3S42A

Crystal structure of the 3-dehydroquinate dehydratase (arod) from salmonella enterica typhimurium lt2 with malonate and boric acid at the active site
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
260
structure length
259
Chain Sequence
NLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTIDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Crystal Structure of the 3-Dehydroquinate Dehydratase (aroD) from Salmonella enterica Typhimurium LT2 with Malonate and Boric Acid at the Active Site
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 104
structure length 259
sequence length 260
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3s42A00
3GNDA 3W1AA 1GZGA 2ABBA 2PE4A 3PY2A 1I4NA 3OHIA 5KMYA 5L9FA 5D33A 1GVOA 5U4NA 3FKRA 1PS9A 4LT9A 1PIIA 2FPYA 1K7FA 2ZZ2A 5E1QA 2YCEA 4JNMA 4N9BA 3G1XA 1EP3A 2QUVA 1M7OA 3W1UA 3OVQA 1OK6A 1A5CA 3C2RA 2Y89A 1WOBA 2JGYA 3B06A 2V2CA 2VFFA 4AXKA 3O15A 4ZZ9A 4R53A 4NJGA 1H7NA 3BLEA 4UFHA 4DPPA 2J27A 3UY7A 4N02A 5K9XA 1FY6A 1YXDA 3GDMA 3CEPA 1ICPA 3A24A 2CLFA 4NJKA 1QFEA 2A4AA 4JICA 2WOQA 5BMWA 3FKKA 5KZDA 1R2TA 4UTHA 1P4CA 3TMQA 3I7QA 1QMLA 3HMJG 3NM1A 4IMGA 3LHUA 4XUGA 3O06A 3BPWA 2NUYA 4JY9A 3OBKA 1V7YA 3BK0A 1A5BA 5EL1A 5KTLA 3MBDA 3VKJA 3W1RA 3GDKA 4KWWA 2V5LA 5L6UA 1FBAA 1QCWA 4Z0JA 4N9DA 4RK8A 1KFBA 2DJLA 1Q6QA 4AWUA 1EP1A 2WO5A 3W7KA 5G1TA 3PS7A 1SW3A 4CNNA 3LHYA 1FWWA 2RFGA 5D03A 5I3IA 3MHFA 2WSQA 3W86A 3L21A 3TSBA 2E1DA 1F74A 1K7EA 2A7NA 3M44A 1OFAA 2ZRVA 3E02A 3NQGA 1QO2A 4PODA 3TC7A 1OX4A 4CNPA 1DJNA 5C2XA 2QCLA 2H3BA 1BWLA 2I14A 2I1OA 3RU6A 1WV2A 2YFOA 3NQMA 4JY8A 5AHNA 1SO4A 4K39A 3W83A 1U5JA 5CSSA 3S1VA 4FX7A 5FEPA 3CT7A 1ME8A 3NOEA 1KLZA 1B3OA 1JVNA 4O1CA 3W7PA 3THQA 4A22A 4OQVA 5CPNA 1TYGA 1IXQA 4FNUA 1JQXA 4MPQA 1JCXA 1WAUA 3HGRA 3TKFA 2DU2A 5DXYA 1AL7A 1Z41A 3PAJA 1WBHA 2QEZA 1JULA 3NQ8A 3NQ6A 4WD0A 3S0CA 3BG5A 5TIMA 5F4SA 1GEQA 1TTQA 1ZENA 2LLEA 3BV4A 5HWJA 4HT3A 2QDHA 4LVGA 1LBMA 4IXHA 1TPH1 2ZDRA 2B7NA 3L5AA 1GG0A 2TPSA 4M7TA 4UC5A 1Y0EA 3IIPA 1BWKA 1ME7A 4UFMA 4PH6A 3EB2A 4WX2A 4WXZA 5EYWA 4LC6A 3W1NA 4HNVA 3LI0A 4JXCA 4TU1A 3GKAA 3N73A 4O15A 4UIOA 3C3NA 3SIZA 3HO8A 3NXFA 1EA0A 1TPUA 4EF8A 1TJPA 1VJIA 3CWOX 4I7UA 1GVQA 4N6FA 2OT0A 4M6VA 3UWQA 1FDYA 1AMKA 4ICNA 5HJLA 3KFTA 3PG8A 2J88A 3W1QA 2R14A 1P0NA 3DFNA 4XTIA 1OYCA 4CCEA 5BRBA 1IXOA 5D2VA 2X1TA 4H6KA 1Q6OA 1GG1A 2RDTA 4HSNA 4NVTA 2W0UA 1T0OA 3W7QA 5AYXA 1H7OA 4AB4A 3UPWA 3W7NA 1SO5A 3N34A 1JCMP 2E68A 3QYQA 3EX3A 3LERA 3U2OA 1YTDA 2CLEA 5CZ0A 1TCDA 1O5KA 5A8GA 2OCZA 4R7JA 5D30A 2PCQA 1XDMA 4DF1A 1TV7A 4MVAA 1NEYA 1RVGA 1H50A 3G1HA 1SUXA 3TROA 3U8GA 1HL2A 1VYPX 3GX9A 1GTEA 4XWUA 4N2YA 5K2ZA 3LTSA 4MUZA 3G8EA 2D73A 4BFAA 2QCDB 2GVGA 1KM4A 3W84A 1VYRA 3NYZA 3TDFA 5AB3A 2VC6A 3GNNA 1F6PA 1IIGA 3W2JA 3NDOA 3L5MA 2V8ZA 1KFEA 1W1ZA 3TJLA 3W2UA 4O28A 3HG4A 2BX7A 5LNRA 4AWTA 4ZL1A 4K6AA 1GYNA 3T78A 1AG1O 5DLCA 1SQ7A 2Y61A 2FPTA 2P0OA 2C19A 2WV8A 3T7VA 1YDOA 1ALDA 1L6SA 2Z2UA 1M7PA 4MZYA 3N3MA 4GUIA 1H61A 1GYLA 1XBVA 2TMDA 2QAFA 3O05A 3EEGA 4GXMA 4AF0B 4QM1A 2VEPA 2DZVA 4HNNA 4IPIA 1FDZA 2DZUA 3LCIA 1ZAHA 4N6EA 4NZFA 4O1DA 2Q8LA 3LB0A 4GFSA 4OE7A 2ZRUA 4R34A 1YXCA 1HTIA 1TRDA 3PR2A 3GXTA 1CW2A 3M5XA 4UR8A 3DHDA 1TPVA 3BG3A 2TRSA 4FX8A 1U83A 3MUXA 3LHWA 4I7VA 3W7DA 4GWEA 4QAIA 1TREA 1Q6RA 2XN0A 3L66A 3PC0A 2NLIA 4E2BA 2C13A 1SZEA 4CQAA 2ISVA 1JCYA 2X1SA 2QCMA 4S2BA 1DV7A 4ZQPA 3CIXA 3TMLA 3KRZA 4RCXA 2A0NA 1VS1A 1C29A 2AAMA 3A22A 4O53A 2ZYFA 4QNWA 3WJWA 3QF0A 1QPQA 1VH7A 1W5OA 4OT7A 5DN1A 5K4XA 4Z1AA 1Z44A 3VFLA 4JEQA 1ZNNA 3PF3A 2EF9A 4YXGA 4YL2A 4O4WA 3CIWA 3BO9A 4LVBA 3TAKA 1QDSA 4GJ1A 4Y9AA 4OV9A 4LUIA 1F5ZA 3V75A 3PSVA 1BEUA 1SO3A 3W1MA 5DBTA 2PC4A 1YTKA 2ZZ4A 3WJSA 4AHOA 4JS3A 4Y6GA 5LHEA 4M7SA 4JTUA 8TIMA 4JTLA 4MY1A 3GAYA 1DQWA 3F03K 1ZHAA 5EBUA 3GKFA 3ATYA 1FXPA 4D2JA 3QMSA 4K38A 5AHEA 4DXVA 2NUXA 5LHFA 2CU0A 1PCKA 4JIPA 1G6CA 2A7PA 5LSMA 2VFGA 1RQHA 3NL2A 4K37A 2GPTA 5HWNA 5A5WA 3LLFA 5H91A 1W56A 3P80A 3PM6A 2VFIA 3DXIA 2DZPA 3GLCA 3KVKA 5U7SA 1HUVA 3S6DA 2ISSA 3WJZA 3UY8A 2E09A 4RZ6A 4MY8A 4HHPA 3GDTA 4AHQA 3PUOA 5HINA 3NQEA 2WSRA 1CI1A 1SFLA 1VRDA 1C8VA 2GQ8A 4UTUA 2Z0IA 4Y8FA 2OX1A 3HPXA 3SGUA 3W1LA 5AHMA 4KFOA 3C2FA 2NV1A 5F2LA 3RK8A 3UWVA 3M9YA 3SY5A 4DO4A 3SZ8A 1FCBA 2ZZ5A 3BGGA 3OVPA 4E2DA 4IX2A 3VE7A 3B05A 3SI9A 1WOAA 3I68A 2YSWA 1IXPA 1LTDA 3G1VA 4TX9A 2CLKA 3G1DA 2OJPA 2C0AA 1SSGA 1KTCA 3S8HA 1M6JA 1XBXA 1SZGA 3NGJA 4FB7A 1UASA 3QH2A 3LCXA 1LLZA 2QCNA 1VCVA 3B0VC 3W22A 3NG3A 3M1ZA 4UTTC 1PVNA 3GIYA 5G2WA 2G96A 3SECA 5HNRA 4UTIA 5FF3A 3LHVA 3GXPA 2CWNA 1FWSA 3GR8A 4UFLA 2BLEA 2GJNA 1O60A 3CWNA 1TPFA 3FS2A 2UV8G 3PG9A 6ALDA 1DVJA 2NWSA 1JUKA 2Z6JA 3HF3A 2FJKA 4WY0B 3C56A 3W23A 3M5YA 2WQPA 1W8SA 1LROA 5ABTA 3S1WA 3C2VA 3LBMA 1F76A 2QJHA 3NQVA 1NFBA 3O6CA 1OABA 1OFBA 3C2OA 2ZZ7A 3QQ0A 1YADA 2RDUA 3O63A 2RKXA 2ZZ3A 3QQ1A 3W7JA 4RZ5A 1OFOA 2Y62A 1ZJIA 5TBOA 1FCVA 3DBPA 4UNLA 3R8RA 1OX6A 3OA3A 1FWNA 1O94A 2XFWA 4ALDA 2FQIA 2FPVA 5EKYA 1JCLA 4DO5A 1JCJA 4WZHA 3L9CA 3LRLA 1HFBA 1RPXA 3LI1A 1OVDA 5HULA 3TR2A 5AC7A 5F1VA 