1PJ9A

Bacillus circulans strain 251 loop mutant 183-195
Total Genus 237
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
237
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFNDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSSYEDGIYRNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclomaltodextrin glucanotransferase
publication title Improved thermostability of bacillus circulans cyclodextrin glycosyltransferase by the introduction of a salt bridge
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 237
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pj9A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pj9A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pj9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pj9A01
1QLRB 5E8EB 1CTNA 1RK0A 5HVHB 1FHDA 4D0DA 1BD2A 4EZMA 1V3IA 2VI0A 1MH5B 4OGZA 3A5VA 4V1DA 4YEEA 1IZJA 5I71C 3F4VA 1HHKB 4P4RA 3QEQB 1GORA 4D8PB 3VFUA 3KPLA 5B3NA 2XT1B 2FEEL 5IVNA 4XC1H 3HUJE 2BVDA 2GK0A 5DSCA 1OTTD 2FHBA 4NZUH 3BPCB 3HA0A 1N5AA 1ZT1B 2NY4D 3RIKA 1AFVL 4OF5A 3BAEL 3RRQA 4HA1A 2V9QA 4PJIB 3MPCA 3SJVE 1YNTA 3GBEA 2OX5A 3DTXA 5KSUA 1KCKA 2EPNA 3BJLA 4NZFA 3P9LA 4R9HA 1FNLA 3BLPX 1MOEA 4DGIL 2WC7A 5CEYA 5I1DB 5C0AB 1JNHB 1U95A 2ID5A 4OZHF 4JG1H 4M7ZC 5FKPA 3BGFB 1GONA 4F57H 5DJAB 3JUGA 4LCWA 2W60A 1XGUA 1E73M 1WDPA 3V6OA 4WI7A 5BS0A 2ADGA 2AI0L 5A6SA 4GO8A 1A47A 3DWTA 4I18A 4KJWC 4QO1A 4LLQB 4HWBL 5DYOA 3R0MA 3L6FB 3RBGA 3HAEB 4XCFL 4PMVA 4ZO8A 3QUMH 4D9RE 2JJWA 3SCMD 2O26U 3QXAB 1T3FA 4JM2B 5C07B 1YY8A 5DO2C 1QI4A 4CCDA 5EOCJ 1V0KA 1I3UA 2GTZA 3WFBL 5EU3B 3KZSA 3BKYH 4YQXL 2W4XA 1YEJH 4GQ9L 1HP4A 4ZXBB 4OGXH 2YD9A 3UO1L 4GAGL 1NC2B 5IB5A 5E8DL 2PWEA 3GJFH 1MJUL 1EZVY 4IOIB 4BUHA 3L7EA 2P8PA 4WIQA 4AG4H 5F21B 2PWHA 1CGVA 3ZYIA 1UWSA 4E41A 3BRGC 4NJAL 5GRXG 2VN7A 5I9QC 1OGBA 1LP9F 1B9ZA 5GQBA 5GISL 3MRCB 1U8KA 3O9WB 5D70H 4K3GA 2YPLA 1KN2H 4J8RB 5F70A 2Z8WC 4YDVB 5DJCA 2D03L 2N4IA 5FL1A 3IDJA 1Q72H 4M9PA 1JGVH 5IVZB 4TVCA 2CRIA 4JFYB 3P3YA 5F6HJ 2IH3A 3KLHC 2WVVB 1Y0LA 4W87A 1WBZA 1MRDL 4XVSH 4FQHB 2FJGB 1RURH 3HNSL 7A3HA 1C5BH 1NFIB 3MOAH 4AW7A 1RULL 2D7NA 1MCPL 1IKNA 2JIXA 3O3UN 1GOKA 3A21A 2VDKL 1CLCA 5MHSD 2P5WB 3BSZL 3VGFA 1A9BA 1MEXL 5D5MB 4F3FA 5B38A 5EUOF 5D71L 2NX5A 4HPOH 2WXDM 3G5YA 1WCGA 4GW5B 4K3EL 3QQ4B 3RY5A 3JUZA 1SMDA 3SCRA 1YN6A 1FHLA 2WCGA 5BXSA 3T0EE 1NCTA 3OKMA 2ZNXA 1TCMA 3KR3H 3B5TA 2WMIB 3MYJA 5KJRH 5C0JB 4F8TA 1LQSR 2XQYK 4W8LA 1BZ7A 1GC1L 3E3QC 2X9XA 4NYLB 5H35A 1EEYB 1XF2A 4WCYH 4AD4A 4XCEA 3SN6N 1JWSA 2DS4A 4J1UA 3QQNA 5J11B 2R15A 3HE6A 4X6DF 1R47A 2AKRB 2R0KL 3PWNA 4OV6F 5FUCC 2H32H 4QLRA 5I1EL 5HVWA 4J23A 3VGDA 1E6ZA 3PN8A 2E9BA 3VE0B 1J9CT 4I2XE 1D2KA 3RWHB 4EN3A 2VXUL 3E0GA 4APQC 2KPNA 1LDPH 4JL2A 2J7DA 1S7SA 1G7LB 3G5VB 2UY6A 2H8PB 1IEHA 5D1QA 3LQAC 4GINA 1NARA 4M02A 2CCRA 3PGCA 3ECBB 2E4TA 1UR8A 1NAKH 3NOIA 3PV6B 1ZLVH 4AEHH 5ID0B 1WZAA 5BV7B 1EV2E 1K4DB 3S5YA 1RZ7H 5J57B 1A7PH 1L4IA 3FQRA 3CZLA 5JXAH 5L2KB 3IDXH 4FXGB 3O6AA 3VXMD 5BOZG 3GXNA 1A3LL 3L3KA 5FM5O 5GGTH 1FO0B 3IU3A 4XTRD 3Q6GL 4JRXA 1VEOA 5AG8A 1T89C 4OKVA 2KUTA 4YO0A 1YEDA 4I9WE 2XHYA 4G6AD 3CZEA 2J4WL 1FL5A 3SGDH 5E6ID 4MDPA 5I8OH 2X05A 5ERWB 1MQ8A 5FYLD 2UY4A 3B4NA 2B4CL 2FGWH 2CYGA 4Z7NF 3TYGL 2VC2H 4JFEB 4N5UA 2BP3A 2VISB 2NY1B 4UZGA 5F88B 4IRSD 3TT3L 3BKMH 4ELMA 5CFHA 3GSNB 3HC0B 4GW1B 1F90L 4F9PC 3OXSB 2V38A 5BWFA 5JW3H 4HKXA 4F37K 1OAYH 5D1ZB 1NBVL 4QXUL 2E7LA 4MD5B 5C9JB 4OFYA 1J8HE 2F1AA 3BXNA 4TSCL 2XXCB 1TFHA 2Q86B 4FQIL 5ALBL 4LRIC 3VWKC 5IMMA 5JPNB 1U8HA 4LCCB 1BAFL 1KJMA 4UI2A 4XHQA 1G7JA 1OGGA 1IGYB 4FQXC 5E2JA 2JB5H 5FYKD 2RAMA 3TYFB 3GIZH 2OL3L 1QNPA 5CUSL 4LASH 3CFCH 3AMLA 3CUHA 4UINH 4YR6B 4LFHD 1V7ML 4D6DA 2V17H 5GIRA 4PCTA 1CBVH 4ZNEA 3JXAA 3MRMA 4FFVC 2ZXAA 4LHUG 3FOLA 3QAZC 4PLJD 3RWGA 5EU6B 2FEDD 1JPGB 3G5ZA 3TZVA 2ENYA 4OFPA 3DARA 4ZOCA 5CJXA 5FOBA 5C0AD 2AV7B 2J7BA 3RTQB 4PRPA 5B8CA 2R0WL 2EYSB 5HI5C 1EQCA 4M24A 4NRYA 1KG0B 5FCSH 2Z35A 4OLXL 3MXVL 3C09B 3T0VA 1MCEA 5F1KC 1KB5L 1NSNL 3SE9H 1F4YL 1A1OB 4IOFD 3ZTNH 2WCSA 1A8JH 1UACH 4PD4J 3SKNA 4LXFA 4UQDA 1E6XM 3QEUA 4W85A 4X99A 2Y5TB 1KLUB 3QUYD 2YLLA 1OIFA 4NKOA 3DRTA 5CCKH 3ARDA 1V6XA 1JG9A 5CZKA 5IB1B 5J6HB 4MZ2A 1FP9A 3VIPA 1HSAA 1XT5A 1DEEA 2ZKHH 1PY4A 1PG7X 4JM2D 1JFQL 1QNSA 3ROLB 3FQUA 2DTML 2NLJB 3H3KA 3QFDA 3WENA 5D2LE 5A2JH 4FLOA 3ZQ9A 4ZXBD 2DDQL 5BV7L 2ICWA 1NC2D 3LHPL 5B39B 1KBGH 5F96L 2JCCB 1QSFB 1JI1A 4K7PX 4HEPG 3CK0H 3VI3F 1UH3A 3OR6A 3TTQA 3GEWB 3BPNC 3G6JF 4WUKL 5HGBA 3O6FA 2IMNA 3VGAB 1LEGA 4Y4FC 5IFJB 3BSGA 2Q8BL 2R56L 1BREA 5SX5H 1IGTB 2DQEH 4XPGH 3PZNA 1KJ2H 2ZUSA 1UM5L 3S88H 4AYSA 3PWPB 3WH5A 4IM8A 1KJVB 4OZHA 1HHHA 4WV1B 2OSYA 4LIQL 3RNQB 3V4UL 1UEYA 3DX9A 1F8TH 1LWRA 5BVPH 3QXTA 1EDGA 3MRRA 3ZE0F 1FG9C 4JFPA 1SBSL 3KLLA 4K94C 3WBEA 1LWHA 4NZRH 4YNYA 5K9OA 2HG5A 5I75C 4HH9B 3RVVD 1RK0B 2OXHA 5LA2A 1BD2B 4U5KA 4V1DB 4JFXB 1JCKA 1I1AA 4ZAKA 3P0YH 5K9KA 2VQUA 4G8IA 4P4RB 3EFFA 2VDOH 4BSWB 4H5SA 2CK0L 3QI9C 3VFUB 1JPTL 3KPLB 4GRLC 1D7FA 3BYTA 3IJSA 5F7DA 2BFGA 3S34H 3WUZA 2GK0B 3T3PF 5CGYD 5EWIH 