3S42A

Crystal structure of the 3-dehydroquinate dehydratase (arod) from salmonella enterica typhimurium lt2 with malonate and boric acid at the active site
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
260
structure length
259
Chain Sequence
b'NLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTIDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
molecule tags Lyase
source organism Salmonella enterica subsp. enterica serovar typhimurium
publication title Crystal Structure of the 3-Dehydroquinate Dehydratase (aroD) from Salmonella enterica Typhimurium LT2 with Malonate and Boric Acid at the Active Site
rcsb
total genus 104
structure length 259
sequence length 260
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3s42A00
4XBSA 5CPLA 4QM1A 1GG0A 4JX5A 4K39A 4LU0A 1XCFA 2YGYA 3MHUA 1H62A 4O4VA 2WKJA 4UNLA 2C0AA 4O53A 1JVNA 5G1YA 4JIPA 4N6FA 5D30A 1ZAHA 1EA0A 4JTGA 3W1QA 4NU7A 5TBOA 4XQ6A 1DHPA 3LGEA 3HQ1A 3T4CA 5AC6A 3W2JA 2E6AA 1VZWA 3EWYA 2CLEA 1ALDA 3OIXA 3P62A 5D32A 5K2ZA 1Z41A 5KZMA 1A5SA 7TIMA 4B5NA 4OT7A 2NX3A 2J9XA 4U28A 3W6YA 4JIQA 1PHWA 1T96A 1KLYA 4O28A 3S9YA 3MWAA 1JCJA 2A21A 3TFXA 2Y7EA 4ML9A 3G22A 1TMHA 1LM1A 3ABQA 2V30A 3DXIA 5K4XA 2ISVA 4Y90A 3DHDA 1AL7A 2B7NA 1ME9A 4LVDA 1FDJA 1W31A 3NQ6A 3S6DA 1XI3A 3ZWTA 4GRSA 1T99A 3CWOX 1G67A 2X1TA 1RPXA 3W1MA 3V75A 4PH6A 1L6YA 1GVFA 3L68A 1TO3A 1LOQA 2ZYFA 1TQXA 3G3DA 3THAA 2WO5A 4JYFA 3WFAA 4JTEA 3MHGA 1VR6A 1JQXA 3E9AA 3GDRA 3B0PA 1W8SA 2ZRYA 2VEMA 4WY0B 2Y6ZA 1EB3A 4NZFA 4IMDA 3L0KA 4DF0A 1W5NA 4MZYA 4FO4A 1H1YA 4RXGA 4ZQMA 3TV8A 1VLIA 2NX9A 1GEQA 2V2HA 1EWDA 3W86A 3WK0A 3LRKA 2V2DA 5FESA 3KVKA 1OABA 2Y61A 1QPQA 3LM7A 1P5BA 1H7WA 3N19B 5G2WA 3BG9A 3NR0A 4FNTA 3P5ZA 1PE1A 3HB9A 1KFEA 2JK2A 1FWNA 2ZA3A 4DO5A 1VPXA 3PS7A 3G24A 4HNVA 3GXNA 3P82A 5LGZA 2NWSA 1LDCA 4WY0A 2G96A 4K37A 4JS3A 1M6JA 3QEZA 1KM0A 4HNTA 4FIRA 3QSRA 1JUBA 3P74A 2J6XA 3EXTA 3O16A 4Z1AA 4CNNA 1KA9F 5G2HA 3O6YX 4UCGA 4WJEA 2CFFA 1K02A 1R2TA 1PCWA 1KTNA 3A24A 1VGAA 1SZNA 3NQ2A 5I3GA 1PL9A 4DELA 3JS3A 3B8DA 4DO6A 5K7JA 3W7NA 4H4IA 4TR9A 5DY3A 3W1UA 4IMFA 1OYBA 1D9EA 4HSOA 4YLWA 3MJYA 3N9SA 3CLMA 2FPTA 4N9EA 1QPOA 3NA8A 3NQ8A 2RDWA 3DFQA 2ZZ1A 3BO9A 1TTIA 1A5BA 1GVSA 3DBPA 3W7LA 4IJBA 4LT9A 3O63A 3CTLA 1VRDA 3L0NA 3Q58A 4M6VA 5EBUA 2A5HA 2Y7FA 4OWGA 1LLWA 2CLOA 4AB4A 2JKPA 4O1BA 3MO7A 3LHTA 3HPXA 2CLMA 4HT3A 1C8VA 2C6QA 3TROA 4O14A 1XL9A 3TAKA 3G3MA 2NWRA 4JTHA 4UMAA 1UUOA 1A5CA 4DPPA 3ABRA 2NUXA 4QIUA 3W7PA 3FYOA 1FCBA 5LNUA 3EX6A 1HUVA 4LV9A 3GZ3A 2VENA 2E77A 3NQCA 2EHHA 5AHLA 5HWNA 4Z1CA 1AW5A 2ZRWA 3TU9A 2ISWA 3W1NA 4PC8A 1IF2A 1HO4A 3W71A 4IMEA 2FLIA 2YXGA 3W72A 1KM5A 3NG3A 3C2FA 1EUAA 3NQDA 3MBFA 1K8ZA 3YPIA 4A21A 2CLKA 4YCOA 1CI1A 2RHGA 3NPUA 1I2OA 4MJZA 3RLUA 1L9WA 4MFEA 4O15A 3I7SA 4UTMA 3GXPA 5AHNA 3EX4A 2PC4A 5D2XA 5AHEA 1L6WA 1VCGA 3PR2A 3TA6A 2HS8A 5CGQA 3PBWA 4I7UA 1D3GA 1TPFA 5HQEA 4AWTA 2GQ8A 2ZZ7A 2OMAA 2AQWA 2DZSA 2RDUA 6ALDA 4O1CA 4O19A 4QITA 4DF2A 1IIHA 2G97A 1LORA 3H53A 3EKLA 4CCCA 4ZMGA 3EKZA 3M7WA 3O6CA 5AN7A 1JULA 1DBTA 3KRUA 4POCA 4E0CA 3TSBA 1OF6A 2DJXA 2QCCA 1XUZA 1OK6A 2PCQA 3IEBA 1NF0A 1PVNA 1L6SA 2C16A 2WV8A 4OBTA 5G4EA 4MYXA 4FF7A 3N2XA 1GTHA 3EX3A 3GNNA 3M44A 2B7QA 2H3DA 3W2NA 4LC8A 4WQ6A 1H61A 1AL8A 5DCBA 2F84A 3FYPA 3PG9A 1VLWA 3W7RA 4NJKA 4JYEA 3EWBX 4UMCA 5HNRA 2XFWA 4JD4A 4JN6A 3E0IA 4S1FA 2QAFA 2YW3A 3QZEA 4AH7A 4CNOA 5K3VA 4LRTA 3PWAA 2E68A 4WXYA 2W0UA 3N2MA 3ELFA 4IX2A 4TX9A 3R12A 2WJZA 1J4EA 1VQTA 3PB0A 3VCRA 1ML1A 1I2RA 3W2KA 5EKYA 2A6NA 4P61A 5BRBA 3G1HA 4PEKA 1W3TA 4XKYB 1F05A 3G1XA 1XBYA 5F2GA 5D02A 1Q6OA 2P0OA 1I8JA 3M43A 4JTTA 4O13A 2QDHA 3T55A 2X1SA 2VEPA 2VEIA 5G1TA 4DF1A 1BKSA 4M6QA 4BI7A 4JX4A 5G4WA 1O95A 2DZVA 3ATZA 5DBUA 1YDOA 3VFLA 3TUUA 5D2WA 4WOZA 4NJIA 2ZFAA 4IMCA 1VC4A 3BVJA 3C2EA 2H90A 4QJ1A 3FA5A 4OQVA 3A5FA 1EUNA 1A50A 3W23A 4UTIA 4Z0JA 1O94A 3TMQA 1ZFJA 3B05A 1AW2A 2EAWA 3G1FA 4M19A 5BW6A 1HTIA 4NNBA 3NNTA 4I7VA 4XTIA 1RV8A 4QQ3A 2BSLA 3HG2A 4JR5A 2JGYA 3IGXA 1THFD 3C2VA 3QMTA 3W7GA 3FEMA 5HMSA 2QCGA 1W5OA 3NM1A 2RKXA 3A5VA 1XM3A 3G8RA 5LZLA 1EPXA 4K7YA 3EB2A 2QCNA 3SECA 2Z0IA 3I6RA 3PY2A 1IGSA 1TIMA 3UWYA 3S1UA 3DFPA 1G6CA 3UY8A 3IRDA 1WOAA 3LBMA 3LHVA 1H7OA 3PUDA 4QNWA 4UTLA 2R91A 3S5YA 3LCXA 1LRNA 4CCDA 2Y70A 3MYOA 3OVQA 4FHAA 4IMGA 4CQ8A 1LYXA 4MFDA 1SZFA 1WDWA 2V2CA 1G4EA 1JQVA 1OFPA 3G1VA 2WSYA 1SUXA 1SU5A 1FWRA 3IIZA 1ZAIA 1H7RA 3DKLA 5D33A 4ZZ9A 3TAOA 3M5VA 3CIWA 3M5ZA 1V7YA 4RR4A 3PUOA 3C56A 2FDSA 5K9DA 1H50A 3LV6A 3USBA 3FKRA 4GBUA 1VS1A 5D04C 3CEUA 2QUVA 3LB0A 4IOTA 3QYQA 4FXRA 4O11A 3EWXA 3MI2A 1X6UA 4M7TA 4UFMA 2V0TA 3C52A 3VNDA 1SSGA 4AHPA 4K38A 1OFAA 1JRBA 3IVTA 3STFA 1IXQA 1YADA 1KBJA 1WBHA 1KM4A 5EL1A 2DU2A 5I3FA 2X2GA 3QRHA 1M5WA 1K3UA 3BW3A 3MP4A 3A9IA 5IBXC 4UTTA 2BX7A 1OK4A 3T40A 3N73A 3W7CA 3MP5A 1FCQA 2YFOA 4XKYA 3F4NA 4MKNA 3PB2A 4JTIA 2B7PA 3GAYA 3LCWA 4LUJA 3W22A 1B4EA 3HPZA 4K6AA 2QUTA 4ADUA 8TIMA 4Z1DA 4FNQA 2E6DA 3LHZA 3STCA 4OGZA 5C5YA 1TSIA 3UWWA 4FNRA 3UXDA 3FKKA 5C54A 5DELA 3R13A 1ZCOA 1UASA 2YYTA 1B9BA 3T7VA 4HIBA 2BTMA 