2YOCA

Crystal structure of pula from klebsiella oxytoca
Total Genus 335
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
335
sequence length
1051
structure length
1051
Chain Sequence
DVVVRLPDVAVPGEAVTAVENQAVIHLVDIAGITSSSAADYSSKNLYLWNNETCDALSAPVADWNDVSTTPSGSDKYGPYWVIPLNKESGCINVIVRDGTDKLIDSDLRVAFGDFTDRTVSVIAGNSAVYDSRADAFRAAFGVALAEAHWVDKNTLLWPGGQDKPIVRLYYSHSSKVAADGEGKFTDRYLKLTPTTVSQQVSMRFPHLSSYAAFKLPDNANVDELLQGETVAIAAAEDGILISATQVQTAGVLDDAYAEAAEALSYGAQLADGGVTFRVWAPTAQQVDVVVYSADKKVIGSHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPDGWDNLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAGDSNMVQHLKTLSASGVTHVELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLNQLKQSDSQDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTTRIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMGYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDSVRGGGPFDSGDALRQNQGIGSGAGVLPNELASLSDDQVRHLADLTRLGMAGNLADFVMIDKDGAAKKGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKASQEADLATRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRISDDGSNYEVITRVKEMVATPGEAELKQMTAFYQELTELRKSSPLFTLGDGSAVMKRVDFRNTGSDQQAGLLVMTVDDGMKAGASLDSRLDGLVVAINAAPESRTLNEFAGETLQLSAIQQTAGENSLANGVQIAADGTVTLPAWSVAVLELPQGEAQGAGLPVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PULLULANASE
publication title Structural Basis of Pullulanase Membrane Binding and Secretion Revealed by X-Ray Crystallography, Molecular Dynamics and Biochemical Analysis
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Hydrolase
total genus 335
structure length 1051
sequence length 1051
chains with identical sequence B
ec nomenclature ec 3.2.1.41: Pullulanase.
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
A PF03714 PUD Bacterial pullanase-associated domain
A PF11852 DUF3372 Domain of unknown function (DUF3372)
A PF17967 Pullulanase_N2 Pullulanase N2 domain
A PF18494 Pullulanase_Ins Pullulanase Ins domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yocA03
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yocA01
2.60.40.1130 Mainly Beta Sandwich Immunoglobulin-like Rab geranylgeranyltransferase alpha-subunit, insert domain 2yocA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2yocA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yocA04
5DJDA 3QNYB 5I1CH 1DBKL 4WUUD 1SHMA 2R0WH 1CLXA 4DWSA 4QWWD 1TNMA 4KRNA 1MI5D 1QVBA 4P2QD 2X2YA 1JD7A 3PZQA 1JPGA 2A2QT 1ZANL 4MD4B 4C83B 1G0CA 4ZUVA 3SKNB 4OI8A 4JE4B 1GOKA 3WFLA 1EZVX 1LO2H 3OGVA 4WO4A 1IM9B 2CJUH 4PGDA 4NO0A 5BS0A 3AHVA 4NQED 3LCYA 4L9LB 5E08L 3PBGA 4Q9RL 4QHMA 3GSNB 4HGKC 1G7HA 4K71B 3ZE0E 4OLZH 1A14H 1GGCL 2VQ1A 2FYVA 1AHWB 1S3KL 3GSQA 3WO4B 5E2VL 3CC5B 1OGAD 5CEZL 2EXYD 4QXTA 3WFBL 3KJ6H 5I1JL 2NY4C 7FABL 3BAIA 3SDXB 3ARFD 2DT1A 4APQD 3VXPB 4FHBD 5F8QC 2UUDH 5C07E 4GG8A 3O6LL 4AENB 1MWAB 1EO5A 3L2MA 2Z8SA 2W91A 5HYSA 1Q1JL 3EBVA 5BRZA 5CILH 1E4MM 2CXGA 4NQDB 4XPGH 1FHLA 1MYRA 3ZT5A 4UT7H 4HP5A 5DRXB 3RX7A 3EOTH 3VXUE 5B22A 4POZC 5E0FA 2XWBB 3D0LA 2CLZA 3L3OB 1EHLH 4ONFH 3DV4A 3VA6A 2VDQL 5K9JH 5CS7A 1DUYA 2G2RA 4MDPA 2QPUA 4XV0A 5A16A 3CSYB 2FECL 4PJIA 4ERSH 5IHUL 2QSCL 2UY7A 4NHCH 5C0AE 3K4ZA 4ZYKA 5JUEH 3DJ9A 3VXRB 3AISA 3KYMB 1LWJA 2VT0A 3D50A 3M46A 1HJSA 4QWWC 3TA3D 4NZFA 1IGCH 3OGSA 1IKFL 1S7RB 2XPGB 2IH1A 5FECB 4FNSA 4KWUA 3HG2A 5DJ0A 4OCRL 2PBGA 4MNQD 1FYTD 2KL6A 3O9WD 4FFVD 1WFOA 5DJ8B 4ODSL 1I8IA 3W4RA 4YXLL 4R90H 4JHBA 2W92A 4GO8A 1PLGH 2PWHA 4QXGH 2CGRH 3KL3A 3GSNL 1A6VH 1J8HA 4N0YL 3ZSTA 1NMBL 3AMGA 1DLHA 3DVNB 4WI2A 4PJBF 1EXPA 4D3CH 2OW7A 1U58B 4LX4A 4P3CL 1C5DB 4APQC 1OF2A 1XT5A 1T5XA 3I50H 5JOPD 5BROA 3WN5B 3DMMA 4MA8L 2DT0A 4RFOL 5IB1B 1OGTA 5C7XH 4U1IB 1H5BC 4RWHA 1GJWA 2D20A 4PY8I 4DEPB 3QUMH 2PYEE 4HLJA 1T0MB 1MWAL 2EDWA 1S7UB 1T1ZB 4I0PA 4C57C 2WQRA 4CCDA 3MJGX 4QRRE 2CDEB 1HE7A 4XI5D 1FCCA 3D52A 3UC0L 4NFBA 3LKOA 1MCPH 5AWNL 5DTFA 1MFCH 1E6PA 2PXYB 5HVHC 1KG0B 3L6FB 1XZ0A 4I18C 4UINH 4HWEH 2A3AA 2V2TB 2P48B 4LAJH 4HHAB 4OD3L 2EC8A 2ENSA 1JFQH 5DJYA 3WF0A 2HJFB 2VLLB 4JFDD 8FABA 4GG6E 1A7BA 5E2WH 4JG0L 1NGPH 4G5ZH 4W93A 3S5LA 1KULA 2JCCA 1WSST 3U4AA 5ISZD 2B2XL 3UEZA 4ZXLA 1P4IH 2W0LA 3IJHB 5C0CA 2Z8VC 3KNBB 3TA3C 1VJSA 4HUVA 4ODBD 5BXFA 4WTWA 4LVEA 1HNGA 1GJIA 4ZFGL 4L4TB 3O9WC 1AGFA 2O5ZL 3UESA 4U2ZA 5EU3B 1ZJBA 5DMIH 3D18B 2Q6WA 4EN3D 5JXED 4HSQA 5LJYH 4C7DA 1R3JA 4N0FB 3G04A 1NUNB 1A2YB 4PRIE 2P8PB 4XCCL 2IF7A 1QBLL 1UKPA 3LKQB 3Q3GA 4XNZB 1MY7A 4K07A 5T5NF 3RGHA 4DN4H 3IJ8A 3BIKB 3MOAH 4JDVB 3ARDA 4KK6C 1CE1H 4TNVK 1MFEL 4LFHD 1T03H 3PWPD 4GRWB 3V7AE 4U3AA 2NZ9D 2VDPL 4F2MB 4GMTL 3JUGA 4HAGA 2GJ6B 3F6LA 4BELD 3MO4A 1XIWB 3RY6C 2YBUA 3GHBL 4WDIB 1A21A 3FO0H 4I3SL 5ESAA 1CLCA 5TDNB 3VFTA 1J86A 2JF7A 3H9SD 4MD0B 3FQXA 2UVEA 3GSOA 1QHPA 3SJVA 3QHZH 1ONQA 1KCSL 1CDCA 2VQTA 3SE9L 2NLJB 4OZFA 4GSDH 1FZJB 3EIFA 3V0VB 4DCQB 5E9DA 2Y24A 1KV3A 3ZDYE 4OLVL 1QSFB 2E9IA 1A7OH 3DXAE 3MNWA 1XGRB 2B20A 1T83A 1R75A 2R2HA 2XFYA 1XCTA 3HRZA 1E73M 5EIQA 5JDSA 1NC4D 4PIRF 4U0RC 3TN0C 2CXKA 1JZ5A 2XY1A 2YPVL 5F88B 3DDGA 1ZSDA 4UI2A 5DK0B 4G8GD 3MMEA 3W39B 3MV7E 1K4DA 4YR6B 1A1MA 4Z78B 1U8PB 3D39D 3SGDI 3TO4B 2G9HA 2DKUA 4Z7WA 1OW0C 5DQ9B 3VIIA 2R1XB 3WIHL 4LGSB 3FQTB 4EN3C 2GITA 5JXEC 1E6ZA 1CLZH 