3WUBA

The wild type crystal structure of b-1,4-xylanase (xynas9) from streptomyces sp. 9
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
313
structure length
313
Chain Sequence
DTATLGELAEAKGRYFGSATDNPELPDTQYTQILGSEFSQITVGNTMKWQYTEPSRGRFDYTAAEEIVDLAESNGQSVRGHTLVWHNQLPSWVDDVPAGELLGVMRDHITHEVDHFKGRLIHWDVVNEAFEEDGSRRQSVFQQKIGDSYIAEAFKAARAADPDVKLYYNDYNIEGIGPKSDAVYEMVKSFKAQGIPIDGVGMQAHLIAGQVPASLQENIRRFADLGVDVALTELDIRMTLPRTAAKDAQQATDYGAVVEACLVVSRCVGITVWDYTDKYSWVPSVFPGQGAALPWDEDFAKKPAYHAIAAALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase A
publication title Structural perspectives of an engineered beta-1,4-xylanase with enhanced thermostability.
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Hydrolase
total genus 129
structure length 313
sequence length 313
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wubA00
3WQ5A 3CZEA 1V0MA 2Z1SA 3GTNA 5LA1A 1UZ1A 4U5IA 2EPKX 1W91A 2J25A 3SURA 3VPLA 3B9DA 2YLLA 3AIEA 4XUYA 4ATLA 1BGAA 1W9DM 2BHZA 4W85A 3WMSA 4BQ5A 2VTFA 1CENA 2XM2A 3EYPA 1BGGA 3GXFA 5ABEA 2V5CA 2XWDA 1JG9A 2DT0A 1QHOA 2A3HA 3AS3A 3MO4A 1V3IA 3OBAA 2DGAA 1UR0A 1JAKA 1VFFA 2WLZA 4J3XA 1UWRA 3AIUA 2JFEX 3PBGA 1B3VA 3N15A 1V08A 2XSAA 2YL5A 2ZUWA 4PCTA 2WMFA 2BY3A 4B16A 5JIPA 4GZJA 1UD2A 3ARZA 2J7EA 5CGTA 2DSZA 4MDOA 1E71M 1DWAM 3VGBA 5M17A 4CD8A 4PYSA 1AQ0A 4DWSB 1EDQA 1V02E 1ZBCA 4PMOA 2WNWA 3NUKA 4W5ZA 1CWYA 2XSBA 4QAWA 3WDRA 3KWXA 3N18A 3BSGA 3M46A 1C93A 1HX0A 3PTMA 1CZ1A 4OBRA 1K9EA 2V38A 2CETA 5FOOA 4IPNB 1WZAA 4U2ZA 4AIUA 5CGMA 3T2QA 5HXMA 3CUIA 1VJSA 4UZUA 2WANA 2GVYA 2VVNA 2NW0A 3GYCA 3VMOA 1JZ4A 3BAWA 4MADA 2WM0A 1VEMA 4C7GA 1J0YA 1JIBA 1W9PA 1Z32X 4JZ5A 2XVPA 3K8KA 5DEZA 4GQQA 1XHGA 1V3HA 3RCNA 4HP5A 3AHZA 2QLYA 1NWSA 2DSWA 1UR8A 2QMKA 2J4GA 1QNRA 4ZE4A 3HN3A 5I2UA 3NSXA 3O6AA 1UWSA 2JALA 2PWGA 2YKKA 4TVUA 1GVIA 1JL8A 5ABFB 2NT1A 4HZ7A 4AD2A 1GQIA 3AI0A 3WH8A 4CD7A 2PWDA 3BLPX 1ITXA 4WIWA 5DT7A 3WD0A 2EPMX 4J27A 3SCUA 4CUCA 1X6LA 1MQRA 3A3HA 4WLCA 4XB3A 1E6SM 3EDDA 4D6HA 4HU0A 5A6LA 3HMCA 1ISYA 3WL0A 4BQ2A 2XFYA 3TTYA 2OYMA 5A6BA 2V3DA 1E73M 1S46A 5I6SA 3PZOA 1LWHA 2VZVA 3SUSA 3VIKA 4M80A 5JBEA 4W88A 2X1IA 1ZS2A 2WAGA 3ARXA 2JEQA 4WSKA 2J47A 1PX3A 2QF8A 1AMYA 3AMDA 2EEXA 4W5UA 2UY5A 1BFNA 3IAQA 3OLDA 1NARA 2YIHA 2WCSA 1L0PA 3QOKA 1J0KA 2JE8A 3WUBA 4PTXA 3AISA 3ZT6A 3ARYA 3ARVA 3II1A 4UFJA 4W8LA 1W9XA 5A8OA 3SCWA 1EHNA 4P7OA 1W3KA 1ZJAA 2W63A 3I3EA 1BSIA 3BCFA 4U2YA 2WC3A 1EIBA 4UOQA 4MB4A 3BH4A 3CZKA 3AYRA 5EFFA 1C7TA 1WAWA 1BHGA 4QFUA 1OBAA 1I1XA 5GNZA 4M82A 1FHDA 1X6NA 4P7QA 2XVNA 5A8NA 4P7NA 1E15A 2YA0A 1GQLA 1KQZA 2C8NA 2OSWA 1QVBA 4HZ6A 4EANA 3AIBA 1IV8A 1OT2A 2PB1A 3THDA 2VRQA 4B9YA 1UKPA 4UFKA 4DWSA 2WZHA 2CYGA 4KRTA 1K9TA 1J01A 3LPOA 1E6PA 3TA9A 5A8PA 4J3VA 3IAPA 3F5KA 3VDCA 1GOMA 4CD5A 3FHQA 2NT0A 2MANA 1WDQA 5JBFA 1OB0A 5EFDA 2D2OA 1EOMA 1H41A 2ZX6A 1J0HA 2Q8XA 3MKKA 3JUGA 1MW2A 2YL6A 3I3BA 2G3MA 2PWFA 1CGYA 1WDSA 4HZ8A 3W82A 3OG2A 3OGVA 1R85A 3WH5A 1MFVA 2XFRA 2XG9A 3AZTA 4LX4A 1E1FA 4JHZA 5I5RA 5M3WA 4GZEA 1ESWA 4W8AA 3ARRA 4WSJA 2EPLX 5IHSA 1HT6A 4B9ZA 3MUZ1 2J75A 2PF0A 4CCCA 3RM8A 2PI6A 1HKMA 1KR1A 4L4PA 1SMDA 3ZSSA 2W91A 1HVQA 4K68A 2WKLA 4OOUA 1OT1A 1W3HA 2DIEA 3TOPA 4JFWA 3U5UA 3CUGA 4C7DA 1UYQA 4YHEA 5TD4A 4LYQA 3KL0A 4U31A 5GPRA 2WMIB 3SUWA 4KWUA 1ISZA 1DHKA 2OSXA 3UESA 1JZ2A 1ZBKA 2ZXBA 3QR3A 3VIOA 4N0RA 4TTGA 3L4ZA 3VIGA 4AZGA 4CU8A 3ZMRA 2GJXB 1EDGA 1UH3A 5HNNA 2FH6A 3TTSA 3WDQA 5A6SA 1UUQA 5EMYA 4M1RA 2WK2A 3VIIA 1XC6A 2VZOA 4MAZA 1P6WA 2VZSA 4AC1X 1HJSA 1A47A 4AIEA 3OZPA 2CBVA 3VDHA 3S2CA 5CZKA 3VDAA 1JD7A 1ODZA 1BVNP 1JYNA 4HOXA 2BNJA 2RGLA 1QNPA 2GFTA 3GM8A 1GW1A 4Y7EA 1OM0A 2O9TA 1K6AA 3MSGA 1E43A 1PAMA 1B3YA 1PZ3A 1B9ZA 1WZLA 1HJXA 3BAIA 3UR8A 3A4WA 3GBDA 1ISWA 3UR7A 4D6DA 2BVTA 2WVUA 4AIOA 4AZCB 3VUPA 4A4AA 3BAYA 3CPUA 2WVVB 1E6NA 3W38A 3W0KA 2GDUA 3THCA 2BVDA 3NSNA 1Q4NX 1V0NA 2OLHA 1U2YA 4DUWA 1W3JA 4LYRA 4HTYA 1IT0A 1JZ7A 1NOUA 4ZFMA 3DYMA 3AROA 2DEPA 5I78A 1W1VA 2OYLA 3SCNA 5A94A 1XD1A 2OWCA 5CPTA 1C8QA 2B31A 1CBGA 1QNQA 1B2YA 3ZT5A 2BV9A 2XVKA 3TTOA 4D71A 2DSVA 4W87A 4QLJA 1JYWA 3MMDA 1HN1A 2WHKA 1E3XA 3VO0A 1OWQA 1WP6A 1UD5A 2EPNA 2ZUSA 1GOIA 1NWUA 4OJYA 3U5YA 2PWHA 1O6IA 4XZBA 1V3MA 2DIJA 3D5HA 1VFOA 4GPNA 1EXPA 4J3SA 3N13A 4J3TA 1GZJA 4PCSA 5AYIA 3MANA 1CLVA 3OLEA 4CU7A 4GZIA 3GZAA 1C8YA 1DWJM 1PJ9A 1TFVA 1WZMA 2CCRA 2TAAA 7A3HA 3OB8A 2BXZA 3WNNA 4OKDA 2BS9A 3WNKA 1SFSA 5D8ZA 3WD4A 2ZX9A 3WQ4A 2ZE0A 2CKRA 2GK1B 3WNLA 4ZXLA 1EQPA 1E40A 2CBJA 1LLOA 4MB5A 1F4AA 1OD0A 1FFRA 5A1AA 1IZKA 2J62A 3VGFA 1CXLA 2WMIA 4AZ7A 2YBTA 1NOFA 4JFUA 3WD2A 3W26A 1ISXA 1ODUA 1FH7A 2XVGA 5ABGA 4P8VA 1NQ6A 1OIFA 3CH9A 1SYTA 3ALGA 5HPOA 2J77A 4CU6A 3CHCA 1CXHA 1AQMA 2GJXA 1JXJA 1HJQA 2XPKA 3IJ7A 1W9VA 3T2PA 2YBUA 2F8QA 4UQBA 4OUEA 3W37A 1NWTA 1E6RA 1UD8A 1UD3A 3AS0A 1J0IA 1V6XA 3ECQA 1VRXA 2BY0A 2E9BA 2DT2A 4KGJA 3CBWA 3T0BA 5HPCA 2G3IA 3SCTA 3PZQA 2VQTA 1H1NA 4NF7A 1J11A 1MW1A 1E0WA 5E70A 1XD0A 2W66A 1KBBA 3EMZA 1GUVA 2WC7A 2FHBA 5CG0A 5IFPA 3B8SA 3WL1A 2WHLA 3VM7A 3VMPA 4QLKA 1KGWA 1CLXA 3BAXA 3N04A 4NRRA 3WF2A 1QI5A 2WWDA 