3WUBA

The wild type crystal structure of b-1,4-xylanase (xynas9) from streptomyces sp. 9
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
313
structure length
313
Chain Sequence
DTATLGELAEAKGRYFGSATDNPELPDTQYTQILGSEFSQITVGNTMKWQYTEPSRGRFDYTAAEEIVDLAESNGQSVRGHTLVWHNQLPSWVDDVPAGELLGVMRDHITHEVDHFKGRLIHWDVVNEAFEEDGSRRQSVFQQKIGDSYIAEAFKAARAADPDVKLYYNDYNIEGIGPKSDAVYEMVKSFKAQGIPIDGVGMQAHLIAGQVPASLQENIRRFADLGVDVALTELDIRMTLPRTAAKDAQQATDYGAVVEACLVVSRCVGITVWDYTDKYSWVPSVFPGQGAALPWDEDFAKKPAYHAIAAALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase A
publication title Structural perspectives of an engineered beta-1,4-xylanase with enhanced thermostability.
pubmed doi rcsb
source organism Streptomyces sp.
total genus 129
structure length 313
sequence length 313
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wubA00
4QP0A 3WH7A 3IANA 4OZOA 2EPLX 5JIWA 2BXYA 4B16A 3ARZA 4XV0A 2YDQA 2XFYA 1ISZA 1E5NA 1QI3A 3FXYA 1JZ6A 2W61A 3EYPA 1GHSA 2WB5A 1GHRA 3WL1A 2ZUTA 4KGJA 3VIIA 4GQQA 2G41A 1E56A 5F7UA 3AIUA 1UWTA 1E15A 2ZX7A 4LPCA 2ZXDA 2DSKA 1HNYA 1MW3A 2YKKA 3PTQA 1CGVA 1X6LA 1LG2A 3SCVA 2GDUA 1HKMA 3ZJ6A 2WZEA 2JFEX 1ZBVA 2OSXA 3TP4A 4KH2A 1QI2A 1DWFM 2QMKA 5FKYA 3O2LA 3W0KA 5A8QA 1AVAA 5I0DA 5GPRA 2J25A 2BFGA 3DECA 3F5JA 1BSIA 1WDPA 4AD4A 4CN6A 2WANA 4P7OA 4QCEA 4UQ9A 4E2OA 3EMQA 4PTXA 5IDIA 4GINA 4WKHA 1Q4NX 1EIBA 2PI6A 4UQBA 3MSGA 1KBBA 3N04A 3EBVA 4HMCA 2DPEA 1OGBA 2DQXA 3A6OA 3N13A 1J0KA 1UG6A 3AIQA 3T0BA 1PX8A 1EXPA 2DH2A 3VD9A 5A3HA 2CXGA 1FHLA 4PTMA 1F4HA 1NM9A 5ECUA 1WPCA 4WSJA 2E40A 5GNZA 3VINA 3ZT5A 1H5VA 2XGBA 1PX4A 3W6LA 3SCQA 3CTTA 2J62A 2WCAA 1UD5A 1US2A 5A2AA 2D0FA 4BCEA 4Z2LA 1A47A 3UG4A 3WDQA 3ARYA 3CZ8A 1FP9A 2EXOA 4UFMA 1WDSA 3AOFA 1QNOA 1HJSA 1EQPA 1OGGA 4HOXA 4HP5A 1H0GA 3WQ6A 5CG0A 1UQYA 4TX6A 2CESA 2WMJA 1TA3B 3RCNA 4M56A 1BGGA 2O9PA 2OWWA 4R27A 4U2YA 3BAYA 1W2PA 1E1EA 4N42A 1ZJAA 4GI9A 4GO8A 2PBGA 5D4YA 1D7FA 1E4NA 1E6SM 3AHXA 2VCCA 1KGUA 1M01A 4P7RA 4OKDA 1TA3A 2VZUA 3W29A 4IISA 4CCCA 2GUYA 1BYDA 1XGZA 1CXHA 3W28A 2Y4SA 4YHGA 2XVKA 1V03A 4W84A 3TTSA 1J0ZA 2J74A 4YN5A 3WDIA 3U7VA 4E8DA 2UWFA 1C3FA 4AZHA 2EQDA 3WF0A 5D9NA 1Y7VA 3BAXA 4PMXA 3WFZA 2G3IA 1FOBA 3GNPA 4WKAA 5FCZA 4CGTA 1K6AA 1E6QM 1OD0A 3ARUA 5ABEA 3VD4A 5ABHA 2V3GA 1R87A 1X1NA 5KEZA 1MXGA 1ZJBA 2ZX6A 4PBGA 1UH3A 3A3HA 4U33A 1V02E 5A8NA 1OCQA 3UESA 2JALA 1UKTA 3FHQA 3ARQA 1W3JA 1CBGA 4MAZA 4OBRA 3GZAA 2OYKA 2WHJA 3ARTA 2WW5A 3ALFA 4HZ6A 3WQWA 4J3WA 3UEQA 4V2XA 1EA9C 2C0HA 3WN6A 3OZOA 2F8QA 6CGTA 4WKFA 3WD2A 1PEZA 1UKQA 2WC7A 2CBVA 2CKRA 3EMCA 1HX0A 3IAPA 3CMGA 3L4XA 2ZXQA 3POCA 1V3MA 3W26A 4AC1X 3WL0A 3DHUA 1SR0A 1GW1A 3AICA 5AYIA 1W9XA 4U31A 4W85A 3ALGA 3PZQA 2CPUA 4CVWA 1C93A 2XM2A 4UFIA 1XD1A 4AZGA 4FLSA 5DMYA 1RP8A 4D6FA 1JXKA 1JNEA 4J3UA 1GZJA 3T0DA 2WMFA 2O9RA 3GXFA 3WBAA 1DEDA 1G94A 2ZOXA 1QI4A 2YBTA 4Y7EA 2GDVA 1MQRA 4ATDA 1P6WA 4JKMA 3W27A 1CGTA 3PZOA 1XSIA 2XIIA 5ABFB 4D6DA 1U33A 1KXHA 1JDAA 3DHPA 1BVZA 1CXEA 1UD2A 4V27A 1UZ4A 1KXVA 5GNXA 4ML4A 2CETA 3SURA 3B9EA 2W67A 1H11A 2NT1A 2Y8VA 3U5UA 2O9TA 5M5DA 1NQ6A 2VJXA 1UD4A 4UCFA 1PIGA 4UQCA 4JHOA 2GJRA 2PBOA 3WQ4A 3QHOA 1J9YA 5TD4A 4GPNA 3WH6A 2JF7A 2J4GA 3LPPA 4DUVA 3ARXA 1MQQA 1V3IA 2YA2A 2IXVA 4NSBA 1FH7A 2Y24A 1J18A 4NRSA 2X0YA 2UY5A 4F66A 3N18A 4TUFA 3S6TA 2V3DA 2G3JA 1ISWA 1OT1A 3VX0A 2EPNA 3RM8A 4AIUA 1WO2A 1V02A 2VZVA 3A4XA 3CHDA 1G1YA 1R86A 3LMYA 3K1DA 3PBGA 1MFUA 3WD0A 3HN3A 3BMVA 1KGXA 4LGXA 2ZUVA 1EDGA 3F5KA 1KR1A 1V0LA 1EDTA 4JKLA 2WZIA 4AD5A 1CGWA 4CU8A 4CCDA 2WVTA 1SYTA 3CHFA 1HJVA 2J7HA 4AW7A 3PN8A 2WPGA 5CLWA 1NWUA 2VRQA 4UNIA 1C8QA 1EO5A 3AIEA 4PMVA 1EOKA 1K9FA 5KZ6A 5I78A 2WZHA 3GTNA 1E71M 4E4PA 1D2KA 1MW2A 1I75A 1Z32X 2PC8A 3VIFA 2WKGA 1JYXA 5BXRA 2DEPA 2W62A 4B9YA 4M80A 4GXPA 4OOZA 3AJ7A 1HL9A 1JYVA 3AHTA 4JAWA 3BCFA 1HP5A 3VX1A 4F9JA 3GM8A 4J3VA 5HOSA 6A3HA 3WD4A 1V6UA 3TA9A 1ESWA 1WZAA 3N9KA 5A6KA 1DHKA 4PCSA 1DWJM 3AMLA 2B31A 1HL8A 1W9VA 2DGAA 2ZWYA 3EDDA 1QI5A 5GQBA 3GXDA 3AXXA 4DWSD 4NRRA 1JZ8A 3VTRA 1JI1A 3OG2A 3L4ZA 3RIKA 2GJXB 1NWRA 1JZ3A 1CTNA 3U7BA 1CXLA 2A3BA 3BXWA 2VOTA 2VZTA 4MJ4A 3BH4A 3WMBA 3CUJA 5AYBA 2PWFA 3OLIA 2D0HA 4AZCB 4CU7A 2X1IA 3AFBA 8A3HA 2XWDA 1JI2A 3K8LA 5JBDA 4ZEPA 2DDXA 4GQRA 4WK9A 2GJXA 1E4MM 5M3WA 1WE5A 4W87A 2XGIA 3THDA 4DWSB 1H3GA 1GOWA 4CU6A 3VDCA 1UYQA 1GONA 1E70M 3SIMA 1DWIM 4JL1A 1HJXA 4DUXA 3I3BA 1V6YA 4F8XA 2VQTA 4FK9A 4M82A 3N1AA 1DWHM 4HMEA 4PYSA 2W4XA 5HPCA 2G4FA 2BHYA 3CUFA 3K46A 3PZTA 4W7WA 1C7SA 2Y8KA 4ZXLA 1CPUA 1HXJA 4FMVA 4CN4A 2XVGA 4TTUA 3AI0A 4Z2JA 3WNKA 3NSMA 1UR4A 2WXDM 4DWSA 4UZSA 3GNOA 2HISA 1DTUA 1Q6FA 3VIJA 1XCWA 4YPJA 1R7AA 1HF6A 4B3LA 2J7CA 2WSPA 5EFDA 2OYMA 4Z2KA 1GJWA 3W4RA 1GOOA 2WKLA 3U57A 4LYPA 4AMCA 3HMCA 3FAWA 1B0IA 2WAGA 4MADA 1LJYA 1B1YA 1US3A 3W6MA 1HJQA 2D3NA 2ZUNA 4W93A 4HA4A 4AIEA 2D1ZA 3LPOA 4Z2HA 3RJXA 4JHZA 3RM9A 3GDBA 7CGTA 1GNXA 4JKKA 1EH9A 3NJ3A 1UH2A 1KGWA 4J3XA 3WQ5A 4AYSA 2OYLA 1QBBA 3K4DA 1JD7A 3WUFA 4BQ2A 2EPMX 3QGVA 2QV4A 4W8LA 1TE1A 2VMFA 1PIFA 4LYRA 2XWEA 2RGLA 1CLVA 1QW9A 1JZ4A 3VIGA 1E6PA 3ZMRA 4TOQA 1V3LA 1G5AA 3DYPA 