3S42A

Crystal structure of the 3-dehydroquinate dehydratase (arod) from salmonella enterica typhimurium lt2 with malonate and boric acid at the active site
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
260
structure length
259
Chain Sequence
NLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTIDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
publication title Crystal Structure of the 3-Dehydroquinate Dehydratase (aroD) from Salmonella enterica Typhimurium LT2 with Malonate and Boric Acid at the Active Site
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 104
structure length 259
sequence length 260
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3s42A00
5EBUA 3PC0A 1DQXA 2JGYA 3RLUA 4HNNA 3NQGA 2VKZG 2YFOA 5D04C 2F84A 3LOTA 4GFSA 3MI6A 3DENA 5FEWA 3W1PA 1JUEA 1L6YA 4M19A 3ABOA 4Z1AA 3NO5A 1VC4A 5BMWA 1OFRA 3EWBX 5FF7A 1KV5A 3HJZA 2B7OA 4MYAA 3QMSA 5KMYA 3TE9A 3W84A 1C8VA 4O1CA 1FQ0A 2CLHA 3MUXA 5DXXA 3TXZA 1FXPA 4FX7A 3ATZA 2E5CA 2JK2A 3M9YA 1WV2A 4FHAA 3CIXA 3NL3A 3BARA 2RDTA 2V82A 3WJWA 2FPVA 4UTJA 3L66A 1J2WA 3NM3A 4UTMA 4JTGA 5AN7A 5EKYA 1QOQA 1OX4B 1KV8A 3DFSA 1SW7A 5CZ0A 1FWRA 3P62A 3SZ8A 4U4MA 1XBVA 1EWDA 5G5IA 2PURA 3STEA 3G1VA 3H54A 2YSWA 5DN1A 1H1ZA 4KFNA 4LVGA 1XI3A 3F4WA 4P2VA 2Q8LA 4OV9A 1K02A 3W7QA 1PCWA 4LOCA 1ALDA 3CLMA 3KHJA 4NX0A 4XZ9A 1KFCA 5AHNA 2WOQA 4XBSA 1VHNA 2A0NA 2NZLA 4O17A 4BF9A 3DAQA 5LNSA 2F7FA 2YR1A 2GPTA 4IMFA 2WNZA 2J9ZA 2ZQ0A 5I3JA 1PHWA 2E6YA 4UFLA 4UXDA 1SPQA 3EXRA 4Y8FA 4EOUA 3GKAA 3BLFA 4JYFA 3B03A 2YYTA 1LRNA 3W1NA 1NAL1 3TC7A 3QZEA 3NPVA 4LVDA 4M7SA 4AEOA 4HNVA 3CEPA 1W5NA 2ZZ2A 4M5PA 2G5WA 2E5DA 3JS3A 3AO0A 5D32A 3G0XA 4MFDA 1VYRA 1G7UA 5KZDA 3TC6A 3G1FA 1QWGA 3M5YA 3DH7A 1JJKA 4ALDA 4UMBA 2QCCA 3YPIA 3I7RA 1C9DA 2VOMA 3KXQA 2LLEA 1Q6LA 1W3NA 4ZQMA 1AG1O 2WV8A 5HNRA 1K7FA 2ZZ6A 5G2HA 4KWVA 1YXYA 4G1KA 2ZA2A 5LGXA 4IMEA 3TR2A 3GVGA 1AK5A 2I1OA 4HIBA 3CM4A 1WOAA 2J9YA 3MHUA 3GDLA 1LOSA 1R47A 4O16A 3SGUA 1VQTA 4JTJA 1KM1A 3IEBA 4UTTC 2ZZ4A 4GNJA 4XWUA 1GWJA 1RZMA 4ZQNA 3MMTA 3CC1A 3F03K 3KVJA 2ZCGA 4ML9A 4JX6A 4HHPA 4XTDA 4QJ1A 2B7PA 4MFEA 1I4NA 5A8GA 1GTEA 4RR4A 2OT1A 4O52A 3M7WA 2HMCA 2ZRVA 5J5DA 2A85A 2PRMA 3LERA 4GUJA 3BO9A 4CLMA 1ZY9A 3FJ6A 2HSAA 4KKXA 4N9EA 4IPJA 1XM3A 4JIPA 4IMCA 3LI0A 2X1UA 4UTKA 3C2FA 5EL1A 2AQWA 1P0KA 4D2JA 4FNPA 2A7NA 1WA3A 1H50A 3W85A 5HR7A 4BI6A 2NUWA 3NL6A 4O54A 3MHFA 2OT0A 2QCFA 3RU6A 3U8GA 3W7PA 3NXFA 2OCZA 3HGRA 5E93A 1LCOA 1PV8A 5AHFA 2ZZ5A 4Z1BA 4ADTA 3MYPA 3N9SA 3S5OA 4O50A 2WO5A 1QPRA 4IOTA 1VYPX 2FPTA 5EY5A 2FB3A 1JVNA 4LC8A 3S1UA 1IIHA 3C4UA 3PG8A 3C8FA 4WOQA 2VC6A 4NXSA 2E1DA 1TPUA 4HSNA 1C29A 1FWWA 1KFJA 3CWOX 3KX6A 3BW3A 1SUXA 1EX5A 1VH7A 1SFJA 3C61A 3BK0A 2V5LA 4O13A 1YXDA 3CHVA 2Y7DA 2A7PA 2GQ9A 5EMUA 3L5MA 4CNOA 1G4EA 2YFNA 3L9CA 4UFJA 3W7EA 3W7NA 1VLIA 1N8FA 1J4EA 3LDVA 4PTNA 4XTIA 4IX0A 5D05A 3IGXA 3W07A 4JTFA 3G1HA 4O4VA 3TIMA 1J5TA 4RX0A 3WJSA 3CU2A 3LCIA 4UFMA 3IIOA 3HG2A 3LCXA 4MZ8A 3S1XA 3TU9A 4NNBA 1TB3A 5D38A 4YWIA 1YPFA 3R5EA 1WXJA 1LBFA 4JY9A 4OGZA 1S5VA 1G69A 4P61A 3FA5A 1QMLA 3QJAA 1EPXA 4NJHA 2B4GA 4CQAA 3B06A 3IVUA 3EXSA 4E2BA 1Y0EA 1U83A 2VFHA 1W3IA 1M6JA 3STFA 3GR7A 1R2TA 4PL2A 1XDLA 2V30A 1I2RA 3MO7A 3GNNA 4GWEA 2V2CA 2Y70A 4JYEA 5DLCA 4QAIA 3N2MA 3NPWA 5F2IA 3M5VA 3SY5A 5TBOA 4IXHA 4FNUA 3CT7A 3G22A 4M6PA 3DFTA 3DKLA 3G1DA 4A2RA 1OX6A 1A5CA 2VELA 1Q6QA 3W1XA 1FUYA 1VCVA 4NJKA 3DFQA 3DBPA 2ZRXA 5LKYA 3IIPA 3W7MA 1AL8A 3ELFA 4LC6A 1O94A 2QDGA 3LHUA 5FF0A 1O95A 3L21A 4ZQCA 2B0MA 1LYXA 4QISA 3WJYA 3CWNA 3IRDA 3NL5A 5K9DA 1TYGA 3PF3A 4LVAA 2VEIA 3A22A 2ISVA 1KFKA 4WZHA 1OFQA 3Q58A 1W5QA 4ZQOA 1GQNA 1L6SA 5D09A 2YGYA 1RVGA 2C6QA 4DELA 2ABBA 2HS8A 4CQ8A 4I7VA 4DEFA 3PM6A 1FDJA 4FIRA 3W73A 2BLEA 5K4XA 3W75A 3M43A 5AC7A 1KFBA 4FNTA 2PE4A 3LBCA 5L6UA 1W37A 3S1VA 4UFIA 1JCJA 3JR2A 4Z08A 3GR8A 3MBDA 3MP4A 4AH7A 3EWZA 1AW2A 1EP3A 1TPC1 2C0AA 2H8ZA 1F7BA 4RXGA 5HULA 1GT8A 3LM7A 4K7YA 3LBMA 1EP1A 1T96A 4K7VA 4PL1A 3NQMA 1G4SA 5F2LA 1KTBA 4JGDA 4ORMA 2EAWA 1K3UA 5D30A 5K9CA 1KM5A 4JS3A 4HT3A 3W22A 3S8HA 3W7DA 5KINA 1AW5A 4LUJA 4ZMGA 3QH2A 1CI1A 4JYDA 2GVJA 3TX9A 2QJHA 3GIYA 3NQEA 3W87A 3A5VA 1T8XA 4PCFA 1NVMA 2WPBA 3BGJA 3S5NA 2QAPA 3EWUA 2ISWA 4GUHA 4O8RA 1K8YA 1SR9A 4UIOA 3OVRA 1O5KA 4CNPA 2GQ8A 1LRQA 4BK9A 1FX6A 3OEXA 3IGSA 6ALDA 5AHEA 3LXAA 1KBIA 4FNQA 4QM1A 3HGJA 3G0SA 3KRZA 3DI1A 3G8EA 3L0KA 1VRDA 3IGUA 1CX9A 2EF9A 3FOKA 4FNRA 4IGHA 3OG3A 4HN4A 5G2IA 3L65A 1W8SA 1H1YA 1F73A 3TXVA 3M47A 1DV7A 3Q94A 1S3HA 3NQAA 3O8AA 2ZRWA 2OZ0A 5HINA 3W83A 1E51A 4UMAA 3O05A 5G2WA 3HG5A 3PWAA 3QMRA 4FNSA 4O12A 1M7OA 4IX2A 4WQ6A 1ADOA 4FX6M 4X22A 3FJLA 3O07A 4O14A 3MI2A 1SZEA 3TAKA 4O4WA 1ICSA 3C56A 1GVQA 1EB3A 1IXOA 5LHFA 3M5XA 4EF9A 4DO4A 4IMDA 3N2XA 4N4QA 4OBTA 3P67A 4MLRA 4UTIA 2CLEA 3H53A 2QKFA 3W86A 3A23A 1VGAA 3EWXA 4S2BA 1F76A 3PY2A 4NUWA 1IIGA 2DORA 1DOSA 1Q6RA 1OYBA 3LRLA 4JTIA 4NQ1A 4IMGA 1VCGA 3DFOA 3M5ZA 4UTUA 1EIXA 3FKRA 3C0JA 4IPIA 1GOXA 1FCUA 1TTQA 1TV5A 2C3ZA 3R13A 2GVLA 4JXCA 1QPNA 1U5JA 3MJYA 1XBZA 3UWYA 1F6PA 5CZJA 1QDSA 3R2GA 