2YOCA

Crystal structure of pula from klebsiella oxytoca
Total Genus 335
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
335
sequence length
1051
structure length
1051
Chain Sequence
DVVVRLPDVAVPGEAVTAVENQAVIHLVDIAGITSSSAADYSSKNLYLWNNETCDALSAPVADWNDVSTTPSGSDKYGPYWVIPLNKESGCINVIVRDGTDKLIDSDLRVAFGDFTDRTVSVIAGNSAVYDSRADAFRAAFGVALAEAHWVDKNTLLWPGGQDKPIVRLYYSHSSKVAADGEGKFTDRYLKLTPTTVSQQVSMRFPHLSSYAAFKLPDNANVDELLQGETVAIAAAEDGILISATQVQTAGVLDDAYAEAAEALSYGAQLADGGVTFRVWAPTAQQVDVVVYSADKKVIGSHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPDGWDNLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAGDSNMVQHLKTLSASGVTHVELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLNQLKQSDSQDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTTRIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMGYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDSVRGGGPFDSGDALRQNQGIGSGAGVLPNELASLSDDQVRHLADLTRLGMAGNLADFVMIDKDGAAKKGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKASQEADLATRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRISDDGSNYEVITRVKEMVATPGEAELKQMTAFYQELTELRKSSPLFTLGDGSAVMKRVDFRNTGSDQQAGLLVMTVDDGMKAGASLDSRLDGLVVAINAAPESRTLNEFAGETLQLSAIQQTAGENSLANGVQIAADGTVTLPAWSVAVLELPQGEAQGAGLPVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PULLULANASE
publication title Structural Basis of Pullulanase Membrane Binding and Secretion Revealed by X-Ray Crystallography, Molecular Dynamics and Biochemical Analysis
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Hydrolase
total genus 335
structure length 1051
sequence length 1051
chains with identical sequence B
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
A PF03714 PUD Bacterial pullanase-associated domain
A PF11852 DUF3372 Domain of unknown function (DUF3372)
A PF17967 Pullulanase_N2 Pullulanase N2 domain
A PF18494 Pullulanase_Ins Pullulanase Ins domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yocA03
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yocA01
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2yocA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2yocA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yocA04
4XGZA 2OWXA 4I77L 2G75B 3CZGA 3O2VL 4NKQB 2AERT 4KMQA 4JFWA 3ZIZA 1DDHA 3GBLA 3F5WB 5C9JA 4N5ED 4RFOH 3GMOB 2YPLE 1BGAA 4E9LA 4PJ9A 3PHQB 4I4WA 3GXDA 1B0RB 3FXYA 1BQUA 2PW1A 5HI3C 3OL2A 2YUXA 3FO2B 5CD5C 4C55A 3EDDA 5CJQH 1HYSD 1FAIL 2MKLC 1CE1L 2UVFA 3SEPA 3ZKMD 5T5FL 3TOPA 3D4ZA 1KN4H 1FDLH 1A6PA 4N0CD 5DJZB 1T2JA 3REVA 2FX8L 3F5KA 1J1PL 1QQDB 1TJIL 1VGEH 4KJQD 1T4KB 3JXAA 5F96L 5D71L 3GKWH 2CXKA 4XP9H 2P47B 4K23H 1IM3A 4RGMB 1FN4A 3JV4B 1GW1A 4DGIH 1MJ8L 1G7MA 1GGBL 3B5TA 3I50H 1L6ZA 4UMGA 4CCEA 3LDBB 5FA3B 5D9SB 3NGBC 4LMQI 1WCBB 5INDB 2XNAA 1PY9A 1A4KB 3BKMH 3IDXL 5AYUH 2EXOA 2VLRD 3EOBB 5M5DA 3CHEA 2NY4B 4E5XA 3HNTL 3HC4L 4YUEH 4YC2B 3L3HB 2VCCA 2LFGA 3GO1H 2NW3A 1TCRA 4M48H 1AKJA 5CJ5A 3QDJB 3K4ZA 2BSTA 4AL8L 3ULSB 2HT2C 5GZND 4JG0L 3L5XL 4IS6A 4PJFF 4IJ3B 4LXFA 4AH2A 4PJGF 4Y19D 3Q6FA 1IL1A 1U8NA 4ZOCA 3K3QA 1HJUA 4FQXA 3SDYH 2F8QA 3OPZL 5A1AA 5J1AA 3OKEB 1PEWA 2VLMD 3QZWB 1NCBL 4WHTB 5I1AB 4HMEA 2LTQC 2VXVL 1QNZL 1UD3A 1J9CT 3VU2A 1HI6A 4H8WH 5L7XH 2L7JA 2HJLA 4U0RB 1QFUL 2OK0H 2YBRA 3EJJX 1BOGA 3BEWA 5IG7A 4ZFZB 1SMOA 3HR6A 2CK0L 4L1HA 3FFDB 1WJ3A 3BZ4B 3OA5A 4CD4A 1U8MB 3WFLA 3DROB 3N0PB 5HHNA 4EXKA 2ZOLB 4PJ8D 5DURB 3CXHJ 1RK0A 3H9SB 5AD0A 4NI3A 4JQVA 3SOBL 5C07D 1MFEH 2CESA 3MCG1 1KFWA 3P77B 3O6FA 4PLKC 3I84A 3IFOA 5F3HB 1CXKA 3CLFL 1GVYA 1AD0B 3NCYP 5IB3A 1M71B 3HE7C 2HWZL 2WIIB 3BYTA 1U6AH 2GSGB 1XR8B 4LPCA 2EAEA 3HI1B 2QQLH 1IILE 3FN0L 1OCQA 4FNTA 1KPVB 4LSVH 3P30H 4MA3B 3NCFB 1B31A 5I77A 3PHOB 1EHXA 5CSUA 3DSFH 4MB3A 1YNKL 2XN0A 2FEEL 3QI9D 1NC4A 3VXUE 1X5GA 4I3SL 4HS3B 5DA4A 2FBJH 1NP2A 4KRLB 3GMPB 4BQ5A 5FYKD 3C2SA 3WD2A 3GMQA 4R4ND 5EBLA 5BO1H 5CUSH 2EE6A 2XYLA 2WVSA 1FL5B 1WEJL 3NTCL 5DRZA 1A7QL 2H32A 3CZEA 1C1EL 4V2BA 1T03H 3I3EA 4F8XA 3VFRB 4JFHD 5IV2B 1MRFH 4UT7H 5MEOB 1UXWB 3RWJB 4OAWB 3ZKXB 1H0GA 2YPLD 4AG4L 3B9KD 1X5KA 4P9MH 4HH8A 5HYIA 5KN5B 1LK3H 2XQBL 2DLEA 2IPKB 1R0AL 4XZBA 3AAZB 3MLSL 5ICXB 3TESA 1U8IA 1CF8H 3OKLB 3AIRA 2P49B 5EIIB 2DIJA 5CD3A 1MOEA 2Q8AH 4JPIA 5D93B 4K55A 2CKSA 3ARBC 4JPVH 4Z7UE 3QWOA 3PUCA 3AIBA 3GSVA 3SDDA 3RVVC 3OGCA 1KENL 4X99B 4B15A 1I9RL 1A3HA 2WP3O 4LLDA 4QTHB 1OTSD 3EKCA 4ODXA 5GGQH 1ZHBA 3T3PF 2W38A 3I9GH 4E41D 4F37K 5HY9A 1G6VK 2WCGA 3DURB 4U5KA 1P5UA 2IADB 2HLAA 3X14A 4PUEA 3RWHA 4JY5L 4JQXC 3SDXA 5A8OA 5IVXE 1WK0A 4WU7B 1M4KA 4PJ5B 2BXZA 3KLDA 4M1GH 1TNNA 1IEBB 1V8HA 3VXOB 3BX7C 5HHXL 1YY9D 4HK3J 4RA0C 2C4FT 4FQPA 5CBEA 2V7NA 1LVEA 2Q8BL 2YC1A 1IFHL 4OZGF 5I0ZA 1I1AC 2GJXA 1P6FA 5FGBC 3JWNC 3IS1X 2OSWA 3MODH 4ACPA 2WHMA 4JREC 5C3TA 5AAWA 3TTYA 3DRTB 4NHUA 4FABL 4MQ7B 3BEVB 1NWRA 3N0AA 4DUWA 3RI5K 4Z8FL 1SEQL 1MRDL 4HT1H 3H7BB 2R1WB 1D5BA 4DM1A 4S1DD 3C9NB 3KPQA 2X05A 1HNGA 1ES0A 1URLA 2JCCE 1L7IH 4G6FD 3L3OA 4L3CB 1OP9A 3DX9B 1AR1D 4KV5F 4P7LA 3O2WH 1IKFH 4NZRH 5GRJL 2ICWJ 5EUKB 2V9RA 2HFFB 1PBYA 2PO6A 1OD8A 4Z2IA 4P3CH 3LKNA 2YDRA 2W92A 3DGGB 3FOMA 4OFYD 2DLFH 1CICC 3QUXD 4U6TA 4N1CA 1JZ8A 4R0LB 4N8PA 3VXSE 2V2XA 2OJZL 1E0OB 1QVBA 1AE6H 1ISWA 4HWEL 