3WUGA 3AHYA 1QNPA 1NP0A 1B9ZA 5A2BA 2YDRA 1E6RA 3MMUA 2CBJA 4M8UA 4BF7A 3UG3A 1BFNA 1E9LA 1V0KA 2OSYA 1TR1A 4PMDA 2BV9A 1R85A 4PTWA 3A4AA 1LL7A 1J0JA 1CXKA 1ZL1A 1BGAA 1UWSA 4UFKA 5IHSA 1HKKA 1OGSA 3ZJ8A 1B90A 1UR8A 2X05A 1E3ZA 2D3LA 4DM2A 5BXPA 1XV8A 2X2YA 2DIEA 1CEOA 1OB0A 4AD3A 2XTKA 3B9AA 3AYSA 4GKLA 2WWCA 4H41A 3ZT7A 4RE2A 1NOWA 2E8ZA 4NZCA 2Q8XA 4WIWA 2PWGA 3WENA 1JFXA 4UFJA 4B3KA 4JCMA 3W25A 3ZO9A 1HJUA 4YHEA 1HKJA 3VD7A 5CXPA 3VVGA 5BXSA 4W8AA 1KWKA 4MPKA 2VVSA 1K9TA 1GQIA 2BHZA 2E9LA 1B30A 3MMWA 5M17A 4ZE4A 1AQ0A 1E1FA 2V3EA 4HZ7A 3VGGA 1VF8A 5DT7A 4QLKA 3BCDA 4GO9A 5EFFA 1UOKA 3L4YA 4UOJA 3SUTA 1BPLB 3W24A 5EMYA 3FW6A 1NP2A 1W1YA 4P8VA 1UH4A 4FLQA 1A3HA 4MTVA 4AZBA 5A6SA 4HU8A 1UKPA 3GH7A 1UR2A 3SCTA 3VIKA 1OINA 4OOUA 4PMRA 3AYRA 1B3XA 3BSHA 1GOQA 4UZUA 4XUYA 1QVBA 2FHFA 4DUWA 3BSGA 2UY3A 4EAMA 1XYZA 2XVNA 4W7VA 2XSAA 3WH8A 3BAJA 2JF6A 4TTGA 3AMGA 1UR1A 3WD1A 3B9DA 3AHZA 3CMJA 5DO8A 3AIWA 3GXIA 4M29A 3VILA 2ZX5A 3W37A 3ZJKA 2XIBA 1NH6A 3UETA 4B15A 3GH5A 3ZR6A 1LWJA 2QHAA 4IPLA 1CECA 1WDRA 1ZBCA 3FAXA 3AS3A 2CCRA 5A95A 5EBAA 1QI0A 1CZ1A 2ZX9A 5EB8A 2BVDA 2TAAA 3AZTA 2WCSA 5FOOA 3OZPA 1VJSA 3CBWA 2VQUA 2WVSA 3W81A 5HDRA 2Y2WA 4UOQA 1BVNP 1ZS2A 2EEXA 5AC4A 3CZLA 3SEPA 1LWHA 2J7BA 1ISVA 3K8MA 3AROA 3AS2A 3M7SA 3WH9A 1AQHA 5BROA 4WLCA 3KEHA 3SUWA 4FLOA 1CGUA 3ZIZA 4HMDA 2PWDA 2YL9A 1EHAA 4UTFA 3F4VA 3ZOAA 3SCUA 2XVLA 3EDEA 3CIVA 4Q7NA 2G3MA 2OWCA 5D9MA 2AMGA 2J77A 4GZJA 5BRQA 4N0RA 1UA7A 2WNWA 4AD1A 2EJ1A 5BYWA 1CWYA 3WNLA 1QBAA 2A3AA 3ARWA 2WYSA 3VIMA 1UR9A 2YDSA 1HVXA 3HJEA 3UG5A 3AQUA 3EDKA 3WF1A 4PSRA 3MO4A 4Z2IA 3IJ7A 3OLGA 2VVNA 1E6XM 5I24A 2ZICA 4QFUA 3IJ9A 4LX4A 3CZGA 3AIVA 5GNYA 1CXFA 3OLDA 2VT0A 4GI8A 1UQZA 5A2CA 3TONA 4CCEA 4TVCA 5HXMA 1WKYA 1S46A 1J0YA 5A6MA 3OIHA 3CHEA 1VBRA 4RL3A 3RJYA 1GJUA 5LA0A 3SCRA 4WJXA 2A3EA 2VNCA 2ZIDA 3CLWA 3L2MA 1XD0A 1WB0A 3WSUA 5BCAA 1TMQA 1OD8A 1V3HA 3NSXA 3QHMA 1L0PA 4EK7A 2OLHA 3L4WA 1E55A 5A69A 1TUXA 3T08A 2YJQA 4XX6A 5I23A 2X09A 3BMWA 5A6LA 1VAHA 4AEEA 4JFUA 4AD0A 4BQ5A 4S3KA 4W89A 1WZKA 1PZ3A 2WMIB 4IUGA 3VM7A 3WMCA 2DSZA 4M81A 2FHCA 3K4AA 1J12A 4EANA 1M04A 1E0XA 3CHCA 1EOMA 1W3HA 1V3KA 1NWTA 1J01A 1YQ2A 1TG7A 3GH4A 3DYOA 3GXMA 4CKQA 2DIJA 4X0VA 3ECQA 1VEOA 1QOXA 5IHRA 2O9OA 1VBUA 2V3FA 1LL6A 2WMIA 2WLZA 1KWGA 2HVMA 2VRJA 3F5LA 3TTYA 1B3YA 1AMYA 1JF6A 4HA1A 3VGHA 2VCBA 4LYQA 1CNVA 4U2ZA 1FFRA 1X6NA 4J3TA 4OJYA 4ATWA 1IZKA 4PMYA 3VGBA 1GOMA 3A47A 4BQ4A 2GSJA 3PZUA 3ZM8A 4JFWA 2CIPA 2E9MA 4RE3A 1KXTA 2WMGA 4UOZA 4GIAA 1B31A 3BAWA 1EQCA 3PZIA 2CBIA 1WCGA 1V6VA 3SUUA 3MKKA 2CERA 4MDOA 1QNSA 4QCFA 4W5ZA 2OWXA 1ITXA 1M03A 1W9PA 4PMZA 5HNNA 4PUDA 3TTOA 4A3YA 1M7XA 2WM0A 1BYCA 4DM1A 1QNRA 1R8LA 2J8FA 3RO8A 3CPUA 1HN1A 5BXTA 2VUYA 5A1AA 3CUHA 3NDZA 4AD2A 2ZXAA 3BAIA 2J8GA 3KL0A 5CQ1A 1QHOA 3SUSA 3ARRA 5LYRA 4IM4A 4F9DA 4C7FA 2CKSA 3DYMA 5CPQA 4W86A 2YL5A 3WF3A 3G6LA 1H09A 4KGLA 2FHBA 5FIPA 4LXFA 1CLXA 2PWHA 4J7RA 1J11A 2EBNA 1H1NA 1UZ1A 2DT0A 2JIEA 1ODZA 3FN9A 1GQJA 5CZKA 4MDPA 1PAMA 1TCMA 1UD8A 1TVNA 3VKKA 1UWRA 1KCKA 1VFOA 4W7UA 4ZXOA 2BNJA 1B2YA 5CSUA 2J7EA 1JDDA 1OIMA 3OLEA 5HBFA 1KXQA 4S3JA 1B3ZA 2XG9A 1UWQA 1BG9A 1JD9A 3M6DA 3AZRA 4MB1A 3WDPP 3MUY1 3SCOA 5DFAA 1J10A 1OWQA 4UQDA 1BF2A 4HPGA 2D0GA 3PZVA 4UFHA 2V5CA 4WSKA 2J75A 2ZX8A 3WFLA 4X0NA 3K8KA 3POHA 1JL8A 2FGZA 4HTYA 4ATLA 2QMJA 4H2CA 4CD7A 4HZ8A 1CIUA 1SMDA 1VRXA 1Q6DA 4WF7A 2FGLA 4AWEA 4KRTA 2VX4A 3WELA 1VENA 2DT2A 1UKSA 3MSDA 1ECEA 1FA2A 4PMNA 4FF5A 2WVUA 3ZR5A 1D3CA 4MNKA 4GI6A 3S2CA 1JZ5A 3VNZA 5A94A 1MVYA 1EHNA 1VEMA 3MS8A 2CBUA 4CD5A 4W88A 5A6AA 3MUAA 2WWDA 2YLAA 5E6YA 2G8ZA 3U5YA 4AY1A 3CZKA 2DSWA 1UWUA 1E6NA 1L8NA 1UKOA 1KB3A 1NARA 5DT5A 5BWFA 4LQ1A 1WP6A 4W5UA 3OA5A 3IK2A 3WMSA 2YBUA 1E4LA 1VJZA 1JGIA 2Z1SA 4P7NA 4D6CA 1FHDA 5JBFA 4RE4A 2E0PA 2E4TA 4PMQA 2VC9A 1VFUA 2VR4A 4BS0A 1XC6A 5D8WA 4P7LA 3NYDA 1OIFA 3VDHA 3VM5A 3LPFA 3RDKA 4MB3A 2A3CA 2XUCA 4CD6A 4R5EA 1W32A 3AXHA 4HA3A 3VNYA 3QR3A 4CD4A 5AC5A 1HKIA 4AISA 3VGDA 4AIOA 1BYAA 2J79A 1QPKA 3GYCA 5I2UA 3AMDA 1E3XA 2V5DA 1K9DA 1ZBWA 4EKJA 3CZJA 2JEQA 1KCLA 4M1RA 1W3KA 2CITA 1BTCA 3T2OA 1WNOA 3MV01 4UQAA 3T0AA 1Q6CA 3MANA 2WC4A 2J7GA 3BGAA 3UR8A 3VIPA 2AAAA 3WEOA 3KWXA 3VD3A 4IPNB 1JZ2A 2WSKA 1XSJA 4M24A 5DEZA 1AQMA 4NF7A 2QF8A 2E9BA 3VOCA 4PN2A 2QLYA 3SCNA 2VR5A 1OSEA 5ABGA 5BRPA 2VI0A 4UR9A 4QLJA 1I1WA 1J0IA 1JDCA 5HPOA 2QPUA 2J78A 4D1JA 4URIA 1GPFA 1W9BM 1WZMA 3WUBA 4NI3A 1RH9A 1K9EA 1EGZA 3WNPA 1U2YA 4AXNA 3AIRA 3RILA 2EPKX 1C7TA 3IJ8A 1UWIA 3VU2A 2WMKA 2XHYA 3GBEA 2WC3A 4TXEA 7A3HA 3NSNA 2GK1B 3QOKA 4QLLA 3QHNA 2CEQA 1IV8A 3CUGA 4JFSA 2WVVB 1CENA 4P7QA 3VPLA 4U5IA 1IT0A 4J27A 2YL6A 1XH0A 3WEMA 1GUVA 1WDQA 4PMUA 2GFTA 1XHGA 1MW0A 3L4UA 3WUEA 2WBKA 2GK1A 4E8CA 1E4IA 3W82A 2WVVA 5I5RA 1W3LA 2C7FA 2BY0A 3NIYA 3OBAA 3LPGA 3AS1A 1JXJA 2XPKA 2OSWA 1VEPA 2BHUA 3WQVA 1BYBA 4U5KA 1RPKA 2ESCA 2JE8A 1WAWA 1O6IA 1JF5A 3ZQ9A 1XSKA 1ZBKA 1H4PA 1W9UA 5CPSA 4GZEA 3SCPA 1G9HA 1H0IA 5A8OA 3BLPX 2XVPA 1VIWA 3D3AA 2X8RA 5CSYA 1QHZA 1RP9A 3AMKA 2WCGA 3DC0A 3FNDA 1E40A 3N11A 1PBGA 2ZXBA 2J47A 2D24A 1W1VA 1ZB5A 3T2PA 