3E1F1 3FFDA 2ZWLT 3T08A 3SGEH 3IAPA 1MF2H 5DSCB 4LSQL 1XHGA 1BFOB 4Z7UE 2GK2A 1KCRH 1PAMA 1RZKL 3HE7D 1S5IH 2O5YL 5FKYA 2NY0B 3FN3A 5KVDH 1DUZA 3MFFB 4GW4A 4Z95L 3AFLA 5F97E 4ZS6D 4Z7VE 4JO3L 4Z0BH 1RK0A 2NZ9C 2MQCA 4KHXH 4EXPX 1U30A 4FTVB 4GKNB 4JO4H 2NX5B 4XPBL 5IEHA 3QZWB 2E7HA 4G9DB 4L29A 4URTB 2EJ1A 2BJMH 1B2WH 5HGBB 4EI5D 2AQ2A 3LKPA 1OCWL 3HG1A 3WY2A 2ZXQA 1RH9A 2YZ1A 4N90E 2QQNH 4B9ZA 2J2ZA 1CD0A 2NXZB 4XCYA 4Y7EA 4ATLA 4NKOB 5L2KB 2YD2A 4OTXH 2Y5EA 1I8KA 2EABA 5IB3B 3E6FB 3GNMH 2NZIA 2VN4A 4LLDB 2BY0A 1QI2A 4CN1A 4Y16B 3CH9A 3F8UB 4NSKA 4OZ4B 4RE2A 2GFBA 2AJXL 2R8SH 4MD5A 4OLWH 1H1NA 3VXMB 1M7IA 4RMUA 3HNVL 3C8KB 1FG2B 5FHAL 4X6EA 4OUOA 1T7VA 3TYGL 2VLMD 1HKLL 4MS8C 2LAAA 2X1PA 3HJEA 5DK3A 4FQJH 3BP6B 3O2DH 3V5KA 3QNZA 3NN8A 4WGVB 1YMHA 1F97A 4PTTB 1OIMA 4ZXBB 1MFBH 2H45A 1E56A 1A6PA 4WFFD 4F7TA 1EEQA 2H26A 3SURA 4WW2C 4UTAL 1BBDH 2VSCA 1P53A 2JELH 4JY6B 1GGIL 2V17H 4X6FA 5IW3A 1VF8A 3L5WA 1B0WA 1IGIH 4CJ0A 3BP5B 4HBCH 2X4NB 5EUKA 1R5VB 4TSBL 5TFSL 3HS0A 1X7QA 1KJMA 1PSKH 4KGJA 5EULV 4GQQA 2X4PB 3HE7C 4ZAKA 5EU6E 5D1QA 4OJYA 2X9YA 1YEDB 3VPLA 5M03A 3A24A 3OJ2C 3O6FD 1XGYL 2DI9A 5MENA 4K9EL 2P5EA 3B8YA 5FDWB 4YO0B 2VLRE 4TVUA 2BX5A 4G6MH 1MLCB 3MRHB 4H88L 4UUJB 4HZ7A 1UZ1A 3IAGC 1MRDH 3EDKA 3ABZA 4Z6AT 5JHDE 3F7YB 4QOKD 5JW4R 5BV7B 3TOPA 4LCUA 3LHPL 4L8DA 2EPOA 5IG7A 1HJXA 2O92A 4JIEA 4PMZA 1WAAA 2JIXB 2VDRL 1RZIA 1G9NL 4JQIL 2RIKA 5H35B 4L8CB 2XZAL 4E41D 1H3TA 2YZ8A 4HMEA 4HK3J 4KK8D 4HOXA 3P77B 4MJIB 1AGEB 2X7LB 4FABL 1SMOA 3TT1L 5BQ7B 2X1IA 4R2GB 3N06B 3KWXA 4XT1C 1IJ9A 5C0EA 1U9KA 5IROC 3BSGA 3CZ8A 1NKOA 1GONA 2PC8A 1RJLA 1X1NA 2J8FA 1NWSA 2C5DC 3ISWA 2C3GA 4F9PC 4CKQA 4XZBA 2AJVH 3WD5L 3WD3A 1BJ1H 4NO3B 4YDLB 2X1OA 1SR0A 3RFZC 4OUUA 3HHRB 4O02H 5BOPA 4OOUA 1M03A 5GGSB 5KZCD 2UY2A 5CJ5A 4WU5A 5M7QA 4N42A 1JNLL 4JFWA 1I9RH 4XUYA 4CVWA 1R0AH 4LCCA 1YYML 1YNLH 1TMCB 4IMLB 2IXUA 4XNQB 4R6UA 3OGCB 1SY6L 1F3JB 5CEZD 1QSEA 4PLKC 5C0IA 3HC4H 3MRJB 1MCBA 4KMTL 3MX0A 2J44A 5EDXA 1SEQH 2XGBA 4QHNB 5I8KH 4TUJB 3WKZA 3UXFA 1OP9A 4KAQH 4MA7H 1FHDA 4WF7A 1X5LA 3T3MF 3O6FC 4NWTL 3MA9L 1AO7E 4NN7B 4LPTA 3QIBA 4P4KD 4WJ5B 4JHAH 3JWOH 1WJ3A 2JJUA 4YDJA 5HBFA 2FDBP 2VLKB 3UTTB 1JWUB 1WFNA 2DQCL 5JHLH 4P2OA 1UR4A 5IB2B 2VXSH 4FOMA 3A4AA 4JO2H 1AQHA 3QUKA 5BV7L 5TH2B 1KEGH 5IFJA 1TETL 1P7HL 3QEQB 5FGBC 1WITA 1DQDL 4NN6C 1BQHB 2YHGA 1B0GB 3GO1H 2DBJA 5JMOC 3IU4L 5KW9L 4KK8C 5GSRB 5I1LA 1E4JA 1NAKH 3MUY1 3BGAA 4N0UB 4Z8FL 4RX4A 1BEYL 3QIWD 1SJEB 3CVIH 3QG7H 3KPTA 5F3HB 2FYYB 2WUBL 4DM2A 5E00A 3FW6A 4WV1A 1U8LB 1AXTH 3I6KB 4Q2ZB 4U1KA 4FQHB 5E4EB 4PJFF 3WS6A 4OZGE 2P24B 4X4XB 2EICA 2VUYA 3GHEL 3GXTA 4P9MH 5A2KH 2VNCA 3QULA 4CD6A 4XCFH 4X98A 2V5RA 3HMWH 1SEBA 3GI8L 3OLEA 1JPFB 3MPCA 2GJXB 3IFLL 1J0JA 3LN4B 1FVDA 5D6CA 5DMJB 1JUFA 4W6WB 5CHNB 5D7LA 4WI5A 3JTTB 3TVMA 1TJHL 3UG3A 1EVUA 2HT3D 5CCKL 1F2XK 1EHAA 3MGOA 4MCZB 3ZR6A 4MWFA 3M17A 1T6WA 2QADB 1KTBA 5ID0B 3MV9A 4MQTB 5HNNA 5IDIA 4NM8L 1OAZL 1A1OB 4MX7A 3ECQA 2EDHA 4MXVF 2K7QA 3RKPA 5I19H 2WSPA 1W9VA 3N9GH 3WLWD 3BZFA 1TCRA 4J3OC 1DQLH 1LO2L 3CMJA 4N8CH 4UQDA 1X4YA 1HL8A 3IT8D 1JF1B 3VWKA 4ZTPL 3FB6A 5AYUH 2QTEA 2Z92A 4P4KC 4V1DE 4UQ2B 5IMOB 2DQHH 5ID1A 5DQDH 5JOFA 4HZLA 4NQDD 4YHMH 5IVXA 1MH5B 4Y4KA 4OCLC 2A9NL 4M93C 4BQBA 1OARL 2IQ9L 3WDIA 5JQ6L 3CC1A 2OZ4H 2DSVA 1HDMB 2ZKHL 4LBEA 3MQIA 3MRNB 2DN7A 2EDFA 1ZEAL 2GKIA 3AFBA 3KXFB 1K9TA 1BF8A 4Q7DA 1KLUB 1FDLH 1NCNA 1QLFB 3VXQB 2CO6B 2WBJA 4L4VB 1A6AA 1A64A 1PGRB 2FBJH 4XPTL 3MJ7A 2XVPA 4ZFFB 4ZO7A 2R0KH 3C5JB 1E0XA 3ZO9A 1FAKT 1NAMH 4GFTB 5B3JE 1G7IA 3RVXD 2QQLL 4KFZC 4C55A 3QEHA 3AM8C 4UDTA 1Q9WB 5F7LB 3UTOA 43CAA 5MP6L 3QDAA 1U41A 2QV2A 5C0RL 1S7VA 1BGXH 1T4KB 3G5XA 4KZDH 3OBAA 1S9WB 5EBGA 4HIJB 2HT3C 5ABHA 1XF5B 4L9LC 1YY8B 2ICEA 2GSJA 4NZUH 4NQCA 3PL6B 3TP4A 4UB0L 1LWRA 2VZ1A 3D3VE 1IGJB 2KUTA 4XC3L 5D5ME 4PV9B 4K71C 3MI6A 1HZHL 4UNUA 1IGCL 1AHWC 3WO4C 4M6NL 5DT5A 3GSRA 1INDH 3G9AB 1ORQA 2OP4H 4AZHA 1RP8A 4P23A 3IFNH 1FQ9C 2V5TA 1MFVA 2AEPL 3WLWC 3RM9A 4YIQB 2C3VA 4X7DC 2WW8A 3NCBB 1S78C 2JJTC 1VKXA 2HTLD 3GJFB 4LDEB 2FJGB 1X5HA 4CADB 5F9OH 3B6SB 4DN3H 3BKMH 3DUUB 3OKDB 3QO0A 1UH4A 3OZ9H 4F58H 4XB3A 1PX4A 3VXTB 3QQNA 3EOYG 2K1MA 3TV3H 2CKNA 2RB8A 1VPOL 2Z8WC 2F53A 4S11A 2PCPA 1X44A 3QQ3A 4PS4L 5EWIH 1KPVA 2V9RA 4X6BB 4PRNA 4EANA 1TDQA 2XG5A 5FD0A 4HDIA 2EDLA 5JXAL 1DQJB 2DQEH 3T2PA 2F58L 2PW2B 3V0DA 2ZIDA 4O58L 4TVCA 1GHFH 1YN7A 3GMLB 3MRFA 4KXZH 3NCJH 4DQOL 1J5OL 3V0HA 2J62A 1P1ZA 4X4ZA 3PDOB 5D2NB 3GBNL 4KDTA 4HIIB 1BIHA 1RULL 1YEGL 2I24N 4ZO6A 3W6MA 3O6ML 1Q9OA 3BPCB 5A1AA 4NDMB 1E28B 1MCPL 1MEXL 2E9LA 3DOSA 4DUWA 4P46A 5ANMA 4PD4K 3RVXC 4HKJB 2O9PA 1KEMH 1ISZA 1ZGLP 1I3RA 5IF0A 4XAKD 1SMAA 3H3KA 1DSFH 3OAYK 5F3BB 2EIEA 1Q72H 5T3XD 4HV8A 1JFQL 4NP4H 3ZYIA 2Q76B 2O9TA 2YPLA 1L4IA 5E2WL 1UM6L 3KPNB 2BVQA 3L3KA 2X1QA 3C5ZD 5CJBA 1C5BH 5IQ9B 1CF8H 2ADJB 2AV1A 3IF1B 1VEOA 2AGJL 1TQWA 1C5CH 1EAPA 4DGVH 4G80B 4NC0B 3S88L 4JFOA 3QHTC 2GJ6D 3O3DB 5IB5B 5DMIL 2KKQA 3S7GA 2QHRH 3V0AC 2H6PB 3WN5C 2WWMD 3AXLB 3FKUS 2GK0A 3KWWA 4UU9B 4B9YA 3QDME 3QIUA 4TSAH 3KEHA 2PKDA 5I24A 2DMKA 3MOAL 4DEPC 1A22B 3QB7C 8A3HA 3HZMA 2GDVA 3TPUA 3IJ9A 3CUIA 2A3BA 1QLRB 1UWIA 3UO1H 1A9EB 1T0OA 5IESL 3QFDA 1R7OA 1MQ8A 3W82A 3HI6L 2ERJB 3F7RA 3O41B 3HR6A 