4ZMGA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with dh03a338
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Human Dihydroorotate Dehydrogenase (DHODH) with DH03A338
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
total genus 139
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4zmgA00
3LRLA 2GQAA 3HPXA 2WOQA 5C55A 1FXPA 2ATSA 5DCEA 2OT1A 3T78A 3IIVA 2QCHA 2QCEA 3G1SA 5T26A 3RF9A 5K7JA 4ORMA 3W2MA 4XQ6A 1LBFA 3KRSA 4UMBA 1QCWA 1H63A 3NVTA 3JR2A 3NPXA 1XDMA 3EB2A 3EKLA 1FWSA 4KWWA 3GKAA 3N2MA 3U6WA 1P0NA 4JTEA 1DVJA 3GXTA 1OX5A 2KZHA 4XUGA 4O11A 3H55A 5F4XA 1YPFA 3G1DA 3UWVA 1TPC1 2WNZA 5AC7A 1T8XA 2WV8A 3S0CA 3W7RA 2WKJA 3NQAA 4QISA 5K3VA 1OX6A 3S1XA 1JCMP 6TIMA 3UXDA 2JBMA 4U28A 4IWWA 4LS2A 4CLMA 4N6FA 1OFBA 4DF2A 4O53A 1UJPA 4UTKA 4PA8A 4FB7A 2NXIA 4LC6A 1D3GA 3GB6A 1VQTA 4XWUA 1YDNA 3N3MA 2P0OA 2NUXA 1RR2A 4N4PA 3LLFA 2NX3A 3TW7A 2BZNA 2ZTKA 1SZFA 2EPHA 1TV5A 2E6DA 3WK2A 3RNDA 1Z41A 5ABTA 3FIGA 1I8JA 1GVOA 5DBUA 4HPJA 1SZNA 4ZQPA 5G2WA 5C5YA 1IXOA 2CZDA 3LV5A 4MUZA 3W76A 3UNDA 5AHEA 3PSWA 3DFSA 1O94A 5K9DA 2OJPA 1G4PA 2X1TA 4LUJA 1HO4A 4M6QA 3R5EA 3S6DA 4JEQA 1TV7A 3HQ1A 5DBTA 3B04A 4DO4A 4NJHA 2Q8LA 1YXCA 1KM0A 3QRHA 1RQHA 2A7RA 2ZA1A 1ZJIA 3CT7A 3ATYA 4O12A 2Z6IA 4MY8A 1H7NA 3B0PA 1GYNA 1G69A 1ZAJA 2QCLA 2X1SA 1WXJA 2QDGA 4AB4A 1TTPA 4O16A 1R46A 3C3NA 1EWDA 3KRZA 1OX4A 1TJRA 2DZVA 2E09A 4AF0B 1C29A 3O6CA 3EXSA 3G1AA 3WJWA 1WBJA 1DQWA 4IMGA 4JDBA 5LNRA 5U7SA 3L0KA 4LTSA 3VFLA 2DJLA 4UTMA 3BLIA 4U4MA 3IVUA 1BWLA 4O54A 4UMCA 3RU6A 1R2TA 3R2GA 3PS7A 1UASA 3W7QA 3C2RA 2P1FA 3QZEA 4W9TA 3N34A 2Y6ZA 5AN7A 1L6SA 2Z1BA 2C0AA 4ZQNA 1DL3A 2QEZA 3QF0A 4O0ZA 2WNNA 2LLEA 3MHGA 1F7BA 4LV9A 3TQ0A 5CZJA 4Y9AA 4AHQA 1JULA 1FDYA 4JY8A 4OV9A 3QFEA 3LGEA 4PTNA 2QCDA 3IVSA 4MLJA 1L9WA 1OFDA 4O10A 2R14A 4S2CA 1OF6A 3GAYA 2X2GA 2YPIA 1Z44A 2A6LA 3NG3A 1ONRA 1TREA 4CQAA 2QJGA 3GNNA 3EWZA 3L5LA 4ML9A 3G8EA 5GVJA 3TQKA 2EAWA 4KFNA 3SW6A 1DV7A 3VCRA 3NAVA 1AL7A 4QITA 2ZZ7A 4MIMA 4TR9A 3W7CA 4GXMA 2QCFA 1VCVA 4QAIA 3QJAA 1B3OA 1SSDA 1TPH1 1W3IA 4NZFA 3EWWA 3NL5A 5FF0A 3N9SA 4NJGA 3GKFA 3FKRA 2VXNA 4WUIA 4JTFA 3SIZA 4M7TA 2V2DA 3GLCA 1Y0EA 2JGYA 3FFSA 4M19A 1KBIA 3S1UA 4DO5A 1YTDA 3O1NA 3W7GA 4RLIA 3ABQA 4WOQA 4MFEA 2V2CA 1W3NA 2NX9A 2YCEA 1VPXA 3HPZA 1GTEA 4DELA 3FYPA 5EL1A 1YPIA 3O05A 3MWAA 4PH6A 4XZ9A 3DI1A 3MJYA 4BWLC 3BLFA 1TB3A 3L0GA 2V5LA 3GK0A 5KZEA 2J27A 3CM4A 4CCDA 1J2WA 2ATMA 1J5TA 2QR6A 3HGOA 1T0OA 4WXYA 3NGJA 5LNSA 1GOXA 2G5WA 5F2GA 1VCFA 4JGDA 2QJHA 3UZ5A 4FNSA 4O13A 1A5AA 3MUXA 3PC0A 3F1QA 1W3TA 2I14A 1XCFA 3IGSA 4JTUA 4LVFA 1VLIA 2IQTA 3OA3A 3QQ0A 3W1UA 1VHNA 1PHQA 1SUXA 2C13A 3M5YA 3P84A 3ANYA 1R30A 1CW2A 2VFEA 4S2BA 3TJLA 4ZQMA 3SR7A 3FA5A 2Q8ZA 1KFBA 2PCQA 4N9EA 3UWWA 4JS3A 3HF3A 3NQFA 1JUEA 3PG8A 5KINA 1OX4B 5EYWA 2HTMA 1TPWA 2CW6A 1OVDA 2C3ZA 4BK9A 3OG3A 5D38A 2VFFA 3TIMA 4FHAA 1H7WA 3W7NA 1SQ7A 4UFJA 2EF9A 4ONVA 1H1ZA 3NDOA 4HKPA 5LNWA 2ISVA 1PVNA 5F2LA 3BARA 5D04C 1A53A 3PY2A 3A21A 2DZSA 4JY9A 1ME9A 1T99A 3T7VA 4N9CA 1DBTA 3WK1A 3UQNA 1H51A 4RR4A 4BWLA 2B0MA 3TR2A 4UC5A 3ABOA 1B9BA 3NL2A 2WQPA 2V9DA 2J6XA 5FEXA 5F1VA 3LCWA 3P5ZA 2A85A 4JIQA 2H8XA 1OFQA 1XDLA 2BX7A 3MP3A 3W7PA 2DP3A 2BWGA 4IOTA 3GXNA 3ELFA 3EXTA 3M5ZA 3OEXA 3LTYA 3EX3A 1W5OA 4YLWA 2AGKA 3IIXA 1IIHA 1LP6A 4IMDA 2VENA 5DCDA 4YWIA 3M41A 3DKJA 1SZEA 1YDOA 2OX1A 3NNTA 2ZRXA 3N2XA 1NFBA 4OHQA 2RHGA 4ALDA 3MI3A 3NOEA 1B4KA 4TIMA 2DJXA 2V2HA 5AYZA 4XTDA 1GPWA 3M47A 4YCPA 1W5PA 4JDYA 1W5NA 3C61A 3BG3A 3B8DA 4FXRA 3UPWA 1L6YA 3TC6A 4AWSA 4B5NA 4FO4A 1PL9A 1TV8A 4KFOA 3TKFA 5CG7A 3SJ3A 4EWND 4YL2A 1SW7A 3Q2DA 1Q6OA 2CLOA 1VCGA 4FX8A 1TRIA 1EP2A 2YYTA 1X8FA 2GVLA 2A1YA 4E2BA 1KM4A 2C6QA 1BTMA 1I2OA 2FIQA 4CCCA 4S1FA 1GVSA 1GTHA 4MJMA 2V81A 4PODA 4LUIA 3W84A 3TC7A 2XN1A 2GQ9A 5K4ZA 1ZFJA 3HG5A 1VRDA 1H60A 5EMUA 3FKKA 4JICA 3LX9A 5G5IA 3HBLA 2W79A 3G0XA 4NXKA 2TPSA 3IEBA 4Z08A 2J88A 1QMLA 3MBFA 2E5BA 3W70A 2E77A 5AHLA 3NR0A 3ZS4A 4ZL1A 4O18A 1KTBA 2Y63A 3TW6A 2CLIA 4YMZA 2ZRZA 1I2NA 1V7YA 3IV3A 3SECA 3W7MA 1H7OA 4NJJA 3CIXA 3C0JA 2AQWA 2D73A 3LCXA 5AC8A 5LNVA 4XBSA 3G1VA 3N73A 2F84A 4J9JA 3W1NA 2BXVA 4DEFA 5HUOA 3EXRA 3W7JA 4M6VA 1L6WA 3NZ1A 2TYSA 1QO5A 3E9AA 3MI6A 1K02A 4AH7A 1QWGA 1TQJA 3I68A 1EX5A 1GEQA 4O4VA 4PL1A 3GYEA 5FEWA 4GFSA 4E2DA 1ZAHA 5E1QA 3HG2A 1KA9F 2NXHA 4EOUA 2ZCGA 3P5YA 5FI8A 3LHWA 1YLVA 2YSWA 3PUDA 4IGHA 5D33A 5D09A 1W8SA 4NNAA 3LDVA 3MP5A 1JVNA 1LOLA 1ML1A 2VEKA 2XN2A 1KLZA 1AL8A 4Q32A 4RZ4A 4Z1CA 3A5VA 3LI0A 1ICPA 3R89A 2JKAA 1F05A 3NQ8A 2ABBA 2VEMA 5K4XA 1EA0A 3NO5A 1XUUA 4JTJA 2BTMA 3F4WA 1VC4A 3THQA 2VFDA 3DH7A 3W86A 4HNUA 4RZ6A 1AW2A 5LHFA 3LHYA 1K8XA 2ZRVA 3MW7A 1QPNA 3B05A 1OFOA 2Y70A 4K37A 5U4NA 5FF7A 4WQ6A 3U8GA 3M7WA 1H5YA 1Q6QA 2XN0A 1D9EA 5LGXA 4POCA 4UCGA 5A8GA 4MLRA 3LXBA 3QMTA 3S5YA 3TMLA 2GUUA 3M16A 3GDLA 4O1BA 2QAFA 4M6PA 3DENA 3W85A 4GBUA 5K9XA 3L65A 4AF0A 2ZRUA 4LS1A 4UUIA 2QCNA 1XXXA 2PC4A 3EEGA 4DXVA 4Z0JA 3S5ZA 3L5AA 1A50A 3MMTA 3PB2A 3UY7A 1ALDA 2CU0A 3A22A 4UTJA 1PCWA 4IX2A 1K8YA 