3W81A

Human alpha-l-iduronidase
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
616
structure length
616
Chain Sequence
EAPHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-L-iduronidase
publication title Human alpha-L-iduronidase uses its own N-glycan as a substrate-binding and catalytic module
pubmed doi rcsb
source organism Homo sapiens
total genus 196
structure length 616
sequence length 616
chains with identical sequence B
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w81A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 3w81A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3w81A02
4FZ8L 1GHSA 1JHTB 4MQXD 1G9NH 3SDAB 4NQEE 3VX0A 4HLZG 3VWJA 2V9QA 3GSNH 1HHJA 5F7HA 3H7LA 3RIAF 4NC2B 4G9DB 4LLVB 3RTQD 2DT2A 5A2BA 1B0RA 4LSQL 4Y4HB 3AHYA 4H8VA 3LMJH 1ZHLB 5F72S 3L3HA 5EOTB 1YECL 5IOPB 5JPNB 1HH9A 1T22A 5JW5B 2ATKA 2YD6A 3N1GC 2D1ZA 4Z7VE 1WZMA 3DRQB 3RDTB 1J1XL 4HSQA 2EIEA 4D6GA 2V3FA 1KJVB 1P7QA 4QFUA 5D1QA 3ARFC 3C60C 4KJYA 1RZGA 1M71B 5KAQG 1OAQL 1EBPA 1CLXA 3QDMA 2WHMA 5EOCH 3SGDI 5A8NA 4RRPG 2XFXB 5HYJE 1AKJB 1Z3GL 4JG1H 3WO3B 4XCCL 2VLLB 3C5ZD 5LBSH 4R97B 3DUHA 3IFLL 4RAVB 4XX1G 4I18B 1UYWL 5EG6C 1H0IA 1FNFA 3MZTA 1BAFH 1LHZA 2GQHA 3OGRA 1XGUB 4FP8H 5DJYB 3V5DA 4CL7A 3WF3A 3ILPA 1QRNB 2DQTL 4NRZA 5BRQA 2FGWH 3P4NA 1A7NH 2H26A 1A6UL 5JR1H 1UCBH 1GC1C 3G5XA 4N0UB 3QR2A 1GJIA 1E6JH 3AIWA 1P4BL 2IC2A 4K07A 5AYIA 5T1MA 2R56H 1BAGA 3PZOA 3WKNA 1F4XH 4JB9L 3RUGF 4WSJA 1A9EB 3GB7A 2LFGA 4DFHA 3RL2B 1TMCB 3OAYK 4WHYH 3T3ME 1T83C 1BOGB 1FH5H 3MV7A 3BDXA 1NP2A 2J8UE 1FA2A 1AHWC 1IEBA 3EKCA 2IXUA 5C0DA 4Y5XC 3OTTA 3SGKC 3FMGH 4LSPH 1N26A 2OX5A 2W5FA 2GTWA 4WI8A 2D7NA 3ALFA 5HVHB 3QFJB 2RR3A 5IFJA 1BBJB 2R1WB 4OD1H 5KVDL 2D3VA 4HS8H 1U30A 3HNVL 1BHGA 1KJ2H 1JGVL 1GVIA 1JCKA 1AGFB 3D9AL 4L8DA 4QRUB 3I50L 4D1JA 5M7QA 1WZAA 1JGEA 1CVRA 2W4XA 5ADPL 4LSVL 3I9GL 3O6FB 5IGXH 1GHFL 5DJ2A 1NANI 2NYYC 2EEBA 3UPRB 5SWSE 3DX7A 1HINL 4MJ5B 3EO0A 3OKLA 5FK9A 2EIDA 5GZOD 2VRJA 2C5DC 3CFIC 3VI3E 2EXWC 1G9NC 1DJSA 1T04B 3U5UA 1GGCH 1CICA 2V5RA 3C09C 1DLHB 4UZUA 3THDA 3BPLC 4PJ7E 1CL7L 5A43C 1WCBA 1NCTA 1BD2D 4WWKA 3V6FA 3SKMA 4RISH 1WAWA 1H15B 4HT1H 3HZMA 4PRBB 4PB0L 4HKXB 2WMGA 5HOSA 3QHNA 3FB6B 4MVBD 2K3TA 1I9IL 2WIIB 5TE7H 2PO6A 3ULSA 5KW9H 3LQMA 4PJAB 1FVCA 5ABDE 4NUJB 3OR7B 3C6LC 2DQJL 2R0LH 1QNPA 1NDGB 2VDMH 2EYSA 2IAMD 3H7BB 1J11A 3OXRA 3QUKB 5TJWK 3BPNC 5C0GB 3WD4A 4ORGB 4I3RH 3OXSB 1LO3L 3PWUB 1YUHA 4JY5H 5FCZA 2DWDB 1KGCD 2VNCA 2ZNWA 5HHOE 4XX1E 3QIUB 3CHFA 1A3RL 5CXPA 2PXYD 5EU3A 1DBKL 4Q0XH 3VMOA 2XSBA 4Y19A 4JZJC 5HGAB 3PL6C 1GGTA 3GSUB 3ES6A 4HWZA 4L4VD 1F02I 4ONGL 1W3LA 3STBA 4ZUSA 2GUOA 4KGJA 4JFQA 2VLKA 3SCSA 4LSUH 1I3VA 1R24A 3V5KA 4GMTH 1NM9A 4OLZH 2D0FA 2YLAA 3BXWA 2W65B 4YBQC 4JRXB 4V28A 3MRJA 5DZOA 2OLDA 2QPUA 1MQRA 3WS3A 5J9PA 1KXVA 3MV8A 1YNTA 4RGNB 3LN9A 4DM1A 1QFWL 2IWGA 2ORBH 1LO0L 4Z8FH 1RJZB 4NNYB 4F33B 4WFHE 1MCSA 4NBXB 2BHUA 3HE7D 1YN6B 4LEOA 4H25B 4EUPH 3CLFH 1AGCB 3FT2A 4PTTA 4X7EC 5T1KA 5EUOA 1RIUH 1S7TB 5DQJB 1DWHM 4PUEA 3B4NA 1AH1A 1EEYA 3TYFB 3MLRL 3LEYH 3PJSB 2W92A 2IPUK 1ED3A 5HVFB 3S88H 3NZ8A 5FYLH 1W0YT 4APQA 5GRWA 1Y0LB 4LIQL 1G6RL 4Y16B 3TOPA 1P1ZB 4FLOA 3VCLA 2H9GA 4IRJB 4XNZB 1CK0L 1GGBH 3SDDB 4KHXH 4OSUL 5DD3L 3ZKMD 4YZFF 2DM2A 4N0RA 1WC7B 4Z77B 3SUVA 1S7XB 4HP5A 2FWOA 3BHBB 4YUEL 5I17A 5DD1H 4O02H 2VLJD 5C0BA 1ONQA 4JFXA 1QFOA 2CUHA 1WTLA 3WXVL 4HHAA 3IU3B 1F8TL 3B5GA 4PJAF 5GS0L 1OGSA 1D5IL 1T89A 5IB2A 2ICEB 4WUUD 3KPRA 2R4RL 4H5SB 1I8KB 2G2RB 5I8KL 4TNWF 3NVQA 5E9DE 3STLA 4Z7WB 2NXYC 3O9WB 1L0XA 1NANH 3OKEA 2Q7NA 2Z91B 4V2CB 4F9PA 1E6OL 5C86A 2BNQE 2MNUA 4Y1AD 4MZ2A 3M1BB 4OM0H 4WTZG 4K7PL 1NBQA 2VB5A 1INDL 2P8PA 3WIHL 1QA9A 4G80B 4U33A 5I2UA 1IM3A 1S5HA 3MFFA 4AEEA 2P8MB 3EOAB 1FZKB 1EFXB 5IXEA 3WJLA 4YHPA 2BSED 3RKDD 1N5YH 1S9VB 8FABA 3ROOA 3RJDA 4Y4KD 1I1FA 2AK4A 1CBVH 5I1GH 5ELIA 1QOXA 3SCMB 5C08D 2J25A 4BZYA 2R0WL 4PJ5B 4CAGA 2A77H 3VIMA 3U7VA 5FKPA 1BFOB 3BPOC 3VXRE 4KUZH 3CFKA 2YKLH 3JV0A 1LGVA 5TF1H 4N90D 3ZMRA 3BXNA 1G7QA 3PUCA 3HG1A 4HMCA 5DTFB 3TZVD 4IMLB 2HG5B 2KUTA 5KANI 4XP4L 5A2LH 5TDOB 1NDMA 2YUVA 12E8H 2XIBA 5JQ6H 1NUFA 2EC9T 5EN2A 4YDKL 2VJXA 1E0WA 3SGJA 4P46C 5DR5H 1FNHA 2D7OA 3G5VB 2CK0L 2Z9TA 1INQA 2YD8A 2FYYA 2FX9H 3KLAA 1IEAA 5CCKL 2XTLA 2VC2H 2IPKB 1EHXA 2A83A 3KS0H 4AK1A 2E7LA 3QDGE 4DAGL 5SV3A 1BQHA 2A6KA 4J3TA 4PRDA 3FO0H 1X5IA 5I1JL 3S8WA 1BF8A 5IQ9A 4FQPA 3ZSSA 3QZWA 4XP5H 3G6JB 4FQJL 5KZCB 5EFIA 4OUEA 1IGYA 5I8OH 1UXSA 3OGCB 3VIGA 1V7NH 2AS5M 2Y7QB 3RWEB 5IWLC 3U0WL 3TNNA 4GKZB 4WRLA 5BVJA 2ZUSA 3GKWH 1V08A 1H8NA 3EMCA 4ONFL 3LKQB 1A3LL 3LCYA 3P3YA 3ZDZE 1TVHB 3H0TB 1C92A 3KPSA 1C12B 2A73A 2YPLB 1SJHB 2F54D 3VD3A 4JFEA 4KVCH 2PC8A 3RO8A 5INCB 4LAQH 5ICYA 5F1SA 3WSQL 4AL8L 3WNNA 5EULV 3NCOA 2P4AB 4L8BB 3O2VH 3WEZA 4LVNC 4Z7WF 5FYLE 1GAFL 2IG2L 3MJ8A 1BQUA 1KLFA 4TSCH 4BZ1H 5DJ0B 3O11B 4PGZA 3PNWB 3O8XD 1MI5B 1RVFH 1J05B 3CFDB 4YEEA 2EEAA 4KDTC 1VEMA 4N0YL 3I6GA 2H41A 4M5ZL 4U1IA 1W0VB 5LQBL 3VIOA 3V79C 1GGIH 3UR7A 3L4YA 4L3EA 1F45A 4CVWA 5ERWB 1EUUA 1UM6L 