3W81A

Human alpha-l-iduronidase
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
616
structure length
616
Chain Sequence
EAPHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-iduronidase
publication title Human alpha-L-iduronidase uses its own N-glycan as a substrate-binding and catalytic module
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 196
structure length 616
sequence length 616
chains with identical sequence B
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w81A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 3w81A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3w81A02
3GKZA 3BP6B 2CDEB 4PYSA 4L3CB 3BAYA 2YBRA 4WU5A 3MRPA 1OVZA 5MP6H 1KIQA 1AGCA 4OZGF 5A6BA 4JPVH 1UR0A 3AYRA 2IMMA 2EEXA 4WFGE 2NR6C 1CIUA 1ZLWK 4RAVA 4GRWB 3WDRA 1OM0A 4HD9A 5SWZB 1I7RA 1KT2B 2ICES 3ZOAA 1F6AA 3BGMB 1MXDA 1MLBA 2ITDA 5ALCL 1FV1B 3MRBA 1JGEB 1P53A 3KG5A 4APQC 3SCUA 1ZT1B 1V6XA 4NWUL 3QUYB 1I3VA 2J7BA 3QNZA 2R8SH 4KMQA 4UAOC 3NGBC 3L2LA 2V3DA 3DUSB 2B2XH 4WU7A 3VIIA 1DQJB 5FKPA 1AXSA 1R0AH 1DBBL 2ZUXA 1QZ1A 2BJML 3X12A 4ZENA 1MHEB 5C0RH 2IADB 4DKFH 1UWGH 5ERWA 1WBYB 1ZT4B 4OJFL 3CK0L 2OI9B 4LAQH 3PWLB 5JW3L 4XAWL 1H2JA 3RGVC 2G5BB 3DUUB 4OZIA 1YEHL 4LIQH 5EZJA 4UZSA 1HI6B 5KVGL 2W0KA 1AO7B 5E8OB 2YD7A 3L9RB 4PMNA 2K3TA 4P57A 1JD9A 3NH7H 3S35X 3TTSA 4POZC 5KSAA 5C2BL 1BSIA 2F8VA 1ZJBA 1G7QB 3D3AA 5T1DH 3PP4L 2VAJA 3WUWG 5DSCA 5E6IC 1JFXA 2HVJB 3EOTL 1S7RA 1RVFH 3V4PL 3VFOB 3CSYB 5FHAL 1YEEH 2MSPA 3E6HB 4XNZB 3HC0B 3M8OL 3ETBF 3GNPA 3AIUA 4RBPK 2X8RA 5C08B 1NGQL 3VFTB 5GJSH 4HPYL 5T1LA 2DICA 2EIEA 4LHQB 4NZCA 2VLLA 1JZ6A 1HT6A 3J7HA 4EXKA 2WHMA 1HXYB 1L6XA 3GSWB 2EE2A 3C6LD 4LLUB 2VT0A 3UG5A 4I0CC 1TJGH 4H1LA 4PJ5E 5F9OH 3WMBA 5JA9A 2DQEH 3ZMRA 4JJ5A 1MI5A 5A6AA 2FX9L 4HPOL 2RCSH 4X6CA 5E99H 5J6GB 3QDGA 3HC3H 2KQMA 3OF6D 1C16B 5D9PA 2VXVH 3SCVA 1JAEA 5TF1H 3BAEH 3FN9A 1AGBA 3G08A 4JO3L 4XHJD 3TBSB 5IW6B 5KSBA 2BY1A 2D23A 4Q6YA 1NGXA 1ZTXL 3PG2A 1RFDL 3T1WA 5IVXE 3SUSA 3C5ZB 5C1MB 3OL2A 4TVDA 1OW0A 1F4YL 1LHZA 2Y4SA 4S0SD 3EOBA 3BXNA 4FNLL 2G9HB 3W53A 5J9PB 1S8DA 3MOBL 3U0TA 3RVUC 1JWMA 1RIUH 2ORBL 3DSNA 2YL5A 1RK1A 4NFBA 1QD0A 4BM7A 4HX1B 3TNNB 4XVJH 1H49A 5T3ZE 3GHBL 4LSQL 1UQYA 3EMCA 3WIJA 1CLYH 3IDJB 1BZQK 2VDPL 5C0BD 4LLWA 3GRWH 2NY3D 2VQ1B 2XTJE 1QRNB 2OSYA 2H32H 4MJIA 2I9LA 4X5WA 4BK4A 3HPJB 5C09D 1QQDB 1Q9OA 4L8CB 5A6KA 1AP2A 3BAWA 3Q5YA 1MCRA 1RIVL 4JRWA 4KUCD 1H3WM 5E2TL 3QG6A 4AC1X 3NCYP 1CD0A 1FCGA 1GGYA 1A3RH 2GY5A 4FTVB 4XNYH 1FG2B 4XCFH 4IS6A 3AREB 5EOQL 2BVTA 1P4LB 5TDNA 1G9EA 3VI3E 1XHGA 1E27A 1TTGA 4JDTL 4MQ7B 3TYGH 3K74B 1R3HA 3FO0L 3UJJH 1BYBA 1UXWB 4NQXA 3QXAB 5L6YL 2YMXH 3AS2A 3QWRD 3PGCA 2JIXA 1BBJA 4GRWF 1FHLA 1T21A 3L5JA 1CXKA 4XXCC 3K46A 2DI8A 3BMWA 4KRNA 5E4EB 1AE6H 4FFYH 3CDGA 1LP9E 4GT7A 3S4SA 3VA2C 1YECH 3QUMA 2QF8A 4H26B 1GOWA 2DQGL 5EBMB 2AKRA 3V52H 5A3ID 1BVKB 2BCKB 4JFXB 1U95B 4JFFD 4LVNC 1TPXC 4I5BA 2DF3A 5HYSA 2QSQA 1H5VA 5A2IH 4LLDB 2C9AA 3MROA 3PJSA 2FYYA 4WY7L 3R1GH 2GITB 5D1ZD 1DL7L 4M8VA 5GZNC 5JZ7D 4WI7A 3ZKNC 4Z7WA 1UXSA 4JZJB 1B6DA 1KB9J 1T7ZA 2O5ZL 1T1WB 3LN5A 4K3GA 3ZT6A 4K7PX 5I74C 1ETZA 5KTEL 5GSRA 3NCJL 1N4XL 3PZQA 2WBWB 5F1SA 1MFEH 3DMMC 2UUDK 3PGDA 1ZHNA 3VFMB 4F9DA 5E8DH 3S88H 1SYVA 4Y2DB 1EQCA 2X89A 4OB5H 1YMMB 4JZNB 3S8WA 4G80B 1DANU 3D0VB 4YEFA 2PO6A 2V2TA 2GT9A 4NHUA 3BRDA 2FJFA 4M4PA 2EO1A 2ZNXA 3DVNB 4YH6A 2QMJA 3RA7L 4JN2A 1CGSL 5IEKA 1VGKA 2CH8A 4C56A 1KWKA 5CIPB 3QG7L 3E6FB 3BRFA 1CD1B 1Q9WA 3HI5H 1NUFA 4RAUB 4AZ6A 5JXED 1GJWA 5FM4A 2H9GB 4QHLA 4NT6B 4D9LL 3GSNL 1MH5B 4K23L 5E94A 4LVHB 1ZLVH 2HTLC 4URTB 3BAJA 2GTWB 3Q48A 3QEQB 5C7XL 3EOYG 1MCFA 3I2CL 1E6SM 3THCA 1A1MA 5ESQB 3X11A 4NQEA 3QZWA 2PN5A 3P0GB 5DJXB 5IB4B 2ERJC 2R69H 1T4KB 1EA9C 5D2LA 2X1PA 4X98A 1E0XA 1G0XA 1U36A 1CFNB 4B53A 4B16A 5K9KA 2MQ3A 4QRUA 4YAQA 4G6MH 2W9DH 4KMTH 4C83B 2A6DB 3BZFA 1U8MB 3QIBD 4DGIL 3C8KB 1YEFH 3QP3A 4KKAC 4OQTH 2EYRA 3GK8L 3D85D 5DHYA 4UCFA 4ZUWB 4CN6A 4JFEE 4LBEB 3JV4A 5DDHA 3OHXB 5IBUG 4PB9H 1N3NA 5HHMD 1QBAA 4MCZB 4W4NA 3HE7B 4XX1E 1TJIL 3RVTC 3EYOB 3G6DL 1OIFA 1RUQL 5HDBE 5IFAH 5KANG 3AVEA 3BT2H 2YK1L 2GFBA 4R97C 5D1XD 5F6HJ 5E08L 5I1LA 5DLML 5IEHA 3PZIA 4TOYH 1XCTB 2BVQB 4YIQA 5E2VH 3CU1A 1P7KA 5A6LA 2PYEA 2D7MA 5TJWK 1UKPA 4AD3A 4R8WH 2NXYC 3AM8C 3SDDD 3L3IA 3RQ3A 4U1GC 4N90E 3ULVD 1GL4B 4ODXB 4QT5A 4RZCA 3ARGB 2R15A 3RAJL 4GIAA 2Q8BH 2NLJA 2O5YH 5IHZA 1KQYA 1HKMA 1FNHA 1DDHB 3B9KB 4M7LT 2JJVA 3O6FB 4OCNC 5BXFA 3TPUB 4GW4A 4F57H 2Y8VA 1S7WA 3ULUD 3RIKA 4OCMC 4JFDA 2DLFH 4H0IA 4JFUA 1O7AA 4LCCB 5EBGA 3SO5A 1CXHA 3PWJA 5FIEA 1ZLUH 1FZMB 4P4KA 4DOHB 3RJXA 4YHPA 4GJTB 1HJSA 3L5XL 3G6MA 5GS0C 4D6CA 5HDOA 2HT2D 2FJHB 4NBYB 1JL8A 4GPNA 4UQ3B 4C58B 3KPSB 2Y2WA 2YDRA 1MAMH 2A83B 5CPQA 1NOUA 2E6QA 2DWEA 4JHAH 1KENL 1MIEL 2H32B 1G9NH 1IBGH 3WS6A 4KRPC 1JNLH 4F7PA 2CR3A 3NFSL 2C7UB 4DFIA 4MD0A 4XPHH 1HHKA 1QPPA 1U2HA 4PG9B 2OR8A 5IMMB 3IDNB 1I8MA 4P46B 2LAAA 4ZQKA 5DHVB 4CBPA 4LYPA 5DQJA 3KXFB 4G6JH 1VEMA 2AEQL 4XVTL 5D1QB 4HQQL 5E95B 3VGAC 5A95A 1J87A 4GMTL 4JHWH 5FKAA 4XP4L 4LEXL 