4JS3A

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with 057
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
365
structure length
365
Chain Sequence
b'TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with 057
rcsb
total genus 135
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4js3A00
1VLIA 1OYBA 2H3DA 1QAPA 3RU6A 2ZA3A 4AWSA 1KTCA 1Z41A 3V75A 1TREA 5H91A 2A7RA 3HG2A 3G0SA 1LBMA 1F2JA 5K4ZA 2BLEA 5AB3A 2ZRZA 3MJYA 1RV8A 1NFBA 4RK8A 1DHPA 3G0XA 3UWQA 3W7CA 3LHWA 1UJPA 1GG0A 1D3HA 3O1NA 4G1KA 4ZQPA 4C1LA 1KFKA 1TV5A 1R47A 4ZL1A 3NPXA 3GR8A 1ADOA 5BOOA 1QPOA 2VOMA 1FXQA 3STEA 3TSMA 1H60A 3HIJA 3FIGA 6ALDA 3B06A 4M7SA 1J2WA 3G1SA 3G1DA 1KM2A 1J4EA 3EKZA 3LRMA 1WQ5A 4OBTA 1UB3A 1LZOA 4AXKA 3W74A 3N2XA 3VNDA 3BVJA 3PS7A 2CLIA 4M7TA 3UWZA 4ORIA 1TRIA 2WO5A 3WK3A 3QW3A 4N2YA 2DZSA 4KFPA 3WJWA 5I3IA 2X16A 4LS1A 3LHYA 3TUUA 1QPRA 4UMBA 4QNEA 1GQNA 1NVMA 5DCBA 1A5BA 2J24A 3CT7A 5EY5A 3TMLA 3LCGA 4OV4A 4HNUA 1W3TA 1XDLA 3E0IA 1NEYA 3GR7A 2YR1A 3UXAA 3ZR4A 1H7RA 1TCDA 4JTUA 1GVSA 2CU0A 4WX2A 4DF0A 3BG3A 2RFGA 4D2JA 1YYAA 2ZBTA 3T44A 4KFNA 1BWKA 1AL8A 2DJXA 4IQLA 1VYRA 4RLIA 3QMRA 4RZ4A 4RCXA 1Q6LA 1MZHA 5AHIA 4XBKA 4TO8A 4LS2A 1EIXA 4MY1A 1M7OA 5F2MA 1TPVA 3NL5A 4CCDA 4HNVA 2B0MA 2YW4A 3A23A 3M5VA 4ORMA 1GTEA 4PFMA 3GXPA 3SFKA 5AHNA 2V2CA 5HUOA 4FXRA 3FJLA 3KHJA 4LY8A 1W37A 3L0NA 3TV8A 2BWGA 4JTJA 3P8JA 2ATSA 4H4IA 1TO3A 1KFBA 3TCEA 3W7OA 3NOEA 5AC6A 4LWWA 1OFEA 4Y96A 3W1UA 4CNNA 2ZYFA 1RPXA 4EWND 4NJGA 2ZZ2A 3IIZA 4LC6A 4Y90A 1F6KA 2G95A 3P80A 2NV2A 2NXGA 1TPUA 4BFAA 1SFJA 1W3IA 3LGEA 5L6UA 1QDSA 3W6YA 4Z1AA 3EWUA 2QR6A 3W75A 3L67A 3TDFA 5BMWA 1FWTA 4KWWA 3TC6A 3JRKA 3PULA 1SSGA 1XC4A 5D38A 2E6YA 2CWNA 3NG3A 1JJKA 2YFOA 4J9JA 1YPIA 3KX6A 1SZGA 5EKYA 3TW7A 4FF7A 5FEPA 3DGRA 2C19A 5KTLA 4M6VA 4OE7A 1GVOA 3I65A 2VENA 1N55A 1H7XA 2BZNA 1T96A 4O28A 1IIGA 6TIMA 1WBHA 3PSVA 2VEKA 4YLWA 2XN1A 4GRSA 4M5PA 2EAWA 4HSOA 2V0TA 2CLOA 4RJEA 2IQTA 5D30A 5EMUA 3THAA 3IGSA 1FWNA 5FF7A 3BW2A 2VFDA 3E9AA 5K9CA 5E93A 5J5RA 4YMZA 4IMEA 1RR2A 1LBLA 4X22A 4MPQA 3STFA 1H61A 1LOLA 3L21A 3O05A 3IEBA 2QCFA 3C2FA 4DPQA 3QSTA 1AMKA 2CZDA 4DQWA 4WOZA 3OVQA 3U6WA 1TTQA 3DI1A 5D2TA 1LOSA 3PUDA 4A2RA 5LGZA 5BNKA 3RLVA 1L2UA 2ZTKA 4XTIA 2XN0A 3NNTA 1AG1O 5FF3A 1Q6QA 3W1RA 5D09A 4K38A 3NM3A 3MUXA 3G1YA 1OX6A 3W7KA 4HIBA 1VR6A 1OK6A 1O95A 2QCNA 3TFCA 5D05A 4GE8A 1XBXA 3P62A 4CQAA 2R8WA 3GAYA 5IBXA 4O15A 4PTNA 5D2WA 1B3OA 3W7RA 3W72A 2E6FA 3L65A 1X7FA 2V9DA 3DZ1A 3IVTA 4AMAA 4FHAA 1H51A 5EPDA 1K8XA 3L5LA 1GWJA 1MO0A 1PL9A 4GUJA 1RVGA 3EXRA 2JBMA 5IBXC 2CZEA 1HG3A 5EYWA 3LLFA 5T26A 1EWDA 2TSYA 1KW1A 3W1NA 2YX0A 3NXFA 4Z1DA 3DFNA 4NNAA 2B7NA 4HN4A 3QJAA 4ZMGA 1L9WA 1R46A 1W56A 4TMCA 4UNKA 1S5TA 3G0UA 5AN7A 3UWVA 4MYXA 4LVBA 2PCQA 2ZDRA 3D0CA 1H1ZA 1YLVA 1K7EA 2YW3A 4FO4A 2ISSA 3C56A 3PG9A 3TXVA 3OIXA 4ZQNA 2X1UA 3W1AA 4JTEA 1M7PA 2Y62A 3HJZA 3LDVA 3ZS4A 1ML1A 4JYEA 1LM1A 4DPPA 1L6WA 2QCMA 1QPNA 1QFEA 1R2TA 3U2OA 4O1DA 1JRCA 4RZ6A 1W5QA 1YPFA 3UD6A 5F4SA 1P5BA 1FCVA 1TPWA 4CNPA 1T0OA 3NQCA 3NQ6A 4QQ3A 3FEMA 3SI9A 1DVJA 1T99A 2QAFA 3O6YX 3QMTA 2YDAA 4DO4A 4HKPA 3LOTA 4O54A 4QNWA 1I45A 3DKLA 3F4NA 3ZWSA 3LTSA 3Q37A 1PVNA 1KM3A 5DXYA 4POCA 3MWAA 1TRDA 1LP6A 3GXNA 3H54A 1KLZA 1Q6OA 4UFKA 4FX6M 2EPHA 1EP3A 3SJ3A 3GDRA 2G97A 1H5YA 4I7UA 1S5VA 4X9SA 3DAQA 5LNWA 2VEMA 4JICA 4BWLC 2Z6IA 1GTHA 3M43A 4FB7A 4JY8A 2R91A 4NJIA 1WAUA 1EUNA 3NL6A 4GUGA 4U4MA 4CLMA 2WNQA 2B4GA 3TROA 2YFNA 3BK0A 3N3MA 3RMJA 3TW6A 4RV8A 1OX4B 1WXJA 4NNBA 4GNJA 4JTKA 1JULA 1T8XA 1Q45A 2BTMA 3DFPA 5DCEA 3G8EA 3KFTA 3LI0A 3ABOA 4NJJA 2V2DA 3CTLA 2TMDA 4C1KA 4PL1A 1DJQA 4BI5A 4UTIA 4JX5A 3VCRA 3S1WA 2NLIA 4N6FA 2A2IA 1ME7A 3W2KA 3PB0A 3W2MA 1ONRA 3UPWA 2GQAA 1YDOA 1V5XA 2NWRA 5I3KA 3N9RA 2AAMA 4EF9A 4ONVA 1O94A 1ZAHA 3LB0A 2ZRVA 1EEPA 3O06A 4MIMA 4O0KA 5HINA 3GKAA 3PSWA 4O10A 3EX1A 3M0ZA 1XCFA 3UPBA 3EKLA 4K7VA 3W7IA 3PF3A 3G18A 4CCEA 1UUMA 3IIVA 5G2WA 2ZTJA 1SW0A 4GC4A 1Z48A 1OABA 4CCCA 1K03A 3OHIA 3PR2A 4EIVA 3DH7A 1ZJIA 3HBLA 1OFQA 1DORA 3QQ0A 5LKYA 3IIOA 2GJLA 2OJPA 3PM6A 3UY7A 3LRLA 5K3VA 3BG5A 4ZZ9A 1RZMA 5HNRA 4TU1A 1WYIA 5AYZA 3ABQA 5KSWA 2NX9A 1IXOA 1H62A 3W1QA 3C2OA 4O1CA 4BI6A 3SY5A 1DOSA 5AOUA 1BEUA 3LV5A 1IF2A 5HUPA 3RLUA 2ZRUA 4AB4A 4UNLA 3EXSA 3W87A 3W1TA 1OHLA 3NL3A 2DORA 3W71A 2DZPA 3NYZA 5AHFA 3DFTA 3BLEA 1FDYA 3S1UA 3DHFA 5AYYA 1E51A 3BPWA 4OT7A 4XWUA 2Y61A 3TAKA 4UTJA 1G67A 3TNOA 1UBSA 4N6EA 1A53A 4JS3A 1P0NA 2WKJA 4M6QA 3KVKA 3SIZA 5KZDA 2QJHA 1TSIA 5EBUA 5D2VA 2Y85A 1OJXA 1H63A 4AF0A 1ZNNA 3I7QA 5CKSA 3VI2A 1ZAIA 3KAOA 3GDLA 3B8DA 3IGUA 5G2IA 1EPXA 2YYUA 2R94A 2ZA2A 1ICSA 2WNNA 1D9EA 4DBEA 2G5WA 3BV4A 3SGZA 5K9DA 3S42A 4LNYA 1YXYA 1SZEA 1C29A 2Y6ZA 3PVFA 5SWUA 1YXDA 3KVLA 3HPSA 3TU9A 3BGJA 5HR6A 3TK7A 2C6QA 3LCLA 3QQ1A 1TQXA 3DENA 1V7YA 1KM0A 2OT1A 3LCFA 3MYOA 4GJ1A 1A5SA 1GVQA 5I3FA 3M44A 3LI1A 5F1VA 3QW4B 1TQJA 4LC8A 1WBJA 4JY9A 3QEZA 1OFAA 4NX0A 3MYPA 5F4WA 1TJPA 3LHUA 4DELA 1B4KA 4OHQA 4NXSA 2FTPA 3LXAA 3DU0A 4FNTA 4NUWA 2A1YA 2E6AA 5DN1A 3GKFA 