1B3OA 4K8EA 3PBVA 1HFBA 2WNNA 1EP2A 4AMAA 2QJIA 3W70A 2GJLA 2RDUA 5G1YA 1B4EA 5K9XA 4ZQPA 5HMSA 4LRSA 1HTIA 3G3MA 3O6DA 3GDMA 1VYSX 1UCWA 3QF0A 4K6AA 1QNVA 3LX9A 2FFCA 3T44A 1WYIA 1SO6A 1JCMP 2NWSA 3S42A 3ZS4A 2H3BA 4RKAA 5TIMA 5CPOA 4H4IA 5C5YA 1OK6A 3E96A 4IQLA 3UD6A 1B57A 2B7QA 3PBYA 4HPXA 4MOZA 3W74A 3M41A 3TQVA 5D2TA 2X1TA 1HO4A 5FI8A 3KOFA 4JD4A 5C54A 5H2ZA 4JN6A 4N2YA 3SI9A 1YTEA 4QNEA 1G4PA 1ME8A 2B7NA 1SFLA 2NXHA 2QEZA 1F6KA 1HUVA 3W7GA 3RK8A 4FB7A 5BW6A 3FYPA 1WAUA 1JCLA 3WJXA 4C1KA 1K8XA 1ZAHA 3TQ0A 1TPVA 3LHVA 2ATSA 4MJMA 3DXIA 2C15A 3GLCA 5C55A 1H7OA 4N6EA 1BKSA 3VE7A 2C1HA 4XUGA 3STCA 4R34A 1WDWA 4UCGA 3CEUA 1FBAA 2GQAA 1TIMA 2GOUA 3M44A 2FLIA 3M16A 2PRLA 3S9YA 3UWZA 3HGSA 1XUZA 1TREA 2X16A 3CPRA 3F1QA 2X30A 4POCA 3LGEA 3W7KA 1OYCA 5HUPA 3G8RA 4XBKA 2V5BA 4K38A 3LRMA 3PG9A 3I65A 1OYAA 4RZ5A 4M6VA 2NX9A 4KFOA 1TPB1 3R12A 4ZZ9A 1D3GA 3NVTA 3OVQA 1H61A 2ATMA 1KFLA 4XKYA 1G4TA 4EVZA 4JTSA 3T40A 3UQNA 3P5ZA 2GVGA 2HTMA 3ABSA 3L68A 2EHHA 3QQ1A 5BNKA 3E12A 4LV9A 4C1LA 2C18A 1IXPA 3W2LA 3NYZA 1H7XA 2A2IA 4WXZA 1W56A 3TA6A 3EX2A 1LZOA 4YXGA 1VHCA 1W5OA 3HB9A 3NA8A 5KSWA 2Y7FA 4N4PA 4X2RA 5LGZA 2CLFA 1GVFA 1RPXA 1G7VA 4JX5A 3W1UA 2J6XA 4UC5A 4MY8A 3W71A 4WY0F 1D9EA 3GDKA 1ZHAA 2TYSA 3P5YA 1GZGA 2XN0A 3G1AA 3PB0A 3W1TA 2JKEA 4WX2A 3GX9A 5HR6A 3HG4A 5G1TA 1ZENA 1ICQA 2Y62A 4FEZA 2D73A 3G24A 4AVFA 3ABQA 1XUUA 3DZ1A 3EX6A 4A22A 4JY8A 1LBMA 4J9JA 3UWQA 3OBKA 3RNDA 1DL3A 2CZDA 1PIIA 1RQHA 1FDYA 3TROA 3GAYA 1S5WA 3KRSA 3VI2A 3HO8A 2V0TA 4PFMA 4K36A 5J5RA 2CZFA 1TSIA 2ZRYA 1M5WA 2UV8G 1ML1A 2V2HA 3KVLA 4O1AA 2CU0A 3LRKA 2R94A 4LV4A 4OWGA 1A5AA 2VXNA 1YXCA 3L67A 1P5BA 3P7YA 3ZR4A 2BZNA 3S0CA 3R8RA 3GDRA 4BI5A 1NF0A 2V8ZA 1K7XA 4JIQA 1OG0A 4HKPA 4AF0A 3W7LA 4QQ3A 4QNWA 5F1UA 5CZTA 2G96A 3IIXA 1FCBA 2QCDA 4TX9A 1YYAA 4UNKA 3HIJA 4Q4KA 2YDAA 3C6CA 1HO1A 4OE7A 2TPSA 1TRDA 2QCGA 4YMZA 2DZWA 3QEZA 5DY2A 1SW0A 1I8JA 3EB2A 1H62A 2DZVA 3GAKA 1NFBA 2TSYA 3NQFA 1KM3A 4N9CA 3O6CA 1ZALA 1F5ZA 3UXAA 3QSRA 3W2JA 2TMDA 1N7KA 2H90A 5EPDA 1W0MA 3NOEA 1KM2A 4HPJA 4BWLA 4YCPA 1FWTA 1LLZA 3KVMA 1EEPA 3W2KA 3Q2DA 5K2ZA 3TJLA 1H51A 1TTPA 1XFBA 3B4UA 3NQ2A 3VKJA 4K37A 3SW6A 3NZ1A 4MKNA 2VEPA 4GUGA 1NEYA 1ZJIA 1T0OA 3W2UA 4DPPA 3HPSA 3GK0A 4DO5A 1UB3A 4GUFA 3LHZA 2JKPA 4AWSA 3W2NA 1TPFA 2P1FA 1AL7A 3I7QA 2KZHA 3W7OA 1RV8A 1DVJA 3PUOA 3DHFA 3UPWA 3BW4A 2YW4A 1D3HA 2DZTA 3G0UA 3MWAA 4O1BA 1ME9A 3UWWA 1DKWA 4Y9AA 1OFEA 3W1RA 3USBA 2TRSA 2ZZ1A 4NNAA 3A21A 3FFSA 3LTYA 5AFDA 3WK2A 4U28A 4AXKA 2DJLA 4O0KA 1Z42A 2C16A 1F2JA 3NDOA 1B4KA 4UR8A 1A53A 1TV8A 4DPQA 3IVTA 4NZJA 4JR5A 4LNYA 4MZYA 3EWYA 3TAOA 3W23A 4XKYB 4ICNA 1VCFA 2YZRA 1IXNA 3R89A 4WY0A 2J88A 3BV4A 2DZUA 2ZDRA 3Q37A 1H7NA 1RQEA 3QW4B 2CW6A 3S6DA 2A1YA 2BSLA 3FYOA 1DJNA 2G97A 4N6FA 3W1AA 4S1FA 1F05A 2ZFAA 3V75A 2X2GA 2XN2A 3MI3A 3N73A 5LNRA 4ADSA 3HMJG 1LP6A 5I3IA 2YPIA 1GVOA 4UMCA 5LSMA 4RXFA 1NSJA 5EYWA 1G67A 1AMKA 2E77A 4K39A 2A6NA 5AYYA 5CPNA 4OU1A 2QUUA 1SU5A 5AB3A 4FIQA 2BTMA 1B9BA 3ZWSA 3EX1A 3PBUA 3QM3A 3MYOA 2R14A 5EA9A 4DF1A 3EWWA 1XXXA 1YLVA 4MPQA 1JCXA 4R7JA 4Y90A 4KFPA 5FESA 3TFXA 1YADA 2NX3A 3B0UX 2QJGA 1OVDA 5SWUA 4N9DA 1TPEA 2NXGA 5AYXA 2P10A 1LBLA 3MP3A 3NZRA 2ZZ3A 3C2RA 4FO4A 4L4MA 3LV5A 3I6RA 4QSHA 2H8XA 4QIUA 1SO4A 2CLMA 2NUXA 3STGA 4YCOA 1UASA 2ZA3A 2ZRUA 4YLWA 3IV3A 3SSJA 1MZHA 4I7UA 3GXPA 1TPWA 3PR2A 4AF0B 1V7YA 2RFGA 4WOZA 3N14A 4DXVA 2QCDB 4ONVA 4NX5A 1LM1A 3E02A 4GE8A 4W9TA 3DFPA 2R8WA 4BI7A 1OFPA 5FF2A 4HNTA 3TJXA 3GZ3A 4TR9A 5AHLA 3NL2A 4N9BA 1W31A 2Z1BA 3T55A 2YW3A 1T99A 2FIQA 3GDTA 4M6QA 3HBLA 1K03A 4OHQA 1VPXA 5HQEA 2Y6ZA 2Y85A 2E6AA 1DHPA 3N3MA 4BWLC 1JQXA 1SO5A 5I3GA 1LROA 3N19B 1JQVA 1MEWA 2EGZA 4DBEA 1ZAIA 4Q32A 4A3UA 3INPA 3W7RA 4LS0A 4MUZA 4OV4A 2IQTA 3O16A 3QFEA 4GXMA 4NJJA 2QR6A 3P8IA 4ZQRA 1LOLA 3CIWA 3BW2A 3C3NA 3NG3A 5F1VA 3SFKA 1PS9A 3OHIA 1TTIA 3GXTA 1GYLA 2C19A 3VE9A 4NZFA 4GRSA 2DU2A 2ZZ7A 4S2CA 2NX1A 3P84A 3LLDA 5LZLA 3WK3A 3ANYA 3NQVA 2GJNA 4JTTA 3TFCA 2VEKA 3KVKA 3ATYA 3T78A 4X3ZA 1BWLA 1FWNA 5I3FA 4AHOA 4LWWA 4JEQA 4LRTA 3L5LA 3BLEA 5MHBA 5HUOA 4MY9A 1QAPA 1GG0A 2QCMA 3BLIA 1OF8A 4UTTA 1TV7A 3P80A 3WK0A 1LLWA 4Z1DA 4ZVJA 3EX3A 5CZSA 1TJRA 2Y7GA 2J24A 3QPZA 1RR2A 5LNWA 3FKKA 3G3DA 2WKJA 1ME7A 1PCKA 5HJLA 3QYQA 1YDVA 3IIZA 2Q3OA 4K8HA 2A5HA 1I2OA 1JULA 4WY0B 3QQ0A 2ZTJA 2E6DA 2CLOA 3UZ5A 2W0UA 2QCHA 5D02A 3QC3A 2H6RA 3PSVA 1FY6A 3C2VA 2Y89A 1DBTA 1SZGA 4CQ9A 3O6YX 1PHQA 1XL9A 1Z44A 2WJZA 3HG3A 1UJPA 5U7SA 5HWNA 3NPUA 3KRUA 3BG3A 4CCCA 1EUNA 3NQDA 1SO3A 4TMCA 2G95A 2W6RA 4LW7A 1LDCA 5F4XA 5DBUA 4JTKA 7TIMA 3P82A 1TTJA 4GUIA 4ADUA 4JTUA 1Q6OA 2A21A 1ICPA 2E5BA 5CKSA 1A50A 1PVNA 1WX0A 1VJIA 1H60A 3UZJA 4NJIA 2XFWA 1Q3NA 3O1NA 1TMHA 3A5FA 1EWEA 3PSWA 4YL2A 1N55A 3KAOA 1HL2A 1LTDA 3N34A 1K8ZA 5GVJA 5KITA 3PVFA 2NV2A 3RLVA 1IGSA 4EF8A 1EUAA 3LLFA 1SSGA 3MW7A 1W5MA 1OX5A 4UFHA 2A7RA 2DZPA 2QCLA 3GKFA 4O15A 3NQCA 3U2OA 3DI0A 1KBJA 3NGJA 2AGKA 3B0VC 3D0CA 2ABAA 1KTCA 2O7SA 3KFTA 4BR1A 1WOBA 1X7FA 1OFAA 1TPDA 4CNNA 1UBSA 1O4UA 4O18A 2QUTA 3OIXA 2CFFA 2CLIA 5IM51 4KWWA 4MVAA 2Y88A 3WFAA 