3W81A

Human alpha-l-iduronidase
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
616
structure length
616
Chain Sequence
b'EAPHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-iduronidase
molecule tags Hydrolase
source organism Homo sapiens
publication title Human alpha-L-iduronidase uses its own N-glycan as a substrate-binding and catalytic module
pubmed doi rcsb
total genus 196
structure length 616
sequence length 616
chains with identical sequence B
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w81A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 3w81A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3w81A02
3LPWA 4NDMB 3JWOH 2LV4A 1ZVHA 2NW3A 5DT7A 1BZ7A 3MV11 5ETUA 3NSXA 2NXYB 4CCEA 5DZLA 4QRPA 2NZIA 3OKNB 3QDJE 1GZPB 1JGVH 4PJBB 3S37H 5EZOL 3UG5A 2GTWB 5DS8B 3M1BB 1EDGA 3FQTA 2QMKA 5JA8B 3DHUA 2WMKA 4A6YH 3TEUA 3DX6A 4F7MB 1TA3B 1NOUA 3N1PC 1H9VA 4UDUB 5DJCA 3PTMA 2R2BA 4EDXB 3DV6B 4FQLH 2DI9A 5IUSA 2MKWA 5CLTA 3KDMA 3TVMB 2NT0A 5C0AE 4OKDA 5DJZA 5DFVD 2YEZB 3OSKA 4CDHA 2LVEA 3GSVA 4JFFD 5C71A 4JFWA 5JIWA 5DRXB 5I2IA 2AI0H 1E6ZA 4HA3A 5JBFA 2IFFH 3BEWA 5JW4R 2R29H 2E9MA 4N90E 4G80B 1HSBB 4Z2JA 1DQLH 4IMLA 3IFLH 3BEVA 4LQFH 4MXVF 3B5HA 3MRNA 1OTSD 3NCEB 4KMTL 3BP6A 2UY7A 4BQ8A 2F8XC 5C0FB 2C8NA 3LS4H 4OCWH 4JO1L 3RGHA 5FAAA 2JIXA 1JD9A 5DK0B 3VJ6A 4XBPB 1TVHA 1D5BA 2J7LA 2B31A 1ZBVA 4P2OD 2G2RA 4O58L 1H2JA 4RISL 3VXRE 2CK2A 3AOFA 1OGTA 5CILL 3BKCH 3BC9A 1MJUH 3S88H 5C0IB 2VRKA 2BOBA 2GJXB 3ARTA 2EDNA 5GGQL 3GM8A 4R90H 4YBLB 3E8UH 5DK2B 3WJJA 5C0DB 1Q94A 1U8IA 5FOBB 3N17A 4HXAH 4X7TA 1EX0A 4K71C 2R0KL 3MRHA 5F3BB 3O2LA 1SJVA 3DBXA 4XMPH 1I3RA 3S37L 3ALGA 4WIQA 5IW1A 3OKOB 4QCIB 3WJLC 4NUGH 4U1HA 3W0KA 4YX2H 5C0EB 5I8CB 1M01A 1QSFD 3S7GA 4U1GB 5F88A 4HMCA 3ROLB 1WLHA 4G7YL 1BQLL 1A6TA 1OAZH 2PTUA 4NKIL 5DO2C 1XT5A 1J8HE 8A3HA 2X9YA 4UTBL 4PJDE 2QEJA 1JRHI 2VDKH 3KPRA 5DJ6B 2B2XL 4YBQD 3RILA 4PGCA 4JM2B 1EXPA 2DD8L 2DDQH 4BFEA 1S78C 5ECUA 4N0FA 2L7JA 2R2EB 1BG4A 3D3VE 1NGPL 1NJ9B 1DBKH 4X0KA 3GZAA 3AFLA 3VIJA 4H88L 4HG4J 4E5XB 3APGA 2A3CA 2UY5A 2KL6A 1HNGA 1HEZB 1XMWA 4IHOB 4L8CB 1WPCA 4O9HL 2JJTA 4JDTL 3MR9A 3QG6B 3F62A 2VLRD 1KXHA 1Q1JH 5F3HA 3MRLB 4B0MM 1NGXB 1IM3B 1YN6A 3BUTA 1BREA 5JLZB 4KKLC 2G5BA 1ISYA 2VDMH 1YY8A 2HKFL 1CTNA 3EKCA 3OKMA 1MRFL 1HJXA 5DUPL 4IRSB 3ULUD 1CDJA 4OGXH 3X12A 2RFXA 4G8EA 5D7LD 3IJ7A 2D0FA 3NCCB 1C91A 2WZIA 3RZCC 4DKFL 4P8WA 3ZTJG 4QOKA 4X8XA 1AKJA 4L4JA 2AJXH 2A3BA 1HJUA 3EO1B 4LASL 5DMYA 4RDQF 5AYBA 4P23B 1IC5L 3SE4A 2IPUG 5A2FA 4X4XB 4EOWL 5LYRA 4L29A 5FIEA 3WL0A 1U8OB 2M2DA 4HKBA 3W9DA 5L88H 5DO8A 5HHVH 4ZOCA 1H3WM 2VRAA 2E4TA 4JFPB 3CDGB 1WIOA 4I8DA 2EYSA 1WT5C 1N4XH 3QUMA 4LKCA 4MQXC 2XWEA 5I6XC 4FQHB 3T0ED 2ED9A 2HLAA 1SVCP 2ZSWB 5B3JE 1P2CB 2A6KA 2DBJA 3LKNA 4D6IA 1IKNA 4N0UB 4N0CD 3V8OA 1RIUH 1NBVL 4K3DH 4KDTA 3KS0J 3FQXA 4V1DB 2Z8SA 4GFTB 5ERWB 2XHYA 3FCTB 4ZYKA 3HUJB 1D5ZB 4Y16A 2PXYA 3WO3B 1OSPL 1OSEA 3H0TA 3CFDA 3JZ7A 1RJYB 4XI5C 1J1OL 5C0BE 4M1RA 4K7PL 2X1WL 3QNYB 3CZJA 1Q6DA 4P2RD 3PGCA 3SY0A 2AOSA 3QDGA 3QDMA 3TJEH 3QRGL 3LOWA 3F12B 4U6HA 4WI5A 4LLQA 4N8CL 4U1HB 1ISVA 1DE4A 1N82A 1DL7H 4LNRB 2KQNA 1DBBH 2X4SA 4L4TD 1G6VK 1NAKL 4XWGH 3MLVL 2J77A 4S2SB 3U46A 4M82A 3QO0B 1MIML 1QLEL 4XMLL 3GSNA 3CZFA 4X6BA 3WN5B 5L2KB 4HMDA 4Z76B 1ZS8B 3L95B 2Y23A 3IXTA 1GVIA 2VITB 3NH7L 4OV5A 2JEQA 4TVPD 3BXNB 5JDJA 2JELH 2APWA 3GKZA 3UTSB 3KHOA 4ZFOA 1HE7A 2NY0B 2OTPA 2IPTH 3EMCA 5AYUL 1QBBA 2P43B 4OZGA 2FH8A 1MY7A 3G6JF 5IR1A 5ESQA 1I9IH 2XJ7A 3IFNH 4TSCL 4ZUVB 1FHLA 4D0DB 1V5JA 5IHRA 3FO9A 1CZ8H 2AJVL 5ACZA 4J3UA 5ISZA 2VKWA 3GBDA 3QR3A 4L4TE 3MLWL 3VRJA 3J8F7 4D71A 4HH8A 5C9JB 1U8QA 2YL6A 1NCBH 3CPLB 4MDJA 3D2UD 3WBDA 2DIAA 5HGAB 4XHJD 3CSYA 1GOWA 2XFFA 1DJSA 3O3UN 3G5XB 1MQKL 4RFNB 3X3FL 4D2NA 2OCFD 3G6JA 3AMLA 4JANA 1V7NH 2Y8VA 3OZOA 4GS7B 4Z7WA 1ZGLB 2QSVA 4HLZH 5CKAA 2ZUUA 5I17A 1TR1A 4PCTA 5IT2L 3VWJC 5HHMD 4ATDA 4QCFA 1YN7B 4NNYA 1OTTD 1JVKA 2MKLC 3PQYE 2DYPB 3VI3E 1IEBA 3TPUA 1CD9B 5CD5C 2HLFC 5CJQL 3J7HA 1H15A 2H41A 5CJXC 3MBED 2VABB 5DD6A 1CD1B 2Z31D 1KFAL 1DHKA 3EOBB 4GI9A 1H5BA 2V3GA 2OSLB 3BOVA 3FL7A 1ZAGA 3V4UH 1OAQL 4PREB 5FL1A 1ZJBA 2WCSA 4NN6B 3U7BA 4HK0B 1FFNA 5J3HD 2J75A 4RE2A 4LLDA 1JI1A 4X80L 1U58B 3LKSA 3O4OB 3K2UL 2DQUH 3JWNC 3ZKQD 4NBXB 3VGBA 4PGBB 4FF5A 1MUJB 3SUTA 1AHWA 3GMQA 3CX2A 2Y2WA 1WTLA 4W81A 4CMMA 4KU1A 2F8VA 3KPSD 2D22A 5D1XC 1V3IA 4OLYL 3HNSL 4IRJA 1M6OB 2IALA 2E9BA 1QLRB 5T33H 4LLQB 1CGSH 4L4PA 3DX6B 4F7MA 3MA9H 3BD3A 3QGVA 4MDPA 3GI9L 3HZKA 5LXGL 2B1AL 5HHOD 1MWOA 1EO8L 4L5FH 1QRND 4HZ7A 2OM5A 2BDNH 3MCLH 3ES6A 1XH3B 3V79C 3VX0A 3OGVA 4P3CH 4XVTH 1J88A 2X9XA 4KRMB 2I25N 4WUKH 3UPRA 2BVDA 4AZIA 4DVBA 3NSNA 2VDOH 1SJXA 1OSPH 2NX5A 1GGCH 2CHNA 4MNMA 5IHSA 5FUCC 4WFED 2XTJE 2X4TB 1EGJA 4HXBL 3GSUB 4LPCA 1VFAB 1VFBB 4RWHA 2HT4C 3WBAA 1XGZA 5IB4A 3D3AA 1LL6A 1ZK9A 2VN4A 1PZ5B 2DLHA 2E9WA 4X6DF 5T5NF 3WNNA 2AJYH 1T1XA 2Z92B 2NYYC 3WKZA 4U3XA 4NSKB 4UTAL 1OP3H 2ZG1A 3TNNA 1TVNA 1NCCL 3C9NA 1DFBH 5D6DA 3T0XA 2G2RB 2JIEA 1TQCB 4RAUB 5F1IA 3GXDA 3AIQA 1UXSB 