1PJ9A

Bacillus circulans strain 251 loop mutant 183-195
Total Genus 237
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
237
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFNDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSSYEDGIYRNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclomaltodextrin glucanotransferase
publication title Improved thermostability of bacillus circulans cyclodextrin glycosyltransferase by the introduction of a salt bridge
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 237
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pj9A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pj9A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pj9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pj9A01
4JFWA 5I74C 2HG5A 2JB5L 3O8XC 4UTBH 3KPQA 2JELL 4HIIB 4TSBH 4HLZG 5FOBA 3AAZA 3D3VE 3L5XH 4F58L 5KSAD 5ADPL 1CFSB 2N4IA 2Z35A 1SY6L 4Q7DA 3BPCB 4H8WC 2AQ3A 1JGVL 1FO0A 5HJ3B 4JRXA 1MJJA 4NPYA 4KKCD 3V0AC 3KXFB 4PV8A 2PBOA 1G7MA 4HULB 4NKIL 1X5FA 3DV6A 5C0AB 1Y7VA 2DEPA 1TPXB 2A6JA 1IMHC 3RMEA 3MRJB 3U82B 1I1AB 4ACZB 2XWDA 1ZJAA 3L4TA 2GCYA 4KZEH 5GGVY 3WHXA 2Z93B 4YEEA 1HOCB 4NRYA 4NWTH 4G8IB 1PLGL 3PWNA 4JFUA 5ADOH 1PJ9A 2UY4A 2A3EA 2JIEA 4OF0A 4N5UA 4OFKA 3H53A 1YEIL 2HKFL 4HKJA 4LLQA 4ENEC 1FVCB 3EJYD 2W60B 4KHXL 2A3AA 3VXRA 1P9MC 3V6FA 4O02L 2JE8A 3LSOA 2VE6B 5F3HB 3QG6A 4FFVC 4QFUA 1R5VA 3LQAL 3UCRA 1Y18B 3ZM8A 3GI8H 2VURA 4K55A 4HS3A 1SJEB 1GC1H 5IFPA 3VWKC 3MCLL 4WI7A 2WZPD 2KL6A 1JYWA 1UR8A 2YK1L 4APQA 1ZLSH 4OF8A 4RFOL 1AJ7L 3MSGA 3QWQB 4YHOH 3TT3H 1YZZA 3T77B 3JWNC 2O5ZH 5GGUB 2ZUTA 1A6AB 4M7LL 5A16B 4HUMB 3IRPX 4P4KA 2X0YA 5DEGB 1E28B 4YGVA 2PR4H 1A14H 3IXAB 1NBZB 3TZVD 3RUGA 4ZAKC 3QO0A 1FCGA 1T7WA 4RNRB 3INUL 3QUZB 4NM4L 1E4MM 3DUHA 4LCUB 3SKOA 1TR1A 2G75A 3H9YA 3JWDH 3LS4L 4WU5A 3SO5A 1P4BH 4QRPE 1KB5L 4HGWB 4XNUH 1A7OL 5KZCB 4M5ZH 1RUPL 4JZOB 4P48A 1AO7B 3HUJA 3KPRB 1UZ8A 4S1RH 4HXBH 3SCOA 2A0LD 1AE6L 2WQRA 2NX5A 1I8MA 3MRGA 1SEBB 2CXGA 1S3KH 4JM2C 2GIYA 3EYFB 3IGAA 3BP5B 4I2XB 3TO2A 2NMSA 1E6SM 4W6XB 4QOKA 2CHOA 1YMHB 1JDDA 1WITA 4PRPA 2VDLH 1MFUA 3QIWB 3S36H 1U33A 1IGCH 3VGFA 2BK8A 5T3ZD 4Z7UA 1GJUA 3GMRB 5ENWB 1OHQA 1XF1A 1A7NL 4ZNEE 3ZSTA 5I1EL 2G60H 1AHWB 2PB1A 2B2XH 3OXSB 3W11D 1MVYA 4D8PB 1WWBX 1E3XA 1KG0B 1J11A 3LEVL 4KJQC 3VXPB 4JFVA 3PZ9A 4EE9A 2VH5H 2PYFA 2IANB 1Y0LA 3C60B 7TAAA 5D2NE 3G6JB 3QG7H 4MQXD 2IADB 2FGZA 1ETZA 3HNSH 1KCSL 2BHYA 1RUQH 1DE4B 2YPLB 3MLUH 4X4YB 4O2FB 3TO4B 2G3NA 2QADC 4G80B 3UZEA 3GSNL 2J4WL 2V3DA 3RU8H 3QIUB 3TBTA 3P3YA 3A67L 3GO1H 3RM9A 1MW3A 2E9WA 4XCCL 1IGJA 1EVUA 4JN1L 4LAQH 4Y2DD 4IMLB 5BV7B 3KNBA 2OYMA 2W92A 2UYLA 4Y16A 1BFVH 4UZGA 3RY5A 3BAXA 4PRHE 1ZLWK 2X4TB 1EAPB 4MWFB 2CHNA 3BGMA 3KYNB 3W0WD 4PTUB 1W9DM 1Q0YL 4U3CA 5CIPH 4PMXA 3N15A 3ZKXC 1TMQA 3NH7H 1WE5A 1YMMA 2EJ1A 4XHJD 2DL9A 2VRJA 3Q1SH 4AZCA 1W0WB 5IFJB 1RMFL 3HRZA 2GJ6E 1KIPB 4FQ2L 4LDEB 1K9DA 1T3FB 3OJDB 5IM7B 4JDZB 4X9HA 4I48B 4WU7A 5IP4A 4XXDA 1BBDL 1XGQA 2IPKB 4G8EA 2K3TA 5HHOA 3DROB 3WQ4A 3SDAC 4R7NB 1S78C 1XEDA 4XHQA 3WFDL 4YPGB 2BV9A 2BSSB 2WMIA 1MHPH 3WNNA 1NLBL 3JSSA 2OX5A 3WDHA 1HYRC 3MJ9H 4PJ8D 4PJ7E 1A6TB 1BAFH 3GSRA 2JKXA 4JY6B 3V8OA 3U36B 4PJGB 1KFAL 4BH8A 2PW2B 3F58H 2JF6A 1BMGA 3BPNB 1NAKL 4OM1H 4OLZL 4YDVB 1XH3B 1DR9A 4JFOA 5BS0B 2NY7L 6A3HA 1B2YA 3QQ4A 3IFPA 4XPTH 5C08D 5FO9B 4PRNB 3VFOA 5IB2B 2OTPA 4NZFA 2EH7H 2VZSA 4LRNH 2QHAA 1WWWX 1X5HA 1CICD 2ALWA 2IQ9H 4GQQA 1FZJB 1OW0C 3ARPA 4NC1C 4QCIB 5JOEA 1E27B 4YHLH 1VACA 3B6SA 5HGBA 3I50L 1VBRA 1HF6A 4X5XA 3DVGB 3V95A 3NDZA 1JGUL 5JZ7C 4KI5D 2WP3T 3SBWC 1A21A 1CLOL 1S7QA 2W9EH 3SDXA 1T1XA 4HS6B 4LYRA 5SWZB 1CDCA 5DMGD 4PEEA 1E0WA 1WV7T 3B8SA 3LKPB 2J47A 4Y4KD 2FD6L 2ZCHL 4JQIH 1D9KA 4AC1X 4PY8J 1OOAA 3REVA 2HVMA 4KRTA 1E6NA 1FBIL 2FHFA 1MRFL 4PJGF 2DRUA 2XPKA 1UKTA 1CQKA 2H32A 5F1KC 3IDXH 3SGJA 4C56E 2IFFL 3IETA 3L9RB 5KG9B 2G3MA 1IAIH 4YO0B 2WNGA 1UHVA 4EJ1C 4NQCE 4YXHH 2AGJL 4JPVH 4E9LA 4HKBB 2XKNA 2J88L 3MGTB 3BGAA 3RIKA 2I07A 4JVWA 3ALXA 3VXUB 5EU7C 3KPOB 1G7HB 1HKLL 2BNQB 3CC5B 2VABB 1OT2A 1WAAA 3MLZL 3OKDA 4N9GA 2E4TA 3CZJA 4JFFB 5C0EA 1J05A 3BH8B 4AEHL 3QXAA 4DGIH 3SCUA 3PHQA 4F37F 5BVJA 3HC0B 3HC4H 3QXUA 2X1QA 5I78A 3CSYA 1IC5H 2GI7A 5DTFA 2NXZC 2ZUQB 1RZIA 3ALWA 4PJEA 3FB6A 4MNJA 2BVYA 5EBMA 1KJ2H 3F65A 3WJJA 1G7QB 4LKXB 1GGIH 4P2OB 3AXIA 5ICXA 4OOZA 2EEBA 1BZ7A 1KXQE 1VENA 1QLEL 2PXYA 5KVGH 5CQ1A 3C08H 4G8FA 1FYTE 1QO3A 3S35X 3CZLA 3MNZB 4GLRH 5BRZD 5JHDA 2YWZA 1JNHA 1FFRA 5IMKB 1INQA 4GI9A 3O3EA 1BVZA 1WFOA 1MNUH 1UADC 5CBEA 3WS6A 4Q9BA 2EIZA 3D18A 4DQOH 1GJWA 2GJZB 3F5WB 5T3ZH 2HN7B 1NAMH 1HL8A 2XTJB 4QT5B 2ADJB 3MV9B 1X5AA 5C6TL 2CGRL 1JF1A 3FO9B 3CCHA 5DJZA 4LNVA 5BXSA 1N7ML 2DQUL 4H88L 4M9OA 2UVEA 3WJLC 3CFCL 3MNWB 1KPRA 3RIAK 2XWJA 1YQVH 4PMQA 1XCQA 4ODHH 4Y5VA 1AP2B 3RY6A 3HR5A 1CBVH 4ODUB 3PWJA 5F96L 5I1HL 1RJYA 1B0RA 3SDYH 1EQCA 5H8DA 2EYTA 2AEPL 3UTPD 4GO9A 3WFEH 2E7LA 1DEEB 4U1IB 4R2GD 2F5BL 4GSDH 3UP1A 1B3YA 5GRZA 5ESVB 3GUTA 1RUAH 1AQHA 3NZ8B 4RWYH 2XM1A 4HPYH 1N5AA 3C8KB 1QR1A 1LO3L 3FN9A 1F6AA 