3MUIA 5IXEA 4AEFA 1QW8A 1LLOA 2FDMA 3II1A 3ZSSA 2ZUSA 1VB9A 1UHVA 3SCSA 2XFFA 4PEEA 5E0FA 1OBAA 3THCA 4ZENA 5E09A 7TAAA 1KQZA 3AIBA 1ITCA 1C91A 3EDJA 5D9OA 3O6AA 4HPHA 4UFLA 1E73M 1VFMA 3OGVA 3PHAA 1DP0A 1BHGA 1V08A 2WLYA 4HOWA 2PF0A 1W2VA 1HIZA 4JFVA 1NOUA 3B8SA 1DWAM 2QPSA 1CGXA 3OGRA 4PCTA 4H8UA 2WHMA 2VO5A 3KL3A 1B3VA 1PJ9A 5I77A 3N17A 2PB1A 2DH3A 1IZJA 2ZUMA 3MUZ1 4HU0A 4UQEA 2XYLA 3WF2A 4MNJA 2WMHA 1SMAA 5D9PA 3T2QA 5C8BB 9CGTA 3A4WA 1TFVA 3AS0A 3WNMA 4EE9A 4JIEA 1H41A 5FL1A 4D6JA 2GJPA 1NOFA 4OBSA 2VZSA 3SCWA 5CLTA 3VIOA 3D5HA 2NW0A 2YOCA 2DSUA 5E70A 3WY1A 2G3NA 2BXZA 1MYRA 3PZ9A 3M07A 3NDYA 4TX8A 3TTQA 2DT3A 4U3CA 5A8MA 5I6SA 1BLIA 1I1XA 2VL4A 1W91A 5LA2A 1EO7A 2XJ7A 3J7HA 1V0NA 4MNMA 3PZNA 3VDBA 3WDHA 2J7FA 1GQLA 1V3JA 5D8ZA 2FH6A 3OGSA 1UA3A 2F2HA 4JFTA 3VMPA 3WDJA 1J0HA 4W8BA 4JZ5A 3WEZA 4PTVA 4KMQA 2EO7A 2W92A 4D6HA 1C92A 3WBEA 3OB8A 1JAKA 1CGYA 4F79A 4MB5A 5CGTA 1V6WA 2BVTA 5M03A 4PRWA 4MJ2A 3VDAA 1JZ7A 3I3EA 3WH5A 1UR0A 5FL0A 4MNLA 1KFWA 2Z1KA 3VMOA 2O92A 2WK2A 4P8UA 2V38A 2W91A 2VCAA 2D23A 3VUPA 4AZ7A 1MW1A 3VGFA 3MU7A 3AHVA 2ZUUA 1H2JA 1ISYA 3ARVA 1BAGA 2Y5EA 2WHKA 1GVYA 5AY7A 1CDGA 2IUZA 5FD0A 3KZSA 1FFQA 3MMDA 4A3HA 4ACZB 1YHTA 5A8PA 3L2LA 3IAQA 1E0VA 4P8WA 2J7DA 3HU7A 3WDRA 4L4PA 3W53A 1TZ7A 3PTKA 3GNRA 1Q6GA 4D6GA 5JUVA 4D71A 3T09A 4Z2GA 3MV11 1M53A 1PX3A 5JBEA 1FP8A 3CUIA 5ABFA 2E3ZA 3W38A 1JIBA 1BG4A 4ACZA 4AZ6A 4K68A 1V0MA 3FHAA 3WF4A 2DT1A 2XM1A 1UD6A 1R7OA 2YA1A 5I3DA 3CH9A 2MANA 4CN1A 1FH9A 1C90A 3KL5A 3ARSA 1GVIA 1GQKA 1SFSA 1CXIA 2F61A 4D6IA 3WIJA 1C8XA 2BY2A 5CGMA 4QDMA 1E6ZA 1W1PA 1Q6EA 1XRVA 4BA0A 4J28A 3GBDA 2VX5A 1N82A 3NCOA 3O9NA 2ZE0A 1E43A 2WHLA 1VFFA 2VZOA 3AMCA 4OUEA 2BVYA 4L4OA 5CPTA 1HVQA 1MQPA 2NT0A 3ZSTA 4MB4A 2GVYA 1RD6A 4XZBA 3WD3A 4CD8A 4X9YA 2VURA 4BQ3A 2NSXA 3APGA 2ZUWA 5E9AA 4CUCA 3WNOA 1NWSA 1HP4A 3WKZA 1W9DM 4H7VA 4DWSC 1LQ0A 2D20A 1H49A 4PMOA 2CYGA 2FH8A 3CO4A 3QOMA 1FH8A 8CGTA 4U3AA 2PWEA 1MXDA 1OM0A 5I79A 2C8NA 3PZMA 3TOPA 3AZSA 1JFHA 2UY2A 1DWGM 4KWUA 1JG9A 4TVUA 2VX7A 3BLKA 3RM4A 3RPMA 3SUVA 3UCQA 5C70A 4PSPA 4CVUA 4BZYA 1PZ2A 4JL2A 1JYNA 4H8HA 1EDQA 4ZFMA 4GZIA 3BAKA 5A6JA 3ZJ7A 5E6ZA 1GCYA 1PPIA 3UR7A 4C7DA 1HJWA 4AZ5A 2YIHA 3AISA 1KBKA 2E8YA 1U30A 2BS9A 3VIHA 1KR0A 3L4VA 1F4AA 1UUQA 2UY4A 4PUEA 3ZT6A 3WNNA 1ZU8A 3I3DA 1BQCA 1JAEA 1O7AA 1KQYA 4D72A 4A4AA 6TAAA 3WQ8A 3VD5A 1C8YA 3VMNA 5A6BD 2AOSA 2VTFA 2D2OA 3L4TA 3EMZA 1E0WA 4B9ZA 2CHNA 1GORA 4FLRA 3G6MA 2W5FA 4ZE5A 4C7GA 2RGMA 3PTMA 5C71A 4AZCA 1B3WA 1LL4A 2XFRA 1OT2A 2EPOA 1HT6A 1TVPA 3KE0A 2D22A 3PZGA 5IFPA 1XH2A 1ISXA 3BC9A 4J3SA 1WZLA 1XCXA 4HOZA 2WBGA 1MWOA 2JEPA 4XB3A 1LF1A 2XSBA 2YL8A 2CNCA 4AZIA 1XH1A 1G0CA 5IFTA 3VO0A 4XZWA 1E5JA 5A6BA 3JUGA 1QHPA 3N12A 3CGTA 1JNDA 2BY3A 5CJ5A 2W63A 1LG1A 1XYFA 4JCLA 2JIWA 2W66A 1V6XA 4KRUA 4ACYA 1QNQA 4D6EA 3RMEA 1G01A 3E1F1 4Q22A 1CYGA 3NUKA 2YLLA 1JYWA 2IXUA 1ODUA 3M46A 3N15A 2YA0A 2DSVA 2ZWZA 2A3HA 2VRKA 4P8XA 1W1TA 3ARPA 2VX6A 3VGEA 1MFVA 2BY1A 4D1IA 4V28A 1GOIA 3UERA 1GOKA 4MAVA 2CHOA 3CZEA 4H04A 5DF0A 2X0HA 3AXIA 5LA1A 3FY1A 5E0CA 1UD3A 4QAWA 1E72M 4H8VA 4OIFA 5JIPA 3EDFA 4TVDA
chains in the Genus database with same CATH superfamily
4YTSA 4TQTA 2ZQ0A 3N3MA 3GTFA 3VNJA 5JIWA 1ZGDA 3A3WA 4HHLA 4XV0A 1XR2A 1KM1A 1SFTA 3H12A 1QI3A 1JZ6A 4K39A 3WL1A 4C6OA 4GQQA 3TC7A 2G41A 3GU2A 1E56A 4RZBA 4LPCA 3C2OA 1QK0A 2YKKA 1MEIA 5LNWA 3FV9A 1X6LA 4O13A 4JTFA 1ZBVA 3TSMA 3F2CA 1DJGA 1QI2A 2QMKA 5A8QA 5GPRA 3DECA 3F5JA 2VGFA 3LRMA 2WANA 1QTWA 4M51A 4UMAA 4E2OA 1EBGA 1EL3A 4GINA 2C16A 2GJNA 3LRKA 2R94A 2PCEA 5I3KA 4UQBA 4QS6A 4HMCA 2Y62A 3CQJA 3MHUA 2R8WA 1UG6A 4HNVA 1MDRA 2HTMA 3KX6A 3FVMA 3VD9A 5A3HA 4PTMA 1NM9A 2FPVA 1J2BA 2P8CA 5ECUA 3PWGA 1Q65A 2NVAA 6REQA 1H5VA 2XGBA 4KWOA 3W6LA 4TR9A 3CTTA 2J62A 1SZRA 3IVTA 4BCEA 1XLFA 3DIPA 2OX4A 2VYOA 3IIZA 1H50A 1FP9A 2EXOA 4LBUA 4S3GA 2PTZA 3AOFA 2E77A 1OGGA 3W7QA 2NQLA 3EWBX 1FQ0A 1YW1A 2WZTA 4DPQA 3ORWA 1TA3B 1EP1A 4M56A 4JR5A 2OCZA 3MYPA 2OTDA 2O9PA 4U2YA 1DJQA 3P74A 5D38A 3GXNA 1W2PA 1P0EA 5G2IA 2EG8A 5D4YA 1E4NA 1GZGA 1SO5A 1OFBA 1W5PA 2ONEA 1F8MA 2X1UA 4P7RA 4PRRA 1TA3A 3W29A 8TIMA 1BYDA 2JK2A 4TV6A 3LTPA 4RDZA 4PL2A 4EP8C 1FDYA 7REQB 4GUJA 4GISA 4N7QA 3TTSA 4S3BA 1J0ZA 3U7VA 5K3VA 1C3FA 4QDPA 2EQDA 2PDPA 2EHHA 3WF0A 1Y7VA 4BF9A 3LHWA 4WKAA 3MP5A 3C8NA 1R87A 5JVLA 1MXGA 2ZX6A 1VKFA 4FOKA 5A8NA 3LOTA 3L9CA 3NNTA 1UKTA 3FHQA 4JY8A 3U4FA 4AIBA 1W3JA 2GOUA 3GHUA 5HNRA 1ALDA 2OYKA 2WW5A 1QPQA 3NQBA 3WBYA 2C0HA 3RN6A 4PUWA 1G67A 1XKYA 3DN5A 3PFRA 4WKFA 5C2XA 4DRSA 4G56A 4DBSA 3NQDA 1HX0A 1GYMA 4Q8VA 4PODA 1VBGA 2QPXA 3POCA 1V3MA 3W26A 3H7VA 4AC1X 3G2GA 1A5KC 1K70A 1WKDA 1W9XA 3UA4A 3ALGA 3CT2A 2GSHA 4XZIA 4R34A 2ATSA 3ZVHA 1EEXA 1GQNA 2VGGA 5DMYA 2GVJA 4DI8A 4D6FA 3HGJA 3HFTA 1GVFA 2QDEA 1B9BA 3VNIA 4GJJA 3LCLA 4GG9A 1FWJC 1MQRA 1G6CA 3R58A 1J79A 4JKMA 3BWWA 2ZZ6A 1IT8A 2XIIA 2Y1HA 1U1JA 5C7VA 1WXYA 5KITA 1JUBA 3EKLA 5GNXA 4ML4A 2OG9A 3B9EA 2W67A 2O9TA 3V36A 3GAKA 3PVFA 4HCDA 1JCTA 3P60A 4L4LA 4R9OA 1NQ6A 4JIHA 2VJXA 2NUYA 1OADA 1HO4A 2PBOA 3DZ1A 3WQ4A 5D03A 3TC3A 2JF7A 3LPPA 