1VACA 3LKRB 2J88H 5C09B 1HJWA 4HKZA 4MSWB 1XRVA 1A3QA 4WI5A 1KC5L 4AIOA 4Q2ZA 2G4FA 3CO4A 4X5WA 1NGYB 1SJVA 4XWOD 3SIMA 4C7DA 3NCJL 1HOCA 2NW2A 4ZS7H 5INDB 1U93B 1JIBA 3RIAK 2OTUA 1MCOL 3QUMA 3EDEA 2O92A 5HGHA 4YO0A 4GG6E 5FHBL 3OR6A 3I6LD 2DGAA 1LE9B 4MDIB 4TVPD 2AJUH 3UG4A 3PGCB 1ORQA 4JREC 4LCWA 2FBJL 4GBXB 4F3FA 1N6QH 5H94A 5IVXB 2NMSA 4NKQB 1YA5A 5AYBA 2ITDA 2VITB 4OCXL 2X2YA 4YHIB 1KV3A 1EHLL 4K7FB 1MFEL 1FG2A 1D5BA 4PJ9C 4P2RE 3TA3D 5CBAA 4XZWA 4J4PC 5I1EL 2UZIL 2X1IA 1DP0A 1ZT4B 1BF2A 3W5NA 4AZ5A 2DQCL 3VXTA 4G8GE 3IFOA 4XMPL 5ECUA 3O3UN 3WUWB 1GPOL 3NABL 5IEHB 4FFZH 4JO4H 3J7HA 2B20A 1UB6B 3G6JF 3TYGH 2BCKB 5IK3A 4KKLC 4HCRH 2ICWA 4EVNA 2VDPH 2ADGA 4LHUB 3OJDA 5F1KC 3VFPA 3TH2T 1OARH 3D0VB 4OZ4A 3CDGB 1HXJA 3BLKA 3VTRA 2JE8A 4DUVA 3OAYH 4JFHD 3DXAD 1L7TL 1QSEA 3AXHA 3PQYD 4E41D 3BC9A 3OZPA 4OZGA 5K9OB 1U91B 1ZXQA 4HJJH 3PWLA 3DOSA 2AQ2A 1P4LA 3CTTA 4YR6B 3C2SA 2RFXB 1PGRB 1FIEA 2I9LA 4R7DB 4WEBL 2DIEA 3WD2A 4WUKH 2CKRA 2VZOA 2XKSA 4YHOH 3TVMB 1QFUL 1E1FA 1C91A 2E3ZA 4Z7QE 4PGEA 1ZANH 4P57A 4P5MA 1KBKA 3QG6A 4OI8A 4K8RD 3AU1B 2W60A 2G9HA 1DQMH 1UD6A 1S7QA 2QQNH 3INUH 1JF1A 1CS6A 4GINA 2DN7A 3C8HA 4MNGB 1VKXB 3ARSA 1GJWA 4ZFOA 3G9AB 1ZT1B 4MJ6A 3CAFA 1ZVHA 3QUXA 4MJ2A 2YPKA 5DVKA 1CQKA 5FA3A 2J1KA 4ZFZA 1XF2A 5I73B 3CMJA 4A3YA 2JB6A 3HE6D 5FGBC 1ACYL 5F9OH 2XY1A 3ARTA 4JY6B 5C0FB 5I76A 1S9KC 4ODSL 3VD9A 2LU3A 3BI9X 1X6NA 3QIWB 5BRZB 1TVNA 5BVPH 4Z76B 1PQZA 2IBZX 4KQ3L 5IJKC 1CGWA 1UH2A 3RRQA 5JW3L 3HCVB 5IQ7L 2GJ6D 2X09A 5E09A 1HH6A 2J2ZA 4YHYC 4KFZC 3MNVB 4MA7L 1NEZB 1QO3B 2VXTH 1U92A 3QNZA 4FN0A 5TH2B 4Q9QL 3MOAL 5IVXF 1TCRB 4KAQH 4KI5F 3G6MA 5TDPA 5H37H 1KPUA 1HHHB 5HHME 3RGVA 2R0KL 4PJXB 3SN6N 4TSAH 3WELA 1AGDA 1UKQA 1V7MH 4HDIA 5TF0A 5DC9B 4NZJA 3LS4L 1A9BB 1ZHBB 2GFBB 2VR4A 4X9FA 3KPLA 3MXWL 5J6GB 3BGAA 1IM9B 2NTFA 1M01A 4XNYH 4Y5VA 4FQXB 5MERB 1BQCA 1TA3B 5KOVC 4HU8A 1UKSA 3RPMA 7TAAA 1NAMB 2RBLA 3HMCA 1C93A 3GSNA 1LWHA 1KCRH 3MRPB 4NM8H 4B3KA 5H37G 4PG9B 2DH3A 3FKUS 3TV3H 1NOFA 3DTXB 3RVXC 2N7BA 3DX8A 4QXUH 3JTSB 4ZFFA 3GMMB 4M6NL 2WUCL 2UYLA 2A6IA 1LG2A 2VLJA 3DUSA 4EI6B 3FONA 2BXZA 2YXFA 4LARL 4PGCB 2OYKA 4JKPL 4X7TA 3BUYB 3MLXL 1T80A 1BVLB 5FAAA 4K68A 2WHLA 4MQ7A 3WEXA 1KPRB 1T6VN 4DWSC 2LABA 1OAUH 2P45B 2YUXA 3TIEA 5CD5C 2ARJQ 4CVXA 1DBAH 5DUMH 1KJMA 4N8PA 4P7QA 2DL9A 1U3HB 1PW3A 1FFQA 1V02E 1JGLL 1UWTA 5DUPH 2P5EE 5K59F 5IBUG 1OVZA 4DZBB 2E0PA 1IGJA 1IV8A 1LE5B 1CTOA 5BZWA 3VFSB 2OSWA 5DFWH 3IFNL 2VLRA 2AAAA 4RGMC 2CIIA 2IH1B 3FN3A 1ITXA 2FL5B 3BQUD 5K9KB 4JFDA 4RWHA 1ZHNB 3MUY1 1YQVL 5DVNA 1NC4B 3WFBH 5IG7A 3O2DH 2WLZA 43C9A 4JPVH 5DRWB 2W63A 1RZ8B 3U79A 35C8H 4AENA 1NQBA 1IAIM 1HI6B 4AG4H 4BH8B 1CDYA 3OKDA 4P9ML 2D7TL 2VXQH 5A16A 5D96C 1W1VA 2GSIB 2BVUA 5JA8B 2FDMA 2GTZA 4C83A 1LDPL 1ZL1A 5AYUL 4C55A 4P7NA 1KG0B 4MJID 1EQPA 3G5ZA 2IALA 3UBXI 1ND0B 4P59L 4BQ2A 3FFCE 4O4YL 2ZUWA 4PJXF 4XVJH 2OP4L 4LEXL 3RJQB 4UOZA 2VXSL 1EJ6A 1T1XB 3MROB 5T3XD 4AIZB 2H3NA 3D3VA 4JY4A 5EO9B 1MF2H 4AEHL 3M46A 2FJFA 1PKQE 2VDQL 5I8EA 1DVFC 1UZ6F 3RWIB 3LEXA 4Z0BL 5AZEH 4TNWK 1NBZA 2BVOA 4YFLF 4XTRC 1Z9OA 4IRZH 2HISA 4XHJC 2CYGA 5GGRB 9CGTA 1N0XH 4FTVE 4AH2A 4AY0A 3KJ6H 5J0BA 1A7OL 1R3LB 4N8VA 3QPXL 5GS0C 5KG9A 2NX5E 4HUMB 2CGRH 5FYJL 1QW9A 1A1OB 2DTMH 4ZAKB 1RIVH 1DWGM 5DEZA 2ZJSH 1R8LA 3UXFA 3B83A 4RQQB 3O6KH 1AO7D 1XD1A 5F7FA 2L4OA 4LBEA 5F1OB 3T0XA 4JO3H 2O61B 2FJHA 3T1FA 4UR9A 3D69B 4PTUB 1YY8B 4BSVB 1RUAH 2YIHA 4W7VA 1JNHB 1C8QA 1NCDL 1QLRB 5F1NA 1EDTA 1RUPL 4LGXA 2IFFL 3KNBA 3DGCR 4U1KB 1RIHL 3VIJA 3L6FB 2V3GA 5A1AA 3AXXA 5IESH 5F88B 3TN0D 3S6CA 3AREA 4RMRA 1KCKA 2ITCB 3IDJB 1KB5H 4OM1H 3CFJB 3F7RA 3QQ9C 1A0QH 4PRHD 4P2OD 3PP4H 3RX7A 3FQWA 1RJLB 2VR5A 1Q4NX 4X9HA 4MNHA 4PV9A 4JKMA 3QDJD 4XPTL 1XGYH 3DBXB 1J8KA 1JWUA 4YC2B 5DC0A 4I0PD 4XP9L 5LAXB 1CFQA 4M3KB 1HILB 1W9VA 3VH8B 4U31A 3MNWB 4RFNB 2APVA 5ICXA 1AXTL 3L5JA 2Y36H 3NA9L 4GXPA 2WWDA 1FLRL 3UEQA 4WFFE 4XNXL 4PLKD 3VXSD 1NMCC 4ETYA 4HA4A 4BSWB 1KPVA 1B3VA 5I1AA 4C4KT 1FNGB 3SO3C 3U83A 3DMMD 3BCDA 1C16A 3RP1A 2IANA 2NY3C 3IXAA 2JELL 1B0GB 2A6DA 4K3HA 5CHNA 5D6CB 15C8H 2PYEB 1FZJA 2F5BH 4UT9L 3EJJX 3K2UL 2XQYG 3OKKA 5EBWA 3CX2A 4GW1A 4HWBL 4MAUL 2BOCB 25C8L 3OKNB 1I1YB 2B39A 1J8HE 2CJUL 4EUPA 1LILA 1CXKA 5LGJB 3AIVA 3TA3A 3H9SB 4AD4A 4GZEA 1QSFB 3P4MA 2CO7B 5I1CH 4AZ8A 2R1YB 5E8PA 1FN4A 2C26A 1KIRA 3VJ6B 2Z35A 5JLZA 2CHOA 1WBXA 4MXVF 2FIKA 4JLRB 4ZQKA 4IOIB 5TGBA 3FB7B 5C07D 1NQ6A 3X17A 1C7SA 3H9YA 4MB3A 2WLYA 1N64L 2HT4C 4PRAB 4HFUH 2A1WL 4WY7L 1T1YA 3BDYH 4XI5C 3K46A 3AQUA 4PTMA 3AGVA 1T1WA 2DQGL 2E4TA 5BJTA 4Y4FD 5J11C 3EOTL 2NLJB 1HIMH 4BFGA 1K5NA 3MPCA 3OPZH 1XIWC 4O2EB 2L0DA 4A6YB 3E8UH 3D18A 5F71A 3BYTA 1IC5L 1TVBB 5IMKA 4Z7OF 5JHDD 1F2QA 5EC2A 4YQXL 1R3IH 4ETQA 1F90L 4LSRH 5DJCA 4HPOH 3MGTA 4QHUB 2GVYA 4L1DA 5DHXB 2XY2A 3MRQB 4D9LL 4ZD3L 4KKAC 5CZVH 3B3IA 3TBVA 2CLZA 3MSPA 2DLFL 2AQ3A 2ZG3A 2HFGL 5L2KE 4I8DA 1P7KA 2CQVA 3OA5A 3FY1A 4D8PA 3KJ4C 3MLZH 2C3XA 3DV4B 4NO2B 2E5EA 4XPFL 4R4FL 4QHLA 5L6YL 3MACH 1YEHL 1DANU 2Z31A 4HX1B 4K94L 4GRLD 3QI9D 5I74C 1CQYA 3CUJA 1LO2H 1YMMD 