2YOCA

Crystal structure of pula from klebsiella oxytoca
Total Genus 335
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
335
sequence length
1051
structure length
1051
Chain Sequence
b'DVVVRLPDVAVPGEAVTAVENQAVIHLVDIAGITSSSAADYSSKNLYLWNNETCDALSAPVADWNDVSTTPSGSDKYGPYWVIPLNKESGCINVIVRDGTDKLIDSDLRVAFGDFTDRTVSVIAGNSAVYDSRADAFRAAFGVALAEAHWVDKNTLLWPGGQDKPIVRLYYSHSSKVAADGEGKFTDRYLKLTPTTVSQQVSMRFPHLSSYAAFKLPDNANVDELLQGETVAIAAAEDGILISATQVQTAGVLDDAYAEAAEALSYGAQLADGGVTFRVWAPTAQQVDVVVYSADKKVIGSHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPDGWDNLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAGDSNMVQHLKTLSASGVTHVELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLNQLKQSDSQDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTTRIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMGYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDSVRGGGPFDSGDALRQNQGIGSGAGVLPNELASLSDDQVRHLADLTRLGMAGNLADFVMIDKDGAAKKGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKASQEADLATRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRISDDGSNYEVITRVKEMVATPGEAELKQMTAFYQELTELRKSSPLFTLGDGSAVMKRVDFRNTGSDQQAGLLVMTVDDGMKAGASLDSRLDGLVVAINAAPESRTLNEFAGETLQLSAIQQTAGENSLANGVQIAADGTVTLPAWSVAVLELPQGEAQGAGLPVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PULLULANASE
publication title Structural Basis of Pullulanase Membrane Binding and Secretion Revealed by X-Ray Crystallography, Molecular Dynamics and Biochemical Analysis
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Hydrolase
total genus 335
structure length 1051
sequence length 1051
chains with identical sequence B
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
A PF03714 PUD Bacterial pullanase-associated domain
A PF11852 DUF3372 Domain of unknown function (DUF3372)
A PF17967 Pullulanase_N2 Pullulanase N2 domain
A PF18494 Pullulanase_Ins Pullulanase Ins domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yocA03
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yocA01
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2yocA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2yocA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yocA04
1OARH 2DWEB 2QJDA 4KDTC 5D2NA 5DURB 2B4CC 4AZ6A 1LWRA 3BVNA 1Q9WB 1ZU8A 4IS6A 4JFDB 1WCBA 1OM3L 2OYLA 1BVKA 2DQFB 1GQJA 1AE6L 2W5FA 1MVFA 1GJUA 1RJZA 1G0CA 1RH9A 3BP4B 5I2UA 4XNXL 1EGJA 1UKQA 5C0IA 4S1SH 1MW2A 2A3EA 2YPVH 1C93A 3RVXC 1FSKB 2WM0A 2J4WL 3RWCA 5D5ME 1B4JH 5EZLB 1V7MH 3TIDB 3KL3A 1I3RA 3T2NL 5BW7C 1RK1A 4NSBA 5TGBA 5JORB 3HRZB 5E6IB 2ATKA 1X5AA 3V6ZA 3QHMA 4HUUA 2FHFA 3BN9D 4QY8B 1VFMA 1BWWA 3V0VA 1HSAA 1FN4A 4AW7A 1U8MA 4AY1A 4NHUB 1PYWA 3ARDD 5GS2D 3CPLB 3HR5A 4RGNE 2W61A 1W72L 3EGSB 1VERA 4PRBA 4XT1C 3U83A 3UYRL 3RVWC 4RE4A 2YBRA 1R5WB 5SWSA 3VXOB 4OZFA 3LPGA 1D5XB 2R4RL 3ZTNL 4NWUL 3QHFH 4XWGL 2C1OB 4MJ5A 4M81A 4PJBE 3QDMB 1LO4H 2R2HB 3MRMA 3CZNA 1FL6A 4UILL 1R87A 1UEYA 3V4UH 5DRNB 1KFAL 5E0CA 3SPVA 2XQBH 1UB5A 1UWXH 5E8EA 2OJEA 5HVHB 4MCYB 5I0ZA 1BYAA 4TVPD 1RZKH 3QUZB 3RVXD 3VMNA 3DLQR 5BXPA 5TDOA 1EO5A 5KW9L 1A1NA 5IVOA 3FO0L 2IMMA 4OIIL 1IEBA 2YRLA 3AS1A 4XNQA 1A6VL 2FE0A 3DXAB 4X6CF 4XC3H 5IB3B 4MWFA 1CLOH 4N1HB 3Q6GH 1WICA 4Y2DC 3SDDC 3K1DA 1OB1B 3GFUA 3H0TA 1WTLA 5I18H 2VDML 4HXAH 1AH1A 5D96B 1OW0A 3W27A 3CUIA 1RUML 4EUPB 3U7WL 2VXUL 3IFPB 2WC3A 5ANME 5E1QA 5I74C 3BKML 3SCNA 2VLRD 3CGTA 5ESAB 1HK6A 1MLCB 4JFOB 4NZRH 4CN6A 1WWCA 4JFQA 1HKFA 1UZ6E 3T0AA 4J4PC 4JPKH 5ALBH 1URLA 1IGML 1CXKA 1Z3GL 2DD8H 3VE0B 2EEXA 4QRRA 5HY9B 3B6SB 4WIWA 1B0GB 4R2GB 4X7EC 4YBQC 1ZWIB 1V0MA 2A9ML 2J5LC 4TPRL 4Y19E 1P5UA 4OGAD 5L9DL 2AXGA 1K4CB 5E0QA 3WCYA 4U1JA 3BXNB 4YXKL 4NN5C 3SQBA 1OAQL 1OAZH 3I3DA 3MYJB 1NFDF 4RAHA 5D7LB 1ZV5A 2OI9B 4IOIB 4M1GH 1OSEA 4MNLA 2G9HB 2CBJA 5FHAL 4EUPG 2DI9A 1F11B 2X9WA 5IFHL 1UH3A 3KJ4B 1Q9KA 1BG4A 5DQ9B 5T33H 5HPOA 3SCPA 4JY6A 3SCOA 4XCNA 5LWYH 1GZPB 2EIZB 2XKNA 2HFGH 4E5XB 3WL9A 4BA8A 4PYHA 2MANA 3AM8C 1S7WB 1SEBA 5F21B 3A21A 1IL1A 3QEQE 4PV8A 2OTUA 1E4XL 5SX4I 5H35B 1MHEA 4NXSA 3IDYC 1HKMA 2ZUSA 4J4PD 2BHUA 5D71L 1JFXA 4FMVA 4HOZA 1N7ML 1RJYA 3VRJA 4WFHE 3S35L 3ALXA 2X4QB 3HB3D 3N9GL 4YDJB 3MUY1 3WD5H 3TESA 4LF3A 3TNNB 1ISXA 4HS8H 5E8OA 4DFHA 1MIEH 2AJ3B 2QL1A 1QRNA 2M1KA 1PS3A 5HHNA 5EBAA 4S3JA 6FABL 4FFWC 4XBEH 5ISZE 3HZ3A 1QI2A 2GJ6E 3TCLA 2F74B 2OYKA 5FGBC 1X1NA 2Y9RT 3FQRB 1IAKA 5DFAA 4WUUE 2APVA 2TAAA 1MFUA 4DKEH 4RFEB 5AAMA 3NCCB 1LTXA 4TNVK 4L4VD 2P5EE 3QFDB 5CUSH 2WVSA 4I18B 1K8DA 2PO6C 4F8XA 1DBML 4UTBH 4PJBF 1W1TA 5GGSA 5DLMH 4HJGA 2PI6A 4FLQA 3BDXA 1N64H 1S9WB 4XV0A 3WH7A 3UESA 3A4WA 3SUWA 3E8UL 2ZXBA 4KQ3H 1A4JA 4Z0XA 5FF6B 2XA3A 2ARJA 5DEZA 3BEVA 4TNWF 3D3VD 1NUDA 1IGTA 1HXMA 2F5BH 5F9AC 1I7UB 2YIHA 2XWJB 3DVGA 4KJYA 2OTWB 5LQBL 4O58L 3BVTA 1C5BL 3A6BL 5DMJB 2IH1B 2V3FA 3LQAL 3VFVA 3QWRD 3VIHA 1M05B 5FK9B 1JBJA 4PMQA 4OZGE 1UKPA 2HVJB 4PJGE 1WWAX 4FFWD 2N56A 3QCVH 1FFQA 4WGVB 4YNYB 5C0DA 1A0QL 3EBAA 1JYWA 2VSDA 3OLGA 2NSXA 3TO2B 4DKFH 1DQTA 1YN7A 3UC0H 2E7LC 4G8IB 4FXGB 3O9WC 5L2JB 2E0PA 3TIEA 2BRRL 3ES6A 1A14L 1NCBL 2V5TA 3LEVH 2F1BA 1KN2H 1LVEA 1QLEL 1T5XB 1WC7B 1N4XL 1UFUA 1YJDH 3RA7H 4HC1L 4JVWA 2AXFA 2DB8A 3PWLA 4NQCE 1JYNA 1FNEB 4DTGL 1AJ7H 3BZ4B 2KKQA 