3S42A

Crystal structure of the 3-dehydroquinate dehydratase (arod) from salmonella enterica typhimurium lt2 with malonate and boric acid at the active site
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
260
structure length
259
Chain Sequence
NLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTIDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the 3-Dehydroquinate Dehydratase (aroD) from Salmonella enterica Typhimurium LT2 with Malonate and Boric Acid at the Active Site
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
total genus 104
structure length 259
sequence length 260
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3s42A00
2WOQA 3TROA 3QM3A 2HTMA 2W6RA 1HO4A 1SQ7A 1UJPA 2CLEA 2VENA 1DKWA 2ZDRA 1SO6A 1XDLA 2I1OA 1QPNA 1U83A 2ZRZA 3HJZA 3BG3A 4LU0A 1WBJA 1SZEA 5HUOA 5LSMA 1LRTA 1VJIA 3STEA 4AHPA 1LBFA 5D2WA 4CNOA 4UTKA 1A50A 3ZWTA 4LV4A 4JTGA 3TU9A 1QPQA 5EYWA 3W1TA 2CZEA 3PAJA 3D0CA 3S6DA 5ABTA 1FCBA 5EY5A 2ZRUA 1A5BA 3IVSA 1WA3A 2VEKA 5D38A 4LY8A 3LCLA 3O16A 1RV8A 3TMQA 1L9WA 4EIVA 2Y7GA 1JCMP 3P81A 5HR7A 3GVGA 1DHPA 2A7NA 3LXCA 4IOTA 5LNVA 2R8WA 1ZAJA 4Z1DA 1XUUA 3FKRA 2ZCGA 1K7FA 3IGUA 5C54A 3MP3A 1YADA 4JYEA 4GBUA 1UCWA 1T0OA 5AHEA 5HWNA 1PCWA 5J5RA 3G1HA 3MHUA 2NWRA 5AHLA 3NGJA 1VH7A 3C2RA 3M6YA 3CWNA 3L0GA 1BTMA 2CLLA 4QQ3A 3UY7A 1SSGA 2A2IA 2H8ZA 4BWLC 4OHQA 2W79A 4PC8A 1WOBA 4PFMA 2JKPA 3W84A 3G0UA 4UFHA 3WK1A 5KZDA 3RFAA 1JCJA 3RU6A 3HGOA 2QCDA 2DP3A 1H61A 4FO4A 2BXVA 1H7OA 3PUEA 2Z6IA 4IXHA 4GFSA 3TXZA 3MJYA 2ZZ5A 1GQNA 3HPZA 2VXNA 4EF9A 1GVFA 3C6CA 4N2YA 5D32A 2CZ5A 4UTMA 4EOUA 4JNMA 3W2UA 3CM4A 4DBEA 3G1VA 1H7RA 3BV4A 3BK0A 3STFA 3DZ1A 3WJYA 1KLZA 1TPFA 2QUTA 1FQ0A 1XBVA 3QF0A 2QF7A 3W1AA 1I2RA 3KX6A 1Q3NA 4Y96A 4WUIA 4AMAA 3GR7A 1XM3A 4CLMA 3O63A 5CKSA 2CU0A 3C2OA 2ALDA 5HJLA 4Q32A 2RFGA 2QUUA 4XQ6A 4JTJA 4WOZA 4M5PA 2ZRWA 3IVTA 1TQXA 5HR6A 4IX0A 4RJEA 1TMHA 4UMAA 3CLMA 1GG0A 1NSJA 1GYLA 3IIXA 3FJ6A 5CPOA 3S5NA 4CQAA 3BG5A 1KM5A 1TTPA 1VLIA 4YLWA 3R12A 4G1KA 2NV2A 2PURA 1I2PA 4O54A 3HB9A 1DL3A 3LLDA 3UPBA 5FF2A 3NQMA 4QJ1A 3FOKA 4P61A 5IM51 1ZNNA 4O28A 2QCDB 3C0JA 2YDAA 2FFCA 3EWUA 1M7PA 3O6CA 4UUIA 5H91A 3BW3A 3NQCA 1TTIA 1YDOA 3LTPA 3W7LA 1ME9A 3N14A 4WX2A 1XUZA 4O4WA 3IV3A 4PCFA 4TU1A 3UYCA 3MUXA 4JYFA 4NNBA 4A2SA 1IF2A 4UNKA 1FWWA 2R91A 2CZFA 1R2SA 2DZPA 3V75A 1VCFA 1XL9A 1KBIA 3EKZA 2XN0A 3BVJA 3G1AA 4JXCA 4LS0A 3B05A 3TK7A 1D9EA 2NX3A 2Y85A 2VELA 3LRKA 1PIIA 3LHVA 3K30A 3EXTA 1UB3A 4IPJA 4K37A 1G4TA 2C14A 3O8AA 5BMWA 4LVAA 1YTEA 1ADOA 3ANYA 2J9XA 3PB2A 3T78A 3C2EA 2HSAA 3EXRA 3P5YA 5D2XA 4O1CA 1QMLA 1TV5A 1UASA 3EWZA 4M19A 3HGJA 3C4UA 3W7HA 1RQHA 3L5MA 1A5SA 4O14A 1YXYA 2VEMA 2NUXA 4Z0SA 1FCQA 3ZR4A 3W7DA 3H53A 2Y7FA 3LCFA 4O1DA 4AF0B 3L67A 3L2IA 1SZNA 2A85A 2QKFA 1O60A 3DU0A 3SI9A 4ADTA 3LI0A 3T44A 2WNZA 4NQ1A 4HNVA 3HG2A 1GWJA 3P60A 1ZJIA 1Z48A 1DOSA 1BEUA 2GJNA 4PODA 3W6YA 4ZMGA 1OFBA 4HKPA 1FWNA 4O1AA 1MXSA 1H50A 3MP5A 1FCUA 1Q6QA 3S5OA 2ZZ7A 2DZTA 4IQLA 3GDMA 3NQEA 3DFPA 3MBFA 3CB8A 4ZQNA 4FNSA 1SSDA 4DEFA 5BMXA 4K39A 2J6XA 3S8HA 4X9SA 4JTIA 2VEPA 4EVZA 2A6LA 1H7WA 1YYAA 1KFJA 1XC4A 2LLEA 2NUYA 5FF3A 3BGJA 2B7NA 4ZQPA 1KM0A 1I4NA 2V30A 4UFJA 5D2TA 3L0NA 3GXPA 1SR9A 1NAL1 4IMDA 1OX4B 3DHFA 4QSHA 5DBTA 2CFFA 1O4UA 7TIMA 3BW2A 4L4LA 3HOJA 2Z1BA 3HQ1A 1ML1A 2H3BA 3NDOA 3ABOA 1QPRA 4OV4A 4MOZA 4ZZ9A 3HG4A 1TPB1 3UXAA 1G67A 2NX1A 2J9ZA 2TMDA 1M6JA 1LOLA 3S1XA 3JRKA 1XXXA 3TC6A 4O11A 2HS8A 3WK3A 2Y7EA 4LUIA 3F4WA 4WOQA 3I7QA 1TTJA 1XFBA 4UC5A 1DV7A 3M7WA 4JX4A 2YXGA 1FDYA 2QAPA 4MY8A 3UWQA 5HQEA 3LXBA 2X1TA 2DU2A 4GRSA 1LBMA 1XBZA 1VR6A 1F76A 1GYNA 3NQ8A 3IRDA 3M5YA 1R2RA 1H62A 2QDHA 1B57A 4N6FA 1OX6A 4K38A 5I3GA 3W88A 2WNQA 4HHPA 2TPSA 3BLIA 3EKLA 4QITA 6ALDA 3QQ1A 4K36A 5DLCA 3W72A 5G5IA 2V5LA 3QSTA 1Q6RA 4RXFA 5CSRA 1OFEA 2DZVA 1RQBA 4AB4A 3W85A 1OFPA 3LCXA 1W3TA 2YPIA 5D2YA 2YR1A 2E09A 3C56A 1KV5A 4UFIA 2CWNA 4UFKA 4X22A 1JRCA 4Y90A 3P84A 4MYXA 1YTDA 4O53A 3CT7A 1XDMA 3O05A 1SO4A 1XI3A 1I2NA 2CLMA 4UR8A 2AQWA 1KM1A 3NO5A 4WY0B 4FF7A 2ATMA 2ZA3A 2RKXA 5G4EA 4NJIA 3I65A 2BSLA 3NZRA 4AAJA 1E51A 1HUVA 1OHLA 1ZY9A 4BK9A 5D02A 3W83A 3TFXA 1UBSA 1P0NA 3U8GA 3ATZA 4CNPA 2JK2A 1W3IA 4UMCA 1JR1A 1TB3A 1MEWA 2JKEA 3NXFA 4NJKA 3G18A 3GKAA 4HSOA 1GVSA 1FCVA 4X3ZA 1OFRA 3B0PA 4YL2A 1GT8A 1GEQA 3CC1A 3W9ZA 5C2XA 2BTMA 1KTNA 3E12A 1F2JA 2QDGA 1OF6A 2HS6A 3OVPA 3WFAA 3KVKA 4I9AA 1TYGA 4JTTA 2GJLA 1W8SA 2IQTA 3PULA 5FF7A 1L6SA 1GZGA 4AH7A 3N9SA 4UTHA 3VKJA 4JYDA 4FB7A 1AW2A 4A21A 4RCXA 3MO7A 3TQVA 4FIQA 2B4GA 5LNUA 1EP1A 1TPEA 3W7MA 2Y88A 1AW5A 3F1QA 3GLCA 2GUUA 3NPWA 1WOAA 4A3UA 1TPDA 4FX6M 2EHHA 1G7VA 3TH6A 1FBAA 4UTJA 1F6PA 1LLWA 4DXVA 3PG9A 2FQIA 3VE7A 4BR1A 4GNJA 2WKJA 3NQ6A 1TO3A 3KXQA 4DQWA 3U6WA 3LGEA 1K8YA 3QW3A 3TIMA 3TNOA 5K4ZA 1HFBA 3TAKA 3QEZA 5D03A 2WSYA 2YZRA 1AMKA 3CIXA 1CI1A 5U7SA 5AYXA 1SU5A 4FEZA 1R47A 3FYPA 1TTQA 4O52A 4WJEA 1QPOA 1OK6A 1FXPA 2CLFA 4YMZA 4TR9A 4UMBA 2QJHA 3QYQA 3L0KA 3LCGA 1PS9A 4X2RA 4WXZA 3UY8A 3SW6A 3NEVA 3CQ0A 2A21A 1JRBA 4OV9A 5KINA 1JUEA 5CPMA 1OVDA 3P62A 4AHOA 1YXDA 