4UOQA

Nucleophile mutant (e324a) of beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
689
structure length
683
Chain Sequence
HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMAQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
molecule tags Hydrolase
molecule keywords BETA-GALACTOSIDASE
total genus 241
structure length 683
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uoqA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uoqA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uoqA02
2F1AA 3B9AA 2W5FA 4OOUA 4LX4A 2JFEX 3NSXA 2Z1SA 1JXJA 1OT1A 3AHXA 2XN0A 3VU2A 4U5IA 2YA2A 4Y1RB 3W0KA 3ZR5A 4QFUA 1ZB5A 3JUGA 2GDUA 1HJUA 2XFRA 3AIBA 3W4RA 1ODZA 3OGRA 3WN6A 1ITXA 1HP4A 3A47A 5I6SA 2CPUA 2WVVA 1HL9A 2D2OA 1KR1A 3WDQA 1W9UA 3TA9A 2GVYA 4E4PA 1KBBA 1RP9A 4DO5A 3ALGA 4AC1X 3L4TA 4RE2A 3ARPA 4J3SA 2WBKA 1A9XB 3SIMA 1XSJA 1OT2A 3L4XA 3WY4A 4ATDA 3TQIA 1TVPA 4OBSA 5FL0A 3EDFA 2J7BA 1EDQA 3U57A 3PZTA 3VO0A 1UKPA 4L8YA 4PTWA 1IZKA 1J0KA 4NZFA 1BVNP 3AS2A 3GBDA 4UQDA 1GW1A 1DWJM 1W3KA 5BXRA 4P8WA 3N13A 3CIVA 1PPIA 4M29A 2WLYA 1G2IA 1UCFA 3TTXA 1C3FA 1CXFA 3ARVA 4MAVA 2XJ7A 2JEQA 5ABFA 1AQ0A 3VIOA 4W85A 1E71M 2PC8A 2OYMA 5GNYA 2V3DA 1B3ZA 4OKDA 2BXYA 2GSJA 2XPKA 2ZX6A 4B9YA 5LA0A 1JZ2A 3EMQA 1E6ZA 2F7RA 1GNXA 4JZ5A 4CU8A 4L78A 5BV2P 3WDHA 2UY3A 1ZBWA 3PQ7A 4H8UA 3B36A 1V3LA 2AMGA 3PHAA 3HJEA 4MDPA 1E73M 1KEEB 1MWOA 3WY3A 2V3FA 2VVNA 5BXSA 3PZIA 2WSKA 4OQ4A 1WZAA 5F7UA 5GNZA 3WSUA 3OZOA 1FYEA 3PQ4A 1GGJA 1L0PA 4Z2HA 1CEOA 1NWUA 4FLRA 4AZ6A 3W82A 1LLOA 2GDVA 1CF9A 4UOZA 4PCTA 1BSIA 2E9LA 3IGUA 3AYRA 1UA7A 3D52A 3BVVA 1G9HA 1SYTA 2J8FA 1B0IA 1KCKA 3MANA 4H41A 3L3BA 1EQCA 2EADA 2LXNA 5A8QA 3T2OA 2X2JA 4ACZA 2VRQA 5D9MA 4S0ZA 5I3DA 4WKHA 1T3TA 5KEZA 3WBEA 3OB8A 2J7GA 2JF7A 8A3HA 3VMPA 2PWFA 3PQ6A 3WNNA 1CDGA 2DDXA 1B9ZA 4ENWA 4J3VA 3ARYA 1QI2A 3EWNA 2VRNA 4GIAA 4CU7A 4EE9A 2D3NA 1K6AA 1NQ6A 1DHKA 1LWJA 1MQPA 1JZ4A 1E0VA 5FD0A 3QHMA 1TQWA 2D22A 1UWRA 4AW7A 1XD0A 3PZQA 3WQ5A 2F61A 2G8ZA 3IAQA 1T0BA 5E70A 2V3GA 1TCMA 1NH6A 4DWSD 1QI4A 3GTNA 1O6IA 3LXBA 2GK1A 4PMRA 3N12A 3QHNA 3WEZA 2J47A 2O9OA 3CZJA 1E56A 1ZBKA 2WKLA 2VO5A 2ABWA 1GOKA 3BCFA 2X8RA 3KL3A 3BAXA 5KZ6A 4D6GA 3HG3A 3OLDA 1H5VA 2VX7A 4C7GA 3HMCA 5A6AA 2XVPA 3OA5A 4AD2A 5C8BB 2WWCA 1JL8A 1NARA 1UD3A 4CD7A 3AHTA 1UH4A 2BY0A 2XVGA 3BC9A 1PBGA 2J75A 1V6WA 1WE5A 3SCPA 3VIFA 2FHCA 2X0YA 3AJ7A 1B2YA 3AS0A 3WH7A 3BMWA 2YBUA 5I23A 4PRWA 3L4UA 3VILA 4Z2LA 3BLPX 2VX6A 1O1YA 3HN3A 4XV0A 3D51A 3ZT5A 3BSGA 3UR7A 3ZSTA 2YDQA 1V02E 1XYZA 2DEPA 1BVZA 5EFFA 2TAAA 8CGTA 3PTQA 1ZU8A 3B9DA 4ZFMA 3VIJA 2W4XA 3AROA 4Z2JA 2F7QA 2J8GA 4U5KA 1EXPA 4GZJA 4HU8A 1QNOA 5CPTA 3CGTA 1KXJA 1GVYA 1XH0A 1TE1A 3AXIA 3DYMA 1JYNA 4D1YA 1TMQA 3WD1A 3BAWA 2BVTA 1HWWA 3SCRA 3WF2A 3NSMA 2YKKA 5A3HA 1FH9A 4PMOA 3FSEA 5CLWA 4PMVA 4NSBA 3CUFA 4UOQA 3VX1A 3MMUA 4WF7A 1FH7A 1QI0A 1M01A 1P5FA 1CXEA 5HPCA 1W3HA 1T0OA 5JBDA 1B3XA 1H0IA 1UOKA 3CMJA 4WIWA 4I2NA 4D72A 1PS3A 3N11A 4NZCA 2CKSA 1ZS2A 1CXIA 2XG9A 2OYKA 3EN0A 1U30A 1NP2A 4TX8A 1V3JA 4TVDA 1OGBA 2J7EA 3CZAA 1CWYA 4Y1RA 2EAEA 2XSAA 4FNRA 4MJ2A 4P7LA 2BHZA 2BV9A 1X6LA 1VAHA 1CGXA 1SR0A 4ENUA 2OYLA 3CV5A 3PZOA 1T36B 3O6AA 3EDKA 1JYWA 4W88A 3AZSA 1EOMA 1V0NA 3VIKA 2YL5A 3EFEA 2W91A 2UY2A 5BROA 4MB1A 1H2JA 5D9PA 5A2AA 4ATWA 1UQZA 3CUIA 3A24A 1BXRB 2E8ZA 3SUWA 1UQYA 7CGTA 3W38A 1PJ9A 1UH2A 3L4EA 3DX1A 2G3NA 3G6MA 3UMMA 1FH8A 3KE0A 3SOZA 2D20A 4AMWA 4WKFA 4JKMA 4Z2KA 4AZCB 1LQ0A 3LPPA 5M17A 1GGKA 3CUGA 2WKGA 4D1JA 1I7QB 1TR1A 1MW0A 3MGKA 1PZ3A 3J7HA 1KTBA 4GKLA 5CPSA 3M3PA 1CPUA 4OZOA 2DH2A 3NONA 3OGVA 3POHA 3RCNA 2ZXQA 2ZWZA 4AMXA 1B3VA 7TAAA 5I79A 3AXHA 2G3IA 4X9YA 1G1YA 3VIGA 3OT1A 3SUTA 1W3JA 3AFBA 4PMQA 1JZ8A 1B90A 2X09A 2EPKX 4JKLA 1MFVA 3OG2A 1CIUA 2AOSA 4HZ6A 4W7VA 2OWWA 1V08A 2FDMA 1HX0A 5BRPA 1OX4B 3DECA 3IANA 4FNSA 3WNMA 5BYWA 2RK4A 1GOWA 1MW3A 1UASA 4ZDJA 3GH7A 5DT7A 4N0MA 4CN4A 1J0ZA 3PN8A 4CVUA 2GK1B 3CZGA 5BWFA 5CG0A 4D1IA 4OIFA 3ZR4B 1UG6A 2F2HA 3QR3A 4Q22A 2IUZA 1PX8A 1UZ4A 4UFKA 1VCNA 1UR0A 4ZXOA 1FHLA 4TTUA 4IISA 3L7NA 3WNPA 3SCVA 2OSWA 1JYXA 4WLCA 2VXOA 1OINA 4V28A 1E6RA 3GNRA 6A3HA 1WCGA 7A3HA 4U2ZA 3NUKA 4UQ9A 4P35A 4MDOA 3OIHA 3IK2A 3SCUA 1KGXA 4GZEA 2A3CA 4F8XA 4I4NA 3NDZA 4D6DA 4BA0A 3AS1A 1JF6A 2H2WA 1CZ1A 1E9LA 2ZUTA 2XYLA 3QHOA 1C7TA 3NSNA 1BGAA 4PYSA 1JNEA 4JHOA 4QLLA 4BCEA 5A6BD 1WPCA 3AOFA 2OWCA 1JD9A 3HU7A 3RM4A 1W9BM 2C0HA 4HOWA 4V27A 1U33A 1OGSA 1EH9A 4M8UA 4Q7NA 2EXOA 3F71A 2FYVA 2FGLA 1NP0A 3SCQA 4AD1A 3AIUA 2WMFA 4GZIA 1FY2A 1ISXA 2WLZA 3WL0A 2AAAA 1QDLB 4BZYA 1HF6A 4EK7A 4Y1GA 4J3TA 3VINA 2BHUA 4RKYA 1ISVA 2EPMX 2F7OA 3T2QA 5D9NA 3WQWA 2BS9A 4ACYA 1PX3A 2AD5A 1WO2A 1R34A 4F9DA 1G01A 4IPLA 3VSVA 2J4GA 1D3CA 3U5YA 1AVAA 4AY1A 1VJSA 3BAJA 3CZLA 1Y7VA 3T08A 4ADSG 2YA0A 4KGLA 4E8CA 3F4VA 1XYFA 3WMCA 4U3AA 3W29A 4ENPA 2ZXAA 1JFHA 2J7DA 1UWIA 2YBTA 1HXKA 2VRJA 1JDBC 4PMDA 2JF6A 3APGA 4N0RA 2VJXA 5I24A 2C7FA 3ZSSA 4A3HA 1PZ2A 2CBJA 3ZJ8A 1VEMA 5IHRA 5SY9A 4E5VA 4NRRA 2J7HA 4QLJA 3BHNA 2PWGA 4M56A 3WD2A 1GQLA 3WL1A 3NDYA 4FMVA 1H3GA 