4MJIA 1P2CA 4Y4HC 2DI7A 4Z7WB 1OLLA 3IJ9A 3E6FB 3DI3B 1KBGL 4HFWB 1MHHB 5DT1H 5HGBB 3GSVB 3SDXB 4HUXA 1H3UA 4XC1L 1A7NH 3V7MA 4HV8B 4AQOA 5A40E 3IANA 15C8L 5FB8B 2B4CL 3TBYB 1VACB 3RY6C 3BZEA 4CN4A 1EGJH 3QWQB 1C8QA 4MA3A 5HDLA 2X8RA 3ROLA 5HYEA 2QR0B 3VG9B 4YZFF 1CTOA 1G7PB 5D1QB 4M5YH 3O9WD 5DI8B 3ZE2F 1JPGA 2F53E 1JF1A 3IKCA 5FDWA 3AHTA 3D39A 5FO9A 4ZUTB 3BVXA 4OI9A 1UD6A 1PBGA 2WSKA 4BKLA 4JFEA 3AMLA 2IH3A 3KYOB 4OT1H 1WFOA 4OF8A 3W5MA 1QSZA 3WH9A 1OGTB 4PUBL 4ZXLA 4OLWL 5C08E 5DC0A 2BCKB 2ZSVB 1WIUA 1F58H 1NCTA 4K7FB 1ETZA 2XYLA 4QAWA 5IB2B 43CAA 1OWRM 3CZKA 2GHWB 2PBGA 4RFOL 1U0QA 2WBWB 4OZFH 5CPSA 4WEUD 1EUUA 4HZ6A 2Z8WC 3EJYD 1XF5A 2HJFA 4EI6A 3ROOB 3BAEH 4G3YL 3GSRA 4YHZL 3THCA 4H25A 3VSTA 1BIIB 1SMOA 3IDIA 5BXFA 3IDGA 4M4RA 1XCQB 4HFUL 4QRUB 2DQCL 5A2FA 4JFYA 5DJ8B 1TVDA 2AK4A 4MAUH 2BVQB 1LK2A 4L3CB 4X6FA 3PTQA 1P7QA 4JJ5B 3IETA 3RWJA 3Q0HA 5E94B 5EORL 1GOOA 4LL9A 3TJEL 5C0CA 3B9KB 2PR4H 4J6RL 4P3CL 2ZUWA 4HXBH 1YN6B 5J6GB 2NY2C 2EPOA 4LLDA 4JZOB 3TWCH 1H3XA 4GAYB 1JWSA 3BQUA 5TE6L 1TLKA 3WSQL 5FYLH 4RAVA 3BPOB 1XCWA 1E55A 1DQLL 3MUAA 1UM4L 1Q94B 3ZDYE 3MRQA 2NR6D 3INUH 1BD2D 1OD9A 1I7ZA 3PWPD 3QT2A 4NNYA 3RWEB 4IUGA 4HU0A 1DQQA 4P57A 1V03A 4NQDB 2WCAA 2FBOJ 1DUYB 5L2KD 2DLGA 4DJMA 4PJGF 1WNOA 1OSPL 1XH2A 5CEXB 4OM1H 4MX7B 3X3GL 4I77L 4U1SB 4EOWH 3CVHB 2ESVD 1TQBB 3BE1H 2ICEB 3EYVA 2WBJC 3O2VL 1ZEAH 4S11A 3VI3E 1HDMA 4LIQH 1CDJA 3U9PL 1D6EB 4QOKA 4JM4L 1CXHA 3BWAB 5HI4C 2AV1A 4LGPB 3TBVA 2XZCH 4PTXA 2DQXA 3ILQC 1MUJA 3NFSL 4FNLL 4LCWA 5CINL 4B50A 4NC0B 3RRQA 3LS5H 3DX8B 2AJZB 3L7FA 4Z95H 2W65B 1JZ4A 2FBJL 5CBAA 3AXIA 5DQJB 2YMXH 5MP6L 5HSFA 1U92B 2VKXA 4Y4FA 4F3FB 4GRMA 1BYBA 2D24A 4NM4H 5E9DD 4UQ2A 2DLHA 1CZ8H 1EDGA 1TVPA 4GS7C 2O9RA 3QUYA 4OD2A 3MV7D 4XCCL 3T0EB 2VCCA 1FNGB 4OJFH 3NAAH 5IT2L 3I9GL 1KIRB 3QR3A 3CDCA 3EDJA 43C9B 3VW3L 4HEME 4UI2A 3L2LA 2V3GA 1UKTA 1RZ7L 1WGOA 1LD9B 5HI4D 4HUVB 1F00I 1BGXL 3MRPA 2VRKA 3ILQD 1NGPH 1REIA 4W4NA 3VINA 2GFBA 2IFGA 1IGFH 3O0RH 3WIIL 2YBTA 3QBTB 2X70B 3P30L 1S9YA 2J6EA 2R9HC 1UWEL 5HHOD 3WEOA 3BRGC 4KMQA 1NMBH 3ZYZA 4P2QA 5BMFL 3UTPD 1B9ZA 1IT9L 3ULVE 3B9DA 2PUQT 1MJUH 3BW9A 3CC5B 5DZNA 2P8MA 4PJ8C 5ERWA 3FOLA 5DD3L 4OCYH 2EECA 2A83A 4W7WA 3LCYA 3WELA 1M53A 4NFCA 4JFZH 2XWTA 3AIQA 5CGYC 2XIDA 4MQXC 4AEIH 1KJ2B 1SJHB 3DO7A 1H0DB 1NGXA 3ARGC 1S78C 1XH0A 1U8KA 2P49B 3EJQA 5GRXG 4LVNB 1OVZA 4MLSA 1IC4H 3VDCA 1PSKH 3N1PC 2EXOA 3WNMA 2WHJA 1EXPA 2P1YA 5ID0B 4TUKH 3MZGB 4FABL 3MXVL 1BBJA 5GSVA 2ZWYA 1T4KB 2PF0A 1NKRA 1Y6NR 1OT1A 1O5DT 1RV6X 1ZHKA 1F45A 5C2BL 4R3SB 2CUHA 2JJTC 2F18A 3ZDYF 4LLQA 3HLAA 3SJVA 2X4OB 1S7SB 4NRZB 5F7FA 2X1IA 1T1ZB 5C0JA 5JW3H 1CE6B 3KS0J 1HJWA 2NTFB 1DBBL 1W0YT 1DVFD 1U2HA 1EA9C 4PV9A 1W8NA 2G75B 4OZIB 3RFZC 2NY3C 4NZUL 1NLBH 4B5EA 2V7NA 3BSZL 2X4TA 3FTGB 4P2OC 4L1HA 1RFDL 1RPQA 4P7RA 4PJHA 3VI3F 4W88A 2HH0H 3HE6B 1VGEL 1A47A 1B90A 4JQVA 3VH8A 4AEFA 3KWWB 3N9KA 1INQA 4E41A 1KCLA 4O02L 4UT6H 3UTSE 3V9FA 2DIEA 3VWJB 1UZ4A 1RHFA 5KSAC 3GO1L 1KB9K 4QDMA 1T0MB 2G8ZA 3AWEA 2VDLL 3QA3A 5D7IB 1PVHA 1FIGL 3QO0B 5GSRA 3OLIA 3RGVB 1CICC 2FZ3A 5GGRA 4ERSH 1HCVA 1U95A 1W8OA 2KQNA 1JXKA 2ENYA 3WQVA 4H26B 1YDPB 3NA9H 1NMCB 4RA3A 3KXFE 2ZOLB 1BQLH 1YY8B 4JKMA 2GVYA 2J8FA 2UY3A 1V02A 1PZ2A 1GNXA 3C6LA 4I0PC 3N85H 4JPWL 3TT1H 1HWWA 4Q22A 3I6LD 5FKPB 4HZ7A 5TPWL 3GMNB 1I8MB 4IEFB 3FQUB 4FQXB 5HHMD 5I1CL 3ZR5A 2CDEA 3SQOL 1ZSDB 2F5AL 4EUPH 2WUCL 2CIIA 3SDAC 4PJAF 2NY3D 3EOTL 5JLZB 3T8XB 4OTXL 2D20A 1VESA 5KAQF 1M71B 5LG1A 5LKNA 2EAEA 2DQHH 2WC7A 2AEQL 2BNQA 4GKNA 1A3LL 1QPPA 1VFUA 3WDHA 3TT3H 1Z0MA 2BERA 2OZ4L 1FORL 5DFVC 1PEZA 1N6UA 2WP3O 2D7OA 3V4VL 3QNXB 5DHYA 5CG0A 2ITDB 2XN2A 3GNML 1QEWA 3T09A 3QJHB 3NCMA 2W0PA 3L7EA 3RMEA 1EZVY 2Y07H 4MB1A 4AD5A 1UENA 2CNCA 4D6HA 4Z76A 4Y7MA 4R7DA 3BN3B 4GG6E 4OQTH 4J3SA 4P7LA 2C3GA 3ULVF 1I85A 3SUUA 2FB4H 1T89C 4KY1L 4LAJH 1WPCA 1MQKL 4LLWB 5CSZA 4PP1D 2D7MA 3AUVA 4HMDA 3N15A 1U8NB 4D1IA 1XMWA 1U8IB 4HPHA 3SCMA 1FHGA 2UWEB 4JO1L 4X4XB 3U1SH 3MLUH 3L6FB 4JDZA 1NEUA 5MHSD 3FFDB 3CZJA 1JPTL 1NPUA 3SDAD 1G7IB 4PTMA 1E4MM 3OAUL 1V7NH 4GBXB 1O0VA 4OCLC 2EBNA 3MMEA 1OWWA 3VXSA 4NDMB 1Z6JT 1WT5A 5AYBA 1TZHB 4LCCB 1U8HA 5MEND 2IPTH 4JZNB 3CSBA 3MFFB 1EDQA 2BOBA 3WBDA 1RULL 3TYGL 1YHTA 4PS4L 1CFSB 1TQCB 3EJTA 1HQ4B 3NTCH 4KROB 4BQ5A 4CD7A 1VFBB 4A6YA 4TVCA 1NLDH 1VKXA 1T6WA 1MYRA 1MJ7H 4K3JL 4KV5E 5A6BD 3UJJL 4ALAH 3AXLA 3ZDXE 1E6JH 2IFFL 4UUJA 1CZ1A 4YDIH 3DECA 4PRHB 5CJXC 1XF3B 4DGVH 5JQ6L 2XN9B 1ISVA 3ZYIA 4NN6C 3MNVA 2CLVA 5M7QA 1OAXH 3NSMA 1AMYA 3K0WA 5A8MA 5ICYB 1DE4B 1FHLA 4XHJC 4XNYH 4FLSA 5JOPD 3TBSA 5CD3A 4MDPA 4J3XA 5KN5A 2ZSWB 3CX5J 3Q5YA 4G7VH 1MAMH 2G60L 4MB3A 3VFUB 5E08H 2JB5L 4ATWA 2ZXAA 2VR9A 4FZEH 1R3HA 2HLFC 1KGUA 2L0DA 1SEQL 2Z8VC 2ESCA 1SZNA 4D6JA 3OGOE 5BOZG 4KUCF 4LKXB 3S34H 3O9NA 1YEGH 3QFJE 1BZ9A 1R5IA 2ED7A 2EICA 2E3ZA 1QO3B 2E6PA 4MNHB 4L8BA 2ICWJ 4IMLB 2A6KB 3BO8A 3RIKA 5TQ0L 4HWEH 3SCUA 1R3IH 2IPKA 2F19L 2R0KL 4GKSB 3SIMA 4OFIA 2Z31D 2WKLA 2NY1C 5F97E 1ZT4A 3MREA 1MFNA 2ADFL 1FFNA 4LLVA 4ZQKA 3WIFB 4ODWB 5I30L 4UDTA 1VDGA 2EJ1A 3VX1A 1LF1A 4XP9H 5JOFB 4X5WB 3L4YA 2PYEE 5AYUL 5KSBA 4CADB 2WMIB 5HD8C 1H1NA 3NCYP 1TZIA 2WIIA 5A43C 1S46A 4CMMA 3RWFA 2EACA 1XSJA 1UXWA 1QNZH 2BNRD 4Y1AA 4PTTA 3QIWC 