2YOCA

Crystal structure of pula from klebsiella oxytoca
Total Genus 335
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
335
sequence length
1051
structure length
1051
Chain Sequence
DVVVRLPDVAVPGEAVTAVENQAVIHLVDIAGITSSSAADYSSKNLYLWNNETCDALSAPVADWNDVSTTPSGSDKYGPYWVIPLNKESGCINVIVRDGTDKLIDSDLRVAFGDFTDRTVSVIAGNSAVYDSRADAFRAAFGVALAEAHWVDKNTLLWPGGQDKPIVRLYYSHSSKVAADGEGKFTDRYLKLTPTTVSQQVSMRFPHLSSYAAFKLPDNANVDELLQGETVAIAAAEDGILISATQVQTAGVLDDAYAEAAEALSYGAQLADGGVTFRVWAPTAQQVDVVVYSADKKVIGSHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPDGWDNLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAGDSNMVQHLKTLSASGVTHVELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLNQLKQSDSQDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTTRIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMGYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDSVRGGGPFDSGDALRQNQGIGSGAGVLPNELASLSDDQVRHLADLTRLGMAGNLADFVMIDKDGAAKKGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKASQEADLATRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRISDDGSNYEVITRVKEMVATPGEAELKQMTAFYQELTELRKSSPLFTLGDGSAVMKRVDFRNTGSDQQAGLLVMTVDDGMKAGASLDSRLDGLVVAINAAPESRTLNEFAGETLQLSAIQQTAGENSLANGVQIAADGTVTLPAWSVAVLELPQGEAQGAGLPVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PULLULANASE
publication title Structural Basis of Pullulanase Membrane Binding and Secretion Revealed by X-Ray Crystallography, Molecular Dynamics and Biochemical Analysis
pubmed doi rcsb
source organism Klebsiella oxytoca
total genus 335
structure length 1051
sequence length 1051
chains with identical sequence B
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
A PF03714 PUD Bacterial pullanase-associated domain
A PF11852 DUF3372 Domain of unknown function (DUF3372)
A PF17967 Pullulanase_N2 Pullulanase N2 domain
A PF18494 Pullulanase_Ins Pullulanase Ins domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yocA03
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yocA01
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2yocA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2yocA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yocA04
4GLRI 3Q5OA 2WUCL 3AHVA 4ATWA 3VFUB 4C7DA 3LAFA 2XG5A 2GJXA 3OGOE 3RY6C 2DI9A 3FB5A 2AKRA 4F7CA 1HKLH 4DOHE 1QVOB 2O5XH 1LK2A 4KGJA 4RBPK 4HG4K 4WW2B 3POHA 4JY4B 1ZA3B 1KUMA 4WSJA 1NMBL 3A4WA 3A4XA 1P4LA 4HS3B 5A6JA 4JR9H 5GS0D 1CL7I 5CHNB 3OKYA 2CO6B 5KW9L 2DQUL 2A3EA 1NBVH 3UO1L 1OGAE 1BFOA 1NBYA 3O2DA 4JM2F 4JRWA 5J11C 1P69B 3GSXB 3R1GL 5E99H 3RVWD 4YXLH 5IBUG 3WELA 1CZ1A 1VFMA 4K55A 3HI6H 1N7MH 5ANME 5L2KE 3WEOA 4I0PC 4FNRA 4OLZH 3HC4H 1MEXH 4PJ8C 5DMIL 5AG9A 1CE1H 3OJ2C 3VW3L 2V3GA 3PBGA 4P59L 5LJYH 2YD3A 2YEZA 4W68A 4PMYA 1X5XA 2FH8A 2FX9H 2VLME 4HEME 3LKNA 2VABB 4NNPL 3VNZA 5C07B 3RFZC 4PGDB 4ORGA 5DK3A 4U1SA 5DMGC 4HU0A 1H5VA 1SBBA 3ARFD 1TJIL 1QLRA 1R5IA 1Z2KA 4ZTOH 5IMMB 3MUIA 3O41B 3QQ4B 1W72L 5E09A 4TVPE 3THMH 1CXIA 4ZUVA 4OB5H 3U46A 2VL5B 3VFWA 5E95B 1YEDA 3FQUB 4RE3A 1U8NA 1JWUA 3WUWB 3SDDD 5A2CA 4N8CL 1XAUA 3UYRL 4PGEB 3DMMC 4RNRB 4LU5H 4N0RA 4YXKL 3CH1B 4EI5D 4UFIA 4MYWB 4NZJA 4XP5H 2QLVB 4LLVA 1JPSH 2YWZA 3WIIL 1HJSA 5EU4A 3X13A 1BFSA 4AIZA 3S88H 1I1FA 4RFNC 4G8GB 4JKPL 2DQTL 4XNXL 3SHSA 1S9WA 3LKPA 4PY7A 4FXLA 5SWZB 1DWAM 1YPZF 3PP3H 1A6ZA 1DTUA 4QXWA 1W9VA 5CIPA 4QLKA 2XRAL 4AMXA 1BP3B 2GITB 2VXSL 1E40A 4K3HA 4U6XA 1DQLH 4MA7H 2XI9A 4I18C 3QEUB 1YJDL 2VIRB 2XA8H 4XGZA 3T4AA 4KAQL 1FE8L 4RGNC 2A9NH 4L8SA 1IVLA 3OXRA 4NCC2 2Z8VC 1BZ9B 3TN0A 1TTGA 1ZLUK 3OGVA 4Z7QE 4UU9A 2DTML 3QUXB 4S10A 1I4FA 4GG6E 4QAWA 1GOQA 2AJZB 2EXWD 4HUMB 1CVRA 2EZ0C 3PL6A 2PCPB 1J8HB 4KJQD 1RK1B 3KPRD 3MR9A 1UJ3C 3GSVA 4I77H 5F7EH 2NTFB 4K7PL 4YH6A 5DEFB 1W3JA 3VXSA 5F1OB 5DD6A 3FFCD 2NY5C 2MQ3A 3KNBB 2C1PA 4JLRB 3G6JE 2ZG2A 4JVWA 3V6ZB 4PFEA 4PUBL 3SEPA 5IEKA 2DH2A 4U6HA 4YBQD 4BQ5A 1UD8A 4JFDB 4CNIA 3GXNA 3BLBA 1JZ8A 3FY1A 3AHYA 3OGRA 2AEIT 5FCSH 3U1SL 3E6FB 4S3JA 1MHHB 2P5EB 4Q22A 3WD1A 3HUJE 4I0CC 3VFNA 3D6GA 2DM2A 1EMTH 2X4NB 2L7JA 2E7LC 4RFOH 1RSFA 4W4OA 1L7IH 2NY0C 4JFOA 5FM5M 4Z0XA 4KKLC 4YHEA 3MRLA 1U2CA 5L2KD 3LN4B 2ZUWA 1I7TA 1ITXA 5DC4B 1DDHB 3KYKL 8A3HA 1YNTA 2EKJA 4HBCL 1R24A 5L88L 1KIPA 3MRRA 4TUOB 5IVNA 2YZ8A 1C16B 3FHAA 3CAFA 4XTRC 3FTGB 1R5WA 3QWRA 3IGAB 3WIFB 2DDXA 3TH4T 5L2JA 1UWGL 3OG4B 4JO4L 2VLMD 1I1AC 2EACA 2BCKA 4N8PA 5H2BA 2D3LA 3O9WC 3IANA 3WFLA 3QNXB 4BZ1L 4NN6B 2Y72A 1W9DM 4MJ6B 1CXKA 4DWSC 1M05B 5IROA 5T1KA 2ESVB 4TVPD 3TZVD 3WKNA 4LPCA 1UENA 2ZSVB 1WCBB 3WJJC 1UACH 5DK0B 5EC2A 3IDIB 2ZXAA 4MAYB 2FDBP 4M8VA 4PREA 4NIKB 2A6KA 2A74B 1LWHA 3KLSA 4PV9A 1MELA 2DPEA 3CHFA 1ORSB 4KI5D 4P2RB 2EDKA 1T6WA 5DZOA 4JANA 4UDTA 1AD0B 3RZWA 4HC1H 4IHOA 5IQ9A 2YRZA 4H1LG 1C12B 2FBJL 1FO0H 1Z9MA 2DLEA 4M7KH 3EJYC 1WT5A 3V4PH 3KYNA 3CZSA 4KROD 1FZKA 1DE4B 1MLCB 2VQTA 3VRJA 2W9DL 4BKLA 4EUPH 4AWEA 4AK1A 4YX2H 4DVRL 3O3DA 1WCQA 3O8XC 3MS8A 3V6OA 1IAIH 1OWWA 3C5JB 2EIBA 3VFRB 3MJ9H 4HXAL 3SDCD 4PMDA 2EXYD 5EO9B 2F19H 3PWJB 3DV4B 1NP2A 1ND0B 3F7YB 2W0FB 5SWQA 5DK2A 3OR7B 3T0WA 3MCLL 4WU5A 4OZGA 4DAGL 1MCOL 1FH8A 4OQ1A 5DEZA 1KFAH 5IK3B 2VH5H 4MZ2A 1H5BA 3RWEB 4OLYH 4MDIA 3WUGA 4GAJL 1NGPH 5F96L 3AQUA 3GO1H 3MU7A 2AK1H 2AJXH 