1MJJA 2OQJA 5BW7A 2D2OA 1EEZA 1RK0A 3MBEC 4K23H 1H0DA 3LKPB 3MRFA 4NHUA 5MEPB 3UTPE 4JE4B 2LU7A 1BG4A 2WAHA 1JYVA 1SBSL 3CVHA 5KVGL 2XIIA 1GW1A 4UUJB 3MO1A 5ABFB 1OW0A 3S5LG 2P7TB 4FS0A 1UHVA 1O7SA 4WV1B 1A1NB 5D8JH 3ECBB 2WMHA 1YNKL 2GSJA 1AGBB 4JPWH 2BNJA 5KEZA 2C4XA 3SKOA 3WH7A 3L9RB 3ZQ9A 4PJEB 1RV6X 3GMQB 3X14A 1K4DB 2EC8A 2VDOH 1MHHB 4S3KA 3ELAT 4TPRH 5A8OA 4H26B 3IS0X 4JM2B 4XCEB 5C0NC 4ZS6C 4J7RA 3DURA 5E56A 3SE4A 1UUQA 4NDMB 4OCWH 1FPTL 1G7IA 5D5ME 5E8EA 3ZHLA 3DV6A 3WMBA 1I7RA 5LWYH 5IW1B 5FXCH 3SJVA 6A3HA 5FGRA 3RL1A 1KCVH 5E24E 3GMRB 1EK3A 4NN5C 4EIGB 1GQLA 1NCCH 4HIIB 2EE3A 4JZNA 3TWCL 1UVQA 3FCTB 3MV9A 3CFEA 3QO1B 3OJVC 3QEQB 3L4VA 1CIUA 2XQBH 1A6TA 5ABHA 1JG9A 5IV2B 1T5WB 5D7JC 1NCBL 5ADOL 1Z9SA 1A4JA 2WWMD 5GGQH 5GGSA 1CFTA 4H0GA 2YPVH 3A6BL 1KTLB 1HIZA 1MFBH 3U0TA 2ZOLB 3NAAH 4O5LH 4F15C 1FZMA 1A6ZA 1XF5B 4QHKI 3QCTH 3JTTA 3ZE2F 4CW1A 2VXVH 5DQDH 5JIHA 3B2UC 1OSZB 2AABL 3T0EB 3HAEB 4KPHH 2EDEA 3U30B 4PGDA 4EK7A 1MRFL 2IH3A 2MKWA 3CSGA 5JUEH 1MCIA 3QJHB 4XCYA 2A9ML 1QSZA 3GHBH 1DZBA 5DMKB 1ZS8A 2VZUA 1GL4B 4JL1A 5CEXB 4NNPH 4PRWA 5D1ZA 1NLBL 1CT8B 2JJUA 1WQVT 1OGAA 3WBEA 3MRBB 1J5OL 1E4WL 5D8ZA 1HEZA 4C7GA 1K6AA 2E6PA 3SBWA 4PRIB 3BWAB 4U6TA 3D87B 4NKOB 4Y5YA 4ML4A 3RBSA 4NWUH 4GQ9H 1EGJH 4LDEB 5E99L 4CCDA 2QHRH 2XWJB 1BWWA 5E7FA 3BLPX 3VRIB 4KHTH 4U1HB 1D9KA 1F4WL 5HYSA 2DM7A 2JLLA 4P5TD 1YEEL 2DWEA 2C1PA 4MAYD 4XGZA 3ARYA 2IQ9H 1EPFA 5C0EA 1UWRA 5D7LA 3RWCA 4M1CD 4QOKA 4Z5RA 1QOKA 2BNUA 1FYTE 4PR5B 2CMRH 5DFVD 5MI0C 5CIPB 5DT1H 3FRUA 1V3IA 1YHTA 1YDPB 1JHKH 4PS4H 4PJEF 1EJOL 4GAYB 2QQLH 2VQUA 3UJJL 5J89A 4RMWA 2VVNA 2AAVA 5E5MA 4X98B 4IJ3B 4JM2F 2XN9E 2DM3A 2JKXA 3ARGD 1UZ1A 2ZXDA 2R29H 1H3PH 4W84A 4FZEH 4FQ1H 3GMLB 5F3HA 1NMBL 4NT6A 4X4ZA 4U1SA 1MCFA 4OLWH 2DQUH 4PRPB 3RUGE 4C56B 2O5ZH 3UTQB 4NFDA 4S1RH 2ZOXA 5DA4A 4Y7EA 3AS2A 4NM4H 3CZKA 1A4KA 4HCRA 5CP7B 5GHWH 3SKUD 3I84A 1OAXH 5ALBL 3ARVA 3O3DA 3GGWB 4MWFB 4TYUA 4X4XB 4ENED 1ADQL 4RFEA 4G5ZL 1U8OA 3PZTA 4U5KA 1UXWA 3IXTB 1U0QA 5CS7A 1KBGH 4EN3C 3RNKB 5HI4D 4F8TA 2DD8H 2WAGA 5C0CE 2W9DH 2COQA 4ODXB 1B88A 4PJDB 5F7DB 5JOEA 5E08H 4ZE4A 1KUMA 1EHAA 2BS9A 1F4YH 1Z5LB 3P9MA 5AD0B 3F6LA 2CBUA 5TPWL 4JQVC 3NOIA 1X7QA 5FF6B 1K2DB 4OZOA 2NY6B 1UG9A 1B3WA 4LSSL 4DKEL 2CCRA 3GRWA 2OR7A 4G9FD 4NQDD 4R7NB 4WU5A 4D0BA 3TBWA 1GXEA 3QXTA 4Z7UB 4B16A 2NY4C 3D2UD 4OF6A 2HAZA 2GK0B 1D5XB 1DL7L 2XWTA 3FZUC 4HGWA 5GIRB 4B50A 2NW3A 4JN1H 5AAMA 1X5GA 5MEOB 4M5YL 4S1QL 3D0LB 4KRPB 5IFPA 1CDGA 5IMMA 4R97C 1F42A 2Z93B 4I18C 4JHWH 4KMLB 3HMXA 3RWJA 3EDFA 4U7MA 1K8DA 2XTJC 3VXSA 2PB1A 5E8DL 5ID0A 1VGKB 4L4TB 3QIBD 4MXQD 4XB3A 4MD0A 5L88L 4MNLA 5M5DA 4PJFB 4LRIC 5CP3H 4PJ8D 3SDYL 3VWKA 1DEEA 2UVEA 4UV7H 2AEPL 3P9LB 3R8QA 5BRPA 1OGGA 5F97E 5I71C 1Q1JH 4QTIL 1W2KT 4YDIL 3C87A 4MNQA 2X4QA 3MGOA 2R2EA 2XOTA 4GPNA 2XTJE 1L7IH 3RVTC 3FT3B 4KQ4L 4NO0B 4JRYA 5E2WL 5B38A 1UWUA 1DQLH 3H3BC 5I1HH 4N0UE 2CKBB 4XNUL 2FX8H 2QKIB 1WFOA 1IQWH 4PY7A 3K74B 1JWMA 3D39E 5E1AB 5HHNA 3W11D 3WH9A 5I24A 3LPFA 3WKZA 3QDAA 4HUWB 3SKNB 3VVGA 3RZCD 2AXJA 4MYWB 3RNQB 5IFHH 4EKXA 4UFJA 5FYJE 3HRZA 2C3GA 4JM4L 1PX3A 5EORL 5TE4L 5IB1B 4V2BA 4YPGA 5EZIH 1A6WH 4NQUA 5M95B 4OD3L 4ATDA 5E2TL 5B3JF 4G43B 4NQED 2GY5A 1GQJA 1A6VH 5TDNA 2ZUNA 3O6FC 3TA9A 3ARBA 4OI9A 1AQMA 5GGUA 4WHTA 1R3HB 3MRHB 3W39B 5KSBE 3AAZA 2CIKB 3KPTA 4PJDF 5C6PB 3X3GH 3DROB 4QT5B 1YEJH 3UP1A 2P47B 4P23A 3VW3L 1F3JA 2GW5A 3VFVA 3LB6C 5KSVA 1HKJA 1FHDA 3GMOA 5CLTA 2HFTA 4K3EH 5I19H 3ZDXE 3TCLA 1JPSL 1YEIL 5J56B 3BGMA 3LKSB 2G41A 3EBAA 4Z7UF 2YD9A 3UZEA 3M8OH 4TVSa 4Z0XA 4P2QA 4Y2DA 1DSFH 3LIZH 1JPST 3TO4A 5JPMA 5A6AA 1ZVSB 3BKML 2ZCLL 2X41A 1SM3L 1V8HA 3GIVB 3THMH 2F53A 3B9KB 4G6ML 2J6EA 2ZX8A 1QFWM 4YZFE 5DEFB 2BRQA 4ZUVB 1L6ZA 5J1AA 4JFFA 5MENA 1NC2D 3SDCB 1N59A 3RY5A 4JDTL 1DTUA 3ARFD 3C60D 2YDQA 3OLIA 4OLUH 1L6XA 4RMUA 4PJFF 4G6FB 4JG0L 1TZIA 2KDGA 2DYPD 1P4IH 5C7XH 1SEBB 4PJAE 2RQ8A 3SCOA 1MHCA 3T2PA 4D0CB 3E1F1 5D1XB 1M7DA 3QUYC 1BLIA 3LEVH 2ADFL 1CZ8L 4AIUA 3FQNB 1OAZH 4M93B 2H6PB 4JHAL 4WW1B 3TPUA 1FVDA 4I2XA 5FKAB 3FO2A 3O4LB 4DK3A 4W86A 1QBMH 2ARJB 3L2MA 4OFVA 4QWWD 4U4BA 4L9LB 4P5KB 4RGNC 3QWOA 3GNPA 3CC5A 1BSIA 3BJ91 2DT3A 2YLLA 4DVBB 2DS4A 1J1PH 3BAEH 2A9NH 2QSCL 1U8HA 1T7ZA 1JN6A 3MUGA 5E6ID 1HHJB 5JW4R 1JPFA 1XH3B 2F74A 2GK1A 1VFAB 4YK4B 4O2CA 2GI7A 1LO5B 4Z2KA 1B0RB 3CU7A 1BJ1J 2VQ1B 4OT1L 5DJAA 5C9KA 4K55A 4JRXE 1ZV5A 4POZC 1XH2A 3R4DA 2IGFH 3W37A 2XG4A 1UFUA 1CLYH 4RGNE 4U1LA 1UWEH 2QV4A 1HH9B 3SDXA 3PHQA 4MS8C 5L8KB 2X1OA 2P24B 1BMGA 1PEWA 4M7JL 4PB9L 2HJKA 4XMKH 3FOLA 5SWSD 5IIEA 5EBLB 4Y16C 4K71B 3ZJKA 2DQFA 4NQCA 1I3GL 2WKGA 1OY3B 1RZGB 4KJYB 4KI1A 1AY1H 4HK3J 1OWQA 2QTEA 4XNZC 1Q72H 3KGRA 4KY1L 5IW6A 3QHTC 1XGQA 3L4WA 2Q87A 1KB5A 3UYRH 2WC3A 1VHPA 3WJJA 4J6RL 5C2UB 1J9CT 2HLAA 2NYYD 4IRSB 5KVEH 2H1PL 2XWEA 5IMOB 3OAZH 1LG1A 3V5DB 2A74A 2C4FT 2G75A 4NRZB 3IF1B 2EXWD 1DWFM 1SEQH 1Q38A 1P7HL 2H26B 1RAMA 2OL3L 2NT1A 4K7PX 3VO0A 2JALA 2P5WA 5FUOH 1KN4H 3FQXA 5T1MB 1ACZA 1I3RB 3AY4A 5IJVA 4G8FA 5DJXB 5IDIA 5FV1L 2EKJA 2NY7H 4YFLI 3GB7B 2DICA 