1PJ9A

Bacillus circulans strain 251 loop mutant 183-195
Total Genus 237
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
237
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFNDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSSYEDGIYRNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Improved thermostability of bacillus circulans cyclodextrin glycosyltransferase by the introduction of a salt bridge
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords Cyclomaltodextrin glucanotransferase
total genus 237
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pj9A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pj9A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pj9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pj9A01
3P73A 3MUIA 3SGDI 1F3JA 5IFJA 3CMGA 4GSDL 2O61B 1HSAB 1I8LC 4QT5A 1HP5A 5F93C 3BDBA 2Y06H 4PV8B 1QFUL 1J8HE 1MNUL 3EHBC 4QRSA 1OAXL 5FGRA 5DJ2B 4PP2B 4OIIH 3VFWA 1OSZA 5ABDE 2VDNH 2W91A 1MQKH 4POUB 5C0CB 1FZJB 3RL2B 3IKKA 1ACZA 2VURA 1UD2A 4D6CA 3ESVF 1S7VB 2YMXL 1EDQA 3B3IB 1V02E 3VGBA 4GFTB 1UH3A 2R2BB 5BRZA 4I2XA 3SGKA 3ARZA 4HEME 1HXKA 5C6PB 4OZ4B 3UTTD 2FJHB 2FR4A 3U4EB 1CT8B 3FFCA 2QQLH 1MY7A 3MRMB 1BOYA 3QR2A 2ZCKH 1JMXA 2NXYB 5CZXC 1JWUA 3WDQA 2R1YA 4HKJB 4QCEA 1YPZA 4DWSC 1U8PB 1HINH 5BVPL 4ODUB 2A2QT 4LLWA 4EK7A 3LRLA 3IGAA 4X99A 4MNGE 1HHIB 3U30B 4UQBA 3D2UA 3EDEA 1I3RB 4P57A 5JZ7C 3CSBA 3DX7B 4JM2D 4HKBB 1BIIA 2IH1A 4OV5B 5HHXL 1JXJA 5IQ9A 4Q74A 4AH2B 1KLUB 3L9RB 1T1YB 3V6OC 1UR2A 2L4OA 2WUBL 4X6CE 1QRNE 5IFTA 4PJAB 1T04B 4YHLL 3F5WB 3GXIA 2JFEX 3KPLB 1RJYA 4JFYB 1MQQA 3CLFH 3WF2A 3TPKA 3UBXI 1DQQA 4YDVB 1JYNA 1GCYA 2X4SB 4P23B 3TO4B 2VUOA 1CEOA 4QXUH 2O9PA 3RX8A 1FL3B 3BVNA 4JFEA 5I23A 5IW1A 2Z0BA 4LOUC 3VXRA 1LE9A 4NQEB 2V2WB 5IFAH 1LNUA 3MROA 5I76A 3U48A 2WZEA 2DICA 1EO5A 4JZJC 1OT1A 4EN3C 5A6LA 4GG6B 2BXZA 3RTQD 1KJ3L 3CHDA 5I2IA 3MA7A 4HJ0D 4HBCH 1IGIL 2VLKD 4NHCL 4TSBL 1XSIA 5DD0H 4M7KL 4PYHA 4PREB 1BVKB 2IBZX 4OKVB 4LGXA 1JI1A 1UKSA 4JFXB 1U3ZA 1QLEH 2NPLX 4H5SB 3F5JA 1BD2A 2C26A 3AZSA 1DBBL 3QCVL 4LLYB 4DO5A 3QH3B 4FNLL 4CVZA 1TJIH 1LDPH 3N15A 3JTTB 2Y5TA 4JFSA 2X4OB 2C4FT 5TD4A 2G4FA 4RGOL 1QSZA 5EPMA 1BEYL 1UB5B 3RIAF 3ROLA 2OW6A 4PJ8A 3FT4A 3HLAB 4P9HC 5DURD 1DBMH 2OCFD 4L29A 4GRLC 2ZOLA 5JA9A 1CE6A 4RX4A 2A38A 5GISL 3TBWB 3PHQA 4JKLA 1KG0A 2FNBA 3C5ZA 5D6DA 1Y6KR 4HH9B 2VRAA 3IRZA 3QWOB 1QP1A 4BZ2H 4JPVH 5TGBB 4KRLB 4KK6C 1BM3L 2P8PA 4FQLH 1MFBL 4HUUB 3CMOH 4ZO9A 5ESQA 4N0RA 5J4MA 1QYGL 3V6BR 3SQOL 1MWAL 2X5PA 3U5YA 5IBTH 4FFVD 4M4RA 3C6LC 4CU8A 4FQQB 5MEQB 4HMDA 5CSUA 4JY5H 2PWGA 4MYWB 5F89B 4KDTC 2D0HA 2OR8A 5EZIL 2XICA 5LXGH 4GRWB 3MCG1 5CPSA 3W27A 3ZM8A 2GFBB 4HSQA 4G7YL 2OTWB 4ONGH 4HULB 1U95A 2YPVH 3HC0B 1HIML 1WBXA 4PBVC 4RA0C 3SDDD 1J11A 4G6ML 2RIKA 2FYVA 4U1KB 1PS3A 4QRRB 2WK2A 5ESVB 1KNOA 5CZXD 3P0YH 3ROLB 3DECA 3DRQA 4L4TB 4B41A 1NMAH 3VFUA 4X7SH 4BK5A 1JGIA 1V0KA 5T5NG 1A4KB 2DQJH 3CHCA 4PMYA 5FA3A 3D6GA 2TAAA 1C12B 4C7GA 3RWFA 3W39B 3KHOA 3UPRB 3FQXB 4W4OA 4HXAH 3T65A 4DK3A 2IMMA 3NCFB 2AK4A 5EFDA 1T0OA 3M45A 4NBYB 5GS3A 2K1MA 3BP4B 1U2HA 1IC1A 2VTFA 3DOSA 4C4KT 5F8QC 4X4YA 4BUHA 4CD4A 2F58L 3I85A 4MQ7A 3HKFA 1A1NB 1OAZH 1IT0A 1UQYA 3GMLA 1WISA 1MREL 3KJ6L 4KJQD 1W1VA 5EORH 5E2VH 5ITFA 1EAPB 3TNMB 2C4FU 3WD3A 1A7OL 1IAII 3IDIB 3GSQB 5ISZD 2E7LA 4M48H 3S88H 3AISA 2GAZA 3A67L 3OXSA 1TLKA 3BIAX 5HHOA 5D2LE 1I7UA 1UGNA 1IGYB 1C7SA 3BKML 1X44A 1QLRB 5BQ7B 3N1PC 4OD3L 5GGRA 5CZVL 1Q0YH 4I0KA 3EFFB 5L0QB 5ABHA 3OV6A 4M7JL 5D2NB 4KC3B 3NBNA 1H9VA 3L5HA 3I02B 4Y4HD 1L7IL 2DQTL 4QRUB 2AKRA 4JGJA 1W1PA 3H42L 3D39D 5CILL 4PP1D 1U30A 4HCRA 3CIVA 3NFSH 5CLWA 3OWEA 2QSTA 2VLKB 4I77L 5SWZD 5F7EH 4U7SA 1UKOA 4KZEH 2D73A 4MA3A 2DWEA 4JG1H 1LLOA 1OM0A 1CDBA 5D6DC 5DK2A 2XXMB 4S1QL 3SKOA 1L9NA 5J1SC 5GJTH 1EZVX 3O6FB 4PRHD 2WHJA 1N4XH 3FT2A 1KENH 4N1CA 3ZKQD 2PTTA 3KPPB 4NRYA 1MRDH 1UKQA 1F45A 1E6OH 1LL4A 2QKIB 3B2VH 1VKXB 4C57C 3WENA 1G9ML 1AQKH 4OUEA 5H37H 5DJ6B 2YC1B 2BVQA 2XWEA 5ANME 4LKXA 3MNVB 2JKXA 3RQ3A 3MLYL 3L3IA 2WWKO 3NSMA 3IU4H 1KIPA 3MZTA 3PWPB 4BZ1H 4DK6A 5I1CH 5BRZB 1CLZH 1UXWB 1NH6A 4YBLB 1OTTD 1JRHI 4DVBB 1KOAA 4RBPH 4PB0L 3MLWH 5DJYA 3VIHA 1ED3A 1ZEAL 3QQNA 5ESAB 1ZGLP 3RTQB 4E41A 2PWDA 1FAIL 3NSXA 3CIQA 4NKMA 2VITB 4J28A 3WL0A 5FM4A 3G5ZA 3VFWB 4JZJB 4FMVA 4PJBB 3UDWA 3MUGA 1T0NA 4M43L 1IFHL 3TF7C 3HFMH 3WUWA 4UNTA 2ED7A 1A7OH 3MRHA 1CF8H 1G6RA 3VFGH 1BJMA 2CK0H 4HPYH 4PJBA 4HIXH 4OD1H 2WUBH 5C0NC 2NY2C 1JG9A 3BKMH 4IIQA 4Z18A 2GJPA 3OR7B 4IMKA 5KW9L 1UH2A 3VM5A 1ND0A 4XP5L 1JPGA 4MXVE 1EX0A 2BVEA 2X89D 2DF3A 3V5HB 2DLIA 4JFPA 5J12C 4DVBA 3V6ZB 3I9GH 3AJ7A 3KL5A 1HVQA 5C70A 4QTHA 5CIPH 4DZBB 3H42H 1VAHA 3HU7A 2JIXB 3QNXA 8A3HA 1G7LA 2I9TA 4KTEL 3SDCD 2AJYL 3SKMB 3GBMH 2BNRD 4LKXB 5EH1A 1I7TB 3DI3B 1U8OB 3AB0B 3BN9D 3OX8A 3QHOA 3NCJL 1QFWH 4K71C 1V03A 3RWGA 4F3FB 1OIFA 4HWUA 3SGEI 3LEVL 1T7VA 1P84J 1QQDA 2CJUH 5EBLB 4DN4H 1KGCD 3EMQA 2X41A 1MFDH 3DSFL 3JUGA 4YZFF 4NHUB 3X3FL 5IESL 5DGRA 1EOKA 3HJEA 3ZDYF 4ORGA 1P4LB 1U8HA 1EO8L 4EDXA 4JVPA 4CVWA 5J11B 2XVPA 3FO0H 