5BXTA 2F15A 5ISZB 4QEGA 4LSUH 1QNZL 3DOSA 1RV6X 4NNPL 3WEXA 4P8VA 4YHNA 4CVXA 4M62H 2ED8A 5J4MA 4UFHA 2E5EA 4L3CB 4FQ1L 4X0NA 4Z7NF 3U46B 4HWZA 4AIZA 3RGHA 1VA9A 4JY4B 4O58L 5GNYA 4G6FD 1HEZA 4GW4A 3VFWA 2NY0C 1ZVSA 5JW3L 1CDIA 5JXAH 1BWMA 2PCPB 2JJTC 5A2BA 3RHWK 2IUZA 4ERSH 1JFHA 2R15A 5BV7L 5CP3H 2DYPA 1RD6A 1JYXA 4JO3L 3OLGA 4G42B 4K8RH 1JV5B 2VXQH 1WCBB 3LPPA 3RL2A 3VXUE 1WPCA 1FNSH 3VTRA 5E4EC 2IQAA 2A6DA 1S9WB 3C6LC 1UVQB 4L4VA 1LWJA 2C3VB 2VLMD 5E7BA 4HU8A 4Q7NA 5DEFA 3LXBA 5TQ0L 1XCXA 3HKFA 3TVMB 3V7MA 3A6OA 6CGTA 4PJIE 3WY3A 4K3JL 4UQ2B 1X4ZA 1KFWA 4WKFA 4IHOB 1OP9A 3OKYA 5FL1A 5I77A 1FC1A 4CCCA 5DJDA 7FABH 5AC4A 3QB7C 3VXRD 2DSZA 3KYMB 2FIRT 2H41A 2CJUH 4U1JB 1M71A 1HWGB 1PZ5B 2F54E 4W81A 4DO4A 2ZOKB 3O2VH 5CKGA 1QEWB 4NO2A 5CIPB 5B39B 2D7PA 1E6RA 1TPXC 5DZNA 4TUOB 2D03L 1UD6A 3GSWB 4DVRL 2GK1A 5D2NC 4QHKI 1I1AC 2FO4B 4NDMB 4BZ2L 4HU0A 4APQD 3PHSA 1LK2B 4OUUA 1V7ML 2BRRH 1IFHH 3AFLA 1KTKE 3BUYB 4QLKA 4BFGA 3L4WA 4DEPB 1JHTB 1I7ZA 4Z7NE 2RGMA 1RHHB 5E2TL 5DRWB 4JFDE 1H3PL 4ONOA 4QGTA 2ZWLT 2QR0A 4R7DB 3GMLB 4TVDA 1A7RH 1L0QA 3HCVB 3QA3A 1NGYB 1HHJB 1U3HA 3OKLA 4P4KD 2NT0A 3SDCA 5GRUL 3ZJKA 2YD3A 4RISH 1B6DA 2GQHA 3SKUD 1FNFA 1GVYA 3N17A 4LYQA 4KQ4L 1UXWB 2Y5TB 2BNRE 3HE7A 5EO9A 1MHEB 3DUSB 3H42L 2A77H 2F74A 4QWWC 5D1ZA 1FZMB 4ESKA 5I30H 1GOOA 3RDTB 4PPTA 5AD0A 1NC4B 1JZ5A 4W86A 1AY1L 3BQUC 4HPGA 5E1AB 1NQBA 2NX5D 3KYKH 3P4LA 2OW6A 5FB8B 4OF6A 5C6WH 2XICA 4K7PY 2VXTL 1LLOA 5B3JE 5ECJE 4LFHG 4PP2A 4XB3A 4LXFA 3IF1A 1CXFA 1PS3A 4OBRA 3F4VA 4QOKD 4PP1C 5C0DB 2WC7A 4KZEL 3LRHA 4PRPD 1WDQA 3KLDA 4P3DB 1P4IH 4NWTL 5FV1L 1N6VA 4Y19B 4ZOEA 3NA4A 3CXDH 2P5EB 3PTKA 1ZEAH 5ADOL 4P49A 4M7KH 3QUZC 1NJ9B 2H9GB 4ETQA 4MJ6A 4YHKH 1T1ZB 1E15A 3ULVH 2G4FA 2NQCA 2Q8XA 3I75A 2HTLC 4CVWA 2R69H 2W0FB 1KJVB 5IHRA 1M03A 4QKXB 1T21A 2AMGA 4QF1B 4QXUL 3IVKA 1NDMA 1DZBA 2EACA 1YPZB 1T0NA 2OZ4H 3KWWB 3L95B 5C0RH 1QHOA 3MRHA 3MBXL 2R0WL 4DN4L 3NJ3A 1IAOA 1IEAB 1T89C 3D0VA 4M8QA 1AGDA 3Q3GB 2DSUA 1PGRB 3ALFA 2EYRA 1R8LA 3CK0H 3WSQL 2EDTA 3IDGA 1N3NB 4K07A 4RAHA 5ERWA 1PG7L 2D31A 2NLJA 3QIWC 4YHOL 1Z9SA 5EB8A 3FFCB 1EXPA 3GBMH 1CU4H 3A24A 4WKAA 4GKSB 2E3ZA 5MP6H 2V2XA 2APXA 4XBEH 4NT6B 1D5ZB 1KJ2B 4I77L 4YBHA 1V6YA 1AHWC 4UDUA 5IVXA 4U1HA 5A8PA 1FL5B 2PR4L 3GZKA 4XRCA 3RIFK 2OWCA 5BZWA 3VI3E 3QOKA 1XF3A 1FG2B 1YMMD 3WKZA 3JV0A 3C60C 4KI1A 4ZPTB 3O2LA 1MFAL 1JI2A 3QO1A 1VHPA 3JWDL 3RTQA 1KIRB 3RAJH 1YPZF 8A3HA 4QRTA 3BO8A 4ZSOE 4W7UA 4U31A 4PRWA 3HMXL 1DBBL 3TO4C 4R0LA 1TDQA 2ICES 5HOSA 4M5ZL 1NAMB 5J6HB 1BQHA 1FO0H 1D7FA 1KC5H 2QQNL 3GSUA 3FO1B 3B43A 4QXTB 1QNPA 4XPGL 4FP8H 1S7VA 3HAEA 5GRVL 3VRIA 1XT5A 4P2QB 1UB6A 1T20B 2H3NB 4P5MB 1XF2A 2YFOA 4MPKA 4FQHA 3HZMA 5FYLH 1OGAE 3TN0A 5AAWA 3IJSA 1JTOA 2VDLL 3I6GA 1R3JA 5GQBA 4Y1AA 3S36L 2F2HA 1IGCL 4EDWL 5HYJA 3VA2C 1L7TH 2VZUA 1IILE 2IALB 4XV0A 1OTTD 1BM3H 4LSPL 3P4NA 2J7EA 5ANMA 2G60L 2C9AA 5IW1A 4NRZA 1Q9OA 3RVXC 3S96B 1YEKL 3RVWD 5IV2B 1YNTB 3A22A 2X4RB 3VWJB 4Z95L 4JREB 1QPXA 4HWBH 1MI5B 3HI1B 3M45A 4M93B 4M7ZC 5CLTA 1NCWH 5C0JA 3DTXB 3QG7L 1SYSA 3KPNA 5JUEH 4OFVA 3PZNA 2OSLA 4KXZH 5DK2A 4LLVA 2FCBA 2J6EL 4DZ8B 3W0WB 5FAAA 5LG1A 1SEQL 3RWJB 2VQ1A 4JM4H 4KROD 3S5LA 5H35B 3GO1L 1D9KD 4UIMA 5JXEC 5MENA 2VISB 1X5JA 1UA7A 4NFDA 2D0GA 1W3JA 5GGSA 4F7PA 2X10A 5F9OH 4M61B 4L1DA 4PJAB 4Q97A 2VB5A 3SO3C 1LP9B 1X3DA 3BH9A 1UR9A 1CZ8H 3RKPA 4XNXH 4WWKC 4S0TD 5D6DC 3UJIH 1UWSA 1IGFH 4WTZG 1UCBL 3FT2B 4U7KA 1OTSD 4LCCA 5D71L 1BYBA 1OP3H 3Q1SL 4M6OH 4I3SH 2MPAH 3U0WH 2X7LA 4X6BB 3VXMA 3WDJA 1DVFC 5B22A 3NBNA 5J3HD 3SPVA 1LWRA 3ZZ1A 3KJ4C 4LQFH 1MSPA 2VLLA 2QMJA 5KAQG 1NCBH 5C08B 3GB7B 5E8DH 1BYAA 2DI7A 2VDPL 4FFWD 2Q76B 3QQ9C 1F3DJ 1CICB 3QULB 2PXYD 4FQXA 2JCCE 1ODAA 1BAFL 4PJAF 5JHDD 3QDGA 5TE4L 1A1NA 3F58L 3PABB 5A3ID 4HUVA 4N0RA 4NQEA 4WDIA 4OM1L 1K3IA 3BSZH 1ISXA 1GQIA 2NZIA 4TUFA 4WTWA 5T3ZE 1A6VL 3QUYC 4Z2KA 1IZJA 1WTLA 5IMLA 4Y4KB 5E9AA 5DDHB 2EH7L 1BHGA 3QR2A 4W68A 1MAML 1IEHA 4PJFA 1ORQA 4YDJA 2IQ9L 5A8QA 3RWGB 1ES0B 2IG2H 3JXAA 4I18A 2CNCA 2ZUQC 1T4KB 3W9DA 3AHZA 1HYSD 1QX1A 1V0KA 3OPZH 5HXMA 2P24B 3QNYB 4P2OC 3TNMB 5IWLC 1T22A 4F9LC 4C54A 3QWOA 4PJ9B 3ZTJG 4OIIH 5E0CA 3DX7A 3B9EA 1UWGH 4GG8B 2NY6D 4H26A 1BD2A 1GC1C 3MMEA 2VITB 4BQ8A 3DYMA 1ZHLA 4BFEA 2ZXDA 1FE8H 4KZDH 4KKLC 4D2NA 1IAIL 3QAZB 5GJTL 5E2WH 4KDTC 1T6WA 1NMBL 1W8OA 4Q0XL 4QRQA 3DX2A 2XTJC 5EFFA 4FQIH 1MREH 2ADFL 1KXVC 4WO4C 1GOQA 3RVVD 1HHKA 4NO3B 1CGVA 3FFDB 1UACL 1BEYH 2FJFB 3QEQA 3ZJ6A 2AK1H 2X4QB 5IBTL 3QDJB 4UOQA 4WI8A 1OWRM 1A6WL 3TA3B 4Y0GA 4DGIL 1CGWA 1MCNA 5I2IA 5DZLA 4PJXE 5LGHH 3QNXB 1F97A 2R23B 4QXGH 3HC4L 2DYPD 1IC5L 3JWDC 4ODVL 5E2JA 2R1XB 5JDJA 4PREB 4YN5A 1ZS8A 3EDJA 5AUMB 1KJ2L 4F9JA 1GGIL 1YEEH 5FHAH 3F7VA 2HYMA 4PJDE 4P8WA 1UD4A 4IS6B 3C08L 3GBLA 3SE8H 2NR6C 4L4VD 43CAB 1ESWA 1N0LA 5F9WB 2W07A 1WBYA 1T6VN 1MNUL 1X7QB 4GRMA 3ILPA 3JWOH 1B0IA 4TX8A 1R3LA 4R4ND 1RURH 3UDWC 3K4DA 4DQOL 6FABH 1WC7A 2B0SH 1ND0B 3KR3H 3MRRA 3O2DL 4LGSB 5FYJL 1NAML 3VFUB 2OM5A 1ZLVH 1QQDB 3G9AB 4R2GB 4XNQB 5C08E 4V28A 1P1ZB 4GI8A 1W9VA 5C9KA 2Q3AA 3BH4A 1D5XA 3FB8B 