4ZMGA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with dh03a338
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of Human Dihydroorotate Dehydrogenase (DHODH) with DH03A338
rcsb
source organism Homo sapiens
total genus 139
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4zmgA00
2RH9A 3PR2A 4LTSA 3G1SA 1UUOA 3DBPA 5DY2A 2QJIA 4O1AA 4UNLA 3RK8A 2C15A 2EPHA 3PULA 2A0NA 3NVTA 1LRTA 5CZ0A 3O05A 3GXPA 3PWAA 2QCEA 3GKAA 3MP4A 1IXOA 1U83A 3BW3A 5A8GA 2RFGA 1G4SA 3TU9A 3C3NA 3PBUA 1LZOA 4O11A 4NU7A 3LI1A 3G18A 3W85A 4AHPA 3QSTA 4E0CA 3P60A 5L9FA 1X6UA 2NUXA 3RNDA 2R8WA 3R12A 3SIZA 4Z1CA 1JCMP 3B8DA 4ZQNA 3L0GA 4MKNA 1VYSX 1W1ZA 3W2NA 5HINA 3O6DA 5AHEA 5LGZA 3IGXA 4UFIA 3NL5A 4JY8A 2B7NA 4WX2A 1OG0A 3R13A 1DORA 4GC4A 3L5AA 3W6YA 1NF7A 3FOKA 3CWNA 3EXTA 1WAUA 1SZFA 3QW3A 4RZ5A 3DI1A 2Y7DA 4JIQA 3CEPA 4JTFA 4NJIA 4HNTA 5H2ZA 3W1UA 3MI6A 2DJXA 3DFSA 4LVGA 1F6KA 2QDHA 3CWOX 3TUUA 4QM1A 3UXDA 2NLIA 1QPQA 2QEZA 4NJHA 5D2VA 1ICPA 4ORIA 1Q45A 1KFBA 2OCZA 5SWUA 4UMAA 3KVLA 3RMJA 4XBSA 2Z0IA 3W7KA 5CKSA 1WDWA 2ISSA 4YXGA 1W5NA 1W3NA 3L2IA 3QPZA 3C61A 1YTKA 5D03A 4Q4KA 4H4IA 4PA8A 3A5VA 3ABOA 4KFPA 4ADTA 5C2XA 3WJYA 1VRDA 3PUOA 4BFAA 2NWSA 3NL6A 2FB3A 4K36A 4WXYA 3TIMA 1AG1O 4C1KA 3PSVA 2WNNA 1SZEA 2YCEA 5LHEA 5K7JA 7TIMA 1TTJA 2E1DA 3N14A 3CU2A 3DKLA 3LXCA 3TJXA 3N3MA 1TPFA 1B4KA 2WNQA 2V9DA 3TSDA 3DAQA 1NAL1 3UPWA 3VNDA 4ZMGA 4QQ3A 3MHFA 3R2GA 2CLOA 1OK4A 1XKYA 3BG5A 4OHQA 4XTIA 1YPIA 3WK2A 3VE7A 2CW6A 5AB3A 1GZGA 5HULA 3SY5A 4IPJA 4S1FA 4NZFA 3H53A 3NQAA 4N9CA 4PCFA 5DELA 3UQNA 1H1ZA 4JNMA 2HMCA 2V81A 2YDAA 1ICSA 4UIOA 3LLDA 5KMYA 3W7DA 3QF0A 5FEZA 2DJLA 3NOEA 2HS8A 4WZHA 4DO4A 1WA3A 3GZ3A 4O57A 1AW1A 3G0SA 2VEPA 2I14A 4FIRA 3W1AA 8TIMA 3ELFA 1ICQA 4UTMA 2GJNA 1B3OA 4O12A 2ZA1A 4K8HA 3IIPA 3DENA 1QPNA 4WJEA 1DV7A 5FEPA 1IIHA 4AWSA 1X1ZA 1H7OA 1UCWA 2QCMA 3NEVA 1EA0A 2V8ZA 2FFCA 5D05A 6ALDA 1WV2A 4LVDA 4RZ4A 5LSMA 4UTWC 3TQVA 3NPVA 5E93A 1T0OA 2VXNA 3W3OA 4OBTA 2QJHA 4JTLA 3W1MA 5D2XA 2RDWA 4CCDA 1WYIA 4K7YA 4JYDA 3BK0A 1HUVA 4LRSA 4A22A 2BTMA 3HPXA 1VC4A 3ZWTA 1CX9A 3GR8A 5EA9A 4LV4A 4Y8FA 1GTHA 2D73A 4LNYA 3W7JA 1H1YA 1F76A 4NX5A 3GNDA 3VKJA 5K9CA 1OX6A 3OIXA 2QUVA 1IXQA 3E96A 4J9JA 1VZWA 1TRIA 4RX0A 3L5LA 3BW4A 4CCCA 4ZQOA 3G3MA 4LUIA 2QCNA 1KV5A 2W0UA 4AAJA 1I2OA 4UFLA 1MXSA 2ZZ6A 4O28A 4O8RA 5AYYA 2BWGA 1PL9A 5EBUA 4C1LA 2ISVA 3F4NA 2FB2A 1DHPA 3CIXA 1ZAHA 4EVZA 5LNRA 3TE9A 4LVFA 3UY8A 1Q6OA 2A2IA 2ZRWA 3B03A 3KX6A 4NVTA 2A7RA 3PBVA 3PBWA 1W31A 5J5DA 3TDFA 3LRKA 4BK9A 2C6QA 3PB2A 1SW3A 4MLJA 2CU0A 2FPTA 1H7RA 3GR7A 3LRMA 4NXKA 3TNOA 5KINA 5KZMA 2J88A 5KTLA 1F2JA 3EEGA 2Y6ZA 5AHNA 1HO4A 4GUGA 1XUUA 3QW4B 1ONRA 4GFSA 4JIPA 1G69A 2A5HA 3KRSA 1SQ7A 5C54A 2RDUA 1LROA 3P80A 5U7SA 2ZRVA 4UFJA 5FF3A 4HNNA 2TPSA 1TPUA 2WQPA 3B0VC 4N4PA 1FCQA 1P1XA 3T55A 3UZJA 4JTSA 1ZAJA 3EXSA 3W73A 5D30A 4TX9A 1RQEA 5AC8A 3EKZA 3R5EA 1UJPA 1ZCOA 3W1PA 1QO2A 4UFKA 1OFRA 3IIVA 3LCGA 1GVRA 2QAFA 3MWAA 2VFEA 1LORA 3CEUA 1K02A 1L6WA 1R47A 4LOCA 1HTIA 5LNUA 4N9BA 3LV5A 3W1QA 4O54A 1N55A 3TCEA 2A1YA 3M41A 1TO3A 4WOQA 2C13A 5HWNA 5FF7A 1G4TA 3NXFA 2AGKA 3UZ5A 2C0AA 2NXHA 5CZJA 3FS2A 2JGYA 2ZQ0A 3M7WA 4MZ1A 4UTTA 4NJKA 5HMSA 2GVJA 3RU6A 1C29A 5HR6A 1ME7A 2TRSA 2QCDB 2DZPA 1YLVA 3GK0A 3N2MA 4MLRA 3LXBA 1W5OA 3NYZA 3OBKA 3DHDA 1TB3A 1VCGA 1K7XA 3ZFHA 3E49A 2ZZ7A 2NX3A 4FNUA 1Q6RA 2NUWA 1PE1A 3CIWA 3RLUA 3BW2A 3UXAA 1SUXA 1ZFJA 1GYLA 1TMHA 3O15A 1SSGA 2OMAA 4TIMA 3QH2A 1DJNA 1FDYA 3YPIA 4O0ZA 2LLEA 5DBTA 1D9EA 3LTSA 3G1FA 2YW4A 4WY0F 2GOUA 3S1XA 1N8FA 3LBCA 3C8FA 4O18A 5CZSA 2VFFA 3FKKA 1H62A 3C2OA 4LS1A 3KOFA 3NQCA 1QFEA 4WXZA 4UR8A 1YADA 3P81A 1MSSA 2H90A 1OX5A 4X2RA 1QCWA 4QISA 1KLZA 4JTHA 3MP3A 1W8SA 3EX3A 1TPB1 3W87A 2VFIA 2NX1A 2G95A 4N6FA 3P82A 3NNTA 2X16A 3UYCA 5D32A 4RV8A 1G67A 3UD6A 5CGQA 5AHMA 3G8EA 2AAMA 4O19A 2CZEA 4WY0A 4U28A 4O53A 2EAWA 4NNBA 1BTMA 3QMRA 2E6YA 2VELA 3LGEA 2GPTA 2VFDA 4FNRA 1ZNNA 1JVNA 2O7QA 2EHHA 2I9EA 3W71A 2NV2A 3PS7A 4RZ6A 2XN0A 3RLVA 4PODA 5IBXC 3U8GA 1TREA 5DN1A 3NPUA 3LB0A 4DF2A 2ZZ5A 4QSHA 1XBZA 3B04A 3CPRA 4QAIA 5K4XA 1VLWA 2CZDA 3M0ZA 5G4EA 5TBOA 4WD0A 2J6XA 2J24A 5EPDA 3VE9A 3LXAA 2PC4A 1ALDA 4NUWA 2PE4A 1BEUA 3S1WA 3TMLA 1ME8A 4H6KA 4GE8A 5F4SA 4A21A 3UPBA 3M5XA 4OV4A 3P62A 4MFDA 1RR2A 2WV8A 3V75A 5K4ZA 2X1RA 4FEZA 2WJZA 4HNUA 1IXPA 3LTPA 1Q6LA 3I7RA 4XKYB 4N02A 4JS3A 1HO1A 2QCLA 4I7WA 4ZQPA 5AHLA 1TPDA 1XFBA 1DL3A 1LBFA 3QJAA 3Q37A 2V0TA 1R46A 3W7CA 2Y85A 4QIUA 5HR7A 4GWEA 2FTPA 3NQ6A 3LV6A 3FYPA 2CLFA 3MBDA 1AL7A 4MFEA 3IIXA 1YDVA 4RXGA 1G6CA 3W72A 4O52A 2JGQA 3MBFA 1XBVA 4O17A 4FNPA 1HL2A 1TQJA 3GB6A 3NO5A 4IPIA 2V30A 1VLIA 5FESA 1W5MA 4GUJA 4OE7A 3BLEA 3NL3A 5A5WA 3NQVA 4OV9A 1OFOA 2ATSA 3FJ6A 3B05A 3LCFA 3OEXA 3EWBX 4K7VA 1F73A 5HJLA 4JTTA 3W7HA 3BG3A 1FDJA 3EX6A 1YDOA 2E6FA 3HGJA 3NAVA 4GNJA 5F4XA 2C16A 3QFEA 4S2CA 1PCWA 1TPWA 1TYGA 1P0KA 2A6NA 2QUUA 5T26A 1WOBA 2Q8LA 1W3TA 4TMCA 3N2XA 5D33A 4KWWA 3LM7A 1LP6A 3KRUA 3EX4A 3CM4A 1Q6QA 3MHGA 3THQA 4LW7A 5LNVA 3DKJA 1WOAA 5FEXA 4K37A 3QC3A 