3WUBA

The wild type crystal structure of b-1,4-xylanase (xynas9) from streptomyces sp. 9
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
313
structure length
313
Chain Sequence
DTATLGELAEAKGRYFGSATDNPELPDTQYTQILGSEFSQITVGNTMKWQYTEPSRGRFDYTAAEEIVDLAESNGQSVRGHTLVWHNQLPSWVDDVPAGELLGVMRDHITHEVDHFKGRLIHWDVVNEAFEEDGSRRQSVFQQKIGDSYIAEAFKAARAADPDVKLYYNDYNIEGIGPKSDAVYEMVKSFKAQGIPIDGVGMQAHLIAGQVPASLQENIRRFADLGVDVALTELDIRMTLPRTAAKDAQQATDYGAVVEACLVVSRCVGITVWDYTDKYSWVPSVFPGQGAALPWDEDFAKKPAYHAIAAALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural perspectives of an engineered beta-1,4-xylanase with enhanced thermostability.
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase A
total genus 129
structure length 313
sequence length 313
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wubA00
2VZOA 3MUZ1 4UFIA 3WDHA 4F9JA 4NF7A 3CBWA 2B31A 2YDRA 2V3DA 3M46A 4OIFA 2VURA 1FP8A 4W5UA 5CQ1A 3CGTA 1B3ZA 3WFZA 5I5RA 4K68A 3SUUA 5DFAA 1UD8A 4P7OA 4ZXLA 4YHEA 2UY2A 3RM4A 4UZUA 4CD7A 1PX8A 3VDBA 1JFXA 3EDFA 1G9HA 1L0PA 1BYAA 5CSYA 4FLRA 1QBBA 5I2UA 3WH7A 4GI6A 1H4PA 2IUZA 2CBUA 2ZWYA 3AICA 4JHOA 4V27A 2CCRA 1GOMA 2VQUA 4PUDA 1XD0A 3RPMA 1J0IA 1R85A 1V08A 1C7SA 3J7HA 4A4AA 1GQKA 2VRJA 2J8FA 3WDRA 2WBGA 3U5YA 1E5NA 2CPUA 2HISA 1EQPA 5HPCA 4GKLA 4LGXA 3ZT5A 5HXMA 4FMVA 4W89A 4PCSA 1GOWA 3GNPA 3EMZA 5A1AA 2WYSA 4QDMA 1J9YA 4AD5A 1J0ZA 1SR0A 4LYRA 3L4UA 2G4FA 1CZ1A 2PC8A 1JYXA 4U5KA 3ECQA 1UKTA 3DECA 1K9FA 5FCZA 1CLXA 4EANA 3WF3A 1H49A 1VEOA 4CU8A 1E4NA 3BCDA 1JZ3A 4GIAA 1WZMA 4D6HA 1CLVA 1H2JA 2A3CA 3BAJA 4EKJA 4M1RA 1JXJA 5ABGA 4AY1A 4ZENA 4U5IA 3OG2A 5HDRA 3WEOA 3AJ7A 2WXDM 3MV11 2VT0A 4V28A 1WDPA 3OLDA 2J79A 1F4HA 3D5HA 1UR8A 4UQ9A 4AD0A 3N13A 1J0KA 1L8NA 3WUGA 1AVAA 1BTCA 5HNNA 3OGRA 3AMLA 1EDQA 3FW6A 3PN8A 4PMYA 1DWAM 2OSWA 3EYPA 3K4DA 1UQZA 1FHLA 3VGHA 3VDAA 3RM9A 3PBGA 4D6GA 1FHDA 2A3HA 4GINA 4MTVA 4BQ2A 3F5JA 6TAAA 1VEPA 1WZLA 1EQCA 3TTSA 1W91A 4PRWA 4E8CA 1J10A 3MS8A 2GDUA 2XWEA 5C8BB 5EMYA 2DH2A 4KH2A 5E70A 1CXLA 1OD8A 3O6AA 3VPLA 1CGVA 2VO5A 4CD6A 1EHAA 5A95A 4KMQA 3WL1A 2BVDA 1LG1A 3AHVA 1BYCA 1Q4NX 2O92A 1MYRA 1V6XA 4NSBA 4MB1A 4W7UA 1R7OA 4Z2LA 2CHNA 1OGGA 3KWXA 1IZJA 1MW1A 1TMQA 2WM0A 4M8UA 3MANA 2WAGA 4H8UA 1K6AA 1UUQA 1KBKA 4UTFA 1UKOA 4W85A 3W27A 1A47A 5AY7A 1J01A 1Z32X 4MNMA 1UZ1A 2WVTA 4WKFA 2ZOXA 4P8XA 1PZ3A 3WUEA 1JZ2A 1R7AA 3VGFA 2W91A 3ZQ9A 3VUPA 4CD5A 1PJ9A 3CZJA 5IHRA 1V6UA 4WIWA 5A6BA 5ABFB 1UR2A 2YIHA 3GXFA 4JFTA 1BF2A 2D0FA 1JGIA 3BSHA 3POHA 3L2MA 1E6SM 1HIZA 4DWSA 4ATDA 2EPOA 2VR5A 3N9KA 2NT1A 2D3NA 3W4RA 3BAWA 3UETA 1GJWA 2VCBA 1WDRA 1RP9A 2IXUA 5I0DA 3CLWA 8CGTA 1A3HA 1CGUA 2WMFA 1JZ7A 2Q8XA 2X8RA 1OIMA 5BXRA 1XSIA 4DUVA 1OD0A 1G0CA 3WF1A 3SCSA 1JD7A 2ZE0A 4DWSC 3GM8A 2Y8VA 5A2AA 2A3AA 3PZOA 4JFWA 4ZFMA 1W1VA 2J47A 1HJWA 3ZT6A 1NARA 3PZQA 3VIHA 3QHNA 3MKKA 3PTQA 4M29A 2WC4A 3KL3A 4B16A 1H3GA 1J0JA 2QMKA 1E4MM 1GORA 1XSKA 3ALFA 1GNXA 2W4XA 4JKMA 3GXDA 2WBKA 1MXGA 4AD2A 3BH4A 3UCQA 4MNLA 4MNKA 4HU8A 3F4VA 1ZJBA 2WPGA 2XSBA 2EXOA 5A6SA 3VIIA 2V3EA 2JALA 3NSNA 1CXFA 4UQDA 2NSXA 3RO8A 2AMGA 5CLWA 3WF4A 1VBUA 4X0VA 4IPNB 4P8WA 5A6JA 3VILA 3ZJ7A 3VINA 3WDPP 3WNMA 4GZJA 3MV01 2CEQA 2D0GA 1WZKA 2J7HA 2OYKA 4MB3A 1JZ6A 3APGA 4ZE5A 3WEZA 1CGYA 1PEZA 4BQ3A 1BGAA 1MFVA 1NP0A 4H8HA 1BVZA 1VJZA 3OGSA 3WDIA 3CHCA 3MO4A 2E0PA 2JEPA 1KR1A 5IXEA 2D2OA 4AC1X 2FDMA 4Z2IA 1Q6DA 1CDGA 2WCAA 2XUCA 3U5UA 4X0NA 4MDPA 2G3JA 2XM1A 4GO8A 1TFVA 3K46A 4UOZA 1E15A 1V3HA 3VIGA 4TUFA 2BVTA 4LYQA 4TVUA 1GQJA 2ZXDA 4WLCA 3II1A 3SUSA 2Y4SA 3VU2A 4AZBA 3BCFA 3PZ9A 2G8ZA 4CN4A 5CJ5A 1AMYA 2X2YA 3CZGA 1C8XA 3EDKA 4PCTA 2YJQA 1V02E 1QNRA 1VF8A 3T08A 1ITCA 2WLYA 3RCNA 1JYVA 4UQEA 2J78A 2GJRA 5CG0A 3UR8A 5FL1A 1GVYA 4CU6A 1US2A 1FH7A 5JIPA 3KZSA 1W32A 1UWTA 4GXPA 4ML4A 3IJ7A 9CGTA 1F4AA 5ABFA 3BLKA 4AEFA 2V38A 3ZR6A 3UG3A 4DWSD 1E1EA 2F61A 4FLSA 5A6MA 1DWIM 1PZ2A 3KL0A 2E9LA 1QI0A 3AYSA 5BRQA 2WMJA 5E6YA 3EMQA 5JIWA 2DIEA 1KXVA 2YL6A 4WSJA 1V0MA 3A3HA 3N15A 1JF6A 2JEQA 3WMCA 1KGUA 6A3HA 3L4YA 4FF5A 1JD9A 2PBGA 1QHPA 3S2CA 2VOTA 3T0BA 3AS1A 2PWFA 1JNDA 1WZAA 5I78A 3A4AA 5A6LA 3PZUA 4OOUA 1NWTA 3RJYA 2CYGA 1VIWA 2YOCA 2DSVA 1IV8A 1B3XA 1NP2A 3N17A 4KRTA 4W93A 1X1NA 1TCMA 1JDAA 1NM9A 1WDSA 1UKSA 1OINA 2O9PA 1NQ6A 4UQCA 4JCLA 1LG2A 1HVXA 1E0WA 1B31A 2PF0A 3SCPA 1NOUA 2GJXA 5IHSA 3SEPA 3I3BA 2WLZA 1XRVA 3ARRA 4UFMA 1BHGA 3EBVA 1GHRA 2J25A 2EPLX 3A47A 1DWFM 5I77A 4HA3A 5M5DA 3WH9A 1W3LA 2WCSA 1U30A 5DEZA 2V5CA 3WBEA 5I79A 5A6BD 1UWSA 1H5VA 2XIIA 4WJXA 4DUXA 4P7RA 3WH5A 5A8OA 1K9TA 2WMGA 2DEPA 2VRKA 3G6MA 1B30A 4D71A 3CUGA 1UZ4A 4EAMA 1B3YA 4PMVA 3W24A 4JFVA 3K8LA 4W8LA 3GDBA 1V03A 3N12A 3ZOAA 1US3A 3GXIA 4WSKA 1KQZA 1WKYA 4OKDA 1Q6CA 4U31A 4AIEA 2YL8A 4OBSA 3BC9A 1K9EA 2FHCA 3OZPA 2XM2A 3RMEA 2QMJA 1GPFA 1O7AA 1V3KA 4UFHA 1TZ7A 1XSJA 2CBIA 3L4TA 1QW8A 2RGMA 3ARQA 3T2PA 2C8NA 2FGLA 3VDHA 2XIBA 5C71A 7TAAA 5HPOA 5A8NA 4ZXOA 3NSMA 3FNDA 4MB4A 5EB8A 1SYTA 4JFSA 4GQQA 2BHUA 1ISWA 3WDJA 1J18A 4GPNA 1CWYA 4D1JA 2EBNA 3AZTA 3CPUA 1OSEA 2V3FA 1B0IA 2J77A 2VC9A 2G41A 1MWOA 4BQ5A 1EO7A 1SMDA 1HKKA 