3QDMD 2FO4B 2QQLH 4PRNA 4QRPD 4JFYB 2MKWA 4H20L 1PG7W 4G42A 5CEZL 2C7FA 1MJJA 3F7RA 3MYZA 4LMQI 2R9HD 5AAWA 3D25B 1ORQB 1MQRA 4L3EE 3ROLA 4X9FA 3TF7C 2XQBH 4FOMA 5EFIB 1PSKH 4NRXA 5GGSA 4X0KB 3KJ4C 4JN1H 3MRCA 1JCKA 1XGTA 1IKFL 2W91A 3ARBB 2XN9A 2AGJH 1R5IA 4XP5H 2BNQE 3N11A 4DUXA 3SGJA 3VRLE 2CPUA 1IFHH 3DWTA 4Z7VE 2EC8A 1T1YA 4AY1A 1ZEAH 5KVDL 4LQ1A 1MPAL 5FHBH 1VEPA 5JIWA 2P5WA 4S11A 4J1UB 1WQVT 4HKZA 1R8LA 1E6XM 1JNNL 5C0CB 5IWLA 4LFHG 1A14L 4ZPTB 3WDQA 5GGUA 1HINH 4W68A 4K3JH 1KTRL 1ADQL 3S34L 4BELD 3F65A 1AI1H 1HQRA 5D5MB 1V05A 4MXQC 4PJ7E 1JZ4A 3JWOL 1NFDE 4ZNEE 1WITA 2J12B 5DEGB 4ERSL 2VLME 2MCPH 4P23A 1Q9KA 2R29H 1E4KC 4JFHD 1XGRB 3HUJE 1VB9A 1BEYL 4JLRA 1S7TB 1FLRL 1U8NB 5FB8A 3IJHB 1ZA6B 5MEPA 2WVVB 1LQSR 1GQIA 1YQVL 1M71A 1H8OA 3C6LA 1INEH 4PR5A 4KK6D 4HAGA 3UTTE 2OYPA 1PKQE 1QVOB 3HZMA 4BFGA 4Q9QH 5LGKA 2XZCL 4MB5A 1OHQA 5ENWB 2W0FB 3HMWL 2WUCL 1MOEA 1C3FA 5ADOH 4XV0A 3O4OC 1EBPA 2XZAH 5HYSG 5DD0L 3VXME 5EDXA 3IFLH 1QEWA 1OSEA 1BZ9B 4E41B 2J62A 1HOCB 1REIA 3UYRH 2V6HA 3MJ9H 1YPZB 3AISA 2AXGB 3HZYB 1TXKA 3WO4C 5HY9A 4O58H 2IWGA 2DWDB 3K7UA 3A0OA 4YK4B 1CE6B 3BD4A 5E2UL 3O6LH 2BVOB 1VPOH 4LASL 5CZKA 3SCSA 5J1SC 3IFPB 3EO1A 1EVUA 3SE3A 1YMHA 5I1DB 1V0KA 1RY7B 1FP5A 2AJYH 5FYLH 5F7DA 3WYRA 1FFPB 2NY2C 4GAYA 4QRRB 3MNWA 5IROC 1RJZB 3CVHH 3WN5C 4GI6A 4ZXBA 2R8SL 1VFAB 2F54D 3MUGA 4JFWA 1IGTA 2YPLE 4NDMB 4PMOA 4LPUA 1LO2L 3GKWL 1I8LC 3KYNA 3HMXH 4O9HL 4YEEA 3KLSA 4PJDE 4IMKA 5TQ0L 1LD9B 5A43C 3BC9A 4IPLA 1YYML 1OD0A 5SX5K 3QZWG 2Y23A 1YEDB 4NBXB 2APBA 3I50L 4LIQL 2YL9A 2O9RA 4V2BA 1OWRM 4XPGH 3QWRA 1U58B 1FZKB 4QWWD 4HFWB 3NH7L 3V6OC 4Q9CA 3F4VA 1HHGB 3QR2A 4PEEA 2D0HA 5CJ5A 5DWUH 3GH7A 3OR6B 1NFKA 1WEJH 1JHTA 3UPRA 5LGJA 1ITXA 4GAGH 3UTZA 2GK0A 2ATKA 5CJOL 2FX7H 3O81A 1UJ3C 1YEEL 3CFDA 3ZYOA 1JE6A 3QUZA 4WUUD 4TTGA 3E8UH 1F4HA 1S5IL 2EZ0D 3C60C 5EU6E 2ARJB 2G3MA 1KLGA 4ISVA 4R0LC 1A7NL 2AMGA 3U1SH 1H3PH 4P2QA 5F9WB 1CXFA 1CICC 1DJSA 2W07A 5EPMA 3DLQR 3MRIA 4H8HA 4TVPH 3QSKB 2Y7QA 4JY4B 5F9OL 2PKDA 1FL5B 2DQEL 4XCNA 5F6HI 5GGVL 2D2OA 4P4RA 1BF8A 1F42A 3MV7B 4MAVA 1M05B 1NKOA 5E9DA 2RCSL 2UWEB 2A3HA 4P8XA 3ARTA 2XGIA 1RZKC 5DMIH 3KYOA 5E24E 5TF1L 3OKLB 2ZIDA 1FCCA 1G7JA 1FN4B 1XGQB 3LV3B 3SGKA 4CL7A 3TTOA 1EEZB 1L0QA 2WMHA 1CDIA 2H3NA 3RPIB 1NGYB 1VA9A 4WO4A 3EDDA 4KK8D 1NBYB 4MPKA 3WEMA 3MV9D 1MHPL 2PYFA 4WHYG 3EFFB 2DBLH 4NN6C 3VFWB 3GSXB 4KJYB 4ZFOB 4P8VA 1CLYL 2ESCA 1DLHB 2APXA 1AGFB 2MPAH 4Y16C 3ARDD 3MRRA 3DBXA 5IW3A 3H9SD 1W3KA 2P8MB 3TH3T 4BQ9A 3RWDA 2FIKB 4H1LH 2W65B 5TDPA 1NEUA 3L3HA 3VGHA 1GHRA 2ZSWA 1I3RB 3R8BB 4RQQA 1BF2A 1K4DB 2Q76B 1M01A 4OCWL 1LL6A 3LZFH 1F02I 4ZFZB 4UNVA 1I1RA 3ARFA 1YPZF 3OKDA 4D3CH 3UPCA 4I18B 1FNEB 3RZCB 4PJ9C 2XGBA 3NCOA 4PJ8A 1T0NB 2CJUH 4X80L 2VO5A 3QQ3A 3T0DA 2R1WA 3HNVH 2WVTA 3F5WA 3GSQA 2XPGB 3BDYH 3GSVA 1GXEA 2YMXL 3VGEA 1OAZH 2R2BB 3BO8B 5D6CA 1QFUH 2CKNA 3PP3H 3V5HB 1TETH 1ZGLP 2E8ZA 1ZT7B 1H1NA 3GXIA 1B3JA 3MBED 2C0HA 5DHXB 3PV6A 1KYOK 3PWNA 1QLFA 1K4CA 4PIRF 5DJ6A 3WJJC 5BS0D 1GW1A 1X5IA 3O9WA 3R1GL 3VXSD 3OAUH 3MRLB 4KPHH 5MEQB 5DA4A 2GSIA 5CP7A 5JOFA 3UTSB 3WELA 4CUCA 1CDYA 3GBNH 3V6OE 3C2AH 2QV4A 4HGMA 1ONQB 2YRPA 4YC2B 3LPFA 4XZUA 5DR5L 5C0JB 3VIJA 4KK5C 5IHSA 2VE6B 3VIMA 4MDPA 1K6QH 2Y9RT 1XSJA 4O2EA 1LEKB 3IETA 3P3YA 2JF1A 1NOWA 5T3XD 2APTA 1B0IA 1NGWB 1EGJL 4WI2A 3FQTB 3EYQD 1FSKB 3NJ3A 4JFQA 3ALFA 5HYJE 2LTQB 2VQTA 4X0NA 2BSTA 4G6KH 2AK4A 3P73A 4NO2B 3N04A 1LJYA 3ZE1E 1R3KB 4P2OA 3L4ZA 1QACA 1HHHB 3LEXA 1ZS8B 5C07E 1A1NB 4ZUVA 4LP5A 1QSEE 4TUJA 4JJHA 2K9UA 1Q6DA 1UZ6F 4HWBA 4MA1C 1ORSA 1H5BB 3FT3B 4MWFA 3MU7A 4L8DA 2J8OA 1PX3A 5I0DA 4AEHH 1ZLWH 1ZJAA 1MHCB 2NNAB 2UWEF 2BK8A 4UU9A 3VM7A 1MWAH 5D71L 3WNNA 3CUGA 5LAXB 3U9PH 4EVNB 4WW2A 3HZKA 3M17B 4Y19D 5A40E 1G9ML 3QDMA 4YO0A 5H2BB 3RIAK 4QRPA 4F3FA 4PFEA 4KMTL 5J56B 3KR3L 2VXTH 1HCVA 4MHHG 5BRPA 4HUKB 3AIWA 1JWSA 1YEFL 1VKXB 1V03A 2DYPB 2DLHA 2FSEB 3ESVF 3VW3H 3T0ED 4F58L 3FW6A 4HCRA 3OB0K 1IT0A 4J3UA 3MTRA 4OZHB 2BSRA 4PB9L 4NYLA 4RAVB 3QXWA 3VXUD 1I7RB 2EDWA 5E2JA 4MDJB 2ZCKH 4UB0H 3CMOL 1T7XA 4PJGE 1DWIM 2VSDA 1G7LB 3Q3GB 1ZA3A 1S9WA 3OSKA 2G60H 2YC1A 3EGSA 3VIGA 3BT2L 2Z31C 4YPGB 2CLZB 1NCDH 3BEVA 1IT9H 3WNMA 3QNZB 4TOYL 3W0WB 1S9YA 2PETA 4KROC 2MKLC 2BVPA 1PG7H 5FKPB 4XP1L 3U30C 1IAOA 4WWID 1N64H 4F7MB 3W11D 2GJXA 3X12B 4FQJH 1HKLL 5FYJD 4R26H 4UBDD 1F3DJ 5KOVC 2Q8BL 2IFFL 2O5YL 3F58L 4HUXB 4IRSC 1CLVA 3WH5A 4HSQA 1XF3A 3SUUA 1CVSC 5CP3H 4F57L 5FGBA 4FA8A 4RBPH 3NZ8A 3O6KH 1VEOA 1JPTH 3LB6D 3P2TA 3MUY1 3WL9A 3FB8B 5J3HC 2ZUTA 2WC3A 3Q6GH 5EC2A 5DFAA 3HN3A 2DDQL 4ZUTB 4U1HB 3TBTB 4WTXA 2YBUA 4PBGA 5I15H 3QIWD 4OV5B 5DSCB 3OZ9H 4TSAL 5T1KB 1AXIB 1KGUA 4AY0A 4LCWA 4PJCA 3WXWH 4BZ2L 1ZGLM 4U7MA 3I6GB 5D7IA 4JZ5A 1E9LA 4RAHA 1MAML 3VXTA 3H7BB 1W0WB 3V8OA 1S5HB 4JHAL 3WS3B 3TBVB 3LPPA 3KYAA 4Y4FD 2ZSVA 4EANA 3QUYC 4N0YL 3X14B 4ELMB 4FQIH 2XM2A 4PJXE 1NMCB 2X6MA 3HC4H 3T1FB 4X6CB 3GM8A 3BN9D 1AD0B 3QDGB 1IGMH 4Y5YA 3UTPE 2F8XC 2EDEA 1A3HA 1AQMA 5I30H 3BH8A 1KG0B 1N5YH 3G08B 1AGBB 3U7WH 5KSBB 2OI9C 1D6VL 4G8FA 4PUBL 5J12B 1B0WA 