1QWGA 1Z42A 2HS6A 4GUHA 4K6AA 3UWQA 5KSWA 1G7VA 3FJLA 4D2JA 3ZR4A 4AEOA 3O1NA 2YGYA 2Y88A 1OFEA 3KVJA 4M19A 2A7NA 1LLZA 1VCVA 2H6RA 2QCDA 3ABRA 2PCQA 4HT3A 2Q3RA 3W9ZA 3NR0A 1OFPA 1AMKA 1X1OA 1TCDA 2RHGA 2VENA 4NT0A 3P84A 1SO5A 2WKJA 1H7PA 1IIGA 2EF9A 1M7OA 4YL2A 5DY3A 5F1UA 6TIMA 2W79A 4UFMA 2WSRA 4DO6A 4YLWA 4OGZA 1FBAA 3QM3A 3IV3A 3V1PA 3IVTA 5F2MA 1ZHAA 1NF0A 3TFXA 5EL1A 3B06A 1KM2A 3SJ3A 3DZ1A 5G1YA 3IGSA 3BV4A 3DFNA 1I45A 3W7IA 4RXFA 4JR5A 1PHWA 5IM51 4UUIA 5LGXA 3BPWA 3L21A 3OVQA 2ZTKA 2A7PA 1BWLA 3ABQA 1KLYA 1FWTA 1EB3A 3FEMA 4PH6A 4ZVJA 2WO5A 3KFTA 1EWDA 1R2SA 4NNAA 2B7PA 4ORMA 1FY6A 4X3ZA 1W5PA 4IOTA 1O5KA 1VQTA 4E2BA 4CLMA 3FIGA 2F84A 3LCLA 4UTKA 2E5CA 3ANYA 3HQ1A 3W7PA 3BG9A 2HTMA 1KFEA 3LLFA 4LT9A 1GG1A 5HWJA 3G22A 3IIOA 3QQ0A 3C4UA 4PEKA 3PM6A 4XWUA 3EWYA 1QR7A 3NQ8A 4UTWA 4LY8A 3C2FA 3PUDA 3KVKA 3S0CA 4PL1A 1W5QA 3E12A 4WOZA 3S5ZA 3NG3A 4RCXA 1KTBA 1EEPA 4A3UA 4LC8A 2TMDA 1TTIA 2VC6A 2HSAA 2YYUA 3NQ7A 5BOOA 1LTDA 4R33A 1SW7A 4P2VA 1KM4A 2Y7EA 4AVFA 3QSRA 2FIQA 4MOZA 4ADUA 1K8YA 3G0XA 3O06A 5AN7A 1B57A 5I3GA 4MJMA 1GPWA 4W9TA 2NUYA 1FXQA 4WY0B 4DF0A 1OYAA 3S5OA 4O16A 4IQLA 4MIMA 5HNRA 1VYRA 3HG4A 3D0CA 1SFJA 3N19B 1K8ZA 2O7SA 3M6YA 3G1XA 4AHQA 4O15A 3NQ2A 1A5AA 2E77A 4LUJA 5K9DA 1O5XA 3BLIA 3R8RA 3W2KA 3M5YA 1JRBA 2H8ZA 2C1HA 3SECA 3GYEA 4DEFA 4ZQCA 3W1TA 1OJXA 1UB3A 3HPZA 3LHUA 2CZ5A 4R7JA 3WJWA 3MO7A 1S5VA 5CPMA 3BLFA 1KFKA 2XN2A 1OABA 3PBYA 4O50A 1T99A 3DGRA 3C6CA 2VFGA 3UWVA 4XKYA 4B5NA 1TV7A 3A9IA 3O8AA 4XQ6A 2WOQA 3DHFA 2YYTA 2R14A 3T44A 1RQBA 4KFNA 1D3GA 4O14A 3TMQA 1YTDA 4UMBA 1KM5A 4Y96A 1PHQA 3I6RA 1YDNA 2XN1A 1GOXA 1O4UA 3A21A 3CLMA 2FLIA 3CQ0A 3M5ZA 2OZ0A 2JKEA 2VFHA 1EX5A 3M43A 3R89A 3TJLA 4EF9A 1JCNA 1SO6A 1SU5A 3KRZA 3TQ0A 3MUXA 3T7VA 4GUFA 5D04C 4BI5A 4NX0A 4QITA 1WBHA 1LLWA 2OJPA 3DFOA 1A5SA 1YTEA 4JTIA 4LVAA 5GVJA 3A24A 2JK2A 3NPWA 1GT8A 4UMCA 3DFQA 1LRQA 3STGA 2E5DA 3CC1A 5AOUA 1LM1A 3TX9A 3OA3A 4JTEA 2QCHA 3S5YA 3W23A 3S5NA 4FXRA 2A21A 2I1OA 4E38A 1GTEA 2YFOA 3UWWA 2FDSA 2GUUA 3THAA 5HWMA 3STCA 4ZQRA 4IMEA 4ALDA 4CCEA 4M7SA 3W74A 2DORA 3O63A 1FX6A 4EOUA 1L6SA 1ZAIA 2J9XA 4EWND 2QJGA 2ZYFA 4GUIA 2V82A 2Z2UA 1K3UA 4IMDA 3DFPA 1K7EA 1TV8A 3WJXA 4RK8A 2QCGA 1OFQA 4MVAA 1J4EA 1BWKA 4ONVA 3AO0A 1HFBA 3LCHA 4S2BA 3C2RA 4OU1A 3W7QA 4BI7A 1KBJA 5C6MA 4Z0JA 3NGJA 1OYBA 3GAKA 4Q33A 2H8XA 3LX9A 4CQ9A 4K8EA 1XI3A 4IGHA 3W1LA 1E51A 3W22A 4OQVA 5G2WA 5D2WA 1S5WA 4FX6M 1LRNA 2DZUA 4M7TA 3W7RA 3E9AA 1TPEA 1SFLA 5LHFA 5D2TA 4N6EA 3HPSA 5CZTA 1L9WA 1PV8A 1DQXA 1TPH1 2G97A 1FWWA 4AH7A 4DPQA 3M47A 2H3BA 1GJPA 3TROA 3STFA 1JR1A 1I4NA 1KM3A 5AHIA 1HG3A 1QNVA 3IVSA 4JDBA 4FHAA 4UTLA 3L68A 1IXNA 2TYSA 4Z1DA 3N34A 3AJXA 4JTKA 1K03A 4MYAA 3S9YA 3MI3A 4L4LA 3HB9A 1QMLA 1KBIA 3TW6A 3NZ1A 5LKYA 3LHYA 2YR1A 3Q2DA 3N9RA 2ABBA 4IXHA 3S8HA 4YCOA 4MY8A 3B4UA 2WSQA 3W7EA 3GKFA 4O0KA 4UXDA 3MHUA 2A85A 1VHNA 3TAKA 2VKZG 4R34A 4UR7A 1S5TA 3GNNA 3TW7A 2RDTA 3BGGA 4MYXA 5F2LA 3E02A 1YXCA 2OT0A 2ZZ2A 1IF2A 1V5XA 5BMXA 4UTTC 2J9YA 1PIIA 2CLEA 1W3IA 5CPLA 5AC6A 3DXIA 1OF8A 1T8XA 1LYXA 4XTDA 3VFLA 2AQWA 3HGOA 4BI6A 2CLMA 2Z6JA 4JTUA 3WJZA 2A4AA 2H3DA 3P5ZA 3W1XA 2CLIA 3HG3A 4R53A 3I7SA 2BXVA 4O4VA 4A29A 4AXKA 3LBMA 3SGZA 4P61A 1W56A 3DI0A 3LOTA 2QCCA 4XZ9A 3W75A 5HQEA 2ZRZA 3QMTA 1JUEA 3GXNA 3STEA 3PG8A 3USBA 3TXVA 3K30A 1RZMA 3S6DA 2ZA2A 2P0OA 4MZYA 3G1DA 4N4QA 2CFFA 3IEBA 4I7UA 1O94A 3F03K 5D37A 4XUGA 4UTJA 2FPVA 4M5PA 4X22A 3G8RA 3MW7A 5AYXA 1OFBA 2C14A 4A2SA 3O6CA 4UNKA 3EWZA 5D02A 4Y90A 5G2HA 1A53A 3EWWA 4RLIA 1GYNA 3BVJA 3L0NA 2RKXA 3ABSA 3HBLA 4HPJA 3OVPA 1EPXA 4RR4A 3MMTA 1LCOA 3SI9A 1YXYA 3LHTA 3W83A 4BWLC 1PS9A 1I2PA 4Z08A 3UWUA 2FPYA 4N9EA 4JTJA 2EGZA 2KZHA 4UC5A 1DQWA 1PVNA 3LCIA 5U4NA 3W2LA 1H63A 4CNOA 3HG2A 1B9BA 2ZFAA 2R94A 3H55A 1JUBA 2W6RA 1YPFA 4LRTA 1UUMA 2E5BA 3W2MA 3GX9A 4Z1AA 3G1YA 1EUNA 2ALDA 4NQ1A 2WNZA 4POCA 3C2VA 3NL2A 4DPPA 1ADOA 4OT7A 3G1HA 2JKAA 4DELA 4IMGA 3TA6A 1DVJA 3LHVA 4TO8A 3QPYA 3EXRA 3PB0A 1BKSA 1KTNA 1OK6A 3WFAA 4AB4A 4JYFA 3TH6A 1EP1A 3P8JA 1XBYA 4FX7A 4O4WA 1A50A 1ME9A 1AW5A 2NZLA 3NPXA 1XC4A 2WPBA 1JCJA 1S3HA 2YXGA 2NX9A 5BW6A 5DXXA 5D2YA 1VS1A 4WUIA 5G4WA 2EKCA 3W1RA 1TTPA 3WK1A 2DZWA 3NZRA 3A22A 3T78A 1FCBA 1R2TA 3UWZA 3ATYA 3GAYA 4O1CA 1ZENA 5EKYA 3S1VA 3GLCA 1RD5A 3SGUA 5G2IA 1LOLA 1TTQA 3GDKA 3M1ZA 1PCKA 4M6VA 2BSLA 1J2WA 3PY2A 1UASA 1LOQA 2QF7A 3OVRA 5G5IA 3TR2A 2C3ZA 4BR1A 3P67A 3S42A 3P5YA 3NDOA 3KVMA 1SPQA 2CLLA 4DBEA 4JD4A 1JCYA 1MO0A 1O60A 4LV9A 4ZL1A 2V2DA 1G4PA 1FCUA 2VEIA 3LI0A 3JS3A 1ML1A 3I65A 1TQXA 4JYEA 4XBKA 3PUEA 5DBUA 1KW1A 5LZLA 2J27A 3MYOA 1LOSA 4FX8A 4RJEA 5HUOA 3NQEA 1SR9A 1H7WA 1UBSA 3MP5A 1XBXA 1FXPA 4JGDA 3L0KA 2YFNA 2G5WA 4FB7A 1GEQA 5HUPA 1KA9F 1QPOA 3NQFA 1LDCA 2BX7A 4LS2A 1JCXA 5D38A 2YPIA 5FEWA 1EWEA 1M7PA 3SW6A 2PRMA 5C5YA 1OYCA 5DLCA 5CPNA 1T96A 3FKRA 1FWRA 5F1VA 1LBMA 3INPA 3N73A 1SSDA 3C0JA 2DP3A 1V7YA 1WX0A 4O1BA 1JRCA 5E1QA 4YWIA 2J9ZA 2VOMA 1VCFA 1MEWA 4I7VA 1JQXA 1YYAA 1N7KA 3G3DA 2QCFA 4Z0SA 3ZWSA 4UFHA 2GVLA 3PAJA 1A5CA 1F7BA 