4JS3A

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with 057
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with 057
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 135
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4js3A00
1Q6OA 1TPWA 2ZZ5A 4N02A 2WNNA 2ZYFA 4MJZA 3EKZA 1XBZA 3NQCA 3WK2A 3W84A 3RK8A 3HPZA 1XFBA 3W7GA 3A21A 4DBDA 3BW4A 2QF7A 1DHPA 3W1NA 3W6YA 1VRDA 1VS1A 4XUGA 3TC6A 4PL1A 3QEZA 5G4WA 3BO9A 1OYCA 1L9WA 1ZNNA 4N9CA 2Y70A 3TDFA 1A53A 3MI2A 2P0OA 3DFQA 4JN6A 2A21A 2H90A 3BLFA 1GJPA 4IMFA 1KFCA 3W1UA 1D9EA 1FCQA 3IIPA 4RXGA 2OZ0A 4WY0A 4EF8A 1VJIA 5I3GA 1KBIA 3NNTA 5FF0A 3NL2A 2G96A 3TUUA 2QCEA 4O15A 2GJNA 4EWND 4L4LA 4RZ4A 2O7QA 4PC8A 3A24A 1F2JA 3P8JA 3PY2A 3VNDA 3DFSA 5LNUA 2Z1BA 2GOUA 3M0ZA 1SU5A 3UWZA 3B0VC 2CLOA 2VENA 3C2VA 1PL9A 4DO6A 1OJXA 4PEKA 5U4NA 3W88A 3LRMA 1LRNA 3MI3A 1TPDA 3VKJA 1MO0A 2BSLA 3P5YA 3MHGA 3GXNA 3LBCA 2GQ9A 1O5XA 2VXNA 3LHTA 3UWUA 1K02A 3CIWA 3GK0A 1XC4A 3HIJA 1H7XA 3HG5A 4DF1A 3W7OA 4K8EA 3TXZA 4AMAA 4TX9A 2Q8ZA 3W22A 4AVFA 3GX9A 3UWQA 2DJXA 1YDVA 1TMHA 3LCGA 5HUOA 3MHUA 4R34A 1FXQA 3LRKA 1HUVA 3QC3A 2J88A 3S9YA 4AAJA 2CU0A 4HIBA 4RXFA 5KITA 3GIYA 4MY1A 3BPWA 2VELA 3QMTA 1OFPA 1KTNA 2RDTA 5DY3A 5D05A 5I3HA 1WAUA 1X1ZA 4CQ8A 4UTTC 2V8ZA 3HO8A 1TTJA 2ZZ6A 3LV6A 4IOTA 3F03K 4GNJA 1KA9F 4FX7A 3W7PA 1T8XA 2E6YA 3ABOA 4NU7A 4CLMA 1K7XA 3MP5A 1B4EA 1H7RA 3O6YX 2ZA1A 1S5VA 3NQGA 5D38A 4O1CA 4Q32A 5AHLA 4UTIA 3EX3A 5F2IA 4ADTA 3HGOA 1LDCA 3LCIA 4NXSA 4S2BA 3L65A 5CGQA 4W9TA 3TQKA 1D3GA 3UQNA 3NZRA 4ZQMA 2ZCGA 2QCDA 2QCCA 3F4WA 2AAMA 2A6LA 2HMCA 3FOKA 2PE4A 4PH6A 4TMCA 3R13A 4IMEA 4B5NA 4WOZA 3TMLA 4MLRA 2DU2A 1TPVA 2OCZA 3N9SA 5D02A 3P74A 2VC6A 4A2RA 5TQLA 5G4EA 1B3OA 2WJZA 2YR1A 5J5RA 3ABRA 1NVMA 4H3DA 4JTTA 3TC7A 3BARA 5KZDA 1SZFA 1H7OA 4HN4A 3HGJA 4C1LA 5D37A 1M7PA 4PODA 3MYPA 1LOLA 1PHQA 3G0SA 1EUNA 4DO4A 2ZRXA 2B7NA 7TIMA 4NXKA 4ZQPA 3THQA 3NDOA 5BRBA 4UMAA 1V5XA 4IMGA 2ZRYA 3FA5A 3PUEA 4N9EA 4UR7A 4LVFA 1NF0A 1F05A 5EPDA 3TNOA 5L6UA 3TQVA 3MO7A 4BI5A 4XTIA 4QJ1A 4MVAA 1Z41A 2DORA 2WKJA 1F73A 3KOFA 1FCBA 3PBUA 3MWAA 5DCDA 2OMAA 3THAA 3USBA 1R47A 3EXTA 3CB8A 5BMWA 4CCDA 3BV4A 4O8RA 3N2XA 5KTLA 1JR1A 3R89A 3W1LA 4RV8A 4CNNA 4Z0JA 1ZY9A 1I2OA 1G4TA 3PG9A 5CPLA 2Y89A 3NQ8A 4GBUA 1FDZA 4YLWA 3Q58A 4AEOA 4JIQA 5LKYA 1ZALA 4LW7A 1PS9A 3LM7A 2YYTA 3M1ZA 3G1XA 3MI6A 3UY8A 4MYXA 1OYAA 3LTPA 3GXPA 3RMJA 4U28A 3TU9A 4ONVA 3IV3A 2WO5A 4IMCA 4XBSA 2V2CA 1A5SA 4GUHA 4BWLA 4MFEA 1FWNA 4UTJA 4IX0A 4O1AA 2YSWA 3LBMA 3STCA 2A5HA 5LHFA 4JXCA 2CLFA 4HPXA 4WQ6A 1JQVA 4O54A 5EYWA 4A21A 3MW7A 5C54A 3G1VA 5IBXA 2QEZA 4JX6A 1HO1A 1QCWA 1KM2A 3IIOA 2V81A 1XKYA 4EOUA 5CPNA 1EPXA 2V30A 3NM1A 1AMKA 2X2GA 1OFAA 4Y9AA 5D2VA 1Z48A 3SFKA 2C19A 3OVPA 5CG7A 3STEA 4HNUA 4K37A 3SGZA 3OIXA 2NWRA 3HPSA 2DZPA 3MBDA 3PS7A 3LV5A 3P8IA 2PC4A 4RZ5A 4MYAA 3FS2A 3HF3A 2E5CA 1VLIA 3NQ6A 3KFTA 2A1YA 4O12A 1ME9A 4O10A 3HPXA 5CKSA 1EP3A 3W7CA 3S5NA 1GVSA 1S3HA 2FFCA 5CZTA 3NG3A 1L6WA 4MJMA 2CZEA 3ZR4A 3PF3A 1G4SA 2ALDA 1CX9A 1LLWA 4O16A 4LU0A 1FUYA 1A5BA 4POCA 1RD5A 2WSYA 5D32A 4UMBA 3O6CA 1AW2A 1KM6A 3L5LA 5T26A 3CU2A 1SZNA 3P61A 4UMCA 1IXNA 4QNWA 3S1XA 1M7OA 3G0UA 3N14A 5TIMA 1QAPA 3LI1A 2J6XA 3ATZA 1A5AA 3I7RA 4DBEA 1K3UA 3W2UA 3PG8A 3IGSA 4FNSA 3W7KA 5H91A 1FQ0A 4DXVA 1UJPA 3OVRA 4JTUA 2WV8A 3WK3A 1QO2A 4LNYA 2CLLA 3H55A 3HBLA 1W0MA 2ATMA 1VHCA 2DZXA 1VLWA 1UBSA 2ZZ7A 5HJLA 2WNQA 3T40A 4RJEA 4O28A 4OT7A 3TSBA 4NVTA 4OV9A 2H3DA 4OV4A 1QR7A 3BG5A 5AC8A 3W85A 2VFGA 4Z1BA 4MLJA 4QISA 1OVDA 4LVGA 1JCMP 4RR4A 5DY2A 5HR7A 5FF2A 1RZMA 1EB3A 4O13A 1N55A 4XKYA 1KFKA 4O4WA 2Y61A 3L0GA 4YMZA 1I8JA 4IQLA 3HG2A 3FJ6A 1OX4B 4MUZA 1SW7A 3ANYA 2DZUA 2J9XA 4A2SA 2FB3A 3KAOA 3VI2A 3ATYA 3BGGA 4DEFA 1W5MA 2J24A 3U8GA 1VH7A 2J9YA 4O1DA 3C56A 1RV8A 5AHFA 4Q4KA 5AN7A 1TV8A 2Z2UA 1ML1A 1VR6A 5BMXA 3C2EA 1JCYA 3LHYA 5FF3A 2NXGA 3F4NA 3M6YA 4M7TA 1WOBA 1H50A 2DZTA 3BK0A 3DFPA 4TMBA 4UTKA 1TRDA 1OFQA 1SO6A 3WK1A 5AB3A 4FNUA 4Z0SA 3GYEA 2H8XA 3G0XA 4UFHA 1Q3NA 1AW5A 1KTBA 3DFTA 1XBYA 3O6DA 1XBXA 1GVRA 5CZJA 4ZZ9A 1OX5A 1S5WA 3KVJA 3CTLA 1ZAIA 2ISWA 3A23A 6TIMA 3I7QA 2CZDA 1TREA 3MP3A 1K03A 3DHFA 4MY9A 5G2HA 4WXYA 5F2LA 1AK5A 5C55A 3QW4B 3NQ7A 1NAL1 3G1AA 3M41A 1ICPA 2A85A 4UNKA 4BI6A 3RFAA 4GE8A 3PWAA 3FYPA 4AWTA 1FY6A 1OFEA 4M5PA 1T96A 3LCLA 1QPQA 3DI0A 3B04A 3S6DA 2Y62A 2V2HA 4ML9A 3NQEA 3S5YA 1YTDA 4QQ3A 2CWNA 1XDLA 1RPXA 1K8YA 2VKZG 3NPXA 4WZHA 1AL7A 5D04C 4DF0A 5I3KA 2ZRZA 2ABAA 4FB7A 3OEXA 3EWBX 3W76A 4ZQOA 3TROA 2FQIA 4UTHA 3TQ0A 3Q2DA 1KLYA 4GJ1A 2LLEA 1DBTA 3FIGA 4Q33A 4NJIA 5IM51 1YADA 2JGQA 3S42A 1XCFA 1I2NA 4PFMA 2QCNA 3A9IA 4RK8A 3M5XA 4O0ZA 4XQ6A 1GVOA 2WQPA 1XXXA 1LORA 4R53A 3QRHA 3UXAA 1LP6A 2Y63A 1YXYA 3C6CA 2FDSA 2E6DA 5FEZA 5AOUA 4O11A 1L2UA 2PRMA 1EP2A 4K39A 1YPIA 1P4CA 3GB6A 4HT3A 3L21A 5F1VA 1OHLA 3NYZA 3W7EA 5FESA 1K8XA 3P60A 3LHVA 2E1DA 1QWGA 1VC4A 3EX4A 4Y6GA 3NPVA 2E77A 2ZQ0A 3W9ZA 3TW7A 4FXSA 4UTUA 2GVLA 3W7HA 1C8VA 1O5KA 4NX0A 3EWWA 3NPWA 2QJGA 1UUMA 4IXHA 2YCEA 3G1FA 1WQ5A 3HQ1A 