1HKIA 1JZ8A 2BHZA 4RE4A 4Q22A 1WE5A 2O9RA 1HXJA 2WNWA 2Z1KA 4DM2A 3BMWA 2FH8A 2ZUTA 2OSYA 4F66A 4Q7NA 4MB5A 1E40A 3ZO9A 4WF7A 4B9ZA 1CIUA 1H1NA 1XHGA 4JFUA 3ZSTA 1D3CA 3L4WA 3LPGA 3E1F1 1KCLA 1QHZA 3VD7A 1TUXA 1HP5A 3GXMA 2VX6A 5A3HA 3IJ9A 3U57A 3B9AA 3FXYA 3UERA 2DGAA 4J3UA 4W86A 3D3AA 4AISA 4IPLA 2NW0A 1LLOA 3OLEA 1ZBCA 2UY3A 3OLIA 3UR7A 1UG6A 3OZOA 1HJUA 1RP8A 2WMKA 5BXPA 3CIVA 1EOKA 4E4PA 1E6XM 4UR9A 1W3JA 3MUAA 4TX6A 3VVGA 1NOWA 3AHZA 2DT2A 3I3EA 1KXHA 1HJVA 1BLIA 4P7NA 2WHLA 3VM5A 5TD4A 1JAEA 2Z1SA 5FD0A 2BS9A 3FHQA 5IFTA 3UG4A 4PMDA 3EDJA 3L4ZA 5FIPA 4JKKA 1HX0A 1E9LA 2PB1A 3SUWA 4CU7A 4AZCA 2V5DA 4P7QA 1JYWA 1V6YA 2XVPA 3VOCA 1B9ZA 4WK9A 1QNSA 4XV0A 3AHTA 4UZSA 1JXKA 5A94A 4HZ7A 1MW3A 1UR9A 1HJQA 2CHOA 4JHZA 3WD4A 3MUY1 1X6LA 4H04A 1GVIA 1LWJA 5LA0A 4LPCA 3AIEA 1E6ZA 1ZU8A 1JI2A 3VX0A 4YPJA 2J4GA 1HJXA 1C91A 2J75A 4ACYA 3OB8A 4IUGA 2OSXA 3CHFA 5BXTA 3NDZA 1UOKA 3S6TA 5EBAA 4PMZA 3A4WA 3A6OA 5BYWA 4JIEA 2ZUUA 4DM1A 1VB9A 3VM7A 1UR4A 1RPKA 1ZL1A 4JL2A 3CHEA 3WNOA 3CZLA 3WSUA 4HTYA 1MFUA 4W88A 4M56A 3CUFA 5CGTA 1YHTA 2GSJA 5F7UA 1Y7VA 1KB3A 4YHGA 4W5ZA 3GH5A 3WNLA 3VMOA 4RE3A 3AIWA 3LPFA 1CNVA 4AWEA 2WVUA 5LYRA 1ZBWA 2BXZA 4QLLA 3AFBA 5CXPA 1E55A 3AS0A 3ARTA 1J11A 2EPKX 6CGTA 1IZKA 2WMIB 2WHKA 3MU7A 1E4IA 4QFUA 4XB3A 1PPIA 1J0HA 1BG4A 4KWUA 1CGXA 3HJEA 3QHMA 2WK2A 2PI6A 2WWDA 4Z2HA 2EPMX 3VIFA 4TTUA 1ZBKA 1E70M 1KXQA 2CIPA 3EMCA 2WVVA 2X1IA 1BVNP 3ZJ6A 1VEMA 3WL0A 1ISYA 2F8QA 3PZMA 2YA0A 4N0RA 4J3WA 1IT0A 4C7FA 4PSPA 3W53A 2E9MA 1UR0A 3CH9A 3DC0A 4AZ7A 2ZX9A 4NZCA 3ZIZA 1D7FA 4S3JA 4UFLA 4J3SA 5GNXA 5E6ZA 4R5EA 2E9BA 1W9XA 5A8PA 4JL1A 1OT1A 2AAAA 1FH8A 3WIJA 3N04A 4HP5A 4U2ZA 1W2PA 4HMDA 1E72M 5M17A 3CTTA 5FL0A 1V0NA 4D72A 3FAWA 3EDEA 5GPRA 4E2OA 3VD3A 2XGBA 3FAXA 4PTVA 1OIFA 2WMIA 1TA3A 1GOQA 1XYZA 2ZXQA 1DHKA 3GBDA 1ITXA 1D2KA 1HN1A 2D22A 2WKGA 4LQ1A 1V0KA 2VL4A 4XZWA 3N18A 4L4PA 3ARYA 4PBGA 1E43A 4AZ6A 4V2XA 5BROA 3ARXA 1M7XA 3W37A 3AIQA 2IXVA 2O9OA 4PYSA 5DT7A 2YA2A 8A3HA 2UY5A 4ACZB 1W1PA 3WH8A 3ARVA 3WQWA 4URIA 4CGTA 2X09A 4AIUA 1Q6FA 3WNKA 1V3IA 4CCEA 5CGMA 3VNYA 2VNCA 3FY1A 3T2OA 2XVKA 4UFJA 5D8ZA 4BF7A 4W7WA 3AISA 3AS3A 3AIVA 4R27A 2A3EA 3WEMA 1CENA 3PZNA 3WNPA 2CESA 1OWQA 3TTOA 4B3LA 2WKLA 3K1DA 2VZSA 1J0YA 1XH1A 4A3HA 1TG7A 1HL8A 2WC7A 1JIBA 1TA3B 3IAPA 1QNPA 3AIRA 4W84A 1JAKA 1UH3A 3BLPX 1TVNA 1ISVA 4D6EA 3AIUA 4CUCA 1HKJA 2X0YA 3POCA 1CBGA 3SCOA 2GJXB 4CN1A 4MAZA 1GQLA 1AQMA 2D1ZA 4W87A 3T0AA 1XCWA 3SCUA 4D6IA 2VZVA 4ACZA 4M80A 2BV9A 3VTRA 3U7VA 2J7GA 2PWGA 4AMCA 4AZHA 1QBAA 3AMDA 1B2YA 1V3JA 1GJUA 2YL9A 1G5AA 1EO5A 4FLOA 4B15A 4M82A 1Q6EA 2X05A 4WKAA 3OIHA 4BQ4A 2EO7A 2XJ7A 4GO9A 2AOSA 1JZ5A 3MMWA 1B3VA 1BFNA 4JAWA 2DSKA 3DYPA 1C7TA 1EH9A 1HP4A 2VX4A 4AD3A 2XVLA 4ATWA 1DEDA 2WSKA 5CZKA 5HOSA 3FHAA 5BCAA 2WWCA 4H2CA 2WANA 1RD6A 4HZ8A 3VIPA 5HBFA 5AYIA 4AW7A 3PTKA 4HPHA 3WFLA 2YDQA 3VD4A 5DT5A 4MPKA 3PHAA 4HZ6A 3THDA 1I1WA 1ISXA 5AYBA 2JF7A 1OM0A 1P6WA 3CZ8A 1TR1A 4PEEA 1UKPA 4PMQA 5D9PA 4CN6A 2ZIDA 1U2YA 2DT1A 1VENA 2EPNA 2PBOA 4UCFA 4QP0A 3LMYA 4TXEA 2BHYA 2Y2WA 4BA0A 4FK9A 1KFWA 1E71M 1FFQA 2PWDA 2VR4A 3HU7A 4J28A 1FOBA 3L4VA 4LX4A 2FH6A 4P8UA 1QNQA 5E0CA 3W6MA 3AMGA 4U3CA 3IANA 1B3WA 5BWFA 4MADA 1G01A 5M3WA 2YKKA 2W67A 1UQYA 3CO4A 4D6DA 1BYBA 2W62A 1BYDA 3NYDA 3VIJA 2X0HA 2WSPA 3VMPA 1H0GA 1VBRA 4W8AA 2DSWA 2GVYA 2JFEX 3WQ4A 3SCRA 2XFRA 2VX5A 4HA1A 1E6PA 1FA2A 2W63A 1UHVA 1EHNA 1R87A 1VFOA 2GDVA 1V3LA 1BG9A 3SUVA 3QR3A 1UA3A 2JF6A 1ESWA 3SCQA 5E0FA 4YN5A 2D23A 1G1YA 1M53A 2YL5A 1W2VA 3ARPA 4W7VA 3CZKA 1TE1A 3PZTA 2ZUWA 4X9YA 1EXPA 1UD5A 4HA4A 2BY0A 3NUKA 1S46A 1EDTA 2BY3A 3W26A 1UR1A 3WQ8A 2OWCA 3N11A 1LL7A 5BRPA 2DH3A 3JUGA 3BGAA 5KEZA 5JBDA 3F5LA 2DDXA 2VCCA 1R8LA 1E5JA 3TOPA 2YBUA 1BGGA 2W66A 1Q6GA 2VUYA 2C7FA 1KR0A 1HNYA 2E40A 1PIGA 3VD9A 2PWHA 3AYRA 2G3NA 3SUTA 3ZJKA 3CUIA 4MAVA 4UOQA 3BAIA 3GZAA 2XYLA 1I1XA 1CGTA 1EDGA 1KWGA 4AZ5A 2GUYA 1DP0A 3GNRA 3A4XA 4GZIA 5EFDA 3DYMA 1VJSA 4A3YA 1YQ2A 4PTWA 3UESA 3WUBA 2FHBA 3RDKA 1UD3A 2ESCA 1JNEA 1M04A 4Z2GA 2VQTA 1ODUA 3ZSSA 3RJXA 3MUIA 3W25A 3CUJA 3WY1A 3T2QA 4DWSB 4Z2KA 2JIEA 5CSUA 1ECEA 1OCQA 1V6WA 3TP4A 1H09A 3VGBA 4C7GA 3BAXA 4XX6A 5CPTA 2NT0A 4UOJA 3M7SA 3WF2A 1ZBVA 3CMJA 3GH4A 4MDOA 3SCVA 4Y7EA 3QOKA 1W9DM 2YDSA 2OWXA 4AD1A 5A69A 4D1IA 3VIOA 3CHDA 3KL5A 1XCXA 5BXSA 2WC3A 3WMBA 4HOZA 4M24A 4MJ4A 1XC6A 1H11A 4AEEA 3GTNA 1JG9A 1PBGA 2QF8A 2QLYA 2WMHA 3NDYA 4UQBA 3SURA 4F79A 4PMXA 4U3AA 1QW9A 3AXHA 4QCFA 1G94A 3MMDA 2WHMA 4AZGA 7CGTA 3WMSA 5EFFA 2VJXA 3WELA 1QNOA 3BSGA 2OWWA 4EE9A 3WUFA 2CXGA 1WPCA 2Y5EA 3K8MA 3OA5A 1NWSA 4CCCA 4AZCB 1UD4A 1CYGA 2BY1A 3B9DA 3WDQA 4AIOA 5E9AA 4B3KA 3WD2A 4L4OA 1XH0A 1HJSA 2VVNA 3DHPA 2XVNA 3VMNA 2OLHA 4OBRA 4C7DA 4QLJA 3GNOA 4TTGA 4J7RA 1E3ZA 3GYCA 3SCNA 4JKLA 5I24A 4WKHA 4CVWA 2JE8A 4QCEA 3VDCA 1KBBA 1B1YA 1PIFA 3WKZA 2QPSA 1MW0A 5LA2A 4HMEA 1E0VA 2D3LA 1I75A 2VCAA 1MQRA 2F2HA 3W29A 1GONA 2XGIA 1HF6A 4U2YA 1C92A 2UY4A 3AZRA 3VO0A 2XFYA 4AD4A 1KGWA 3WH6A 2GK1A 2D20A 3O9NA 4TX8A 2J74A 2ZWZA 1UWQA 3GBEA 5A8QA 1HL9A 1NOFA 1NH6A 1LL4A 3DHUA 3IJ8A 4IISA 3DYOA 