2GTWA 3QJFB 2QSQA 4RAUB 5F7EL 5E1AB 5C0JB 2ZUYA 1PW3A 4PGEA 2ENYA 3QWRD 1FIGH 3GXPA 3OKKB 4M29A 4PJAB 1T2XA 2BSTA 3T1FB 5I16B 1AD9A 4JFQB 1VA9A 2GAZB 1OB0A 2VLJD 1BOGA 1A6WH 4G43A 2ATPB 3CVHH 1WBYB 1HSAB 5DD5L 2J7LA 3QQ4B 1MFUA 4AYSA 3RWDA 2VH5H 3BW9A 3L4WA 5CBEB 2EYTA 4BZYA 1L6XA 1E27B 4DM1A 3TO4D 4EVNA 5I2IB 1NCAL 2AEQL 2CLRA 2VDLH 4NKMB 4Y19A 3CUJA 1UYWL 2B1AL 1J0ZA 3OAYH 5DUPL 5I8OH 5JW4M 1Z9SA 2DEPA 4AEIL 1T22A 4NUJB 5ABGA 1KJ2A 2ZCLH 4MJ5B 1E4IA 5D9NA 1ZK9A 4B5EA 3O6AA 4XNZC 1RZKC 2CLVA 2E7CA 4RDQF 5I73B 4W88A 3A67L 5EZOH 2VIRA 1BQLL 2D3VA 1I9IH 4UMGA 5FCUL 5C92A 5IW6A 1HP4A 4MYWB 3DYPA 3L7FA 4WUUA 3O9NA 1OPGH 1MNUH 4OJFH 4FTVD 1FJ1B 3DSFH 4PN2A 4R0LB 2NX5D 3MV8D 3JV5A 3TYFB 1XIWC 3RP1A 5DWUH 2WWMC 3BWUC 4NYLB 4GH7B 4NQEA 4X7FC 3LV3A 1NJ9B 1S7TB 5DJ2B 2VXVH 5JMRA 2NYYD 3AMKA 1AKJD 5TGBA 2O61A 5L2KD 5IVZB 3QH3A 2G60L 4M6OL 5F7DB 3QEGH 3EFDH 5FL0A 4ZPTB 3V4PH 2FLRT 2HKFL 1VRXA 5FB8B 1JDDA 1VACB 2V5MA 4F7PB 1XSJA 1V03A 2R4SH 2ICCA 4KHXL 3RJQB 3WFDL 1SVCP 3GBLA 2IFFH 2JCCF 3BH8A 3PHOB 5GS1B 1CT8B 4WY7L 5HHNB 1LEGB 3PIQB 1ISVA 4APQA 5DDHB 4PMXA 2XXMB 5FO7A 2W0FB 5IIEA 1H5BA 4QCFA 1T7WA 3MCG1 2XYLA 4OQTH 4PJBE 5D8ZA 1ZBVA 3BZEB 3WSQH 5I6SA 5HHQB 2J8UF 5C1MB 1QWUA 3DO7B 5GGQL 4OLXL 1FE8L 1YQVL 1ZL1A 4U7SA 2G5RA 2AERT 2VXTL 4ZXBD 4XPAH 3TO4C 1ADQA 5DMGD 1R7AA 4AQOA 4I18A 4OLWL 2CKBH 3QA3B 3P73A 3VG9B 2J7BA 3W53A 1N64H 2L7JA 3TH2T 2IH3A 1UXSA 1YEFL 4ZS7L 3FONB 3NFPA 3BKJH 3X11B 3CFJB 2R23B 3WD4A 1C7TA 1J1PL 1EGJH 4C4KO 2YD5A 2VVSA 5ESVB 2J6EL 4CL7A 1XGPA 1I8MA 3TBWA 4KROB 3PWJB 5T3ZH 2FHCA 4K9EC 4X80H 3GI9H 2ICWI 1JMXA 3OKYA 4KJYA 2GJZB 3SOBL 3TA3A 3GKWH 1RZ7H 5M95B 1F02I 4YAQB 4HGWA 4HIXL 1BBDL 1CFNB 2QR0A 3STZB 4MNQA 4CVUA 1FYTA 3VWJD 1IGIL 3BAEH 1ZT7A 1DEDA 3O9WA 4KVNH 3MSDA 3EYFA 2V7HB 2DM3A 2VUOA 3PV6A 3KHQA 2JIXD 1G9NC 2NXZC 3EJZC 3WUFA 5A6AA 4C56E 2AMGA 3KLHC 1KN2L 4HKZA 4AJ0A 1OAUL 3C87A 2NY3D 3VFGL 1VFBA 5AG8A 4PJGB 4KRPB 4MJID 1A6TB 25C8H 1HSBB 5FA4A 3UTZB 5DK2A 2ZUMA 1BVLA 3LQAL 5ELIA 3U7YL 4Y16C 4UFHA 2VDKL 4D0DB 1K8DA 3RY6A 1CECA 2BXZA 5EBAA 5LG1A 3REWB 4J3XA 5HXMA 5J0BA 1MFDH 3VGFA 3QXDA 5I8CA 3MR9A 2CEQA 4O9HH 2BOBB 2V5YA 4NZTL 3EGSB 5ACZA 3WNLA 4YHIA 1MCOH 2Z93A 1R46A 4G7VL 4GMSH 1DQML 4RMTA 4WSJA 1RZJH 3BP7B 4ZXBC 4GKSB 3ZKND 1U6AH 5DMGC 1CBVH 3GMRB 4HFUH 2DWEB 4D6EA 4U1SB 4YDVA 4CMHB 4YUEL 4BSWB 1DWIM 4HA3A 3TN0A 2PUQT 1J1XL 3MCLH 2H8PA 4JFDA 4PRPE 1NL0H 5D7IB 2UWEF 5DHVA 3KVQA 3RHWK 2PF6A 3L9RA 5ISZA 1WIPA 3MUZ1 1D6VL 3IDJA 1LO4H 1YJDL 3DX7A 3PNWB 2IMNA 3P0YL 5DQJB 3VXSD 5EU4A 5FYKL 1ZBWA 3JV6B 4K7FB 5JLZB 2BVUA 1TQBB 1KCVL 5EUOB 3AIBA 1YNLL 2DLGA 4BFBD 6CGTA 1OW0A 4XB7A 2OL3A 2VLKD 3VWJC 4Y89A 5DO2D 4BH8B 1EOKA 4JFHE 1Q94B 4YE4H 4JR9L 4EN3A 3O45B 3ZKMD 3GMOB 4WEBH 5JXEA 5BV7C 1FVEB 5C0ND 3AIVA 1FH7A 4H04A 3JUZA 4NM4L 3CH1A 3RNKB 5T1DL 2WZHA 5I1IH 5E2TL 4RL3A 5GGRA 5IBUB 1XMWA 4Q74A 2YWYA 5B3NA 2EYRB 1IGTA 2P4AB 1JNDA 3QDJA 4XZUB 1EJOL 3EYVA 2EH8H 2FRGP 3PWPA 4JFPA 4JCLA 4WI7A 1P7KA 1YPZA 1H8NA 3UDWC 1OD9A 2ARJQ 1J8KA 3P2TA 4R2GC 4AEHL 4YLQT 2OCFD 2ITDA 4G42A 3KPOB 3LEYH 1HH6B 5C3TA 3UTPE 3H6JA 3H9SA 4J8RA 2HFEB 1U93A 1V3IA 1LL7A 4D1IA 1EXUA 3PQYA 1EEYA 2V38A 4P5MA 1P9MC 4YDLC 3Q6FA 2GJRA 4JZNB 2XTKA 5MERB 4X8JB 1WP6A 1TZGH 3CVIL 4H5SB 1BD2E 5J56B 3SCOA 1EH9A 5AAMA 5I6XB 2OSXA 3H2WA 1QFWI 4KMQA 2IADB 3MNZA 4KH2A 3SDYL 3VJ6A 3O0RH 3MRRB 5IEKB 1UD5A 3IETA 4LCYA 3WUWG 1VEPA 3P4MB 3PWUB 2CIKB 1PKQB 1V7MH 1URLA 1CN4A 3KPLB 4MVBC 3U9PH 4JZOB 3PZNA 1PG7H 2IPTH 5TQ2H 3TCLB 3VSTA 3MLPA 5CJXC 2YIHA 1RHHA 5IMKB 1F58L 3D39A 4NN7C 4NJAL 1WAAF 3A6OA 3BE1H 5CAYB 2Z31D 4TVPH 5GIRB 1LEKA 4RQQB 5IMLA 3MMUA 2OJZH 1OVZA 2FIKA 2EDKA 2R2BA 3S36X 1S7SA 2C1PA 1ACYH 3VI4F 2YKKA 2V2WA 1BLNB 3QG6A 5FO9A 3N9GL 3ELAT 2DWDB 4NO5A 2ARWA 4HAFA 5C0NC 4LXFA 5BWFA 3JTSB 4UILL 3T2NH 1A9BB 3HE7A 2BDNL 4FQ1L 5BZDB 1FAIH 1I7ZA 5F6HI 5GISL 4QRPB 3KXFD 4FQXB 4WRLA 3CSGA 1UKOA 5AYUL 2FJHA 4P59L 4XTRC 2ALWA 1BAFL 1F6FB 3MLUL 4L4VD 1LDPH 2F5AL 3WFCL 4NI3A 2VN7A 4HULB 3AQUA 3PGDA 3LKSB 1E6RA 4LSUH 3HE6A 4G3YH 5CP7B 3FMGL 3S35X 5E4EC 3VG0H 2HG5A 4HPOH 1DFBH 1XH2A 1NSNL 2OZ4L 2J88H 2X8RA 3AY4C 3F5KA 5GNYA 2P5WE 3GB7B 5DD0L 3GMMB 4IUGA 4GUPA 3EOBA 4LCWB 3O2LA 2APTA 1KSRA 1J0IA 2OWCA 1T1XA 4OI9A 3FHQA 3V7AG 2PYFA 3DGCR 5EOCL 2XT1B 1Z3GH 3KDMB 3B4NA 4V28A 3PL6D 4M43H 4TUOB 2XA3A 3EJPA 4L8BB 3VXUB 2QADC 2HJKA 3CDCA 4JZJB 5TQ0L 2FZ3B 4NGHH 5CEXB 5IROA 5LWYL 3ULUH 5D4YA 4X4YA 2ICWJ 4LPCA 1IGFH 2Q86A 5H2BA 4D6FA 4Z2KA 3MRPA 1QRNA 2QEJA 4JPWH 2DKSA 3DRTA 1KYOJ 3LIZH 1U8NA 2VABA 4F9PA 4PV8A 4PMQA 3CZJA 2AVGA 2BNRA 3A4XA 4GI6A 3MLZH 2YUWA 3U7WH 5A8QA 1G7PA 2VERN 1UWSA 2MJWA 5C0FB 1PEWA 3T0EE 2E0PA 2JJSC 3QHFH 3HPJA 5ESQB 1VGKB 3VFWB 4AIEA 4HTYA 5CKAA 4XP5L 1I7UB 4W8AA 3A6BL 2A77H 4AM0A 1VFFA 5IM7A 1ZXQA 1UKTA 2ZCHL 4JAWA 4PJCA 2EIDA 2RFXA 5TF0A 1JHLH 4EJ1C 1JG9A 3CLEH 1HHJA 5INDA 2AK1H 5DD1H 3QNXB 3HG3A 4LNVA 5F7HA 5K9KB 3IDGB 3O6FA 3SBWC 1DBBL 4DN3L 1LL6A 4OZFH 1VGEL 4ALAH 3GXIA 4MNGB 1W32A 1TJGL 2YC1A 3A21A 1CR9H 2DIBA 1Q9LA 1L7IH 3WEOA 3QR3A 2Y7QA 4F58L 2Q8AH 1FORH 3T3ME 3O3EB 4YC2B 4QOKA 1HILA 2AS5M 1FGNL 5DMKA 1FRGH 4KVCL 5D96B 2ADGA 3CUPA 3QEUA 2BSSB 3GFUA 2WHJA 5DRNA 5IK3A 3RAJL 1KENH 5KN5B 3MBED 4KY1H 4PGCB 5FGBA 2UY3A 4DOHB 1MCFA 1RUMH 3IDNB 1QI5A 4QRTB 