1OYCA 1W5QA 3HOJA 5AHIA 2J24A 3G1HA 4ZQRA 3NQGA 3O16A 3KVJA 1Q6LA 3AO0A 3HJZA 3N19B 3NA8A 2E68A 3E02A 1X1OA 3W1RA 1EIXA 3IIPA 3R13A 4CNOA 8TIMA 1OYBA 3QYQA 3T55A 4WZHA 1FDZA 2A0NA 1JR1A 2Z0IA 1PS9A 1RVGA 4L4MA 5FEZA 2ZTJA 3NPUA 3W07A 5EA9A 1J4EA 2VOMA 1LLWA 3H54A 4GUFA 3IIZA 3TNOA 3LI1A 2RDWA 3ZFHA 1RQEA 1R47A 2E5CA 4H6KA 1QFEA 1MXSA 4I7VA 1W31A 3I7QA 1JRCA 1G4TA 2HS8A 3KVKA 3THAA 5HULA 4LOCA 4NNCA 3CPRA 5K9CA 3FLUA 3SGZA 3BV4A 4RCXA 4N02A 4LRTA 3PBUA 4I9AA 4HIBA 1IF2A 1QOPA 5D37A 2J9ZA 3NEVA 4UTTC 1W5MA 1NEYA 5EPDA 3C2FA 1GVRA 3RMJA 3UZJA 4UTHA 5D2YA 5TIMA 1SZGA 1DJNA 3DFNA 1PV8A 3CEPA 3E96A 2NUWA 3HMJG 1F6PA 1TSIA 2DZUA 3LOTA 2YW4A 5FF2A 3LHZA 3UY8A 5I3IA 1X7FA 3LCGA 3UYCA 1YXDA 1MSSA 4DPQA 4HHPA 4PFMA 5CZTA 1MO0A 4JTLA 1SO6A 4FNUA 3PF3A 1XBXA 1A5BA 3GDRA 3G1FA 1LRNA 4CNPA 2FPTA 4O1CA 4RV8A 1X6UA 1QO2A 1DQXA 4IQLA 4UXDA 2RH9A 1NAL1 3G8RA 5EY5A 5G4WA 1OK6A 3IIOA 1SFLA 2QCDB 1WX0A 4JD4A 4M7SA 3S5OA 4DF0A 1FCVA 4O50A 5EKYA 3GX9A 3LB0A 3JS3A 5I3HA 1WOAA 4MY9A 5KITA 1KW1A 4LNYA 1F5ZA 1SW0A 1JCLA 1U83A 1EB3A 1TPB1 5D03A 1X1ZA 2G96A 4ZVJA 3A23A 3CC1A 3DKLA 1ICQA 1XKYA 1W1ZA 4ZQCA 1H50A 1VYSX 1BEUA 3SSJA 2H90A 1EP1A 1CX9A 2CLFA 3L0NA 4JN6A 4MZ1A 1JQXA 3IGUA 3NQEA 1WAUA 2VEIA 4FX7A 2JKPA 1ZCOA 5D32A 4XKYB 1WDWA 4MKNA 4AHOA 1W56A 4GUIA 1ZENA 1S5WA 2R94A 3G3DA 1KM6A 5CPOA 3PBYA 5G4EA 1VYPX 4FX6M 3TXVA 1EEPA 2RKXA 4LY8A 1LRTA 1NF0A 2VELA 3D0CA 3PVFA 4Y90A 2ZZ1A 2A7PA 3GZ3A 3KAOA 3EX2A 4N4QA 4BR1A 4GE8A 2A6NA 2Y89A 1VS1A 4I7WA 3KVLA 2Y7EA 1GT8A 4Q4KA 1LBMA 3TU9A 1ZNNA 3F03K 3QSTA 4FIRA 1LM1A 1K7EA 5CZ0A 2GVJA 2O7QA 2RFGA 5LNUA 1LYXA 3P8IA 1XBZA 4O1AA 4GUHA 5MHBA 3TFCA 3HGSA 1N7KA 3HGRA 3DXIA 4N9BA 3BG9A 1OFAA 4NU7A 1XUZA 2DZTA 3W7LA 4ZQOA 3O63A 4JYDA 5DY3A 4UIOA 1KTCA 4ZZ9A 4RKAA 5L6UA 3G18A 1G6CA 1S5VA 4Z1BA 5G2HA 2R8WA 4A2RA 4AVFA 3C2VA 4HNVA 3C52A 1QPRA 3A5FA 1VLWA 1FWWA 1K03A 3UPBA 4UTWA 1QDSA 1FY6A 4JTSA 4AMAA 3NM3A 4A22A 3P74A 1WBHA 4R7JA 2OCZA 4X22A 1HUVA 1W37A 1SPQA 4R34A 4FNTA 1TPVA 2A21A 3TE9A 3WFAA 3MBDA 1QOQA 3NQ7A 1I2RA 4NJKA 2H3BA 2BSLA 5D02A 2YDAA 3L9CA 1TTJA 2NWRA 2NWSA 5H2ZA 1IXNA 1DHPA 1AW5A 4DO6A 1VR6A 2OMAA 3LCIA 2GVGA 3Q58A 3GAKA 1XBVA 1CI1A 4NQ1A 4HPXA 2I1OA 3EWUA 3N14A 1DORA 1NVMA 4WX2A 2AAMA 2E1DA 2V0TA 4Z1DA 4ICNA 5D2XA 1SO4A 1YXYA 3C4UA 2C1HA 3HPSA 1QAPA 1KFKA 4X2RA 2A7NA 2WO5A 4DF1A 1D3HA 4GRSA 3S8HA 4JTHA 3L68A 2Z2UA 3EWXA 1XL9A 5KZMA 4O14A 4A21A 4DQWA 5AHMA 1I4NA 4X3ZA 4RK8A 1LTDA 2GJLA 4HN4A 1VJIA 1R2RA 3S9YA 1Q45A 1YTEA 1AW1A 1NF7A 1EUNA 5L9FA 1S3HA 4UFMA 1TO3A 2WSQA 2TSYA 2EHHA 5KSWA 2J9YA 3DI0A 2F7FA 4IMEA 4MFDA 3EX6A 3HB9A 4C1KA 2CWNA 4K38A 3V75A 4LVGA 4NX0A 4I7UA 3LCHA 1B57A 3M1ZA 2V8ZA 1FUYA 5F1UA 4RZ5A 2W0UA 3LBCA 5DXXA 3USBA 5IBXA 5BOOA 5IM51 4AXKA 3BGGA 3CU2A 3KX6A 5DXYA 1OFPA 1HTIA 3KVMA 3DFTA 1I2QA 3DZ1A 4JTTA 1PIIA 3NQMA 4AWUA 4Y8FA 2TRSA 3DHDA 2B4GA 2ZZ5A 4C1LA 5BNKA 3NQCA 5LZLA 4YCOA 2ZZ6A 1UBSA 3O06A 3P82A 1TPEA 5HINA 3IGXA 3NXFA 4D2JA 3TFXA 3P62A 2WNQA 1C9DA 5BW6A 3BLEA 4BI6A 2EKCA 1Z48A 4IMFA 3P67A 3LLDA 2GPTA 3DGRA 4RX0A 3GVGA 3QH2A 4OE7A 5LKYA 1C8VA 1T96A 4MZ8A 4IXHA 3LCLA 2P10A 3V1PA 4IJBA 4OWGA 4R33A 2QF7A 4FEZA 4TMCA 5CPLA 3P61A 3W1PA 3W7OA 3LTPA 5AC6A 4EVZA 1GZGA 1K3UA 1WOBA 3TA6A 2H3DA 5D2VA 4AEOA 4ADSA 3I7RA 2ALDA 1M5WA 3BW2A 5FF4A 5LGZA 3B0VC 1M6JA 3CHVA 1B4EA 4QSHA 3CIWA 3PM6A 3LERA 4EF9A 1XFBA 2PURA 4HNNA 4LVBA 3W87A 4LVAA 4MVAA 5F2MA 3NL3A 3BO9A 4UTLA 3LBMA 1TQXA 4BI5A 3M5XA 1LBLA 5D2WA 4WY0A 5D2TA 1LROA 3LHTA 3VKJA 3STEA 1VHCA 1LOQA 2GJNA 2TMDA 4QM1A 2RDTA 3MI2A 1VYRA 3STGA 1JRBA 1KBJA 4K7VA 2FB3A 3P60A 3W74A 2ZZ4A 1LOSA 4K36A 3QPZA 2JK2A 2ISSA 2PRMA 3W22A 3W7HA 2CLLA 1O4UA 5TBOA 4Y6GA 2Y7FA 4PC8A 2FJKA 1DKWA 3OVPA 4FXSA 2CZEA 4DPPA 4O1DA 3QW3A 3ZWSA 4PL2A 3W3OA 3KHJA 4JXCA 4O15A 5CPMA 3SZ8A 4UTTA 1LLZA 3NPVA 2XFWA 4JX5A 4GC4A 3RFAA 2H8ZA 2O7SA 3G1XA 1UCWA 1WA3A 4N6EA 4BF9A 5D30A 2C15A 3NQ2A 1I45A 1HO1A 1ZALA 3W2KA 2A4AA 3CLMA 4G1KA 3G1YA 4QNEA 4X9SA 1N55A 2PE4A 3O6DA 2ZRYA 5AYXA 4HT3A 3TV8A 3P8JA 3PSVA 2FPVA 2FFCA 1P0KA 3KXQA 2QKFA 5CZSA 1M7PA 3QPYA 1SU5A 2ZZ3A 5F2IA 4PCFA 4WXZA 1XI3A 1RQBA 4JTIA 5CSRA 4N9DA 1VH7A 2GOUA 4BFAA 4EF8A 1XM3A 3GIYA 1SW3A 4Y96A 5C2XA 3NL6A 5G2IA 3ZWTA 4RXGA 4Z1AA 3PUEA 2ZQ0A 1UUOA 4WD0A 1K7XA 5HNRA 4OT7A 3ATZA 2C19A 1XBYA 2I9EA 2A5HA 3KOFA 2VFIA 3TAKA 5AFDA 3NM1A 2E6YA 1TTIA 2QCGA 2YXGA 3W88A 3W1TA 2B7QA 2CLMA 3DFPA 4K6AA 4K7YA 3R8RA 4CNNA 2WSYA 1KM2A 1W54A 4GUGA 1EPXA 3AJXA 1ADOA 1TJPA 1DOSA 1V5XA 3GR7A 3W7KA 1GYLA 1Q6RA 3RK8A 3WJXA 2NLIA 4TX9A 3LXCA 1O60A 2NZLA 3W6YA 3WJYA 5FF3A 3W2JA 1JQVA 2QUUA 4OBTA 4R53A 3W1MA 3W2LA 1KTNA 4QNWA 2WPBA 1U5JA 3M0ZA 1S5TA 5J5DA 2ISWA 2Y7GA 1KFJA 3I65A 1SO3A 3B0UX 1H1YA 3L67A 2E5DA 2V5BA 3TDFA 3SFKA 3TH6A 4AHPA 1HL2A 1O5XA 4MPQA 4TU1A 3FYOA 3W2NA 7TIMA 5BMWA 3I7SA 3M43A 1P5BA 1OF8A 2YYUA 2OZ0A 3DU0A 1GVFA 2YW3A 3OVRA 4O0KA 4LW7A 1K7FA 1FX6A 1RD5A 3G0UA 1UUMA 3E0IA 2PRHA 1A5CA 4PEKA 1OHLA 1ZHAA 3TK7A 3PBWA 1M7OA 4OV4A 2RDUA 5DCBA 1VGAA 3BW3A 3TCEA 3WK3A 4O17A 2G97A 1LRQA 3MHUA 3L21A 5H91A 3LRMA 