4ZMGA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with dh03a338
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of Human Dihydroorotate Dehydrogenase (DHODH) with DH03A338
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 139
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4zmgA00
3OHIA 3UZJA 3W07A 3LTPA 3G24A 3LTYA 5D2XA 4HHPA 4IGHA 2A2IA 2ATMA 1XFBA 3C2VA 3W70A 4CLMA 1DJQA 1RQBA 2V5BA 3B0VC 1SO3A 5D32A 1QO5A 3O05A 1WOBA 2GPTA 3L9CA 5HINA 3W1AA 3FLUA 2VEPA 4PA8A 1H1YA 1Z44A 1Q45A 3B0PA 3ANYA 1IIGA 5I3KA 1PVNA 1C29A 2ZRWA 2J6XA 3Q2DA 3MO7A 3EX3A 1OG0A 2I1OA 2DZWA 4FIQA 5G2HA 3QJAA 4WY0B 5DCDA 3W85A 2E5CA 1VJIA 1R2RA 4XKYA 3I7RA 1WX0A 3QQ0A 4MYAA 4JY9A 2A6NA 3P5YA 2E1DA 1FY6A 2DZXA 3TJXA 4LRTA 2QCMA 3QQ1A 5U7SA 4HNVA 1GZGA 3DHDA 3DFPA 3W7CA 4ONVA 3QFEA 4JTJA 1OFDA 4N9EA 3TFXA 3P7YA 3JS3A 5I3FA 1FCVA 3CU2A 3EXRA 1N55A 4BR1A 2Z1BA 4GWEA 4O15A 4JX4A 1UCWA 3BGGA 2IQTA 1XBYA 1EUAA 4N4PA 1MSSA 1SZGA 2OMAA 3UWYA 2ZQ0A 1MEWA 3QMSA 4OU1A 2DP3A 1TPEA 4JDYA 3F03K 3PWAA 1PCWA 3TQKA 2X16A 3UXDA 4DQWA 1TQJA 3W1LA 1QFEA 1FCUA 1DBTA 1VC4A 3S1XA 1O5XA 4PFMA 4O8RA 4S1FA 1SZEA 2A85A 3CHVA 1YADA 2NX1A 4JS3A 4XBKA 3HO8A 3P74A 3G0UA 5K4ZA 5D04C 2ZZ2A 1HO4A 5BOOA 3LBCA 5FF3A 2QEZA 3OBKA 1WBJA 3HF3A 4HNTA 5K4XA 3PG9A 1RV8A 1G7UA 3K30A 3W1PA 3DU0A 2VFDA 1H7OA 1VCFA 3HBLA 3CIWA 3NO5A 5KTLA 3NQMA 6TIMA 2VFHA 3FA5A 1QAPA 5D33A 1TSIA 2WSYA 3LXAA 3MYPA 1DJNA 4OV9A 1W3TA 4JIQA 5CSSA 3KXQA 3CEPA 5FI8A 1N8FA 2FFCA 3MWAA 5CPLA 3UPWA 3PBWA 3B8DA 5LGZA 5C54A 2C0AA 3KRZA 1FQ0A 1XUUA 1U5JA 3HPSA 3NM3A 2H3BA 1SZNA 1ONRA 4MLRA 1KBJA 5AC7A 3F4NA 3LLFA 4P2VA 1K8XA 4NNAA 4YCOA 4JX5A 2A7NA 3R12A 1AW2A 4AVFA 4ZQMA 3E96A 5IBXA 3C2OA 3TAOA 3LCGA 3FYOA 2G95A 1OK6A 4NJKA 1QPRA 3RMJA 2QUUA 4DF0A 4CNNA 3C2FA 5FF2A 3DHFA 2W79A 3P61A 4UTWC 3DH7A 1OVDA 1OFEA 4BI7A 1D3HA 1UJPA 4OBTA 4WY0A 3TR2A 5K9DA 3EWXA 4O18A 1ZHAA 3P82A 4I7WA 4MVAA 4NNBA 4JDBA 1KTNA 4BI6A 5AFDA 3IIXA 4IXXA 2NWRA 3PR2A 3YPIA 3ZS4A 1GVFA 4XZ9A 4O1DA 3I7QA 3PBVA 4JGDA 2YX0A 5EA9A 3INPA 3NQEA 4JYEA 5KITA 3UWZA 1PS9A 4GNJA 3FIGA 2R94A 4UFHA 1KFEA 3ATYA 4K6AA 4ADTA 3WK2A 5H91A 3C52A 2YSWA 4NUWA 2QUTA 1TRDA 4IPIA 3NGJA 3STEA 4BFAA 5D2TA 5D02A 5L6UA 2WNQA 4MZ8A 1JR1A 4AMAA 4EOUA 2C18A 3B0UX 1TB3A 1AMKA 2YPIA 3LXBA 3ELFA 3IIZA 4DELA 3OIXA 1GWJA 1A5AA 2FPTA 3R13A 5CKSA 3LHWA 1W8SA 5T26A 3HGJA 3PG8A 1O5KA 2NUYA 1RPXA 3IEBA 1WOAA 2VENA 4O10A 3L21A 1R30A 4RXFA 3GDTA 4AH7A 2CZFA 4EWND 3IIOA 4Z1AA 3P8IA 4FNPA 3W7QA 4PEKA 2NXHA 4O11A 3W22A 5CPMA 2ZZ6A 4N4QA 2WSRA 3ZR4A 1HUVA 4QNWA 3BW3A 4NXSA 4LC8A 2XN2A 3VNDA 2ZYFA 4MJZA 4DO6A 4LC6A 4ORIA 4RV8A 5BMWA 2GVLA 2DZVA 3C8FA 5D2WA 4A22A 1WA3A 4FNRA 2X1SA 5A8GA 3EX1A 4FO4A 1HL2A 3U6WA 1GQNA 2BLEA 1X1OA 2BTMA 3ABSA 1P4CA 2Q8LA 2QCHA 2Y70A 3FYPA 3PUOA 4UC5A 4E0CA 1W5NA 4WXZA 4N02A 3WK3A 1P0NA 3SI9A 5F4WA 1L2UA 4O14A 4Y90A 3B03A 4LWWA 2JGYA 2QAFA 2ZTJA 5DN1A 3EXTA 4LS1A 1W5OA 3PS7A 2B7QA 5FEXA 1YXDA 3C6CA 4E2BA 4GBUA 4LUIA 1TMHA 4J9JA 1G67A 1I2OA 3B05A 5G1YA 2EGZA 1HG3A 3I65A 3SZ8A 2H8XA 1TV7A 2VFIA 3G3DA 1G4TA 3BW4A 1KFCA 5D37A 3WK1A 4GFSA 3S5NA 1PCKA 1TJPA 3DFTA 2HTMA 1JCMP 4RXGA 3P81A 3HG3A 3UY8A 5KZMA 5CZ0A 3TDFA 3C4UA 1IXNA 2VC6A 3HIJA 5DLCA 1KFLA 1WDWA 7TIMA 1ML1A 3N73A 1Q6OA 1FXPA 4WY0F 3MBFA 3SFKA 1A5CA 4EIVA 2EAWA 2UV8G 4ADSA 4CQ8A 1OF6A 3UY7A 2OZ0A 5HWMA 1PV8A 3LI1A 2E68A 1VPXA 1KM2A 1LCOA 4GRSA 5HJLA 3RLVA 2NV1A 3O63A 3CTLA 2GUUA 3LTSA 4O52A 3A5VA 4AB4A 2X1UA 4UTTC 1UUMA 3N9RA 3GLCA 5AHMA 3CC1A 3DZ1A 4FHAA 3CM4A 3DI1A 4OGZA 4BWLA 2F7FA 1BTMA 2YZRA 4N9DA 3T4CA 4D2JA 3O15A 5AC6A 1EX5A 1KM0A 4MIMA 2HMCA 3GZ3A 1CW2A 1IXOA 2OT0A 3GR8A 4W9TA 2FB2A 4DPQA 3FKKA 2V81A 2H8ZA 5G2WA 2ZDRA 3ATZA 1AL8A 5EYWA 4DXVA 1TPC1 2YYUA 4AWTA 4IPJA 3EWBX 3L68A 4MYXA 1TV8A 4PCFA 3MI6A 2RDWA 3TROA 4JNMA 5L9FA 1DHPA 2A7PA 1VQTA 3BLFA 3PC0A 4FEZA 5G4EA 3TMLA 1QNVA 1W5PA 5G1TA 5F2GA 2VEIA 3HQ1A 4YWIA 3M7WA 2CW6A 5I3JA 5ABTA 4X22A 1LORA 4AF0B 1LOQA 3LDVA 4AHQA 4HPXA 4M6PA 3B06A 4ZL1A 1A5BA 4R33A 1SO4A 1UUOA 3NQVA 1KLZA 1FWNA 1KV8A 4MFDA 1PL9A 1OK4A 3BW2A 1TTIA 4NJHA 3T40A 4K7VA 1KM1A 1Q6LA 2YFOA 3DBPA 1G6CA 3MHUA 2GJLA 1JRBA 4O4VA 3HJZA 4EVZA 1VH7A 3M0ZA 4FIRA 2VOMA 1OHLA 1GG1A 2V30A 2X1TA 4LVDA 3TUUA 3C56A 2J27A 1I8JA 1M7OA 4JTSA 2ZZ5A 3M5VA 3W7HA 5K7JA 2VEMA 2A4AA 3N9SA 2BSLA 3WJSA 3OVRA 4YLWA 1KFKA 3NG3A 1HTIA 5IBXC 2GQ9A 4UMAA 2I9EA 3NYZA 4UMBA 4PH6A 4KFPA 2GVJA 1DVJA 1JUKA 4L4LA 3NQCA 1HO1A 2E5BA 1JCJA 2Y6ZA 3LGEA 3LRLA 2ZRXA 3NQAA 4WD0A 3S1UA 3W7DA 2E6FA 4XTIA 1RVGA 1VHNA 2C15A 4JYDA 1JRCA 1VCVA 1NF7A 4K36A 3H53A 2NUWA 4AHOA 1MO0A 3EWUA 3E49A 1QPOA 3IGSA 1OJXA 1W56A 3VE7A 5SWUA 1YXCA 4M6VA 2TRSA 3CIXA 2O7QA 2CLHA 3PB0A 2YYTA 3EWWA 3M6YA 4RCXA 1ZAIA 1I2PA 1DQXA 1KFBA 1H7RA 2C19A 2QAPA 1YPIA 4MY9A 3O6DA 2ZRVA 3A21A 3NR0A 2GVGA 5G2IA 4M5PA 5FEWA 3EXSA 4Z0SA 3G1DA 2QJIA 1FWTA 4IJBA 1FDYA 2EKCA 4CNPA 1F05A 2E6DA 2CLEA 2CLIA 3N3MA 2DZUA 2ZZ1A 3WFAA 4LT9A 3UXAA 3TU9A 1MXSA 4UTHA 2YCEA 5FESA 3RF9A 1DL3A 3IVSA 1TRIA 3W1NA 3QW4B 3STGA 3AJXA 1ZJIA 1EP1A 3TXZA 2CLOA 