2AGJH 4FMFA 4Y88A 1GRWA 4UQDA 4LNRB 1KB5A 4XHJD 2NY0D 2J6EH 2QHRL 4M9PA 4EBQL 3QUMA 3DHMA 5E1AB 2Z35B 3LPPA 3ESUF 1QFWI 4OGXL 1IAII 5F1KC 4MQTB 4ZXBD 1TVHA 3PGCA 4R9HA 4PRPB 3WFHB 3MUIA 4X6DE 2HLFD 3UTZB 1ZA6A 1NCAL 3N1MC 4Z18A 5I15L 3OKDB 4QHNA 3BOVA 3OBAA 4P2YA 4N5UA 1U2CA 2X44D 3FQTA 1MPAH 2PWEA 2OQJA 4JKPL 4GG6F 1YPZE 2YLLA 2DICA 4M48L 2CEQA 5CPTA 3DMMB 2XGIA 1IAIM 1X5JA 1WTGT 4UOW1 1T1YB 4FQ2H 3TVMA 1QQDA 1C7SA 1W2PA 1XSIA 1HHKB 3KYKH 3LD8B 5C92A 3TH2T 5I0DA 4XPTH 1UD2A 2OBGA 3VWKA 2I27N 4ETQA 1RUAL 5T1KB 5HD8D 5HGHB 4JRXB 4ZO6A 2I07A 3FZUC 4DUXA 1EAPA 3IJYA 3S3JA 1HSBA 5KANI 1XF2B 1IKNA 3O3DA 3KPSA 1BZQK 3MRIA 1XFPA 4F7TB 2FNBA 4IRSA 4NZCA 1ND0B 5DRXA 5FUCC 3ZOAA 5IBUB 3UZQA 3V0WL 1OTSD 2C3HA 3NABL 4RFNC 1NGQH 4NHCL 1MIML 4DUVA 4W84A 1BJ1J 2Z91A 1RZ8B 4IRZL 4LVEA 5F7DA 1FO0B 4U0RB 2IGFH 3NVQA 4D0BB 2YEZA 5I73B 1T5WA 4YK4B 1MNUL 2W38A 4HIEB 4UU9A 3NCEB 3PWNA 2YDQA 5D1XC 4XAKE 1NC2A 4IOFC 4KV5F 2Q8AL 1A7BA 1H4PA 1YNLH 2NW0A 5D1ZA 3RL1A 3PP4H 3ZDXF 4D6DA 1JNLL 1VGKB 4WW2B 3X13B 1HI6B 5IVXA 1WCGA 4RMSA 4W7VA 5F6HI 3NSXA 1QSEB 3DURA 4B9ZA 2H32B 4X98A 5EULV 2VXVL 3RHWK 1CIUA 3PZOA 1UJ3A 2BVOB 4ZFOA 4MD5A 4IIQA 4R4BA 2ZOKB 5J12B 1KTCA 1LWJA 3VGAB 3LEXA 1FH8A 3MYZA 3PE9A 5LGJB 4LVHC 5JO5B 2Y2WA 4ACYA 4WFGD 2BY0A 3SKOA 3L3OB 3R1GL 3RWIB 2JFEX 4XGZA 4Y0GA 3U46B 3WEXA 1YC7A 3U7YH 4OI7A 5KVEH 1NGYB 3QHOA 5FYJH 4AL8L 1F4HA 3WIJA 1IQWH 1NAML 4KRLB 5DRWB 1AXTH 3FJTA 1IGJB 3G6JE 1S7XA 4EK7A 1NCUA 3AU1B 1C5CH 3P9MA 4KKLC 1IAMA 4EI5D 3BIBX 5D1XD 5LA2A 2X41A 4HWZB 4JKWA 1K2DB 2B2XH 3LH2L 5BROA 3QDJB 4R4FH 4V1DD 2H1PH 1KXQE 3OKMA 1PD6A 4L9LC 3UPRA 1WCBB 3AB0C 3TOPA 3IVKB 4P46B 2IGTA 4HWBL 2A3AA 3WKZA 3WKMH 3AWGA 5IP4A 5IJKC 3GRWA 1E27B 2XY1A 5GXBB 3KAAA 3S96A 5C6TL 4KI5E 2L4OA 1V3IA 5EUKA 2G5BB 3QIBB 2WK2A 1IJ9A 2YLAA 2C9AA 2ENSA 1YUHA 4PJIF 3CK0L 5T5FH 1NCWL 5D2NE 5JR1H 4LMQE 2MPAH 1EH9A 4PJDB 1E71M 3NZ8B 3S5LA 4L4TD 4NQSB 5HYFA 3HC3L 1MJ8H 4OLEA 4RGMC 4AYSA 1DQDL 2VLJA 4OCXH 4D9RE 1INEH 1A6ZA 4X8JA 1E4WL 2VLME 4XPGH 5IVZA 2EO1A 5C0BB 4TQEL 5GPRA 2ID5A 4MQ7B 3U4BL 1NAKL 2Y25A 1A6AA 4KXZH 3QI9B 5FCUH 2YBRB 1W9BM 1MCPL 5LXGL 5CZVH 2H6PA 1MLBB 4QRPA 3FN9A 3C08L 3QISA 1IGYA 4FZ8L 4HPOH 4ZE4A 3VPLA 4G8EA 3RTQA 3HAEA 3BUYA 4A6YH 1G7HA 1NBYA 3SDCA 3SPVB 5TFSL 5KS9B 3Q6FA 4KK5D 4JPIA 4JHWL 3IJSB 3BCFA 3WUEA 4KRPB 2EDKA 4HSQA 1FVCB 5HVGB 2XI9A 1U2YA 4ZD3L 5CEZD 2ZCHL 5SWSE 3UPCA 4GQPH 2GJRA 2WHMA 1US2A 4N0CD 2VZSA 1FP8A 2WHLA 4LEXH 5DR5H 4OGYH 2FLBT 1M04A 2WANA 1OP5K 1KGCD 3A24A 4U1NA 4L3AA 3PHAA 2Q6WB 3GKWH 3DX9A 4UAOB 5L7XH 5HOSA 3I02B 3AREA 1OGAE 4NBZB 5DMYA 2W07A 3EO0A 2W1NA 4ODVH 2QMKA 1KTLA 1UA6H 1NCCH 5MEQB 2E5EA 3BZFB 4JGMA 4XH2A 1I1FB 1S3KL 3L4ZA 5IROC 5E99L 2ADGA 1XR8A 2QLYA 1NP0A 1BFVH 5I2IB 4PSPA 1TTGA 4W6WB 4UQ3A 5CMAA 3FHQA 4Y89A 5FYLE 3IAQA 2JEPA 4E42A 3CH1A 4D9QD 5LBSL 3LXBA 4PBWD 2DAVA 3DUHA 1ADQA 2P47B 1LJYA 5DSCA 4PRWA 5DHVB 3T0BA 4N0RA 4X7SH 3MRLB 2ZUNA 4B3KA 2BMKA 2EDHA 3JWNC 1J5OL 2V38A 1HJUA 2EKSA 3GSNA 3C9NB 1YECH 4QRRE 3LN5B 4Y5VB 2IADB 1T3FB 4BH7A 1KB5H 1RZJC 1H3WM 4ZEPA 1Z32X 3BP7B 3QUMH 4X4MA 3MLTA 4LIQE 3H9SD 4EIZC 3HNVL 4Z2LA 4R5EA 1H3GA 1SEBB 2Q76A 4U7KA 4MD4B 4D0DB 4RRPG 2XFXA 3MLXL 3OXRA 4KTDH 3VXMB 1JNNL 1MHEB 4R97C 4GXUM 5BS0D 3RNQB 1U3JA 1K3ZA 5C0AD 4P4KA 4OCRL 3ZDZF 5GZOD 4JAWA 4IHOB 4LASL 4XPBL 3CMJA 2AJYL 3NCFB 4P3DB 2VLKB 4JO3H 3PV6B 4D0CA 2R2EB 5TF1L 4KMTL 4GAGH 1T1WB 2BVDA 4ZAKD 5LCVL 4JG1L 5C09B 1I7RA 4EDXB 2YN5A 1U8PA 3DBXB 4W4OC 4QHMB 2J8OA 3EYOB 3OGSA 3QUXB 3X11A 1FP5A 1IAKB 2WP3T 2NPLX 5E8PB 3BPNC 2A77L 4WI8A 1W9DM 4EN3A 3JWDH 2E9IA 4C4KO 3DETC 3DWTA 5CP7B 4G6AC 5IM7A 2EDJA 2OX5A 4Y4KB 1A1MA 3SE8H 4ZPTB 2R69H 4G6JL 3SE3C 1RJLB 3MJ8A 5FAAA 3VFWB 5KVFL 1LP9F 1QRNE 3O4LD 3WUZA 3W0WA 1HVQA 3L95B 4L5FL 4HIXL 2GCYA 4I4WA 4JFHE 4GKZA 4HA4A 1R5VA 1BVLB 1TQTA 2OL3L 3ILPB 3L5XH 4M61A 3VFMA 2ZUQB 3WN5C 5IFPA 3BEVB 4HPYH 1JPFB 1HXMB 1UGNA 5TH2A 4QYOB 4M56A 2DQUH 3TFKC 2C3VB 3HE7A 2H3NA 5HYQA 4LPTA 1EQPA 1KJ3L 4WU5A 5GRJL 4G8GA 3M17B 4NGHH 4ZUVA 2VDKL 3BI9X 5ACZA 1E4XI 2X2IA 5IHZB 4TSCL 4OUOA 1DP0A 3GSUA 1J1XL 4PGDA 2I5YH 1KQZA 3P0YH 3W6MA 1EBAA 5E6YA 1DBJH 1VEPA 3QXDB 1IC7L 1W0WB 1XR9A 2HN7B 5LAXB 2XSAA 5F1NA 5FV2A 3RIAK 1HINH 4G6AD 4YQXH 1S7VB 3DUUA 3ES6B 2YDSA 5GNXA 4UIMB 1NGWB 1FGVH 2FWOB 3K4DA 3ARBB 1KPUB 2R56H 5AZEH 1RZIA 5D8JL 3PG2A 2JJSA 4XP1H 4AIZB 1H8SA 4LGRB 3TGXA 4DUWA 1N82A 4G80A 3I2CH 1N2RB 3ALFA 1UOKA 4M6NL 1GC1H 4Y16A 3OA5A 3E6HB 4AY0A 5EZOH 4PRIB 3BHBB 2YD3A 5BRZB 3THML 3RJQB 3SOBL 4YHML 4OF0A 1GVIA 2WAHA 3S98A 4QFUA 5DUBA 4PJ5D 2CYGA 3GRWH 1DSFH 2PKDA 3BZEB 2DBLL 1F6LL 2R2BB 4AIUA 4MJIE 2BVPA 5FHBL 1QNQA 1MRFL 1DEEA 3RAJH 3REVA 2P24A 5HYJA 2XA8L 3TNMA 5DQDH 3FO9B 3ALGA 2DL2A 1MHCA 5GS0D 1OF2A 2YUWA 3ECBB 3A22A 1T0NB 1OM0A 1HIML 2D31A 3VMOA 5D6DA 4JZJB 2CK2A 4H2CA 4K94C 5DS8A 1KEGL 1BZ7A 4Q9QH 2JEQA 1WE5A 4D1JA 2R1YA 2FH6A 3B5GA 3LS4L 3LKRB 3JTSA 2A0LC 5D7JC 2AV7A 3QQ9C 4TUJB 5MERB 3WUWB 4WO4C 2C4XA 1FLTX 1JDAA 2Q87A 3SGEH 5C8BB 1YEDB 5I8OH 1TJGL 3MC0A 3D39E 3L5WB 4RRPA 1HXYB 4Q6IB 4WJ5B 5E56A 3MRJA 4JFEE 1FE8H 4WTXA 5GGVH 3KLAB 2CRYA 1QSVA 1DQML 3HAEH 1U8LA 5BXFB 3FN0H 4NKOA 2QV4A 4ZFMA 4P8VA 1NOFA 3I50L 2QTEA 5CCKH 4ODSL 2XPGA 2EDFA 4PRDA 1GHSA 4DZ8B 1LK2B 2V9RA 1F90L 3WHXA 