4LRSA 4TO8A 1O95A 3W7DA 1WV2A 3CWNA 1QPOA 3ZR4A 1RV8A 2YFNA 1FWTA 2Y7DA 5AHFA 3T44A 5HJLA 3BG5A 4NNBA 1A5SA 1KM3A 3C2EA 4YXGA 2V82A 3W7EA 1VZWA 3L66A 5I3GA 3STCA 4BI7A 2ZBTA 2QCCA 3B06A 2YX0A 4NT0A 1HG3A 1TYGA 1YYAA 3IRDA 4GJ1A 2BLEA 1FQ0A 1RPXA 3LHVA 4JR5A 1G7VA 3TSBA 3FEMA 1BWKA 1SFJA 1F6KA 2VFHA 4E38A 1TPDA 5HMSA 3KRUA 5CGQA 2UV8G 3E12A 3R12A 3UWZA 4UFHA 4GWEA 3EKZA 3BK0A 4UFIA 2YZRA 1EWEA 1GJPA 4UFLA 2NX1A 4NX5A 3VE9A 4JX4A 4UTUA 3PB0A 5KMYA 1AK5A 4MJZA 1TPUA 1G4SA 5C54A 2HMCA 1JCXA 3P80A 1GVQA 2NV2A 3LHUA 3TJXA 5IBXC 2DU2A 3MYPA 1AG1O 1GQNA 2Q3OA 1HFBA 3T4CA 4L4LA 3W2UA 1YDVA 1H61A 3O07A 1MEHA 5E0KA 1GG0A 4O8RA 3UWYA 5FEPA 4ADTA 5E93A 1F74A 3FS2A 1RZMA 2Y85A 3VNDA 1ME8A 3MHFA 1TIMA 2J9XA 4JNMA 1PE1A 1TMHA 3IVTA 3CB8A 3L5MA 3Q37A 3JRKA 2WJZA 4M5PA 3EX1A 3NPWA 4JYEA 1F73A 5LSMA 2NXGA 1SR9A 2CLHA 1SSGA 2X1RA 1H62A 3GNDA 3HG4A 6ALDA 1THFD 3OIXA 3W1AA 1KFCA 4JTKA 1KV8A 3M6YA 1YTKA 4MZYA 5KZDA 1YADA 5DLCA 1P4CA 2Z6JA 4OGZA 4WOZA 2ZDRA 3DFOA 3W1QA 3LM7A 5I3KA 3ABSA 3C8FA 3W23A 4Q33A 1OJXA 2QUVA 4MYXA 2R91A 5D05A 4FIQA 2E6AA 3S1VA 3KFTA 4NXSA 4HNTA 2C16A 3W9ZA 4HSOA 1BKSA 4XTIA 5CKSA 1KFEA 3QSRA 4FNQA 3EWYA 1TTQA 4IPJA 3O15A 5K2ZA 4LC8A 3W1XA 3DFQA 1K8ZA 4UR7A 4K8HA 4MY1A 4O28A 3DAQA 3P7YA 1OFRA 3B03A 4FNPA 1KM1A 1JJKA 1FXQA 3QQ1A 2CLKA 1OYAA 3VE7A 1LDCA 1GWJA 4LU0A 1OFEA 4QIUA 3I6RA 3CEUA 2EGZA 3A24A 3SGUA 3K30A 4KFPA 5AHNA 5AB3A 3WJZA 3LXAA 1ZY9A 2QAPA 3PBVA 2VKZG 5SWUA 4IUOA 3TMQA 2Y62A 5HUPA 3EX4A 5G1YA 3QMRA 3QW4B 3MYOA 1G4EA 4K8EA 5F4SA 5HR7A 3W73A 2DZXA 3GR8A 4JTGA 4IXXA 1FDJA 4UTIA 2HSAA 4RXFA 2V30A 4A29A 5AYYA 3GDTA 5HWNA 1I2PA 2B7PA 2YFOA 3N9RA 3MO7A 3O6YX 3LCFA 5A5WA 2WSRA 2ZA2A 3WJSA 1JCYA 1JUKA 3GXPA 1WQ5A 3QM3A 3W72A 2ZFAA 3S42A 3HO8A 1O5KA 1KM5A 4O4WA 3YPIA 2X1UA 1H7XA 1NSJA 4HSNA 2CZFA 2CZ5A 3UD6A 4CQ8A 4XBKA 3CWOX 1UB3A 1MEIA 4H4IA 4H3DA 3ABRA 4UNLA 3NZRA 4UMAA 3HIJA 3S5NA 3C6CA 2FDSA 2E6FA 4O57A 3GDKA 4LV4A 1QR7A 3M9YA 5AOUA 5G1TA 1MEWA 1FWRA 1W0MA 4NJIA 2PRLA 2FB2A 1QPQA 3BVJA 3MP4A 4JYFA 3B4UA 3E49A 3UXAA 4NZJA 3G3MA 5BMXA 2C18A 3Q94A 3TSDA 1G67A 1E51A 1FBAA 1OABA 2NUYA 4N2YA 4JX6A 3TSMA 2H6RA 3NQDA 2DORA 1Z42A 2FPYA 3TAOA 3NYZA 4ZMGA 2W6RA 1TRDA 1F76A 3O8AA 4IPIA 3DBPA 4KKXA 2GQ8A 2X30A 3CQ0A 5DN1A 4EIVA 3GDMA 2Y88A 5HWMA 1TCDA 1GG1A 1AMKA 4QJ1A 3UWQA 3C56A 5I3JA 4KWVA 4AAJA 1PHWA 3OVQA 2NV1A 1H7RA 4LS0A 4DBEA 3OHIA 1FCBA 5C6MA 1IGSA 4FNRA 4LWWA 4NUWA 2ZYFA 2C14A 2HS6A 4TMBA 3T40A 2VC6A 3EWBX 3W75A 1DJQA 3F4NA 2B7OA 3OBKA 1JCNA 5CPNA 3INPA 3LV6A 4DBDA 5HR6A 2JGQA 2X16A 4CCEA 3G0SA 1KFLA 5CSSA 1R2SA 3P81A 2DZPA 5KTLA 1L2UA 1Q3NA 4MYAA 1EUAA 3QEZA 3WK0A 4Z0SA 1QNVA 3SY5A 5I3FA 3BW4A 3TUUA 1FCQA 4NVTA 1WYIA 1SO5A 1JUBA 2ABAA 3TXZA 2Q3RA 5HWJA 5DY2A 4UNKA 4K39A 3LTSA 3FOKA 5FESA 5HQEA 4A3UA 1G7UA 1MZHA 3RLUA 4MOZA 4WY0B 2FTPA 2B7NA 3LRKA 1LZOA 5F4WA 2FLIA 1F2JA 3QMSA 2VEPA 5DELA 1ME7A 1N8FA 4IX0A 4LT9A 3SI9A 3PULA 4WJEA 1LORA 1TPFA 4OQVA 4IMCA 2QCMA 4QQ3A 3CTLA 3HG3A 1ZAIA 4P61A 3TQVA 2FQIA 4O19A 4ADUA 3BPWA 1EP3A 5BRBA 2ZZ2A 2CLEA 1IXQA 1JCJA 4GNJA 2QJIA 3S1WA 2QDHA 4UR8A 2DZWA 2ZRWA 1KLYA 1IXPA 1IIGA 3DHFA 3BGJA 3L2IA 3QC3A 3M5VA 2Y61A 4E0CA 3HGJA 4OU1A 4XKYA 3W71A 4CQ9A 1ICSA 1XC4A 4UTWC 2A2IA 3NQ6A 3G24A 3PR2A 3PUOA 4WY0F 3W7IA 3U2OA 3W1LA 2YR1A 2ZA3A 2CFFA 2OT0A 5TQLA 5LHEA 2JKEA 3STFA 3C2OA 3PWAA 4UFKA 5J5RA 4A2SA 4AWTA 1PCKA 3FJ6A 1LCOA 3PAJA 3W83A 4RJEA 3M44A 3H53A 1KV5A 2YGYA 2QUTA 1OK4A 3VI2A 4FF7A 4LVDA 4JIPA 2G95A 3RLVA 3TX9A 1P1XA 3G22A 1FCUA 1FWNA 3NQVA 4O52A 1OG0A 4ORIA 3UWUA 3A9IA 4GUJA 5EBUA 1H7PA 3FJLA 4P2VA 3PG9A 2VFGA 3TROA
chains in the Genus database with same CATH superfamily
3LRLA 2GQAA 3TTYA 1XX1A 5DCEA 5A8OA 1EO5A 5A2BA 2QCHA 3G1SA 4AX7A 4S3DA 4M29A 3IJLA 4R5EA 4Q4QA 4AW7A 3NPXA 3OBAA 2J13A 4MWAD 4A8LA 3EKLA 1UC4A 4Q3MA 1FHUA 3CXOA 3U6WA 1P0NA 1NM9A 1BHGA 1OX5A 2KZHA 4XUGA 4FXJA 5F4XA 4Y9NA 3UWVA 5AC7A 1EJXC 1MRAA 3S0CA 3W81A 4QISA 1OX6A 1JCMP 1XF0A 5AKQA 4G7EB 2W3ZA 3U5UA 3T0CA 3VMOA 4CLMA 4N6FA 1RJQA 4O53A 1UJPA 4KW2A 4ATLA 3VD9A 3GDBA 2NXIA 4LC6A 3FJNA 1BGAA 1KWKA 4WEVX 4QG9A 5EU9A 1JF5A 3OZYA 4LAOA 1BSLA 3AUJA 3ENLA 2BZNA 2ZTKA 2EPHA 1TV5A 1K4HA 1I60A 3XISA 5ABTA 3FIGA 1I8JA 1GVOA 5DBUA 1SZNA 5G2WA 4DIAA 5C5YA 4MUZA 3LV5A 3W76A 2GFTA 2RJHA 1WB0A 3A9BA 3BH4A 1HO4A 3NOYA 4IGNA 3GTNA 1YNQA 3R5EA 4M6QA 2AMGA 3BMWA 4IQEA 1V6WA 3B04A 1UQYA 1KM0A 2ZA1A 1ZJIA 2WANA 4O12A 2Z6IA 3QPEA 3GO2A 1H7NA 4GOAA 1WXJA 1YX1A 2EG7A 4AB4A 3RPDA 1TTPA 2OB3A 1OX4A 3LY0A 4YTUA 2DZVA 2E09A 2Y8UA 4LAMA 2BS9A 3BE7A 4S3JA 5G4HC 1B30A 2DJLA 2DY3A 1O5QA 3WDIA 3CWHA 4U4MA 2XIMA 2E28A 1R2TA 3WIJA 1OC5A 3CV7A 3PJXA 1GW1A 3OZPA 4BA0A 2P76A 5M17A 4W9TA 3N34A 3M0MA 1L6SA 1WUEA 2AL1A 2C0AA 4ZQNA 1G0CA 3QF0A 1I0BA 3WUFA 1XG4A 3N4FA 3U3HA 1PTDA 1F7BA 2PA6A 4LV9A 5CZJA 4AHQA 4XD6A 3IVSA 1JPHA 1OCQA 1OCJA 1IR2A 1KKRA 2WC7A 1V7AA 4O10A 3W24A 5FJIA 2R14A 3FYYA 2YCIX 2YPIA 4F9DA 3PZGA 2QJGA 3L5LA 2J7GA 1W9BM 3EOLA 3TQKA 1DV7A 1TKKA 2ZZ7A 1GVYA 2G3NA 2QMJA 1FWBC 4P8VA 3UCDA 3OBEA 3QJAA 3CT2A 1TPH1 2AOSA 