3CJJA 2FLBT 3GSXA 4DVBA 1IT0A 2DQEL 2Z9TA 3QR2A 4E41A 1GHFL 3NZ8B 3L1OH 3UETA 3RNQA 1I9EA 3CVHB 4POUB 5ILTL 4QY8B 4NRZB 1Y6MR 4CD5A 1ESWA 3PL6C 2DDQH 3G6DL 3RQ3A 2EO1A 5DZOA 4ZO9A 4MDJB 5C70A 1FLRH 1TVBB 2OK0L 4IBLT 5IFAL 1FIEA 3ZLQC 4WU7A 2XN9D 3RY5A 4F7CB 3KLAA 4MJ4A 1DSFL 3ZZ1A 1EIBA 4LAQH 5TDOA 2PNDA 2DYPB 5CJOL 2WKLA 5IVXF 4PGJA 3BN9D 5K9OB 4PJFE 2ZOXA 1NUFA 5EU5A 4GO9A 5DI8B 3IKKA 1C5BL 1ZT4B 3VMPA 32C2A 1G7JB 3ES6A 3OZOA 2XTJB 2HFFB 4BA8A 3D4YA 4GW1A 2F2HA 5AYIA 2XVNA 4QTHB 3QDGE 5FL1A 3RPMA 1WF5A 3PZTA 2DQGL 5HI4C 1T21B 4D6JA 1NCDL 1UADC 2XKUA 4M82A 3H3BC 4PRIB 3OXRB 5EO0B 3V6OC 5F9JB 3C60B 3BD3A 3DLQR 3WNOA 4ZFZA 1BX2A 5FV2A 5F7KC 3MBXH 3NBNA 4W7VA 2BC4B 3WDJA 4MXVE 2BVTA 1KPUB 1NGWB 4P4KA 3UBXB 3NH7H 4AQ1B 5BXSA 4OCXL 1NGZB 5A2AA 3L3JA 5D2NC 1S9XA 4IS6A 3U4BL 1A3LH 1ZA3A 1BSIA 1UZ8B 4HZ6A 1AGDB 3CFKA 2X4QA 4HKBB 5BMFL 4DJMA 4NIKB 4U1NB 4ETYA 2FX7H 3NACL 1T5WA 1K5NA 4NN5B 3V5HA 1ITXA 1DBML 3OJDA 2Z0BA 2E8YA 1K4CA 3OG6B 1UQSA 3MGTB 4JJ5A 1IGYA 5E8PA 5HHVH 4AEFA 1QKZL 3CFCH 4ZG1A 1EGZA 3SCSA 2VYRE 3VIOA 2PI6A 1N0LA 1CICD 3HNSH 3GXFA 3QNYA 3CVHL 3DXAB 1X5FA 5A2LH 1MW0A 2X1XR 4MAUH 3L2LA 1IARB 1I3GH 4BZ1H 1KIQB 2Q87A 5DHXB 1RU9H 2CKBB 3AM8A 2YS4A 3L7EB 2AXHA 2MCPH 3O4OC 3PXJA 4MD4A 5I8OL 4C83A 1NP2A 4HWBH 1MCCA 4D8PB 3SKNA 3BN9C 4BZ2L 4PRAB 3U83A 2ZCLL 4EUPB 3QCTH 3H3PH 2QSTA 3CBWA 5FFLA 1IM9A 2YPKB 3CIQA 4LDOB 3U0WL 1RAMA 4L9LA 1T1YB 1D6EB 1LILA 3OKNB 5EBWB 1BVKB 4XMKH 1JFXA 3GSNA 2V7NB 3O4LE 2HT4D 4JPVL 5F6HJ 4LQFH 4XVTH 1AHWA 3SO5A 2D9CA 3CC5A 4ML4A 1LMKA 1CGUA 2ERJC 4M1DH 2P8MB 3SDXA 4YDIL 5DWUL 3QO1B 4I5BB 3BVVA 1MRFL 4Z7UB 4Z2HA 2JJTA 3AMDA 4WTZG 3VXPA 3NFSL 1HH9B 3DHMA 2YRZA 4G6AD 1JGVH 3UJTH 1XGZA 4AENA 1C8XA 1MWAA 1X5JA 3BT2H 4Z7VB 1IZJA 5GS0L 4H8WL 5HDBF 4NQDA 1WVZA 4NJ9H 5CFHA 4WIQA 3DURB 5DRXA 5E94B 1FA2A 3MGAA 3BJ91 2VDOH 4BQCA 5GGTL 1FNLA 3LAFA 4AD5A 4ODTH 2DQDH 1MSPA 1E4XH 2XWBA 3L3OA 1VSCA 1FH5L 1W9XA 5AG9A 1UB6B 2ZX6A 4FLOA 2F74B 2GUOB 3BH4A 2J74A 3CSYA 2WHKA 5C09E 3MJ9L 4YHKL 5BO1H 1CICC 1IBGH 4CNIB 3WSQL 2RR3A 5I73C 2IQAA 3P0VH 4KROD 4FQQB 3VXRA 3KYMA 4O5LL 5FYKD 1I75A 5GJTH 5HPMB 3HU7A 1S7RA 2XPGA 4H8UA 2XIBA 1YC7A 5FECA 4QCEA 4PMVA 1JGLL 2CKBL 2IGFL 3KL5A 3HNTL 5J1AB 4R0LC 5A8NA 2FATH 1JPSH 4BQ8A 1US2A 4YWGL 4HLZH 5DJ8A 4OKDA 3R4DA 4NO0B 3BKJL 3TT3L 1BM3H 4XP9H 5I66B 12E8L 2HLAA 5DRWB 3O3UN 2R9HC 1ITBB 1LO0L 1HXMB 4I0CC 4LSTL 1OP5K 1K6QH 3PP4H 2AJ3B 2HT4C 1GOMA 1TVPA 4GLRH 1RZ7L 2ZSWB 3QFJE 3ZJ7A 3OB0K 4KRPD 1MHEB 3LQAC 5EBMB 4J2XA 1E6QM 1JIBA 4KVNL 3DVNA 2R56L 3BH9B 4HT1H 5HYJB 1U58A 1C5DA 3WN5A 5EU6B 4RGND 5IB1A 1H8OA 4G6AC 4U1IA 1I1RA 4G6KH 1GC1L 5FKAB 4LL9A 1O0VA 4XMPL 5C6TL 2WKGA 3QOMA 5BRZB 3ARGB 4DUXA 1T0MA 1T89C 1JGIA 4QCIB 1UT9A 3C6LB 1S7UA 1T1ZA 4J28A 3MSPA 3IJYB 2VLRB 3P9MB 5CINL 2CDEA 5AD0B 1QNZH 3ZMRA 1MQRA 3NJ3A 3PTKA 2R1YB 4JN2B 4AZIA 3S4SG 4WCYL 1LD9B 1KG0A 1A1NB 1W72B 3L6FA 5GGUB 3KHOA 3SUUA 2FB4H 3VG9C 5FGSA 1KGUA 5SX4I 2V2TA 4K3JH 4JB9H 2F15A 5ECJE 4HHAA 4Q9QL 1I9JL 1U8IB 5ENWB 3VRJB 3EYPA 4Z2LA 2HJFA 2VLLA 3PHSA 1RZGB 3I6GB 2C3WA 5B39G 3UZEA 1YJDC 5TE4H 4S1SL 4KROC 5TF1L 4X0NA 2A6JB 3IJHA 5A3ID 4M7KL 3KNBA 4AIZB 2D24A 2OLDA 3N85H 4HF5H 1CBVL 3BJLA 4ODXB 1YEIH 3HMXL 4CDGC 2GIYA 3WIHA 4L4TA 1U3YA 4XP6H 1R3LB 2BZDA 4L3CB 1MFAH 5EU3A 5B38B 2HWZH 3V0JA 3MCLL 3D18A 4YHEA 3MODH 1PD6A 2NY7L 4N0FA 1A2YA 2P8PA 4LIQE 3LKQA 3KGRA 1CLOL 2Y07L 2BNQE 4I48B 2MNUA 3N15A 1Q4NX 3BIKA 4WW1B 4JDVA 2AXJA 1OP5H 1BHGA 1J8HE 1UASA 1EBPA 3AB0B 5HDQH 3GSWB 2HT2D 3C2SA 3OAUH 1BECA 4KRPC 4U3XA 5CSBA 4U6VH 5HDOA 1NWUA 4F2MA 2MQ0A 3ESUF 5DMYA 2DSZA 2GJ6A 1XIWA 5GZOD 5D8WA 4WDIA 5KJRH 2APVA 5TDNA 3FB5B 1SBSH 5HY9B 4N8VB 5I17B 4PYSA 2VR4A 4HUXB 4MD0A 3QPQD 2FL5B 1F6AB 4L3EB 3ILPB 2GVYA 3BVNB 3HZKB 4PJ7F 1G9HA 1AO7B 3DIFB 4OIIL 1PEZA 2NLJA 3MLVH 1FNAA 4YXHL 1FZJA 3X3GH 3V0VA 1QSFA 4M48H 3S96B 4XP1H 1XGRA 2E6PA 2H1PH 4HUUB 4ZUWB 3W0WB 2NNAB 3ROOB 4M80A 4OZHF 1EHXA 4PJ5E 2DD8L 4JFTA 1PY4A 1W72L 3QWRA 4YK4B 3WO3B 4CMHC 4WKAA 3MRQB 1MCIA 4HEME 2AAVA 2IAND 2JCCE 5F88A 4ONGH 4BUHA 3PGFH 3DX8B 2JJWA 5DK0A 5BW7C 4XMLH 4E5XB 3AYSA 5C0CE 3W39A 4F37K 3G08B 4KUCD 5FKPB 1B4JH 1R85A 4YR6A 4Z78A 1U8PA 3BRDA 4OZGB 3TO4A 1TQBC 4JREB 3AXXA 5DQ9A 2J8UE 3O0RL 2R1XA 4I77H 3I85A 3FQTA 3K3QA 1BFTA 2BVDA 4PUEA 4HUKB 3A47A 2BY2A 1V7ML 3WY3A 4ONOA 5DSCA 5JIPA 1BFOA 1FNSL 1IMHC 4XNYH 2Z1SA 5TD4A 2J7FA 3MFFA 3GJEA 4FQXD 5ITBL 5IFPA 1CENA 3TWCH 2HT2C 4M7JL 4RZCB 1M05B 5KSVB 2GUYA 1HIMH 3PJSB 4KDVA 4NRYA 2D7PA 4FTVA 4GKNA 1H11A 3WEZA 2NX5A 3QZWA 4G9DA 5GZOC 1OAKL 4Z7QF 5SV3A 3S4SB 4AIUA 5HGBA 3CMOH 2WWCA 4I9WE 3B9VA 3IS0X 2DMCA 3T2NL 3RTQD 1ZTXL 5D2LF 2VC2L 2EIZB 3MOBL 4G8FB 4NC2B 1FAIL 4U5IA 5C07D 4JPIB 4NKOA 5L2KA 1FGVH 5ITFB 1FPTL 3VIMA 1RV6X 2DMBA 3AAZB 3LEVH 5EA0L 5IB3A 3E6FA 3F7VB 2I60H 1IEHA 4LLDA 2O5XH 1AQDA 2O93L 5E6IB 5I6XC 2ZUQB 4IIQB 4Y16A 1XH3B 4OZ4A 3VXUD 1VIWA 1PVHA 3MLSL 3EJYD 5IFHL 1DFBL 3CX2A 1FFOB 3VXMA 2OTPA 4V2BA 1IAIH 3A23A 3C8KA 1H41A 2YBRB 3VH8B 3O2VH 2DQTL 4MGXA 1YECH 5E56A 1U33A 4JL2A 1HN1A 3BP6A 1QPXA 2W9EL 5IGXH 5C0AD 4P2YA 4FZ8H 3S3SA 3B5GA 1RUQH 4PTTA 4ZXBA 3H0TB 4M43L 3V0WH 3WH6A 4J1UB 1SY6A 4JY6A 3RDKA 3RM8A 4GZJA 5J1TC 3ULUL 1BGAA 3BP5A 1CGVA 1IGFL 1GXEA 2X4NA 4PTMA 1R5VA 4JPWL 4U6XB 4W5ZA 1S46A 3F65A 