1B9BA 2NWSA 1TPVA 4Y9AA 1HL2A 4FNPA 5D37A 5K9DA 4RX0A 1H5YA 2C18A 4RZ5A 4MVAA 4GUGA 4YCOA 1N7KA 1ZFJA 2WQPA 3NNTA 5FF4A 2QCEA 3MW7A 3ZFHA 1ME8A 4MUZA 2A7RA 4TMCA 4DBDA 5AFDA 2AAMA 1P1XA 5LGXA 3PBYA 3P8JA 2H3DA 1JQVA 1JUKA 2RDUA 3LCWA 5CSSA 3E96A 4ZQMA 1OF8A 2Q8LA 1PVNA 3G0SA 2F84A 2VFEA 4N02A 4MIMA 1T99A 1LROA 3C3NA 1TV7A 3GDLA 3INPA 1HO1A 4KKXA 3G22A 1SUXA 5F1UA 2XFWA 5CG7A 3DFNA 1RR2A 1AK5A 4DO5A 3PSVA 3W22A 2J88A 3W1RA 1KW1A 3G3DA 4M6VA 5T26A 3A21A 3G8EA 3TX9A 1B4EA 4NU7A 2A0NA 5DXYA 1VPXA 5CGQA 5LGZA 3UXDA 2QCGA 1S5WA 5AB3A 1QOQA 1QO2A 3WK0A 3C61A 5AHIA 4Z0JA 1I2OA 1KM3A 3KRSA 2QJGA 4CCEA 3W87A 4MLJA 3N73A 4KFOA 5CZJA 3P82A 3GXTA 3W2JA 5CZSA 1V7YA 3G1SA 1KFEA 2WNNA 1I8JA 1S3HA 5HINA 3GNDA 2RH9A 3W2LA 4DF0A 1DJQA 1DQWA 3TSMA 4OT7A 4NXKA 1L6WA 3BARA 2A7PA 3UWVA 3TQKA 2PRMA 1A5CA 1F73A 3FKKA 3W71A 3QH2A 2VFGA 2CLIA 2NXGA 3NZ1A 1CW2A 3G1XA 3QPZA 3LTYA 4CCDA 3LXAA 2KZHA 1W56A 3GX9A 1TSIA 2C1HA 3TJLA 3GZ3A 2YYTA 3M1ZA 2W0UA 3AJXA 4M7TA 1P4CA 5EBUA 4MZ1A 2BZNA 3G1DA 3ATYA 3W7EA 4O8RA 1GVRA 4R7JA 4UCGA 4ADSA 4CNNA 4JGDA 4ZL1A 3O15A 3TFCA 1G4EA 3M41A 1ICPA 3GNNA 4ZQRA 2ATSA 3B0UX 1Z41A 4O15A 1VYPX 3P7YA 1CX9A 2ZRXA 4KWWA 4PL1A 3RK8A 3I68A 1QCWA 4FX8A 4NT0A 2FPYA 3QPYA 3SR7A 4O18A 4NJJA 3EX1A 2J24A 4QM1A 3B0VC 1F7BA 2NX9A 3IIOA 4DO6A 5CZ0A 3A5VA 4JTHA 4OU1A 5G2IA 4RZ4A 4ZQOA 5I3FA 4K6AA 3I7SA 4JD4A 3W2KA 1YLVA 2X1RA 4MKNA 5FEXA 3TW6A 1G4SA 4KFPA 3UPWA 2V0TA 3LHTA 3NQ2A 3RNDA 1T8XA 4QIUA 3NQAA 2YSWA 3NYZA 2ISWA 2JGQA 1H7PA 5KSWA 1J4EA 4BI6A 4S1FA 1ZENA 3HG5A 3NQ7A 2WSQA 3GDTA 4FXSA 2G95A 4HNUA 1W1ZA 2ZA2A 5HMSA 1JCLA 4ORMA 3EX3A 3DI1A 3QZEA 3LCHA 3QMSA 3OVRA 2P10A 1K02A 5F4XA 3NQVA 5LNRA 2ZBTA 3DH7A 3W7QA 5G1TA 1BKSA 4RK8A 1HG3A 4MZYA 4XZ9A 2A1YA 3G0XA 4XWUA 1W5PA 2R94A 4H3DA 3GXNA 2WJZA 1AL8A 3B4UA 5LZLA 1AW1A 1SO3A 2OT0A 3TSBA 3LLFA 3THAA 4LC6A 2Y62A 5TBOA 3BG9A 4OE7A 3GAKA 3KVMA 6TIMA 1NEYA 1JCNA 4UFMA 4A2RA 4UTWA 1XKYA 2WSRA 3M5XA 4K7YA 2H6RA 5BNKA 1W0MA 1YPIA 1QWGA 1QO5A 3WJZA 5AC6A 4Y6GA 4YCPA 2UV8G 3T7VA 2GPTA 4W9TA 3MHGA 1GG1A 1GJPA 4Q33A 5J5DA 4LVDA 5FEPA 4DPPA 3TCEA 2NLIA 8TIMA 4LUJA 3O1NA 3W7JA 5FF0A 2DZUA 5KTLA 5AOUA 3N34A 2QEZA 3CHVA 2FPTA 2Q3RA 1DVJA 1NFBA 1V5XA 2C13A 3CU2A 3HPXA 1J5TA 1X1ZA 2VEIA 1L6YA 5C55A 2C3ZA 1EUNA 3OVQA 5I3HA 4H6KA 2OCZA 5D05A 1KTBA 5KZEA 2ABAA 3W1UA 5AHMA 4IWWA 1OK4A 3C2FA 2RDWA 1GVOA 5AYYA 4BF9A 3TC7A 1VYSX 4HIBA 3W7GA 3G1FA 5K9XA 2A4AA 3GAYA 3QQ0A 4PA8A 3GDRA 1Z42A 1KA9F 2Y89A 4N4PA 3W1LA 4CQ8A 3TE9A 2PC4A 1GOXA 4IPIA 2P1FA 2ISSA 2OMAA 4TMBA 1RVGA 2E5DA 3B04A 1G6CA 1G7UA 4NJHA 2XN2A 3G1YA 4BWLA 5F4WA 3W7IA 3VI2A 3S9YA 3LX9A 1YDNA 1Q45A 3PUOA 2JBMA 1OJXA 3EWBX 1OYAA 4QISA 1JQXA 4E2BA 1BWKA 1TCDA 3SZ8A 1QAPA 4JIQA 3PB0A 4I7VA 3CWOX 3BW4A 1O5KA 1QOPA 3C52A 2B7PA 5BOOA 3PSWA 2Y70A 3MYPA 1SO5A 3OIXA 3GKFA 2X30A 2ZZ2A 1A53A 4HT3A 4RXGA 4XKYA 4OBTA 1GPWA 3STCA 3M9YA 3ABSA 4DO4A 4RLIA 3O06A 3R89A 4LRTA 4UIOA 3W3OA 1IXOA 4GC4A 1YTKA 1VRDA 3NR0A 1EWDA 1ZALA 2YGYA 2GVLA 2RHGA 5AHFA 3SSJA 2V8ZA 3EXSA 3BPWA 1NF0A 4PEKA 1PE1A 5D04C 5K7JA 2VFDA 4DF1A 2G5WA 2X2GA 2C6QA 4MLRA 3MMTA 4JTKA 4JX5A 1LOSA 4WY0F 2WV8A 3HGRA 2P0OA 3SJ3A 2V2CA 1EP2A 3UD6A 1KM6A 4U28A 3VE9A 2ZYFA 5FEWA 3S5ZA 1VCGA 4NJGA 4N4QA 1EA0A 4NNCA 5D09A 5I3IA 1OG0A 3TQ0A 3T55A 4E38A 4NZJA 1TJPA 4AHQA 5FESA 5DXXA 4O10A 2DJLA 3W1NA 1TRIA 3MI6A 2YCEA 2ZRYA 3THQA 3TJXA 3RLUA 1QNVA 1JUBA 2C15A 5LKYA 2YX0A 3DAQA 4JX6A 3LV5A 3OEXA 3KOFA 4J9JA 3QW4B 3DFTA 1QR7A 5D2VA 4TO8A 3NQFA 3OA3A 3W23A 3M5VA 5KITA 3E9AA 3W7RA 3GB6A 4NXSA 3TAOA 3R13A 1LYXA 3N2XA 4LW7A 1WDWA 2O7SA 2VOMA 4UR7A 4OQVA 2OX1A 1SZFA 2RDTA 3EWYA 3HIJA 3W07A 2E6YA 3MI2A 4AVFA 3PY2A 1Y0EA 5HNRA 3DHDA 4O19A 3W1PA 5DCEA 1LLZA 4NZFA 1FY6A 3BGGA 4JICA 3NG3A 1X7FA 4ORIA 3L68A 3MHFA 5K4XA 3RMJA 1FWRA 4O12A 4IUOA 2Z6JA 3IIPA 3LB0A 2FDSA 4WD0A 1WXJA 4BFAA 4PL2A 1ICQA 3T40A 4U4MA 2CLOA 5TQLA 1TREA 4AXKA 2GQAA 5DCDA 5E0KA 4MY9A 3HG3A 1JCXA 2PCQA 2BWGA 1LTDA 1YPFA 3HPSA 4D2JA 1LP6A 3TSDA 3DFQA 1GVQA 1TQJA 4POCA 4LTSA 4EF8A 5EMUA 2NV1A 4LNYA 1X6UA 4KFNA 5DCBA 1KBJA 5D30A 3EB2A 2JGYA 1ME7A 1W5QA 3HMJG 1OYCA 3LDVA 1HTIA 1FDJA 4RR4A 1GTEA 4MZ8A 3QMRA 2E5BA 2FB3A 2FB2A 4C1LA 2GVGA 1O95A 2YW4A 1O5XA 3PS7A 3RLVA 4FIRA 1FXQA 3DENA 4S2CA 2QCMA 3S1VA 1RZMA 4FNRA 1OX4A 1K8XA 3DKLA 2F7FA 2E68A 2ZA1A 4FNUA 4LOCA 1JJKA 4WZHA 5F2MA 1KFLA 1QDSA 4NX5A 3F4NA 2QAFA 3WK2A 3MYOA 4JIPA 4AF0A 5HWMA 2Y7DA 4JEQA 4MY1A 3QC3A 4O0ZA 5DELA 5DN1A 1DQXA 1H60A 2PRLA 3W86A 2YFNA 3FA5A 5HWJA 1ALDA 3NL2A 1JVNA 3UWUA 3NOEA 3NPVA 3HGSA 1PL9A 4FX7A 1MEIA 5A8GA 4UFLA 2WPBA 4MFDA 5BRBA 1YXCA 2E1DA 3IIVA 4MYAA 5F4SA 3TDFA 2VKZG 4FNTA 1OFOA 3MWAA 4N9EA 3WJXA 1QFEA 3FS2A 3LHYA 3EX6A 3GIYA 3LOTA 3CEUA 2EPHA 3V1PA 1JCYA 3JR2A 3DBPA 4O4VA 1H63A 1S5TA 1Q6OA 1T96A 3KFTA 1FWSA 2ZTKA 3L5LA 2AGKA 3O6YX 4IMFA 5CPLA 2X1UA 1SZGA 3USBA 3GK0A 1RD5A 4NNAA 4I7UA 5K2ZA 4N9CA 2I9EA 3NM3A 4HPJA 4ALDA 3I6RA 1IIHA 2EKCA 1UUOA 1VQTA 1KLYA 2J9YA 3DGRA 4LV9A 3SECA 3W75A 2A5HA 3KHJA 1IIGA 3A23A 3MP4A 3UQNA 4RZ6A 4UTLA 3LM7A 3PF3A 3KRZA 4XUGA 3LHUA 3TA6A 2D73A 5G2HA 3CIWA 2Y63A 1U5JA 