1BQCA 2VL4A 1JGIA 1UR4A 4HPGA 4FLQA 3WELA 3ZIZA 3AIQA 3UOWA 3FHQA 1TG7A 1W9DM 2VQUA 1WKYA 1P6WA 2CHNA 4BQ3A 2DSWA 4B3KA 2ZUMA 5ABHA 4QYTA 3PZMA 5A6JA 2UWFA 1Q4NX 4XZBA 4TVUA 5JIPA 1QW8A 2WBGA 4R27A 1SOAA 2J62A 3ZMRA 2Q8XA 1H4PA 1KXHA 1R7AA 3KWXA 3WH9A 3I3BA 4OOZA 1PDWA 2D24A 3THCA 1E6PA 3N17A 2OSYA 4KRUA 2X1IA 4HMEA 1JAEA 3RJXA 2VKTA 5LA2A 1WZLA 1EQPA 2DQXA 4GE3A 2XF2A 5A6BA 2J74A 3B9EA 4BF7A 3SCNA 3TTYA 1SMAA 5DEZA 1C30B 3EMCA 1UH3A 1BAGA 5IFPA 5ECUA 2FH6A 4JFUA 1R7OA 1R75A 1IT0A 3M7SA 4CD4A 4S3KA 2ZOXA 2DGAA 4MB4A 1L8NA 3OLGA 2GFTA 2OW6A 3EJTA 3BSHA 1TUXA 4WINA 3P9SA 1S1MA 1IPHA 2WMGA 4LPCA 3VGBA 3SCSA 1OIFA 3SCOA 4UZUA 1W2PA 2RK6A 3O2LA 4RE3A 1I1WA 3DX4A 4DUXA 4GQRA 5CXPA 3IJ7A 2YLAA 3S6TA 2VCCA 3BUDA 4FNQA 4LRUA 3GXTA 3VU3A 4MNLA 4B15A 2GJRA 1GOQA 5E1QA 4AWEA 1PV2A 3WQVA 3VPLA 1CE8B 1V03A 1V0LA 2W62A 3AHVA 3ZT6A 3R74A 3ZJ4A 4WSJA 2Y8VA 2QLYA 3UERA 2XIIA 5I2UA 4QP0A 1E3ZA 3GXIA 3K1DA 2WJZB 1VFMA 3TOPA 3WF0A 4W89A 1KA9H 4W86A 3BLBA 2HISA 2VZUA 4CUCA 1LF1A 4H2CA 4UFJA 4CVWA 1E0WA 4ML4A 1BYBA 4LXFA 4N42A 4D6EA 4BQ5A 4GPNA 1N57A 3CHEA 1QVZA 4HA1A 3A4AA 4XZWA 4WK9A 3BUQA 4FNTA 4Z2IA 4UFLA 1P81A 1RPKA 3D3AA 5FOOA 2EPLX 1QI5A 3T0AA 4TXEA 3UESA 4M1RA 4PCSA 3WD4A 1VHQA 1KXQA 2VQTA 2RK3A 1UUQA 2CXGA 4UFHA 2X2IA 3MU7A 5A8OA 3ZJ7A 4P8XA 2D0HA 5DO8A 4ENVA 5AC4A 4FLOA 1CNVA 1UYQA 2ISSD 1E4MM 4A3YA 2BY1A 3VNYA 1AQHA 4QDMA 2ZX5A 2RGLA 3EBVA 1I1QB 3BCDA 1V3KA 1NOUA 2DH3A 2BFGA 1GJWA 2A3BA 4S3JA 1ZL1A 1H1NA 5FCZA 3FIJA 1W9PA 1GONA 3GM8A 4UQBA 5SYAA 5BXPA 3MV01 5E6ZA 1MW2A 1QHOA 1EGZA 5EBAA 4W87A 5ABGA 2VDJA 1GQKA 1W9XA 3GH5A 2WYSA 1UKTA 3VDHA 2YIHA 4PUEA 4MJ4A 4C7FA 2W61A 5HOSA 1VBUA 4FNPA 2EPNA 3FHAA 5CSUA 5EFDA 3MMWA 1B31A 3KZSA 5DT5A 4YN5A 2VC9A 1V0KA 1F4AA 3GXNA 4UQAA 1B1YA 3ARRA 1CLXA 1G94A 1ISYA 4MPKA 1J01A 1R87A 3AZTA 2A3AA 5I5RA 2FGZA 1M6VB 3P9RA 3MIIA 2CBVA 4IPNB 2WC3A 5AYBA 3CUJA 3OT1B 4AZCA 1AQMA 2OR3A 1QWSA 2R1TA 4RKWA 1K9DA 4HCJA 1MVYA 1BGGA 4AXNA 1HP5A 2FH8A 1BYCA 1FA2A 3NJ3A 3VSUA 3MKKA 2YWCA 2GUYA 3BLKA 1OM0A 1EO7A 4KH2A 1K9FA 1VRXA 1J0IA 2WHKA 3VTRA 5JZOA 3N04A 3WDPP 2WB5A 3D5HA 6CGTA 1W1TA 2AB0A 4C7DA 3F5LA 1V6VA 1R47A 3LX9A 2YWBA 1KR0A 1IV8A 2CEQA 4B9ZA 3W53A 2BHYA 4E2OA 3LPGA 4GE0A 4LYRA 4ENRA 1GPWB 5GPRA 2Y5EA 4GI8A 4J27A 5JUVA 1WAWA 3LRLA 4JFVA 1CBGA 2DIEA 1R85A 4PMUA 1Q6DA 1R86A 4W8LA 4QCEA 3MUY1 1E70M 1H0GA 4AMCA 2IGTA 3VMOA 3UJNA 2MANA 2WZHA 1C91A 4DWSC 3LXCA 3WDIA 4LGYA 1KQZA 3ALFA 1LG1A 3FXYA 4B5KA 2VR5A 2FE0A 2QMJA 3CUHA 2XGBA 1H09A 1V3HA 3BXWA 5M3WA 2D7JA 3RDKA 1E1FA 1VEPA 2CBUA 3F5JA 1V3MA 2GJXB 3GDBA 4FLSA 3PZGA 3OBAA 1EOKA 3BVUA 2ZUUA 2OSXA 3R75A 1XC6A 1GHRA 4WXYB 2VTFA 1JIBA 3PQ2A 4ZDIA 1R46A 3KL0A 3MV11 4UOJA 3L18A 2J25A 2X2YA 4P34A 4JFTA 1S46A 4B2YA 2YWDA 1CYGA 1E4IA 4NXSA 4W8BA 4HTYA 4UNIA 4D6FA 4UR9A 2R1TB 1WDRA 1HVXA 4AUEA 4XB3A 4KWUA 3B38A 4B7AA 3GNOA 1HT6A 5FKYA 1TA3B 1JZ5A 2WHLA 1DWGM 3VIIA 2VZOA 2XFYA 2PWDA 5IDIA 2D0GA 4L7QA 1H49A 3TTQA 3OLIA 3AIVA 2WXDM 2WHMA 2YL8A 3GXPA 5A6KA 2J7CA 5LA1A 2W66A 3EJSA 3ARWA 4L95C 1B30A 3WDRA 3I3EA 5DFAA 4L4OA 9CGTA 2CCRA 2G3MA 3CLWA 3VNZA 3CZ8A 1MYRA 2V4UA 3NVAA 4ZE5A 1HXJA 4NI3A 1WDPA 2VRKA 4UQCA 1QNSA 3QOKA 2JIEA 2Y8KA 2E4TA 3VIMA 1J11A 4GI6A 3T09A 3VX0A 1JI2A 3UK7A 2ZUNA 2YL9A 1UD8A 4U33A 1JVNA 4IM4A 4P8VA 1JDAA 2E0PA 3WDJA 3VDAA 1Q6FA 4R5EA 4F66A 1E6XM 2QPSA 3BVTA 4HOXA 1CS0B 3BWEA 4WKAA 1OCQA 1VFUA 4JCMA 3ECQA 4AIEA 4AEEA 2ZICA 1V02A 2WHJA 4K2HA 5CQ1A 3WH8A 1PIGA 3A21A 1QOXA 2UY4A 2PBGA 4AYGA 1NWRA 2O9PA 3WQ6A 2CERA 4KMQA 3BUPA 4PTXA 1PDVA 4JHZA 2R1VB 1E55A 4CGTA 2FHBA 1M04A 3K4DA 1UD6A 2E9BA 3SEPA 3G6LA 3W6MA 4AZHA 3PQ3A 4PEEA 2O9TA 1VFOA 1UKOA 4BTEA 3PTMA 5A6MA 3UGJA 3CZKA 4P7QA 4GQQA 3VD7A 3CY6A 4HP5A 4D71A 1SMDA 3VKKA 2RGMA 2WVSA 2XM2A 2XM1A 5AC5A 2WM0A 4YHGA 2GJPA 1E1EA 2IUFA 3EDEA 1KXVA 3ZJ6A 3ARSA 3WBAA 4L4PA 3HG2A 3N9KA 1V6XA 1J18A 3A3HA 2Y2WA 1NWSA 3CHFA 1UR9A 1GCYA 3AIRA 3DYOA 5CZKA 5A8MA 3GNPA 3RMEA 2EBNA 1A47A 2ZUVA 1QWNA 1ZJAA 2WVUA 2EPOA 1HJSA 2XIBA 3WNLA 5CLTA 4CD5A 4YHEA 2B31A 2VCBA 1Q6EA 4Y7EA 1UD5A 2VPIA 1CLVA 1YQ2A 3CHCA 3UEQA 1W3LA 3MUAA 1EIBA 5JZMA 3CHDA 5GNXA 3DHPA 3VGDA 4F79A 2DSVA 3SUSA 1FP9A 3A22A 1UKSA 1NOWA 3BGAA 4PUDA 3EMZA 3CZ9A 1VENA 3D50A 1BLIA 1DTUA 3MSGA 3CMGA 3TTWA 5JBEA 3THDA 2JEPA 3N18A 1D7FA 1CXKA 2F8QA 1JYVA 3L4VA 1GUVA 4PMNA 3AS3A 3WIJA 4J3UA 3B8SA 2VZSA 5HNNA 2ZUWA 4AYSA 3KL5A 1QNPA 3EZGA 5I77A 4OFWA 1CXLA 4GINA 1UKQA 1P7ZA 4OGFA 4QYXA 3P9QA 2W67A 3D54D 1XCWA 3RPMA 2WC7A 4PTVA 3T0DA 3IJ9A 4M82A 1WP6A 3W81A 3DC0A 4BQ4A 3WUBA 1GG9A 1CTNA 1US3A 4J7RA 1Q6GA 4CCDA 3LPOA 3FN9A 3N7TA 2DIJA 4P7OA 1QHZA 2YDSA 4H04A 1QVBA 2EO7A 3DX3A 2XVLA 2R1UA 2XTKA 3NOOA 4AZBA 2YFOA 4LYQA 3S2CA 2XN1A 2X2HA 3MUZ1 1TZ7A 2QMKA 3KLKA 1C92A 4AEFA 4B16A 5D8ZA 2VI0A 5IHSA 5IP5A 4MTVA 3LPFA 3ARTA 6TAAA 3RO8A 3II1A 4ZXLA 3CBWA 4P7RA 1W1YA 5A94A 3TTTA 4AIOA 1LL4A 1TQTA 3AYSA 1SY7A 1DWAM 1KGWA 4JL2A 1C8QA 2ZX7A 4NXKA 4PBGA 4MNTA 3M6DA 4PMXA 2DSUA 4OGGA 3CNEA 4D6CA 4AJ9A 3HZ3A 2NV0A 4XX6A 1VF8A 2WC4A 3VDBA 1E15A 4MB5A 1R33A 1XD1A 3PQ8A 3KLLA 1WDQA 3WH6A 4JL1A 1C93A 