3W81A

Human alpha-l-iduronidase
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
616
structure length
616
Chain Sequence
EAPHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human alpha-L-iduronidase uses its own N-glycan as a substrate-binding and catalytic module
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-L-iduronidase
total genus 196
structure length 616
sequence length 616
chains with identical sequence B
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w81A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 3w81A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3w81A02
1SY6H 3AZRA 1D5XB 5I1DB 1X5KA 3OKYA 2X70B 1IGYB 1SMAA 5DD6A 1TIUA 3HUJB 4P2OA 4D0CA 1XGUB 1EDGA 1R0AH 3VDAA 2R2EB 3K1KC 4Y5XB 1GHSA 5KAQF 1CZ8L 3M07A 2UY4A 4O51A 1CL7L 5KSUB 3QIUC 1FNAA 1V5JA 4E2OA 1EA9C 1OLLA 3WIFB 5EOTA 3CFKB 3MRPA 1JG9A 4P57B 5IW6A 2FJFB 3MFFB 3PHOA 3L7EA 1YJDC 4NUJB 4CJ0A 4GRMA 3VMOA 1G7MA 2CRZA 3S5LA 2ESVB 3BH9B 1ZOXA 3IU3A 4RIRB 2FRGP 1A3QA 2Y6SC 4P2OC 3NFSH 2PBOA 1M03A 1H9VA 2YD2A 4PJXE 5INDA 1TJGH 3TOPA 4B41A 5DVLA 3VIIA 3G9VA 3SY0A 5KN5A 4U5KA 3TYGH 4XH2B 3IDYC 1IGTB 1P6AB 3QDJE 1KXTB 3IAQA 4LEOB 3BRDA 3WF4A 3NABH 4QXGL 2DM4A 2DAVA 2VL4A 3D25B 1HNYA 3H0TB 5LXGH 3GSOB 2E9MA 4H8WH 3BE1H 4PGJA 1JRHH 3WKMH 3NH7L 2CLZB 5CGMA 1QLFB 3GBEA 1MRDH 4L8BB 2XPGA 2HLFC 1E9LA 3FY1A 3ARDA 1R5IB 4WEBH 4PJAB 3BH8A 3O2DL 5HHQB 2G5BB 1NLDL 2PW2B 3EMZA 1YY8A 4XWGH 2AXGA 3V6ZB 2WUCL 4IHOB 3PDOB 1IKFH 4F15C 1OM3H 2EDHA 4HIXH 4BKLA 3QAZB 4L8DB 3MLZH 1GJWA 2GJXB 1BQHA 1NGWA 4IMKC 4HJGA 4LK4A 4ZFGH 4P2QA 2A3EA 4ZYKA 4M7ZC 3BO8A 1ZVHA 4NN6B 5HI4D 4N0CD 5GS0C 2GK0A 3IKKA 3FXYA 3ZJ8A 4ODVL 4X6CE 5DSCA 2CDEA 5GQBA 1LE5A 4FQ2L 1ETZB 5D7JA 5I77A 4QCIB 2YLLA 2WBJD 1CE1H 1XGYL 3OXSA 3ZE1F 3WL0A 4J12A 2GVYA 3RWCB 3B9KB 3W0KA 4W5ZA 1X7QA 4JQIL 2HYMA 4KKBD 3VIKA 1KN2H 3OHXA 5LXGL 4GOSA 5T3XH 4LHUG 5D9SB 3AMCA 4HUUB 4IOFC 3NH7H 5I66B 3Q2CA 1U8OA 4K8RL 4JFYB 5FO8A 3PGCB 4Z7VB 3U0TB 1D5IH 3O2DH 2YSSB 3IFPB 3QFDA 5ICYA 3GSWB 3N1PC 3KR3H 1A4JA 1MI5B 3PWPB 2V9RA 4HFWA 2AERT 3HZVB 5CJQH 1C16A 5D2NA 1M6OB 4G43A 4G6JH 5JZ7D 4NQTA 4Z5RA 1HKKA 4ZUWB 3QO0B 1V7ML 1JHKL 2DQIH 3ZHDA 1D3CA 3IDXH 1ADQA 1AR2A 3SHSA 3TIEA 1W0WA 3F6LA 4F8TA 4PTWA 1US2A 1KTLB 4HT1H 1XZ0A 1U8KB 5F9OL 1HOCA 4PD4K 2WAHA 3BWAA 1T20A 3NJ3A 3NZHL 4Q9CA 2KH2B 4LSQL 4GG6F 5C0AA 1EDQA 4K94L 1A47A 3PBGA 5E6IB 1FCCA 3ARDB 3KL5A 3QUKA 1YN6A 2Z8SA 3ELAT 3S8WA 1GQLA 5EBLB 3MBED 1S5HA 3VXSB 4F37K 5F9JB 2KZWA 4OTXL 3PP4L 4LPUA 3X12B 4P5KA 4GKNB 5BXFB 2DQGH 3MRMA 3MNZB 5C0DB 2EH7L 3NCYS 2FJGB 4U1LA 1JP5A 4LQFH 4GAFB 1K6QL 3K46A 3VRJA 3EJYD 1FORL 2EIEA 3WQVA 5A6LA 4D6CA 4XNZB 4LCCC 1SJHB 3RZCC 5IW1A 4XWOD 4M9PA 4UINL 1I4FA 5DJ0A 1AP2B 1K9TA 3T3PF 4U6HB 3RPIB 5LJYH 4HLZH 4YZFE 4POZC 4Y19D 5DURB 5M3WA 2WCAA 4ORGB 3S34L 2H6PB 5DVNA 2F61A 3ZYZA 1UVQB 4WWKA 5E99L 2QQNH 2BS9A 4FTVB 5C0JB 4GFTB 4DGVL 4V27A 1F8TH 5FHAH 5AZEL 3RJDA 1VADB 2DLIA 4AT6B 1CG9A 5M95B 3SKJH 5CCKL 2GSGB 3R4DA 1ZT7A 2E7HA 4YXKL 3PZVA 1V0LA 2A83B 2MFNA 1HQ4A 4HZ6A 2WC7A 2OTUA 2CD0A 3ES6A 4NCC1 4YC2B 4TUOB 4KJYA 3FB6B 3DHPA 3H42H 3U7WL 3QFJB 1T3FB 3C6LB 3QHFH 2OMBA 4K3HA 1GOWA 4G42B 4ZXBB 4YK4B 4KI5C 4YAQA 1MCJA 4HPYL 3AREA 2FATL 2CK0L 2HFTA 4KPHH 4M1GL 5F3HB 1UQYA 1V3MA 3SE4A 5C07B 1E6ZA 3PZTA 3GSNA 5J1AB 1HWGB 1UH2A 4G7VH 2VC2H 2GW5A 1OAYH 1MCNA 1KOAA 2R39A 4KVCL 5CD5C 3O9WA 1IGFL 2FGWL 4ODSH 1L0PA 2X8RA 3GMQB 1K8DB 3NIGE 4QXUL 1FYTB 4LVNC 2CXKA 2WVVB 1MFEL 3GSQA 1H0DB 4TNWF 2OQJA 5BS0A 4HBCL 3W25A 3K2UL 2NTSP 2ARJA 1NMBH 4DWSA 4RZCA 1JGLH 5H2BB 4M7KH 2WBJA 2AOSA 2Z92B 2BVQA 5DK0A 3QPQD 5GSRA 2XVLA 3KXFE 3HZKB 4G6KH 5I1KL 4TUFA 1KLGB 1J8KA 4UT6L 4PMZA 1EGJH 4WI3A 4PTTA 3OL2A 1KEGL 1NGQL 2UY7A 3DVGA 4L3AA 2X4PB 2JB6A 3RM8A 4P9MH 2B1AL 4K68A 3W6MA 4KPHL 4M1GH 4U1HA 2BOCB 4JDTL 1DBML 3OG2A 5EU3A 1U8MB 2P43B 3GJFH 2MCPH 3FT3A 3QO1A 2XTJC 4Z7NF 1KFWA 1VPOL 4GINA 3QI9B 1GZQB 4KHXL 3SBWC 2VDRH 5I78A 2D7TH 3MV9D 2K3TA 3WFHB 4X4YB 4Y4FA 1R3KB 1V0MA 5E8DH 1WO2A 4P8VA 1YYLL 3SEPA 2YPLA 4JM2A 4P2OB 1W72L 3EJJX 1BSIA 1A6WH 5GGSY 3BKCL 5JOPE 5MHSE 1U9KA 1QUNA 4D3CL 1ZEAH 1NQBA 3DYMA 5HHOB 3SE4C 3LQAL 4P49A 5BXRA 5CILH 5EULV 2WBKA 4HFUH 5FF6B 3RL2A 5INCB 5JZ7C 4IRSB 3HR5B 5J6GA 5C07E 4PB0L 3VDCA 4JFFE 3S5LB 1KIUA 4BQ6A 3LRGA 3G6MA 4KDTA 3JWOH 1QW9A 1NWUA 2CLRA 5LKNA 3O2VH 3ZKXB 1KYOK 4L5FL 2C8NA 3BOVA 4Y16A 3T8XA 3OKKB 2YKKA 4IRZH 1S9VB 4NRYB 5ISZE 5CHNB 5L7XL 3OAYH 1I1XA 3ZJKA 3L1OH 4I9WD 4NNPL 1YYMH 4PRIB 2NY1B 3N12A 4D9LH 2E9LA 2JIXD 3OLDA 1SM3L 1FIGH 4UOQA 1J8HA 4FQJH 4AD4A 3MNVB 1J12A 4U05A 3TPKA 5DVMA 4MVBC 3V5HA 2WBJC 2GSIB 5JIIA 1S7WA 3QCTL 5FUCC 4OZHF 4PBVC 3WEXB 4OCXL 2QKIA 1A7NL 3MLXH 1HSBA 1R3JA 3GJEB 5HGAA 1G7PB 3CXDL 4HOWA 1QRNA 5CZKA 2NXZB 1YNTB 2E6PA 1CVSC 3CFJB 2DD8H 2DT3A 3EO1B 4P59L 3H9HB 1KV3A 1RSFA 1INDH 5C0FB 2GK0B 4S3KA 2Z93B 4PG2A 1HHGA 1IFHL 4HEME 2OZ4H 4AMCA 4HIHA 3RUGB 1KJMB 1UKSA 4BS0A 4ZO8A 4FA8A 4NQDB 3WS6C 2H2PC 4EIGB 3F8UB 5IMOA 3V5KA 1CGSH 4XPHH 4AZBA 1ITCA 1FIGL 4S1SL 4ACYA 4Z7QE 3PWLB 4D94A 1CD1B 1I8MA 1HKMA 2R56H 