2GFBA 4U1IA 2GY7B 4F2MA 3CGTA 2F5AL 5DZLA 3SE9H 2Q7YA 1LEIA 1M7IB 3GNMH 4W70A 5ACLA 2CUHA 1AHWC 1QYGH 4LOUC 3WDQA 5JZ7C 2FR4A 1HILB 4ONHB 5JUEL 3GBNH 4BJLA 4BH7B 4HIIA 4NZDA 1UB6A 4NPYB 5ID1B 1JGDA 2A73A 5FYJE 4LAQL 4D8PB 1Z9MA 1OPGH 1ZVHA 4WNQB 5HYJE 1V08A 3WIJA 4UQAA 1BP3B 2QADB 4ZUTB 1A2YA 4I0KA 3KLAB 5JXAL 1AMYA 2WWDA 3RWGB 3MRNA 1HKMA 1LO0L 1SJHB 2JIWA 4NP4H 1GOKA 5C0GB 3D5OF 1FVDB 3ZJ7A 5FIPA 2B0SH 3ARUA 1KXHA 3LQMA 4X7EC 4K68A 4KJWC 1KCLA 3RX5A 4C4KO 3FFCE 1DJSA 4OZIA 5DHXB 4YHMH 1AO7A 4Y4FC 1CD9B 4EN3A 3ZSTA 4MA1B 2CNCA 2EDFA 1TXKA 2DQIH 4M7KH 4GRLC 3ALFA 1Z5LB 5HDQL 3FB8A 1ZA6A 4UZSA 2MQ0A 1QTYT 5E03A 3K8KA 5D2LF 3HFMH 1A6VL 4OF6A 3BKYH 3HLAA 1CT8B 4ZAKA 4H7VA 3HE6B 2WHLA 2ILLA 4WEBH 1B4RA 3FQTA 2I9LB 4HXAL 1U92A 4HXBL 4OKVB 3SKMB 1AGCB 3MCLL 1GZQA 4UQCA 4KC3B 4KQ3L 1DFBH 4NSKA 5EOCJ 3PWNB 1BSIA 1MW2A 3HN3A 5DHVH 4TTDD 1EEQA 3C09C 5IQ7H 2WZEA 1BHGA 4NRXA 4PRBB 5FIEA 1RUAH 4LEXL 5IM7A 1BREA 3BZEA 5BS0B 5B38A 1WAAE 5E8OA 2V5SA 3BIBX 2N7AA 3KYMB 3CZSA 2FEEI 4RMQA 4C56A 2FIKA 5EZIH 4PRIA 4L4VD 3QOKA 3WIFA 5D9MA 4NGHL 4NQCA 5D6CA 5TDNB 1I8MB 4QTIL 3NIGF 3O9WC 2WW5A 4FS0A 3T65B 1MHPL 2IPUK 3JTSB 4QRUA 2JJSA 3MUJA 2JK5B 4JANA 3U9PH 4DAGH 1HHGB 1AP2B 2JKXA 2AKRB 3RWIA 4APQC 4ATDA 4U1NA 3F65A 2OLDA 3RBGA 1KB5L 3F5LA 5DUMH 3DRQA 3WNNA 1S3KL 3BP5A 2XA8L 3D18B 6TAAA 4PRNB 1QFHA 1IZJA 5HD8D 2F58H 5EBWB 2X09A 3IFNL 4MS8C 5JW3H 4GMTH 1YEJH 4G7VL 5FF6A 1GUVA 2C1OA 3RGVC 3SN6N 5FOJA 3LZFH 3EDEA 3SUUA 2M2DA 5ACZA 1ZXQA 4EDXB 2YD8A 5CAYB 3O3AB 1TQUA 3N85L 1MCDA 1MF2H 5ALBL 5CBAA 5D7SL 4WW1B 3NFPA 2VLJA 2OTWB 3H9YA 5HVHC 2KH2B 2VC2H 3VXSD 1L6XA 5E95B 5KSBA 4XP5L 1TJHL 2JELH 4H1LG 1ORQB 1GYAA 1H15B 4W88A 5C2UB 1JHTA 3WN5C 3PWPD 2O5ZH 5A2FA 2VAJA 1ZK9A 4TVPH 5DD3H 3WD5L 4N9OB 2W63A 3D69A 3ARGA 4HBCH 2KKQA 5E2WH 5HHPA 3WIIH 2FJHB 3CUFA 4JG1L 4J12A 4PJ7B 4F15B 5EU6E 5FYJD 3RPIB 4IDJH 1B90A 1GNXA 4OSUH 5LYRA 1NGZA 1ND0B 3LHPH 1QSFA 1WZMA 5HYJD 3O2DH 5HYSB 2GYSA 4X4XA 1UR2A 4H20L 5FUZH 4J8RB 4B3KA 3VW3L 3V0WL 3MA9H 3CU7A 3V0HA 4PJBB 2AMGA 2YA1A 1EAPA 1LL7A 2W60A 1UG9A 2MCG1 2B4CC 4RGND 1ZLVH 5D8JH 3QDME 2X1XR 5DJ2A 2D23A 1DLFL 3ULUC 5A2IH 3RRQA 3W2DH 4XCEA 4YHIA 3HE7A 4ZEPA 2R0LL 4I0PC 5C70A 2WBWB 5TDPB 1WZAA 1NMCB 1IVLA 3FQRA 5EUOA 1KLUA 1XGQA 5DEFA 5IBLC 3NAAL 5I71C 5DD1L 1NBVL 4X4MA 5CP7B 5MEQB 4WRLA 3ZJKA 1MEXH 3ABZA 3U0WL 3DXAE 1GGCL 4IRSD 4OLVH 2FSEA 3R0NA 4U6YA 4X0NA 1WC7A 2YRPA 5GNZA 1A6WL 3RTQD 5FCUH 2EEDA 3APGA 4P7NA 4XCNB 5J0BA 4XBGA 3OF6A 2IQ9H 3KS0H 3VWKB 5TQ2H 2B5IC 5I23A 2A77H 4G6JH 4MQTB 4EI5D 4Z2LA 5IROC 2CGRH 3VIMA 1WIUA 1A22B 1IAIL 3HZYA 4ELKB 3WUWG 1OF2B 1QLEL 3HG1A 4KRMB 2XVKA 1KB5A 5BWFA 4WCYH 2HFEB 3QFDB 4PJCE 2R69H 3NZHL 2DI7A 4HK3N 3S3JA 4PMQA 3KPRB 2JJUA 4NO0D 1R33A 1EMTL 3WHE0 1V6XA 3ULVE 2DQHL 1VGKA 5MERA 1MUJB 1ZS8A 2D3VA 5EN2A 4G8FB 1HOCA 2ZSWA 5F9OL 4I18C 1T6VN 2EADA 1SJEA 2VIRA 2X4SB 3D9AH 3MRKB 4AEFA 4C59B 4S1RL 4OF3A 1R3LB 2FWOB 3ARXA 2MCPH 1ORSB 2VWEC 2H9GA 3G6DH 3VFGH 1H09A 2VDQH 1K8DA 3ARBA 2FCBA 4OM0H 4DJMA 4DVRL 3D4YA 3Q2CA 3MRIA 2ATPA 2HAZA 4P7OA 1RZGB 1YMME 3QT2A 3B4NA 4R26H 1C92A 4WDIA 1U8QA 3ZDZE 3UBXB 1AI1H 5IJKA 1JNDA 4PTUA 4Z95L 4U4BA 2RR3A 3QPQC 4K3JL 2HG5B 1O6IA 3O45B 5INCB 2J62A 5GGRY 3UJIL 2VERN 2OYMA 1H0IA 4JCLA 1L7TL 4JQXA 5L9DL 4PJ5E 3MLTB 3FQWA 3ARDD 3CFDB 3OZ9L 4XPAH 1S46A 4N0RA 4JL1A 5D1QC 2A9MH 4JKWA 3RNQA 2H8PA 4AZCA 4R6UA 3BKCH 1PIFA 1D9KC 1DE4A 4ODHH 4Y4KC 2NXYB 3O3BA 1HQ4A 1I1AA 1H2JA 2I07B 2F54D 5FGBA 4ZDHA 5BRZE 2XKNA 3VFNA 1KGXA 1JZ5A 1JCKA 4Z5RA 1BVLB 3BH8B 1IEAA 3V4UL 3H7LA 5C8JA 4BH8A 1QG3A 3B2VL 1MCJA 1ZA3A 4HPYL 3RWDB 2BVOA 1K5NB 2ZOKB 3MRQB 3VG9C 1LEKA 1N3NB 5TQ0H 5F1IA 5EU4B 3MLZH 1T83A 4ZO6A 3VIKA 4K9EC 1KB9J 4LP5A 5FB8A 2G41A 2I24N 1XF4B 1H3TA 1MFDH 4ZE4A 3QIBC 2R0WL 4NRZA 4HUVA 3DGCR 5E08H 5IR1A 5JA9A 1CFBA 2CIIA 2XZAH 2P5WE 3WDIA 4OZFG 3RBSA 5EU6D 4PY7A 3TH4T 4YDVA 3GXNA 5CSZB 2VX6A 5T3ZL 4OV5B 2OBGA 3O8XC 3QNZA 4DGVH 2R29H 1EJOL 3BGFB 1IM9A 5D7IB 3U1SH 3MBEC 3NCJH 2NY7L 1DVFD 3H0TB 4GG6A 1BZQK 5HPCA 1QSVA 1JGUH 1YN6B 4TSBH 5EBMA 4F9DA 3BN9C 2P8MA 3QDMD 1J1OH 4OLXL 2FE0A 3D25A 3ZTNH 2J74A 1UVQA 2IQAB 1SEBB 4G6AC 2Q6WA 3UC0H 5IHBA 1F97A 3JTTB 2RQ8A 3IDJB 3DVNB 1UT9A 4P59L 3S35L 1H3XA 3QNYA 4YDKL 5D7JB 2IJ0C 1NEZB 2BDNH 4YXHH 3PNWA 2UZYB 2HMID 3HZKB 2FD6H 2MHAA 2P7TB 3CNKA 3DXAD 3K4AA 3D85B 1KTKE 4MDJA 2Z93B 3WS6C 4R7DB 2XQYG 3BVTA 3WY1A 4XMPL 4ZTOH 4JFQA 5E7BA 4AT6A 2Y8KA 3E6FB 3P9WB 2UY3A 4GSDL 4PG9A 2ICES 1OCWH 3CU1A 1YPZB 5C6PB 5BQ7A 2A3HA 2X4UA 4YO0B 5LGHL 4FNSA 4PTMA 2ENYA 4OIAA 4G8GD 4UOW0 1EDQA 3VXQA 3ARVA 2DLTA 1DTUA 4BS0A 2B8OT 3FRPG 4N9GA 4Y4FA 4PB9L 4QRRA 5JR1H 1KTLB 5L2KD 4LL9A 4DOHB 5LAXA 5GRZA 3FOLA 1UWUA 4ZPTA 4AY1A 1AJ7L 4CN1A 4GRLA 5GS0D 4P4KC 3O6AA 3ULVD 3C60B 1UWGH 5D9NA 1OLLA 5E2UH 3HCVB 4ZUVB 2BNQB 1ZHLB 2IH1B 4HOXA 5BMFH 1R86A 4AEEA 5JHDE 1E6PA 4WI5A 3G5XB 5CKAA 1D5RA 1NL0H 2QQNL 2EDNA 3QUYC 4GOSA 3VO0A 1MQRA 4OD1L 3DUUB 5EU5B 3WXVL 2CIPA 5D7KD 4Z7VA 3KGRA 1KBGH 2W91A 4QEGA 4YDJA 5DUPL 4EUPG 4HU8A 3U6RB 1YMMD 4AIUA 4FQCH 5DI8B 2Y24A 4Q7DA 3MLVL 5IFAL 4H25A 3G08B 1NBZA 2NW2B 4XZWA 3ULUL 1LL4A 5BS0E 3WDPP 3RY5A 4JFXB 5FYLH 5AC5A 4HHAA 3PHSA 3H42H 3NPSC 3JV5A 5FHBH 1JXKA 1E56A 3V8CA 3DNKA 4XI5C 4LLAA 5D5MA 5EZLA 2XWJA 2B2XL 2X2IA 