3DBPA 2FJKA 3QQ1A 4Z1AA 3O07A 4I7VA 3NM3A 4NJGA 4KFPA 4AB4A 2QCGA 4UR8A 4LY8A 2ABBA 1EUAA 3W87A 3TXVA 1MEIA 4D2JA 5C6MA 3M16A 2GPTA 5D2WA 2FIQA 1OFRA 1UB3A 2R91A 3EXRA 3DFNA 1OABA 2ZFAA 2NUXA 4IMDA 2A6NA 1IXOA 4LRTA 4MIMA 5CZSA 3IEBA 4BI7A 2Q3RA 3NL3A 1H1YA 2BWGA 4BWLC 3I65A 2J27A 4Z1CA 1I2RA 3Q37A 1PIIA 4JTIA 1OG0A 3LCWA 3U6WA 4O17A 5F2GA 3LLDA 1JCJA 2QUTA 3PC0A 2OT1A 4FNRA 4Z1DA 2EKCA 4WX2A 1UASA 5IBXC 5EL1A 2PRLA 3DZ1A 4A22A 4K7YA 2E6FA 3LI0A 5DELA 5K3VA 1DV7A 4JTGA 4FNPA 3CM4A 4FHAA 3TV8A 3P7YA 1X1OA 1XUUA 4IWWA 2ZRVA 3KHJA 1BKSA 2E5BA 1X7FA 2A7PA 4CNPA 1NEYA 3S8HA 2NWSA 2VFFA 1KFJA 4N9BA 3TA6A 3T7VA 3HG4A 2ZZ3A 3HGSA 2ZRWA 2Y7FA 2NXIA 3BW2A 1MEWA 1W37A 5AFDA 3EWXA 3UPBA 5CSRA 1RQEA 4GXMA 4UTWC 3RLUA 1SQ7A 4PCFA 3PBVA 3INPA 1R2TA 4WJEA 3DI1A 4JGDA 1SO3A 1E51A 3TJLA 1YDOA 3A5FA 2VEPA 3SI9A 3EB2A 3I7SA 1VZWA 2QCHA 2NUYA 3NEVA 3VFLA 2NXHA 4LC8A 2E5DA 3B0PA 4IJBA 4LRSA 4R33A 5CSSA 1GVQA 4KWWA 1SO4A 1OFOA 4ZVJA 5AYXA 1P0KA 4TR9A 1ZAHA 2QCMA 3SSJA 2I9EA 1IIHA 1DJQA 3C52A 2Z0IA 1TQJA 4NQ1A 3TAOA 1FWSA 4JYFA 3OHIA 2A7RA 3W7NA 4GFSA 1WV2A 5GVJA 2VFIA 4JD4A 4HNTA 4HHPA 4EVZA 1FCUA 1LOSA 5CZ0A 4NNAA 1YTEA 1OF8A 3BVJA 1Q6RA 2YW3A 1DOSA 1DVJA 2ZA2A 4WD0A 3W3OA 4GRSA 4JX5A 1TPFA 1J4EA 5KZMA 1WDWA 1QPRA 3L0KA 1SZEA 3EX1A 1KFBA 3EWZA 3TMQA 2NX1A 2BX7A 1MZHA 4KWVA 3UWWA 2GQ8A 4RZ6A 2WNZA 3LHUA 1L6YA 3TW6A 2A4AA 4K38A 3L66A 4XZ9A 4AXKA 3WJSA 4JR5A 1JJKA 1TJRA 3U2OA 1ALDA 1FCVA 1H1ZA 2OJPA 4LV4A 2QCLA 2JGYA 1VCGA 1ONRA 3BG3A 1IF2A 1ZCOA 2WOQA 3NVTA 3AO0A 5D2XA 1MEHA 3BGJA 1GPWA 1V7YA 2G5WA 4HSNA 2YFNA 1EX5A 5KZEA 2QKFA 1RVGA 1W1ZA 2PCQA 4HSOA 3KX6A 2QAFA 1GG1A 3FKRA 3KRZA 3GLCA 1LRQA 4BF9A 1NF7A 2ZZ2A 1RQHA 5I3IA 1JVNA 4OBTA 1W3IA 4UFMA 3TSMA 1SFJA 1XBVA 2R14A 2ISSA 4JICA 4HNNA 2V5BA 3UYCA 3B4UA 4FIRA 1B57A 4NT0A 3Q94A 5SWUA 3CEUA 3N34A 3SY5A 1LLZA 2J9ZA 2QUVA 1OK4A 4IUOA 4O0KA 4FNQA 4UFJA 5D2YA 5LNSA 3P5ZA 2CW6A 4KFOA 4QSHA 3WJYA 1YXCA 1M5WA 2VEKA 2VFEA 1SR9A 4O14A 4CQAA 1EEPA 2VEMA 3IIXA 1QOPA 2C13A 3I6RA 3C2FA 3TIMA 5K9DA 1TPH1 3M5ZA 2UV8G 3VE7A 3BW3A 1WBHA 3W7JA 2FPTA 3EKLA 3KVLA 2H6RA 2ZA3A 4R7JA 4WXZA 1FXPA 1GYNA 5DBUA 3B05A 3O06A 1LYXA 4PTNA 3WFAA 4AF0B 4CNOA 4ZQNA 5LSMA 3GR8A 1GTHA 4OE7A 4AH7A 4ZQCA 3ZS4A 5HWMA 3QQ0A 5AC7A 3C2RA 1R30A 3G1YA 2W0UA 4QAIA 1FDJA 3EXSA 4GUJA 3E0IA 3W7MA 1W5NA 4QITA 3HJZA 2FPYA 1H7WA 1VCFA 2C1HA 5K2ZA 5F1UA 4UIOA 2X30A 3CQ0A 5AHEA 4EF9A 1OFDA 3NQ2A 3EEGA 3R5EA 4JYEA 2EPHA 5I3FA 5G1YA 1TYGA 1G69A 1KV8A 2YX0A 3NPUA 3NL6A 5EMUA 3UZJA 2VFHA 5TBOA 3QZEA 3CWOX 2ZDRA 1W56A 3W1PA 2RFGA 3O16A 2XN2A 2Y7EA 1P0NA 3R8RA 1W5OA 2P1FA 4JEQA 4FX6M 4DELA 4O50A 4OWGA 3W1MA 3UWVA 5BNKA 2RKXA 2HS6A 3P84A 1DQWA 5G1TA 3DFOA 3G18A 2O7SA 1BWKA 2YFOA 4O4VA 1N7KA 1H7NA 1ZAJA 4O53A 4FF7A 4FNTA 4LV9A 3TCEA 3W83A 3FKKA 2WSQA 5BOOA 2W6RA 4AWSA 1VPXA 1W31A 4E0CA 1I2QA 5DLCA 3LHWA 4ZQRA 1Y0EA 1ZJIA 3MHFA 2KZHA 4FIQA 1LM1A 4FXRA 2YZRA 5D09A 3SIZA 1OX4A 4Y8FA 2JKEA 5EA9A 3SW6A 1SO5A 2C0AA 1KM1A 4Y96A 5DN1A 3MYOA 2PRHA 3H54A 3DU0A 1TTQA 3DKJA 2GVJA 2FLIA 1F74A 1BWLA 3W23A 3NQVA 2NX9A 5K4XA 1SFLA 3NXFA 5FEWA 2JBMA 1GQNA 2V2DA 2XN1A 3ABQA 2X1UA 3ZFHA 5D03A 5HR6A 1TIMA 3JRKA 5HWNA 3NQMA 3LXCA 5HINA 1OF6A 3S1UA 1YLVA 2VFDA 4NJJA 3N2MA 3G8EA 2NV1A 3UXDA 2G95A 1TSIA 4UTMA 3GNDA 4M7SA 1VHNA 3TFCA 2FTPA 1W54A 3CIXA 1JRBA 3BG9A 1WX0A 1YTKA 3HGRA 1L6SA 4LTSA 1KFEA 1PE1A 3ABSA 1KM0A 1QO5A 1HO4A 2QJIA 2QDGA 3LDVA 2ZRUA 4LVAA 3UZ5A 1F7BA 3M44A 4MZ1A 1Z42A 3W71A 1VYRA 5D33A 4UTLA 2ZTJA 1QFEA 2RHGA 1Z44A 3GXTA 1EIXA 2VOMA 2CLMA 3RF9A 3W86A 4K8HA 2B4GA 1M6JA 2ZZ1A 1TV5A 4JNMA 3LERA 3UD6A 3W7QA 3IIVA 4NJHA 5DBTA 1ICSA 1TTIA 2EF9A 5E0KA 4UXDA 3GR7A 3K30A 3QPYA 3C4UA 1KM5A 3VCRA 4AHQA 3W7RA 5F4SA 1D3HA 3BLEA 3EWYA 1Q6QA 4WUIA 4YWIA 3F1QA 1G6CA 2PURA 3QYQA 1GZGA 3L0NA 2C6QA 1QNVA 3O15A 2C15A 3QSTA 1H60A 4XTDA 1TTPA 1W8SA 2ISVA 3DHDA 1R46A 4BFAA 1FDYA 4L4MA 1GTEA 1RR2A 4N6FA 4LS0A 3FFSA 3W2NA 3FYOA 4LC6A 3NR0A 2D73A 4DO5A 3O8AA 2FB2A 2W79A 2IQTA 3PSVA 2DZSA 1QOQA 3KRUA 3KVKA 1U5JA 2A7NA 1JCNA 3MUXA 1LZOA 4JTHA 4K7VA 4QNEA 1W3NA 2GUUA 4GUFA 4ZL1A 4E2BA 1C29A 5BW6A 2X1RA 3L5MA 1HTIA 2DJLA 4JTFA 1VYSX 4TO8A 1JUBA 1LBLA 5AHNA 3W2JA 5LHEA 1ICQA 3E96A 3T44A 3IVUA 4O52A 2E09A 4N6EA 5K9CA 5D30A 1Q45A 3WJXA 3WJZA 1OYBA 5C2XA 3O05A 2RDWA 5EY5A 1X6UA 5LZLA 3E02A 2I1OA 5AHMA 3S1WA 1X8FA 3M9YA 2V9DA 3T55A 4DPQA 4XWUA 1XDMA 1H7PA 1VQTA 2RDUA 1SW0A 2Z6IA 5G2WA 5KMYA 1GEQA 3SGUA 3NA8A 3O1NA 4UUIA 1PV8A 4A3UA 3MBFA 3E9AA 4NZJA 3LCFA 4PL2A 4S2CA 3B03A 1DL3A 3P62A 4Z08A 1W5QA 4ZMGA 3STFA 1DQXA 3LCHA 3CWNA 4MFDA 4OU1A 3OG3A 1ZHAA 1T0OA 2R8WA 1P5BA 3LRLA 1TPEA 4E2DA 3V1PA 4ORIA 2I14A 1IIGA 2QDHA 4MPQA 4N9DA 2BXVA 4QM1A 1ADOA 3V75A 3PM6A 4XBKA 3CC1A 4GC4A 2DZWA 4M19A 3N19B 1SPQA 3LGEA 4S1FA 2BTMA 3NL5A 3LX9A 2NZLA 1IGSA 1KM4A 4WY0B 3E49A 4P2VA 4JTJA 4UCGA 4YL2A 4M6PA 1GVFA 4FX8A 1G4PA 4LUIA 3UPWA 2EHHA 4O57A 5G2IA 2X1SA 1O4UA 2QR6A 3YPIA 1FWTA 3C2OA 3L67A 2X16A 5H2ZA 2Y7DA 3GVGA 1NSJA 1EP1A 3W7IA 1PCWA 2YXGA 4HNVA 3L2IA 4N4PA 4DQWA 2TPSA 4MZYA 1A50A 