4HNUA 3TE9A 4JTFA 3IIPA 4MPQA 5EMUA 3G1SA 4HIBA 3VI2A 4UTMA 1ZAHA 1VRDA 4JX6A 3PB2A 1VYSX 2QCEA 2VFEA 3NZ1A 4JTIA 3CB8A 1W3NA 3W7NA 1WYIA 4Y6GA 4CCDA 3NPVA 5HR6A 4NJGA 1YTKA 1YDNA 3Q37A 1W1ZA 3TSMA 3GKAA 4M7TA 3Q94A 4FXSA 1IF2A 1EPXA 4A3UA 4WQ6A 4LNYA 1ME9A 5BNKA 4NT0A 2G96A 4POCA 1V5XA 4O54A 3PSWA 4IX2A 4AF0A 3W1UA 1KV5A 1V7YA 1WV2A 3WJYA 3NDOA 4E2DA 1GPWA 4XBSA 5LKYA 5C6MA 3BARA 4LVGA 3KVKA 1EEPA 8TIMA 4UNKA 3G1VA 1QR7A 1NVMA 2QDGA 1J5TA 4Y8FA 6ALDA 4PTNA 4UTTA 1ME8A 4KFOA 1UBSA 4UFKA 3QPZA 3GYEA 2OT1A 3QMRA 4O53A 3BG5A 5K9CA 1SSGA 3N34A 3CT7A 5D30A 4FNSA 1IXQA 3NQ8A 3DI0A 4DO4A 4LW7A 3S5YA 3T44A 1QOQA 4FX6M 5FEPA 1SFLA 4AAJA 5DCEA 4ZQOA 5AYZA 2RFGA 3O07A 4JIPA 3W86A 3W7GA 3BPWA 4IMFA 1DOSA 3LHTA 5BRBA 3GXTA 2Q8ZA 3TKFA 4RLIA 1XL9A 3VFLA 3W7KA 4UFIA 1A53A 5E93A 5F2LA 1G4EA 1VLWA 1KM4A 1VR6A 3G8EA 1LDCA 4TR9A 2WV8A 4O1CA 4UFJA 3GAYA 3ABQA 1LBFA 1NSJA 3MMTA 1F76A 2QCNA 3V75A 3LCXA 2HS8A 3GVGA 2DJLA 3NL3A 5KMYA 1X7FA 1JCLA 3FS2A 3W7MA 1EUNA 1R2TA 3ZFHA 1P5BA 3BO9A 5HMSA 1OFPA 2KZHA 3ZWSA 5EL1A 4ALDA 4BWLC 3F1QA 1VS1A 2PURA 3G1FA 1MZHA 2I14A 3BLIA 1F5ZA 5HUOA 4KKXA 4XQ6A 1TPFA 3E0IA 1GTHA 2J9XA 2V82A 1ZY9A 5CPNA 3KRSA 1ZAJA 1EWDA 3NNTA 2D73A 3M9YA 2FPYA 1EA0A 3NL5A 1EWEA 3M16A 1RD5A 1JCNA 4RZ6A 4N6EA 2H90A 2JKPA 1KLYA 3LXCA 2PCQA 3B04A 3T55A 2P0OA 1O95A 4O17A 3L67A 4GUHA 1W3IA 2GJNA 2EF9A 1GT8A 3NPXA 4FNUA 2Z0IA 5EPDA 3TSDA 1JQXA 4QITA 2Y62A 3IGUA 2VFFA 2HSAA 1KW1A 3SECA 3MP5A 4TO8A 2A1YA 1OFBA 4Q4KA 3CLMA 1LRTA 3AO0A 3S5OA 1TCDA 4O57A 3EX4A 3W83A 3W7LA 4C1KA 3L5MA 3JRKA 1XDLA 4UNLA 3BG9A 1M6JA 3GNDA 5HUPA 2VEKA 2AQWA 1DV7A 2B0MA 1YTEA 1YXYA 1W37A 1LBMA 3U2OA 3G8RA 1R47A 4P61A 3S42A 1TV5A 2QCGA 4ZQPA 3OVQA 1J2WA 4FX8A 1AG1O 1S3HA 2GOUA 3EWYA 3NXFA 1K02A 4FNTA 2XN0A 3M5YA 1LYXA 3M5ZA 3LHZA 1FDZA 3SGZA 1H51A 3L0GA 1WQ5A 2BXVA 3W6YA 3N14A 1RR2A 1D9EA 1YDOA 1L6WA 3W2UA 5K9XA 4JTLA 3NL6A 3W72A 3BG3A 1LOLA 1HFBA 1PE1A 3E9AA 3A23A 5DXYA 4AHPA 2ISVA 5K3VA 3W1MA 5C2XA 1KM6A 3HPZA 4IQLA 4Z1BA 3O6YX 5F4XA 2RDTA 3QSRA 4QAIA 2QCDB 1I2QA 3C3NA 1Z48A 4ML9A 1X8FA 5D05A 2A0NA 1K3UA 3CPRA 5BW6A 2AAMA 2ALDA 3MW7A 2Q3OA 3N2XA 2R91A 5F4SA 1ZALA 3EWZA 4WJEA 2PRLA 3WK0A 3O8AA 3PBUA 1EIXA 2Y7GA 5DXXA 1ZNNA 1B4KA 1SSDA 5EKYA 2AGKA 4ORMA 4GC4A 3W7PA 2FJKA 4FF7A 1W54A 2DJXA 3NPUA 3SJ3A 1ICPA 2DORA 2FIQA 1TPWA 4GJ1A 3IV3A 4CCEA 4I7VA 4S2BA 3G3MA 3LLDA 1H1ZA 4QM1A 2Y88A 2V0TA 4N9BA 1I2RA 2H3DA 4O16A 1W5MA 4U28A 5MHBA 1F74A 1QPNA 1SFJA 3W75A 1F73A 5AYYA 3HGRA 4RX0A 2Y63A 1I45A 1SQ7A 3LHVA 3SW6A 3LV6A 4RKAA 4A29A 3I7SA 2ZRZA 2QUVA 2C13A 3L65A 4X9SA 4NNCA 5I3HA 2Z6IA 3MI2A 3TJLA 3GAKA 4N2YA 5LNVA 3RFAA 4WUIA 3C0JA 2FDSA 3PY2A 4FXRA 2WPBA 4TMBA 5LHEA 3ZWTA 5CGQA 5HWNA 2J24A 5IM51 3SY5A 1OYBA 3EB2A 3IIVA 1Q6RA 3CWNA 3CEUA 4CQAA 3LCFA 3BVJA 1JUBA 2QF7A 4MJMA 5D38A 4ZQRA 1XUZA 4IMDA 1JVNA 1K7XA 4MUZA 3JR2A 4PC8A 5DY3A 4ADUA 5KZDA 3L66A 3GDMA 3FOKA 3IGXA 4QIUA 5CG7A 2C1HA 4Z0JA 3W87A 4Q32A 2YDAA 2NX3A 3DKJA 2P10A 2C16A 2XN1A 1H7NA 1FBAA 1Y0EA 2CLMA 3S1WA 1TPB1 3VE9A 1FWSA 4ICNA 2WJZA 4UMCA 4O28A 3CQ0A 5CSRA 3LV5A 2ZA2A 1DKWA 4H6KA 1FUYA 2ABBA 3DFQA 1TIMA 5G5IA 1AW5A 3L5LA 1LOSA 3NQ7A 3WJWA 4UTIA 4CCCA 1R46A 3NQFA 5AHIA 4JN6A 2A5HA 3QYQA 5F2IA 1LLZA 1VYPX 1PHQA 1QWGA 5D09A 3OVPA 2DU2A 3RK8A 5CZTA 5AN7A 2JKAA 3KAOA 3SGUA 1TPDA 2QCDA 1SO6A 5G4WA 1L9WA 4OE7A 3PUEA 3M1ZA 1N7KA 4X3ZA 3NM1A 1S5WA 3UZ5A 3LI0A 2BX7A 3L2IA 3Q58A 3MUXA 1KTBA 2CZEA 2G5WA 3FKRA 3UWVA 3LM7A 2E6AA 1H5YA 2Z2UA 3W73A 1OFAA 2PE4A 3LB0A 4YL2A 1Z42A 3TA6A 1LRQA 1NAL1 3PSVA 5GVJA 3T78A 5D03A 1YLVA 1PHWA 5AHEA 1T99A 3LERA 4NX0A 4O12A 3PM6A 3S6DA 1FXQA 2C3ZA 3W84A 3S0CA 2V5LA 1TPVA 2F84A 3KX6A 3TW7A 3G1XA 4E38A 2BWGA 1QDSA 5DCBA 3GDLA 2QCCA 2B7PA 4QSHA 3GK0A 4JD4A 4AWSA 1H62A 3LCLA 3H55A 4NU7A 3FJ6A 3TC6A 2V8ZA 5F1UA 3E12A 3UD6A 1H7WA 5EBUA 1KA9F 4K38A 2Y7FA 4I9AA 4X2RA 4LS2A 4GUJA 1TPUA 2V2HA 2OJPA 4KWWA 4JEQA 3LRMA 3QZEA 3MI3A 2RDUA 2V2DA 3G1HA 1WAUA 5HNRA 3W2MA 4LOCA 1QO2A 5FF4A 1WXJA 1XBZA 2WNNA 3BV4A 2WSQA 3S8HA 4L4MA 3W1XA 3DFSA 2EHHA 3PAJA 1F6KA 2YW4A 3EEGA 2C14A 3M41A 2QCFA 1GVQA 4K8HA 3BK0A 4MFEA 3L0NA 4UTJA 3BLEA 5E1QA 1H50A 3G1YA 3QF0A 3RNDA 5DBUA 1ZCOA 1I4NA 2H6RA 3PBYA 4IUOA 1GOXA 4HSOA 3V1PA 4LVFA 3DFOA 1E51A 2P1FA 1MEIA 5AOUA 2VKZG 3LCWA 5F2MA 2CZ5A 4K7YA 2X30A 4CNOA 5AB3A 2NX9A 4NQ1A 1LRNA 3A5FA 5DBTA 4ZMGA 4OQVA 1T0OA 4WX2A 4N6FA 4JICA 5I3IA 4K8EA 3GXPA 1B57A 3U8GA 3PF3A 2Y89A 4M19A 1KTCA 2TSYA 5CPOA 4JYFA 1TJRA 4MY8A 3M5XA 4ZZ9A 3STFA 2FQIA 2V2CA 2WO5A 1KM5A 3MBDA 3KHJA 3W7IA 3GB6A 3HGOA 2B4GA 2QKFA 1AL7A 1JCYA 4HKPA 1XC4A 4RZ5A 3MJYA 3W1QA 3TX9A 4TIMA 5AHLA 4JY8A 1FWRA 2X1RA 2ZBTA 5LZLA 3VKJA 1H63A 1L6YA 2ZZ7A 5C55A 5LNSA 2DZTA 4IWWA 3IVUA 1JCXA 4UCGA 3W2JA 4FB7A 3OG3A 2J9YA 4Z1DA 4FNQA 1TO3A 4NXKA 1LTDA 2FPVA 1YDVA 3RU6A 4M6QA 4RK8A 4WXYA 3MP4A 2EPHA 4RJEA 3P5ZA 2WOQA 1GYNA 3R8RA 1SUXA 3W2NA 4YCPA 3DENA 4LVBA 4CQ9A 1U83A 4O50A 4DEFA 1Q6QA 1GYLA 4H3DA 3KVMA 3P80A 2OCZA 3TSBA 2A6LA 3NA8A 3HPXA 1GVSA 1H60A 3FEMA 5HR7A 2Y7DA 4TX9A 1QMLA 2ZCGA 1EB3A 3PUDA 1Z41A 