1FNAA 4WHYH 4AMCA 1V3MA 2IBGA 1OSZB 1P4IH 4YHYB 4XWGL 3HHRB 1ECEA 3CFCH 3AMLA 4U7SA 1EDGA 3MUZ1 4ZFOL 2VDOL 5IHBA 3DARA 4PJAB 2X4OB 1NL0H 2HT3D 5CD5C 4F37K 1NGZB 3RY4A 2B20A 1RK1B 2NXZB 3W2DL 2DJ4A 2WNWA 1QHZA 4EIZC 4W7VA 2QR0A 5EN2B 2F5AL 2EBNA 4IDJH 1DQDL 3NFNA 1FVDB 3SDXA 1IFHL 4WI3A 3EOAA 4RRPA 1ZVHA 3OKNA 1FYTD 2B5IB 4MX7B 5CZVL 4D0CB 4DKAA 1UA3A 3RUGA 1CXLA 4MJIB 1ZVYA 2IAND 4FZ8H 1SJVA 3WLWC 3ECBB 1IGYB 2HTKC 4PJFF 3IDUA 3V6BR 1N2RB 3VFUA 1KJMA 1VAHA 1HINL 4IHOA 4OD3L 4PTVA 2E4TA 1AI1L 3MUAA 2VUOA 3AROA 1U8HA 4IS6B 5TDNB 1E27B 1SJHB 4Z2IA 4JO2L 2MCPL 2W4XA 1IC1A 1OGAA 5IBTL 1WAAA 2WQRA 3QXTA 1OWWA 4PJHA 3GBLA 4EN3D 4NQXB 2P48B 1E28B 2D7QA 3DHMA 1OOAA 4WUUA 4S3JA 3PGCB 1JWUA 3EBVA 1W9UA 3OXSB 3GI9H 2YUVA 1SEBA 4GAFB 3C5ZC 4M1CD 3FOMB 4FXLA 5LA2A 5I17A 1U2YA 4D6EA 2Y5TB 3A3HA 1INEL 1N7ML 3SKUD 3S4SB 2EDLA 2D0GA 3O4LE 2AKRB 3U9UB 4EUPB 4LHUG 3L95A 3HI1A 1MW1A 3RM9A 5CAYB 5HHQA 1KB5H 3WE6B 1IAKA 1OAKH 3S5LB 1TCRA 3EYVB 4MJ6A 2A74A 3IFLL 3LIZL 1T1XA 2QSCH 5GXBB 4HLZG 3WBAA 3UYRL 2P49B 4Z7WB 5FYKL 2B31A 3MJ9L 3RJQB 1DBJH 5GZOD 1R3LB 4PRHE 3N13A 1QTYT 4NRZB 4OZIF 1D5ZA 4OLEA 4NQUA 1WDQA 1MWAB 2D31A 2H8PA 4O58L 2QKIB 2JCCA 4X83A 3V0WH 4OAWA 5C8JB 1ZHNB 4MSWB 4L4TB 4Z0XB 4UQBA 1MFBH 3Q5OA 5HVHB 3OB8A 2E27H 4G8GB 1VPOL 2APFA 4JKWA 3O41A 1GGTA 1QG3A 2X1WL 3MRKB 4W8LA 2JALA 1BJMA 3AREC 4PLKC 1KXVC 3ARDA 4X4MA 1G6RA 5JUEH 1CLZH 1C5DA 3DXAD 1JNJA 2QBWA 3K81A 3NN8A 1S9XA 2EPOA 2EXWD 3VIPA 3FFCA 3D87B 3HCVB 4XCEA 1Q4NX 5F21B 5B39G 1F97A 1YC7A 3LN4B 5E4EC 4DZ8A 4XNQA 3HMXL 3OKYA 2HAZA 3O3DA 4JVWA 4X7FC 2CKBA 1UJTA 4ELMF 2VL5B 4D72A 1C12B 2F74A 3DNKA 2HN7B 2HFTA 2WIIA 2AP2A 3OKMA 1XH3A 4X6CF 4PGCA 3I02B 3IRZA 5CS7A 5HSFA 5JHDB 2O5XH 4X98B 3CZEA 5KZ6A 4OCXL 4XVSL 1M03A 1AO7E 3GSRA 5KSBF 1FFNB 4JZJC 4F33B 1HSAA 1C7SA 3U83A 3I84A 5DI8A 4P3DB 1WEJL 4P7LA 3B2UC 5GSVA 3MBXH 1ESWA 1P1ZB 4Z95H 1F90L 2FX7L 4HKXB 3AXLA 4PJAF 4DFHA 4Y2DC 1EOKA 1H41A 4J6RH 4C7GA 1N3NB 1Q9LA 3E8UL 1F8TH 4PJIB 3CUPB 2JK5B 4WFHE 5KSVA 5EZIH 1H3PL 5SWSD 2NY1D 1FNSH 2FJGB 5I1LB 5HHNB 4M7LH 5E1HB 2R2EB 2PYEB 3QUXB 2I60H 2OX5A 4U1SB 1MRFH 2VKXA 2JJUA 3VGFA 2PTUA 3WQ6A 1E4XH 4LVHC 4HIJA 4BUGA 2QQKH 3FL7A 1JF1B 2N1KA 5IHZB 1NCUA 2NY5H 4XPBH 4EQ3A 1G7HA 5HDLA 4ZDHA 4GO6B 4P5MB 1MFNA 2OMBA 3TT3H 1UWXH 3DROB 2NW3A 2E7LA 5TE4H 2Q7YA 4W7UA 3CDFA 4ZXOA 5FCSH 3UG3A 2JB6A 3SDAD 3SOBL 4YHGA 3PWJB 1UKQA 1KXTB 5FA4A 2MHAA 4YHPB 4PN2A 2DBLL 1HKFA 4IOSD 1K6AA 3PE9A 3VDHA 1PQZB 5ID0B 2XXCB 1C5CH 5DK0A 4YHIA 3WFEL 5CGTA 2I5YH 2VH5L 3QH3A 2CIKA 2D9QB 3ZKMC 5IFHH 2A3BA 2R1YB 4DM2A 1O0VA 1MFCH 3H3PH 1FO0A 2X4SA 5F72S 4Y19A 1QBML 3F12A 5F7LB 4AXNA 4Z7WF 2O61B 3GMRB 2VVNA 4GUPB 4MD0B 5CJQL 2FLBT 3DETD 5MEOA 3BJLA 3VXQB 4MAUH 4JM4L 4Z7NF 5DK3A 1NM9A 4WDIB 3T0EA 5A16A 1LO0H 5DQJB 1UACH 4M8QA 3UZQA 3PQYE 1FC1A 4NM8L 2NY4D 3P9MA 3BDYL 1CD8A 1QFHA 4Z8FH 3P77B 3ARGC 2YRLA 1NARA 1WCGA 4PRNB 1NMBH 1PEWA 2ATPB 3MV01 3VRIA 1ZBCA 3L4VA 3B9KC 2IMNA 1MHHB 6FABH 2CRZA 1HJXA 5DMGC 2L7UA 3DI2B 3MNVA 4JRXB 4LCCC 2CDGB 4D0BB 2HJFA 5I3DA 1GVYA 5LCVH 3WNKA 1HH9A 2YLLA 1OCWL 3LKNA 2D1ZA 1NDGA 3BX7C 4X7TA 1CXEA 3KPNB 3P0YL 4ZO7A 4JHZA 2V2WB 4JG0H 4N68A 4UDUB 3T04D 3QEGH 5E00A 5AD0B 5FGCE 2AXFB 1T1YB 4OF5A 4RRPG 1KB5B 1B1YA 4EXPX 3C2AL 3INUL 4BJLA 2D3NA 1ZWIA 3D9AH 5FCZA 3MJ8A 3PHOA 1IJ9A 4JL2A 1MJUH 3NDZA 1RQ5A 2P44B 2VDML 1A6AB 2IUZA 5J8OA 1KXQE 1AY1H 4NO3A 1A1OA 1A9BA 1AQDB 5EU3B 3N17A 1NAKL 3MZGB 1DWJM 2EDFA 1GOMA 4P46C 5I8EA 5I1KL 2XFRA 4ZPVB 1CD9B 1XT5A 1XCWA 5AWNH 1Q9KB 4J8RA 1FBIH 3TV3H 2R0LH 4X7EC 3CO4A 1EERB 2VX5A 3TOPA 3AXIA 4YXHH 4G6KL 4Q97A 4PJIF 1K9DA 2QLYA 1U92A 1X5YA 2JIEA 1RUKL 4UFJA 4CKQA 3DIFA 3ULVH 2ZUMA 5IFPA 2P8PB 4R7DB 5EFFA 1RJCA 4J27A 3OIHA 1AGDB 3RY5A 5I77A 5HHVL 3VFVA 5HI5C 3MJGX 4QLLA 4HHAA 4GSDH 3G5YA 4JANA 4APQA 3BCFA 1JPST 3ARBC 4GZJA 4NGHH 3MMEA 3ULUH 1MWAL 1QOXA 2YBTA 4NNXB 1EH9A 3DHJA 4M24A 3VNYA 1LP9A 4LDOB 4PYHA 2AJZB 1U8JA 5ITBH 4M9PA 5HHOD 4M5YH 4IM4A 4F2MA 3FAXA 1J5OL 1R7AA 2X4RB 1KIRB 2F53A 2M26A 3S36H 2V5CA 2XY1A 5F7YC 4KZDL 4X9GA 3RGVA 3H0TA 3I6LD 5DT7A 3UYOD 1VCAA 3LKOA 3MREA 1JRHI 4MQTB 3SJVA 4PJEA 1RI8A 3IT8D 3CSBA 5I1AB 3O45A 1PPIA 3C9NA 4FLQA 1HYRC 5ICXA 2VZ1A 1INDH 4RA3A 2G60L 1BPVA 3M6DA 3RIFK 5C0BB 1IARB 1J8HE 1L7TL 4GXVH 4WJ5A 1FYTA 5JR1L 2NY3B 5ECJE 1QHPA 2UY3A 4OZFB 5IQ9A 3IDMB 5C09B 1NCDL 1YEKH 2X4NB 4CD8A 5E6IA 2MJWA 4K94H 5TDOA 1EIBA 3UBXG 1ZGLB 4PRPD 4QO1A 3HI6H 5IKCB 4NKDA 4CJ1A 4E42B 4ETQA 5EUKB 3GHEH 5E7FA 3QA3B 3SDYH 4ACZB 4IBLT 5IB3A 3L3DA 2ZUNA 3SO3B 3IGAA 4X6DE 4N0UB 1AC6A 1XIWD 3N15A 2NZ9D 2X42A 1WCBA 2QTEA 3HAEB 1F11A 4TTDD 5IHUL 1XEDA 4QF1B 4MZ2A 2EE9A 2EKJA 1R85A 3O6KL 5E4IA 3V4UH 4MNGA 2ZICA 3QRGL 4ODTL 3N85L 4P2RA 1W9XA 5I15L 1Z3GL 3VMPA 5LGJB 5JQ6H 5K59F 3OZ9L 4Z7QE 4YK4C 4JFFB 5C0GA 3STLB 4PGDB 4WLCA 2AEPH 4ZSOB 1T2JA 3O2DL 3MODH 5I2IA 2UY4A 4GBXD 4UV7L 4HV8B 5D1ZB 1Q6FA 5DJCA 1EHLH 1P5VA 4FQPA 3OJMB 1R24A 4MAYD 1CT8A 3DTXA 5ALBH 4R90L 5TPWH 3JVGC 5L9DH 4TTUA 4JRYE 3MMDA 4KKCC 1A7RH 4XBGB 4WCYH 3S96A 1ISZA 1AKJD 3L5IA 1IGML 5D96C 5K9QG 4O4YL 1NFIA 1FFOB 3R8QA 