3BGJA 1WBJA 5BRBA 3M5VA 4UTUA 1NSJA 3EWXA 2Z1BA 2QKFA 3EX1A 3A23A 1RQHA 3PSWA 3WK0A 1FWSA 1ZY9A 1Z41A 3WK3A 1NVMA 1M5WA 2QDGA 4K38A 4IJBA 2X2GA 3KAOA 4FNQA 4YMZA 4CNPA 4X9SA 2XFWA 3OHIA 2ZCGA 3HO8A 1FQ0A 1K7FA 4GXMA 3W86A 1F74A 4E2DA 1G4EA 4FNTA 2IQTA 3GIYA 4DXVA 3FLUA 3M44A 2ZRUA 2ISWA 2ZTJA 4JX6A 3KHJA 3MYPA 1H5YA 5H91A 4CQ8A 1XCFA 2ATMA 4DF1A 1EUAA 1NFBA 1DBTA 3E0IA 5D09A 3W7MA 5FF0A 3CTLA 3P74A 1XUZA 4NZJA 1C9DA 4QNWA 3HIJA 4PTNA 2ZBTA 2B7QA 3EKLA 2P1FA 5E0KA 3PG9A 2NV1A 4OWGA 1DOSA 3M16A 1GVSA 1C8VA 1OX4B 3LTYA 2GJLA 1QO5A 4MY1A 1KFCA 1GG0A 1I2QA 2GQ9A 5EMUA 3TFCA 4K39A 4WQ6A 3HMJG 1JULA 3JRKA 1AW2A 3FFSA 2TSYA 3HF3A 4ZQMA 1OHLA 1FCVA 3MJYA 3BARA 3RFAA 3GDRA 4MY9A 4A2RA 1L6YA 1CW2A 1RVGA 4H3DA 4JICA 5FI8A 1TSIA 2V2HA 4YCPA 1H51A 2B7OA 2ZRXA 1FWNA 1XXXA 2NXGA 5F4WA 2X30A 4ML9A 2GVGA 3MI2A 4IX2A 3UWYA 3FYOA 1LBLA 1U5JA 3CB8A 1I8JA 1KM0A 3NQGA 1A5BA 3I68A 2G96A 1RPXA 1D3HA 1JCLA 3S1UA 2DZXA 1J5TA 2V5BA 1Q3NA 4FF7A 4FXSA 1DKWA 4TU1A 1K8XA 1GVFA 3P61A 3W7LA 3NQDA 1KM6A 2DZVA 3L5MA 1QAPA 3P7YA 1VPXA 1OFDA 3IGUA 1WQ5A 3LHWA 5DXYA 2YZRA 4U4MA 1SO3A 1NEYA 2V5LA 1EP2A 4FO4A 3JR2A 3A5FA 4CQAA 2JBMA 3UY7A 3W07A 2CZFA 3TC6A 5I3IA 2PRLA 2GQ8A 1JQVA 4LVBA 4NNCA 3B0PA 4HSNA 2DZSA 1H50A 3TAOA 1I2RA 4GRSA 1GQNA 4KKXA 5LNSA 3HGSA 3O16A 3HJZA 4N9DA 3TSBA 1KFJA 2DU2A 4AF0B 4KFOA 3TKFA 4MJZA 4O13A 2NWRA 3WJSA 4UTHA 4GJ1A 2OX1A 1SZNA 5L6UA 4L4MA 1XL9A 3TSMA 1IGSA 3GVGA 4NXSA 2Y7GA 5J5RA 4HSOA 1TIMA 3T4CA 4PL2A 2QAPA 1QDSA 4NJGA 4ICNA 5AHFA 4O10A 4GBUA 1F5ZA 3EB2A 4HHPA 2Y7FA 4LS0A 4QJ1A 2QR6A 3W1NA 1W0MA 1QOPA 2P10A 4KWVA 3PC0A 4TR9A 5MHBA 3W88A 3QRHA 4MZ8A 3ZS4A 3W2JA 2A6LA 1SZGA 5EY5A 1O95A 1TJRA 3VI2A 1GVOA 1TV5A 5G1TA 5KZDA 3SZ8A 4MUZA 3G1VA 2OT1A 5I3HA 3F1QA 3C52A 5FF4A 1P5BA 1AL8A 2FQIA 1F05A 3KXQA 3GDTA 2VEMA 4LC6A 3W2UA 2E68A 5I3FA 4IMFA 1SW0A 2E09A 3TC7A 3W7GA 1W54A 3PVFA 4LU0A 4HNVA 1TJPA 5K9XA 3LCWA 3G0UA 3GXTA 2X1UA 2Y70A 4RKAA 3GDMA 1XDLA 2ZA3A 3CHVA 4IX0A 4AWUA 1ZJIA 4FIQA 4JY9A 3TK7A 1P4CA 4JEQA 3TV8A 5AC7A 4IMCA 3IRDA 3IVUA 3L66A 3W7OA 2C19A 4Y6GA 4O1DA 5LNWA 1WXJA 3LHZA 5K2ZA 4IUOA 3DFTA 1H7XA 1AK5A 2B4GA 4AWTA 1I2NA 1SO4A 1JUKA 3EWUA 3ATZA 3NM1A 4NJJA 1XDMA 3G1AA 3W70A 1X7FA 1FUYA 3I7QA 4PFMA 2GQAA 2PURA 5KITA 2YX0A 4CNNA 1QOQA 1G7UA 1VR6A 2Y61A 2CWNA 3NA8A 2BLEA 3P8IA 4TMBA 4PC8A 4JN6A 5K3VA 1M6JA 3PF3A 4Z1BA 3W84A 1JJKA 5F2IA 3SSJA 1FDZA 2WSYA 3L67A 2ZZ4A 3SR7A 5KZEA 4I9AA 3HGRA 4AMAA 1R2RA 1TPVA 3B0UX 2YW3A 2JKPA 5I3JA 2F7FA 4HKPA 4ADSA 1MEHA 1QPRA 5IBXA 3W76A 1TRDA 2R91A 1OX4A 4Y9AA 3OG3A 4M6PA 4DO5A 2E6AA 1XM3A 3TXZA 4EIVA 5I3KA 1VHCA 1X8FA 3QMSA 3LRLA 5CSRA 2FJKA 4MPQA 4JXCA 3QQ1A 3G24A 1Y0EA 1P0NA 1THFD 1F6PA 1B4EA 4QNEA 4BWLA 1GWJA 3CT7A 5EYWA 5BNKA 3H54A 3M9YA 1VYPX 1L2UA 2Y62A 2C18A 2Q3OA 3Q58A 1YXDA 3UNDA 5CPOA 4G1KA 4LWWA 3QEZA 4JDYA 1W37A 3O07A 2ZZ3A 5DCBA 4HPXA 4UTIA 5C55A 1CI1A 2X1TA 3DU0A 1KTCA 2Q8ZA 5ABTA 2ZDRA 3QZEA 1EIXA 3DH7A 1VH7A 2ZRYA 4N2YA 5TIMA 5DCDA 3W7NA 5BMWA 2Z6IA 3NM3A 2CLHA 1ZALA 3HOJA 5FF2A 4M6QA 1KV8A 1OF6A 1VGAA 1VJIA 2ZZ1A 4UCGA 1GVQA 5F2GA 4JX4A 2PRHA 3NQMA 5AFDA 3C56A 1H7NA 4EF8A 1OVDA 1EP3A 3LERA 2BZNA 2Y63A 4HN4A 3O6YX 1H60A 4ZZ9A 1MZHA 3F4WA 5CSSA 3IIZA 2YSWA 2CLKA 4HIBA 4DBDA 3LCXA 1OFAA 4IXXA 1KFLA 3L65A 3U2OA 1KM1A 3BO9A 5DCEA 5TQLA 3RF9A 1DJQA 1H61A 2VEKA 2Y89A 3GDLA 3L9CA 2B0MA 3HG5A 4AF0A 3VCRA 2ABAA 3LDVA 5AYZA 4FNSA 3U6WA 4AHOA 3N9SA 3QYQA 3Q94A 4DQWA 2E6DA 1Z44A 1Z48A 4BF9A 2V2CA 4JX5A 1RV8A 3C2EA 1MEIA 2DZTA 2UV8G 5CG7A 3T40A 4JTGA 2NXIA 1TPC1 3TQKA 4IWWA 3SFKA 3FA5A 1R30A 2X1SA 4Q32A 3EX2A 2QUTA
chains in the Genus database with same CATH superfamily
3PR2A 4CKQA 5DY2A 2CNCA 3DX5A 2DIJA 3O05A 3PWAA 4C6IA 2BG5A 5LXXA 3GNPA 1U83A 3BW3A 1PXGA 5A8GA 4KMQA 4HCHA 4O11A 5BROA 3LG3A 1KRBC 4UQ9A 4PZVA 1JI1A 1W3KA 3RNDA 4H9XA 3H26A 1JCMP 2R24A 1HGWA 2BGNE 3B8DA 3G6LA 4MADA 1VYSX 4F2BA 4FLSA 3CUZA 1W1B1 3WH9A 2VGBA 1RY0A 2B7NA 3FV9A 1T40A 2X8RA 3R13A 3BC9A 3L5AA 4GJJA 3IJ6A 1PZ0A 3EXTA 1G94A 1SZFA 2Y7DA 4ROQA 2VEGA 4TV6A 3W1UA 1H41A 1UROA 2QDHA 1XH1A 3UCDA 2QPSA 1QPQA 1L6GA 3V0UA 4QDPA 4DJED 1BSLA 1YBQB 3GXFA 1RH9A 3ONBA 3GXMA 3RMJA 4ZENA 2QZRA 1R3RA 4L5ZA 3TYCA 4ZSTA 3GUGA 4XAFA 3L2IA 1E6PA 4JKKA 3PJXA 1YTKA 3IJ9A 1VPYA 5D03A 3PFRA 1J9YA 3WH7A 5C2XA 1E3XA 1JPKA 4JEJA 2NWSA 1VD6A 2FB3A 1EO5A 3CQKA 3PNZA 3TWBA 2PTDA 3TIMA 3PSVA 1HKKA 4GQRA 1TTJA 3GR4A 3WH8A 2YCLB 3N14A 3IK4A 1B3ZA 2V9DA 3DAQA 1NAL1 2WLZA 1XIBA 3MB9A 3N2CA 5HPOA 4DYKA 2KAUC 3R2GA 4K2SA 2WKLA 1HL8A 3EOUA 4C7DA 1ESWA 1YPIA 4R9OA 3AHXA 2CW6A 3QBUA 1WO2A 1GZGA 3SY5A 5FKYA 1HKWA 3Q67A 1TELA 3URNA 4J3UA 5A6KA 3N12A 4XUYA 2HV5A 5DELA 3GBDA 4JNMA 2P88A 1HT6A 4HCDA 3RLGA 5KMYA 3QF0A 4D72A 1GGOA 3E74A 5FEZA 1ZBCA 3HFYA 2DJLA 3C0LA 5I2UA 2YB1A 1AW1A 3G0SA 2I14A 3W1AA 1B3OA 3ZVIA 4NI8A 1E0TA 3POCA 2GUYA 3DENA 1Y65A 3BV7A 2ASHA 1BG4A 2V8ZA 2X0SA 4NZ5A 4LFYA 4RZ4A 1Y8BA 4UTWC 3NPVA 3W3OA 1CZ1A 4PMRA 3U5UA 5D2XA 3VOHA 3PZVA 1IR1A 4JYDA 3T05A 1ISVA 3FK4A 1R3YA 3FCPA 4YJ5A 1DJYA 1GTHA 4LNYA 3W7JA 1HJWA 5I6SA 3GTFA 