5LHFA 2CU0A 3UWQA 3STCA 3W7EA 4GUIA 3I6RA 3TCEA 3SIZA 3TNOA 1YYAA 2NLIA 1VCGA 4ZVJA 4R34A 2YFNA 4LV4A 3W7OA 4RZ4A 2A21A 2W0UA 1YTDA 3E02A 3W2LA 3HGSA 5FF7A 1OFRA 5KINA 1F7BA 1BWLA 4LTSA 3KFTA 1Q3NA 1SW0A 1GEQA 3GR7A 3LX9A 1NEYA 2ISSA 4DPPA 2RKXA 4XUGA 4NJJA 2CZDA 1XBXA 1W31A 3TQ0A 3GXNA 4Y9AA 2ZTKA 3TW6A 3O06A 4R53A 1T8XA 3R89A 1BWKA 2ISWA 3TMQA 1FX6A 1EP2A 3P67A 5TIMA 3T7VA 1KBIA 2Y61A 5LGXA 2B7NA 3F4WA 3MHGA 3O16A 2QJHA 4UTKA 1JUEA 2ZA1A 3C61A 1LLWA 4BI5A 1QCWA 5U4NA 1P1XA 1TTQA 4NJIA 4O4WA 3HOJA 3FJLA 3P84A 1K03A 1SR9A 2A7RA 1ADOA 4IMGA 4OHQA 3HG5A 3WJZA 5HQEA 1BEUA 2ZZ3A 1XDMA 3LHUA 5J5DA 1IGSA 4WOZA 3W9ZA 3I68A 4O19A 3ABRA 2XFWA 1W5QA 4MKNA 3UPBA 1B9BA 4O1BA 3QM3A 2ZRUA 3KOFA 5AHFA 2NXGA 2O7SA 5J5RA 4U4MA 1TREA 3S5ZA 4HPJA 3C2EA 3WJXA 1FWWA 3M47A 3W71A 1SZFA 1F2JA 2HS6A 4LU0A 2JBMA 3P62A 2QCLA 4DBEA 1KFJA 4IMEA 1X1ZA 1J4EA 4MLJA 3DFNA 3QMTA 3S9YA 2YR1A 5LSMA 5TBOA 4ZQNA 3A22A 2TYSA 3IRDA 3EX6A 4AEOA 2QDHA 1OX6A 1ICQA 3NPWA 4HSNA 2ABAA 1RQHA 4JTEA 1D3GA 4MZYA 4FX7A 2NZLA 2X2GA 3NQ2A 1NFBA 3W1TA 3UWWA 2QR6A 1B4EA 1I2NA 1JULA 4JTTA 1G4PA 3TH6A 1OABA 2OX1A 1FCBA 4OV4A 3QPYA 3GNNA 5H2ZA 1ZFJA 4BK9A 2Y85A 3GDRA 3LBMA 5AYXA 2GQAA 2ZZ4A 4R7JA 2E6YA 1O60A 1AK5A 2WNZA 1A50A 2YW3A 3UWUA 1QOPA 5BMXA 4IMCA 1NF0A 3LCIA 5TQLA 3BGJA 2E5DA 2RH9A 4EF9A 3W1RA 4N9CA 1TTJA 1VHCA 4IX0A 3S1VA 4Y96A 2R14A 4QQ3A 2DZSA 4UR8A 1RQEA 2Y7EA 3NAVA 3MYOA 4QNEA 4NVTA 1F6PA 4O0KA 2PC4A 4JTHA 3QEZA 2NUXA 3NVTA 2JK2A 4UR7A 1SU5A 4LRSA 5AC8A 3D0CA 1KM3A 3DKLA 3A24A 4QJ1A 4DF2A 4LVAA 1XXXA 4HT3A 5K2ZA 3PVFA 3W74A 4IXHA 2TMDA 3A9IA 2CLLA 3KVJA 4O13A 1TQXA 1GTEA 3B4UA 3O1NA 1SW3A 1JQVA 3IVTA 3GX9A 1X6UA 3HMJG 3QRHA 1BKSA 1LBLA 2WQPA 3DGRA 1QPQA 4A2RA 1G7VA 5C5YA 1VYRA 3UQNA 3MP3A 1ICSA 1OX4B 3W7JA 3L5AA 3THQA 1XCFA 3UYCA 5HWJA 4Z1CA 3SR7A 4A21A 1OYAA 2DZPA 2Q3RA 3P8JA 1GJPA 1B3OA 3QC3A 4JXCA 3ABOA 3LHYA 1GVRA 3G1AA 3W7RA 1VGAA 1O94A 4PL2A 5LNRA 1WBHA 1THFD 4DBDA 2BZNA 1XI3A 1G69A 2CLKA 4XTDA 1CI1A 2CFFA 1OFQA 2ZFAA 1XBVA 2GQ8A 5I3GA 4BF9A 3TK7A 3EKZA 4YXGA 4TMCA 2E09A 3QW3A 4EF8A 2NWSA 2C6QA 3NEVA 1M5WA 1UASA 3TXVA 2W6RA 4PODA 3PULA 4NZFA 5F1VA 3N2MA 3HG2A 4A2SA 3OEXA 4B5NA 2ZA3A 1SO5A 5DELA 1LM1A 4AWUA 2JGQA 2TPSA 5CZJA 2VFGA 3G0SA 1LROA 4UTLA 1GVOA 4YMZA 4UFMA 2B7OA 2YXGA 4C1LA 1OX5A 4LUJA 3R5EA 4GE8A 3RLUA 3M43A 3EX2A 4DO5A 4O0ZA 3USBA 3W76A 1ME7A 1XM3A 3SSJA 4QISA 3KRUA 5KSWA 1FCQA 3CWOX 5HULA 1R2SA 1W0MA 3O6CA 3NL2A 3TC7A 3NZRA 1H61A 3G22A 4RR4A 4LV9A 4Z08A 2VXNA 3W88A 4MZ1A 1MEHA 3NOEA 4XWUA 3FFSA 1M7PA 2NV2A 3HB9A 1G4SA 4UXDA 1L6SA 4JTUA 1K8YA 2FB3A 4H4IA 2PRHA 2YGYA 3VCRA 5LNWA 4JTKA 1IXPA 2QJGA 1RZMA 4UTUA 4JTGA 3DAQA 1H7PA 1TPH1 1YPFA 1OYCA 1OF8A 2V9DA 4KFNA 1P0KA 4AXKA 1PIIA 4TU1A 5D2VA 3R2GA 2ATSA 4K37A 4XKYB 3TV8A 1LZOA 3C2RA 3NQGA 4UUIA 4KWVA 4UTWA 2JKEA 4GUFA 3TQVA 4JR5A 5E0KA 2FTPA 2Z6JA 1T96A 4O1AA 5FF0A 1C9DA 2J88A 3M44A 1OX4A 1TTPA 3W23A 3GDKA 4LY8A 3G0XA 5DY2A 3OA3A 1A5SA 5CZSA 3N19B 1DQWA 1DORA 1TYGA 3QSTA 1VLIA 4GUGA 4I7UA 1H7XA 4G1KA 1UB3A 3MHFA 2R8WA 1FDJA 3GIYA 4UIOA 1CX9A 4OWGA 2WKJA 2PRMA 1S5VA 1ALDA 1VZWA 4NZJA 4PL1A 4WZHA 3LCHA 2VELA 1AW1A 3G18A 4ZQCA 2FLIA 2LLEA 2ZRYA 4LS0A 4IOTA 5AHNA 4GXMA 1XKYA 1OFOA 3TFCA 3NQDA 4OT7A 3W2KA 1K7FA 4HN4A 1O4UA 3W3OA 3H54A 3TIMA 4HNNA 1EP3A 2G97A 4M7SA 5KZEA 3GKFA 1K7EA 1IIHA 1SW7A 4UFLA 3TAKA 1SPQA 4MOZA 1C8VA 4S2CA 1LP6A 5LNUA 2J9ZA 3L0KA 3DXIA 3QH2A 3EKLA 3KVLA 1K8ZA 4MY1A 3P60A 2E77A 3LRKA 5EY5A 4NX5A 1JJKA 1ZENA 4WOQA 5FEZA 5A5WA 1GG0A 2CWNA 5D2YA 3LOTA 2NXIA 2CLFA 3UNDA 1S5TA 4Q33A 4K39A 3HG4A 4DF1A 3THAA 3NQ6A 2RHGA
chains in the Genus database with same CATH superfamily
4PGLA 1FRBA 3OHIA 3OVGA 1REQB 4KIEA 2CZVA 5D2XA 2OG9A 3IUDA 4D1JA 2Z26A 2A2IA 4C90A 3MUAA 2ATMA 3C2VA 4J2MA 1Z3NA 1DJQA 2CXEA 4EXAA 5D32A 3U7VA 3WMLA 1QO5A 5HINA 1PIGA 2GWNA 5D9PA 3FHAA 3ANYA 1IIGA 3GTNA 3AIVA 5I3KA 1PVNA 2NVDA 4KF1A 5CGMA 3EX3A 1H3GA 4FIQA 4ROQA 2Q09A 5DCDA 4GCAA 2W66A 3W82A 1WDSA 1R2RA 4XKYA 2PCEA 3F5KA 1VFHA 2A6NA 2E1DA 1FY6A 1GK8A 4LRTA 3NSMA 2QVHA 4TX6A 4AVNA 1GQLA 1WKFA 1ZP4A 2ACRA 1K9TA 3N6JA 4B5VA 4JTJA 3KP0A 4PUDA 5I3FA 1FCVA 1XW8A 3EXRA 1N55A 4O15A 4GWEA 1RA0A 3GG8A 1XBYA 3WG6A 4N4PA 1SZGA 2OMAA 4DJEA 3OYZA 1UUQA 3PPGA 3QMSA 4ZTXA 2ZE0A 4M3PA 3WQWA 5IHSA 3PWAA 5REQA 1TQJA 2V38A 1DBTA 1O5XA 4G8TA 2NX1A 1TMQA 2EG7A 4JS3A 1Q63A 4RNHA 2YXXA 3QV9A 1R3TA 4JIEA 5BOOA 1CXLA 1XG4A 5LXEA 2QEZA 3OBKA 2FHBA 4GI4A 5K4XA 1RV8A 1UC5A 3HURA 3NQMA 6TIMA 2VFHA 3AMCA 1XS2A 1HZYA 1SFTA 4LCQA 5HOSA 4I8DA 1PX8A 3QOMA 4Z17A 3U57A 4OV9A 4KWUA 1W3TA 3STPA 3VIOA 1BSIA 3KXQA 2CBIA 1JZ8A 5CPLA 3ENLA 4O0QA 7TAAA 3PBWA 2DUXA 3B8DA 2GK1B 2O9PA 2C0AA 3KRZA 1JYNA 4PCTA 3WN6A 2B31A 3H22A 1U5JA 1UW9A 2YCKX 3UCQA 4GIAA 5CPQA 3GYCA 5AC7A 3LENA 2ACQA 1BFNA 4JX5A 4ATDA 2D0FA 3TTEA 2BS9A 1ZQ5A 5IBXA 3C2OA 2X0YA 3LCGA 3UXKA 1WKEA 3ABZA 3QTPA 2QUNA 4B9ZA 4DY1A 2QUUA 5I5RA 5FF2A 2PDUA 3CL6A 2W79A 4P7QA 4UTWC 4PMXA 3ANUA 4H8UA 3TR2A 1QATA 3V0UA 3TJIA 1XQLA 2OODA 1G94A 2FVMA 1C93A 2NWRA 3PR2A 3AOFA 3YPIA 1MQQA 4XZ9A 