1XV8A

Crystal structure of human salivary alpha-amylase dimer
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Human Salivary Alpha-Amylase Dimer
rcsb
molecule tags Hydrolase
molecule keywords Alpha-amylase
total genus 160
structure length 496
sequence length 496
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xv8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xv8A01
3NUKA 2GDVA 1MW3A 3PZ9A 1UQZA 4FNQA 2JEQA 4H2CA 4JL2A 4R5EA 3ZJKA 1CXIA 5TD4A 5FD0A 3KEHA 1C92A 1V0KA 1ZBKA 3BVWA 3N13A 1QHPA 3AOFA 3GNOA 1B3XA 3CV5A 1R33A 3CZGA 4PSPA 2VQTA 3VIFA 1PZ3A 4ZENA 1OB0A 1MW0A 3TOPA 2FDMA 1I1XA 3ZOAA 3THCA 2ZX7A 2V3DA 1UOKA 5A6AA 5E6YA 1E6PA 2A3EA 1CXEA 2CYGA 3TP4A 3WMCA 3G6MA 4NRSA 3VSTA 1C3FA 3WD0A 1NQ6A 4M8UA 1CGYA 1K9DA 3CZLA 4NX0A 1NOUA 3CUHA 2OYLA 2J8FA 2RGMA 3L4UA 6A3HA 5A6LA 2DT0A 3EMCA 3WFZA 4P8UA 3AFBA 4WKFA 1VBUA 3WNPA 1QPKA 3W27A 2JALA 3PBGA 4MNLA 3AICA 2WMKA 2XYLA 1XH0A 4W7UA 5M5DA 1V6XA 1KCLA 1KQZA 4TX6A 1HL8A 3HZ3A 4W93A 1ITXA 4JCLA 4W8AA 3HMCA 3DX2A 3WQ5A 1CPUA 3SCPA 5A6BA 1P6WA 2A3BA 3AMKA 4H41A 3HG5A 1HT6A 3WUBA 2CBJA 5A3HA 4HOWA 3TTYA 4XV0A 3RMEA 1TA3B 4NXKA 1M04A 2XFYA 2X05A 2HISA 1CGXA 1KTBA 1HX0A 2WHMA 4MB1A 4M80A 4DWSB 3GXTA 1ECEA 1UWTA 4MDPA 2YLLA 1XC6A 4PTWA 1JYVA 1S46A 2VZTA 1CWYA 3U7VA 1JXKA 4PUDA 4UCFA 2W5FA 1W9XA 2OW6A 3THDA 4EANA 3WBEA 2WPGA 3A4AA 1MQRA 1E6QM 4DUXA 3VGEA 4UFJA 4UZSA 3ZJ7A 1GCYA 5A6JA 1JZ3A 4KRUA 3BVUA 4CCEA 3AMLA 1XH2A 5CPQA 1AQ0A 1I75A 1GQKA 3LPOA 1PIGA 5LA2A 3APGA 5E09A 1WZMA 3PZMA 3IJ8A 4M29A 4AD1A 2PWEA 1V3MA 2D3LA 3WEZA 2DSZA 5GNYA 1EO7A 2CBVA 3WD3A 5CGMA 4ZXOA 3FHQA 3SUVA 2WC3A 1HVXA 1JYXA 4WSJA 4TX8A 3W53A 1XSJA 4ZXLA 3W4RA 2VL4A 3OLGA 2VT0A 3MUIA 2YL9A 4GZIA 3W26A 3WDJA 1K9TA 1UD8A 2NT0A 1UKQA 4OIFA 3UEQA 1JYWA 4W7WA 3TTQA 4URIA 3MMWA 2WVVA 3AISA 1ITCA 3MSGA 3BCDA 5M17A 4QFUA 2YA2A 5EMYA 1E15A 2XM1A 1WE5A 4OBRA 3K4AA 3WQ8A 2F8QA 1B2YA 2JF7A 1BG4A 1UR8A 2WVUA 1QHZA 1WP6A 4Z2HA 3AIUA 4RE3A 5JBFA 1HKKA 3OZPA 7A3HA 1C7TA 1R7AA 3D3AA 3NSNA 2OWWA 4Q7NA 3SURA 3NSXA 2PC8A 1TQTA 3GXFA 3I3DA 1V02A 5A2BA 3AI0A 1EIBA 1GUVA 3CO4A 2J7GA 1ESWA 4GINA 4HPGA 3VSVA 1GOOA 4FLOA 1V6WA 1W9UA 2ZWYA 4JCMA 1CXKA 4W88A 2BHZA 3OLIA 4AD5A 2VRQA 2WLZA 3ZR5A 4FNSA 1KBKA 5A94A 3VNZA 2CERA 2E9LA 3KL3A 4BS0A 1EDGA 2J78A 4BF7A 4D6IA 3VU2A 1MQQA 4V2XA 1HP4A 2W63A 4CN4A 4F66A 2BXYA 1B3YA 2C0HA 4WSKA 1BF2A 1E55A 1IZKA 1UKOA 4JHOA 1DWGM 2DH3A 2G3JA 1VIWA 2EABA 2PBGA 3MI6A 3GBEA 2ZUUA 4P7RA 2WB5A 2D20A 1Q6DA 2WMIA 3AYRA 2D2OA 3EDFA 2NW0A 3E1F1 3F5LA 3VD7A 3EJTA 1US3A 2UY5A 3VNYA 3L2LA 3MU7A 1JAEA 1RP8A 2D73A 1W3HA 2IUZA 3ZJ6A 2PBOA 4GIAA 5I23A 1SYTA 1WAWA 1HTYA 1HXKA 3BH4A 4U5IA 3WDRA 3FW6A 2EEXA 1ODZA 2CBIA 2F61A 4GI8A 3OBAA 1ISXA 1V3IA 3CHDA 4H8VA 4IUGA 2CBUA 1KXTA 4S3KA 1J0YA 5D9PA 5FL0A 2VC9A 1TQSA 3QHNA 3GXPA 4X0VA 4UQBA 3BSHA 3A6OA 1B3VA 4CU7A 5I77A 5BRPA 4M82A 1H4PA 4JL1A 3AZRA 2A3AA 4RL3A 4AZGA 3OLEA 2D3NA 8CGTA 4CUCA 1BPLB 5CZKA 3HN3A 4PN2A 1BVZA 4AZ6A 1CECA 2YJQA 3UR7A 4HPHA 2WCSA 1UA3A 4OGZA 3L4VA 4UFIA 2EQDA 2YA0A 1W1PA 4IM4A 3O2LA 2W4XA 3W38A 1UZ4A 5HPOA 3QR3A 4J3XA 3RJYA 1GJUA 2XHYA 4HMDA 3GH5A 2F7OA 4MB5A 3U5YA 3BAJA 3CZEA 5GNXA 2VO5A 4MB3A 2XWDA 1PEZA 3I3BA 1VEPA 1W91A 3ZT6A 4AZIA 1GJWA 4U3CA 3WKZA 2PWDA 3D4ZA 2V3EA 2WBGA 3MUZ1 4EAMA 5JUVA 3WBAA 5ABHA 1WDPA 1J18A 2WVSA 2DDXA 1WKYA 2EPOA 1TCMA 1QWNA 2G41A 1JF5A 4PRWA 1Q6GA 1OGSA 4GZJA 3EDDA 4TVUA 5CSUA 2BVTA 2XPKA 1UWIA 4HZ8A 3SCUA 5D9MA 2F2HA 1O6IA 4PSRA 2QHAA 2Z1SA 2D0GA 4BCEA 2E9BA 2UWFA 2VRJA 2XJ7A 4UQ9A 1W9DM 1JIBA 4PMYA 4AXNA 4J3WA 3PZQA 5A8QA 3BUDA 5CGTA 1R86A 3PZVA 3T2OA 2V5DA 3B9EA 1JD9A 3WENA 1I1WA 3AHZA 5A8MA 1VENA 3A21A 2Y8VA 3WUFA 1JL8A 3FY1A 2WCGA 1JD7A 4JFSA 1KBBA 4ATDA 2W66A 1J0IA 3RO8A 4UQDA 3T09A 1PJ9A 1CEOA 2A3CA 4UTFA 1JFHA 1R34A 1BHGA 1GQJA 4FNRA 5I24A 2PWFA 1KWKA 4PMDA 1FH7A 2DT2A 5JIWA 3HG3A 4AMXA 4FK9A 3BUPA 1VBRA 4A3YA 1AQHA 4GO8A 3VIMA 1QI4A 3CMGA 1OIFA 3WF0A 4D6FA 2G3MA 1FOBA 3AXXA 3TA9A 5D8ZA 4JIEA 1X1NA 2O92A 3KL5A 1UD6A 4WKAA 4HOZA 4OJYA 2WSKA 2ZXDA 1O7DC 5HXMA 3AXIA 4AZBA 2VCAA 3HJEA 3WQ6A 2HVMA 4IPLA 3DX1A 1U30A 3EJQA 4QCEA 3BUBA 1VEOA 2VZOA 4S3JA 1JZ5A 1UUQA 1KR1A 3AIVA 2Y4SA 1W9PA 3WIJA 3CPUA 3VGGA 1PAMA 1J10A 3ZQ9A 2J25A 3AROA 3WNNA 1W3LA 1EGZA 4D6EA 3O6AA 3SCTA 1W1VA 1SR0A 3WH8A 3ZT5A 3CZSA 1RP9A 1Y7VA 1X6NA 3VGFA 2XIBA 2CKRA 1G0CA 3ECQA 3AIWA 3F5KA 1E0WA 1E70M 2BFGA 5JBEA 5C8BB 3A4WA 2PB1A 2EPNA 1OINA 3VIHA 1E40A 1W1YA 2WVTA 1NWRA 4TVCA 3SCRA 2MANA 4HU0A 1ISVA 1V0LA 3AHXA 3VIJA 2AMGA 4NF7A 4V27A 1DWHM 2FH6A 2BY3A 3VX0A 1KWGA 2PI6A 4BQ5A 3EJUA 2BHUA 1HJWA 2E3ZA 1R75A 3W28A 4JKKA 5ABEA 3ZO9A 2JEPA 2YLAA 2TAAA 3IAQA 5DF0A 1G5AA 4PMXA 1JZ7A 1V0MA 5I6SA 4EKJA 1E4MM 3T0AA 3HG2A 1CYGA 3F5JA 8A3HA 3AIBA 4WJXA 3MSDA 3PTQA 3GXIA 2YBTA 1CLVA 4MB4A 5CPSA 3AMDA 3WELA 1JDDA 2D0FA 2V5CA 1X6LA 1E4IA 2DIJA 3GM8A 4HTYA 2VR4A 2VR5A 4YPJA 5IDIA 3KLLA 2ZUMA 1CTNA 5IFPA 2WHKA 5GQBA 4E8CA 1R47A 1D3CA 1J0JA 1ZBVA 1OT1A 2WSPA 3W6LA 1UR9A 1EO5A 3K1DA 4PMRA 1C8QA 3UESA 1QW9A 3CHCA 2GUYA 2V3GA 3UCQA 3RCNA 1GVIA 3TONA 3WDIA 