1PJ9A

Bacillus circulans strain 251 loop mutant 183-195
Total Genus 237
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
237
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFNDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSSYEDGIYRNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Cyclomaltodextrin glucanotransferase
publication title Improved thermostability of bacillus circulans cyclodextrin glycosyltransferase by the introduction of a salt bridge
pubmed doi rcsb
source organism Bacillus circulans
total genus 237
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pj9A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pj9A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pj9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pj9A01
3GMQB 4XP9H 1S9YB 3LN5B 4C7DA 3V6FB 1A21A 1XGUB 4ZE5A 2YBTA 3QI9B 4GAFB 1FZMB 4G6AC 4NQVA 4LSPL 2BX5A 4U2ZA 2AEIT 1JYVA 4ZUUA 1BVKA 5I1DB 2XFRA 4M29A 3LKSB 1B88A 1F42A 2Z92A 3VFRB 4A3YA 1EOMA 4C56E 4BYHA 4KTDL 1SEBA 6FABH 2EO7A 1A6PA 5D9PA 3ARXA 1B0IA 4D6CA 2Y06L 2EXWD 3W9EB 4GW5B 3F8UB 1CR9L 1SYSB 5FDYA 4CN1A 4HK0B 2VABB 1FSKC 3TIDB 2BOCA 2Y6SD 1DUYA 2VLRE 5I8OL 3W0WA 3DXAB 2EE3A 1D6EB 4ZD3L 5I3DA 4PV8A 1ZT4A 5CIPH 3QR2A 3RM8A 4DAGH 3HMCA 1MIEH 3AU1B 3Q6FA 5FUCE 2JFEX 1U95B 5HI3D 4MAUL 5EC2B 1YDPA 3MYZA 4KJQC 3ZZ1A 1MJ7H 1WWBX 4K2UH 3CDCA 3KG5A 1YNKH 5M7QA 3H53A 2UZYB 1AGCB 1IAIH 1D5XB 3MRMB 2J8FA 1T1XA 3W5MA 5E7FA 1NARA 4YHNB 1MCCA 2R4SL 3U79A 1ZGLA 2ZX8A 5I1CL 25C8H 3WLWC 1S78D 4QOKA 4YBLC 5B8CA 1CL7I 4JANA 2QHLA 5C7XH 4HIJB 3BQUA 5TQ0L 2XZCH 4MXQD 2G9HB 3K8MA 3B5TA 4PJ9C 3LB6C 4WIWA 2XVKA 1BF2A 1QFWH 3L3DB 4FMVA 2NY6B 1FC1A 2W07A 1X9QA 2G5RA 1A7BA 3JTTB 3T0EA 2R0WH 2YOCA 5EB9A 1AQMA 2EYTA 2MCPH 3N0PB 2KBGA 4I48A 5FGRA 3C9NB 3IVKA 1JHKH 2XGIA 2VXQH 3MO4A 4PGJA 5J8OA 2YPLE 3BKYL 4PBVC 1CLXA 1KT2A 3FB6A 4ATDA 1TENA 3GSOA 1OGTA 1G0CA 2XZQL 3WEXB 1GJUA 3GXIA 1R8LA 5KSBF 4O51A 2VLKD 1E28B 5T3XH 5ABDE 2VZTA 4TUKH 3GSVA 4GG6F 3N1MC 3HC3H 4MJIE 3OJDA 1KJ2A 5HHXH 5BRPA 3HCVA 5C70A 2J8OA 1ZHNA 1J0KA 3MOBL 3W0WD 5FK9B 1T7WA 3BUTA 3CH8A 3QO1B 2UZIL 4I77L 3BP4A 3DX9A 5TQ2L 2UY6A 1P7HL 4LARH 1U8PA 3SKMA 4XVUC 4GUPB 5FYJD 1DQQB 1PW3A 4D8PA 3BKJH 4GLRI 2IALB 1T4KA 3RVTD 4MAVA 1VPOL 4EUPB 1LL7A 3QIWC 4XP6H 1NWTA 5H94B 3RO8A 1BX2B 2W65B 3C6SA 3JWOL 4QOKD 5C0GA 3VMNA 1DWGM 1P4BH 2XV6B 1XR9B 3BQUD 3NCEB 5AC5A 2IEPA 3KPSD 4LSUH 3VDAA 1QTYT 5EBLB 4CD5A 4WI7A 4PRWA 2CKBH 1UZ8B 1FV1B 5SWQB 1CDCA 3T8XB 4F7CA 4CKVX 1O5DT 1OWWA 4IIQB 1MCHA 4IMKC 4AISA 3IS0X 2R2BB 2EEXA 3KWWB 3BEWB 4OFPA 1MIEL 1DE4A 4RAUA 3CHCA 1A2YB 1A6AA 4QRQA 2KQMA 3HKFA 4W4NA 1YZZA 1LO3L 2XQBL 4KXZI 2JCCF 2NNAB 1E6XM 2M26A 4R7NB 3MLWL 4UTAL 3BFOA 4AD4A 4M43L 1VFUA 3UESA 1FZOA 4JO1L 4AIZB 1IFHH 5DJ8B 4XP4H 5FUCC 25C8L 1GNXA 1E0WA 3MZGB 3LD8B 2V9RA 3MUZ1 1Q6DA 2P8LA 4TQEH 5CD5C 3KVQA 1HHKB 3TYGH 5J12B 3BGAA 2VITA 3WKMH 4TSCH 3MA9H 3TYFA 5IGXH 4N0YL 1YPZA 3ZR5A 4EQ3A 1EO8H 3DSNA 3LEXB 1XF3A 4UFMA 3L3IA 3HUJE 3WUEA 3G5XB 5EUOB 1ADQH 4IOSD 2YPVH 4R3SB 4OLUH 4NQEE 5BW7C 2HISA 3WD3A 1EO7A 5KN5A 3UCRA 4NC0B 5E9DB 1NGWB 3FN3A 5CILH 3GMRB 1NAMH 4FQCH 4I18B 1I9RL 2W0KA 4NKOA 2CDEB 5IB2A 2D03H 2ZXAA 3D0LB 3MA7B 1KGCE 2ORBH 1QI4A 4KRUA 1AGEB 5HI4C 3RUGF 3ZDYE 2C3XA 4U4BA 2NXZB 1G9EA 1AXSB 1U41A 4OI8A 4K3JH 2Z93A 4BKLA 1R3KB 4PJCA 3O6KH 4NM8L 2WBJA 2IQ9L 2A83B 4OZGF 4QY8A 2QL1A 3MFGB 3MLUL 4Z5RA 5MI0C 4OIAA 6A3HA 1V7NH 5T3XL 1G84A 2F15A 5LKNA 3AIEA 4RFEA 5HHXL 1D9KB 2C3VB 2NY4D 4K9EC 4PJAA 4HULB 3QO0B 4IOFD 3UCQA 1CWYA 2CHNA 4XZUA 2LV4A 4KQ3L 5AUMA 2A38A 1D5IH 3MU7A 2IH3A 2EDJA 1TPXC 1IGYB 1OLLA 1I85C 3P4OB 5DJ6A 3A0OA 1Y6MR 5CZKA 2PXYA 3FT4B 5L8JB 1PKQB 5EMYA 5ICZB 3OAYH 2OYKA 2LABA 1QRNA 4Y1AD 2GUYA 4DN3H 1W72B 3IAGC 4MD5B 2R69L 5CP3H 1ZSDA 3MLSH 3W0KA 5FV2A 5KVGH 4DTGL 1J1OL 4HKZB 3HS0A 2DQJH 4PP2B 4OOUA 2EC9U 4F7PA 3UTQB 1DLFL 5GS0H 4LHJB 5DJ2A 4KV5E 5C9KA 4U5IA 1E4XL 4D1IA 1J18A 1MHEA 4KPHL 3L6FB 3WUWG 3KLAA 2CKBL 2EKSA 4GQ9L 1ZLSH 5J9PA 1DL7H 1UGNA 2PB1A 1PLGH 1QNSA 3VD4A 2OP4H 3X11B 2D0HA 2QKIB 5E1QA 3OZ9H 2DQTH 5INCB 3MRNA 2F74B 5C86A 1P7KB 4DM1A 5FUOH 1XF4B 2BNRB 3IDJA 1IMHC 4RMUA 1G9NL 4NHCH 4E41A 1DQMH 4NRZA 2GAZB 1MNUH 2WNGA 5JW5A 2E40A 4GPNA 3QIUB 1T80A 4AY1A 4PJ7A 3POCA 2LFGA 3SDDC 4POUB 4Z76A 2EH8H 1FNGB 3HC0A 4N8VG 1CBVH 4GS7C 3NA4A 1I8MB 4PJHE 3SDAC 4Y2DB 1LJYA 1QOXA 2WBJD 4C57C 3TYGL 4CKQA 1YEFL 4KMQA 5DHVH 3HE7B 1CICA 1ODAA 1VESA 3S8WA 3BP5B 1EO8L 5GGVY 3REWA 4PRHE 3NIDF 1ADQL 4RL3A 2J77A 5HSFA 2EE2A 5B3NA 4ELME 3H7BA 3SE9L 2X42A 1V0LA 3QJFB 1TE1A 1C90A 2NX5E 5SWZA 3WIHH 2KDGA 3CC5B 2DH3A 5CILL 4WO4B 5C07E 4Y5VA 5FOOA 2H8PB 4R2GD 1NAML 4YBQC 5C0JB 2ESVA 3I84A 1AD9A 4PR5A 3GXFA 4U1GC 3MNVB 1KPRB 2YUZA 4FTVB 3NMEA 2PXYD 2W92A 4A2MA 5JTWA 1UWUA 1W0WB 1VKXB 4W86A 1U93B 3DVFA 2CKNA 1QRND 1UZ4A 1UACH 4GRMB 1ZHKA 4YZFF 1FFOB 3SCMC 2EDWA 3VFSB 1T5XB 3QWOA 1DQTA 3P73A 5DQ9A 1NC2B 4JDZA 1OF2B 4HXAH 5K9OB 3WBDA 2YEZB 2JIEA 4U6HA 5ID1B 2CIKB 3QA3A 4XXDA 1HNYA 1VFFA 1HWHB 3VSVA 1JBJA 5C6PB 3LQZB 4RRPG 5ILTL 3PHOA 1A7PL 4AT6A 3VIMA 1HXKA 4N1EA 3QFJB 2VC2H 