3W76A 1W54A 4RJEA 1AK5A 5HWMA 2YFNA 3IIOA 2CZ5A 1G4PA 3EKZA 3DFTA 1P0KA 4M6PA 1FDJA 5I3FA 4E38A 1AW2A 3L2IA 3TNOA 3PBVA 4PA8A 3E96A 1T8XA 1I8JA 1I2RA 4RXGA 4X2RA 1QNVA 1TPEA 3CLMA 3QMRA 4MY9A 4O1BA 4H3DA 5CKSA 2NV2A 4CCDA 2QJGA 1NSJA 1FQ0A 3B0PA 3LXCA 3W7EA 4MLRA 5DELA 1H5YA 5G4EA 3T40A 4O0ZA 4YLWA 2NX3A 4UNKA 2ATSA 3A5FA 4BWLC 1XUZA 4RX0A 4AVFA 3KHJA 3WK0A 3HG5A 4WQ6A 1VHCA 3C4UA 3H54A 4RR4A 4E0CA 4FNSA 1MEWA 5G4WA 3WK1A 1QAPA 4RXFA 4M19A 4MZ8A 1B9BA 2E6DA 1EP2A 3KRSA 2JKAA 3PBYA 3MP5A 1LRNA 3P8IA 4MLJA 1TB3A 2WNZA 1ML1A 2PRHA 5EPDA 3RMJA 4BF9A 4UTLA 3TAOA 1A5AA 2CZFA 4JTJA 1B57A 4MYXA 2YW4A 2ZCGA 3L0NA 1SSDA 3P60A 3DKJA 3G0XA 3K30A 7TIMA 2XN2A 1UCWA 1NF0A 1SW0A 4ML9A 1K3UA 2IQTA 3GDLA 2JK2A 4A2RA 4XTDA 1R47A 3NQ7A 4CQ8A 5K9CA 1TJRA 1I45A 3LCGA 3IIXA 1R46A 4POCA 5BW6A 3I6RA 4P2VA 2NUWA 4Z08A 3GDRA 4O52A 1MEIA 3LM7A 2ZFAA 3R2GA 2QAPA 3FJLA 1G4SA 1AL8A 2Q8ZA 5G5IA 4A2SA 1S5WA 3LXBA 3HJZA 3EKLA 1OFRA 5IM51 3WK2A 1PV8A 3A5VA 3I7SA 1PL9A 2J9XA 1ZY9A 3W7HA 4TMBA 3DFOA 2ZZ6A 5H2ZA 1SU5A 1N7KA 3KVJA 3M43A 2Y7EA 4AF0A 3P8JA 4O1AA 1KFLA 4JN6A 4UMAA 3LOTA 5D05A 1JRBA 1JUEA 3W6YA 1C9DA 1DORA 3PUEA 3ZWTA 3C2EA 3GVGA 4BI7A 1JR1A 3H53A 2NXGA 3N9SA 2PURA 1P5BA 1KM0A 2GUUA 3STFA 4ORIA 3G0SA 2ABAA 2R91A 3KXQA 5AC8A 5I3HA 1G69A 3W2MA 3HGSA 3TV8A 2GOUA 1YYAA 5AOUA 3TJXA 4UMCA 2WPBA 5K3VA 3ELFA 1FCQA 3EXSA 2AGKA 1TTIA 1ZFJA 1WA3A 2HMCA 2QKFA 2E6FA 2ZRYA 1UUOA 1PHWA 1H60A 3W7LA 3ABOA 3TU9A 3M0ZA 2H6RA 2YZRA 2YW3A 4JR5A 4LW7A 1S3HA 5FF7A 3LRMA 1TSIA 3IVSA 1BTMA 3NL3A 1B4KA 3P84A 2JKEA 4JTFA 1K8XA 4UTTA 4S2CA 3IRDA 4XZ9A 2V0TA 1W3NA 3MP4A 4PFMA 4S1FA 2DZTA 4DBEA 1D3HA 1TQJA 5D38A 1EWDA 2CW6A 2ZA2A 1GT8A 1H62A 1LLWA 1HO1A 1TO3A 2VENA 3QRHA 2A5HA 4UFIA 1L6WA 4HN4A 2E5DA 4LY8A 3N14A 3PB2A 5LGXA 3DFQA 1OFQA 5F1UA 5BNKA 3ABQA 4XKYA 4JX4A 3IEBA 1S5VA 1W5NA 4NNCA 4O10A 4DELA 3L0GA 2V30A 2FLIA 2V2HA 1OG0A 4AH7A 2Y63A 1J4EA 1XBZA 1W0MA 3O6DA 4LU0A 4BI6A 5DBUA 3VCRA 3UQNA 1ADOA 3KVMA 4ZQNA 1OX4B 1QO5A 4XBSA 2BZNA 3G18A 3L0KA 3HG2A 2EGZA 3HB9A 3LCLA 5D32A 1H7XA 4LV4A 4WOZA 4HPXA 1VZWA 4NXSA 4FXSA 1I2PA 4K7VA 2ISWA 4ADUA 3I65A 4NUWA 3R5EA 2Z1BA 3W7CA 3QSTA 4Z1BA 1UB3A 2CLLA 3P82A 3C0JA 1R2SA 1DKWA 2FB2A 3N2XA 3CEUA 4ZQMA 1WDWA 2H90A 2VFHA 3BARA 4UCGA 2H8ZA 1G7UA 1YDVA 3EXTA 3FIGA 3NL5A 1H51A 3P7YA 4PCFA 3M41A 1W37A 4CQ9A 1QOPA 3QPZA 3G1YA 4JYFA 1AW5A 3FYPA 3Q37A 1F73A 2O7SA 1SR9A 4CCCA 1X6UA 4IJBA 3LV5A 3NEVA 1SW7A 3B03A 2EHHA 3MWAA 2CLHA 3MI6A 2HSAA 3NQFA 4EIVA 1WBJA 3O1NA 1OF8A 1XL9A 4X3ZA 3KVLA 1QPOA 1JQVA 1LRTA 4IMCA 5J5DA 3CPRA 2NXIA 3SR7A 2P10A 1ZALA 2DZXA 3FLUA 1LORA 3GK0A 2CFFA 3G1AA 4IOTA 1PHQA 3EWBX 5HUOA 3C8FA 4MZ1A 3NPUA 1ONRA 1FCUA 2ZRXA 4BWLA 1YPFA 3LHZA 3P5ZA 3R89A 2A6NA 2F7FA 5HR7A 2QF7A 1WYIA 3MMTA 3NR0A 3LBCA 4TIMA 4NX0A 2V2DA 2CLMA 3NQAA 4OBTA 2X1RA 3W7MA 4DO6A 3CQ0A 3MW7A 2ZA3A 3T55A 1LZOA 1FX6A 4LUJA 3B04A 3P61A 1OHLA 3HBLA 2V82A 4BK9A 2CLIA 4MOZA 4XQ6A 1Z48A 2XN1A 1K02A 3YPIA 1OX5A 1J5TA 3RLUA 3MJYA 3R12A 1SZFA 1OFPA 3W7RA 4NZJA 1T96A 3QW4B 4JTSA 3P62A 1I2NA 1XUUA 3M7WA 1VCGA 5E0KA 4JDBA 4JTTA 4AEOA 5LGZA 2I9EA 3NM3A 4ZVJA 2VFDA 4YWIA 2Y70A 3FJ6A 4UFJA 3A9IA 2TYSA 4NJJA 3S5ZA 3TXZA 3SSJA 1DBTA 4FNQA 2BWGA 4MKNA 4WUIA 1X8FA 4A21A 2WJZA 4LVDA 3TQKA 3DI0A 1EX5A 5E93A 2R94A 2QCFA 3TW6A 2KZHA 2WNQA 3SJ3A 1VC4A 4RKAA 2A85A 1LBLA 2E77A 1KLYA 4UFKA 1GVFA 4R33A 2NZLA 4A29A 1EUNA 2OT1A 3W85A 3GB6A 4NJIA 4JD4A 2ZZ1A 3IV3A 4W9TA 3HGOA 1IIHA 3EX2A 1H7WA 4C1LA 3ZWSA 3RFAA 4LS1A 1LYXA 1XBYA 5AHIA 1DJQA 3S1UA 1OF6A 4BR1A 1Q45A 4LV9A 3VNDA 5I3JA 4WJEA 1FUYA 2VOMA 2G97A 3GXNA 5FF4A 3A23A 2DP3A 3E12A 2H3DA 4U28A 4Z1CA 1D3GA 3W1PA 4O18A 1W5PA 3PBUA 2ZRZA 3NQDA 3O07A 4JYEA 1TRIA 4K8EA 2OZ0A 4AMAA 4O8RA 2JKPA 1F7BA 1O5XA 3TK7A 5I3GA 2JGQA 3G0UA 2QCHA 1BKSA 1KTNA 1WXJA 3UZJA 1KBJA 4HPJA 3FA5A 1QPNA 2HS6A 1A53A 4QISA 3W70A 4IGHA 3S42A 1XM3A 3DH7A 1KFKA 2PRLA 3EX6A 4IX0A 2R8WA 4LS2A 3PSWA 1QPRA 3UNDA 2YYTA 2VEMA 4JTEA 5DCDA 3NVTA 4P61A 3ABSA 3MYPA 4JTKA 4EF9A 3NPWA 1M5WA 4QSHA 3FYOA 4QQ3A 2Z6IA 1I2QA 4BI5A 4ZQRA 3EX1A 2RH9A 5CG7A 3WFAA 2C16A 3PBWA 1R2RA 3PB0A 1Q6LA 3QM3A 2A1YA 3OEXA 4DF2A 1I2OA 1OFEA 1XC4A 1K8ZA 5BOOA 3V1PA 3W3OA 3BW3A 3QJAA 3I7RA 3NA8A 1VGAA 1JUBA 1Q3NA 1XFBA 4UR7A 3OG3A 3DFSA 4O17A 1GWJA 4HKPA 1NF7A 4Y96A 3W7GA 4GUHA 5KZMA 3TA6A 5FEWA 1W5MA 4ZQCA 4ADTA 4UMBA 1H7PA 1QWGA 3TH6A 5EA9A 5AHLA 5LNUA 5TQLA 2Y7DA 3HGJA 3HQ1A 3F4NA 4LTSA 3FOKA 2QCEA 3UXAA 4I9AA 2GVJA 3IIZA 4ONVA 3UWYA 4HIBA 2GJLA 4OU1A 1RV8A 1ZCOA 3O8AA 3TCEA 5SWUA 3KOFA 3NPXA 1GPWA 4JGDA 1KBIA 1KM5A 4O13A 1YXYA 1SZNA 4N4QA 5DCBA 3CTLA 3LCWA 1T99A 2JBMA 1GTHA 2O7QA 4GUJA 3B8DA 1EIXA 1H63A 1K8YA 1OK4A 3QSRA 4FNRA 5KITA 1XCFA 3ZR4A 1TPDA 1ME9A 4KFPA 2ZRWA 4PEKA 3OVRA 2Y85A 4IWWA 3G22A 5CZJA 2F84A 2GQ9A 3GZ3A 2V5BA 2E6YA 2FTPA 3EWYA 4FXRA 3KX6A 1F6KA 1KFJA 3W87A 1LOSA 1GVRA 4UTJA 1OYAA 1EUAA 3Q58A 3W2NA 2YGYA 3UWZA 3BG9A 1EWEA 1X1ZA 3NZ1A 1KM2A 4IQLA 5LKYA 4NX5A 3B0UX 3DKLA 4O0KA 2QCCA 2C6QA 2CZDA 2QR6A 2VEKA 5J5RA 2YYUA 4I7WA 4WOQA 3WK3A 5LNSA 4GRSA 1G7VA 3QEZA 1XDLA 2QCDA 5D37A 2J9ZA 4QITA 2X1UA 3PWAA 