3VFWB 4JHZA 4J3VA 5FL0A 3QHZH 1F4AA 1Y6MR 4LYPA 4XNZC 2LTQC 2R4SL 1ZWIA 4JFYA 1G0CA 1DANU 2V7HB 3N1FC 3C6SA 5F9WC 3VGGA 4DK3A 2RFXB 5ESAB 5F97E 4IPNB 3D6GA 3QFJE 3PL6A 4IS6B 3ZL4H 2A3CA 3GMNB 4NIKB 5ICZA 5KSAB 4ELMA 3MCG1 5I73B 4Q0XH 3AIQA 5ADOH 5E2VH 1X5XA 4BZ2L 1SYSA 1XIWB 4EQ2A 3KJ6H 3OR6A 4TUJB 5EZLB 1FDLH 4OCRH 4MCZB 1HNGA 2JEPA 5EUOE 3IKCB 3G6AA 2V7NA 3H3BC 1DQDH 4DK6A 3ECQA 3QUZC 1S7XB 4GZEA 1UEMA 2VXSL 1FVCB 5GRJH 2OTPA 3F7RA 3D0LB 5IMLB 1ZBVA 2ITCA 5B3NA 2GUYA 4NKIH 4DKFL 3EOTL 4NN7C 5M94B 3LV3A 4I3RH 3I3BA 4JFXA 1AKJD 1CXKA 2EDRA 4QNPF 4TQEH 2EPMX 3NCOA 4IRSD 4FOMA 3IDUA 3CX2A 2YEZB 3RAJL 4OB5H 1J1OL 1QQDB 5IB2A 1MPAL 2Y5TB 1HNFA 4U1GB 3LMJL 1TFVA 4G8GD 1QI4A 4YXHH 1NOFA 5C0IA 4Y4FD 3CBWA 4YUEH 3DXAE 3MANA 4PYHA 3UCQA 1CECA 1IM9B 4HC1A 4EI5A 2WZHA 4KMQA 5IFTA 5LGKA 4PTMA 2X1XR 1G9NC 4P4KD 2MCG1 1W1YA 1RZ8A 4L3EB 4QRRE 1NC4B 1EQPA 3QO1B 2EICA 2VXSH 1DBAL 1D2KA 4XZUB 1H3UA 5IXEA 1DBBL 5JUEL 1RD6A 3N9GL 2HRLA 4NRXA 1UXSA 32C2A 3QUXA 5JXEC 5DJDB 2W59A 3EOTH 4CDGC 4TNVK 1KEML 4L9LC 3FW6A 2IJ0C 1NUDA 2E3VA 1MVFA 2AAVA 4LSDA 3VI4F 2HMID 2BHUA 5CLWA 3A6BH 3FQRB 2QL1A 3PZOA 1V02A 3F12A 1MPAH 1IQWL 1B2WL 3HA0A 2AJXL 1FO0L 4HU0A 3MUHL 3U83A 4YH6A 1T21A 3HCVA 4JR9L 4P5KB 5DJYB 2XTLA 1BPLB 4HOZA 2GY5A 2C7UA 3NIDF 4XBPB 5I74C 5MEPB 3L5HA 5DS8B 3FHQA 1AQMA 3NFPA 2A73B 2DWDB 4OLZH 5E2TL 5D2LA 3TVMD 5D1QB 2RIKA 2C5DC 4ZS7L 2X0HA 5IIEA 1CDBA 5A6MA 3ZKNC 2NY6B 3VFSB 4MLSA 4YGAB 4M5ZL 2IPKA 2GJ6D 4K71C 5IJVB 3HB3C 5C7XL 3L3KA 4HWZB 5F7KC 3CK0H 4AWEA 5D5MF 3V4VL 3BIKB 1X4XA 4HJJH 1MWAL 4AIEA 2O5YH 4NZRH 2PO6D 1DN0B 4K3JH 4L4JA 1YECL 1FGNH 1ZVSB 1RY7B 5I1HH 4H1LA 1ZS8B 2DQDL 1A3HA 1NEZA 1TNMA 3HPLA 1C08B 4V2CB 4N42A 2VQ1B 2XA8L 1NC2A 3C9NA 4PJ7A 3S5LG 2ESVE 2HFGL 4GKZB 5L2KA 4NJ9H 1H3TA 4K94C 3QJFA 5DFVD 1BIIA 1MI5E 3PWPE 3ZTNL 3M1BA 2GKIA 5EA0L 1JTTA 4ZUVB 1DJSA 3K81A 4PJAA 3A67L 1JRHI 3C6LA 1J10A 4ETQB 3CZ8A 3WHXA 1GAFL 4M56A 5D1XD 4ORZC 4XC3L 3U0PB 5SWSA 1TQCC 5EBWA 3UJJH 4ZE5A 1GW1A 2GFBA 3WYRA 4ERSL 4YBQD 2CERA 5BWFA 5HY9A 2YD1A 4JM4L 3UPCA 3WN5C 1ZA6A 3QIWC 3BJ91 4FABH 3ARBB 4YGVA 4HJJL 1UKPA 1AXTL 1BFVH 3U0WL 4KKCC 1JUFB 4PTUA 1PIFA 3QDHA 3WIIH 5IR1A 2WCGA 1GGIL 5JW4N 1J0KA 5MP6H 2RGLA 2NYYD 3TJEH 4UT7H 2DQDH 1ACYH 3VMPA 5C09A 4PRNA 5T5NG 1KJ2H 5IVZA 4C55A 5DQ9B 1MHEA 4WI9A 1EO8L 5D6DA 5FOBA 1B2YA 2P5ED 1UZ8B 1F02I 4PRHB 4BFGA 4HV8A 1T2QL 3VX0A 3HI6H 1C1EH 1BMGA 5E8EB 5AZ2H 2WC3A 5CEZL 1FH5H 1E28B 2G75A 3I2CH 4ATWA 5INCA 1LO3H 2BVPB 5T1MA 3EBAA 4KKLC 1T5XB 5KTEL 1ORSA 2OWCA 2AGJH 2BSSB 3AICA 4Z0BL 4HKJB 1A6TA 3STLA 5CPQA 4HUVA 2CPCA 4Z77A 1AGCA 3B9DA 3QI9D 3MPCA 4M1DH 1KIQB 3CZFA 1T03L 1JAKA 2ADJB 2XOTA 4LCWE 4PJ8A 5C3LD 4QHMB 5KSVB 4YFLI 4F7PB 1N7MH 4HGWB 1YN7B 3G04B 3RWIB 2DDQL 2QADD 3GMRA 4Y5VC 5DK3A 2YRZA 2HP4A 4JRWA 4PJFB 1WBYA 4B16A 1BFVL 3RTQA 3U0WH 4PJCF 3UTPE 5CD3A 1HOCB 1RVFL 3UDWC 2DT0A 4JFXB 4JO3L 1F3JB 3WDQA 4XBGA 4YDIH 3MLTB 1LK2A 3MRJB 2VX5A 3AOFA 2ZIDA 3DMMC 4PLJD 3K4ZA 3KPMA 2R2EA 2WHMA 5ABDE 4DGYH 1VEOA 3WEXA 5TFSL 2VKWA 1INEL 3OAYK 2XQYG 4HJ0C 5I15H 4LASH 4YHYC 2XVGA 5FK9A 1ZGLP 4AH2A 2WMIA 2YN5A 5DVKA 2V3DA 3WFDH 5IEHB 3B6SA 3CPLB 4Z2GA 1HILA 1DVFB 5EOCJ 3N85H 1AC0A 1OSZA 3Q5TA 4LF3A 5E1AB 4XB8A 5EBMB 1I4FB 5DJ0B 1CFBA 4E8CA 5D8JL 1YEGH 2EDTA 2ATPB 4RQQB 5T3ZL 2V17H 4Y16B 1FFRA 5JQHC 4JRYE 2CK2A 3CJJA 3C60D 1QSEB 1WQVT 3SBWA 3GSOA 5D7JD 4KJPD 4RGNB 2FX9L 1X4YA 1INQB 2V5DA 1T7YA 4GW5B 1LO2H 3G6JB 4MSWB 3SKOA 1E28A 3VG0L 4JDTH 1L7IH 1ZHKB 4ZDHA 5ALCL 5CP7B 5F1SA 5HHQA 4JFPA 2VIRA 3VXUB 1NUFA 3JWOC 5SX5K 1HVQA 4QRTB 5EC2B 4KK8D 4P3CH 1I7RA 4LLVB 3FQUB 4Y2DA 4V1DB 5ICZB 5KSAA 2HJFB 3E6HA 4UB0L 3DO7A 4Y1AD 1JL8A 4M6OH 4D8PA 2OP4L 2OLHA 2FD6H 4IIQA 5SWSE 1TTGA 2QHRL 1AR1D 4ZXBA 5CBAB 4H88L 4PRAA 2DWDA 1J88A 1C3FA 5F7EL 2OM5A 2OJZH 2UWEA 2WQ8A 3W81A 4AQOA 3CFCL 5C9KA 3NCMA 3LEYL 3MCLL 4HH9A 3WENA 3MRRB 5KVEL 1CBVL 1CBGA 1H5BA 4PLJC 1UENA 1UD5A 4Y1AE 4F2MA 1KPUA 5JBFA 3ULSA 2GT9A 1KPRA 5DZOA 3EFDL 1EEYA 1MCKA 3OGRA 5F7UA 3UP1A 3RO8A 4GW1B 3MUGB 2W60B 3LQAH 2QQLH 2V2XA 3O6KL 5A8OA 2OYLA 4AEFA 1U8OB 1UA6H 2QADC 3RM9A 1U42A 1Z9MA 1E4JA 2CETA 2DQUL 1S7TA 3VG0H 3BGAA 1SJHA 4LRNL 5I16A 5F6IC 4FQXC 3BT2H 4XNXH 2OWXA 3IDXL 3O2VL 3D2UD 2BZDA 3AY4A 3CMGA 4U1KB 3L5XH 4QTHB 5ANMA 4MADA 3AAZB 5C09D 1XIWD 3QG7H 4TVCA 1N4XL 3MACL 4OLXL 1XGQB 3FO0H 2WWMD 2QHRH 3GM0A 1HH9A 4GUPA 4HKBA 3CZJA 2EH8L 4KROD 3BPCB 4KTYA 4XP9H 3S3JA 3TFKC 1MWOA 4W7UA 3MOBL 1WB0A 5J13C 1II4E 2ZG1A 3LRHA 4WEMB 2FECL 1CBVH 5DYOA 5DFAA 4PRIE 4X5WB 2VC9A 5HGHB 4JY5L 3FOLB 4ODHH 1N64L 1LEGB 3MRGA 3QDMB 1IEBB 1TTFA 4WY7H 2HN7A 3I02A 2WIIB 3L4XA 1WC7B 1SVZA 1GZJA 4TPRL 3WH8A 5FYKH 1A9BA 1SEBB 4GBXA 1GJUA 1WZ1H 5EOQL 3WD1A 3MA7A 3BGFB 4BSWB 3HAEG 4KGJA 1I7RB 4LLVA 5FIEA 1U8QA 2P8MA 5IM7A 4YBQC 4P5TB 4KK6C 3O3BA 2C9AA 2D03H 1FVDB 5BRQA 3RTQD 4XAWH 3GB7A 3HE7A 1WTLA 5L8KB 3L4UA 3ZDYE 2A74A 1FZJB 2NLJA 1WZKA 4HA3A 3PHOB 4FXGA 2XPKA 1XV8A 2VAAA 4PRPA 1H5BC 3ZT7A 5EFIB 1J5OH 4JCMA 4DFHA 2XY2A 5CEXA 1T7ZA 1IGMH 4HGKC 4X7SL 2VR4A 5TE4H 5BOZG 5BV7H 2EIZA 2VLMD 4OV6F 2HJKB 4JLRB 1ZT4B 1Z9OA 