1BHGA 1N5YL 5M3WA 4PRBA 1U8PB 1JNHA 1HHIB 4MS8C 5B38B 1N59B 3SQBA 1J9CT 1MEXH 2Z4QA 2H3NB 4PP2B 1A5FL 3TO2A 3RU8H 5TFSL 5EB9A 3DXAA 3AHZA 1IC7L 3FZUD 4JPIB 1X7QA 2D7TH 4OTXH 4TUKH 5AC4A 4LHJB 1GH7A 3WXVL 3HB3C 4NP4L 2WP3O 5F1NA 2FB4H 3ILPA 3P4NA 1BWWA 3MS8A 1O6IA 2F58L 5C6PB 4IDJL 1BQUA 4S1DC 5A6MA 1SJEA 3DBXB 1F58H 4XXCA 3P30L 3WFBL 3SURA 5HGAB 2CK2A 4WI9A 3BPNB 3MLVH 4M1GH 4Z77B 4W4OC 1PZ2A 1RUPL 1KPUA 3KL3A 3GNML 5BRZE 1EJ6A 2APWA 4ZTPL 5F9WC 1YY8B 4HBCL 4MNHA 5CMAB 3OKDB 5TH2A 3I75B 5EORH 3GI8L 3QIBB 5C0CE 5C8BB 5CILH 3L3GB 5EBWB 3PWVA 4I2XA 3D85B 4KKBC 1D9KD 3B3IA 2YZ1A 2CDFA 5D70H 4KI1A 2XICA 5EUOA 1G9NC 3WSQL 1CDCA 1TDQA 5FOBA 1BX2A 5HHMB 3UJTL 1FJ1A 1RU9L 5E7BA 5AYQA 4U6YB 2A77L 5D7JD 5FOJA 2NX5D 4XNUH 1MQKL 4EBQH 5DUML 3QFJA 4AK1A 1P4BL 3KPMA 4YBLC 5C0EA 2DMBA 5D6CB 3F7QA 2IPUK 2DLGA 3KWWA 3CPUA 4AH2A 5L88H 4ALAL 2XHYA 1RZIA 1PY4A 4QOKD 5D1XB 3X3GH 1I9RH 4XVUD 5DQDH 5I23A 3G5XB 2X10A 2CLVA 2K7QA 5JLZB 3X13A 1WWAX 4KI5E 3ZTJG 4GZEA 3SDDB 3D0LA 3LEYH 3NSMA 4BSVB 3MV8B 2PC8A 3MRJB 2DM7A 4P3CL 4X4XA 2P45B 2V7HA 2DLIA 3RKPA 5BXTA 2NY7H 5CP7B 5CD3B 5JOFB 4MD5A 1TZHB 4IRZH 2QADD 4CRPA 1DBJL 1RZJH 1ODAA 2QQQA 1UYQA 2Y24A 1NANH 5D9MA 1KEML 3REVA 1YPZE 2DAVA 1I1AD 1YNTA 3SCOA 2A3EA 1QYGH 4PGZA 1MCEA 1MFBL 2B4CH 1A02N 4FFVC 4KJPC 3MRDB 4I18C 3RZCC 4HF5L 1E43A 2R0KL 2XZQH 4J23A 5A2FA 4S1RL 3IETB 1FC2D 3PWPD 4YFDB 1WTLA 3FN0H 4Z7UB 4IMLB 4U4BA 5HYQA 2NMSA 4Y1AB 2VLRD 4GG6B 2WXDM 1SYSA 3IF1B 1FIGH 3RRQA 5MENE 2J4GA 4D1IA 5JOPE 3W0KA 3PIQB 5DUBA 4AYSA 2BSTB 2Q86B 2EO9A 1KB3A 5JNYA 5DJ0A 4G9FD 2XJ7A 2WAHA 3KLDA 2DBJA 4L1HA 3VFSA 1I1CA 1N8ZB 1TVBB 4OD2B 5HVWA 1JYXA 3LEXB 4KJQD 1ZBVA 2ESVA 4LCUA 4BS0A 4ZUVB 1KCSH 2JJSC 5INDA 3FNDA 3GUTB 2BNJA 3FQUB 2I07A 2OXGA 3HA0A 5A8MA 3WKNA 4L8DB 2PBGA 1H0DB 1RK0A 4HIIA 4UFHA 5HD8D 4MA3A 4NKIL 5TE7L 3RWEB 1J18A 4MB4A 3C8DA 3HZKB 1K8IB 3QDMB 3QYCA 2EE3A 4QGYA 3TGXA 4QRPB 3IS1X 4F3FB 4I3GA 3PZTA 3BD5A 4JFPB 4XCCH 2E0PA 3QEUA 1WKYA 4PTUB 1WDSA 2FDBP 4LLMB 1BVNP 1YNKL 5DJ2A 1KN2H 3FQNB 4JZOA 4WTZA 4QEGA 2G5RA 3QULA 4YC2C 2JFEX 3GMQB 3DHPA 4S10A 2H26A 1G6RH 3VCLA 2BSRB 5I19H 4NYLB 1I7TA 3FQWA 1MF2L 2AXHA 2UZYB 1MCBA 4FXGA 1B3YA 3CC5A 1ZA3B 3BSGA 3DGCR 4KVNL 4D9RE 2E6JA 4YGVB 1J0IA 1FSKC 3KPQA 5F8QC 1BGGA 3V7AG 1QKZH 1FNSL 1FGNL 3O3AA 1T7WA 2LTQC 4Z5RA 4CDHA 2WAGA 2VNCA 4LNVA 2CKBH 4M7LL 4DTGL 3CXDH 3KAAA 5EO0A 3BKCH 1LK2B 3VH8A 1IAOB 2A6IB 5A69A 2GJXB 2FATL 1IM3A 1JGLL 2BMKB 3EJZD 4HXBL 1IMHC 3WD3A 2VR9A 3T77B 5I8KH 2OSWA 4V27A 2IQ9L 1H5BC 5I1CH 3EYPA 5HGDB 1QSFD 1X5KA 5IHLB 1GNXA 1A64A 3K4DA 3TT3L 4M7JH 2IALA 2A9NH 5TE4L 3QEHB 3F5LA 4Y4HC 1U3HC 2EYTA 1JYNA 1IM9A 4Z7OE 2PWEA 4K9EL 1MCQA 2ICWJ 1EDQA 1KCUH 3IKKA 4BQ4A 4YBHA 3VA6A 2VDRH 3IFNL 3NCCB 1MFDH 5B8CB 5M17A 4K71B 4MJ5A 1MJ7H 2P5EA 4CADA 2C3HA 3MA9H 1BQHA 3ILQD 4O2FA 5EA0H 3HNTH 5CXPA 2I5YL 1JRHL 1H0GA 3DV6B 4YQXL 2PW1A 1E3XA 4Z76A 3ULVF 3MRQB 6TAAA 1HH6B 3VFGH 4ACYA 1EO5A 4KTYA 1F6FB 3CFJB 4NO5A 3RVVD 3RPMA 5E2WL 4B7IA 3WKZA 5CSZA 3AU1A 4OKVB 2NW2B 4P48A 3VIOA 1WICA 4DW2H 3MA7B 2HRPH 1E70M 1IGFH 4PTWA 2F5BH 4MAUL 3KLHC 5T1MA 3ULUF 4RL3A 1MFAH 5JIHA 4JO4H 2PWFA 3WH8A 4M00A 4AENA 1LO0L 3BRGC 1UACL 1UEYA 3GMMA 5JW5B 4N0RA 3BH8B 4L4VA 4KJWD 1AR1D 1L7IL 2IPTH 4ONFH 5AZ2H 4Z7UF 1UB5A 1S7UB 3OR7B 1IC4H 4OT1L 4UDTA 3C08H 4YHNA 4GG6F 5A6JA 3VXRA 3UP1A 2DQHH 4KTDL 1A6VH 4HIEB 4PRPA 2EDQA 1ZE3C 2F54B 4YR6B 1E4KA 2CKSA 2XG9A 1YY9D 5DVLA 3S37H 1FO0H 5TQ2H 5ANME 1DQQA 1XIWA 1MIMH 5EG6C 1TVNA 1ZANH 4WWKD 3NA9L 3OKNB 4AD2A 4BSJA 5I2UA 5CBEA 2H6PB 3QAZB 4QHNA 5D7LD 5D8ZA 3FAWA 1T5WB 3UTSE 4MADA 3D9AL 5F70A 4KK9D 2WMJA 1JV5B 4HUNB 4RX4D 1IL1B 4NJ9L 1JDDA 2BY3A 3DUHA 4OIAA 5GRJL 1AY1L 1EAPB 3SGDH 3L5WA 1T04B 3MLTB 4IHOB 1PX8A 1KC5L 4X99A 1UQZA 3EO0A 1WWCA 2PTTA 3PDOA 1NMCC 3UZEA 4EJ1C 4NIKB 2PR4H 1K9FA 5C0AD 4Q2ZA 5AWNL 3BPLB 1C1EL 2EXYC 1PLGH 2HG5A 4LDLB 5KN5B 1TJHL 5I16A 3L4WA 1WC7A 1W91A 3LH2L 4HIHA 3R0NA 4K7FA 1OAUL 1SEBB 2HLFC 2PXYD 3REWA 3ZTJH 5I17B 4U1NA 3WH6A 4MAYA 3WIHL 5FUZH 1HJQA 5FYLE 2BSED 5HXMA 2NSXA 5ISZD 4ODUB 4WEBH 4HUWB 2VZUA 2UZXB 2E7CA 4NKMA 1IAMA 4HJ0C 2X70A 2NXZC 2EIZA 4PSPA 3F6IA 1C92A 5IROA 1ITCA 3WN5A 5FECB 1ISXA 1A0QH 4NGHL 2A74B 3ULUL 2FH8A 3O3EB 5EC1A 5A2AA 3R0MA 4IJ3B 3EO9H 4HUVB 5HNNA 2B5IC 3GJFA 4M5YL 3T3PF 4DVRH 5E5MB 5IG7A 4PJFE 5TGBB 3SEPA 1E55A 1I8LA 5L2KD 4I13B 4OAWB 4PMRA 3MV9B 1W72B 3GMOA 5BV7H 4KTEH 3H8NA 4JGUA 1RURH 5C08D 3RX8A 1IZKA 2HLAA 1HNFA 3KYMA 4FQ1L 1WT5C 4WW1B 3BIAX 2SEBA 3VRJA 4OGAD 1PIGA 1I1FA 4I9WE 1QNQA 4GXVL 1JGDA 3U0PB 3H9SB 1C5DB 4ZEPA 3NN8B 4CD7A 1X5FA 3BP7A 4LEOA 5E8EB 4CW1A 3HI6L 1GHSA 4OZOA 3QNYB 4TQEH 3W39A 2Q1EA 1PZ5A 3GHEL 4LPVA 3SDYL 1EMTH 3C5SA 4XNQB 2OTUA 3C60A 1W3JA 2OYMA 3LPOA 5KG9B 3O3DB 4R0LA 3JV6A 4EDWL 1ACYH 3SY0A 4TVPE 5FXCH 1HEZA 2JE8A 1WP6A 3O3UN 4UTBH 3WBDA 4RISL 1CICA 1UWQA 1A9EA 5I18H 3VO0A 3OGCB 1GHFL 2FIRT 1A6PA 3RHWK 4OZIE 1D5XA 2WINB 2ZPKH 5D7JA 2X0YA 5CEZD 1X9QA 3GSRB 5FO8B 3EJYD 3NCEB 3TH2T 4HPGA 2OLHA 2J47A 1S9VB 3WHXA 4WFGD 3HS0A 3A4XA 4QOKA 4WTZG 5CWSA 5KANI 1GSMA 2WW5A 3GO1H 4CN1A 2WMIA 