1XV8A

Crystal structure of human salivary alpha-amylase dimer
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
496
structure length
496
Chain Sequence
b'EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase
publication title Crystal Structure of Human Salivary Alpha-Amylase Dimer
rcsb
molecule tags Hydrolase
total genus 160
structure length 496
sequence length 496
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xv8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xv8A01
4LQ1A 2J7BA 3AIVA 2ZXDA 1JF5A 3PHAA 1MW1A 4HTYA 1WDSA 1EH9A 1KGXA 3VDCA 4UNIA 5HDRA 1V02E 2CHOA 1VEMA 3W28A 1V0KA 4P8WA 1JIBA 1KXVA 4HZ6A 3ARZA 3RJYA 5IHSA 1QOXA 4N0RA 3VMOA 4XZWA 2FH6A 4RE3A 1NQ6A 3BCDA 1E73M 3BH4A 4N42A 4PTWA 1UKOA 2DSKA 3BVTA 5IXEA 3F4VA 2WMFA 3ARSA 2DT0A 2AAAA 2YA2A 5IFPA 3SIMA 3BAKA 3EJQA 1G1YA 2XHYA 2YDQA 2Y8KA 3TOPA 2BV9A 2BY2A 2O9RA 3U57A 1GJUA 1SFSA 1US3A 3OIHA 5HXMA 3L4XA 5I78A 2GVYA 4QCEA 1GUVA 4P7NA 2WBGA 3AMKA 4NX0A 3AFBA 1S46A 3AZRA 4L4PA 2A3EA 3BAWA 1LJYA 2F7RA 1ITXA 1NOFA 1G0CA 2BNJA 3AMCA 1ZJAA 3N1AA 1GQJA 3AS1A 3F5KA 3QGVA 3M07A 3HMCA 3A23A 2VRJA 3FY1A 1IZKA 2JIWA 1XH2A 2PBOA 4D6EA 5M03A 3AIWA 1NWTA 2OWCA 4UOZA 1RP9A 4URIA 1JZ8A 1LL6A 1VAHA 4AD2A 2X1IA 1W32A 1GONA 1UD8A 3VD5A 3IANA 2F7OA 4L4OA 4X0VA 4PSPA 2ZUTA 1MW2A 4D6JA 1E71M 3OLDA 2PB1A 4W7VA 2Y8VA 3IK2A 3U7VA 5A6BA 1CIUA 3BVXA 3SCPA 3WNPA 3DX1A 3U7BA 2QHAA 3GZAA 5E6YA 1DWAM 4AD5A 3RMEA 4BQ3A 1R7OA 2VZSA 3TTSA 4HA3A 5BXRA 4WKAA 1E3ZA 3W38A 3EJUA 2QPSA 2ZX7A 4FMVA 2DH3A 2WVTA 1UH2A 3WD2A 2ZX6A 1JGIA 2OSWA 3ARRA 3AXIA 2DIEA 3T09A 2QLYA 1GOMA 2YIHA 1SMAA 3CUIA 1KB3A 1QBAA 1XGZA 3DYPA 4H8HA 4S3KA 5AY7A 4AEEA 1IZJA 4WJXA 4QAWA 3WQ5A 2VX4A 5LA1A 1H11A 1C8YA 3U5YA 3VTRA 1GQIA 2J7FA 1JZ4A 1FOBA 2V5CA 5KEZA 1QBBA 1V3JA 5AC5A 4WIWA 4B16A 4JKKA 3TV8A 3BVUA 1UUQA 3PTKA 4TVCA 5E9AA 4TXEA 4QLJA 5D9PA 3N04A 2ZIDA 3ARXA 3TP4A 1HJSA 6A3HA 2RGLA 3VD3A 3WDPP 4OUEA 1PS3A 3OA5A 3LXAA 3AHVA 4LXFA 5HPCA 3WBAA 4MTVA 1WCGA 3WEMA 1UD6A 1ECEA 2G3IA 1JI1A 2DSUA 1U30A 3KEHA 4JL1A 2IXVA 4WKFA 1JZ2A 4KH2A 3PZTA 4PMYA 2DSZA 3PZQA 1BYCA 1XV8A 2WWDA 4AD1A 1Q4NX 2XVPA 4ZXLA 1LWJA 1W9XA 1OIMA 3F5JA 1GQKA 1WZLA 1OD0A 3ARVA 1UZ4A 1BYAA 4TX6A 2IXUA 3L2LA 3PZUA 3DHPA 5GNYA 1UR0A 2UY5A 4JIEA 6TAAA 5GNXA 3GM8A 4EAMA 3S5ZA 3RO8A 3GBDA 3WNMA 1VRXA 3BUQA 2O9TA 5BRPA 1QI0A 3MUZ1 3VSVA 3SCSA 5A1AA 3T2OA 1VFMA 1C8XA 4UTFA 1D3CA 2WVVB 3K46A 4ACZB 1BTCA 5A94A 4HZ8A 2ZXAA 3WNNA 1PX4A 3APGA 3PZGA 3O6AA 2UY4A 4W8AA 1B3ZA 3AQUA 1A47A 3HU7A 3CV5A 5CZKA 5E09A 1XC6A 1JDAA 5A6SA 4C7DA 1DWJM 4PBGA 5LA0A 1O6IA 3E1F1 1HJXA 2CETA 5DEZA 3VIOA 1EDTA 2FDMA 2PI6A 4ZE5A 4Q7NA 4GQQA 4MPKA 1QHZA 4XX6A 4AZCB 3MI6A 3QHNA 1XRVA 2Z1KA 2DH2A 4RL3A 4DO4A 1EOMA 2OWWA 1E4LA 1CGTA 4HMCA 4JHOA 2CYGA 3CPUA 5I23A 4JKLA 1QNQA 4LYRA 3ZOAA 1BPLB 2JEPA 4HOXA 3CHCA 4PTMA 1OWQA 1E6NA 4NZFA 4XZBA 1JNDA 1QW8A 1UWSA 2WHLA 2WVSA 4IISA 2WLYA 5GNZA 3BVWA 4UFHA 2EJ1A 3AHZA 3VGGA 1WZMA 4NZJA 2X8RA 3T0AA 4W88A 3CZGA 1V3LA 1BG4A 4D6HA 5A6KA 4QFUA 3K8KA 4ZENA 1VF8A 1MYRA 2EO7A 1QW9A 3VINA 4GKLA 4AY1A 4F79A 3OZPA 4ZEPA 3AICA 5BXPA 4B9YA 4YHEA 3WD0A 1EO5A 3ARWA 1VB9A 2B31A 1TQSA 1MW3A 3CUGA 2CNCA 5AC4A 1WAWA 3A4XA 1CNVA 2D3LA 4FNSA 5I5RA 7CGTA 1E4IA 1B3YA 2Y4SA 4J3SA 4OBSA 2XN0A 2WBKA 1XSKA 1PX3A 1TVPA 3W25A 3WD3A 4MNMA 1XCWA 2VOTA 4IUGA 4NXKA 3WQ4A 3BLKA 4AWEA 2Y2WA 2V3FA 4UOJA 3DX0A 3MS8A 4X0NA 4E2OA 1KR1A 4K68A 3BAJA 2XUCA 1WB0A 1NARA 7TAAA 3GH7A 2JFEX 1E4MM 3ZQ9A 2ALWA 1UWRA 3MUY1 3GXTA 1F4HA 1OT2A 2J62A 1CPUA 4QDMA 2WCAA 2OYMA 3MV11 3CUJA 3ZR6A 4JKMA 4MAVA 3DC0A 1NOWA 3WY4A 2F8QA 2W4XA 1B0IA 4P8VA 3DX2A 5CGMA 2O9PA 3NJ3A 4E4PA 3LRKA 3AZSA 1Q6EA 3W4RA 1M53A 2VCCA 3CLWA 3L4WA 2W67A 3LXCA 1V3IA 2CHNA 1OBAA 1GNXA 5EBAA 3BUPA 3AYRA 5A2AA 4V2XA 1H41A 3GXIA 5A6JA 4FF5A 3WNKA 1G01A 1AQ0A 1NWRA 1DWGM 4H41A 1KQZA 1UR9A 2V38A 4P7LA 4H2CA 4CGTA 3AISA 1TE1A 3BSHA 3SURA 4JFSA 4AZIA 2CERA 5ABHA 2NT1A 3AMGA 3L2MA 4AZ5A 3VPLA 5A3HA 1XSJA 1W1PA 1E0XA 4Z2HA 3WH6A 4NI3A 1UQZA 1HP5A 2E9LA 3AS3A 4HP5A 1JNEA 1UWTA 3I3DA 4H8UA 4EE9A 3THDA 4W93A 5FL0A 1H0IA 1X6LA 3GXNA 1W3KA 4QLKA 3VM5A 3ALFA 1UHVA 2J8GA 3QOMA 1UWIA 5KZ6A 1KXTA 2G8ZA 4AMWA 2XIIA 2VCBA 3CIVA 1B31A 4CCCA 1DWIM 2YL9A 5E0FA 2Z1SA 1GZJA 4PMNA 1M7XA 2VQTA 3N17A 4MJ4A 3AS2A 4MB4A 4V28A 3MUIA 2J78A 1ZL1A 5A8MA 2UY3A 5I6SA 3WUBA 3WDIA 5D8WA 3G6LA 5JIWA 2JALA 4J3WA 2FGLA 1UOKA 1EQCA 1WZAA 3KLKA 3J7HA 4W5UA 1GCYA 1LWHA 4CN4A 1PEZA 3HG4A 4TTUA 2WPGA 2F7QA 1K9DA 4M8UA 3EBVA 3DYMA 1QI3A 2J7DA 1UH4A 1CZ1A 4KRTA 1MWOA 2J75A 1F4AA 4JCLA 3AYSA 3GTNA 3WDQA 1V02A 2VQUA 3QHMA 1N82A 2JF7A 1WDPA 1GOWA 3HG2A 3GNOA 3K8LA 1NP0A 1E72M 1HVXA 3PZVA 2GJXA 2ZUVA 3RM4A 2EAEA 4PMRA 2E9BA 4FNRA 1E6PA 3B9DA 2NW0A 1CXFA 1V0LA 3WMSA 2PWEA 5AYBA 2C0HA 2JEQA 3WNLA 4A3HA 1ODUA 4D1JA 1H0GA 5ABFB 1J9YA 1EQPA 1WE5A 4GXPA 1NM9A 4JL2A 5E70A 1VENA 3WH7A 3B8SA 4W8BA 4MB3A 4BS0A 2EPOA 4TOQA 1VEPA 1BFNA 4HZ7A 3QHOA 3VDAA 2C8NA 2OYKA 2XVNA 3IJ9A 4MDPA 4B15A 1FFRA 2V3GA 3WMBA 4GINA 3UG4A 2DSWA 3FAXA 2EPMX 4AEFA 2CCRA 4JZ5A 1CDGA 2D23A 2ESCA 3CHDA 2J7EA 2WHMA 