1KTNA 1QFEA 1JRCA 4AAJA 1JCYA 3TSMA 3SECA 1ZAJA 1LORA 4JDYA 5E0KA 3PBWA 3FLUA 1H63A 4DF2A 2H3DA 1UUMA 2E68A 2NXIA 3L0NA 5D37A 2YXGA 3EXTA 3QSTA 5D2XA 2HS6A 3TH6A 1YDNA 2R91A 3T4CA 4BFAA 4DBDA 5ABTA 3PS7A 4HSOA 4ZL1A 2ISSA 5FEZA 1GJPA 1P1XA 1L9WA 3TQKA 3P81A 1TQJA 3THAA 3HGOA 1LOQA 3TW7A 4AHQA 1I45A 3L2IA 1GG1A 2Y7EA 3W76A 3H55A 2NV1A 3I7SA 4A21A 3GNDA 3UY8A 1QO5A 3CTLA 3VNDA 3QW3A 3NEVA 2CZ5A 5FEPA 3LTSA 3THQA 4WJEA 4UUIA 1GEQA 2C13A 4O11A 3MP5A 4UTWA 1YDOA 3W7JA 1ONRA 1YTDA 3VCRA 4NT0A 3MHGA 5LHEA 1DQWA 3FIGA 3LB0A 1MEHA 3BVJA 5AC6A 4CCDA 1OK4A 4PEKA 1TCDA 4LUIA 2GUUA 1WBHA 4GBUA 5FF3A 3B05A 5H91A 3MBFA 5AHIA 5AOUA 4WXYA 1QOPA 1MXSA 1SZFA 4RLIA 4CCEA 1PL9A 2W79A 5CGQA 2QCNA 1XKYA 4A29A 3EEGA 4R53A 4NU7A 1I2NA 3O63A 4NNCA 4MLJA 3ZFHA 4LU0A 3WK1A 2P0OA 3W7HA 1H7RA 1Q45A 3LV6A 2OX1A 1GVSA 5D2VA 3DKJA 1JR1A 5DELA 1KW1A 3M1ZA 8TIMA 4JTHA 3CQ0A 3FS2A 1FDZA 4UTLA 4WUIA 1H7WA 5D2WA 5AC8A 3LTPA 2XN1A 2VFDA 2I9EA 5CPLA 4DO6A 1R30A 1W5PA 4Y6GA 3JRKA 4TIMA 3HF3A 4I9AA 4FXSA 4DF0A 1O5XA 1VS1A 2Z2UA 3UY7A 5D03A 2ALDA 5G4EA 3TCEA 1P0NA 3WJZA 1VR6A 5K3VA 1MEIA 3LCWA 2CLLA 3UWUA 3UYCA 1TPH1 4FF7A 4GJ1A 3G1SA 2PRHA 2OJPA 4AHPA 3QPYA 1QO2A 3F4NA 4O1DA 1OHLA 3PULA 5E1QA 1KFEA 2QCEA 5F4SA 5IBXA 1GVRA 5LNVA 4ORIA 3P74A 4Z0JA 3DHDA 3SR7A 5F2MA 4Y96A 2JGQA 3NM1A 2FB2A 1FCVA 1FCQA 4PH6A 2O7QA 4E2DA 2Q3RA 5CPMA 3PUDA 2FTPA 1G6CA 1K7EA 3QMTA 4TU1A 3NAVA 1KLZA 1XC4A 3BG5A 3ABRA 5CSRA 2JKAA 5DY3A 2JBMA 1SSDA 1X6UA 5KZEA 4FX8A 2DZXA 3M0ZA 3L0GA 4WD0A 1OABA 3LHTA 3LCLA 3S1WA 1QPQA 2E09A 5LNUA 2FDSA 5C6MA 3W1LA 3NQ7A 4IJBA 3LCHA 2V9DA 1LRTA 4UFKA 1JUKA 4MIMA 4AB4A 1DORA 3LCGA 3TMQA 5HWJA 5BRBA 3AJXA 3B04A 4LTSA 2EKCA 4PA8A 2RH9A 3TDFA 4LS1A 5D2YA 5AHMA 3V1PA 2VFEA 1M7PA 2RKXA 1SZNA 4LVBA 4A2SA 5U4NA 5KZMA 2VENA 4UNLA 3EX4A 3N9RA 1ZFJA 5CG7A 3DFNA 1XBXA 2FJKA 3W7IA 2NLIA 4Z1CA 2Z0IA 1SQ7A 2J27A 4RK8A 5DXYA 3FEMA 1F74A 4R33A 2VFGA 3W88A 4RJEA 3G1YA 1X1ZA 2V81A 3NQ6A 1SW3A 1OFDA 1W54A 3VFLA 2Y63A 4JX4A 1BEUA 1XCFA 3E9AA 3O15A 1H7PA 4UTWC 2NWRA 1OFOA 4E38A 1EA0A 3IIVA 1OF6A 2EPHA 3RFAA 3NNTA 4UR7A 4O28A 2VFIA 1TRIA 5TQLA 2WSRA 1R2RA 2ZTKA 1W1ZA 3TV8A 1HG3A 4JDBA 2CLKA 1PE1A 2AAMA 3I68A 2E6FA 3P61A 1GYNA 4X9SA 2BWGA 4LVFA 1RD5A 1XBYA 2FPYA 3TUUA 3LCFA 3W7CA 2X1RA 3G18A 2I14A 1I2PA 4LY8A 3SJ3A 1OFBA 1DJQA 1FWSA 2V2DA 1KM6A 3C2OA 4EWND 3GB6A 3BGGA 3B0PA 3A24A 3TK7A 3TKFA 3UNDA 4RZ4A 3NQ8A 1JUBA 1L6WA 5BMXA 1UUOA 3LI1A 4O0ZA 4E0CA 2Q8ZA 2ZRZA 5DBTA 1QR7A 1ZNNA 3S5ZA 1WQ5A 2BX7A 4JTEA 4L4LA 3DU0A 4FXRA 1OX4A 4IWWA 4PODA 2YYUA 4B5NA 4JTLA 4JNMA 2RDWA 5FEXA 4Q33A 4PC8A 3BPWA 3RMJA 1L2UA 4MJZA 1XDMA 3W9ZA 1O60A 1MSSA 3TW6A 4QITA 3RF9A 2Z6IA 2QDHA 5CSSA 1YTKA 4OQVA 4IXXA 1RQBA 3A9IA 1VLWA 1KM0A 5F2GA 1QPOA 2WQPA 1R46A 5L9FA 2NUYA 2YCEA 1X8FA 3G1XA 5DCDA 1VZWA 1CW2A 1KM4A 2CWNA 2QAFA 3E0IA 4DQWA 3OA3A 5DCEA 2VFFA 4AWTA 4MZ1A 4TO8A 2Z6JA 3HPZA 3TSDA 4EIVA 1W3TA 2OMAA 3C52A 3P8JA 2RHGA 5IBXC 1KLYA 2DP3A 3LXBA 2X1SA 4O19A 2QF7A 3SGZA 2VEMA 3UXDA 1V5XA 3W72A 3OVPA 2Y61A 2ZA1A 4MY1A 5DCBA 3CB8A 3PUEA 2A6LA 4RZ6A 1X1OA 3HPXA 2C14A 4H3DA 2DZSA 3W6YA 4NJGA 4RCXA 1QCWA 5T26A 1MO0A 2PCQA 3SIZA 2PC4A 1P4CA 1TO3A 3IVSA 4M7TA 3LXCA 2BXVA 3LHYA 5I3HA 2QUVA 4O10A 4Z0SA 4LT9A 3UWVA 2ZBTA 4LS2A 1BWKA 5HWMA 4UTHA 3U6WA 3O06A 4I7WA 5I3KA 1NF7A 4MYXA 1AW1A 2FQIA 3E49A 3L5AA 4NXKA 1IXQA 4AWUA 1A5BA 1ZCOA 3BG9A 5F4WA 3HOJA 3QRHA 1WBJA 3M6YA 5A5WA 3W2MA 5BOOA 5KTLA 5AYZA 4JICA 3W3OA 1Z41A 3C2EA 4RV8A 5D33A 1JCNA 1A5SA 1I2QA 1JRBA 4NVTA 1FXQA 4IUOA 2CZEA 3NR0A 3PAJA 1H5YA 4N02A 6TIMA 4OT7A 1TJPA 1BTMA 3EKLA 2WNQA 3GXNA 1OJXA 3P60A 5G4WA 3B8DA 3K30A 5C2XA 4O57A 3TNOA 3UPBA 3S5YA 2YX0A 4O53A 3HQ1A 3W1QA 3EKZA 2ZYFA 3T7VA 3TSBA 1Z48A 4H6KA 1IF2A 2WSYA 3DGRA 3PB2A 3LHWA 1YPIA 2A4AA 3TMLA 3GYEA 1S5TA 4XQ6A 4TMBA 2J9XA 2WSQA 5K4ZA 2DJXA 1KA9F 3W1MA 1GPWA 5FF4A 3NPXA 5K7JA 1GTHA 4GC4A 3ZWTA 4HNUA 1THFD 1R2SA 1TQXA
chains in the Genus database with same CATH superfamily
4C6KA 4OVXA 2XIIA 5EBUA 1DQXA 5D8WA 1M1BA 1KR0A 4HNNA 4GFSA 2BNJA 4M19A 3N04A 3NO5A 3SN0A 3SY1A 3EWBX 3PBMA 4XUYA 3K2GA 1EYWA 4B3ZA 2E3ZA 2WWCA 3QMSA 4MYAA 3TONA 1XIJA 1TWDA 2O9OA 1YNQA 1X1NA 3K5XA 3WQDA 3TXZA 4H6RA 1WDQA 4GNVA 4PMOA 1WV2A 4FHAA 4KRTA 1Q6FA 1AD4A 2V82A 2FPVA 3WBEA 4GVFA 4UTJA 5H8UA 4XZNX 1J2WA 1A3WA 3RRAA 5IRPA 2UY3A 4JTGA 3H7RA 3V16A 2CHOA 5EKYA 2BBFA 3UXIA 1UOZA 5CZ0A 1FWRA 2R82A 4NAEA 5G5IA 1NWRA 4V1XA 3G1VA 3QY7A 3UNTA 4D8LA 1MRAA 3VFCA 5DN1A 3U0HA 1QW8A 3F4WA 4P2VA 2Q8LA 3T0AA 3SM0A 3W7QA 4P7NA 3FSTA 5JU6A 1XLGA 4LOCA 5AHNA 2ZUSA 3RMEA 1UOKA 4B90A 4HMNA 4H19A 4DIAA 4BF9A 3DAQA 2XU2A 3JU2A 2YR1A 2WNZA 2D1ZA 2J9ZA 3PHAA 2ZQ0A 2Z7KA 1Y5WA 4UFLA 5FJJA 3GBEA 2VX5A 1KXQA 3EXRA 5CC7A 3S2CA 4AD2A 3W1NA 3NZGA 1Z8AA 4M7SA 1FA2A 2FZBA 2PZNA 4HNVA 3VX1A 2ZZ2A 2AAAA 3JS3A 3NURA 3AO0A 3G0XA 4MFDA 1UC4A 3G1FA 2IQ0A 4G7FA 2BVTA 3W26A 3YPIA 2AL2A 3I7RA 1OCQA 3CL7A 3V18A 1AG1O 2WV8A 1K7FA 2OG9A 4CNSA 4QLKA 1O1HA 4G1KA 3KOXA 4IMEA 3TR2A 2I56A 3PK7A 1TE1A 1JPKA 2I1OA 1YX1A 5E0FA 1WOAA 2J9YA 3FVMA 1MQRA 1R47A 5DT7A 9XIAA 4O16A 3SGUA 4UTTC 4Y9NA 5JUVA 