3IDNB 5LA2A 4U1HA 5HDQL 3O0RH 5E6ZA 1RZ8B 1DANT 3MJ9A 1HZHH 3U4BH 4FA8A 4S11A 3O8XA 4XBEL 4WK9A 1U6AL 2PO6A 3C8KB 3TM6A 4Z7OF 1N82A 5J3HD 5IBLD 3T0XA 1MPAL 4FP8H 4IOIB 4AMXA 5JR1H 2I9TB 4HGWA 3EW3B 3BXNB 4PSRA 2EPMX 3MANA 5C0EB 1KC5L 1MUJB 2P5EA 3TIEB 3RGVD 1S8DB 3X13A 4URTB 4YXKH 5IKCB 1T7YA 1A3QA 1KFAL 3VSTA 3KYOA 2UWFA 5ESQB 4NKMA 2P8PA 5DJCB 3S88L 1CICD 5GZOC 3AQUA 32C2B 3WFBL 5A8NA 1GXEA 2D0GA 5GRXG 4IRJA 2PKDA 3LV3A 2GT9A 1ZA3B 1CLOH 1T03H 5HVHC 4HKBA 3GMMB 3CGTA 5I1EL 2WW5A 1DL7L 2E6JA 3T4YA 1PLGL 1L7IH 1YMMB 3KPMB 4F15C 5SWZD 4FZEL 4OLZH 4G5ZH 3LEVL 3TO2A 3CTTA 1KCRH 1VHPA 4WFGD 5FEBA 3U0TB 1UQSA 5FUOL 4EDXB 1G7MB 1W32A 2ESVD 3DNKA 2W91A 2OR8A 5DA0B 1MNUL 2L7JA 1BM3L 1BBJB 4JFDE 3VGHA 3WFDH 3WN5B 2V2TB 1TETL 1HKIA 2QLVB 1DEEA 2MOVA 1BVLA 2DTSA 2EKJA 1X5FA 3OB0K 1T1ZA 5JOPD 3EBVA 4LEXH 3FAXA 3N1QC 5E8DH 1EUUA 4P46B 4Z78A 4JO2H 1TTFA 1ZANH 1WBXB 2BNUB 1NGPH 3K2UH 1YECL 3SO3B 4G3YL 1UA7A 5D9SB 1MREH 4MS8C 1L9MA 2ZP0T 3PV6A 1A14H 3DURB 5D70L 4GAYA 2DLFH 1R85A 4XX6A 1NAKH 3T3ME 2H3NA 1I1FB 4NQCE 3T2NL 1QNQA 1HNFA 2AK4B 2I9LB 2VX7A 5J6HA 4OZHB 4NNYA 3ROLB 3VDCA 1LL6A 4HKXA 1H11A 2C26A 2QQKH 2RJMA 4XPGL 2BVOB 3ARRA 2H45A 5B38G 1I8IB 4ZNEA 3VXPB 5IM7B 2GFBA 3GDBA 3L1OL 4WNQB 1B0GA 3RL1A 2IANE 4UFHA 3QWRA 2P5ED 3SKJL 3O6FA 3H7LA 5FIEA 1MFCL 2V5CA 1JYNA 1CLCA 2BMKA 4G42A 4NO5A 4YIQB 4OZFH 2I24N 2BVDA 2OTWA 3TNMA 4KK8C 7TAAA 4NZUH 4IRJD 1U92A 1R86A 4JRXB 4JB9H 2NW3B 2HJKB 2ITCA 1U8IA 1IQWL 5CLTA 1KACB 5MHSD 3WUBA 2AABH 3RJDA 1IAMA 1WFTA 2E6PA 1I9IH 4IMLA 4AIEA 4ZMAT 3LPGA 3IKCB 2E7LC 4HMCA 4JN2B 5JO5B 5CAYB 5D7LA 5AY7A 5LBSL 4CCEA 3O6LL 1KN2H 4D0CB 1G7IA 4FXKA 1C12A 4OGXH 4NHUA 3WCYA 4YLQT 3K80A 1JJUA 5HHVH 3IDYC 3D0VB 4APQC 3SUUA 1KWKA 3U82B 5GRVL 2XTJE 5ERWA 2Y24A 5IEHB 5EU6A 3S5LA 1DN0A 3HRZA 1A7NH 4N0RA 3RWFA 3RVWC 1MCEA 3AIWA 1TTUA 1NOUA 4NQVB 4X6DE 1AQKH 2Q6WA 2X70A 4CMHC 4Z7NE 4ZUUB 1BVKB 5ADPL 1H1NA 1KV3A 2YZ8A 2Z92B 1TFHA 1OM0A 3MV11 4OD1L 2NR6C 1SEBB 3BSZH 2H41A 4YHPA 3R8BB 3RZWA 3BHBA 1MFAL 3GHEL 3AHTA 1BZ9A 4H8UA 1RAMA 1W91A 4XPTL 4WWID 1FGVH 3QNYA 3S36H 5HJ3A 3ARUA 2BOCB 5L7XH 1F4WH 1DUYB 2W62A 3C60A 2HJLA 4GH7B 4PJIA 3LHPH 3W0WB 3H9HA 3UX9B 1WCQA 1OL0A 3RJQB 1M71A 3UJIH 4PV8B 1ZT4B 1NUDA 4WTZA 3Q6FB 2A3HA 1RQ5A 1YDPB 1QSFA 3JV0A 3QWRD 3TA3C 2B1AL 3GHBL 1FLRL 1DWHM 4PMZA 4J23A 1T1XB 5JQHC 5AD0A 2OSYA 4MTVA 1ZANL 3TA9A 2CERA 4NRXA 3T3PF 4GO9A 1ZGLB 2G60L 3VXQA 5JHLH 4P23C 2JB5L 2HT4D 2NYYD 5LGKA 4QOKB 4GG8A 5T1LA 1XR8A 1ZGLP 5B8CB 1EGJH 4KK6D 2HLFD 2W9DH 1GW1A 4L8DA 2AVGA 3BQUB 1CFVH 1JPSL 4OGAD 3PXJA 4FXLA 4YQXL 2UVEA 2XN0A 2ZG2A 4BFIA 1V0KA 4XX1G 1CS6A 4OF3A 4P57A 5FM8A 3POHA 4XC3H 3OF6A 4HX1A 4QRPA 2K7QA 4LCWE 4URIA 5D7IE 1DVFC 1HJVA 4AH2A 3CUPA 2QMJA 5EU6D 3T0EB 3V0AC 2DL2A 1FYTE 1GC1L 3L4UA 4U1LA 2EYTB 5IBTH 3L2MA 3EHBC 4I48B 3U7BA 1S9XA 5KVMC 1EJOH 5F1NA 4JFTA 3IVKB 2NPLX 1UWSA 1AGBA 1NBQA 4NZUL 4Y4KD 3AB0C 2HFTA 1S7UA 3GYCA 3QUYC 4P8VA 4JDVA 1G7HA 3FB6B 3I2CH 3MJGX 5T3XE 1Q0YL 3GSOB 4W81A 1OGTB 1VFAB 4ZSOE 2WBWB 4O51B 5CJBA 3LKPA 5HHOE 2HFFA 3GSVB 4CJ0A 1P5UA 2W9EL 3OJDB 1KJ2B 4OM0L 3HCVB 3V5DA 1ZHNB 2VVNA 2R8SL 4OI9A 4P99A 5MENA 3HZ3A 3C6LD 3NAAL 1A6UH 4JM4H 1KXQE 5CMAA 4HOXA 2HRLA 3BP4B 3DX9B 4E42A 1SBSH 4OBSA 1MXDA 1RULH 5F7LB 1FN4B 1E6JL 4G43A 4M1GL 3UTPE 1BFVL 1C91A 1U8PB 3ZM8A 3SKMB 2YSSA 1QSFD 2HFGL 1CDUA 1RUMH 3MUHL 1ODUA 2HN7A 5A6BA 4D8PB 1TZ7A 3Q5TA 2XTJC 4XT1C 4UFLA 4O5LH 2ZOKA 1T4KB 5EH1A 3QXAA 1E4KC 3RNKA 4P3DA 5D5ME 2YBRA 3TZVC 5JPMA 4FQLL 2EXYC 3ULVL 4QRUA 3C6SB 4B7LA 5T1LD 5C0GB 4BQ4A 1PKOA 5GS1C 1CQYA 1IGTA 5IF0A 5HOSA 1C1EL 1MJUH 3P0YH 3I6GA 1A02N 5IROC 3WELA 2Z31A 3AMLA 5L7XL 2EACA 4V2XA 2H6PA 2NY4B 4UQEA 1R7AA 1FNEA 3S7GA 2DL9A 2FH8A 3OAUL 3N12A 1RU9H 3OF6D 3UJIL 1OT1A 4F7CB 4M82A 4AMKH 2VQTA 5ADOL 1E0OB 2DWDA 1VBUA 4GRWF 4WFHD 1AKJA 1DE4B 4RAUB 3RHWK 3VXSA 2IXVA 1HJUA 4QRQB 3VWKC 4GINA 3KYNB 3B4NA 2CPUA 5I78A 4MAYC 3K1KC 3UDWC 4LKXA 1EZVY 4KJQD 4ETQA 1FZOB 3QEQE 5E8PA 3QDHA 2VKWA 4GXVH 4NNPH 5JHLL 3GZKA 4O58L 1T20A 2P8LB 2C7UA 2W9DL 1MRFH 1VEMA 2VITB 3LQAH 1E6ZA 1E4MM 3TYFB 1CFVL 1YPZB 1Q94A 4PJDE 2AERT 2X2IA 3JUYA 4JFQA 4RX4A 4OM1L 3L3IB 5FA4A 5JHDE 1YMHA 3DUHA 3WF2A 2UUDH 5ALBL 3HPLA 1DP0A 4XPBL 4C56A 4RBPK 5T3ZH 3QUZA 5SWSE 3ULUH 4PJ9D 3SGJC 4P4KC 3WXVL 3WFLA 4FQXC 1A7RH 5KN5B 4OQ1A 4RDQG 3R0MA 4MSWA 5JORA 4M81A 1ZEAH 4KJYA 2VX5A 2YL5A 4IMKA 3T1FA 1PX3A 4ZS6C 4NKOB 5IB2B 3IF1A 5DK3A 3ISWA 5C0CA 5A6BD 4YUEL 1B0RA 2H2PC 3VW3H 2F1AA 4HJGA 5KZCD 4HWEH 1DQDH 4RFOL 2CKRA 5HHQA 4BKLB 2IPTL 4PJCB 4P49A 3EZ8A 2WBJB 4RDQF 3UR8A 3L4TA 4QY8B 5E8OA 5A8QA 2EPLX 4Z5RB 1MCIA 4GKOA 3EJSA 4UZSA 4A6YA 3L4ZA 1C5CH 2BHUA 1CLZH 3CSBA 1X6NA 1QBML 1KELL 3SBWC 4RFEB 4PJAB 1K6QL 4XZUB 3L3KA 5HGHA 3VX0A 1NMAH 1RZKH 4PP1C 5HYJA 4FFWC 4L4TE 1A6UL 4RMTA 2R9HC 5AUMB 1H09A 2IH3B 3JWDH 3M1BA 1IC7H 3PZMA 1G9HA 3W25A 4RGMB 3RBGA 5DJ6B 1EXPA 1ZT7A 5C2BH 2PXYB 4KC3B 2UY5A 1TMCB 3U7YH 1LDPL 4JG1H 3BAKA 4XVUD 4O5LL 2CSPA 3EDFA 4K23L 3ZDXF 2YPKA 3SCNA 2A6DB 5KANG 1KTDA 1ZSDB 1W2PA 3JWNC 1RK0A 5L0QB 4D3CL 3HS0B 3IJHA 3KXFE 3QQ3A 3H42H 1KWGA 5CQ1A 