5HHOD 4NZUL 3TTSA 4MAYA 2AJXH 3MBXL 3WQ5A 2AJYL 2G8ZA 4F66A 4MGXA 5D6DA 4XPAH 3C6LD 1UT9A 3ARDB 5E2VL 3OJMB 1I9RL 3L1OL 2QSQA 3NCMA 4YGVA 2BVTA 1IEBB 1KLUB 4Z7WE 5C0DB 3CX5J 4J3VA 1IT9H 1ETZB 1MJ7L 2VRKA 4W8LA 1RK1B 2X4NA 4YE4L 5IFJB 2BJML 1WWAX 5SWZB 4QRPA 1R5VB 2DSUA 3G5YB 3O0RL 5IT2H 1ERNA 1KSRA 3QNXA 3DRTB 3B6SB 3PL6D 4L8DB 4L8CA 1QI2A 2XZAL 2OWXA 3SUUA 4WFHD 1BG9A 1MW0A 3UTSA 4ZEPA 5DURB 3JWNC 2LU4A 4JN2A 1GCYA 5L2JA 3K7UA 4PJ5E 3EO0B 4YBQD 4ZOBA 5FK9B 1TMQA 5T3ZH 2MJWA 4RIRA 2R1XA 3QOKA 4PLJC 3UBXA 2J8GA 1QBLL 3N1FC 3WDIA 3I2CL 1F3DH 1HWHB 5I16B 2WSPA 2WBJB 4WWKB 3SKMB 3OLGA 3JV5A 3E6HA 2J5LB 1HNGA 3LQAL 4MMZC 3UROR 1YECH 3WHE0 1MLCA 1CU4H 1FNEA 2DKSA 2EH7H 2YD3A 3N1AA 3ULSB 3QA3A 3VE0A 5CEZH 2WWCA 1PG7L 1JI1A 3EOBA 5FUZH 1FZOA 1FVCB 4PRNA 1AQHA 1TJIL 2FATH 4OLXH 3A6OA 4OCYH 4PMNA 5ICZB 5A6BA 3SQOH 1JP5A 2EYSB 3OXRB 3UZVB 4UIKL 2D4FA 1V6VA 1BZ9B 3EDJA 3P73B 1VERA 4DKFL 1FL6A 1MCHA 1YUHB 1IGTB 2VH5H 1E55A 1Q6DA 5F7EH 1UYWH 4NNXA 1INEH 5MEQB 3BZFA 5E9DD 2R69L 5JORB 1UZ8A 5D70L 4LPYA 4Y19B 2D9CA 1CLOL 3ES6B 1NCUA 4HWZB 4KTDL 2DIBA 2BNQD 2VKXA 2ENYA 4ZUSB 3DSFL 2YPLE 4LQ1A 2VLKB 3DI3B 3M07A 3Q5TA 1UKOA 1R24B 4NGHL 3V4PH 1YC7A 4XP6L 4CCEA 4YFEA 2WBGA 1GSMA 3MRJB 3N13A 3GHEH 4L4OA 1ZLUK 1R0AL 4DGYL 3WS3B 5J9PB 1FH8A 1T2QH 3FB5A 3MV8B 1YNTB 1LDSA 3KWWA 2NXYD 5DD0L 2NT0A 3EYFB 2BV9A 2UY2A 2VURA 4QLRA 3G6AA 3OQ3B 4NO3B 3W0WA 1WDQA 4IHOA 1S78C 1KELL 5IEKB 1HSAA 4JQXA 3VXRD 4E5XA 1HKFA 1UENA 3T8XA 3EYOB 5EUOB 2XG9A 4BQ8A 2VX7A 1TJGH 1YPZB 5JA9A 1ED3B 1G7JA 5EU4A 4OCSH 4GBXC 4YNYA 1OB1A 3NZ8B 2Q86B 1NEZG 1JHTA 1U41A 4YDVB 4KI5C 1VSCA 3SDAA 5DFAA 2VX5A 4N9OB 1NAMH 2YUZA 4BQCA 5JXEA 2FRGP 4S11A 5J13B 2H9GB 1T6WA 4NUGL 3VNYA 4G9DA 4YHZL 2DQHL 4LLVA 2OYMA 4MADA 3P0YL 4Y4HA 4Z2GA 5I1IL 1HINH 1MWAB 1ZHLA 5E03A 2J47A 1BZ7A 1TFHA 5EOTA 2E6JA 2FWOB 5JPNA 3BKCL 1JF6A 4X9YA 4F9LC 3QDGD 5IVXE 5C0BB 3QUZA 1ONQB 4LSTH 4XWGL 5JW5A 4KI5E 2W61A 4JFXB 4ODVL 2W62A 3FT4A 3VFWB 3BAIA 5GS3A 4H8WH 4P46D 1IGFL 3DRQA 5EU6A 3RDTA 2GJRA 4NPYB 1Z0NA 1JNLH 1KJVA 5IB2B 4HUVA 4GSDL 4CDHA 1LQ0A 1JZ3A 1OLZA 2QADC 5E5UB 3IVKB 2ESCA 1Z9LA 5CILH 2ZE0A 1I9IH 3STLB 1KOAA 2XFXA 2MQ3A 2X40A 3NPSC 2VLLA 4RAVA 3KE0A 3O2WH 4ACPA 3WHE1 4LASH 5T3ZE 3MMEA 1AFVL 2P8PB 3MXVH 1DFBL 1YEGH 5DJYA 3MUIA 4XPBL 5FYLD 1WDSA 1QNSA 1QRNA 1S5HB 3ESUF 5L9DL 1CWYA 1UJ3A 4YHPB 8FABB 1WWWX 3F7YA 1I1FB 2AK4B 5KS9A 3KYKH 1A3RH 1JZ2A 4TVPL 5GNYA 4W87A 1YMHA 2ICCA 1HZHL 3K1DA 5GS1C 1E4XL 1HJUA 5FKPB 4HBCH 5C92A 5GJTL 2P1YA 5I73C 1K4CB 4JVUA 2ERJB 3BXNB 1G7QB 4YX2L 2BNRE 2HJLA 3HG1B 32C2B 2A3AA 4TSBL 5K59E 5IW3A 3RY4A 2YMXH 1Q9KB 1RJCA 3KPQA 1G9HA 1NDMB 3HI5L 5DRZB 5A2IH 2EDXA 2WMJA 3ZKNC 4L5FH 2ZWLT 2QJDA 3QFJA 4OGXH 5EUOF 2J7BA 1BBJA 1K6QL 2R1WA 2ZUTA 3U4EA 2R0ZH 2EO9A 1LO4H 1INQB 2PBOA 3KLAB 3MUZ1 4XVSH 3VG0H 1RMFL 4XBEH 5E6IA 4AY1A 2A83B 3U7BA 5EA0L 2HKFL 5L7XH 3RTQB 1DQDL 2IADA 1JYWA 2VYRE 4AD1A 2A6KB 4PRDB 2Y25A 1OP3K 5IQ9B 3UPRA 4HD9A 1TQBB 4P2RD 5EFIB 4M48H 1IGYB 4LIQH 3UG3A 2AVGA 1AR1C 1BVZA 4DCQA 3ALGA 2PW1B 3TNNB 2JIXA 5BVJB 1T04A 4G8GD 1OAYH 5J12C 3ZE0F 3L3KB 4CD8A 1E72M 1CK0H 1NFKA 3KPSB 4HMDA 5E8OA 3Q6FB 4PJXE 5GGVH 3ULUL 4JFEB 4UFIA 2OCFD 4K8RL 2DMKA 4PMZA 3U1SH 5ICYB 4PRBA 3NACL 1A14H 4NCC2 3LD8C 5EFFA 4PJ9D 4M7KH 5CJXC 1E73M 1UZ6E 4J4PD 3CHCA 5I6SA 3PZQA 4OF5A 1BBDH 3MJ8B 1A7RH 4Q58C 4PCSA 1MCWM 2WB5A 3OR7A 4H8WC 4OLVL 4NZRH 3DARA 1OSPL 3V6OA 5D9SA 1KGWA 4JIEA 3H7BA 3I6GB 5C0GA 2W67A 4U1IB 2VL5B 3B8YA 4KKLD 4ORGA 4L4PA 3GEWB 3VRLE 2CDEA 3OXSA 1SY6L 3CZJA 1FE8H 4L3EB 4Z18A 3MO4A 2OZ4A 5CG0A 5B8CB 2NXZD 5JBEA 1VACB 4DTGH 2JJVA 4HEPG 4F57L 4HKZB 3UJTH 4XPGH 3QIUA 3KLDA 5DUBB 1BZQK 4X5WB 1JF5A 4KDWA 1HOCB 4JHBA 2NW2B 5HGAA 2ZUQB 3PABA 3FQTA 2GDUA 3S35H 4B15A 3TBYB 1RZFL 2R9HC 5IB4A 1UA3A 4FQQA 1FRGH 3N9GH 2VUOA 2QLVB 3QUMB 5HGHB 4YO0B 2W9EL 1H3UA 5DMGC 4YPJA 3AS0A 2W65A 2Y6SC 1GVYA 5CMAB 3RA7L 1HVQA 4CU7A 4LCWB 4F3FB 3WMCA 5H94B 4XXDB 2ITDB 4GXUM 3IAPA 3RU8H 1RJZA 4F33A 1WWCA 4FA8A 1YN6A 3EO1A 5JW4M 2XIDA 3DIFA 4H25A 4TRPL 2J4GA 1FG2B 5LA2A 1P5VA 1UR0A 4OCRL 1VESA 5LCVL 1S7TA 5CJBA 2X1QA 2CBJA 5HHMD 3S4SB 1KXQE 2LVEA 3KXFA 3TYFA 4M03A 3QH3A 3JWOC 3T3PF 2O93L 1QHZA 2V9RA 3OF6A 3WMSA 1URLA 3SE8H 1V3HA 4NF7A 5CCKH 5IK3B 1PBYA 2ICWB 1H8OA 1QKZL 1WCGA 3OJDB 5D7SL 1YYMH 3B43A 3D25B 4IRJA 1RZJL 1BD2B 2FHBA 3LZFL 1PSKH 4IMKA 3DO3A 4Z77A 4R0LA 1QSEB 1S7XA 3S37L 3JBG7 3X3FH 4OZGB 2DMCA 2O9TA 3BHBA 4U5IA 3PWLB 1P4LB 3RWFB 2I9LB 5FL1A 3MLUL 4A6YH 4CD4A 4U1GB 3EYSH 1N6VA 3IU3A 2M8XA 5GJSL 2VKWA 4PGEB 1CDCA 4ZXBA 1Y7VA 5TFSL 4IDJH 3JVGC 4Q6IB 1VBUA 2ZX5A 4U6YA 4H5SA 4AL8H 2G2RA 5EU7C 5EZLA 3RIFK 3WS6C 4OV6F 3O9WA 2B2XL 4P4KC 3RVXD 2Z91A 1LWJA 3BKJH 4BK5A 2DT0A 2OSYA 3DYOA 2PXYB 4PIRF 4RFOL 2CR6A 4AZCB 5FA3B 2YPKB 2ZCHH 3M1BA 2P5ED 1S9YA 2R4SL 4JZ5A 4ZPVB 4L4VB 3VXNB 4TUKH 1N6UA 4NHCH 3VFOB 1CDBA 5HPOA 2WVSA 2P8MA 3QCVH 3EOAA 1EFXA 4B7IA 4URIA 3HC3H 3CLEL 4PG2C 5EU7E 2HYMA 1NARA 2VUYA 1FC1A 3A6CL 4PSRA 3KDMA 5CD5D 2J7HA 1QHPA 4TTDC 1LD9B 1MFDH 3SCMA 2FR4B 4WI6A 4ZSOE 2WZEA 1I85C 4Z7OE 5FYKH 4F37K 3PWPE 1CGYA 1U92B 