1OINA 1JL8A 1J0HA 1MVYA 4U33A 4NSBA 1NH6A 1QWNA 3SUUA 1M03A 4HU0A 3WMCA 3VDHA 1TMQA 4AD3A 1VBUA 2YDSA 2XJ7A 4HA1A 4U3AA 2XPKA 3MSDA 2FHCA 3AI0A 5DO8A 3CZSA 1J0IA 1HWWA 5CXPA 1OB0A 2DQXA 2DEPA 1JAEA 3VILA 4ACZA 1OSEA 3NSNA 4H7VA 1QNOA 5E1QA 2X2IA 4Q22A 3A5VA 3WDJA 5A2CA 1BVZA 3AS0A 2EABA 1CWYA 4MNKA 1KBKA 5JBFA 1TZ7A 5CLTA 4JFTA 2VJXA 1JYXA 5CSUA 3BUIA 2WANA 4ACYA 2XN2A 2WMJA 1TFVA 3JUGA 4GPNA 4B3KA 4NZCA 5JIPA 3LRLA 1K9EA 3FHAA 2XIBA 4UQAA 5CQ1A 2DPEA 3PBGA 1BYBA 3WQWA 1GJWA 1B30A 1EDQA 1V6XA 3VIHA 4GO8A 2YKKA 3W6LA 4LYPA 4PMXA 1UG6A 4P7RA 4CD6A 1FH7A 4MJ2A 1W1VA 1V6WA 2FE0A 2D73A 4FK9A 4KWUA 2ZE0A 3QOKA 5BWFA 5CPTA 3WSUA 1HL8A 2WZIA 3OB8A 1UQYA 1E4NA 3NCOA 4BQ2A 3LPFA 1SZNA 3MMWA 4PMVA 2W63A 3L4TA 3VU2A 3PZ9A 1EXPA 1U33A 7A3HA 3ZR5A 4PMQA 4FNUA 1YHTA 6CGTA 2EXOA 1UR4A 1W9PA 5M17A 3BLPX 1GW1A 4OOUA 4FLQA 1LQ0A 2XN1A 4U3CA 4F9JA 1I1XA 1ZBKA 4HOWA 3ZJ6A 2OW7A 3EMCA 4PN2A 5I0DA 2D0FA 4S3JA 2VC9A 5C70A 1QI4A 1CXHA 3FXYA 3OG2A 2PBGA 1JD9A 3CZNA 5I24A 3N9KA 2GK1B 2VI0A 2DT1A 1GQLA 3ZT6A 2A3CA 3W81A 3BMVA 2EPKX 3VGHA 4W89A 1UD3A 1W2PA 4AD4A 3B9AA 1BGGA 2F1AA 1VIWA 3POCA 3WUGA 3GXFA 4BQ4A 1EHNA 2PWHA 2A3HA 2X2YA 3K4DA 4ATLA 1JZ3A 4YN5A 1E6SM 3WEOA 4XB3A 1A3HA 2YBUA 5CG0A 4NRSA 1NWSA 3A4AA 1JYVA 4LYQA 4M82A 2W62A 4CN6A 3AHTA 3WNOA 1E56A 4KGJA 2XSAA 4CD8A 4AIUA 4AZHA 3AMDA 1HL9A 4AC1X 2YL6A 2XVGA 3A6OA 2VX6A 3DX3A 3UEQA 1E6RA 2G3MA 1B9ZA 4HPHA 3WD4A 4BCEA 1VJZA 3EMZA 1JAKA 1UKSA 3UG5A 2Y24A 2E40A 4YPJA 2QMJA 3ZM8A 1QNPA 1WNOA 1JZ7A 4D72A 4P8UA 2WAGA 1B3VA 3KL5A 4CU8A 3GH5A 2BHUA 3WIJA 4M80A 2WNWA 4AYGA 1UD5A 3OLGA 4PMUA 2WKGA 1QNSA 4F66A 1OCQA 2YJQA 3VNYA 1E1FA 4DWSB 3DHUA 4B3LA 1OIFA 2GFTA 3BUBA 1US2A 1P6WA 1JD7A 3L4YA 2J4GA 2ZXQA 1JXJA 3ZT7A 4PTVA 4W7WA 1L0PA 4IPNB 2YA1A 3AIBA 3VSTA 2WMGA 2F1BA 3CMJA 2G3NA 5D9MA 2WKLA 1R34A 1BVNP 3RIKA 3FNDA 1LL4A 4AYSA 2EBNA 1HP4A 1R46A 4CD5A 1JDCA 3WF0A 2Q8XA 1H09A 3BC9A 1HIZA 2W61A 4CN1A 3PZNA 2FHFA 3IJ8A 3CHFA 2OW6A 4CU6A 5I77A 1CGVA 2HISA 1R7AA 2WW5A 3F5LA 4JFVA 2X2HA 3IAQA 3VX0A 1C7SA 2OSXA 4MB5A 2ZX8A 3CC1A 3O2LA 1V6UA 4M1RA 2CBUA 4W5ZA 5M5DA 1C8QA 3WH5A 2YLAA 4J27A 3EJRA 3EDDA 2WCGA 5CJ5A 2X05A 4V27A 1GOIA 3WDHA 5JUVA 1CXEA 5A6AA 1KGWA 2RGMA 5EMYA 3NDZA 5F7UA 1E6ZA 1IV8A 3KLLA 3SCOA 1WP6A 1E6QM 1GOOA 3FN9A 2PWDA 4D6FA 2EPNA 4UFJA 3K1DA 2WHJA 1EHAA 3TTQA 2XM1A 1HN1A 3MSGA 4Z2GA 2HVMA 1R75A 3B9EA 1KCKA 4YHGA 3KL3A 3POHA 1JFHA 1LG2A 3VGBA 3SEPA 3N18A 2CPUA 3O9NA 3GXDA 2F61A 2C7FA 1KXHA 5BXSA 4LGXA 1XD1A 1HJUA 4D6IA 1UKTA 2NT0A 3AXXA 3AROA 3W82A 5BRQA 4A4AA 1DHKA 2CITA 3NUKA 4DO5A 3RCNA 2IGTA 1RH9A 4OGZA 1H49A 1RPKA 1BYDA 2GJRA 1W3HA 3TTYA 1UH3A 4LPCA 1EA9C 2W91A 3AIUA 4UZUA 1VFFA 2VZOA 1JG9A 1HJWA 1HNYA 1J0JA 3GNRA 1JF6A 4D6DA 1PIFA 3CUFA 4OKDA 1TVNA 1ZBWA 2IUZA 3LPPA 4TVDA 1TQUA 1NOUA 1E9LA 4PEEA 1Z32X 2CEQA 3MUAA 2BVYA 1PAMA 3HG3A 1EDGA 4XUYA 3VKKA 2JIEA 3EDFA 4U31A 3LXBA 1UZ1A 3SCWA 3VGEA 2ZUUA 5A8OA 4PUEA 1E1EA 5D9NA 1X1NA 1G5AA 1B3WA 4GI9A 2WWCA 3SUSA 1QPKA 3WFLA 1TA3B 1BAGA 3KL0A 3WEZA 1O7AA 2PC8A 5D9OA 1M01A 4QP0A 1WZKA 3WDRA 2XFFA 2DGAA 4M81A 4Z2LA 3L4ZA 4RE4A 1VFOA 1UA7A 1RP8A 2E0PA 1LF1A 5D8ZA 1JXKA 2CBVA 4FLRA 1EOKA 3ARTA 3W6MA 2BFGA 4HOZA 1D2KA 3MO4A 2ZWYA 2AMGA 4H8VA 4U5KA 1D7FA 3CZLA 1C7TA 1GOQA 2D24A 3A21A 1OGSA 1HJQA 1AQMA 5TD4A 4UQDA 2VZUA 1BG9A 1HT6A 4CVWA 5CGTA 4OJYA 3RJXA 3BGAA 3NYDA 1LL7A 2J47A 3AHYA 3ALGA 1QI5A 2YFOA 3VIKA 3VO0A 1PZ2A 2YOCA 3VIGA 4CUCA 1CECA 1UR8A 1GVIA 1DP0A 2VNCA 5M3WA 1Y7VA 3AIQA 2ZX5A 3WQVA 4E8CA 1E70M 1K6AA 5ABGA 2ZUSA 2WMIB 3SCNA 1KTBA 3IAPA 4C7FA 3FHQA 4UFKA 3EJSA 3A47A 2X0YA 3D50A 3NSXA 2OLHA 1XH1A 3HZ3A 2ZX9A 4GIAA 2AOSA 3SCVA 4MNJA 5I2UA 1JZ5A 1CLVA 2WLZA 4P7QA 3MMDA 1OD8A 1KFWA 2D3NA 4MDOA 3TONA 3DECA 4JFUA 3VSUA 1E0WA 3PZMA 1CGUA 3T2QA 1M04A 4TUFA 3UCQA 3VUPA 5FL1A 1GHRA 3RM8A 2O9OA 3A24A 1MQRA 4PMDA 2BY0A 2BY1A 3UR7A 4W8LA 1B90A 1E6XM 1CENA 2WSPA 1E43A 1GVYA 3CH9A 4ZXOA 1R85A 1JYNA 3WD1A 3CZ8A 3D4YA 4HMDA 2E9MA 1PJ9A 4W87A 3GXMA 5DF0A 1HXJA 3HN3A 2XYLA 3BAYA 1UA3A 4KGLA 3WF1A 2WHKA 3WY3A 1ZS2A 1TQVA 3WH8A 3RPMA 3WQ8A 5A8NA 3L4UA 3W27A 4J3UA 4P7OA 2WYSA 3RDKA 4A3YA 3D3AA 2WMKA 3PTMA 3H54A 2WC4A 2YBTA 2X2JA 3PZOA 4AISA 2XTKA 3T08A 3THCA 4D71A 3MV01 1ITCA 3UERA 1EIBA 5FD0A 2WCSA 2CBIA 4FNQA 1ODZA 3DYOA 2WM0A 4WLCA 2J79A 4FNPA 1Q6FA 1G94A 3A3HA 3ZJKA 2D22A 5CPSA 4JCMA 1CEOA 4W84A 2VRKA 8CGTA 1R47A 3S2CA 2J7HA 4W86A 1CLXA 1BSIA 3ZSSA 3VIIA 1UWQA 3ZO9A 1C91A 2BS9A 3WELA 3MANA 2WSKA 4DUVA 3FW6A 2J25A 3CBWA 3KZSA 3N13A 3T0DA 1FH9A 4AIOA 4QLLA 3WFZA 4HMEA 4P8XA 3UESA 3OZOA 1V08A 5E0CA 3BUDA 2DDXA 4GZIA 1V6YA 3VGFA 3OLIA 1R87A 3W26A 4J3VA 1MFVA 2DSVA 2E3ZA 5HBFA 2XSBA 3LPOA 4CCEA 3CZEA 3M6DA 3D51A 2YLLA 3WL1A 3ARUA 1ZBCA 1HF6A 4PMOA 1FA2A 3BAIA 2WVVA 4J28A 2ZOXA 4CKQA 2CKSA 4UFMA 4CD7A 3W53A 4M56A 1J10A 2WXDM 4AZGA 4EKJA 1J18A 1GPFA 1K9TA 3II1A 4UQBA 4E8DA 4PMZA 2ZXBA 2ZWZA 2XVLA 1RD6A 1ESWA 3OGVA 4KRUA 4DWSA 1AMYA 1VJSA 2W5FA 5EFDA 1VBRA 1BF2A 2G3JA 4NRRA 1XSIA 3VIJA 1TQTA 3HG5A 1E40A 4PYSA 3WUEA 3WKZA 4AZCA 5DMYA 3GBEA 3VM7A 3CZJA 4AD0A 2CKRA 1FFQA 1LG1A 