQH 3ESPA 2Y61A 1F58L 3CH9A 5CEZD 1K9EA 1Z8AA 2Y6ZA 1FL5B 4ZEPA 4OHQA 2JKTM 1WZLA 4FLSA 2A99A 3F2DA 2BVEA 1Y18A 2YKKA 2WMKA 1MCIA 3QUYA 4LCUB 4CN1A 4JRLA 1Q4WA 3STFA 5T3XD 5FFGA 2CO6A 4HWBL 3GKWH 1UR2A 4JN2B 4KF1A 2Y06L 2H26A 4IOFC 1EJWC 4N68A 2ARJB 3TNNB 1F3JA 1R5WB 4K23L 1U95A 4ZW3A 4PJCF 1RVKA 1FZOA 1ML1A 3D2TA 5C5YA 2JVUA 3BD4A 3ARGC 5SWSE 1TUPA 4ZYKA 2OPJA 1AC0A 3NYKA 4GQRA 4K37A 1G7IB 5EFIA 3DSNB 5HYJA 3QH3A 2HAZA 2WWKO 4KO9A 2F2HA 1BQHB 2TPSA 3FN0H 1NANH 1WFNA 2QDWA 5D2NA 4ZT1A 2NX5D 2Z0UA 3RLHA 1LDCA 3H3BC 3KX6A 3OW1A 3VZYA 2WYHA 1SGJA 4QBXA 2IMMA 4M43L 1M9HA 2G4FA 4PTDA 3AIVA 1KCLA 3NM3A 3VI4F 3RHGA 3ZL1A 4MNQE 4GIPD 2PGRA 2BTMA 3PHOA 4TSAL 2CDFB 3VWKB 2KQNA 4CVUA 2AJVL 1VBRA 3WE6B 4O53A 2VDKH 4GI4A 3QFWA 3G3DA 1NFIB 4CADB 1WJ3A 5AHLA 1E1EA 3LS5H 3W7OA 1KN4L 4BXSV 4P61A 4UNKA 1AL8A 3MCKA 5E5RB 2RR3A 1E51A 3I75B 3THUA 5C6MA 2FECL 3LEYH 2X4PB 3QYCA 3VXPA 5LLIC 1LEKA 1PD1A 3MXVH 2CLVB 1RCOB 5BMFL 4ZTPH 3TO4B 4OAWA 5C07E 5HHNB 4PRIE 3BW9B 1IHIA 4O14A 3OKMB 2GG1A 1JAKA 1ZK9A 4HKJB 1N2VA 1N82A 1HZHH 3LZFH 5CJNA 2A85A 3IXTA 5DJ8B 1JMXA 4Q4RA 4XAKE 4F2ME 1ZTXE 2ZCZA 5B7YA 3L5AA 5JPNB 4YK4B 2QUUA 1PYWA 4S10A 5LDUA 2H1PH 3FQUB 1WZMA 4M03A 3SRDA 3MFGB 3KCJA 4KPHH 4JRYD 3U6XS 2WVUA 4URIA 4XNAA 2Z3FA 3QNXB 1E71M 3TBWA 2RCSH 3RWCB 3N6JA 4HG4J 2R56H 1KKOA 1R3YA 1KCVH 3T6ZA 2PU0A 1MNUH 3UIYA 2J47A 1BKSA 5F2FA 3B8SA 2EZ0D 2AAMA 3STZA 3SOBL 5ECVA 3EYOA 1QLRA 4P5MA 1QNZL 4QHNA 5K9XA 3VI3B 4FG6C 4R4BB 3LDVA 4NRSA 4IUGA 3C9NB 5KYUB 1E4WH 2R1YB 1JHKH 3BN9C 2QZQA 4B3KA 1QHPA 2X28A 5DRXB 1RH8A 4PJGA 1HHKB 1E9YB 5D8WA 3QPEA 1NFGA 2M1KA 3QDMB 1KG0B 1Y65A 1EQWA 