4BZ2L 4LF3A 1YEEH 4HS3A 3S5LA 1P9MA 4WI5A 3JVGC 3NFNA 4RL3A 3GBNL 3ARYA 3BVTA 4XVUC 2HKHH 4X7DC 3ARZA 3K4ZA 1YNTB 4X83A 2YZ8A 2GIYA 5E4EB 1VPOL 3DTXB 3SKJL 5KSUB 2A6IA 3HI6H 3RIFF 1F4WL 1HJQA 2E6PA 5EBAA 3P9LB 2X1OA 3QIUC 5DO8A 1A5FL 1ZLVK 1K5NB 4N8CL 2DI7A 4G6KL 5CEYB 5DC9B 3MROA 3MRFA 1U95B 1WO2A 3OJ2C 3BUBA 1KJ3L 5FKPB 1NCWH 4YC2B 2DJSA 1OP9A 4D6FA 1T2JA 2YBRA 4LCWB 3SKUD 4P8WA 2W60B 1VFOA 1XGUB 2AJVL 2GDUA 3C6LB 4CD6A 4UIKH 5BS0B 2ADGB 4I18B 3VRJA 3RY4A 4JQVC 4YHOH 5DYOB 3OA5A 2X0YA 4WHYG 1RK1A 3O3AA 2C3WA 3JTTA 4KMLB 5A3IC 1T3FB 4D9QD 1YY8B 1ZLSH 2QMKA 3QDJB 2GTZB 4NUJA 4B9YA 5EA0H 5JNYA 3HNTH 2VKWA 3FO1A 4ZE5A 1B90A 3S36H 4AL8L 1MAMH 5DRXA 15C8H 1J0HA 1MHEA 5IB3A 3OZ9L 4JFED 4PB9H 4HG4J 3ILPB 3RL1A 4BM7A 4ODWA 3L7EB 5CKAA 2NY1D 2P8PB 4X6DA 1ETZA 3TVMB 4E41B 1BOGA 4ONGH 3RJDA 4UILL 1R8LA 4Y5YA 3K8LA 1KCVH 2YPLB 2E7CA 4ODSL 4JFUA 1FLRH 5JMRA 1JMXA 1H3TA 4N0YH 5DJCB 3IDJB 2EXOA 1FAIH 4LCUA 5IHZB 2SEBA 1FGNL 4YBQD 4LSTL 2IH3B 1BVZA 1Y0LB 4HZAA 4PJEF 4OZ4A 1MCFA 4KHTL 5I8CA 1OD0A 1BQLL 1CDCA 4XWGH 3RDTA 4DW2L 4MJ2A 1FZKA 4N1HB 2I24N 4HXBL 3UXFA 2NY6C 4KGLA 3PGFL 1BPLB 5CZXC 3TNNA 4PG2A 2RHEA 2JIXB 1MQRA 4OLWH 3UG5A 4F9LC 1FYHB 3RO8A 4F3FB 4U4BA 1P5UA 1A9BB 4NQEA 5B38B 1N0XL 4XVTH 4XAWH 4R2GB 4GAYA 3G5YB 1HVXA 2W9EH 4I77L 4W8BA 5EU6D 1IT0A 1AQMA 4NBZB 4HTYA 1J11A 5AYBA 4QRTB 2G3IA 3MRIA 4B41A 3MA9L 2YLAA 2YPKA 3OKMB 5E5MB 3MYJB 1JHLH 2NY5L 1UGNA 3UG4A 5EPMB 1BZ7B 5I0ZA 5H35B 1NP0A 3ARBD 1F58H 4UCFA 4CD8A 1XF2B 5BJTA 3ZKQD 2HT4C 4XCEB 4RRPA 2GFBA 5CG0A 2VN4A 3L5JA 4J1UB 5IW3A 3T4AA 3WY4A 2D1ZA 3CUGA 4NHUA 1RHHA 3HE6B 1GHRA 5FKYA 3PP4L 3PWNB 4PIRF 3QDHA 3FL7A 4EN3B 2PC8A 2DI9A 4HZ7A 5HYQA 4F15B 2VXTL 5FYJL 1S7SB 4GMSL 4O02L 5SX5K 5D1QB 2DM2A 3PGCB 1QSFD 3IGUA 2YPVH 4P7NA 4YUEL 3RA7H 3CMJA 1AH1A 3FQRB 5T1LA 1JUFA 3OBAA 4D1IA 1SMOA 1BQSA 1BG4A 5HBFA 3P77A 1QD0A 3L3KB 1AJ7L 4P2RA 3IU3B 3AVEA 3QFJD 3X14A 4JRXB 4TNVF 4OKVB 1T6VN 3TGXA 4KTYA 3PWPD 2ED7A 4ODUA 1YEDB 4GI6A 3TV3L 3CFDA 1R3LA 1RAMA 4K8RH 4GS7C 2ZG2A 3EBVA 1XGQA 5EOCH 2WM0A 4X80H 1Q94B 2G4FA 1FL5B 2A9NH 5IXEA 3ARUA 1U3HC 3LB6C 4GT7A 2WV3A 4OD2A 4APQA 3VD4A 3LEVL 4HT1H 3S36X 3TH2T 5M94B 2YD1A 3RKPA 3RGVA 3RPIB 4P3CL 4Q0XH 3CCHA 5HDQH 3RAJH 2XVGA 1FVCA 4OCSL 1VKXA 3WUEA 1ZT4B 4JO1H 3VU2A 4HU8A 1E4XL 1VIWA 3TLRA 3RBSA 4UOQA 4HWNA 2QSCH 5E8OA 5BZWA 3TO2A 5A69A 4U5IA 5KSAD 4ELMB 2BC4A 5IEHA 4X0KA 4HKXB 4HQQH 4HPHA 3EAKA 3C5SA 2K1MA 4L4JA 4X7TA 3ZDYF 1T89A 2V2XA 2K7QA 4LAQH 4LPVA 3IFNH 4CDHA 4KZDH 3BXNB 5I76A 1MFCH 2A1WH 4AD0A 4W4OA 5IMMB 1U8HB 3NAAH 4LDEB 2ZG1A 4Z18A 3ULVL 1KJMB 5F7HA 1TQUA 2JK5A 1G7JB 3FRPG 3T1WA 3G6JA 3WIJA 5CZVH 2J1KA 5E2TL 1KTRL 1NGQL 5EIIA 3QG6A 3IXTA 4NCC2 3G9VA 3OJMB 3V4PL 5E08L 1A7BA 1PKQB 4OQTA 4Q9RL 1D3CA 1C5CL 2NZ9D 3BE1H 2RJMA 4GO6B 2VLMD 3KJ6H 3MLUH 2WLYA 4MLSA 4ZUUB 3W4RA 5D1XA 5GIRB 4F9PA 2DQCH 3MRMB 3MV8A 1S5IL 3D4YA 1UWIA 3FOLB 3ALFA 3NCBB 2Y24A 3RWGB 4YE4L 3QRGL 3G5ZB 3TZVB 1TQBC 5JUEH 3D18A 4UTAL 3VWKA 2B5IC 3GHEL 4PRPB 5B8CB 1Y7VA 3LMJH 4NRYB 2Z35B 3CLFL 3HFML 4FQXA 4QCFA 5DWUH 3MRKA 4XHJC 5JHLL 4FNQA 2C26A 3SKNB 1V7NH 3WKMH 4X99B 5BS0D 1OGTA 4NKOB 3DRTB 2XN9E 4YHIB 4AMKH 1EHLL 1GQKA 4OT1L 1BHGA 4QRRA 3C6SA 1HSAB 1XGRA 2WW5A 1DEEB 5KTEH 3FOMA 3GRWA 4QXTA 5GNZA 1CF8H 4FQ2L 4L1HA 5IFPA 3EIFA 3FQUB 1MIMH 3QFDB 3PF2A 4BELD 5CWSA 3FRUB 4P46C 4NN5C 3IK2A 1OD7A 2DKUA 3RJXA 2B1HH 3ZDZF 1X5JA 2GDVA 2XTJE 1FL3B 2ICWB 2QTEA 3FO0H 2VIRA 1ZJAA 4BZ1L 4L3EA 1NMAH 3OR6B 5DEFA 5TH2B 1I8MA 1TQVA 5HGBB 3O6FB 5D8JL 2D9CA 4Q6YA 1NGZB 3D39D 1UASA 1LEGB 1FH7A 3GSXA 1SJHA 5A3HA 3CDCA 4XWOC 5DK2A 4MQSB 1AXTL 5I8KH 1VSCA 1GSMA 2OYKA 2Y23A 4KI5D 2DQJH 2YPLD 1EFXA 4P59H 5F7UA 5GS0H 4OZHB 1CL7H 4GI9A 4ZPTA 3SCSA 1E0XA 3N9GH 4IJ3C 2EO9A 1OAQH 1TIUA 2HFTA 3ZE2E 2F5BL 4HAFA 3U36A 2DF3A 2DQTH 2YA2A 1X5ZA 4LSQL 1HE7A 1G9NC 5C0GA 3JZ7A 4KTEL 1UM6L 4JFPB 2J7HA 5C6PB 2ORBL 4F7EA 1K4CA 3BESR 1A4JA 4LOUC 2JIXD 4XX6A 4YNYB 1DQLL 5K9OB 2CBVA 2HG5B 1M71A 4XP1H 3OL2A 2EXWC 4Y4FA 3BMVA 3UTSA 4YAQA 1SR0A 2NX5D 1I1AB 4ZAKB 1XD1A 3FW6A 4R2GD 1PFCA 5K9KB 3MRQA 3HB3C 3WNOA 4G8IB 3EFFB 3RI5K 1IC7L 4H5SB 3OLIA 1DANT 1DWJM 2ZCHL 4TUKL 1FP8A 4W86A 3BVUA 3IJSB 1OINA 4JPIA 4AEFA 1NGPL 4HS3B 3S5LB 1GAFL 3CC5B 3RU8H 4M80A 3W6LA 4QCIA 3NFNB 2PR4H 3LX9A 1UA6H 3NYDA 2OZ4A 3X3GL 1LP9B 4DK6A 3V7AE 4X9GA 4I0PC 5BXTA 4XGZB 4NC1E 4W89A 1UA3A 2EAEA 2A6IB 3GXFA 1PQZA 3H2WA 1TG7A 3HE6D 1FA2A 1Z6JT 5D7JC 2D31A 1WFNA 5I71B 1LL4A 1C8QA 2QMJA 1FLTX 2BSTA 3SDXF 1FN4A 2XKUA 1MAKA 4H1LH 4PJEA 3QI9A 1F13A 3MRFB 4HK3N 2CK2A 2ICWI 3VWJA 4AZ8A 4D2NA 2DQDH 2WNWA 1CFTA 2V3EA 3VIIA 4KI1A 2ZX7A 3QJFA 3T08A 1WAAF 2RR3A 3M8OH 2L4OA 2YBRB 1SM3H 3WYRA 2WQRA 1XSJA 5EUOB 1C08A 1XD0A 4JG0H 5HDBE 3VRJB 5GGSY 1ZB5A 4HF5L 4FK9A 3EDDA 1RK1B 2FL5B 4UZUA 3V0VA 1W72L 4JRXD 4NQDA 3JTTB 1TMQA 1YNLL 1P4IL 2DQIH 4PJ7F 2ADFH 1UM4H 2J7FA 4UOJA 1QLEL 5J0BA 4O5LL 2QF8A 5GJSH 1XIWC 4R97B 4MX7A 5C70A 3N13A 2GJRA 2F19L 4M7ZB 4NN6B 1KENH 2HTLC 5C0FB 1FRGL 3NPSB 1NANI 5DRXB 2X44D 3KPQA 2L7UA 5D6CB 3PZOA 5IB3B 2D23A 1DQML 4D9QE 3I85A 4F7PB 1Q6CA 3RL1B 4ODWB 4X6DB 4M43L 