1HKMA 1UWIA 1B90A 4PTXA 2E8ZA 1C93A 1E6RA 5E09A 1C8YA 2GFTA 2CKSA 1UWUA 4GQRA 4JZ5A 2UWFA 4XZBA 4GZEA 1DTUA 1ODZA 1CXKA 1OB0A 4NRSA 2VMFA 2BNJA 2J7EA 4OUEA 1V3MA 5DO8A 4B9YA 4J27A 1W3KA 2J7BA 2OYLA 1UWRA 3WF0A 1OT2A 4HU0A 1C8QA 2DQXA 3CZEA 2VZUA 1E6QM 1XV8A 4J3VA 1GOIA 2QPUA 1UD6A 1KCKA 5CPSA 1JFHA 1JYNA 3AIBA 1MVYA 1O6IA 4JCMA 4NI3A 1BSIA 4P8VA 4PMRA 3TA9A 1VFMA 4Z2JA 2ZUMA 4D6FA 3AZSA 3RM8A 2VZTA 2WZHA 1H0IA 4HOWA 2YA1A 2GJPA 1WO2A 1KXTA 2G3MA 5DF0A 3KE0A 3HN3A 1GCYA 2BY2A 2J7FA 4BZYA 2VVSA 3VNZA 1QI4A 3LPPA 1GHSA 3IK2A 1QOXA 3WNNA 2QHAA 1FFRA 2XFFA 2WVVB 1W9VA 1EGZA 1PAMA 2OYMA 1QI5A 2EJ1A 2WZEA 3PTMA 1CXIA 3AS2A 2HVMA 4H8VA 3WD1A 1N82A 3L4XA 1CECA 1WP6A 2J7DA 1QHOA 4HMCA 3THCA 2XVGA 4PMUA 4OZOA 1E3XA 3ZJ8A 1C3FA 4F8XA 1GZJA 4UNIA 2DPEA 5I23A 1OGSA 3AXXA 3RILA 3ARZA 1CTNA 3K8KA 4IM4A 4LYPA 3RIKA 1E0XA 4ZEPA 4OJYA 3NSXA 3VIMA 3CUHA 1CGWA 5A8MA 4UFKA 5JBFA 3W38A 3ZM8A 4RL3A 1LL6A 1W1TA 4CD8A 2WVSA 5IDIA 2CETA 2W92A 3QGVA 4F9DA 5A2BA 2ZICA 1AQHA 3PZVA 1LWHA 2YBTA 1J12A 3VIKA 4N42A 3ZR5A 5I3DA 5C70A 1HT6A 5D8WA 2ZUSA 3TTQA 3NCOA 4PUEA 3T09A 3ARSA 3N1AA 4PTMA 3BAKA 1XGZA 4LXFA 1XD1A 2RGLA 1E73M 1FP9A 1GUVA 2QV4A 1FH9A 5D9NA 1MXDA 1CXEA 5FKYA 3AHYA 1QVBA 1NWRA 2XG9A 1BQCA 3K4AA 2ZX5A 2J7CA 4KRUA 2WW5A 2PWEA 5JBEA 2Y24A 4DUWA 4GI9A 1W9BM 7A3HA 3BXWA 2WZIA 2CBJA 3AXIA 3G6LA 3MMUA 4HPGA 3AQUA 1KGXA 2DT0A 1WB0A 2O9TA 2YLAA 1V6VA 3WQ5A 1RH9A 2XWDA 5GQBA 1ZS2A 2CKRA 1NWUA 1JL8A 1SMAA 1E1FA 2GK1B 5ABEA 4AXNA 1E6NA 2WCGA 2YLLA 4XUYA 3WQ6A 3BMVA 1W9PA 1VRXA 1ZJAA 3W82A 4D6JA 3M6DA 3GH7A 1DWJM 4NRRA 4HOXA 1VFUA 4H41A 1E4LA 3L2LA 1GW1A 1V0LA 1UYQA 1BPLB 1UD2A 3VX1A 5FOOA 1W9UA 4CD4A 1DWGM 5GNYA 3SIMA 2J62A 2XPKA 3QHOA 1LJYA 3QOMA 5AC5A 1R86A 2WB5A 3IAQA 3UEQA 1ZB5A 1WCGA 3SCWA 4PSRA 3UG5A 1LF1A 3AROA 1EIBA 1QPKA 1W1YA 2BXYA 2W61A 3VKKA 1CEOA 1UA7A 3AHXA 2VRQA 4FLQA 3AOFA 5IFPA 3ARWA 4BS0A 3CMGA 3TONA 3ZT7A 1EOMA 2D24A 1VFFA 2WHJA 3AMKA 3MSGA 3MSDA 3M07A 4RE2A 5CLTA 3B9EA 4PMNA 3W0KA 4CVUA 2W5FA 1JDCA 2ZXAA 3OGVA 4W8BA 5CPQA 2ZX8A 4EK7A 1SFSA 3B8SA 4QAWA 2DT3A 1W3HA 4H7VA 3FN9A 1UH4A 4OOZA 5M03A 5JUVA 4KGJA 2ZXBA 4S3KA 3WQVA 5ABHA 2ZX6A 5D4YA 3EDDA 5A2CA 2VTFA 4BCEA 4CCDA 3W81A 1CPUA 2E3ZA 3I3DA 1MW2A 4CKQA 2Y8KA 3ALGA 1PX4A 3KEHA 3F5KA 1UH2A 4P7LA 2D0HA 2EEXA 5D9OA 2BVYA 5KZ6A 1V02A 1X6NA 1XYFA 1PX3A 1DWHM 2CITA 3VGDA 1OBAA 1KWKA 1GOKA 3T0DA 4PN2A 1UKQA 1QI2A 2XSAA 1E56A 4J3XA 1QI3A 3SCTA 3VGGA 3W28A 1U33A 3AI0A 4TVDA 4MNJA 2DSUA 5D9MA 5A6AA 3U7BA 4AZIA 3ZMRA 4GI8A 1JDDA 1MQQA 4QLKA 1GQIA 3TTYA 2TAAA 3BAYA 2DIJA 2A3BA 2VI0A 3NIYA 1JF5A 5ECUA 1M03A 1OGBA 2CERA 1C90A 3NJ3A 4TVCA 3AMCA 1JI1A 2J8GA 3VGEA 5LA1A 2G3IA 2XHYA 3PZGA 4J3TA 4M81A 5GNZA 1CXHA 5A6KA 2MANA 2ZX7A 3WENA 1WNOA 4ZE4A 3PZIA 1LQ0A 4ATLA 1K9DA 4U33A 3HMCA 2ZUVA 1KQYA 5AC4A 3VD5A 1AQ0A 5DMYA 3LPOA 2V3GA 5I6SA 4PMOA 2E8YA 1MQPA 3WD0A 1JZ4A 3O2LA 3W6LA 1XH2A 2C0HA 2CNCA 1H41A 2DSZA 1VAHA 4TOQA 4AYSA 2VX7A 2BFGA 4UQAA 1EA9C 1TVPA 3OLGA 1WDQA 2XTKA 2FGZA 3OBAA 4KGLA 4MJ2A 2E4TA 2CBVA 2JIWA 2ZUNA 2EQDA 3WBAA 4D6CA 1WAWA 4E8DA 1GOOA 1M01A 3WD3A 1ISZA 1HVQA 3ARUA 1BAGA 3WN6A 2FHFA
chains in the Genus database with same CATH superfamily
3WDHA 2B31A 2YDRA 3M46A 4GD0A 3N6QA 2PGEA 2I9UA 1NVMA 3CGTA 3ITLA 2PP3A 3WFZA 3LGEA 1Y5VA 1LRQA 3VC5A 1Q63A 3F03K 2PC4A 2JKPA 4UZUA 3VDBA 1I2PA 2QUVA 4JR5A 1JPIA 4LB3A 1JFXA 1G9HA 2DVXA 3GVRA 2EG7A 1L0PA 3T44A 3V4BA 1F3WA 2SFPA 1QBBA 1KD0A 5I2UA 4QBXA 1DJWA 3WLNA 1XLEA 4GJIA 4GI6A 3UYIA 3AICA 5C7VA 1R3YA 4HJWA 1I0BA 2CCRA 1VJIA 3S4TA 4A05A 1GOMA 2VQUA 3F2CA 1XD0A 1XUUA 4FR1A 1KRBC 4A4AA 1GQKA 2J8FA 1E5NA 4CQDA 4GKLA 4LGXA 2HQAA 3ZT5A 5HXMA 3TJ4A 4W89A 3EMZA 1F6YA 1U1UA 2WYSA 4AD5A 1J0ZA 1Q7QA 3M0IA 4GIRA 2QJJA 2R14A 1F7BA 3ECQA 4QJ4B 1CLXA 4EANA 1E9IA 3MYPA 1IEQA 4D6HA 1TQXA 3QN3A 3NQ2A 4EKJA 1YNYA 4K39A 3DG6A 4U5IA 2QNEA 4QM1A 2FPYA 4GA8A 1DJXA 4HB7A 2PDWA 3MBFA 3AJ7A 3MV11 2CZFA 3K30A 1WDPA 2J79A 2V5JA 4FXFA 4PH6A 3UPMA 1V8EA 4TR9A 3IEBA 1UR8A 3WO8A 4UQ9A 3N13A 3HG4A 3WUGA 3P2VA 3OGRA 4OE7A 3IVTA 3AMLA 1XLBA 2NX3A 3WLLA 2J27A 2KX9A 1POJA 2OSWA 3K4DA 2NUYA 3BMXA 1TV4A 2V82A 3H70A 2A3HA 4GINA 1K6WA 5D2TA 3I4KA 6TAAA 5SWUA 1EPVA 1EFZA 1C9DA 1WZLA 2WNZA 1CCWB 4OFCA 4E8CA 4DO6A 3ORWA 2QDGA 1AG1O 1CXLA 4LH8A 3UZXA 3O6AA 3LCWA 5E1QA 1OYAA 1Q2RA 5A95A 1TPDA 1LG1A 1N8FA 1E9YB 5C2GA 1JUEA 3EWZA 3NQ7A 3HG5A 1K8ZA 1PV8A 5HUOA 4Z2LA 2FMNA 2V9DA 2G0WA 1ADOA 2P5NA 2Y8UA 4A6GA 3GXTA 2XH7A 4EXBA 2WM0A 4ZZ9A 1KFJA 2D2HA 3W27A 1A47A 5AY7A 3TOYA 3SQSA 3BG3A 4WDTA 4P8XA 2A4AA 3W75A 3VGFA 4CD5A 3CZJA 4A8NA 5ABFB 3MUXA 2YIHA 3OYZA 1JGIA 5EMJA 5MKGA 1I45A 1E6SM 1NFPA 2QW5A 1Y0EA 3COTA 4DWSA 4ATDA 3L23A 3MVTA 4AY8A 3BARA 4WDWA 3BAWA 3KVLA 3UETA 4HVXA 2QCDB 5HMSA 2V5LA 3A3WA 2NQHA 2ZRWA 1QK2A 2Z29A 1X6UA 1XF0A 4F4RA 1LORA 8CGTA 1TWDA 4GYPC 1CGUA 3ZWSA 2QCMA 3CL8A 4CNOA 3AXKA 1JD7A 3W7KA 4FOUA 2VFDA 3TMQA 2A3AA 4Q4KA 4ZFMA 3EOEA 2V69A 2W0UA 4ADTA 1CI1A 3VIHA 3PTQA 3KLLA 1XC4A 2C6QA 2ZA1A 3PY2A 1ALDA 3LV6A 1TV5A 4DNHA 3GUGA 2YB1A 4HNVA 2TPSA 3E96A 1J0JA 2QMKA 1GORA 1XSKA 3ALFA 4JKMA 4V33A 1U5VA 3I68A 3UD6A 4AD2A 3V5CA 