4D0CB 4OJYA 5C08E 4XP6H 3CGTA 3ARDB 4OOUA 3VXQB 5I15H 4I5BA 1UWXH 2SEBA 4F37F 4GOSA 5CZXD 1QBLL 5JO5A 4WKHA 3TV3L 4I3SL 4R0LA 1ZANL 4WKAA 3WH7A 1CBVL 4HMEA 3OPZH 4KK9D 2NZ9D 3F58L 5K9OA 4P2OD 5GRVL 1T22B 4F33B 1FV1B 2VE6A 1GGCL 3WUWA 2HT2C 4KJYB 4GINA 2A6DB 4ZSOB 2BC4A 1HCVA 4JHAL 2VDRH 3T0XA 4HTYA 2FX7L 3T08A 4KMTH 5HYEA 2YUZA 3B5HA 3IXTB 3ZYIA 4LQ1A 4TPRH 5T3ZL 3S3SA 3V6BR 3U0PA 3IFLL 1VDGA 2LAGB 1FDLH 3JXAA 1P6WA 3PV7A 4P99A 1J11A 2Y23A 3AXXA 1AI1L 4G8EB 2AJUH 1NJ9B 4TN9A 4TVSa 1VGEH 2HG5A 1VESA 1WK0A 1XGRA 4JHOA 2J71A 3ARGC 5IQ7H 1KPVB 1GPOL 2ENYA 3S5LG 1RZFH 2YKKA 3VILA 3GSWA 2BNRD 4Z5RA 3HU7A 2NY6B 3D2UD 5DVOA 4U6YB 2FSEA 3GSUB 4J3UA 1NLDH 4HAFA 2WMFA 5E8NA 5I1JH 1JF1B 4EQ3A 3BAIA 5I6XB 3VPLA 4KV5E 1WDRA 4U1LB 3QR2A 4HUVB 1UA7A 3PWVB 4WHCA 5DQJB 5E7FA 1RIUL 1ZS8B 1LGVA 2VAJA 1TTFA 5EU7C 3GRWA 2FJGB 4D3CH 5IB1B 1NH6A 1FZMB 3VVGA 4PJ9B 4U49A 1U8JA 4YE4H 3FO1B 1UM6L 4JLRA 3EYSH 3QQ9D 5AWNL 3GZAA 5TD4A 3V79C 3KPPB 3O45A 5I66A 2VZSA 5KSAA 1URLA 5DA4A 5DC9B 3GDBA 4KXZI 5EU6A 4UOQA 5GRUH 4UV7H 3N1AA 5E56A 4PMVA 3LH2H 1S9VA 2WUCH 2AS5M 3AIVA 5GISH 2BVDA 2XPKA 2X0HA 1RZ7L 3RPIB 4PJDE 4B5EA 1LEIA 5EZOH 5T1DL 3MREA 3QDJA 2IGFH 2DYPD 5C7XL 1NMBH 1WAAA 2VXVL 4TNWF 5IFPA 5DHYA 1U93A 2OL3B 2C3HA 2W60B 2OX5A 5C0ND 1TITA 4L4TA 1JYXA 4RL3A 1LNUA 4Y5XA 4BA0A 2V7HA 5KVFL 1W32A 2VURA 5FGBA 3RI5F 3UO1H 3BVTA 4Z7VF 4LRNL 3R1GH 2DIAA 5KN5A 4FNLL 2VZUA 3FB6A 3BZEA 4ACYA 3SGDI 5CPQA 3VD7A 4H8UA 4X7TA 1MAML 4FA8A 3QNXA 5H37G 2FYYB 3WKZA 5AC5A 4HGMA 4A6YB 3GUTA 5DMIH 4ELME 1LP9A 4PP2B 4P59H 1XGPA 3NDZA 3D87B 1U3YA 2LV4A 2I25N 1CFTB 4V1DD 4G80A 3V6FA 3OKKB 1S7QA 1JPTL 1FFQA 3RNKB 1C5CL 5IHZA 4HZLA 1MCLA 1QTYT 3RIAF 4NNPH 3V5HB 3H42H 1F8TL 3MC0A 3UTTA 5B39A 1IGIL 2W63A 1GVYA 3JUGA 1CDHA 2PYFA 3A6BL 4K94C 3NCYS 4QF1A 2XTJD 1QG3A 4FMVA 1W72H 4JY6B 1T3FA 3W5MA 1AD0A 4U1GB 1F11B 3BT2L 4D71A 1PZ5A 1MH5A 1G7IB 1JFQL 1R87A 4AIOA 4N8CH 4P48A 4BQ2A 4UQ3B 1WDQA 3UYRH 1XZ0A 2DL9A 5BS0A 5DVMA 3DYMA 1HL9A 1YEKL 4GQPH 3FXYA 4YXKH 2J7BA 2D22A 4DFHA 5TGBB 2EE6A 1HI6A 4EEEA 1NFDF 3CUPB 3UEZA 3WIIH 3GI9H 5HDQL 3TA3D 2IANB 5KS9F 4RGMB 4QT5B 5BRQA 4JKPH 2DQTH 4XNXH 5ENWA 4MA3A 5ITBL 2LU3A 1SHMA 4XXDB 3QXDB 5ISZE 1RPKA 5IHRA 5CLWA 2XRAH 1IAMA 2VXSH 1T4KA 3MUHL 5EOQL 4I18A 3LRLA 1DQTA 4B15A 4CMHB 3ESUF 3AAZB 2EDLA 4NKQB 2FHCA 3W27A 2QQQA 3RGHA 4KAQH 3A5VA 5ERWB 1FE8H 4OIBA 2QADB 3UTSB 2YD2A 4QCIA 3WFCL 1KCRL 2ZWLT 4FXGB 4K8RL 5IGXL 3CMJA 4JRXE 3LVEA 4OIAA 4TX8A 3BN9C 5L0QB 3STBA 5C2BL 1I9JL 4W7WA 3FFDA 2R23B 5LGKA 3QXAA 1QYGL 2D31B 3EOTL 4S2SA 1RP9A 1E0WA 3WO3B 4K7PH 2Y8KA 1NWRA 5A3HA 3SKMB 2D7OA 4PUBH 3QUKB 4YDKL 4ZXBD 2XWJA 3VH8B 4OCWL 3QRGL 5CJBA 2X4OB 5DLML 2GTWB 3CIVA 2ZPKL 5EB9A 2X4RA 3U1SH 1GVIA 2HFTA 1IRAY 3VJ6A 3QZWG 2FLRT 4LHUA 5HI3D 3IJ9A 4N42A 3KPSA 4P7RA 4HJ0C 3F5KA 1C8XA 1YY9C 3D5HA 3CDGA 4UUJB 1GJWA 4PJBA 1MVYA 3KYKH 1FN4A 4HBCH 5L88H 4WJ5A 5AUMB 3PZMA 2XKNA 5FKAA 4NZRL 1JDAA 3ULUD 1I1AA 3OR6B 4LLQB 1UWGH 5KOMC 5IW1A 4HKJB 4JO4H 2FH6A 3O9WA 2UVEA 3HRZB 1OTUC 1ZS8A 5HTSA 3QSKB 1OQXA 2KDGA 4X4YB 4UOW0 4BZ1H 5C2UB 4NQEE 1IARB 4GO8A 1NDGA 1YNLL 2YDRA 3G5YA 4NO3A 4IRSC 3LHPL 2DSZA 1G7PB 1PSKL 1G1YA 4X6CA 4E41B 3OBAA 4HULB 3VFOB 3CSGA 1HEZA 5ETUA 4M8QB 5F44A 3L9RA 1BVNP 3ISWA 3WFDL 1UUQA 3TV8A 2VISB 1N0XH 2IQAA 1UA6L 4HMDA 1G6RB 4GKOA 1JTOA 2PWFA 4WO4D 4GW1B 1VIWA 1YDPB 4A2LA 2CO7B 1FORL 2BNQB 3UXFA 4Y1AE 2FBJH 3P4NB 2DKMA 4JFED 5ISZD 1O7AA 1MREH 3FO2B 1KJMA 3RDTD 3SQBA 3BH8B 1FG2B 4CCDA 3HE6D 5HI5D 5I1LA 5CBAB 1NOUA 4LCWB 4IIQB 4HXAH 2D3NA 4GQ9L 4R9HA 2ZE0A 5IUSA 3O6FD 3QA3B 4GRLD 1AHWB 1HXYB 1S7VB 2X4UA 4IOIB 3TBWB 1MCEA 5HNNA 4PUEA 1BYCA 5I8OL 1FYHB 1HSAB 5MEPB 5A8QA 4OF3A 2FR4A 4RDQF 4KI5F 3MCLH 4GBXC 4A6YA 1X7QA 4DAGH 2A0LD 1EIBA 3KHOA 1N6VA 3IK2A 5EO1B 4KK6C 5M95B 4MJIA 1R3JB 2VCBA 2GJ6E 4NQVB 1K9FA 4GAJH 5F96H 3QNYB 4ZAKA 1PKQB 4JEGB 3PJSA 4RX4A 5EBWA 1RZIA 2EIZB 4HS8H 3BP5B 3EJPA 1X6NA 1ADQL 1C5BL 1I9EA 3H2WA 4E2OA 3MA7B 3TV3H 1FC1A 3MO1B 1ZANH 3B9KB 4Z7WF 4LRIA 1CBVH 3F58H 1G7MA 3DJ9A 4JZ5A 4Q74A 5J9PB 1JVKA 4O2CB 3WN5C 1MWAA 1GGCH 1LD9A 4K94L 2BOBA 2PXYD 1L4IA 2WWKT 3IU3A 3ARBB 5FO9B 2IJ0C 4NYLB 1JWMB 2FX7H 3FB8B 4Y7EA 1MVFA 3IT8D 2ZCHH 3EMQA 2E4TA 1PQZA 4R97B 1A0QL 1CTOA 2BJML 3LKOB 1KTDB 4PMUA 3C6LA 5T3ZH 4NRYA 3M46A 5BXFA 3EO0A 5HJ3A 2J8UB 2GFTA 4POZC 1XHGA 4PMRA 3NSMA 4NPYA 4ODUB 2F53B 3TONA 4PRHD 1TA3B 5C8BB 4FQCL 1EEYA 4HV8B 5FDYA 4NKIL 1U2YA 1Z3GL 4C56A 4UMGA 3Q0HA 1ZA6A 3BGMB 1GPOH 1E27A 4PTXA 4P3DA 3WH6A 3FOMB 5C09A 3AAZA 3IDGB 4NQED 3AC0A 4D9LL 1E71M 4YHPA 1QO3B 5IBLC 3BUYA 3WDJA 1X44A 1J0JA 3HUJF 4AD2A 1FNEB 4WRLA 3ARSA 1WWAX 1D9KB 4YBLC 2ZUQB 3HHRB 3RVVC 3QHNA 2WMGA 1RIUH 4NCC1 5FYKH 1HDMA 3DI3B 3MNZB 1PBYA 3D39B 1X5FA 3VIJA 1NAKL 3QI9B 3GXIA 3QXVA 5EBLA 3QIUB 4Y1AD 1UM6H 5A94A 5AWNH 1B3JA 5HHOE 1MVUA 1WGOA 4Z0BL 4YAQA 3MLYL 4MLSA 1HHIA 1F4WL 1ZHKA 3VXUE 3H9SE 4N5EC 3GMMB 4HZ6A 1UB6A 1SBSL 3F8UB 1T2QL 1YY8B 2IG2L 3BP4B 5D4QA 4P23B 5IOPB 4D1JA 1RZ7H 2OR7A 5F7MC 1NAML 1ORQB 1HH6B 5IFJA 1HQ4B 4QHLB 3VMPA 4QKXB 1XR8A 4TTDD 5C7XH 3RMEA 2VXVH 3ZDZF 5FYLE 3MOBL 2D2OA 3PZGA 1CYGA 1HWGB 3OF6D 4KDTA 1TZGH 1JGEA 2EDEA 2X42A 1ZHNA 3EYQD 3VRLF 3EJUA 1LG2A 4LYQA 2CLVA 2AXJA 1OSPL 3IETA 4OLUL 3WEZA 2WIIA 3NGBB 3U5UA 5KVFH 4WU7B 2PR4L 