4UZSA 4EK7A 1JI2A 4M24A 1ISZA 1QWUA 3NDYA 2DIJA 1FP9A 2BVTA 3PTQA 4UR9A 5A6MA 1QVBA 1UWUA 1BLIA 3NIYA 1WPCA 3BLBA 4WSJA 1R8LA 5C71A 1PZ3A 3ZIZA 2EEXA 4UQCA 2XWDA 4UQ9A 1AQHA 1WDRA 4UCFA 5CSYA 1H4PA 2CBJA 2WC3A 3SCQA 4GI8A 4AZ6A 2VR4A 1E0VA 1TR1A 1J0ZA 3CHEA 3EDEA 1SR0A 3VIMA 4GI6A 4PCSA 3ARQA 3UG3A 1KWKA 1W9DM 1V3MA 2X09A 3T2PA 3OBAA 4IPLA 1H1NA 2XGBA 5FOOA 4AW7A 1H2JA 2XG9A 1J01A 2VX5A 3EJTA 1V03A 5C8BB 2ZUMA 4OIFA 4PCTA 4BF7A 4ZE4A 2YL5A 4AMCA 2J7GA 3GXPA 4PRWA 3W29A 2UY2A 3G6MA 1LLOA 1DWFM 4Z2JA 3IJ7A 3CTTA 4PSRA 2WZEA 1V6VA 3ZJ7A 3M46A 5GQBA 1NP2A 4UQEA 2D0HA 2JE8A 1DEDA 1QX1A 1WO2A 2QPUA 5CLWA 1XCXA 2VO5A 4ZFMA 2J7CA 1B2YA 2D1ZA 1B3XA 5DT5A 1C93A 1E5JA 3RM9A 1HTYA 1TQWA 2GJXB 2A3BA 3S6TA 2QV4A 1W1YA 2E4TA 3WF4A 2EADA 1XD0A 4W85A 4J7RA 1CTNA 3AOFA 1TG7A 2DT3A 1J12A 2FHBA 1V0NA 3CMGA 5CPQA 1ISWA 1ZJBA 4FNTA 9CGTA 5A8PA 1JYWA 1HX0A 3DX4A 4H04A 4CVUA 2VUYA 2D0GA 4GQRA 2VCAA 2W66A 4B9ZA 1QNRA 1FH8A 1KCLA 1OGBA 3VX1A 1DWHM 1UASA 4Z2KA 4LX4A 1R86A 2VL4A 2Y5EA 1QI2A 4UOQA 4AIEA 3CUHA 5FCZA 1J0YA 2YDRA 5BROA 5IFTA 5E6ZA 3WUFA 4JHZA 5A69A 1JZ6A 3WF2A 3SUVA 3VIFA 1ZU8A 1CXLA 3AZTA 2W92A 2UWFA 4PTXA 2ZUWA 1W91A 3LMYA 1TA3A 2FH8A 4NXSA 4F9DA 4J3XA 3EYPA 2PWGA 3KWXA 2BY3A 4Y7EA 1U2YA 1HKMA 3SCTA 4EANA 2VR5A 3U5UA 3H55A 3VIPA 5I3DA 1KQYA 4KMQA 2D2OA 1KXQA 1BGAA 5BYWA 1W9BM 2YFNA 4D6CA 4HU8A 4C7GA 1W3LA 5LA2A 1KBBA 3VMNA 1HJVA 3ZMRA 4JAWA 1JDDA 2QF8A 1FP8A 3LPGA 1FHDA 4CCDA 4F8XA 1HXKA 4WKHA 4AXNA 1O7DC 1X6NA 4AZBA 3VVGA 5HOSA 2QMKA 3AIRA 5I79A 4DWSC 1IT0A 3D4ZA 1L8NA 4DWSD 1MQPA 1T0OA 5HPOA 4QCFA 3GH4A 1GOKA 2EACA 1MXDA 1C3FA 1ISVA 4JFWA 5IDIA 3GYCA 4ATWA 3VD7A 2YL8A 2WMIA 3EMQA 1W9UA 1PPIA 1UYQA 4D1IA 2GUYA 2D20A 1OT1A 2G4FA 3I3EA 3ZT5A 3SUWA 3W24A 1JFXA 5A6BD 1YQ2A 4MAZA 3WY2A 3CZKA 1HVQA 5JBEA 3UR8A 2BHYA 2EPLX 3N11A 3VNZA 4DUXA 5FKYA 3L4VA 2VVNA 1C92A 2BXZA 2V3EA 2XM2A 4FLSA 1UD2A 5DT7A 1SMDA 3BVVA 1G9HA 2ZICA 5D4YA 2ZUNA 3BSGA 2FYVA 2MANA 1BHGA 1WKYA 4MB1A 3EJPA 3VMPA 2EQDA 3ARYA 5FIPA 5LYRA 1XHGA 3WF3A 3DDFA 3I3BA 1BQCA 1HKIA 5BCAA 1E5NA 5EFFA 2V3DA 2F2HA 3ZSTA 3AHXA 3A4WA 2WK2A 5GPRA 1I75A 2GJPA 4GZJA 1CYGA 1H5VA 1GHSA 2VRQA 5DFAA 4TVUA 3OGSA 4DM1A 2X0HA 4XV0A 4W7UA 3N15A 2WMHA 2GDVA 2VT0A 3GNPA 1CXIA 1PBGA 4D6GA 2FGZA 3AJ7A 3CGTA 2XGIA 3H53A 1TCMA 4U2YA 1ISYA 5ABFA 1KR0A 2BHZA 1ZB5A 3ZJ8A 4TTGA 2VX7A 2WC7A 4RE2A 3W37A 2VZVA 5BXTA 3WY1A 1EGZA 2TAAA 2J8FA 3MMUA 1H3GA 4M29A 1B1YA 2E8ZA 3EDJA 1ISXA 2VZTA 4BQ5A 2BVDA 1J11A 1UD4A 1E3XA 2XFYA 1CXKA 3SUTA 3OGRA 1UR1A 1XYZA 1J0KA 4R27A 4OOZA 3WL0A 4DO6A 4UFIA 1XH0A 1CGWA 4CU7A 2GSJA 1CBGA 4R5EA 1PIGA 1SYTA 1PX8A 3BAXA 3SCUA 5A8QA 1KTCA 2WZHA 3RILA 4IM4A 1R33A 2WB5A 3MKKA 5ECUA 2OSYA 4X9YA 1UKPA 4CD4A 4DM2A 1Q6GA 3IGUA 2GDUA 3MU7A 3K8MA 3OLEA 5A6LA 3WQ6A 3BCFA 3PN8A 4HA4A 4OZOA 1GORA 2OWXA 4WK9A 3UETA 3WBEA 1Q6DA 2J74A 1VFUA 2WVUA 1V3HA 2V5DA 3ECQA 3GDBA 5A95A 3WENA 3NSMA 3AXHA 1E55A 2J77A 1I1WA 2CXGA 1HKJA 2PF0A 5EB8A 1FHLA 1KGUA 3AMLA 1NWUA 4OBRA 1K9FA 3K4AA 3D52A 2F18A 3SCRA 4TX8A 1UKQA 3PZIA 3S5YA 2VTFA 3WH9A 1MW0A 1HKKA 2DT2A 2CIPA 1C90A 3W0KA 2OYLA 1KWGA 2VVSA 4U2ZA 3TA9A 2JF6A 2O92A 2A3AA 1MFUA 5AYIA 2XWEA 5JBDA 1CGXA 4J3TA 1OGGA 3VDBA 3AIEA 3EDKA 1OM0A 3ARPA 4BA0A 1MXGA 5IHRA 1ZBVA 8A3HA 2VMFA 4NF7A 1QHPA 4ATDA 2CESA 3FAWA 4MNLA 1CGYA 2E8YA 3KE0A 1V3KA 1MQQA 3N12A 2VURA 2G41A 5HNNA 4AZ7A 3D5HA 3CO4A 3M7SA 2XVKA 3VOCA 4GO9A 4WSKA 1W1TA 4GZEA 1QHOA 3TTOA 4WF7A 3VD4A 2XFRA 5ABEA 5A2BA 3WN6A 4DUWA 1TUXA 2PWFA 1W2VA 1W3JA 1W9VA 4MADA 1V0MA 3HJEA 1Q6CA 3LX9A 4PUDA 3BMWA 2F7PA 4U5IA 4FLOA 1EO7A 1E15A 2BXYA 1XYFA 3BXWA 4ML4A 3DDGA 3A22A 1VEOA 3T0BA 2GK1A 4Z2IA 4BZYA 2NSXA 4HPGA 3LRMA 1UR2A 1DTUA 3VGDA 1WDQA 2YA0A 4UFLA 3QR3A 1AVAA 4AMXA 3VD9A
chains in the Genus database with same CATH superfamily
5ICXA 3CFCL 3V6OA 4HX1B 2C9UA 4XBSA 3B3BA 4PG9A 1WBJA 3TZVB 4LPVA 1AW1A 4QIUA 2YUZA 4GYKA 1FPTL 1GGBH 1RQEA 5I1EH 3EGXB 4NYLA 1VCVA 4U0RB 3ARSA 1NELA 3N1PC 4E68A 4HIHB 2RTTA 4MAUL 5EF1A 3G6JA 2J55A 3RUGA 4C57C 4Y5VB 3X11B 4J2MA 1R3WA 4Z3JA 1SFJA 2HPIA 1G0CA 2QEZA 4CMHB 1GQJA 4O51A 2NY6D 1CFVH 2IDUA 4BA8A 5M03A 1L9SA 2ERJB 1TVBA 2R82A 2OWCA 4JAMA 4K9JA 3TAKA 1ITUA 5BZAA 2X1IA 3Q6GH 3GC2A 3UP1A 4FABH 2ADAA 3BWAA 3WQDA 3CEUA 3V1HA 1M1SA 1U2CA 4XP9L 3PVFA 1F5ZA 2NY0C 3U7VA 3BWUC 3IK2A 5K9CA 1KTJA 1LT8A 5K2ZA 5IV2A 3RMEA 4ZX6A 3V9EA 4F27A 5DUPL 4YHPB 5EZJA 2HQAA 2YPLE 4MZIA 3G6AB 4XP6L 5IBLC 3ARRA 3BP6B 1TG8A 5HDWA 3WLTA 2A38A 3L81A 5JDJA 4L1WA 4HSNA 1MH5B 1KT2A 4I4WA 3EOBA 4PJIB 1BIIA 3LMJH 3MRCB 1BG1A 5IKCA 1LBMA 3D46A 5KANI 4PVLA 3IUDA 5EEVA 2CKBB 3TO4C 4PV9A 1WT5A 3U79A 1UC6A 1RVKA 5KETA 1GC1H 35C8L 2J7LA 4MNQE 3WDPP 4P49A 2QSTA 4MCNA 1DDHA 2DP3A 2UZIL 3CQ0A 1XF3A 2DSZA 2OV0A 1XV8A 3MT1A 4FQHB 5BRZE 1W9XA 3KHQA 4YTSA 5B4MC 1XGQB 4JPVL 5JXEA 4PLKC 2VWEC 4UTTC 1VCGA 2IXUA 3FT0A 1EZVY 2X87A 3QUYB 4G6ML 4FX7A 3A4FA 5IW6B 4PUMA 3RZCC 3E9TA 2Z3FA 2QPFA 4BFOA 4ZS6C 3O6AA 4O53A 2EDOA 1ZK5A 1TR9A 3WMLA 1N3NB 3KAOA 4XAPA 4U0QB 4YDJB 1QEWB 5A2IH 1XT5A 2F15A 4JDZB 2XWBB 5KZCD 2VDRH 4MPKA 1QHZA 4N6RA 3SOTA 1F1GA 