4O1DA 3I7QA 1F9CA 3SGGA 4PR4A 1OC5A 4GNJA 2R94A 4UFHA 4K6AA 5CSUA 1CIUA 3WNKA 4NUWA 1OIMA 3L4VA 2QUTA 1ECEA 1CT5A 3UR7A 5D2TA 3SDOA 2WNQA 1JR1A 2VEFA 3M6DA 3ELFA 1GWJA 3FV9A 2E8ZA 5T26A 3PG8A 4IPLA 1O5KA 3IEBA 1WOAA 4B90A 4LAMA 2VENA 3A13A 1NIUA 3GDTA 3LQLA 4L65A 3N18A 1XP3A 2VZTA 1QU4A 4O11A 5FAGA 2ZZ6A 4NZ1A 4N4QA 2FMNA 1BGGA 2WSRA 4QNWA 5E70A 3UGVA 1UQZA 4GMEA 2XN2A 3VIPA 4MJZA 4DO6A 1H2JA 3WQCA 4RV8A 1DXEA 4QJ3B 5D2WA 5A8GA 2X1SA 3T07A 2ASHA 3EX1A 4M1RA 1HL2A 1EGVA 3DEQA 3WQVA 1X1OA 1V6UA 2BTMA 1MNZA 4DJFA 3FYPA 3PUOA 4UC5A 2BY0A 4E0CA 5CJNA 2ISFA 4N02A 3DESA 3Q45A 1XIEA 4LEFA 5C0QA 3PFRA 4O14A 3B03A 2JGYA 3EXTA 1YMYA 1W5OA 1YXDA 1VBGA 1TMHA 4F0MA 3N04A 3FYYA 1CBGA 3SZ8A 4F4RA 4UCFA 2W61A 1KFCA 4M56A 2AKMA 3IS4A 4O1EA 2HTMA 1JCMP 2DVTA 4RXGA 3HG3A 3UY8A 1JZ2A 3C4UA 2J74A 1F8MA 2VC6A 4E2OA 4DAFA 1XINA 3WF0A 1KFLA 3LPGA 1LUCB 1E0TA 5IRPA 1XPGA 4XD3A 4KETA 2WSPA 1FXPA 4EXQA 4Q8WA 1ZL1A 3MBFA 4GO8A 4EIVA 5HDRA 2QV4A 4ADSA 4CQ8A 2D2JA 4PE8A 2DH3A 3QGVA 3CO4A 1VFFA 4HGXA 1KM2A 5HJLA 3CTLA 3LTSA 1OINA 2HNHA 2IS7A 3BURA 5M5DA 3VOJA 2CETA 1TMLA 1J8VA 1W2PA 1UUMA 3WLJA 1MW2A 2PEVA 4BWLA 3T4CA 1RHCA 2PDQA 3PJUA 3CZGA 3ONBA 1EX5A 1XX1A 5EMJA 3WLHA 2PDXA 1NQ6A 5A6JA 2ZVIA 1DXFA 3WBAA 4W9TA 2FB2A 1E3XA 1KKOA 2ZDRA 2XVGA 5EYWA 3E5PA 1TPC1 5J8LA 4AWTA 1E70M 4LBSA 4UQDA 1TV8A 4NG3A 4PCFA 4C6MA 3SCVA 3MI6A 5L9FA 3JW7A 2XH0A 3PC0A 3J7HA 1E5NA 1QNVA 4WHBA 5F2GA 2VEIA 2E28A 4B15A 3GHSA 3M7WA 2CW6A 2GSEA 1AMYA 4X22A 3LDVA 1UUOA 5HMFA 3GU1A 3FGCA 1UMYA 2E67A 1O68A 1OK4A 4E3VA 1L0PA 2EG8A 3MMWA 3OO2A 4EANA 2YFOA 3C0SA 3DBPA 3LD5A 2GJLA 4EVZA 3M0ZA 3CUFA 1EOMA 2J27A 3QC0A 3W81A 1I8JA 4JTSA 2ZZ5A 4RUBA 2A4AA 1ZJAA 1TG7A 3N9SA 3WJSA 4GQ0A 1J0IA 3QZAA 3GVVA 5A6TC 1AD1A 4YLWA 1RA5A 1ODZA 1RPKA 2HCVA 5LA0A 1A5UA 4IT1A 1B54A 2OEKA 4UMAA 3NYZA 1XG3A 1UWIA 2NQ5A 1NM9A 3OHMB 1VEMA 3VDAA 1QXLA 2ZIDA 3TTSA 3NQCA 2Y6ZA 2H9AB 1XLLA 4N7QA 3W01A 3W38A 4XTIA 4H83A 2C15A 3SEPA 5H1WA 1PTAA 1JF5A 3RLHA 4AHOA 3TEVA 1DIDA 3WLSA 1XYMA 2CXGA 3VE7A 1UP3A 3ITXA 1MDLA 1YXCA 4GGHA 2TRSA 2O7QA 1FTXA 4L80A 4GNVA 3PB0A 3ZR5A 2NT0A 2YYTA 3TWBA 2J7DA 4RCXA 1DQXA 2QAPA 1BVWA 3IJDA 1S2CA 3IJQA 2YBVA 3O6DA 4AX6A 5EB8A 2ZRVA 4A4AA 3HJEA 4M5PA 1E55A 1S2WA 3VMOA 4Z0SA 3IK4A 5FEWA 4S3EA 2J8TA 4IJBA 4R5EA 3WBEA 1XRSA 1PKYA 2CLEA 1OZQA 3N3MA 2DZUA 3WFAA 4HK6A 2FGLA 2VR2A 3AUOA 3V4BA 1H0GA 3TU9A 1WUFA 3T09A 2XIBA 1EYEA 2OYMA 2YCEA 3RF9A 1DL3A 3PZIA 3VD7A 1CTNA 4ZTYA 1XLGA 1EP1A 1UH3A 4IH3A 1XC6A 3NYDA 2YLLA 1TWSA 3VI2A 1VRDA 3PNZA 3RPDA 3H12A 3KOYA 4R3UA 1XH1A 4DUXA 1WYIA 4Y6GA 1HJWA 2Q71A 4GYPA 1YTKA 1YDNA 3WMSA 3PZMA 3BMVA 4FXSA 2WC7A 4S23A 1MFUA 4US5A 3W1UA 4P7NA 3WJYA 5AECA 3NDOA 5M3WA 3G1VA 3RYSA 1NVMA 4PRTA 6ALDA 4KFOA 1KB3A 1EZWA 3QPZA 3GYEA 2OT1A 3H8AA 4O53A 2XINA 1XD1A 3MA8A 5ENLA 5FJUA 4G7FA 4JKKA 1Y5WA 5FEPA 3ITLA 3BQ5A 4ZQOA 1X98A 2OU4A 4DN1A 3WF3A 2QIWA 1PKNA 1DOSA 4YPJA 3GXTA 2Q8ZA 3SY1A 5EMKA 3QY7A 4M81A 2CPUA 2BB0A 3W7KA 4UFIA 1Z69A 1A53A 1EOKA 1G4EA 2GWGA 1VR6A 3G8EA 4TR9A 4O1CA 3TN5A 2PMQA 3ABQA 1LBFA 1ISVA 4XD4A 4S3AA 4HNCA 3MMTA 4JKLA 2QCNA 3LCXA 2HS8A 2DJLA 3R7MA 5IXEA 1JCLA 4PSRA 3FS2A 5FL0A 3ZFHA 3O7UA 3WNPA 3ZXWA 3WELA 5HMSA 1OFPA 1UZDA 4GHRA 3XISA 4CNTA 1E40A 1MZHA 3U3HA 4Z1YA 5HUOA 3AXKA 3ONCA 4RE2A 4IG2A 5HK4A 1EDGA 1GTHA 3GVWA 2V82A 5CPNA 4CD7A 3RLGA 3TN3A 1EWDA 2OZ8A 2QPXA 3Q65A 3VNZA 2FPYA 1CENA 3UW6A 1EA0A 4NYYA 4B5TA 3H24A 1EWEA 4N6EA 1O95A 2ZVRA 3WL1A 3OGSA 5D4YA 4AUBA 3VGBA 4XSLA 1GT8A 3PTKA 4JFVA 3U4FA 5KZ6A 3HN3A 2PBGA 3IGUA 3ITYA 2VFFA 2HSAA 3RCYA 3MP5A 3WQ8A 1XYLA 1U5HA 4CN4A 4AG0A 1TV4A 3CLMA 1LRTA 2EPLX 4UNIA 1TCDA 4Q7NA 1KBKA 3VA8A 3H2OA 2XG9A 5BWAA 2PWUA 3JRKA 1XDLA 3L5MA 3JZEA 5HUPA 1SJBA 4NL1A 2AQWA 4G56A 4LUYA 1FFQA 4GFIA 5JBDA 1B31A 1K6WA 1J2WA 4FX8A 4DIAA 4ZOCA 1S3HA 3GHUA 1XGEA 3KZPA 3SGZA 4N42A 1WQ5A 6PTDA 4L4PA 1UR8A 3W6YA 1RR2A 1J0YA 1VB9A 1XLAA 1YDOA 3IJ7A 2XGIA 1XIJA 3K8LA 3NL6A 2JF6A 5IDIA 5H6HA 3PTQA 3E9AA 1GJUA 4KWOA 3A23A 4AHPA 4NHVA 2ISVA 1CDGA 3W1MA 4XZMX 1KM6A 2WHKA 4Z1BA 4IFKA 2G3FA 5F4XA 2RDTA 4GJIA 1I2QA 3AU2A 3N11A 1D8CA 1J12A 3CV1A 3CT2A 1RD6A 1YW1A 2SFPA 3MW7A 2R91A 3UP8A 4MADA 4WJEA 5C7HA 1DJGA 2MUCA 3O8AA 1EL3A 3AZTA 5DXXA 5ECVA 3KCOA 4MB3A 5EKYA 2AGKA 4GC4A 4I3GA 2FJKA 3NDZA 1W54A 2GVEA 2XJ7A 4CVUA 5CG0A 1E3ZA 1X6LA 4DB7A 1RBAA 2DY3A 3V35A 3G3MA 3UZYA 1T6MA 3AYTA 4N9BA 5TNVA 2X7WA 4O16A 1SFJA 1IT7A 2TODA 5DX7A 1I60A 1DPMA 4DBWA 2BY2A 5J04A 2NVCA 4NYUA 1WDDA 2C13A 4AY1A 1E9LA 3IK2A 2Z6IA 3MI2A 4N2YA 1AVAA 3C0JA 1IQ8A 4FXRA 2UY4A 2WPBA 3GIPA 1IGWA 2J24A 2VC5A 5FOOA 4LB3A 3SY5A 3IIVA 3GG1A 3WF4A 3LCFA 1JUBA 5B7ZA 1KWGA 3GTFA 1JXJA 3SAZA 4C5YA 2GGEA 4C7GA 4MUZA 4PC8A 5JXQA 5KZDA 3L66A 3GDMA 3CQJA 1VFOA 3D3FA 3IUHA 1HF6A 2C1HA 1F3WA 3T0DA 1XLBA 2FGZA 3W87A 4JQ4A 4Q32A 2VRQA 3DKJA 4X60A 4XVDA 2CLMA 1NDYA 3S1WA 4OTKA 2RGMA 2IQDA 3UEQA 3UYIA 1QI4A 4LUSB 1GVEA 2ABBA 4O8AA 6XIAA 4Q8MA 1XWYA 4PMOA 2ALRA 2CIPA 1YNYA 4X2PA 2HE8A 1H41A 5AHIA 4XAFA 1AQMA 1TWDA 2FHCA 3IJLA 5BRPA 1H49A 2JF7A 1X96A 1NFGA 4MSSA 