1P0NA 2NQZA 4NSBA 4IFOA 1FDZA 5L9FA 4L9ZA 4J5NA 4HK5A 1LRTA 2UY5A 2V0TA 4F66A 5K9CA 1S5WA 4TUFA 1QCWA 3GWQA 1ISWA 3QPZA 3RM8A 2CLEA 4ICNA 5PTDA 4FNTA 2KX9A 1TV4A 4EPEC 1KGXA 1XIEA 3QV6A 3F5KA 1EJRC 1F74A 3H55A 1LUCB 2E1DA 1DTNA 3W00A 4GE8A 4AD5A 4HCHA 4E4UA 4ZO8A 5FF4A 3EWZA 4CU8A 2V8ZA 4HZMA 4O12A 1EKOA 3CHFA 3FEQA 1HJVA 3TKFA 3WLSA 2WPGA 1DYSA 3RX3A 3JW7A 3O6CA 4I9MA 4GUIA 3AIEA 1H1ZA 1DQWA 3CM4A 2WZHA 3RAOA 1E71M 4ZQMA 4B5WA 1MW2A 3T42A 4P61A 2RUSA 2DEPA 4B9YA 4FXRA 3CAWA 3L68A 3KLKA 3MP4A 4V15A 3P8IA 3SGUA 3AHTA 3VX1A 5HA7A 4AXKA 3LLFA 4J3VA 1NTHA 4E6MA 6A3HA 5ENLA 3WD4A 1V6UA 2G4JA 1XLJA 3UCDA 4C6LA 3MTWA 3GO2A 3AMLA 4GY0A 1TJRA 3VOFA 4F48A 4EXBA 1W9VA 3W73A 3EDDA 3LYEA 1S5MA 4MWAD 3N9RA 1JI1A 1R3SA 3RIKA 1Q6LA 2NWRA 1JZ3A 4KIRA 3JU2A 2VZTA 5G5IA 4MJ4A 3P7YA 3WMBA 5AYBA 3ZLHA 2PWFA 1TPVA 4AZCB 2ALDA 2X1IA 3SFKA 4Q4RA 1R9XA 1UIPA 2XWDA 3EX3A 4ZEPA 3MC5A 2DDXA 2RJGA 3QH2A 4NT0A 3O6DA 1CX9A 1WE5A 3PG8A 4W87A 5HWMA 3QY6A 1VD6A 3KCJA 3EX1A 4IPIA 1GONA 3G1YA 3SIMA 4H7CA 1DWIM 1HJXA 3QLDA 4DF1A 3N1AA 4HMEA 4WX2A 3K46A 5T26A 4W7WA 2Y8KA 2VEGA 1CPUA 2H8XA 2Z4GA 5IDZA 2FZ9A 4MWAA 3HV8A 2WXDM 1R2SA 4UZSA 3W7IA 5CZTA 3VIJA 1XCWA 4YPJA 3HQPA 5EFDA 2OYMA 4HNTA 2B81A 2YYTA 3BARA 1GOOA 1MUCA 5FJJA 3HMCA 4O18A 2L5HA 5DN1A 3G1RA 2Y7FA 4FZIA 1HJQA 4DO5A 4UBPC 3STFA 4I8DA 3GXPA 4DHGA 4HA4A 4P2VA 4Z2HA 3KLLA 3N6HA 2ZRXA 3GDBA 2DVXA 3GD6A 7CGTA 1XLHA 2ZRVA 1UH2A 1KGWA 4WY0F 2QF7A 3UJRA 4J3XA 3CQIA 4AYSA 3LA4A 1QBBA 2O7QA 3OQEA 2QV4A 4KEZA 1FTXA 1PIFA 1W3NA 3CJPA 3QV7A 1E6PA 3ZMRA 3QYSA 3BG9A 3DU0A 3DYPA 2PGEA 3EOLA 2PWVA 1N55A 1B9ZA 1E6RA 3EWCA 3W02A 2E25A 3BLIA 1BFNA 4PMDA 3GVGA 2QJIA 1J0JA 1ZL1A 3L21A 1JJKA 4UFKA 5BNKA 2BODX 2D3LA 4DM2A 2NUWA 2P1FA 2QW5A 2DIEA 4YS1A 4ZMGA 1S2WA 4JTCA 1LBMA 1NOWA 2E8ZA 4NZCA 1KTBA 1X98A 2PTXA 3E2QA 3N2BA 3A24A 1JFXA 1PHWA 4UFJA 1OJXA 1ZAHA 4B3KA 2X30A 3SFWA 1A0EA 1QU4A 3KRZA 4YHEA 3T8LA 1HKJA 3VXGA 1SO6A 3CYVA 3VVGA 3P62A 3TN4A 4MPKA 4LAKA 2Y85A 5M17A 2CZ5A 2Z00A 3LS9A 4PH6A 2B7QA 4RDVA 1E1FA 1VS1A 3W7GA 2P76A 5DT7A 3T1GA 1TKKA 4QLKA 4D2JA 4GO9A 1UOKA 3BLEA 4KCTA 2CZDA 1EPVA 1TQXA 1NP2A 4X3ZA 4FP1A 5AHLA 3HPSA 1A3HA 4MTVA 5A6SA 4HU8A 4LVDA 1RHCA 2PD9A 3N6JA 4R33A 1TYGA 3VIKA 1OINA 4OOUA 4PMRA 5F4WA 1AH3A 4RZ6A 4DUWA 4JTLA 4NJJA 5IOBA 4EAMA 2XVNA 2XSAA 3LG3A 5CJMA 3W1QA 1PKYA 1X39A 1WQ5A 2ZZ7A 1D3HA 4ZQNA 4YCOA 4B15A 3LXCA 3R11A 1POKA 3S2LA 1TREA 1CECA 1IEWA 2FQIA 1WDRA 3R10A 3FCPA 2ZX9A 1CZ1A 2TAAA 5BMWA 3OZPA 1JPIA 5HDRA 3EEZA 5AC4A 4N9BA 3SEPA 1GYLA 1XIIA 1TTIA 3PAOA 1ISVA 1C8VA 3AROA 4UTHA 3WH9A 3L66A 1Z9AA 1QT1A 3KEHA 3SUWA 2BGQA 5GJPA 3WJWA 3BLLA 1KCXA 6TIMA 1LTDA 2XVLA 3CIVA 5RUBA 4BI7A 4PL1A 2PDKA 1DIEA 3F4CA 4NXKA 3W1TA 4M6UA 3VKCA 4LVBA 4YXGA 4AD1A 1S2VA 2WYSA 3I7SA 1Z7AA 2GJLA 3N2XA 2EF9A 3UG5A 4AG0A 3ABZA 1H5YA 1E6XM 5I24A 4GY1A 3IIVA 3IJ9A 3ITGA 2ZYFA 1YKWA 3GRIA 2V2DA 3UW6A 1CXFA 5EL1A 1IWPA 3MVTA 4I90A 4JQAA 1UQZA 2YFOA 5A2CA 4CCEA 4TVCA 1WKYA 1UBSA 1J0YA 1PWLA 1CI1A 5A6MA 4RL3A 4R3UA 3GR4A 2PSNA 4ILSA 1GJUA 4YVXA 3LDVA 3P84A 4WJXA 2A3EA 2CLIA 3NVDA 5T9CE 3CLWA 3L2MA 4PTNA 2VC7A 3UR5A 4J2PA 4N6FA 1JPMA 2F6XA 3C2EA 1UC4A 4JTJA 1E55A 3UXDA 4XX6A 3UPBA 4GH3A 2HWGA 4AEEA 4JFUA 1D3GA 2O4MA 4DF2A 4LC8A 4E4FA 1WZKA 1PZ3A 4IUGA 3VM7A 5ABTA 3WBXA 3NQMA 4LFYA 1M04A 4US5D 1KFEA 5CSRA 1SJAA 3CHCA 1V3KA 1NDVA 1YQ2A 1TG7A 4BR1A 3DYOA 4MOZA 1A49A 2DIJA 3IRDA 1GKQA 3TJXA 2CWXA 5IHRA 1VBUA 2V3FA 1KWGA 2HVMA 1K8XA 2VRJA 4GIYA 9XIMA 3B0VC 3VGHA 3M44A 3EXTA 4GC4A 1EJWC 1X6NA 4OJYA 4ATWA 3H23A 4QSFA 3G1VA 1GVSA 2OT1A 1EEPA 3VGBA 4NKCA 3VKJA 4MUZA 4BQ4A 3PZUA 2E6DA 5HUOA 3INPA 2RJHA 3MJYA 4QG8A 4HT3A 4RE3A 3RGTA 4GIAA 4K37A 1SO4A 3BAWA 1FY6A 3ITYA 2CBIA 3O6YX 1G4SA 4US5A 5CJNA 4QRNA 3GQYA 2ODOA 2CERA 1QNSA 4JNZA 4NZ5A 4FX6M 5XIMA 1M03A 1W9PA 4L6OA 2WM0A 1W37A 4MWAE 3NQ6A 4ZQPA 1QNRA 2J8FA 4IP7A 3M0KA 1GG1A 3SADA 4H00A 4LVAA 5A1AA 3CUHA 3NDZA 3EWWA 4H2HA 2H9AB 4L9XA 2ZXAA 1P1MA 3GHTA 3UVAA 3M5YA 4O1AA 3DBPA 3ZXWA 3ARRA 3DG3A 4IP5A 2F9RA 4XZLX 4F9DA 2YL5A 2FHBA 4RNIA 4LXFA 1CLXA 4PBFA 1TB3A 1IXQA 2EBNA 1H1NA 1UZ1A 4J35A 3BW4A 3MPGA 2IKHA 3NA8A 1UD8A 2RAGA 3VKKA 1UWRA 1DXFA 4W7UA 4ZXOA 1S2UA 1JDDA 1OIMA 1B3ZA 1Q6QA 4ERGA 4JTGA 4O1CA 3U8GA 2VOMA 1XLAA 4Z0SA 4XTIA 4IWWA 4TU1A 1KW1A 5I02A 2Z7KA 3WLOA 1YLVA 3JR2A 2ZADA 3PZVA 4UFHA 4WSKA 3WFLA 4OECA 3WLPA 4X0NA 4MG4A 3K8KA 3POHA 3FLUA 2FGZA 4HTYA 2QMJA 4CD7A 1EX5A 2Q02A 4QTGA 2BOFX 1R3VA 4EF9A 1SMDA 5C55A 1WYIA 1V77A 3Q58A 4AWEA 3P93A 4RW3A 3W2KA 4HK6A 4KRTA 4LCSA 2Z0IA 3HA1A 3XIMA 1JEZA 2DT2A 3BOXA 2WVUA 1D3CA 1PE1A 3GR8A 4C1NA 1JZ5A 5A94A 5KMYA 2R14A 3I10A 2ABAA 1EHNA 3TSBA 1YBQB 1VZWA 2CBUA 4RXGA 4XD3A 5A6AA 3KVLA 4DXVA 3XINA 5E6YA 1S2AA 2F6UA 2R1KA 3QXBA 1L8NA 4N02A 4K1WA 4XAFA 5DT5A 1Y8BA 3S2NA 2YBUA 1VJZA 1JGIA 5A8GA 1YBQA 3KBJA 1YTKA 4RR4A 4GUFA 2E0PA 3T05A 4V33A 1VFUA 3BJTA 4BS0A 2ACRA 4P7LA 3TFXA 5IBXA 4LSBA 1OIFA 3VDHA 3RDKA 5C2CA 4R5EA 1W32A 4CQBA 4CD4A 4X2PA 3UGVA 4IPPA 1KLZA 1BYAA 5I2UA 1E3XA 3H21A 6XIMA 1K8YA 2JEQA 3B03A 4M1RA 2FZDA 4RNHA 2HMCA 1DBTA 3APYA 5C9XA 3IEBA 4BI6A 2PGRA 1AL7A 4C91A 1ECQA 