5AHNA 3FLUA 1FDZA 3W74A 4EWND 2HMCA 3LBCA 2C16A 1OFDA 2A6NA 5HULA 3W1QA 4AWSA 1EX5A 3LBMA 3IEBA 2E77A 3LI1A 5DBUA 3VCRA 5GVJA 1ZHAA 3LHZA 1VZWA 2CZDA 3E02A 2CLKA 3M5ZA 1G4PA 1LRQA 1MZHA 2VC6A 1C9DA 1MO0A 5EL1A 1EPXA 4JR5A 3KVLA 2ZZ1A 1TRDA 2DZSA 2DZXA 3M43A 5KMYA 2V82A 3PUDA 4GWEA 5I3KA 3LCIA 4XBKA 4UXDA 3A9IA 3PR2A 1LBLA 1OFAA 2YFOA 1I45A 1WQ5A 3B8DA 3NQDA 3N9RA 4HNTA 3SGUA 4OGZA 1RQEA 1KV8A 5FEZA 3L66A 4XKYB 2NZLA 4LWWA 3PC0A 3ZS4A 2DORA 2PRHA 1FWTA 1H7XA 1N8FA 4ZQCA 3HF3A 4MJZA 4R34A 4QNWA 2EGZA 3WJSA 3Q94A 1EWEA 1ZAHA 3E49A 3PVFA 4QAIA 3W1MA 3EWXA 2Q8ZA 4WY0A 1R2TA 1MSSA 3N3MA 1XBYA 5BW6A 1ICSA 3HBLA 5K9CA 2G96A 4UTIA 5G4WA 2Q3OA 2GOUA 4AEOA 1B4KA 1R46A 4JY9A 4MPQA 1VLWA 4ML9A 3W7OA 1DORA 4ONVA 1I2QA 5F1VA 4H4IA 5D33A 4FXRA 1BWLA 3GR8A 2I14A 4OWGA 4LC8A 5K3VA 1VGAA 2V9DA 3PBVA 3SFKA 1H1YA 4Z1AA 5KZMA 1F6KA 4O0KA 3ABQA 4YXGA 3Q2DA 3EX4A 2XN1A 4JN6A 4UTTA 2V5BA 4RKAA 1ZCOA 1KFBA 3YPIA 1K7EA 1K7XA 1F5ZA 3Q58A 1KTCA 4HN4A 4UNLA 4NUWA 3P67A 1LM1A 1PCKA 4S2BA 1SW0A 3EWWA 2VFIA 5C6MA 3EX2A 1WYIA 3NPUA 4L4MA 4FHAA 3W2NA 3PBUA 1KFKA 3TKFA 3UNDA 4LT9A 3W7KA 3WJWA 2ZRVA 4O16A 1TIMA 4DPQA 4M6PA 1P0KA 2CLHA 1EB3A 5FI8A 4GUFA 3LV6A 4FNQA 1TPUA 2GVJA 3TUUA 3KAOA 4IXXA 2X1SA 4HNNA 4LS2A 4JTLA 4JTEA 4O13A 3P80A 4ICNA 1IXQA 2J27A 4AWUA 1TPH1 5CPNA 3DFOA 3F03K 3R5EA 3S42A 3G3MA 5IBXC 3T4CA 1W54A 3TMLA 3L21A 2Z2UA 2YW3A 1AL7A 1VC4A 4GUHA 1VS1A 5LHFA 1J2WA 3FEMA 3IGXA 1LOQA 3MI3A 1X1OA 4CCCA 3VFLA 5F2IA 3W70A 1Q6LA 3QFEA 1W5OA 4LS1A 5AC7A 1UUMA 5EKYA 3I7RA 3L5AA 4GUJA 2DJXA 1W31A 1WAUA 4IGHA 3W7PA 3SIZA 4LVGA 3FYOA 3LTSA 2BLEA 3PG8A 5L6UA 1W5MA 1XCFA 3R8RA 2B7OA 4DF2A 2FJKA 2X16A 4LRSA 3NPXA 1A5AA 4BI7A 1M7OA 4GE8A 1VCVA 3O6DA 2C19A 3N19B 3FIGA 3NL6A 2TSYA 1TV8A 2QCNA 3M16A 3BO9A 3C8FA 4PH6A 2B7QA 3CTLA 4P2VA 4Z08A 4CQ9A 4N6EA 2ZTJA 1TPWA 3NM1A 1C8VA 4E0CA 1M5WA 2NUWA 3P74A 4JTSA 4WXYA 3PBWA 3L65A 2TYSA 5G2WA 3ELFA 3W76A 1MEHA 1KM4A 1W37A 3DKJA 4YWIA 3STGA 4UTWC 4A29A 2WO5A 2QCHA 4IMCA 1X8FA 5C5YA 4KWVA 2QJIA 5EPDA 5F2LA 3UZ5A 1IXPA 1SPQA 1WV2A 4QNEA 2VFFA 3LRMA 4Y8FA 1K8ZA 4LVBA 1TPC1 1PHQA 1Z44A 3DXIA 2DZWA 2FTPA 4ADUA 4JS3A 2QUVA 1D3GA 3GDKA 4Z1BA 2EAWA 3UWZA 4XTIA 3P8IA 5LNSA 4Z1CA 1XBXA 1WBHA 1D3HA 3FFSA 4JDBA 3UZJA 2E5CA 5SWUA 1L2UA 1O94A 3JS3A 2QCCA 1GTHA 5AYZA 4HSNA 3TW7A 2ISVA 5EA9A 1OABA 2Z0IA 4IMEA 4N9BA 3NVTA 1EP3A 4O57A 3LERA 2GQ9A 2H8XA 3TV8A 4K8HA 4MJMA 3OHIA 1KFCA 1ONRA 2V81A 1YDVA 4M6QA 1LORA 1OYBA 2B0MA 3SGZA 3QJAA 2Y61A 4A22A 2FIQA 3GYEA 4WQ6A 1B3OA 1WX0A 2VFHA 4XTDA 4O50A 1F74A 5IBXA 1ZAIA 2PE4A 2YYUA 2NXHA 3S0CA 2Y6ZA 3EEGA 4E2DA 1AG1O 3NA8A 4ZVJA 3P61A 4IX2A 4K8EA 2FLIA 2JKAA 2FPVA 1LCOA 2ABBA 4JY8A 3DI0A 1IGSA 2ZQ0A 1RPXA 3NL5A 1IXNA 3PM6A 2V2DA 4K7VA 5F2GA 1C29A 1FUYA 1SFJA 3C2VA 3BLEA 4Q4KA 3OBKA 1K03A 3A24A 3A5FA 1TJRA 2BX7A 4BI5A 3UWWA 2ZZ6A 1EEPA 3A22A 1JULA 5AC8A 4PTNA 1W3NA 5DY3A 4C1KA 2CW6A 4I7WA 3SY5A 1SFLA 3Q37A 4JDYA 4R53A 3UWYA 2C0AA 2NXIA 2E6AA 5E93A 3W73A 2G97A 2QR6A 5CZTA 2OZ0A 4HPXA 3H54A 1SW3A 3O07A 3KVJA 3CEPA 1H1ZA 3IIZA 4JTUA 2ZFAA 3VNDA 4UTTC 3NAVA 2E6DA 1LDCA 3W2MA 1NVMA 5A5WA 3S1UA 4XBSA 2TRSA 4M7SA 1R30A 3PWAA 3OG3A 4N9DA 4B5NA 5LNWA 2OT1A 4GJ1A 1S5VA 3KRUA 5E1QA 3NQGA 1W5NA 1NF7A 3W7CA 4NX0A 4GUIA 1PHWA 1OX5A 3QMTA 3ZWSA 1F05A 3IVUA 1P5BA 5MHBA 4DELA 3TR2A 1N55A 2QCLA 4RV8A 3M47A 3LHWA 1FX6A 2OJPA 3ABRA 5H2ZA 3RF9A 3LRLA 3G24A 3B03A 4NVTA 4O1BA 3FJLA 4IMGA 4TX9A 4IJBA 3TXVA 3B06A 3E0IA 2ZZ3A 5TIMA 3L9CA 2H90A 3S1WA 3QSRA 3DFSA 3G8RA 1OFQA 3QRHA 4GXMA 3P5ZA 1EIXA 5U4NA 3N2MA 5LHEA 2EF9A 5G1YA 1VYRA 3HO8A 3W7NA 4O17A 3M0ZA 5DY2A 3W1XA 3BLFA 2ZZ4A 1VHNA 1K3UA 1KM2A 2O7QA 1SW7A 1THFD 1PV8A 1EUAA 3IGSA 3AO0A 1G69A 3CPRA 3NL3A 1H7NA 5L9FA 2GQ8A 1DBTA 4AWTA 2V2HA 5HUPA 3H55A 3R2GA 1LZOA 4TIMA 2QCFA 4MFEA 2E6FA 3U2OA 4LVFA 5I3JA 1LRNA 4UTUA 4R33A 3S5YA 5AN7A 1VHCA 4JTFA 3MBDA 1H51A 3M44A 1DJNA 2R14A
chains in the Genus database with same CATH superfamily
1C9WA 2ALRA 3QM3A 1DKWA 1XDLA 2I1OA 4JKMA 1QPNA 3BG3A 4LU0A 4FS9A 3HPAA 1SZEA 1QBAA 3CAVA 1VJIA 1T40A 3STEA 3EDFA 1LBFA 3VD5A 3WN6A 4UTKA 1Q65A 3A4XA 4QDMA 1J9YA 3TU9A 3BJSA 4GA8A 2I7GA 3U2ZA 4KF1A 3FXGA 1S2UA 2VEKA 5D38A 2X0SA 3VIPA 2P8CA 3KE0A 1JPDX 1RV8A 1UA3A 3UJFA 4AW7A 4EIVA 3P81A 3GVGA 4KWOA 2A7NA 4IFKA 3I10A 3GXIA 1H5VA 2R8WA 1XSIA 1ZAJA 4WCJA 4H2CA 3GNOA 3FKRA 1XH0A 1K7FA 3F5LA 4PBFA 1Q63A 3MP3A 1YADA 4JYEA 1RPKA 4OOUA 4DJEC 3F5KA 5J5RA 3OJGA 4MADA 3NGJA 1VH7A 4FA3A 2J78A 4RDVA 4X0NA 4A8RA 1E6SM 3M6YA 2QZRA 1BTMA 1J96A 4QQ3A 1QI4A 3K46A 1SSGA 5DFAA 1QT1A 2PDHA 1UWQA 5LIKX 3N2OA 1S5MA 5KZDA 3A4AA 5GQBA 3GDBA 2CEQA 2BXVA 4PUMA 1QBBA 1OQFA 1ZS2A 2W63A 4CU8A 1BLIA 3LN3A 3NYDA 3AMCA 4RE2A 4EF9A 3SADA 1EJSC 3C6CA 3MZNA 3FAWA 3QYSA 4N2YA 3W2UA 3CM4A 3H4GA 3G1VA 3FHAA 4IP5A 4Q22A 2EBNA 2QUTA 2BMBA 1OT2A 1XBVA 1BD0A 3W1AA 2O9PA 1TCMA 3B8SA 3FEQA 1E6XM 5C7VA 5HJLA 3H70A 1PTDA 4HPNA 2YB4A 4C6IA 2QUUA 2HISA 3MUCA 4WOZA 1E3XA 2GSJA 2ZRWA 1Q5MA 3AJ7A 4RNIA 5HR6A 4IX0A 2YLLA 4PMRA 2PGRA 1UZ4A 4RJEA 1GG0A 2O9RA 1NSJA 1GYLA 1FWJC 4CQAA 1TTPA 1VLIA 2OODA 3R12A 4ERIA 2NV2A 1I2PA 1XYMA 