3QIWD 3FOMA 5DJ2B 1MJUL 1K2DA 4PFEA 3FB8A 3P0YL 1EDTA 1MHEB 5DD0H 1N6QH 4GI9A 1JE6A 4RX4D 4P8UA 3GJEA 3KLAB 2PYEE 4LMQE 4V2BA 5HYSG 2EKSB 5J9PB 1U9KA 1MCWW 2FX8H 3RVUC 4C56D 3TBWA 4AMKL 1DR9A 1JUFA 1EMTH 1G01A 2ZUSA 1JWUA 3MRNB 2V5MA 1XGZA 3IDJB 4E41B 2CNCA 1PD6A 4K8RH 4OIIL 2DQDL 2UZXB 3VG9C 5KTEL 5JW5B 4CNIA 4FF5A 2ALWA 5C0CD 1UM4H 1Z9OA 4PJ7B 3C8DA 3EYSH 1C16A 1WTGT 3S3SA 3ZT6A 3G5YA 2D9QB 3N1AA 1R0AH 1G9NC 2WMPA 4Z76B 3HC0B 3S4SG 4MYWB 4UT9L 4OCYH 4BZ1H 1WO2A 1GOIA 2CBIA 1HX0A 2J7GA 3B2VL 2DQGH 1CICB 3IU4H 4LLYA 2WMHA 4GO8A 4UZGA 4YHYC 5CD5D 3REWB 4MHHI 3BZDA 4NYLA 3BAXA 3H7BB 3FQRA 1RUKH 4CVXB 2BDNL 5TF1L 5SWZB 3ULUL 2APVA 2XYLA 1ZHBA 12E8L 5IMLA 1F8TH 2P7TA 5B22A 5JW4M 3M46A 5D2NE 2NY7L 4Y5VB 3WD2A 4LQFH 3SE4C 3OGCA 2ESVB 4FS0A 4ETYA 3GBLA 1AD9B 4RMWA 2OYMA 3FY1A 4PR5B 1JNHA 5ANMA 4RCAA 1ZHKB 2D4DA 2O9OA 3QWOB 4QCIA 1DQDL 3VJ6A 3P73B 2W38A 5DQ9B 4MLSA 4JDZB 5A95A 3SDDA 4GQQA 4LCIL 1JGIA 2CRZA 4WEBL 1VRXA 4MX7A 4U6HB 3QA3B 4XXDB 1OD0A 5GNYA 3NH7H 3DIFA 1EPFA 3K46A 5HGBA 3PHOB 4AT6B 1BOYA 4Y4FA 2OL3L 3RRQA 1LO5A 2F61A 4W8BA 2E7HA 3CSPA 5FGCE 3BWAA 1D6VH 4U1HB 4JPWL 3L2LA 1XFPA 3Q6GL 1V0MA 3PE9A 4DKEH 2DGAA 1QFUL 5D1ZC 2DEPA 5EB8A 3O8XB 2PC8A 1W8OA 2YPLD 4O2FA 2EIBA 1NQBA 3DX4A 3EJUA 3BD5A 4GMTL 1DWJM 2PO6B 4ODVH 3S3PA 1TMQA 4UU9A 5HGAA 1R7OA 5FYLH 1E6SM 4KDTC 4U1JA 2YC1A 2UY3A 2DIAA 4UQBA 4MHHG 1FE8L 3HUJA 5L2KE 2O92A 1VJZA 4JG1L 4OLEA 4OGZA 3MRFA 4HGWB 3GMOA 4HH9B 4NQEA 2WZIA 1V08A 5GZND 3MRIA 2J6EH 1A3RL 2P5EB 4XXCC 3X13B 3NYDA 1MW0A 5JBEA 3EOYG 3KYOB 3TBSA 4NKMB 4FFVD 2P8PB 3BW9A 4ZXBA 1UADC 3F5KA 2Y25A 1BQHA 4N9GA 4IRJB 3LV3B 4OSUL 2WCAA 3W39A 2GT9B 4LAJH 3HFML 5GS0C 4HKBB 3HJEA 1KG0A 3T4YB 1WWCA 3SCWA 4CVUA 2NY5H 2YD4A 3TO2B 3IB4A 1ZE3C 1L0PA 2R2HA 1Y6KR 4DZ8A 3D39E 3ILQD 1UQSB 1A4JA 1QLFA 3VILA 1MFNA 4HBCL 1JWMA 3A6BL 4H8WL 4K94H 4XVTH 5C9JB 1DEEB 5FO8A 4DGYL 5A6SA 3F6IA 1BVLB 3WSQH 4YDKL 4B50A 4F8QA 1T1ZB 3RZCC 3D85A 4JCLA 3BPNC 3SDDD 1OGGA 3B9AA 2YMXH 5T5FL 4WKFA 5JW3H 4YHMH 3L3HA 1AR1D 3VIKA 4KFZC 2VDKL 4Z78B 1V6XA 2DQGL 3IU4L 4HFWA 4CD6A 1OAKL 5LXGH 2Y1VA 3GJFH 4LSRL 4Y4FD 3L7FA 1MJ8L 3ZTNL 1S7WA 3VFVA 2GYSA 4S1SH 1F4AA 4Q9QH 2V5DA 3PV6B 2XPKA 1MQKH 1A6WH 4GAYB 5IG7A 3V4PH 4KHTH 4OD3L 2H3NB 2XWDA 3KL3A 1QYGL 4NUGL 2A77H 5J6HB 4JPKH 1KTRL 4NNYB 4X0KB 2A2QT 4QYOA 1K5NA 3BCFA 2J8UE 2RHEA 2Q8XA 2BY2A 4HKXB 4YBQD 1SVCP 3PHSA 5DS8A 4QRRE 4XNZB 2DRUA 5BVPH 5JW4R 2DD8H 1OP3K 4NQED 5D2NC 2EO1A 2GFBB 4A2LA 4NWTL 2DLTA 3RL1B 2XJ7A 3FQXA 4BQCA 4YC2C 3O6FB 3NTCL 3SCMD 3VD5A 2PW2A 3EAKA 2BMKB 4G42B 4PV9A 1RUQL 1GQLA 4F3FA 4NO5B 4HPOH 3QUMA 1OAZH 3QBTB 4ZXBD 4OCRH 2GK0A 3V4UH 2F54E 2OTWB 3TNMB 3RDTA 3CFDA 3C09B 1KGCD 2AS5M 4KK5D 1D6VL 2ITCB 4XP5L 5FHAL 2ZWLT 1U8IB 2E9IA 1OOAA 5CFHA 3UBXI 1MEXH 3BKCH 1UASA 4IMLB 4PJHA 1JDDA 4XPHH 4XP1H 5D7LB 5HYFA 2CIPA 1G7IB 4FXKB 1C12B 5DO2D 3G6MA 1A6VH 2DS4A 2V9QA 1A0QH 4NHUB 2IFFH 2V6HA 4QXWA 1E4IA 4WUUE 4XBPA 1CGXA 2P47B 2R56L 2F7QA 4PUBL 5ERWB 4JPIA 1QVOA 4HT1H 5HYQA 3INUL 5EU6B 3S5LB 1DN0B 3VG0L 1CXKA 2D7OA 3HRZB 2JLLA 3RM9A 2P5WE 2IPKA 5I6XC 3RWFB 4RGND 2DJSA 1T21A 3BZFA 1QO3A 5FYKL 2MSPA 3VFUA 2Q6WB 2X70B 2BHZA 4TOYH 3U9PL 1J86A 1F3DH 1ORSA 4GLRH 1NPUA 5F7EL 4YHPB 5GZOD 3N1PC 3VXUB 3BHBB 3VM5A 1H0GA 3IJSA 2RR3A 1BZ9B 5M94B 6CGTA 3QNYB 1NGYA 2EDBA 2D20A 5HJ3B 4PMRA 4LIQL 2VRJA 4JQXC 2ERJC 2XIIA 5GGSY 3C60B 5A40E 2HJLB 1UR4A 4M1CC 3MV7A 4NFDA 4PJIB 2B31A 4UV4H 4GZEA 3ZYOA 3H9HB 4KRPC 5KEZA 4MZ3A 2J78A 1M71B 4XVTL 4TULL 1YEEL 4J28A 1INDH 4M8VA 5E7BA 3FZUD 1MRDH 4JY6A 1BWWA 1F4HA 3UBXG 2DSVA 4WKHA 2X9WA 1Q0XL 3L5HA 5TPWH 2LTQC 3CZNA 3CVHA 1QSFB 9CGTA 4AD3A 2QQLL 1Q38A 2HG5A 5IXEA 3NIGF 4ATWA 1ZLVH 3VI4E 2DQFA 4KXZH 5AD0B 5LXGL 3KHOA 4LLVA 1PYWA 4GIAA 3ALXA 4NRXB 3HRPA 4JM2F 3MPCA 3ZHDA 2FB4L 3U6RA 3VXQB 1G1CA 3A3HA 4XMLH 3BH8A 3F6LA 4JR9L 4GG8B 1DANU 1XR8B 4K7PX 4LSVH 5T1LB 5CCKL 1MQKL 4YE4H 1JDCA 5TFSH 2Q8BH 1FP8A 1FNHA 3B5GA 4KHTL 4L8DB 4N42A 1CL7L 4LOUC 4MADA 5J4MA 3D4ZA 4JPKL 1JZ2A 4BFIB 5EOQL 4HSQA 3IDUA 4P57B 4DWSA 4PRHD 4QRPB 4B7IA 3SDXF 4YEFA 2XZAH 3MOQA 5I74C 1NMCB 3BI9X 1S5HA 3UZEA 4AH2B 2X9YA 4YFEA 1RURL 1I9EA 4D6FA 1X7QA 3CUPB 2WUBL 2NX5D 4I0PA 2WQRA 4U1LB 5EU4B 1WITA 4JZJA 5C07D 3OKOA 3UYOD 4OUOA 1S9XB 4XZWA 1CGWA 5F1NB 1FH5L 3ZSTA 2QV2A 2XSBA 1GC1C 1AGBB 4QT5A 1S7UB 3UPAA 3OPZL 2PR4H 1FIGH 1QBLL 1G7HB 3BKCL 4JDVB 1JRHH 4KK8D 3WN6A 4A4AA 5F9OH 4Q58C 2VLJB 1ZWIA 4LP5A 2APBA 4XPHL 2DBLH 3GMPA 3LKPB 1V7ML 2HFFB 3O11A 2E27L 4XAKD 3VA2C 1E4JA 3MLZH 5I17A 4NCC1 2P46B 3SJVE 1KTLA 3V5DB 3MV7D 1GOWA 4RAHA 1HP5A 2AEPL 5MENB 2CUMA 4DN4H 3QPQC 4C58B 2W4XA 4M48L 4MNHA 5CMAB 4E42B 5DUPH 2VAJA 4G43B 1DVFA 4M93B 2YSSB 4NQCA 2D7TH 4ZFOL 2FBJL 2HN7B 4IM4A 3QOMA 3SCRA 3GIZH 1GGUA 4Z6AT 4C4KO 1XCTA 2ZOKB 3S97C 3F7YA 3QXAB 3RNKB 5I1KH 4P3DB 2BFGA 1A4KA 1Z9LA 2YBRB 1S5IL 3F7QA 3WDHA 1LF1A 5JPMB 3ARFC 2DF3A 4QRUB 3MLXH 4XMKH 1IGTB 5IF0B 2CO6B 4NQDE 3I6GB 2AJZA 1GOHA 5KSAA 1CVSC 2Z31B 1JZ5A 4NO2A 2H6PB 4S2SA 1FNEB 4UV4L 2YRPA 3GXDA 1YEHL 4WW2C 5E5UB 4DWSD 1INDL 2DWDB 4Y19A 4XZBA 1AKJB 1MHPH 3IDIA 3VXSB 4UAOC 3WIIH 4E5XA 