1U2CA 2EE9A 3O9WA 3TIEB 5IMMB 3U9UA 4L9DA 5F21B 5EFIA 3O11B 5DRWA 1XGYH 2QSTA 3RVXD 3V6ZA 4W7WA 2HKHL 4I0CC 2G2RA 4M80A 2H6PB 2CDEB 4U31A 4YHGA 2Y07H 1BFVL 3HUJE 2C3HA 1GOFA 2ADJB 4APQA 1HTYA 5BRZD 4E8CA 5J13B 4PSRA 1H3GA 4PFEA 4QYOA 1G7LB 1RZJC 4OGYH 5EZJA 3QYCA 4P2QB 2E9IA 4FK9A 3VGFA 4TPRL 5KSAD 2Z0BA 5I79A 5I0DA 1GORA 5CZVH 3RDTC 3W5MA 3WLWC 1U8HB 4ZFGL 5A8QA 4L29B 3GSNL 2D9CA 5HVGB 1P7QD 3GIVA 4JLRA 3PGCB 4PGDB 2DICA 3MUY1 4ENED 4PJIB 3OLGA 1FZMB 4LSPH 4XVJL 3ZE1F 2CD0A 1LK2A 2WBJC 3CVHB 4OOZA 3IKCB 1KEMH 4YFEA 3AMKA 1TQSA 2Z1KA 2XG5A 5DGQA 4JPWL 4FA8A 4QP0A 3QIWD 5D1XD 5FL0A 5FAAA 3UZQA 1BYAA 3MRFA 2J44A 2ED7A 4YHYB 4HA4A 4NN5C 3VE0A 1A14H 3ZDXE 5C0EA 5CMAA 1A4JB 4PRDB 4U1JA 3KYAA 3NCMA 4KTEL 5DQ9B 3WN5A 3S8WA 2PBGA 4M82A 2C8NA 3RJXA 4JDTL 5DO8A 1XR9A 5TE4L 5CEYB 2P8LA 3MROB 4P2OC 2BJMH 5JPMA 1JZ7A 1E3ZA 2J8UB 1J8HA 4ZODA 2Z8SA 4KTDL 5ANMA 5DQDL 5LGJB 5C0RH 2W0FA 5IBUG 1D5MB 3VXMB 1U8OA 3C6SB 3V5KA 4XB8A 3KHQA 4XC1H 4Z6AT 3QIUB 2JB6A 5HHOB 4UFMA 4U7KA 5I1CL 3MTRA 3G5ZA 4QT5B 5EU7C 5B3JF 2BOBB 2YSSA 1QOKA 4IRJA 4KXZH 4BFIA 4AENA 1FNGA 4KMTH 5BOPA 2D7NA 1XV8A 2BVQA 1VSCA 5A16A 1UKSA 1TZHB 2D7MA 5F9WC 1U8JB 4I0PA 5TH2A 4AMKH 5ABEA 1CVSC 4K9EL 4NNYB 2FGLA 3P11L 4XZUB 3OXRA 1J8KA 1TETH 4N0UB 4W7UA 5IB4A 2P8PA 3SGDI 1KACB 1NLBL 4D9LH 3UTTA 2DH2A 3GH5A 5EIQA 2J6EL 2VDLL 3PDGA 5BZWA 1EO7A 2APBA 1GPOL 2X8RA 2BNUA 1Q9OB 1K6AA 5FOOA 4HKXB 3L5WB 1F4HA 4U1HA 2V2TA 4WUUA 1ZBWA 1KIQB 5LQBH 2EC9T 3CVHH 4YHPA 3L7EB 3U0TB 4OD2A 4XNQA 1R5IA 3MRPB 4JRYD 1R3JA 3LS5L 4LLYB 2W65A 4PR5A 3S34H 2WMHA 3O3UN 4CUCA 2O61A 2YMXH 3UO1H 1C08B 1EAJA 2X89D 5HGDB 3AYRA 2X1PA 1NARA 4FQ1H 4QCIB 3GSNA 1U3HB 2J79A 1ZU8A 1S7RB 1E6XM 3PL6C 1FL6A 3T4AB 1VFOA 2WANA 4PJAF 3WNMA 4PYHA 4ODWB 5BRQA 5C0DB 1KJ2L 3LEVH 1RVFL 5C9KA 2G8ZA 2DDQL 2WWMC 4FQLH 2Q8XA 5DO2C 2N7BA 3BPLB 5C2BH 4MDIB 3AGVA 4DKEL 2F1BA 1ZWIA 1YUHB 1KGUA 2QQQA 1JNNL 1O0VA 2CMRL 5EA0H 2YBTA 3O4LA 4JGUA 3VD3A 4PY8I 4WWID 3RAJH 5IHSA 3FT3B 5I8OL 2R15A 5HGHA 3I75A 4K07A 4OZ4A 4DZBB 5F93C 3UYRL 2P45B 2ZSVB 1R5WA 1YECH 4ZOBA 3BDYL 4CU6A 3O6KH 5ISZE 5I5RA 3KDMB 4OLUH 1HNYA 1XGUB 4U1SB 4YFLI 3LH2L 4X6DA 4N5EC 3GK8L 1KJ3H 1MFAL 4K7PH 4JHBA 3BP4A 4FTVE 3ZJ8A 2IGFH 2GJZA 2P24B 5D1QA 4LVHC 4LIQE 3IDNB 3BPNB 5DEZA 5K9KA 4M5ZH 3VXNA 3GHBL 1D9KA 1ZLUK 3HG5A 4Y4KA 3TA3D 1MCRA 5TPWH 4JRXB 4X6CF 1BEYL 4B50A 4Q2ZB 4OCNC 1HYSC 1JFHA 2UY2A 2VL4A 1BQLH 3ZKMC 2QQKH 1KGCE 1GGIH 5ABHA 1JAEA 1F3RB 5KJRH 3MXVH 4N0CC 4MADA 1X4YA 1IGIH 1P6WA 2IFGA 2WP3T 2B7DT 3OKMA 4CW1B 4WGWB 5KVMC 1TVHA 3C08L 4KRNA 1H41A 1XF2A 2VX5A 3REWB 3FT2B 4Y4HB 1BZ7A 4H26B 1SM3L 3GDBA 3LKQB 4WO4D 3A21A 3TBWB 1EA9C 2XV6B 4QHNB 2J6EA 4XGZB 1C8YA 4CCCA 1H4PA 3LRKA 4WJXA 1T2XA 5D7IE 2ERJC 2V5DA 3IJYA 5C9JB 3AXXA 3VCLA 3CHFA 1QI5A 1OP3H 4JPKH 5E24E 2ARJA 5FYLE 2PW1B 1R46A 5GZNC 1CG9B 1RZJL 5KAQF 1LDPL 3VRJA 5CQ1A 1NCAH 1XYZA 4FMKA 2VXSH 2EDWA 5DZNA 4YBLC 2MSPA 1FYHB 2YUZA 2DQFB 3UP1A 3REVB 2LU4A 4QDMA 4LCCB 1KJ2A 4G9FE 4DWHA 4LSTL 1W9BM 2DQDL 4X4YB 5E6IB 3MLYL 4OCXH 1VPOL 3QXVA 5A2CA 4YHKH 3WS6A 5JQ6L 2RFXA 1WKYA 4NQDD 1WFNA 1G7MB 5J3HD 3M8OL 2ARJQ 1H49A 4DW2L 4W89A 1EEYB 4L5FH 4TOQA 3C2AL 4HIEA 4PJ8C 4XX6A 3O6MH 3BSHA 5ALCH 2GQHA 3W82A 1PQZA 4V1DA 5JXED 4J4PA 4NQEA 4PS4L 3DVIA 3OR6B 4ORGA 4K3EL 4E5XB 1BBDH 3PP3H 4DQOH 1BIHA 4DOHE 1LQ0A 4N90D 1BGGA 2FX7H 2NW3B 5BZDA 5D7LD 3MRBB 2XXMB 5E1AA 1PKQB 1AKJB 5IKCB 4P4KA 4OCWH 2BNQE 6FABH 4KDTA 3V0JA 5A3IC 2IAMA 3QUMH 5IW1A 1HHIA 2CBUA 3AY4C 4P2RA 5A43C 3QUYA 4FNLH 3W24A 1OAYL 1E0WA 1IL1B 5F7YC 2DI9A 3OG2A 3QI9C 4FQXB 2YEZA 1KXTA 2E4TA 2J4WL 5D2NA 5I1JL 3IT8D 3S88L 1QACA 3ES6B 5DRXB 4R4NC 5F7WC 3RA7L 1B0IA 4H88L 1HI6B 1WTGT 4JO3H 4RAHA 1N2RB 1SYSA 2HJLB 3KXFD 4P49A 2YBRB 4NZTL 1R7OA 4C4KT 3FQNA 3BEWB 5IG7B 4XP1L 3W29A 3QHFL 4PJDA 4JHZA 5ISZD 1UKPA 2AV7A 1XF3A 2OSLA 5LXGL 3CH9A 4UQDA 1VFUA 5E00B 1M7XA 4GAGL 2PYEE 1IGTA 3B9KC 1JJUA 3UTZA 4N8VG 3L1OL 1A8JH 1LO3H 1AIFA 1I9JL 5DHYA 3O6FB 4JFUA 3OGSA 3FO1A 5E9DD 3IFOB 3G6JA 3OLIA 4E42A 4HUWB 2WV3A 2ZXDA 3BQUD 4BKLA 1KWKA 1UC6A 1WWBX 2Y5EA 3ARFD 2VITA 5C08A 4D0DA 2YUVA 1NC2B 2J12B 2HFGH 1U3ZA 1TQWA 4ZO7A 4MMXC 2O5XL 1MCQA 3GJFB 5ETUB 2YJQA 3BKJL 4MNGA 3U7BA 2X4QB 3MV8A 3MXWH 1NC4B 1OTSC 3RDTA 3T0WA 1HXKA 4ZSOA 4LNVA 3EYUL 2ZUQB 3VDAA 5IMLB 3QULA 3GMQB 2HFTA 2O5YH 5DRZB 1F45A 1KCUH 1P4LA 1NSNL 2H32B 2WBJA 4Y1AE 3MSDA 1VF8A 2X4PA 1NBYA 5HDLA 3SKOA 4TULL 4BZ2H 1QZ1A 2GK0A 3I6GA 1EGZA 3VA6A 3DX4A 1YY9C 3LKSA 5C0CB 1U8KB 4MAYD 3PP3K 2A74A 4OLWH 3AREB 3QCUL 3MYZA 3WQWA 5IEHA 5D1ZA 4FP8H 3UJJL 4MNKA 1OAKH 4XCCL 3GSUA 5E0FA 4JZNA 5JW4R 1CLOH 3LEYH 3W0WA 4LSRH 1NJ9B 2X2YA 1UQZA 3SCMB 3MRMB 1U8IB 5JORB 1NCCL 4P2OA 4JY6A 5GS2D 4EI6A 4X9YA 1UKOA 4W6WB 3PZMA 1NUGA 4QFUA 3GSVB 3SDDB 3VXME 3TO4D 1V7NL 1F6AA 2Y7QB 4G9FD 5C09D 5JW4M 5I6XC 3OKOA 4JJ5A 4LLDB 2QLYA 4PUDA 5HHOE 3AU1A 4M3KB 4I77H 3S4SB 2DJUA 5F6HI 4EANA 1L0QA 3O2VH 4L9LA 4NZFA 4ODXB 3I3BA 2Z31A 3VM7A 2AS5M 3GMMA 4NHCL 4TUKH 5DFWH 1ZEAL 1UQYA 4I5BA 2HLAB 1VFFA 1MHEA 3QUXC 4GKSA 1GPFA 3QHZL 2R4RH 3NA9L 1RQ5A 2XN2A 3IDMA 1CDYA 3T77B 4KROD 5HHQB 2UVEA 1ONQA 3PWLA 3HPJA 1QRNA 4Z7WA 3MLUL 43C9A 3GXTA 5KVFH 1JNEA 1CE1H 3GJFH 3MV7D 5T5FH 1V7MH 3PDDA 4LPVA 2EDRA 1MCPL 1EQPA 3EOAA 4WGVB 1IBGH 3IJHB 3PWJA 3V8OA 5M03A 