2D0FA 4GNJA 1LQAA 1VFLA 2EG7A 4GIEA 1BLIA 1IEXA 3F03K 2D24A 1OZQA 4M1BA 4QJ1A 2B7PA 7ODCA 2YB1A 4ROQA 1E15A 2PDNA 4L6HA 5CJMA 1YBQA 1OD0A 2X1UA 4UTKA 5TAOA 1P0KA 4C5ZA 4CGTA 2WBKA 5IOBA 2NUWA 2WMFA 2OT0A 1KXVA 2QCFA 3RU6A 3QY6A 2VDIA 3OG2A 2ZZ5A 4ADTA 3F2DA 1XLDA 4O50A 2WO5A 5EY5A 2FPTA 2FB3A 4JHOA 3T05A 3KDNA 3C8FA 3PTQA 1TUFA 3ARUA 3OPSA 3S5SA 3FA3A 3KX6A 3WF3A 2YLAA 2L5HA 1GZ1A 2AGTA 4KCUA 3PNZA 5C9RA 4DY1A 3B0XA 4FPSA 3BK0A 1DJWA 1VBGA 3PFRA 5D9MA 3CHVA 2Y7DA 3VOIA 3PPFA 7REQB 1R0MA 2O9RA 1BGAA 2F6KA 2DH2A 2HPMA 1HKKA 4S39A 4W7UA 4CEXC 1F07A 4PTNA 4W8LA 3IGXA 1XIEA 3G2GA 3CYJA 2QV5A 4O4VA 3U7BA 3CU2A 2BGSA 3HG2A 3TU9A 4GX9A 3ARSA 4OGZA 3WMSA 1G69A 3ARPA 4PTMA 3AHXA 4H00A 3QJAA 1OY0A 1F3TA 3CTTA 3OJGA 2WC7A 1XIGA 1U83A 1W3IA 4GPNA 1R9YA 2FTYA 3STFA 4Q8OA 3APYA 2OO0A 3VTRA 4QAIA 3N2MA 3T8QA 2OVLA 3NPWA 1VPYA 4ATLA 5AYIA 3BCFA 3MANA 2QGYA 4M6PA 2PDWA 2GGIA 3CS2A 4EXBA 1KD0A 1P43A 1GZJA 3DKLA 2VELA 1Q6QA 3DFQA 3DBPA 4JIHA 4PTWA 5I0DA 5LKYA 1M41A 1ADDA 3J7HA 3GNRA 1XYFA 3AYRA 2VO5A 2QDGA 4KERA 2D3LA 3WBYA 1HQTA 3R4IA 1GONA 1FHLA 3IRDA 3NIYA 4LAMA 4ERAA 2W91A 2ZDSA 4AD4A 3PF3A 4XZMX 3VNMA 2VEIA 4UQCA 4QE1A 1V0LA 4JKMA 4PUDA 4HPNA 4EX4A 1C8YA 4XSMA 6A3HA 1RVGA 2ABBA 4CQ8A 4I7VA 3EDJA 4DEFA 5K4XA 1KRMA 4H1ZA 3QFWA 1XRFA 2NT0A 3O0FA 4B4HA 1GCYA 1MVYA 4XAZA 3S1VA 1XSKA 3WBXA 3QPEA 1HN1A 1HP4A 3FXYA 4PUMA 1VIZA 3UA3A 2PUZA 1KTBA 4GCAA 2EAWA 4IUGA 3EWCA 1K3UA 4NAFA 5D30A 1KM5A 1AZ1A 1XLIA 1WKYA 1D7KA 4HT3A 3GU1A 3W22A 3LPGA 5HNUA 1CI1A 4XAYA 4PMZA 4GZEA 2EPLX 1T8XA 1NWUA 3ENLA 1NVMA 2WPBA 2VX4A 3S5NA 2ISWA 3TYDA 2PP3A 4CNPA 5C7VA 7ENLA 1TR9A 4BK9A 4Q4OA 1FX6A 3BTNA 1AH3A 1HJUA 2X1IA 3OEXA 4ICCX 1Q7QA 5AHEA 6ALDA 2VX6A 1JF6A 1QBBA 3HGJA 1JI2A 4P5UA 1EIBA 3BJSA 4F3HA 1UW9A 2VYOA 1RLCL 1DPMA 5A6MA 2GDQA 4XZLX 4Z2JA 2WW5A 4XBJA 3NQAA 1CBGA 2OZ0A 5FACA 2IKGA 5HINA 3W83A 6REQB 3SEPA 3TQPA 3HG5A 3QMRA 5CXPA 4IX2A 4WQ6A 2DUZA 2PA6A 2PDQA 4IPLA 4XVEA 3TAKA 2PDGA 1EB3A 4W8AA 3VKCA 3VGHA 4OBTA 3LU2A 2V67A 4LAUA 1E9YB 1U1JA 4H9YA 1KQZA 3E5BA 2QV4A 3M0LA 5A2CA 2G41A 2Y8VA 3P14A 4KCWA 1Q6RA 1E1CB 1UG6A 4YVXA 1Q8AA 5C2CA 1VCGA 4QAWA 2WCGA 2Z1KA 4MG4A 3VMOA 1EIXA 1DWJM 4GABA 2ZX5A 1A3XA 1YW1A 5FJUA 3WMCA 4FI4A 1TTQA 1TV5A 2C3ZA 5A94A 2VCAA 2W92A 3CLWA 4ZOAA 2QUMA 2XGZA 3R2GA 4J4KA 3W28A 3PBVA 4FLRA 5BU9A 4MJ2A 1HFBA 4MNKA 2QJIA 1RHCA 3N4FA 4YTUA 3RJXA 3WLQA 4HBKA 1B4EA 4ZQPA 4ZE5A 4LRSA 3G3MA 4DJEA 4EK7A 1VYSX 3TTQA 1A47A 1OGBA 1EJXC 3BUVA 5BXPA 3OLGA 3CZKA 1G94A 3NYDA 3NVDA 2H3BA 4RV3A 4W8BA 2BY1A 3E96A 1B57A 2R6OA 3N2CA 1MW2A 3FNDA 3TQVA 1RH9A 4PB4A 3OBAA 1EGMA 3VO0A 3WMLA 4JD4A 4S3CA 5CEWA 4N2YA 1YTEA 4HA1A 1ME8A 3HQPA 1L0PA 4G7EB 5IHSA 4FB7A 3RK8A 5XIMA 3WJXA 3LHVA 5JIPA 2ATSA 1BXNA 1XD1A 4N6EA 1LT7A 1N8IA 1Q4NX 4QTGA 1CNVA 3HPFA 5D8ZA 1MW3A 3EOEA 1DWAM 2GQAA 4DUOA 4AY1A 2X16A 2XSAA 4POCA 5JBDA 4AEFA 3VPLA 2PS2A 3LG3A 5HUPA 1EHNA 4K38A 4ROPA 2F9RA 4I8DA 3LRMA 3PG9A 2VGBA 3R12A 4RDVA 1H61A 1KFLA 3KWXA 3WDHA 4JTSA 1V0NA 2PDLA 1A5LC 2E67A 3UQNA 3P5ZA 3ZVHA 2HTMA 3ABSA 4ZFMA 3L68A 4YTSA 1DIEA 4W88A 2XDFA 3HFTA 3ITCA 3TYBA 1Z6KA 3W2LA 2XIJA 1WE5A 3VKAA 1DIDA 1H7XA 1XLEA 2A2IA 2PLJA 4A3QA 5LIWX 2D23A 1EO5A 2WLYA 5KSWA 4JFWA 4N4PA 3GFXA 2Y4SA 4M80A 1RPXA 1G7VA 1RCOB 3W1UA 2J6XA 3CWHA 4I9JA 4M0XA 2ZUVA 2A3HA 3GHUA 4WY0F 2E9BA 2E8ZA 2TYSA 3WX7A 1GZGA 5ECVA 3E2VA 4DBWA 3HG4A 1XLJA 4XD3A 1ICQA 5BOFA 1L2QA 2D73A 1BVZA 3HTWA 3M0XA 5H8PA 3A4JA 3PTDA 2FZNA 3AXHA 2YCLB 2BVWA 1LBMA 3WH7A 3KDOA 4Q6XA 4H2HA 1OCJA 3RO8A 4KF1A 3HO8A 1BSLA 1TG7A 1ISVA 1IEQA 1O6IA 1TSIA 2XIBA 3VZXA 4JIRA 2CU0A 3LRKA 4K68A 1NFPA 2XWEA 4IQEA 2VXNA 2NQZA 1YXCA 3P7YA 4DLFA 4XO7A 2BZNA 3AYTA 3F5KA 4Q8UA 1NF0A 4QSFA 4HKPA 2FTWA 1OCBA 4QQ3A 5F1UA 5CZTA 2G96A 3AAMA 4HNLA 4C6FA 2OSXA 4TX8A 2QCDA 4TX9A 3RPTA 5D4YA 5DFAA 4YTTA 4IF2A 1FP9A 2TPSA 1H11A 2AL1A 4YYFA 2DZWA 3BLPX 1I8JA 1QNSA 3EB2A 1H62A 2DZVA 3NQFA 2PWHA 4IIHA 4GA8A 3K4WA 4EPEC 1KM3A 3O6CA 3K4AA 1UMLA 1L6FA 1V3LA 3FDGA 1N7KA 4H41A 5D9PA 4XAGA 1ZSXA 1ZUAX 4BWLA 3CQJA 4YCPA 2Z00A 2F6UA 3A3HA 3B8IA 4D9PA 2I17A 1PAMA 1EEPA 1P1MA 3UJFA 3DOPA 3TJLA 1TTPA 2XVLA 1UQYA 3SW6A 2HVOA 4O1FA 1ZBWA 1NEYA 1ZJIA 1T0OA 2PWUA 1KO0A 3RX2A 3HPSA 1BPLB 3WQOA 3GK0A 4D71A 2R1NA 1UB3A 1REQA 4HU8A 1V6XA 4LX4A 1J93A 4PEEA 3B8WA 4AD5A 1PYFA 4AZHA 1EBGA 3QKEA 5CZKA 2A3CA 1HX0A 4EPBC 3L7RA 3MWAA 3I3DA 3FJ4A 4Y9AA 3UG8A 3W1RA 3USBA 2TRSA 4Q8MA 3NO3A 1PX3A 2DJLA 1F2JA 3NDOA 4DJFA 2G8ZA 1JYWA 2ZICA 3VOCA 1GOOA 4MZYA 4REQA 4ZCWA 1UR4A 1VFSA 4F79A 1XGDA 1QT1A 1QHZA 1CENA 2RDXA 1IXNA 3U4FA 2J88A 5HMFA 3BV4A 2BMBA 5DO8A 3FYOA 1DJNA 3LPFA 4GI9A 4DB7A 4DM2A 1V77A 5GJPA 3MCOA 2XN2A 3MI3A 3HMJG 1LP6A 2DFAA 4I5RA 3N4EA 1XLBA 1GVOA 4RXFA 3UJEA 1OD8A 2XGBA 2WBGA 1OT2A 2FVLA 5AYYA 1OWQA 4XISA 4FIQA 4GKTA 3K8LA 1GVIA 1ZGDA 4DWSB 3MYOA 1VIWA 3N12A 1Q13A 3MWCA 5LA0A 4MPQA 4IMAA 2I5QA 4GJIA 1E6NA 2PTXA 4Y90A 4E2OA 1ENUA 1YADA 3B0UX 2QJGA 4LH8A 5SWUA 1TPEA 1KWGA 2NXGA 2GK1A 2JIWA 4MWAA 4GKLA 1ELSA 2P10A 2HVMA 2J77A 2WYSA 3MP3A 3RAOA 4FO4A 4TVUA 2FH6A 4L4MA 3QXBA 3OQEA 4XG1A 2R1LA 2H8XA 1CLXA 1H4PA 1SO4A 