4JS3A

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with 057
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with 057
rcsb
source organism Homo sapiens
total genus 135
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4js3A00
3R2GA 4MLJA 4IWWA 1FWNA 3THAA 1SSGA 3S8HA 1S5WA 2CZ5A 3C52A 1FY6A 3EX6A 1GT8A 1TIMA 1QO5A 1Q6QA 2NUWA 2F7FA 3KHJA 3NXFA 3W07A 1QMLA 3UWWA 3TJXA 1W5MA 2QR6A 4WOQA 2G95A 3LI1A 4RLIA 3S9YA 3HG2A 4AHQA 3KVKA 5AOUA 2OCZA 4O57A 3E49A 3R5EA 1TPC1 4MUZA 3SY5A 2E6FA 1F2JA 2EGZA 4M19A 3P84A 4S2BA 3RF9A 4OE7A 1ICSA 3K30A 3NZRA 1OFRA 1JRCA 2X30A 3EX2A 4GRSA 3TAKA 1TB3A 3GDLA 2J9XA 4O4WA 1IIHA 1UUMA 3N14A 4NNAA 2P1FA 4HSOA 5K9DA 2A5HA 3WJSA 2Q3OA 2V5BA 1A5AA 3NGJA 1EEPA 3GXPA 4MPQA 3SZ8A 1F5ZA 4NJJA 4LWWA 3W7DA 1TSIA 2FPVA 4ZQNA 3VI2A 3W2NA 1WBHA 4WUIA 4ALDA 4XKYA 2E68A 2CLIA 4O14A 1ZENA 3AJXA 3E02A 1H63A 3MI6A 3UWUA 3W2UA 1GEQA 3MYPA 2QUVA 3PG8A 4UTKA 1G4SA 4LS0A 4JTEA 5TBOA 1FWWA 4GNJA 1N55A 2E1DA 1ICQA 3LRMA 3M16A 1JCNA 3TCEA 1FCVA 2B0MA 3TC7A 4O8RA 5DXYA 2C1HA 2E77A 1U5JA 3HPXA 3BPWA 4AB4A 1TRIA 1YADA 3TSDA 5EMUA 3G0XA 1G4EA 2YXGA 3IV3A 4LW7A 4JTJA 4JX6A 3W22A 4BI6A 1PVNA 2QCCA 1RD5A 3GX9A 2DZWA 4WQ6A 1TV7A 3LM7A 4PH6A 5I3KA 3P7YA 3CLMA 3P8JA 1QCWA 3IRDA 3LHUA 4A2RA 5CKSA 3MBFA 3QMSA 4A2SA 3N19B 4JY9A 3SSJA 3IVUA 1OK4A 2ZRZA 3GNDA 3ABRA 4AH7A 3W71A 3V75A 3TFCA 3KX6A 1A53A 3UY7A 4Z1CA 1GVRA 4JTIA 5EL1A 3W1MA 5FEZA 1MZHA 2GJLA 3B4UA 3CC1A 4A22A 2DZUA 1TTQA 3DENA 4POCA 2Q3RA 4CLMA 1TYGA 4AXKA 1W3TA 3M7WA 4OGZA 2E6AA 2X1SA 2Y7GA 3SFKA 2TSYA 3G8RA 1MSSA 3NOEA 1RVGA 2FIQA 3LCLA 1G69A 4PFMA 2JBMA 3EX3A 1YPIA 1F6KA 1P1XA 4WXYA 1KFCA 1EWEA 2VC6A 2QJGA 1KW1A 2V30A 4NX0A 4MY9A 1EPXA 2QAPA 1GVQA 1B9BA 3LXCA 3U2OA 5AHNA 1C29A 3L65A 1H7PA 5F1VA 2RHGA 2ISWA 2ZFAA 3P5YA 2H8ZA 2WNQA 5U7SA 2E6YA 2YW3A 2NZLA 4TX9A 2QCMA 1GVFA 1KLYA 4UFJA 5A8GA 3W9ZA 4YCOA 4IPJA 1H7RA 5DCBA 5D32A 4XZ9A 5IBXA 4YWIA 4N6FA 4O54A 3FJLA 1VYPX 3RNDA 1NAL1 3CPRA 2H3DA 3H54A 1G4PA 4MYXA 2IQTA 2A2IA 2JGQA 1HFBA 3EXSA 3NPXA 2YYTA 3UYCA 5KINA 1C8VA 1FWTA 3RLUA 3G1HA 1EX5A 2VELA 2C18A 1OX4A 3G1FA 1TPB1 5F4WA 3LTPA 2E5CA 1ZAIA 1JJKA 1DHPA 1OHLA 3LV5A 2CLMA 2GPTA 4LS1A 1TCDA 4ORMA 4MYAA 3RU6A 3NQCA 1AK5A 3HGSA 3LHYA 4JNMA 4IQLA 2RH9A 4ADSA 1JUEA 3CWOX 2HS6A 4LOCA 5DBUA 1CW2A 4Q32A 5LGXA 1KM0A 5CPMA 2Y63A 1W0MA 2QCLA 3MP4A 4XQ6A 4X22A 3S5NA 1JCJA 5K4ZA 4QQ3A 4Z0SA 1QOPA 2YCEA 3DFNA 4FX6M 3KXQA 4UTTC 5KTLA 2B7PA 2ZZ3A 4PA8A 1KFJA 4EVZA 4UFHA 3MBDA 1D3HA 3STCA 1SO4A 1FXQA 3AO0A 1L6YA 2J6XA 3B0UX 3HG3A 4E0CA 2EPHA 4O1BA 3LV6A 3GXTA 1KM5A 4Z1DA 3S5OA 3THQA 1R2RA 4UTMA 3QW3A 2QUTA 4AEOA 3TDFA 1L6SA 4LTSA 3P62A 3GNNA 3BO9A 1S5VA 3P61A 2QUUA 5FF2A 2V9DA 3L66A 2OT0A 5AC7A 3TV8A 2BLEA 4H4IA 4QM1A 5LNWA 3DKLA 3UXAA 1IIGA 1C9DA 4JDBA 3GK0A 3M9YA 3EWWA 1IXOA 3I7QA 3NQVA 3G1XA 1I2QA 4QISA 3TQKA 4DO4A 5LHFA 3MO7A 4C1KA 2G96A 2A1YA 1R2TA 1RQBA 4HNVA 1DORA 2JGYA 3LHTA 4UTHA 4WD0A 4LVDA 5K3VA 1MEHA 3TIMA 2OZ0A 1KFLA 3HIJA 3F4WA 1ME9A 3FYOA 3VE9A 1WV2A 3O07A 2RDTA 1RPXA 3LBCA 1GYNA 3B03A 1W56A 4R7JA 3KVLA 5TQLA 1J5TA 2QCEA 2WSYA 3KVMA 4X2RA 3HF3A 4JTLA 4DEFA 1SO3A 3PWAA 3STEA 1YDOA 2PE4A 1WDWA 3GVGA 4LNYA 1AG1O 4IGHA 2B7OA 1FCQA 5LNSA 3FKRA 3KVJA 2CLHA 4MJZA 4Z08A 3SW6A 2H8XA 4GXMA 3UZJA 5I3IA 5AC6A 2B7NA 3I65A 4Y96A 3W7GA 3ELFA 5F4XA 2J9YA 4IX0A 4WZHA 5I3GA 2C19A 3QYQA 3QSRA 3MUXA 4N9DA 1YYAA 2TMDA 4DF2A 1KM6A 1FDYA 4EOUA 1HL2A 3NQ8A 3G1YA 1DQWA 3HPSA 1O5XA 3EKLA 4JN6A 5EPDA 1SZFA 3EKZA 1PCWA 5TIMA 1RQEA 1LYXA 3BLIA 2Y70A 4QSHA 2QJIA 3W2LA 3GAYA 1TPFA 1HUVA 4LV4A 2RDUA 4DQWA 5HMSA 1H50A 1LP6A 5G2WA 4LV9A 5H91A 2OMAA 1F76A 4XWUA 2NX3A 2FTPA 2V0TA 3WK2A 3DHFA 1GTHA 1TRDA 5ABTA 4FNTA 1QPQA 5K9CA 1E51A 1PL9A 4FEZA 2VXNA 4R53A 1DBTA 4YXGA 3L67A 3PS7A 3LGEA 2GJNA 3N9SA 3LCXA 1XUZA 5DCDA 1OK6A 3TSBA 3WJXA 4MOZA 3LDVA 1RV8A 2PURA 4K6AA 3W84A 1OFOA 1DV7A 3G3MA 3PUOA 5HNRA 1PHQA 3T7VA 1DKWA 4RZ4A 1JR1A 3W7CA 3O63A 2ZA1A 1VHNA 5FI8A 3RLVA 3TAOA 5LGZA 3CM4A 3QFEA 3NPUA 1EP3A 3CHVA 5BRBA 1N7KA 4MFDA 5FF3A 1UBSA 3O6YX 1VPXA 1B4EA 1OFEA 3BW4A 3PBWA 1K7XA 1M5WA 3JR2A 3LTSA 2ZRYA 2DZTA 3C8FA 1PHWA 5F1UA 1GQNA 4PTNA 4HT3A 4UCGA 3HGJA 3BVJA 1OVDA 1JRBA 3GAKA 5EKYA 1CI1A 2ISSA 1EB3A 3BG9A 3TU9A 1R2SA 2WNNA 4GBUA 2PC4A 4RKAA 2WNZA 4AF0B 3TUUA 3M44A 1ME8A 4UIOA 4AWSA 5CGQA 3NQFA 4DO6A 5HWMA 2J24A 3CB8A 1ZJIA 2EAWA 1A5CA 1X7FA 3W1LA 3L5MA 1OX5A 1X1ZA 1PV8A 3W7LA 4Y8FA 4RXGA 4EF9A 2JKAA 3T40A 3ABSA 1EP2A 3LOTA 3C56A 3EWBX 3W70A 3W7HA 4RZ5A 1YTEA 1O5KA 4AWUA 1MO0A 5J5RA 5KSWA 3QPYA 3SGZA 3WJZA 2TRSA 3LRKA 3PG9A 3N3MA 3NQEA 1SFJA 2ZZ2A 3FKKA 5FEPA 4UXDA 3M5XA 3LLFA 1DJNA 4UTUA 3UWYA 2WQPA 1R30A 3HBLA 3I6RA 3TW7A 2FQIA 4LT9A 3ABQA 3W7JA 2ZRUA 3EWUA 2NWSA 3PBVA 5LHEA 5KITA 3IIVA 3M5VA 4FIQA 5A5WA 4GC4A 1VGAA 3UPBA 5AHLA 3Q94A 3TR2A 4K39A 2BXVA 2VEPA 1XI3A 1ZFJA 3S1UA 3S42A 1UJPA 2WO5A 1KFBA 4HIBA 4ADTA 4KFNA 3L2IA 5DBTA 3WK3A 3PULA 1LTDA 2Y7DA 3STFA 3TE9A 3W6YA 1NFBA 3LI0A 1IF2A 5AB3A 3HB9A 1PE1A 1QOQA 1WXJA 3HGRA 5EYWA 3MYOA 3O16A 5LKYA 5BW6A 1XBVA 5HINA 3S5YA 