1GEQA 1W0MA 2J9YA 4HSNA 2XFWA 1KFCA 4PEKA 2WJZA 2FDSA 4NX5A 1OFRA 5C5YA 3M5ZA 3TSDA 3S5YA 4DXVA 4GUFA 3S5OA 3JR2A 2Y7GA 2VELA 3DBPA 4O53A 1Q6RA 4PC8A 3UWYA 4A29A 1GT8A 4Q32A 1WV2A 4JX4A 2W79A 1KM6A 2QDHA 4TX9A 3RK8A 1N8FA 3W86A 2ATMA 3TQVA 4UTWC 1VRDA 4O1AA 3LERA 1LBFA 1ZAJA 4EOUA 4UTKA 4O50A 2A7PA 3I7SA 1FBAA 2EF9A 4FX7A 3W1PA 1XFBA 1S3HA 3NQ2A 2DZWA 2JKAA 3MMTA 5F2LA 3HMJG 3NVTA 3TFXA 1K8YA 3MBDA 4AHPA 2CZFA 2V30A 4JGDA 3O6DA 3IVSA 4N9BA 2Z0IA 4E0CA 4DO5A 3NZRA 1MEHA 4MY8A 2WQPA 3TX9A 3QPYA 2XN2A 3FKKA 3ZWTA 3THQA 1LRQA 1TTJA 4MFDA 3IIXA 4RXGA 4M6PA 2QUTA 3P5YA 4JEQA 3GLCA 2I1OA 2QCGA 3N2MA 1UUOA 2J9XA 4O12A 2A5HA 1FCQA 3T4CA 3EB2A 3I6RA 1H50A 1F73A 2YPIA 2PRHA 2E09A 2B7OA 3BO9A 3UY8A 3GK0A 2BSLA 4OGZA 4OWGA 1YTDA 1PV8A 2FQIA 3N9SA 1XBZA 3W1LA 4GXMA 5C54A 1JRBA 2A85A 3F1QA 2VFEA 3CWOX 3C0JA 1LTDA 4N9CA 3HF3A 4O57A 3W7JA 1D3GA 3UZ5A 3IRDA 1OG0A 5F1UA 4AWUA 1JCYA 1CW2A 1F7BA 2WV8A 4IPJA 1QO5A 5CSSA 3CIWA 1VHNA 2EKCA 5LNSA 2QCDB 1F74A 1KV5A 5AYXA 4ALDA 4LUJA 3W7QA 1QOPA 1G7UA 2OMAA 3VE7A 5DXXA 2P10A 1OX5A 1AW5A 3CEUA 3OVRA 1VYPX 2GJNA 1H1YA 3R2GA 1I2QA 4JR5A 3A21A 3M41A 3MHFA 1HO4A 4FNSA 4DF2A 1HTIA 3FOKA 2A6LA 1X8FA 2GOUA 1X1OA 3L66A 5DY3A 4X2RA 5E0KA 3TXZA 3FLUA 4EVZA 2HS6A 2WSQA 1SW7A 3RFAA 1IXPA 1GPWA 4IMDA 4UR7A 3W07A 1ZHAA 3BG9A 1FCUA 3LM7A 4LV9A 2PRLA 3TIMA 4JTTA 1OX4A 2RDTA 3ABSA 4UTMA 3EX3A 5FF4A 4BI7A 1I2RA 3R5EA 1QO2A 5LNRA 4FNPA 4MZ1A 5C2XA 5CG7A 1VGAA 4FNRA 5U4NA 1F76A 5DELA 3ELFA 3OA3A 2YXGA 1YADA 2A4AA 3IIPA 2ZZ5A 3TQKA 1FWSA 3G1AA 2C18A 4QIUA 3L2IA 2FIQA 4NNCA 2GVLA 2AGKA 1ZENA 1EUAA 1YDVA 4WY0F 3W7MA 5F2GA 5FF0A 2C0AA 5KMYA 2FPYA 3L0KA 3N14A 5AC8A 2QUVA 5ABTA 1W1ZA 5TIMA 3NPUA 3G24A 3GAKA 1WOBA 3INPA 3LV6A 1FDZA 4IX2A 3MP5A 5U7SA 4P61A 3EWYA 2TRSA 3HGSA 3NQVA 2GVGA 5I3JA 3MI3A 1PHQA 3E02A 1JVNA 1RQBA 4WJEA 3UYCA 3L0GA 1RQHA 2QF7A 1GVRA 4DBDA 1JUEA 4NXKA 3QFEA 2E6DA 2QCHA 2NWSA 3GZ3A 2YGYA 3NDOA 1ME8A 4BK9A 3STGA 2RH9A 3M6YA 3P61A 4PL2A 1SU5A 5D04C 3WJZA 4JIPA 2JK2A 4MZ8A 2GUUA 3OEXA 4QAIA 3G1XA 1JQVA 2V5BA 3AJXA 3EWZA 5F2IA 3JS3A 4JYFA 2Q3OA 4N4QA 4CQ8A 4UXDA 3N73A 2J9ZA 2WNZA 2PRMA 4AH7A 7TIMA 3F03K 4YCPA 2RDUA 3EEGA 1N7KA 1AW2A 2ZZ6A 2Q3RA 3QYQA 3TC7A 3CWNA 3UXDA 1H7WA 2FB2A 4XUGA 2NX1A 4FIQA 1VPXA 1R2RA 3CIXA 4RZ5A 1JQXA 2Z2UA 3P67A 1W54A 4BWLA 4UUIA 4HNTA 3S8HA 4UFMA 4O52A 4H3DA 1QNVA 2G96A 4IX0A 3QPZA 4L4MA 2O7QA 5F4XA 2Y7FA 3NO5A 1VYSX 3C2EA 1XBVA 1K7XA 4JTLA 4QSHA 4IJBA 4RX0A 4O11A 2QCCA 5G5IA 5I3HA 3TMQA 2B7PA 3WJXA 1OYAA 2BXVA 3QMSA 4AF0B 3A24A 2NXIA 1U83A 4UCGA 1W31A 1LRNA 2X2GA 4BR1A 4O1BA 3VFLA 1IXNA 1JCNA 1SO4A 3G22A 5EA9A 1KM1A 1KBIA 1MEWA 1O5XA 4X3ZA 2CLFA 5C55A 3BLIA 4JTSA 5CZ0A 4JXCA 3S1VA 4IOTA 4H6KA 2CFFA 1QPQA 1O60A 3T78A 3NQDA 4FX8A 3NQ8A 4MKNA 2VFIA 4LW7A 3BARA 3AO0A 3QRHA 5K2ZA 5LHEA 3WJSA 1KTNA 2OCZA 3CU2A 1PE1A 2H90A 5DY2A 3ATYA 2C1HA 1XUZA 1GVFA 5CPMA 4RKAA 1FX6A 5D37A 1B57A 1GG1A 3GIYA 2GQ9A 2JGYA 3A5FA 3O8AA 1SUXA 1BKSA 2VC6A 3KXQA 1QWGA 4MYAA 3FA5A 3NQMA 2FFCA 4KKXA 5AHLA 2YCEA 3EX4A 4TMBA 2V5LA 1FY6A 4KWVA 2ZRXA 3QF0A 1SR9A 4UFHA 1UCWA 2FPVA 3W73A 1AK5A 5AFDA 5D32A 2Y70A 4E2DA 1G4TA 5BRBA 1TPDA 2H8ZA 3LXBA 3C4UA 2TYSA 2ZRYA 5CGQA 3W2NA 2CLLA 3LTPA 3P5ZA 1I4NA 3OVPA 3S5NA 1OFPA 2ISVA 1VLWA 1DQWA 3MHGA 3LTYA 3T40A 3U8GA 1CX9A 4L4LA 3PC0A 1LYXA 2ISWA 2H3BA 3L5AA 4PCFA 2CLMA 5HJLA 1JCXA 1X6UA 1SO6A 5AHEA 5FEWA 3L68A 5G4EA 3W70A 3CLMA 3NPWA 4TR9A 5C6MA 1EB3A 3NR0A 1TTIA 3TJXA 4JN6A 3W2UA 1XKYA 3OBKA 1A50A 4EF8A 1M5WA 4UTLA 3Q2DA 2VFFA 5TBOA 4LTSA 3SW6A 1H7NA 2A21A 3B0PA 4LRTA 2J88A 4W9TA 1NAL1 4S2BA 2C14A 3HQ1A 4WZHA 2H8XA 1EX5A 1KBJA 5BW6A 3NQ7A 4O4VA 2BX7A 4LU0A 3M5YA 5FI8A 4I7WA 4O8RA 2ZZ7A 2PE4A 1YXCA 2DP3A 3O63A 4BF9A 2D73A 1W3NA 3W2JA 3R13A 1W8SA 4UTTC 3W7GA 5K7JA 4IGHA 1SO5A 3W9ZA 5K4XA 3A22A 3BW4A 2C16A 4MLRA 4XTDA 3MI2A 1VC4A 1KTBA 4GUHA 1W5MA 2CZ5A 4XZ9A 5HULA 4PA8A 3KRUA 3NQAA 3PWAA 2HTMA 2ABAA 2QUUA 1OFOA 4Z0SA 3C52A 4N4PA 2QJGA 3M1ZA 4A21A 2EGZA 2ZCGA 4S2CA 3NZ1A 4FNUA 4IMCA 4K39A 1AW1A 1LOQA 3T55A 4LT9A 1OFBA 1SO3A 1TPH1 1I2PA 4O13A 3DXIA 4TIMA 1VZWA 4YL2A 2OT0A 3GX9A 1W5OA 2UV8G 4N02A 2X30A 4DO6A 2LLEA 1FXPA 5CZSA 3G1FA 1G4SA 1DKWA 3P81A 2GPTA 1WOAA 4ML9A 1DBTA 3LCHA 3HG3A 2Y88A 4WOQA 4JTGA 3L9CA 5CPLA 4PH6A 4YXGA 4AWTA 3NQFA 5DLCA 1KFJA 1NSJA 3O15A 2NZLA 2NUWA 3F4WA 2DZUA 1SZNA 4MLJA 2J27A 3R12A 4IMGA 3GVGA 2Q8LA 2E68A 1G7VA 4O17A 4R33A 4WD0A 5HWJA 1TJRA 3RNDA 3O6CA 1SFLA 3Q58A 2C15A 1ICQA 1OF8A 3A5VA 1QR7A 1A5CA 1GYNA 1PCWA 2Y7EA 3O16A 4QISA 4MFEA 1LROA 4MOZA 4UFIA 5IM51 1FDJA 3S9YA 1F5ZA 1KA9F 3TKFA 1SQ7A 4IPIA 1RQEA 3R8RA 3TR2A 2CLEA 4OV9A 1OYCA 3C2VA 1JUKA 5L9FA 2NUXA 4IXHA 2HS8A 1ICPA 3NPVA 1YTEA 3TE9A 2QCEA 1PHWA 5A5WA 1FCBA 1IXQA 1QCWA 1J5TA 1DQXA 4K6AA 3FKRA 1EP1A 4MJZA 5KINA 3HGJA 4O4WA 3HG4A 4CNOA 1HO1A 3QC3A 5D2XA 5KITA 4I7VA 4UFJA 4WXZA 2ZA1A 5HQEA 4OQVA 3KRZA 2GQ8A 3E12A 2C13A 3CPRA 4NU7A 3B03A 4K36A 2C3ZA 1U5JA 2B7QA 2TPSA 1DL3A 4R7JA 1F05A 2FB3A 1IIHA 1VS1A 3S0CA 3DFOA 3CC1A 2ABBA 1WDWA 4ICNA 2ZZ3A 3NM1A 1TPFA 4Y6GA 3BGGA 2I9EA 