1A5FL 1J0KA 3ULVF 1YQVL 3MV8A 4ODHL 4N5EC 5IB3A 1SQ2N 3ARZA 3QXWA 2XZAH 5I18H 2BNUA 4HPOL 4PTTA 4DK3A 1KTDA 4QHLB 1CBVL 3P0YL 4KI5E 2J62A 3JV6A 5F88A 4EI5A 2HFGH 5C0BA 3WFEL 1HT6A 4JFQA 4G6FB 1U92A 3LB6D 4Q6IA 5L0QB 1BFOB 4BFIA 3TVMC 4MNHA 4LSUL 5D7LA 1KOAA 4JRXB 3LH2H 2WM0A 4JFPA 2H32H 1U3HD 5HI3C 3P4MB 4M62L 4NPYB 3SDCD 3THML 1G7MB 2X2IA 3DV6B 1CL7I 2LVEA 1OTUC 3O9WA 4J28A 3T0EA 5LQBH 3V5DB 3HE7D 2A6JB 2Z8SA 4AMXA 4MNGE 5D1ZD 1Q94A 4QRRA 2GCYB 3EFFA 1G6RH 4XNMA 3VE0B 1QI0A 1LL6A 2WHMA 4IDJH 4PSRA 1H5VA 5JW5B 4K8RL 1FL6A 2XIBA 3RQ3A 3O3DB 3OKNA 3VGEA 2UY2A 5KSAC 1H5BA 4GRLA 4DEPC 1FNSL 4LLQB 4F57L 1MIEH 4XBGA 3RWFA 5C07E 4NM8L 4ELMA 4PMOA 1CFVL 3ZTNH 2C7UA 3D52A 3VX1A 1BZ9A 3JUYA 3EBAA 4LSVH 4LIQE 1LDSA 3PTMA 4AWEA 1TQCB 3GXNA 4Z78B 5F44A 3WL9A 3CUIA 2FH8A 4NQTA 5BRZE 5I6XB 3BZEA 4ZE5A 3B9KA 1KCKA 2P8PB 4RMTA 4DGYL 2AEQH 3RNQA 1MFCL 4DW2H 1CDGA 1AMYA 4YHEA 4LLUA 1CFBA 4CCEA 3CPLA 3PP4H 4UIKL 1FH8A 3RDTC 4TULH 4EIZC 7FABL 1KGXA 4DVBA 2CJUL 2CPCA 1SBSH 5LA0A 1YNLH 5DA4A 2VDOH 5T33H 3A47A 1MUJA 1G94A 3DV4B 2VKWA 3MRFA 4WGVB 1JPTL 2D7MA 2R1WB 5B8CC 3AIUA 4YGVB 3KPSA 5IG7B 3UXFA 5DC9B 1A6PA 5CILL 3EJYC 4FLOA 3QO0B 2E9LA 4GRWE 3FXYA 2BRRL 1IFHL 3SKOB 3L3OB 2G75B 5L7XH 1MAJA 1KBKA 4HV8A 4WU5B 5IB5B 1EZVX 2ZG2A 3P73B 4EVNA 1JJUA 4ALAH 4P2RA 2IBZY 5ID0A 3B3IB 1T04B 3BRGC 4NZRH 3OZPA 1WZMA 1IC4L 4LGRB 2Q7NA 4RISL 5FA3A 5E08L 3UO1H 1I8MB 1MCQA 5FFLA 3IS1X 1T2QL 3E1F1 4XWGH 3IGAB 2ESCA 1AI1H 5E1QA 3RTQD 3TO2B 5A43C 2CH8A 2WBKA 5CSGA 3U5YA 5CCKL 3SHSA 5L6YH 3WFCH 1CGXA 5LBSH 3TZVC 2AJ3B 4XMKL 3RUGF 1F4XH 5IBUB 3D25A 2W38A 2FR4A 1DQLL 3KYKL 2WIIB 3Q6FA 4PY7A 2HFFA 4NQUA 4TRPH 2O9RA 4P5KB 4NJAH 4PG2C 2VKXA 4X80H 1E40A 2Z91A 1PKOA 2PYFB 2HJLA 2G5BB 3CO4A 5IW6A 3TN0D 5I0ZA 1P4IL 5FDYA 4Y1AD 4R97B 1ETZB 3CFKA 1RK1B 5HYJD 1ZEAL 3ARGA 4D94A 2VLME 1NBVH 2XY1A 1DSFH 2BX5A 3UERA 1XGPA 3KPPA 4GG6B 4O51A 3PGCA 2DD8H 4FFYH 1DWJM 3TBTB 3ULVL 1WO2A 1Y6MR 2R69L 4OAWB 4QNPE 4M6NH 5TDPA 1ZMYA 3VCLA 3IYLW 4Y16B 5HPOA 3N1AA 4HOXA 3BXNA 3VXRE 1DQDL 5FUZH 4Z7UF 4UILH 2OZ4L 5C0RL 2HT4C 3EBVA 3W11C 2C1OB 3SCMA 25C8H 2ESVB 3UTTD 4NP4H 3VNYA 5HBFA 2YD4A 4PMRA 4JRYA 1YMMB 3MOAL 5MEND 3DBXA 4KPHH 4HBCL 3HRZB 1L6ZA 3VU2A 1J86A 2V3EA 3RPKA 1DWHM 3N12A 3KS0J 3QPXL 1TFHA 1CU4L 4UUJA 1KT2A 2GSIA 3PDOA 1X5XA 2P49B 3QNZA 5TE7H 5MP6L 3UBXB 4G8EB 3ZIZA 5GNXA 1RIHL 5HHOB 3VSUA 4GG6F 2ZZUT 1URLA 1K6QL 3HE6A 1C08B 3L3IA 2IXVA 3VWJC 2WMIB 3P4OA 4L8DA 4JREC 3UTOA 4XZBA 2VX4A 3RUGE 1SJHB 1UZ6F 2XRAL 4F9PA 4NN5B 3ZE1F 3WEZA 4PRIB 3VXMD 1MLCA 3GSRB 4U6HA 4M03A 2ADGB 1AR2A 3PTQA 5CHNA 3QEUA 2E9IA 4L3EB 5CUSH 3V4VL 2E9JA 5BVPH 4XHJC 2C7FA 3AXHA 5HI4C 3HUJE 5GIRA 3FO2A 4ZPVA 1U2YA 2NX5E 4U4BA 5DZOA 4NFCA 4OGYL 4K8RC 4FQXD 5ALCH 3W2DH 4YFDB 1VACB 5KVEH 1KR1A 5FYLL 4PYGA 1V7NH 3QDGD 1AXTH 4QHKJ 4QOKE 4X9YA 3H2WA 4NQED 4LSTH 3PV7A 4OKDA 4PRPE 1BM3L 5KSUB 4UNVA 1KCVH 4JO2H 5I5RA 4Z7UE 3MOQA 4KROB 3KHQA 4R4BA 3BZ4B 4PJ8C 2FE0A 3K1DA 1HL9A 1WTGT 1NGQH 1A7QH 3MJ8B 1C92A 1O7AA 3GFUA 4MA1C 4EXKA 2JJSA 4HWBL 2VXSL 2ZCKL 3TNNA 4IUGA 3IETB 3QXDA 5JUEL 3WNKA 1BBJA 2JB6B 3ORJA 3G6AB 2XKNB 4ZFZA 2ZOXA 3EOAA 4NKOA 2Q20A 4NHUA 4WHYH 2WWMD 2GJRA 3KPMB 3O41A 1CICC 2KQMA 2I5YH 2P43B 5BZDA 1BD2D 3TCXA 4JPWH 4U3XA 1G6RB 4IOFD 2EEAA 3EYVA 2B31A 4YBQD 3VDHA 1SHMA 4R26L 5DMGC 1AQDA 1UUQA 3WNLA 3S3JA 1S5HA 2D73A 1CZ8L 3BIKB 3L4ZA 3GGWA 4Y4KC 4XNXL 1CVRA 3UJIL 5D6CA 4EOWL 1EHAA 3OQ3B 3ARUA 4HG4K 5D9NA 1BZ7B 1A4JB 4X6DE 4M6OL 4I3SL 2PXYB 4X5WA 3RFZC 4G8FB 3WDPP 4K68A 4KKNA 1B88A 1WICA 5E6YA 3P9MB 3X13A 4XP1L 4YDKH 3HTLX 3S4SB 5HVFB 3RM8A 4HEPG 3SUVA 1LWHA 5C0IA 3D18B 1NPUA 1YYLH 2DLIA 5I1GL 1XCWA 5A2CA 1QFUL 4U3AA 1FDLH 4LSRH 3V52H 4EIGB 1WAAF 1OM3H 3BISA 1JE6A 4D6JA 3S6CA 3VD3A 4WUUB 1BJMA 1FV1B 1G0XA 1FQ9C 3S35H 3QAZC 3AM8C 3DURB 5BMFH 3CCHB 3MLTA 5DJZB 4LLMB 3RWHB 3MI6A 1TVDA 4BKLA 1I9IH 5CINL 4ZDHA 4HUUA 3SOBL 3X3GL 4LMQE 2PF0A 3VFGH 4Y5VB 3BSZL 3EYQD 3HR5B 4NKDA 1RJYB 3DNKA 1M7DA 2XWTB 1P6WA 3NCCB 3PL6A 3TA3C 4MCZB 2VNCA 4D6GA 3U0TB 2VDRH 4PN2A 4TQEL 1QR1B 3AROA 1FP8A 5EFIA 5T1DH 2HLFC 5EC1B 1W9XA 4PMNA 3OPZL 1OBAA 1H0GA 3NIFE 3IT8D 5KVDL 4JFYA 4WFED 3D39B 2A1WH 3FY1A 1QBAA 1P5UA 3SDXE 5C0BD 3BHBA 1RULL 4OI9A 1HEZB 1UB5B 2G8ZA 5C9JA 3AZSA 3NFPB 5KVFH 1EHXA 3T4AB 5CBAA 1E9LA 1QSFB 2YUZA 5EOCJ 5FO8A 5D7LD 1G7JA 3OR6B 4M48H 1F45A 2DYPB 1GZJA 2NY3B 4FQIL 2VCCA 5B39G 3X14B 4R2GC 5GGRA 3WN5A 3BP4A 4EUPA 3O9WD 3WQ5A 4C4KO 3CZSA 4OZ4B 3T0ED 1BEYL 3LKQA 2FSEA 2HRPL 2W0LA 2AK1L 4RA0C 4BSWB 5E99H 4AK1A 1JCKA 2QSQA 3MRCA 2IQAB 2YPKB 5F9DC 4Y5YA 1K9TA 3DSNA 5D7IB 2ZX8A 4QRRD 1WAAE 2IMNA 5F7MC 5ACMA 2VZ1A 3AZTA 4K3DH 2EC8A 2EEDA 3MOBL 1HVQA 1QHZA 3WHE0 1MCSA 1I1CA 4DKEL 4NRSA 1A64A 2E7BA 3TV8A 4NWUL 4YXKH 4RFEB 5AWNH 3MV01 4L9LA 4PJEE 1P84K 1YEEL 1HH6A 4GRLD 5L0QC 4OSUL 2NNAA 2VLJB 2Z31B 4A4AA 1YUHA 3SE8L 5JIKA 1M71B 3SY0B 1J18A 1JNDA 2AI0H 4RE2A 2AV7A 5C7XH 1ZVHA 5JDSA 4TVPD 3THCA 4ZS7H 4N0UA 3E6HB 1U42A 1HHHA 5JHDE 4HF5H 4UT9L 3MRPA 3JTSA 1FNHA 3B9KD 1HSBA 6FABL 1Z32X 3AS0A 3KR3L 1JVKA 4X9IA 1UKPA 1EO7A 3WFZA 4S1DD 5D7IF 1T03H 1QBMH 3S34L 