1IC7L 1T7YA 4XAWH 1C5BH 4ODBD 1EX0A 2EYTA 1LK3L 1MCOH 4QF1B 2JJSA 3LDBC 1U8MB 4UT7H 5KJRL 2XA8L 3RGVB 4WTXA 3WO4C 3UTOA 2HG5A 1FP5A 3GO1H 1AGDB 2JF1A 4E8DA 4NZCA 2DB8A 1BJ8A 5TDOA 3UDWA 4HXAH 1O7AA 1RZKH 1CE6A 3MOBH 3N1MC 4H1LG 1ZU8A 4FNLH 5DVLA 1MCNA 4QLJA 3FFCD 1NGWA 3G5VA 4E9LA 4Y5VB 2NPLX 2BFVL 3PG2A 3AHTA 3CUIA 3LQAC 4KTEL 3CPLA 1NGXA 3ALPA 4U1NA 2EH8H 4JEGB 3WNOA 2UZIH 4ZYKA 3NIGF 4ERSL 2CKNA 4Z95L 1KFAH 2GITA 3HUJA 2UYLB 1GOFA 2OTWA 3G6JA 2VLJB 4HKBB 4FTVD 5HVGB 3WL0A 4X7TB 3RWEA 1EZVY 5SX4I 5F7UA 4GKZA 4OZGF 4HS6B 3LN4A 4OGZA 3WL9B 2NX5D 2EC9U 4TNVK 3H0TA 1C12A 4MQ7B 1DVFD 2Q3ZA 1SJHA 3VFTA 1C1EH 3ZTNH 1QPPA 4XTRD 5INCA 2DJ4A 4ZOAA 2J4WH 1QSFE 4X6EA 1HKIA 4XHJD 3UTTD 1AR2A 2EE2A 5HHVH 5FB8B 3HAEH 3DSNA 5HDQH 4L8BA 3UC0L 3MV01 1QFUH 2E7CA 4Y1AB 1IE5A 1OCWH 3QXVA 3AB0B 3ZL4L 3ZO9A 3IJ8A 4ZFGL 5GS0D 4OZFG 1MH5A 2VLRB 2ZIDA 1MI5A 1MQKH 3F5KA 4K7PY 1J05A 3CFDA 5BV7L 1DN2A 1KQYA 5D2LE 3H3PH 5IG7B 43C9B 4LLMA 4Y4KB 3BKYH 5ERWA 5DDHA 5LXGH 1SYVB 3LKRA 3OKDB 5C09A 5A16B 5C08B 5AYQA 1NSNH 4XZBA 3JV4A 4EI5A 1NGYA 4MZ3A 3NUKA 3T04D 2GTZB 5C2BL 5F7NC 5CGMA 2A3HA 3MLYL 3P11H 4C83B 4ODSH 1DQTA 2YD2A 5C0AA 1CPUA 3QQ9D 3RI5F 2YS4A 3ZE2E 1HL8A 2ADIB 1MCBA 5BS0D 1LEIB 1T7VA 4PJHE 5DJ8B 2J8HA 1CG9A 4I9WE 4MDIA 1LE9A 1G5AA 1HF6A 5IQ7H 4ZOCA 1SMDA 1HXMB 1I1AC 5HDOA 4WFFD 5I18H 4WU7A 4LLAA 1GZPB 5F21B 2BY0A 4EE9A 5FGSA 3KHQA 4NWTL 5CIPH 2H3NB 4JY4B 2UVFA 2VITA 5I8EB 3LN5A 3WKML 3VILA 3LEXB 3O4OB 1YN7A 3AFLA 2X1PA 3WDPP 2WSKA 4WV1C 3BP6A 5SWQB 1UA6L 1S8DA 3OLDA 2ZG2A 4K7FA 5JHLL 2N4IA 4U7KA 2FIRT 2AGJH 1TZGL 5F7MC 2EPLX 1T21A 3KYNB 4M43H 1RZKC 3ZTJG 1RU9L 4N8VB 5I0ZA 1VRXA 3WUWA 1IRAY 1U36A 1WT5A 2UWEA 5FYKE 3MCLL 5IEHA 1WFNA 2AXHA 1FHLA 2XTKA 1U6AH 2F5AH 3BAXA 2NY3D 4JM2C 2WCSA 3GTNA 4LBEB 2BCKA 1NLDL 4YXKH 2FJHB 3FAWA 3T1FB 4X7SH 4LHUA 2FO1A 3RAJL 4ISVB 1E15A 1FP9A 1MAMH 2O5XL 3B2VL 3CXDL 3CDGA 4KKBC 4LPXA 2X1WL 3IDUA 4JPKH 4UTAL 3KNBB 4ZOEA 2XACC 5FCUL 1VCAA 5K9OA 1T1ZA 3SE3A 4Q7DA 4FRWA 2RFXA 3AREB 2I60L 4H88L 3TVMA 2FLRT 3C08H 1E4NA 3S36H 4BUHA 4U2ZA 3FQWB 5HHQA 2PKDA 1HP5A 5H8DA 3CFCH 2VTFA 2WKLA 1HQRB 4PV9B 1MCQA 4X7DC 2L7JA 2OYLA 1JGLH 2EDQA 3TT1L 3DHUA 4YHLL 5I77A 1WTGT 2HT4D 1Q94A 4G6JH 3CHEA 4MNGA 5GSRB 1VKXA 4XI5D 4RDQG 3E6FA 1IAMA 1ZT1A 3IFNH 4KRUA 1XFPA 3GSVB 1MJUH 5SX4H 4WI9A 5E5RB 1OP3H 4HIXH 3WDHA 5IB3B 3MU7A 2E7HA 3MLWL 1XIWD 5C0JB 1YQVH 1QSVA 5FEBA 4P4RB 2GCYA 2HLFC 3BEWB 3QIWA 5BRZA 4FABH 2VVSA 3F5WA 5ISZE 2D7TH 1ZVYA 1KPVB 1MJ8H 1Q9LB 4Z76A 4UDTA 1QNOA 3HN3A 4WW2C 2YR3A 2OR8A 3WUFA 5L8LB 2JFEX 4KKAD 2IANB 3P4OA 4UI2A 4GXUN 2A6DB 5CHNB 3MNVA 3O3AA 1QO3A 1XHGA 1FZJB 2YRLA 1S5IL 5EBWB 2QQKL 4GW1B 5JW4N 1TCRA 2QQQA 1NGPL 4OTXL 5TQ0H 1W2VA 2HT2C 1GZJA 1IGIH 2BY1A 1DBJL 2MFNA 4EIZC 3MA9L 3TA3B 5IMLA 1HVXA 2OP4H 4V2XA 2VXSH 3P4MB 1LP9A 3AM8C 2E3VA 4G6KL 2GFBA 4QRTB 5E8PB 2ZP0T 4FQ2H 1RD6A 1XR8A 3BUTA 5J6GA 3S2CA 2CKBH 2PR4L 5FO7A 1WBXB 3MBED 4FQXA 4Z0BH 2WNGA 1DHKA 5MERA 1FO0B 2VDKL 2CESA 5C0RL 4H20H 4F7PA 3RJXA 3PXJA 4LRNL 1NAMA 3CGTA 4K9EH 4OAWB 1ZTXH 4Z2LA 4PG9A 5I15L 5KSAA 2QR0B 2H2SC 1A64A 1G0YR 1R6VA 1T1WB 3WYRA 3PQYB 5BJTB 4HXBL 3GMPA 3IETB 5ITFB 5B3NA 4CU6A 4RGOH 3ZJ8A 1DANT 1LL7A 4IUGA 5CSZA 1CFNA 4YHKH 4CMHB 1R3JB 5LA1A 3CU1A 3QDHA 1BVLA 3VFGH 3B5TA 1QUNA 2CDFA 4IOFC 2PN5A 5C0ND 1NCDH 2WC7A 5T5FL 3WFEL 3HFML 5DJCB 5BQ7A 3MGTB 3KYMA 1DEDA 1WAAA 1PD6A 4KMTL 5IUSA 1U3HA 1H5BC 1X5YA 4NQTA 4DFIA 5AG8A 3WCYA 3FW6A 2AERT 1MIMH 4U6VL 1LE5A 1P7KB 3VFSA 4PRPE 5C6TH 4D8PB 4HOXA 3QG7L 3HE6B 3CSYA 5ABGA 2VWEC 1A6PA 4R6UA 4DN3H 1JVKA 2FL5A 4X5XB 2ZKHL 4MCZA 5D7JD 1ZHNA 5B3JE 2Z31B 1NC4A 3VD4A 4QRRE 3CK0H 1UQYA 5DRWA 4CGTA 2VXUL 2NY6C 2OQJB 3WY1A 1HI6A 1KGUA 3BP7B 1YJDH 4BH8A 4XP9H 3P30H 2GJ6B 2GSIA 3CSBA 4NHUB 3AHZA 2AJ3B 3B2UD 4ESKA 4L8SB 3QXWA 3CVHB 3PWJA 2VWEE 1F4HA 1FGNL 1KNOA 3MO1B 4AD5A 4X6DE 3GBML 4KRPC 4RAUA 2LAAA 1MIEH 1UWGH 3MRDB 5DS8A 2DAVA 1K9FA 2WANA 2ZPKH 4D6CA 3TTOA 1GGYA 3QO0A 3MNZB 1C5DA 4TUJB 3SKOB 1T0MA 1U3JA 4N8CL 4PMVA 2UY5A 1QG3A 4FMKA 3X14B 1EMTH 1KCLA 2YJQA 5CEYB 4AIZA 4K2UH 4UNTA 2VCBA 3S34L 4MAUH 3RWIA 1FYTD 5A94A 4JZOA 3DV6B 3A67L 1R85A 3PP3K 4O2FA 4OBRA 4PMXA 1FAIL 3KPNA 5GGRA 2ZICA 4QXGH 1P6AB 4PP1C 3MLTB 1VENA 4DOHE 4PJFE 2XN9D 4GKOA 2ZUVA 4WFGE 1R3LA 3MV9B 3CFEB 4MA8H 3N12A 1YNLH 1TPXB 5LGHL 4FFYH 4QLKA 2DQIL 4V1DE 2FZ3A 4ZAKA 1HK6A 1G6RA 1NH6A 2OJZH 4RQQA 2AI0H 3QAZB 1A4JB 1FL5A 2O61A 1X44A 3S3PA 5IF0B 4PTUA 1LEKB 1YY8A 3M7SA 1YEKH 2R39A 2A1WH 2GJJA 4WY7H 1B0WA 3QSKB 3U0TB 4L3AA 3VA2C 5HYFA 1H3WM 1E4KA 1AMYA 4OJFL 3BN3B 1A6ZB 3Q0HA 1JFQL 3JTTB 4CW1B 4U1KA 3UTTA 4H0HB 5HBBA 4UTBH 3L5WA 5F88A 4AMKH 1KENH 4PGDB 2ITCA 3HI1B 1PZ2A 2WP3O 3WQ8A 3IDJA 3AMKA 2AQ1A 3H8NA 3CFJA 4QNPE 5I1KH 2FB4L 3IU4H 4EEEA 5D93C 1F90H 3BQUB 2E8ZA 5C0CD 3EYPA 5D1ZB 1F6AA 1OGAB 4ZD3H 1NFIB 4X4YB 2CH8A 3KAAA 2KQNA 4LVEA 3SE9L 2QHAA 4WKAA 2DLFH 2PF6A 2HFGH 1PIFA 5FYJU 4Y5YB 4TOYL 2Q8XA 4F7CA 3QRGH 3UPAA 5LAXA 3OKOA 2AV7A 1HILA 3WIHA 4R4FH 4XNMA 3VH8A 5FM5M 4EN3D 1WGOA 4JDZB 4LCYB 4MD4B 1GQIA 3VD5A 1L0QA 3QHFH 4U3CA 1W8NA 4UCFA 4JGJA 4MJIB 