7TAAA 5BCAA 1PX8A 5BXSA 2CNCA 2NT1A 5I5RA 1W2VA 5A2CA 3SUTA 2Q8XA 1KGXA 3VDCA 3B9AA 4ACYA 2J79A 1E6ZA 3CUFA 5IXEA 4NZFA 1ZB5A 2VZVA 1G01A 4GKLA 2WYSA 1FP9A 2WHJA 2XFFA 3M46A 2FHFA 1HJVA 2DGAA 2ZOXA 3GTNA 2J47A 3WL1A 3AS2A 6TAAA 3WY4A 4AY1A 1B90A 2CETA 3MANA 1Q6EA 4P7OA 3SUUA 3BAYA 4GXPA 1N82A 2QPUA 4BZYA 1US2A 3EDKA 3WDQA 4YHGA 5DT7A 2G3IA 4UZUA 1W9BM 4PCTA 4MPKA 5CPTA 3WH7A 3VVGA 2GJPA 3VIOA 2QV4A 4D71A 2WMFA 1E4NA 4AYGA 4J3SA 1U2YA 1D7FA 2WAGA 1JYNA 3BMVA 5BXRA 2F7QA 3WQWA 4PTMA 3MS8A 3HU7A 1UQYA 2BXZA 3AS3A 1LWHA 4MNKA 1QBBA 3BLBA 4JFUA 1B3WA 4TOQA 4CVUA 3SUSA 1V3LA 3LRLA 1GQLA 1BVNP 1UR4A 1CBGA 2VOTA 1E4LA 5JBDA 4CN6A 4DUWA 3BMWA 5EFFA 2JIWA 4TVDA 5BYWA 2XG9A 2WM0A 3VO0A 1NWSA 4NSBA 3FNDA 4PMQA 2FHCA 2C7FA 2W91A 2ZUWA 1AQMA 2D23A 1HP5A 4CVWA 3AQUA 1Q4NX 4LGXA 1R46A 2VURA 2A3HA 2WZHA 3LXCA 3WDHA 4JFWA 2BNJA 5CSYA 2FHBA 3GXDA 2FGZA 3A47A 1W3KA 1V03A 1CGTA 3EDJA 4PEEA 4BQ3A 5BXTA 1PX3A 1HF6A 2BY0A 1MYRA 3AS1A 4DO4A 3TTSA 4ACZA 3D52A 3AJ7A 3VM7A 1J0ZA 5EFDA 2XIIA 2AAAA 3ZSTA 1W1TA 4U2YA 3NCOA 1H41A 1E1FA 1XD1A 2F7RA 3W25A 2W67A 2WZEA 1XSIA 3NSMA 3WN6A 4HZ7A 3RDKA 4HMEA 1G9HA 3RJXA 3POCA 1V02E 1E0VA 1KXQA 5CJ5A 2D24A 3U5UA 2YA1A 4B3LA 4D6JA 3K4DA 3PZTA 2WMIB 1JNEA 4NI3A 3OGRA 2CESA 1BAGA 3S6TA 1UR0A 2OWXA 4NXSA 5CG0A 5D9OA 4WIWA 3WFLA 1VFOA 3UG5A 3ZJ8A 2NSXA 2CXGA 4MNMA 4AZCB 3DDFA 3A22A 3CZ8A 1JZ6A 4AEEA 4B9ZA 2J74A 3CIVA 1GOKA 1FA2A 3EJRA 2IXUA 2VMFA 3ARYA 4M56A 4AMWA 1V3HA 1EHAA 4IPNB 4F8XA 1SMDA 1G1YA 1UD4A 3CZJA 3OB8A 2UY2A 3N15A 5CLWA 3S2CA 1CXLA 2WCAA 3W6MA 3A24A 1IZJA 3LRKA 2WBKA 2XN2A 3T08A 1HWWA 2WZIA 2F1BA 1IT0A 1QHOA 4J28A 3T0BA 2ZUVA 3J7HA 4P8XA 5E0FA 2GJRA 4UFLA 3ARTA 2C8NA 1XD0A 2DSKA 1XH1A 5D4YA 1GQIA 1FHLA 2WLYA 2VX5A 1BGAA 5A8PA 1JF6A 3FAWA 2XUCA 3CZKA 3OGSA 5BROA 3OA5A 2JIEA 3GXMA 3BVXA 2DPEA 5IHSA 3WQ4A 4OBSA 2OSYA 3WEOA 3N11A 3D4YA 1M03A 3GH7A 4GZEA 3OGVA 2DT1A 5HBFA 2J4GA 3CC1A 1KXVA 1TZ7A 1OBAA 1EA9C 4PCSA 5M03A 1HN1A 3VGDA 3IANA 5HNNA 4XX6A 5ABGA 7CGTA 1XHGA 5CLTA 1GORA 1UD5A 3WD2A 1DWJM 4CU8A 3GNRA 1FH9A 1GOQA 1K6AA 4C7GA 4CD8A 1UKSA 4Z2LA 3L4ZA 3TV8A 1R7OA 3MMUA 3AYSA 1CGVA 3LXAA 4F9JA 3HG4A 2DSWA 3A4XA 4P7NA 3VDBA 2X1IA 4W89A 2G8ZA 1RD6A 5CQ1A 1JNDA 2XN0A 3ZSSA 2BV9A 4MJ2A 4AC1X 1GW1A 1VEMA 4X0NA 3H55A 1WPCA 3ARXA 4ZEPA 3WH6A 1BQCA 1WZAA 1GHSA 3T2QA 3WF3A 1JAKA 1J9YA 2BS9A 4YHEA 1TFVA 3LRMA 5A6SA 2J7FA 5AY7A 2WMGA 1XCWA 4EK7A 4QP0A 4AWEA 2YDSA 4QDMA 3AIRA 1T0OA 3PZGA 1VFMA 3UG3A 1UD3A 2JF6A 5M3WA 1CLXA 1ZJAA 2ZXAA 4UFKA 3WY3A 4FF5A 1UD2A 3WH5A 2EBNA 1AVAA 3SCOA 5A95A 3BVTA 5E70A 1TA3A 1KGUA 1H0IA 3OLDA 4FLSA 3N04A 1B0IA 4E2OA 4NRRA 4A3HA 4K68A 4Z2JA 4JFTA 3IJ7A 4UOZA 1E72M 2VZSA 3NIYA 4CKQA 4H7VA 4CD6A 2X2IA 2FGLA 3W24A 5E6ZA 2GDUA 4C7FA 1HJSA 4PMUA 1B30A 2J7BA 1CXHA 1YQ2A 2XM2A 2OSWA 4U31A 3AXHA 3LX9A 3MUAA 3VGBA 2YL5A 1V3KA 4AZHA 4ATWA 1CXFA 4AZCA 3ZIZA 1BYDA 3SCSA 4AMCA 2OLHA 4C7DA 4OOUA 2X2JA 1JGIA 3CBWA 1NWUA 1XYFA 3WSUA 1J12A 4F9DA 1OGGA 2GFTA 4W5ZA 3W29A 1R8LA 3L4TA 4BQ2A 1C93A 1UA7A 3WDPP 1L8NA 5FOOA 5A69A 1KFWA 1E43A 1V08A 4ZE4A 1PX4A 5EB8A 2OSXA 1GOMA 2D0HA 3ARSA 3PZOA 2YDQA 1NM9A 3VIIA 2VNCA 1QI3A 1OIMA 3BLPX 4N42A 3QOKA 1AMYA 4ACZB 2EJ1A 4UQEA 1WDQA 1WNOA 1UKPA 2ZX9A 1PBGA 1E71M 2XN1A 1TQWA 3G6LA 4JZ5A 1L0PA 1E9LA 5F7UA 4ZFMA 1UH2A 2E40A 3N17A 2XFRA 1C90A 2E9MA 3N1AA 1MWOA 4PMNA 3WF1A 2XVGA 1XRVA 4DM2A 5CXPA 3BLKA 5IHRA 5A1AA 1GPFA 4GI9A 3WL0A 1CDGA 2J7DA 4JHZA 2CHOA 2Y24A 1V0NA 4B16A 1VFUA 1EQCA 4D6CA 2EACA 1B31A 2YL8A 5DEZA 1TUXA 1NARA 4HU8A 2EADA 3KLKA 3GBDA 2X2HA 3VMNA 1GZJA 1H09A 1QOXA 3WF2A 4WLCA 4RE2A 3VD4A 4L4PA 1ZBCA 4AZ7A 2CITA 3RM9A 4DO5A 2XGIA 1VFFA 1MW1A 3H54A 5HOSA 1G94A 1F4HA 1Q6CA 3SCNA 2WKLA 1A3HA 3ARPA 1ISZA 2W61A 2UY3A 2VCBA 5A2AA 4J3VA 3MV01 4KWUA 1QWUA 3LPPA 1JDAA 4MAZA 4W86A 2XTKA 1WO2A 3IJ9A 4KGLA 1F4AA 3SUWA 3DX4A 4Z2IA 4U33A 1DEDA 4QCFA 4XUYA 4XB3A 3FN9A 2WHLA 4D1IA 5C70A 2O9PA 2E8YA 1XSKA 2CKSA 1KB3A 3UERA 2FYVA 2D1ZA 4KRTA 4UQAA 2QMJA 3U57A 1YHTA 2XVNA 3AHTA 1TQUA 1LWJA 2ZIDA 2WXDM 1VJSA 3WY1A 5FKYA 4MJ4A 3T0DA 3UR8A 4E4PA 1W9VA 2DT3A 1KQYA 3H53A 4HOXA 3KZSA 3KL0A 3AMCA 4UFMA 2ZUSA 4J27A 1BYCA 4TXEA 5E1QA 3AMGA 1TR1A 1KR0A 3VD9A 1FFQA 1HKJA 4RE4A 3II1A 2YOCA 3NJ3A 3MV11 2J75A 2VVSA 1DHKA 3BAWA 3K8MA 4CGTA 2J8GA 4B3KA 4QLLA 3VMOA 4UFHA 4KH2A 3ARRA 4UQCA 4HA3A 1UWUA 1LG2A 2BY1A 4A4AA 4MDOA 2D22A 5EBAA 3GDBA 2EXOA 4ATLA 5E9AA 2E8ZA 2ZX5A 3BUIA 3ZR6A 1E6NA 5I0DA 4CD4A 4QLKA 1TMQA 2VX4A 1UR2A 5D9NA 3OG2A 3A5VA 3BC9A 2X0HA 4OUEA 3WUGA 4JKMA 4LXFA 2V38A 4W85A 2ZUTA 2ZXQA 3WMSA 4FLRA 3WNOA 3M7SA 1MXDA 2IXVA 4W84A 5LA0A 2XVKA 3IAPA 3VUPA 2WWCA 3NYDA 1OM0A 1WDRA 2GJXA 3KWXA 3DYOA 3B9DA 1BYAA 2GVYA 4FNPA 3BXWA 2VJXA 1SMAA 4WK9A 1OT2A 4CD7A 3MKKA 4P8WA 4ZE5A 2YIHA 5FCZA 3ZM8A 1JFXA 2YKKA 1HL9A 2WKGA 1QW8A 1H1NA 2VX6A 1EDTA 2VX7A 5KZ6A 2EAEA 1XGZA 1V3JA 2E4TA 3ALGA 3VIGA 2XVPA 1V6VA 5IFTA 5DT5A 4W5UA 5ECUA 4P8VA 1QI5A 4OOZA 3EBVA 5I79A 1JZ2A 2V3FA 4AIOA 2F18A 4UOQA 1LQ0A 2DIEA 1UWSA 2BHYA 1ZJBA 1EHNA 1FFRA 4XZWA 3VMPA 1XCXA 4W8LA 4WF7A 2XSBA 3DYPA 2Y2WA 2J7HA 1EOMA 