4QAWA 2DI8A 3GUTA 1JNLL 5C0CB 4L9DA 5F88B 3MRCB 1IGCH 1I8LC 5IBLD 2EDLA 3V6OE 1CLYL 2DDXA 1TPXC 5D7KE 3QPXL 4X99B 3H2WA 5FGCB 2Y07L 3VA2C 3VXPB 2P4AB 3GBMH 4Z7WE 3O9WD 4OQTL 3UG5A 1I1FB 1VESA 1WF5A 4HPHA 4EN3C 1R5VB 3MA9L 5IFAH 1AHWC 1FL6A 4FXKB 1OAYL 5GS1C 4PJCE 2ZSVA 3ZKND 1FYHB 3SCRA 4HPGA 3CD4A 2NY7L 1MW1A 5BS0E 2BOBB 5EIIA 1J01A 3TVMC 4LCUB 3CX5J 3EDJA 5D1QD 5JW5A 4NN5B 3PWUA 4MXWH 4AG4H 4YPGA 4ZUSA 1IAOA 4MA3A 2QJDA 1G01A 4URTB 4XCFH 2CBJA 2Y72A 2IH1B 3TH3T 1HXYB 3V2AR 4XCCL 2EDYA 4OZFH 3SCNA 1CIDA 3U7BA 1E5NA 3U7AA 2EYRA 4UTFA 5BOPA 3UMTA 2WW5A 3F6IA 3UPRB 3G5ZB 3PABB 2C3GA 5E9DB 1JMXA 1XR9A 4XB3A 5JBEA 5I1GH 3D0VB 3MJ9L 1CFVH 4WK9A 2VLKA 3BIKA 2Y07H 1JHKH 3ULUE 2WMHA 2VXTL 2J2ZA 3JV4A 4LHUA 1INQA 1IKNC 5KOVC 3UAJC 3SCUA 2UY5A 3BP7B 4KROB 3MRBA 3TTYA 2IPTH 3JSSA 4W70A 1M01A 1NFDB 4UNTA 4LU5H 4Q58C 3VD3A 5B39A 4NO5A 4NQCA 4MPKA 1J05A 3L7EB 3GH4A 4N0RA 2YPLD 4JHWH 4EUPG 1FRGL 1BFOA 2GITB 4CNIA 2JJUA 5MENA 5F1KC 4Z5RB 2X9XA 5I30L 1QR1B 1U8JB 3VX1A 1PX4A 2M26A 2VZ3A 3SCTA 2R2CA 1PZ2A 4XUYA 1XIWA 3O8XC 3V7AG 4IRSC 1J87A 1K4CB 1B2WH 1L0QA 1C5DA 4NKDB 1JE6A 2Q7YB 5IKCA 3TCXA 2C1OA 1TG7A 1RZJL 4X6CB 3W9EA 4PCSA 3QOMA 3SGKC 4PB0H 3MLTA 3CUPB 1RJYB 1DBJH 3WD0A 4YE4L 4D0DB 4I77L 3RI5K 5FFLA 2BNRD 1FFNB 2W67A 1EGJA 5EN2A 4W89A 4PRNB 3KWWA 3G08B 1YNTA 5MI0C 1CR9L 1XSIA 1RU9L 4NBYB 4JO1L 4LAQH 4MJ6B 4PJFE 3MBEB 3VXSD 3TZVA 2H8PA 4K3EL 2R0KL 5IW1B 2Z93A 1PBYA 1BVKA 4RRPG 4DN3H 3FAWA 1QBML 3WSUA 4HIEA 3EYQC 3O11B 2NZ9C 3VM5A 2BFVL 5CXPA 1KBBA 4JKMA 2B1HH 1UD4A 4PRBA 3CNKA 4KK5C 4WWKB 1QRND 1OGSA 3O41B 3HUJE 4MWFA 2EYSB 2UZYB 1NFDF 4LBEB 4NNYB 4YFLF 3IFLH 1KLUA 2VRKA 2HFGH 2OQJB 1PG7L 1P69B 1JYWA 3PGFL 4APQD 1E6OH 5ABHA 2NZIA 2BC4A 3TO4A 4HGWA 5KVGL 3UCRA 1N5YL 1V0NA 5D9SA 3NFSL 4RZCB 2BNQA 2H2PD 4JY4A 3O3EB 5C8BB 3V9FA 3P0VL 2OTUB 1R87A 1IGFH 2FGWH 2G9HB 4ODSL 2V38A 3MODL 5B38A 5T3XE 3QXDA 4LNVA 1JXJA 3T04D 1KR0A 5IG7B 5TQ0H 3MGTB 2V5TA 1AY1L 1A5FH 1OF2A 1MCHA 1UG6A 3KZSA 4JRXB 1LO5A 4OLVH 4D9QD 3L4WA 3AREB 5DUBA 3MNWA 1OB0A 5JOFB 2DIBA 3HU7A 1BOGA 4UQDA 4IIQB 3VXOA 4HCRA 1AMYA 4PGCB 4UQAA 1CLVA 5DD5H 1CICC 1T89C 3NA4A 3PE9A 4KXZI 4QHLB 3RU8H 5A2CA 3BLKA 5L0QC 5GJTH 4H20L 1FG2B 1MAJA 1OAZL 3KYKL 2LAAA 4D9QE 2ZUUA 4ISVB 3WJJC 2DH2A 1OAXL 1RUPL 4HIHB 5DR5H 5D1QA 3H9ZA 2XIBA 1OT2A 3W9EB 4XCNB 3BPOC 1FHDA 3RA7H 1DSFH 5D7JB 3P11L 5LCVL 4JRYA 2JJTA 2P5WA 2FO1A 1ODUA 3WN6A 3BAKA 1W9XA 1E6OL 3C5ZA 4OZFA 43C9B 2DEPA 3P9LA 3VXMB 2VUOA 4OT1H 4K8RC 3O8XD 3T3ME 2ZKHL 5HVHC 1K85A 3UPAA 1F3RB 4HIJA 1ZANH 2PW1B 4PJGB 5DGRA 5D70H 1BVKB 4YDKL 3WJLC 5I8KL 4GAGL 1UR9A 4OSUH 5I2IB 4XP4L 1X4ZA 3GXMA 2ZOLB 1YNKL 4Z7WF 4ZDHB 1C8PA 1F45A 3BHBB 3DVGB 2G3MA 3P30H 1UXWA 3QH3B 3BAEH 4L1HA 3W38A 2DDQH 1DUZA 3PWNA 2FBOJ 4P5TC 3L9RA 4G8GA 3WDRA 3V0VB 3FCTB 4PJEE 4X7FC 2I9LA 1G6RH 4Z8FL 5CIPH 4NZTH 1HWHB 5BRPA 3UAJD 4AY0A 4QHKJ 2P24A 3TWCH 2UWEB 4GW4B 4IOIB 1Q8MA 2FEEL 5HGDA 2FR4B 4ODUA 2A6JA 4UZSA 4CD5A 1M4KA 3I9GL 1H3VA 5BMFL 3IK2A 2CKRA 3B5TA 3G5VA 1VFFA 5MERA 1YZZA 3QUKB 3AMGA 2P8PB 4E42B 1G1YA 1OW0C 1ERNA 3WSQH 1DEEA 3NAAH 2VLRB 4BZ1L 5ETUA 4Y19E 2J88H 3BKYL 1UG9A 1LDPH 5DS8A 3VW3L 3FN3A 1I3RA 4U6YA 4WWKD 3VFGH 1LLOA 1JK8A 5GRWA 4D72A 3QULB 2XZQH 1RZKC 4Q22A 3SE9L 1S9XA 4JHAL 1C12A 1MIML 3TF7C 3P4NA 4M29A 2I07B 1MFDL 3WLWD 2DGAA 1IGIH 2E8ZA 4HWZA 3CVIH 4APQB 1KEMH 4U1JA 5J9PA 5CSZA 3QHNA 4PJ9D 4PJGF 3SCMC 5DWUH 4M93B 4PY8I 3RUGA 3IDJB 2EE2A 3V6OC 4WSKA 3A6BL 3ILQC 1MELA 3ROOA 15C8L 1TJHH 1WUNT 1HT6A 1UZ4A 4NRXB 5I19H 2WV3A 3QDGB 4IEFB 5I5RA 4FQPA 4R26L 1XD0A 2DD8L 2Z1KA 4HS8H 5DT1H 1KULA 3CIQA 1U36A 2F8XC 2EPOA 2NXYD 3ARED 2WIIA 4P5TD 1WBZA 2ZPKL 1O7AA 4UQCA 1ZXQA 5A2AA 4MD0A 3QIUA 2PO6A 4MHHI 2OSXA 2CXGA 3HZKA 5IBTL 2JIXB 5DJ2A 4JDVB 2UWEF 5IVNA 3CUHA 5D9MA 2ICWI 2JB6B 5HI3C 3DX8A 5K93A 3N11A 3ULUL 1D5ZB 4JZJA 4XP1L 3DUUB 1U8NB 4Z95L 3HMXA 4LSTL 1R6VA 1DDHA 2O5YL 4YHZL 2WCSA 4NSBA 4GQPH 3KPSB 1EGZA 3IVKA 1IQDA 4O58L 4PGDB 1L0YA 1CE6B 2IG2L 4KK6D 3QEHA 4UFHA 3C5JA 4KU1A 4FQ1L 2FJHB 1QBLL 3C5SA 3RGVA 5E4EC 1MCRA 4L4VB 4JFDE 1MFVA 4AL8H 4YX2L 4YBLB 2R23B 3MRMB 5KANI 1BGGA 2EDBA 3FL7A 4AZ8A 4XVTH 2R9HD 3HFML 5HYIA 4H0IA 3FQWB 3X13A 3MSPA 2W66A 2Z4QA 4WLCA 5IB2B 4RBPK 2R1XA 2ZG2A 5C3TA 4I0PA 5MEOB 3L3IA 1KIRB 1KQYA 3DRQB 2RAMA 3RWFB 4GI8A 2QLVB 3I6GB 3QUZB 3BZFB 4GW5A 3ZO9A 4HBCH 4R4BB 5A6BA 5I74B 5IVXB 1JHTB 4LSRL 1JNEA 1OAUL 1F11B 3F5LA 1TCRB 2VIRB 4LLAA 4ODHL 3ARGC 1G7QB 3MNWB 4JZJC 2QEJA 3KXFD 2X4PA 4KJWD 1GOFA 4YFDB 1WIUA 3F7YA 5FYKL 3T8XB 5HHMD 4NM4H 2CK0H 1G0DA 3VFOA 3FT3B 1HJWA 1P4BH 4P7QA 4YGVB 4GO9A 4AL8L 1T7XA 2ITDA 4AEIL 1K2DA 2PTTB 3MLRL 3CSYB 3X11B 3SJVE 2R69L 2G41A 1UCBH 2WC4A 3ZT5A 5DJ2B 2B4CC 5GZOC 1JV5B 3QG6B 4NKOA 3LSOB 4YDVB 4CN6A 3GGWA 1GGBH 2HG5B 4UOZA 4CCDA 1FFNA 3QEQB 1DBAH 5EPMA 5DJYA 1IGML 3VFUB 3CUJA 4G9FE 4KRTA 4P8UA 1A7PH 1VKXB 1VBRA 4JHBA 2VE6B 3FTGB 4M7KL 1DQQB 5ISZD 4E0RA 3JWDC 3UTZB 5I16B 2CRMA 2DF3A 5CUSH 1KBKA 1WIPA 3MROA 4EI5B 2WWCA 2EXOA 1JFHA 2WVVA 4G8GB 3V5DB 4JFFB 2PYED 3DX6B 4OGZA 1RJZB 2FB4H 4M7LH 4QHMA 4OQTH 4XPTH 3SDYL 2R0WL 2R2HA 