4IDJL 1DQQA 3HMWL 4BZ2L 2E7HA 3B43A 4KTYA 4JRYB 3QPQD 2Y8VA 1QFUL 4LRNH 1Q9OA 4CUCA 1LO0L 4FNLH 4Y4FD 3HRPA 3G04A 3VXNA 1A9EA 1IKNA 4JN2A 1KR0A 1MAMH 3BLKA 1PY4A 2RBLA 1PG7L 4DQOL 5CMAA 1S9YB 4JZOA 5ESAB 1N8ZB 5F9DC 1LG1A 2DJ4A 3LDBB 3T1FA 5ITFA 4S1RL 2NX5A 5TPWL 1R5VB 1JPTH 4NHCL 4F2MA 3IFOB 4L9LC 2GDVA 1T1WA 1F8TH 4F8TA 5B4MC 1IGIH 1EGJL 5HGHB 4XCCH 3A6BH 3LD8B 2EDXA 1XH0A 3M07A 4HGWB 2FATL 2XN9E 4YHYB 1P84J 5FIEA 1UR1A 1I3GL 1TCRB 4KK5C 4N0FA 1JYNA 3BT2H 4G6ML 4UFMA 1JFQH 1ES0A 4NRZA 3VXRE 4HKXA 3WEXB 3DWTA 1JZ7A 2J7CA 1X5ZA 3HC0A 2GDUA 1K8DA 1W3HA 1MIEL 4UZSA 2X4TB 2V2TA 3KLAB 1QWNA 2PYEE 1QSFE 5DJYA 4PG2C 3MBEC 1I9RL 4IS6A 3QT2A 3ZKQD 3VXSE 2R15A 4XVUC 5HDQH 4TVUA 2E9JA 2FECL 3ZE1E 4P4KD 1G94A 1G0XA 3FT2A 5DURD 2R4SL 2I24N 2DMKA 1TIUA 1VFUA 2CBIA 2BZDA 5D6DA 5ITBH 3QIWC 2PO6A 1A5FL 4XRCB 3SGJA 1E4IA 1VFBB 5EOQH 2AXFB 3VDAA 4H20L 5EH1A 2WMPA 4PTMA 1QSEA 3ZKXB 3WNLA 3TJHC 3O2VL 2B1AL 4JPVL 2F8XC 1I8MB 3ECBB 3ILPB 4GMSL 4RFEB 4P5TD 3WFCH 1KCRH 3K4ZA 3P0YL 4K8RH 5IGXH 3HE7A 2ZOKA 1FO0B 3HZYB 5HHOD 5D7IA 3SE3A 5I1IL 5SWSE 4QXGL 3VXUD 5D2LE 4FQLL 3H9SD 3BSGA 5FXCH 5C2BH 1I9JH 4JHWL 4LLDB 1E4LA 5IVXF 3QDGB 2AJYL 4O9HL 2YDSA 1P1ZA 1TFHA 3OIHA 1BJMA 4OT1L 1GQJA 1QYGH 2X41A 3EOTH 1E9LA 1AQDA 5I17A 1UKTA 2WW5A 4ZS6D 1WFTA 4WI7A 2XSBA 3A23A 4HWUA 4PTTA 2EYTA 4OF8A 2GUOA 1MLBA 3RVUD 4H25B 4YDKH 3S97C 5HDBF 2ZZUT 1UXWA 2X9WA 2BERA 4LNRB 1BQUA 5FYLD 5TDNB 3HMCA 4OCWH 1N5AB 1FL5B 1D5ZB 2WWKO 2BOCA 1LF1A 1Y0LA 5DLMH 3BRFA 2ZPKH 1ZBVA 5EU3A 1IL1A 3S5LA 3RJXA 3RUGA 3E6HB 3SOBL 5MEND 1E5NA 5IFTA 1S7XA 2N7AA 1ZVSB 1QHOA 5DFTA 5CCKL 1B4JL 4HLJA 1JD9A 2BSTA 4M7ZB 4NRXA 3AICA 2I9TA 4J4PD 4LSPH 1ZT4A 4QTHA 1JPGB 4DGIL 5F1SA 2HJFB 4OCXL 3O3AA 1I75A 2P47B 3B2VH 4QHUB 4NHUA 1FNEA 2A3CA 4UAOB 3NSNA 3S4SB 2P24A 1J05A 3BSHA 4WV1A 1FAKT 5K59F 3VDBA 2BVEA 4HCRH 5E94B 3UYOD 2ED9A 2B4CH 1QNPA 1TVDA 4XPTL 3TPUB 4KU1A 1YNLH 1YUHB 3LHPH 4H26B 4IJ3C 1NMAL 1PSKH 3WNMA 2N1KA 4KKBD 5BCAA 4OZHF 3H7BB 1SZNA 3O2LA 2EYRA 2EPKX 2QHLA 4JFHE 1GGUA 1A22B 3VXRD 5IWLA 3PZNA 4NO2A 3WFDH 2PYED 4Y5VC 1QSFD 5JHDA 2OR9H 3D85D 1UA6H 5JLZB 2ARJQ 2Z0BA 4AJ0A 4ZUTA 3TYFB 2Z93A 1OB1A 1HOCB 4PJCA 5L7XL 1FORH 3ULUF 1NEZB 5C07E 1OCQA 1HE7A 5ESVB 3ZE2E 3QUZC 1F4XH 1G7JB 4R96B 1WTLA 5I24A 2VX6A 3PZUA 3DRTA 4K9EC 3BZDA 4QGTA 3RZCA 1A1NB 3UTOA 1UQSB 1MQRA 2R56H 1IGJB 4PJXA 1K85A 3SGEH 5E6IC 4MXQD 4W8LA 1AGBA 1Q38A 3MV7A 3X3FL 4PB9L 1GRWA 5A2BA 3OG6B 1QR1B 4GQ9H 4NN7B 4O4YL 1LDSA 5E1AA 5INDB 2YA0A 3FO0H 1HH9B 1H9VA 3PTKA 3PQYD 3NDYA 5I8OH 5SWSD 4XB7A 3RGVC 3EHBC 1MW2A 4OLVL 3BPOC 4FTVB 4UDUB 1TNMA 4XC3L 4G8GE 5FGCB 4ELKA 5SWZE 3CSYA 1JZ3A 3BRDA 3AWEA 4JFFD 4DZ8A 1HWWA 4KRMB 1KQYA 1NC4B 3EDJA 1HT6A 1ZXQA 4WWKB 4PJFF 1JRHL 4L9DA 1ZKAA 2JJUA 1ADQH 1C5BH 1JN6A 4Y4HB 4MAVA 2A73B 3V0HA 3BQUB 5DJXA 2BVPB 2OMNA 2AEWA 3MFGB 2CEQA 3AREA 1MW3A 4FQQB 3WJLA 1FNSL 3HFML 1MI5D 1HHJB 4AZ8A 2DL2A 3PNWB 4LVHB 1L7TL 3G9AB 4APQD 2UZXB 2BVYA 3WEXA 5IIEB 3VWKC 2XGBA 1AGEB 3B9VA 2DMBA 3B8SA 4NP4L 1KOAA 5KSBA 4LL9A 3PGDA 5T3XH 1WZMA 1A3RL 3PWNA 1A0QH 2BJMH 2AQ1A 2YD5A 1XSJA 1SJHA 3EO9L 3S7GA 2FEEL 3ZTNL 5ESQA 2XWBB 3W82A 3E3QC 4NQDA 1HZHL 1A2YA 4JFDE 4KWUA 3ZZ1A 3RKPA 4FQCH 5MEQA 4MJ4A 4NKIH 4P3WA 1Z3GH 2Q7NA 4JPIA 2E6PA 4E42A 2P5EE 4X9FA 4PJHA 2QSCL 5IJVB 4FLRA 5HHXL 3BMVA 4FFWD 3L3JB 2VL4A 3E8UL 1PPIA 1NEUA 1W72B 2CDGB 4WW1B 4XXCC 4XNMB 4JO3L 1T04B 3BXNA 4LBEB 3APGA 1UZ6E 4QNPF 2R2CA 3VA6A 4Y19D 2NCMA 3C60B 4M29A 2WMIB 4L8CA 4O51B 1T1YA 4Y5YC 1CDBA 4DKEL 1IGCH 2CRIA 4L4TE 3GSQB 2HJKA 5DMKB 4EUPA 2Z91B 5DJ8A 2W61A 1JIBA 2VQUA 7CGTA 5KSVB 4TRPL 5CEZL 1NAKH 4F15C 1ZBKA 5KAQG 3RWFA 1J8KA 3DX7B 1DBKL 4X6DF 3T4YB 4Z0BH 3QZWA 4LCCC 3MLYH 1F4WH 4HIJA 5LCVH 4YEFA 1LP9E 2ESVE 1BOYA 4LNRA 1U9KA 1SBSH 4J3XA 1T2QH 5EOTA 1UKQA 2IG2H 3HCVB 3AB0B 3C8DA 3ULVC 3KPMA 2XQBL 4V2XA 1NAMH 2HWZL 4H0IA 4AEHH 1CXHA 3CVHA 5FYJD 1HQRB 3WDPP 4R2GD 5TF0A 2J4GA 3T0EB 3PGCB 1TQBC 4O58L 4P2RE 5E08H 4XP4L 2EKSA 3OX8A 3BAJA 3VWJC 1UVQA 3AHXA 1KJ2L 4FFZL 4KHXL 3MOBH 4XPAL 3S96A 5IJKA 3REVA 5TQ0L 5JPNB 3CFIC 4G8GD 3S35X 3B5TA 4XP9L 1A6WH 2APVA 1XCXA 1OSPH 5BS0E 5I16A 1G0YR 4Z7UB 5EUOF 2AOSA 2PR4H 1I1XA 4BZ2H 4S1SL 2QKIB 4XH2B 5EG6C 3JTTB 5MI0B 4MVBC 1QFUH 1KYOK 1NQBA 1QHPA 4F7EB 4ZXOA 4W7VA 1LO0H 4HPOL 5EBMA 2BSSB 5BROA 1KLUA 1PG7H 1XF5A 2OTUA 3AXHA 1BHGA 5IHUH 1EXUA 2WK2A 2NY2B 4PTUB 2HT3C 4BELD 5HVWA 3BEWB 1E6XM 2VR4A 5IF0B 4HOZA 3QUXD 1C5DA 3EYPA 3K7UA 1Q6GA 5DJ0B 4S1RH 5TPWH 4ZNEA 3OB0K 3SUVA 1ED3B 3TC9A 4NHCH 3L5JA 4L9LA 4HOXA 1J8HD 1K4CA 2VO5A 3VI3E 2CR6A 3K46A 4RBPH 5J1AA 5IEHB 1EGJH 1QFWH 2JELL 4OZFG 5E2TL 1JGIA 2FATH 2Q6WB 2M26A 4HWNA 2AJ3A 3NFPA 4ZDHA 2P46B 2A77L 1NBZB 1NCDL 4P46C 1U91B 4G6MH 3I75A 3P0VL 3D52A 4R4BB 3IAPA 1U8OB 3ZHLA 4LFHG 3OXSB 1DCLA 3LQZB 2GFBB 2EE2A 4JM4H 5DRWA 3OV6A 2GIYA 1BBJA 3BGFC 1KSRA 1TZIB 4PG2A 4UIMA 3TESA 2P5ED 5CJQL 1I9RH 4OD2A 2CIPA 5E03A 1OM0A 5I77A 4ZSOE 1OM3L 4RWHA 4K9EL 4I3RL 1V3KA 2R4SH 4IDLA 3BSZL 5ICZA 1T21A 3VM5A 1DBJH 3RWHB 4K3JL 1RZ8B 4PV8A 2PTUA 5GGSB 2JF6A 1XH1A 1A5FH 3GBLA 1CE6A 1P7QA 1LDPH 3MRBB 1OGTA 3WF2A 4KGLA 3QQNA 2DT2A 2CQVA 4H20H 1NKRA 4AW7A 3TTOA 3PN8A 4WIWA 2B20A 1VSCA 4YDVB 3BPNB 3C9NB 1V02A 3O2VH 4NC1E 4GMSH 1TQTA 1HNFA 3P0YH 1AFVL 2OYLA 4LVNC 4U1MB 4ODVL 3I6GB 