1QAPA 1QOPA 5D2TA 1U5JA 4RK8A 4BWLA 2AAMA 4Q32A 3UY7A 3T78A 4JICA 1H7XA 2TMDA 3S5OA 4N6EA 3CU2A 3VE7A 5L6UA 3G0XA 2PURA 5F1UA 4GC4A 2ZZ5A 4N02A 1SQ7A 5CG7A 5GVJA 4G1KA 3S5ZA 1ONRA 2DZTA 1H63A 3RF9A 1SW3A 5BOOA 1MSSA 1ZHAA 3F1QA 3QJAA 3SSJA 4O4WA 5LNVA 3O05A 1P1XA 1W37A 3P61A 2E5BA 3MMTA 4WOQA 1DQXA 1XUUA 1FQ0A 1IXPA 4GXMA 1E51A 1OFRA 1TPC1 1VCVA 1Z44A 1AG1O 3L21A 3HG3A 4UTJA 4JNMA 4AHOA 5LGXA 3LXBA 3G0UA 3Q37A 1ZALA 5CSSA 2CWNA 4JYDA 3CWNA 5A5WA 1ICSA 1SW0A 4NJGA 1MEWA 1KFJA 1TTPA 4PL2A 5F4SA 3TXVA 3UD6A 4Y9AA 3LCIA 1B57A 4FB7A 1TJRA 3GIYA 3R89A 3UPWA 4CLMA 1HL2A 3IVUA 4RX0A 3UPBA 1F7BA 1VCFA 3L66A 3P67A 2JBMA 1TPH1 3TX9A 2VXNA 2P10A 3P8IA 2X1UA 4H6KA 4O8RA 2G5WA 2J27A 1K03A 3SY5A 3S0CA 2C18A 1A5AA 1G4SA 2ZA1A 2VFIA 2FQIA 2Y89A 4JTJA 2OZ0A 2Q8ZA 1RQBA 3KOFA 4TMBA 2EPHA 2C19A 5KMYA 3TXZA 4AAJA 3W1LA 4MZ1A 3P5YA 1ME7A 4RKAA 3NL5A 4BR1A 3KFTA 1H5YA 3HMJG 1OX4A 1P4CA 3STEA 1S3HA 2HTMA 3MI6A 4PTNA 2YCEA 4WD0A 1YLVA 1YTDA 2B7OA 3W7MA 2NUWA 3U8GA 3DFOA 5LSMA 3KRSA 1WYIA 2CLFA 2ZRUA 2WSRA 5FF4A 3LTYA 1ME8A 2FTPA 3I7RA 1FDYA 4Y8FA 2PRHA 1Q45A 4UXDA 3LTPA 1YTEA 3UZ5A 1XDMA 2O7SA 1JCNA 3LCLA 1OFOA 1QFEA 3BW2A 3W74A 3SGZA 1T8XA 2E6YA 1VH7A 3NVTA 5D2VA 4UR7A 1T0OA 4O54A 1GZGA 3L0GA 2GJNA 4AWUA 3GYEA 1VHNA 2A4AA 2HS6A 2Q8LA 3NQAA 3PVFA 4MLJA 3BK0A 4JTLA 2BWGA 2GVJA 2WNQA 3CIXA 2VFFA 4ADTA 1RQEA 4RV8A 4ZL1A 4CNPA 1OYCA 1O60A 4GUGA 4FNPA 1N7KA 4ZQOA 4WY0F 4NX5A 2R94A 5BMXA 1TPVA 2YFNA 1K8XA 4O52A 4O0KA 3B0UX 1SZEA 3DH7A 1JCLA 1F6PA 3GK0A 4M5PA 2E09A 2E1DA 3P60A 3NL3A 3W7KA 4WUIA 4K8EA 5KSWA 4AEOA 5J5DA 1DKWA 4TU1A 1MEIA 3TJLA 5L9FA 4EF9A 3FOKA 3P81A 2G95A 3GDLA 3L67A 2DZPA 5DN1A 3TQ0A 1KFBA 2A6LA 3RNDA 4XUGA 4LUIA 3F4WA 1KTCA 5IBXA 1KW1A 5HUOA 2XN2A 4OU1A 1KLZA 1WAUA 2NV1A 3M5YA 3EXSA 3TW7A 2IQTA 4O17A 4KFPA 1LCOA 3LCFA 4AWSA 4LC6A 3HOJA 3UNDA 3NL6A 5D38A 1G69A 3UZJA 5ABTA 1QR7A 3CQ0A 3L2IA 1FWTA 5EY5A 3NQMA 3FLUA 2FPYA 1O5KA 2PRMA 4AF0A 1RZMA 3M6YA 3PG8A 1O4UA 2RH9A 2Y62A 3ATYA 3WJXA 1C29A 3CC1A 1FBAA 4OV9A 3ZWSA 6TIMA 2CZDA 3C8FA 3ZS4A 5CKSA 3W3OA 4BI5A 5T26A 3K30A 3EXRA 4GJ1A 4NJJA 4X22A 4LVAA 1WX0A 1KFLA 3TKFA 5E0KA 5AHFA 3NPWA 2JKAA 3TDFA 3QSTA 3O06A 2CZ5A 4Q33A 3VI2A 3KRZA 4JEQA 4JY9A 1TQJA 4DQWA 1SFLA 3BG3A 3NEVA 1I45A 5E93A 4LTSA 4NT0A 5D2YA 3W85A 4CQ9A 2GOUA 3GX9A 5CZSA 1TTJA 3WJYA 4UNKA 1OFDA 4RZ5A 2NLIA 2Z6IA 3LHWA 2A85A 4LS1A 1YPFA 3W70A 4DEFA 3BV4A 3W1PA 4HPJA 1LBMA 1TREA 3NPXA 1G7UA 2ZRVA 5DY2A 4M7SA 4MOZA 1XBZA 2CLLA 1LZOA 4GFSA 1QO2A 2NV2A 4RCXA 2GPTA 2OJPA 1RR2A 1KM1A 3LLFA 2V5LA 2J24A 3WK2A 4N4QA 4XTDA 4K7VA 3SIZA 3B04A 1S5VA 3KVMA 3QC3A 2BXVA 4O16A 5F1VA 4FNUA 4BK9A 5AB3A 3BLFA 1F73A 3W2MA 5I3IA 5DLCA 4O0ZA 2XN0A 1UCWA 2ABBA 2A7PA 2Y7GA 3DHFA 4HN4A 1Y0EA 2VELA 4EF8A 3RFAA 2ZQ0A 4K8HA 4AVFA 2QF7A 2ZTJA 3IIPA 5DBTA 4PODA 5K9XA 3GDKA 1F5ZA 3RK8A 1OFBA 2FB3A 3MUXA 4BFAA 3B4UA 3G18A 1F76A 4A22A 3MYPA 1TYGA 4Z1BA 2QUUA 1ZAJA 1LROA 4IXXA 1U83A 1VJIA 5F2MA 1ICQA 4O18A 2J9ZA 1DJNA 4A2SA 4PA8A 3NZRA 1AK5A 1FUYA 2WQPA 1W56A 1XBVA 3LLDA 4J9JA 3HGJA 2Q3RA 2ZZ2A 1OX4B 2I1OA 4Y96A 4QNEA 2ZZ4A 3M5XA 4NNAA 5AYZA 1I2NA 3KVLA 1HO1A 3SGUA 5I3KA 3CM4A 2A0NA 1OJXA 3BG5A 1SO3A 1XC4A 3QPZA 4K36A 4LVBA 4JXCA 2DZWA 4NNCA 1TV7A 2NXHA 4W9TA 5AHIA 1VHCA 4RZ4A 5F4WA 4O12A 4GUHA 2VOMA 4YL2A 4ZQRA 4GWEA 3KAOA 4PCFA 1FCUA 2KZHA 4JTKA 3NDOA 2NX1A 4O1AA 1JJKA 2QCLA 3B06A 4O10A 2V81A 1UJPA 1B4KA 4EWND 5KTLA 1UUMA 4IPJA 2JKEA 4HNNA 4NQ1A 3LRLA 1AW1A 5FF0A 3OBKA 4R7JA 4FXSA 4S2CA 2P1FA 4WX2A 3I68A 1WQ5A 4RZ6A 3M1ZA 3MBDA 1LOSA 3H55A 5H2ZA 2OT1A 2QCMA 1EWEA 1HG3A 3DAQA 3QPYA 3W9ZA 1DJQA 3GAKA 3RLVA 1HFBA 2WSQA 3M41A 2E6FA 3IIXA 3BGJA 1FY6A 4PL1A 3G1DA 3B03A 1YXCA 2GVGA 1YYAA 4S2BA 2Z2UA 2V82A 2ZZ3A 3OHIA 3WK1A 4MUZA 3NM3A 5FEXA 4NVTA 3LOTA 3UWQA 3UYCA 2YW4A 3GVGA 1J2WA 3DGRA 3THQA 3LCGA 4JGDA 1NFBA 5D09A 4ZQPA 3DI1A 2TRSA 3HPSA 5CZTA 1Z48A 1W5MA 5FI8A 3A22A 5HINA 1GVQA 2Q3OA 1GJPA 1R46A 5LKYA 4EVZA 1H7PA 4Q4KA 3DKJA 3LI0A 1TCDA 1B3OA 2GQ9A 4N2YA 1YPIA 4UTWA 1WV2A 4AMAA 4CCEA 5EPDA 1PS9A 3O1NA 1DV7A 1V5XA 3NQ7A 2C13A 1JCXA 4MZ8A 4BWLC 4QISA 5CPMA 3QMSA 5KITA 5AYXA 4HHPA 1W5QA 1SO5A 3HGSA 4O1DA 1JRCA 2QCDB 2PRLA 1X8FA 3TQKA 4IPIA 3SJ3A 3W83A 4Z0SA 4LY8A 2V5BA 1MEHA 3R2GA 1GYLA 2GVLA 3C4UA 5H91A 3LDVA 4JX6A 3QQ0A 1H7NA 1JUEA 3L5MA 1VYRA 4DXVA 1H1ZA 1K7XA 3TQVA 1UBSA 3TNOA 1SFJA 3ZR4A 4FEZA 1TPWA 5LHFA 1PHQA 4D2JA 3S5NA 3LTSA 4KWWA 3Q2DA 4O57A 3W7OA 3GLCA 5K9CA 4BI6A 2B0MA 3NPVA 1GVRA 3PBYA 3MP3A 3NAVA 4NXSA 3FFSA 4C1KA 4LW7A 3FIGA 4FX8A 1TTQA 2FIQA 1KBIA 2YR1A 2ATMA 4KWVA 4R33A 1K7EA 4X2RA 5AYYA 1LTDA 2FB2A 3PAJA 3AO0A 3FJLA 3KXQA 3N14A 1M7OA 2OX1A 3B0VC 1XXXA 2H8ZA 3TH6A 3GDTA 2UV8G 3HJZA 4LRSA 1I2PA 3F03K 1BWKA 3C2OA 1KV8A 3I65A 2QCFA 1Z42A 3TFCA 1IXNA 3BGGA 2VFGA 1FXQA 2R8WA 1DOSA 5FF2A 4QAIA 2CLIA 2YPIA 4ZVJA 4OE7A 3O8AA 2HSAA 4NXKA 1WA3A 2YZRA 2JGQA 4HSNA 1SZGA 2QAPA 3E12A 1OF8A 4XBKA 1F6KA 1R47A 1DORA 1W54A 2VFDA 3W76A 4L4MA 4UTHA 2ZBTA 1GT8A 1P0NA 2PE4A 4ICNA 5D03A 3C2RA 2VEKA 1F74A 3KX6A 2VC6A 2YSWA 2QCHA 3P80A 1ZY9A 3TMLA 3LI1A 3UXAA 1SO4A 3QW4B 4IGHA 4LVGA 3S8HA 1LP6A 1JR1A 3G1SA 2X30A 