3VD4A 2HJFA 1EEYA 4G3YH 2D31A 2Y23A 5J0BA 3L2LA 1FNSH 3SGJC 3NIFF 1KQZA 1RUML 1NEZB 2EKJA 3KYKH 5GGTL 3L1OL 3DETC 2YRPA 4PJ7A 3LRSB 5C7XL 1HI6A 4Z76A 4EI5B 1NBZB 1F42A 3Q48A 5CSBA 3SOBL 3IXAB 3N06B 3W25A 3U36A 3EFDL 3WIIL 2WW5A 4MWFA 3LKOB 3ZKMC 1XGRA 1J0IA 3EJYD 3BRGC 2DH2A 5T33H 4FQPA 1MW1A 1HJXA 3RO8A 2YL8A 1EAPA 1HZHL 5I18L 1P9MC 2R23B 1NANI 2Q76B 4ZFFA 4H8WH 5J12B 2H9GB 1TVNA 4JPIA 4WTXA 2J4GA 2Z4QA 4NKQB 2Y6SD 32C2B 1SYSB 1ZT1B 5DJ8B 2QTEA 2E9IA 1JNEA 2X1XR 5AC4A 3P11H 3GNOA 3Q1SH 1Q8MA 2P5WA 1TTGA 1WFTA 1JGLL 1ZT1A 5DJ8A 4X6DB 4DZ8B 3VFVB 4J23A 2V7HB 4OZGB 2E40A 4NZUL 1NCWL 2OXGA 3RU8L 4PSPA 1W2KT 3MRGA 5EC1A 3S36H 4QRRA 1UACH 2H8PA 2J4WL 4G6JL 4YHZL 1JZ4A 4NC1E 1MVYA 4CD8A 2GSGB 1WBXB 1IJ9A 1G7HB 4YDKH 3SJVE 2GW5A 1HYSC 1XCXA 3EJRA 4D6IA 2GFBA 5IHLB 4NM8H 3LPFA 1UWIA 1PKQE 4YUEL 1P4BL 3ARFD 5GRUH 4UMGA 4D1IA 3MR9A 5L88L 1TG7A 2IG2L 3EDFA 1NDGB 4CBPA 4JFHE 1K3IA 3BW9A 4PJDE 3QWRD 4PJ9D 2ENYA 1JNDA 4ESKA 1XT5A 3ARED 1OTUC 3VWKC 1JE6A 1BLNB 3HMXH 4W8LA 3SKNB 3PP3H 5IHRA 4NBZB 2X1IA 4ETYA 4XV0A 3F5KA 1HJUA 1VCAA 1BF8A 4PGBA 1FYHB 1T4KA 2AJSH 1KCSL 4PRBA 4NZJA 4KVCL 3X12A 3PDOA 5T1KA 3A5VA 1CQYA 3R1GL 1J1PL 2QQNH 1QHPA 1DQDL 4O00A 4AD2A 3SO3B 3WIHH 5HVFB 5ID0B 1FE8H 1H49A 2NX5D 3QEQA 4E2OA 3KPRD 5HJ3A 2XM1A 2AERT 4X9YA 5HGHB 2Z1SA 3A23A 1LEKB 3G9AB 2HFEA 1HKFA 5D71H 2J47A 4TVCA 1JTTA 1H3PH 4LSDA 5EU5B 1TCRA 2NZIA 3WH5A 3C6SA 5CHNA 5EUKB 2FH6A 3RDTA 1BFVL 1CLOL 1T22A 5IB2A 5AC5A 2L7UA 5A6KA 1AXTL 5I15H 3PNWB 5B39A 4RSVA 1T0PB 3BGFC 1UWXH 4HOWA 4JFEE 4Q6IC 3V5HA 5C1MB 1KN4L 1U8LA 3BIKA 1G9MH 1FSKC 1T1WB 4PBWD 3GUTB 5MI0C 1YNTB 3E8UL 3HA0A 4X98A 3VJ6B 4GI8A 5M17A 4W6YB 1BZ9A 5EBWB 3GM0A 4OF3A 1DEDA 4KWUA 5GJSH 5IVNA 2DBJA 1PZ3A 2FX7H 4NOBA 3NACL 3S36L 4LCUA 1YMMD 3MUGB 4R4BA 5B39G 2G5RA 3DUHA 5IEHB 2VITA 3LKNB 4Q6IA 5CCKL 5FM5O 2WMKA 3OZPA 4DAGH 3TIEA 2G75A 1G6RH 3AS1A 4J3XA 4QXGL 3EOTH 3B5TA 1X5KA 3ALXA 5FYKD 2CBVA 2RJMA 5L2KB 1GOMA 4MHHI 3QNZB 5J9PA 2YD6A 3BVWA 1HT6A 4YQXL 3QUZB 2X1QA 3HI1B 1EA9C 2VQ1A 3OKNB 4K7PL 4U3HA 3OKLA 4P5KA 4Q0XL 1KXHA 4N0FB 1RZJL 1G1CA 4PJCA 1JBJA 1OD0A 3BDYH 1Z9OA 5D1QA 5JW3H 1KCSH 3MREB 3PWNA 3SCMB 1FFQA 4W5ZA 2XN9A 1E6QM 1JWUB 4KI5F 4HV8A 3W4RA 3H9SA 2YN3A 2DJ4A 1UG9A 4L5FH 4PLJD 1K85A 1XCTA 5FF6A 3KPOA 4PJ9C 1QA9B 5GHWH 5FA4B 1U92B 2APWA 2APTA 3FMGL 3N12A 4EI5C 1DN2A 3ARFB 3AHXA 2F5AL 2VXSL 2QQKH 1J8HD 1H3PL 5ISZE 2G3NA 4KZDL 2V7NB 4XB3A 4XRCB 2CPUA 2OW7A 2GUOB 1NOWA 1FNGB 4I2XE 1MEXL 2I25N 3QDJD 1BFVH 1CLOH 2E8YA 4NM4H 4KFZC 2VZVA 2HFEB 1OSZB 3MLUH 4LSVH 3DX8B 3V0VA 5JLZB 1T21A 2D4FA 5JBEA 1BJ1H 1MCWM 3QUMA 5AUMA 1J9YA 5EU3B 1UD8A 4KROD 5EZOH 1MFDL 1P1ZA 1QUNA 1RJLB 1E56A 1W9BM 4YBLC 1WV7T 2IAMC 2EDRA 2BVPB 3QEQE 3WQVA 4LIQL 4BFBD 5DQ9A 5HGBA 2FH8A 1KN2L 2HKFL 4XXCA 4Y88A 3TV3L 3DVGB 2GAZB 5GJSL 3L5WB 4L8CB 1QPPA 3TZVC 3HNSH 4YHKH 3VGAB 3MCKB 5DT5A 4IRJB 1JN6A 1UHVA 3SDYL 2W61A 4FG6C 3VG9B 5FV1L 5HHVH 5CEZD 4WU7B 5C6WH 1MQKL 1OQOA 1DQLL 2ZUQB 3HE7A 4U1NB 1FZOA 2W9EL 2C1OA 4XP1H 1WAWA 1GGCL 2VDLL 3L4VA 4HPGA 4P7NA 1TJGL 4XB7A 3KPSE 3QIUD 1FPTH 3MXWH 3MYJA 3NSNA 3VXSA 3GSVB 4X6CF 2YD1A 3HC4H 4X7TA 3OR6A 4JFQB 4E42B 1P9MA 1TQBC 4POZD 4PEEA 3VDHA 4IRZL 1HXYA 1R75A 2BNQB 1NAKH 2I27N 1BBDH 3WBAA 5DEGB 5A6BA 3MRDB 2D20A 3RPKA 4MLSA 1TA3A 1HXYB 2VLLA 3X12B 5EBGA 5FK9B 2H2PD 3TH4T 3AC0A 4NDMA 3KYNA 2A6KA 2OTWA 2DSKA 2F8QA 1IAOA 4UQCA 5EUOB 3IDMA 2P5ED 1IM3A 3WD5L 4NZRL 4WO4D 2D7PA 1BLNA 4PJFE 3BPOC 2E6QA 1WIOA 2GDUA 1S7RA 4FQIL 2IMNA 4RCAA 4YZFE 3H3PL 3HZYB 3TEUA 4ZFFB 5I8CB 4DUWA 4LX4A 2MKLC 5BZDB 3DHUA 1IM9A 1JUFB 3EGSA 1BYBA 5C0JB 4Y5YA 4Z95H 5F3BA 3CFBA 4AENA 3T0BA 1E4IA 4R3SB 2ZOKB 4ONHA 5GRUL 5K9KA 5F96H 2W65A 3TVMB 2Q3AA 3MRGB 1RQ5A 2MOVA 4IJ3C 2ICES 1GL4B 3BGFB 4TX8A 4ZS6C 1BTCA 4KKLD 4LSPL 4PJIB 1EPFA 5DLMH 4EEEA 2CKRA 1FFRA 3NH7H 4OCNC 4KJWD 5DWUL 3SEPA 3P77B 3MLVH 3KE0A 2MKWA 4D1JA 4HX1A 2WSKA 2VZUA 4Q9QH 4KVCH 2VXUH 1XIWD 4EDXB 2Y2WA 4GKOA 4AL8H 4UDUB 3ZSSA 2P46B 4O02L 4WK9A 5T5NF 1U92A 1IAIH 1YDPA 3UZQA 1F13A 3LY6A 3JV0A 5JHLL 2DQHL 4M03A 1LP9F 3VW3H 3ELAT 1U6AL 5DFTA 2F8VA 3MGAA 3GGWB 4IIQC 3ES6A 3MPCA 4L3ED 5BVJA 3GMNA 2ZSVA 2DGAA 4BSWB 1CFVH 4BFIB 5JQHC 4U1JB 1VA9A 4OQ1A 2OX5A 3IFLH 3CFKB 1NBZA 3OKKA 2X2YA 3AVEA 3OKLB 1CFTA 4MAZA 5IHUL 1W9XA 4ZO7A 4D0CA 3GMOB 1NARA 1AGFB 1IQDB 4OUOA 1IEAB 1L0YA 4HXBL 1N59A 5JXED 1FC2D 5KSVA 2HJFB 3V2AR 1N5AA 4YJZL 3ZT6A 1S8DB 5JOPE 1FNLA 1F58H 1JPGB 2BSRA 3UTTE 2AXGA 2P44B 3WL9B 2XTJE 3SDAD 4XPGL 4PJFF 5FDWB 1I8MB 2ZICA 2GSIA 4YFLF 1WVZA 3QUKB 3RWJB 4EN3D 2G3MA 5C8BB 3GBDA 2WB5A 5HHOE 5SX5K 1N3NA 3EYVB 2J7FA 5FIPA 4LDLB 4LLWB 4H8UA 3FONB 1J05A 2YUZA 1CG9B 4GO6B 4JB9H 1VACB 4LVHC 4MA8H 4HIEB 1ZOXA 3O2DL 1BAFL 4DAGL 5JOEA 2F61A 2VAJA 4Y2DB 1TQTA 1ED3B 4P2QD 3OGRA 5EDXA 1D6EB 2J8GA 4L4PA 1VBRA 3IDGA 3QIBA 5LWYH 1NSNH 3TIDA 1B88A 3QXVA 1D9KA 1E1FA 3EDJA 4UZGA 3NCMA 3NH7L 1OY3B 1G0XA 2ZCKL 2R2HB 1ISXA 1T22B 4LSSL 4CMMB 4ZO6A 1ZLVH 4AIZA 4YHNB 4LPYA 3ILQD 2ATKB 4MHHG 1KCKA 5D7KD 2XACC 4C83A 1YQVL 2QSCL 2R0WL 5D7SL 2RAMA 4UQEA 1XF2B 4OCRL 2CKBL 1IZJA 2X2IA 4JFED 4PRIA 4S1SH 2Z93B 