2P1FA 3UCQA 3K2GA 4MNKA 2L5HA 2WPGA 5A6SA 2JALA 3KOWA 1XIJA 4FX6M 3WF4A 1VBUA 4PRTA 2R94A 3GO2A 1ZPTA 1TKKA 3VINA 4DJED 2V2DA 3MV01 1F5ZA 1XW8A 1SVDA 2CEQA 3GW0A 4MB3A 5CBJA 4H2HA 1VCFA 1TPUA 4ZE5A 4BQ3A 1BGAA 1KLYA 1VJZA 2JEPA 1KR1A 4DBSA 3VFCA 4O8RA 2QS8A 2GPTA 3HURA 1L8PA 2H3BA 5HULA 3HIJA 1TZZA 3UWQA 2C15A 3M64A 2MUCA 1PUDA 2G3JA 3SBFA 2VWSA 2OU4A 3UXDA 5T26A 2B7PA 3B03A 5LIUX 5K9XA 3MW7A 1AUSL 3NL3A 3SUSA 2Y4SA 3URBA 5CPMA 3B8DA 2DUZA 4TX9A 1SW3A 2ZZ7A 5EU9A 1A5NC 4DNMA 4YVVA 2QJHA 2I14A 3EDKA 1JPDX 1Z69A 1VF8A 3UCDA 1JYVA 3D46A 3ONBA 1SQ7A 5CG0A 1O12A 1HUVA 1R5YA 3VZYA 4UTUA 4LF1A 4ML4A 3H4XA 3NQGA 2VEPA 3EXTA 4K1WA 5ABFA 3BLKA 3G0SA 2X2GA 2V38A 3L65A 2RAGA 2F61A 2AQWA 2PD5A 2E9LA 1QI0A 3AYSA 5BRQA 3RGTA 1EJSC 2WMJA 5E6YA 1WV2A 2DIEA 2EG6A 3N19B 4HNUA 3AWNA 3GS6A 4AAJA 5L6UA 2YL6A 4WSJA 3N15A 1JF6A 2V30A 4J40A 3GKFA 3TCEA 1J8VA 2Z2UA 3IGXA 5F1VA 2JQXA 3T0BA 1R6WA 4QE4A 4UTWC 3WK0A 1XIGA 3LBMA 1VIWA 4JIQA 1X1NA 3MPGA 1WDSA 2KZHA 4UMBA 2GOUA 2NLIA 2O9PA 3T05A 3CK5A 4UQCA 4JCLA 3P82A 4M51A 1LG2A 2QCHA 1B31A 2PF0A 4E3TA 2ZC8A 4X60A 5IHSA 2IQDA 3SEPA 1YTEA 2RDUA 3H2NA 4ZOCA 2Z1BA 1GHRA 3CAVA 2J25A 1CT5A 4GY1A 3HPAA 1W3LA 3S0CA 4HBKA 5DEZA 3A5VA 2YYTA 3OJGA 2GSHA 4Q7IA 1UWSA 2XIIA 1O95A 2Y7FA 1MMFA 3TN5A 2B0MA 2DEPA 1ENUA 3DN5A 4GUHA 3RLGA 1B30A 3CUGA 1W37A 1UZ4A 1KKRA 3S1GA 4PMVA 3W24A 4JFVA 3GG7A 4U31A 3RITA 4OBSA 4ZSTA 1K9EA 1XDMA 3HGOA 3OZPA 3O16A 2V2HA 3PJUA 1GPFA 3DEQA 1V3KA 4HCLA 1TZ7A 4J3ZA 3KX6A 3L4TA 1LOQA 2ONEA 3P8IA 5BOOA 3ARQA 2J8TA 2C8NA 4IMDA 4EP8C 4RJEA 3H21A 4LU0A 3M5YA 3NVDA 2C1HA 1DQUA 3FNDA 4MB4A 3KLKA 3RFAA 1SYTA 4GQQA 1YMYA 3N2TA 3TQ0A 3GTXA 2IPGA 3FGCA 2OQHA 4QG8A 3DBPA 2WOQA 2EBNA 4DAFA 3SN0A 4KT2A 3NL6A 2J77A 3CU2A 1HKIA 5CJMA 3BE7A 3S6DA 3NXLA 1QR7A 2WNWA 4IXHA 4UR7A 2H90A 2OSYA 5FJRA 5DCEA 4B9ZA 3LK6A 3PB2A 1XHGA 3L4WA 1GJPA 1W3TA 3PTDA 1KCLA 3VD7A 1TUXA 3DFTA 3KRZA 3FJLA 4G5DA 2VX6A 1QPRA 3UWUA 2DUAA 1LBLA 3SGGA 1O66A 3T6CA 5CPOA 1QJWA 3D3AA 3PNZA 4AISA 2NW0A 3OLEA 1ZBCA 3EZ4A 2HNHA 3TYZA 1UG6A 3URQA 4O57A 1EOKA 3M44A 4C5ZA 3MUAA 3TNBA 3W7MA 5I06A 1RSCA 1OADA 4KWSA 1ME7A 4H7ZA 2FB2A 1JAEA 3GY1A 1DHPA 4YIWA 4O1AA 3CAWA 2BS9A 2FYMA 5IFTA 3UG4A 3ZYZA 4PMDA 3SADA 2QZRA 3EDJA 8TIMA 1DJIA 1HX0A 2PB1A 4B4HA 3SUWA 4C6CA 4CU7A 3HGRA 4AZCA 1QDSA 4PTDA 3TWBA 3SQLA 1LM1A 1NDYA 5K9CA 3AHTA 4UZSA 3RCMA 3WLTA 1F8IA 4XAZA 4JHZA 2CHOA 3QRHA 4X9SA 3R4IA 4IF2A 4HT3A 3SZ8A 4AU0A 1DQXA 5I03A 5AVNA 2QV5A 1E6ZA 1JI2A 1VS1A 3VX0A 4JDYA 4YPJA 1HJXA 2VGGA 2INEA 1C91A 4GBDA 3OB8A 1VFTA 3C0SA 1UOZA 1KBLA 1V7YA 3DH7A 1FX6A 5EBAA 5HJYA 1KFBA 4US6A 4N7QA 4DXXA 2ZUUA 3E3HA 4O18A 1KTCA 4DM1A 4P61A 5HR6A 2OOFA 3NZQA 2F84A 3UNTA 1UIOA 1RPKA 1ZL1A 4JL2A 3U3HA 3WNOA 3CZLA 1GG0A 4HTYA 1MFUA 4W88A 4M56A 7REQB 1ICSA 3M4HA 2GSJA 3TKFA 3FKRA 1Y7VA 3DHFA 1I6NA 4YHGA 3AAMA 5LYRA 1S2AA 2PLKA 3WLIA 3H26A 3LB0A 3VOFA 2WSRA 5CXPA 4BI6A 3AS0A 1YTKA 6CGTA 3EOUA 3USBA 4QQ3A 2WHKA 3TW9A 1E4IA 4KFPA 3TYAA 1J0HA 3EWBX 5CPNA 4KWUA 3GC4A 5FESA 1CGXA 3QHMA 2PI6A 2GVLA 2EPMX 1E70M 5AN7A 2EG8A 4IJCA 1O1HA 1BVNP 3WL0A 2F8QA 2YA0A 4J3WA 5CH9A 1IT0A 4PSPA 1I2RA 4Y9AA 4IOTA 3P93A 3EWCA 4LY4A 4IGSA 4J3SA 4EPDC 1W9XA 5AHMA 1KM1A 1L2QA 3WIJA 1AFSA 4U2ZA 1W2PA 1PB0A 4Z1CA 3QF0A 2AL1A 2ZQ0A 3FVMA 2IKJA 3EDEA 4E2OA 2XGBA 1VYPX 1LBMA 1OIFA 3UW6A 2WMIA 3FK4A 3Q94A 1XYZA 3WG6A 1DHKA 4YTQA 2D22A 4XZWA 2VL4A 1P0KA 2AAMA 3BJTA 1H1ZA 4PBGA 3QC3A 3N4AA 3FYOA 2R1NA 4LRSA 2J24A 1M7XA 3W37A 2IXVA 5DT7A 2YA2A 4DO5A 8A3HA 3C2YA 7TIMA 4P2VA 4DBWA 1W1PA 1YPFA 1XYAA 3WH8A 2JK2A 3MSRA 1WXZA 3GB6A 2X09A 1KCXA 5KETA 3WNKA 5CGMA 2E6DA 4H9TA 2VNCA 3FY1A 3T2OA 1GVRA 3BWWA 4QDPA 4UFJA 4BF7A 2H3DA 4C60A 3AIVA 3QV8A 2A3EA 5I3FA 3AXMA 1PZ0A 1OFQA 1VGAA 3PZNA 1A53A 3WEMA 4B3LA 1OWQA 2WKLA 1QOQA 1HL8A 1QNVA 1RQBA 4G7EA 3IAPA 3WMLA 1S2WA 1M5WA 4HZMA 2GGEA 4ZQCA 1P6CA 3MCMA 2XH0A 3BLPX 1ISVA 3C56A 2D73A 4L9ZA 4P5UA 4JYFA 3LTPA 1IF2A 5C9RA 4XIAA 2GJXB 4DX3A 3PG9A 3SO7A 4K38A 4W87A 1XIIA 5J04A 3C2FA 3H6OA 3FOKA 1ZALA 4M80A 2BV9A 3VTRA 4FXSA 3U7VA 2ZA2A 3HFTA 4KFNA 1F61A 4E8GA 1QBAA 3AMDA 1B2YA 3KRSA 3LX9A 1G5AA 1EO5A 1GKQA 4B15A 1K7XA 3SGUA 4INFA 3OIHA 2YXGA 3ZZ1A 4IP4A 3W7QA 1C7TA 1B4KA 3QPEA 1EH9A 3B04A 4AD3A 1HGWA 4ROQA 2XVLA 5G4EA 3TN6A 3I6RA 1IQ8A 5CZKA 5HOSA 3FHAA 5BCAA 5G1TA 3VXGA 1P48A 2ISDA 5G1YA 4HZ8A 2ZBTA 3VIPA 3A23A 5AYIA 4AW7A 3PTKA 4EF9A 5DT5A 3AYTA 3THDA 1I1WA 2QJNA 1ISXA 2OG9A 1OM0A 4N6FA 1VH7A 1UKPA 5D9PA 3GX9A 4NNBA 2EPNA 1P5BA 3HQ1A 1EJTC 1KFWA 1FFQA 5FJPA 1GZ1A 4MPQA 4LX4A 1FOBA 3L4VA 4H6KA 2P53A 3JZEA 4KIRA 4AX6A 3W6MA 4WD0A 4NKCA 4U3CA 1ZAIA 3FCPA 4MADA 1G01A 5M3WA 3QR0A 4MY8A 1PKYA 2W67A 4D6DA 4UIOA 4K8EA 1BYBA 1BYDA 2X0HA 1XIDA 2GVYA 3UNDA 3UPWA 4KF1A 3WQ4A 3HV9A 2XFRA 1LROA 3TYCA 2W63A 3ZLHA 1EHNA 2OQLA 2RFGA 1ICPA 3T78A 1TPWA 3GFXA 3O07A 4PULA 1F3XA 3SUVA 1BTMA 4YWIA 1SZEA 4YN5A 1FCQA 2PD9A 1G1YA 1PTGA 2YL5A 4W7VA 1VRDA 3ARPA 3B0UX 3CZKA 3PZTA 5LNVA 4RW5A 4HA4A 4KWOA 2GGGA 2OZ8A 1FVPA 3P84A 4FX8A 1R3SA 1LL7A 2QIIA 1R8LA 1BGGA 1T8QA 1POKA 1FWJC 1R9YA 3QV7A 3W7EA 1HNYA 2E40A 4WGHA 4IFKA 4IHCA 3BGGA 1K02A 