5A8QA 1UB5A 3D5OF 3WEOA 3KYOA 5HD8C 3OLEA 2RGMA 2E3ZA 1JNLH 2WZHA 5ESVB 1FVCA 5E9DE 2GYSA 1REIA 1YPZB 2JIXD 2V5YA 1BFSA 1T1YA 3NYDA 1OAUL 4WRLA 2N7BA 4U1SB 4IUGA 1WP6A 3K46A 1KPVB 3H42L 5ICZA 4P3CL 4A2LA 4PGJA 4H88H 3BZ4A 1P7HL 3WQ5A 1ACZA 5ICXB 2VR9A 5BJTB 3O8XD 3VD7A 3S2CA 3SJVA 3MQIA 4GKSB 1PKQB 1UA3A 4TOQA 3CFEA 2VL5A 3PHQB 1NGQH 4QTHB 1IGJA 3MA9L 1SY6A 3EUUA 3QDME 2Z35B 2V5SA 4ZSOE 3PHOB 4Z95H 1DEEA 2ARJB 4HGKC 4RGNC 4YHIB 2D9CA 3HUJF 4OKVB 2OP4H 1HHGB 1ODAA 1T3FA 5C0BB 1H8OA 2WBJA 4LLMB 5DMGC 4JG0L 2MCG1 3EAKA 4QEGA 1DQML 1DWAM 1LQSR 1O6IA 3OB0K 4PREA 5DA4A 3CZKA 1OPGH 4JKKA 1NCWL 1UEMA 2I5YH 5K9JL 3CX5K 3DI2B 1K4DB 1U58A 1I7ZB 2VDQL 4NWTL 4JG1L 4Y8AA 2Y6SC 4NO0A 5TQ0H 1PEZA 5KJRL 2XPGA 3VD5A 4HCRL 3AMGA 3WIFB 1XF2B 3SDCD 4PRWA 3DURA 5HHOE 3LN9A 4QXTA 3MRJA 2YIHA 4F15B 5HYJD 1BWWA 5DVLA 1V3MA 2BNRB 4UB0H 3PP4H 5HJ3B 3WSQH 2BC4B 4UDTB 4WJ5A 4MB1A 1KWKA 4MAYA 4UOZA 5TPWH 1RZFL 3ARGA 5BRPA 3HTLX 1S7SB 4V28A 5CWSA 1R0AH 1NLBL 3WH6A 1CF8H 2ENSA 3BIKA 3PQYA 5DRWB 5EPMA 4G5ZH 5GGTH 4LQFL 3V4PH 3QNXA 2BRRH 3RAJL 3BKJH 3X17A 2IH3A 1BOYA 1INQA 4I3RL 1HK6A 1EEQA 4W4OA 2H32B 1MEXH 1X5AA 4NT6A 4PJ5B 3TC9A 3QJHA 5ALBH 2BSSB 3RWCB 4BSVB 5BW7C 1N0XH 4JAWA 5A3IC 1EHAA 5IMMA 5TDPA 2PO6B 4UT6H 3WF2A 1MFEH 1N7ML 1HI6B 1NAMH 4QRTA 3JTTB 5DMIL 1Z9SA 4X99B 4X6CA 3VXSE 1JWUA 4YHYB 4H25A 3FFDB 4TUJA 4NQCA 4OBSA 3RCNA 2NZ9C 1Y0LB 1P5VA 1JTPA 3ARBA 1JD7A 4ZYKB 4PPTA 5HHME 1NC2B 1JPSL 5TQ0L 5KJRH 4L3EB 3BRFA 4JFXB 1H3TA 1H11A 1AHWC 1DUZB 1YYLH 1GCFA 1XYZA 4PS4L 2V7NB 2W60A 3CVIL 2BSTA 1FL6A 5GS0L 5GRWA 1FNGB 3QSKB 4C4KO 4HKXA 3SDDD 1HQ4A 2JTDA 1V05A 3QA3B 4OCSH 3ZKXC 1XIWB 3KPRD 4OD1H 4JPIA 5EA0L 3VFRB 4CD7A 1V7NL 2W0FB 5CBAA 1TG7A 3WEMA 2EBNA 1RULH 1G9NC 3MODL 2YWZA 2F74B 2COQA 1E43A 5I15H 4OKVA 1QLFA 4N5ED 4KZEH 1FCCA 3TZVC 3ZMRA 1TNMA 3NACL 3QIUD 2WC3A 1MAJA 1RJLA 3B9DA 2VDLL 1ADQH 2WVSA 1C93A 1IAIL 4U6VL 1OB1A 3MRMA 4LRNH 3QHFH 3RJQB 1FNSL 5IB1B 4ZE5A 3IDMA 1Q6EA 2XN9B 5DA0B 1FP8A 3OAYH 3DUHA 1T0MB 4Z8FL 2EDHA 4UZSA 3KJ4B 1H3GA 3NCYP 4WUUB 1FORH 3BAEL 2EECA 4M3JA 4XRCA 1DLHB 5I8OL 1FVEA 4PBVC 2HFFB 3MA7A 2XOTA 1FG2B 1EFXD 1VENA 1ZHLB 5ID0A 4XP1H 4Y4KA 3OF6A 1FV1A 4PJXE 3S98A 5D6CB 1EDQA 4P5TC 1A6VL 3P9MA 3Q5OA 3SQOL 5C8JB 2ICWJ 4PUDA 3OLGA 1FZOB 3V5KB 5D93C 1GRWA 5E6ZA 5ENWA 2PR4H 1ESWA 1HINH 3GRWA 1SY6H 4XNUH 4HC1A 1EOKA 2R8SL 3SUUA 4MCYB 4Y5YC 5EA0H 5FYKU 3E6HA 4OIAA 4YAQA 4PSPA 4S1DD 1GC1C 1HOCA 1U2HA 4XP9L 2IQ9L 5AD0A 2NY2C 3THMH 5LGKA 5C08D 3L3IB 2ZXQA 2Y24A 4M8UA 5JNYA 5F8RC 4OIIH 3L5JA 3MLSH 1OM3H 1I7TA 3TYGL 2ADGA 3LH2L 4XNQA 1NWSA 4HGWA 3FFDA 2X1IA 1B0GB 4WHYG 5ABFA 4ODUB 5C0IA 1G6RB 3VXOA 3S35X 1J9CT 4LARL 4L3EA 3H9SE 5AY7A 2GJ6D 4PGBA 3SDAA 4EZMA 2YKKA 4ACPA 3RWFA 1WF5A 1LLOA 5A6LA 1PKOA 3FTGA 4MZ3A 3MLVH 4ZXBA 3ULUE 5GGUB 4FOMA 1E28B 3JUYA 4S0SD 1TVPA 4PGZA 2WWKT 1K4CA 2ZCLH 1V0MA 3HC3H 1PSKH 4PUEA 4QFUA 1N64H 3D3VD 4BZ2L 3CHEA 5DJYB 4YQXL 3NIFF 2JCCA 2VLRE 3BMVA 3QUYB 4K9EH 5BXRA 4LVNB 4PY7A 3WMSA 1KJMA 1XH3A 5DJ6A 2GT9B 3EFFB 2BSRA 2VLME 3LRSA 5F1OB 5MP6H 2FECI 2FJHB 1CICB 1HYRC 2WLYA 2Z91A 2VX6A 2JJTC 2RGSA 4U1LB 1UADC 4DWSC 1N26A 1LE5B 3GMMA 1RK0B 4YE4L 1BF2A 4XVUD 1VESA 1TFHA 7A3HA 1HXMA 4WTXA 4YO0B 5I1AB 2E6PA 2FGWL 1UWXK 1QFOA 1NCAL 1MQPA 2CDFA 5KG9B 2J3SA 4WFHD 2JE8A 4CD8A 1LO5A 4P2YA 3CZ8A 3W6LA 3E3QC 1JJUA 3WEZA 4ENED 4NNXB 3REVB 2DH3A 4D8PB 5EC2A 3TO4C 3WE6A 1ODZA 4Y19E 3VIHA 1N5AA 4MNGE 5SWZD 3C5SA 1RZKC 2EIBA 3FONB 3IDGA 1S9VB 3ARDB 1UVQB 4XTRC 3PE9A 2ZX9A 4EUPH 5GS1B 4EK7A 5EU6D 4U6XB 2ZXDA 3QEUA 1SVZA 3T0VA 1EMTH 35C8L 4RE4A 2J7FA 3VM7A 1GL4B 5FYKE 3EJYD 4TRPH 1B4RA 3WH9A 2PETA 1W2PA 4X6FB 2CJUH 4YFDB 5FB8B 2DQDL 3OKEA 3ECBA 3PZUA 2NY3C 4ZXBC 4M1CC 3TA3A 2VZUA 4IRZL 2NR6C 2JB5H 3SIMA 4Z7NF 4H04A 3ZT5A 1YMHB 1RSFA 3T0WA 5GGQH 3VFNA 5CBEA 4B9YA 1CVRA 4AEEA 1KJVB 1RD6A 3V6FB 5ADOL 2B0SH 4XPFL 1ZB5A 4OF5A 4B3KA 4WUUD 3HB3D 2M8XA 3SPVB 3I6GB 3KXFE 3QCTL 1P1ZA 2XZCL 4G9FD 1WBYB 4C83B 2Y25A 4G6ML 5DR5L 2EDDA 5FKPA 2EYTA 3OXRB 5EUOB 1H8NA 4KQ4H 3NCJL 4AG4L 1TUXA 3MJ6A 4BSJA 3R1GH 5ERWA 3CU7A 4PJ5E 1WCGA 3QQ4A 1EAJA 5I79A 1KC5L 4WO4D 4Y1AD 2XPKA 1LEKB 4R5EA 3GNPA 3L4UA 4MDIA 8FABA 3WIFA 4WGWB 1U3HC 4LYQA 4J2XA 3WDJA 1TPXC 2FD6L 1DN2A 5TF1L 2X70A 4DTGH 4TTGA 2CBUA 4EIZC 4QXGL 2GDUA 1OLZA 3IETB 3QDGB 3KPQB 5IHLB 3CFIC 3CFBB 4NZRH 3IU3A 4HXBH 2YZ1A 4PJEA 4UDTA 2X4SB 5K9OB 2VLKA 5DJCB 5IB2B 5KTEL 5DDHA 4WHDA 4XCCH 5HGDB 4ZAKC 4AZ5A 2WINB 4H5SA 3JUZA 2J6EL 4DN3H 4KHTH 1RUKL 3WBEA 4J8RB 2R0LL 4PB9H 3QUZA 1FL3B 1UZ4A 1CFQB 1QSEA 2N1KA 2A3AA 3DX8B 2IH1A 4G8FB 1SEQL 4OLVH 1IM9A 3BN3B 5GZNC 4YUEL 1I7UA 3HMXA 4PJ5A 5ESQB 2PTTA 4Y5VB 2VQ1B 4ZPVA 2LVCA 5HPMA 1J1XH 4E41D 1NAML 3VG0L 5IVZA 1CR9H 5HDBF 5FYJE 4XVJL 3RQ3A 4PV8B 3GYCA 5C0RH 1NLDH 3SGEH 4R4FH 4D8PA 4B7LA 5DJXB 4PTTA 1KJ2B 1IAMA 2FBOJ 5FO9A 1MW3A 1LL4A 5EU5B 2D3VA 2CLVA 4WLCA 1UM6H 1DCLA 4XPAH 1A2YB 3MV8A 4M7LH 1OLLA 4JHAL 2Q86A 1MHCA 5CSGA 2H8PA 3GIVB 4ZAKB 1AD0B 4HUUB 1M04A 3PL6D 1JZ4A 2JJWA 3JVGC 2C4XA 1N2RA 2WXDM 3MRHB 5ISZD 3WHE1 2O92A 1K8IA 3FO0L 4Y4FA 4LCWD 1KB9K 2BVUA 4PP1C 4G8IB 4YHPA 