2PCPA 4TX6A 2MFNA 1NJ9B 1H3UA 1RMFL 3B43A 2GJZA 4UI2A 3MBEB 2ADGB 5HVHC 3OPZH 3TESA 4PP1D 3ARWA 3WF2A 3MO4A 5BS0B 4ZOAA 1LMKA 2V9TA 5DRWA 4AEEA 3VXSB 3NIYA 2J8UA 5IGXL 2W67A 4UIKL 2V3EA 5EO1B 3SDXF 2B8OT 4XC1L 1A47A 3GGWA 1GZPA 1I1AA 1BAFH 3KL5A 4GS7B 1Q0XH 4Y16A 2BRRH 3JSSA 5FL0A 3QPXH 1KGWA 1MI5E 1AVAA 1IEBA 3IVKB 1NBVL 2R0ZL 2UZIH 4X6CE 5MERB 3QDGE 4ELKA 5JW4N 1W1PA 1G7HB 3PWPA 2N4IA 1S7VB 4KGJA 3RNKA 3W81A 2J6EL 2VIRA 5KSBE 1QR1B 4GZIA 3QQ4A 4G3YL 1WAAF 2GYSA 4CMMA 1Q94B 2NW3B 3AIQA 5A2JH 1S7SA 3FXYA 4KKLC 4J7RA 4GQRA 2D7TL 3G5VB 1MVFA 4UV4H 4ZAKB 2FB4L 4RMRA 2ICWI 4R4BA 1KLUB 3GSOA 4LOUD 1P7QB 3QRFM 3ZE0F 5IBUB 5INCB 1XGPB 1YEIL 3F62A 5JQHC 3SCPA 3T09A 3P4MA 1BQHG 3GIVA 5FO7A 2D3LA 1H3VA 4M1GL 3OBAA 4G8EA 2FHBA 1FO0B 4OZGA 4PJ5D 2VCBA 2X4SB 4MJIE 3SGEH 4BFIA 3S36X 2CHOA 3CH1B 3AICA 4XMLH 2VL4A 3RI5K 5FUCC 2LABA 3DVGB 1CFVH 4G8IA 3WJJA 5J1TC 1BIHA 1QBBA 3BWAB 3N9GL 3QUXC 2JCCF 4YHKH 1NCAL 2ZUQB 1IQWH 1A6ZA 4ZUSA 5H35A 1V8HA 3T4AB 1NCWH 2IEPA 1OY3B 1DBAL 3VXUB 4MVBD 5KS9A 2MQ0A 4ENEC 4Y4KD 1N26A 1DUYA 5BVPL 1E6RA 1UD3A 2IAMD 1BGXH 1KN4H 4X9HA 4JPKL 3MNVB 1BGAA 2ZKHH 3BKJH 2HJFB 2XSAA 5A1AA 4K7PY 5LWYH 4X7TB 4EI6B 4P2CG 3BHBB 1G01A 3T8XA 1PFCA 3N0PB 1T22B 3FB5A 4OZ4A 3QHZH 3LEYL 2AABH 1T0MA 2LU7A 4DWSD 1I3GL 1M7DA 5L0QC 1FL3A 4GO8A 4YBQC 1NUDA 4IRZL 1NEZA 4YHZH 4WI5A 4ZODA 1QSFA 5DGQA 3ROOB 1HHJA 1KBKA 3A47A 4Z7WE 3ZJKA 1H0IA 3D2UA 2ICWB 5IB1A 4LCYB 1EPFA 1EX0A 3WHE1 4WKFA 4PY7B 4Z7NE 1A2YB 3D69A 1MUJA 3QWOA 5D72L 4HFUH 5DEFA 3WS6C 4YHEA 4M1DL 3DYMA 1TZGH 3HE7D 2D7NA 3QIWB 3AHXA 4LSSH 4ODVL 1Q6CA 1V0LA 2OP4H 4AWEA 1WF5A 3FN0L 4DZBA 5IF0B 1A6TA 5DZLA 3VG9B 1FIGL 5IVZA 2DTSA 1UG9A 5F1OB 3K8LA 2HWZL 3LEVL 2IBZX 4C56E 1E40A 3GDBA 3MLZL 4HWZB 8A3HA 1CG9A 1E4LA 4Q74A 2EEAA 1UGNA 1AJ7H 4AISA 5DMYA 4P0DA 3FTGB 4UILH 5FK9B 1G7PA 4Y4FB 5CKGA 2JJWA 2EIBA 1GQKA 1WAWA 3EW3B 2C3VA 3AS3A 2FGWH 4CVZB 2VURA 4PMVA 3O6FD 3VFVB 5H37G 3TZVD 1T3FA 3LHPL 4EDXB 4O51A 4WK9A 2D4FA 3IXTB 4NQEE 2E9JA 2DQDH 3MLXH 1VBUA 1V3LA 3IKCB 1ZVSA 4E2OA 3DRTA 4E4PA 1KTDA 1WIUA 2YUWA 3QDJA 3LOWA 5D2LE 3ZHDA 1W72L 3O4LA 1FVEA 4TRPH 2NT1A 1UQSA 3BZ4B 4DK3A 5ADPL 3IJYB 2OJEB 4XP6H 3G6AA 4IRSA 4TSCH 2EDHA 4OCSH 2VLJA 4LNRA 1XC6A 3VD9A 5K9JL 1A7BA 3H0TB 1OD8A 3NACH 3GSNA 5I19L 1ES0A 4PJEB 3O45B 4XRCA 2GUOB 3SCMD 3TWCL 1LEIB 4GKSB 4Q0XH 3C9NB 5JHLH 3WQ4A 4NFDA 3EHBD 2BSSA 1P7HL 2CMRL 3LKQA 1A8JH 4WFFE 1TVPA 3BP6A 2CDEA 4M9OA 4L3CA 4PBVC 2YEZB 1QKZL 5IQ9B 3JWNC 2IANB 1KCKA 1CDUA 3QGVA 4YDIH 1NP2A 1QNZL 3G04B 4WGWB 3BKCL 4M6OH 5D1QD 2W1NA 3PABB 2Z92B 1E6QM 3C6LC 1H11A 5D8JL 5IB3B 2PYEE 1RIHH 1UWEL 3ZL4L 2EIDA 5SWZA 1KT2A 3EFDL 1TMQA 1OGTA 2G75A 2YOCA 3BGMA 4FMVA 1KGXA 2DM4A 4ONOA 3RVWD 3T3MF 2JEPA 3R06B 4OD1H 1FV1A 2IGFL 1YN7B 1JGEA 4EN3B 1ZT1A 4OCRL 2XKSA 1KBGL 2A9NL 4FQQB 4XHJC 1DQJA 2GUYA 4JFDE 3MNZB 1KCUL 3Q2CA 5FF6B 4CVUA 1MHEA 4HZ7A 2IADA 2W63A 2VDRL 4FN0A 1WBYA 3LKSB 1BQLH 1ZT4A 1PD6A 5T5FH 5FO9B 2JELH 1CGTA 3PWLA 4LCIH 4TUOA 2G5BA 1E6NA 1DQLH 3DUUA 2J3SA 5EA0L 3NSNA 3N18A 1H3TA 5LXGH 1HI6A 2DM2A 5E8OA 4CCCA 4DGVH 5GS0H 3L9RA 5TD4A 2BOBB 1CLOH 2J7CA 3SE3C 5GGTH 5DJCB 1IGJB 2F8QA 3FOLB 1INQB 1DBKL 1IGIL 1S3KH 2NY3C 2DRUA 3EYFB 1G7QA 2PTVA 3HZVB 4JY5H 4TSBH 4QXGH 4CU6A 3QOMA 4F15B 5LBSH 2R4RH 4N90D 2W66A 2F5BL 2HVJA 4NZTH 3CSYA 4KKNA 3E6HA 5T3XL 3HC0A 4LGXA 1KPRB 4LGSB 4UR9A 1X1NA 4OLWH 5C08A 4PUEA 3VFTA 1W9PA 3SO3C 2KUTA 5ABFA 3UR8A 1DBML 1HXYA 3GSWA 4JO1L 2IPTL 2VC2L 4LLUA 3THMH 2NW0A 1IC4L 3DXAB 1E6PA 2Y1VA 1A6VL 2IQAB 2PWGA 3DYPA 4Z18A 5J6GA 3WKMH 3P4NB 2N7BA 3DHUA 5IIEB 1URLA 5DS8A 1GIGL 5I76B 5HDQH 2PW2B 1RHHB 3LDBB 3TBSA 2VDQL 4AMKH 5IW6A 2VX6A 1OP3K 1LLOA 4LARL 4TPRL 3C5ZA 1IC5H 1OARH 4W89A 4QNPE 5I1GL 1HWGB 5BVJB 5GNZA 2G9HA 4JB9H 5J9PA 2C4XA 2DSZA 4M03A 2BNRD 5D1ZC 4XPFH 3WDIA 5JZ7C 3TIDB 2P5WE 2WUBL 1A7QL 1I85C 4HX1A 3TNNA 5GGQH 3B2VL 4OGXH 1BYDA 4I2XB 1FH7A 1KCVH 3IDJA 1UB6B 1BBDL 3V5DA 2PR4L 2VSCA 2VQ1A 4MMXC 1QRNA 4U6XA 5JPNB 1PLGL 1HVXA 3HPJA 3CUHA 1QQDA 2AV1B 2QSTA 4PJEF 5DVKA 2JF6A 4L3ED 1QI5A 4TYUA 3LMJL 1L0PA 3KPMB 2DQCH 4OM1H 4HC1H 3KWWB 1XGYL 5SWSB 2NY1B 4FMFA 1GORA 3SIMA 1KIPB 4E9LA 4LU5H 4FTVA 3W26A 1FG2A 5FYJL 5GS3A 3AREA 3ET9F 1P4LA 1EEQA 2BNQD 4FRWA 4MQ7A 4WEBL 5ESVA 1I8KB 4HWEH 3CSGA 2EECA 2YN3A 4GRLD 5JXEC 1UXWA 1ADQA 3QXAA 3ZT7A 1A22B 3AJ7A 3DX7B 4DEPB 1UR8A 4GI8A 1R5WB 1DQTA 1HDMB 4CCDA 1MFUA 3BPNC 5EBMA 3BPCB 3JZ7A 2WC7A 2CXGA 2EICA 3S35H 1BVKA 1PGRB 4JFVA 4KWUA 3GSUB 3SUVA 1U95A 3SDAB 2VLMD 2YLAA 4NOFA 4FG6D 3QIBC 1GCFA 3LQZB 2GITA 2HKFH 2N7AA 1CK0L 3ARUA 4JZJA 1WZ1L 1RSFA 3TIEB 4HAFA 2W9EH 3JWDH 1U93A 1HYSD 3LSOB 2XA8H 4PG2C 2OLDA 4U2YA 3VPLA 5DJ0B 3VFMA 5H37H 4FLSA 2E7HA 1FRGL 4J2XA 4Y2DA 4UT6L 1YMMA 4JZNA 4ZTOH 4G80A 4NJAH 4RWYH 3Q6FB 1CQKA 4LCUB 5D1XC 3VXMD 1KEGH 1FGVH 1JVKA 2I07B 3DVNA 2B0SH 1FIEA 5IW1B 2EQDA 3GJFH 3MLSL 2JB5H 5F9JB 4LSUH 1EFQA 3OGOE 1RK0B 1QFWM 2NY4B 5CIPA 3SDDC 3ULVC 1CD1A 3N50A 5E6ZA 1S46A 1MW3A 4RAUA 1Z5LA 2HFGL 1NOFA 3K8KA 2RFXB 3D3VB 3BYYA 1Z9LA 3WUGA 4D2NA 4Y4KA 2Y36L 2H9GA 3MXWL 1Y18B 2WZHA 4XUYA 4D1JA 4NT6A 1D2KA 1MH5A 