1OCQA 4W87A 3DX3A 3N12A 3OIHA 2EO7A 4W7VA 1MW2A 3DHPA 3SIMA 1E6XM 1WCGA 3ZMRA 1K9FA 3RM8A 3WY2A 4AIEA 2YFNA 4D72A 3AHYA 4GQQA 1JI1A 3BVVA 3JUGA 1JZ4A 4FLQA 3SEPA 3AIEA 3UETA 1M7XA 3ARUA 4D1JA 1LF1A 3VKKA 4EE9A 3VINA 1KGWA 3VOCA 3GZAA 2F1AA 5ABFB 4BA0A 3WMBA 5A6KA 4ML4A 3ARZA 2VCCA 4AD3A 3MMDA 5A6BD 3D5HA 1B1YA 4CCCA 1QX1A 3CUJA 1EH9A 2OYKA 1J01A 1E6RA 3L4YA 3S5ZA 3VTRA 3WNLA 2DSUA 3WUEA 4GQRA 1O7AA 1ZS2A 1GNXA 2BY2A 5D8WA 1HKMA 4X9YA 2CCRA 1MVYA 4JFVA 2JFEX 2ZX8A 4PTXA 1TQVA 4BQ4A 3VILA 3DX0A 3BUQA 1UWQA 2YL6A 2PWGA 1FHDA 3L2MA 3PZUA 2EPKX 4TUFA 4D6DA 2XWEA 4PMVA 4B9YA 3D50A 6CGTA 1JI2A 2IGTA 2OWCA 4CU6A 1UYQA 1RH9A 3K8LA 1OD8A 4Y7EA 1M53A 2XGBA 3WF4A 2O9TA 1LG1A 1XYZA 1UR1A 3AS0A 1CENA 3RM4A 3PZIA 5AC5A 9CGTA 4R27A 3AIQA 3FHAA 1KXHA 4DWSC 4GI6A 1GOIA 3KE0A 3QOMA 2VRKA 2XVLA 4W8BA 2WC7A 5GNZA 2RGLA 4AIUA 1TVNA 4LPCA 2XSAA 3EMZA 2VUYA 3W37A 4HMCA 1CZ1A 3PN8A 1EQPA 3AHVA 4DM1A 4AW7A 1UH3A 1D2KA 4PYSA 1SFSA 1ZL1A 3W82A 1RPKA 4UNIA 2ZWZA 4FNUA 2GK1B 2Z1KA 5BXPA 1GOWA 1BSIA 3PTMA 3PZNA 5A8OA 3EDEA 3DC0A 5FL1A 2WANA 1OD0A 1UKTA 3WD4A 1DWAM 2Y5EA 1VF8A 2VQUA 1J0KA 4HZ6A 5I2UA 3SCVA 1LL4A 3BSGA 4U5KA 4DO6A 1UWRA 2JE8A 4H8UA 4AD2A 2X0YA 1MXGA 4B15A 3M07A 4XZBA 4M1RA 3IK2A 2G3NA 4PMOA 1KCKA 3WNMA 4J7RA 2GJXB 1E56A 3MO4A 2DEPA 2YBUA 2WMHA 3WQVA 5DMYA 2QPSA 4UR9A 1E3XA 3M6DA 1PIFA 3VSUA 3UG4A 3MUY1 3RPMA 3BGAA 1NOFA 5AYBA 3VD5A 3W0KA 4DWSD 2J62A 5I78A 1SZNA 4UOJA 4MAVA 3ARWA 4HP5A 1JDCA 1Q6FA 1H0GA 3PHAA 2YFOA 2QMKA 3CMJA 5LA1A 2EPLX 1GHRA 1ZBWA 4AD0A 2DH2A 1E5JA 2WC4A 4Z2GA 3RILA 3L4XA 1H3GA 1GVYA 4JAWA 1E6SM 4LX4A 1JG9A 4QLJA 5ABFA 1DTUA 3CH9A 4YN5A 3BAIA 1TG7A 3QHOA 4GO9A 1VJZA 4U3AA 1ISWA 1DP0A 1JZ8A 3K46A 1HJQA 3A23A 3LMYA 1HNYA 2ESCA 1XV8A 4Q22A 3SCWA 1QNOA 1BGGA 1VB9A 1BFNA 3CUGA 4P7LA 3DDGA 4HA4A 2X09A 1BG9A 1EXPA 2OW7A 3BAXA 3L4WA 3GH4A 2VZUA 3S5YA 4HA1A 1J11A 4FMVA 3DYMA 1IV8A 1BLIA 4AEFA 4LYRA 3EMQA 5A6MA 3W81A 1CIUA 1H49A 1LLOA 3AZTA 3N18A 2FE0A 3LPFA 2W62A 4MADA 4LYPA 2QLYA 1W3JA 1QI0A 2WK2A 2BVDA 1H5VA 1EOKA 1LL7A 4GPNA 1J0HA 5JIPA 2DSVA 2ALWA 4PTVA 1UH4A 3CHFA 1NOWA 1GONA 1KTCA 2GSJA 3CHEA 3QHMA 1BTCA 2J7CA 4LYQA 1CNVA 3EJPA 3VGHA 3TTOA 1HKIA 1E1EA 5AC4A 2G4FA 3OZOA 1HVQA 2WWDA 1OSEA 4OKDA 3K8KA 3ALFA 3BCFA 1C8YA 1HJUA 2X8RA 1TVPA 2QF8A 3CZNA 1V6UA 5FIPA 3GYCA 1E5NA 1W32A 2CIPA 2BVYA 4FNTA 4Z2KA 2OYMA 4TTGA 2O9OA 4N0RA 4E8DA 4KMQA 1B9ZA 3B8SA 3NDYA 3EYPA 2J7EA 1WDSA 3D51A 3LXBA 3ARVA 1QNPA 1DWIM 5BRQA 1UG6A 2J77A 3VD3A 1TE1A 2F7PA 4L4OA 2ZX6A 3F4VA 4PBGA 1PPIA 2WVVB 3WD1A 1Z32X 1JXJA 4D6HA 1HXJA 3QGVA 1NP2A 1LJYA 4AD4A 1BYBA 1OWQA 3WNKA 1QNRA 2B31A 3CLWA 5KEZA 3CTTA 2UY4A 1FH8A 4D6GA 3O9NA 4LQ1A 2FH8A 1ODUA 3BAKA 1NP0A 1PS3A 2X2YA 3DHUA 3ZT7A 4MNJA 3VDHA 1UZ1A 2CEQA 1DWFM 1CGUA 2AOSA 1H2JA 2W92A 4V28A 3CGTA 2Y8KA 1R85A 4H04A 3RIKA 3A3HA 1U33A 1MFUA 3GNPA 3FXYA 3IGUA 1MFVA 3VM5A 4QAWA 4AISA 1M01A 2VI0A 5LYRA 2ZXBA 1VAHA 1E3ZA 3DECA 1WZKA 4TTUA 4NZJA 1NH6A 4KGJA 3LPGA 4PMZA 4M81A 3FAXA 2VTFA 1C8XA 4IISA 1MQPA 3ARQA 2GK1A 4CN1A 5I3DA 4U2ZA 3WEMA 1OGBA 5AYIA 3VX1A 1ISYA 2ZUNA 1K9EA 1V6YA 3N9KA 3AZSA 2E0PA 5E0CA 2ZE0A 1CGWA 3WH9A 3SCQA 1QVBA 1WB0A 2VVNA 3VIKA 1NWTA 3VPLA 1WZLA 3NDZA 1C7SA 2PWHA 2PF0A 3I3EA 4NZCA 4J3TA 1H11A 1PZ2A 1LL6A 2CHNA 2WW5A 1QI2A 1HIZA 2ZICA 1E73M 1QNQA 5GPRA 2WNWA 1UHVA 4CCDA 4P7QA 1VRXA 1QBAA 3PTKA 4DWSA 4OZOA 1ZU8A 2WMJA 5HPCA 5C71A 2O9RA 1QNSA 1E0XA 2YDRA 5A8NA 3GXNA 4J3UA 4WKHA 3VDAA 2EPMX 1A47A 4DUVA 3CUIA 4M24A 4AZ5A 3EJSA 4JKLA 3VIPA 4MTVA 4PUEA 2DQXA 1UASA 1C91A 1FP8A 3U7BA 2CPUA 4CD5A 5DFAA 1HJXA 3T2PA 5DO8A 4H8HA 1EDQA 1B3ZA 4AYSA 1W2PA 1R87A 4F79A 5BWFA 5HDRA 3POHA
chains in the Genus database with same CATH superfamily
3WFCH 1MW3A 4Y5VC 1ITUA 1UQZA 4MZIA 2JEQA 4L29A 4I3SL 3KNBB 1HFBA 4RH4A 3S1WA 1HH9B 1T03L 3ZJKA 5I74C 5LXEA 2ZYFA 1AHKA 4RRPA 2QUUA 4PUWA 3OZ9H 3DO4A 2BP5M 5TD4A 2ALAA 3BAEL 3K2IA 4E9SA 2J13A 5FD0A 5SWSB 3EYUL 2VN5A 3T4AA 1V0KA 3BVWA 3BFWA 3N13A 1UWXH 3N44B 1QHPA 3AOFA 2VLJB 3FT9A 2ZCLH 4PY7A 1JUFA 1B3XA 1EHLL 1FHVA 5D1QB 4PSPA 3VIFA 2YCLB 2DDQH 3MRFA 3RY4A 1OB0A 2LGNA 1XWYA 3NJFA 1P84J 3NTCL 4B7LA 4RISH 2CZ5A 3KZPA 1C16B 3L5AA 1CG9A 3EFFA 5F1OB 4WSHA 3THCA 4MJ5A 5AFDA 2FJUB 4AKQA 3N06B 6ALDA 3EWZA 7PTDA 1IAKB 2FLBT 4TLUA 3I6LE 1S78D 1QRNB 3O9WC 3GZOA 4JO4L 1TPFA 2Y1YA 5IM7A 3UPAA 5I76A 2O5XL 1CE6B 4W9GC 4NRSA 3VSTA 5U4NA 4M8UA 2ZSWA 1SZEA 1RALA 3RWGA 4GSUA 4UTIA 1A9BB 4ANUA 3VWJA 1K9DA 1CFSB 4JFXA 3CZLA 1XCQA 4YIQB 1KV7A 4WD0A 2YB1A 1FWGC 1MVUB 1NDGB 1FO0A 5EL1A 5IIEB 4G6AC 4GRWB 5FW7A 4ZB0A 4U4MA 4PC8A 2J9YA 3UJSA 1IGYB 1AZCA 1YG9A 5AZ1A 3MLSH 5EOTA 1VFTA 2XWJA 1NCAH 4E9WA 4NNAA 4HSCX 4PJ7A 4C6BA 3N1FC 4FG6D 3X14B 1ZALA 2J8FA 3SIZA 2RGMA 4UNTA 3EGDB 4S1DC 4PLJD 4PJCA 2VC5A 5FJOA 1X5GA 2DLFL 5A6LA 4ZTXA 4HDIB 4YSCA 5E5MA 2OCJA 2ZYIA 3NFPA 3WFZA 4H9YA 1J9TA 4HBKA 3C86A 5ESVA 4H25A 3VXRA 5BOPA 1IWBA 2AQTA 2JALA 3QJFA 2RACA 1KCZA 1U8LB 2VXVL 4E9YA 3AICA 4F1SA 1EAJA 3M9YA 1WEJH 1IQ8A 3K6FA 4K7PY 1XH0A 3UBXB 5BVPL 1AQFA 1ZA3A 1RA5A 4FABL 2WXGA 3IK4A 4HJIA 4I7VA 4UDUB 