3KW3A 5CBBA 5DANA 2I56A 3NQMA 3TYAA 1J5SA 3WH9A 3WQPA 4AD5A 2XUCA 2PU1A 1ONEA 3SY1A 4XAZA 3BW3A 3NQCA 2GOKA 3N29A 2ZVIA 3N14A 4FZIA 2PODA 1XUZA 5CSUA 1J6OA 1E6QM 4TU1A 4IPNB 4A2SA 1WKYA 2FZ8A 1P1MA 3V75A 1VCFA 3PK7A 1KBIA 4LS0A 1D9EA 2NX3A 2Y85A 1XYLA 1PIIA 2ACQA 3EXTA 4NZ4A 3VGEA 2VCCA 2C14A 3TTOA 5CLTA 1EO7A 3T78A 3UA3A 2OSXA 4L6HA 3EXRA 5I23A 1UASA 1JG9A 1E1CA 4O14A 1YXYA 3D47A 4S3CA 4C6LA 1FCQA 1LG2A 4AF0B 2X2YA 4QRNA 4YTQA 2Y5SA 2A85A 4ADTA 4XIMA 4D8AA 3HG2A 4FALA 2AMGA 3P60A 4MMWA 4XO6A 3EYPA 3G1RA 1OFBA 2DVXA 3L12A 2ZX5A 1F07A 3OLDA 4IQLA 3GDMA 3NQEA 3ISIX 4FOUA 4ZQNA 4PBGA 1JF5A 4DEFA 4KWSA 3P0XA 3VOHA 2ZXDA 2OQLA 2A3BA 1XLMA 1ITCA 1XC4A 2LLEA 3BGJA 4ZQPA 2V30A 5D2TA 3VKKA 5MF5A 1CXLA 3VIHA 2MUCA 2AMXA 1HJXA 5H8UA 1LL7A 2CFFA 4U3AA 2QIWA 3VZZA 1IZKA 2Q01A 3UF9A 2H3BA 3V0TA 1AH0A 2OOFA 4Y9NA 1GW9A 4Q4MA 1W9VA 2ZUTA 4B9YA 1TPB1 2NX1A 2J9ZA 1ZTVA 2TMDA 3S1XA 3WQ8A 3JRKA 1M65A 4XIAA 3UZXA 2WC3A 3TC6A 2AOSA 3B8IA 3WK3A 1DXEA 4LUIA 4HZMA 3F4WA 5EMYA 3AIQA 3I7QA 1DV7A 4JX4A 1GOKA 3T8LA 3UWQA 2DSVA 3S3GA 2X1TA 4HGXA 4GRSA 1LBMA 3OP2A 5A6TC 1GYNA 2ZWYA 4EK7A 3N25A 3NQ8A 1H62A 1UH2A 2QDHA 1B57A 3WF1A 1DP0A 3LUTA 2WNQA 1QW8A 3SUSA 6A3HA 4QITA 4MWAC 3K5XA 4K36A 5I2UA 5G5IA 2XM2A 3QSTA 2DZVA 3CV1A 3M0IA 3VOFA 3E74A 2J8FA 1MW3A 3SCUA 1DXIA 5DEZA 3FN9A 4CGTA 3K4AA 4P8UA 3AHYA 3GE7A 4LUTB 1YNYA 1O5QA 5D2YA 2E09A 4UFIA 1H4PA 4QE1A 5FL0A 4Z2JA 3AOFA 3P84A 1UP0A 4F2TA 3BLOA 1TR9A 3O05A 4H9TA 2CLMA 4UR8A 1AJZA 1KM1A 3NO5A 4FF7A 5G4EA 5I3DA 2BSLA 4BK9A 1HUVA 3WNPA 4QX4A 3TFXA 5HBFA 1AQFA 3U8GA 5KZ6A 4R3UA 2PWGA 4MB3A 4F0KA 4UMCA 1E0WA 1MEWA 2JKEA 3NXFA 1FCVA 3B0PA 2I5QA 1JGMA 2C8NA 3W9ZA 5C2XA 1ECEA 3MCOA 2BTMA 3NCOA 1RK6A 3GVQA 1W1YA 2JIEA 3LENA 3AI0A 2G3NA 4JTTA 1DTNA 1W8SA 4TUFA 4DUXA 2DSUA 1GZGA 4AVNA 3N9SA 4UTHA 1F3WA 3T6CA 3KZPA 3EPOA 4A21A 3V1HA 1DJGA 4JTDA 3TQVA 1TPEA 3BQ6A 2AKZA 4IPLA 1F3TA 4HU8A 4A3UA 4H8VA 1B3WA 1V79A 2WVVA 4PEEA 1LLWA 4DXVA 4GINA 2BHYA 4BR1A 4GNJA 2J77A 3NURA 4HOXA 5B7YA 4NYUA 3KXQA 4C6EA 4V2XA 3LGEA 1K8YA 3NQBA 5XINA 5D03A 4GYFA 1AMKA 1W9UA 1F3EA 3UR2A 5U7SA 1EO5A 3PJXA 5C70A 1FKWA 1QPOA 1UP2A 2CESA 3VGDA 6ENLA 2H9AA 2PDKA 1GZJA 4UMBA 3FGCB 2GYIA 2QJHA 3LCGA 1PS9A 3SCOA 4X2RA 4P7QA 3BSGA 3SW6A 3WDPP 4YTRA 1GPFA 3UG5A 4QS6A 3NJ3A 2X8RA 4JZ5A 5CPMA 5FA5A 1YE4A 3GC2A 1B9BA 1AJ0A 1B0IA 4Y9AA 3R1ZA 1DYSA 1V77A 1EBGA 1UA7A 5D37A 3C2YA 4RX0A 4RZ5A 4MF4A 2Q09A 4DBWA 5ECVA 2INEA 4HVXA 4GUGA 4MB4A 1PKLA 3RCMA 2V5CA 4DBDA 1U1JA 1P1XA 1KWGA 4B3LA 4FLRA 4W85A 2H3DA 1JQVA 3LCWA 1U1UA 3E96A 2Q8LA 1DJZA 1ESWA 4LYPA 1HT6A 3WLOA 4TTGA 1LROA 3A4WA 2YIHA 1KXVA 1BYAA 3VO0A 4PCSA 2QLYA 3INPA 4FAMA 1DJHA 1XG4A 3WBAA 1JZ2A 3G22A 1KB3A 1SUXA 2XFWA 3P14A 3GYCA 1VEOA 1VKFA 3PSVA 2PTDA 3I4EA 4YTUA 2HVOA 3LYEA 1B4EA 5RUBA 1VPXA 3A64A 1FVPA 3C5QA 2IKIA 2WYSA 2PF8A 3AXMA 2BOEX 3AU6A 3WK0A 3H2FA 3C61A 2Z1SA 5AHIA 4AD1A 1I2OA 4PMDA 4EP8C 3QR1A 5EFDA 3HZ3A 3H26A 3GBDA 3KCJA 2RGLA 3CWHA 4TOQA 5CZJA 3WY1A 1PTGA 3P82A 1IEWA 3GXTA 3NEHA 2VC7A 1V7YA 3SM0A 3G1SA 7A3HA 1W8GA 4J1OA 1S3HA 3GNDA 2IKHA 2PTYA 4W88A 3U5UA 1H11A 5CJMA 4HZ6A 4IT1A 3L4ZA 1VD6A 1Z69A 3TA9A 2PRMA 1R5YA 1GEHA 2VFGA 4CN6A 2CLIA 3QPZA 2OSYA 4V15A 3WL0A 1FTXA 1VFLA 5LA0A 2YYTA 1F8MA 2YCLB 4H7CA 1P4CA 5EBUA 4MZ1A 4GOAA 2BZNA 1QPKA 1UBPC 2VX6A 3GHTA 4RDYA 2GSHA 4O8RA 4KESA 4R7JA 4CNNA 1FH9A 3O15A 1G4EA 3GU1A 3R11A 5E5CA 3M41A 3NFUA 1XLLA 2VUNA 4ZQRA 4RE0A 4MKVA 4O15A 4D72A 1CX9A 2XFFA 3RK8A 3NXLA 1CEOA 2WM0A 1R3VA 3VTRA 3VOJA 1QI0A 4NJJA 3B0VC 2HRWA 4M80A 2NQJA 2DT3A 2YL9A 4W84A 1IEIA 3W2KA 3I7SA 4HP5A 4JD4A 2X1RA 2AAAA 4MKNA 2D1ZA 5FEXA 3TW6A 5DRIA 3UPWA 2V0TA 3NQ2A 1T8XA 2OLSA 2BFGA 4BEQA 1GGOA 4A3HA 4BS0A 1GKRA 4S1FA 1GOWA 3KEHA 1RVKA 3SUTA 2IPWA 5LXXA 5HMSA 1KBLA 1W2PA 4ORMA 3VOIA 3CXOA 3LCHA 3OVRA 3D3FA 1QTWA 1RAKA 4Q8OA 3DH7A 1BKSA 1X97A 1HGYA 2EJAA 2R94A 3GXNA 4FSAA 1S38A 2UWFA 4B16A 1UC5A 3B4UA 4W89A 4CVWA 3AS3A 4YU1A 1IYXA 1KQZA 1XIMA 2WVVB 1YEYA 2WVSA 4OIFA 4OE7A 1RLDA 5BCAA 1AH3A 6TIMA 3DX5A 5FJIA 3BCFA 1XKYA 3UG4A 3GG1A 2PDPA 2H6RA 1W0MA 3WJZA 5AC6A 4L64A 1WDSA 1F61A 2GJPA 3MHGA 3KBWA 1GJPA 2YJQA 1QNSA 3UJ2A 3TCEA 2CPUA 2X0HA 5CPQA 2V3DA 4FLQA 4NG3A 4F8XA 1X6NA 5KTLA 3MVTA 2ZE0A 3N34A 4HYVA 3ITXA 2Q3RA 4U31A 3ZMRA 2VZOA 1V5XA 3DYOA 3VUSA 3GTXA 3CU2A 4ZFMA 3VCCA 1XGZA 1AVAA 1X1ZA 2VEIA 3ARVA 1EZWA 1EUNA 2OVLA 5D05A 2DIEA 5G1MA 5KZEA 2ABAA 1BQGA 1EQPA 5AHMA 4IWWA 3C2FA 3TC7A 1WZMA 3G1FA 4Q8VA 3GAYA 4LGXA 4PA8A 1CGWA 1PYMA 3ITLA 2E67A 1R0MA 2Y89A 1YHTA 3W1LA 2GGIA 1V8EA 3PP7A 2DEPA 3LEPA 3N2TA 4YYCA 2GK1B 1G6CA 4D1JA 1PZ0A 3W7IA 3VI2A 3WDJA 3LX9A 1YDNA 2YDRA 2VM8A 3PUOA 2JBMA 2D0GA 1SGJA 3PZVA 4HB7A 5DO8A 4IIEA 4QISA 4E2BA 1BWKA 4UQAA 1UWAA 1NQKA 4D6HA 1WKDA 2OLAA 3CHCA 3VFCA 4JIQA 3BW4A 3C52A 3S2CA 1XLCA 2GZXA 5BOOA 2Y70A 1EJXC 1SO5A 3OIXA 4S3DA 2ZZ2A 4RXGA 4XK2A 1GPWA 1JPMA 4DY1A 4DO4A 4YIWA 3O06A 4UIOA 1IXOA 1YTKA 3OU8A 2RHGA 2VL4A 4M81A 4AZ7A 1XIEA 4P7OA 1EXBA 1GVEA 3BPWA 4HA0A 1PE1A 1XD0A 3AQUA 1D7KA 2VFDA 2G5WA 4LBSA 2CBJA 3MMTA 4JX5A 1LOSA 1ZBVA 3SFWA 4WY0F 2WV8A 4CQBA 2P0OA 1D3CA 