5I1IH 2V7NA 4QXGH 2ESVD 4NKOB 5D1XC 4FQLH 5JHLL 4JHWH 2AJYH 4O9HH 1E4XL 3MJ8A 4OT1H 5FB8B 1XF3B 3MXVL 1IZKA 4N0UA 1J0KA 3LKRB 3WD5H 1OP9A 5ECUA 3NCCB 5IP4A 3CU1A 1LO5B 1GGBH 5JXED 5F6IB 2OYKA 2F2HA 2V5YA 3OKDB 3DX6B 3G5VB 1R7AA 1PY9A 2AK4A 3A24A 3DUUA 3ULUL 5AYUL 3K74B 4OV6F 1BQLL 2VZ1A 1BBDL 5J11B 4WEBL 2OTWA 2VZOA 4ZOEA 5D1QD 1KLGB 4AD5A 1V0KA 2IAMC 2YL9A 2YIHA 3TBSA 4J3OC 4F58H 4FQXB 4I0PB 4B16A 4PJ5D 4Z2IA 1BIIB 1XGUB 4PJ7F 5DRNA 5EUKA 4PRAB 3JSSA 1B4JH 5CCKH 1FNGA 4X7EC 1MCBA 3AXLB 1XF4A 5E2UL 4WI2A 2YPKA 4JGUA 1ZLUH 4QRTA 2UY2A 2YK1L 2FD6L 4CADB 4DGIH 3F5WB 4OCXH 4MWFB 1RK0B 4YIQB 2GJXB 2YL5A 1HKFA 4OV5B 2PWDA 1B1YA 4Y8AA 2Y06L 2Y5TB 1V6UA 4DGYH 2P45B 5D93C 1UT9A 1T04A 2D03L 3BWAA 4NO0A 4WNQB 3GYCA 3MX0A 4O51A 2C3VB 3U57A 1E55A 5DUBB 4QDMA 4GUPA 2VLLB 3FQRA 1UWEH 3GNML 1FNAA 1EQPA 4K23L 3MOQA 4L4VB 2D24A 3DMMB 3HTLX 2YN5A 1DEEB 1XGQB 3ARDD 5CWSB 2B7DT 2AV7A 1GZQA 1K2DB 3BZ4A 3PDGA 3LEVL 4Q6IC 2A6JA 4W6WB 2EH8H 1MRCL 2CRMA 1FFOB 2ADGA 1M4KA 1Q6DA 2OJZL 4OLEA 3WQ6A 1TVBA 2W91A 5ECJE 3D5OF 4HIEB 5HHME 3IJ7A 3HCVA 5F7HA 5LQBL 4F79A 1X5LA 1S78C 2QSQA 3NACL 2J74A 4YDLC 2AQ3A 3L2LA 1HWHB 2E9MA 5L7XH 3RILA 3FCTA 1MF2L 1WBZA 2DQXA 3DSFL 4LIQL 2D7QA 2UWEA 3PGCA 3MRHA 4XNQA 5GS1A 1AO7A 4RGNB 4H8WH 5K9JL 1A6UL 4NN5C 3U5YA 1FPTL 3VO0A 2ARWA 4B9ZA 4UIKL 1UR9A 1V7NL 3MSGA 4G43B 5FM5O 3X3FH 4PB9H 1GOOA 3H9HB 3GJFH 2JK5B 3DXAD 4IRJC 1U8HB 2G2RB 4CJ0A 1PLGL 1S9XB 4E5XA 4O4YH 1FFPB 4KDWA 3MRNA 2E9WA 3LPPA 3WQ8A 3RGVA 3W0WA 4F7EA 4ENED 1BX2A 3S3JA 3MNWA 1UR2A 1UJ3B 2NY6D 1FL3A 3NABL 4I3GA 2EEBA 4PJIF 3AS0A 4LSUL 1CD0A 4Y16A 3GBDA 4RAUA 3FQXA 1ZWIB 4KUZL 1J0HA 1DL7L 2CKBH 2OJEB 4ZFFA 3CH9A 5C6WH 4YHOL 3VFSA 3U36B 1BLNB 3SJVB 4WK9A 1INQB 4HQQH 1M7DA 4L29A 5HYIA 2G5RA 2E9LA 3PG2A 4AQOA 2XN0A 4P9HC 2GY7B 5HYQB 5F1NA 5FKPA 1BYDA 3UTSE 4PJ9D 2CDEB 4R7NB 4ACZB 4OI9A 1FNSH 2NY0B 3HFMH 2OSLA 3DX4A 3BD4A 3L95A 1CLOH 1L7TH 3EOAA 1P9MA 3O11A 2X4SA 1ZLVK 1H8SA 3HN3A 4HUWA 3L3HB 4ZQKB 4NP4H 4E8DA 1MQPA 4YN5A 4G6AD 2ALWA 3VU2A 2N4IA 3SQOH 4G3YL 1XCQB 1A3RH 1B0GB 3OGCB 3MFFA 4L4JA 3L3OA 4Y4KC 3VDHA 5JOFB 5J12B 1NFIA 1RUKL 3BYYA 5DS8A 3D50A 3EO9H 3CLEL 2EEXA 3QHFH 1OPGL 4MNMA 3L6FA 3KPQA 2C0HA 3ZTNH 2CSPA 1HZHH 3Q6FB 2FRGP 3B3IA 4ZFOL 1XCTA 2DLFL 4DWSB 5BZWA 1UZ1A 1U8IA 1U58B 3FAXA 4GKSA 2XG4A 4OCSH 2XHYA 4JJ5B 4XWGL 2X09A 1A21A 1M04A 3E8UH 5DD0L 1NGYB 2A1WL 3BAXA 1V0LA 5I3DA 3L4YA 1AC0A 1Q9WB 5AY7A 4JO3H 1W0WB 5F88B 4OAWB 2VRJA 4YEEA 4Y5YA 2WWDA 3H53A 3QG7L 3LEXA 2HT4D 3HAEG 4X5WB 5SX4H 1BF8A 3HZVA 1IQDB 1NUFA 4DKEH 3BUPA 2DEPA 2DQFB 1T5XB 4NDMA 2ZX7A 3MV9A 4QRSB 4TRPH 5CEZH 3BP6B 2WWMD 1KIQA 3RWCB 1RP8A 5FA4B 1G9EA 5EN2A 1DBKH 4JHBA 3LQMA 3LN9A 4LCCA 4QRPB 4MHHG 5FF6B 3QOKA 3ETBF 3O8XB 3DX6A 1U8KA 2EBNA 3G5VA 5IBUB 3UC0H 3MRIA 4PGBA 2Q76B 5CINL 2ZSWB 1TVPA 1BIHA 4E41E 4D6IA 1F90L 4LSQH 1A4JA 2C1OB 2NX5E 2P8PB 1GZJA 5DWUL 1HHHB 3WF1A 2XQBH 3FQNB 4MB4A 2J7GA 1OF2B 4S1DC 1AQMA 4NFBA 1EO8L 2VRKA 2X6MA 1IGML 1XYFA 4U1KA 3VWJA 1UEYA 1VKXA 4O58H 5IT2L 4XP4H 3CZLA 1G9NC 4U5IA 1LILA 4GMTL 4EI6A 5DT1L 2IAND 4PRBA 5BYWA 2XWTB 3CFBA 1OCWL 4XP9H 1R3IL 1RIVH 2JIXB 4NQCA 3HLAA 1TTUA 3BO8B 4Z6AT 4HXBL 4AZHA 1A7PL 3QDMA 5I74B 4S1SH 4NUJB 3II1A 1R46A 3UG4A 2APWA 1CECA 1T1ZB 3DVGB 4YHNA 3MRPA 3MCG1 4LCWE 4HPOH 5JQ6H 3UPRA 3H3KA 4UZUA 1OGSA 2QADD 1YEGL 1YYLL 4QTIL 3UTSD 4Q9QL 4Z7OF 3O4OB 4W4NA 1K5NB 3TA9A 5I8CA 5HY9B 3KYAA 3T3MF 1U8LA 3NMEA 3U0TB 2CKRA 1SY6A 4EN3A 1EHXA 4RMRA 2VDOH 1IC5H 1QSEE 4MQ7A 1AXIB 2XACC 3MUY1 3VFMA 3VD5A 4BFBD 5CKAA 1B2WL 3WEMA 2C26A 5AZ2H 4HIIB 2JELH 4LCYB 5J3HD 3DO3A 1UYWL 1Z6JT 1W9UA 1UWUA 3OHXB 4JM2A 4YBHA 1PKQE 2YPLB 5A6LA 2A77H 1NCDH 3ARGB 3AY4A 1REIA 4AQ1B 3C87A 3K1KC 4XP1L 3P0VH 1EQCA 2AP2A 3EFDH 4MZ3A 1U0QA 2NY3C 5E9DD 1OTTD 8FABA 5FDWA 1L9MA 1EH9A 1FAIL 5KVEL 1FG9C 4Y0GA 2W5FA 5J57B 4I3RH 3ZKMC 3BSZH 1FZJA 4K3JH 1YEIH 2XM1A 2COQA 3MLTB 3I3DA 1NC2B 2P5WB 4NC2B 3DBXA 3MACL 5GS0C 3I3EA 1R3KB 4GW4B 3IVKB 4QRRB 3OGSA 2J8UE 3HZKA 4XBEL 3RUGE 2WHKA 5T1MB 3TTQA 1TR1A 3ZTJG 2QEJA 1BD2B 4HZ8A 1EGZA 2KZ1B 3GHEL 3RM9A 4DUXA 4XBGA 3OKEB 4HUXB 4HHAB 5C0RH 1KNOA 2OJEA 1OGBA 2R9HC 1S5IL 1FP8A 1AFVH 4TYUA 1R3LA 2GEEA 4X6BB 1BLNA 5D1XA 1F2QA 5KSUA 3JWNC 3WLBB 5ABFA 4ODVH 3MLPA 1N26A 1JYVA 3MMEB 4X6EB 1HVQA 4G9FB 4E41D 1CDUA 1CD1A 1CBGA 3GGWB 1S8DB 4C83B 3MXVH 1YPZA 4CAGA 3WYRA 5E1QA 2JEPA 1H3TA 4P9HL 5F7YC 5CLTA 3TCXA 1MQKL 5JUEL 1EHAA 4HAGA 2WHLA 1A6TB 1GGYA 3D39E 2YMXL 4NQSB 1JUFB 3ULUH 3QIBB 5AYUH 1W3LA 2BNQD 3LIZL 3D0VB 1BQLH 2VJXA 1BBDH 1KBGL 4WEBH 1RY7B 3KWWA 2ZUTA 2BXZA 2IGTA 4AZ7A 2XZQL 2EDQA 5GGVY 1WIOA 2ERJB 3T2QA 2G3NA 4C4KT 1QP1A 3QUML 3CUFA 3O81A 4LCWD 2N7BA 5HHVH 3KZSA 4PUDA 1KT2B 2YK1H 2HVMA 3FT3A 4JJ5A 4FQHB 1Q9LB 5D9SB 1WDSA 5DQDH 1JRHI 1ODUA 2Y06H 5TDOB 2HKHL 1FHLA 4QHNB 4M93C 4H1LB 4BH7B 5CGYC 2D03H 3EDEA 4PJXE 3GMNB 3VXTA 1AQHA 5EU5B 2WNWA 3VCLB 3GNMH 1B0IA 4K23H 2RGLA 4DUVA 1FA2A 3PGFL 4WUUB 2Q7YA 4LOUD 4Q6IA 2DSVA 1Z0MA 2EXWC 3RTQA 3LEVH 2XN2A 4UQ9A 1JHTB 5GZOD 4A3YA 3LRSA 2O5ZL 1DSFL 4MJ5A 1KG0B 1CFNB 1MRCH 3B9KD 4GAGL 1P5VA 2I26N 3WO4C 4OM0L 2OJZH 5LXGH 3HI1A 3RY5A 4PYHA 2W07A 2VQ1B 3EYOB 2BP3A 3VFVB 1Z5LB 3H0TA 3OAZK 3G5XB 5LQBH 1JFHA 1MFCL 5C0CA 1QW8A 3ARBD 3NACH 3F12B 2V9QA 3VXMA 1H0GA 4YBQC 1MF2H 4K3GA 3DSFH 