2EHHA 3PY2A 1MSSA 3KVMA 4UMAA 3NQGA 2W6RA 3GB6A 1K3UA 2OX1A 3SR7A 1KM4A 4XBSA 4NZFA 4CQ9A 3LHTA 3P60A 3W76A 3NQEA 1JCLA 4JTFA 3IGXA 5FF2A 3C2RA 5A8GA 3LHVA 1GYLA 3MI6A 2ZZ4A 4A3UA 4UTTA 1EWEA 2HMCA 1K8ZA 4IXXA 1QOQA 1XL9A 5GVJA 4UR8A 1WX0A 2NUYA 3PUOA 4UFLA 3SECA 1THFD 4OU1A 1G6CA 2YYTA 2VFGA 4O16A 5D02A 5LSMA 2VEPA 4QM1A 5KZEA 2E5BA 1BTMA 1W5NA 3B0UX 3DKJA 5D03A 3HO8A 5MHBA 1PIIA 4Z1CA 2V82A 4Z08A 4ZQOA 2DZXA 3C6CA 4ZQRA 3K30A 3QM3A 2JKEA 1JR1A 2NXHA 1TTPA 2P0OA 4LOCA 3LBMA 3MP4A 4JTIA 5K9XA 3W7NA 4YWIA 3EWXA 4YCOA 4A2SA 3W7DA 1WA3A 1VQTA 4JIQA 1AL7A 2QAPA 1X1ZA 1C8VA 3KOFA 2V81A 1TV8A 5AC7A 4UC5A 3GXTA 3PB2A 3W1MA 3HPXA 4MUZA 3WK0A 5LGXA 1JCJA 1S5WA 1Z44A 3P7YA 1K7FA 3I7RA 1RD5A 3TJLA 1F6PA 5KZMA 2X1SA 4N9EA 1R2SA 3W88A 1FQ0A 2ZRWA 3HGRA 2PURA 1LLZA 3T7VA 4LS0A 1XXXA 3E49A 4HT3A 1SZFA 4JDBA 2A7NA 4O19A 3HPZA 5G1YA 5BMXA 2CLKA 1VJIA 3FYPA 1FWWA 1YTKA 3B4UA 4WY0B 2FLIA 4O0ZA 4UTHA 2F84A 5D2YA 1I8JA 5EL1A 3LHZA 3LX9A 2Y7DA 2DU2A 3G8RA 4N9DA 2VKZG 4FXSA 4GBUA 1B4EA 1G69A 2H6RA 3O07A 2VFHA 4AVFA 3G1HA 5I3GA 3PG8A 4AAJA 1JUBA 1TV7A 1SPQA 2Y89A 3S5ZA 2WPBA 1GJPA 2J6XA 1BWLA 3KVJA 5CPNA 3IVUA 2ZZ1A 3W1XA 3B04A 4U28A 2QCDA 4Q4KA 5HR7A 1TIMA 3MBFA 4NVTA 1XM3A 5HMSA 4KFOA 2Y63A 4O14A 3ZFHA 3FJ6A 3LCIA 4MZYA 3TSBA 4K7YA 4ADTA 2E5CA 1IGSA 2WSYA 2NX3A 4O18A 3SZ8A 3UWWA 2AQWA 3USBA 1HUVA 3NGJA 1XUUA 1VHCA 5FEZA 1L6SA 3W2LA 2YSWA 1OK4A 1XBYA 4JTHA 1SW3A 3HG5A 3W23A 3M7WA 4LV4A 5DCDA 3W7LA 3N34A 3UNDA 4K37A 4JNMA 4QJ1A 4IUOA 2E77A 3NAVA 1KLYA 3PBWA 1H7PA 1K02A 3I68A 3EWBX 3GNNA 4RXFA 4WY0A 5H2ZA 5LZLA 3MHUA 3W85A 5HWNA 1L6YA 1MXSA 2R14A 3KRSA 3PBYA 2O7SA 4WUIA 4I9AA 2YZRA 2WSRA 3MO7A 4DF1A 1CI1A 4XKYA 3P8IA 4LVFA 5CPOA 2ZQ0A 4AEOA 5G1TA 3W7PA 8TIMA 2GVJA 3GNDA 5LNUA 2QCLA 1I2NA 3GYEA 5CZTA 1A5AA 1I2OA 3HOJA 4GFSA 2V2HA 3LRKA 2RDWA 4R34A 2A0NA 1HFBA 4K8HA 1SSDA 1TPC1 4UTUA 3C3NA 1EA0A 1XI3A 4WQ6A 5FEXA 2Q8ZA 2HSAA 3DHDA 2PC4A 4Z0JA 1OF6A 1W5PA 2ALDA 1UASA 3WFAA 3VE9A 4XKYB 3W3OA 3EX6A 5D33A 1VCGA 2CLHA 1QMLA 4B5NA 5AHMA 3M9YA 4Q33A 4Y8FA 1ALDA 1M6JA 3TA6A 1PCKA 4HPJA 5DBUA 4IMFA 1OFDA 3EXTA 4AHQA 3H53A 3BLFA 1VCFA 3W83A 1R30A 3CEPA 3B05A 1C9DA 3ABRA 3VKJA 3PBVA 4R53A 4DEFA 1DV7A 1LLWA 3EX2A 4P2VA 1DJNA 1Z42A 2QJIA 3G1VA 4S1FA 3FYOA 5LHFA 3LXCA 1ZCOA 4GUIA 3DI0A 3NEVA 3HGOA 4Z1BA 2WOQA 1NF7A 1KFLA 1P0KA 3Q94A 3WK1A 4PODA 4JX6A 4WXYA 5E1QA 1O4UA 5FESA 1ZALA 3EWWA 4FEZA 4FNQA 3S1XA 3P74A 4ADUA 3LCXA 1H7OA 4E2BA 2JGQA 3H55A 3GDKA 3ATZA 4NJHA 1FWRA 3STCA 4K8EA 3A9IA 3QZEA 2E5DA 3QSRA 2W0UA 1G4EA 4M19A 4RR4A 1LORA 4IWWA 1LDCA 1GOXA 3M5XA 1FUYA 1HL2A 4LVGA 2OZ0A 4ZVJA 3V1PA 1KFEA 1TB3A 3LLDA 4MVAA 4ADSA 5G4WA 3W7HA 4JD4A 1TYGA 1O5KA 3CB8A 3UQNA 4Y9AA 2DJLA 4HHPA 2A6NA 2Z1BA 1P4CA 1OVDA 1GZGA 1ME9A 2QKFA 3FFSA 3WJYA 3FS2A 2VXNA 1Q3NA 3CHVA 3CQ0A 3TH6A 3P84A 1YDNA 4UIOA 3UZJA 5TQLA 1LCOA 4XQ6A 1TMHA 5J5DA 4HPXA 2ZFAA 3W7EA 2I14A 2DZVA 4AHOA 2FPTA 4JDYA 3G3DA 1ZFJA 5LNVA 4UTWA 1PS9A 1TPB1 3RF9A 3S6DA 3MP3A 3NL2A 4HNNA 1XDMA 2RKXA 3PUEA 3P82A 5CSRA 1P1XA 2X1TA 4NZJA 3LBCA 2KZHA 3IV3A 5HWMA 3W84A 2P1FA 4LVAA 4MY9A 4NT0A 2QEZA 1JCMP 2E1DA 4LRSA 4E38A 1G4PA 4QITA 3M47A 3M16A 1Y0EA 3BW3A 3WK2A 2FJKA 3SSJA 3GDTA 2DZTA 1KV8A 1VCVA 4LVDA 1MEIA 3DFQA 2JKPA 3OG3A 2F7FA 4UMCA 3ANYA 2V8ZA 4ZQCA 5CZJA 2Z6JA 3C61A 3LCWA 4GWEA 2NV1A 1EP2A 4A22A 1B9BA 4MJMA 3QH2A 3YPIA 3B0VC 1ZY9A 1LRTA 3G3MA 3L5MA 3C8FA 4JYDA 3HB9A 2VEIA 4LUIA 3MW7A 3DFSA 3TQ0A 3UWUA 1TPEA 3PBUA 2X1RA 1KM5A 3NA8A 1VH7A 3W22A 3SGUA 3CM4A 4NQ1A 4NJKA 2QDGA 3PAJA 4FIRA 3TAOA 2RHGA 1NF0A 4ZQMA 5DBTA 3E96A 3N19B 3R89A 2CW6A 5G2HA 3GDMA
chains in the Genus database with same CATH superfamily
5FJIA 4NZ4A 2E8ZA 1QAPA 3ZT5A 2X42A 4DM2A 1KTCA 1EDQA 2Q8XA 3WBEA 4DXKA 3CNYA 1Z41A 4HMNA 3V0SA 2A7RA 1LBMA 3P93A 5K4ZA 2ZRZA 3MJYA 1RV8A 3VDGA 3HTWA 1E6SM 3H7VA 4KCWA 4RK8A 1DHPA 4PSRA 1XH1A 2J8TA 3RRXA 1GG0A 3IJ6A 4ZQPA 2BOGX 1HGYA 1TV5A 4J3TA 1O66A 4ZL1A 1XV8A 1ADOA 1V51A 2VOMA 3WQEA 3QY6A 4Q8TA 2PDXA 3HIJA 3FIGA 1RJPA 7CGTA 2FHBA 4W93A 4M7SA 3G1SA 4ACZB 1J4EA 4CCZA 3C0LA 1WQ5A 3VDAA 2GJPA 2YXOA 2X41A 2E0PA 3AMGA 4M7TA 3N2BA 1SJBA 1QI3A 1UR8A 2OEJA 1XINA 3WK3A 3FK4A 3QW3A 2F38A 2YA2A 2DZSA 4KFPA 1HKKA 3WJWA 4LS1A 3RAOA 3TUUA 3U4AA 4UMBA 1U33A 2WW5A 4UQCA 3ZT6A 5DCBA 3VUSA 3THDA 1E72M 1A5BA 5EY5A 3CHFA 3D47A 3ONCA 1VD6A 1A3HA 1DJYA 2GGJA 4PRTA 3BGAA 3WF2A 4A3YA 3WSUA 3TLQA 3SAZA 3UXAA 2PF8A 3FJNA 4IMAA 3W26A 1TCDA 3DOPA 5CCZA 2RFGA 4ACZA 1YYAA 2ZBTA 3VK5A 5H8MA 3SCPA 2INEA 3UT0A 4IQLA 1VYRA 4RLIA 3DC8A 3QMRA 4RZ4A 3DYPA 4RCXA 3CAVA 5CJMA 3SN4A 1Q6LA 1PKYA 5E5CA 1I75A 4QE5A 4TO8A 1EIXA 4MY1A 2G37A 3NL5A 4W5UA 1PTGA 4QDWA 3TTEA 2CZVA 3PJTA 4FMVA 3WNKA 5XIAA 1J12A 5A2CA 3M64A 4FXRA 2GJRA 4LY8A 2VZUA 3ME3A 3MV01 1J0JA 3W7OA 2VX4A 5ABFA 2TAAA 3CB3A 3RITA 4EWND 3IIZA 2ZVIA 5TAOA 4Q7IA 1XLBA 3VIGA 1HP5A 1ZBKA 1SFJA 1W3IA 3W6YA 4Z1AA 2XSBA 1RHCA 4L1XA 2F9RA 5GJMA 4ZA0A 3KHDA 2YL9A 3TDFA 5BMWA 4UR9A 3EOEA 4NY2A 3VIIA 1SSGA 5E9AA 4HB7A 4YYFA 2P0IA 2OEMA 4J9JA 4JIEA 1JPKA 1SZGA 5EKYA 3TW7A 1GQKA 5FEPA 