3OV6A 1UYWL 1XCXA 3MROB 3PL6A 1C8XA 1EEZA 2NXYD 3R0NA 2LU4A 1W72A 1A6UH 4AXNA 2A6IB 4NO2A 4DAGL 3FT2A 4KJWD 4U2YA 1GSMA 3WUWG 5J0BA 3OAYH 3BZDA 3HZVB 4C56B 4OZHB 1RMFH 4YHOL 4D3CH 1I9EA 2GDUA 4MAYA 4EIGB 2VITA 3G6DH 4RMRA 1IM9A 2AK4E 1W9PA 5T1LD 3MBEA 1ZA3A 1NQBA 4NNYB 1U3HA 3U30B 3MZTA 4JANA 4Y5XC 4ZOEA 1QFWH 4O51B 2YD2A 5C0CE 1S8DA 4MZ2A 1J0ZA 1GOQA 5E2VH 4JM2A 4ATLA 3OMZA 2CH8A 3K80A 5EC2B 3K46A 4TTUA 3OR6A 1ISWA 5FOBA 2QPUA 1JWUB 1T66C 4KHXH 1HZHL 2J43A 4HLZH 2FHBA 2GUOA 1GXEA 5E4EC 5KOMC 3DVFA 4YR6B 4KKCC 5K93A 4GO8A 1A2YB 3II1A 4HZLA 5I5RA 3SKJL 1AD9A 4XX1G 1ADQH 4P5TC 4ZUSA 3RM9A 1YMHA 4XCYB 3C5ZC 1AQKH 1PKQA 1JF6A 4HZAA 5D7KE 3QIUA 3AMCA 1JZ5A 5B21A 3GHBL 3GSNH 1WBZA 4QT5A 1K6AA 2XJ7A 3NIDE 3CSGA 5A16B 1QPXA 1RQ5A 3UTTA 1Q1JL 1MVYA 4YHKH 4M62H 3GHEH 5C0FA 1A3RL 2DQGH 2Z0BA 1KNOB 4FS0A 3W81A 5IESL 2PW1B 3RDTD 5D70L 3DSFL 2OK0H 4GI6A 5HHXL 1RZGA 1JL8A 2D2OA 3ZE0E 4C58B 4AMXA 3FFCA 4QOKE 2VLRB 1GIGH 2GJZB 4BF7A 3FB6A 1RZJL 3Q48A 3ZYJA 2VAJA 3LV3A 2M8XA 1CDYA 2FIRT 4KHTH 5I8EA 5CJ5A 1RD6A 3ARFD 4H0GA 4LCWE 3DIFA 4NN7C 3CH8A 3FNDA 3V5DA 3GMRA 4K3DL 3O81A 3KYMA 3FT3A 3AQUA 3PZMA 1MI5A 1AQ0A 4BELD 1HHJA 1MHPH 1FZOB 4KKCD 2XG9A 5LGHH 4I3RL 4DEPC 2FDMA 5EUOA 4JG0L 3EOBA 1W1YA 4PRNB 4XNMA 4WHTA 1TFHA 4AD4A 4Q97A 5I1KH 2XM1A 2EIDA 1QBAA 1FYTA 3P9LB 4HKZA 1ZLWH 3KPPB 1BJMA 1W2KT 2V6HA 4LLYA 5HDBE 1EMTL 2X89A 2X42A 2D0GA 1LE9A 2R29H 3ZO0A 2CIKB 3KR3H 5DJCA 1R3JA 3APGA 5IW6A 3LKOA 1LO0H 4HF5L 3O6FA 2VDQL 5LA1A 1MFBH 2BY1A 3LB6C 3FOLB 5EOTB 4H88L 5F6IC 3S4SA 3TZVA 2PXYD 3FO2A 1P4LA 1KJVA 3DHJA 4J12A 4WNQB 5CP3A 3CSYA 4YO0B 4UQCA 3RIFK 4XP5L 4MA8L 5GJTL 4RQQA 1GGBL 5HI3C 5KTEL 3OGVA 1U36A 5C3TA 1K5NB 2JIEA 3NCOA 3ULUH 2DQTH 1A9EB 3SGDI 1U8KB 3VXPA 2CBUA 3PQYD 4P2QE 3GZAA 4PLJC 3RVUC 5ACLA 3P11L 4Z78A 1KTRL 3RDKA 3IU4L 5BRQA 3PP3K 1VPOH 3ZKND 3B5TA 1K9FA 4X5XA 2X4RB 5C0EA 4X7TA 1L8NA 5F3HB 2NY6C 1UB6A 3EFFA 2WB5A 1EHAA 2BZDA 4W70A 2NYYC 2VSCA 3VILA 4KUZL 5DRZA 4AMCA 35C8L 4WWKC 4F58H 2D0HA 4OUUA 4L4VB 1BECA 3GXFA 1YMMA 2UYLB 2Y5EA 3WL1A 5C0RL 3L3GA 5I1JH 5K59F 4L8SA 1AI1L 3N04A 5TDNB 4P23A 1DWAM 3LB6D 5A3HA 3WFEL 1CU4H 3QCUL 4K9EC 4OOZA 4A2LA 2CRIA 3O8XA 4PJ9D 4ELKB 1DBKL 5EO9B 1BP3B 1AY1H 3IFNH 1TFVA 4JGJA 4JFPB 4NUJA 1PX3A 1ZANL 3H8NA 5I78A 5HI3D 3A5VA 2D7QA 3N13A 2VXQL 3AVEA 4Q0XH 3SJVE 2ZX9A 4ELMA 4UDUB 1XF1A 4G6ML 4NQED 3G04B 4O9HH 4DGIL 3BMWA 3OZOA 1PJ9A 3V7AE 4YDLC 4UZGA 5L0QC 3GBDA 1F8TL 3LAFA 3G08A 4QEGA 3NIDF 3QG7H 1W9UA 1HWGB 4R96B 2BFVH 5AWNH 5JA9A 2WMHA 1G9MH 3UAJC 8FABB 4PJHE 1A6WL 4F7PA 3W9EA 2RIKA 1F97A 4E41E 3LX9A 5D72L 1T20B 1D5IL 3VDAA 3EYFA 4LSPL 4Z7VA 1FNSL 5T5NG 1VADA 4BFGA 4R7NA 3QXUA 1M4KA 5F7LB 2EKJA 5EU7E 4Y2OA 2GJXA 4P2RD 3ARDA 1OM3H 3WE6B 4MNKA 4NI3A 2QSTA 1F6AA 5EBWB 5IK3A 4HUWB 5EIQA 5ILTL 1AQMA 2E9LA 1QHPA 4EZMA 3FCTA 2LABA 3FMGL 4KKAC 4MNJA 3BPLC 2IAMD 1AE6H 4KDTA 4M8QB 3N12A 1DQJA 1V02E 4K94L 3DRTA 4ODBD 1KOAA 2BNQB 2J79A 4XNXH 1RIVL 1E6NA 4DZBA 1DN0A 5FYJE 5EU6A 5I75B 5DFTA 2X1OA 2P8LB 3WKNA 2R1WA 2J4WH 3DX3A 3MRCA 1R75A 2J75A 2NW3A 1EXUB 1JWMA 3U2SA 4PD4J 2BC4A 4NKDB 5CHNA 3QJFB 5A2JH 3RKDC 3T2NH 1A9BA 3NFPB 5I17B 3HPLA 3OL2A 4BH8B 5EC1A 2H9GA 3WNPA 3HG4A 1IGCL 3KLKA 1HYSC 2YPLB 5K9JL 5I71B 3ZJ6A 1QSFD 2R23A 4KQ4L 2BDNL 5BW7A 2VN4A 1W32A 2OR7A 4LOUD 4YDKL 1W72H 3UYRH 3HZMB 4CL7A 1U8QB 2R4RH 3ZTNH 4NWUH 3GI9L 4XWGH 2NZIA 1JN6B 1MCIA 5F9JB 1H5BB 4AISA 1GOWA 1I9RL 2FGLA 4FFVD 1K9TA 4UILH 3DO3A 4WK9A 1KFAH 4KKAD 1C8PA 5BV7B 3BGMA 3UZEA 4BSVB 4BZ2L 4ONHB 4EXKA 3SBWC 4QRTA 1VA9A 3V6OC 3QDGA 5DVKA 3PN8A 4AZBA 5AG9A 4BFEA 2VIRB 5KW9H 1V8HA 3FO0H 4Z7WF 3OXSB 1FSKC 4OIIH 2E7HA 2BSRB 2ATPA 1A6VH 3O6ML 3GMPA 1KIQA 1CBVL 1LGVA 1BF2A 3MRNB 3MV8A 2W0FB 3SDXF 5A6AA 1RIHL 2VDMH 3L4WA 3MA7A 5E6IC 1FCGA 3VXSE 1RY7B 4M1CC 3NFNB 3VXRA 4BQ9A 3AS2A 1RUMH 3VOCA 3U7WH 4M93C 2VXUH 2BSSA 2XNAB 3KPQB 5CJ8A 3GMQA 3BKMH 4POZC 4Y2DA 3SDDA 1RURL 1G7MB 5HBBA 1CLZL 1HQRA 5J7CC 5GRVK 2D3VA 5IB4A 3DDFA 2GYSA 1HJXA 5BO1L 4Q2ZB 2RR3A 3MJ9L 3OJDB 1IGMH 1Z3GH 4JDTL 2DPEA 4JFDD 4LARL 1B6UA 2W0LA 5IMKB 5IG7B 1JYXA 1BD2B 3WD2A 2A9MH 1B3XA 3OAZK 4TPRH 1XGQA 1BHGA 5HHQA 5L2KB 5L9DH 2CETA 2F7PA 4JZ5A 1AC0A 1TMCB 5HVHC 4AD1A 1SY6L 4YXKH 4HA3A 4RGND 3WF0A 3PJSA 1OAQH 3QUZC 5EBMA 1JHLL 4XP4L 1K6QL 3FQNA 1BQCA 3CDGA 4ZMAT 2EEDA 3IYLW 2ESVB 5FHAH 2C5DC 4LDEB 2P48B 3BH8B 3L5IA 5IFHH 3GGWA 3RNKB 2VVSA 4DM2A 4M1CD 1DANU 1YEJL 4PJFB 1DBAL 5D96C 3CZ8A 2EDLA 2WIIB 2PCPA 4POZD 5DJ6B 3IRZA 2V2XA 3O3BA 5ITBL 5EIIA 4PJEB 2JIXA 1E4XH 2ZCKL 4Z7UA 1R3KA 4ENEC 4WY7L 5D71H 1LEKB 3WNLA 1ZB5A 3WQWA 4UFHA 3GXTA 3DTXA 3IFLL 3AM8A 5J6HA 1N7MH 2V2TA 4H04A 2OWCA 3S35H 3QDMD 3VM7A 3N9GH 3UR8A 5E7FA 1MY5A 3DX7A 3H9HA 4XNUL 4R2GC 5GS1B 5KSBE 5EFDA 1HILB 5CIPA 3AYSA 2CMRL 3UPAA 5F96L 3MV7B 4Y1AE 1ED3A 2LU7A 4QCFA 1MELA 1JK8A 6FABH 3QUZD 4YHIB 2YPKB 2VL5A 5I76A 2ICWI 2OSLA 3N11A 2APBA 4GRWB 5BCAA 2UY6A 2OI9C 3TVMB 1N5YL 3NACL 3UMTA 3P2TA 5K9QG 5TF0A 2F54A 3KJ4C 4JL1A 3VWKB 5FGBA 2ICWB 3P0GB 1DWGM 1DBMH 3CUPB 4HWNA 2YN3A 1HSBB 5FECA 1UG6A 3CCHB 2X1XR 4Y19D 4FNPA 3D0LB 3E8UH 4RISL 4KAQL 2VTFA 2PO6A 5DRXB 2NXZD 3QSKB 4TTDC 4ENED 5HHOB 1U58B 3DROA 5CZXD 1W0VA 3LKSA 3T65A 4YE4L 3C6SB 5LQBH 4O58H 1KENL 3F12A 3O2DL 1QBLL 4UU9B 3A6BH 2YXMA 3GJEA 3LQAH 1DLFL 1NC2B 5K9KA 