4RMRA 1NIAA 3AM8A 5FFGA 4H40A 1M56B 2J6XA 1JNLL 2VAAA 1EOMA 2QR0A 4M8QA 4HMCA 4NC0B 1D6VH 2HV5A 4LYRA 1QSFE 5C7XH 3DVIA 2JEPA 4PTMA 3CVHH 4IISA 3O45A 4X98A 3K91A 4TRPH 1A22B 3KTSA 4GUIA 3WHXA 3K8KA 5F7DB 4RGOH 3ILQD 1IXOA 4BWTA 2ZNWA 4QGCA 4F79A 3VA8A 1LHZA 4B9YA 1XEUA 1XDJA 2B31A 3QQ0A 1MCKA 2WXOA 4TV3A 2CNCA 2IBGA 5I5RA 4IBZA 5CFHA 7CGTA 5EN2B 1XYCA 1W0VA 4MXWH 2PTTA 3H9SE 3VXSD 1IIIA 4X0NA 4TSAL 1JPGB 2CUMA 5EU3B 4ZMPA 3UIZA 3MR9A 3S1XA 3QDJB 5FO7B 1MELA 2XBZA 1CU4L 1QPQA 1U3JA 4H9YA 3MACH 2A4EA 5I74B 4YWIA 1K3UA 4PVBA 2W0UA 5I8KL 4XBGB 1RZQA 4HU3A 3NJ3A 2YC1B 3S2JA 3R4DA 2VLKB 4DAGL 4LPYA 2GQ3A 2VSCA 1OBAA 1T1WB 4LOEA 3MV8E 3GXIA 1G01A 5I1CL 3D07A 4Y5YC 3CBRA 5FR3A 3TM6A 3L3DB 3ZDXE 3CQPA 4KPLA 1QFWL 4NKDB 4O1CA 2APFA 2BNUA 4H8PA 1SZFA 2AV7B 4XMPL 4D8ZA 5E6UB 3ULUF 4Y2DC 3STPA 1MI5E 1V7YA 4IQDA 1XYBA 3W11C 3ALFA 1AJ0A 4XPBL 1ZAGA 4NQSA 4M8RA 3IIVA 3OTTA 4GKZB 4MJ4A 2YYTA 2NCMA 4YSTA 2MCMA 3DH7A 4G8TA 5C2BH 5JIWA 1OYAA 1V79A 1ZNNA 4QE4A 4HXBL 1D7CA 4K5PA 1KYUA 4Q4IA 2NUTB 1FVCB 4Z3TA 4PW9A 5MF5A 4ZT1A 4KKBC 3B8TA 2Z7UA 3PNRB 2VXSH 5AAWC 2PLKA 3L5MA 3N2CA 1KEGL 1LCOA 1Q66A 3WMQA 2ATMA 3H9SD 4JFYB 2WOBA 2KKQA 3G9VA 3DRTA 1SM9A 4UIKL 1NMBL 4QKTA 1YNYA 1IAOB 3DOSB 4IGBA 2FJKA 4A3HA 3E6FA 3UAJD 2IH1B 1L8PA 3FFCE 2X4RB 2XX0A 4DFHA 3TMQA 1XUUA 2EDXA 2V2WB 2YZ5A 1ZVNA 5BMWA 3R8GA 3IVKA 4XP4L 3VDAA 2OYKA 1C9WA 3N43B 4B15A 5B22A 4G71B 4FFYL 4K23L 4HZ1A 3UC0H 3QC3A 1FNAA 1TV3A 1KFGA 1A0QH 4A2GA 1HDMA 4A6YB 3P73A 3C2YA 3UPRA 3MCYA 3SRHA 5FW7A 3FH8A 5MERA 4AD3A 4Q9BA 4Q4MA 1J7VR 3MRMB 2H6PA 4G9FE 1PQZB 2XPKA 2QHLA 3AI0A 3NVQA 1MI5D 2DEPA 3VILA 4ACZA 1JNHB 4JB9L 5EORH 2X2IA 1R3HB 3IFOA 1BVZA 4BKLA 2NY5C 1NAMA 1XPGA 3FEMA 2WO5A 5CSUA 4HT1H 4H9ZA 1YN6B 5AZ0A 4A38A 1FZOB 3CQQA 5G1TA 1ZVYA 1TKWB 4YZWA 3O8XD 1BMZA 5F7FA 2IG2L 5FC9A 4RNFA 4R85A 3AREB 3KBSA 5HYIA 4MJ2A 3P0YH 3NQGA 1H7NA 1Z3RA 2Y7MA 2ZOOA 3KPSB 4C83B 4Y7MA 4MDIA 5DZVA 1R9FA 4YCPA 1FKXA 5GRWA 1QSEE 3HRZB 2HROA 1A14H 3IBEA 4JHAL 2H3DA 4DZAA 3TU9A 3ASWA 3AUOA 2EXOA 3BLPX 4NC2B 3TZNA 3FFOA 4FLQA 5KBDA 4NG3A 2CLRA 4P4RA 4ICMA 3TWYA 4HCRL 3IDMA 3FQNA 1LYQA 4Z8FH 1YA5A 2CBOA 3K4WA 4AF0A 5K59F 1I1AD 5CZRA 1JD9A 3CZNA 1HHKB 3W73A 2XIMA 4OLWH 3ZT6A 1T04B 2X1TA 2F1AA 5KJRH 1MLCB 3THAA 4ATLA 2E86A 1UWEH 4JO2L 3SSJA 1GAFL 1E4JA 2ID5A 4JO8A 3F2BA 4F5CE 1U92A 4BHYA 1QU4A 4EI6B 1EZWA 3F85A 1DLFH 3P9WB 3QGAC 2PLTA 1FFNB 2VX6A 4UMBA 5DMIL 4F0LA 3HKFA 1REIA 5AYZA 1UKSA 3UG5A 5E2JA 3UZWA 1AZ2A 2IH9A 5CLZA 4ORZC 3FT3A 3MJ7B 3G3DA 3DRQA 4G9FD 1JZ7A 4NZ3A 1FNSH 1P4BH 4WJEA 4DBUA 4RISL 2LLGA 3WIJA 3WXWL 2V5RA 3VAVA 4AYGA 3W00A 1XEDA 2FLBT 1BQKA 2O4QA 3VYOA 4Z1AA 2IPUG 4X7EC 1YEJH 4HJTA 3IK4A 4NQDB 1JD7A 2V68A 1DBJL 4Q9RH 5F6IB 5KVFE 4CAGA 2PGFA 1FO0H 2J8OA 1JCLA 2FB3A 1RUAL 5DY3A 3G3MA 3NGFA 4BRVA 4JFPA 1R46A 1JDCA 1TV7A 1D3HA 3TT3H 4P57B 3CHFA 4CU6A 5JW5B 4LLDB 4BFFA 3IETA 3W1LA 5C7VA 5G2HA 3UYRH 4UT9H 1X38A 3SB0A 4K7PH 1V6UA 3RTLA 2FWUA 2WWOA 4JZJB 3MRGB 4HSOA 5CJ5A 1UM6L 1XAUA 4U3SB 1GOIA 3HO8A 2G60L 4AITA 4F33A 4BZ2A 4PRPB 1PG7L 1OFQA 3VH8B 3SN0A 4YCOA 4NAEA 2CLMA 2HVMA 1ZA3B 1QKZH 5K1NA 1DZ0A 3VGBA 2Z0IA 2ZKHL 4JEGB 3D34A 5H8PA 1TZHB 1L4IA 3G1XA 5CU5A 4ODTL 1HJUA 4M7KL 2BZNA 5D1ZI 4E42A 5GXBB 2XXFA 1HINL 4O02A 2C3XA 3QY7A 3DNKA 2X3BA 1EA9C 5TDPB 2ICEB 4NRZA 4I5BA 4UU9B 3S35X 3P14A 4F8TA 3CUFA 4M7JL 1HSBA 1NOUA 3B2VL 1R9YA 3L66A 3NYZA 1PAMA 3DROA 3MO1A 5KJ7E 2WBXA 4N4YB 3QNYA 3SY6A 2QSVA 3VU1A 1KIQA 4WTXA 4RX0A 5ABZA 4GK8A 2VHLA 1QPKA 3APCA 4FXKA 3SCMB 3NVDA 2B7DT 2ZP9A 4LVBA 4P2OC 4QP0A 2QDVA 5EMLA 1HHJA 3ZYOA 1II4E 1E2ZA 3HMWL 4GUJA 1JPST 4GYBA 2Q8AL 4U5KA 5FFLA 4NPKA 3HPLB 3EXRA 1S2AA 1GZ1A 1ZAJA 2OELA 2NY5H 4AEIH 3S8FB 4OJYA 3WMPA 3DG7A 3AG1B 5HNUA 1XF0A 1TIUA 4QWWC 4QXVA 3BOVA 3VIGA 2BO0A 2GVEA 1HXYB 3W22A 2ED7A 4JTJA 2G30A 4AM0B 2X0YA 4GAAA 2DVXA 2V30A 3CVHB 4GUFA 3ELFA 3HZ3A 1T7YA 2E3VA 3QQ3A 3FU5A 2EIBA 4MXVF 4WFFE 2EVGA 4E41E 4L3EE 5XIMA 4O4WA 4KO6A 2XQ0A 5JHMA 3SDDD 1XBRA 4BINA 1WCQA 1VS1A 1PJWA 3MLXH 5B8CB 5IGXH 3O11A 2YMTA 3IFPB 1PKLA 5CZVH 3ROLB 1C29A 5I18H 3ABSA 1QAPA 3S5LB 1TZGL 4N0YH 3WF1A 1FVPA 4F8PA 1F6PA 2VXNA 1XICA 3TEZA 3F3HA 3K6SA 5C1MB 4Q6YA 2WYSA 4NNBA 4A3YA 2X2JA 2J8UB 3PV7A 3L67A 5D2LA 5B38G 1Q6FA 1BZEA 1QTSA 2NLJB 5CPSA 3TBYB 3S2CA 1KM0A 3UO1H 4G8FB 4PHXA 1E8WA 3ZSSA 3PL6D 3EOTL 1SUHA 1MFAH 4V2BA 2WY3B 1UZ6F 2ADJA 4LALA 3OSVA 4EJ1C 1F8IA 1XKYA 4JFDB 1B88A 4DBDA 3VUAA 2E3ZA 2NQLA 4L4VB 3RAJH 5GSVB 4BUHA 5DD1H 4PMEA 5GS2D 4UFMA 1AKPA 4M56A 4YNYB 3L1FA 1G9NL 2OZTA 2NY0B 4GBXA 1NLDH 3OPZH 4WEBH 3MRQB 4XE0A 3HS9A 2DV0A 2J1KA 1VJSA 2FDSA 4O5LH 2NY3D 1GSKA 4EF3A 3EJJX 2XINA 4FQJL 2BSSA 4EIBA 1IFGA 3EOOA 1UXSA 3EH5B 1LOQA 4QOKE 4TUUA 4GE8A 1PZBA 2I26N 5J1AA 3ABGA 4E41D 2XWDA 3ZHDA 1T7VA 3VWJC 4HIIA 4KTEL 1V3MA 5AG9A 3OWEA 2XGBA 3BV7A 3O41B 4UB0L 1V55B 3K4ZA 1FVEB 3O7UA 4U1NB 5EIVA 2X4UA 2M8XA 2BMKB 3HE7C 3S34H 3QHTC 5ELIA 1UB6A 3CTTA 4DKAA 2WZEA 1U5HA 1F8TL 2NY2C 3IJYB 3AYTA 3O2DA 4JTRA 4AK1A 3PWVB 3N3MA 4GYFA 2VLLB 3EFDL 4O2FA 2DMCA 1T89C 1RZJC 1X5FA 2X6UA 2DT3A 5HA7A 3P30L 1ML0A 