3S42A

Crystal structure of the 3-dehydroquinate dehydratase (arod) from salmonella enterica typhimurium lt2 with malonate and boric acid at the active site
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
260
structure length
259
Chain Sequence
NLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTIDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the 3-Dehydroquinate Dehydratase (aroD) from Salmonella enterica Typhimurium LT2 with Malonate and Boric Acid at the Active Site
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
total genus 104
structure length 259
sequence length 260
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3s42A00
1GEQA 3NZRA 4WQ6A 3B05A 3TC7A 3S8HA 3ELFA 5J5DA 4IJBA 3QPYA 1XC4A 4IX0A 3C61A 3IEBA 3CTLA 3LOTA 3PG9A 4UMCA 3EWWA 1KTCA 1J2WA 1I45A 4ZL1A 1ZNNA 1GQNA 5EKYA 4NNBA 1GWJA 1YXDA 2WSYA 3N9RA 3W7MA 3UPWA 4LS1A 3MO7A 5BOOA 1ICQA 1FDYA 3RMJA 1Z41A 3ABRA 3W86A 1OK4A 2X1SA 2FB3A 2V5BA 1W56A 5D30A 3DH7A 3TFCA 4FO4A 3HG2A 4JXCA 1A5CA 3OVPA 2Y88A 3I7SA 4R53A 2ZZ3A 3NQ6A 8TIMA 4NZJA 4UFLA 4AXKA 1TPH1 3NL2A 4XTIA 4NX5A 2EKCA 1JCXA 3P5YA 2V2CA 1YADA 3C2VA 4X9SA 1EP3A 1GVQA 1BTMA 3L66A 1MEWA 3NL3A 3S5YA 5DY2A 3NQCA 3UD6A 5LNSA 2VKZG 2ZTJA 1KV5A 1MSSA 3G18A 3PUEA 1OABA 4A29A 3T44A 1TPWA 3MUXA 1SUXA 1WBJA 2C14A 3LB0A 3QQ1A 4A21A 1U83A 1GOXA 3SW6A 2JK2A 1F5ZA 3NL6A 4OU1A 3MYOA 5AYZA 3STCA 3VNDA 3CWNA 4HNTA 1TB3A 1NF0A 4NU7A 3MBDA 1GTEA 2E77A 3TX9A 3KX6A 3PUDA 2XN2A 2JGQA 1N55A 2NLIA 4IXXA 1LLWA 3OA3A 3VCRA 5SWUA 1OFDA 1EWDA 3FYOA 1JCYA 3C56A 1KFJA 3LCIA 4OQVA 5G4WA 2GPTA 4TIMA 5DCDA 3W7JA 3STGA 1VZWA 3NQFA 4DF1A 3GAYA 1TV7A 4OHQA 1FY6A 3LTSA 4N9BA 1YPFA 3IIVA 4K38A 2VFIA 4FNTA 3NM3A 3HMJG 4IMCA 2V0TA 4UTUA 3IVSA 5F2LA 3CC1A 2PURA 5CZTA 3VKJA 1IXQA 1YXCA 3A23A 1EEPA 4MFDA 2YW3A 3OVQA 3GR8A 1KV8A 1GVOA 4ICNA 3BARA 3G1FA 4HHPA 4JYFA 3CEPA 5F4XA 3A24A 4AVFA 2HTMA 4MLRA 3W85A 2HSAA 1TPEA 2X16A 1LP6A 3UQNA 5HUPA 3UWUA 2CZ5A 4NNCA 1K3UA 3O8AA 4MJZA 2NXGA 5LGXA 1VCVA 3P8IA 1QPQA 3S1UA 3EB2A 2E09A 1TMHA 3KHJA 1SFJA 3G0SA 1TO3A 4O8RA 1LRQA 3LCLA 3O16A 4UTJA 4QQ3A 4BWLA 3E49A 4QIUA 1G7UA 3MHFA 4JTSA 1KM4A 4Y8FA 1TYGA 4NJKA 1Q6RA 5CSSA 3PY2A 3GB6A 3GDTA 1L6WA 1KFBA 1GYLA 4LVAA 2A1YA 2J88A 4C1LA 3E0IA 1TQXA 3GXPA 2RFGA 1PCWA 1X8FA 3QFEA 1R47A 3NR0A 2CZEA 3P84A 1OFOA 4IUOA 2G96A 4LTSA 1U5JA 3DAQA 3N73A 2X1TA 3LLDA 3WJSA 4QM1A 2YW4A 1GVSA 2NZLA 1H51A 4UFJA 1GVRA 4E2BA 3ABQA 4HN4A 4X2RA 4GFSA 3EEGA 1PS9A 1Q45A 4EF9A 1EWEA 2Z6JA 3P5ZA 5IBXA 3CQ0A 1NFBA 5I3JA 2WSQA 3T78A 4YL2A 2Z2UA 3YPIA 2OX1A 3MWAA 3SGZA 4S2CA 4DQWA 3OBKA 2A7PA 5G4EA 3GNNA 3G22A 4PEKA 4NXSA 2A0NA 3P80A 1KM0A 4TU1A 1YPIA 4XUGA 4MY9A 1H62A 3NQMA 2TRSA 2GJNA 5AHIA 5K9CA 4O54A 2ZBTA 5AHNA 3TAKA 3W7QA 3C2OA 1XI3A 1T8XA 1O60A 3IVTA 3KOFA 2HS8A 4NJGA 3TA6A 3E9AA 1RPXA 4I7WA 4UTHA 1M6JA 2C18A 3LRLA 3CHVA 3QMRA 3FIGA 4KKXA 1VQTA 4ZMGA 2QUVA 4JNMA 4HIBA 2E5CA 3IGSA 1K8XA 3B06A 5HWJA 2ISSA 4Z1AA 4OT7A 2NX3A 3GNDA 3NDOA 5F4SA 1HUVA 3W22A 3IIOA 5LGZA 1W31A 3DFSA 4JTUA 4BR1A 2B4GA 4MPQA 5D2VA 2GUUA 3NAVA 4BI5A 1SW7A 5EPDA 3VI2A 3DFTA 5D05A 4XKYB 3TNOA 1QPNA 3QMSA 4JTKA 3MHGA 3B03A 2QCHA 4CCEA 1O95A 4FIRA 4JTLA 1LRTA 3QPZA 2FB2A 2EF9A 1IGSA 4UFHA 1ZAHA 3EWYA 1CI1A 1SZNA 2O7QA 1XDMA 2WO5A 3WJYA 2J27A 3TROA 2ISWA 1FWWA 1EUAA 4Y96A 2Y7FA 3GXTA 1HG3A 6TIMA 2A7RA 1DJQA 3FLUA 1R2SA 1VR6A 4O15A 1T0OA 1M5WA 2ZZ2A 2GQAA 1R46A 2E6YA 2E1DA 3CEUA 1G4PA 2C6QA 4MZ8A 4N6EA 5F1UA 5AB3A 1LTDA 2TPSA 3O07A 1NSJA 5LSMA 1SSGA 3SFKA 3L67A 1PL9A 2ZRXA 3CB8A 4EOUA 5AC8A 4RK8A 4XQ6A 2ZDRA 1H7NA 5EA9A 3LRMA 2V2DA 1H7XA 3LHZA 1OVDA 1RVGA 3C2FA 3LXCA 1EB3A 3SECA 5KINA 4FX8A 3DKJA 3BLFA 3VFLA 3UPBA 3IGXA 3JR2A 3VE7A 1I2PA 3W1AA 4R33A 5CZSA 5BMWA 2WKJA 1ME9A 2CLMA 1FBAA 1GG0A 5CG7A 3LRKA 4ZZ9A 3TE9A 1FX6A 5K4XA 2PCQA 3TAOA 4IMFA 3MP4A 1JUEA 1VGAA 1ICPA 2FJKA 1W8SA 1IXNA 2XN1A 5BNKA 2EPHA 4RCXA 1HO1A 5K9XA 3B0UX 3N2MA 1PIIA 1SFLA 1SSDA 2J9ZA 3O63A 4YXGA 4UFKA 3QSTA 1YYAA 3UWWA 2W0UA 3LHWA 1R2TA 4MYXA 2DZUA 1EP1A 3NNTA 4JDBA 2QCNA 3HF3A 1H7PA 3TXZA 2GQ9A 3KRZA 4LVDA 1BWKA 2Y7GA 2WSRA 3V1PA 3WK0A 3HG5A 1LOLA 1Y0EA 4IOTA 3W1LA 4I9AA 4DO5A 3M5ZA 2GQ8A 3E12A 3NZ1A 3GDKA 1I2OA 3D0CA 4Z1DA 2Y61A 3TUUA 1DL3A 3FKKA 4QSHA 5LHEA 2CFFA 3LBCA 3SGUA 4DF0A 1H50A 3T55A 1RQBA 4MOZA 3OEXA 4M7TA 1VPXA 1Z42A 4E2DA 3GX9A 4FNUA 4N9DA 1OJXA 2V9DA 4GUGA 4UMAA 1Q6LA 4NJHA 3DHFA 1XDLA 1MEIA 1OX4B 3W7NA 3B0VC 3OG3A 5AYXA 3BPWA 1PVNA 5D32A 3MYPA 3PM6A 1UUOA 1QFEA 1OK6A 3S5OA 3KRUA 3TCEA 3EWBX 4R7JA 1ME7A 4LVGA 3LTPA 2VFEA 2BTMA 3TW6A 2AQWA 4PL1A 1X1OA 3MMTA 2ZRWA 1WOBA 1YTDA 1H5YA 1NVMA 1TV8A 2VEKA 3HPXA 1IIGA 1VLIA 4LRTA 3EKLA 2WNNA 2V30A 3BG5A 1KTBA 4EWND 5HQEA 2PC4A 2WNZA 2FDSA 2GVLA 1TCDA 2PE4A 3B04A 4PTNA 3QH2A 1I4NA 5H91A 3PS7A 3JRKA 1H7OA 2TMDA 3R8RA 3BGGA 4WX2A 5FF3A 3RK8A 4O4VA 2ZRVA 1QMLA 5BMXA 1HTIA 4M6VA 3DKLA 1LROA 3LCWA 5GVJA 3MW7A 4RZ6A 1LBMA 2Y6ZA 2P10A 3USBA 1SZFA 1QO2A 3ANYA 4KWVA 1H7RA 2A2IA 4LU0A 3GIYA 4OGZA 3TQKA 3GDRA 1XBZA 1A5SA 3GKFA 1RR2A 4JD4A 3LHYA 4JYDA 2E68A 4FF7A 3MP3A 4IQLA 4LS0A 4DBEA 4LVBA 3IIZA 1KFLA 