1FDZA 2ATSA 1BKSA 3W76A 4JTGA 1VCFA 1XBZA 3N9RA 5AN7A 2BWGA 1KM1A 1FWSA 3R12A 3UNDA 1TJPA 1R46A 2W0UA 2Y88A 2LLEA 2B7QA 1IXNA 1XXXA 4K8EA 3T44A 2DJLA 4AHPA 1H7WA 1OF6A 3TX9A 2CZFA 1ONRA 1ZY9A 1VLWA 4UTWA 3KRUA 3OHIA 1MXSA 5F2MA 3U8GA 4LVGA 1K7EA 1THFD 4FHAA 1LOLA 1TPDA 3A22A 4QJ1A 1K03A 4EIVA 3M43A 5G2HA 3NQDA 4ADUA 1QDSA 3EX4A 5FF4A 4EF8A 5G2IA 3VCRA 1LZOA 4IPIA 1GTEA 1FDJA 4LU0A 2HS8A 1F74A 4M7SA 1B4KA 1SW3A 4TO8A 4JGDA 2I9EA 4J9JA 3HPZA 4IMDA 4ORIA 3NQMA 4O52A 3TNOA 2A6NA 5KZMA 1ME7A 5HULA 1V5XA 4DXVA 1HG3A 4UC5A 4JX5A 3MJYA 2NV1A 1VR6A 4JTFA 2XFWA 1OFAA 1I45A 5E0KA 2FLIA 3OA3A 1VC4A 3ABOA 4TU1A 3S1VA 2ABAA 4UMCA 3IGSA 1WYIA 4NT0A 2C16A 2F84A 1P4CA 1M6JA 3R89A 1OABA 1P0NA 1D3GA 1SPQA 5CPOA 1I4NA 3VNDA 3PR2A 4IMGA 3TQ0A 1XC4A 1X6UA 4JTUA 3GIYA 1OFPA 3HOJA 1VCGA 3DZ1A 1UB3A 3OG3A 3CIWA 1CX9A 2EKCA 4AAJA 4JD4A 1KTBA 5AC8A 3LTYA 4MKNA 5FF0A 1W8SA 2NWRA 3GLCA 4N4QA 3WK0A 4K8HA 4Y90A 2C14A 1FQ0A 2CW6A 3O1NA 2JK2A 2QCDA 2BX7A 3W73A 4TIMA 4LS2A 2DZPA 1FCBA 4NZJA 2W79A 2WJZA 4LUJA 5DXXA 1AW1A 5D2XA 3QSTA 5D38A 1AL7A 1G7VA 1LM1A 4UFKA 1Q3NA 3C6CA 2HSAA 3GKAA 1NVMA 4KFPA 1QAPA 4FNQA 4WY0F 2A7NA 3GDMA 1A5SA 3STGA 1Q6LA 1H51A 3PUEA 4NQ1A 3NL2A 2DZVA 3W3OA 5DELA 1JUBA 3W7KA 4X9SA 3VE7A 1GPWA 3I68A 2H3BA 4M6VA 1EUAA 1XKYA 1SU5A 1S3HA 3PAJA 3L0GA 3NZ1A 2GOUA 5D37A 5GVJA 4UTTA 4UR7A 1W3NA 2WSRA 3W7QA 2QJHA 5C5YA 4NVTA 4CCEA 3P74A 3GDKA 1VCVA 1LBFA 3Q37A 1JVNA 1Y0EA 2NXIA 4E2DA 1K8YA 4QNEA 3PM6A 3KAOA 4K36A 1TTIA 3PB0A 2GVGA 1K8XA 1H1YA 3TA6A 1VZWA 3GZ3A 4NJGA 3DBPA 4RR4A 3BK0A 3M0ZA 4U4MA 1H1ZA 4RV8A 1WX0A 1YDNA 5K7JA 2A4AA 5AYXA 1KV8A 2NLIA 3BG3A 3QJAA 4CCDA 1PIIA 3G1SA 5IBXC 1ZAJA 4UNKA 1XM3A 4M5PA 1FX6A 3BLEA 2ATMA 4WY0B 4LUIA 5U4NA 1EA0A 3GYEA 4LRTA 4JS3A 4JYFA 4UTLA 5C6MA 3UY8A 1GVSA 2R14A 3F03K 1GJPA 2A6LA 4CQAA 3W2MA 4I7UA 1A50A 4K37A 3A24A 4ZMGA 3NR0A 3ZFHA 3G18A 3PSWA 2QKFA 5K9XA 2ZRXA 3BARA 2VFDA 3L21A 3Q58A 4KWWA 2E09A 4CQ9A 4WX2A 4BWLC 2A7PA 4RCXA 1UCWA 3NNTA 2YYUA 3TROA 2ZZ5A 3LERA 1KFKA 3LBMA 4OT7A 3W23A 4OBTA 4FB7A 1GOXA 2D73A 5I3JA 4WOZA 2X16A 3DAQA 3DH7A 4JR5A 3W7RA 3TK7A 5CZ0A 1HTIA 2E6DA 2V81A 3DGRA 4NX5A 3BW3A 2VEIA 1PCKA 3DHDA 4PC8A 4YMZA 5G5IA 1KBIA 5SWUA 2I1OA 5CPLA 3DFTA 1H61A 3ANYA 5KZDA 4CQ8A 4X3ZA 4N9BA 3DI1A 1LRNA 3E12A 3TH6A 3E0IA 1VHCA 4NUWA 4UMAA 2ALDA 1TREA 2C0AA 3G22A 2A7RA 1XDMA 2OT1A 4ZQRA 5FEWA 3TJLA 1UASA 4O4VA 5D2YA 1DJQA 2HMCA 4L4MA 3SGUA 4HKPA 4U28A 1P0KA 6TIMA 3TMLA 1YTKA 3OEXA 4O53A 1LRTA 4PL2A 1QPRA 1FXPA 4DBDA 4IXHA 4LVAA 1W37A 3B0PA 2CLFA 4QITA 1GG0A 1W3IA 1M7OA 1LCOA 2QAFA 4XKYB 1JUKA 5CSRA 2Z1BA 2X1RA 2RKXA 3B06A 3A5VA 4ZQCA 1H7OA 3FS2A 3P80A 1QO2A 3M5YA 4AHOA 1TPVA 2Z6JA 4IX2A 1SFLA 1UUOA 2YGYA 3KFTA 1NF0A 4HN4A 5AHIA 3W7NA 1TO3A 2CU0A 1WBJA 5HJLA 2WKJA 3LXAA 3QW4B 2X1UA 2QCGA 5D2WA 1BEUA 3CTLA 3HGOA 5DY2A 1AW2A 4UFIA 1N8FA 5KMYA 4O10A 4Q4KA 4AWTA 2BZNA 5LZLA 3GR8A 4GUIA 4W9TA 3W85A 3PY2A 2VENA 2FB2A 1F7BA 5LNVA 1I8JA 4ONVA 2YR1A 1YXCA 2CLEA 3LHWA 4MVAA 2CZEA 3INPA 3P81A 3LX9A 3UQNA 4BR1A 2O7SA 2V8ZA 4Q33A 4O1CA 4L4LA 2NXGA 1RR2A 3W7OA 1IGSA 3A5FA 3CEPA 4UTJA 4NJIA 1OFQA 4WJEA 4UFMA 4I7WA 3O6DA 2V2CA 2AAMA 3M47A 3QH2A 3LCHA 1LBLA 3GB6A 3NDOA 1LLZA 1XDLA 2VFIA 3EXRA 1BTMA 3LCFA 3IIPA 2VEKA 3SJ3A 2TYSA 3A9IA 4N9CA 4E2BA 1L6WA 3CQ0A 3W1TA 2V5LA 1SW7A 3UWZA 4YL2A 2FFCA 1GZGA 3BW2A 1W5NA 3ZWSA 3JS3A 1W31A 1X1OA 3VKJA 3NPVA 1A5BA 4RXFA 4BK9A 2YX0A 1QNVA 1OYBA 3T4CA 1ML1A 3NG3A 1T99A 3LCIA 5FF7A 3LCWA 3L68A 5BMWA 1KM4A 1G7UA 3C0JA 2Q8ZA 1D9EA 2V2DA 4HNUA 1ALDA 5G1YA 2Y7EA 1GYLA 1SO5A 4HPJA 5BOOA 4FXRA 1F05A 3DU0A 4UNLA 4IMFA 4JIQA 1XBXA 1VQTA 4K7YA 5CG7A 1EWDA 2CLKA 3LXBA 4M6QA 1I2NA 4MLRA 5D33A 3GDTA 2G5WA 1K8ZA 1VRDA 1S5TA 2QCFA 4JTHA 1J2WA 3C4UA 1Z48A 3CU2A 3BLFA 4UMBA 1NSJA 4OWGA 3W86A 4O18A 1ZCOA 3B8DA 3A21A 1SZEA 1OX4B 4JYDA 1SZNA 4G1KA 3EXTA 2C3ZA 3G1AA 5D2VA 4MZ8A 5K4XA 3NA8A 3MP3A 4WXZA 2A0NA 1LOSA 2X1TA 4A21A 4UFLA 3L0NA 4FF7A 4FX7A 5CZSA 5BMXA 3N73A 2NV2A 3L9CA 4OQVA 3NAVA 5G4WA 3ZWTA 3MI3A 3DFOA 1W5OA 2DZSA 2FDSA 4N02A 2WPBA 1YLVA 3QMTA 1VLIA 2XN0A 4HSNA 1T96A 2FB3A 2P10A 3QF0A 4O16A 1RQHA 1Z41A 5CSSA 2GQAA 5C2XA 2WSQA 4ZQMA 2Y61A 1JULA 3PBUA 5DLCA 4FXSA 4GE8A 2ZQ0A 4OU1A 2ZZ7A 1EIXA 2RFGA 1YPFA 4ZL1A 1KA9F 4JXCA 3M41A 3IVSA 1H7NA 1Q45A 4GUGA 1B57A 3A23A 2J27A 3FJ6A 4FO4A 4BF9A 4FNSA 5K2ZA 1TPH1 3MP5A 2ZDRA 2CFFA 3EX1A 4MZ1A 3IIXA 3RMJA 3I7SA 2XN2A 1TJRA 5C54A 4JX4A 1GVOA 4IUOA 4FIRA 1ZNNA 4O0ZA 3M1ZA 1T8XA 3SR7A 8TIMA 1AW5A 4LRSA 5G4EA 1W1ZA 3F1QA 3CWNA 1IXQA 3PF3A 5FEXA 3MI2A 1JCMP 5D02A 1PS9A 4D2JA 1KTNA 5FESA 4IMEA 1LROA 3NPWA 3UD6A 3QC3A 3TFXA 1H60A 3SIZA 2DZXA 1K7FA 4S1FA 3G0UA 3OVPA 3H55A 4N9EA 1FUYA 5I3HA 1JCLA 1DVJA 2QF7A 3B04A 4UR8A 5LNRA 3NL3A 1Q6RA 5EBUA 3UXDA 3QMRA 2YW4A 4O0KA 4FX8A 2X2GA 3EB2A 4UTIA 3T78A 1H7XA 5AYYA 2PRLA 3TMQA 2W6RA 4P2VA 1KTCA 1OG0A 2QCNA 3IIZA 3NEVA 3NQAA 2R91A 3C2EA 2ZZ6A 4B5NA 4N4PA 4OV4A 4NXSA 3M5ZA 2VEMA 3DFSA 2ZA2A 1SZGA 4LC6A 1ADOA 3HJZA 1HO4A 5CZTA 3HMJG 1GG1A 4BI5A 2ABBA 2QDHA 1KLZA 3DXIA 4GFSA 3NQGA 1OF8A 4OHQA 