1HL2A 1WXJA 5LNVA 4JDBA 2V0TA 3PULA 3QF0A 2OT0A 3M5YA 3W7DA 3B06A 4IPJA 3UNDA 5CPMA 4OHQA 1B9BA 1TPC1 3L9CA 1H5YA 3VE9A 1TCDA 2E6AA 2WSRA 4JYDA 1KFLA 5LGXA 3B0UX 3JR2A 2ZZ4A 2C16A 4UFLA 4ADUA 3W1TA 5EKYA 5D2TA 1VGAA 2CLEA 1WA3A 2B7PA 1H62A 4P61A 1I45A 3G24A 3W72A 3NQAA 3N9RA 4NX5A 1R2RA 1C9DA 5HQEA 4UNLA 4ICNA 1TRIA 1DKWA 4I7UA 3TSDA 4M6VA 1THFD 5J5DA 1O60A 1XL9A 3LCXA 3G22A 3AJXA 1TJPA 2NUWA 3KXQA 3SZ8A 2V5LA 1WBJA 2C18A 4WOQA 5DXXA 1I2PA 4UFIA 2CFFA 5ABTA 3C8FA 2ZTKA 3FLUA 1OFBA 3S5ZA 2OX1A 2CLIA 5AYYA 2VEIA 3W2MA 3TKFA 3KVMA 4ALDA 1G67A 3NO5A 5F2MA 1BEUA 3W73A 1CW2A 2V82A 4I9AA 1MXSA 3G3DA 2QCDB 1QPOA 4NZFA 3W74A 2AGKA 2YPIA 1PVNA 1YDNA 3LLFA 4IPIA 3DH7A 3N73A 4YXGA 4BK9A 4A29A 1JUEA 3PB2A 1HFBA 3QSRA 3LB0A 5CPOA 4JTSA 3QPZA 3LXAA 1F6PA 1KM3A 1P1XA 2BZNA 1RQBA 3W07A 4ADSA 3TR2A 3WJWA 3OA3A 5G5IA 3HB9A 5HWJA 1G7UA 3FEMA 4FO4A 2R94A 4UC5A 4AHOA 4GUIA 1QMLA 2C14A 4X22A 4Y90A 2RH9A 5DCBA 1G4EA 3GKAA 4NNCA 3SR7A 3QM3A 1DORA 1W3TA 1SSGA 3QH2A 2P10A 4RCXA 2WPBA 3MMTA 1TPUA 1GT8A 1LOQA 2CLHA 1F5ZA 5E93A 3TAKA 4JS3A 1YPFA 1JQXA 5FEXA 1XM3A 3WK0A 4QIUA 5E1QA 3PBWA 5FI8A 2B7QA 3PUOA 2C3ZA 3IGUA 4WY0F 2CZ5A 3H53A 2CLKA 3QMRA 3PB0A 3PAJA 1B4KA 4X2RA 1TB3A 3S0CA 3STGA 3GDMA 4I7WA 4AF0A 3CPRA 3PSWA 4G1KA 3SECA 1GWJA 4HPJA 3GDRA 4HKPA 3ELFA 3PUDA 2Y85A 3T78A 1N8FA 4IGHA 1LROA 2XFWA 1H51A 3EX6A 3EX2A 5C5YA 3LTYA 3LOTA 3MJYA 3W2LA 1IXPA 2HTMA 3FJLA 4YCOA 3KRSA 3MP4A 3E12A 5KSWA 1KV5A 4LVBA 1SUXA 4H6KA 1WOAA 3NOEA 4KFNA 3S1VA 2ZBTA 4MZ8A 3DENA 4H4IA 5I3JA 3DGRA 3W7LA 2FPVA 1PCKA 2QAPA 3BLIA 2GQAA 3A22A 1J5TA 3D0CA 1JCLA 3M47A 3OVQA 3QFEA 4RKAA 4YCPA 3M7WA 3UWYA 4ORMA 2YW4A 3S5OA 1VYPX 2DZVA 5HUPA 4LWWA 1O95A 2TSYA 1GYLA 3C61A 2QCFA 5MHBA 1T99A 2X1TA 3SJ3A 1EWDA 1JUKA 4KKXA 3QMSA 5K4ZA 3I68A 3GNNA 1H61A 4EIVA 1U83A 4UTWA 2A0NA 4LOCA 3CEPA 1FWWA 1GOXA 2Q3OA 2JKAA 2YDAA 5HMSA 3NGJA 3IIZA 5HNRA 4N2YA 4GWEA 5U7SA 1G7VA 2Y88A 1KLZA 1LRTA 3G1HA 3IGXA 1PHWA 3OBKA 4OGZA 3CLMA 4UTTA 3PVFA 4DPPA 1A5CA 4LT9A 3P81A 3G8RA 3HMJG 4MOZA 2H3BA 3ZWTA 2NX3A 3NZ1A 3W75A 4E38A 2NV2A 1UUOA 4CCCA 3IRDA 3W1XA 4LUJA 3HG3A 5LGZA 2B0MA 2GJLA 4JIPA 1FBAA 4JTKA 2JKPA 2EAWA 4LVDA 1XUZA 4CCEA 1YYAA 3GDLA 1YXDA 4M6QA 2Z6JA 2BLEA 8TIMA 1WYIA 3M5VA 5DCEA 3QW3A 4GUGA 2E68A 3CT7A 5FEPA 5F4XA 3LTSA 3RNDA 4K6AA 4PA8A 3DXIA 3LHZA 1VCVA 5AHIA 3W1RA 3RU6A 3G1SA 3GZ3A 2QUUA 2TYSA 3TX9A 1K8ZA 1FWRA 1KTCA 5EBUA 1ZFJA 1OK6A 2A2IA 4NUWA 2F7FA 1IXQA 4X9SA 4TIMA 4XKYB 1BTMA 2ATSA 4BR1A 1LTDA 2HS8A 3W2KA 1MSSA 3TH6A 3IVTA 3W1AA 2F84A 1ME7A 1TQXA 1GG0A 5AC6A 5FF7A 1KW1A 2JK2A 3NAVA 4J9JA 4JTEA 3TJXA 3O63A 3R12A 2EGZA 5LNRA 1TPB1 4X3ZA 2GVGA 3UY7A 2YGYA 2YYUA 1KBJA 4MKNA 5FF4A 1UCWA 1R2SA 4RX0A 4U4MA 1QPNA 3GKFA 5HULA 1QDSA 1K7EA 4N4QA 5A5WA 1I4NA 1SSDA 4AHPA 1ME8A 1NFBA 1LBMA 1JULA 4NJKA 4TU1A 1Q6LA 2B7OA 5K7JA 3NQDA 1SW3A 1HG3A 3GDKA 1F76A 3T4CA 3TE9A 1H63A 3L68A 4JTLA 1AW1A 3QJAA 1JCXA 3B8DA 4NNBA 1S5TA 4CQ9A 1O94A 1ZENA 1TO3A 2NLIA 3HOJA 2Y7GA 3G3MA 1CI1A 2TMDA 3W70A 3PBYA 3NQFA 3TFXA 3C3NA 4JY9A 5L9FA 3L5AA 2QJHA 1F6KA 1LBFA 3LXBA 1AL8A 3C0JA 3GDTA 1XI3A 3A5VA 5A8GA 4LS2A 1J2WA 2XN0A 1SZGA 3M43A 4AWUA 1LCOA 3P67A 1AG1O 3PR2A 1EA0A 4IX2A 4O18A 4JY8A 2H8ZA 4OQVA 3GAYA 4DF2A 3TK7A 3R2GA 5DXYA 3DAQA 3IVSA 3ZWSA 4C1KA 4MY8A 3N3MA 1K7FA 2TRSA 5AYZA 2HSAA 1EWEA 4O19A 4IXXA 1DJNA 4UFKA 3CHVA 4JX4A 1OX6A 3DKLA 4JDYA 2DP3A 6ALDA 3P82A 2AQWA 2Q8LA 4FEZA 5K9XA 3W1QA 4RLIA 3P80A 4O1BA 3GAKA 4LS1A 2CZFA 1FX6A 3G1DA 3JS3A 4K36A 5F4WA 5LNWA 1JRCA 1TV7A 2G97A 5KINA 3RLVA 2Y6ZA 3EWUA 1W5PA
chains in the Genus database with same CATH superfamily
3ZLHA 3UXIA 1TPWA 2ZZ5A 4LSBA 2VRQA 4F0HA 3NQCA 3WK2A 5A69A 3RK8A 3HPZA 3W7GA 4HMCA 3A21A 5CBIA 2QF7A 4DZAA 1VRDA 4WKAA 1V0NA 1DEDA 5HPOA 3QEZA 1XKJA 5G4WA 1OYCA 1IEWA 1L9WA 4AYGA 3TDFA 2P0OA 3DFQA 1EO7A 1FWAC 3ECQA 1KXHA 2VGIA 3BLFA 1GJPA 1FH7A 4PMDA 2XVLA 1GQLA 1EDGA 2UBPC 1VJIA 4RZBA 1KBIA 2X40A 3PZVA 3TWAA 5JBEA 3RLGA 2G96A 4ACZA 3TUUA 5ENLA 3WLNA 1BXCA 4XIMA 4O15A 4XZNX 4F0RA 2QDDA 4W7WA 4IT1A 1W9PA 1MI3A 3PY2A 3VNDA 3DFSA 1Y5VA 3DC0A 2GOUA 3R10A 1Q7ZA 3WENA 4BA0A 1KCLA 2VENA 1KC7A 3C2VA 4DO6A 4PEKA 3OBEA 1TPDA 3VKJA 2BSLA 3CHEA 3MHGA 4Q8QA 3LBCA 4B91A 1O5XA 3O0KA 1CLKA 3K4DA 3AHZA 3GK0A 1XC4A 2E25A 1H7XA 3HG5A 3QR3A 3M0VA 4TX9A 2Q8ZA 1QHOA 4JHMA 1YDVA 1H49A 1ZS2A 1CXIA 3LCGA 5HDRA 3LRKA 1BVZA 4L56A 2G3FA 5I77A 2J88A 3AFBA 3L4WA 3TC3A 5JUVA 1XYMA 4RXFA 5KITA 2D2HA 3VGDA 1OFPA 1E9LA 1MDRA 1V6YA 4GKTA 1A3HA 1VF8A 5I3HA 2R1PA 4CQ8A 2WHKA 3NCOA 2E8ZA 3WF2A 5DANA 1JDCA 3VNKA 2V8ZA 4GPNA 4IOTA 3BLPX 4GNJA 1EEXA 4FX7A 2NVAA 4CLMA 1K7XA 5HK4A 1JF5A 2FTWA 5D38A 4O1CA 4GIEA 2IKIA 4UTIA 2BVDA 3KOYA 2RGMA 4W5UA 4O1EA 3KL3A 1AQMA 4QG8A 4S2BA 3L65A 3TQKA 3NZRA 5CSYA 3QHOA 2WC7A 2ZCGA 4RE3A 1OSEA 5AVHA 2PZ0A 4LUTB 2AAMA 4K68A 2HMCA 3FOKA 4J5NA 4TMCA 3R13A 4JHOA 4WOZA 4MLRA 3VOHA 1RY0A 1X39A 1K6AA 5TQLA 3ARVA 1B3OA 1TFVA 4MAVA 2WCGA 1XYLA 3RN6A 4UZSA 1H7OA 4C1LA 1IT8A 1LOLA 4C6OA 5CJNA 3AYVA 2ZXDA 3C3UA 4NASA 4ZQPA 1NWRA 3WFZA 3CO8A 5BRBA 4IMGA 