3I7RA 2VOMA 2RDTA 2QCCA 2UV8G 3F1QA 4RXFA 4NZFA 5AHMA 2C0AA 4WOZA 1F05A 1TRIA 1P4CA 3W2JA 1Q6QA 4OE7A 4QJ1A 4HNUA 3PUOA 3ATZA 5ABTA 5IM51 3NVTA 1AW2A 3GKAA 1OFBA 3TQ0A 1C8VA 1W3IA 1DHPA 4N6FA 1JQXA 3W1TA 1VCGA 4JX4A 4PA8A 2V5LA 3I6RA 5KZEA 1KM3A 2GOUA 3K30A 4PCFA 4M6PA 4AH7A 3FFSA 3PB0A 1S5VA 2YFNA 5E93A 1VLWA 2OCZA 4JY9A 3I68A 1JVNA 1X7FA 2AAMA 3G1DA 5DXXA 1W5OA 2FIQA 5T26A 5HINA 3E02A 4FNRA 4LVFA 2EAWA 5TQLA 3DFPA 1XXXA 2NXHA 3STFA 1ONRA 2ZA3A 5EMUA 5AHFA 5EL1A 5TIMA 1XCFA 4DF2A 3WJZA 4Y9AA 3HPSA 4PH6A 4ML9A 3G3MA 4WZHA 1V7YA 2YCEA 3CT7A 2B7NA 4YLWA 1TPB1 2CU0A 3B0PA 3BW2A 4JTJA 3W7GA 5AC6A 4LW7A 1FWNA 5DBTA 1YLVA 1X6UA 2BX7A 5HMSA 5F2IA 3TU9A 2R14A 1LYXA 3WK2A 3L5MA 2RHGA 3P74A 3B8DA 1KLYA 5I3HA 5FF4A 3FA5A 4IPIA 3W9ZA 2PRMA 2CZFA 1OG0A 1J5TA 4O1CA 3NL5A 1R30A 1OYCA 4IXHA 1SW0A 3I65A 2XFWA 4O17A 4D2JA 3W72A 4DPPA 3O15A 5FEWA 3W76A 4N4PA 4UTTA 1JCMP 3N2XA 5AC7A 4O16A 3RLUA 3G8RA 4Y6GA 2WPBA 3IGUA 4O10A 5K7JA 3KRSA 3TR2A 4EF8A 2G95A 2QCLA 4LUIA 1SW3A 3PVFA 1UASA 3S5ZA 3W7RA 2OT1A 4Z0SA 4FXSA 1ZAIA 4BK9A 3PC0A 3UXAA 3W1RA 3N3MA 4ADTA 2F7FA 3EWZA 1NAL1 4A22A 3TDFA 3W87A 1AL7A 1TRDA 1TTQA 2RDWA 3W2KA 1KW1A 3G1AA 1YDOA 1EIXA 4EIVA 3W07A 3HOJA 1G4EA 4EVZA 1M7PA 4LY8A 3UNDA 4Q33A 4YCPA 3Q37A 2B7PA 3KVMA 4E38A 5FESA 1TPUA 2XN0A 3G1YA 2C3ZA 2ZRZA 2A7NA 1AW1A 2QUTA 3NPUA 3BV4A 4H4IA 1VCFA 1KFCA 1KBJA 1LORA 3MI3A 1TPDA 1B9BA 2DJLA 1GZGA 1L6SA 1A5BA 2ATMA 3IIXA 3S1XA 2E5BA 3FOKA 4K7VA 4ZVJA 3HIJA 4PL2A 4UNKA 3S6DA 3FJLA 3UZJA 1OF6A 3A22A 4NXKA 3CM4A 2Y7EA 1JUBA 1RZMA 4JIQA 5CPMA 2A6LA 4AEOA 1SQ7A 1ZJIA 3OVRA 5A8GA 5J5RA 3W70A 5DBUA 3W71A 1QO5A 2QDHA 2C16A 2I1OA 5F2MA 3M9YA 4MKNA 1I8JA 2V81A 4L4LA 1LZOA 1D9EA 1QDSA 5AFDA 2J6XA 1KM1A 1FWTA 1SO5A 1FCVA 3BVJA 3TJXA 3DFQA 2GVGA 2ZCGA 4TX9A 3GVGA 3GDLA 5I3GA 2H8XA 4UFMA 3NM1A 3W1UA 5LHFA 3U8GA 4O1DA 2Y62A 2Y7DA 3ABOA 4QNEA 3HG3A 2QCFA 1ME8A 3M16A 3P7YA 4P2VA 4HSNA 1JJKA 4B5NA 4O57A 1OFEA 3I7QA 2G97A 1WDWA 1R2RA 3LXAA 4GUHA 3ZWTA 2A6NA 4TO8A 3PAJA 2VFFA 4X22A 2EHHA 2DZSA 1B3OA 4IMGA 3W1XA 1YDNA 4JX5A 2IQTA 2PRLA 1YTEA 3THQA 4JIPA 2B0MA 4AHPA 4OV4A 5CSRA 1QOPA 3NPWA 1IIHA 3W73A 1MZHA 2ZA1A 4O28A 5F4WA 3HGRA 1Q6OA 3WJWA 4W9TA 2C19A 1QCWA 2B7OA 3RU6A 3UYCA 3O6CA 3LCFA 5CKSA 3KFTA 1HO4A 4JGDA 3R13A 3TSDA 3W88A 5E0KA 2ZRUA 1JUKA 1DQXA 3QJAA 4BF9A 4Z0JA 2QCMA 2Z1BA 3AO0A 1ICSA 3DENA 4JN6A 2ISVA 3PG8A 1AW5A 4MUZA 1W5NA 3HBLA 2QCDB 3QW3A 2H3DA 1MO0A 3C8FA 5DN1A 2NWRA 3UY7A 1JRCA 4IMEA 2X30A 4KWWA 4O1AA 3RF9A 3PBUA 2CLIA 2DZPA 1WXJA 5KMYA 5DCEA 1W0MA 3OHIA 1GG1A 5KZMA 2W79A 5G1YA 4RXGA 4LV4A 3C52A 3P61A 2TYSA 4N4QA 4IX2A 3G3DA 3BO9A 3HB9A 2Y63A 3Q58A 3F4NA 3NQEA 1LLZA 5LNRA 1UB3A 3EXRA 4PODA 1CX9A 2ZZ1A 2NUWA 1S3HA 5CZ0A 1LBFA 3G24A 3GLCA 3LI0A 3LX9A 2ZA2A 2Y70A 1SO6A 2YGYA 3NQ2A 5BRBA 3C4UA 5IBXC 2OZ0A 3NGJA 1VH7A 4GC4A 1G7VA 3INPA 3PR2A 3L0GA 1DBTA 2X2GA 2FQIA 5FEPA 2E6AA 2TSYA 2Q3OA 4CQ9A 2JKEA 4Q32A 5C6MA 2H6RA 5I3IA 4UR7A 2V82A 3L2IA 3PBYA 3TKFA 3EWXA 1FXPA 3LGEA 5G5IA 2J9XA 3LHTA 5G2IA 4FB7A 2OT0A 3O6DA 2DJXA 2VELA 1O5KA 4NT0A 4UTMA 3G1HA 4HNNA 4WY0B 3W83A 1V5XA 4AMAA 4ONVA 4KFNA 3KVJA 3O06A 1O94A 2D73A 4LOCA 1DORA 5G1TA 5F2GA 1XBXA 1W37A 3MI6A 1SO4A 4PFMA 5AN7A 5U4NA 1I2NA 4S2BA 1DQWA 5CGQA 2VEIA 3WJXA 1FDJA 4O11A 4JTEA 2YFOA 1FWRA 4NJIA 4LRSA 4GNJA 5K4ZA 1W5PA 3EKZA 1H60A 4O14A 1VYRA 2VEPA 3SJ3A 3M47A 3HJZA 5TBOA 2Z6IA 3A5FA 2WV8A 3M0ZA 5MHBA 3AJXA 4JYEA 2FTPA 1PE1A 6ALDA 1OHLA 2C15A 3GDMA 5HULA 4YWIA 3M5YA 4CNOA 4FEZA 3NPXA 4P61A 2ZYFA 3M1ZA 1F73A 3W1MA 3H53A 1G4TA 4K39A 2A5HA 4O13A 4PC8A 1G4SA 2NWSA 2ALDA 2GVJA 4UXDA 3W75A 4N02A 5A5WA 1AK5A 2RH9A 2YYTA 3R12A 3A5VA 4XTDA 4GE8A 3FEMA 1QPOA 2BWGA 1AG1O 1WV2A 3PB2A 3UWYA 2QDGA 3W1PA 1YDVA 3KVKA 3W1QA 1WOAA 2NUXA 4O52A 1QNVA 3ABSA 2CLEA 4NNAA 4HPJA 3M41A 3BK0A 5FI8A 3MHUA 1LCOA 2ZFAA 3FKRA 1HL2A 4OV9A 3UWQA 1W1ZA 1T99A 3HGSA 2C13A 3ZWSA 1H1ZA 4JTIA 1TQJA 4K8EA 4DO4A 4JS3A 4E0CA 4M7SA 3LCGA 4AWSA 3KXQA 5DY3A 4LC8A 2YSWA 3W7OA 4RKAA 3P81A 5D03A 1OFQA 2QCGA 1F6KA 1WBHA 3U2OA 4Z08A 3LTYA 3GAKA 4GUFA 1GPWA 1KBIA 4O19A 5FF7A 4K36A 1F7BA 3G0UA 3W7PA 1PHWA 3EX4A 3HQ1A 3TIMA 1EA0A 2PRHA 3NEVA 5D2WA 3F03K 3QYQA 4UC5A 4ZQPA 4WUIA 2FPYA 3LHUA 3H54A 1JCJA 1ZHAA 3M6YA 4RZ4A 2OJPA 1B4EA 3HO8A 4NQ1A 1UUMA 1KLZA 5AYYA 4JTHA 1ZY9A 3ATYA 4WXYA 1RQHA 1RV8A 3O1NA 1VS1A 5BW6A 3G1VA 5I3FA 2QAFA 4N9EA 4DBDA 3BG9A 3MP5A 1XUUA 3SI9A 3QM3A 3Q2DA 1RD5A 2DZVA 1FQ0A 1UCWA 2ZZ5A 3PWAA 1EPXA 5AHEA 3PF3A 1S5WA 1TPVA 4M5PA 4MY1A 2A21A 4BI7A 3W7HA 4BWLC 3EX1A 1SO3A 3BGJA 1ML1A 4HKPA 4HSOA 5HJLA 3TMLA 3GXNA 1H7WA 1KM5A 2CWNA 1KA9F 3R5EA 2ZZ7A 1QWGA 4UTIA 1KFKA 2R8WA 3NG3A 1VJIA 4O50A 1G6CA 1VHNA 3QQ0A 3T4CA 2BZNA 2DP3A 2FPVA 3THAA 1PCKA 1K7XA 4JICA 2P0OA 3RFAA 5DCBA 2WJZA 1XL9A 1VYPX 3Q94A 4AHOA 3TQVA 1F74A 3NQDA 1OF8A 3HPZA 3EX2A 5D38A 4HPXA 3P62A 4IMDA 2C1HA 4DPQA 5C5YA 2YZRA 4Z1CA 5LKYA 2RDUA 3OIXA 1WX0A 1H63A 1XKYA 4RV8A 5AOUA 5EY5A 3HG4A 4LNYA 5LNVA 1YTKA 3LHVA 3L65A 1LRNA 1TTJA 5U7SA 3DBPA 4I7UA 4IWWA 4AF0A 4BFAA 2CLFA 2LLEA 2NX9A 5HWMA 5AHLA 4IGHA 4XBSA 5HWNA 3EX6A 3EXTA 3CU2A 4UNLA 3W2NA 