3EJTA 4R0LC 4PBXA 1HQ4A 1M6OA 3S96A 2WIIA 3OAYK 1WAAF 4WY7H 2ADIA 4WU7A 2CLRA 4U7SA 4LKXB 4J7RA 1QG3A 3TA3D 4UIMA 1H8SA 5E8PB 2V7NA 5I30H 2EO9A 1CGTA 3SQBA 1T5WA 4B15A 2ICCA 1KIQA 4M7LT 1T20B 1I1WA 1E4KA 3CMJA 1LO2L 1ITCA 3GBDA 5HHME 2C7UB 1PG7H 3TZVA 2KPNA 1SJHA 3GM8A 1Q94B 3AS2A 3DETC 1T1WA 3QP3A 2J5LB 4JFQB 2N7BA 5FA4B 5GS1A 1I9JL 4W88A 5DD1L 5JXEC 3ULUE 3HPLB 5GISH 3BRGC 4C56B 2XZAL 3QUZB 1H3TA 1I8LC 4UQ2A 4E0RA 3BDYL 3RA7H 5DQDH 4MSWB 5JORB 3ZKXC 4HZ6A 4KJYB 1AXTL 1DVFD 3T1FB 3QPXL 3PJSA 4NQCD 3IF1B 5C0CB 5BZDA 3K4DA 3DX3A 3TVMC 2UV3A 5BV7L 4KJWC 4PG2A 1B0RB 4W8LA 4LYRA 1GRWA 1EH9A 3EHBD 4HJGB 4TUJA 5HHQB 3G08A 4EXKA 3CUHA 1S7TA 2ICWJ 4PTTA 1FIGL 1FPTH 3UO1L 5E8OB 2QPUA 2CBJA 4JDTL 5F9OL 4ORGA 3STBA 3K0WA 5TD4A 3QUYD 4A6YB 2IAND 2DBLL 4NCC2 3KLLA 5KS9E 1G0YR 1YEGH 3NBNA 5I1GH 2WC4A 5KSAD 3B83A 2XQYG 4PB0L 3VGDA 4PMDA 2EIDA 1V6YA 1R6VA 2PTVA 1CF8H 1RJYA 3MX0A 2BZDA 4N0CC 4F9PA 3L3KB 5HGHB 4DN4L 4X6CA 5HYJB 1DBML 4AK1A 5IFAH 5D7KD 5J1SC 3M1BB 4MJ5A 4JKKA 1QEWA 1GZJA 1NGQL 4OJFL 3W27A 4P4KA 4FQXA 2NLJA 1ZT7B 2E8YA 1IE5A 1YJDL 3RDKA 5IVXE 1P6WA 3BKMH 1E73M 4F58L 1MWAL 3P9WB 2YPKB 2DKSA 1KTDB 1V3LA 2XTJD 4R8WL 1RK0B 1J0JA 3ARGC 5I2UA 3IJHB 3QQ3B 4HUWA 1NP2A 4HEME 5FB8A 3G5VA 3PV7A 4QNPE 3UTOA 3FOMB 4HGMA 4XMKL 2YJQA 1FYTA 4U7KA 3TZVD 2XI9A 2AOSA 4ZFZA 1DHKA 3HI5H 1K2DB 3FB8B 1GSMA 3QISA 2ZICA 4O00A 3D3VE 1F11A 3TWCL 5MI0B 3GJEB 5C0AA 1QLRA 4OCXL 4KDWA 1LNUA 5C09A 4PLJC 1GQIA 3TBWB 2EIEA 2WV3A 1JUFB 2WSKA 3I6LE 5IB3A 1JWUB 2HKFL 3D25A 2CMRH 4ZSOA 5CG0A 4EXPX 1N6UA 5HHOA 1G7LA 1M53A 4CNIB 4Z7VE 3G9VA 4QGTA 1M04A 3VWKD 2MJWA 4L9DA 5E2UH 1C16B 2CQVA 5A69A 4R90H 2WLZA 3VFNA 2EDLA 4BELD 1HOCA 1GOQA 3RWGA 1IKNA 4X7FC 2X89A 1UG6A 4HK3N 4F7EA 2GDUA 5E6YA 4CN4A 1PG7W 3MLRH 2X1QA 5CJ5A 4M1DL 1VJSA 3D87B 3SDCC 5EN2A 4UQAA 4LLYB 1B30A 2CIIA 4B41A 1MRCH 5E94A 2NZ9D 3CK0L 4ALAL 1OW0C 2R4RL 3QSKB 4NYLB 3J7HA 3VXOA 4OZHF 5GISL 1UB6A 3ZDYF 5ABGA 3FQRB 3HG2A 2Z9TA 5D8JL 1XSJA 1CENA 4PPTA 1ZHBB 5IMLB 5DYOA 2P7TB 5DVKA 4MXWL 5L88L 5DQDL 5T1MA 3HTLX 1MCJA 3OSKA 1MVUA 3SDYH 3OGCB 4L29A 4P4KD 1IT9L 5DUML 2E3ZA 4FQXD 1SMOA 3ULUC 3W38A 4PCSA 4KVNH 1JNHB 4NJ9L 3TTOA 1NBZA 1HHGA 4NGHH 5BOPA 5ANMB 4W8AA 1UKTA 4MDIA 3CPLA 4UIKH 4PRPE 4UQCA 3PZVA 4QCIB 3VJ6B 3MYJA 1KENL 3APGA 5KJRL 3AYRA 3SDDB 3OHXA 1W1PA 2F53A 4MX7B 1I7TB 3RHWF 1HYSC 2XM1A 4GS7B 2B4CL 3DIFB 1FYTD 5HGBB 4DW2L 5HI5D 3DRTA 3BE1H 1IARB 1J8HE 4Y4FB 4LDOB 1LO5B 3VXRE 3BWAB 2V17H 5C0AD 2E6QA 3SUSA 4GAJH 3QEQA 4GKNA 4KTYA 2ZSVA 3DSFL 3OG4B 4H1LH 4ZDHA 5C09D 2A73A 1DEDA 1J1PL 3PZUA 3FHAA 4HAFA 4BA0A 4Z77A 4PRBA 1N64L 1SEQH 4JJHA 4O2FB 5FYLE 4DO4A 5T3XD 2AXHA 4BSJA 4M7LL 1F4XH 2KZ1B 3GSNH 4DJMA 2R9HD 4UU9B 4I2XA 5HGAB 1FG9C 5J1TC 4U1JB 1WIOA 5HHOD 2YC1B 5IFJA 1FFRA 1FRGH 1CFTA 5DD5L 3HUJB 3UTSE 2DQEH 4G80A 3EOAA 4LLMA 4D9LL 4W85A 3MRFB 4NQEB 3GMOB 3NUKA 5EZOH 1ERNA 2XUCA 4BUHA 3MRIB 1JFQH 4UILL 5FYKE 2BVUA 2PWHA 4XCCL 5D8ZA 3QCUH 1CU4L 4YFDB 1R5IA 2DTML 3P4MA 4GO6B 2F8XC 3F7PC 3TBSB 2AXFA 3NDZA 3GZAA 3UTPD 3BW9B 4ZXBB 5IQ7L 3F58H 5DR5H 1BQHB 1EEQA 4N9GB 4D6HA 5EU3A 2I25N 2NQCA 3W39B 2QLYA 1QFWM 1BMGA 2BERA 1KG0B 3LRSA 3S98A 4YAQB 2UY2A 1UR1A 3HE6C 4LIQE 4KHXH 5DMGC 1WGOA 4N1HB 1OSPH 4FOMA 3BDXA 3OX8A 5KSBE 3RVUD 2R2HB 4DZ8B 5D1ZA 1G6RH 4GG6E 1A4JB 3SKNA 1UWGH 1IT0A 5C0NC 2G41A 4M9PA 1JWMB 4UINH 5D96C 1LK3L 4N5EC 5CEXA 4IJ3C 3VU2A 2FHBA 3SCQA 2ZUWA 5FO8B 1GOGA 3FHQA 1N8ZA 3O2DL 3CZGA 4L4TA 3D85B 2WHMA 2O61A 4RGNB 2KZWA 4KGJA 4LPVA 1AJ7H 2B5IC 4J3SA 4OAWA 3L3HB 1B3WA 1NANI 4D1JA 1BWMA 4HFWB 1M05A 3ZJ6A 4F57L 3AI0A 1MRCL 3JUZA 3L7FB 1LE5A 3RNQA 3G5ZA 1S7WB 3VXMA 3VFVB 1Z0MA 3QEQD 4ODXA 1F3RB 4JZ5A 4S0TD 1VBRA 5IT2L 5IG7B 4J4PC 3MCLL 2ICES 3SDYL 1GORA 4Z2IA 4QYOB 1K5NB 3VH8A 2XN9E 4C59B 4LCYA 2Z8SA 2OR9H 2GITA 7FABL 5JHDD 3UTZA 4HPYH 5DS8B 3TJHC 4UIKL 3THDA 4R4FH 5GJSL 5SWSD 1ND0B 2OX5A 3FQXB 3DWTA 5LGHH 2PW2B 1HJQA 2JCCE 3WFHA 1QP1A 1D5BA 3OAZH 4PV9B 4F3FB 2Z8WC 3QUMB 1NEZA 2GK0B 3NGBC 3A4AA 3RDTB 3CFDB 3CZFA 3MZTA 4AD1A 4K3DL 2V17L 3MV8E 3CUGA 4PEEA 4PJFA 4OOZA 1JF5A 3HZKA 3WKNA 2NSXA 4PJHB 4Q9RL 3BVVA 1MY5A 2YRLA 1JTPA 4MA7H 1WDRA 1XCWA 1JNEA 3MBXH 2WC3A 1F4XL 1HHHA 5D1ZD 3SGDI 3ZT5A 3GSRA 1Q6GA 3H9SE 4XBPB 1E72M 1RFDL 1Q6CA 2IBZX 2UYLA 3WXWL 2Z8RA 3VWJA 2YHGA 2BRQA 3EGSA 2DQEL 1JF1A 4JPIB 1QVOB 1JYXA 1JPFA 3S9DB 2ZIDA 5EZOL 3ROOA 5HYQB 1T3FA 2H32H 2WINA 3WO4B 4I0CC 4U6TA 4L4TD 2IPKB 2KUTA 4JKLA 4MMXC 5D2NA 2AAAA 3IXAA 3BIKA 3BZFB 1KJMA 1QO3B 4QHUA 3VFUB 4XB3A 1ZOXA 1K9DA 1RIHL 1RUPH 1RVFH 3V95A 2AJYH 5DR5L 2AJ3B 3RUGE 3U30B 1ORSB 2HVJA 4I8DA 3FRPA 4BH8A 4WJ5A 1H3GA 5CHNA 5JIIA 1NCBH 2XYCA 4OZGE 1CGYA 2DWEA 3IJSB 4WHTA 4ZS7L 4Y89A 4D9RD 4PG9B 1JNDA 5B4MD 4AZ7A 1BAFL 1NGYB 4HCRL 5GGSA 3KPLA 3DX2A 1G6RL 4LCUA 1M7DA 2J8GA 3MV7B 2NY5C 4EVNA 1R3HA 4YX2L 1HSBA 5JUEL 1U2YA 3IK2A 2DT0A 3WDJA 3EFDL 1KJ3H 4I3SL 2YD5A 4JY6B 1TJGL 1OY3B 2VRAA 3AM8C 5DRNA 1NGXA 4HC1H 3CVHB 4K94C 5BRZE 1AJ7L 2G3NA 2ITDA 5BXFA 4CVZA 2DQFB 3LIZH 1N5YL 4PRIE 5KW9L 2QHAA 4LLVB 1PYWB 1YPZF 2VXTH 4CMHB 3U6RB 3W26A 1RMFL 4UNTA 3RL2A 3JVGC 3BH8B 1BEYL 4L9LA 