1W8OA 1ETZB 1K3ZA 2G3NA 5I1JL 3DVFA 1U8OA 2BNJA 1BOGB 1IGML 4KKLC 4PUDA 1ZHNA 2C1PA 5DFVC 4Y5YB 2DT3A 3RKDD 4DVBA 1NLBL 4M7LL 4OFYD 1E6NA 4U2YA 1RMFH 2DIBA 5F1SA 4OIBA 4AT6A 1X1NA 1N8ZA 1P84J 4LCUB 2QSTA 3CVHH 2SEBB 3KS0H 1ECEA 2PO6C 4FA8A 1ITXA 4BQCA 4OZ4B 2BK8A 5GZNC 1RZGA 5E1HB 4ODBD 4CMHB 3PWJA 12E8H 5FGBA 3TNNB 3O81A 4K23L 2W67A 5ECUA 4KUCD 5TGBA 4P99A 3IJHB 4NQEB 1OP5H 1BZQK 2CDEB 4JFOA 1JGEA 5JORA 2P8MB 1NMBH 5SX4H 4WHYH 3L1OL 1NWUA 3BQUA 3TZVD 1C5DA 3UESA 3D48R 1XGTA 4PRPD 4NRRA 5CPTA 4JFFD 5E2VL 3WLWD 5LKNA 1M53A 5LJYH 2IXVA 3WF2A 3DYOA 4HA3A 3O8XA 1G9HA 2OJZH 2UUDH 4UFMA 4NQCE 1UT9A 1P4BH 4S3KA 4OCRH 5BJTB 1NQBA 4AZ7A 3ARDD 4F9LA 4JR9H 2GFBB 1R0AL 2XIBA 3BUQA 3BKCH 3T4AB 3SGJC 2CETA 3RX7A 2WMHA 3AYRA 1MF2H 4NHUB 2NT0A 1RHHB 2V3FA 5J7CC 3TA9A 2JE8A 4RGMC 5DHYA 2VH5L 5AZ2H 4PJBE 1TTUA 1T0MA 4YXHH 4X7CC 2VSCA 1V3HA 2VDQL 1T03H 4HWEL 1A7QH 3VH8G 5HYQB 3HCVA 1XH1A 5B3JF 3VO0A 1HKLL 2KDGA 3GSUA 3PV7A 4Z5RA 3LIZL 4V2CB 3HMXH 2EO7A 2IBZY 2BVPA 4OGAD 1TQSA 5T5NF 4OJFH 5HHQA 4IDJH 4EDXA 3SDDA 2J5LC 5T1LB 3QHMA 1JUFB 1V3KA 2OLDA 4FNUA 2R29L 1DFBL 1NBQA 1QO3A 3P77B 3QXDA 5A8OA 4Z0XA 2OQJA 1MRFH 4P2RB 2QQKL 1XR8A 1HDMA 3CPLA 4U49A 1UOKA 3X14B 1JHKH 4YHPA 1JYWA 25C8L 1GQJA 1RIVH 3BUPA 2A9ML 1QSFE 4ODUB 4LU5L 3CFDB 1R3LB 3U30C 2AK4D 4P23C 1XGQB 3T4YA 4FQ1L 3BZFB 1NCCH 2OTWA 2IGFL 4APQB 4OD2B 1TMCB 2XV6B 2CLVA 3SQOL 3MBEA 1WP6A 2WAGA 3WHE1 2H2SC 3RGVB 1E4KC 3C8KA 3QFJE 3CCHB 1R7OA 1FVCB 5IK3A 1VKXB 2FBJH 3P4NA 4MDOA 1N6VA 1I9JL 5HHNA 2YBTA 1KXQE 2ZUTA 1U8LA 5E8OB 5BZWB 5LXGL 3TO2B 2YN3A 4P9HH 2BC4B 1OWQA 5IEHB 1EHAA 5CEZH 4X0KB 5KW9H 1JYVA 1I1AD 1YYML 3RDKA 2HVKA 3C5SB 5MEQA 4X7TB 3D51A 4WENB 2V2XB 3MODH 4TPRL 3UR7A 5I76B 1IEBA 5D9OA 5FFLA 4ONHA 1QPPA 2JK5B 4MJIA 2XJ7A 1KCUL 3CUFA 1KTKE 3G6JB 3PL6C 4CU6A 1PIGA 4AMWA 4H25A 3WS6C 5EIIB 3QG6B 4HMEA 3EMCA 3IXTB 4G8GA 4J6RL 5KANI 1MFVA 4MD4A 5HI4C 5HYSA 2XGIA 1QYGL 4M1CC 4RIRA 4TQEL 1N7MH 3HG2A 1WIOA 5CJQL 5M95B 1BOYA 4C56A 5D1XB 3WNNA 3OAYK 4MB4A 3MV8B 4CD7A 4KVNL 3LSOA 4J3WA 5JHDA 1G7QA 2DBLH 1CD8A 4LRNH 2V5TA 4ERSL 2OS7A 4WSKA 2J2ZA 4Z7OF 4E42A 3FMGL 3I3BA 3VWKB 3I6KA 1EBPA 3O2VL 3ULUD 4QHKJ 2ZXQA 1HXKA 4J4PA 2CEQA 4FQXB 2AEIT 4IOSD 3MRKB 4LLUA 1FNAA 4LKCA 4E8DA 4UOW1 1UD4A 1OGTB 1G7HA 2XG4A 5BOPA 5DD3H 3G6DH 3O2DL 4ZUWA 4QRRB 3R4DA 1XGRB 5CJBA 1OM3L 3FOMB 4QXTB 1J1PH 3CFKA 1UWEH 3QAZB 1E43A 5IF0A 3HAEG 5CWSB 3WD5H 1I1XA 3NCEB 3MCLL 5SWSA 5IBTH 2P4AB 4XCCH 4RQQA 1CGXA 1MW0A 3HJEA 2CLZA 4L3EB 4KRNA 4HJJL 4B7IA 1TNNA 1SY6L 5DEFB 2E9JA 4QRUA 4IRZH 1I8MB 4NO0A 3D5HA 4MA1C 4YHML 1PY9A 6TAAA 1OD9A 1UCBL 2VZ3A 5I8EA 3GSXB 3OB8A 1SJHB 3DV6A 4L1DA 4CVZA 2W0FB 2PYFA 5CINL 5DK2B 2QQNH 2ZCLL 1H0GA 3IJ8A 5D72H 2XPGA 3ARGA 1EFXB 2YKKA 1OARL 5DO2D 1YEGL 4WFHD 1R3HA 4ACZA 4ZPTB 2CLRA 3FONA 1YECL 1PKOA 2GY5A 3GMRA 1KCSH 1Z9LA 3LQAL 1IGCL 3OKKA 1WAAA 3D39E 4P46A 3EOTH 4ZSOA 2FATH 4KDVA 4ZUSA 1YEKH 1YNKL 5C0GB 4NFBA 4OM0H 3RDTD 2PF0A 1K4CB 2BCKA 4KI5E 1A4JB 2MJWA 3GXPA 3BPNB 4GMTL 2VX7A 4EIZC 2AJSH 1UQZA 1M71B 5HDLA 1FH5H 5BCAA 3KWWA 4Y4FB 3OKOA 3UTSB 1D6VL 4NQED 4YAQB 3HZMA 4PJ7A 2DLEA 3THML 1UG6A 4WHCA 1OAXL 3MRQB 3WSQH 3V7MA 2EH8L 2WINA 3VA6A 5LGHL 2O9PA 5ACLA 3HZKB 1UZ6F 3NZ8A 1CYGA 1SEBA 2UUDK 4XXDA 4R4NC 5CJ8A 1DVFA 3B2VL 1IE5A 4JPIB 1H9VA 4MB3A 4QTIL 2D22A 1DBJL 1QUNA 3WHXA 3IDNA 4JKPL 2NX5E 3MLPA 4QCIB 3GSOA 3IU4H 1ISZA 4KFZC 4O2FA 4Z7WE 1KYOJ 2H2PD 3LKNA 3SOBH 4KJYA 4ZTPL 5I75B 1QNZL 1G6VK 4ZUVA 5FM5M 5GRVK 3QR2A 1SYVA 1PQZB 3PTQA 2D31B 2X7LA 2AW2A 1HKIA 1K6QL 3A47A 5KEZA 1A14L 4KV5E 1FN4B 4QEGA 2AEQL 4PJ5A 3DPBA 5DJYA 4PJEB 3QI9B 2MPAL 2PXYC 3UAJD 4GRLB 4J3XA 1JNLH 2Y7QA 2EDFA 1VACA 5ACMA 1CFTB 1Y6MR 2UYLA 2BNUA 4IM4A 3QJFB 1CLXA 1IAII 4NSBA 1YZZA 4EBQH 2Z91A 4PJDF 3FFDA 2EDRA 3WIHH 5IJKC 5T1LD 4Z2JA 1C08B 3V52H 2W38A 3ZL4H 5JOPD 3VTRA 3GRWL 1MUJA 4P2RD 3OZPA 5DMIL 3V0VB 4NQDB 3CUJA 3CDGA 4M6ML 5D7JA 3O9NA 2HMIC 3QIUB 5DJ0B 5FA3A 4MXQD 3BHBA 1FYTB 3ZHKA 4APQD 3VFVA 4WJ5A 1QACA 3CLWA 3WDQA 4FNLH 4OCYH 4DEPC 5DT5A 5D9NA 3RGVD 5EMYA 3KPQB 2DQGH 1UKTA 5INCA 2J88H 3BZEA 3KE0A 2NW0A 1V3LA 3TWCH 4XNXL 1L9MA 3PZGA 4UQBA 1U8OB 3AM8C 3DV4A 1CGYA 3P11L 4PN2A 4NN7B 1JYNA 3LPWA 4DVBB 3QG7L 2G2RA 5E00A 4JO4L 3KYMA 1J0JA 4Z9KB 2OW7A 3HI1A 2WC4A 3SCNA 3TN0C 3EZ8A 4M5YL 4AT6B 5CAYB 1N8ZB 3T77A 3NIGE 4L4TA 3VGGA 5JLZA 3QGVA 3RWIA 1O7VA 1FIGL 5T1MA 1FJ1B 2VLRA 4L9LA 3QB7C 1RZGB 4ALAH 3P0VL 3PWJB 1NAMH 2EDOA 1L0QA 3OMZA 4OF0A 4L9DA 3WFZA 2EACA 5TGBB 1M04A 4URIA 3ULSA 4JFOB 3BZ4A 1ADQA 4U1JA 5D1XD 1QI5A 1JGEB 3K4AA 3MV8D 5JORB 1T2QL 3CFEA 1FQ9C 3VGBA 2R9HC 2BNQE 5B4MC 4WWKC 4FQLH 3MLVL 4DN4L 3W0KA 3BQUB 4ATDA 4FQQA 4JRYE 1HSBA 2X2HA 1MPAH 2CERA 4POYA 3VWKD 1RUKH 4TVSa 4RGND 1O7AA 4K94L 2PO6A 2OZ4L 4LDLB 4MJ6A 5ISZA 3AXLA 4PSPA 4ZNEE 3O8XB 1B30A 1EDQA 2DPEA 4HPGA 4DM2A 3RJQB 3PDOA 2YWZA 1U2CA 1IT9H 2VITA 4IS6A 4X0NA 1X5GA 2MOVA 2NY6B 5FUOL 4OFIA 2RCSH 3DVIA 3VFSB 4CNIA 4RE2A 5DMYA 4PJ9C 3SDYH 3VFTA 5GS0C 4QRRD 1IMHC 3NA9H 1RU9L 4HJGA 4NX0A 1GOGA 2ZG3A 4JFFE 1I8KA 4OKDA 2BNRA 4B7LA 3TTOA 4FFVD 4GBXC 3VSTA 1KXVC 1B0IA 3W11D 5DHYB 5HYJD 