3FONA 5J1TC 1IAIL 2J8OA 3VXRD 4H8HA 5HPMA 5IFJB 5GSVB 3U7WH 1MI5D 2Q86B 4EDWH 3SBWA 1EUUA 1S7QB 4GRMB 3WIHA 2N4IA 5HYQB 3BCDA 5FDWA 3BE1H 1UD3A 2I07B 4F33A 4TUFA 2VISA 3H9HB 3RTQA 5C0GB 3CFDA 3UTSA 1MCDA 3T1FA 4P8WA 1JZ3A 3F8UB 3ZT7A 4CVUA 2NY0C 5DK0A 1E6JL 3T0EC 4P46C 1R33A 1J9CT 4MJIA 2WWMD 2PWFA 2LE9A 4LCYB 5DRWA 3AIUA 1HHHA 1X7QB 1IMHC 2NSXA 4QHMB 1BREA 3CFIC 3OTTA 5BXSA 1T5WA 5IMOA 5HPCA 3CFKA 3IKCA 1FHDA 4EIGB 2DMKA 1JK8B 3CUFA 3QXTA 2CDFB 5JDJA 5ADOL 2JF1A 4L3EB 4M6AA 3KEHA 1MJ7H 3O3DB 1S5HB 5GS1C 1NCUA 1D5BA 4P5TB 3LPGA 1KXTA 1YDPB 5TE7H 1V3IA 2XQBH 3PZQA 3BCFA 2W9EH 1S9VA 1JGDA 3VGGA 2A74A 1RULH 3JXAA 5CEXA 3WYRA 4RFEA 2UY5A 3GO1H 4IBLT 4HXAL 3B83A 2ZUSA 2NXZC 3FQXA 5D7IB 2JIEA 32C2A 2PW1B 5GGUA 5HVWA 4HWBH 3AU1A 4UB0H 2V5SA 4H04A 3UPAA 4JZNA 2R23A 4D9LH 5EO1A 3O3AA 4F2MB 5CUSH 2AS5M 3WEOA 1JAKA 2D9QB 1TFVA 5DT7A 4BFGA 4NNPL 4JFZL 1YEDB 3OXSB 5A2AA 4Z7VA 1JHLL 4KJWC 2VXTL 3KWWB 4FQLL 1KGXA 2CDEB 2GY7B 3IDYC 5CP3H 1TPXB 3LRHA 1IFHH 3OAZK 1M7XA 3CLEL 3N18A 3GMMB 5A40E 4ZD3H 2FX8L 2XXCB 3W5MA 3UCQA 5CEYB 3VFMA 5A2IH 4L4TD 4G9FE 4P2OB 2DQUL 1HEZB 1GJIA 2WV3A 1AE6L 1PG7W 4WI9A 4X6FA 5D7LA 3TP4A 1TXKA 5IIEA 1NQBA 3RX7A 4XNMA 1I1CA 2A6IA 3GSNA 1JFHA 1HXMB 4KAQH 1R87A 2J7BA 4Y5YC 5HHME 4U4BA 2Y8VA 1OAKH 5BV7B 3SCPA 2A0LD 2ARJQ 3PIQB 5IFAL 3POHA 2XZQH 3O2LA 4UZUA 1CD9B 2BOBA 5GRVL 4PJEF 5INCA 3BRDA 3FT3B 2EXYD 4EAMA 3BAEL 1U3JA 3LVEA 1MCPH 3RWHA 1GQJA 1V7NH 3GK8L 3JTTA 4X7TB 1ODUA 4L8BA 5FM8A 3QDHA 4U6HB 2CRIA 5DI8B 1ZLSL 3MO4A 3B9EA 1V5JA 1GHSA 2QSQA 1VADA 4N90E 4XP9H 5F7YC 3DNKA 2PETA 4TTDC 4V1DA 1YUHB 4U6VH 2OTUB 4K2UH 4EKJA 3W5NA 4MQTB 4JFVA 4D6DA 2EDLA 5DQJA 2W38A 4I48B 5KG9B 3S8WA 1C5CH 3CVHB 1F6AA 3ULUE 2X4QA 2APVA 3LQAH 3U83A 3UJJL 3UDWC 1CLZL 4PJXB 4PRAB 1B3JA 2OWCA 4PRHA 2FJFB 1DBML 1QWUA 5ECUA 3DURA 1G9NL 3VXNB 5T5FL 2F1AA 1RH9A 2V9RA 3OGVA 4X6EA 3MNZB 2UWFA 3H7BA 4ZFZA 1MCJA 2CITA 3NMEA 3WUWB 2UYLA 1ACYL 1R3LB 3O8XD 4QP0A 1WJ3A 1V3KA 4Z5RA 4B53A 5IBTL 2X42A 1NMBH 4C56D 5LGKA 2ZWZA 3VRLF 2BV9A 4DUXA 2ATKA 1NMCB 4HWNA 1UA3A 3AOFA 4A2MA 5F7LB 5IHSA 3EYFA 3TVMC 3I6LE 2DBLL 2K7PA 5EFIA 2R2HA 4Y4FC 3T8XA 4G7YH 2CEQA 1TQVA 3BMVA 3ULSA 4NT6A 1KLUA 2FE0A 3CCHB 2EC9U 3AHTA 1H3UA 1NC2A 3EJTA 2J1KA 4G6MH 2VIRB 4GRWH 4V27A 1F8TL 4ODTL 5GRJL 3VU2A 2DQEH 3MRJB 4Q9RL 4CVXA 3MODH 5AG9A 4XAKE 2XSAA 1CIDA 3P0YL 2XM2A 1OAQH 2AJYH 1WITA 1A6WL 1I3UA 3RKDD 5FHBL 3HZMA 3L7FA 1LO4L 3O41A 3VTRA 4M93B 4ZQKB 4BF7A 1Q0XL 2EEDA 4TUJB 5E8PB 4U1HA 3MRMA 4OFVA 3DHPA 3TNNA 3DX1A 2VZOA 4QNPE 2B4CC 2I60L 3MGTB 4RNRB 4IOIA 1TFHA 4HU0A 2R8SH 1XGUA 4G8EA 4XP9L 1CBVL 1NC4B 1RU9H 3P4LA 3C5SA 3TN0A 5E70A 1CWVA 3UROR 3DUSA 5C0CA 1QLFB 3RP1A 4LIQE 1UJ3B 4GKLA 1CFSB 2BNRA 3DUUA 3QJHA 4G3YL 5TF1H 3WLBA 2CXKA 4F7TA 3ZKNC 3DMMA 1QI3A 4QTIH 1HVXA 2Q8AH 3FQTA 4GAFB 1F90H 4ZOBA 2DQFA 4TQEH 3VXMB 4HPHA 2Z8VC 5F9WC 3DPBA 4L4VD 4AMKH 3NZ8B 3FRPA 1S7XA 4P4KB 4DGIH 1I7UB 1EIBA 1AXIB 1G9NC 2GIYA 3K3QA 3QHMA 5JIHA 4PJXA 3T0EE 3CDGA 3R0MA 2VIRA 2YPLB 4GI6A 4M1RA 4K8RC 3IDNA 1UQSB 4NT6B 1AFVL 3BUTA 3JV5A 4WRLA 2OYKA 1P6AB 5GGSY 5IBUB 5FGBC 1D2KA 1FIGL 1RD6A 4PJXF 4LVNC 1G0DA 2D03L 4LPXA 3RUGB 4G7VH 2HFFB 4N8CL 2MSPA 5EU5A 5EO9A 4WGWB 1QZ1A 4QRSB 3PL6C 5TQ2H 2CJUL 5I8OL 5D7JD 5DVLA 5F70A 3N9GH 4NRXB 1F3JB 3PTKA 1XGPB 3BD5A 4NOFA 1YEFL 4GW1B 5LVEA 3V4UH 3U0PA 1QSEB 3KPTA 3MRFB 1N64H 2IANA 2VO5A 3QAZB 5I1HL 1UD4A 1JWMA 4LOUD 1PBYA 3VWKB 1WDPA 3W6MA 4PRHB 2YA0A 4WFFE 4HLZH 4PRBB 4XI5C 2W0PA 2FJGB 5F7MC 3VD3A 4NPYB 2P8LB 3GO1L 4U3XA 1XCQB 5TH2A 3GSWB 2X4QB 2QMJA 43C9B 2B4CL 1I7RB 1FJ1A 4C56B 4XX1G 3CPLB 4Y4KB 1PZ2A 4BQ9A 5C0EA 1XD0A 5ETUA 5LGJB 2QR0B 4K8RD 3NCEB 5HPOA 3WNNA 1YUHA 4FG6D 4NFCA 4EXKA 3MR9B 2JE8A 2VVSA 3RWDA 1UJTA 2HAZA 4HUUA 2OL3H 4HUVB 2XG5A 2DRUA 1KIQB 3IFNL 3SCQA 3FN9A 5HHPB 2FX8H 3B2UC 2H8PB 1EBAA 1NBVL 1K3ZA 2AJSL 5DEGA 1LWRA 3VFSA 5EO1B 2HVKB 4RMQA 1F5WA 4BA0A 3O4LA 3VIIA 2Z31D 1GOWA 5E8NB 4HA3A 4E42A 5BV7H 3AXHA 3PIQA 3PZGA 2PR4H 2WANA 1KIQA 4X6DA 5AYIA 4XBGB 2EYRA 3VXSB 3GMPA 2PCPB 1MUJB 1CDIA 2JCCB 2WUCL 5IG7A 1MPAH 5IUSA 3RVUC 1NCDH 2C1OB 4KRPD 12E8L 3QSKB 4FZEL 1VGEH 3FCTB 3DX2A 1AFVH 3O3EB 1S9VB 3KNBB 3EYUL 3EO0A 5CG0A 3ALFA 3D51A 2E4TA 1GZPA 1I7RA 3IDNB 5I1IH 4K9EH 3GMMA 1MFVA 4LYPA 3R06A 4PJDB 3WMSA 1HOCA 1EHAA 4WFGE 2B0SL 1F6LL 5C8JB 3VM7A 1AGEA 3BAIA 1CDCA 2XFYA 3QPQD 4LCIH 2XTJB 1GNXA 3OJ2C 3GXMA 3DX6B 4I0PD 1VPOH 4O2FA 4RE3A 3P9WB 4F15B 2Q8BH 3P9MA 5I73B 1J5OL 1RVFL 4CUCA 1X7QA 3TBTA 1E70M 4M5YL 2LVEA 5JUVA 1H5BA 4I8DA 3ILPB 5ERWA 1K8IA 5IBLC 1PZ5A 1WWWX 1YEEL 5CINL 4UUJA 4G6KH 4WUUE 4P2CG 1HSBB 1XGUB 1CICB 4OZIB 2EPKX 5E6IB 4HK3J 1ZHLB 4ACYA 1JYWA 4QLRA 3P2TA 4HDIB 1YPZF 1KTBA 1VIWA 4ALAH 1Q6FA 3O3DA 1UR4A 2ICEB 4AZBA 1IILE 1S5IL 3UC0L 4ZQKA 3FO2A 4EANA 1D5XA 3NDYA 4WEBL 1MHCB 1OGAB 4RGNE 1FH8A 2R1YB 3WIJA 1TVHA 3BDYL 2YPKB 4UV7L 5IMOB 3MMEA 3Q5OA 3EDDA 2F54A 2F8OA 1HE7A 2BY0A 4H20H 4ZUTA 1INEL 1K5NA 3VINA 3F6LA 1M7IA 2BVDA 3K81A 4GMTH 5GHWL 3WD5H 5DC0A 1I1FA 1HQ4B 1Z3GL 4JO3L 2X2HA 3AIQA 1O7VA 4RWYH 3W0WB 3BDXA 1R5IB 3TFKD 1SMAA 1UKPA 1N6UA 2VL4A 4NO0D 2E7CA 4P9ML 