3FB5A 3VWJD 4NHUB 5I75B 3LEXA 2ZOXA 2CEQA 3LRSA 5C1MB 1VB9A 4ERSL 4DGYL 1NFDA 4NXSA 4PEEA 2X1IA 1NWSA 3QHMA 4LCYA 1D5BB 3LMJL 2WMFA 4QRSA 1T22A 4KAQL 4Y5XC 4O5LL 1ES0B 5CJOH 2BHUA 1B0WA 2Z4QA 2FATH 2UV3A 3FB6A 4OD3H 3KYKL 1ZS2A 4KK6D 3QEGL 5DYOA 4IOIA 1ROWA 2DQJL 2OJEB 1KLGA 1JIBA 1XYFA 5DMKB 1N64L 5GGSB 4Y16B 1QBML 1IC4L 1OWRM 3PL6A 2LE9A 3FOMB 2FB4L 2YKKA 4G7YH 4M62L 2XSAA 3QHOA 4CL7A 2AJ3A 2BNRB 1ZVYA 4QGYA 1LEGA 3LN5A 5JLZA 2VXTH 2YPKB 4K94L 4F2MB 1MH5A 5JIWA 1NGQH 2QHRL 3SY0A 1UHVA 1GOWA 3GIZL 2Q7YB 2BRQA 5I1GH 1LEIB 2I60L 1I3GH 4IIQC 2FR4B 3LRHA 1TVDA 2XN1A 4LMQE 4HIIB 4M6ML 4QXUH 1E4WL 1T1WA 3TCLA 1JGDB 2A73B 1MY7A 1XEDA 4O02H 5MENA 4V27A 3OR7B 1L0YA 2ICWB 1LP9A 1A2YB 2I5YL 1FP9A 4ATWA 4TTDC 3VFUB 2UUDH 4DN4L 5E6YA 1TQTA 2CK0H 1Z0NA 1PZ2A 3MRNB 5E9AA 4WWKA 3VSUA 4L8CA 1WNOA 2JJWA 2DQUH 3CFEA 3JV6A 5TE6L 2MFNA 1A6TB 2ZJSL 4UB0H 4D0BA 4Y1AD 4Q6IB 4OKDA 3LS4L 2F5BH 4KPHH 1B3WA 4G42A 1AO7B 2UYLA 2A0LD 5EFDA 2WC3A 1DBBH 2H1PL 5EZOH 2CCRA 5FYKL 2NY0B 2Z35A 2HTKD 3GJFK 1WFUA 4GXUN 4JFFE 3WUBA 3N18A 4JQIL 4M00A 3WCYA 2X7LA 4P46B 3DHJA 4U3XA 4S2SA 1JF6A 5I73C 4M6NL 2J71A 4UIMB 3HLAB 3N1MC 4U3AA 1E3XA 2J4GA 3CXHK 3FQTB 5ECUA 5DA0B 4PJFB 2NXZB 3V52H 1B1YA 5FUCC 3BHBA 1GZQB 4XP4L 2YDQA 2R2EA 5BROA 4XNUL 4S1SL 3KLSA 2VLRA 4PJEA 1CWYA 2D1ZA 3KPMA 1IAOA 2AJVL 4RZCA 4YR6A 3UG5A 1BIIA 4LEOA 4MWFA 3PXJA 3TNMB 1JYVA 5IFJB 2CKNA 1S5IL 3MNVA 1AY1L 3WKML 4H8VA 4TTUA 2CDFA 4NRXB 2OZ4A 3RZCD 3BVXA 4M6OH 5IM7B 1MCLA 4YXKL 4GQ9H 3HNVL 4MJ2A 3RX7A 1K85A 4UAOC 3QHNA 1Z9SA 3U7WL 5CGMA 2FIKB 3K2UH 1PS3A 4PRIB 4HWNA 3WIFB 5EO1A 2YHGA 4NQCB 4XP6L 1Q6CA 1NDMA 4FFZL 2GDUA 1CGVA 1NCTA 2RBLA 4QRUB 4ZO8A 1QPPA 1C5CL 2VDRL 3CFIC 4JANB 3S5LG 1BM3L 2YPVH 2AEQH 4GW5B 3IAPA 3BGAA 4KKLD 2PI6A 3SCQA 1CK0L 4JHWL 3CBWA 4FN0A 2AABH 5IMOA 1DEEA 1FHLA 5AUMB 1U93A 3FAWA 1PFCA 1I8LA 3TNNA 4RFEA 4D94A 1HJSA 1CFVH 5JQHC 3BP5B 5IVXF 3JBG7 3S2CA 1RI8A 3NGBB 5ICYA 3CPLA 4PJ8A 4W6YB 2E27H 3BXWA 4GG8A 2UUDK 1FYTA 4HCRH 4PGBA 1E4MM 5C07A 1FG9C 4RGNC 2C1OB 2WC4A 4D6IA 3HZMB 2FGZA 4X98A 1GGUA 2MTPA 4ONFL 5HBBA 1CU4L 5DR5H 5AG9A 1XAUA 5ACZB 4JR9H 5DUBB 4KHTL 1A7PL 1YYLH 5H94A 2QPSA 3WSUA 5GRUL 5CBAB 1KCVH 3MV9A 3NFPB 2VLJB 1MFBH 1RJLB 3AY4A 4PUBH 2Q20A 4BSJA 2JCCF 5HOSA 5KSBB 4IRSC 4URIA 4JO1L 4OZHA 3RTQC 2Q76A 3BGMA 3UPCA 3PZGA 3U7VA 1A9EA 3EYSL 1ZANH 2LTQB 2AP2A 4JDZB 1PVHA 4M7JL 1RP8A 2HP4A 1TQCC 3WD4A 3D69B 1NLDH 4EI5C 3OGVA 4D9RE 2MWCA 1QLRA 4Z78A 3N13A 2GAZA 5HPMA 3I3DA 2DYPD 3FTGB 5GPRA 2B31A 3EJUA 1NGZB 4GQQA 4WW2A 2GTWA 1QSFB 3LB6D 5T3XE 4J3SA 1OTTD 2VTFA 1H5BC 5HGAA 2R0ZL 4GI8A 1V0NA 4RDQF 2VZOA 2GCYA 1FZOA 2ZUYA 3B9KA 3MANA 3VRIA 1U95A 2W60B 3TM6A 3U48A 1BFNA 5HTSA 3GBMH 3IU4H 1T1ZA 2J78A 5DJ2B 1HIML 2E9BA 2F5AH 4HZ8A 4XCEB 4YHIB 3HE7B 4U7MA 5EOCH 5TJWK 1A64A 25C8L 3U4EB 4NKIL 5JUEH 2AJZA 1KLUB 1XGQB 4PGZA 5DEFB 1C91A 2GK2A 1JPST 1FP5A 4AD5A 5FOBA 4B3LA 4JFFD 1BF8A 1WC7B 2BS9A 4NF7A 3K1KC 1CENA 4E41A 4OZGB 4XC3L 5EC2A 4QKXB 4A2LA 1FFQA 5B3NA 3BCFA 4GLRI 3E3QC 5HI4D 5JXAH 4QNPF 5E7FA 1DQLH 1CFTA 4Q9CA 1JWMA 1NAMB 1X5HA 4NRSA 4HIHA 3ZL4H 1KB5B 1F58L 1Q0YL 1SVZA 4LKXA 1F02I 3MLRL 1AQ0A 2RB8A 5HYFA 2J75A 1N0XH 3OKDA 3SGKA 2A9NH 1N59A 1Q1JL 3TN0A 2B1HH 2MMXA 3MFGB 1PJ9A 5MERB 2BNJA 1BFOA 1E28A 4XPFL 5EN2B 1CGSH 1HOCB 1IAMA 2ZSWB 3N1FC 3PQYD 1JXJA 2D3LA 4LFHG 1SJEB 1EHAA 1MCOH 4I3RL 2VIRB 4JN2A 5MEPB 4ZXBA 2OTPA 4L8BA 4LCIH 4KZDL 1N7MH 1A6VH 1DWFM 3ARQA 3ARBB 1K8DB 2E9LA 4HXAH 4U6HA 2J5LC 5ECJE 3UETA 3B8YA 4R96A 3HAEH 3MCLH 2VKWA 1MWAL 1U8QB 4WDIB 4F79A 1WAAF 2HT4D 4KQ3H 3F12B 4EOWL 3CZ8A 1A02N 3ZYIA 1VEPA 4LFHD 5FK9A 3R1GL 1Q9LA 3SDXE 3QUXA 1E6SM 4AMWA 1MNUH 3IVKB 2UWEA 1LO5A 3MUHL 2PKDA 3S36X 1DVFC 3CDFA 3TJHD 3TO2B 4LYPA 1OQOA 2ESCA 4PJHA 3IGUA 3NFSH 4FZ8L 4AD1A 3A22A 4AZCB 5C0IB 1TVBA 2VOTA 5T1LD 1T1XB 1HQ4B 5J8OA 1FVEB 1MCBA 1MHPH 2AEIT 1I1AB 4Y5YA 3TCXA 4RMWA 2XKNB 3BW9B 3GXFA 3WY2A 4JREB 4Z5RB 5C8JB 4BH8B 1NAKH 2LV4A 3HU7A 2HMIC 1NAMH 3G6AA 4MJ6B 2E0PA 5EMYA 2BVOB 4JO2L 4Y5XA 1KB5H 35C8L 3CFJA 5F1IB 3A24A 4U6VL 3W9EA 1P84K 5FB8B 2D0FA 3S5ZA 4HUVB 5IR1B 4D9RD 2CIIB 1TUXA 5IFPA 4Y8DC 3T04D 4PY7B 1DCLA 2G9HA 3WD3A 2RHEA 3EYVA 1W9DM 1XMWA 5ITBL 3TF7C 1CD0A 3DX2A 3WHE1 5T3XD 1YQVL 4M43H 3AC0A 1CICB 3MOBH 1IM9B 3BLKA 3AHVA 4XH2B 4NNXA 3DETD 4FXKA 1SJXA 2YKLH 1RZFL 5GS0C 4LDLB 3ULVC 4GG6B 5EWIL 1J0ZA 1I1CA 4D3CH 4XBPA 1ISXA 5EBMB 3N04A 3MLXH 1AHWB 5EB8A 2D7OA 1S8DA 1UVQB 4AMXA 3AHTA 1DUZA 3EJTA 2V5MA 1VDGA 3VGDA 3X3GL 4D6GA 3QNYB 2VZVA 2Y36L 1F00I 1GQIA 3CCHA 3ARYA 1AXTL 4JO4H 5IIEA 4UV7H 3RWEA 2GJJA 3QHTC 1Q0XH 4ODTL 1JTTA 1VBUA 4JY4B 4YX2H 4LHUG 4OQTH 3BT2H 4LPXA 3N9GH 1AGFA 5IW6A 3DTXB 5LBSL 5CWSB 3CXDL 1MWAA 3V0WH 4LU5H 4TSAL 4AZ5A 4L4VA 5BQ7B 2YN5A 4TX8A 3SJVD 4OZIE 3DO7A 1AO7E 3VXQB 3EMCA 2PC8A 1HZHH 4Y4FB 3RVXC 1DLFH 4G80B 1XGPB 2V2WA 5LAXB 3FOLB 1JK8B 2F18A 4ZPTB 5KOVC 4GRLB 1QWNA 3HJEA 2CO6B 1RIHL 5DFAA 3VFTA 4N42A 5I18L 2X9YA 1PKOA 4LHUD 4XX1E 3W81A 1JNLH 5CIPA 4YHNA 2BC4A 3EDKA 4PV8A 1QRKA 4NBXB 1A6WH 3LKRA 4WHDA 5TDOA 2WZIA 4NQUA 4NYLA 4PJCF 2R1YA 2C7UA 5DJDB 2AJYH 2ITDA 3WFEH 1SY6H 3OJMB 4QRTA 1IAIH 3KPTA 1W8NA 1V3HA 1OY3B 1YEKH 4ENEC 1AGDB 1AH1A 1TITA 4H25B 3C8HA 1S9XA 3C09B 1N5AA 2Y25A 3T2OA 1GHSA 3RVWD 2JIEA 4XCYA 5F7EL 5D2LA 5A2JH 2C7FA 2PTUA 