3SUTA 1Q8AA 4MGGA 4TV6A 3KHDA 2ZRYA 3PUEA 2O9PA 1CLVA 3PZ9A 4KRUA 4AD2A 4J4KA 4LVFA 3H2MA 3RO6A 4LQ1A 4BI5A 2PD9A 4QJ1A 3H26A 2DORA 2WKJA 2PDPA 3VM5A 3MWAA 4HNCA 4UR9A 1R47A 2F8QA 2VJXA 3NGFA 2WMJA 4AZIA 3CB8A 4CCDA 1BAGA 3N2XA 5MKGB 3OYZA 3MCMA 4RV8A 4Z0JA 5C9RA 3PTMA 3TZFA 2VVNA 1IR2A 2PLKA 3PG9A 1KRCC 4YLWA 5LKYA 5D8ZA 3OHMB 4CVUA 4LW7A 3LM7A 1W8GA 4ERIA 3VNLA 3QGAC 4AEFA 4I5XA 2YYTA 2CERA 3G1XA 2OEMA 3LTPA 3CK5A 1JZ5A 3RRXA 4FOJA 1A5SA 1M41A 4MFEA 4O1AA 8XIAA 1YQ2A 2A5HA 5DT7A 4HPXA 4GNVA 3BAWA 1JQVA 4O54A 4J27A 5EYWA 4A21A 3MUAA 2VL4A 3OTRA 3RM4A 3WDJA 1K9FA 3FSTA 2QEZA 4Z2KA 1HO1A 4AFYA 3PWIA 3OQ8A 3OLEA 2FJUB 2BY1A 1I75A 4BEQA 4EOUA 2WHMA 3OLGA 4Y9AA 3NM1A 3ZLFA 3OBAA 3OLDA 3SFKA 1CZ1A 7A3HA 3HPSA 2DZPA 2OOFA 1M1BA 5CEWA 2EEXA 3ARSA 4IIBA 3HF3A 2E5CA 1J9YA 4O12A 3TOYA 2I56A 3L23A 2EBNA 1K70A 2FFCA 4MJMA 1JF6A 3ZR4A 2VCBA 1CGUA 1B3YA 4LU0A 4GZIA 2ZOXA 4ZXLA 1S2AA 2KX9A 2WSYA 4LXFA 3CZ8A 4QDPA 3RR1A 1UZ4A 1AW2A 2A3LA 1SZNA 1IXNA 1P7TB 4HJWA 3G0UA 4Y2WA 1BHGA 2VD9A 3VIIA 1HGYA 5E09A 1F3WA 2QVHA 1QAPA 2EJ1A 1J0JA 3I7RA 2HBXA 1TMQA 3IGSA 4U2ZA 4TX8A 4KCUA 4JTUA 2VNCA 5HBFA 3WK3A 1QO2A 4LNYA 5CBBA 3ZVHB 3HBLA 1W0MA 4QLLA 1VLWA 3LGGA 1ZCCA 5HJLA 4RJEA 4L6DA 3AALA 4OT7A 4NVTA 4C6CA 2XDFA 1QR7A 3VKKA 3QN3A 4JTCA 1ZP4A 2NSOA 1POKA 2AAAA 3D6NA 1JCMP 3GH5A 4M56A 2FHCA 1PWLA 4RR4A 1X7IA 3ZO9A 2PWGA 4F0KA 2OWWA 5T9BG 4MUZA 2DIJA 4D8LA 1HX0A 4A2SA 3VI2A 3W53A 5FJOA 3BGGA 4WGHA 3MB9A 4Q6JA 3BJFA 1O5RA 5BXPA 4Q4KA 3E38A 3PZTA 1CXKA 3G6LA 5AN7A 2Z2UA 2YOCA 4D6GA 4QE5A 3LHYA 3QOKA 3C8NA 1TMLA 3QZ6A 3V0UA 1H50A 1GK8A 3BK0A 3EDKA 4TMBA 3WD4A 1OFQA 3WK1A 5AB3A 4PZVA 4NZ5A 1FA2A 2CHOA 4FNUA 3BL3A 1AD1A 1JDEA 3R11A 4ROPA 4HNOA 5H8UA 3ARWA 3DFTA 3VUPA 5CZJA 4CVWA 1EYEA 3S46A 1J12A 3ES7A 3KVJA 1E4IA 1P48A 3CTLA 4DVOA 2ISWA 2Q01A 1TREA 3MP3A 1H41A 3K1GA 5G2HA 1DWGM 2PWEA 3UG3A 3VMOA 4H9YA 5A95A 1LQ0A 1YNQA 1V6UA 1EC9A 4AZCA 4BI6A 4UNKA 4GE8A 2WSKA 3FYPA 4AWTA 3HURA 4R3UA 1H09A 3B04A 3KDOA 3MUZ1 3ITGA 1HF6A 5EBAA 2Y62A 5CPSA 3WD3A 1NDVA 3S5YA 4QQ3A 1QI4A 1RPXA 4FA3A 4XO6A 3NPXA 5D04C 3WLOA 2ZXAA 3CZJA 2ZUTA 2O92A 4LCRA 3SIMA 3TROA 1E15A 3MS8A 2VRJA 2LLEA 3GNPA 4PFMA 3DC8A 3GC4A 4GY0A 1GVOA 2INZA 3DBNA 1PZ1A 1LORA 4GJIA 1SJDA 4M6UA 5I2UA 1C8YA 1YXYA 3F4DA 1J11A 5EB8A 5FEZA 3UWEA 1EP2A 4DNHA 3GB6A 4HT3A 3L21A 3ZYZA 1OHLA 3RILA 1K8XA 2E1DA 1QWGA 3EX4A 1H0GA 1UW9A 1WP6A 4UTUA 5CC3A 5A6TC 1C8VA 1V3HA 3WQ4A 1O5KA 3PJWA 1P0BA 2YCEA 1WQ5A 2GGJA 3WQDA 3ORWA 3EAUA 4A3QA 4DUOA 4DAFA 3O07A 3NM3A 1FWBC 3EDJA 4Z17A 3WF4A 3MVIA 4D2JA 5C6MA 2WXDM 4ZB0A 2FIQA 1UB3A 2YL8A 4ECLA 3OG2A 1D7KA 3IEBA 2VVSA 4DJDD 1H1YA 4GXWA 1HL9A 4BWLC 3I65A 1M65A 2J27A 2PLCA 4HN8A 1I2RA 1GOIA 1HGWA 1OG0A 1XLLA 4OZOA 1JCJA 2QUTA 1UASA 1R3SA 2VR4A 4PUDA 2PRLA 4D6DA 3MWCA 4CUCA 3FDKA 4H7ZA 5HA7A 4FHAA 1CXEA 3P7YA 4RW5A 4Q7BA 1BKSA 4ZSUA 4CNPA 5FKYA 3S8HA 2WHJA 3TCSA 2ACUA 4HPHA 3CBWA 4ATDA 1QUMA 1MW1A 4CQDA 2Y7FA 4PB4A 1MEWA 1W37A 1ZJBA 4ZXOA 3ARUA 2VYOA 4GXMA 4UTWC 3RLUA 1UG6A 3UT0A 1LUCB 1UMYA 3INPA 1R2TA 4WJEA 1R9ZA 3L12A 4JIEA 3EEZA 3E2VA 4GI6A 4W86A 1FWJC 1XCWA 1YDOA 3A5FA 2VEPA 3EB2A 1V3JA 1RAKA 1I6NA 2NUYA 1PUDA 2G3IA 2NXHA 3B0PA 4IJBA 5BOEA 1IEQA 3KS6A 4CN4A 2PS2A 3W37A 3UG5A 3WF1A 4AZGA 1ZAHA 2QCMA 4CD4A 4NQ1A 4XB3A 5LIWX 1FWSA 4FLSA 3W7NA 2OSXA 5I3DA 1J2BA 3KP1A 3KBVA 1EJVC 4WSHA 2DVTA 1LOSA 1OCBA 5CZ0A 1BWVA 1YE4A 3BVJA 1XIIA 4WD0A 3VILA 4I90A 2XVNA 2XUCA 1REQB 1G01A 3TMQA 3P93A 1NQKA 2BX7A 2AOSA 2OSYA 4YVVA 1FHLA 4FK9A 3N11A 3TW6A 4K38A 3L66A 3WJSA 2XIIA 3U2OA 3FHAA 3CQIA 1KBBA 3QBUA 2JGYA 2P76A 2C1IA 5IRPA 3VYLA 2RAGA 3KCOA 1IF2A 3NVTA 1DXIA 1Q6GA 4JFUA 5D2XA 3BGJA 2G5WA 4HSNA 3TTYA 1EX5A 2Z7GA 3MU7A 1VB9A 2DEPA 3BLKA 5C9XA 3KX6A 4TXEA 1LRQA 2Z27A 1NF7A 5I3IA 4MB3A 4M80A 4IP4A 3QOMA 3H12A 1XBVA 2ISSA 4OBRA 2V5BA 3UYCA 3CIVA 3H2CA 4A8LA 4GINA 1GZ1A 2OEKA 1CENA 4G5DA 4FNQA 3QKZA 3GTFA 2V69A 1FHDA 2I57A 3P5ZA 2CW6A 1M7XA 4KFOA 4OUIA 4US5D 3I4KA 1WKDA 4JQ2A 3ITXA 1W1A1 1U5VA 4OBSA 4RL3A 1X97A 2VEMA 3IIXA 3MV11 4LAMA 1QOPA 3TIMA 1KKRA 3ZZ1A 1JGIA 4AD5A 3BW3A 3WLMA 4EP8C 5KZ6A 1E0TA 2H6RA 1WZKA 4J35A 1MW3A 1PDYA 3WFAA 1SJBA 4ZQNA 2GJXA 3WQ5A 4ZQCA 1UR9A 5A6BD 5AC7A 4FZIA 4V1YA 5GPRA 1RK5A 1UPMB 2X42A 3G1YA 3GBEA 2PTDA 2PD5A 1UKOA 4NYUA 1AZ1A 4QITA 4R27A 2VHLA 1DJWA 3NDYA 3TONA 3VUSA 4YTUA 3VIPA 8A3HA 1VCFA 2C1HA 4CD7A 5K2ZA 4C6QA 2E0PA 3AYTA 4HYVA 3CQ0A 3VCCA 1KGXA 1N8WA 1OFDA 3NQ2A 4EF9A 1FHUA 1PB0A 5BWAA 4JYEA 4ZE5A 1U2YA 3V36A 3BCDA 2NT1A 1HKJA 1NY1A 1RY8A 1G69A 1KV8A 3NPUA 2DZAA 1UWIA 5EMUA 2ODOA 5TBOA 3DG7A 2MNRA 3CWOX 4QG6A 2PMQA 3KBJA 4MMWA 2R9RA 2VT0A 1VIWA 2VQUA 5I0DA 3R8RA 3EPMA 3R79A 5CGMA 2VC7A 5BNKA 2RKXA 1UP2A 3LY0A 1Z8AA 5I03A 2DGAA 1O66A 4HD5A 1N7KA 1ZAJA 3CUGA 3KBMA 2NVDA 2GZXA 2WSQA 3BMXA 1A0DA 1Q7QA 1DE6A 1W31A 4ZQRA 4FXRA 3E0VA 1QK0A 3SIZA 4IQJA 2JKEA 4PEEA 4V33A 5FJTA 1TTQA 5DQPA 5I78A 1F74A 3W23A 2NVCA 1E73M 3TQPA 3O0FA 3NXFA 5FEWA 1K4HA 3UBPC 2V2DA 3WDQA 3ABQA 2X1UA 3CYJA 3IK2A 3VGGA 4BCEA 2VM8A 5LIXX 3JRKA 3KTCA 4FAMA 2V6AA 