3BVTA 4WV1A 1N2RA 5I1AA 4D9RE 4LCWE 1R5VB 2EYSB 3RPIB 4RE4A 1I8MA 1E71M 4JY4B 4XCEB 4AY0A 4BSVA 4LIQH 1KFAH 2VR4A 3FO1A 4X5WB 4Q2ZA 4LLMA 3FB6A 1JRHH 4ZOCA 5TF1L 1JHKL 3QOMA 4P7OA 1O0VA 4LRNL 3KLSA 5DLML 3LD8C 1OM3H 3U9PL 3V52H 5FYKU 4BUGA 4M56A 1NAMB 3NUKA 3GMRB 5DD0L 4PJGB 4GRLB 2PTVA 3VFOA 5ISZB 3UMTA 5DRXA 5JIPA 2HP4A 1YYMH 3RVVC 4V1DE 4M5ZH 4YEEA 2EAEA 1FPTL 3C5ZD 2VDQL 3BH9B 3NFPB 1CD1B 2ARJA 2R2CA 3LKQB 3C09C 1J0HA 5EA0H 4YPJA 1NLDH 4NQDB 1QNPA 4LLDA 4YDIH 5FGCE 4FP8L 5AD0B 2D03H 5ICXA 2ESVD 1JI2A 3D4ZA 4AZGA 1RIHH 4QRPE 1FDLL 4NM4L 1S8DA 3D39B 1ZSDB 1CD0A 4KK8D 2R1WA 2EE6A 2WMIB 4TVPL 3VRLE 4G80A 2R1XA 5E1AA 2QADC 2J88L 1DTUA 2X9WA 2XY2A 3M07A 3C60A 3E8UH 3V4UL 1RURH 4AM0A 4ZSOB 4ELMF 1NOUA 3VXSD 3D3VA 3MU7A 5A43C 4HU8A 1KJ2L 5I75B 2FECI 2Q8XA 3KHQA 4HLZG 2VOTA 4PJGF 3LN4A 1TTUA 5HI4C 1BVNP 2C0HA 4N1EA 2QSVA 3GMNB 3BVVA 2Y7QA 1XH3A 3O9WD 3ES6B 1FYTA 3QZWA 4LASH 5E0QA 1S7SA 3HR6A 1RMFH 4JPKL 4JB9L 1VFAB 2IAMB 2P5EA 4N0UE 3W11D 5DS8B 1UWUA 2EIEA 2JELH 3SDDA 5F9WB 1A6AB 4QYOA 2GCYB 3TTYA 4KPHH 3LD8B 3L7EA 2N7AA 1NQ6A 4QOKB 2R4SH 3RAJL 4PBXA 2C7FA 5AAMA 4NQSB 4TULL 1IGCL 5HHNA 3TT3H 3KYNB 3PZUA 4P48A 3S97C 4U2ZA 4MZ3A 3GDBA 4EBQL 1QBBA 4NN7C 4F9LA 4WNQB 1V08A 3FAWA 5DF0A 4Z77A 1G9MC 5HHXH 2EDTA 3KWWA 5E2VL 5A2BA 1HJVA 4WF7A 4XNZC 3LKOA 4KY1L 5TFSH 1JNHB 5FKYA 3NVQA 3FMGH 3A67H 5CEZE 5ILTH 1M71A 3T0VA 4G9FA 1WBZA 1X5AA 3RWDB 1U2CA 1JF1B 3WS6A 1XAUA 3C87A 2XKSA 4FQIH 4YDLC 4QXTB 1QI4A 2VNCA 2V2TA 2AMGA 3EYSH 2R0ZL 3UESA 2BERA 4LSVL 4DM1A 3F58H 3VPLA 3AYRA 4RWHA 2OJZL 43C9A 3D18A 4L4VE 1EEYB 5GGTA 3SDCB 3WD1A 3MGOA 4PG9A 2YL9A 1F4YL 3CFDB 1VPOL 3BX7C 1DLHA 3HLAA 1E4KA 2RB8A 5DJAA 3A6CL 1BPLB 1QQDB 4FRWA 2G5BB 1IZKA 4R0LA 1JL8A 4WFHD 1UR1A 1LWHA 5B38B 3LRMA 1N4XL 2J7CA 3V0VB 3C5ZC 4RFNB 3FB7A 4M7KH 3RVVD 4PUBH 4G8IB 3B2VL 5ICYA 2K9UA 1OVZA 4U33A 4Z7NF 1JDCA 4MDJA 4HWZB 5TDPB 1U8IA 3EYPA 1DBBH 1UD5A 4FZ8L 4I4WB 4PJ8C 2QF8A 3JWOL 4K07A 1T83C 4FNSA 4WGVB 5E9DE 1KEMH 4L1HA 4LCYA 5JDSA 4UTAL 2GVYA 1D9KB 1AQDA 1RHHB 1QOXA 4P49A 5I9QC 1NGWA 2A6DB 2YPLA 5I8KH 2F7RA 25C8L 3FO1B 4X5WA 3VH8B 1ND0B 4NJ9L 5KVDH 3DDGA 1A3RL 3IJ9A 4ZFMA 5HGBB 4TPRL 3QDMA 4CJ1A 1RAMA 2KZ1B 3RIFK 4LP4A 1R5VA 3RPIA 3UTTB 3BYTA 4OFDA 2W66A 4Z7WA 1XGQB 3WNOA 4IUGA 3JTSA 1SY6H 4QHUB 4NYLA 3L4WA 1CXKA 1ZWIB 4YLQT 1ULVA 2ATPB 4WHTA 2GSIB 5I1GH 1QW8A 1Q6GA 4XWGH 1UJ3A 3MV9A 1I9EA 2FX9H 4AZIA 5C07D 4MPKA 2NY5C 1P5VA 3ZZ1A 3QIBD 1TZHB 1KCUH 2CSPA 4AIEA 4YGAB 5KN5B 2X4RB 3HC3H 3I50H 5DRNA 3TIEB 3ROOB 4LKCB 5DUPH 1RPKA 3HS0B 5C0FA 2AAVA 2EH7L 4NQDD 4KKNA 1UXWA 3RJQB 1CL7L 4DVRL 4LHUG 4YHIA 4E0RA 5EBAA 5CGYD 3SN6N 2VQTA 5FF6B 1E6JH 4QDMA 4CD7A 2GTZA 3IDGB 1MF2L 3E2HC 2R4RH 5F96L 3FY1A 4W7VA 1E27A 3IGAB 4X99B 5CP3A 1A7QL 3HZMB 1DQML 4ODSL 4OGYH 3SCMA 4XVJL 3ZMRA 4M4PA 4Y5XC 3MLRH 5GGVH 3GFUA 4KKAC 5E6IC 4WW1A 3OLGA 2ZX6A 1T1WA 5LWYL 3EYQD 1ZS8A 5KSUA 4M9OA 1AHWC 4LFHD 2ICEA 1EXUB 5EFFA 4XVUC 1BZQK 2ZUUA 4FXLA 3O6FA 3U1SH 4YHPB 4JM2C 1GC1C 5SV4A 4U6YB 3VXTB 3VDAA 3WJJA 1ZT7B 2AJXL 4BZYA 4CN4A 5HYIA 4U1LA 1WZLA 2B8OT 5DHXB 5C0CE 1GOOA 3VX0A 1S7VA 3IDXL 2FL5B 5F7HA 3NTCL 4S1SL 4Q6IB 1EO8H 3BH4A 3UTQA 4M5ZL 8CGTA 3P30H 2WZPD 1VB9A 4Y5XA 1I75A 2OK0H 3PZ9A 3JTSB 4QHUA 3QO1A 2BJMH 1B0GA 4S3KA 1UFUA 3K2MC 4WWKC 5EBWA 4P2OC 2C3HA 2BRQA 4A6YL 5E1QA 1T89C 2DQTH 4FQXC 1FP8A 1OLZA 5C8JA 5IWLC 4Y5YB 2V3FA 1PX4A 2R0KL 5E7FA 5MEOA 3QZWG 1JHTA 2X0YA 1JHLH 1J0ZA 4PJFB 4DFIA 3BVXA 5C0IB 3GJEB 1BQHB 1X5IA 4JFFD 3VWJB 1WKYA 3AROA 3MXVL 3MLSL 3QO0B 4U0RB 3HG1B 1HNYA 3BW9B 4YO0B 5GRVK 5GS1A 3W6LA 4QXTA 3C6SB 4K3GA 4KVNL 1MCWW 1ZTXL 5DZLA 5ICYB 3W2DL 4ACZA 1A22B 1VADB 1VERA 2DQIL 1AP2A 1NFDE 1HX0A 4R97B 1AR1D 4IDLA 5C0ND 1T5XA 3OSKA 5BOPA 3QFDB 5F9JA 3TZVA 4UFIA 4A4AA 2A77H 3WFDH 2W62A 5J3HC 3ZJ8A 1AQ0A 4OB5H 2R9HC 4U1MA 3SCTA 4RGMC 3JWDC 3MLYH 3L3KA 4WI5A 4JG0H 3RU8H 4NQEE 5IMKA 1DR9A 4P8UA 3U57A 3DYPA 3MCLL 1JFQL 3OR6B 5HYJE 4PV9B 2VDML 3J8F7 1BIHA 4BH8B 4YPGA 1AGDB 4S1RL 4HZ6A 2V5YA 3G5YB 4QRRD 5DJZA 1U8JB 4YGVA 3U1SL 3EOBA 3LX9A 4TSAH 3KDMA 1OBAA 1YQVH 2QSCH 2R0WH 3T4YA 5GPRA 3WE6B 2OR9L 3D85B 4QAWA 1MELA 1PY4A 4YGVB 4IRJA 2V3GA 3C8HA 4PJ8D 5C0IA 4G9FB 4XBEH 4JKKA 4H41A 3ZKXB 4F57L 1DL7L 1CD8A 2OQJB 1Q9OB 4I0PC 3VFTA 3QWRA 4PJ9A 5IHZB 2ED9A 2DMCA 5CSYA 5DT1L 2QADD 4HMEA 2W4XA 3SGDH 2Q8AL 5KVMC 3RMEA 3RNQB 4GXVH 4Z76B 5IB4A 1RJLA 1IARB 3BKYH 3WNPA 5MEPA 1D9KC 3F7PC 1QO3A 2P45B 3DJ9A 5KVFL 2WLZA 4OSUH 1NEZG 3HZKA 2PYEA 4J3OC 3WUEA 4CL7A 5C6TL 4GAGL 2WVTA 4O4YH 5KBNC 5A6MA 5C0RH 1KJVB 4ZEPA 4JO1H 1XH2A 1P2CB 4PRPE 1FSKB 1FNGA 1P7KA 1CU4L 1C7TA 3S4SB 3GBML 4G8FA 3FB5A 3WS6C 2V7NA 3ULUH 4JFUA 3QEQD 3LS4H 1F4WH 3R8BB 4ORGB 1CDJA 4D9QE 1QFWI 3MLSH 3FN0L 3MXVH 1OCWL 4WY7L 3CZNA 3MFFA 1EEUA 4L8CA 3D52A 4P2OD 4PMZA 1T2QH 2XUCA 4TOYH 2V5DA 4K55A 5K9OA 1NWTA 5I6XB 1ZVSB 4I5BA 1NDMA 5DRXB 5I76B 5IQ7H 3O0RL 4NP4L 4LPWA 1NGXB 4N1HB 5FYJL 4NC2B 3SUTA 2BFGA 3MRIB 2MPAL 4QRRE 1QFOA 1B0GB 3CBWA 3W26A 1D6VH 3TJHD 3FQTB 2J12B 4UTAH 3B8YA 4JKPH 4X6CB 4DO6A 4JVUA 4PJAE 1HHHB 3D2UD 1G1YA 1RUMH 3CPUA 3MCLH 4OT1H 4PJHA 5FO7B 5EZJA 3BAWA 