2OXHA 1J10A 3HRPA 2C1PB 4F58H 3BAKA 3BD3A 4GAGL 3WE6B 5BS0A 4PSPA 1MRCH 3VA6A 3VM7A 1FNGA 3T0AA 3RWCB 1YJDC 4QOKB 1SBSH 4WO4A 4Z5RB 2BNUB 1RUQH 5D6CA 4B0MM 1I8MB 3FRUB 2BVQA 4HWEL 4HQQH 3NIFF 2PYEA 2A3CA 5D72H 2Y9RT 2NY4D 2OK0L 4CD5A 1EAJA 4W7UA 1KCUL 3FZUD 1AKJD 2BOCA 3SHSA 2WW8A 3OKNA 1I1YA 1VFOA 2WBKA 4OIIL 2J7FA 5D1XC 4PJBE 5DGRA 1IBGL 3H9SA 3I3EA 4R5EA 4RBPH 2XTJD 4HG4K 4G6AC 2R1YA 3BP5B 4M93C 5LVEA 2HN7B 1TJHL 2GAZA 3QFDA 3VJ6A 4U1SB 4AZBA 2J75A 4JLRA 1AO7B 4IOIA 5EUKB 5CD3A 1E3ZA 1A4KB 4L9LC 3VXUA 4ODHH 3WLBB 4M7LT 3D39D 3HNSL 4O58H 3O3DB 4EOWL 1ZAGA 1PYWB 4UFKA 4JANB 1C8XA 1WIUA 1VAHA 2WMIB 2XT1B 4RFEB 3VWJC 3WN5A 1SJEA 3RVTD 2ZSWA 4D2NA 4EBQL 5FYJD 4DW2H 4M4RA 5I30L 4YK4C 1NBVL 4EKJA 2QBWA 2XYCA 3RI5K 4A6YA 4UDUA 5KVFH 4PRHB 4W4OA 1TVBA 2I5YH 3KG5A 1PLGL 3UJIL 3TJEL 3G04B 3SKJL 3TPKA 3ULVL 3PZUA 4NJAL 4G7YH 1S7UB 1TE1A 4P9HH 2AABH 5CFHA 1UWQA 4K71C 3ZE1F 1Y6KR 5D1QC 1NPUA 4WU5B 4GI6A 4P8UA 3U48A 3R06A 1X4YA 1FV1B 1JNJA 5IVNA 5CZKA 2RCSH 4HGWB 4TUFA 2WIMA 2NW3B 3O6FD 3DV4A 5BV7B 5AG9A 4NO2A 4PPTA 1OGBA 5HTSA 1W1TA 4JKWA 3D3AA 1TCMA 1JRHI 4EAMA 3OGOE 5HDRA 3GZKA 3H9ZA 4LPTA 1OT1A 3VXSB 1AE6H 2YD5A 2YA0A 1LEGB 2NZ9C 2ZUUA 5I3DA 1F58L 3DMMB 3LB6D 1GIGH 3QDME 4R90L 4PMDA 4M1GH 1FORL 3PGFL 5ETUA 4MNQB 3DHJA 5GRVL 2DQEL 2X4QB 4QHMB 2QV2A 1RUKL 1ZS2A 2VSCA 1US3A 1GC1L 4UMGA 4NKMB 1NFDA 1IAIL 4GH7B 1Q6EA 1HHGA 1AGBA 2E40A 4PN2A 1PEZA 4ZFOL 4JRYB 3LQZB 4A2LA 1E28A 2EDJA 4PJEA 1E0OB 3GMQA 1MHHA 1EJOH 1WBYB 3MBEA 1JWMB 2IQAB 5HHNB 4H26A 1EXUA 1CGSH 4O9HL 4UILL 1RUMH 1BJ1H 4XCEA 3QCUH 4PY8I 5C07B 1UC6A 2HFFB 4YGAB 2F19L 4MNKA 1DQQB 3MCKB 3OB0K 1WPCA 4YPGB 1ZWIA 4D6JA 3GMRA 3QUYD 3MV7E 1W91A 3FCTA 5TDNB 3QEQA 5D7IA 4EDWL 5DO8A 3ARBB 1MWAH 1OM3H 1H5VA 4WHTB 3OZ9H 3HKFA 3AAZB 2XKUA 4FQLL 4JR9H 3DVFA 3BT2H 1BLNA 1KTLA 1MREL 4MPKA 4RGND 2ZOLA 3WFCH 2DJSA 2HVJB 1CWVA 4P23B 2RGLA 4G5ZH 5F7WC 1NCWL 2V7HB 1CICC 1WKYA 5KSVB 1B4JL 2YBTA 3NSMA 2PETA 4UBDC 3T0EA 3GMOB 1PG7X 3HAEA 1G9NL 3OKYA 5IP4A 4WWKC 5EBMA 5D9PA 4LHJB 3BGMB 3GSNL 1JNNH 3QJHA 5ESAB 3LVEA 4POZD 2PO6C 4Z0XB 5DMKA 4HUKB 1AVAA 5CEXA 5JPMB 3IANA 3LMJL 4KK9C 3QI9B 2PTTA 4MS8D 3FOMB 2JK5A 4Z9KB 3RQ3A 1EO8H 4WVRA 4X9IA 5FOJA 1DDHB 4JFFB 2I07A 4PRIA 4Y16D 1M7IA 3BWAA 3KR3H 3FFDB 4RA0C 1N8ZB 4U3AA 4DN4H 5D4YA 4U0RB 1TZIB 3W82A 3VGAB 2XWJA 3U9PH 1CR9H 3GI9H 2X44D 3VRIA 1MHCB 5EOCL 4YHNA 3V7MA 2XVLA 1M7DB 2YL9A 5GPRA 1MEXH 4NFCA 2ICWI 5LBSL 3SDYH 1VADB 4M62H 1JGUH 1FIGH 3TPUB 3BMWA 2HFEA 2FEDC 1BAFL 1MUJB 1A2YA 4LCCB 3FO2B 1WJ3A 5I75B 1NWTA 4FP8L 4RX4D 2FGWL 3QQ4B 1FFNA 4GAYA 1A7NL 5IROA 1KXVC 4HU0A 3OKMB 5JR1L 1UCBL 3QWOB 4Y19E 4X98A 1MPAH 3L2LA 3CC5B 1JRHH 1C08B 1S46A 4XBGA 4FQIH 4PBGA 2R56L 3V4VH 1MCRA 1EO7A 3EFFB 5ENWA 5DEGA 1F4XL 3NTCH 3ZR6A 2F74B 3B9EA 5I9QC 2VLKE 4XNUH 5M94B 2D0HA 1WP6A 2ZX7A 1HKLH 5DJAB 3ARRA 1UM5H 1T5XA 3QULB 1BTCA 4C56A 1EVTC 1WITA 3MV8E 1KXTA 3AHXA 5KSUA 1UOKA 2O9RA 4CVZB 4LNRA 4YDLC 5GISH 5ECJE 2YZ8A 4RWYH 2RB8A 4B5EA 3IDXH 4APQC 5FO9B 3FMGL 4LSPL 5IIEB 4PJ5D 2B4CH 2J3SA 4OD3H 4YXLH 2ZWYA 3DO7B 2Z4QB 2DQFB 4NQCB 4R8WH 1XV8A 1NCAH 3NGBC 4HBQA 5J13C 3U7AA 4TVCA 5JIWA 4OD1L 3F62A 4LOUC 2V7NA 3GH7A 4HS8L 5EUOE 1KJ2L 2FCBA 4KJQC 5IW6B 2JIEA 3A4WA 1XGQB 3RNKA 3IK2A 4MA3A 1BQHG 4ODXA 4PJDA 5F7DA 4F7MA 1MCEA 3VXPB 1UACH 1T20B 3QZWG 5AD0A 3JWDH 2HLAB 5IGXL 2YL8A 3D5HA 1NCNA 1T03H 1K2DA 2BSSA 4PBWD 1RI8A 3MCG1 2A74B 4Y89A 1EO5A 4ZENA 4OZIB 1ZB5A 1UD4A 4NCC1 1WSST 1T89C 3B8SA 3PP3H 4PLJD 4AEIH 4Z7UA 3CUHA 2CETA 3ZKXC 1GGCL 1Q6CA 2P5WB 4HJGB 2VDRH 4XC1H 5MEOA 3CCHB 2Y07L 2FH8A 4F9PC 5C0BE 1H3VA 1ECEA 2Y5TB 2Z93A 3BKMH 2ZCLH 4G8FB 4M9OA 4HT1L 4P5TB 2DDQH 5EBGA 2DQXA 4MAYB 4ZG1A 3CDFA 1MY5A 2UY6A 1VGKA 2V9TA 4L4TA 5TE7L 5A8PA 4TULH 5KW9L 4JDTH 3QUMH 1FBIH 2AXGA 1JDCA 3KPRE 5MP6H 3DJ9A 3WJLC 2W1NA 5D2NA 4QDMA 4YGVB 2XGBA 2R0LL 3AZRA 2HRPL 2EPOA 3UTZA 2VDML 2VI0A 5TQ2H 4DKDC 2XPGA 1P2CA 3STZA 1FCCA 4ONOA 1EV2E 4UB0H 3BRGC 3ARGB 1ORSB 4JY5L 3U0PB 3LRGA 2N56A 4I0CC 1ZGLB 3FT3A 1AIFB 3B9VA 5FIEA 1MCWW 2ERJC 4L8CB 4D6IA 2FDBP 4UAOC 3I85A 4Q0XL 2QMJA 3QWRD 1VIWA 3MRKB 1IGMH 2EXOA 4LLWB 3UTSB 2AK4E 2QKIA 4MDJB 4HH9A 2DSVA 1TITA 4JN2B 5L2JB 2VMFA 5IM7A 4GXVL 4LSUL 5TD4A 1DN0B 2PCPA 4K3JH 3SGJC 4GMTL 4HUWA 1FFRA 4RIRB 3RNQA 2R1XB 4HF5H 3CVIH 5IB1A 4NP4H 1GZQB 3HG1E 4NN6C 5ACMA 1K8IB 2JCCB 3G08A 3N85H 1OCQA 4LFHG 1S78D 2DMBA 3LKNA 3HPLA 2BERA 2E7LC 1HSBA 3TBSA 2MQ0A 3MFGB 3CLFL 3MRHA 5DMIH 3VE0B 3VIKA 1E6NA 1TQBC 3EOBB 4M7JH 1FZOB 3RZWA 3KYOA 1DR9A 2CIKA 1RIUL 2ID5A 4QT5A 5DMJB 4GBXD 1GONA 3LEYL 4Z2IA 4PD4J 4KI5D 3S88L 5FYLL 4NQDB 1X5ZA 3T3PE 3X11B 3HI6H 4ZDHB 4OZIF 2VSDA 3VFNB 4OOUA 1FL6B 3U9UA 2BC4B 3LKSA 4ODUB 3NMEA 2WPGA 1I7UA 1RURH 1UZ8B 2DKUA 4KHXL 1G1YA 1ZVSA 2F2HA 4MAZA 4D72A 2EDNA 3B9KA 2O9PA 4KZDH 5I1LA 5T3ZD 5DD1L 4M7ZC 3KPSE 4O02L 3U57A 4ZUVA 2BVYA 4ZMAT 1CGUA 4JFEE 2ENSA 3SDCA 1U42A 3QYCA 4Q9CA 4HA1A 2VDNL 2QADD 4HAFA 2FX7H 4LGSB 5GZNC 5F96H 3KWWB 3MLSH 4UNVA 4NZUH 4N0CC 5CJQH 1AC0A 3BEVA 3U46B 3G6AB 3LS5H 2ED8A 3W0WB 2ZUQC 4ZODA 2D24A 1C8PA 1QFPA 2C3HA 2XKNA 2AK1H 7A3HA 3BAYA 3HMWH 