4BA0A 4EKJA 1HJVA 3AHXA 4NZCA 2WVVA 1NP2A 2G4FA 3GDBA 3WDJA 1QBAA 1BG4A 1EQCA 1TMQA 1CGWA 1FP8A 2ZUUA 4MB1A 1UR9A 5A6AA 2XHYA 3VINA 1PZ2A 3AJ7A 1TR1A 3OLGA 2X0HA 3CO4A 4Z2HA 1UG6A 1HF6A 4H2CA 1CNVA 3AZRA 4BF7A 5LA0A 2WPGA 4UQCA 2W4XA 3DC0A 2D0GA 4AW7A 4TVCA 3BGAA 2NSXA 1NH6A 3MMUA 4CD4A 4UFLA 3PZUA 4EAMA 2X0YA 3WQWA 3ALFA 4ATDA 4PSPA 1V6UA 3WNPA 2GSJA 3ZJ7A 1KBKA 2ZUMA 2WW5A 5CQ1A 1C90A 3E1F1 3N1AA 3SCRA 1MW3A 2QV4A 3RILA 1PPIA 3VGEA 4FLQA 3WMBA 1BF2A 1UWQA 3AMCA 5A6MA 2BY2A 3ARTA 1OGSA 5E09A 4LQ1A 4TX8A 2X05A 3U57A 5AYBA 4AYSA 1O7AA 2ZXQA 4X9YA 1FHLA 2O9OA 4HPHA 3K8MA 4V28A 4LGXA 2A3EA 1FH9A 3OZOA 3F5LA 5FD0A 1Q6FA 4M8UA 4TVDA 4ATWA 2A3BA 1ECEA 2WZIA 3VGDA 4MTVA 1PX8A 4UQAA 2WKGA 1WB0A 3FW6A 5E6ZA 4ZXOA 5A6BD 3ZSTA 4A3YA 3BMWA 4X0VA 1UD6A 1D7FA 2FGLA 4Z2LA 1B3WA 1W1YA 4QCEA 3L2MA 3L4WA 1H5VA 1MXGA 4E2OA 2ZUVA 4WKHA 2W5FA 2UY2A 3WQ6A 3WF3A 3CZ8A 3ZJ8A 4DUXA 2AOSA 4AD4A 4AWEA 2YA1A 2JF6A 1BVZA 1B3XA 3WY1A 2ZUNA 2VMFA 1QBBA 1KXTA 4HU8A 1GORA 3WH6A 1R86A 2YDSA 3FY1A 1JF5A 2G41A 3OIHA 4PUEA 4WKFA 5KEZA 3F5JA 5C71A 2ZOXA 4W89A 5DFAA 2WSPA 2YJQA 1UH4A 1HP5A 3SCOA 4R27A 1JZ3A 1E6XM 1MQQA 1OINA 1CEOA 1TG7A 3RM9A 1BAGA 3B9AA 2J8GA 1E70M 1GOQA 2O9PA 2W61A 1SMAA 2VR4A 4YN5A 4TX6A 1M53A 3W29A 1UR1A 4ZENA 2VJXA 4W8BA 1US2A 1UKOA 4TOQA 3ARUA 4Z2GA 2QMJA 3VD4A 2J7BA 4HMCA 3WFZA 1PIGA 3W4RA 2CESA 2WHJA 4XV0A 5C70A 4CN4A 3AXIA 2CHNA 3HJEA 3LMYA 4D6GA 3WMCA 1TZ7A 2C7FA 2Y4SA 1GHSA 2VRJA 1RP9A 2WHMA 1EA9C 4UOJA 1UA7A 4GI8A 1KR0A 1CECA 1V6YA 2WLYA 1CPUA 1EOKA 3UG4A 2PBOA 1NM9A 2E8YA 1OIMA 4UOZA 1C92A 3WBAA 3W27A 4U33A 2FHFA 5DT5A 3CHDA 2IUZA 3ARQA 1H3GA 3VIFA 1E4IA 2QHAA 3VOCA 2V5DA 4ACYA 4JCLA 3L2LA 3VNZA 3K8LA 2F61A 2XIIA 1DWHM 4PBGA 2BFGA 1SR0A 3G6MA 3WENA 2YOCA 1DP0A 2BXYA 1QNOA 2D23A 3MMWA 3WDIA 2VQUA 4UR9A 4JAWA 2VURA 3OGSA 2J7GA 5DF0A 4D6JA 1H49A 1VBRA 3AXHA 4CVUA 1HJUA 4D1IA 2X8RA 1LG2A 3AOFA 2DT3A 4TUFA 1GQJA 1TCMA 3SCVA 1TVNA 2PC8A 5CPSA 3FNDA 4JIEA 4QCFA 5GNXA 1G1YA 1JNDA 1J12A 1QW8A 4CKQA 1MXDA 4UCFA 4XZWA 3ZJKA 5IHRA 1GNXA 4PMYA 1PIFA 1UQZA 3AS2A 3MV01 4S3JA 5E9AA 2V3GA 4ZEPA 3AS1A 5CLWA 2X2YA 3CUHA 2Y24A 4C7FA 3ZM8A 4RE4A 5LYRA 3UERA 1RD6A 2D20A 4AMCA 3WKZA 2JEPA 5ABFA 3AHYA 3FXYA 1M7XA 3QGVA 1GOOA 5I77A 1LQ0A 9CGTA 4GI9A 5HOSA 2OWWA 4MB3A 2WCAA 4OBSA 3M07A 4JFSA 2XGBA 4AZ5A 3UETA 2HVMA 1A3HA 4FF5A 4BS0A 4IM4A 4JL2A 2E9LA 3WUFA 4DM2A 3KZSA 4AZHA 3NDZA 4MAVA 4HOWA 2D24A 3NYDA 2VVSA 4AD0A 4GO9A 1B1YA 3NCOA 5EBAA 1E4LA 4PMXA 1QI0A 1ZB5A 4WF7A 3VDBA 1BYAA 3RO8A 5A6JA 2JIEA 2ZUTA 1XRVA 4DUVA 3NIYA 1FA2A 4RL3A 5HDRA 2A3AA 3WD1A 2VX7A 4AISA 4E4PA 6A3HA 3WSUA 1WNOA 1WO2A 3W25A 1KXVA 3ARPA 1KB3A 2HISA 5FL1A 3RJXA 4UFHA 1RH9A 1B3ZA 1MFUA 2G3JA 2XM1A 4WKAA 4M56A 3AHTA 3WDPP 3WEOA 3GH5A 2V3FA 1XCWA 1QOXA 4U3CA 4WJXA 4BQ3A 3RIKA 3J7HA 3WEMA 1ITCA 1BYBA 5HBFA 1GHRA 3K46A 2Y2WA 3K4DA 5CXPA 4B3KA 2EO7A 1GOKA 1WE5A 3CIVA 3VX1A 3PZTA 4JKMA 2CBUA 3GNPA 1W3LA 2WSKA 1QPKA 4D1JA 4H7VA 2WYSA 3QHNA 5ECUA 4DM1A 5BXRA 1C7SA 2UY3A 4X0NA 4NRSA 3GXIA 3FN9A 4W7UA 4MNMA 3ZIZA 2J7CA 2YA2A 2Y5EA 3VIJA 5M5DA 1J0ZA 4HOZA 5AC4A 1PEZA 8CGTA 2GJRA 3VGGA 4ZE5A 3POHA 1CXEA 1HKJA 2F2HA 2J7FA 1OD8A 1MVYA 3POCA 1UH2A 5BROA 3O9NA 1EGZA 2CERA 2XFFA 3GBEA 3O2LA 3NJ3A 4RE2A 5CSYA 1V3KA 1KWKA 3WBEA 5JUVA 4D6IA 1QI2A 1JFHA 4FLRA 4CCEA 4L4OA 1W2PA 4PMQA 4U5KA 3WH9A 1VBUA 4CCDA 3VIHA 3DHPA 4UZSA 4PTWA 3W6MA 1J0JA 5F7UA 4Z2KA 1Y7VA 3EDKA 4P8XA 2YL8A 1HL8A 4URIA 2CIPA 3UG3A 3QOMA 3DECA 3CZLA 1CXKA 2WC4A 2UY4A 4H8VA 1D3CA 1V6VA 1JYXA 4W7WA 5GQBA 1GJUA 2DH3A 4MNKA 4A3HA 1J10A 2VI0A 4V27A 3AZSA 3OLIA 1U30A 1EH9A 2VCCA 1UQYA 1VIWA 2WBGA 3AMLA 4H8UA 4P7LA 3NDYA 5DO8A 3CZJA 4MNJA 3BAKA 1R7OA 2DQXA 1XSIA 1WZKA 4WK9A 4UNIA 1UR2A 5BXPA 1NOWA 3ARSA 4B15A 1XGZA 5D9OA 1H2JA 2VX4A 2QPSA 2WZEA 4FMVA 1V02A 2E40A 2WVTA 1JXKA 4M24A 3VTRA 1V6WA 1EO5A 1C8XA 2EBNA 3CMGA 2YLAA 3EDEA 2BY1A 1WPCA 3WF1A 5BWFA 4S3KA 4F66A 2OSYA 3WUEA 5AC5A 3T08A 5AY7A 2UWFA 3N17A 3FAWA 4M81A 3VIPA 2D22A 3KL5A 1CGUA 1C91A 4J3WA 5A3HA 1GCYA 5IDIA 1DWIM 1QW9A 4GKLA 4HA1A 5CSUA 3M7SA 4U3AA 4J3UA 2E4TA 2VC9A 3W6LA 1TA3B 1UKQA 4AEFA 5EB8A 1E55A 4AZCA 1HNYA 1ISVA 5A8MA 4F9DA 3VNYA 2AMGA 4QDMA 1HIZA 4W93A 3ZQ9A 1UHVA 1XH0A 1E0XA 4UFMA 1CGTA 1E6QM 3QHMA 5A69A 3WFLA 2XTKA 4GIAA 1LWJA 3CUJA 1JZ8A 1VEPA 1GQKA 3KE0A 1WDPA 4D6EA 7CGTA 3VD5A 5BXSA 3CUFA 5JBDA 4GXPA 1W1TA 5IXEA 1GONA 3T0AA 1Q6GA 4J28A 2DSKA 4HA3A 2EJ1A 2ZIDA 3WNMA 1K9FA 1JZ5A 1IZJA 2CBIA 3MV11 2QPUA 3BLKA 3EMCA 2VUYA 4PRWA 1FFQA 1JDDA 2CXGA 4UTFA 2YDRA 4E8CA 5M03A 2CNCA 1ZL1A 4MJ2A 4UQ9A 3K1DA 3CMJA 3IK2A 5IFTA 5LA2A 4AZIA 2VCAA 1NWRA 2VRKA 3PZMA 1CGVA 4JL1A 3VKKA 3TTQA 4QP0A 5CLTA 5I24A 4AZ6A 2O9RA 4HA4A 5FKYA 5GNYA 2Y8VA 2GK1A 1JDCA 3APGA 3MUAA 3U7VA 3B9EA 2DDXA 1DTUA 4R5EA 1HP4A 2J79A 3PZIA 3VX0A 2CITA 5KZ6A 1B0IA 3NSMA 3GXDA 3VD3A 2D1ZA 1BG9A 4LXFA 1W1PA 4PMNA 1JDAA 1OSEA 2PWEA 1H0IA 1OGBA 3A6OA 1G5AA 4LYPA 4H04A 2VL4A 1JZ6A 1I1WA 1JD9A 2ZXAA 5C8BB 1HKIA 5A6KA 1E4NA 1R87A 4GINA 3PN8A 1YQ2A 4Z2JA 3ZOAA 4B3LA 1E0VA 1G01A 3GNRA 3L4TA 4H8HA 5D9NA 3EMQA 2ZXDA 1KWGA 3ZR5A 1E5NA 2GDVA 3MUIA 4AY1A 2J8FA 5JIWA 3L4VA 