3FT4A 3D0LB 3QIWC 4C56E 5D1XC 1OAZL 5SWZE 5D5MB 4NQCE 3VXSA 4W4NA 3GEWB 2C1PB 3O9WB 4OUUA 3U9UB 4J1UA 2Q86A 3DIFA 4YIQA 5EFIB 5DRWB 3V6ZB 3ZO9A 5K9OA 3AXLB 1DSFL 3H9SD 3PWPA 3ZDZF 3KJ4C 3QQ3A 2BVPB 1E6ZA 2NLJA 1RURL 4APQB 4QYOB 2XN9A 3ECBB 3T4YA 4WI2A 4MJIB 1R3IH 4OCYL 2DQEL 4P99A 1OGAD 1YEFH 2OM5A 4XPGH 4R7NB 4UT9H 4L8DA 3G9AB 3I02A 1SBBA 1OT2A 3TV3H 4OJYA 2XZQL 2EDJA 5DT7A 4H1LA 3N12A 5C0AD 2IFFH 5FUOH 3WNKA 5F9DC 1D5IH 4HQQL 4ETQA 3RGVB 1GVIA 4PRWA 3L9RB 1MJJA 4FFYL 4UOW1 1KTDA 1J0KA 4HOWA 1Q94A 2PO6D 5DJAB 3JUGA 1P7KA 3BXNA 3O9NA 2BHYA 4CGTA 3WH6A 3IETA 3RIKA 1FH5L 1WZ1H 2X5PA 5HVHB 2YIHA 3MRFB 4OF0A 4NWTL 5J57B 4HWZA 2DD8H 4IRSA 3STLB 1HNFA 1X5AA 3VE0B 4MA8H 3N11A 3RTQA 5IK3B 3WN5B 4FFVD 4U2ZA 2VVNA 1BVNP 5JOFA 1DZBA 4EI5A 1KXVA 4JFSA 5JPMB 4ACYA 1JTOA 2R0WH 9CGTA 2V6HA 1QX1A 5I30L 1QSFE 2W0FB 3P4MB 1E6JH 2PWEA 2AXJA 4UINH 1CGYA 1WF5A 1U8OB 3V5KB 3W39A 4NO0A 3RJQB 4NCC1 7A3HA 4BQ8A 3N15A 4IM8A 1TJGL 1UA6L 1HHJB 1OM0A 3TP4A 1W0VB 4QOKB 2DSZA 2CYGA 3GBEA 4NFDA 2YSSB 1K4DB 4PLJD 4P3DB 1AGEA 1F8TL 4BFIB 4AENB 1FNGB 5DWUH 1MRCH 4KJYB 1OARH 1FFPA 3BUYA 3U2SA 5A16B 4KKCD 1KB9K 3NH7L 4O9HL 2JE8A 4HIXL 5EUOE 4I0PB 4EN3D 1K6QH 4X4ME 5BVPL 4M03A 1KOAA 1A1MA 1D6EA 3D0VB 4R3SB 2W9DL 5I71B 5D70H 5E5UB 3A6OA 1F4WL 3OXRB 3RILA 5IB4B 1W2PA 4KTYA 3V9FA 1DQQB 1WZLA 5T1DH 2P8PB 4F8TA 4UTAH 1A9BB 3ORJA 2ZUVA 3H3KA 4MJ5A 4ZAKD 4RIRA 5BZWB 2JF6A 1P4IL 2BNUB 2B5IB 5BCAA 1KG0A 2ZCKH 1GOGA 4U1HB 4O2EB 4XVTL 1OSPH 4WUUB 4F7PA 3KWWB 4YHPB 3HG1E 1FZKA 1XH3A 2HRPL 2W67A 2VL5A 1DCEA 2X1QA 4NO2A 4OD2B 1R5IB 1UH3A 3ARDA 5GS0L 1KBKA 4GSDH 4PR5B 1Y0LA 2CO7B 5GGVH 3VPLA 2Z92B 1BVKA 4NUJA 3MRHB 3M17A 3U36A 3T2QA 3TA3C 5EOQL 4R9HA 4TN9A 1D3CA 3LSOA 1DBAH 2F54A 4F57L 4JKPH 1Q8MA 4I18B 1FL6B 4Q9RL 4K3HA 4C56D 3DMMA 3VFPA 2YD3A 1SMDA 1U33A 4L8SA 5SWZD 3SE8L 1EK3A 3CVIH 3GB7B 2F2HA 3MKKA 1H3UA 3V6FA 4Q74A 2KQMA 4R4FL 2M1KA 1ZWIB 2SEBA 1HCFX 2WCSA 5M17A 1N4XH 1S7SB 4CVUA 2OP4L 3O4LB 4WO4C 1FLTX 1CXIA 3HS0A 2HRLA 5KZCD 3VMPA 4HWUA 3VJ6A 3LMYA 2BV9A 4JM2A 5DFVD 1FNFA 4BK4A 2FHCA 4OZ4B 1N6QH 1FH9A 2B4CH 4QRQA 1S9WA 3BD3A 3BUTA 3F7RA 2E6QA 1A7NL 3FRUB 4X6DB 2BZDA 2DSWA 2R8SL 2QADD 3BP4B 4PJXA 5IESL 1DLHB 3SUVA 5ADPH 2OYLA 1TZGL 2FBOJ 2GJZB 3LPFA 4MLIA 1ZHNB 5D1QB 1VFBB 4D1JA 3CUPA 3HUJF 1IAKA 2WZPD 4X6FA 5K9KB 3VXNB 2VX7A 3TV8A 1BAFL 1D9KB 2B2XH 3OXSA 3QDMA 1UR0A 3NUKA 4Y4KB 2XOTA 2V9QA 2J7GA 1U3JA 5KOMC 2ED9A 1AGBA 4OCLC 2VH5H 2VE6A 5CGYD 1DUYB 2YOCA 4OZFA 1S5HA 1I1RA 2OTUB 4JN1H 1YMHB 2AI0L 1ZT7A 3UX9B 3MRRA 4HX1B 5IHUL 2FEDD 4NCC2 4HZLA 3OKMB 3PZVA 3SCPA 1XGZA 3WH5A 2A6JB 4HIJA 1ZT1A 4HUNB 4X6BA 5ILTL 3VG9B 1G7JA 4ETYA 1MI5B 3CMOL 5E8EA 5L0QC 4Q22A 1HJQA 3QIBB 1L0PA 1GIGH 5EORH 5J1TC 4LF3B 1HT6A 1EGJL 4I3GA 4NFBA 4HDIA 3K8MA 1RV6X 4KRUA 3HE6D 4HGKC 4X5XA 2E7LC 3G5YA 4Z76A 4G8GA 1J7VR 1Q72H 4RISL 3O8XB 4OIIH 4W8BA 1J05A 1EEZA 1NGYB 1IGML 2GVYA 5L2KA 3IJYB 8FABA 4XPTH 4KQ4L 1Z3GL 1NFIB 5K9QG 3MBEB 3ZDXF 4GG6E 3NSMA 3WF1A 4TVPD 3SGEI 4PGJA 1J9YA 1C8PA 3UDWC 1UWEH 1QSED 2ARJB 2XTKA 4UOQA 1A1OA 2J25A 4KVNH 3EAKA 3VRJB 2WNGA 4P9HC 5JIPA 4KTEH 2OL3L 1QNPA 2FZ3A 1E4XL 3HTLX 4YJZL 2X70B 5M95B 2FGWL 5TE4H 2GSJA 1KJ2B 1P53A 1BQHB 5KTEH 1ZBVA 4EEEA 3DV4B 2AJXL 2APFA 5ADOL 3IRPX 3BIAX 3VFVA 2RFXB 4B9ZA 2XT1B 4GMSH 4CVXA 5E94A 5DT1H 3PTQA 5AZEH 2XY2A 4P8VA 2VXQL 4MD5B 3GFUA 4NWUL 1QOXA 4C7GA 3T09A 2O9RA 1DN2A 3MNWB 3HG1D 2ZCLH 4HKZA 4PD4J 2HVJA 3B2UD 1NEUA 1GQLA 4V1DB 1B4JH 4QRRE 2E7CA 2EYTA 4YHLH 4WUKH 3G04A 1XGRA 2DMCA 1J5OH 3EFFA 4EUPA 5BZDB 4AEHH 1Q9KB 2HYMA 4GKOA 4P4KB 5IMKB 2PETA 3BQUC 1C7SA 2D20A 1LO4H 3OKYA 1T0MA 1FIGL 3ARFC 5IW1B 3P11H 5B39A 3VGAC 2X41A 4ODSL 2J8HA 4GAFB 4P2RB 5KSAA 5EBGA 4HKBA 3QUYB 1NLBH 5BZZA 2CLZA 4U3HA 4Z7VE 2YEZB 1WPCA 1GPOH 3V4PH 5I9QC 3JWDH 3GMRA 4Z7NE 1P7QA 2XY1A 4X8XA 1CL7L 5IHLB 1UQSB 2ADIA 4KKAD 3MS8A 1MELA 1CR9H 1JPFA 1SYSB 2ZX9A 5FO9B 3WH7A 1KB3A 1O5DT 3EGSA 3FQNB 1OP5H 5ABDE 1JRHL 2OR9H 3K1DA 1HKIA 4GRMA 4XAKE 1EGJA 4ZOEA 3NPSB 3QIWA 4ZPVA 5ITFB 5D1XA 1XF3B 1HKLL 4MAYC 1QKZL 4UNTA 3GSWB 4JJHA 2ZICA 4BCEA 1ACYL 5T3ZE 4XNYH 3A4AA 1E6OL 2G3JA 2LAGB 1IGTB 3UTZB 1KUMA 4M7LT 2EZ0C 5E8DL 5DHYB 2DDQH 4CCDA 1ZJBA 5D4QA 3QQ4A 1CLZH 4BKLB 2WVTA 2PUQT 4DKEH 2RAMA 3OAYH 2VITB 5C08B 4D0DB 4HFUL 4O4YL 1QEWB 3Q5YA 3WIHL 5IB2A 3LQZA 3TO4C 1J11A 1HVXA 5F7HA 4WY7L 2ZX6A 4MNGB 2OL3A 5I15L 5JTWA 2JB5L 3MV8B 3RDTB 3PZNA 5I17B 4X8JA 2EDTA 1VRXA 3AS2A 3KL0A 3IXTA 1OB1A 5F70A 4C83B 2VT0A 3WNPA 3QULB 2VLLA 3LH2H 4LPTA 5DK0B 3GK8H 3HMWH 2X1OA 3CFKB 3NN8B 3H3PH 1YEHH 4NT6A 2NTSP 3RQ3A 2WBJB 1HEZB 1JDDA 4DN3L 2X4PB 1NBYB 3QXDB 1NANH 5B4MD 4KROC 3SKOB 2GK0B 4XPHH 5JBDA 2VABA 1AQKL 1VADA 4BQCA 5EFFA 1I3RA 5I1IL 1BBJA 4MNQD 3MMEA 5C7XH 4NN5B 1FNSH 2H26A 4F7TA 1AXIB 3HC0A 4LYRA 3UBXG 3CZFA 3VWJC 3GSUB 2A3AA 4JZNB 2R9HD 3UJTL 1ITBB 5D72L 4UQ2A 4K7PY 5KVDH 5I76B 2Q3AA 2DKMA 3T8XA 5B8CA 3VIPA 4I48B 3CH1B 3THCA 3QH3B 4P2OB 1J8HE 4BSWB 3CFBA 1MJ7H 4EI6B 5ANME 4UFJA 5GGRA 5D7IF 1SM3H 3MGAA 4JRYA 3HG2A 3QJFA 2EYRA 1OSEA 3PIQA 3HNSH 4HZ6A 1F6AB 4CADB 3TBSA 3BZFA 4P57B 1HDMA 1BD2B 3OKOB 4KK6C 4XAWL 1UA7A 2X89A 4NZUH 2YLAA 3GI9H 3H55A 4HV8A 4YXLL 3FJTA 3FO0H 5HGBA 1OP5K 2EEBA 2WUBH 3O6LL 3UTSB 3HPLA 3RNKA 1J10A 1LO2L 3ULUE 2D4FA 3HR5A 4YNYA 4O51A 1OLZA 5F9WB 