1TPC1 5FEXA 3TQ0A 2VKZG 3ATZA 5AC6A 2A7RA 5FF0A 2X2GA 3LCFA 4N9CA 3S5OA 2OMAA 3S9YA 2Q3RA 1VYSX 3ZFHA 1UUMA 4DPQA 5D2YA 1K7XA 4GBUA 4IUOA 4AHPA 2P1FA 1YTEA 5CZSA 1RQBA 3N2MA 2B4GA 2WNNA 3SGZA 1L2UA 1TMHA 2YXGA 3M5ZA 3DI1A 1QR7A 3HG3A 1VR6A 4MYAA 3MBFA 1KA9F 3USBA 3GR7A 2X16A 2WKJA 5AHFA 4L4LA 3STCA 1RR2A 5FF2A 5I3KA 1TPWA 4FO4A 4G1KA 4C1KA 1H1YA 4M6QA 4RLIA 1LM1A 5AN7A 3QZEA 5DY3A 4O54A 4NQ1A 3NL6A 1KV5A 3M47A 3W7IA 3IVTA 3SFKA 3U6WA 5CPLA 4EVZA 4FIRA 2B7PA 3S5YA 1TIMA 4LRTA 1IXNA 5C55A 3NNTA 3D0CA 4K8HA 5KSWA 4N9EA 5AFDA 4NJHA 2C1HA 2QCGA 2PRMA 4TR9A 3EWWA 2FIQA 1KW1A 5F2MA 4UTWC 5D09A 1ZAJA 2VEIA 5D02A 4OHQA 1HO4A 5IBXC 4DEFA 2BTMA 3BGJA 3GAKA 4AWSA 2BSLA 3SW6A 1W31A 2E5CA 1LCOA 5LZLA 1P1XA 4O19A 5FEZA 3EWZA 3IGSA 3M16A 2B0MA 5CPMA 4NT0A 1VLIA 4O4VA 4NXKA 3L68A 2J9YA 3C6CA 1LBFA 3P5YA 4MFDA 2NXHA 1G4TA 3HIJA 1A50A 2DZWA 1OYBA 3DZ1A 4B5NA 1O95A 1YLVA 4FIQA 3N9RA 2BXVA 3JS3A 4LS0A 3E49A 4TO8A 1G4EA 3KRUA 3M6YA 1EPXA 2EAWA 1KFCA 3CC1A 1CX9A 3TFCA 5F2GA 3GYEA 4O57A 3ZS4A 2DJXA 3L67A 3NPVA 4OGZA 4LNYA 3LDVA 1E51A 3STGA 1FXQA 1XKYA 4DQWA 3W07A 1H7RA 3O16A 3EWXA 3LCHA 4FF7A 4L4MA 1KTBA 1K03A 3L5LA 2G95A 4RZ4A 5BMXA 1THFD 4NNBA 2ALDA 1KM3A 2V9DA 3OIXA 4JX5A 3LRKA 4QIUA 5HR6A 4LWWA 2DORA 4IPJA 4FEZA 1W3TA 2W6RA 2E6AA 1LOQA 1IGSA 3JRKA 4GUGA 3EX4A 3W1XA 2CZEA 4LRSA 2YPIA 3DENA 3NZRA 4JTGA 3KAOA 3MHGA 3JR2A 2Y7GA 4YCOA 1XXXA 4YMZA 3IGUA 1J2WA 5DCEA 3LX9A 5GVJA 4UTMA 2HS8A 3MI3A 1GVSA 3LHTA 3W2LA 1S5TA 1SO6A 1XI3A 4O50A 5C6MA 4OWGA 2Q3OA 4J9JA 5EMUA 1RD5A 4RV8A 1MEHA 1TPB1 1VLWA 4QJ1A 3RLVA 2QUUA 2J6XA 4TMCA 1KM1A 3QW3A 3DAQA 4MJMA 1JJKA 5G2IA 4KKXA 1LDCA 4Q33A 5DY2A 1DHPA 5DXXA 3TFXA 1DL3A 3EWUA 5MHBA 3T44A 3QPYA 1YDNA 3WJXA 3CB8A 3MO7A 4FNPA 1VHNA 1ICQA 4Z1DA 1VQTA 1TV8A 5AYYA 1VCFA 3NQCA 4ZMGA 2HTMA 1IF2A 4H4IA 1SFJA 3BW4A 2VFEA 1HG3A 4JYDA 4PL1A 2CLOA 5F4XA 4CNOA 3W73A 5LNWA 2YX0A 2C18A 2ZA1A 2AQWA 3B4UA 3MYOA 3UD6A 2VELA 3DHFA 3CU2A 5CPOA 5D04C 3PUDA 3W74A 3W2KA 4A3UA 5KINA 4IMEA 3AO0A 3P67A 5D2TA 3P74A 3CM4A 1TQXA 4O12A 4O11A 1WX0A 4WY0F 4LVAA 3Q94A 4HSOA 1OJXA 4WY0A 2G5WA 2QDGA 4KWVA 4EWND 1GJPA 3TXVA 3S5NA 1W5QA 4O14A 1GOXA 3A21A 3DGRA 1RQEA 2YR1A 5KZEA 2RDWA 4XBKA 1VPXA 4FNTA 1UJPA 1RZMA 1TTPA 4UUIA 4ADSA 1LRQA 3WJYA 2ATMA 4DF0A 5LNVA 1FWRA 1X7FA 3IIVA 4Q4KA 1N55A 3G8RA 3IVUA 4ZQOA 4JIQA 2B7QA 3W72A 2FDSA 3M5VA 3BW2A 3HPZA 3W71A 3INPA 3TSDA 3LTYA 4X9SA 3W75A 1ZAIA 4K7YA 1JCNA 2Y7FA 2Y88A 3FEMA 3TIMA 3CHVA 3FFSA 4GE8A 3VE9A 3W1TA 5FI8A 1QOQA 4XKYB 3UWUA 5CSRA 3RNDA 5C54A 4Z0SA 1TTJA 3THAA 4HNTA 4U4MA 2X30A 3LXAA 3MHUA 1PCWA 3UXDA 1MSSA 1L9WA 3NO5A 1EB3A 2ZBTA 4IXXA 5EY5A 4FX6M 2NWRA 3G1SA 3MI2A 3EXRA 3C52A 5CZTA 5D2XA 3G24A 1TV5A 3AJXA 1D9EA 3S1XA 2FFCA 3W88A 1NVMA 4MFEA 3BVJA 3G3MA 4UXDA 1FWTA 2V81A 4N4PA 4UTKA 1DQXA 4EOUA 2TSYA 1R30A 2ZTJA 4ORMA 4Q32A 1A5SA 3HOJA 4PL2A 1SPQA 3QFEA 4JTIA 3HPSA 3E0IA 1W3IA 2DZSA 1AW1A 1MO0A 2YDAA 3NQ2A 1Z42A 5CGQA 3ABRA 4HNUA 1MXSA 3MP3A 4UTWA 4MJZA 3TQVA 1MZHA 2B7OA 4GUFA 1B4EA 1UBSA 3E9AA 5IBXA 2ZTKA 3UWWA 5HQEA 3PVFA 4JTHA 2GQAA 4OV4A 5K9DA 1F05A 2C15A 1OFDA 3QMTA 5F2IA 3C61A 3VI2A 3UZ5A 4IMFA 1X1OA 4IMDA 3BLFA 1NAL1 4NNAA 5HUPA 3QC3A 3LTPA 1F2JA 3R13A 3W7OA 1ICSA 2QJIA 4YCPA 3F4WA 2A21A 3UPBA 4MIMA 4JX6A 4QNEA 1KM6A 1H1ZA 5G2HA 2A2IA 3G1FA 3W9ZA 2NX1A 3TC6A 2EKCA 2W79A 3H55A 4KFNA 5T26A 3TUUA 2H8XA 4JDYA 3TSMA 1EEPA 4AAJA 3Q2DA 3PULA 5D2WA 4Y90A 3BLIA 3T4CA 4FHAA 4GC4A 3IGXA 1YPIA 4O16A 1GQNA 2WSYA 4DBDA 3O6YX 2C14A 3UYCA 4PC8A 5AYZA 4LVFA 5HMSA 1JRCA 4LOCA 4WXYA 4PTNA 6TIMA 3ANYA 1LP6A 3RF9A 3G3DA 3LGEA 2NX9A 2C3ZA 5G1YA 1DOSA 1G67A 1PE1A 3F1QA 4CLMA 5K4ZA 3TW7A 2FB3A 1O4UA 2VXNA 3N19B 2EPHA 3DU0A 3TE9A 1L6YA 2GVLA 3DFPA 4GNJA 1V5XA 4NU7A 3STEA 1WQ5A 3LV6A 5K7JA 5C5YA 1KV8A 4K36A 2ZQ0A 2E5BA 3LLDA 1N8FA 4LC8A 2Y6ZA 1LOLA 2J24A 4M5PA 5FESA 3P81A 2A6LA 2RHGA 5F4WA 3TX9A 3NAVA 4X22A 3L65A 2QUTA
chains in the Genus database with same CATH superfamily
1EJWC 1GZGA 1OCNA 1I4NA 3OHIA 3L4XA 1WNOA 3IJDA 3WUGA 5KMYA 1H41A 2PLJA 3DDMA 1PIIA 3KL0A 4QP0A 4HK5A 1K7FA 2ZZ2A 1EDGA 1LL7A 1NJJA 1EP3A 1M7OA 4WRHA 3OVQA 4PCNA 1IEQA 2CCRA 3C2RA 1UJQA 1Y7VA 3U7BA 3BLLA 2E67A 3CJPA 3ALFA 1H7NA 3BLEA 3WKZA 2J27A 1C93A 5CJMA 2FFIA 5K9XA 3T0AA 4H83A 1JYNA 2CLFA 3CT2A 4TOQA 5JIWA 3VINA 3FKKA 3ZLHA 1US2A 4XUGA 2XIIA 1I1XA 3O06A 1VPYA 5KTLA 5GJMA 4NSBA 1QHZA 3VKJA 2UY2A 2V5LA 1FBAA 4JTQA 7ENLA 4MNLA 1UH2A 3IAPA 3T42A 1OC7A 4XSLA 4GACA 8XIMA 4N9DA 4YYCA 2DJLA 4ICCX 3W7KA 5IXEA 1AQFA 5CC5A 5DMNA 1CGTA 4DNHA 5I3IA 4L9ZA 2WSQA 1NTHA 2OR2A 1SFTA 3HURA 2GVYA 2E1DA 2AGTA 2A7NA 2ZRVA 4QHRA 3E02A 3XIMA 1JZ4A 3GBEA 3MDWA 3O2LA 4PODA 3TTSA 5EMMA 4GVHA 4C91A 1VFFA 4LNCA 2H3BA 3GHTA 3RU6A 3PFRA 1XIDA 1SO4A 2WKGA 3EMQA 4F2UA 1M9HA 4FX7A 4L4PA 2V5KA 1PKLA 3N12A 3NOEA 4PUJA 2PU0A 3CMGA 1B3OA 1JVNA 4M56A 4O1CA 1JFHA 3NO1A 4OQVA 5CPNA 1ECQA 1E6QM 1JCXA 1WAUA 3MQTA 4JNZA 3NQ8A 3IUDA 1O6IA 1XPYA 3WMLA 1GEQA 1VRXA 1UA7A 4AC1X 1ZENA 3E2RA 1EC8A 5HWJA 4HT3A 1LBMA 1TPH1 2ZDRA 2RDXA 3HV8A 3SN4A 4M7TA 2RUSA 2QXWA 1XLDA 2VC7A 2GDQA 1Y0EA 1BWKA 3LNMA 1UWQA 4LYKA 