2B0SL 1D3CA 1WDPA 2APWA 2EEXA 3BGFB 2X4PA 4R26H 5GRUL 4U4BA 3EZ8A 3U7WL 5AC4A 3WENA 3NSXA 4D94A 1YEDA 4PRDB 3D3VB 3ARSA 1IILE 4FQXC 2O26U 2J8HA 3QHFL 4ELKB 1X5GA 5ABEA 5JBFA 1DWHM 1MIEL 3ZJ8A 2J7EA 1MIML 2BRRH 2XYCA 5FDWA 4YO0A 4HUWB 2UWEE 4W84A 2EE6A 1MLCA 1NBYB 2A77L 1IAMA 4ZUTA 3MRHA 3RL1B 3VWJA 4UUJA 1R33A 3MLXH 1VJZA 3TEUA 3BUBA 3HG1E 3BKCL 3ZT6A 3PHQB 3F7YA 2CMRH 5LQBH 3BSZH 3L5XL 1S5HB 3UP1A 2Y8VA 3CLEL 2JIXA 1MUJB 4PP2B 4JKLA 5JR1H 3ULSB 5KSUB 2PYED 5H35A 1ODUA 1TQCC 2OLHA 4L8CA 3WQWA 4ACYA 4DKAA 4XZWA 5ALCL 1K85A 2NW0A 4QRRD 3JV4B 3P77A 1CR9L 4MJIA 1AGEA 2X7LA 3B8SA 3UDWA 3QI9B 2AJZB 5BQ7A 2GJJA 1UACH 4UZUA 3EJYC 4JZJC 2DQUH 4AZ6A 3V4UH 4P7OA 1WB0A 2J7CA 1FRGL 3K8LA 1E6JH 1HXJA 1QO3B 2ZOKB 4AZGA 1KLFA 4KY1L 1E6OH 1KJ2H 3RWIA 5BVJB 1P9MA 2CK2A 4G8IB 4NO3A 1UM4L 4PCSA 3RBGA 3LKNB 1MREL 1BVZA 4F15B 1FZOB 5GGSA 1Y7VA 3P4OB 2H26B 2VWEE 4Q97A 4UT6H 1B90A 2UY6A 5AZEL 1RMFL 4IMLA 4XNQA 4P5TD 1PY9A 3HPLB 3OGCA 1X4ZA 1F3JA 5EUKB 1YYLL 4M1CD 3NCYS 5I1AB 1KJMB 1U3JA 3MRJA 2KQMA 1JP5A 2Q3ZA 5D8JL 3SEPA 4PRID 4QHNA 3H42H 1P84J 4BFIB 5F9AC 4TUJA 3TJEH 5HHOE 5DC4B 4M7LT 2NY5C 4K94L 5CJXA 2P47B 5J6HB 1H3PH 2P5EE 4F33B 2AJUL 1M01A 1GOFA 2W9DL 5GS0D 1PG7W 1RJCA 4WJ5A 3CSPA 5ICXB 4EI6B 2VLKA 3UTTA 4ZDHB 1JWUA 1CGTA 1JGEB 5IB2A 4YDKL 1ZT1B 4L8DB 4XPHH 1WAAE 5HPCA 5HHME 5D96C 1CXKA 4ZTOH 5TH2A 4BCEA 3CIVA 2ZZUT 3QDMB 4GKOA 4YFDB 3QEQA 1OAXL 3MBXL 3RUGF 1BQHA 3W5NA 1B0GA 3AHZA 3VI4E 4PTWA 4HFWB 3QXAB 3ARBB 5GSRA 2XQYK 1GIGH 1CI5A 4N0UA 1MXGA 1SJEA 3IS1X 2AKRB 1UCBL 5F3HA 1M7DB 2FYYA 1E6XM 3DXAD 1U8LA 1RVFH 4ELMB 4RMRA 3I6KA 4Q2ZA 4FQHA 3ZYOA 2P24A 5GRJH 4X4XA 1W9PA 4P7RA 2M2DA 5IBTH 3MXWH 3AY4A 3LS4H 5DC9B 4FLSA 3FO9B 1JPFA 4LSRH 5DEZA 2EXWD 3WXWH 4LSSL 4FNTA 1EQCA 1R8LA 2GJXA 5ERWB 1AXIB 2XZCL 4TNWK 1P4BL 3VW3H 5CHNA 4UTBL 1HWWA 3N11A 3S37L 3MV7D 5DA0B 3JTTA 1NQ6A 5T5NG 4GZEA 4UIKL 4GXUN 4K2UH 3TA9A 2XTJC 1E4WH 4MCZA 1GGUA 4BA0A 4MAUL 1JGDB 1I3GL 5ID0A 3UROR 3NZHL 4LLMB 4AMCA 2Y06H 4M1CC 2NW3B 1MJ8L 4N5ED 3PP3K 4Y8AA 1A1OA 2HLFD 3VDHA 4JL1A 4LF3B 4HWBL 1P4LB 4KQ3H 3T77B 3IJSB 4M5ZH 2EEAA 3C60C 3GM8A 3H3PL 1AVAA 5GNXA 3ULVL 3DO3A 1JF1A 3BXNA 2JJSA 1KELH 5GS0C 4UQ2A 5IMOA 1E4KC 4H8WC 1F45A 1NGYB 1JL8A 3UTSB 5I1GL 3FJTA 5KZ6A 4FNRA 1MH5A 4WHTB 5KBNC 2ORBH 2X9XA 3ZTNL 3F5WB 4W81A 5J13B 4Q9BA 1NCWL 4YHZL 1W1VA 4CU8A 1HDMA 4P99A 3WHXB 4NN5C 1JHKH 4N90D 1IEBB 3MRNA 5EC1B 5DS8B 4HMCA 5BCAA 3O8XD 3KXFA 4ORGB 1KLUA 4PB9H 1KT2B 3DX6B 2VB5A 3SBWA 1CU4L 1HYSD 1VHPA 1QLFA 3VXQA 1OGSA 4W8LA 4L4VA 5DT7A 4KHTH 4NJ9L 1OT1A 1CLYL 2D03H 3K8KA 1W9DM 4ZFFA 3C5JA 4NUGL 1UVQB 2A38A 1CD1B 2YRLA 4OT1L 4S2SB 4WFHE 3P9WB 4NSBA 4WEMB 1Q9WA 2EXWC 3N18A 5D7LE 4S1DD 1UM5H 3UYOD 1I85C 2FX9L 5DHVH 1T4KA 1S9WA 2F54E 2HAZA 4HIJA 2IALB 5TDPB 3T4AB 2EDQA 4QGTA 1YY8A 3TIDB 2YA1A 4QNPF 2XHYA 3PL6A 3MV9E 1IGJA 1UWUA 4PV9A 2OSYA 2X4SB 1MAJA 1LK3H 2LTQB 4G7YH 1KB3A 5FYJL 3SQOL 4PBGA 3PP3H 1XGQB 3R06B 2HLFC 1IC5H 1QYGH 3NCEB 6A3HA 2ZUSA 4QEGA 2LABA 5C9JB 3DHJA 1DWGM 4JANB 5F96H 1R5WB 4YIQA 2YD9A 1LP9B 1BM3L 3MYZA 4JQVC 1KB5B 3UG5A 3AS0A 5EU6D 2P7TB 1ODAA 3SUVA 3GJFA 4TUKL 1GC1C 4JJHA 5MHSE 2E40A 2FJGA 4P57B 3VVGA 3B6SA 4LKCB 3ARGD 3PP4L 5IVXE 3RVWD 3DUUA 3OKDA 1P5VA 4JFFE 2VLRD 4F8TA 1JGUL 3VXTA 4X83A 2XZQL 5JHDD 5JIKA 2GY7B 4HT1L 1TE1A 1D5MB 3V6OA 3ME0A 4X6BA 4P2RB 4HPHA 4NBYB 5F70A 3GMPB 1CQYA 1DQJA 4WLCA 2PW2A 1HYSC 3GMLA 1B0RB 3HAEH 3FCTB 4IRSB 4L8SC 3CHFA 2ZXBA 3RO8A 2K3TA 3PDOA 5D2NA 3RGVD 5JW3H 4L4OA 3SE4C 4OGXH 4HIIA 4U31A 1YNKL 3BPCA 5A2BA 4NDMA 1E28A 2SEBB 3W11D 5D72L 1RUPL 3BEWB 1QW8A 3S6TA 4LNRB 1AE6H 4NFCA 4FQCL 5FUOH 5F3BA 5KS9B 2XWJB 4CVXB 1QNQA 1R24B 4PBXA 4PTUB 4E42B 2Q76A 4GAJL 1U8JB 4TVDA 5HSFA 4K23L 4JPKH 3KPNA 3L3DB 5EOQH 2DI8A 1BG9A 3NTCH 1UD4A 5IQ9A 1CDJA 5DUBB 3TO2B 2ADJA 3IF1A 2G8ZA 3N85L 4M5YL 2NTSP 3Q6GH 4G80A 2NW2B 1WBXB 4PLNC 1V7NH 3UR7A 3VRIB 1KYOK 3NDZA 4PG2C 3O3DA 5IB5A 1XV8A 1IQWH 1RUAL 2AK4E 5IJKC 2R0LH 2H6PA 3AXLA 4UU9A 2DT2A 2OX5A 4AD2A 1KB5L 5CSGA 2CITA 1AO7D 5DEFB 3ARGC 2D1ZA 4ORZC 4U6HB 2I27N 4M8UA 6FABH 3WNMA 5EB9A 1QLRA 4OCSH 1A9EA 4MTVA 5FXCH 4UT9H 2XN0A 3T2QA 3O41A 3RRQA 1W2VA 3QJFA 4OFIA 4PUBH 4PJDB 4RAUA 1NLDL 1DL7H 3OKEB 5E1AA 1UJ3C 5C0JA 1INEH 1UZ6F 4KPHL 3L4XA 4KK5C 2V3GA 4LMQE 3DHPA 5E9AA 3OKKA 4PJAA 3DX4A 2EYSA 3T1FA 4YHPB 5I16A 2D31B 4JFQA 2GAZA 5DJZB 3RGVC 2ATPA 3MJ8B 3SCVA 5DLMH 3X3GL 1HSAA 1JCKA 4JM2D 4M6MH 4H25B 2D7TH 2EDOA 4PJ8D 3WLBB 3QQ4A 5ANME 5CBEA 1RJYB 3H55A 3JVGC 1GSMA 1E27A 3GBDA 5I2IA 5HDBE 4NKMA 1MCEA 3EKCA 3KL0A 4NWUH 3ETBF 4EOWH 2YPLE 4YFEA 4NUJA 4LPUA 2ZX7A 4PUDA 4MJ5A 3S97C 2CBIA 3MV11 2J6EA 3BVUA 3RWCB 3AREB 1BD2B 3ZKSD 3INUH 1JV5B 4RRPG 3WNPA 3E3QC 3ZJKA 1WBZB 1EJ6A 3AB0C 3FQRB 1P6FA 4PY7B 1XCXA 4HWZB 4YQXL 1K9DA 2HMID 4FLRA 1GPFA 3QWOB 5B4MD 5FF6B 1OTTD 1UFUA 1FJ1A 4JN1L 1JXKA 4R0LA 1OBAA 3Q1SL 4JHWH 5CWSB 1YQ2A 1PIFA 4IM4A 4NYLA 1RZFH 3WJJC 5HJ3B 5CD3A 3RIAK 5M5DA 1NJ9A 1S7TA 2ZUVA 1UR0A 5DJ2A 5EH1A 4OSUL 1C16B 2DBLL 4X5XA 4V1DD 2GSGB 1N2RB 4EK7A 5IVZA 3ILQD 3THDA 5F7DA 5I1KL 3I02B 1WTGT 2OXGA 1UWEL 4ZPTA 4BSJA 1AI1H 5HVWA 1JYNA 5FUZH 5FB8A 4CD4A 1VACA 4F7PA 3I2CH 3QSKB 3I3EA 4XWGH 4BSVB 3OJMB 1YEKH 3PHOA 1IKNA 2YMXH 5GS1A 1CT8A 5IR1B 5HHNA 2Q8BH 1LEGA 3PIQA 5IHRA 3CLFH 4YK4C 5BXPA 5DDHA 2X4OB 4OKVB 2W9LA 