4Y90A 5EYWA 3W74A 1ZENA 3TC6A 4FX7A 5K2ZA 3W7KA 4UTKA 3P8JA 2Q8LA 3EX3A 3TK7A 4NUWA 3ZS4A 3QMTA 1N7KA 4FX6M 3MBFA 3F4WA 1O4UA 4CCCA 3CWOX 5C54A 5KSWA 4KFOA 4O18A 3IIPA 3L9CA 1I2RA 3SIZA 4FNSA 3W2MA 1OFAA 2VC6A 5D02A 3GZ3A 5CZJA 2Y85A 3IRDA 2G5WA 3CPRA 3RNDA 3MJYA 2FLIA 3LM7A 1DKWA 3R89A 3W7DA 2HMCA 4MZ1A 4FNPA 3LERA 3N14A 2WNQA 3N9SA 1AL8A 3C6CA 4JR5A 3C2RA 1K7FA 3P82A 1FDZA 3STEA 4UMBA 5G2HA 3SSJA 4O0ZA 4TR9A 4GWEA 4TMCA 2NXIA 4UCGA 2H90A 3O05A 2YDAA 4ZQNA 5DLCA 4GUJA 1VC4A 1GYNA 4AF0B 1PHQA 1BKSA 4DEFA 1LDCA 1SZEA 3NA8A 4LWWA 3EWUA 4G1KA 2ABAA 1KTNA 2DZTA 3NPVA 3NXFA 4ZQMA 4C1KA 4NJJA 2YXGA 4RJEA 5KZDA 1W5QA 4RZ5A 4XBKA 1BWLA 1NF7A 4CNPA 2NUYA 4R34A 4U28A 2BSLA 2QCEA 2J9YA 5L9FA 3QEZA 1OYAA 4O12A 2Q3RA 3C0JA 3M44A 1W3TA 2CLOA 3DFOA 3S42A 4WY0F 3QF0A 2AGKA 4N2YA 3QC3A 2Q8ZA 3TJLA 4MJMA 5L6UA 2VENA 3KVLA 1UBSA 3U6WA 1OX6A 1H61A 4XZ9A 2QUUA 1SPQA 1E51A 4YMZA 1DOSA 4GXMA 1W5MA 3TXVA 4DXVA 3IVUA 2QEZA 3SR7A 2NX1A 2YYUA 4ZQRA 1TTIA 1JCLA 3NO5A 3TFXA 1SU5A 3M43A 5I3KA 4UTWA 4UTLA 3M7WA 3RLVA 1TJRA 1L6YA 5CPOA 2GJLA 1LBLA 4NVTA 2I14A 2ABBA 2CLLA 2ATSA 4WY0A 1A53A 1IXPA 1K03A 3QW4B 4XKYA 1NEYA 1WYIA 3TW7A 4AHQA 3TSBA 1JQVA 4JTFA 4UUIA 1LM1A 3W84A 1TPFA 4KFPA 4XWUA 1EP2A 4QNWA 1SZGA 1ZFJA 2V2HA 2JKPA 5CPLA 2X1UA 1K8YA 2E6DA 2VEMA 3W3OA 3LV6A 1TREA 5D09A 4CNNA 1FCUA 4NX0A 4FNQA 1I2QA 2R94A 3N19B 1GVFA 1W3NA 4O0KA 5C55A 2RKXA 1ZCOA 1DVJA 1XFBA 3S5NA 3BLEA 3L5AA 4JEQA 1TTPA 4N9CA 1RQEA 4UR8A 4BI6A 3W23A 1Q3NA 5K3VA 4POCA 1OX4A 4M19A 1IF2A 1ZALA 4MY8A 3L0NA 1SR9A 2CZDA 2FPTA 3R2GA 2WQPA 1TV5A 4RX0A 1XBVA 5D04C 4S1FA 3G1XA 1S5TA 3G8EA 3O6YX 4ZQCA 7TIMA 4WJEA 2H3BA 2QJIA 2E5DA 3ZR4A 4TMBA 2DZWA 2QCDA 4GUIA 3BW3A 4H3DA 3NQGA 3PBWA 3TH6A 1VHCA 4ORIA 1L2UA 4LUJA 1JCNA 1G69A 3G1SA 5F1VA 3FS2A 3W6YA 1D3HA 4JTTA 3P60A 4LV9A 3NOEA 1P5BA 2V8ZA 3UY8A 5D37A 3LV5A 1W54A 4AWTA 5HUOA 1KFEA 1P0NA 3DI0A 3FYPA 4OBTA 3HGJA 2VFGA 2ZRYA 2QF7A 5LZLA 3EXSA 4MLJA 2VXNA 3VE9A 1MEHA 2FFCA 1THFD 4RLIA 4CQ8A 2Z0IA 3PSVA 1B4KA 1C29A 4O1BA 3W7IA 3L5LA 3LLFA 3W7CA 5C2XA 4UTWC 3WK3A 1H1YA 3QRHA 1FCBA 1FCQA 3S1VA 3DZ1A 3TMQA 3H55A 3LXBA 5H2ZA 1LOSA 2B7QA 4UIOA 5KTLA 2BLEA 2F84A 2DZXA 1FUYA 2Y89A 5FEXA 3P67A 4JX6A 3UXDA 1QAPA 1F6PA 1WAUA 2QKFA 4ORMA 4A2SA 4FXRA 1N8FA 4O53A 4GBUA 5KITA 4UFIA 1O5XA 2CLKA 3WK1A 3T7VA 1A50A 3DGRA 4MYAA 1F76A 1UJPA 1QR7A 3DFNA 1ADOA 2JGYA 2KZHA 1VYSX 5DELA 4AB4A 4JY8A 4L4MA 1FXQA 1XBYA 3NQAA 2E6FA 1BEUA 3G0XA 3NQVA 4LC6A 1P0KA 3M5XA 3WFAA 1B57A 1XUZA 3UWZA 3KAOA 1JR1A 4A3UA 3S1WA 1PV8A 4ADUA 4YCOA 1GT8A 5CPNA 1GTHA 4JTGA 5DXYA 3FJ6A 2DORA 5E1QA 2JBMA 4QISA 3W7EA 1IXOA 3DU0A 5LNUA 3LDVA 2VFHA 3NQ7A 1EUNA 1JRBA 2YR1A 1MXSA 3BW4A 3NQ8A 4HT3A 3C2EA 1J4EA 2A85A 2WOQA 3W2UA 2EGZA 2X1RA 1K02A 2NV2A 1ALDA 3LCHA 4H6KA 3PBVA 3TV8A 4JDYA 1A5AA 4K8HA 1JULA 5EBUA 5FF0A 4ALDA 2ZZ4A 1K8ZA 3L21A 4ADSA 1M7OA 4O4WA 2ZQ0A 1OFPA 1QOQA 3BLIA 1DJNA 2W6RA 5D2YA 3GR7A 4HNVA 4WXZA 3IV3A 1C9DA 1TJPA 4CLMA 4DO6A 1VRDA 3QZEA 5HR6A 5FEZA 3PSWA 1OX5A 5HR7A 3W2LA 3MI2A 1OYBA 2QR6A 4ZQOA 4K7YA 4GJ1A 4WOQA 2CW6A 1GJPA 3BG3A 5K9DA 2J24A 1KM2A 4CQAA 3B4UA 3GYEA 2OMAA 3V75A 3W1NA 1TPC1 1P1XA 4A2RA 1HFBA 2P1FA 4U4MA 1K7EA 2O7SA 3CIWA 1DV7A 3HGOA 2A4AA 1L9WA 3TSMA 2VFDA 4AWUA 5G2WA 4Z1BA 3E96A 2JKAA 2YPIA 1XM3A 2YX0A 1T96A 5HNRA 3GK0A 3L68A 4OWGA 3LCXA 3NYZA 1FWSA 3QSRA 2I9EA 4J9JA 3UWVA 4I7VA 1Z48A 5D2XA 5LNWA 4LT9A 3SZ8A 4RR4A 1TIMA 3N34A 1KM6A 4IPJA 1OFRA 4FIQA 1QPRA 4AAJA 3DI1A 1G67A 1Z44A 3M5VA 3SY5A 4QITA 4LS2A 1X1ZA 3T40A 4WD0A 3S0CA 2QAPA 1LOQA 1TSIA 5D33A 4CCDA 4K6AA 4MFEA 2NV1A 2HS6A 4MVAA 3C3NA 1ZAJA 1WA3A 4M6QA 2ZZ6A 2BXVA 3L0KA 3PULA 4DELA 2QJHA 5FF2A 4MZYA 4MIMA 3JS3A 1D3GA 1WQ5A 3ZFHA 1AMKA 2R91A 1YXYA 3LI1A 4K37A 3UZ5A 2CLHA 2H8ZA 3DHDA 3S9YA 3A9IA 5D2TA 3CLMA 3DXIA 4Q4KA 1EX5A 3W7LA 2QJGA 4FHAA 1F2JA 4GRSA 2ZTKA 3LBMA 3A21A 4X3ZA 3CIXA 4UTTC 4QAIA 1CW2A 2DU2A
chains in the Genus database with same CATH superfamily
1DEDA 4KIEA 3R0DA 4ES4A 3TC7A 3ELFA 1LT8A 2XG9A 3WNPA 1E43A 1CPUA 4A3QA 2F2HA 4DO7A 4HYWA 3C61A 5E6YA 1U22A 1VRXA 3LBOA 4BQ2A 1W32A 2V69A 1JPKA 3PUGA 1J2WA 2GGGA 1PUDA 1ZNNA 3QXBA 3AHVA 1C90A 2VD9A 4J3VA 2ZUWA 4RNIA 3N9RA 3UGVA 1J0YA 3MO7A 2QPXA 2HXTA 3APGA 2V3FA 1ICQA 1FDYA 3LEPA 4O1EA 3ABRA 3W86A 3DH7A 3HG2A 1RLDA 3AMKA 1E4NA 3S2LA 1RXOB 2IPGA 3QTGA 3VGFA 2VVSA 3NL2A 4NX5A 4IIFA 4X9SA 1RK6A 3NQCA 3WLTA 5LNSA 2VKZG 1ZGDA 1KV5A 1MSSA 3PUEA 3WUBA 1R9YA 3ZSSA 2GJRA 3GH7A 1WB0A 4FZIA 1TUXA 3GU9A 5J04A 3GQYA 2OLHA 2GDVA 3SQMA 5M2FX 2R1PA 1W1A1 1EO7A 1JGMA 5AYZA 2IMRA 4BZYA 8XIAA 1XIIA 4M1BA 4DY1A 3BLPX 1K6WA 3VCRA 5SWUA 1EWDA 1W8GA 4GIAA 2YCKX 1R0MA 3C56A 5DCDA 1VZWA 1KXHA 2XISA 4GH3A 6CGTA 1TV7A 3LTSA 1A3XA 3SCWA 1YPFA 3KBJA 2A3HA 4F66A 4Y8EA 4FNTA 3HMJG 4IMCA 5B7YA 4A35A 4D6HA 2X2YA 7ENLA 2PURA 2VI0A 2GQ3A 3OIHA 3MKCA 3BARA 2A3BA 4HHPA 3GBEA 1JIBA 3SUSA 3MJMA 4LCQA 4MLRA 3W85A 1V3MA 1XRSA 1WDQA 5HUPA 1BSIA 4UB9A 4A6GA 1TIWA 2A3EA 2HVOA 1VCVA 3P8IA 5TNVA 3OA5A 2B81A 1TMHA 3U2CA 1SFJA 3TN5A 3VNLA 2W61A 4AVOA 2R1LA 3G0SA 3OZMA 4GNKB 1LRQA 1Q8AA 3LCLA 4GVGA 4UTJA 4WSJA 1XLDA 4QIUA 