3EWWA 1PSCA 3NL5A 5FF0A 2VRJA 1ODUA 3GU1A 3FKRA 3T09A 4DAIA 4WUIA 4V1XA 1Y0EA 3FFSA 1W1IE 4DO5A 3PZUA 4JFTA 4M6UA 4RLIA 4DHGA 1JZ7A 2OG9A 3UEQA 5FAJA 1P6BA 2NX9A 2YCEA 3SQMA 4DELA 3KCOA 3FYPA 3VD7A 1YPIA 1CXHA 5HNNA 1AODA 1PWMA 4PMXA 3AMCA 1TB3A 3L0GA 5IOBA 4PRTA 1CXEA 1HKJA 1J2WA 3ZIZA 4G2DA 2A79A 4J4KA 3AZTA 5JMUA 3CZKA 2I57A 1GOXA 4JGDA 4FNSA 1E3ZA 1A5AA 2WMFA 1XYFA 3CV2A 4GI8A 4K1GA 3WL1A 1MW2A 2E0PA 1XJBA 4JTUA 3IAQA 5GNXA 4ZFMA 3OA3A 2GSJA 3OHMB 2HK1A 1CW2A 2VFEA 1R3YA 2PS2A 2Q8ZA 4N9EA 1KCKA 2OO6A 3HF3A 3VC6A 6CGTA 3PG8A 4R9XA 4PUUA 1E1CA 2HTMA 1TPWA 2C7FA 2CW6A 4MGGA 3QYSA 3OG3A 5D38A 4L1WA 4XZNX 4B5TA 5A6SA 3CHEA 3W7NA 3NEHA 3EDJA 3B97A 4JFVA 4HKPA 1NDZA 1V8EA 3A21A 3MT1A 1T99A 3UQNA 4RR4A 3U48A 4AYGA 1JZ2A 2QV4A 3IPWA 2WQPA 5FEXA 3SRDA 4W89A 1OFQA 1S1RA 1O1HA 3HN3A 2PLMA 2BWGA 3THUA 1B90A 2VGIA 3ELFA 4GQGA 1E55A 5DCDA 2R1PA 3WH7A 3UXIA 1C91A 3N2XA 4OHQA 5TAOA 3NOEA 4JTDA 1B4KA 2DJXA 4J5NA 1NIUA 2R9RA 3LEPA 3CZLA 4KCTA 1W5PA 1D7KA 1W5NA 1TR9A 4ZENA 3B8DA 1E4MM 1VKFA 3ONBA 4Q8WA 3REQA 4FO4A 2YXOA 3T8LA 1TV8A 4HMCA 4IH3A 5CG7A 3RXZA 4EWND 4M51A 3H2FA 1B31A 4FX8A 1TRIA 2YYTA 1MDRA 1I2OA 1ISVA 3F2BA 1S2AA 4CCCA 4Y7EA 1GVSA 3ZLHA 4MJMA 4CKQA 3MKKA 4GNKB 2BGSA 1IT0A 1JI2A 3L4WA 3BJTA 3ZXWA 1VRDA 1H60A 4AVOA 1PKLA 3IWPA 4NRSA 4MWAC 3R4IA 5G5IA 3HBLA 1Y65A 5A3HA 3VIJA 4Z08A 3USZA 4QJ5B 1DXFA 1QMLA 3QGVA 1H4PA 2E5BA 4C6BA 1NFPA 3WDQA 2E77A 3NR0A 3WZ0E 4O18A 1KTBA 3TW6A 2CLIA 4IFRA 3W82A 2ZRZA 5DEZA 8XIAA 1H7OA 3ITGA 3C0JA 5AC8A 5LNVA 3BC9A 3WMSA 2F84A 4J9JA 2BXVA 4AZIA 3W7JA 2FJUB 3WEMA 1X1NA 4H19A 3MI6A 4IIBA 1K02A 1V0LA 1GQLA 2J7BA 1UKPA 1E9LA 4LFYA 1TQJA 1EX5A 3NJ3A 3V5OA 3T2PA 2DT2A 1W3LA 4PSRA 4HA0A 3HG2A 3CAWA 2NXHA 3UGVA 3ITLA 1W9UA 2ZCGA 2PLKA 4Y9MA 3FDGA 3B8TA 1QTWA 1V3JA 1UH3A 4H01A 4NNAA 2IKGA 3LDVA 1XLEA 2UZ9A 1LOLA 2VEKA 4Q32A 1KLZA 4RZ4A 3A5VA 3LI0A 1ICPA 2V38A 2EPMX 2JKAA 3GM8A 4AZCA 3NQ8A 2Y0FA 1EA0A 1UROA 3NO5A 5EMYA 2X1IA 2PDKA 3W86A 4RZ6A 1E9YB 3AFBA 4Q4SA 2GYIA 2DT0A 3K4DA 4AY1A 4MNLA 1R9XA 4A3QA 1HIZA 4NL1A 3A6OA 5LXEA 1ZP3A 3GNPA 3U4FA 3MO4A 3L7RA 3GG8A 4JBRA 5REQA 5FF7A 4KIEA 1QI0A 4Z2IA 4Z2LA 1UOZA 4XZIA 5FJJA 4JKKA 3ZLGA 4UCGA 5A8GA 3QMTA 3IUDA 1Q85A 3TMLA 1VIZA 9RUBA 2V3DA 3E2VA 4XKMA 3RILA 3M0YA 4H9UA 2QCNA 1XXXA 3UXKA 4IP7A 2YKKA 2AL2B 1NQ6A 2CBVA 2O9PA 3AYRA 4BCEA 1UWAA 4D8ZA 1C3FA 1LF1A 4Z2KA 1ALDA 4L80A 4UTJA 1PCWA 3UESA 1E15A 5CC5A 4JIRA 5A6TC 3G1HA 1CYGA 4XZLX 4P7NA 2QPXA 2VX6A 3BSGA 1IWBA 4PUMA 3AUOA 1V3MA 3N19B 3IIPA 3VABA 1OWQA 3QYQA 3WQ5A 1KRMA 1UP2A 5H8UA 2Z25A 2Q09A 2A0NA 1PPIA 1RJRA 1UWRA 1Z3NA 4L4MA 4FOKA 1YHTA 5EA9A 1QT1A 1XQKA 3H54A 1AQMA 3LI1A 5I0DA 4V15A 3ZFHA 2EPKX 1R47A 2E5CA 2J66A 2XH0A 4H6KA 1QFEA 3RX3A 3I7QA 4NF7A 2FMOA 1G4TA 3N04A 4AWEA 2HS8A 3KVKA 4LYRA 3THAA 5HULA 2AQOA 4GQBA 3CL6A 3SGZA 2D23A 4N02A 4O0QA 4I9AA 4K3ZA 4U3AA 2J9ZA 3QTPA 1FP9A 1KD0A 5EPDA 4CCZA 1WDQA 3RMJA 7REQA 3ARUA 3UZJA 3VZXA 4UTHA 3QGKC 1FOBA 4R88A 1QOXA 4R27A 4PTXA 1WZKA 2X42A 4ACYA 1HVQA 4UNIA 3E96A 1AH0A 3ZO9A 3OA5A 2DZUA 1QU4A 3UERA 2MUCA 3AMLA 1EHNA 2JF7A 2W5FA 2I9UA 1X7FA 1ZS2A 4PFMA 3CMFA 5CZTA 2GUBA 1KO0A 3PF3A 1XBXA 1A5BA 3G1FA 5CPTA 3T1GA 4DUXA 1ESWA 1OBAA 4H9ZA 1NAL1 3ERPA 4TV6A 1CB2A 4ZXLA 2QCDB 4M7SA 2IPFA 4IMAA 4P8XA 4C6LA 3UJ2A 3TC3A 4PTVA 1TA3A 4ZB2A 5I3HA 1KW1A 1XLBA 4RDWA 4Q7IA 5D03A 5FJRA 3CYVA 3CC1A 5XINA 2DW7A 1ICQA 4LCSA 3APTA 1W1ZA 1EOMA 4QCEA 4GHRA 4ZQCA 3NSMA 5ECVA 3RIKA 1MQQA 2J62A 3GXIA 1E56A 1EP1A 1CX9A 2CXEA 2PDMA 4S3AA 2CYGA 4FX7A 4GZEA 1UZDA 5MF5A 4GXPA 1ZCOA 4XKYB 2G37A 1WDWA 2R94A 3B8UA 1VYPX 4LBSA 4WSHA 1Y5XA 2FGLA 2OSXA 1W3KA 2VELA 4AXNA 3PVFA 3QTGA 4IG2A 4Y90A 2KAUC 1E6RA 4IJRA 4N4QA 4HNCA 3FV9A 1BVZA 1D7FA 4US5A 4QHRA 3QSTA 1ZJAA 1LM1A 5CZ0A 4P8UA 5LNUA 3UJSA 1CGYA 3CZ8A 5MHBA 3TFCA 2GOKA 3HGSA 3V0TA 3DXIA 3MDUA 3BG9A 2NQ9A 1XINA 4QEHA 4NU7A 1XUZA 4ZQOA 4CQDA 4E3TA 4W84A 4JYDA 3S3GA 1OGGA 1G6CA 1LWHA 4D71A 4AVFA 4Z17A 4GYJA 1Q13A 1K03A 1QDSA 3TQPA 3GWQA 4AMAA 1S2UA 4RNJA 4X22A 2JIWA 1HUVA 4R34A 3CV1A 2A21A 4Z2GA 3WFAA 3MBDA 1QOQA 4EP8C 1CIUA 3I3BA 1SJAA 5D02A 2NT1A 1PIFA 2NWSA 5H2ZA 4B3ZA 1JGIA 4DO6A 2OMAA 1ECEA 3LCIA 1TV4A 2HBVA 1XBVA 2DQXA 5ABFB 4HPXA 3N14A 2E1DA 4MWAA 3VU2A 3S2NA 3QKEA 3UR7A 3TNBA 4UQ9A 3PTDA 2C1HA 4H7CA 5HJYA 1YRRA 4DF1A 1KFKA 5T8GA 4Q6JA 1UD8A 4GRSA 4JTHA 3EWXA 5KZMA 1XIDA 1REQB 4DQWA 1AA1B 3WKZA 4X3ZA 2R1LA 4A35A 1JNDA 3CH0A 4A05A 3M07A 4WGHA 1YTEA 2I7GA 3K1GA 3SSZA 1NF7A 3WDPP 3VM7A 4GQ0A 1JDDA 1DPMA 4GGHA 2TSYA 2EHHA 1P7TA 2BASA 2F7FA 2WCGA 2UY2A 5CXPA 4IICA 4C1KA 1MFVA 3UP8A 2VX5A 4I7UA 4PTWA 4CEXC 4NRRA 1L8PA 3M1ZA 3C8NA 5F1UA 4RZ5A 2QZRA 1HNYA 5AVNA 2E67A 2QQ6A 3T42A 2VOTA 3L23A 2VVNA 3CU2A 2FGBA 3KX6A 1JPDX 1OFPA 1HTIA 1MQPA 2REQA 1I2QA 2V5DA 3NXLA 3NQMA 9XIMA 4QBXA 4IPLA 4GLEA 3TTSA 5LZLA 3NQCA 2I16A 4B15A 3RLHA 1X38A 2ZADA 5DFAA 5I00A 4DZ5A 2DUZA 4Q8VA 3TFXA 4GC3A 1RSCA 1KXVA 4INFA 4BI6A 1Z48A 2CEQA 4RW3A 3P67A 3SY1A 3DGRA 3QH2A 3KTSA 2VC9A 4V2XA 3VFCA 3OP2A 2V68A 3E0LA 4YVVA 2O4QA 3SY8A 3OOQA 4TMCA 5JH2A 1E6SM 2ZICA 