4YMZA 4Q3MA 4UOQA 3LHYA 1CGTA 1R2TA 4UMCA 3B9NA 4A3YA 4PTWA 3RDKA 1UD3A 2Q71A 2ESCA 4EPBC 3ZSSA 3RXZA 3W25A 3EXRA 4LUJA 3WLHA 3GC2A 3QBUA 4Z2KA 1H09A 4XX6A 4LTSA 2PDHA 2EKGA 3M7SA 3QY6A 1W56A 3LTSA 3OU8A 3VNKA 5AHIA 4Y7EA 4D1IA 2RJHA 3SQMA 4HOZA 3GLCA 4AEEA 3B8TA 3N29A 1VR6A 1JG9A 2XFWA 1TTQA 2X1RA 4S3AA 2EJAA 4ICMA 3GUWA 2X42A 4AF0B 4MY9A 3AXHA 1IGWA 2FTWA 4BFAA 1G94A 3MMDA 2WHMA 5DMMA 7CGTA 4YYCA 3QZAA 1AZ2A 2ZC1A 1QNOA 5FF2A 3FEMA 4MFDA 4JDBA 4A22A 1N55A 5BMWA 1UD4A 1BWKA 1CYGA 1MUCA 3B9DA 3WDQA 1PCKA 4IPJA 4L4OA 2XVNA 3G8RA 3VMNA 1EJXC 2OT0A 4QLJA 4BHYA 1E3ZA 4WKHA 1Z41A 2PTYA 1EYEA 2QPSA 3IIZA 1MW0A 2FJKA 2G5WA 3TH6A 1J6OA 1MQRA 2F2HA 1CB2A 1W31A 4IPIA 2XGIA 1UWAA 3W29A 4U2YA 3BICA 1GVQA 1RBAA 4Y90A 4FI4A 1GPWA 2ZRXA 3P5ZA 4REQB 5CSSA 1NOFA 4JX5A 3PNUA 3KBWA 1XLAA 3DHUA 4IISA 3QSTA 1BRLA 3W7CA 1UPPA 1X39A 1UP2A 5E09A 4JZ5A 4GZEA 4NRSA 2J7EA 3CEUA 4AB4A 1JR1A 4FPSA 4JX4A 2A7NA 2XN2A 3WF0A 1OT2A 1OG0A 3VNLA 2DQXA 2VZUA 1XGDA 3T4WA 1JQXA 1GOIA 3G24A 3WK2A 1KCKA 5CPSA 1JFHA 3A3XA 1JYNA 1MVYA 4JCMA 4PMRA 4OT7A 5RUBA 1VFMA 3ZR4A 4D6FA 3RM8A 2WZHA 1H0IA 1TTJA 2YA1A 3EXSA 1KXTA 2G3MA 5DF0A 1AW1A 2XIJA 3LLXA 4NAFA 2J7FA 1KFCA 3UZ5A 5FA5A 1GHSA 3IK2A 1QOXA 4JTIA 4J35A 5AC6A 4A29A 2QHAA 1FFRA 2WVVB 2OYMA 4C6OA 1OX5A 2EJ1A 1M65A 3PTMA 4GNVA 1OYCA 2PLJA 2PF8A 3AS2A 3S42A 4H01A 1UJQA 3UY7A 4G6CA 3UVAA 4ZB2A 1W8SA 3SB0A 4HMCA 3THCA 4OZOA 1E3XA 3ICJA 3MBDA 4HN4A 5D03A 3N2CA 3LY0A 4GK8A 3AXXA 2XDFA 4UNKA 5AOUA 5HUPA 4L6DA 1E0XA 4LYPA 3RIKA 3NSXA 3STCA 2F9RA 3VIMA 3CUHA 5A8MA 1AL8A 1NSJA 1SW7A 4JD4A 3W38A 4RL3A 3R5EA 1LL6A 4NILA 4CD8A 2E6AA 1EC8A 3ITVA 5A2BA 4F9DA 4ZTXA 1AQHA 2ZZ2A 3UWWA 1JCJA 2A6LA 4HPNA 3N3MA 1MEHA 4NJKA 2Q02A 5C70A 4DPPA 4Q4RA 3LGGA 3GIQA 4H6RA 4QROA 1A49A 1DPMA 3ARSA 3PK7A 4LXFA 5ABTA 4JICA 2RGLA 1GUVA 2QV4A 6TIMA 3LNMA 4W4QA 1MXDA 1CXEA 2QDEA 2A3LA 4FNSA 4ZQMA 9XIMA 3UXLA 2JGYA 2QCDA 3VOIA 1BQCA 2J7CA 1GZGA 2BSLA 2GLKA 2WW5A 5JBEA 2Y24A 4DUWA 1GYMA 3NZ1A 2ZFAA 2EGZA 4MYXA 3ZVHB 4IFRA 1KGXA 2WQPA 2QEZA 2XWDA 1ZS2A 1NWUA 3UFYA 1BXCA 5FACA 2OEJA 2QT3A 4L61A 1FWTA 5EMKA 4IZGA 3CTLA 3ES7A 3NQAA 3HZ3A 1KO0A 4D6JA 1ZJHA 4N9EA 2BOGX 3KDOA 4H41A 2I5QA 3TQVA 3S9YA 3QR1A 1E4LA 4IX2A 1GW1A 1R3QA 4E5TA 8XIAA 4JEJA 1UYQA 3VABA 1OC7A 4HSHA 1W9UA 2Y61A 3E49A 3T42A 1DWGM 1R46A 4H9UA 1VD6A 5GNYA 3SIMA 2J62A 3QHOA 1TPH1 2QCLA 4UBPC 3MKVA 1LJYA 3QOMA 5M2FX 3MDUA 3AROA 1EGVA 1KCZA 3CWNA 4O52A 2BXYA 3F4DA 2YDAA 3RX3A 1R9XA 1SSGA 2CLLA 4TV6A 3HA1A 1UA7A 4MLRA 5IBXA 2VRQA 2G97A 2IMRA 3ARWA 4BS0A 1VBHA 3TONA 2D24A 1R30A 5DLCA 3RG6A 4I6VA 1Z8AA 4HJFA 4LAMA 3OGVA 1P7TA 1G6CA 3LS9A 1K4HA 4E2VA 1RHCA 2ZX8A 4EK7A 1SFSA 3B8SA 3WJYA 3PC0A 1RAKA 1S5WA 1SJAA 5JUVA 3WQVA 5ABHA 2ZX6A 5D4YA 1BVWA 3R0KA 4MJZA 5A2CA 4CCDA 4KCWA 4UTTC 5IDZA 3RNDA 3AU6A 3PUOA 2NXIA 4U28A 3ABZA 3RMJA 3ALGA 1PX4A 3F5KA 3IACA 4GNKB 2D0HA 3FDGA 2WM1A 5D9OA 4JIRA 1VYRA 1X6NA 5LNUA 4I90A 3WLPA 4ASTA 1DWHM 4IIBA 1KWKA 3T0DA 1J4EA 2YSWA 1CX9A 1E56A 4OUIA 1QI3A 5FJIA 4YL2A 3W28A 2DSUA 1ZCOA 3W9ZA 4JTFA 3U7BA 4EAYA 3UZZA 4GI8A 5CEWA 4QLKA 2YBVA 5AHLA 2TAAA 3BAYA 2A3BA 3NIYA 1XICA 4DWDA 3BCJA 5ECUA 3QM3A 3STEA 1M03A 4O28A 4O14A 1OGBA 2CERA 1YPXA 2OTDA 1JI1A 1O94A 2J8GA 3Q45A 2J9ZA 3VGEA 1OX4B 4HA0A 2XHYA 3PZGA 3NPXA 4M81A 4FXJA 1WNOA 3K4WA 1TV2A 3LUTA 4PFMA 4RDWA 3GNNA 5AC4A 4QJ5B 2QJGA 1AQ0A 3LPOA 4PMOA 1T40A 3Q2DA 2I17A 3OW1A 1M41A 1P6BA 3W6LA 2CNCA 1A5CA 2DSZA 1VAHA 4HPXA 4Q8WA 2OFJA 1EA9C 3OLGA 3HQPA 2FGZA 1JDFA 3EA2A 1XI3A 4H7CA 2Z26A 3HV8A 1BF6A 3QQ1A 4LAKA 3CPGA 3I10A 1XKJA 2HPMA 3IGUA 1M01A 3WD3A 3ARUA 1E9LA 2VZOA 3GIPA 4OIFA 4MWAE 3NL2A 3QY8A 4W5UA 1B3ZA 5I5RA 1AJ0A 4R85A 3SUUA 3CPRA 5DFAA 4PE8A 1FCBA 3TJXA 1KKOA 1W5QA 4CD7A 2G96A 1PX8A 4LVGA 1PTDA 2RJGA 2UV8G 4HHMA 3EDFA 1XR2A 5I3GA 2FB3A 2XN1A 2BX7A 2HJPA 2VFHA 4RLIA 2I9EA 1H4PA 1FUYA 2IUZA 3NQFA 2I7GA 4JHOA 4GZ7A 3B0XA 4V27A 3A64A 3PUEA 2R1MA 2Y6ZA 4MUZA 1R85A 1V08A 1C7SA 3J7HA 2VRJA 2GWGA 3V16A 4AHPA 1LCOA 3QY7A 4UXDA 4LAOA 2FPVA 4PCSA 1GOWA 4C6MA 4ZQRA 1J5TA 4H9YA 3LENA 2GJNA 3B4UA 1J9YA 5C9UA 4AYGA 1SR0A 5HINA 4GABA 3L4UA 3CH0A 2PC8A 1JYXA 4U5KA 1PDZA 4IL2A 5FCZA 2NX1A 4A8IA 2IKGA 2C18A 2WKJA 4S3GA 3TQPA 4CU8A 1EP1A 4O16A 1WZMA 1CLVA 2A3CA 2DQWA 5DMLA 3BK0A 4M1RA 1JXJA 3QMTA 5FJTA 1JJKA 3QMRA 1Z3NA 3WEOA 5K3VA 3KTCA 1QO2A 3ZLFA 1XLKA 2QJMA 4WEVX 3FJ4A 5PTDA 3TSMA 2GGIA 4QS6A 3UXAA 3D5HA 1XLIA 1GTEA 3V1HA 1JPHA 4AD0A 4M7TA 1L8NA 3W7GA 1US0A 4NZ3A 3BZJA 1AVAA 5HNNA 3MWCA 4JQAA 1EDQA 3VKJA 3FW6A 2PZ0A 3QGAC 3W07A 1H7RA 1S1RA 3PN8A 1GQNA 1NTHA 2IQ0A 4WZHA 4PMYA 3AALA 3CHVA 3EYPA 1UQZA 2YPIA 3VGHA 3RM9A 4GFSA 3PBGA 2X1SA 5HA7A 1XYBA 1IYXA 3OHMB 2QPXA 3CASA 4MTVA 2Y85A 4ZVJA 3LCHA 1I2OA 3XIMA 4IIGA 1KM4A 4WXZA 4PRWA 1J10A 3UWYA 5EMYA 4KH2A 3L66A 1OF6A 2Z0IA 1TB3A 1X97A 4CD6A 3TVAA 1EHAA 4KMQA 3IPWA 4RDYA 1C29A 1WXJA 3PWGA 3AHVA 2QCNA 1Q4NX 2H9AB 1ECQA 3SN4A 2CHNA 1OK6A 3KWXA 4AC7C 4M8UA 4Y2WA 4PCPA 4YU1A 1L6YA 4EXQA 4H8UA 4O13A 3E2VA 1KBKA 4UTFA 1IXOA 3EKLA 4C6KA 1UZ1A 4WKFA 2ZOXA 5J8LA 3TX9A 3VUPA 4RW3A 3B4YA 1FWBC 1YW1A 1PJ9A 5IHRA 5A6BA 2VEKA 3NTYA 4GXWA 4WDXA 