3L5AA 3W88A 1FBAA 2PRHA 1W5PA 3U6WA 4UTWC 2V82A 3LHZA 3PUDA 3ATYA 3UZ5A 4Y6GA 5MHBA 1WQ5A 2YDAA 3S1XA 5D04C 4JTSA 1TV5A 5D05A 4XBKA 1FCUA 1AMKA 2A85A 4O19A 4DPQA 1RZMA 2G97A 3MHUA 3RFAA 3LCGA 1TTJA 3QPZA 4RX0A 3KRZA 1O4UA 3G8EA 5HR6A 1BWKA 1XFBA 5D09A 2QEZA 2YPIA 3NL6A 2JKPA 2GQ9A 4QIUA 3W7IA 2Z6IA 3W1AA 1OFDA 3W7PA 3FYPA 2NXHA 3IGUA 3OIXA 4I9AA 4KKXA 3PBYA 3ATZA 3C2VA 4DPPA 4O11A 1WAUA 1LLWA 2ZA3A 1DL3A 3C2FA 1U83A 4BFAA 3NM3A 2ZRVA 2J9ZA 4IJBA 1JQXA 5E93A 4ZZ9A 1IXPA 4XTIA 3BG5A 4HNTA 3WJYA 4AF0A 3MHFA 1ICPA 3FFSA 2YFOA 3OBKA 3G3DA 4O15A 3SI9A 3C61A 1SW0A 4KFOA 1WOBA 3F4NA 2GUUA 4S2CA 4OV9A 1G6CA 1M7PA 1I2PA 4JICA 4O12A 3W75A 2YZRA 3C3NA 1QPOA 1WOAA 5HWNA 1LOQA 4DF0A 6ALDA 4LVBA 5T26A 5BNKA 3N2MA 3TXZA 1F6PA 3HG4A 3FEMA 3QQ0A 2I14A 3O06A 3HQ1A 3TW6A 3EEGA 5D30A 5DY3A 1X8FA 3TKFA 4FNUA 2DJXA 4MIMA 1AL8A 2WOQA 2FPYA 2ZYFA 1MEWA 3E96A 1QPNA 5AHEA 5C55A 2UV8G 3MWAA 3W2KA 3GKFA 2VKZG 2GVLA 2GQ8A 5F2GA 1Z44A 2XN1A 2ZTKA 3W7MA 1K02A 1TTPA 4JTTA 3RK8A 4HPXA 1TPEA 1R47A 3OVRA 2DP3A 3EWZA 1NEYA 1MEIA 4PCFA 1EUNA 1TPUA 3TSMA 3W1UA 3B0VC 5CPNA 1ZALA 2VFHA 3P67A 5KZEA 4YCPA 3R13A 4AVFA 1I2RA 2CLLA 4GUJA 2FJKA 2A21A 3GR7A 1OFBA 3W87A 3NL5A 3WK1A 3KRSA 2EHHA 2BTMA 5AHFA 1YDVA 5E1QA 4AMAA 2C13A 3QZEA 2C6QA 1JCXA 1SO6A 4BWLA 1VYRA 1VH7A 1JCYA 4XBSA 3TQVA 1OYAA 5IM51 4MZYA 4JDYA 3EWXA 4K38A 4NZFA 1I2OA 2CWNA 3CEUA 4O50A 3KOFA 1WA3A 3FOKA 2JKEA 4LVFA 2GVJA 4H6KA 1W54A 2DU2A 1ZAHA 1SUXA 3R8RA 1KBJA 2YSWA 2FPTA 5F4SA 1LBMA 3TC6A 3MMTA 1GWJA 2NUXA 4Z0JA 4K7VA 3IEBA 4O17A 1VYSX 4R33A 5HUOA 1TMHA 3FLUA 3S1WA 3O05A 3G0SA 3P82A 3W74A 4JIPA 5CZJA 5HQEA 3TXVA 1NF7A 3O8AA 3QEZA 4BI7A 2Z2UA 1QFEA 4N6EA 1XUUA 2CLOA 2B4GA 1FWRA 1W5QA 2EF9A 4HHPA 4FNRA 2ZTJA 3W7EA 5AYZA 3W1QA 3NQ7A 4ML9A 4DF1A 5D2TA 3UWQA 5AFDA 5J5DA 3Q2DA 2R8WA 3LHVA 2ZRWA 4O1AA 7TIMA 4ICNA 2BSLA 2OX1A 1YTDA 2CZDA 1VJIA 2J88A 1KM3A 4RK8A 2ZBTA 4MJMA 3PB2A 1SSDA 3I7RA 3MHGA 1H62A 2E5DA 4LY8A 4NU7A 5HWJA 3BGJA 3QQ1A 2QCHA 4GWEA 4O1DA 2NX1A 1K3UA 4JY8A 2Y7FA 3G1DA 2QDGA 3B05A 4TR9A 2VFGA 3N2XA 4NNCA 2ZZ1A 4IXXA 3PC0A 2VOMA 1L9WA 4A3UA 3MW7A 5L9FA 3W1NA 4ZQPA 4GUHA 1LORA 4DBEA 4JTKA 3IGXA 3BGGA 2ISVA 3VFLA 3DI0A 4H3DA 1O94A 3W1XA 2Y85A 1XL9A 1Z42A 2ZCGA 1TPWA 1T0OA 2ZZ4A 3DFQA 1OYCA 3T55A 3QRHA 4FNPA 4GUFA 5F2IA 2V2HA 1B3OA 3O15A 4RJEA 4DELA 4PEKA 3CT7A 3IVTA 1DQXA 4QAIA 2VFFA 2VFEA 3E9AA 2OJPA 4IOTA 2PRMA 1G4TA 5L6UA 3NVTA 3L5LA 1KM2A 3N34A 5EA9A 4P61A 1G67A 1ZHAA 1L2UA 5DCEA 3PSVA 2E5BA 1BWLA 1LDCA 3V1PA 3HO8A 1JQVA 5HUPA 3NQ2A 4C1LA 5I3FA 4YLWA 4KWVA 4A29A 1YXDA 2Z0IA 3LRLA 3FIGA 3H53A 2PCQA 1TQJA 4M7TA 4DO5A 4Z1BA 4R34A 3D0CA 4TMBA 1Q6OA 4ZVJA 4CNNA 3P5ZA 3SECA 3IIOA 3HG5A 3S0CA 4HNNA 2R94A 4LC8A 4Y9AA 1QR7A 2YFNA 1XBYA 5H2ZA 4EWND 3WFAA 1EP1A 4O13A 2Y89A 3NQ6A 4Z1AA 4NXKA 4CCCA 3W1PA 2KZHA 3EWYA 1KV5A 1OJXA 1YXYA 3USBA 1TV8A 1J4EA 1VS1A 2RDWA 1O95A 4GJ1A 5DN1A 2P0OA 3C2RA 4NJKA 4E38A 1QWGA 3OVQA 3P60A 2H90A 1HO1A 3NYZA 2DORA 1OX6A 3PVFA 2Y6ZA 3LLDA 5LSMA 1SQ7A 2WV8A 3W2JA 4CNOA 3UPWA 2QCDB 1KFEA 4MFEA 3P8IA 4UUIA 4XTDA 4MY8A 5EY5A 3W83A 3YPIA 3GDRA 3M6YA 5AHMA 3UWVA 3FA5A 4NJHA 3QM3A 3NO5A 1P5BA 4ZQOA 4NNBA 3NM1A 4O28A 2NUYA 5D03A 2O7QA 3G1VA 3S5ZA 1DOSA 2NX9A 3C2OA 1O60A 2AQWA 3DKJA 4PODA 1XCFA 2H6RA 1TQXA 3GXNA 1V7YA 3LB0A 3DFPA 4IMCA 3O6CA 3S6DA 4JEQA 4JYEA 2HTMA 5G1TA 3CIXA 3G24A 4CNPA 4TMCA 4I7VA 4WY0A 2C15A 2TPSA 1LRQA 5HR7A 3ZR4A 3ZS4A 2AGKA 3L0KA 4QNWA 5F2LA 3WJWA 1H5YA 1SR9A 4RZ6A 1F73A 4M6PA 3W1RA 2Y62A 5LNUA 4N2YA 4MY1A 4XUGA 3BV4A 3W72A 2Q8LA 4PL1A 3JRKA
chains in the Genus database with same CATH superfamily
1NWSA 4IQJA 1DPMA 5FAJA 1RSCA 3B8VA 1XIBA 5JXQA 3RJYA 2GWNA 3S8HA 4UCFA 1FY6A 3LNPA 1F61A 1JAEA 4YVXA 5DT7A 2F7FA 3KHJA 3NXFA 4ZO8A 2QR6A 4XX6A 3BOLA 1TUXA 1V6VA 5C8BB 4WKFA 3E49A 4QTGA 1KCXA 4MUZA 3P0XA 1JZ4A 2EGZA 2WNWA 3LYEA 5LIYX 2NSOA 3D5HA 3AHVA 3EPOA 3RF9A 4OE7A 1OFRA 2J62A 1XISA 3EX2A 3TAKA 1HKKA 2J9XA 4ML4A 1BGGA 3N14A 2R82A 3VOHA 3APYA 3H70A 1A5AA 3RHGA 1EEPA 4B4FA 3SZ8A 1UWTA 1AJ0A 4H8VA 3IPWA 3ITTA 3FA3A 3W2NA 3MANA 3UG5A 2E68A 1WXYA 1ZENA 3UWUA 1H63A 3MI6A 4GIEA 2JF6A 3USZA 3V5FA 3ITVA 1J0KA 1GEQA 4MWAC 4PEEA 4TVDA 3WQOA 2QUVA 3PG8A 4JTAA 4KQNA 1G4SA 1TJ2A 4DXXA 5A6KA 3BH4A 5CJMA 1F4AA 1JCNA 1I1WA 2B0MA 4O8RA 5FKYA 4AUBA 2C1HA 2E77A 3SM0A 3BPWA 3WLIA 1TRIA 3OHMB 3TSDA 4AB4A 3VGEA 1A0EA 2YCLA 4BI6A 4BEQA 1RD5A 4OUIA 3L12A 3LM7A 4PH6A 3P7YA 1QCWA 4A2RA 3RITA 3LPGA 4YS1A 3KTSA 3DX5A 1JCTA 4O1FA 4AH7A 1DJZA 1UZDA 2PGFA 4MM1A 1R6WA 4JTIA 3W1MA 2WBGA 3B4YA 2R6OA 1UW9A 5IXEA 3ZVHA 4J4KA 3DENA 4CN4A 1TYGA 4AXKA 3LM3A 5HAOA 3WDPP 3G8RA 4WKHA 2FHFA 3T05A 3NOEA 1E6ZA 3P3BA 1RVGA 3LCLA 1JXKA 3W37A 4BKNA 4CD8A 1F6KA 4WXYA 3FY1A 2OSWA 4IIEA 2V30A 2YBTA 4NX0A 3DG3A 4MY9A 3ITGA 5C9UA 3LXCA 4P5UA 5A95A 1C29A 2BOFX 3LGDA 3LGGA 1Y5VA 4WK9A 4TVUA 5F1VA 1FWAC 3W25A 3VZZA 2QGHA 3A4XA 2GK1B 2H8ZA 2WNQA 3M7SA 2WBKA 3T0BA 1VP5A 2NZLA 4TX9A 1UZ4A 4NAEA 2W9MA 4UFJA 5A8GA 3W9ZA 4UOJA 3LPPA 5D32A 4AZIA 3AUOA 2VO5A 1PDZA 1JYXA 3VIHA 5D8ZA 3N2BA 1NAL1 