1TVDA 2D3LA 3B9EA 1T0PB 1HVQA 7CGTA 43CAA 5FV1L 3BVNA 1IAII 4D0DA 3VI3F 4L3CA 4ZFFA 2H26A 2ZCKH 3Q0HA 3S35H 4DWSB 4AZ8A 3VWJD 5C71A 1E1FA 3OKDA 2Y07H 1S5HB 3MRCA 5D71L 3AMGA 3VSUA 1X7QB 1NEUA 4PGDA 8CGTA 4I1NB 1ESWA 1HJSA 1AI1L 4I0PB 4ONFL 5IK3A 4PJCF 4BZYA 5LGHL 2DLEA 4LFHD 1RUAL 4B9ZA 4H41A 1DWIM 4UBDD 4GI8A 4JZJB 3D39A 3OKOB 5AZ2L 4NJAL 1OARL 1CDJA 1QFWI 3KR3H 3DX0A 4AYSA 1EAJA 1NUNB 4QT5B 5GRJH 1X5LA 4XI5C 3ETBF 1L7TH 1HKLL 5SV4A 2HVKA 1ZWIB 4N8CL 4OUUA 3GMPB 1RPKA 2OXHA 2YA0A 3O11B 5FUZH 2UUDK 1UFUA 5I17B 1UVQB 4M56A 1EGZA 4PRAA 4FZ8H 4Q0XH 2YXMA 4D0BA 5HYIA 4X6DF 3WE6A 1KTLB 4WCYL 3TN0C 2AW2A 3QEHA 3P2TA 1V3HA 4X7SL 3BOVA 2BHYA 1UYWH 4NC1E 3CH1A 1QKZH 1OTSD 5GJTH 4MNHB 4FQJH 4YHKL 4U7MA 4HWBH 3UG5A 3IFLH 4MNLA 1DVFB 3P11H 2JJSA 1UR2A 4NQCB 4YWGH 2RCSH 1EHXA 1RVFL 4JO3H 1KIRA 2J8UA 4JL1A 1XCTB 3F7YB 1JGVH 3U7AA 4YJZL 3GBEA 4TNVK 5F89A 5MP6L 1A4KB 1AGDA 1WDPA 4AD0A 4OQTH 3NACH 1EDQA 3WQ8A 2AJZB 5KSAB 4GRLC 4YHGA 4RGOL 1KB5H 1E5NA 4Z2HA 4NO2B 4S2SB 1TQBC 1RZFH 4YXHL 1FZKA 3VFMA 5DGQA 3NABL 1OAUL 2D9CA 1FO0L 1U8KA 1NCWL 3BAIA 2R1YA 3AXLA 4M1CD 5ESAA 4Y19B 4KRPD 1I4FA 2P43B 1GOOA 1WKYA 3IDIB 4E5XB 1HQ4B 1M6OB 3S96B 1JN6A 2WIIB 2CGRL 3NSXA 1E0XA 4Z7OE 1G7PA 1C5BH 4E8CA 3CIQA 4JFFA 2X4RA 3D39D 3FJTA 4WU7B 5LWYH 2CLRB 4JHZA 1BHGA 1C8QA 2V7NB 4HWZA 3WQ5A 2W67A 1T5WB 2XTJB 3CMOL 5HY9A 4KH2A 1IILE 1KIQB 5D7IF 4RFNC 3GIVA 5FOBB 4PJ5A 3TZVB 3N17A 1SJHB 2MQ0A 3ARFA 2E7CA 3OJMB 2BVQA 3EDEA 2WYSA 2GVYA 5GS1B 2A3CA 3O3UN 2GEEA 2YD2A 3RX7A 5E2VH 5IB5A 1OPGL 1GGCL 5DI8A 4ODBD 2QHRH 5IBUG 4XNXH 3DO7A 1E55A 4W5ZA 1XF2A 4NZRH 4MB1A 1NBYA 4UQ2B 4E0RB 3BH9A 3DV6A 5J7CC 3HAEA 4LP4A 4P2CG 5IVZA 2M1KA 4QHKI 4LDEB 4FLQA 2EADA 4GAGH 1GZQA 2R29L 1J7VR 3BUYA 3K7UA 5EO9A 3QZWG 2GJXA 3PJSB 5AG9A 3QIBC 4TVPH 1E6OL 5BZDB 4MA1C 2HJFA 5EO1A 3VIFA 4BM7A 5DT1H 4EKXA 1PBGA 3NN8A 1BJ8A 1T89C 5HBBA 4TUJB 3G08B 3NCJL 5GRJL 4FFYL 1S7TB 3OGSA 2GSGA 3PP3H 3P30H 4QRRD 1ZLUH 4PTTB 1V3KA 1DLHA 4ORGB 1MCOH 3RU8L 4ZOEA 2R0ZH 4PJBA 3BT2L 4EANA 3CX2A 3UAJD 1RJYB 3FFCA 5GGTL 3GKWH 2OI9C 5DQJA 4CD7A 4IBLT 5DMIH 5F7KC 1CN4A 4X6CB 5D5MF 4JHAH 2LAGB 1QKZL 3IGAA 4HS8L 3FB5A 4AIXA 1NFKA 4MJ5B 4RAVA 4FQJL 3DVNA 1QEWB 4XMPL 3IFLL 3QPQD 1BQUA 1I8LA 3KDMA 4HIXH 2NLJB 4S1DC 3SQOL 4JFFD 5HVWA 4NC1C 2GJ6E 5IOPA 4WUUD 1KIUA 2QADC 3AMKA 3NPSC 1JK8A 1KLFA 1MAMH 4M5ZH 4X5WA 5GIRA 1HXMA 2CH8A 3SGKA 1WEJH 2EPKX 2X2HA 2C7FA 2VXSH 2FE0A 3WMCA 4HUWB 1TZGH 5FB8B 3G5VB 1B2WL 4B5EA 2DT3A 2YUXA 1FYTB 2WM0A 3AVEA 4Y7MA 2P5WD 4ZFZB 1WIUA 3ARFD 3VIPA 3DECA 3V9FA 2RBLA 1X5ZA 1F11B 3ZKMC 1U8LA 3L5JA 2V3DA 2JELH 5DWUL 1E40A 2DSUA 5C0AB 3HMWH 2HWZL 1NCDH 1QLRB 5ALCL 2HRPH 1LNUB 2XWJA 5C09B 3QRFM 1CGSH 3ULVD 5JBFA 4HBQA 1INEH 4L4VE 1HTYA 3NFSL 2CHOA 2J8HA 4OZIA 5IB3B 2C0HA 4V27A 4M6NL 3D25B 1FOBA 1K9TA 4CD8A 4IDJL 2WVSA 3B9KA 1QNZL 1ZTXH 1QW8A 5HHOB 1C5BL 1G7LB 4ONGL 5KSVA 2F7OA 1H49A 2XG5A 1A8JH 2FLBT 1JV5A 1IEAA 4IRSA 4ELKA 4G6MH 3VFNB 1Z9SA 2J79A 4LLQA 1F4YL 1HOCB 5F7MC 3RWGB 1J8KA 4GBXA 4M00A 2CR3A 2WUCH 1FH7A 3KPPA 3MV01 4F7EB 1MFDH 1EDGA 1QW9A 3ARQA 4NSBA 4EUPH 5I9QC 4FLRA 1UR8A 3ECQA 5CWSA 5I73B 5EN2B 2PWFA 7A3HA 4HWUA 2Y7QA 5F9JA 2CIIB 3N1FC 5E94B 4FNTA 4MDJA 1YA5A 3VGFA 3WL9A 3VXOB 2P8MA 5DJYA 2QHRL 1UB6B 2V5YA 3FFCD 5F8RC 3DETD 3HZYA 4KROC 2OZ4H 4WTXA 3AOFA 3HNVH 5DYOB 4Q6IA 2IBBA 4HH8A 4PJEA 2RQ8A 5T1MB 3SE8L 1MVUB 5DD3H 4L29B 5A2FA 1OTTC 3LKNA 5EIVA 2EZ0C 4LNVA 3DX7A 4HPGA 4TVPL 3ZDZE 4FLOA 5C0BA 1NBZB 1HHGB 5EIQA 4DVRL 4U1KA 4MDIB 4PLKC 4ZAKA 3S5YA 3CPLB 5I19H 1R5WA 2DLHA 3MYJB 1I7ZA 3TVMD 4Q9CA 1XZ0A 3MCKA 3OHXB 2B2XH 2F53B 3G6JF 2K3TA 3QQ4A 3HR5A 1MCOL 3A6CL 1JXKA 2YXFA 3DRTB 4HPHA 3MRLA 3WJJC 3Q1SL 4G8GA 1TDQA 3T3PE 3H3PL 4HUNB 4K7FA 3MJ6A 5JIHA 1FFPA 3QEQB 4GKNB 2ZSVB 4ZDHB 1YNTA 5DMIL 4LVOC 2A73B 4L3EE 4OLXL 2VX6A 5LCVH 5F96H 3Q5YA 4Z77B 4M3JA 3HNSL 4PRBB 4N0CD 5GSVA 4DGIH 5I79A 4NN7C 1WK0A 2OBGA 4KUCD 4PY7A 2A74A 1GOFA 3B9KD 3MRGA 4I2XB 1AO7A 4OLWL 1UB5A 5IWLA 4LLDA 5IFJB 3RIKA 2FJFA 1CFTB 4KKNA 4TRPH 4TTDD 3LS5H 1A7QH 4I3GA 4XTRC 2PWDA 4G80B 2IAMC 2GCYA 3EOAB 4LLMB 1OT2A 2BNQA 5IHUL 4IRSD 4M5ZL 4L3AA 3S36X 3LXCA 2WMKA 3LVEA 3HZMA 1U3HA 2VXSL 5E09A 3ARTA 2VDPH 3ARDC 4Z0BH 1XYZA 3UC0H 2NW0A 1R5IB 3BN9C 3P4MB 4WTZG 5EZIL 2AXFB 4CW1A 2J1KA 1BFSA 5DVLA 3ARGD 3QDME 4CU8A 2ZX9A 4KMTL 5EU3B 1BYDA 2DSZA 3C5ZC 2JEPA 3OJ2C 3I9GH 4HXBH 4MD0A 3LRSB 2CUIA 1NMBH 3N1GC 1XGRA 3DX1A 3TV3H 4NIKB 1E4WL 2VDLL 3CMGA 1CE6A 4MMZC 4UT7H 5I1JH 3GI9L 1VFBA 4XPAL 1KGWA 3OX8B 4PLJD 4DUWA 3T1WA 3NJ3A 1IGCL 2OL3A 2DICA 4JPVH 4U0QB 5D1ZB 3L4YA 3SKNB 3MRKA 4PBGA 4Y16C 4X0NA 4NQDD 3STZA 1RJLA 1A6ZA 1UZ1A 3GRWH 5CEXB 3BX7C 3QDGE 4HJ0D 1SMDA 3ZL4L 4ZAKD 2VDOL 3BUBA 1EJ6A 4J3UA 5CUSH 1N8ZB 5BZWA 4JREC 5I1HH 2XFXA 4BA8A 4H8HA 4L4TB 3D51A 4EQ2A 2O61B 1IC4L 2OJZH 2IBGA 4OAWB 3TNNA 1W72H 1B3ZA 3MO1A 1M05B 4LCCC 2BY3A 3CSGA 1N5AA 4Y5YA 2C5DC 4TVUA 4NZTL 5IVXA 1LE5B 4WWKA 3RNQB 3G5ZB 1BJ1J 3TT1H 4ODTH 3SDCD 3VXMB 1QNOA 1Z5LA 1RZJH 1E6NA 4M5YL 1T83A 4ODXB 3NSNA 3WNOA 2OZ4L 1KB3A 3KWXA 1L0YA 3DHJA 2VCAA 2APXA 5J13B 3ZIZA 3DV4A 1GQKA 4F33A 5DFVC 2DQCL 