4WX2A 4WXZA 1CXHA 2OYLA 3LI0A 4TU1A 2O9PA 3W28A 4O15A 1PZ3A 1IV8A 3DIPA 1JNEA 3HO8A 3NXFA 1EA0A 2J78A 3CWOX 4JKKA 4JQ1A 1MUMA 4C6BA 2QDEA 4DZ5A 2OT0A 4M6VA 2OWWA 4ERAA 3AXIA 4QXIA 3KFTA 1ENUA 3VD9A 1P0NA 2YZ5A 5BRBA 5KZ6A 3G2GA 4UOZA 4WDWA 4Q6XA 1NY1A 2PDHA 4HSNA 1OG6A 1OIMA 4PTWA 1T0OA 1VBRA 1H7OA 2A79A 3UPWA 3U5UA 3OYZA 5CZ0A 1TCDA 1XDMA 1NEYA 4V33A 2Y0FA 1HGWA 4H2HA 3WSUA 2D73A 2QCDB 3VIIA 3M0LA 3KZPA 3PBGA 2VC6A 3GNNA 4DZAA 1IIGA 3W2JA 3JVAA 3TJLA 3W2UA 4ZL1A 5CPQA 1OWQA 4GVIA 4EACA 3T78A 2BVTA 2Z2AA 4AZCA 2P0OA 1ALDA 4GUIA 2G41A 2YL8A 2TMDA 4F0MA 3BMVA 3O05A 2OOGA 4GXMA 3WUBA 2BB0A 4AF0B 4IPIA 1NDZA 1FH8A 1X39A 3AS1A 3RILA 4GFSA 5I6SA 2ZRUA 4R34A 3RPDA 4DUVA 3NSXA 2P3ZA 3TQPA 5ABFA 5HK4A 3M5XA 4J4KA 3WQVA 4S23A 3CASA 1TPVA 4NY2A 1N8IA 1UR0A 5C2CA 4GIEA 3LHWA 4I7VA 4QX4A 4QAIA 1TREA 3L66A 2C13A 4IIDA 4NI3A 4CQAA 4E4UA 1EQPA 3VD3A 2DW6A 4S2BA 4ZQPA 3FDGA 3TMLA 4RCXA 4O53A 3A22A 4LUSA 1SYTA 3UZXA 3BJTA 4TUFA 1W5OA 5EGRA 3VNJA 5EU9A 2NVDA 4JEQA 2IKIA 2EF9A 3AIEA 1XFCA 2O9OA 2SFPA 3UU0A 1X1NA 2BV9A 3BO9A 1CWYA 4BHYA 5I09A 4GJ1A 4OV9A 3PSVA 1SO3A 3W1MA 4P7OA 2GWGA 1XLGA 2PC4A 2GZXA 2D20A 3WJSA 1WDRA 4Y6GA 1JAEA 1D7KA 1E9IA 4JTUA 2E3ZA 3ORWA 5H6HA 3H2NA 1DQWA 5EBUA 1ZHAA 1S46A 1KRMA 2IPJA 3KCLA 1FKXA 1PCKA 4JIPA 2A7PA 2VFGA 1RQHA 1S3TC 3NL2A 1V3IA 5LIUX 2GPTA 5I5RA 4MMWA 1W56A 4GYJA 1RH9A 1UD8A 2D2GA 4S39A 4QQUA 3GDTA 3CAQA 3NQEA 1CI1A 2D69A 1REQB 3DYOA 2PWHA 1FTXA 2OWXA 5AHMA 2VYOA 3PZ9A 1E70M 3UGVA 3WQ5A 3SY5A 4DUXA 3SZ8A 2ZZ5A 2YA1A 2HROA 2JQXA 5CQ1A 2E9MA 3B05A 3SI9A 3U9IA 1IXPA 3V0SA 3G1VA 1GJWA 3VVGA 1B2YA 1A3WA 1FWIC 2ZIDA 1EFZA 3G1DA 1ZQ5A 4IFRA 3U57A 5HMFA 4P8UA 3WDHA 3M1ZA 3BANA 2QVNA 1AZ2A 1PVNA 2INEA 2I17A 4UTIA 1R9ZA 3U3HA 3P0XA 1W9DM 2ZX6A 2ZX5A 3U7VA 3GR8A 4UFLA 4Z2GA 1LUCB 1XLKA 3IWPA 3HF3A 2AL1A 1GEHA 3F2BA 4CEUC 3UCCA 2OGYA 1UD5A 3FSTA 4GQ0A 4ZXLA 3S1WA 3CYVA 3LBMA 1XIMA 1B3WA 4PB4A 4P5UA 1BSIA 4R9OA 1U2YA 3QKZA 2VX5A 2RKXA 2ZZ3A 4TV5A 3QQ1A 1KCLA 4RZ5A 3MS8A 3TVAA 5TBOA 2PDGA 4PUKA 4H9YA 3V35A 4M0XA 3VGBA 2XFWA 2X0YA 3PZVA 4CUCA 4WF7A 1S1RA 1QRQA 1JCLA 4DO5A 4Z2IA 1T8QA 1HFBA 4C1NB 1KQZA 5JXQA 1GYMA 1P6CA 3M0JA 5REQA 3IIOA 1NOFA 2CZ5A 3IUIA 5IHRA 3DFTA 3ES7A 2HE5A 3DC0A 3TN5A 4HYRA 1JI2A 2XZ9A 3L2MA 2XHYA 2QGHA 4XIMA 4H9MA 4PBGA 4HNOA 3DX5A 3WLNA 4X2RA 1QNVA 3CLMA 3QMRA 3P0WA 4O1BA 2QJGA 1NSJA 3W7EA 1FWDC 3NJ3A 5G4EA 4YLWA 1UPPA 1KGWA 1U1UA 2WQDA 3A5FA 4BA0A 4BWLC 1EGZA 2VVNA 3M0HA 4PEEA 4AEFA 3UZYA 4AFYA 1VHCA 3VFCA 3C4UA 1MUCA 4L7ZA 2HISA 4QG9A 1TA3B 2FVMA 4GK8A 5HXMA 1O5RA 3KRSA 4F2TA 3Q67A 4GPNA 3QV9A 3TYAA 2PRHA 5EPDA 3RMJA 4BF9A 1A5AA 2NT1A 4ZSTA 4BQ5A 4JIIX 2YW4A 3M46A 2ZCGA 1SSDA 4PBEA 1XV8A 3G0XA 7TIMA 3AHTA 1QW7A 4DB7A 1S2UA 4PUMA 1XHGA 4B90A 1NF0A 3NFUA 1KBLA 3HU7A 3FY1A 2ZE0A 3GDLA 2JK2A 4A2RA 1O66A 1S1PA 3CPUA 2Y4SA 3ZVHA 3F4DA 3ERPA 1I45A 5BW6A 1QNQA 3GDRA 1MEIA 2UWFA 3ZM8A 4IIGA 3R2GA 4IIHA 1AL8A 2Q8ZA 4H7ZA 4URIA 4A2SA 4C6CA 3ARXA 1HJXA 4DRSA 5IM51 4J7RA 4A05A 3A5VA 1EJUC 1V3LA 4HPNA 2F6XA 4KIEA 1R7AA 2PU1A 2Y7EA 3E3HA 2PDXA 4W7UA 2YBUA 3WH9A 3SY1A 5A8OA 4UMAA 3RM4A 2EG6A 3W6YA 3HA1A 4JFSA 2BY3A 3PUEA 4FALA 3W38A 4DHGA 3C2EA 3GVGA 3IARA 1JR1A 5ECVA 2NXGA 5TAOA 3N9SA 1KM0A 2GUUA 3URQA 3WENA 2XIBA 4ORIA 2DT0A 3G6LA 4AZ5A 1V3KA 2ALRA 2OQHA 2BHYA 3WEMA 3HGSA 3MPGA 1VAHA 2WMFA 5H8PA 3SIMA 1Q2RA 2OEJA 2WHJA 2PA6A 1IZJA 2ZADA 1TTIA 3PN8A 2JE8A 3TNBA 2ZRYA 1UUOA 4LBUA 1BVZA 3R10A 3VIGA 3W7LA 1PAMA 3M0ZA 1RXOB 3HPAA 1AQ0A 2WKLA 2JKEA 3SCVA 1W3NA 3MP4A 2Z1XA 4Q6JA 2INFA 3GUGA 1SR0A 1KRAC 1H62A 2CBJA 2D22A 2QMKA 3QR1A 2XDFA 3GVVA 2A5HA 1L6WA 3FDKA 2E5DA 3PB2A 1KR1A 1XSJA 5F1UA 1C8QA 1S5VA 3LSCA 4DELA 1BF2A 3CHEA 3BZGA 3L0GA 1W8GA 5A69A 3VIJA 1J4EA 1W0MA 2YXXA 5DMLA 3LPGA 4XIAA 4H8VA 2GSEA 3U0HA 4YS1A 3L0KA 4LXFA 1I9CB 3RDKA 4WOZA 4HP5A 4NXSA 2PTXA 4M1RA 1I2PA 1ZJAA 2ISWA 2GDUA 3I65A 3SY8A 1R6WA 3UZWA 1WDWA 4TVDA 3DG7A 1EO7A 3FIGA 3NL5A 3AMKA 1W37A 4CQ9A 1QOPA 2D23A 2YL6A 4ZTYA 4QG6A 4CCCA 1X6UA 4IJBA 3LV5A 1TVLA 3NEVA 1CLXA 2C91A 2CLHA 1V6YA 3C0LA 4JEJA 3T9PA 1OF8A 4IFKB 2FMOA 1JQVA 2Q09A 4IMCA 2NQZA 4KRTA 3QXBA 4QFUA 1ELSA 4GIYA 2DZXA 4GIRA 4A3QA 3UEQA 1PIFA 2YA2A 5IHSA 1FCUA 2YCKX 4F48A 1YPFA 3IS4A 3LHZA 3P5ZA 5JBEA 1BG4A 2XVPA 1JPMA 5HR7A 1YMYA 1E0WA 3NZGA 4LYPA 1YEYA 2ZC1A 4RDVA 1E73M 2OX4A 1YX1A 2V2DA 4PMNA 3EZ4A 3W6MA 2CLMA 2X1RA 3UYIA 2WHMA 3UESA 1HKWA 1Q5MA 3I3BA 3T55A 1LZOA 3P61A 5E0CA 4JHOA 7PTDA 3U2EA 3HBLA 3ALGA 2WB5A 2XN1A 3N1AA 4HHMA 1K02A 1UP3A 3IRSA 4AZIA 3YPIA 1I0BA 3R12A 1OFPA 3AIWA 2YL5A 4MKSA 4U2ZA 4HCLA 3QW4B 4JTSA 1XD1A 3WH7A 4XUYA 5E0KA 1XIHA 4JTTA 4W4QA 5AYBA 5LGZA 3F5LA 2VFDA 4YWIA 3VMPA 3EKGA 1QNOA 1GOOA 3TXZA 1RALA 3FHAA 1IEVA 2WJZA 3TQKA 5E93A 2R94A 3OQEA 2OWCA 2KZHA 3SJ3A 3K46A 2Z28A 5A6LA 1QUMA 3VIKA 4PFHA 2NZLA 3QYSA 3MTWA 2VX6A 2ZX8A 3HGOA 5FJOA 4L64A 3S2JA 2VUYA 3OZOA 3SJNA 4EANA 4H8NA 3OBEA 5AHIA 1DJQA 4LV9A 3QV6A 3WUFA 2QIWA 1FUYA 3GTHA 4TV6A 4QCFA 3GE7A 2PZ0A 2H3DA 3CYJA 4U28A 1D3GA 2WWCA 2I5IA 3W1PA 9XIMA 4NIRA 3BAWA 1BHGA 4IQEA 4L9YA 3O07A 4GI8A 3TZNA 1E9ZB 2XSAA 4Z17A 5I3GA 1X6NA 1JD9A 