4U28A 3VE9A 4ML4A 1KQYA 1ECQA 3GHUA 4NNCA 1EYWA 3T55A 1A5LC 3TTQA 1F9CA 4AHQA 5DXXA 5BU6A 4C6PA 4DJFD 2BODX 1HF6A 3RITA 1TRIA 2VGBA 3RLUA 1QNVA 1JUBA 2NV9A 1JYXA 2WJFA 2YCLA 1UMLA 3WUEA 2GSEA 4J9JA 3GUWA 1QW9A 1R86A 3DCPA 1TA3A 1G5AA 1QR7A 3CQJA 3U3HA 3E9AA 3GB6A 1Q6DA 3GD6A 1WDWA 2VOMA 1PJ9A 3KOWA 5F7UA 1S1PA 3W07A 1LG1A 3MI2A 3DHDA 1SYTA 5AKQA 2VTFA 4AC7C 1LLZA 1EJUC 3TZFA 3RMJA 1A4LA 2NT0A 4IUOA 2VCBA 1EA9C 4BFAA 1D8CA 2CLOA 5TQLA 3OYXA 5DCDA 1MVYA 4K8GA 3QBUA 4A8LA 4CEUC 3GFZA 3DFQA 3VNLA 4POCA 2O56A 4LTSA 3WIJA 5BOFA 3ERPA 4PFHA 1XRFA 5D30A 3LPPA 1JNEA 3AMDA 1CT5A 3LSCA 3DESA 2WMFA 4V1XA 1MFVA 3SJNA 3DFHA 4ZB2A 3T1GA 1FDJA 2WZIA 2Z00A 3QMRA 1RJRA 2HQAA 4DLFA 3LZ5A 3PS7A 1OEPA 5FACA 5AZ1A 1HJUA 3SCQA 4FNRA 3M0KA 4D8LA 1OX4A 4LOCA 2F7FA 3DKLA 4FNUA 1JJKA 1E43A 1W3JA 1KFLA 1QDSA 3WK2A 3LPOA 2OSWA 3T0CA 2C7FA 4E8CA 3PNZA 5A6JA 1FH8A 2YFNA 3BLLA 1E0TA 3F2BA 4Z2GA 1PL9A 3QVQA 1ZJBA 5HQLA 4EXAA 4UFLA 4AZ5A 3VIGA 2WPBA 4MYAA 3OGVA 4DZAA 4ZSTA 1K4GA 3MWAA 3WJXA 4GGBA 1JYNA 1BYCA 3GIYA 1UJQA 3CEUA 2EPHA 4GPNA 2F2HA 3CHFA 4MWAE 2XIMA 3JR2A 1JDEA 3EDJA 3QY6A 1H63A 2FZBA 1T96A 1R9ZA 4E6MA 5M1TA 2XVPA 5DQPA 2Z1WA 4EE9A 1EFZA 3USBA 1KXTA 1RA0A 3S46A 1OY0A 1TG7A 3H23A 2E40A 4LUTA 4N9CA 6TAAA 2XFRA 2GDVA 3DGRA 4LV9A 2A5HA 3KHJA 3MP4A 3UQNA 3K8MA 1C91A 4XUGA 3TA6A 1V6VA 5TNVA 5AVNA 2FVMA 1QI3A 4YVVA 3UXKA 3FLUA 1FDZA 3W74A 1C3FA 4BY3A 1V08A 4HD5A 1R38A 2HMCA 1OFDA 3W1QA 3LBMA 2G3IA 3IJLA 1H1NA 3WQEA 1ZHAA 3THCA 2TAAA 4U5IA 3PNUA 3CL7A 3UERA 1K9EA 3GY1A 2XPKA 4PCNA 4J3SA 2VDHA 4B2DA 2ZZ1A 4HZ7A 2DZSA 3M43A 3VIOA 2V82A 4GWEA 3B8VA 4JNZA 3VIIA 2A3CA 1QHPA 1QATA 1L2QA 4CNUA 2Z29A 4HYRA 2XH4A 3L4XA 4HNTA 1RQEA 3QTPA 3L66A 2NZLA 2AL2B 1P48A 1SJBA 3HF3A 2PP1A 4UOQA 3FX4A 1EL3A 4F3HA 3AMKA 3EWXA 4WY0A 1R2TA 2ACSA 4GI6A 3N3MA 2FZNA 3KTCA 5K9CA 4QJ5B 2CYGA 4JY9A 3TTSA 1KGXA 2P3ZA 1DORA 4ONVA 4M1RA 1I2QA 3VC5A 3KBMA 4A6GA 3EDKA 3UR8A 1BWLA 2I14A 1EDQA 2WPGA 1R6WA 4K68A 1XD1A 1BXCA 3VGHA 3PBVA 3OLEA 4Z1AA 5KZMA 4O0KA 2Y8KA 1MNSA 2XN1A 4JN6A 1W17A 4UTTA 2VZVA 4KT2A 4MSSA 3YPIA 6REQA 5A6BA 5I03A 1F5ZA 3KOYA 3P67A 1FH7A 1U5HA 1LM1A 1Y5VA 1PCKA 4S2BA 2OEKA 4P8WA 2VFIA 3BL3A 3E2VA 1DIOA 3UNDA 3ARXA 1UW9A 4C6FA 1TIMA 4BQ5A 1EB3A 1TE1A 1TFVA 4C90A 4QQUA 2CCRA 2GVJA 3TUUA 3MKCA 2NQ5A 4XZHA 4IXXA 1U22A 5LA2A 4M6UA 4XAPA 1WDQA 1B2YA 4GO9A 4EX4A 5ABFB 4L9ZA 2G50A 2GGHA 3BQ5A 3DFOA 3L4TA 1JAEA 1TVLA 3O6AA 1AUSL 4WDTA 4C6OA 1E40A 1W54A 4NAEA 3TMLA 3HQNA 3H4XA 3BZGA 1VC4A 3FEMA 3IGXA 3VFLA 4A05A 3WD0A 1NELA 2J4GA 2DJXA 3GC4A 1WAUA 2IPGA 4IGHA 1TWSA 3AROA 3GFYA 3LTSA 1CYGA 1JF6A 4J7RA 1SM9A 5L6UA 4ES4A 2DUXA 4DF2A 1FWFC 3NOYA 8CGTA 1GQJA 2DPEA 4I6VA 2OTDA 4BI7A 3VPLA 4PTVA 4W93A 1M7XA 3VDBA 4HK5A 5LIUX 1V3HA 4Z08A 2FKPA 2QDEA 2ZTJA 1OADA 1MI3A 5M2FX 2DVTA 2NUWA 4PMZA 5CBIA 3AS0A 3VDHA 4F2UA 3HPFA 2D23A 2HCVA 2I17A 3L65A 5G2WA 4W86A 1MEHA 1W37A 3EMCA 5A2AA 4PRWA 4HMNA 1XIBA 1RP8A 1UZHA 3RAOA 5EPDA 5H8PA 4LSBA 1UZDA 4QNEA 4NSBA 1FHDA 1SFTA 1JCTA 1Z44A 2Y1HA 1R7AA 3BUVA 2QUVA 1A5OC 4C5YA 5FIPA 1WXZA 1RALA 4RL3A 2YCIX 4Z1CA 1WBHA 3UZJA 2PWHA 1O94A 1W1TA 3JS3A 1GTHA 3WD4A 1CGVA 2BDQA 1FHVA 3II1A 1RBOB 2R24A 4O57A 2IPFA 1DTUA 3TQPA 1DWJM 3TV8A 1PEZA 1HKIA 1KFCA 2V5KA 3RRAA 3V16A 5JBEA 3WLMA 4HZ8A 1YDVA 4HBKA 1HKJA 4C1NB 5A8MA 2B0MA 3BMXA 3SGZA 1EJTC 4A3RA 1A3HA 1XLAA 1B3OA 1WX0A 2VFHA 4XTDA 4GCAA 1OINA 2YYUA 5FJJA 3IJQA 6XIMA 4L65A 3S0CA 1VENA 3SCNA 3P93A 4E2DA 1AG1O 3NA8A 4B9ZA 2BY2A 3P61A 5H8MA 2PGWA 3DI0A 3KDNA 2YCKX 1RPXA 3QLDA 3NL5A 1L0PA 1W6TA 1IXNA 4K7VA 1MW2A 2VDGA 1SFJA 4Q8UA 1G9HA 4RZBA 3OBKA 3LD5A 5CBJA 4IH3A 2PD9A 4JHZA 3UETA 1XIHA 1NFGA 3BWWA 4PTNA 1DIEA 3Q37A 4JDYA 3COTA 3W73A 4HN8A 2G97A 4PSRA 3QGVA 3MWCA 2F6KA 3H54A 1SW3A 4UWMA 3MDWA 4E2VA 3NUKA 3CHEA 1NVMA 3GHRA 1NP0A 1V6TA 4CNSA 5BU9A 1GNXA 4GJ1A 1WDRA 3N6HA 5CLWA 1XQLA 3ZLGA 4NX0A 1XYBA 1CPUA 3PZOA 3ZWSA 3R58A 3P6LA 2QCLA 4RV8A 2OJPA 1SVDA 3ABRA 5LA1A 2PDQA 3G24A 4AD0A 1HNYA 1XLFA 1H0IA 3TXVA 3BANA 3E0IA 5TIMA 2H90A 4GXMA 5HANA 1JDDA 3BAWA 2HVMA 1V0LA 2YXOA 3BLFA 2TODA 1Z7AA 1SW7A 2J7FA 3AO0A 2BXZA 3NO3A 3VNIA 1DBTA 1LT8A 3WSUA 1GHRA 1LZOA 1DWAM 3U2OA 4UTUA 1KCXA 5AN7A 1AD1A 5ABEA 1VBRA 3NZQA 1TR1A 1J93A 3PZUA 1M1BA 1UR0A 3CK5A 1HKVA 1W1A1 1H0GA 2EEXA 3QR3A 1WZAA 2CLEA 4AX7A 2DGAA 5HNUA 1CCWB 2C1GA 4KPLA 3H2CA 1WBJA 5HUOA 1LRTA 1PTAA 1A50A 3ZWTA 1EEXA 4GFIA 4B3KA 1US0A 4D6IA 1X8CA 2WANA 3W1TA 5ABTA 2BHUA 4AD2A 4M24A 2ZUSA 4C6DA 3R8GA 4UOZA 1WA3A 4QEHA 3W4RA 3LZ3A 4I5RA 2XTKA 3LCLA 3O16A 3AMLA 3CS2A 1L9WA 4N42A 5AYIA 3MDUA 1JCMP 2VZSA 4RPQA 5HR7A 4JFWA 1WP6A 1KWKA 3EOLA 3LXCA 4Q7NA 4G6CA 1WB0A 2BGNE 2VVSA 4G5DA 3ECQA 3IGUA 1E9IA 3N15A 1T0OA 5GJPA 4PMUA 5HWNA 1A5KC 3MHUA 4JTAA 5AHLA 2BNJA 4XZBA 2QT3A 1VBUA 4PB5A 1XYCA 1RUSA 3CWNA 3L0GA 5CC7A 3K1DA 4KMQA 4X60A 3UY7A 4PC8A 2W79A 4DX3A 2JKPA 3RLGA 3WK1A 3RFAA 2ISFA 2CHRA 2E25A 1W3KA 2DP3A 1V7AA 4PTDA 4MWAA 4G2DA 4IXHA 2VRJA 3TXZA 3MJYA 2ZZ5A 1TWIA 1B3XA 3HPZA 1O5RA 2ADAA 1XG3A 1E0UA 2NSXA 1JZ7A 4B90A 1ZCCA 4UTMA 4EOUA 4EXBA 4JNMA 3WLSA 4DBEA 1H7RA 3BV4A 3BSMA 3DZ1A 3STFA 3WJYA 