3L65A 3O6DA 3SZ8A 2EF9A 3PM6A 1K8YA 2H3BA 2F7FA 3GNDA 4NX0A 2QJIA 3W7IA 1QMLA 1VYPX 2H8XA 3EX1A 4ZQNA 5HULA 1KM2A 3DENA 1H60A 3SR7A 4ZQCA 1KM3A 4MY9A 2QJHA 1JCMP 4UUIA 1SPQA 4UFLA 1G4PA 4X9SA 5A8GA 5LNSA 1YXYA 3E49A 1TB3A 5TQLA 3WK3A 3QM3A 5K4ZA 3LHUA 1QOQA 2W6RA 1LLZA 4HPXA 4LOCA 3M0ZA 4JDBA 1QO5A 3KHJA 2XN1A 2Z1BA 5DXYA 4N9BA 5CZJA 2EGZA 4IWWA 1QDSA 4E2DA 3W7EA 2C14A 2DJLA 4QSHA 3W2UA 3BLIA 3L9CA 3SI9A 2A7RA 4NZJA 1GOXA 3PULA 2YYUA 1G7VA 3U2OA 4MVAA 4A2RA 4UR8A 2DZUA 4IX0A 3HF3A 3GR8A 4UTWC 1M7PA 1W5PA 3R5EA 3QH2A 1NEYA 3OVRA 1NVMA 2ATSA 2W79A 2C3ZA 3QMRA 3DFTA 1A53A 3HG5A 3W75A 2Y85A 1EP1A 4I9AA 1FDZA 5CZ0A 3T44A 4ADSA 1XBXA 3STGA 3PSVA 3LERA 2CW6A 2NUYA 3R8RA 4JTSA 1W1ZA 5EA9A 4GUIA 1XDLA 3UQNA 1PIIA 4DO4A 3WJWA 4HKPA 3IIOA 3TE9A 3W7DA 3KVJA 1RVGA 3HIJA 2D73A 4X3ZA 2C15A 1K7FA 3P84A 5C2XA 4NUWA 3PBUA 5HJLA 3M47A 2E5DA 4L4LA 4LS2A 3G1YA 1KM6A 4TO8A 2NXGA 4JY8A 1OX6A 2DORA 3ABSA 1GYNA 3TR2A 5J5RA 4H3DA 4RLIA 3D0CA 4ORMA 2CLHA 3TC6A 2NXIA 2ZRZA 2AGKA 4WZHA 1QPNA 2QDGA 2QR6A 2Y7DA 1TRIA 4RJEA 1ADOA 1VYSX 3UWUA 2QEZA 4PFMA 2WPBA 1DVJA 5AOUA 1CW2A 3N3MA 4UFHA 1BTMA 4FIQA 3NOEA 1TPUA 4LNYA 2V9DA 4UTUA 5IM51 1YDVA 3W1RA 1EEPA 1QPRA 2ABAA 2Z6JA 3CPRA 5CPOA 3GKAA 5HWMA 3DFSA 1NAL1 1GVOA 3E02A 1IIGA 2I14A 3W2LA 3CB8A 3NL2A 1EIXA 1OYAA 1NF7A 3IGUA 5FF7A 1OX5A 4FX7A 4DBDA 3M9YA 1FWWA 3C0JA 2A2IA 4DPQA 2VKZG 1AMKA 3UWVA 3HO8A 4AF0B 4KFOA 3DI0A 1SO6A 3LRMA 5LNRA 1PV8A 5CPNA 1R2SA 3CT7A 3DZ1A 4MYAA 5HUPA 3TSMA 1KFCA 2RDTA 3C6CA 3P8JA 1ZNNA 3O15A 3DFNA 1XKYA 4JDYA 1L2UA 4E38A 1ZJIA 4YWIA 1X7FA 1KFKA 3W73A 4P2VA 2VFHA 4LWWA 3S42A 2QCEA 2WNZA 5C55A 4N9CA 2BLEA 4YCPA 3W07A 1YDNA 2VFEA 3GR7A 5SWUA 3HG4A 3AJXA 4IQLA 2R14A 3LX9A 3N9RA 1JCYA 1TPDA 1Q6RA 4R34A 4GE8A 1P0KA 4YXGA 3M16A 4Y6GA 3EX2A 3VKJA 1Q3NA 1J5TA 3QW3A 4UFIA 3VE9A 1UB3A 4UFKA 2A1YA 3GDMA 2Y88A 3ZFHA 5D37A 3L5LA 4BF9A 5HR6A 3TC7A 1TRDA 5FEWA 2ZTKA 3MHFA 5I3JA 3RU6A 3EWWA 3HGRA 4O50A 5U7SA 3C61A 4MY1A 2YDAA 5KZEA 1Q6LA 4UIOA 3LHYA 1N8FA 1GQNA 1F2JA 4UC5A 1NSJA 4UTKA 5BNKA 2I9EA 4IXHA 3S1WA 1OFEA 4M6PA 1TV8A 1W0MA 1TV5A 2QCDA 5FEZA 1LBFA 4TMCA 1MZHA 3MW7A 2TYSA 5FF3A 1S5TA 4U4MA 5AC7A 3IV3A 3ABOA 4N4PA 3NO5A 2O7QA 5E1QA 2RFGA 2TSYA 4HNUA 4Z08A 1QCWA 2GJLA 4MIMA 4ALDA 1MO0A 1YXDA 2ZZ6A 4LVFA 4A29A 2J9YA 4UMBA 1O5XA 3LXAA 3W1TA 3FS2A 4A3UA 1LBLA 1TPEA 4MJMA 3G8EA 2CZFA 1TJPA 1W3IA 3PF3A 4FX6M 4XWUA 4XZ9A 5HR7A 3WJZA 5DCDA 4NJHA 5EMUA 3L5AA 4KKXA 5TIMA 5I3HA 1EP3A 3SW6A 2ZA2A 2OCZA 3W1XA 1D3HA 1TPB1 2C1HA 1KV5A 1SR9A 4RXFA 3OEXA 4GUFA 3W88A 2CU0A 3H54A 4JTUA 5LHEA 4UTTC 3PBVA 3GKFA 1EP2A 3TCEA 5AFDA 1JUKA 1MXSA 5F2LA 3OVPA 3OA3A 4FNSA 3IIVA 2GUUA 3NQGA 5D05A 5HWJA 3W1AA 3TK7A 2FJKA 5DXXA 3OG3A 2NZLA 5DCEA 1QWGA 3A21A 3BLEA 1OVDA 3MI3A 2X1RA 5KINA 3W7JA 3QQ1A 3EWZA 3UWZA 2WNNA 1BEUA 2FPVA 3NGJA 4GUJA 1DQWA 2QKFA 5KZDA 1EX5A 3FJ6A 1Q6QA 4KFNA 3QF0A 4TIMA 5G2IA 3LBCA 5F4XA 1SSDA 3Q94A 1S5WA 4IUOA 3S1VA 3QFEA 5G5IA 1DL3A 5FEPA 4DBEA 5LNWA 1H51A 3PC0A 1QNVA 4UFJA 3DU0A 1WXJA 4C1LA 2YX0A 3O07A 5AC8A 3TSDA 3U6WA 4LS0A 3GB6A 3INPA 3P7YA 3PUEA 2TPSA 3ANYA 1X1OA 2J88A 2CZEA 3WJSA 1W3NA 1I2QA 2FFCA 3PSWA 5C6MA 2DZXA 4EIVA 2ZRXA 5CSRA 3G0SA 5MHBA 1I4NA 3S1XA 5F2IA 2ISSA 3JRKA 3CEPA 1WBJA 1WOBA 2LLEA 3JR2A 3TW6A 2GQAA 1FXPA 2BZNA 4ORIA 3RMJA 1X1ZA 3W7HA 3V1PA 4LV4A 4GNJA 4CQAA 1C9DA 3SFKA 1SW7A 3NQFA 1GWJA 2HMCA 3BW4A 1XFBA 3LXCA 3IVSA 5AHMA 4AHQA 3NYZA 4ONVA 3W87A 3HBLA 2A7NA 1ZENA 1N55A 2Y63A 3G1AA 4JTFA 4OV4A 1LRTA 3NQVA 1LRQA 1OHLA 1ICPA 1R30A 1GPWA 3N34A 3BARA 3BPWA 1YTKA 3EEGA 3IGSA 2DP3A 3E96A 1PCKA 2QJGA 3GXTA 1RD5A 1BWLA 1OFQA 4WXZA 3TIMA 3W7QA 1IXOA 1R2RA 3TJXA 4I7WA 2OT0A 1FCVA 3HGOA 3I7QA 5EYWA 2ALDA 3CHVA 2WOQA 1CX9A 1OG0A 3LV5A 4MLRA 1GG1A 4OHQA 1RQHA 3LCHA 4YMZA 3NXFA 4N9DA 1G4TA 4AXKA 3NZ1A 3EWUA 5BMWA 1GTEA 4R53A 5U4NA 2ZCGA 1FX6A 2E5CA 2V8ZA 1KTBA 3W84A 4E2BA 2H6RA 2ZDRA 1LOLA 3NQEA 2EKCA 4MY8A 2X16A 1FWSA 2B4GA 4EOUA 4MPQA 3A23A 3C3NA
chains in the Genus database with same CATH superfamily
4XBSA 5I03A 5CPLA 1EJUC 1XLJA 3GVRA 3DESA 1KXVA 1J96A 3AIBA 4WSJA 4UOZA 4EPKA 1F4HA 1JPMA 1XLBA 4O53A 1NFPA 3AIEA 4N6FA 1F8IA 1YNYA 4JTGA 1KGXA 5TBOA 2GJXA 1TKKA 3HQ1A 1PDZA 1R38A 1TJ0A 2RGMA 3OG2A 4YU1A 1TVLA 3EWYA 3W29A 4L80A 1VBHA 3OIXA 1XF0A 1QJWA 1PIGA 1A5SA 4XX6A 3BAJA 2ZC8A 4UTFA 4B92A 1DPMA 1T96A 4O28A 4B2DA 1IR2A 3MWAA 1ITUA 2A21A 3TFXA 1DJXA 3ABQA 1MW1A 2V30A 2PP3A 3DXIA 5E6ZA 1HN1A 2VDGA 3MUAA 3WL1A 4KRTA 3DHDA 2DVUA 3GVQA 1UD3A 1W31A 1DP0A 1XI3A 1T99A 4D6IA 4ASTA 3W1MA 4NZ1A 3MSGA 4AXNA 5HMEA 1LOQA 2ZUSA 4TTGA 1TQXA 3THAA 3HFTA 1EPVA 4JYFA 5KETA 3KOZA 3A12A 4XD3A 3E9AA 3GDRA 3B0PA 2OKTA 2Y6ZA 4LYKA 2XVNA 3OZOA 1UOZA 1H1YA 3VXGA 1E6ZA 4UZUA 2NX9A 3WK0A 3GW0A 3T6CA 1KB3A 3KRBA 1T5AA 2G3FA 4JQ3A 7ODCA 1P5BA 3GR4A 4QR6A 1C8QA 5HQLA 3BG9A 2Y2WA 2OPJA 1PE1A 1KFEA 1FWNA 2ZA3A 2TAAA 1EJVC 3UCCA 2POTA 3MVIA 3DHUA 3P82A 5LGZA 5EMYA 1TX0A 1F3TA 2XG9A 3QEZA 4FIRA 2OYLA 4AIUA 1UA3A 2YKKA 1AD1A 1ISYA 4CNNA 5G2HA 3O6YX 2BVYA 1K02A 1K9FA 4W89A 1SZNA 1YDYA 4C65A 3VC5A 4CQDA 4YTSA 3E0WA 2UY5A 3B8DA 1WE5A 5JBFA 3LPPA 3W7NA 