4HIEA 4JZOA 3MZTA 3W81A 2NMSA 1CN4A 4MDJA 2XSAA 1BJ1J 3MO4A 5HI5D 2F7QA 4NQXB 3C2AH 2FH8A 4Z5RB 2DSKA 3OGRA 2VVSA 3VA2C 3LY6A 4PGCA 5J89A 3D0LA 4OLVL 5KSVA 3S5ZA 3SDDB 3UTPE 2FBOJ 5B39G 4L4VA 1KUMA 1KULA 3QZWA 4UQEA 1PIFA 1QO3B 2UV3A 3QXDB 3KPOA 4Z0XB 3PNWA 2OQJB 5I6XB 1XR8B 3CPLB 2P47B 3SGJA 4YHPB 5IIEA 1EFXD 3KPSA 3T4YB 1OCQA 4PJFE 3SO5A 3THCA 4OLUL 4QF1A 2D7OA 1AR1C 1TTFA 2OTWB 2YRLA 1AFVH 3QIBA 2CLVB 1WSST 5HTSA 3DX2A 1AY1H 1H09A 4DUXA 5IK3B 3OG2A 3P4NB 5AAWA 3N11A 5HHNB 1KLFA 3ARVA 3BFOA 4KJPC 4O58L 4OI7A 1U8LB 2AK4E 3H9HA 5TE4L 2OYLA 4DGIH 4Y4FD 3UTSD 1RIUL 3EYSL 4U1LA 2HVKB 4BFIA 3I02A 5MEQB 5KVDH 2EKSA 1EEQA 3L7FA 1IEBB 4U3CA 4GS7B 2CHOA 1U8IA 4M1DL 4LEXH 1B31A 4ONHB 1FFPB 1K9TA 2AI0H 1ZU8A 1RFDL 2D9QB 1PZUB 1EJOL 3AIEA 1V05A 4H25B 1RVFL 3QJHA 4G8GB 3ARTA 3GNRA 4MD4B 5HYSB 2F53A 4NGHL 4LL9A 4RIRB 4LLYA 1LG1A 3SGEI 4NJ9L 4HW6A 4PRDA 3NTCH 4JVWA 3VMNA 3QUXC 4C56B 4OTXH 4GQ9H 4XMPH 1B3WA 3LSOB 2XFFA 1G7QB 2D7MA 4GAGH 4ZS7L 5DT1L 3FB5A 1J0IA 4E42B 1IFHH 2EC9T 1MJUH 3JWDH 5M17A 4RISL 3LEYL 4JHAL 3VWJD 5D7SL 3I6KB 3P2TA 2ADIA 3WN6A 5ETUA 2M1KA 4LLUB 1JK8A 9CGTA 5FDWA 4DWSC 3KJ4C 1P7HL 1PLGH 2Q7YB 1DDHA 5GRYA 5EO1B 1E6OL 4G7YL 1X4YA 2D03H 3N12A 1JTOA 5FYLH 1LD9A 1MCHA 4Y19A 3M46A 3F5JA 5BRZA 4NQDD 1ZTXL 3ULUE 2W91A 3AS0A 2BV9A 2WMKA 5EO0A 4E4PA 4MHHG 2NW3A 5IHRA 2WHJA 1WBYA 1ACYL 1LO2L 1MRDH 3CFKB 3GXIA 4Q2ZA 3MU7A 1TQBB 3HNSH 3L9RA 3WFEL 1IAOA 1ZLUK 5T3XD 3QO1B 1RULH 5SWSB 2IANA 1MCPH 2B5IB 3U0WH 1X5IA 2W1NA 2VDKH 1HOCA 3D2UA 4I3SL 5JIHA 4AH2B 5IFHH 2CLZB 1QZ1A 1H4PA 4QRUB 4Y2DA 4NO0B 2XZAL 4K3EH 5I8EB 3DV6B 3DYMA 2Y72A 1NCBL 2PYFB 1HK6A 2VAJA 5FYKH 4JFVA 3OGSA 2VL4A 1IL1A 2VUOA 4I5BA 5E03A 3SDXB 4R8WL 2XPGB 1UJ3C 3QBTB 3ARGB 3I6GA 3V4VL 1W2KT 1AMYA 4GIAA 1R3HB 2DJUA 4ACZB 2CLRB 3FONB 1CLYL 5KVGL 3GMRB 3RVTC 2XICA 1XSKA 1GC1H 2AJYL 3OKKB 4NN5B 4P46B 4ZSOB 4DKEL 4LGSB 5CD3A 4X6DE 4FLRA 4PJDA 4MNJA 1LWJA 43CAA 2NYYD 1R85A 4FP8L 2VOTA 4JPKL 4OCXL 3U9PH 3II1A 4D6HA 4U1IA 5JZ7D 3WCYA 3S37X 3FB8B 2GSIA 5E2UL 5B21A 3T65A 3VXRA 1KSRA 5I1CL 4L4PA 2XFRA 1GOIA 5KN5A 5DZLA 3CU7A 3KWWB 5AUMA 3OKOB 1CE1L 5LGJB 3HZMB 4PJ7B 4XC1L 5DK3A 2WINB 3DX6A 5TQ0L 3BQUD 5I24A 1FNEB 1X7QB 3NZ8B 5B38G 1MELA 1KFWA 1SEBB 4XXDB 3IFOB 4U6YA 4IJ3B 4PV9A 3HUJF 3HAEH 3QPQC 2Y6SC 1DVFB 3NCYS 3E2HB 4Z77A 3RWFB 3KNBB 5JIIA 4V2BA 2N56A 3O8XD 3WHXB 1G0DA 3IDNB 2PYEE 5CSGA 3GSOB 1MWAB 2NY6D 3F7VA 3F7QA 3K1KC 3ZKMD 4UZSA 3QHFH 4PLOB 3LKNB 2J4WH 4PMXA 4KJYB 1MFNA 4PMZA 4ZUVB 2DSWA 3ZKXB 1U30A 1SYVB 3T0EC 4JG1L 3FHAA 5DGRA 5ILTH 2EABA 4OF6A 4F57L 1YMME 4PJ5B 5DJYB 3RILA 4UAOC 4DO5A 1DQTA 4OLZL 5LCVL 2Y7QB 2X4RA 3TT3H 4DKFL 3KLAA 2UYLB 2BNUB 2WCAA 1F90H 4TN9A 5L2JA 3MRNB 2Z91B 3SDCD 4K9EC 3SDDD 3QUML 3ARPA 4QXUH 3IFPA 2QADD 3T8XB 4KK9D 4CKQA 4TSCH 4FQIH 5ALBH 1B3VA 1L7TH 1MUJB 2ESVA 3BKYL 2OM5A 4H0IA 4JFZH 5C8JA 1BAFH 1D5BA 2AQ3A 1UD6A 2VCAA 4EOWL 2AXGA 4OGXL 4MDIA 3CDGB 5D7JB 4CADA 5FA3B 1B0WA 3BHBB 3PZ9A 3B9KC 2V7HA 2PW2A 4YN5A 4F7TA 4FLQA 3VFVB 2HLFD 4WJ5B 3QWRA 5IM7A 5JOPE 3MBED 1SMAA 1V7MH 4ZMAT 4Q9QH 1VENA 3I75B 2FDBP 1YN7A 4PYHA 5INCB 1VEPA 4ZFMA 3B3IA 5DXWA 3BZEB 3F6IA 5DC0A 5F9WB 5IJKA 4MWFA 5ANMA 2XVPA 1FZJA 2VRJA 1UQSA 5IEKA 1Q72L 1QP1A 3NJ3A 5A6JA 2R0WH 1JGVL 4UBDC 1SBBA 3SY0B 2P1YA 2G2RB 3PHSA 5E00B 3KYMB 4MCYA 4EQ3A 3OB0H 3HI1B 1US2A 4G9DA 4XVSL 1IARB 1NSNH 1F4YH 2UY2A 2NSXA 2VSDA 4L4TB 1C5BL 5JLZB 3MOAL 4MJID 3MUHL 3LB6D 2VZ1A 3RWIB 5IBUB 5T1MB 1AQKL 2VLRB 4HHAA 4L9LB 5C71A 4HZLA 3AY4C 4YHGA 3DMMC 3QCTH 1UZ8A 4HPOL 3WEZA 2J47A 3KPRE 3VSUA 1JFQH 4JO2H 3HZVB 2DTMH 1HWGB 3WY2A 2VLKA 1OQOA 1T2XA 4M1GH 4C56D 4U1JB 3MNZA 2DDQH 5BV7H 5JHDD 3CFEB 1N2RA 5F96H 4WI2A 1UD2A 4FQQB 3ZDXE 3T2NL 1HSBB 5EZLA 3TN0A 3QNYA 1G9NL 1FO0H 1Q1JL 3E6FA 1CTOA 1MWAL 4J4PD 2R56H 2PO6B 1H5BC 1I75A 4MJ6B 3AXLB 5T3ZL 1S9KC 1OAUL 3PDOB 1PG7L 3AIRA 2VITB 4IS6B 1U8NA 4Y16C 5MP6L 5KBNC 4GFTB 3V4UH 5E94A 4W4NA 3VFTB 1Y18B 2BDNH 4UDTA 1QHOA 4HJGB 2IG2L 4LCIH 4RGNE 4J2XA 1LDPL 3EOAA 2BNRB 3WXVL 2OK0L 3NN8A 4K7PL 4WWKA 4HIEB 5D6DC 1NAKL 4JZOB 1UZ1A 3WH7A 1J87A 1RZ7L 3GSNH 4MDJB 4PR5A 5SWSD 2IFFH 4Z0BL 5JXAL 3WXWH 4G6MH 4S0TD 1VGEH 4XNYH 2ED8A 3D0LB 5GGTL 5KSVB 4O4YL 1DBBL 4NO0D 1P7KB 1W91A 1PZ3A 5HYJE 3QZWB 3BIBX 2C3VA 2JKXA 3SE8L 3WL0A 4G7VH 3KPOB 3PNWB 1H0IA 4PJ9A 1EA9C 5IIEB 1DUZA 1RUPH 5I8OL 2DH2A 3ARGD 4JHBA 4C4KO 4NM8L 3WH6A 5FO8B 3W9EB 3DURA 4AD1A 4J7RA 4BZ2H 2YD8A 1KXVA 4RGMB 3KPSB 1Y6NR 1WISA 4QF1B 1EDTA 3GBNH 2VC2L 3ILQD 3QIBB 5ESAA 3D0VA 2P48B 2X4UA 3K8MA 4WTWA 1YEIH 5KVFH 1H41A 1UWXK 1VPOH 3BKML 4JZ5A 1MI5A 5I1LA 1TR1A 1C91A 2YUXA 1F4WH 4H20L 4X98A 1OAYL 2PBOA 1DBKL 3LN4A 2EZ0D 4XCNA 3H9HB 4UNTA 5EUKA 1T66C 4G6KH 5I1AA 4MA8H 2ZCKH 3C5ZA 2APTA 5KZ6A 3G6MA 4U1LB 3NH7H 1YC8A 4K68A 3LKSB 4NO5A 3H9SA 1KJ3H 4BFIB 3I02B 4Z2LA 5C0EA 2EKSB 4C55A 2JB5L 4CL7A 1IGJA 3EYFA 3L7FB 2ZX5A 3U30B 1U8IB 2AJVH 4RMUA 3GK8H 3UCRA 2R0LL 1IKFL 2LQRA 1DVFD 1M05A 3CFCL 3LRLA 4XMKL 3V6BR 1R3IH 4K3HA 4LPTA 4Y89A 4R7NA 3B9EA 2R8SH 4PY7A 3OGOE 5I74B 2F53B 1T21B 4ODVL 5TFSL 4LLYB 4YX2H 2O93L 1J0KA 3LD8C 3TBYA 3S5LG 1CG9A 4FXLA 4PRDB 