1AD4A 4L9ZA 1GZGA 4YNGA 5D2VA 3I7RA 5I79A 1U2YA 1B4EA 2EJ1A 4EF9A 3WYZA 3FSTA 3W37A 4LVAA 1H0GA 5F2MA 3BO9A 2EJAA 1ZQ5A 3H2MA 3ZZ1A 1WNOA 1DJGA 3V4BA 3MSDA 1EZ2A 5GNZA 1VHCA 5AZ1A 1TCMA 2Z2AA 2GJNA 1P1MA 5BCAA 4QM1A 1UMLA 3A3XA 3MI2A 3LK6A 2WJDA 1TX2A 4K7VA 1XV8A 2GGJA 2ZZ4A 4E3VA 1LOSA 4K36A 2ISSA 2CLLA 5TBOA 4F0HA 1E40A 2Y7FA 4JL2A 2FHCA 4PMUA 3A47A 3APYA 4Z2HA 5A6JA 5CQ1A 2F9RA 2IUZA 4KWUA 4A8IA 4AX6A 5IDIA 1CLVA 2XFWA 3D5HA 3VIHA 2O7SA 3ZLFA 1UCWA 5C9RA 2Z1WA 6TAAA 2C15A 3BZGA 1QNOA 4L1GA 2QPUA 4G1KA 4HOXA 1JD9A 1N55A 3FCPA 2ZRYA 3KTCA 2GSHA 3TV8A 4HT3A 1OSEA 4IG2B 2HE8A 2FFCA 2JF6A 3KXQA 3RR4A 2QKFA 2B81A 5CZSA 1GPFA 3QPYA 1ISZA 2ZUTA 5F2IA 1XISA 3F4DA 1BGGA 2XWDA 3F4VA 1XI3A 1TELA 4KEMA 5A6BD 4JTIA 4HVXA 5CSRA 4N9DA 2OX4A 4BFAA 2R1NA 3GIYA 4X60A 1QVBA 2E7FA 3NL6A 3ZWTA 4EPEC 3PUEA 2VC7A 3ZSSA 5HNRA 3ATZA 2C19A 4WDTA 4E2VA 3WDHA 4HZ8A 3AS0A 3NM1A 3OO2A 2E6YA 3IANA 2YXGA 3HQNA 1R0MA 4IIGA 3W1TA 4JKMA 2B7QA 4K6AA 2CESA 3R8RA 4CNNA 1KM2A 1PB0A 4GUGA 1EPXA 2HDJA 3AJXA 2PSNA 2Z27A 1V5XA 3KOYA 2R1KA 1PUDA 4UQEA 1XHGA 1A5KC 2WC4A 4UCFA 2DUAA 2XDFA 5DF0A 3S9IA 2EBNA 3HQPA 3W2LA 3M0HA 3WUGA 3PPFA 1QK0A 2Y7GA 1VBRA 3EKGA 1SO3A 3B0UX 4D6JA 2QVNA 1L8NA 1H1YA 3PAOA 3E0WA 3L67A 5BRPA 1MNZA 1P0DA 3LPGA 3VUPA 4AHPA 3FYOA 7TIMA 3S6TA 1P5BA 4V28A 3DU0A 1GVFA 2YW3A 2Y8KA 5CGTA 3W6MA 1VBHA 1RD5A 1A5CA 4PEKA 1RY0A 4GA8A 1OHLA 5D9OA 4HOZA 4IQJA 3V5CA 1ZHAA 2YZ5A 1M7OA 4I6VA 5DCBA 3WK3A 1KB3A 3ZJ8A 3UU0A 2ACQA 1BQGA 4GY7A 3CTTA 2ZX7A 3CQJA 2C71A 4GACA 3NSXA 1QPOA 1NWSA 4LYQA 2Y7DA 3JVAA 1NP0A 2HVNA 5HJLA 5LIKX 4NNBA 2OLAA 1A5SA 3S47A 1KM3A 4B5SA 2V82A 3MVIA 2E8ZA 4BI7A 3WDJA 3B06A 3SCOA 3ARZA 1TYGA 1R85A 4GJ1A 1XYZA 4CU6A 2YA1A 1FQ0A 1J11A 3LHVA 4JR5A 1G7VA 3TSBA 4B5XA 2CHRA 2O9OA 1J0JA 3U2EA 4E38A 1Q7ZA 1TPDA 4HOWA 3PZ9A 3E12A 3R12A 1IT8A 1MYRA 5CLTA 4FAMA 3LBOA 5ECUA 5A2CA 3VZZA 2BHUA 3B3DA 5CSYA 1RVKA 2YZRA 3GHTA 3ONCA 4B92A 4JX4A 1WUFA 3AXHA 1TPUA 1G4SA 1YQ2A 1B3ZA 3P80A 1JCTA 3KM8A 3TJXA 2DU2A 1GQNA 5A6MA 1XLGA 2A3HA 3DX5A 4X2PA 1V6TA 3DHUA 3MHFA 3RRAA 2PBOA 1EJUC 3HPFA 1EJRC 2BHZA 3L5MA 3Q37A 3JRKA 3EX1A 1ZBWA 2WVVA 1H62A 2PWHA 1M1BA 3OIXA 3R0KA 2YDQA 1KV8A 4TQTA 5D9NA 3DCPA 1S39A 3WFZA 1CNVA 8A3HA 3DYPA 5KZDA 1TV2A 2OGYA 1P6CA 5A8NA 3W1QA 2ONEA 4GVHA 5ENLA 5I3KA 3HM7A 1OJXA 4EX4A 5D05A 3HJEA 5H8PA 4FIQA 4DBWA 1WDSA 1QATA 3B40A 5RUBA 4C6KA 3RLGA 1GOQA 1BKSA 2IPJA 4FMVA 5EGRA 3QSRA 5CKSA 1TTQA 3MKVA 1NELA 1VFTA 3N3TA 2VUNA 2ZX8A 4LAUA 1M04A 4FNPA 4NSBA 4DJDD 4PUEA 4F0RA 1LDCA 4MUPA 4LU0A 1OFEA 1VFHA 2EGZA 3SGUA 3K30A 1O5RA 4KFPA 4X63A 4ZBCA 2DIKA 3LSCA 1SMAA 3WJZA 1QWKA 3KBWA 4EXBA 2QAPA 3GNOA 3TMQA 1ZJBA 5HUPA 3EX4A 3QMRA 1G94A 3MYOA 2PZ0A 4E8GA 3FXGA 4LPCA 2J77A 2HXTA 1JG9A 3EOOA 1FDJA 2GL5A 5AC4A 3HA1A 3CQHA 1UZ1A 4G6CA 3PZTA 5AYYA 5HWNA 2XU2A 1N82A 5TF0A 3LCFA 2WSRA 1XPYA 2SFPA 4CVWA 2OFJA 2YXXA 2FZMA 1UIPA 3LPOA 3REQB 1XLDA 5A69A 3W72A 4CEUC 3BLDA 3HO8A 1G01A 1O5KA 3YPIA 2X1UA 3H24A 1EDQA 1H7XA 2I5GA 4GXWA 1MWOA 2CZFA 2CZ5A 2GVYA 4XBKA 4CQ8A 5C7HA 4HHHA 3ABRA 2DDXA 3QZAA 4O57A 4DM1A 3ZVIA 3PPCA 5AOUA 3LA4A 5G1TA 3WQ8A 4KEUA 1ONWA 1FWRA 1V0KA 4JPGA 2VGBA 4E5TA 4NJIA 2PRLA 4W93A 3MP4A 2PI6A 2PWGA 3G3MA 4UB9A 3TSDA 2OOGA 3WEZA 4WR3A 2GDVA 1E51A 1SMDA 3CAKA 2Q71A 3KLLA 3I6EA 2CLPA 4BQ5A 1A4MA 2H6RA 2GJXA 3IJ8A 1CZ1A 2DORA 1UD6A 5M5DA 5C8BB 4GG9A 4ZMGA 1BVWA 1TRDA 1VFOA 1F76A 3O8AA 1EQCA 4KKXA 3VD4A 1IEXA 2BXZA 2VCCA 5CBJA 4C1NA 3WL0A 1ZP4A 1AMKA 3C56A 3AZSA 3DFYA 4KWVA 5HMEA 4FP1A 4L7ZA 3OHIA 4ZO7A 1FCBA 4URIA 3FHAA 1GQIA 4LWWA 3MCOA 2ZYFA 4NUWA 3AS1A 1VFLA 1BQCA 4NZ5A 2HS6A 3T40A 2AGTA 4FLSA 1P43A 1DJQA 3OBKA 3QLLA 3VIIA 4DBDA 4GFIA 2INFA 4ZR8A 5LIXX 3EDFA 3G0SA 1R2SA 5KTLA 3BJSA 4Q7NA 3GHSA 4XZHA 3CASA 1BSIA 4AC7C 4PFHA 2ABAA 4DJEC 1OT2A 3KZSA 5DY2A 3GVQA 3FOKA 1EZWA 1YE6A 2XJ7A 3H26A 1MZHA 1E4NA 5REQB 5B7ZA 2WMHA 3LRKA 1MI3A 5F4WA 4OBRA 4L6OA 4RE0A 2VEPA 1ME7A 4IX0A 4UQDA 3PULA 4WJEA 2NLYA 3RITA 2PAJA 4WGXA 2WBGA 2VR5A 2JALA 5EFDA 3VIMA 3H2CA 1CT5A 2QJMA 4IISA 2CLEA 1IXQA 1JCJA 4GNJA 5HMDA 3WH6A 3E0FA 3S1WA 2REQB 2OKOA 1F4HA 3NCOA 5HAOA 1IIGA 3L2IA 2R6OA 2WMKA 3M5VA 5CC6A 1P0BA 3BWWA 2YCLB 4RDYA 3THCA 1ICSA 3FW6A 4CQ9A 2R1MA 5HPOA 3PR2A 3W7IA 4GX9A 2GLKA 2G4FA 5AYBA 3JU2A 3AALA 4DJFD 2OT0A 1JDFA 2JKEA 3KS6A 2BOGX 2YA0A 3N4AA 3C2OA 1EGMA 3BAKA 3NFUA 5J5RA 4XIAA 4C6PA 1SVDA 3N29A 1T40A 3WLQA 2YGYA 1B0IA 4IJCA 2J7HA 4S23A 4J3UA 3BAJA 1ZL1A 3CL7A 4JIPA 1DIKA 2YOCA 1FCUA 2PWFA 1FHVA 2QJNA 1M01A 1FWNA 4O52A 1NOFA 1TWIA 3ZJKA 4AY7A 5B7YA 3AU2A 3W25A 5IFTA 5EBUA 1H7PA 2YCKX 3G77A 4BEUA 3PG9A 2DH2A 2VFGA 4B4FA 3TROA 4KGJA 1JNEA 2IXUA 2WOQA 2WMIA 2ICSA 4Q22A 5C55A 3R1ZA 2OT1A 1UD4A 4DI9A 4GCXA 1S1PA 2QCEA 3NZGA 1FKXA 2WWCA 3K8MA 4PSPA 4XB3A 5FIPA 4OOZA 3W2MA 4XQ6A 3AXMA 1LBFA 3KRSA 1QCWA 3OPSA 2PUZA 3NVTA 2PWVA 2FZBA 3JR2A 4FPSA 1XDMA 2P53A 2VZSA 1XYMA 1FWSA 7ENLA 3GKAA 4N7QA 3N2MA 3IJQA 1U30A 1AD1A 2J7EA 2C79A 4O11A 3BCDA 2PZNA 1YPFA 4S3KA 4HNOA 4DJDC 2DQWA 3N6HA 2WKJA 1RCQA 3UT0A 4HN8A 3EDKA 3LM3A 4HBKA 6TIMA 4LANA 