4M6ML 4TRPH 1WBYB 5F1NA 4F33A 3OZOA 5A6SA 2AEPH 4DVRH 4F79A 1GOMA 3JTTA 1A6UL 1B31A 5EFDA 5C08A 1W1VA 5DO8A 1KLGA 1KGCD 4F9DA 1NC4D 4RAUB 5FA4B 4QRTA 5E8NA 4AG4L 4AD2A 5HVHB 4AIOA 2P8PA 2F53D 3NZ8B 1F6FB 3E6HB 3F12B 3MRLA 5DC0A 3DO7B 1YMMA 3WFCL 4G3YH 2AJ3A 1RK0B 3INUL 1OPGL 1QR4A 4L4VD 1I9RL 4QHUA 4P5TA 5T3ZH 1MCEA 3NN8A 4JAWA 4ZAKB 5I75C 3WNNA 3MRHB 3SDCB 1EHXA 1CFVL 5L0QB 4Y4KA 5TDPB 5H8DA 5IHBA 1QFWI 3ZDYF 4HULB 1QKZH 4PGBB 4PJHF 1BWMA 1N8ZA 2APBA 3EGSA 4LSSL 3VXUE 3MS8A 4ESKA 4GKSB 3KPLA 4ETYA 3LKSB 3MU7A 3MUIA 2NNAA 4DKDC 1KG0B 1KACB 5A8QA 3VU2A 4I3GA 4IRJC 1S5IH 2BVEA 4G6FB 4LXFA 5D2LF 3VIHA 2UZIH 4Z76B 3ZLQC 3DIFA 4W7WA 3WLBB 4TXEA 3E6FB 5IJKC 4KI5F 2PW1A 2JFEX 3GXFA 35C8H 3UDWA 1FN4B 1EEUA 5D1QC 2X7LB 3QI9C 3KPSE 2A38A 4U49A 1I7TB 3LEYH 3MCLH 5C0IB 5KVEH 3MRDB 3WUGA 2R1YB 3LRSA 3RVXC 5MP6L 5GZNC 5AEAA 2CIPA 3QUMA 2AK4B 4XRCA 3UJIH 4XXDA 3SO3B 2PR4H 4I0PD 5C0BB 1XF2B 3BQUA 1R24A 2R2HB 3S2CA 2HJLB 1MFAH 5TD4A 4MX7A 5GGQH 1IEBA 1UZ6E 4F7PA 1CFNB 3REVB 1TJGL 4PREA 3WY1A 3ARBC 1JN6A 5HYQB 4LSSH 1N3NB 1M71A 1XGRB 2GT9B 2AW2A 1R86A 2Y1VA 1WT5C 2XWBB 5D1XB 5TE6L 1MCDA 5DHVH 3WNOA 2HRPH 4CKVX 4JVPA 2XN9B 1HX0A 2E4TA 2WYSA 1M7XA 2CLZA 3OJDA 1BJ1J 3OQ3B 2GDVA 4GMTH 2AGJL 4AIUA 2G3JA 5E08L 5ISZB 2OYPA 2UZIL 3TONA 1GRWA 3WKML 4FP8H 4OQ1A 5H94A 1ODZA 1I1YB 2VRQA 4EI5D 2ZG3A 4CD6A 1CNVA 2R1XB 3W4RA 2HFFA 5EO1B 1F4HA 5DUPL 1I3RB 4MJID 4MAUL 4W86A 5ID0B 4HWBH 5CEXB 1HI6A 4CVXA 4P2QB 4A2LA 3BP7A 4K2UL 2UVEA 4NC1C 3N9KA 3VXNA 1UM5H 5E1AA 1UH4A 25C8L 6CGTA 5KJRH 1G7IA 4WKFA 1H3WM 5CSZB 5DFVC 1V3JA 5IMOB 4U0RC 5FYLE 4FQIL 1OT1A 1KXQA 1KB3A 4LCYA 3IAGC 1US3A 4NZUH 3OIHA 3O0RL 2FHBA 4OIIL 3PWLA 3C6LC 4J7RA 4GKLA 4PRPD 2HVKB 4XXCC 4MCYB 3S3SA 3BUYB 5SWZA 4WW2A 4UZGA 3UETA 2J6EA 1NFIB 1MLCB 3V0WL 1P4IH 3F7VA 1QHPA 3SGKA 3N15A 5IK3A 4L8SB 1A9BB 2ICCA 4NSKA 4LSUH 4WHYG 3SGDI 5L2JB 3MLUH 3TTOA 5DJDA 4IM8A 5GHWL 4PTTB 2DKSA 2CJUH 5D6CA 3PNWB 3HB3D 3GJFB 3UO1H 3ULUF 3GGWB 4CBPA 3MRNA 4Q6IA 3WIHA 4Y89A 4Z7UE 2BSTA 4ONHA 4M43L 5FCUH 1WICA 5GGRA 5GRVK 3V52H 1VEPA 1V3HA 5ABGA 1U8LB 3SGEH 4PP2B 2XV6B 3AGVA 3AIRA 1FNGB 3IFNH 2LQRA 2PXYA 4K9EH 2ZUVA 1CCZA 4FNLL 2Y23A 3DHUA 4OAWA 1T6VN 1UWGL 5EOTB 3KJ4B 1AGEA 2A0LD 3LEVH 1K9EA 4OGAD 3VGHA 3O0RH 4XAKD 3K2MC 3C5JB 1I8LA 2J74A 4U1JB 3HG1D 2HMIC 3SCWA 3W5MA 3GDBA 3VFSA 4Z7OE 1PX8A 2CDGB 1BD2B 1CI5A 5D2NE 1UD3A 4X6EB 2PBGA 5F7DA 3MSGA 4PMRA 3O4LA 4H88H 4J4PC 1OLZA 4DFIA 1MFCL 3SDDD 1JWSB 4NZDA 1NKOA 1UM4L 4LLWB 3C6LD 3AXLB 2CJUL 1E1FA 2VCAA 3PP4H 1ZLSH 4FLOA 5GGSA 3FRUB 2F54A 1XCTA 2AQ1A 1QSED 4R2GC 3V52L 4Z8FH 4DW2L 4NZTL 3RKDC 2BSED 2B4CH 2GAZA 6FABL 3L3DB 4XWGL 4WI6A 4R27A 3T0ED 4WI4A 1LDSA 4GSDH 5GS0L 3LY6A 1I1AC 1WEJH 2CEQA 3V7MA 1PZ3A 4P0DA 2H6PA 2EDQA 1QBBA 4KJPC 1GVIA 1JPTH 3S4SA 3RFZC 5IBUG 1JIBA 4LGXA 5EZOH 1VJZA 3ZTNH 1JNDA 1SJVA 2DYPB 4DWHA 2QQNL 5E24E 4FN0A 2I27N 4HWUA 1LG1A 4OF5A 1CU4L 2P5EA 4AD5A 5FHAL 2IBZX 5AZEH 2O9TA 1AGBB 1S7SB 3EKCA 1CL7I 1T1YA 3OZ9L 5GRYA 4XVSH 3W29A 2R1WA 3BVNA 5DHYA 3V4VH 4Z2HA 2APTA 1L8NA 3T3PE 3QUZD 3ZT6A 4PP2A 2HG5A 3T1WA 4B7IA 4P46D 2OSYA 3NACL 3D85B 4JPIA 4LSPH 2UWFA 1JYXA 2JEQA 1YNLL 2IADB 3PDDA 4I0PC 5DRXA 2EEBA 3PGCA 2DQTH 4P2RE 2WHKA 3B6SB 3CPLA 1OB1A 4I2XB 1DVFA 4C54A 1GOHA 4WCYH 2CESA 5MENB 2CPUA 1DLFH 4WV1B 4LBEA 1RZJH 3EYVA 4HS8L 4NNYA 4JEGB 5IV2B 1JWUB 2DQIL 4QRPB 1FC2D 5GJSH 4HWBA 3D69A 1KIPA 3SGEI 1MHHB 3QQ3A 2YL6A 4Z77B 1A1MB 2CUMA 3I2CL 4LKXA 3GSQB 5GGVY 1I8MB 4YQXL 1VIWA 3S88H 3D48R 3KS0H 5IFJA 2I9TB 1OCWH 3V6FB 5IDIA 2XN9A 3LQZA 4OKVB 2YOCA 2R0KH 3RY5A 3ZYJA 4NPYB 5I1IH 5TPWL 3CMOL 1P4LA 3SDAD 2C3WA 5HYSA 4KKLD 2Q8AL 2VDOH 3GFUA 3S37X 1HHJB 2IMNA 3ZDXE 3OKNA 4O58H 3P3YA 1P5UA 1JGUL 4ALAL 1Q0YL 2QTEA 3QZWB 4U0QB 5L88L 3FZUD 1E4NA 5FYLH 3MNZA 5C0DA 3HG1B 3T2QA 3O3AB 1V6UA 4ACZA 1KN4L 1CYGA 4D8PB 1HEZB 4NQSB 1I8KB 2HAZA 3TIDB 1BD2D 1YEIL 3EDEA 1IAIM 3M46A 4ZAKA 2P1YA 4HWNA 4JFDD 5KVGH 3MA9H 3EAKA 3T0VA 1VB9A 1ZGLB 1VGKB 5E9DA 4RX4D 1V6XA 5KAQG 1MHEB 5EZJB 4KHXH 2W0LA 3RVUD 1S3KH 2MOVA 4NO0B 3RWEB 2BNUB 5TE7L 4F3FB 5E9AA 4FFYL 2YBUA 4YXLL 3AFBA 4ZFFB 2EDJA 4LCWB 5GGTA 4LHUB 3UTSE 3Q1SH 2D4DA 4NI3A 4OUEA 1T1WA 5IQ9A 4Y1AA 4C83A 4NUJA 2CBUA 1I1AD 1PD6A 2NX5B 1RJLB 4JRYD 3WO3B 4X4XA 3T0EC 4AIZA 4ZTOL 5IQ7L 3C5ZD 2UY6A 1NEZG 3DYPA 4ZSOA 3RKDD 2D3VA 3U4BH 1OAZH 1ZT1B 3KYKH 2NXZD 3LN4A 1Q0YH 1S9KC 5AYQA 1NAKL 1RUAL 3BKJL 1AQKH 5I2UA 2ID5A 1KCUL 1JWUA 4QRPA 3KYOA 4K55A 5LGHL 1A2YA 5BW7C 2V5RA 5CKAA 3SDDC 1L7IL 3BPCA 4GQ9L 4MXVF 5J1TC 4R0LC 5I1LB 5EIVA 3VFRA 1U8JA 3B9VA 4ZQKB 2WNGA 5CHNA 1BVLA 3UR7A 3REVA 3ZM8A 2PO6C 1BFSA 2UUDK 2EC9T 4YJZL 3VGFA 2NY5H 4MAVA 3GSNB 4X9HA 2PWHA 4JKPL 3UTTB 2XWJA 3T4AB 1IC4L 4OGAC 3D2UA 3KPMB 2D0GA 3VE0A 4PJEA 2A0LC 3MRKA 4RMQA 3G6DH 1C5BH 2GSIA 3LD8B 3Q1SL 2VWEC 4HHAB 4UTAL 3IU4H 4LOUD 4U6VL 2GJXA 1S7RB 3WE6B 4PMUA 3U9PH 4FLQA 3IJSA 5IMMA 3WF2A 4B0MM 1F4YH 4RFEB 4PJIA 1U2YA 3P4NB 4WJXA 3ZSSA 1N0LA 4K23H 1A7NH 4I0PB 5C0BD 3SE3A 2BP3A 2Y24A 1J05B 4JN1H 4X5LA 3WUWB 2XVPA 4XXCA 3SGJC 3NCJL 5DF0A 4NQEA 5CBEB 1W3KA 2FO4A 4R3SB 2AEPL 4RQQA 1DBJL 