1HVQA 1J0HA 1NM9A 3L2MA 4UFIA 3K8MA 4ACZB 1GVIA 1UZ1A 4OJYA 4W93A 4MNMA 4J28A 3TTVA 3L4WA 2G4FA 2DT0A 4D6JA 3VGGA 4AD0A 1CXHA 2X05A 1QVVA 1O7AA 1C8YA 1V6UA 3OLEA 3VD4A 1ODUA 1KTCA 1Q7RA 3RHTA 2F1BA 1SFSA 4E8DA 4NF7A 1OX4A 4W7UA 4TVCA 3MI6A 3WENA 3ZO9A 1J9YA 4AD4A 1YHTA 3OGSA 4YPJA 2NT0A 1BG4A 3NIYA 5AYIA 1WL8A 1H11A 3NOQA 4PN2A 1QBBA 1AMYA 4GO9A 3W27A 3D4YA 3WH5A 2ZXDA 3FNDA 1GGEA 2FEXA 3IJ8A 2JIWA 4K68A 2D0FA 1H41A 4FK9A 3TTUA 3WF1A 3M07A 1WB0A 1JAKA 5E0FA 1LWHA 4MADA 5CGMA 2WW5A 4LQ1A 4EAMA 3I3DA 2GK3A 1WZKA 3ZR6A 1PIFA 1QVWA 3GBEA 4XUYA 1LL6A 4AZGA 1VCOA 1KQYA 3FAXA 2NSXA 4I46A 1GOOA 5LYRA 2F18A 4ATLA 1P80A 1QWUA 3W28A 3VIPA 3DX2A 2J78A 1KGUA 1E6NA 1V6YA 1CGWA 4U2YA 2ZXBA 1QW9A 1MW1A 1XHGA 4FF5A 1E3XA 1ECEA 1KFWA 1MXGA 1J12A 4MTCA 2WANA 3S5YA 5DF0A 5FIPA 1OX5A 3AMCA 1HNYA 2VR4A 1KCLA 3A4WA 3N1AA 5A6SA 1J0YA 4TUFA 2BY2A 3O9NA 4OBRA 4P36A 1D2KA 3K8KA 1FHDA 4P5PA 3TTOA 4QCFA 2WMIA 3GXMA 4HMCA 5A95A 2DT2A 1MQQA 1VB9A 2E9MA 5BRQA 1PE0A 1E40A 2CESA 3SF8B 2EABA 3PZVA 2VVSA 3WQ4A 4QAWA 2PF0A 1B3YA 1E4LA 3BH4A 1MFUA 1GORA 4N12A 3FY1A 2BXZA 3EJRA 3A5VA 3ARQA 3DDGA 1M7XA 4P2GA 1JNDA 2JALA 1GPMA 1ONSA 4BFLA 2J79A 3SCWA 4CU6A 1NOFA 5I0DA 2VX5A 3AMLA 1U9CA 3H53A 2Y24A 1NWTA 2VX4A 1IZZA 1GQIA 3AXXA 1HL8A 1TFVA 1WNOA 3U5UA 1GHSA 1XCXA 2ALWA 1BFNA 2YFNA 3WKZA 4RE4A 3AIEA 3SUUA 2D1ZA 3WEOA 3WUEA 5DMYA 1GOIA 1F4HA 2WCGA 4DM2A 1ZJBA 4L8WB 4M81A 4AD3A 1PAMA 3AQUA 4DM1A 4JCLA 3WFLA 1G0CA 3DX0A 1TQVA 2YLLA 1K9TA 4PSPA 3WMBA 2CYGA 1KBKA 2PWEA 2ZE0A 3CH9A 5CSYA 1XRVA 3L4ZA 1DWHM 2WMIB 3CTTA 1RH9A 3AHZA 2XUCA 1KB3A 4LGXA 4ZDKA 5A69A 1XSIA 4A4AA 5BXTA 2BY3A 3CYFA 2XWDA 1PX4A 5A8PA 1XV8A 1GGHA 4IUGA 3A6OA 1JD7A 1DEDA 1UWQA 2O92A 3HG4A 3VOCA 3U7BA 1ITCA 1Q2UA 1QF7A 4HU0A 1OY1A 3GXFA 5I78A 3VDCA 3NOVA 4UZSA 2X0HA 5A8NA 4HOZA 1KWGA 1QNQA 2CITA 4ZE4A 1WDSA 4EKJA 3S5ZA 4J3WA 4V2XA 1C7SA 3WEMA 1M53A 2WMJA 3VM5A 4B3LA 1EDTA 5LIRA 5A2BA 1CECA 2D3LA 2XVNA 1E6QM 3ZJ5A 2ZUSA 5HBFA 4Y0NA 3LXAA 4W8AA 3KEHA 4DWSB 4TTGA 3VGFA 2OWXA 2O9RA 3CZNA 1TQSA 3EJPA 1A3HA 4GI9A 3FAWA 2EEXA 2E8YA 4WSKA 3GZAA 4DO6A 3AHYA 5TD4A 2YOCA 4X0NA 5ABEA 2F7PA 3CPUA 2CETA 1W32A 1HJXA 3CZSA 1TVNA 2ZX9A 4BS0A 3T2PA 2Z1KA 1W2VA 4CCEA 3KKLA 3BVXA 2DSKA 4R7GA 1CGTA 1ISZA 3TV8A 2OLHA 4MNJA 3UCQA 3WMSA 3EDJA 1J0JA 1QI3A 4JKKA 2W92A 3PZ9A 3RM8A 2WZEA 1K9EA 1OGGA 4M24A 4H8HA 3TONA 1RD6A 3VMNA 2YDRA 4KRTA 1UR2A 3EJQA 1E5NA 4CKQA 3SURA 3D4ZA 3HG5A 4URIA 3U7VA 1UD2A 4KGJA 3VSTA 1UWSA 2ZIDA 4PMZA 4CN1A 4CD6A 2WVTA 3EDDA 2CBIA 5JIWA 3WY2A 1FFQA 1ESWA 1B3WA 4MNKA 1UR1A 2DT3A 5E9AA 4PTMA 5SY6A 2D73A 3UG5A 4CCCA 2WWDA 3VGHA 1FOBA 3AI0A 5ABFB 2YWJA 4AISA 4TOQA 1JXKA 4JFSA 4OUEA 3WFZA 1CENA 5C71A 2PWHA 1E43A 2VCAA 4GUDA 3CC1A 1E5JA 1FP8A 2Y4SA 3WUGA 3PZUA 4JAWA 1QNRA 1OB0A 2ZWYA 1UHVA 4HPHA 1VFFA 3UG4A 5M03A 3QGVA 4AUMA 3UG3A 2ESCA 2E3ZA 1J10A 3VD9A 1W1PA 3PBGA 2E40A 3BAIA 2WMHA 2W63A 1UD4A 3ARXA 1TQUA 3AIWA 3VD3A 4DUVA 3LMYA 3PTKA 1EDGA 3WNKA 1IZJA 1UWTA 1JFXA 3ARZA 4P7NA 3IAPA 1JDDA 1Q6CA 2IXVA 5C70A 1HTYA 1O7DC 2J77A 3DDFA 3VGEA 1G5AA 4BQ2A 3K8LA 1M03A 1UR8A 2G41A 2CHOA 2WMKA 1JG9A 3POCA 1GJUA 3VM7A 4UTFA 1L9XA 3W25A 5K4AA 1GOMA 5GQBA 4AZ5A 2WK2A 3LRKA 2CIPA 3SF8A 4GO8A 3K4AA 3EJUA 2NT1A 4D6HA 1VEOA 1BHGA 3ARUA 4JFWA 4ENQA 1DWIM 4AD5A 2EQDA 3BAKA 4MGHA 2PB1A 2A9VA 1DP0A 3WF3A 3NYDA 1GZJA 2WVVB 2XGIA 4CD8A 1U2YA 4LYPA 4BIMA 2DT1A 2CKRA 2XVKA 3E1F1 2IXUA 3H54A 4Z2GA 1HKKA 4MB3A 5CPQA 4W5UA 1R9GA 4PSRA 3RJYA 1J42A 3MUIA 1KWKA 4U3CA 1Z32X 1RP8A 3NORA 4ENSA 2UY5A 2QPUA 1PEZA 2NW0A 1EO5A 4X0VA 1N82A 5D9OA 4ZGGA 2V5DA 1X1NA 1US2A 2VZTA 5EMYA 2DSZA 2WCSA 1VCMA 4HMDA 4E08A 3A23A 1BTCA 3PQ5A 1DWFM 3GH4A 1MQRA 3MSDA 1SZNA 4AZ7A 1C8XA 2V3EA 2WZIA 4UCFA 1XGZA 4AUNA 2YJQA 1VJZA 4U31A 1XH2A 5A1AA 1ZBVA 3BUIA 2QF8A 3MMDA 1GPFA 4DUWA 3RILA 4J3XA 3AMDA 4H7VA 5HDRA 1BYDA 1FFRA 4NRSA 1P7YA 3WD3A 4NZJA 1I1XA 2WAGA 3WNOA 2YA1A 3RM9A 3WUFA 3L2LA 3F5KA 1E72M 1OBAA 2YL6A 3BVWA 3F5DA 4XLLA 5HXMA 3AMGA 1BF2A 3A4XA 1LL7A 5EB8A 1E6SM 5BCAA 2G3JA 2VNCA 1ISWA 2VT0A 2XSBA 1OD8A 1VIWA 1JZ7A 1WZMA 2R1VA 4DO4A 2C8NA 2QV4A 4F9JA 1I75A 4MAZA 1JF5A 1HJVA 5E0CA 1JDCA 1BG9A 2VMFA 4W7WA 2CNCA 1JZ6A 1MXDA 4HA4A 2BVDA 3WY1A 4FNUA 4W84A 3VD5A 1TA3A 4JQSA 1LG2A 1HKJA 1R8LA 1CGUA 1K9VF 3AICA 1XSKA 1V0MA 3DYPA 4AULA 1HKMA 4PXYA 4Y1FA 1HN1A 1UA3A 1EHNA 4HZ7A 3M46A 2J7FA 3OZPA 2QHAA 4WJXA 5FL1A 1I7SB 3B3AA 1JZ3A 5AY7A 3GRAA 1E4NA 3CO4A 2WSPA 5JBFA 4M80A 1OWQA 5A2CA 2EJ1A 5HPOA 1JI1A 3N15A 1C3OB 2FHFA 1KXTA 2XN2A 3TTSA 3TP4A 3LRMA 3ER6A 2PI6A 3WQ8A 1GGFA 2A3EA 4Y1EA 1HKIA 4TX6A 5D4YA 5A6LA 2A3HA 3AZRA 4CN6A 1W1VA 1OI4A 2BVYA 5D8WA 1LJYA 4EANA 2WCAA 1X6NA 3K46A 3DHUA 2VOTA 3ZM8A 2WNWA 3BUBA 3QOMA 3WF4A 4PMYA 1XH1A 4P8UA 3WD0A 4B40A 1OSEA 1QHPA 1GQJA 2XWEA 3L4YA 3RIKA 1EA9C 2HVMA 1IZYA 2EACA 3H55A 4ZENA 5IFTA 4B31A 1CGYA 1HIZA 1VBRA 4NX0A 3FW6A 3VUPA 4GXPA 1E0XA 4UFMA 2W7TA 3EJ6A 5CGTA 3R76A 2VZVA 3GXDA 3EYPA 2GHRA 1HJWA 4JIEA 2JE8A 5E6YA 3NCOA 3UETA 4AIUA 2VUYA 4H8VA 2PBOA 1BYAA 1EHAA 3MO4A 4QLKA 2ZX8A 3PZNA 1UWUA 5E09A 3AMKA 1OD0A 2V5CA 3VIHA 3ZT7A 3VVGA 3W24A 2OW7A 3W26A 1BPLB 1QPKA 2GJXA 2VURA 1QBAA 3T0BA 2WPGA 2NV2B 4ZEPA 1QX1A 5M5DA 3UR8A 2D23A 3BMVA 3SUVA 3MS8A 3ZOAA 2V38A 4UQEA 1OIMA 1V3IA 4DWSA 4L8FA 1ZBCA 2DPEA 4RL3A 3GYCA 4W5ZA 1W91A 1OX6A 4HA3A 3BAYA 1W9VA 3W37A 5SY4A 4OGZA 3CZEA 1HJQA 1C90A 5IXEA 3W6LA 4ENTA 2BNJA 4D6IA 2XHYA 1CGVA 4HZ8A 4AZIA 2XFFA 5CJ5A 3ZQ9A 3SCTA 3AISA 3ZJKA 3P9PA