3DBNA 3B9DA 4MYXA 2JGQA 2YYTA 3UYCA 1TWZA 3ZLGA 3UXLA 1UOKA 1V7AA 5EBAA 3RX4A 1OX4A 2E5CA 1VFLA 3WH7A 1V0NA 4JKMA 2Y24A 2Y2WA 2ON3A 2CLMA 1XGZA 2PP3A 3KOWA 4L4OA 3PPCA 3RDKA 4DWSD 1DYSA 1WDQA 2D0FA 3HGSA 3LHYA 4JNMA 4DUVA 4N0RA 3GFYA 2PD9A 4ADSA 4M24A 2HS6A 5DBUA 1UOZA 4Q32A 5LGXA 3WF1A 2V3DA 4H2HA 4HJFA 1BQCA 2G37A 7XIMA 1N82A 2CBIA 4PA8A 1FH7A 3CV1A 1MFVA 4XISA 1A80A 3AO0A 3S2JA 1L6YA 2VQTA 3E0VA 3AICA 1XW8A 3GXFA 2EPHA 3QY6A 1KM5A 4Z1DA 2JIEA 4V15A 3SURA 3PTMA 1H0GA 4AEOA 3TDFA 4KH2A 4A3QA 3WENA 4H9VA 1TX0A 5DMYA 1WO2A 3GNNA 1EJXC 3EDEA 3U7VA 3DIPA 2D2OA 3P61A 2QUUA 2OT0A 3L7RA 3VCNA 1UH2A 3B8IA 3DKLA 4JDBA 1IXOA 3GHTA 3NQVA 3RM9A 2MUCA 5FJTA 3TQKA 5LHFA 1JEZA 4AYGA 2G96A 1R2TA 4HNVA 2JGYA 4B90A 3E1F1 2QXWA 4WD0A 3B8SA 3WLRA 2HRWA 3FYOA 4JBRA 1WV2A 2JIWA 4XZIA 3EEZA 2OLSA 2BVYA 3MMDA 3BCJA 5TQLA 2WSYA 4MAZA 3PWAA 5JBEA 1E70M 1ZQ5A 2PE4A 2NQ9A 1JFXA 4IGHA 2B7OA 2XSXA 4H6EA 5LNSA 3U0HA 2YCKX 3FKRA 1X96A 4L65A 3D3AA 3RLHA 3U4AA 3VD5A 1XYLA 5I3IA 3I65A 4Y96A 4GH3A 4LH8A 2Z29A 3BSHA 4LYRA 4DAIA 2C19A 3VAVA 3VDHA 4JHMA 4DB7A 2TMDA 3BC9A 1EC7A 1P6WA 3OVGA 4XD3A 2BHZA 3RX2A 1S39A 4EOUA 1DWGM 2GVYA 1O5XA 4D6CA 3UR5A 3EKLA 1CXFA 3GXIA 5CLTA 5EPDA 2CIPA 1DJWA 5TIMA 4B5TA 1UA7A 3WDJA 1RCQA 4KERA 1HUVA 3Q67A 1DJGA 4M8UA 5H91A 4D8LA 2OMAA 1F76A 3IJ6A 1VIZA 1Z69A 3WK2A 1TRDA 2JF7A 1UC5A 4XD5A 3LGEA 4AC7C 4C6QA 5BXSA 3OYXA 1JF5A 3TSBA 1OEPA 2HDJA 1XQKA 3PFRA 3GTNA 4RNIA 1YRRA 1DV7A 2Z2AA 2VX6A 3G3MA 1PHQA 3AALA 3O63A 3NUKA 4KIEA 5LGZA 1DHKA 5BRBA 5IHRA 4DJEC 1ZRQA 2JEPA 4GACA 3CUZA 5BXTA 3K13A 2G3IA 5M17A 3RJXA 3NDZA 1B4EA 1OFEA 2GQ3A 1B3YA 3BW4A 1K7XA 1HJWA 1M5WA 3WQ6A 2ZUWA 3K1GA 2QQ6A 2Y5JA 4L80A 2VX7A 5F1UA 1TR1A 4FOKA 4RDZA 2PLMA 3RUBL 1JRBA 2CITA 2WNNA 3A3XA 4QGCA 5HMDA 1T40A 3M44A 2F38A 4UIOA 1J0HA 3VILA 2BXYA 2V3GA 1EJWC 3N3TA 2VM8A 1ZJIA 3VIMA 2CBVA 2REQB 4G9PA 4INFA 4R5EA 2DIJA 5JH2A 3SFWA 3BMWA 1DXIA 1X1ZA 2PLCA 4KRUA 4Y8FA 2NVDA 5DQPA 4FLSA 3LOTA 4GZ7A 6TAAA 3W70A 4RZ5A 2W27A 3UERA 3SGZA 3WJZA 2TRSA 4EXBA 5JH1A 3FKKA 1FFRA 3M5XA 2XJ7A 2J47A 4MB3A 5H6HA 4EPEC 4UTUA 4IGNA 2PZ0A 3DDMA 2QPUA 3UWYA 1XLBA 2BY1A 1DP0A 3K1DA 3VNKA 1A4MA 3HBLA 2DUZA 2I57A 1TR9A 3ABQA 3W7JA 1XH0A 3EWUA 3R0UA 4G8TA 1GVYA 3PBVA 3M5VA 4MAVA 4GC4A 3UPBA 3TR2A 2VEPA 1WDPA 2GJXB 4F9JA 3SCQA 5HJXA 2PFHA 3S1UA 1R8LA 3S42A 3ABXA 3SCRA 1RUSA 1UJPA 4PUEA 1KFBA 3GU1A 1R38A 5D9NA 3BXWA 4ADTA 1LUCA 4WCJA 5DBTA 4QAWA 4S3AA 3W6YA 1W9VA 2DY3A 2GGJA 3IRSA 3FN9A 1J0ZA 2PWDA 1DIDA 2XFFA 3H2EA 2ISFA 5IRPA 1QBAA 3ZIZA 1M01A 1C9WA 2O56A 4JTGA 1FA2A 2A3BA 3N9RA 4ECLA 1HKJA 1KM1A 1S38A 3I4KA 3PZNA 3UNDA 2L5HA 4F3HA 1R46A 2W0UA 1IR2A 3TYAA 3RO6A 1XXXA 2DJLA 4LB3A 4B5SA 1H7WA 3GHUA 3MSDA 1VLWA 3O0FA 1VFTA 3XINA 1AVAA 4ZCWA 3VIPA 2VZTA 5F2MA 4LVGA 2P8BA 3VD3A 1PEZA 1LOLA 3QHOA 1LT8A 1QVBA 2QPSA 1JPKA 1K03A 3NQDA 2VEGA 2ZIDA 1E6PA 4EF8A 3VCRA 1GTEA 1FDJA 4LU0A 2HS8A 5GJMA 5I6SA 2WZTA 1XICA 2I9EA 3M0YA 4UWMA 3H6OA 4O52A 2D2JA 1ME7A 1MNSA 5HULA 4DXVA 4QDMA 5E0KA 1Q63A 2HCVA 3SO7A 2DUAA 1RK5A 5CC7A 1GVIA 3WUFA 3G2GA 4E4PA 3S1VA 2ABAA 1I1XA 2P88A 4RE0A 4LAUA 1BVNP 4W8LA 3QLDA 5HNNA 4LAKA 2PDUA 4IMGA 1XC4A 3HOJA 3APTA 2QNEA 3DZ1A 3OG3A 2D2GA 3CIWA 5EMLA 4AAJA 1CLVA 4JD4A 1KTBA 3LTYA 3VABA 5A2BA 2NWRA 1HKVA 1B3WA 3WK0A 4K8HA 3GC2A 2JK2A 3BOFA 2XVNA 4LS2A 1IEQA 3V3WA 2WZHA 2IPJA 1MWOA 1ELSA 3UVAA 2WJZA 5DXXA 1XFCA 1G7VA 4FK9A 4D1IA 5EMMA 1Q3NA 3G77A 2ESCA 1QAPA 4FNQA 1BVZA 3GDMA 3QY8A 1RBLA 3P14A 3VMPA 1UPPA 3PUEA 5BRPA 2EKGA 2DZVA 4NP7A 1TA3A 3W7KA 4X9SA 5E6ZA 2GGHA 2WMIB 4L1GA 3EDKA 5A6JA 1J0YA 2H3BA 4M6VA 2O9RA 5DX7A 2PWVA 4ZEPA 4HTBA 2ZADA 3VGBA 1B90A 1QNOA 2INFA 4Q7NA 3W53A 2DZAA 2VGGA 4UTTA 2XZ7A 5CC3A 5BXPA 1JDCA 2X0SA 4OTKA 4BA0A 4KPLA 4NVTA 4CCEA 2EPKX 4GQ0A 3HPAA 1LBFA 4C7DA 4H7VA 3GBEA 3MO4A 3W26A 2WW5A 4JQ4A 1XH2A 2ZXQA 3PM6A 4K36A 3PB0A 4QJ4B 3CBWA 1H1YA 1Y5XA 2ZUNA 4F2UA 1VZWA 3GZ3A 1MRQA 4RV8A 4ZO6A 1HX0A 2DIKA 3ABZA 4QEHA 3KBSA 4KCWA 4CCDA 1VEMA 3MVTA 1HGWA 4GI4A 1YEYA 2ATMA 3BAWA 4WY0B 1AQHA 1EA0A 1W9XA 4JYFA 4HNOA 4DUXA 4B92A 3F03K 3AHXA 3REQB 3ZLFA 1A50A 3CHDA 4GXPA 1EJ7L 4ZMGA 2CBJA 1H3GA 4PBFA 2IKHA 2QKFA 2ZRXA 3FSTA 1TG7A 3GXMA 3L21A 3EA3A 1J6OA 2E09A 4KWWA 3UWEA 1J6PA 2Z1XA 1RHCA 4I8YA 4WX2A 2B31A 3WBXA 3NNTA 2YYUA 4YU1A 2ZZ5A 1KFKA 1Z6KA 2PDLA 1EF3A 1SJDA 1E4MM 3H7RA 2WSKA 3SUTA 1V0LA 1GOXA 2D73A 3N11A 3HURA 3QKZA 2OLAA 4GABA 3VD7A 4S3BA 2PTWA 3LMZA 3HQOA 4NX5A 4Y9OA 3GUGA 1PCKA 4PC8A 1OC6A 2RGMA 3DFTA 1BYBA 2PF8A 4IM4A 3EOSA 5KZDA 3ZYZA 4N9BA 5GNXA 3V0UA 1UP3A 2PA6A 3FDGA 4NUWA 4UMAA 1JGMA 2ALDA 1HIZA 3VZXA 2EJAA 3CZJA 2IXUA 2OT1A 1EF2A 1DJQA 4JFVA 4W4QA 2HMCA 1P0KA 1YTKA 3NSMA 3OEXA 3SCNA 4O53A 4PL2A 1QPRA 1FXPA 2CLFA 2GDQA 3F4DA 4QITA 1W3IA 1LWHA 3M0MA 3A5VA 1H1NA 3RR1A 5BWFA 4ZQCA 4ZSUA 1H7OA 1VBUA 3IK4A 3BURA 3HQNA 1SFLA 3WLQA 4CQDA 1QNSA 4GG9A 1NF0A 4KEVA 3W7NA 4AMCA 1Q8JA 2CU0A 3WUBA 3AQUA 2PP1A 1XGDA 3ERPA 3LXAA 4Q7BA 5AVNA 4BQ2A 3NXLA 3THUA 4MDPA 1AW2A 1J93A 1KGUA 2WHKA 1N8FA 2ZXBA 4F79A 1EBGA 2VENA 2FB2A 1POKA 2E8ZA 4QG6A 