1X96A 4AVNA 4KGLA 4MGGA 4Y8FA 5CLWA 4K1WA 3OZYA 4XG1A 1C8XA 1GVEA 1L6WA 3GWQA 4AWEA 3K5XA 1PCWA 1GNXA 3IJLA 1KBBA 5D9PA 1NELA 2QVHA 3P84A 4NSBA 3ZXWA 5DMMA 3NQBA 5F7UA 2X09A 3GVVA 4QM1A 4W8AA 4PTDA 2NZLA 3SQLA 3R10A 3SRDA 4AEEA 1GVRA 4E2BA 4GYKA 1OB0A 4HN4A 3HZ3A 1QNSA 4ENLA 2Z6JA 3CH0A 2WMIA 2IKJA 3ARQA 1C9WA 4F0RA 5IBXA 1NFBA 2VQTA 3SUTA 3ANUA 2W5FA 4GZEA 2PTYA 2XSBA 3T78A 2ESCA 1FWBC 3MWAA 3SGZA 7ODCA 3P80A 1KM0A 2BG5A 4MY9A 1BF6A 1V7AA 1EXPA 4DZHA 2ZBTA 3TAKA 1M03A 1XI3A 1T8XA 3UG8A 1ZB5A 4DLFA 4UZUA 4AD1A 3E9AA 4QGCA 1RPXA 4J27A 3RG6A 1A4MA 1R8LA 3LRLA 2NVDA 4MG4A 3QMRA 4Q8NA 5HBFA 1XSJA 1RY0A 3WEZA 2IKHA 4KKXA 1PYMA 4JNMA 4KWSA 4C6IA 4HIBA 2PP1A 3TWAA 3NDOA 4M82A 1TZZA 4P7OA 2YBVA 4WGXA 2PU0A 1W31A 3NOYA 1QW9A 3DFSA 4JTUA 3THCA 4MPQA 5D2VA 4FS9A 2C1IA 2G50A 3ITYA 1QNPA 5EPDA 4LSBA 4GQRA 1S2CA 4XKYB 3OTRA 4ZB0A 3MMWA 3QMSA 2V3EA 4F0LA 2QCHA 1O95A 4DBSA 3QPZA 3RCNA 1XQLA 2Z1WA 1ZAHA 2R1MA 2DT1A 3WJYA 4WLCA 2XH2A 4BF5A 3RRXA 1JCTA 3ARYA 3VIGA 3OBEA 1EEXA 2A7RA 5E70A 3CL8A 3DG3A 4IIHA 1R2SA 2D3LA 4GZIA 4EKJA 4EXBA 3OGVA 1PDYA 1T0OA 3B8IA 3NUKA 5A95A 2INFA 1BLIA 4M0XA 1CTNA 4X9YA 4N6EA 3CZLA 4KERA 1NSJA 4PUJA 5LSMA 5C2CA 1W9BM 2EBNA 4WJXA 4X60A 4EOUA 3CB8A 4RK8A 2DV0A 2CEQA 3GG8A 1H7NA 4JEJA 2QULA 3LRMA 2V2DA 3C2FA 1EB3A 2BGSA 1PO9A 1K77A 3BLFA 4XIAA 3SSZA 1K1DA 1I2PA 3W1AA 4R33A 3AC0A 2WKJA 3CZKA 4FXJA 4LYQA 2NQ9A 3GUWA 2R82A 2ACUA 3B8SA 1L6GA 3GD6A 3P14A 1T41A 1JUEA 1VGAA 3F4DA 1ICPA 2FJKA 1CXIA 4KEVA 5CBJA 2WW5A 5C9WA 1PIIA 4J35A 5H8PA 3QSTA 3CO8A 1FFQA 3RMEA 3UWWA 1UZ1A 2DQXA 1R2TA 4NIRA 4AZCB 1BPLB 5FJJA 3UERA 2QCNA 3D47A 9XIMA 2SFPA 3IAPA 3TW9A 3HF3A 3HV9A 5BOEA 4YTQA 3MWCA 5JXQA 2E8ZA 2ZVRA 1AODA 1T6MA 2ZXDA 3V1PA 1GQLA 4KESA 3CK5A 3AMLA 5D9MA 2DQWA 4I9AA 3NCOA 3M5ZA 2GQ8A 4QSFA 3NZ1A 3K8MA 2R24A 1I2OA 1XGZA 5D9NA 1OC7A 4L80A 3TYZA 3TTYA 1VFTA 1H50A 3T55A 4M51A 4MOZA 3CAKA 1M9HA 2Y4SA 2A79A 3VMPA 4DJDD 4XAYA 3DHFA 2VDHA 1J12A 1OX4B 3W7NA 3OG3A 4X61A 3VM5A 1UR0A 2BY0A 5XIAA 1A0CA 2OEMA 3PM6A 5IHSA 1IV8A 4ZO6A 3F2BA 4LPCA 2O4QA 1QFEA 1XLKA 3S5OA 2BB0A 3M0MA 1Y7VA 1REQB 2ZWYA 3UVIA 2J8FA 2QGYA 8CGTA 3AIBA 1EGVA 1X1OA 3QY7A 3P2VA 1WOBA 1TV8A 2VEKA 1TUFA 1IIGA 1OZQA 2VC9A 2V30A 1OD8A 3ME3A 1KTBA 4EWND 4GC3A 1TCDA 2PE4A 4PEEA 1O5QA 3LYEA 3ARSA 3QH2A 2YL5A 1PZ0A 5H91A 3N25A 3G6MA 1PKYA 4HOWA 1TMLA 3RK8A 3ITOA 4O4VA 2ZRVA 2GJXB 4C1NA 1HTIA 3DYPA 3W24A 5GVJA 3MW7A 1NP2A 2P10A 3USBA 1IHIA 1SZFA 2PDFA 3ANYA 2Z24A 3WX7A 3R0UA 3BCFA 3RJXA 4OGZA 1A5SA 3BLDA 3LHYA 5CEWA 5ABFB 3ITVA 3NURA 4LS0A 1XV8A 3E0LA 2X0HA 3HMCA 3KBWA 3AS2A 4LVBA 5A6JA 5DEZA 2VOMA 3RLGA 1JF6A 4IIGA 2J6VA 4MB5A 3JU2A 2D2HA 4RXFA 4CQCA 1RCXB 4I6VA 1P4CA 3U0HA 3W2JA 1AW2A 3IJ8A 3TQ0A 1T40A 1C8VA 5CZKA 4N6FA 4PA8A 3PTDA 1WZMA 2WLZA 4M6PA 3PB0A 1VLWA 4GO8A 2VRQA 3H2AA 4Z2HA 1S2TA 3AXXA 4YN5A 3E02A 3L4YA 4LVFA 4HPGA 4QFUA 3BZJA 3WBWA 1EF2A 1XXXA 1YE6A 2NXHA 1A47A 5TIMA 1XCFA 3VCNA 3WJZA 4Y9AA 4YHGA 3G3MA 4CQDA 3UW6A 2J7FA 2YCEA 1A5MC 1BF2A 3B0PA 3BW2A 2UBPC 3W7GA 4LW7A 2OX4A 1YLVA 5I07A 4ZO9A 3E2RA 2KAUC 4PTVA 2R14A 4MWAB 3L5MA 2RHGA 5A6BD 3OPSA 3O0KA 2X40A 3H23A 3MC5A 3AXKA 4IPIA 2EG7A 2CZFA 3LNMA 1SYTA 3EA3A 1QRQA 4S3JA 1JEZA 4IXHA 4WKFA 4PMOA 3O15A 5A6KA 4UTTA 3ZT6A 4O16A 3CBWA 3AS1A 4O10A 1PKNA 3TR2A 2G95A 2QCLA 1I9CB 4FLQA 4C6LA 2Y5SA 4KWUA 3UXAA 3N3MA 1X97A 1RSCA 2GUBA 4A22A 2Y8KA 1TTQA 2GZXA 1EOKA 3EB4A 3UCCA 1DE6A 3EAUA 3W07A 1M65A 3HOJA 1JL8A 4EVZA 4LY8A 3UNDA 1E9IA 4F2TA 4YCPA 2B7PA 3KVMA 4A8RA 3GW3A 4G7FA 5FESA 2XN0A 2ODOA 5HPOA 1FKXA 2QUTA 2Z4GA 1KBJA 3T1GA 3PN8A 1A5BA 2PA6A 3IIXA 2Q02A 1PZ2A 4I8YA 1NTHA 3CPGA 1S2WA 1OWQA 3FJLA 4CGTA 1OF6A 3A22A 3CM4A 3WO8A 1JUBA 1ZJIA 4GBDA 3GS6A 2CIPA 2EPMX 2QDHA 2I1OA 4BCEA 4MKNA 3U48A 3WQ6A 5DFAA 1PAMA 2OZ8A 3CHFA 4C6CA 5JQ9A 3VNKA 3BVJA 3TJXA 1QBAA 3FY1A 2WZTA 3LA4A 2GVGA 2FH8A 2ZCGA 1Z89A 3EDDA 5AYIA 2XM2A 4GGHA 4UFMA 1U5HA 3B9OA 4DI8A 3VNYA 4MB4A 4O1DA 2Y62A 1VFLA 3B9EA 2QCFA 1ME8A 3M16A 4IIDA 2GSJA 5T9CE 3WQOA 1W2VA 4KH2A 4P2VA 4HSNA 2WZEA 3CAVA 4HA0A 4EK7A 1WDSA 2G97A 3R1ZA 1H1NA 5CAHA 3IAQA 2PD9A 3LXAA 1QASA 1AA1B 4G6CA 2VFFA 4X22A 1X6LA 3BGAA 2EHHA 1EZ2A 4UNIA 1B3OA 4IMGA 1MUWA 1YDNA 1TG7A 3KE0A 3AHXA 1YTEA 2BY1A 3SAZA 1UWIA 1VB9A 2FTYA 4LGXA 1MZHA 2V67A 4EPEC 2C19A 3UYCA 4DVOA 1SR0A 2XUCA 3KFTA 3R13A 4DXKA 3NDZA 4BF9A 3TC3A 1U1JA 3S6TA 4ACYA 2E9MA 3H2CA 1ICSA 3LMZA 4JN6A 4O1FA 2ISVA 3PG8A 1CGWA 1H4PA 4MUZA 1MO0A 5JU6A 3PJWA 5DN1A 2NWRA 3AROA 4KWWA 3RF9A 1AJ0A 1BYAA 3N2TA 2AOSA 3OHIA 1GG1A 4BJHA 2Y24A 5HNNA 5JH1A 2CBUA 4LV4A 3L7RA 4N4QA 4IX2A 3BO9A 3LPPA 3CQJA 4HYVA 1CX9A 2NUWA 3WLJA 5CZ0A 1TR9A 1LBFA 1D8CA 1GHRA 3LI0A 1F3XA 1CEOA 4C5ZA 5E9AA 3GIPA 4Z2GA 1Q85A 1EC9A 3VFCA 1E9ZB 3WG6A 3INPA 1WDRA 2FQIA 5D8WA 1UMLA 2TSYA 4CQ9A 1W1IE 2JKEA 3BH4A 4XD4A 4Q32A 1PIFA 2PFHA 3OYZA 3VD5A 1FXPA 5EFFA 4UQBA 3UR5A 4AD2A 1KWGA 3IJ6A 4H7CA 3K8LA 3O6DA 3WELA 3G1HA 1XIGA 4AZIA 4KW2A 4FSAA 4QDWA 3TA9A 1HX0A 3LU2A 4AMAA 1N2VA 3KVJA 4GIYA 5G1TA 3PK7A 4F9JA 3MI6A 2DSUA 1SO4A 3PANA 1P6CA 1JFXA 3VD3A 2FGLA 3U2EA 1F8IA 4QLLA 1M04A 3LQLA 2FZBA 4GNJA 