3DX3A 4UV7L 1IRAY 1AD0A 1NC2B 1DN0B 2Z92A 3OA5A 4XNYH 1QSEB 5FKPB 2NXYB 2P7TA 3BOVA 3KLKA 4TN9A 1B1YA 2GITA 2VXVH 3DYOA 1U3HB 5I18L 1CFNB 2XZAL 3WD3A 3DARA 4LDLB 1UENA 3KPSD 4JKPH 3BW9B 2DQCH 2C3HA 2FRGP 2HFGL 2M8XA 3GIVB 2GT9A 3ET9F 5EO9B 3UTSA 1TQCC 2VERN 1NGXA 4HW6A 4RMQA 5D1ZB 4NRXA 3O6FA 4FZEH 5I6XC 5JPMA 1TCRB 3BWAA 5HHPB 2D2OA 1PZ2A 4P2RD 3IKKA 5I19H 4PJBA 1UWXH 2WHLA 3R8QA 3QOMA 3LKOB 4F66A 1TZIA 1EV2E 4UFLA 5A2LH 3H7BB 3SE9H 4ETYA 1TENA 1Q1JL 3IU3A 5SX4H 3DX6B 1GYAA 3IF1B 4OFYA 4FMKA 4UQ3B 4GXPA 4NKMA 1OAQH 2LVCA 5DYOB 1O0VA 4P4KC 2CIKB 3OGOE 4PGDA 4BSJA 1G6RL 2W0PA 1N26A 3DVFA 5IJKA 1UZ1A 4IDJL 5IF0B 4GPNA 3WF4A 2E8ZA 4MJ6B 2O9TA 1ZV5A 3L7FB 4JHZA 1MIEL 3W24A 4YQXH 1J1OH 3ZMRA 5E24E 4BQ9A 2OQJA 5B4MD 1GGCH 1MFBH 1U8IA 4HZ6A 2GFTA 2OMNA 4PS4H 2CK0H 3QUXA 1LVEA 2IH1B 1T0NB 2W5FA 3WO3B 1G7PA 2F8OA 1VGKB 4L4VE 3EUUA 3R06A 3ARGD 4PCTA 3VXSA 3FB5B 1H4PA 2M2DA 1IAOB 3D0VB 2XWBA 3OKKA 1AGDB 1PFCA 2AEWA 4DW2L 1CK0H 5FGBA 3WXVL 1T80A 1T5WB 2EO1A 3IDGB 1IV8A 5ERWB 3BDYH 2NLJB 5GGTL 5SX5H 2PBGA 3QJFB 4WCYH 4F2MA 3FB7A 1SBSL 4JPKH 2UZYB 3TONA 2VDOL 4P23B 3P40A 4JFEA 2V2XB 5T33L 3MRMA 5FECA 1U8QB 4UDUB 3SGEH 2BDNH 3SCMD 4XRCB 5EIIA 1CDHA 1IGYB 1FIGH 4XVSH 4MB3A 3G5VA 1XF3B 2Q6WA 4JRYD 2H26A 5EZLB 5FUCE 5EBLB 1MCDA 5L7XL 3RTQB 4R97C 4KQ3L 3S97C 3V7AE 2CDEB 4QRTB 1FZOB 2P8LA 2EDFA 3VOCA 2O61A 4R0LB 2VLRA 4ALAL 1TG7A 5GZOC 4AL8H 1PD6A 4PLKD 2O26U 2O92A 4Z76B 4NZRL 2YPVL 5HGDB 4K9EL 4GAYB 1EGJH 2EC9U 2ICWJ 3HE6D 1S7VB 4JAMA 1IAKA 1VPOH 1PYWA 1MFDH 2HRLA 4Y16C 3ROOA 4U1GB 5ACLA 5C8BB 1CNVA 4P8XA 1B9ZA 1WBXA 3AHXA 3V6OC 3EO1B 1HXYA 3TN0B 4AY1A 1ACZA 3I6GB 3BJLA 3ETBF 3WFCL 4LPVA 5I75B 1W2KT 4MDPA 1F4XL 3P4NB 4W5ZA 2PYEE 2WWCA 4NC0B 5DUPL 3NSNA 2IXUA 4H8HA 1YYMH 4X80L 1P6FA 2WBJA 4R3SA 3OKEA 5C0JB 4FTVA 3MR9B 1XAUA 3FONB 4OB5H 3VUPA 1NDGA 1MHCA 5DFVC 2OSLB 1T0OA 2ERJC 3L3GA 4AH2A 4LLVB 2XN1A 1NBVL 1RK0B 3EOTH 3F5LA 1UCTA 2G9HB 4LOUD 5CJOH 2VQ1B 4FFYL 1CF8H 3S5LB 1BGXH 2WB5A 4XMPH 5J57B 4GBXA 3JWOC 4UIMB 5MENB 3IJYA 4XT1C 2WCGA 3FKUS 3VFMA 3WY2A 3O4OB 3H9HB 3AYRA 1CLVA 1GGBL 1H15A 4V1DE 4DCQB 3NCFB 4KTEH 4UB0L 4UILL 5DGQA 5CS7A 1KLGB 1CZ1A 3BEVA 3G5XA 4M4PA 2X70B 4RGND 4F7MA 3WO4B 2YR3A 3SQOH 3FMGH 3ME0A 4GO6B 25C8L 3VPLA 1EHLL 3KHOA 3D6GA 4XZWA 3SGKC 3DJ9A 1OARL 1I85A 2RCSH 4JLRB 1J12A 4BQ4A 5C0FA 4QAWA 4Y4FA 1R6VA 1NGWA 5JTWA 2CIIA 2J12B 1W91A 1ZHKB 2BXYA 4KROC 2A83A 2A3BA 4ZD3H 2OS7A 5FHBL 2VN7A 3CZGA 1D9KC 4AMCA 5DD5H 1ZT1B 4H04A 5IVXE 2ILLA 2ZUXA 3NFNB 3ZE0E 3SGJC 1XC6A 5GRVK 1P2CA 4WTXA 2WZEA 3HZYA 1VDGA 4PJCA 2DOCA 3RZCB 1B4RA 3T0DA 5CEYA 1IAII 4WDIB 4EXPX 1GQLA 4MDOA 1MJ8L 1OTSC 3V5HB 4U0RB 2Z1SA 1RUKH 1WBZB 4BELD 5FIEA 5CXPA 1GIGH 4I3RL 3U57A 2J7CA 4F33B 3D69B 4X4MA 1ZLUH 1DL7H 2VC9A 2B4CH 5EZIH 3FJTA 3ZKNC 4W70A 5DHYA 1WSST 3BDBA 1UJ3A 3PWLA 5F7HA 5F7LB 2IH3A 3BMWA 3AS2A 4FNRA 5CP7A 1B0GA 3BUPA 2NY5H 3WJJC 3AXLB 4Y1AE 5ITFA 3KWXA 4AYGA 4JO2L 5HYJE 4FFWC 2F53A 3LQZB 4FQPA 3PL6D 1UJTA 2PXYC 3BN9D 4PFEA 1A6ZA 1S7WB 5ANME 1AQKH 2ATPA 5IOPA 2WAHA 4S3JA 4ZMAT 5H2BB 4M6AA 1JN6B 1A7QL 1IQWH 5EA0H 2DTML 1K8IA 3IFOB 2D0HA 5ETUB 4U1SA 5HI5D 2Z9TA 4GLRI 1S7TA 3QFJB 3BX7C 4BH7A 1BGAA 4QGYA 4MTVA 4K7FA 3WUZA 1INDH 5AYUH 2A3CA 4BFBD 2EDXA 3BUDA 2ZSVA 2CUHA 3OZOA 4PJ5E 4DK6A 1QSZA 4U0QB 4V27A 4FZ8L 4PJFF 4ZQKA 3QEQB 4EN3A 4YHPB 1TJIL 2I5YL 3P30L 4NQVB 4D0CA 1TTUA 5BW7C 4HFWB 1W0VA 3UTTE 2X1WL 5SWSB 4E0RB 3RI5F 2ZX9A 4M1RA 43C9A 1AGBA 5MENE 1WZ1H 1HYSC 4Y5VC 1LK3H 1YEJH 3OG4B 3RY6C 4JO1L 2I9TA 2Y4SA 4P8UA 4JGMA 4H0IA 4KWUA 2Y72A 2A6KA 3GMMA 3BD5A 1YC8A 1F3RB 5DD1H 2EE9A 3MACH 2NY6C 3MRDB 2PO6B 3F7PC 4KGLA 1B90A 4MQ7A 5K9KA 2FIKB 3LKSA 3EIFA 3O3BB 2D4DA 2RGSA 5LCVH 2CLRB 1UC6A 3D3VA 3T2NH 1ITCA 2I9LB 3BE1H 4TTUA 5E4IA 5T1KA 4ZYKB 4WW1B 5J1SC 3FT3A 3CC1A 5I73B 1WBYB 2J8UB 3VXME 4GRMB 4YDKL 4HG4J 2UWEA 4NCC1 2H2SD 5DA0B 5CWSA 1YYLL 4GS7C 5EU6B 1W1PA 1WC7B 5ESQA 5ABGA 1FDLL 4C83A 4KDWA 3UAJD 4OCRL 2R4SH 5JHLL 5D4QA 1VSCA 5E2UH 1IEBA 4W5UA 3PNWA 1NGPL 4Z2GA 1HHGA 3ARWA 1I9IL 3D85A 3I02A 4M43L 2NY3C 5I8OL 4U1KB 4I0PA 4L8CA 5FIPA 1ZWIA 1UA3A 1UD3A 3MV8B 2NW0A 5D7JB 3EOBA 5HPMB 4ZFFA 3ARBB 1YY9D 3R1GL 3QDGE 1Z9LA 3V0VB 1KTDB 4NQEE 1OGGA 1P7KB 2AVGA 4PGBB 1S9XA 4RX4A 5EBWB 5F88B 5E9DA 3WH5A 1CLYH 3IDNA 4EI5B 3O2WH 3V8CA 3TH2T 3QR3A 4MQSB 2VDRL 4F8TA 2DQFA 4H7VA 2GTWB 3SCQA 4PJFE 4BFIB 3BUQA 4R4NC 5D5MB 4PTXA 4MNHB 4X7TA 1A9BB 1S9KC 2OI9B 2E7HA 2APBA 4JFPB 4XAWH 2D24A 3SKNB 2GJPA 1TQVA 4ZTPH 3CHFA 2A1WL 1Q0XL 3VD4A 1DQJA 2BVOA 1T2XA 1SMDA 4HT1L 2XVGA 1ITXA 3RNKA 2Z31C 3LPWA 3TIDA 3QQ3B 4NQXB 4XP5L 3RO8A 3UTSD 3G6DH 3OXRA 2G2RB 15C8H 1Q94B 1BD2E 3O6FD 4J6RH 1I3RB 4RIRA 4X98A 1VERA 1UYWH 4M48L 1TCMA 4IBLT 5GS1A 4GUPA 3NMEA 4NZTH 2ZJSL 4JB9H 3CHEA 4U6XB 2X05A 3TCLB 3LB6C 1H5BB 2Z1KA 1NOFA 2FBOJ 5E1HB 2CLZA 4UNIA 4XBGB 2VWEE 3OX8A 4OFYD 3ZE2F 1Z3GL 1OL0A 3I85A 4ELMB 4LPTA 3SE4C 3MV7A 2W91A 4K2UH 4QRPA 5D5MF 4WNQA 3LMJH 2YD7A 1U3HC 1GGTA 3BEWB 3SDCC 2XM2A 4OZIB 1RJZB 3BZEB 2Y7QA 3VI4E 3HE7C 4NRRA 4U5KA 4YXKL 1Y6NR 2Y2WA 4P4RA 1NWSA 4OQTH 2VLKB 2ZXBA 2YD9A 1HXMB 3EW3B 4LLUB 5D1ZC 