3IDMB 4QCEA 1V05A 4FQIH 4QRRD 1ONQB 5IB1A 5KANI 1LDPH 3PTKA 1GAFL 3CX5J 2GITA 3C5JA 3HPJB 1YJDC 1WZKA 3V4VL 4HKJB 1E0XA 5TE7H 1IGCL 3EOAB 1RZKC 3UTTE 3PWJB 5HI5D 2NXYD 4G9DA 2F61A 4X6CB 3L2LA 3OAYK 4HP5A 3FNDA 3QDHA 3EJSA 2ZUMA 2VDML 4F7MB 1YPZF 4ZNEA 4NFCA 4OTXL 3ESVF 2X4TB 4HPOH 4WUUE 1P5VA 5J7CC 1NFDB 3G6LA 1N82A 3LPPA 4LBEA 1T22B 1WBYA 3WJLC 4K3GA 3WIHA 3OAZH 2Z4QB 3BAWA 4FQJH 3QCTL 2RGMA 4Y88A 4F9JA 4RWYH 5DYOB 4IOIB 5HDOA 2WCAA 4TOYL 2C4FU 2NY1D 3MBXL 4PS4H 2E3ZA 1B2WH 2VRKA 5H35B 4GI6A 3EYQD 3MUGA 1WFOA 1DBMH 5DJ8A 1U36A 2B1AH 3PL6B 4Y2OA 2GSIB 2A0LC 5ELIA 5MP6L 4BK5A 5DJXA 4LSQH 2AJ3B 1NCDH 2NX5E 3MA7B 5T3ZD 5FKYA 4MNMA 1EERB 1T2QL 3F7YB 3LN5B 1KJMB 2VWEE 4Z0BH 1MH5B 3AZRA 5SX4H 3OV6A 3SY0B 3IXAA 1LF1A 1NGWA 2IBZY 4O00A 1ZJAA 5HYQB 1XGTB 3CLWA 5FCZA 3O4LE 2BVYA 1G7IA 1G9NC 4WO4A 1ZOXA 3P0YL 4M8QA 5DT5A 3KHOA 5HJ3A 1T1WB 1V3IA 2YN3A 2FIRT 5E99H 1C90A 3QUZC 4U5IA 5K59E 1E27A 1LP9B 1LE9B 4X6DE 5IWLA 4WFHE 4MVBD 3T0EA 3RWFB 2DDXA 4YFDB 3RZCC 4BQBA 3BH9A 4LVHB 1INDL 4EVNA 4KRPD 3CFEB 3JV6B 4QAWA 2IGTA 5FECA 3RU8L 2J88H 4LYQA 3S36L 1VIWA 4LK4A 2V17L 4TX6A 2QF8A 1CL7I 2XWDA 4G42B 4PRPD 3INUH 1YNLH 3QAZC 3ME0A 1JMXA 4U3CA 1UJ3A 2YBUA 1FO0L 1AR2A 3TT1H 1V6YA 1CDIA 4M8UA 3P2TA 1JRHI 2A3EA 3V79C 1T0PB 2CBVA 5IJVB 4PJIF 5HHME 2X7LB 3AS0A 1DN0A 1A7RH 4S2SB 1ZGLP 1KCKA 4FQ2H 4NQDA 5F71A 5K93A 2PWHA 4H41A 1QPXA 1PLGL 2F7RA 1RFDH 4XWGH 4DWSD 1J8HD 4YQXL 5BOZG 4S1QL 4AM0A 2C5DC 3A3HA 2E7LA 3PV6B 5KVGH 3GUTA 4NSBA 4Z2KA 2D0GA 3IDYC 5JXEA 3OAZK 3KPMB 4YWGH 3I2CL 5LJYH 4RZCB 2EDYA 2D03L 4YR6B 2ERJB 4LEOB 1FCCA 4MWFB 3TWCH 5D7LA 3U82B 4QXGL 1A6ZB 3L5IA 1ETZA 3MO4A 4MNLA 3UDWA 4JDVA 2FRGP 3MMDA 3WHXB 3W37A 1UWSA 2X4NA 5A8PA 3DI2B 4KY1H 4CN6A 4TSCH 3X17A 5DD6B 3HZ3A 4Y19B 4Z2JA 1F2QA 4YBLB 4LLUB 5GGTH 3C8DA 2D31B 1UCBL 5DMIL 4V2CB 4XMKL 1PYWA 1P1ZA 3EOTL 1ED3B 3KXFA 3VVGA 3UTTD 4ZTPL 3L3KA 1DEEB 5IMOB 1DBKH 2YD9A 3TNNB 4IPNB 1BVZA 3P4OA 2EH7H 4RFEB 3GJEB 3DI3B 3L95A 4EBQH 3GSOA 1OTTC 3VDCA 1R8LA 1QBLL 2V7HA 1YEGH 1HHHA 4OBSA 3CFCH 4PJ8B 4GG8B 4V1DE 3HC3L 4NQEE 3DPBA 1JGEA 3CDYA 2PWGA 2R2HB 4ODUA 2DWDA 5C07B 2DIEA 1TMQA 4MAUH 4NJ9H 4X7TA 1UZ8A 2NNAB 4X98B 4LLMA 5E9DA 3F7QA 5C6TL 1G7PA 1W0WA 2XZCL 2VDKL 3BQUA 3EHBD 3MLUH 3LN9A 1J01A 1JMZA 2HJFA 1EBAA 4Q9BA 3ARFA 3QGVA 1TVNA 1F4XH 2OQJA 1V0MA 4P2RE 3TFKD 1JF5A 2YA2A 1RHHB 4K3DL 1MCWW 2NX5D 1R3HB 4P48A 5IF0A 4YAQA 5FYKU 3QI9B 5D2NE 5HVWA 4XUYA 1RIUH 2Q76B 3BGMB 4D9QE 1FO0A 4ZS7L 1A9EB 1T7XA 3NACH 5J6HB 3QEHA 3EYOA 5HI4C 1UA3A 2E40A 4KAQH 1QNSA 2NCMA 1IZKA 4Z78B 1P4BL 2XYCA 5JUVA 3BMVA 5CSGA 1OGGA 1GRWA 3OLDA 4PJDE 3LN4A 3EO9L 2NY5L 2GTWB 3WY4A 2WUCH 1C12A 3HRZA 4MAYA 2XG4A 5HGAB 1YJDL 1N64H 4K71C 1MHCA 5ESAA 3QXAA 5ESVA 4GKNA 2DL2A 2A6IA 2GCYB 2YPLB 1FZOB 4PJ9C 3B9KB 5A6JA 1JNHA 3VRIB 1U95B 5F3BA 5T1KA 4J3VA 2XRAL 4WENB 1T66D 3MLWL 3ZE2E 4CKVX 1T1ZB 1JFQL 3HZVB 3WEMA 3G6JE 1C5BL 2DJSA 3GRWL 1HN1A 15C8H 1BJ8A 1HP4A 2QHRH 3KPOA 3P0VL 5C08E 1I1YA 1EDTA 1W1PA 1LD9B 2G60L 3L3IA 3K8LA 4Y5VA 3EOYG 3TO4A 1UM6H 4MNGE 1G0DA 2FO4A 5C09A 1M05A 4J6RL 3TH3T 5FOBB 3MV8E 1DBJL 3DX8B 3TT3L 4ZSOE 1W72H 4F80A 1XH0A 2R2BA 2HT4C 4K8RD 1UACL 2W66A 4E41B 2R23A 5EC2B 4QHLA 1PAMA 1FFNA 1GOOA 4X7SL 1UR9A 2K7PA 5IGXH 3X13A 3VX0A 4RAUB 4Q0XH 1ZHKB 4BZYA 4G3YL 2ZWLT 3RHWF 3TJHC 3S97C 4YHZL 4OFPA 4LKXB 2ZE0A 1KFAH 3SKNA 5JHLH 1XFPA 1B3XA 1BFSA 1I4FA 2DKUA 1ZBKA 3N17A 4P7QA 3MV7A 1N59B 3LS4H 3V5HA 4MPKA 1KT2B 4IRZL 3OZPA 3MX0A 2D0HA 5F97E 1BFOB 1E28B 5GS1C 1HXYB 1BMGA 3VWJA 3W0WE 4YHOH 5IFHL 3MMUA 5A6KA 3PGFL 4F66A 1NGPL 4JN2B 4HF5H 2VXUL 4JHAL 4ZUSA 4JFEE 3VOCA 1RAMA 1UR4A 3QG7H 4LSUL 4A6YB 3PDOB 1AQMA 4G6FB 5T33H 1CD8A 1UWIA 2HJKA 4R96B 5I6XB 2ICCA 4XP4H 1TPXC 1GHFH 2I9TA 4LPUA 2AJVH 3O3DB 5HNNA 3AMCA 3R4DA 5EU7E 1WV7T 1I9IH 2GJ6D 5IFTA 1Q9LB 2XZZA 5GRVL 5J9PA 3F5JA 3QUXB 2ZG1A 3PHAA 1W8OA 2P48B 3DETC 4AD2A 3HNVH 4YLQT 3VGHA 1BGXL 2QTEA 3K2MC 4Z7WE 1QRNE 4H8HA 1O7SA 1XZ0A 4GRWE 1TVBB 5C0FB 4CVWA 1U8LA 3UPRA 4M7ZC 1RZIB 2EDKA 4BA0A 1U91B 3C5ZD 1RP9A 3HI5H 1F3JA 5IHRA 1LTXA 1E1FA 4MDPA 1PG7L 1WB0A 2AJUH 1BM3H 3LIZH 3CUHA 4NBZB 4LPYA 1A3LH 2C3GA 4JKLA 1MSPA 1NFDE 3GRWA 4RNRA 3LCYA 4X7DC 5GNYA 1ACZA 4KWUA 5FA4B 3G6AB 3WFDH 1JHKL 1NMBH 4Y5XB 3WO3B 1YY8A 4U1MA 1KPRB 4D9QD 5M3WA 4OGXL 1A3RH 2Z9TA 4DK6A 5JDSA 3LRMA 5F6IC 3WENA 3JVGC 5E5MB 1IC5L 2J7DA 1PX4A 3O0RL 1EHLL 2AEPH 1E4IA 1HQRA 3OHXA 1EV2E 2G9HB 4HK0A 3EZJB 1FZJA 4ONFH 1CU4H 1XC6A 4XMLL 1X5ZA 4W5ZA 4PSPA 3O41A 4KHTH 5EU3A 4HH9A 4NNXB 1IC1A 1T89A 4XVSL 3BMWA 3U4BH 1UWXH 5GRYA 4A6YH 4QRPA 1OAUL 4ZUUA 2XVGA 3BUDA 4IIQB 1HL9A 4P4RB 1S8DB 2ZUSA 3DX1A 2QJDA 4FNUA 3CC5A 3TZVD 3DHMA 5MENE 3GNRA 2WYSA 2EJ1A 1HWHB 4R4BA 4XBEL 4M7JH 4Z7UB 3CCHB 2ZNWA 1MPAL 4QXWA 5IIEB 1FE8L 3KPNA 4KK5D 4PRAA 3RWEB 4WV1A 3KVQA 3ZHLA 1MLCB 3SQBA 4PMZA 1NCNA 2VDNL 3GI8L 1MCIA 1QR1B 3RZCA 3RVWC 3VD4A 3QCVL 4R97C 4HC1H 1OWQA 1AGFB 3FZUD 5IW6B 3M7SA 3A6BH 1MWAB 2R4SL 5D8ZA 3AOFA 3GGWA 2XHYA 4L4VB 4DCQA 3A6CL 4JKMA 2CR6A 4NQSA 4GPNA 3DO7B 3PABA 4G6KH 4MX7B 5DTFA 1HINH 1CBVH 3PP4H 3KPSD 5CPQA 3SO3C 4P8XA 4D6DA 3OGRA 3HG4A 3FO9B 2V5YA 3HMXH 4FZEL 5D1ZD 1YEEH 4NKIH 1MCHA 3VFTB 5CEXB 2WMIB 1EXUA 4ZYKB 4MCZA 3SE3C 5CSBA 4G5ZH 4KHXL 5I73B 4OCSL 2P5ED 3W0WD 1HYRC 4UILL 5DJ0A 1HK6A 4AY0A 2DM2A 