2D24A 4TUFA 4OCXL 3BUYB 1KLUB 4Y2DB 1SJEA 3PJSA 4WCYL 2PXYD 1YQVL 5BW7A 5KVFH 1YMHA 2VXTH 3O3DA 3HNSH 1L0PA 2AJSH 3FFCD 3UAJD 4XPAL 5MEND 4M6AA 5DMGD 4EKXA 5EOTA 2IANE 4UTFA 3KJ6L 1U93B 4JPKH 1BYDA 3T0DA 3QCVH 5F7HA 1MRCL 4JZNB 4XPGH 3F7VB 4JQVA 5C0ND 5DTFB 3LPFA 3RDTD 1NC4A 4GO6B 4PLKD 2C3WA 2VDNH 3LEVH 1F58L 2WUBL 5DT5A 3ZR5A 3MLXL 1INEL 5JHDE 3EYFB 2D03H 3L3GA 3PZ9A 5EFDA 1DQDH 5BRZA 2NY2D 4ERSH 3DYPA 1DP0A 4M1DL 1AP2A 3LQZB 3MGOA 3L1OL 2AV1B 1NKRA 4N5EC 4E0RA 2OL3L 4HFWA 2DQIH 5DD5L 1S7VB 1XCTB 2KDGA 4S1DC 4NZUL 1BD2E 1C5CH 3WIHL 1S7WB 4HV8A 4OCXH 2V3EA 3SURA 3H2WA 3RY5A 3U9PH 5ID0B 1E4KA 5I8KH 1CLYL 2OR9H 4Z9KB 4YNYB 1O7AA 2F8OA 4QXUL 2NY6C 1RUQH 1X1NA 4ZMAT 3UC0L 1KN2H 1SY6L 4C7GA 1XR9A 1P7KB 3NN8A 4K3EH 4BFBD 1R5IB 3SCQA 1NBYA 2D03L 3GI8L 4OGYH 5KANG 4UZGA 1A6TB 3MZTA 3C87A 4U1KA 5CLWA 2E6QA 5M03A 4JHZA 2CITA 1CTOA 4CVXA 3VDAA 3LN4B 4BFGA 1NMCB 1JV5A 1B30A 3CC5B 3S6CA 1CGWA 2IH1B 4G8FA 3SO5A 4K07A 1AO7E 1KJ2H 5KSAB 5L9DL 1JF6A 1U8KA 3TN0B 1QKZL 4MHHI 1NCBL 3MSGA 2AXFB 5BQ7B 4FFVD 4U3HA 1EA9C 1J0KA 2RQ8A 1B9ZA 2VTFA 1T1XB 1J8KA 2UYLA 2P7TA 1V6WA 4L8DA 3WDQA 1YEGH 2HTLD 2Y72A 3HRZA 1J0HA 4MSWA 1K3IA 2NNAA 4TVPL 5JHLH 2ZOLB 2PW1A 5C9KA 5A2AA 2P45B 4MA8L 2RCSL 3GZKA 1UB5B 3HS0A 4R7NB 3F5WA 1XGRA 1DBML 5GGSA 3RTQB 5KSBB 1D6VH 3L3JA 4JO2H 1MPAH 2XYCA 1Z2KA 4Y2DD 3V95A 5A6JA 4QP0A 4NRYB 4DUWA 4J6RH 2EIZA 4XCYB 4P59L 4BQBA 2MSPA 4BUGA 2YSSB 3GUTB 4RMSA 3NAAH 2FSEA 3VD9A 4P4KD 1YY8B 1FLRL 2EH7L 2YRLA 2WQRA 4JFVA 3ARVA 2AJZA 3HMWH 2VKXA 1IARB 1MXGA 4NHUA 3FOMA 7FABL 2W66A 3ARPA 2EDYA 4FXLA 1DDHB 4YFLI 1ZMYA 5CG0A 1E4JA 3OLDA 4G9DA 5DQ9B 3NJ3A 4UU9A 2EE2A 5JTWA 1B88A 3ME0A 5LGJB 1N6VA 2WNGA 3GIZL 5CJXA 4C7FA 5C09E 3GSNB 3WN5A 1XAUA 2HMID 1JFXA 3M46A 3OJ2C 2CCRA 1SMDA 1UYWL 5KSBF 2NY5H 1VGKB 1CFBA 4CKQA 3EO0B 3NAAL 4PG2A 4WW2F 2VXUH 5F72S 3K2UH 4ZUWA 1S9KC 1CFTB 4PUBH 3P0YL 4Q58C 3NA4A 2BJMH 3GMMB 2MPAL 3KPSA 4KMLB 1E1EA 5L9DH 4MD0B 4OZGB 3O9WB 3EIFA 3MTRA 2ED7A 3MNWA 4PJ9D 4RDQG 1F4HA 1DEDA 5EUKA 3O2DL 4KJWC 3N1MC 2VIRB 3QQ9D 1A7PH 1M05B 3FCTA 1UR9A 3TLRA 3LIZH 3AAZB 1WWAX 5LXGH 3FN0H 3OL2A 4NC0B 4GRLC 3IJYA 3U2SB 1G7PB 2JK5B 2NY7H 3IDGB 3CK0L 1NGYA 3E1F1 4AIOA 2DMBA 2DYPD 4EN3A 2QPSA 2BVPA 1O0VA 4N8VA 3MRQA 1OAKL 1HCFX 1NEUA 4AZCA 1BIIB 5DRWA 1BQHB 1NBYB 3GBMH 3VWKC 4AEHH 4P57B 1N3NA 2VRJA 2GHWB 3AREC 3HZMA 1W9PA 4PTWA 4X6FA 5FB8A 3KL5A 3T3MF 4GKOA 1MWAH 3HE6C 3QDGE 1RQ5A 3WQ8A 4KKCC 3BHBA 3VRIB 4F37K 1JV5B 1V8HA 5FYLE 3VIGA 3O45A 2FJFA 2VDML 1VJSA 1UKSA 1GGIH 3ZR6A 3B9KA 1A3HA 4F7PA 2BERA 5C08E 1EEUA 3OX8A 2BS9A 1CGUA 4ZO7A 1FHDA 1MELA 5IK3A 3RWGB 3VE0B 4PRHE 5LGHH 5D7SL 4TUOB 2EDJA 4R26H 2A9MH 3C5ZA 1YECH 1FO0L 5GS2D 1B0RB 4ZODA 2J4GA 4UINL 1R3HA 3NIGE 1RU9L 1A1NB 3F7PC 1RZKL 3P73B 2EDQA 3T1FB 1C08B 3ZYIA 1CDCA 1BBJB 3NH7H 3CUPB 2OLDA 4PJIE 1DBJL 3CFKA 5BV7C 5T3XD 2FEDD 4ZFOL 3CZEA 4PJ8C 1KB5L 5CPSA 5DYOB 1RIVL 4WU5A 1AJ7H 4BZ1H 3WS6C 3DWTA 5EZIL 1UH3A 1PBYA 5DQ9A 4FMFA 5IB2A 5KZ6A 5DJ0A 2VE6A 2YPLE 1TZ7A 2NY0C 3X13B 4KHTL 4XPTH 1T0PB 4N8VG 1N5YH 3U36A 5BROA 1KBGH 1S9WB 5JR1H 4EI6A 2XM1A 3CFJA 1R3KA 4DVRL 5ACMA 1T1ZA 1ULVA 2GJ6B 1MCWM 3OJMB 5GNZA 5CS7A 3OAYK 4W85A 5AZEL 2AS5M 5FYLL 1LILA 2EXWC 3LB6D 4NC1C 4OZ4A 5FDYA 4H20L 4NQDB 3QFJA 1RIVH 4JDVB 3GMLA 2CEQA 4LOUC 1QP1A 2ZG2A 1AXSB 2A83B 4ODHH 4U3AA 4ODSL 2D23A 4LKXA 5GRVL 3ZDYF 3CVHA 3TYFA 3TBSB 1EBPA 2R1XA 4WCYH 3SDCA 4UAOB 2NY6B 3JWDC 4OI8A 4HZLA 4JFEE 3WD4A 4QXWA 2NXZC 5IMLB 1ZVSB 1IC7H 4UIKH 4M61B 4X5WA 2JKXA 4XBGA 5GGRY 1YEIL 2C7UA 1KTKE 4HPHA 3ARGC 4H1LH 4TNVF 4ORZC 1MFVA 1M7IA 3MV8B 3IU4L 2WUCL 4G9FB 5DHYB 2HG5B 3QP3A 4LASH 3CDFA 1CL7I 1XGYH 3WJLA 2IAND 3ULUH 1GHFH 4MB3A 4F9PC 3MLZL 3ZKMD 3AHXA 3GMRB 3RUGF 1AC6A 3IRPX 4X80H 1G0DA 1KLGA 1HVXA 3LDBB 4LLVB 3E6HB 3QHZH 3QXVA 1ZWIA 3HI5L 4GKZB 4HUKB 2HRPL 3QUYC 4PJCB 15C8L 1JAEA 1FDLL 4K7FB 3G5ZB 4GRMA 3SJVD 3CH1A 1CU4L 5AD0B 3VXRB 2EEAA 3NCMA 1FL5A 4OQTA 4CAGA 1T04B 2G75A 4G6AD 2VAAB 3H9HB 5CHNB 3F4VA 2O5ZH 2Y7QA 3A6CL 1KLFA 4CNIA 4OGZA 5DGRA 2HT3C 4ZNEA 1B0RA 2EEBA 3V52L 3RUGA 2BNQA 1G6RA 4MA3A 8CGTA 3NTCH 2W4XA 4L4OA 2UY3A 3PL6B 3JVGA 4KUCD 3O3BA 3UTTE 1D9KD 3H3KA 2XVLA 1ZHNA 1A6VH 1U2YA 3VGGA 3BZDA 2AQ3A 4I3GA 3C2AH 1OF2B 1T1YB 1H8SA 4QF1B 2APTA 5AG9A 4OCNC 3S3PA 3OG6B 4JO4H 3MV9E 1MJJB 2DDXA 2OWCA 4KROD 1OTTC 4P5MA 3T8XB 4KKLD 43C9A 3AJ7A 1CD0A 4WFFE 1TVDA 1JZ5A 3QO1B 5JOFA 5EFFA 4XMLH 2R15A 5IV2B 4Z7UE 3EYUL 4LU5H 2EH8L 2W92A 4JDTH 4LSUL 1F4AA 1R5IA 2GT9A 4OBRA 4UILH 5FYKH 4KTEL 3LSOB 3QNXB 4KKAC 1QW8A 2X4NB 3IT8D 1FNSH 32C2B 4CN4A 3BEWB 4CVXB 3NVQA 1ZT7B 4DJMA 1KV3A 4YHIA 1NC2D 3MROA 1WJ3A 1S8DB 3FRPA 1W32A 4TQEL 1G1CA 1OGAA 3C60A 4YDIL 3BD5A 3OZPA 4NOBA 2ZUQB 1B2YA 3STLA 5CIPA 4KFZC 1KGCD 1NKOA 2EH7H 1FC1A 1FLRH 4FG6C 4YXHL 1KJ3H 1D5MA 3QFDA 3W11D 3MLWH 1K4DA 4FQ1L 1VGEL 4F57H 5JO5A 4NDMA 2PW2B 3OAUH 3VDCA 1A3LH 2A6JB 3QT2A 1E6PA 4GRLA 2DKMA 4JFZH 5JW4M 2XPGB 5GGSB 4ODTH 3RTQA 1LG1A 3BSZL 2XY1A 1IT9H 4Q2ZA 1LDPL 3B3IB 1EAPA 5F9JB 4NYLA 1QI0A 4H8WC 3MNZB 2H6PA 3BWAB 3EMQA 1P4IH 5DRZA 2W63A 1GOQA 3SOBL 5BVJB 4JFFB 4I1NB 4W8BA 1AQMA 