4PBEA 1KLZA 1NQ6A 3VX0A 1RJQA 4UTFA 2F2KA 2QF7A 1UR4A 4B92A 4F0HA 4I5XA 4QLJA 4WUIA 4AMAA 1XM3A 2VR4A 3UW6A 2CU0A 3C2OA 2ALDA 4Q32A 2PZNA 2OKOA 1IV8A 4XQ6A 4H8NA 2VT0A 3IVTA 4XZLX 5BOEA 3AALA 3AZSA 3RR1A 2Q02A 3FJ6A 4LB4A 5CPOA 4HPHA 1TWZA 3MY9A 4ERGA 4YLWA 3LMYA 1XIFA 3UFYA 4A8NA 3ZLFA 3H21A 2AQVA 5FF2A 3LG3A 4QJ1A 1PZ1A 4AEEA 3FOKA 4WDWA 1VIZA 3C0JA 3TYBA 1M7PA 5H91A 2GWGA 1Q7MA 3XISA 3LTPA 3KBVA 1ME9A 2R14A 3IV3A 3UYCA 4IP7A 1A49A 2VQUA 3MUXA 4NNBA 5D9OA 4UNKA 1FWWA 1V03A 2R91A 3AXKA 2OG9A 2DZPA 1E9LA 1XDJA 5HATA 2YA1A 4REQA 5M03A 1RLCL 2ESCA 4ZO8A 2XN0A 4J3VA 3BVJA 3B05A 3ITVA 3PPFA 2VELA 3LHVA 2PDUA 1UB3A 1X98A 4IPJA 4FPSA 2ZOXA 1Y5XA 1WCGA 4NIRA 1I60A 1U2YA 2REQB 4O1CA 1TV5A 4UQ9A 3EWZA 5JQ9A 5BXTA 2VRQA 3ZR4A 3H53A 1M3UA 3R94A 3LCFA 4O1DA 1SZNA 3SI9A 3DU0A 4ZOAA 5M17A 3VNJA 1ZRQA 3ITYA 1Z48A 2BG5A 1DOSA 1BEUA 1Q8JA 4CU6A 2QPUA 4ZMGA 2X7VA 3PTMA 4O1AA 1DJYA 4IIFA 1B3YA 4GX9A 2QUMA 3ONBA 1B90A 4QBXA 3S5OA 2ZZ7A 1DE6A 1PWMA 2VHLA 2WCSA 5D4YA 5EMJA 5BMXA 4DUOA 4JTIA 4EANA 3OA5A 3VVGA 1EYEA 1BVWA 4DAIA 3AYTA 1H7WA 3C0SA 2NUYA 2OZ3A 3TLLA 3WDRA 4UFJA 3L0NA 2FFIA 7PTDA 2ZX6A 4IMDA 3UVIA 3GU9A 4B3ZA 1YNQA 3HOJA 3RN6A 2Z1BA 1ML1A 3SN4A 3VAVA 3ABOA 4F0SA 3HG4A 3UXAA 1G67A 2HK1A 5I6SA 1M6JA 4X2PA 2WQDA 2HS8A 2FZDA 4WOQA 4WKFA 1TTJA 3DG7A 5IOBA 2JEPA 3DG3A 1FDYA 3WFLA 1J18A 4MY8A 4HCDA 4R27A 3LXBA 2QGHA 1Q4NX 1H2JA 4NHVA 3REQA 3S47A 2VP8A 1L8NA 4K38A 5I3GA 1CGUA 3W88A 4S3BA 3RCNA 2TPSA 2NLYA 3EKLA 1YE6A 6ALDA 2WHMA 1AJ2A 3W72A 2DW6A 3NIYA 4RXFA 3WMCA 3A4JA 4ASTA 1RQBA 1OGGA 4AB4A 1JI1A 3W85A 1MZRA 1OFPA 2DIKA 2VMFA 1RBAA 3LCXA 1R7OA 3F2CA 4YHEA 2DH3A 3A3HA 2XGZA 1JL8A 4KQNA 1KV5A 1V3JA 2ZVRA 4GZJA 3WQ5A 3CT7A 1NWSA 1XI3A 3LGGA 4WY0B 3BOLA 5CC6A 1KR1A 4OJYA 3WUBA 3MSRA 4HA1A 3NZRA 4AAJA 1E51A 1ZY9A 5KETA 3W83A 4LAKA 5A6KA 1UBSA 3S6OA 1ENUA 1CXIA 2OEJA 1W1PA 5LXEA 3ATZA 4CNPA 4RE3A 1HL8A 1JR1A 4E3TA 2UY4A 4HSOA 4X3ZA 1CLKA 1OFRA 1GT8A 4U2YA 4U10A 1Q4WA 2ACRA 1J8VA 2CKSA 4NYYA 3E12A 3UR5A 2BHZA 1F2JA 1N82A 1Q85A 3IUHA 2VNCA 4CNTA 3PWGA 1B5TA 3MPGA 2HS6A 1SZRA 3OVPA 2QULA 3ITCA 2ON3A 5CAKA 3GUGA 4D71A 3PULA 1HIZA 4DHGA 1PIGA 4RPPA 4Q7BA 2PP3A 4XD3A 3AWOA 4Y9PA 5DMMA 3WFZA 5JMUA 4F0MA 1AW2A 2E3ZA 1HVXA 1C7SA 5GNYA 4FIQA 2F6XA 4S3AA 2YA2A 4C91A 4KCWA 2Y5JA 2BVWA 1ADSA 2RJHA 2PU0A 4FX6M 2NQHA 1FBAA 4S3FA 4UTJA 1FFRA 3I3EA 4E5TA 2WKJA 3OODA 1ITXA 4AIBA 4ATDA 4DQWA 4LY4A 3ABZA 2PCEA 3G5EA 3O0FA 2QQ6A 2OGJA 1EJ7L 4IUGA 3TIMA 3TAKA 1GJUA 4EPBC 1NTHA 3CIXA 1VPQA 4LFYA 3ALGA 1SU5A 3FVMA 4M51A 4WJEA 1G01A 4EKJA 4AQLA 1E5JA 1OK6A 4ZOCA 1XLDA 3U0HA 3R6IA 4PUNA 4TR9A 3W26A 2CNCA 4C6BA 3UY8A 3NEVA 4PTXA 4FXJA 4OV9A 1JUEA 3P3BA 3TLQA 2QVNA 4TTUA 1OVDA 1TV4A 4DM2A 2NWSA 4JFVA 1HL2A 4HQVA 5FJPA 2F61A 2C18A 4G9PA 4MVAA 1J0IA 3H2NA 3W28A 3EDEA 4V33A 4IIBA 1ZFJA 5FF4A 1CBGA 5FJRA 4DJED 3UCQA 4Z42C 1POKA 5A6AA 4MUZA 2O9TA 5REQA 4TMCA 1WKEA 1OM0A 1XPYA 3GH4A 3NSXA 3KWSA 4HK6A 3G0SA 1EH9A 4KCTA 3DYPA 4PMJA 4N02A 4I9TA 1SJCA 4GCXA 3IPWA 4X9YA 1XH1A 4B15A 4GI8A 5BZAA 1OC5A 2FGBA 2PLCA 1BGAA 5F1UA 1XPGA 4LXFA 4RW3A 1AODA 4MDPA 8RUCA 2OYMA 4TXEA 1IR2A 1KW1A 3EA1A 2PWFA 5I00A 5T26A 4CQDA 3OZMA 4P8XA 3A21A 3TX9A 5CGQA 3ANVA 4FMVA 5LGZA 1KRMA 4LAZA 4CD7A 1MRQA 1XRTA 5AB3A 4PRTA 1QO2A 4ACYA 4AD4A 1JGIA 3GXMA 3VNZA 1X1NA 3W87A 4V27A 1AQ0A 2XH0A 4OOZA 1VRXA 3QKEA 3VMNA 2E8ZA 2OOGA 2WNNA 5DMYA 1HZYA 1E15A 4GYPC 2PDGA 4OT7A 2Z25A 3DDMA 4W8BA 1GUVA 4NAFB 3TQKA 4ATLA 2HDJA 1A5CA 1F73A 1TWWA 2WZTA 2BY1A 3KTSA 3NZ1A 1CW2A 4TVDA 1T7LA 2IQDA 4CCDA 3LXAA 3WQVA 1QVBA 3KUMA 4N7QA 3H24A 3WNKA 3RO8A 1L6GA 4FR6A 3GW3A 3GXFA 4J3UA 4NI3A 2BGQA 2FGZA 3BC9A 3G1DA 1QASA 5HA7A 3W7EA 6XIAA 1Q2SA 1GVRA 4ADSA 1MRAA 2GJRA 3WQWA 1EHNA 1JZ3A 4GO8A 3TFCA 4A35A 1GQKA 1ICPA 5A95A 1V6YA 1EXPA 1Z41A 1VYPX 1I9CB 2YZ5A 1WNOA 4KWWA 4KWUA 3I68A 1QCWA 4FX8A 2FPYA 2OEMA 3QPYA 3SR7A 2J24A 2NX9A 2QVHA 4J3ZA 3FVDA 1TMQA 1TKKA 3CNYA 1JPKA 4RZ4A 1C8QA 2QV5A 1PZ3A 1UKQA 1TJ2A 3AIEA 2OU4A 3WUFA 4XSMA 3W37A 4QHRA 1ZJHA 5ECUA 3LHTA 3TYDA 2YSWA 3M0JA 3SQLA 3WL1A 5AVHA 4M29A 2WSQA 1KCKA 3AXHA 4HNUA 2G95A 3GO2A 1JCLA 2XWEA 3T0DA 3DI1A 5D8WA 3QMSA 1K02A 4C6CA 4KERA 3IARA 5LNRA 1HG3A 4MZYA 2A1YA 4XWUA 1BFNA 1W5PA 5HJYA 1IHIA 3UGRA 2PDYA 1F4AA 1AW1A 3VKCA 3TSBA 3QV8A 3THAA 1LWHA 2MANA 4NZ5A 4DWDA 4PMYA 3GH7A 4L1WA 2CBUA 1NEYA 1RCQA 3JU2A 1KKRA 2WSRA 5JU6A 1XF0A 1YPIA 3W0KA 1QWGA 5TD4A 3CUIA 4JIRA 2QDDA 4Y6GA 2UV8G 3T7VA 1CZ1A 2GPTA 2BV9A 2E1WA 2PBGA 3I6EA 4HPGA 4D6DA 1GG1A 4KRTA 3VGBA 4Q33A 5J5DA 1A3XA 4GIRA 2PDBA 2EJ1A 2QJJA 3CL8A 1OC7A 1A0CA 3FA4A 4KH2A 2WAGA 1DQUA 5GJNA 3DERA 3QHMA 3ES8A 2XSXA 2QEZA 3CHVA 2ZUMA 2FPTA 3GZAA 3AIWA 1PIFA 1E5NA 4GX8A 3SQMA 2D2JA 4H6EA 1L6YA 1OZMA 4P8VA 2C3ZA 3TWBA 3LK6A 2PF0A 3EOUA 4L1GA 3D46A 5FSEC 1J11A 5CEWA 4GKLA 1OK4A 2WBKA 3L2MA 1GVOA 4TVUA 4BF9A 2OQYA 4JKLA 1LQAA 1MQRA 1B54A 1BWVA 1H41A 2Y0FA 2G4FA 2IMRA 2WMJA 2FMNA 2OR2A 2WM1A 2J25A 4N4PA 3ARTA 4LALA 3A12A 4GC3A 4XVEA 4CQ8A 1NY1A 2HXTA 3TE9A 1GOXA 4IPIA 1E6NA 1PKMA 1MXGA 4PCTA 5F4WA 3ITGA 3N2CA 2XISA 2J7HA 2QUNA 2FHFA 4PMQA 3S5SA 3RJYA 4JQ2A 