1M05A 4DWHA 4JFYA 3WD4A 5F9DC 3C9NA 3PP3K 4OZHA 1ZSDA 2H6PB 2B7DT 3WMBA 5IJVA 2CBJA 1YY8A 3VWJD 3PZTA 3S5LG 2GFTA 5J1AA 4BSVB 3RVTD 3PWPE 5FAAA 1T03H 3MRQB 5EIVA 5J6HB 3KLDA 3MV9B 1D7FA 1L0QA 4WI7A 1J12A 1OARH 1U58A 4LCUB 4KMLB 5I18H 4Y4HA 3GBNH 5D2NC 1OW0A 3ABZA 3KS0J 5CMAA 3RRQA 3WKNA 4X0KB 4HS8L 3DIFA 1YPZB 1F90L 1XF2A 1CENA 5D1QB 1U93A 5D7JC 5EOTA 4NBXB 3KPQA 4FNPA 4NRRA 1M4KA 1E40A 4ZFGL 1J8HA 3RVXD 4OLXH 4HLJA 2XA8H 1YMME 1OCQA 3NCYS 1QWNA 3RWCA 1CYGA 3RVWD 5E2UL 1ZK9A 1AQDB 1RHHA 3POCA 1OGGA 3T3MF 3QHZH 1N6QL 2X05A 3L3OB 2MCPH 5CGMA 1E3ZA 4J12A 4C58B 1UG6A 3H55A 3B3IA 3ZE0F 5CHNB 1M6OB 1K9EA 1OTTC 3N9KA 2QPSA 4FZEH 1A7NH 3LHPL 3DMMD 3I6GA 4M1DH 3PF2A 3FFDA 3QFJB 5FGBA 1Q0XH 3ZE1F 4XPHH 4ODWA 3MBEC 1QRND 3MLZL 3FNDA 1MIML 3CFJA 3WCYA 2ZUTA 3BEWB 1XRVA 2AV7A 2EDBA 4MS8C 2PWHA 3UYOD 1WFNA 3BT2H 3NAAH 3MBED 1MFCH 2ADGB 3C6LB 1PDKA 3VJ6A 4APQB 3B2UD 1N6VA 2VXQH 2Z35B 3TA3A 5JW5B 4MB1A 5L6YH 3AZTA 2CLRA 3IS1X 4ZTPL 5C09D 1EGJA 4PGBB 3E6FB 2GTWB 4MSWB 2LAAA 4RGND 1MHEB 4ODVL 1HKLH 1WT5C 2A3AA 4YBHA 4M7ZC 4JKPL 1TQBB 3MLXL 4LSRH 1J0KA 2GITB 2EABA 4HS3A 4UTBL 1I9JH 3NZHH 4JRXB 1BGGA 4I4WA 3JBG7 4AG4H 3MRNB 5E56A 3ZLQC 4HJ0C 1QI0A 3KPMB 4XC3H 5I19H 1LEKA 5LGHH 5GISH 1ACYH 2VKXA 3K2UH 5DYOA 3AS0A 1UM4H 4L8BB 4PLJC 1AC0A 4L4TE 4PMVA 4NJAH 3HE7D 3FO9A 3N1FC 4LSTH 1QR1B 4UILH 1L8NA 4HUNB 1MWAH 2X9XA 1AD9B 4HDIA 3UC0H 5E9DA 1FZMA 2EE3A 2IALB 4PPTA 3LN5B 2G41A 4MQ7B 3IDJA 1V3JA 3F7VA 1BBDL 4NCDA 1DZBA 1B4JH 1T4KB 3SKUD 3PGFH 4MJ5A 1HHGB 3SDCA 4QWWC 3MBXH 2VZTA 1GGIH 1Y6MR 4HBQA 1BWWA 1Q6DA 5ABEA 2D0GA 4R5EA 5CD5C 5KS9F 1KCVH 4JN2A 2EYRB 1A6AA 4FNUA 4WFGD 5FCSH 1A6WH 1BAGA 4XAWL 5L0QC 2F53B 4FQ2L 3FTGB 1VFAA 2IAMA 3MOAL 5IB4B 1FG2B 4MD0A 2Y07H 4WO4A 2W65B 3TVMA 1DBJH 3LHPH 4B16A 2GQHA 1KYOJ 5HHPA 2WQRA 1G01A 4GKNB 4K9EL 4Z7VB 1OWRM 4FS0A 3F4VA 3SE8H 2E6PA 3CFBB 3WO4B 2Y36L 2Z31A 1HOCB 3VXPA 1V6WA 4MNQA 2XHYA 1ZJAA 1AY1H 1KCRL 3OHXB 1A5FL 4YXKL 1IT9L 2ZUYA 3EOAB 4PGCB 3D3VB 2OR9H 3EOTL 1B0WA 5EWIL 4CDGC 1RP9A 2ZX8A 3TJEH 1F2XK 1UXSA 3UBXG 4JN2B 1JGUL 5HDOA 4LU5L 1IAKA 3LRGA 3OKMB 2Q8BL 1YJDL 1CFQA 3GSWA 4PJXE 1CE1H 3D39A 5A3ID 1ZHNA 3MLXH 4LSRL 3WLWC 5JW3L 1T3FB 1FNHA 3LN5A 4KK5C 1I85C 1XYFA 1ZBCA 5SWZA 4DGIL 2H32B 3STZA 5E9DB 1ZMYA 4RMWA 1HN1A 2BNQA 3DVFA 3O11A 3P9LA 5A2KH 1KLGB 1NBYA 1G7JB 4P7RA 2O5YH 4JFQA 1IC7L 5DMKB 2BFVH 3CC1A 4X5LA 5HI5D 2XZZA 2QQKL 3BH8A 4V2BA 3VXMD 1KUMA 2BSTA 3WD0A 3WELA 1UCBL 4JFXA 4KQ3L 1XR8B 1WAAF 3W81A 4FQQA 4RGMB 1WDQA 2R1XB 5E1AB 4QHMA 3CMJA 3U7YH 4DZBA 4XP4L 4A2LA 15C8L 1E4WH 4HA1A 2X4NB 4TOYL 3N11A 4PMXA 2FDMA 1GGIL 3PQYD 4KTDH 3VSTA 4QGTA 3VA6A 1B3ZA 3KPNA 4P46D 3DVGA 5F6IC 1RUKL 5ICXB 1OB0A 3I6KA 2A3HA 1S7XB 3VD9A 4APQA 4NHUA 2ADJB 2DL9A 4PTTB 1FGNH 1UB5A 4E41D 2Q86A 5IGXL 2AQ2A 4LPVA 3GKWH 1XGPA 1HHJA 4B7LA 3BH9A 3AMKA 2A1WL 3O6KH 1IC4H 2F15A 3DMMB 2DSZA 1QVOB 1EO7A 4ODHL 1FO0H 2EDOA 4JFOA 4UOJA 4M6NH 1SJVA 4NZTL 5ABFB 1NANH 2EE2A 3MLWL 4PJIF 4NWTL 3A4XA 1K4DB 1EMTH 3O2DH 4PREA 5EULV 4HIHA 4WSKA 4G8EB 3MBEB 1OW0C 1KGUA 3THMH 5AZ2H 4N0YL 3ZDXF 1HKKA 3WY1A 4Q2ZB 3KWXA 3QI9A 1G7PB 2YS4A 4HGWA 2WINA 1UZ6F 4P2QA 4P3CH 5JPMB 2G3IA 3ULUD 4YFDB 4GI9A 3SCOA 4QEGA 4ODUA 4UV7H 1SMDA 1ZAGA 3OJDA 2VC2H 3L4XA 5E2WL 2EXWD 2HMIC 3SO5A 4PJ5D 4B9YA 4CMHC 3GHBH 3L3GB 1W3JA 2PXYA 1VHPA 2PTTB 3WHE0 4TNWK 1XH1A 2WUCH 2J7GA 3QUKA 4QRPD 1YYML 2GTZB 4TN9A 4YEFA 2QHRL 5INDA 4OZ4A 3UX9B 2VDQH 5B4MC 2IFFL 4C4KO 5I6XC 5J6HA 5KEZA 2DT1A 1UWGH 1BQCA 1XR9A 3F5WA 5J1AB 1CBGA 3MNWB 5I8EB 4R7NB 3S98A 1JWSA 2XN0A 2V2XA 4B15A 3IDUA 4XH2A 1KIRA 1OSEA 1TETH 2AJUH 3WN5A 3Q6GL 5INDB 5DJ2A 3MACH 4QRUA 2XZAH 4B9ZA 2OYPA 2CRYA 4O9HH 2XFXA 2IC2A 1WZKA 2B39A 3SPVA 3VCLB 3VIJA 3UTTA 2CR3A 2BVQB 3QBTB 3IETB 3M7SA 1UQZA 3ZYOA 1U42A 3EHBD 3REVA 5F3HB 3QRGH 4XCFL 3FO0L 3E3QC 1ADQH 4GG6E 1U8LB 5DWUH 1JHKH 3EKCA 6FABH 4IDJH 1L7TH 4NQXA 3R06B 4UTBH 2I5YH 2ICWB 4DKEH 3UG3A 1BZ7B 4F9DA 2R2BA 4JZ5A 1SVCP 3RDTB 4P3WA 4KDTA 2XQBL 3VDBA 5KSBE 3EMZA 2AI0L 2CKBB 3MX0A 3NPZB 2ICCA 1P6FA 3RY6A 3QI9C 3D3VD 1NGQH 2EKSA 4PGJA 1KTLB 1IGML 4JQXA 1QNRA 2R4SL 1NFIA 2VUYA 1PLGL 3GKZA 4N0YH 5FA3B 3H9SD 3OAUH 5BJTA 1HSAA 4QT5B 1JPFA 1YEJL 2AV1A 2KZWA 4LPTA 5ALBH 4HGMA 2XWTB 5LG1A 5FUZH 4H26A 3EJUA 5KZ6A 1MQPA 1KB5A 2ZOKA 4LEOB 4AMXA 3ARDA 1FLRH 2XRAL 3BIBX 3U4AA 4W8BA 4GO8A 4P7LA 1XGTB 3DARA 4JY6B 1FVEB 1OGSA 3DETD 3QWQB 3V0AC 2PI6A 2EDDA 1A1NA 3CLEH 4BK4A 2DMBA 2XZCH 3HI6H 3U7AA 4X6FB 3MUY1 4MQSB 4ZXBC 2WHKA 3HG2A 2NY4D 5E8OA 3D9AH 4XPGH 1EV2E 3OJMB 5FOJA 1BVLB 2D3VA 1FGVL 4FFYH 4LAJH 5DJZB 2WBGA 1G7QB 1MJUH 3UERA 2A6JB 2NZ9D 3GMPB 5E6YA 4ZTOL 4UINH 4O2EB 4KHTH 4RFNC 5CIPA 3T4AA 1AY1L 1KCRH 4R7DA 4L29B 4Z6AT 2OI9B 3VXUB 3A24A 4ZXLA 4WHCA 4DW2L 1A14H 3VFSB 1H0GA 2A3CA 2ITCB 5HYJA 3BSGA 1K6AA 3SY0A 4R2GC 3ULUC 4KJPC 2BS9A 3M8OH 1GORA 2J2ZA 5GGVL 4OV6F 2EYTB 1KTLA 4AZ8A 2XQYG 1RZ7L 3Q5YA 4F58H 1WO2A 3S34H 1IKFL 1I3GH 2JB6A 3D5OF 3M17B 3L3DA 4HGKC 1AKJD 4PLKC 3TA9A 3IANA 1QSFA 1NLBL 3BLKA 3LAFA 2P5WE 5DMIH 1FVEA 3OF6D 5HHMB 2BZDA 4PJFA 3ZKMD 2QV2A 5TGBA 2AI0H 4HJGA 3VI4E 2EXOA 3U7WL 2KDGA 3B5GA 