1NIFA 2RJGA 1EZ2A 4ODUA 1AP2A 1WKDA 5A6IA 1S8DB 4GUHA 2PLMA 4ESKA 3BO8B 3OXRB 4Y5YC 5GRVL 2GZXA 3W9EA 4LVBA 2DEYX 4NJIA 1NFDB 3LZFL 4HISA 3UYOD 5TF0A 3OAUH 3EBGA 1QZNA 4PB0L 4Y16C 1JJKA 1KBWA 3KHJA 5A6BA 2ESVD 2B59B 1ZTVA 4QRSB 1KCRL 2HJLA 1FN4B 1ZPLA 3TEYA 4A22A 1W72H 1A5AA 5I73C 2Z35A 5EN2B 4DGVH 4BGDA 4S1RH 4N90E 4QRPE 5ABDE 1WV7T 4MSSA 3U9PL 4R53A 5A3HA 3FU3A 2H8PB 4KMTL 4LVGA 4Y88A 5JIQA 2IADA 3PGFH 1M04A 3E0VA 1TWDA 4MY9A 5FUCE 2Q8LA 3I65A 4GUIA 3QW9A 5EU6B 5FYKD 2EKJA 4TQPA 2HISA 1CD1B 3PWLB 3T1FB 1KTBA 3KYNA 1ADDA 2HKFL 1AKJA 3CHSA 1ILUA 3WS3B 2Y5SA 4DQOH 2YXFA 2DKUA 1TZIA 2W9EH 3Q45A 4DWSB 5L9FA 2OXGA 3EOAB 2W60B 3QAZC 3RWIB 3E0IA 1W72A 1UWTA 1MI3A 1V5XA 2P5EE 4MDPA 4FG6C 1SLVA 1K8DB 1PZUB 2WN2A 4IRJA 4MNQB 1XC6A 5AVWB 2OVLA 4PTWA 5CGQA 3ZVVA 2HFFA 4P2OB 5HJGA 2VZTA 1BIIB 3APDA 4HWZB 4JRYA 1H8OA 4HGXA 2WUCH 1BEUA 3OKEA 1X5HA 2GSEA 1HWGB 1FC2D 3KBEA 3QNYB 4UB0L 1CFVH 5AAWA 1NMCB 3KVPA 1R2SA 3NEHA 1DE6A 4PUDA 3LAFA 2ZZ5A 1OAQL 5HHVL 3U9UA 3BE1H 4L8DB 1Z44A 2HSAA 4JTLA 5C7VA 1F5ZA 1ZT1A 3G6JB 3GG0A 1ELSA 1AOHA 1XJBA 4I48B 1ZA3B 1A49A 5HHQA 2A6JA 2Y1AA 3GDMA 3H4WA 1HL5A 3H2EA 3CFJA 1AE6L 5TDNA 1MCPH 3JTSA 3QDJB 4MHHG 2V5BA 2Z0IA 4UFJA 5FAJA 1GCYA 3VXSD 3T78A 3NJKA 5ESVB 4KRUA 2QGHA 2WMPB 1G7IA 3F7PC 4RIRB 3ZIMA 4BH7A 3UPBA 3LN3A 1YEDB 4BKNA 6REQA 1SW0A 2RQ8A 3H9SB 4OLYL 4WO0A 3AU1B 2VM4A 1F4XL 3VXTB 5FFLA 4EDWL 4J40A 3AMLA 4CCEA 1TKWB 4JUSA 1RKRA 4ZMOA 3T8QA 2K3TA 3WHE0 5KJRL 1K7EA 4XK2A 5GS0D 2NR6D 2VEMA 3ARDA 4L9YA 1I75A 2YD9A 1JZDC 1HU8A 3U7YL 1YPZF 2YGQA 5I1KH 4GSRA 2A7PA 1GGCH 3KRZA 4Q14A 1N4XL 3OU8A 2YEQA 3PZMA 3VA8A 2UUDK 4P2CG 3V4VL 3AU0A 1ZVYA 5FEXA 3RZCD 3MQTA 3IWVA 1YYMH 3V5DA 1FFOA 5C2BL 4BSWA 4LB8A 1VYSX 3WEZA 4XCFL 5HYJD 4UT6H 1MIMH 3MRCA 3M41A 3VNJA 3LRHA 3QZWG 4GW5A 3MV7E 3ISRA 4ZXOA 4D9LL 1XLDA 4NO2B 2DYPD 1JQXA 3KCOA 5K9KA 4NQTA 3W3OA 1FVDA 1WDAA 1SM3H 4G8FA 4MNGA 1AH4A 4Z7NF 1TTIA 4K3DL 2PLCA 1HVXA 4GI4A 4Q74A 3VYOA 1CF8H 3W84A 4RFEB 2DBLL 1A5FH 1G9EA 1FCBA 4N3UA 1RLWA 2L4OA 1O1HA 3UBXG 5LQBL 1DQXA 2YDAA 4XCYB 2DWTA 4AKOA 5FGRA 3DSFL 4FXGC 4DAGL 3GGWA 4H8WL 5C0JA 3L7RA 4K38A 2H3DA 4L65A 4UB9A 2E27H 3OR7A 3RFZA 3VA6A 1LQ2A 2PTXA 3AAZB 2YL9A 3R2GA 3MLVL 4YHPB 1TO5A 4PY7B 3PP4H 1UD8A 3JWOL 1UKQA 4LSQL 1T2XA 4I9XA 4C6NA 4W7WA 5SX4I 3W1RA 4TU1A 4XSLA 1IBZA 3QORB 4R7VA 5A40E 2Q3XA 1NLDL 4OFIA 3QRLA 3HUJB 5EF3A 4BQBA 3KNBA 3LBCA 2CGZA 4NP4L 4DKEH 4QFUA 2YA2A 3TO2B 3Q8AA 4I4WB 3ULVH 1BD2E 3BIKA 5HGAA 4Z3JA 4KCUA 1F6YA 5IKCA 4LLMB 4LRNH 2O61B 3BQUA 1BG4A 5M2FX 1KIQB 1PAZA 3URQA 4UTKA 3PIQB 1TPXB 3U6RA 4PW4A 3GHUA 2XFGB 2B4GA 5JBFA 2SEBA 3KLAA 4UMAA 2E9IA 5FYLD 2IO5A 1C7TA 4QXVA 3D3AA 4NZ8A 2OWWA 2TRHA 1S2AA 1H0DA 2HCVA 4Q7NA 3SURA 2WLKA 3ZR4A 5HNRA 1TQTA 3GXFA 4XO5A 2GC7C 4KDVA 1UJQA 3A6BH 3QHFL 1MUWA 2PYEE 3HGSA 3KOYA 3ZRCC 1UMYA 1AGEB 1TQJA 5ENWB 1UOZA 3LMJH 1E4WH 4O5LL 1H7PA 4XN2A 1D6EB 1MG2C 4LGPB 3VE9A 3UC0L 2HG5A 3MRHA 5ACLA 2HXUA 5KG9B 3MREB 1ESWA 3LGEA 1VADA 2EH8H 2NVDA 4GINA 1YEFL 1CZ8L 1OAKL 4R3UA 2R0WL 1IEXA 4MNQD 5FF0A 1M71A 3LV5A 4HC1A 1AY1L 1U91B 4GY4A 4YSQA 4DLFA 4XPAL 3MRGA 3Q1EA 1XF1A 2ZP8A 2Y5TA 3M86A 2X2GA 3VFUA 3S88L 1KBKA 4LCRA 4OZFH 3RPIA 2PGRA 4HSOA 1RZ7L 2DQUL 2Z8VC 3FFCA 1XLBA 3BJ91 3KL3A 4OTXL 4PJHA 2J78A 4D0CA 3SDYH 4HD5A 1BBJB 2IDFA 5I8KH 3QCTH 4EEEA 5EBMB 1KYDA 5JO5A 1LILA 3NN8B 3T6QC 2Z0BA 1PYWA 3BVNB 2CDEB 2XPGA 3DGDA 4FXKA 1G4SA 4CN4A 1HP4A 1PHQA 2W63A 2VFHA 2Y23A 5CC3A 1QSFE 2PTTB 1RIHL 2EKSA 4YUEH 3RDTC 4BXVA 43C9A 3TU6A 1YAZA 4TMPA 3ZYIA 3BN9D 4P5MA 4XRCA 3INOA 1UKOA 5D6CB 4GJJA 1Y1DA 4U1LB 1DWGM 5H2BA 4JHOA 1FZOA 3WFEH 1HOCA 1T7ZA 1WAEA 2J55A 1BDYA 2EABA 4U05A 2PBGA 4Q8PA 1ZY9A 3NL5A 4PRHB 1PJWA 2WB5A 2NVCA 4HVBA 2FJSA 4S0HA 1KFLA 1Q6DA 3D47A 1EO8H 2D2OA 5FUCC 3QV6A 4FYTA 2NZ9D 1GVFA 4GGBA 3MC5A 3STLA 2CNZA 3EJTA 4ZO7A 2X4NB 5A16A 3CSTA 3LTVA 1AGBB 1KIPA 3L2LA 5DHMC 4A63A 2FDSA 3C6CA 3PTDA 4XBKA 5C0CA 5LNSA 3L3KA 4PBXA 3V4VH 5IUSA 1EJTC 1NA8A 5DD0H 4B3EA 2V8ZA 2QL1A 5I23A 3GSNH 1HXKA 3IDNB 3FKUS 3HC0A 1XINA 5TE7L 2QR6A 2P52A 3GDKA 2ACQA 4NAFA 2FKPA 1DN2A 3FW6A 1ODZA 2GGHA 2J9ZA 1BLNA 2F61A 3OAZK 1KTDB 3CLEH 2VXUH 3QNXA 5IB4A 5F7KC 1LCOA 3GHRA 3QC0A 4ICCX 3ET9F 3MOBH 5DK2B 3KM2A 2H47C 3NJMA 5DYOA 3UABA 4AE0A 5HYFA 5KITA 2VISB 4O4YL 4G1KA 1OOWA 1PHWA 3QIWB 3WN5B 1IBDA 2DD8H 1I7ZB 2AXGB 1LD9A 1J0YA 3DUHA 5D9PA 4PJ9C 5FL0A 1OZQA 1YPZA 2JB5H 1E2WA 3HJ0A 5LO7A 2IQTA 5LAXA 4X9FA 3UXIA 3TA4D 3MCLH 3QJTB 4X0VA 4K15A 4BFNA 2V9DA 1KT2A 4JIRA 1ZLWH 4K5MA 4UQBA 2P8PA 1ES0A 4BK8A 1B3VA 1ECQA 5AKRA 1QDSA 4G1MA 5BRPA 2QJIA 3D48R 4H1ZA 2WLIB 1PDKB 3RTQD 2A3AA 4R4FL 4BE6A 3EOBB 4DY1A 3CV2A 3EZJB 5H35A 2CLZA 4IKJA 2G9HA 3RWEB 4D3CL 2FVNA 4G6JH 2WYHA 4TYUA 3ULUL 2D3NA 1PLAA 1K8IA 3QO1B 4FZEL 5GGTA 3H7UA 5CZKA 2ICWI 2WBJC 5D5ME 4NRYB 2Y7SA 1WA3A 1BVZA 2RFXB 4KZDL 2HPIA 3OAUL 5GGVY 3L3IB 1D5MB 3STZB 1W0VA 2UZYB 3SDDC 4B7IA 4F7TA 1CECA 2QFRA 3DHJA 2PDMA 2Y8UA 3UR7A 3PP3H 1AI1L 1UOVA 3OPZL 3CL8A 2WCSA 3EYFA 5C7XH 3JS3A 3L4VA 3P84A 5F7AA 4D8PA 2ZWKA 2YA0A 4WKXA 4IM4A 4IS6A 1RJLB 2QADC 4QRNA 