2P5NA 3EOLA 4GZIA 4A8IA 4HPJA 3ZT6A 4C6EA 3NDZA 1TJ1A 3Q4DA 1ZJBA 1XC6A 4ERIA 3EX6A 1H0IA 2PBOA 3UNDA 3K8KA 3POHA 4MDPA 1Q7MA 2VEMA 3W6LA 3A9BA 1M5WA 3CS2A 1EXBA 2Z6IA 2DQWA 1I2QA 4PYSA 4ZQRA 2RH9A 5J8LA 3AYTA 4MJ2A 1CENA 2WC3A 4NILA 4C6IA 4ROPA 2QNEA 2Z24A 3D3AA 1J6PA 4Z2LA 1XW8A 1K8ZA 4QAWA 3W3OA 1J2BA 1NWUA 1Q3NA 4WR3A 3H21A 2XH4A 1UR9A 3EYPA 1UH3A 3TA6A 1QASA 5BU9A 1LQ0A 1QWGA 2O56A 3TH6A 2PDBA 2EKGA 4GXPA 4YTUA 4LTSA 1V6XA 1OC5A 3FOKA 3GFYA 1R3SA 2GVJA 3NDYA 1V93A 3W25A 1ZCOA 3WBEA 3CV2A 3NPXA 1GNXA 4O13A 3QR3A 3CTLA 3LCWA 2JBMA 2OEMA 1JL8A 3MCNA 4G6CA 1GTHA 4HN8A 5E9XA 4OTKA 4YJ5A 5MF5A 2I9UA 4Q22A 3OGSA 1EIXA 1MWOA 4KH2A 3VILA 3HFTA 4XZBA 3B40A 1XCFA 2WZIA 3ZR4A 2EO7A 4EPDC 4G5DA 4DWSD 5HOSA 4LGXA 2QW5A 4IWWA 3OVRA 2OOFA 5CZJA 2F84A 2GQ9A 3GZ3A 1OD0A 2EJ1A 3GW0A 3ZR6A 1MUWA 3SUTA 3CLWA 1B3XA 3MY9A 2HNEA 2DVUA 3VOJA 2OU4A 1L2QA 1EUAA 2GGHA 2PDWA 4AD0A 3D5HA 3A3HA 3Q58A 2XPKA 4LYRA 3L12A 3BG9A 3B0UX 3DKLA 1W9UA 1HJSA 4PBFA 1QWKA 3AHXA 1R3YA 2A3BA 1HKJA 4I7WA 4ZOCA 3U2CA 4WOQA 3WK3A 3QFWA 2UZ9A 3UG4A 3O9NA 1XDLA 2QCDA 1XG3A 2X1UA 3PWAA 3BUVA 3EOUA 4FP1A 4F0KA 3LBOA 2ZUSA 4AWEA 4ZOBA 4JCMA 1UUMA 4IUOA 1UW9A 3FAXA 2GVEA 4GLEA 2B4GA 2ONEA 4YVPA 3SGZA 1L2UA 1X8CA 3HG3A 3WLRA 4L1XA 3M0MA 4H04A 2Y8VA 3BL3A 3C0QA 3GR7A 5AHFA 4L4LA 2WCGA 2X8RA 1BRLB 3ZVIA 3UG8A 3XINA 4M6QA 2FGLA 1WDQA 4DI9A 1LM1A 1PB0A 3QZEA 3EPMA 4NQ1A 1KV5A 2XTKA 3SFKA 3CQJA 4CD7A 1KWGA 1XH2A 2Y8UA 3S5YA 1IXNA 2R1PA 2ISDA 4K8HA 5KSWA 4N9EA 1UZDA 2PTDA 4Y2WA 3WMSA 2C1HA 4TR9A 3RJXA 3EWWA 1Y8BA 2FIQA 3AMCA 2W67A 3QVQA 5D09A 1EC9A 1ZAJA 4KIRA 4LYQA 2XSXA 3WIJA 2BTMA 3BGJA 4AWSA 5D9MA 5LIYX 2BSLA 5BWAA 1W31A 1QATA 4O19A 4KWSA 5FEZA 5FJIA 4OFCA 1W9XA 2VC9A 3ZSSA 4I8YA 5A6BD 2H9AB 4O4VA 1E4NA 4I5XA 2J9YA 1JFXA 4X60A 3C6CA 1LWHA 1F3XA 4B3ZA 2DZWA 4V27A 2VD9A 3N9RA 1KC7A 2BHUA 1O5QA 3JS3A 4LS0A 3SCNA 2Z7KA 1O68A 3CC1A 1XQLA 1HF6A 2XJ7A 5F2GA 3W37A 2PDLA 4O57A 2FYMA 1UWSA 1WZMA 4OGZA 2BOEX 1FXQA 3URBA 3H4GA 1XKYA 2AMGA 1X97A 1FP9A 1JEZA 4QLJA 2PP3A 1K03A 4KCTA 4RZ4A 1QI5A 3V36A 2VRKA 3KE0A 2ALDA 1OB0A 1G9HA 2V9DA 5E70A 2YDQA 4DBWA 3MUZ1 4M24A 2Y5JA 3EX4A 4LRSA 4DJFC 3VNIA 3ITLA 3N25A 1UWAA 4JTGA 3JR2A 1Z69A 2OZ8A 1NP0A 1REQA 4WDUA 1J2WA 4J2MA 3VDBA 3MMUA 1EXPA 4IGNA 1GVSA 1KCZA 3W2LA 1S5TA 2G3MA 1XI3A 5LYRA 4AD5A 2Q3OA 1P48A 4RV8A 1M3UA 1VLWA 4QJ1A 2G4JA 1XR2A 2GYIA 1NWTA 4MJMA 1JJKA 5G2IA 1LDCA 4JTDA 4NHVA 5DXXA 4TVUA 1Q85A 1YDNA 1OT2A 1E4IA 1ICQA 4Z1DA 3RG6A 4C6DA 1VEOA 1VCFA 4IL0A 3VKAA 1IF2A 1Z6KA 4H4IA 5CPSA 3AS3A 4GC3A 1MW1A 2ZXBA 4PE8A 3GG7A 4HZMA 3WLOA 1XIJA 1HKMA 2AQWA 2WLZA 4E8CA 3KTCA 2ICSA 1WXYA 4D8ZA 3CU2A 1ZCCA 1T41A 1IHIA 2EQDA 1GONA 3W2KA 1Z9AA 1LUCA 3KBJA 1OM0A 3IK2A 5D2TA 3CM4A 2WM1A 4DWSA 1V8EA 2Y24A 7ODCA 2O55A 1GJPA 3S5NA 4O14A 3DGRA 5LA1A 4AIEA 3BQ6A 1HL9A 4Q8VA 4WK9A 1VPXA 3NUKA 1UJPA 4FNTA 3I4KA 4C90A 4D6IA 4KEMA 3OU8A 4ADSA 1LRQA 1RPKA 3APYA 1UZ4A 1VFTA 3IIVA 2C71A 4Q4KA 3G8RA 4JIQA 4J5NA 4LCRA 3M5VA 5HQLA 1R9YA 3BW2A 1CEOA 3TSDA 3A4JA 3LTYA 2CYGA 1OC6A 1W1VA 4KPLA 3FFSA 4C1NA 3CZEA 4K68A 4MADA 5FI8A 1M53A 3URNA 4GFIA 4PULA 3UWUA 3TTQA 5CXPA 3RNDA 3WLSA 3CIVA 1TTJA 4UQCA 4HNTA 3GDBA 3N29A 3LXAA 3VMOA 3MHUA 2POTA 3QGKC 4GQQA 4XAFA 3WBYA 2NWRA 3MI2A 3JZUA 3EXRA 3H2MA 3C52A 1TV5A 3AJXA 4GKLA 2FFCA 3HN3A 3WDIA 4PMYA 1PX3A 1F3EA 1V3JA 5HANA 2P76A 4XZIA 2PODA 4W87A 2W91A 1DE6A 1RCQA 4N4PA 2W3ZA 2XH0A 3A6OA 3GTNA 4C6FA 5GNZA 3GXDA 1B9ZA 4ORMA 3WDRA 2QV5A 2OYKA 1SPQA 3QFEA 4JTIA 3HPSA 3E0IA 1PTAA 2DZSA 3KCOA 1NM9A 1RUSA 1Z42A 1Q6FA 1TA3A 2PGWA 5CGQA 4ZA0A 3MP3A 3N9KA 4UTWA 1F3TA 1MZHA 4LEFA 4P8VA 3VGGA 1XQKA 3PVFA 2XGIA 4GVGA 2PAJA 5K9DA 2C15A 3FGCB 2PMQA 5EBAA 4FAMA 4IMDA 4LB4A 7REQB 3A12A 5HUPA 2YOCA 3UNTA 3QV7A 3T2QA 3W7OA 3S9ZA 4KF1A 4WSKA 4MIMA 4B3LA 2WWDA 3OA5A 3AYVA 1V6VA 2DUXA 2FZ8A 5FJRA 3TC6A 2EKCA 3TR9A 3CZLA 2WC4A 3TUUA 4EXAA 2YCLB 3E5BA 3Q2DA 3BLIA 2JEQA 3WUEA 5DO8A 4QLLA 4J2PA 4GX9A 4MAZA 3NEHA 2C14A 5AYZA 4LVFA 5HMSA 1Q2SA 1UOKA 5BXTA 3ANYA 2V3DA 3LGEA 2C3ZA 2DSUA 5DX7A 3F1QA 3GD6A 3QOMA 1O4UA 3H2AA 2Q8XA 1KWKA 4E5TA 1UIOA 3UR5A 3DFPA 4GNJA 5AECA 2VCCA 1V5XA 3ARZA 4QSFA 1KV8A 4Q8OA 3HV9A 1Q4WA 2IPWA 5EFDA 1N8FA 1MNSA 2PPGA 4M5PA 1DXIA 4A6GA 3TX9A 3G6MA 4X22A 4PR4A 1EO5A 2QUTA 3W1AA 4ZCWA 4EE9A 2XISA 4OUIA 4CNSA 1LJYA 5L9FA 2FPYA 3RN6A 5E1QA 1QPKA 2WMJA 4N9BA 1JDCA 2WPGA 1A5CA 3CTTA 1AUSL 1WOBA 4G56A 4U5KA 2JGYA 3B06A 4D9PA 4AXKA 1ZGDA 4R53A 4CEXC 4W8AA 3EA2A 3UY7A 2G3NA 2VZUA 4N02A 1YXDA 3CEPA 1ICPA 3ZJKA 4NJKA 4W8BA 5KZDA 3TZFA 3W0KA 4UTHA 1DQUA 1US0A 1XYMA 1P7TB 3LHUA 2AL2B 4XZWA 1TKKA 1V7YA 3GQYA 3ONBA 3MSYA 3RX4A 3V5OA 3II1A 2V67A 3TTEA 3W1RA 1S2AA 3NSNA 4GISA 5GQBA 5L6UA 1KFBA 1SZRA 4CNTA 2BOGX 2BMBA 5G1TA 4CNNA 3VOHA 1O1HA 3VOCA 3W86A 3L21A 1Q4NX 1C90A 1BD0A 1OFAA 3NQGA 1QO2A 1Q8AA 2ZUNA 5C2XA 1NQ6A 1GUVA 1BWLA 1GOKA 3VM7A 3Q65A 2I1OA 3NQMA 4K39A 2VR2A 3JUGA 2QIIA 4JQ2A 4EAMA 1UKTA 3CT7A 1VFLA 2IKHA 1KLZA 3UXLA 3UZZA 3CK5A 4HQVA 5FL1A 1J18A 1JPHA 4O1FA 5TNVA 3TKFA 3VIOA 4AYGA 4Z2HA 1JULA 3NQ6A 3S0CA 3BG5A 4IGSA 1Q6DA 3TN3A 3EDFA 3GWQA 4LVGA 4KEVA 