4OOZA 1DEDA 1J18A 4MJ4A 1V03A 3GH4A 5FCZA 5BRPA 2YL9A 1V0KA 2O92A 1KXQA 4EE9A 3BSHA 4F79A 3PHAA 4MPKA 1UWIA 1BTCA 1XH1A 4ACZB 2XGIA 2W62A 1QHPA 1TA3A 2VNCA 4PSRA 1XYZA 4BZYA 1LG1A 2IXUA 1M01A 4Q7NA 5D9MA 5BRQA 1XH2A 2DH2A 3CLWA 3ZO9A 4BCEA 1JNEA 1EDTA 3AIRA 1FH8A 3TP4A 4LPCA 4P8UA 4JFVA 3BXWA 4HMDA 4PTMA 4DWSD 4OIFA 4PMZA 3AHVA 1V3LA 1K9DA 4JCMA 4J7RA 1PBGA 2ZX5A 3IJ9A 4CD6A 1LJYA 2VZTA 3AIWA 3MU7A 3AQUA 3PZ9A 1DWGM 1VFUA 3VILA 4GQRA 2VT0A 5A2BA 1UKSA 3N11A 1JFXA 3VIMA 3AMKA 3MUY1 1H4PA 1Q6EA 1WCGA 1ZU8A 1GPFA 3VM5A 5BYWA 3MS8A 4BQ4A 4JHOA 4D6FA 2ZICA 1ZBVA 3SUUA 3AICA 2VO5A 1RP8A 1EHAA 2E3ZA 1XSJA 1KGXA 3AYSA 5FIPA 2FGZA 4HPGA 4CN1A 4Z2IA 3IANA 2OWXA 2J7HA 3W81A 1QHZA 2G8ZA 4GO8A 4IPLA 1KFWA 4E8DA 5BCAA 1BQCA 1BYDA 3WNOA 3W28A 1JAEA 2J78A 2DT1A 3AXXA 3AFBA 2E0PA 4F8XA 4AZBA 3CGTA 3N12A 1JI1A 4F9JA 3WD3A 1HXJA 1LF1A 3WIJA 3WN6A 5I3DA 1DWFM 8A3HA 2CHOA 4FK9A 4MDPA 3WQ8A 4HMEA 3A47A 1HVXA 1B30A 1AQHA 1ZBWA 2WXDM 1H0GA 1UWUA 1BLIA 3K4AA 2WB5A 4UFIA 5CPQA 5E0FA 1CYGA 3HU7A 3BC9A 1UA3A 2OYKA 2VZUA 2DPEA 2PBGA 4CGTA 1V3JA 3S6TA 3OA5A 1MW0A 1VENA 4JFTA 2XYLA 1CDGA 2CEQA 3LPFA 1H11A 1HL9A 3WF0A 4FLOA 1R7AA 4NSBA 1KCLA 3RPMA 3BMVA 3KL3A 4KMQA 3GH7A 2BHUA 2GUYA 1JYVA 1QI3A 5I79A 1H09A 3UCQA 4D72A 1UKTA 2J7DA 3ZR6A 1I75A 3SIMA 1PX4A 3LPPA 1G9HA 3I3DA 5D8WA 4ACZA 2JF7A 3EDFA 1UZ4A 1VB9A 2WVSA 3LPGA 2V3EA 2WMGA 3SCSA 1J9YA 5A8QA 4TTUA 4Q22A 2WMJA 2GJPA 1E56A 1B90A 2XIBA 4PMDA 3L4XA 1HKKA 2CKSA 1E3ZA 3DYOA 3MSDA 3RMEA 1CTNA 4V2XA 4DWSC 1U33A 3EBVA 1AVAA 5I0DA 5A95A 2X09A 5A2CA 2WCGA 4AD5A 1FOBA 1G0CA 3AIQA 1MQPA 2Y8KA 4IISA 3W53A 5D4YA 1VEOA 2ZX7A 3IJ8A 2XVLA 2IXVA 2FH8A 7TAAA 2BHYA 3PTKA 1L8NA 2WBKA 3BAJA 1MWOA 1HJWA 4CVWA 2VCBA 3QHOA 3WUGA 2ESCA 4RE3A 2XWEA 4QLLA 1N82A 4JKLA 1E9LA 3A4AA 4UQDA 5A2AA 4YPJA 1XYFA 1WKYA 5E0CA 3GXMA 1LL7A 2EPOA 1Q6DA 2FHCA 1KQYA 1UOKA 1W32A 2VR5A 1JGIA 2DSUA 2AAAA 5DMYA 1QI4A 2CPUA 2YDQA 1W9BM 3SCQA 2JIWA 3WF4A 6TAAA 2D3NA 1R8LA 3D3AA 3CHFA 4YHGA 1KCKA 2WMHA 4MNLA 2ZX8A 1CIUA 1LL6A 4AD3A 1TUXA 4H41A 4PEEA 1LL4A 1BPLB 1GJWA 2W92A 4M29A 3G6LA 3CTTA 2D0HA 3A4XA 3N9KA 3VD7A 1JI2A 4NI3A 2WWCA 3PTQA 4IUGA 3VU2A 1Q6CA 3ZJ6A 4AEEA 2EXOA 2D0FA 1CXFA 1B31A 1XSKA 2XUCA 3CHEA 4KH2A 2VOTA 1E6ZA 3T0DA 3FHAA 4CN6A 1X1NA 4TXEA 3UEQA 1E72M 1CXIA 3ZT7A 1W9UA 3SEPA 1G94A 2VX5A 3FAXA 1W2VA 3L4YA 1TE1A 1VJZA 2J74A 4P7RA 5BXTA 4FLSA 2BVYA 3AIVA 3EDJA 5FL0A 3T09A 1GVYA 1FP9A 2G3NA 4W84A 2Z1KA 4P8WA 1VFMA 5ABHA 3WEZA 1OGGA 3PZGA 3CZGA 3VVGA 4PN2A 2WMKA 4AXNA 3DYPA 3SUTA 4ML4A 5E6YA 2D3LA 2E8ZA 3VGHA 3L4UA 2C0HA 3KEHA 1US3A 4PUDA 3T2OA 3RDKA 3AMGA 1KXHA 1E1EA 1QNSA 3M6DA 1XV8A 1JF6A 1F4HA 2FDMA 2VX6A 4JKKA 3WELA 2ZWZA 4PMRA 1OCQA 3WDHA 4W7VA 3RM4A 4W86A 1D2KA 1RPKA 2XJ7A 3WQVA 3PZVA 1VF8A 3DHUA 4GI6A 4KGLA 4UQEA 1EO7A 4OZOA 3VMNA 1M03A 3OGRA 1UR4A 3RJYA 6CGTA 1TVPA 4KRUA 4N42A 1E4MM 3SCPA 3PZNA 1C3FA 3U7BA 2E9MA 3ARWA 1YHTA 3UG5A 1GOWA 3F4VA 3WH7A 4AD1A 3TONA 1V0LA 1WDRA 3GNOA 4PTVA 5CJ5A 4PMUA 1MYRA 4PMVA 2EQDA 4D6CA 3W24A 3BCDA 1KGUA 1M04A 2W67A 1BYCA 1XCXA 1NP0A 1UD4A 3VD9A 1E5JA 2A3CA 5I23A 1UWTA 2ZWYA 2RGMA 4XX6A 5D9PA 4EK7A 1CGXA 1VAHA 3SUVA 1ZJBA
chains in the Genus database with same CATH superfamily
3MDWA 2C14A 3CZEA 1E0TA 3GVRA 5LA1A 4U5IA 2CZVA 3E0WA 1W91A 2J25A 4O1EA 3E0FA 4X3ZA 5BZAA 3WMSA 3TYEA 4I6VA 2XM2A 3QBUA 4O11A 2VFGA 1RVKA 3QM3A 3B8TA 2A3HA 1BKHA 3CTLA 2DVXA 3B8IA 1MEHA 2FB2A 3LCFA 1H7WA 4O4WA 2I57A 1PTAA 3KBVA 1UWRA 4X22A 1K70A 1IE7C 2XSAA 3BQ5A 2WMFA 1VYRA 3RU8X 1EJWC 2ZKMX 4J4KA 4F2TA 2PP1A 4BK9A 3VGBA 5M17A 3LCHA 3V1HA 2Z2BA 4KRZA 1EDQA 3ES8A 1XXXA 2ZTJA 3L67A 4PMOA 3NUKA 3BSGA 3M46A 1C93A 1CZ1A 4OBRA 2V38A 3TN3A 2CETA 2UV8G 1WZAA 3GAYA 1MUMA 4NHVA 3CUIA 4DXXA 2WANA 3VMOA 3GYCA 1T0OA 3C3NA 1JZ4A 4NAEA 3EKGA 4GQQA 3E2RA 4HU3A 2QJGA 4TMBA 3AHZA 1WBJA 2J4GA 1QNRA 4M51A 4XD3A 4YXGA 1JL8A 5ABFB 3G5EA 3AI0A 1P6BA 2CLKA 3BLPX 1ITXA 2QUVA 3U4AA 4DNMA 4NAFA 3IVSA 1X6LA 3A3HA 4WLCA 7PTDA 1T8XA 3KRBA 5DX7A 1RY8A 3DFQA 3OP2A 1DJHA 1FWCC 3KBNA 4BQ2A 3EA1A 1W5NA 5HNTA 2V3DA 5I6SA 3ZR4A 2X2GA 4Q8MA 4ZSTA 3W72A 1ZS2A 1W0MA 4WSKA 2V2DA 5CC6A 1AMYA 1T40A 1GK8A 2J9ZA 1BFNA 3L5AA 4H6QA 3H54A 3PPGA 2WCSA 2HXTA 4IF2A 4PZVA 2GGGA 2YYTA 3RAOA 5XINA 5LZLA 3EXSA 1EP1A 3ARVA 3NQ8A 1Q7ZA 1WDDA 4W8LA 4LVFA 3WLTA 3QTPA 3N6JA 1BSIA 3BCFA 1EIBA 1HTIA 7TIMA 4XKMA 4IMDA 1Q8AA 1C7TA 3W07A 4UXDA 2W9MA 4M82A 2VDHA 5A8NA 3IJIA 3ITLA 1E15A 1GQLA 2P0OA 2OKOA 2BOFX 1EBGA 1RZMA 4FAMA 5GJNA 3QV8A 4HZ6A 2E6AA 3RFAA 1F3EA 3REQB 1UKPA 3QMRA 3UXKA 1W6TA 4Y9NA 4DB7A 4KRTA 4AB4A 3AO0A 1E6PA 3V1PA 4Q8NA 2Y0FA 5HNRA 2ALRA 3CU2A 2FZDA 3OO2A 2CLMA 4R33A 1GKRA 1IT8A 3CYJA 4A2SA 1KBLA 4CD5A 1PCWA 4E8GA 4YYCA 1D8CA 6REQB 2XDFA 2MANA 3U2OA 1WDQA 1D3HA 5J5DA 1OZMA 1R9XA 1EOMA 1J0HA 1DPMA 1XIBA 3TWBA 2HROA 3QEZA 1SR9A 3MVIA 1WDSA 3LYEA 4HQVA 1P1XA 3GNXA 1XIEA 5EU9A 1R85A 1I2QA 2XH7A 3AZTA 1E1FA 3KP0A 4JHZA 7XIMA 1EKOA 4W8AA 4FO4A 4HZMA 5IHSA 3N9SA 3NTYA 4PGLA 4CCCA 3T40A 2PI6A 3HV9A 4WVXA 1KR1A 1SMDA 5LXEA 3NO1A 5FJUA 3VNJA 4N7QA 2WKLA 1ICPA 2F84A 3VKAA 3U5UA 4C7DA 4JYFA 1UYQA 3L0GA 4YHEA 1J96A 1YTKA 5GPRA 