3CT2A 4ZE5A 2HVMA 1F76A 1MUMA 2ZE3A 3GNDA 4YYFA 4HZ7A 2W5FA 1O1ZA 5K9CA 3OIXA 5MKGA 3CQJA 4HJFA 1JNEA 1H1NA 4J9JA 3ARSA 3RJXA 3ZJ6A 3G3MA 3BGAA 4AAJA 1I2OA 4GA8A 4NAEA 2UY2A 2WZHA 4O8RA 4H9VA 4A35A 5EBUA 3R43A 2YCJA 2FB2A 1DHPA 3C2YA 3CIXA 3UBPC 2EEXA 5LNRA 1XS2A 5M03A 4PBGA 4B5UA 2GSEA 1QPKA 1D8WA 1JXKA 4WDWA 2I56A 3DG7A 7REQB 1XLDA 4BK9A 1W9VA 3PB2A 9XIAA 3QHOA 4MLJA 4IG2A 4RE4A 4BJHA 1RHCA 4NASA 5KINA 3NIYA 3EEGA 1XHGA 4JNYA 4F0RA 3QW4B 1E4MM 2PLKA 4IF2A 1PIGA 2RDUA 5D9NA 3LBOA 4HNNA 4PMQA 4ECLA 3VZXA 2WQPA 3SRDA 1P1XA 3T55A 2Z24A 3H2CA 1HKMA 4QFUA 5D30A 2WCAA 1F07A 4CU6A 4HPNA 5EMKA 3W1PA 2WC7A 3QPEA 4UFKA 1HXJA 3IIVA 4TOQA 4PCSA 1XFCA 3IV8A 3IAPA 3MWAA 1NTHA 3CV6A 3E2RA 5CZKA 3CHCA 2GL5A 2WLYA 4LOCA 1W3LA 1WKYA 3UG8A 4N9BA 1QI4A 4D6GA 3ZSSA 2OQLA 2OSXA 5FF7A 1G4TA 2IKIA 4WGXA 1CGXA 2C0AA 2XPKA 1CIUA 4DI8A 4J5NA 5F7UA 1RAKA 3RCYA 1XIGA 2O4QA 3P6LA 4NAFB 5TF0A 1QI2A 1C92A 3WDJA 5HR6A 1ME7A 2WNWA 2WWDA 3EDJA 1B2YA 4RZBA 5DX7A 3LXBA 3WL0A 1E6QM 4D6IA 3NYZA 3WLQA 3W37A 1VCGA 4GG9A 2E25A 2A3BA 1Z8AA 2ACRA 3WF1A 2NUWA 2AQOA 3WX7A 1M01A 3RLUA 4GI9A 1EHNA 1KR0A 3A3HA 4XISA 1TMHA 4KIRA 5AECA 1SSGA 2NQZA 4TIMA 3QH2A 3U4FA 3QYSA 2BB0A 5DBTA 2J8GA 4ZR8A 1TV3A 4MB5A 4PMYA 2YW4A 4WY0F 3VU2A 4HGXA 2VQUA 4H9TA 3S1XA 1H62A 4PCNA 1ISZA 2R1MA 4QAWA 5GNZA 4LS1A 3NQCA 4MM1A 1QFEA 5E9AA 3LN3A 4WXZA 1YADA 2VCCA 3BCFA 4X2RA 4GQBA 4JTHA 1GOKA 1XIFA 3MP3A 2QF8A 1KD0A 4HA1A 3EX3A 3W87A 1ZBKA 2NX1A 2WQDA 3AS1A 4Q8NA 1B3XA 1MW3A 3UYCA 3PNUA 4RV8A 1QNPA 4WK9A 4IFKB 3CASA 3SAZA 4FR1A 5CGQA 4QP0A 3G1RA 3G8EA 3AHZA 1UWSA 2INEA 3R58A 2E6YA 2GPTA 1XIJA 1F9CA 1EKOA 3V36A 2HROA 1LLOA 1KQZA 3UU0A 1A3WA 3U57A 1CENA 4S3FA 3GTHA 4QSHA 3CPRA 4QAIA 2XIJA 4PUWA 5G4EA 2JFEX 2J6XA 3VE9A 5EPDA 3LXAA 2PC4A 2YL5A 3UETA 4DVOA 3VO0A 3BQ5A 1JZ5A 4PFHA 4Z2KA 5CJNA 1FWEC 3HM7A 2VC7A 1UQZA 3V75A 5K4ZA 4JTAA 2QQ6A 1W17A 4FEZA 8XIAA 3MO4A 1KGXA 4HNUA 1XSIA 3CLWA 2ZOXA 4GQ0A 5FJTA 3GRIA 4N02A 4JS3A 2QCLA 4RPQA 1DL3A 1LBFA 1IZJA 5BXRA 1UA7A 1R46A 3W7CA 5HR7A 2PTZA 3NQ6A 4WVXA 3FDKA 3UG5A 4BS0A 2G50A 3COTA 1TMQA 5HQMA 3MBDA 3W25A 4OBRA 3IIXA 4RXGA 3W72A 5KZ6A 4PUDA 3GDBA 4JBRA 3MBFA 5I24A 2PDGA 3LNPA 3AXIA 2VR5A 1TQJA 4CN4A 2V30A 3TR9A 4XSLA 5FESA 1HKJA 4OE7A 5A5WA 3E0VA 3WLMA 4YTQA 3SCNA 4XVEA 3SQSA 4ES4A 2O9PA 5GQBA 4KCUA 1E1EA 1TVNA 2ATSA 3LCFA 5HJLA 1VFTA 3W7HA 3BG3A 1WUFA 3EX6A 1YDOA 1ZU8A 1C9WA 4KH2A 3QFEA 1PCWA 1P0KA 2A6NA 2Q8LA 3HU7A 4TMCA 3N2XA 5D33A 3OA5A 4KWWA 3EB3A 4E4FA 3O0FA 4JFTA 1WDSA 1PPIA 1LL7A 2WK2A 1OIFA 3CM4A 4M6UA 1TVLA 4PBFA 3M0JA 3N1AA 5FEXA 3QC3A 4GUHA 4Z2GA 2GYIA 3ZR4A 4V2XA 3GBEA 3KVJA 2BMBA 3KTCA 2WC4A 4GBDA 1W2PA 4MTVA 3O9NA 1VCVA 2QCDA 4LAMA 3WDHA 4WLCA 1DIOA 1OFPA 1UZ4A 2POTA 4DZ5A 2D2GA 1EJSC 4TQTA 4YL2A 5DY3A 6TIMA 4UFMA 4DO6A 4YLWA 4OGZA 1FBAA 3I6EA 3QM3A 1R9ZA 1NOWA 1XYMA 4KWSA 3B06A 3SJ3A 1E72M 3MUY1 3ORWA 4L4PA 3BV4A 1I45A 3W7IA 4TVDA 3BPWA 3OVQA 3N29A 1Z6KA 3LGDA 1B5TA 2XZ7A 2CESA 4Q4RA 1JG9A 4S3DA 1MRAA 1V79A 3V7PA 3CZLA 5I0DA 1O5KA 4UZSA 5CLWA 2VJXA 2F84A 4P7OA 3KOYA 3RDKA 2E5CA 2YDQA 3BG9A 3LLFA 3AMKA 5M17A 3E5PA 3ANUA 1GG1A 1UIPA 5HWJA 4AYSA 3C4UA 4WDUA 1CLVA 1BRLA 1QR7A 1V7AA 3MZNA 1E6XM 3NG3A 2YOCA 3W27A 3VZYA 4KIEA 1TTIA 1EOMA 3W29A 3ZM8A 4S39A 2GWNA 3OPSA 4MOZA 2EPKX 5MF5A 2GSJA 1FKWA 3WDRA 1B57A 5I3GA 1A47A 4MJMA 2NUYA 4WY0B 4DF0A 2WXDM 7ENLA 1K8ZA 3LK6A 4H04A 1MQPA 4X9YA 3RU8X 2OFJA 2ZX9A 1R5YA 3NQ2A 1A5AA 1GOOA 1V3KA 3MPGA 1O5XA 2G3IA 5A8MA 4BZYA 2C1HA 3GH7A 4IGMA 1CB7B 2WVVB 3BAXA 2Y4SA 3BLFA 1KFKA 4KEMA 2XN2A 4S23A 3WNOA 3PBYA 3DGRA 3UWVA 2GVEA 5CPQA 4B5NA 2X2YA 5I00A 4CVWA 3KDNA 1OT1A 4FOUA 5HMEA 4PCPA 4EWJA 1RY8A 3GG1A 4M0XA 1ONWA 3N2BA 1W9DM 4W86A 4QX4A 3VNJA 1GOXA 1O4UA 3CLMA 1FVPA 1YDYA 2OZ0A 2VFHA 3M43A 3TJLA 1VB9A 2FGLA 1SU5A 2CETA 2YDRA 5D9OA 1CNVA 4IISA 5E0FA 1E71M 3FAWA 3RO6A 5BOEA 2EPMX 4YTTA 1UKTA 1LLWA 1P7TB 3L4WA 4ACZB 4AG0A 4W8LA 2QPXA 1GT8A 4W85A 1DP0A 2I57A 3DHPA 4UMCA 3DFQA 1LRQA 3GH5A 4F79A 5FSEC 4E2VA 1DQUA 3VNZA 1PYMA 3IJQA 3VDCA 2IXUA 3XINA 4MKSA 3B8SA 3S5YA 2WPGA 3W23A 4XD5A 4RE0A 2W27A 4IPLA 2GUUA 4F2UA 3E38A 4M7SA 3O63A 2PTXA 2Q09A 4S3GA 1ZAIA 3BAIA 1ELSA 3H21A 2Z2UA 4IMDA 4B5WA 4CD6A 3DFPA 2BNJA 2RAGA 1DJIA 1YQ2A 2IPWA 4RK8A 2QCGA 3AUOA 1BWKA 4D9PA 5CGMA 3EBVA 3W7QA 5C6MA 1US0A 4Z0JA 3NGJA 2PDXA 4R85A 3LX9A 4CQ9A 2WBGA 4R7WA 2J25A 4CUCA 4X0VA 4H9YA 3ZOAA 1E51A 3GG7A 4OQVA 5D2WA 2DZUA 2DT1A 1UQYA 4N6EA 3HPSA 3UZZA 3CAQA 1L9WA 1PV8A 1HJVA 3L4UA 3KOWA 2GZXA 1TPH1 3AIUA 1FWWA 4AH7A 2FFIA 3M47A 3N18A 3WSUA 3PJUA 3V35A 1US3A 1HG3A 1P6CA 3T08A 1V3HA 4JDBA 4UTLA 4E8GA 4Y9PA 4M51A 2YA0A 3SM0A 4C7GA 2DVTA 1K8CA 2OOFA 4L4LA 1JD7A 4HQVA 3EMQA 3WQ8A 5D8WA 4YCOA 4HMCA 1XRTA 2WSQA 3W7EA 3R1ZA 1M3UA 3GKFA 3Q65A 1BKHA 3WLTA 3GS6A 3CQIA 1B0IA 4H01A 4QS5A 3OG2A 2ZIDA 1IEQA 2VDGA 4C6DA 3TW7A 3G6MA 2OT0A 4EACA 4UTTC 2DIEA 3CL6A 1GOIA 2V3DA 1PIIA 5CPLA 1W3IA 5AC6A 4XTDA 3UWEA 2WCGA 3LPFA 4BI6A 3UT0A 3UG3A 4JTUA 2A4AA 2CLIA 1JXJA 4O4VA 4A29A 4AXKA 3OZOA 5AC4A 3LBMA 2AAAA 3SGZA 3DI0A 3KL0A 3WLJA 3GXNA 