3KPTA 5L6YL 8FABA 1GHSA 1H9VA 2EDRA 1AO7D 3VH8B 4LCYB 4GKSA 4XWOC 2GITB 1WTLA 4X80H 5EIIA 1E15A 3UTZB 3ULUD 3CZJA 2BNQD 3IGUA 4HIEA 5ABFA 4RE3A 3I3EA 5E6IC 3LH2H 2XNAA 5T1DH 4X0VA 1ZLVK 1TCRB 3ZJ8A 3WFHB 4CL7A 1D5BB 1EEUA 4QXGL 5IR1A 3BO8B 1NEZB 4W68A 3MRHA 4P9ML 3CZFB 4Z7VA 1I3GL 3CFCH 3A67H 1PZUB 1M4KA 1MCKA 4C55A 3SE3C 3HMXL 3BPLC 4PJFB 3HZKB 4YO0A 1TA3A 2XA8H 3FRUA 1RIVH 3CU1A 4H26A 4OIFA 4MD4A 5D93B 2P44B 4XVJH 1HHHB 5IW3A 2OR7A 2AJSH 3GSRB 4J4PA 3RTQA 3CVIH 2CD0A 4U33A 1KCUL 2UYLB 1B31A 4LYPA 3VWJB 2BRRH 3U0WL 4TRPL 3EGSB 3BGFC 1GAFH 2KQNA 1JF1B 3G6DH 1JPFB 4GQRA 2C4FT 3RVXC 1US3A 3LKOA 2FHFA 3ROOB 1UD6A 4G8EA 4C83B 2WSPA 1T3FB 5F6HJ 3DTXA 4YHZL 2WINB 4PGEA 3MRBA 2OSWA 3KPRA 3ZE1F 4Z0BL 2BOBA 5D2NB 4G6KH 4PRNA 3NZ8A 3BIKB 4QHUB 1KJMB 1BFOA 2F58L 2VZVA 5HGDA 3SCUA 1CK0L 1YN6A 1EAPA 3QHZL 2HVJB 2J88H 4WWKD 3T4AA 1MFEL 1RD6A 4BH8B 4WJ5B 1RV6X 2CLVA 4PRPA 5CHNB 4M4PA 4FK9A 4Q9BA 1FCCA 3D9AH 2DWEB 4WHTB 4AZIA 4LSSL 4YK4C 4O4YL 4CCCA 5GGSB 3KPLB 4OB5H 1KXTA 3HI6H 5DMGD 3GFUA 4LCUB 4HLJA 1CLYL 3QXTA 1M7DB 4AM0A 4EVNB 3BXWA 1HSBB 1VGEH 1AXIB 2WMGA 3WIFA 3DARA 3UMTA 3QCTL 3LMYA 2F18A 3CPUA 2IQAA 4PS4H 5C0ND 3BRFA 1HWGB 1N7ML 4JFEE 4N5ED 1KTBA 1NCAH 5DRNB 1NGXB 4P5TC 3CX5K 2YRZA 1ZVHA 3I6LD 2ITDB 3CNKA 5BXFB 4CVZB 3H6JA 3N85H 4OZFG 3KS0J 1W8NA 1O7DC 5EFIA 4OLYH 4LHUD 1KEML 1MVYA 4D6DA 4JQIH 5F7YC 3ZDXE 2B0SH 3UTSA 1D5ZA 4ODTL 5C08E 5DK2A 2AKRA 2XGBA 4NN6B 3RL2B 1TNNA 2F8VA 4L9LB 1PX8A 1BYAA 1KYOJ 3VO0A 1CPUA 4O2EA 5GGUA 2IGFH 1YY9C 43CAB 2OLDA 3LMJH 2NY1C 3BVNB 2FGWL 4XCNA 1OAYH 3V2AR 1US2A 1OD7A 5AYQA 4D0DB 4L3CB 4QEGA 4ZFFB 2H26B 2Z35A 4J4PD 3RTQD 1JVKA 5JOFA 1J0YA 1LO0H 3LEYH 3X3FH 1U33A 4X80L 4BQ9A 1V6WA 2WC7A 4PJGF 5E00A 3AXIA 5EORH 1FQ9C 3OKDB 3MRCB 4KRPB 4TVDA 1BGXL 1AY1H 1DQLL 1UC6A 1DBKL 4UNUA 4PGDB 1MI5A 3LH2L 3CH9A 3TJHD 5D4QA 1KQZA 5IK3B 5T1DL 4H20H 5KSBA 5EOCH 2YK1L 1B0WA 5D1QC 3D39B 4X9BA 2DI9A 4GG6A 1AFVH 2O5XL 5JW4N 3CXHK 2OTUA 1XSIA 3CFCL 4TUOA 3VGAC 3NFNA 4X8JA 3AHZA 3HC4L 4LVNC 4P2RA 3GK8L 4ODSL 4PRPD 3VRLF 2UWEA 2ZKHL 3HG1E 2HVKB 4OUUB 2XA8L 1HHJA 4XNYL 4MNJA 3RX8A 3BCDA 3ECBA 4XVJL 4K7PH 4PRAB 1KN4H 4D0BB 2YFNA 3WE6B 1G5AA 3LPWA 1H3PL 1CIUA 3DUSA 3QEHB 1BIIA 1WT5A 1J8HD 4D2NA 1QSVA 2FATH 4UZUA 1CT8A 4LHQB 3CH1B 3WJLA 4FNPA 3ZO9A 4EEEA 1OINA 3U36A 4ENED 1EFXA 4K9EL 5FYLD 4NXKA 1Q1JH 2W0PA 4PLOB 1KCSL 1IC5L 1KIRB 2B1HH 3TJEH 2DQHL 4XCFH 1FVDA 4EOWH 2X09A 4CU7A 1NDGA 4YXLH 5F89B 3UTSD 1AGDB 2VH5H 3KNBA 3KJ4C 1MFVA 5FIPA 2NY2B 4OCSL 1KBGH 4M7ZC 5TE4L 4ZTOL 3HG3A 2I27N 1WBZA 5FYKD 1U8MA 2J25A 3WQ4A 3QDAA 2JCCA 2FD6L 3HLAA 2F5AH 3AGVA 1KGXA 3HI6L 3EOTH 1R34A 3MLTA 1CFQA 3VI4F 1FZKB 3VFMB 1BJMA 2V2WA 1LMKA 1F3JA 2M2DA 4D6JA 1U8KB 1BD2A 5LA1A 3LKRA 3FQUA 3LDBC 3A22A 2R1YB 3AXLB 2MPAL 2IH1A 3PL6C 5ESAB 4AENA 3E8UH 1I4FB 1UCBL 2DQIL 3IFNH 1E1EA 4HUXA 1JN6B 1FZJA 4ZO7A 2EYSA 1G7PB 5DEFA 4JFFB 1P5VA 2X4RB 4KU1A 2OSXA 1C8XA 4QF1A 1ZBVA 4ZUVA 3H9SA 3KYKH 1LHZA 4HWZB 3BYYA 3LN9A 5HY9B 3ZHLA 5DRZA 1NL0H 1NJ9B 1Q72H 3GIVB 4K07A 4DFHA 1U8HA 3L4WA 4ZFOA 4PJ5B 3S3JA 3ET9F 5J06A 1ACZA 5CINH 2ZCHH 2BVQB 3LMJL 3BUDA 2FSEA 3W37A 3WFEL 5KG9A 1EHAA 5BMFL 3BVTA 1R87A 1AE6L 4FQ1H 1JGLH 1UA6H 1UWIA 1QZ1A 3UJTH 4FHBD 5IB5B 4M9OA 2AV1A 1IJ9A 5DI8B 4B16A 3RUGA 1LO0L 3X3FL 2R39A 3DO7B 3L4XA 5LYRA 3CHFA 1XF2B 5H2BB 3DXAE 4W89A 4YHOH 1NBYB 4LVEA 5EORL 3BH9B 3DV6B 3HAEB 3PP4H 5IVZB 4TVPE 1WF5A 5DC0A 4POYA 1GZQB 5IJKA 3BUYB 3B5HA 5EO9B 3B2UD 2GJXB 3GI8H 1OCWH 2V7HA 2VE6A 4Z2LA 2HJFB 5EO1B 2FYYA 1N6VA 3L3JA 4F80A 2JB6A 4D71A 4EDWH 5F7WC 3NN8B 3L95A 4NP4H 1MIMH 5DLML 4N0UA 3VCLA 2GSGB 4CVWA 4NZJA 3TT3H 1DLHB 4C7GA 2A9ML 2WLYA 4DUXA 4YHLH 2FEEL 4XI5D 4GT7A 3ORJA 2JJWA 3LQMA 4K7PL 4PJBB 3RIAF 4PRIA 3FFCB 2ED8A 4M62H 1URLA 5DQJB 1BIHA 2B8OT 3GB7A 3MFFA 5DMYA 1BD2D 4LAQH 1TJIL 4Y5XC 3PGCA 3MV8D 3TN0D 3IGAB 3WF0A 1BBDL 3FB5B 2AQ2A 1QFOA 4RAVB 2BNJA 3AUVA 3DVNB 4DEPB 3KDMB 4XHJC 5IFHL 3VRJA 5E24E 2ZPKH 5IW1A 3CU7A 1CEOA 3GTNA 3RX5A 2ENSA 3QUXA 5IOPB 3H9SD 3KJ6H 3TJEL 1J1XH 4EOWL 3ARVA 1JK8B 4X5WB 3S5ZA 1PEWA 1G94A 5GIRB 2X0HA 4M6AA 1HXMB 1FGNL 4HQQH 3T2PA 4ERSL 1MQQA 1QPXA 1TQTA 4ODHH 5EZJA 2CJUH 1W9DM 1CE1L 3DRQA 4FXGA 4PTUA 5HD8C 3BAEL 4AZCA 4HIIA 1N4XL 3QUKA 3WH6A 3PZNA 1U8LB 2DM2A 4MQ7A 1JHLL 1EFQA 3LAFA 1XIWA 1LEIA 2XWJB 4F7TA 5DXWA 4GRLD 4QP0A 4F7MA 4EBQH 2QSVA 1EX0A 1YEDA 5K9JH 1KJ2H 1QD0A 4OZIB 4JFXB 1FAIL 3MNZA 2YUWA 5GRZA 2WMIA 3B9KB 1D5MA 1JZ4A 4CBPA 2A3EA 5KSVB 4MQXC 4RISH 1GPFA 2HTLC 1JV5B 3V0WH 1IEAB 4IRSB 4XH2A 4ELKB 4N8VA 4LLQB 5D2LF 4FQIH 4GBXB 1JNNH 2HKHH 1NL0L 4G6JH 1XHGA 3F62A 2Y5EA 3KPPB 2VLME 3AHVA 2AJVH 5LVEA 2I60H 3E6FA 4FQQA 4UT6H 2VL4A 4LYQA 2ZJSL 1S7VA 2QSQA 5CWSB 35C8L 5BRZD 5TE6H 1B4JL 2Y7QB 3NZHH 4LRNH 5F9JB 4TXEA 5H35A 5ISZE 3PDDA 4RMSA 3BISA 1MWAA 1NANH 4MDJB 1PGRB 2Q3ZA 1UA6L 5DRXA 5F6IC 4XV0A 1UM6L 4TSBL 3WL9B 4L5FL 2P8MB 3EYUL 5DJYB 4PRID 3D3AA 4NPYA 3H2WA 3HZYB 4NUJA 4DGVH 4TNVF 4UOQA 3DYOA 4PYSA 4JE4B 4BQBA 1N3NA 2Q8AL 3TBTA 4Q6IB 2XSAA 4PTMA 4PJEB 4RIRA 2YD3A 1QLEL 1GGBL 3QQNA 5I1AA 1DZBA 3HG4A 3LKNB 2ENYA 2QPSA 2CESA 3DX7B 5KS9F 5C0BB 