3DGRA 2C19A 4EANA 3SCSA 3J7HA 1T96A 1IIGA 1RA0A 3NFUA 2XN1A 3ABZA 1JDEA 4AYGA 1POJA 1AA1B 5EMUA 2HXUA 1UWUA 4ZOCA 3PANA 1YX1A 1US0A 2VFDA 4DJDA 4PTXA 3K1GA 1DJWA 2VI0A 3STFA 5EMMA 1ISXA 1LOLA 4UZSA 3L21A 3IEBA 2QCFA 1TMQA 3CS2A 3ES8A 4DQWA 3LY0A 3HU7A 2YA1A 3U6WA 3DI1A 3AYTA 4JCMA 1TJ2A 2E40A 1RLCL 3DESA 2ZTKA 4LALA 5FF3A 2GK1B 3TZFA 5D09A 4GYJA 3NM3A 3MUXA 3G1YA 1OX6A 2VMFA 1ITCA 1IEIA 1JDAA 4GLEA 2YKKA 4HIBA 4DBUA 1X8CA 3W01A 3SURA 2QCNA 3TFCA 1XBXA 3MKKA 3KOXA 3QZAA 1LF1A 4I9TA 1V4YA 1IWAA 2OR2A 4R5EA 5D2WA 3W7RA 3W72A 3MCMA 2E6FA 3PZMA 3CT2A 2ALRA 3T2PA 1EJUC 1AMYA 4DYEA 4DVOA 1JYXA 1MO0A 3CV2A 2ZE0A 3EXRA 1QI5A 1CGYA 2CZEA 3LLFA 2INZA 1JG9A 1K9DA 1EWDA 1HVXA 1RBAA 4QG6A 3TYBA 2W61A 4Z1DA 1XIMA 3DFNA 1MUWA 2QMJA 5LYRA 4HN4A 1BGGA 4ZMGA 5DX7A 2GZXA 4TMCA 1S5TA 4PULA 4MYXA 2PCQA 2WVVA 4BA0A 2OX4A 2FGBA 3TEVA 1JCTA 3TXVA 3OIXA 2D3LA 3EDEA 4ZQNA 3W81A 2X1UA 5AC4A 1E1EA 3LDVA 1P0BA 3M0VA 5AYBA 1LM1A 2PDWA 4DPPA 3EA1A 4ROQA 1L6WA 2QCMA 1QPNA 3V18A 4Z42C 1VB9A 4M80A 4ERIA 1PDYA 1XH0A 3P3BA 3QR1A 1JZ4A 3F4VA 3CZKA 3UD6A 4NAFB 3NQ6A 1IEWA 4GK8A 3QMTA 4ATWA 1I45A 3DKLA 3F4NA 3ZWSA 4GVIA 3LA4A 1TRDA 1GQLA 3W6LA 2PZNA 4ZGYA 3GXNA 2ZX8A 4HZMA 3AS2A 2G3FA 3N6HA 5C7HA 3SJ3A 2G97A 2WHMA 3SCVA 3ZZ1A 2VEMA 4QX4A 4Z2LA 1WE5A 2Z6IA 1TV3A 1VFTA 2HBXA 3GHRA 3CUFA 4HK5A 5CH9A 4JY8A 2R91A 4NJIA 1WAUA 1W6TA 4CLMA 2WNQA 3TROA 1N8WA 3I6TA 3N3MA 3GHSA 4RV8A 5DMLA 1UWTA 1WXJA 4NNBA 4D6IA 3GW3A 4JTKA 4AVNA 1T8XA 1D8CA 3C86A 2J66A 3QQWA 1QPKA 4OJYA 3A4AA 4NILA 3UFYA 2BOFX 4RDVA 4NAFA 4LYPA 3D6NA 3TYZA 2DY3A 2DUXA 2NLIA 2A2IA 2JALA 3UG5A 3PB0A 1ONRA 4R3UA 3N04A 2GQAA 2QS8A 4Q6XA 3N9RA 1G94A 4EF9A 1ZAHA 4Q6JA 3U2ZA 1W91A 5RUBA 4BJHA 2W5FA 4O0KA 1W9VA 3GKAA 5BZAA 4AU0A 1XCFA 4JQ4A 1OG6A 3EKLA 3W7IA 3GNPA 3GH7A 2ZTJA 4B3ZA 1Z48A 4CCCA 1K03A 5I6SA 4LUSA 1FTXA 2GVYA 4H6QA 2V67A 4HNCA 2VTFA 3IJ8A 1DORA 3N2OA 4N42A 4PUWA 4LAKA 3W37A 3RG6A 1RZMA 3KE0A 1ZBCA 2PDPA 1HKJA 5AYZA 3KTCA 5KSWA 2NX9A 2P8BA 1C7TA 1C8YA 5AOUA 3RLUA 3CZGA 3AZRA 3H2CA 3ZSSA 3W87A 4E3VA 4ZSTA 3W71A 3W38A 4JOMA 2PTXA 3DFTA 3WLKX 1LWIA 3DHFA 5AYYA 1UQZA 1VKFA 3BPWA 4OT7A 2Y61A 4QBXA 4XWUA 4UTJA 2OSYA 2CHOA 1A53A 1FVPA 2PGEA 4XZIA 4M6QA 1RBOB 1MMFA 4J3SA 3MVIA 4H9XA 1NWTA 5E09A 1E4IA 3VXGA 5H1WA 1XG4A 2OSXA 2BGSA 2A3LA 2W66A 4PUNA 5G2IA 4GBDA 3QV9A 4JFTA 2YA0A 1OCBA 4DBEA 5CC3A 1W3HA 4IIBA 3S42A 4L56A 1YXYA 1WNOA 2ADAA 1BG9A 1YXDA 1UZDA 1HKIA 3KVLA 3HPSA 3RR1A 3TK7A 2YB4A 3DENA 3SQLA 3ISIX 1Q8JA 1LWHA 1A5SA 4GJ1A 1WDDA 1GVQA 4US6A 3T0BA 1B30A 1HNYA 3NJ3A 1V02A 4L61A 1XSJA 2SFPA 1HJXA 3WDIA 1ISZA 1OFAA 4NX0A 3MYPA 1K9TA 2OGJA 4DUXA 5JIWA 2XVNA 2XISA 2J25A 3BLDA 1GEQA 1ODZA 2XFWA 2ZWYA 4QR6A 2FDSA 4NX5A 5C5YA 4AUBA 3PZIA 1H09A 2FVKA 3S5OA 4CD5A 3R0UA 2Y7GA 1B1YA 2FJUB 2HROA 4WSJA 3KWXA 1M01A 2HVOA 2P3EA 1TE1A 3JUGA 2NW0A 4UTWC 3LERA 1GOKA 1LBFA 5JMUA 7REQA 1X98A 2XU2A 1R3VA 3I7SA 1FBAA 4J2MA 4XIMA 3NQ2A 2DZWA 5A2BA 2L5HA 4V2XA 5F2LA 4LNCA 3HMJG 3WNNA 3GNOA 3AS3A 3TFXA 1QNSA 4GGHA 1XCXA 4AHPA 2V30A 1AZ1A 4ZO7A 4N9BA 3NO1A 2Z0IA 3UESA 1ZJAA 3TTSA 1Q6GA 2VZTA 3WNLA 1LRQA 5FJTA 1JIBA 1UMYA 4MNKA 4PMZA 3ZOAA 1D7FA 5JBFA 2J9XA 4L5ZA 3WMSA 3C0QA 3EB3A 2QJJA 2XWEA 2HXTA 5EMJA 2QJNA 2ZC1A 1IR2A 3WMLA 3UY8A 2VOTA 3GK0A 1YTDA 1PV8A 4MJ2A 2GUYA 1FP8A 2ZXQA 5C54A 2A85A 4LYRA 1JF6A 1LTDA 2J8GA 4N9CA 3HF3A 5FJOA 4KEUA 2ONEA 4O57A 1H41A 1OG0A 1KXTA 5F1UA 3V3WA 2OWCA 4AWUA 4IIHA 4JTAA 1TKKA 1QO5A 3CZEA 2E67A 3N15A 1KV5A 5AYXA 2XH4A 1EQPA 4OOUA 2P10A 1AW5A 3CEUA 3AMLA 1A3WA 1H1YA 3POHA 1UW9A 3QV8A 1NDWA 4HHHA 1X8FA 3L66A 4GJIA 1UIPA 5DY3A 4K2SA 1BG4A 4EVZA 1SW7A 4J7RA 3WIJA 2ZUNA 4S3AA 1FWDC 3FHAA 3TIMA 2PRLA 4JTTA 2VZSA 4KEZA 1SJDA 3ZVIA 3SFWA 4HCHA 3R5EA 4MADA 2QUNA 3WQPA 4Z2IA 4BEUA 4MZ1A 1E4LA 3VVGA 4FNRA 3W29A 4WGXA 2W92A 2ZX9A 1D3CA 2YXGA 1YADA 2A4AA 4H19A 3TQKA 3G1AA 2C18A 5BXSA 3L2IA 1S2UA 3TJ4A 1BVNP 5F2GA 4HYWA 3N14A 1IEVA 1R86A 1KB3A 2QUVA 4K68A 3T1GA 3OYXA 5ABTA 3VX0A 3RU8X 3B8UA 3VM7A 4S3GA 1FDZA 2FYMA 2VGGA 4M6UA 1E43A 4S3DA 5JIPA 1BPLB 3E5PA 1KCLA 3S1GA 2GVGA 1PHQA 2CHNA 3UYCA 3WQ6A 1GOMA 4DBDA 1JUEA 3NZQA 5FKYA 3QFEA 1P6WA 3DHPA 2YGYA 3GH4A 4BK9A 3STGA 4AD2A 3P61A 2HRWA 2PDIA 1XIEA 5JUVA 2ACQA 1RY8A 4TV5A 3ITLA 3EWZA 2Z1XA 3KOYA 3JS3A 4JYFA 4AZCA 4REQA 2V6AA 4E8CA 3A4XA 4N4QA 4CQ8A 4B4FA 1A0DA 3WYZA 3E0FA 1Z6KA 7TAAA 1QT1A 3QHMA 1A4MA 2HE5A 4XUGA 4QFUA 4DWSD 1UOZA 3WELA 1FWFC 2Z2UA 3P67A 3RXZA 3S8HA 4O52A 2G96A 4M29A 2D22A 1GZJA 5F4XA 3ID7A 1HL8A 3U2EA 1VYSX 4JTLA 4QSHA 4IJBA 4YJ5A 3L23A 4Q8VA 3IJIA 4S3EA 5G5IA 3SCNA 1OYAA 1BF6A 3RMEA 1KNWA 3OIHA 4AF0B 1EL3A 4ASTA 4EWJA 5BXTA 2BBFA 2PODA 3U57A 4UCGA 1A0CA 1LRNA 3VFLA 4GQBA 4EPDC 4HZ6A 1KM1A 1MEWA 1O5XA 2WJEA 3MA8A 3O2LA 2CLFA 3LU2A 1X38A 5C55A 2ZE3A 3CHDA 4TOQA 3S1VA 4IOTA 2J62A 4FX8A 4LYQA 2GVEA 3WJSA 3ZYZA 3AICA 3SDOA 3ATYA 2WZHA 4WKFA 2ODOA 1GG1A 1VAHA 4Q4QA 2BHUA 2JGYA 3A5FA 1KXVA 4AY8A 1BKSA 1Z69A 4QJ5B 4MYAA 3FA5A 1K1DA 3B40A 5C70A 5BU9A 2FFCA 4KKXA 2YCEA 2WM1A 3KP1A 2ZRXA 4UFHA 2PDHA 1UCWA 1V6UA 1J6OA 3GU1A 5FL0A 1M53A 