3SUWA 2ZBTA 1WOBA 5MHBA 1S5VA 1DHKA 1Q7MA 1JZ2A 1IIHA 2ZXBA 3SRKA 4H1ZA 4CU8A 3QPYA 2OZ0A 4X2PA 3N9RA 3F4DA 5HNNA 2B7OA 3PULA 2IPFA 3STCA 4AUBA 1KLYA 1UUQA 3W1AA 3EB4A 2E67A 1LRNA 4KEVA 1Y8BA 1JCJA 2VZSA 4RX0A 4HVXA 5ENLA 3OZPA 2CBVA 4LUSA 1V7AA 3S2CA 5CZKA 3AC0A 3MKCA 1BVNP 1RHCA 3FJ6A 2RGLA 1IR1A 2GFTA 3GM8A 4Y7EA 4GI4A 5HMDA 1PAMA 5HQEA 1XIDA 2POTA 4M6PA 2PDPA 5H2ZA 1D9EA 3A4WA 3UJRA 4DELA 1ISWA 2P8BA 1H1YA 3OOQA 1XLLA 1BXCA 3VUPA 3G1RA 2RFGA 1VPYA 1RXOB 3R0DA 3W0KA 5G1YA 4PCPA 3C2RA 1QPNA 2CWXA 3KOWA 1U2YA 1W3JA 3C61A 4LYRA 4YVPA 3T4WA 1A5MC 3B0UX 2P10A 5I78A 3WLRA 1X39A 2OYLA 3W83A 5A94A 7REQB 5CPTA 1OZQA 2C91A 1CBGA 2Y85A 2XVKA 4D71A 3RNDA 4W87A 1O1ZA 1TWSA 1BSLA 2WHKA 2F2KA 3OYZA 2WJDA 3LXBA 1UD5A 1IEIA 4NZFA 2W3ZA 2PWHA 4IGNA 2BG5A 2OZ8A 4JX6A 4GPNA 4C5ZA 4GVIA 3LRMA 3UXIA 3MANA 3CAWA 3F4NA 4LRSA 2GGEA 3GE7A 4GZIA 4CU7A 3GZAA 1TFVA 5HK4A 2PWVA 4KPLA 4KCWA 4OKDA 2BS9A 3WNKA 4IIFA 2GSEA 3QN3A 4QISA 2CKRA 3QGAC 4Z42C 5AHLA 3NZ1A 1F4AA 4O13A 1FFRA 3P14A 3GG8A 2J62A 5DRCA 1CXLA 2RJHA 2WMIA 4UC5A 4MVAA 2R94A 1FWBC 1NOFA 3WD2A 4NQ1A 3LNPA 1Z44A 3NGFA 3TE9A 1TPEA 5HMSA 1FH7A 3N2BA 5ABGA 3GG1A 1O1HA 1R3SA 4ZTXA 1BRLA 4DF0A 1N8WA 1B4EA 4QDWA 1LZOA 2GJXA 1KD0A 1HJQA 3HOJA 5CC3A 2H90A 3A24A 1HFBA 3IRSA 2YBUA 1I4NA 4UQBA 4OUEA 1NWTA 1E6RA 1TSIA 1UD8A 4V1XA 1UD3A 3AS0A 1J0IA 4L6OA 2BY0A 2E9BA 4KGJA 1JRBA 1TPVA 1XBYA 2HDJA 3T0BA 3P2VA 2D73A 5HPCA 4PMJA 3PZQA 2VQTA 2VUNA 4JD4A 4MWAB 1QT1A 4XWUA 1GYMA 1K8XA 3T05A 4ZFCA 4S23A 3M16A 5FJIA 4FF7A 4O4VA 1XPGA 4NJGA 1NDZA 2FHBA 3IIOA 3WL1A 2WHLA 1D3GA 1ZGDA 2Z7KA 4C6PA 1W37A 3EOSA 3F7JA 4QLKA 1KGWA 1LM1A 2WPBA 3N04A 3PBVA 1HJVA 4B5TA 2WVVA 1XFCA 1XKJA 1QBAA 1BG4A 1TMQA 1FP8A 4O50A 2FFIA 5A6AA 2PRLA 4YCOA 3QW4B 1RD5A 1TR1A 4GCAA 2GUUA 4F0LA 4JN8A 2X0HA 1GT8A 5CJNA 1YMYA 1UG6A 3AZRA 1FWTA 3GFXA 3ZXWA 3DC0A 4TVCA 1H7OA 2PDUA 3BGAA 5FJOA 1NH6A 3IJ6A 1EBHA 3WQWA 1MUWA 3N4AA 3MHUA 3ZJ7A 2GSJA 4NIRA 4R53A 2XGZA 5CQ1A 1HKWA 3E1F1 3N1AA 1PPIA 3RG6A 2JKAA 4FLQA 3OVGA 3WMBA 3GDMA 1BF2A 1UWQA 3APYA 4RJEA 1G4TA 2WNQA 1TQJA 5E09A 4TX8A 1O7AA 2FFCA 4H19A 2VFEA 2V81A 3TIMA 5F4SA 2FYMA 1TJPA 2A3EA 2R82A 4NJIA 3P3BA 4PFMA 3F5LA 3G1VA 4ATWA 1SPQA 2A3BA 1ECEA 3IIPA 4CNUA 5E6ZA 5A6BD 3BMWA 4YS1A 5D04C 4X0VA 1UD6A 4IWWA 2FGLA 3HQ1A 1REQA 1TPDA 5FJTA 2PTDA 1ZAJA 2OOGA 4FNRA 5LIWX 2IQ0A 4QCEA 1ZCOA 3H24A 3KP1A 1H5VA 4Q8OA 2RDXA 3U4FA 1XIFA 2E1DA 1EC7A 3TW9A 2PA6A 4DUXA 3UGVA 3W74A 4AWEA 3MCOA 3R43A 3R58A 4RW5A 3DENA 1EL3A 2ZUNA 4L6HA 4HMNA 3LQLA 3VABA 3OQ8A 5EA9A 1XINA 3WH6A 1R86A 2FGBA 4DY1A 3WK1A 2G41A 1TPH1 3OIHA 4F0KA 3F5JA 3R0KA 4B5WA 2E28A 4W89A 5DFAA 4AF0B 1XM3A 4PC8A 3V7PA 1E6XM 1MQQA 4MZ1A 2DV0A 1QTWA 3QKEA 4FXFA 4RNJA 1E70M 1GOQA 1J5SA 3HA1A 1SMAA 1IQ8A 2VR4A 2Y7DA 4G9PA 1SGJA 4I7UA 4OQVA 2Y62A 1US2A 1P7TB 3M47A 3ARUA 4JYDA 5HATA 4Q6JA 3VD4A 1DJWA 1I6NA 1PIGA 4R3UA 2WHJA 1ADDA 4CN4A 4XAGA 3KOZA 4D6GA 3CWOX 1RVGA 4GRSA 1RP9A 1EA9C 4WY0B 1KR0A 1CECA 2YW3A 3M0MA 2WLYA 2C1HA 3UG4A 5AHFA 1F6KA 3SY1A 2OZ3A 1OIMA 4ZQRA 2E6DA 4C6CA 2E6YA 4H9XA 1QPQA 1KV5A 2ZC1A 3ARQA 5DELA 2QHAA 4NJJA 3VOCA 4ACYA 3UA3A 4UMAA 3BJTA 2H3DA 2XN2A 1BD0A 3PPHA 2XIIA 1DWHM 2BFGA 2BXYA 5ECVA 2D23A 4GYPC 2VQUA 4GZ7A 3L12A 3OU8A 3CLMA 2VURA 3OGSA 2J7GA 5DF0A 4ICMA 3W23A 2EKCA 1BF6A 2OQHA 2PP0A 3IGHX 3AOFA 2DT3A 1R9ZA 1TVNA 4QCFA 5GNXA 5K9XA 4KWVA 4CKQA 3TUUA 4OU1A 5DRIA 1MXDA 4UCFA 1YNPA 3BV4A 1GNXA 3G0SA 4DF2A 1FWRA 4S3DA 2GVJA 4CLMA 1RD6A 1PXGA 1N8FA 1U1UA 4GYJA 3H7RA 4AX7A 1O66A 5ABFA 1TPB1 3OJGA 3E38A 4JTHA 4OVXA 4GI9A 2ZRVA 5HOSA 4I3GA 3N3MA 4MB3A 2WCAA 3CB3A 4OBSA 4UTTC 3LOTA 3UETA 5BOOA 4E3TA 2P1FA 5I3IA 4IM4A 3WUFA 3KZSA 4JS3A 3VKJA 4MAVA 3Q67A 4WGHA 3KHDA 3G1HA 4AD0A 2BZNA 3BURA 1E4LA 2YXOA 1OYAA 1DBTA 4F2BA 3DFSA 2X30A 3NIYA 4FIRA 4N6EA 1WNOA 3DBPA 2PSNA 4YVVA 5FL1A 3GIYA 1MFUA 2XM1A 3NURA 3CT7A 1QOXA 3G0XA 4LEQA 4GX9A 1PKMA 2R6OA 2Y2WA 5CXPA 3IRDA 3OIXA 2EO7A 1R3WA 3W1XA 3PZTA 4JKMA 1X1ZA 3PUOA 3N3TA 1LYXA 2WYSA 8XIMA 4IP4A 3LSCA 4OWGA 2CLEA 4UB9A 4DM1A 1C7SA 4A8RA 2ZDRA 3QMSA 1BXBA 2VXNA 3T81A 1YDNA 2NX1A 4W7UA 2ACRA 3SGUA 4C6NA 4QE5A 3HPAA 2NQZA 3LQGA 4HA0A 1PEZA 2QCNA 4YCPA 4RCXA 3B4YA 9XIAA 4Z08A 3POCA 9RUBA 1UH2A 2QGHA 5BROA 2PP3A 1EGZA 3GBEA 4S3EA 3O2LA 2WJEA 3AWNA 3ANVA 2G37A 3BO9A 4EXBA 3WBEA 3G8EA 1QI2A 1JFHA 2QCHA 2ABBA 4PMQA 2QCFA 2F38A 4B90A 3NQAA 1J6OA 2J6VA 3VIHA 3DHPA 3NPUA 4IFKB 1N8IA 3R6IA 1TR9A 1J0JA 4OV4A 3EDKA 1TREA 1HL8A 4DYJA 2D2HA 2DP3A 3UG3A 3C0QA 1MDLA 2WC4A 4W9TA 3LGGA 1SSDA 1D3CA 5DCEA 4W7WA 4MNKA 4XTDA 3L2IA 1J10A 4V27A 3ME3A 1U30A 4K8GA 1SZNA 3VNKA 2PEVA 4ECLA 4NZ4A 3P60A 2YYUA 4JOMA 4OE7A 3NG3A 2ZYFA 5T26A 1OC5A 2GOKA 1H2JA 1ZP3A 1PS9A 5FESA 3A23A 2E40A 4H9MA 2HTMA 1C8XA 4KEZA 1EJUC 2EJAA 4IXHA 6PTDA 4NNAA 1WPCA 4J5NA 5CZTA 4EOUA 1TJ2A 5DY2A 3WF1A 3GC4A 4F66A 2GQAA 2EF9A 2QVNA 1VGAA 4OT7A 3LV5A 5ABTA 2UWFA 3PBWA 1XGDA 5FJRA 3LCLA 5IDIA 1M41A 4GKLA 3QGKC 5CSUA 2X7WA 4U3AA 1F2JA 4J3UA 4LH8A 3IJDA 1TA3B 1UKQA 3BUVA 1TZ9A 4ADUA 4XG1A 4XAZA 1C9DA 3SRDA 5A8MA 2HSAA 2AMGA 3GTHA 4JQAA 1HIZA 3A5FA 1XH0A 4IJCA 1E0XA 3BDKA 4UFMA 2Q01A 5H8PA 3WFLA 