4I5BA 4JO4L 4NOBA 3BP5B 3KPSE 4GKLA 1XYFA 2AP2A 5JW4N 3U4EB 1HTYA 4WI9A 1A0QH 5GIRB 3QEQD 3M1BA 1NEZA 2P7TA 4K9EL 1XH3A 4P7QA 3MRBB 4ZFZB 1GZQA 1GOGA 4I48A 4X98B 3WS6C 2Q7YB 2BRRH 5DVLA 1A14H 1NCBH 1L0XA 2CLRA 4WFHD 4IIQB 1EJOL 5DYOA 1QLEH 5A1AA 4NO0B 1EVTC 1NM9A 4Q9RL 2P44B 4I18C 1N4XH 2XWBA 5ETUB 2Z4QB 2P5WA 1H09A 3O9WA 4HC1H 3C60D 5CJOL 5DD5L 4AZGA 2NQCA 4DTGH 2Y1VA 5F89A 3AJ7A 1DHKA 1U8OB 3MRFA 4AIEA 5IVXE 5ISZD 4OCMC 5JXEC 5C0GB 1P69B 4Q9BA 2GJ6D 3X12B 3MO1B 4WUUD 1ZGLA 2WMPA 1DVFB 5ABGA 4YBLB 5JW4R 4I8DA 1KBGH 2A1WL 3WH5A 4L3EA 4B16A 5J57B 2P5ED 3MANA 4Y4HA 2WMJA 1OD7A 2OR8A 3ELAT 3B8YA 4XC1H 3NDYA 3LXCA 1JGEB 3BJ91 3KWXA 3CUJA 15C8H 2B4CH 1KPVA 3UJIL 3VGDA 4Z2JA 1FVDA 3GH7A 1P4IL 1P84K 4OGZA 4ZFGL 2VC9A 2CUIA 3GM0A 1US3A 4FQQB 2XHYA 3ARVA 1CVRA 3LKPB 4QRQB 1MAKA 3RY6A 4PJ7B 4YAQA 2UY7A 4MNGA 2XQYG 4YXHL 3PXHA 4XPFL 5JZ7C 1YQVL 2SEBA 3HG1A 4PUBH 4OLWH 3B43A 4KVCL 3CDFA 2X4SA 3LN4A 4WSKA 4LCUB 1DDHA 2ALWA 4NPYB 2X7LB 5JXED 2DT0A 5EB8A 1JNEA 2LVEA 4RFOH 4JVUA 4LKCA 4PMOA 1MCCA 5HHMB 1J18A 3RVTD 5A8PA 4LK4A 5I1LA 4X9IA 1S7QB 3RPMA 3N0PB 2D1ZA 3MRGB 4BK4A 2FYYA 4G3YH 4YHZH 1E0OB 4UFKA 3IU3A 3GJFA 1Z9SA 4NQXA 3DUSB 4HFUH 1MCWM 4OZIF 4MVBD 2DQCH 3U6RA 4YN5A 4X83A 4N1EA 1O7SA 3G6AB 4ODTL 5CWSB 4NQCD 1E6XM 2QQLL 1T2XA 4QNPE 1A3QA 1IGYB 3KNBA 3L9RB 3RX8A 5EORH 3TJEH 4G8EB 2VLJE 4DWSD 3VG9C 4APQD 2FEDC 4J6RH 3PUCA 1CL7L 4P3CH 1VEOA 2VDRL 1U93A 1VSCA 4HAGA 5D1QC 1RUPL 1W1VA 5D7IF 5JZ7D 2IQAB 4UNVA 4WTWA 1AD0A 5TE6H 2VZOA 3WSQH 1WBYA 3F62A 1YQ2A 4AYGA 4JN2A 2V9QA 5T3XE 1DQLH 1QLFA 1UM4H 4QRPE 4QCEA 2I9LB 1ZLVH 4P5MA 5IR1A 1MOEA 4OCSL 4QKXB 5KSVA 3DX9B 2RJMA 1QWUA 2VRQA 5HDRA 2HFEB 3EJZC 3AREB 3CFKB 1JXJA 1OSPH 2BY3A 3LEYL 3SDAB 4MNQE 3C5JA 3X3GH 3GUTB 2F53D 5I6XB 4I77H 1RUKL 5E9DA 5I1HL 1B4RA 3BAKA 2APWA 4Q7NA 2JB6B 3FT4B 3O2VH 3FRPG 5DJ0B 5MENB 3U9PH 4HG4K 4PJCB 3PIQB 5C08D 2JALA 2PWDA 1IAOB 2CR6A 2FATL 4WHYG 4JM4H 2FX9L 1AP2B 3NCJL 4BFIB 3T1WA 2WBJA 2IXUA 4QHLB 3BRFA 5CMAB 1C92A 2O26U 3NFSH 4FNLH 3REWB 2OM5A 5I8CB 2YFOA 1VFOA 5CINH 3F7YB 3RJXA 1XGYL 2AJUL 4KZDL 1JG9A 4U2ZA 3V0JA 5I23A 1YA5A 3HMWL 3MCKB 2FBJH 1SR0A 1T22B 4JGUA 4M6AA 2IPUK 5CEYB 5MP6H 1A1OB 1ESWA 3NCYS 5IQ9B 3E3QE 3BD3A 3HI1A 1X5FA 1T80A 4XVSL 3BPOC 3BC9A 3JV4A 5SWQA 3CNKA 4UT7L 1N8ZB 2O61B 3EJZD 1NJ9A 2YL5A 4OKDA 4XCCH 3EJRA 2PTTB 4G43A 3V0DA 1MCWW 5IT2H 1JNDA 3I9GH 2YOCA 3GMLA 2CLZB 3JSSA 3TA3A 1S7TB 2Q76B 4Z77A 1XIWD 4UOQA 2A73B 2CKNA 2WNGA 1JGDB 4HMCA 3RWGB 3WY4A 2GSIB 1TQBC 4OBSA 3VIGA 5F1IA 2Y7QA 1Q4NX 1RZ7H 1UQSB 3L5JA 5A3IC 1OIMA 5E1HB 1BGXH 1CGSL 2FD6L 3PZNA 4FP8L 3M45A 4X4ME 2VT0A 4OIBA 2F7QA 2Z31B 4F7EB 3PZGA 3WIIH 2QADD 4PJBA 3P30H 1KGWA 1UWEH 3ZJKA 1WAAF 5HJ3A 5BMFH 2RAMA 3BUTA 2GY5A 1IT9H 3ZL4L 2XZZA 2C7UB 2BNRB 4LQFL 4D6GA 2EE3A 4ZOCA 5DD3H 2WZPD 3U82B 4UINL 1RHHA 4O2EB 1SMAA 1QNSA 2CDGA 2NY0B 1OY3B 1WZKA 5IM7B 2WXDM 3RWHA 5GZND 3RQ3A 5BOPA 3QCTL 2PNDA 5MI0C 5DJZB 3T0EC 1JZ7A 4ZXBB 1KLUB 1UCBL 4WTZG 4PJ8A 4G9DB 3RL2A 3U48A 4WFEE 3P40A 4PR5B 1NOWA 2I60L 2VVNA 1UM5L 2HAZA 5C07A 2YFNA 5B38B 2R8SL 4OB5L 1OAKL 5HXMA 1MWAA 3JWOC 4M61B 2DLIA 3N06B 3PWVA 3ARGA 3LKQA 4LSSL 5A3ID 2V5CA 3KS0H 1JGLL 3WD1A 4FABH 4NKIL 2MTPA 3MXVH 2V2WB 2LFGA 2J78A 5BZXA 5IUSA 1GGIL 1FZMA 3HE7B 2H3NB 5C2BH 1WZAA 4RMUA 1FV1B 5H94A 5CZKA 4XI5C 1HHHA 5D4YA 2AJXL 4S2SA 4U3HA 4B0MM 2OW6A 4YHPB 3W0WE 3I84A 4A2MA 5JHDE 3D18A 1H8OA 1AGFA 3WV0A 1MREL 4WHCA 2JJTA 1DBBH 1W3JA 1XCTA 5A2BA 3MOQA 4EEEA 1PIGA 5EU4A 4NZUH 3ULUE 1EAJA 3BSZH 1UACL 3PWUA 5B38G 1RFDH 2DQIL 3MUZ1 1VGEH 4PMXA 3X3FL 3TBWB 5IDIA 4O02H 3O11B 4G8GE 3GO1H 2VDLH 3P4MB 4P2OA 3U0PB 2PF6A 1FIGH 4CD4A 4RA0C 2EXWC 4ZFFA 5DUPL 2WWMC 2OYMA 2ZUMA 5SV4A 2LE9A 3ULVD 1AKJA 5KG9A 1MFEL 3IDNA 4LVNC 3GSXA 5KSAA 5F8RC 5KEZA 4LHUA 2RHEA 1SJEB 3TN0B 4EVNB 2MQ3A 3CFEA 3FRPA 5IW1A 2QLVB 1CICA 4JLRB 1FLRL 3MRHA 4HIHA 4JPWH 2WZHA 5I1AB 1AQDA 1NAMA 5TPWH 3QGVA 1I8IA 4OZOA 1Q9OA 2X09A 5F1SA 1W1PA 2BVPB 1PG7L 1C91A 1VF8A 1M1SA 5KBNC 5I1CH 3SQOH 3AZSA 2F5AH 4I0PA 2WUCH 3REVB 2MWCA 4Z2GA 3EOTH 3MRKA 4OTXH 5B3NA 5AC5A 5DHXB 5IHUL 2GAZB 4TOYL 2JCCB 4FTVA 1FZKA 2D31B 4U7SA 4X9BA 2A3BA 2AEQH 3P73B 2DDQL 1VENA 1P7HL 2ADIA 4H1LA 3HE6C 2EE2A 1A3LH 4PP2B 2IALA 4HX1A 3D85D 2O5ZL 2OZ4H 1FORH 3MV9A 4HWBA 3VWJC 5HVWA 4LSQL 4NSKA 3V4VH 4EI5B 2FJGA 3GNMH 4XXDB 4Z7NE 3KLLA 2D22A 1PQZA 3GJFH 4Y5YA 4LPCA 5HYJE 1CS6A 1DUZB 3D9AL 5CLTA 3RGVC 4U1KB 4P8XA 2FX8L 4N8VG 1ONQA 4P59L 4CNIB 5CSUA 4GW5A 4C7GA 5EA0L 1NMCC 4KY1H 4R26L 4R0LB 1MQKH 4OAWB 3UBXA 1U8LB 4UZSA 1MH5A 1O7AA 4WW2F 4OLVL 3WJJC 1JYVA 3SCSA 1T7YA 3KYKL 4BQ8A 1UM6L 3C8HA 3EOYG 4QLJA 4JO1H 5TDPB 5E2WL 1T89A 3W11C 2GJJA 4MSWA 1JPTH 2IBZX 2V5MA 3SGJC 4FQXC 3R4DA 3OAUH 1F4YL 3VXUA 5ICZA 1K8IA 4YDVA 4PJGA 3MPCA 1O7VA 4L4TB 1QWNA 4UTFA 3UG4A 1ZT1A 3B3IA 1CLVA 1LL6A 2OR9L 3KXFD 3ABZA 4P8UA 3SDYL 3NA4A 4UFLA 4NRYB 1RULH 1FRGL 1MVUB 3TYGH 4PS4H 2DH2A 3KLHD 3QULA 1I4FA 1NDMA 1IM9B 3STZA 5FFLA 4PGEA 4LCYB 2ORBL 4L29B 1Q0YL 2D7NA 4GUPB 3D50A 1Y6KR 4K3JH 2ZX6A 1CFTB 3RGVD 1S8DB 3AMKA 3UJJH 5HBFA 1IZJA 3OPZL 4WTZA 3AB0B 1RVFL 2J8UB 5AD0B 2IFFH 1HCFX 5FGSA 1YNTA 5JQ6H 3GBNL 4C54A 4RGOL 5KAQG 4GRWH 4JDVA 3KE0A 4ZDHB 5IMMB 3ULUF 3ZKQD 4AG4L 5BXTA 5IVNA 1ZLUH 3WLWC 4CVXB 4KJPD 4HHAA 2F2HA 2FSEB 5A6KA 3W11D 