2BOEX 1Q6CA 4LWWA 3BGAA 1TPFA 1THFD 2AAAA 4G5DA 1P6BA 2HJPA 4MPQA 2ZZ3A 3LQGA 3R8GA 2XIMA 2QF8A 3GIYA 3SCNA 3LCIA 2VR5A 3VNLA 1TPB1 4GCAA 1JDCA 2QPUA 3JZEA 2VFFA 2G97A 3PS7A 2C71A 1GPFA 1BKSA 1E0UA 1G7UA 1VLWA 1RH9A 2VD8A 1EGZA 3RITA 3BUVA 3M5VA 1VBJA 3RILA 4D8AA 1XIFA 3IJ8A 4JHMA 1QNVA 3Q65A 3GBEA 4NIRA 1YNYA 7A3HA 2ISVA 3KTXA 3QOKA 5HQLA 3L12A 1CT5A 4NZ4A 2G0WA 1S38A 2TODA 7ENLA 1YE6A 4MIMA 4ZO9A 4A2SA 4GJIA 1M7JA 4U5IA 4ZGYA 2YL6A 4XSMA 5C5YA 3T44A 3TMLA 5AHMA 1XJBA 3OVGA 1AQFA 2GFTA 3L4UA 3BJFA 1X8FA 4NHVA 4E8CA 4LRSA 1XLCA 5I5RA 4Y90A 2A6LA 1OX4B 2C7FA 3CV1A 4GGBA 3DUGA 3AS1A 1MNSA 4JQ4A 1Q8JA 3QQ0A 4JPGA 3NL3A 1BRLA 2PUZA 3GY1A 4AVNA 1OX4A 3IUDA 5D2YA 1F73A 1ONXA 1G9HA 3TCEA 4L4MA 4O1DA 3GFZA 3IVSA 3BLPX 4UNKA 2PWUA 1NAL1 2PRHA 2X8RA 3IJQA 5AC8A 4ZTYA 3R1ZA 3DC0A 4GK8A 3N11A 1PBGA 1RCQA 1US0A 3UBPC 1EC8A 2QNEA 4AEFA 1QW8A 2FDMA 3KBMA 2I9UA 2ZUSA 1VB9A 1ZLPA 2FMNA 1UHVA 1DJYA 4AH7A 5E0FA 2V2HA 3GIQA 4AC7C 7TAAA 5I3GA 3CPGA 5D9OA 2NQJA 4RJEA 4REQA 4DXKA 4JN8A 2PF0A 1M7OA 5EU9A 4OGZA 2VEPA 3TQ0A 3WQDA 2QPSA 3TROA 5HQEA 5BOOA 4XWUA 4B4HA 1B3VA 3GDTA 3RCMA 3M0LA 4MZ8A 3TMQA 4Y2WA 3MZ2A 2VP8A 2ZUMA 1SGJA 4QJ4B 3WK3A 3M0HA 2WMHA 2BLEA 1UPPA 3A4WA 1ZP4A 4EE9A 2DFAA 2IPWA 1H41A 5DXXA 1NOFA 3QPYA 3T78A 4OBSA 3H2NA 1O66A 5CLTA 2O56A 4IUOA 3PJUA 4MM1A 3VIOA 2P5NA 2DUAA 1ZPTA 2NW0A 5BMXA 2XN1A 1A0DA 2GLKA 2BXZA 1NF7A 4AVFA 1SPQA 4LUYA 3PFMA 5C9RA 4TX8A 4AF0B 3TTQA 5A8MA 1I1XA 2VL4A 4DY1A 1OQFA 4KT2A 2Z29A 5LA2A 2HQAA 3VDBA 3EX6A 1TZ9A 2FH6A 3PPCA 2BGSA 2F2HA 4JFTA 1PL9A 3EA2A 4W8BA 3W3OA 3UVIA 6ALDA 2G5WA 4PTVA 2DZWA 5I03A 1K1DA 3NL5A 1UPMB 3CIXA 3M64A 3NYZA 2FTPA 4WEVX 3BJSA 3B0XA 3MWCA 3HURA 3I3EA 2VHLA 3WLKX 4OV9A 3H4GA 5CH9A 2QDHA 1FVPA 2O92A 3ME3A 2WK2A 3CO8A 1VLIA 2W91A 2VCAA 3VUPA 4FSAA 2YCLB 4PZVA 2ZUUA 5FJUA 3EEGA 1A3WA 1ISYA 2DY3A 3CQKA 4B5SA 4LY4A 1B54A 5FD0A 1XGDA 2GVLA 4GYJA 1FFQA 2ISFA 2ZA3A 3VABA 1MNZA 4A3HA 4AEOA 3EPMA 1UP3A 3TAOA 1UP2A 5A8PA 2YPIA 3LRLA 3B4YA 1RJQA 3WDRA 4WSHA 4AMAA 4L4PA 1B3OA 3R13A 3QZAA 4D6GA 5JUVA 3W74A 4WDTA 4Z2GA 5HMEA 1FP8A 1EF2A 4DQWA 1KM0A 1BG4A 2AQVA 3LHTA 4AZ6A 3FHAA 1ELSA 3GTHA 4YCPA 1UD6A 5KZDA 5I09A 2PD5A 3CH9A 2MANA 4CN1A 3L0KA 1DJHA 4PFHA 3OU8A 1ZHAA 3KL5A 1UOZA 2GYIA 3WIJA 1FKWA 1RVKA 1C8XA 4KERA 2B7PA 2J6XA 2NLIA 1S2TA 5G1TA 1W1PA 3TQKA 3C4UA 1UIOA 4J28A 4IOTA 2RDWA 5LGZA 4JYEA 2VX5A 2PGWA 3GHSA 3W7JA 2D2GA 4JTEA 1M68A 2XH4A 3LM7A 1O5RA 2BVYA 2Z24A 1IR2A 5CPTA 2PTWA 1HVQA 2Y5SA 1MQPA 3ZSTA 3M0XA 4MB4A 2GVYA 3HPFA 1RD6A 4KWVA 4HNUA 3CPRA 4ZCWA 4BQ3A 3QFWA 2NSXA 3APGA 2ZUWA 3DFTA 4CUCA 1TV8A 2OXNA 3KBVA 1GK8A 5FJPA 2VEKA 2V69A 1H49A 4LF1A 3HFYA 1FCVA 3CO4A 2OZTA 1L2QA 1FH8A 1X6UA 4DVOA 1QWKA 2ZRWA 3FYPA 3RU6A 2QCDB 1TPDA 1JFHA 3E2RA 1MEHA 1DWGM 3BLKA 1QAPA 3RM4A 3SUVA 3VC5A 4MZYA 3IPWA 2ISSA 1WX0A 5H2ZA 4JL2A 1JYNA 1EDQA 3BAKA 3W76A 1X7IA 4CQCA 1SSGA 1GCYA 1EP3A 2DZPA 1ZJHA 3CL8A 2QCDA 4C7DA 1HJWA 3QBUA 4AZ5A 4XBSA 3UWVA 1R30A 3H4XA 3AISA 3R12A 1XGEA 1KBKA 2BS9A 3U6WA 1S3TC 3NO5A 1AL8A 3ZT6A 4NX0A 3ITVA 4FNQA 1ZU8A 3I3DA 9RUBA 3T9PA 1TE6A 4ES4A 1O7AA 1KKRA 1H7XA 3S1XA 3CQHA 3MCNA 2YCJA 1GEQA 6TAAA 5HNTA 1KRCC 1I2QA 3R43A 3VD5A 3VMNA 5A6BD 4MJMA 2VTFA 2D2OA 4KEMA 1OCJA 3L4TA 4DJED 5HNUA 1LRNA 3EMZA 3LBOA 4M1BA 4MSSA 1V51A 1GORA 4FLRA 4NAEB 4ZE5A 2RFGA 5GJMA 2FMOA 4FA3A 2QR6A 3M5ZA 3GSMA 5B7YA 2EPOA 1HT6A 3KE0A 5IFPA 3SRFA 3KBNA 3W1AA 4CNPA 1XH2A 2V5JA 4NAEA 5FEWA 3EAUA 1XCXA 2UV8G 5TIMA 3GIPA 1RQHA 2WBGA 3Q67A 3WLTA 3LHZA 4WGHA 2JEPA 4XB3A 5M2FX 3OZMA 3QR0A 1XH1A 5IFTA 4GBUA 3KHDA 4XZWA 3FX4A 1QPNA 5A6BA 4WXZA 3JUGA 3GG8A 4K2SA 4DJEA 5BZAA 3I4KA 4LUSA 5CJ5A 3QKEA 5XIAA 4CNUA 4QJ5B 2W66A 3L0GA 5G1YA 3S5OA 2PEVA 4NILA 3UWEA 2UBPC 2HS8A 4D6EA 3MUXA 3RMEA 1XCFA 5LHEA 2FPTA 2YLLA 2IXUA 3M46A 4KFNA 2JKAA 3PAJA 1FHUA 3TV8A 1NF0A 2DSVA 2ZWZA 1W1TA 1MFVA 2ZVRA 4F0SA 1QOPA 1MI3A 4LB4A 3BE7A 3CZEA 3AXIA 5LA1A 3FY1A 1I2RA 4AX6A 1UBPC 4QAWA 2REQB 4H8VA 3CAVA 3G5EA 3EDFA 1ZNNA 1TIWA 1H1YA 2EPLX 3A22A 2VEMA 5KZMA 2BXYA 3HG3A 3GX9A 2YDQA 1ISZA 2Z27A 3FXYA 1KRBC 1AW5A 2REQA 4GVGA 1GHRA 2VFEA 4IQDA 2ZUTA 3CC1A 1DIKA 2WSRA 3MY9A 4Q4QA 5AHNA 4GWEA 2ZXDA 4YTRA 1MW3A 3DBNA 3EB4A 3GVQA 1U22A 1GVOA 1Y65A 2QUVA 1MDLA 3ZJ6A 1XRTA 4DN1A 3DERA 1VR6A 3EKGA 1W8SA 1DWFM 5FKYA 4F0MA 3O2LA 5I0DA 1XLKA 3VOGA 3RU8X 2OKOA 1WDPA 4P7OA 3EKZA 3NDOA 4UQ9A 4WKHA 1Q4NX 1EIBA 4MLJA 3EBVA 2C14A 4YNGA 5D05A 3U2ZA 3A6OA 3N13A 4XZMX 2VEFA 4HKPA 1J0KA 4P5UA 5IRPA 5DELA 2PRMA 1ENUA 4KBXA 5CPOA 3ES7A 1EXPA 1BSLA 2C15A 2HS6A 2X0SA 1VJIA 2AQOA 5H8MA 1FHLA 4DNMA 1F4HA 3BTNA 4WSJA 4UB9A 2E40A 5GNZA 3S3GA 1RUSA 4XUGA 3TYEA 4PGLA 1US2A 1DVJA 1S2CA 4MMWA 3N14A 3UG4A 2OPJA 3CU2A 2BSLA 3CZ8A 3TU9A 2FB3A 2NQHA 2ZC8A 1QNOA 1EQPA 1XC4A 1W5QA 4HOXA 4HP5A 1Q6OA 2B0MA 1VFSA 1AJ2A 4TX6A 4XAGA 3OHIA 2CESA 2J9ZA 3NR0A 3W7LA 1J93A 4N6EA 1E1EA 4N42A 4DYJA 2PBGA 3G22A 1D7FA 1E6SM 3E6EA 4JIIX 5EMUA 2VCCA 3USZA 4HN8A 1A5CA 3P3BA 4OKDA 2NVCA 2VZUA 5CC5A 2GUYA 4LALA 5FJRA 1NEYA 3W28A 2Y4SA 4YHGA 4H9XA 4AVOA 1VFTA 2Y63A 3LI0A 3G1XA 3KTSA 1V03A 4W84A 2J74A 4H9VA 4IF2A 3GHRA 5D9NA 2Y70A 3GNPA 4CGTA 