2OULB 4TL4A 4YSRA 5C0BA 1BXCA 4W9FC 3F4NA 3I02A 1Q6LA 5KSUB 1WH0A 2BSRA 1FH8A 1UM5H 5CD5D 1IC4L 3BQ5A 3VZXA 4CMMB 1UASA 1X4ZA 5B21A 2B59A 2FQFA 2GC7C 3OB0K 1IR2A 1QLEH 1BFSA 4LLVB 3FFDB 1R2TA 5JPMC 2W38A 2W92A 2K9FB 2YKLH 1N0XL 1TELA 2BY3A 4Z76B 5EC1A 3GG1A 3S97C 4ZYKB 2J56A 2BDQA 4DYJA 2OSLA 2GPTA 1C8VA 2C3ZA 4Q8PA 3NP4A 1BGAA 2CLOA 1ONRA 4MA7H 2FZ3B 4R2GD 3EZ4A 3FLUA 4JAWA 4UZGA 4YLQT 3SDYL 1I8AA 5IVXE 1J8HB 2NXYB 2JB5H 3D4ZA 4FZ8L 2MQGA 4U7SA 1OGPA 4NAMA 1AL8A 2YL8A 2DLHA 4S1SL 5JDSA 3N40F 3W24A 1JPSL 1L6GA 2Z31C 4TQPA 4M5ZH 4MJIE 4Y1AE 4OCXL 5DJ6B 3L3HA 2V3EA 4GP4B 3S36X 5DT7A 4FA8A 3ID7A 5AW9B 3GVRA 1IGYA 1LEKA 2ZUNA 3BSGA 4GQ0A 2EZ0D 5FIPA 4RDYA 3FCSB 5CEZE 5GPRA 2ALDA 3B8WA 3OZ9H 3DV4A 4UWQB 3G1SA 5AKSA 3IDGA 4TVUA 3S37X 4DK5A 4F3HA 4LPUA 5D4QA 5KVEL 1GKOA 1NFDF 3S5OA 3L7EB 1BIHA 5IW1B 4MYPA 4CSZA 4C6FA 4ICNA 1IGJA 4WW2C 5LDSA 1ES0B 4P4KD 4AZ8B 1AIFB 4M29A 2E8ZA 3QEQA 3QSKB 3Q8CA 4JRFA 2QGBA 5C0EA 4AQEA 5C2XA 5FM5M 4OF6A 3QY8A 4N5ED 3NL6A 4N2LA 4LS2A 5AYYA 5A3ID 2W9EH 4Y5YB 4J35A 4WXZA 4MNGA 3TF7C 5C55A 2H0FA 3CN4A 3CVIL 4QRPA 4OM0L 4Y2DB 5ECUA 3RTQD 3ET9F 1NGPL 3WQ6A 1F3JB 4R9OA 1M3IA 2F8OA 1LYXA 1FO0B 2WVUA 3MRBA 4YL4A 5CN3A 3JQOB 3T4WA 3AXHA 5JHLL 2UYLB 4HUVA 1CK0H 2PF0A 4HWUA 3HUJF 1ZHLA 3SPVA 2GBVA 2JIXD 1SLUA 3SCRA 4LE8A 3WFAA 3FSAA 1F61A 2O0TA 2ORBL 5F7HA 4CNOA 1C90A 4LMQE 5FGBC 4YHNA 1HJBC 4MJID 4RNRA 2BX5A 1ACXA 2ARJB 1T41A 4LB8A 1IJ9A 1QRNB 4B50A 5HGBA 3LEYH 3P40A 4A2RA 2QVHA 5HPMA 3ES7A 2R4SL 3CO4A 1I9JH 2GUBA 2YGNA 3ZQWA 1HGYA 5ABEA 2QCEA 1Q0YL 3KWUA 4DUWA 4GAJH 1TO3A 5IQ7H 4U6TA 3FQ4A 2B4CL 5CZXD 4GEIA 4OB5L 1BVLB 4C8XA 1A8JH 3VXQA 1YYCA 1CDHA 3PGDB 3EUUA 3C09C 3TT1H 1VHPA 4HTYA 2DUAA 5D7LB 4BEQA 2VXTL 3O9WB 4H20L 4MD4A 4KXCA 1LUCB 1I60A 4DXKA 4K6AA 3D0VA 2H3NB 3ZLQC 2GW5A 4UBDD 1CZ8H 4RE3A 2Z8VC 5D4HA 4LOUD 5IFPA 4M6VA 2BV9A 2DAVA 2BY2A 4U6YB 4NGHL 3PJUA 1KZQA 1U8QB 3W3OA 1SFSA 4QY8B 1F58H 4ICXA 3W72A 1N59A 4GKNB 5DUBA 2WBGA 4A68A 2CWRA 2AS5M 1NOFA 1NBCA 2I5QA 3WFDH 3SBFA 3A23A 4JFFA 5HI3C 3LA4A 5D7IA 2HKFL 1OSYA 4Y5VC 3VGAC 1LL6A 3HZMA 1Q5MA 3O3DB 3ZZQA 1YN7A 4L4OA 4CMHC 3OLDA 3GG8A 7FABH 2WD0A 1CIUA 5MEQB 2W60A 4M62L 3SYAA 1ZWIA 2IGLA 3C5SA 1YDPA 3LERA 1NVMA 1T22B 4Z78B 1CCWB 3FYIB 5I6MA 4EUPG 1JGIA 5AAMC 4DSYA 1KGCD 4LSVL 3HZVA 1IHIA 2YIHA 5E6IA 2AGTA 2W95A 1R3IH 1R5WA 2HT2C 4DP5X 4J6RL 1KCSL 1QFWM 5SWZE 1F90L 4QEEA 3SSGA 4Z7UE 3NQMA 1T21A 5EBMA 1W8OA 3NACH 1AS8A 2BDNL 3ULVE 1JUFB 4X6CE 3QNZA 1C1EL 1IMHC 2YPVH 4DQWA 3D85B 4N9BA 5E9DB 2XU9A 3OG4B 3GFUA 3TP4A 4LCRA 1HJSA 3VD3A 2PR9A 2IALA 3NZSA 4TVPD 4RESB 2F5BL 4IBSA 1X8FA 3QXDA 4PTNA 4CC0A 2DMGA 1JI1A 4HWBA 3KRUA 2IXVA 1FNLA 4AQ8A 3ME3A 2QQQA 5ACMA 1BYCA 3PBUA 2AK4A 2YCLB 3H4GA 3P77A 1BLNA 1FRGH 1VF5C 3ANYA 4FEMA 4YAQB 3I9GL 1M9WA 5CGBA 1OM9A 3PWPB 4MNHA 1QLRA 1E2WA 1FQ9C 2PABA 3RWCA 5C9JA 3AUVA 5IZ7A 2XFXA 4AGQA 4CNIA 2EIZA 3GO2A 4JY8A 1UATA 1MF2H 3R89A 4K3EH 2POZA 2WXIA 3TBWB 3B0PA 2B7NA 2C1GA 5DO2D 1CF1A 1XGTB 2EC9T 4XB7A 4IRJA 5I76B 1XC6A 4MS8D 1O6IA 2VDNB 2E7BA 1XL9A 4Q7NA 2J2ZA 1T7XA 3BL3A 1A7RH 3SGUA 1KN4L 4F7MB 4ZX4A 4BFGA 3WBYA 4JY9A 2E47A 4QHKJ 1E27A 1URLA 1FWXA 4R7OA 1SLWA 2AXFB 2KZBA 3QB7C 2WVSA 3DGBA 3FTVA 4A2FA 4W9GC 3AVEA 4PBDA 2X8RA 1V3LA 4D6HA 5H94B 1DSFL 2ZSWB 3H2CA 3BD5A 4ZPVB 4YBLC 1S9VB 3UTPE 3WD0A 3WE1A 3U7WL 1ERNA 3RI5F 1EFXD 1R3LA 1OCRB 4FFVD 4WDXA 2X3CA 5CINL 1NJ9A 4FEZA 3RGHA 2OFJA 2PP7A 2AZUA 1TVPA 4B92A 5EO9B 3AW5A 1C12A 4AWEA 3WYRA 4LVOC 4FXFA 3QG6A 3HBPA 3LSOB 2Q8ZA 2H26B 1WB0A 4EXQA 1JF1B 4LARL 4UINH 1JHTA 1E67A 2K6YA 3O3EB 2O6DA 2Q6WA 4P3DB 4Z77B 5TAOA 1DQKA 3HFML 1QLEB 4M19A 4FR1A 4P2OB 3UWQA 3ANVA 3DGGB 5D7JA 5F1NA 3VFRB 3IEBA 3F7QA 4N3TA 3KLAB 2AC0A 4PUNA 2F54D 1BAWA 2ESVD 4X8JA 4PYGA 2CG9X 2XWJB 1QBLL 2A1WH 2V8LA 4JYEA 3MW7A 3MQIA 2R1XB 4PWFA 4KBXA 4GXUM 3G5WA 1TWIA 1AGDA 1GEQA 4QIRA 5JORA 4XO3A 3IGLA 2A0LC 5IM7A 2CO7A 1FL5B 5EEYA 4G1KA 3NCCB 3MCLL 1VFBA 5KSAC 1DYSA 2IH8A 1YMHB 1ELSA 5F93C 3GGWB 25C8L 3O0RH 3Q2LA 5DT1H 3K74B 3VE0B 5L9FA 2NY7L 4C5YA 2DEWX 1G87A 4QRAA 4OF0A 3BTNA 1NCNA 3EOEA 1WCBB 5ABTA 4DI9A 5FA3B 4HIJA 3BVDB 1RZGA 3W2UA 1E51A 3ATAA 3UTPD 5F9JB 3UBGA 3W2DL 3C5JA 3HG4A 2N7AA 4OJFH 3MRLB 3KVPA 3FB8B 1L6FA 3LSCA 3AT9A 2IPKB 5BVJA 1NGXB 4Z7VE 3FTUA 2HJKB 3BPCA 1JGEA 3TBBA 4S3FA 3ZYJA 4A7UA 3V0WL 3QAQA 3E6EA 1N82A 3L1GA 5LNWA 3HA1A 2P44B 3TE9A 1SSGA 3L1OH 1T5WB 1UZGA 1WBXA 2XIQA 1H5BA 4ODWB 4AVHA 4E36A 2VFEA 4DCQB 5BOEA 1M68A 3UXDA 4P5TD 1WWBX 3EJZC 4F2EA 1EQPA 5D2VA 4P2QB 4AEHH 4YH6A 5HMDA 1K8IB 4JFQA 4W8BA 5L6YH 1ZKAA 2WTPA 1FNGA 2XVNA 1LP9B 1TUFA 3MSYA 3S9ZA 3SGZA 3OL2A 5EF0A 1OF0A 5JW4Q 3Q2DA 1RQHA 4I2XE 5DMKB 2IFFH 3UP6A 2PDBA 5CBEA 1EJOH 4KMTH 4KITB 4NSBA 5TQ2L 3QR1A 4PIBA 1UXMA 4PV1C 5JA8B 4UAOB 1R3JA 2I9UA 2YDSA 1QFEA 5CJMA 5GS0C 1QVOA 1OZQA 1WKDA 1EHLL 1W1B1 4NERA 3PAZA 3LGGA 5C9UA 5FJPA 2D9CA 4O50A 1DJYA 4D8AA 4UTAH 5A2CA 1GYWA 4AVFA 1MHCB 3S6CA 5C2UB 3S5NA 1BD2A 2WANA 1IAKA 1U3YA 2FT7A 1K9EA 1S3RA 1XIJA 2IWKA 3VWJB 4JKWA 1V6XA 4NO2B 2ASHA 1UG6A 5HQLA 1FH7A 1LD9A 1DQUA 3NZUA 2Z4QB 4K8EA 4Q9QH 3QOKA 