4TR9A 4OBRA 4IMFA 1OYBA 1D9EA 1P6WA 1CLVA 3EWDA 3FYYA 2Z7KA 3NA8A 3NQ8A 4Z2LA 3DFQA 1TJ2A 4PYSA 1GVSA 2VCAA 4IJBA 2REQB 1DWGM 4NAFA 3Q58A 4M6VA 5EBUA 3SY1A 2VVSA 4Q8PA 3VCNA 4ROQA 3MO7A 5D9MA 3WQPA 4QFUA 4J28A 1S46A 3FDGA 1EDQA 1QOXA 4BEQA 1EBGA 2CLMA 4HT3A 3VDHA 4O14A 3FXYA 3TAKA 4HPHA 3D3AA 3CL7A 3P2VA 4UQDA 3WNOA 3ABRA 4QIUA 3W7PA 3GH7A 3OVGA 5AHLA 1EFZA 2RAGA 4Z1CA 4HNOA 1GEHA 2ISWA 1DWFM 4F79A 3W00A 2YXGA 3W72A 4S3KA 1LQ0A 3NG3A 2J4GA 1U1UA 1NDYA 2WHJA 1CI1A 3NPUA 1KGWA 3RLUA 3N6JA 4PMQA 1L9WA 4R85A 1W2PA 1MXDA 4UTMA 3GXPA 4BEUA 3TA6A 2VQUA 3PBWA 4I7UA 1TPFA 3KTCA 2GQ8A 2YCLA 4JFVA 1CGTA 3VX1A 1S2UA 4Z2HA 4O1CA 1VKFA 4QITA 1UZHA 2XGIA 4DF2A 4K3ZA 3T2QA 3UWEA 1LORA 3H53A 3HV8A 2IS7A 1PSCA 3LM3A 2OKOA 4ZMGA 2J7FA 1JULA 3KRUA 3RR1A 3VDBA 3W0KA 3TSBA 1A5MC 1XUZA 1UR0A 3ITTA 1WZAA 4DNHA 1JDDA 3U4AA 2C16A 2WV8A 5G4EA 3BAYA 1OCQA 1MFVA 2HK0A 2NVCA 1N8IA 4DLFA 2G3MA 4LC8A 4NG3A 2PDIA 1AL8A 4PMUA 3DCPA 3FYPA 1VLWA 1LL7A 4MADA 3V0TA 2WZIA 4JN6A 3E0IA 4AH7A 3LPGA 3QZEA 1NWUA 4KQNA 4LRTA 3PWAA 3RLGA 2GJXB 4PCTA 5HQMA 4YJ5A 1B2YA 1I2RA 1UP3A 1ZZMA 1AH3A 4LUYA 3C0LA 3K2GA 3G1XA 3IPWA 5F2GA 4F2UA 4L9XA 1UROA 4AEFA 2X1SA 3H2EA 2VEPA 3WF2A 2XH7A 2VEIA 5G1TA 1XYAA 4H04A 3T9PA 1TE1A 3VZXA 4PB4A 1BKSA 1AODA 1R3TA 5DBUA 1YDOA 3VFLA 1I1XA 3HZ3A 5D2WA 1HJVA 3WFLA 4KCTA 3BVJA 4XSMA 6ENLA 3OHMB 2D0GA 3WO8A 4OQVA 3A5FA 4Z0JA 4PUKA 3ZR6A 2V5JA 4M19A 1V03A 1YMYA 2BSLA 4D8ZA 2JGYA 3IGXA 3QV9A 4DWDA 3C2VA 3QMTA 2OGYA 2BG5A 2WZHA 5E6YA 3PTMA 1BVZA 2RKXA 5I24A 4ZR8A 1EPXA 1IV8A 4I8DA 3SCNA 3SECA 1IGSA 1RY8A 3UWYA 3S1UA 4KEMA 4JFUA 5FJUA 1NP2A 4L4PA 4MTVA 1UUQA 1TVPA 3GXIA 3ZVIA 1WOAA 4GINA 3WH9A 2OSWA 3S5YA 3LCXA 2YCLB 2PDNA 3C5QA 4CCDA 3UZZA 1P0DA 4FHAA 2XIIA 2Z4GA 1LYXA 4ACYA 3W02A 4DWSA 4OUEA 5GJPA 3AHYA 2V2CA 4ZB5A 1JQVA 4TQTA 2WSYA 4ERIA 3E38A 2QDDA 1FWRA 3IIZA 3RHGA 1VIZA 5J04A 3BJTA 5D33A 4RR4A 2PBGA 3CHEA 3PUOA 1WDPA 5K9DA 4GBUA 1VS1A 3CEUA 3EPMA 2QUVA 4IOTA 3IJ6A 3S6TA 1X6UA 5C0QA 1SSGA 2PBOA 1YADA 3QVQA 3ITXA 1RJRA 3ARPA 5EL1A 1OG6A 4IISA 2X2GA 3E2VA 3QRHA 3MP4A 4F40A 1Y5XA 5IBXC 1DJYA 1D8CA 4AD4A 3HTWA 3N73A 3OBEA 3MP5A 3VNKA 3W7CA 4YYCA 1FCQA 2YFOA 2EQDA 3GTFA 1B3ZA 3PB2A 2B7PA 3OTRA 1CCWB 3HPZA 8TIMA 2E6DA 3LHZA 2VL4A 5C5YA 1TSIA 4FNRA 3UXDA 3FKKA 4ZFCA 5C54A 2WZTA 4KBXA 1DWAM 2BTMA 4HIBA 4GXWA 3BAIA 1ISZA 4Q32A 3E5BA 4S39A 3UY7A 4JICA 2TMDA 4S3JA 3S5OA 3ANUA 4LXFA 3CU2A 3VE7A 3G0XA 1M53A 1BD0A 4H6QA 5C70A 3TYUA 4XD5A 2ZZ5A 1FWGC 3WUFA 4G1KA 2GGHA 1T41A 1XLHA 3PWGA 3H2CA 3QHOA 1UR3M 1CXFA 5LNVA 3N25A 2AKMA 1XYFA 5D8WA 3BGAA 5ABFA 2E5BA 1DQXA 1A3XA 1MNSA 4DZHA 1E51A 1OFRA 1E9LA 4EAYA 1UR2A 1Z44A 4MF4A 1AG1O 3K1DA 3VYLA 3HG3A 4UTJA 4JNMA 5BYWA 4XZIA 5AC5A 3G0UA 3TWBA 3PZTA 3MPGA 3Q37A 2W9MA 4EXAA 5FJTA 2ALRA 4QLJA 1ICSA 1ZU8A 4NJGA 3NFUA 1MEWA 1KFJA 1XH2A 3EZ4A 4JHMA 5F4SA 3UD6A 1B57A 1TJRA 3R8HA 1CECA 4MKVA 1W1PA 1P7TB 4HNLA 3IVUA 4RX0A 1IE7C 3UPBA 1PYFA 3B3DA 1VCFA 4HBKA 3A3HA 1Y5VA 1TPH1 3S1GA 3OLEA 3SURA 4H6KA 3WMSA 2J27A 1L8PA 2W3ZA 1E40A 4H1ZA 4BQ5A 1ISVA 1A5AA 1G4SA 2Q8ZA 3COTA 5ABFB 3KOFA 1E4NA 1KCKA 4TMBA 3OOQA 1J0IA 5C71A 4HK6A 3MZ2A 3DUGA 4H41A 1XCXA 4AAJA 2HE8A 3W1LA 1U33A 2OB3A 4RKAA 3AIVA 3NL5A 3RCMA 4BR1A 1WZMA 1J18A 1H5YA 3C8NA 5JBEA 3R11A 3STEA 3HMJG 1FKWA 3R6IA 3BAKA 3QGKC 4WD0A 4PCPA 5HBFA 2B7OA 3W7MA 1UZDA 3U8GA 2ODOA 2R82A 4C7GA 3KOWA 4CD6A 5LSMA 2V63A 3EGJA 2CLFA 3BQ5A 3VD5A 1AZ2A 3LTYA 2ZXQA 3T81A 1RH9A 3VA8A 1XIIA 5LA1A 4L1XA 2PRHA 3LTPA 1YTEA 2DT3A 3LCLA 3AU2A 4FAMA 1A0CA 1Q85A 1ZUAX 2ACUA 3NVTA 2EPMX 5M17A 1T0OA 3V4BA 3RJXA 1QHOA 3L0GA 2GJNA 1DJWA 3GYEA 1VHNA 2HS6A 4AWUA 2Q8LA 3NQAA 1P0BA 2C91A 4MLJA 3FVMA 2WNQA 3CIXA 1V08A 2BNJA 3DYPA 1RQEA 3E2RA 4RV8A 2XWEA 1OYCA 1QASA 2YL5A 3W53A 3H2NA 1HJXA 1EQCA 1TPVA 1K8XA 2VZUA 2BHUA 3TONA 1F6PA 4PTVA 3FA3A 4M5PA 2E09A 3NL3A 4K8EA 3SCTA 2WM0A 1VPYA 3FV9A 3GDLA 4QE5A 1QPKA 3RJYA 4KERA 3SBFA 4H9MA 4HCHA 3GU2A 1WAUA 1QI3A 4AWSA 3CJPA 2WWDA 4Q4QA 3UNDA 1UR9A 1G69A 1E0TA 3BAXA 1Z32X 2XIBA 3L2IA 2GGIA 4PMOA 3LGGA 2O9PA 5IHRA 3NQMA 3FLUA 4GY1A 1RZMA 3SRHA 3PZUA 4GO8A 2RH9A 2Y62A 1M7JA 2AGTA 2AAAA 2PCEA 1UMLA 5A6MA 2J25A 4GJ1A 2F2KA 1WX0A 4NRRA 3TKFA 5BRQA 5I3DA 5A6LA 1GHRA 4WGHA 3WLIA 3SUUA 3EEZA 1AVAA 2CZ5A 4JL2A 4DQWA 3BG3A 5CC6A 3NEVA 5E93A 4NT0A 3LUTA 4CQ9A 3EDDA 3WJYA 3ITGA 4RZ5A 1OIFA 1YPFA 3BV4A 1TREA 5DY2A 4M7SA 1W91A 3AMGA 4GFSA 1RHCA 4RCXA 2QIWA 2OJPA 1KM1A 3LLFA 4WDXA 3QR3A 2J24A 1DWIM 3WK2A 4N4QA 3MC5A 4XTDA 4K7VA 3SIZA 1HKWA 1S5VA 2EEXA 4O16A 1Z9AA 3QZ6A 3ZT6A 1SR0A 3QZAA 4BK9A 3CHFA 3BLFA 1CXLA 1TWWA 3W2MA 5I3IA 4FF5A 2ZUUA 1ZGDA 1HP5A 1YNQA 2ZXBA 2W27A 3PZ9A 4GIRA 4WK9A 3N6QA 1OBAA 3RFAA 3QY6A 2QF7A 4AY7A 4EANA 3HM7A 4AC1X 1FWCC 1XV8A 3GDKA 2C0HA 1QXLA 4XAZA 4L9YA 3B4UA 1F76A 2WKLA 4A22A 4HMNA 4HPNA 4Z1BA 4HK5A 4JL1A 4C6OA 3M0VA 3PZIA 3P3BA 5HA7A 3VIJA 4AU0A 3AXMA 2DH3A 4PA8A 3NZRA 1PX3A 1FUYA 2YDRA 3LLDA 1UPMB 1OX4B 2VZVA 2PEVA 4B4HA 3OGSA 1I2NA 1HO1A 2A0NA 4AISA 1OJXA 4PCNA 4MUPA 1OD8A 1KD0A 4NILA 4HZ8A 4JXCA 3OP2A 2DZWA 1U5HA 3H4XA 1VHCA 2O56A 3IGHX 3U3HA 1MQQA 4YL2A 1FCUA 4JTKA 4CQCA 3VO0A 