3QFDB 2OWWA 4HHAB 3WKNA 4WW2A 1XHGA 2R0KH 2DBLL 4P3CH 5KBNC 2ZUSA 1OD0A 5D96B 2YHGA 1P84J 3QUXD 3AGVA 1MUJB 4TOQA 2DDQH 5DUML 4W88A 3MRFB 3G08A 3VXSD 3SUTA 4HWEL 2P46B 4M6MH 3W39B 1DDHB 3ECBA 1EBAA 1BOGA 2H1PH 2MANA 4XH2A 3MYJA 5A6JA 3P2TA 1JK8B 1ED3B 1NP2A 3FN3A 4ELMF 1QBML 5IR1B 4W8LA 2BOBB 2WCAA 1OPGH 3L6FB 1BIIA 1ADQA 1WDSA 3BUBA 3WF3A 1TZGH 4PCSA 4KK5D 3UJJH 2OTUB 4JFED 3IDJA 4YDIH 3ZT5A 5ID0B 2YEZA 2RJMA 3DETD 3CLWA 4WV1B 4ZUTB 2FEDD 5M17A 1JF6A 4YHYB 5D8ZA 4NO5B 2DQCL 3OGVA 5C0CA 4UCFA 4LRIC 4AZGA 4WFEE 3TBWA 4RAUA 3TJHC 2XZCL 4MD0B 4I5BA 5C0BE 3QH3A 3D4ZA 3VMNA 1KQYA 3DUUA 1MWAH 2AJUL 5ABEA 2A74A 1VFAA 4FZEL 4PRHA 4E41B 2XXMB 1AGFA 1YJDL 3VJ6B 5TD4A 1FFOB 2VLRD 1GXEA 2XFRA 1U8KB 3EDEA 1M05A 1CLCA 4XPBL 5D7LE 3AREA 3W27A 2EIBA 3VIGA 3DVNA 3EFDH 5C2UB 4LGPB 3SE9L 1ACYL 5M94B 1QZ1A 1YY8B 3BFOA 3S5YA 4QHUA 1AGCA 4MDIB 4EUPH 4P23C 3T0EE 5AG8A 2Z91B 4ONFH 2OLHA 2NW3A 5DEZA 5GJSH 5A2KH 4JFXA 3BCFA 3DDFA 1OAQL 4HIXL 5IW6B 1LEKB 3AIWA 3O3AA 4N42A 4UFJA 1MRCH 1KIQA 3TJEH 4QRRE 1C1EH 3UBXG 4WEUD 4JY5L 1XGPB 2E8YA 1GUVA 4G5ZH 5I2UA 5DQJB 1EBPA 3RTQC 3WD1A 1A0QH 2X1PA 3U7YL 2XOTA 1E6OH 4YQXL 1J1OL 3HMWH 4JFZH 4ZO9A 3CMOH 3VW3H 2PTTB 3FTGA 4R0LC 5KS9A 1IQDA 2WBJD 5IEHB 1GGCL 1H09A 1MFBL 4HUKB 3I84A 4K7PX 5F3BA 5JIWA 1T7YA 3X12A 4G8GB 2DSKA 1NFDB 4UINH 3RM4A 3I6KB 2V5YA 4ZNCD 3AHTA 4POUB 1H3VA 3OKOA 4TVPE 4HXAH 2XUCA 4JL2A 4U1GC 3KVQA 2IPTH 3T09A 3GI9H 3HC3L 1CK0L 4Z7WB 4MCYA 4GT7A 5I0DA 4GBXD 2D9QB 5DMIH 2WZIA 3TN0C 3VIKA 4C7GA 2QQLL 3HG4A 2X4UA 3I3DA 5HVGB 2E7MA 4UUJB 4WCYL 5DK0A 2ARJQ 2GSIB 5KSBB 4JPKL 3C9NA 3OGCA 3MX0A 4KDVA 1QVBA 4X6FA 2QLYA 4S10A 4MVBD 2ICEA 4MX7B 1QW8A 1MLBB 1Q6FA 3QIBB 5EZJB 3V4PH 1VFUA 2CITA 3L3IB 2O93L 1I1FB 1YECH 1FIGL 5DRZA 1E71M 4XCNB 2YD5A 3TTOA 4L8DB 4XMLL 3KPSE 2F58H 4Y88A 4G7YL 4MJIE 1IM9A 3DX8A 1JWUA 4ZS6C 2XG4A 4Z5RB 4C56A 2Q86A 4AM0B 2AS5M 3SJVA 2V38A 1OB1B 1A9EB 1ZHBA 1NFDF 4W7WA 1MOEA 3MLYL 4Y4FD 1TUXA 4MLIA 4Z77A 2ENYA 4IRJA 3MCKB 3REWA 1F11A 4P2RE 4IRZH 2DQXA 2J75A 5DMJB 1QFWH 1CLZH 1D5MA 4AENB 1EGJL 3QHFH 4FNSA 1OF2B 3K4ZA 4NNYB 1H8OA 4KAQH 5GIRB 4Z7QF 3O4OC 4ZPVB 2CLVA 1LDPH 4XGZB 2F7QA 4ZFOB 1I1WA 4H8WH 1VEMA 5KSBF 3JV4B 4OGXH 4OGAC 2PKDA 1HHIA 4E8DA 2DT2A 4LGXA 1U30A 1H41A 4LCCC 5A2IH 2CBIA 2OMBA 4PBVC 4ACYA 1TVBB 4JDVB 4GMTH 1X9QA 3PQYA 1XGUA 4R4BB 4OT1H 1I8IB 2LU7A 4JO4H 1CWVA 1GRWA 2W65A 3OB0K 5FA4A 2F7PA 1HIML 2QSCH 1KXQA 2WMGA 1H0DA 5E8NA 4OCXH 1I4FB 4XVUD 4DGVL 4QP0A 5GSRA 2B5IC 4OB5L 1WFNA 1BP3B 3GMPA 1BBJB 3NIDF 4Z7VB 5IMMA 3FRPG 2EIDA 4NIKB 3TBYB 2JEQA 4ZFZB 3EOAB 4HIJA 3EJPA 4NKOB 3S4SG 3EOTL 4NHUB 4R96A 3H9SB 5FK9B 3O6LH 3ULUL 1AC0A 2GFBA 3A23A 2F53D 3O41B 3IU4H 3VX0A 1CF8L 4FQXC 4HGKC 2NY4B 4F7CA 4XMPL 4G6KL 4IRSA 3TBSA 5BZDB 4CBPA 2OL3L 3UG5A 4GKNB 4X5LA 2AXJA 3RZCC 4CGTA 1YEHL 4UMGA 3EYVB 1TETH 4HZ7A 3CH1A 4U0RC 1H2JA 2A6IB 5F8QC 5M5DA 3GGWB 3SQOL 5GS0L 2N7AA 1QNOA 2DJSA 4WJXA 1HDMB 2P5WA 4JN2A 4EN3D 3TF7C 5L8LB 3GKWL 5A8NA 4RAVA 3T2OA 4DAGH 3K74B 2V17H 2ZCLH 4JRYE 4HKXA 1DBAL 4PR5B 2VL5A 5IB1B 1KELH 4Z7QE 4XWOD 3KYOA 5HYQB 5FDWA 3F6IA 2WMKA 4QXWA 1WIPA 4L29A 1SYVB 2WWMC 2E6PA 1U95A 32C2B 4MNQA 1NEUA 1E4LA 1MAKA 3U7VA 3PWVA 2RFXB 3AU1A 5KOMC 1K4DA 3G5ZA 4ONGH 1EOKA 2XPGB 4IOFC 2FWOB 3D3VD 4NHCH 4YBQC 1JAKA 4LASH 1K2DB 3WNOA 1W1TA 5T1KD 1B4JH 2IC2A 4RMWA 5LGJB 5K59F 1VFBA 4KKAD 5AZ2L 1F3JB 3H0TA 3EMCA 4BZ1H 4HA4A 1Q6DA 4NJ9H 2CMRH 1RUKL 3WENA 1M7DB 4UBDC 4D0BB 5GSVB 4I3GA 3MRBA 2FATL 3PL6B 3MRIA 4HQQH 2V9QA 4H0HB 4KMTH 4K3EH 4RE4A 4CU7A 4Y5XB 1XCTA 1S7SB 5D72L 1X6NA 2X4NB 5J6GA 2B4CL 5EZIL 4EANA 1NLDL 3D85D 3D9AH 5TDOB 2EQDA 3AHYA 2V5TA 4YUEL 4ODSH 1AC6A 3N06B 1CCZA 2PO6C 2NY5L 2ZIDA 3DXAA 3T0WA 3WIHA 2IBGA 1S9VB 4JFYB 5DFTA 4PJIA 2XG5A 4RX4D 4WI9A 5E9DD 5IK3A 2PWGA 3UBXI 1XR9A 1MWAB 2SEBA 3FAXA 2C3XA 4DM2A 5F1SA 5K9JH 5KJRH 5FCZA 4N8PA 5I73C 1IQWL 3LHPL 3TA9A 4UU9B 1FNLA 1EXUA 1I9EA 3TPKA 3WIIL 3T3PE 2H2PD 2F8VA 4X9GA 3T4YA 3WF1A 3H3KA 4AZBA 1G7JB 1U2HA 3SN6N 3CZKA 3CZFB 2MOVA 3RJQB 1D6EA 1INDL 5INDA 5AYUL 4PIRF 3GMNB 5CJQH 5L8KB 3UESA 3C2SA 3H55A 5GGRB 3VXQB 3CFBA 3BP4B 4RGNE 4EUPB 3QDME 1KGCD 2AV1B 2FSEB 4U2YA 4YHMH 1B3ZA 1WZKA 4LHUD 3ZDYE 5CGYD 5SWQB 3FQUB 4YXLH 2PWEA 3TLRA 4BSVA 2H8PA 2JLLA 3RWDA 2XA8H 1C8XA 3C5ZB 2X4OA 1JBJA 2IF7A 4JFDA 2Q8AL 1YEJL 4ZXBA 5DI8A 5I8CB 1QI5A 2J8GA 1VKXA 1F58H 1AFVL 1KXTA 2PWFA 1KN2L 4Z2LA 5C0ND 4EI5C 1EFXA 3BSGA 1V0NA 5DD1L 8FABA 1OAKH 2VTFA 1BX2A 4JQXA 3A6BH 1TJHL 5GRWA 4Q6IC 3RX8A 2BNRA 2AJXH 2Q7YA 3T2NL 3UYRL 3OLEA 1H3TA 3MV7D 5D4YA 4QRPD 4QTIH 2OI9C 3EDDA 1HINH 5HHXL 3UC0H 5FL0A 2V2TB 3QCUH 2KZWA 1MH5A 3IJHB 4HZAA 4M7JL 2AV7B 3RGVA 2YDQA 3HG2A 2DQDL 1QRKA 3L3DA 3MRPB 3T0EC 1HSBB 2VZOA 2YLAA 3GXIA 4ZXOA 4CD5A 3LEXB 1PSKL 4UQEA 1AGEA 2A9MH 5MERB 3MRLA 3BC9A 3U2SB 3OV6A 4O2CA 1OSZA 5AY7A 2XVNA 1FNGA 1PY9A 2R4SL 4DTGH 3BMVA 1AD0B 3AIBA 1MPAL 1UWEL 1R3IL 4ZFOL 2Z92B 4PBXA 2YSSA 3EYUH 1ZA6B 4U5IA 5CSZA 2P7TB 5INCA 2DQEL 3SDDB 1H5BC 3S9DB 1NKRA 1UEMA 3HPLA 5AZEH 4ML4A 3CDGA 3FN0L 2V7NB 3V5KB 1CLYL 3S3PA 3T1FB 3GH4A 1A2YA 2VIRB 2W59A 4OKVB 3UEZA 5I8KH 3DMMA 2WC4A 