chains in the Genus database with same CATH superfamily
2O54A 2QPAA 3N4FA 4ADTA 4IEEA 4LPXA 1JXJA 2IDQA 2WWNA 2GYUA 5EXEA 3I7RA 3ZTJG 4NKQB 2CR3A 2VGBA 3F78A 2ZF9A 4YUWA 3W4RA 3EZ9A 2WJ3A 2ITFA 4KK8C 3OWXA 1C7RA 1FMJA 1P75A 5F64A 5T67A 4E5XB 3KQNA 3UY4A 3D6UA 4P5SA 1KBBA 3HI4A 4F5CA 4YP5A 4QICA 3SYTA 3ARPA 1XPRA 1J1ZA 3US0A 5JQ9A 3KR9A 2NNAA 1HRKA 4BEIA 4KITB 4JVOA 3OPQA 2W42A 2Z9DA 5AAWC 4NKOA 3T4WA 5EA9A 1DZ0A 3AGWA 2YX0A 3CMOH 4JPIA 3G8CA 4YREA 5C0GB 2NW3B 4L7ZA 4FNGA 2P4HX 1A69A 4UQDA 2P3OA 3W87A 5EZYA 5L6MB 2LE9A 1JUFA 4LDOB 3GH1A 4EIWA 5JD6A 3ARVA 4XWUA 3QQXA 4UD2A 1BC5A 1J2JA 2X7XA 3H4IA 2Q1UA 5JIQA 2QKIB 5JALA 2RH4A 3D8MA 2ED8A 1C0IA 3QZWB 4R31A 1FSPA 2MCFA 2EH7H 3VHXB 2DAPA 4LMRA 5C0IB 4KKXB 4H8UA 1FVHA 1TU0A 4MA8H 4PYIA 4FJ2A 4M03A 4LXHA 3DMNA 2VVNA 2X42A 2AJCA 1M1YA 2YB4A 1QRUA 1NQVA 4RPKA 2PMBA 1FYEA 3OZOA 4DVBA 4YRFA 1GGJA 1L0PA 4Z2HA 4H6QA 4WKOA 2XV6B 1NWUA 9GPBA 4NEHB 3E7WA 1M6JA 3P19A 2BTMA 5HE9A 4FWTA 4IQGA 2BNRD 3IETA 3V2IA 2P0AA 5BRZE 3HE6D 4I77H 5FSDC 1HFEL 4M3JA 1E7UA 2WZPD 4B9IA 2A1TS 3CZRA 4BB9A 3W5NA 4MZ2A 4DLLA 2PKCA 4AU1A 3QOYA 1MA3A 2GJZA 1D7DA 2C2XA 3HO6A 4WKCA 1UM8A 3FMFA 2I07B 3QYSA 3BL8A 2CA3A 4PRDB 3F6RA 4YXKH 2BN4A 3G0IA 1ZPDA 2V37A 3BDVA 2HMID 4KC3B 3UWSA 1B9ZA 3D8HA 4J3VA 4PZZA 1N8TA 4CKXA 3K6SA 4P57B 5L4FA 1YYCA 3T9DA 4HWGA 1CPYA 4OMDA 5AW0A 1Y3FE 3ZDXB 2Y1GA 2OO5C 4QEHA 4PC2A 4A37A 3W3AA 3KWJA 2GUOB 3TYUA 5IHPA 4AQZA 1OY0A 4JGNA 4O0KA 1QI4A 1WXHA 4IGAA 1C1XB 3TL6A 4X9FA 3IMBA 5H16A 1GTSA 1O6BA 3BB4A 2ED9A 2DZPA 4M5ZH 2A9QA 3ACDA 3QWIA 3JPYA 4PJXB 5FAJA 2OQJA 1VG1A 4WWNA 1I9EA 3ME0B 3GSNH 4JG0H 3T05A 5B80A 1BZYA 2V9ZA 4GR4A 1TQJA 1NRXA 3AB7A 3VBEA 1SJCA 4H1LA 2A9DA 3D08A 3KUKA 3BO8A 3R0XA 4A66A 2PRKA 5B58T 4AD2A 1SBTA 4GB9A 3GVIA 4G9FB 2UXCB 3MNVA 4HB2A 2JH2A 2XVBA 1UWXH 2RGSA 3O2DH 5L3RA 3AHTA 2INZA 2IXEA 1MCWM 4NVRA 5DGCA 1YJQA 3GSWA 1B2YA 1CP2A 3FKUS 3M6FA 4ZFZA 4FQ2L 2IYYA 3NOIA 1GNRA 2D3WA 5FUYA 4LLWA 4N2BA 1QOPA 4KC0A 2W60A 5F76A 3SZKC 4QS5A 1O1YA 3TYFB 3D51A 1UFUA 4BFOA 4LAUA 1ISIA 1RLJA 4U6TA 5EHGA 4AXXA 2NQ2C 1KNOA 1IHOA 1ZU8A 4QRNA 4XWOC 1NI3A 1EEYB 4RMSA 4BFXA 3T99A 4HXBH 2V3VA 3ZD7A 1N18A 4AGOA 4LAJH 4L57A 5I30H 4LSSL 2C4WA 5HRCA 4MW7A 5I1HL 4EI6A 3ZGXA 3FWYA 4II3A 4IP0A 2VNIA 1JEAA 1RJFA 2O1EA 3C8DA 4EPSA 3F7OA 5AK5A 3NTVA 1UWEH 3VX1A 2A7PA 1P5FA 1EP1A 2JGDA 3IXMA 5KHAA 2ZOUA 1GWNA 1RUAL 4M6AA 5BS0B 2H6RA 4YJHB 1CXIA 1IM3B 1EXVA 4TVDA 1FVXA 2HRGA 2OMUA 2UZYB 4DLFA 2KBFA 4WFKA 4D96A 3TAXA 3I65A 3ZN6A 3LTEA 5AOIA 3P3UA 5JBQA 3ETCA 4M3NA 3SXJA 1G7IB 4XCYB 3SGEH 1LPBB 4HPWA 3BHBA 4CODB 1ZS8B 2ZNXA 4MINA 1T21B 1EE2A 4LCWD 1QKKA 1T0NB 4LCUB 3GUUA 2FP3A 5G5IA 3TBTA 1NDTA 1MVFA 3AW5A 3C16C 5I74C 4DLBA 1SYVB 3KB2A 4ZZ3A 1XIBA 1R2SA 1P1HA 2FFJA 4W82A 7CGTA 1PGRB 2VHYA 4HKXB 1HH9B 4LRSB 1J8QA 4M83A 4F4IA 1NL0L 3ORJA 4B0MM 1V7ZA 2X4UA 4BHUI 3ND6A 1IXNA 4AMWA 1O9HA 4JRYA 2X89A 3RWDB 3VOIA 1R3DA 3TIVA 4AZCB 3WIHL 1LQ0A 1T4KB 4Q9RL 3QWRA 1QHHB 3CUGA 1K4CA 1W8IA 1VJRA 2VK4A 4JC4A 2QVNA 4UB0H 4FYKA 2AJBA 5EIFA 1JMZA 3KAPA 1C14A 3HJAA 3AV0B 4LPKA 1MZYA 3OGVA 5H59A 2QW5A 3PDCA 2DE0X 3O0FA 4W5HA 2EUXA 3X1WA 5AW1A 2XNAA 5DMLA 5J0BA 4XNXL 4G56A 2VYQA 2VHCA 3SVLA 3ETHA 2WN2A 2J88H 5JEDA 3T0EC 2BHTA 4D92A 1PSKL 2O1XA 5KYVA 2DR2A 4XE5B 1A4UA 1DZIA 3C5SA 3C8UA 4TXHA 4MARA 3HLKA 1DO5A 1AGYA 3A9RA 2XR1A 5JFGA 4ZZ1A 3GS4A 4G1FA 4TPKA 4I5XA 4ONHB 4FNSA 1V8EA 5HDQA 4R96B 3IKKA 2J56A 2H7WA 2IODA 3B2VL 1F6WA 1L1QA 1SC3A 3S2YA 5L8KB 3CW9A 3R0MA 3BIWA 4OIFA 4IJVA 3ULUE 5EO1B 1RPZA 2VYVD 4DJFA 1JWSB 1HHKB 4J6RH 1K63A 2NZVG 5K9ZA 1QSEE 3Q48A 4UUNA 1QAWA 3QUZA 1RVDA 4Y16C 3NZPA 4DR7B 4P4SA 4OUIA 2P5WA 1L6IA 4QRRD 4G07A 3RIFK 4QXIA 4WLCA 1BAFH 2EHDA 1CBJA 2YZ8A 2DZVA 3KCPA 2PR2A 1Z2CA 5I5JA 3QMPA 2NYUA 4R96A 2QQLH 4HWSA 3BXOA 3QF7A 2R7AA 3P82A 1H6AA 1NDYA 4MEBA 3IK2A 1AG1O 3MV7E 4NP7A 1FYFA 5DNCA 3P93A 4I4NA 3IDMA 3T40A 3W3OA 3AS1A 3AY4C 1L6SA 3P0FA 5CFMA 3L95A 1EEXB 5CB6A 3TUIC 1KRAC 2VT2A 4X6DF 2AFVA 1F74A 4QRUB 3VFTA 3V9PA 2OO0A 5EP3A 4BCEA 4LC1A 2O8DB 4IGEA 1P9LA 4NPHA 3U17A 4OX9B 4IBUA 4RGBA 5MHBA 2EDOA 5B1EA 4F48A 4PULA 4F4JA 4M8UA 4Q7NA 3OQ6A 4B6GA 2UV3A 1CJTC 2BG5A 3R5EA 4PRLA 3LM8A 2V7NB 1FY2A 3STLA 2IU3A 4CTOA 4A92A 5LNRA 4R6XA 2ISDA 3EJWA 4JTTA 2IYEA 4P98A 3U3HA 5ICSA 4ATNA 1PY9A 2QP4A 3W5IA 4RKAA 4ZAXA 5C2JB 4DOHB 4IPLA 5IUKC 1X6UA 3R0VA 3QZBA 2BIMA 4TSCL 2WWVD 4JNXA 3BA6A 4HKXA 32C2B 4O02H 4PGMA 5A3SA 4XCEA 3IAHA 1H69A 3QBVA 4EYQA 4HVLA 1A9TA 4N0RA 4N6GA 4NQRA 2EEDA 1MJFA 5BVPL 4NHVA 4BFNA 3RVPA 3R7FA 4BO2A 5AN7A 4G6ML 2CBJA 1JJUA 4C6TB 3LEPA 5H9WA 5GS2D 1JDFA 1TETH 2VE6B 3E5HA 5FDWA 4M1YA 2VDUE 2IQAA 2FWJA 3ZE2B 3WGHA 4IOFC 5IKXA 1O5XA 5EIXA 2VL4A 4W5TA 3U7HB 4FLQA 