1RD6A 1JJKA 1GJUA 3AHXA 2VM8A 1FHLA 2V81A 3B0YA 4WSHA 3WBXA 1UJPA 4IL2A 1M41A 1R3RA 1K70A 2O4MA 4P7LA 4EWND 1EC9A 2VDHA 1SM9A 4KRZA 4IPJA 8CGTA 1EJ7L 4Q8WA 2FDMA 3BCFA 4PBEA 2EPOA 3DC0A 4NHVA 1WO2A 3N2TA 3OBKA 5JIWA 4S2CA 2P1FA 4EX4A 2IUZA 4DYKA 4WX2A 4GI8A 2J7BA 3FSTA 1QATA 2QCMA 2JE8A 4OUIA 1HFBA 1F9CA 3GG1A 1W1TA 5FKYA 4IIHA 3W28A 3SCUA 2YB4A 1W17A 2GVGA 4HJWA 1YYAA 3ES8A 2QMJA 3N4AA 3CHDA 2JALA 3UZWA 1FH9A 3LOTA 1AQHA 3UWQA 1CGVA 3BSMA 4D8AA 3SCVA 1MDRA 1JZ3A 4ZQPA 2TRSA 2QGYA 5CZTA 3TOPA 3BANA 1W5MA 3A22A 4ATWA 1BTCA 1KXTA 3GG0A 4B4FA 1ZBKA 4XAYA 2PWUA 3TLQA 4BQ2A 4Q4KA 3TYZA 4EVZA 2IKGA 2XPKA 3TYBA 2C13A 1JCXA 3TNBA 4BWLC 5IXEA 5KITA 5AYXA 2BGQA 1SO5A 3W25A 1JRCA 4JHOA 1I1WA 3GXDA 1QHPA 3N9KA 1N2VA 5CGMA 3LDVA 1XIGA 2KAUC 3JUGA 1H7NA 1REQB 3L5MA 4MHBA 1H1ZA 5I0DA 3DG7A 1K77A 3TQVA 2XU2A 1OZQA 3UJRA 3OQEA 3CH0A 3SQSA 4JN7A 1OCBA 2IPFA 1TPWA 4D2JA 1YE6A 4BA0A 4O57A 1BHGA 3T2OA 1TR9A 4O0QA 3W6MA 2PB1A 2BFGA 5A3HA 4RUBA 3UJSA 3WH5A 4MWAB 3PBYA 4QLKA 4S38A 4NXSA 3FFSA 1NDVA 2XIOA 4JKLA 2QUMA 1EYEA 3KS5A 1CENA 3HN3A 4AD3A 4R33A 1K7EA 5AYYA 1IT8A 1LTDA 5LIXX 3AO0A 4ML4A 3KXQA 3N14A 1M7OA 2GK1B 3FXGA 1JZ4A 2GGEA 2UV8G 1BWKA 1KV8A 2ADAA 2QCFA 1Z42A 1Q7QA 1J6PA 1VFSA 4D6EA 2X2YA 2EXOA 1IXNA 3CL6A 2VFGA 1FXQA 3WUBA 4ZVJA 4OE7A 3O8AA 4EAMA 4E2VA 4HSNA 1VD6A 1OF8A 3PJWA 3L4UA 4FOKA 2ZBTA 1GT8A 3CHCA 3SUSA 1P0NA 5E9XA 4OIFA 1HP4A 1I9CB 5D03A 1R86A 4MWAA 5GNYA 2BGNE 4C6LA 5BXSA 1ZY9A 3UXAA 4IGHA 3S8HA 1H41A 4HNCA 1C8YA 1E0UA 3O6DA 4HMEA 3PM6A 2QJIA 4R88A 1QMLA 1VYPX 4UOJA 4ZQNA 4QG9A 2MUCA 4TX6A 1H60A 3VNLA 4XK2A 3MJMA 4DM2A 4ATDA 1G4PA 1K9EA 4FLRA 5LNSA 1G94A 1WKEA 4QQUA 5TQLA 3BLPX 3VKKA 3O7UA 4GH3A 3WMBA 3WK3A 5K4ZA 2J78A 1QOQA 1LLZA 4LOCA 4JDBA 3KHJA 2I16A 2P3EA 4N9BA 4ROPA 3VILA 2QPXA 2YA0A 4DX3A 4QSHA 3K4DA 3L9CA 4DVOA 4MAZA 2ZX8A 2PP0A 2WHMA 1GOXA 3VOHA 4UR8A 1KO0A 3WBYA 4Q4PA 2FZBA 2NSXA 1A53A 3HG5A 2Y85A 1XLKA 3T44A 1XBXA 3PSVA 1W1ZA 2ACSA 4GUIA 1XDLA 4FR6A 3LK6A 1AZ1A 4GQGA 1XW8A 4BF7A 1PIIA 1LL4A 4P7NA 4M1BA 1J0YA 2I7GA 3TE9A 3ZJ8A 2DVTA 2D73A 1K7FA 1LJYA 2ZX5A 1UWAA 3KW3A 4LS2A 4HZ6A 4ZSUA 2NXGA 3BV7A 4AVOA 4ORMA 4LUTB 4WZHA 3EOSA 1MRAA 1JNDA 4RJEA 1ADOA 1VYSX 1MQPA 1E0XA 4GFIA 4PFMA 1GKPA 1VJZA 4PMZA 3T8QA 1LWHA 1TPUA 4LNYA 2V9DA 5IM51 1QPRA 2Z6JA 1ONXA 3N15A 3ZOAA 1DXIA 3NL2A 1OYAA 4OOZA 2WCSA 3IGUA 5FF7A 4MMWA 2VRKA 2H9AB 3WLHA 3WH8A 2A2IA 2P88A 2VKZG 2PAJA 3WF3A 3S83A 3B97A 1BAGA 1MW3A 1M3UA 3ZMRA 3T05A 2BVTA 1OY0A 2GYIA 3KZSA 3LG3A 5LNRA 2Z28A 3CT7A 3A4WA 4HHLA 3CUIA 1KFCA 2RDTA 1JF5A 3P8JA 1H2JA 2R24A 1L2UA 2ZIDA 4I5XA 2WJEA 4E38A 5LXXA 1ZB5A 3K4WA 4YWIA 3TTYA 3G6LA 3W73A 7PTDA 4A3YA 4V33A 5CC5A 3MTWA 1NOUA 5GJMA 2WNZA 3ARZA 4YCPA 4R9XA 4OVXA 3HQNA 5SWUA 4B9ZA 2WB5A 5AECA 3HG4A 4QXIA 2HK1A 3WMCA 3N9RA 3KDNA 1TPDA 1E1CA 2YOCA 4GE8A 1TV2A 3GFYA 4Y6GA 1XYBA 5KZ6A 4M6UA 1Q3NA 1JAKA 3AWOA 4UFIA 5EFDA 1E56A 1IZKA 1Y65A 2A1YA 3L5LA 4LCQA 1XWYA 5A69A 1FP8A 5HR6A 4S3BA 1XQLA 5DMYA 3R79A 3EWWA 1TWIA 5U7SA 3C61A 4NIRA 3K13A 4IP4A 1E5JA 2CBUA 4UIOA 3B4YA 3LHYA 4GVGA 2X0HA 4GNKB 1ISXA 3FDKA 2F61A 3F2DA 2CWXA 1NSJA 4UC5A 2WVUA 3H21A 4HQVA 3S1WA 1PUDA 3OPSA 2BV9A 2CNCA 1LBFA 3H12A 3MW7A 2TYSA 2ZVIA 1YW1A 3WF4A 5AC7A 2DQWA 1OADA 1W2VA 4IFOA 1XRTA 4GIYA 3QKEA 4N4PA 2Y4SA 2X41A 3LBOA 1S39A 5ENLA 4BHYA 1EO7A 2PS2A 2OSXA 4CU7A 1YXDA 2ZZ6A 4LVFA 4B9YA 1ADDA 4A29A 2OG9A 1E4IA 1O5XA 3BUVA 3WQEA 5CG0A 4XWUA 4DAIA 1JGIA 2P8CA 4H7CA 5EMUA 1EGVA 1QK0A 5I3HA 1A5NC 1D3HA 3AHZA 1KV5A 1Q5MA 2XUCA 1HXJA 3FY1A 3OU8A 4W4QA 4JEJA 4UTTC 4Q8TA 1EP2A 1QI5A 3UNTA 3GU1A 1D3CA 1Q6FA 5E70A 3HU7A 4FNSA 2GUUA 3PZVA 7ENLA 4QCEA 1E55A 3TN4A 3Q65A 6XIMA 3MI3A 4W8BA 5C9UA 2QYGA 2ACRA 3ZYZA 3P0WA 1KQYA 1V6UA 1WB0A 3NGJA 2CITA 4GUJA 4LX4A 2ZUWA 5KZDA 3FJ6A 4KFNA 4TIMA 2JQXA 1SSDA 4JCMA 4PMXA 4IUOA 4O1FA 3R1ZA 5AC4A 5FEPA 4YIWA 3PC0A 1VB9A 3DU0A 4C1LA 3O07A 3CLWA 4U3CA 4X60A 1A80A 2Y5SA 1A47A 3GNXA 2FZ8A 2TPSA 1JPIA 3OZPA 3ANYA 1X1OA 2J88A 3MKCA 5D8ZA 2CZEA 4N42A 3V5FA 1W3NA 3WQCA 3PSWA 3K8LA 4HN8A 5CSRA 3G0SA 3JR2A 3APGA 4P8WA 3ENLA 2HJPA 2YBTA 3GUWA 3RMJA 1CXIA 2VUNA 3W7HA 5BOFA 5CPSA 1TWSA 3SFKA 4AZ5A 2POZA 2HMCA 3BW4A 1XFBA 3IVSA 5CEWA 4ONVA 4QDWA 3E2QA 1N55A 4JTFA 2Y63A 3GC5A 1SJDA 1OHLA 1XDJA 1AH0A 1PO9A 1UP0A 1DJZA 3N34A 4CEXC 1E9IA 3TEVA 1PCKA 2QJGA 2INFA 1RD5A 1BWLA 1OFQA 2VRQA 4H7ZA 3AMKA 5C7VA 2V69A 5HK4A 4I7WA 4BJHA 1T8QA 2WZEA 4G6CA 3BXWA 3CZEA 1EHNA 5AKQA 1OG0A 3AUOA 5I07A 3ZVHA 4X61A 4AXKA 2PDYA 5BMWA 1CXKA 1H3GA 8XIMA 1XIHA 3ES7A 3W84A 4RNIA 1SGJA 3RPMA 2ZDRA 3H2AA 3NQEA 1RXOB 2X16A 1FWSA 1P43A 3C3NA 4WGXA 3AZSA 4AIBA 4AFYA 2Y0FA 2I5QA 1TFVA 4K39A 4E4FA 3MHUA 1H62A 3E6EA 3SCWA 1XGZA 4KETA 4GX9A 3VOJA 3PBGA 3VIFA 5FJRA 5CGTA 4XQ6A 1DHPA 8A3HA 3JU2A 4QTGA 4JQ1A 5AC6A 2P8BA 3A6OA 2E6AA 1JGMA 5G4HC 3T08A 3GHRA 3UGVA 3P62A 5K2ZA 1DWHM 3RCYA 2G3NA 2X40A 3TC3A 1ISWA 3FW6A 4JKMA 3PZGA 2NX3A 2J9XA 3RUBL 1PHWA 4RL3A 1P6BA 3WLTA 1BF6A 4P5UA 4PN2A 2ISVA 4I6VA 1JDEA 3SIMA 4CKQA 4GYJA 1K6WA 2Z00A 3NQ6A 3S6DA 2W66A 3O9NA 3CWOX 4JKKA 1G67A 2PTYA 3OZYA 3MANA 3PPGA 1VR6A 1QI2A 1W8SA 2OR2A 2ZRYA 2AKZA 