4HYWA 3ARUA 1A5UA 2V3GA 4ICCX 5KEZA 2OZ3A 1ZJBA 3EOSA 1Q8AA 1FWBC 3GC4A 3B06A 2DZTA 3W75A 1Q2SA 3M0IA 3DI1A 4OBRA 1ZFJA 3OA3A 2WHJA 3ARTA 3ALFA 4HZ6A 4J3WA 3UEQA 3E0FA 4V2XA 3W7CA 4H19A 2WQDA 3HBLA 2DV0A 3OZOA 2F8QA 4DZIA 4DJFC 1UKQA 1L6YA 2ZRYA 4WZHA 4IJBA 2CKRA 3EMCA 3IAPA 3L4XA 1XBVA 1C9WA 3AU2A 4FXSA 1PVNA 1A3XA 3WL0A 1SR9A 2DUXA 1LROA 1GW1A 3AICA 4W85A 2QIIA 3PZQA 1PZ0A 1C93A 4NXSA 1J5SA 2ADAA 1YTDA 4FLSA 3QEZA 1HTIA 1YDNA 1WKEA 3DFOA 5L6UA 1PDYA 2GZXA 1JXKA 4O10A 3THUA 2ZOXA 3PNZA 2GDVA 4ZB0A 1P6WA 1CGTA 2HROA 4AUBA 3G24A 5ABFB 1U33A 3NZGA 1JDAA 1DE5A 4NJHA 1UZ4A 1KXVA 3PSWA 2NT1A 2XU2A 3U5UA 3M0ZA 4UCFA 4UQCA 2GJRA 4HNNA 4AY8A 5TD4A 2A4AA 1IQ8A 2EGZA 3WH6A 4B5NA 2YA2A 2IXVA 4U28A 3E02A 4B2DD 3MO7A 4GYFA 4GCXA 3N18A 2QGYA 1A53A 2I7GA 1ICQA 3S6TA 1OT1A 3VX0A 3GC5A 2EPNA 2OT0A 1V02A 5D33A 3A4XA 3DFYA 1G1YA 1I0BA 4RZ4A 1JCLA 4Q32A 1ONRA 4F3HA 5BU9A 3MI6A 4LGXA 2ZUVA 3NZRA 2Z6IA 4DZAA 2VDIA 1KR1A 3GNXA 4JKLA 3GR7A 1TIMA 3PWAA 1OZQA 1TJPA 1Z8AA 3LI1A 3SW6A 1J4EA 4G7EB 2J7HA 4ZOEA 4XKYA 4AW7A 4HJFA 2C1GA 5CLWA 3QM3A 3G1SA 3KHJA 1JPDX 3KDOA 3DFPA 4I5XA 1KM4A 1JQXA 1Q6RA 3S8HA 5I78A 4B2DA 4E5TA 1D2KA 1RLCL 1Z32X 2PC8A 4G7EA 2WKGA 3VIFA 4KESA 1XYAA 4M80A 4GXPA 3TJLA 1E1CA 2J9XA 3HJZA 5A5WA 5IBXC 1Y5WA 1ZCCA 1HL8A 3UU0A 2QCEA 1UZDA 3OP2A 1B5TA 2YGYA 1QI5A 3PJTA 3DFSA 4NRRA 1JZ8A 2W9MA 2WJDA 3TR9A 2GJXB 3C0JA 4YJ5A 5T91A 3BXWA 4J9JA 2HE5A 3CUJA 3WCZA 3TJIA 4CU7A 2V5BA 4HNCA 1H61A 3PR2A 4FB7A 3K8LA 2Y5JA 4QS5A 4N2YA 4WK9A 2GJXA 1CB7B 4HPNA 2XGIA 3THDA 4CU6A 1H60A 3VDCA 1EJUC 1UYQA 2PP0A 4IP4A 4MYXA 2QCGA 3A5VA 4F8XA 4IMCA 4DBEA 1ONWA 3GTXA 3LCHA 4ZXLA 4FMVA 4Z2JA 4S2CA 3M0YA 2PRLA 1DTUA 2EJAA 4KPLA 2EAWA 1A5MC 1XX1A 2P53A 2BXVA 3H70A 1PKMA 4KWWA 4R53A 1M3UA 5CBBA 4JTHA 3W4RA 3CWNA 3U57A 1DHPA 1TQJA 1B0IA 2WAGA 4IZGA 1B1YA 2YCEA 5EA9A 2D3NA 4QHRA 3CLMA 4W93A 4AIEA 2Z7GA 3NQCA 5LKYA 3LPOA 3LY0A 4BWLA 2P88A 4XZHA 2NXIA 1GNXA 4H9UA 2X7VA 4M6PA 3E96A 1EH9A 3NJ3A 3G1FA 1FCQA 2ALRA 3WQ5A 2I9EA 5AZ0A 5HJYA 3H2FA 2EPMX 4W8LA 1TE1A 3PUGA 3UF9A 2CLOA 2RGLA 1CLVA 2Z1WA 1QW9A 4XO6A 3P14A 1G5AA 3E0WA 1QNPA 4MGGA 1F9CA 2I5IA 1V0KA 3VAVA 4NL1A 2BV9A 3WX7A 4PTWA 3TQPA 1LL7A 3CAKA 1BGAA 3N2OA 1SO3A 1HKKA 1B90A 1UR8A 1E3ZA 1FRBA 1NJJA 5BXPA 4EWND 2YYUA 1MZHA 2O0TA 3JZUA 2C13A 1XIHA 4IMFA 4IJRA 4GKLA 2WWCA 1JCMP 3FA3A 1ADSA 1W1B1 1JDEA 4NZJA 2Q8XA 2PWGA 4PUNA 2ASHA 2QCMA 4Z1CA 3GAYA 3W25A 3ZO9A 3GW0A 4S23A 3CB8A 3VD7A 5CXPA 1EP2A 4O54A 2CLKA 2VXNA 3H22A 2QAPA 3TDFA 4F2TA 4HBKA 1GQIA 1Q66A 2BHZA 1B30A 4RCXA 3BOLA 4C5ZA 5AHIA 5AHFA 4JIQA 3KW3A 2PU0A 4XQ6A 5JU6A 3LHUA 2V6AA 1OFDA 3NQAA 4ORMA 4PEKA 2ZVIA 4LYKA 3OEXA 3W24A 3TLLA 1P4CA 3BLFA 3UY7A 5CZ0A 3ABSA 1RY0A 1EB3A 3LCFA 3GH7A 2WJZA 1UR2A 4B5TA 2ZTKA 1FWAC 4GOAA 5AN7A 1GOQA 1RLDA 3M47A 4HIBA 3BSGA 4F0LA 1XYZA 4NJIA 2I14A 4Y9PA 3QY8A 2W27A 2ZZ1A 2CLPA 2VFHA 5IM51 4TTGA 3CQ0A 1UR1A 5EGRA 2ZX5A 4JQ3A 3IARA 2VENA 3WLMA 3UETA 1PTDA 1PKLA 1LWJA 3R79A 4Z1AA 2QHAA 3MVIA 2YXXA 3EXRA 4V1YA 2JKEA 1ZBCA 3AS3A 1NDWA 5A95A 1QI0A 3UWUA 2WCSA 3KBWA 2E67A 3WLJA 1IWBA 1N7KA 3V0TA 2WVSA 2HVOA 4YTTA 2Y2WA 5AECA 2B7OA 1YNPA 2EEXA 1LWHA 4LC6A 2VR2A 4ECLA 1SFLA 2OKTA 1AQHA 3G0UA 5CPNA 1SQ7A 4FLOA 2BB0A 3BQ5A 2YL9A 1EHAA 5AC7A 3R8HA 3R0UA 1J5TA 1TZZA 2G3MA 5C9WA 5D9MA 5AKQA 3AUJA 4AAJA 3W01A 1Q45A 3HB9A 4GZJA 5BRQA 5XINA 3NG3A 1BEUA 2E68A 2GGEA 3FIGA 3NZ1A 4R85A 5BYWA 4MJZA 4ZSTA 1JR1A 3WLNA 3ARWA 3VIMA 1F6KA 1P43A 4IJCA 2V30A 3WF1A 1KRMA 2BVWA 4Z2IA 2XFWA 3IJ7A 2WOQA 4PBEA 1E9ZB 1T8XA 2F7FA 5HMDA 4LX4A 4GXWA 1HKVA 5C54A 3OLDA 3ABOA 1TWWA 1YXDA 5KETA 4ALDA 3NGFA 3CHEA 4EF8A 1JRCA 3W7MA 3TVAA 2VNCA 1XD0A 5DQPA 3WSUA 1XLMA 4ICMA 3G1AA 4IH3A 3QHMA 2OZ8A 1Z44A 2EPHA 2DJXA 2OLHA 1DQUA 3L4WA 1WA3A 3T08A 1RAKA 1Y5XA 2X09A 3BMWA 1F07A 4TMBA 1W56A 3WBWA 4BQ5A 4S3KA 4KRZA 2QCFA 4W89A 1EC9A 3WMCA 2WM1A 4M81A 3TSDA 2EKCA 1BWVA 4HK7A 4KF1A 2FPYA 3I65A 1NWTA 1J01A 4LS2A 1MRAA 5I3IA 1R38A 1QOXA 1HO1A 2O9OA 1XIDA 3W23A 1RK5A 3H7UA 1X97A 3F5LA 3R0DA 1B3YA 4JXCA 2VCBA 1A5AA 1B4KA 1WUFA 1IZKA 1K3UA 4Q8UA 3UA3A 3A47A 1AW2A 2OLSA 1IIGA 1LT8A 1OFOA 3W7PA 3W1UA 3C8FA 5F1VA 3O8AA 3UXLA 1IGSA 1KXTA 4A8RA 4GC3A 3HO8A 3UYCA 3PBMA 3SUUA 3KOYA 3TYUA 3WQOA 4GHRA 1KFLA 4GLEA 4JICA 1FWTA 1ITXA 4WDXA 5HNNA 2Q6ZA 2Z1BA 1M7XA 4JX5A 1U1UA 1NY1A 4GVFA 4DM1A 3RO8A 3ZWTA 3CPUA 1YDVA 1M7PA 1EX1A 3L5MA 4DAIA 1K77A 3KL0A 1K8CA 4L7ZA 1QHOA 4NASA 1DIOA 5LYRA 3H6OA 4C7FA 3DYMA 2QVNA 5EMKA 4W86A 1TELA 1H09A 4KGLA 5EYWA 1QR7A 3R2GA 5LHFA 5I3HA 1LQ2A 3NZQA 4RDYA 5B7ZA 5HUPA 2JIEA 1ODZA 4OBTA 3EOEA 4XBJA 3WQEA 4Q3MA 1TVNA 4Q4KA 4I5RA 1KCKA 1VFOA 2AGKA 3OLEA 1KXQA 3ITCA 1BG9A 2VD9A 3V5OA 4RK8A 1JPHA 3AZRA 3M6DA 4NJKA 4MB1A 3UXIA 3PBYA 3WDPP 3N25A 3IJDA 4I8YA 5EKYA 1VH7A 2SFPA 1QO2A 1I9CB 4ZA0A 2V5CA 1RJPA 2J75A 1ADOA 2ZX8A 4DJEC 3NQFA 4BF5A 3EWXA 2OQYA 1JL8A 4HZ8A 3O06A 3UZXA 3W2MA 1PUDA 1F6PA 4WF7A 5DBUA 2FJUB 3RLGA 3WELA 1UKSA 3IIXA 1A5OC 3TFCA 1LYXA 4B90A 1LDCA 4MNKA 2PDQA 3VNZA 4CD5A 4C1LA 1XP3A 3MUAA 2PP1A 3U5YA 2DSWA 4AY7A 1YDOA 4PB5A 5E1QA 4H9ZA 3OYZA 3OA5A 3IK2A 3WMSA 1E4LA 2Z1SA 4P7NA 2QULA 2PDMA 4XZ9A 