1EJSC 4X9YA 4DZIA 5D4YA 4IFKA 1SJCA 2TPSA 4UC5A 3HMCA 3A13A 3IIPA 4PH6A 5I0DA 3GVQA 3TONA 5FJTA 4PMVA 1MVYA 5FAGA 1UKOA 3GKAA 3S2LA 3N73A 1UG6A 4MJ4A 3C3NA 3N6JA 2D1ZA 1TJPA 1VJIA 1D8WA 1GVQA 2XM1A 4N6FA 3QKEA 4LAKA 1AMKA 2VDHA 3DG3A 3KBSA 4ICNA 4L6OA 5HJLA 3VKCA 1CGUA 1A5OC 1EZWA 2P8CA 1BF6A 1GG1A 1Q6OA 1V6WA 2RDTA 4NVTA 1D7FA 3J7HA 2J62A 1TG7A 4J35A 2E68A 4OECA 3LERA 3U2OA 1YTDA 4XZMX 2YJQA 2CXGA 4A3YA 2OCZA 4R7JA 2ADAA 4AIUA 2BG5A 3OLEA 5D30A 3GRIA 4DF1A 1NU5A 2IUZA 3B8WA 1SJDA 4MVAA 3TROA 1G01A 2I16A 4GGHA 4AY7A 1VYPX 3GX9A 4XWUA 2PDIA 4N2YA 2V3FA 3LZ3A 1EDTA 3LTSA 3G8EA 1E1CB 1SJBA 3WMCA 3W84A 3N15A 3NYZA 1F6PA 1KKRA 2VP8A 3EWDA 4IL2A 5TF0A 1KFEA 3HG4A 6REQB 4K6AA 1GYNA 5DLCA 3RGTA 2OG9A 3NCOA 1L6SA 4AMCA 1PZ0A 2Z2UA 1M7PA 3N3MA 4QLKA 5C7HA 3VCCA 2NT0A 3EEGA 3KP1A 4KRZA 1JF6A 9RUBA 3V16A 4QM1A 2VEPA 1GQJA 4A35A 2DZVA 3SSZA 3GFZA 3S1GA 4BF5A 1AQHA 3LCIA 2Q8LA 4O1DA 1BPLB 1UPMB 1HXJA 3WD3A 3DOPA 3LB0A 4IJCA 1YXCA 4LF1A 1EX1A 4XO6A 3GXTA 1EKOA 3AICA 1CW2A 1TZ9A 1P0DA 1R3WA 3BAJA 4UR8A 1CT5A 4S3GA 3QC0A 2KX9A 1V02E 2X40A 2HWGA 3BG3A 4OBSA 3TYBA 4GWEA 2RJHA 5CC3A 3AZSA 2XN0A 1K6WA 3OHMB 1SZEA 1HKVA 3A47A 1FHDA 2PUZA 2QCMA 2ACQA 4O8AA 3KTSA 2P3EA 1CCWB 2CBIA 2BFGA 3FAWA 4XAYA 2A0NA 1C29A 4CU7A 4RV3A 2QT3A 1B3VA 4JHMA 3WJWA 4I6KA 3QF0A 1DIEA 2Y1HA 1QTWA 1ZJHA 3VFLA 2FZNA 1XLJA 4O4WA 3CIWA 3TAKA 3S6TA 3AMDA 4LUIA 3ANUA 2WYSA 4Q4SA 1V02A 2ZXDA 1AZ1A 5LHEA 8TIMA 4U3AA 4Q7IA 4JTLA 3GAYA 4I9MA 1GGOA 2WHKA 4Q8QA 4D2JA 1JI1A 4D6GA 1UWTA 3OZMA 1L6GA 3AS2A 2HCVA 3ARQA 1G6CA 4K37A 1VFHA 1GK8A 3P80A 1E5JA 1CGWA 5A8PA 5U7SA 3R1ZA 1HUVA 3VIPA 2ISSA 4MY8A 4HYVA 4AHQA 5HINA 2WSRA 5AKQA 1NP2A 2GQ8A 1MQQA 5E0FA 1KRCC 1XICA 1Q6CA 3PZMA 3W1LA 2WW5A 4KFOA 4TXEA 3C2FA 3RK8A 3UWVA 3M9YA 3TN4A 1QI0A 4DO4A 3BGGA 4GH3A 4W7WA 4ZFCA 4IX2A 2A3AA 3S4TA 1ZLPA 4H00A 2YSWA 2WMKA 1ODUA 3DN5A 4GMEA 3RX2A 3SM0A 3ITOA 1BWVA 1SSGA 1KTCA 1XBXA 1SZGA 3T2OA 4FB7A 2CLPA 4O0QA 1TWDA 3QH2A 2ZKMX 1B90A 1VCVA 3B0VC 3NOYA 2ZXQA 3NG3A 2W66A 5BOFA 3HJEA 4UTTC 5G2WA 3VDAA 3UVIA 5HDRA 3VD4A 1ZUAX 2V69A 4HA3A 2CWNA 3I3EA 4JHZA 3ENLA 3AJ7A 3G77A 6ALDA 3GH7A 3QZ6A 1JUKA 1RBOB 1ECEA 2FJKA 4WY0B 1F3WA 4E4PA 3CV7A 3W23A 1E0XA 3M5YA 4PRRA 2WQPA 4DAIA 1LROA 2REQB 1D3CA 1BAGA 1NFBA 4J3TA 3ZJ6A 3O6CA 3C2OA 2ZZ7A 3QQ0A 3T08A 3W7JA 2J8FA 1NH6A 3NWRA 5DFAA 1RD6A 1OFOA 3ZZ1A 1QNSA 4MF4A 4PRTA 1BRLA 3DBPA 2E28A 3F5JA 4C6KA 4XKMA 1WP6A 5A8NA 2FQIA 2FPVA 1JCJA 1MDLA 4GD0A 3L9CA 2AQVA 3WH6A 1OVDA 3S9IA 5AC7A 2PWEA 1XG4A 3FJ4A 1P0KA 2J8TA 4M6PA 1FDJA 3USZA 5I3FA 5T9BG 3COTA 2I5QA 3PBVA 1T8XA 1I2RA 4WSJA 1SJAA 2YXOA 1YQ2A 3RAOA 1FQ0A 4B92A 1JG9A 3B0PA 2W9MA 4MLRA 2H9AA 4ACZB 5C8BB 3M7SA 2GOKA 1VENA 1QOXA 2XINA 4KRUA 4O0ZA 1T6MA 4ML4A 4UNKA 3PANA 3B8UA 2ATSA 3GNOA 3NZQA 3HG5A 4RR4A 4WHBA 1MEWA 4DJEC 1Q6EA 1ZL1A 3WL0A 4HB7A 4MZ8A 1B9BA 3LMYA 1EP2A 2JFEX 4WKHA 1RK5A 4MLJA 1TB3A 3QPEA 1ML1A 4UTLA 3RU8X 3TAOA 1F61A 1E6RA 4RUBA 3SEPA 1FA2A 5CG0A 3P2VA 2GJXB 2P50A 2ACRA 1FWHC 1MFVA 5DT5A 3F2CA 3B9OA 3K30A 4NASA 1TV3A 1UCWA 4I5UA 1EOKA 3TYCA 5A6MA 5JH2A 1SW0A 1UD6A 5D9OA 4ML9A 4KCVA 4S3AA 2Z2BA 3UG5A 1RBAA 3GC4A 1PTGA 3I4EA 4XTDA 1R47A 4CQ8A 1V08A 1DHKA 2DY3A 4ATWA 1R46A 5XINA 3I6RA 4RE0A 3KOZA 4P2VA 2NUWA 3T0DA 4GZ7A 3LM7A 2PDKA 4UCFA 3WQPA 3KCJA 2QAPA 1Q7QA 4IIBA 1PKMA 3LXBA 4OJYA 4ZO9A 3HJZA 3EKLA 1QT1A 1H11A 1RY8A 2J7EA 1PV8A 4NI8A 3I7SA 4RW5A 3VC6A 1H1NA 1ZY9A 3HQNA 3W7HA 4TMBA 3H7UA 2ZZ6A 4S3BA 3RO6A 1EOMA 2F9RA 3KVJA 3UCDA 1JXJA 4IP7A 4JN6A 4L56A 5D05A 4RZBA 4ATDA 1IYXA 3ES8A 3O3RA 1DORA 5C9ZA 1VB9A 3PJUA 3H53A 2ZVIA 2PURA 1DJWA 1Z7AA 2R91A 2V3GA 2OKOA 5I3HA 3W2MA 1YYAA 4UMCA 2OZ3A 1L8NA 3HQOA 4HYWA 3C8NA 4H2CA 1ITXA 5HMEA 2WPBA 5K3VA 3W4RA 4V28A 4EP8C 1X96A 1IR1A 1AH4A 4D6CA 1QK2A 2HMCA 4RE3A 2QKFA 3MB9A 3K4DA 4GYKA 1PWLA 4LBRA 3GXFA 1VF8A 3GIQA 3WLMA 5M17A 2D3LA 2ZC8A 4B9ZA 2H6RA 2YZRA 4Y8EA 1DJZA 2RAGA 4LW7A 1S3HA 3WBWA 2GJRA 5GNXA 3LRMA 4QJ5B 1TSIA 1OBAA 1BTMA 3NL3A 1B4KA 1K8XA 3AXKA 2G37A 4S2CA 3IRDA 4DLMA 4XZ9A 2V0TA 1E5NA 3ZMRA 4S1FA 2DZTA 4PUUA 4DNMA 1TQJA 3CNYA 2V38A 4CKQA 1V7AA 2ZA2A 1LLWA 1TO3A 2VENA 1A3XA 2DT1A 3N14A 3QY6A 2E4TA 3SBFA 5LGXA 4GXWA 1W5NA 2QPUA 1J10A 3N4EA 4PUWA 2V30A 5LA0A 3VX1A 3EDDA 2Y63A 1XBZA 3O6DA 3CUJA 4ZENA 1V77A 4AVOA 4E8GA 4ZQNA 3BJFA 1QO5A 3MWCA 4CQDA 1QXLA 2CHOA 3DYMA 6XIMA 3HG2A 2EGZA 3HB9A 3LCLA 5D32A 4DM2A 1NQKA 4HPXA 4NP7A 1VZWA 2GGIA 1JZ6A 1PJ9A 1JGIA 3PJTA 4FXSA 1HNYA 3CAWA 5GPRA 3QSTA 1UB3A 1KBBA 1DKWA 2FB2A 1YDVA 3P7YA 4PCFA 3G1YA 4JYFA 2OKTA 1BYDA 3FYPA 2O7SA 3MKVA 3FVMA 4DJDA 5AC4A 3B03A 3WFZA 1LG1A 1XS2A 2X41A 3E1F1 4PCSA 1PEZA 3CQKA 3O1NA 2OB3A 3FGCA 4YTQA 5J5DA 3CPRA 1C9WA 7REQA 1R87A 4DO7A 1GOMA 2BBFA 3GK0A 3VNYA 1MW3A 3G1AA 4IOTA 3EWBX 5HUOA 4MZ1A 4MNJA 1TX2A 3NPUA 1ONRA 3QR0A 3AU2A 4PCTA 1MXDA 3R89A 2A6NA 2F7FA 2WCAA 2YCLA 4JQAA 3R6IA 3GG8A 3MMTA 2C8NA 4QJ3B 4TIMA 5CAHA 1UHVA 5I2UA 1M68A 4DO6A 3CQ0A 3MW7A 1KO0A 4AZGA 1FX6A 4LUJA 2R1NA 2RGLA 2W63A 3EA1A 3EDJA 2G0WA 4BK9A 2Y2WA 1CTNA 3WN6A 4CU6A 4AQLA 4XQ6A 1Z48A 4GJIA 1XGDA 3T09A 3IJ8A 4KWUA 3BCDA 4QE1A 1SZFA 4NZJA 