1EB3A 4NZFA 1YEYA 4IMDA 4DF0A 3H8AA 1XSIA 4FO4A 4RXGA 4ZQMA 4HTYA 4CNSA 1EWDA 3LRKA 1JDAA 1OABA 1DXEA 2Y61A 3LM7A 4ZO7A 1H7WA 4NASA 4M51A 1VPQA 1OT1A 1QVBA 2WCAA 2XISA 2XIQA 2BY3A 4FNTA 3GC4A 4DO5A 2JK2A 3AYTA 2VR4A 1VPXA 3R0DA 3CV2A 2XM2A 3IAPA 2NWSA 4K37A 3UR8A 3VDCA 2PGEA 4JS3A 5DMNA 4HNTA 4H9ZA 3QSRA 4BQ4A 4QDPA 4IQDA 3P74A 1EDTA 3EAUA 3THDA 4Z1AA 1JNEA 4UCGA 1H49A 4WJEA 1HJSA 1BGAA 1VGAA 5I3GA 3P14A 4LBRA 4V1XA 3A3WA 1PL9A 1UH2A 4DELA 4IQEA 6PTDA 4W84A 4DXXA 3VIOA 4YLWA 3N9SA 3CLMA 2FPTA 3NVDA 4N9EA 3FK4A 5FCZA 1NARA 1HL8A 1QPOA 4U5KA 2CBVA 3UW6A 2F8QA 2PZ0A 4J3VA 3W7LA 3Q4DA 2UY2A 3L0NA 4CNTA 2Y7FA 3PANA 2JKPA 3URQA 3ORWA 3WDHA 2YIHA 4JBRA 4MDPA 3LHTA 4AUBA 1C8VA 2C6QA 4WDUA 4JTHA 5GNXA 4UMAA 3I4KA 2YCKX 2I5GA 1UUOA 1A5CA 5REQA 4TOQA 4AZGA 2HWGA 2CKSA 4P7QA 3WD3A 1V0KA 4GVFA 3NQCA 2EHHA 3GS6A 2PF0A 3VKDA 1XD0A 5ABEA 2WMKA 5FJJA 2VGFA 3TU9A 1XLAA 1GVIA 2OFJA 4IMEA 4IIFA 3SO7A 5DO8A 3N13A 5A8NA 3GW3A 3NQDA 1K8ZA 3YPIA 1NIUA 4Z42C 1V3HA 1OEPA 4AW7A 2RHGA 1OZMA 4XV0A 4MJZA 2WKGA 4XIMA 4MFEA 4O15A 3UCDA 4DJFD 2Z2BA 5AHNA 1TMQA 3BURA 3GE7A 5D2XA 3M6DA 3PR2A 2J62A 5CGQA 2G50A 4RE3A 3VMNA 1OC5A 5IOBA 2ZZ7A 4H8VA 3VOGA 3SN4A 1FTXA 2RDUA 3P0XA 1IIHA 2C79A 5TAOA 3LNPA 4CCCA 2FTYA 3EKZA 4TV5A 3M7WA 3O6CA 5AN7A 1DBTA 4X63A 3CZLA 2ZUVA 5D4YA 4E0CA 1OF6A 2PU1A 4QDMA 4DBSA 3IEBA 1NF0A 4MWAD 5D9NA 4PRRA 4PRTA 4N7QA 4GACA 4AG0A 4WQ6A 1WUEA 5DCBA 2F84A 2BOFX 3BOLA 4NJKA 5CXPA 1KBBA 5HNRA 2HISA 4JD4A 3QC0A 5HAOA 3U4FA 4S1FA 2YW3A 5K3VA 2PDMA 3II1A 4CNOA 2E68A 2EBNA 3R94A 2W0UA 3WY1A 3N2MA 3R12A 2WJZA 3PB0A 1KCXA 2XVPA 5DMMA 1ML1A 4IL0A 2A6NA 1OWQA 4PEKA 1W3TA 4XKYB 1F05A 4U3AA 1O12A 1ZBVA 2HVMA 1R5YA 4KGJA 5H1WA 1RK5A 1W6TA 5D02A 2P0OA 1I8JA 1GCYA 3M43A 3T55A 2ZOXA 1XFCA 1UD8A 2OWCA 1I75A 4BKNA 4BI7A 1LL6A 3IWPA 2D22A 1O95A 2DUZA 5TF0A 4WOZA 3AMCA 4NJIA 2ZFAA 4IMCA 1VENA 4JCLA 3TW9A 1KRMA 3C2EA 5C2GA 4CU6A 4QJ1A 3FA5A 3TYCA 3VINA 3FSUA 5JMUA 3GTIA 2NQZA 1A50A 4INFA 4FK9A 2QULA 2C1GA 1ZFJA 3B05A 4AD5A 2X8RA 2EAWA 1HTIA 2GSEA 3U2EA 4XTIA 1RV8A 2XVLA 3HG2A 4JR5A 4F0KA 5CPQA 2FTWA 4KS0A 1JL8A 2DSUA 2WSPA 1W5OA 1XM3A 5LZLA 1DJIA 2ZADA 3C2YA 3EB2A 4C90A 3O3RA 2W4XA 4S3DA 2YL6A 3ARYA 1G6CA 1EZWA 3LHVA 3BDKA 2R91A 2C1IA 2PTXA 1OIMA 2YCIX 3OVQA 4CQ8A 3UP8A 3U7BA 4MFDA 1WDWA 3I4EA 1G4EA 3H26A 2FZ9A 4PTXA 1E0WA 1WP6A 7XIMA 1SU5A 1H7RA 1GK8A 3WEZA 3UPMA 3N2CA 4LAKA 4ZZ9A 2HZGA 4ZEPA 3OO2A 3M5ZA 9CGTA 1QTWA 1V7YA 4CD8A 1EGZA 1DIOA 2FDSA 4F2TA 2UWFA 2HXUA 2ZC1A 1O7AA 1H50A 3A64A 3LV6A 3USBA 3PFRA 3OLDA 4WDTA 4XZNX 1QRQA 3QYQA 4FXRA 2GGGA 1IEXA 1R9ZA 1SJCA 3DYOA 2W91A 1BPLB 1VFFA 3AQUA 2PC8A 1BQCA 1OFAA 1JRBA 3USZA 4HYWA 3IUIA 1EJSC 1REQA 1WBHA 3TN5A 5GPRA 2TODA 5I3FA 4B3KA 1K3UA 3BW3A 3KEHA 2FH8A 4UTTA 5DT7A 5I2UA 2JFEX 3AXHA 1R9YA 3IAQA 4NY2A 4XKYA 5AYBA 3AU6A 1UR4A 3K46A 2F6XA 2E9LA 3GAYA 3LCWA 4LUJA 1B4EA 4K6AA 4Z1DA 4P7RA 2A3CA 2ZXDA 3STCA 4OGZA 5FAJA 5LYRA 4WCJA 3GBEA 1B9BA 4HGXA 4JOMA 5AYIA 1U5JA 4RK8A 2V3FA 3PPCA 2AAMA 4BWLA 3KCOA 4N6EA 3CV6A 4V1YA 3QXBA 1ODZA 4PMJA 5F1UA 3NOYA 1FWIC 4N02A 2PWGA 5GVJA 3GG7A 2CPUA 2XSXA 1XLLA 1LWJA 4K2SA 4D1IA 3RF9A 2YBVA 2GDUA 2R1LA 1ZHAA 3MKVA 3SSJA 1NWTA 3O05A 4EP8C 1JXJA 4PULA 5I5RA 1UWQA 5PTDA 5I00A 2CIPA 2EG8A 1HL9A 1UW9A 3UG8A 2OU4A 3LXBA 3LSBA 4OECA 1ZALA 4TVCA 2CWNA 3CWNA 4Q8NA 4GQBA 3R43A 1U22A 2DY3A 4Y9AA 3LCIA 3QOKA 1KCZA 4A8IA 4CLMA 3VGBA 2HBXA 5H8UA 1F7BA 2JBMA 4F66A 2P10A 3P8IA 3V5OA 2G5WA 3H4GA 3C86A 2QGHA 3SQMA 4A8RA 2FQIA 4JTJA 2OZ0A 3DFHA 3W82A 4PB5A 2C19A 5KMYA 2YXOA 1AJ2A 3TXZA 1UHVA 4MZ1A 2WJDA 1JYXA 2BGSA 4EXBA 1K4HA 1XLGA 1OX4A 1S3HA 4AEEA 3MI6A 2GOKA 5C9WA 4PTNA 2YCEA 1YTDA 2D20A 4GABA 1UMYA 3KL5A 3KRSA 5JIPA 2E7FA 4DJFC 2ZRUA 4H7VA 3UCQA 5FF4A 2I57A 2OYMA 2FTPA 4IFKA 5JH1A 3I7RA 4Y8FA 2PPGA 2CHNA 2Z25A 4GGHA 1Q45A 3POCA 3AOFA 3VAVA 1JCNA 3WQVA 1OFOA 3VMPA 3BW2A 1ITQA 3W74A 4CD4A 4NSBA 3CPUA 3MSDA 2DQXA 4Q8MA 3U2ZA 2O9TA 1ZP4A 4FALA 4O54A 1R3QA 2EJAA 1GZGA 1NOFA 4RDYA 3GHTA 4NI8A 3WEOA 4A6GA 3BK0A 2GVJA 2VFFA 2OZ8A 4ADTA 1VFLA 2BHYA 4HYRA 2FMOA 3M0XA 2J8FA 4GUGA 2G0WA 4ZQOA 3G6MA 2AL2A 5LA0A 4NX5A 3WDRA 2P0IA 5E09A 3GK0A 4Q4RA 2E1DA 3MDWA 3TJLA 1MEIA 1MVYA 4OTKA 3FOKA 1RCXB 4RW3A 3UXLA 3L67A 2DZPA 3B9NA 1KFBA 1XD1A 4G9PA 4RNFA 5IBXA 4DWSB 1KW1A 3G1RA 2XN2A 2FGBA 2NV1A 3NUKA 4CCZA 4KFPA 3UGRA 2HVOA 4LC6A 4M8UA 1YKWA 3L23A 3W24A 2D3NA 3L4TA 5D38A 1RVKA 3VGDA 1JYNA 5ABTA 1XIDA 3CQ0A 3OJGA 1GOKA 5EY5A 3K8MA 3BLKA 5MKGA 4QX4A 4GVIA 1TA3B 2FPYA 1SZRA 2PRMA 4AF0A 3E74A 4DN1A 4QG8A 4HTBA 3PUGA 5A6KA 1C29A 2VEGA 4R7OA 3CC1A 1FBAA 3BCJA 3ZWSA 4AX6A 6TIMA 4IMAA 3C8FA 3ZS4A 2DPEA 3IJ7A 1Q8JA 1KFLA 2ZICA 5DEZA 5E0KA 2JKAA 3QSTA 2CLPA 3ME3A 4Q33A 3VI2A 3KRZA 1TQJA 1SFLA 2ZVRA 3NSXA 4WLCA 1I45A 4FLQA 4AC7C 5D2YA 4JZ5A 5B7ZA 3A3XA 3MMDA 2GOUA 1G01A 3I6TA 4UNKA 4QCFA 1OFDA 3LHWA 4DEFA 2X42A 1NP0A 1LBMA 4F2BA 2WHKA 2V5KA 1UWRA 2GPTA 2V5LA 1V4YA 1J0JA 1E4MM 1ESWA 3FAXA 4M0XA 4Z2JA 2VWTA 5DLCA 2YA2A 4KWSA 2D2OA 4O0ZA 1QNSA 1UCWA 3DHFA 1JFXA 4HN4A 2PU0A 5IDIA 3WYZA 4EF8A 4AZ6A 4GCXA 2ZTJA 2DT1A 4PODA 4OFCA 5K9XA 2V3EA 3CQHA 2CHOA 1B3XA 