5C55A 5BNKA 3POHA 3UT0A 2RDXA 4M7SA 5F4XA 3W7IA 3STGA 2VR5A 4IIEA 3LZ5A 2D3NA 3W4RA 2GL5A 3NPWA 2QAFA 1XLHA 5IBXC 4Z1DA 1WDRA 1Q5MA 3U9IA 3CLWA 4RZ4A 3HG3A 3MP3A 1OIMA 1G4SA 4AWTA 4H9VA 4DUVA 3NWRA 4MZ1A 1REQB 4JNMA 4DWSC 4AXKA 3W3OA 1PHQA 2Y8VA 4M6PA 2PMQA 3G1FA 1OFDA 1WQ5A 3SW6A 1NARA 3PZQA 3QHNA 3B8IA 2YCJA 2PS2A 5HMDA 2WZTA 3V75A 1RALA 5C9ZA 1NY1A 3GTHA 3TXZA 4G2DA 1H3GA 3HPZA 1GNXA 3GXDA 2WBKA 2Y88A 1ZAHA 5TNVA 4E2BA 5DY3A 1ZJBA 1XIEA 2EXOA 1W1ZA 1VYSX 3NSNA 1JRBA 3RO8A 4WXYA 3R94A 3GQYA 4X0VA 4CQ8A 4IPNB 2JBMA 3VILA 3HM7A 5CBBA 3FYPA 3WDPP 3WNMA 4GZJA 3NQVA 4I7VA 4A2SA 2OO6A 2Y0FA 3RRXA 1SJCA 4JY9A 1JZ6A 3QLDA 3APGA 4H8HA 3T40A 3PS7A 3MO4A 2E0PA 1WOBA 3DI1A 4AVOA 2PFHA 1IXPA 3AO0A 4AC1X 4OQVA 3QV9A 4BK9A 1Q6DA 1Z42A 1VCVA 3NOEA 2XUCA 4KRZA 3U5UA 4JYDA 3ENLA 4MDPA 2XM1A 4GO8A 4L7ZA 3TW6A 4UOZA 1Q8AA 4KBXA 1V3HA 4HPJA 2WJDA 3DAQA 4S23A 3JZUA 4WLCA 5I3KA 1AK5A 1GGOA 4EACA 3BCFA 3UYCA 3CJPA 1M3UA 2CW6A 2G8ZA 2ZZ4A 3QKEA 2WPBA 4S3FA 2YJQA 4PCTA 2PDCA 1V02E 2OQYA 3T08A 1FXPA 3RCNA 7ODCA 2J78A 3UJ2A 5FL1A 4GX9A 4CU6A 1XJBA 5H2ZA 1UWTA 4Z1YA 1F4AA 5B80A 3JR2A 1Q2SA 3UG3A 1E1EA 5HQLA 1QWGA 2ABAA 3KL0A 2XIMA 3W01A 3VFLA 1K4GA 5A6TC 1A5KC 3GR8A 3SM0A 1LYXA 1J96A 1EB3A 2JEQA 4FOKA 3W2NA 3CB8A 6A3HA 3L4YA 4FF5A 5CKSA 1JD9A 5AYYA 1QHPA 3S2CA 4EIVA 3AS1A 2PWFA 1XIMA 1WZAA 1RBOB 4PMJA 4N2YA 4IQEA 4OOUA 1B4EA 3CNYA 3TCSA 3GDLA 1GWJA 1XDJA 1I60A 3N17A 1NP2A 1W8GA 1E9ZB 1TCMA 1JDAA 1YRRA 1OINA 1NQ6A 1MEWA 2WSQA 3W22A 3S5NA 4H9XA 1E0WA 3SCPA 4LUIA 1RR2A 3P60A 3OVPA 2WLZA 3ARRA 2VGBA 2CLEA 2EPLX 3A47A 5I77A 5M5DA 3WH9A 3CQJA 3NQDA 2V5CA 3WBEA 3O06A 4A3RA 5A6BD 4DUXA 4K7YA 3NDOA 4P7RA 4GFIA 5HNTA 4JEQA 3DZ1A 4WY0F 4ZB0A 3KBSA 4YVPA 1PXGA 3T7VA 1UASA 4R34A 2WNNA 3GDBA 3N12A 1GEQA 3KVMA 3HPFA 2O7SA 5T91A 3N9SA 4WSKA 3A9BA 3OBEA 4OKDA 2C79A 5HWNA 4AIEA 3G8EA 3BC9A 3SFWA 2BMBA 4LEFA 2D69A 4PRRA 3V0TA 4ZL1A 5F2GA 5HQEA 2XM2A 3IJLA 1M7OA 3SGZA 3H7UA 1TJPA 4QSFA 2Z6JA 1QW8A 3V1PA 5CC5A 4HNCA 3T2PA 2FGLA 5LGZA 3RU8X 2OGYA 5TF0A 5C71A 4ZBCA 5D32A 3EKGA 4F40A 1VBGA 2BHUA 4O4VA 3VC6A 1J18A 1HTIA 4FP1A 4V1XA 1IXQA 1YLVA 4RPQA 1CWYA 3TYDA 3VKBA 1HL2A 3GK0A 1DJHA 2V3FA 2QKFA 3WBWA 4QE1A 2VC9A 5MHBA 2ISWA 2G41A 4HN8A 5KZDA 4GOAA 3A21A 4JQ1A 1FCUA 2P76A 4Q22A 1ZP4A 1HXJA 1SZRA 2C3ZA 3L0KA 4A8RA 1WDWA 2Z1KA 3WZ0E 1PKLA 4XZIA 3GZ3A 2DU2A 3DI0A 2ZUTA 4O17A 4WF7A 4UWMA 1H1NA 4JFUA 3ZSTA 5HQMA 1K7FA 4WUIA 3DFHA 1P7TB 4E3VA 1HP5A 1KRCC 3ITGA 3B9AA 1A5MC 3FXYA 2DGAA 1TO3A 3BW3A 3F7JA 3MCOA 5LIWX 2REQB 4IPLA 2UY3A 4RNIA 4H4IA 2FQIA 2DV0A 3BLIA 2WMKA 2I5GA 5BXPA 1UJPA 3CIVA 4KERA 4H3DA 4E4PA 4UUIA 2Z25A 3H2OA 2DY3A 1NOWA 1DIOA 2DT2A 3I3EA 4MZYA 3SRFA 2QDDA 1QPNA 4FSAA 4AIBA 3IUHA 4FXRA 1H7OA 4I9MA 1HJVA 2WHLA 1DIEA 4RUBA 2Z1SA 4DO4A 1K8CA 2Z27A 4RNFA 4HMNA 3HJZA 1LBFA 4CQAA 3RX2A 4AHOA 4JKKA 3PPGA 1R3WA 1RXOB 2V5DA 1QMLA 2HSAA 2XSXA 4P7QA 3A22A 5XIMA 1NAL1 1I9CB 4IH3A 4IMGA 3LU2A 3G1SA 4NIRA 3M9YA 1MW3A 1TTIA 4G1NA 1HJQA 2AL2B 2BDQA 1X6LA 1UROA 1GVIA 1EX5A 2FZDA 4QRNA 5LA0A 4LPCA 2E28A 3SSJA 3AIEA 1ZU8A 3RUBL 5TAOA 3DFQA 2KAUC 1PZ1A 4Q4QA 4ACYA 2GVJA 3A12A 5BXTA 3R11A 2I5IA 4CCZA 4LEQA 1FWAC 4M1BA 1VB9A 3W7OA 4HYRA 3VM7A 2WJZA 3P80A 1EJUC 3GFZA 2WV8A 3GRIA 4V1YA 3PR2A 5CGTA 1YHTA 1A0EA 2PRHA 2O7QA 3VMOA 3AIWA 3LPFA 2WVUA 4Z1AA 3UZJA 3KRUA 4JNYA 3B0PA 1XL9A 4Q8UA 3V0UA 3VOGA 5KINA 3KCLA 1TV7A 5EGRA 2WWDA 2GSEA 4TTUA 4D9PA 3TTEA 1KXQA 3VE9A 1P4CA 2DZAA 2WVVA 1BD0A 4IMFA 4GCAA 1VEMA 4NYYA 1ISYA 4ADUA 4N0RA 4D2JA 4C7FA 3M5VA 1XBYA 1YPIA 3AWOA 2E9MA 1UR0A 3KZPA 4Z08A 3KP0A 1D7FA 3V5FA 5GNXA 4R5EA 4JTCA 5A8PA 4JL1A 2AAAA 3TYEA 2OT1A 3W87A 5FL0A 2BP1A 3CUXA 1V0NA 1TIWA 4D72A 3FAWA 3B0VC 3MCNA 2A5HA 3LCFA 4PTVA 4TO8A 1W17A 4IMCA 1M9HA 1AZ1A 4C90A 3D3FA 3GBDA 1ITXA 3OZMA 4R3UA 3C8FA 1V0KA 3N18A 4L4PA 4J9JA 1TWWA 4JTDA 1KV8A 2VGIA 1QRQA 3NQEA 2PGWA 1XINA 1O5RA 1AH3A 4H00A 4GJJA 1VLIA 4IQLA 4ACZB 1TX0A 4QISA 1IT8A 5LNWA 2HXUA 1FWCC 1Q6FA 4CCEA 2XH2A 3QC0A 2V2CA 2XVKA 1Q45A 3H7RA 4WCJA 3CT2A 3KBVA 4LC8A 3L7RA 3TC6A 4KCUA 3W1PA 3TNOA 3ZVHA 3K1DA 4HYVA 3V3WA 2NXHA 2WC7A 4DY1A 2R82A 3WQEA 2HK1A 3SFKA 1R47A 4W84A 5DXXA 1TVNA 1M6JA 4FAMA 2NUXA 1NF7A 5AHNA 4EX4A 2O4MA 3SCOA 1J5SA 3UJSA 3T0AA 1XCWA 3SCUA 1YTDA 2VZVA 3M43A 3KCJA 4DJDD 4YTRA 3E6EA 3WJSA 4GI4A 2J7GA 4JTTA 4AZHA 4E38A 4B5XA 5CC3A 3VZXA 4UTTA 4M82A 2OLSA 2X05A 1XG4A 1PCWA 4WKAA 2EO7A 1WA3A 4B5WA 2FZ9A 1B3VA 1BFNA 4JAWA 2DSKA 5AHFA 3DYPA 3ITOA 4I8DA 2HE8A 1HP4A 5CJNA 2Q01A 4ATWA 5EY5A 2WWCA 4H2CA 2WANA 1K1DA 1RD6A 5HBFA 3WFLA 1ZTVA 2ON3A 4IQDA 3N73A 1YIXA 3NEVA 3GAKA 4CN6A 4XVEA 4K3ZA 2WNQA 5LXXA 4QP0A 3LMYA 2BHYA 2Y2WA 1IWPA 1KBIA 4LYKA 2VR4A 4J28A 2VFIA 3OVRA 3Q65A 1S2CA 4XAGA 3N9RA 1AODA 3P81A 3HGJA 5CZJA 1OC6A 4KEVA 3DFSA 1UPMB 4O8AA 3E5PA 4S2CA 4Q6XA 4L56A 3PG8A 4GH3A 1UQYA 2R8WA 3CO4A 4GG9A 1DIKA 3VMPA 2ACUA 3L0NA 4OV9A 1H0GA 2JFEX 4HSNA 3FEQA 3RF9A 3INPA 3MA8A 5DCBA 1EEXA 3OEXA 4U10A 3ISIX 4RV8A 4Q32A 1A3XA 1BG9A 4XBSA 2VGFA 1YEYA 3N2OA 3QR3A 4YJ5A 2JF6A 5E0FA 4H8NA 1XP3A 3RAOA 4CNUA 2D23A 3W7PA 1N8WA 1W2VA 3QZ6A 5LGXA 1XLMA 5BRBA 2ZUWA 4O19A 4X9YA 1RZMA 