5CG0A 3KDNA 3VGGA 3RYSA 1YXCA 4GX8A 2CLEA 2GK1A 3LHWA 3TYZA 1D7KA 3CMFA 3LX9A 3UQNA 2OEMA 2V8ZA 1LJYA 2PDYA 4O1CA 3W7OA 3LLXA 3ES8A 1CENA 3CEPA 1OFQA 1U30A 2WK2A 2O92A 3TTEA 3I3DA 4S3JA 4XAZA 2V2CA 3AS1A 4ZENA 3ZSTA 4DNHA 1LLZA 4FSAA 3TN4A 1MW3A 2EPNA 1BTMA 2TYSA 3PZVA 4TV5A 1XLMA 4N9CA 1WUFA 3R10A 3VNYA 3W1TA 2V5LA 3UWZA 1CEOA 7A3HA 3JS3A 3VKJA 1JFHA 1A5BA 4RXFA 1Q5MA 1OYBA 1GEHA 3T4CA 4H2CA 1TELA 3LCIA 1E73M 4WVXA 3A4AA 5FF7A 1PIGA 3LCWA 1OQFA 3NZPA 3OIHA 4NYUA 1V0MA 1KM4A 1G7UA 2TAAA 1D9EA 1IEXA 4M0XA 3T2QA 4FXRA 4UNLA 4IMFA 2OO6A 4REQB 3IV8A 5CG7A 1EWDA 2CLKA 4TX8A 2BDQA 3GDTA 4J35A 1Z48A 4PUKA 4RL3A 1PO9A 2GGGA 3BLFA 4L56A 1NSJA 3POCA 2NVCA 4B2DD 3A12A 3B8DA 3A21A 3CMJA 1KC7A 1MFUA 4G1KA 3G1AA 5D2VA 3GWQA 1EJUC 3AYVA 5IFPA 2W92A 4JN7A 4A21A 4UFLA 3L0NA 1ZL1A 1N8WA 5CZSA 1W1PA 3LS9A 3G5EA 2QLYA 3ZWTA 2WMFA 1W5OA 4Q8PA 4P7OA 4N02A 1YLVA 1VLIA 1T96A 4PUUA 2P10A 3B8WA 3KLLA 4YYFA 1UWIA 5C2XA 5DLCA 3PBUA 4FXSA 1VFOA 1VJSA 4OU1A 1FWIC 3R58A 2QJJA 3ORWA 4L5ZA 1H7NA 4P8VA 3GVRA 2DIEA 3FJ4A 2ZDRA 3EX1A 4W8AA 3RMJA 3T9PA 3CJPA 3I7SA 4PCNA 4GMEA 3UG8A 5C54A 2GJPA 2YA1A 4FIRA 3M1ZA 1T8XA 8TIMA 4LRSA 4PMQA 1XLGA 3MI2A 2GGIA 3KCJA 4G7EB 1PS9A 1KTNA 3U2ZA 1LROA 4YJ5A 1EDGA 2NQJA 2OGYA 4N9EA 1FUYA 1DVJA 4UR8A 3UXDA 1CZ1A 4D71A 4FX8A 2X2GA 3QHNA 4PYSA 1H7XA 1QI4A 4HCHA 4P2VA 3SUUA 3NEHA 2YXOA 4A6GA 4LSBA 4N4PA 2V6AA 3M5ZA 1E6QM 1WZMA 4IGMA 2ABBA 1JZ2A 1KLZA 1R87A 2X7VA 3IK2A 1OF8A 4E8GA 4LEFA 4UNIA 3ZSSA 1W5PA 1UKOA 5DRCA 1BVWA 3PUDA 1NDWA 3UZ5A 1HZYA 3R94A 5I77A 2POZA 2VZUA 3GYCA 3KBMA 4I3GA 4A3YA 3RX3A 3RFAA 3LCGA 4RX0A 3QPZA 3KRZA 3G8EA 1EJTC 3VUSA 2Z1WA 4LB4A 4V2XA 1W1A1 2JKPA 1S5MA 2Z6IA 1V03A 2BBFA 3W1AA 3W7PA 3FYPA 4QHRA 3OIXA 3PZQA 4W86A 1PYFA 2VC7A 3A4JA 3L4WA 1A5KC 3C2FA 5FAGA 2V5JA 2A3AA 2ZRVA 2J9ZA 4IJBA 1JQXA 5E93A 1IXPA 3WJYA 3R0KA 8XIAA 3QPEA 1ICPA 3OBKA 4O15A 5ABFB 1KBBA 4W7WA 2X7WA 1WOBA 3IJ9A 2GUUA 2FZ9A 3H8AA 3GTFA 4OV9A 1JYVA 4JICA 3KS6A 4O0QA 1W3LA 4HPGA 1HKWA 1XWYA 3N2MA 1Y8BA 3P6LA 4HA0A 4Z42C 3S2CA 3QQ0A 3TW6A 5DY3A 4H19A 4MIMA 3S4TA 4ZGYA 1WPCA 4AD0A 1DE5A 1B2YA 1CGXA 5AHEA 2UV8G 4MUPA 2VKZG 2GVLA 2GQ8A 5CLWA 4DJDC 4HPXA 1TPEA 3EWZA 4IGSA 3NSXA 1EUNA 1TPUA 2FDMA 5CPNA 5LA1A 3EBVA 5BCAA 3HA1A 3BCFA 4AVFA 1I2RA 2CLLA 2KX9A 2GJXA 5I02A 1VPYA 5HQLA 1W91A 2FZDA 4AMAA 1JCXA 5ENLA 3MZ2A 2ZUTA 2ZWYA 4JPGA 1V3MA 1C90A 4XBSA 4B16A 3N18A 5IM51 1YIXA 1J9YA 3IAQA 4GYPC 1K8CA 4LGXA 1I2OA 4DUOA 3WQGA 1IZCA 3RG6A 4IFKA 4H6KA 2OYKA 2DU2A 3R8RA 3LK6A 4P7LA 2BGSA 4KF1A 4B4HA 1ENUA 4Z17A 5GJNA 4Z0JA 4K7VA 2VDHA 1S2TA 3IEBA 1X6NA 3UA3A 4ZB5A 2WCSA 3B0YA 1M3UA 3S1WA 3MCOA 3ID7A 1E1CB 3G0SA 3P82A 2PDWA 4KCVA 5A6MA 2Z27A 2Q8XA 2QULA 2J7DA 1QFEA 3K8MA 3N12A 2CLOA 1BYCA 1FWRA 2BXZA 2XG9A 4HHPA 3EOUA 2C7FA 4QDWA 3W1QA 3EDJA 5EGRA 1Q2SA 3UWQA 1OINA 1I6NA 3VKAA 2OX1A 4KWUA 4Z2LA 1YTDA 1UQZA 2XISA 3IS4A 2BB0A 2DUXA 3ITLA 4MJMA 4GJJA 3H24A 3URQA 2E5DA 1Q6EA 5HWJA 3GBDA 4GH1A 3BGJA 3CQKA 4AVOA 1RK6A 2Y7FA 3LEPA 5JVLA 2VL4A 4IPLA 2J25A 3CL8A 4AZ7A 2QDGA 4AU0A 4ZODA 5T8GA 1L8NA 4MWAD 1KWGA 1X98A 1F6YA 4DLMA 3V18A 3MW7A 4ZQPA 1V8EA 1LORA 1W9UA 1GPFA 4Q4RA 4JTKA 2ISVA 3DI0A 3PZMA 1O94A 2Y85A 2FGLA 2ZCGA 4H7CA 1R3QA 1T0OA 3QKEA 3WNOA 1OYCA 3QRHA 4FNPA 3VA8A 2AAAA 4F0KA 1B3OA 3N13A 4RJEA 4PEKA 3CT7A 3IVTA 3ITYA 2AKMA 2QDDA 4HD5A 1G4TA 5LIKX 3NVTA 4FXFA 1V51A 4P61A 1QJWA 4X9YA 1JZ8A 3DUGA 4HP5A 4UZUA 1B30A 3NWRA 4GYFA 1JQVA 3NQ2A 5MKGB 4KWVA 4UQEA 2ZWZA 3LRLA 3FIGA 1L8PA 2PCQA 4M7TA 3D0CA 2IXVA 3P5ZA 4YHEA 4EPBC 2V5DA 1S2CA 4QLJA 3S0CA 4HNNA 2R94A 3ONCA 3WD1A 4C6DA 2WMIA 1XBYA 3M0LA 4G5DA 3WFAA 4EWND 4U33A 2YA2A 2PDQA 1W9DM 2Y89A 4O13A 3C2YA 1P43A 1F8IA 4TXEA 3W1PA 2KZHA 2YJQA 3EWYA 2PDMA 2PF0A 4XZHA 3N4FA 1TV8A 1J4EA 1VS1A 1O95A 5DN1A 1JZ5A 2P0OA 4GCAA 3GRIA 1FHUA 2C8NA 2PWUA 4E38A 4HZMA 2ACSA 3P60A 1HO1A 3EOLA 1OX6A 2Y6ZA 3LLDA 5LSMA 3FXYA 1SQ7A 4Q4OA 3QV7A 2WV8A 4LBRA 4CNOA 1KFEA 4MFEA 3L23A 4Q4MA 4XTDA 3W83A 3YPIA 1K4HA 2J6VA 3FA5A 4NJHA 4PSRA 4Y9MA 1L6GA 2RJGA 4J27A 1PTDA 5LA0A 3OQ8A 4ZQOA 1IHIA 3NM1A 4O28A 3L4XA 4WEVX 1TVNA 3KTXA 1Q6CA 5GJPA 1K77A 3S5ZA 1K6WA 2R24A 2NX9A 4ZE5A 2AQWA 3DKJA 3T2PA 3WL1A 2H6RA 1TQXA 3K5XA 4XK2A 4RPPA 4IMCA 3O6CA 3E2RA 1WDRA 1OG6A 3UJRA 3BMVA 4YHGA 2HTMA 2DW7A 4CNPA 4WY0A 5HOSA 4KEMA 1GW9A 3AMDA 1NDVA 5CBJA 5J04A 5HR7A 4N42A 4EWJA 1GJWA 3REQA 2AGKA 2C1IA 3WJWA 4C5YA 1QI5A 4MB1A 2E1WA 4FZIA 5LNUA 1KCZA 2EXOA 4MY1A 4XUGA 2Q8LA 1H4PA 3JRKA 3VNIA 4IHCA 4IWWA 2ALRA 3PP7A 1SSGA 1LWIA 1CGYA 3EX6A 5A6SA 1GT8A 1XLFA 4IUGA 1GHRA 2XDFA 3EOOA 2WMKA 1QI3A 4S3DA 1AQFA 1QMLA 1AA1B 4GZIA 2GYIA 1XIGA 1U1UA 2W63A 1DWJM 4AHQA 4O57A 1PZ2A 3R1ZA 1TPC1 3SY5A 1ISVA 3ISIX 4M19A 4S2BA 4F66A 5CQ1A 4QR6A 3VDAA 2X30A 1D8WA 1TB3A 1YE6A 3MDWA 3GDLA 4HA4A 3GDBA 4IIFA 1B3ZA 2P1FA 1S5NA 5IFTA 2A5HA 3WJSA 4U5KA 7TAAA 2V5BA 3GNXA 2EG8A 3V0SA 3KDOA 3GG7A 5AC5A 1TSIA 2CHNA 4E3TA 3WBAA 4PB3A 4WUIA 3WQPA 3F5JA 1KFWA 4O14A 2CLIA 2CEQA 1ECEA 3M6DA 3MYPA 4G7FA 2NV9A 4UTKA 1LQAA 4D9PA 3RAOA 2VGIA 1Q4WA 5TBOA 3WNLA 2E1DA 1ICQA 5HMEA 