4OH2A 1ITUA 2HZBA 3IE9A 2FZ8A 1EZVY 2VQUA 3QV2A 4EQ6A 2O3SA 2AW2A 5MEND 4BQ3A 1I3NA 5FEXA 3ANYB 1E8MA 4FI6A 4WCJA 2R0WL 1DL7H 4UTCA 1BMQA 3CNYA 3WTCA 4LNAA 5C09D 5TK4A 4PX3A 4QXTB 3QQWA 4M6VA 4NNYB 4NNBA 5BN4B 3UR2A 3KJEA 3PP3K 4K9DA 3DD5A 5CC6A 2D62A 4ZQRA 1LDPL 4H13C 3THCA 3EC1A 4QOIA 2ZVIA 2WSDA 2IIJA 1AUOA 3W3BA 3LQZB 4ZD6A 1I1CA 1JSZA 3QJSB 4FBMA 3CVWA 3CVCA 5CWSA 1GEGA 4CCZA 2TSYB 5GRZA 4R88A 3VXSD 1QH0A 3TQVA 1XXDC 5AKLA 1BS1A 1WBZA 1D7OA 5K59E 4KQCA 4TSKA 3LGGA 2Z7WA 3K6JA 4H4DA 1EXDA 1GYNA 3FK4A 2B2XA 2P9YA 4KQWA 2NO6A 1QZUA 4C4ZA 3C4UA 3FYOA 5FUOH 1ME8A 1A5CA 3QI9B 1NE7A 4U6QA 1IK4A 2QYOA 4D0DB 2FNBA 4KX8A 5CH9A 2Q5EA 3SRHA 2D31B 3P9SA 3MRLA 4HUXA 4ZSOE 5G1MA 2I2WA 2HZGA 5K3DA 5DW0A 1HIMH 3OBBA 3CNHA 2CGRL 3K7EA 1P7KA 2VCCA 2EEFA 3QNWA 3MD9A 1YJBA 5A5EA 4LLUB 2QV0A 4GPIB 1J8HD 3W75A 4K9LA 5LOVF 5AUQA 2JLZA 2Z58A 1VH7A 5EBMA 1B6GA 1P5VA 3T6CA 1YLVA 3WQVA 4IFEA 1Q9KB 5TPWB 3AVPA 4GD0A 5HNRA 4Q14A 3KPSA 4LNRA 4A7QA 1YI1A 4ZVKA 2ZRLA 2NVUA 2MJWA 4ZTOH 2XUIA 1R3SA 4DI9A 5CVDA 2Y8VA 2JFGA 4ZYYA 4P4RA 3KVYA 2OT3B 3UAGA 3HKZA 4W89A 1QQ5A 3L1IA 3QITA 4LBZA 2GK0B 5AI0A 2HUHA 4H2CA 1FTGA 1H6CA 3QLEA 4CVWA 5KKAA 2EBUA 1UXHA 1IVTA 1EYEA 4LXFA 4MZ3A 4Y4KC 1L0XA 5EKSA 5BVHB 2EWWA 2ZS9A 4KESA 4UASA 3S4TA 4OTZA 1TFHA 3L65A 1ZU5A 4DERA 2BSLA 3PUZA 5D1XD 3UEZA 3NCBB 3T0AA 4M1RA 4JKPH 4XAGA 4HMPA 5LQNA 3APYA 2O5CA 1G7PB 2VD9A 1FFNA 3LSBA 3RWEB 4IK6A 2ON6A 1JU3A 1WCIB 5FADA 5AC4A 2ICEA 1TU2A 2CRIA 1KLZA 4J3ZA 3M2TA 4MVJI 1CUYA 3SMVA 4W5NA 3PYCA 1QO9A 1VKJA 4PWIA 1QIFA 2GVEA 2NXWA 3ENNA 3FWHA 3OIGA 4YTRA 4Q7EA 2TMDA 3WGGA 3WS3B 5F7JA 3W1RA 1GONA 5A6TC 1YYMH 3C3CA 3M1YA 5SYAA 5T5QA 1DGQA 1UFGA 4UNLA 1MPTA 5LNVA 3DJSA 1F6BA 4LHZA 5J4LA 4PRHD 1GPWA 2RMNA 2WB2A 4HIXL 3F12B 2PTVA 4EF9A 3H70A 4IDHA 3RFUA 2DL9A 1KSJA 2W61A 1GZQA 1GA1A 4N39A 5F93C 3GPEA 4PLKD 1BZ8A 1D6VL 5I19H 4YN5A 3WK1A 1RVKA 3KFVA 4PRNB 1P4UA 3JQ7B 4ICCX 1JIKA 2NVAA 1DHTA 1N0IA 5KTLA 4IGMA 3RSCA 2NXZD 1US8A 4Z0TA 3AZTA 4NQDD 4ZJ9A 3ENKA 3ACCA 5TT0A 3EIQA 3TZBA 5KCZA 2OM5A 1BDBA 1BGVA 3R0UA 1T9GR 3L4CA 1BNCA 1U8TA 4FTVA 3SBQA 1HP5A 1SKAA 4AM8A 2YRPA 2NCMA 1C1YA 4JEJA 4G3XA 2BH2A 5F4WA 1BXRA 3L2NA 4HCDA 1ADQA 1T4DA 5CN2A 1QOZA 3F73A 1GRNA 2D13A 2G8NA 1Y7IA 1J0IA 5CEXA 3GAKA 2V6FA 2YN2A 4MHOA 1BXZA 3NEAA 3BYTA 1EB9A 3UUFA 4KJQC 2PR9A 2B78A 3UGXA 1E6MA 4C7DA 1GU0A 2J12B 1XAKA 2EIMB 1DT3A 4GISA 1VLXA 3KXFB 4YDIL 3OCWA 5CMLA 1L7TL 2AJ8A 3ITCA 4IHKA 2CKNA 4LOLA 4ZYUA 1CDEA 5IHLB 4EJFA 4LB8A 3W85A 3D0LA 4HNTA 4HDKA 5F3FA 4YFLI 4ZK2A 5IT4A 3CX5J 5ITBL 1EA0A 1RMFH 1UODA 4X8HA 3VXRD 1MMFB 1DAPA 1ZCCA 1SZFA 4O2FA 3N28A 3KV1A 1VP3A 2FOLA 4LU0A 3WNDA 5KSWA 2ZWAA 1LT8A 1YRQA 4E2YA 1QFJA 5JSYA 3FXYA 4LX0A 3HE7B 3CRVA 2AK4E 4DLZA 3HPZA 3ES7A 2Y6SD 2CMKA 2RAUA 1V3MA 4AVIA 3E3LA 2FQYA 3G2QA 1GY1A 3GFZA 2GJ4A 3P4XA 3R94A 1R18A 4HKJB 3WS7A 1KMIY 5LBVA 4JJ5A 2AWNA 3T0XA 1T6ZA 4BWTA 5DGHA 2QNIA 4RY9A 1ESOA 4MR8A 3UKJA 4ZDIA 5IS2A 3JQ8A 3D12B 2J25A 3EOZA 5DO2C 1EGVA 4DE5A 5JCJA 4YHML 5JPMA 3BTVA 4P4RB 1CZNA 2WEKA 5EIQA 3KTCA 2NQTA 2X1QA 4JDBA 3QQ1A 2AQ1A 3JWDH 4EB6A 1YEIH 4YRJA 2VP3A 1DWGM 3DMYA 1XWFA 5IXSA 2XFYA 5IDIA 2A0LC 2X4TA 3IT8D 4IYJA 1QTYT 2ZSEA 2DPMA 1KBVA 4K36A 5FP0A 2IPXA 5D1XB 3U61B 5LA1A 3PPWA 3E1KA 4XNBA 3TWCH 3B0VC 2PTTB 3W22A 5EBLA 4XYEA 3CTLA 2WTPA 3B3IB 3DPBA 4D56A 25C8L 2ENWA 4MAYA 4YBQC 4XCCL 1AS2A 2W8BB 5GS0L 1VXOA 4F5WA 4KDTC 1QNSA 3C61A 4N6QA 2DQTL 2E4TA 2VLRB 3N73A 4A22A 1XHEA 5ALNA 3P5BA 4GI6A 3VX0A 4TSFD 4UHJA 2APTA 4DN4H 4FALA 1BLNA 2NV9A 2BNRB 1EAOA 4KWEA 3FFDB 4QRPE 3D9QX 4BNIA 1S39A 2QPSA 2OK0L 3SY6A 5KI6A 5D1ZI 4DEYA 1DADA 1IN8A 3CZFA 3IEUA 3SPXA 3BHJA 2YC4C 4AIEA 1TTFA 4JAMA 4U1LA 2QSQA 1TZ9A 2TSYA 3GC2A 3RPDA 2VH2A 3EOSA 4U1NB 1CF8L 1QOXA 3ABQB 3B2NA 1U8KB 2UY4A 4QXOA 5JH2A 1NWRA 3B5EA 3OP1A 5FWNA 1XTVA 3WXWH 1NBYB 4AEOA 1EUUA 4WI5A 2FDXA 4BP9A 3MWCA 2FZ4A 4I36A 1KDYA 4QQKA 1TZGH 2HYIC 1QWOA 2X2PA 4WJZA 4GNKA 2WINB 1UKOA 3DV0A 2R6R1 4DPAX 3UGJA 4ZW3A 3TZVB 3WLAA 4QG3A 3G17A 3C6BA 4D71A 3SCMD 4TXVB 2F1HA 5U9CA 3L54A 5C6TH 4H6XA 1G21E 4LSRL 2OVBA 3S37X 4WRRA 4HGWA 4ILSA 4DJED 4B3MB 1MIEH 2ZVPX 1KDIA 1KXVA 5JSZB 2DFAA 2YBRB 3ARSA 2C94A 4OQPA 1J8YF 3FDXA 1U1GA 4LO9A 5D85A 3CHFA 3VACA 4CILA 4OVXA 1OD6A 1O94A 2ADFA 1AQFA 5CP7B 1ZUIA 2P49B 1G9ML 3AR8A 2FHPA 3NZHL 4JT2A 4XOCA 1A5SB 3ZVRA 2WXJA 3THSA 1Z5VA 4Y2GA 5F2IA 1BVLA 2P5EA 3IOYA 3KPMA 2LCQA 1EIBA 3PXAA 4X0KA 2DLHA 2XTLA 3ESPA 2ZUEA 1YNKL 2XRYA 1POXA 3NCCB 5JADA 1GGYA 2I4LA 4NG3A 1M71A 4ROTA 3EF1A 3AUJB 1ILEA 5C31A 4EG7A 1QNFA 4UUQA 1AW5A 3L81A 1OOEA 4G8JA 4TXLA 2RIKA 1FHVA 1JPGA 1FWTA 4NUJB 3I6MA 3IU4L 1SW3A 4LSGA 1F7UA 1GKKA 1ZT4A 1JG6A 1YE6A 1L9TA 5CN1A 3DTVB 3S28A 5DMNA 2B94A 3LUKA 1UM9A 4R4FL 2UVFA 3PJSB 3WYBA 4DFIA 1AM4D 2SKDA 4Q4CA 2PGRA 1UL1X 1JN6B 4IMPA 4DZ8B 1Z8AA 3VNIA 3OKKA 3GLSA 2K6YA 2WNGA 2J4WH 1JGEA 4G8GB 1V5IA 4HVAA 2RMKA 3Q3JB 3K9QO 3RJ9A 2D74A 3SDXF 4M8QA 2FI1A 3H3BC 3L77A 4ZCTA 5EN4A 1GG9A 4D0NA 1US3A 5DN9A 1TZJA 4W8OA 4AW9A 2WC1A 2DLEA 3W76A 4X7PA 1WUFA 5I7SA 2YMQA 2PYFB 2J3HA 2E7CA 1NXPA 2FWOA 4NCKA 1IHIA 