2XTKA 1AG1O 2OFJA 1DIEA 1EF3A 3SBFA 1VEPA 3KE0A 3BV7A 4QJ4B 3T42A 7CGTA 3CAVA 4GXPA 2F6XA 4I7WA 1X38A 3T0AA 2YZ5A 4J28A 2V5BA 1X7IA 3ITTA 1PSCA 4AWSA 1GTHA 5JVLA 2ZIDA 4G7EA 4KKXA 4ZOCA 1IZJA 3EEZA 3MV11 2QPUA 3BLKA 3URBA 2Z1VA 3UJFA 1EEXA 3EMCA 4PRWA 3SN4A 1JDDA 1XBVA 4DBWA 3S6DA 3UA4A 1ELSA 2I56A 1YX1A 2INEA 1JDFA 4JTFA 2HK0A 4LV4A 4MJ2A 4RZ5A 4UQ9A 3BQ6A 4DBEA 3IK2A 3V36A 2VCAA 2VRKA 4BEUA 4JL1A 4UTLA 5DLCA 3TTQA 1GZGA 4O52A 5FKYA 3VE7A 1NFBA 2O56A 1GG0A 3U7VA 2ACUA 3B9EA 2ZRYA 1DTUA 1HP4A 2J79A 3UY8A 3GHTA 2NQHA 2CITA 3W1TA 1B0IA 2D1ZA 2Y5SA 1P0NA 1XDMA 4LXFA 3RUBL 4XSLA 1LT8A 3EX6A 5FAJA 1XUZA 3IVUA 1U5VA 1UZDA 4LYPA 1JD9A 5C8BB 1S2WA 3WQFA 4HHMA 3M43A 2YCLA 3M44A 5E0KA 1E4NA 3KS5A 3NYZA 1E0VA 1EUAA 1TV5A 3L4TA 5REQB 3GVGA 1KCXA 1ZLPA 3EMQA 2NV1A 2Z27A 4IL2A 4JHMA 2GDVA 2AGTA 4AVNA 3C2EA 3KTCA 4AY1A 3WLMA 3M0HA 3QSTA 1IIGA 5LIYX 4DZAA 4J35A 4MJ4A 1YDOA 1V0KA 4XISA 5M1TA 2BOGX 5HJYA 3GUWA 3RCYA 3LCWA 1QOQA 1UWIA 1BTCA 2H8ZA 2FTYA 2G4JA 1JCYA 1QHPA 3NWRA 3CV7A 3RX2A 1XYZA 2PTYA 4AY8A 3OTRA 4H4IA 3ATZA 1IR2A 2INFA 3B3DA 1XL9A 2DH2A 3CLWA 2E5DA 3ZO9A 2YB1A 3HQOA 1EJVC 1XDJA 4C6FA 2IPJA 3T07A 4DWSD 4PMZA 2FJKA 1K9DA 3NQ7A 4PFHA 4GQGA 3MTWA 1RLCL 4ZQNA 1MZHA 3GG0A 3PZ9A 3LHYA 3IACA 1VFUA 3VILA 1R0MA 2VT0A 8TIMA 1EC8A 3MUY1 3FS2A 3OVRA 3PUGA 3MS8A 2DVUA 2ZICA 3BARA 1H7RA 1YTEA 2E3ZA 3P6LA 1SU5A 2KZHA 2GVLA 5AFDA 2A1YA 3CL6A 2EHHA 4GC3A 3ENLA 2QJMA 4ZR8A 5H91A 2OWXA 3W81A 1QHZA 4XD6A 3MKVA 4IPLA 4ZOAA 1BQCA 1BYDA 3LZ5A 2BBFA 2F7FA 3W28A 2QCEA 2J78A 2PC4A 4F8XA 3CGTA 4RZ6A 3T0CA 3PNZA 3PVFA 4CQ8A 3O1NA 2HMCA 1BQGA 4DAIA 2GVEA 3WD3A 5HMFA 2QUNA 1LF1A 3WIJA 3E6EA 4IIHA 2R1KA 3WN6A 2QUTA 5LNUA 4Y8EA 2X1RA 2CZEA 4FK9A 4MDPA 3WQ8A 3A47A 1LUCA 1HVXA 2Q8LA 2DU2A 1I2NA 1S5WA 3ABRA 2WXDM 3EA3A 1AJZA 4E38A 2WB5A 4YNGA 4LVGA 2NXGA 1RK6A 1RJRA 1UA3A 3TMLA 2OYKA 4B3ZA 5D02A 4HNCA 3TYUA 4JFTA 4RDVA 4H9UA 3EPMA 2CEQA 4NSBA 5AECA 4JTKA 3KL3A 3F2BA 4YWIA 1KTBA 5IBXA 3ID7A 2BGSA 1DIKA 4GG9A 4JTGA 2QULA 3GDRA 1PX4A 3LPPA 4Q4QA 5CAKA 3P80A 4JIHA 1UZ4A 3LPGA 3UVAA 5AYXA 4IQLA 4D2JA 2RDWA 2XN1A 5A8QA 4MM1A 1P0BA 3RLHA 3QY7A 2GJPA 1B90A 1OCJA 4PMDA 1UJQA 3M0VA 4OFCA 1U33A 5MF5A 3S83A 3DFOA 1R3YA 2EG8A 3NPWA 3VZXA 3NZPA 3PB2A 1WXZA 3S2LA 1Q2RA 4C6IA 2ZX7A 3KVMA 2XVLA 2IXVA 1J4EA 5M2FX 2FH8A 1CB7B 3LCGA 2Z28A 4GVFA 2WBKA 1UUMA 4WJEA 4HNUA 4DNHA 4RE3A 4QLLA 1Z3NA 3FV9A 3S8HA 3LM3A 5CZJA 1E9LA 1F3TA 4AWTA 4YPJA 3GHRA 3P61A 5AKQA 2NWRA 2DZPA 2CPUA 3CHVA 1IHIA 2JIWA 4DEFA 6TAAA 2PDXA 3D3AA 3VNMA 1KCKA 4Q7BA 3ZWSA 4E2BA 3UQNA 4US5D 1LL4A 4LW7A 4M29A 2D0HA 1XRFA 4MLRA 3QLLA 2NLYA 3B9NA 1KFCA 2J24A 3UCDA 2DZTA 1E6ZA 1GVOA 3FHAA 3VKBA 3LGEA 4GBUA 4WDTA 4NZ5A 3GXTA 3ZT7A 1W9UA 4X63A 1G94A 3L4YA 2J74A 4P7RA 4OTKA 4RV3A 2BVYA 4YJ5A 1JVNA 3T09A 1WBHA 1FP9A 4ENLA 1YTDA 4QXIA 4W84A 2QF7A 3HV8A 1KV8A 4IGSA 1R2SA 1GEHA 4N2YA 1P43A 3W7QA 4C65A 1OGGA 4IX2A 4I9JA 3SFWA 1EC9A 3PSWA 5A8GA 1JCXA 2QCDB 4AXNA 5LNVA 2DZVA 4GXWA 3WBXA 3GDKA 4O54A 3U2EA 2D3LA 2E8ZA 3S5YA 2XH2A 1W1A1 1AMKA 4GABA 4PUDA 3C2VA 3RDKA 4LF2A 3AMGA 5GJMA 1QNSA 3QFEA 4V15A 1JF6A 4JKKA 2P76A 1OFAA 3WDHA 4AG0A 1ZZMA 2D69A 3WK2A 4W7VA 4S39A 4W86A 3MI3A 2ATSA 3CV1A 1G69A 4B91A 4GI6A 4IPJA 4JY8A 4NP7A 1C8VA 1QWGA 4OZOA 3VMNA 1UBPC 1UR4A 3RJYA 3JU2A 2ISVA 4N42A 4TR9A 4DO4A 4HNVA 1MDRA 4DO6A 2NUYA 2HK1A 4XVDA 3SCPA 4GXMA 1FWNA 1R6WA 4ERGA 3KRSA 3ATYA 3KX6A 3F4VA 4PR4A 4J40A 3S9YA 2PDWA 1JPKA 4PMUA 4PMVA 4D6CA 2DORA 4QIUA 1UWAA 2RAGA 5JXQA 1LORA 1UD4A 1OK4A 3SQSA 3MSYA 2VDIA 1U22A 5D9PA 2ATMA 2RGMA 4KCUA 4Y6GA 4KIRA 4HK6A 4HN4A 4I5UA 5D03A 1PZ1A 5F2MA 4XUGA 2EPKX 2J13A 3OBKA 1XGEA 2VEKA 2YLLA 2OZTA 1W9DM 1SJCA 2VTFA 3EYPA 1GQNA 1BGGA 3GXFA 4JN6A 5ABEA 2V5CA 3HGRA 2DT0A 4AHPA 1QHOA 5KZEA 4QAIA 1JPHA 3AS3A 3PJTA 3W7OA 1V3IA 3PUDA 5HINA 1FWGC 4S2BA 1JAKA 1VFFA 1VH7A 2TYSA 3AIUA 2INZA 4PCFA 4MY1A 3PBGA 3RU6A 2BB0A 4PCTA 3LTYA 1OG0A 2BY3A 3ZLHA 1YE4A 4C1KA 1UD2A 1VHCA 3ARZA 1MXSA 2J7EA 2QR6A 1VHNA 4MDOA 4IIBA 3NQDA 4DBDA 1A3XA 2QIIA 3ELFA 4ZO9A 1V7YA 2WNWA 4G7FA 5HUPA 4JEQA 3KOXA 4W5ZA 4CNSA 3N18A 1FHVA 1TWIA 1HX0A 3GTXA 3NVTA 1K9EA 2PDMA 5FOOA 1CI1A 3GXNA 4LU0A 4AIUA 4KCVA 3EZ4A 4HJFA 1VJSA 4UBPC 4UZUA 2VVNA 1A4MA 1LQAA 3LSBA 3BPWA 2E5BA 1W9PA 3TX9A 3U9IA 3CASA 3BOFA 2X42A 1V3HA 4CEXC 4E2VA 1I2OA 4QG9A 4HP5A 4QG6A 3Q45A 1NWSA 2OVLA 1UR8A 4K6AA 1THFD 2V82A 3MUXA 2JALA 2PWGA 3CEUA 4TVUA 4N4PA 3QH2A 4HZ7A 4AC7C 4AD2A 3YPIA 4L6DA 4XO7A 3PWIA 4WIWA 4LUIA 5DT7A 3P7YA 3WD0A 2QDGA 2EPMX 3IWPA 3LCXA 4JTDA 2PTZA 2PDHA 1MQRA 3EDDA 4D6HA 3HMCA 1Q4WA 4LCQA 3JZEA 3WL0A 4IFOA 1S46A 3A4JA 1KRBC 1LWHA 1NQKA 4M80A 3N2MA 2X1IA 1J93A 2WAGA 3ARXA 2JEQA 4Q8QA 2J47A 2QF8A 4X61A 2QJNA 1QPRA 2DZUA 4GMEA 4GNKB 2YIHA 2G97A 1L0PA 1FWFC 1E0UA 1A80A 1J0KA 2JE8A 4G6CA 4UFJA 4AEOA 1W9XA 1YKWA 5A8OA 3SCWA 2QCGA 4DWDA 1EHNA 4LSBA 4PL2A 2WC3A 2WM1A 3FVDA 1E9YB 4MB4A 2E09A 3BH4A 4C6KA 3W87A 1KM4A 3AYRA 5EFFA 1WAWA 4QFUA 2AQVA 1OBAA 3VNLA 4MUPA 1FHDA 1X6NA 2TODA 1YBQB 4P7NA 2YA0A 1QVBA 3BLDA 1VP5A 4DWSA 2WZHA 4LBSA 1OEPA 4HJWA 4N9BA 5D2WA 2QS8A 3GFZA 3S2JA 3IAPA 4C5YA 5U7SA 3H70A 4WSHA 1BXNA 