1XYLA 1XGZA 2GDVA 3GXIA 3ALGA 4FALA 1Z9AA 1DEDA 2ZA2A 5BWAA 4ZB2A 1V3IA 1XG3A 4YIWA 1EJVC 1OT2A 5D37A 2ICSA 1DXIA 4XUGA 4X22A 2BVWA 2ZKMX 4JIHA 3WCZA 4HU8A 4A2SA 1DPMA 3O6CA 1XIHA 4Y90A 3EWWA 3MMWA 1GYNA 1ZQ5A 4PMDA 1KXQA 3FA4A 4HPJA 3CUXA 3VOIA 4DNHA 1LCOA 3SI9A 1YXYA 3K8LA 2FPYA 3DOPA 4ZO7A 1L0PA 3K4AA 4JTJA 2UBPC 1DQWA 3LCIA 3HG2A 1SGJA 2DIKA 1HW6A 1RVKA 4LRTA 3W2MA 2QPUA 3WELA 2D3LA 3G1YA 4V15A 4M3PA 4POCA 3C2VA 1ADOA 4OT7A 1QI3A 4IL2A 4IMGA 3KS6A 3LHVA 3OB8A 4TO8A 3QPYA 3EXRA 4ZBCA 3VABA 3PB0A 1P0DA 4MGGA 1J0ZA 1NP0A 1JEZA 3R94A 4JTCA 2WW5A 1QW7A 3P14A 4FX7A 1H11A 1XC4A 1UUQA 2IPGA 1KGUA 3SIMA 2PLJA 2W9MA 1VS1A 2EKGA 5G4WA 1CGUA 4HZ8A 1XP3A 3WK1A 1XW8A 1GYMA 2DZWA 3NZRA 3A22A 3VC5A 1FCBA 3TTEA 5HNNA 3CYVA 3GAYA 1ZENA 3S1GA 1IEXA 1D3CA 1EZWA 4GO9A 2QXWA 3BURA 1J2WA 1FHLA 3W53A 3OVRA 2DQWA 2AOSA 4GPNA 3PAOA 1AZ2A 1IZKA 3P5YA 4RL3A 3UZYA 3SB0A 4DBEA 3CHDA 1VBUA 4LV9A 3N3TA 2CHNA 1FCUA 5CGTA 3RO8A 2VEIA 3LI0A 3UXIA 3I65A 3WQ5A 4XBKA 3PUEA 1NDZA 4RJEA 2DSVA 2EG7A 1VFUA 1H7WA 4RDYA 1XBXA 4XK2A 3DYOA 2G5WA 1HVXA 3BAYA 1UJQA 1XQKA 4LUYA 3NQFA 1LDCA 4KCVA 1TR9A 3NVDA 3VUPA 1U1HA 4QLLA 1CBGA 5DLCA 5C5YA 4GINA 1DJZA 3FKRA 3T4WA 5F1VA 7CGTA 1LBMA 1WX0A 4PRRA 5E1QA 3JVAA 4IJCA 1VCFA 4XO7A 1C7TA 1JQXA 4ZO6A 2H9AA 3CMJA 1D7FA 4MJ4A 3ZWSA 1OC6A 2W91A 3LEPA 1VRXA 4UFHA 3TOYA 4NRRA 4HHHA 2GVLA 3TYAA 3PAJA 1F7BA 3BGJA 5BRBA 3M5VA 2X7VA 3GZAA 3EX1A 3XISA 2CPUA 4IQJA 1VFSA 4IJBA 1GUVA 2AL2A 4FNQA 4YMZA 3KWXA 3GNXA 4PB3A 4UQCA 2W63A 1JDDA 4UOJA 3GHUA 3UEQA 4CNSA 4NZ3A 4AU0A 3LQGA 2XSXA 2OKOA 2YIHA 1G4EA 1E4IA 1V3MA 2PGFA 2OLSA 2PUZA 5HAOA 2IQTA 3FSUA 2OGJA 3WDQA 1OCBA 4K68A 2UZ9A 5DO8A 4JX6A 3S9ZA 1FTXA 1EUAA 5FF0A 2XHYA 5CSUA 3LD5A 3WD0A 1Y5WA 4MUPA 3WQWA 4W8AA 4H2CA 4L1GA 4OWGA 3WF3A 3M16A 1ZP3A 3OLDA 1GVSA 3UW6A 4LX4A 4ASTA 1OX4B 4G7FA 4PUNA 4GZJA 1R3VA 1GG0A 3N4FA 1I2QA 3HPAA 3SRFA 2R1KA 3O6AA 4I6KA 1TWSA 4Q8TA 3RIKA 4ZQMA 1V0LA 4O0QA 3EA3A 1L6YA 4CN6A 1OZMA 4L80A 3DYPA 5CC3A 3UGVA 3A3WA 1YHTA 3GO2A 4YCPA 3A6OA 2ZRXA 1FWNA 1XXXA 4A3RA 3ARVA 1BF2A 3RJYA 1JGIA 2GVGA 4IX2A 3EWCA 3VGEA 1LBLA 1UWIA 2FJUB 1OCJA 3NQGA 1X39A 3FYYA 3I68A 3MV11 3SSZA 1ZBWA 3GHTA 4TU1A 1K8XA 1ZP4A 1GVFA 2ZVRA 3EEZA 1KM6A 4CCZA 1UR2A 3WEOA 3EOSA 3WUFA 2VRJA 2V5LA 1VJZA 3A5FA 1E6SM 3RG6A 3W07A 3PHAA 3MC5A 4AD3A 4F4RA 2DZSA 3TAOA 2F38A 4KKXA 1GQNA 5E6YA 4N9DA 2PDYA 3QGKC 3FY1A 4KFOA 3TKFA 2FYMA 1J18A 3GU1A 2ZX7A 4MJZA 1Q2SA 3WJSA 3BTNA 2GQ3A 3GQYA 3ITOA 4WHBA 2ZUUA 1DJWA 2VWTA 4PL2A 2A3HA 3CUHA 4NJGA 1R3QA 3EA2A 4ICNA 4JCLA 4Y9NA 4G7EA 3KZPA 1HQTA 4O10A 1F8IA 4F0SA 3GY1A 2Y7FA 2CERA 4QJ1A 4M29A 3RGTA 2HZGA 4YYCA 1K9DA 3VIJA 3LLXA 4DBSA 1WKEA 4ZOEA 3ZS4A 2VGIA 3W2JA 2VZTA 1TJRA 3BANA 5KZDA 3WF4A 4Z2IA 2CIPA 5I3HA 1P5BA 4Z2JA 4LC6A 3VIOA 3T2PA 2O0TA 2E68A 5I3FA 3VDBA 2E09A 1Q13A 2NQHA 4X63A 4JQ1A 2G3FA 4LU0A 4IP5A 4HNLA 3GXTA 5I09A 2WWCA 3MMUA 4RKAA 2FMOA 2ZA3A 2KX9A 2OWWA 4AWUA 4GXPA 3VILA 4JY9A 3TK7A 1P4CA 1GHRA 4JEQA 2D0FA 3IVUA 3NURA 3W7OA 1QK2A 1XQLA 2C19A 4O1DA 4S3AA 1WXJA 3LHZA 4IGNA 4LUSA 1H7XA 3GG8A 1SO4A 1XH0A 1FUYA 2PMQA 4PFMA 2GQAA 2GGJA 3O7UA 3N15A 1S38A 3GIQA 1VR6A 4W5ZA 2BGQA 1IEWA 4O1EA 3VKKA 5DMYA 4TTGA 4Z2HA 1CXIA 4JFUA 2BLEA 4IT1A 2I17A 2J7GA 4Z1BA 1JJKA 4ZXLA 3ZIZA 5FCZA 3SR7A 1ZUAX 3VGHA 5KZEA 4I9AA 1NDYA 1XSJA 2NV9A 3B0UX 3AJ7A 4JAWA 4H6EA 2FH8A 1PUDA 2F7FA 1E9LA 2HJPA 3VZZA 1TRDA 2P8CA 2NLYA 1XIDA 2E6AA 1V3LA 4JXCA 2XH0A 3S2MA 3CPGA 2MANA 4QNEA 1B4EA 4BWLA 1OINA 1GWJA 4KWUA 4DWSB 4WKAA 3WLNA 3AHVA 1L2UA 3W82A 8CGTA 1YXDA 3UNDA 3HQNA 4G1KA 4GH1A 5CLTA 3O07A 5DCBA 3PTQA 3QR0A 3U2EA 1CI1A 2HE5A 4IZGA 1XISA 1GQJA 2INZA 5ABTA 4ZXOA 3I10A 4L61A 3QZEA 2NT0A 3QLLA 1GVEA 2Z6IA 3PZTA 2HPIA 3D3AA 2BBFA 1CGTA 1ZALA 4FK9A 1OM0A 4M6QA 1VJIA 1XLLA 3GHRA 4MNLA 2W61A 4TXEA 2MUCA 1EPVA 1H7NA 2I5IA 1EP3A 2Y63A 4BA0A 3ITYA 4QSFA 4ZZ9A 4F2TA 3MUCA 2G41A 2QNEA 4FLRA 1C7SA 4BQ5A 1QHZA 5LXEA 3WLSA 1JGMA 3TTYA 4IXXA 1KFLA 1KM1A 2J7FA 1DJQA 1H61A 1UWQA 1QHPA 3VCRA 5AYZA 1B31A 4P7NA 2V2CA 4JX5A 3EGJA 1MEIA 1GJWA 1R0MA 4JTGA 2NXIA 1K4GA 1TPC1 1SMAA 1W9PA 4IWWA 3FA5A 3T0CA 1R30A 1F4AA 1W2VA 2X1SA 1E5NA 3EX2A 4IIGA 4DAIA 3NDYA 4JTRA 1I60A 4XIMA 4GACA 4O1AA 3FVMA 3ENLA 4G5DA 2J6VA 3NVTA 4KRZA 5A69A 2WCSA 2QCEA 3TLQA 2ANUA 1IXOA 1FWJC 2I7GA 4FPSA 3C3NA 5I07A 3H24A 4AHPA 2CITA 3WNNA 3QSTA 1RLDA 3P60A 5L9FA 1X6UA 2NUXA 4Z1CA 3WD3A 4DNMA 3H2NA 3GC4A 3JUGA 2AGTA 5HINA 5AHEA 3ITLA 3NL5A 1EBHA 1OG0A 3RMEA 3EMCA 1WAUA 4V1YA 2RDXA 3IANA 5A95A 1JYVA 4URIA 1RJQA 1S2WA 1PZ1A 4GI8A 4QQUA 4AZCB 4HOZA 3BWWA 3THUA 3CWOX 4L56A 3TUUA 3UXDA 4NJHA 1UZDA 3ZT6A 1ICPA 2OGYA 1EO7A 3BDKA 1Q45A 5SWUA 7PTDA 1BYDA 4UMAA 3KVLA 4L1WA 5B7ZA 2Z0IA 2ISSA 4XBJA 1Q7QA 1H2JA 1OEPA 3QPZA 3ZLGA 2PDMA 1WXYA 5A6AA 4QE4A 3REQB 4PA8A 1S46A 4ADTA 3OO2A 1VRDA 4K36A 4WXYA 3TNBA 3ZVHB 3Q45A 2P53A 1FH7A 3TA9A 3VKBA 4C1KA 1AG1O 2WNNA 1J01A 1SZEA 1J6PA 2YCEA 7TIMA 1EC7A 1U1UA 1O5QA 1YEYA 3IJLA 4NKCA 4H9MA 2V5CA 1D8CA 4HBKA 3LXCA 3WDIA 1UD3A 1TPFA 2HEJA 2WNQA 1TWZA 4JQ2A 3UPWA 1Q63A 4QQ3A 2WAGA 1XKYA 