1CWVA 4LIQH 3SDXB 1J10A 1A1OB 1C1EH 1VERA 3SCVA 4PLJD 2WW8A 3GB7A 5DSCB 5K9JH 1ZGLP 1A6UH 3KYMA 4MXVE 2GSJA 4X6FB 4KTDL 5E8OA 2F53D 1YQVL 3BEVA 4QOKB 1JK8A 3KPLA 5DO8A 3GKWL 1G9NL 3D3VA 5EOCJ 1PLGH 5DVLA 4HX1B 1FNLA 5KSBE 3T8XA 3ZDYE 2W92A 1FGVL 3V2AR 1KWKA 5GNYA 4DKAA 4D9QE 2WUBL 4YFLF 4PR5A 1E1FA 1NGQL 1K8IB 3NABH 1E6JH 2O61A 2JALA 4LSUH 5BQ7B 3SKJL 4MADA 4D8PA 4FZEH 1D9KD 3IB4A 4KUZH 2ESCA 4CW1B 1TQVA 4OZFA 2YBUA 3U0TA 4PRNA 5GIRA 3TBYA 1NAMB 1DL7H 1YNKL 5C0DB 1MCSA 1A6AB 3NIFE 4GS7C 3FRPG 3W11C 2OWCA 3W25A 4YHOH 1NFDB 1BPLB 4XZBA 5EFFA 1SJEB 4NJ9H 4P8XA 3NIYA 1CI5A 2QV4A 3D39D 5KS9B 3QI9D 3QFDA 4HFWA 3K2UL 4LARH 4AM0B 3QIUD 1TQCC 2WCGA 1D2KA 3L3GA 5LGHL 1LQSR 4W8AA 4ZUWB 2CLZB 1AD9B 2QHRL 4JQIL 43CAA 5INCB 3PWLB 1JDCA 4RA3A 1Q6EA 1U95B 1L0XA 3C09C 3WS3B 4ATLA 3QDGE 4DZBB 2HMID 4P23D 3WBEA 3CFJA 4HCRA 1IT9H 1PX3A 4P57A 1RD6A 3TVMC 3N0PB 2Q8XA 3U9PL 1EEZB 3MLVL 3UTZB 3VX0A 2H3NA 2RHEA 1RUKH 2V5TA 4KKAC 3CLEH 4MNGB 1OPGH 4WHDA 4EI5B 4KROC 2VWEE 3MRFB 2ICWJ 5IKCA 1GIGL 2DLFH 4UQDA 3ZM8A 2NY1C 4NO5B 2XFXA 1U3JA 4IRSB 4GW4A 4NNYA 3U6RA 1C92A 3HG1B 1T0MB 1LO2L 1ONQA 4XWGH 1A1MA 2LTQC 3BGAA 3BVNB 4JRYD 5DD0H 1EA9C 5HGDB 3HC3H 2BFVH 3AWFA 1KIRA 4LDOB 1J7VR 4PG9A 3O9NA 3VMOA 1HK6A 5BZDA 4JFZL 3LKQB 3GIVA 2VDKL 3WIHL 2AEQL 1XGTA 3QG7H 3V0IA 3RKDC 3PHOA 3I6KA 1MHCA 1CFQB 5FYJL 2AAVA 4CJ1A 4LGXA 2R1WA 4X98A 2BDNL 4M6ML 3DSNA 3ARRA 3W9DB 3IDNB 5I71B 1MCWM 5BJTB 5D7LA 5HVHC 1D7FA 1RZJL 4OQTA 2W9LA 4HK0B 5CZXC 1VFFA 1TETL 2NLJB 2VZVA 2A2QT 3PIQA 2FLBT 2DQDL 3UAJC 3T04D 3KPRB 1F6LL 5CINH 2D7TL 2J8HA 4KK9C 4YO0A 5I30L 3ET9F 1INDL 2Z4QB 2O9PA 2P8LA 1T2JA 1A4KB 4GQRA 2DWDB 5EPMB 1CGSL 2LVCA 2J3SA 1EO8H 5C0GA 3NOIA 4GBXB 2BSRB 1DUZA 1IGMH 2CETA 2EDRA 2V38A 2AQ2A 4YUEL 3VGHA 1JP5A 4DM2A 1S5HA 5IMKB 3SCWA 4GMTH 1ADQA 3BUTA 5DT1H 4XCYB 5EZLA 3OLDA 3CZGA 1R3IH 5ACLA 3G08A 2WQ8A 3RIFK 1A6VL 2HRPL 3S35L 1A7PH 1E4XI 3W9EA 3RVXD 3MNVA 1KJVA 4PB0L 1D5BA 3BZFB 4UFKA 3EYFB 4Y2DC 4XHJD 4EAMA 1QRKA 4ZUSB 3RL1B 1MFEL 3WN5B 1YEGH 1YYLH 4Q9QH 3TO4A 1ZBCA 4AZCB 4JQXA 3SIMA 2V9TA 4MXWH 2J2ZA 5A6BA 4LSRL 4HIHB 3BIKB 1OSEA 5E24E 4D0DB 2EXOA 2IPTH 4CU7A 4B3LA 1AGCA 4FTVE 3QDGD 4X4ZA 2ICWA 5IB3B 3ESVF 5FGCE 3N12A 5DUPH 1B2WH 1TG7A 3QUYB 3HZMA 5F7UA 3ARZA 2XZCL 1JF6A 1UYWH 4Z7VA 4F57L 1WWCA 4KZDL 4NZTL 5CD5D 1FGNL 4OZIA 3MGOA 3KHQA 4XP1H 3UDWA 1D3CA 2IH3A 5A2JH 4JDZA 2F8VA 4PCTA 5HBFA 5J1SC 1LTXA 4POYA 3D69A 4ORZC 4LSVL 3WBDA 2LQRA 1T0NB 1FAIH 1A7BA 4O00A 5KVEH 4X9YA 3O3EA 1KF9B 3OJMB 1JV5A 2E9IA 4X6FA 3WL9B 4YBLB 3CFKB 3S8WA 3TLRA 3QHTC 2NW3A 1NGXB 3FMGL 3AS1A 3MACH 4B3KA 4G8FB 5M17A 5TH2A 3V9FA 1BQHG 2WKGA 1ZE3C 4XBEH 2H8PB 2E9BA 1CFVL 1N0LA 3AM8C 2N56A 3DTXA 4OIIL 1T7ZA 2H45A 4MAZA 1FFNA 1MJUL 4UT7L 1UHVA 1S5IH 5GGRA 3T09A 5J06A 3OLGA 3D9AL 1VGKA 1WWWX 2VC9A 3N1QC 4TUKL 1YN7A 1TDQA 2MCPL 3Q48A 1DQJA 4P4RB 1T83C 4UT6L 1WBXB 3ZKSD 2NNAA 3LB6C 4P9HH 3GJFB 2IH1B 1C8YA 2P49B 1A7RL 2JTDA 2G75B 2BS9A 3ARFA 2ATKB 2ITDB 4M4RA 5A40E 5JUEH 4YZFF 3T77B 2A83A 3V0GA 4LAQL 1IGTA 4P2OB 1XIWB 5D5MA 3BXWA 2YMXH 2XFRA 1H0IA 3DUHA 3SDDA 1S7RA 3LIZH 3V52L 1C7TA 1D6VL 5HI4D 1IAKB 5F70A 2HAZA 4URTB 2AGJL 4FQ2L 5EIIA 1U92A 1A64A 3X14A 4L8BB 4EI5A 1N6QL 4NQXA 4DTGH 2DSUA 3QUMH 2OZ4L 5B3JE 3P4OA 1U36A 5FECB 4PJGB 3TIEA 4PY8I 5FO7B 2DQEL 2R1XA 3QH3B 4RMUA 1SJVA 3H3PL 3FW6A 3HAEA 4PP1C 1WSST 1U8PB 4UNVA 1S7SB 3T0EE 4FXKA 3OJDB 4W85A 5GZND 1AO7E 4PRPD 2JCCA 2K1MA 4FTVD 4O2EA 1W0YT 3QO1A 3RU8H 3AWGA 2DD8H 3WLWD 3JVGC 3D18B 3QNZA 3UMTA 4K7FB 2ZNXA 1I7ZA 2PTVA 4WTZG 3P9MB 4ZODA 1VFAB 2NYYD 2W59A 4BM7A 4P2CG 1FNFA 3PGFH 4NM4L 4P2QB 5DJDA 4L3CB 2F7PA 4B50A 3T2OA 1NC4D 1HN1A 4YNYA 4WWKD 5A8NA 4Y4HD 3MBEB 2GK1A 1KB5L 3BQUD 2O5ZH 4GAGH 1U8QB 2F74B 3W5NA 4OM0H 1C3FA 2VOTA 3G6DL 4M1GH 3FO9B 3FFCA 1I8IA 2YC1A 4FP8L 1VAHA 3ARYA 3QIWB 2QSTA 1LO3H 1MCRA 4JKMA 4PJAF 1IM3A 4CU8A 2X1QA 1XR9B 1U41A 1XGYL 2DIJA 4U3HA 5HYJB 3TFKC 1MQ8A 2CK2A 3MUZ1 4FNPA 5FOBB 3RWIA 4A2MA 5JUVA 1RFDL 1PEZA 5I1AB 3C5ZC 1Y6NR 4XCNA 2VXQL 1TLKA 4KTDH 2MSPA 5C0BB 1YQVH 4U7SA 3LV3A 1H41A 4R4NC 1R0AL 2J6EL 3GKWH 2NT0A 5L2KA 2QQLH 5T1KD 3LQAC 2FJHB 2GKIA 1FGVH 2VUOA 2Z1SA 5CSBA 1ZGLM 3OKMB 4FLOA 5KBNC 2MHAA 1NGQH 1BZ7B 2WLZA 1KTBA 3S5ZA 3MGTB 4OFYD 3N15A 2CIIB 2DKSA 5BRZB 1KWGA 3SKJH 5D9MA 5BW7C 3MRJA 4AG4L 4M7LT 2PWGA 4WENB 1NLBL 3C60D 3LKSB 5B3NA 1YNKH 3EJSA 4Z78A 2XZZA 3JTSA 5JPMA 2V2XA 4IBLT 2I5YL 3TZVA 3WDHA 2YD6A 4ONHA 4X9GA 4FFVC 3SBWC 4R26L 5ICYB 2YBTA 1CL7L 1KJ2B 4LDLB 3K2UH 4N8VG 2E7CA 3GMRA 1K4DA 3DVFA 5FCZA 5DO2D 4XX1E 1NUGA 2QHRH 4JQIH 5IG7A 3A6OA 3BWUC 1U33A 4ZO6A 3C8KA 3DROA 1H15B 3BDYL 4XMLH 1WF5A 2EEAA 1IEBB 4AMCA 5IR1A 3W39B 3EOBB 3RX8A 4BSWB 4GKNB 4TULH 1SEBB 4B41A 2MKLC 2BHUA 4YHZL 5KVGL 5FA3B 4I4WB 4I9WD 1OW0C 3MLVH 3U9PH 3VXPA 2XGIA 3VG9C 3MV01 2EJ1A 3OAYK 3MYJA 3RDTC 1TJHL 2BVQB 2D9CA 4UFLA 1JBJA 1GIGH 1AH1A 4G8FA 4Z7WA 3SDCA 4IJ3B 3RX7A 2DQIL 2CIKA 2FZ3A 5TE7L 2FHBA 4OKVB 3O6FC 4LQFL 5JW3L 1CLVA 4HIXH 1HIML 3R06B 2FL5B 2XKSA 1AJ7L 4Y5VB 2ICEA 4Z2HA 1CEOA 6A3HA 4YDJB 4JFZH 4Q9RH 2VDKH 2VVSA 1IC7L 2YDQA 2AEQH 3SCTA 1I1YA 3RWJA 1ZSDA 4MA1B 2NY2D 3LRGA 5AEAA 3BUDA 3DX9B 2K3TA 4KVCL 5FYJH 2BK8A 5ABDE 5ACZB 2OI9C 3G6JA 3UTPE 3QDME 5JZ7C 1ESWA 3GMOA 3QUZB 3X12B 2BDNH 1MJ8L 5D1ZB 4M1CD 2F58L 1A9BB 