3UXKA 1U2YA 4LYPA 3AALA 2VEPA 4GMEA 3FXGA 3FSTA 3HJZA 2XVNA 3M0ZA 3TQPA 3WENA 1PKMA 3BURA 3E5PA 4R27A 2FTPA 2RGMA 4ZB5A 3GFXA 3U3HA 3NPXA 5C0QA 1G4TA 4NL1A 2VR2A 4O8AA 2G41A 4LAKA 2IQ0A 3CPUA 2ALDA 4UXDA 3VKKA 1F9CA 4GI9A 5A5WA 2EG6A 2YYTA 3R12A 3A5VA 5C7VA 3DERA 4XTDA 4B5TA 4L9XA 5HMDA 4HQVA 3UWYA 3RM9A 2AAAA 3KVKA 3RDKA 2G0WA 1WOAA 2ZOXA 4ZTYA 4O52A 4NNAA 1FWAC 1JNDA 1ZP3A 4OV9A 2ZFAA 3UWQA 1S46A 3PZTA 2WJDA 1H1ZA 4JTIA 4GISA 4W88A 4JS3A 4K1GA 3CS2A 3S2MA 2OOGA 3ARTA 3KXQA 3AHTA 3WF0A 4PMYA 3W7OA 4WGHA 3P81A 1AD4A 5D03A 4M24A 3WBEA 3ONCA 4YVPA 4Z08A 4Z42C 2I9UA 4ROPA 1HNYA 4GUFA 3V16A 1PDZA 1GPWA 2PDKA 4JTRA 4O19A 3W02A 4RL3A 2PDHA 1F7BA 3G0UA 2DEPA 4ZXOA 1V6VA 2PRHA 4UC5A 2PGWA 3L4UA 1EGZA 2FPYA 3LHUA 4S3AA 2HNEA 1KCXA 3BSHA 3H54A 1ZHAA 1MXDA 1C93A 1UUMA 3A9BA 1M53A 4B2DD 3B0YA 4WXYA 4K3ZA 4DJFA 2NW0A 2PDMA 1RV8A 7PTDA 5TD4A 1VS1A 3G1VA 3CYVA 3WDIA 4OFCA 3I4EA 3DOPA 5BU6A 3MP5A 2OGJA 2WVTA 1C91A 1TPVA 4MKVA 4M5PA 2D24A 2J74A 3BAKA 4J28A 3VDAA 3BGJA 4HKPA 5C9XA 1XLJA 1JFHA 1M41A 3TMLA 1H7WA 4U5KA 2ZZ7A 3VYLA 1KFKA 3CHEA 3FJ4A 2Z7KA 3PNZA 3OP2A 1RBLA 2P0OA 2OQYA 1XL9A 1VYPX 3TQVA 2NQ5A 4CEXC 5JIPA 1O5RA 1RP8A 4IMDA 5C5YA 3WD2A 5LKYA 1HF6A 3U5UA 2G4JA 3OIXA 3TYBA 3U4FA 3UGRA 4RV8A 1MQPA 2GSHA 1LRNA 3MCNA 4M81A 1UHVA 4I7UA 3AFBA 4HZ6A 2BNJA 4AF0A 1DYSA 4NAEA 3HQNA 3LD5A 4XBSA 5HWNA 3PPGA 4UNLA 3W2NA 4Y90A 3W37A 3W74A 1WXYA 4DBUA 5CC3A 4AFYA 2OELA 3M0YA 3TK7A 3PZOA 3WH8A 3ZS4A 3QMTA 1N7KA 3ES7A 1O4UA 5KSWA 5C54A 1EJVC 3L9CA 4W93A 2O0TA 2Y8UA 1OFAA 1W1PA 2VC6A 5D02A 5LA2A 1F61A 3SDOA 3CPRA 3ZLHA 4W4QA 3W7DA 2R1KA 2PGFA 3LERA 2O92A 3N9SA 4WJ8A 2P8BA 4JR5A 3P82A 5FJPA 4B90A 2VZVA 3STEA 1PX3A 2QJMA 3PZQA 4Y9OA 5M03A 2POTA 4MWAC 3ARZA 3B8TA 1EHNA 4DEFA 1UD5A 1KGXA 3W4RA 3ECQA 1GOWA 3NA8A 4BEUA 2ZUVA 2ABAA 1POKA 1KTNA 3NXFA 3OGSA 4RJEA 3FSUA 4RZ5A 3HN3A 1BWLA 4EAYA 4CNPA 2NUYA 1M68A 4GYFA 3U5YA 2VX6A 3VUPA 5L9FA 2F61A 1S2VA 3QEZA 4L9YA 1OYAA 4O12A 1ZTVA 3KUMA 1SJBA 1K6AA 3V0SA 3S46A 5I06A 3RO8A 4DRSA 4WY0F 3QF0A 1MW3A 4N2YA 1OCBA 3QC3A 5HOSA 2JF6A 4JQ3A 3KVLA 3U2ZA 2V63A 3D46A 4XZ9A 1H61A 3ITTA 3U6WA 3UZZA 4HA3A 3WLLA 1SPQA 4GVFA 2VX7A 2YB4A 3RXZA 1W5MA 3TXVA 4DXVA 2QEZA 1FWEC 1TTIA 5C9ZA 4UTWA 1AQ0A 2GJXA 1FP9A 2GJLA 1LBLA 4NVTA 3M0LA 4XSLA 1GKPA 3M64A 5HANA 1A53A 3QW4B 7A3HA 1NEYA 1TE1A 3H2NA 1JQVA 1QWKA 1X98A 1WKDA 1DIOA 4H19A 4JTFA 1GZJA 3W84A 4DWSD 3EOSA 4JTDA 3FA3A 1XRFA 1UD4A 4IL0A 1PJ9A 3PPCA 1E56A 5I03A 1TWZA 2FJUB 2ZXBA 2JKPA 1IZCA 1XQKA 2J7EA 1SMDA 3DBNA 4CUCA 3LV6A 3ZVHA 3MO4A 1R6WA 1Y65A 1FHUA 1FHDA 4O0KA 4B91A 2XWDA 4XK2A 3L5AA 3MSGA 2W67A 3E0WA 2DZAA 1ZQ5A 1RQEA 1TJ0A 3MUCA 3ARVA 5FA5A 2XHYA 1ZBKA 1SJDA 4QE4A 1ISYA 4IPPA 3O3RA 1OX4A 5LIYX 1IF2A 3O0FA 3ICJA 4XZWA 6XIAA 2ACRA 3T8QA 5XIMA 1E6PA 2RJHA 4AC1X 4GVHA 3MVIA 4AY8A 3H4WA 1FH9A 3QR0A 1S5TA 4MPKA 3BAXA 3B4YA 2H3BA 2VX5A 4HK7A 1BRLB 4TVCA 1QW7A 4TMBA 1LUCB 4GUIA 3TH6A 2AQVA 1E0VA 1XP3A 3FK4A 1OIFA 3WNOA 3K2GA 1E70M 3G1SA 3H22A 3URBA 4LV9A 5JUVA 5CJ5A 1EYEA 4PB5A 4AWTA 1FHLA 4PMVA 4DZ5A 3MZNA 2VFGA 2ZC8A 4L6DA 4E4PA 2OZTA 2VXNA 3VE9A 1THFD 3M07A 3AIQA 4GD0A 3N12A 4OUEA 3UZWA 1C8YA 3UG3A 3DZ1A 3TMQA 2B7QA 1OC5A 3KOXA 4UIOA 7REQB 5KTLA 2Y89A 5FEXA 4JX6A 3DFYA 1WAUA 4ORMA 5KITA 4LJ3A 4IG2A 1A50A 2OZ3A 3DGRA 4ZOAA 4MYAA 3MSDA 4N42A 2PTWA 4I9TA 3TR9A 3VOHA 1NIUA 3S5SA 2QIIA 1ADOA 5DELA 1JNEA 3VIOA 1UP3A 2BXYA 4L4MA 1PX8A 2DDXA 3NQAA 3KOYA 1CLKA 1CBGA 1BEUA 3SRFA 3G0XA 3NQVA 3UA3A 2OTDA 3K4DA 3IANA 1XUZA 3K4WA 3L2LA 4HNCA 3KAOA 4H7VA 1W9VA 3EOOA 3S1WA 1PV8A 1XD1A 2HXUA 4ADUA 4Q8QA 1E15A 3S3GA 1CCWB 1HZYA 2CKSA 2R9RA 3DU0A 5LNUA 2VFHA 3PJXA 3TOYA 3VU2A 1EOMA 1EUNA 3BQ6A 3WLIA 3E1F1 2GGIA 5AECA 1ITXA 3BW4A 4U10A 2A85A 1W17A 5DQPA 1Z6KA 3W2UA 2FMOA 5B7ZA 1K02A 2O9PA 1ALDA 3MANA 3N4EA 3TV8A 4GVIA 5H8UA 1MNSA 3F7JA 4Q6XA 3VPLA 1UWTA 4OIFA 5FF0A 3FAWA 2WM0A 4ALDA 3IARA 4EWJA 3ZR6A 4AUBA 1XSIA 4MNLA 4Y2WA 1DJNA 1VF8A 4M29A 1H0GA 1J0IA 2ZUSA 1V51A 4CLMA 3QZEA 3WMSA 4V1YA 1ADDA 3AI0A 1GEHA 3A6OA 5GPRA 2QR6A 4OUIA 4GJ1A 4C6NA 1RA0A 3BG3A 1GJPA 3D3AA 3AHZA 3KRBA 1YQ2A 1P0DA 3W1NA 2HVNA 4GXPA 2Z1KA 4U4MA 1K7EA 5LIWX 1K4HA 2DPEA 3HGOA 4IJRA 3TSMA 3EDJA 3AXIA 1V3LA 4Z1BA 4LUYA 1W3LA 3I3BA 1B3WA 2YX0A 4DM1A 1T96A 3L68A 1BG4A 1XRTA 3T42A 3NYZA 3ARXA 4J9JA 5C9UA 4I7VA 1Z48A 2XIBA 4REQB 4RR4A 4TUFA 2WCGA 1KM6A 2CHNA 1OFRA 1QNQA 4XAGA 4AAJA 3SURA 1Z44A 4RUBA 2ZX7A 4QAWA 3QVQA 2OWXA 3IJ7A 3T40A 2YA0A 2XVKA 4XISA 4ERAA 4ZE4A 3WQ5A 4F40A 1J96A 4KRZA 1IEXA 3WBXA 2HS6A 5A3HA 3VO0A 3C3NA 3W01A 1WA3A 3H7VA 4LBUA 1B3YA 4DELA 2A3AA 4MIMA 5CXPA 3K1GA 3VZXA 1WKYA 3A3XA 5JIWA 2CLHA 4GY0A 3N6QA 2HBVA 3A9IA 1F3WA 4P7QA 3Q45A 4Q4KA 1Q4WA 3BLOA 5IXEA 1HJXA 1IR2A 4W7WA 2ZTKA 3LBMA 3A21A 5E9XA 3NTYA 3V1HA 3H2FA 4QLKA 3VD4A 3NZRA 1DHKA 1CDGA 1BGGA 1FVPA 3S47A 2PP0A 3T2PA 1UH2A 4KEUA 3IEBA 2XGIA 1RY8A 1H41A 3D6NA 3FW6A 3PG9A 3ZJ6A 3JVAA 2I57A 3LNPA 3EWWA 1GJUA 1I45A 2V3GA 3BZGA 5BXRA 1E72M 4JIIX 2NT0A 4NNBA 2GUYA 3AIWA 1QOXA 3GU2A 4LS1A 1V6XA 5AYBA 5REQB 2ZE3A 1J6OA 4GPNA 1CZ1A 1OK4A 1BG9A 5D30A 1ONWA 1A5CA 2WHMA 3T4WA 3OVPA 3I7SA 