1RZIA 3FQNA 4WK9A 2H6PA 3BZEB 4OM0L 4E5XB 3T8XB 5FKAA 4L3EE 3O4LA 2BNRD 4M24A 1W0WB 4HWBA 1JPTH 1G7JB 3I3DA 2NTSP 3NFPA 5T1DL 1N5YL 1OB1B 5F9WC 3RZCB 2WYSA 3QXDA 3AHVA 5GGTL 1CBVL 4DVBA 5CZXC 4CKVX 2B1AH 5F93C 1DLFH 1A7PH 1XH3A 2A77L 1VFAA 4NQEB 3IDIB 2HKHH 1R7OA 1LO5A 4KUZL 4NI3A 3RVUD 2YKLL 2VQ1A 1BZ7B 3ULVC 2JCCF 2WXDM 4LCWE 3MRRA 3QUZB 4PJCA 1LK2A 5GRXG 3ZKND 4N0FA 2P24A 3V8CA 3FT4B 1E40A 1RP9A 2W0KA 5EU6B 12E8L 3LPGA 1QBLH 1QPKA 3QJFA 5EBLA 5JQ6L 2ADJB 4X5LA 3GSRB 4NZTH 3S37X 2OMNA 5DR5L 4HUVB 2F8QA 4Z7VB 3F12A 3PWNB 3RCNA 3TESA 1CD0A 2FX9L 4XPHH 1GOIA 4LSDA 3ULVE 3O3EB 4XB7A 2VC2L 2BY2A 3V52H 5ID1A 3ABZA 3CIQA 4MVBC 5T5NG 1E0VA 3MJ9L 4JFOA 3VFUB 3HNTH 2VCCA 2XICA 4IRSA 3MMEB 2XVGA 3OV6A 1T66C 5HGDA 1PFCA 4U1GC 3FO0L 5IMOA 1IM9D 2I26N 1AR1D 3EHBC 3NIGE 3IF1A 5I8OL 4KJPC 1MVUB 2XI9A 3HZYA 3V2AR 3WSUA 1V7NL 1KLGA 1UJ3B 4N68A 3CH9A 4FMVA 1NC2B 1OQOA 2C7FA 3GKWL 3ARFB 3C60B 3F7YB 3PN8A 2E7BA 1MFVA 3AXLA 5KS9B 3MV11 1QSEE 2R69H 4OZGE 2E6QA 2DYPB 4H0IA 1YMHB 1I3RA 1CLOH 5ANMA 4KVCL 5DJXA 5CJOH 3QUXC 1CF8H 4LAQL 3BSZH 1UGNA 2A2QT 5E4EB 4FQCH 3AIRA 2K7PA 4RE2A 2ATPB 2HJLB 1TNMA 1SYSA 3ARDA 1MHPH 4TSCL 4BZ1L 1G9MH 1KLUA 3KPQB 1R0AH 8A3HA 2C4FU 1RVFL 4JRWA 3HB3C 1ETZA 2J8UB 1HNYA 2BZDA 2ZXAA 1RK1A 2XNAA 1WEJH 3U4EB 1GGIL 4NJ9H 1BWMA 5SWZA 1R5VA 3G5YA 3QISA 3BN9C 4UV4H 1PZ5B 3DRTA 3P77B 1NGZA 3B6SA 5GRZA 4ELKA 5E6IB 3U4BL 1Y6MR 1V6UA 4WHYG 4PTVA 2VZSA 3O45A 4UT6H 2ESVA 4I4WB 2R9HD 3RGVC 1LF1A 4ZS7L 3AC0A 2IADB 2WW5A 1FNSH 2G3MA 4CN6A 4M6OL 1AHWB 1VPOL 5DMGD 2BSRB 2Y6SD 1QTYT 5AEAA 1X5KA 4DCQB 3G6DH 2PNDA 2JIXB 4Y5VC 5SWSB 1OD7A 3LV3B 4OFYA 2RGSA 4WI7A 1AXIB 5I8CB 1U95A 1N6QL 1B6UA 5E8OB 1Q9WB 3QRFM 4BQ6A 3P0YH 5I16A 4PGBB 2WBJA 5I1IH 4M8VA 3WIIH 4JJ5A 2Q8AH 3RWGA 5I6XC 3JSSA 4Z7VF 1R3KA 1BQLH 4MQSB 4RMQA 4N8VG 1JD9A 2OJEB 2GJZB 4LHQB 4UZSA 4HOZA 4JGMA 3L3JB 4UQEA 2CLVA 2W59A 2VR9A 4XCNB 1JZ6A 2BRRH 4R96B 5ICZA 3GJFK 5D9SB 2Q20A 2MKLC 2R2HA 1DBMH 4FFZL 4JO4L 5CINH 2CDEB 1BZ9A 3BPLB 3TYGL 3P73A 4AD3A 3FNDA 4HCRL 1IGTA 3TFKC 4G7VH 2VDPL 3WF4A 5MEQA 1OARL 2VLJE 5JXAH 5KS9F 5JORA 1AFVH 1ZA6A 5HHOB 3PABB 3FQTB 3IKCA 5IB4B 4HJJL 4FQQB 1GOWA 3GBEA 3VXMA 2O5YH 3D5OF 1OF2A 3L3GB 4WUKL 3UYPA 4YHOL 5C9JB 1HDMA 1L4IA 1MFUA 3II1A 4YBLB 3SGDH 1K85A 4TVPH 3BPNB 2B31A 1ZANL 4AM0B 1HZHH 4Z7NF 4NOFA 3S97C 2GJPA 2VT0A 3T3MF 2NW0A 3EYFA 1DQML 1UR2A 5GJTH 4P4KD 2QQNL 3U5YA 3INUL 2O26U 2NY5H 2J8UF 2VLRE 4NO3A 2YOCA 3NCYP 3RIKA 3K3QA 4JZJB 3RX5A 5IEKA 2V5MA 4JFDE 1IKNA 1G0DA 3PWPD 1KIQB 2OMBA 3EO1B 3DIFB 3W9DB 4Q9RH 4TTUA 4AQOA 2J7GA 1EA9C 4IEFB 2DF3A 1IZKA 3EYOA 3FRPA 5F9OL 3GNMH 3MRMB 3KXFB 1YPZA 3QH3B 4MMXC 4HEME 5HDBE 5C70A 4N1HB 2DH2A 4W89A 5IBTL 2Q86A 4TTDD 4RNRB 5BVPL 1ROWA 4YDVA 3GBNH 1FO0H 6FABH 2J7EA 3P2TA 5EA0H 3IJYB 5KBNC 1IFHH 1X5XA 4EUPG 2VXTL 3N06B 4FXGA 4NC1C 2VN4A 1X6LA 4ELMA 4R0LB 1MWAA 3D85A 1G1CA 4LF3A 4KAQL 4QYOA 1OPGH 4LMQI 4TSAL 2PW2B 3D3VE 5HNNA 3VI4F 3VFWA 4GAJH 4M4PA 2CRYA 4NPYA 2YD1A 1Z32X 3F58H 4ZXBB 2V5TA 4XNYL 3O3BA 4U6YB 3LRHA 3IVKA 1C8YA 4GRWB 4NC1E 1G9EA 3KEHA 4P3DB 4AZGA 5EZLB 1RY7B 2Q7YB 1KJ3H 1I9JH 4NM8L 5HI3C 5E70A 5E9DB 2TAAA 3TV3L 5KAQF 1UB5B 1RHHB 3AREC 1QSFD 4QXUL 2XVNA 1S9YB 1P9MA 2YD4A 4Z2HA 3BGFC 3RY6A 1W72B 2WNWA 4FFVC 5FYKU 2AKRB 3HR5A 2C3VB 2G3NA 1LMKA 4XVTH 3KS0J 4PUBH 1KTDA 3FQRA 5T1LA 5DJZA 3CJJA 4K3DH 3KDMB 1B30A 4G3YH 3OX8A 5B21A 5CKGA 1OAUL 4W5UA 3FL7A 1DBAL 5DUML 3CVHH 1E6XM 1J88A 5ACZA 1K4CA 5DUPL 2EYTB 1P69B 1J9YA 2J7CA 1RJYB 32C2A 4PTWA 2FHCA 4LDOB 3EJZC 1TETH 4M02A 4GQRA 4KRMB 1N4XH 1Q9KA 3RA7H 3V6ZB 3MLVH 5GRUH 3CUFA 5DRZA 4UNIA 1CE6B 2X89D 1PJ9A 1V6YA 3WFBL 3O2DL 4I9WD 1NGWB 4JPVL 1QYGH 4GS7B 1QEWB 4BUGA 4AG4L 3T4AA 2NY5C 1KTRL 2VXQL 3Q2CA 1V0NA 1R7AA 4TRPH 1BYBA 2X5PA 3CPLB 4WTWA 1NGXB 5A2FA 4U1NB 3RTQA 4ZYKB 2AJSH 3TA3C 4XC3L 2OI9C 1WDPA 2GITB 3HUJB 4URTB 4XNQB 2OTWB 2IANE 1KXHA 4FG6C 1I1AD 1V3MA 4ODTH 1R87A 1RFDH 4J28A 2PW1A 5LG1A 4P46B 1W1YA 5EO0B 1BYCA 4XVJL 3LN4B 1UR8A 3DGGA 3L3KA 2DDXA 1RZJH 1UQSB 2RIKA 5DK3A 2APTA 1BM3H 3Q6FA 2BHZA 2V38A 2V5DA 3VFTB 1MF2L 1A21A 3O41B 4G8IB 3D1MC 4X6EB 5AZEL 2X4TA 3HJEA 4J3XA 2C1OA 3C5ZA 4GRWF 4LKXB 3SY0A 4IRZL 3VFMA 1JDAA 2FBOJ 3T2NH 5H2BA 3T1WA 2ZUXA 5I23A 5EWIH 1X5AA 4RE3A 4NKIH 3KJ6L 1FNAA 2XYLA 1MH5B 3UAJC 3UESA 4PGJA 3WDQA 3MQIA 2CGRL 4JM2D 2DTML 1QBBA 1RIVL 4RMSA 4HPHA 2ZJSL 2VL5A 3CDYA 3O6KL 4LLMB 4N1EA 1BYAA 4KDVA 5DDHB 4JO3L 3RMEA 5B8CA 4KKBD 1BFVL 1RUAL 4GW4B 1NP0A 1HYSC 5DUBA 3JV4B 4EI5B 3FHQA 1V6WA 1JK8A 5EOQH 1X5FA 2W9LA 3QHOA 4LQFH 4UOW0 2MHAB 4LVNB 3NJ3A 5ITBH 4KZEH 3VDAA 5C0AB 3TBYA 3ZDYF 4JL2A 3ARXA 4UTFA 3A0OA 2Q76A 2V2XB 2Z31C 1KB5L 4OM1L 1A0QL 3T4YB 4MX7A 2CD0A 3PP4L 1CG9B 4S3JA 3WQWA 4OF7A 5CMAA 5BW7C 1ITCA 4MHHI 4WU7B 5ISZD 4GG6B 2XM2A 1E5JA 5T3XH 4HH8A 3TT3H 4XXDA 3NFNB 2Y2WA 3LN5B 4KGLA 1OW0C 1YN7B 3NH7H 1OWWA 4TVUA 3BP6B 5HYSG 1S8DB 4NBZB 2YA1A 1V03A 3V8OA 5CSYA 2HLFD 3L3DB 1DBBH 1T21B 3S4SA 2Y36L 3WD1A 4M80A 3MODH 2NCMA 4HZ6A 2IBBA 3SQBA 2UWEB 4N1CA 3HUJF 1ZT7B 5IHBA 1J7VR 3BESR 3SE4C 4GFTB 2APFA 1IVLA 2HVKA 1WWBX 4PMYA 3D25A 2EKSB 15C8L 