1EFQA 1TTGA 2O26U 3O6FB 1MHHB 2BX5A 2P5WD 3E3QE 4RX4A 5T1DL 3TT3L 1E40A 3UZVB 3WELA 3PF2A 1TNNA 4QYOA 3KGRA 1AMYA 1NOWA 5E7BA 1HXYA 4PLOB 4JDZB 3FY1A 4GW1A 3MOAL 1E0WA 3ZJKA 1HIML 3HPLA 4W70A 1KTRL 3V8CA 2YZ8A 3B2VL 4UQ3B 3L1OH 2IH3B 4ONGH 4JO1H 3LKQA 5B8CC 2ESVE 2QHAA 3RZCB 4PGCB 2V2WA 2LTQC 1IKNC 3RL2B 1WBYA 2WUBH 2CSPA 4DCQB 2DLFL 4JPWL 1CLXA 4PRPB 3W27A 3BSGA 5I8KL 3FB6B 2VUOA 1RJCA 1A02N 4F8QA 4OFYD 5SWSD 1MCEA 3PV6B 3VFOA 3GRWH 4XBPA 4Y16C 3CVHH 5EO0B 2X89D 5ITBL 5A95A 5ICYA 2VVNA 5ELIA 4Y5YB 3MKKA 3PL6A 2Q3ZA 3V4VH 5KVEL 3RGVA 5F1SA 1JWUB 3OHXA 5E8PA 3BIAX 2OK0H 1PLGL 1VIWA 3VINA 3G6AB 4QHMA 4X7CC 5EZLB 4BYHA 4JFDA 3L3DA 3L4YA 3C60D 4J3TA 3DRTB 5CP3A 2YD7A 5CEYA 1NC2A 5DJ2A 1C12A 5KN5A 2CO6B 5DF0A 3DVNA 1BFTA 4G7YH 3QFJD 3T8XA 1DBAH 1G9MH 3PZVA 4DN4L 4EN3B 2ZCKL 4XNXL 1MAML 3U82B 1OGBA 2KQMA 4P2OB 1UWUA 3MJGX 4WTZG 1OARH 3KLAA 3SCMB 4QOKB 2F54B 2RIKA 2VWEE 5F9AC 1N59B 4NQXA 5EBLB 1D9KC 1HJSA 1FYTB 2E9LA 3EHBD 3X3GH 4ACZB 5D2LF 1BBDH 5J1TC 4M7KH 1ZKAA 3F58H 3DMMD 4HWUA 4UQ9A 2VNCA 4J4PC 3CNKA 2BY2A 5HPMB 3MUY1 1FJ1B 4G6JL 2DAVA 2DDQL 1WCBA 3S36L 1Z3GL 2Y5EA 5E6IA 1FIEA 3CGTA 4FLQA 3CVIH 4PJEF 2H2PD 4IOFC 5EBMB 3RWIA 1UCBL 4YEEA 5EC1A 1AGBA 1MHPH 4WU7B 2DLFH 4JPWH 2OZ4H 1YUHA 3IDMB 2XN9A 3W26A 1S7QA 1JNLL 4LFHD 4QRUB 2R0WL 1WBZA 3PIQA 1FH7A 2W62A 4LOUD 5HDRA 2VXQL 1HWHB 4G6KH 5D2LB 2EXWD 2XWJA 3LB6C 4HUWB 1RZ8A 1ZHLA 3V5HA 4MA1B 2BNUB 4Y4KB 1FGNL 5I1CH 3L9RA 5C09B 5IJKC 3AIUA 2NLJA 3P3YA 1RVFL 4MPKA 2NX5E 5IFJA 3DUSB 4R9HA 2R39A 3GHEH 5D8JL 3WSUA 5DWUL 4QHLA 3BUYA 2PI6A 2KKQA 4JHBA 5F9DC 2NY5L 2XZZA 2QQLH 1PEWA 3U7AA 3X13A 4X6DB 3IJHA 4HKBB 4L1HA 1QHOA 4Y5XB 3I75B 1ACYL 1S5IH 3AY4C 2AW2A 3VG0H 3GNRA 3MV7A 4XV0A 2K7QA 5KTEH 3WKMH 1A4KA 3R06A 3BZFA 1TPXB 4F9LA 4FA8A 4KXZH 2X4OB 1VEMA 1HJVA 1CENA 3QFJB 1NC4B 5ABEA 2YOCA 4GKLA 4YO0A 1K8DB 3PP4L 4WGVB 4APQD 4PRAB 3DUUA 4OZFB 4UI2A 5ICYB 4D0DA 3RX8A 1JGLL 1GUVA 3O3EB 4YUEH 2CK0H 2GK2A 2HH0L 3I02B 4GAYA 1BWMA 3FJTA 4HHAA 4G5ZL 4W6XB 3KLHC 1S7VA 1XCTA 3PWJB 4F15C 4MJID 4DN3L 4N68A 3ZTNL 3ZTJH 1GGIL 4XWOD 1VPOL 5EULV 5I66B 1HHJA 1JYWA 2Z1KA 4DOHB 3O3AA 2XM2A 2CKBH 5D1XB 4WK9A 1QOKA 3PTQA 5GS1A 2R4RL 5I73B 4NN5C 2O9TA 1MWAL 4Z7UB 3SUWA 3KLAB 2BFVH 4U2YA 4WO4A 1SEBA 4R6UA 3L3OB 3WENA 5SV3A 4ZS6C 5F9OL 4K68A 2UUDK 3ILQC 4D9LL 4TULL 2UWEA 2V5TA 1BQCA 2CO7B 3QZWG 4HOZA 3N15A 3FMGL 2DKUA 4X6BB 4N1CA 4URTB 2ZUYA 4HIHB 1QI3A 2XGBA 2HN7A 2OX5A 5IQ9B 2HP4A 4NCC1 4UBDD 2FO4A 1QYGL 2ZXAA 1CL7L 1U8NA 1CN4A 1OHQA 1IVLA 1X7QA 2PYFB 1KJVA 2WBJC 4JFUA 2P5WB 3V5DB 1WCBB 3TT1H 1YEDA 1KCKA 2VDRL 1KIQB 1GQJA 1JNNH 3NIFE 1TJGH 4UIMA 1QSVA 1DQDL 1XF3B 1YUHB 1WEJL 3QXTA 4H26A 1BOGB 4HUMB 1ORQB 1WAAE 2VDPH 4PJHE 1OM3L 4IM8A 3LD8C 3BW9B 4LCUA 2NXYD 5DD5H 4JY5H 4HAGA 2DIBA 4OIBA 1ZBKA 4NN5B 1UACL 1T5WA 1YMMB 1C7SA 4APQC 4Z6AT 2HFGH 3VIPA 2CIIB 3GB7B 4WEBL 3OWEA 4LHUD 4LVEA 4UNVA 4POYA 4XXCA 1QD0A 1AHWB 2XWJB 4HUWA 2OR9L 2HWZL 3O6FC 3IVKA 4HPGA 3SKNB 3CU1A 1EHLH 3KJ4C 5FHAH 5I1GH 1MI5E 4PTMA 4YK4B 4JFOA 1UC6A 3AS1A 3DUSA 3AHZA 4XP6H 4JAMA 4WW2A 4FRWA 3U83A 5CZVL 3HC3L 1WWWX 3QQNA 5D7JB 2K9UA 5D96C 4PEEA 1DWIM 4RGOH 5IV2A 1IJ9A 2PO6D 1VERA 4K2UL 4YR6B 1BGAA 3KS0H 3Q5TA 1G94A 1TIUA 4M8VA 1CG9B 2H3NB 5EZJB 4E42A 1W8OA 4U7MA 4BA8A 3QQ9C 1KCVL 2V7HB 1PYWB 4J8RA 4ZS7H 2DQHH 2WMPA 3ULSB 4HJ0C 4RMWA 5BZDB 1YDPA 4HZAA 4PJ9C 5A16A 4URIA 1PSKL 3O9WA 2AEPL 5I16A 2E7BA 2OSLA 5IFPA 1P4IL 2FDBP 4Z7OF 1J7VR 3WLBB 4LDOB 2DEPA 3IGAA 1TZIA 3OAZK 1BAFH 4K3HA 3NZHH 5AYQA 4KDVA 4I0CC 1I8MB 1EO8H 4PTTB 1DL7L 1P53A 5FGCE 3B8YA 4Q2ZB 1F4YH 1LEGA 2DI7A 3T77B 5EIIB 2VLLA 4P5KA 1IMHC 4CMMB 1T21B 5D9SA 4LSRL 2AP2A 4EVNB 5CD3A 1MWAA 4Q9RL 5CUSH 3ETBF 4Z7UA 3U4AA 3T0BA 4OFVA 3C09B 4OUUA 4ZFFA 5B39B 3SCPA 4U1MA 2QSCL 5KVDH 5IQ7H 1AQKL 2GK0B 3W9EA 4XAKE 1YEKH 1IGYB 2K7PA 2YXFA 2DQHL 3S6TA 5I18L 3IFPB 2J8UB 3ABZA 4MB5A 5I19L 4ORGB 5IBTL 2FH6A 4U4BA 4IOSD 4PJFE 2JB5L 1I8KA 3D9AL 5EZOH 3MRFA 1TQBB 4K2UH 5A2CA 1DWJM 1RU9H 5DD0H 4EUPG 2PWEA 3F5KA 1FL3A 4Y4FC 4GXUM 4KAQH 4M1GH 4PG9A 4PJ8B 1UWEH 5TE7H 5JXED 1XF3A 2OYMA 1GOMA 5KS9F 1F90L 3AGVA 4F9LC 3ECQA 5DT1H 3C5ZB 5FHBH 4KRTA 5MENB 2ZSVB 1MAKA 3EDDA 5BS0D 3D87B 1Z6JT 5LCVH 2V9QA 4MWFB 3L7FB 1Z3GH 2LQRA 1TE1A 3WHE0 1WAAA 4EOWH 3NCFB 5I0ZA 4QRRD 5DK3A 1NP2A 1CGTA 4JG0H 1VBUA 2X7LB 2IANA 1YEHL 3CFKB 3MBEB 1S7TA 1IC4H 1B3YA 1QFWI 1CD8A 4Q6IC 4HPYH 2K1MA 3FQTB 3MOBH 3BLPX 2CYGA 1DANU 4P4KA 4KWUA 2BOCB 5CSYA 1FZKB 4MQ7A 1WDQA 4QRSB 4KTEH 3FN0L 3EO9H 2Y07L 4FQXD 4ONFL 4PRBB 1U42A 5IBLD 2WANA 1FZJB 1Q0YL 1X3DA 2A74A 4GKSA 3RL1A 5CEXA 4KTDL 5DVKA 4NPYA 3MACH 4ZTOL 3QHNA 1VF8A 2VX7A 1KLUA 3GSVB 2EPNA 4GG6F 5JIIA 2Z35A 1E6JL 4HUXB 4X6CF 4Y5VC 3CSBA 5FHBL 3LIZL 1C5DA 3NPSB 4WSKA 2VLKD 3DX7A 1GSMA 3MRIA 4I0PC 4P9MH 5E5RB 1T3FB 3SCTA 3MV01 4GQQA 3U4BL 1HF6A 5CSZA 3N0PB 3UTPD 2GEEA 4LBEB 5D7IA 1AXSA 5FA4B 5E8NB 1FPTH 3QIBC 3FO1B 1RZGA 1GCYA 1E73M 5IMKA 4OZGE 3BP7B 2VR5A 1AGBB 4WU7A 2F9BT 4MHHG 2WVTA 1KCSL 1SBSL 3CO4A 5TD4A 4PJFA 1I8IB 1MFDH 1EVTC 1KEMH 3MRDA 4X7SL 1ZT4B 5DMKB 2A77L 1Y6KR 1E56A 4N42A 5BRZB 1WBZB 3PIQB 3HE6B 