4H83A 1BHGA 4QDMA 5DANA 2W4XA 4MNMA 4UFLA 4AXKA 1TPH1 1IE7C 1E5NA 2EKCA 4XZNX 2OSWA 1JCXA 3PFMA 2QPUA 1V02E 5FSEC 1M01A 3C2VA 1WKEA 1CXLA 1BTMA 1I6NA 3L66A 3BCDA 1PBGA 4W5ZA 3GH4A 4JCMA 3T44A 3MUXA 2XM1A 2E9BA 1EPVA 1WBJA 2C14A 3QQ1A 1TMQA 1GOXA 1F5ZA 1QNRA 4Q8PA 4B3KA 3NL6A 4OU1A 3CWNA 3MBDA 1GTEA 2E77A 2GOKA 4Q8VA 4ILSA 1LLWA 3OA3A 2PWDA 1HJUA 2DIKA 3FYOA 4NAFB 2OG9A 3VGEA 1JCYA 1YBQA 3LCIA 3UYIA 2GPTA 4TIMA 1UD8A 3STGA 4DF1A 2WVUA 4US5D 3WUFA 2PDGA 2VM8A 3IIVA 2IS7A 2X0YA 1BAGA 3CV6A 3NM3A 5CZTA 3A23A 4MFDA 3OVQA 5I3DA 1GVOA 2GDUA 4ICNA 4GACA 3CEPA 2WWCA 3KOZA 4AVFA 2QYGA 5C7HA 3LUTA 4W8BA 2HSAA 2X16A 2VR4A 1GQKA 4C6OA 3W82A 2E09A 2J47A 3NZGA 3W00A 2HCVA 1CLVA 2XIOA 3EWCA 4QQ3A 3MHFA 1ZRQA 2ONEA 4AXNA 4LB4A 1F8MA 1AQFA 2X05A 2G3MA 1KFBA 4LVAA 1GQJA 2A1YA 4I5UA 2OYMA 1JG9A 1OFOA 4IUOA 2G96A 3DAQA 4W8LA 4AIUA 3LLDA 1VJZA 3RO6A 3OZPA 3T8LA 4IJCA 4DJED 1H51A 4HTBA 4UFJA 4YIWA 5FJRA 4WDTA 3T81A 3ABQA 4X2RA 1KR0A 2REQB 1LL6A 4EF9A 3E38A 1EWEA 3ZJ7A 2VWTA 2Z26A 3CQ0A 1UZDA 4XZIA 3MY9A 4Q6JA 2Z2UA 1UJQA 2Z2AA 3T0CA 2OX1A 1US0A 3GIQA 4S2CA 5G4EA 4PEKA 4NXSA 2Z25A 2AL2A 3K4AA 3SCSA 1NDWA 2Y5EA 5AHIA 4IQDA 1XIHA 1VEOA 3GVRA 1YIXA 3KOFA 1IEWA 5EGRA 2PWGA 4J3TA 4NJGA 3TA6A 4D8LA 4I7WA 2EO7A 4QS6A 4XV0A 4MDOA 3GNXA 1LWIA 4FK9A 1UH4A 1F4AA 4ZMGA 1XG4A 1X6NA 3IGSA 1K8XA 3B06A 5HWJA 4Z1AA 3BAYA 1J9YA 1JXKA 3W22A 2VCCA 2B4GA 3VGGA 1S1RA 3VI2A 3JUGA 3DFTA 3UXIA 5D05A 2IQDA 4HHMA 4BY3A 1PZ1A 2HROA 4GQ0A 4JTLA 1LRTA 2FB2A 2ICSA 2EF9A 3OOQA 4GY7A 2NVCA 1CI1A 2O7QA 2QVNA 3WDHA 1IT7A 1R9ZA 3RHGA 4Q4OA 2QHAA 2ISWA 1WAWA 2CCRA 1FWWA 1QBBA 4AYSA 3VIMA 5REQA 2Y7FA 2D20A 3AMCA 3GXTA 1HG3A 4B5SA 5FSDC 2WBGA 1UZHA 3CLWA 3SRHA 1ENUA 1XDJA 5A6MA 1J0HA 3TLLA 1LJYA 2NSOA 1HL9A 1M5WA 2ZZ2A 1R46A 4W84A 2E1DA 4LUSB 5AB3A 3NDYA 1EZWA 1E6NA 3L67A 1PL9A 5AC8A 3DIPA 4XQ6A 1I0BA 2ZDRA 5CBBA 1ONEA 1QI4A 5KEZA 4HU0A 4PN2A 1E4IA 2WWDA 3LXCA 4D1JA 1OD0A 2C1GA 3R94A 3UPBA 4L5ZA 1MMFA 3IGXA 3JR2A 3VE7A 4GQBA 4AZBA 1DTNA 2HISA 4IL2A 3TYUA 1ME9A 1IT8A 3FA4A 3AS3A 5JBEA 3ALFA 3RIKA 3R11A 2VCAA 2GL5A 4S23A 5K4XA 2PCQA 4M56A 2GK1B 2YXOA 3GFZA 1DXIA 1W8SA 1VKFA 1S5NA 2HBXA 5K9XA 1F6YA 3EEZA 1SFLA 1ZJHA 3O63A 4UFKA 3PZ9A 3LMYA 2KX9A 4H01A 2W0UA 3LHWA 4X63A 2XJ7A 4MYXA 2DZUA 1EP1A 2GSEA 2QZRA 3NNTA 2WCAA 3MDUA 1YEYA 4NZCA 1F3TA 1OCQA 2HK1A 4LVDA 2J66A 2Y7GA 2WSRA 2IW0A 1FRBA 3D5HA 1LOLA 3GG1A 3WQCA 4DO5A 4V1XA 4M8UA 3E6EA 4Z1DA 1NM9A 3TUUA 5J8LA 3GRIA 1LQ2A 1UD6A 1R87A 5LHEA 2CFFA 1SZRA 1ZBWA 4E8GA 3LBCA 4DF0A 3RILA 3FXYA 1JAEA 3HFYA 4M7TA 3EOLA 1VPXA 1KXVA 1Z42A 2XH4A 1E6QM 4GUGA 1Q6LA 1RCQA 1MEIA 5AYXA 3BPWA 4Y9PA 4C6QA 4INFA 1PVNA 5D32A 3CUZA 5AZ1A 1XJBA 2WM1A 5GJMA 3EWBX 1ME7A 5FAJA 3LTPA 2VFEA 2BTMA 3K1DA 2AQWA 4CVWA 2ZRWA 4ZO8A 1H5YA 3HPXA 3EKLA 3OYXA 1ODZA 3URQA 1UYQA 2FDSA 3B04A 2QDDA 5LIKX 3KLLA 4PTNA 4PSPA 3WNKA 4Z2KA 4V27A 3CQKA 5HATA 2Q01A 3BOXA 1QMLA 1T7LA 4PCTA 3QV8A 1C7SA 4RZ6A 4IPNB 3ITLA 4CN1A 1QO2A 4GCAA 1EDQA 3QBUA 3M6DA 4IT1A 4KWVA 3KWXA 4C60A 1JYVA 1GYMA 2XIQA 3VK5A 2E68A 1UQYA 4YTUA 1CIUA 3GTHA 4DBEA 3GC2A 1XLIA 1OCNA 3IIZA 4XX6A 3WF1A 3SCVA 3CQHA 1QVBA 1TZ7A 3KHDA 2OFJA 3GXIA 3GTNA 3EDEA 1DIEA 4NZFA 5IOBA 5AHMA 4P5UA 5KETA 1Z9AA 4HNUA 5ABTA 4ZOBA 1EDGA 1JPIA 1OFBA 1HKVA 4JKLA 3CMGA 3UVAA 2EQDA 5BZAA 3UA4A 1JQXA 3W1TA 1VCGA 1E55A 5KZEA 4LX4A 2GOUA 3A12A 3C8NA 1S5VA 3FFSA 4JY9A 3I68A 4V2XA 3MCMA 4B9YA 4HPNA 4HA4A 5AVHA 2FIQA 2W9MA 4IMAA 4A4AA 4H2CA 4ML4A 2BHZA 1I1XA 3F4VA 3N2BA 1XLCA 1W1VA 5EMUA 1RH9A 4DF2A 2YA1A 4ZCWA 4PH6A 4ML9A 1KKRA 4D1IA 4JTJA 1R3WA 4YWSA 5AC6A 2BASA 3N4FA 4DXXA 1BQCA 5F2IA 3P74A 1EF3A 3B8DA 3MQTA 1KLYA 3MDWA 1BYCA 1AVAA 5FF4A 3FA5A 5AZ0A 1DWJM 1XIJA 3B97A 5FJTA 1J5TA 4LAZA 1ISZA 1R30A 3L2MA 3UNTA 1SW0A 2XFWA 4LANA 4O17A 3W72A 1LF1A 4N4PA 4Q4PA 4XB3A 4GCXA 1E3ZA 3QC0A 3IGUA 4EF8A 1VEPA 3SCPA 1SW3A 3PVFA 3WF2A 3S5ZA 1WZLA 3W7RA 4Z0SA 3T09A 4DAFA 5HQMA 3P3BA 3PC0A 1WP6A 4ADTA 5I02A 2X7WA 3VOGA 3W87A 1TRDA 1RPKA 2RDWA 3W2KA 3IJ9A 4RE0A 5G1MA 1EIXA 4EIVA 4JIEA 2VP8A 4Q33A 3V0TA 2PZ0A 5E5CA 1TPUA 2ANUA 4AZ6A 4QCFA 5FAGA 2A7NA 3EPOA 3NPUA 3BV4A 3TYDA 1V6YA 1VBUA 1VCFA 3LY0A 2ZX5A 1HL8A 3E0VA 1L6SA 2ATMA 4HD5A 3S1XA 3EBVA 3U7BA 1E0TA 3FOKA 3TNBA 4PL2A 2BDQA 4JIQA 1RZMA 5CPMA 4JNZA 3N17A 1SQ7A 3OVRA 5A8GA 3W70A 2RDXA 4XIMA 5DBUA 3RX3A 3W71A 1XICA 2C79A 1CGYA 3WSUA 2C16A 3MV11 3M9YA 1LZOA 1D9EA 1UP2A 3WBYA 4EAMA 3UU0A 1SO5A 3MMUA 1FCVA 2BBFA 3H21A 1EO5A 2VGIA 3GVGA 1H3GA 4GYPC 2YKKA 2PDPA 4BQ3A 3TJ4A 3P7YA 5H6HA 3POCA 3V35A 1XLLA 3RPTA 1WDWA 4GUHA 3GBDA 4HPHA 3P6LA 4GKLA 3N6JA 2IQTA 2PRLA 4JNYA 4JIPA 2B0MA 1QOPA 4KEZA 1HKKA 2EKGA 5FL1A 1E1CA 4EPDC 3C3UA 4GY1A 3LCFA 1OIMA 3TEVA 2Y1HA 4JGDA 4DYEA 3ARPA 3TSDA 3W88A 1TWSA 2ZRUA 4MUPA 3F5JA 4BKNA 1NP0A 4Z0JA 1CWYA 2Z1BA 4NI3A 2GVEA 2QCDB 2VGFA 3C8FA 4IIBA 2XSXA 4NAEB 1JDFA 3UY7A 1JRCA 3B40A 4O1AA 3VDCA 3PBUA 2VEFA 1W6TA 1W9UA 1SM9A 2ASHA 4E3VA 4IH3A 2W79A 2WPGA 1GONA 3WNMA 5G1YA 1XIDA 3C52A 1RA5A 3P61A 4IP4A 2CC0A 1YX1A 3GHRA 1GJWA 3F4NA 3G77A 2WBKA 3H2MA 4WDXA 1UB3A 2ZZ1A 2BOEX 1ISXA 4UQEA 2XVPA 4A05A 2Y70A 2MUCA 