3UU0A 1FCQA 4YMZA 5EY5A 2CLPA 3F5KA 2H6RA 3AJXA 3FJNA 3C6CA 1F5ZA 3JVAA 2GL5A 5XIAA 4Y9AA 1F8IA 2NQJA 5JBFA 5EFDA 1X8FA 1YDVA 1H41A 2ZX6A 3I10A 3MKKA 1LLWA 3JUGA 3LTSA 2G3MA 2PWFA 5C6MA 4NNCA 2NQLA 3UCCA 3TYCA 1CGYA 4WDUA 3MWAA 4HZ8A 1V5XA 3OG2A 3WLOA 3OGVA 3CAKA 2PDKA 3UJEA 5M3WA 1GW9A 4GZEA 3LLDA 1EX5A 3LA4A 4B4HA 2J75A 2P88A 2V5KA 1ADOA 1M5WA 2CZDA 1PB0A 2BTMA 4E4UA 4UCGA 4AWUA 1HVQA 1L9WA 1SUXA 5I3FA 3V35A 2QJHA 1W3HA 1XG3A 3TOPA 3KLLA 3HPFA 1YNYA 4QE1A 5TD4A 2Q8ZA 2B7PA 2O4QA 4KWUA 1FWSA 1O5XA 4C6LA 1AA1B 4IGHA 3CYVA 2OSXA 5I06A 1H7NA 1LQ2A 2FZMA 2P50A 3NPVA 4H8NA 3QR3A 5D30A 3VIOA 1AK5A 4N0RA 4TTGA 1B57A 4REQB 1RBLA 3VIGA 4AZGA 1I2RA 3WQCA 5H1WA 3NPXA 5TNVA 2FH6A 4FOJA 3TTSA 3WDQA 5KTLA 3VCCA 3LX9A 1CLKA 2NQ5A 3HO8A 1XC6A 2VZOA 3TFXA 1IWAA 4MAZA 3S6OA 1JQVA 4Q4MA 1HGYA 1RCOB 1UIPA 3LG3A 2JKPA 1SZRA 5F2GA 1SM9A 4DYEA 5JU6A 4HOXA 1O68A 5H8UA 5HULA 1DJZA 3MBDA 3WLIA 1SZEA 2O9TA 3IJQA 3MSGA 4C6DA 4C6MA 1MRAA 1WZLA 1HJXA 2J66A 4D6DA 2BVTA 3FYPA 3PBYA 4AZCB 2XH0A 4A4AA 3BAYA 3CPUA 2Q3RA 4XTIA 3DXIA 1MEIA 3MJYA 1V0NA 3G1XA 4DUWA 1W17A 3LU2A 4IGMA 1JZ7A 3DYMA 2FLIA 4E3VA 3AROA 1MNSA 1A5SA 1JDEA 1H60A 3SSZA 3AU6A 2OWCA 3GNNA 2B31A 4O16A 1EJ7L 4GWEA 3PG9A 3LHTA 3GU2A 4GC4A 4PB3A 3MMDA 3RR4A 4GE8A 4B5NA 3DFPA 3DERA 1OWQA 2DIKA 2EPNA 2ZUSA 1XF0A 3GVWA 4XZBA 1V3MA 4Q4RA 4JQ1A 2MUCA 1EXPA 3GIPA 3N13A 4J3SA 4J3TA 4XIMA 1GVRA 2WV8A 3DFYA 1CLVA 3OLEA 4BEQA 1PJ9A 1WZMA 2OLAA 4FXJA 2R1MA 7A3HA 3OB8A 1JCLA 2BXZA 3WNNA 2DW6A 5D8ZA 3LHVA 4DN1A 1DE5A 1BWKA 1EQPA 1F61A 2CBJA 3EOLA 3GU1A 2XZ7A 1OD0A 4D8LA 4DYKA 5BMXA 3W2LA 3PP7A 2IW0A 4K3ZA 4C60A 4HK5A 1RCQA 2YCJA 5CBBA 4JFUA 3W26A 1ISXA 4QITA 2QZRA 2XVGA 3LRLA 2QIWA 3H23A 5LNSA 1V6TA 4GD0A 3HJZA 4GIRA 1PYMA 5E1QA 2QDDA 3W01A 1R2RA 5G2WA 1R30A 2VM8A 2J77A 2VGIA 3LXCA 1AQMA 3B03A 2Y63A 4JDYA 3TQPA 3IJ7A 1IEQA 3T2PA 1E9IA 3DZ1A 3W37A 2HCVA 2OQYA 1GGOA 3GW3A 3HPZA 4MG4A 2IKIA 3LHUA 1FWAC 1IT7A 1ITUA 4HGXA 1H1NA 2Z24A 1UMLA 1J11A 5C9XA 1MEWA 3QZEA 2A3LA 2TPSA 3MYPA 1KBBA 3UW6A 5CG0A 5CSRA 1H7PA 3TAKA 3RCMA 3VMPA 4FXSA 2QCCA 3BAXA 4NRRA 5JH2A 1RLDA 4BA0A 4EKJA 1OFBA 1LRTA 4MB1A 1K7XA 1PZ2A 3AJ7A 3VFCA 4B5SA 1XISA 4Y9MA 4MJMA 2CHRA 4JPGA 2W4XA 4AW7A 3UJSA 1UMYA 1Q13A 4PCNA 4GVHA 3PZUA 3ALFA 2BOEX 3PWGA 3U48A 2EAWA 3EAUA 7ENLA 3TQVA 1C90A 3MDUA 2HE8A 4GX8A 1MW3A 2QV4A 2QNEA 2VC7A 1UW9A 5MKGA 3R0UA 4XD5A 2ZZ4A 4A2RA 5KSWA 1DE6A 1H7XA 3TN4A 2GDQA 1VLWA 2CW6A 1OGSA 1JCMP 3T7VA 3H26A 4LQ1A 4GVGA 3U57A 5AYBA 4TMCA 2O9OA 4HPHA 3BGGA 4M0XA 1IEXA 4BI6A 1XLFA 1DTNA 5D32A 1FH9A 3IUIA 2I5QA 3LEPA 4PA8A 5DXXA 5FD0A 4FNSA 2WZIA 4MTVA 1PX8A 4UQAA 1XICA 2WKGA 2VELA 1YXYA 3FCPA 3ZZ1A 3NZGA 2BVWA 2NSOA 2R8WA 2POZA 3UWWA 5EKYA 2BXVA 1EJRC 3UPBA 1OF6A 3ABXA 1MXGA 4IOTA 4WKHA 4Q7IA 3VNDA 1DHPA 3G3DA 3KBWA 3NOYA 3WFAA 3H2MA 3WF3A 3KWSA 5K9CA 3CZ8A 3ZJ8A 4AD4A 1QMLA 3WY1A 1UP2A 4XZ9A 3SGZA 4HU8A 4FR6A 5LIXX 3EWBX 4B92A 1Z42A 2YDSA 3FY1A 1VCFA 3MP5A 2CLHA 4LEFA 1F9CA 4XBKA 1TRDA 4AU0A 3W88A 4YVXA 4KERA 3SCOA 1JZ3A 1PIIA 1NDWA 1TG7A 4UTHA 4GY7A 1LRQA 4FHAA 1VC4A 4ZO8A 5AC6A 3W29A 1UR1A 2CZFA 4ZENA 1PTDA 4FX7A 3SR7A 1UKOA 1I0BA 3A3XA 1XI3A 4MF4A 4Z2GA 2QMJA 4R88A 1IXOA 5T91A 1AJ2A 4HMCA 4XV0A 1JPIA 3AXIA 1S1PA 3WMCA 1TZ7A 2C7FA 2Y4SA 2VRJA 2WNNA 1KFJA 3GHSA 1CPUA 1EOKA 1PHQA 1ME7A 1AH3A 4UOZA 2OQLA 3VC6A 1C92A 2IKGA 2YCEA 2R1NA 2A7RA 5L9FA 1AFSA 2IUZA 3F2DA 1E4IA 5D2XA 3QW3A 2PURA 4IG2A 3KBSA 1EEPA 2AKZA 4RDZA 2F61A 4EX4A 3M0IA 1SO6A 4TV5A 1SR0A 3VOIA 4A3QA 3BCJA 2JQXA 1DP0A 2YOCA 3ISIX 4WQ6A 1QNOA 3MMWA 1RJPA 4Q8TA 3GY1A 5LXXA 5D2YA 1VBGA 2P53A 3ZVHB 3TC7A 1H49A 1VBRA 4CVUA 1HJUA 1SJDA 4S2CA 2X8RA 1XS2A 3A13A 3M6YA 3R89A 2OB3A 3EX4A 4JIRA 1EFZA 1TCMA 3QQ1A 3FNDA 4JIEA 3PF3A 4TU1A 2BSLA 1TUFA 3MW7A 3W73A 1NTHA 5AC8A 3MWCA 1YPXA 1R47A 2QJIA 4LAKA 5EL1A 3AS2A 3MV01 4WGXA 4I8YA 4WY0F 3AS1A 3O8AA 3CUHA 3KAOA 2FMNA 2Y24A 4C7FA 1NELA 3QQWA 3PJXA 3UERA 3WJWA 4DBUA 3NM3A 1R3VA 1EZ2A 2HS8A 4ICNA 3FXYA 1X8CA 5TBOA 4MGGA 5BWAA 4QR6A 4MKNA 5G5IA 4RNFA 2OWWA 3BG9A 3M07A 1PZ0A 4E4FA 5C2CA 2XGBA 3ICJA 4DM2A 3TH6A 3RPDA 4HOWA 2NUWA 4C1NA 2VVSA 3NCOA 4QQUA 3P74A 4PMXA 4WF7A 3VDBA 2PLCA 3RO8A 5A6JA 2A6LA 2FPTA 3H4WA 3WJSA 2NVDA 1YPFA 3HIJA 4NJHA 3WD1A 2VX7A 3TN5A 4XKYA 4E4PA 1J2BA 3WQEA 3W25A 1OCNA 1KXVA 2HISA 3S42A 2FPVA 2EPHA 4UFHA 4FX8A 4AMAA 1RH9A 2CXEA 3LS9A 1OFEA 3WEOA 5G1TA 4WJXA 4U3CA 3RIKA 3J7HA 5HBFA 3W02A 2AL2A 4MY8A 3K4DA 2D2JA 2PFHA 5BNKA 1MRQA 2G0WA 3CIVA 3UZJA 3SB0A 3EGJA 4C1LA 3M0ZA 1A3WA 3IIZA 5CPLA 5BXRA 2Q09A 5B7ZA 3DG6A 4B5UA 3BW4A 3ITXA 3DDMA 4H7CA 2Y5EA 1T41A 3TROA 1A5BA 1J0ZA 1IWBA 1R3TA 2ODOA 3VGGA 4UTWC 4ZE5A 4KFOA 1HKJA 1SW3A 3KS6A 5A5WA 1OD8A 2VEGA 4MJZA 3G18A 1UZHA 2ZZ2A 4LCRA 4NKCA 1OX4B 1V3KA 5FA5A 3WLKX 5JUVA 4D6IA 4FLRA 4L4OA 4LYKA 1UBSA 1W2PA 1DQXA 3G8RA 4BWLA 2BMBA 3IGUA 4PUNA 3ZYZA 4CCDA 1OFDA 1F6PA 4UZSA 3FIGA 4HHHA 5F7UA 4Z2KA 4PB5A 2YL8A 3DFTA 4Z1CA 2VYOA 2CIPA 4GY0A 3VOGA 3WK3A 2O0TA 3DECA 3T8LA 2UY4A 1VPXA 3K5XA 2R91A 1JYXA 1EJTC 3G1FA 2GQ3A 4DAFA 5F4WA 3HPSA 4K36A 2FVKA 3EXTA 3HQNA 1GVEA 1TTPA 3HG4A 1UQYA 1VIWA 2WBGA 3AMLA 4H8UA 3L5MA 4EXQA 