4RL3A 5DI8A 3BVVA 4F33B 3US1A 1BRLB 5H2BB 4H7ZA 4W5ZA 3B3IB 4M1GL 2YJLA 4LY4A 4P23A 3N1GC 2HBVA 3UOAB 3GJEB 4MA3A 5D1ZD 1WWWX 2QVFB 4WTQA 4N42A 3MV9B 3RVVC 4FP8H 4LLMA 3I3BA 4LVGA 3MO7A 4OZGA 1KDIA 4QT5B 2ERJC 4JQXC 5LWYL 3WL0A 4IX2A 4HPNA 4GK8A 4CL7A 1OSPL 3QAZC 1F8MA 1E4XH 4PD4K 1BZ9B 2G3IA 3ES7A 1FFNA 3MI2A 4FL4C 4RAVB 1TVPA 3D34A 4HUXB 2HUHA 4MNMA 1VESA 4HA0A 1NAML 1ZGLA 4NAMA 3DVNB 1Q5MA 5ADOL 4DIAA 1DPMA 1IGYB 3C5ZD 2AOSA 3V5HB 3GBEA 2LT9A 1ZHLB 4JLRA 1EXHA 5HATA 4UMGA 4MFEA 4AIBA 2OXGA 4WW1A 1AQMA 4F7CA 1AH1A 3IS0X 1DQWA 3V0JA 4P2OC 2P3ZA 3AWGA 2Z7WA 5KBDA 1CE1H 3EJQA 2B9BA 2NXZB 2OMTA 1UPMB 1T5XA 2GPTA 5K5YA 5EO0B 3T3ME 5F21B 1FZKB 3II3A 4QJ1A 4TOYL 2QJGA 2BLEA 4F3FA 2ZTKA 1QU4A 4OKVB 3ULVE 5DFTA 4P8WA 4I5RA 3BYTA 1ZS8A 1MYRA 3N2TA 4UOJA 3EYUL 4A2SA 3R5EA 4XNQA 1SZNA 4H7VA 4YO0A 5L9DH 4LX4A 1B57A 4ES9A 3HOJA 1T89A 3EPMA 3DIFB 1FWAC 1NSNH 1ZMYA 4Z18A 1NELA 1S5WA 4JQ1A 3LLXA 5B7EA 2APSA 4NYYA 3FSUA 3RUGA 4NZFA 1TG7A 2ODHA 3FA5A 5ISZD 5EEZA 1GKQA 3EZJB 1T7LA 5LB1A 4C6DA 2IGFH 1BKHA 4O1AA 1P5UB 5JYLA 3KJ6H 2YFOA 1HHHA 4HBCH 1OFDA 1Y0LA 2X7LA 1AGEA 3O8XA 4P8UA 1A0DA 4MWAB 1L6FA 5C0CD 1O7SA 5DA4A 3SD5A 3HE7D 1Q0XH 1GKPA 1HI6A 1BZQK 2DIKA 3FO0H 1E4IA 3SYCA 4LPCA 4P48A 1TNNA 2FGZA 1W6WA 3GSNL 3CHFA 1NMBH 1B4LA 5L7XL 4OZHF 1OZTG 2BSEA 5CPNA 1B6UA 1MHPH 1V05A 1DJIA 2QULA 3GVWA 1HH9B 2H2PD 2N7BA 1V3JA 1LGVA 2P5WD 3U2CA 4HCLA 1VPOH 2EUWA 4KHTH 5FB8B 4F8QA 2GIMA 4KJYA 6REQA 2Y1ZA 1J2WA 2PP0A 4W9EC 2JIEA 3DWTA 3ILDA 3DK2A 5F93C 3QQ1A 3UW6A 2VDRB 4RGNB 3VSTA 2ZRXA 2XQ0A 5I77A 5T91A 5B39G 5E6YA 4RNJA 3PHAA 4LOEA 4XPAL 2PEVA 1ONWA 2VDIA 3T1FA 4YTUA 1X5JA 