4M29A 1YYLL 1M7XA 3NAAH 5DJ2B 3UZVB 4W85A 3ULUC 2GTWA 3QEQA 1HXMB 3S37X 5JIKA 8CGTA 5FCUL 3QHFH 1NWSA 2XVGA 2RBLA 3VMNA 4KZEH 3V7MA 5IMOA 1T4KA 2E9LA 3OAZK 3OPZL 4QCEA 4A4AA 3WQVA 1CFNA 2P46B 4DWSA 5GRYA 4BQCA 4ZSOE 2HT2C 1MRCH 3VXOA 4F7EA 3EIFA 1B31A 4C83A 2A6DA 5BXSA 1U8MA 2YPLD 3C8KA 4AIZB 4P2QE 2FLRT 3E2HB 4ZUWA 1BAFL 1Q0XL 4LBEA 3VWKB 2VDLL 1IVLA 1T2QL 3CTTA 3VH8B 3OHXA 2UY6A 5F9DC 4U1IB 4HG4K 2HJLB 1FDLH 3FCTB 4MCZA 3HE7A 5E9DE 2UZIL 2XTLA 4DAGL 1XF5B 4K94C 5I0ZA 5E09A 1U6AL 3CXHJ 5ALCH 1E0WA 5MHSE 5ELIA 4KFZC 1V3JA 4NWUH 3GBEA 1XCTA 1WBZB 2BVQA 4FQLH 3STZB 1YHTA 4OBSA 4LKCB 4R9HA 1DBBH 2C3WA 4EOWL 2BFGA 5IMKB 4GH7B 4ZUUB 4OV6F 1NCBL 5HBFA 1XR9B 4FQCL 2R9HC 4ODXA 3ARGA 3ZDXF 2NPLX 4OJFH 3CK0H 5CGMA 3QCUL 5JW3H 1M1SA 4L29B 1E72M 2VKWA 1XSIA 5EU6D 5HYEA 1V3IA 1DDHA 4N8CH 3RO8A 3B9KA 4WGVB 3O6FA 4YPJA 3TPUA 1YEHH 1FZJB 4NI3A 5KVGH 2NY6D 2G3JA 1GJIA 1GPOH 3SDCD 5JOEA 3JUYA 4LCCA 4PRID 5FYKD 4XMLL 5HDRA 2VXQL 4LVOB 5HHOB 1KR1A 1FZMA 3ZSSA 1CFVL 3AU1B 4K8RD 4FS0A 5CUSH 5GRVK 1AGEB 3EOTH 3U2SB 2FJHA 5JXAL 3V4PH 1W2KT 5FHAH 2WK2A 3M8OH 3CFEB 3TN0D 1IQWL 4BQ3A 5JMRA 5LGHL 3GMMB 1NGQH 1FNFA 3M46A 3KPSA 4HPYH 3I6KB 3BEWB 4FFWD 2A83A 1U2CA 1Q0YL 4QAWA 3ZHLA 5E8NB 2C1PB 4XC3H 3ABZA 5GGRA 2YL8A 2H32A 5BO1L 4RE4A 2V7NB 2C7UA 5HI3D 1OSPH 4YHNB 4E8DA 5DJZB 4PG9A 1UENA 5IMMA 3IDNA 4AT6B 3FKUS 4P46A 2FX9H 4HPOH 4PRPB 4X6EB 1RPKA 5DHVA 5HHXL 1K3IA 4M8UA 5LWYL 3KXFA 5D1QA 1E4MM 3MOAL 5B3JF 3LPGA 4KK6C 2G3NA 3F7VB 2W38A 2AABL 4UINL 4JO3H 1T0PB 5B8CC 3G6JB 4K71C 3LD8B 3DX6A 4JFYA 1ZTXH 2WWKT 4NN7B 4F66A 3ULVE 2Y06L 1ULVA 1OWQA 5CBEB 4Z2GA 1F4YH 2XIIA 3D25A 3HR6A 1ORQA 2Y6SD 4FNLH 3K2UH 4HK0B 2FBJH 2ORBH 2YN5A 5IB5B 4V2XA 1WZLA 4HFUL 3L5WB 1LE5B 1H3GA 3GHBH 3PXJA 2P24B 3ARBA 4LSQH 4M02A 1TZGL 3W5NA 3BFOA 4RNRB 4LSSL 2CO7B 3PDOB 5ETUB 2OP4L 2VDPH 2I9TB 3GNOA 1TVDA 4JL1A 1VF8A 1NCTA 1UYWH 1X5AA 4U5KA 5AYIA 2UY5A 5I16B 1J7VR 1WC7B 4J1UA 3V79C 1WO2A 4GBXB 1RIVH 3F6LA 5C0CA 4K7FB 4ZPTA 1JPSL 5E2TH 2AK4E 4NFCA 2WHJA 4MAYB 1O7VA 1YN6A 3UYPA 4EQ2A 1BFTA 2B7DT 5D5MA 5A94A 3I3DA 5EOQH 2E9WA 4YFLF 3PNWB 4RMWA 5KJRL 4NQDD 3TA3D 1GJUA 3FO0H 3DX8B 3SCRA 1X6NA 1AKJB 1XGRA 5L6YH 3MLXL 3CZGA 4C7FA 3NIGF 2E9MA 1U8NA 2C3XA 3IJHA 1ZA6A 2YXFA 3POHA 2WVVA 3CNKA 5ILTL 5DYOB 1EGJA 4PRWA 2VVSA 4B41A 1UD5A 4KC3B 3QAZC 3QDME 4XBEH 3A67H 4QRPE 4XCYB 4IOFD 3V5KB 1QVOA 2DQGH 5T1KD 1T80A 1SBSH 3QCVL 4HZAA 4TNVK 4WHCA 4OCSL 4NUJB 2W0FA 4QWWC 1Q72L 5IR1A 2A0LD 1GC1L 1RUAL 1RZJC 4G7VH 4D71A 4U5IA 3GZAA 3NACL 4P7OA 1KF9B 4WY7H 3OGSA 3G5ZB 4Q0XL 2WCAA 1BZ9A 1DL7H 4E41A 5HYJD 1HOCA 2AJXL 3IJSB 1W3HA 1J0KA 1T20B 2VLKD 2O5ZH 3K80A 4XP9L 3BPLC 4ZNCD 4YHML 2APVA 5I1IL 5EOCJ 2AXGA 3HZYA 4ODWB 4RFOH 5C07D 2EZ0C 2DWDA 1Q8MA 1GGIH 1QSED 1E3ZA 1CE6A 4O5LL 5DD6A 1R87A 2BVOA 3AGVA 3O2WL 5CJXA 3RVXD 4JHOA 4LHUB 3BLKA 3JV6B 5I1DA 4CMHB 1UR9A 3RA7H 1D9KB 1CGSH 4QXUL 1FFPA 1UM5L 1X44A 1AQKL 25C8L 3TO4D 4QRRA 1RJZA 3WJLC 3JVGA 3MGAA 3QG7H 4G6FD 4TNWF 4FQXB 3MCKB 1C93A 1XR8A 1VFAA 2NX5B 3IK2A 4ODSL 1MCNA 4IJ3C 3EYSL 1E4IA 4NDMA 4K23H 4ZFFB 4J4PD 3GIZL 4S0TD 1PKOA 4M6NH 5C7XH 1BQLL 3GTNA 3VTRA 1LD9A 5I8CB 4KK8C 3ZJ7A 1EHXA 1YEDA 4UUJA 5ABHA 3RBSA 2GJZB 5F7EL 3PXHA 5LXGL 4KHTH 3LRGA 5FD0A 1KCLA 2Y72A 4LCWE 4PJCE 2XNAB 1U58A 1FZKA 5DRWB 2KL6A 2J7HA 1CLOL 4HFWA 5D7IE 4LSRH 3FRUB 3G6JF 1WB0A 4U1JB 1GGUA 3O11A 1HHGA 2Q3AA 2QADB 4YXKL 3OKEB 1O5DT 2XG4A 3OR6A 4QXGL 1HXJA 5LYRA 3IDIA 5LBSL 5DXWA 4R27A 1I1AB 1HIZA 4NZTL 2CHNA 4HZLB 1IAIM 1V6YA 4LYRA 1RD6A 4OLWL 2ARJA 4QXTA 4L4PA 2YHGA 3G6DH 4NRRA 3PWPB 1FPTL 1G0CA 1JN6B 3M1BA 4P9HL 3RNKB 3THML 3AFBA 4Y8AA 2YK1H 1WK0A 2VLRB 4U6HA 4AIUA 4U1LB 1U8QB 1FL5A 3KYKH 3BAKA 1S7SB 5FYKU 1ERNA 3HFMH 4G9FB 2W9LA 3MV7A 1M05A 3UTQB 5F7FA 2UWEA 3WKML 3K1KC 3O0RL 3QIUD 4AYFA 4Z0BL 1ZHBB 4DVBA 3OKLA 1FN4A 1QR4A 3LV3A 2WB5A 1EEZA 3MBEC 2X1IA 4X5LA 3SDXE 1GQLA 3RPIA 4NKQB 2OWWA 1NGYA 4G8EB 4JB9L 4LSTL 4EAMA 1BOGA 4L4TD 2DQTH 4BFIB 4M6AA 1NCNA 4XPFL 1EHNA 5GRUL 3MGOA 5EFDA 1EO8L 3HG1D 3EFFA 1U33A 1XCXA 3S3PA 3L5XH 5JO5B 4ZFOA 4O2CB 5CINL 1TA3B 4M3KB 1AGFA 4TX8A 4GS7C 5EOCH 1O7SA 4X9BA 2P8MA 4ODBD 5H35B 1B0RB 2W65A 5IQ7H 5J0BA 4D0DA 1I3RA 1OGAE 4QCIB 1K4DA 1WAAE 2Q76A 1OQXA 4PJHE 4H0GA 1MLCB 3OX8B 4WUUE 5T33H 4HZ8A 1W32A 1JG9A 1KENH 4ZFZA 4HC1L 4BFBD 1UA6L 2MMXA 1LG1A 3EYQC 3NFSH 1FNEA 3WDHA 1VDGA 3RTQD 3RZCA 4X4ZA 1E56A 1CQYA 1T0NA 4OFKA 1V0MA 2YZ8A 4HGKC 5E70A 4W6XB 4PREB 3KE0A 1G7MB 4XVTH 3VWJD 2XPGA 5JHDD 3L7EB 3VMOA 4GMTH 4OM0H 2DLTA 4LEXH 3WY1A 4B5EA 2R2BA 4H20H 5C0DB 3BO8A 1X5XA 5CEZH 3AIBA 1NEZB 4H41A 4M48H 1PZ3A 1JYWA 1ZT7A 2JJSA 1W3LA 1UR2A 5FOOA 3O8XD 2WYSA 4M7ZB 1H3XA 1M53A 4Z9KB 3D69B 2VR5A 2X1QA 2JCCE 4G43B 3TYFB 4MXVF 1IKFH 1WSST 5DJ8B 4DKEL 5F3BB 3MV9E 1JDAA 4GRMB 3B9VA 2BVEA 3AY4C 2HKFL 3QI9B 3MRLA 1YEJH 3T0EC 3WDJA 2ZUQC 3VGBA 5KVDH 4XPAL 2W9EL 3JWDL 5FGRA 2XA8L 1A7OH 4X4ME 1ONQA 3FO2B 3SDCA 1OP5H 1JNNH 3L2MA 4PRIA 2PBOA 3MJ9A 2DT1A 5DMKB 5C0JA 3FFCE 3S34H 4ZTOL 3OJ2C 1V7NL 2VE6A 4RWYL 1XSKA 3DVFA 3THDA 3JWOH 3MRFA 1EUUA 1LEKA 1CR9L 3D6GA 5EU4B 1CFTB 1TMCB 1DR9A 4ERSH 