5IW6B 3L5WA 3SGJC 4LGRB 5CD3B 4JFSA 3D69B 4HWEL 4HUNB 1U8IB 1YQVH 2XRAL 1FDLH 1A7RH 2XWTB 2FSEB 1KULA 2WCAA 3PXJA 5HJ3A 4CU6A 2XKUA 3GHEL 5D2NE 2W60B 1XC6A 2GK0A 4P5TB 2BSTB 1W1PA 5C09A 2FECL 3MV7D 2NLJB 1HCVA 3SJVE 2VLKE 5K33A 4OF7A 3QZWA 4ZE4A 1BQSA 3KDMB 3VFRA 2CKNA 4LLVA 3JWOC 1LK3L 1Y18A 1OD9A 5AZ2H 4OGAD 1G7IA 1HSAB 1NWTA 4JN2A 5LGJA 3LD8B 5HHVL 3BAJA 3C2AL 2XACC 1IFHL 3RAJH 1GC1L 3LN4A 4Y5XA 1T7XA 3HAEH 5IEHA 2YD4A 1TFVA 3RVXC 1AE6H 3D39B 1Q6CA 2DL2A 5D5MA 4NM8H 4LSTL 1E15A 2F58H 1XF5B 5E00B 1KB3A 1M71A 1YPZF 1W3KA 3TN0A 4NP4L 1AR2A 3BGAA 5M94B 2DMCA 4ELKB 3C5JA 1VKXB 5E2UH 3BN9C 2DIEA 3U9PL 2X4RB 3MGTA 3RUGE 4YK4C 3AMKA 4OD2B 1P4LA 3O6FD 4FQIH 4ZD3H 5D9OA 4L8DB 4E5XA 1CLVA 3OJDA 1TCRB 4I0PA 4TYUA 3PDOB 1IGCL 2Y06L 3HKFA 4ETQA 1WZMA 1YEFL 2IBZY 4K3EL 3BP4A 3QUXA 3DSFH 4GAYB 4AD1A 3DRQB 4H1LA 4OUOA 4JO3H 5HGHB 1RURH 5E2JA 4CADB 4QXUH 4FFWC 1S3KH 3MUHL 2P5EB 1DLHA 2OJEA 5LWYH 1W72L 1NM9A 1AKJD 3DNKA 1YN6B 1CFSB 4U31A 3UTOA 4CVWA 4AK1A 1JPFB 1AO7A 2W61A 4OFDA 3O9WD 1HIZA 1EPFA 5FOBA 1PPIA 1TJGL 3TH3T 5JR1L 1WFUA 3UESA 2YD8A 2WAHA 4RL3A 4AYFA 1GIGL 4AZCB 1NBQA 5FECB 2Q7NA 3L5XH 3FAWA 1A64A 5J12C 1QVBA 4MVBD 1XHGA 4MA8H 5EU6A 2DQCH 4RMRA 1EGJH 1FH5H 4HCRA 5EU3A 3RKDD 4HIHA 1S8DA 3DARA 4A4AA 3HG1A 1OIMA 1CIDA 5I1GL 5SWZA 2VDRH 4OZHB 3O6MH 4JM2A 5C07E 3GDBA 2P46B 3ARGD 4MNGA 4R2GC 1S7RA 2WMGA 3MLUL 3ZOAA 5CIPB 5C6PB 3GM0A 5C7XL 1SJHA 1RZGB 4FP8H 5I78A 5A8OA 5T3XE 1JDDA 3L6FA 1CZ8L 3NIDF 1W8NA 4OZHE 3C09C 2Z31C 2GJPA 3BGMA 3WF4A 2W9DH 1YNKL 3WFZA 5ALCL 3CHCA 3NA9H 3DXAA 2WQ8A 2E8ZA 1IGCH 2Y06H 4X9BA 4PTUA 1U8PA 4ZUTB 3SQOH 4TSAH 5I1IH 2WVVB 3WNKA 5GRYA 3MRCA 3O6LL 1RJYA 4PJIF 4YWGL 1FZMB 2G8ZA 3EJZC 1AFVH 4NKOA 4WHCA 3DGCR 2A3HA 4H8WL 4LPVA 2QV2A 3QUXC 4OCWL 3FO0H 1W72H 3OGCA 1AR1D 2XTKA 3RIFF 3G5YB 3LMJH 3W5NA 3UG4A 2B4CH 2ZNXA 1A7OL 4OZFG 1YJDL 3HR6A 4F79A 5MEPB 2D7QA 2J88L 2VO5A 4PB0H 4LYPA 5FYLD 3HAEA 4MAYC 3UDWC 3WFDH 3GRWL 5DUBB 4Y1AA 2ZKHH 4Z76A 3POCA 2J7CA 5JXAL 4PJIA 1UZ8A 4KXZI 1BX2B 1XF5A 3ARFA 5E00A 4L3ED 4NHCH 2PYEE 2V7HA 1VPOH 4QGYA 4F7PB 5JXEA 4JM4L 4K3JL 4FLOA 1NCCH 5EU7E 3LPPA 1AC0A 5ILTL 1DZBA 2RGLA 3KEHA 2XKNA 1C1EH 2DB8A 3IFLL 1A7RL 4GJTB 2DRUA 1MW2A 4LSVL 1NFDB 1TVBA 3D18B 3VXNB 5CILH 1E0VA 5HI4D 1M7DA 2ERJC 3BDYL 5LKNA 1OT1A 5ISZB 3SCWA 4RGNE 4NJAH 3SDYH 3WUWG 5ABFB 2C26A 1D3CA 4OLXL 3IDJA 5CP7B 4YHML 1PD6A 3GMOB 5EC2B 2OJEB 1I1AC 1QRNB 5JW5B 4XGZA 5D7IF 3RTQC 5F7YC 5DJDB 4FQ1H 3STBA 2R0KH 1D9KA 3DYOA 3MCLL 4XCCL 2AEIT 1UCBH 2G41A 2IADB 4AIZA 3I9GL 3Q6FB 3G6JB 1JP5A 2WHJA 4XB3A 1MIMH 1QLEH 1XZ0A 1E5JA 3CBWA 2B8OT 5BYWA 2QV4A 1B6DA 4EI5A 2Z8WC 1H3UA 1KB5B 3KNBA 5DJ8A 5CIPH 3N18A 4WU5B 4D6CA 4F80A 4LEXL 5EOCH 3GI8H 1YC7A 3HE6D 4KVCL 1IBGH 4YC2B 1R0AL 4NJ9H 5BCAA 1BM3L 2H1PL 4NKDB 5CEZE 2VC9A 2UV3A 3NABH 1EFXA 3GSXA 1KJMB 5I1LA 4TNWK 4XH2A 3T4YB 2J47A 3L5IA 3TNMA 4MJIB 1XSIA 3NZ8B 3RIAK 3VA6A 1X44A 5A2IH 2VABA 1FJ1A 4HX1A 1HHIA 4KH2A 4XCFL 1ZLVK 4TRPL 3VXRA 5GJTL 3OXSA 2VXQH 5DHVB 1UQSA 1US2A 4PG9B 5EBMA 3RWIB 1F11A 5EC1B 3BQUB 4GAGH 5D6DC 1UJ3C 2OWXA 5LAXA 2ATPA 5L8JB 3ZE0F 1EJOL 4ONHA 4J3VA 3HG1D 1L0XA 2EDLA 4KJQD 4XX1E 3TA9A 2CXGA 2EO9A 4AZGA 1UR8A 3IF1B 5IB3B 3N1FC 1NFDE 5K9KA 1E6NA 5M5DA 1N4XL 1BP3B 3W29A 2P42B 4HZ8A 4MCZA 5LQBL 1IEAA 2ZCKH 2IF7A 1CBGA 4P9ML 4B50A 4N1HB 5CZKA 3HAEG 3SE8H 3D2UA 5GSVA 4U0RB 1OF2A 5J89A 4OLEA 3QPXH 2OSWA 5F71A 1U6AH 4CW1B 1JNEA 3PDDA 3V6OE 43C9B 3ULUC 5DSCA 1UHVA 5GGRA 4HF5H 1KR1A 1JWMA 4ISVA 1T6VN 4BCEA 2ADJB 4TTDD 5I74B 1PIGA 4KK8C 3JBG7 4BQ9A 4D9RE 4QNPF 5HOSA 4H1LG 4JQXC 2EXYD 1AH1A 1WZLA 4B9ZA 4JFFE 4HP5A 1BX2A 1Q4NX 1T0NB 4UIKL 4GQ9L 3P30H 3BZFB 4IDJH 4OJFL 1T6WA 3FZUD 5C0AD 1CXEA 1ZT7A 1B2WH 4KUZL 5BV7H 4P2QB 3K2MC 1AGCB 2QLVB 3C6LA 5HDQH 2I24N 4N8CH 3V6ZA 1RIUL 5E2VH 2OZ4A 1IL1A 4TNWF 4XNYH 3MNVA 4TXEA 1BD2D 3BJ91 3OGSA 4GMSH 4HUVA 2JCCF 3AU1A 5D7LA 1GOFA 1G5AA 2HFEB 4O51B 3LKSB 1NFIA 3MRBA 4NBYB 2HTLC 3AMDA 4GG6B 1FN4B 4GRLB 2DQJH 3UJIL 1BTCA 5HYSA 1GHRA 5HHQB 4FFVC 3FHAA 2E3VA 4KC3B 4GAJL 3L3HB 1OP9A 3B6SA 4LMQI 2D3LA 1ITCA 4PRIB 3E2HB 5IXEA 1MHCB 2O5YH 4EI5B 1WITA 4Y16D 5M95B 2CPCA 3RWDA 4XVTL 2B1HL 2J4WH 3AM8C 1MCWW 2MHAA 3MYJA 4IMKA 1YYMH 2IQAB 1NEZA 2VL5B 1PG7H 4P9HH 5CGTA 1MNUH 4OJYA 4R2GB 2BVYA 1KEGH 3GSQA 3PJSB 4XH2B 4PJ7E 5LG1A 3T4YA 4BELD 4ZQKB 2DSVA 1WZ1H 1F3DJ 3KZSA 4RFOH 3N9KA 3PXHA 1MFAL 4BQ5A 3B9EA 1G84A 5TH2B 1QNZL 5EOTB 1KXQE 1NGWB 3VH8A 1WWCA 5IFAL 1L7IH 4MLIA 1PVHA 1UM6L 1NDGA 2GSIB 2CUMA 4ODWB 3S4SB 3V0VB 1C90A 1QHZA 5IWLC 4F2MB 2P5EE 5FO8B 1K6AA 2JJSC 3BE1L 4JO4L 1UD6A 2NMSA 1VKXA 1UA6H 1CT8A 1XF4B 1X6LA 3ZQ9A 3GXIA 5IOPA 1YEHH 5C09D 4M62L 1J01A 1E55A 2CQVA 4MX7A 2WSPA 3VM5A 4XNYL 5JUVA 4JY4B 3UTQB 3IDYB 2WBJD 3OHXB 2QQNL 4LSPL 5E8PB 1ZXQA 2XIIA 1E6OH 3WQWA 4DZ8A 1MJ7L 1H5VA 1BPVA 4D6GA 2H9GA 2BHUA 3KYKH 1WSST 5T5FH 1PX3A 3O4LE 1FFPA 4GG8B 1UQYA 5KOMC 3JV0A 4HV8B 4DKDC 2HJFB 4G6FD 3TH2T 1UKTA 1AGEA 1CI5A 2FIKA 4WJ5B 2YPKB 4R96A 4KUCF 3GBEA 4X8JA 4F58H 4HWZB 4G8GE 3CMOL 1JXKA 4P8UA 4MNHB 1Z0NA 3RVWD 2FJGA 5D1QD 1IGFH 4MGXA 3JV6A 3WDHA 3I84A 5CJ5A 1P7QA 1NCUA 