2Y24A 1UASA 1YMYA 2ONEA 2ZRUA 4L9XA 4YLWA 3VDCA 2HVNA 4D8AA 1TPWA 2PBOA 3PR2A 3UT0A 2RFGA 1RAKA 2X2YA 4WOZA 4C6EA 3N14A 4DXVA 1IR2A 4NRRA 1PDZA 4BI7A 3T07A 1OM0A 3TJXA 4G9PA 4KS0A 4WSKA 1CCWB 4TR9A 2OFJA 3NL2A 6XIMA 1F4AA 2F6XA 1F8MA 1E55A 1UROA 2EJAA 2J13A 1DHPA 2XVGA 3SN1A 4QQUA 1K9DA 2EGZA 3D47A 4QCEA 1XD0A 3K8MA 4HPHA 5CQ1A 4IFKA 3AISA 4XIAA 3V0UA 1CXEA 2WQDA 3O16A 2XZ9A 3P8IA 5GJMA 4ZQRA 4HCDA 4ATDA 4GYJA 3GXTA 2Z26A 2P50A 2XVKA 4J3VA 3WCZA 5HATA 2NX1A 2HK1A 3USZA 3LLDA 4HJWA 2CBIA 2PDMA 1EJVC 3ANYA 4JTTA 4BEQA 5CG0A 3TFCA 4BEUA 3DFHA 1S39A 5CJNA 6TAAA 4HA0A 4NL1A 4YWSA 1MFVA 5MHBA 4LUSA 1QAPA 1OSEA 3BLIA 1OF8A 3B0YA 1TV7A 3IS4A 3EGJA 2W3ZA 5FA5A 1TE6A 2NVCA 3EX3A 5CZSA 4QXIA 2WKJA 3APGA 4GHRA 4UOQA 2W62A 1ME7A 1IWBA 3GR4A 3PJWA 4R9OA 3IIZA 4C7GA 2A5HA 1NP0A 3W0KA 2ZTJA 3U2CA 2CLOA 3UZ5A 2QCHA 2CNCA 4ECLA 3NEHA 2H6RA 4W85A 1R87A 1XL9A 3IV8A 4US5A 2WSKA 3BG3A 2G95A 1YPXA 1JYXA 4X60A 5JH1A 2F38A 3IJ6A 9XIMA 4JTUA 3BJTA 4DX3A 1ESWA 3K1GA 5CKSA 4NG3A 2E1WA 1H60A 2XINA 3UZJA 4NJIA 1Q3NA 3ZJ6A 1EWEA 1W2PA 1WZMA 3N34A 1K8ZA 5KITA 5BOEA 1SSGA 3MW7A 4DXKA 3LQGA 1OX5A 4UWMA 2A7RA 4AUBA 1ZU8A 3CGTA 4O15A 1B3XA 4CU6A 3W24A 1B3VA 1UQZA 1KBJA 1RLDA 1J79A 3B0VC 2J8GA 3D0CA 1KTCA 3AU2A 4HQVA 1X7FA 4UBPC 1HF6A 1A80A 3BH4A 4CNNA 2ZC1A 3CPUA 3OIXA 4HMDA 4DJDD 4MVAA 3CUHA 1AVAA 3TSMA 3B9NA 2BFGA 2PDXA 5IHRA 2NXIA 3L0NA 2YXGA 4M6UA 2JQXA 3EXTA 1PKMA 5D2XA 5F7UA 2E9LA 3T4CA 2ZX8A 4ZL1A 1GOMA 2O9PA 5FEZA 3NXLA 4WHBA 1GOWA 2HBXA 1I45A 4UB9A 4J5NA 1GG1A 3KW3A 4Q6JA 5C9ZA 3DFYA 4A21A 3GNDA 4Q4QA 1IHIA 3QW3A 2CZ5A 5FEPA 1GOKA 3LTSA 4R9XA 2H9AB 4GZ7A 5C7HA 4UUIA 1S1RA 2OWXA 5C9WA 1HZYA 2C13A 3TYZA 1R85A 1YDOA 3W7JA 4PTDA 4JQ4A 4NT0A 3FIGA 1MEHA 3BVJA 3GG7A 5AC6A 1XYMA 4LUIA 3FN9A 2YXOA 2ZVRA 5AHIA 3WNLA 2C8NA 1LQ0A 4IFRA 4KQNA 4WDWA 3ZLFA 2CKSA 2CPUA 3B4YA 1XKYA 3EEGA 4NU7A 2HE5A 4D6FA 4GXWA 2NVAA 1R9ZA 5CBIA 3LV6A 3P0XA 4MB3A 4W87A 4F40A 2OX1A 2ZVIA 4RW3A 3SCOA 5HQLA 2ZC8A 4AZCB 3M1ZA 4HHMA 4JTHA 3FS2A 1FDZA 1C8XA 4PRWA 1IGWA 1H7WA 1JDEA 5AC8A 5CC5A 3LTPA 1XLAA 3S2JA 3QV6A 4TUFA 3WQGA 3BMXA 5CPLA 2QW5A 3UW6A 1W5PA 3JRKA 3HF3A 3NWRA 3DEQA 4I9AA 4DF0A 1VS1A 2YDRA 1M7JA 1XLCA 1P0NA 1X7IA 1E9LA 1VR6A 3W00A 2E4TA 2GOKA 2CLLA 3UYCA 3UZZA 4V28A 5D9NA 1E72M 1MUCA 5LNVA 3ECQA 3P74A 4Z0JA 5F2MA 2JIEA 4Y96A 2FB2A 1FCQA 3PPGA 2A3BA 4Q7NA 3SQMA 5HK4A 2D20A 4H9ZA 1E0WA 2XH4A 3QMTA 1ISYA 4ZO7A 5I09A 3AMGA 3H6OA 1DJZA 3TYCA 4A8LA 4O1EA 3GFZA 3K46A 3ZO9A 1UH4A 3BAWA 4WD0A 3LCLA 4G56A 1MUMA 3UCCA 1QPQA 4GFIA 2DIJA 5LNUA 4E3VA 1CIUA 3W1LA 4IJBA 1UD4A 1H3GA 1DORA 2NQHA 2ZXAA 5HWJA 3W37A 4XSLA 3B04A 1IWAA 1XICA 4L9YA 2RKXA 3GVRA 4UNLA 4MADA 3C5QA 4JTDA 3CHCA 3W7IA 1POJA 3H2EA 3EBVA 2DZAA 3AXKA 3N3TA 3VFLA 3QGAC 2Y5EA 1LG1A 3ZZ1A 3AYVA 3O15A 2W5FA 4PTXA 1H7PA 3WH9A 4S3FA 4UTWC 2GSJA 1UWSA 4O28A 2VFIA 3MCNA 1A5OC 5TQLA 1ZP3A 4GZIA 4R7WA 3TV8A 2D2OA 1V6YA 4X9SA 2WVSA 4OUIA 1FH9A 2CETA 4H2CA 4Y2WA 2W61A 3VUPA 3TUUA 2X1RA 2PCEA 4KWUA 3G18A 4ZSTA 3RILA 3AS3A 4ZENA 1DJQA 1MNSA 3ZMRA 1FWSA 2DY3A 4GOAA 1TZ7A 5CH9A 4GIYA 4F0SA 5GNXA 4XD6A 4O0ZA 2OB3A 3VIOA 4PMVA 5DBTA 1FHDA 3S5ZA 4JTEA 4L4LA 3AIBA 4IWWA 5AC4A 4Q8VA 4Q33A 3OZYA 1RY8A 4MDPA 1U33A 1IQ8A 4JFSA 4PMNA 3BMVA 5TF0A 1NOFA 2OOFA 2Z6IA 4V27A 5CSSA 1NJJA 4LALA 3CB3A 4IXXA 1RQBA 4U10A 4Y9PA 4KEZA 3AMLA 3NZQA 2YCEA 4OBSA 1IZJA 5EMJA 1CW2A 4F8XA 2CWNA 1T7LA 3NOYA 4MZ1A 4EIVA 1W3TA 4HA4A 2VRQA 1KLYA 2BY0A 2YA0A 2VEMA 4WKAA 4A6GA 1V5XA 3I6EA 3UVAA 2RJGA 2QDDA 3UR5A 3OVPA 1WZLA 3CB8A 2A6LA 2WZTA 5A6TC 2C14A 4H3DA 1T6MA 2DZSA 3W6YA 5T26A 1CTNA 2PCQA 3SRFA 3SIZA 4HOXA 1QOXA 1P4CA 1TO3A 3IVSA 3LXCA 3UJ2A 3GYCA 2UY5A 2XFRA 3LHYA 1RP9A 5A95A 2IKJA 4UTHA 3O06A 2V5DA 4NHVA 1NF7A 1EGVA 1IE7C 3L5AA 1XRVA 5DMYA 3BG9A 4GQRA 1I1XA 3XINA 1HGYA 5KTLA 3ME3A 5AVHA 3C2EA 4RV8A 3I4EA 1XRTA 3SCRA 1JCNA 1JRBA 2VQTA 2YL8A 3S47A 4GIAA 4PE8A 1H5YA 3MUIA 4M81A 4WKHA 4C6CA 1V93A 3CUFA 3GS6A 4DVOA 2WNQA 1UP3A 1SR0A 3CZJA 1EDTA 3B8DA 5C2XA 3TNOA 3EMZA 1XW8A 2XGIA 5FL0A 4O53A 4L5ZA 3W02A 3CMGA 3TSBA 1Z48A 4H6KA 4ZB2A 3PB2A 3IWPA 5I00A 2VX7A 3ZXWA 1S5TA 4XQ6A 2J9XA 4PBEA 3VMNA 2WSQA 4AZ5A 4J3ZA 4MHBA 3KBMA 3SUVA 1TQXA 1G1YA 2DZBA 3NQGA 2VKZG 1O66A 3LOTA 3MI6A 5E6YA 4HVXA 4Z1YA 2OZTA 4Z1AA 1L6YA 3ABOA 1VC4A 5HJYA 2BXZA 3HJZA 4MJ4A 2B7OA 3TE9A 1CZ1A 4QHRA 1BRLB 1VFHA 4JHZA 1UP2A 2P88A 3H7UA 3WH6A 2GYIA 2OX4A 4DYJA 1NFGA 1RJRA 1JZ3A 3CIXA 2PBGA 1V03A 3B9EA 3BARA 3E0VA 5E70A 3TW9A 4UTMA 4E4PA 1W3JA 2FZMA 5I07A 3UA4A 2OR2A 3KEHA 2OYMA 4U4MA 1IWPA 3RU8X 1IEVA 3NTYA 3STEA 3H54A 3SQSA 1JYNA 2YSWA 1NDVA 3N18A 1H1ZA 1XI3A 1R5YA 1ALDA 3CLMA 4XBSA 1E6RA 3WN6A 5HMDA 4IJCA 1Q6EA 4O17A 3DESA 4IMFA 2DSZA 1PHWA 2E6YA 4UXDA 5BZAA 3GW3A 1AFSA 1Q6CA 4JYFA 1E6PA 4CKQA 4X0VA 1W3KA 1YIXA 2EO7A 1NAL1 5A3HA 5JVLA 5AZ1A 3QC0A 3OHMB 5D32A 3TYAA 1VYRA 2UY2A 3AXMA 3O2LA 3M5YA 3DH7A 1QU4A 4ALDA 4UMBA 3IANA 3E0LA 3PP7A 4LQ1A 3VYLA 2LLEA 1W3NA 3N1AA 5HNRA 4NASA 5G2HA 4C6NA 1UIPA 5LGXA 3GVGA 1AK5A 4KT2A 1RA0A 4KWSA 4HIBA 3P6LA 3HU7A 1NP2A 3REQB 2C7FA 1RY0A 2G4FA 4U3CA 2ZZ4A 2GVYA 1AMYA 1XH1A 2G50A 1GWJA 1RZMA 