2X1IA 2OZ0A 3NGJA 3IK4A 5CQ1A 1A5UA 1DBTA 3R79A 4GO9A 2X2GA 4IFKB 1Q7QA 2E6AA 5GNZA 1MQQA 2Q3OA 2EXOA 1V0LA 3WQVA 5G2IA 3KL0A 1A49A 1O5KA 1ADSA 4UTMA 3PWIA 4ONVA 4KFNA 3O06A 4DYJA 1O94A 2D73A 3REQB 4LOCA 5IDZA 1DORA 1YW1A 3PNUA 1W37A 5AN7A 1I2NA 1DQWA 5CGQA 3RGTA 1FDJA 1KNWA 2YFOA 4G8TA 4M6UA 4NJIA 3BMVA 3FEQA 4BS0A 4LRSA 1ZJBA 4HSHA 3AZTA 5K4ZA 3EKZA 2XFYA 2PWHA 4M3PA 1TKKA 2WMJA 4HCHA 1Q5MA 2OKTA 2Z6IA 1E6ZA 2WV8A 1V93A 3GUGA 4RDYA 1TV4A 1XLFA 6ALDA 1UIOA 3ZJ8A 1DPMA 2W66A 3WH7A 4H9XA 3ZQ9A 4CNOA 1XIFA 2ZYFA 4R5EA 3H53A 4K39A 1G4SA 2NWSA 2Y0FA 2I16A 4N02A 3WLOA 1QI0A 3EDKA 1UKQA 1AK5A 2RH9A 4GOAA 2L5HA 4DB7A 3VOCA 3ES8A 5A6LA 1XLGA 2XGBA 3A3HA 1XF0A 3BE7A 5I6SA 3PB2A 3PZUA 3W1PA 3WD3A 1P48A 3Q65A 1QNVA 3ABSA 2CLEA 4EXQA 4LF1A 3M41A 5FI8A 3ZOAA 4LUTB 4CU6A 3BTNA 1T99A 1VIWA 2QNEA 3HGSA 2XVGA 4ZTXA 4K8EA 2BOGX 2FZ9A 3H2EA 3OU8A 3SRKA 2PEVA 4V33A 3WMBA 4M7SA 5B80A 3LCGA 4FALA 4WIWA 4UQCA 4UOQA 4RKAA 4L64A 2G3FA 4AQLA 4JPGA 1LLOA 4NP7A 2RAGA 3U2OA 1BYBA 3QGVA 3LTYA 1MQRA 3ITXA 1KBIA 1XINA 3W7PA 1PHWA 3ZT7A 1HJWA 3T0TA 3HQ1A 1QI3A 3NEVA 1LQ0A 3F03K 5MKGB 3B8UA 4WUIA 3AWNA 4JQ2A 1DJYA 3KW3A 1QI5A 9XIAA 3HO8A 2X8RA 3OLDA 3WD1A 1QTWA 1EL3A 4YYFA 3ATYA 4AZ7A 1VIZA 5CGTA 1IT0A 2XH7A 2I5GA 3V5CA 3WQ8A 5BW6A 3MUIA 5I3FA 3QV6A 3NZQA 3AMGA 3BG9A 1XUUA 3VC5A 3MKKA 2WC7A 1RD5A 2ZZ5A 1EPXA 2AKZA 1LL7A 4AG0A 3QLDA 1SO3A 3UR8A 1WDPA 2WHLA 4HTYA 4HSOA 2F38A 2NQHA 1KM5A 3MMDA 1QWGA 2R8WA 3NG3A 5D9OA 2DSWA 3N29A 3QQ0A 1B0IA 2BZNA 4W89A 3THAA 2OO0A 1K7XA 3UP8A 2WJZA 1QJWA 3A4XA 2YZ5A 3OQ8A 3EX2A 1W91A 3N18A 4L4PA 2C1HA 3QR1A 3W81A 4DPQA 4Z1CA 3A4JA 1GKRA 1GUVA 4UQ9A 3SIMA 1KCZA 4CD5A 5EY5A 1XKYA 5AOUA 4EANA 1YNQA 3CGTA 4GABA 5LNVA 1YTKA 3LHVA 1TTJA 5U7SA 2JF7A 2G4FA 2CLFA 3OODA 4GNVA 4GA8A 4KRUA 5AHLA 1CB7B 4C6JA 4XO6A 4IP5A 4AZGA 4KCWA 1ZENA 5FIPA 3TONA 4PUKA 3GNOA 2Z2BA 2V38A 2V5DA 1XWYA 3P0WA 2D3NA 4KF1A 4KFOA 2ZXAA 3IIPA 3GW0A 1I2RA 2WZMA 3EOEA 3W2MA 3GZ3A 3L23A 1VAHA 2G5WA 1JAKA 3MJYA 3RNDA 4B5VA 2HZGA 3LM7A 4DLMA 1DKWA 3R89A 4U3CA 3XISA 1SFTA 3N14A 1EYWA 2F9RA 1AL8A 1K7FA 2QUMA 1XFCA 4W5UA 1FDZA 3IACA 3NSMA 3CAWA 4UMBA 3SSJA 3M7SA 2UY5A 4TR9A 1FWHC 2JE8A 4CU8A 4JQAA 5JH2A 3O05A 4RNJA 4TV6A 3VIKA 5A2AA 1V4YA 2Z29A 4DJEA 1EJTC 2O55A 3I3DA 2FZDA 5M3WA 3RU8X 1EJUC 3GNPA 3A13A 4LUSA 4R34A 4P7LA 2BSLA 1KBKA 1QUMA 4IUGA 3EB3A 2PBOA 3GY1A 2Q3RA 3C0JA 1JD7A 2QIWA 3M4HA 2CBVA 3SCRA 3WD4A 2J7BA 3S42A 2WMGA 1G9HA 5LYRA 5ABHA 2P0IA 2VENA 3E3HA 1MDLA 1UBSA 2IXVA 1OX6A 5HPCA 2QUUA 2C0HA 1E51A 1CT5A 1DOSA 1JZ8A 4J3SA 1GVYA 2NX1A 3W26A 3ENLA 3NO5A 2VMFA 3KBVA 3M43A 5CSUA 3NFUA 3AUOA 4UTLA 3M7WA 3RLVA 4Q4QA 1TJRA 4FI4A 5CPOA 3VMNA 4E4FA 2ZWZA 2I14A 2ABBA 2MANA 2ATSA 2QDEA 4WY0A 2GFTA 3NO1A 1K03A 1NOFA 4AHQA 4OBSA 1N8WA 2V5CA 1SMAA 1V08A 4UUIA 1Z8AA 3LSCA 4KFPA 4PRWA 3DHPA 4QNWA 4DI9A 1UC4A 1K9FA 1UWUA 2NQJA 4EACA 1GOQA 4S3EA 1ZFJA 5MKGA 2YBUA 3BMWA 3WUEA 4C6DA 3FDKA 2DT0A 4NX0A 2DUZA 1I2QA 1RLCL 4L1XA 4OZOA 4R7OA 5C55A 2RKXA 1ZCOA 3S5NA 3BLEA 1H0IA 4U5IA 4D6CA 4N9CA 4UR8A 2VJXA 1GGOA 5C2GA 1W9PA 4AZ5A 4PGLA 5CBIA 4ICMA 2EG8A 3G6LA 4BA0A 4M19A 3BUVA 4R7WA 3V4BA 1E0WA 1NDVA 4IQEA 3BLKA 3R2GA 1TV5A 4LUTA 4A8LA 5LXXA 1N8IA 1XBVA 4S1FA 2PGEA 4GFIA 2C8NA 3G8EA 7TIMA 5E0FA 2Q6ZA 1OC6A 4IGSA 2HNHA 2R1NA 2PLKA 2QJIA 2E5DA 3SCQA 1UG6A 2DZWA 3EYPA 4OECA 2PU1A 4ORIA 4LUJA 1OG6A 2FTWA 4AIOA 2E8YA 3FS2A 4GGBA 3W6YA 3P60A 1P5BA 2V8ZA 3RM8A 4GZJA 3LV5A 5HUOA 1KFEA 3L4VA 4HU3A 4OBTA 3HGJA 2QF7A 3CT2A 3EXSA 4MLJA 3WD0A 4RLIA 2XYLA 2Z0IA 1B4KA 4O1BA 3L5LA 3T2QA 2VDGA 5C2XA 1H1YA 4UQAA 1FCBA 4U2ZA 1UR2A 4FA3A 2BLEA 2F84A 4MAZA 1FUYA 4HB7A 3VIJA 1JZ2A 4QJ5B 2OPJA 1NDZA 1F6PA 1R3QA 1N8FA 4O53A 4UFIA 5PTDA 1O5XA 4TX6A 1RP9A 2WC3A 3WLKX 4D6GA 3PZIA 9RUBA 1NOUA 1JYNA 4MMWA 1OT1A 1QR7A 4HU4A 2JGYA 2KZHA 1VYSX 1WO2A 3ITGA 2E6FA 4EP8C 1J18A 3SM0A 2Q09A 3VOFA 4NG3A 4LC6A 3WFAA 5D4YA 1B57A 1P7TB 4A3UA 1R38A 2DIJA 4Q7IA 1JZ5A 4ZGYA 4YCOA 5CPNA 4JTGA 5DXYA 3AICA 3W7EA 2J13A 3UEQA 1UOKA 2ZICA 3UT0A 4QLJA 1RVKA 3OVGA 1QHPA 1YBQB 3C2EA 1XIMA 2WOQA 2YOCA 4NAFA 3MA8A 6REQB 3PBVA 2IPJA 1A5AA 3GHSA 1D7KA 4K8HA 1JULA 2YIHA 5EBUA 4D8AA 4I9JA 4RNHA 1K8ZA 3L21A 1M7OA 4O4WA 3B8VA 1XYAA 3T0DA 2W6RA 4WXZA 1KC7A 4NI8A 5HR6A 1VFOA 1L6FA 3W2LA 1UPMB 2J24A 2CKRA 3CUFA 2OMAA 4N7QA 3V75A 1TPC1 4A2RA 3ISIX 3S9IA 4WRHA 1HFBA 2P1FA 1XLAA 1DV7A 1G94A 1L9WA 3EA2A 1JPDX 4AWUA 5G2WA 5DF0A 5LIXX 4C5YA 1RALA 3ZM8A 3KOWA 4U2YA 2O9RA 1XYFA 3N1AA 2Z00A 4NZ3A 2I9EA 3FVMA 5D2XA 1AD1A 5LNWA 4LT9A 2GGJA 3JW7A 3B8WA 1QPRA 4C6MA 3SY5A 1B5TA 3TZFA 4LS2A 4PUMA 5I24A 1V3IA 3S0CA 1V0MA 1DIKA 4A3YA 1LOQA 1TSIA 4CCDA 3M0JA 4JN7A 4MFEA 2NV1A 4J3UA 4CD8A 2OWWA 4M6QA 4JL2A 2BXVA 3L0KA 1B1YA 3AYRA 2V5KA 1EH9A 5HJXA 1FH7A 2QJHA 2PS2A 4S39A 1CNVA 4MZYA 3QY6A 3JS3A 1WQ5A 2D2OA 1AMKA 2WSKA 3LI1A 4ZXLA 4FLOA 3BXWA 5D2TA 1P7TA 3TYCA 2HEJA 3W7LA 2DVTA 3OLEA 3QPEA 3GM8A 2QJGA 2VZSA 2E3ZA 1Q13A 3AXMA 4X3ZA 3CIXA 5I2UA 1HGWA 4S3DA 3WLQA 2D22A 1W2PA 1M7XA 3B05A 3S8HA 5A94A 5J5DA 4IJBA 3QPYA 1XC4A 4IX0A 4NRRA 1EC7A 1RD6A 2FHBA 4UMCA 4ZB2A 1KTCA 3GC5A 3NO3A 1AH0A 3NGFA 