3IAPA 1J86A 3MJGX 4RNRA 2WAHA 2G60H 3HRZA 4NPYA 3DUSB 4I0KA 1MCLA 3FB5B 3LOWA 4PJ5D 4JZNA 3SE9L 3OZ9H 5IFAL 3ZTNL 1QFUH 3X12A 3V6FA 3QDAA 1R33A 2RQ8A 2K7PA 4PRNA 4U6VL 5ETUB 5CCKL 1JK8B 5FDWB 2B31A 3ZT6A 2ZPKH 2ZKHL 3AIWA 1B3YA 1OTTC 3I2CL 1DDHB 1WTLA 1ZKAA 3JWOC 5F93C 2NY4C 3A23A 1LD9B 4Y19B 1J88A 2A6DA 3QUXA 1B0GB 1MFBH 2WSKA 3MJ9H 5BRZB 4LYPA 3ZT7A 5EO0B 2NW3B 1KLGB 5D7JD 1ZGLA 1WBYB 1JNNH 4Z8FH 3PTKA 5D2LF 1BQLH 4Q2ZB 3CK0L 3LKOA 4HXBH 2V9TA 1IAOB 2OWWA 3RWJA 2IANB 3GGWB 1BJ1H 5TF0A 1HOCB 3D2UB 3MRLA 5MI0B 3SJVA 1NC4A 2WMJA 2X1PA 4WNQA 1KJ2L 4Y2DB 3S88L 4WKAA 1INDH 1A64A 4N90D 4DWSA 3K4DA 2NXYC 4I77H 5JXEA 4HIIB 2OR9L 3OB0K 4O9HH 1DEDA 4TUOA 1WNOA 2YD6A 5T3XE 1ZVSA 2XFYA 1IL1B 4KK5C 1SVCP 1F8TL 4HGKC 4O2EA 4JQIL 3MA9H 3I6GB 2AXFA 2R69L 4M6OL 3CXDL 2UWFA 3SCMC 1GXEA 1S7WA 4L4TD 3VNYA 3GDBA 4NZRL 4PJDB 1BWWA 2XYCA 3V95A 3VXSA 5DC4B 5A1AA 43CAB 2XVKA 1H49A 1ORQA 3S2CA 5SV3A 3P9MA 2VB5A 3ZYZA 3G08A 4U1IB 1D5IH 2GSIB 1KXHA 5A8NA 3T65B 3VXRB 4JM4L 4OD3H 2HJKA 2NTSP 4NZTL 2ZICA 1LJYA 5AUMB 2APVA 1X5HA 3BZDA 4LCYB 1D5ZA 3CC1A 5FYJH 4MCZA 4GXPA 3WMSA 4GMSH 4O02H 4UB0L 5DFVD 4JEGB 2I26N 3S34L 3DX6B 4XH2A 3I6LD 4EI6A 1WITA 3UMTA 3TO4D 5JOEA 2Y06L 4PV9B 2HKHL 5F7EH 4XNZC 1C1EL 2PO6D 5ISZD 1FC1A 3UC0H 1N64L 1T1YB 3F7VB 3TV3H 4OUUA 4R4FH 5BZDB 3WBDA 1O0VA 2M8XA 2WK2A 5KANG 2B2XH 3QWOA 4IMLA 1WDSA 1TVPA 5HSFA 3LEVH 3E8UL 3N06B 4RRPG 1BVLA 4U1GC 5JA9A 4JVUA 4GKNA 5HYIA 1CZ8L 4JDZA 1Z2KA 3AB0C 3FQTA 5F44A 3ESUF 4UIKL 1E4XH 1U92A 3VMOA 1MHCA 3W0WE 4EUPB 4YHOL 5L2JB 4RE4A 1HT6A 4L4VD 3IFPB 4JFDE 1ZLSL 2CIPA 1HWWA 3AI0A 2ESVB 5EA0L 4C54A 3ULVH 1D5BB 4XVJH 4LPXA 2AXGB 4MDIB 1C16A 3S36L 4CADB 3T0EA 1JMZA 5E2TH 1HXJA 3QEHA 3ALXA 2X2IA 1UR2A 1NCDH 2V7HB 1W2VA 15C8L 2PW2B 3IT8D 2Y36H 4F7TB 3QIBD 4K7PY 1OLLA 5AG9A 4Q9RH 1E5NA 5IM7B 1C5CH 1KEMH 2QL1A 2DQXA 5TF1L 4ONGL 3B3IB 4HH8A 1KCVL 1TXKA 2QEJA 3QRGH 5ANMB 5JDJA 1FZJB 4N0YL 2PTUA 5IEKB 4I2XA 1VFAA 4LLDB 1KTCA 3GHEH 2RGSA 1Z0MA 4CU8A 1MSPA 1AD9A 3JWDC 1GZQA 4G9DB 5DQJA 4AIUA 2WVUA 4XTRC 2VABA 3RWCA 3B9KA 3K2MC 4M7KL 4M6NH 4JDVA 2D3NA 4OLWL 3MLYL 4G6AC 5I1KH 5DD6A 1A6TA 3H9YA 4DEPB 4HHAB 1EHLH 4OT1H 4YPGB 4HZLB 3RWDA 1LHZA 4NNPL 2EPMX 2F53D 1UZ8B 1N5YH 1XF5A 4O00A 2F58L 3N04A 1GHFL 4FQ2H 3LRSA 1HL9A 4OAWA 1DJSA 2VLKB 3L3DA 1U93A 3QDMD 1OAKH 3ZMRA 3MNZB 4MJIE 4Z2KA 1HQ4B 4IRSC 5HVHC 1N2RB 4S1DD 1QPXA 1SJXA 2AAAA 1S8DA 2OMNA 3RVUD 5A2BA 3NZHL 5EZLB 3TN0B 5DS8A 5D8JH 1FP5A 4OF8A 4BK5A 1X5KA 4ZXOA 1F58L 1QI0A 1X6LA 2CBUA 1T83C 3W28A 5HNNA 1AXTH 5JHDE 1RJYA 3AY4A 5LWYH 1U8NB 3GXDA 3MKKA 3AXIA 2GAZA 2XXMB 1J8HA 3L3OA 4UDTB 5SV4A 4Y19D 4KAQH 5BRZD 3EOAB 3LV3B 4HV8A 4LSQH 3NN8B 4WWKB 1UM6H 1P53A 2HFGH 4S11A 4XNUH 3KG5A 2YPVL 1MJ8H 2A3BA 3CO4A 1ZLWH 3RA7L 3DO7A 1TVBA 4PR5B 4PLJC 3BRFA 1NWSA 2Q3ZA 4WW2F 2FEDC 1DQLH 2XIIA 3D2UD 4GZJA 1FV1A 3PXJA 3MRPA 3IJYA 3T0XA 4Y2DD 3BGFC 3ZTJG 1QSEE 3VM7A 1KBBA 4Y16A 2C3VB 2P43B 5EOCL 4PJ9B 5I1HL 2A9NL 3HC4L 1C92A 3QUYC 3DIFA 3IAQA 1DUZB 4BQ3A 1NGPH 4GBXB 4HT1L 2GJXA 1GAFH 4AJ0A 4GQQA 1FFOA 2VXQH 3WD3A 5D6DA 2EDQA 5F8RC 4JM2C 2BHZA 5ESAB 3STZA 3D0VB 2X4UB 4P7OA 2XA3A 1OGAB 5HGDA 2QSCL 3QXVA 3WMBA 5EG6C 1XC6A 1MI5B 5I1LB 4YIQA 4PLNC 3K0WA 2ZUWA 3VXRD 4HQQL 4G9FA 4X98B 1KPRB 3LN4B 4XCNB 2YL5A 4GZEA 3IFNL 4FMKA 1WLHA 5I1AB 1MFCL 5ITFA 2PBGA 3C5ZB 5D2LA 1CZ1A 4NO5B 4WI9A 4QLKA 1CS6A 3NFPA 4KZEH 1KNOA 3U7WH 1KTBA 4QTHB 2ILLA 5C0EB 5CZVL 1IVLA 1IGJB 3U48A 2APFA 2EJ1A 1HHJA 5HGAA 4NT6A 4FLSA 1NUNB 2AV1A 2IH1B 1A2YA 1M05B 3BDYH 3BE1L 4XP6H 3TPKA 4H88H 3D50A 3T1FA 3KJ6L 3MLUL 4GKZB 4R7NB 1IV8A 4PY7B 2HH0L 4PJ8D 4WVRA 1CU4L 4KROB 1ZBKA 1TNMA 5E0FA 1P4IH 3TBYB 2V5CA 5FCZA 1CG9B 2CESA 4M62H 4POZD 4NKMA 1QLEH 3HMWL 4O5LH 5IGXH 1IJ9A 3JV5A 3GZKA 3LMJL 3BO8B 3RVVC 2F19H 4XB7A 4LNRA 4IHOA 4NPYB 1FRGH 3HRZB 4WFFD 5DWUL 2ESCA 4UT6L 1FFRA 1P5VA 1I3RA 5A8QA 4JREB 1DQMH 1U41A 1H8OA 5E8NA 1T5WA 3WKML 4HOXA 4XNQB 3VFPA 1SQ2N 3FT3A 4PRNB 4NRZA 4S1QL 4ML4A 3OHXA 1H3XA 4GPNA 1MIEH 5DA4A 3GMOA 3P0GB 1V6WA 4GG6E 3BAJA 3BH9A 4M7LH 4Y4HA 3KPNB 1CICA 4PJ5E 5C6WH 1MIML 4BH8A 5IR1A 2F1BA 4MA3A 4RCAA 3DO3A 2A6DB 3QDGD 3CD4A 3QUXB 2ZWYA 1NANH 2B1HL 3J8F7 4XB8A 1ZGLB 3HUJB 4BKLA 3SCUA 3ELAT 3MLZH 3LKOB 1NMAL 4JHWL 4ETQA 1KB3A 4DK3A 1EXUA 3QWRD 4K23H 5DEGA 4R7DA 4NZDA 4HS6A 3MRLB 4WDIA 3SJVB 3SKOB 2H41A 3VFRA 5I8KL 4WNQB 4DWSB 3KJ4B 5C0BA 1S7QA 1E56A 1GUVA 2J3SA 5GS0L 3F5WA 4TUOB 1WZMA 1CL7L 2K9UA 2FIKA 4X7FC 3N9GL 3WS3A 5IMLA 1ZVSB 4PYSA 2YJQA 1HKKA 4W6YB 5C09A 5E2VH 4AZ5A 4ZFOL 2AXFB 3VRIA 2NR6D 3OAZH 3ZE2F 4KRMB 1S7WB 3AYSA 2Z1SA 5F7WC 3JTSA 1TDQA 4NO3A 1FCGA 2W9DH 3VXSB 3SE3C 2WKLA 1ORQB 1KACB 4NKIL 2ADJA 3FN9A 3G08B 5MEPB 2J7GA 1E4WL 1H3GA 1PBYA 2HJKB 4FN0A 4PLKC 5EORL 3S3SA 2VLKD 1UUQA 2R0ZH 4L4TE 2A73A 3EDKA 4GRWF 4NWTH 4MCZB 2NY1C 5TE7H 2Y07L 3WFHA 4HUMB 2EE9A 4XH2B 3HHRB 4RA3A 3MO1A 4EI6B 3RU8L 5DZNA 4TX6A 2WUCH 1NCAL 2PR4L 1WBXA 4XNMA 1UA6L 4J3UA 2FLBT 1SVZA 2J74A 2ZOLA 5FOOA 2R29H 2IJ0C 1W3KA 2FIRT 4W6WB 5ICYA 3RP1A 3MC0A 4YBQC 1CFSB 3QUZA 3SPVA 25C8H 1H15B 5KSBA 2R23A 1REIA 4Y8DC 1E6QM 1OL0A 3W26A 4LU5H 4H04A 4KQ3L 