4PRAB 4AZ7A 2HH0H 3UTSB 1N2RA 1Q9WA 3STLB 3CLEH 3L4VA 5MEPB 1GGYA 1NGXB 5JORA 4PUDA 5K33A 5DT7A 3O6FB 5EU4A 1IARB 1F4YL 1SVZA 2HFEB 3L5IA 3BWAB 3NFSL 4IEFB 4RZCB 4PJBB 4WHYG 4G6JH 3QEHB 4XPHH 1GHFH 4S1DC 3GSOB 3HHRB 4O2EA 2YD2A 1NUFA 2V7HA 3LDBC 3PJSB 4JZNA 5C0CD 1Q6GA 5T1MB 1MQKL 4JFHE 3PHOA 4MA3A 1OGTA 1TZHB 2OSWA 3IU3B 3DVIA 3JVGA 2F7RA 2R9HD 3F12A 3G6DL 2FJGB 4GZIA 1VFOA 2DJUA 1CEOA 4LPXA 4NKMB 4ELKA 4PRHD 4ZODA 2VDML 4DUXA 2IEPA 1UYWL 1I7UB 3C2AL 2YD8A 5DFWH 3MO1A 3QYCA 1MWOA 1FAIH 5EULV 4J3WA 2VZVA 3ARED 2Z4QB 1WWAX 4JB9L 3MA9H 4U2ZA 3F6LA 3PV6A 4LL9A 3M7SA 1T2JA 1UOKA 4MXVF 5BXRA 2J8FA 4KU1A 1U8HB 4K94H 4AG4H 3LS5H 2VC2H 2ZG3A 5DSCB 5J9PB 3LMJL 4PJBF 5ABDE 4WV1C 1U8IB 1UWQA 1UM4L 3MUIA 4HUWB 1G7PB 3EJSA 1I3GL 3R06B 2HWZL 4TNWK 3VXSB 3WD5L 3JZ7A 4OZHE 2R0LH 4YR6A 1Q4NX 3OKKB 5DJ0A 2X0HA 3IDIA 4OQTL 2GJXB 4M56A 5J0BA 1HVXA 2Y5EA 4LBEA 4XCYA 4D6HA 4GQ9H 2YC1B 1T1WA 2BXZA 1IL1A 1HILA 1SMAA 3DC0A 5I1KH 1G7LA 1OGAA 1I9RH 2QQKH 4F2MB 2XWEA 1EFQA 2DQGH 4OLUH 1CXIA 5I8EA 3RL1A 1TJGL 3HG1B 2DQJH 5FECB 2E27L 5IKCA 4LEXH 1R75A 1PDKA 3NPSB 4M6ML 1CD0A 5GGVH 4N0UE 5DJ6A 5J12B 2H1PL 5EIIB 1RZKL 5JQ6L 3WIJA 5GS2H 3G5VB 5B4MC 4NSKA 3PZIA 2H26B 3BIAX 3IFLL 4BZYA 4EAMA 4MA8L 4JVPA 3X3FH 2I24N 1FORH 4TNVF 1FZKB 1CGSL 1N6UA 3VXOA 4ZAKB 1TZGL 2F5AH 1DQQA 3UJJL 2O61B 3MKKA 1JRHH 1HCVA 3PWPA 3QUMA 1W32A 2AK4A 5DJ8A 4XNZB 3PE9A 1DEDA 2DWDB 4G9FA 4TUKL 4P0DA 4YNYB 4OOUA 3ZKQD 3RVUD 2BZDA 5HDBE 1PYWB 1UH2A 2E3VA 3ROOB 1IM9D 4XPAH 4YAQB 4XUYA 1MWAL 1S8DB 1WBXB 5EC2A 3D5HA 3SJVD 1J1PH 4CADA 4BS0A 1QRNA 3UTSE 4N8CL 1FNEB 3ARFA 1XRVA 1UM6H 1QFWM 4IRJD 5K9QG 1S7XB 5ELIA 3OAUH 5C2BH 1TITA 3PF2A 4R4FH 3VFPB 2BOCB 4FABH 5TF1H 1R5WA 3EFDL 2WVSA 4OD2B 1L0XA 4OV6F 4KK6D 5HNNA 3OKMB 5EUOB 1JP5A 4FQQA 5EPMA 4D6CA 1F4WH 4HUXA 2IBZX 3CSPA 5IEKB 5FD0A 3QUML 2FBJH 1KCUH 4JZJA 3WHE1 4YX2H 1JZ6A 1PVHA 3O45B 4H41A 5ESAB 3OKEB 5ACZA 3QISA 4LCIH 3CGTA 4G9DA 4FTVB 3NCYS 1RZJL 2ENSA 4CUCA 3HI5H 4WEBL 1CE1H 3QIBC 5C09A 2J7LA 1C1EL 1OAUL 3HE6C 4WLCA 1E4XH 1FFNA 2UV3A 5D1XA 4A6YL 2OK0L 2D1ZA 5IB4A 4JPIA 1CT8A 3LOWA 5JPNB 1JHKH 3PQYD 2ATKA 1A0QL 1HNFA 1IT0A 1LQ0A 2DQHL 5D8JH 4DOHE 2QSVA 5DJYA 3RRQA 4BA0A 3VW3L 3NYDA 2JCCA 1K6AA 2QPSA 1GPFA 5F7DB 4YH6A 4P59L 5F6HJ 4ISVA 1H15B 2BVDA 1Q9KB 4LAJH 4L5FL 3GNPA 5I1CH 5KSVA 5E94A 2ARWA 1XYFA 1RUML 3G5XB 3Q6GH 2VAAA 1NARA 1G0YR 2B39A 2XN2A 2YBUA 1ORSB 3SCPA 4MJ2A 4JR9L 2CYGA 1WUNT 1ZS2A 1J8HB 4IRSD 1DUYB 3CLFH 3FQWB 1NH6A 4WHTB 4EI6B 3DHUA 4JDTH 4HP5A 4Y4FB 5LWYH 1J9YA 1ADQH 1NGWB 1YNKH 4POYA 3KE0A 1JZ2A 3ISWA 1W2VA 4JFEE 3K8KA 5HTSA 4UNTA 5DD6B 1ISYA 5IHSA 3V4PL 2P5WD 1YECL 2EDWA 1BJ1J 5T3XL 2JJSC 1WCGA 5JOPE 1J5OH 1IGTB 3CFDA 5A3HA 3ARTA 3BKMH 3P11L 1JWSB 1MF2H 5FUOH 2ZKHL 1ZHNB 4ZTOH 4N0CD 4MADA 2DLHA 1NFIA 3VFVA 1F8TH 1S7UA 5CEYB 3UPAA 5I15H 2FEEL 1QACA 4Y8AA 1JZ4A 4MNQD 1PKQB 3FZUC 2VLRE 1RHFA 2NY4C 4G6ML 4IIQA 2VI0A 4O9HH 2PWHA 3UTZA 5F1IA 2X1IA 3QHFL 1DLHA 4KVNH 1CG9A 1U8PA 3CFEA 4LP4A 3WQ8A 4E42A 4XZUA 1FH5H 4FNPA 2CRMA 3GHBH 4H8WL 1BVLA 1OAYH 1VESA 1CD1A 2XFXA 2WKLA 2Q1EA 1CFTA 3PWLB 2IAMB 4A3YA 4D9RD 3L3KA 3OG2A 2O5YL 5CP7B 1B0GB 2GDVA 1KPUA 4N0FB 1M01A 3KDMA 5I3DA 3VWKA 4ODXB 5CZVH 2VRAA 3VFTA 5CMAB 4OTXH 1UXSA 1B2WH 4LPYA 5EIVA 5C71A 1KN4H 3A5VA 4J4PA 1NMCB 4OCYL 1FOBA 5F97E 5MEOB 3IAGC 1C91A 4PJCF 1K8IB 2L7JA 5M03A 5DJXB 5A40E 4DKAA 4FRWA 4P57B 4BH7B 2MNUA 3TIEA 4AMKH 3L1OH 3DXAD 1NGZA 3I3BA 2ZSVB 1EMTL 1EVTC 4DZBA 1Z5LA 3IU4L 4ZQKB 4EN3B 4KRNA 4D0CB 5DHXB 5IVZA 4NQDA 5DT5A 1W0VB 2DM2A 1X5LA 2VDKH 2HA1A 2UZIH 2GTZA 43C9B 4P46A 3TWCL 3VVGA 2I9TB 2PTUA 2FECL 4J3SA 1LE5A 2A6KB 1R33A 4PJHE 3PL6C 4PRDA 3BN9C 1AXSB 4MXQC 4OD1H 1I9JH 4UQAA 2A73B 3S7GA 4UTAH 5DVKA 2R0ZH 4M1DH 2QHRH 5J1AB 3D3VB 2NXZB 2CBJA 5JNYB 3N1PC 4YHIA 5T1KB 5I1DA 1U6AH 5E09A 1PX8A 5FXCH 4ZXBD 3RP1A 1IBGL 3BLBA 3OF6A 1EFXD 5DVOA 5T1LB 1JNEA 5EH1A 5ESQB 3GRWA 1E6XM 4QHMA 5BQ7A 2AOSA 2NSXA 3O6KH 4RA3A 4NOBA 1LE9A 1WP6A 1NUGA 1OT1A 2D7TH 4LASL 4J2XA 4EDXA 4GW1A 4NYLA 2APVA 1Q9LA 1B4JL 3TBVB 1FLRH 1HHGB 2WP3O 3D85B 4HDIA 4MDJA 4I0PB 2J8HA 3RGVD 4L8CB 3UCQA 4WJ5A 3W9EA 3WN5C 3SCWA 3U83A 4BZ1L 3THDA 4PJCE 5FKAA 4NJ9L 5IGXH 2CMRL 3H9ZA 3EYOB 1OP5H 2X4SB 3LRSA 2J78A 5K9QI 3QRFM 1JHLH 4Y5YC 5BO1H 3IDNB 4JKMA 2XN9A 5IBLC 4S3KA 3CVHH 2ED7A 4UT6H 3ZJ8A 4K3EL 2X4PB 3BUTA 1IM3B 5C07A 4IMKA 1FVEB 4Z8FH 5EOQH 4X4ME 3DSFH 4U1NA 2XSAA 2WVTA 1JUFB 2H2SC 1KWGA 3P0VL 4ODSL 3MA7A 4X7TB 4AT6A 3DO7A 4HCRL 2V9TA 4MD4B 3P9LB 1BVKB 5CJ5A 1V6XA 3O4LA 5DFAA 3UAJC 2BVOB 1BAGA 2EDJA 2R2BA 1IGML 5I66B 4PRBA 2COQA 4RBPK 3DMMD 1GZQA 3TIDB 1XH1A 5KJRL 2F53E 3UJTH 1A3QA 5MEQA 3TTQA 2HVKB 1YY9C 2VDQH 2Y06H 3SGDI 1X5YA 1WISA 5DLMH 3ULSB 4U1MA 4X98B 3H6JA 5CZKA 1IVLA 2ITDA 1DFBH 4MAYA 3GSXA 2X5PA 2ICWA 5CJQL 5GS1B 4MMZC 1CDYA 2B1AH 1SY6A 2EDHA 3SDAA 3EJUA 4RDQF 4WFGD 4MNKA 1HSAB 4D6FA 4Q9RH 2BMKA 1M6OB 5JO5A 1JNNH 3HU7A 5HHQA 2NY1D 2XA8L 4OD3H 4QRPB 3BYTA 1RZ8B 5IMOA 3SDDC 2FJHA 3ARDA 3U6RA 1F58L 1OB0A 2Y7QB 4R5EA 2GK0A 1F4HA 1OAKL 3B9DA 4XBPA 5EO1A 3VG0H 4P2YA 3GJFH 4P4RB 5CSBA 4PG9B 1DQML 4AXNA 3O6FC 2DJ4A 4MYWB 