5MEOA 4W87A 2L4OA 1RZJH 5E6IB 4K07A 2DQDH 4WCYL 1DQDH 1BYAA 4L4VE 1GQIA 1GGIL 3Q6GL 2D7TH 5I30H 4JZJC 3HUJA 4KRPC 5T3ZE 4AD0A 1INDH 4HWEL 2FX8L 1PVHA 4XCEA 4X80L 1UR0A 4NZFA 1CGSH 4ZXBB 4GKLA 2CKBA 4J6RL 4GXVL 3ZKNC 3HR5A 1JNJA 5FECA 5FO7A 3MLXL 2VDMH 2IXVA 4OZHB 3CUJA 3TH3T 1U8PA 4QXUL 5HHQA 3KLHD 2XV6B 3MV8B 4NC0B 2VITB 5GRVK 2PWHA 1V0MA 4ZEPA 1A6VH 4QLLA 2HRPH 3OJDA 5M94B 3LPOA 4YK4B 4PB0H 5EORL 2BNRA 3MJ7A 1JHKH 5LA2A 2X8RA 2MTPA 3D2UA 5FYKE 1I1CA 3BJ91 1BREA 5E8PB 2X1XR 3FONA 1MW1A 1W9PA 1NCWL 1AIFA 5JORA 1MFEH 1OT1A 3S36X 1E70M 1B0RA 3ZDXF 1LE5A 3TO2A 3I6LE 3VWKB 5CBEA 2Q86B 3HMXL 4LSRH 4X5XB 3SDAC 1VACB 4KKNA 3BAKA 3BH9A 4QFUA 3QG6A 2WZPD 4AL8L 1MHEA 1Q94B 3JV6A 3WFHA 5GSVA 5LAXA 3V0JA 1NL0L 1FLRL 1KPUB 3WF3A 1AR2A 2YD7A 3B6SA 5D6CB 1V3JA 3BPCB 5BXPA 2YLLA 4L8DB 1OSZB 1UQYA 1CGTA 3W0KA 4F57H 4HKBA 4KZDH 1MYRA 4NZTH 5IMOB 1FGNH 5I2IB 3WHE1 3SJVE 3J8F7 3MROB 2D7MA 1ACZA 1SJXA 2Y07L 1MSPA 4CKQA 1DZBA 5HD8D 4ZYKB 5F1IB 3CC5A 4WO4B 5D7SL 5LWYL 5A2LH 3NN8B 2NXYC 3KPOA 1XGZA 1KBBA 2JF1A 2Z8WC 1FL6A 1X4ZA 3M1BB 4X83A 4MQXC 2E0PA 4KFZC 1CIUA 1TPXC 2R69L 4I0PD 4JFEB 4F3FA 2I27N 1M71B 2DYPA 1RJZB 4PJ8D 3D25A 4YPJA 4PJFB 4TTDC 4QXTB 5CEYB 4QRQA 1CGYA 1D5XB 3FMGH 2J25A 3DRQA 3LZFL 4JREC 1QI0A 1Q9KB 2XN1A 3EYQC 3CU7A 3FRPA 3S37X 5A2IH 4F15B 1T7VA 4W8BA 1E6SM 3VE0A 2Z31C 3LQAL 1QWUA 3AM8A 3UTPD 2P4AB 5DMGD 7TAAA 4JAMB 4OIIH 1G6RL 2PI6A 1J12A 1ZHBA 1GOFA 2QR0B 4W70A 1MJUH 4O2FA 4Y4FC 4LKXA 4UT7H 1EBPA 4BFIB 4YLQT 4QYOB 5D7JC 3QXUA 1HYRC 4L4VD 5JNYA 2OBGA 4TUKH 3GM8A 2G5BA 3DMMD 4MQTB 5T3ZD 1QEWB 1NCBL 5F7DB 2MCPH 4V1DA 5CD3B 1T83A 4LLUB 3DDGA 4UT6H 1TQBB 4X8JA 4ZMAT 1HIZA 4RZCB 2IALA 1A6PA 2XJ7A 1NGZB 3P73A 1A7RH 2RGMA 4NKDA 5D2NB 4Z77A 2WP3T 5JW5A 1H3GA 1L8NA 4MD0A 3U4EA 1LE9A 4LAQH 1N64H 2D0GA 2ATPB 2GK0B 4BSWA 2CMRL 3GSOA 3RIFF 5JDSB 4CCEA 2JB6B 5I76A 3V52H 1UKPA 1WCGA 1D6VH 3QHZL 2DRUA 2WNGA 4QRPE 4YGVB 4FQ2H 1LL6A 4JFPB 4K3DL 4N9GB 4Y89A 2QV2A 1N6QH 1L6XA 5E4EB 3SUWA 4RGND 2WBJB 5FCUL 3B5GA 5IVXA 1A02N 2OZ4H 4RISL 3ES6A 1F6AB 2H32A 3DUSB 3TA3A 2DQEH 2FWOB 1X3DA 1ECEA 4LMQE 3H3PH 3VXME 1KB9J 4D6GA 2HFEB 1TZ7A 2HKFL 1DVFB 4CVZB 3ZYOA 3I6LD 2EZ0D 2ZUNA 4BQ4A 4NFCA 3ROOB 5B8CA 4KQ4H 1W2KT 4OF6A 5GGUB 1EAPB 1UB5B 3P0GB 1C08B 4JFXB 4P8WA 2P7TB 1TVHB 4ISVA 4JFSA 5F21B 3GH4A 2WC7A 4PRDB 4UOJA 1BWWA 3A67L 4P46B 4G9DB 3VRIA 5JOEA 1MY5A 3NTCH 5J6GB 4ZXLA 1G6VK 4NM4H 1PS3A 5MERB 3SJVD 2WAHA 4OM1H 5DVNA 1KB5H 2RGSA 2RIKA 2CITA 4ZFOB 5FGRA 1GC1L 1VA9A 2NY0D 4PJDA 4AYGA 4R7DB 4PPTA 4KKLD 5EUOB 1DLHB 4LASL 35C8H 1RURL 3FB7B 2P8MB 4D0BA 5J7CC 2FJFA 4F7TA 1WEJL 5I75C 2B1HL 3TBTA 2XFYA 1XGYH 2G3IA 3N18A 3IJYB 3I02B 3GMLA 1GOWA 5IB2A 2TAAA 3VSVA 1RHFA 2Y7QB 4W5UA 4U1JA 5CJXA 2GCYB 2DKUA 2VKXA 2W9EL 4LVNB 3NBNA 2QF8A 1YZZA 1KXTA 1CGWA 1SYVB 3GSNL 4DWSD 2V9RA 3WUWG 1YEHL 4G7VH 2PN5A 5L6YL 4PTVA 1IZJA 3C5SA 4MD4A 1OAKL 1OAXL 4RMQA 1T1XB 4AY1A 4EVNA 4GLRH 4TOYL 1W1VA 3CH8A 3L3IA 2EYSA 4NKMB 5TE4L 3WENA 4HWZB 3SKNB 5BW7A 2H41A 4ODBD 1UCTA 2ARJA 3L1OL 5EU7E 4HT1H 4AG4H 3AMGA 2H26B 4V2BA 3B9DA 1NLBH 4CN6A 5ILTH 1WIUA 3AU1A 4QRRE 3WQVA 4WI3A 2I07A 1UWTA 2ZOLB 1S7UB 3V7MA 2PW2A 3RQ3A 3DV6B 4L8SC 2PWEA 3EJYD 1I7UA 4R26H 4AEEA 3TN0C 2IAMB 2ORBL 1CL7H 4GRMB 4XVTL 4ZPVA 2X1PA 2VR5A 1K3IA 1ZVHA 3QULA 3N04A 2VAAB 1WWBX 5EIQA 3D1MC 1KXQE 3P9LA 4QRPD 4FNTA 1UEMA 5HPMB 4MB3A 3WN6A 3O8XD 3PL6C 1RHHB 3MROA 3DOSA 3L7EB 1MFNA 1XV8A 4DEPB 1JGVL 4G9FE 1WNOA 1FSKC 4MCYA 4MNHA 2GAZB 3BDYH 3VD4A 4WO4A 4OBSA 1OOAA 5DZNA 1OW0A 4YHZH 5D7LE 4ZOCA 1V7ML 1BQHA 1JNEA 5ISZA 3NA9L 4K8RD 3G9VA 1IAOA 4LGSB 5ALCL 3AIRA 3RDTA 3ROLA 1VJSA 2GSGA 3CD4A 1UCBH 2XQYG 3O3BB 2PBGA 3HE6A 3NCMA 3L3DB 4Z76A 4KJWD 2CDFA 1DN2A 4NUGL 1EAJA 1G7LA 2ZP0T 4MXQC 2EIDA 2X4PA 4MHHI 5CSZA 2ZWZA 2DQIH 2JIXD 3PXJA 4HLZG 3KWXA 3K81A 4W4OC 3O6FA 4GRLA 2O5YL 5TE7H 2XY1A 4JRXA 4XBPB 2YBRA 2FO1A 5HHNB 2X0YA 4LQFH 1LEGB 3IJHA 5J89A 2Q8AL 1J9CT 1QNOA 2CYGA 3IDMA 3PP4L 3PHSA 4PJEB 2DF3A 1IC7H 2GT9A 1UZ8B 1T0OA 2ZWYA 4PS4L 1ETZB 2HT2D 5LGJA 3RNQA 1ZLVH 5HDRA 4BH8B 4YDLB 5CP7B 1NDMB 4KVCH 5J6HA 3W4RA 5DI8A 1GYAA 1JWSA 2ITCB 1KC5L 5GSRA 5T5FL 1AXSB 1NARA 2F58H 4OZGF 4L3EB 1BZQK 4HUKB 2O26U 3QQ3B 2W4XA 5IROC 4NN5B 2JB5H 5D2NA 5T3XE 4WCYH 3WQ4A 4UQ2A 3FRUA 1GGIH 4WUUE 1NOWA 2YPLD 4IRJB 2CBVA 4WHYH 5CSYA 4Z7UF 3V0WL 3ARGD 2Z35B 4DO5A 4UOW1 4HWEH 2PXYA 5J8OA 4PGCA 4I2XB 3WE6B 3QO0B 4APQC 1BVKB 2J43A 4X80H 1EV2E 5HGBB 5F3HB 1MJ7H 2DM7A 1JZ6A 4J6RH 2ZJSL 4GXVH 1K9TA 4G6FB 4DKFH 1T03H 3VXOB 2XZAL 1F6AA 1YN6B 1ZT1B 1X4XA 3QAZC 2Z92A 5B39G 4GZEA 4Z7VE 5ICXB 1MJJA 3BOVA 2XG9A 5H94B 2HFGL 1QHZA 1QPPA 4F9PA 4ZPTB 4X6DA 4PRHA 4PMNA 2PF0A 2DQHL 5FOOA 4QXUH 2I9LB 2P5WD 4WTZA 3SDXE 1T89A 4Q9BA 4KQ3L 3WDRA 4QRRD 3V6OC 4H88L 4OZ4B 1W0VB 3W6LA 5EORH 1VFOA 4NQEA 4EJ1C 2F61A 1TVHA 3CFEB 4BS0A 5L9DH 3OKNB 1BD2D 3PDOB 1NCWH 5HGAB 3JWDH 4EIGB 3FN9A 4MX7A 4YR6B 5D8ZA 3VGGA 3HI5L 3HMXH 1ZGLB 1R75A 3O2DL 5MERA 1RJLA 2ADIB 4M1DL 3BKML 2VLRB 1CLZL 5DEGA 4AL8H 4BF7A 1CNVA 4G9FD 4MLIA 4LCUB 4WGVB 4Y4KB 1H5BC 5DJZA 4U0RB 3QUMB 4J8RB 1TJGL 1FLRH 1CLXA 4Y1AA 2DWEB 1Y18A 4HK3J 1G9MC 5E7BA 4U2YA 2R2EA 2LU7A 4XMKL 1MCCA 4FQIL 1NFDE 5DJCB 4BQ3A 4R0LC 1FVEB 3L2MA 4NNXA 3TCLA 2Y07H 3IKCB 5GGQL 5KS9E 3WHXA 4LHJB 4PJIB 3QIBD 1NP0A 3OZ9L 5D7SH 