2PLKA 5DXYA 4CU6A 1BF6A 3HPXA 3EDFA 1YADA 2QJMA 3G0XA 3IV3A 1CXLA 1XLCA 2QCCA 2YA0A 2DZWA 3O3RA 4GD0A 2WVUA 1V3HA 4GA8A 5I3KA 1E56A 3P8JA 4CD4A 5CKSA 3CUFA 3MBFA 4A2SA 1M03A 1DJHA 4AFYA 4IFOA 3KBVA 3QGVA 1OK4A 5HJYA 3ABRA 3W71A 3AS2A 4HTYA 3V75A 3KX6A 1KCLA 3ZMRA 1MZHA 3SADA 3FVDA 5ABEA 2P0IA 3B4UA 2V3FA 4JCMA 4DX3A 4A22A 1TTQA 3OA5A 1TMQA 3H23A 1UC4A 4X60A 4CLMA 1W6TA 1W3TA 1VF8A 2VCCA 2V68A 2X1SA 3PN8A 3OB8A 1MSSA 1E0WA 1EC9A 3HQPA 2W67A 5KETA 2GSHA 3HFTA 4EXAA 3PK7A 4IIDA 2YKKA 1KGXA 2XYLA 2VC6A 3EPNA 1EPXA 2QAPA 2H9AB 1B9BA 3U2OA 4I6KA 5AHNA 4TV6A 3L65A 2O4QA 3WH5A 3U2CA 1QNRA 1H7PA 1U5HA 2KAUC 2RHGA 4Z1YA 3P5YA 1RCXB 1MDRA 2FTYA 2E6YA 1CGUA 4M1BA 4KWSA 2QCMA 4REQA 2JALA 3MZNA 4IPJA 2PU0A 4ROPA 4HGXA 4XZ9A 5IBXA 2HVNA 1N2VA 2HBVA 5I06A 3FJLA 3F2BA 7REQB 2BY3A 3FSUA 3RNDA 1I0BA 2H3DA 2PTXA 2IQTA 3CYJA 3NPXA 1I0DA 2C0HA 4S3FA 3G1HA 1EX5A 3G1FA 4PUNA 3PJTA 1QW8A 3VNZA 1ZAIA 3F2CA 1JJKA 2OO0A 4K1GA 3LV5A 3R6IA 1HJSA 3TJ4A 2EPOA 3WLPA 2D3NA 1LT7A 4IQLA 2RH9A 2Y5SA 4MKSA 4I6VA 1VBHA 1KM0A 5CPMA 2ZDSA 1W0MA 2D22A 2QCLA 4A8IA 1JCJA 1DTUA 3UGRA 4Z0SA 3E2QA 1QOPA 3NYDA 2OZ8A 3TQPA 4LAZA 2IUZA 1FH8A 1KFJA 4UFHA 3MBDA 4QS6A 3BL3A 2J6XA 1UR9A 3B0UX 4XUYA 1HJVA 1X6LA 3ZZ1A 2E9BA 1E6RA 1R2RA 4UTMA 1HNYA 2IKJA 1BG4A 5A8NA 1L6SA 4LTSA 3P62A 4I9JA 1CXEA 3BO9A 4H6RA 2V9DA 3L66A 5AC7A 5A6BD 3C0LA 3DOPA 4HU8A 3CS2A 4IJRA 4G7EA 3M9YA 2VR5A 2FHBA 1XQLA 1M7XA 1XG3A 3WMBA 4M81A 4QP0A 3MO7A 3D47A 2A1YA 1BSIA 1E72M 1RLCL 2WWDA 5XINA 3BUVA 3HZ3A 2ZUSA 1P48A 3MUZ1 3TIMA 4MF4A 5A6TC 4JFTA 3O07A 1S46A 1RPXA 1GYNA 3B03A 1EC8A 5AC4A 3II1A 2BVDA 3KVLA 4JTLA 1SO3A 4J2MA 3STEA 2HVMA 1WDWA 4LNYA 3UETA 5CEWA 2PP0A 3TOYA 3TCSA 1PX8A 1FCQA 3COTA 3HU7A 3O7UA 5CC5A 3KTCA 3KVJA 2CLHA 4MJZA 4XB3A 3W6LA 1SZRA 4GXMA 5AC6A 3OZMA 2FH8A 5F4XA 2J9YA 1KWKA 4LUTB 4W87A 4R3UA 3MUXA 4N9DA 2F6XA 3BSMA 1VBRA 3UFYA 4S3CA 2HE8A 1RCOB 1HL2A 2WQDA 4JN6A 3UR7A 1IT0A 4AIUA 2UY4A 3BCDA 4GISA 4MNLA 4C6NA 3VU2A 3W2LA 3OBAA 4LV4A 2RDUA 4P8XA 5HMSA 3UBPC 4CKQA 5G2WA 2YCIX 3GD6A 2NX3A 1SFTA 2ONEA 3WG6A 4C6JA 3CV2A 2Z1VA 4M1RA 3IACA 4DM1A 5ABFA 5JMUA 1GTHA 4ZOAA 5ABTA 4FNTA 3FAWA 4QE4A 1E51A 1NQ6A 4JCLA 4FR1A 2I5QA 3PS7A 2O9OA 2GJNA 3NOYA 3N9SA 3LCXA 1XUZA 5C71A 3CB3A 3BLOA 4KETA 1HL9A 4K6AA 3W84A 4DBSA 1KRMA 1OFOA 3PAOA 4JFUA 3PUOA 6REQB 1FWEC 1DKWA 1JR1A 3V16A 4NIRA 1NY1A 2E9MA 5FI8A 3RLVA 2OTDA 3TAOA 4YNGA 3QFEA 2WM0A 3CHVA 3LMYA 1UBSA 2QYGA 4K8GA 1DXFA 4QROA 4GPNA 3O9NA 3QGAC 3F2DA 4ATDA 3S3GA 2EPMX 3LTSA 4H1ZA 3AZTA 3E2SA 3U2EA 5EKYA 2IMRA 1EB3A 3TU9A 5HDRA 4W89A 2CPUA 3NZGA 3TUUA 1ME8A 1H09A 4UOQA 3MTWA 5HWMA 1JF6A 2EAWA 3I6EA 1ZJBA 3E5BA 4NG3A 1X7FA 3WUEA 2PBGA 1OX5A 1PV8A 3W7LA 3MSRA 1NOWA 2AMGA 3S47A 3AU6A 3ABSA 1EP2A 4V1XA 1ZLPA 3AXIA 3GNRA 4AWUA 1MO0A 4Q6XA 3QPYA 3H4GA 2BVWA 3N3MA 1IT7A 1SFJA 1RJQA 1GQIA 2ODOA 5LXEA 1E1CA 3NURA 3T8LA 4RV3A 1C93A 1ODZA 4WIWA 4A35A 1R30A 3EOEA 1W17A 4KGJA 4GIRA 4LT9A 5BZAA 2ZRUA 1G5AA 4DLFA 2D69A 5KITA 1PAMA 3IIVA 3WQCA 3Q94A 4U2ZA 4K39A 3GFZA 5GPRA 1E9YB 5A1AA 3WQ8A 3VFCA 2PC8A 3AROA 5EMKA 1NOUA 2ZICA 3MU7A 2X42A 1YQ2A 3L2IA 1K9DA 1JPHA 4JL2A 3PULA 2Y7DA 2P53A 3STFA 1C7TA 3FHQA 3LI0A 5AB3A 3HB9A 1XIFA 5EYWA 3RPMA 1DIEA 3KOZA 5HINA 1GOQA 4GLEA 3S5YA 2ATSA 4US6A 2G50A 1WCGA 3RN6A 1VCFA 1XBZA 1XINA 2QS8A 5LIWX 1TJPA 2Y88A 2LLEA 3T44A 2WXDM 3PUGA 3KL0A 3SQMA 3TX9A 2CZFA 1ONRA 4RE2A 2V38A 1XF0A 3KRUA 2DVXA 3U8GA 1V0KA 3UPMA 1TCMA 3TR9A 1UMLA 3A22A 4QJ1A 2XFRA 3M43A 2XWDA 3EX4A 4W88A 5FF4A 4C6EA 1SW3A 2XM1A 2PEVA 4YTUA 4J9JA 3NQMA 1YDYA 4UTFA 5MKGA 4F9DA 3OPSA 1HG3A 4UC5A 2VURA 1B54A 1MW2A 3ABOA 2E25A 3Q45A 3BAXA 4TU1A 3BLLA 1NDYA 2GSJA 1WYIA 5CPTA 1W8GA 2G0WA 3WF4A 2VOTA 2C16A 3THDA 3DHPA 2INEA 3R89A 1P0NA 4QS5A 1FWFC 3ARWA 5JUVA 5MF5A 1SPQA 1Q65A 1I4NA 1IZJA 4JQ3A 3VMNA 3GM8A 4QX4A 4ZFMA 1EJRC 3GIYA 3JUGA 3W02A 1VCGA 3G6MA 3JVAA 1UB3A 1HJUA 1NFGA 2AL2B 4PSPA 2ISDA 1PTAA 3OU8A 5FF0A 4Y90A 4UQBA 3SGGA 1FQ0A 1A5LC 4QE1A 2CW6A 3S2MA 3VX1A 1BQGA 4BHYA 2DZPA 3OGVA 1E6SM 3URAA 4MNMA 2W79A 1XLEA 3A6OA 3QR0A 3T07A 3QSTA 3R7MA 2WSPA 5D38A 1AL7A 3EWDA 2EG7A 5GNYA 4P7QA 3GKAA 1VEOA 1NVMA 1P0DA 4WY0F 2A7NA 4YN5A 4P7NA 1H51A 4A4AA 3CQJA 2XPKA 3NL2A 4NAFB 2NQLA 5DELA 2V3EA 5CXPA 1HP4A 3I68A 4F2BA 4HCDA 3WIJA 1EUAA 1LG1A 1XKYA 5FSDC 3L0GA 2OELA 5GVJA 4X2PA 4YPJA 4UQ9A 1DWFM 1EXBA 1CWYA 1QI2A 1HJXA 5M5DA 1OGGA 2QMKA 3GDKA 1AFSA 1XV8A 1QASA 2HNEA 3CIVA 1TKKA 2D24A 9XIAA 1Y0EA 1PBGA 1K8YA 2Z25A 3AIEA 1F9CA 5E9AA 1V6WA 1BAGA 3QYSA 4LCQA 4NJGA 1W2PA 4PTXA 3M0ZA 3ITCA 1H1ZA 5K7JA 1QWKA 3CT2A 1KV8A 2NLIA 4TQTA 4CGTA 1S2WA 1ZAJA 5IBXC 5C2CA 4UNKA 2XGIA 4URIA 1XM3A 4L1XA 4U3CA 1RA0A 3WBWA 5I09A 4XG1A 3T0CA 5E6YA 3K8LA 3SRKA 2OQYA 4UTLA 5B7YA 2R14A 3MT1A 1GJPA 3IJIA 4DJFA 3ALFA 3W2MA 2PDHA 2QF8A 4J3TA 3ARRA 3NR0A 5DF0A 3WQ4A 3ZFHA 3G18A 3PSWA 4PULA 1GKRA 4CU8A 4LYQA 3R8GA 5A8PA 3BOXA 1Q85A 3KE0A 3WO8A 5AECA 2FZ8A 3ZJKA 4BWLC 4G2DA 4RCXA 2PDIA 2OKTA 2UY3A 2W66A 2Z00A 1EO7A 3LBMA 5A2CA 3W23A 4EACA 1QHOA 4LANA 3E0LA 1MW0A 3DH7A 1UWUA 3W7RA 3TK7A 