5BWFA 4J2XA 4GIPD 1YY9C 4N0UB 4WHTA 4KK5C 3HE7B 1NBZB 4PH8A 3RX3A 4ZUVB 1FZKB 5IF0B 3VVVA 1M7DB 2RJMA 4LVNB 2NY2B 3KVQA 4PJIF 4W68A 1GW1A 5DZJA 1H7OA 4PGEB 1PSKL 8FABA 1I1XA 1MXSA 3NOEA 5I0DA 1J96A 3B56A 2ADGA 1I82A 5HSFA 1MY7A 4G80A 1BGXL 2JK5B 1OCNA 4ZMVA 4P5UA 2WIIA 4LU5H 5DRXB 1TJ0A 1I8MB 2YBUA 2J6EH 4G42B 4JS7A 3E8UH 5JPMB 4X6DA 3TJHD 1MCFA 2O5XH 2D03H 1E6RA 3LCWA 2X1UA 4ECLA 1PL9A 1FDLH 3VI4B 2X7LA 3WIIH 3NXFA 4XHJD 3VACA 2I56A 1FUNA 2JJUA 5E1AA 4PD4K 3WTTA 2MKWA 5AAPA 4AYBA 4PMUA 1DQJB 3BSZH 1FYTA 2GJJA 2OPJA 4NIRA 4D8PA 1T1XB 3F7JA 1I8IA 4KFZC 1MDLA 3R6IA 2ZXQA 2WNGA 5AZEL 3PBYA 5KAQF 3VSTA 1M42A 3IMBA 1KTKE 1MNSA 1A53A 1UPPA 2NCEA 3QDGB 4IBQA 5AOLA 1BVNP 2B77A 2L7QA 3HNVL 2ZKMX 2Z31B 1HP4A 4KK6C 5GGSA 1E9YB 2WZ0A 4UANA 3VKCA 3UAEA 2B16A 3GMMB 1S5WA 2Q20A 2UV8G 3NPUA 3LH8A 4JQVA 5L7XL 2WCGA 5JUVA 4NQXA 3OAZH 1DVZA 3MA7A 4HGWB 2JQAA 2E77A 4Y89A 1UWAA 3QYCA 3S96B 5EDXA 2CIKB 3IRCA 4IMLB 4FX5A 2VXUH 3D08A 4C6NA 3MMTA 4DP6X 5IROC 1V93A 1WV7T 3FGCB 3V0AC 1VFLA 4WW2B 2AJZA 1EC7A 4EAEA 2RFXA 2W91A 1VPQA 1KLFA 1FLRH 1HNYA 3OC8A 5AL0A 1MCJA 5E2TH 5BMXA 1GC1C 5DS2A 4BGLA 4ZOEA 2IUZA 2BS8A 4N22A 2NZIA 1VPOL 5IVOA 2BERA 3VGEA 4FQIH 1GYUA 4JDEB 4IPJA 1HC1A 1B3WA 1BFOB 3KBHE 3X1GA 1J9RA 4NZRH 1I8LA 2H1PH 1A9BB 3NCFB 1ZLWK 3WU1A 1DKWA 1HNFA 3KRZA 3MDWA 2R29H 1DO6A 1CICD 2BJML 1OARL 1QW7A 3W87A 2WWKT 5GS0H 4PBVC 3GRIA 3ZDYE 1DVTA 5KG9B 1RZFH 2NYYC 3A21A 1A5BA 4LAOA 4UQDA 3UJEA 4DZBA 1HG3A 3ITGA 1CBJA 3CFNA 4PJ8B 4UF7C 5ICZA 3AIQA 4NNPH 1VGKA 5FYKH 1XX9C 5ABGA 4ZOAA 4UMSA 1NUDA 2I9LB 5CF3A 4QYOB 3FO0L 5EKYA 3MBWA 4S1DD 1M7PA 2F68X 2PCFA 3W7MA 3B7SA 4HUWA 4L4JA 2HT3D 4XNYL 4FXGB 3CQHA 4FERA 1BM3H 1TYGA 4HKZA 4WDTA 1M7UA 5FL1A 3KAAA 5HMFA 4MFEA 1DJZA 3QUKB 4H8WL 5IT2L 1ICTA 5TE7H 4QNEA 1KUMA 1GVYA 1HHGA 2YYUA 2J1ZA 3IXTB 4OTKA 3C09B 5ANMB 4TQ8A 4N1EA 3WQ8A 2YCIX 5CZTA 4WWNA 2WC4A 2CIIA 3ZTEA 4HFWB 3T08A 3THCA 1UB5B 3T65B 4I77L 3ZKMD 3NZHH 3R58A 1WFTA 3QCTL 4BWUA 4WUKH 4MDJA 4HNTA 3OKKA 2VRKA 3X13A 1R47A 3VIIA 2H4EA 5HD8D 3MNZA 4L5FL 3RJOA 2WSKA 1GGYA 5AFAA 4H88H 3NSJA 5A43C 3N43F 1INDL 1Y6MR 4HUXA 3T6CA 3T7VA 1K8DB 1SSDA 4JNYA 4RDVA 2OCCB 1UC5A 1JGDB 2Q0ZX 4XXCA 3VGAB 3PHQB 1BXBA 3L6FB 1HF6A 2DLTA 3SPHA 4DVBA 4XNBA 3II1A 4N26A 2AQSA 3MJ9H 5ENWA 2ZWZA 3OGVA 3RHWF 3VRJA 2LABA 2W9DH 2W5FA 3AT8A 3DBXA 3QWRA 1GZPA 1BF2A 4M7ZC 3MRFB 1PYWA 1XSIA 4Y4KA 1QFWI 1GGCH 2BNQB 5T5NF 1AMXA 3MGOB 1FFQA 2VDGA 3PUGA 4ZO8A 3QRFM 3NIYA 1WPCA 3VFPA 2ISSA 2EEXA 4UQ9A 4MAYA 2XETA 2Q3XA 1I9IH 4MRBA 3O6KL 3MUGB 4AZ6A 1XXDC 2NX5D 3V18A 3UG3A 1DVJA 4JCWA 1XGEA 1H1NA 3DFYA 4P5KA 3SO7A 4Y5XA 4EUPA 1OP3H 4IL2A 4KPHH 1UOWA 4ANVA 3PWUA 4CBZA 3SOBH 5GHWL 2WV8A 3IGXA 4PUBH 1DCLA 1XCXA 1OYCA 1B2YA 4PJHB 1C93A 6REQA 1TQWA 3S6TA 4F57L 1G6VK 3FB6B 3TCXA 2FHBA 1JR1A 1PWMA 5ID0B 2BPBA 2QEJA 4I48B 5GS1C 4M5TA 4CVUA 3WK1A 3VXSE 1KMGA 4HK0A 2Y5EA 2G4GA 2G0KA 4R7LA 4KJYB 5FYLH 1H7XA 3OX8A 3SE9L 1JRHL 4XWGH 5K9QI 1U5JA 2XQYG 4K07A 4JE4B 5J04A 3S9IA 2PWGA 2P88A 1MHPL 1Z3GH 5E1HB 3ARBB 1HKMA 3BOFA 3GSUB 4TR9A 1WXZA 2E7FA 5JXAH 2DWEA 1UBSA 1S2WA 1GZHC 3ZMRA 1UJTA 3HB3C 2VGBA 5BVPL 3MZTA 4XPAL 4QTHA 5F7AA 2X6CA 2AV1A 2FGWL 5I7GA 4HIBA 1PLAA 4GUQA 5D96C 2EIEA 3GJEB 3PJWA 3F5WB 3O4LA 3SKNB 3IDIA 3PIQA 2NXYC 4YBLB 5A6BD 4OFPA 3H7BB 4AL8L 3MBXH 1QFPA 3N85H 2CA3A 1FWCC 1F6LL 4N87A 4L4MA 2Y1VA 5IMLB 3WF3A 1A4KB 4NQCB 1BQCA 3ZSTA 1N7MH 4LVOB 1I75A 4XBKA 1P1ZA 2E9WA 2JCCE 4LNVA 2CSPA 2ZNXA 1XM3A 1JGUL 4NCC1 2E6FA 3O6MH 2J3SA 4EQ3A 1VACA 3GNPA 2A9MH 5IG7B 4ZFFB 1QJWA 2BOCB 1YEEL 5ABFA 3W57A 1U8KB 4HS6B 1FC1A 1SJHA 4NB7A 2WC7A 3SPJA 3MX0B 4NP9A 3UPMA 1H3GA 5EBUA 1ISXA 2HUHA 1CXKA 3DURA 2FMOA 4CA4A 4MQSB 3T3PB 2ZA2A 4LUIA 3KPPB 4L2YA 4KI5D 4I0KA 5TGBB 2YD8A 5GGVY 4I0PC 1BVOA 1E7UA 5CGYD 2Y5TA 5DD6B 2ZADA 4HNNA 1AOZA 4HS8H 4X0KB 2FNBA 4EOWL 4QXTA 1BQLL 5KSAB 4XNXH 2G3FA 1EJSC 3HMXH 1OAXH 3ZZSA 4K37A 2XXGA 3IU4H 4NQTA 1IQWL 1E55A 3UWVA 4QSHA 3D48R 5CBAB 3SBRA 5IOKA 3FSUA 2Q1EA 4WWKA 1AHWC 4UV4H 2O5YL 3CV6A 2OMBA 1SY6A 4U2ZA 3LS4H 4QTIH 3TYUA 5AC7A 3VDBA 2X2GA 1TQCB 1OM0A 5I07A 4C5ZA 3LBMA 2D4DA 3U2JA 4XIAA 2F6AA 1E4HA 2DZPA 4FIQA 4NYUA 4R26L 3E80A 3F7YB 1F13A 3N12A 4JRXB 2EYRB 2XZQH 4NQVA 3KJ4C 3OJGA 2QHRH 2UXVA 1NICA 1A4JB 1W2VA 3HJEA 5SX5H 3DDGA 2Y2TA 3GSWB 1THCA 1NCDL 3TSDA 5IB2A 2J8UF 1F2JA 4AQAA 4M7LT 3PCYA 3CFJA 3AU1A 2DVUA 3QNXA 4WNQA 5T3ZL 2QJGA 1VEMA 4P8WA 1JIBA 1TYRA 2VCOA 5IHSA 3VC5A 3BCDA 3RU8H 4PTWA 4L8BA 1B4KA 3F4VA 2NNAA 1VQTA 2OTDA 1E8ZA 3SIMA 1NC2A 3O9WC 2YDQA 1DUYB 1US0A 1T6VN 3E2RA 4ZDHB 4L1SA 4ADTA 3ECUA 3CYVA 4DHGA 3RL1A 4P7NA 1KG0B 5DD5H 4GWEA 3U25A 1PZ5A 4U1JB 5HGHA 4EXAA 5T1KA 4K38A 4XO8A 1VKXB 1EZVX 4X4KA 2FQGA 4BZ1A 3EO0A 3BWUF 4IKKA 2KYIA 3VD5A 2R69H 3Q6FA 3K5XA 2CR3A 4R7JA 1JK8A 2OT1A 1USQA 2HKHL 4MHHG 1OB1B 2VDQL 1TCRA 2INEA 2J88A 4UDUB 5E6YA 2WZPD 1AI1H 2FPYA 3TTSA 4Y9BA 1XB3A 2QPSA 1UH2A 1ZT4A 2R2BB 2NVAA 3WLNA 1CN4A 1CO1A 1KJ2B 1Z0MA 3QZMA 1XGZA 2HVNA 1AGEA 4XNDA 1IC5H 4L37B 2JH2A 2DL9A 4PP2B 2HVBA 1H3PH 3X14A 3NQFA 3U5YA 3DOHA 1WAPA 5FF6B 2VLRD 4JRWA 2VQ1A 3Q8AA 4JKKA 