3O0KA 1NFPA 1QWGA 2DU2A 3M4HA 5AN7A 3H26A 2P8CA 2YIHA 3KAOA 4A8RA 1TJ0A 1SO6A 4F40A 3FA4A 1R85A 1CEOA 3M1ZA 1KRAC 1B30A 4J7RA 4HZ6A 3ORWA 4MWAD 3SUTA 2XPKA 4DZAA 2ZUMA 2F8QA 4W8AA 3FKRA 3NDYA 3CQKA 3LM7A 3QXBA 4C6DA 4ZOBA 3SCSA 3THCA 2OLAA 2X2YA 4S3CA 3PZTA 2PE4A 3LB0A 3AROA 5GNZA 1R3VA 1K70A 3VVGA 5AHEA 4O12A 3S6DA 1M53A 3D47A 3W84A 1BQCA 2V5LA 3QR0A 1TPVA 4L56A 2W62A 3G1XA 1S3TC 3JVAA 4JD4A 1H62A 3LCLA 3REQB 4PUMA 4GIRA 2WVVA 1OT1A 1JZ4A 3AMLA 5C9UA 2O9TA 3QFWA 4K38A 3N2CA 1WXZA 2HZGA 1T40A 4KW2A 4Z2LA 4LYKA 3LRMA 1P48A 2V2DA 3B8TA 3EPNA 2R1PA 1EJRC 2O55A 3ITOA 3WKZA 2GOKA 5FF4A 4DYJA 4AZ6A 3BV4A 2WSQA 3DHPA 3S8HA 3W1XA 1JPDX 3L7RA 4QROA 2YW4A 4D6CA 4UWMA 1AZ1A 4C60A 3BK0A 1ISYA 2WHJA 4UTJA 3PWGA 3GY1A 1UMLA 3E6EA 3DX5A 2NT1A 1YBQA 2PZNA 3QF0A 4L6OA 1GOKA 1GKQA 1LG1A 4QDWA 4HSOA 3B9OA 2HISA 4ZGYA 4DUOA 3CQIA 1E51A 3BAWA 2P1FA 1MEIA 4R27A 5AOUA 3UWEA 1HN1A 5FKYA 1CWYA 4DJDC 2CZ5A 2IKIA 4UOJA 1V4YA 3A5FA 2PDPA 1T0OA 3COTA 2PTYA 5I3IA 1EBGA 5CPOA 3QY6A 1W3JA 4ZZ9A 3P2VA 3W53A 4B9YA 3MBDA 3W7IA 2YBUA 5A6KA 2B4GA 3FSUA 4GIEA 1JCYA 1CECA 3MJYA 1ZSXA 4TIMA 2E8YA 4JY8A 4ERGA 2ZBTA 4H9YA 5HNUA 3AZSA 1K8CA 3DYMA 3IVUA 1ZBCA 4A6GA 3OZYA 3GRIA 3N25A 1W9PA 3OG3A 2J9YA 4KRUA 4BEQA 4NXKA 5AY7A 3W27A 4HHHA 4B16A 3TYEA 4RK8A 2OOFA 2EPHA 3GNRA 1GYNA 4JTAA 4MKSA 3DENA 2PC8A 4QCFA 2O9OA 4O50A 2VQTA 4ERAA 4DEFA 2VGGA 4H3DA 3TSBA 2A6LA 1XIFA 1UOZA 1VFTA 2XVPA 5HR7A 4S3JA 4XUYA 3NURA 3H7VA 4X9YA 3KLKA 1XYAA 3SIMA 1EB3A 3T6CA 5LHFA 4WKHA 2DV0A 3EDEA 2PPGA 4V15A 1EGMA 3ES7A 2J7BA 3STCA 3TCEA 1U2YA 1YYAA 3VD5A 5BZAA 3M46A 4AY8A 1Q65A 3MUY1 3UU0A 3W7OA 4RZ4A 3QV7A 1YTDA 2Y2WA 1E6RA 3W2LA 3HGSA 2IXVA 2EPMX 3PPHA 3V5FA 1E56A 1F7BA 2OLSA 1BWLA 4Q4SA 2J47A 2VX5A 1SW0A 3ARSA 3QR3A 2VI0A 4XUGA 4AVOA 4NJJA 2OEJA 2WJEA 4E5TA 2BHYA 1AH4A 2DUAA 3ZIZA 1K77A 4Y9AA 4PUEA 3DFHA 2ZTKA 4GD0A 4R53A 1T8XA 3R89A 3CO8A 4L9YA 1G1YA 3V18A 2CWXA 3AUJA 5TIMA 1HQTA 1UKQA 3GW0A 5D9OA 3FX4A 1KBIA 3F4WA 2J7EA 4KMQA 3E2SA 3MHGA 4OIFA 4UTKA 4Q22A 1QT1A 2ZA1A 1W1YA 5U4NA 1KKRA 1QW9A 1JI2A 2HDJA 5XIAA 1K03A 1SR9A 3NXLA 2WZEA 1BRLB 1IGSA 2PDBA 3I68A 4B3LA 2XFWA 3VX1A 1VBRA 4HMNA 2DQWA 2Z24A 1B9BA 1W2VA 4DWSC 4WF7A 1Y5XA 3SN4A 4M80A 1RVKA 5J5RA 4U4MA 1BYDA 1KO0A 1Z8AA 3W71A 3M47A 2Y5SA 1F2JA 2HS6A 1E9IA 3BWWA 3P62A 2QCLA 4DBEA 1X1ZA 1J4EA 3S9YA 2YR1A 1CXFA 4ZQNA 4GC3A 1OD8A 2XVNA 3IRDA 3EX6A 4AEOA 3WMCA 2WB5A 3N6QA 2J6VA 4WGXA 4FX7A 2NZLA 3HPAA 3PJTA 1KCLA 3VINA 1O66A 1OABA 2PWVA 4US6A 5H2ZA 1XQKA 4WJXA 2Z1SA 2Y85A 3GDRA 3M0JA 5AYXA 3ISIX 3KBNA 4DYEA 1KD0A 3GS6A 3UA4A 4Y9MA 3APTA 4DLMA 4NASA 3LCIA 4WGHA 5TQLA 1HL8A 1JAEA 3BGJA 2PD9A 2RH9A 3UG4A 3NO3A 3ITCA 1TTJA 4Y8EA 2DZSA 2Y7EA 4QNEA 1F6PA 2PA6A 3KOZA 4O0KA 1IWBA 2DDXA 3QEZA 2JK2A 1SU5A 3IJIA 4FXJA 4PTVA 1CGXA 3W74A 3KVJA 5IFTA 3L12A 1Q85A 2HWGA 3W00A 3P0XA 1SW3A 3IVTA 2YDSA 1X6UA 4C7FA 4XZLX 3TYAA 4RNFA 4PRRA 1WDRA 5C5YA 1ZTVA 2P5NA 3MP3A 3UQNA 3BCFA 2P76A 3GBEA 3L5AA 1FHDA 1XCFA 3UYCA 3TW9A 5HWJA 3UJFA 3WD3A 4NRSA 3TOYA 4X0NA 1GJPA 4CNSA 1B3OA 3QC3A 4MNKA 1EJ7L 3G1AA 4PL2A 1WBHA 4Z2JA 1J93A 1B9ZA 4PUNA 1CI1A 3RJYA 3SCWA 1WDQA 3H2AA 2CKRA 2GQ8A 2V68A 3EA1A 2YDQA 4GZJA 4BF9A 3TK7A 4KQNA 4YXGA 2GGJA 4KEMA 3EMZA 2PLCA 1QVBA 1E6PA 4AU0A 2C6QA 1QBBA 3VD9A 2GJXB 3T0TA 4CUCA 5E09A 3L23A 4GH3A 1JG9A 1OT2A 4S3KA 4UQ9A 1SO5A 4AWUA 2JGQA 4WDXA 2VMFA 4YN5A 3DYPA 1LROA 4UTLA 1GVOA 4YMZA 4UFMA 1HKIA 3H70A 4C1NB 5IOBA 4GI9A 3V5OA 3OIHA 3M43A 4FLSA 4QLLA 2XFFA 3EX2A 4O0ZA 2EPNA 3LG3A 3SSJA 3EWCA 4G1NA 3KRUA 3P14A 1FCQA 1GHSA 5HULA 2VX4A 4RR4A 5E6YA 1UQYA 2VRJA 4LV9A 1PO9A 1TX0A 4Q4PA 5A6BD 1VENA 2VXNA 2YA1A 4XAZA 5KETA 5KEZA 1R5YA 3FVMA 4XWUA 4IP5A 3FFSA 3CZEA 3DHUA 2NV2A 4NI3A 3MKKA 4UXDA 1L6SA 4JTUA 3UR5A 3AISA 3MSRA 3BH4A 2WZHA 5CGTA 2DVUA 3CV7A 1RZMA 4L9ZA 4S3GA 2XISA 1GKRA 4JTGA 3DAQA 1DWFM 1H7PA 2WBGA 1CXIA 2VZSA 5JMUA 5DRCA 1QWKA 1MW3A 6REQA 2DSUA 4DZIA 2PGFA 1PIIA 4XZHA 3R2GA 4K37A 4XKYB 4DWDA 1JXKA 4ZB5A 1LZOA 3NQGA 4UUIA 3W24A 5HA7A 3NSNA 5A6AA 3LPOA 4UTWA 2JKEA 1T96A 1AD4A 3M44A 1TTPA 3UESA 2X0HA 4DM1A 1XLDA 1Y65A 1JPHA 4MMWA 2POZA 3T0CA 4KESA 1QHOA 4HU3A 4H8NA 4JKMA 1Q8JA 2VP8A 5JH1A 4QRNA 1TYGA 4C6NA 1H7XA 3JU2A 4G1KA 3RG6A 4JOMA 4IGMA 1KCKA 4MNJA 4GYJA 1OM0A 3GIYA 3H7RA 2PP1A 4AZBA 5REQB 4ZOEA 2AGTA 3FCPA 3KL5A 5C8BB 3MC5A 2IPWA 4WZHA 2NQ9A 3R10A 4OOUA 1ITUA 4G5DA 1DXIA 3WH9A 1VBJA 5AHNA 2PU1A 4GXMA 1XKYA 4GISA 4HA0A 6TAAA 1O4UA 3W3OA 3H54A 3QGKC 4MWAA 1E71M 4HNNA 3TZFA 2QGYA 3L4XA 1D2KA 3TAKA 5D8ZA 5M2FX 3ZJ6A 3CHDA 8CGTA 3T1GA 3KVLA 1K8ZA 2GGIA 4JCMA 1SVDA 5HJYA 4ZXLA 3WY1A 2X09A 1ZENA 4CEXC 5A5WA 4A35A 3W0KA 2PWHA 5D2YA 3LOTA 3UNDA 4Q33A 4L1WA 3A4XA 4ICMA 4DF1A 1R86A 2RHGA 2OEMA 4EWJA 5HMDA 2PFHA 4PCPA 4E4UA 3NTYA 1V0MA 2YL6A 3LTPA 3LTYA 3W07A 1OC7A 3VCCA 1XIGA 4C6QA 1TX2A 3IUIA 2BBFA 4FOJA 3ZR6A 4NY2A 4Q7IA 4P7RA 3UXIA 2QV5A 4CNUA 4YWSA 4H1ZA 3B97A 3CPGA 2OSXA 1Z44A 4XAYA 4Y9NA 3UZXA 1OQFA 1EXBA 1W3LA 3VC6A 2OSWA 4GQBA 2ZRWA 2J6XA 1UR2A 3RRAA 3MO7A 4JCLA 2YCJA 5FIPA 2JQXA 2PTWA 3E0WA 3W85A 3KL3A 4F0HA 