2PCQA 3GDMA 1XBZA 3ONBA 4D6CA 3D6NA 2OO0A 4RE4A 5G2HA 2E5BA 2OR2A 4L6DA 3PB0A 1XC6A 1TVLA 3QC0A 3NYDA 3SQSA 3L67A 2XUCA 4RLIA 4CD6A 1XQLA 3VNYA 3P5YA 3QR3A 3S46A 4CNSA 1ZY9A 4D8ZA 1ZRQA 3PPFA 2OGJA 3VGDA 4AIOA 4IX2A 4MZ1A 2E6AA 3AMDA 2V5DA 1IEXA 4AFYA 4EKJA 1UW9A 2Y6ZA 4DBUA 2CITA 1BTCA 4IG2B 1M1BA 2C91A 1IWAA 3F7JA 4EAYA 2R1NA 3T0AA 5DCBA 1ZQ5A 3MSRA 2WC4A 2D73A 3UR8A 3WEOA 3IGHX 4WUIA 2WSKA 3GDKA 4Y9NA 3P5ZA 3PJXA 4O1BA 4NF7A 3VOCA 4PN2A 2QLYA 2PTYA 5BRPA 3HM7A 4WY0B 2ZKMX 3CNYA 5BU6A 1J0IA 3L2IA 4MVAA 5FESA 2FZNA 2GQ9A 3LGGA 1YRRA 4FPSA 1WZMA 4CNOA 3CMFA 3DFHA 1K9EA 1XLEA 3AIRA 4JY9A 3HGOA 4FEZA 1DIDA 1C7TA 2G96A 4E3VA 4M7TA 1QFEA 2RDXA 1KFBA 1EZWA 2WMKA 2XHYA 1XYBA 4TXEA 1AFSA 3NSNA 4LUIA 4QLLA 4Y96A 2CEQA 3DCPA 2HBXA 4J27A 3R0KA 1ZSXA 5H91A 3OYXA 3WEMA 1OK6A 2CZFA 1MW0A 4UTJA 1FWCC 1RCOB 3EB2A 1T6MA 1E4IA 3TW6A 8RUCA 1W3LA 3O15A 3OBAA 2IMRA 3LPGA 1JXJA 1KFJA 2XPKA 5HJLA 2OSWA 3WQVA 2WJEA 2TPSA 2JGYA 4KFOA 2ESCA 1O6IA 1AZ2A 1Q3NA 1XSKA 1W9UA 2VC5A 3SI9A 5CPSA 3P82A 3SCPA 2HZGA 1H0IA 3NAVA 1PV8A 2Z25A 5HATA 3BG5A 5CSYA 3IWPA 1QDSA 1YPXA 4FS9A 1E40A 2J47A 2ZZ4A 3CV7A 3MBDA 3T2PA 2R82A 4OTKA 1SJDA 1V79A 4UTWC 1EJ7L 1AK5A 5D2VA 4WJEA 3ZSSA 3DHDA 4C65A 2FVMA 2VWSA 2XFFA 1JGMA 1W1ZA 5HMFA 3CB3A 1F05A 1OBAA 4ZOCA 4S3DA 3THCA 4ZENA 1O1ZA 1TWDA 4WDUA 2FJKA 3AIBA 4S1FA 1ITCA 1LLWA 1XLDA 4UFLA 4DO4A 3OGVA 4L1GA 3SQLA 2WLYA 4HOWA 1HIZA 3ITXA 4LNYA 3OGRA 4OHQA 2WHMA 2VO5A 4ASTA 1X38A 2RDUA 1XICA 3KL3A 1PJ9A 2PB1A 4FOJA 3VNKA 4K7YA 2BG5A 4UQEA 2OVLA 2XYLA 3S83A 1SMAA 4K1GA 5D9PA 3SJ3A 1F5ZA 1MO0A 3S2JA 4LVGA 2VDGA 4JIEA 4ZL1A 4HU4A 5FL1A 2ATMA 3GVWA 3SCWA 3S1GA 5AHEA 3BGJA 1QW7A 4UTIA 1W3TA 3WY1A 7REQA 3PZ9A 5DMNA 2DT3A 1S1RA 4U3CA 1NFGA 1QXLA 3KFTA 1EO7A 2WO5A 4B5UA 2J7FA 1GQLA 1V3JA 5D8ZA 1FCUA 1UA3A 4IIDA 1SFJA 3QPEA 3VMPA 3NGJA 2V5KA 4GYKA 4JZ5A 3EGJA 2WNZA 2EO7A 2HEJA 2W92A 4D6HA 1G4EA 1YADA 3WBEA 5CG7A 2VC6A 4QJ3B 3WYZA 2YBVA 1JAKA 1CGYA 1R9YA 3BO9A 4UR8A 1OCNA 4QXIA 4EPKA 5M03A 1FWGC 3C86A 1NDZA 4QSHA 3G77A 2D23A 3T7VA 4AZ7A 4M7SA 3TWBA 4C60A 1H2JA 3ARVA 1BAGA 3BLDA 5D2WA 3B97A 4ZQOA 3QW3A 1CDGA 1XLBA 4J1OA 2IUZA 3KZSA 1TMLA 1V8EA 3P67A 1YHTA 3VCCA 4DIAA 3IAQA 1E0VA 4PA8A 3Q94A 3PTKA 1Q6GA 3T09A 1H63A 4JOMA 3V1PA 3GTIA 3B40A 3BK0A 3TYCA 3QMTA 4ZZ9A 3UJEA 3W7OA 4K68A 1V0MA 4Q4OA 4ZO7A 1RV8A 2DT1A 4C6PA 1VQTA 3N6QA 2J6VA 1EBHA 4WQ6A 3ARSA 4D6IA 2BY2A 2FKPA 5CGMA 1B4EA 3E3HA 1E6ZA 3GLCA 1Q6EA 1TTJA 1XRVA 4Z1DA 1SVDA 3N4AA 1Z3NA 3HGSA 3LD5A 3NCOA 1UR3M 4EPBC 4KWSA 5J5RA 3SECA 5FA5A 5HK4A 2Q8ZA 1M65A 4L4OA 1XL9A 3BPWA 1WDWA 4B5VA 5HULA 3KZPA 3HTWA 2QUNA 5I7GA 4HA0A 1OX5A 5AYYA 3WD3A 3EB3A 3U3HA 5G4WA 1YEYA 4J2MA 1H7NA 1M5WA 1LUCA 3WNOA 1HP4A 4LCRA 3BANA 3WKZA 3HIJA 1O5KA 2I56A 4PMOA 1W1A1 3TH6A 1SW7A 2FH8A 4G1KA 3M5XA 3GXTA 3QOMA 4U3AA 2PWEA 5JH2A 5REQB 3TOPA 4A22A 4ERAA 1OF6A 5F1UA 2UY2A 1JG9A 4TVUA 1ME8A 3RPMA 2PLCA 2PDWA 4O0ZA 3UCQA 5C70A 1U1HA 4JTRA 2ZCGA 3GKFA 4BZYA 1RBLA 4H8HA 4O4WA 4GZIA 3E0VA 2A7RA 2NQ9A 3T0CA 3PUEA 3AWOA 4C6NA 5C2GA 5H1WA 4BWLC 5I3JA 3M41A 2FLIA 1L6SA 2E8YA 1U30A 3VIHA 1UUQA 2GOKA 4H3DA 2CLMA 1KQYA 1P0BA 3O3RA 2AOSA 3EWYA 3W07A 3W6YA 4B9ZA 2CHNA 3KRSA 2ZC1A 3G6MA 2W5FA 2P8BA 4C7GA 3THAA 2I16A 1XYCA 2Q09A 4AZCA 4IIGA 2XFRA 2DZUA 2FZBA 2LLEA 5DMLA 3PZGA 4IXHA 4X2RA 1ISXA 5DBTA 4GQBA 4JIRA 2AMXA 2OMAA 3OQ8A 1CCWB 3Q45A 4EWJA 1XFBA 2PLMA 4CEXC 1RXOB 1VBHA 5GJNA 4AZIA 1OC7A 1WUEA 1G0CA 3UZYA 2W3ZA 3USBA 1E5JA 4S3AA 3N12A 4YMZA 2W63A 4G2DA 1XYFA 1OFPA 2JIWA 3MBFA 3L7RA 4KRUA 1QNQA 4Q7BA 1G01A 1X1OA 3E1F1 4HHPA 4H9MA 1JYWA 1LCOA 4K6AA 3F03K 3MYOA 4O53A 1UJQA 4OUIA 2DIKA 4JNMA 4E3TA 4Z08A 3S9YA 4O52A 2A3HA 1VPYA 4IMAA 2VX6A 3VGEA 5CZJA 2QUUA 3QSTA 2BY1A 4D1IA 4RXFA 2E6FA 3QMRA 1Z41A 3W72A 4Q6XA 1KFCA 2CHOA 2X0HA 7ODCA 3W2JA 2NWSA 4IPJA 2YCKX 1JUKA 3PPGA 2YDAA 3WH7A 4BFAA 3IANA 2RHGA 3PB2A 4S3FA 1O4UA 2ZE3A 5D30A 4TMCA 4K7VA 2WV8A 4DLMA 1PTAA 2NZLA 2WB5A 4IGSA 3TJ4A 4KGJA 5CKSA 1R3WA 3AIUA 4DWDA 4LUJA 1UWTA 1VCGA 3FKRA 3RPTA 3PTQA 2OODA 2GDUA 1O5XA 1YX1A 2WZEA 2JFEX 5F4XA 1F76A 2OSXA 3TP4A 1JPKA 1BXNA 4KH2A 4YU1A 3NO1A 3DFQA 1DJIA 3QVQA 3KUMA 2XGZA 4ZVJA 2AQWA 1PHQA 2BFGA 1UUOA 2J25A 2VFGA 3MHGA 1BSIA 4AD4A 2POZA 5HR7A 1Z6KA 3TXZA 1MZRA 5FF0A 3DKLA 5I3FA 3ABXA 2PI6A 1K7EA 3KAOA 3N04A 3IJLA 1OGBA 2DQXA 3ANYA 2PDLA 3AJXA 3T0BA 1TJ0A 4ZR8A 4KFPA 2WNQA 2J27A 2CXGA 5F2GA 4PUKA 1CB2A 1TX2A 2H8ZA 3PUOA 2VEIA 3SCQA 4YYCA 3N2TA 1IEIA 2WCAA 3RF9A 1UD5A 2V82A 5A2AA 4Z2LA 1DPMA 3A64A 3WDQA 1N2VA 4RZ5A 4O1FA 1WDSA 2DJLA 2DUZA 3RX2A 3WLIA 4CQAA 3VZZA 4DAFA 3RCNA 1BXCA 1BGGA 3W86A 4GMEA 2V68A 4O16A 1W5NA 4LV4A 5EMJA 1ZJAA 3D3FA 3C6CA 3AHXA 1M01A 1POJA 3FA4A 3QKZA 3UJ2A 4CCCA 1M41A 1XGZA 1CXHA 2Y0FA 4AWTA 1YXYA 2DZVA 1RJRA 4YN5A 2UWFA 1WBHA 2PDFA 3R25A 1XIMA 3COTA 2G3IA 1EA0A 1U83A 5FCZA 1K6AA 1OD0A 3VD4A 5ABEA 4YWSA 3MKVA 3QV9A 4EPDC 1X1NA 4PFMA 1ZAIA 4PBGA 2HDJA 1XS2A 4ZQCA 3IV8A 1ITUA 4U33A 1OCQA 3VKAA 3LNMA 4JD4A 1ME9A 1GVRA 5FJOA 4H83A 3ARQA 4FNSA 3U2EA 1CBGA 1TTQA 3LXAA 4MAZA 4QDWA 3BQ6A 4MFDA 5JMUA 3BV7A 4DJDC 1EA9C 3KDNA 4HSHA 2C6QA 3G8RA 3N9SA 2PFHA 3IUIA 1E9YB 