1EFXD 1F4XL 5GXBB 2DMBA 1FNHA 1WAAF 5E5RB 5LAXB 1L9NA 1R3HB 5IFHH 1QVOA 1A6VL 1OD0A 1C7TA 1OD8A 3SPVB 2ZUXA 2OZ4L 3B3IA 2IQAA 1FL5B 4AENB 3V5KB 1CEOA 1UH3A 4RGOH 1UWQA 5F7EH 4A6YA 3MACH 1U2CA 4OLXH 3HMCA 3CVHA 3T1FA 4BZ1H 1U8IA 5J57B 4PMDA 2Q76B 4AZIA 3VWJA 4S0SD 5ICYB 1PZ5A 1N3NA 3VXRD 2BFVH 1OIFA 3IRZA 4G9DA 4TVPE 4UTAH 4EI6B 2I26N 1U8PB 5IHUL 4LAJH 3EOAA 4X98A 2IANB 3EO0A 3OG4B 3MOQA 2J7BA 1WITA 3QXUA 4LP5A 3OAUL 4NRZA 1HL8A 4TSBH 5K9KB 3QHFL 4WSJA 3MJ6A 2AVGA 3BGMA 4NM8L 3U0PA 4XPBH 1TVBA 4ZUUA 4AZGA 1OTSD 2YWYA 3ZL4L 3PWUB 1CF8L 3DUSA 3WIHH 4M3JA 3H9SD 4Q0XL 4KI5D 2VJXA 5BRZD 3R0NA 5D7KD 3O6FC 3LH2H 4CD4A 1X5FA 2VX4A 4M62H 2J6EH 3OF6A 4NJAH 1S7XA 3VD9A 2WIMA 1KJ2A 3AIBA 4W8AA 1KENL 3UESA 2NW3B 4QHNB 2QQKH 4AZCA 1HINL 1C92A 3LN5B 1GGTA 1MCBA 1DQDL 2XI9A 2L0DA 3JVGA 1LVEA 5HD8C 4HA4A 3X12A 4LCYB 1MH5B 1M7IA 4YHPA 3C5ZB 4XP9L 2NY4D 1B3XA 1SYVA 1OARH 5AYUL 1ZVSA 2YA2A 3PL6D 1CENA 5BVJA 3ARFD 4J2XA 3ULVH 3TM6A 3JWDL 4WFGE 1U3YA 3BAXA 1KTKE 1N64H 4MB3A 5EO9A 3VKKA 1UT9A 2X4RA 3NCFB 3RAJH 4HA1A 3ZR6A 5IVXA 1CXEA 5GZND 4JB9L 3RVXD 1LEKB 1I9JH 4HF5H 4NQEB 5CBEA 1YC8A 3X17A 1WZ1L 3P4MB 4ZUTB 4ZNEA 1G9MH 4PLNC 1LL6A 1AE6L 1NGYB 4ZSOE 3U30B 4HK0B 3V5HB 2VR5A 4N68A 3LD8C 1G1CA 3LQMA 3L4YA 4V1DE 4OUOA 4P9ML 4XWOC 4NQVA 2CLVA 4YO0A 5E2WH 2FHCA 2IQAB 3UTTD 2Q86B 3GMOB 4PJ7F 4ZS6D 5IB3A 5JA8B 5F3BB 5E6IC 1VAHA 5D70L 2ZJSL 4GMTL 1J1XH 2BY0A 1UQSA 1LE5B 2P24B 2IH1A 2UYLA 1TZGL 4PJBA 3QRGH 1MJUH 32C2B 1LP9A 1QLEH 1QVBA 3D5OF 3O2WH 4JN2A 3FONA 1JZ5A 4FG6C 3GSRB 3W0WB 1NCAL 2D7TL 4QRQB 5DZNA 2DSVA 5FEBA 3HNTL 4JFEA 1NP2A 4YHLH 5L6YH 4PJBF 5IHZB 1CT8B 1LP9F 2PF6A 3RVTD 5DQ9A 4OZFG 4X5XA 4X6EA 4YBLC 2X05A 3GKWH 5BV7B 1UM5L 5FM4A 2J8GA 3L3IB 3CUGA 1BQLL 3UJTH 4AH2B 4P4KA 3UYRL 4P2RB 1U3HA 3D5HA 1YQVL 3MROB 1UKQA 4NZUL 1W3HA 3LN4B 5CILL 2HTLD 3F4VA 2H8PB 5JW3H 3GMMB 1SYTA 3V5DA 3HZVA 3GIZL 4QDMA 5D9PA 2JF1A 1KCKA 4R97B 5F88A 1UJ3C 1G7JB 4OUUB 2I60L 5C0GA 2OI9C 3KPRE 5FGBA 3FO9A 4QGTA 1Q72H 2CIIA 3VXRB 3L3KB 3ARVA 1YEJH 1HXMA 5HYEA 1IBGL 4G5ZH 3KLAA 3ROOB 3JV0A 1BVZA 1L4IA 5L7XH 1FP5A 3VFGL 5I1EL 4IOFD 5GRXG 4OD3H 4MA8H 5C0AB 4JJ5B 5HHNA 1HJUA 1X6LA 3IFOB 3O6FB 2ITDB 2XQBH 5DI8B 2W1NA 1J8HE 4ZOCA 2HVMA 2H3NB 1RFDL 1NLDH 4U1SB 5JW4Q 1GIGH 3WF1A 4TYUA 3PV6B 4P46B 4PJ7B 1JNHA 5JXEA 1S7SA 4NDMA 5FUOH 1HP5A 5JBDA 4HXBH 1XH3A 4W8LA 1ZHLB 2ZZUT 5D4QA 4JFVA 4NQVB 4YO0B 5KVDL 3T0XA 1TZ7A 4OZIE 3LEXB 5DHYB 3MGTA 4JVWA 3LEVL 2X70A 3WUEA 3SKMA 1CICD 1F2QA 4PJCA 4S10A 3CLFL 4HEPG 5CPSA 1A7QH 2DLFH 5DJCA 5EH1A 2X44D 4X0VA 3PQYD 4O51B 4DGIH 3PWPD 1MI5D 4OFKA 1UM6L 4PJBB 1UWUA 1QG3A 3UPRA 4UNVA 4RAVB 3SE8H 1BG9A 1MHCB 3MO1B 4LHJB 3V0AC 4P23D 4TTDC 4QCIA 4ERSH 4FG6D 3W24A 3MZGB 1NGPL 4MNQB 4WI8A 4QY8B 3EMCA 4GZIA 4PRBB 4FABL 3L2MA 1VADA 4AT6A 1W2KT 2KUTA 5SX4I 1AXTH 4U33A 4GPNA 2X10A 1FH9A 5DT5A 1C90A 1HCFX 1QA9B 2GDUA 3EJZC 3OF6D 1KXTA 6FABH 4DOHE 1EHLH 4CW1A 3VA6A 1E6JH 5BVPH 2XZCL 4WW2B 3ARGD 2APFA 5HTSA 2WBGA 3BDXA 2R4SH 3IB4A 5J3HC 4UV4L 1HXJA 4JFPB 1RIVH 3FO2B 3PHSA 4GMSH 2XM2A 2IANA 3LPWA 3QDGD 3CLWA 3RDTA 2NZ9D 3W53A 1V7MH 4BSVA 4YX2H 1PJ9A 3HE6A 1G7HB 2K9UA 4Z7QF 4R8WL 4GO8A 3BHBA 4I5BA 4PUBL 3Q5YA 3VXME 4YHMH 4CRPA 3W37A 2BSSA 2EE3A 2X4UA 1E6QM 4S1RH 5DQJA 5KTEH 1U8LA 4UIMA 3PL6C 1GOQA 1HDMB 2NY4C 1A3LL 2ED7A 4R9HA 2GJPA 2OR9L 5DEFB 5KSBA 4FRWA 4KTEH 4NO0D 3JUZA 4GLRH 3KL0A 4OIBA 4KAQH 3PIQB 1KBGH 4KV5E 5M5DA 4LCWD 3NDZA 2DQGL 3NSNA 3TA9A 1CDHA 1YDPA 2E9WA 1EEZA 4KVNL 4NKOB 1H3PH 4YHKH 1KB5H 3Q3GA 1X5LA 4H20H 5D7LA 4F3FA 4OCYL 5C6TH 4E42A 1OAXH 2VMFA 4WU7B 2PWGA 5I17B 3UTQB 5E4EB 3VG9B 3ULVF 5F44A 5IMMB 2X4RB 4KZDL 4JPVH 3QNZB 1P4BL 5F7MC 2UUDH 1CZ1A 2B8OT 4W6XB 2AJYL 4P3DB 1RJLA 5GJSL 5HDQH 3QULA 3DUHA 3L5IA 3QFDB 1A7BA 1E4IA 4P4RA 1MEXL 3GH7A 2JE8A 3E3QE 1YQ2A 3GHEH 2P46B 4NQDA 2HT2D 4WW2F 2X4SB 1A1OA 1JFQL 2X4TA 4JE4B 4MJIA 1VEMA 1ZE3C 1E27B 2X4QB 2VI0A 3W9DA 2OR9H 1QO3A 4KWUA 3U6RB 3VI3E 5K59F 4IBLT 4D6DA 2XFFA 1I9IH 3JTTB 4Q9BA 5FKYA 2EYTB 3LZFL 3MOAH 4JFHD 2JIEA 4XNQB 1U92B 3MC0A 4LPTA 3SCMD 4P2QE 3B8SA 1X5HA 1A8JH 1JFXA 2VXQL 4G7YL 4DM1A 3ES6B 2DTSA 5D93B 1ACYL 4DZ8A 3LSOA 1AGDA 4YDVA 4H2CA 4LCUA 4C56B 4GAJH 1Q6FA 4QTIH 3O6ML 2YBTA 1Z2KA 3P77B 3S96A 4EXKA 5DHXB 1OWRM 2M8XA 4MAYC 3MX0A 4RCAA 2J4WL 3C08L 5F72S 1A6UH 4P7LA 5ETUB 2C3XA 4J8RB 4NWTH 1BAGA 2RCSH 2YRLA 3LHPH 1HVXA 3MBEC 3WXVH 1F3DJ 3OXRB 4HH9B 4HS3B 1R7OA 1AJ7L 1QP1A 3FO9B 4NFCA 4WNQA 4BYHA 5GGVL 3BAEL 3ULSB 5FECB 4YWGL 3VXMA 2PXYD 1C8YA 3LKPB 2IH3B 4PJAE 4GG6E 1NFIA 3JV4B 2ERJC 4PJGA 3WBDA 1G6RL 4YDLB 1SYVB 1T0NA 4K3JL 2EDEA 4RMWA 4P23A 3I6KB 2YD5A 2E3ZA 4LEOA 3IFNL 5LGHH 3TWCL 1KCSL 4UAOC 1VFAA 3BIAX 4R5EA 4PJ7E 1XF4A 3VGEA 1N2RB 4W4OA 5DD3H 5CD3B 1KJ3H 1ZLVK 1DBMH 5JOEA 1TA3B 3CLEL 5E0QA 4DQOL 5JR1L 2VVSA 4ODVH 2X4SA 4NPYA 3C5ZC 3SKMB 3H9SB 1S9YB 1Q1JH 3A4WA 4XCYA 4O2FB 1INEH 2VURA 3RHWK 5B38G 4MA3B 4NO2B 3B9AA 2CO6B 4HH8A 3F62A 4HSQA 1MRFH 4J23A 3OB8A 3NGBC 4MX7B 4OIFA 2XFXA 4UOW1 4IPLA 3VGBA 2FSEB 4DCQB 1AO7A 3QEUA 5C0CD 4WHTB 1QW8A 4Y5VA 1JGVH 3MXVH 3POCA 5HGHA 1C5BL 1ADQL 4CU6A 3KPTA 1FZOB 4R7DA 