1BD2A 4OQTH 1NKRA 2F5BL 3N15A 5MHSE 2HT2D 3KVQA 4HK0A 1OTTC 3NIFE 4NKDB 3ZDZF 1T1ZB 3RWFA 4LAJH 1TPXC 2ZX6A 3I75A 4F9JA 4D9RE 3MYZA 1VFUA 2YWYA 5I1CL 5D9NA 1A6AA 1UD2A 5HHQB 3QAZC 2ZSVB 3QNYA 3ULUD 2HH0H 2IAMA 4Q6IA 3SJVE 1IGCH 2WUBH 5JMRA 2NY2C 2FO4A 2HVMA 4EANA 3SGEI 5KANG 1E27B 4FXLA 1AJ7L 2NXZB 3GRWH 1Q94B 2H2SD 2NY0C 3UC0H 1HJVA 4J8RB 3MV9E 3EO9L 4K3GA 3E6FB 2PXYA 4HFUL 3LAFA 4AZCA 2FJGB 3R0MA 1F11A 3BDYL 5DI8B 5JDJA 1KULA 2IPTH 4D3CH 5BV7H 4ZPVA 4L4VA 3VXNA 2OWWA 1WICA 3VFOA 4PRPD 1HIML 2GCYB 3HMXH 5JW4Q 3OPZL 1TNNA 3TP4A 2OL3A 3HPJB 1P6FA 5D1ZC 4W4NA 5FL0A 1HJSA 2DSWA 3E8UL 3F5WB 4IOFD 3RVWC 3N0PB 4UDTB 4UQ2B 1FH9A 4MQTB 3HC0A 2Q1EA 1LD9A 1R3IL 4QRRD 3SBWC 4F8QA 5HI5C 2FR4A 3BPCA 4LSRL 3WS6A 4Y5YC 3LPOA 3P4OB 4HPOL 1MCLA 1WLHA 2DJUA 4N9GA 3O3AB 4YIQA 5CZVL 1IL1A 5D71H 3ALXA 4KTYA 1KN2H 3LH2L 4QF1A 1JZ4A 1U8MA 3HE7A 3ZE1E 5FFLA 1D9KC 2NY1D 3ZT6A 1OGAE 3MLZL 1AQDB 1B2WH 4OCLC 5IMLB 4DGIH 4YWGH 1DUYA 1LP9B 1MCJA 3V0VA 3MACL 3KPMB 1XR8B 1FFPB 4Y0GA 1CGTA 3U7WH 1PVHA 1JGIA 5FO7B 5TE6H 1NWUA 1LO2L 1WV7T 5ESQA 2DBLH 1LLOA 2YRZA 3WXWH 4DGVH 4F7PB 4K23L 2UWEF 3PDOB 3BH8B 4DEPB 4UQCA 2EYRA 3GNOA 1VF8A 3POHA 5KSAB 3MUHL 4KRPD 2PWHA 1JD7A 5FECB 2DT1A 4OB5H 5D7LE 2B8OT 3GMPB 4JFPB 5B38G 4QOKE 5D8JL 3LHPH 3EBVA 2FECI 3NIDF 4HKBA 2EZ0C 5CSZB 1CFNB 1NL0H 4WFGD 4CUCA 1JGDB 4HS6A 4OLEA 3WL9A 5DF0A 2CDFB 4V1DD 4HAGA 5FOBB 2VDOL 4FHBD 5F7LB 1V6XA 4WUUA 5F89A 4TPRL 3QEGH 5BQ7B 3KYMB 4BH7B 5GRVK 4I1NB 4W5ZA 2MMXA 5J4MA 3GI8H 4J27A 3K8LA 5LWYL 1FGVH 5FB8A 4MHHG 4Z7QF 3DHPA 3CIVA 4PP1D 4NO0D 3CNKA 4LK4A 1FYHB 4Y1AA 5HHXH 1LVEA 4HWUA 3CSYB 1NCCL 5A2CA 1ITBB 4X0VA 2AJZA 4MCZB 2DLHA 1NUNB 4UIMA 3TT1H 2XQBL 1S9XA 2J6EH 4Y4KA 5FDWB 1JYXA 5AC4A 5GGQL 1SYVA 1FSKC 2YPVL 4XRCB 2XUCA 5C08A 5AWNH 3V5HA 1MFBL 1D2KA 4KUCD 4OI7A 7FABH 1UKPA 2VDLL 4O5LL 1BGXH 3MLWH 1R5IA 3PWJB 3QCTL 2V2TB 4QEGA 2VXVL 5DQDL 1KNOB 1NKOA 2IPUG 2MCPH 1PAMA 4R2GB 4FXKB 4RAUB 4KPHL 4PBXA 5DS8B 2ADIA 3TZVA 4PD4K 3UEZA 5CQ1A 4PLKC 3SGEH 3QO0B 5JUEL 1C5DB 1QNQA 1LEIA 4GQPH 1MW3A 5DJ8A 1T0MB 4DUWA 6CGTA 1HXMA 3T77A 1OGTB 3VWKC 1GZPA 1CENA 1HYRC 1G01A 1NAKH 1LP9F 5DT7A 1QLFB 5D96B 3MRGA 1JBJA 2PBGA 3FO1A 1NGPH 4JZOB 4W93A 4C59B 4LLYA 4NWUL 4GQ9L 1EGJL 4KC3B 5SWQA 4HUXA 1DQJB 3VXSE 2YL5A 1JE6A 4O2FB 3ZJ7A 1HT6A 3KPNB 1L0PA 1UCTA 4YHGA 1I1RA 4BZ2L 3KYNA 1I3UA 1H3TA 2P48B 5LJYH 2YBRB 1WUNT 5GRJH 2IQ9L 2FZ3B 1Z0MA 4ALAH 1G6RB 1E71M 4CD7A 3Q6GH 4MNQE 5DRXB 4LRNH 5JOPE 1QVBA 3MJ7B 2NX5B 1FL5B 1GOHA 1ZBWA 3CBWA 2CMRL 4ISVA 1DVFB 1C5CH 2MPAH 4XP1H 5DT1L 2F54A 1M6OA 3AIEA 4CJ0A 5E8NA 2QQLL 4WCYH 4AJ0A 4JRYE 3SCTA 3UTTB 5D1XD 5B39A 1J0JA 1H8SA 3BCFA 2W0FA 3IT8D 3L5WB 1WAAF 4G6AD 2R29L 1H3PL 3ARBC 3VM5A 4FZEL 4FQ1L 1XCQA 3O8XA 2APBA 4BQ9A 1JFXA 4UU9B 4OLWL 2DQUL 3GUTB 4ZO6A 1MCPH 1F6AB 2B1HL 1HQRA 2DOCA 2O5ZL 4S1RL 2XZQH 4P23C 4NM4L 3ORJA 1CLZH 5GSRA 5GHWL 3RVVC 3A4XA 2QSVA 5IFAH 4LPVA 1OAXL 4RZCB 3VWJD 5EU5A 4F7CB 5JO5B 3GSVA 3OKOB 5IBUB 2AV7B 1G7LB 1E6QM 1G7MA 4XNMB 2QF8A 3KPOB 5IB3A 1QNRA 5C0JA 4G8EA 2B5IB 3HZVA 4ZTOH 2W38A 4P4RA 2YK1H 1E0XA 1KBGL 4RMTA 4Y2DC 1U3YA 3TO4C 5HPMA 2DD8L 2H2PC 2W9DL 3BEWA 5BOPA 5E08L 5BS0B 4D6DA 2WINB 1Q9LA 4WENB 4B53A 3OWEA 1WE5A 3ME0A 3T2QA 1QLEH 3GIZH 1QR1B 4OIAA 4GO6B 1U8IA 4WO4B 3RX8A 1P7QD 1CVSC 5D1QD 1IT0A 1KCSH 2BVQB 5E9AA 3F8UB 2G60H 3QDMD 1XZ0B 2D20A 2V17H 2EXYC 4P2QE 3VPLA 3RM9A 1IZJA 2LAGB 4NBYB 5ILTH 2F53E 3BH4A 5DGQA 4JN1L 4PFEA 4S1SH 4JFWA 1L9NA 1MHEA 4JFFE 4LKCB 5MENE 4JHWL 2GUYA 4QRTA 4JFUA 1YEDA 2GAZB 3QFDB 3WNKA 4WF7A 3D6GA 4DZ8A 2NZ9D 3BJLA 3SO3B 4OF0A 2YN3A 4HV8B 5F8RC 5I75C 4PP2A 4I13B 4ZPTB 1CFVH 4JO2H 2NY3B 2WC4A 1FO0A 3CUGA 5CD3B 4UV7L 1OTUC 3VXUB 4OAWA 1UEYA 1ZBKA 1HN1A 1RZ7H 1Q1JL 1SBBA 2QR0A 4X6BB 2PUQT 3VXQA 4JFZH 4BA0A 5HYQB 5FGCE 3VDCA 3WN5B 3DXAA 1SJEB 2N1KA 3PQYA 4E41A 2ZSWB 3IETA 5ITFA 4I2XE 1H11A 3QR3A 1L7IL 4TX8A 2FD6H 3AICA 4I77H 3MV7D 3FQUB 1FL3A 3C5SB 4UDUB 1R3JA 5FUCC 1DQLL 4W70A 5I1HL 4B41A 2FX8L 2GYSA 1IQWL 3N1PC 1VDGA 4QGTA 2R8SH 3WV0A 2WHKA 1CD8A 3UBXG 5DVMA 1GOGA 2E27H 4XMLL 3R06B 4XVUC 5JNYA 4AQ1B 2J78A 3ARPA 4GI8A 3QQ3A 5IFHL 5I5RA 4YH6A 2GIYA 1IKFH 1X4XA 2FH6A 3ALWA 4N5EC 1AQKH 3O6MH 4KJWC 1II4E 5EZIL 1A6WL 5FUCE 1I1WA 1XSKA 3HE6A 1TQCC 1XIWB 3BE1H 3WJJC 3SDXE 2Q8BH 5DURD 1A6VL 1SFSA 4X5XA 4BCEA 2B0SL 4HW6A 1SY6A 1PZ3A 1UKTA 3QOMA 4QXTB 1QP1A 5I79A 3K8MA 5FV2A 4RMVA 4NQCE 1KEMH 3V4UL 2X4UA 3BP7A 1MRDH 4M61B 3X3GL 1CICD 2GJ6A 1YEJL 4UBDD 2AJ3A 1HQ4B 3HR6A 5FO8B 1BGGA 4KROB 4HULB 4L8SA 5ETUB 3VXOA 2QMKA 3PTQA 4WWKD 1KIPB 5DD6B 1LQSR 1W2PA 1UG6A 3AY4C 4K3EL 4WFEE 5AUMA 1NFDB 3MRDA 3CLWA 2PO6D 1CE1H 4LVHB 1HHGB 4OGAC 3MNZA 4TUJA 3M8OL 3GXIA 3S3JA 4G42A 4KK9D 3W26A 5I74B 1OAKH 5D6DC 1HKMA 1DSFL 3LIZL 4OD2B 3LOWA 1E28B 3PWVA 2Q6WA 2Y1VA 5BMFL 3THML 1JPGA 5CEYA 4BQBA 1KACB 2P5WE 3MBEB 2XWBB 4N42A 2WZHA 1EXUB 3L3IB 2AOSA 3MYJB 2ZCKH 4GQQA 1U3ZA 2P8LB 4PUDA 3MRIA 2EDTA 4OLUL 3HZKA 1C3FA 3GNRA 1O7VA 4F79A 4X4MA 2E9IA 5D5MB 4XUYA 3IKKA 1ZWIB 1P4IL 3MLTA 4LLDA 4Y19D 5C7XL 5JBDA 1B0IA 4NSBA 3UX9B 5D7IB 4DJMA 2MANA 2FEDD 2VLKD 4LXFA 4AZ6A 1OAZL