1B30A 4DYJA 2FHCA 4LY4A 1E4LA 1XUUA 3FCPA 3ARUA 3GFXA 4HOZA 2WZMA 2VL4A 1K9TA 4HNLA 3S5ZA 4K8GA 3WY1A 1WKDA 4ZEPA 2BWGA 4WUIA 3VKKA 2BY0A 4EWJA 1X38A 4EX4A 4LVDA 3SCRA 2WNQA 4XD3A 4MWAB 5A2CA 3H22A 1LBLA 3ABZA 4UFKA 4R33A 3WQGA 2OT1A 4NJIA 4W9TA 3TJIA 3QBUA 3AHZA 4Q4MA 1IIHA 4BKNA 1CIUA 1H7WA 4UQ9A 1SM9A 4DYEA 1GQIA 3RFAA 4LS1A 1LYXA 1XBYA 5JBFA 3QHMA 5AZ0A 5GJNA 4BR1A 2VUNA 3K13A 1P7TA 3TA9A 2AL2A 2G97A 1C8YA 5FF4A 2DP3A 3E12A 4Z1CA 3VZYA 1BXCA 1CBGA 1PSCA 5IRPA 3NQDA 2OZ0A 3QZAA 1XSIA 3CBWA 4NZ5A 1O5XA 3TK7A 2JGQA 1BKSA 3WLKX 3K1DA 1KBJA 1QPNA 1FWFC 2HS6A 2OSYA 3PHAA 1A53A 3LA4A 2VI0A 4IGHA 3W70A 1YDYA 3PJWA 1ISXA 5C0QA 4B4FA 3THUA 2FKPA 4IX0A 1OQFA 3PSWA 1QPRA 2BGQA 2WZEA 5DCDA 3NVTA 1K6AA 4P61A 3MT1A 5C7VA 2D0FA 3NPWA 9CGTA 1P1MA 4W5UA 4BI5A 5B7YA 5CG7A 2B31A 3S3GA 4U31A 2O9RA 3WDJA 1G5AA 1UD4A 4RNJA 1XLEA 4L6DA 3BC9A 3UJEA 4MWAC 4HOWA 1UD3A 3V1PA 1GZ1A 3QJAA 3I7RA 4YVVA 4AX6A 4UR7A 4MSSA 2X2YA 2NQLA 3W7GA 1XP3A 4GUHA 3BTNA 3L23A 3WNLA 4ADTA 5AZ1A 4LFYA 1WO2A 5LXXA 5BU6A 3HQ1A 3F4NA 4ACYA 2E9BA 1OD8A 4I9AA 1E43A 4ONVA 3T05A 4OU1A 5T91A 4AZ6A 2HZGA 5SWUA 2G4FA 2PDQA 3EB3A 3KOFA 4C5YA 1GPWA 3ZOAA 1TV2A 1KBIA 1KM5A 1WKFA 4DWDA 2PTWA 4GUJA 4KESA 1RK6A 3OW1A 3SCWA 3ITXA 4IGMA 2OSWA 1H63A 2NW0A 3QSRA 1E1EA 4FNRA 3K2GA 3UETA 1E0UA 1XYFA 5DEZA 1QU4A 2HV5A 3P3BA 4WIWA 3EAUA 2Y85A 1RBLA 3G22A 3WF0A 1PTDA 2VRJA 3LD5A 3LPOA 2OQLA 2QQ6A 2FTPA 4FXRA 3KX6A 1KFJA 3LUTA 1LOSA 2WLYA 4EXQA 1TWSA 3RXZA 3D3FA 4HGXA 3GM8A 3EDEA 1AFSA 2YGYA 3WH8A 4XZHA 3UWZA 4IQLA 4NX5A 3FA4A 2VVSA 4JQ4A 4O0KA 3S6OA 1ZB5A 2QUNA 2WZTA 1XLLA 1VBGA 2YYUA 3C86A 2J4GA 3BGAA 1MW2A 4ZOEA 1G7VA 5B80A 5D37A 2J9ZA 1E1CA 4ZE5A 2HXTA 3N3TA 2A7RA 2X2GA 3LCFA 4N9CA 4WGHA 1M41A 1IE7C 2Q3RA 1VYSX 3ZFHA 2YB4A 2F38A 6REQA 2IPFA 4AHPA 2NSOA 1YTEA 3ICJA 1RQBA 4GNKB 3APTA 2YXGA 3M5ZA 4AISA 1KA9F 3M0YA 3UF9A 2WKJA 5A95A 3BMXA 3WLQA 3O0KA 4G1KA 4C1KA 1HZYA 1H1YA 2F2HA 1C7SA 4BQ2A 5AN7A 5DY3A 3EPOA 1BSLA 4HTBA 3M47A 3U6WA 5CPLA 3CMJA 3GH5A 2BODX 1X7IA 4IP4A 4G7EB 2PD9A 5C55A 2VZTA 3NNTA 1W3KA 1OCBA 4DYKA 5AFDA 3WQEA 2O92A 1TCMA 3WQCA 3WBAA 5D02A 1TVNA 5IBXC 2E8ZA 3AIRA 4DEFA 1U1JA 3TW9A 4D1JA 1A0DA 3LENA 6CGTA 3ARVA 2E5CA 5HATA 3VKDA 3EWZA 4CVWA 1TMQA 1V03A 4KEUA 1VLIA 2HPMA 4ZODA 3BCFA 3A4XA 1LBFA 2HVNA 3ZYZA 4MFDA 3HIJA 1OYBA 3DZ1A 1O95A 4FIQA 3E49A 4TO8A 1OCJA 3KRUA 4GHRA 1OT1A 4ZSUA 4HU3A 4HMNA 1EPXA 1DJGA 1K9EA 1W9BM 4HU4A 3GG1A 3RMEA 3ANVA 1SMAA 3QHNA 2X0SA 3WLHA 3NPVA 2R82A 3CZKA 2EJAA 1KQYA 4FOJA 4Q4RA 3AZTA 4DQWA 3POCA 1H7RA 3O16A 3ITGA 4IPLA 5DMYA 3XISA 1J11A 4L4MA 3CPGA 5BMXA 4Z2KA 4UNIA 3NVDA 1THFD 1ZPTA 1XH0A 3VGDA 4JX5A 5HR6A 3GTXA 4IPJA 3N2CA 1W3TA 2VTFA 3IPWA 1XINA 3W1XA 2WJEA 4PTXA 3QLDA 3VU2A 1DWJM 4ZO7A 3KBWA 5CSUA 3KAOA 3MHGA 2Y7GA 3IGUA 3TYEA 1W1PA 3R11A 4Q8MA 1J5SA 3W53A 2HK0A 3B9EA 1DJXA 3LHTA 1SO6A 5CLTA 4O50A 5C6MA 1UZHA 2QUUA 3ZLGA 2ISFA 4A4AA 4LH8A 3DAQA 3PZGA 3WD0A 4KKXA 5DY2A 2D2HA 3QPYA 3CB8A 1UA3A 4FNPA 1VHNA 4F8XA 2XYLA 3NQCA 3AZRA 3MKKA 1RVKA 3BW4A 1HG3A 4PN2A 4JYDA 5DRIA 4C7DA 3H2EA 2C18A 4TVCA 4GY0A 1XSKA 3L4TA 1CB7B 1CECA 1ISWA 4IICA 1G0CA 5D04C 1GHRA 1O7AA 1VJZA 2DW7A 3SAZA 4UOQA 5KINA 1K9FA 4IMEA 1HGYA 3AO0A 1GCYA 2YCIX 4O12A 1WX0A 4WY0F 4MM1A 4LVAA 1W1B1 4PTMA 2YDRA 4WY0A 3MO4A 2OYMA 2VZSA 2QJMA 5FSDC 3TXVA 4HA0A 2REQA 3BDKA 5CH9A 2RDWA 5IFPA 4XBKA 1E72M 4W8LA 4MGGA 3OTRA 3PWGA 4OUEA 1TTPA 4DM1A 4J3XA 3TJ4A 2ATMA 4G9PA 2RGMA 3MCMA 5JVLA 1NDVA 1M04A 3HPZA 4KMQA 5A1AA 1JCNA 3E6EA 4Q3MA 3FEMA 4AZ7A 5DANA 1E1FA 1VFOA 4KBXA 3RCNA 4FI4A 4H1ZA 2Q02A 3P14A 3SRFA 1QOQA 4XKYB 4JIHA 5HPCA 5C54A 4M81A 1Q63A 2A3HA 3CHCA 3THAA 2F61A 4DIAA 2X30A 3SFWA 3VDGA 1F8MA 1VFMA 2EG7A 4D8AA 5EY5A 2Z1WA 2W27A 1ZBVA 2FH6A 3KW3A 3G24A 1XJBA 1ZBWA 4H7CA 4QEHA 3W88A 2XGBA 4MFEA 2Z7GA 4UXDA 4ACZA 2J79A 1K4GA 3GTFA 1FWTA 1C92A 1N82A 2VRQA 2TSYA 2ZTJA 3HOJA 3KM8A 3VKBA 3CHDA 2FGBA 3E2VA 1KBKA 1Q7ZA 1MO0A 2MUCA 3C5QA 3T8LA 3ABRA 1AJZA 3CL7A 1MXSA 4U2YA 3EDKA 3N4FA 2NV9A 4FLSA 3LEPA 4TQTA 3FA3A 1F07A 2XSBA 3S2MA 5HQEA 3SGGA 1VPQA 4OV4A 2FJUB 1OFDA 1KD0A 5F2IA 3C61A 3VNZA 2GJXA 2XWEA 4GBDA 3BLFA 4NNAA 3TYDA 3LTPA 1AH0A 1DWGM 1M65A 2XM2A 2PBGA 3BAXA 1B0IA 1ICSA 4HZ8A 4YCPA 4FSAA 4JX6A 4QNEA 1KM6A 5G2HA 3ITVA 2A2IA 1J0IA 2NX1A 3E2SA 2W79A 4AEEA 4F0SA 2PB1A 3RJYA 5T26A 1TWWA 4AAJA 2I57A 5D2WA 5BXPA 1GHSA 1Q66A 3VX0A 2PWFA 5IOBA 1GQNA 1FKWA 2WSYA 3B9NA 3UYCA 3VOFA 3QTPA 3AQUA 3BURA 1LP6A 4GQGA 3R0UA 1EGMA 2VURA 2NX9A 2DGAA 5G1YA 1G67A 1RCOB 1C3FA 3N19B 4DAFA 2JIEA 1WKEA 1TELA 1LWIA 5DQPA 1AH3A 1PZ1A 4Y7EA 5K7JA 4PMXA 5C5YA 4K36A 3N6HA 3LLDA 2Y6ZA 4UTFA 1ZBKA 4RPQA 4E3VA 1BYAA 3M07A 3OOQA 2MANA 3ZJ7A 2ODOA 5FIPA 4CVUA 3VCNA 5AY7A 1H5VA 3GNDA 4MB1A 4NYYA 2ABBA 3G5EA 1QW9A 4W7VA 1GVOA 3OZYA 3FKRA 5U4NA 1PS9A 4LT9A 1EJRC 1JPKA 2ACUA 2GSJA 4JNMA 3KHDA 2QUVA 1GVIA 3W1UA 3WLLA 3SQLA 1OK6A 3W81A 4LUTB 2Y89A 2D3NA 2V2CA 1GJUA 3O15A 4ZZ9A 4FZIA 4NJGA 3AWNA 4R7OA 1R0MA 2CEQA 4DPPA 1WPCA 4WKAA 5BMWA 1R2TA 2WC7A 2D0HA 3I7QA 3HMJG 3RRXA 2P88A 4E2OA 4B5WA 3BPWA 4JY9A 1XWYA 3PAOA 4DN1A 1EJXC 3BK0A 3UR7A 2OO0A 5EL1A 