4UT9H 1II4E 5E8EA 3QXAB 4MXVE 4AG4H 5D7KD 1HSBA 3RFZC 4PSRA 4PJAE 4WW1B 1NUFA 2E6JA 5LQBH 3Q2CA 3BFOA 2A73B 1INEH 4YN5A 2GIYA 1EEZA 1TETL 2CKBA 2DWDB 4PRPA 2ZNWA 1JFHA 4L4TB 1LG2A 1L0YA 3GMPA 4Z7UF 1KJ3L 2NY7L 1WV7T 3AU1B 3O9NA 4MSWB 5JORA 2NW3B 4PJ7A 4L4VE 1I1CA 3EYFA 1FSKB 4OCLC 3L3JB 4LF3A 5HHQA 1P84K 4HIIB 4WKAA 2VLLB 2MCPL 4YDKL 1P5UA 2YD3A 3WHXB 2NY3B 3Q0HA 3HFML 4R3SB 4YZFF 3PZNA 4U1MB 1C1EL 1B31A 4YX2L 1GPOL 1PZUB 3HMXL 5CEZH 3IFPA 4P46D 2R2BB 2QL1A 4P2OA 4EDXA 4NKMB 1L0QA 1YA5A 4NJAL 1QNSA 3VXQA 5HXMA 5KZCB 3V9FA 1QFHA 4YLQT 3O0RH 1N59A 4NQXB 3CSPA 4BKLA 4DZBB 3EJZD 5EH1A 1GORA 2NW2A 1GZJA 3IFNL 4TSCH 4GI6A 1LD9A 4YEFA 4PJIB 4RGOL 5D1ZC 3BEVB 1MCDA 4DGVL 3MV7B 4WFFD 2I07A 1U8KB 4EI5D 2P8LB 4NQVB 1FVDB 3RTQD 2G60L 5C92A 4U6YB 3PWPB 3QDHA 3TBVA 5GZOC 3AHVA 3V52H 3NZHL 4D6JA 4CD6A 4H0IA 3QUZC 5FHAL 2EQDA 5LBSL 4M29A 3QBTB 5A3HA 1TVBB 3VXNA 1JGUH 4JRXE 4N0UE 4U49A 2YRPA 3T4AA 4S0TD 3LEYL 3REWB 2ICWI 2YD1A 4OB5L 4EUPA 4LCWE 1DQLL 2WWMD 2WYSA 2VMFA 1KELL 5H35B 5GS0H 3QIWD 3BYTA 5IB5B 4ZS7L 1OW0A 2BSED 1XR8B 4MNKA 1Q94B 3QUKB 3SE3C 3X12B 5D1QA 4HWZA 4JFTA 5IKCB 1K9FA 1XZ0B 5E8OA 1TMCB 2XA3A 4XP4L 5IW1B 4EXKA 5CEXB 1W3JA 4AD3A 1FCGA 1D5IH 2P47B 4XB8A 5IG7B 1EO7A 4JPIB 4YGVB 2O61A 3TVMA 2A3EA 2ZUVA 3CCHA 4JR9L 4Z0BH 4JFHD 4IMKC 5T1MA 4KJPC 4F9PA 2YL8A 2HAZA 1U8OA 1CXKA 3OZ9H 3W9DB 3LKOA 1I3VA 4LSSL 1I1FA 2PF6A 5EN2B 3N12A 1K9TA 3MJ9L 2P5ED 5GRJL 1U8NB 3WH7A 3AVEA 2AK4A 3QUMB 3CMGA 5HHPB 2W0KA 1JG9A 1W0YT 2C4FU 2JF7A 2FX8H 3B5GA 4P2RA 5CCKH 4WI7A 1QSFB 4YGAB 1GAFH 5HY9B 3S5LB 3BH8A 2OZ4L 5FF6B 1KXQA 3U4EB 3OB0H 4FN0A 4YHEA 1UM4L 1S7UA 3H9SD 5JIKA 2J88H 1RHFA 4NZJA 3HRPA 5IBUB 3WFBL 4L4VB 3UG3A 2DGAA 4OFKA 3BZEA 4ETYA 5GJSL 4QCEA 3L5WB 2OBGA 4DFIA 3RWEA 1KQYA 1BMGA 2VCBA 1N6UA 1UKPA 2FGZA 3BGFB 5DLMH 1RV6X 5E08L 3MOAH 1HNFA 4DEPC 1BAGA 1G7PA 2JK5A 2PUQT 1I4FA 1G9NH 5DJAA 3QNYA 1P6WA 3DMMC 4QT5A 3U30B 2GTZA 3RKDC 3OZ9L 1T2XA 3ROOA 4KRPB 2AXHA 2P49B 3AS2A 4NQEE 3AZSA 4LDLB 4PGDB 1J05B 4X0NA 3VXQB 2DL9A 5GRJH 1BQLH 2Y36H 1NQ6A 5KEZA 2VZ3A 3A6BL 2GUOB 3B2VH 3BT2H 3O2WL 3CZFB 1JN6B 5FUOL 1W9BM 3JUGA 4PJ5D 2BZDA 2Q20A 4ZO8A 1DVFC 3RWHB 3OKKA 4DWSB 5SWSB 4B5EA 2FJFB 4GI8A 3UTSA 4QRQB 1NGZA 1MNUL 1NEZG 1G7LB 3BX7C 4ELKA 5HGGS 3DETD 1R5WB 4YXLH 1MCCA 2X1XR 4MXQD 3OX8B 5A16B 4W93A 5E7FA 1OP3K 4X0KB 1IL1B 1TCRA 7CGTA 2O5YL 5HYJB 5HI5D 5ANME 3WLBA 3LQAL 1LK2A 4M3KB 1HEZA 5KW9H 1RPKA 1ZHBB 2EE3A 3PV7A 4HUVB 4RRPA 5HGHA 3WV0A 4Q6YA 3MUGB 3IDIA 4JRXA 3D39E 3HN3A 2EPMX 1PG7L 3ZDZE 3WF3A 3RI5K 1A6PA 4LIQL 1SBBA 5FGBC 1JHKL 3CUPA 2DBLH 3STZA 5FGSA 5KSVB 1U9KA 3NPSC 4Z77A 1FIGL 3UO1H 1HILB 4OCRL 5A69A 1YHTA 3NCOA 3GGWB 4K9EL 2ESVA 1V08A 1JGDA 1H3VA 1LQ0A 2VZSA 3WCYA 3S34L 2JF1A 3TTYA 3IRZA 4UV7H 1CDUA 1IGYA 2G5RA 4WWKA 2WP3T 4FQJH 3KYMB 1KBKA 3BQUD 1BBDL 2Z0BA 5CJQH 2KBGA 4FABH 1CNVA 2G3JA 1ND0A 3QDGD 4LPUA 1QFWL 2CRIA 5KSUA 1T89A 3HG1B 2G3NA 4Y4HA 2A6IB 1PYWA 2E27L 1FBIL 1K85A 3PWUB 4HSQA 1MY5A 1T1WA 5CPTA 1T4KA 4QRRB 4JLRA 4LGXA 1CLYH 4ODWA 3V0VA 3KPMB 4C83A 4W89A 1LO3H 1QFUH 1MJ8H 2FB4L 4X9FA 1SM3H 2ARWA 1W72B 3EOYG 3WS3A 3TFKD 3HR5A 2F15A 5KG9A 5E03A 1T5XA 3ZSSA 3JV5A 1G0YR 1YNLH 1NH6A 2EDKA 1OCWH 3NGBC 3MO1A 3WE6B 1V3HA 4CVZA 3ULVC 1XFPA 3WH5A 3DV4A 4X5WB 2IANB 4PLKC 3UYOD 5B8CA 2GTZB 5I75C 3BO8B 2PN5A 5C0NC 2P24A 4P5KB 1BVNP 2CJUL 4FABL 1VEPA 4N1EA 3KYAA 5D1ZB 1Q9LA 4YDKH 5EBWB 1CXLA 3CMJA 2H2PC 1NL0H 4L8BA 4OLZL 5I17B 3N13A 4OQTH 4WI3A 5HGBB 5JW4N 3BRGC 5E6ID 1GQLA 2CRZA 1KIRA 2DYPA 1K2DB 5JHDA 3LAFA 4NKQB 4ALAH 4B15A 1F8TL 1J1PL 32C2A 3U0WL 2DQGH 3VH8G 2VC2L 4LIQE 2EEXA 4BFIB 4GRMB 2MTPA 4N0RA 5E08H 4NCDA 1BECA 3SKMB 1OGAB 1IGMH 2ZXBA 2ZCLL 1RURL 1NFDA 1CE6B 3VXSA 3NFSH 2Y7QB 2E27H 3T65A 1LE9A 4YDJB 3L4WA 1C92A 1MQ8A 1L6ZA 5HYJE 1URLA 4LVOB 1XGUA 3WLWC 1F58H 5I75B 2IAMC 3QPQC 1WC7B 2GSGA 4BSWA 4YPGA 1CBVH 3AXIA 1R3JB 2BNQB 1G1YA 2UZYB 3MO4A 4RAUA 4HC1L 2YL5A 4Z7VF 5IQ7L 2YD9A 4HS3B 3KJ6H 4HS6B 4R27A 2R56H 3SN6N 4YXHH 4XBEL 5L2KE 4LSRH 1C16B 5J13C 4XNZC 3UROR 4YQXH 1GJIA 4P7QA 4P3DB 3LZFL 4OIFA 2WPGA 1LDSA 4K9EC 3UC0H 3FFCA 2CIKB 4UOW0 2DQTH 3C8HA 1UR0A 1ORSB 2R0LH 4HW6A 4ODVH 4M62H 2ZUSA 4YHPB 5D7JC 3N11A 3LPOA 4NHCL 1Y6MR 2WNWA 2Q87A 3WL9B 1ODUA 3DETC 1IEBB 3TPUB 4TOYL 1C5CL 3HPLB 4OZIE 2DSUA 2DQEH 4Z2KA 1GH7A 1EQCA 5I1IL 4UZUA 2BCKB 1N6QH 5M3WA 1XGQB 1H4PA 2CDEB 1QSEB 3HUJE 1MJUL 3S88L 3HE7D 3P4MB 2HKHL 3D1MC 5C07D 1EEYA 1X5IA 3BQUA 4XVSH 5TQ2L 4HAFA 4JFZL 4M03A 2YD2A 4P2CG 1LEIB 5DFAA 1M53A 3DOSA 1I9JH 4RMTA 3IAGC 3IAPA 2PF0A 4PP2A 1ROWA 3QFDB 5GSRB 2RHEA 3PWNA 4MXWH 5EUOE 1QW9A 5CZXC 1BSIA 1L8NA 3GNOA 4HH9B 3PDGA 1UXSA 2ZUTA 3P77B 3VGFA 2JALA 1I9EA 2ZX6A 3FHQA 3BGFC 1JHTA 1BJ1H 1RZIA 5C3TA 3MJ9H 4JFDB 1BG9A 4QRPB 5DFVC 1YPZA 3WYRA 3WFBH 5H35A 5FIPA 4LSSH 4WJXA 1IAKA 4M24A 1FO0B 1KIUA 2QADD 2NY2B 2YK1H 3W25A 5EBWA 1V3KA 1M6OA 2XWTA 4GRWH 4O02H 3RWJB 4WFGD 5GGTL 5H2BA 5CXPA 2GJJA 3L3KB 3BZ4B 1Q1JL 1SMAA 3NCBB 1QR1B 1E4XH 3QXUA 3IAQA 3LVEA 5IHUL 3ET9F 3L2MA 4JHWH 4Q9BA 1D5XA 1MRFH 3D0LB 1CDGA 3TPKA 1H5BC 4RA0C 1DQQA 4E9LA 5E24E 3AIWA 3PWPD 2QHRL 4JN2B 