5E9XA 1WZKA 3RCYA 5CJNA 1OBAA 2G4JA 3BAJA 2PFHA 1D2KA 3WLIA 4XO7A 1PYFA 1O5KA 1QOPA 1CGYA 1SJAA 3GKFA 2X30A 4PYSA 3STCA 3CTTA 1N8WA 1Q2RA 3AYVA 3R89A 3W3OA 1HVQA 4GC4A 3NR0A 1EWDA 1ZALA 2GVLA 2FHCA 3AU2A 3SN1A 2V8ZA 4G56A 3CMFA 3EXSA 1FKXA 1GQIA 3W00A 4DF1A 4JTKA 3GTHA 3GTIA 2V3GA 1SR0A 1YMYA 1EP2A 1KM6A 2PDXA 1DIKA 1VCGA 4N4QA 5CXPA 3AIRA 4V1YA 5ABFA 5I3IA 1EA0A 5C9UA 1OG0A 3TQ0A 4ACZA 3N04A 5IXEA 1EGMA 4J4KA 5E70A 3CAKA 5FESA 3HM7A 3WH6A 2DJLA 3W1NA 1CIUA 2YCEA 2ZRYA 1QXLA 2C15A 3N9KA 2G0WA 4OECA 3OEXA 3OZOA 4J2MA 3TJ4A 2HBVA 4QEEA 3N6JA 2W61A 3W23A 3M5VA 5KITA 3PAOA 3MA8A 2CWXA 2OB3A 3W29A 4REQB 3PZTA 1PX3A 2R1MA 3TAOA 3R13A 4MNKA 2DVUA 1GVIA 4GQBA 1NARA 2OX1A 4L6OA 4MM1A 4D6JA 1BG4A 2J13A 3HIJA 2XYLA 3UEQA 4AVFA 5HK4A 1Y0EA 5HNRA 1A4MA 4O19A 3W1PA 7ODCA 3BGGA 4JICA 3NG3A 1X7FA 5HOSA 4ORIA 4IG2B 3L68A 7XIMA 4O12A 2FDSA 4QR6A 1PAMA 4WD0A 3SUWA 4US5D 3KM8A 4L4OA 3UNTA 2E9LA 2PWEA 4AXKA 2GQAA 5E0KA 4MY9A 1TIWA 2PCQA 5HMDA 5BXSA 1LTDA 1YPFA 3QN3A 4QE4A 3AXIA 1LP6A 1VFSA 1VFMA 1GVQA 1Q6FA 1TQJA 2P8BA 2OZ8A 2AQOA 4EF8A 5EMUA 2NV1A 4NKCA 1GOMA 1X6UA 1U33A 4KFNA 3N1AA 2JGYA 2PTXA 8XIMA 3HMJG 2IKGA 2V5DA 2GDQA 1IT7A 1CXHA 4DYJA 5GJMA 4Y7EA 1E71M 1CENA 1R3QA 2V5JA 4GVGA 2FB2A 3IK4A 3W81A 4C1LA 3VD3A 1KGWA 4P7NA 3MCMA 4DVOA 2O92A 1FXQA 3MV01 3S1VA 3CH9A 4WRHA 3A13A 2V67A 1K8XA 2E68A 3TYEA 4HJFA 4NX5A 1V3KA 2QAFA 4IGSA 3MYOA 4JIPA 2Y7DA 4MY1A 4WVXA 3TNBA 3W82A 4O0ZA 4IPPA 5CPSA 5HWJA 1UR1A 1JVNA 1ZJAA 4LANA 1L6FA 3UWUA 1BF2A 4NY2A 4FX7A 2Q6ZA 1MEIA 3U57A 4JIEA 1O68A 2JIWA 3CUHA 5DF0A 3TDFA 4N9EA 3AYRA 5A94A 3ZR5A 4H04A 5A6SA 1S46A 3EBVA 2WSKA 3AIVA 3V1PA 4DBUA 3DBPA 3KFTA 2Z7KA 2ZTKA 5FJUA 4F0RA 2AGKA 3SCWA 1BGGA 1ZU8A 3WZ0E 3GK0A 5D9PA 4NNAA 3ZJ7A 2ONEA 3BOXA 5HDRA 5K2ZA 2I9EA 4AIUA 2XIJA 3I6RA 5T91A 4JPGA 1VQTA 2J9YA 3SECA 1ISYA 1R3RA 1IIGA 3A23A 4RZ6A 3I3DA 1V02E 3VUPA 5G2HA 3RG6A 3ZSTA 1VIWA 1ONXA 3R43A 4M1BA 3VM5A 4EWND 3CV6A 2A6NA 3OG2A 4CKQA 3IAPA 3LI1A 5GVJA 3LHZA 1E72M 3M5ZA 4DRSA 1G4PA 1LRQA 1MZHA 2VC6A 3OO2A 3UCDA 1R85A 1EPXA 1ZL1A 4JR5A 1BTCA 1TRDA 2DZXA 1TE6A 4M0XA 1AZ1A 4LNCA 5C9RA 3LCIA 2FZ9A 1I0DA 4UXDA 2INZA 1LBLA 1I45A 3V7PA 4K3ZA 4PZVA 3C0LA 1KV8A 5FEZA 4QROA 4XISA 4OZOA 2DORA 2PRHA 2FVKA 4R34A 2YXXA 4QNWA 2YDSA 4UQEA 3WJSA 3CIVA 4QAIA 3ARWA 4NZ1A 4NAEB 1ICSA 4DWSB 2GUBA 4AIEA 3R4IA 1R46A 4I6KA 3AS1A 4L1XA 4HNCA 3KP0A 2NVCA 5F1VA 3UJEA 4H4IA 4O1EA 1GKPA 1M04A 3WMSA 4KEMA 1W3LA 3LNPA 3PHAA 5K3VA 3RM8A 1CGTA 1VGAA 2FTYA 4ACZB 3L23A 2PGFA 1H1YA 2XVNA 4H8UA 4YXGA 2WCGA 3WBWA 1K6AA 4JHMA 4RKAA 2W27A 1ZCOA 2E28A 4J3XA 1K7XA 1Q7ZA 1LUCA 1ZP3A 4UNLA 5A69A 2DT2A 3VK5A 1J6PA 1XCWA 3NVDA 1SW0A 1ITQA 1V6XA 3NPUA 4L4MA 2CZVA 3W2NA 4LT9A 5MKGB 1YBQA 3VCNA 3SCTA 4O16A 4GD0A 4LF1A 3R0DA 4UR9A 3IJ9A 3KAOA 3VNKA 4JTLA 1UC4A 2I5IA 4O13A 3PTDA 3P80A 3FW6A 3CUZA 1TPH1 5CPNA 2ZKMX 4KEVA 3CO4A 3S42A 3G3MA 1ODZA 3T4CA 3ARSA 3L21A 4OBSA 4GUHA 3H6OA 3WH5A 1VS1A 1EOKA 4HA3A 3RPDA 1X1OA 1MFUA 3WMBA 3W70A 1W5OA 1UUMA 1UR3M 2YLAA 3I7RA 3ARPA 1SFSA 2OX4A 3SDOA 2PS2A 2FHBA 3UJRA 3W7PA 1MDRA 4LVGA 4S39A 2QS8A 2BLEA 3PG8A 3OQ8A 4B2DD 1XCFA 3DHPA 4BF5A 3RRXA 2FJKA 2ODOA 1A5AA 2C19A 1QK2A 3TWAA 3NL6A 4LYQA 1TV8A 3BO9A 4ICMA 3VZXA 1YW1A 1HJSA 3CTLA 4N6EA 1OD8A 2VQTA 4Q8PA 5A2BA 1C8VA 2IKJA 4E0CA 3U7BA 1M5WA 3BH4A 4DJFC 3P74A 1AZ2A 4JTSA 3PBWA 2TYSA 4O8AA 3G6LA 4W5ZA 3STGA 4A29A 1NIUA 2WO5A 2QCHA 1XWYA 3C86A 4JN8A 1UOKA 3GW0A 5M5DA 4KCUA 4XX6A 1S39A 1M01A 2DZWA 5XIAA 3GDKA 3GM8A 3JZUA 4M8UA 3UWZA 4F2BA 1NU5A 3F2DA 1C8YA 1Z8AA 4XZWA 3WBXA 5LNSA 2J7EA 4JDBA 3ZJKA 4RUBA 3GU2A 2E5CA 1L2UA 2QCCA 5AYZA 3TW7A 2R9RA 4IMEA 2Z0IA 1VBGA 4QAWA 1ZSXA 4I90A 5A6LA 3G6MA 4LEQA 3VC6A 3V0UA 1M41A 2OXNA 2ZC1A 4K8HA 4MJMA 1CB7B 1OCQA 1DE5A 2VOTA 1ONRA 2QF8A 1MMFA 2VUYA 2ZUVA 1OYBA 1EZ2A 4A22A 2FIQA 3GYEA 1VFTA 5E09A 3IJIA 1ZAIA 2PE4A 3Q65A 3SCSA 1XRSA 2Y6ZA 4ZVJA 4R85A 4CD4A 4K8EA 4AWEA 3SQSA 1V3IA 1H3GA 1LCOA 2ABBA 2I5GA 4JY8A 2W62A 4HA4A 3LPFA 2ZQ0A 2CBIA 3WNMA 1NOWA 4GGHA 1C7TA 3PM6A 1FUYA 1O7AA 2QMKA 3C2VA 4Q4KA 3L4WA 2D24A 3A5FA 2GJXB 1TJRA 4NRRA 1XFCA 4BI5A 2ZZ6A 2VDIA 5AC8A 5CJ5A 5DY3A 1W3NA 4AY8A 2CW6A 1R3SA 4AYGA 1SFLA 4R53A 4YS1A 2C0AA 1EJVC 4K1WA 2OZ0A 4HPXA 3D5HA 2XH2A 3CEPA 3IIZA 1XX1A 3IK2A 4UTTC 3BLKA 3NAVA 2WK2A 2E6DA 2Z4GA 1B3VA 3AZRA 5JVLA 2WHJA 3QXBA 4AUBA 4A3QA 3OG3A 3VNMA 4B5NA 3KRUA 3LU2A 5E1QA 4U33A 1V0NA 1EBHA 4WDUA 4JKKA 2Z1VA 1HP4A 1DJIA 3IVUA 3B0XA 4GQGA 4DELA 4H9XA 4J28A 3M47A 3WF2A 4ILSA 1FX6A 1XJBA 1VJSA 1K9DA 1QK0A 3LRLA 3OGSA 2QMJA 3FJLA 2WZHA 4IJBA 3B06A 2ZZ3A 3QSRA 3VYLA 3P5ZA 3URAA 4XZNX 4AZBA 4AZHA 2YB1A 1IT0A 3WQCA 4LQ1A 3S2NA 2EF9A 2JE8A 2X40A 1O6IA 3M0ZA 1JFHA 2DW7A 4MNLA 2ZZ4A 1EUAA 4DI8A 2QJMA 1G69A 5L9FA 4R5EA 4AWTA 1G1YA 5CGMA 1B31A 4KW2A 1QNPA 2IS7A 4MFEA 3IJ8A 3PBMA 4Z2LA 3GR4A 3V4BA 1UPPA 3UXIA 1QOXA 1U1HA 2VZTA 2XZ9A 1UQYA 4R33A 3CQIA 1VHCA 4HCHA 4DIAA 5C9XA 3MBDA 2PMQA 4ZE5A 2WOQA 3TROA 2XZ7A 3CT2A 1V3MA 2HTMA 2W6RA 1SQ7A 4S3EA 1UJPA 4TVCA 4JQ4A 1U83A 4GMEA 1EIBA 5JIWA 3ARQA 5LSMA 5A8NA 4AHPA 4CNOA 3I3BA 4LV4A 4JTGA 4L61A 1QPQA 4LF2A 3XIMA 4Z2KA 