4ZQNA 3GNXA 3MMTA 1EZWA 3A4XA 1XISA 3S9ZA 3VGDA 1X38A 3KVJA 2AQOA 4ML9A 4HHPA 4XTDA 4MFEA 1D7FA 2OT1A 3SCTA 3M7WA 5J5DA 4GUJA 3LERA 1R3YA 2GJRA 3NDYA 5CPQA 1RBOB 1GOIA 3ZR6A 1IEWA 4IMCA 2POTA 5EL1A 2A7NA 1EXBA 2Z29A 1WA3A 4Q8TA 4RL3A 1HJXA 1H50A 3W85A 1MWOA 2DSVA 4NZ5A 2VC9A 4MTVA 3W7PA 5ABFB 3U8GA 3W29A 2XZ7A 3NXFA 1JNDA 5E93A 4IG2B 2Y1HA 4Z1BA 3MYPA 4IOTA 1VYPX 1AD1A 4LC8A 1ZPTA 2RGLA 3S9IA 5H8MA 3VABA 2VC6A 4NXSA 2WM0A 1HVXA 4HPGA 5CAKA 3KLLA 2PWVA 1KFJA 4HHLA 4G8TA 4L7ZA 3QHMA 1OGSA 4HYVA 4QE5A 4Z2HA 3T09A 1ZS2A 5EFFA 1B5TA 3KUMA 4OOZA 3L5MA 1K8CA 1RA5A 1G4EA 1KBKA 2YFNA 3M07A 1C3FA 3W7EA 3W7NA 1VLIA 5I79A 1J4EA 3LDVA 2PSNA 1HXJA 4IX0A 2WZHA 4JTFA 2YB4A 2F2HA 2BOEX 3TOYA 3QZAA 3WJSA 4BF5A 1E6SM 4CCZA 4FK9A 4UFMA 2X8RA 3IIOA 4MZ8A 4YWIA 1YPFA 3R5EA 4JY9A 3RYSA 1S5VA 4QDPA 2ASHA 2WMGA 2ISFA 4H7CA 2B4GA 4CQAA 3B06A 4J27A 4H9MA 3UR2A 1XDLA 2V30A 2YBTA 3MO7A 5E0CA 4QS6A 5DLCA 3M5VA 5TBOA 4IXHA 4FNUA 3CT7A 3N2BA 1XCXA 3Q67A 1QNQA 3TWAA 4A2RA 2ZUUA 1OX6A 4H8NA 3MDWA 1ITXA 3PZUA 2ZRXA 3MA8A 3JZUA 1WDPA 1RBLA 3D6NA 1O94A 3PUGA 3PAOA 2B0MA 1NQKA 4US6A 1PSCA 4NYUA 2QJMA 3SAZA 3IJIA 1TUXA 5K9DA 3KTXA 1OC5A 1E73M 3TTSA 4A8RA 4B16A 2AL2B 3TN4A 3A22A 4WZHA 1KFKA 2EPNA 2VZTA 1W5QA 4S3EA 1GQNA 4R27A 2VT0A 1L6SA 2WMIA 2C6QA 1TVPA 4RE3A 1NQ6A 1FDJA 4FIRA 2WMKA 2BLEA 3W75A 2YCJA 3VIMA 1XGEA 3HURA 2NLYA 3VGBA 4PBFA 2OLHA 5M3WA 4Z08A 3LD5A 3GR8A 3E2SA 4PTVA 3EWZA 3WEMA 1RPKA 2VCCA 1EP3A 4TX6A 1F7BA 2J8TA 4RXGA 2F8QA 2E25A 3EZ4A 4J28A 1KXHA 2OKTA 3LM7A 1T96A 3NQMA 5F2LA 2VWSA 4JGDA 5K9CA 3VOHA 1DJXA 4LBRA 3S8HA 3W7DA 3WH5A 2GVJA 1QK0A 2Z1XA 3A5VA 3CUXA 4PCFA 2QAPA 4HCHA 2CBVA 1P0BA 4P7OA 3QKZA 1O5KA 3LENA 3WDRA 3ZJ8A 1TR1A 3OLDA 1NWTA 2HISA 3G0SA 3DI1A 2OSWA 3L0KA 1BFNA 1UC5A 3GDBA 3NUKA 4P8WA 4CN6A 3WDPP 3BL3A 3M0MA 3N4AA 4FNRA 4BQ2A 3OG3A 4PULA 4UOZA 2O55A 3CQIA 4V33A 4DLMA 1H1YA 1F73A 4X63A 2ZRWA 3OOQA 1ZB5A 2XFYA 4M8UA 1E51A 5G2WA 3PWAA 2P53A 4O12A 3VVGA 5FSDC 4RE2A 1DXIA 4X22A 1S1PA 3FJLA 1EC9A 1N8WA 1SZEA 1VFTA 4O4WA 1ICSA 1IXOA 4HYRA 3M5XA 5LHFA 4DO4A 2WMJA 4IMDA 4NY2A 1FWAC 1LL4A 4IICA 2CLEA 3L12A 3KLKA 3W86A 3A23A 1BQCA 3THCA 4WDXA 5HA7A 1IIGA 2DORA 2DV0A 4TXEA 1DOSA 1AODA 1NWSA 4JTIA 5H6HA 2PDKA 3MVTA 4FR6A 4IMGA 3WBAA 3DFOA 1V6TA 2HROA 4NI8A 1XR2A 4YYCA 3GH4A 3M5ZA 1QI3A 4J35A 4I5XA 3C0JA 2X09A 4IPIA 3CV7A 3ABZA 4JQAA 1O5RA 3UESA 4A3RA 3R13A 3BLOA 3PWIA 2W4XA 1UZHA 2PDPA 4JXCA 1PPIA 1QPNA 4WIWA 1UZ4A 1XBZA 4J1OA 2XM1A 5CZJA 4I5UA 4Q8WA 1QDSA 3D46A 4JQ2A 1YEYA 2WNNA 3HJEA 3W70A 3TTOA 1DE6A 2GJLA 1VPQA 1GQIA 1VBJA 1LQ2A 1TFVA 2QVHA 3S4TA 3AQUA 4K6AA 3LX9A 3SB0A 5EFDA 4D6GA 3ZS4A 5CPOA 4EWJA 2DSUA 1ZQ5A 1OK6A 3WLLA 4AG0A 2Z2AA 2NQ9A 3PBYA 4HPXA 3RUBL 3LPPA 3M41A 1HO4A 5FI8A 2VP8A 3KOFA 4FOKA 1QBAA 3OP2A 5H2ZA 3PZIA 1C90A 1HJVA 1MW1A 3GC5A 3TJIA 4HZ7A 3KBJA 1SFLA 3VIFA 3FYPA 4LPCA 4GX8A 4C1KA 3EA3A 1K8XA 4JKKA 1ZAHA 4WDUA 2Y8KA 2PLCA 1LUCA 5C55A 1H7OA 1TKKA 4NAFB 2C1HA 3ARWA 3CEUA 1PKNA 3GC2A 3RJYA 4XD5A 4WDTA 3M44A 2O92A 3M16A 2PRLA 3UWZA 4FF5A 3HGSA 1XCWA 4L1XA 3W38A 3H2OA 4KIRA 2Z7GA 4ZBCA 3WDQA 2O56A 3UXLA 3W7KA 1K77A 3G8RA 1QRQA 1W9DM 4GYPA 4XBKA 1QXLA 3AHVA 2P76A 4R85A 4RZ5A 5A2AA 2J75A 4KFOA 4ZZ9A 1D3GA 4JTRA 2ATMA 3DERA 4EVZA 2X40A 3T40A 3CO4A 3B8UA 4XZIA 2NV9A 3ICJA 4F0LA 4N7QA 1ZRQA 1OEPA 1TWWA 3NYZA 3CQKA 1V3KA 2J7EA 2ZADA 4WXZA 1W56A 3TA6A 4YXGA 3V4BA 1VHCA 1W5OA 3HB9A 4LBSA 4X2RA 5LGZA 2CLFA 2PDCA 4WKFA 1GVFA 2CHRA 2PF8A 1UZ1A 1UKTA 4ZSUA 1GKPA 1XINA 3PB0A 2DUAA 4E3TA 3GX9A 2A3EA 4FZIA 4Q8QA 5G1TA 1WCGA 2GGJA 4QJ5B 3S83A 5CPSA 1X96A 3DZ1A 1HKJA 4A22A 2NW0A 2PGEA 4IFOA 4CNUA 1ZBKA 3UWQA 1DL3A 2CZDA 1RQHA 1FDYA 3TROA 2CBUA 4U31A 5M1TA 4Z17A 3KRSA 4HK5A 3WUFA 2ZRYA 3TZNA 1M5WA 4RW5A 1RALA 2V2HA 3KVLA 2EEXA 5REQA 4L56A 1PTGA 1QUMA 5LIYX 4TTGA 3ZR4A 3S0CA 3VZZA 3QGVA 2PD5A 3IJDA 5DMNA 1V0MA 5CBBA 3GDRA 4QCFA 1UD5A 1MUWA 3S6TA 3OIHA 2FMOA 1FCBA 3IJ7A 1YYAA 4Q7IA 4DZAA 3L4UA 3HIJA 4OE7A 1TCMA 1TRDA 1A5MC 1PXGA 3QEZA 5DY2A 1SW0A 2OQYA 2TSYA 4N9CA 1UKSA 1ZALA 4D6EA 2V68A 3W2JA 4J3UA 3WLHA 3MY9A 2XVPA 4JBRA 4M24A 4GVHA 1W0MA 2GJXB 2V3GA 2XHYA 3LNMA 4HPJA 1CECA 3CIVA 3KVMA 4TTUA 3ITGA 3L4WA 1FOBA 1VBHA 1XFBA 4ZO6A 3AFBA 2VOTA 4K37A 3MUZ1 3BSMA 4C6DA 4MKNA 1GKRA 2VEPA 3A4AA 2OXNA 2PDFA 1QJWA 2O4QA 4MB4A 4DO5A 4GUFA 3LHZA 2JKPA 4AWSA 3V5FA 1MQPA 2OQLA 5C70A 4IGNA 4S3JA 1RV8A 3AMCA 4IH3A 3PUOA 4KH2A 4UZSA 3DHFA 5ENLA 4FA3A 3WFZA 3T2PA 4PCNA 1Y5VA 2DZTA 3HA1A 4O1BA 3ZJ7A 1ME9A 3UWWA 4AISA 3R11A 1FH8A 4NNAA 3A21A 4PUWA 4DNHA 3WK2A 1QI4A 3IK4A 4XZBA 4ZXOA 2JALA 2DIEA 4AU0A 1A53A 3F5LA 3STPA 1BG9A 3V1HA 4FLQA 3EWYA 3TAOA 3PZNA 1VCFA 5FIPA 2YZRA 1X98A 5DANA 4UTFA 3TA9A 3ZVHB 1DHKA 2G3MA 2FHCA 3AZRA 2CW6A 2QIIA 1G9HA 4N0RA 1F05A 2ZFAA 3ZIZA 4MGGA 3BURA 2PP1A 2X2GA 2G3FA 3N73A 2UBPC 5LNRA 3LSBA 2YPIA 5MF5A 4LANA 5A6KA 2E77A 1S2UA 4NKCA 3K8KA 1K9TA 2QUUA 4DWSC 1UR8A 4C91A 2XH7A 3TVAA 3N6QA 4Y8EA 4DF1A 3NCOA 4KW2A 2JEQA 1XXXA 3KOYA 5DQPA 1JCXA 2JE8A 3ZQ9A 3G77A 2D2GA 3H7VA 1V0KA 3TYUA 1E0VA 1XP3A 3DYOA 2UZ9A 3BSHA 4N9DA 3TN6A 2J79A 2XWDA 4JOMA 1LLOA 1X97A 3OYXA 1LBLA 