3PJWA 2H8ZA 3A3XA 2TYSA 3WG6A 2ZRYA 3LTPA 3WLLA 1I4NA 3AMDA 3CO8A 2EPKX 3OVPA 1K4GA 1OFPA 1DQWA 1VJSA 3LTYA 2VR5A 1DJHA 1CX9A 4QEHA 4L4LA 3A13A 4EAYA 3L5AA 4PCFA 1N2VA 1BF2A 3KDNA 3OO2A 3H4WA 2BVWA 3IRSA 3AMCA 5C6MA 3ZSTA 5BCAA 4DUVA 4HU0A 1HP4A 2WXDM 2CPUA 4E2VA 4D72A 1BXCA 4KQNA 4DWSA 3KOZA 5TBOA 4LTSA 3SW6A 3B0PA 2C14A 3HQ1A 4WZHA 4LU0A 1UD8A 2ZXBA 2NQJA 3HV9A 3MB9A 4O8RA 1YXCA 2DP3A 3A12A 2AKZA 1ECEA 1V8EA 1W3NA 3R0DA 4YTSA 3UVAA 5A69A 4WDUA 4G9PA 1SO5A 4IGHA 4GUHA 4Y9NA 3T42A 4PA8A 4IFKA 3NQAA 2HTMA 2Q09A 3IGHX 4N4PA 3OP2A 1UPPA 2WHKA 4GVGA 3NZ1A 4EPKA 4FNUA 4IMCA 3FAWA 3UJ2A 4LANA 1LOQA 1S1RA 2HJPA 3HM7A 1SO3A 1TPH1 4O13A 4JQAA 4YL2A 1VZWA 3MUY1 1E0WA 4MB3A 3KCOA 4NASA 3G1FA 2OFJA 2WBKA 3P81A 2GPTA 4AX7A 1B54A 4HCLA 4C6OA 3TN6A 1DBTA 3LCHA 2Y88A 3QBUA 5I7GA 3EEZA 1KFJA 3UCQA 2HE8A 2NUWA 2DZUA 3RJXA 1SZNA 4MLJA 2WCGA 3WQ8A 3R12A 4IMGA 1V02E 1XGEA 1XIJA 3H4XA 1G7VA 2O9RA 4R33A 4WD0A 5HWJA 1SFLA 2Z1VA 4HNOA 3A5VA 3PTKA 1QR7A 2Y7EA 4H04A 4UTFA 3H70A 4L65A 1F5ZA 1KA9F 2X0YA 4KCTA 3TKFA 2YCJA 3R8RA 2XHYA 1O1HA 1OYCA 2REQA 4XAPA 2HS8A 4KWOA 4A6GA 2NVDA 1YTEA 4FLSA 2J74A 1QW8A 5A5WA 3VNYA 2OYKA 1EXBA 1QHZA 2YCLA 3E74A 4PMOA 1V03A 2YZ5A 1J9YA 3HG4A 4O4WA 4CNOA 3S2CA 1CLVA 3QC3A 3UBPC 4UFJA 1YQ2A 4LBRA 2IKHA 2ZA1A 1QRQA 2GQ8A 4K36A 1U5JA 5JBDA 1DL3A 1F05A 3LQLA 5H8UA 2HISA 3UJRA 3R94A 3NSXA 2F6KA 3NM1A 4HCDA 3BGGA 1HT6A 3VGEA 2AQVA 1NIUA 2EHHA 3AUOA 3B9OA 1MSSA 2WCAA 3GB6A 1K3UA 2OX1A 3DHUA 1EJXC 1GVIA 4MJ4A 3GHUA 3LHTA 1ISWA 1TZ7A 3C2RA 3MI6A 2YJQA 2JFEX 3KL5A 5DO8A 4ZCWA 2GSJA 3W4RA 2HMCA 2PTWA 4GMEA 1FHLA 1OC7A 1QOQA 5GVJA 2NUYA 3BCJA 3BMVA 2IKGA 3SECA 2DEPA 4C7DA 2IPWA 5HQMA 3TN5A 5D02A 1JGMA 3GTXA 2E5BA 1W5NA 1Q7MA 3VIFA 1NDZA 1Y5WA 1RK5A 2PUZA 3GVQA 3WY1A 3GR4A 3C6CA 4ZQRA 3K30A 1XIHA 1XLCA 2JKEA 4E5TA 1JR1A 3H23A 4LOCA 3HURA 4B5XA 5K9XA 4YWIA 1MXGA 1XLLA 4AD4A 2WQDA 4A2SA 2OG9A 2EJAA 1WA3A 5HOSA 4KF1A 4JIQA 1AL7A 2V81A 3UJSA 3CL7A 4UC5A 3GXTA 1JCJA 3V4BA 3CHEA 1RD5A 3OGVA 4KIEA 1R2SA 1R9YA 5CAHA 2REQB 1FQ0A 1WKEA 1PAMA 3CO4A 4JTQA 1K6AA 4LS0A 4GIEA 2D3NA 4HT3A 1SZFA 5G1YA 2CLKA 2FLIA 5AVNA 1OGGA 2F84A 5D2YA 3LX9A 2DU2A 1HZYA 1SFTA 3WD3A 4V27A 5FA5A 3O07A 4ZO9A 2VFHA 3PUGA 5DEZA 3G1HA 4GI6A 1JUBA 1TV7A 2GWNA 3KVJA 1W8GA 3EAUA 3HQPA 4KS0A 4UOJA 4U28A 4DZIA 4Q4KA 1U1HA 3WDJA 1V79A 4KFOA 3HZ3A 3ZFHA 5M17A 3NWRA 2C91A 1HJSA 2WSYA 4LUSB 4XZWA 1ZU8A 3VD7A 1B31A 2DVUA 3T0CA 4H7CA 3BDKA 4LB4A 4MKSA 3T8QA 4J3XA 2W62A 1S5MA 5BXRA 2BODX 1OK4A 2PB1A 1ECQA 2XIMA 3HG5A 4LV4A 4EPEC 3N34A 2F2KA 4K3ZA 1DJIA 1UC5A 4IFKB 2X8RA 1Y7VA 1H0GA 5H2ZA 4UQAA 3W85A 3WLSA 1V3MA 6XIAA 2UBPC 3PBYA 1Q6CA 1OCQA 3WNPA 2YZRA 3MO7A 1DJXA 1Q85A 3P8IA 4LVFA 2AKMA 1R3SA 4AEOA 3IK2A 1ONEA 1F3XA 5LNUA 1CXLA 1FA2A 2QCLA 3GYEA 1HKWA 2W4XA 4AY1A 4DNHA 3HN3A 3WL1A 3LRKA 3JZUA 2GQ3A 4OUEA 4F79A 1YIXA 2XG9A 4K8HA 2BY3A 4IG2A 1EA0A 1XI3A 4WQ6A 5C9WA 1EJ7L 1OF6A 3QFWA 4MM1A 3BL3A 4XKYB 3BQ5A 4Z2KA 4HD5A 3GFZA 3EX6A 2VX5A 1VCGA 3GS6A 4PB4A 2VCBA 4EXQA 4Q33A 2ZADA 4LBUA 2BOEX 4MB1A 1M6JA 5LIXX 3TA6A 2DT1A 4AHQA 3H53A 5CC5A 2YCKX 3MO4A 4W85A 1W3KA 1VEPA 5REQA 3ARVA 4V1YA 4QTGA 1XH2A 2QYGA 1DV7A 1AH3A 2XM1A 3EX2A 4RE4A 3DDMA 2VT0A 2QJIA 4Q8OA 4PTMA 1DWGM 4JIRA 5LHFA 1XSKA 2J7HA 2VRQA 4CQDA 1S2TA 2IXUA 2WOQA 1NF7A 2F8QA 1ZRQA 1KFLA 1O4UA 3DIPA 2J47A 2CNCA 2WJDA 4RDYA 2ZVRA 2VDHA 3LCXA 1XRFA 2PCEA 1E6RA 1IT0A 2DPEA 3OPSA 3STCA 1RP9A 3KM8A 4Y2WA 2R1LA 4S38A 1KO0A 2W0UA 2RJHA 4RR4A 1LORA 1TUXA 4FLRA 3LMYA 1OC5A 2NQ5A 4LVGA 3WBXA 2QF8A 4C6PA 3KBWA 3ZLHA 2V3GA 5G4WA 4DJEC 2DIKA 4PUKA 4NHVA 1TYGA 3SSZA 1E0VA 1DEDA 4IJCA 1P4CA 1GZGA 2Z28A 3WUGA 1YHTA 3AALA 4MPKA 2VXNA 1V6VA 5E9XA 5ECVA 1RBLA 5TQLA 3BJSA 3LQGA 1TMHA 4J35A 1FKWA 4AC7C 2ZFAA 4LGXA 2FPTA 4AHOA 4JDYA 3HMCA 1ZFJA 5DMNA 1IZKA 3MUAA 1TWZA 3RF9A 2VD8A 3H2AA 3WF4A 3MP3A 1WDPA 4OKDA 1JZ7A 3P82A 3VINA 2WZMA 3AXMA 3U3HA 5LA0A 2EJ1A 1P1XA 4EE9A 1Q7ZA 4V33A 1GJWA 4NZJA 3FY1A 3GBDA 5C9UA 1V6YA 3W84A 4ATLA 2P1FA 4X61A 1T5AA 2QEZA 4LRSA 1G4PA 2E1WA 4QITA 3M47A 1TV4A 2UY5A 3WK2A 4TXEA 3SSJA 3GDTA 4I9JA 5DT5A 3T8LA 4US5D 4MWAA 2WMJA 1XKJA 2C79A 1W9UA 3OG3A 3WLJA 3OZPA 4L6DA 2V8ZA 3VC6A 3C61A 4GWEA 2FMOA 3ANUA 4L7ZA 5M2FX 4O8AA 4JIIX 1XYBA 1S2CA 4LUIA 2QPUA 5XIMA 1OIFA 4NQ1A 3OYZA 2C1IA 1UR0A 2EBNA 3OZYA 4PTWA 2H3DA 1TJ1A 1A4LA 4U2ZA 3EDDA 1TV2A 2ZA3A 3RU6A 1EGVA 1CXFA 3QLLA 4H8NA 2XZ9A 4IGSA 2RGMA 3G0SA 4Z2HA 1F2JA 2QPXA 3E38A 1TWSA 4C5YA 4DWSB 4M1BA 4RNIA 4PZVA 1A5MC 3PZGA 1D3HA 1FWHC 2XH2A 1N82A 1V08A 4ZB0A 1PX8A 1R47A 3GR8A 1W32A 1QPOA 3WQVA 4IT1A 4KEMA 1FXQA 1H60A 4P8UA 3FSTA 2R82A 3QYSA 3G1DA 4FS9A 1KM2A 1U1UA 3EKZA 3LRMA 1UB3A 3A6OA 1LZOA 3W74A 2XGIA 1HL9A 3PS7A 3BZGA 3UU0A 1ELSA 2D2HA 5C2CA 2FGZA 1QNPA 1QWKA 4N2YA 1E73M 3L4TA 3GVWA 4DJFD 1E55A 1QPRA 1FWCC 4OECA 8XIMA 2PZ0A 5D9NA 3CT7A 2YBUA 5M3WA 3TMLA 5IRPA 4OV4A 4EPBC 3TTOA 1Q4NX 1XDLA 4PUEA 3CYVA 1SZRA 4JTUA 1GVSA 4XAYA 3TYUA 4DF0A 1ZLPA 4D2JA 4B5TA 3T44A 4U3CA 3DX5A 1C93A 1W2VA 3VKDA 5AC5A 3S46A 1BWKA 1DIKA 4EKJA 1H5VA 4GISA 2FHFA 5CG0A 3DFHA 2DFAA 