4PUEA 1YE6A 3QGAC 5I23A 1W1IE 4XTIA 3G77A 3WIJA 3WK2A 3SRKA 1A5NC 3VE7A 5AB3A 4IPJA 3BLKA 4S1FA 4NZFA 3H53A 3VMOA 1VF8A 3NQAA 4N9CA 1SR0A 2D2JA 1S3TC 3R0KA 5JBDA 4J1OA 2HMCA 2Z1WA 1GNXA 2YDAA 3NGFA 1V02A 3W7DA 4ZFCA 3AMCA 2HS8A 4WZHA 4DO4A 2WSKA 2ZXQA 2I5QA 2VEPA 1B3VA 2OKTA 4LXFA 1YX1A 4K8HA 3IIPA 3U2ZA 3LY0A 4WJEA 5FEPA 2VX5A 4NI3A 1UC4A 2WHLA 2QCMA 5D05A 6ALDA 4F0MA 2DGAA 3MY9A 1V0KA 4KERA 2PGEA 2REQB 3FJNA 6ENLA 5LSMA 1H0GA 2QJHA 4JTLA 4JNZA 3VDHA 1Z32X 1UW9A 3GFYA 3BK0A 2W62A 1AUSL 3QVQA 4LRSA 4HOXA 4J3SA 3R0UA 3B9DA 1R9YA 1VC4A 1CX9A 1E4LA 3AIQA 3WD4A 4LV4A 3L4YA 2Z29A 3OLIA 4LY4A 3VYLA 5FSDC 4YTRA 2FZNA 1H1YA 1NWSA 3BCJA 2YDSA 4NX5A 2ISFA 4XSMA 2YZ5A 4HCLA 4ZTYA 1OX6A 2ODOA 2QUVA 4QGCA 1IXQA 4Q8OA 1TRIA 1XC6A 4CCCA 1EXPA 4LUIA 2QCNA 1KV5A 1CDGA 4UFLA 3NTYA 1MXSA 3L12A 2GSHA 4O28A 3O0KA 2BWGA 1PL9A 4RV3A 1K70A 2XIOA 4EVZA 1JYWA 1RJRA 4AYGA 2ZXAA 4J2PA 4LVFA 2CBJA 3GNRA 4PTDA 3SUSA 3PBVA 4A8NA 1W31A 3TDFA 1XD0A 3VOCA 2DDXA 2DV0A 4B4FA 4L1XA 4MPKA 3WQDA 3LRMA 4GY0A 4QXIA 4HN8A 2J88A 4GYPC 3UG4A 1F2JA 2Y6ZA 1XUUA 4J4KA 2PGRA 3VOJA 1U1JA 4F40A 3ITTA 2GVYA 2VX7A 4JKLA 1F3EA 3KRSA 3R79A 3S9IA 2V63A 1ENUA 5C54A 8RUCA 1LROA 4IGSA 4L9ZA 3RX2A 2INFA 4Q4SA 2CEQA 2W66A 2DY3A 3BMWA 3UZJA 4E2OA 1ZAJA 3H23A 4TX9A 1RQEA 3J7HA 1K4HA 5AC8A 4AIOA 3EKZA 4C6QA 5CC7A 1F3WA 5E0CA 1QO2A 1ZSXA 4CD8A 1OFRA 3LCGA 1Q8JA 1A5LC 2QAFA 1LORA 1C90A 1HJQA 2ZWZA 3ARYA 1R47A 1K02A 3AYVA 1GJUA 3LS9A 3VNKA 4CU8A 3FX4A 4XAPA 1GORA 3UFYA 3AWOA 1NDVA 4O54A 1TO3A 1MQQA 3KS5A 3GC2A 2NXHA 1VBGA 3L4VA 2Q02A 3ZSTA 4A3HA 4DZHA 4MZ1A 4UTTA 3VIPA 5HMSA 2GVJA 1E1FA 4O1FA 3W6MA 3ARXA 3GK0A 3CO8A 1UP3A 4HA3A 3QV7A 2PD9A 4W93A 3ZFHA 4JHMA 2YXOA 2XVPA 3E49A 4QR6A 2NX3A 3B9OA 4Q3MA 3CV2A 3ONCA 2BOFX 3AZSA 4ZOBA 3VGFA 3B3DA 3UXAA 2BODX 1ZFJA 3F2BA 3O15A 3PZGA 1RCOB 3AIWA 2CCRA 2PODA 3N2OA 1FDYA 2VCAA 4O0ZA 2LLEA 1HP5A 3UPMA 3S4TA 1N8IA 3LTSA 1I75A 3G1FA 2ONEA 1NWRA 1CTNA 5A6MA 3LBCA 3C8FA 4LBRA 4HYVA 5CZSA 3C2OA 2VGFA 3WBXA 3P81A 3UXKA 2H90A 3BLOA 2BY2A 1Z69A 3AU2A 1PTDA 1LF1A 3APYA 2PB1A 2AMXA 1ITUA 4FS9A 1TPB1 2G95A 4N6FA 4GVHA 3P82A 2X16A 5JXQA 4D6CA 4DWDA 1H3GA 1G67A 2CZEA 1V0MA 4WEVX 1XKJA 3I3BA 2EAWA 3K4WA 3A13A 1YKWA 3BLDA 4NNBA 2XGBA 3WQ6A 3QMRA 4CVUA 4PE8A 3N2TA 2EQDA 2VFDA 4BEQA 2BVYA 2O7QA 3V0TA 3W24A 3WY1A 3W71A 2NV2A 3PS7A 2BY1A 3RLVA 3U8GA 4DBUA 1TREA 5REQB 4D8ZA 3LB0A 4D1JA 4YU1A 2ZZ5A 5K4XA 4HNCA 5TBOA 4WD0A 3EB4A 3E2QA 1B9ZA 3T2OA 4HPHA 4NUWA 4DXKA 2WVUA 1BEUA 1HJXA 4M56A 3TMLA 3E1F1 4GE8A 5F4SA 4A21A 3VD4A 3QY7A 1RR2A 4LUTA 4QS6A 2WV8A 4G9PA 3SY8A 4HK5A 1VFHA 3BSMA 5GNXA 1IT7A 5IFPA 3B8UA 1IXPA 4C6LA 3I7RA 1HO1A 5A8PA 1XFBA 1OZQA 2BOEX 2BV9A 4UWMA 3UVIA 4I5XA 2XWEA 4BKNA 4GWEA 2FTPA 3AIBA 3LUTA 4GVGA 3MS8A 4CD4A 4HOWA 5HA7A 3KM8A 2SFPA 7REQA 2ZC8A 3FYPA 3PZQA 1NARA 3UGRA 4MFEA 4D6JA 3CAVA 1G6CA 4O52A 4O17A 4CNUA 2G3NA 3GB6A 3AQUA 3NO5A 4IPIA 4DX3A 4IP4A 1GEHA 2XM1A 1K9EA 1AH0A 4QEEA 2VEFA 1JNDA 2A3LA 5ECVA 3GXDA 5TAOA 4JOMA 4MDOA 2VURA 2PDJA 6CGTA 1OFOA 1BHGA 5C9ZA 4QG6A 3VPLA 1UR4A 3PBMA 1P0BA 2ACSA 3W00A 1O66A 1EH9A 4GNJA 3SN0A 1TPWA 3RPMA 1ZLPA 2QUUA 3VX1A 1WOBA 1MUCA 3BOLA 3LM7A 3KRUA 4EPBC 3MHGA 3THQA 5LNVA 4GY7A 1WOAA 1Z42A 1CXHA 2HS6A 4K6AA 1EOKA 3WBEA 1UWTA 5KSWA 2EPOA 4MNKA 4AEOA 4MWAB 3O1NA 4AZHA 2DSWA 2FH6A 3I3EA 4H19A 3LA4A 2GJXB 4NAFA 3XIMA 3F5LA 1H4PA 2Q3RA 3NR0A 3PPGA 1AMKA 2VTFA 4E8DA 3P84A 1SJDA 1SO5A 1H7PA 2X0YA 2FVKA 4PTVA 4GOAA 2WSRA 4U3CA 1EF3A 2E40A 4FOKA 2CC0A 1C8YA 3L4XA 3IVTA 3TFXA 1V6YA 4CGTA 2F6UA 3IGSA 1CXFA 3DFNA 4JR5A 1PHWA 3T1GA 4OZOA 2A7PA 3ABQA 1KLYA 3AUJA 3KFTA 1EWDA 1R2SA 3ICJA 1QNRA 1V51A 3KLLA 1EA9C 3AZRA 1VQTA 3AOFA 2EPNA 3LCLA 1HKIA 3T0AA 2HTMA 1KFEA 4LT9A 1JF6A 1S2UA 3WMSA 5JBFA 1EJRC 1PKYA 2D22A 5PTDA 3AXXA 1HKVA 3AICA 4LY8A 3C2FA 4IFKA 4RNIA 3T9PA 3ARQA 1KB3A 3S0CA 1KRMA 1W5QA 3E12A 2VR4A 4MHBA 4AIBA 4UQBA 1EIBA 2HBXA 3B9NA 4U31A 4LC8A 2TMDA 1TV4A 4MAVA 3L4ZA 2VC6A 2HSAA 3NQ7A 2WZIA 4GD0A 1XPGA 2OB3A 4E8CA 3H2FA 2FIQA 4ADUA 4C6PA 3NZPA 1K8YA 3G0XA 1I0DA 3O06A 4AISA 3TJIA 4W9TA 1LWIA 1AFSA 3OOQA 1OYAA 3NZQA 1AZ1A 2IMRA 2QJJA 1UR0A 2DH3A 1RCQA 4MIMA 3HG4A 1SFJA 3M6YA 3WH6A 2VC9A 3C8NA 1H0IA 3G1XA 1RALA 3R8GA 3G2GA 3GC5A 4DWSC 3IUHA 4O15A 2E77A 2BFGA 3A4XA 3F7JA 3ITGA 1QK0A 3GYEA 4UOZA 4DEFA 4ZQCA 1OJXA 2CZ5A 2GOKA 1I9CB 1XYFA 4O50A 3W38A 3C6CA 2VFGA 1SFSA 1GKQA 4AIEA 5D9PA 4IPNB 3T44A 1RQBA 4LH8A 1XH2A 1D3GA 1V0NA 4G8TA 1R9XA 3WMLA 4ZEPA 1QJWA 4LYQA 3MKVA 5DRCA 3A21A 5GNYA 1ZJBA 2R9RA 3OLGA 6REQB 3TQ0A 3KRZA 2WZTA 4ZODA 1E1CB 4PMNA 3T7VA 4GUFA 2WMGA 1UBPC 3ZMRA 4EKJA 3DFOA 1A5SA 1YTEA 4JTIA 2X42A 3RX3A 1KWGA 1GVYA 2XH4A 3LPPA 4K8GA 2C8NA 3DG6A 3JU2A 3GH4A 3E0LA 4JTEA 1DJGA 1EF2A 3GM8A 2GJRA 2XZ9A 4GZ7A 3DC0A 3VD3A 1J79A 2A21A 4CQDA 4E38A 5C8BB 1OD0A 1EJXC 4AXNA 2FDSA 1AJ2A 4ZQRA 4AIUA 4DAFA 4IP7A 5I06A 2J9XA 4MSSA 3OQ8A 3NDZA 2QJGA 5JU6A 1K3UA 4M1BA 1TV8A 2BHUA 1J0KA 4HA0A 4JHOA 5GJPA 3TONA 4ONVA 1MYRA 4S2BA 1BPLB 4BI7A 1OYBA 1EJUC 2E9LA 3GAKA 1QRQA 1RP9A 2V5JA 4WGHA 3S47A 4IGHA 3OYZA 3DBNA 