1JAKA 5E9AA 2ZZ3A 4GK8A 3TP4A 3I6RA 4QSHA 1SVDA 2RGMA 4O0QA 3PZMA 4YCOA 5IDZA 5A6BD 3CUIA 4B3KA 4I7UA 4RPPA 4ACYA 3LEPA 2INFA 1WB0A 3GUWA 2W67A 1V7YA 2VZOA 4FR1A 2QCDB 3AOFA 4NX5A 5JXQA 5LIXX 1LM1A 4GE8A 5I77A 1OFPA 4HNTA 3R7MA 4KEUA 2TAAA 2Z1BA 4LAKA 3HPAA 1MZRA 2R1PA 5I06A 3BJFA 1K03A 1BXCA 4NIRA 3WLIA 2ZX9A 3N3MA 3A12A 3EEZA 1JQVA 1MEWA 5I5RA 3SRDA 2G3IA 5DX7A 1EOMA 4DBEA 5A6AA 3INPA 3URBA 4LS0A 2PDIA 4MUZA 4F0KA 3QFEA 2VEFA 3TN5A 1GQLA 2FGZA 3SFKA 4ZTXA 2WK2A 3OO2A 2INZA 4S2CA 5T9BG 5LZLA 3H2FA 2YCLA 1AH0A 3PTMA 3NQVA 2GJNA 2VEKA 3WY1A 4KBXA 1EJRC 1FWNA 4F0RA 2GGGA 1VAHA 4LWWA 4FP1A 3FGCB 4P8VA 1AJ0A 4MY9A 3G5EA 4PMJA 3WL1A 3R79A 3WK0A 2FDMA 2IPWA 4CD8A 4JL1A 2QYGA 1TJRA 5HOSA 2Y7GA 3RXZA 4REQB 3G3DA 5BRQA 4D6IA 5BRPA 1PCKA 1CXLA 3R0UA 1X8CA 2DSWA 5IXEA 1JULA 3QQ0A 2E6DA 1IZKA 1GW9A 4B2DD 2Y89A 3LGDA 1PHQA 1Z44A 5JBFA 1UJPA 3GXMA 3KRUA 1POKA 3WLMA 4TMCA 2QHAA 1PO9A 3MZNA 4XB3A 3HQOA 5DBUA 7TIMA 1Q6OA 2A21A 1ICPA 1JFXA 1CGWA 1PVNA 2XFWA 3RHGA 1TMHA 2X7WA 3A5FA 3PSWA 4YL2A 5LXEA 3KAOA 1HL2A 3UZXA 1OZMA 3W53A 1O5QA 4G2DA 3PVFA 3BOXA 3RLVA 3EPOA 3SGGA 3T0CA 1V8EA 4UFHA 2DZPA 3B3DA 3GKFA 1EO7A 1JPDX 3ONBA 3RLHA 2W27A 2GK1B 2ABAA 3VM5A 3DECA 3E38A 4G1NA 1K4GA 1ONEA 1OFAA 1O4UA 3PPCA 3VIKA 4HU0A 2CFFA 2VNCA 4V1YA 1H41A 3CK5A 4KWWA 4NRSA 1J0IA 1KTNA 1JRCA 1JCYA 1ZAJA 2ZUNA 3U2ZA 4JDYA 3WQ6A 2FFIA 1UPMB 1FFQA 1UUMA 2E68A 3XIMA 5B7ZA 3QSTA 4PUKA 1R9XA 3EB4A 4D6CA 2HS6A 3H70A 2R91A 1ISWA 4LFYA 3PS7A 2J7HA 1J0YA 1M68A 3OA5A 2I9UA 2ISSA 3GZAA 2VC5A 4PMRA 3TQKA 1HJSA 3P81A 1TQJA 4KRUA 3HGOA 1LOQA 3PFMA 3TW7A 1W3HA 3LBOA 3H55A 2NV1A 3I7SA 1QO5A 3CTLA 5BXRA 5CLWA 1AQHA 3TTEA 1J2BA 3KCLA 4IFKB 2WZIA 4ZA0A 4MKVA 4O11A 3MP5A 3OLEA 4HYWA 1ONRA 3LS9A 5M03A 1C93A 1PIGA 2DVXA 3AHYA 1GVYA 1TCDA 4GBUA 1WBHA 3GY1A 4JN7A 5FF3A 3WLSA 3B9DA 5FD0A 3MBFA 5EMLA 3DGBA 4C60A 5AOUA 1EF2A 3GUGA 2PB1A 2J78A 4E5TA 4JZ5A 4WXYA 2WHLA 1MXSA 1WAWA 4W84A 2FZ9A 3VNKA 4IP4A 1VFFA 4CCEA 1PL9A 5CGQA 3IJQA 1VD6A 1GPFA 2EJ1A 3WLRA 1I2NA 3O63A 3AHTA 4LUSB 4NNCA 4MLJA 4TV6A 1FTXA 1RK6A 3LM3A 3GTFA 4MF4A 3ZT5A 1A3HA 4H04A 5D2VA 3GO2A 5DELA 3UERA 8TIMA 1V79A 3RDKA 2MANA 3CQ0A 4UQBA 4UTLA 1Z7AA 4XK2A 1NY1A 2VRJA 4WUIA 1HKIA 2XSBA 3RX3A 1J01A 2XN1A 3HV9A 2I9EA 4DO6A 3P3BA 4TIMA 3LN3A 2Z2UA 3TC3A 5D03A 3OLIA 4F2UA 3WJZA 5K3VA 1OGGA 2EKGA 4W89A 1RBAA 2G4JA 3O6AA 2HRWA 4GJ1A 1DJYA 2PRHA 1GJUA 2OJPA 4AHPA 3H4GA 2FYMA 1DTUA 1PB0A 3PULA 1KFEA 1H09A 1GVRA 5IBXA 2J47A 3SR7A 2NSXA 3NM1A 1FCVA 5JH2A 2O7QA 3S2NA 4PUUA 3RO6A 4ZO9A 1G6CA 4WVXA 4ILSA 1EJ7L 4E4FA 4OUEA 4UR9A 7CGTA 1DYSA 5CSRA 2JKAA 3QTPA 5DY3A 2JBMA 4DYKA 3RG6A 1SSDA 4FX8A 3M0ZA 1OABA 2DIKA 3CV6A 3DYMA 9CGTA 3A3WA 3KTSA 2WHJA 3U48A 3WELA 1DWGM 2E09A 1U5VA 1JL8A 2JFEX 5E09A 2QGHA 1E70M 4GYPC 3LCHA 4DZ5A 3L2MA 2W63A 1ZZMA 1KFWA 5BRBA 4RE4A 4Q4RA 2PAJA 2PZ0A 5D2YA 1EJUC 4NI3A 2VFEA 1SZNA 4LVBA 4A2SA 1YQ2A 5KZMA 3EX4A 3N9RA 2NVDA 2PDYA 2HPIA 1ZFJA 3LMYA 5CG7A 4OIFA 1XBXA 1V6VA 2J7GA 1J6OA 3H2CA 1IYXA 4BF7A 3FEMA 1F74A 4R33A 3H4WA 4EANA 2GWGA 1KRAC 1VEOA 2PGFA 4RJEA 2V81A 4X0NA 1OFDA 1UWAA 1W54A 3KM8A 3WD1A 2Y63A 4JX4A 1G0CA 1PYMA 3WNOA 1J0KA 3E9AA 3WENA 3KZSA 4UQ9A 3RFAA 3NNTA 4YIWA 4H6EA 1L8NA 2AMGA 3WD4A 1CGTA 1SFSA 1PE1A 2VHLA 1FWGC 3F4VA 2E6FA 3P61A 4WGHA 2QNEA 1OCNA 1XBYA 2FPYA 3H2MA 2GZXA 3CUZA 4GYFA 2I14A 1MYRA 1JGMA 1KM6A 4K1GA 3BGGA 4QLJA 4KCVA 4RZ4A 3R25A 1JUBA 1V3IA 3DC8A 3PZTA 5BMXA 1BYBA 4PFHA 2Q8ZA 2ZRZA 4IPNB 4JQ1A 1QR7A 2BX7A 3BQ5A 4IP5A 4FXRA 1U22A 4WRHA 1H1NA 4C6IA 1OX4A 4FOUA 4HJFA 2YYUA 3GD6A 4B5NA 3CXOA 4JTLA 2YL6A 5FEXA 1PTAA 1A49A 1XDMA 3AIUA 1XPYA 4HP5A 3GHRA 3RF9A 1E4MM 4NZ4A 2QDHA 4EXAA 1XGZA 2IUZA 5B80A 2ISDA 5F2GA 4PMUA 3SUWA 5L9FA 4GXPA 2NUYA 3HM7A 1VZWA 1KM4A 2IKIA 1PIFA 4HK7A 1BKHA 2VFFA 4AWTA 2OTDA 2Z6JA 1UD6A 3KL3A 3TSDA 4UQAA 2RHGA 2WB5A 2X1SA 4J3WA 3KZPA 3NQBA 3W72A 5A6LA 3TOPA 3C3UA 2Y61A 1CB7B 1P0DA 1US3A 3AXXA 1S2AA 5I6SA 1MRQA 3UEQA 4INFA 2O4MA 1VFUA 1UR3M 1CLVA 4AD0A 4RCXA 1QCWA 4U5IA 5E9XA 5AZ0A 1GGOA 2BXVA 1L6GA 4NILA 4O10A 4Z0SA 4LT9A 2ZBTA 4LS2A 5J04A 4L6OA 4MYXA 1NDYA 1AW1A 3E49A 4NXKA 3FCPA 2IS7A 2V69A 5KETA 1ZCOA 5JMUA 3R43A 3ZR5A 3LLXA 4LJ3A 1KGUA 3W2MA 2IXVA 3MSDA 5BOOA 3W3OA 1W32A 1Z41A 3L23A 3OYZA 1R86A 1I2QA 3BV7A 5C0QA 2HE8A 1FXQA 1VKFA 3EOSA 6TIMA 4A35A 4PUEA 1AJZA 1HKMA 3WLKX 1QPKA 5G4WA 4DZHA 2PWFA 4WR3A 1PTDA 4GCXA 3FJNA 3HQ1A 1E4NA 4GACA 2QS8A 3W1QA 2ZYFA 1JZ6A 1TJ2A 1ODZA 3TMLA 5LXXA 3GYEA 2I57A 4Z42C 1JYVA 5K4ZA 3BANA 2DJXA 1TV3A 2GUBA 3E6EA 5K7JA 2Z1WA 3ZWTA 1KKOA 1AQMA 3PC0A 4EXQA 2JGYA 4IIGA 3GVQA 2Q71A 4W7WA 3S46A 3T6CA 4DBSA 3DENA 1A4MA 5FEWA 4JTCA 1JUEA 3W1PA 3NSNA 5BMWA 2WC4A 1U30A 2OODA 3DCPA 2YCKX 4PUNA 4O1CA 1FQ0A 3VA8A 1WKDA 4C90A 4FX7A 1FKXA 2JK2A 3M9YA 1KKRA 3H4XA 4D1IA 3WJWA 1S2WA 1XYLA 2NT1A 3BICA 3NM3A 2BASA 1CWYA 4L61A 2ADAA 1X6NA 1FWDC 4DWSD 1QOQA 1KV8A 3DFSA 3SZ8A 1EWDA 4L6DA 4KFNA 2WVTA 3H8AA 1KCXA 1P7TA 4OV9A 2OYKA 1LJYA 1Q8JA 1I60A 2QZRA 3N9KA 3KHJA 4NX0A 4XZ9A 1KFCA 2QQ6A 1MMFA 1MI3A 3AMKA 2WOQA 1TIWA 4ENLA 1XLMA 1LWJA 3QY8A 4GINA 5LNSA 2F7FA 3BSGA 4BHYA 2GPTA 3MZ2A 