3W81A

Human alpha-l-iduronidase
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
616
structure length
616
Chain Sequence
EAPHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human alpha-L-iduronidase uses its own N-glycan as a substrate-binding and catalytic module
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-L-iduronidase
total genus 196
structure length 616
sequence length 616
chains with identical sequence B
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w81A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 3w81A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3w81A02
1VFOA 4NZUL 5ENWA 2VC2L 1RIUL 3MRNB 1XT5A 3VILA 4NHCL 2F54E 3RWIA 2BSSB 5LKNA 1WP6A 3OAUH 4Z76A 4MD5A 4G43A 2QV2A 2J8UB 1FDLL 2EXWD 2VKXA 4Q2ZB 2EPOA 3K4DA 4PMXA 1ZWIB 4JQIL 4XWOD 3U46B 5CD3A 4LHQB 1UZ1A 5DXWA 1IKNC 4LSUH 3IAPA 2HAZA 4QRPB 1CFBA 1NP2A 1HT6A 4ACZA 1WZ1L 3AY4C 3VWJD 4JY5L 1Q94A 3C2SA 2NX5E 3QEUA 4U33A 2P24B 3BJLA 5EBLA 3GIZL 5HI5D 1TQBC 3INUH 5H2BB 3AIWA 5HHOD 3BT2L 5IVNA 1H8NA 1BREA 5D2LE 2OSLB 2WWCA 5K33A 3RIFK 5ABHA 5JW5A 4LNRB 4JLRA 3QUYA 2NY5H 1JWSB 3FXYA 4FZ8L 4I3SL 2XTKA 5B8CB 4YPJA 2OJEA 4PJXF 2CR6A 3SCUA 5C6TH 1I1RA 5GGRY 2YD1A 3DARA 4OF3A 2QLVB 5D6CB 2MQ0A 5E70A 5DC4B 4KGLA 2E9JA 3NA9H 1MUJA 3PJSA 3S5LA 4NO5B 1Q94B 1QQDB 4OF8A 1WFOA 2VC9A 4L4JA 1FORL 3UTQB 3LRGA 4LPWA 2BFVL 4H88H 2OBGA 3HTLX 2V3GA 3UBXG 1CQYA 3D69B 3DIFB 2X9WA 3VIKA 4AQOA 2LQRA 4HIHB 2AKRB 2QMJA 2FECL 3KE0A 5LAXA 2A6KB 3GGWB 4F7PA 5MENB 3H3BC 4X0KB 3NGBB 2CDGB 3G6LA 3FO2B 2HT2C 5F7UA 4NCC2 1XZ0A 3LZFL 4NQCB 4WDIA 4LASH 5ID0B 1U6AL 3QIUB 4LBEB 2VLLA 1UWXK 1R3LB 2WHKA 2AJYH 3VE0A 3B8SA 1S7QA 2BVUA 5I8OH 2EEBA 3ARBD 1T6WA 5TPWL 2AI0L 2JEPA 1G84A 2BNQD 1YJDC 1W9BM 1RUML 1OAKH 5C07B 4LSPH 1NWRA 1UM5H 3BE1H 3H42L 2JB5L 2UWEF 1D5MA 1VENA 3SDAD 4OFKA 1CD9B 4S1SH 1GUVA 5D2NB 5E4EB 2WIIA 1TVBA 5CBAB 3ZDYF 3OJDA 4N0CC 1PG7X 5HY9A 1OY3B 3UTTD 1ODZA 4X9IA 3MRCA 4V1DA 1IJ9A 4C7GA 1YY8B 3GNRA 2AJ3B 1AD0B 5JOPE 3GHEL 1H5BA 4Y5VB 2YPKB 5K9OB 1AO7A 1EDQA 4LARL 1JPTL 4WSJA 5LYRA 1EXPA 3LRHA 1TITA 4JHZA 3IKCB 2IGFH 4H04A 3L3OB 2DYPA 3MV9A 5JXEA 1WQVT 3L5JA 4JG0L 5CZXD 5D7SL 4CDGC 5IG7A 2X70B 4XCNB 4MAYD 2EDDA 1VGKA 2GY5A 3MUJA 1CXFA 2VABB 5TDOB 4MA8L 3CGTA 2ICWJ 1UA6L 3V7AE 5LQBH 3VA2C 2E0PA 5IG7B 3U4BL 3DNKA 4U1SA 3VFMA 5IB4B 1DSFH 4XP9L 3RVXD 2R4SL 1YEIH 2BVPA 4HK3J 4OLWL 1NMCC 3CUPA 1IGFL 3EBAA 1YNTA 3GJFA 2UUDK 3ILQC 4MDOA 1TVHB 5SWZB 5EPMA 4ZFOA 4HKZA 4YHYB 5EB9A 1MLBA 1FGNH 4X6FB 2YZ1A 3F8UB 1R3HB 5DS8A 4FQJL 3HZKA 4WFFE 1EX0A 4GPNA 3HZKB 4KKNA 4P3WA 5F9WB 2WUCL 1JZ8A 2YL9A 4N8VA 3RVUD 3AYSA 2P1YA 2XIDA 3REWB 1YQVL 4B9YA 3MO4A 3I3EA 5DJXA 4Z5RA 3AIEA 3MC0A 2QLYA 1ADQH 4HS6B 4C4KT 1H4PA 1S3KL 3EYVA 2F5BL 1A2YB 3I02A 3PGCB 4OJYA 5BV7H 1I3GH 1W3LA 1IKFH 3PL6D 4BKLB 5C86A 4PYGA 2G41A 4F9PC 5HYSG 1QO3B 4Z7UA 4ONHA 2YMXL 5LGJA 5IB5B 5D1QD 1RK1B 4PJ9C 2GCYB 5IGXL 4M48L 1DBMH 2AEPH 3OJVC 1JFQL 3SDDC 1IC5H 4X9YA 1X44A 4BM7A 5C7XH 1BZ7A 1FNSH 3RPIA 3EYVB 4K71B 1H15A 3E8UH 3K2UH 3OPZH 4QRUA 4Y5YB 1A7OH 4XAWL 3UR8A 3U0PB 3ZYIA 1BP3B 4Y4FB 4CUCA 3MSPA 1C8PA 3VM7A 2CYGA 1MY7A 1IEAB 3MXWH 4X6BB 3FO1A 3SQOL 5A2LH 4KMQA 1RZKH 2HVJA 1F3JB 1Q0XH 8A3HA 1GZPB 1XR9B 5D7IA 5CHNA 1ZBWA 4H25A 2RCSL 1GHSA 2J62A 2GJJA 1CLOH 2EDRA 4FFYL 4OGAD 1JIBA 5I75C 3GI9L 1OGAE 2HRPL 3UDWC 4YLQT 2BVEA 3BP6B 2VLRA 4DCQB 4JRYE 1Q9KA 1IM3B 1AGEA 2IANE 5GZOC 5FKPB 2YRLA 4P0DA 1HXMA 4EUPA 3MV01 1A1OB 4H1LG 4JDVA 4OZHB 2X0HA 5KBNC 3AYRA 3JTSA 3I50L 1OB1A 4OM0L 3C5ZD 1E70M 4AZ7A 2CBIA 4Z2GA 2ZJSH 1INEH 4LVOC 1VADB 1QTYT 3FQNA 3D87B 3MGOB 4LLAA 4MNGB 2EE9A 4X0KA 4NCDA 2YHGA 1UB6B 4PJIE 5A3HA 1Q4NX 4PJXB 2J7BA 2F54D 3T0XA 1U8OA 2YA0A 3L95B 5D7IF 2UY7A 1DLHA 1KOAA 4U31A 1TPXB 5DURD 5DA4A 1I1FA 4D2NA 5EU4A 2IH1A 2OQJB 5AEAA 5TJWK 1A4JA 3MV9E 5HDOA 4NI3A 3KPMB 4PMRA 2X4PB 1K4CB 4R9HA 3IDNB 4MA1C 2DQGH 2C3GA 2DWDA 4KZEL 4DEPB 5CLWA 4AT6A 1A3RH 3SCRA 2WMJA 4J3WA 3CUHA 4D0DA 3IJYA 3LKSA 5FAAA 2C9AA 5TDOA 5ABEA 5KSBE 2J47A 4BQ6A 4PGBA 3KZSA 4P7NA 1T3FA 2F53D 3IVKB 2FECI 3C5ZC 4KKLD 2JIEA 3SHSA 3GMPB 3WDPP 5A43C 4JFED 3FW6A 3LN9A 2GQHA 4JN1H 3S96A 1AO7B 2CLVA 1CBGA 1A6ZB 4FRWA 4FA8A 2EBNA 3BN9D 1UKSA 4UT6L 5EU3A 1UEYA 1ZA3A 5DK0A 3FN0H 1GVYA 1II4E 3PABB 1QLRA 5TDNA 1KXTA 1SY6L 3S35X 2WMIA 1FZOB 3LPWA 4J12A 3CZFB 4QRTB 5FV1L 3T77A 2AEWA 2RAMA 2N4IA 2R0ZL 4G9DB 2BVQB 4XP6H 1NARA 3GSUA 5ABFA 5T3ZL 2VISA 5CEZE 3UP1A 4GAFB 3NFNB 1P4IL 1YYML 3NFNA 4LLYA 4U1HB 4JCLA 3O8XB 4PGCA 3W9DA 5IJVA 5EO0B 3AXHA 5EO0A 1SMAA 3KPRB 1G6RA 3SE4A 6TAAA 5T3XH 4QLLA 1ZMYA 4JZNA 4PRAB 5JMOC 4LSQH 5GGUB 2YLLA 3BW9A 4J6RH 4OTXL 4JJHA 5EU3B 4GG6A 3VRLF 1PGRB 5IMLB 5EFIA 3PTKA 4Z7UB 3LB6C 3TOPA 3GK8H 4WFEE 3QDGB 1JN6B 2CK2A 1AY1H 2H3NB 1CFQA 4Z0XA 2JFEX 1X3DA 1TMCB 1M71B 4NJ9L 4LXFA 1M05B 2FJFA 1J1XL 3ALFA 2E7BA 4JZJB 1MI5B 1J0YA 3DSFH 1KG0A 3O9WA 2APBA 4KHTL 4LPXA 4MXWL 3ZHLA 4ZO7A 2VZ3A 3ECBA 1E5JA 4S1RH 5K9JL 4U3AA 3L3DA 3ZE2F 4Q74A 5FYLL 3RNKB 1OW0C 2IH3B 4P2QE 4XCCH 1XIWC 4UTFA 1U8QB 4WWKD 5TQ0H 5E9DA 3C08H 3WN5B 2H45A 3MRPA 2EH7L 1UWTA 