2HRWA 4NRRA 1YLVA 4XD5A 2VFDA 1AJ0A 2NV1A 2F61A 4FS9A 3UXDA 2G95A 4UTMA 1KB3A 2GJRA 3GNDA 4M7SA 1EGVA 1Y8BA 4LF2A 4C1NA 2OQLA 3ZJ6A 4B5XA 3CIXA 4NRSA 1QATA 5A6AA 1K9EA 4D6HA 1WX0A 1PE1A 3WLLA 3ABSA 2V5DA 3BJTA 4YTSA 3VGFA 5DEZA 2QDGA 1XH2A 2ZRUA 3UZ5A 2EG8A 3M44A 4MZ1A 4UOJA 3W71A 2GK1A 4PSRA 4P5UA 3H2FA 3RF9A 1EIXA 3W86A 3CASA 2OWCA 2VGFA 2B4GA 3FNDA 2WQDA 3OQEA 1JDDA 1HKWA 1XIDA 5C2GA 3IIVA 5DBTA 2EF9A 2OLSA 4WJ8A 4XSLA 5M3WA 4D6FA 1FH8A 3B9OA 3C4UA 3CL8A 1KM5A 1XG4A 3VCRA 3W7RA 6CGTA 3J7HA 3LENA 3BAKA 3EWYA 4WUIA 1D8CA 4YWIA 3F1QA 1G6CA 2AQOA 1PKNA 1ISYA 2Z1SA 5TF0A 1GZGA 2ZUNA 3WNNA 1HJWA 2O4QA 3QSTA 2C15A 3WH9A 1JPIA 4PRWA 5EMMA 2PPGA 2INEA 2PA6A 5A1AA 1RR2A 4LS0A 3FFSA 3FYOA 4R5EA 3C0QA 4LY4A 2D73A 3O8AA 3STPA 4GIAA 1U5HA 3KRUA 1JPHA 3SUWA 4C6IA 3WQOA 1Q6FA 5JBFA 4GUFA 4DI8A 4PRTA 4YVPA 3ITVA 2VTFA 3NO3A 5BW6A 1NOWA 4B5VA 2GJPA 3MKKA 2X1RA 1R9YA 2DJLA 4JTFA 1JUBA 1NWSA 3SCSA 3UVAA 3T44A 1BGGA 1P43A 3AMDA 3CQJA 2E09A 2BV9A 4BS0A 5D30A 1Q45A 4EAYA 2VO5A 1F9CA 3U7BA 1W17A 5ABEA 3CT2A 2PU1A 2VUNA 4YTTA 1X8FA 1TWZA 4DWDA 2GGIA 3ENLA 2Z6IA 2RUSA 3B8WA 5KMYA 1GEQA 5FJJA 3O1NA 4UUIA 3LM3A 2XH2A 1PV8A 4A3UA 2DDXA 3E9AA 3LCFA 4GYKA 3B03A 3P62A 3STFA 1DQXA 5HATA 3LCHA 2E7FA 3CV1A 4QQUA 4MFDA 4OU1A 1ZHAA 4LCSA 1T0OA 1P5BA 3MC5A 2I9UA 4D6JA 3VD3A 2I14A 4MPQA 4QM1A 1ADOA 4S3KA 2FHFA 3AHXA 4HU3A 1O12A 2DZWA 3B8IA 4B15A 2OODA 4IHCA 1IGSA 1KKOA 4I9TA 2FVLA 4UCGA 2ANUA 4M6PA 2VD8A 3UPWA 4GYFA 1ESWA 4ACZB 3CUZA 2I5IA 1US2A 2PAJA 1TKKA 1UWSA 1RCQA 1J8VA 3QV6A 3C2OA 3WD1A 2X16A 3GVGA 1NSJA 2ZXBA 3W7IA 4W8BA 4LPCA 4LUYA 3L2IA 1RJPA 4N4PA 2DSWA 3ZM8A 2F9RA 1A50A 1HL2A 4FMVA 5LNVA 1PTGA 4XVDA 2DSZA 1HJSA 5C71A 3EOLA 4IPJA 3UF9A 4OHQA 2VP8A 1TPC1 2PTXA 3L7RA 4JYDA 2HBVA 3JR2A 2ZZ4A 4ADUA 3WUFA 1VGAA 3WQ6A 5E6YA 4XX6A 4GMEA 3N6QA 2WW5A 3E3HA 1CTNA 3IUDA 1C9DA 3QV9A 1UHVA 1C92A 5TAOA 5H8MA 1DKWA 4I7UA 4UBPC 5J5DA 2XG9A 1O60A 1XL9A 1TCMA 1TJPA 2NUWA 1E5JA 1CCWB 5FL0A 3WMSA 1WBJA 2C18A 1RLCL 3RYSA 1SYTA 1RP8A 5IDIA 4UFIA 3MSGA 5ABTA 3C8FA 1V3KA 3GNRA 3BLLA 4D9PA 3C0LA 3L4YA 2ZX7A 1GOKA 1GOOA 3W01A 2XSXA 1G67A 3S2JA 5FCZA 1WCGA 1NJJA 3W73A 3KTXA 3EPNA 2V82A 1MXSA 1TZ9A 3G3DA 1S5NA 1YDYA 2YPIA 3EDFA 4IPIA 1E6QM 1ZGDA 4YXGA 5GQBA 3KLKA 2E67A 3EMQA 1TA3A 5CPOA 2DZBA 3QPZA 3LXAA 2CKRA 3QXBA 1F6PA 1TR1A 1W1TA 4HBKA 2BZNA 3W07A 4ADSA 4W7UA 3TR2A 3TVAA 5G5IA 4QLJA 3T0AA 5A2CA 5CZKA 4KIRA 3QTPA 5HWJA 3MV01 4FO4A 3BUVA 1JCTA 4GQQA 2C14A 1PZ0A 4HPNA 3SR7A 3QM3A 1DORA 1W3TA 1M04A 3MKVA 2P10A 4RCXA 3PFRA 4ZENA 1XW8A 1TPUA 1LOQA 4JNZA 3TAKA 2HCVA 4JS3A 4N42A 1CECA 4AWEA 5FEXA 4QIUA 2Y8KA 3VMNA 3NSXA 3W4RA 3PUOA 2C3ZA 3IJ6A 4BQ2A 2CZ5A 3POCA 3H53A 1IQ8A 4RNHA 3PANA 4BKNA 1UBPC 3DN5A 2FZMA 2Y5JA 4RNIA 4H83A 1ISWA 1UP3A 3LPOA 1ITXA 4XZMX 4AF0A 1US3A 4D72A 1GWJA 4HPJA 3CS2A 2NSXA 4M1BA 3IACA 4IGHA 1FWDC 5C5YA 3LTYA 4W84A 5FACA 1YNYA 3FJLA 1XISA 4C91A 3BLOA 1GQIA 4RDWA 1SUXA 2INFA 1WOAA 4NP7A 3S1VA 4MB4A 3M0LA 4H4IA 2F38A 2Z24A 5I3JA 1W3HA 2DT2A 3SCRA 2QAPA 1SR0A 2GQAA 3M47A 3AWNA 3MSDA 1TZ7A 3QFEA 3M7WA 4GNKB 1J0HA 4ORMA 3S5OA 1VYPX 2ZC8A 3DYOA 2D1ZA 4A05A 3ALGA 5LIYX 2QCFA 2X1TA 4UTFA 2DSKA 4I6VA 4KKXA 4YNGA 1KCXA 4DZHA 1UKPA 3GNNA 1U83A 3UJRA 3WG6A 4LOCA 4CD6A 3CEPA 1GOXA 2JKAA 1B3XA 3IIZA 1GHSA 1X6NA 3GIQA 4GWEA 5U7SA 1MRAA 2OO0A 2Y88A 3G1HA 1K9TA 3IGXA 2CBJA 1JIBA 4OGZA 4ZOAA 1L0PA 2VWTA 1ZBCA 3HMJG 4MOZA 3ZWTA 2IQ0A 3CJPA 3L4VA 3W75A 5LGZA 2BP1A 3AIVA 4I8DA 2YB4A 1UWTA 1W3KA 2DQXA 4AEEA 3PTKA 3MY9A 2BVTA 5LA2A 3B8SA 4UQBA 1YKWA 4W93A 4LVDA 1YYAA 3RPMA 1U1UA 1DWFM 4XZLX 1VFOA 2BLEA 1VFMA 4H9XA 2QPXA 3UG4A 3BV7A 3RITA 1WYIA 1LL6A 2I16A 3VVGA 1QOXA 5F4XA 3LTSA 3RNDA 5HNNA 4EACA 1J0ZA 3CUFA 5C8BB 3LHZA 1VCVA 1R86A 1BXBA 3VKCA 4GO9A 1KWKA 4DUXA 3DHUA 3IAQA 1RLDA 1EJ7L 4KETA 1FWRA 4P7OA 1TIWA 2F7FA 1IXQA 2OKTA 2WZMA 4X9SA 4BR1A 1FOBA 3W2KA 4O8AA 1B3ZA 2ACQA 2DVXA 4U3CA 3NAVA 4JTEA 4C7DA 3O63A 3R12A 1TPB1 4X3ZA 2YGYA 2G4FA 3ITCA 4LBSA 1UCWA 3TNBA 3GKFA 2VEGA 4WLCA 3V3WA 2DFAA 1K7EA 2PP0A 1LBMA 4NJKA 3KL5A 3AJ7A 1SW3A 2BG5A 2AQVA 1HG3A 3AISA 3SN4A 3TE9A 1H63A 4UCFA 3BE7A 4RE2A 3L68A 1R8LA 4PCTA 2VR5A 4NNBA 3ME3A 4CQ9A 1O94A 1R0MA 1ZENA 3EA2A 2XGBA 1UR1A 2ISFA 3HOJA 3WN6A 1MQQA 2NW0A 3W70A 8CGTA 1F07A 5CC6A 1UPPA 3TFXA 1LBFA 3LXBA 4GLEA 3VIJA 1EYWA 5A8GA 2IXVA 3AI0A 1J2WA 3B9DA 4QS6A 3D3AA 3M43A 1IWPA 1LCOA 3P67A 1EA0A 1VP5A 3W00A 3VDGA 3G2GA 1JPMA 1XLCA 4AZCB 3VA8A 5DXYA 3LZ5A 3DAQA 1K7FA 1XIHA 5AYZA 2HSAA 3WFLA 4IMAA 4Z2JA 2XYLA 6ALDA 3C2YA 2Q8LA 2W66A 5K9XA 3WLQA 2HXUA 3MJMA 4K36A 1TV4A 1QW7A 1SFTA 4J40A 1JRCA 3LZ3A 1WDRA 8XIMA 4AIEA 1W5PA 1VFLA 1Q6OA 1DIDA 4H1ZA 4IQEA 2ZYFA 3QY7A 1XFBA 4NZ4A 4DBDA 1EC8A 1AFSA 3QGKC 3W6YA 1VS1A 3SBFA 4PL1A 4PBFA 4B5TA 5LA0A 3BO9A 3GVRA 1A49A 4NI8A 2IKJA 2XH4A 2CC0A 3H24A 2PWHA 3MI2A 3AXHA 4JN6A 1LWHA 4WCJA 2A21A 3VOCA 3WUGA 4L9ZA 1D9EA 3IIPA 1OY0A 3WEMA 4JQAA 4Z42C 2ZADA 2WMGA 3OODA 2VDGA 3OP2A 2B81A 5FF0A 3SRDA 3SQSA 2J66A 2PU0A 3CPUA 2QCEA 4NF7A 3SJNA 3BANA 2FVMA 2J62A 4PC8A 3ZOAA 3HQOA 1F2JA 3P8JA 