3K8MA 4ICCX 3E0LA 2HEJA 4CCDA 1RH9A 2YW4A 1K70A 1SM9A 1RA5A 2J8FA 3VNJA 4DRSA 1XYAA 3O0FA 1GQJA 3CZLA 5DF0A 3T81A 3H6OA 2O92A 2FZDA 3TV8A 2BWGA 2ATSA 4LWWA 4K1GA 2ZYFA 4YTQA 1LWJA 1FRBA 4DZHA 2Z26A 4LC6A 1KR1A 3GC2A 4H9MA 4RW5A 3P80A 2NXGA 2PAJA 3BE7A 1WKYA 2FKPA 3EWUA 4DJFC 3AIRA 2QR6A 3A3HA 4IFRA 4HOZA 2WVTA 4L6HA 4C6KA 4AIBA 4X0NA 3RJYA 3RPDA 4AZCB 1XC4A 2E6YA 3NG3A 4A8NA 2QULA 4Q4RA 1YPIA 4PB5A 3KX6A 3WUFA 3OOQA 4QCEA 2VENA 1N55A 2BZNA 4O28A 6TIMA 1WBHA 2E7FA 3PSVA 3NSNA 2CLOA 2BS9A 1XLEA 5D30A 2BVDA 4PMRA 3THAA 1EJWC 3PFMA 3FCPA 3HFTA 1FWNA 4S3BA 2JIWA 5FF7A 3BW2A 3E9AA 5K9CA 4YMZA 2RUSA 4H7VA 4J5NA 4MPQA 1OGBA 3ZM8A 3HJEA 1HXJA 4DPQA 1AMKA 2IPFA 1PB0A 2PDGA 4FSAA 1RVKA 4WOZA 3OGSA 2I5GA 1DXEA 2YIHA 1WKFA 4A2RA 5LGZA 2CHRA 1JPMA 4DO7A 1OCJA 3NNTA 1AG1O 5HMDA 3AIVA 2VGBA 1MVYA 3FA4A 2WHLA 2FVLA 3W7KA 5CAKA 1AVAA 1OK6A 1O95A 2PBGA 2YCIX 1PIGA 4MWAD 4GE8A 3WEMA 1BXNA 5IBXA 3DECA 4O15A 4B5VA 2V38A 1G9HA 1X7FA 3II1A 2V9DA 4GX8A 4FHAA 1F8IA 1GWJA 4Q8WA 3LBOA 1B2YA 2VWSA 1S3TC 4QQUA 1GZ1A 1PL9A 3FYYA 4QLKA 5IBXC 1VPQA 5T26A 4GI9A 4PFHA 3W1NA 3NXFA 1CGWA 5CQ1A 4JHZA 1XCWA 3QJAA 4Y9PA 3L4WA 5C2GA 4Q4PA 5CLTA 5AN7A 3UWEA 1HW6A 1BSLA 3D0CA 5A3HA 1W9DM 5JH1A 1YLVA 2NT0A 2UWFA 3IACA 2PWVA 1W9XA 1E5JA 2WZTA 3UETA 3MJMA 5BWFA 1VPYA 5HMEA 3APGA 4JTEA 1PWMA 4HYRA 3S2NA 3RHGA 3HJZA 3UPMA 4W7UA 1VBUA 3BSHA 1MDLA 1QFEA 1GVEA 1JRCA 4RZ6A 2ZOXA 3P14A 1W5QA 1YPFA 2FGLA 2I17A 2H9AA 5FSEC 4QQ3A 3FEMA 3SI9A 3VX1A 1P7TA 4GQGA 3O6YX 2YDAA 3AYVA 4PCNA 2CEQA 1PVNA 1KM3A 4ERAA 4C6DA 1IZCA 4POCA 1LP6A 2Y8KA 4DY1A 5A6SA 2PD5A 1DPMA 1Q6OA 2X7VA 3N1AA 4IG2B 3LD5A 3MANA 1C8QA 4JBRA 4X9SA 4I7UA 1S5VA 3KRBA 1UR4A 2WK2A 4EK7A 2YB1A 3DAQA 4BCEA 1F3EA 5LNWA 4BWLC 1EFZA 1UYQA 1UZ4A 1GTHA 1UWAA 3M43A 3NURA 3QGAC 1N8IA 1XF0A 4FB7A 4UOZA 2E8YA 4C6BA 5A8NA 1AJ0A 4UWMA 2YFNA 3BK0A 1SMDA 1X7IA 4I5UA 3F2DA 2GGEA 4H1ZA 1IEQA 3VNLA 2BTMA 1BVWA 3G8EA 4C65A 3ABOA 2TMDA 4BI5A 1V0MA 2VUYA 2PDCA 4H9VA 1ME7A 5BROA 3W2MA 5C9RA 3FHQA 4XSMA 2AAMA 2PDJA 1O94A 4B90A 1EEPA 3O06A 1XDJA 2EQDA 4MIMA 5HINA 3PSWA 4O10A 1D7KA 5CJNA 3LK6A 1E9ZB 1A5LC 1GQIA 3M0XA 3G18A 4CCEA 1UUMA 3UR2A 3IIVA 1SW0A 3VOHA 2JQXA 3OHIA 4EIVA 3DH7A 1ZJIA 1OFQA 4ZE5A 5LKYA 3IIOA 1UKOA 4XO7A 2E9LA 1F3TA 4GI4A 3UY7A 1KQYA 3FXYA 3ORWA 5BOFA 2WSPA 4TU1A 1CCWB 3HQNA 3W1QA 4RE0A 3C2OA 1DOSA 4F8XA 1BEUA 4FA3A 3LN3A 3LV5A 3QR0A 1ZL1A 1REQB 3CXOA 1JDFA 5A6BA 4UNLA 3GIQA 3UR5A 3W1TA 1OHLA 4ENLA 2OGYA 2ZUWA 3NYZA 4Y9MA 3S1UA 2J7DA 1JDDA 3DG6A 1HQTA 1G67A 3N11A 1NH6A 4HN8A 2QQ6A 1EF2A 2WKJA 4BF5A 3KVKA 4TX6A 1XYMA 2VUNA 3T6CA 1TVLA 1NOUA 1JZ8A 1OJXA 2QVHA 1V3KA 4AF0A 2PDLA 1WO2A 3MCNA 3PN8A 4D71A 5I2UA 1ZAIA 5B7YA 1QJWA 2WMKA 2NQLA 3B8DA 1AJZA 1DJGA 4OUIA 3MQTA 3KL3A 4P5UA 2WNNA 1D9EA 1AJ2A 1J0KA 3TTQA 1T8QA 1EIBA 3AROA 3SO7A 5H8PA 1UPMB 5A6KA 1SZEA 4RE2A 1E1CA 4LX4A 3RILA 2NLYA 3O6AA 2OOGA 3TU9A 1U22A 1UD6A 3BGJA 3VGBA 2C6QA 1V3JA 3QQ1A 3QY7A 4P8WA 1KM0A 3BAYA 3DC0A 5I3FA 5FL1A 2ZICA 1S39A 5IHSA 1GKRA 4KW2A 1WBJA 3S9IA 4JY9A 4D6DA 1UD2A 1OBAA 5CXPA 1KCKA 2J13A 2AGTA 2JF7A 3V0UA 2ZDSA 4DELA 1B4KA 4OHQA 3UCCA 5DN1A 2E6AA 3UXIA 2O9OA 3RR4A 1A0EA 1W0MA 1L8NA 4PBGA 3L4ZA 1KFCA 2QW5A 2WJZA 4X63A 2Z24A 3M5ZA 3TSDA 4DXVA 2Y8UA 4ATDA 3WLNA 6REQB 2VELA 1Q6RA 4PC8A 1H4PA 4A29A 3D3FA 3N25A 2W79A 3UF9A 1KM6A 2QDHA 3M6DA 3VOFA 2WB5A 3W86A 1W2PA 2ATMA 3TQVA 3KBMA 4AZ5A 4NZ5A 3VMPA 3SUVA 4GYPC 2EF9A 4XO6A 3ENLA 2WLYA 1OZQA 3MMTA 3OODA 1PZ1A 3NVTA 1K8YA 1V3IA 3CL8A 2EEXA 3MBDA 2CZFA 5E6YA 4UCFA 3CUHA 1ITQA 1G5AA 3IJDA 3MSYA 2WQPA 3A4WA 2XN2A 4ZSUA 2R1NA 1TTJA 3IIXA 4M6PA 1OC6A 3W24A 4RUBA 3BLPX 4JEQA 4ZEPA 4B9ZA 3GLCA 2OQLA 2I1OA 4AD3A 2QCGA 4O12A 4TX8A 4GQQA 2IQDA 4HMDA 3L4XA 3BSMA 1F73A 2YPIA 2BASA 2PTYA 3BMWA 3KBSA 5IXEA 2QGYA 3BO9A 3PZUA 1BKHA 4PMNA 1W1YA 4OGZA 4OWGA 2WLZA 1XGDA 4IP7A 5HBFA 1XBZA 4OTKA 3W1LA 4QS6A 3F1QA 1XX1A 2VFEA 3VOGA 3C0JA 4MKVA 3W7JA 3UZ5A 2EPMX 3IJQA 3IRDA 3T2QA 3RN6A 1CW2A 4Q22A 1F7BA 3ERPA 3TLLA 4IPJA 5ENLA 1VHNA 5IDZA 2EKCA 1IEXA 5LNSA 2QZRA 3RM4A 2QCDB 4M56A 1F74A 3LSBA 5FACA 3RPTA 2FZBA 3VE7A 5DXXA 1OX5A 1IE7C 4IFOA 1VYPX 3R2GA 3I6EA 4JR5A 4QDPA 1KCXA 1PZ2A 3MHFA 1HO4A 1PJ9A 4GINA 1NJJA 4C6IA 2EXOA 1X1OA 1YNPA 5E0KA 3EOUA 4MSSA 2WSQA 1I0DA 3VMNA 4KRZA 3RFAA 1GPWA 4UR7A 4MHBA 3WNOA 1FCUA 3TYCA 2PDBA 1OX4A 2RDTA 4UTMA 3EX3A 4L1GA 1I2RA 3AUJA 3RO8A 4M81A 1R9ZA 2CKRA 5GNYA 1Z32X 2EPNA 3OA3A 4XVDA 2ZZ5A 3FXGA 5EU9A 2VR2A 2GVLA 3G1RA 5HJYA 1TZ9A 2AGKA 3W7MA 3GW0A 3AIEA 5FF0A 3MKCA 2BY1A 5KMYA 3L0KA 3EMCA 3BICA 3WD4A 4HJFA 4IQDA 1B3XA 1W1ZA 3NPUA 3A4JA 1UA7A 4GZEA 1QK2A 3INPA 3LV6A 4IX2A 3MP5A 4I9MA 3CMJA 5I3JA 4D8AA 1RQBA 4IPNB 2QF7A 1GVRA 3APTA 4NXKA 3LPGA 5E6ZA 1JAKA 2OKOA 2ACRA 3GZ3A 3N17A 3NDOA 1WZLA 1BFNA 1C7SA 2X05A 1MWOA 1BAGA 3OEXA 4QAIA 1E0XA 1JQVA 3AJXA 2Q3OA 4V15A 5TD4A 3QY8A 2WVVB 4XZNX 2PRMA 4AH7A 1LL7A 2RDUA 5CPSA 3EEGA 2Z1KA 2A3CA 2Q3RA 1OT2A 1RXOB 1TG7A 2G4JA 3MCOA 1R2RA 4RZ5A 1FP9A 5D8WA 4XB3A 1W54A 4BWLA 5IDIA 4C6FA 2B31A 4H3DA 3CAKA 4IX0A 1JPHA 3AQUA 2Y7FA 1MRAA 3NO5A 4F0LA 