4P5TD 2EDBA 5CIPB 4YHNB 2BC4B 4OFVA 3MJ6A 4JFED 4NKDB 5TDOB 4PV9A 3UTQA 3EMQA 4GAYB 5IW3A 4XC3H 1D5XB 3WFHA 2VLRE 2R1YB 2C7UB 4PJEE 4PTWA 2ITDB 2JCCB 4M93C 4MGXA 4RFNC 1N5YL 4NXKA 1RUKL 4PPTA 1OGTA 1N6UA 1W2VA 3S5LA 2DJ4A 2EO7A 1F58H 5FM4A 4U1KA 3VH8G 3IFLL 2PO6C 1VEOA 3O4OC 5GISH 4XCYB 1RUQH 5SWQA 1ITXA 2PXYA 4ZUWA 3VKKA 4PBXA 3FMGH 4UAOB 4WEMB 3V0VB 8A3HA 1AFVH 4RFOL 1N6VA 3ZDYF 3M1BB 3VXSB 4U6XA 4XPFH 2ATKA 1HXMA 3GYCA 3GHEL 1FFOB 4J1UB 5E70A 3DIFB 4YIQB 1QRND 5K9OB 4FFVC 3PWPB 3SDAD 3E6HA 3PV7A 5CJQL 3BC9A 3GXMA 1V0LA 1QHOA 3CDCA 1G9EA 2IANA 1KN4L 1MQKH 5KEZA 5IXEA 1IGJA 4P23D 5JMRA 2AXFB 2DYPA 3SDXF 1IJ9A 3GKZA 5DK2B 4DVBA 3AWEA 3ZTJH 3QDGA 1VGEL 1VKXA 1MWAH 1Q6GA 4AIXA 5HYJB 1CEOA 3PZQA 2QR0B 1NC2D 3GKWL 4XP9L 2EKSA 5K9JH 4K23L 1FYTE 4NDMB 3GNPA 1JF1A 1EIBA 3BWAB 4YPGA 4PBVC 3AISA 2WKLA 2F53D 5C07E 1W9VA 5DQJA 3B9AA 1G01A 4RGNB 2FJFA 3WS3A 1YZZA 4PLJC 5IQ9A 1MJJB 3CSPA 1KTDB 2BY1A 5AYUL 4NQTA 1Q94B 1MW3A 4YE4H 1G6RL 4KKCC 3BXNB 4Z77B 1GONA 1MIEH 4YUEL 2WLZA 4F3FA 3IETB 3MV9E 4EN3C 1DWHM 1I7RA 5CIPH 1C93A 4M48L 4S3JA 3WN6A 3OB0H 5DJ6A 1VHPA 1R75A 1CGXA 5C0CD 4IRSB 4PBGA 4OZHE 4F7CB 5FYKE 3RTQB 5MHSD 3S4SG 2A83A 4ZAKC 2AXGB 4TVUA 1DWJM 1I7TB 5CILH 1UKTA 1MVUA 5I6SA 3OG6B 1AVAA 5IVZA 5JOFB 1TQCB 35C8H 4EI5B 2QMKA 5T3XL 3SDYL 5MEND 1MREH 5GGUA 4JFHE 3BWUC 3V2AR 3PTMA 4D6JA 3AMLA 1H0DB 1BECA 1XCTA 1DP0A 3KYOB 1TIUA 4FLSA 5L7XL 1E73M 1GJUA 4HS6B 2LU7A 4CD6A 1H5BB 2OK0L 1J0HA 4F33A 3X11A 3QA3A 4XXCA 4NO0B 1QFWH 1FL3B 2ED8A 4WWKD 1VACB 2BVUA 5ITBH 1X5FA 1ADQH 5KW9H 1BZ9A 4W4OA 4TUOB 4Z2HA 2F7PA 3PQYA 1JDAA 3D52A 2EDEA 3G5VB 1CLYH 4GW4B 4AD3A 1E1EA 1AGEB 1VA9A 3IYLW 2BXYA 1L4IA 1FFPB 1ZSDA 3BUYB 1GJWA 1RSFA 5FYJH 4Q9QH 1MFEL 2JJSC 5BXFA 3HI6H 2E9WA 1A1MB 1D6EB 2BERA 3QO0A 4HEME 3SCNA 1KR0A 3EBVA 1V6WA 3AFBA 2AK4D 2XPGA 2Y36H 4NNPH 1U6AL 4J28A 4E41E 1I8KA 5DFVC 2QQLL 4X6EB 3B43A 2CBIA 4RIRB 3P30L 4NZJA 5F72S 5F7UA 3UZVB 1KG0B 5J56B 1SMAA 3DSFL 3MGOA 4OZIF 4W8AA 3BJLA 5JDJA 4F7PB 2JIXA 1FZKB 1XH3B 4PTTB 2FBJL 5BV7H 3T0AA 4UNIA 2QV2A 4WFED 2X40A 5CZXD 5BO1L 3STZA 5CUSL 4BSVA 3QEUA 3IS0X 3M17B 3U36B 5EOTA 2CR3A 5T1LA 2J47A 1T03L 1R24A 4NC0B 1MRFL 1F6LL 5CGYC 5DC4B 4HOZA 4UT7L 4IPLA 5GS1A 1VCAA 3MCKA 3S96B 3NZ8A 2DMKA 2CUIA 4F7EA 2FEDC 4GKZA 1RIHH 3UPAA 2L0DA 3OB0K 2ESVD 1JGVL 2VLKA 3LOWA 4YGAB 1G6RA 5I18H 4P9ML 2EEXA 4NUGH 1E55A 4WK9A 1YYML 1LK3L 2BNRD 2FLBT 4UZGA 3V6FB 2EC9U 4UU9B 1XF5A 3RIFF 2SEBB 4O58H 1FC2D 2J5LB 2CJUH 2DWEB 2LAAA 3OB8A 1L9NA 3ARGC 4GBXD 1CF8L 2Z91A 4KK8D 3HS0B 3WV0A 2OLHA 2DLHA 1WUNT 3CZKA 1DR9A 4AYGA 2JJVA 2Q8AL 3FONB 4JPVL 4QHKI 3D6GA 5EU6B 5J11C 1T04A 4MSWA 4QRQB 2Q1EA 1S9WB 3TJEH 3T08A 1I75A 2G75A 2UWEE 2H2PD 4K7PX 5GGQL 4NM8L 5C0ND 3I9GL 1FYTD 3TLRA 1HWWA 5F7EH 4PJHE 1DVFB 2OYKA 3GMOA 1IAKB 1M01A 1G9MH 3D2UD 2BCKA 4O2CB 4AQOA 3QDMB 3PHQA 3A67L 3VIIA 5FHAH 3TA9A 4M1GL 2MQ3A 1CLVA 4OZFB 1UB5A 3F58H 3MV9D 3QWRD 4IHOA 1CQYA 2AGJH 2EXYD 4RSVA 4HZLB 3DYMA 5GIRA 3V0FA 3DXAB 1ZT1B 3MODL 2DH3A 2NY0D 1A0QL 4LLVB 1G7JB 3EYFB 5L88H 1T4KA 4ZFFB 1QW8A 1JWUB 2HTLD 3J8F7 4HT1L 3JVGA 3JV4A 1IGFH 4OF5A 1NCWH 4HDIB 1L7IL 4GAJL 5IHZA 3L4VA 3SJVA 3G5YB 1G84A 3ARTA 1W3JA 3O2WL 1IKFL 1BLNA 1DQTA 5INDA 5KSBF 3T0XA 1J05B 4NZRL 1A4KA 4PJCB 3L3DB 1XRVA 5A6SA 1KF9B 3DECA 3BH4A 1M04A 4YH6A 4LKCA 4MXWH 4P3CL 5IVNA 4GXUM 4NKMB 3VTRA 4LHUA 2VI0A 3QDJA 4NKOA 1AE6L 3ULSA 5DLML 3VSTA 5TF1L 5CD5D 3SE9L 2WW8A 2FZ3B 3GNML 1QYGL 2E8ZA 3BUQA 1G0XA 4N8CH 3GBNL 2CKBB 3SQOH 4OB5H 1YMMB 4KKAC 5IJKC 1CFSB 5HGGS 3LKPA 5AZ2H 3W53A 3CIQA 3ETBF 4M7LL 3WDJA 4F15C 1QI2A 1HSBA 2IBZX 4OI9A 4QHUA 4BQ2A 4L4VE 4XNMA 4JM4H 3BZ4A 3QFJE 1U8MA 4HKZB 3DROA 2HVJB 3MNZA 1RUMH 1JYWA 4UIKL 3KEHA 4CNIB 2ZOLA 2EYTB 2D9QB 1MFCL 1T21A 2B0SL 3H9SA 5E1HB 3TN0D 4EUPB 1U8PB 1FNAA 4HIXH 4LQFH 3VXPA 1M6OB 4D71A 2QPUA 3P77A 4YHML 5BRZB 5F3HA 3SE3A 1T0MB 4XCFL 4NBYB 5HDBE 1F4WH 5B39B 5CG0A 1QHZA 2DQIL 2WIIA 4H5SA 1OGAA 4M7KL 4ZXBD 2GSGA 2PNDA 3HI1A 1L8NA 5FUCE 2IH3A 4RL3A 1FQ9C 4PLNC 1T83C 3HAEG 4MA3A 2W9LA 3HFML 2AAVA 3BKYL 3R8QA 4XVTH 1NOUA 3AHZA 5C0AA 1P7QB 4YPJA 4WEBL 4HS3A 3P4NA 4UOZA 3WQ5A 1KN2H 4JFZH 3KR3L 4YDLC 5I66B 4AWEA 1CZ1A 5GS0H 4RX4D 3ULVH 2P5WB 1UEYA 5KSVA 4J23A 1DFBL 3WUZA 1SR0A 5D2LE 5B4MC 1BFTA 1I1XA 4RGOH 1FNEB 4MCYA 4GRMB 4Z7QE 4ZPVB 4P5MB 2DQCH 3QIWB 5D1XB 1L0XA 3X12B 2XFFA 2IMNA 5IV2A 1YN7A 5IQ7L 4AZHA 1RZ8A 1UXWA 3OJDB 1RUAL 3SKJH 3PWPE 1BG9A 2CKBH 1JZ2A 4MJ4A 2R9HC 3KJ4B 5DK3A 5EZIL 4YK4C 3RY6C 2IXUA 3WE6A 3QQ4B 2IPKA 3C6LD 2XN9E 2MQCA 4WFFE 4R4FH 3DUHA 2G3NA 5GGVY 5ICXA 2ZUNA 1HH9B 1RMFH 5IB2B 3U9PL 1V5JA 4DAGL 4PB0H 1HP5A 5EIIA 3I6KB 1V6UA 1VJZA 2A1WH 3UAJD 4NOBA 3W6MA 2J2ZA 2OL3B 3W38A 4GXVL 4X99A 4AIZB 4X8JB 1J1XL 5GSRA 1X9QA 1KC5H 2PF0A 1OB1B 4RGNE 3L4UA 1M1SA 1Z9LA 3DO3A 2A3BA 3DX0A 2DL9A 5IESH 5I19H 3BYYA 2F58L 2IADA 4KVCH 3SUWA 3UCRA 5JW3L 5E2TH 4GMTL 1YEJL 4HS8H 2CRZA 4W86A 3LZFL 3FCTA 4WU7A 2DM3A 2F1AA 4MAZA 3WL1A 1EVUA 43CAB 1TZIA 3VXOA 4QWWD 3U7YH 2MPAH 3BE1H 2DQTH 1CECA 1MF2L 4QO1A 4PYSA 5HI5C 3HC0B 1T1YA 3L4WA 1F90H 1CDUA 3WF3A 2VC2L 3AHXA 3T1FA 1CBGA 5JHDB 3LY6A 3T8XB 4ACZB 5LCVH 1K9EA 4MQ7A 2JELL 4KI1A 5HHVL 4IMKC 5GGRB 2O5ZL 1FSKC 5DS8A 2R1WA 3RUGA 4BA8A 4TVPL 4JRYB 5DD3L 3C9NA 2EYRB 3PIQB 3VD7A 4GG6F 1CWVA 2XFXB 5E2WL 3TBSB 