5DA0B 43CAB 4U7KA 3X13B 5BRQA 4NQEA 1QI5A 4M1CC 4GW1A 3PWLA 1YEHL 5E8DH 2YOCA 4CDHA 3UO1L 3TO4A 3C60B 4TUKL 1A4JB 4GRWE 1CGSL 2CH8A 2ZWLT 3QDGD 5IB5B 1FH5H 2RGMA 3BUQA 1GOKA 3UJTL 4MJIB 1IM9D 1X6LA 2X1PA 1ES0B 4H2CA 4JPVL 4YDJB 1A6TB 5HHOD 3BJLA 2A74B 1EFXA 1E5NA 4D6HA 4OKVA 4JRYA 1Z6JT 2ESVB 2F5BL 3KZSA 1KC5H 1KEGL 3U0WL 3H9SE 2N56A 3TBYB 4MCZB 2EC8A 4ISVA 2WKLA 3MA7B 5KSAA 4GSDH 3QT2A 1X5YA 1EQCA 4BM7A 1PEZA 4I0CC 2KBGA 4JM2B 4Y19D 4JAMA 4HV8B 3CDCA 4K7PX 1HNGA 4HT1L 2VSCA 3RWGB 3ZKND 4YHML 1R0AH 5ISZA 3VFOB 5GRZA 2HG5B 2Z9TA 3N17A 3P3YA 3P4NA 2A77L 3ZDXE 4OCSH 2FB4L 1UWSA 3OKDB 4MZ2A 2XFXB 1XIWA 1YMHB 1OP3K 2IQAA 4BYHA 4CCDA 4OFIA 3QUZA 1UJ3C 3QNXB 1ZT4B 4X7SL 2I9LA 2A3EA 4TULH 3U82B 3NFNB 2XWJB 4UR9A 4PJIE 1TDQA 2QQLL 3BUBA 3KPLA 3EJPA 4KK6D 3HS0A 1WCQA 5E00A 1SEBA 3MA9L 1ZVHA 3GXPA 4JM2F 1H1NA 2GDVA 2AJXH 4TSAL 4FFVC 5B8CA 2V5MA 5I1DB 2E27L 2WQ8A 1JZ8A 3QA3B 1RI8A 1GRWA 1PKOA 2C3VB 2DOCA 3UPCA 3VMPA 3VG0L 1DEEA 5LKNA 4PV8A 1KELH 5MHSD 1TZ7A 1US2A 2CGRH 3T77B 3MRHB 4MNKA 2OWWA 2CO7B 4Y7EA 4EZMA 3L3GA 2WC4A 1L9MA 3MI6A 2EDFA 1CLYL 4Y1AE 3W9EA 4F15C 2GK0B 2F54E 3OJDB 5GGRY 3HC3L 4YWGH 2VLKE 1U2YA 1QTYT 2E9MA 3AQUA 3QA3A 3KAAA 3O2DA 3DO7B 5ESAA 1TUXA 3D39E 4PYSA 2WINB 1TR1A 3NN8A 1W2VA 2DTML 5CD5D 1U3YA 4O5LL 4NFBA 5T1DH 4R0LC 4P2RD 2F7OA 1HWGB 2XZAL 3VO0A 5EZOL 2VDPH 5C3LD 4Q22A 1CGSH 4O4YL 2ENSA 4N0CC 1WAAA 4U2YA 3X14B 2VLME 2IJ0C 5D6CA 4JDVA 3RNKA 2YIHA 1I1YA 4GW5B 3KPQB 1WBYA 1L6ZA 4LSQH 4KZEL 1F4WL 5BXPA 3FB7B 1ADQL 4H8WC 3HI5L 1XF5A 1ZTXH 5CMAB 2JEQA 2FSEB 2HN7A 1X5ZA 4ATWA 3FO2B 3SQBA 4S1QH 1N3NB 3PWPD 2I5YL 5B4MD 3KPPA 3IJSA 3PHSA 1NFDF 4DKEL 1AXSA 5CBAA 2P47B 4X6EB 4N5ED 1DWIM 1D5ZA 2APBA 3JSSA 2E3ZA 1H3GA 3I6KB 1U8KB 2AJZB 4OBRA 5D7JA 5I1HH 4PFEA 4NQVB 1YY8B 4KHXH 3HCVA 3KXFD 1LEGB 1DN0A 1OTSD 3MXWL 5BXFA 4HUWA 1ISWA 4YXLL 2VLRB 2DI9A 3TBTB 2BC4A 3GMOA 4PJIA 5FM5M 4UIKL 5JNYB 1XR8A 1KGWA 3PWVA 5EO0B 3EO1B 1YN6A 4JDZB 5CSGA 4PMUA 1N82A 4AEIH 1PBGA 5K9KB 2D0FA 1PSKL 1WFUA 1MCNA 1W72B 5D7IE 5F3BB 4N90D 3WQ5A 4M3JA 1GVIA 2EBNA 4GQPH 3MFFB 3STZB 4D6EA 1GZPB 4PRDB 1MCSA 3GBNL 4HZAA 2CK0L 2FD6H 4C56E 4MX7B 4PJEE 3S37H 4OCMC 3INUH 4YWGL 4AEHL 3KPRE 3D50A 4HX1B 4OSUL 4QOKA 2DYPB 2YPVL 5CEXB 1MUJA 5EZLB 3L7EB 3I9GL 5E2UH 5AYUH 4FXGA 4JREC 4JO1L 4DKAA 3RY5A 3AMGA 4OB5L 2UVFA 2BVOB 4I77H 5IBLD 1AGCA 4PRNA 5JQ6H 1WAAE 3AMDA 3D85D 5JA8B 4KKCD 2EPLX 2YA1A 3MV7E 1OCWH 4M7LT 3FOLA 4EUPA 4M1DL 3T2QA 5H2BB 5BCAA 4OZIE 4MNQE 4DCQA 1KJ3H 2F7QA 3TYGL 1IC5H 3MSDA 4AISA 4PTMA 1I85A 3VGDA 5EMYA 5IBUG 3ISWA 4JHAH 4DQOL 2VL5B 3PWJB 3SJVD 4PLNC 1MAJA 3PWVB 3PZOA 5C0AD 2J7HA 1LK3L 2F58H 1LILA 4BH7B 4TUOA 5DJCB 2ZZUT 4XUYA 1T20A 5EC2A 2DQHH 4I3RL 3EZ8A 1OF2A 1JN6B 4PB9H 4RFEB 5CEZL 4I0PA 4QTIL 1HDMB 4JY6A 3BZFA 1TQCB 5FOOA 5I1CL 1C8QA 4NPYA 1ITXA 2GTWA 4HTYA 4Y16A 3WFEH 1FNSL 3FB8B 3DROB 4A6YH 3ZOAA 2CLRB 3T3PF 3WY4A 1WWBX 3VWKA 3L4TA 3BPOB 1B1YA 1FFNA 4P5TA 1GZJA 1JGVH 1JF5A 3UO1H 5J7CC 3NFPA 4PMRA 3BEWA 1JPFB 1T5XB 3NCCB 5IOPA 5HYSB 4H8VA 1MQRA 3CMOL 3SCVA 3VXOA 2GJZB 3IAPA 4M43H 3QUMB 5AUMB 1WGOA 3WMCA 3V7AG 4OCLC 4QCIB 5EO9B 3EJZC 5DMGC 1HH6B 4F7MA 1Q94A 4OZGE 4U1NA 3FN0H 1FHLA 1DBKL 1BVKA 4PRIE 1G7LB 2DH3A 1SHMA 4F7PB 3ARFA 1NCBH 4MAYD 4WDIA 1XMWA 5GJTL 5C0BD 3VWJA 3VOCA 5M03A 4NUJA 4QHKI 1E28A 1OTSC 2FBJL 5D5MB 4Z7OF 4H0GA 1E6OL 5J06A 3UG4A 4AXNA 2DKSA 4QKXB 4OLUL 3ZDZF 1ZA6A 4F33B 3ZE2F 1MCOH 2ADFL 2DM7A 4QCFA 1QVBA 2ZG3A 2VYRE 3DVNB 4PSRA 2IFGA 5GSVA 1G0CA 3G5XA 4GS7B 5M94B 2ZCLL 3OZ9H 5I77A 2J4WH 1IAMA 5C09E 3ZJ7A 3QEUB 4HIIA 2WP3O 4P9MH 7A3HA 5JXAH 5ITBH 4BS0A 4N5EC 7CGTA 4XNQA 2B1HL 5I1JL 3EJZD 3W38A 2WP3T 4LEXH 4RIRA 4OM1H 3SUVA 4FQ1L 1FBIH 1S3KL 4GLRH 3ARFC 3D0LA 1O7SA 2P4AB 1G7MA 3FZUD 4U6YA 1IEAA 3WNLA 3TTOA 3AI0A 4RQQA 1FVCB 3V4VL 4N5UA 3G6DL 5DT1H 4XNUL 1OP3H 4ZFOB 1TZGH 3SGJA 3V0WH 5MERA 3FFCD 4LRNH 4M02A 3QCUH 1AJ7H 3BLPX 4OD1L 3D2UB 1QRNA 4P57B 4UAOB 1INDL 4Z7WE 1FLTX 3W0WE 3MANA 3P4NB 1CFNB 1RIVH 3PGCA 4U1JA 2DS4A 5DC4B 3LPWA 5KJRH 1F3DH 3R1GH 1EGZA 4BSWA 1QRNB 5C6TH 4P5KB 4M8QA 5LGHL 4ERSL 2EEXA 3N1AA 5T3XE 3BN9C 4JM2A 2ZSWA 3JWDH 1K8DB 5FEBA 1UWEL 1S9WA 3WSQL 1CU4H 4UFHA 1B0RB 3U0TA 4Y16C 5IF0B 5E6IA 3D0LB 1C8XA 3CU7A 5FIEA 4UDUA 5I66B 1KSRA 1H15B 2CUHA 4G8GD 5DRNB 5JR1H 2VABA 1P7KB 3NCJH 1W2PA 1NAMH 2RGLA 1OINA 3X17A 2BY3A 4JFOB 1NCBL 3IDYB 4LPUA 1UVQB 4D0CB 3MZGB 4GAJL 2PYEB 3PP4L 4PUDA 3RM9A 2Y72A 2HTKD 3QEQB 2ZUMA 1LQSR 1YN7B 5D2NA 5D9MA 3P73B 1LP9B 1FZKA 1BQSA 5GGRB 4MMZC 1D6VL 1INQA 1NUGA 1UWQA 5I1KL 4GG6F 4KK5D 3AREC 4Z2JA 4GAYA 2CCRA 4ZUSA 3GGWA 3IDIA 4AIUA 1YEIH 2A9NL 2DIBA 4HJGB 1KR0A 4L4JA 2DAVA 4QRQB 1E28B 4M7LH 4JZOB 3O6KL 1FORL 4JREB 1CPUA 1PEWA 5BZDA 2DIEA 1FN4B 1XF4B 5FGCB 3D25A 4JFDE 4ACPA 1TQUA 4I48A 1LF1A 4DOHE 1CCZA 1OAYL 3CU1A 1KPUA 4HUXB 1HH6A 5JMOC 1QFHA 4RA3A 1TNNA 2NT1A 3CO4A 1FBIL 4YPGB 5GS0D 1PGRB 3WIFB 3L2MA 2OZ4H 1ISVA 3CZGA 3KPSB 4KUCF 5H37G 4PJAF 1GOFA 3OKEA 1W72H 2F53D 3AHVA 4YDLB 5DTFA 4P3CL 1CK0H 2ZXBA 4YHOH 1G6VK 4QLJA 3OG4B 5A2FA 1U8QA 2B5IB 4MA7L 3ARBB 3T4AB 2BHYA 1GHFH 5F1IB 5GZND 4D8PA 5DD3H 4HWBA 5DC9B 5I71B 