2CZEA 3PAJA 3D0CA 2UBPC 5LIYX 3PN8A 4E4PA 4IIGA 2WB5A 3IVSA 4MG4A 4AYSA 4IM4A 1UROA 2X42A 4KRZA 4PUEA 1CXKA 1M7JA 1XP3A 4G7EB 4XVDA 2Y7GA 4YHGA 2P50A 3PJTA 1DHPA 2F9RA 4I9JA 5LNVA 3AIUA 3CV7A 1XIDA 4Z1DA 1Q7QA 3GNPA 4AX6A 1XUUA 2PLMA 4S23A 2JQXA 2ZE3A 2NT1A 4GBUA 9XIMA 1UCWA 2QV4A 1V3LA 1KCZA 1PCWA 3RM9A 2NQ9A 2XVGA 1HP5A 3G1HA 2VC9A 2OLHA 2NWRA 4W7WA 3W24A 3WYZA 3WX7A 4BF7A 1UR8A 4LAOA 5AYBA 2A2IA 1WOBA 3RUBL 4UFHA 1LT7A 1UD2A 2J62A 3MT1A 3HGOA 3BAYA 3BDKA 2QW5A 2QCDA 5I78A 4AU0A 4FO4A 3DC0A 1H7OA 2ZX7A 2OYLA 2Z6IA 4GFSA 2VXNA 5E0CA 2WMHA 1P0BA 4CVUA 1QI5A 2C71A 1HX0A 5D32A 2CZ5A 4HMDA 3PZQA 1FQ0A 4TX6A 2CERA 3QF0A 3BSHA 4C65A 1UH3A 5DT5A 1I2RA 3KX6A 1Q3NA 3GTFA 3IV8A 3OBEA 4Q4SA 3VDGA 2REQA 1EC8A 4ZA0A 4C6QA 5C8BB 3GR7A 4XD5A 3O63A 2YA0A 1Y65A 3WD3A 3EWCA 1OCBA 1OGSA 3CMJA 1EOMA 1DXFA 4JTJA 4M5PA 3WLLA 1IWPA 3N11A 3VGGA 5E6ZA 1PSCA 4JL1A 2R1LA 4UMAA 3WNNA 4Z1YA 2QPSA 2ZXAA 3BG5A 2E0PA 3NO1A 2ISDA 3M0MA 2OQHA 2WHKA 4G1KA 4QE5A 5BRPA 7REQA 3AAMA 1K77A 2PURA 3NSMA 4O54A 2VI0A 4C6KA 1DL3A 4W87A 2EPKX 4OUIA 3O0KA 2PEVA 5IM51 3KP1A 4O28A 4HU0A 1K9TA 1UPMB 2YDAA 2FFCA 3EWUA 3O6CA 1TTIA 2ANUA 2P3EA 2WVUA 1YDOA 1Y8BA 2P5NA 3L2LA 3MQTA 4RNHA 5HXMA 5H6HA 5HNNA 1IF2A 1P6BA 3HFYA 1JIBA 4DZ5A 4ZCWA 4J2PA 3EKZA 1MYRA 2VGFA 1F8IA 1BYDA 5C9ZA 3IUIA 2YKKA 1E55A 4IISA 3K30A 1ZQ5A 3BCJA 2CXGA 3DBNA 3RR4A 5BMWA 4FR1A 1S2WA 3PB2A 2ZXQA 2J9XA 4FP1A 4H00A 2HSAA 5D2XA 2HBXA 1JPHA 1QMLA 1TWDA 5A3HA 2PTZA 4QFUA 2VCAA 3FDKA 3HGJA 3U9IA 3W7HA 3L5MA 3E0LA 1UZ1A 1AFSA 2NUXA 2QHAA 4Z0SA 1HJQA 2Y7FA 3E2SA 1US3A 2XFYA 3L67A 3L2IA 3LI0A 3T44A 1REQA 4QLLA 4NQ1A 5CGTA 2GFTA 4GZEA 1Q6EA 4DM1A 4E3VA 1EDTA 4QP0A 4DJDD 1BKHA 1H50A 1JNDA 2EPNA 4Q8WA 1KC7A 4NAFA 1S1RA 2DZTA 3DFPA 1TUFA 4FNSA 1SSDA 3H12A 2J6XA 3S8HA 2J74A 3UESA 2PPGA 4P7RA 1DWGM 3N13A 3B0YA 4EVZA 2A6LA 1YYAA 1KFJA 2B7NA 1KM0A 1I4NA 3TR9A 4QDWA 3MSDA 2HEJA 3GXPA 1SR9A 1NAL1 3DHUA 1OX4B 3DHFA 2PWVA 4QSHA 5DBTA 3NGFA 3BW2A 4B4FA 4L4LA 1KNWA 3TCSA 1UKTA 1CNVA 1QPRA 3EMZA 3FCPA 2EXOA 4OV4A 3RO6A 5JIPA 4DUVA 2OWCA 1LOLA 1V93A 3UG3A 2VX5A 4D9PA 1E1FA 4A4AA 4O11A 1P6WA 2Y7EA 3IACA 2J47A 1O1ZA 4JFUA 4OFCA 3KZSA 1XFBA 1XW8A 3M7WA 3VMOA 2YXGA 5HQEA 2GDUA 2DU2A 3H7UA 3Q45A 1VR6A 1BVNP 1F76A 4FXFA 3M5YA 3C8NA 4PTWA 4GIYA 1PBGA 4N6FA 1OX6A 2DQWA 4PB4A 3FV9A 2AGTA 4JIIX 2OZTA 4IFKB 1Y7VA 2EPOA 4H9ZA 1IQ8A 5CSRA 1SMDA 1OG6A 1OFEA 4JAWA 4HCLA 2YOCA 2FMOA 1EF2A 2Q8XA 1E6RA 2YPIA 1TZ7A 3MMWA 2WLYA 3OGRA 5FJOA 2INFA 5JBDA 3N3TA 2YR1A 2B81A 3C56A 1UD6A 1N8IA 3GWQA 2CWNA 4UFKA 4UBPC 3AHVA 4Y90A 4MYXA 2RAGA 3GG7A 1G94A 1YTDA 4O53A 1XDMA 1SO4A 2WKLA 4XAYA 1I2NA 3RLHA 2ATMA 2ZA3A 3EDDA 2RKXA 1BXBA 3MSYA 4HK7A 4NJIA 5HQMA 1KO0A 1OHLA 3WLTA 5FOOA 1D8WA 3VIMA 4XSLA 2NQLA 2EG7A 3E0FA 1J10A 3TW9A 2JK2A 3DEQA 1W3IA 1T6MA 2WC4A 3K8LA 4NJKA 3SRHA 1J0YA 1GVSA 3CZ8A 1US2A 3UPMA 5DMNA 1GEQA 3VKDA 4E4UA 3CC1A 2Y8UA 1KTNA 1A5UA 4B5WA 1OF6A 2YCJA 3WD2A 1ZLPA 3WFAA 3T2OA 4D8ZA 4I9AA 5JBFA 1W1VA 2WCAA 3CZKA 3RM4A 1R8LA 1MQQA 3PFMA 5FF7A 2OYKA 3WUGA 4W8LA 1EHAA 3VKJA 1RXOB 2PTWA 4RCXA 3WQDA 4MB1A 3PTKA 3AHTA 3MO7A 1YBQB 2D0FA 2B4GA 3GNRA 2Y88A 4BQ2A 2GUUA 2Z2BA 1WOAA 1G7VA 1F6PA 3PG9A 3VE7A 1R9XA 1QWKA 3NQ6A 1TO3A 1V51A 2CHOA 4ECLA 1QNRA 4QDPA 5HMFA 1K9FA 7REQB 4MNMA 5K4ZA 3QEZA 2WLZA 2WSYA 2YZRA 3CH0A 2FVLA 1EJWC 3CUJA 1GQLA 4RW5A 4O52A 4DWSD 5I0DA 4LX4A 4YMZA 3QQWA 3M07A 1PB0A 3QYQA 2J7DA 3DGBA 1K1DA 1NDWA 1JDCA 3VMPA 1JRBA 2OELA 5KINA 1EGZA 3OLGA 1F4HA 4IJRA 1YXDA 4AZIA 4N0RA 4XUYA 4FNPA 4XBJA 2V69A 1IE7C 5FKYA 1H5YA 4GG9A 4XKMA 1RH9A 4TX8A 1A80A 2WQPA 5AY7A 1CECA 5DT7A 3UZYA 1MWOA 1P7TB 4R9OA 4BQ3A 4OUEA 3MTWA 3ZFHA 4AIOA 2A7RA 2JFEX 4ZO6A 4YWSA 3POCA 2AAMA 2CKRA 2D3NA 1JUKA 3OOQA 2XIIA 3TJIA 4CD6A 4ZQMA 1Z9AA 1OF8A 3LY0A 1E56A 5EBAA 2F84A 3WEZA 3T09A 3EB3A 1ODUA 2DQXA 4Q8TA 1PX8A 2G41A 4BZYA 1HO1A 4J27A 1OSEA 2HNEA 3ITOA 1W9XA 1UHVA 5CG7A 4L6DA 5JUVA 3DFNA 1RR2A 1AK5A 3W22A 2J88A 1CGXA 3R0UA 4M6VA 4NU7A 2ZWZA 1M68A 2YBVA 1E9ZB 3UXDA 1XCXA 1S5WA 1E4LA 1UOZA 2GLKA 3S1GA 4GYKA 2PWUA 1RCXB 3RX4A 4Z0JA 2HWGA 1KM3A 4H1ZA 1OGBA 3PPCA 4X61A 4GLEA 1UMYA 3FK4A 2ZUWA 1T41A 3ZM8A 1LL6A 4BHYA 5BXPA 3B4YA 2W91A 4JL2A 2A3EA 5HINA 2RH9A 1DJQA 3BXWA 1DQWA 2WZEA 4NXKA 1L6WA 4KS0A 2RUSA 3UWVA 2WSPA 3QH2A 1AQHA 3RGTA 4WGXA 4PCPA 2NXGA 1XS2A 3G1XA 4IICA 1ISWA 1IZJA 3LTYA 2POTA 1A5MC 2KZHA 1JPIA 1TSIA 1FWHC 3TJLA 3GZ3A 3M1ZA 2W0UA 3AJXA 3UXLA 9CGTA 4M7TA 3STPA 4L9YA 2J79A 1JYVA 4RDWA 2SFPA 2RGMA 4AISA 3CHDA 2Y8VA 1IEXA 3SURA 1WZLA 3GNNA 4ZSUA 3W6MA 4AY7A 1UWIA 2ZRXA 4HHHA 5GPRA 5IHRA 3WH7A 4HOZA 4O18A 3EX1A 1VFOA 4QM1A 3B9AA 1F7BA 2GGEA 2PD5A 3IJDA 4DO6A 2YL5A 3A5VA 2PC8A 1KRAC 2R1KA 5G2IA 3AHZA 4UZSA 3BURA 4ZQOA 5I3FA 4K6AA 3IJ7A 1C93A 1YLVA 4M82A 4DLMA 5FJTA 2BP1A 1W1B1 1G4SA 2XVKA 3K4DA 3SRDA 3RNDA 1Z89A 5I79A 3NYZA 4XAFA 4MDOA 2JGQA 3PZIA 5KSWA 2UY3A 1ZGDA 3CUXA 1RK5A 3HG5A 3NQ7A 2OPJA 4BCEA 3I4KA 4S3KA 1TJ0A 1W1ZA 2ZA2A 5BRQA 1OZQA 3QZEA 3MV11 1QHOA 2P10A 1UD8A 1N2VA 3WDQA 2PGEA 3WQ6A 5A6BD 3NQVA 3HMCA 3W7QA 3E5PA 1LQ0A 1M03A 3UWEA 2CITA 2A3HA 2NSOA 4XZ9A 2J8GA 2BGSA<