1V6WA 3SBFA 4YNGA 4J4KA 2DUAA 4O11A 1YNQA 2CETA 2QCCA 3PZNA 5I3HA 5DMMA 3AJ7A 3TMQA 2B7PA 3WJXA 4YTRA 4HSHA 3QMSA 3NVDA 3AOFA 4GXPA 1U83A 3MSGA 1CDGA 4O1BA 2I16A 1IXNA 3KWSA 2ACUA 4X3ZA 1OSEA 1M7XA 4JXCA 2CFFA 3NQDA 3OLIA 4MKNA 1M68A 3BARA 3AO0A 3K13A 5K2ZA 5LHEA 1GK8A 1XYFA 3CU2A 4Y9OA 3FDGA 4RKAA 2QIWA 3GXFA 3GIYA 4CQBA 1X97A 4M0XA 1Q8AA 5HNUA 3KXQA 2Y1HA 3R7MA 1KRMA 3EX4A 2VZOA 2V5LA 3QZ6A 1FY6A 4KWVA 1SR9A 3W73A 5AFDA 5D32A 3Q67A 3B9AA 4GYPA 2HWGA 3LXBA 5DT7A 1EDGA 2CLLA 3REQA 4D9PA 1AQFA 1NQKA 1FWJC 3S5NA 3EA2A 1SFSA 1SGJA 1XS2A 3U8GA 3SGGA 4ILSA 1LYXA 1JCXA 1SO6A 5FEWA 3L68A 5G4EA 3QN3A 3W70A 3CLMA 4GO9A 1EB3A 3NR0A 4FK9A 2EG8A 3QHOA 3A9BA 3OBKA 3TWBA 3ARZA 4FOUA 4O0QA 3H26A 4XSLA 5CBJA 1OCNA 2DW7A 4UTLA 4D1IA 3Q2DA 2VFFA 3ITVA 4DAIA 2J88A 1NAL1 4S2BA 4YHGA 2H8XA 4NRRA 3MDWA 1EX5A 1KBJA 4GIAA 4O4VA 4C90A 3IANA 2BX7A 3M5YA 4I7WA 2ZZ7A 3O63A 2YBTA 4IGNA 1FFRA 4BF9A 4D6HA 2D2OA 3GTIA 3W2JA 3GO2A 1DIEA 4UTTC 2J78A 3W9ZA 2O56A 3A22A 3LGGA 3MI2A 1KTBA 5HULA 4OBRA 1JL8A 2CERA 3KLLA 2UY4A 1OFOA 2ZUSA 4GPNA 1V0LA 4A21A 3UW6A 5IFPA 4S2CA 3LZ3A 1ZP3A 1MQRA 4MWAB 4S23A 2WMFA 3TYEA 4LT9A 3DXIA 1Y5VA 3WH5A 5F7UA 4LCQA 4L6OA 1WKDA 3ARXA 1O12A 4R88A 4WEVX 1FHVA 2D2GA 4N02A 4UZUA 1ZB5A 4DO6A 5CZSA 2OU4A 3DCPA 4BEQA 4ZR8A 4UQBA 5GNXA 4ROPA 4JTGA 4PH6A 4AWTA 3GG7A 2NZLA 2PDKA 2VURA 1DIOA 2J27A 3F2CA 2ZC8A 2ZWZA 4W84A 4O17A 1TJRA 3O6CA 3Q58A 1RCOB 1ICQA 1A5CA 1GYNA 5E0CA 1PCWA 3S6OA 2IKJA 1XQKA 1XYLA 1FDJA 3N2CA 2HBVA 4IPIA 2O0TA 2CLEA 3VPLA 1Z89A 3C2VA 1JUKA 5FD0A 1AH0A 2O9PA 4IXHA 3K8KA 1UA3A 3NPVA 5CC6A 3V36A 1B9ZA 1OY0A 4KBXA 1FCBA 1DQXA 1SYTA 1VBGA 3FKRA 3TWAA 1MYRA 3QTPA 5KINA 4PGLA 2FZ9A 5D2XA 1HO1A 4I7VA 7REQB 3BWWA 5MF5A 5HQEA 4OQVA 3KRZA 5IHRA 3E12A 2C13A 3CPRA 1FH7A 2UY3A 1R5YA 3STPA 2FB3A 2CKSA 3MDUA 1RALA 3SRKA 3B9DA 5A8OA 4JQ1A 1DXIA 1VS1A 3RPMA 3RO6A 5M5DA 3E0VA 2ZZ3A 5C71A 4JZ5A 4C6QA 3AWNA 2FHCA 3ABXA 3M07A 3AS0A 1R7OA 2J75A 1FWIC 3KVMA 4E4UA 1KRAC 3F7JA 4QEEA 1KM4A 1RP8A 4CQ9A 3P60A 3W76A 4JL1A 3NQEA 4QS5A 4HA4A 2QXWA 1DE6A 4JTFA 4L4OA 2GWGA 2OB3A 4JFUA 1EWEA 1K8ZA 4GH3A 4WF7A 1XL9A 1R9XA 1CXIA 1ZBWA 4UFLA 1THFD 4IPPA 1G6CA 3HV8A 3V16A 2VFGA 1EZ2A 1I0BA 4O16A 1AQ0A 5LSMA 5KZEA 1BTMA 5J04A 4NL1A 4RPQA 3HO8A 5MHBA 1PIIA 1W1A1 2F6XA 1UUQA 2V82A 1LL6A 2IW0A 1XD1A 5LIYX 5EGRA 4H9YA 2CESA 3QM3A 3KBVA 1P48A 2NXHA 1TTPA 2P0OA 3LBMA 5LIWX 4JTIA 3R1ZA 5LA2A 4BS0A 4IZGA 2XYLA 1CZ1A 4UQEA 1TIWA 4CU6A 5GNZA 1ONWA 4MG4A 3TW9A 3ITOA 4H01A 1JYNA 1UWRA 2QAPA 1X1ZA 3UR8A 3BSGA 4PR4A 1R85A 3ARPA 4J2PA 4X60A 1XRSA 1S5WA 1Z44A 2Z1WA 1K7FA 2GUBA 3MVTA 1EJVC 3I7RA 2A3AA 2VRKA 4HK7A 4N7QA 3GXDA 2WJFA 3GNXA 4RPPA 3T7VA 5FCZA 3SCQA 1HN1A 3QHNA 4NF7A 1R38A 3HPZA 3FYPA 1FWWA 1YTKA 1W1IE 3B4UA 1A80A 4WY0B 4O0ZA 1X39A 1FWEC 4H6RA 4MWAC 5EL1A 3LHZA 1XIBA 3VGGA 1YMYA 4HA1A 2Q6ZA 3GXIA 1J01A 4PCSA 2VYOA 4AVFA 5I3GA 4AAJA 3N9KA 4ERGA 1DWFM 4LAZA 1XQLA 3IVUA 3UXLA 1H1NA 1XRTA 2QCDA 5DRIA 2DZBA 4NVTA 1XM3A 2OODA 4O14A 1RD6A 4WRHA 3FJ6A 3LCIA 3BAKA 1FWAC 4DXXA 4H8UA 1W17A 3TSBA 2E5CA 1IGSA 3SZ8A 4O18A 3UWWA 4D8LA 1EPVA 1HUVA 1XUUA 1VHCA 5FEZA 5AKQA 3R79A 1UZ1A 1L6SA 4DM1A 3K1DA 1MNSA 2YSWA 4P7NA 1BRLB 4JTHA 3M7WA 3VNZA 3UNDA 4XISA 3VIKA 3MZNA 3NAVA 4UNIA 3WEOA 4JFVA 1ZTVA 4GC3A 3EWBX 3GNNA 1XIGA 3KS6A 4WJXA 3DG3A 3VZZA 3MHUA 5HWNA 1L6YA 1V3HA 1QI4A 3JW7A 3O7UA 1GPFA 4Q7BA 4B9YA 2Y4SA 3LMZA 1MZRA 1W1TA 2ZQ0A 4GXWA 2Z2BA 3W7PA 3S5SA 2HNHA 5CZTA 4PUMA 1DYSA 3PNZA 3ARWA 3GDBA 3OJGA 2A0NA 4IISA 1TPC1 3MUIA 5FEXA 1GOIA 2HSAA 5I07A 2NV9A 3EPOA 3U48A 2PLMA 1UASA 3WFAA 4B5UA 2I56A 3OBEA 3WLOA 2IPGA 3W3OA 1WXZA 2P5NA 5D33A 3P0WA 3H7UA 4UB9A 2OZ3A 1QMLA 4B5NA 1H11A 3BOFA 3NCOA 3K2GA 4RDWA 4NYUA 3FAXA 4Y8FA 1ALDA 1ZP4A 2F6UA 4HOXA 3GQYA 4AD1A 3I3BA 1VFOA 4IMFA 1OFDA 4IIEA 2PDNA 3EXTA 3W83A 1R30A 1A49A 3M0YA 3ABRA 3GXMA 4DEFA 4P2VA 1Z42A 5CSUA 3GVVA 1J96A 4GACA 4S1FA 3NTYA 1ZCOA 1GKPA 4Z1BA 1P0EA 4JX6A 3CTTA 3H2MA 4ZFCA 2NVCA 2YOCA 3CL6A 5FESA 4JHOA 1FWBC 2YL6A 4FEZA 4FNQA 3N2TA 2E28A 4XV0A 4ADUA 2BG5A 3SCRA 1OINA 4E2BA 2DT2A 4K8EA 3A9IA 3QSRA 2V3FA 2NSXA 1IYXA 1Z7AA 1G4EA 4WK9A 3CASA 4OFCA 3ZMRA 1GOXA 3M5XA 1KFEA 1TB3A 2EG6A 3LLDA 4CNTA 4ADSA 1UZHA 4JD4A 4QHRA 3MKVA 2FDMA 3N18A 3PHAA 4JN7A 4HNLA 5ECUA 1BQGA 4HHPA 2Z1BA 2PDFA 1ME9A 1NFGA 3WJYA 2AMXA 1I9CB 1E6PA 1R3QA 1Q65A 3CHVA 3F5JA 3TH6A 1YDNA 5XINA 2OSWA 3RCNA 3VZXA 2YL8A 3SCTA 5GQBA 3M4HA 4XD5A 3MMDA 1UKSA 2D20A 2DZVA 4G1NA 4A3RA 3G3DA 2XWDA 4DN1A 1E3ZA 4A05A 2G41A 4YVPA 4W8AA 3VU2A 2WMIA 4EX4A 1XPGA 1X6LA 4JAWA 3PPGA 2RKXA 3PUEA 3D3AA 3V5OA 3JU2A 1KBBA 4ZXOA 5AVHA 2X1TA 1EZWA 3LBCA 4WDTA 2JIEA 2FVMA 4PEEA 1U5VA 1JCMP 4E38A 1TE6A 3GFYA 3GWQA 4L64A 4DZAA 2DZTA 4WHBA 1VFUA 3DFQA 2J6VA 4NKCA 2X0SA 2JKPA 1NDVA 4UMCA 3OBAA 4ZQCA 2VDIA 3O0KA 2NV1A 3H2FA 1JZ5A 1EP2A 1B9BA 3B0VC 3WO8A 1ZY9A 1LRTA 1QVBA 3C8FA 2VEFA 4G5DA 4U5KA 1Q2RA 3DFSA 3THCA 3UWUA 3BAXA 3ITTA 3RUBL 2HK0A 1WZKA 4L1WA 3LNMA 4GI8A 1V0NA 5EB8A 2RHGA 1NF0A 5ABHA 3AIWA 4ZQMA 3E96A 3N19B 3R89A 1OD0A 3ITGA 4DJDD 3CH9A 5B7ZA 4AEEA 5G2HA 