4WW2C 3HAEB 4F33A 2Q86A 5DI8A 3SCQA 1Q72H 4YDIH 3I3DA 2FX8H 3RP1A 2YD4A 3I3BA 2P8LA 3MMEA 3WHE0 1PD6A 2VLLB 4R97B 4Z7VE 5HGHA 5J9PB 2ID5A 5E6IB 4L4TE 4GG6F 3HAEH 3VXTB 1NWTA 2EIZA 3HR6A 1KCKA 1XGRB 2H2SC 2XXCB 5KZCB 3IU4H 3BE1L 4N5ED 5FO8B 1AVAA 1EERB 4XTRD 5D9SA 3SUVA 2NT1A 4G6JL 2DQCL 3LMJH 4YGAB 3G5YA 5IEHB 1NCNA 1S9XB 1XCTA 4DGYL 2X4UB 2DIJA 4X6EB 3T4YA 3JUGA 2K7PA 3GIVA 3TBTA 3ROOB 5DHYA 4WW1A 3MNVA 4DEPC 2WCSA 3IS1X 1X5GA 4WFFD 3BPLC 4ODSH 5E24E 4X83A 5DUBA 1MRCH 1G6VK 1LEKA 2FX9H 4JFPB 4V27A 1TNNA 5D2LB 3ULVE 1KIPA 5D6DC 2EICA 1U92B 1K6QL 2PXYB 3A67H 2D4FA 4QXUH 3S37H 4YEFA 3OV6A 1GOMA 4QP0A 4XRCB 1QSEA 2X9XA 2Y1VA 1MFDL 3FQTB 2CJUH 4KDTC 3AB0B 4GZEA 1RUKH 1JCKA 1VHPA 3B2VL 4GQ9H 1CE6B 3HG1E 5AWNL 1HX0A 1QBBA 2L7UA 3O4LA 2EKSB 1JHLH 4N90D 3M17B 1MHPH 2PWHA 5KS9B 5FKYA 5E1HB 1HHKA 5IVOA 3B83A 1IGMH 2P48B 3MXVL 2H2PD 4H5SA 3PZQA 5EUOE 2X4PA 4G43B 4HWBH 1JNHA 1UM6L 3OAZK 3WUWG 3QUXC 4L8SB 3C6SA 3RWFA 3MO1A 4G8GD 3WN6A 1WZLA 1T4KA 2C1OB 3S4SA 4S0TD 2YUZA 5LBSL 5DJCA 4EBQH 1XSIA 1I3GL 2UUDH 2EO9A 5KZCD 4HBCH 5JORB 1G7HB 5IB1A 3WIHL 5FKAB 1QNRA 1PY4A 2VX5A 4N8CL 5B39B 2OJEB 3WXWL 4BH8A 4M24A 1W2PA 2J7FA 2VDLH 1H49A 1JJUA 4GKSB 3AS1A 4HK0B 1U30A 4QTHA 4ZXOA 2AJSH 4LDOB 1XH3A 5I1KL 2XM1A 1ZBKA 2HFFA 2GUOA 2PNDA 4ZQKA 3ZO9A 1F97A 4FOMA 2P24A 3BWUC 4QTHB 5JW4M 1W1TA 4H1LA 2CHNA 3KPNB 2AOSA 3W0WD 3P9WB 2G8ZA 5ERWA 3MLVH 4GO6B 1GC1H 3RBGA 4GKZB 2VZSA 2X7LA 3D0LA 2X9YA 2IALB 2WIMA 3X14B 3SUTA 4XPFH 3B9KB 4EQ2A 3N85H 5KANG 1NDMB 1BGXL 3S4SG 2YRPA 2YD3A 2HLFD 3UO1H 3VWJC 4UQDA 4YXLH 1B6DA 2YXMA 3GNMH 3QIBD 1B6UA 3MROB 3U0PA 4OFIA 1XGZA 2W5FA 3CFIC 5FDWA 2GJXA 1OF2A 3G6MA 3QUMH 4UDUB 4XWOC 1OW0A 1U3ZA 1DN2A 2H1PL 2XPGA 2HWZH 3SKUD 1YDPA 1DQQB 1XD1A 5A6BD 4XP4H 5IMOB 1RJZA 3MMDA 5CHNB 4UDUA 5HHOA 1HP5A 1JAEA 1IC1A 1IL1B 3U7BA 1KJVA 2B2XL 1Q9WA 3LKRB 4OD3L 3RVTC 1EK3A 4PSPA 4ZMAT 2XG9A 3V52L 3NCYP 3QQ4A 4U6YB 5KVDL 3CUJA 3RNKA 5I1AB 4PJ8C 2ILLA 5E6IC 4WTZA 5JR1H 4C7DA 3W6MA 3QPQC 1B2YA 1UXWB 4FQXD 1IC7L 1L7IL 4W85A 5JO5B 3WNMA 1CNVA 3DVGA 5DVOA 3WFBH 3BQUC 1NEUA 3FT3A 1S7QB 3EHBD 4ATDA 3T1FA 3MCKB 3HI1A 3V6FA 3QIUA 4EJ1C 2Q6WB 2IANA 1V6YA 3UTPD 1EOKA 5DMGD 2XY2A 2AJ3A 1KJ2L 3IJSB 5E8PB 1DVFB 5ICYA 3BIKB 5H8DA 2Y5TA 3T0DA 4NC1C 2RFXB 4C56B 5DQJB 2YBTA 3CUFA 1T0PB 2AMGA 1O7VA 1FFPB 5LA2A 5I0ZA 1AFVL 5IR1A 1KJ2B 1FNFA 1J8HE 1QSFB 3LY6A 4OZGB 3GUTA 3S35H 1VCAA 5IFJA 5D5MB 3ZR6A 1TVHA 5F7HA 2ADIB 2OJZL 3WYRA 4YHOH 4UU9A 1BIIB 2CO7B 4F7EA 2QF8A 2CBJA 1X6LA 3GO1H 3FB7A 1A7RL 2Y36L 4K2UH 3QXAA 2B0SL 3B9DA 5L9DH 1D5BA 2DDQL 4XNXL 4JY4A 5TDNB 3VXMA 4BUHA 4HP5A 4GUPB 5HGDA 1RMFL 1B3WA 4NDMA 3QGVA 2X89A 4ONOA 5C0BA 4S0SD 4FQXB 3HN3A 4Y1AB 4ZFZA 4OAWB 1FO0H 4JRXD 5E94B 3NSMA 1F11B 4LVHB 1A1MB 4FQXA 1UJ3C 5A6MA 4O4YL 5C09D 2J74A 4PJ9D 1CGUA 1ZGLB 2BVPB 1KQZA 1NGPL 2D31A 4U1MA 4OFYA 3IK2A 5JXAH 1CTOA 4PRAA 4WI6A 1HHGB 2Z8SA 5FIPA 1C8XA 1R5IA 3FTGB 3U0TA 4X0VA 2CRMA 3U0TB 3E6FB 3WNOA 3WQWA 5E9AA 1CFSB 3JV6A 4QGYA 3VD5A 3CJJA 4X7CC 1MCJA 5DZOA 4Q2ZA 3GSUB 4HGMA 2O5XL 5ABFB 1KLGB 1K4DA 3E1F1 4RWHA 5T1LB 5EBWA 4XXDB 2NY4B 5C70A 5M94B 2BCKA 1WTGT 3DSNA 3GM8A 3TYGL 4MNGE 3FCTA 3GSRB 2JJSA 2DDXA 1UYWL 2D9CA 4JFHD 5E8NB 4XB7A 4Q7DA 4NHCH 4V1DD 5I1LA 2FGWL 3IGAB 1EDGA 4FABH 3SGEH 1IAKA 4DQOH 5BQ7B 1U91A 1N59A 5I18H 3PZMA 4KHXL 5AYIA 3P2TA 5ISZE 3CVIL 1QNSA 5I2UA 5D71L 3BSGA 2H8PA 1U2HA 5D96C 1LO0H 1I9IL 4BSVA 4XNZB 3T0VA 4R4NC 4XCCL 4ZNEE 3VA6A 1KLGA 4MS8D 3S36L 2J25A 5ETUB 3NA4A 2OSWA 4AIUA 4F2MA 2NY4D 1BQHA 4YDIL 5D4QA 4X5WA 3LPOA 3W6LA 2AXJA 3L3JA 2EXYD 2O26U 3ALPA 5DURB 2WVVB 5SWQA 4HUUA 3C9NB 1GC1C 1OWWA 2CUIA 3INUL 2WPGA 3VO0A 1RV6X 4V2CB 5IB2B 5DFAA 1E4MM 5FO9A 5DSCB 3KJ6H 3N50A 2YN5A 3ULVD 1Z32X 1PQZB 2ZXQA 4Z6AT 3OGSA 5D8JH 5HI3D 3VXRA 1DQQA 3NCOA 5C0AB 1KGUA 5KSAB 4LPCA 3CK0L 1YN6B 1D9KB 4HU0A 5KZ6A 1CGWA 4GRWB 1GGBL 3BQUD 3LV3A 3TBVB 2ADJA 3SGKA 3S37X 3SCOA 4GRMB 3GKWL 2AP2A 3S9DB 3H7BB 3GBLA 1KUMA 1F3DH 2XA3A 3MRJA 4CD5A 4C57C 3RAJH 2UWFA 2NX5D 4ZSOA 5EU6D 1RP9A 5JQHC 1YN7B 4U49A 3KJ4C 4JRYA 4NYLB 4ZAKB 3QHFH 4M82A 2FJGB 5FO8A 1HYSC 4W89A 2VDOL 4GLRH 3UJTL 1W8OA 4GAGL 4CD6A 1RZJC 4LGRB 1A9EA 2CRZA 4WU7A 5EC1B 3RFZC 4ETQB 2ZOLA 4DTGH 4ATWA 1MHEB 2Y9RT 5D1ZB 3P77A 5KSUA 2J88H 5ICXA 5FYLE 5F9OL 3DV6B 4WEMB 4O2CA 3RY6C 3PHQB 1YYLH 4LDEB 4BH7A 1CBVL 2EDLA 4FNLL 2VZTA 1OAXH 4HSQA 2HH0H 3MCKA 1SHMA 2JB5H 4F7EB 4MJ2A 5INDA 32C2B 1J05B 1FCCA 1YUHA 3WXVL 2IAMD 2OXHA 4P5TD 2OR8A 5BV7C 2R2CA 5EN2B 1NH6A 2X5PA 4Y5YC 2JLLA 5CJOH 5JUEH 1VFUA 3L3IA 3U1SH 4OGYH 3VXPB 1UR4A 3GMQA 1BVLA 5CJQL 3S3SA 2DSWA 2FWOA 3AFBA 2GITA 3H9SA 1W72L 3MRHA 3H9SB 3MRHB 5F88B 3KLHC 1MCOH 4WTZG 1WIUA 3SBWC 2Y72A 1BVLB 5LBSH 1YECL 4W8AA 1OTUC 2Z8VC 3LPGA 4YHNB 5HDRA 1KELH 2V7HA 3SGKC 2BNQE 4NO0A 3A6OA 4PEEA 4MA7H 3UZEA 1ORSB 3PZ9A 4JL2A 4ZFFA 4MNLA 2Z8RA 5ADOL 3MRLB 4CN6A 4PJ7B 3CZEA 4ELKA 2YPLD 1WISA 4L9DA 4LHUA 4M7KH 4MQ7B 5K93A 1E6PA 2BOCB 1J12A 1X5IA 3WNLA 1T4KB 2C1OA 5KANI 2BVQA 1FFQA 5A8PA 1C92A 3FB5A 1JHKH 2MHAB 4JM4H 4ODWA 1FZOA 4F7CA 4KKCC 4JQXA 5F9WC 2WNGA 4I0KA 5I1EL 3ARED 5I8CA 4HH9A 4CKVX 