3UXDA 1TJ0A 4J2MA 4EE9A 2CCRA 3A3HA 1XLFA 5E6YA 2V5KA 1S2CA 4DF2A 3GVWA 4JTRA 3N17A 2GZXA 4FB7A 4L6HA 2INZA 2BVDA 3GR4A 1U1HA 1RBOB 2GUYA 4JNZA 4N4PA 3GIQA 2NX3A 2AAAA 6A3HA 2E6DA 1JDCA 1FA2A 2QMKA 4ZQPA 1SJDA 4WLCA 2CZDA 3UNDA 1CGTA 1X6NA 3NDYA 1UD2A 2OJPA 3OGSA 2X1TA 4LUJA 4Q4RA 3E6EA 1C9WA 4JEQA 1TV7A 3HQ1A 3SUWA 2PLJA 1XIJA 5DBTA 4BKNA 4NJHA 1V02A 4NKCA 4WVXA 1RQHA 4R3UA 5TD4A 3VMPA 2YL9A 1QJWA 3DDMA 1G69A 1R3QA 3K2GA 2WB5A 3C3NA 4XAZA 2G50A 3TTEA 1TJRA 3O6CA 4W8AA 3WJWA 4C6FA 2WMJA 3H2NA 3L0KA 4UTMA 1FWIC 4DWSD 3PZQA 3IVUA 2HISA 3RU6A 1BKHA 1PEZA 2FTYA 3RG6A 1UASA 5BRQA 3QZEA 5AN7A 4HU4A 3BLPX 3UCQA 3WQWA 4W4QA 4U5KA 1L6GA 3MHGA 5GPRA 3ITVA 4PBGA 1JULA 4K8GA 1CTNA 2WW5A 3LGEA 4C5ZA 1ODZA 1OT1A 1OFDA 2X8RA 3K1DA 1LLOA 2RDXA 3GAYA 2X2GA 2X7WA 3M0LA 1C90A 3VINA 3L4XA 4CQAA 5CLWA 3DIPA 2VHLA 4GBDA 1A0DA 3ORWA 4DXKA 3VCRA 3SW6A 1AL7A 2FH8A 4G5DA 3A4JA 3F5KA 3FA4A 2WNWA 4GXMA 5E70A 2WKLA 2QCFA 2WLZA 3QQWA 2Y2WA 4UBPC 4E4PA 4QAIA 2D0HA 3ZSTA 3VNMA 4DWDA 1EO7A 1W3IA 2X0HA 2D1ZA 2VD8A 1Q6DA 4NZFA 1W9XA 1VRXA 4B91A 2WLYA 4GINA 3KDOA 4NJGA 3GKFA 4ZXOA 4A6GA 4QG6A 2V2DA 3GLCA 2HV5A 2JGYA 3O1NA 1I9CB 3UW6A 3B8WA 3ABQA 4WOQA 4MFEA 4JQ4A 1WPCA 3N6JA 1XC6A 2XVKA 2DUXA 1HJXA 4L9XA 2OOFA 2Z7GA 5EL1A 3MWAA 4XZ9A 3DI1A 3ARWA 2ZXAA 3BLFA 4QAWA 4ZFCA 4ZSUA 2C1IA 1AH3A 2J27A 3CM4A 4CCDA 3MKCA 2ATMA 2QR6A 1T0OA 2QUMA 4LJ3A 4WXYA 4D9PA 1XYBA 2EPOA 3PC0A 3SADA 3M4HA 1J12A 3I4KA 4GYPC 3IGSA 2E9BA 1UZHA 5GJPA 3MANA 1ITQA 2BVWA 1PHQA 1SUXA 3M5YA 1PTAA 2IQ0A 1R30A 2WMGA 4KGLA 4S2BA 4ZQMA 1CPUA 3NTYA 5HBFA 2RGMA 4KF1A 3UWWA 4JS3A 2YBUA 1KBLA 3B4YA 1ZUAX 2V3GA 1DWHM 3UG3A 5EYWA 1JYNA 3MVTA 1R6WA 2C3ZA 1KGXA 1XGEA 1ONEA 3HMCA 3TIMA 4FHAA 1H7WA 3CQKA 4QE4A 4RPQA 4NI3A 1TV3A 3DESA 1D8CA 4ECLA 3BARA 1A53A 4EANA 4HQVA 1ME9A 3TR2A 4GVFA 3ABOA 2ISDA 1B9BA 2FTWA 2V9DA 5H6HA 2G3FA 1UA3A 1MDLA 5HANA 3GC5A 3SCTA 3BLLA 3W7PA 2DV0A 4IOTA 1HP4A 3GXNA 3EXTA 3M5ZA 3LTYA 1W5OA 3IIXA 1Y5VA 2PODA 3M41A 3DKJA 5DQPA 3MPGA 4F3HA 4V1YA 3O2LA 2RHGA 4TIMA 2XWEA 1UJQA 2PFHA 1GPWA 4YCPA 1I1WA 3W01A 2QT3A 2PDNA 1SFTA 1Q6FA 1RA5A 4LSBA 2EO7A 4IGSA 1L6YA 3TC6A 4B5NA 4DWSA 1WDDA 4Q8MA 2BXYA 1ISXA 1R9ZA 4NIRA 3RRXA 2XYLA 3LQLA 3SCQA 1OC6A 1UW9A 4YL2A 3E2SA 4H00A 3VGGA 2FKPA 1BG4A 1EP2A 3ZQ9A 4UQBA 2C6QA 4JTAA 5DMMA 1V4YA 2FIQA 4YPJA 3UZZA 1KFWA 2XISA 3GSMA 1GTHA 3MMWA 1XLAA 2V81A 1VJZA 3S2CA 4LUIA 3TC7A 2XN1A 3O7UA 3W00A 4GI9A 3VD3A 3B8SA 4C65A 4GZ7A 4JICA 1HKMA 2W66A 3DGBA 3VIFA 2X0SA 2TPSA 5BXPA 2J88A 4GH3A 1ZZMA 3ES7A 5DRIA 1JDAA 1NDWA 2PF8A 3W70A 2BMBA 5AHLA 4YJ5A 1CB7B 3VGBA 4PMDA 1I2NA 3RUBL 4GJJA 1V7YA 2XZ9A 4NJJA 3CIXA 2AQWA 3WQEA 4UZUA 3G1VA 1QI3A 3DBNA 2IW0A 1NU5A 4DEFA 4QLKA 2W4XA 1XGDA 1FH9A 2VZTA 1L6WA 3VKKA 3E9AA 4FZIA 1PKMA 2BBFA 4AC1X 1AMYA 4XD5A 4LBUA 4YTTA 4PL1A 1E4LA 3GYEA 4ZOBA 1BYDA 4EOUA 4ZB5A 3P5YA 5FI8A 5FACA 4FR1A 3U7VA 1YLVA 2HZGA 2J47A 3BXWA 5D33A 4W5ZA 2IQDA 1TZZA 3M64A 1C92A 2QIIA 1ML1A 2XN2A 3H21A 4Z1CA 5JXQA 1WXYA 2BB0A 1F05A 5K4XA 1XUUA 1VENA 4F2TA 4GABA 2ZRVA 3UCCA 1IYXA 1I0DA 1QUMA 2QHAA 2Y70A 3CUFA 5BXRA 3L4VA 4GI4A 5CPSA 5FKYA 3K4AA 1Q6QA 2XN0A 4UQAA 1D9EA 3WNMA 4POCA 4MB3A 5TNVA 3AS2A 1OD0A 1CLXA 4MLRA 3UVAA 3S5YA 4IFOA 1CBGA 3GDLA 1F6YA 3QV9A 2QAFA 4CN6A 3DENA 3W85A 4IIHA 5K9XA 3PJUA 1J0KA 2ZRUA 3V1HA 4UUIA 1M7XA 2PC4A 4DXVA 3S5ZA 2OYLA 1E1CB 3DECA 1A50A 4IIDA 3UY7A 4ML4A 1GONA 2CU0A 5C71A 3A22A 4CD6A 5C9WA 1XIMA 4HPHA 2WK2A 1K8YA 1PX3A 5AHIA 3WDRA 1EGVA 2BV9A 1V93A 1SM9A 3PPGA 4H2CA 3TJ4A 4QP0A 1EIXA 4CNOA 8TIMA 4C91A 1OYBA 4KPLA 5JUVA 2J25A 3EEZA 4TX8A 1VB9A 2WWDA 2Z0IA 3KL5A 5FEZA 3CBWA 2ZTJA 3U0HA 3W07A 4MWAE 3IV8A 1J4EA 2VOMA 4GUFA 3TNOA 2P88A 4GQRA 1MXSA 3A4WA 4I7VA 3EDDA 1B1YA 4LOCA 1K6WA 3H22A 4NNCA 4U2YA 2VRQA 3H23A 4WCJA 3GD6A 2CETA 4PCNA 3BV4A 1I75A 1LT8A 5I3DA 1QOPA 1W5MA 3C2FA 1LQAA 1RJPA 4ZO8A 3KHDA 1KRAC 2VCAA 4PUNA 1A3WA 3VCCA 1HL9A 1PV8A 2WZHA 3CEPA 4MMWA 3W26A 2NUWA 1OADA 2XM2A 3TYDA 2YW4A 3EB4A 3FNDA 4FK9A 1QPKA 3SB0A 3LCGA 1M68A 4DPQA 2FVMA 2PLCA 3WD0A 1P48A 5CJNA 5DT5A 1A5UA 3GDRA 1WP6A 5CZKA 5CEWA 4DLFA 4DBSA 4RV8A 5MKGB 2BY1A 3ANUA 2Q01A 5EY5A 1JF6A 3UNTA 3VD5A 1UR2A 2BVYA 3GTXA 1WX0A 2JQXA 4IIFA 3VOHA 1ADDA 4A8RA 4CNUA 3GX9A 3LB0A 2BGQA 4L1XA 1WOAA 4LNYA 1F5ZA 1SW0A 3BLOA 1TZ9A 1EB3A 1TPB1 3OTRA 2F6KA 5I78A 4ZVJA 1U1UA 2QV5A 3W27A 1VYSX 2D22A 1BEUA 2FVLA 4AZBA 2J75A 3GZAA 4J27A 2PDUA 2D2JA 4Q8NA 1FH7A 2H90A 3NSNA 4MZ1A 3IGUA 3GC4A 3MUCA 3NQEA 4AZ5A 1W9PA 4YN5A 2JKPA 5D32A 1H09A 4R7WA 4MKSA 4MKNA 1IWAA 3SCVA 3G3DA 4D6EA 5G4EA 4FX6M 3WCZA 4EAYA 1EEPA 2RKXA 1HXJA 3COTA 1NF0A 3N2BA 3V7PA 1UBPC 2A7PA 3GZ3A 2WZMA 3EX2A 4BR1A 1E1FA 2Y89A 3VPLA 2A3AA 3KVLA 4I9JA 4Q4KA 1MNSA 3WF4A 3F03K 4JZ5A 4FIRA 5FJPA 2E3ZA 3OU8A 1IR1A 1K7EA 2RFGA 3BZJA 1LYXA 5IHSA 1XBZA 4GUHA 1FRBA 5CH9A 4HMDA 1UD5A 3HGRA 1ITXA 1BRLA 1EL3A 4MDOA 8XIMA 3KL3A 2DZTA 2HNHA 4UIOA 1EC9A 1S5VA 1RK6A 5G2HA 2R8WA 3CK5A 4A2RA 3C2VA 5HK4A 3VIPA 3POHA 3AMKA 3GH5A 2W9MA 1Z89A 1QPRA 4FLQA 1US0A 4H9MA 3A5FA 1XDJA 1HT6A 5FJUA 4ZODA 1HJWA 3UPBA 1FY6A 1E0TA 