1A49A 1CXHA 3WO4C 2WQWA 1FVCA 1XIGA 3C87A 1DJWA 1FDLH 3GSRB 5FS5A 5BWFA 1ODAA 1K4CB 4UIKH 3BXWA 3GTIA 3EPOA 3BO9A 3PTQA 1CD0A 4AD0A 4JFQB 3GI8H 3CNYA 3BFQG 3IJHA 3GTFA 5FYKD 1R38A 4DGIH 1LMKA 1QO3A 4E68A 3R94A 2WB7A 4OGQC 3TV3H 2C34A 4WO4C 1OC7A 3CMGA 2HUEA 1MRDL 2WSRA 2RDXA 1CLYH 4FADA 2Y5EA 4LXFA 2OP4L 1XWVA 5HYJE 32C2A 4IRJA 4GRMA 2W91A 3MLYL 3WFCH 1LO4L 4F92B 4UB9A 4JTCA 3EA3A 5D04C 1RIUH 2F8IA 2DLFH 1H7OA 4KAQH 4RNFA 5D71L 1FQ9C 4QRRB 2E7BA 4A55A 5HHQB 1CI5A 5BUGA 1AQDB 1VQTA 1FCQA 2E5BA 1DLFL 3H2WA 4L9DA 2WLMA 4KVNL 4DWSD 3AXHA 1H50A 1P4LA 3E8VA 3I7RA 4POCA 3MUGB 1WA3A 4D3CL 4GIRA 5E9DB 5MEQA 1UUNA 2J66A 2XUCA 1HEZB 4Z3JA 3P4OA 4XZHA 4H8UA 2ZZ2A 4PJ9B 5B7FA 2RHGA 4YWIA 1RKRA 4I9JA 2OX5B 1PCKA 3SE4C 4H9YA 3QI9B 2WHMA 2X4RB 5I9QB 1DQXA 3CC5B 3ETBF 2DIEA 3G6AB 4IIQB 1V5JA 1NFDB 3FQXA 8XIMA 5JOEA 1FO0H 1ACYL 4ONVA 1U92B 1H3WM 1AGBA 5GJTH 2X1TA 3GPSA 1S7SB 5ALCL 4ZMOA 4X6FA 1EFXA 3P0VH 1PZCA 5I6NA 1MXSA 4IQEA 2WC3A 3HMXA 4BDVA 2AV7A 4BFIA 3TQKA 1W3IA 5GS1C 3V4LA 4GH1A 3EDKA 5BVPL 5CZXC 3BYYA 2Q8BL 4PMRA 4UTAL 1RZJL 4IEFB 4QLWA 3CQFA 4V1YA 1W72L 1GAFL 4AZHA 4Q89A 1CGUA 5BZXA 1G1KA 3D05A 4RCAA 3BUIA 2WWKT 4GYPA 4A7GF 3L3GB 3FYIB 5I0WA 4L1TA 4GBXC 3CUGA 1SYSA 4RSVA 5D5MF 1HP5A 4XI5D 1N5AB 1MEXH 4G9DB 5JLZB 3TSDA 4QHUB 1XG3A 1IWPA 1M5WA 3IMUA 5EZOH 3S2NA 3CDGA 4K94C 2HTMA 4P2RD 3L2MA 2L04A 5FECB 2FX7H 2PO6B 5I18H 4F3HA 4UB0L 5KUMA 1VCGA 4XVJH 4PJGE 1SJVA 1A7PH 3HS0B 3DUSB 4J3OF 1IQWH 4X4YA 1IT8A 3LNPA 4OB5L 5B8CA 1PDKA 2GYSA 4F8PA 4MY1A 2CSPA 1C9DA 1EC7A 3RY6C 2Y62A 5JBEA 2ZNWA 4U10A 4P57B 1AH0A 1UM4H 3FMGL 3KPOB 2ODOA 1S3TC 1FA2A 2Y22A 3W2NA 3LG3A