4LPUA 5LWYH 1RZGA 5HYSB 1PKOA 5TQ2L 5E00A 1CD8A 1FYTB 1BAGA 2FGWL 4XI5C 5HVGB 5DTFA 4GKZB 1EUUA 4XNUL 3BI9X 4QY8A 2RAMA 3GXFA 2Z8SA 1FZOB 5IV2B 3TEUA 3OF6A 1BFVL 3LZFH 1VADB 2FNBA 1H0DA 3TBVA 1DQMH 2E6JA 4MNGE 4MNKA 3ZT7A 1WAAF 4UQBA 3WMBA 3IJSA 3NFNB 4IMLA 5E8EB 1G6RH 3PQYB 4RAVA 4WTXA 4V27A 4Y4FA 5F8RC 3LX9A 4N8VA 5DHVH 5HBBA 1AXTL 4W89A 3AIEA 4AZ6A 5IB4B 1U3HB 2VC2L 4AT6B 4P8VA 1MHPL 2ZX9A 3WQWA 4WUUD 4OUUB 5IB5A 3MRKA 1NCBH 1DN0B 2H6PA 4X0KA 1H3WM 2PTTB 5GRXG 1QQDB 3HKFA 3PTMA 1CK0L 1X5IA 3MRDB 3FQWB 2F5AL 4PD4K 1WC7A 5CP3A 1ZHLB 2EABA 3IU4H 5C3LD 2IQ9L 3C2SA 1ZLSL 4MCZB 3LN5A 3SKOA 1KV3A 1E4NA 1QA9B 3STZB 3LPWA 5C6TL 4V2CB 5DUML 2CMRH 4NT6B 1P84K 4MMXC 2D0FA 2WLYA 4Q58C 5KSAC 4GAYA 3QHZH 4HS6B 4LKCA 4Z8FL 2YRPA 4K3DH 3H55A 3IS1X 3KPRE 1EFXB 1I8KB 5I8EA 1HKIA 4XZWA 3OKOA 3ZHKA 3KXFB 3AIBA 3FFCE 2CJUL 3JV4A 4BQ6A 4RISH 3PXHA 4P4KA 2KZWA 4OCMC 2GTZA 4QOKD 3BN9D 5K33A 2C5DC 3UX9B 1BJ1H 4GZJA 3DX8B 2HKFH 4XBPA 2BNJA 2PF6A 4U6VH 3K2MC 4OIFA 4RIRA 3ZOAA 3VG0L 2CK0L 4ZD3L 5D96B 2AV1B 2GY5A 4YHGA 4Y5XC 1TFVA 1CENA 2DAVA 2VTFA 1F3JB 3JUYA 3MRMB 1TZHA 2CXGA 5FGBC 4HPHA 4DN4L 4U1NB 2VLJB 3A67H 3CX5J 4P5TA 4X9HA 3WL0A 5GRZA 2RQ8A 3IDJB 4PJ7A 2NY3B 4Y19B 5HHOA 3MCKB 5F89B 3NCYP 5C0JB 4R8WL 3VXUA 3BVXA 3H9SA 1U42A 2IBBA 3CUIA 5CSUA 4I48B 5E5MB 1FVDB 2X2HA 3VFPA 2FO4B 4HJ0D 1GC1H 3MODL 5SX4I 2EICA 1M6OA 3GH7A 3CIQA 1G84A 1YY9D 5B38A 1OGGA 4P5MB 4MAYC 5F9JB 1WITA 4LASH 3PWPB 1RURH 1QD0A 2W0PA 4D94A 5JXEC 2ADJB 2YKLL 2OQJB 4ZUUB 4XB3A 1WEJH 1GCFA 2B1HH 5JA8B 3GHBL 5EWIL 2CHOA 3PWUA 3IFPB 4UBDD 4G8IB 2X9XA 3TNNA 3QJHB 4FLSA 1T7YA 2HVKA 3MRQA 5MENA 1UOKA 1OTUD 5DQ9A 4R2GB 4KI5E 4TVDA 4J4PA 3GSNH 4Q7DA 1IT0A 3OKLA 4IRSD 1Z9OA 2IXUA 3EGSA 4MDJB 5C0EB 4LEOB 5L6YH 3HG1D 1CG9B 3BKCL 4KXZH 3GBML 2X4QA 1NSNL 2QPSA 1OAKH 1OAXH 1T66C 2VDQL 1NFKA 4BSVB 2PETA 3G6LA 4TOYH 5CEXB 3CUHA 2DJSA 2R0LL 2WINB 3D0LA 2F7RA 5TE4H 3NZ8A 4PJBF 3L1OH 1DUYB 3H3BC 1EPFA 4U1IB 3OAZH 3PZTA 4Z7WE 1UC6A 4JCLA 3RWDB 3UBXB 5BOPA 2O9TA 3FT4B 1IGYB 2XN9A 1T6VN 1IILE 1H2JA 1UKSA 2QL1A 5K9KB 2EPNA 3ZIZA 1IEAA 2HLAA 2ORBH 4XVTH 7A3HA 5T5NG 3WUEA 1XSIA 5BVPH 1HXMA 5BVJA 3M17B 5C0IB 3V5DB 3VXRA 1QRNB 1P7KB 2YPVL 3LSOA 1E28B 3F6IA 5D70H 3KDMB 2HVJA 2PYEA 1QSFA 1G9ML 4HKZB 4X6CF 1OAZL 1JGVH 3D85A 3WFEL 4Q2ZB 3CSBA 3H7LA 3MRCB 4DUWA 2BV9A 3AYSA 1FP5A 2W0KA 3SGDH 3I84A 4X7FC 3GMQA 3CZFB 3VOCA 4M93B 5SV3A 2XIIA 4MNLA 4FN0A 4YC2C 4CMMA 1V7MH 1TMQA 5H35A 3NA9H 4DN3L 3CZJA 3CBWA 4GBXD 1MUJB 5ALCH 2DSWA 2FYVA 4PYSA 5DHXB 4AH2A 3KLLA 4GO6B 4KK6D 2G9HA 5A43C 4F9JA 3KJ4C 1PFCA 4NUGH 2H9GA 1U8MB 1PYWB 4YHIB 1N59B 3VH8G 4B9YA 5EB8A 5KG9A 4PMQA 2Q3AA 5A3IC 4X4XB 4NC1C 3UCQA 1UM4L 2AXGA 2XPGA 3UPCA 1VPOH 2R2HA 2Q8AH 5SWSA 2Y6SC 5D2LA 4ENEC 3DIFA 4ZTPL 2NSXA 5ID1B 2ZXBA 4J1UA 2V2WA 4DOHB 4PS4H 3N85L 4YPGA 4TTUA 1OARL 4OTXL 4JFFA 5I6XC 4JZNB 2O9OA 5TDPB 1E6RA 4BA8A 5ACMA 1KC5H 1S3KL 5T5FH 1W91A 5DJ6A 2BNRE 3GJFK 3MI6A 1HILA 32C2B 5GGRY 3MUGB 4POZD 3QUYD 1PBGA 3I50L 4ODHL 1OGAB 1NWSA 2ZUXA 4YHKL 3GRWL 1MI5A 4P2QE 3IF1A 1VF8A 5EFIB 1AKJB 2C8NA 3V0WH 4APQA 3LRHA 3UESA 5ANMB 3ZDZE 4HJGB 5BRPA 1ZBWA 4P3CH 3CFDB 3VFUA 3VRLE 5GJTH 3CCHB 2WHMA 3RWGB 2K7QA 4MAUL 2ZJSH 5I1CL 4Q0XL 2HP4A 1QVOA 1J1PH 2XZAH 4LLYB 5FK9B 2IMNA 5D1QB 4WW2A 2ZX6A 4JY4A 1ZA3A 3RVVD 1V5JA 2HFGH 4PJ5B 1S7TB 4GS7B 1I3RB 3DX8A 1TQUA 4HS3A 2DQHH 4GW5B 5HYJE 1ISVA 1MFBL 4CDGC 5CHNA 2H2PC 2J7DA 4TOQA 2OSXA 3MRGB 4H88H 4WGWB 1WE5A 1F3JA 3E1F1 4WVRA 2YUXA 1JNLH 2KQNA 2DLTA 2R1YB 3RRQA 3O4LB 5C0BE 3GSXA 4AD4A 4HWBA 3QEQB 5CEZE 2ZUMA 5FO8B 4R5EA 5C0AB 1OIMA 4ZE4A 4N5ED 2AAAA 1QPKA 3S36L 1AGFB 1XH3B 2F54B 3QWOB 4LCIL 5FV1L 4MMZC 3BKMH 3WHE0 3TVMB 3PUCA 3TPKA 3NA4A 5BRZE 1HSBB 5HHPB 1BOGB 1SM3L 2E8YA 1TJGH 3KR3L 4ZAKC 4UILL 2VABA 2WWMC 2Q3ZA 5C07A 4PGDA 4XMKH 4UQEA 5CJOL 1H09A 5IMMA 2NY1B 3O41A 3QQ4A 1ZVYA 4D6JA 4HPGA 2M2DA 2VL5A 4LRIC 2FIKB 1XIWD 5DDHB 3FQUA 5GGQH 4V1DE 4U1GC 4N1HB 4CRPA 5DT5A 1KYOJ 4OF5A 1KGWA 3QJHA 3CVIL 4PTWA 4RNRA 4PGEA 3FQTB 3ZR5A 3EBVA 1IMHC 5TQ2H 4GG6B 3CH1A 5FV2A 2JKXA 5E8DL 2FGWH 3EFFB 1JMXA 3SO3C 2OP4L 4XNUH 2XTJE 2PW1B 2UY7A 1HXJA 5JIWA 3EO1B 1NGWB 3C6LC 5C0EA 4LEOA 3LRKA 4G8GA 1BFVH 1YMHB 1DJSA 4RGMC 1FH7A 1KB5B 4HH9B 4R3SB 3AFBA 4WIQA 5SWZA 3DXAB 1DEDA 1N3NB 4ZE5A 5HVHB 1K3ZA 2GITA 4CBPA 5B4MD 3TT3H 3F7VB 3QEUA 5IVXE 2DQCH 3WCYA 3F5LA 2VIRA 4K71C 1GQKA 3RWDA 1WIPA 4KK5D 4U7MA 5CIPH 1FC2D 1XD1A 5JQHC 3R0NA 1YC7A 2QADC 2VC2H 1XSKA 1BZ9A 3PHQB 4P2QD 3BUQA 3ARPA 3QUXA 4PBGA 3W26A 1ITCA 2ZICA 2Y4SA 3HB3C 2AJZA 5DYOB 4WFGE 5HDBE 1EERB 4HSQA 3MBED 1CK0H 2QQNL 2PCPA 3D48R 1BYBA 1J8HA 4XVUD 2WPGA 2F5AH 1RK1A 3B4NA 1V08A 2NTFA 5DEFA 1ZLSH 4M8UA 2MJWA 5K9QG 2ZOXA 1LMKA 3KNBA 2O93L 2G3MA 5A95A 1CDIA 3V6ZA 5J3HC 3QIWD 5C6TH 2YFOA 1QLFB 4JDVB 3HG3A 1UXSB 4JFDA 4NOBA 2NY5L 4Z8FH 1LO4L 5HYJD 4Y2DB 3EDDA 4P5KB 3MPCA 4R4FL 1HKKA 3C6SB 1MNUL 3TJHD 3E6FA 2C7FA 1MHHA 2P5EA 2YWYA 5CUSL 2CJUH 2X4NA 1QOXA 5C0BD 2WHJA 4H8VA 3GH5A 5CEZD 5C0FB 5K59E 1P53A 3LN4A 1INEL 2VXTL 1DDHA 4RQQB 3SCMB 4RWYL 4F80A 1KIUA 5CZVL 4KDTC 1CFSB 4TUOA 5IM7B 5C8JB 3VG0H 1C16A 1F58L 2CK0H 5KW9H 4ZD3H 1N4XL 2DQUH 3FTGA 5A16B 2E3ZA 1BGGA 1N5YL 4DVBB 2B39A 1OD8A 3IGAA 4OZHE 5BRZD 3WIFA 1JNHB 3ULSB 4DN4H 2WSPA 3MV8E 5E0QA 1AR1C 5DJAB 3OWEA 3S3PA 