2B0SL 3SCNA 3FQTA 1LO4L 1OT2A 2JB5L 3IDGA 1BEYH 3W11C 5HTSA 5IBLD 1FLRH 4Q6IB 4RIRB 2XYCA 4UBDC 4NO2A 4HXAH 3U6RA 1YQVH 3O2LA 1P6AB 2Z1SA 1R3KA 1DWAM 5D8WA 3FB6B 1HHHA 1UR4A 1ZS8A 5EO9B 2V3GA 1A1NA 1WFOA 1JI1A 1GVIA 2XZCH 1BLNA 3LB6C 3HMWH 2WUCH 2XQYG 5C3TA 1CDGA 1H5BA 3FT3A 4OIFA 1H09A 4AQOA 3UBXI 2GQHA 1MHCA 4DUWA 1KOAA 2NNAA 2R0WH 3HMXA 3QIWC 5LAXA 4EVNA 3MUIA 1XMWA 1LF1A 5H2BA 3LKQB 1B30A 5KVFL 4WWKB 4L9DA 3VG9C 1WFTA 5D7LB 1VKXA 2X1OA 2DYPA 2FSEA 5I73B 1MQQA 2OZ4H 3SE8L 1U9KA 1S7XB 2AJ3B 5BMFL 3GXMA 1S7QB 5E2UH 4OZHA 1IILE 1QW8A 1UD2A 1CXIA 3WHE0 3BKMH 5CIPH 4LASH 1FDLL 2NQCA 3BDXA 2EC9U 4Y4FC 1OGTB 5I71B 4MDJA 2G75B 4IRJD 1CL7I 1IAIH 4AIOA 1G7LA 3Q3GA 2R56L 1BJ1J 2VZSA 3IYLW 1KUMA 1ZKAA 5C0AB 3BN9C 4YPGA 3AAZB 2BZDA 2CLZA 1WJ3A 4JRXD 3W0WA 4FQLL 4YDJB 1RHFA 5KS9F 2PXYB 3QJFB 4JKPH 1LO2H 4F7MA 3GKWH 3L3JB 3TPKA 3TTYA 4L9LA 4O9HH 4U0RB 1W2VA 2OS7A 4HUXA 5TQ0H 4M43L 1YYMH 2DI9A 4RMVA 4TUOB 1D5IL 5ISZB 3K3QA 2FDMA 1TFHA 4HKJB 2HT3C 5D7SH 5DJAB 1UCBH 4N8CL 2DTML 1GGBL 4WFHD 3BLPX 3I50H 2Y5EA 1T66D 4XTRD 5H8DA 1GPOL 5I1HH 5K9QI 3FB8A 4UTAH 4CGTA 3QPQD 1JYVA 3H9ZA 4J3XA 1ZMYA 1HF6A 1JFHA 3OG2A 5E0CA 2DKMA 1TUXA 4ZUTA 4U1HA 2VYRE 3HE6B 3TBTA 4Y19E 5L2KB 4OV5A 5CUSL 1RJYB 4H88L 5T1KA 1ZB5A 3WF1A 3OAYK 5CJOH 2VABB 4BH7B 4AW7A 1W8NA 2P8LB 3T3ME 3S97C 1HILB 1K8DB 3I6GA 4GQ9L 3CD4A 3T0EE 1QFOA 1E6JH 1S5IH 4NO0D 2J74A 3MLWL 1A7NH 3H7BA 1W0WA 3RWHB 4L5FL 5ABFB 3W9EB 4XC3L 1S5HA 3WS3A 3TBVA 1ZLSH 2VDNL 4EN3C 4CD5A 1UZ8B 4QGTA 1OSPL 1PZUB 3X14A 5GGVH 4ELMA 4QP0A 4PMUA 1Q1JL 1R5VB 1BJ8A 3A4AA 3T1FA 4M1CC 1AD0A 4AD1A 5DS8B 3DURB 1KG0A 2XV6B 2RAMA 4RFNB 5IXEA 1JZ5A 1OSZA 4BSWB 4Q9BA 1BYAA 4X6BA 1MCOL 3VG0L 3K2UL 2FBJL 1CDHA 3L3KB 4PJAA 2X4OA 4HG4J 3K4AA 1MHPH 3N1MC 2W92A 4QYOA 3BUYB 1D7FA 2AS5M 1NGZA 3GMPB 1T1ZB 5CSBA 3D18B 5GZOC 4W86A 3DV4A 1C08B 1ZSDB 3PQYD 4JG1H 4F15C 5EN2A 3N1GC 3OLGA 1FVDA 2NYYD 3X3FH 3V5DB 1X4YA 4WSKA 4MX7A 3Q1SL 1CGUA 4D0CA 1UYWL 4U6XB 4N1HB 1MY7A 5KAQF 1HNYA 4I0PD 1ROWA 3ECBA 1IGYA 4OCWH 4OBRA 4G7YL 4XMPH 4JFOB 5DHVH 5IHRA 2YWYA 1N2RA 1A6WL 4HUUB 2C1OA 3PWUB 4O02L 1IAII 1WT5A 4X80H 2EXWC 1YUHB 1SJHA 5ESVB 1GYAA 1DFBL 1E28A 1PBGA 2BV9A 4ZFGL 5DD5H 5F7HA 3LDBC 2Q3ZA 2IJ0C 5GS1B 1LNUB 4PLNC 3OXSA 1KFAL 4L8SA 3FOMA 3P11L 2QSVA 4URIA 2Y5TA 1WFNA 3IRPX 5CPSA 4XBEL 3A67L 3U9UA 1SBSL 4EUPA 1JHKL 1UM6L 1U8LB 1QLRB 2F53E 2ARJQ 2XWEA 3VOCA 4G7VL 3AMGA 3WE6A 4Q9RL 3S5LA 2FZ3B 2GK1A 3EYVA 4U6TA 3SJVE 3S6CA 4PJEE 3VFRB 3TVMD 1ODZA 1R3LA 4UOQA 4NRZA 2OYKA 1XH0A 1U93B 1MWAA 4A2MA 1JD7A 2QKIA 3V7AE 1FYTE 4RFOL 1KNOB 2DIEA 4PJ5B 2WQ8A 5C8JA 4MSWA 1TE1A 1GGIL 4L4TA 4Z0XA 5DR5H 3CUJA 4HA4A 3AIEA 5M5DA 5DT1L 3HG1A 1V7ML 4G8GA 1H9VA 2NY1C 3GMLB 2DSKA 3MRKA 1IEHA 1AD9B 4XGZA 1XGUB 4GAJH 4LK4A 5AUMB 2HYMA 3U4EB 1EGJH 3W25A 1C90A 4OLVH 4P9MH 4W6YB 3T2NL 1WISA 5IVXB 5JPMB 3AC0A 4DEPC 1Z5LB 4QY8A 1RZGB 1RZFL 3HCVA 1P2CB 1JXKA 1OGSA 4Y4KB 5D7KD 4MNGE 3SPVB 2DKSA 3LN4A 3RL2B 1CS6A 3V4VL 1BZ7B 4PYGA 2IAMB 2X4PB 4M6NL 4E8CA 2R4SH 3FY1A 1AXTL 4P2RE 3ZDYF 2VL5A 3WNOA 1C12A 4QRQB 5IMOB 2HN7A 3SDAC 4QRTB 1J8HD 1Y0LB 4KHTL 3VWJA 3CLWA 3I02A 5JHDA 5D71H 1QO3B 5TE6L 4DWSB 1G9MH 1GUVA 5AZEL 3U5YA 5CCKH 4LSRL 1FFNA 1FH5L 1JPGB 3VXOB 4F33A 4F7EB 1GC1C 5CP3A 3KR3H 3U36B 2H41A 5EU5A 2ZOKB 4P3DA 2HJKB 2EYSB 12E8H 1P1ZA 4CAGA 4F58H 1U0QA 1FL6B 4HKXA 3LS4L 1J0HA 1DEDA 1J1OL 1NC4B 1JZ7A 4GW1B 2Z8RA 3MLUH 4B9YA 5F96L 5J13B 2QHAA 1HNGA 5B3NA 4PJIA 3DETC 3CUPA 3CMOH 1VRXA 2JK5A 1JGUL 3C6SB 4I8DA 4X5XA 2ZUUA 3UO1L 1Y6NR 5F8RC 4N9GA 2ZG2A 3OWEA 4KDVA 2FJGA 2NY4C 2Z91B 4YUEL 5HHNA 5ICZB 2YUXA 3O2DA 3KYKL 35C8H 3CHCA 2R2EA 3QUXA 4V2CB 4U1SA 3HFML 3DXAE 4XP1H 1FZOA 3ZHKA 2V2XB 4M4RA 2J25A 1H15B 5HVGB 3MV8D 1HKLH 1RJLB 4RGMB 4HTYA 2IFFH 3F58H 1JF1A 5BZDA 2QPUA 2V3FA 1FVCB 1DWFM 2V5MA 3OMZA 1VFOA 1FAIL 3OJVC 3TZVB 4P5MA 1NKRA 3DROA 3CGTA 4PV9B 1UD6A 3D1MC 2Z8VC 4JRYD 1B2YA 1CZ1A 2DQTL 5FEBA 3CSPA 1KXTA 4J12A 2DDQH 1JIBA 3VI4F 1OTUD 1CFSB 3NPZB 8FABB 2WBJD 4TSAH 3BGFB 1PQZA 5FM5O 5ID0A 3B6SB 1D5BA 2Z0BA 3B4NA 5A8PA 5EOCL 4Y1AD 2AK1L 2BRQA 1T7YA 4BZ2H 1XZ0B 4I2XE 1NCCL 3E1F1 4CCEA 1QNOA 5IQ7L 1I7ZB 2R1YA 2HVMA 3SCMB 3GJEB 5E1AB 5EUOE 5LVEA 5GRZA 1GOOA 5IOPB 5IB2B 1OCQA 4NPYB 5T33L 2G2RA 1CL7L 3TT1L 3MJ7B 1U8IB 5GGRB 4ZFMA 5AYUL 4D6GA 3MRMB 2Z9TA 5DZOA 2O61A 1QA9B 3GMRA 3QFJE 5LJYH 4GUPA 4H1LG 4N0YH 2WBKA 3VXQA 1ZBKA 3U0WH 4WDIA 4OI7A 3FHAA 4P9HC 3UDWC 2VITB 1MSPA 4LQFH 3P77A 5C0FB 3H9HA 4OM0L 4K68A 1D6VH 4PUBH 3DX6B 2ATPA 1B3WA 2VZ3A 1CBVH 1MHHA 1G5AA 5BRZD 4XWGH 2J8GA 1BP3B 4M48L 2X05A 2XKNB 2VXSL 3N1QC 2VDOH 5IVXF 2FWOB 4JRXA 4D0BA 1DVFD 2CDGA 1F45A 3IANA 3W2DH 2OJZH 4LVOC 2OSLB 3KPNA 4JFEB 5FDWB 1VFUA 4KDTC 2V2WA 4UDUA 5BCAA 1FORH 4HP5A 2F5AH 1DQDH 5AD0A 4BQ8A 1A3LL 4FP8L 1YEJL 2AXFA 3AMDA 5CZVH 2ZG3A 1KB5A 3CDYA 3MRNB 1DZBA 3UTOA 4HJJL 4TULL 5DRZA 5CEYB 1A7OL 1A6AA 3NCBB 1MCCA 4M5ZL 3MCLL 1OAXH 1FH8A 3VE0B 2I25N 2GKIA 4RE2A 3T0BA 4KI5D 4OD3H 1AQDA 1YN6B 5EU3A 4JM2D 3BWUC 5B3JE 3EZ8A 3CU7A 2ESVE 1Z9SA 4LLVB 4JO2H 4ZPVA 3JTTA 4FF5A 5EZLB 4H7VA 5AY7A 4P5KB 4IUGA 5IBTH 1TQCB 2YDQA 