5I23A 2PDNA 3WNOA 3MV11 1HW6A 3MBDA 4J3UA 3EPNA 4KWWA 3MU7A 4QBXA 1YNYA 2NVAA 5PTDA 1QCWA 3PUGA 4YTTA 1Q6QA 1RLCL 3VOIA 4QJ4B 4JL1A 2WAGA 1RY0A 1ZP3A 1SW3A 1FWWA 1XH1A 3OODA 1K7EA 2WVVB 4H19A 3PTQA 3M0XA 1M1BA 1K8CA 2GGJA 1DXEA 2QPSA 1E56A 1DJNA 2QCLA 1GQKA 2I14A 1GVEA 2YFOA 4GO8A 1U5JA 5CSSA 4FOUA 3HPFA 3N2BA 3GTIA 1QVBA 3N13A 4GO9A 2C0HA 2FTYA 3W7PA 1X98A 4A22A 5C2GA 5AVNA 1GOWA 4FNUA 4W5ZA 4B5XA 1JZ7A 3B8TA 4NF7A 2O4MA 4GCXA 1AL7A 1Z41A 3PAJA 5BZAA 4CU8A 2CBUA 2W61A 5TIMA 3A64A 1EJVC 1W17A 2NLYA 4PTVA 1TTQA 2XVGA 2QDHA 3PK7A 4IXHA 3C0SA 2B7NA 4XB3A 3L5AA 1E6PA 4PMQA 4UQEA 4W89A 2FZDA 5GNYA 3EOOA 1ME7A 2W5FA 4UFMA 4A3HA 1W9PA 4WKFA 5EYWA 3ZT5A 4LC6A 1R38A 4HNVA 1TWIA 3KTXA 2G3JA 1VJSA 1IWBA 3SIZA 1TPUA 3H24A 5JH1A 4EF8A 4I7UA 4H6QA 1F4AA 4TX8A 3GXIA 3UWQA 2VO5A 4C5ZA 3QLLA 4DX3A 2J88A 3GBDA 5EMLA 4JTAA 3W1QA 2R14A 1WDSA 2VZVA 3DFNA 3V4BA 5C9WA 4K1GA 4YWSA 1IXOA 4MWAE 4ASTA 1DIDA 5D2VA 3UXIA 1SVDA 2WVTA 3DG6A 3W7QA 5AYXA 1XYZA 4MPKA 2PDFA 1VBHA 3W7NA 4HA4A 1W2VA 3QYQA 3EX3A 3M6DA 1J0HA 1O5KA 5A8GA 3UJ2A 3FYYA 1JF5A 1C7TA 2G8ZA 1TV7A 1RVGA 5AYIA 3U8GA 1HL2A 2DQXA 2Z1VA 3KLKA 1XYAA 3KL5A 4MUZA 4BFAA 4HU0A 3AMGA 3TDFA 3N18A 1WZKA 1S2WA 1KRBC 1WDPA 3L5MA 1W1ZA 4O28A 2BX7A 5LNRA 3SRDA 5JU6A 1SQ7A 3SRKA 2HRWA 4B5UA 5AC5A 1PKYA 4YHEA 1XLFA 1UZ1A 1GYLA 2GJPA 1YBQA 3LQLA 1R3TA 1DPMA 1MNZA 1LL4A 1BGGA 1RA5A 5D8WA 4HNNA 2J66A 1POJA 4N6EA 3WD1A 1XYCA 2WMGA 3BOXA 4X63A 3GXMA 4PGLA 4OE7A 3IK4A 1NWSA 3PR2A 2G3FA 3DCPA 1I0DA 3EMZA 4Q8TA 2JF7A 1OSEA 1U1HA 2R1KA 2TRSA 1E9LA 2YIHA 3MUXA 4R5EA 3OLIA 1RCXB 5D9NA 2Z29A 1Q6RA 4E2BA 3MV01 5M5DA 2ISVA 1JCYA 2DT3A 1ZSXA 4I3GA 3PFMA 3B4YA 1DV7A 2XFYA 2CNCA 3CIXA 2CESA 4MB4A 4AD1A 3MA8A 2AAMA 2ZYFA 3H12A 3REQB 4DBUA 4IP5A 4GG9A 2ZUTA 1QPQA 1FWCC 1FFQA 5DN1A 5K4XA 4Z1AA 1Z44A 3M0KA 4ZGYA 4ZO8A 1QDSA 3E0WA 4NAFB 4N42A 1F5ZA 2BDQA 3V75A 4F79A 5I06A 1BEUA 4QDMA 5DBTA 2QS8A 1YTKA 2ZZ4A 1GW9A 4AHOA 4JS3A 5FKYA 2OSXA 3K1GA 4X0VA 2PLMA 4L9XA 4M7SA 5AVHA 2ZOXA 1UYQA 1BQGA 3GKFA 3DHUA 1FXPA 4DUOA 2QJNA 1XCWA 2NUXA 1JPDX 1ISVA 2UY4A 3MMDA 5IDZA 2DT2A 5HWNA 3LLFA 4GX8A 2GWNA 5LXEA 3PM6A 2VFIA 3DXIA 2DZPA 3KVKA 5EMYA 3S6DA 3UY8A 4RZ6A 1J12A 4HHPA 3TEVA 2BS9A 1O12A 3PUOA 2R6OA 1D2KA 4G7FA 1SFLA 3IJ6A 1VRDA 4PMRA 5BXSA 3MZ2A 1C8VA 4LJ3A 4UTUA 2Z0IA 4Y8FA 3HPXA 3MVTA 3R0KA 1XGEA 3SGUA 1G94A 3SCQA 2NV1A 1FCBA 3VM5A 3OVPA 3VE7A 1CXEA 3OB8A 2OXNA 4PB3A 3I68A 2X05A 4G1NA 4H9TA 4TX9A 2PDYA 4BJHA 1RJQA 2C0AA 4B5SA 1YPXA 4ZE4A 3NGJA 4QCEA 2GUYA 1JDFA 4IG2B 4MHBA 1BYBA 1Z8AA 2HE8A 2HBXA 2WM0A 3E0VA 1NWRA 2VHLA 3LS9A 1BQCA 2G96A 1XLMA 1OGBA 1NARA 4HBKA 3BLPX 5FF3A 3LHVA 3GXPA 4H8UA 1T40A 2BLEA 1UKPA 1O60A 2GJNA 3FS2A 1ZTVA 2UV8G 1B54A 3W29A 2OZTA 3UT0A 1V3MA 3LY0A 2ZDSA 3AIBA 1S5MA 4F3HA 4R9XA 1W91A 3C56A 3OG2A 4QTGA 3KOXA 3L4WA 2MNRA 5I77A 3W26A 3AROA 1F76A 2QJHA 1EHAA 3TWAA 5HPOA 3WELA 3FX4A 1OFBA 1YADA 1HP4A 3O63A 3LZ5A 2Y62A 4YIWA 4PMJA 1ODZA 3BLDA 2V6AA 2DVXA 3E0LA 2QJJA 3R8RA 1OX6A 5J04A 3OA3A 1FWNA 4ALDA 1HIZA 4K3ZA 5EKYA 3AAMA 3OLGA 3UCQA 4WZHA 1HX0A 4RE4A 1W1TA 3LI1A 5HULA 1N8WA 1NIUA 2FZBA 3S47A 3L4UA 3DESA 3IAQA 4G7EA 5F1VA 2VGFA 3W76A 4RJEA 3QY8A 4Q7BA 5HWMA 4L1WA 1XLHA 4E38A 3UR8A 4KCWA 3THCA 3VMNA 3TNOA 3H7RA 2J7CA 4KGJA 4MDOA 4PA8A 3E96A 1A5MC 1I8JA 2AAAA 4I90A 1EZ2A 5CLWA 1F9CA 4H3DA 5CKSA 5CSYA 4CCDA 1OGSA 5BOEA 4XSMA 5DELA 1JZ3A 2CPUA 1XDJA 3VXGA 1H5YA 3T40A 3V0UA 4C6OA 3ME3A 2NX3A 1XIEA 5IDIA 1UOZA 3LMZA 4MNMA 1XUZA 3GW3A 4DXKA 4RX0A 1PIGA 1NELA 1S5NA 2CZVA 3GS6A 5G4HC 3KHJA 4WQ6A 1ZRQA 2D24A 3TWBA 1GZJA 3BWWA 4FNSA 5G4WA 3WK1A 2X7WA 4PCPA 4IPNB 4RXFA 2G50A 2X7VA 2JKAA 3PBYA 4IT1A 3MP5A 1LRNA 2A3CA 3P8IA 3EWCA 4MTVA 2HDJA 4GI6A 4S3DA 4HK6A 2OVLA 4F9JA 3V1HA 2CZFA 1M7JA 4JTJA 2PCEA 2VD8A 1GOQA 4MYXA 2IPGA 3P60A 2WMIB 1YNPA 4C6PA 2XN2A 1CDGA 3D6NA 3AXMA 6A3HA 4S3KA 1UROA 5C9XA 2IQTA 4YVXA 5DF0A 4F0LA 1SGJA 2FHFA 3NQ7A 5K9CA 1TJRA 3TYUA 4HD5A 4AIBA 4MAVA 3S46A 4FPSA 4O52A 4M29A 4GYFA 1XF0A 5CPTA 1S38A 1QHOA 1WUEA 4R88A 4UQAA 5G5IA 1OFRA 3WK2A 1XLBA 1UWIA 1E3ZA 3ZO9A 3V7PA 3DFOA 5H2ZA 3WZ0E 1A5KC 3M43A 4AF0A 5E6YA 3P8JA 4ZTXA 1XIGA 3C2YA 1W2PA 1JRBA 1JUEA 1C9DA 3AWOA 4AD2A 4A8RA 4Q4QA 3ZWTA 1CXFA 4BI7A 4QR6A 1P5BA 4X2PA 2HQAA 3QHOA 1ONWA 4HSHA 3STFA 2Q6ZA 3B9AA 3GC2A 2VQTA 6TAAA 1G69A 9XIAA 3RHGA 2IXUA 5AOUA 3TJXA 2XIMA 3DC8A 1P43A 1FCQA 2ZX9A 2BASA 3BICA 3RRAA 2AGKA 4E3TA 8XIAA 2E6FA 4LX4A 2WK2A 3WNNA 1A80A 1UR1A 1PHWA 1H60A 4WJXA 4QS5A 4AUBA 3ABOA 2VEGA 2GGEA 1AA1B 2XIOA 4UZSA 4KGLA 5CGMA 5FF7A 2A3EA 3ISIX 3MZNA 2FVLA 4JN7A 3BZJA 4PFMA 1HJWA 4DBEA 4LAUA 1EWDA 2CW6A 5DT7A 1HO1A 1W1YA 1V0NA 4CD5A 3WBXA 3LGGA 4EPBC 1G1YA 4UFIA 1OFQA 4XKYA 8RUCA 3IEBA 3T07A 4NNCA 3GUWA 2C7FA 4P7LA 4O10A 2VCAA 3MKCA 4LALA 1KCKA 4AH7A 8CGTA 2E8YA 4GCAA 1H0GA 1JYWA 2PGFA 1AD4A 3VCRA 3UQNA 3BCJA 5E09A 1EF2A 1BVWA 1OX4B 4XBSA 2BZNA 2F6UA 4L65A 1BXNA 2OELA 3VDHA 1WUFA 1H7XA 4LV4A 2YLAA 1IEXA 4C6MA 4K7VA 4NUWA 2Z1BA 4IHCA 4Z1BA 3C0JA 3UXKA 2JF6A 3N2XA 4IIFA 4ZQMA 2H90A 2Z1KA 3BARA 4UCGA 3FXYA 3PZUA 3H8AA 1H51A 2Q71A 4KQNA 1YNQA 3QPZA 4C7FA 1AW5A 3Q37A 3CL8A