5DO8A 3CZJA 1PE1A 3C2FA 2WNZA 1WZKA 4DQWA 4LF1A 2ZRWA 1YXCA 1XGZA 3PR2A 1XC4A 2VX4A 1PUDA 2Z2AA 4IPPA 2WVTA 1JXKA 4M24A 3DX5A 4L9YA 2X7VA 2YLAA 4R9XA 3EDEA 1XG4A 4MPQA 4H9YA 4L4LA 3UBPC 4N9EA 3UNTA 3WUEA 5AC5A 4WEVX 1TV8A 5CPOA 3FEQA 2PD9A 3H21A 3VIPA 3KL5A 1R38A 2Y5JA 2E1WA 1LTDA 4G5DA 1P6CA 1C91A 3GC2A 2OO6A 1SFLA 3HGSA 2C71A 4NX5A 3NFUA 3M7SA 3GRIA 2QYGA 4AEFA 3QPZA 3UFYA 2VFHA 4KIEA 2PCEA 3STGA 4AZCA 2PZNA 4D8AA 4F9DA 3VNYA 4QDMA 1E1CB 1XR2A 3QR0A 5DANA 3ZQ9A 1YDYA 4CNOA 1A5CA 2ZRXA 1LWJA 3EWWA 1JZ8A 5TIMA 2CLLA 3AAMA 3M0LA 4LNCA 1YXDA 3VD5A 3CUFA 3UG8A 1W1TA 5IXEA 1GONA 1Q6GA 4QSHA 2OELA 1KKRA 2DSKA 3FA4A 4J9JA 2QPXA 3F1QA 1K9FA 3LLXA 2REQA 4NT0A 2OTDA 4JQ2A 4NNBA 4RXGA 2CXGA 4QM1A 3XISA 3O15A 1FVPA 3L0KA 1Q85A 5LA2A 1BWVA 3VKKA 1G4EA 1HUVA 4QP0A 5CLTA 3VCNA 5I24A 4FX6M 3MUAA 3QMTA 1WOAA 3B06A 2NWSA 3VCRA 3B0XA 4LUTB 1AQFA 2QAFA 1XQLA 3VX0A 3FJ4A 4KWWA 3NSMA 3TYAA 3VD3A 1JDAA 4JTJA 4IIDA 1V51A 5CPNA 2OCZA 3I7QA 3GHUA 2H9AA 4H04A 1JZ6A 1I1WA 1XLBA 1VD6A 5HMEA 1HKIA 2HNEA 1TE6A 4U10A 1R87A 2Q6ZA 1F74A 4GHRA 1GOXA 1YYAA 2VEIA 2OO0A 3S5OA 1S2VA 4PULA 3N19B 3KBMA 3OYXA 4H8HA 3S1VA 4O1FA 5BMWA 5D9NA 5D37A 5CC5A 4EPDC 4Z17A 3BK0A 2PDQA 1EYEA 3R13A 1L2UA 4EWJA 3JRKA 5JIWA 3PPCA 3L4VA 4OOZA 3LXAA 1Z6KA 4C6QA 1V03A 2IQDA 1PYFA 2O92A 3Q65A 4C6OA 2DVTA 1OQFA 4RV8A 1TV2A 3PHAA 4Q8UA 1CX9A 2OT1A 3HTWA 1XH1A 4ACZB 1KFEA 3BWWA 2XGIA 2W62A 4GYPA 1QASA 1XYBA 4UNLA 4DF1A 1V79A 1TV3A 4PSRA 4BZYA 1LG1A 2FZNA 4Q7NA 3A12A 2O7SA 2KX9A 3PANA 2ZADA 2J6XA 3H6OA 1FWJC 3AIRA 1G6CA 4UMBA 4JFVA 3BXWA 4HMDA 4CNTA 1K03A 4OIFA 1PL9A 4JCMA 4J7RA 1A53A 2ZX5A 4CD6A 2VZTA 3KRUA 3MU7A 2Y88A 4Z0JA 2VDGA 3U2ZA 5CCZA 1EGMA 3N11A 3LMZA 3AMKA 1Q6EA 3TNOA 1ZU8A 2FIQA 5C54A 4JHOA 1ZAIA 4N4QA 1KFBA 3AICA 3UF9A 4ZMGA 4A3RA 1EA0A 1XSJA 1KGXA 3AYSA 4UTTA 1NY1A 1RY0A 4LBUA 2R1PA 5DBTA 4Z2IA 3HMJG 4IXXA 2J7HA 3CIWA 4GO8A 4S38A 5BCAA 3WO8A 1L2QA 2PDJA 2DUXA 1BVWA 1HG3A 1JAEA 3AFBA 1YPIA 4AZBA 3N12A 3DHFA 3S1XA 1JI1A 3AYTA 1HXJA 1KFKA 2QAPA 5AHEA 3S46A 4DUOA 4MLJA 8A3HA 1LBFA 3NXFA 4PUKA 3E12A 1NSJA 4ONVA 4HPJA 1ZBWA 2FMOA 1BLIA 3K4AA 2Z4GA 2PDIA 1NFGA 3VFLA 2PDLA 3HU7A 2QQ6A 3N73A 3NDOA 3EWZA 3LD5A 4EVZA 5I00A 2DPEA 2PBGA 4Q8PA 3BLEA 1L6FA 1V3JA 3E5BA 4V1YA 1W54A 4WHBA 1H11A 1XLEA 2KAUC 1FCBA 2FQIA 4FLOA 1IF2A 3DKJA 4KWOA 2DZWA 4O0QA 4KMQA 3VNIA 3GH7A 2BHUA 4H9ZA 3HFYA 1H09A 3FX4A 3MY9A 5C55A 2A21A 1UKTA 3NNTA 1S3TC 3ZR6A 1I75A 1VCVA 3NQGA 4J3ZA 5I3HA 1S2AA 2JF7A 2WVSA 1H61A 1SVDA 4H2HA 4I6KA 3RGTA 1EPVA 2WMGA 3N2TA 5CZ0A 4Q6XA 3SCSA 4ZOBA 2VD8A 4G8TA 3NEVA 9XIMA 3L4XA 3W7MA 4QROA 5IM51 3S5ZA 2XISA 1XYAA 4DPQA 3PNUA 3TJXA 3EX3A 3COTA 2GYIA 3EBVA 4HU4A 2VEFA 5A95A 2WCGA 5F1VA 1FOBA 4DXKA 4F2UA 1G0CA 2Y8KA 5D4YA 2I5IA 3IJ8A 3GSMA 4DRSA 3U2CA 3M0YA 7TAAA 1L8NA 3GLCA 3G24A 4NYYA 4ROPA 3GKFA 2P5NA 3BAJA 3U3HA 1HJWA 1MWOA 1GJPA 3VAVA 4CVWA 3G2GA 2VCBA 3QHOA 2ESCA 2EKGA 1N82A 4OV9A 3W7GA 2B81A 1VRDA 1XLKA 2WQDA 4JKLA 4LANA 2ASHA 4TV6A 1L6SA 3A4AA 4F0SA 1WKYA 4DJFC 3M4HA 1LL7A 2EPOA 3CQHA 2FHCA 4G56A 2A2IA 2DSUA 2AAAA 4IIEA 5DMYA 3V16A 4KBXA 2PUZA 1BEUA 4AAJA 3ZVIA 2J8TA 2A5HA 3WF4A 1ZJIA 1GYLA 3CHFA 4YHGA 1XKYA 1RQEA 4MNLA 1WQ5A 2HPMA 4AD3A 4PEEA 2PLJA 4I5XA 1BPLB 2VEPA 3N9KA 4BI7A 6XIMA 3A4XA 1PVNA 3TYBA 5CC7A 3GK0A 3TSDA 2WWCA 3EOOA 3PTQA 4IUGA 4O17A 3ZJ6A 3UZYA 1R5YA 1B31A 1XSKA 2XUCA 5DXYA 3TR2A 1KM1A 1OFQA 3TV8A 1E72M 5KZDA 4EAYA 4PBEA 3W1MA 3O3RA 3E2SA 5RUBA 4FOUA 4ZZ9A 1G7VA 3IPWA 1W2VA 3MJMA 3IV8A 3KLKA 1TE1A 1VJZA 3W1RA 4N9CA 3G1AA 3BW3A 1OHLA 4QG8A 3AIVA 1A5UA 3EDJA 1Q45A 2ZVRA 4DO5A 4KCTA 3DFNA 2Z1KA 1MI3A 4P8WA 5C2XA 1B5TA 1P0KA 3RN6A 2D2GA 3CH0A 3NZRA 2W0UA 2VR2A 4PN2A 2WMKA 3DYPA 3TFCA 3O6CA 4HKPA 4IICA 1SJBA 3VOFA 4ML4A 1TPWA 1XQKA 3VGHA 3CQJA 1E1EA 3CJPA 3FFSA 3QKZA 3GO2A 3WELA 6TIMA 4PMRA 1OCQA 1FWWA 1R3QA 3GW0A 4IJRA 1RPKA 3PZVA 4I7VA 3OW1A 4KGLA 4FS9A 4UQEA 1WXJA 1TWWA 3R79A 3TNBA 4AVOA 4BY3A 3GDLA 6CGTA 1TVPA 2PTXA 3U0HA 4KRUA 3HQPA 4WD0A 5B80A 4MHBA 1LWIA 2GGHA 4LT9A 1W5QA 3U7BA 2FKPA 1YHTA 2DJLA 3UG5A 3WH7A 2P3EA 2BLEA 5D38A 2E25A 3BZGA 4WRHA 1OK6A 3TONA 4IH3A 5BRBA 1WDRA 5CJ5A 4FXRA 1MYRA 4NAFB 3BVJA 2EQDA 1JQXA 2HPIA 3M0KA 3O0KA 3W24A 2BX7A 2A6NA 4O1CA 3I4KA 4H3DA 4Z1AA 1M04A 2W67A 5EMJA 1XLIA 5G1MA 3WMLA 3VD9A 2YSWA 1E5JA 5I23A 1UWTA 4XX6A 1KA9F 2XINA 4QJ3B 1M7JA 2HXUA 1V0MA 3GTNA 2NX3A 5FEWA 1ECQA 2WSYA 3B40A 2TSYA 2ZZ6A 1W31A 3SURA 4PH6A 2BP1A 3G1SA 3RYSA 3B9DA 3XINA 1TJ1A 3AIEA 4XUYA 3MI2A 4S3CA 1V77A 1CENA 3CPGA 3OHIA 2C15A 2X1SA 2PDYA 2XWDA 3C2OA 4R9OA 2A79A 1FWEC 1JEZA 1M9HA 4H00A 3OBAA 2DGAA 1H50A 2EGZA 2WZTA 5CH9A 1G4PA 3DGRA 4JTUA 5HR7A 1Z8AA 2JFEX 4MKVA 1B3VA 2GGJA 2YL5A 2ZUWA 4GKTA 4MMWA 3SN1A 4B16A 3VA8A 5JIPA 2J27A 4MWAD 3N14A 2BWGA 1O60A 2ADAA 5CGTA 2HNHA 4K1GA 1DWAM 1SSGA 1AQ0A 3PK7A 1ZBCA 3M5YA 1ZP4A 3VYLA 3SZ8A 2XSBA 3WDRA 2PF8A 3KWXA 4C6JA 1AUSL 3PTMA 2DZAA 3A22A 4IPNB 5I07A 4DIAA 3I4EA 3HPXA 1AW2A 3GTFA 3W2NA 2WM0A 1VEMA 4CNPA 1JIBA 5DEZA 2XVPA 3SSJA 3RCNA 3LNMA 2ZZ3A 2YZRA 2DSWA 2QMKA 4FSAA 1JPDX 5BU6A 4C90A 5I2UA 3NSXA 3O6AA 1UWSA 3EPOA 3UNDA 4QS6A 1GVIA 2GWNA 1PTGA 2NT1A 1FXPA 