1BF5A 3CKLA 4TSBH 1HFWA 5KC9A 4WJKB 4C55A 1KJJA 3OPYB 4NILA 5CDHA 2HN9A 1LXCA 3S2FA 4HKTA 3QVXA 5I82A 3VJLA 2WIFA 4Z4FA 1A3QA 3DAYA 4TLKA 1LSOA 5HGBA 4KW2A 3VCLA 1R6WA 4DJDA 3RX3A 1N36B 5F89A 3AYSA 2V2XA 5DDHB 4KV5F 1EFZA 1HL3A 1CLOL 2NY1C 2WLIB 3H8VA 1ZD4A 5HK8A 1TUGA 4GLBA 4W68A 2R2HB 3TGPA 3GG2A 5LXEA 1TE6A 4UJ5A 2BGGA 3N8KA 1L6GA 2YMXH 1XKJA 3B13B 3L5JA 2CUIA 5EZQA 3V6FA 1FUYB 5HJ2A 4N8DA 2ESVE 4NKDA 3A9WA 4M4SA 5HVHC 2QQGA 5DHMC 4FNLH 3T77B 3RY6C 1HPLA 1YUBA 1BU5A 3UXMA 1P4BL 3VA8A 1AGRA 4I13B 3SW6A 3NETA 3MBXL 3VGGA 2GZ3A 3D1LA 1T8WA 3QF4A 3B3BA 1MAHA 4TNVF 1ECGA 4MFDA 3MWDA 5FEWA 3WSQL 1OB1B 1OX4A 4ZTBA 3ZO9A 1MB4A 4KO4S 4LNHA 4JC0A 3IB6A 3JALA 2VN7A 4FNOA 4HWPA 3RYTC 2XFGB 3QH4A 3GJFA 1JEYA 5DCWA 3FQNA 4YSCA 2Y25A 4R7XA 4LIPD 5HJEA 4GRWH 5DW3A 2VUIB 2QY9A 4DRXA 1Z18A 3FLAA 4L3OA 5FYKD 2VYOA 1Q9LB 4BNDB 4FCHA 4RRPA 5DHVH 4FFYL 3AALA 5KMYA 1Q0LA 4XTCS 2F64A 4TSFA 5K33A 4ZUWA 3NL6A 4F3YA 2RH9A 4L8DA 6NULA 4B74A 5I5GA 2R56L 1LD9A 3OC6A 3PGDA 5IUJC 2PSNA 1SUSA 2OZVA 3IUYA 3G5TA 5SWSB 1CG9A 4ESHA 5TNVA 2ZUXA 3VR2D 5I3ZA 3SSZA 5KEIA 4E9LA 2QVTA 1KMHB 5BSRA 5CUSL 3W28A 3RUGF 3RZCA 1FZOA 3D4LA 4B4UA 1E6NA 2IYVA 3TCSA 4P38A 2D06A 1XJWA 2CVOA 3INNA 3JS5A 4YIKA 5CT6A 4FQQB 2PYEA 3Q15C 1USZA 2C3OA 1CLEA 3TPCA 5FRDA 1IKFH 4P36A 3H9SB 3WZLA 4DLXA 4P5PA 5C0CE 4EVNB 4JM2B 2ZR0A 2NY5L 2DWEA 2VN4A 2EDHA 1MQQA 4GLJA 2A9JA 2OCGA 3M9YA 3KSMA 4PNEA 5EA2A 4GQBA 1RPQA 1AB5A 4M0MA 2XUGA 4QYOA 1DLHA 3UT6A 2BSDA 2BVQB 3MMXA 1F8TH 1F00I 3GMPB 2NIPA 3QORD 3S4YA 3WK6A 2Z8WC 4UZGA 3K81A 3MROA 2C7GA 1ZT4B 2SODB 1JNDA 1ONSA 3HMJG 2G3FA 2BERA 1NOFA 5GZOC 4M7PA 3THMH 2B81A 4A6XA 2O2IA 5JZ7D 1WS6A 4FDMA 5EGNA 1TFVA 4M6PA 4LOEA 3JQPA 1HMPA 2YMMA 3VR6A 3CFCH 4O58H 4ED9A 4A68A 2ESVD 3TA3A 1BGXT 2YFNA 5I1KH 1TYDE 2HD4A 1BJ8A 4ZSOA 2R7KA 4MI6A 3KVPA 4X0KB 4RSGA 5KYWB 3L8ZA 4IF6A 2BK8A 4ZU3A 2OMXA 2VHUA 3EWSA 3RD5A 1ZLDA 4DM1A 2PU5A 1UZMA 4HU2A 2P5YA 5AUMA 4OHMA 1LRTA 3BB1A 3G1FA 1U2ZA 1EGJA 3TNMA 3NC0C 3W77A 1EGJL 2DZXA 5AB9A 4DCNA 4KQGA 4ZWNA 3B1WA 4INJA 4X99B 1II8B 1RHCA 5A0VA 4J4PA 1NF2A 3R7NA 1PJLA 2FZ9A 3CYFA 4AWXA 4UKDA 3R2GA 2QCMA 3MBOA 1M2WA 2IYTA 2QN7A 3LVEA 3A4VA 5CZ0A 4OOEA 2RDMA 4E9TA 3VXME 4LC8A 1J4AA 4GG6B 2O6EA 2H0QA 4TLBA 3DM9B 1AF7A 2HMSA 2Z2AA 4CSSA 1XCQA 2WF5A 3FTCA 4V2XA 5CK5A 1D8AA 3NAQA 1KFBA 4DRSA 1XMWA 3C09B 3H4HA 3BWUF 1KFEA 2WINI 2VLRE 1DBTA 1SXSA 5DSXA 3V6OC 4Y9SA 1QFUL 3B9VA 4XVHA 4XJXA 2BMKB 1Q38A 1NEZG 2EEXA 5DX8A 2P4EA 2XI9A 3AF6A 2CLSA 4KWHA 2EWMA 3C2AL 3OWEA 5HVFB 3KYKL 5J23A 3QUMA 3CZSA 1MJJA 1YACA 1L4IA 3TQFA 4BS0A 2W2TA 3PK0A 3LH5A 4B79A 1ZJJA 2NM0A 1KACB 4XZIA 5EKXA 4OIBA 4ZVNA 2M98A 1MJ7L 3PWVA 2NY3B 1WV7T 3TEZA 3LIUA 1MFDH 4LSVL 4UTWA 4XNYL 4C4OA 3FFDA 4OQXA 3FRUB 4MV1A 5H9VA 1BLNB 3LVQE 5KW9L 2HFGL 4Z7QB 3QBDA 4AQYB 5K9JH 3EW7A 3NHFA 3QJFB 2AJYL 1A7KA 4PMZA 1Y4SA 3VQLA 5B4TA 4N2HA 3QY0A 4RVFA 3BP6B 4D8PA 4EPTA 2ZOLA 1A9BB 4L5BA 3KQLA 4CIBA 4LY0A 3HE6B 4FR0A 3U13A 1SA0B 4S3GA 4Z2YA 1M6UA 3PWVB 4CCCA 5FPQA 5INDB 5D1XA 2Y0PA 3OGCB 4XPBL 1USVA 4OFZA 5G2WA 2UY7A 2JTYA 4L48A 1FG2B 3LKQA 4OJKA 3DO5A 2V7BA 4OSPA 1IOZA 1SRQA 2B4QA 3HI5H 1U65A 4CLHA 2HUNA 3AVEA 4KO8A 1RMTA 3KSZO 4LSQH 4N9GA 4Y9OA 1Z4LA 3GFFA 3TNLA 2FFHA 1IXQA 4QAQA 1F5SA 1BZ9A 3RUFA 1B4JH 3IN0A 4BJ6A 5IMLB 1HNGA 5ES4B 4MQ6A 3H9GA 3VZRA 4L3ED 3HLAA 2JLYA 3CHSA 1UMCA 5AW7A 3N39C 1IT7A 1OSNA 1ORSA 2R1WA 3IEPA 1TPUA 3CXDH 1KMMA 1TT5A 3MP4A 1L5ZA 1PZ5A 1QATA 1IWOA 4PY2A 2FTKE 3ZK0A 3QLTA 5AZ0A 5BRZD 2IPMA 3BYYA 1FCVA 4BVJA 4G4SO 4JEMA 1JQXA 2AEIT 3W9ZA 3FUVA 3W3AD 1HSBB 3R89A 1RHRA 3FPGA 1L4MA 2BSRA 4YRCA 1L9XA 1PZFA 3V8QA 1PLGH 4NO2A 3NZSA 1NBOA 2PGOA 3HBNA 3RFZA 4Q8MA 1XVUA 5DLEA 2H1XA 4HB3A 3ACBA 5BWNA 4A7GA 2CYCA 4RACA 2GPJA 4QOKA 3UWWA 2ODTX 2Y6ZA 2HQAA 5D7IE 1I85C 3ABSB 4HK6A 1XDGA 2YWGA 4P5KA 4YONB 4IFBA 3T7EA 1WCQA 3P3TA 2DT1A 5EYWA 4ORGA 2XMSA 4L74A 2D00A 4MDYA 4XSMA 3H54A 2PGWA 1GAQA 3ULUL 5LIUX 5FR2A 4GUAA 4H5SA 4OCSH 3W00A 3HU5A 4BP8A 2DZDA 4A0QA 5FGCE 3MOBL 3E80A 5J1SC 4ENSA 2CKBL 4F4HA 4RH0A 3MN1A 1RVV1 1EXUA 4X0VA 1U83A 4GY1A 5CN3A 4HYRA 3RU2A 1Q20A 3N6YA 3KBSA 1M66A 4M7LL 5JIHA 5E1HB 1OAZL 2G77B 1VCMA 3OTHA 5IJBC 3QN3A 3D7SA 1Z3GL 1JTVA 4N2YA 1N2EA 1L6XA 4ELKB 2V7TA 1HINL 5B7PA 2I4NA 3OF5A 4LVCA 4N9GB 3IGLA 3SKUD 2Z5FA 1GJPA 3IUSA 3PFQA 5F7DB 4ITVA 1RQPA 2V2WB 5AENA 4KH0A 3V3WA 5FOSA 3QKSB 1DR9A 3I6LE 2GYVA 2BVPB 5LIXX 2IBGA 4XMKH 1BDHA 2FG7C 3VX3A 1RQ2A 2HJPA 3DVIA 1KI6A 4C58B 4BFWA 4ARSA 1MHEB 1LL7A 4PCUA 2H2IA 2AK1H 1PG7H 3D39A 3GUYA 3D85B 3U83A 1ZAKA 3AHGA 1H50A 1ECYA 3KSDO 5GGQL 1J5PA 3FQ1A 3BLDA 5IBTH 2C4TA 3SQBA 1U0FA 5HHXH 4PJ7F 1N59B 4Y3UA 3VB9A 1NJ9A 2ADFL 4LBAA 1LILA 4J8PA 1Y8CA 4YAEA 3ICQB 3ZEAA 3FRUA 2JFXA 4QRSB 4X8OA 1MB0A 3VPSA 1Z12A 3IPCA 4GIOA 4WO4A 3LLVA 5B30A 3M46A 2RGUA 4BOYA 3OZPA 1NSFA 5GGRA 4TTTS 1B4EA 5HUOA 1V8PA 4PC1A 4HX9A 2HN7B 2HVOA 2B2NA 5C1MB 3CJTA 3RBXA 4GSUA 4X20A 4IHQA 5A2CA 1Q0EA 3FPSA 3TZVC 3FUJA 3L40A 3APTA 3CQ0A 3KD3A 3H3XA 4BO5A 4MW2A 2UZ1B 1FQJA 2W5PA 3TUZC 4S1SL 5A6LA 4UYQA 5T1KB 2XYQA 3WQEA 5GS0H 2ZZ2A 2W6JD 2M32A 