1ZLSL 1ED3B 3U4EB 2EKSB 1D5XA 5I1DA 3BXNA 3BP4A 2ZCHL 1ISWA 2AKRA 3UG3A 5LBSL 4BFIB 4D71A 1K4DA 3LN5A 3QISA 1PYWB 1QSFD 4PRID 5FUZL 5CEZD 4Q6YA 4W85A 3KYAA 1EK3A 3BPLB 2ZNXA 5EN2B 1RUKH 5ICXA 3RWCA 1OGBA 1X7QB 1WCGA 4FLRA 5A2KH 4WTWA 1J0HA 4X0KB 4TSCL 2DS4A 2D22A 3K8MA 3WO4C 2WSPA 1WAAA 4DQOH 4HIEB 4OBSA 5IFHL 2VLLB 1A6AA 1A6VH 4N0UE 4UU9A 1NP0A 4M80A 1GOOA 5JPNB 1MVYA 3NPZB 5J56B 3W0WE 1R3LB 5EFIA 2VWEE 2RBLA 3U79A 4O5LL 1Y6NR 3KDMA 4O02L 1IGTA 3ABZA 1FL3B 3PTQA 2NSXA 4O2EA 4WGVB 2DYPA 3RBGA 4X6CF 4QLLA 3QIWA 1P84K 2JK5A 3WN5A 1R5WA 4M4PA 5KZCD 5CMAA 4MD0B 4NQDD 4RISL 2X89A 2VUYA 3TN0C 2ZUNA 4K3GA 1ORQA 3R1GL 3BH8B 2JKXA 2DQTL 4OCXH 3W0WA 4KRUA 3EYQD 1K2DB 5ISZA 4HCRH 1N0XH 3DURA 3CXDH 3MV7D 4GXUN 2H1PH 4DKEL 4Y7EA 1HKIA 4PJ5A 3BCFA 4TSCH 2Y5TA 1FBIL 3CFBA 2R0ZL 3CC5A 3IJHA 1DBKH 2XFXB 1NCTA 1ZTXH 2XN9D 4HHAA 5DJ6A 2BMKB 4QOKB 2AABH 3KLSA 2R69H 2J5LB 1XYZA 1VFOA 1X5YA 3GTNA 5I71C 4NP4H 3AROA 3WNKA 5BQ7A 1F8TL 3ARBA 3KG5A 3VXNB 1VJSA 5DRWA 1GGCL 3O3DA 2R23A 1GHRA 3LMYA 1OAUH 3ARWA 1MWAA 4M6NH 4MWFB 2MTPA 4OV5B 3UZEA 4CCCA 4I8DA 2OYMA 2EXYC 5D7JC 5CUSL 4JFDA 3VDHA 2P44B 4I3SH 3C60C 2OSLB 4J3XA 4UFLA 4TULH 4X5WA 1UWGH 3PTMA 5GISH 3ZZ1A 1E4WH 4PJBE 5HHNB 1FAIL 2B0SL 2VXTH 2IFFH 2VH5H 4ATLA 5E9DE 4X7EC 1R3LA 4DKEH 4DZ8B 3KYOB 3MRNB 4Q6IB 4WIQA 4IRJA 3VGDA 4NQCB 3IXAB 1DQLL 1Q9OA 2Z8VC 2IAMC 2H2SD 4HKZA 1QI0A 3GBDA 1P7QB 2AQ3A 1GGBL 5GNXA 2XA3A 3EO0B 3K80A 4LNRA 3O2WL 4N8VA 5F96H 1H49A 2CITA 5FB8A 4PD4J 4NHCL 3RGHA 4J4PD 4LIQE 1VACB 2J8OA 2YPLE 1LMKA 3GZAA 2DJSA 3IKCA 3PDGA 2DWEB 3HLAB 3D3VD 5C9JB 3FT2B 1ZAGA 2PYFB 1QSZA 1C5DB 2DMKA 3QAZC 3DV6B 3KPQB 2O61B 4F66A 3O4LE 4LARL 1TUXA 3CZGA 4Q9RH 5C0CA 5A8MA 1UZ1A 3DC0A 1DLHA 1H8SA 1E4WL 3MV9A 5EU4B 1G5AA 1KG0A 4U6YB 3MJ8A 1G7LA 2C4FU 3KYMA 5FO8B 3MUJA 3TT3L 3VFPA 2E7CA 5I17A 3UTQA 2F54E 2X09A 3VI4E 1FAKT 5C1MB 1ES0A 2ZX5A 3AZTA 1EFQA 5IFAL 2EDFA 3BEVA 4D6FA 2XHYA 1Z6JT 2EDKA 2FECI 5ECJE 1MHPL 1O6IA 1GC1H 1TVHB 1NCUA 3RX5A 2LU4A 1IV8A 4HK0A 1NCDL 8FABB 1LE9A 4AW7A 1V03A 1WDQA 1UD8A 1JPFB 2J8FA 1BM3L 1ZT7B 4HUXB 3WMBA 1SQ2N 4Q6IC 5F6HI 4ZFOL 2CDFB 2L7JA 5DD1L 1HYSC 3GO1L 3SUUA 5E8NB 3KWXA 2DJUA 3NIYA 2NYYC 2IUZA 1VENA 3BAYA 5EU5A 1QYGL 5A43C 2Z1SA 3IAPA 5K9QG 5A95A 5F9JA 3VXSA 1QKZL 3CHFA 4O9HL 1EJOL 3BD3A 4NHUB 4CDHA 1J0YA 5F7HA 4OF6A 1FGVL 3QIWD 5FIPA 3TT3H 3WNPA 4OCSH 1LWHA 3RKPA 2WXDM 4Q9QL 1BZ9A 3VRJB 4YQXH 5DA4A 3BZEB 2YUWA 3BDBA 3QCUL 3PWVB 1A5FL 1VFBB 4Y19A 5LG1A 3DRTA 3WFEH 2BNJA 3HLAA 2D7NA 2H26A 1BG4A 5C08E 2GYSA 1QPPA 4Q2ZB 4E5XB 5SWZD 5I71B 2Y5EA 1LD9B 2CDEB 4XV0A 1FRGH 3MV8B 2V2WA 3DX9B 2J5LC 5FV1L 5TJWK 4PJ5D 5EORH 3LB6C 3U4AA 4JAMA 4MDIA 1K8IA 1MQ8A 4WV1A 5TE4L 5BV7L 1EHLL 4ZTPL 2O5ZH 2Q87A 1KTDB 5B3JF 1YA5A 3QP3A 5EZJA 1HE7A 1FE8H 2Z91B 3D18A 2ENSA 1EX0A 5IT2H 3L4ZA 3E6FA 3ARBD 2EEXA 5LCVH 3ZMRA 1HP4A 1KIRA 3HNVL 1JYNA 2A6KB 1WAWA 1JTPA 1V08A 4FQXA 3WMCA 4OI9A 4P9HH 4XP5L 2HT4C 3BRGC 3S35H 3UTSA 5GGSB 3SUWA 1B0RA 1ZANL 4P59H 4RWHA 4M48H 3IS1X 2XT1B 3ARFA 4LL9A 1U95A 4LKCA 4PPTA 5L9DH 3AB0B 5T1DH 2ZCKL 1DUZB 3Q0HA 4X9BA 4TTGA 1ZHLA 3RRQA 3U5UA 4MXWL 2YK1L 1MOEA 3CAFA 1G94A 1T4KA 3IVKB 4JZ5A 3S9DB 4KGLA 5GS2D 4IRJD 1NCBL 3ULVL 1B0WA 4U7MA 4M43H 5FCUL 5IQ7H 4R0LA 2UWEE 1TETL 3SDDA 3CSGA 3MA7B 5EC1A 2FYYB 1RUAH 1T7VA 3RPMA 1FE8L 5CJBA 5FYJD 3NYDA 2J8UF 4PJEB 1G0XA 2ZWLT 1KNOA 1QTYT 2FEDD 2AJYH 1FFOB 1SEQL 3TNMB 4WUUD 3QNYA 4RL3A 1UWEH 3AMLA 1VFBA 1MCLA 2Z92A 4Y19B 2YL9A 5DURD 2NY3D 4N0UB 4EVNB 3F58H 4ZFZA 4RE4A 3CUFA 1O5DT 2Z35A 3UTZA 3BZFA 2BNQB 2FNBA 4FTVD 2J88L 1VFAB 4ZO6A 5GNYA 2G60L 4Y2OA 4LLMA 3QRGL 3OKOB 1LEIB 2DBLL 1A7RL 5ANME 5LQBL 1Q38A 1M1SA 3M1BB 3ARUA 1LNUA 4PP1D 3OLGA 2NX5D 1OF2B 5BO1H 1RZ7L 1AGCB 3ZKXC 2JCCF 4WDIA 3AIWA 5JQ6L 3T2PA 2EC8A 3TPUA 1OSEA 1IAKB 4HKXB 2PKDA 4M9OA 2L4OA 3V6BR 4FNLH 2EQDA 3ARTA 4OLWL 1RUPH 2IQ9H 4X7TB 5EU6E 3PHQB 1RJCA 2LVEA 4N5UA 3BDYL 1WIOA 4JFEB 1EBPA 1Y6KR 3EDDA 1MIEL 2BSTB 2YDRA 3C60B 3WQ4A 1ED3A 3U4EA 5K33A 3ALPA 2V2XB 4OZGB 4QF1B 1XGZA 3FB6A 5T1KD 1JZ2A 4JM2B 2J77A 4G8EA 2ZKHH 1ITBB 3MV8D 2PW2A 3F58L 3FN0H 2M2DA 3WXVL 1ZU8A 5HHOA 5LGJA 3TBYB 4GAGH 1HXYA 4RGMB 5IB5A 1IBGH 4G5ZL 2WINA 2HKFL 4UDTB 4LLUB 3TTQA 4JO1H 1NCWL 5I1EH 4B3KA 1MAMH 3ZJ7A 3HI1B 5DO2C 2AEIT 3MV8E 4EXPX 4Z95H 5DFWH 1SJEA 1CDJA 5GZOD 1XR9B 2DH3A 3QXWA 1JGEA 1GIGL 1MNUL 1L9MA 2ESVA 3BH9A 4UR9A 1A3RH 1RJZA 3GHBH 2F15A 3O4LB 5JHDE 2GJZA 3S6CA 4KQ4H 1D6EB 3GNOA 3FO1A 1NANI 1XH0A 4JQVC 1ZWIB 3BP6B 3CLFH 1OGAE 4KJWC 4PUDA 2J6EL 1ZHBB 1O7SA 3VI3F 5K59E 3VMNA 4F7CA 3SCQA 7TAAA 2QQKL 1OINA 1MUJB 4LSQH 1U8PA 4M6OL 3KE0A 4WI2A 4HLZG 4XMKH 5CJXC 4OZ4A 4ZS7H 4IRJB 2PWEA 3MLWL 1AD0A 1OGAD 5D1ZA 3SKJL 2W9DL 4KFZC 2V2TB 2IAMB 3UYOD 5JHDA 2W4XA 4GXVL 3VFVA 4H25B 2ADGA 4N9GB 2XM1A 3UEQA 2VSDA 1LQ0A 2EDNA 1NMAH 5FB8B 4P8WA 1PG7W 2VDOL 1CFSA 2R9HC 4NGHH 1YECH 1G6VK 3W6LA 3PGDB 1U3HC 3NIDE 3GNMH 5CP3H 2XYLA 5D2LB 1I85C 4KKCD 5JIHA 4MVBD 1G9ML 3RL1B 1GC1C 4WCYL 1IJ9A 2NY3B 3P2TA 4LGRB 3WUBA 3KPLB 4PN2A 1I1AA 1JGIA 4D6JA 1KWKA 1YEIH 1MH5A 2P5EE 1H0DA 4JFZH 4O00A 4NJ9L 5ALBL 4YHEA 4L4TB 1IEAA 