1DLFL 1IKNC 4XZUB 3L5WB 2IADB 3SDXF 4MJ6A 2DTSA 4R8WH 1M05A 3VW3H 2ESVA 1BVZA 2EE9A 1F42A 3K8LA 1KEML 1M7IB 4NBXB 2ZSVA 1WCBA 3ULUE 5DK0A 2CUIA 3IDIA 3PE9A 4MAYA 2V5RA 5D7IF 5E0FA 3QCTL 3DURB 5JXEA 5F6HJ 1G5AA 2A74A 1TMCB 1D5MB 2J7LA 2OLHA 2NXZC 4HJGA 1TJIH 1ORSA 4P2RA 1N82A 1SMOA 3CFDA 1UZ4A 3GHBH 5EWIH 4BQCA 2GK2A 3QFJB 1X5JA 1C12A 3E3QE 3NPSB 4UB0L 3SCNA 4N0YL 1BVLB 4HA4A 5C08B 3K8MA 5IW6B 1DE4A 1MLCA 4HZAA 3RM8A 3N11A 1B88A 4CCCA 4JL1A 2FGZA 3HS0B 3KL0A 1HJXA 3SPVB 3MJ6A 3C5JA 3VFRA 5EBGA 1CICB 1E5JA 5EO9A 3OLIA 4GRWF 1PZ3A 3BKCH 3PWJA 4JJHA 1PX8A 1NSNH 2VDQH 3DV4A 4JFEE 4XNZC 1ND0A 4EBQL 5D6DC 4K7PX 5HDOA 3F7YA 1Q0YL 2W0FA 1KACB 3OR7A 2PO6C 4PJFE 1FJ1B 2B0SL 4WFGD 3SGJC 3WSQL 5I1DB 1YJDH 4G42B 3LMJL 3WFBL 3QOMA 3MLZL 1OP3K 5IVOA 5BMFL 5IK3A 3RWEA 4X99B 2VDPL 3NUKA 3S5YA 4C7FA 4AC1X 3ZO0A 4D0CA 1RQ5A 3QUZD 3HE7C 5DRZB 2DTMH 3ARDA 5D1ZD 1KCUL 3VXQA 1PEWA 3SE3C 1E0VA 4QRUB 3CPLB 4LOUC 1EDQA 5E6ID 2WIMA 2DBLL 4LIQE 4WLCA 1D6EB 3CK0L 1T22A 4F33A 1LEKB 1FV1A 1OAZH 4U05A 2BRQA 4KJYA 2A6DA 4ZSOA 1P2CB 5CG0A 4NZUL 1F3RB 4JFYB 4EUPG 2NY4C 3ARBC 1KB3A 5T1LB 3RGVD 2VX5A 1YECL 4AIUA 2HYMA 1XFPA 1WBYB 3GTNA 5D2NE 4GG8B 5E9DB 3DGGB 5JW4M 1MWAL 3IXTA 5GGVL 1OP5K 3ZYJA 3M45A 1KXVA 4KTEL 4AZIA 4QWWC 3AMKA 4MSWB 3LCYA 1NWTA 1IM9B 4PJCF 2YD4A 4G8EA 1LK3L 1NJ9A 5EO0B 5DRXB 3HNVL 4QNPE 2I60L 2UUDK 5F1KC 4DO4A 3MV8D 3DXAA 3TNMB 3REWB 3CTTA 2JFEX 1KPVA 2R8SL 2RB8A 4FS0A 1UM4H 5C92A 3T65B 2QJDA 2B5IC 3B2UC 4QHKJ 1JGDB 4GQQA 1XMWA 4LNVA 1JL8A 4U6YA 3GSUA 4ZTPH 3STLB 3GJEB 4POUB 2CLRB 2R4RL 3P3YA 1WP6A 2FE0A 4X6DE 4PRHE 1JF1A 3N85H 3FN3A 4M4PA 3SDYL 3VWKD 4JHZA 4ZOBA 4U1LA 1OARH 3Q3GB 4HUVA 3PWVA 5DQJA 4WV1C 4Z7NF 3K80A 4QHMB 4NF7A 3AMLA 4Z2GA 1S3KH 2FJGA 5IB1A 4LF3B 4PRIB 3BUBA 4AXNA 1FZMA 1V0NA 3MGAA 4PJ9A 3C5ZB 1GSMA 3OAYH 1GGTA 3FO1A 1G01A 5IVZB 1KPRB 4EDWL 4ODHH 3KPPA 4YHKH 3GRWH 5D71L 4TUFA 5IWLC 4D6HA 2WZHA 1CLYL 1KGXA 1J0IA 4C58B 1CF8L 1KTLB 3PABB 4ELMB 1JZ2A 1OBAA 5DHVB 1CXFA 4N90D 3RPIA 5AZEL 4MAUH 5I1CH 4Q0XH 1EVTC 5EUOE 3VGDA 1AQ0A 3E0GA 3L7FB 4TQEL 5DD1L 1E6PA 1ZT7B 2JLLA 1W1PA 4CKVX 2W9DH 3O0RL 3FN0L 2FEDC 2OL3A 4M43L 3RZCC 3N9KA 4DVRH 1BGXL 2W60A 4J23A 1MFBH 1NEZG 3QHMA 3QEHB 1A3HA 1VBUA 2HFFB 3N06B 3NGBC 1NCNA 3G5ZB 3LS4L 5ADOL 3FOLB 1GZPB 4PJAB 1IV8A 4M03A 1US3A 2F8OA 2VZ3A 1N2RB 3TJEL 3EJTA 2FYYA 1B3ZA 4PP2A 1MCOH 3ULVD 3U7WL 4U1HB 2ZUSA 1CFTA 1F3DJ 4YHLL 3LDBC 1QNZL 1OD0A 1JTTA 3ALXA 3PV6B 3OKKA 3RNKA 2YSSB 1MFAL 3VG9B 4UILH 3VWJD 5E5UB 3V5HA 5F3BB 2WC4A 1QBLH 1UGNA 5CJOH 4I3SH 5DFVC 2HN7B 3AS3A 3LD8C 3WD3A 4JY6A 1BJ8A 4YHYC 1CT8B 2JJTA 3AREC 3FZUC 1F11A 3WJLC 1I7RB 4LK4A 3KAAA 1G7IA 1QZ1A 43C9B 4MVBD 1RULL 4UQ3A 4I13B 1ODAA 4TUJB 4JHAH 1UWIA 2WB5A 4JKWA 4U5KA 1GOIA 5C1MB 5TGBA 5IW3A 3ALWA 2GSIB 1J1XL 1JGUL 2WBJD 3CUPA 2BNUB 2FBOJ 2YD1A 4OLWL 4ODXB 5ELIA 3IFLH 4IUGA 4LLMB 1OQOA 1B4RA 2IANA 3V5KB 1YEEL 4QT5A 5EC1B 1AI1H 1KCVL 1RJYB 1MIML 2JIEA 1DVFD 3IXAB 3HG4A 4WI6A 1YMMB 3QXDA 4L3AA 4XXDA 4M7LL 3V0VB 1KCKA 1E43A 3WBAA 3RVXC 1E72M 3GK8L 3KPNB 2J77A 4RMSA 3UERA 4HJJL 4KRPB 5ERWA 4JDTL 3UTSA 1ZOXA 4P46D 2W65B 4F7MB 4FXGA 4OBRA 3BW9B 3NCOA 2CUHA 1CR9L 1WKYA 5C3TA 4U3AA 1V6VA 4EE9A 1E3XA 4IMKC 4N1CA 2APXA 1L9NA 4C57C 5DF0A 2R23A 2Y2WA 4PJEE 2QQNH 4XVSL 2FIRT 2VLKB 4WDIB 3TOPA 2BVOB 2D31A 3GSNB 2JIWA 4PJGF 1G1CA 2E27L 2O5XL 1E6OL 4XWOC 1BEYL 4UNTA 3SKMA 4PJ7E 1BAFL 5DJ2B 2A6IB 4JR9L 4DCQB 3QUKA 2C7UB 2F5BL 3L3KB 4L3EE 2MFNA 3BP7B 3G6AB 2VWEC 4UFJA 3LXAA 2NY5H 1WBYA 3VH8A 3VDCA 1LO4H 3DGGA 3VIMA 2X4OA 4IOFC 1NBVL 2GTWA 4DK3A 4UCFA 2IPKB 4HF5L 4GJTB 1MNUH 4E0RB 5E99L 5CUSH 3GSRB 1OTSC 4LLWB 5T1DH 3HI6L 1N7ML 1SQ2N 2NR6C 3DHUA 5F71A 4F8XA 4AENB 3SCRA 1I1RA 4CDHA 4NSKB 1BJ1J 3SDAB 3P77B 2E8ZA 4EDXB 4C59B 4UUJA 4F7PB 3I3BA 1INEH 4RWYH 3QWQB 1KEGL 5IJKC 1KBKA 5LBSL 3MLSL 5CZVH 5AUMA 1F58H 1N4XH 2FX9L 3KYOB 5MENE 3ABZA 3OG2A 2R0KL 3OR6A 3ARTA 4LLQA 4UAOC 4HKJA 1BG4A 1F4YL 2AERT 4ZFZB 4MTVA 1JPFB 3SY0B 3HRZA 5HSFA 1WFOA 4QHMA 3NIGF 4X4YA 4ODWB 3SCPA 4MA8L 4W84A 5M03A 3AOFA 1KGUA 3DO7B 1G7PA 1PW3A 4LP5A 4E41A 4WHTB 4E4PA 4CVXB 4LU5L 2IAMD 5E2JA 3VFOA 5A8PA 3F7PC 1W2PA 2X2YA 4X9BA 4K3EL 4M8QA 2W0LA 2JJVA 1C5CH 2ID5A 2VISA 3U9UB 4H2CA 1FH5L 3RL2B 3VFTB 5IMLB 5I8KL 3BYTA 3TIDB 3RPKA 4R27A 1G6RA 3WD4A 4GW1A 3BD3A 2Z31B 1YDPA 2LABA 1FCCA 2EO9A 2BNQA 2WVVB 3VM7A 1G7QB 2GJ6B 3P4NA 4UB0H 4N0YH 2OYPA 5C9JB 5I1EL 1YEKH 3FO2A 3IAQA 3IKKA 1ZTXL 3BH8A 2XA8L 5EZJB 1MCHA 4KJPD 4MNQD 1FG2A 5D7JB 3VI4F 3QEGL 3UTQB 2A9NL 4PJIE 5CBAA 4LCWA 4IIQA 1WO2A 1XF2B 3QA3A 1FYTE 2EECA 1AHWA 1HXYA 1S7VA 4IOIA 4JFQB 4EBQH 1BLIA 1T5WB 3TBWA 4ETQB 5HGGS 1Q0YH 2R2BB 1FVCB 5ID0B 1HSAA 3QCUL 5MEPA 4XNYL 2B0SH 1MRDL 4S0SD 3SUSA 3K4DA 1GOKA 1T20B 3DI2B 2UYLB 3LMJH 3LPFA 1S78D 3AJ7A 3MLZH 4M3JA 5EO1A 5BMFH 3EBAA 5C0CD 1R3JA 2VDPH 4NQVA 2G8ZA 3VIHA 2ZUYA 3QNYA 3DX0A 2NYYC 1PKQA 2D3VA 2EIZA 3PQYE 3BP5A 4ONGL 2G4FA 4L3ED 5I18L 4WWKC 3MA7A 3PZIA 5KZCB 3MO1A 3B9KA 3FB5B 5FYKU 2AKRB 4U31A 4F7CB 2DBLH 3KLKA 3N0AA 1LHZA 2BMKB 4M9OA 3NSXA 1LK2B 3CK0H 3UEQA 1L7IL 4IRJD 4XX1G 5J9PA 4FNUA 4O2CA 5BUGA 4JFFE 5HOSA 3GXMA 1P4LB 4TNVK 3LEYL 4U33A 4LVHC 5FO9A 3QGVA 3ARBA 4NZUH 1KULA 4NYLA 1JWMA 1CXEA 3T2NL 3FB8A 1YECH 2WVUA 3IS0X 3QRGH 2J47A 1MWAH 3L5HA 5GGVH 4G6FD 3LKOA 1KTDA