2OULB 5BO1L 1BWMA 3M1BB 3BG5A 2W4XA 5DJAA 2P5ED 1PKQE 4KVPA 4MCMA 4EI5A 3QR3A 3RGTA 2HJKA 3KJ6L 3WIIL 2DBLH 4ZUVB 3VTAA 3B3BA 1P7KB 3A9IA 4AMKH 4J23A 4LS1A 3OF6A 1GJUA 4GT7A 1LWIA 1XIIA 1LK2A 3CASA 5I1DB 5K59F 3GMRB 4QTHA 2QF7A 4MB5A 4MLRA 4WUIA 3PV6B 4K7PL 5GRUH 4LLQA 1PDYA 1BWWA 4BFIB 4YDLB 1R6VA 3OKYA 5AUMB 1VEPA 1W91A 4A7QA 2R39A 4FYQA 1VFSA 3EJZD 4U3CA 3VYLA 3WKZA 1S5HA 2PCQA 3BT2H 3MLWH 5C9UA 4NKOB 1FAIH 5DK0B 5HI5D 4JZOA 1USQA 5AYUL 2A83B 3GC3A 3MUZ1 5C0IB 2MKWA 5I6XB 4OCWL 3HAEH 1IMHC 3VCRA 4GBXA 1QOQA 3FTZA 1NC4A 4HIJB 4XPTL 2XBTA 3D18B 1N8WA 1RCYA 2GIYA 4HAFA 5C09E 4NN5B 2GFBA 5AYXA 2DDXA 4LRTA 1TCMA 1QWNA 3ZUNC 2G41A 4G7YL 3QNFA 4ODTH 3TEVA 1I8LA 3RA7L 4PRWA 4KHXL 1PKNA 3TLQA 4FYRA 3DIVA 4U1GB 3NZPA 1BVLA 4BEIA 1OGSA 4Q33A 4P2QB 3BRFA 4AI7A 3RP1A 3FULA 4Y9FA 1NUNB 5JR1L 4C8XA 4OD1L 3FK3A 2DUAA 2YPVH 4XVOA 5I1CL 5DRWB 3ZDYB 3PPGA 4LHUD 4TUOA 3BDYL 3C2VA 1LOQA 1DBMH 3FQ1A 2F2HA 4GRMA 4M7ZC 4XP9L 1EEZB 4Z9KB 3ZYZA 1OF8A 4V33A 2BG5A 1TV3A 1WK0A 3GPEA 3QHFH 3TS8A 4GW4B 3JV6A 2WTPA 3O3AB 2FCBA 4OM0H 3PL6B 4BCEA 1I3VA 1UZ8A 1PCXA 4APQD 1T96A 2VRJA 1LE9A 3WJWA 3OAYK 3QEGH 1BYOA 4HC1H 3ETTA 5D7LE 2ZUXA 2VLRE 3EX1A 4N6RB 3VNIA 3PFMA 1SJEA 4QRUB 1MNSA 3P69A 2DI8A 4KVNL 1Y18A 5HGGS 3PV7A 5F7LB 3DBXA 4MLIA 5DS8A 4BH8B 4ALDA 5KSAB 5A8QA 1HIML 3BUDA 4FKKA 4JDVB 4YE0A 1FQ0A 1FL6A 1R86A 4ZSOA 4RA0C 4YJ5A 1D9KC 3E0GA 2PYFB 4ADJA 3R1ZA 3B9EA 1JD9A 1S7RA 3GKWH 1E9YB 4RMQA 3MI3A 3MRQA 3WENA 1FGNH 1U8JB 3P67A 1VENA 4XVDA 2Y8VA 1CT8A 2CO1A 3LKPB 4KK8D 4OLEA 3GLCA 2DQGH 4ONVA 1KBBA 5HYEA 3CVIH 1D7KA 4NQCE 1DJWA 2XQBH 3RO8A 1F11A 5I8KL 1GZQB 4UBPC 3FPXA 1KYOK 3JV0A 4B3VA 5CKSA 5LG1A 3BPNC 2NY3C 2QQLL 3FO1B 5EF0A 5KTEH 2QYGA 3TIEB 4ZMYA 1PJ9A 1OFAA 2BSRA 3LN5B 3P0VL 2Y7NA 4R0LA 5DQJB 2A3CA 3M0KA 1U4FA 4JO3L 2MNWA 4IM8A 3QISA 1FH5L 4KNUA 2Z8SA 1X98A 4HNOA 4FNRA 4HJGB 2DVUA 5KAQF 5IRPA 4HH8A 2R4SL 4EXBA 4G9FD 5BXFA 4OJDH 5IB5B 1T03H 2HQAA 4LOEA 3UTPE 3HG3A 3OZLA 5I0ZA 2HA1A 1GVRA 5JIWA 3QEQE 2FECI 3D25A 3IGHX 3RVXC 4RW5A 1XH3A 2DV0A 4A3YA 4BF9A 2BP0A 3N4EA 3O4LE 4FEIA 4YDKH 2VDRB 1QI4A 4PJ5A 4DT2A 3T9PA 3GEWB 3RIAK 3TTEA 2M83A 3LDVA 3BP7B 4FFVD 4YE4H 3QFJD 3M0YA 2HTLD 1ML0A 2V5YA 2CFFA 3NSJA 4IGNA 3IDXH 3QS2A 5AKSA 3FUFA 2WW8A 4KKQA 5I30H 5IFJA 1AHMA 3AQYA 3TC3A 1J87A 3GSNL 4OJYA 4R0LB 4Y9AA 5KVGE 2H6OA 3FQXA 1IZCA 4FXFA 1LHZA 1YECL 2K1MA 1LYQA 3QC5X 5IVOA 4GBXC 2H3BA 3TNBA 4EOUA 4L8CA 2IFGA 5IVZB 4PJ8B 5EUOE 4TUKH 4BJHA 3LN9A 1A2YA 2ALDA 4ZD3H 1LO5A 3GTIA 1OGTB 1CT8B 3ESPA 5CJQL 2MCAA 3EJQA 2I5IA 1MF2H 4FOMA 5I18L 3KVJA 2DIAA 2X4OA 5CBIA 1INQA 3RI5K 3CNYA 3IAGC 4S3JA 3KMDA 1S38A 3GTHA 3IJSB 3VI2A 3RWJA 5GJMA 3Q01A 4KTDH 4NJAL 4Y19D 1NKGA 3GSUB 3T2LA 4MS6A 1EFXD 2J4WH 5CSZB 1IUZA 4Q7DA 3DPDA 4XP1L 3W23A 4MJHA 4IK6A 4N6RA 5CCKL 2C5DC 3VNDA 5I07A 4KWOA 3TV3H 3VOGA 3BKJL 3WNNA 5TNVA 3MRBB 1MUJB 1RJQA 4ZZFA 3O6AA 3P30L 1SM9A 1S3HA 2OELA 3O6DA 5K5YA 3PUUA 1LO3L 1A6ZB 2UY6A 5C3TA 2GHZA 4JIQA 5ICYA 2NY3D 2ETWA 3JV6B 4G7VH 1BF5A 4GW4A 1SR0A 4FI7A 4ZOEA 1TDQA 5KVFL 1OHQA 1OTSD 1W1VA 1JRHL 3ZT5A 1YEJH 3HHMA 1PZAA 4JLRA 1RZ7H 1OLLA 3H4FA 4G1EA 2WLLA 4HUNB 1JGDA 3A64A 3VGFA 1U2HA 3SZKC 3NCMA 3WGVB 4XXDA 5HYJA 4PRBA 3P9MB 1IGIH 3ARGA 3QJQB 2QKIA 2AK1L 4JZJA 5JBEA 2EXYD 3VACA 1E70M 1KM1A 2N01B 4G8IB 3V5HA 1S7TB 3OPZH 1WFNA 2LHAA 5CBEA 5C0DA 1BVLB 4F2EA 2IAMD 3UBGA 1CD9B 3NSFA 4Y89A 5HJLA 1KENH 4EO5A 3UJRA 2OBGA 5I17A 2O0TA 3VIHA 4M1CD 1EJWC 3QZMA 2IV9A 5HGDB 4WGVB 4BD4A 1I82A 2XZCH 4JZNB 5ACZB 1I9RH 3BIBX 4TVCA 4KX7A 4L0ZA 2VUKA 4Y4FA 4XNDA 3ZLQC 1KGJA 1K5WA 3QA3B 4UM9B 3CSYB 2R94A 3DDMA 4ZMPA 3DETC 1ZRUA 4LOUD 2G2PA 3VZXA 3DUGA 3SADA 4S3GA 3QUMA 2CJTA 3B0VC 4FNLL 3W7RA 1F58L 3GNDA 4LTSA 5D09A 3FF8A 4NQVB 2Z8RA 2INFA 3LM7A 3WBWA 5ESAA 2DYSB 1NMBH 1BX2B 2FH6A 5I66B 5JPNC 5JPMB 4DOHE 5LHDA 3LI1A 2BY3A 5FA4B 1HKFA 4XOEA 1AMXA 3VD1A 1U8MB 1KWGA 2PI6A 5K4ZA 5D9SB 2H32A 2XUWA 1VKXA 1CMOA 2QGEA 3I74A 5F1UA 3V6OA 4Y9MA 4JGNA 1Q8JA 2BM3A 1SFJA 4GNVA 5LGHH 3V0JA 3DK2A 4UOW1 3TMQA 5MHBA 2VGGA 1K4CA 3HE6C 3IAQA 1L9RA 3S9ZA 1DHPA 3QKEA 4UTUA 5DJAB 4XAWH 5T1LA 2GTWB 1I6NA 4NI8A 1V0MA 1J8HE 4Z76B 5KSVB 4EKJA 1JNHA 1RJLA 4PRNA 4Q9RH 2N3JA 4JX0A 3AYVA 3AZUA 4JKPL 4BR1A 4UQ3A 2EP6A 1HKLL 2P47B 4LSQH 4HKXB 3MSDA 4AOFA 4M5YH 4PMJA 2AERT 3DVNA 2B39A 5F7DA 3LG3A 5GGRB 1KY6A 2Z34A 3ZFHA 3QCUL 3BDKA 1L6PA 3WELA 4K1WA 5GGQL 4LSTH 3SKOA 3KPPB 3UIZA 1X6LA 4I89A 1E4IA 3ITOA 1BBDH 5D4JA 4UTTC 4FA7B 3O6KH 3RITA 1QFPA 1RU9H 5F7NC 1SFTA 3V0VA 3K2GA 3VTTA 2GQ8A 3DKHA 1GKQA 2WHKA 4NJJA 5IFPA 2VUOA 3OA3A 1D3CA 3MRNA 4RGND 1FDLH 1AGFA 4DW2L 3NCYP 1JNNL 2Q76B 1MOEA 2OYPA 4OJFH 3QRHA 3LZLA 3NZRA 1C8QA 4RAUB 2ZDSA 4O2EA 4OF5A 1ZFJA 5CEWA 2V3GA 4ZQOA 1DVXA 4W81A 1PQZA 1DBJH 1NLBL 3WDIA 5BZXA 4OZHA 1ZAIA 3QMTA 7TAAA 1QTWA 1KC5L 4E5TA 2A4AA 4JY6A 5I19L 3WE1A 3DETD 1PX8A 4LOUC 4ORGB 1QCWA 2AXGA 3VD0A 4GXWA 5BXSA 4F57H 4IJ3C 5I2IB 3EYSL 3SODB 4Z5RB 1TOXA 1DSFL 2DU2A 2DM3A 4GS7B 4WWKC 4KKZA 3RNDA 1MFBH 4NVTA 1W2VA 1GOHA 1E6JH 3NAAH 1TENA 3ZDZB 1PLGL 4Q58C 5KYXB 5DWUH 1BD2D 3BWSA 2Q8XA 3SUTA 