1WS8A 4A15A 3AJDA 1KNWA 1H1DA 5CPLA 1CGSL 4XASA 2EUZA 3GQFA 4Q9BA 3GLFE 1LRJA 2WM8A 3LVRE 1JWMB 1TKWA 3MXVH 4G26A 2MTPA 3BCHA 4RA9A 2H3KA 4FW8A 1HIZA 4JFEB 1Z4JA 3BGWA 3HEMA 5FJPA 3HPSA 5K2MA 2IS2A 4H7IA 1TOAA 1EEZA 3NPSB 1E1MA 4YSRA 4ODHL 3F2CA 3FNQA 2ARWA 3H7BA 5JDCC 4UPDA 5IW8A 4JVSB 1ZMBA 3ZKWA 4PJFA 3VU1A 1BYAA 2EFDB 1ZV2A 4UEKA 3HG0A 2WTXA 4C06A 2YXXA 2GSGA 4NP4H 4QLRA 2VO1A 5GIOE 1XHHA 2XUQA 3O4RA 1SVOA 3TNMB 1TF7A 2F8XC 2AFHB 1XEXA 2E9JA 3PXLA 4C04A 1XS2A 4HGMA 1I80A 4ZEPA 3TV3L 3EK2A 3ZOAA 4BD4A 1HHJA 4MUNA 2WIAA 4IQ8A 3SOPA 4B5VA 4ZX5A 4Q1EA 1GV0A 2O7NA 3C8MA 1KM1A 3GPDG 4KI5D 1OLXB 2ZKIA 5ADHA 3E3HA 1VL2A 1FYTE 3ARGB 4URWR 3RK0A 4KI1A 1Y42X 4P5DA 3JV0A 3AVTA 5HUQA 4L1SA 2PWBA 1QXSA 4HZ8A 2H9GA 2C19A 3ZTJH 4IRJC 4KO9A 5GGVH 3X13A 3WK5A 4ZRNA 2X1PA 3NSXA 4JL5A 5T4HA 2FSFA 3T1QA 1F8YA 3DDUA 5HYJD 3JUGA 3NZHH 1U1IA 4UINH 4MV6A 1CEEA 1IBYA 5AKZA 4MAYD 3PXJA 3C5CA 1ITXA 5AKQA 3WBKA 1ZANL 1QCDA 1E9PB 2GNPA 4DO5A 3VKCA 1U42A 4HPOL 5I5IA 2A6KB 1GOHA 2WIDA 3O83A 4JAVC 4C4YA 2HK0A 3IDSA 1DBKH 1Y8QB 3I2FA 1U4EA 3FQRB 2ZRWA 4EJSA 3SOBL 2R4TA 3V0HA 3VR1A 4C7OA 5DXJA 5AKHA 2XRFA 2ZQ0A 3TA6A 2FMHA 3R41A 1UEMA 1VYRA 3DP7A 4EO5A 1XD9A 1UC5A 3P2EA 3LB6D 1ZJHA 2ASVA 2QDEA 1ZU4A 2IBZY 3UBMA 2PYIA 1XEXB 1L7XA 1DFXA 3JRXA 1SJHB 2W6ZA 4MWCA 3GDHA 3JXEA 1LP6A 3OAUL 4CNUA 2YUVA 1XQYA 4EUSA 2P2GA 2NX9A 1H3NA 1G8SA 3WTVA 1KJ3H 4LLYA 5E00B 5HPMA 2QULA 1U7WA 1SC1A 1JRHI 4MOZA 1B0GA 1A5BB 4R98A 2QFRA 4KXNA 2IYPA 1N7JA 3MFFA 1A53A 3PRYA 1PQZA 2Q0SA 3T7JA 1GNXA 3MP3A 4X1YB 4FKZA 4G5ZL 2OHGA 2AYYA 3TSBA 4ZX3A 2YXNA 3QOXA 3QC0A 4LH8A 4Z0BL 3CRMA 3T4AC 3GCDA 3N74A 2C5SA 1R0RE 5G4KA 3U3JA 2A6IB 2UXBB 3S9YA 3H2OA 3H7RA 4WUUB 1XZ8A 4NQEA 3T42A 2JXMB 1NNLA 2YNMC 3G7SA 1NAMH 4JVUA 1PLKA 4Y4FA 3CLTD 1XBTA 1DCFA 5A43C 3MBDA 5IJXA 1DE5A 1QJ4A 4XB7A 1EX5A 2X1HA 5K0BA 2W81C 4XAPA 1M2OB 2G95A 2TRHA 1P9WA 3TFWA 5D7LA 1XSEA 4H41A 1IH8A 4X2RA 5DN6A 2Y7SA 5TFSH 1XG4A 2GLTA 4F40A 4EBFA 4TTDD 2VW6A 1MI5D 3WKCA 4I48B 5EA0L 2XEXA 3X12B 2VVTA 2R9VA 1HT3A 3E9NA 3VOBA 1QIDA 2HJGA 4OAPA 3N05A 5HBRA 3FCYA 1ADQH 4Z7UF 3SRDA 4CDHA 4QEZA 3PUUA 3VYNA 1FFOA 1T9BA 1CLYL 4ZUTB 3WKML 5GP1A 5IROA 1QS0B 3BP5A 3KUDA 1I2DA 1I9CB 3KRZA 3QM1A 1F45A 4YCDA 2OL3L 1W2WB 2LLNA 4WO0A 2MTAA 3KXPA 4XCNA 4YSOA 1YL7A 2X4RB 1AO7B 4RTMA 3HQPA 3TO4A 2C6QA 1KEZA 3ZWXA 3DHFA 3KWMA 1C9MA 5KSOA 4FQIH 1WDDA 5LZ9A 1UD3A 3QPYA 1ZHLA 5HHNA 5LXTF 1I1HA 2JJ2D 4C5YA 2OV6A 1FSKC 3CLUC 2HHAA 1G7LA 3HURA 1L0YA 4XGZA 1AF4A 3VXUA 1W6LA 2BZ0A 4AECA 2GJLA 1V6SA 1HC1A 2QUKA 1A8ZA 4MA8L 1H2ZA 2FW0A 1FPTL 3L4UA 1V16A 1HL7A 2PL1A 4L6IA 3W04A 4DVJA 3BZ5A 3HN3A 1ZRMA 3DBRA 2J3DA 4WHTB 2REBA 1X9UA 4IX9A 4HX5A 3HSSA 4FBLA 1GL9B 8CGTA 1TJYA 4NL1A 1XNHA 3QTBA 3ZU2A 4B76A 3CJPA 3W1MA 1KTVA 4L0YA 2BGQA 2WO5A 4M3HA 4N68A 2ADAA 4C1NB 4TQHA 4Z2JA 4U5KA 1DORA 1JCMP 3W90A 2G82A 4GZJA 2QP9X 3GU1A 4AYID 1A1MA 3OCYA 5AI9A 3N85L 3JY6A 1MEEA 3HMXH 4Z0JA 1G8KA 1R74A 3RGVD 3ELDA 2Z25A 4K73A 5REQA 1R2TA 4B50A 4GGMX 2OEJA 4D9JA 1KZ7B 2OC4A 5ACMA 1BX0A 3WIFA 3Q8MA 4DXDA 2QL6A 2KZ1B 1EJSC 3HV8A 3B3QA 2Q10A 4JFHE 4PVMA 4O0MA 2AN5A 3ATZA 1AOXA 1EX7A 1CU4L 3FXAA 2XGMA 4GW5A 1T3FB 4IG2A 1OCEA 5H1WA 5I8EA 3ZGOA 1HEJC 2MHCA 3LD5A 4QNPF 3DE7X 2WSLA 4BTVA 4OQDA 2GUUA 2P2ZA 1AHWA 4ZHQF 1GS8A 1ILWA 2PD9A 3QNMA 4WA8A 1CI5A 3MXOA 2WABA 2BCJQ 1UJ5A 3V1MA 2OYLA 1S7GA 2OYSA 4FE4A 3KJ6L 4EKDA 3T3PB 4UEQA 3QH2A 1M7UA 5A16B 3WBFA 1INDH 2W91A 4PGDA 1RADA 3OKYA 1JCJA 1RRGA 4FMDB 3NACL 3KHUA 4Y88A 5FX2A 2WD8A 3Q1EA 4S1RH 2C77A 1MCWW 5IC6A 4HH1A 2HJKA 1UOEA 4DJTA 4H3HB 3PRHA 5CIPH 1PFYA 1PMYA 3NJVA 4QHRA 3VYSB 1X9QA 2CV0A 4D97A 1VHWA 4AJ0A 2EP8A 2G9QA 5E5UB 3TVAA 5D2NE 1GLGA 3B9PA 4YDLC 3P69A 4M8RA 4OJFH 3M3PA 4ZQFA 2X8AA 5CPSA 4QHKI 2R5NA 1XLWA 3CM0A 4OZOA 4HZLB 4WEUD 5HYSA 1Z17A 5ILTH 5CILH 4L72A 1GZQB 1GEHA 3G9QA 1PL3A 2XUWA 2CC0A 1KHHA 2BR5A 3G7TA 2IP1A 3KSUA 3VRIB 3QELB 3ZLQC 3Q5DA 2W60B 1PE1A 5ADOH 5CDTA 3RV3A 1B0RA 3PAOA 5JS7A 4P4KC 1JZ8A 1T26A 4UUBA 5ISZD 2WLMA 3OW1A 4M54A 3DX9B 5HY9B 1RJGA 2W3ZA 5BW6A 4HZ6A 1G7QB 3V95A 2PH1A 3A0RB 1LI7A 3BZJA 2ZRYA 4A0GA 3F58L 1VKNA 2X4GA 3HV0A 1UP0A 3TYEA 4G6KH 1OE0A 4IOMA 4S1DD 1ZHNB 5DT7A 1RZJH 3S1UA 2X2OA 4PJ8B 2PX0A 1IE5A 4C3VA 5M34A 1A49A 3IWUA 4XMVA 1UK8A 2JEZA 5DRXA 2F2HA 3QR3A 3Q3VA 5DU2A 2VHJA 4LSDA 1Q1ZA 5DEGA 5IK3A 4NYJR 1G4RA 3CQFA 4U3XA 1TT6A 4NQXA 4EY3A 1WQ4A 1W4RA 2AG8A 5T5FA 2JB5L 3UPRA 2FKPA 5EFIA 2HFGH 4MJJA 2HTKD 4PYGA 4RO0A 4IKKA 1NWPA 1J2EA 3P96A 2PLWA 4U2ZA 1D0SA 3A9TA 2W0UA 4KREA 1IYXA 3SZLA 4GYFA 4F2ME 4F8XA 1NL0H 1SCJA 3ZXSA 4WFED 5LUBA 1D8CA 2QGCA 1UB5A 4Z7QF 1KTJA 2DLFL 4AW4A 4PYSA 3OA2A 2FRXA 2TS1A 1H9BA 1BVUA 2EC8A 3GLKA 3H1FA 3CFJB 2PE4A 5KSWB 4L9ZA 5L3VA 4HDNB 4PUBL 4KNQA 1AP2A 2WFMA 3EJCA 4Z3TA 3W11D 3SMQA 1U33A 5J1AA 1O7SA 2ID9A 2EXOA 2E5LB 5F7FA 1XAIA 1WBYA 4JZNB 4GZLA 4GQZA 3TF5A 2D7NA 4W9MC 4J3TA 1GTJ1 2GPSA 5MP6L 2ZT7A 1T2QH 3EZ7A 3TQ0A 4BNTA 2O3QA 3OPZL 5JXED 4Z7VA 2VXTH 3CSTA 1CIVA 2P4SA 1E28A 5I2IB 2QPFA 3HYTA 1W94A 4F9DA 3K9HA 3V16A 3WGTA 1E2VA 2FQDA 2OHFA 2WJVA 4FOPA 5HUPA 3STCA 5CFRA 