5CJXA 4WUKL 4S1RL 1DFBL 2G60H 2YK1L 4FQXD 2JB5H 2ZOXA 2BHYA 3VFPB 3IB4A 1N0XL 2HVKB 5BZDA 3PGDB 4QT5B 3K81A 4GBXC 4ACZA 1SEQH 4H5SB 4AT6A 3GIVA 2EDYA 2LTQB 1OSZB 3I6GB 1C12B 1J1OL 4PJDF 5ADPL 5C0FB 4LCCC 2DRUA 4PREA 3DX0A 5MEOB 3VCLA 5TQ0H 4QGYA 5D7SL 4RIRA 5AG8A 2F19H 3HZKA 1OP3H 1BM3L 1TQCC 2R0KH 4AMWA 1C08A 1U42A 4KROC 4LSVL 3HG2A 3W53A 1PKQE 4BA0A 1B0WA 2YUVA 2ZUYA 3MLZL 2ADFH 4LLUA 4XCEB 5E5MA 5I30H 4HGKC 3BPCB 5INCA 4DN3L 2EDTA 3CXHJ 1MCQA 4NOFA 1SYSB 5EOQL 5AYUH 3ZR6A 4JRYA 3UTTE 3FT3B 3IDMA 1GGUA 4GMSL 1YY9D 2VQ1B 1LO5B 2DYPD 1JNHB 1N0LA 3TC9A 1HHJB 3OG4B 3CVHL 1P6FA 3ARPA 5CJBA 3ZKMC 1QBML 3JUZA 3WLWD 4NT6A 3V6FA 3FFCE 2QHRH 4EBQH 5KS9F 2VISA 1V08A 3WL0A 4YFLI 4RAUA 2VKWA 4OGXH 4GQQA 1S5HA 2H41A 5E0FA 3QIWA 4U5KA 3CMOL 4W6YB 1QLRB 3JTTA 5FYKD 1NCAH 4GBXD 3UETA 3LSOA 5I15H 1M03A 1V6UA 2X4NA 4OCWL 1MI5E 5IW6B 3GYCA 4AZIA 2VWEC 2DDXA 1KXVC 5EUOE 3QEUA 4JKPH 3PHOA 4M48H 1FYTE 4KROD 3PHSA 3M6DA 4AIOA 4FFYL 4HH8A 3BYYA 4HA1A 5BS0B 3DC0A 1BAFL 3QH3B 5JPNA 3EZ8A 3KPOA 5C0AB 3MCLL 3FB7B 5HPMA 1RUAH 5FXCH 1I1AA 3MR9B 4BSJA 5JIPA 3QFJD 3JWOL 5IIEA 4LEOA 2XN9D 3WLBA 1AC6A 4N8VA 4ZAKB 4LYPA 1B3WA 2VZ3A 4M1RA 3NABH 4X5XB 4NHCH 1NP2A 3DGGA 1MIMH 2QSCL 3P0VL 1UB6B 4IRZH 2CUMA 1KXTA 4BJLA 1FL3A 1BLNB 1CK0L 1XGRB 4ZSOA 4B7LA 1MNUH 2A6JB 4K55A 3L3JA 2JELL 3MLWL 4XZUB 2OL3A 1M7IB 4Z7OF 2PYED 4UNUA 3HUJB 2EO7A 2Q8AH 1CGWA 5L7XL 2QEJA 3GSQB 4NP4L 5BXSA 1JNLH 3O4LB 2GSGB 4P2CG 4MDIA 4PRAA 4G8FB 3D2UD 4H8WL 2AOSA 1DN2A 3ZJ7A 1WZLA 3ZLQC 5L88L 4GQRA 4QXUL 3DMMC 4PMUA 4WEBL 2VXVH 3QWOB 3HN3A 3LN9A 3CFDB 4GJTB 5DJYA 4NZFA 3OR7B 2DS4A 3RILA 1KJ2L 2FECI 3LD8C 1YMME 1ZHNB 4LDLB 4H8VA 3CHCA 1UWSA 3D69A 1DCLA 1U91A 3R1GH 1EFXA 2AS5M 1V0NA 5IEKA 1WB0A 3QO1A 3VA2C 3C5SB 3NBNA 1EFQA 4AL8H 1E28A 5FKYA 4WHYH 2BVYA 1NAMH 3FONB 4MHHI 4PJAA 3F6LA 2F8OA 3RVVC 1F3JB 1I3UA 2RFXA 5C7XL 3L2MA 1ES0B 1GYAA 4GXPA 5INDB 4ISVA 3M8OL 1WAWA 1AGCA 1UWGL 1QACA 4PRPD 1W91A 2YWYA 4U0RC 4ELME 1SYVA 4OM0L 5I73C 5I9QB 4U3XA 4YK4C 2G4FA 3LH2H 1JZ6A 4N0FA 4JAMB 5CSYA 4J3OC 4PJXB 3ECQA 5I66B 4H1LH 1KCKA 4NO3A 4OF6A 4GW4B 1RK0A 1F6AB 3ETBF 3KPLA 4IRJD 4AD0A 1JFHA 1AGEB 3L3KA 4HWBH 4WW2C 2QKIA 5FA3B 3AIUA 3GB7A 1PZ5A 1XGPA 1FH5L 4L9LA 3UTOA 1B2YA 3WXVL 1OPGL 4DZBB 5C6TH 4NC1C 4XX1E 3VXTB 4M7JL 4W81A 4Z7VE 5T1KD 4J8RA 5J12C 3I6KA 5DMKA 3WO4B 3OKYA 4M9OA 3VGAC 3CK0H 3MRCB 3H3BC 1NCWH 5IJKA 5CS7A 4U05A 1LK3L 2BC4B 3BP6A 2Z93A 1HNFA 4HDIB 1A9BB 1I3VA 3PNWB 3ZT6A 1T04B 1CVSC 2XWDA 2WMGA 3BKJL 3HC3H 2H9GB 4MHHG 5C70A 1MAJA 4HAFA 4WEMB 5FA4B 2DL9A 3HCVA 1B6DA 1DQDH 4CU7A 1TPXB 1CI5A 1ZAGA 2D73A 1E9LA 2R23B 1E4WH 2HTLC 2Q86B 3IJHB 5KOVC 4TQEH 3MSDA 1CD8A 5FL1A 1Q6EA 3EAKA 3U4BH 1NAKH 4F33B 1MCPH 5LXGH 4K68A 1Z2KA 3L1OL 1NFIA 2OP4L 4JB9L 3D3AA 3C08H 1F02I 3MI6A 2VOTA 2CKSA 3AGVA 1BEYL 1J05A 4GRLD 4FZ8H 1QBBA 3O45B 4NCC2 1QG3A 3HNSL 5A8OA 4P46C 3V0HA 1QSED 5TFSH 2C8NA 1A6TA 5F7MC 4JHWH 3B4NA 5DK0A 4PYSA 1AO7A 1D5ZB 1XV8A 2O5YL 1ZGLP 3VFGL 1B1YA 1WUNT 4ZD3H 1QRKA 2QMJA 4NC2B 2ZCHH 2F61A 1QD0A 1ZT7B 3QIBC 1XT5A 3T77A 1KTDB 4HK0B 1WFUA 3OB8A 3BH9A 1KIQB 3H9ZA 3LQZA 3UTSA 2DM3A 3MJ7A 4N9GA 4YHEA 1MFAL 2FR4B 4FK9A 1M7DB 2CXKA 4C7FA 3VFSB 3ZHKA 2GT9B 3W9DB 1UG9A 3E0GA 2NXYB 2XOTA 3GH5A 3QDGE 1WISA 5KSUA 5T1MB 4KI5D 4GKOA 2LV4A 4E0RA 4X7DC 1DEDA 3W4RA 2EIEA 1S3KH 3OKEB 2VO5A 3QI9C 3GBLA 2J1KA 4S0SD 4ZTOL 3H9SA 5E99H 4OD3L 4UV4L 1KB3A 3MV8E 5EZIL 4CJ1A 2J71A 5FYKL 5F9DC 1HKIA 4XHQA 5T1LB 1FFRA 2J25A 1E3ZA 1A4KA 1DL7L 3VXRE 5IROA 5LBSH 4OV5B 1SBSL 2WLYA 4KRPC 1XD1A 2VLMD 3FQXA 1D6VL 4H0HB 3IDXL 1DZBA 5AZ2L 1J5OH 5ITFB 1G9MC 1NUFA 4M7ZB 3TLRA 2F8XC 5SX5K 3EJUA 4OKVA 2C4FT 4F7MA 3WDQA 5E00A 2R1XB 2APTA 2H2SC 3MNZB 2EABA 1KIPB 1LMKA 4UAOC 1RIUL 2CKBL 2AKRB 3HNVH 1S9XA 3G5XB 3CU1A 3MLXH 4K7PL 1JNNH 4C59B 4GG6A 2HA1A 2GI7A 4GAFB 1CG9B 2NX5A 5H2BA 1E0VA 1R3KB 4FQHA 5HVFB 2XN1A 3WFBL 3RDTB 3BCDA 3DTXB 4OCRH 3AHZA 2CPCA 3PXJA 1B0RB 4LASH 4OZHF 1E4JA 4XPBH 2E40A 1I75A 1L7TL 2AJYH 4U1IA 4KK6C 5TF1H 4KMTH 4R4NC 1KC5L 4RBPK 5I1EL 4Z2KA 2ZICA 6CGTA 5LCVH 4JG1H 4U1HA 4HOXA 3I75B 4YEEA 3ARFB 4U1MA 3EMZA 2DH3A 4S1DC 5FIPA 4BQCA 4Z7UE 2ITCA 1FVEB 1GGCL 1UR1A 2FJHB 4AD3A 1L0YA 4TX6A 4IMKA 4HGMA 3VRIA 5IOPB 2A77H 4M6ML 3SKMA 4WI4A 3WNKA 4YC2B 4BK5A 5M94B 3HG5A 2QQKL 3W6LA 4JFXA 4W4OA 4Y5VC 3SUSA 4CDHA 2P42B 3K1KC 3VFOA 3VNZA 1TNNA 4G6JH 5DVMA 4HKXA 3G5YB 2E9MA 2FL5A 4G6FD 5KVFH 3D3VE 2YBUA 2IJ0C 3P77B 5ABEA 4L5FH 2PWFA 4U3CA 4HIXH 5DEGB 2Q8BL 1P1ZA 3MGTA 4LSUL 4U7MA 5FGCB 5GRWA 5J1AB 2DMBA 1CD9B 3H9YA 4MXQC 2HG5A 2YD7A 5DK2A 2Q3AA 1LEGB 3IDJB 1SHMA 3DDGA 1BREA 4HKBB 1TQVA 3WF1A 2E27L 4QRRD 5FKAB 1AIFA 2F54E 5DEFA 1NANI 3KPMA 1T21B 4PGJA 3VD4A 5ABFB 1MFVA 4R4ND 2XXCB 4UIKL 2HT4C 2PXYB 2XG5A 4PLNC 1KJ3H 5GRJH 3WF2A 1JDDA 3JBG7 2VDKH 1IAIL 2HRPL 3W29A 4MMXC 4LU5L 5D8ZA 4LLMA 4LVOB 3V8OA 1J1XH 4LPYA 1NEZB 5FO8B 3L3IA 4WGWB 3KPRA 4FMKA 1GQLA 3QUXC 1IC7H 2IANA 3PQYB 3FOMA 3STLB 2KZWA 4I48B 2WINA 5JPMB 2J7EA 4QF1B 5I19L 3O41A 4AK1A 2JLLA 4NX0A 3W39A 2FJFA 5D8JH 4Y4KC 3EOAA 4ATDA 1IE5A 3WUGA 3RBSA 5IMOB 5DA4A 3BLKA 2WV3A 4MXQD 4YHNB 1AHWB 5M3WA 1K4DB 4M6NH 2DWDB 4ZS6C 4PMZA 2ZUQC 1ZGLB 4B3LA 3MGOA 4U6HA 2WVVB 3N17A 5F3BA 3THMH 3SOBH 1FO0L 4YHMH 2J7DA 3BDBA 4HGWA 4PJ9B 3CUHA 3G5ZB 1ZBVA 1ZGLM 2P5WE 2DMKA 