1KGXA 4PJFF 1MZRA 1KOAA 1PY9A 4F4RA 2J79A 1AS8A 4H0GA 4RV8A 2XDFA 2H9GB 1CFBA 5AZEL 1Z5LA 3N3MA 5FAGA 2OKTA 2JCCF 5IXEA 3KGSA 3Q94A 4KV5F 1QFHA 4KKLC 1ZTXL 4QTIL 1TV5A 4OUEA 1NDMB 4G6AD 5D71H 5IHLB 4TQ8A 1IEBB 4ZX3A 1DQQB 3AM8C 2JKJA 1FP9A 2XFFA 1TYGA 1HJVA 3DMMA 1LORA 2DGAA 1KIPB 1LOSA 4TXVB 3F2BA 1SJHA 3BKCH 3AS2A 4R84A 1YIXA 4UAOC 6TAAA 2C7UB 4NO0D 4PD4K 1UWXK 1KW1A 3APTA 4Q4KA 2B1HH 3UY8A 5IV2A 4AY1A 3ZWSA 2ARJA 4MFHA 1NFGA 1B90A 2J88L 5DMNA 2DIKA 3DX9B 4LUTA 2AEOA 4I85A 3SJ3A 2J12B 2A7RA 3QJZA 3BJTA 4IFRA 2O6PA 2QHRL 3SUUA 3BAYA 3PPSA 2O4QA 1IC1A 4XRCB 3RA7H 1EFXB 1S7WA 1UZHA 2J8OA 3VGAB 4QPEA 2G3IA 3VWKA 2QVIA 2IS7A 1GEQA 3TF4A 4FCHA 4Q0XL 4J5NA 4RWYH 3B4NA 4B91A 1VPQA 2I16A 3BHBB 1M41A 3Q6FA 4JO8A 2BRRL 5H4YA 4YHKL 3U83A 1SPQA 1E9ZB 1VACA 5HQEA 3U6WA 3DFSA 1UG9A 1G7JA 3GDCA 4DKEL 3C6LC 2H90A 3BZDA 4B96A 3SGJA 2EIJB 1FL5B 3JWOH 3RWCA 5FM8A 4KHTH 1B4KA 4MZYA 3B8IA 5AAWC 2EYRA 4J3SA 4A55A 2F74B 2EHHA 4L4VB 1TPB1 1U2YA 4AY7A 1A6ZA 3C09B 1EVTC 4X6FA 1WX0A 1ZQ5A 1JYNA 3KOZA 3BMVA 2Z7YA 1OV8A 2F7QA 2HG0A 5EIVA 1UXSA 2V2CA 1RVFH 2XA3A 1NMBL 5DD5H 3TNMB 4BA8A 2P8CA 1AQ8A 3W1PA 4N02A 2BXZA 1WOAA 3AS3A 2A4CA 3CB3A 3GDTA 5FF3A 1QBBA 1OP9A 3BLBA 3PK7A 4H01A 5DZJA 3KRSA 3FKRA 3H6OA 2J8HA 2VN6A 4MQXD 1WBHA 1CURA 1MH5A 1V3LA 2J7FA 3LZOA 1N6UA 3CC5B 4JRXD 5EC1B 1AGEA 4LJ3A 1BVNP 1UR4A 3GFYA 3PSWA 1EBHA 5DMMA 4X98B 3O15A 5TBOA 5DC4B 3BMWA 3EXRA 1A7OL 2UZXB 4OUOA 4O2FB 2IOOA 1K2DA 5EFFA 1TZGL 4TVDA 1XZ0B 2HKHH 2XY1A 1GJPA 4HX1A 2WM0A 5AW9B 2LOEA 4GIRA 2Z91A 5C6MA 4J1UB 3FA4A 3VO0A 1L6YA 4IP4A 4Y2OA 3MV9B 3FNDA 2ZAGA 1DXFA 1J86A 3B8YA 4LGRB 3QFJE 5EA0H 3CH0A 3K1KC 4QJ1A 4K23L 3VFGH 1VLIA 2WYIA 1HP5A 4NO0B 2MEJB 1YEWA 2R2CA 32C2B 1JCLA 1K8ZA 4LGXA 1R46A 2B3IA 1G4PA 4OGAC 4QRRE 3NIDB 4QHLB 2OMYB 2ERJC 1AQDA 1HSAA 3O8XD 2BNJA 3BZJA 3S5NA 1W0YT 4C6QA 1ZHLA 4OT1L 2FHBA 3FCSA 3GXDA 2YAMA 4F2MB 1NGWA 1RAMA 1VPYA 4R85A 2JCWA 2W0FA 4XGZA 4GUQA 2V30A 3EDJA 4PEEA 1TTJA 2Z1XA 5XINA 2WXNA 2DQMA 4HEPA 1KYFA 1DDHA 3KHOA 4N4QA 2BDNL 4IGBB 1W8OA 2WWMC 4LCWA 4M9OA 3WFEL 1HL2A 3H4XA 4DO4A 3GC2A 4KTGA 3C6LD 1SVBA 4CDGC 5DN1A 3Q2NA 1GKPA 2IV8A 1CR9L 1X4XA 4JO1H 1U1HA 3SYCA 4XCYA 4DYKA 1B4TA 4F8PA 1OSYA 3VM7A 2X7LB 5G1TA 2WJFA 3W2KA 1SVZA 2AK4E 5GS2D 3PWNA 3VAEA 1K72A 5B1BB 5TGBA 5IVNA 5BUAA 1TX2A 1VGAA 2PC4A 3LOWA 1CL7L 3WD5H 3LCHA 4LLDB 3GKFA 3D9AL 3C5XA 2QKIC 2BSTA 1J9RA 4JZJC 2FPTA 4Q4OA 1IAOB 1F4YH 3JVAA 3NCOA 4MD4B 1E4KC 4BBWA 3R18A 2FSDA 2ZRZA 4F92B 4WUUD 5DMGC 1DN0A 1A02N 1XD1A 4GW5B 3KBVA 3L65A 4NNXA 5HI4D 2GWNA 2PYFA 3W25A 1XSIA 4QRFA 1N0LA 4QXWA 4Y2DB 1BJ1J 3CHRA 4O17A 4FA3A 3L4CA 4WW2B 1YRRA 4HJSA 5HI3D 4GABA 1L3NA 1V02E 3WYRA 1E0VA 1KXQA 6PCYA 2HVBA 3TPUB 3U36B 1NCAL 4WEMB 3TCXA 3WJJA 5F1KC 3P7YA 5AAPA 5JZ7C 4F9PC 3LHPH 4N8VA 1KCUL 4Y16A 5INCA 1UWGL 1AXSA 4GYKA 1XTMA 1C08A 1MY7A 5HHNA 4UT7L 2WMIB 4LY8A 5DURB 3O05A 1FDLL 5J89A 4FADA 5DXWA 3HO8A 5H1WA 5F2FA 2CESA 2QHRH 4JFHE 1B4LA 2Y07H 1BAGA 4HAGA 5LNGA 2R1LA 3EHBB 2PYEB 2V7NB 4NXSA 2KZHA 1LO0L 2WIMA 1DSWA 4OZ4A 1JR1A 3UG5A 3RYSA 3GI9L 4ENZA 3GSNB 1N6VA 1VZWA 3ZJ8A 3FFDB 4N8VG 2K0RA 2NSXA 3AITA 4LEBA 1F02I 4MNMA 4GC4A 4OGAD 1T21B 3COOA 3WJMA 3OGCA 5JW3H 1H51A 2YGYA 4KOCA 4GAJL 4KQ4H 3SGEH 1JE6A 5A3ID 3CZ8A 2B9BA 3DG3A 3LV6A 1A9EB 4JE0A 4YSRA 3PP3K 3UTSE 2A21A 2R7EB 3KPRA 5LLIC 1RSCA 4NX5A 2BJMH 4CNSA 4WW1A 2ACSA 3ZTNL 4OKVB 2WWMD 3CCHA 4I9AA 4QSFA 2EE2A 2VMFA 3QULB 3JWNG 1A64A 3C5ZC 1TJRA 3ZE0E 3QZLA 1V3HA 2A9NH 1J5CA 4NKOA 5DK0A 1AXTH 2VRAA 1Q9LB 3J07A 4HS3B 4O9HL 1EHAA 1C9DA 1EEUA 1RZJH 4R5XA 5J9PB 1VCGA 4H9TA 2W60A 2D4DA 4F7CA 4ZUTA 1G1YA 3HCVA 5DZAA 1YUKB 2ZSVA 4X8JA 2G4GA 4NU7A 5F6HJ 4S1FA 5CAYB 3MRPB 3WS3A 2Q9OA 3UMTA 2BWQA 8PAZA 4XCCL 4HIQA 2WCAA 3W6MA 3KYKH 4A05A 2C1PB 4DN3H 3M0HA 5EU6A 1IZJA 1P4BH 3QEQA 2MCMA 5BOJA 4GKSB 2X40A 3W75A 3DFNA 4S1SH 1HWWA 3AXLB 4IMCA 1MNUL 1YVLA 3HZVB 4KQ0A 4XC1L 3AWOA 2AEIT 3O8XA 2XG4B 1BXAA 1OYAA 1OAUL 3J2PA 4PVNA 3B4UA 4PGZA 5A7EA 2OX4A 1QSEE 4NEHB 3LDBC 4OW6A 5FHAH 2OP4L 1NKOA 2DJ4A 4LCCA 4D8PB 2G3ZA 2Z35B 3TA3C 3CFUA 4IK7A 4PL1A 3GK8L 4W6XB 4IHOB 4NN7B 5CKGA 4KXZH 3W39B 5D4YA 2AZUA 4Z7VB 4YQXH 1JZEA 4ZDHB 5GGQH 4FJYA 4ELKA 5GS1B 1FHLA 2F0CA 1RJZB 1R0AH 3NNTA 5BRZD 4G7QB 5C0GB 2VX5A 4NKIH 1I85A 5IHWA 4OCLC 1Q94B 4ELME 4Z0XB 3U25A 1FJ1A 3FAWA 1JGUL 2OMWB 3CZKA 5HVWA 3FCUB 1ONRA 3WLBA 2XETA 4HF5H 1PKLA 5JIKA 1NEZA 1YXDA 3RHWK 5BROA 1KCWA 2PDKA 4JRWA 2O5YL 1LM1A 3QZ6A 1MRCL 4OJFL 1EEXA 3EOSA 1D2PA 3N85L 5B38B 5AD0A 1XBDA 3D4YA 2XDHA 3UP8A 3MTXA 2PA6A 4HLZH 2IC2A 3UCDA 3T4YA 3GHTA 2J2ZA 3ILEA 5JU6A 3VFVB 2ADIA 5CJQH 1NFDE 3CC1A 4TVPL 3DZ1A 2J3SA 2VW7A 2OXNA 3C5ZD 4AMKL 1ZP4A 5CZ0A 1U5VA 4JG9A 1T0PB 5DXYA 3QKZA 3BSZH 5FOBA 1OBAA 4MAYA 1K3IA 2NZ9C 4NUMA 4WKZA 5TPWL 4DKFL 3BDYH 5LWYH 3E96A 4GVIA 5GZNC 3ONCA 4O02B 5K9JL 2A74B 2R1PA 4YDJA 1J4EA 5IB4B 1F8TL 1IM9A 1KTDA 1F90H 4GSDH 1UBPC 5ABGA 2PTZA 1J96A 2YYTA 1XHGA 5GSVA 5CLTA 3VKAA 4Y2NA 1FHGA 1UD5A 3TBTA 4JQ3A 2WD0A 4YIQA 1VBGA 1T5WB 4CDHA 5C0EB 1DWJM 3IRSA 5F9OH 1MCNA 2ENSA 3OGOE 3FEMA 1GOQA 4PE8A 1PGRB 