3AHTA 3RR1A 1S5WA 4FX6M 4QDWA 3W7RA 4S3EA 3DGBA 3WUBA 1UD2A 5LHFA 5CZTA 5I02A 1JDEA 3M07A 4TVUA 1SMDA 1YMYA 4HYWA 3STFA 1I4NA 4GC3A 5AHIA 1RBAA 4GJIA 5E70A 4HPGA 2C0HA 4FHAA 5IDZA 3L68A 3VD7A 4LANA 4Z1DA 5M1TA 4KS0A 1XYAA 1XWYA 1EBGA 3MI3A 5C71A 2F8QA 3VIIA 3OZYA 3LZ3A 1V02E 2TAAA 3E2SA 3N4AA 3N9RA 2ABBA 3B4UA 3MHUA 3WLKX 4RNHA 3TAKA 3ARPA 4NZCA 1Q4NX 3FGCB 1S5TA 1AA1B 3GNNA 3PFMA 2RDTA 3BGGA 3OBAA 4NSBA 5F2LA 3E02A 1V5XA 5BMXA 1WXZA 4AEFA 2ZICA 5EU9A 3KL3A 1WNOA 3SFWA 3KOZA 3DXIA 4QJ3B 1LYXA 1AD4A 3BAKA 4X0NA 1MUWA 5DMMA 3WJZA 4Q7IA 3DCPA 3GFZA 2E7FA 1K9TA 4ACYA 2H3DA 3W1XA 4R53A 3B8VA 3NFUA 3WKZA 5CAHA 2DQXA 3NQBA 1Q7MA 2ZRZA 1BSIA 3PG8A 2ZXBA 1UH4A 2P0OA 4MZYA 1DXEA 3G1DA 4N4QA 1QUMA 5HPCA 2CFFA 3IEBA 4L65A 4HA4A 4I7UA 1O94A 1RJPA 3WUEA 2Z7KA 1U33A 1NOUA 1QVBA 1L8NA 1T5AA 1UA3A 3QFWA 2FPVA 3PZMA 3QV9A 5AYXA 4DYJA 2PWVA 2Z00A 5CCZA 1P1MA 4RLIA 3BVJA 2WVVA 3KRBA 4I5RA 3MZ2A 1EFZA 3H6OA 4RR4A 1W1PA 3LHTA 4EANA 2YBVA 1YNQA 4FF5A 1OGSA 3OQEA 1PVNA 1W1VA 3W2LA 1H63A 2PU0A 4WF7A 2QUMA 1AH3A 2R94A 4W7UA 3H55A 4Z2LA 2W6RA 4W4QA 3CAKA 4W84A 4NQ1A 2ZUSA 4XG1A 1WKDA 4DELA 4Q8UA 4DZAA 3JZUA 1BKSA 1Q6CA 1KTNA 4Q8QA 1PTAA 1KWKA 2WJEA 4AB4A 4JYFA 3F4VA 1AQ0A 1NQ6A 5A2BA 1AW5A 2VZOA 2WPBA 4ACZA 4GYKA 5E6ZA 2YXGA 5DXXA 3GW3A 4WSHA 4HD5A 4JFVA 4CNTA 3T78A 4ERAA 3ATYA 3CUIA 5EKYA 5FD0A 3GLCA 3SGUA 5G2IA 1LOLA 5LA0A 1DHKA 2OPJA 1KRAC 3RPTA 3V0SA 3PY2A 1UASA 1PB0A 4LEQA 3OGSA 4XZHA 4F9JA 2OU4A 4BR1A 1HF6A 2X40A 3AC0A 2PF8A 3BMVA 2PDKA 4X61A 3TQPA 3VIGA 3NDOA 3KVMA 4L7ZA 4LCRA 4JD4A 3VCNA 3CH9A 3CZEA 1JCYA 2DUXA 1O60A 4UOQA 2E9BA 2V2DA 2IKGA 3S3GA 1ML1A 1JAKA 1KW1A 1ZTVA 1MDLA 3SCPA 1LOSA 4U5KA 1JFXA 3A4WA 5CBIA 5CC6A 1UBSA 2PBOA 3GVQA 4YWSA 3S6OA 1X6LA 1FXPA 4P5UA 3TWAA 3S83A 3L0KA 3W6LA 2HWGA 1GEQA 1KA9F 4IIHA 1MWOA 5JH1A 2BX7A 4LS2A 1FWGC 3B9EA 1JL8A 3AAMA 3VAVA 1M7PA 1OD8A 2WMJA 4B15A 1GCYA 5CPNA 4C6FA 1A4MA 1FWRA 4AY7A 2DP3A 4OTKA 4O1BA 3TTSA 2E0PA 3VDAA 3KBSA 1MEWA 4I7VA 4JIEA 2VVSA 4CEUC 1N7KA 3G3DA 4H8HA 4DUWA 1WAWA 1WBJA 9CGTA 4FXJA 3EWXA 3WFZA 1JPIA 2Z1BA 1W9UA 5LIUX 1Z41A 1VIWA 1UKQA 1M5WA 4K38A 1EL3A 2X2GA 3KAOA 4C1NB 2ZCGA 2AQVA 1K7FA 1FHVA 4GXMA 2OLAA 3W86A 1IR2A 4FNTA 3ARZA 4EXAA 3STPA 4NZ4A 3L7RA 3ZYZA 1Y7VA 2ZTJA 1H5YA 1I0BA 5H91A 3HZ3A 1XCFA 2DUZA 1NFBA 3E0IA 3W7MA 1JZ7A 3P74A 4NZJA 1C9DA 4KRTA 3HIJA 4PTNA 4C6BA 3MVTA 2A3EA 2GUBA 2B7QA 2PDLA 3BJFA 3OW1A 2PZ0A 3WNLA 3NYDA 4PUJA 4MMWA 4QHRA 5HMFA 2C71A 3CNYA 2GJLA 2OQYA 1KFCA 4HU4A 2G4FA 4WQ6A 1JULA 3JRKA 2EPLX 3N4EA 3FFSA 1OHLA 5DANA 3PZOA 3MJYA 3LNMA 4DJDC 3BARA 1LG2A 1ADSA 4A2RA 1CW2A 3SJNA 1GKRA 1IE7C 4H3DA 4JICA 1PEZA 4IIEA 4NY2A 1XLFA 2X30A 4ML9A 4U10A 2D0GA 1U5JA 9RUBA 4OVXA 1FWBC 2G37A 2P8BA 5HQLA 3VINA 3WD2A 1HJSA 1T7LA 3WQOA 2B31A 3M46A 1VBJA 2X7WA 2GWGA 5BCAA 1J5TA 1Q3NA 3VOFA 4JCMA 4FF7A 1XRFA 3GVRA 3VVGA 3W7LA 3HN3A 4BY3A 2DZVA 3LHWA 3IGUA 1WQ5A 3W28A 2IKJA 4PSPA 2OLHA 1E55A 3GHSA 4U4MA 1R7OA 4LSBA 1G1YA 4FO4A 1XINA 4CQAA 2VUYA 1Z89A 4PRTA 1YE4A 1JQVA 3QZAA 4PCTA 4XKMA 1ZPTA 3S2CA 3RLHA 2PP1A 3CQHA 4GRSA 1I1XA 1L8PA 3O16A 5T8GA 2F6KA 3CV1A 3RXZA 5IRPA 2NWRA 3TP4A 3N04A 4L9YA 4GGBA 1UKSA 4GJ1A 1SZNA 1L2QA 5IFTA 5A8NA 4DUVA 1IGSA 4NXSA 2Y7GA 5J5RA 3TW9A 4HSOA 4YVPA 1W8GA 3T4CA 3POHA 3SCTA 1MXDA 4GHRA 1QDSA 3UESA 1HL9A 3FAXA 1DYSA 4RUBA 1DWFM 4EPKA 4ZFMA 3TYDA 2I9UA 1IWAA 2QR6A 3H2EA 1QOPA 3EKGA 4HTYA 2XIQA 2P10A 3FN9A 3MUZ1 4BQ2A 5MHBA 3QRHA 5FA5A 1GOMA 4PULA 1YNYA 1R86A 1O95A 3VI2A 4F8XA 1EDQA 1GVOA 1J6OA 1EZ2A 4MUZA 2RJHA 3G1VA 1W1A1 1QOXA 1BQCA 1F05A 3KXQA 2VEMA 3W2UA 2RJGA 1CLXA 3IJDA 5CBBA 1TUFA 3TC7A 3K1DA 2DEPA 4F0LA 1Q65A 2D69A 3OGRA 1MNZA 1C8XA 2X1UA 2Q01A 3T81A 3CHVA 4IX0A 4FOJA 1ZJIA 3UYIA 2WMIA 1PX4A 3TV8A 2QUNA 2D3NA 4IMCA 1TUXA 2POZA 4YHEA 4AUBA 5LNWA 5I7GA 3ITVA 3I4EA 3ARRA 1A5MC 4JPGA 2H9AB 4MWAC 4AWTA 1M03A 2QW5A 3ATZA 4OECA 1PSCA 3HJEA 1NQKA 2O9TA 1QOQA 2Y61A 1US2A 1WPCA 1CEOA 3PN8A 3NA8A 4PC8A 1I6NA 1M6JA 4IQDA 3PF3A 4Q4QA 4DB7A 3NUKA 3W84A 3V5FA 3RPDA 3BJSA 1FDZA 2WSYA 3L67A 1BLIA 2ZZ4A 1R2RA 1DIEA 1TPVA 2Z1XA 2VC5A 1UYQA 2FGBA 2XDFA 2R91A 3OHMB 1OX4A 2YLAA 3GUWA 1XM3A 1VHCA 1X8FA 4CU7A 3LRLA 3CTTA 2BASA 3VKAA 3QQ1A 3PZUA 3G24A 2QV4A 4HMDA 5JQ9A 4MF4A 5EYWA 1POKA 4AZIA 1JF5A 2Q3OA 3Q58A 1IZCA 1XD1A 3QEZA 2D23A 1XYZA 1XR2A 4HPXA 3ZR6A 2HK0A 4PMJA 1E0WA 4XD3A 2X1TA 3DU0A 1KTCA 1YIXA 3AS2A 1NFGA 2Q8ZA 2ZDRA 3FJ4A 1DIDA 1VH7A 1MW0A 2PTYA 3WYZA 3L2MA 3W7NA 5BMWA 4D6EA 4AX7A 2UY3A 4J27A 2ZZ1A 4UCGA 1GVQA 4JX4A 1JPDX 3M0HA 2OWCA 2VD9A 3TYBA 1OVDA 3LERA 5J04A 1E9YB 1QASA 1UP2A 4ATDA 1MZHA 2YBTA 4KCTA 1QNSA 3SCRA 3PTMA 4BCEA 4HB7A 2VDIA 2CLKA 3IJIA 1NU5A 4HIBA 4Q4MA 3MSYA 1W9BM 1ECEA 3BO9A 3S2JA 1UWAA 5TQLA 3RF9A 1EYEA 2VEKA 4GIRA 1W9XA 4EE9A 2WVSA 4B3ZA 2ZUWA 5C9XA 2ABAA 3PWGA 3KP1A 5HJYA 4FNSA 3QYQA 3U9IA 1JIBA 4Q4OA 2NVCA 4BF9A 4LF1A 1CGVA 3C2EA 3VIKA 3GYCA 4V27A 3T40A 3WQ4A 4U2YA 3CZJA 4Q32A 2WMKA 3EWDA 3T0DA 3LENA 2FKPA 2V38A 2RH9A 4LTSA 1UUOA 4US5D 4UNLA 3RK8A 4DJEC 1HX0A 2EPHA 1R3TA 1LRTA 3ZJ7A 4I8YA 1TA3B 1DWJM 2FGZA 3GKAA 