2W0FA 1AD9B 2PWFA 1T3FB 2BERA 1N8ZB 4LK4A 2CHOA 1T89A 3BZEA 1EMTH 4PJXB 5HHQA 1DEEB 4YPGB 4LU5L 3LEVL 1DBKH 1FFQA 3DO7A 2Y8KA 4QHUB 1M6OB 2YR3A 5IVOA 2GJPA 1QI4A 3HCVB 4HH8A 4K3GA 1U2HA 4LSVH 3DTXB 4I4WB 3WHE1 5KAQF 4ZUUB 4JREC 4S1RH 1ZANH 3VE0B 3QA3A 3OSKA 3ARPA 2I26N 2MANA 1V0KA 3FONA 4IOIB 3SCRA 3X11A 5F1SA 1W3KA 3CFJA 2R23A 1X6NA 3F7PC 5E08H 2XIDA 1LWHA 1W91A 5ESVA 4HW6A 4WI3A 2VCBA 3PWJA 1GGCH 3D3VD 3SCNA 3MC0A 1MI5B 2GJZA 4P2QB 4OF0A 1GOOA 4H41A 4W6YB 5CEZH 3CV5A 1A4JB 4RA3A 3WFBH 4H1LB 5I1JH 1CFNA 3STZA 2DJUA 5B4MC 1QBML 1OTTC 3U7VA 4K3DL 7FABH 4M00A 2F8VA 3N1GC 2OTWB 3IDIB 2ZUXA 2J4WL 4ESKA 1KIUA 2V7HA 4NQEB 2MQ3A 2DQJL 3GMNB 4CW1B 3APGA 1VERA 1EA9C 1XF4B 1Q1JH 2A74B 4DKEH 1ITCA 2QPSA 2V5CA 4NBZB 4OB5L 1OGAB 4PJGA 1A6TA 1CE6B 1HSBA 3UTZA 1ZHBB 3RMEA 3ARWA 2ZUQC 3ARFB 3MLXL 3QI9D 4IIQC 4O4YL 4LLAA 2WP3T 4D0DA 5LQBL 1GOHA 2WXDM 1QFPA 2VDQH 4FA8A 1WIUA 1F6LL 3QUYB 1AGCB 1GGBL 2EDBA 2CPCA 5IHUH 1TVNA 4H26A 5C8JB 3AWGA 2XVLA 2BOBA 2QSCH 3EGSA 1N26A 1K3IA 2CBJA 3KPMB 5CMAB 1ZHLB 1MLBB 4NCDA 2XVKA 5FYLL 1HINL 3BP7A 2VX6A 4I13B 1CGWA 4XX6A 4Z2JA 4GKSA 3WBAA 4PJ7E 1IKFH 1H09A 1VBUA 3GMRA 4UNVA 2DWEA 3AUVA 3HG5A 1IAKB 4U1SA 1QFWH 4BSWA 5CZXD 3F5JA 4ODSH 2MWCA 1E6OL 2B39A 3ZE1F 3K1DA 3BIBX 4YXLH 1QSVA 3QUXD 1UYQA 3BGFC 5D7IA 4OZHE 4AH2B 5BW7A 4Z2IA 1B1YA 1E9LA 4K94C 1PYWB 4IPLA 3GSNH 3PNWA 1A7RL 5DQJA 3DETD 2XICA 4N0YH 2EKJA 2OR9L 2FCBA 1IRAY 3JV6A 4K7FA 4NOFA 4XX1G 5JLZA 5EUOA 1UWRA 1NMBH 5DD6B 4OV6F 4LKXA 5HD8D 4BH8A 2TAAA 4P3CH 1RK1B 3TNMB 1Q94A 4BK5A 1UR2A 3PF2A 2R1WB 3O45A 3GMOA 4GBXD 4MA8H 3H9ZA 2FO4B 4PJFB 4RFOH 5LA2A 1NEZB 1FVEA 1QNSA 2XGIA 3QDMD 3RNKA 1F4XH 1XF2B 3WELA 3QRGL 2UZIL 5DURB 1MWAH 3IKCB 5CLTA 2ZCKL 2EYRA 4CUCA 4QHLA 4XCNB 4XZUA 3QDGB 1JNNL 5EOCJ 1ES0B 1CXEA 5AWNH 3KYAA 2DLHA 3QI9C 2KZ1B 1PG7X 5B8CB 4FK9A 2QMKA 3FO1B 4XPHL 2NR6D 3RVTD 1MHHB 4QXWA 2OZ4A 3KPOA 1T80A 3K2UL 1HH6A 3K8MA 4YXKH 4OD3H 4ZTOL 3NGBB 4JDZB 2HFEA 1LJYA 5JBDA 4PJ9B 2A73B 4JG0H 4NQSB 4Z7QE 1WFTA 5ECUA 4MJ6B 3BYYA 5C08E 4WFGE 3RDTB 3BKYL 2B2XH 3JWDC 4JZNA 4XCEB 2WC7A 4MNMA 5MERA 2VX5A 4X8JA 2BHUA 5KVEL 3EDFA 4F15C 4H5SA 3TV8A 5D2LE 3BC9A 2VX7A 1BJ8A 4OGYL 3E8UL 1MJJB 4ZFGH 2IADA 3IJ7A 4MDOA 4HMDA 5GQBA 2UY5A 3MRRA 5IEKA 1CDIA 5IBTL 2O5ZH 5CZXC 2B1HL 4DFIA 4IDLA 2CKRA 5HYSG 1A7NL 3KS0J 4XCCH 3P4MA 3PWUA 2CIKA 1PKQA 3KPLA 1TFVA 5AZ2H 5ISZB 3WQ6A 5TPWL 1HT6A 1ZLUK 4JZOA 3ULVC 3GK8L 43C9B 5DVNA 2GDUA 4KKCD 3MLWL 3TCLA 1ZGLB 5IMKA 4JY5L 3MUGB 5CXPA 3MLYL 4U33A 5E7FA 4FLQA 5T1KB 3B43A 1QPKA 5KSAB 1JPTL 2VDPH 4W4OC 4GMTH 3BAYA 5GIRA 3FNDA 4RQQA 1W3HA 4DWHA 3HN3A 2XM2A 3GHBH 3SE8L 3WQ8A 3MRIB 4I3SH 1BLNA 4Q6YA 5L7XL 2DWDA 1FVCB 3JTSA 3CH1B 1QR4A 4JDTL 4PYGA 1SYVB 4GS7B 4OF8A 4F7EB 1A9BA 4DGYL 5BZDA 3BIAX 1KCSH 1SVZA 3QDJE 3SE9H 4QRPA 4FQXA 3O4LB 1JN6B 3ARBC 3V8OA 1UG9A 4OLVH 2BNUB 3VINA 4JKMA 4ATWA 3LKSA 4J23A 4CU7A 4NQVB 1ODZA 3RVTC 5CP7A 2NR6C 1CTOA 3H9SB 3WUBA 2CR3A 3PQYE 3NCFB 1UD6A 4O2CA 4HZ8A 2HRPH 3GB7A 2YPVH 1F4AA 5C07A 3GMMA 3HB3D 3DUSB 2AJYL 4LCWA 3HAEB 3MNVB 1LE5B 7A3HA 4H8VA 2PR4L 2YXMA 4OD1L 4Q0XL 2VL5B 4RDQG 4BH7B 3KDMA 3BI9X 5HDLA 4HBQA 1R86A 4TUOA 4L8BA 5F9DC 3VXUA 4M8QB 4OI7A 4JZJA 3RKDD 2FZ3A 2GCYB 5CEXA 1NC4B 3WIHH 1NMAL 5T3XH 1DQQB 3G6JF 2VQUA 2OSWA 3MO1A 4FRWA 3AWFA 5C09B 4LSQH 4G8GB 4J7RA 2ESCA 4PMYA 5DFTA 4JFYB 1RZKH 3D5HA 1ZLUH 4KKCC 4J4PD 3RILA 3D25B 5C0FA 1KIPB 1EFQA 1NANI 2CK0L 1IGML 4JO3H 4O51B 3H8NA 3KJ4C 4WW2B 5ESQA 1YZZA 1VGKA 4PMRA 3VFWA 3P9LA 1M7XA 4ONHB 4GRWH 3O6KL 1I7UA 4XPBH 3W38A 3DVGB 3VO0A 1CNVA 4NOBA 3BPLB 5J13C 1DBJL 1OCWH 3S5LG 1FH9A 4EQ2A 3UJIL 4I2XE 2ZX8A 3CUGA 1J87A 3EZJB 3QNXA 4I8DA 3OX8B 4C56D 5K9KA 3IDGA 5CGTA 3L5JA 4H2CA 1ISYA 3QFJB 4MNGA 2XG9A 4L4PA 1UWQA 4OFDA 2VRQA 1KPRB 1LE9B 3BDXA 4EI5B 2AJXH 3O3EA 3HNVH 3V95A 2FJFB 3PN8A 2OJEB 1T2QL 5FHAH 1OIFA 3UJJL 1BQSA 4DGIL 2BSSA 2EH7H 4RCAA 2WWKT 4YNYB 5KN5A 2DJ4A 3TYGH 3OLGA 4GXVL 4PGCA 3VD9A 3HB3C 1NLBL 4FXLA 3IDNA 3CZGA 4QRTA 4WWKB 1Y6KR 5EB8A 3NZ8A 4PJHB 4QYOB 4Q7NA 2DQFB 4Y0GA 3CVHA 1JDCA 3Q5TA 1NBVL 4NRZA 4QY8A 3A22A 1KIRB 4JRXE 5DFVD 5I8EB 4EKJA 1WZ1L 5LXGL 3RUGE 4UTAH 5EFIB 4MDJA 3RKDC 1GGIH 2G5BB 4A4AA 1TVBA 2LTQC 3SDAD 2DH3A 1IM3B 4OFYD 4R4ND 1ZGLM 4ZE4A 1QRNE 5TFSH 4TSBH 2XWTB 4F7CA 3A3HA 3QCVL 2BNRE 3AROA 4JO1L 4OZFG 2DYPA 4PRPD 4R97B 5K9OA 5F7MC 5CP3A 3DWTA 2F19L 4J4PC 3TONA 2WANA 1XGYH 1T7YA 5DI8A 1L7TL 2E7BA 4K9EH 3V6FB 1ZT4A 4NRRA 4R27A 1Q9KA 2XWDA 4QHKI 5GGRY 2HFFA 1CIUA 1QOKA 3X13A 2ICWB 4H88H 4KRUA 4QTHA 4NQTA 3D0VB 3MRGB 3CDFA 4UOZA 3L5IA 4JFHD 1T21A 2WZEA 3LHPH 2EBNA 5I3DA 1MVFA 3U6RB 1QWNA 4PRIA 2Q7YB 2AXFB 2VDRH 3OXRA 5EO0A 2R0LL 5F9JA 3C60A 1NARA 2BNQB 3FRPA 1G9NH 4JQIH 2BC4A 1NC2B 2XZAH 2J78A 1KPUA 1NGWA 3SDCB 2BY1A 4NNXB 4DZBB 3F4VA 3UBXA 1FHGA 1E4KA 5IWLC 1NOWA 3IGAB 1NGZA 1F90L 2N7AA 5CUSL 4KU1A 4FABH 1W9BM 1UZ8A 5GGTA 2OQJB 5BZWB 3TGXA 1CDBA 3AHYA 1AGDA 2F7PA 1ORSB 2I9LB 4HKBA 3BHBB 4PUBL 2I5YL 4U1NA 1OM3H 4PCTA 2AW2A 5GS2D 3UTPD 4KI1A 1INEL 2WPGA 1Z5LA 3WD5H 5T1MB 2WMFA 4NXKA 4LARL 3MGTA 4Y2DD 3D9AL 1B6DA 4R96B 3D4ZA 3MJ9A 3VM7A 4N0CD 5EZLB 3ARED 1BD2D 5EZJB 5DFVC 1B6UA 1JNLH 1N5AA 1UJTA 3DXAA 4R4FL 5DJCB 3KPQB 3FB7A 1SJHB 1GW1A 2Y36L 1SY6H 4PJ5B 1KIQA 1NBZA 4R4NC 4YZFF 3ZL4L 1TZ7A 3HKFA 2CKBA 2ZJSL 4O2EB 3TCXA 4KMTH 