4MYAA 2J78A 3TJXA 3BDKA 1UWUA 1RLCL 1MRAA 2G8ZA 2C91A 3DFPA 4IIBA 4IM4A 5H8MA 3KWXA 4ONVA 3QFEA 2HBXA 3TFXA 3JS3A 5LA2A 1R87A 1JF6A 1S5NA 2Z1BA 1BWVA 1UKSA 2IQTA 4GNKB 5ABGA 1MSSA 1VFUA 5EMLA 2VQUA 2X7VA 3CH0A 2HBVA 3BQ6A 1TPEA 4LALA 4PN2A 3TQKA 2X16A 4DQWA 2GSHA 3T0BA 1FCUA 1VC4A 4PFMA 3KBJA 4S1FA 3CHVA 1FWEC 1MUMA 3UFYA 2F2KA 3TN6A 1GJWA 2FMOA 4QLJA 2G0WA 1US3A 5K4ZA 4IFRA 2V5JA 4HNOA 1E9ZB 1MWOA 3S83A 1S1PA 4NSBA 4DLFA 1EIBA 4HHMA 4HMDA 4D6HA 2PGWA 4C6LA 5A1AA 4HNTA 1G7UA 4Q8OA 1TUFA 4HPGA 1H7OA 1XKJA 3B8WA 4YHGA 1VCFA 5KTLA 3ITVA 3FA5A 3LXAA 1EYWA 1V3LA 1DJNA 3NQBA 2DT1A 3BJSA 4JIQA 1Q7ZA 7REQA 2GGHA 3QPEA 5FI8A 3SN0A 1N8FA 4GXPA 3MWAA 3SCQA 4YIWA 3DG6A 1KC7A 3WL0A 1A0CA 4RE3A 3DDMA 4MJ2A 2QUMA 5C54A 4G7EA 1X39A 3LBOA 1XUUA 2AOSA 2O9RA 3MT1A 3HPSA 5GQBA 3QTGA 1ONRA 3BJFA 4MLRA 3WBXA 1KBJA 3B0YA 3F4NA 3LLFA 4P2VA 1K8XA 4NNAA 4YCOA 3D6NA 3TAOA 3FYOA 2G95A 2WPGA 1OK6A 3FVDA 1QPRA 3WIJA 1S39A 1ODUA 4H9UA 2PDMA 4CNNA 2FZDA 3MSYA 3FAXA 3TYBA 3DH7A 1OFEA 4BI7A 5CBIA 4WY0A 2OQHA 3W29A 2CESA 4I7WA 4JDBA 1XIMA 4BI6A 5AFDA 3BLDA 4W85A 3IIXA 1SYTA 1GVFA 4L7ZA 1GNXA 3VPLA 3PBVA 2YCLA 3CYVA 2Z1XA 5KITA 3UWZA 3FIGA 1KFEA 5IHRA 3ATYA 4ADTA 3PBGA 9XIAA 2DSVA 5DRIA 1VF8A 4PMJA 5ABFA 5D02A 1C7SA 5L6UA 3VMNA 4IPNB 4EOUA 3B0UX 1MRQA 4NZ4A 4I5UA 1UR1A 1IEVA 2IPFA 4C6IA 5CKSA 1W8SA 1FP9A 4C6KA 1OGSA 1IZJA 4MJ4A 3L4WA 4P8UA 2A3EA 1Q6DA 3PZ9A 1R30A 1BQGA 4RXFA 3AIRA 4PBGA 3VU2A 3K46A 3IIOA 2HROA 3HFYA 4FNPA 2XFYA 5LXXA 4PEKA 3WQDA 2NXHA 4E2VA 1V3JA 4G9PA 3A4JA 1G9HA 1HUVA 1EX1A 4LC8A 2ZYFA 1MVYA 2ZADA 4J3SA 4ORIA 5BMWA 5AVNA 1LG2A 3MV01 2ESCA 1JCTA 4F2BA 3FGCB 1S2VA 4V1XA 2BLEA 1AA1B 3TVAA 2Q8LA 4W5UA 2Y70A 3GZAA 3SQMA 1M04A 4WXZA 3B40A 3UZZA 3NFUA 3SI9A 3GG0A 3RRXA 4U31A 5F4WA 1V79A 3K13A 2Y8KA 4Y90A 1W1PA 1LLOA 1F4HA 4A3RA 4LFYA 4LS1A 2B7QA 4GBUA 4GVIA 4J9JA 1I2OA 3H2NA 5XINA 4WSKA 3CL7A 4MKVA 3AIQA 4XZNX 1TJPA 4L5ZA 1K4GA 1NWSA 2WBKA 4GYPC 5CZ0A 3QV6A 1WDWA 7TIMA 5CPSA 2GQ3A 3NSXA 3N73A 2PLMA 4GQRA 4WY0F 1FVPA 3SFKA 1ZPTA 2EAWA 1ZUAX 4H6RA 1ADDA 4WVXA 1XYCA 3UY7A 4QS6A 3URNA 2IPJA 2WLZA 4PMDA 1VPXA 3R6IA 3AHXA 2BVWA 5FL1A 2XGZA 1EJXC 1OCNA 3E2VA 4O52A 3A5VA 2VOTA 4AB4A 4KEZA 2OWWA 5CCZA 5AHMA 3CC1A 4FHAA 3DI1A 1ONEA 4IZGA 4PFHA 1HW6A 1E0UA 1BTMA 4D1IA 1A5NC 3O15A 5T9BG 1KM0A 4MIMA 1CW2A 1M1BA 1QOXA 1FKWA 4PRWA 4KGLA 1S2AA 2J7GA 2V81A 3ALFA 4L61A 5T9CE 1HJQA 2NLYA 1IE7C 1GZJA 1XCWA 1SMDA 2D2OA 3PZGA 2XFRA 1A47A 2VHLA 1MNSA 1TKKA 3S9IA 1AJ0A 1DHPA 2A7PA 2CHRA 3BLFA 4FEZA 5A8QA 4QE5A 4UOZA 4UR9A 3BLKA 4H41A 3URQA 3HQ1A 2BDQA 1W8GA 5ABTA 4IGNA 3MB9A 4H00A 1LORA 3SCOA 1RCOB 4JTCA 4HB7A 4HPXA 3EGJA 4R33A 3EOUA 4XZIA 1PL9A 3BW2A 1ZU8A 4IIEA 3RAOA 3SUWA 1J6PA 1TTIA 4DXKA 1Q6LA 4YJ5A 3MHUA 4D9PA 4HYWA 1PDZA 1JZ5A 3QKZA 2VOMA 3WBYA 4FMVA 4LVDA 3TUUA 2F6UA 5K7JA 4F0RA 3VGGA 3N9KA 3CTTA 1XIHA 4ES4A 1KFKA 4HCHA 3NG3A 3NZPA 6ENLA 3ZT6A 1HTIA 5I6SA 3GNPA 4QFUA 1JUKA 4L4LA 4WD0A 3LRLA 3LGEA 1JCJA 1TE6A 3F7JA 3W7DA 2E6FA 3HMCA 1VHNA 4WR3A 1MUCA 4MAVA 4JYDA 1JRCA 1VCVA 2AMXA 3GNXA 2VO5A 3VIJA 1MFVA 3RCNA 4WSJA 3EWUA 2C1GA 4RPPA 1QPOA 3WFLA 3IGSA 1W56A 1IHIA 3HPFA 2OYLA 5CC6A 4C6FA 1KFBA 5EGRA 3RHGA 3A21A 2GVGA 1VRXA 4IG2B 3WF2A 3QV8A 1UWTA 3G1DA 2X1IA 2EKCA 3ZM8A 1PX3A 2E6DA 2Y24A 2G50A 4YTUA 1DIKA 3P6LA 3H2MA 5GNYA 4CQDA 1NQKA 2A3BA 2VUNA 3IVSA 4YU1A 3W1NA 3QW4B 1N8WA 1ZJIA 1EQPA 1IT8A 3RDKA 2EJAA 2VZOA 4JTFA 2ZC8A 4MPQA 3MMUA 4EPEC 3OLIA 4HIBA 4UTMA 1ZAHA 1C9WA 1MW0A 3WX7A 2QS8A 3BLLA 3NZ1A 3VNLA 4JTIA 4AZ7A 3KDNA 3W7NA 4CCDA 4LH8A 5HR6A 1G01A 1W1ZA 3O0FA 4LNYA 3F2BA 5BNKA 4YVXA 5A2AA 3GH7A 1XRTA 2G96A 4OJYA 3SO7A 2DT3A 4O54A 1DJHA 4IX2A 2WMIA 1KV5A 1V7YA 4ZE4A 1GPWA 1O1ZA 5C6MA 3A3WA 4W88A 3LN3A 4AD2A 1QR7A 1J5TA 1EO7A 4PTNA 3BLPX 4UFKA 1V7AA 1HKWA 3BG5A 4C6OA 3N34A 3OBEA 5D30A 2RAGA 4PUWA 4RDWA 1IXQA 3NQ8A 3DI0A 4AW7A 4DO4A 3T44A 5B7YA 4IFKB 4FX6M 3BMWA 4AAJA 1H0IA 1E6QM 4REQA 3O07A 4JIPA 1L6GA 1UKOA 5DO8A 1Z9AA 5GJMA 2Y8UA 3BPWA 3LHTA 3TKFA 4CGTA 3VFLA 1I9CB 4Z2HA 1UIPA 3TLLA 1NWRA 3S9ZA 1VLWA 2WV8A 4G2DA 1PZ3A 3EOLA 1NSJA 2RJHA 4F9DA 2W67A 4NKCA 1HJUA 2QT3A 2VGFA 3IGHX 4V27A 3NL3A 1X7FA 4KEVA 3BO9A 4MF4A 3FXGA 1O12A 2X8RA 2KZHA 5EL1A 5I09A 3WFZA 3AYVA 4JFWA 2VDIA 1UZ4A 2I14A 4XQ6A 3WD2A 4Q4MA 5IFPA 3NNTA 3PP7A 2D73A 1V6WA 1B1YA 3NL5A 1IZKA 4LF2A 1JCNA 1HGWA 3B04A 3L67A 2DIEA 4GABA 3UVAA 1W3IA 2EF9A 4KRZA 1M68A 1UC4A 1UOKA 3RPMA 3AJ7A 3AWOA 1JQXA 4QITA 4X63A 2Y62A 3SECA 2A1YA 4Q4KA 3S5OA 2DQXA 2F9RA 3AYSA 2OLHA 3CV2A 3VNYA 3W83A 2ZUSA 1WB0A 1H5VA 2QNEA 2BODX 2XYLA 4AEFA 4DUWA 2GUBA 1F4AA 4IIDA 3DUGA 1YXYA 3ZVIA 4JBRA 3G8RA 1UH2A 3S42A 1UH4A 1JDDA 3OVQA 2ISDA 4WDUA 5GPRA 4NIRA 1V0LA 3UG3A 1KXQA 2GOUA 1FWDC 1YX1A 1PWLA 3M5YA 3TP4A 3M5ZA 1FDZA 2BXVA 3N14A 1D9EA 3W2UA 4DJDA 1QUMA 5JIWA 1J2BA 3E5BA 3JZUA 5AC5A 4QDMA 3BG3A 1HFBA 1PE1A 1UZ1A 2XH7A 2BG5A 2OQLA 3G6MA 3UERA 5K3VA 3U48A 5C2XA 1JZ7A 3WCZA 3LK6A 3C3NA 2YXOA 1K3UA 2D3NA 2J13A 4PBFA 4P8XA 2AL2A 3WLOA 2AAMA 2ALDA 2ZKMX 2Q3OA 5F4SA 1UD5A 1ZALA 3RMEA 1CGUA 2I5QA 3ARQA 1KGUA 3W6MA 