4PJEB 4O58L 4QT5B 4L6HA 2NY1C 3C08H 3ZE2E 1F4WH 3UEZA 3T04D 4TXEA 1U8IB 1KLGB 4XVUC 4G9DB 2ZIDA 6A3HA 3QUXA 3JZEA 4IJ3B 1MRDH 1TQXA 3Q5TA 4LLMA 4A63A 1WCGA 4JTKA 1XGUA 3ZKXC 4DT2A 4MFDA 3Q2NA 1N8OE 3DGCR 3BRDA 3O2WL 1LWJA 4MTMA 4XMKH 5EU7E 1FORH 3ZTJH 5BV7H 3VQ2C 1YBQA 2VXVL 5GNYA 1VYRA 4MWAC 1P7TB 3S47A 2EYSB 5ESVB 1DIEA 2APTA 3VFWA 3BUQA 3M5ZA 4JX5A 5BRPA 1DQDL 4QKXB 4BKSC 4F15C 4MHBA 1QI0A 2ODIA 3MUZ1 3EH3B 1UBPC 4K36A 4JQIH 4NQED 3AXLA 3APGA 5DZAA 3H2EA 4FI8A 4JIPA 1FFOB 1NDTA 3KEDA 1RZ8A 3LKOB 3GNNA 5FCUH 4RR4A 4G6CA 3P2VA 2VDKH 2DYPB 1JWMB 2RACA 3HUJA 3FUHA 4G7YL 4NQ1A 3GI8L 1V7NH 3MWCA 1SY6L 2CYGA 2OXHB 3LH9A 2NW3A 3CPUA 4FQQA 1FN4B 4WDUA 4GRMA 4XP1H 4HOXA 5F7NC 4P04A 3GDCA 1XF5A 4URKA 4M8VA 1SNRA 3QFDA 4XNMA 3SGEH 3IGSA 3T0AA 4YHOH 2FECL 4QRFA 4DJEA 2DTML 1BDYA 1QW9A 3VINA 3LNIA 4RZ6A 1EEYB 4OKVB 1C9SA 4XVOA 2FEEL 1BWKA 4APXB 1U1JA 3KPTA 3VFMB 5L2JB 2UV3A 4PRIB 5JOPE 1SXNA 4KRPD 4YMZA 3HM7A 1Q45A 1NARA 4JIQA 2VH5H 1C9DA 3KYMA 1AD1A 3N6YA 3SY1A 1F6AA 2VKWA 1IEHA 4GG6E 4IX0A 4K3GA 1B9BA 2ITFA 5EIIB 4KJPD 1YRKA 4D9PA 3S4TA 2O9PA 3SO5A 1MFCH 3RK8A 4M00A 3UIYA 4TOYH 4MZYA 4NJ9H 5J5EA 1R30A 1HIML 2CM6A 3WNKA 4M7LL 4H41A 4LBSA 5EZOH 5AN7A 4LQFL 4BZ1L 4IJTA 2ZOLB 3UPWA 3BSHA 4GCXA 2XYCA 3WLKX 3U0TB 3JZ7A 1NAML 2A9DA 3A6CL 2VDRB 3B6SA 3FCUB 2QJJA 3US0A 3DMMA 5DELA 4PFMA 3TUUA 4LBRA 3VM5A 1AO7D 3MUHL 4BIKA 2DW5A 3QOMA 1UWIA 4JRYD 2AABL 4HS3A 3CPGA 2G8ZA 1PZSA 1U8HB 1RK7A 1OLZA 1YMMD 1XLKA 1GZJA 1I53A 2QBWA 3M8OL 2HJLA 4E2DA 3FN0H 1TPC1 3V4PH 3BVNB 5EEWA 4R5XA 5AYXA 5CJXA 2VDLL 1XGRB 2Q02A 4J4PA 2QGEA 2Z93B 4BFRA 4KT2A 3MCKB 5AUMB 1WZAA 1F6YA 3MLWH 1R3SA 1LWHA 3OKLA 3KYAA 2YCKX 3D2TA 2WP3O 5FF7A 3DX8A 3OKMB 5BZDB 3WOVA 1JRBA 3W7KA 1F4AA 2GWGA 3ERXA 2DQCH 3H0TA 5JOPD 4J3OH 1BMWA 2C0AA 1XC4A 1X5YA 4RNHA 4RMWA 3IMUA 2EAEA 3LKNA 1TREA 1YTKA 3ZZ1A 1AOHA 4R83A 2Q7YA 5E2WL 4XNAA 4GIEA 1SOKA 3EJYD 5F0PB 1DIKA 4JL2A 1LE5A 3A4EA 4ASTA 4A1RA 3MFGB 2NV9A 4NZUH 1SUXA 3QHOA 1TDQA 2CDEB 3R0UA 4UR8A 1MRAA 5DJDA 1XCQB 4YSOA 2B1AL 5F3HA 2IPWA 2DQTL 5J6GB 3NO1A 3MYJA 3B5TA 3IDXH 1QWNA 4PRHB 1UIOA 3BP5B 3VFGH 2F8IA 4XNQB 1HFBA 5G5DA 2DZWA 4M7ZB 1R3QA 2OZ8A 4XWOC 5D2XA 2I1OA 2K4AA 3GLDA 2W5PA 4JNMA 1Z9SA 4A2DA 1KBKA 4UAOC 1TZ7A 2E7DA 2F1EA 3EA3A 4DZ5A 5C0JB 2QLVB 3QR2A 5JIPA 3LRLA 2BFVL 3QEGH 2OB3A 4HC1A 1GJWA 3WHE1 5K5YA 5E8NB 4GAGL 6TIMA 2QR6A 1V6WA 2J4WH 3N14A 3WYZA 3QO0A 3W5NA 3VH8G 1SZNA 4BZ2L 1EXPA 5KSBA 3ZR5A 3WLBA 2DQIL 3TO2B 3TPKA 5EBGA 2AQQA 3P2TA 1A6ZB 3N50A 1VHCA 3GSRB 2D0FA 4PUKA 1GPOH 3Q0HA 2GHWB 5GGRB 4LVNC 5GS1B 1T0MA 1E1CA 2PBGA 3N9KA 4O02L 3ZLGA 3IRZA 3G5YB 5I17A 1EO8L 5KN5B 2AXGA 4JY5L 4FXRA 1QUNB 4M0XA 4G7SB 1G4RA 1EHNA 1ZUAX 1DJIA 1G9MH 3UJRA 1KBGL 3RJQB 4NRSA 3DIPA 2ZRUA 4A8RA 2WYZA 4K7VA 4FOMA 3QFJD 3FA3A 2P80A 3LKQB 2P50A 2PTVA 3W7PA 1KYOK 4AC1X 4PHZA 3DX3A 2QQKL 1OX4A 5GRJL 1NSNH 4ZMQA 1P6AB 1F2QA 4GW5A 2B81A 1I1YB 3WK0A 4LCYA 1Q63A 4HPYH 1OK4A 2WNWA 2HRHA 3HB3B 1OCJA 3VNYA 1RUKH 1OTUC 4AMKL 3SKOB 2CFFA 4H83A 1YNTB 3L5XH 4W6XB 3GIPA 4JLRA 1EXGA 4Y16C 3N42B 1OQOA 2QQLL 3URQA 5D96B 3BKYH 1M1XB 4CW1A 5AVHA 4F80A 2G3NA 3FCTA 1A80A 1QLFB 2VE6B 3HPZA 2EVFA 2UBPC 1LL4A 5LKNA 4A2MA 4HPOL 1C7SA 2W1NA 4TXVB 1M5WA 3N41B 2WLNA 2YOAA 1SXAA 4ONFH 3FQ2A 1C8QA 4XKYA 1IZCA 1RXLA 5I1IL 4D9LH 3ZR4A 5F7UA 1NGQH 2W9LA 1A66A 1E6QM 3AY4A 5GGQH 4ML9A 2ZG1A 3CHSA 3FN9A 4D6FA 4L8CB 4N8CH 3S5LG 1JWSA 2P0OA 3QZEA 4FFZH 3O6LL 2WGNB 1ZRQA 1G7HB 1AQKL 3OWRA 2EE0A 4WGXA 4WY0B 3U3HA 1A1NA 3SPCA 1DBBH 4D6IA 3L95B 2CD0A 3TURA 1U8LA 5JW4R 1LO2H 4DPBX 1RPKA 3OJMB 3VI3A 1Q6QA 2EXWD 5BMFL 2CO4A 3A9BA 3RR4A 1LEIB 3U4BL 2F74A 5BS0B 1XLAA 4UT6H 1LO3L 3WJWA 1MAJA 4POZD 4JY4A 2HXAA 2IBZX 3MKGA 4I0PB 1HESA 2D7MA 1IWBA 1KYDA 1TA3B 1BAGA 4EBQH 3X11A 4N0CD 2ONEA 4M81A 1YEFH 4DKFH 2PS2A 3GS7A 1D2KA 2MH4A 2FJHA 3CFDB 2VDKB 1R0AL 2AEPL 2MCPH 1JERA 2DZBA 5K9XA 1F6FB 4C6KA 4AY0A 2Z4TA 2BX7A 4PB9H 3FKUS 5LGYA 5J13C 5FOBA 2Q3RA 1LMKA 1AHWB 5TIMA 3LB6C 5EU6D 1GVIA 1SBBA 1KFAH 4JHMA 3BUYA 4MZ3A 3U1PA 1DDTA 1Y7VA 4AGPA 5CBIA 3D50A 5G4EA 3UR5A 3TVMD 3I6EA 4RV3A 3SCVA 4MNJA 3UWZA 2VL5A 4PJ8C 2ADFH 3V52H 5TE4L 3NCYP 4EXPX 2DMBA 1R5IB 4I9XA 1E0WA 3PZMA 3QCVH 2GFBB 3KJ4B 4LDLB 3GUWA 5AZ2L 3KP0A 1Y5WA 4B5SA 5TK2A 2BY0A 4MD5B 4NPJA 3REVB 3CK0L 1P43A 2I5IA 2V17L 4PJIA 2H32H 1KGCE 5L0QB 1R85A 1S1PA 2ZZ6A 3D4YA 4LAQH 4FXGC 5MENB 3W84A 3QSTA 4DHLA 1FRBA 1O6TA 5DVOA 4DNLA 5BU9A 3O2DL 1XLLA 1NC4B 1I4NA 2BASA 1QRQA 4R0LC 4TN9A 4IMFA 1LOSA 4KY1H 3PTMA 4AISA 4CSTA 2N56A 3Q13A 3QJZA 1KENH 3V16A 5D2NC 4FNPA 5DCDA 5L2KB 1DEEB 1CFMA 4ETQB 5DQ9B 1BSIA 3TJPA 3ZO9A 4Y9OA 3VUSA 3KVMA 1KB9K 3FW6A 4TVPE 4CDHA 2G4JA 1LP9F 3K5RA 1HE7A 2WUBH 1FFPA 1XGQA 4ZG1A 3NXLA 3OLIA 1ZA6A 4JHVA 5DC2A 1O5QA 3BDXA 2XSBA 1VJIA 3D51A 4FYTA 2KZWA 3QIUD 4IF2A 3ARUA 3HKZA 2DWYA 4EI5C 4OJAA 5FHAL 5HNRA 5CKGA 1FWFC 3ASOB 2VDIA 5DMJB 5I15H 4PREB 3C2VA 3SKUD 2E9GA 2PF6A 1ESWA 3NQDA 1AMYA 4UUJB 5E8OB 1QEWA 3IJSA 4FQXB 3BAEL 4NRRA 4QDWA 5E5MB 1IT8A 3QQ9D 3LQMA 4GH3A 4BHUI 1SRDA 4YOKA 1N55A 1E90A 4ZQCA 3M1ZA 3PTQA 1QVBA 1BLIA 4NHUB 1W72H 1WIOA 