1B4JL 2XWEA 4CGTA 2WUCH 1QW8A 5EIIB 1FPTH 4HIEA 1E1EA 2P5EE 1TJGH 4AEHH 1RVFL 1F13A 5CIPH 1WO2A 1WB0A 5I74B 3WD5L 4Z95H 2J7HA 5EZIH 4AY1A 1U8NB 3G04A 5CSUA 1ADQL 3MRGA 1T7XA 3QIBB 4WV1C 4EXKA 4LCYA 3IDJA 5MEND 1GJWA 3UTZB 4YH6A 3M46A 4F7CB 2FRGP 1ODUA 5JDSA 3N9KA 1CVSC 5IESL 1I3UA 3DI2B 3MMWA 2F53A 3GHBH 2OYPA 3GH4A 4KQ4H 1NAKL 2XVNA 5A8NA 3PWLA 2CEQA 5C08B 3ZKQD 5MP6H 1I3RA 1RIHL 4Z78B 2Y6SD 3FT4A 1NBQA 2OS7A 3MLZH 1J8HD 1JGIA 3P4MA 4UIKL 5C0AA 4JO4H 1YEJL 2GAZA 2NY6C 4IMKC 4RGOH 3D9AH 4RAVB 2AK1L 1IC7H 4PTTB 4DFHA 1GOHA 3MNVB 3ARZA 1J5OL 1FA2A 2ZX6A 1MCRA 1NEZA 1SJXA 3HZYB 1HQRB 5IIEB 4DM1A 3L2MA 3T4YB 2WVVA 1NGZB 2XFXA 4KAQL 1JGDB 1YEDA 2OLHA 4QHUB 1L9NA 4IRJA 3OTTA 1O6IA 1A0QL 3MA9H 3REVA 4X4ME 2QHRL 2X70A 4XCNA 2EDQA 4ORGA 3MRBB 4AZCA 1YC7A 4YDKH 1LEGB 2PYFB 5EOQH 2A6IA 5DZNA 1DDHA 1U2YA 4OZHE 1TVDA 5EORL 3THDA 1AQKL 3BZFA 1NBYA 2NW0A 4Z18A 5FCZA 1HSBB 3HZVB 4X4YA 2ZG1A 3VMPA 5J8OA 4E0RA 3CTTA 2G75B 4I9WE 1QUNA 4WWKC 2FYYA 5LG1A 4PJXA 3KEHA 4PJXE 4KMLB 3R4DA 4GZIA 2OWCA 2R1WB 4WV1A 3OBAA 3QSKB 5DHVH 1WJ3A 1NGYA 4OM0H 2ZSVA 1OP9A 1R3IH 2IFFH 5IHLB 1MXGA 3DV4B 4M1GH 4E41D 5KEZA 2ZJSL 4IRZH 4DZBA 4XVJL 1RMFH 1CDGA 1GH7A 4KVNL 5DHVA 4U1SB 3L5IA 4IRSD 2HJLB 5IB4A 3VFMB 1FL6A 1KCVL 4V1DE 1CDHA 3MRMB 3HI5L 3WH6A 2FX7H 3QT2A 3B5GA 5ICXB 1ZGLA 2EH8H 5KG9B 1NAMA 5E8DH 2XVPA 2GITB 3OKOB 3FFDB 4HWUA 4JDTL 5GGQH 3CIQA 5F3HA 3DJ9A 4MAYA 4NGHH 2FDBP 2G9HA 5SX5H 5I1GL 5EUOA 2OTUB 5EC2A 1S7SB 4BQBA 1MCNA 2D4DA 1WZMA 2IG2L 5DJXB 3FQXB 3RX8A 4Z5RB 4L4PA 4Z0BH 3MOAL 3WDHA 3H6JA 4QHMA 3STLA 4WU5A 2EYSA 3W25A 3S4SB 1QFWL 2OM5A 2OR9L 2OWWA 3UESA 5CP7A 4MVBD 2DAVA 5I71B 3QIBC 2BZDA 1GORA 5L7XH 1OQOA 5ABDE 3P9MB 4DUXA 3JZ7A 2YR3A 3B3IB 1AHWC 3ARDD 4IOIB 3QUYB 3LEYL 3PP3K 1WFUA 4UDTB 4A2MA 4GRLD 5BXFB 3ECQA 2CKBA 4CVXB 2R0ZH 5I66A 3ULUH 3VFTB 4QHLA 1DWFM 1U2CA 4NQDB 4Z7OF 4ZS6C 4RWYL 3TN0A 3W81A 4MGXA 1WITA 2UZIL 1V02E 1VFAB 2VR5A 3UYRH 3VD7A 4W81A 5L88L 4TRPH 3VW3H 1G01A 5DYOA 3PN8A 2HFEB 1MVYA 3D69A 3I6GA 2N1KA 4PY8J 4OCWH 4G8IB 5IJVB 2Q8AL 3K3QA 3SDDD 5ELIA 4M7LT 3KLDA 3QP3A 4PRDA 1G9EA 3D39B 3QQ4B 4RISH 4U6YA 1A6VL 3BSZH 3L7FB 3P0YL 1H11A 2CLRB 5CWSA 4HXBL 5D6CA 3LKRA 4ZODA 2XVLA 1ACYL 3EFDL 3CFKB 1E73M 1H0DA 1H0DB 4I3GA 2WV3A 1H3VA 1VEMA 1I8LA 3U83A 4KHTH 4MXWH 5FO7B 3RZCA 4L8CB 1NBZB 4ZG1A 2I5YH 4HIJA 2FB4H 4JKLA 4Y4KD 3HPLB 4JFYA 3KR3H 4PJEE 2QQNH 5F7KC 4Z8FH 3OGVA 2IANB 5E00B 3G5VA 3UTQA 1U58B 4G6AC 4L9LA 1FJ1B 3L3HB 2R2EA 2CIPA 4NPYB 3G6AB 4WWKB 1UCTA 2AW2A 5T3ZE 4M9PA 1F6AB 5CBEB 1CN4A 3QI9D 1MNUL 2ZUWA 4K7PH 2NNAA 4PJFF 5HPOA 2ZE0A 4QRPE 2ADIA 2AEQL 4NZCA 2ORBH 4P4KB 4OZGA 4BSJA 5K9QG 1BYAA 4QRQA 5CMAB 1PBGA 1U8KA 3O9NA 4OQTL 2XWBB 4MQXC 4FQ2L 5AC5A 4PGDB 3MFFB 4CDHA 2DQDH 4LCCC 3QXTA 3S34L 2RFXA 2R2HA 4DGYH 4P2QD 4WY7H 3W11D 3N11A 5HYJD 3CMOH 1PKQB 1E1FA 2YD5A 3N1FC 1JGEB 4JHWH 3SUWA 5D1ZD 1ISYA 1TQBB 4L4VB 5LCVH 3RTQB 3QDAA 2PR4H 3ESVF 4JO3L 2V5DA 4KK5C 3RNQA 3FMGL 3QIWB 1HKMA 3S98A 3DUSB 5ESQB 1MCSA 4JPWH 3W28A 1GGCL 2NW3B 1LWRA 3BMVA 3DYOA 3QUXB 4L8SC 4OUUA 3WIFA 4CU8A 4B15A 4PJFA 3RWJB 1JWUB 3PTMA 1Y18A 1AQMA 5F89A 4W84A 1IC4H 3FFDA 2D03L 3Q5YA 5C0BB 3L5WB 1OPGH 1JWUA 1CICD 3CXHJ 1NBVL 1UACH 2JEQA 5MENE 1KJ3L 1JV5B 3KYNB 1BBDL 2P7TB 4H0HB 2UWEA 4JFEB 5D1QC 5A6AA 4OCSH 3LH2H 3VDCA 3MFGB 4OB5L 4U1HA 3W9DB 1V7NH 4OIFA 3LKQB 5ACMA 1LWJA 2VL5B 3TCLA 3UTTB 1MFNA 1ZTXH 4YDLC 4GXUM 1CDIA 1DE4A 1WWCA 5JIWA 3PWPB 4MD5B 3MJ9H 4A3YA 3DUUA 3RZWA 2ESVD 1IE5A 3B6SA 5SV4A 1UADC 2V5SA 6FABL 2VZ1A 3GSQA 2VZVA 1SMDA 3CUGA 2X2YA 3DUHA 4NQXB 4TNWK 4EOWH 1R85A 3RA7L 4TUJA 3M45A 2DSVA 4G7VH 4KUCD 5F44A 5JIHA 4ZFMA 3NTCL 4N1HB 4P4KD 1ORQA 1F8TL 3ULUF 1V6UA 5IDIA 5GGSA 5JPNB 1DWAM 3VXSE 1CDJA 3VXSA 3HG1D 3Q6FA 1JMXA 1KULA 5LGHL 1CT8A 3LB6D 4ONFH 5HVHC 2IADA 4NOFA 5DRZB 3VTRA 3AXLA 4P2QB 5I1DB 4KK6C 1JF5A 3OKMA 2K3TA 1IEBA 1KPVB 1N4XH 2BDNH 2H8PB 4K8RC 2PYED 5F7LB 1UD3A 2GCYA 4TNWF 4DVRH 3SCMB 4E42B 1X5YA 1EOMA 5JZ7C 2WMFA 3CCHA 3MLVL 1HKFA 2BMKA 5DGRA 3S97C 1UZ6E 4GW4B 4M7ZB 4NNYB 5FB8A 1DWIM 1NOFA 1N6QL 3I6KA 2J78A 4J3XA 4F7MA 5I1HH 2FEDC 3OGRA 4E41E 3SN6N 5FEBA 3KPPA 5LA1A 2VI0A 5FGCB 3AREB 1ETZA 4XVSL 2YIHA 3N1MC 3F62A 4GXPA 3MGTA 1J7VR 3JTSB 2X4UA 4KU1A 3HB3D 5GGVY 4XNQA 4OCXL 5GZND 2FBOJ 5DEGB 5GRJH 1L0PA 2E7HA 4ZTOL 3PBGA 4BFBD 3CMJA 1XZ0B 1D5IH 3QISA 1UGNA 5C0CE 3QDHA 3QIUD 3NZ8B 3VFOA 3TO4D 1SBBA 3GBNH 2BXYA 3BAEH 4KVCL 5DHXB 3V95A 2YKKA 4FG6C 5I19H 4MJ5B 1ONQA 5BRQA 5FM5M 2EC8A 3CXDH 1HCFX 1YNKL 4P46A 1C5BL 3PWVB 4FQCL 1JWMB 5HYJB 5DK3A 1A3QA 1FC1A 4HS8H 1SEBA 4TXEA 4JO1H 4OZGE 1BM3H 5JHDA 5D9PA 2Z1KA 4QWWC 1R8LA 2O92A 2XNAA 5DMIL 4DKFH 4S11A 1GCFA 1MXDA 1KJMB 1OOAA 5J12B 2XWBA 5DO2C 4ZXBB 2DSUA 3RTQC 1P84K 2VDNH 3FB8A 5IW6A 1C93A 5A8OA 2BSED 4YDLB 2X1QA 2SEBB 4J4PC 2Z9TA 2SEBA 4NBYB 5AG8A 3GSNH 1TLKA 4HZAA 3TWCL 4NZUH 4RMSA 3GXMA 5DJZB 5F72S 2J77A 3MOAH 5DJ0B 4M43H 3VFRA 2G2RB 4PB0H 2FCBA 2ZUNA 2W0PA 3CDGB 2NZ9C 1Q6FA 4AH2B 3O8XA 4PGCB 3O6ML 2E7CA 3WQVA 2A83B 5INCB 2FR4A 2Z91B 4BQ2A 1MOEA 1NKOA 5I75B 3ARRA 5EWIL 1NANI 3HNSL 3PWPD 4P5TA 4TUFA 4AIEA 4U5IA 