4X0NA 4PJIA 2HFFB 1QRND 1ZTXL 1SFSA 2DBLH 1BQHA 2EXYD 4GI9A 4NQEB 5C0ND 5FM8A 2JF7A 5FHBH 1MRFH 1UWXK 3U36B 3RZCA 1WVZA 3FN3A 4I2XA 2XA8H 3MOBL 4GAJL 1NBZB 1IILE 2EADA 4NBYB 1DWFM 3HC0A 5T1DL 4IJ3B 4L3EE 2VRAA 1HIMH 2YD8A 1KEGH 2NZ9C 1YZZA 3O3AA 3ARBC 3DGCR 4NIKB 3LS4H 3QOMA 4K71B 2EYTB 2X4SB 1ZS2A 3P4NA 3U0TA 4GLRI 3KZSA 2XXMB 2DKUA 5T3ZL 3VDHA 3R06B 1NUNB 1IT0A 5D7JA 1TJGH 4P2RB 1JUFA 1QVOB 3ISWA 1CDHA 1FBIL 4RNRB 5F6HJ 4HZ8A 5HNNA 4WO4A 1X44A 2FIKA 3OB0H 4MNGE 2DSVA 2VX4A 2ARWA 3D0VB 1KCSL 1J0HA 1DQMH 4HP5A 1C90A 2IAMB 4JFWA 3HG1E 2BK8A 3MTRA 3NN8B 5GGUA 4MDOA 4CDGC 1E6OL 3GSOA 4ODSH 4M80A 2C3WA 5T5NF 4AENA 1LEIB 1EPFA 4DCQA 1F90H 4X6CB 1UYWH 4OLXL 4GXVL 3V5HA 2BJML 5ID1B 4YHGA 4QTHA 2W60A 3A6CL 5L0QB 4G9FB 3VFTB 3QHZL 1U93B 4DAGH 4ZPVA 5JW4M 1LWHA 3GNRA 4KKBC 1A5FL 3T4YA 3PWPE 1HVXA 3CV5A 4F9JA 4HQQL 5EBLA 3D5OF 2IQ9L 1QSFB 1TVBB 4JZJC 1P7KB 4YHOH 1TG7A 3QQ3A 4PG9B 5D2LA 5J9PA 2DLFL 2LAAA 1J8HA 4MS8C 4OZ4A 1MW0A 3VX0A 1XGTA 4JY4B 3VA6A 5F9WB 3VXQB 3QUKA 4BZYA 4MJID 1T0OA 4PB0L 3N1FC 1S5IL 3CDYA 5B39G 1V3LA 2YXFA 5GJSH 1NL0L 4W86A 1JRHI 3WMBA 1FL5B 3FB8B 1X3DA 4P49A 3IDUA 1J01A 1F2XK 1HZHH 4Q6IC 4Y5XA 5F72S 4L9DA 5A6LA 5A8QA 1D9KB 5DJ2A 3HZYA 4X5LA 5AUMA 5E9AA 5IFAL 1NFDB 1XF4B 2JE8A 3SKJH 5SWZB 4ZG1A 4C7DA 4KI1A 1Q9LA 4XBGA 4N0UA 1UXSA 3U7AA 4OV6F 3BUPA 4L8CA 1X7QB 2GITA 3NUKA 4ORGA 3VD7A 5JUEL 4DN4H 3ARWA 5C71A 3MRRA 3C8KB 2BNUA 5DJAB 1HE7A 2UZYB 3IT8D 3GHBH 2H8PB 4F79A 3B5HA 2V5YA 4KKBD 3U9UB 4P5TA 3D39D 5E9DE 2K7QA 3EO1B 1Q1JH 2YD4A 3QEHB 3TPKA 3C5ZA 3L5HA 3MJ9A 4NRXB 4JFED 1A3RH 1JVKA 5JNYA 5L6YL 3E2HB 1KYOK 5IESH 3BN9C 2GTWA 5D70H 1KFWA 4MS8D 5HHXH 4P4RA 5ICXB 3JV4B 3CFBA 1RZJH 4HCRL 5FUZL 5GGTL 1NARA 3U30C 4X99B 2BX5A 5M17A 3C2AL 2EYRA 4IOSD 4M1DL 2J3SA 2AK1L 5D5MB 3RM4A 3A6OA 1HXKA 4QLRA 3NGBB 4K3DH 5HGDA 5DTFA 3TA3B 3ZTJG 5GHWL 1TVNA 4OFYA 4ZUWA 4RWYL 2ZPKL 2J88L 3NJ3A 4I3RH 3X14A 4D8PB 3WS3A 4JG0H 2PWGA 1AXSB 5DDHA 2VH5L 2AK4D 3MNWB 3G9VA 1E5JA 1JV5B 4RGNB 4DOHE 1EMTH 3MJ6A 3HG3A 3JVGA 1P7QD 1TA3A 4FNSA 1I8KB 4OFPA 5IHBA 4FNRA 5C0CD 5FO7B 2X40A 4PJBB 1E4NA 1SBBA 1LP9A 2MCPL 2BVEA 2DQEL 4GXUN 4HF5H 4C56D 3WDIA 1F4WL 1WJ3A 3VTRA 2VDQH 3BQUD 4M93B 3SKNA 5JDJA 5E70A 4FQIL 2YS4A 3O3UN 5I16A 1GOIA 1Y18B 1OAYL 3CHFA 3QNYB 4C83B 3RPIA 4YUEL 4H88H 1ZJBA 1AFVL 4WV1B 4XB3A 4U1LA 4URIA 5CSBA 2HISA 4ZOBA 3AFLA 4XP5H 4MA8H 5D7KD 5GJTH 1GGBH 5KTEH 1R46A 3AZTA 3PZTA 4AEHL 3RL2B 2BV9A 1J0IA 1OP9A 1MSPA 2E8YA 3P11H 3U57A 1QP1A 1MWAB 4V2BA 3S3SA 1OGAA 3IFOA 3IU4H 3ZZ1A 1EHLL 2HJLB 1WEJL 4OGAC 5ANMB 3OKOA 1IFHL 4W7UA 4QOKD 5CD5D 1CTNA 3LZFL 3OKLA 1FP9A 4HUKB 4GINA 1H5VA 4KUZH 5JBDA 5EO1B 2YJQA 35C8H 4LCWD 4S2SB 2ICCA 1QR1A 5C07E 4YIQB 3DX2A 5MEPB 1Q0XL 2XRAL 5C0RH 3WH6A 4NZTL 4FQJL 4ZYKA 2A6DA 1AI1H 3S37L 2X1WL 1YC8A 4WWKA 4Y4FD 4HS6A 3WFEH 4PJFF 3QCUH 4Y19B 3O2DA 2GDVA 4WI5A 3QEGL 1D5BA 2GTZA 3TPUA 1I7TB 2BOCB 1DBKH 2OXHA 3GM8A 3OKNA 5JW5A 4PCTA 2NXZB 1UVQA 1PG7X 1ZANH 4P5KA 1MCEA 4GG8A 3QUYD 3ZIZA 1GPFA 1J1PL 2VXQH 2QSVA 3AROA 2UUDH 2VB5A 4G6MH 2AMGA 3V5KB 4DGIH 3HB3C 1WDSA 5EU5A 5DD6B 4OLUL 2EDXA 5B39A 1LILA 1F8TH 3BESR 4NKMB 4O2CB 3VFRA 1IM3A 1BGGA 4PY7B 1AKJB 1FFPB 4ZNCD 1S7UA 1MCDA 4LHUB 4X4YB 4OQ1A 3QEQB 1FNHA 5BZWA 2R4SL 3F5WA 1A6WH 1BOGA 1HH9B 3RHWF 4X0KB 4Z5RB 1FFOB 1A21A 5D72H 1D5IH 2XVKA 5EO0A 8CGTA 5TJWK 1I8IB 1LO2L 1FNSH 2NNAB 4LSPH 2GSJA 5CILL 2MHAA 2VQUA 4GRWF 3CFJA 2WPGA 4FQLL 1E0XA 3DVNA 4P2QD 1HKKA 1X6LA 6A3HA 3C60B 3CZFA 4YZFE 5ILTH 3RWDB 2MSPA 3FHAA 3ZE2E 3FMGH 1T83C 4JVPA 1IC5L 5ISZB 2GJ6B 4K94H 2EC9U 3CFCL 3G9AB 4XMLL 4HBCL 5CBEB 3Q3GA 1RIVH 3DRQB 4U6TA 3ZMRA 2W9EL 4WUUB 2HLAA 1GGTA 1D5MA 2Y06L 1FZJA 1BGAA 2P5EB 4CAGA 4YGAB 3DJ9A 4HU8A 1BFOA 2EPLX 1IGCH 3UDWA 2H2PC 1W9XA 4PSRA 3HPJA 1ZHLB 2GK0A 2AXJA 3GZKA 1MFDL 4FTVE 5JDSA 1U8JA 5BJTB 5IMLB 5K9JH 3HS0A 3NPSB 5ESVB 4KQ4H 2BDNH 5JMOC 4YDKH 3IS0X 2P45B 3AWFA 1AGBB 4XBPA 2R39A 3MV9E 3O6AA 1HH6B 3GI9H 4LYQA 4MSWB 1I9RH 1CD1B 3D25A 5I1DB 4OZGB 4YDVB 1DJSA 4PJGB 3GI8L 4JFFA 4BZ2H 3VGHA 2DWEA 1HOCB 1Q9WA 4E41D 4NJ9L 3OX8B 3OLEA 3QULB 2E6QA 5I75C 5I1IL 3VIMA 2DQDL 2DQFA 3CZGA 1C5DA 3O6MH 4WVRA 3SBWA 1CBVH 3V6OA 3M07A 3BP4A 3VXUE 3EDKA 3KHQA 1U9KA 1RIHH 2H2PD 4F2MB 4A4AA 4NQCB 3W37A 4HWUA 4HLJA 1Q6FA 1MCJA 4NM8L 5I71C 4OFKA 3G5VB 3QDHA 4KJQD 4DWSB 3C6LD 3FQWB 4APQB 1RURH 4XZBA 1CDGA 4PTUB 5FYJD 1CLZH 5JORA 3KDMB 2AW2A 4BQ6A 3HRZA 5E6IA 4UQBA 2NLJB 2A38A 4QY8A 5BO1H 5E8NB 3MJ9H 3T4AB 2HMIC 4JDTH 4LARH 4NHUA 1H5BC 3GXPA 3CPLA 3EIFA 5E4IA 2VAAB 3EGSA 3TTOA 2WLZA 1IC1A 1G7QB 1QOKA 1ZHBB 1R5WA 2GW5A 4LCIL 3VXOA 2J7HA 1S9VB 5BV7C 1D5XA 2C1OA 2ZUVA 2BNQD 4E8CA 4X9FA 1SY6H 2XKUA 1P4BL 2R2HA 4YGVB 2F53B 1JHLH 3EJYC 4XP4H 1K6QH 3BAWA 3PZVA 5DRNA 3T0XA 3HJEA 5F7UA 3TH3T 3BEWB 4R90H 4MCYA 1JI2A 1GGYA 5C08B 3L3DB 1ZVSB 1YEJH 1DBAH 2YPLD 3JV6B 4UOZA 2VDOL 4F8QA 2W9DL 3DXAA 5ITBH 4NYLB 3RY4A 2NW2B 2ZCKH 7A3HA 3TTYA 1OB1A 1M01A 1NWRA 2EYSB 2VMFA 4TVPL 4WY7H 4L8DB 3R8BB 3SCMD 3D4YA 5D9OA 5JIKA 2HMID 2XZQL 1INDL 1KUMA 3IFLH 3IXTB 4EUPA 1ZS8B 3FB5B 2Z9TA 3IFPA 5DGRA 3SCWA 32C2A 5I1GL 3WBEA 5A6MA 5ESAA 4XNUH 1L0QA 4JFOA 4JRYE 3SO3B 1PY4A 2NR6C 3VXSD 1E6PA 2CMRH 5F96H 2EE9A 2DI8A 4CW1B 1MCRA 3QEUB 3VE0A 5DUML 1UWTA 3ARXA 4LBEB 1UJTA 1CXLA 5HY9A 3B6SA 1GOKA 1B0GA 4N42A 2OS7A 