1E6ZA 1B4KA 3VO0A 5BU9A 5A8OA 4FF7A 3NPUA 1FHVA 4HYVA 3KBVA 1Q7QA 1TPWA 4AMCA 4IP4A 2A3LA 3VKBA 1H1ZA 2Y88A 1I2RA 4Q8PA 1PUDA 4AD3A 3C8NA 3WUFA 5MHBA 1QPNA 3B8IA 2WVVB 4CEUC 2Y63A 3EDFA 4ENLA 3LHVA 4HA1A 4RKAA 4PMVA 4A29A 3OODA 1PTDA 2QUVA 5BXTA 5F7UA 1LJYA 3KS6A 5I0DA 4X9SA 4NNCA 3VFCA 3TJLA 3WLIA 5LNVA 4M51A 1RP9A 3RFAA 1U1HA 1AZ2A 1ISZA 5LHEA 1O5RA 3RM9A 1PJ9A 3CBWA 1UKPA 2W27A 1OCJA 5I24A 4L4OA 1FWAC 1AFSA 2DVXA 5D38A 1RBOB 4JFSA 3LMYA 1YBQB 3KCJA 3OTRA 2ZXQA 3BC9A 5CH9A 4ADUA 3VZZA 4A8IA 3FOKA 4UOQA 4S3DA 3IGXA 4JAWA 3POHA 3CH9A 3RGTA 2E7FA 1VJZA 2P10A 1LQAA 2XN1A 1H7NA 1Y0EA 4XD6A 3GC2A 1TPB1 3AXXA 4XKMA 4A8LA 4ICNA 1EF2A 3TOPA 1AQFA 1YNPA 2ZA2A 1DKWA 4NF7A 3DFQA 2HXTA 4TV5A 4DNHA 3DC8A 3JUGA 1NOUA 5BXRA 1LOSA 3NQ7A 1HKKA 1TWZA 3VOHA 3D3AA 3VNJA 4L6HA 1UJQA 1A5OC 3QYQA 4HOZA 1V93A 2O92A 5F2IA 5XIMA 1LLZA 3M0YA 3R8GA 1VYPX 2BHUA 4R7OA 3O6AA 3ZJ8A 3EZ4A 2NQLA 2X41A 1TPDA 1BLIA 1Q2RA 5G4WA 1L9WA 5D9NA 3GXMA 2J8GA 1JDEA 3NM1A 4X3ZA 2VC7A 3ARRA 4DWSA 3F4CA 3MUXA 1S2TA 1NP2A 2CZEA 3AFBA 2Z2UA 4IHCA 4LY4A 1R9ZA 3W73A 4TV6A 1Z42A 3TA6A 1NAL1 3UT0A 5GVJA 1TR1A 5D03A 1UIOA 1Q6GA 1U1UA 3EPMA 1OWQA 1I1XA 1GPFA 5C7VA 2F84A 3BCDA 3BSGA 5DCBA 5JU6A 1W1TA 2QCCA 1RXOB 4QSHA 4AWSA 3H55A 4A8NA 1JDAA 3HM7A 1R9XA 4FALA 1H7WA 2ZUVA 4Z42C 2ODOA 3OW1A 4I9AA 4HTBA 4FI4A 4LS2A 3GG7A 1TPUA 4JEQA 5DMLA 3B0XA 3QZEA 1WAUA 4WJ8A 1TZ7A 2NSOA 4LOCA 1QO2A 3OQ8A 3WQOA 3VIIA 5C2GA 3PAJA 1F6KA 4G6CA 1ZP3A 3EEGA 4CKQA 1V3MA 1J0KA 1GVQA 2QCFA 4K8HA 3DOPA 4MFEA 1OGBA 3P3BA 5DBUA 1HGYA 6A3HA 1ZCOA 1I4NA 1C91A 3VGEA 1FH7A 3DG7A 2VEGA 4ZENA 1IEQA 4AZCA 3RPTA 4GIYA 1IZCA 4OZOA 2QHAA 2VKZG 3VIHA 4LCRA 4K7YA 4CNOA 4GY7A 4NQ1A 3C86A 3V36A 3QHMA 1B57A 4M19A 1HP4A 1GONA 2WNWA 3M5XA 3AHYA 1WZLA 2V2CA 5EMMA 1KM5A 4D6IA 3HA1A 2V67A 5I03A 5EMYA 1AL7A 1XC4A 3F5LA 3KOWA 3ICJA 5TAOA 3WBWA 1G0CA 5DQPA 5AHLA 3GQYA 1FWRA 3I3BA 2X1RA 5BROA 5LZLA 3VKJA 1RJQA 1IYXA 3PZUA 4IWWA 3W2JA 3W4RA 4FB7A 4NZ5A 4FNQA 1KGXA 3OG2A 1LTDA 2FPVA 3RU6A 4TXEA 4HK7A 1WXYA 3MP4A 4RJEA 1HVXA 5I3DA 1TWIA 2WOQA 4LX4A 1UR3M 1SUXA 3W2NA 3APYA 4YCPA 4CQ9A 1UKTA 5M03A 1C8XA 1Q6QA 3NJ3A 1PEZA 4KH2A 2REQA 3NA8A 1H60A 3FEMA 4J3UA 2O4QA 3IPWA 2Y7DA 4ZA0A 1B3YA 1QMLA 5DT5A 3PUDA 3IRSA 4LNCA 1BPLB 1BVZA 1J0HA 5JH2A 2WC3A 3SIZA 4S3BA 3TNOA 3AALA 1TZZA 5I06A 1VCGA 1CZ1A 2YFNA 3VNMA 2WWDA 5A6SA 4MUPA 1PKMA 2A21A 2W0UA 2I9UA 5KINA 1J6OA 3VKDA 2EO7A 4Z2GA 4LTSA 2TAAA 3UZWA 3KFTA 1Q3NA 1GEQA 2XSAA 3AHVA 5A94A 3CAVA 4DPPA 4BZYA 2CZDA 3G77A 1W31A 2Z1KA 1IEXA 3O06A 5M1TA 1UHVA 4QTGA 1FX6A 4BCEA 4B2DD 1RY8A 4PMUA 3P67A 1ZGDA 1HIZA 1WKYA 1NDVA 4LPCA 3UNTA 1IWPA 3T7VA 5JQ9A 3NOYA 2NW0A 3B8VA 4GQQA 3T2QA 3UG8A 2P8BA 1P1XA 2A3HA 4O4WA 3HOJA 3MV11 4JZ5A 3P84A 3NO1A 2EEXA 4OHQA 1ADOA 4FLRA 2XUCA 2JEPA 1CNVA 1VD6A 3CAKA 3RO8A 5A6MA 4O19A 3ABRA 4JTDA 4XZWA 3E0VA 4ZO9A 1W1B1 3UF9A 1VEPA 4LF1A 3GXIA 3L4TA 3MUIA 1OADA 1NWTA 2O7SA 1V08A 3ZLHA 2D22A 1US2A 4P8WA 3SY8A 3WJXA 3KTXA 4JQ3A 1NOWA 4LU0A 3VNKA 1KFJA 1HJXA 3AIUA 4MLJA 3QMTA 1R38A 3S47A 4X61A 3W6LA 5LSMA 5TBOA 2GUYA 3BLOA 3K4AA 2R9RA 2J8FA 1VEOA 1ICQA 1W17A 1WAWA 3EOOA 3FAWA 4F2TA 2G4JA 1JGMA 3MZNA 4JTEA 2WK2A 1D3GA 4MZYA 3IJ6A 3N12A 4J3XA 3NQ2A 4DRSA 1EQCA 1NFBA 2QR6A 1I2NA 1JULA 4JTTA 1G4PA 2OX1A 2ZX7A 4OV4A 2WZMA 3VKKA 4BK9A 1XYFA 1VIZA 1Q4NX 3PTDA 3AXHA 2GQAA 1WCGA 1DIOA 4I9TA 2E9BA 1AK5A 3BMXA 5BMXA 2YW3A 3IAQA 1QOPA 4IMCA 4HSHA 3LPPA 5BYWA 3N29A 4KCUA 4GCXA 2E5DA 4EF9A 1VHCA 4PSPA 1GQJA 1NDZA 1XIDA 3K4WA 4ZO7A 3SFWA 4QJ4B 2ZX9A 3SJNA 3NAVA 3W28A 3MYOA 2CYGA 4IF2A 3PJXA 4MWAC 4LRSA 5AC8A 1Y5VA 3DKLA 4CD5A 2Y0FA 5AYBA 2P50A 1TQXA 2PP3A 1GTEA 3IJ9A 4AFYA 3B9EA 3II1A 3VM5A 3QRHA 4KRTA 1NJJA 4AISA 1LBLA 4A2RA 4EKJA 4LYRA 4LANA 3B4YA 1ICSA 2Q01A 4M8UA 9XIMA 1J0ZA 3GH5A 1OYAA 3P8JA 4A3QA 2J25A 1QRQA 3W7RA 1O94A 4K1GA 2BZNA 2CFFA 4J2PA 2EPKX 2WVTA 2ZFAA 1XBVA 1V3KA 4IMAA 2DSZA 3EKZA 2C79A 3GXFA 3WQ6A 3TYZA 2CCRA 1I6NA 2V5KA 3PULA 4AQLA 5F1VA 2XH4A 4KEUA 3SCUA 1E0WA 3E2QA 2P53A 1Z32X 4MWAB 1SJCA 4GYFA 5DELA 1LM1A 2VNCA 4GXWA 2VYOA 3LYEA 4Q4OA 5CZJA 2QGHA 4IJCA 2VFGA 4HCDA 4KERA 2P0IA 4C1LA 3I6TA 1A80A 2G3JA 3VZYA 1ZB5A 2FGBA 2ZWZA 3USBA 3EYPA 3VD4A 1CGVA 3KL0A 2RUSA 5KSWA 5LIXX 3CWOX 3T42A 3KTSA 3NL2A 3NZRA 4HMEA 3G22A 1RK6A 3PUGA 3W88A 4WKAA 1MEHA 1RALA 2O56A 1FP8A 2BGSA 3LNMA 2GL5A 1LT8A 4AEEA 1G5AA 4P5UA 1J11A 4D8AA 4H4IA 3T0AA 3DG3A 2YGYA 4B4FA 1SGJA 4JTKA 5LNWA 4LCSA 3L2MA 4UTUA 1GOQA 1XSIA 1MXGA 1YPFA 4FR1A 1OYCA 1H1NA 4ACZB 1DTNA 1BVNP 3RM4A 1QNRA 1B3VA 1V3HA 1EC9A 3R11A 2J62A 4JR5A 5E0KA 2QJNA 1D7FA 4O1AA 4U2YA 4XK2A 5FF0A 2J88A 4LY8A 5A2CA 1AQ0A 4KS0A 3OA3A 1E1FA 3VGFA 1CLKA 5AVHA 3LQGA 3FSTA 4GUGA 3QSTA 1VLIA 1UROA 4FPSA 3S5SA 1FDJA 2GJPA 1CX9A 3AZRA 3MKCA 3WF1A 1S5VA 1UR0A 4PB5A 4D8LA 4NZJA 1TVLA 4AC1X 4XSMA 3WLNA 2PLKA 1YE4A 2FLIA 2ZRYA 3N1AA 1FA2A 1GOMA 1ZBKA 4GH1A 2I5IA 3TFCA 3U5YA 3ABXA 3W2KA 1K7FA 3TIMA 1K7EA 1IIHA 1Q2SA 3OP2A 4QG6A 1FHUA 1KCZA 1OG6A 1GGOA 2Z2AA 2VC9A 4NP7A 2QYGA 1Q8AA 1LP6A 2J9ZA 3L0KA 4XX6A 3EWDA 3KBSA 4KCVA 4FA3A 1DE6A 3L4YA 