4HJWA 1GQNA 5EKYA 3AIUA 1YXDA 4B9ZA 1Z7AA 3W7MA 3UPWA 3AMDA 3OGRA 1MZRA 1HKMA 2X1SA 1PWLA 2FB3A 3TFCA 1QNOA 4FO4A 3N15A 1MW1A 1PXGA 3OBAA 1JDEA 2ZZ3A 3NQ6A 8TIMA 4DUWA 4OOUA 4XTIA 2FYMA 4ZFMA 3L4TA 3P5YA 2V2CA 2E9LA 1T5AA 1YADA 4ZE5A 1EP3A 1GVQA 4H9VA 3NL3A 3S5YA 5DY2A 4S3FA 5GNXA 3UD6A 3SQSA 3STPA 1OABA 4A29A 2FVMA 1UC5A 5CSYA 4RDWA 3M0VA 3CHDA 2PC8A 1HVXA 2VOTA 4ECLA 3LB0A 4NHVA 1U83A 2Y5JA 3RCYA 3SW6A 2JK2A 1QT1A 2O56A 3FAXA 3MYOA 5I78A 1QXLA 3VNDA 4NU7A 3IPWA 3TX9A 3PUDA 2WZHA 2XSAA 3R43A 4IXXA 1OFDA 1S38A 2J75A 1KFJA 2UY2A 5FCZA 3TTSA 1NDYA 3WLHA 3AJ7A 1NWUA 1DTUA 4OHQA 4N9BA 3WDPP 3NJ3A 3CNYA 4K38A 1U33A 2QGHA 4MDPA 3GO2A 1SFSA 2VZOA 5F2LA 3CC1A 3ARUA 1S3TC 1LL4A 1OCJA 1YXCA 4WK9A 1EEPA 1HQTA 2BMBA 2WMIB 3GR8A 4QCEA 2UY3A 2PMQA 3WEOA 1KV8A 1TJ2A 5AC5A 1IWBA 1K8CA 3TTQA 4JYFA 4IISA 4JKMA 3GZAA 2P76A 1J11A 4D6DA 4G1NA 1TPEA 3UQNA 1HKIA 3UWUA 3VIHA 4NNCA 1K3UA 4IG2B 2NXGA 5LGXA 1Y5VA 3IJIA 4MWAE 5EMYA 3S1UA 3KHJA 5TF0A 4LEFA 5HK4A 1S2UA 3O16A 3E49A 4Q8MA 5CG0A 2J77A 4JTSA 4PSRA 3T05A 1TYGA 4NJKA 2FZ8A 3CV7A 3GB6A 3GDTA 1GQIA 1RJPA 2J88A 4C1LA 3E0IA 4UR9A 2RFGA 1SGJA 4YPJA 1X8FA 1R47A 4PCNA 3QFEA 3NR0A 1ITCA 2HV5A 3TOPA 4E6MA 4LTSA 1U5JA 3N73A 4FAMA 1OGBA 2YW4A 3UCDA 4F2UA 4MB3A 2GYIA 2CETA 2BGNE 4X0NA 3C2YA 4GFSA 1PS9A 3PZVA 4KPLA 4MTVA 3GG7A 5CJNA 3P5ZA 2WSQA 1EFZA 1W9XA 3ZLFA 2VC5A 4YL2A 4U33A 3EMCA 4DQWA 3OBKA 2A7PA 3XINA 3DUGA 3G22A 3BAIA 5HMEA 2D2GA 2A0NA 1YPIA 4XUGA 2QF8A 1H62A 4NF7A 2D1ZA 2GJNA 2TRSA 3HJEA 4O54A 5K9CA 3KTSA 2P3ZA 5AHNA 1A5OC 3C2OA 2F6KA 5A8PA 2UZ9A 4H6EA 5ABGA 2HS8A 2TAAA 5CPSA 3FDGA 4AISA 1DIDA 1XYMA 1M6JA 2C18A 1XS2A 4PMDA 3CHVA 5A8OA 2ACSA 3FIGA 1UPPA 2O9OA 1XD0A 4AY7A 2QUVA 1N82A 3T07A 1E0UA 4L7ZA 4Z1YA 2CESA 4XSMA 2ISSA 2GVYA 4HMDA 1V3JA 3ITCA 2PDUA 3UJEA 4F0KA 4KIRA 4ERIA 1HP5A 2AGTA 1HUVA 3ZMRA 5LGZA 2VCBA 3K13A 1MUCA 2WVVA 4BR1A 2QMKA 2GUUA 1BSLA 4BI5A 2WVVB 1RJRA 5FOOA 3TNOA 3Q4DA 1ESWA 1GHSA 1QPNA 3MHGA 2OGYA 3B03A 4CCEA 3WQFA 1A5NC 2OYKA 1DE5A 3HTWA 2XU2A 2ZX9A 2F6UA 4UFHA 4DIAA 3H8AA 2WO5A 3CIVA 5I79A 6PTDA 2J27A 1FTXA 1EUAA 3KTXA 1DWGM 2ALRA 1HJVA 4QEHA 1E9LA 1TR1A 4S3GA 6TIMA 1F4HA 1UWQA 4F79A 5CPQA 3RR1A 4F3HA 4I5XA 1KB3A 2PDIA 4O15A 1CGUA 3SEPA 2VR5A 1XCWA 4P8WA 1US3A 4XD5A 2E6YA 1XCXA 1G4PA 2C6QA 1LTDA 2E40A 2TPSA 2HE8A 1K4GA 3SN4A 3WNNA 1E6SM 3WYZA 5LA1A 1FA2A 1PYFA 1E1EA 2CHRA 3E0FA 1A3WA 5ENLA 1HP4A 2XGZA 2CHOA 5CC5A 1J5SA 1H7XA 3RPDA 3LHZA 4KWOA 2E4TA 2BY3A 3AQUA 4FR6A 2J8TA 4FX8A 4FOJA 3DKJA 3VFLA 1KRCC 5JVLA 3CWHA 3PZGA 4HOZA 4IPLA 4CVUA 5EB8A 3WDRA 3SO7A 3VZYA 4QE1A 1GOIA 1JDDA 4ZENA 3TE9A 1FX6A 3TAOA 3MP4A 3V18A 4QX4A 2V6AA 1AZ1A 2QV4A 2HRWA 2XN1A 1CECA 5BNKA 5HNUA 4FR1A 3B0UX 4JHOA 1TE6A 4YXGA 1VBGA 1YYAA 1AJ2A 4QEEA 4TQTA 4JDBA 2J62A 1H7PA 4F4RA 1NWTA 5D8ZA 3WN6A 3UG5A 3WK0A 1AUSL 3BOLA 1CXFA 4IOTA 3W1LA 3WQGA 5AVNA 1DJZA 1ZZMA 3GDKA 4LCSA 3D0CA 4WDWA 2Y61A 1DL3A 4ZSUA 4JAWA 3VIIA 2VQUA 1GOMA 3CAQA 3W25A 2JFEX 8A3HA 4E2DA 1ZBVA 3IS4A 4N9DA 2DY3A 1OJXA 2V9DA 4MNKA 4UMAA 2EPOA 4NJHA 3SN0A 2YCJA 2XIIA 1QPKA 1W1TA 3CUIA 3U57A 2QS8A 3MYPA 5FJIA 3AXHA 3VABA 1UUOA 1OK6A 4GH1A 1IR1A 2VGBA 4LALA 4LVGA 1XISA 2E0PA 3TW6A 3WNLA 4H8VA 4PL1A 3SCOA 1NJJA 2DSZA 1YTDA 2OLAA 4LRTA 2WNNA 3BG5A 5HQEA 2PC4A 3R6IA 4A3RA 4D6FA 2WNZA 1JZ7A 1ZL1A 2Z1SA 2OKOA 4GYJA 1I4NA 3JRKA 4DBWA 1MNZA 4HVXA 2Q8XA 1KGWA 1H7OA 3TYAA 1RAKA 3R8RA 3BGGA 1EJXC 2IUZA 3OQEA 5BMXA 3LCWA 1EQCA 5FJOA 3DYOA 3T0AA 1LBMA 4AIEA 2G3NA 3VNIA 1H7RA 2Y8VA 3KCJA 2W91A 4IFKA 3S6OA 3C5QA 3GDRA 1XBZA 4MAVA 2PDQA 2G3IA 1RR2A 2AMXA 4HN8A 3MTWA 4G5DA 4WKHA 4WVXA 4FF7A 3MP3A 4IQLA 4QTGA 3NSNA 3I7RA 1MFUA 2QCCA 2UV8G 1T8QA 3AU2A 2OO6A 1F05A 1TRIA 1E6RA 4MJ2A 1ZCCA 3PUOA 3ABZA 3GKAA 5C8BB 1FP8A 1W3IA 2BVTA 4JX4A 3GC4A 1MXGA 1KM3A 4LEQA 1XGDA 1TVPA 3WH5A 3K30A 2R6OA 4PCFA 4AH7A 2YFNA 2OCZA 4EXAA 3IWPA 1JVNA 1IWAA 2AAMA 3G1DA 5DXXA 2YCLB 5T26A 4RE4A 1WXZA 4IF2A 3N4AA 3PHAA 2WB5A 4LCRA 1LQAA 4UQDA 5TQLA 3WDJA 3SB0A 4GI8A 1UR1A 2ZA3A 5LIUX 5CC6A 5EL1A 1E1CB 1HN1A 3E74A 4XD3A 5C70A 2UY4A 3LSBA 4HYRA 1XLHA 3VA8A 3S4TA 2A3LA 1V7YA 4JFSA 3CT7A 3FNDA 1BVNP 3FV9A 1BXNA 3VKBA 3HPAA 1LYXA 1D2KA 1G0CA 5I23A 3S1GA 1R85A 2INEA 2PWVA 3QGKC 4RV3A 1ZPTA 3WUGA 3W9ZA 2PRMA 2E25A 3EPNA 4QXIA 3SCNA 3Q67A 1OYCA 4AY1A 3I65A 2Z7GA 3R25A 4DPPA 3FYYA 4D2JA 4IHCA 3DG6A 5FEWA 3W76A 3GXDA 1XR2A 1QW8A 3KZSA 3POHA 4Y6GA 2WPBA 5EMLA 5K7JA 3E2SA 1UASA 1DWFM 2YA2A 1V77A 4FOKA 3AOFA 1US2A 3QV7A 2G8ZA 3EPMA 2DH2A 2F7FA 3B9NA 4K2SA 1JD9A 3TDFA 4L61A 4PCSA 3A3WA 1KW1A 4IZGA 1YDOA 2J25A 2Q71A 3QOMA 5AKQA 1G4EA 3GG0A 1Z69A 1QK2A 1TWWA 3Q37A 1EHAA 3S83A 4ASTA 3G1YA 2A3CA 1Z3NA 3I10A 3H2OA 5CH9A 2ZRZA 1JGIA 1J0ZA 4R88A 4A8NA 3AU6A 4H4IA 2PDYA 1KFCA 1TPDA 5LXEA 1B9BA 1JI2A 2DJLA 1GZGA 1QI2A 2PLCA 3B0XA 3S6DA 4UNKA 3UZJA 3DC8A 2EJAA 2D2JA 5J5RA 4H00A 3WKZA 3LZ3A 3KBMA 1QO5A 1I8JA 4L4LA 3CQIA 2YCIX 4L65A 3OJGA 2WKGA 1QDSA 2X0SA 5AFDA 1UKTA 2J6XA 1KM1A 2WXDM 4RDVA 1FWTA 1TA3A 2CWXA 4JQ4A 4XD6A 4TX9A 1O66A 2WAGA 3UZYA 3BMXA 1Z32X 1JDCA 3NM1A 4J2PA 3U8GA 2Y7DA 4QNEA 3HG3A 3EA1A 4HCLA 3VNMA 5A6BA 4B5NA<