3S6TA 2P42B 2BFVL 2CLVA 1XGYH 1UZ6E 2XZQL 3HE7B 1N5YL 2R0LL 4E5XB 2AEQH 4YNYA 2CBIA 1QFWL 1LO2H 1BQHA 4XMPH 2O9OA 1D3CA 5FYLL 3VFNB 1X9QA 3ZHLA 5HDRA 1XFPA 1WCBA 2DD8L 4WWKD 3LB6D 2G2RA 4KRPB 4NDMB 5SV3A 1VENA 2WLYA 2OJZH 5DD6B 1R47A 1LEIB 2Z8RA 4NM8L 3IAQA 4MA1B 3VFPB 1U8QB 3A4WA 4GAJH 5T3ZE 4W8AA 1IT9H 2CXGA 1U91A 4KMTL 3SE4C 1RUKH 5T1MA 1EEQA 1A0QL 3C2AH 5BZWB 5E0CA 3AGVA 1W0WB 3TZVB 3GSRB 4GINA 3HMWL 5FV2A 4D6GA 4AW7A 4LNVA 1R7OA 4IRJC 4TTUA 1KN2H 4WW2A 3LQAL 5LA2A 1OM3L 3U9PH 1AP2B 1IC4L 1BPVA 2EPNA 3MQIA 4HF5H 3QIUB 3RVTC 2AK4D 1EH9A 1F4XH 4EI6B 1ZA3A 4WKHA 3PBGA 3AXLB 1W9UA 5EOCH 1HHGA 4XXDA 3A6BH 4IRSC 4PCSA 3ZR5A 1NFKA 4LLVB 1YY9C 3S96B 1H3VA 1KEML 3K8MA 4Y1AA 1MHHA 2DQDL 3ARUA 1T1XA 3HE6C 1I1AB 1HZHH 4TVSa 2VLJD 4BQ8A 3LH2H 1NMBL 5FO9B 3RA7L 1RZFL 4Y5VA 3WHXB 3WBDA 2AAAA 1TVBB 1ORQB 4KQ3H 2CRMA 5HOSA 1RZJH 1LQ0A 5EO0A 3MBXL 1GC1H 2VDOH 3QUYD 1CGYA 4OF0A 5FOBA 2X40A 2RR3A 3P11L 4JFDA 4KRNA 1DQQB 4R27A 4JFTA 1NEZA 3K7UA 3O6LL 1WDSA 2H1PH 1AR2A 4FQHB 5EU6D 2VAAA 4ZNCD 4YHIB 3DUSB 5GRJH 5A8NA 4X9BA 1LK2B 5I1GL 4NRSA 1DN0B 1BFTA 4M80A 2P48B 2G60L 5ANMA 4R7NA 2ORBH 3CLWA 1LO0L 4U1LB 2DJUA 2X4RA 2DIAA 1KTKE 3ZKXC 2IPUK 4O58L 2VN4A 5FA4A 5DHVA 3SCMD 5IWLA 5HGDB 2A1WH 2VLMD 2JJSC 5FKPA 1S9WB 4JGUA 1MEXH 2Q6WB 5C0CD 2R69L 3WH8A 3CNKA 5E03A 2HVJB 1CD1A 1GOQA 3VGFA 3DXAD 5J56B 5GXBB 1AO7E 4M6NL 1TQCC 4LLAA 4JPKH 4FNRA 2R4RL 3BXNA 5EWIH 4NKMB 3I6GB 3TBSB 5F88A 4XVJH 5D6CB 5IDIA 5KSAC 4AIZB 2H26A 2WBJC 3QI9B 4HGWB 3QB7C 2A83B 3M8OL 4X5XA 2I26N 2VWEC 3L5XH 3BN3B 3PNWA 5B39B 3BEVA 3VSVA 1GIGH 3OAYK 3KYAA 5FB8A 1DUYB 1I1RA 1S7TA 4LKCA 1ZV5A 5IVXA 2GJXA 4UI2A 3WF1A 1MIEL 1K4DA 5JXEA 1WIUA 3O6FC 4HKXB 4X4ME 1C93A 1CDUA 1EVUA 4AL8L 5DR5H 2OZ4A 5CPTA 3T2PA 5HGHA 4PMQA 5CKGA 1CG9A 3OXRB 4Z2HA 5I1AB 3SDAA 1B3YA 4MD4B 4JO2H 3H53A 1BYAA 1FP9A 3VI4F 3OG2A 3DHJA 4NN5C 5F8RC 2DQDH 5A1AA 3T2NH 5L8LB 4JZJA 4IRZH 1ZLUH 2Q3ZA 4RGOH 4HJJH 5DFWH 5HGGS 3CXHK 1HINL 2NMSA 4JFWA 1EFQA 1T1ZB 3U46A 4XCYA 4XPTH 1N5AB 5E00B 4HQQL 4W6WB 4WV1C 3F7RA 2PBOA 3MACL 4KU1A 2XVNA 1X4XA 1N0LA 4GS7C 3SKNA 4PBGA 1HQRB 2RBLA 2YDQA 1CFBA 1JVKA 4OZHF 4RFOL 4BZ2L 4J27A 2CIPA 4IMKC 3BUIA 1ZT4A 3B5HA 1MI5A 5CP7B 2CR6A 4NZRH 5EUKA 4AY1A 1NCCH 1CL7I 4HWZA 1MCIA 5DDHA 1Q94B 3WY2A 2ZCHH 2NXZB 2PYFA 4IOFC 2BSTB 3AIRA 1GAFH 4JKMA 1DANU 2HT4C 5T3XH 2XG4A 2HKFH 3WKZA 1DWJM 5DMKA 3CSYA 3BP7B 4U31A 1KB9K 1GJWA 1KXQA 4ONGL 1AD0A 3CXDH 4PRID 3ARDD 3TYFA 3S96A 2M26A 4ELKA 2NY7H 3DLQR 4R26L 3TBYA 3MV7B 3CFEB 2C1PB 1TJGH 4W6XB 1T66C 3STBA 3BWAB 1T83A 3RKPA 4G8FB 1DE4B 2DKMA 3QQ3B 2A6IB 1KJVA 1MOEA 4ZXBA 2VXVL 4GKZB 5TDOB 5ICZB 5CWSA 4DGVH 4TYUA 2F74B 5FHAL 3S34L 4RAHA 5KANG 4LYQA 5A16A 4M1GL 3NPSC 3IVKA 3WH7A 3DRQB 1R3HB 2Q76A 1B3XA 4HUKB 3B9VA 3ARTA 4XVUD 2J7LA 3RNQA 1MFAH 1BJ1J 2W0FA 4J4PA 4LCCC 4PJGE 5BV7L 2HT3C 5KOMC 2E27H 4ONHB 1FYTB 2CDEA 2JJSA 4MJ4A 4XWGL 2OQJA 3F5LA 2G2RB 4M48L 4Y8AA 2O5ZL 4HFUH 5L2JA 4U3AA 4U0QB 2VH5H 3HZYA 2J62A 1EJOL 4ELMA 3OGCB 1Q0YL 3B43A 4X4YB 4C54A 4HJJL 3PZMA 5ICZA 2JB6B 1R34A 1L7IH 1U8JA 1A6VH 3I2CL 1V6YA 5IG7B 4HD9A 4GBXB 3RFZC 1I7ZA 4HQQH 3UPRA 5C08B 4HH9A 1AIFB 3NFSL 2C1PA 5I75C 1AKJB 4KMTH 3ET9F 5BXRA 5FL0A 3MV7A 3VRJB 5IVOA 2YXFA 4JQIH 1S9XA 3OPZL 3RX5A 5J8OA 4RZCA 2H32H 1QSED 4QY8B 3QZWB 4FLQA 1R86A 2JIWA 5EPMB 1Z0MA 3MJ6A 4MXWH 1BQHG 1NGYB 1TNMA 1H5VA 4HF5L 1IKFH 1ETZB 3Q0HA 2DI7A 2WVSA 5EOCL 4H88H 4UNIA 3SKMA 2EPMX 4ZSOA 3QQ9D 5ETUB 4JRXA 2XJ7A 4B7IA 1VDGA 4R2GB 2OSLB 4ZPTB 1C08B 4N9GA 2EDQA 2R1WB 3FKUS 3MCKA 2WMIA 2JLLA 4XAKD 1PLGH 1FQ9C 1E1EA 3U46B 1DWAM 1I1WA 5I71C 1YEKL 2HMID 1UADC 2UWEE 1JD9A 4XPAL 4MVBD 2WMGA 3S5ZA 3MA9H 4MJIE 1JWMB 1C91A 1KB9J 1XHGA 3D3AA 5C9JA 1HH9A 2CKBH 1MFBH 2MQ0A 3WH9A 3KPRA 1BQLL 5ADPH 1Q9LA 3BAKA 5GIRA 3EYOB 5GZOC 4RE2A 1ZE3C 5FKAB 2APFA 3QIWC 4HPYL 4RMTA 2GUOA 1LO5B 1T04A 3TV8A 5DJYB 3W2DH 1H15A 3KGRA 1U8MB 3R0NA 1DUYA 4U1SB 4UFJA 1ZT7A 1J01A 1SYTA 1KCLA 2YRLA 1BZ7A 1T1YA 4V1DD 4PYGA 1DSFL 3O2WL 1T0MA 1S7WB 2HKHL 3FB6B 4UBDD 4V2CB 4F8TA 4GZIA 3QIBB 4CU7A 4HT1H 4CW1A 2ZSWB 1UUQA 3QXAA 5FDYA 1OAKL 2AJ3B 5AYUL 4WW1B 5ALCL 5SWSA 1BHGA 5DJ6A 4ZS6D 3MROB 1G94A 3ZL4H 2DQJL 4QNPF 1XYZA 1A7NL 2EYSA 2FGZA 4JLRA 1CICC 4PMOA 3EYVA 1D5XB 5K93A 4Y4HB 3TTQA 5C09A 1JDDA 5GRWA 2VCCA 3S4SG 1SBBA 1XZ0A 2RFXA 2V9QA 3HI1A 1MIMH 3O4OB 1NC2D 1MRFH 3C08L 4OQTH 2EH8L 3VX1A 3GXFA 5GNZA 1YEGH 3C5SB 3S5LA 4PJ5E 1H0DA 2G75B 1E6SM 2XGIA 1IEBB 5I9QB 5L6YL 2H6PA 1BLIA 4ZSOE 3QEGH 5ERWB 5L9DL 4GO9A 3E6HB 2OJEA 4RNRA 1M01A 3TT1H 5KOVC 1RULL 4NO3B 1DJSA 1IE5A 4JFDB 1ZGLB 2IQAB 2EDEA 2LTQB 1CLYH 1Y0LA 5A2LH 5MP6H 4WFEE 1XGQA 1CWYA 4WVRA 3TN0C 1U0QA 2HH0H 5E9DD 3T0WA 1B2YA 5CJQH 1OGAA 2EQDA 4OIFA 5C07A 4HKJA 1MH5B 3QDMB 3I6LD 3JWNC 4AZCA 2SEBA 3TN0D 3AY4A 5BO1L 3AHYA 3CSGA 4JCMA 4LFHG 4FTVB 4NNPH 2XTLA 4NUGL 1V05A 3MV8E 3SKOB 2J88H 3CZSA 4FXKA 1FYTD 3EO0B 3AS2A 4M24A 4UDTB 2IF7A 3ALPA 4R90L 3EYFB 5T3XL 5D9OA 1G7IA 35C8H 4Y4KC 4W89A 1OQXA 1P2CA 1RJZB 2DLGA 2JCCA 1UEMA 1B9ZA 3GRWA 4R0LB 3I02A 5J89A 2UYLB 4OF5A 3FHAA 1HHJB 3KYOB 3UR7A 4W86A 4MGXA 3V9FA 2DQEL 1FFNB 3BGAA 5E5RB 