2DQUH 4UNVA 1IEHA 4U1KB 5SV3A 3QRGL 5CD3A 3QUXD 1LP9B 4ZAKB 3MMWA 3DLQR 2BXYA 3QIBD 1R5WB 3UTTA 5C1MB 1QNRA 4L4PA 1N0XL 4P3CH 1I7ZB 4H88L 1GPOH 1XZ0B 2E8ZA 3MCKB 4OV5A 3IFOA 3GSWA 3QQ4B 1OLZA 5EA0L 3HR5B 1NFDA 3NIGE 5EOTA 1V3JA 1I3VA 4RRPA 1R3LA 2BSTA 3QG7H 3ARBC 5IJVA 2D2OA 2P45B 4J3WA 3KPQA 3MRLB 5FECA 4FNQA 4G8GB 2J4WL 4K7FB 1TQCC 4KTEH 1FFPB 4M62L 1OB1A 1XIWD 1DBBH 1KLGA 1YNTB 3LN4A 2X4OA 3T0VA 3MLYL 5I18H 3OXRA 4AZ5A 5GSVB 4PB9H 2V38A 2PI6A 4OFVA 1A3LH 3KLHC 1HINH 5E9DE 2I5YH 4PY7B 2A74B 4UOW1 3MRGB 2X05A 3PF2A 1AO7B 1UB5B 4LHUG 4LLDB 3SGDH 2FJFB 5A16A 4ZENA 2AJXH 4JFVA 3O4OB 1K9EA 3SDXE 1IGFH 2GCYB 1J1XL 2BNQB 4S1DD 2NY6C 3TOPA 3HZMB 4J2XA 1QI2A 1U3HB 3LKQA 4ODUA 3OAZK 4ZUTA 2CJUL 5F1OB 2IUZA 3OR7A 3CHEA 4CW1B 1HI6A 4KAQH 4AEIH 4ZEPA 4DCQA 5GGRA 5GRUL 4LSTL 3P3YA 2BFVL 4I13B 1EQCA 2VZ1A 3PGDA 4ZUSA 5I8KH 4MD0B 3V8OA 3AXXA 1YYLH 5I76A 4ZTPL 3CLFH 1CE6B 2EBNA 3ME0A 5K9JL 3V52H 4F66A 1DDHA 1VFBB 4YBHA 5HDRA 3OL2A 2OL3B 3MRKB 3OV6A 3BUQA 4KDVA 1GGTA 4U3CA 3VMOA 1LO4L 2L7UA 3STZB 5I0DA 1RJLB 3O2VH 2XXCB 4KQ4H 1A6ZB 4P4RA 1PKQE 1NSNH 1E5JA 4FNLH 4AXNA 3PNWA 3X12A 2JJTC 3QFDA 2BXZA 1FNSL 1XD1A 1BECA 5BZWB 1VACA 3UTTD 1W2VA 4KUZH 2XFXB 1B90A 4QWWC 4FQIL 1JNNL 4M7KL 3FQNA 2HKHL 5IESH 3QAZC 3X3GH 2W5FA 4NKQB 4QHKJ 2AJVL 3OG2A 2VLKA 2VDNL 3TNNB 5C0RL 3MO1B 1FORH 2Q20A 1SM3L 1JWSA 2C4XA 1N5AB 1S3KL 4Y5YB 2EDEA 1YYMH 4WWKB 2OWXA 3AZTA 2ADFH 1I1AB 4LLWA 2FO1A 1Z5LB 1ITBB 1DTUA 3C5ZA 1O6IA 3V6OE 5I1LA 3QB7C 5IMKA 3A23A 1ACYH 1P4IL 2D3VA 3MLVH 1UA3A 5HHNA 1FVEA 3DV4B 2X4NA 3MACH 4KROD 4F33B 4AC1X 4F8TA 1B3YA 3BLBA 2AGJL 3OA5A 3ARWA 3ZKQD 8FABB 2NY0B 2BNRE 4GKSB 2X2JA 1NGZA 5EIIB 5BJTA 3NVQA 2NZIA 1PSKL 5AAMA 5B38A 1A1NA 4KRLB 4NM4H 4HIEB 5D96B 5ABFB 4P3CL 3N9KA 4IJ3B 4WU5A 4ORZC 4L4VA 3G6AA 4PLKD 2VN7A 4P0DA 2XNAB 4MA3A 1TG7A 1YC7A 2J7BA 1UWEL 2G8ZA 1WAAE 2DDXA 1KQYA 3KPSA 5F9DC 5IR1B 4M8UA 4JFZH 1SY6L 4EN3C 2PNDA 3MRHB 1WV7T 4Z7VB 1ISYA 3EO1A 3O2DA 3W11C 1PQZA 4LCCA 5KVEH 3PXHA 5CEZH 3BUPA 4YDVA 1FP5A 1RHFA 4F37F 3QWQB 5F7DA 4LPTA 5KBNC 4PJ8C 4YO0B 3LD8C 4P59L 1ZAGA 1TA3B 1Y18A 1JF6A 3FRUB 4HG4K 1OD8A 5J12C 1CXEA 4PB9L 4K3GA 1NCTA 4MD4B 5C6TH 3VD9A 1A3LL 1TFVA 4FABH 1HINL 4AZBA 3E0GA 2NTSP 4JM2C 3RTQB 3W4RA 4MCYA 2Y8VA 1BVNP 4FTVE 1J10A 3LKOB 3BMVA 1WBYA 3JUGA 4JAMA 4AEEA 1W3LA 2DDQH 3C5JA 4G8EB 3DTXB 1N2RA 5CPSA 2AI0L 3EFFA 3ZE2F 3KPRB 2BOBB 4ISVA 4PRNB 3GGWA 3NZ8B 2NY3D 3IDMA 5HGDB 1BFOB 4JQVC 1XGYL 3UZQA 1QHOA 2EDOA 4HUVA 1YN6B 1EAPB 5D9MA 3BN9D 4WSKA 3KE0A 2GJ6D 3T4AB 2NXZC 1RZ7H 2CLVB 4PRPB 2F19H 5KZ6A 4XGZA 5IHBA 3C5ZD 1S7XA 1HIZA 1FNFA 4XP9L 1I75A 2ZSWA 4NO3A 2BY1A 3VMPA 1FL5A 1KXTB 2VXUH 4X4MA 3MJ9H 5ELIA 3CV5A 2XZZA 2X4UA 4AM0B 5IHRA 1EA9C 3PWPE 2VERN 4PGCA 3WIFB 4AD2A 1PG7X 2IQAB 6FABL 2EJ1A 1KULA 3U7WH 4L4VD 5IESL 3BYTA 5CJXA 2XTKA 3X3GL 2DI7A 2CRMA 4Z7UF 1WFOA 5DC4B 1QHZA 5EFIB 4X6EA 2DLGA 1EK3A 3UTSB 1D5ZB 2J7HA 5DK2B 2AKRB 4ZYKA 3CLEH 1CDIA 5A8PA 5I71B 2ICWA 3VGEA 3WNLA 4IS6A 2AXGA 4O2EB 5EO0A 5GGUB 2NXYB 4DAGL 1V3IA 4R27A 5DF0A 3MLVL 4KJPD 3E6HA 1YMME 4XCNB 3S37H 1MJ7L 1WCBA 1RZJC 4K2UL 4BQ2A 1YNKL 2Z35B 1KBKA 1IAIL 5CJQH 5JOFB 4Y1AA 2FJHA 3V6OC 2X1OA 3S34H 5E00B 5DFVD 5J11B 5AZEH 3F5LA 1H15A 1X44A 4HCRA 2FWOA 1MI5B 4X8XA 1KOAA 1FL6A 4J3VA 1E27B 5C7XL 1HXJA 1LEGA 5F93C 1T0NA 4WENB 2XZCL 2XG4A 4P5TA 4GG6B 2R0LH 1SFSA 3M6DA 4HD9A 3AS0A 4P5MA 3QIUC 1ROWA 4Y88A 1CDHA 2NT1A 2OTUB 5CZVH 2QSCH 5I15H 1ZK9A 4TUOB 2VTFA 3NFNB 4X8JB 3QDGA 2EH7H 4P2RB 1QFWL 5CEZL 1YC8A 2UWEB 2ZWZA 5D1XA 2ZUYA 2V3FA 1HHJB 2R0WL 4RZCA 3ECBB 3HE7C 4FABL 4O2CA 5GXBB 4ONOA 4KVCH 5JOEA 3NCYP 2YD6A 4Y7EA 2MCPL 2AK4E 2VT0A 4MNGA 3DUSB 4GW4A 1BIIB 4OZHE 1JDAA 4MNQA 1JHKL 5IB4A 5I2IA 2VXQL 1CT8B 1T66C 3MBEC 3THCA 1JRHI 2DDQL 1E43A 5I1IH 4L3ED 1J5OH 3U36B 4WO4C 1JD7A 4MDOA 4IPLA 1EFXB 1KF9B 1DJSA 3RY6A 2H1PH 2OK0H 1NC4A 4TUKL 2BVPA 3HC3L 4ZPVA 5D1QA 1FVDB 3D48R 3PP3K 1ZLUK 1NDGB 3FO1A 4MJ6B 3IU3A 5JQ6H 4TX6A 1XF5A 2XRAH 3KNBB 4JRXE 3MCG1 2OYPA 3MXVH 4HS6A 1G9MH 3DVGA 4G7VH 2JJVA 4JEGB 1WBZB 3VDHA 1U8MB 4LRIA 1F2XK 4LARL 2MKLC 3H3KA 2JCCB 3HLAB 4WKAA 1TVPA 2HT2C 3MJ9L 3KAAA 5TH2A 3MLTB 5GS2D 1CFQB 4PMOA 2V2WB 3X17A 3BKJL 3G6LA 1F3JB 1BD2B 3LKRB 3FT3A 3EKCA 3FQUB 2R2EA 4XP6L 2IH1B 4AENB 1X4XA 1L0QA 3ZO0A 5KAQG 5D6DA 4PMNA 4HUXB 1FZJB 1P4BL 2EYSB 5DEFB 2AV7A 1BGAA 4P5TD 4LSUL 4Q22A 3D1MC 4QF1B 1UENA 4ZUVB 3H9SB 3U5UA 2OMNA 1MAJA 2MMXA 1NOFA 1Q9KA 3ELAT 5E95B 4HHAA 2MCG1 2XWEA 3QDGD 3OZOA 1X5AA 1IBGH 5DRZB 5BCAA 5KAQF 4U0RB 1U8HB 4MVBC 5FAAA 4ZFOB 5D1XD 2KL6A 4WLCA 4X7CC 2FSEB 3S37L 5KG9B 1MW2A 1I7RA 4JRYA 1YY9D 5CJQL 2AV1B 2NY1D 3IDGA 3RUGB 3LPOA 4JGUA 4HGKC 3RWJA 4MNQD 3S34L 3W0WE 1IFHL 1RH9A 4X83A 5LG1A 4UV7H 4XP4L 1JI1A 3Q3GA 3C2AH 2C4FU 4HJJH 3RGVA 4JG0H 4AG4H 5JZ7D 1CZ8H 4TQEL 4QXUH 4ACPA 1W9PA 2YKLH 1K8IA 2FX7H 4RWYH 4O9HH 3UROR 2DBJA 4L8SC 3WKML 4TSCL 3MA9L 5IGXL 2V7HB 2R0KH 1FO0A 2VE6B 1NC4D 2FYYB 4WI5A 3L3JB 3OQ3B 1RP8A 2JB6B 3WN5C 5MEPA 2YR3A 3WHXA 5D1QD 3L95B 3FB7A 2QSCL 1AQDA 3T2QA 1P53A 4PBWD 1E3XA 2YPVL 3GNOA 4OLUL 3W81A 2X1WL 4N0UB 1VERA 3VCLB 3SUWA 3CFKA 4Y2OA 2VC9A 1TIUA 