1BFVL 4RV9A 2WYVA 1QTIA 2YBTA 2IY7A 5JCOA 2VRJA 3UZYA 3IP9A 4DUOA 2C2WA 2COVD 2FR4A 1V93A 4PR4A 3A6FA 4FFVD 4HV8B 3PUHA 4YV0A 4XZMX 1CDUA 2DWSA 2C13A 1JLMA 3BBLA 1VKFA 3TSDA 2H32B 4KL8S 5ID0A 1OF2B 2W00A 1KJ2H 3AHJA 4M56A 1FZQA 5LZ7A 3GZKA 2PT7A 1L0QA 2VD8A 3OOQA 6ADHA 3FHQA 4JXXA 1XPGA 1OGAB 4WBNB 1M42A 4RPIA 4MWAC 1KGCD 5ABHA 1AGDB 2G2RB 2YZ2A 2Y7DA 1S7CA 4IOKA 2XV3A 1JK9B 4LE8A 4NDZA 1QW8A 3GJSA 3FROA 2Q3CA 4XXCC 3HMKA 5CZXC 1BMFA 3S40A 3TYCA 3NV7A 8LDHA 1JQEA 5EOQL 1UBJS 2ZOKB 1NVEA 4S1QH 3Q9NA 1LL1A 3S97C 2OPHA 2YOGA 4P46D 3TJPA 4G2AA 3PC4A 1T8XA 5LNUA 3HDTA 4WGVB 2CCWA 2CHQA 3IFLL 5G4LA 1VRSA 2IALB 3R3YA 4WHCA 3CL6A 3W6YA 3CLRC 5C0FB 1EJ6A 4F96A 2XITA 4ZUWB 1RTTA 3Q8XB 3GBNL 4HR7A 1CUXA 4KUZL 4Q58C 2Z0IA 4YACA 4NCBA 4HKZB 3C3MA 3QBTB 5G2NA 1LSUA 3HKBB 4TLMB 4TUYF 5LA6F 3TRHA 5J3HC 1INLA 5TGTA 1HWHB 3F3SA 2C9AA 3WGQA 1PFWA 3ESYA 4YHPA 1OF6A 2XTSA 3RIAK 1O1ZA 5IMOA 2DPLA 3L06A 5L7TA 1IRIA 2DP3A 3IC5A 3MX0A 5ALBL 2AZ4A 1FJ2A 1OAQL 3OEHD 4BCBA 4RIFA 4Z4GA 3R0IA 2DM6A 4S2SA 5BW7A 2QE6A 3IJ7A 1A7QL 1UKBA 2Q3LA 3BWCA 3MREB 3GLHE 2QG4A 4FNQA 2R97A 2VXCA 5CLGA 3GYRA 1GWJA 4WKGA 1ICTA 3QW9A 2EH8H 3IP6A 2CXPA 3FSTA 2V9PA 1NP3A 1ZA6A 4NJ9H 4KP7A 3K0BA 3PDHA 4FKMA 1NCOA 3SM0A 3KALA 1YY9D 2MSDB 4YJKA 1WA1X 2X0VA 3OJDA 2GM3A 4B4WA 3W7NA 1PEAA 4JG1L 3WRYC 5JDSB 4TMWA 5KVSA 3PPGA 3GHRA 3PFNA 2CCLA 4S1TA 2COUA 3KPSE 2Z2BA 4AO7A 4OM1H 4PJ5D 4OHFA 3W5DA 5HOQA 4GOJA 3MS7A 1KS2A 2MR5A 2ZXWB 1PJZA 3P0EA 3ZIYA 2RUSA 3GW3A 4MI9A 4OQMA 5BWLA 1Y89A 4IDFA 4BXVA 4MJ3A 1UT8A 1ST2A 3PC6A 1NSJA 3BOXA 3EBIA 1QVZA 4EW1A 2BVWA 1IXSB 2K0RA 1H9AA 3H6HA 2X8JA 3UUWA 2VT3A 5AI6A 4J76A 3TQRA 3EH2A 2G5BB 1XF1A 3H1BA 3CAWA 1CGSH 4C4BA 3L8QA 3SKMB 4JFHD 4K1GA 2CDCA 1JPEA 4XFJA 3EVCA 2YPKB 5I48A 1GPBA 3AZQA 1M9WA 4IDJH 2RGLA 5A7HA 4HKBA 1B7GO 4I48A 4WW0A 2VMCA 3PUGA 3C0QA 1FGVH 3T5CA 4IG9A 3OHXB 1ONQB 3T0EB 1KORA 4JLPA 3HBPA 2JRLA 1KOJA 3L04A 1XMJA 2V6GA 1QONA 3AIIA 4HSGA 4I6KA 5CLXA 2ECPA 1DVSA 3D85D 4N3GA 4FG6C 4JX5A 3CV7A 1QABA 1P4JA 1MUUA 3KKQA 1DRUA 4HWEH 4X95A 5I1JL 5DD6B 2Q2WA 5EIHA 5L9DL 1XR8B 2V7UA 5IULC 5M5BA 4I3SH 4LESA 2J7LA 3MUXA 1NCWH 3ZTDC 1YQUA 4Q9AA 2MIZA 1SBBA 3VMFA 4NP9A 1KFLA 1BOYA 1PCXA 4MB2A 4O54A 3Q9QA 5KSAA 4DMLA 2R2CA 1LK0A 2VKQA 1J8HA 2FVNA 4WESB 3UYPB 1IONA 5J58A 2QVGA 1BGGA 4P06A 3BS4A 4ZCLA 2BVOB 1NEPA 2FH8A 4XRCB 4C1LA 5IK2A 2ZB7A 5AC7A 3SN6A 2O61B 1QFOA 1JGDA 2CL5A 2H48A 3WMFA 4BFZA 4WECA 1FO0B 1Y5VA 1QFWL 1WJGA 4IH4A 1E8XA 2IEPA 4KH2A 4BVLA 4HJIA 4F8QA 1VRXA 1B3IA 4WY8A 1IAIL 1YEDA 2QXYA 3C97A 3PGLA 3TBKA 4ECAA 4LSPL 5LP6B 5GJSL 3WHE1 3ZVNA 1R47A 1JZHA 3W53A 5JDCA 4JKWA 3L1HA 2PL5A 1QZ1A 1FWDC 4EJSB 1WULS 1U3YA 4AFNA 3F01A 1C7QA 3HR4A 4L5JA 1IM3A 4LI0A 4OP1A 5AHMA 2JAQA 4LRIA 2JSFA 2GPWA 5KNCH 3SVTA 2ICWA 2B4AA 4NZUL 7GPBA 5EU7E 2AXPA 3KLPX 1TE2A 1IPFA 1OH6A 4W8LA 1PQWA 4GXRA 1O5OA 4PJXF 3ULVH 4FJYA 1QAPA 5EU6B 2MANA 3GR6A 5GJNA 4L2IB 1KSGA 5E8EB 2H3XC 5JROA 4CKCB 5KWJA 4RUBA 1G2QA 5U4NA 4ZUUB 4NQTA 1TR7A 3HBLA 4K5QA 2DKFA 1MG5A 2AQSA 3IOBA 5DBTA 3QYQA 3GDBA 5K9OA 2BSSA 3EA3A 2DT8A 3QGMA 4IHAA 5F1PA 5DNYB 4D46A 3ETBF 1IGYB 1QO3A 1XQ1A 4OK6A 2NNCA 4CBVA 4MCMA 3DOSA 3BPSA 2OV0A 5J5AA 4NZTL 1WJ3A 3SZOA 3UCEA 1E4IA 3IEBA 3QIWC 2DOKA 2QLLA 2X2GA 2AQ8A 3I45A 4JGBA 5IFJB 4AF6A 1TTAA 1ZCAA 4RE5A 3FFCE 2ZRPA 1QP7A 6ABPA 2OA9A 5CT9A 4DV7B 4HGZA 4P23D 1TVBB 4WDTA 1E9QA 3TTQA 4AH2B 1WBYB 4PXAA 3A6CH 4GVLA 3GXPA 1X5LA 3QJYA 3TK7A 1ONRA 3QEMB 4DYKA 9CGTA 1HLGA 2JJQA 3UP8A 3GMNA 1EMTL 2WJJA 4G3YL 4EK9A 1MIHA 4FYWA 4NCC1 4NI3A 3E6FB 1C4OA 4NV3A 4DEPC 1Z6QA 4QVGA 3ZW7A 4A2MA 3ZWBA 3CHRA 1ZLUH 2HVKB 3IVTA 4NT6B 5KOJA 1NFDF 1DRKA 1FPMA 2J3QA 3DWFA 1ZOOA 4BMDA 2QY6A 4RZ5A 2R6GA 4G80B 2C0QA 4XI5D 1NF7A 3WDJA 1IQRA 1N25A 3MWFA 3KS6A 2XAUA 1KTDB 5DHUA 4JXCA 2GTWA 2DMHA 4N3BA 4FYXA 3V7YA 3HZKB 5KAQG 4L5FL 3TW8A 3ESCA 3ZWPA 2XVYA 4FR2A 2Q6WB 4U9HS 3MZ0A 2VGGA 1RK6A 2XG4A 2O9PA 3QVGA 4PJ9C 4AZSA 2CERA 5AW5B 1TV8A 4A67A 3GG8A 4OLFA 3QQDB 1MRAA 3MTEA 2QRKA 5ESXA 3EEBA 1RWBA 4LFHG 2EG5A 4TWJA 1XA3A 3SDDD 1ZP4A 3U81A 2X19A 4FHBD 3SKOB 4U1JA 4N5NA 3BG5A 4S1DC 4RMUA 4TLUA 4MDHA 3PV6B 3U7FB 3O75A 3N40F 3IIKA 1IT9H 5CU9A 2BNQE 4XVTH 4IMDA 3P0YL 1P7TB 3EIXA 2OBGA 4YHGA 4EEZA 3F7VA 2UWEE 4DNMA 3EDEA 1AHWC 3X1EA 5LN4A 1PAZA 2B7LA 4HDQB 2OWDA 4YS4A 1E2JA 4QDOA 4MQUA 3ABLB 5C08A 5E3JA 4CRPA 2RC5A 2NTNA 1DDHA 2BOBA 3GLIB 1CUBA 1K6WA 4ODSL 3GRWH 4F27A 4OI1A 1JHMA 2NX5A 1W3LA 3T1VA 1NF3A 1A1NA 1TYBE 3PUKA 2VDWB 4L4UA 3L3KB 5ARCA 3WLPA 4Z0NA 1N6OA 2RHMA 4AY6A 1A76A 1WGVA 4CL0A 5EZYF 1TTQB 4MYSA 3JAWB 4FEMA 5RUBA 1DJYA 5ICCA 1OLLA 1MCZA 5F97E 5CCBA 2ZIXB 1XTTA 5GVRA 4DIEA 1XP5A 1G8PA 5EWLA 4B73A 3W57A 2F8QA 4D9MA 2WIKA 1TQ4A 3LS4H 4ZKEA 4KWOA 2WNSA 4ARZB 2OK8A 5HNNA 3DHDA 2AQ2A 3QY9A 1WG8A 4X7TB 2CLDX 1R8XA 4F4CA 4G0UA 1Y6FA 4CDGC 3LQAC 2F6UA 2W67A 2AOUA 3FFCD 1TZGL 1O4VA 3L07A 3T0DA 1NSTA 4M82A 3W81A 4M9UA 5AXCA 4GRLC 1J5CA 3WUBA 4G6JL 1PGNA 5JC8A 4JW3A 3GJ8A 5FBVB 1Q6GA 4CCDA 3FU5A 4A29A 1XRSA 3S8YA 1O0CA 2EO7A 3SR0A 1TWWA 3F4WA 1Z38A 1KC7A 4JLDA 4X64B 2W43A 2TRYA 4WO4C 2EG9A 1QH8A