1E1EA 3AHTA 1LG2A 2QYGA 1SU5A 1E6SM 3ID7A 2NQZA 3W88A 2VGGA 3BZJA 3MI3A 4S3EA 1MO0A 5DX7A 3P5YA 4J3WA 5AC5A 1W9UA 4NI3A 4XO7A 4LFYA 4IG2A 3LHTA 4E4UA 3HIJA 4DF1A 3B0YA 4JQ4A 1SJCA 3UWQA 4FOUA 2DJXA 5CH9A 4FALA 5HUOA 4NZ3A 1HIZA 1E6XM 3LNPA 2CZVA 1I1WA 3GZAA 2NQLA 2RDTA 5DY3A 1BPLB 3CAKA 1WAUA 4B3ZA 1EF3A 4DWSB 1UQYA 3N18A 2E6YA 1QU4A 3AIBA 4NU7A 3B8UA 3MP5A 2UZ9A 4V27A 3RJXA 2ZA1A 1S5VA 1AMYA 2PDHA 2WKLA 4ZFCA 4LYRA 4JOMA 2X7WA 3EX3A 3WBYA 5CAHA 3MCNA 5F2IA 4ADTA 1F6YA 2OZTA 5CGQA 1YMYA 2PFHA 4ZQMA 1QW8A 3I10A 4QR6A 6XIMA 2A6LA 4D6EA 2V38A 1LQ2A 1P6BA 4IMEA 2PTWA 4B5NA 1S2CA 3W0KA 3TMLA 1TPVA 2MANA 1JZ7A 1WNOA 2VC6A 3GDBA 4F3HA 2GGHA 3UFYA 1VBGA 1NVMA 3IUIA 3MUY1 3O9NA 4HA1A 5KZDA 4G9PA 5FJRA 1G1YA 1XQLA 1SZFA 3SURA 2PTZA 4HN4A 4G7EA 1EXPA 3T9PA 5M17A 4DO4A 3E2SA 1NM9A 3NDOA 1XGDA 1KXQA 4UMAA 1V5XA 3WQVA 2W27A 4HCHA 4KCVA 4N9EA 4UR7A 4OOUA 1UWRA 1NELA 3TNOA 3K46A 3PPHA 4MVAA 1F73A 3KOFA 1XRTA 9XIAA 4YJ5A 4F40A 3USBA 3WQEA 4F8XA 1NU5A 5CGTA 3OIHA 3BV4A 3OB8A 3UVIA 1SFSA 4O8RA 3Q45A 3UNTA 1E9IA 4AXNA 1E6PA 1ZY9A 3TP4A 1I2OA 1E6NA 3DG3A 5CPLA 2Y89A 2WPGA 2W92A 4HPGA 4AEOA 1EZWA 2WANA 3N2BA 1ECQA 3CO4A 1TUFA 4WK9A 1RBLA 3M1ZA 3MI6A 3BMVA 4MYXA 2PDIA 3RMJA 4U28A 2JALA 4XAPA 2WO5A 2UY2A 2YLLA 4IMCA 5BROA 4XBSA 2V2CA 3RCYA 1NWTA 1J79A 4BWLA 3IJDA 1JXKA 5EFFA 1FWNA 1RH9A 4LJ3A 3T2QA 2YCKX 3T8LA 4IFRA 3LBMA 3STCA 2CLFA 4WQ6A 1NFPA 1CWYA 5C54A 4QLKA 5EFDA 4EK7A 1QCWA 1KM2A 3IIOA 4PTVA 3D47A 3AS2A 1WUEA 3FSUA 3GVQA 3W02A 4P8VA 5CPNA 3LQGA 2V67A 2QS8A 3LBOA 1EPXA 2P3ZA 3LS9A 2X2GA 7XIMA 1OFAA 3N4AA 5D2VA 1Z48A 1EQPA 4Q6XA 2GJXB 4J2MA 4HNUA 2BASA 2NWRA 2X09A 3LV5A 3P8IA 4RZ5A 4FSAA 3FHQA 1VLIA 5A8OA 3NJ3A 5IOBA 2DVUA 4NAFA 4O10A 4JEJA 3HPXA 4AZ6A 5XINA 3NG3A 2GOKA 3PF3A 1G4SA 2ALDA 1CX9A 4DLMA 4O16A 3A4JA 1FUYA 3AXMA 1A5BA 3OLIA 3T07A 5C9UA 1RD5A 1QHPA 3QC0A 4RV3A 3UGVA 4IIEA 5D32A 4Q22A 3E0FA 3O6CA 1A3WA 1KM6A 4Y7EA 2XSAA 2WJEA 3S9ZA 4MJ2A 3KOXA 2G37A 3S1XA 3GXMA 3N14A 4BHYA 4DBEA 2WYSA 2WBGA 3PG8A 1XC6A 4WDUA 4Q8UA 3SSZA 1NOUA 3FA3A 4H9VA 2WV8A 3OGVA 3H55A 2FZ9A 2HWGA 1HXJA 2DZXA 4JN8A 2ZZ7A 3T40A 2PLJA 3VGBA 4GY1A 4LB3A 3TSBA 2BY3A 4OV9A 4L7ZA 3TR9A 1J0KA 4S3DA 3RX2A 1MMFA 3W82A 3VXGA 1XLHA 4YPJA 2HDJA 2XPKA 4QISA 2AMGA 5J8LA 4O13A 2W4XA 5A2BA 1Q6EA 4YMZA 1I8JA 3HG2A 3FJ6A 2BVWA 3GU9A 1IWBA 3ANYA 4GKLA 4INFA 2J9XA 1JI2A 1E9ZB 3KAOA 3NFUA 4JN7A 1PYMA 4DEFA 1W5MA 3II1A 1VH7A 2J9YA 1UR4A 1UR8A 1VR6A 3LEPA 3C2EA 5BCAA 1RVKA 3PNZA 2AL2A 1JD7A 5CLWA 3H70A 3P0XA 1O1ZA 2DZTA 4C1NB 1WUFA 3A12A 4A6GA 4QTGA 3GYEA 4A8RA 3G0XA 4UFHA 1AW5A 2ZXQA 3UCQA 4JQ1A 2PZNA 3O6DA 4MTVA 2GFTA 2VX4A 4MJ4A 1B30A 3RX3A 4IJCA 1NP0A 1MUCA 3FCPA 1ZAIA 4YHGA 2HQAA 3I7QA 1K03A 2GK1B 2YA1A 1Q2SA 5F2LA 3QW4B 2OQYA 3VOIA 3NQ7A 1RJQA 1NAL1 3WH8A 1BGAA 2QV4A 3M41A 1ICPA 3FYYA 3PWAA 4GI9A 1OFEA 4ZGYA 4M5PA 3H22A 1QPQA 1H2JA 4Q7NA 2X0YA 2V2HA 3NQEA 1NTHA 2HROA 4U10A 1YTDA 1XDLA 4ACYA 2OGJA 1OGGA 4GI4A 4WZHA 4LUSB 2X8RA 4DF0A 1TV2A 4REQA 5I3KA 6REQA 4FB7A 4GI8A 3OEXA 3W76A 4ZQOA 4Y9OA 3TQ0A 1KLYA 4GD0A 1DBTA 3FIGA 3WQ8A 4KEZA 5IM51 1GZJA 2VX5A 1MXGA 2VQTA 4XBJA 2QCNA 4O0ZA 2ALRA 4XQ6A 3QRHA 2FTYA 3C6CA 3PPGA 1YPIA 2VDHA 5BXSA 1PX8A 4DYJA 1EC7A 1GORA 3MSRA 5F1VA 2V3EA 3NYZA 3W7EA 5FESA 2X2YA 4PGLA 4Y6GA 3M64A 3NPVA 3VDCA 2ZQ0A 3W24A 4FXSA 4DO7A 5LIKX 2GVLA 3EA1A 3W7HA 3NPWA 4HP5A 2BY0A 1E1CA 3G1FA 3HQ1A 1TV3A 3DBPA 4MNLA 2FJKA 4Z1AA 2BHUA 2F6UA 3NIYA 1DTUA 4KFPA 4AB4A 5IXEA 5HAOA 1EUAA 4UQDA 4HMNA 4JKMA 1MEIA 3GHSA 1PX3A 2EQDA 5D2WA 1HVQA 3OPSA 3U7VA 2BY2A 3SUUA 2W91A 2ZFAA 5A8MA 4IMDA 2A6NA 3M6DA 2P88A 4MIMA 3WLSA 1QXLA 1GHRA 2Q3RA 3NL3A 1GGOA 5JBDA 3QY8A 3Q37A 4Q8VA 3LCWA 3CXOA 3W28A 2CPUA 4O17A 1UD8A 5F2GA 3LLDA 3PC0A 2EKCA 2PWFA 4WX2A 5IBXC 4K7YA 1Z69A 1LWIA 3WIJA 5K3VA 1EXBA 4FNPA 2RJHA 1EHNA 2QXWA 4DNMA 1TWWA 3LYEA 3WLRA 1A5MC 1X7FA 2A7PA 4S3JA 1KFJA 3PK7A 4K1WA 3TA6A 4UOZA 1CDGA 3BW2A 5AFDA 1U33A 1R3TA 4E8GA 5CSRA 2I17A 3B4YA 4PCFA 4PRRA 5EMYA 4IL0A 3PBVA 3AZTA 5IHRA 3DI1A 4AY7A 1E51A 2EPLX 5FJUA 3SI9A 3I7SA 3AZSA 3BGAA 1VZWA 1R87A 4MKVA 5AKQA 3R94A 5T9CE 4TVDA 2ZX8A 5M1TA 3GW3A 1GVQA 4KESA 4ZVJA 1BSIA 3ZT6A 3NSNA 2PGRA 3SSJA 2Z0IA 1JEZA 2UY4A 4JYFA 4PUWA 1J10A 5GVJA 2VFIA 3SY1A 3OZOA 1W1YA 4HNTA 4HHPA 1GJWA 3BOLA 3H4XA 1YTEA 4IPLA 4GVIA 4W8LA 3VDBA 2YW3A 1DOSA 2ZA2A 1M53A 1T40A 4GRSA 4JX5A 5KZMA 2PGWA 1WDWA 4U2YA 1XRFA 2NT0A 1KFBA 1IE7C 5CAKA 1UYQA 2GQ8A 2WNZA 4TUFA 2WMIA 3UJFA 5T91A 2GUYA 4LX4A 1BYCA 4L4PA 3L4UA 3KBNA 1PTAA 1H1ZA 1GW1A 3EGJA 3RO8A 7ENLA 2PDNA 4WJXA 2BS9A 1ZCOA 2WOQA 3LSBA 1MEHA 4X0VA 4MF4A 1V7YA 2Z00A 3S4TA 3ZVIA 1VBUA 2QKFA 1AH3A 2XFFA 3H4WA 4HSOA 3GTNA 1MW2A 1DHKA 3FKRA 3GLCA 1AQHA 2FMOA 4H2HA 2NQ9A 1DJIA 1PZ2A 6XIAA 2XVPA 4UFMA 3TSMA 1SFJA 3RXZA 3RHGA 4JICA 3AU6A 2DQWA 3Q94A 2E9BA 2ZVRA 3SY5A 2J7HA 1E0UA 1OK4A 1GCYA 5D2YA 4KEUA 1KWGA 4RDZA 1SMDA 3WJYA 1V08A 1YXCA 4MPKA 4XISA 4F9JA 1SR9A 4IGNA 3MPGA 1CGXA 2ZDSA 3CL7A 4O14A 2R1MA 1DYSA 3TYCA 3HV8A 3UXKA 4PUJA 3I6RA 3W81A 5K9DA 1TPH1 2DT0A 3M5ZA 1UKSA 1L8NA 2UV8G 2P0IA 