3A4AA 1JPHA 3AS3A 3PBUA 3HQOA 4CQCA 3G18A 3U4AA 1VENA 3R12A 3SIZA 4KBXA 4ZQNA 3SUVA 3R0DA 3L0GA 3BXWA 1VFLA 2DH2A 3LPOA 3SRHA 2PU1A 2FTYA 3NSMA 1TV2A 4UFIA 1U2YA 4WX2A 4EPDC 1DORA 1A0DA 2IUZA 3FOKA 3CWNA 3QW3A 4OUIA 4JIQA 1UWRA 4NJIA 4HNTA 5H2ZA 4BQ3A 2VCBA 4QG8A 3DFHA 4Q4PA 3DFSA 4LVGA 1F6KA 2BY0A 1KNWA 1CCWB 1TJ0A 4QM1A 4UTFA 2QEZA 5D2VA 2AKZA 4ORIA 1KFBA 1AD1A 4KW2A 2PDIA 4DM1A 2IXVA 3S2LA 3QV8A 2D1ZA 1P6WA 1M7XA 2QVHA 1WDWA 1NDWA 1RSCA 3C61A 2XSAA 3FSTA 2R1PA 4DUXA 4Q4KA 4H4IA 5KETA 3VNMA 2BXZA 3NL6A 1E3ZA 1O1HA 1VFMA 4RDVA 5K7JA 5T9CE 3N3MA 1B4KA 1W1TA 1X97A 4M82A 1B30A 4OBSA 4KQNA 3URQA 3M0VA 1OK4A 4AMCA 3QR1A 4LEFA 3BG5A 1GVIA 3FHAA 3WLOA 1A5KC 1S2VA 2ZX6A 2XH2A 3WUGA 5HULA 1ZZMA 2JF7A 5LIKX 3SEPA 3AYSA 4PCFA 4AD5A 3VMPA 1H1ZA 4GK8A 4YPJA 2BHYA 3UA4A 1ICSA 1EQPA 4YVVA 3NOEA 3M0KA 3V16A 4O57A 3OTRA 3EDDA 1UR9A 3ELFA 1FP8A 1ICQA 2PWFA 2GJNA 4O12A 2ZA1A 4KF1A 4UB9A 1QPNA 1DV7A 2OYLA 1IIHA 4AWSA 1X1ZA 4ZA0A 1H7OA 2WYSA 1GKPA 1EA0A 2FFCA 2Z2BA 4KESA 2Y8VA 1N2VA 4LVDA 4GQGA 1W91A 2E28A 1T0OA 3ARWA 4OBTA 3W1MA 2RDWA 4CCDA 4IM4A 1HUVA 1S1RA 5AYBA 4PMOA 1J93A 1PWMA 2BTMA 4NYYA 1VBHA 5EMMA 2V69A 1OC5A 4Y8FA 2D73A 4XD4A 4GYFA 2VX4A 5ECUA 1ZJHA 3BLPX 4RPPA 3VKJA 5A2AA 1TWIA 3IJ7A 4GI4A 2XINA 1MFUA 3OGVA 1WUEA 4EX4A 1T8QA 4RX0A 3L5LA 1QBAA 5HMDA 3QN3A 2ZZ6A 2GGIA 2YJQA 1AJ0A 2VWSA 1PZ3A 1UP0A 5JVLA 2FZ8A 1UKOA 4C1LA 3BQ6A 5A8OA 4ATLA 3SURA 3U7BA 4LPCA 1OGGA 1YRRA 1IGWA 4Q6XA 2C79A 1Q6OA 3B03A 3PJWA 3QZ6A 4NVTA 5CSYA 1R85A 2A7RA 4PTXA 3PBWA 3JZEA 1RK5A 2X0HA 1DWGM 4PBEA 2J75A 5B7YA 4RE3A 2CU0A 4F0HA 2Y2WA 3KDOA 3TNOA 2XSBA 4M24A 5KTLA 5AHNA 4ZB5A 1MZRA 1QBBA 1G9HA 2EG6A 4LYPA 1J2BA 5LA1A 1SQ7A 4TX6A 1S2TA 4INFA 5FF3A 2J47A 4Y9OA 2Z25A 2QHAA 1TPUA 3B0VC 4UBPC 4LF2A 1A0EA 2FDMA 3A9BA 4JTSA 3EXSA 4PTMA 2Z7GA 1K6WA 1ODZA 1VFFA 2XM2A 2RUSA 5A94A 1OG6A 4H1ZA 2QLYA 4AZCA 2VFEA 4PMVA 5DMLA 5LNUA 4B2DD 3LV5A 3W1QA 2A1YA 3M41A 2VI0A 4WOQA 2C13A 5HWNA 2HVOA 1E40A 3E5BA 5CZJA 5M3WA 2JGYA 2ZQ0A 4QJ5B 1Y5VA 3M7WA 1QATA 3CHEA 2P3ZA 2X09A 3MSGA 4J7RA 3EOOA 1XGDA 3VNLA 4LYKA 4P7LA 1E6NA 1YLVA 3N2MA 4MLRA 3ZVHA 1W5OA 3ZO9A 1TX2A 3OBKA 4KEVA 1K7XA 4KT2A 4QRNA 2ZZ7A 2UWFA 3DHUA 1XIIA 1PE1A 4J3XA 3CIWA 3WG6A 1IQ8A 5H6HA 2B81A 1J5SA 5A2CA 3KCJA 1SUXA 4GZEA 2CWXA 2OMAA 2DVUA 2QGHA 4V33A 3URBA 1U5VA 3URAA 1XLGA 2JIWA 2QDEA 1FWAC 3AI0A 4CQBA 4B91A 1KXTA 2GOUA 1NFPA 1X6NA 3C86A 2OEJA 2VFFA 3FKKA 3ZJ8A 3KOFA 3CPUA 3GE7A 3BL3A 3AS0A 1ITQA 4G56A 1MSSA 1OX5A 4QISA 4D8AA 3R4IA 9XIMA 2VFIA 4NIRA 3LZ5A 5D32A 1B54A 4DLFA 3F2DA 4US5A 4R27A 1PZ2A 2AAMA 1RA0A 4O19A 1F8MA 4H41A 4U28A 2HPMA 1BTMA 5A6LA 4S3BA 2I9EA 5XINA 4RZ6A 3ZT7A 5IBXC 3VGGA 4PRWA 4C91A 3W02A 5DN1A 3DDMA 3B04A 3KTXA 5CPTA 4GKTA 3NSNA 1VLWA 3AROA 1RUSA 2J24A 4WDTA 2YL6A 1ALDA 2PE4A 2V67A 3NCOA 3S1WA 4PUUA 1Q85A 4AQLA 3UPBA 3WNMA 4OV4A 3P62A 4MFDA 3VM7A 7TAAA 1XYBA 2ZC1A 4MB3A 3A3XA 1E9IA 2WJZA 4BEUA 3PANA 1CXLA 1FWIC 4GISA 1Q6LA 3RRXA 3LMZA 4XKYB 1AVAA 1VPQA 3EA1A 1TPDA 5C9RA 3NWRA 3QJAA 1UWUA 1NWUA 1ZBVA 1FWCC 1JZ4A 2F61A 4QIUA 1RK6A 2PDPA 3LV6A 3IK2A 4LJ3A 1Q8AA 3WQPA 3EZ4A 1PDZA 4J28A 1IEIA 4FLQA 4FNPA 1HL2A 4U5IA 1XG4A 4J3WA 5DQPA 1RA5A 1KQYA 3AYRA 3NL3A 3NQVA 4OV9A 4C6OA 1DE6A 4BF7A 4GY1A 3B05A 3OEXA 1LQAA 4JTTA 2OTDA 1E0XA 3IJ8A 4Q8MA 3KHDA 5D8ZA 5F4XA 2C16A 2D2OA 5T26A 2IQDA 3UR2A 3BSGA 3GW0A 1ITCA 3EX4A 3DUGA 1X7IA 1BXBA 3DKJA 2PDQA 4K37A 1QWGA 5AC5A 2FHFA 3FJLA 4D2JA 1FH8A 2BHZA 1OFEA 5EMYA 3VTRA 1AMYA 1LQ2A 2H6RA 3ABRA 2PCQA 3W9ZA 4GVIA 4Z1YA 4US6A 1J96A 3A47A 1S2AA 1TCDA 3BLLA 2WKJA 5ABFB 1IIGA 1UG6A 2W79A 3NZGA 1LUCB 2Y5JA 3I3DA 4FMVA 3RITA 2MNRA 1A49A 3F2CA 3IV3A 2C1IA 2QV5A 1S1PA 1ZHAA 1NF0A 4HJWA 5EL1A 2QDDA 2OELA 3WD1A 5IHRA 3DZ1A 1TIWA 1TMLA 1WZMA 4IJRA 3EOEA 3SCOA 4AD4A 4UUIA 3L21A 4HP5A 2ZTKA 3RCNA 2VZSA 3DECA 1K9FA 4PH6A 2WBKA 4BQ4A 4RW5A 1PYFA 2ADAA 4QG9A 3CL8A 2B7PA 4DJDA 1FY6A 4P8WA 8A3HA 4IOTA 2DT2A 4CLMA 3W26A 3AYTA 3FIGA 4P7QA 4XZMX 3HQ1A 3W7PA 4B3KA 3DG3A 2J7EA 2YCKX 3IIOA 1P48A 5A1AA 3QQ0A 4DO7A 4FSAA 2XYLA 4XWUA 3FXGA 3NQ8A 4J3ZA 3CMGA 4A3YA 4UTWA 3ZLHA 4NRSA 5HNUA 3T09A 4MB4A 4WOZA 1J0HA 5CEWA 4RCXA 3MJMA 4KGLA 2PP3A 4A3UA 4K1GA 5DT7A 2GJPA 5BOOA 4R33A 1SW7A 4P2VA 1KM4A 3OZPA 2XH7A 1WDPA 2VD8A 5AN7A 3W0KA 1V03A 1GPWA 3CIVA 5REQA 1E56A 4O16A 5HNRA 3D0CA 2VGGA 3JW7A 4LB4A 4ZO9A 4Z42C 4GFIA 4LUJA 5K9DA 3W2KA 4DHGA 3R8RA 3M5YA 3CK5A 3KLKA 2TODA 2DUAA 2P50A 2PEVA 1FHDA 3LHUA 4R7JA 3WJWA 5ENLA 3AIRA 1S5VA 5CXPA 5LIXX 3KBJA 3FW6A 3B4YA 5CAKA 4ZSUA 1TV7A 4QLJA 1VJSA 3KW3A 3A9IA 3O8AA 3F5KA 4XQ6A 3ZXWA 2PZNA 4B2DA 2WOQA 3DHFA 2YYTA 2R14A 4ZCWA 4FI4A 1CGWA 3Q4DA 4LUTB 4O14A 4TUFA 1YTDA 1FFQA 4UMBA 1KM5A 4Y96A 1PHQA 4R5EA 5EGRA 2FLIA 2ZX5A 1OC7A 3CQ0A 3M5ZA 1EX5A 1JYNA 3R89A 1DXFA 4EF9A 2PDHA 3MUXA 2DVXA 2DZAA 4O8AA 1UD4A 5D04C 1WBHA 2OJPA 4JTQA 3A24A 3GG0A 4JFSA 3NPWA 5CPSA 3MV01 1J0JA 5AZ0A 2ALRA 3AISA 4IPPA 3STGA 3CC1A 3TN3A 3T0TA 1M1BA 3TX9A 3R25A 4IICA 4QTGA 2OQHA 4C6CA 2VZUA 1XICA 4REQB 1SFTA 4B5SA 2VNCA 1WDQA 4E5TA 4GCXA 1V77A 2BVTA 1TZ7A 4ALDA 5HNTA