3NM3A 2RJGA 3P74A 4FNTA 1V03A 1TPVA 1H41A 3N11A 3UJEA 1AVAA 3H4XA 5E09A 3UVIA 4C1NB 4A8NA 1I1XA 2BFGA 4GKLA 4PB5A 4NJKA 2BSLA 5CBBA 3CPUA 5EMLA 4XZMX 2GK1B 1J2BA 3E3HA 1DHPA 4M8UA 3CMGA 2GVGA 7XIMA 1UR1A 3GAKA 1RHCA 3OB8A 3AI0A 4RPPA 2I1OA 3EWUA 4ZB0A 4M24A 1DORA 4WX2A 4XO7A 1EDTA 3T05A 3DC0A 1YXYA 1RPKA 3S5SA 3C4UA 4BF5A 4LXFA 2XM1A 1U5HA 2OKTA 3HPSA 1QAPA 2WO5A 3L68A 3PFRA 1XL9A 4MF4A 4I9TA 4O14A 3B9NA 1I4NA 1LTDA 4HN4A 1EXBA 3WBEA 1GOKA 1R2RA 4HYWA 3QN3A 3SEPA 3TYAA 3JW7A 4HMEA 3BAWA 4A3YA 4UFMA 5MKGA 4G8TA 3UYIA 5KSWA 2J9YA 1LQ0A 3BQ5A 4PUDA 3PP7A 3CZJA 1RXOB 1OQFA 1B57A 5F7UA 2W0UA 4IP5A 4B5VA 2XFRA 3SJNA 4H7ZA 2I17A 3DEQA 3F5JA 5BOOA 2VVSA 4Z2JA 1DYSA 1XH0A 3CB3A 2J8FA 5DXYA 2X2YA 3KVMA 3ARTA 4MKVA 3DFTA 3DZ1A 2BNJA 2ZZ5A 2PP0A 4C1LA 3DYMA 5BNKA 5HQMA 4Q8PA 2PMQA 1UBSA 3O06A 3P82A 4PUJA 5HINA 1E6QM 3NXFA 3WLTA 1Y7VA 4LAZA 4D2JA 1UUQA 3P62A 2OWCA 1F07A 2QNEA 1HVXA 2CXGA 4DNMA 2WM1A 4NYYA 1AZ2A 2O4MA 3Q45A 1UWSA 3TN3A 1T96A 4MZ8A 3RO8A 3LCLA 1FWDC 4F0MA 3HQOA 2QF7A 3VKAA 4C90A 3KRBA 4YTQA 5BZAA 3HPAA 3LTPA 5AC6A 4EVZA 1K3UA 1WOBA 2H3DA 4KEZA 4AEOA 1CGUA 1M5WA 5FF4A 4M1RA 4GVIA 2PU1A 3PM6A 1QRQA 1DJZA 1XFBA 2RGLA 4HNNA 4DNHA 3FA3A 3W87A 3NL3A 1Q7MA 4UOQA 4ZSTA 1LBLA 4GYPA 3BAIA 2G3JA 3VKJA 4JFWA 2PDBA 2QVHA 3LLXA 4QFUA 5DRCA 1JRBA 4NAFA 3W74A 4TVUA 2E9MA 2JK2A 2PRMA 4HNLA 4NAEA 3W22A 1DIEA 5A94A 1PYMA 1J9YA 2O0TA 3P14A 3OVPA 1EGZA 2CZEA 4DPPA 4AIBA 1UMYA 4MJ4A 4O1DA 3QW3A 5BU9A 3W3OA 3MJMA 1GZ1A 3HV8A 3U2CA 3WLKX 4O15A 4OUIA 5CPMA 3SZ8A 2CC0A 1LLZA 3OGRA 2XFFA 3RFAA 4S3BA 4CQBA 1VAHA 4AQLA 4QTGA 3GBDA 1FVPA 4IP4A 2QYGA 1ZALA 3SCWA 1EKOA 2A4AA 3G1YA 4X9SA 4FF5A 1PKYA 3O6DA 3IS4A 3WF3A 2OODA 4L56A 1E6XM 1P0KA 2F2KA 5J04A 2ZE0A 2VZUA 1M7PA 2NVCA 3QVQA 3H6OA 4PMJA 2XINA 4ERAA 3ZOAA 4OECA 2ZVIA 3MSGA 4F4RA 4Y96A 5C2XA 4C6IA 5G2IA 2YB1A 4WD0A 1GW9A 1XBYA 3H12A 2A5HA 2XGIA 3QLDA 3TAKA 2Z1VA 2OQHA 3R10A 3W88A 3DFPA 3MZ2A 4K7YA 1VPQA 4P7QA 2L5HA 1XLJA 2W91A 4LX4A 4AFYA 4XD4A 1ADOA 4AIEA 5A8PA 1KXQA 3B9AA 1GYLA 4LCRA 4YHEA 4TX9A 3T9PA 3LXCA 1O60A 5A2AA 3W6YA 3W2JA 1JQVA 2QUUA 4OBTA 1VJSA 4CNTA 4PTDA 4W8BA 1R38A 2FGZA 2ISWA 3SUUA 1GKRA 1A5OC 1VEMA 1ZGDA 2JIEA 1GYMA 3K46A 3WF0A 4XAYA 4QJ3B 2V5BA 2Q02A 3QV6A 3TDFA 4H41A 1P0EA 4OVXA 2PGWA 3NGFA 1UKQA 3AHVA 3TH6A 3WQ6A 3M0VA 5JVLA 1Z7AA 4MPQA 4LCQA 3KCJA 4PMYA 2YYUA 3PTQA 1EJTC 9XIAA 1K7FA 1FX6A 3G0UA 3TA9A 2W27A 3RX2A 1E4IA 3BUVA 2NT0A 1TZ7A 4HZ7A 3PBWA 1B54A 3TCEA 4O17A 2XIQA 3LZ5A 2G97A 4W7VA 2OPJA 3PFMA 5HPCA 3RGTA 3QC0A 5I02A 1OY0A 4QLJA 3IARA 3VOIA 1DWIM 3LMZA 3H4WA 4YU1A 3ZR4A 1RV8A 2EPLX 2Q6ZA 1FWTA 3AMGA 3GHRA 1JDEA 3CO8A 4U31A 3C2EA 4JCLA 4YXGA 3LNPA 1VZWA 3L66A 5I3GA 1XIBA 2WKGA 2ISFA 3VC5A 1F8IA 2YX0A 4NT0A 1HG3A 3OVGA 1GNXA 3TN6A 5IFPA 3LENA 1A5LC 3MUIA 1RLCL 4HA1A 1DXIA 4C5YA 1F6KA 1WAWA 4QGCA 2CZVA 4PCSA 5CJMA 3KRUA 3SUVA 2UBPC 3UWZA 1BRLB 2GK1A 4UFIA 1EWEA 4ACZA 4QROA 4MB5A 2VURA 1AK5A 1H49A 1MW0A 2PWEA 3K4WA 2DSUA 1CXLA 4N0RA 3PUGA 3WBYA 3KOWA 4PGLA 1AG1O 1HFBA 4L4LA 4P7OA 3W2UA 1H61A 4AD2A 4KWSA 1C8YA 1GG0A 5FEPA 4ADTA 5C2GA 4I3GA 3FS2A 4WSKA 4YVXA 3GC2A 1XLLA 2HPMA 1VBUA 1R3RA 3THDA 1IEWA 1TIMA 2J9XA 1PE1A 4J3TA 3CB8A 2WJZA 4L65A 4M5PA 1GGOA 4JYEA 5KEZA 4H8HA 2CLHA 2X1RA 3GNDA 3MWCA 4LGXA 1BYAA 2PDGA 1KFCA 5EMMA 5C7VA 3CL8A 4OKDA 3WBAA 2FMNA 1YADA 1DJWA 3EMQA 1P4CA 2Z6JA 5FL0A 4E4FA 3GVVA 1JYVA 2AKZA 2ZDRA 4GYFA 2OLSA 1Y5WA 3VGHA 3W23A 3U5YA 5DANA 4HU0A 4S3CA 3S1VA 2I5QA 3FSUA 4NG3A 1TR1A 2CERA 1GCYA 3W9ZA 4B16A 2FH6A 1J5SA 3MB9A 4IPJA 1R86A 1MW1A 5I2UA 4LC8A 3LUTA 5LA0A 5CBIA 3DAQA 4GD0A 2PPGA 1KM1A 1UR4A 3IK4A 3WH5A 4QXIA 2CLKA 1OYAA 3KCLA 1WKDA 4QIUA 2XFYA 4JQAA 2VQTA 2P50A 3LXAA 2PB1A 3I4EA 2WHJA 4IUOA 1TVPA 3KP0A 3UBPC 1ELSA 4ZGYA 2DZXA 4JTGA 3EWCA 4UTIA 3O3RA 2HSAA 3D6NA 4RL3A 3R25A 4E2OA 3GDTA 4L61A 4PUWA 1PO9A 3UXLA 3CZEA 4C60A 2GSEA 6XIMA 2AKMA 3O6YX 5A5WA 3C5QA 4P7LA 1JCYA 3GBEA 2DT1A 3OLDA 2ZFAA 1JAKA 4Y9OA 1QI2A 3QHNA 3EYPA 1NSJA 2JFEX 4HSNA 2O55A 4H4IA 4UMAA 1TVLA 5EBAA 5IDZA 3G1RA 4LV4A 3W29A 2EXOA 2I5IA 1B2YA 2XIOA 3TYZA 1W0MA 3GS6A 1UIOA 2FB2A 4JYFA 1L6FA 4DRSA 3B4UA 3E49A 3UXAA 4NZJA 3LU2A 2C18A 4J28A 1WZAA 4JAWA 1G67A 4J3VA 4MJ2A 5DMNA 1CWYA 4JX6A 3WBWA 3AIEA 3NQDA 1GOOA 1LWIA 3SGGA 3MDWA 1K9EA 1ZSXA 2HVMA 3DBPA 2DVTA 2OGJA 3NURA 4BY3A 3KW3A 4C6NA 3R58A 1GHRA 5PTDA 1TCDA 1GG1A 4I5XA 4QJ1A 3UWQA 4NAEB 4W5UA 2OZTA 2VC5A 2WXDM 5JH1A 2XG9A 1G5AA 3P93A 4LEQA 4D6GA 1PHWA 3QHMA 1UA7A 2PDHA 4YHGA 1BXNA 2C14A 3KL0A 1OCNA 2VC6A 1LL4A 3GU2A 3CV6A 3W75A 4FI4A 3F4NA 2B7OA 1JCNA 1V77A 2JGQA 2ZKMX 2FHBA 3F2DA 2PTZA 2GWNA 1K6AA 2AL2A 3BOLA 1L2UA 3AS3A 1Q3NA 3WK0A 1QNVA 5HXMA 3ZJ7A 3LNMA 3TWBA 1FCQA 1WYIA 1TUFA 1SO5A 4JTCA 4BQ3A 3B9EA 4LUTA 3RAOA 4W8LA 1JPMA 4K39A 4ASTA 3LTSA 2OLHA 4ZA0A 4MAVA 1R7AA 5HQEA 2XGBA 4A3UA 2VJXA 4KBXA 4MOZA 4WY0B 3EDEA 2BHYA 3C0QA 3UZWA 1LZOA 4O1FA 4LALA 4ZE5A 1ZTVA 3EBVA 2WSKA 1HQTA 5E0CA 4D6DA 4OQVA 4R7OA 3SBFA 2QPSA 2FQIA 4ADUA 3BPWA 5BRBA 4QX4A 4L4PA 3EZ4A 4XAPA 1C7TA 2ESCA 2QJIA 1R7OA 1V08A 4J3WA 4NYUA 4YTSA 