1IZKA 1C92A 4ZB2A 3IANA 3M0VA 3KBWA 1IE7C 4MSSA 5IHSA 4V28A 3DHDA 2PGEA 4H8UA 4ENLA 5AVHA 1JAKA 5CGTA 1KXTA 4CNUA 2CXEA 3AIUA 1H61A 4X3ZA 1V6YA 3UW6A 3BAJA 3E0IA 4LYKA 5IOBA 4HVXA 2WAGA 3G22A 2A7RA 5FEWA 3WEZA 1UASA 3WDRA 4OJYA 3VCCA 5CCZA 4L4MA 3M0HA 4U28A 2YBVA 1R7OA 6TIMA 1EA9C 4Y7EA 4D6IA 4IXHA 4FS9A 1W37A 5C9RA 2ZX6A 4UQCA 2GZXA 1GG0A 1QW9A 3S2NA 4XKYB 1JUKA 5B80A 2Z1BA 4PCSA 3VIKA 2X1RA 1CXKA 5CSYA 2XFYA 1TV3A 1QO2A 1MUWA 2W4XA 4AHOA 4OVXA 1XYCA 3KW3A 2CYGA 2I56A 1VIWA 1R3SA 3LU2A 5E9XA 4KCTA 3E2VA 2D3LA 5CBBA 4X0NA 5XIAA 5HJLA 1YX1A 2O4MA 4I9MA 2X1UA 4WR3A 5XIMA 5D2WA 2GDVA 4C6CA 3CUXA 1E0UA 1Z7AA 2VQUA 4DJEA 5TF0A 3ECQA 2H9AA 4AWTA 2BZNA 4GUIA 1E3ZA 2Q71A 4H83A 4WRHA 4S3EA 1XDJA 2PDGA 3PY2A 2Z7GA 1HQTA 3W28A 4O8AA 4CCZA 1SYTA 4ONVA 2VDGA 3ICJA 2BVTA 4QCFA 1WDDA 1KNWA 1C3FA 3BMXA 3INPA 3AHTA 3WMLA 3AAMA 3H2OA 4Q4SA 4I9TA 2EQDA 4HYVA 4UTJA 4UFMA 4I7WA 1BXCA 5EMYA 7REQA 2OLHA 1UBPC 1ZGDA 3WF2A 3M47A 4B5WA 1XDLA 2VFIA 4JFWA 3EXRA 2BS9A 3LCFA 1KKOA 1ADDA 3AIQA 3MKVA 2VEKA 1NWTA 3XIMA 2VP8A 3A9IA 2DH2A 1SW7A 4IZGA 4YL2A 2XIBA 3T08A 2E8YA 2OEKA 1W5NA 2YDRA 3LENA 3NPVA 2XUCA 1KO0A 3TONA 5A8MA 2YX0A 1KRAC 1QNVA 1C91A 4ZR8A 4DWSC 5TD4A 3L68A 5GQBA 3V36A 1OIMA 5BMWA 3WEOA 3C0JA 3U3HA 4EE9A 1CGVA 1ALDA 2Y7EA 1GYLA 1SO5A 4HPJA 1F05A 2OWXA 4YTSA 1NELA 1XYFA 4HZ8A 4JIQA 1XBXA 1VQTA 2BY2A 1MYRA 3LXBA 4M6QA 5AKQA 1I2NA 1OC5A 4NF7A 1EIBA 4HU3A 1VRDA 1YNQA 4MADA 3HV9A 1MQQA 2E9LA 2QCFA 4JTHA 1ONWA 3IJ7A 3KUMA 4UMBA 2ZX8A 3RILA 3W86A 3R4IA 4A3RA 4WGXA 1M41A 3UG4A 2AGTA 3M0XA 3MVIA 2C3ZA 1RD6A 3TZFA 1X97A 3LQLA 3MP3A 7ENLA 1V79A 3S1GA 1LOSA 2X1TA 2CWXA 4FX7A 4W84A 5BMXA 2OKOA 3T4WA 1OY0A 4JNZA 2OVLA 2J4GA 3GQYA 3T2OA 2DZSA 2WKLA 2QW5A 1XIEA 4PRTA 2WPBA 3MQTA 2P3EA 2NQ5A 2FB3A 3T0AA 1RQHA 5JIPA 1Z41A 4RNJA 5CSSA 1AJZA 3QY7A 5HPOA 2XHYA 4GE8A 1ONXA 4AG0A 2BV9A 3AU2A 2Z4GA 3GSMA 5DMNA 4GY1A 1OGBA 3IVSA 5C9WA 3CK5A 1Q45A 4GUGA 4BJHA 3WD2A 4BF9A 2BG5A 1ZP4A 3MP5A 1L2QA 2PLJA 3VVGA 1W3KA 1W9BM 4IUOA 4C5ZA 3TN6A 1ZNNA 4O0ZA 3SR7A 1AW5A 1RP8A 2FGBA 3VM5A 1W1ZA 3UR2A 4LUTA 2Y4SA 2DFAA 4D2JA 5FESA 5E09A 4HA3A 3UD6A 3QC3A 3TFXA 1H60A 2PZNA 4IPNB 2DZXA 3RRXA 9XIMA 3JU2A 4RE3A 3VGFA 1PKMA 1B9ZA 2QF7A 3B04A 5LNRA 3NL3A 1QNQA 5EBUA 3QMRA 2YW4A 4O0KA 1E4NA 1DEDA 1CDGA 1ZTVA 3QFWA 3CYVA 2HROA 2R1KA 1KTCA 1OG0A 5D8WA 4F0SA 2XU2A 4HCLA 3KBNA 4B5NA 3MUIA 4NXSA 2VEMA 4PUWA 2C91A 2QUNA 2VD9A 2R1MA 4LC6A 2IQ0A 3ZOAA 1HO4A 3CPGA 1GG1A 4EX4A 2BNJA 2P8CA 3GG8A 1EBHA 3HTWA 3LZ5A 3BE7A 1ZS2A 2ZUMA 6REQA 1VPQA 3KZPA 5D05A 4XBKA 3AS3A 3WQEA 1FCUA 4AD4A 2DT0A 2OXNA 2NSXA 2G97A 1TTJA 5FJRA 3H2FA 1PKYA 1M68A 2YPIA 3S2LA 3NL6A 3W38A 4QIUA 2WLYA 4F40A 4LYPA 3L4UA 3K4AA 1IEWA 3N2OA 1W3JA 2BODX 3RCYA 2FVLA 2ZX7A 4ZZ9A 2IPWA 3SDOA 4AC1X 1YMYA 3H22A 3PNZA 3MHFA 3MCNA 4LF2A 1P0BA 3G3DA 1SW0A 4KFOA 2PTZA 3F4NA 1J96A 1V93A 2CERA 1G6CA 1UIOA 1I2PA 3T0TA 3WZ0E 1QK0A 2FZNA 4DF0A 6ALDA 4LVBA 5T26A 1W1YA 1PZ3A 4UQDA 3FEMA 3HQ1A 3EEGA 3TKFA 1X8FA 2VCAA 3VGDA 2DVUA 4GQGA 7CGTA 3VIFA 3W2KA 3DEQA 2XN1A 2ZTKA 4R9OA 3ZVIA 1MEIA 3TWBA 2XWEA 3AXXA 4E8CA 2DT2A 5I2UA 1Q6GA 2YL6A 2FJKA 2I16A 3GR7A 3QOKA 2CC0A 1U5VA 3BJSA 1ISYA 5E1QA 1JDAA 1XGEA 2C6QA 3IUHA 4L61A 4GQRA 1MUMA 4FXJA 3CXOA 1JCYA 3DG7A 1OYAA 3PBGA 1UWQA 4MZYA 3B9EA 3A47A 4V33A 3EWXA 3WDHA 4NZFA 1K70A 5EB8A 1VFMA 5C70A 2DQWA 4O50A 3KOFA 5ABGA 4LVFA 2GVJA 1JZ6A 1SUXA 2OYLA 4JIEA 1EJVC 2NUXA 2XINA 4CNSA 4O17A 4MG4A 4RDWA 5HUOA 1GCYA 2GUBA 3S83A 1WDSA 1EXPA 5HQEA 3LG3A 3O8AA 3QEZA 1WXZA 2Z2UA 2DZBA 2BOEX 3D46A 4QLKA 2B4GA 3WNMA 1MXGA 2HBXA 1XLDA 4QBXA 2PDKA 2WMHA 3NQ7A 4ML9A 2AL1A 3Q2DA 2ZRWA 4NL1A 1QOXA 2BSLA 5C9ZA 2CZDA 1VJIA 2J88A 3AYSA 3ZJ8A 4CD5A 4OOUA 1UQYA 4DJFC 4NU7A 2QHAA 1B31A 1OZMA 3U4FA 1K3UA 1KKRA 3RRAA 3N6HA 3GIPA 3SRHA 1ZBKA 3N2XA 2ZZ1A 3ONBA 4IXXA 2YL9A 2VOMA 3F5LA 3QC0A 1EJSC 4GUHA 3ARPA 2BOGX 3BGGA 4PUDA 3KM8A 4L6DA 2AL2A 5BU9A 1AODA 1Z42A 1AQ0A 1YHTA 4GUFA 5I78A 3TW9A 4DELA 5KZ6A 1KBLA 4IP5A 3U9IA 2VFEA 1DJIA 2OGJA 3E9AA 2OJPA 4IG2B 2PRMA 5L6UA 1D2KA 2ZUUA 5DCEA 2E5BA 1PYMA 3V1PA 5HUPA 3GG0A 3CNYA 4GYKA 4YLWA 4YTQA 1CNVA 1Q6FA 1YXDA 1OD0A 2FFIA 1VFHA 1FKWA 1R3VA 1KXVA 1DIKA 4R34A 4TMBA 4ZVJA 4NAFA 2FH6A 3HV8A 4LC8A 4Y9AA 3NSNA 3FNDA 3G6LA 3KRBA 4H9YA 4S23A 1CXIA 2FJUB 1FP8A 3NQBA 2PWFA 3PWIA 4CCCA 4AISA 1V08A 4KESA 2WC4A 2DDXA 4GJ1A 4AZCB 3UZZA 2WJDA 4IIHA 1QWGA 2XM2A 1UD3A 1JPIA 2WC3A 3S46A 1PIFA 1V02E 2FVKA 1A5UA 5FACA 3NYZA 5DT5A 1FTXA 2R9RA 3KS5A 5HATA 1DJYA 2DT1A 3A13A 3OQEA 4UUIA 4MY8A 1TWIA 1A3WA 1V3JA 3DC8A 3GDRA 5LIXX 5AHMA 1WKFA 1WE5A 4PMOA 3QM3A 3NO5A 1S2VA 3WD3A 1UG6A 3XISA 3SCOA 4DYKA 2I9UA 1XLJA 3PPFA 1U2YA 2X05A 2Q01A 4HB7A 5D03A 2O7QA 4C6KA 3BZJA 4PODA 3OG2A 1IEIA 4S3GA 2XSAA 1V7YA 1B0IA 4XVDA 4NAEB 3S6DA 1B3VA 4TMCA 4I7VA 3UP8A 2WLZA 1LRQA 4KEZA 3U48A 3H4XA 2FTWA 3VKKA 3ZR4A 3L0KA 1H5YA 1DIOA 1F73A 3CUHA 2BASA 4M6PA 3OODA 1W1VA 3GIQA 2XIIA 1FHLA 2VYOA 2Y62A 5CZKA 3BV4A 3W72A 4PL1A 5LA2A 1BXBA 2IPGA 1E43A 1FWNA 3WNNA 1S5WA 4UOZA 2CZ5A 3C52A 1JZ3A 4D6HA 1FOBA 4NZ4A 5HK4A 