1S8DB 3Q3GB 4LRNH 3KJ4B 4ZAKC 4F3FB 4Y7EA 4IIQA 4JY5H 1MJJB 3GB7A 4AENA 1MJJA 1LO4H 1FL3A 1UZ8A 4OF6A 4QRSA 3TPUA 3B3IA 2F5AH 5L88H 4UZSA 2IBZX 5C9JB 4YFLI 3JWDC 1I7RA 4OLUH 3W0WB 3CAFA 5F7WC 2E7LC 2IH3A 1IV8A 2UY4A 1HZHH 1HEZB 2HTLD 5EZLA 3M1BB 3SDAB 2GY7B 3VXUB 2IAMA 3O81A 1G7LB 5E4IA 2QADB 1JPSL 1V6XA 2Q20A 4QRPD 4RIRB 4WEBL 2WQRA 5CLTA 3WIHA 3EYQD 4WKHA 4XXCC 1TG7A 1ZS2A 1NANH 1IMHC 2YK1L 5BXSA 1U8NA 3G04B 5HVHB 1R7AA 1OGSA 2YL8A 4E5XB 4QY8B 5DFWH 1MVUB 3CHCA 3BEWB 5C09E 3VXTA 5IFHH 4G5ZH 4UQ3B 1LLOA 4QXGL 2BFVH 4H88L 2JJSC 3UTOA 5HGHB 3OXSA 1KXVC 1BG9A 2DT1A 3HRPA 1EHNA 2R0KL 3LQAH 3P73B 2OX5A 5B3NA 1EAPA 1FLTX 1S9WA 3WUFA 3W5MA 4AZ6A 2DBLL 3IJHB 4G8FA 1RU9H 3D39D 4WFHE 5D2NA 1LL6A 3MV7D 4JM2C 1KCSH 4XZUA 3O0RH 4LLDA 2J8OA 2DQJH 2O93L 4FP8H 4PYSA 1NUGA 4IOFD 5DDHA 2YA1A 4PTVA 4ELMB 4QT5B 1LE5B 4Q6IC 3DVGB 4X6CE 4B50A 5EBGA 1U41A 5IBUG 3V7AG 4JPKH 4LEOB 3T65B 4ODTH 3V5KA 4G6FD 1C16A 3NZHL 5GSVB 3TZVD 4CVZA 1YEDB 1JGDA 4QYOB 5JDJA 1AD9B 3VRJA 3PNWB 2NLJA 1E4JA 3MX0A 1J1PL 4LSPL 2WHJA 5J56B 1XGQB 2KBGA 4GMSH 1Z3GH 4I5BB 1A14H 3BQUA 4RGNB 3PHOA 4J3SA 3UC0L 3WHXA 4D72A 4WU7B 3X11A 1V3HA 1C12B 2CKRA 1NUFA 3DUSA 4Y1AD 2RJMA 5E6ID 3QAZB 2NX5A 1CFTB 4U6HB 1U8HB 4NO3B 3UPAA 4JHOA 3QXAB 2R9HC 5D1XB 4DZ8B 3VRIB 3BAKA 2JK5A 4FQLH 2NMSA 3FB7B 2F19L 4F7TA 5T33L 3TNNB 1OGTA 1U8JA 1PDKA 1QZ1A 2AXHA 2ZUTA 5GJTL 1LP9F 3BH9B 3AAZA 1YPZB 3D2UD 1OP3H 3L1OH 2P7TA 2XVGA 1CQKA 1VF8A 2J88L 2B5IB 2R39A 3C5SA 1RJLB 1OAUL 4XCEB 1UWGL 1RFDL 1XF4B 4NP4L 4IM8A 5E94A 1E4XL 1MH5A 3HCVA 3H9SD 1IAMA 2HH0L 1EGZA 5KN5B 4OB5H 3ZE0F 4CN4A 1HQ4B 3ZYJA 5DEFA 5EU7C 4NRZA 4M8QA 3VCLA 5GS0L 3CPLA 1RH9A 4HPGA 5CZKA 3MJ9L 1QBAA 5CJOL 4L5FH 2A74B 5C0BD 3NABH 2BS9A 1V6WA 3QHOA 4LPVA 4JQXC 3ZTNH 2R29H 1UA7A 1A9BB 1JDAA 4XHJC 1CPUA 5C0NC 3B9AA 3BP5A 4ONGH 3VH8B 3WKNA 2YC1A 4P2RE 2CPCA 4FQ1L 4ELKB 3TT3L 3QHZL 1FG2B 4NUJB 4QRUB 2PB1A 4OFYD 4UIMA 1IAKB 4CBPA 2W60A 2FO4B 3GB7B 3J8F7 4L29B 1XHGA 4N0RA 4H8VA 1QFUH 4PV9A 4PP1C 4RMQA 5EO9B 2CKSA 2XTJE 5LGHH 2ZX9A 5L8JB 3MPCA 1WC7B 3FB6A 5JQ6H 3U57A 2PXYD 2XWTB 1T21B 5HHQB 5K9KB 3AIVA 4AZGA 5IEKB 1IQDA 2XFYA 3GFUA 3WFDH 3L3JB 5JW3H 3BP5B 2QR0B 3BISA 1PKQE 3KL3A 2KDGA 4W93A 4POZC 1LDSA 4GAYA 1DJSA 1NC4D 1CR9L 4L4VE 5C0CD 5I1EH 5D1XD 4IDLA 4JFZH 4JZ5A 5F71A 1B4JH 1JNLH 2B1HL 4BA8A 1J0IA 2ZOKA 4LHJB 4M6NH 4MS8C 5T1MB 5FXCH 4H1LB 3MBED 5KS9E 2QADC 5I1HL 3LN5A 4UINL 5KSAA 1BQLL 5LAXB 3BDYH 4PPTA 1F4YH 4XP1L 1Z5LA 4ZS6D 2NYYC 1AKJB 1R6VA 3WEXA 5ACZB 1VFFA 3W39A 3QHTC 5HBFA 2BSRB 4KUZH 4AM0B 2FD6L 3T0ED 1U95B 4PD4K 4PTXA 4KMTH 4HTYA 2ZPKL 4ISVB 4PTUB 1PG7L 5B3JE 2WZHA 4HCRL 3QUZD 4UNUA 5BZWB 5M5DA 3SEPA 3AREA 5I24A 1A7QH 1A7PL 5ESVA 3UG4A 1BX2A 1VSCA 4CCDA 2R2HB 4NN5C 1UWIA 1T7WA 4JO4L 1ZVHA 5DQDL 2CSPA 1VPOL 3OAYH 4P3CL 4FFWC 5I5RA 2Q76A 4PJGE 1P4BH 3QQ9C 1WCGA 3QXDB 1GOQA 4C56A 2VOTA 1AGBA 5KW9L 1F6LL 2CUHA 4RQQA 1KT2A 2BJMH 2FH6A 5DUPH 3TZVB 1WBZB 1NOUA 1DBBH 4Z7NF 3POHA 3ULUC 1N7MH 4G9FE 2I25N 5I1IH 5IMKB 5ESQA 4A6YA 4MSWA 3WFEH 4YHEA 5FF6A 3IFNH 4X98B 3C8HA 4ORZC 1N6VA 4F9DA 4JDZA 2E9MA 4E41A 4HUXA 5IBTH 1E28B 4KZEH 3GXDA 2BHYA 1RZ8B 2ZSVB 1CE1L 4PJ7A 5DD6A 1H8SA 4NN6B 2MSPA 1FFNA 1FBIL 4D6CA 3B5HA 3MANA 3N06B 2HKHH 4WK9A 1HKLL 1AI1H 3RWGB 4QOKA 1MJ8L 1OL0A 4W6XB 1UWEL 3MRCB 4V1DB 1WKYA 1T2JA 4AEIL 1EEQA 1KIQB 5F88A 2V5TA 4L4TA 1VJZA 4DWSA 4RA0C 1AIFA 2QPSA 3KDMA 3QUZA 2W0FB 2OCFD 5EO1B 2NXYB 5F96L 4AZIA 3DECA 2H32A 1QFOA 3QRGH 4J8RB 2ZG3A 3IDUA 3JUZA 5T3XE 4H20L 1INDL 3R0NA 2ICWA 1E6ZA 5B21A 3HS0B 5T5FL 2QMKA 1OAZL 4J8RA 4PUBL 2X41A 3BJ91 4K3GA 1VEPA 3M8OH 1EUUA 4JZJA 5CINH 1KENL 4S1QL 3C09B 1I7TB 4TVUA 2HJFB 4JDTH 3X13B 1IARB 1JYXA 4NRYB 4WEUD 3V4UH 1NGQH 2WP3T 3N04A 5B39G 3QEQA 5KTEH 4H41A 3U7YL 3BW9B 3BZ4B 4HJ0C 5CUSL 1FH9A 4XZWA 5E0QA 4K3DL 5DI8B 2Q86B 5B39A 2VC2H 4PJDB 4JCMA 3CZ8A 1LP9B 3SGDI 3QEGL 3UMTA 2VB5A 5KAQG 3EYOA 1A9BA 4WJ5B 5GNXA 3BP4B 3C5JB 4CW1B 5JDSB 3FFCB 4U1IA 3CUIA 4GAYB 2C4FT 5F7MC 4AC1X 3B2UC 1H15B 1GOIA 4MAVA 4YFDB 1NGZA 3ZYOA 4F37K 1B2WH 5EA0L 3IJ8A 1T1YA 5C0JA 4JQIH 3WDJA 3LQAL 3HLAA 3HMXL 4MJIB 4WHYG 2JALA 4MDJA 4W87A 2FHBA 4BZ1H 5JPMA 1M53A 1WC7A 4LSUL 4ONHB 5LGJB 3KPOA 1F3RB 1B4RA 4MZ3A 1BD2B 1C5CL 2AJZB 4Y1AE 5SWSE 2UZIH 2J7GA 3O2VL 4O9HH 4OIAA 2DS4A 2FH8A 5HYFA 3A6CH 3B5TA 5GQBA 2GIYA 4JPKL 4XNQB 4Z7UF 2PWGA 4D6DA 2JB6A 1ITXA 3RY5A 4Y2DB 2DPEA 4PJEB 3SOBH 5CJ8A 3UROR 1CYGA 5E2WL 1UEMA 5D1QB 1NL0H 2PXYA 3U7AA 2ESVB 4RRPA 4UILH 1WCBB 3UC0H 1P2CB 4XCFL 1FLRH 1BSIA 1G7MB 1TCRA 3MRNA 3CFKA 2VH5H 4LCWD 3IETB 3AIBA 2QQNL 3W5NA 5E2UL 3T08A 4GRWF 1XGQA 3RZCD 1K8IA 3K8MA 1BBJB 3U4AA 2YD7A 3AMDA 1HHKB 1T1XB 1T1WA 1TZIB 1L7TL 1G0XA 5BXTA 4M61B 3WH5A 1YPZA 4N1CA 3MBEA 4NZRL 4GKNB 2XN9B 4F15B 4JFQB 4TVDA 3HKFA 4P2RD 3SUUA 3G5ZA 2XG4A 5E2TL 3WL0A 1T20B 3OKDB 3IFOB 5E8EA 4B53A 3UERA 4ODUA 5IW1A 3IDGA 1QPXA 1G7PB 5A3IC 3T77B 3RVVD 4N0YH 1MCPL 4ZPTB 4XUYA 3EOTH 4OQTH 4QTIL 4HA4A 3ISWA 5EOCJ 1G9ML 1V3MA 1MHCA 3RX7A 5DRWA 3IKKA 2JKXA 1WZKA 1FH8A 5EZOL 2C4FU 1EZVY 5EU6B 1OAQH 5IJKC 1UJTA 1M7DB 4LCCA 2I9TA 4MAUH 3HUJA 5IVZA 5I15L 