5F1IB 3OR7B 4IRSC 1POJA 4DTGL 2PDYA 2QCCA 3NR0A 3SCQA 3MHFA 5D7EA 1W17A 3VIMA 4QSFA 2YD3A 4IPLA 1PZ1A 1G7PB 1H2JA 3Q1SL 2VX5A 3O16A 4XX1G 3L0KA 3NP3A 5HHQB 2NY1B 5BJTA 5IP4A 4A29A 4EXKA 1LLOA 5CWSB 4V11A 4LRNH 4DGIL 2PTDA 4TSBL 2LFEA 3ZK0A 3MXWH 5EN2A 1L9NA 1E9QB 4KUCF 5D72L 1HZHH 5F2MA 3RM9A 2XSXA 1IBFA 1MQKL 2ZCKH 4QRRD 2A3BA 3NGBB 2VM3A 3ZKXB 1J12A 4FYQA 3W7CA 3VVWA 3H3BC 4KEZA 4Y8FA 1QO5A 4YXKL 3DX4A 4H04A 4B2DD 1T83C 4L9LC 3GZQA 2D9QB 3VX1A 5KZEA 1RZKH 2APVA 5MEPB 1QFUL 4MWAB 1QI2A 5JIMA 3T9PA 4P61A 1E9PB 5FEPA 3J2PA 4F15B 3WF2A 3QDMB 4IGHA 2BLEA 4NM8L 1MFBL 4QGTA 3VI4F 2R9RA 4F2TA 5A40E 2VLKA 1D5BB 5DVKA 4XD6A 2DOCA 3KMDA 2XWRA 4MYAA 3R11A 1Y65A 4Y7EA 2Q3AA 3T6WA 4HN8A 4NPYB 3L3DA 1KQYA 2QSCL 2F54E 1ET8A 2V2TA 3KOXA 2ESVE 4HU8A 1AH0A 5SX4I 1W3LA 43CAB 2C9SA 2F8XC 2AV7A 4XGZB 3VWKD 4W9TA 3TXVA 3GC5A 5E4OA 3DARA 1OP4A 1BJ8A 3E2SA 3ARBC 3T2NH 1HKWA 1X6NA 4AZBA 4H44C 4EN2A 1IT0A 2F53D 3IJLA 2EACA 4UOW1 1F86A 2PR4L 1W9UA 2W65B 4DJDA 3WIHA 1TV5A 2QUVA 1KULA 2PDKA 1NM4A 3I3EA 4ABUA 5EB9A 4B6ZA 1AG1O 5CEZH 1RI8A 3LRGA 2PYFB 5EZIH 1W3TA 3ZHKA 1BD0A 4H4NA 5FKYA 3CSPA 4AH2B 1XTLA 4HJJL 4DX3A 2HP4A 3FCBA 2NUTA 4B5WA 4ENED 2FVNA 4JPIB 1IM3A 4O4VA 4YDKL 4FN0A 1INEH 1SW0A 4HLJA 2ZZ3A 4Q7DA 2WK2A 1TEYA 3TBSB 4JTFA 4JFYA 3KHJA 2VRQA 1LORA 4PJ5D 3K1KC 1MREL 1K85A 1XVSA 4WW2F 1D2PA 3FSTA 3DOSA 2Y07L 4A55A 2IH1A 4YDIH 1ISYA 1KR0A 3V5KA 4TTGA 2X4RA 4LDOB 2V2WA 3IDJB 1I7ZB 1B1YA 3HZKB 2QQ6A 3E2VA 3QFGA 4G7VL 3BIKA 2WXPA 4O15A 3MCOA 1RUML 1XH0A 4CU7A 4RCXA 4O1BA 3MJMA 2AJ3A 3EYUL 2CJ3A 5KTEL 3PS7A 5ITFB 3VB9A 3SCUA 2NQJA 3P4LA 4EF9A 3URAA 1PQZA 1FVDA 1YG9A 4JIRA 3PABB 1GA2A 5I1KH 4PA8A 2QSQA 2N1TE 1DCEA 5D5ME 3GDBA 4FX6M 1O1ZA 3NSDA 2BINA 1WZ1L 5EB8A 4KETA 1FHLA 2AKRA 3BKJH 3JT0A 1NWUA 4K71C 4JN2A 4GKSB 1DQQA 4P9MH 2OMNA 2V2XB 1YEIL 2DT2A 2OK0H 4AIZB 3W0KA 4OZHE 4C59B 4NT0A 5C09E 3KPSA 4IBTA 1CGXA 4FKHA 3BD3A 1N0LB 3R0KA 3A64A 1MXGA 2FLIA 4W4NA 4EAYA 4KNTA 4JGNA 3HRZA 4NF7A 1NEYA 2MOGA 3N44F 4LCWD 1GVSA 1GGIH 3JTTB 2AERT 5CZSA 1XB6A 2XQBL 5DQDL 2XVKA 4OZIE 5E5UB 1TIMA 4HLZH 1TQCC 4LUJA 3WN6A 1UGKA 4FYRA 4MADA 4U5IA 3GE7A 1P5UC 3A22A 2J13A 1HHKA 5DXYA 4XXDB 1KCVH 2FZ8A 2P5WE 1MLCA 3GHTA 4R7DB 2K6ZA 5IB4A 3VDCA 1CGSH 4MQXC 1RVGA 2GQ8A 4HWBL 1MVFA 3ARGA 1KCRL 4YWGL 2Y7NA 3V5FA 5BO0D 2L3BA 5K93A 4HJEA 4GEJA 4N42A 3BVTA 5B38A 1XG4A 2NY4C 3MU3A 3NTCH 5IR1B 1XLHA 1Y1UA 4G5AA 5AZUA 4DYKA 5FW6A 1G0YR 5E0QA 3MJ7A 3OAYK 2I24N 1G69A 1COBA 5E94A 5L8JB 2P47B 2BIMA 3I6LE 4WNSA 3AFBA 2GGGA 3M07A 2O30A 1UACL 2VRJA 2FZMA 4D6EA 3FMGL 3ZUCA 4JQ4A 5AOUA 2AGJH 2NDFA 1NBVL 1XF4B 3PLYA 1XFBA 1W0WB 1I7RB 2OFQA 5J3HC 1GONA 3TKFA 4QXGH 4X0VA 1JPMA 1DN2A 1Y18A 4GXUN 4RPQA 3S35H 4ZFQA 2V2DA 3ESPA 3LZ3A 2UXTA 2YGYA 4OU3A 3U7BA 2BNRB 2OMZB 2YARA 5C09D 1R7OA 3NQ2A 1B3OA 3DFSA 1K8XA 4IXHA 3ULVH 4JZJA 1NFAA 5L9DH 2MFNA 4XBPB 4U3SA 2FQIA 4RAVA 2H32B 3HFFA 2WMPB 4PRPA 5ALCL 3CXHJ 3BT2L 3VH8A 2YPIA 4JPWL 4WKZB 1BEYL 4O28A 1BAFH 1PLGL 1FOBA 3DFHA 3NA4A 2PDCA 5AOJA 4FAMA 4QJ4B 2Q86A 4TTDC 5LNEA 1F8MA 1N5AA 4ZZFA 5F97E 1UUQA 3NCBB 4PJHF 1OTTD 2P5WD 4AM0Q 4XBMA 2EDEA 4JFEA 4DETA 2NPLX 4QDPA 4DEUA 2ICEA 4LXFA 2OJEA 3KLHD 1YDYA 4P9HL 4LUSA 5DC9B 1EHKB 3TA3C 3A67L 2XRAH 3AWGA 2X9YA 3QIBB 2X2UA 3PWLA 4IJ3C 4CQBA 3I6LD 2JWYA 1M05B 2F08A 3WNMA 3BJ91 5GIRB 2CALA 4MVBC 4D0CA 3VYNA 4KQ4H 4M7TA 4JM4L 4Y16B 1C8XA 3I9PA 3TYZA 3V0VB 4IDJL 3GLZA 1M3UA 4JDBA 4HVBA 1JDAA 1DWJM 1KFKA 1PB0A 4CGUB 3NZ1A 3MI6A 2ENYA 3QHNA 3UY8A 1BBDH 4G3YL 5B1AB 4DO4A 4AM0A 5HUOA 1W72B 5HHOB 5IIEB 5CPNA 4AWUA 4XZBA 4HF5H 5GZNA 5GNZA 4V1YA 2Q7AA 2BWQA 1WBHA 1WZMA 1G0DA 5D9SB 5SWSD 1BG4A 5LN4A 2DLFH 4IICA 5TDOB 4EN3C 5DWUH 2GQ9A 3EGSB 1WKEA 5B8CA 1VZGA 4ZEPA 5JHDA 3QHFH 4I6KA 5HYJB 4ZR8A 2ZF9A 2A9CA 3ROLA 3IS4A 1RV8A 4YWSA 4J6IA 4ENLA 4PGDA 3TJEL 2X70A 1OE3A 4IMKA 4HALA 2DKSA 3IMWA 5JU6A 2J8UA 3IKCA 4AYMC 2E76C 2M83A 3FVMA 4E2OA 1LO0H 3N91A 7TAAA 1XR9B 2JFEX 1UWRA 1QWGA 3GXTA 4QITA 3BE1H 1Q0EA 4NVTA 2P49B 4QDMA 3B3DA 4JG0L 4Z7IA 4NKCA 3FU3A 4Y1SA 4S1QL 3KVJA 3WJSA 4YSSA 4G6AC 1NOWA 5I26A 2V63A 1KLUA 4E4PA 3CAVA 3T3PF 4JFDA 3VI2A 4NC1E 2KDGA 3AADB 1GNXA 1JRHI 7PAZA 2R0WL 4L4VA 2C19A 5GSVA 4PCKA 3WFHB 2B5IC 1L6YA 2P42B 5J13B 1A5SA 6FABH 3OBEA 3WTYA 2KH2B 3RX4A 4MY8A 5ABHA 4JFSA 2IH3A 2RUSA 3GR8A 4AZIA 2NT1A 4MMXB 1RFDH 1B4RA 2JGQA 4XCCL 1E0XA 1G7VA 3QORD 3TK7A 2HFEB 4IOIB 3THDA 4HEME 2WTOA 2YN5A 2ATPA 5DUMH 3LM3A 3GBNH 1S5TA 1ONXA 1NJJA 3CIVA 3VCCA 1B31A 1U95A 4XVSL 1DWIM 4ZW5A 4EPSA 2Z1SA 4XCEA 1UA6L 1NUFA 2TPSA 1QPNA 4GYPA 5DHYB 1YNLL 4PJAB 1GYCA 1UW9A 5D8WA 2I5GA 2FX9L 1IKOP 2WJDA 4RGND 1NAKH 4M3PA 2R0ZL 3KLKA 1I1FA 1YMYA 2IANA 3NFUA 5KBPA 5HYQA 3EBVA 3S3BB 4XMUA 4U1NA 3N44B 3QZWB 3RVUD 2NX5E 4R0LB 1DVFD 2BMKA 4X9BA 2OBGA 3TO4A 5LHEA 4LBEA 3RVWC 1Q9OB 3JV5A 1JHKL 2C3GA 1EFQA 1GOWA 3QV8A 5D2NB 3K8LA 4WJG3 4XC1L 5EEZA 2A73A 2LVCA 5KW9H 1KTLB 2XH7A 5CSZA 5I6OA 1IC0A 4WI6A 2KZKA 1ODUA 4D1JA 1UUNA 2PETA 5KSUA 3T42A 4UM8A 3BP4B 3N55A 3GSQA 4M48H 4HZ7A 3N9GH 2C8NA 2QPEB 4JJ5A 4ZTPL 3IJ9A 3NZ8B 2PDQA 4XC3H 5JZ7D 1I9EA 2V9DA 3S36H