1WH0A 1UOLA 2YGOA 4ZUUA 1BYNA 3HFMH 3FB6B 1UB5A 2AANA 4G42A 5I76B 1OFRA 3QM3A 5HANA 2Q1EA 1VFBA 3MLRH 5C0CB 1OCNA 3TN4A 4FQ1L 4JX4A 2J5WA 3NT0A 3MJ7B 1QRNA 3PPEA 3U46A 3NP4A 4FXGB 3RWFB 3TJHD 1WAUA 2V17H 3AYSA 3RY6C 3PG9A 1IBYA 2VDGA 4OM1H 3LKQA 4I0CC 1ICTA 2OKMA 5IFAL 4KO9A 1OANA 3OVPA 2P3ZA 3WZ0E 3LXAA 4RX4D 5C0ND 1HK6A 1R3QA 4KRZA 4F9JA 2ADIB 1CCWB 1SYVA 2QT3A 4PRHA 1FH5H 3H7LA 4ZFOB 1YQVH 3VDBA 3ASOB 1V93A 4F58H 1JPKA 2X9XA 2HT4D 1EEPA 2G8ZA 3HA1A 5E6IC 1JNDA 4JTJA 4DJDD 3S9IA 2R4SH 4U1LA 2OJZH 1P5BA 5HMEA 3TBSA 5AB9A 1G1KA 1NZRA 2VLJE 3MBWB 4E41D 1JPMA 2EKSB 5LAPA 2BV9A 2PTTA 4GG6F 2NQ9A 1NUFA 1MLCB 3ZE2B 4QDGA 4IMLB 4AK1A 1ZTMA 3EOOA 1VBHA 2JCCE 4XPGL 5SWSA 3FFOA 2P10A 4JMNA 3MJ8B 4WWKB 3T2QA 4PFMA 2ISVA 3FN0L 4YSSA 3QIBB 4JPSA 1F3RB 2W3ZA 1Q94A 2H2PD 3MX0A 4R4BA 5BW7A 1YN6B 1YSOA 1AO7A 3ZE2E 3RRAA 1A6TB 3ECVA 4NWTH 1YE4A 2DQCL 2OMZB 5JIMA 4WU5A 1EQPA 4EN3C 2ADGB 2A1WL 4FQXA 1OGPA 3OVGA 3Q5YA 5HSFA 4KESA 2VEPA 2KDYA 2GJZA 1U91A 3RGVB 4H2AA 4ZMQA 4MUPA 3LVTA 3T0ED 5H8MA 5HYQA 4TUKL 5MEQB 4H9ZA 3PZGA 3P73B 3TYDA 4KWVA 5M3WA 4HIIA 1FCVA 1FSKB 3MNMA 3MREA 5D1XC 3WY3A 1HS6A 4B41A 2NY0B 2A1YA 5JQ6H 3AXLA 3N2CA 3B7TA 3P8IA 3WH5A 5MI0B 2EC9T 4LOFA 1AVAA 1UVQA 5AOZA 3TW6A 1THFD 4PCPA 3SCOA 5A95A 1TA3A 2VQ1A 4CC4A 4FLSA 1QR1A 1W37A 4Y8EA 5JQ9A 4E2OA 5BV7C 4FQLH 1DE4B 4BFGA 1FWCC 3AWNA 4R33A 1HILA 4LESA 4JFTA 3MCYA 5E9DA 3E0FA 3TAOA 4AU0A 3IJ7A 3NJGA 5K69A 3ZVHA 5C2XA 1FNSH 3HQNA 3GIPA 3GHSA 3CU1A 4DF9A 3AU2A 5D72H 5CP3A 3AAMA 4FDWA 4CKQA 5I1GL 3NIYA 3PULA 1XRSA 5LGXA 1PZ5B 1J88A 3L3GA 2EO9A 4RZBA 4PRDA 1J93A 2J57A 2R4RL 3CLMA 3BIKB 3S2AA 3VFGL 4MX7B 2GDUA 2OSLA 3HG1B 1N2RA 2XLLA 1W16A 3QFDA 1DL7L 1IL1A 1YQ2A 4XBEH 1P0DA 4JRFA 3AABA 5IQ7H 1OX6A 2PB1A 5C2GA 1ZSDB 5DD3L 3AXHA 3GSXA 1M2OA 3IJYA 4FOJA 1NLBH 4KK5D 2PSNA 4EI5C 4HWNA 4YHLL 2EDBA 1BYDA 5I0WA 1CJYA 5IMMA 4E0RB 5DX7A 4HBCL 1RV6X 2RTTA 4AMCA 2V5MA 2N7SA 3KDMA 1L7TH 2Y85A 4IIBA 4OOUA 4LOVA 4XPFL 3JQOB 1JGIA 4C59B 4GJIA 4K5PA 4H88H 4MUZA 3CBWA 3L7FB 4LPVA 3CE1A 4OF3A 1TZ9A 4UDTA 4I7UA 4DI8A 5I03A 3WSUA 1J12A 2NNAA 4CMHB 4W68A 3G0SA 2F54D 4N2LA 1YNQA 2AVGA 3W29A 1R8LA 4Y16B 3S37L 4HWEH 4NIYE 2HE8A 2FFCA 3W2DH 2JK5B 4GLRH 3U36A 1A7RH 5DCDA 3GNXA 3QZPA 2PTUA 1MCJA 1UB5B 3M1CA 1CF1A 4CJ1A 1O5QA 1BEYL 3IN2A 1RZIB 2JKIS 4WIQA 5L88L 2F7FA 3DFTA 4YTUA 5D4QA 1TNMA 4PGEB 3WMPA 5E6UB 3GJEB 1PTDA 5G2HA 3SRDA 2VC6A 4MDIA 1OT4A 5CNHA 4NNXB 1NQKA 5FJRA 3V5DB 4ZE4A 5E95B 5D8JL 3Q3GA 4MCZA 1WHPA 1IGFH 4AQEB 1SLXA 1NMCC 2D0HA 2PP7A 4FFYA 5KVFH 2ONEA 3WXWL 4FQJH 5DQ9B 3HM7A 3G6JE 2R29H 2EE0A 1KZQA 5EBWB 3RAOA 5HQLA 1DJGA 3NJHA 4WKZB 1LDSA 3KJ4B 5FF2A 2VDQB 4HLJA 1JCXA 1L5GB 4M6MH 4N42A 3QOKA 5ERWA 1I8MA 1FTXA 3TLRA 3S0PA 4G6FD 1X1OA 4P2VA 3EYQD 2EH8L 1WNOA 3K2MC 4ZW7A 4Z1DA 3UZJA 3GMOA 4UIMB 1YPZE 2JXMA 3HS0C 2HX7A 3SJVB 3HBQA 2Q8ZA 2PW2B 4H6KA 4LVDA 3T8XB 1X7FA 4R7WA 1V7AA 4Y9EA 2NXZD 3BEVB 4I48A 1TVBB 4DP0X 1IQDA 2I9LB 5EDSA 1XXXA 1N8ZB 1PBGA 4NUJB 3DHDA 4F2MA 3S46A 4YTSA 4GO6B 1A7PL 1U41A 1OALA 3BSZL 3NYKA 3Q5OA 4DCQB 3G6LA 4XNUL 2E6YA 4ZFMA 2E40A 5D37A 4LP4A 2APBA 1BP3B 4EWJA 3DOPA 3MRMB 3N1AA 2XVGA 4JPKH 4M3KB 3TBWA 1R9XA 1AL7A 4HNLA 1RBOB 2OFJA 4AWUA 3BLKA 4DM2A 5GS1A 4LCCC 1BIIA 3FU5A 1JHKH 1XFPA 3KPOA 1RUAL 1T99A 2Y24A 2ZXWB 4B16A 5D5MA 3V79C 4LL4A 4HK6A 2EACA 2X1XR 4YFDB 1B31A 2H6RA 3H42L 4LB3A 3BZGA 3C61A 1TUXA 2XZAL 3OB0H 4TV5A 2ESVB 1NARA 2CCLA 2AGTA 1AR1B 2EADA 2VWEC 3VG9B 4O14A 4X5WA 4NKCA 2X2HA 4N2OA 3RX9A 3TCTA 1A66A 1QOXA 2HLEB 2CWRA 7PCYA 2XISA 3TU9A 3TR2A 3EHBC 2IAMB 4WLCA 1S5IH 3KYNB 4AVOA 4IFKB 1EAQA 3M0JA 3CX5K 4E2DA 1ZBCA 3EEZA 2XH4A 2OEKA 2LAAA 4PJ5D 3L5MA 4IFKA 1T6WA 1JPHA 1VFFA 5BNXD 3H54A 1G94A 2G9KA 1NICA 3IFLH 4NC1C 1OQFA 1Q6CA 4F7CB 4AVIA 3KHDA 3IVKB 3NABL 4Y4HD 1DIKA 1D5ZB 2EG6A 3MHFA 2ESVA 4I9MA 3DIPA 2Y5QA 1JZHA 1ISZA 2VCBA 3S2MA 2VN7A 1FN4A 3W1XA 1G7MA 1MHCB 3TH6A 1NBVH 1SXAA 1FIEA 4XZNX 4L4VA 4HUUA 2AEQH 2IH1B 4I5UA 1TIUA 3CSFA 4MAZA 4OLXH 2AK4A 5BOFA 4Y4HB 4LAQH 3IJ9A 4KK9D 3TBWB 4WY0B 2PCFB 3N5AA 2X1QA 4UIKH 1QTSA 2O6CA 1Z9LA 3IM1A 3RIFF 1T5XA 1T6MA 4XB3A 4NPYA 2BS71 4K8RH 3BHBA 5AW7B 2WHLA 3CQIA 1UYWL 2X4PA 2ZKHH 2DTML 4K3EL 3VC6A 4DWDA 2FIRT 1VCAA 1XR8A 4DVRH 4K8RC 5CZXD 5CCHE 1NCOA 1EGJH 2Y7MA 4HGMA 2CG9X 1Q4WA 4UIMA 1M3UA 2QMJA 4P46C 1XIWD 2HPTA 1ZCCA 3PM6A 3QEZA 4O02L 2YXWA 4R2GB 4OI8A 3PL6C 3SGUA 4WK0B 2YGVA 3NQAA 3NCEB 5E00A 4LMQE 3ZIYA 1VJSA 4D7BA 3KYAA 3O0RL 4KUCD 3T3PB 3WY1A 4N6FA 3K72B 4UTBL 4MJ4A 3R6IA 3CQ0A 3UR8A 5HHNB 4WJ5A 1QFWM 2P8MB 2QZ5A 2VXTL 3HE7D 4XXCC 1TELA 2J1XA 5E6IA 4R83A 4WDXA 4E4PA 3D2TA 4F40A 3W7QA 4ZT1A 1SJHB 1F3XA 2REQB 4FX5A 3D4GA 5KSBB 5KYUA 1E7VA 1P5UC 2GI7A 3KL0A 4KDTC 4OFDA 4BZ2H 3KZSA 4DZ5A 4XMZA 1KBIA 1YX1A 4U0QB 4P05A 5B21A 1J5OH 3JTTA 2J72A 5IIEA 2WAQA 4PGBA 3GYEA 3R13A 3AMGA 1AHWA 4HULB 3SJNA 2HMCA 1QBLH 1DBAH 4M5ZL 1FFQA 2AJSL 1OW0A 2ZE3A 5FLVA 4G9FB 2Z6JA 1HKJA 3LD8B 1DBKH 4UTAA 1WITA 3VH8G 1A5BA 3ABGA 2PETA 2I26N 2UXTA 4OFYD 2ZA1A 1IAMA 2R29L 5I6XC 4ODHH 1A7OH 5F6HI 3SRKA 5IEHA 2OLAA 4UMGA 4ACTA 3CVIL 4HS8L 