4OUUB 2CPUA 3VDCA 3VFNB 4FQCH 1MFEH 4FQ1H 1ZLWK 3BP7A 3PIQB 4IMLB 2JF7A 1E5JA 2DT0A 3SQOH 2YDSA 1HVQA 5ISZE 2R9HD 1R46A 1BVLB 4M48L 5LBSL 4GKNB 5E99L 4JDZB 3N18A 1SM3L 3FQTB 1I9JH 3DRQA 3VFGH 5M5DA 2VMFA 1U92B 5DVLA 1MHCB 2HT3D 4DGYH 4JG0L 5LXGH 4WHDA 4MAUH 1F3JA 2EIBA 1XGYH 5HDBF 1HJXA 2H26A 2DQIL 4TPRH 2ADFL 3NPZB 5IHSA 4U1NB 1JNDA 3U9UA 3ARBC 2G41A 3IDMA 3O6KH 1JPFA 1WCQA 3RI5F 1C16B 3T0EB 1CXKA 2X42A 3IYLW 3QEHB 4MYWB 1EX0A 4J6RH 3X3FL 2XWTA 1T7WA 1CD0A 1KWGA 1F3DH 4L4VE 4UAOB 2DQHL 3WF4A 1BJMA 3FFCE 2VQ1B 3DVGA 3EGSA 1ZA6A 5CJQH 5DLML 1VADA 1MI5D 1BFTA 2W61A 4KVNH 4LLVA 4PB0H 5C0CD 4ERSH 5CSZA 4Y88A 4MXWH 4G5ZH 3C5ZD 5DRWA 2W9LA 1VFAB 4I2XB 3VGAC 5KZCB 3AIBA 3CVHL 3H9SD 1AD9B 3WNPA 5K9QI 2A38A 4WW2A 4KVCL 1GZQB 5DQJB 2VABB 3RWCB 3B9KB 12E8L 4PTMA 3KXFA 3QT2A 1OCWL 4JDVB 4TNWF 1BAGA 5DD6B 1A6TB 1QBAA 4BA8A 3RWDB 1LK3L 1OM3H 4KROD 4HDIA 4OF3A 1NMBL 4HGMA 1IRAY 3LRSB 4OAWB 1S5HA 1X5FA 2KQNA 3L3DB 4UTBL 5HYSG 1U93B 1WJ3A 5JO5A 3MCLH 4OZIA 4FFYL 4P49A 3FTGA 3TBSA 1SZNA 3QWQB 2XWBA 3B8YA 3MXWH 5KSAC 2WHMA 3MI6A 1KIPA 2P5EE 2F53E 1KB9K 2OJZL 1NOFA 4KTDL 1GOWA 1UCBH 1OAZL 3TC9A 3WIIL 5CINH 5I18H 3KWXA 3QDME 4YBHA 2ZCLH 3BKCL 1W9VA 1F00I 1RJYB 1NBZA 3CX2A 3A3HA 1EERB 2B39A 3DMMB 2GAZB 3MNWA 1YEGH 5AZ2L 3MSDA 1JL8A 3ROOA 1J8HB 3L3OB 3DGGA 4YDIL 2VRKA 4ATLA 3LQAH 3QUXD 1IGCH 3BSHA 5I6SA 4G8EA 1A7QL 1T20A 4PJBF 3KLKA 5E4EC 3N1GC 4IRSA 3EO0A 3ARQA 5A2CA 1LNUB 2NNAA 5LGKA 4P4KC 4GMTH 1TVBB 3DO7B 5DGQA 1IGFL 1E70M 5DQ9A 2EDLA 1FV1B 3MRPB 3AHYA 1NC4D 1MFDL 1MRFL 5BRZE 3THMH 3U7VA 1AKJA 1JHKL 1OAXH 1RIVL 2F54D 5JXED 5DVMA 2EH8H 4MD0B 5LGHH 4Y16B 3G6AA 4HEME 2DM7A 3P30H 5IG7A 2PCPA 4JHOA 5FGSA 3VFMA 4EKJA 4AEIH 3MRJA 3P4MA 2ATPA 1AGEA 3EJZD 4CRPA 4OQTH 4PYGA 1DBJH 1FFOB 4JKPH 2J4GA 5I15L 3CVIH 2FBJL 4PREA 1W0WA 4WEBH 1C93A 5GGRA 3STZB 1W9PA 3PDGA 2BVTA 4Y4KC 5EOQH 3VXSD 5DFAA 4K9EL 3HG1E 1QNZH 2X41A 3CFIC 2XN9A 4P9HL 4YIQB 2VE6A 5KW9L 5CEZL 4PCSA 2IPUG 3NFSL 5GNXA 2MKLC 3GMNA 3PG2A 2ARWA 1A14H 2AEQH 1A6AA 2PNDA 3WNLA 2MPAH 2PUQT 5D2LB 3K2UL 1AQHA 2HFEA 3NFPB 3QUYA 3OLEA 3D3AA 5CXPA 4FNSA 1FNGA 3F5KA 5FK9A 1NFDE 3R8BB 1QFHA 1KF9B 4KKAD 5HGAB 4NT6B 4KI5C 4N0CD 2FECI 2AV1B 1N7ML 4M8QA 4ISVA 1A2YB 3GRWH 3T1FB 5DMIH 1A4KA 4UQ2A 1CFNA 4KMTH 1GJUA 4M6MH 5C9KA 2DBLL 3SEPA 1X5LA 2HRLA 1EAJA 1PYWA 5I1GH 3ZTJH 4NKMB 2WUBL 1U8MA 1OB0A 3SCOA 1V02E 3U83A 1IKNC 5D4QA 4CN1A 4NZCA 2V5DA 2YMXL 1IAIH 1EIBA 4LNRB 2F18A 3UZQA 4IHOB 3WQ6A 1I3RB 4CMMA 1H3WM 5IHUH 3SBWC 1T5WB 3Q6FB 4DKDC 3QPQD 4U1MA 1EVUA 2GJPA 4HAGA 1OT1A 3FT3B 4NRZB 4XNXH 5FO9A 5DD3L 3FO9A 5DTFB 3BEWA 1TFVA 3OHXB 1ULVA 4C4KT 3GMOB 5D7LE 2PB1A 4WFFE 3BH9B 1E28A 4JO4H 3OKYA 4Y4HB 3LD8B 1J1PL 4NM4H 1UWEL 1JXKA 1JI2A 2O5XH 4M5YH 1G7MA 4BH8B 5IR1B 3IDGA 5CD5D 4MA3B 3WD5L 4J27A 2FX9L 5F1NA 5IBTL 4XCCL 1FIGH 1WVZA 2QR0A 4BKLB 3OPZH 5CMAB 2WW8A 5EH1A 3P0VH 5DA0B 4ETQB 1GOHA 1CI5A 1TA3A 3AMKA 4PJXA 1EXUB 5DEGB 4ZTOH 4R7DB 4PGDA 1L9NA 4NSKA 1U0QA 1ACZA 4WDIB 2B20A 2CUMA 3QDGE 1OPGL 2QQNL 3VFRB 4F15C 3WD1A 2MQ0A 3EOYG 1MW3A 3CX5J 2ITCA 3V2AR 1S7QB 4DN4H 3F5WB 4BH7A 2FIKB 4F79A 2R2BA 3WS3B 5IMLB 4P7QA 2XA8H 2NY4B 2FATL 1YEKL 4K94H 4ZQKA 2BZDA 3VRIB 4ZPVA 2OZ4H 3T0BA 3KL5A 4OM0L 3VXTA 1W3JA 4W5ZA 2IMMA 3AHVA 4BQ6A 2QSQA 1WDQA 3JTSB 4YHNA 4NO3B 4U6XA 5FUOH 2J25A 2AJSL 5AEAA 4PGEB 4RMTA 1FH5L 2OR7A 5EO9A 1BX2A 4KI5F 3F5LA 3O3EB 4PV8A 2EDXA 5IBUG 3MTRA 3WSQL 2NXYB 3FZUD 1G6RA 4PUBL 4I9WD 3QNZA 2A73B 4TTDD 5FGCE 5I30L 4P9ML 5DUPL 1Q0XH 2X4TA 3PZQA 3WFHB 5INDB 4LSDA 4X6FA 1WC7B 4RMWA 1GGBH 4KK8D 5JQHC 2VR9A 1YPZF 3MO1B 4OLVH 2CDGA 1RQ5A 3RKDC 3IU4L 3SCMB 2E7LC 2ZOLB 3R8QA 2VLKE 1M6OB 3SE3A 4HC1L 2EADA 3MV7A 5ICYB 2PF6A 4X9BA 2LFGA 5E1QA 3PHAA 3D5OF 3SPVB 5EBWA 3C08H 1DQJA 2R23B 4Z7WF 3CFBB 4WU5A 4A2LA 1T5XA 5C86A 1J8HD 2AXJA 4WFEE 3ZJ8A 3BP7B 5D8WA 3CFJB 3CSBA 5D2NE 1AQ0A 1JNLL 3CSPA 5DQDH 1RY7B 5F9JA 2XN0A 5F3HA 4H8HA 4KV5F 5HBBA 1CDBA 3JV0A 1WZ1H 4YHKL 3PZTA 4EBQL 5J6GA 3DRQB 4O58H 4J3OC 3TZVC 2CKSA 2QKIA 5CJXC 1G9MC 3QCVL 3RX8A 3ZL4L 4BYHA 3UYOD 2QQLH 2Z8SA 1YQVH 5B8CC 3N85L 1F3JB 5D9SA 3N17A 2WYSA 3WLWC 1NOWA 1OIMA 4LKXB 1RUQH 3E3QE 4MNMA 4Y16D 5E9DA 5L9DL 1HEZA 4ZD3L 5IDIA 1NPUA 4L29B 3U9UB 4RMQA 3IDMB 3U1SH 3U4AA 1ISWA 3QZWG 1JPFB 1LO0L 3ARDC 3OLGA 4OCYL 3IETA 2DQGL 2XWTB 3AB0B 4NGHH 4ZFGL 3AMGA 4NQCA 2EO1A 3GNPA 4EKXA 3DVGB 4WEUD 3EGSB 5ABEA 1ZA6B 2GCYA 4BQ9A 4B3LA 4B9ZA 5GGVH 3MMUA 3SUWA 4N42A 2VERN 2HISA 4LEOA 1HNGA 4G9FD 5K33A 3JWOL 4LLVB 3TV8A 4ZS7H 4KKCD 3KHOA 4K07A 4GKLA 5CSZB 4OGAC 1VB9A 2AABH 1QQDA 5A16A 1M7IA 4RISH 3LEYH 5DRWB 1IZKA 4JHAH 5D7SH 3ARBA 1MCWW 1TITA 4WW2B 5A40E 2J12B 3ZM8A 1INQA 3EYVA 3NIGF 4FXKA 5C0DA 4D3CH 3UG3A 1XYZA 4ALAL 3SGEH 2VCCA 1NAML 2JIEA 5C0CE 1JFXA 1E6OH 4G7YH 3F6LA 3BP4A 4FMFA 4JVPA 2C8NA 4L3CA 1J8KA 3H9SE 4N0UE 1ZTXH 4HDIB 4PRIA 1LO2H 2EEXA 1S5HB 2X4NA 3RIFK 2JF1A 1ISVA 1QNOA 2IPKA 2NY7H 3IDIA 1JGUH 3U2SA 3FTGB 4LSUH 3TBSB 2VX5A 1QEWA 4KMQA 2G75A 2J8UE 4I3SH 4CN6A 1WPCA 2XWBB 2E9WA 2HT2D 3A0OA 3DJ9A 1AGFA 4XZUA 2J78A 2YKLH 2ZUQC 1BTCA 4KUCF 3IXAB 1MY5A 3UJJL 2RCSL 3RFZC 3DX4A 1NCBH 3O4OB 