1KBBA 5I3JA 3WEOA 4P8UA 3GKAA 3OQ8A 3GQYA 3TN3A 3B03A 2YYTA 3MV01 3URAA 3EAUA 2IPJA 4LVDA 5FJTA 1UH3A 4M5PA 4P7LA 2E5DA 1J9YA 2VDHA 2REQA 4QLLA 3PANA 4C6OA 1IT0A 1JJKA 5FSEC 2YA2A 3CAWA 1Z69A 2PD9A 1C9DA 5JBEA 3KXQA 4HCLA 4HK6A 3SRKA 2ZZ6A 4KWVA 1V51A 4AX6A 5CC3A 2X7VA 3CNYA 4B5XA 2VR4A 2J62A 3BXWA 3CM4A 1LOSA 3KL5A 1VQTA 1XLHA 1KM1A 4GG9A 3IEBA 4HGXA 4DJDA 3QN3A 3CC1A 4LUTB 3RM8A 2YDQA 2PFHA 4P7RA 5HXMA 2Z1SA 4QJ4B 3M64A 4CLMA 4ASTA 1ZY9A 2HSAA 4IPJA 1XM3A 3LI0A 5A1AA 3C2FA 2AQWA 4D2JA 4FNPA 4X9YA 2HNEA 3CZ8A 5HR7A 3N29A 3ARTA 3NL6A 1KWKA 1NOUA 1QNOA 3EPMA 3HGRA 3ARVA 5AHFA 2RUSA 3W4RA 3S5OA 1B3WA 1QPRA 1R3QA 3S1UA 3C4UA 5CGMA 3FAWA 9RUBA 3VNLA 2E1DA 4QR6A 1I1WA 2CCRA 4FALA 3II1A 2BHYA 1RXOB 1SUXA 1VH7A 3SRHA 4ZXLA 1SFJA 1VFMA 3MKKA 2V3EA 1QNPA 3OZMA 3VKBA 2V5LA 4D6DA 3W82A 2A7PA 3R6IA 4MNMA 5A8PA 1NELA 5EMUA 4KWOA 4Y9MA 4HSHA 4UFJA 3VNJA 4GQGA 1K9EA 1EL3A 5LA2A 4XTIA 2UY4A 4L1GA 1TJ1A 1W1A1 4IIBA 3TIMA 2DH3A 1A0CA 1J5TA 3LCIA 1W1IE 1BTCA 4LCQA 3LCXA 4NNBA 4C6BA 1TB3A 7XIMA 4AWEA 3FA5A 3MTWA 1TV4A 4NJHA 4WCJA 2Q6ZA 4AXNA 4E2BA 2WHMA 3KBNA 4PL2A 4LBUA 1I2RA 2V2CA 4JYEA 3WF4A 1YNYA 3SY5A 2VWTA 3G22A 3NZPA 1J0JA 3DFTA 4EKJA 2Z4GA 1A5CA 4AZIA 1GQJA 1FUYA 1VCVA 4NJKA 1A5KC 1H49A 3HQNA 4ERIA 4GBDA 3VD9A 2EPOA 3W7MA 1XSJA 1JCTA 3FV9A 4GI8A 3ELFA 4M56A 4LC6A 5A6JA 1GEHA 3P0WA 3LHUA 1ZJBA 4MB5A 4ZQCA 4TOQA 1I75A 1DIOA 3WJYA 3CWNA 3VMPA 1TWIA 1U1HA 2YJQA 3VCCA 4JHMA 1BXBA 1W1YA 3AXIA 1TYGA 3CH0A 3WUBA 2ISVA 1Q66A 5BXTA 1OFQA 5M17A 4B92A 1FWJC 5D09A 4DELA 4HNOA 2HS8A 4IIFA 4OJYA 3GRIA 3W73A 1J10A 5AC7A 1JZ2A 5FOOA 1KFBA 2OLSA 4FNTA 3LBCA 1RCXB 1JCJA 3KWSA 1AW2A 1TPC1 3AJ7A 2C0AA 5FL1A 1R38A 4IIDA 2G0WA 3SCQA 4DXXA 5HULA 3LNPA 3SBFA 3ISIX 4LY4A 4K7YA 4IISA 4K7VA 2V3DA 4PL1A 4ORMA 1IV8A 1TZ9A 3E1F1 5EB8A 4JS3A 4AW7A 3WQ4A 4CD4A 1ADSA 5KINA 1AW5A 1HL8A 2QJHA 4ZEPA 3NQEA 3W87A 3BGJA 2J25A 4GUHA 4O8RA 2QT3A 1JF5A 3O7UA 4UIOA 1VJSA 3O3RA 3WNMA 3N11A 1LRQA 4RE0A 4TVDA 1ITUA 4ZB0A 3ZT7A 3H23A 1I9CB 3IGSA 4B9ZA 4ACZA 4AMCA 4U3AA 1P6BA 1OB0A 5FJIA 1HNYA 4FNQA 4QM1A 1BVNP 3AICA 4MDOA 1NOWA 3G8EA 2F61A 2WVVA 2EF9A 3FOKA 1OBAA 5C9XA 3U5YA 1V3HA 5G2IA 3L65A 5TD4A 1W8SA 3SCPA 1E40A 3TXVA 2Y2WA 5CLTA 3Q94A 3WQ5A 1KNWA 3PZGA 3CV2A 3ARZA 1DJGA 4CVWA 3VC6A 4FX6M 3GU9A 1B31A 2POZA 2J66A 3C0QA 2DGAA 3AC0A 4LB4A 3I10A 1O68A 1S3TC 4MLRA 2B81A 3SQLA 4LXFA 4UTIA 1E5NA 5I03A 3EDKA 4S2BA 4QP0A 1LWIA 4LF2A 2AKZA 1PDYA 1HKWA 1IT7A 3E2RA 5CSUA 2XTKA 4NQ1A 4AIBA 1JG9A 1XV8A 4D8ZA 2GGHA 4GD0A 3E5PA 4C6PA 3WDJA 1US0A 1F3EA 1US2A 3RPDA 4CQCA 3CAQA 1GOXA 2RAGA 5C2GA 3SUTA 1D8CA 4H9TA 4ML4A 2GVLA 2P8BA 1C8QA 3BQ6A 1B0IA 3UWYA 1F6PA 1BGGA 1HJWA 1B3OA 2PGWA 1V02E 2I16A 4K8EA 3FDKA 4GI4A 4PSRA 2RDUA 3M0HA 1WP6A 5K9XA 1W1PA 2WVUA 3O6DA 1T8QA 1UCWA 1E3ZA 1QNVA 3MKVA 4XVDA 4C5YA 1Q2SA 4AC1X 4LEFA 3CMJA 1W91A 3L4XA 3A47A 1SO6A 2VUYA 1JCMP 4OFCA 2NWSA 2BOGX 3S42A 2OSYA 4RKAA 1UD2A 2WMIB 3NGFA 2B7QA 4ZGYA 4W5UA 4MOZA 4PSPA 4KIEA 1ITCA 4F0HA 1EOKA 5D2TA 2QMJA 3L4ZA 1MXDA 1GHSA 1VF8A 1B9ZA 1FWIC 3GBDA 3VGEA 3SI9A 4QNEA 2B7NA 1TVLA 3PWGA 2NXHA 2QEZA 1F6KA 4IQJA 5MKGA 1HUVA 3W7GA 2V5CA 1JCLA 5DRIA 3WLJA 1TPVA 1CYGA 2PF0A 3COTA 1XHGA 3KE0A 3RPMA 5IFPA 4MJMA 3DXIA 3GH7A 4Q4PA 5ABGA 1KR1A 2C15A 1BKSA 3VE7A 3VGGA 3VGFA 3STCA 3DHUA 4H83A 1JPIA 3B9AA 3R94A 5JIWA 4RNHA 1TIMA 3ITXA 5DF0A 2J7FA 3KOWA 3S9YA 2DSKA 1TREA 3RM4A 3CPRA 3F1QA 4AFYA 2X30A 3LGEA 1OYCA 2YA1A 4C1NA 3ARYA 1JD9A 2V5BA 3MU7A 1J11A 2VL4A 4IGSA 1PZ2A 3A64A 3I65A 1OYAA 2YDSA 2NX9A 2W66A 3ORWA 3FXGA 2WJDA 1TPB1 2O0TA 3NVTA 3OVQA 2JF7A 2VI0A 4XKYA 3AI0A 4YHGA 4YPJA 1QATA 2EHHA 1H0IA 3QQ1A 1N82A 4J2PA 3VX0A 5BNKA 3E12A 4LV9A 4H9XA 2C18A 1IXPA 3B8SA 4ZFCA 3GH5A 5CGTA 2VZUA 1W6TA 1Q65A 2J7BA 3NA8A 1XSIA 2Y7FA 3WD2A 2XM2A 3KOZA 1YHTA 2OWWA 2XIOA 5FAJA 1OC6A 2OO6A 1W8GA 4MY8A 2FZDA 1QHPA 3GDKA 2PODA 2XN0A 2YBUA 3G1AA 1WDSA 1TJ0A 3MKCA 2OOGA 5HQMA 2OZ8A 4FEZA 1RSCA 2X41A 3G24A 4AVFA 3R10A 2FH8A 3EX6A 3SJNA 4Q3MA 4CVUA 1D2KA 4GISA 4JY8A 4J9JA 3RNDA 3U5UA 2IPGA 1TV2A 3UFYA 1XC6A 1PIIA 1K70A 4JIEA 5CAHA 3CAKA 1S5WA 2AKMA 4RNJA 2V0TA 4PFMA 1YNPA 4K36A 2EQDA 4PRRA 5J5RA 2CZFA 3H22A 4KGJA 3U7VA 4GO8A 1TA3A 2R94A 4EAMA 3M46A 4QG9A 1A5AA 1TWSA 2AOSA 3XISA 1P5BA 1UR0A 3R8RA 2CXEA 1K7XA 4AF0A 4DJEC 4AD1A 4JCMA 1FWHC 4UNKA 2ANUA 5FKYA 3QZ6A 4Q4KA 4OTKA 2YDAA 2QJJA 1HO1A 3C6CA 3MUY1 3UR7A 3SIMA 2PPGA 3U3HA 3IACA 1UWRA 4NZ3A 3TLQA 1OC7A 2QUNA 1NFBA 3GAKA 3WBWA 3WNNA 4XO6A 3VD4A 1C92A 2H90A 1RJQA 2VD8A 4XIMA 1DP0A 2P5NA 1H0GA 1FWTA 1LLZA 3BLLA 3UG4A 1P0EA 3AS0A 3B4UA 3FX4A 3NQ2A 5GPRA 4UZUA 2DT1A 4UQDA 2QF8A 5FAGA 4LEQA 1YE4A 4QDMA 3W2UA 3ZSSA 1SZRA 4B5SA 3U9IA 1TWZA 1LUCB 4HNCA 4Z2KA 4DI8A 1UWTA 1A0DA 1W1VA 3KP1A 4NZCA 1TPFA 3W2NA 3AYSA 3I4KA 1AL7A 3VU2A 1HL9A 1XH0A 3GTNA 3Q4DA 4AX7A 4JCLA 4AZ6A 3BW4A 3WF1A 3G0UA 3EOOA 1DKWA 1YRRA 3S6OA 1J12A 3FFSA 3EDFA 2WJEA 4PMXA 3URNA 4U28A 4O0KA 1Z42A 2C16A 3WIJA 1B4KA 4UR8A 1TV8A 3FY1A 3MSGA 4DPQA 3MB9A 4NZJA 4JR5A 1F61A 1UA3A 2CZVA 5EMMA 1GJWA 3R89A 4WY0A 3DC0A 4Z2GA 3GXDA 2DZUA 1FWCC 3Q37A 2MNRA 1H7NA 1VBRA 2R24A 1CXKA 2BSLA