1HDMB 2YWYA 3WIIL 5AG8A 5CEZD 3DX9A 4AD4A 3JWOH 2IG2H 2NY1C 4HV8B 5E8PA 4OSUL 1NOWA 4MA7L 3HHRB 3LHPL 2PR4H 3ARZA 2O26U 3O2DL 5F88A 2D7QA 2Z8WC 2HFFA 3HPLB 3RNKB 1CPUA 5FUZL 4P3WA 2JTDA 5SWZA 2HLFC 4JAMB 3KLKA 2DT0A 3DGGA 3PJSB 3RMEA 1VERA 3QFJD 4YNYB 4O51B 3BD4A 5DHVA 5D8JL 4HAFA 4R0LA 5IB1B 4A4AA 2GITB 3C5JB 1J0YA 1JI1A 5ENWA 3SBWC 3HUJB 3W2DL 1E4XH 1NQBA 1M7IA 3J7HA 4B5EA 2CH8A 2FGWH 4HMDA 4ONHA 2D7TH 3D3VD 1A21A 5BW7A 4BH7A 4N68A 3E3QE 1FORH 2AJXH 5ADOH 1MEXL 5JW4Q 3BISA 4OLVL 4D8PA 1US2A 3V7AE 4HJ0C 4HWBH 1DANT 1ZB5A 4LBEB 4JFPA 3MV01 4W81A 3BVVA 1WBYB 4MVBC 4WNQA 2XFYA 3H2WA 1PIGA 2IQ9L 4AZGA 2VXQH 3KLAA 5TQ2L 1ZLSH 3NABH 4G6JL 4KRPC 2CGRL 4ELMA 4OJFH 4DK3A 5H2BB 2A6KB 3WUEA 1SJHA 3TA3B 1H8SA 3BP7A 2F54E 5C0GA 5FO7A 1FVDA 3TH2T 1EZVX 1NUDA 1OW0C 4MYWB 1HJXA 1RPQA 1YNTB 2R69L 4FMFA 2MKWA 3DBXB 4KZEH 5DJXB 3KL5A 4Z7VF 1E6QM 1I7UB 2NPLX 1H8NA 1CICD 4AYFA 3QEQD 4Z7NF 3R0MA 3D87B 2VISB 3CJJA 3AIEA 2V5TA 1CI5A 1Z5LA 3D9AL 1FJ1A 4HPHA 3WD1A 2DBLH 4WO4B 3MRCA 2MCPL 3B3IA 2P1YA 2XN9D 3G6DL 4WFFD 3VFGL 4DWSC 2OW6A 2VDQL 4OM0L 2YK1H 1UXSB 3HE6A 5D5MF 3BSZH 1MCFA 3MYJA 4OKVA 3SKMA 1AGCA 4R26L 2J72A 2KL6A 5E56A 1T3FB 3SUSA 1JPTH 4PJXE 2EPLX 5FGCE 1RH9A 2CLRB 4KUZH 1P2CA 2CETA 5CPSA 2F8OA 1QSEA 3MACH 4EVNB 4HUXA 2K9UA 4IRJC 1ACYH 3H6JA 5GJTH 4PRBA 5FECB 3NIDE 3U7AA 2OXGA 4LARH 2A9ML 1IKNC 3O2DA 2RCSH 3BJ91 1WP6A 3EFDH 3BKCL 2QSQA 3AZTA 4ODHL 2BSED 4M5YH 1I8MA 3W9DB 5K33A 4LCWE 1OL0A 3D39D 1CGWA 5DDHA 2JK5A 2OX5A 2KQNA 4M61B 5DRNA 3SDCD 1CFQA 1HSAB 3MI6A 4CD7A 2NW0A 5J6GB 5L0QB 3GXPA 1IMHC 3TBVB 5I15H 3L2MA 4PMOA 1X44A 3BD5A 5TQ0L 3MLZL 5J06A 5TGBB 4G8GE 4AM0B 4AEIL 4Y89A 4PG2A 4PRNA 2FYYA 1MHHA 1MFDL 1TR1A 2EQDA 4NQXA 5L2KE 1FBIH 4OF8A 2XZAL 5D7LB 5FO8B 3WXWH 3W5NA 3EHBC 4GZEA 2H3NA 4L4OA 4DGVL 2R29L 2D3NA 5I1IH 2VN4A 4MD4A 3U1SL 4YDIH 1EH9A 3O3AA 3TFKC 1HXJA 1NFKA 1Z2KA 3WEXA 1OBAA 5JOPD 3IDIB 5D7KE 3V0AC 1JGUL 2AK1H 4TSBL 2NY2D 4MB5A 1J1OL 5GSVB 2QL1A 3ZTNL 3QB7C 4MXVE 3OKKA 3UC0L 1PYWB 1P1ZB 1OTUD 2EPOA 3KXFB 4ESKA 4YXHL 1PSKH 3P4OB 3KPLA 3ULUF 1PZ5B 2FJHA 3BAYA 4PJ7A 5ISZB 3L95B 3GMNA 2FD6L 2EPMX 3LXCA 4MJID 1NKOA 3GSOB 2DT1A 4X83A 2V7HB 1IQDA 1KLFA 4ZTOL 1KELH 2XWEA 5F1KC 4FTVB 3IJ8A 1JGEB 2EECA 3R8BB 2YL9A 4ODUB 1WE5A 3CV5A 2DWDB 4J8RA 4EIZC 5AWNH 1Z0MA 3TBYA 3VFMA 1ZLVK 3NVQA 3VFWB 1T66C 4PJBA 4S3KA 1UZ8B 1OCWL 5DMGD 4ZG1A 5DD5H 1MXDA 1G7PB 2ZP0T 2IC2A 3BQUB 3OX8A 3OQ3B 1J12A 3V4VH 4LNRB 2HJFB 3TVMD 3DMMD 3ARFB 5JR1L 2OQJB 3VGAB 3U5YA 4QGTA 1C5DB 1UWGL 1HCVA 1YHTA 2AV1A 4YAQB 5E1QA 1A6AA 4C7DA 5CP7A 5MEQA 4K8RC 3GSRB 3DX7B 5BMFL 1FO0B 4XNZC 5I9QB 4ZXLA 2NMSA 1LE5A 4W6XB 1NL0L 1RU9H 4OLZH 2UZIH 5K9QI 4GO9A 3PE9A 3ZKNC 4HJGB 1I3VA 4JM2D 3VWKA 4H0IA 1KBGL 3CX5K 2BVDA 3U5UA 3Q6GH 4ELKA 3WF0A 1OF2A 2HH0H 4FQCL 2WVVB 3HRZB 3LXBA 4MAYB 1MHCB 2HFEA 3QXAB 5JW4N 1LG1A 3RL2A 1ZTXL 4GKNB 3F62A 4P9HH 4PTVA 4MNQA 3WH8A 4ZFOL 3KPRA 5JO5B 5MP6H 3H42L 5F3BB 3QXTA 1I8IB 1T2QH 3RY6A 3MUIA 4G8FA 3MJ9H 5ABGA 3AUVA 3KPOB 5K59F 1T0OA 1NMAH 2N56A 2OMNA 3RKDD 2VX4A 1XGYL 1I1YB 3VIFA 4JFTA 4LASL 4KUCD 4X6DF 3C5SA 1BPLB 3P0YH 1XIWD 2Y07L 2FWOA 3TO4B 1ORSA 4G9FB 5C09B 4LCWD 3CUJA 2Y6SD 2Y23A 3AFLA 2ZX5A 1RZGA 4CJ1A 1ZKAA 4LIQH 3PZUA 7CGTA 3C8KA 5A8NA 4XB3A 4LGPB 4PGEB 1ZGLB 3SCTA 2F7QA 1C8QA 4OLYH 1INDH 4J4PC 4JVPA 3RL1A 3AXIA 4KROB 3SKNB 3D3AA 3LQAC 3MLTA 5I8CB 1W9XA 3DJ9A 4LSPL 5EIVA 2DTMH 3CFDA 3UR7A 1I4FB 3MV7B 2V17H 4PP1D 4XWOD 1CTNA 3V5HB 4NZCA 3BPNC 4UT6H 4KDTC 1OWWA 3C5ZC 1KNOA 1HIZA 1UM5L 2IAMC 3KG5A 3VWJB 3BPCA 3AWFA 3BO8B 32C2B 1QO3A 2F74B 2I26N 4ZUSB 1BVLA 1OAXH 3BH8A 4XT1C 3B8SA 4JHOA 1A14L 1HVQA 3THMH 4IMKA 1QW9A 5D2NC 4Q6YA 4JRYE 3SCUA 3RWDA 4TQEH 1DL7L 1K5NA 1PLGH 2X10A 2ZOKA 1N3NA 5TFSH 5EU4A 1G7QB 2BJML 3HKFA 3SPVB 4BQ3A 3KZSA 1XF4A 4X80H 3GTNA 1JNJA 1IEHA 2EE3A 4PYGA 2WINB 4X5WA 3QPQD 3L4TA 1JVKA 5J9PB 2CLVA 4OV5A 3MFFB 2APTA 1WDPA 3N50A 5GS2H 3WSQH 2PYEB 3ZYOA 5C8BB 3TC9A 1XZ0B 3VFOA 4DUVA 4NO5B 3H0TA 1O7AA 4KMTL 3UPRB 2NY3D 1PW3A 3SBWA 1A1NB 4ZFOA 1F3JB 3DHUA 3TZVC 1ISVA 4UTBL 3NDZA 1T5XB 1OAQH 4PY8J 3S37H 1SEBA 4ZNEE 4J27A 4GW1B 1G7HB 2ZCHH 2EYSA 1M7DB 1IC7H 2CRMA 3EOTH 3JTTA 4XRCB 1TETL 1UKQA 3MQIA 4KK5C 5BJTA 3QBTB 3GMLB 3HZKA 3NCOA 2EIBA 3L3JB 3D85A 1R3KB 2Z93A 5JDSB 4R7DA 3FZUC 5LQBL 4FQHB 5FD0A 3CVHL 4PMVA 1XSIA 3E6FA 2QBWA 2I27N 4Y1AB 5B21A 4TVCA 1UENA 3OHXB 1OW0A 4HK0B 3S34L 1JPSH 3AICA 1FZJB 3MUAA 3UBXI 5JPNB 3LXAA 4KU1A 4PRPA 4YO0A 3UO1L 5SX5H 4KGLA 2VDKH 3O41B 4FQ1L 3QJHA 3MREB 2DQGL 4ZFMA 2BFVH 4YGVB 5D1ZC 4ALAH 1BQHG 4WJ5A 1KJVA 3PWVB 4MQSB 3BFOA 3MBED 1EJ6A 4ZUUB 2BRRH 2BY2A 3AM8C 4P5TC 2I25N 3MU7A 4WEUD 1REIA 1ZHLA 4PJDF 5CP3A 3CC5B 3CMGA 5C2BL 4OOUA 4Z2GA 4DWSA 2BOCB 3Q1SH 5E8NB 3QUZB 4R4BB 1IT9H 5C0BD 5EA0L 3MJ8A 4PRHD 3VDBA 2DM4A 3HA0A 3H9HB 3KPNB 4J3OC 3KJ6H 3T0EE 1MCNA 3HMCA 3RAJL 3DUSA 4L9LC 7FABH 1J0IA 2Z31C 3ZE2F 3RZCB 1YECL 1V6VA 3G6JF 3O6KL 4OLUL 2BMKB 3LRLA 3FQXA 2NW2A 3CLEH 3L7FA 2WHJA 1QFWM 5ESQA 1KJ3L 4JFXA 3GGWB 4K7PL 4LRNH 4MHHG 3WLBB 2IGFL 1RZKH 1KPUB 4NQSB 2XRAH 1IKNA 2O93L 4LVNC 4M5ZL 4WFGE 5DTFB 3QAZB 4WKFA 3BOVA 4K8RL 5TPWL 3SDAC 4AZIA 3OSKA 1I9EA 2KBGA 3O11A 2DIAA 4L3AA 1BQLL 2QQKL 3MOAH 2H6PA 2CDEA 1GGIL 4P23C 2LABA 2FL5A 3QPXH 5E4EB 4QF1A 4X7FC 4LDOB 4NQDE 2WMPA 2DSKA 1IGIL