3PGFH 4XPGL 4YJZL 5TDPA 3O6AA 1E4KA 2NW2B 2ZWYA 4WSKA 3OHXA 3O45A 3G08A 4RAHA 1X1NA 1WAWA 4RGND 4X6CB 2PWFA 1IGCL 1TENA 4KQ3L 1Q6CA 2Q3AA 4JPIB 4DGVH 2CK0L 1ECEA 4U0QB 4KRPB 4XVTL 5BO1L 3DBXA 3OXRA 5HDBE 5LQBL 5I66B 2JELH 2QHLA 5JQ6L 1HILB 3RCNA 5GISL 4DW2H 4XX6A 4OLWH 1KJ3H 3HI6H 1NCDH 2YPVL 3SE8L 2C3XA 2EIEA 3RJXA 1E56A 2KZWA 1PZUB 3LKOA 2A73A 3WO4C 5BJTB 1OINA 3HAEA 4JR9H 2J5LC 2QSQA 1HHJB 4JM2D 4L4OA 1ZTXL 1N26A 3FAWA 2HMIC 4KDWA 1HK6A 2W0KA 4OSUL 3MLTA 3LKQA 4LMQE 4M6NL 4R4FH 1PX8A 1J18A 3G6DL 2PCPB 1XD0A 5HI4C 3DMMB 1FCGA 3UZVB 1N5AA 1HEZA 3GH7A 2XM2A 4UINH 1XRVA 3O2WL 1BQLH 1MWAB 4D0BB 3BDYL 1HIML 4OZFA 1BGXH 1OP3K 2KH2B 2Y8VA 1LK2A 4CJ1A 3QUKA 3S88H 2EYTA 3QH3A 1YPZF 3AREC 4PP2A 2EYTB 3P11L 4YZFF 3ARFB 4AG4L 4I18A 1M01A 3MMEB 3MKKA 4IMLA 1Q6EA 4FQQB 5ALCL 4EKJA 5GGSY 1ZS8B 2D23A 1WT5C 2WVUA 2DM3A 3GJEA 4XP4L 1YMHA 4PRHD 3QO1A 1MQ8A 2M1KA 3DYPA 5CGMA 5IGXH 1VDGA 4M48H 5I17A 3SCMC 5DUMH 4YXHL 3UDWA 5TE6H 2FBJL 2Z93A 2FATH 5GNZA 1MCLA 4G6KH 5D9OA 2X1PA 3KWWB 1NCWH 3IT8D 4KI5F 5C2UB 4Y89A 3QQ3B 3AMKA 4K8RL 3U36B 1BF2A 4YHKL 1JI1A 1S9XA 4JRXB 5KOMC 1EH9A 1SJEA 4A6YB 2EJ1A 4NF7A 2X4SA 1S78D 3TNMA 5SX4I 4PG9A 2WBGA 2XPKA 2V2XA 1T2QL 3MFFA 4PMNA 5IMMB 1P9MA 5I79A 1LEKB 5DS8B 1NLBH 3QJHB 4L8BB 5CCKL 2EECA 1TJIL 3MOQA 1ZEAL 5D9MA 4G6ML 3QUXD 1T7YA 4UB0L 5KS9A 4G3YH 4ALAL 1UZ4A 2A6IB 2ZCKL 2J2ZA 1T2XA 1DQJB 1J11A 1FFOA 1PZ2A 1J1OL 4FQPA 4G6AD 4IOFC 1Y7VA 3MJGX 4ORGB 1X4ZA 3TTYA 3WD1A 2J1KA 3LVEA 3MBEB 4NWTL 2UV3A 5EOTA 1UQSB 4HCRA 4MVBC 2DMKA 2HKHL 4LCWA 1KEGL 4E8DA 1NGXB 3H9ZA 5J6HA 4UTBL 3KYOB 1F4HA 3V0WL 1KR1A 1MI5D 1CK0H 4YHOL 3HNTH 2IBBA 4XBEH 4PJ8B 4HG4J 3RWHA 1H3WM 2JIWA 1CFTA 3QNZB 4PJFE 2IFGA 4TX6A 4NCC1 2FNBA 3TO4A 3NUKA 1KF9B 1KCRH 4EIZC 1DEEA 2XKNB 3MBXL 3RKDC 2F8QA 4F79A 2DM4A 3RIKA 4TN9A 1TJHH 2GFBB 1X7QA 4JFSA 5EG6C 4XNMB 2MWCA 3L5XH 3CFJB 5T5FH 4FXKB 3KXFA 1J87A 1E4LA 3STLB 5E8EB 1GHFH 4B7LA 2NY2D 4HIIB 3EYFA 1HKKA 1XYZA 2OP4H 2WUBL 5KOVC 5H94B 1VEOA 1B0IA 4YDJB 4ERSH 3QA3A 5F7NC 3F7PC 4YNYB 2VDNL 3HFMH 4X4MA 5CAYB 1C08B 1K6AA 5AZEL 2E40A 2VIRA 3VFTA 2BFGA 2WC4A 5IB5A 3AS3A 3PP4H 1V0NA 3OLIA 5E8OA 3RILA 4GFTB 5BRZE 2CKBB 4KDVA 4OQTA 4KROB 1PAMA 4NIKB 4HUVB 5D7KD 3IAQA 2FGWH 4MNKA 4MX7A 1ZHNB 4CJ0A 1MWAL 1LD9B 1JTTA 1TR1A 3JWNC 4WKFA 1WF5A 5HPMB 4HG4K 3T0EC 4U1LB 1IEBB 1KPVA 2J6EH 4U1LA 4KRMB 4P23A 5D71H 5DFVD 1H3UA 1UG6A 3ARGC 5JUVA 3M1BA 1B3VA 1OD0A 4LCWE 1AGCB 3NPZB 4W6WB 1DQLL 3O2VH 1AXTH 5DT1H 1IGJA 3RGVD 3W2DH 1LEIA 4OV5B 4UT7H 5D7LE 3DMMC 1JNEA 1N0LA 2HVMA 2DLHA 1AE6L 2YD9A 4FFVD 4QRSB 1Y0LB 1N2RA 2C7UA 2DTSA 3NH7L 4OTXH 5JTWA 4TPRH 1KB3A 3T09A 4GKLA 3ROLB 5IWLC 3Q48A 3BESR 4JO2H 2YSSB 3NIFE 1BTCA 1KR0A 3SDAA 3BAJA 4LKXB 1NPUA 4NPYA 1GIGL 1S7UA 5F1NB 1FVEB 2AK4E 2YK1H 1S7UB 5F1NA 1ZHKB 4PD4J 4Z2LA 2OWXA 5E1AA 1FLRL 3I2CH 5CEZD 1D6EA 1QFPA 3CHDA 3IB4A 1KB9J 1V08A 4S1RL 3MBEC 2R0KH 4OI9A 3O3AA 3QHFL 4U2ZA 4S3JA 2DQUH 3LQZA 1N2RB 3MLSL 5MEQA 3MU7A 3MR9B 5FV2A 1M04A 5CMAA 2GUYA 3R1GH 5DQJA 1OM3H 4QLJA 3UJTH 4YX2H 4Z77B 3QJHA 4L8BA 5D1XC 3CHEA 5AYUH 5GS1A 4NRXA 4JANA 2ZNWA 5IW6B 4QO1A 2DD8H 1KEML 4HUXB 4H26B 1CLZH 1J0KA 3FO9A 5BVJB 1I9RL 1ZANH 4RGNE 1UVQA 2DJUA 3HE7A 2XSBA 4ODTL 3HMWL 3U36A 4LAQL 4M6OH 4PREA 2VVNA 2ZX5A 3BD4A 4XPHL 2X4QA 4FNLH 4XPTH 4UQ2B 4X8JB 3WD2A 4ZD3H 4J3VA 3BVNB 4NFDA 2NY7H 5BYWA 2DI8A 5HHMB 4YHPA 2PKDA 1OCQA 4ZS7L 2X4OB 3VXRE 1A14L 2WZEA 3SKMB 3QPQD 4RSVA 1QLRB 3TBWA 3D39E 1Z0MA 4WFHD 1OAQL 1U93B 2I60L 3L4UA 2UYLA 3CLFH 5CJBA 4HKJB 5JUEL 2PYEB 3EZJB 4P3DA 4Y4FC 3B9VA 3UAJC 4DJMA 1TFHA 4QOKB 4NKIL 4X4XB 1KXHA 3MOBL 2ZCLH 3CBWA 3GMMA 4C7FA 5IBLD 5FCUH 4R4BA 4XXDA 2R23B 5JIKA 4TTDD 1Q38A 4OLZH 3V9FA 3WY1A 1HHIB 4I4WB 3RM8A 4NFCA 4O02L 1MCOL 4JHAH 3CZKA 4LSSL 4XI5D 1OGAB 3G6JE 2B4CL 2CR3A 1BJMA 1TA3B 1U8IB 2OL3L 3FTGA 1SVCP 4MCZB 1OD7A 1WLHA 3ZTJG 2CGRL 5DRXA 3JUYA 4R2GC 2MCPH 1HP4A 4JFWA 1TPXC 2EXYC 1NJ9B 1W0YT 4HFUH 4C55A 3SY0A 2MMXA 1JBJA 4M02A 3B2VH 5ANMB 4MPKA 4OGXH 4OOUA 3REWA 4MA1B 1X7QB 2OK0L 3E0GA 5FFLA 4PBXA 1A6TA 1R5VA 3GI8H 4MXVF 4XTRC 4FZEH 3S36X 3QO0A 1UH3A 4XPAL 3VXOA 1UB5B 4DK3A 4AEEA 4PMQA 4PRHE 3WJLA 3WDIA 3BLKA 4RAUA 2CERA 1L8NA 1N5AB 3CD4A 3HNVL 1R5WB 4M5YL 5CSGA 4PMZA 1BEYH 1I3RB 3PZTA 4LSRH 4OLXL 3U48A 1W91A 1E4WH 3KL5A 12E8H 4K3JH 3RM9A 2Z1SA 2QSVA 4X7SH 4X6BA 1W9XA 1U8QA 1UM6H 1T83C 3C5ZB 1G0DA 3VXUE 3WSQH 4ONGL 2W0LA 4DGIL 2XN9E 5C3LD 2A74A 5HHQA 5K9KA 1D5ZA 5E9DE 1QP1A 4JKWA 4FFVC 3TVMB 2R0LH 4RAVA 4NKOB 3VG9B 5J1TC 3P11H 4JN2B 4AG4H 3GJEB 1GQIA 2BNJA 3AUVA 4OCRH 4HBCL 4GW4A 3AY4A 3JWDH 2ED7A 2W67A 1MELA 4NKDA 3WIHH 4S1DC 1HI6B 2CKBL 4U1GC 2EDTA 4LIQL 1WZAA 3TA3B 1FC2D 1BECA 3F58L 2IXUA 3WFCH 1I8MA 3RL1B 3D5HA 1BFTA 3VFUA 5C0BE 3FQWA 3WJJC 1SJEB 3VG0L 4KRTA 1CR9H 4I0CC 1IAIM 2BHUA 5A2IH 1E5NA 3RGVA 3OR7B 2MCG1 3WV0A 1FVEA 4LF3B 4M1DH 4OFPA 3PTQA 1ZB5A 1U3HD 3MRDB 5FYJE 4GSDL 3O6FA 5DC9B 4U5KA 3MA7A 2FGZA 3JVGC 4WV1B 3K1KC 4XPFL 4I3RL 3F7VA 3PHQA 1AO7D 3N85L 1AQDB 4MNQD 1W1PA 3AISA 3F5LA 4D71A 2Z31D 1F4YL 2C7UB 4XP1H 1H0GA 1MRFL 4OZ4B 4P23D 3C60A 1EAJA 2W59A 1T03H 5KSAD 3T3ME 1YEHL 