3GDMA 2EPLX 1LT8A 4IF2A 4Q8PA 1VLIA 1U1JA 3NXLA 2WC3A 4AVOA 4AWSA 1YBQA 1BYCA 2J77A 4I6KA 3V75A 1ITXA 1S2VA 1TREA 3HG2A 3WF0A 4WDXA 3VZYA 2PDQA 4A3HA 2BLEA 2XVGA 5T8GA 1GORA 5AB3A 4Z17A 5GPRA 4XZLX 3BCFA 4GZJA 3W7CA 1UJPA 3O1NA 3VNKA 4F0KA 4RV3A 1KWKA 2VD9A 5BOOA 3E2RA 1QU4A 2BY0A 3FV9A 3A3WA 3B06A 3GYCA 1J2WA 3APYA 1ZJBA 3MS8A 3BAIA 1EHNA 5I00A 2POTA 1DJZA 2ZIDA 5TNVA 4B16A 5JH2A 3N2XA 1BVZA 2CLIA 1J18A 4GY7A 1J8VA 3UWZA 1TRIA 1JXKA 2WO5A 4H41A 3PPFA 1K77A 3W0KA 5I3IA 2X16A 5AZ0A 4F2UA 4JIHA 4R27A 3T2OA 4QNEA 1GQNA 4CD7A 2BVYA 1UP2A 2Z29A 2J24A 3PTMA 3LCGA 4PBEA 3TN4A 1CYGA 4HNUA 1W3TA 4WLCA 5HMFA 2ISDA 2WNWA 1NEYA 3GR7A 2YR1A 4E4FA 2CU0A 2Z00A 3L4UA 3H21A 3WQOA 3IPWA 4TTUA 1W9PA 4GABA 4KFNA 3W00A 1AL8A 3OVGA 4M8UA 1LUCA 1X96A 2OKTA 2VCCA 5AHIA 1KRCC 2HV5A 2DSKA 4JNYA 4BF7A 3DG7A 1M7OA 4XBJA 5F2MA 2WANA 4Z2GA 3GH5A 4PMQA 3PPCA 4LEFA 4ORMA 3DN5A 1GTEA 1ENUA 3OQEA 4HQVA 1NOWA 2V2CA 4QG9A 3VIJA 5D4YA 1O5RA 1UP0A 4CD8A 1W37A 2VP8A 1XLKA 3P8JA 1TO3A 4H4IA 3NOEA 1XC6A 5AC6A 2QIIA 3W1UA 2ISFA 1RPXA 4GQ0A 4PUJA 2ZZ2A 4HGXA 1MDRA 1F6KA 2VGIA 4U5IA 4TQTA 5TF0A 1TPUA 2DQXA 3QV6A 1QDSA 1IR1A 1Y65A 1A5KC 1CB7B 3SUWA 3URQA 4KWWA 4REQB 3QXBA 3TC6A 3JRKA 1XSIA 3PULA 1DTUA 3EOSA 2XFYA 1ITUA 5C8BB 1JJKA 1LJYA 2YFOA 1JAEA 3T05A 3EKGA 3VGFA 1JZ3A 2X1IA 4M6VA 4DUWA 4W86A 1GVOA 3GTHA 1H7XA 4GNVA 5A8MA 1PX3A 4GJJA 4DJEA 4M5PA 2YXXA 6A3HA 4GNKB 4RJEA 4HU8A 2IQTA 5FAGA 3H8AA 1VFFA 3WX7A 1YE4A 4F2TA 1E5NA 2XIBA 4NAEA 4R9OA 1BXBA 1XJBA 1RR2A 4X22A 4JQ2A 1W1PA 2DH3A 2HPMA 2R6OA 3O05A 4A8RA 3C2FA 5ABFB 4F0SA 1VFHA 1TTQA 3MV11 5BRQA 4GVHA 2AQOA 4DZ5A 5BNKA 2XIIA 3RLVA 4HTBA 1QXLA 4XTIA 4BQ4A 1Q6QA 3B9NA 2Y2WA 4JKLA 5E0FA 2IXVA 4W89A 1K4HA 3WH8A 5D05A 1RJQA 1NP2A 2BDQA 2HCVA 2R8WA 3GAYA 4GIYA 4GYFA 4PTNA 1B3OA 2VVNA 1R8LA 5BRPA 5M03A 3KTSA 1TA3A 3DZ1A 3IVTA 2PDYA 5EPDA 5KETA 5HATA 4AY7A 2GYIA 4GUJA 2G4FA 4A35A 2QV4A 5D8ZA 1L8PA 2KAUC 1VJZA 1XLIA 4IP5A 2DDXA 1QUMA 3UJFA 1DTNA 3ZO9A 2B7NA 2V5DA 1R0MA 4PCPA 1L9WA 3G0UA 3SM0A 1AQHA 2YLLA 1BYDA 2YDRA 4C60A 1H1ZA 3LSCA 1RJRA 4FO4A 2ISSA 3V0TA 3GM8A 2VC9A 3W1AA 2YL5A 1JPIA 3S3GA 3G77A 3L2MA 1ML1A 4TUFA 3NQBA 4JYEA 1OM0A 4AZGA 4HYVA 3BH4A 3DBNA 2OVLA 4E8DA 4HMCA 3U2OA 1RCXB 2AOSA 3WL0A 1P5BA 1FCVA 1TPWA 3CWHA 4CNPA 1T0OA 1EJRC 1J0YA 1MW3A 2WVUA 1DVJA 1VFSA 3E3HA 2QAFA 1JD7A 2Z7GA 4MNMA 4DO4A 1E4MM 3LOTA 4O54A 4PMJA 4A4AA 1AQMA 3Q37A 4I8DA 4QRNA 3MWAA 4MDPA 4QGCA 4XVEA 4CNSA 3SRFA 3GDRA 1IZJA 3AU2A 1WDQA 3URNA 1NFPA 1QI0A 2GDUA 3NUKA 4ICMA 1T41A 4BZYA 3TOPA 1EUNA 3NL6A 2OWWA 3QOMA 3MUCA 4J28A 4HK6A 4J3ZA 3NIYA 4BKNA 3BOXA 4GNJA 3VCCA 3VMOA 3LGDA 1Q45A 3V5CA 5I03A 1SJCA 3IUHA 4OVXA 1CENA 3GZAA 1W3LA 4H8HA 3LI0A 4WR3A 4NG3A 3SUUA 1PKMA 4PL1A 4UTIA 4JX5A 3S1WA 1VBHA 3W2KA 3BJFA 3UPWA 2OLSA 1YDOA 1V5XA 2NWRA 4NIRA 5I3KA 2IQ0A 3R4IA 1W1VA 4W8LA 4FZIA 2VCAA 3LB0A 2ZRVA 1RK6A 3TOYA 2J4GA 3TTYA 1MRQA 4F66A 3M0ZA 1DWJM 1TELA 1WXYA 3UPBA 3WDPP 2HK1A 3PF3A 4AZ7A 2XH0A 3WDRA 2GGHA 5T91A 5G2WA 2NQHA 1OABA 1OADA 2RGLA 3AHTA 2XSXA 3H12A 5FSDC 3QOKA 2GJLA 2OJPA 3PM6A 5K3VA 3BG5A 1F4AA 1WYIA 1IXOA 4O1CA 4KMQA 1IQ8A 3SCWA 5HUPA 1PO9A 3N4EA 3ITXA 4M1RA 1GW9A 4AB4A 2BHYA 4FALA 4LAMA 2OQYA 3NL3A 1NARA 2G3IA 2DZPA 5BYWA 5AHFA 3BLEA 1FDYA 2V5JA 1TX0A 1E51A 4S3JA 3TNOA 2VVSA 3PJUA 2OZ8A 4LH8A 4JS3A 1P0NA 2WC7A 4FAMA 3BURA 2WSKA 3VABA 2OLHA 3SIZA 1GONA 3HFYA 4ZXLA 2OLAA 2P8CA 1ZNNA 2PWHA 1B90A 2E9MA 3I7QA 3VC5A 3TQPA 4HMEA 1PDZA 1QASA 3VI2A 3CQJA 5C7VA 1T6MA 3GDLA 1VFLA 3DFYA 2R94A 2ZA2A 1DXFA 3EBVA 4OOZA 1IWPA 3BV4A 3QLDA 1TMLA 4S3CA 5K9DA 1GHRA 5CSYA 1C29A 2Y6ZA 3PVFA 5SWUA 2OO6A 3WZ0E 3WH9A 1XLAA 4DJDC 5HR6A 3AIUA 3S47A 1TQXA 3LCFA 4I6VA 4LF2A 3LPOA 4Q8MA 3N6JA 2ZUUA 5FJPA 3EDJA 4LC8A 4PN2A 1DWIM 1QBAA 3TCSA 3QEZA 3FGCA 4ZODA 2WMHA 2XSAA 4CEUC 4H6EA 4JFSA 2ZXAA 1TJPA 2WYSA 4NXSA 3LXAA 3QV7A 4NUWA 4FNTA 1TCMA 4IIDA 4PYSA 1WPCA 1A5UA 3F5KA 3N4FA 4MMWA 5PTDA 3S5YA 2VDGA 3CAWA 2XFFA 3JR2A 3DBPA 4O53A 1EC8A 1TFVA 1GT8A 3LUTA 1WV2A 4JX4A 3RK8A 1N8FA 2FZNA 1VENA 2OEKA 3UXKA 1VRDA 3BLOA 4O1AA 3AI0A 2XVPA 1ZAJA 1E6QM 1WDRA 4UTKA 4O50A 4LB3A 3EMZA 3U2CA 1XFBA 1S3HA 1NP0A 4A3QA 2JKAA 3WDQA 4GY1A 2JF6A 4KETA 3SADA 2C0HA 3GVRA 4JGDA 3KUMA 4R7WA 4C91A 3O6DA 3VIHA 3M0HA 4RNJA 3CQHA 4DO5A 3NZRA 3P2VA 4U31A 3TX9A 3LLXA 4LYKA 3QPYA 1CGTA 3FKKA 3UGRA 3UP8A 1NU5A 4EAMA 4GZIA 1BQCA 1OGSA 4RXGA 3P5YA 6CGTA 3N2MA 2A5HA 1FCQA 7PTDA 3I6RA 4YVXA 1H50A 4AXNA 3L4VA 2WAGA 4ZBCA 4CN6A 1PYFA 3UVIA 2FQIA 4C6CA 1JZ6A 3N9SA 3FEQA 3CUIA 2F2HA 4J3WA 4F0MA 3CWOX 4HP5A 4AWEA 1OQFA 3THUA 1D3GA 1I6NA 2G3JA 3QVQA 1JCYA 1GJUA 4KRTA 2ZUMA 4H7ZA 4EXAA 4LAOA 1K9EA 2CXGA 3FJ4A 1AD4A 1G7UA 1QOPA 2OMAA 3VD3A 5CC7A 4QDMA 1GOQA 2GJNA 3RM9A 5HK4A 2FZ8A 1I2QA 1OZMA 3WBYA 3VKBA 3A21A 1XLJA 1UKTA 1SJAA 3SY1A 3P6LA 4FNSA 4DF2A 1HTIA 3WLRA 4IUGA 3FOKA 1DQUA 1NWUA 1R3TA 2AL1A 4X2RA 1X1NA 4PMUA 3TXZA 3FLUA 3PK7A 4HPGA 4PB3A 3NSMA 2HS6A 2Z7KA 1VBJA 1IXPA 4IMDA 3CQIA 3W07A 3LM7A 6XIMA 4LV9A 3BLLA 2VEGA 3MT1A 3ARYA 3ABSA 3QGVA 3BAWA 4BI7A 1UD3A 3MSDA 2POZA 1WUFA 3R25A 2DIJA