1CD1A 5CWSA 1OAQL 3GRWL 4D6IA 5A6BD 3G08A 5A3ID 1E4XI 5HPOA 4X5XB 4JZOA 4IDJH 4K7PL 4GT7A 3FT4A 4DGVH 3WD5L 3CU7A 1CGUA 5JDSA 4N8PA 4LCWA 1I1FA 1U41A 4MQ7A 1NFDE 3OKLB 4N9OB 1SY6A 1P7QD 2E9BA 4LDLB 1I3UA 1A3LH 3P4MA 3OA5A 2Y4SA 4MQXD 3REWA 2B2XH 5DJZA 1H8OA 5L2KB 1UA3A 2NY1D 3WUWA 1A14L 4C7GA 1B6UA 2PETA 1BLNA 3OKEB 2YUXA 2FEEI 2FL5B 1QNSA 5I73C 3D3VB 3FN9A 2CRYA 3O81A 3QXVA 5E6YA 5DUMH 3G6AB 3UYRH 1D5ZA 2P49B 3PG2A 4BF7A 2BRRH 4E8DA 3WFZA 3D39A 2A3HA 3EDFA 5I1LA 1OM0A 3C8KA 3DI2B 3AIVA 3AXHA 4G6FD 1OBAA 2ZCLH 4QLKA 3OJDB 2VCCA 4MB4A 4PJ9C 1EXUB 3VRLE 1S7VA 1ZKAA 3QT2A 3RIAF 3V6ZA 4HG4J 5JOPD 5MHSD 1EEYB 4KVCH 3GIVA 2DQHL 4KUZH 5MEQA 1JUFA 4PTUB 3DSNA 4JFQA 3HZYB 4L1DA 3QXAB 5J6HA 1QFWM 1EFXA 3SCMA 4K7FB 3BKYH 5GGRY 1EPFA 4PY7A 2X4NB 3BKML 3EYSL 4M82A 5B3JE 1S7TB 1NDGB 1Z5LA 2XYCA 4U1LB 4BCEA 4JIEA 5FM5M 4Y4KC 1IM9A 4XMLL 1MVUB 1IZJA 4KZEH 4PGZA 1HIML 3GMMA 2P48B 4H8VA 4OCMC 4R7NB 5JXAH 2P42B 2B20A 3BJLA 1W0VB 4NWUH 3S97C 4BUHA 3T2NH 4Z7UB 4UT6H 1DANT 1RUQL 4URIA 43CAB 1I8IA 1FYTA 4CMMA 1E1EA 4X8XA 1JYVA 15C8H 1TJHL 4QTIL 3M45A 4HIJB 4ML4A 5IOPA 1NC2B 3C9NB 4X4XB 3B43A 5I2IA 3MR9A 4P4KC 3FQNB 4KUZL 5DJZB 2DT1A 3LOWA 3CFDA 3O6LL 1C16B 1R85A 4DWSD 1RIUH 3H9SA 4IRZL 1BPVA 2WKLA 4MDPA 2VZVA 4Z18A 1HQ4B 5BRZA 2DQXA 3FFDB 4JY6B 1IL1B 3IJYA 4N8CH 3QHOA 5I8CB 1BAFL 3WHE0 3BKMH 3IJ7A 1IC5H 1KELH 2W63A 2VLME 5DQDL 1AI1L 1A7PL 5F1IB 2WINB 4UDTA 3RY6A 1JMZA 3U9PL 3GB7B 1JGDB 3E1F1 4XP1H 4QCEA 1FA2A 5BVPL 4K8RD 1F4YL 2DQCH 4IOIA 4RAVA 3VTRA 4NWUL 3EYFB 1QSFE 1HDMA 1QOKA 4FQQA 1SBSL 3VM7A 5HYQA 3IDIA 1ZB5A 3TYFB 1RIVL 4GMSL 4E0RB 4OZHA 3ISWA 4XHJD 3F65A 2FX9H 3VG9C 2R4RL 1ZHNA 5JORA 2VNCA 5HVGB 4I1NB 3VXTA 3CZEA 2A3AA 1YDPB 4YIQB 4CGTA 1B4JH 2A6DB 1XGUA 2P5WE 1JBJA 4F7MA 4YBHA 5L2KD 3VNZA 5D7IF 1IM3B 3HTLX 1A4KA 1P1ZA 1OL0A 1UJ3A 4RGOL 1N6VA 1CXLA 4WFFE 1FH8A 3O6LH 5D7LE 5TDNA 1V0KA 2NY2D 3DTXB 3UTTE 1QSFA 4KAQL 2D24A 2WANA 5E8PA 1MJJA 1OARL 2WWDA 1IC5L 1KELL 3ETBF 3OSKA 1UACL 2WUBH 4PMNA 1BJ8A 1MCFA 3HMWH 3WNLA 4M81A 5FAAA 1SMOA 3CU1A 3BP5A 4KHTH 1LNUB 3IXAA 5IROC 4XH2A 3U48A 3EJZD 1SBSH 1QNRA 1W32A 3TA3A 4APQC 4H26A 3WF0A 1FG2A 2OL3H 1CLZH 1MLCA 1F2XK 4TVPL 2Y9RT 4XGZA 1RHFA 3PZQA 4KK5D 4BZYA 4PTXA 2AEQH 4HIIB 2JIXA 3VOCA 4OZFB 4LDEB 1JFQH 2LVCA 4GKSA 1FDLL 2IALA 1FYTE 3LPPA 3LKSA 4H8WL 4D0DA 4PGEB 3HUJA 4LAQL 4PUEA 1B3YA 2Y7QA 4O02H 1F90H 2X89D 3LDBB 3VDBA 2YZ8A 5GIRA 5F89A 3WD4A 2CKBA 4HMDA 1HIZA 1FO0B 4PJ5E 1FNEA 3Q6FA 3WXWH 2AJZB 2VT0A 3ARQA 1RH9A 4I4WA 4JL2A 1JPST 3DGCR 2VXQH 4AIXA 1WK0A 2XUCA 5IB4B 5AYIA 2VLJA 5HYSG 1AXSB 2WZEA 2XSAA 4RNRA 1MXGA 4Y16C 5HJ3B 4PB9H 1KIQA 3CZFB 1OAKH 4YHGA 1T0MB 3LMJH 3ARYA 5DMYA 3AIEA 4YXHL 3L5WA 4LKXB 3SDYH 4JO4H 3U36B 4ZPTA 3HZMA 4WDIB 1ND0B 2XY1A 5E2VL 1CLCA 4PRDB 5CMAB 3VCLA 1NEZB 1WTGT 1OGTA 4H0HB 2I60H 2AV1B 1ZBWA 1Z3GL 2ZX9A 1FV1A 3VFWA 3U1SL 2AMGA 2K7QA 3R06B 1M71B 1XGRA 5HPCA 1OTUD 3CVHL 3PQYE 3ZYOA 5DTFA 3PF2A 4BQBA 1U58A 1E72M 3BZ4B 4MJ5B 3HNTH 1NJ9A 3DGGA 1DWFM 4RWYH 4UQ2A 5I24A 5HI4C 5GS0D 1QSVA 2XQBL 1OSPL 3HMXL 1S7WB 2QSCH 4U6XB 3RU8L 3VFTB 2IAMA 4M8UA 2D7PA 5GJTL 2HKHH 1QFWL 1Z5LB 1QRNE 4XPFH 1VACA 5E94A 3KWWB 1U3ZA 2BVOA 1QSEE 3FMGH 3TH4T 1J1OH 5DMGC 1TR1A 1BBDL 1BZ9B 1IGCL 2XICA 3RVTC 2V6HA 1YMHB 5HYJB 2I07A 3O4LD 1YQVH 3ALXA 4F57H 5F1OB 25C8H 3ZDXF 1RZJC 4M8QA 4M7JL 2XG9A 4FQIH 4HZAA 1EERB 2DICA 2HLFD 3GBML 1XH1A 5JR1H 2P5EB 2FDMA 4IUGA 5BW7A 5DMKA 1DFBH 1K4DB 2F54D 3UBXI 1QFPA 4MNQE 3I6LE 4KKNA 3MJ7B 1OGGA 4X83A 3QDGE 1EEZB 3AXXA 5SV3A 1S5IL 5E6ID 4WO4B 4XP4H 3OGCB 3NIFF 4RFEA 2ZUTA 4MCYA 2CKBB 1N5AA 4D0CB 3J8F7 5HHPB 1S78C 2CCRA 3CGTA 4J3SA 1TZIB 3I6LD 1DEDA 3GSWA 4FFZH 4I18C 2VLRD 2EH7H 1M05A 2GHWB 2BVPA 3C8DA 3U7YH 3K8KA 2QADB 3QPQC 4Y4HA 1CGTA 2AEWA 1S9YA 1R3IH 4EN3D 3TO2A 3C2AH 2XZCH 1NAML 4ONHB 5CBAA 5BROA 1BLNB 1NSNH 3AFLA 3O9WC 4QRPE 3X3GH 2WAGA 4YEEA 3W28A 2ADJA 2ICES 1LEGA 4WI7A 2J25A 4O2CB 2DM7A 2ZOKB 1MCOL 2JK5B 3FT2A 3DI3B 5IBLC 4I2XE 4W6WB 3WDPP 2VZ1A 2Z31D 3WJLA 2P8LA 1Q6DA 5MENE 1V6YA 4NHUA 4JFEE 2O61A 1FLRH 5CD5D 4Y0GA 1XH3B 4HMCA 1YEEL 4XPGL 3S36X 3NZ8A 3DSFH 1JI2A 1OD9A 4BH8B 1I1CA 2ADFL 1DVFD 5FYKE 2F5AL 1MAML 4DUWA 5FDWB 3KLDA 2NXYB 1GCYA 2PC8A 1I7UA 3LIZL 3TJHC 3N0PB 1OTSC 1CGWA 1MQKH 1MCSA 5TDNB 4K3DL 3ARRA 4ZPVB 2DM2A 4K8RH 1HHIA 5I6XC 4HJGB 3MO1A 1JGUH 4F7EA 4J8RA 3ILPB 3OKDB 4WENB 1PLGH 5D4YA 1LO0L 2Z35B 1OCQA 1XGQA 1RZIB 1N8ZB 2CO7B 2XSBA 1FLTX 2MPAH 3FHAA 3QRFM 2FX7L 4IOSD 1W8NA 1IMHC 5IFPA 5FL1A 3M17B 1MCOH 3WQ8A 1D5BA 4AENA 5FGCE 1MLBB 3HI6L 5HDQL 4GBXD 1E15A 5BXTA 1Z32X 1P4IL 5I18L 2HWZL 3OG6B 3FRPA 1JF5A 3NABL 3TFKD 1MFUA 4KROC 1C91A 1T1WB 4PJDF 1EDTA 1NLBL 4XVSL 3TO4D 2F5AH 3QG6A 3SCVA 1Q94B 3WS3B 5EORL 1NMAL 4UILL 3RZCD 4X6CA 1CD8A 3SCOA 4X9GA 1KC5H 4YHZH 3LZFH 3EJYC 3O2DA 1KGUA 4YHKL 2XNAA 4FQXD 3MV11 4I3SL 3FQTB 4H0GA 2LABA 4PV9A 3HCVB 1T21B 4PRAB 5TH2A 2VAAB 4XNUH 1QFHA 3F5JA 4MB1A 4WU5A 1PG7H 4LLUA 3MBXL 3SDCC 1LO4H 4FMFA 1TXKA 5T3ZE 5AZ2L 2PYFA 5IIEB 1Z9LA 1QHZA 2XKNA 1P2CB 3Q3GB 3N13A 3MGOB 4D6HA 2M1KA 4UV7L 4YR6A 3D2UB 4BFEA 2YD3A 1JWMB 2J47A 3LKPA 