4P99A 5E08L 1X5HA 3EFFB 3DX7A 4KUZL 5JLZB 1ZLSH 4JKPH 3ZT5A 3VIPA 3SO3C 5IQ9A 2JF7A 4FQIL 2A38A 5I6XB 1JPFA 4UTBH 3PDOA 1PY9A 1IAIL 4LLWA 3R06A 5D1XA 4MD4B 4DZ8A 3GRWH 1B31A 2R1YA 1LO5B 2B2XH 1A7PH 2J4GA 4WNQB 5JIPA 4NKMB 4HOZA 1KCRL 4AD1A 4UOW0 2BNRE 2J8UA 4HULB 1GQJA 1YMME 1T04A 1DANU 2G3NA 3F65A 4GW1A 4X6DF 1OCWH 1FZKB 5GXBB 4I77L 4MAZA 3QZWA 1PW3A 5JBFA 4D9QE 2WINB 1F45A 3HE7D 5BVPH 3EKCA 1UUQA 1M7XA 1U8MA 5I1IL 2FX7L 4F66A 1NAMH 2IPTH 4NQVA 1MFUA 1DBAL 1WWAX 3P9MA 2EPMX 3QG7H 5JBEA 3O9WD 3PWUA 5FKAA 4HW6A 4RFEB 4IMKA 1L0YA 4PMVA 3GSWB 1UM4L 3BPCB 3PQYE 2P4AB 4LHUB 4MQ7A 2AI0H 1NFKA 5J13B 1GW1A 1Q9LB 3TIEB 4TSAH 1QYGH 2EDJA 3TN0B 1M7DA 5CZVH 2I9TB 2DQEH 1MY5A 4LVNB 5BS0A 3CX5K 2PF0A 1A7RH 2Y36H 3T3MF 1DR9A 1E4NA 5C9JA 3T04D 4NQVB 4R2GB 1GAFH 1S5HB 1H3TA 1MWAH 4WUUB 1A5FH 1FL3B 2VWEC 4XNXH 1TNMA 4P5KB 1FDLH 3QDMB 5EIQA 5TF1H 4C83A 4GI9A 5IF0A 4Q22A 3W27A 2VSCA 4X7TA 3N9GH 3S3PA 3N17A 3DIFA 5D7IB 1SEQH 3WELA 1MWAA 4D0BA 5AAWA 1JGUL 4P5TB 3MLUL 1CU4H 2GJZA 3JV5A 1CD1A 5DMGC 4ESKA 4H7VA 1EJ6A 4KK9C 4LKCB 5A94A 1RHFA 43C9B 3M8OL 3S5LB 1E3XA 1W0WA 1MCWM 3SIMA 3KLSA 3KPLB 3HS0A 1LP9A 4PJDE 1KTDA 1QVBA 1H1NA 2LTQC 1BYCA 3BT2H 1AR1C 1FYTD 3VE0B 2R56H 3KPTA 1G1CA 3L2LA 3VGHA 7FABH 3UTSD 5I77A 2AV1A 2Y23A 1BFVL 5F7YC 1KXQE 4UAOC 5M03A 3C6LD 3QEGH 3QUKB 4HJJH 1R24A 2DN7A 3V6ZA 1A3LH 4DQOL 3VFWA 3FT3B 4PR5A 1FORH 4RIRA 4G7YH 3RKPA 3T65A 4KHXH 5J12C 2FB4L 3FOMB 3P0GB 5DQ9A 3RVXC 1RQ5A 4GKOA 2CBUA 2AQ3A 2CNCA 1TZGH 1AKJD 3NPSB 2YSSA 1ERNA 3EYSH 4K71C 2R1WA 1W9UA 4R96A 1MPAL 3P4OB 9CGTA 5DD5L 1MNUH 4LPYA 3BH4A 3OLGA 1SYSA 3C2AH 5D70H 4OLVL 1I7ZA 1O7SA 2XTJC 3P4MB 3CZJA 4MNJA 4E0RB 4JFFD 4XMPL 1RUPL 4DAGL 4OZIE 2DTML 3BUTA 4OD2B 1WEJH 4M7LL 1JK8B 35C8H 4GW5A 5FECA 1PPIA 1MJ7L 5J1AB 3I85A 2A1WL 4Y4KB 3HC0A 3QR3A 3TFKC 4GZJA 1UC6A 3CUPB 2OI9B 3D85A 3RWHB 3VWJB 4APQB 3EW3B 3OB0H 5ALBH 2OR7A 2UZYB 3UCRA 2W61A 3SOBL 1NUNB 1ZJAA 1D5BB 1FNSL 5E56A 1I8IB 3K2UL 3OPZL 3ZDZE 1MEXH 2DI7A 2XXMB 2V2TB 3VDAA 5CS7A 1E0WA 3WSUA 1GJIA 1WV7T 3OG2A 2KQMA 2B8OT 4XCFH 4JHWL 3SQOH 1BIHA 1RZFL 3JBG7 5BXPA 1T22A 4AW7A 1X5XA 3WF1A 1QBML 1CGSL 1NEZG 3QZWB 1AIFB 3DOSA 1ZT4B 1HL9A 2VURA 1JPTH 5BQ7A 2RCSH 2E9BA 1FE8H 4F15C 4UUJB 2V17H 4PGEB 5A2CA 1MLBB 4X6FA 5F9AC 5GRYA 4PLJC 4NZRH 3RUGF 1TIUA 2APFA 3CVHB 4YGVB 3RJDA 1JI2A 3V6BR 5IFPA 2H9GB 1C08A 5IB1B 4N0UE 2F74A 5E9DD 2DSKA 4YXKH 4YNYA 3ZJ6A 3VXQA 5CGYD 4DZBB 3C60D 1KN4H 4JAMB 3BXNA 1C5DA 1XGPB 4HKXA 1IGFH 3MV11 4JPVH 4JFOB 1HWGB 4N0YL 1MCPH 1L6XA 1JNDA 1UKPA 3TM6A 4ZDHB 2E27H 4FZEL 4R0LC 1BQSA 1KGCE 5FD0A 3Q6FB 2D2OA 2X4NA 2IQ9L 3CH1B 5DVLA 4P2OB 4WUUA 4P2OA 4LSRL 1ZVSA 4OLXH 3BYYA 1AC0A 2X4NB 6FABH 4EVNA 2DQHL 2XOTA 2VXQH 3GMLA 4X80H 5CKGA 4MDIB 5HGAA 3TVMD 4OT1H 5C9KA 2YD6A 2CIKA 1FZMA 2F5BH 3C9NA 4HUUB 5SWQB 4WLCA 3WS6C 3FFCE 2X42A 3FFCA 1KIUA 4U1IB 1QQDA 2DKSA 1EMTL 1OLLA 3RVWC 1F90L 1K2DA 2J12B 4FLSA 5EUOF 4PCTA 4MNQE 1I1YB 1UD4A 2Q7YA 4EUPH 4CADB 4U6XA 4KTEH 4MJIE 2FZ3A 5H35B 1V0MA 2VITB 2YKLL 3VFUB 4DW2L 1IM9B 5EU5A 3SDYL 1GOFA 3NIGF 5EZJB 2A3AA 2ATPB 1DBML 3SKNB 5J0BA 5CGTA 2AEPL 5HVFB 1QRND 2NCMA 3VFVA 4DVRL 5GJSH 5C8JA 2IAMC 3LCYA 3K4ZA 3FQNB 3MGOA 3MRRB 3ARDC 2PTTA 1TJGL 2ZSWB 3IXAB 1XV8A 1W9PA 3DWTA 2VRKA 1GXEA 4K8RD 3VFNA 4JY6B 5ICZB 5INDB 3KPSB 1F4XH 3QWQB 5T3ZH 3MUIA 3OA5A 2XY1A 3IU3A 1HIMH 4GBXA 1UG9A 3S88L 5I17B 3BAIA 1CGTA 2ADJB 5L6YL 4OJFL 3MLRL 1T0NB 3WHE1 3RDKA 3ZE0E 3JV0A 4WGVB 5IESH 3QFJB 5CZXC 2YJQA 4ZTOH 1R87A 1EFXB 3F5WA 4JFDA 3ZL4L 4J6RL 1MHEA 1WIPA 5D1ZA 1NAKH 3ZSTA 5FOBA 4YHML 4QRQB 4WCYH 3WIIH 2Z35A 1AY1L 3BAEL 5FYKD 4P46C 3LS5H 4NJ9H 5CIPB 2XWJB 3PQYD 4LLVB 5GRUL 3PNWA 3CFEA 4R97C 4XMLH 4X9HA 1RZ8A 2XFFA 1Y6NR 2BNRA 3FHAA 4K8RH 5EN2A 4JDZB 2X05A 4D6HA 3W24A 1JZ3A 2GJ6B 4F9PA 4N8PA 3RPMA 1C5BH 4FQCH 3HUJB 5IVZB 2H41A 2VDQL 5A1AA 3HE7B 4OZFH 1CL7H 1JD9A 1T2QH 5HDBF 5IMKA 3JSSA 5IFJB 3ARGB 4PBGA 3AIQA 1KFAH 4HX1A 3WBDA 4NNPH 4LCUB 3LPPA 2IBGA 3FKUS 15C8H 3LRSB 1GZQA 1K5NA 1BAFH 4FFZL 4WTWA 2WAGA 4PJFB 3RWJA 5HSFA 1I1AC 1YEEH 1A7NL 1HILA 5FHAL 2UY5A 3AVEA 4MJ4A 3NFSL 3QDJE 2X4OA 5C0AE 1KEGH 3FQRB 1XYFA 3GSOA 4EI6A 4ZUUA 4KKLC 4U6VH 1A21A 2X0YA 4M43L 4H8WC 2V2WB 5KAQF 3C8KA 4QLRA 5DWUL 1AC6A 1R3IL 2IFFL 3T2QA 2AABL 3GJFK 4OKDA 4M1GL 4ZUWB 1AP2B 1A5FL 1ZA6A 3O9WB 3W0WA 3SCPA 4UT6H 1KWKA 1F6FB 1AGFA 2VLKB 3V6OE 3DHPA 4ZEPA 1JF6A 1OTSD 2A6KA 2G60L 3GGWA 4U1JB 2BHZA 3MLUH 1ZVSB 3VI3F 4U1JA 1JN6A 3QDGA 4KK5D 4XT1C 4BQ3A 5IMLA 2Z4QA 3U2SB 4TVCA 4HZ7A 4Y16C 3SY0B 5F7EL 4U7MA 4ZYKA 3GKZA 5I73C 4PJ7F 1ZHBB 4I9WD 1MI5E 1PKOA 2ZUQC 2EDKA 3EYFB 5ACLA 2VXSH 4OCLC 4HA3A 3KPQB 4D8PB 2W65B 3ARPA 3KPQA 4D8PA 1MCBA 3K46A 4LSQL 1RUKL 3MV8B 1JXKA 1IAOA 1FRGH 4JGMA 1Q1JH 1JHLL 3D0VB 4YFEA 2OSYA 3DMMD 1YN6A 3FO0H 4GIAA 4UFMA 3HPJB 1V3JA 2COQA 3BKYL 3T2PA 2NTFB 1LQ0A 3O2LA 3HR5A 1QFWH 2OR9H 2EE2A 3RI5F 1A3LL 3BKJL 5DTFA 3SDCB 3O6FB 2DH2A 5D2NC 5IMMA 2MQCA 2IBZY 4PB9H 4M6MH 2NLJB 2DL9A 1KB5B 4PGJA 1YEFL 4OCYH 2I9LA 3ES6A 3QEQD 4AZCB 3NACH 4JDVB 3KAAA 3RZCC 2EH7H 2VABA 2R4RH 3REVB 3FQWB 5IEHA 3V4PH 4KI5C 4Q9BA 1EGJA 5A8QA 