3TO4A 5BQ7A 5B22A 3IAGC 1XIWB 3V0FA 1ZWIA 1OTTD 3SY0B 4XVJL 1B3YA 1N5YH 4PMDA 3NACH 1QZ1A 1X5YA 1K4CA 4NUGL 1BPLB 5C9JB 4CVZB 3BXNA 4OQTA 4CKVX 2HJKB 1WCQA 4UQAA 4F80A 3MYJA 4TUOB 5DZOA 1I1AB 5D7LA 4PJCF 4IOIA 2G9HA 2JJVA 1TZGL 3NZHL 1F11A 4LEOB 3RX5A 5IIEB 3WLBB 2QADB 4KAQH 4RISH 1LE5B 1JHTB 5DQ9A 1UA7A 1XRVA 3ZJ8A 1R86A 1GZPA 4CU6A 1CFVL 1BX2B 3T1FB 2EIZA 4E5XA 3MJGX 3HFML 2BY2A 4YE4H 2CJUL 1KJMA 1S7WA 2NY7L 1WDQA 1L6XA 2VLLB 1KENH 4L1DA 3O2DH 1QBLH 3WJLC 1DLFH 1T2JA 3NMEA 5GS1C 4IPLA 3CZEA 4JO4H 2DKMA 4O4YL 3BYTA 2WHKA 3IGAB 1HJQA 2CPUA 2X4QA 2KPNA 4K7PY 4YDJA 4K9EH 5ALCL 4DK6A 3TNNA 1ITXA 1AGDB 2AJ3A 3TVMC 4ZS7L 3VKKA 4ZSOE 5FUCE 1EJOH 3WO3B 4MGXA 2XICA 2WIMA 4QGTA 4Q9RH 3U7BA 2F74A 3VWKC 3FQRA 3WS6A 1G6RB 1WQVT 5CJOH 5DD5H 5EFFA 4PBVC 4Y1AD 4AC1X 1KB9J 1NWUA 2GIYA 1ZJAA 4UOW0 2CDFA 2H26B 2YRPA 3QRGL 3QFDA 5EZJB 1F4XL 3CLWA 4I18A 1IVLA 4FQPA 1JTTA 4V1DE 3KLDA 1UWRA 2VDNL 4MB5A 1S9WA 2A1WH 3VRLF 3PDOB 3Q1SL 1NC4B 6TAAA 2BRQA 2UZIL 5GS3A 1KT2B 2ZWLT 5FF6A 3UJIH 1E4LA 2MKWA 1K9EA 5MI0B 1X5LA 1I7UA 3D48R 3WFCL 5HYSB 2XWJA 2OTWA 1Q72L 1P4IH 4PJAE 2N1KA 4TSAL 5HGAB 4ZFGH 1R34A 3BD5A 3BUBA 4BS0A 3SCVA 2Z8SA 2AABL 1L0PA 3TVMD 1M05A 5FK9A 4LDOB 2V9TA 5E5RB 3LRMA 2EDQA 1UKOA 2AXHA 3Q5TA 1CFBA 3RZWA 4YXHH 1WKYA 3AAZA 4YNYA 3ZTJH 3VWKD 4IIQC 5D9MA 4XPFH 5DJXB 4N8PA 1YQVH 5DMGC 1QHZA 1V3MA 3TO2A 5EPMB 4KVCH 3MKKA 4G8IA 3KPSD 3O2WL 4FXGA 5L2JA 1NDGB 4IRSD 5A2CA 5IEHB 1WC7A 1UWQA 4YPGA 4LHJB 5JTWA 4FNQA 5EH1A 4PBGA 5LJYH 1DVFC 1FJ1B 1RI8A 1FNEA 4YBLC 4KZEL 2FO4B 4JKKA 4GT7A 2YC1A 3OZPA 3BZ4A 4ODXB 4JCMA 2DIBA 4Z7WA 1NC2D 1O6IA 1TJHL 4ODTH 1J11A 2EH7L 2QQLH 3D85B 5D1ZD 1FGNL 3H53A 4HFWA 3GMMB 4AWEA 1MHHA 5HGBA 1S7RB 3GSVA 3SDXA 3JUGA 3MQIA 3RX7A 4HV8A 2GFTA 1CL7H 1RZFL 1YEHL 2VDRH 1FCCA 4B41A 1RUPH 2AQ1A 3TBYA 1VACA 4MJ6B 4AM0B 3WH8A 3ZYOA 3GSWB 5DMGD 4NO0D 4N90E 5IF0B 4NO5B 5I77A 2QR0A 1SJVA 2RGSA 5J13B 1ITCA 5D1QA 4D6CA 4AZ5A 3WY2A 5DI8A 5F88B 4ODUB 1A64A 2DSKA 2YD6A 3QHNA 4AZCB 3F7VB 3UTSB 1TCRB 2XTJC 4OCSH 3I3EA 4ZUTA 3M46A 1FAKT 1U30A 3KYOA 4J1UB 3KPNB 5BVJB 2ZIDA 1E4IA 2I9TB 3LEYH 1OGTA 1AO7E 2BCKA 1RUKH 2ZSVA 5I1HH 12E8L 3H3PL 3LPFA 4EKXA 3IK2A 2R0LL 1TR1A 4U6XB 1KN4L 4K7FA 5IB2A 1SVZA 1PIFA 1UWIA 3KXFB 3S97C 4LSRL 4D9QE 3WFDL 2JCCF 2FATH 2FX9H 2FEEI 4W87A 1M6OA 4MA7L 3AIVA 3NCJH 2R0WL 1T03L 4FXKB 4WLCA 5BV7L 1LNUB 4LXFA 1XCQA 4QRUA 1NMAL 1XGYH 2AJUH 3QP3A 5J4MA 4KZDH 4TX8A 5DJ8A 3IXAB 3HMWH 2UY4A 2BVQA 3CJJA 4L3CA 3PWJB 5HHPB 4WCYL 5DT7A 3P4OB 4JJ5A 3H6JA 3L3HA 5E94A 4K2UL 3IF1B 4YHLL 3B9KA 3H9SE 1WV7T 4XVSH 2XTJD 1MFCH 5DWUL 4PP1C 5LYRA 4FG6C 1YN6A 2EO9A 1P9MC 4UT7H 5J6GA 3QZWB 4JZOA 3UJTL 1BFTA 3ZHDA 5E00B 5CGMA 3THDA 1NGZA 4GAYA 2YUZA 2VLJD 3AREC 2F15A 1S9XB 4QHUB 2DQJL 5I6XC 2J12B 3RWEA 3MO4A 5K9OB 1B88A 1UQYA 4NQDA 5D6CB 4E9LA 1GONA 1DUYA 5SV3A 3OF6A 3ARSA 2Z1KA 3VJ6B 2GK1B 3ZE1F 2QF8A 3VMPA 5FUOL 5T3XD 4QRPD 1NWTA 5CEXA 3EDEA 5EBGA 2NMSA 4F7CB 4U1SA 1CGSH 2FD6H 4FP8H 5HI5D 2D4FA 3OKKB 4N0YL 3CVHA 1HJSA 2ICEA 3RTQD 3SDCD 2AEIT 4WRLA 4DVRL 1WK0A 4S3KA 4AZHA 4TRPL 1D6EA 3BAYA 3PABB 1G7JB 4U1MB 2Y72A 3BWAA 5GRUL 1VHPA 4QRSB 2NX5E 3ZL4H 2DYPB 3CVIL 1X5HA 3A3HA 1ORQB 4LQFH 5I6SA 2B31A 3I85A 2C4FU 4FG6D 5KVDL 3GMOB 4UINH 4MJ4A 2CO7B 3DX8A 2AJZA 3HI6L 4GQ9L 4PGBA 2W65A 2F1AA 5DXWA 2DKSA 3QCTH 1LHZA 3DV4B 3ARED 4HKXB 1U92A 4ORZC 1UCBH 4F3FA 5F8QC 2VCBA 1BMGA 3MUGB 3SE9L 2I60H 1UM5H 1CXIA 4KK9C 1MCFA 2R8SH 1ITBB 4OB5H 1KLGB 4OLYL 1OAKH 2VABB 2ZNXA 3AY4C 2HG5B 1QW9A 3T0EA 2BSTB 1PW3A 2CBIA 1FNGA 4LSSH 4AEEA 1Y0LB 4TVDA 1JGLH 2DT2A 3WQ5A 4NKIH 2DTML 5FCSH 1QI5A 5SX4H 1GGIH 4Y8DC 1HHGB 43C9A 4K23L 3RIFF 2AJXH 2Z31C 1A7RL 1F4AA 2PTVA 1LD9A 4HUVA 2NY4D 2X4UB 5IB1B 5CQ1A 4F9DA 2ZX7A 1MREH 4DVBA 1J0KA 1DANT 2CKBB 1R24B 3QFJB 5IWLC 1UACH 2X70A 3L4UA 1A7QL 4KMLB 3K2UL 3IS1X 1XZ0B 2DQIH 2NY0C 2DF3A 3X3FH 2BSED 1T7ZA 3EOAB 2OJZL 3CC5A 4JQXA 5DD0L 4KK9D 1UZ1A 4ZXBC 4F15B 5C8JB 2VC2L 2EEAA 5DUPH 4PGZA 2PYEB 4R8WL 1H3VA 3KPRE 3QXAB 1SQ2N 2IANE 1MFEH 4OFVA 4PJ5E 1KJ2A 3QQ4B 1YYLL 1H0DA 4P4KD 4YFLF 3MGOB 2GJPA 2JKXA 3TV3L 3ZSTA 3D2UB 1HNYA 4HGWB 1FLRH 4ZO8A 1HEZB 3TBTB 5GNYA 4UNIA 3HE7C 3PHQA 4WFED 1G7LB 4X6DB 3ZO9A 4M3KB 5ID0A 2V5RA 2J47A 1PG7H 1T4KA 4M02A 4YXLL 1CCZA 2BFGA 3UXFA 4DGYL 4R3SA 2Y4SA 5IHUH 1NBVL 2IBBA 4AH2B 4TOYH 3R0MA 2G5RA 4EN3D 1S7SA 1YPZB 3HC0B 4NRZA 1T1ZA 2DDQH 1OTSC 3O3AB 1CE6A 1X6NA 2NTFA 4PGCA 2O5ZH 4PJIE 2G75A 4AMKL 4OZIA 4LSQH 4NQVB 3W0WD 3P4NB 3U0TB 3DYPA 2V17L 2O9OA 3FTGA 1MJJB 1QKZL 3AS0A 2IWGA 2NT0A 3HE6A 4I2XE 3KWWA 3D9AH 2XFFA 2VXTL 3AIWA 4YLQT 2FX8H 3VWJA 3AS3A 4P59H 9CGTA 1T0MA 3FAXA 2HYMA 3HUJF 1DCEA 5IJVB 3TN0C 5EA0H 4IRJB 1MW1A 5D7IA 4RZCB 4R26H 3QO0A 2P8PB 3HE7D 1QA9B 1T1XB 4WHDA 3RGVA 3SCTA 4OLVH 1C1EL 1EZVX 2G2RB 4G8GD 5GGSY 3V52L 4MDJB 1UZ8B 1UM6H 4RMQA 4BSWB 4GZJA 4H26A 1YDPA 5E2WH 1EEYB 5FL0A 4Z8FL 2VERN 3CIQA 1E4KA 2ZOLA 1YY8A 4YX2L 1N5AB 4MADA 4KDWA 2W60B 1F4YH 2Y6SD 4FOMA 3RO8A 1PY9A 1FC1A 2JF1A 5FKPA 3RI5K 3GMNA 1MQ8A 4MA1B 1I8MA 5CJQL 2OR9H 5F7WC 3FQUA 4FQXA 3SDYH 5D6DC 1FRGH 1ZSDA 2P46B 3B2VL 2YA1A 3T8XA 4KC3B 1BTCA 4WDIA 2ORBH 1H2JA 1Q0YH 4EI5C 1M71A 2ADJB 3LPOA 5FM4A 5EN2B 5F7HA 4HMEA 5E2JA 4Y16D 4GZIA 3OPZH 5IXEA 1KELL 1SYTA 2ZJSL 5J8OA 1C8YA 1RVFH 2WW5A 4I9WE 2DOCA 3TN0D 3K8KA