4KPHL 4KHXL 4M6OH 4PJ9B 4YFLI 1GGUA 3STLB 4M62L 2VXVH 3IFPA 4U7MA 1SJHB 3TNMA 3SDCC 4RAVB 3V8CA 3B8SA 5DSCA 4PB0H 1A7RL 2KKQA 4NN5B 5I8CA 1ZU8A 4MDIB 5F89A 4ONOA 3ZKSD 3CDFA 3ARGB 4WI3A 5A95A 4WEMB 3MUJA 5IESH 3NIYA 4ML4A 1NGZB 3DX9A 3QIWD 4UT9L 2YL5A 1CGXA 2EACA 1JPSH 4OF8A 2AEPH 4Q58C 3T65B 2W67A 3QWOA 1ETZA 3LOWA 3O3UN 3EUUA 4PGEB 2FJGA 2WCSA 5F1IA 1JYXA 3V4VH 3N1GC 2VLLB 4GQ9H 3UJJH 4FLSA 4NZFA 5IMKB 4EUPB 1VSCA 3HPJB 2VH5L 4POZC 1FG9C 4Z0BL 4PJ8B 3T3PE 3AY4C 3IFOA 4GZEA 4MB5A 4OGAC 3EYSL 2DTMH 4Z7QF 1NEUA 4Z0XB 2WVUA 1FNFA 4HIJB 4HK0B 4KK9D 2V7HA 3WXVL 1RZKC 5C0AA 3BKCL 4J1UA 3VWJC 1IGJA 4S2SA 4U1GC 5GSRA 1V3HA 5BW7C 3CFCH 3GSNB 5F6IB 2EDNA 5F9OL 2G9HB 4MNHB 2ZOXA 1TENA 1UXSB 4YO0A 3QO0A 4LMQE 4R4FL 3ARXA 4ZUUB 4ATDA 4GMSL 4HPOL 4JZOA 4JO4H 3U7YL 1XCQA 3VWKD 1RZIA 3L5WA 3MO1A 1ZGLM 3L5IA 4QHLB 3UYPA 3TLRA 3TTSA 3V4PL 4DN3L 2Y24A 5CSZB 4MD5B 2OR7A 3NZ8A 3WEXA 1U41A 1QSVA 1AI1H 4KROC 5FYLE 3UTPE 3NPSB 2X9YA 5AEAA 1YEFH 4NN7B 3QDMD 3GJFA 3LZFH 4QRTA 5EOQL 4WHYH 4PB9L 2PW1A 1MWAA 2DQGH 1UR9A 1MAKA 2BP3A 3HPLB 1T7WA 3O4LD 4OLYL 4XNZB 4P0DA 25C8H 3F12A 1YEKH 4F9PA 1YEIL 2CKBA 3VSUA 5GS2H 1CLXA 4RDQF 3AIBA 5C7XH 3KLKA 4NQVA 4D9LL 4RAUB 5AD0A 3CFEA 1A7BA 3K4DA 3WIIH 2WMJA 3BP6B 4NRZB 1G6RL 3U0TB 1UB6B 4OM0H 5CBEA 1S3KH 3KPOB 4NQDA 3HUJB 4PG2C 3GNRA 3THML 4MDPA 4LSTL 3TYFB 1NL0L 2B1AH 2VLRD 1QBAA 3TNNB 5GZOD 4L3EA 3VXSE 1I3RA 4XNUH 5KS9B 2YFOA 2WAGA 1J18A 4PCTA 4AQOA 4CNIB 3PV7A 1UEYA 3RIAK 5I6SA 2ZUXA 4L8DA 1DQDH 5E2WH 4YHOL 5DMJB 1P7HL 2X4SA 4P23A 4EOWH 4YK4B 4Z7UB 4DKFL 1RZGB 3S7GA 2AQ1A 3QNZA 2FBJH 5J9PB 2W07A 1V6VA 3NDZA 1KIRB 3MS8A 4PTXA 3WSQH 4OFKA 4WFED 3TN0B 2X1OA 2E7HA 4XC1L 2NY1C 4B3KA 5D71L 2IFFH 5GGSB 3ROOA 3E6FA 2J25A 5E4EC 1JIBA 1J8KA 2ZX9A 2PO6D 3MLRL 1UACL 1YMMB 3BAEH 3HN3A 1I9RH 4KZDH 5IEHA 4GRMA 1ODAA 3VKKA 1CDYA 1OLLA 4HKBA 4GMSH 4HPOH 5FYLH 4F7EA 2Z8SA 4TUJA 1RUQL 3AIWA 3BGMB 3ALWA 3KR3L 3TO2B 3B6SA 4L9LB 4C83B 1TZIB 4LCWB 2WC7A 2P7TB 3VH8G 4I3RH 5BWFA 3BUDA 1JGUH 1N64L 1EERB 4CW1B 3HMXL 3GI8L 5E6ID 4CMMA 3MRBB 1O7AA 1NGWB 3H7LA 1T0MB 3MRLB 1D9KD 2J5LB 2UUDH 2F54D 3PGDB 1U8MA 2XN1A 4H1LB 3S6CA 4I3SL 2H26B 1JNNL 2M1KA 3B9AA 1WWCA 4LBEA 1HJSA 5DHYA 2YC1A 4CN1A 3BLBA 4NX0A 2J7DA 4QCIA 4ERSH 3DIFB 4D0BB 4XP1L 1RFDL 3TC9A 4B5EA 4Z2GA 1I9IH 3WHE1 1I4FB 1VFBA 1JTPA 1JYVA 5IOPB 2OL3L 1LE5B 4NQDE 1H3XA 1Q38A 4K3HA 3QIBC 4WUKL 2DLFL 5AYQA 5D5MF 4UQAA 4XVSL 2HRPH 2FHBA 1UB6A 5ALBL 1I8IB 2YUXA 1F11B 2JK5B 3WL9A 3O3BB 4FHBD 6CGTA 2CHNA 3DTXB 4N8PA 1KLFA 1XSJA 4PN2A 1GC1L 2VDOL 1CLVA 2XKNA 1M05B 1AHWB 4MJID 8FABA 4ODTH 1H5BB 5DD3L 3O6LH 5C0DA 5DQJB 4N8VG 5J57B 1A3LH 2CETA 5IVXF 1PX8A 3PWUB 3RZWA 1OAQL 4WTWA 2YD2A 4O51A 2VLJE 1VFUA 3UEZA 4OI8A 5A3HA 5CEYA 3VFMB 4U1IA 4KKAD 3BH8B 1R46A 1NGXA 1W0VA 1EHNA 5EIIA 1KR1A 1HYRC 1QHZA 4Z2LA 4IRJD 2YKKA 1NDMB 1LD9B 4XPFH 4WUUA 2CIIB 1G7HA 1MFNA 5C08E 1FORH 3RWHB 5D1XD 1L4IA 5BVJB 4OZFG 2B0SH 3BUYB 3O11B 3P9LB 3GSQA 3VXME 5IW6B 4PJDA 5F7NC 4JZNB 3REWB 3WFCH 4LCIL 4AYGA 4G5ZL 3T0EB 1AKJA 3AU1B 2ICWJ 4ODXA 2J5LC 2ZX7A 5JIWA 3K74B 1SBSH 1YJDC 3G04B 4NQSA 2LFGA 2E6JA 2Y6SC 2VDKL 1G5AA 3OAYH 2G8ZA 1R3JA 3HNSL 2MWCA 4S2SB 3QG7L 3MLVL 3VGEA 4O2CA 2JJUA 1A4KA 2VZSA 4WWKA 4Z0BH 5MEPB 3GNMH 4OQTA 3O4LB 1AGBA 1QOKA 1BF2A 4YX2H 5HYJB 4UOZA 1PG7X 1NLBH 5IB3B 3HNVH 4FQXD 4FQJH 1FV1B 5DJ0B 1ZBWA 5AWNH 1CXHA 3TBVB 4NO2A 3A3HA 4L9DA 2O9TA 4ZAKB 3LPOA 1LD9A 2QQQA 1JNLH 3LN4B 4CCCA 6A3HA 4PJEA 4AEEA 5BROA 1X5LA 4UT7H 3BD4A 2NY6C 3TCLA 4WUKH 1WEJL 2YR3A 1Z32X 3RGVA 2C3XA 1QNQA 2WIIA 2EZ0D 4PJ7B 3P4MB 4JRYD 4AD4A 3T4YB 1SJEA 3TWCL 4GKZA 5TDOA 4MTVA 3EOBB 3TGXA 2DD8H 5FUCE 3PDDA 2WBJD 3W53A 5TDNB 4NQED 1E6XM 3G5YA 3WFLA 1T6WA 2BNQE 3TVMD 4TRPH 1SEQH 1MRCH 3QCTL 2E9BA 5EBMB 5CKAA 1O7DC 4QHNB 4MJ5B 1E3XA 2LU3A 3OMZA 1U8KA 2AJZA 4KGJA 1MFEL 5L7XL 4BFEA 2F7PA 1LO0H 1NCCL 4Y2DC 2H2PC 2F5BH 2WMHA 4U1MB 3UTZA 4H26B 2Q1EA 3VFRB 3ARSA 3H3PH 2JIXD 5DTFB 5T1LB 1DLFL 2AV1B 6FABL 2ARJB 3LKQA 1EJ6A 3IJSB 3SGEH 1IGTA 3DRTA 2PKDA 5M5DA 4P9HL 3BSHA 3MTRA 2IQ9H 1HCVA 4LBEB 4BQ2A 1CGTA 2EE9A 2ZP0T 4Q7DA 2NY3D 4UOW1 4XZBA 4HC1H 3WKML 4HS3B 4Q7NA 1KPRA 3W0WD 1UYQA 2FHCA 3D4YA 1GHRA 1DWFM 3OAUL 5I2IB 4ZXOA 4FTVA 4U1GB 4MSWA 5TPWL 4ZUSB 2HJLA 1WDRA 1NBVH 4HS8H 2DEPA 4UFKA 5FUZL 2VXUL 2BY2A 4P4KA 5DQ9B 5EG6C 5D1XC 3CHFA 3LKPB 3WQ8A 1G84A 4X8XA 3W9EB 4UQ2A 1Q6CA 5F72S 3VXMA 1A21A 2GY5A 4DKFH 5DXWA 3X3GL 4PJCE 1GSMA 4M7ZB 1FL3A 4OCRH 2EEAA 3DDFA 1CDGA 3O8XA 2V9TA 1INEH 1KELL 2C7UB 4Y5VC 1XGYL 2YPLD 3HE6D 3QUXD 3UTQB 1HWHB 4TOQA 4XXCC 1QLFA 3GSUA 4ZNEA 3QXWA 1NLDL 1E4XL 5DRZA 3TCXA 3MV9E 3MJ7A 1I1AD 1JCKA 3CTTA 4PJAA 1MAMH 4G42A 1EOMA 4JRXE 1MVFA 4IRSD 4P46A 3NGBC 5I66A 4GW4B 4KXZH 4XPBH 2FZ3A 1QPXA 4HOZA 5IVXE 3OKOB 1VGKA 2CESA 1EQPA 3L9RA 1VFFA 2BNRE 3CVIH 2UY4A 4X5XB 2I9LB 2FRGP 1S7UB 4XBPA 3PHAA 2P24B 1KIPB 3PWPA 3QDAA 4Z8FH 1MFCL 2D7OA 3KR3H 4NSKB 1F97A 3TBSA 4I13B 3SBWC 2YPKA 4CNIA 2CHOA 2R56H 2GSJA 3RVXC 5HHQB 3PJSA 3HMWH 2YD9A 5SWSB 4P2QE 4NRYB 2NQCA 1CDHA 1CR9L 4RL3A 3SE4A 2OP4H 3X11B 4F58L 4OLZH 2P24A 4XX6A 3QXDB 1I3GL 1CXLA 4DO4A 1GIGL 5I30