2HK1A 1BWKA 3S1WA 2CBVA 2YZ5A 3E5BA 3CMGA 2PC4A 2XIQA 1XIJA 3TZFA 3DHUA 3RLUA 4UMBA 3BMXA 3F4WA 5AYIA 3B3DA 3TN3A 1VFLA 4ENLA 1XD1A 2QJHA 1EC7A 3FYYA 4ZB5A 2ACUA 4JBRA 3NL2A 1JNEA 4J3UA 4DJFD 1GZJA 1KV5A 1Q5MA 3BW3A 3S5ZA 3WBAA 1DEDA 1QI4A 5DRCA 5EY5A 4LS1A 4OWGA 3W1MA 4ATDA 3PK7A 3W27A 2OX1A 4QE1A 1W3IA 2TRSA 3PZOA 2F2KA 4D6DA 3DHPA 3VYLA 1UD2A 1HGYA 4V27A 3NOEA 4O8AA 4H6EA 3CEUA 3A23A 5D2TA 2CETA 1PZ1A 2Y8VA 3QGAC 3W1XA 3T6CA 3FDGA 1BXBA 1RVGA 1UD4A 1S5NA 4JHOA 1R3QA 4R88A 3QHOA 4FX8A 3HG4A 2JGQA 3GVVA 1MQQA 1V3IA 3JS3A 5CEWA 1FH7A 2Y24A 4NRSA 2X0YA 3UWWA 1SJBA 3A4JA 4DJFA 1PSCA 2V3DA 4AIUA 1WO2A 2VZVA 3CHDA 3LMYA 5AVHA 3K1DA 1MFUA 4ROQA 3WD0A 2GVEA 1EDGA 4A8NA 5TF0A 3KRUA 4Q8WA 3QV8A 4HCLA 3TX9A 3MW7A 2WZIA 2VGIA 1UC5A 4EX4A 4HU3A 4F40A 4CCDA 1SYTA 1FBAA 2G50A 1Z48A 1REQB 3U4AA 1HUVA 1NWUA 2WJFA 4UNIA 4ZQRA 3O07A 3U2OA 4PUJA 4PMVA 1K9FA 5KZ6A 2XH0A 3B04A 3T07A 3M0JA 1J8VA 1EWEA 2AAMA 5J04A 2PP3A 2H3BA 2H9AA 3A3XA 5BXRA 1REQA 2HV5A 2W62A 1EJXC 5LIWX 4GNVA 3WQCA 1RPXA 4OOZA 1HL9A 4JAWA 3BCFA 1HP5A 3GUWA 1MUWA 4I3GA 4F9JA 3F1QA 5HOSA 5HWJA 3TA9A 1ESWA 1B57A 3ITLA 4X9SA 3OBEA 1DWJM 3VA8A 3A12A 1T99A 3RYSA 1UZHA 2B31A 3NEHA 4UXDA 1OYAA 1TR9A 1YDYA 4A3UA 2QCNA 3I6EA 4MHBA 3AXXA 4DWSD 2B4GA 3VTRA 4GUHA 2XH7A 1NWRA 1OZMA 1CTNA 2A3BA 3NQGA 3DENA 2VOTA 4HGXA 3V7PA 3OLIA 1W31A 3BURA 5JBDA 4INFA 2YW3A 3BG3A 4GQRA 1E4MM 1WBJA 4NX5A 4PMJA 1J6PA 1NSJA 3O0KA 3PF3A 3B05A 4DWSB 1H3GA 1GKRA 1FWDC 2VQTA 4FK9A 2JQXA 2FZ8A 5U7SA 1C7SA 4CN4A 4JQ1A 2XVGA 3HG2A 3AI0A 4TTUA 4Q8NA 3TNOA 3WNKA 4IIFA 1UR4A 3GDRA 3W22A 4DWSA 1Q7QA 3GNOA 2HISA 1Q6FA 3QTGA 4NUWA 2NQ5A 2QQ6A 1GTEA 3STGA 3VFLA 4TV5A 2J7CA 2WSPA 3LLDA 4GABA 4E2DA 4Z2KA 4AWSA 4IIBA 1OG0A 2ZDSA 2CC0A 3WJYA 2WKLA 3FAWA 1X1ZA 4EXAA 4MADA 1HW6A 2X40A 4O0QA 1US3A 1FWNA 3W6MA 1RSCA 1O12A 1YIXA 2J88A 5LNUA 2ZUNA 2D1ZA 2V63A 4DB7A 4BEUA 1R5YA 2ZFAA 4Z1YA 3RJXA 4JHZA 3RM9A 2WQPA 3LSCA 2W0UA 3IGUA 3AALA 4JKKA 1VCVA 3UG8A 1QMLA 3HPZA 4DUOA 2OYLA 1H7OA 3A13A 3K4DA 3WUFA 4BQ2A 2VELA 3LTYA 2G37A 4LYRA 2XWEA 3ICJA 5B80A 4TIMA 1JZ4A 4OE7A 3VIGA 4TOQA 1V3LA 1NELA 3H24A 4NP7A 1A5SA 3WUGA 3AHYA 4Q8OA 1TV2A 4GVIA 5A2BA 1OFQA 4IMEA 2CBJA 4BF7A 2I57A 3UG3A 1E9LA 2PGFA 5BWAA 2WSQA 1TR1A 4ZOAA 5FF3A 4I6VA 1R85A 1VCFA 4MYAA 3UT0A 3H2OA 3A4AA 5DY2A 1UWSA 3TYZA 3NEVA 5IHSA 1XUUA 4LOCA 3S0CA 3P6LA 4K8GA 1XV8A 4Y9AA 4QNWA 2B7NA 4C6MA 3I6RA 1FWRA 2V81A 3AYSA 2E1WA 5TAOA 3GFXA 3C3UA 1D8CA 4JCMA 3DFNA 5D37A 5HWNA 2DZSA 2QCCA 3LSBA 4W8AA 1KWKA 1SW3A 4B3ZA 2VVSA 1K9TA 5F2MA 3QFEA 2YCIX 1UROA 2IQDA 3MMWA 4UUIA 1EYWA 3SDOA 4HZ7A 4EOUA 3VGGA 1NFPA 1F3TA 3KXQA 5EFFA 1GVEA 3BDKA 3S6OA 3IGXA 4GFIA 3SUTA 1RR2A 5EMYA 1R9ZA 4P8VA 2I1OA 1UH4A 3WG6A 6REQB 1MSSA 3QLLA 4AZBA 4F0KA 1KD0A 5AOUA 4S3CA 2PDBA 4E8GA 4FNRA 5TQLA 4G6CA 1B3XA 3BSHA 3CH0A 2GGHA 4XUYA 1M6JA 3GE7A 1QVBA 2FHFA 2FGBA 4OFCA 4W7VA 1KM6A 1W5MA 3BAJA 2JF6A 3QGKC 3WD1A 4N9DA 3AHZA 3AIWA 4M29A 4XTDA 3ZJKA 3H2MA 2YXGA 4V1XA 3ZR6A 1R47A 2ISWA 1FUYA 2R91A 4IPLA 3UXAA 2PDCA 4O1EA 4EACA 4ERIA 2OQHA 3C2YA 1PIIA 5AFDA 3KVKA 3QF0A 3AZTA 5EB8A 4K8EA 1VJSA 4S39A 1Q4WA 3IRSA 4A8IA 2A2IA 2BP1A 4YVPA 4IIEA 1XM3A 3VE7A 1ZS2A 3B0PA 5BOEA 4NVTA 4PCPA 4XIAA 5BROA 4WLCA 3TA6A 1UJPA 4IL0A 1GKPA 1UP0A 4KEUA 4HMDA 1ZCOA 4UTFA 3IJ6A 3F4VA 3ZOAA 3LQLA 3SCUA 4Q7NA 1HGWA 5HAOA 2AMGA 3EA1A 2J77A 4ZTXA 1O5QA 2QJGA 4WJ8A 3G3MA 4GX8A 4N0RA 1UCWA 4GYPA 1I45A 1UA7A 5JH1A 4LAMA 4LH8A 4OU1A 2WNWA 4F0RA 3AXKA 4S3EA 3WNLA 1QBAA 2A3AA 3F2BA 2PMQA 2YDSA 2FYMA 3M0VA 1P0DA 3OLGA 4DBWA 2VVNA 3UNTA 1TUFA 4PR4A 4QFUA 3AIVA 5GNYA 2VT0A 3ZVHB 4GI8A 2D69A 5E5CA 3KP0A 3NFUA 3FGCB 1RCXB 5LNRA 3OIHA 3RJYA 1VBRA 2R24A 1AA1B 5LA0A 1TV5A 3HOJA 3HPAA 4KEVA 2ZIDA 5BCAA 3H7RA 1TMQA 1V3HA 4J3ZA 3NSXA 4AF0A 3P0XA 1SZEA 3R6IA 4EK7A 3LGEA 5DANA 3FGCA 1TUXA 4L1XA 5I23A 3KOXA 4Q8QA 1UWAA 3LEPA 5DCDA 1W0MA 4AD0A 3C0QA 3FJNA 2WMIB 2H6RA 2DSZA 2NLYA 3K4AA 3STCA 1J12A 3SN1A 4EANA 5CBIA 3FFSA 2V2CA 1TTPA 3E5PA 2PODA 3GXMA 2O7SA 4CKQA 3ECQA 2EG7A 3LBCA 4QG6A 1VEOA 2OJPA 5I06A 2EG6A 3SN4A 2WMIA 2X1TA 3CK5A 2WLZA 3TTYA 4HA1A 4QBXA 4LYQA 1CNVA 4U2ZA 4L56A 3S9IA 1FXQA 4Q8PA 3S1UA 3Q4DA 5BRBA 4PMYA 1GOMA 4ORIA 3TZNA 3DX5A 2YCLA 1U5VA 3T55A 3V5CA 2DZBA 1T8QA 4A2RA 3PSVA 3ZM8A 2OEMA 3QZEA 4JFWA 2E9MA 2X16A 2Z1XA 1ZTVA 3LV5A 1S1PA 1KBIA 1JULA 2WMGA 3NTYA 3B0UX 2Y88A 2X7WA 1YMYA 1B31A 2BBFA 4RV8A 2R1PA 1WCGA 4XVEA 2ISDA 1V6VA 3RHGA 1KM5A 3RG6A 3FJ4A 3GUGA 3MKKA 4O11A 4MDOA 3AYTA 1EXBA 3AAMA 4QAIA 3A9BA 4KETA 2OWXA 4FOUA 3I7QA 4PUDA 4A3YA 4MFEA 2Z28A 1XFCA 1BYCA 2DZXA 1L2UA 1R8LA 3KCLA 1H62A 3RK8A 5FSDC 4MY9A 1EPXA 5G1MA 3BAIA 1I2OA 3PBWA 4HTBA 2J8GA 1R46A 3URBA 5CQ1A 3SUSA 4UTUA 4IM4A 4HB7A 1XG4A 3MCMA 5MHBA 5FJIA 4WGXA 1EWDA 4LJ3A 2GUUA 3WF3A 2FTWA 1QUMA 5FIPA 3WJZA 2PWHA 3SGGA 1V7AA 5LXEA 1J11A 3NM1A 2DT0A 2E09A 1GQJA 3A9IA 2P10A 1PAMA 1TCMA 2ZRZA 5LIXX 5KSWA 2Y8UA 2BNJA 1P0KA 3W7KA 3ITTA 4QEHA 1Q7ZA 4S3JA 1UWQA 1JD9A 4GX9A 3QRHA 1KBJA 4QE5A 2H90A 5AZ1A 4RW5A 3MUY1 1OHLA 3SCOA 5DFAA 1WKFA 3ATYA 1A50A 1OWQA 3V3WA 2OZ0A 4GNJA 2D0GA 2A0NA 3LHYA 5CZSA 3WQPA 3QQ1A 5I00A 1BQGA 3UPWA 4ATLA