4WW2B 4DKDC 3QRGL 4M9PA 2YL5A 4B15A 4QTIL 1J0JA 3EO0B 4AEIL 2AEIT 3SUWA 5HHVH 2OR9L 4Q58C 4B16A 1YC7A 5HHNA 4PBGA 1CLXA 1IJ9A 1MEXH 2EBNA 3SBWA 1A3RH 2FL5B 5FM5O 3NN8A 3BZFA 4XX1G 2EKSB 2UWEE 3PP3H 1EEYA 1D5BA 2AJSL 2A9ML 1XD1A 5CFHA 2BVQB 5E0QA 3PZVA 1J0ZA 5F7WC 4GXVH 5TPWH 5BXPA 4YHZH 5DHVA 4DTGL 5SX4I 3FT4A 3U1SL 5IJKC 2VVNA 1OGAD 4ODTL 1SM3H 5LAXA 5D2NB 3U4AA 3K3QA 4OUOA 3TH4T 1EJOH 3NACH 2DN7A 3U4EA 2X9YA 3VIFA 2KPNA 3N9GL 2WVVA 3WY1A 2YEZB 4O5LL 3EYSH 4F3FB 5L2KD 5LA1A 4Z0BH 1AKJB 3GH5A 4KMQA 2CUIA 2CUMA 4YDLB 3MLSL 4WW2F 1VADB 5I8KL 3WIHH 4I5BB 5E9DE 3LKNB 3DUUB 1NBYB 4H1LH 5EU5A 3MRNB 1KGWA 1VFAB 4PRHB 2NY2D 2I25N 1C5BH 1AGFB 1NM9A 3PWPD 2OP4H 2AK4D 3CU1A 2P8MA 4WTZA 1GHFL 3V6ZA 1M05B 4G9FD 4JE4B 4LVNB 1ZT4B 3Q2CA 4ZUSA 3DVNB 1KB5A 4XCEA 1IE5A 1H8SA 3FQTA 1CL7L 1CBGA 5IHUH 1L7IH 5IFAH 3BQUB 5IIEA 4PLJC 2ARJA 3QUKA 1AGCB 2GJ6B 4KK5C 1ULVA 1KGCE 4DKFH 1KPVB 3GMOB 5EOTA 4PMVA 5E95B 4JFXB 1WF5A 1QRND 3DETC 3BRFA 3CXHJ 4LLDA 2VCBA 3ARFD 3O3AB 3NPSC 2AXGA 3DDGA 2FEDC 1KIQB 3MGOB 3C6SA 5E8OB 5J12C 1LO2L 2OTWB 1FAIL 3BLKA 4Y4HB 4NN7B 4HC1H 3SGEI 1BOYA 4Y7EA 4KRUA 3DHMA 3OAYK 3GMQA 5D7SH 3QI9B 5DRXA 2QSTA 4K94L 4AG4L 4PJ7B 3LS5L 1IQDB 4KUCD 1OCWH 1QYGL 4XNZC 4JG0H 4M1GH 5E5UB 4NNXB 4TSCH 3MV7E 5FYKL 5F3BB 4X7CC 3GEWB 5C09D 3HZKB 3E2HC 5E6IB 5D1XD 2ZUMA 4LU5H 3MNVA 1ZSDB 3AS1A 4FNLH 4D3CH 2FHCA 3OMZA 2PWDA 3WIFA 2BY0A 2DIBA 2EZ0D 5A6SA 4LSSL 1IKFL 4GQ9L 1LL7A 1SBBA 3GSNA 4K7PH 5I1KL 1I9RL 2QQKL 4IISA 1MY7A 3OGCB 2DQGL 4Z0XB 5DJ2A 4I4WA 2DQJL 4JCLA 5GGQH 4NZDA 3P77A 1D5IH 3X11A 2V2WA 2GY7B 1LG1A 1TE1A 4ZUUB 2YUWA 3IJ9A 2WBJC 4PJ7F 5KS9F 5EU3A 2V3FA 3W38A 3BVUA 4CCDA 2RIKA 3DX8B 5HYFA 2HT3D 3LRLA 5CEZL 1N6QL 4C56B 3MJ6A 2CDGB 3KS0H 4J3UA 4YFLI 1FCCA 5ILTH 4NQCB 1JRHL 3MRQA 4CJ1A 5GISH 1QNRA 2GUOA 1V5JA 2HJKA 1OAZL 4GBXC 3GBDA 2UUDK 3TTSA 1R24B 5D7KD 5I16A 1JNLH 4LNRA 4YHGA 5C0CE 4XPAL 5HGHB 3WS3A 4OJFL 3WF2A 1H3GA 3MJ7A 5EWIL 1JPGA 2ZSWA 4F7TA 4K3HA 1XSIA 5DQ9A 3WBEA 1G7IA 1D2KA 2JF7A 5FKYA 1YEGL 4KRPD 1UM6L 1V0MA 2DGAA 2VQUA 3OAUL 4GKZB 5C2BL 4FQLL 4P7RA 1K8DA 3KLSA 3RDKA 3CVHB 4FABL 1QLFB 2AJYL 5TF1L 1KQZA 2V5MA 4HIIA 1I85C 3MJGX 1RH9A 2FX7H 2WLZA 1CFSA 3MLXH 1CIDA 3HZVB 1F4WL 2W9DH 4X6DA 1LO0H 2DL2A 1HP5A 1H0DB 1KJ3L 1BF8A 1JZ8A 2FBJL 4HJ0D 2YXFA 4Y4FC 4YX2L 1LG2A 1FYTB 2D0FA 5HJ3A 2APWA 3AICA 1T83A 4LCIL 3PZGA 3ZJ7A 1U93B 3HI5L 4FFVD 1V3MA 2C8NA 4QTHA 3PG2A 1E4XL 3TGXA 3MS8A 4HX1B 4TSAH 5DD0L 3HFMH 4R96B 1OAXH 3VWKD 3QPQD 4M7ZB 2GFBB 4LPUA 3POHA 1FVDB 3U4BL 4M80A 5DQDL 5KOVC 3MRJA 1I1AA 4F7CB 4O4YL 1A7PH 3BVNA 3TBSB 4J4PD 4OLVH 2Z93A 1IC7H 3NAAL 2H6PB 4G8IA 3ZDZE 4MSWB 3UROR 4HMCA 3VILA 2EH8H 5KS9E 4NCC2 3AMKA 12E8H 2IGTA 2BVUA 4BQ6A 5I1CL 5HHMD 1QLRA 2F9BT 5F7NC 2WW5A 4QY8A 4DWSA 2HKHL 3HLAB 3ZL4H 3ROLB 5F7EH 3DLQR 3LN5A 1D6VH 2WSPA 4LLYB 3MGAA 3GXTA 3KPLB 2ZNXA 1HJXA 3SO3B 4NQDD 3DRQA 1WZAA 1T0MB 3DGGB 1PG7X 1F90H 1UJ3C 2IAMC 5F3HA 2GVYA 1N59B 4P46D 4WWKB 3CLFL 3WN6A 4HKXB 4P9HH 1Y18A 1YEDB 4WI2A 2Q3ZA 1SJEA 4JDTL 3UPCA 5E8EA 7CGTA 1YNKL 3GJFB 4CDHA 1U95B 2G3IA 3RIAF 3VGBA 2FYYB 1DVFB 2D4FA 2X6MA 4MB5A 1NMCC 2J8OA 2A9NL 4F80A 3MODH 4ZUVB 3KJ4B 4JKKA 1J5OL 1A4KB 3BKML 2YXMA 1F6LL 1A6UH 4PB0H 5I76A 1MF2L 5FUOL 1HP4A 1A6AA 4ZTOL 4P7OA 2OJEB 5T5NF 4IPNB 1FJ1B 4KTDL 1N5YH 5DEGA 1E28A 3QZWB 1G1YA 3SJVE 3T1WA 2JIWA 3H0TB 1GQKA 1NBZA 3E6FB 4RMRA 3OF6D 1NP0A 1E6JL 1JD7A 4EN3C 4RNRA 4LFHD 3WSUA 1RJCA 1R5IB 1JGLL 4LCUA 4JANB 2YKKA 4AMWA 1M7IA 4KVNL 3L3HB 1FH5L 3AY4A 3B8YA 4HKZB 2ITCB 4FS0A 4XWOC 3MROA 3CJJA 1OAYL 1XCTB 5J7CC 3J7HA 3QUYB 3ULUE 5GZND 4F8XA 1YHTA 4CN4A 3ZO0A 1AO7A 2JIXB 2G5RA 3KPRA 3K8LA 4CVZB 3RHWF 3KPTA 4ZFGL 2DWEB 4FMVA 3QEGH 2RBLA 3R0MA 2XKSA 4K94C 5J8OA 1JFQH 1SEBA 3IDMA 3M07A 5IQ7H 1GOMA 3AUVA 5E6ZA 4O00A 5A2JH 2QADD 2C26A 4OLEA 4PJIB 1T89A 3MLVH 3UPRB 3EYFA 3BP5A 4HK3J 4I2XA 2R8SH 2DH2A 5TFSH 2RQ8A 2XN9D 4H1LB 4UDTA 1ODUA 3PQYE 5C07D 3KGRA 4K3GA 3G04B 4OLYH 4KKAC 3A4AA 2EYSB 5FM5M 3QJHB 4Z18A 2O9PA 3TC9A 3EJJX 4OFDA 2F54B 4TXEA 2C0HA 3T4YB 4GI6A 2XYLA 3FRUA 4OCSL 4AMKL 5INDB 3O4LD 4OI8A 1AHWA 3NGBB 4PD4K 3OXSA 4ATWA 4D8PA 2DLTA 4UNUA 3CFBB 3F5KA 1HCFX 1KG0A 2F19H 2CK2A 2AABL 1C8YA 2IANA 3C60A 2FX9L 3G6JA 4I0PC 2CKBH 2IADA 3RWDB 4WO4B 5IDIA 4X9BA 1JG9A 3R0NA 4JFDB 5FGCE 2DBJA 5H94B 2VJXA 4X4YA 4B9ZA 2IGFH 1EUTA 2DSWA 3TO4A 3IJ8A 4G80A 3MC0A 2OCFD 5EOCH 1KXTB 2Q8BL 3GNML 1EO5A 4PJIF 3MLRH 1FN4A 3QIUA 4MAYD 1EFXB 1Q6CA 4OD1L 5H37G 1LNUB 1I9JL 5TE6H 8FABB 5JW4R 2FGWL 4WSJA 3SDAD 1BX2B 1U91B 3CPUA 1GZPB 2K7PA 2OJZH 3WLWD 4M1DL 2BNRB 3F7RA 4MA7H 2LTQC 2P5WE 2X4TA 2H2PC 1L4IA 4X8XA 2BJMH 5I79A 4MWFA 3FHAA 1H3UA 3KYNA 3ARDD 1PW3A 4M00A 4PTUA 3RGVB 2HVJA 4JKWA 8CGTA 2GAZA 3L3DB 4W85A 3H3PL 3OGRA 2K1MA 4MNQE 5CGYC 1W0WA 5IFJA 5F93C 3MRLB 4O2CB 2XTKA 2D7TL 2AJVH 5IM7A 3LY6A 1I8LC 1ZLUK 2WV3A 4M3JA 2IPKA 3OZ9H 4FLRA 3DROA 5C0NC 2QKIA 5GS1C 2YSSB 2DICA 4WIQA 5JZ7D 5CPTA 4R7NA 4WUKL 5INCB 4RQQB 1R85A 2BC4A 4YPGA 1V02A 1C5DB 4D9RE 2BSSA 1FL3B 4XCFL 1FFPA 5HY9B 4A3HA 3VMOA 3OSKA 4HH9A 4KY1L 2NYYC 3CDGB 1E1FA 5IVNA 3BKCH 4P5TB 3CVHL 2NTFB 1A6TA 4UT6L 