3WDHA 3SDYL 3MV01 1GHSA 3D25A 8A3HA 3IS0X 4W70A 2WWMD 1FH8A 4R8WH 1NBZB 3M07A 1FNSH 1EHNA 2A74A 3HE7A 1MVUA 3MNWB 4Y4HD 1XMWA 1CICD 1VFFA 1CLYH 4NO2A 3ROOB 3VI4E 4AEEA 4PFEA 3DGGB 5EFIA 5JW4R 2AJYH 3WJJA 4DKEH 5FOJA 4D94A 3QH3B 1XEDA 1T20B 3C2AL 4FP8H 3NCCB 3KLDA 4QWWC 4IRSB 2NZIA 3IDUA 3FXYA 5KSAA 5KAQF 3EO0B 4JPKH 4OCXH 3MS8A 3NGBC 1DE4A 2NNAB 2O9OA 5E2UH 2F15A 1BWMA 5I1CH 1GVYA 5F1OB 2BVYA 2W92A 4TUJA 1CE1H 3Q0HA 4LDOB 2IUZA 1I3VA 3ULUC 5L0QB 5C0BD 1YQ2A 3G9AB 1VCAA 5TQ0H 4LQFH 1YUHA 4JKMA 3G6AB 1D9KA 4BCEA 3PQYD 1GYAA 2PCPB 1O5DT 3OKLB 3VFMB 1PX3A 1HHIB 1S7XA 3WKZA 2O92A 4FF5A 3MRJB 3PXHA 5C09D 2ATPB 3F7RA 1AGEB 2VAAA 4RA0C 4PJFF 1TETL 2Q8AH 4CCEA 4Q74A 3VD5A 1AY1L 3EZJB 1I9RL 3S37L 3SDAA 2F54E 4PREB 2ZSWA 1W0WB 2L7JA 1AGDA 1SJEA 1JPSL 4P4KA 2H6PA 3DI2B 3L3HB 5GGRB 4TVPD 4H0GA 1P69B 2X4SA 3KYNA 3BVNA 1DP0A 2VL5A 5C92A 5DMGD 5FECA 2XN9B 3RIAF 1A3QA 4R97C 2VE6B 4KPHH 1KC5L 4NN6C 3B5GA 3NPSC 3GMNB 2NXYD 4FTVE 2APXA 5KVDL 3QOKA 3DNKA 4EEEA 1NDGA 1A6AB 1BIIA 4LEXL 4IRJD 5DD1L 5HHMB 4OLZH 5LCVH 4XX1E 4KK5D 3VXSE 2HFEB 2ZE0A 3QUYB 4UNVA 2XTJB 4DKFH 5FK9B 2HTKD 1VGKA 2LAGB 4Y5YC 5ALCH 2YD2A 3MRDA 4N5ED 4QHUA 4ISVB 1RZFH 4Y4KA 2AERT 3EKCA 3IDYC 3GUTB 1CQYA 3NTCL 4LVOC 4OFDA 1UC6A 4OTXL 2C3HA 4UQ2B 1CFNB 3QUZD 4XMPL 5A43C 2Z1KA 4EOWH 4HSQA 4IBLT 1CXIA 5ICZA 2BSRB 3VNZA 4E9LA 2E27H 4MJ4A 3OR7A 1PYWB 3RDTC 5GRZA 3DSFL 3REVA 4CMHC 4MS8D 4U1HA 1F45A 1U8MB 2W65A 2EQDA 1IFHL 3JWDL 3AXXA 3AZSA 3GHBL 1NMCC 4PG2C 5IW6A 3D39A 4UFKA 1QRNE 4JN2B 3UTTD 4HULB 1NJ9A 4W88A 5CBEA 4CMMB 3MV9E 4BQBA 3GBMH 2HRPH 2PTVA 3VW3L 1PLGL 2Z31C 4U1MB 3SQBA 4GH7B 5IQ7H 3C60D 3FO9B 3BEWB 5JIKA 3RNKA 4X4ME 5FYLL 4JANA 2E6QA 1DLHB 4EUPG 1M1SA 3O41A 2YHGA 4S2SB 4EAMA 1E28B 4GRWB 3D3VE 4WU7A 3DX7A 3WF3A 1ES0A 1G7MB 1AE6H 3IDGB 3C87A 3DXAE 3ULUF 3S97C 5FKAA 2J7EA 5F1NB 1YPZA 1DL7L 3VINA 1RJLA 2H2PC 4X7SH 5DDHA 3U0WL 1XV8A 1ZHLA 3ZZ1A 2QR0B 4PJGE 1AQKH 3LPFA 2AEWA 5IFHL 4WRLA 4YHYB 4Z7QE 1HJSA 1TA3B 1B88A 3QEGH 3SBWA 4PJXB 2V7NA 4WO4A 1CGWA 5BROA 4PGDB 2GQHA 4NSKB 3UCQA 2OW6A 2R1YA 4Z7WA 1UB5A 2KZ1B 4Q6IC 5D93C 5FYKL 3UAJC 3EYOA 2JJTA 3NCOA 1WEJL 2ITCB 4FNTA 1AP2A 3FB7A 4HIJA 4R6UA 3T2NH 2XYLA 2R2BB 3CGTA 4OQ1A 5GRUL 2Q76A 4KXZI 1G9NH 1IAKA 1Q1JH 3W37A 2PWFA 2GK1A 1MWAH 1T0PB 3SGKC 1TJGL 4ZQKB 4ZPVB 5CKGA 5E0QA 4WJXA 5T3ZH 3U9PL 1OAUH 3VXTB 4PRHE 4OLEA 5BRPA 1CLZL 1PG7H 5E56A 3KXFD 4W93A 3W24A 1FPTH 4U6XB 5MP6H 1EJ6A 1WKYA 3O2LA 4GKSA 4MXQC 1US3A 3F7PC 4YXLH 2HLAA 5JA8B 1BX2B 2IG2H 3VIKA 5EU4B 1GPOL 5TDOB 4DFHA 4PV8B 1ESWA 3WXVH 2OK0H 5I17A 2H9GB 3DX8A 3RGVC 3EO9L 4K7PH 3CNKA 1G6RB 2RGLA 4ZOEA 3JSSA 4HIXL 4H2CA 4Z0BH 5E70A 2X4TB 1PX4A 4L8SA 3OQ3B 4LSRH 3BCFA 3GI8H 5EBMA 2CDGB 4QHKI 4O4YH 1DBBH 1TZHA 5FF6B 4LNVA 3VCLA 3U7AA 4AZBA 2R1XA 3TH3T 3SE8H 1BGXL 4FHBD 3ZO9A 3GSWA 4EXKA 3QHFL 3EJYD 3MV7B 4W4OC 1VRXA 4U31A 3WSUA 1MCOH 5EBWB 3TTYA 4AC1X 1DQJB 3QQ9D 4R96A 4NM8H 1T5XB 5ILTL 3BGMA 5J1AA 4ZOAA 2DYPA 4MSWB 5JIPA 1HINL 3OX8A 3TT1H 2MCPH 1YJDC 5JPMA 4PTUB 5F3HB 2DH3A 1OD8A 2I9TA 4MVBD 5D1XC 2H3NA 2ZXBA 3QULA 3QCUL 5J6GB 4H20H 4CD4A 1H3UA 3O4LE 1DBKH 4M1RA 4OCMC 1DUYA 3HZYA 4NRSA 2OMBA 1L7TL 4GUPA 3ALWA 4JFZL 3SKMA 2R1WA 4RGNC 3REWA 1AKJD 1Q9LA 4PP2A 5D9SB 2W0LA 3VFWA 4N0FA 2BNQA 5AZEH 1HEZB 5EOTA 5C3LD 3GMQB 4M29A 1TVHA 3P9WB 3G5XA 4JRYA 3EOBA 4NP4L 2R0LH 1FVDA 1IKFH 5K9JL 3MMWA 3NMEA 5GNYA 3MSGA 4XMKH 4DVRL 2GI7A 5EBLA 3I9GH 2ZX8A 1OBAA 1MREH 1E4JA 3HI5H 4Q9QL 3WD0A 5J56B 1MCJA 4U3AA 4ODVH 5TFSH 3BD5A 4NQCB 1ADQH 4X4XA 3W11C 2G9HA 2GCYB 1UXWA 1YMHB 2XN9D 4R3SA 2DGAA 1SYTA 2BOBA 4LEOB 1B1YA 2Y5EA 4JFFA 1XSIA 2EPKX 4QRPE 1FBIL 4Z2GA 4P57A 1R7AA 2YL9A 4PJBB 4F80A 1QQDB 5A16B 5IFAH 3D52A 3HMCA 3H6JA 1M7IB 1PG7W 2G5RA 2XKSA 5HHMD 4UT9L 2V9RA 1NDMA 3ARBB 3QPXH 4OBSA 3D69B 2XTJD 4U6VH 4YWGL 3MRGA 3EYVB 2AK1L 4FXKB 2JB6A 4G9FE 5I23A 1WIUA 2HN7A 3QCTL 2JELL 3I2CH 1PZ5A 4JO2L 2D7TL 1CNVA 2CDFA 2H1PL 1RP8A 3H53A 3BP4B 3GJFK 2CJUH 4M1GL 1V08A 1MLCB 5KS9E 1I3GH 1UYWH 4PRIB 4WWID 1V6VA 4F66A 3WL9A 2X4NB 3K80A 2IPKB 5K59E 3BC9A 4PJFA 2NTFA 2GJZA 5IVXE 1FO0L 1T0OA 2G75B 1W3LA 3GIVA 3ZDXF 4WUUB 4MTVA 5FDYA 4DO6A 1AGFB 4XZUB 3QFJB 3RPKA 2IBBA 1A7RH 4CUCA 1IQWH 1I1WA 2OR9H 4H1LG 4XPAL 2AK4A 2WBJC 3GSRA 3D25B 2BDNL 4DUVA 4GI8A 3F65A 4LCIL 4JQIH 4YZFE 3X11A 5MENE 3VXPA 1N0LA 1L7IH 2A74B 1J05A 3HE7B 1MVUB 2R69H 3ABZA 5CIPA 3VXUD 3FRPA 4N68A 4M6OH 4MB5A 4QGYA 3CXDH 4YFDB 5EFIB 4P2OC 2BVQA 4Z2IA 3GSNL 2IFFL 4PJCA 1IBGL 1ZHKA 5JW4Q 4EE9A 4IIQC 2X8RA 1H5VA 4ONFL 3WXWL 4G6ML 4UNUA 3Q5TA 1JTPA 1VGEL 2C4FU 4XNYL 5KSAB 4D0DB 3T2PA 1QR4A 1JXJA 1DE4B 4XPFL 4JM4H 3U82B 3LEXA 4PMQA 4NZTH 3UBXA 2IAMC 4PY8J 1NFKA 2BOCA 5LA1A 3O3DA 4G7VL 4TUJB 1IC1A 2BHYA 4HCRA 2YDQA 4KWUA 5ITBH 3VWJC 4GAJL 4UB0H 1RUPL 4DM1A 4QLLA 2DSZA 2A6JA 2JTDA 1F11A 5DSCB 1YUHB 1D9KB 1V8HA 2DJ4A 1DN0A 1N5AB 2FO4A 2Y06H 3S98A 3NABL 1S7XB 5IW1A 4PPTA 2Z92A 1C1EH 2WNGA 1YEIL 2VAAB 5E1AA 5KVFL 3MNVA 1N64H 1UWTA 3SDAB 5FXCH 5C0BE 1W0VA 8FABA 1B4JH 1AGDB 1UKPA 1SJEB 3A67H 4P4KB 2H6PB 4PJAE 3LRGA 2X4SB 3PQYE 3KYNB 3BVNB 2WKGA 5FECB 4MA8L 2ZCKL 4XT1C 2VLJA 4PP1D 