3H2CA 3BAYA 1QO5A 3UZXA 2NUWA 2TODA 1CB7B 3W07A 3UWWA 3TJXA 1W5MA 2G95A 3FAXA 3LI1A 4RLIA 1WAWA 3HG2A 4A8RA 3KVKA 5AOUA 2OCZA 4L6HA 8RUCA 5I3DA 1V3IA 2E6FA 4A05A 1F2JA 3SCTA 4EPDC 2OR2A 4DYJA 1HF6A 1TWWA 2CCRA 1ICSA 2DSZA 3WDQA 1JRCA 2QGYA 4O4WA 4EPKA 1JG9A 1IIHA 1RLDA 1A5MC 4NNAA 4HSOA 5K9DA 4F2TA 2ICSA 4XAGA 1UHVA 4MPQA 1F5ZA 4NJJA 1G94A 1NJJA 3RXZA 2FPVA 2QV5A 1WBHA 1ZBWA 4ALDA 4XKYA 3CAVA 2ZUVA 5BOEA 3AJXA 2JFEX 4C6LA 2NT1A 3W2UA 3T1GA 4PMRA 2G4FA 3DECA 3QHMA 3TNBA 4AY1A 4LS0A 4GC3A 1FWWA 1E40A 4GNJA 1N55A 1TWDA 3LRMA 4JKKA 3TCEA 1FCVA 3TC7A 1F3XA 3KWSA 1U5JA 3UU0A 3WNKA 3EKGA 5EMUA 1G4EA 3WMCA 3AIWA 1ZB5A 1S3TC 4JX6A 1PVNA 1B3XA 4AZBA 4WQ6A 5BWAA 4AQLA 1NWRA 1XIIA 1Q8AA 1H0IA 4XZWA 3N19B 4JY9A 3IVUA 5CPSA 1AMYA 3LPFA 3ME3A 4W93A 3GNDA 1RY8A 2J66A 1EL3A 3M0JA 4XIMA 3ZR5A 3JZEA 4D6FA 3UY7A 4FAMA 4QJ3B 4PZVA 3TYEA 5AYBA 1GUVA 2GJLA 4XBJA 2J13A 2DZUA 3C0QA 3QBUA 2GOKA 4PCPA 2ACUA 4S3KA 4QG9A 2Y7GA 2TSYA 1Z3NA 4BQ5A 2VTFA 2GVEA 2XIJA 2FIQA 1G69A 4PFMA 3C5QA 1YPIA 1P1XA 3HMCA 2J74A 4NRRA 1EWEA 2QJGA 1KW1A 4ILSA 3UYIA 4DJDA 1HN1A 4GYJA 2GSEA 3DC0A 1GVQA 1NP0A 4DY1A 3KHDA 2WMGA 3N1AA 3KZSA 1X38A 3M07A 1JI2A 1P0EA 2ZFAA 2VWTA 3AOFA 5I03A 1POJA 1GVFA 1IQ8A 4YCOA 3QN3A 1QXLA 3ZXWA 1UD8A 1CGWA 4N6FA 4YWIA 4P7RA 5M2FX 1VYPX 1GW1A 2HXUA 4E5TA 4GYPA 3H54A 1KGWA 2A2IA 3WNPA 2VI0A 3OP2A 5KINA 3T0DA 5FL0A 3APGA 1FWTA 1QUMA 3IJLA 1DWAM 1DHPA 1SFSA 3N4AA 3MC5A 1TCDA 2HE5A 4MYAA 3UCDA 2WPGA 2OEJA 3RU6A 1DWHM 1RY0A 5CGMA 3CWHA 1JUEA 3CWOX 4LOCA 1CW2A 1HKMA 3T09A 2DSUA 1XSKA 4Z2JA 1A47A 5M3WA 3VMOA 1FWDC 5K4ZA 4QQ3A 2A79A 1W32A 1TUFA 4FX6M 4L4PA 3KXQA 4U3AA 4PTDA 3SRFA 2B7PA 5EU9A 1GGOA 4EVZA 1EGVA 4GJIA 1D3HA 4B15A 2EEXA 3CH9A 2Y8KA 2UZ9A 1U33A 1FXQA 2OSXA 4JQ1A 1EZWA 4E0CA 2E4TA 2XTKA 3V35A 1YBQB 3AWOA 4YWSA 4RNFA 2ZOXA 2QUTA 3QLLA 3IARA 4JFSA 1QK2A 1S5VA 2R1NA 4XSLA 2VRKA 3TV8A 4HOWA 1XHGA 4LJ3A 4QM1A 3MB9A 1Y65A 3UXAA 1IIGA 1C9DA 4ZA0A 3EWWA 3CLWA 3I7QA 3G1XA 1T8QA 3L2MA 1I2QA 3UZWA 2VGBA 4ERAA 1AD1A 4DO4A 3AI0A 3NO1A 1JDDA 1PKNA 3NFUA 4C1KA 2Z1KA 2PWHA 3VXGA 1DORA 4Q8NA 4Y8EA 4UTHA 3CMGA 4LVDA 1E4IA 1NU5A 1VAHA 3HIJA 3V4BA 1ME9A 3CUIA 4KEUA 2RDTA 3LBCA 3GHSA 4F0MA 1G1YA 3ARSA 5J8LA 4OZOA 2QCEA 4X2RA 3TTOA 2V67A 1F3WA 4R85A 1AG1O 2WWCA 5LYRA 4H9XA 1BKHA 4X0VA 5H8MA 2ZVRA 1QTWA 3SW6A 1P7TB 2H8XA 4IX0A 2DT3A 4V1YA 2HEJA 5DEZA 3QYQA 3QSRA 1TX2A 3QTGA 1FP9A 4JIRA 3GC5A 1M04A 3SCWA 4AZHA 4DF2A 1XD1A 2XVGA 2DSKA 4CVUA 3G1YA 4L1WA 3ZJ6A 2IQDA 1IT8A 5CJ5A 1SZFA 3EKZA 3OW1A 1OC7A 4W85A 2YDQA 1RQEA 1UD5A 4C6PA 3QZ6A 4QSHA 1TPFA 1UKPA 4HU0A 2EG6A 3HM7A 4PFHA 4R27A 3EYPA 1H50A 1R9XA 2VUNA 1LG2A 2ADAA 1ZJHA 2FTPA 2V0TA 3LSBA 4TUFA 3VUPA 5K9CA 1QPQA 1ISWA 3L4VA 1PL9A 1K9EA 3ZT6A 4FEZA 4R53A 1DBTA 3L67A 4U2YA 3WF0A 1OK6A 3BQ6A 2J7BA 3WJXA 4KMQA 1EHNA 1SMAA 4NHVA 4LXFA 2PURA 1ZUAX 5HNRA 1JDEA 3T7VA 2YCJA 4RZ4A 3W7CA 3DGBA 2ZA1A 3W4RA 3CM4A 3NPUA 3WLLA 1EP3A 3VD4A 5FJPA 3KOXA 2CKSA 4MFDA 3NTYA 4CUCA 1UP2A 1VPXA 4IT1A 3PBWA 1IGWA 3N9KA 5JIWA 3JR2A 2V5KA 3C8FA 1PHWA 5JBDA 4PTNA 4M51A 4UCGA 1UR3M 1OVDA 3BVJA 3GAKA 1CI1A 4KWOA 3BG9A 2VCBA 4R88A 3TYDA 4RKAA 3M64A 3RCMA 4AF0B 4AWSA 5CGQA 2PWEA 3NQFA 1YE4A 5RUBA 4QE5A 1A5CA 3ITOA 3MJMA 3W1LA 3DFYA 1TE1A 2Z28A 5FCZA 4RXGA 1CLXA 1UZHA 3T40A 1J0JA 3W27A 3BANA 4AD5A 1OSEA 4NZ5A 3C56A 2HJPA 3EWBX 3VOCA 1O5KA 5J5RA 1BGAA 3BAIA 2MANA 1UZ1A 2IKIA 2RUSA 3NQEA 4US5A 4FLOA 2ZZ2A 5FEPA 1W3HA 1VKFA 2QUMA 4C91A 1DJNA 4DBWA 3UF9A 3TW7A 2FQIA 1R3RA 2FZMA 2NT0A 3GR4A 2NWSA 3SUVA 4MGGA 4FIQA 2UBPC 5AHLA 1X1NA 2BXVA 1Z32X 1XI3A 1ZFJA 5A6AA 4WGHA 3IJ8A 2WO5A 1ODUA 1CB2A 3C8NA 4LAMA 4HPNA 6XIMA 2VR4A 1A3HA 1US0A 1LTDA 1TE6A 4MTVA 3PWGA 2PS2A 1PE1A 4FALA 2X09A 1QOQA 2D1ZA 2WANA 1WXJA 5CPQA 1TV4A 2Y5EA 1J8VA 1J2BA 6XIAA 5BW6A 1XBVA 5FJOA 1LQ2A 4PBEA 1R86A 1BKSA 1J79A 3W76A 2G8ZA 3S5SA 5AN7A 5AYIA 2P3ZA 4LAOA 1FWSA 4DAFA 1HW6A 5KEZA 4K8EA 4AHPA 1R3TA 1PZ1A 1ZY9A 1A0DA 5E5CA 4UTWA 3OHIA 5FL1A 5CBIA 5T9CE 3TYBA 1THFD 2ZX5A 1FWCC 4DZHA 3A3HA 4FHAA 4O1EA 4W7VA 4IG2A 3WQDA 4HHHA 3AYRA 3PZUA 3QQWA 5G2HA 3RM8A 1UWRA 5G2IA 4IPIA 4IICA 1F74A 3PANA 1OD8A 3MPGA 1Q13A 4JGDA 4Z2IA 4IPPA 5H8PA 5KZMA 2WYSA 3QV6A 1VENA 1V5XA 3MJYA 1VR6A 2F2KA 1I45A 4A3HA 2XIOA 4MDOA 2FLIA 3OA3A 3GTXA 5M03A 4C6MA 3ZLHA 4UMCA 1MQRA 4KCUA 1P4CA 1OABA 2FKPA 3F7JA 5JU6A 3WQFA 3PR2A 3ZR6A 3B9NA 2PGWA 1WUEA 3RM4A 4QDPA 4AZCA 5DMMA 1CX9A 1LL4A 4ZFCA 4JKLA 2EKCA 3V7PA 2NQZA 2HXTA 1BXNA 5AC8A 2EJ1A 3TC3A 3B9OA 1W8SA 2C14A 1FRBA 3GNOA 5AZ1A 3O1NA 1K6AA 1XD0A 2DGAA 1VBJA 1REQB 4Q8OA 3SRDA 1FCBA 2ZE3A 4JIHA 4ERIA 4LUJA 1JGIA 4Q6JA 1AW1A 4J28A 4QRNA 4I90A 1LM1A 3C6CA 2F61A 5TNVA 3N15A 4KFPA 3CAWA 2QVNA 3STGA 4JOMA 1E0TA 2PODA 3N25A 4H41A 3H2AA 5EFDA 2BHUA 1JUBA 1ZPTA 2REQA 4S38A 1SU5A 1A5NC 1S3HA 4DWSB 3NZ1A 4UBPC 1R0MA 2GOUA 3B0XA 4M29A 1XX1A 1LQ0A 2JEQA 1UKTA 2QVHA 4Q7IA 2ZXDA 2WSRA 3W7QA 2QJHA 1EQPA 2VX4A 3SY1A 1JVNA 2NXIA 3TLQA 4E2DA 1TTIA 2J7EA 2GVGA 1CECA 3EB3A 2XH7A 4RR4A 5I5RA 3E74A 1PX3A 4H04A 3W6MA 2VDIA 1YDNA 3WD4A 2A4AA 4PMZA 5AYXA 4B9Y