1A0QH 3O8XC 3FXYA 4NI3A 7TAAA 2BNQE 3AI0A 4R4ND 4ZG1A 3B9KC 4UQ3A 5E0QA 2XZCH 1BGGA 5ID1B 1DBJH 1TENA 3G6MA 1A1MB 1H49A 5HPOA 4XXDA 5KVEH 1A3QA 1PZ5A 1BVKB 1WZKA 5FM5M 2D9QB 3DHPA 3P11L 2KZWA 4QRTB 1A6ZB 2I5YL 4LHUA 5K9JH 4M7KL 3TNNB 2YUVA 5FF6A 1HH6A 1JZ7A 4HFUH 4NO0B 1XGRB 1JPST 1RZJC 4JGUA 1WQVT 5E5UB 2NY4C 4PY8J 1OGAE 4IRSD 3ARBB 5TGBA 1JL8A 3AQUA 3MV7E 3LQZA 3MGOB 1FNHA 4CADA 1EJOH 4U1JA 4PTUB 1OARL 4QY8B 4FS0A 4FTVE 1UWRA 2CGRL 1RH9A 2DT0A 1NAMA 3TV3H 4NBZB 3RWDB 1DWFM 4LVHC 1UJ3A 3ALXA 4X5LA 2NY1C 3GNML 1KENL 3BKML 4BS0A 2ERJB 2VDLH 3QISA 1FNGA 4KKCD 1A7QH 5ICXA 4YNYA 1WTGT 1KXVC 4PD4K 1FIGH 3UO1L 2F54A 2QQKL 4C58B 2ICEA 1I1AB 3AY4A 4ZXLA 2YEZA 2VZTA 1NQBA 3QRGH 3W0WD 3V4PL 1IFHH 4PMRA 2GK1A 4TVDA 2ESCA 2FGWH 5KANI 1G9MC 1XGQA 3QHTC 5D72H 4D9RD 4XNMA 2J12B 4DWSA 5JIPA 3VFSA 1G6RH 5DUML 4NP4H 4NFDA 2EDTA 2X4UA 1XF4A 1W3HA 5KVMC 1GOIA 4PV9B 2X42A 3HI6H 2JFEX 3RPMA 4M9OA 3B8SA 2IBBA 2EDXA 3THCA 1U8LB 3QDMD 4JY4A 5C2BL 2D7MA 4J3SA 3UTQA 5C07B 2G3MA 4KMQA 3S34H 5HBFA 2I9LB 1XF2A 4C59B 5HBBA 2GFBB 2XXMB 1MCIA 1QTYT 5D72L 2NTFB 4M00A 1XIWD 5BS0E 7FABH 3MA7B 1OWWA 4ZO6A 4OCRH 1WIUA 2GI7A 3LKRA 1RHHB 1U3HB 4NKOB 4HT1H 2FIKB 4PTVA 3MFGB 1HL8A 5GPRA 3UPAA 4NHUB 1QNRA 3R0MA 3WFEH 5F7DB 1BIIA 5IT2H 4MQSB 1Y6NR 4AL8H 3GSRA 4WTZA 4QHLB 3P0VH 1K6QL 3CLFL 3D5HA 4N9GB 1RUML 4G9DB 2UWEB 3IB4A 4OM0L 1MCPH 3F6LA 3VWJD 3KYMA 5HVWA 2F74A 1H41A 2VWEC 3EYOB 4EN3C 4NKDA 4OFPA 3M6DA 3RVUC 3K4DA 5IQ9A 5ALCH 3ZT6A 1INQB 2W0PA 3CDGA 4OI9A 2F19L 1G9HA 1ZV5A 1NMBL 3E6FA 4MJIA 4R4NC 2LU4A 1HOCB 3OPZH 4KGJA 3VCLA 1INDH 2M1KA 3DIFB 3GMPB 3I2CH 3ARQA 3RJDA 1S9YB 1UQSB 5C0FA 4FP8L 1QSED 2BMKA 4K7PX 5J1SC 3KLSA 3ULVD 4PMUA 4O5LL 2YPVL 3T2NL 2L4OA 3GHBH 2O9PA 4IHOA 3O3EA 4L8CA 4Y19D 3NFSL 1YNKH 2PXYB 2A1WL 2FX9L 4JB9H 4M7ZB 4WUUA 1NPUA 3P73A 5DD0L 3MRLA 3MLXH 5I76A 2D31B 4RFOL 3QUMH 5MERA 3WNPA 1JYXA 5DJDA 5B8CB 1JRHH 3I50H 1I3GH 4XNZB 4E41B 1QVOA 1TXKA 2DLGA 5KVGH 1JMXA 2W65B 3I2CL 1PX8A 2AK4E 1KN2L 5FCUH 2BVPB 4NUJB 2AAAA 5C8JA 2XTLA 4NQUA 4C4KT 4P8XA 3FN3A 4I2XE 1BVLA 1H3XA 5DJYA 4X9YA 1BD2B 1L7IL 4JVPA 2OYLA 4MAVA 4KAQL 5D2NA 2Q6WA 2VLMD 2VE6B 3GSOA 3ULVH 3KR3H 4DW2L 4XCNB 2NY6D 4L29B 5I1EL 3QHMA 3WUGA 1CG9A 5EZJA 3SUSA 2EDEA 5T1KA 5DEGB 1EFXB 5JHDB 1F2XK 2J8GA 4EI6B 3Q1SL 2YUWA 4Q6IA 1CICA 4WI9A 1ADQL 2A6DA 4GXPA 4BFIA 3K7UA 3DVGA 4NQCD 4Y4KD 3PGDA 5IF0B 1OD0A 1ZANL 1P2CA 2A6KB 1FE8L 4M56A 2CPUA 2X1QA 1OB1B 3MRMB 3VXSB 4Y7MA 1LE9B 1I7TB 5DQDL 1G9EA 3FQXB 2VDPL 3QH3B 5D1QC 2F8QA 2I9LA 2R1YB 1U36A 5AWNH 4CL7A 4YPGB 4HZLB 1BGXL 2UVFA 4WHTA 3VXOB 4NZCA 4I4WB 4OSUL 2HJLB 4D94A 2FX7H 4P3WA 1FVEB 2OWWA 2WHMA 4BM7A 1KTDB 2XFXB 4MCZB 4MB4A 4XBGB 1ZLVH 4EANA 3ULVE 2JCCE 2VLRA 1E5NA 2ZUMA 5L88L 1UR4A 1MWAB 1FV1B 3NABL 3S37X 1R3LA 1KYOJ 4PJHF 1E28A 5KVFL 4JPVL 5J9PA 3GXFA 2GCYA 3KYNA 1G7HB 3W37A 5L6YH 5CZVH 3CLEL 5DSCB 5J0BA 2JCCB 3QUYA 5CZXD 2V3FA 1YMMD 3A3HA 5IVXB 4RGMB 4PJXA 2APFA 2JLLA 3L4XA 5GHWH 4PMDA 1BAFL 2Q76A 4MQTB 4G42B 4FLSA 5CBEB 5HDLA 2NY4B 2GJ6A 5DD6B 5L8KB 2BCKA 4I9WE 3H9YA 5TQ2H 2A9NH 4FQHA 1LE5A 5AWNL 1ZT1B 4PJHA 1RP9A 2ADFH 3FT4A 1MCLA 1B0IA 1P1ZB 4GLRI 5KAQF 1NCDL 1ZE3C 3L3IA 1QPPA 1JFQL 4ZFZA 5DGQA 4TTDC 2Z93B 3GSWB 1SFSA 4ODXB 4DKAA 5AG8A 5J57B 2D7OA 1TZHA 2IFFL 4UILL 5FYKL 3PP3H 1LK3H 2RAMA 3TBSA 2P48B 4J12A 3WD1A 1FE8H 3RWEB 1TJHH 5A43C 1IGIH 4X9IA 2DLIA 2HISA 1MCBA 1LP9E 1MREL 1MUJA 1F8TH 1J1PH 3FONA 1T2QL 5F7FA 2NZ9D 1NL0L 4DZ8B 1JUFB 2VUYA 1LEGB 2VDKL 4KJYB 3ZO9A 4NRZA 3GFUA 4ZSOB 4QF1A 1X5FA 4U3CA 3ZKMC 3QEUB 4PGEB 3MLPA 1HVQA 4M7JL 3MLYL 4W87A 3QWRD 4QRSA 5EO9A 1BD2A 2H2SC 4QRPE 5I71C 1FSKC 1E6RA 4NPYB 2Q8XA 1KENH 3BKMH 1J10A 5EORH 3WD5L 3MJ7B 1US3A 3W0WE 3IXTB 5JPMB 3MOBL 1CDHA 3PABA 1E72M 4BQ4A 4GKZA 4OLUL 3MMDA 1E3ZA 2EKJA 1C5DB 4MNQB 3F7YA 4PFEA 3EO9L 5BMFL 5LCVL 4XPFH 1ZA6B 4A2MA 2R0WH 5IR1B 2ICWB 4CJ0A 5HYJA 2CKBB 4AM0B 4L4TA 3WFHB 1E4LA 5L2JB 1IZJA 2ICES 4MJ6A 3QQ4B 4KQ4L 4OZIB 2GY5A 2ZUNA 5SX5K 1OY3B 1AVAA 3L4VA 4FFYH 3N50A 1OGAD 5HVFB 3ORJA 3VI4E 5HGAA 2PYEB 3FO2A 3QULB 3GXMA 4EQ3A 4FXGA 3EFDL 1UVQA 2ZWLT 4IIQC 2Q8AL 1UB6A 3V6OC 2H9GB 3BWAA 2VJXA 1C8PA 2V38A 2ZICA 1ZGLM 3AS0A 3GH5A 1ERNA 4Q7NA 3HC4H 4M80A 1G7HA 5D5MF 4MNQE 2YPKA 4LCYB 4R96B 5MHSE 5K9OA 3O6FA 4X4YB 4WWKB 1FAIL 4LHUG 5I5RA 2VLKB 1I75A 2YKLL 1ISXA 3RDTA 1AGFB 1IQDA 1IGJB 2FRGP 3KPTA 4JZOB 1G01A 3EJYC 5CFHA 5JW4Q 1KEGL 1FHGA 1MHEB 3O6LH 5D8ZA 4NQCE 3VFGL 4D0CB 3LKQB 3PWUA 4JGMA 1P4BH 1A6UH 4ZOBA 1QBLL 1WCQA 3T09A 4U33A 4R7DA 5KW9L 1IC1A 2VQ1A 3PUCA 4DVRH 1TQBC 5GRUH 3RU8H 1RUPH 3U48A 4QOKD 5MEOA 4H8WH 3O11B 4JHWL 5EFIA 1H09A 1H0IA 1AR1C 1TTFA 4AISA 3BT2L 3M45A 4EN3D 4PJ7B 1X5ZA 3CAFA 1QSFE 1UENA 4JY5L 3ARSA 2CRYA 5AAWA 2OXGA 5CJ8A 4EUPB 5C0GB 4QRRE 1EAPB 1MCFA 2D0HA 3NBNA 2O5XH 5K59F 4NQSA 5CINH 3QFJE 2AK1L 2EDWA 1M1SA 2YC1B 2FZ3B 3T2PA 4K7PH 5LA1A 1XR8A 3TTSA 1TDQA 5ICZB 3GJFB 5C0JA 5I1CL 4PJGF 5BVJA 3CTTA 2IG2L 2YA0A 3CUFA 3P9WB 4F7TB 3TBTA 3IJSA 5GRZA 5BV7L 2HT2C 1N2RB 3BVNB 3UYPA 5BV7B 2R0ZH 2NY0D 3VFGH 1PKQA 5EUOF 5SV4A 4LAQL 4GAFB 5IMOA 1FP9A 1PX4A 4X6DE 5T1LA 3CCHB 4JRXD 