1DLFL 2ZP0T 1HKMA 3NH7L 5C09E 2X2YA 4YK4C 1UD3A 4NHCH 1HWHB 1BEYL 3U7BA 5GS1A 1JN6A 3E8UH 2YC1A 2C3GA 2NY2C 4IUGA 1VAHA 4F58H 1NDGB 1CZ8H 4DCQA 1DWAM 3NIDE 4LVHC 4Q97A 1BIIB 3GMLA 1WWAX 4PG9A 3GK8L 4TVPE 5GRJL 3IJ9A 2D7PA 1EAPA 3DLQR 3EJSA 1IAIM 1R3IL 1VGKB 3C9NA 2UWEE 2R8SL 1XH3A 4NN7C 2CIKA 4HS8L 3MRDB 3H7BA 1QHZA 4YX2L 4QHUB 5FHBL 3DX3A 5K9QG 1XCQA 1GIGH 2HP4A 4FFZH 4Y4KB 4K3JH 3MV7D 1TE1A 2XACC 3Q48A 3GMMA 1MXGA 1DSFH 1LVEA 2NYYC 2XWJA 3BYYA 1HTYA 3OR7B 2G60L 5IB5B 3REVB 1TPXC 4PLKD 5JZ7C 4U1HB 2W65B 5FGBC 5JW5A 1QFUL 3D6GA 5IW6B 3D39B 4WIWA 3DDGA 3AUVA 5H2BA 5TF1H 1NJ9B 3CZ8A 3F7YA 1XH0A 5CBEB 5KSBE 1NQ6A 5B22A 2ZPKL 1U8KB 2W0KA 3BQUC 4P5TA 3QHZH 4K8RD 3U7YL 1I7ZA 3HNVL 4ZDHA 1O6IA 3RNKB 4HBCL 2Q6WA 2GVYA 4JANB 1FCCA 4M4RA 1MFBL 3MJ9L 4JGUA 2FE0A 3UTTE 3O41B 4UIMA 4Z76A 1A3RH 3V0AC 5E9DD 4Z8FL 1JNNL 1WBZB 3O8XC 4WU7B 1J5OH 3DX7B 4W7VA 1ES0B 4MLIA 1V0NA 4DWHA 1RZJH 3TM6A 5FKAB 1FNHA 4Z7VE 1YPZB 3W25A 3OSKA 4M7KH 2MKWA 1RJLB 3ZKMC 5DDHB 4AMCA 3MLYH 1QLFA 2DRUA 4GZIA 4UFIA 4NNPH 1CBGA 2PYEA 2XWDA 2NX5B 2F58H 1INDL 4NQCD 1GHFH 2V7NB 4WO4B 1F6AA 3B8SA 4O9HL 4OF7A 2Z31A 4K3DL 2EIEA 2ZJSH 1MCWM 2R1YB 4Z7WB 1UB5B 2VYRE 2OTUA 3EYOB 1AIFA 1I9IH 1YN6B 3V5KA 1AP2B 4QRQA 3FB7B 4HIJB 3NZHH 1A6VL 4POUB 3SDCC 3TPUA 3TF7C 2XI9A 3RHWF 4IISA 3U6RA 3SDDC 3A22A 1YMMA 1IAKB 2PWGA 2QADC 4YGAB 1Z0NA 4KK9C 4MAZA 4O51A 4Z78A 4DGVH 3MBXH 2ZUNA 5I6XC 3WKNA 1JWSB 2OR8A 1ZEAL 4ZFFA 1D5IL 4OZGE 1I1YA 3PZUA 4AQ1B 2BXYA 1LILA 4OD3L 4TRPL 4GKSB 2DOCA 2XG5A 5A8MA 1CEOA 1FVEA 4KDWA 5DJXA 2AJ3A 4Q6IA 2HLFC 5AY7A 2OTPA 1A0QH 5HGHA 4PRID 3MBEC 5I17B 1MJJA 3DX8B 2PW1A 4BFGA 4EUPH 1LO3L 3KXFE 2EEAA 4M5ZL 3H3PL 2DQUH 5F7EL 4JO3L 4L8SB 5ESVA 1B6DA 2BX5A 3CJJA 3SGKA 5C0NC 6CGTA 3UC0L 5DJZA 5EBMB 4HK0A 1TZHB 2Q7NA 5FO7A 4NI3A 4YO0B 3VCLB 2R1XB 3Q5YA 3C8DA 5I1HH 4OZIE 4R4FL 3HC4H 4XXCA 1ODAA 1QNRA 1HKFA 2B2XL 1NH6A 4R96B 3HG5A 5I66A 3HE7D 1I1FA 1CFVL 3ZT5A 3S4SA 3BGMB 5J1AB 3VKKA 2DYPB 1BBJA 2MHAA 3OX8B 5JPMB 1GZPA 2ARJQ 4OZFA 4K7FA 1J01A 4W81A 2D24A 3MLXH 3DX1A 2I9TB 3AIVA 5E0CA 2H3NB 2X70A 5CP7A 4OI8A 1WGOA 2R39A 3B83A 4Y5VA 1E4LA 3KPRA 4WI3A 3NIFE 3HZYB 5EZJA 1WWBX 3SKMB 4GUPB 1J12A 4AD5A 1PEZA 3SUSA 2R1WB 2HYMA 4XVJL 1Q9LB 2A83A 3REWB 4J4PC 5DHXB 4N0FB 2BNQB 1D9KD 5EOTB 4RWYL 4R0LA 1GGTA 1NCDL 1TVHB 2D4FA 3G5XB 4JRYB 3CZSA 3EOBB 2Y36L 1B3XA 2A3EA 1MFAL 2OYPA 4GRMA 4MNKA 1KEML 5EBLB 4L8CA 3CXHK 2HH0H 3SDAD 4X8JA 3S35X 1CU4H 3BUDA 3WFLA 4P4KD 5I2IA 3Q5OA 2QSVA 2G9HB 1GGCL 1P4LA 2GJ6E 2JJVA 3HMWH 1A21A 4R3SB 5FOBB 5CQ1A 2NY3D 5EFDA 2BOBB 4JFFB 1OP3H 5F9AC 3JV6A 3U4EA 4U3HA 4HWBA 5J4MA 4P7RA 4UT6H 4P57B 1NGXA 2V5MA 4M56A 4LHQB 4LVNC 4XBEL 4Z6AT 3QEUB 3WQ5A 4UU9A 1NDMB 1QBML 2O5ZL 2Z93A 1ZSDA 3OGCA 4M6NL 1MFUA 4NNYA 4P2YA 1V0MA 5I1KL 1Q9OA 1PX8A 3ARDB 4S1QH 1EGZA 4NKDA 3MRGB 1U2YA 2JB6B 4X6CE 1Z9OA 3ARGC 2HN7B 1N5YL 2DWDA 1BSIA 2Z4QA 5HHVL 5HYJA 3PBGA 2CDFB 4Y4KD 4XUYA 3GO1H 3L4WA 1FZMA 5HHME 3ILQC 5J3HC 2QPSA 1OAKL 1T22A 1EH9A 4OSUL 3WL9B 1PDKA 2NPLX 3WEMA 1LMKA 1ZVYA 4JHWH 1CDJA 4PJFB 2NTFB 2GJZB 4FABH 5KOVC 1N82A 2OWCA 2EZ0C 1I9EA 1A7NH 1SYSA 5EDXA 2WSPA 2ICES 3ECQA 3QHOA 3VMPA 3TA3D 2WP3O 2J6EA 2YRPA 4Q7NA 3BOVA 5EC1A 4U7MA 4HXAL 1V03A 4V2XA 5LWYL 1BLIA 4A3YA 1HHHB 1GZJA 2VDPH 5FM8A 2AK4B 5E8EA 3DX9B 2GTWA 3GSRB 2E8ZA 3BDXA 4ONOA 4KAQL 1DVFC 3EBAA 3E2HC 3X11B 3VXPB 1J05B 5M3WA 5A6AA 3MRRB 2EIZA 5E95B 4HFUL 5CIPB 1VFBA 4M4PA 2HFGL 3ZYOA 5GJTL 3U5UA 4AMXA 5C0RL 5CSUA 4XNUL 1MJ8L 4HP5A 2BVQB 1JAKA 3FB6A 4HD9A 2IGTA 5BXRA 5HGGS 5IB4A 4NKIH 3RUGF 3ZKXC 3NACL 3PZMA 1KGWA 1JF1A 2YK1H 1E4WH 2ZUQB 3VXUE 1CR9H 4GRWE 3LEXB 4MA7L 4WO4D 4U33A 3UBXB 5C2UB 1VA9A 1INEL 5EORH 4M81A 2BOCB 5JDSA 4LSPL 3EW3B 2WBJA 1W1TA 3DVNA 4YGVA 2VXVH 1CPUA 5F7DB 2Y07H 5I3DA 2A6JB 1F11B 4F8QA 4LF3B 2DKMA 2VXQL 4C59B 1DN0B 2FO4B 1NCAH 4ZFZA 1CD1A 4PJXE 4GAFB 2YD3A 4P2OA 5IW1B 1HF6A 4GQPH 5ABFA 1QG3A 1TCRA 3BD3A 2BJMH 2Z92B 5IOPA 4IIQA 5E1AB 1NEZA 3MNVB 2DWEA 3MUIA 1H1NA 1HZHL 4S1RH 3NGBB 1W0VB 1G9ML 5FCUL 8FABB 3BDBA 4CJ1A 4XCYA 4HMDA 1B2WL 4RX4A 4UV7H 2CD0A 3BN9D 4KQ3H 2IAMA 5GS3A 4LLQA 3AXHA 1IEAA 1OSZA 3UDWA 3MROB 5TDNA 1QX1A 1OY3B 3O0RL 4KZEL 1X4ZA 4WLCA 3U7WL 5GS1B 1JN6B 2YC1B 4M48H 5C07A 1AXSA 3FQWA 2FCBA 4LAJH 1BQHA 5LBSH 4KC3B 5E99H 4DCQB 1GGYA 1WZLA 2D20A 4DQOL 3GMLB 4PG9B 5F9WC 4Z7UE 1EAPB 3BDYL 4XP6L 1JGDA 4H88L 3BAXA 3C9NB 1BGAA 3QA3A 3O3AB 3INUH 1XH3B 5GRWA 2CIKB 3H7BB 1CIDA 3AFLA 4AZ6A 4IOIA 5I1IL 3L2LA 1XCQB 2R4RL 1RSFA 4HUWA 4M62L 4NUJB 2R2EA 5IGXL 5JNYB 2EE2A 1W2PA 1Z3GH 2EH7L 3FO1B 4LP5A 2XWJB 4L9LC 3O9WA 4ZO6A 4YDVA 2DIJA 3ZHDA 2DYPD 1MHEB 3X3FH 2PTTA 5JW5B 4F9DA 4XB3A 2DQHH 3CU1A 1U9KA 1WDRA 3EYUH 4QXWA 1OQXA 2EDNA 5H2BB 3MV7E 1PSKH 3DC0A 5DLMH 3CHDA 4KDTA 3AISA 1OF2A 3F7YB 3J7HA 1MIEL 4QYOA 3UBXI 4NQUA 2Z0BA 3QNXA 4D6IA 3IFLL 4P5TB 2LABA 3S96A 1I7ZB 1R5VA 3TO4C 4ZDHB 1JDCA 2OL3A 3IDYB 4KJQC 3K81A 2Q6WB 1LO5A 1OGSA 4LVOB 4GG6F 2APBA 1W9XA 2LTQC 2AXHA 3WEXA 2FRGP 3QIWA 4UIMB 4Z76B 2CR6A 1JRHI 2BNQD 5I8CB 4KVCH 5DFWH 2QV4A 1GOFA 3RDTB 1FZKB 4JRYD 3MLZL 1DZBA 1UG9A 3LQZA 1OCWH 5FL0A 1NMCB 3FAXA 3MUJA