4YHGA 2FB3A 2BS9A 3F2CA 3RRXA 2QUUA 5CSUA 4O18A 2J9ZA 3AHVA 3AZTA 4GY7A 3MUCA 1TCMA 4XSLA 1PZ2A 1QI0A 4L6OA 1W56A 2HNHA 4J9JA 1RUSA 3ZIZA 4D6JA 1ITCA 1V3JA 5C8BB 4WKHA 1PZ3A 4RE2A 2ZZ2A 5BWFA 3H7VA 4C6PA 2I1OA 1F61A 4D8LA 1JDFA 4XZHA 1QI4A 3SGUA 3CUJA 3CM4A 3FJ4A 1XR2A 2X1IA 1SO3A 3BG5A 4K36A 4NNCA 3KHDA 4O8AA 2NXHA 4RZ4A 4DJDC 3ONBA 2DSWA 5CJ5A 4YTQA 3GRIA 4F3HA 2PDGA 1Z8AA 2KZHA 3FJNA 1J79A 4J40A 4O1AA 3VD3A 5BZAA 5KTLA 3ZLHA 2JKEA 4GC3A 1R85A 5IDZA 4HNNA 3D3FA 4UB9A 4CVUA 4MNJA 5M5DA 4R7JA 1VBGA 1RBLA 4AWEA 2CEQA 2PP1A 2P76A 1M68A 3I68A 4AD2A 4RZ6A 3M1ZA 3ECQA 2D23A 1LOSA 5H2ZA 1HG3A 3DAQA 3W9ZA 1XLDA 3GAKA 3RLVA 3T2PA 5JXQA 3IIXA 1S3TC 9XIMA 1FY6A 2XIJA 1BSLA 2R1KA 3JZEA 1CBGA 4GI6A 4H9TA 2Z26A 1YPXA 3EB4A 2V82A 3QTPA 2ZZ3A 4QSFA 1Q6EA 2AQOA 4H9YA 4NVTA 4L6DA 3GH5A 2YW4A 1Q8AA 1J2WA 1HIZA 1UKTA 2Z2AA 3LCGA 1NFBA 4ZB0A 4FS9A 3FEQA 2X05A 3DI1A 4BY3A 2IKIA 1KWGA 4JTDA 1Z48A 5AY7A 4PRWA 2DV0A 3OLGA 4JTQA 4GZEA 4Y7EA 4GPNA 4H6EA 1R46A 1TCDA 1B3OA 3QY8A 4QEEA 4UTWA 4AMAA 4CCEA 5EPDA 1V3MA 1XRFA 2UY4A 4C5ZA 3NDYA 5CPMA 4PEEA 3VOIA 3HGSA 1UWTA 4LYPA 4O1DA 4QHRA 1W9BM 2ZX9A 1MW0A 4IPIA 1CLXA 3W83A 2J79A 3R2GA 3UERA 3WLQA 2J7EA 3KBMA 4DYEA 1W9XA 3QQ0A 2HEJA 1M03A 1MNZA 1JUEA 2ZE3A 2PLMA 1K7XA 3VTRA 1S1PA 5JVLA 3GQYA 1IEVA 2VHLA 4RDZA 3N17A 1SFJA 2OO0A 1RALA 3ZR4A 2OQHA 1W9PA 3U57A 2QV4A 2PUZA 3GLCA 5K9CA 1F4AA 2B0MA 3NPVA 1GVRA 3WDQA 4FI4A 2D1ZA 1EGMA 4KWUA 4AZCA 4GO9A 2D0HA 3J7HA 3QN3A 1OCJA 4GZJA 4LW7A 3FIGA 1BRLB 4FX8A 2GLKA 4LFYA 2OEKA 1KBIA 2J77A 2NLYA 3U48A 3FJLA 4M29A 1BG4A 4HJFA 3B0VC 3RPTA 1B3YA 2H8ZA 3TH6A 3HJZA 4LRSA 1XH1A 4Q4MA 4PTWA 4WKAA 4LPCA 3F03K 3K1GA 4R9OA 1YIXA 3CB3A 2R1MA 4XB3A 4ACZB 3L7RA 2G41A 4MB4A 2QUNA 1NQKA 1B30A 3WQDA 3GVWA 4KESA 4QAIA 2CLIA 3WKZA 1FHDA 3PN8A 2HSAA 4NXKA 1AA1B 1SZGA 2DW6A 2QAPA 3LU2A 4UZSA 3BAWA 4XBKA 1DORA 3LA4A 2Q01A 5LXEA 3W76A 3TZNA 4UTHA 4LBUA 1UZ4A 2PE4A 4PMVA 4JQAA 3WNMA 2VEKA 2Z1SA 1FFRA 5CH9A 2QVHA 4Q7BA 3RYSA 1XJBA 2PDLA 5MF5A 2UY3A 3QW4B 1K8YA 2F7FA 3GNDA 4NX0A 1GHSA 1VFUA 3KLLA 5TD4A 2WCGA 1DIKA 1KM2A 3WNKA 3DENA 2OSYA 3HURA 4D71A 4ZQCA 4MY9A 2NQ5A 2QJHA 5GJNA 3AMDA 1SPQA 4X9SA 3GDBA 5EGRA 1O1ZA 1YXYA 3E49A 1XGDA 6CGTA 2BY1A 3U2CA 2GFTA 1IT0A 2NQHA 4Q4SA 4HPXA 3M0ZA 2G4JA 4DWSC 1QO5A 4KCVA 1Q4NX 2QV5A 3V1HA 5CZJA 2EGZA 3NIYA 1QDSA 3AS0A 4E5TA 3W7EA 4XO6A 3GXMA 2DJLA 4WR3A 1E73M 4LB4A 4PZVA 2R1PA 4NZJA 3PULA 3SN0A 1VRXA 2OEMA 2DZUA 2OODA 3LMYA 3HF3A 4IX0A 1J11A 3R5EA 3ABXA 1NEYA 1DWJM 3DFTA 5CZ0A 3STGA 2F6KA 2IKHA 2CW6A 5I06A 1U5VA 4AD1A 3UQNA 1W8GA 4HKPA 3IIOA 1PTGA 2XZ7A 3TLLA 4AQLA 3EDJA 3W7DA 1V0MA 4NZ3A 1RVGA 3BH4A 3HIJA 4X3ZA 2C15A 4HA0A 4NUWA 4OJYA 1UR8A 4L4LA 1KM6A 1KXHA 2VRJA 1L8NA 3ITOA 4JY8A 1GYNA 3TR2A 4FOUA 4V15A 4H3DA 1JYVA 2NXIA 2ZRZA 2AGKA 2PLKA 4PUMA 4QEHA 4Q3MA 1TRIA 1MZRA 2QEZA 1JIBA 2WPBA 4W5ZA 5AOUA 5C2CA 1ELSA 3N3MA 3TJIA 1E1EA 1W32A 4US5D 5J8LA 3PHAA 5CPOA 1TWDA 5HWMA 2WLYA 3L2MA 3E02A 1IIGA 2I14A 3KWSA 3RX2A 1EIXA 3VCCA 1OX5A 2OO6A 1XH0A 4S3EA 1FWWA 4L9ZA 3KCLA 5FACA 3VPLA 3UWVA 5E0FA 3HO8A 4MDOA 4IF2A 4KFOA 1EQPA 4L1GA 3JW7A 4XISA 3KBJA 1EF2A 5A6BD 1CLKA 4Q7NA 2BOGX 1KFWA 3DFNA 1Y7VA 1ZJIA 1V8EA 1X7FA 2DSZA 3M0MA 3FCPA 1ZBWA 1TVNA 2G4FA 1QWKA 1RBAA 3A9BA 1W3LA 2CERA 3W4RA 2VTFA 4H9XA 4NL1A 3VIPA 2BLEA 2WQDA 4IIBA 4PBFA 7A3HA 4S3AA 3GR7A 3B8UA 4IQLA 2R14A 3LX9A 4XUYA 1FFQA 1Y8BA 3T0BA 4YXGA 3M16A 3XIMA 3CO8A 3ARTA 1PZ0A 1JDCA 3H6OA 3IACA 4UFKA 3WG6A 1J2BA 3XINA 1A5OC 2Q8XA 1HKJA 4EK7A 2C71A 3PZQA 1TRDA 4QGCA 3DEQA 3UF9A 4O50A 3VNZA 2X09A 1I6NA 1Q6LA 1N8FA 3E0VA 3MSYA 1F2JA 3CZGA 5BNKA 1X6LA 2I9EA 1UPPA 1OFEA 1J10A 4M6PA 1T40A 2WVVB 2FVMA 5FEZA 2ASHA 1MZHA 4M1RA 4LUSB 1EBHA 5FF3A 4HZMA 3KTSA 2YCJA 4U4MA 3IV3A 3ABOA 4YTRA 3UBPC 3OZMA 4D6FA 4X0NA 1GKQA 2O7QA 1CGUA 2RFGA 3QLDA 3GTXA 1UIOA 1QCWA 2B31A 2GJLA 4A3HA 4MIMA 3TP4A 3DC8A 1AQMA 4C6KA 2BHZA 4J3TA 2NQ9A 1W1IE 4IGSA 4W7VA 3CBWA 3WQ6A 4MJMA 3G8EA 4KPLA 4LUTA 2CZFA 3PF3A 1M7XA 1QHZA 4NJHA 2GJPA 1UIPA 3GZAA 2NQLA 1ADSA 3NCOA 2OCZA 4RE0A 1TPB1 1UG6A 4ZOAA 2PMQA 2C1HA 4RXFA 1XCWA 1KR1A 4W85A 3W88A 4JIIX 3H54A 4C6BA 4FSAA 4JTUA 4B3LA 1JUKA 5F2LA 5HNTA 4RDWA 3LPOA 2V5CA 3OA3A 1XYZA 2G3IA 1UD2A 3VK5A 5HWJA 3EA1A 3SCOA 3W1AA 2FJKA 5DXXA 1UH3A 1XIMA 3CNYA 1OGGA 2X1RA 3VD7A 2WBGA 1VEPA 3ERPA 1R9XA 1IGWA 4Q7IA 1CGWA 3AXIA 3DFYA 1GOMA 1EX5A 3KTXA 5G2IA 9RUBA 4REQA 3PK7A 4A35A 3QFEA 5AVNA 2NW0A 1BXCA 3N12A 4DBEA 4H00A 4UFJA 3RM9A 5AC8A 4LS0A 1D7KA 1UA7A 3PUEA 3WL0A 3WJSA 2FFCA 2DZXA 4EIVA 1QNOA 2ZRXA 3LLXA 1TIWA 4TXEA 3S1XA 1TV4A 3JRKA 3CEPA 4HHMA 2DDXA 1FXPA 2BZNA 1W3JA 1C3FA 3IK4A 4LV4A 1K1DA 1CZ1A 1SW7A 2HRWA 3LXCA 1EXPA 2ZE0A 5AHMA 1A3HA 2VCCA 3UR2A 3NYZA 1D7FA 3W87A 3HBLA 2DZAA 2BVWA 1LRTA 3NQVA 1LRQA 3CK5A 1GPWA 2DH2A 1EC7A 1SFSA 1RA0A 1YTKA 3IGSA 1R6WA 1XG4A 2DP3A 2PGFA 4WXZA 3V5CA 4XKMA 3TIMA 3DGBA 3MU7A 2H9AA 3E0FA 1OD0A 1XPYA 1EIBA 3FA4A 1GVYA 4OHQA 4H8NA 4MNLA 1RQHA 3DHPA 3WCZA 1FKXA 1G4TA 3NZ1A 1U30A 3S3GA 3EWUA 3POHA 4Q8VA 1KRBC 4R53A 5U4NA 4BZYA 2E5CA 2V8ZA 4E2BA 3MCNA 2H6RA 3VKCA 3RG6A 2FHFA 5RUBA 2PSNA 1LOLA 3EOOA 2EKCA 1F3XA 