3L7EA 3CZNA 3BZDA 4YN5A 4D8PA 4XHJD 5CSZB 5A6JA 4PRAA 1MW1A 3GBEA 4EUPA 1HHHB 2AQ3A 1ACZA 1N6QL 2YPKA 3QPXL 5J6GB 4GPNA 4ZFMA 2FD6L 4NWTH 3MA9H 5A8MA 1T1YA 1D6EA 5IOPB 3OKNA 5EBWA 5FYJU 1UWGL 1BVKA 4K55A 2V7NA 2YKLH 3WY4A 3U48A 2DQCH 2J8UB 1U8QB 4PJEB 4Y5XB 5I76A 5JOEA 2E9WA 2VR5A 4QLKA 4LLYB 4QNPE 1MCSA 1JZ8A 5BV7H 1TETH 4I3GA 2P8MA 3QO1A 4I5BA 2F7QA 4AMKL 4LIQL 4Z7UA 1DQDH 4JQVA 5A8PA 5TJWK 1HH9A 1E0VA 5D9OA 2OTUB 4RIRB 4U49A 3IU4H 3ZKXC 5KW9H 3LEXB 2Z4QB 1JNJA 2EPKX 4P4KB 4Z8FH 3LPFA 5F7NC 4Z7VA 2R4RL 1UG6A 2CRMA 2WUBH 4XP4L 3SPVB 4PFEA 5FUZL 5B21A 2BVYA 2VI0A 5CZVH 3DURA 5E94A 5FUCE 1U95B 4UIMB 4J12A 1GQKA 4AW7A 4NKIL 2Q8BL 3GI8H 1QW9A 1TQSA 4ZPVA 2MPAL 5IV2B 2P5WD 3N0PB 1UB6A 3IFLH 5E8DL 2F74A 3O11B 5E8PB 3CFBB 1CIDA 4Y2DC 5SX4H 2GUOA 3TH3T 4F9LC 4GW5B 1QNOA 4N0CC 3QIWB 1JYXA 1TJHH 4DK3A 4CNIA 1EMTL 5CCKH 3AREC 3SE4A 1F8TH 3ZIZA 4U05A 1UEYA 2JK5B 4FQQA 4LSVL 5FAAA 5HPMA 4NM8H 3A0OA 1OAZH 2NY2D 3HMXA 4GJTB 4S1RL 2YD1A 1I7RB 4TNVF 5J1AA 4XBEH 2RCSL 3SKOB 4XHJC 4AIOA 2VXUL 4B16A 1KC5L 5FHBL 3BOVA 2J7DA 1F4WH 1GCFA 4AZ5A 5I66A 4ZTPH 3WF1A 1SM3L 5DRWA 3T0ED 4HXBL 1HXMA 1QBAA 3K74B 2PTTB 4GRLD 3D51A 2AJ3A 4ODWB 4EBQL 5IJVB 3HMCA 2ZSWA 2UWFA 2A9NH 1BZQK 5EBMA 1MHEA 1OARH 2IQ9H 5JQ6H 2ZKHH 3BH9A 1ISWA 4PG2A 4JHOA 2PWDA 3T09A 5HYJA 4ETQB 5IJKA 1ZEAH 1NFIB 1AJ7L 2XOTA 5EU6A 4HCRL 5CQ1A 1IC7L 3LSOB 4EIZC 3QUYD 1WK0A 4C7GA 1G9EA 5FKAA 1C93A 3WD2A 1OB1B 4N9OB 3MTRA 3ARGA 4DKEL 3T0XA 2PTUA 2ZSVB 3C6LA 4QCIA 4KGLA 4XPTH 2UWEB 2VLRA 3IJYA 2J1KA 2OS7A 3P9MA 1VEMA 5CJQL 3WXVL 5AD0A 4L9DA 3QHOA 1G1CA 1M4KA 2R1YA 1YY9D 4JN2A 3F5LA 1YN6B 2CKSA 5JHDA 4LGXA 3WE6B 2QQLH 1LD9A 4PGBB 1A1NA 1KCLA 1W72A 2G41A 4XNMB 5GGUA 2KZWA 3STLB 1L0XA 5MP6H 1KLGB 3WKNA 5C0RH 1U8IA 5FM4A 5K33A 5ENWA 3VRJA 3RI5K 4HIHB 1RZGA 2YXFA 3I6GA 1BTCA 5CSUA 3HFML 2IQAB 3DNKA 3QXUA 3VXRE 1UZ6E 4UB0H 5LVEA 1B0IA 2I07B 1R5IB 4XC3H 2ZXAA 4KK9D 2J25A 4MQ7B 2A6JA 1HZHH 4PMNA 4AIZA 4M6NH 2NY2C 1KFWA 4JFZL 3VD7A 2OR8A 4ODXA 3CUHA 4QHKJ 1NQBA 2AEPH 4YH6A 1QFWL 2YEZB 3EO9H 1R3LA 4L3CA 5B38A 4S3JA 4P8VA 3FB8B 2LFGA 4RAVB 2HLAB 1F11B 4Y4FB 4R4BB 1D5XB 4Q9CA 1ZAGA 3GJFK 3T0EC 3PWVB 4I48A 5HGGS 5I71C 5L88L 4ZOEA 1WICA 4GRLC 4OM0L 4WW1A 2FNBA 5DURD 4JQXC 1CFQB 4WTXA 1KTDB 1NOUA 5JW4N 2EXYC 4GINA 3GSWA 3SGEI 3R1GH 4QP0A 3H9HB 3QDGD 2C7UB 3ZO0A 3LS5L 4WI6A 4AT6A 1YEHL 1VPOH 4KJPD 3DV6B 3ARFC 2EADA 2CIPA 4AY0A 3OG4B 4P7LA 4PS4H 4QO1A 4LRNL 3IDUA 3FB5A 4O2FA 3WJJA 5HHOB 5HY9A 3NFNB 4N8VA 5I17A 4UOW0 4HUXA 5JXAH 2FL5A 1F6AA 2F58H 3QUYC 3ILPA 1F4XL 4L3EA 4O58H 3BVNA 4Y5YB 5CG0A 3K80A 3HZKA 5DJXB 4DQOH 4PJ9D 1AO7A 1J5OH 4IDJL 5SWSE 3GBNH 3DIFA 1LG2A 3RDTD 1RULH 1YEGH 2YUXA 3AVEA 3O6MH 2ILLA 3WBDA 1FL3B 3BO8B 5E1HB 1MEXH 4KTEL 2J43A 3S96A 4QTIL 1V3HA 2BVEA 4HUUA 4ZUWA 3W0WA 2NNAA 3ROOA 1WO2A 2NY6B 3LPGA 3UTQB 3ARZA 4YXKL 3MRQA 1BQUA 3HLAB 1UM6H 1QFWM 2FEEI 3DECA 4NHUB 4C59B 2DL2A 3DX8A 1V3MA 4D72A 4XAWL 4E5XA 1V0MA 1LTXA 4KK9C 5KG9B 3G08A 5FKPA 1FSKC 2AGJH 1AQKL 4OZGA 5ACLA 1E4LA 5T1KD 3S88H 4L4TE 4GQ9L 5KSAD 2QHAA 4FFVC 3VGBA 1C12B 1IL1B 2VAJA 1A5FL 4G9FE 2M1KA 4PJGF 3F58L 1II4E 4EKXA 5AZ2L 3C5ZB 5HYIA 3CSBA 1CK0L 3GJFH 3WL9B 5J9PB 3C9NB 1BFNA 4F7MB 5E4IA 2RJMA 3B9DA 3QBTB 3V0FA 1E72M 1CFBA 3ALWA 1CD8A 5IW1B 3O4LD 5IESH 4RZCA 1KQYA 5EIIB 1M05A 3HI6H 5KSVA 2XSAA 3PJSA 1HWGB 4LYPA 1VDGA 2KDGA 3BWAB 4KJPC 4M24A 4Y1AE 2XFFA 5F7EH 5B8CC 3S4SA 2D0GA 3VTRA 1AGBB 2HJLB 4YGVB 5E70A 1KXHA 1UA6H 1GZQB 3NGBC 3MRMB 1G9ML 2YD7A 2EIZA 4G8FA 4PJ9C 2DTML 1ZE3C 4AG4H 4YHNB 4JPIA 3FQNB 1NFKA 4FNLL 3RDTC 3VI3F 5ITFA 4NT6B 4XI5C 5DD5H 3CZEA 1H0DB 3AAZA 4BJLA 3F7VA 1QSFE 4NO2B 3BCDA 3VDCA 4BM7A 2D73A 2LV4A 2AQ1A 2VKWA 5JIHA 5E6IA 1I8LC 3D2UB 4IIQA 1NCAH 2AEQH 3G9VA 1XH3A 5EZIL 1CGSL 1MCDA 1UYWH 2ESVE 4FMFA 2B1AH 3MU7A 5DUPH 2IPUK 1FFOA 4AEIH 4LVNB 3C2AH 3BAXA 2HRPL 2YBRA 4WUKH 3VH8A 2ED9A 5F72S 2VLJB 5JO5B 5C09D 1E71M 3A67H 2MTPA 1OINA 1V8HA 1BQLH 3GXNA 1LVEA 3ZTJH 4OZIB 5FCUH 4GKZB 2G3IA 3WDPP 1MHPH 1MRCL 2WMIB 3WSUA 3W9DB 3H0TA 3TIEB 3U0TB 4AL8L 3OKMB 4J1UA 5KSAC 3UCRA 3AOFA 1TQVA 2O9OA 5T3XL 4HQQL 2ZE0A 4U1LB 3VNYA 2NT1A 4M4RA 5IB4B 3V4VL 1HKMA 4CJ1A 4U6XA 4OOZA 4M62L 3CFEB 1IEAB 1XYZA 3STBA 3MACL 1CDYA 3RX5A 4DVRL 4BK4A 1E1FA 4GS7C 2XG4A 3C09B 3OAZK 1G84A 3GJEB 2G60H 4PRDA 4M6OH 3D3VA 2BSED 3OV6A 4HJJH 2A0LD 2HKFH 3ZE1E 4ELKA 1NP0A 3P30L 3VMNA 3S8WA 3QFJD 5MEPB 4N9GB 4NRYB 4HUWA 3WFDH 1F5WA 3MV8B 1NBYA 3RL1A 2QQKL 1XH1A 2E27L 3FN0L 4WY7H 3LPPA 3G6AB 1IVLA 3KPSE 5BVPL 3PHQA 2X10A 2R0ZH 1S5HA 1S7QB 2DAVA 4LHJB 3BAWA 3GXDA 2Q7NA 1AKJB 1MUJA 2LU4A 4W87A 4PP2A 1CL7I 4X5WB 2JALA 3ULSA 5KSUA 4WWKD 5A2CA 3G6LA 2W38A 3W81A 4BF7A 5GGQH 4OLXH 1FE8H 1YQVH 4JFFB 1E0WA 2VXTH 3JV4A 4U1HB 1AQDB 4X9BA 3F7QA 4HS8H 1IQDB 1WZLA 3QI9A 2AJZA 5DYOB 2AXGB 3B2UD 3VXME 4WFEE 2VITB 1DP0A 5D7KE 3IRPX 4PRHE 3TBSB 4X7CC 1L0YA 1S7WB 3RWFB 4RGOL 1XCWA 2WV3A 1DCLA 3LMYA 2EH7L 4D6IA 2VE6B 1YEFH 1QO3A 4ZS7H 2ZOKA 5CPTA 1HEZB 1J1PH 2X4TB 5L2JB 5BVJA 2J6EH 4G8IA 1JWSB 2J73A 3VRLF 1NDGB 4WI4A 3LKNA 1ZLVK 2OMNA 3NMEA 2WHMA 1FZOA 3SOBH 4FQIL 3EAKA 1WT5A 1NCTA 1GAFL 2VO5A 2WK2A 3P4OA 4QLRA 2FWOB 4IM8A 4HIXH 5C0BE 1CXFA 5D9PA 3HPLA 3CZLA 2GI7A 1XF3B 3BPLC 4HWBA 5I1AA 1ZB5A 4UFJA 5FCZA 2WCSA 1J0HA 3IXAB 4BFIA 2O9RA 1L9MA 2UZXB 3OAZH 2BNQD 5HDRA 