4OKDA 3P60A 2OYKA 3LRKA 3S3GA 1GOOA 4DJED 5FEZA 1M9HA 1ZBVA 3GHTA 7REQB 2CWNA 4Q8TA 1E9YB 5BOFA 1S5TA 3WH7A 2IXUA 3WSUA 3HG4A 3THAA 3NQ6A 3CXOA 3CPUA 4G7EB 1BG9A 3UZJA 4P7LA 1D3CA 3G24A 4MB1A 4IGHA 4CLMA 1GOIA 3B0VC 1SO3A 1K6AA 2FDMA 1YKWA 5CEWA 2INZA 4PMYA 2HPMA 3O05A 1WOBA 1C8YA 2GPTA 3L9CA 3W1AA 3FLUA 4GI6A 4BQ2A 2VEPA 3AYRA 1H1YA 5A95A 1OCQA 3MDUA 2WW5A 2JIWA 1LL4A 1YNQA 1LQ2A 1ONWA 4C65A 4IPPA 2DZWA 4DM2A 4WY0B 1VPYA 2W9MA 4DBSA 4E4PA 3U4AA 2INFA 1WX0A 1OY0A 4JY9A 1R3QA 3P5YA 5E0CA 3AMKA 1KNWA 1K1DA 2YCLB 1B3WA 2QCMA 1RCXB 5U7SA 1CPUA 1GZGA 5HBFA 2WC4A 4HNLA 3DHDA 5CBBA 4LAUA 1OFDA 1A5LC 4P8VA 3AXMA 3P7YA 3MCNA 3A9BA 5ABFB 3CU2A 2XIOA 1SZRA 1NY1A 1HJSA 2X0SA 3URAA 4BR1A 3SN1A 3VGHA 1PZ0A 1JDFA 1EUAA 4ATLA 1RH9A 2ZQ0A 1MEWA 4AY7A 4OU1A 2DP3A 1DWIM 2NSXA 3I4EA 4MDOA 1PCWA 3UXDA 3RUBL 3W1LA 1QFEA 3WH6A 4M1BA 4O8RA 4JIIX 2IQ0A 3HO8A 2PS2A 3TTOA 4HOXA 4GZ7A 3BOLA 4I9MA 4GZIA 3LBCA 2PAJA 2JIEA 2V5DA 2PSNA 3WDHA 3EPOA 3FW6A 1M41A 1WBJA 2FFIA 2ZXDA 3GVQA 3HF3A 4H2CA 4PYSA 3TCSA 3FJ4A 3DU0A 3W1PA 3HFTA 3HBLA 4F0LA 2PDGA 2VM8A 3BL3A 3SADA 5D33A 2WSYA 3MYPA 4GYKA 1V6TA 3EA3A 4HJWA 2ZUTA 3CEPA 1XISA 2XSXA 3SBFA 3KEHA 1CXKA 1YE6A 5HJXA 3CK5A 1FQ0A 4V33A 3MCMA 2H3BA 2OOGA 3ZMRA 1C3FA 1EJTC 1V03A 3TJ4A 3WO8A 3LY0A 4AZIA 3O9NA 1XH0A 4XISA 1XIIA 3R12A 1AW2A 1MUWA 1BF2A 4AVFA 4L6DA 8A3HA 1NOFA 1RBLA 3RMJA 2XIQA 3AIBA 3V5CA 5ECUA 1EF3A 3PZOA 1EZ2A 4DBUA 3C2FA 2WANA 3DHFA 4LUTA 1D3HA 4OBTA 1UJPA 1TJ2A 1OSEA 2PZ0A 5K9DA 3EWXA 4DJFD 1ZHAA 3P82A 4MVAA 3ZVHA 3MCOA 4GBDA 2EXOA 7ODCA 1HT6A 4JGDA 1A0DA 3VKAA 3NQEA 5GJPA 2DW7A 1TZ9A 3T81A 1HKMA 3WK2A 3C52A 2YSWA 3TQPA 4TOQA 3E38A 4ZOAA 4BFAA 2QULA 4PMQA 2HQAA 3CL8A 4B5UA 4F0KA 1XLCA 4AMAA 2C18A 3EKGA 7ENLA 1AMKA 4Q8QA 1OC6A 1KFWA 1UBPC 1XLHA 1WZAA 3IIZA 4JHMA 3ZT5A 3OIXA 2FPTA 3LHWA 1AJ2A 3HGJA 2NUYA 3VUSA 3VOIA 1W9VA 4O10A 4MB4A 4AH7A 2CZFA 2Y4SA 4EWND 3ECQA 4Z1AA 2OGJA 3P8IA 4PTWA 3NWRA 3W22A 2QMJA 5JIPA 3EDDA 5CPMA 1WUEA 3CZJA 2PF8A 3K1GA 1F61A 3ZR4A 1W1IE 3BW3A 4NXSA 2VCCA 4U5IA 3UA3A 2J79A 4C6JA 4PBEA 2GVLA 3C8FA 4A22A 2OO0A 4AIEA 4FNRA 4FO4A 3U6WA 3MSGA 2C8NA 4HHLA 2QCHA 1PTGA 5CQ1A 1W5NA 1XSKA 4R7WA 5HQMA 3WNNA 4Q8VA 1R6WA 3WEZA 1L2UA 5HANA 1S1RA 1VIWA 1EJVC 1NU5A 4HJFA 5CXPA 2E3ZA 2QAFA 4EX4A 5DN1A 1FH9A 4UZUA 5FEXA 4E2BA 1G67A 3B05A 3TA9A 5G1YA 2MNRA 1US0A 2H8XA 3GDBA 1G4TA 5HNNA 3BW4A 2BVDA 3VCNA 4F2UA 3WK1A 4GFSA 3S5NA 4NILA 3CASA 3GXDA 1PCKA 3VKCA 2HK0A 3DFTA 1A5KC 4NRRA 1GZ1A 2RGLA 5KZMA 2NV9A 3TDFA 4TVCA 4PMZA 3QQWA 2XGBA 1EJUC 1RY0A 2QJJA 4LAZA 1Q6OA 4EE9A 2DGAA 3SQSA 5GJNA 1FWCC 1A5CA 1XSJA 2WLYA 2UV8G 2BY1A 4AZGA 4B5WA 1RP8A 5HWMA 3R8HA 2Z28A 3QGAC 1PV8A 1JEZA 3LI1A 4L9XA 1RUSA 3KOXA 3WLMA 1LCOA 4GRSA 3KDOA 4WIWA 3N3TA 2VR5A 3M0MA 3TTQA 2Z2BA 1OD0A 1OCBA 2CHOA 3GLCA 4RW5A 3HTWA 3DZ1A 1FWFC 3NIYA 4BY3A 3EOSA 1SJAA 4OGZA 2F7FA 2ONEA 4LYPA 1V6YA 2YZRA 4N9DA 2DZBA 4ATWA 4D6EA 3T2OA 4D2JA 5EFFA 5DANA 5AC6A 4JIRA 3V1HA 2OO6A 3BZJA 3GZ3A 1IXOA 2AKZA 2PD5A 2OT0A 3GR8A 3DERA 3H4XA 1W9BM 2XZ7A 4DPQA 3FKKA 4HU0A 1EEXA 2INEA 2I56A 3KLLA 2IKJA 4FOKA 2D0HA 4IPJA 3EWBX 3L68A 3R58A 3A3XA 2RDWA 4JNMA 5G4EA 1VQTA 2WWCA 1W5PA 1XD0A 5G1TA 1P0DA 1JPIA 4HZ8A 3MS8A 3QVQA 4YWIA 4OUIA 1K9FA 1QJWA 1E5JA 2XH2A 3POCA 2WMIB 1FH8A 4AHQA 3B06A 3FJNA 1A5BA 1SO4A 1KLZA 1KV8A 1HX0A 2C1IA 3T40A 4NJHA 3WQPA 4K7VA 1CLVA 1G6CA 3E74A 3HJZA 1Q7MA 3GNOA 5BCAA 1P7TB 2J4GA 1GG1A 4W84A 3C56A 4J35A 1M7OA 4H9TA 3GVRA 4ZBCA 4H04A 4AX7A 4REQB 2GQ9A 2I9EA 4UMBA 2PDJA 4PH6A 2GVJA 1DVJA 3CUIA 3NQAA 4U3AA 2E5BA 2ZRXA 1JPMA 1NF7A 2VWTA 1C90A 1CXEA 3PK7A 2AQOA 4K36A 1HJVA 1V02E 3EMCA 1KXHA 3NEHA 3RX4A 3BTNA 5PTDA 1N2VA 1KBLA 1MMFA 4WKFA 3CWHA 4W8BA 1WO2A 1H7RA 2C19A 4AXNA 4QLKA 3DIPA 5LIYX 2BASA 1CYGA 3BAXA 4KCTA 5FJTA 3SCPA 3NR0A 3BUVA 3V0SA 5G2IA 1JL8A 2QJIA 3HV9A 3GHRA 2CLIA 2XVKA 1PXGA 2ZX5A 4E6MA 4LT9A 3UXLA 3K8MA 3UXAA 3DCPA 3EA2A 1MXSA 3K5XA 1ISWA 1X8CA 3WEMA 5FESA 3RN6A 3WH8A 4HZMA 3STGA 3TXZA 2CLOA 4IQJA 3ID7A 3IIPA 3S2MA 4EAYA 5EMUA 1I0BA 2BVYA 3FHQA 3M0HA 3QLDA 1XHGA 1VYSX 2CKSA 3EDJA 2QCEA 4UB9A 3UCCA 4P7OA 1DJYA 1I0DA 3Q37A 2XDFA 2J7HA 3GKAA 4DHGA 4KIRA 3A3HA 8RUCA 3WNMA 2WZTA 1EPXA 4A3UA 4WQ6A 1ME9A 2CITA 4POCA 4I90A 1H4PA 3PSWA 2WVSA 3L4UA 3V7PA 1S5MA 3N13A 4AF0A 1WV2A 4ZSTA 2WM1A 1VJSA 3SUVA 1A5MC 4XBSA 3KTCA 3BARA 1POKA 8TIMA 4HN8A 4F66A 4K8GA 1RSCA 4L1GA 2OXNA 1IV8A 4UTTA 1UBSA 1UA7A 3CUJA 1Q5MA 3QMRA 2GDUA 5LIUX 3CT7A 3DGBA 1YDYA 1YQ2A 4FNSA 4J27A 1IR1A 4LW7A 1AH0A 1SFLA 4QP0A 2D20A 3LUTA 3W7GA 1KWKA 1TFVA 3I3EA 4V2XA 2AL2B 5BRBA 4RLIA 1XL9A 4YVPA 3DC0A 1JFXA 4PB3A 5E93A 5F2LA 1ITQA 4EP8C 1KM4A 1R8LA 5E0FA 4UFJA 3GAYA 2BFGA 1P0BA 3VIMA 2QPSA 1F76A 3V75A 3GVGA 5KMYA 1GVIA 5JBFA 3MKVA 2XIIA 1T7LA 4YTQA 2V69A 4I8YA 1CGWA 3ZWSA 1VS1A 1E1CA 5A6LA 3G1FA 1HNYA 3BLIA 3VABA 3SCRA 3GC4A 1ZY9A 2V6AA 1RCQA 3M9YA 3SM0A 4WRHA 2HVMA 1RD5A 2WM0A 4RZ6A 3CZLA 4MNMA 3H4WA 1KLYA 3LXCA 3T55A 2P0OA 4O17A 2XM2A 4OUEA 3A6OA 3FK4A 2GJNA 1KQZA 2A79A 3EAUA 4W93A 5FJPA 4FNUA 3TSDA 4IISA 1KW1A 4TO8A 4JQ1A 4Q6JA 1U5VA