4GI4A 3QY7A 3UT0A 2IXVA 4JTCA 1FVPA 3KWXA 2BOEX 4FXJA 2YDQA 4QM1A 4JX5A 4F0SA 3MY9A 3QR0A 1XCFA 2VX4A 2YGYA 3QGVA 1VP5A 2WKJA 1BLIA 1JVNA 3WBEA 3VZZA 1FWEC 4IIEA 5D30A 2GJRA 2R1NA 4GG9A 1S38A 3RLHA 1DJHA 3T4CA 3HFYA 4C6DA 1I60A 1E0VA 1V93A 1BWVA 5CSYA 3QHMA 4ZOEA 1YQ2A 4NP7A 4KW2A 1E9YB 2CLEA 4E4UA 4LBSA 5D32A 1KBKA 1UD5A 1Z41A 4U2YA 7TIMA 4B5NA 3DYMA 3W26A 4OT7A 4U28A 3N2BA 4JIQA 1KLYA 1RLCL 3S9YA 4PBGA 4ML9A 3G22A 1CPUA 1TMHA 4C1NB 1E6QM 2DEPA 3F5JA 5K4XA 3FGCB 1LQ2A 1O1HA 4GXPA 3TCSA 3B8IA 4Y90A 1AL7A 2B7NA 1ME9A 3NZQA 3RM8A 1VIWA 5ABGA 4LVDA 1AFSA 4ENLA 3ZWTA 4GRSA 4HMCA 3U5UA 5D9OA 4HPGA 2X1TA 4AZHA 4PH6A 2XVKA 3L68A 4IG2A 4S3FA 3TTOA 2ZYFA 2PDHA 1ZJBA 3G3DA 2WO5A 4I5RA 3WFAA 1JQXA 3L0KA 4PE8A 2Q09A 2QIIA 2VGBA 4U10A 1IWPA 2PWHA 1GEQA 1C8XA 2F6UA 3W86A 1XLFA 4GYPC 4UQAA 3KVKA 3SCSA 2P5NA 4PMRA 1QPQA 1XQKA 1X98A 4ICCX 4DRSA 4ZO8A 3IJLA 1PAMA 4NAEB 1S5NA 5G2WA 4IJCA 2NV9A 3NR0A 3P5ZA 3WD1A 4ZB2A 5HJXA 4AZIA 3SUVA 1YE4A 3M0LA 4HNVA 2E28A 1LDCA 4WY0A 1M01A 2G96A 1UKPA 3ARWA 1M6JA 4B15A 1JUBA 2D24A 3O16A 1OC6A 1KA9F 1R2TA 3PP7A 3G5EA 1KTNA 4LB3A 3LQGA 3NQ2A 1UWSA 3BLLA 3JS3A 4DO6A 1ECEA 5K7JA 4H4IA 5DY3A 1US3A 3W1UA 1JCTA 4HSOA 2D2GA 4ZE5A 4FP1A 1JD7A 5KEZA 7REQA 3AIQA 3M0KA 1TTIA 3FHAA 1A5BA 3DBPA 3VIGA 4LT9A 2GUBA 3O63A 3CTLA 3UVAA 2ZXAA 4OWGA 1LLWA 2CLOA 4AB4A 4O1BA 3LZ3A 3HPXA 2ZX7A 3GHSA 3TROA 1XL9A 1NELA 3QQWA 1MMFA 1FA2A 3T0DA 5FSDC 4A4AA 1WPCA 5BROA 3T07A 4DPPA 1B3VA 2G8ZA 2NUXA 1ZSXA 3L4WA 1S1RA 3GH4A 5LNUA 3EX6A 3GZ3A 2VR2A 4GOAA 1W3HA 2XGZA 2OEJA 2E77A 4A8NA 3XISA 5BOEA 3AIUA 1IEQA 5C9XA 2ZRWA 4IH3A 3AWNA 3W1NA 1IF2A 4XD4A 2FLIA 1FWFC 2PLCA 3MBFA 2VZTA 4PUWA 4LCSA 4A21A 2CLKA 3BZGA 4PUJA 4HA1A 4QE1A 4Y8EA 1WKFA 2AMXA 3UG3A 2Z1WA 3VGHA 1EXBA 1WZKA 4B2DD 3GIPA 3EX4A 2PC4A 2GWNA 5AHEA 1L6WA 1VCGA 2HS8A 1DEDA 1D3GA 1H1NA 5HQEA 4ICMA 1CT5A 3QV8A 2AQWA 6ALDA 3IV8A 4O19A 3SN1A 4D6CA 1Q6DA 2WVTA 3EKLA 2QS8A 2ON3A 4POCA 4LY4A 3KBWA 2QPUA 5FJIA 2QCCA 4IT1A 2DUAA 2VZOA 1RCOB 2JIWA 1PVNA 1L6SA 7REQB 4L6HA 4OBTA 2E67A 2YL8A 1WXZA 4MYXA 2J7HA 1GTHA 3GNNA 2B7QA 2H3DA 6XIAA 4WEVX 4AX7A 4CU8A 3WDIA 1E3ZA 1KRCC 3V0UA 1WUFA 3PG9A 3TZFA 2E8ZA 3EWBX 1F07A 4UMCA 1UQYA 2J75A 4E8DA 1BVNP 3DX5A 1RSCA 5TNVA 2OWXA 3IJQA 1HKMA 2WMHA 3NSNA 4KH2A 5HATA 4B16A 3ELFA 4TX9A 5HOSA 1VQTA 1AJ0A 3LS9A 3W2KA 5EKYA 1BRLA 5BRPA 4P61A 5BRBA 1Q6OA 2C8NA 4IM4A 4PUDA 4JTTA 3QR1A 4YPJA 4BCEA 3N18A 1HKVA 4JX4A 5G1MA 3GFZA 5ECUA 3ATZA 3MZNA 3TYEA 3TUUA 2QDEA 4G7EA 4RPPA 1Z3NA 4DZAA 2H90A 1CIUA 4F9JA 4DUVA 3AAMA 3APTA 4L61A 4G7FA 3AALA 1PZ1A 3F4VA 1EUNA 3W23A 4UTIA 4GK8A 1XINA 1O94A 3TMQA 4MB1A 3G2GA 3VOFA 4R5EA 3G1FA 2BODX 3CAVA 3QYSA 3SJNA 3NNTA 1HGYA 4KWOA 4QQ3A 4H6RA 4IJRA 3DOPA 5BWAA 3SRKA 5A6AA 3FEMA 5HMSA 3MUY1 2QQ6A 3F7JA 4IQJA 3A5VA 3G8RA 1HVXA 4K7YA 1XLMA 2VX6A 3KP0A 1ZL1A 2Z0IA 4HHHA 1TIMA 1A4MA 3DFPA 4S3CA 4D72A 3UY8A 3IRDA 3LBMA 4PUEA 2CHRA 3PUDA 4QNWA 5EFFA 4UTLA 3WSUA 3MDUA 3MQTA 1LRNA 3GTHA 2Y70A 3MYOA 4IMGA 4DWSD 2DGAA 2NVDA 1SZFA 3OQ8A 4JPGA 1VAHA 4LAZA 4G7EB 1OFPA 4B5SA 4ZCWA 2OX4A 1SUXA 4KIEA 4C7FA 4HU3A 3DKLA 4DUXA 2VI0A 4DIAA 2ZDSA 5M1TA 4AD0A 5JUVA 3M5VA 3CIWA 6REQB 4B5TA 3D5HA 1C7SA 3LPFA 3VUSA 4GYKA 5DRCA 3FKRA 5D04C 2FYMA 4UOQA 1L2QA 2PDUA 4O11A 3WQ5A 4UFMA 2V0TA 1IXQA 1KBJA 4HOZA 3ITCA 4GQQA 4HU4A 1RK6A 3A9IA 4WSKA 2BX7A 1XRSA 3AYSA 1OK4A 3T40A 5IFPA 3A4XA 3F4NA 1TZ9A 4JTIA 1O6IA 4EWJA 2QT3A 5CZKA 3W22A 4ADUA 3MCOA 3EOUA 4FNQA 2ONEA 4WRHA 4AIOA 1JZ5A 1ZCOA 1PPIA 2WSKA 2YYTA 2DT2A 5T9BG 4H19A 3B8VA 5I23A 1X1NA 4LEQA 4TV6A 4QAWA 3SUTA 3T78A 5BXRA 3SQLA 4YVPA 1VEMA 2E3ZA 1K4GA 4UBPC 4NKCA 3MO4A 2VQTA 3S9ZA 4GC4A 4JFWA 5CG7A 2NVAA 3S5ZA 1ONRA 2DZTA 3BSHA 3MMWA 3WELA 2V5DA 1W9UA 4XIAA 1E9ZB 5EU9A 3AYRA 4WOQA 1XUUA 3WD2A 1FQ0A 1IXPA 2Y8UA 2DVXA 3VGEA 1B1YA 1TPC1 1VCVA 3N3TA 4IZGA 4J5NA 3NZGA 4WJ8A 3E2SA 3L21A 3OGRA 4I5UA 4A3RA 5CCZA 5LGXA 3WDPP 4TUFA 3REQA 1RAKA 4J3XA 4JYDA 4XZBA 1XPGA 1SW0A 2ISFA 1TTPA 3BTNA 3BL3A 2WPGA 1FHUA 2BY0A 4MM1A 3PZNA 2HNEA 4FB7A 1US2A 2WXDM 4E2OA 3S4TA 2X7VA 3P67A 4IPNB 3MVTA 2X1UA 2WC7A 1K03A 3CV1A 2XFFA 3VIMA 1EO5A 2C18A 3AIRA 3PNZA 2ZA1A 2VFIA 3KBSA 5EMLA 3RM4A 2Y5EA 1RQBA 4MB5A 5BU9A 1HNYA 3OYXA 2EPHA 2WVVA 3KCJA 4QBXA 4X9YA 3P5YA 1ME7A 1EX1A 2FHBA 3WF0A 3VGGA 4M81A 1EZ2A 1XX1A 2HV5A 5E5CA 4ZODA 2PWEA 4ACZA 3ZSSA 4GCAA 1MWOA 3BOXA 3T4WA 2NUWA 3UYIA 2Z24A 1WYIA 4F48A 4LF2A 2QPSA 3AZRA 1DE5A 1FP9A 1ME8A 3B9EA 4I90A 3AIWA 4O1EA 5A94A 3MV11 3GBDA 4UXDA 2BB0A 2MNRA 3VNIA 1QFEA 2FMNA 2D69A 5A2BA 3SGZA 2EJ1A 1T8XA 1VH7A 5D2VA 1HJUA 2WMIB 1DIEA 4C5YA 3B9AA 2O55A 1V3LA 2WVSA 4Q6XA 3PVFA 3U5YA 4JTLA 2BWGA 4IFKB 1BF2A 4CNPA 1CYGA 4FNPA 4WY0F 2R94A 2YFNA 4S23A 1US0A 4O52A 4YNGA 4L1WA 2XIMA 1JCLA 1QNRA 1UD4A 3M7SA 3B0XA 4J35A 3WNLA 3W7KA 3UVIA 1H11A 5KSWA 4AEOA 1DKWA 1IEIA 3B9OA 3P81A 2G95A 4P8UA 3BE7A 1SMAA 3TQ0A 2A6LA 3RNDA 4AIEA 2AOSA 1ZRQA 4XUGA 3UFYA 3F4WA 5A8QA 1KTCA 2Z27A 1JPKA 5HUOA 3T1GA 2PDQA 3M5YA 4H8HA 3EXSA 3TW7A 4B5XA 1LCOA 1C9WA 2GDVA 1IYXA 3NL6A 1UWUA 2D2HA 3STPA 2J47A 4ZXOA 5C7HA 1NFGA 3UZJA 4UQEA 1FWTA 3IK2A 3GIQA 7TAAA 3ATYA 1AMYA