1KR0A 4M9PA 4ZS6C 1NC2D 1KN2H 5J6HA 2A0LC 1OAUH 1J8HD 3B3IA 3VFGH 4F33A 3NIFF 3SDCD 3GIZL 4PY8J 4ZUTB 5HGHB 5ICXA 3VWJB 4EI6A 4W4OA 3LQAH 3W37A 3U7YH 4ZDHA 4EI5C 2VDKH 2VDNL 1JGEA 4D9LH 2FSEB 5IMMB 2FGLA 1ZT1A 2AK4B 4QLJA 3W29A 1B3ZA 2X44D 1TMQA 4HH9B 5KSBB 3QDMA 2UYLB 1KGCE 3R8QA 4XGZB 3EJQA 5D70L 4NZTH 3CH8A 4WWKC 2NY3B 4GO6B 4G7VH 4HFWA 3QXAA 1LK2A 3ARBA 5AEAA 4YHYB 1DQMH 3VFUB 2D4DA 1GH7A 2WZPD 1JF6A 1WNOA 5ALBL 2W1NA 2AKRA 2G3MA 1M7DA 3T0VA 1UR9A 2IAMD 3B2UC 4ELMA 3RU8L 1HHGB 4ODHH 4B50A 1OM3L 4ZOCA 4PJ5D 4NCC1 3U79A 4YUEH 4BQ5A 1J1XH 3P11L 3RWIB 1E0OB 1HKJA 1JFHA 3FO9A 4X6DF 3FT3B 2VR9A 4MB4A 5ERWA 5MI0B 4UOJA 2QQQA 4R97C 2IG2L 5D71H 4UV7L 4AD1A 5E99L 1ZLVH 1DN2A 3GH4A 1D6VH 5C0CD 1YJDH 5IHSA 2AABL 3P0YH 3CPLB 5FGCB 5FYKH 2YN3A 1FP5A 4JVPA 5DJAB 3KLSA 1S9VB 1EX0A 1KCVH 1JGDA 4LLMA 5EU7E 1A02N 1NGQH 5BJTB 2CPUA 2NW3A 4JR9H 2ADFL 2GQHA 4LF3A 1P4LA 3T77A 3IJSA 4H8HA 3DHUA 1PIGA 4NM4H 1OSZB 1ZKAA 5T1DH 5E2TH 3LXBA 2WWDA 5A2FA 2RAMA 1Z0MA 3VXSB 5DXWA 3G6JE 3ARDD 1EEZB 3MOQA 1GOIA 4H0IA 3SDCC 1EJOH 1NGYA 3UTTE 2YKLL 3UTSA 4HX1B 2GW5A 3U7AA 4AEHH 1QR1B 4WHTA 3UG4A 3F5WA 2XSBA 2HISA 4I9WD 3QEQE 1V6WA 1SBBA 3WHXA 1LLOA 3CO4A 3TFKD 1IEBA 5EC1A 4IJ3B 1JYWA 5DS8A 3SCMB 1EBAA 2X41A 4N0UE 4ORGA 4X7SL 1KT2A 3DX6A 4K8RD 3K81A 3RIFK 3WDRA 3WMCA 3WN6A 4NRXB 2A3CA 5D7SL 1A0QL 2XIIA 2DSUA 1YUHB 2YD4A 3WS3B 1KJ3H 2IAMC 5CZVL 3X12B 3SDYH 2CDGB 1UVQA 4KI5F 1CD1A 4XXDB 4X4ME 4S2SA 4MPKA 2NTFB 4HWUA 5EO1A 1QACA 1F4YL 3J8F7 1BJ1J 3CZSA 4D6HA 1UQYA 2WMKA 1BZ9B 2PTVA 5TE7L 5C6PB 2CR6A 3VFVB 1PZ5B 2WNWA 4IOSD 3LH2L 3U0PB 1F58H 2IALA 5TDPA 4NJAH 3T4AA 5DFAA 3GBML 5GHWL 1GUVA 1F8TL 2HRLA 3TIDA 2X9WA 2A83B 2DM7A 2X4SA 3VU2A 1D5IL 5AAWA 4Y5XC 3R06A 1XGQA 5I1EL 3LY6A 1FC1A 2XQYG 4XBEL 5C9JA 3EYUL 4UILH 4JANA 1R5WA 1RUKL 2BDNH 1LP9A 1F4WL 4FQ1H 2DLEA 3CXHK 4P9HL 4XVUD 4JFEE 5GISH 1KB5A 4JKWA 3UYRL 4J4PA 1JYVA 2P7TA 3BXNB 3OB8A 4P57A 4P59H 4LLWB 3HA0A 3PWNB 1BAFH 4LKCA 1NCBL 2E8ZA 2Z31B 3MLUH 1CYGA 2F5AH 3WFCH 2FEDD 3JSSA 3VA2C 2EDRA 5DHYB 2J5LC 2J47A 1TNNA 3FMGH 1ZV5A 1PBGA 1K8IB 3HG1D 1H3WM 1NSNH 3ET9F 3TLRA 4M8VA 1R47A 1INQB 1D5MA 2XKSA 3TFKC 5DD0H 3RWHB 3ZE2F 4P2RA 3GMPA 1RFDL 1RSFA 4RMVA 1V3LA 1WC7B 3QIWC 4XPFL 1B0RA 1M04A 3FCTA 3J7HA 4IRSA 3KPPB 5EOCH 5IWLA 3SQBA 4XVJL 2C4FU 4UZGA 5TQ0H 5GGSY 2VZTA 2W5FA 2SEBA 5LWYH 2BRQA 3BEWA 4JFXB 1T2JA 3WD1A 3SY0B 3KPRE 1BPVA 4LNRA 3SKMB 4A2MA 2VZVA 5KS9A 4ENED 1KTLB 2XWJA 1YMME 4CVXA 1R24A 4U6YB 4LFHG 4PTUA 4E42A 1U8JA 4Y4FD 1IZKA 3L3DA 3MYJB 1QBBA 4X6CB 4PJ7B 5CD5D 4Z0XB 2OYMA 3OQ3B 4XP5H 4Y5VB 3GIVB 5DUBA 3TO2A 3NSNA 3I9GL 3LVEA 3A6BH 1R3HB 4EIGB 2ZX9A 4WI8A 3VIFA 2KPNA 4DKFL 2NW2A 1WBXA 2ZCHH 3VRIA 1I1CA 3EO9L 4WHCA 1ZVSB 1LEIB 3K4DA 3SGJC 2R69H 3OGOE 5JPNB 5CLWA 4WK9A 4XVUC 4OZHB 4YZFE 5HHOD 5LA0A 4M02A 1DBBH 1VGEH 2P5ED 5DEFA 1TJGH 3W6LA 3QAZB 2FEDC 4U6HA 4FFZL 5A2IH 1NGXB 3OR6B 3S2CA 4Q6IC 3R1GL 4E2OA 1MWOA 3IVKB 2APBA 1FGNH 2W0KA 5GSVB 4KVCH 2EDJA 4U1GB 4PJDA 4ZEPA 5HHMD 2WBWB 3VIPA 5JZ7D 3RAJH 3OKEA 3KG5A 2NY6D 3O81A 5FV1L 5IT2L 1W0WB 4IRJB 4RNRB 2BV9A 5FA3B 2X70B 3RJDA 4YHPA 2D31A 3LQZB 5ILTH 5DJZA 4D6DA 1Z9MA 1WAWA 2HVMA 3G6DH 3MJ8A 3UEQA 4AZ8A 3WLBA 4H25A 1X5AA 5J8OA 4M7LH 1T7XA 2E3ZA 1C1EL 2Y5TA 2OK0H 5IFAH 1RJYA 3EYOB 1I4FB 3LMJL 2YK1L 5EORL 5L9DL 3MBEB 4L3AA 1AQMA 3JXAA 4TX8A 2XZZA 1A7QH 4ENEC 5CJOH 3CZFB 1UXWB 1QA9B 1A8JH 2VDML 4F9LA 5C08B 5BRPA 4FMVA 3OG2A 4OLEA 4Y4FC 5I30H 2KBGA 3RWCA 3AREA 1BQCA 1BD2A 3RX8A 5FK9B 5D2LB 5CD5C 1JV5A 1XEDA 1ADQL 4E4PA 1WBZA 4JFVA 2IC2A 3CK0L 3FQRA 3VGGA 4BKLB 4PY7A 2XN9B 1GORA 4HWZA 4F3FB 3EO1B 5A3HA 1MJUL 2DQGH 4OCMC 3O4OB 4GZIA 4HC1L 3QWOA 1NCDH 1RIVL 2I9TB 4NFDA 5FF6A 1KTCA 3ZJ6A 2HH0L 2HTLC 5CWSA 2XJ7A 1NFDB 4AMXA 2ED7A 2GTZB 2E6JA 5HJ3A 3BDYL 1G9MC 4AY1A 4Y5YC 2NY5H 3QIBD 2V6HA 4MQSB 2AJSL 3U82B 1C16A 3DBXB 2GSGA 1N2RA 4OCXH 2X5PA 5M94B 4CAGA 3KYKH 2C9AA 3U4BH 3I02A 4P2OD 4PJIF 1MAMH 2X0YA 1FNGB 2LU3A 4HU8A 5BMFH 3F6IA 4BSVA 2EO9A 2JB5L 3D2UD 3NACH 5JZ7C 2NY6C 3D69B 5IR1A 1DBMH 4DW2L 2CD0A 1WDQA 1UA6L 2YL8A 2X4OA 2UY4A 4OKVA 3OPZL 1QKZH 2EYSB 1VADB 3HUJB 1T3FA 4RX4D 1N8ZA 4AG4L 2IUZA 3BPNC 2VAAB 4FS0A 3VXNB 4PJXA 1KACB 1DEEA 4YPGA 4RFNB 4QHUA 1M6OA 4X99B 5E8EB 4L5FL 3RHWF 3HCVA 3DTXA 4KMLB 2V9TA 1VCAA 5IFTA 4I4WA 5GGVH 4ZUUA 4GXPA 4WFHD 4ZFOB 2XNAA 3K4AA 4ZSOE 3WKML 3VE0A 7CGTA 3C2AL 1KN4L 4BZ2H 1JD9A 5D7LD 4WUKL 1SYSB 4ZNCD 1OSPL 2BFVL 1CICB 4IOIA 5CP3H 3U0WH 3C5ZC 2F54D 5DJ6B 4MZ2A 1ZLSL 1XR8B 1CDGA 2CERA 1MHPL 2HFGH 3MV9D 4JPVH 1MI5A 4P2QA 1CD9B 1A4JA 3BD5A 1G0XA 3SKJH 4H1LA 4NRSA 1C08B 4JRYE 3S5ZA 2GT9A 1VFAB 1WGOA 2ZWZA 4B41A 4YHGA 3GTNA 4YDIH 2OTWA 1TENA 3IDIA 1X5YA 1MRFH 3K0WA 4E0RB 3AZTA 1S8DA 5CD3B 3NFSH 1J1OL 2E9JA 1HOCB 2X40A 3GMNA 4CW1A 5MHSD 4X5XB 4JFSA 5A6MA 1XF4A 4YHOL 5I0ZA 5IHZB 5LGJB 5F1KC 3FY1A 5GS0H 2A74A 5KANG 4H8WH 4LLQB 4JQXA 4HJJL 1NUGA 4X7TB 1OGAA 5FIEA 4Y4KD 3SHSA 4JFFD 2WUCL 5E8NB 1V02E 3AU1B 5GGTH 5ABFB 1CE6A 1ZHBA 1DBAL 1KCUL 3NA4A 4RMQA 4PPTA 5DT1L 3ARFA 1FH5H 4I2XB 2R0ZL 1ZS8B 5I23A 4FG6D 4LVNC 4N1HB 3OR7B 3L3IB 2CUHA 3TC9A 3QUYA 1AGCA 2HN7B 3H53A 3U7BA 4D0CB 4BQ2A 3MJ9H 4YHKH 1CQKA 1G94A 2WBJD 5C8JA 3ULUF 1HXYB 4LCIH 4J3WA 1FV1B 3C8HA 4UDUB 1JPST 3KPMA 1GOGA 1RJZB 5CMAA 1ZHLA 1MLBA 2YD6A 3BCFA 3S3JA 2ZUUA 2MHAB 4O5LH 2XXCB