4CD7A 4H6KA 1TIWA 2PWDA 1TVLA 4GUHA 1S39A 2PLKA 3SCUA 2YW4A 3OZYA 4GBDA 1JR1A 3NL3A 4HIBA 1EJSC 4YTQA 2I9EA 1E6SM 4HU0A 5A6LA 3T0TA 5BU9A 4O10A 3L7RA 2OYMA 1E73M 3STFA 3WQOA 1MZRA 3PZOA 3SUSA 3AUOA 5JBEA 3DI1A 5IDZA 4LUYA 3DEQA 1ME9A 3AMDA 4W5UA 3IS4A 3IAQA 3URAA 3M1ZA 1NARA 2G50A 3QXBA 3WCZA 2QDHA 4HCLA 3GQYA 4LTSA 3QOKA 1XFBA 3WUBA 3AISA 3T78A 4JTSA 3ARYA 3II1A 1UOZA 1ZJAA 5KETA 2W63A 4F0HA 3I3EA 1SFTA 2MNRA 2FDSA 1GKPA 3W85A 1QPOA 4UOQA 1UASA 1YEYA 4LUSB 4K38A 3CZKA 4JTCA 4INFA 2FZ9A 3IUDA 4LBRA 1BHGA 1QW7A 3UPWA 1H1ZA 1I1XA 2HV5A 4LY4A 2XVNA 4IFRA 1TX2A 1HW6A 4JY9A 2E5CA 3UWZA 4ASTA 2O7QA 3Q2DA 5FF3A 4HBKA 3AIBA 1IV8A 1OT2A 2PB1A 3THDA 1ZY9A 4AVFA 4F4RA 4B9YA 3EWYA 2ON3A 4XZIA 4M7SA 4GUJA 4LAZA 5E9XA 5FI8A 1GOMA 3NEHA 2C1GA 3VC5A 4L65A 2TMDA 3SGGA 2NT0A 1VFSA 2P0IA 2QKFA 4ORIA 1KCZA 3CS2A 2HE5A 3O63A 3GDTA 1AL7A 1MW2A 3I3BA 1DJIA 1L6YA 3PY2A 1QJWA 3R25A 1SW7A 4LAUA 3WH5A 1MFVA 4LX4A 1FY6A 3S2NA 2EPLX 1HT6A 1UROA 3WQDA 4B9ZA 2NQ9A 3RM8A 3DOPA 4L4PA 1Q6RA 3ZSSA 4BFAA 4K68A 3CQKA 4OOUA 2DIEA 4JFWA 3AXMA 3CUGA 3NQMA 3W1LA 4F40A 4H83A 4LYQA 3BICA 2WMIB 4JQ3A 4AIBA 4E2DA 4RW3A 3HZ3A 1ISZA 2C79A 1PDZA 2P8CA 3UESA 2EG7A 1DJYA 3VZZA 1Q63A 1BRLB 5EPDA 1OY0A 2GJXB 4WZHA 4GYKA 1UH3A 4IT1A 4XAPA 4WX2A 3UZWA 2NV2A 1S5NA 5A6SA 3GX9A 3FGCB 5EMYA 2FZBA 2ZQ0A 4QTGA 2QJJA 2WK2A 4GY1A 3INPA 3L0NA 3LB0A 4AC1X 5JQ9A 1HJSA 1YLVA 2V30A 3VDHA 4WR3A 3E96A 1JYNA 4XIAA 2BNJA 1Y5WA 4DJEC 1GW1A 1H63A 3ORWA 3AUJA 4FA3A 1OM0A 4BF9A 1K6AA 1PZ3A 1Z41A 1B9ZA 3BAIA 3BLFA 3GBDA 2V2HA 1PCKA 4J2MA 3UR7A 3REQA 2WVUA 4GQBA 4AIOA 4QSFA 4GACA 4S3BA 1ENUA 3LTPA 3P82A 3TAOA 2WVVB 1E6NA 3W38A 2GDUA 3K2GA 3THCA 4YTSA 5I02A 1EPXA 1Q4NX 2OLHA 3KOFA 3TR9A 1E9ZB 4HTYA 1IT0A 1NOUA 1LLZA 4OBTA 4QEEA 5F4XA 3TWAA 2DEPA 4LS2A 1W1VA 3MPGA 1OFOA 5I09A 6REQA 1C8QA 1QNQA 1B2YA 3ZT5A 2BV9A 1ZFJA 2B7NA 1O94A 5LGXA 2Y7GA 3DAQA 4HB7A 1JYWA 3SM0A 4NG3A 3VO0A 1JRCA 1WP6A 4ZB2A 4FNPA 4IZGA 4IUOA 4OECA 1GOIA 1NWUA 4OJYA 3TXZA 1X6UA 4XBSA 3O6YX 2NUXA 4GH1A 4LNYA 1VFOA 3MZNA 2PDCA 1GZJA 4PCSA 5AYIA 1IGSA 2H8XA 2J9YA 1DV7A 4KS0A 1C8YA 3MVTA 3TJ4A 4XVEA 2CCRA 1AW1A 2TAAA 2V0TA 2C13A 3G77A 4RUBA 2IKHA 2PGRA 1SFSA 3WD4A 2ZX9A 1NEYA 3HGJA 3T9PA 5TAOA 5C0QA 3SI9A 3T1GA 4DZHA 4GNJA 1IZKA 4LRTA 3VGFA 1RK5A 1E51A 3CC1A 4AZ7A 2IQTA 3W70A 2YBTA 1PDYA 3CL8A 5K9DA 5K4ZA 2E77A 2XU2A 4P8VA 2I14A 2YPIA 3CH9A 1OG6A 1TRIA 1FBAA 5HPOA 3TU9A 4CU6A 3CHCA 1CXHA 3B0YA 3UY7A 1LT7A 1W9VA 4FZIA 4PBFA 1REQB 3NA8A 2ZCGA 1P1MA 4Q3MA 2F8QA 4ZO6A 2I7GA 3DU0A 2BGNE 1V6XA 3ECQA 1VRXA 3MC5A 2DT2A 3L65A 3CBWA 1JCNA 3QV7A 3SCTA 1FCVA 1OCBA 5DN1A 4NF7A 1MW1A 3UZZA 1EB3A 4J2PA 1E0WA 5E70A 1Y0EA 1XD0A 5JH1A 5FEPA 4JIQA 2W66A 3MP3A 1TV7A 1GUVA 1VFLA 2WC7A 4XAFA 1QUMA 4QJ5B 4TX9A 3LBMA 3UJ2A 1WX0A 5L6UA 2BASA 3RF9A 3L21A 2QGYA 4L9ZA 3VOHA 4I9TA 3WF2A 1ICSA 2YR1A 2WWDA 3AHXA 1NP2A 2G4FA 3DGBA 3WDJA 4UWMA 3QY8A 1I0DA 3CWNA 3ANYA 2ZUUA 1UR9A 4Z1BA 3C3UA 1PWMA 2XHYA 1W3IA 3TMQA 2VGFA 1Q8JA 3OLGA 2V68A 3CO4A 4Z2HA 1RPXA 7REQA 4H2CA 3CO8A 1CNVA 3HM7A 3FEMA 5I7GA 2D0GA 2PGWA 4Y9PA 4JTAA 5CEWA 4OHQA 1KM3A 1O95A 2Q3OA 1W3NA 2X0YA 1Z48A 2FTPA 3JZUA 2VENA 1V6UA 3TA6A 3WNPA 4RKAA 3QZAA 2YXXA 4I5RA 2YGYA 2AQWA 3JS3A 5KITA 5G4HC 2PZ0A 3EPNA 3O0FA 4N02A 1WKDA 2ZE3A 3HFTA 4FI4A 2A7NA 3MBFA 3AMCA 5A6MA 2G5WA 2A7PA 5KZMA 1KW1A 3ARTA 1VFHA 4E5TA 2X05A 4AYSA 1XWYA 2ZXQA 2ISFA 3QVQA 1FHLA 1PKLA 1PKNA 4L64A 3K8MA 4ZBCA 4V28A 1ML1A 4QDPA 4JYEA 4LGXA 4PUUA 1R9YA 3EX1A 3CAQA 3OZOA 3N4FA 2HS6A 3UWUA 1IEVA 3VGDA 1WB0A 3FW6A 4ZXOA 1KM2A 3ZSTA 4A3YA 3WJYA 3C0LA 2L5HA 3IGXA 4ROQA 3UXAA 1AD1A 2ZVIA 4Z2LA 3PFRA 3QLDA 2ZRZA 3ABOA 3G0UA 2Z00A 4QNWA 4OUIA 4XQ6A 1OVDA 2ZUVA 2PDBA 4G1KA 2W5FA 2UY2A 4MWAA 2AOSA 2YA1A 2JF6A 1BVZA 2C3ZA 3RR1A 4E0CA 4GYFA 1B3XA 3E02A 4ZGYA 3G22A 4EPBC 5FF2A 4CEUC 3FJLA 4NU7A 2Z1BA 1KXTA 1PWLA 3A64A 2DUZA 4HSHA 4ERIA 1JF5A 3N2XA 4PUEA 3T6CA 5C71A 1IZCA 4HYRA 2V9DA 2YJQA 1UH4A 3PG8A 1HP5A 1XLJA 4R27A 5BOFA 4JGDA 1CEOA 1HL2A 3A5VA 4LB3A 2PTWA 5B7YA 2O9PA 1VFTA 3H2NA 2PLMA 5AZ1A 3C52A 5C9RA 3Q37A 2YDAA 4QRNA 3P8JA 3BG5A 4W8BA 1L8PA 4TOQA 2E7FA 4Y2WA 2J7BA 3WFZA 4O1BA 1H51A 1ZJHA 1GVFA 1LBMA 1B3OA 1XLHA 4UOJA 4LJ3A 1EGVA 1AZ2A 2PBOA 1NM9A 3S1UA 3V4BA 2E8YA 4MY9A 3WBAA 3NQ6A 3W27A 4XZLX 2FHFA 5DT5A 3CHDA 4I8DA 3HBLA 1T99A 1WUEA 1FDJA 3K8LA 4RR4A 2PDGA 4K8HA 4FNTA 3O05A 4Z0SA 1W8SA 4RNHA 4B2DD 4LALA 2GPTA 1NJJA 3WDIA 2FZ8A 5LSMA 2X41A 1LOQA 4UR9A 3ZFHA 3AXHA 4D1IA 2V63A 4TUFA 4IQEA 5CPSA 3SCVA 1JNDA 5HJLA 4TO8A 1QW8A 1IEWA 3R8RA 1SZGA 4ZSUA 4IP5A 5IHRA 3ZJKA 4PMYA 3FA3A 1PIFA 2Y61A 3GR4A 4TQTA 4S3JA 5E9AA 3P0XA 2V3GA 4ZEPA 2OEMA 4A8NA 5CLWA 3HG2A 3ZM8A 4LCSA 4RE4A 3G1YA 3VK5A 3ZS4A 2D20A 4ICCX 4AMCA 4Y96A 3NL5A 2Z0IA 1DJQA 3AHYA 2RDUA 1M7XA 3QGVA 4RE0A 1GOOA 5I77A 1LQ0A 3B8VA 9CGTA 1W1ZA 2ALDA 1I2PA 2Z2UA 4UIOA 1OX6A 1AZ1A 3SAZA 3LBCA 3GWQA 3Q58A 4AZ5A 2HVMA 1A3HA 4BS0A 2E9LA 3USBA 3B9OA 4DJDC 4AZHA 3NDZA 2D24A 3DKLA 3NYDA 2PD5A 1VPQA 1W5MA 4ZL1A 1QOPA 4NI8A 4AF0A 1QI0A 4B5XA 1ZB5A 4JQ4A 4Q4SA 1XRVA 4DUVA 1Q6OA 4ZQMA 3FDGA 1FA2A 2SFPA 4RL3A 5HDRA 2A3AA 3QQ0A 4WXZA 4AISA 4FEZA 3QC3A