3BAIA 5JXQA 1S38A 1GPFA 1WBHA 4C6NA 3EKLA 3ZR6A 1BF6A 1DP0A 1ZBWA 3O06A 4XAFA 4AF0B 4CNOA 3APTA 5LSMA 2CYGA 3VAVA 4IGMA 2VI0A 4AH7A 4JKLA 3KLLA 4WSKA 5HWMA 1CBGA 4YN5A 3QQ0A 4EPEC 4QAIA 1FDJA 3EXSA 3WELA 5AC4A 5DO8A 1E43A 5JU6A 4D8AA 3RU8X 4KCWA 1KQYA 1DJZA 5GJPA 4UWMA 1H7WA 2HE5A 1E3ZA 4DBSA 4UIOA 5AHEA 1E70M 5I3FA 3H8AA 1UWUA 3W6LA 4CU6A 2YX0A 3REQA 1TJ2A 4US5A 4JTRA 3QZEA 5M5DA 4LF1A 4UQ9A 2RFGA 5AYBA 1GYMA 3KP0A 3SO7A 1W5OA 2P1FA 4JEQA 1XLAA 3DCPA 1W9DM 1WDDA 4O50A 4OWGA 3WO8A 3HFTA 1HN1A 3GFZA 3UWVA 1K9DA 4M8UA 3P84A 1DQWA 3DFOA 3WD2A 3PJUA 3G18A 4LYQA 4PN2A 2XM2A 4NHVA 1AVAA 1H7NA 4GX8A 4C90A 4FNTA 3CV2A 3W38A 4YWSA 3FKKA 1KRAC 5BOOA 3LPGA 5DLCA 1Y0EA 3MHFA 4FIQA 2KZHA 1SM9A 2YZRA 1B9ZA 5EA9A 4Y96A 1KM1A 1OZMA 3R7MA 5DN1A 3MYOA 1EJRC 5I5RA 2E28A 2FLIA 2XIJA 2Z28A 2NX9A 1SFLA 3VGHA 2PF8A 2V3FA 3A3XA 3ZFHA 3A64A 1J0YA 1TIMA 2W63A 1RBAA 3NQMA 3LXCA 4AC1X 2HJPA 3S6TA 3WNKA 4EPBC 2QIIA 4RDYA 2W5FA 4PYSA 1TSIA 3AHVA 5AZ0A 3M07A 2VR2A 3ABXA 2FTPA 2E9LA 4S3CA 4E3VA 4LB4A 4LTSA 1WDSA 5FSEC 1H5VA 3A3WA 1BQCA 3LDVA 3U48A 5DMNA 1F7BA 1Z42A 2DW6A 1TWSA 1A5UA 4UTLA 1XD1A 2OELA 1QFEA 1ZB5A 2RHGA 3GXTA 2CLMA 2WB5A 3GC5A 1EDQA 4K8HA 4RNJA 4WRHA 1H1NA 3WLJA 2Y4SA 3LERA 3SCNA 4M82A 3CMFA 3KWSA 1IGWA 4X2PA 4GABA 3M0HA 3HJEA 1JD9A 1XR2A 4UXDA 2EPNA 1G9HA 3UZZA 4PBEA 2XWDA 1D3HA 1OADA 3RAOA 2PCEA 3QYQA 1MXDA 2FKPA 3FVMA 2OB3A 1AJZA 5FD0A 3CV6A 4XTDA 1W8SA 3DHDA 1KD0A 1R46A 4BFAA 3E5BA 4B3LA 4WSJA 1GTEA 3WQFA 1JDAA 3F4VA 4PTXA 3GSMA 1LLOA 4DHGA 4DO5A 2IQTA 3E74A 5I6SA 3RUBL 4QJ5B 4C6BA 2A7NA 1JCNA 1UH4A 4JTHA 5BOFA 3AMKA 1RA5A 3VIKA 4QNEA 4GQ0A 1W3NA 2OU4A 3TYBA 2BOEX 1F3TA 4ZSTA 4AIOA 3TWBA 3WCZA 2PODA 3GVWA 3BLDA 3EPOA 3UETA 4Q4SA 1LBLA 4IJRA 3H7UA 5LHEA 4LYPA 3U9IA 1G94A 3LMYA 4D71A 2ZX6A 2OG9A 1TJ0A 1XIEA 1XS2A 4IQDA 3WJXA 3WJZA 2BFGA 3IUHA 3UJEA 4PMYA 1X6UA 3WQGA 3TN3A 3FXYA 5AHMA 3S1WA 2V9DA 1X98A 4IL2A 4XWUA 1XDMA 5E9AA 7CGTA 1B1YA 1SW0A 2QGHA 3ZXWA 3SGUA 1VRXA 3K8KA 3MBFA 5BYWA 3L4TA 4NZJA 4ZOBA 1K4GA 4S2CA 1C7SA 1W5QA 4ZMGA 1EH9A 4KMQA 1MYRA 4PMVA 1F8MA 3OG3A 1E55A 3V1PA 2IKGA 1IIGA 4GQRA 4N9DA 2L5HA 3LGEA 3QHNA 3LX9A 2NZLA 1OBAA 4QROA 3UR2A 3E49A 2Z1XA 2Z26A 4JTJA 4YL2A 1G4PA 2EHHA 4O57A 5G2IA 1CLXA 2ADAA 2QR6A 1T41A 1XYFA 1JYWA 3OA5A 2R24A 3F2CA 2F6KA 4CN1A 4HJFA 5H1WA 3SRKA 4DQWA 2FZBA 1WXJA 4AUBA 2V0TA 2KAUC 2OT0A 3E1F1 3AIRA 3M5YA 3R8HA 4OJYA 4OIFA 2PF0A 4S3FA 3WDHA 3P0WA 3VE9A 2DW7A 1W1PA 1XYAA 4UFLA 4XKMA 5D2TA 2CLEA 1WA3A 1P6CA 2X41A 4TTGA 3G24A 3W72A 4GZ7A 4HHLA 1R2RA 5HQEA 1R3VA 1TRIA 4IPPA 2VCAA 3H6OA 3UXLA 1THFD 4ZR8A 3QR0A 5GNXA 3LCXA 3ZIZA 1OGSA 3N9KA 4JPGA 3SZ8A 2V5LA 3TJ4A 4WOQA 5CJMA 3B97A 2YDQA 4O1FA 2XGZA 2PDMA 3FLUA 1OFBA 3GY1A 1QNPA 2CLIA 5AYYA 3W2MA 3KVMA 3GXIA 1D8WA 4L65A 2GWNA 5E0CA 1ZBKA 1MDLA 1AZ2A 2X0HA 1MVYA 2E40A 2WCAA 5TD4A 6A3HA 3BCFA 3N29A 4EWJA 1QNRA 2XVKA 2DV0A 5HXMA 3M0MA 3LA4A 1PVNA 4PMUA 2DY3A 3RCMA 3PNUA 2OWXA 3E2QA 4Y9PA 3GO2A 1XRVA 1GOQA 1HFBA 3QSRA 3VC6A 3BQ6A 4W7VA 1X38A 1KM3A 2X0SA 3MZNA 3OW1A 5LA1A 4OUEA 5MKGA 4LEQA 1RUSA 3FEMA 2O9OA 4X22A 4E2OA 2RH9A 1G4EA 1O6IA 3GKAA 3WUBA 2WJFA 4F2UA 1UA7A 1ZUAX 1S46A 1DXEA 4JL1A 3S2NA 2WPBA 3MMTA 5KEZA 2YIHA 3R4IA 5E93A 2E3ZA 4ZBCA 4BQ4A 1LT8A 1G5AA 1JQXA 1XM3A 1K6WA 1AODA 2HE8A 2XGIA 2IW0A 1GOWA 2WLZA 3IWPA 1FP9A 1Q85A 1EX1A 3QMRA 2Z1VA 3WBEA 1UR3M 4J1OA 3WBAA 9XIMA 3GDMA 4G1KA 5E0FA 3GDRA 3PUDA 3B9EA 2Y85A 1EBGA 3AXXA 2YBVA 4Z2LA 3DIPA 1CIUA 2TODA 3EX2A 3TOPA 3MVTA 3LOTA 3CZGA 4YVXA 4AC7C 3W2LA 1IXPA 4E2VA 3KRSA 1DWIM 3E12A 2BXYA 3M0YA 3NZQA 3FGCB 3NOEA 4HA3A 1L8PA 1OCNA 4FR6A 4HSHA 4GO8A 3DGRA 3VDHA 1S2WA 2REQA 1J5TA 3D0CA 3EOOA 2XTKA 5BWFA 3BQ5A 1JCLA 2O9RA 4B16A 4BY3A 1JAEA 3OVQA 1O7AA 4RKAA 2YW4A 2DZVA 4BF5A 1QRQA 1O95A 1QW9A 2TSYA 4WDXA 5MHBA 3KEHA 1OINA 1EWDA 3QMSA 1E0VA 3I68A 2CBUA 1H61A 1VFTA 4DJFC 1FWWA 1NWUA 5HMSA 1YNPA 3NGJA 4KF1A 1UD5A 3POHA 1G7VA 3VNIA 1LRTA 4NAFB 5B80A 4DPPA 3P81A 1UWAA 3M4HA 3U5YA 4DM1A 3G8RA 3A4XA 2H3BA 4NILA 3H2OA 4A35A 2R1NA 3H4GA 3PZNA 3HG3A 3LG3A 1V3IA 4ENLA 2B0MA 4JIPA 3B9NA 2XFYA 1XUZA 1XSJA 3N3TA 1YXDA 1JZ6A 3VKDA 2Z6JA 1YRRA 2QJNA 2D0HA 3AQUA 3VZZA 3CZKA 3WF3A 4MWAC 3CT7A 3W1RA 3RU6A 1FWEC 3KCLA 3WLHA 1V6TA 2QUUA 2TYSA 3CUHA 1K8ZA 4WVXA 1QI0A 2AMXA 3HMCA 2QT3A 1KTCA 1Q5MA 5EBUA 1ZFJA 1UKQA 4DJEC 2ATSA 2W9MA 1UIPA 3T08A 5M03A 7REQA 2F84A 2Q02A 2FH8A 4DWSC 2BNJA 4GGBA 1RSCA 3N15A 1IZKA 3CZEA 1U30A 4GVFA 3TJXA 1MQRA 5LNRA 1YHTA 1FH9A 4CD8A 1V3MA 1FKWA 2YYUA 3AAMA 4P7RA 1Q4NX 3ARPA 4Q8OA 4RX0A 4U4MA 4IIDA 4UQEA 4IUGA 3VK5A 1C7TA 2PBGA 3VOJA 4N4QA 3BCJA 1I4NA 1SSDA 4NAEA 4TU1A 1UC5A 2B7OA 3NQDA 3GDKA 1F76A 4RPPA 2AL2B 3VDAA 4ZFMA 5CPQA 5LXEA 3QJAA 1VEOA 1TO3A 3WDPP 3G3MA 1HVXA 1UROA 2ON3A 5I7GA 2XZ7A 1UZ1A 2ISDA 4L4OA 4H9UA 3NQFA 3GTXA 3C3NA 3C0JA 3A5VA 2WJDA 3N6HA 4PCPA 3M0XA 4LS2A 5I24A 1OCQA 5I79A 1IEXA 2XN0A 3QVQA 1A3XA 2OLHA 4JFSA 1L6GA 1EFZA 5CC7A 3PR2A 1IZCA 3N4EA 3PZQA 4JY8A 4QGCA 3GAYA 1M7JA 4DLFA 4ZB5A 3R2GA 3GHRA 2YLAA 4U5KA 3IVSA 4C1KA 4MY8A 3N3MA 4J3XA 1XLBA 2OYKA 1EWEA 3VIFA 