1EXPA 4Z1BA 3LCGA 1EDTA 2OZ3A 4RDZA 2BY3A 3HQNA 3WQ8A 3CAKA 1IIGA 5BRPA 2ATMA 3W7DA 3BG9A 3UP8A 4F0LA 1D3GA 3TOPA 2YBUA 3PUGA 1Q6GA 2BB0A 2Q8LA 3AYRA 4HK6A 3E0LA 3R2GA 3SUTA 3N2XA 5D37A 1LP6A 3ZJKA 3IVSA 1DTNA 3CUIA 3V35A 3UU0A 2C13A 2YB4A 3PF3A 4OVXA 1DP0A 2BZNA 3A4XA 1UC4A 3DYMA 1VJSA 3LHUA 4GVIA 2V8ZA 3LBOA 1R0MA 2NLYA 1JNEA 1M04A 4RV3A 1ODUA 3ABQA 3WY1A 5C54A 3W1RA 2GVEA 3THQA 1ECEA 3FV9A 3TP4A 4Z17A 5XINA 3ABRA 3VGBA 2V6AA 3W1LA 3BAXA 1HZYA 2WSYA 3ATZA 5EBUA 1KLZA 1RQEA 3WF2A 5CAKA 2QXWA 3GH4A 5T9BG 2P8CA 2HBXA 3SCVA 4MG4A 1W9DM 4JX6A 2OWXA 4AD1A 3VIOA 1Q13A 5BXSA 2PDIA 2WC3A 3W2JA 3WMBA 2G95A 5C5YA 4M24A 1TQJA 1XC6A 1H11A 4GUIA 1ITQA 3R8GA 3GTNA 3RPTA 3GXPA 5IM51 1MDLA 5K9DA 2QLYA 5CAHA 2HNEA 1RUSA 1LLZA 1KM2A 1YE6A 3NDYA 3SURA 1QW9A 4L6HA 3IJQA 4QCFA 3DDMA 3APYA 3TW7A 4AZGA 5AC8A 3KP1A 4AMAA 1U5JA 2X30A 3KOYA 2CXGA 1WPCA 3K8MA 1P1XA 1NWSA 1AL7A 1OABA 3TSDA 3GHSA 4Q8QA 1LT8A 4GJ1A 5E9AA 4B3KA 1HJSA 3BANA 2DVTA 3DHPA 5BOFA 2OLHA 4J7RA 2GQ3A 4JKLA 4YWSA 3S47A 2BVWA 3VDCA 3U4FA 3MHGA 3RLUA 3FSTA 3WKZA 1RK5A 2C91A 1A0DA 1E0VA 2O55A 5TQLA 4UTLA 4FIQA 3FDKA 3AZRA 2UY4A 3G1YA 2Z2BA 3JU2A 2D20A 2OELA 4TX8A 2J74A 2ZWZA 1UWQA 3XISA 1HL9A 2PDJA 2PDGA 3THAA 3IJ8A 1M1BA 1HKMA 1HFBA 3IRDA 2CKSA 1UWUA 2F7FA 3FJ6A 5CC6A 2BGNE 4XZBA 2A7PA 5CPLA 1OB0A 1IR1A 1YDYA 2BNJA 3EWXA 2AGKA 4OU1A 4B9YA 4F48A 3SRDA 1VZWA 4DJFC 4WJ8A 4RE0A 1UWRA 2PTZA 3ZVIA 4HU0A 2QDHA 3CZEA 2B7QA 4MM1A 3P6LA 1NFBA 1OJXA 4BF5A 1UD6A 3GIYA 5HR7A 3NG3A 3ANYA 1O6IA 1Q6RA 1BSIA 2CLPA 3TN3A 2HVNA 2ZUMA 1V51A 2VZTA 3HN3A 2BY2A 4Y8FA 3LA4A 4GMEA 2VVSA 1QI4A 1MI3A 4H6QA 1F2JA 1XDLA 5AFDA 4GQ0A 2XFFA 3O7UA 3S1WA 3SDOA 2HZGA 2PDKA 3TA6A 3MJMA 2WZEA 5EKYA 5G1MA 4ADSA 2HVMA 4QIUA 3T8QA 4H8VA 3BJFA 1SFLA 2XGZA 3L4XA 3NNTA 3G0XA 3CS2A 5EL1A 4R88A 4UTJA 3QTPA 1C3FA 3HOJA 2DPEA 1ADSA 1OGSA 2ISFA 3TN4A 1CTNA 1IR2A 1LOSA 3G1DA 4UFKA 4JTRA 4Q8MA 2OO0A 1W1TA 1GVFA 2ZICA 3UQNA 3VI2A 1SO3A 1OG6A 3M0LA 1LWHA 1J12A 5G2HA 3OOQA 3VIKA 2ISSA 4NAFB 5F4SA 1A3WA 3ZR5A 5I3DA 3JW7A 1LRNA 3TC7A 1X8FA 3W84A 3NCOA 4PUEA 3ANVA 1DXEA 1XD1A 4UTHA 3WLMA 4DBUA 3S2LA 3TFXA 4PB4A 5BZAA 1FH9A 3IWPA 4NZ1A 4IPPA 4IUOA 3F2BA 5FKYA 3QV6A 2OKTA 2XG9A 2P50A 2VDGA 1U1JA 4DUOA 2PWEA 2INZA 4XZNX 3UJRA 2R91A 1L6GA 4GI9A 7A3HA 3G1AA 3E0VA 4OWGA 2CBJA 3MMUA 3AQUA 1K70A 4GBUA 2ABBA 2BOEX 2O9TA 2YLAA 1DXIA 5GQBA 4N6EA 3KDNA 3DCPA 4WSHA 3KS6A 1KM5A 2ODOA 3DHDA 1E6NA 2H8XA 2WCGA 2YLLA 1MRQA 4QG9A 4XUYA 1XYMA 3E74A 3WQ6A 1FWIC 1W9PA 2HXTA 4QX4A 4WY0A 7ENLA 5DELA 1W5OA 4JIHA 3M6DA 3W2MA 3W71A 1DWJM 3NGFA 4F0SA 1VFUA 1TR9A 4GYJA 1JDEA 4NXKA 4ZQOA 2P88A 4LBSA 1WOAA 4M6UA 1UD2A 3VX1A 1FWSA 4C6NA 2YCIX 2PDUA 1GT8A 1W6TA 5EMMA 1PO9A 1OFEA 2ALDA 1Z89A 4F0RA 5AC5A 1ZHAA 3S2MA 3UEQA 1ZB5A 1WCGA 3SCWA 1BKHA 1LF1A 5FJUA 1Q85A 4Q8OA 5CZSA 4FNUA 2W61A 2ZZ5A 4GUJA 3QXBA 3VCCA 5FSDC 5IFPA 3FFSA 4MKSA 3ZT7A 3S5YA 1EOMA 3UY8A 4C6IA 3M07A 3F1QA 3S2NA 5CLTA 4PMNA 3L67A 5AVHA 2PE4A 1JDCA 2ZXAA 2PGRA 3G1HA 4JTSA 4CQCA 3EX4A 5D2VA 4NZ4A 1XQLA 4G56A 1W3HA 4H7VA 4JGDA 4CNNA 3GG1A 3FN9A 3WQFA 3WQCA 4OOZA 5M03A 4I9AA 4S3EA 2XN0A 1D9EA 1MEIA 4L4MA 3EDDA 3R1ZA 2H8ZA 4RZ6A 3M7WA 3KVKA 4CKQA 1FY6A 1DORA 1MNSA 1UH2A 4POCA 5BW6A 4EVZA 2ACSA 3H22A 3DXIA 2XIOA 5AZ1A 3I4EA 3MZNA 1V02A 1XYFA 3G1RA 3V5OA 1ZJIA 2CZ5A 4MWAA 4XZ9A 3C2RA 1GOKA 4PN2A 2HPIA 1UKQA 1QI2A 2XSAA 2ZADA 3HPXA 1VPYA 2A1YA 3R10A 1DJGA 1ONEA 4XAPA 3IIVA 3SCTA 3TU9A 4TVDA 1E1CB 4MNJA 3K1GA 4ZQNA 4AZIA 3ZMRA 4GCXA 1RQHA 3MHFA 3WJXA 1JDDA 1EZ2A 4QG6A 1MQQA 2UBPC 4AWSA 3FA5A 3CAQA 4XD6A 2VEFA 2WJEA 2Z6IA 3NURA 3NJ3A 1C90A 1EUAA 1FWFC 3KVJA 4DXVA 4HIBA 1ME8A 3O6CA 5GNZA 1A4LA 1CXHA 5A6KA 3I6EA 3P0XA 3WENA 2PDQA 2PA6A 4ZE4A 3PZIA 1JCXA 2ACQA 4Q4PA 4U33A 3R8HA 3HMCA 4K6AA 2Z4GA 1F9CA 5FF0A 3S83A 3VD5A 5D05A 1XCFA 1Z7AA 4G7FA 2V3GA 5I6SA 3TAKA 3K13A 5K4XA 5DRCA 3O2LA 1BRLB 1OHLA 1XH2A 4MOZA 3TYBA 4MF4A 4AYSA 4TOQA 1U5HA 1BSLA 1TVPA 1WDQA 2XTKA 3U2OA 2Z1XA 3DC8A 4KGLA 2ZUNA 3RLVA 4D6CA 4LCQA 3OVGA 4BF9A 3AC0A 2E1DA 1HVQA 4ONVA 1OX4A 4BI7A 3CXOA 1EF3A 2FHFA 3MUZ1 2PLCA 4UFIA 4F9JA 2I1OA 3P3BA 4NF7A 2V3DA 3LCXA 1IGSA 4R7JA 4GGHA 4K68A 3FXGA 3OYXA 3EA1A 4P7OA 4YHEA 4GWEA 3R25A 1K8XA 1UB3A 2G37A 1PYFA 5FAJA 1KFEA 4M5PA 1VFSA 5C9XA 1PVNA 1UUMA 3TWAA 3IIPA 3WH7A 1AJ2A 1XIBA 4FF7A 2BGQA 4I5UA 1EXBA 3DKLA 4DAIA 2DZPA 4PUDA 3RPMA 2I16A 1XQKA 1GYLA 3IARA 3EEGA 3U5YA 2FTYA 2XISA 1AQFA 2HISA 4FMVA 3SAZA 1A5OC 5A1AA 1S3HA 4QDMA 1X1ZA 4LYRA 4EXAA 3GR4A 2G4FA 3AUOA 1CZ1A 1BEUA 3V18A 1UKTA 3DECA 1K9FA 3QLLA 4MVAA 1H49A 3LDVA 2J6XA 4EWND 3THUA 1VEOA 3SY5A 2ZTJA 4NZ5A 3BCDA 2NQ9A 3IIOA 4XD3A 3WCZA 4IX0A 5ABGA 3NQ6A 3W23A 4MMWA 3OG2A 1UBSA 1DOSA 3T55A 7REQA 1KFKA 4Q4SA 4S3DA 2WXDM 1OX6A 2VT0A 2D2GA 4V28A 4NQ1A 1F6PA 1F4HA 1J0KA 4DB7A 1BTCA 4QEEA 3B8WA 3SY8A 2PSNA 1F05A 4M6QA 4J2PA 1YXCA 4DIAA 1XLFA 3KS5A 1FHLA 4Y9PA 3B97A 4DYKA 3P61A 3F5JA 1SJBA 5KITA 5DMNA 3TTSA 4JHMA 1EKOA 1W91A 3CWOX 4PUJA 4O1BA 2A85A 2XWEA 5C8BB 4XISA 1XBXA 2R1LA 4O53A 3ERPA 5JH1A 3C2EA 4GACA 4IL0A 3W2LA 3JS3A 3LRLA 5REQB 2VO5A 3MQTA 2R1KA 3EKZA 3WL1A 5AECA 2YCLB 2VR2A 3V0SA 5CGQA 