4QOKE 3T65B 3BAWA 4FQCL 2VMFA 4P46C 5DDHA 2OW7A 3BMWA 4ML4A 2D03L 4PRIB 3SO3C 5I0ZA 2ORBL 2CLZA 2E9LA 4Q7DA 4NQTA 3GB7B 3MFFB 4OLVH 2GTWA 3NCCB 4D6IA 3PGCB 4K3JL 1OAXH 3CXDH 5EU7E 2OMBA 1BP3B 1JPTH 1YEKH 3O6KL 1IGJA 2ARWA 1J5OL 1A47A 5AYUH 2EABA 1H0DA 3MRPA 1TITA 3T0EE 4L1HA 2GW5A 2Y6SC 3VRJB 1V7NL 5IW1B 1Q4NX 4HA4A 2BVYA 3QUXB 3DMMC 4ACZA 2YN5A 1GYAA 1JFXA 1UH3A 5ITBH 3FQWA 4W7VA 4JVPA 2Q76A 4K3EH 5FO7A 4WF7A 5EZJB 5HI3C 3DRQB 1D5IL 5EUKA 4PTUB 1FHDA 1IKFH 3R0NA 3VFWA 3C08H 4HIIB 5BV7B 2FGLA 1LVEA 3QUKB 3E2HC 3N13A 4YNYA 4MQ7B 1UEYA 2LQRA 4JRYD 5HYSA 1XIWB 1LEIB 1EOKA 4F7TB 3RQ3A 1NCCH 3BIAX 4AIOA 4DN3L 4F7MB 1P2CA 4POZC 3MLSL 1YEDB 2QTEA 1C7TA 5KVGL 1HDMA 3MNZB 4AJ0A 2DQJL 4HF5H 3A47A 2PWGA 2WMIB 1IGMH 1D5MB 3PL6D 5GS0L 2OCFD 2OQJA 3SCVA 5GGTA 4K7PY 2XVLA 4QFUA 1G1YA 1X5JA 4W7UA 2I07A 1KPUB 5JNYA 4ZE4A 3W9DA 4XH2B 1LLOA 1ZLSL 4N8VB 3S4SA 1CI5A 4JY5H 4OGYH 2ZUUA 5EFFA 1R3IH 4X6BA 2LU3A 4DKDC 2ZOLA 3E6FB 2OP4L 4FQQB 4XC1H 5D72H 1S7VB 3OZ9L 3L4VA 2DQTL 2GJZB 5JXAH 3VXTA 5H35B 4P48A 1DBJH 4NHCL 4OTXH 1DQML 1MWAB 3AAZA 5DZLA 2A3BA 5DRXB 2YL8A 1F6AA 4EJ1C 2XA3A 4NPYB 2J7LA 3NCBB 4NUJB 4QLRA 3QDJE 4GZJA 3U1SH 2EH8L 5I8CA 2WPGA 3WIJA 1M7IA 1CBVL 1N3NB 2E3VA 1T04B 3TBTB 4NZDA 4RIRB 4LSQH 4JG0L 5I1AB 1OD9A 3TEUA 2ZNWA 2EEAA 3D2UA 3O2WH 1BF8A 4TSAH 4EAMA 4X98A 5CD3B 3LXAA 4XWGH 1J9CT 2PF6A 3UTTB 5FO9A 3CD4A 5TE7H 2FRGP 2VO5A 1AD0A 5F7UA 1F2QA 3WIHL 1JHTA 3CFIC 4OV5B 3IFOB 2NMSA 3GSWB 2EE6A 1NFDB 5EOTB 3O3DA 1R3LB 2BSTB 2FLRT 5KVDH 1HSAA 3RWEA 5IJVB 4R4NC 1CCZA 3KPQB 1MCFA 5FECB 1XGUA 4YHIA 1YPZE 5D6CA 5K93A 3V5KA 2A6KA 1OB1B 4WFEE 1KLGB 1UACL 3LN4B 5ENWA 3TO4C 1FG2A 3LKSA 2ZCLH 4Z95H 2PTUA 4HXAL 4TNWF 3OXRB 1JPTL 5B8CC 4G9FA 3FRPG 2SEBA 4X9HA 3VI3E 1M7XA 4KZDH 2DAVA 5A16B 3VFGH 1YEJH 5HPCA 4XHJD 2VC2L 3C8HA 1G0XA 3FO0H 2VIRA 4ZQKA 5EU7C 4HA1A 2W63A 5ITBL 3WY3A 3O0RL 1W1TA 2YLAA 1HZHL 3LKQB 4ODUB 4ZUTB 3U4BL 3T0EC 3OR7B 2GFTA 4PJCE 1IKFL 4PY8I 1HI6B 3MGOA 3HZVA 2JIXA 4DCQB 5GGRB 1R5VA 2IC2A 4BZ2H 4U6XA 3PGDB 4LKCA 1LE9A 4ZUSB 5HD8D 1VADA 1U42A 5J56B 3ARBA 4FP8L 4A6YH 1NCCL 2ZE0A 5JR1L 4PJAE 5I76B 2VN4A 4ACYA 1DDHB 4DK6A 2DPEA 5CPTA 1JAKA 1U8QA 2HH0H 4YXKL 3ESUF 3JBG7 3D2UD 5E2WH 1ODZA 2ZUQC 3IT8D 4Y4KA 4P4RB 3ZYIA 5LQBH 5E0FA 3PNWB 1BFTA 1WAWA 1CLOL 3QFDB 1T03L 4ZXLA 2X1PA 1VACB 1KB9K 2VZSA 1SJVA 1QFHA 4HWNA 3FQNB 1L7IL 1JZ7A 3RBSA 1W9BM 5I75B 4OLZL 3T09A 2NY3B 2VLKB 4G5ZL 2KH2B 4XC1L 1J05A 1KCRL 5DURD 3S35X 3IDXH 1KXVA 1JWSB 5ICXA 2FZ3A 2CITA 1V5JA 1REIA 2D31A 3ZDZF 4O02H 4JKMA 5E5RB 4YDLB 3D6GA 3WFDL 4H1LG 4LLWB 3C6LA 1QA9A 3SCTA 3C5ZB 5I1LB 1B3VA 2Y36H 4Z7WF 2OWCA 1J0HA 5HHNB 1E3ZA 3FKUS 4LSQL 4G9FD 4LEXL 1FVEB 4F9JA 2X4NB 5E8DL 4WI9A 1MCNA 2FEDD 3O2WL 1HVXA 4JO2L 3ARSA 4E41E 4TSAL 4Z2GA 1NGZB 1NGPL 3K2UL 4QRSA 4Z8FH 5BJTB 5C0IA 1G6VK 4KZEH 3RIFF 5B38B 1A1NB 1AIFA 2XTLA 1MREL 1F6LL 3U5YA 4AW7A 4WU5B 4L4VB 1BOGA 4LXFA 3G6AB 5CKGA 1A14L 2JJTA 3CCHA 4JANB 4MA3B 2DLFL 1NAKL 3BVWA 1HKKA 4PRDA 1UZ6F 4TVPD 2XQYK 3KPSB 2LE9A 5D7JC 1TVNA 2JIXD 3IJYA 5CEZE 5EDXA 2VKXA 1SQ2N 3EO1B 3QEGH 3EJQA 1PQZB 2QQKL 4LCCB 4IDLA 5GGVH 4AEHH 4G7YH 3ARBD 1FDLH 4YDVB 1OVZA 5F7DB 5E2TH 1UEMA 1EVUA 2ZCLL 1Y18B 2K1MA 5F9WC 4YDIH 3EJZC 1SMAA 4QLLA 1FBIH 1BX2A 4JHWH 3V7MA 1B2YA 1UR9A 4QDMA 1KSRA 3VA6A 4KI5F 5ISZA 4KZDL 3M8OH 4UQDA 4MCYB 3GXNA 3KLHD 4LPWA 3VXNA 3WFCH 1MW3A 1V8HA 4JB9L 1WBYB 2IADA 4JAMB 2V5SA 3VIJA 3C5JB 1N2RB 1KT2B 2AABL 2XXMB 3ALWA 3EFFB 1I9IL 3BESR 1JCKA 1DCLA 4ISVB 2JALA 3GGWB 3TFKD 3IDMB 1KN2L 3SGEH 4OGXL 3VRIA 4LVHB 3QULA 4HUVB 2EDHA 5KVFH 4XRCA 4QAWA 2O9RA 1A9BA 5HHVL 5CEYA 3O4LE 4UFJA 3FN0H 4R97B 4X5LA 3U57A 1MQPA 4EN3A 5AWNH 4A6YL 4PJ9A 5E08H 3I6KA 3K1DA 4XGZB 3WEMA 1HL8A 1PFCA 1TQUA 1S7XB 2EE9A 4WGWB 2ZSWB 3BPLB 4RNRA 4NO3B 1ZS2A 1A7NL 4PJ8A 1FL5B 1WISA 4S10A 2J74A 3AREC 1TJHH 2X4UB 1AQKL 4K55A 5E2WL 3HMXA 1PDKA 1W0VA 4PGCB 5LQBL 4JM2A 1ORQA 1FL3A 4G6AD 3LS4H 3UBXA 3BSZL 5BO1H 3N04A 3PTQA 1B3JA 1QBAA 4PJXF 1GHFH 4FG6C 5E4IA 4Z18A 2XKSA 2HVMA 1BJ1H 2M8XA 4WGVB 4FFZH 2VZOA 4RGMC 2WKGA 1WIPA 2P5EE 3GBNH 1FGVL 2YD7A 4I5BA 3S36L 3N9GH 2J7CA 3T0BA 5EFDA 1F4WL 1XGPA 4X6EB 1NCUA 3LHPL 4KY1H 4S1QH 1KFWA 2A1WH 3GEWB 3SDXA 4ZYKB 3MA7A 4N0FA 3ZOAA 2ADGA 4UCFA 2ICWB 2HYMA 3ULVF 3FXYA 5FDWA 5MHSE 2CPCA 4IS6B 2AXGB 4OF0A 5EO0B 4WI8A 2DIEA 3PABA 1B6UA 3E6HB 1HQRA 1A6AB 2AK1H 1WCBB 2XACC 4CN6A 5E1AA 2PWEA 5ISZD 4Y1AB 3V6BR 2FJHB 5EU5A 3MXWH 4K3HA 1Z32X 1H15B 2RB8A 4R4BA 3DDFA 3VDBA 2FWOB 3QIWA 1EGJL 2JJUA 1FL6B 1LEGB 1T0MA 1T0NB 1JGDA 5B39A 3EMCA 1C3FA 3WLWD 4K71B 3HNTH 4P5MB 5FHBH 5J3HC 4U6VH 1XF3B 5IBLC 1A1OA 1T1YA 4XC3L 3QDGB 4PJBF 5F21B 4AEHL 4EN3D 1E4LA 3OZPA 3LB6D 5D1XB 3MMDA 1M1SA 5CJOH 4RE2A 3UJJH 4RZCB 4TPRH 4ATLA 2DB8A 2WMJA 2DKUA 4O2CB 4PJ8D 2HAZA 5IBTL 5GNZA 1MF2H 4P9HH 4JCMA 1MY7A 4NDMA 1MXGA 4MNGB 3FN9A 4GW4B 5L9DH 1EJOL 3PWLA 4MNQB 2VLRA 4X7TA 5I2IB 5IB4B 1PS3A 3HI1A 4NF7A 4MA8H 4JM2D 3BWUC 2Z93B 3B43A 4ZFGH 3I2CL 1OBAA 4HU0A 1EXUA 1OGSA 4CGTA 2QBWA 4YPGA 3O81A 1NC4B 4OCWH 5GGQH 2BVPB 4LASH 3RAJH 2O5ZH 4ZPVB 2H2SC 4RQQA 1XF4A 5D1QB 3R1GH 2Q1EA 3FO1B 3IU3B 1YEIH