5F8QC 2R8SH 1UR2A 4X4MA 3KPNB 5T1MB 1BLNA 5I6XB 2WZPD 1E4MM 4OZFH 3TJHD 2XFRA 4JE4B 1DUYA 1HXJA 3SDDB 2XNAB 2A1WH 5E0FA 5FKYA 1ZBWA 2IXUA 1FO0H 3QI9A 2OL3B 4YIQA 4C54A 4QWWC 1CE6A 2QADB 3BH9A 4Y8DC 1UACH 3VFTA 4Z7WF 4MVBC 1E71M 1PY9A 3NTCL 1YEEH 5A94A 4L8SC 2MWCA 43CAB 5T3ZD 4XCEB 1MCOL 5ETUB 3P4NA 3A6CH 5FOJA 5TF0A 4HS3A 3KYOB 3PWLA 4JL2A 2IEPA 1AJ7L 4BZ1L 5E2WL 1HKLH 3OGOE 1C16A 6A3HA 5J6GB 1KGCE 1FH5L 4U0QB 1W0VA 1WUNT 4OLUH 1TZGH 3A4WA 1B3ZA 5CGYD 3GUTA 4ACYA 2QPUA 1E4NA 1MFCH 1E6JH 4ZAKA 1TA3A 1QVOB 4GOSA 3NDZA 2GITA 4X0VA 3EZJB 3QDJD 1DLFL 1T83A 4E4PA 3O2VL 4DWSD 5HDBE 4Y4FB 5K93A 3L7EA 2DQFA 3MV8E 1XR9B 4KZEL 1T66C 3U0TA 4UU9B 3RNQB 5JOEA 4ZPTA 3ZTNH 5ACLA 4NO0D 4X98B 1UA7A 3CPUA 4XCNA 3WEXA 1DEEB 4PLJD 1WDRA 2Y8KA 5CD5D 5EU3B 2CKBL 5LBSH 1F13A 5BXTA 3DVFA 4GLRH 3ARFB 3MUAA 2WC7A 1EEYB 4RWYH 4LLMA 1HX0A 1KEML 2AK4B 4K3GA 4Z7NE 5I2UA 2YA1A 2G60H 3ZJ6A 1LHZA 1VGEH 4AMKH 5FL0A 3PGDB 5IF0A 3AIVA 5GSRA 5I1JL 3GJFH 4QNPE 4FQPA 3QEQE 4JREC 4ELMB 5IEKA 1DSFL 4HLJA 4OSUH 3U4EA 3KPOA 4LRNL 3RMEA 4JZJA 4U5KA 4JR9H 4Z0BL 3WLWD 3MBXH 3QIBA 4I4WA 2EIZB 3MRJB 3TO4D 4Q0XL 3VTRA 2IBGA 3GO1H 2ILLA 1HP5A 5DEFA 3GJFA 5C0JB 3MMWA 4FTVD 3VD3A 4TVUA 3P11H 1UD8A 3L3KA 3OF6D 2VZVA 5IGXH 5J11C 4XZBA 1CFVL 2NPLX 2YWYA 3K81A 4RBPK 5E09A 2J1KA 3Q6GH 3OKOA 4QCIA 5J9PB 5CWSB 3O6AA 5F96H 4GSDL 5EPMB 1KJ2L 1DDHA 5F9WB 5CBAB 3FOLB 3BJLA 2XVPA 4AD4A 4HK3N 3G6JE 3BKJL 2CR6A 1Q6FA 2ID5A 4QHUA 1RUAH 3I9GH 2PR4L 5GZOD 5I1JH 1BZ9B 3P0GB 5FYJU 4LDEB 5SWSA 3EO0A 3EYSH 1TETH 2HRLA 4OF8A 4RA3A 5I1DA 2R4SL 3O41B 3CIQA 4BQ6A 1XV8A 3VUPA 1ZT1A 5D9MA 5EIQA 5B38A 1D6VL 3FT4B 4IIQB 5IMMB 4MD0A 2CDGA 4UIMB 3HJEA 3RVWC 5EWIL 2JIXB 5I1HH 3DX9A 1D5BB 3RDTC 2RCSH 4PRAA 2V9TA 3D3VA 3MJ8A 3TA3C 4HGWB 5EUKB 4MDOA 4UCFA 4QO1A 3S97C 1A6AA 1X4XA 2GJRA 4D3CL 5TDOA 5KSBA 3THDA 3IDIB 2QQKH 1KTLA 3GB7A 5IP4A 1KT2A 1C8QA 3FQWB 2EJ1A 2JF6A 3S3JA 1JUFA 4JHOA 3WD3A 4LXFA 1YJDC 5L7XH 3VA2C 2Y4SA 3ZDZF 1B3VA 3AHYA 1V0LA 2R69H 1Z5LA 1CIUA 4M93C 3O6ML 3F7QA 4NFCA 2XTJC 4XC1L 5D7JA 3VW3L 5D4YA 4L8BB 2FD6H 4F33A 5F88B 4LGPB 3NFPA 4GKNA 5EOQH 5JDSA 4GQPH 4TVPE 3VIKA 4X4XA 3LQAH 1MAMH 5B3JF 2VDQH 5JQHC 5I73C 3U36B 1KIRB 1T03L 5FM4A 1AXTL 4P46B 4HEME 1JGEA 2NSXA 1OM0A 5HVHB 3LQMA 4GRWE 4U6TA 4LEOA 3W2DL 4ZUWB 2XV6B 4I18C 3MGAA 4D3CH 5IESL 4PV9A 5IK3B 5JIHA 3PWVB 4U1IB 4OOZA 2GAZA 3S3SA 1NCWH 1LL7A 1A47A 1TQCC 3BAXA 3RZCD 1P6AB 4AM0A 1Q9OB 1R8LA 4EQ2A 3N06B 1HKJA 3WIHA 1P9MA 3HUJA 4O51A 2VXSL 5I0DA 2NTFA 1PW3A 2ZP0T 4YPJA 1I8MA 3IDYC 3MMEA 2OSXA 3EJJX 4UQ2B 5DEFB 1NLDL 3KE0A 3HC0B 4ZDHA 3KHQA 2WHLA 1OWRM 2I9TA 1QFWH 4JFOB 4D1JA 3RRQA 4TPRH 1WAAF 1Q9LB 4NM4H 1GGTA 4ZFFB 3JSSA 2W59A 2FNBA 5CP3H 3VG9C 1CYGA 1IAOA 1MI5A 2D4DA 3MV9B 1N3NB 2J8UA 1VA9A 4KPHH 5B38G 4PLNC 2YDQA 3U9UA 3DYMA 3TZVD 3VRIA 4E42B 1JHKH 3AFBA 3UTTB 1S9WA 3V7AG 4KRLB 1N5YL 2YL9A 2N7AA 4J3WA 5KAQG 1MLCA 2Z91B 3QJFA 4MJ5A 3O41A 5TH2A 1WFTA 2AERT 3TV3L 1DVFA 3V6ZB 1B3WA 3MRPB 5FYLH 2E7HA 5F7KC 4ZUVA 3U5UA 3NGBB 3P4OB 1NBVH 4Z5RA 3TYGH 2BFGA 4P7LA 4UFJA 2ADGB 1OL0A 3VXUD 2J8UF 5IESH 4PP2B 5D70L 3RUGB 3EDKA 3BISA 4XPTL 3W5MA 1MFDL 1CE1H 3ESUF 3MRBB 1MCJA 1KACB 3BQUC 1IQWH 1N0XL 1A7BA 3MBEC 5DQJA 5D7IE 3W0WA 1NUGA 5GGVH 1XH0A 3L3HA 1MIEL 6FABL 3S35H 2ED8A 5SWSE 1Z5LB 5J8OA 4NRSA 2VSDA 1QSEE 5F7MC 1SYVB 5D4QA 1GNXA 3UTZA 4P99A 5E8DL 4QWWD 1DE4B 2YPLA 4HULB 3OR6A 5H94A 4TX6A 3FFCB 5BRZE 2XIBA 2EKSB 3QOMA 2WINA 4H5SB 3HNVL 3T0AA 4YDLB 1WE5A 3H3PL 1OAQH 4L3CA 1PZ3A 5E95B 2H45A 3CFJB 2Y9RT 3VOCA 5I8OH 3RY6A 3DVGB 5J7CC 1YY9D 2Q8AH 2OTUA 1NGWA 4HEPG 5SWQB 2PKDA 1QPKA 1T66D 1A1MA 3B83A 4L3EE 4OLZH 2C1PB 2PCPA 3FZUC 4KKBC 2W9DL 5IVZB 1AXIB 1TZGL 2QKIA 3UBXB 3VO0A 4K23H 2WMFA 4FFYL 3DGGB 4UT9L 4JREB 4WV1A 4X7DC 3TVMC 2WZEA 3QHFL 1D5MB 5C6TH 4HIJB 3KXFB 4Z7QF 2IPTL 2VVSA 3MXWL 4MA3B 2DJSA 1R6VA 1HH6B 5C9JA 5CGYC 4TUKL 3CPLA 3WMCA 1Q8MA 1R24B 1BF8A 1QSZA 1JK8B 3C5SB 3QUZD 1MW0A 4I5BB 4YHLL 1QEWA 1FGVL 2AJVH 1CU4H 3PZGA 3BN9D 1DQTA 3MNZA 5TDNB 4AEFA 1S7TB 1I85C 2IBZX 3WNOA 3QQ3B 3MANA 2YUZA 4IRJB 2QQLL 3WO4C 3TIDA 4MADA 4JJ5A 35C8H 4Z7WB 5JPNA 1ZGLA 3HNTL 3JV4B 3ARWA 3H7LA 4FQLL 2I60H 5ESAB 5FK9A 3HZKB 5DHVH 2PNDA 2BVOB 1F42A 5AC4A 2P8MA 2WKLA 2HVJA 4OZGF 4GT7A 3GMRA 3WUBA 3AIBA 3GSNH 3FRUA 3OG4B 4YHNB 1P7QB 5E8EB 4S10A 4WI2A 2WBWB 4JY6A 4LCWB 5C0CA 3QJFB 3RIAF 3GJEB 5IEHB 3D39A 3FW6A 1JMZA 3AMCA 2BJML 3MRPA 4ESKA 1FVDA 5IB4B 1ONQB 2YK1L 1V6UA 4UBDC 2DWDA 4RAVA 4HIXL 3RKPA 4OZOA 2Q8BH 5BXFB 1CLZL 3RA7H 5GIRB 4I0PB 2DT2A 4NOFA 3WFCH 2YDRA 5JO5B 3WUWB 5IHUH 3TIEB 2Y5TA 5C08B 5JORB 3IK2A 1PZ2A 5F6HJ 5EO1B 4PJFB 5BVPL 4GIAA 4NQED 1ETZB 3HLAB 4HGMA 3HPJB 4CD4A 4WV1C 2KZ1B 3AROA 5CEYB 3UJTL 1CFSA 4PGEA 4GH7B 3DC0A 3FQUA 2IMMA 5ITFB 3UPCA 1ISZA 3C6SB 3IJ8A 1AD0A 3H6JA 2OR7A 3MPCA 4D9QD 5I19H 3TJEL 2B4CL 4LARH 3S36H 4CU7A 3FFCE 3WFCL 4DM1A 2EZ0D 1I85A 5JHDD 5T1DH 3AC0A 1HXYB 1ECEA 4JFDE 2DSKA 1T89C 4YWGH 2ZOXA 4JPVH 3QXDA 4MNJA 2XKSA 1KGUA 1XH1A 5J1AB 5EMYA 1WT5A 2R2HB 5E99L 3IDNA 5EB8A 1P69B 4GW4A 4O9HH 3VMPA 5INCB 2EC8A 4BA0A 4N5UA 5ILTH 1N0LA 5I1DB 2ICWA 3SCMC 3UZEA