2NY2D 1DHKA 1E0TA 3BAWA 2HKHL 2PP1A 4YWGL 3D0AA 4OF6A 5TGBB 3LQAL 4PJAA 4BKLA 1NDYA 3KX6A 4IUOA 4M8QB 3VMOA 1A6UH 3ZZQA 4UFHA 3W72A 3ARRA 1OP5K 2IOIA 3H7BA 3N1MC 2EUZA 3OMNB 1CFQB 5F7EH 4BSVB 1IIHA 4U3XA 1C16A 2WXMA 1KLYA 2NY7H 4LVOB 2NY5H 1KFKA 1YYAA 1G4RA 4O2EB 1E5BA 3LKOB 2EXOA 2WZ6A 3KYMB 5CPOA 1JN6A 2E8ZA 3FCTA 1JUFB 4L4TA 3SDXB 1F73A 3RG6A 3BUIA 4IX2A 2Q0ZX 1SY6A 3MRNB 5E2UH 4PTNA 3WL0A 2F8OA 5K59E 1QW7A 4MAYC 1F6KA 2VX4A 4XNUH 4QM1A 5D9NA 4CEUC 1SOQA 1AG0A 3WIHL 1F18A 4PJAF 4CADA 5FYLE 3M0XA 2NY4B 2CKBH 3WLOA 3QFDB 3BP6B 2JGYA 3RVWD 3G1XA 5GGVL 2ZXQA 3IS1X 1A80A 2FPVA 3GSVA 3KP0A 2IMMA 1NAKH 2E47A 2JJTC 5FKPB 4Y16D 5IGXL 3W22A 4FLRA 4JTSA 4ODXB 1PZ5A 3L3GB 4KX8A 4O13A 2PGEA 5LBVA 1JUBA 2X9WA 2WBGA 4C90A 3X1BA 2IEPA 3CT7A 4AYEC 3LK6A 1SFHA 4YDIL 4CW1A 3BURA 4HX1B 2OG9A 4XAGA 3RU8L 1XAKA 4ZPVA 1HILB 1WT5A 1TZ8A 4JHAL 2UZXA 4MMXC 5C08B 2GTWA 3RDJA 3NIDE 3SM0A 1MCFA 4IRJD 4NBYB 3DKLA 1L9NA 4ETQB 3B9DA 1K4CB 3HB3D 3WKML 2GVYA 1BYAA 1EAPA 2VJXA 3HAEG 4LK4A 1OT2A 1OTUC 4PY8I 3QDJD 2R8SH 4Y2LA 4XWGL 4P8WA 3W6YA 4KJPC 4AX7A 2PD5A 1UXLA 1UA6H 4M1GL 1IM3B 3G3DA 3ILPA 2V2WB 1IEQA 3BN3B 1JFXA 1TX0A 4MSWA 4OZFB 3RVTC 5D32A 2D7MA 1AC0A 5J5DA 2YKKA 1HL9A 3DX7B 2BCKA 3LIZH 4FQHA 4YVVA 3BJFA 1VFAB 1UXSB 3H2FA 2GJZB 3RGVA 4M43L 2VX7A 4ZB5A 1HAUA 2YX0A 1QMUA 2XZQL 3C6LA 1U5HA 1YNTA 1MHEB 4C56E 4G2AA 2Q09A 3ENEA 1PVNA 3VKDA 3OODA 1KB5H 3KXFE 2OOFA 2VEIA 3VIGA 4B5TA 2VH5H 1NWOA 1G67A 1V6VA 1P48A 4F91B 1BOGB 4PWJA 4R4BB 1Q90A 5DVLA 1QI5A 5FHBL 4W5UA 4MZ3A 4X8CA 1VACB 2QDHA 4K8RL 5D55A 4KPHL 4WTZA 4X63A 5DYFA 1LYXA 3LGDA 4P9HC 2V3FA 4CNTA 1A5CA 2RH9A 2YEVB 3FOMA 4IMLA 1K6WA 2Z4TA 2OTUB 4D8OA 4XAZA 1F2XK 3O3DA 1I3UA 2NUPA 1BAFL 4O16A 2AGKA 1EQWA 2IDCA 5DRZB 3WTUA 4LBEB 3VI4E 4ENLA 5B7ZA 1D8CA 4KAQH 2ODHA 3UWVA 1JGDB 3V0UA 1T2JA 1ZV2A 4ZFOA 1S3KL 2HT3C 2OMXA 3EOLA 1SN0A 2PCEA 4RLIA 3Q13A 2Y2WA 1PTGA 3IJIA 2J7HA 1EOMA 4XTRC 3U1PA 4FR6A 4XMKH 4LVNC 3CIWA 1NDVA 3VZYA 1UACL 3CT2A 2VR3A 2YWZA 4Z7UE 1JQVA 1CDHA 3RLVA 4I5XA 1BVWA 4H2HA 2D31B 3P0GB 2A77H 4XD4A 2DMCA 3DBSA 4HIHA 1V05A 1F1GA 2B1OA 3GI8H 5ITBH 3LV3A 1NDMA 3TFKD 4UM8A 1KFJA 3TYEA 4MNHB 3TX4A 2YD3A 5DD6A 1XL9A 1RMFH 2IPKA 4YXHL 4F93B 1Z5LB 3HB3C 1A1MA 2OB3A 4LSUL 3EOEA 5AVNA 2MTPA 3CX5J 5GSVB 3WY2A 2C1GA 3UH8A 4OGXH 4HIXH 1VPOH 2O72A 3P0XA 3SKNB 3IVTA 1MWAA 1IM9B 5H2ZA 5J04A 4KJPD 3KGTA 1WFTA 5D7KE 3WFBH 4M00A 5HVHC 1ID2A 1P6CA 1LNUB 4BI5A 3TN0B 2PMZA 2X6UA 3SO3B 1G7LB 5IB1B 1JZ4A 4Z5RA 1GGOA 4WFHE 4AXKA 4L1DA 4ERAA 3QYCA 3AIEA 4WTQA 3T65A 1XICA 1M7XA 1BF8A 4E42A 1LF1A 1KELH 2N59A 4XVUC 2EIBA 2VXQH 2YQ2A 3D2UB 1F74A 1VKFA 4OZHB 2QJMA 1BA9A 2VWSA 4LHQB 3T2NH 3ANVA 5TAOA 3VOCA 3GZAA 3NSDA 4CJ0A 2F08A 5BZWA 3WMBA 4UANA 3T6ZA 3UWUA 4AEIH 1SHSA 2DWDB 3RZWA 5AD0B 4PLKD 3ARZA 2IH3B 5IFHH 3BVDB 1N70A 4LS0A 4K7VA 3MMDA 3BUVA 4POCA 4LNRB 4CCCA 4C1NA 1XUUA 1QX1A 1JHLL 1S9YA 4B4FA 3UACA 1HYSC 4LSRH 3X12A 2CRZA 1J01A 4PW3A 3L4YA 3S5ZA 2CKBL 2Z2BA 2OMWA 2I5YL 4DF2A 1FJ1B 1URLA 1M65A 3S4SB 2GTZA 5FECA 2DSUA 1ULVA 3V0AC 4PRIA 3KCPB 5GGVH 3WUEA 3WJSA 1ZS2A 4HUMB 2BY2A 1DKWA 1FWFC 1SPDA 3UZ5A 3EFOA 2ANUA 3DVNB 4QRPA 4ZX4A 5JQ6L 4CNPA 3QDGA 1MVYA 5ICUA 3C8KA 3UX9B 5D2XA 4P3DB 1MRCH 3KPLB 3NFUA 4WK4B 5KSUA 4Y5XA 3L68A 5CGYC 1JNHB 4OZHE 2PWGA 2YSSA 3QDAA 1UWQA 2BK8A 2VJ8A 1W5MA 2FZBA 2NXGA 5EYWA 5EV7A 3DUSA 4AVFA 4ZPTA 5I8EA 2KBGA 1YMYA 4YTQA 5G1MA 1E6JL 3DGGB 4RMUA 5EPMB 4LANA 4RNRA 2GYIA 1I7UB 3CK0L 3ZRSA 6CGTA 1P7TA 4G8TA 4OF7A 3GS6A 1JI2A 2PXYB 3W02A 4K9JA 5HI4C 4U7MA 4YL9A 1F3TA 2ZXEB 5AYTA 3T1GA 3AWFA 1KN4L 4GPVA 4X9GA 2ZCGA 3ROOB 2PDGA 1CDJA 3G08B 3I6KB 4X8JB 3PE9A 2WXIA 1KBPA 2HLAA 1HJCA 2YBRA 1I4FA 3HA0A 3QDHA 3SQOL 1IARB 3NRFA 4N9BA 2PWUA 1F41A 4PGDB 2E75C 3AO0A 2OMVB 4QDPA 5AC5A 3E6HB 3PCYA 3FN3A 3M88A 5FCUL 4DWSC 4GI6A 4Z0JA 2OL3B 3QUMB 1GOIA 1MDRA 2E3VA 1EEQA 3GG1A 1EXBA 4GG9A 3QA3A 3S42A 2RA1A 2NUWA 5FXCH 1UJPA 3R11A 4AH2A 1TVNA 1CK0L 3FO9B 3MGOB 3N1QC 4OLZH 3UYRL 2VUYA 3V8OA 4YEFA 5F7HA 3ZXWA 1XLGA 3KPRB 4GVHA 4I0KA 2WV8A 3PNZA 1B2WL 3LHTA 4FX8A 3BLLA 3QZOA 5TDOA 3UR5A 4DM1A 4AW7A 2Z7UA 4KUZL 3BIAX 4PG9A 5C0DB 1XF4B 1K70A 4QS5A 4PYSA 1B0WA 4M5YL 2UX6A 4TNVK 1SFSA 1UT1A 5IVXF 1ZL1A 2ALRA 3RDTD 2Q3RA 1DVUA 1FC1A 1A22B 3MV9E 4OZ4B 4PJFA 2GITB 4FX7A 1L6SA 2X2UA 5J6HA 4QEEA 3D7PA 5IW1A 4HJ0D 4FNUA 3QUHA 4QY8B 4YSEA 1LT7A 4G1EB 3LHVA 3PHSA 3WIHA 3B2VH 4JHMA 4LH8A 3NXLA 4JFPA 1VC4A 3PZNA 5A8OA 4XPGH 2DV6A 5C0IA 1AXSB 2DAVA 2G5BB 5ILTL 2E7FA 4QIRA 4KS0A 2OMVA 3QJUB 1JXGA 2IOMA 3NPSC 4WCYL 4FG2A 3MVSA 2VQUA 2SFPA 3QV7A 1ZXKA 2C3GA 4ZNEA 4GYPC 2DLTA 2OMBA 2W94A 3TWBA 4X8GA 5CEYA 1WOBA 4LUYA 5DD0L 2B3RA 3PG2A 3ETBF 3ROOA 3LQGA 5EO1A 1QLEB 1DBJL 3NDYE 2JE8A 4M0XA 1R3KA 4OIAA 4M7KH 2W88A 1M7UA 3FUDA 4IDJL 2RR3A 1VSCA 1MXGA 1KBGH 4AQ1A 4QNPF 1KFAH 3M07A 3GRWH 4C6LA 3IK2A 1ZKAA 4YL4A 1XG4A 2G3NA 2CZFA 4PMOA 4UTWA 3BPNB 1OFEA 3QZEA 2KT6A 2Q8BH 4EI5B 3WNMA 3IU4H 1IAOA 1GGBL 3GWJA 4HBQA 4JDTL 3QJAA 1E5AA 4M6OH 3IJHB 3MO4A 4Y4FC 2DEPA 1I1YA 4WEBH 4B0MM 3VW3H 2IXQB 4OCSH 2YBUA 3OBEA 4AL8L 2V5LA 1M9SA 2GG1A