1BYCA 4PUKA 1FKWA 1MYRA 1V6XA 2GOKA 4MB1A 1RV8A 3V7PA 2AL2A 2QVNA 5EMUA 1RBLA 1OGGA 1IZJA 3PAJA 5HMFA 5LHEA 1TMLA 1VC4A 4O0QA 4ZOAA 3MANA 2WAGA 5EMLA 4L9XA 1K6AA 1XIHA 1YBQA 1UUQA 1XKYA 4ROPA 1LRTA 3URAA 3NQ8A 1J01A 2WVTA 2PCQA 2G4JA 1Q7ZA 1XBVA 4GY7A 3E02A 1PZ3A 1XLJA 1JZ2A 2W91A 3T1GA 9XIAA 4JY8A 1V6UA 5DBUA 1UR2A 3HB9A 3N2MA 1BF2A 3BSHA 1EP3A 5KTLA 4GXMA 1K3UA 1DL3A 5EYWA 2O4QA 4LUSA 1OFOA 2VCBA 2PDXA 1RP9A 2NQZA 2IXUA 4S1FA 3WK3A 5I0DA 2GWNA 1A3HA 4XO6A 2Q8XA 2QUUA 2Q8ZA 3TR2A 5BXRA 1XSIA 5LNRA 5HNRA 1G0CA 3EEZA 4G7EB 1G7UA 1R3TA 3SCSA 3W1TA 3HPSA 3WF1A 3GM8A 1Q6LA 4RXGA 4MFEA 5FEXA 3WFAA 5HK4A 1OFPA 1W1VA 2NV1A 3BZGA 1TZ9A 1HJWA 1IEXA 3L5MA 4M29A 2UZ9A 3UCCA 2YX0A 3TSBA 4YXGA 4Y9MA 1EC9A 4GISA 5C9WA 1A5LC 1EX1A 1DVJA 5D09A 4DJEC 3QGKC 2GYIA 1E4MM 3BW4A 1GKRA 4DI8A 1MNZA 4MGGA 3BH4A 1UIPA 3O6DA 3W02A 3WBYA 4H1ZA 2BGSA 3F4VA 3GFYA 3OQ8A 3QJAA 3CYVA 3H53A 2NSXA 1JCYA 1XLCA 3O3RA 2A79A 1EA0A 4A21A 5A6JA 4XAFA 2FFCA 3RK8A 1W0MA 1WZKA 2OYKA 3N6JA 1A5BA 3BVJA 4IG2B 3GU9A 4NU7A 3CEPA 2AMXA 3WEZA 1CGYA 1PEZA 2VENA 1MFVA 3VNJA 1NP0A 1BVZA 3NL5A 3MC5A 3WDIA 2R1PA 3CHCA 2YZRA 1D7KA 4IXXA 5IXEA 2D2OA 1F8MA 3PP7A 4CNSA 2FDMA 4Z2IA 1AW5A 4WJEA 3GHRA 2WCAA 3NAVA 4AQLA 4X0NA 3MT1A 2ZE3A 3S9ZA 1W5NA 2QUTA 3K46A 2YFNA 3Q58A 2VEGA 2XH4A 4ZSUA 2BVTA 5C6MA 3M0ZA 4TVUA 1GQJA 2VD8A 1TIMA 1W3IA 1J6PA 4AZBA 2W27A 3U6WA 5U7SA 4FHAA 2E25A 3W85A 3H54A 1RCXB 1AMYA 2HK0A 2X2YA 3CZGA 1C8XA 1H7NA 1HKVA 5J5RA 1QNRA 2ZDRA 3L9CA 4O0ZA 3FS2A 1YBQB 3B06A 1ITCA 4KPLA 4RX0A 4UQEA 1GVYA 1US2A 3BV7A 4JTEA 2BXVA 3PJWA 4GXPA 2QGYA 1F3TA 4LJ3A 4NAEB 4AEFA 3D0CA 2CU0A 5HNUA 3ZR6A 2JKEA 3OBKA 4LS1A 1QXLA 3ABSA 4DWSD 3LMZA 2DW6A 4FLSA 1DWIM 1PZ2A 1B5TA 3NGJA 2GUUA 2E68A 2HS6A 1QT1A 3ABXA 4LUSB 4FO4A 3W6YA 3TAOA 4Q8PA 3WMCA 1ELSA 4UTWA 4C1NA 1SW0A 2PBGA 1JNDA 3GVVA 1W5PA 4JN6A 2NWRA 3LYEA 4IMAA 4PODA 4Q7BA 5CG7A 2CYGA 1JULA 2DJXA 2DSVA 1IV8A 4PL2A 1B3XA 5I3JA 4DQWA 1HG3A 3W83A 3C2OA 4W93A 1UKSA 2NVCA 1X96A 4NNAA 3C52A 1HVXA 1RJRA 4C6EA 1NOUA 3VOHA 3QZEA 3I3BA 1XRVA 3B05A 3RU6A 2POTA 1DWFM 5D2WA 2WCSA 2TMDA 1NIUA 1G67A 1U30A 2HBVA 5G2WA 5I79A 3OODA 4WJXA 3FX4A 5BU6A 2DVUA 2VRKA 2NUWA 3G6MA 3O05A 1JEZA 4I9JA 4D71A 4EAMA 4XSMA 5D04C 4J1OA 3LHTA 4ENLA 3GG8A 4TU1A 3HBLA 3ZOAA 4RXFA 2DZXA 3GXIA 3DFYA 1WKYA 3R58A 1Q6CA 2YL8A 4JQ3A 5XIAA 2VD9A 4LUTA 2FHCA 2Y62A 1EL3A 1G4TA 4AH7A 4R7OA 3C61A 3RMEA 2CBIA 1VHNA 3M41A 4J5NA 4M0XA 3VNIA 3LLDA 4EF8A 3QPZA 3VDHA 1IIHA 4LS2A 1TYGA 2W3ZA 5A8NA 1HKWA 1TV8A 2Z24A 3C4UA 3NSMA 2QCCA 2YFOA 5EB8A 4XSLA 1T96A 2DZTA 3WDJA 1EUNA 1Z6KA 4B92A 4CNTA 2VFEA 1EJVC 4D1JA 3AZTA 5HANA 5JXQA 5GVJA 1DQWA 4HHLA 5JQ9A 2ACRA 4GQGA 2ATSA 4ILSA 3O0FA 3VDGA 3NYZA 2DZWA 1SMDA 1HKKA 3W1MA 1OFRA 2PRMA 4BJHA 2O9RA 4NUWA 2CLIA 3NEHA 2CWNA 1UBPC 1KW1A 2NQLA 3BMWA 3F4NA 1EJWC 4F0KA 4X2PA 4F66A 3MTWA 4Q7NA 1JUKA 2IKIA 4MB5A 3WQDA 1ZUAX 4I8YA 4O4WA 2OEKA 2OCZA 2E1WA 1D3CA 3LPGA 2CHRA 2X0SA 2FGBA 3E1F1 2NVDA 3U8GA 3GXMA 1OCNA 3C3NA 3UERA 3W73A 4J3UA 4I9TA 2RKXA 3OG3A 4W86A 4FZIA 1LLOA 1TUFA 4KKXA 4FB7A 3OZOA 1HJUA 1FHVA 4GYPA 3KFTA 4C6PA 1LTDA 4O12A 5HJXA 4XD4A 1S5VA 1W3JA 3Q67A 3W1QA 4EPKA 2PP1A 1REQA 4X63A 2PTXA 4EOUA 4NZJA 4P7NA 3VM5A 3ELFA 3FIGA 5FD0A 1S5NA 3FHQA 3IJDA 3ITTA 2JKAA 3BSMA 3L0GA 3G3DA 3L4ZA 5FF3A 2ZVIA 2X41A 3GU1A 4BWLC 3PULA 2V5KA 4OHQA 1TJ2A 3VOCA 4LRTA 1B9ZA 4WK9A 1QNSA 4XZLX 4CNPA 3EX3A 4XV0A 5IOBA 1FWRA 5FF7A 3BLEA 4PUWA 3BLOA 1JXKA 4HZ7A 2R24A 4KEUA 1UR9A 2EHHA 4N4QA 1PYMA 3MUY1 3VK5A 1Q66A 3PM6A 1JRCA 3KTSA 4XZHA 4QGCA 1ONRA 2Y63A 1JPKA 4ZO9A 1VQTA 2VELA 2OJPA 3KXQA 4HNLA 3MHUA 2CLOA 3CHFA 1O1ZA 1UOKA 3S6TA 3A4WA 3TV8A 4JIEA 4F2UA 1DJYA 3EB3A 3I7QA 1H63A 1LZOA 4K2SA 3GE7A 3CHEA 1KRAC 2V68A 1M7PA 3WSUA 4TV5A 3CV2A 3CUFA 3PBUA 5F7UA 6REQA 2EF9A 1KB3A 1TELA 1LQ2A 3GH5A 4RE3A 4AWEA 2HTMA 1SUXA 1W54A 4NYUA 1EGMA 1S5TA 4DI9A 1NDWA 1J11A 2FDSA 3VOJA 1IEVA 1WDDA 4PC8A 3MU7A 8XIMA 4XB3A 5AYXA 2FTPA 1BG4A 4KETA 3AUJA 3BUVA 2WK2A 1X7FA 4Z2HA 3VIFA 2V0TA 2PDLA 3PPCA 2CIPA 3EMCA 4GX8A 3NQBA 3ZJ6A 4DBDA 5LIXX 1O5XA 4O10A 5AHEA 3LI0A 5DY2A 3W53A 1Q65A 1G4EA 3NO1A 1JCLA 3DC0A 4AZ7A 3DOPA 2ZX9A 1GG1A 3ZIZA 4S3JA 4UFLA 2HRWA 3H2FA 3H12A 4AWUA 5E6ZA 2E9BA 1S2TA 1OT1A 5A8GA 1FH8A 1OFBA 2WZMA 3AJXA 3RO6A 2FZ8A 2DZUA 3GWQA 1V4YA 1E72M 5M17A 4N02A 2ADAA 3CTTA 2RDWA 3M5XA 4XKMA 3VD3A 2AQOA 3FAXA 1EBHA 3WX7A 1TA3A 3PB0A 2ZXQA 2F6KA 4QITA 1D2KA 1SFTA 1HN1A 1TJ1A 1PTAA 4LQ1A 1PIIA 5JMUA 3ARYA 3S8HA 3N4EA 1E43A 4HNTA 2CLMA 5BROA 3ARXA 4IP5A 4KWWA 4LBUA 4E2DA 1T8XA 3W2UA 1AD1A 3QEZA 2PURA 1GKPA 4MY1A 4PYSA 3USZA 1JCMP 2HE5A 3QYSA 1ZGDA 3ARVA 4CGTA 3GW3A 4YTSA 5B7YA 2VFFA 4XK2A 5D8ZA 4W7WA 4AVFA 3AISA 3EWYA 4MKNA 3AS3A 3REQA 4C65A 3T81A 2VDHA 1GVOA 3LM7A 1T5AA 4YCPA 1J2WA 3WNPA 4ZA0A 2CESA 3TTOA 3UVIA 1XH1A 4A3HA 1TG7A 1JIBA 4DJFD 5HWMA 1QNPA 1MZHA 4XIMA 3AIRA 3E12A 3GVWA 1JAKA 4RK8A 1TPEA 3P62A 4D6EA 3M6YA 1Y5XA 4CUCA 3MKCA 3IS4A 1FXQA 4PA8A 4RR4A 1GVEA 4CN1A 1X38A 1AQMA 5DANA 4ZOEA 4D6IA 4ACZA 4HU3A 3MVIA 3QPYA 1F3EA 4LY8A 2PWGA 4AMCA 2ZRZA 1V3JA 2FVKA 4JOMA 6REQB 3XINA 4GUFA 1Q6EA 5K2ZA 1EF2A 3C86A 1JZ5A 3MMWA<