5A8QA 1XG3A 4IXXA 1DJNA 3CHVA 2HPIA 3MDUA 1FWGC 3FN9A 4Q7IA 3RRAA 3FY1A 3EZ4A 3WH7A 1P0DA 4REQB 3G1DA 3JS3A 4ZEPA 1NFGA 3WMLA 5F4WA 2EXOA 2EPOA 2H9AB 2G97A 2PBOA 3RLVA 1N2VA 3OVGA 3EWUA 4MDPA 3A6OA 4LBUA 4N02A 2WNNA 1XBZA 2JF7A 4QEEA 2JQXA 3IJ9A 2CXGA 3W84A 1RBOB 1WZAA 3BW4A 3BH4A 4W8AA 4MAZA 3XIMA 1E5NA 3I3BA 4BEUA 3NSMA 4KT2A 3TC6A 4ZTXA 1EKOA 2WMKA 4KRZA 4QJ4B 1ZNNA 5B7YA 4E8DA 2Y70A 4ML4A 4HU4A 4AX7A 3KE0A 4E4FA 5A2AA 1L2QA 3UZYA 3F4CA 3PP7A 4FP1A 2BODX 1J93A 1KFCA 2YDSA 4EXBA 1FCQA 4RXGA 1E1CB 2OZ0A 4V2XA 4KGLA 3NNTA 1BTCA 3NL2A 4HMEA 6ENLA 4KCTA 4DXKA 2XHYA 2GJNA 1SJAA 4DY1A 3ARXA 3A24A 5FL1A 3LSCA 1MNZA 1PPIA 2Z1BA 1ZTVA 2CEQA 3B0VC 1FWIC 1PL9A 4FPSA 2QGYA 5U4NA 4GCAA 1ZP3A 3DDMA 3LRMA 2IQDA 5BU6A 2GQ9A 3VNMA 3JZEA 3KM8A 3CAQA 1K02A 3CIWA 5E5CA 3TEVA 4K8EA 4PMXA 1R5YA 4G2DA 3TXZA 4AMAA 4P8WA 1N8IA 4AVFA 1JYNA 3GX9A 1AH0A 4R34A 4ZB2A 2VCCA 1CNVA 3QC3A 3NZPA 1YW1A 3S9YA 2CU0A 3LK6A 4HIBA 4FLOA 3NVDA 3GIYA 3AYRA 3BPWA 5LYRA 2VELA 3QMTA 1UZHA 4RE0A 3WMBA 1KTNA 3SN1A 4NY2A 4J7RA 1ODZA 1X1ZA 2XIOA 3NTYA 2X05A 2WAGA 3HO8A 2PDUA 1TTJA 2ZZ6A 4KGJA 1MW0A 3LV6A 3F03K 4IICA 4H6RA 3ABOA 4MADA 3VZXA 1B4EA 3TYUA 1OIMA 3NQGA 5I23A 3APYA 3EOEA 3S1GA 4Q32A 3I6EA 2BOFX 1DWAM 3WEZA 4IISA 3CHDA 3K4WA 3IAPA 4G1NA 1XLJA 2CIPA 2QCDA 2QCCA 1C8XA 1FTXA 4XZWA 2YBTA 4PH6A 3VC5A 2A3BA 1BVWA 4H8NA 2NQHA 3P74A 4A2RA 4TVCA 1ECEA 3IPWA 5G1MA 2YR1A 4AD0A 4GA8A 3BARA 3AMCA 1H4PA 4IM4A 1KCKA 4M51A 5D37A 4PODA 1KBKA 1PHQA 3G0SA 3N6JA 4IGSA 4PE8A 4Q8TA 3SY8A 2JFEX 2QF8A 5HQLA 5FAGA 1FFQA 2WMIB 3FA5A 1GVYA 1XQKA 1NF0A 1HT6A 4JTDA 1F05A 2JEPA 5EPDA 2BGSA 3TQVA 2OKOA 3MO7A 4XTIA 2EPMX 1B3WA 2WM0A 4QCEA 1Z41A 1XICA 2FZDA 1EHAA 1FCBA 3PBUA 5DCDA 1W2VA 2OMAA 1KR0A 2PDFA 1CGYA 1US0A 1PKMA 2GDUA 2JE8A 4CNNA 6PTDA 3FW6A 1IT7A 1GKQA 2VMFA 3WNOA 1E4NA 3NQ8A 2P50A 4GBUA 1FDZA 2O0TA 3N2CA 1UKTA 4JIQA 5EMKA 3WQPA 1ZALA 2PGEA 4M29A 1PS9A 1DIEA 3UY8A 1V51A 1WKFA 3TU9A 4ONVA 2OZ3A 1OD8A 1XINA 3IV3A 3WH6A 4HTYA 4PSPA 4GUHA 4F66A 1JDFA 3EYPA 4K3ZA 3WUEA 2P8BA 2WC4A 5LHFA 4JXCA 4GH1A 2D2GA 3UJ2A 1GKPA 2OEJA 3O2LA 3ZJKA 1HJQA 2NQ5A 3UW6A 2WZHA 5IBXA 3C5QA 4JX6A 3H2NA 2V81A 4HGXA 1XKYA 2GVEA 3GFXA 4MNJA 1XH1A 2D22A 3WX7A 1TVLA 2PP3A 1UP0A 1UUQA 4PULA 3CTTA 2V30A 2C19A 2DH2A 5CG7A 3STEA 2VZOA 4K37A 4ICMA 3BSHA 4AVNA 2PEVA 5TNVA 2HVOA 4C6LA 3WBWA 1EJWC 3PS7A 4PTDA 3WLKX 2FZ8A 3SCOA 4MYAA 3FS2A 4JCMA 3NQ6A 3HQNA 2WWDA 3W7CA 1EP3A 3EOUA 2XISA 4KEMA 1GVSA 4UQAA 3URQA 1L6WA 2CZEA 4QDWA 4KIEA 3UJSA 4H8HA 1R7OA 4DM2A 3P61A 4QNWA 1M7OA 2D3LA 5TIMA 3LI1A 3ATZA 4JNYA 1K3UA 3W2UA 3GIPA 4FNSA 3W7KA 3RLHA 5H91A 3VGEA 1UJPA 3SRFA 4HK6A 1YBQA 3WH5A 1VENA 4HOZA 2CLLA 1XF0A 2ATMA 3BOXA 1UBSA 1TX2A 1XLIA 4KPLA 3PUGA 3W85A 3VOGA 1WXZA 3JZUA 1OVDA 4LVGA 4YTRA 1JPDX 4N0RA 5DY2A 1DIOA 1RZMA 1N55A 2QV5A 1KFKA 3V5OA 2Y61A 3L0GA 3TYDA 3CHFA 4Q4QA 4IQLA 5BXRA 2VGBA 3GM8A 3SRHA 1SW7A 2D0GA 1QNSA 1G0CA 3ATYA 3HN3A 4QE1A 3WL0A 4KBXA 3U8GA 4O1DA 3C56A 4E8CA 1RV8A 2WVUA 1YE6A 3KOZA 1D2KA 1TV8A 1GQKA 1ML1A 1JCYA 1S2UA 2QQ6A 5FF3A 2NXGA 4OVXA 2PB1A 4FLQA 3F4NA 2WWCA 3M6YA 4M7TA 1WOBA 2GWGA 1V0LA 4GGHA 3SN0A 3DFPA 4UTKA 4QS5A 3GG8A 3RIKA 3RX4A 2NV9A 1VJZA 4Q4PA 4L9YA 2H8XA 1Q3NA 2ESCA 4K2SA 1XBYA 3BTNA 2PDQA 4R85A 1XBXA 3UERA 1OX5A 2AGTA 1XLEA 6TIMA 4KWUA 2CZDA 1J6PA 3WDIA 1JG9A 1AK5A 5C55A 2V63A 5A8NA 5IFPA 2EO7A 3G1AA 3RFAA 1HP4A 1ZBVA 3P3BA 1FY6A 1T96A 3LCLA 4G7FA 4Q3MA 5CJ5A 2WSPA 3S6DA 1NH6A 1DWJM 4ML9A 2QJJA 3V5CA 1UC4A 2CWNA 2VKZG 1K8YA 1MFUA 3UESA 1AL7A 3UPMA 1BFNA 4AYSA 4UTHA 3E0LA 3URBA 3ARYA 3U2CA 2VOTA 2XM1A 4DXXA 1YADA 2JGQA 3EBVA 1I2NA 1R3QA 3A9IA 3VX0A 3A9BA 3M5XA 2WQPA 1XXXA 3SM0A 2OLAA 5J04A 4JCLA 4WKHA 3UXAA 4LBRA 2Y63A 2FDSA 2E6DA 3CQKA 5AOUA 4O11A 4GISA 4K39A 1P4CA 3AROA 4IPNB 3ARQA 4ATLA 1YPXA 1XX1A 3LU2A 3CAVA 3TW7A 3U2ZA 3ZJ7A 3FA4A 4NX0A 5FAJA 1FWFC 4IXHA 3VNJA 3S2LA 1T5AA 1TJ1A 1VJSA 3QQ1A 4E5TA 2OVLA 2QCGA 3T1GA 4KWSA 1HQTA 1FWCC 3VX1A 1Q8JA 3W87A 5XIAA 3DFNA 3H2EA 3CGTA 4KEVA 1IXOA 2DUZA 4LRTA 4BI7A 1EJTC 1CXFA 2BWGA 3GR4A 1VPQA 3GG0A 3DHPA 3UA3A 3JU2A 3GHTA 1PIIA 1OT2A 4JTIA 3CQHA 3U6WA 4DB7A 4XIAA 2OT1A 4H8UA 2QUNA 1O1HA 5EL1A 4DN1A 3DZ1A 4A22A 4HVXA 3LI0A 5DELA 4DBUA 1DV7A 4H9TA 5C0QA 2WMHA 2WBKA 1JZ8A 3TV8A 3TTOA 3CV7A 1X1OA 4IWWA 2ZRVA 1J18A 3KHJA 4XK2A 1YX1A 1NEYA 4A3HA 4N9BA 5JH2A 3TA9A 2ZRWA 2NXIA 3EWXA 1XSIA 1RQEA 3THCA 2F2KA 2J6VA 4Z2HA 2HVNA 1WZMA 1E72M 4JGDA 1VFUA 3DEQA 3RPTA 1YIXA 2IPJA 3TJLA 4H6QA 3VKAA 4J28A 1WDQA 3NEVA 3VFLA 5AZ1A 1MRQA 4LC8A 4P7NA 2E5DA 4LRSA 4PUMA 4R33A 3VIGA 5CSSA 1I0BA 4KWWA 3M0KA 1F3EA 1GW9A 3SCTA 5IFTA 1SO4A 2E4TA 4TR9A 1RPKA 2FHBA 2O9TA 1DJQA 1BLIA 1H3GA 1TQJA 1O5QA 2A7RA 1CGWA 4GFSA 1WV2A 2IMRA 1E4LA 2J8GA 3IJ8A 3MMWA 2O4MA 1DPMA 2Z7KA 1OF8A 4GG9A 1Q6RA 5A8PA 2A3CA 2VC9A 3W3OA 5CCZA 1OB0A 1T7LA 4UB9A 3M0IA 3S3GA 1J4EA 1EGMA 1QPRA 3EX1A 5IHSA 2WZIA 6TAAA 1MZHA 4KWVA 3UWWA 4RZ6A 4WDTA 1AQ0A 3LHUA 4TQTA 3KTSA 1L6YA 2HISA 3I4EA 3IANA 1C93A 3VTRA 1ZSXA 2A4AA 4AXKA 4RPQA 4JR5A 1JJKA 1TJRA 1Z3NA 1ALDA 2OJPA 4HA0A 4KERA