1AR1C 4EN3B 1MFCH 2Z4QB 4AMKH 1T0NB 3H7LA 3SKOB 1KXHA 2GEEA 3CMOH 5BXPA 1YUHB 1W72B 1WZMA 2WQRA 3LKRA 2NXZC 5JMRA 3MREA 3ULVE 3H3PH 5B22A 4MD4B 1D5IL 1FVEB 1XF1A 2BOBA 2V17L 3OWEA 4HAFA 5EIIB 4OGYH 5DR5L 3UR8A 4D6GA 1PPIA 2OS7A 8CGTA 4MTVA 3SOBL 3WHE1 5IVXF 4PRIA 2MQ3A 4HX1B 1YEHL 4R2GB 1BFNA 1KLFA 4JFFD 4KKBC 3MRRA 1AH1A 4BFBD 4QLRA 1LP9B 2NY4B 1LK3H 3PZ9A 1QPXA 1RUMH 5EU5B 3JUGA 1SEBA 3I50H 3CSYA 3X11A 1ORQB 2ZP0T 4IJ3C 4M7LT 2NTFB 4K94H 4MNHB 4QXUH 1F58L 5TE7H 2YA1A 1U8HA 1DWJM 1HQRA 4RE3A 5CINH 5LA1A 4NQED 2EPKX 2W38A 3CFCH 4TOYH 1FVDA 4PV9B 2ICEA 4L4TA 1UWTA 3I75B 4LFHD 5FYJU 1JGLL 2FDBP 1BWWA 2K7PA 1UC6A 4F9PC 5FOBB 5B39B 2MJWA 3EFDH 4GRLB 2J7DA 1QYGH 5A8PA 4WW2C 3FQXB 5AY7A 4HV8B 4U1NA 1WFOA 1NL0L 4R4BA 4UINH 4H8UA 2PB1A 2XKUA 3ORJA 5FO7A 4JG0H 3REWB 1F42A 3VXRA 3OKKA 4Z7VF 1E3ZA 4EZMA 1G7QA 4HUWB 4CVWA 1YEKL 4DAGL 1AC6A 4FQCL 3W0WD 3ULVC 1H0GA 1IC1A 3AS3A 1LK3L 4PJ9A 4UB0H 2W62A 2NY6C 2FD6L 1ONQA 2WVTA 5DI8A 2ARJB 3KNBB 2UZXB 3QQ9D 1HL9A 2WWKO 4O5LH 3FRUA 2FWOB 2OSWA 1BAFH 3C60A 4L8SC 4XPHL 1NCWH 5FGRA 4RAUA 1RK1A 2PTTA 5CGYC 5I1IL 2V3GA 3TBSB 3T4AA 3QHZL 5FUZH 5EBLA 3FFCE 5JHLH 2ADGB 4N9GA 4JB9H 2YBRA 4JPWL 4S1QL 5A2FA 3L3HB 1HSBB 1R3JB 3GJEA 1GOKA 5HGAB 1DWAM 2GFBB 5DHVA 1EJ6A 5EPMB 1QLRA 5ITFA 2F8OA 1BQSA 5KSAD 3VFMA 4EE9A 1BZ7B 4KDVA 3CHCA 2BMKA 1NL0H 4QOKA 5CS7A 4Y5YB 5E2WL 2AK4D 2HFEA 2EKSA 1HHGB 4ZXBD 6TAAA 2DWEA 3DWTA 4FQHA 3AHVA 3W26A 3MLSL 4WW1A 1TCMA 3TA3C 4APQA 5D6DC 5J9PB 3AUVA 1RHHA 2AXFA 1V3IA 4LVOB 1KPRB 3MRCA 3KYNA 3SIMA 3FO1B 3OKMB 4IM4A 4BK4A 1QQDA 35C8L 3RX8A 4LDOB 2ADIB 4CW1B 1S8DB 3MOBH 2C3HA 2YPLB 4UT9H 5E8EA 4PRDA 1XC6A 3LQAC 1RV6X 5T33L 1XSKA 4Y8AA 3T77B 1G6RA 3MRBB 2SEBB 4HUMB 1KSRA 4J27A 4NN6C 5SV4A 1MCWM 4S1DC 2X7LA 1Q94A 3AS2A 4J3UA 2X41A 4FXKA 2Y8VA 3IXTA 4R2GD 4XTRD 2OR7A 3HR5A 4WIWA 4WI5A 4EBQL 4TUOA 4QO1A 1U95B 3SY0B 5GGQL 2DSWA 1J1PL 4XI5C 1KXVA 1WNOA 5HYJD 3TO2B 2PCPA 1A1MA 3SDXF 5CJOL 1NOWA 3MRQB 5IWLC 1WE5A 2VERN 1NEUA 3DXAD 1T22A 2OTWA 1W3LA 1JNNL 3ZE2E 1IAKA 1Q72L 4HKXA 2HRPL 3PGDA 2ESCA 2DTML 1XRVA 4P8XA 3VUPA 4L29A 4DTGL 5LWYH 3MLSH 3HN3A 4Y4KB 3MRGB 2DLEA 3PHQA 1VPOH 3BWUC 4LHQB 3LKOB 3MXWH 4X4MA 4F7TA 3TBSA 2VDLH 1MXDA 3B5GA 2N4IA 4JQXA 4JFQB 1YY8B 1JZ8A 4GRLD 1GORA 1JNHB 5E0FA 3BRFA 3CFBB 2KL6A 1R0AL 5BCAA 4NQXA 3DMMB 1XH2A 4S1SH 1CK0H 3FT4B 1U91A 2W60A 5L8JB 4ZOEA 5DEGB 5TDOA 1P9MC 3C09C 4AJ0A 1JDDA 4Q74A 4QRRA 1MVUA 4OLWH 5HHVL 1Q6EA 1VDGA 4TULL 1KB5A 3L3JB 3AJ7A 2VL5B 3BKCH 1FSKB 2DKMA 5I1GL 5SX4H 2CBIA 4HS3A 1VRXA 2IXUA 1J1PH 5HPMB 3PZIA 3ILPA 3OKDA 4OF8A 1MWAB 2IPKB 4P4RB 4M5YL 4PJ8D 1L7TH 4Q7NA 5LYRA 3HPJA 1BGXL 3MYJA 1UM6H 4QRSA 3RWEA 4AEIH 1CFTB 1GPFA 2AAAA 4XXDB 2HJKA 4JLRA 4M1CC 4QXGH 3AS0A 2DTMH 3RQ3A 5JXED 4LX4A 4N90D 4IJ3B 5A6KA 1U8MA 2WMPA 2Y06H 3H3KA 3NCBB 3V79C 1GC1L 3PUCA 3UO1L 1EV2E 1T83A 3CIVA 1EUUA 3GXIA 1MF2H 4L9LA 3VRIA 1DE4B 3AIUA 3ZJ6A 3DARA 2QSVA 3IXTB 5DXWA 3BVNB 1MI5A 3PWPA 3WEZA 4HFWB 5B38B 1FNLA 4S0TD 4QRQA 1BFTA 2G4FA 3B9EA 4Z2KA 4G6AC 2C3VA 5J4MA 3SUSA 1MJ8H 4G8EB 1VERA 4GG6B 1QEWB 3QXTA 3TBYA 3TIEB 4K9EC 4P57A 4I18A 3P73B 4GG8B 4EI5C 2VISB 1AHWA 4HGMA 5FYKU 5TF1L 4OOZA 1FZJA 3VGAB 3WQWA 4J28A 2D3LA 1XR8A 2C26A 1MYRA 2NR6C 3EO9L 1OHQA 4MAYA 3MLYL 1ZLVH 1PKQA 4JHOA 4S3JA 2CKNA 5IR1B 1CTOA 5L2KE 1D9KA 3GSVA 1WWAX 4MDIB 2W9DH 1MHHA 3QQ3B 2YD7A 1BJ1H 1OW0A 1RU9H 5FYJL 3P0YL 4NT6B 3WFEL 1QRKA 5IGXL 4LVOC 3M17A 1LJYA 1E40A 5IFJB 1SVCP 4NNXA 5I30H 1MF2L 4KDWA 2V9QA 1KFAL 1TE1A 2KQMA 1CL7H 4JGUA 1JWSA 1WWBX 4UAOB 3LPFA 1BGAA 3IFOA 3O6FA 5HDOA 5AWNL 5E6ZA 5IT2L 2WMFA 2DBJA 5GS3A 4PJ8C 4BSJA 1ZK9A 3TV3H 3WELA 1H1NA 3HNVH 4JRXA 4Y88A 1FL3A 3BZ4A 4JZJB 4MJ5A 5EZOL 2D9QB 1V3LA 4N0FB 3HG1E 5JDJA 5SWQB 5JIWA 2O9OA 2UVFA 2I9LB 1E6RA 1WGOA 4Q9QH 2X5PA 1H15B 5MEND 2PXYB 2OMNA 5DZLA 4OZHB 3AHTA 1AY1H 4AZHA 4HD9A 4WEUD 3VXTB 3DJ9A 2AKRB 3L95A 1A21A 3HR6A 1QNQA 1S7VB 4HPOH 3VIJA 4OF3A 4F9LC 3DXAA 1QFOA 1UACH 1QEWA 2WUBL 4G8GE 3QWQB 1IC7H 4JRXE 5I1JL 1IAIL 4OGXL 4OZGA 1RJYA 5FUCE 5GIRB 1WBXB 1KXQE 4WV1C 5D1ZC 2R29L 2GY7B 1LO0H 1ZVYA 3D85A 2E6JA 3VWKD 4FXGB 3ZKSD 5JDSB 1WPCA 3SGJA 2A9ML 2CIKA 2NX5E 4MS8C 5IF0B 2DSUA 2C7UB 1M04A 2JJSA 4EUPH 3WFLA 2F8QA 4P7NA 1A4JB 4XI5D 1S9XB 3AY4C 4LCIH 3S35L 5HGGS 1K5NB 4ZEPA 2Q8XA 4C56E 2VZOA 5EA0H 2VO5A 4LASL 2Z91A 3D18B 2IBZY 3IT8D 1H0IA 3QDJB 4XP6H 5I18H 3ECBA 5KN5B 1OCWL 3TA3B 2J7LA 5I8KH 1S9WB 4OSUL 3RWIA 2GJZB 3LS4L 2W91A 3MUZ1 5C0ND 4FP8L 4XMLH 1WSST 2BNRE 3G6JA 4MSWA 2W0KA 1OWQA 4HG4K 4MAZA 2QV2A 4MNLA 1UADC 2VN4A 4HIIA 2DIJA 4NZCA 3BPNB 5KSBB 3GXDA 1YPZF 1N6QH 4PJXA 1W2PA 3K7UA 2CRIA 3MRKB 3HE7D 2DN7A 4LRIC 3WIIL 1CDCA 3DURB 4JPKL 5FYLL 3DMMA 2NTFA 4MNHA 2B39A 2VVNA 1T04B 2DIEA 3HZYA 4UOW0 4GRWB 3AU1B 2A9MH 1LGVA 2GCYB 3BAIA 1VBUA 2YBRB 4P2CG 3KPOA 4KZDH 2PF0A 2ESVD 4EOWH 2X4NA 1AVAA 5DDHB 3T65B 2LE9A 1QLRB 3WHXB 2VC2L 4JO4L 4M8QB 1G9NH 2E27L 4P3CL 4PGCA 3JTSB 3VXQB 1A22B 3ZQ9A 2F8VA 1CE6A 1HHIB 3EW3B 4Y5YA 1EOKA 3FONB 1ZBKA 4XP6L 3BMVA 4X6DB 4UUJA 3IU3B 5EOCH 4YNYA 1NPUA 3RL1A 2J12B 4BJLA 1GZPA 2VDKL 3FAXA 3K2UH 1CS6A 2BFGA 4BFIA 4NBZB