1ADSA 3VGFA 6REQA 2DZWA 2ZRWA 1J18A 3UGRA 5HNTA 3T07A 1SJBA 3VNJA 4E0CA 2OEMA 3LZ3A 3ITCA 3W71A 5JBFA 2WCAA 4BQ2A 3PUOA 1GQJA 4J2PA 2XHYA 3PJTA 2GJRA 4HJWA 1JGMA 3MQTA 5LHEA 2VCBA 1WCGA 2EQDA 3WQ4A 3ZR6A 3LYEA 4XSMA 3TONA 4A2SA 4AEFA 2OELA 2FFIA 1ZJHA 3W83A 3H53A 2NV9A 2OSWA 3VI2A 1TWWA 1X8CA 4LVDA 1UPMB 1XYLA 1V6UA 2G95A 3TX9A 4FA3A 1BF2A 3XIMA 3VOGA 3QY6A 4HK5A 3NQVA 4DYKA 4AD4A 1WKEA 1FWAC 3FJLA 4C6OA 4P2VA 3NWRA 2V63A 1N8WA 1XH1A 4H9YA 1FXPA 2ATSA 2UY3A 1RALA 1R3SA 3KLKA 4ZO6A 2DSWA 3IIVA 3OZMA 3QKZA 3RF9A 5J8LA 1GKQA 4UMBA 1HJSA 3WBXA 3PPHA 3EB2A 4X61A 4TVDA 4KWWA 3Q4DA 5GJNA 4JTEA 4JL1A 4LUYA 2VWSA 5IHRA 3EPMA 3H55A 3A4XA 3G1DA 2WNZA 1T8XA 1DTNA 2EG8A 1VEPA 3NQAA 5FD0A 4B3LA 4MHBA 1CENA 1TJ1A 3S1XA 4EKJA 1BFNA 2BDQA 4U28A 1VD6A 4IWWA 4LS2A 4MWAB 4F2UA 5BROA 3URAA 4GZIA 4PA8A 4S3EA 1D3GA 3GB6A 2YL5A 3N2TA 4XWUA 2JE8A 3VK5A 4CN4A 1RR2A 3IJ9A 3R6IA 4DM2A 3LLFA 5ABHA 7CGTA 4HPNA 1XFCA 4QE5A 1SZFA 2PTDA 1AQHA 1MQRA 3WK2A 3RNDA 3ARYA 1Z41A 2C0HA 1V79A 1ZB5A 1W91A 3PSWA 3DFSA 3A12A 3II1A 5AYIA 4Z1YA 3E5PA 3L4UA 2Q8LA 1YXCA 3N9KA 3CT7A 3ATYA 4CD7A 1GYNA 1YE4A 2MANA 2QCLA 2X1SA 3L2LA 2QDGA 4DYEA 1XP3A 4O16A 5DO8A 1EWDA 3KRZA 3MSRA 1VBGA 4HU3A 4AF0B 1Q6GA 4CU8A 3G1AA 1WBJA 1DQWA 1E0UA 4JDBA 2GJXB 5LNRA 3VFLA 2PDQA 3L12A 3CPGA 3BLIA 1BWLA 3R2GA 2Z26A 4NZ3A 5D8WA 3W7QA 3C2RA 3N1AA 1M9HA 1F3EA 3ITXA 5I23A 1O1ZA 1DL3A 2QEZA 4KS0A 4O0ZA 2WNNA 2ASHA 3FK4A 4NZ4A 3ARXA 2LLEA 3M6DA 3TQ0A 4Y9AA 1FDYA 3QFEA 1I6NA 1XR2A 3V3WA 1W3HA 2QCDA 3WNKA 4MLJA 1BYBA 1L9WA 3VDHA 1OF6A 2CIPA 4AZCB 2A6LA 1V6VA 1TREA 3TTQA 5LXXA 3GNNA 4DB7A 1NJJA 4ML9A 2DSVA 3HV9A 5GVJA 2E4TA 3W02A 2EAWA 4KFNA 3NAVA 1DIOA 4QITA 3SO7A 3RYSA 1M65A 1JXKA 1SSDA 3RU8X 1H5VA 4XV0A 4G1NA 1E73M 3O6AA 3IACA 3N9SA 2QF8A 3BQ6A 4JTFA 2QXWA 1F3XA 2J8GA 3MTWA 4M19A 1KBIA 3S1UA 4WF7A 3FVMA 3S83A 2VI0A 1POJA 5I06A 2JEQA 4X0NA 3AHYA 3NO1A 3GXFA 3B9DA 4MB1A 3HPZA 1GTEA 3J7HA 3O05A 4PH6A 5I5RA 3ZT5A 1AUSL 3TZNA 4PCTA 3R8HA 3WMCA 1LG1A 2VDIA 4KWOA 5AVHA 5AC5A 2GGHA 1KQZA 3HGOA 2GQ3A 3NGJA 1VCFA 2QJHA 3MUXA 4D6HA 2P8BA 4QS5A 3ITYA 3F1QA 3WD2A 1XCFA 1KWGA 5IRPA 4LVFA 4A3RA 1VLIA 2IQTA 4ERIA 4DXXA 1OGBA 4ZO9A 2ZE3A 3P84A 2C13A 3ANYA 3ITTA 4EPBC 4RZBA 3TJLA 4PTMA 2VYOA 1VIWA 2V5JA 3GY1A 4H9XA 4OUEA 2DSZA 2VP8A 3NQFA 4KH2A 4AZHA 3UG5A 5KINA 1OX4B 2DPEA 1OVDA 4GIAA 4BK9A 4ACZB 2PP3A 2Y5EA 2VFFA 1RCOB 2QDDA 3AJ7A 1JYXA 1JIBA 4UFJA 4ONVA 1H1ZA 2WHLA 2QS8A 3KS5A 5D04C 3PY2A 1FWCC 2DZSA 4JY9A 1AFSA 1H51A 3S2JA 4BWLA 3SN4A 2B0MA 1O7AA 4PRWA 4PMVA 1XSJA 4KEVA 3NL2A 3W6LA 4GO9A 3LCWA 3P5ZA 2A85A 4JIQA 3PZOA 1PBGA 4LUSB 3MP3A 2XTKA 2DP3A 3R8GA 4LEFA 4AIUA 1DTUA 3EX3A 3ARVA 5CJ5A 3LPPA 2AGKA 3BJFA 3GIPA 3E5BA 3KOXA 2C8NA 4EWJA 4IMDA 1F9CA 2VRKA 2VENA 4YWIA 3K5XA 1YDOA 3NNTA 3W4RA 4M82A 3OG2A 1NFBA 3VCNA 3FGCA 4ALDA 3MI3A 5AYZA 2V5CA 3TCSA 3M47A 1RAKA 3NO3A 1RH9A 4B9YA 3BG3A 3H7RA 3WMLA 2Z1SA 3UPWA 5T91A 4F9JA 3WNNA 1PL9A 3TKFA 3JUGA 1SW7A 3D3FA 1VCGA 2IS7A 1X8FA 2GVLA 2A1YA 3DC8A 4E2BA 1KM4A 4OFCA 3RM8A 3W28A 4S1FA 3PBMA 1NOUA 4FOUA 1S38A 1PZ0A 1KGWA 4PODA 3W84A 1OCBA 5K4ZA 3TYEA 4E8DA 1U1JA 3WD3A 3NVDA 3W53A 2W79A 3G0XA 3ECQA 2DFAA 2QGYA 3BCFA 3N13A 5I07A 4J1OA 3ZS4A 4ZL1A 4H9VA 3CAVA 2PWUA 2Y63A 2D2OA 3SECA 2WCSA 3W7MA 2Z00A 3LCXA 3WUEA 3PK7A 4B5UA 4XBSA 3OJGA 3N73A 4E4UA 5HUOA 1VFMA 3EXRA 2ZC8A 1VFUA 2WYSA 1WXZA 4QDMA 3NZ1A 2TYSA 1QO5A 4K2SA 1LT7A 4AH7A 2WJFA 1IQ8A 3RCNA 4O4VA 3PHAA 3RR1A 5FEWA 4GFSA 4CNSA 1BD0A 1ZAHA 3NZPA 4E2DA 2DT3A 1XIIA 3GFXA 3LHWA 5E9XA 1OZQA 1RD6A 4QR6A 3CUXA 3PUDA 1LUCB 6ENLA 1JVNA 5DMLA 1AL8A 2R82A 3R89A 4RNHA 2VEMA 2YL8A 3WG6A 1UQZA 1UZ4A 4IL0A 2BTMA 1UWUA 1UKTA 1BLIA 3GTIA 3OLGA 1VC4A 3S9ZA 2VFDA 5LHFA 4HNUA 1AW2A 1IEQA 3LHYA 1K8XA 1EDGA 3MW7A 3OZOA 3SM0A 3B05A 4R9OA 1ZBCA 2V67A 1EYWA 3LPFA 3IJDA 1OFOA 1HKVA 2W62A 4K37A 1V3HA 3ARSA 1UKOA 4WQ6A 3MV11 3U8GA 2VD9A 5LGXA 4Y8EA 3KDNA 3NIYA 1YEYA 3LXBA 4KCVA 1QK2A 2GUUA 3M16A 2YJQA 4O1BA 4NZCA 2XH7A 4M6PA 4W7UA 3L65A 4YYFA 4BZYA 4AF0A 4WK9A 2E9LA 4J7RA 4Z0JA 4GIEA 3L5AA 2AMXA 4UTFA 4AZ7A 3MMTA 1DJIA 2C1GA 3ABZA 4OJYA 3EWDA 4ZQRA 3NQGA 2D2GA 3O16A 4RDZA 5IXEA 3HJZA 3NA8A 2E68A 2QDEA 3E02A 3W1RA 1IEIA 1AJ0A 3LGGA 4H2HA 1MUCA 4OTKA 4WZHA 1FDZA 1JFHA 1UP0A 2VX7A 3V16A 2POZA 1PS9A 1RVGA 1MW3A 4UOJA 3NPUA 4WHBA 1J8VA 1K70A 1W6TA 2POTA 1LLWA 4IPPA 3IIZA 3KBMA 2RDWA 4A3HA 4MG4A 3S46A 1PDZA 1KR1A 3RHGA 1W31A 1JRCA 3QY7A 1A0EA 3PWIA 1XWYA 1EC8A 3FLUA 1V6XA 4RCXA 4L6DA 4LRTA 3PBUA 1EYEA 1IF2A 4HIBA 5D37A 1T41A 3NEVA 4UTTC 2WHMA 1UG6A 1NEYA 1X39A 4HD5A 5HNUA 4TV5A 2BOEX 2RUSA 4XSLA 1WE5A 5TIMA 1A49A 1DJNA 4HZMA 1MRQA 3HMJG 4ZTXA 3GVRA 1A5MC 3H4GA 1O6IA 4REQA 4AG0A 4HHPA 5CAKA 3RCMA 3WELA 1SO6A 4FNUA 1XH2A 2PDYA 4RE2A 1K9FA 4CNPA 2FPTA 1DIDA 3VDCA 4PN2A 1X6UA 4PEEA 3EPOA 4UXDA 2HE5A 3CYJA 2BG5A 2WPGA 3GG0A 1J0YA 4F79A 3IIOA 4JD4A 2GDUA 1CGWA 2PD5A 3FVDA 1YIXA 3VOFA 5KITA 2PDPA 1JCLA 4ZOEA 1U83A 2G96A 3SN1A 3A23A 3DKLA 1KCLA 4ZCWA 5FA5A 3LG3A 1GOIA 4B2DD 3SSJA 5M2FX 1YNYA 4JN6A 2CLFA 1ENUA 3TYCA 4NY2A 1C8XA 1NFGA 5CC7A 1WAUA<