4RFNC 4JY6A 3TT1H 5JXEA 4L4TE 1JAEA 1MXDA 3U36A 4PJGA 1L9NA 4Z8FL 1P7QA 3BAEH 3IB4A 4E5XA 1C16B 3DSFL 1EEZB 5JR1L 5EU4B 1XGRA 3TV3L 1HX0A 1CYGA 2X9XA 1XH3A 3HNTH 5BS0A 4U6VL 1M4KA 2MCPL 2CRZA 1PQZB 3M8OH 5FO9A 3LZFH 4LEOB 4PRNA 5IB2A 5L2JB 5IQ9B 5B3JF 3RJYA 3KLHD 4IOIB 4O2EB 5JIPA 2EE3A 2V7HB 3DXAE 4FXKA 4WW2C 5D6DA 2ZXQA 1FZJA 4J3XA 4QCIA 1E27A 5D2LE 3UJTL 1QOKA 1WEJH 4LF3A 4QLRA 4XP4L 4S2SB 4ELKB 2Y06L 2I27N 4FXGA 4HS6A 3MREA 5SWZA 4UQCA 3SKMB 3E8UL 2XJ7A 1DFBL 3MO1B 1US2A 3H3BC 1B6UA 2B1AL 5FYKD 3WFHB 1N4XH 4LCWE 2BY3A 1JWMA 3PV6B 4NUJA 1RFDL 1XSKA 3V0WH 5D9SB 2JK5B 1JYVA 4NGHH 3S88H 4YO0A 3L3JB 1C8QA 1CE6A 4HKBA 1W72H 3HN3A 3MGTA 4ZSOB 4UZUA 1OSPL 5KSAB 5BRQA 2FB4H 2JJWA 5F7KC 4RMSA 4U6YA 2AKRA 3EJZD 3KPOA 4WHCA 4ZO7A 3KLAA 4YDLC 2QF8A 1P5VA 5TQ2L 3VG0L 3CC5A 4W6YB 2VABA 4YR6B 2BFVL 2R9HC 2R1YB 4YC2C 4WK9A 3RIFF 3W81A 1QR4A 3WKMH 1HN1A 1EO8H 4UTBL 1MCKA 1IL1B 3ESVF 4TSBL 3QHZH 1OGAB 2GEEA 3L5XL 1MEXL 3AREC 4LVNC 4YZFE 3S6TA 1J0HA 2DMKA 2P47B 3QBTB 3T0AA 1VEOA 1RVFH 1NFKA 5IKCB 2LU3A 3BAJA 1XZ0A 3LRMA 5DVLA 1G7QA 3VI3F 1G9HA 4LKXA 4P2OA 1H1NA 2PYEA 5SV4A 4EEEA 4KK9D 4B7LA 5JLZA 3OL2A 2XFYA 3IXTA 1A3HA 4GXVL 1E0XA 3IAQA 3MNZA 3MSPA 4N1CA 1XGYH 2EDKA 3MUGA 5IMKA 1JD9A 5B8CB 2PETA 4B7IA 4G3YH 1LEGA 5M7QA 1K5NB 1SM3L 4JHWH 3LD8C 2NY2B 1EJOL 4Y4HC 3II1A 4NN7C 4POZC 2EXWD 5BXFB 2GJZA 1W3KA 2HN7A 4LIQH 3EYSL 3O11B 4QT5A 2ADJA 3MV9A 3QI9C 4F9DA 4Z0BL 3RA7H 1R3KB 3RILA 1MQQA 2WWDA 3FO9A 1YQ2A 4PV9B 2P44B 3D50A 3IKCB 3K2UH 4EKXA 4DFIA 3WH9A 4LARH 3PBGA 4Q74A 3MNWA 4JRWA 4OLWH 5EC2B 5E6IC 1K4CA 4V1DA 4XC3H 1C5BL 1XSJA 1BFSA 4ODUA 5CD5D 4LYPA 1X4YA 3GI8L 4U1IA 3EJRA 3CD4A 5ESVA 1GC1L 4FNQA 3HMXA 1U8OA 1ZBKA 4F58H 3NZ8A 5ADPH 2IPUG 1L7IL 4FG6D 3C8KA 5EPMB 3TZVB 1SY6H 2UY3A 1J0IA 5ISZA 4WFGE 5KVMC 1ZLSL 4DKFL 1BQCA 4GRWH 1JGVH 3VRJB 3CNKA 3OJ2C 3AMLA 3UYOD 4G9DB 2WPGA 4ODWB 3TT3L 3RVTC 3WXWH 4L8BB 2O5ZL 1L0PA 1J10A 4L3CA 4C57C 5EMYA 1F4AA 1FFNB 2XNAB 3RVUC 3U46A 3B2UD 5IB4B 4JY4A 4HC1L 5IHZA 2BSED 3PWUA 4LSDA 5FCUH 1MCWW 2ED9A 3EHBD 4HD9A 3A4WA 2PCPA 1A14L 1DCLA 1LILA 5D7SL 3NCOA 1QSVA 4TYUA 4XVJH 5TGBB 1BPLB 3GIZH 3DX9B 4MD5B 2FYVA 3WDQA 4DUWA 2JCCB 5I1AA 1U8LB 1PLGH 1KTLB 4X7SH 4H20H 3NZHH 4JG0L 4WEMB 4G42A 1P4BL 4HIEB 1JV5A 1U8NB 3VIOA 5E94B 4XNUL 3WE6A 1TA3B 4M4RA 1JDCA 2FEEI 4XX6A 1C8PA 4LU5L 3STBA 2ADIB 4CN1A 4FNLL 4D3CL 1YEIH 2HKFH 4S1RL 4HXBL 2CKBB 5C0GB 1I1AD 1S9WA 2AW2A 1KLFA 4RRPG 3FQXB 4O02H 1S3KL 3I2CH 2J6EA 3HNVH 3OG6B 1KTRL 1NKOA 2MWCA 1B3XA 4HK0B 5TDNA 5DHVH 4PYHA 3AISA 1XH0A 2W4XA 3B5HA 3D2UA 3MCLH 1EZVY 4I0KA 3TVMA 5GGQL 2R56H 4DWSD 4X7FC 1CECA 3LN4B 4LSQH 1TVHB 3QCVH 2YK1H 4IHOA 5B38B 3GSQB 4RFOH 5L2KE 1A22B 3CX2A 2JCCF 4U1JA 4AEFA 3MV11 1PZ5A 4J8RB 2B2XL 5JOFA 4F7EA 2ZOKA 1E4KC 1QEWA 5CIPA 1DWFM 1VGEH 1RPQA 2EO9A 4Y2DB 4BJLA 4PLOB 5ILTL 2VH5L 4GAGH 4CU8A 4GW5A 5B39A 1S7UB 4KRPB 4TUOA 3AFBA 5GISL 1EUUA 3PWPE 2FO4A 4NDMA 2AK4E 4IIQB 4ORGA 1A1OA 4IRSC 3HNSL 4PJ5A 5FGSA 5HYSB 1RUQL 3MLUL 5A6KA 3TTYA 3BUYA 3CFEB 4G9FE 2OYKA 3LS4H 5A6LA 4E42B 3RU8L 4XZUB 1JHTA 5C86A 1JNLL 1RHHA 3UTTA 1SMOA 5DRWA 4X99B 4R7DA 1EGZA 3CZNA 1UT9A 3GMLA 5CPSA 3HCVA 3ALGA 2XFXB 3BKJH 2KZ1B 4PY8I 4NC2B 4PP1D 1W3LA 1HHJA 4LAQL 4PJXB 2WMPA 4PGCA 1JGDA 2F8QA 3L7EB 1GOIA 1BFVL 3L3KB 3CIQA 4JJ5B 1QRNE 1A02N 2FECI 2YL6A 2OR8A 5D9PA 1UXWA 4B3LA 2Y5TA 3V9FA 1KGUA 3AMGA 2FX7L 1T66C 2DQTH 3DUSA 1NEZA 1U2CA 3NH7L 4N0CC 4OZFG 2HTLD 3VM5A 5LA2A 1LO0L 4URTB 4PJDB 2D3VA 1CGUA 5EG6C 3RDTA 3RPIA 1NC4A 5KZCD 5DJAB 1AO7D 4PJ8B 3KPRD 5E1AA 5I17B 2DLFH 1A7NH 1MFNA 1CGTA 1SR0A 2EIEA 1T5XB 4MA1B 3UMTA 5C09E 3VINA 1Z5LB 5LYRA 3LKRA 4LQ1A 3BKYH 1A7PL 5C0DA 3LCYA 3AQUA 4AZ8A 1MHPL 5ABFB 4P3DA 4PJXF 4GH7B 3VFNB 2GTZB 1QNQA 3QIWD 4P46B 3FOMB 3UR8A 4Y19A 5SV3A 5F1NA 3MJ9L 2P5EA 4HOWA 2YL9A 3SCSA 4JG1H 12E8L 2WANA 5T3XE 3C87A 3GSNH 2H9GA 5AYBA 4GQPH 4X6CE 4N8VG 5E00B 4OZGE 3ZTJH 2W0FA 2YZ1A 4XCCH 4PJDF 3MUY1 1UEYA 4JN1H 2FZ3B 1MHHB 4XPTL 2IAND 1W72B 3C60D 4QF1A 1F90L 1GHRA 1I7RA 1YPZA 4KKBC 4LRNL 4YHIB 5I1DB 4P9HL 3L95A 3UYPA 4W8AA 1MJUH 2CDFA 3ES6B 4YHLL 3CMJA 3TO4D 3WV0A 3UG4A 1IEAA 1VEPA 4X7DC 1SVCP 1Q0YH 4CMMB 1HZHH 5I1LB 1W1YA 3QIUD 5A95A 5E5RB 1BG4A 4EQ2A 2W9EL 3NABH 3VO0A 1N3NA 1UH4A 1RMFH 2AJZA 4QHMB 3MODL 5E8PB 3FFCA 4S1QH 1MCJA 4PB0L 2WHJA 2K7QA 4EDXB 4JQIL 4GKSA 5HYIA 4NYLB 4MNGB 5D7KE 3D1MC 1BBDH 3H7LA 1D5ZA 1KJ2A 2NZ9D 3NGBC 1HK6A 1S7RB 4MDJB 1RJLB 1N5YL 3IDXL 5CZXD 4KI5F 1FL5A 2BY1A 3OB8A 1OINA 3RWIB 3WFDH 4YXHL 3EZ8A 4JPVL 1FG2A 1E43A 4CNIB 2P42B 1NLBH 4U3HA 2XN9B 1KIRA 4J1UB 3MMWA 2FHBA 1P6AB 3W4RA 4ZXBC 5C07B 1KFAH 5EO0B 4PGZA 1V8HA 3O2DA 1NAMA 4OLZH 1ZK9A 3B5GA 3ARXA 2X40A 1I8KA 5IROA 4AT6B 5J6HA 1H11A 1TQBB 3QEGL 3DO7B 2GW5A 2NY7H 5BRZB 4JQXC 1BF2A 3FO1A 4M8VA 5HGAB 3AC0A 4WRLA 3MLVL 4UI2A 4P2QA 3RPMA 2R8SL 4TNVK 2UZXB 4HGMA 5TFSL 2NTSP 4P5MA 2PW1A 1W9PA 5CD3B 3I50H 2F8XC 2XQBH 5JXED 3KZSA 2EO7A 4MZ3A 1P7QD 3RGVC 1JGUH 4OLYL 1S46A 2DT1A 4QRUB 5KVGL 2C1PB 5FO7A 4U1MB 3HB3D 4UOW0 5BS0D 1XGTB 4QHNB 2DF3A 1KB9K 2ICWB 1LD9A 4PSPA 3DECA 5HHME 2ZCHH 5IV2A 4NZUH 2AXHA 3W5NA 2YS4A 4D0DB