5DJ6B 1FGVL 1I8LC 3AI0A 4HIXL 5I1CL 4OLVH 3QWOB 5D5MA 3GIZH 1ZBVA 3VWJA 4TOYL 2AK4B 1GJUA 4Y5VA 1MREL 2EPNA 3RI5K 2DM2A 2Q8AH 5KG9A 1ISXA 4GBXC 3SKJH 5HJ3A 2C1PA 5C0RL 3GYCA 2VDML 4IHOA 4I3SH 2X4RA 3CLEH 3L6FA 3T4AB 2FIKA 3BSZL 1AQDA 1RZIB 3HC4L 1RIVH 3WFHB 1ZLWK 2VDRH 5TQ2L 5IM7B 1KIRA 3WUWB 4NO0D 4C4KO 2P5EB 3X3FL 3C09C 1XR8A 1INQB 4S2SB 2YEZA 4Q9QL 3SE3A 3O4OB 4HKBA 4G80A 4FTVB 4LKXA 1CE6A 2GJ6A 1UD8A 1I1AB 2OMNA 1A6UL 4P46B 1UR2A 1QBMH 3V0AC 3HRZB 1UVQB 4JM2B 3SE9H 3OKLA 5D7LD 4KC3B 1CI5A 4KI5D 5IB3A 3MCLH 2H9GA 3WQ4A 1I9JL 2HT4D 3TO4B 3UX9B 4ZAKD 5BXFA 4K7PY 4W8LA 3S37L 5CG0A 1UH4A 2HWZL 3CX2A 1HH6A 3DVFA 3JXAA 2HISA 1T89A 3TIEA 1DWHM 5I8OL 5A16B 3IJYB 1FG2A 3LKSB 3EZ8A 4HMDA 2ZUMA 1OTTC 3V52H 1RUMH 1UWXH 1LG1A 2E27L 5E4EC 4PJ9B 4M80A 4LLYB 4MJID 5A6BA 5JW4R 1HNGA 3EYUL 1NMAL 3FZUC 4BK5A 3QXWA 4H8WH 2IALA 3FB6B 4WY7L 3D2UA 5HYIA 1PEWA 5AG9A 3X12A 2AJXL 4Y5VC 4PBVC 1PYWB 1JF1A 3GDBA 3IF1B 5DD0L 2UY2A 1VA9A 4G8GB 3MOBH 5BRZB 2QQQA 5FCUL 2PW2B 2VCBA 4OT1L 2UY6A 4HOXA 1QR1B 4HK0A 3KGRA 2R8SH 3MLWH 1OM0A 2M2DA 4HPYL 2VXTL 1B0RA 4FQXC 1CGYA 4GLRI 4QAWA 3PF2A 25C8L 3O3UN 2P42B 2A0LC 3TV3L 3DXAB 4EDWL 2OJZH 1DSFL 1QLFB 1UJ3B 3G5XB 2YUWA 3G6AA 3VXUA 5HGAB 3L3DB 3BGMB 3UXFA 2BERA 5MERA 2Q8BH 5EZLB 1MHHA 4KV5F 3MS8A 4MQXD 4XWGL 2IPKB 3PG2A 1NC2B 4ZO8A 3WIJA 1N5YH 4OCSL 2ZUQB 3GI8L 4NQCE 1JPGB 3EMQA 5T1LD 1V7NL 1NBZA 3OKYA 1GZJA 5FO7A 3RZCB 4L8CA 4J3UA 3MYZA 4YPGB 1HVXA 2Y24A 2XPGB 5FYKE 1AQ0A 1BEYL 2F54A 5DMKA 1UB5A 2XZCH 1E4WL 1P7KB 3VDHA 4UQ3A 4X6DB 4NKDB 4PTWA 5C08A 1F4XL 2CHOA 3MLTB 3QPXH 3IAGC 3BGMA 3EJYD 4PRPA 3U7WL 2XG5A 3BMWA 3DMMA 4N0UB 1ND0B 5DFVC 2I07B 4G8EA 1P4LB 4AEFA 4D0DB 2YZ8A 1XCTB 1OSZA 4HUKB 3RUGB 5FYKL 1OSZB 1LE5A 3VFWB 3RJYA 1P5UA 3E3QE 2EIBA 2HP4A 1ND0A 3IDYC 3X11B 2DLFL 4PTUA 1U3HB 2H1PH 5B22A 4WO4D 1CIDA 3CFDB 4I48A 2E9IA 4M6AA 2DL2A 3SJVE 4WCYL 2QJDA 2VZOA 3ZJ8A 4LIQH 1A4JB 4O5LH 2ZUXA 5GS1B 4NQTA 2RBLA 1OAYH 3HC0B 4OUOA 5EIVA 3RPKA 5K9OA 2A9MH 4CN1A 3F58H 1UYWH 3VRJB 3P73A 3QDJD 5GRUH 3L6FB 3KPRE 1W2VA 3BPOC 2Y5TB 2F61A 4LMQI 2ZCHH 3VXUD 3CMGA 3BGAA 1RHHA 2BVOB 3WLWC 4JB9H 2YBRB 1EHLL 2BJML 2AS5M 4NM8H 3GIVB 1J8HB 1QSFE 1I9IH 1AXSA 2PW1B 1Q6GA 3QUYC 3EDDA 3UJIL 2YL6A 3D85B 3WFEL 3S36H 4APQA 1I1AA 1CXLA 3KYAA 4UNIA 4NNPL 1PSKL 4MNQB 2WMGA 5C0ND 2DIBA 1DL7L 2AXFB 3QCVL 1MIML 1UCBL 1R3KA 1T1XA 3T4AA 2WWMC 3GSXA 2C4XA 3G9AB 3WUZA 5D8WA 5E08H 1BOGB 4FFYH 1FFRA 3ARDA 3HU7A 1Q0YH 2C7FA 2PYEE 1R7OA 5ANMA 1ZLVK 5GGRB 3WEMA 3GSVA 3AZTA 3GRWL 3ZYZA 2JJTC 1YA5A 5DJAA 1D5XA 3ARGD 4OUUB 4Q0XL 4NRYA 5IFAH 2V9RA 4HIIA 1DE4B 5I19L 3W37A 2HRLA 5HD8C 1TA3A 2AABH 3NCBB 3ARYA 3SGEI 3BAXA 3FQRA 43CAA 3RAJL 3C5ZA 1P7QB 2P8MA 3IRZA 4EN3B 2G60H 2WBJA 5ANME 3MSDA 2P8PA 3H9HB 3IDMB 4BSVB 3PQYB 3WF0A 4ZYKB 3S3JA 1LQSR 4PJEF 3O8XC 1M05A 5GS0D 5DR5H 1OGAD 4PJAB 3FT2B 3WNNA 1KENH 1NC2D 4UFHA 4RBPK 4FMVA 2VLRD 1H3PL 1U91B 1E4XI 5IB2A 3X13A 1MH5B 4X5XA 4LSVH 1V05A 4AK1A 1IAOB 4LLMA 4NWUH 3A0OA 1FVDA 1A6AB 3HLAB 4G8IA 3D0VA 4JM2F 4I0PB 1F58H 4RZCA 4PJ8D 3OKMB 2V5MA 3ZLQC 4QGTA 4PRIE 1J01A 4U3CA 3G5YB 3EO0A 4Y4KC 1FIGH 3V5HA 5AYBA 1EBPA 1CZ1A 5D4YA 5EUKA 3WCYA 4C58B 3BKYH 5BS0D 1N6UA 4D9QD 3V5HB 4W4OC 1A02N 5EBMB 2VMFA 5IV2B 1LD9A 3RL2B 4YHIB 5DGQA 4X7FC 4PJCE 1JYWA 1HJSA 3L4TA 1JGLH 1T5XB 4RE4A 1T5XA 4MJIA 1Y0LA 1NCCH 5EWIH 3Q1SL 3T2OA 4ETQA 4HWBA 4KJYA 4X99A 1QBLH 1DQMH 3NACL 4W86A 4LGPB 4MB4A 2VXUH 2BOBB 4LF3A 4MA7L 5HYJA 4LEXL 2CIIB 1CWVA 5T3XL 2D1ZA 3RUGA 4TOYH 3HZMA 5I74C 1NMBL 2PXYC 4JFEE 1QW9A 3WNKA 2HFTA 2QSCH 3I9GL 1K9EA 4KXZH 1BFVH 3KS0H 3KPPB 3JTTB 1T1ZA 1NWUA 2OYMA 3GK8L 1H5BB 1P7KA 3CSPA 4HPOH 4KJPD 4NRXB 3C6LA 5EOCL 2XZQL 3MREB 4R6UA 5FYKU 1P69B 1LHZA 5D93C 3PWPE 3VIGA 3U5YA 4OIIL 1S9KC 4Q6IA 3VNZA 1CLYL 4Q9QH 3NSNA 4AEHL 2A6DB 1EFXA 4QXGH 1QRNA 1V8HA 4RMUA 4JRXA 1QNOA 4YQXH 3GMPA 1EQPA 2GK2A 3WN5C 7CGTA 5K9JH 2R1YB 3O6KH 4U3HA 1N64H 4CD4A 1G7JB 2BNUA 2XA8H 1U9KA 2DBLH 3DURB 2DRUA 4YR6A 3EYSL 4XPBL 1CLVA 3LAFA 3UTSE 2R2BA 2Q1EA 3MRLA 2BNRB 2DIAA 4K07A 3I6LD 1X9QA 3S5LG 4XI5C 1GPOL 1QG3A 2DYPB 3QHNA 2D7TH 1ZA3B 5E2TH 2D7QA 1FZJB 2ARJB 4V2BA 3DGCR 4NZDA 4P4RA 4F58H 2BVOA 4GQRA 1LDPL 5EDXA 2HJKB 3WENA 1YYLL 1CBVH 1F4AA 3GMQB 4EN3C 1SJVA 5GPRA 4ZO9A 1J1PH 5IJKA 4F37F 3EYUH 1ZA6B 3WIFB 3K74B 3K81A 3QBTB 1MEXL 3V8CA 4UV4H 1SBSH 4WTXA 3OG4B 4X98A 3BVNA 1MQRA 2Q3ZA 4YZFE 4QRRD 4PJ5B 5EFFA 1NDMA 4E41B 2CMRL 3MLXL 2B1AL 5TH2B 2VZUA 3RWDB 1XGTA 1LF1A 3NOIA 5FGCE 2VCAA 4ZUUB 4XPGH 4EI6B 4DUWA 3UTZA 5BJTA 5E5MA 4AISA 4PJBE 1G9HA 1UR9A 4AD4A 1MRCL 2K1MA 3QIBA 3X3GL 2E4TA 4JFDD 4AL8H 1E72M 3E6HB 1Z9LA 5GJTH 4F9JA 1FNEA 5I2IB 3QEQB 4UQEA 1ZT1B 1FNHA 1I1AD 1RURL 2DLTA 2V9TA 4JHBA 2WZPD 3KLAA 1EEUA 3TJEL 4HJGB 1C7TA 2XGBA 3THMH 4K3EH 1B0GA 1QA9A 1WBYA 1U8PA 2E9LA 4OGAC 1PG7W 2ED8A 4UNVA 1E4XH 5TGBB 4KKCD 1NQ6A 3TVMA 3SO5A 1F3JA 1UZ6F 1UWRA 5DJ2B 1F4WH 3MRGB 1A4KA 4MNHB 1TDQA 5TF0A 3SJVD 5L2JB 4Q9CA 2GT9A 2VN7A 1EFQA 5CEYB 1JG9A 5FL1A 4LGXA 5A2FA 5E0FA 3IFPA 5DRNA 1FPTL 3VXOB 2PBOA 3PDDA 3TONA 2I24N 1Q9WB 3KPRD 3NABL 1QFWM 4RAUB 3M6DA 5HHME 1GCYA 3PZUA 