3VI3F 2CBUA 3GH4A 1II4E 5EZOH 2Q6WA 2KZWA 4HXAL 3LD8C 1XIWC 4NN7C 2NZ9C 4NQCD 4PBXA 4TTDC 1N7MH 5SV4A 3S4SG 2P8PA 4R7DA 4M81A 4WV1B 3CX2A 1AGDA 2VERN 4NRYB 1OM3L 4EUPG 3KPRD 1TCMA 5IR1B 4U33A 1BM3H 1A4JB 2ICCA 4AL8L 4J3OC 3OF6A 4NQSB 2R0WL 3S5LG 1NC2D 2CGRH 1I9IL 3H42L 2XG5A 3LIZH 4NNXA 5I75B 3PHAA 4FQ2L 5DJYB 1EO7A 5FYKH 2AJZA 3WFDH 4ODHL 5HOSA 2X4RA 4LRIA 1JK8B 1KIRA 3WUFA 4K8RH 2J77A 3AS0A 3QJHB 4H2CA 2OZ4L 3UCQA 2CEQA 1OF2A 4GBXC 2EO7A 2BNRB 5MEND 5GGSY 3OXRB 4HS3B 1JDCA 1BVZA 5DD6B 4MAYC 5C6TL 3G6LA 3DO7B 3BKML 7FABL 5DVOA 5I1AA 3JWDC 1OAQL 3RWJB 5JUVA 1C91A 4ATLA 3NIGE 3RFZC 1IAIL 2DJUA 1KSRA 5C0BA 4OFYD 1DUZB 4HU0A 4OZFA 4WTWA 2X4TB 4KH2A 3IDMA 4U1MB 1QNPA 5CPTA 1ZHKB 5C09A 2X4NA 4EEEA 1XR8B 5T3ZL 5IVOA 3WCYA 1ZGLA 1OB0A 3UC0H 4L3EB 1J05B 5IKCA 4E42A 1ZL1A 5EUKA 4JKPL 3QA3A 4ACZA 3CLFL 2E3VA 5IFTA 1BVLB 4N0UA 2GVYA 1SVZA 4EI5D 1B3ZA 3FO1A 3FZUC 2LVEA 5IJVA 3AQUA 5BWFA 1TTUA 5D7SL 4GXUM 2BNQB 1UCBL 3HAEA 4UUJB 4GRLB 2FO1A 4QF1A 1NSNH 4BKLB 2P5EE 4CN4A 4D9RD 4OCXH 4XVSH 3MC0A 1YNLL 5I1HL 4IIQB 4UTAL 4LSDA 3GBDA 1JPFB 3O11B 3KPLB 4ZD3L 1DWGM 1KCRH 4UZGA 3IDIB 2DH2A 4ML4A 2W61A 1W2PA 4G5ZH 1F90H 4NKOB 1K3ZA 4PJ7B 4HWUA 4JFFA 1NFDB 4MA8L 2DLEA 3STLA 2ADFL 4PGDA 3W28A 1DN2A 3IDYB 4ZSOA 1E6JL 1G1CA 3I6LE 2J7LA 4QXTB 3HUJB 4HV8A 5D1ZA 3L4UA 2WBGA 4CMHC 1TG7A 2HISA 3M1BB 1D9KC 1I85A 4L4VE 2A3CA 1ZLSL 4U6HB 1MXGA 4H0HB 5HDBF 1K9TA 3RL1B 3UTTB 4XBGA 4G6AD 1PKQB 1JTOA 4HDIB 4Y7MA 1WTGT 3BPOB 5D7JC 2FR4B 3VXRE 4NBZB 4U1GB 3L3OB 5DD3H 1SMAA 2E9BA 4PRPE 2BFVL 1FFOA 2E9IA 4DVBB 5D5MF 4KVCL 3VXMB 1U8PA 4XVUC 1HHIA 3L4XA 5B38A 1N59A 5EBLB 4P5TD 2LV4A 1M4KA 2X9WA 3U48A 4PP2A 4NQVB 5F6IB 1DSFL 1EXPA 4JPIA 1BOGB 4HS6B 1CEOA 1YEGL 3P9LB 3SOBH 4GW5A 3MGOB 5JXEA 2QADC 2VXUL 2DSVA 3CFKB 1ZLVK 5CLTA 2EDOA 4QHKJ 3PL6D 4JG1L 5C6WH 4M1RA 2YD4A 1B4JL 1I1AC 3CFBB 4YDKL 3X3FL 4XWOC 3WFEH 1QVBA 2VH5H 2ZCLL 5HGAA 4OF3A 4PY8J 4ZG1A 4D0DB 3ARRA 4Z77A 3PZ9A 1DLFL 2ENSA 2P7TB 5DRXB 2J8FA 1AMYA 3O3BB 4OUUB 5CBAB 3SCWA 4C59B 3F5JA 4XMPL 1QBMH 2O26U 1NWTA 2CPCA 5K93A 1YY8A 5CMAA 4HLJA 3I75A 3DSFL 4OUEA 3QIBA 5CJQH 2YPLB 3QXDB 3L3GA 5EBWA 3SCTA 4JM4H 3ZO0A 4P59H 3D85A 5FIPA 3RM8A 3ZIZA 1RZ7L 5AAMA 4KAQL 3ZYJA 4PJDB 3KS0J 4NM8H 3BXWA 3HR5A 3FFDB 4X8JB 4KJQC 1B90A 3HJEA 4PG2A 3SKMB 4U6YA 5DD5L 4MMZC 4NZRL 3VUPA 4XBPB 43C9B 4FLRA 1HL8A 4XXDB 2M8XA 1XF2A 1Q38A 5D1XA 5HD8C 5IMLB 3PHQB 1Z0MA 3G5XA 3RDTB 4HH9B 3KJ4B 5JLZA 1OCWH 5LQBL 3P0YH 5LA1A 1PDKA 3WIHA 3SDDA 3WUEA 4BSVA 4A6YH 3MV8A 2EDNA 1V6VA 5LG1A 3MRJA 4RSVA 5CD3A 4W84A 5EU6B 1TZHA 4TVSa 32C2B 3PZNA 2YR3A 3INUH 2NY6B 3T2PA 3MLRL 1AFVH 4KQ3L 3SDCB 2CLRB 2VDMH 4PRIB 1LILA 1ZLUK 3VXPB 5JIIA 4MDIA 1KBBA 1G9HA 4LLQB 3MRHB 3MRDA 1OTTD 1KB9K 1NAKH 4RFEB 3VD5A 4YDVB 5DFVD 3MRFB 1U8OA 2ADIB 4GAJL 4UFLA 5I1KH 4Z7UA 4IMLA 2YS4A 2ITCB 4OLVL 4P9ML 4Y1AA 3BE1H 4PJ7F 5KW9L 4GG6A 1JTPA 3WL1A 3IF1A 3GB7B 3IDGB 3TN0B 1JUFB 1E1FA 3VXNA 1NFDF 2MTPA 3PIQA 3QO1B 4PS4L 4PLJD 2Q86A 4MJ4A 1WGOA 2QPSA 5EU7C 4EUPH 4IOIB 3EJZC 3U6RB 1M6OB 4UOZA 1JMXA 4ZAKD 1DQMH 1TVBA 1N8ZA 4HMEA 4N1CA 4OD2A 1RUKH 3KPPB 2AJSL 4PCTA 1KJ2H 1RULL 3DOSA 3GUTA 3L6FA 4MXVE 2AOSA 1P7QD 3FQUA 1BLNB 4H8WL 2R4SL 1PAMA 3HTLX 5HHVH 4M7ZC 3ZJ6A 1WCQA 2EH8L 4QOKE 5F1IB 3RP1A 3QQNA 4EE9A 5BJTB 1H0DA 4D6IA 4LPTA 1OQOA 5DEZA 3DGGB 3FONB 2XWTB 3RWGB 3RWEA 1X5JA 1K8IA 3QI9C 5CCKL 1NUGA 1JZ2A 4W70A 3WD0A 4JFPA 1F4XL 4PTUA 4JQXA 3VGDA 2AEIT 3ILQC 4LLMA 1J5OH 4M80A 2EH7L 2J8UE 3IXAB 3FQNA 4AM0B 1A6UL 4JEGB 2CESA 12E8L 4KZDH 4F7TB 3ZTNH 1QSZA 4L4JA 3GMQA 4RMQA 4CVXB 3RVVC 5IV2B 3MLUL 3BZEB 4PTMA 1XF1A 1PYWB 1UD4A 2VUYA 3BW9B 1AR2A 1OGGA 5BOZG 2NY2B 1L7TH 2EDRA 1T03H 5JR1H 3B5GA 4YGVA 2QHLA 3JBG7 3VU2A 1EFXB 2DH3A 3PWPE 1UWSA 3FQXB 4Q6IC 4UFKA 2VWEC 5MI0B 4CNIA 35C8L 3DC0A 4KJWC 5KSAD 1SY6H 1AR1C 2BOCB 1LK2A 1MAKA 2DS4A 2ZP0T 2CUIA 4M62L 3FO9B 1L0XA 2A6IA 3SE9H 3L1OL 4G9FE 4L9LB 2BMKA 5T5NG 3W37A 3CIQA 1TIUA 1UKTA 5C0IA 1EJOL 3VINA 3BP4B 3T77A 5EIVA 4GI9A 5HGDA 4NQDB 4KUZL 5IHUH 3TA3B 4PJDF 5T1LD 4KV5F 1YY9C 4P7QA 3QO0B 5DURD 3B5HA 5IM7B 2IXVA 3QEHA 3QRGH 4RMSA 5A8NA 4ODTH 3N85H 2J6EA 4NCDA 4NQCA 4OZGE 2NTFB 4WWKC 5E9AA 2WWMD 3OQ3B 1Z3GH 1MI5D 2KZ1B 3ZYIA 3EYUL 5I73C 2AVGA 4IPNB 5B8CA 4PCSA 4KK9C 4MXWH 3VFNB 2BS9A 3KPRA 2DQUL 1VFBB 1QOKA 1V6WA 1F13A 4OLUL 3DV6A 3O2DH 3FMGL 5GIRB 5I71C 1NC2A 1LDPL 3MRQA 4UV7H 1HH6A 4DJMA 4AZBA 3JV5A 5HYJB 3IJ9A 3NDYA 4NC1C 3CFJA 2VLKB 2DMKA 5KS9E 1FNGB 4R90H 4OKVA 4M56A 2NW2A 2OR9H 1HJVA 5C9JA 3MA7A 3IU3B 1GOIA 5C2UB 2J7GA 5C07B 1CF8L 3U0WL 3WF4A 3MO1A 1QSEB 4C4KO 2VX4A 1KR0A 2CYGA 1WLHA 2PXYC 2V9QA 4O4YH 5L7XL 5JW5A 2X40A 4JGJA 4LQFL 1I3UA 1TQBB 4FXKB 1BOYA 5F89B 2AJUL 2V5YA 5C0ND 4NZUL 3C5JB 3IDXL 3LRHA 5B38G 4NM4H 2YPVH 1CBVL 2ZOXA 3UX9B 4X6BB 1J86A 3EJJX 5EU7E 1S7UA 1EXUB 3CPLB 3OR7A 1A5FH 3TO4B 5BROA 4G6FB 5TFSH 3WF0A 1E6OL 1IC7H 4LFHD 3G9AB 1QSFE 4HPHA 4HIEA 1T89A 2HFEB 4QYOB 3WXVH 1CN4A 1WFUA 2F54A 4YR6A 2ZOLB 4NP4H 1G7IB 2OJZL 3DV4B 3P4OB 4WHTB 2F58H 2QHRL 1ZV5A 3CVIL 1KGCD 2IBZY 4JVPA 1FORL 3EDEA 2NZIA 2RHEA 4QHKI 4JFZL 3P30H 3WFBH 4XNZC 4PJGB 3QR3A