3N0PB 5C08E 3ZKMD 3RL1A 1T0MB 3OB8A 3QPXL 2GAZB 4Z95L 5EZIL 3DLQR 3O2DA 3TT3H 2ICCA 4Q9RL 1JRHH 3BZFB 4OI7A 1QSFD 1HYSD 5LVEA 1B88A 3SGDH 5BRPA 1BLNB 4NGHL 3RKDD 4B3LA 3POCA 4JAWA 4RFNB 2X1WL 3M07A 5GSVA 4PRHA 4IRJB 1EGJL 5FUOH 3T1WA 5MP6L 1RIUH 4NZJA 5FHBH 2XFXB 1RIHH 2I9LB 3ES6B 3WFHA 3P0VH 4HUWA 4D1IA 2FBJH 3BGFC 4K23L 4P9MH 1EIBA 4XZUB 3OAUL 2CLZB 2CD0A 3BEVB 5L7XL 5F97E 5CEZH 4G8GE 3VXNB 4Y2OA 2PO6B 3JWOC 3GNPA 5C8BB 4MZ2A 3SDAC 1ISVA 4LSDA 1NKRA 1C16B 4JQVA 4XHJD 4KAQH 3GMNA 4U2YA 1S5IH 3W4RA 4ZPTA 4TNVK 3MA9L 2CRYA 4RWYH 4M29A 4YUEL 3CPLB 1PSKH 1I8IA 3UO1L 1UT9A 4YDKL 3V5DA 1MIMH 1FNLA 1UCBH 5EOQL 1E0XA 3TNNA 4PRWA 5C2BL 3KNBB 4GO8A 4NHUB 3TTQA 1J1OH 2GSGB 2NXZC 3RJQB 2HN7B 3LQAC 2XGIA 1E6QM 5JZ7D 2XN9A 1CFNB 2YS4A 4GKNA 2J6EA 4TUOA 4G80B 5A16A 2G3JA 4K7PX 1QRNE 4FXKA 5KSUB 1INQA 4LP4A 3RWFB 4NSBA 2Y7QB 4L8SA 3V0WH 1EXUA 1ZT4A 3BD5A 3WIIL 2HVKA 3WLWD 2RGSA 1XCQB 4OD3H 1XCQA 1UWSA 1M6OB 2BY3A 3NA9L 4K7FA 1B30A 2O5ZH 4MMXC 1ZSDB 1VPOH 3ZDYE 1MHCB 3MBXH 5I9QC 2D7NA 3DX9A 4BH8B 1P53A 5GGTH 1OSEA 3O11A 2DB8A 5IK3B 1P7QD 5KW9H 3SKMA 3TA9A 4BYHA 3NMEA 4PRPE 2PN5A 3D2UB 3FNDA 3SCWA 1CL7L 5HHPA 2A0LD 4P7RA 1HJQA 1BHGA 3L5XL 5SWSA 3ZT6A 4YHYC 4P7QA 5FYJH 4TTUA 3KXFB 2XQBL 4LCCB 3EOYG 3GSOB 4RDQG 2VISB 1CG9A 3IFNL 3PGDA 5SWZD 3TBYB 4CNIB 4FG6D 5JW4N 4ELME 2EPKX 1UZ8B 3TPUB 15C8L 3GXIA 1DUZB 2BSSA 1BAFL 1U6AH 4JLRB 1H2JA 3AXIA 4IOIA 5K9QI 8FABA 1JYNA 1G9NC 4L29A 3LHPL 2AEQH 3PQYA 3QDMA 1DUZA 3GSNB 3TPKA 4K3HA 3L5HA 5D7JC 1X5FA 1Z9MA 3AJ7A 1Y6MR 4KPHL 2X8RA 3IFLL 3RHWK 4RMRA 1OAKL 1FIGL 2ITCB 3D39A 3DROA 1AGCA 4ZXLA 5BS0B 3KPLA 5HVGB 3UCQA 2WYSA 4KJWD 5I6SA 5KVEL 4FMFA 4QRPA 2AEIT 43C9A 3OZOA 1VGEH 1TQCC 5L9DL 1SYTA 4RMTA 4RGMC 5F96H 1KN2H 5IT2H 3BXWA 2J75A 4DVBB 4NO5A 4LHUG 3OJ2C 1S7VA 3PL6B 3RDTA 4JO3H 3HUJF 2AXGB 4C83B 3QO1B 4P9HL 5FGBC 1TTUA 4Y88A 3GSNA 2EIZB 3LV3B 1OAZH 1HVQA 4X7TB 3BKCL 1PEZA 2AKRA 4ZUVB 4NKQB 4PRBA 3P77B 1F3DJ 5A95A 2W92A 1C8YA 2YDQA 5EU7E 3L95A 5FK9B 3MMUA 4F33B 4UTAH 5IWLA 1DWJM 3NZ8A 5KTEL 1AE6H 3EOBB 4OCWL 4AZ8A 2GT9B 1KCLA 4LYPA 4V28A 3NH7H 5CUSH 1FRGL 1DWGM 2XWJA 1SVZA 4RX4D 1Q1JL 1YMHB 3P0YH 4HPOL 1BJ8A 3SGJC 3A3HA 5GNYA 1VGKB 3BPNB 4RFNC 2XVKA 1I8MB 4PYHA 3AROA 1GIGH 4RNRA 5FOBB 3HMXA 1CF8L 1CDCA 1WBZA 2G5BB 5E95B 1XC6A 2V5RA 4ODBD 4CMHC 4P2RB 1B2WL 2WVSA 2NYYD 4EOWL 1V3LA 4IRSC 4MNQA 4X7EC 1BX2B 1S3KH 2OTWB 4JY4B 3VXMB 2BV9A 1KJMA 5EMYA 4Z2JA 3NTCH 4KTDL 2R4RL 3D3AA 4YX2L 3L4WA 2XIBA 4D6IA 2FHCA 2CPUA 4ODVH 2CO6B 1NWSA 4GMTL 1FFNB 4KTYA 4PLKD 4HPHA 3NAAH 3W26A 2D7TL 4PLJD 2YBRA 3PP3H 5E99H 3DV4A 1FHLA 1NP0A 2OL3B 4JFDE 1MREH 1QSFA 3L9RB 1FYTB 3SKJL 4Y19E 2NY3D 5C0RH 4FTVE 3HE6C 3C60C 2W9LA 1JPFB 3VGAB 1S7WB 3CLEL 3C6SB 1CXHA 2V2XB 4W8BA 4YBHA 2DGAA 1RIVL 4PJCB 3KDMB 2NY7L 1E4IA 5JA9A 1FVCA 5CEXB 2PTVA 4ZS7H 2XKUA 4S1SL 3VGFA 5J3HD 4YWGH 4GG6B 1QO3A 1VERA 4A4AA 1YY9C 3NIDF 1VFBA 5HYQA 4IUGA 2XKNA 2QEJA 3DC0A 1KNOB 1QI0A 3B6SB 3K8LA 3A6BH 3C87A 3IDJB 2DT0A 1VESA 3PGCA 3ME0A 4FTVA 1C5DB 1Q9OA 2F8XC 1XGPA 1LMKA 2J4WH 4TSBL 3TCLB 3UTTA 2Y06H 4DN4H 4NSKB 3KYOA 2IGFL 2Z92B 4GAGH 3FQXA 1CLOL 1ORQB 2AGJL 1GHRA 5GRJL 1IC4L 1JFXA 1X5LA 1KTLB 4KZDH 4Y4HB 5LXGL 1OPGL 1T80A 2RHEA 2R0WL 1HXJA 1DEDA 4NQXA 2C8NA 4HFUL 5FUCE 1BAGA 1YEIL 5ITFB 2FEDD 5F93C 5B3JF 4M93B 3MACH 3AM8C 4NKOA 3DRQB 4NO2B 3TGXA 4PJGB 1ESWA 3E6HA 1KLUA 4NRSA 4HKXB 4TVPH 4XP5H 4HWZA 5C3TA 4NN5B 1T5WB 1NMAH 4ACZB 1KYOJ 4Z7VA 4L3AA 5D7JA 3BH8A 3SDCD 4U6XB 3NGBC 3FQUB 4QHUA 3RPIB 1N0XH 3BWAA 5AZ2H 3W29A 1SM3H 3QDMD 3U1SL 4HHAA 2VE6A 3WL9B 2VRQA 5CJQH 1RK1A 1LK3H 3TH4T 1IQDB 3WBAA 4NZTL 1G7MA 1TCRB 3GNOA 3N18A 5E6IA 5BV7L 1PLGL 1MAML 1XGUA 3OMZA 3EIFA 4URIA 25C8H 3BRGC 2ARWA 2HKFL 2VDPL 4JVUA 5HJ3B 3VM5A 2EEAA 5EBMA 5F1IB 1BLIA 5C1MB 4P8WA 4Y4HD 3TWCH 3LD8C 4JKMA 5HHNB 5FHBL 1P6AB 4KKAD 2YPVH 1M4KA 3SE8H 1LEGA 2PYFA 2BDNL 3PL6A 4TX8A 1HXYA 3K0WA 2VE6B 5IVXE 3NCYS 1JFQH 4WENB 1MCFA 4EIGB 3IU3B 1XGYH 1HXMB 4JR9L 3MRQB 3ROLA 3UJJL 2BRQA 2OXGA 5LGKA 1QEWB 2ADGA 1UKTA 4J1UA 4PJBA 3FO9B 2PTTB 4JE4B 4WO4A 2X4RB 3RUGE 1A22B 4OSUH 2C1PB 3SGJA 2G5BA 5C0CB 4WUKL 1KYOK 3WMSA 1VKXB 2VLJB 2XSAA 1BVZA 1KPUB 4NQEA 3HB3C 4PRPD 5IHRA 3MREA 1CGVA 3G5ZB 2YPLE 3MUHL 3VGBA 1KBGL 4UBDC 4X4ZA 5F9DC 4O2FB 3ILQD 4ODUB 1XF3A 4OV6F 2AAVA 1ZU8A 4QCIA 1HZHL 4L4VA 3OZ9L 1ZHKA 5HHVH 2ZKHH 1XF3B 4WW2A 3V2AR 1UR1A 2WC7A 3AC0A 1NC4B 4WI2A 4I2XA 1LE9B 1T1WB 1TZIA 4M8QB 3KPSD 3VCLB 3VFPA 3U4EB 1ES0A 2FATL 1GZQB 1K5NB 4UIKH 5DK0B 5HDLA 2Y2WA 4WI3A 2LAAA 3QUZB 1PVHA 4RGOL 4Z7VF 3CXDL 4G5ZL 2AK1H 1AR1D 4Z77A 4K94L 4CMMA 2GKIA 3S96B 1BOGA 2WHMA 2FEEI 1Z2KA 4GRLA 1FO0B 4NM8L 4P4RB 4ZFZB 1JMZA 2HVKB 1FQ9C 4HLZG 4QFUA 3LOWA 2XQBH 1U42A 3CPUA 3EJJX 3FN3A 4JZOB 2ED9A 1KCSL 2MHAA 2DWEA 1BZQK 3QIWD 3JWOL 2DM7A 5GRZA 3QCVH 1D5XB 1OHQA 2V2WA 4MCZA 3ZKXB 3BO8B 3SDDA 3BO8A 3SDDB 2WCGA 2UZXB 4P9HC 4B3KA 1R5IB 2PTUA 3LHPH 1A3RL 4WW2F 5IEKA 3CC5B 4QCEA 3QI9A 2DBJA 4ODHH 3VWKA 3ARDB 2ESCA 5C6WH 4NJAH 2VLKA 1CZ8L 4IIQB 4WHCA 4UQ9A 4AENB 2F58L 4HKJA 4GMSL 4HEME 1ODAA 2Z0BA 4Q0XH 1Z3GL 4OF0A 5IFAL 5BMFL 1FSKB 1V02A 3QG6B