4UOQA

Nucleophile mutant (e324a) of beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
689
structure length
683
Chain Sequence
HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMAQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-GALACTOSIDASE
publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
molecule tags Hydrolase
total genus 241
structure length 683
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uoqA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uoqA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uoqA02
2Q8XA 4GE0A 1GGJA 1GGFA 3ZR6A 4GQRA 1CLXA 2F1AA 2WLZA 3W82A 2F8QA 2F7RA 4OGZA 4AD2A 2D3NA 4PMXA 2QLYA 4H8UA 3VMOA 1XH1A 2DSZA 2XSAA 2YBUA 1BVZA 2WCSA 1IV8A 3T0AA 3VMNA 4D1IA 5IDIA 2RK6A 2OYMA 4E08A 2F7PA 4V2XA 1V6YA 2XPKA 2WWCA 3DECA 3AMDA 1UKQA 4AMWA 2F1BA 3W0KA 2XM1A 2ZUMA 3WQ4A 3BVWA 3DDGA 5JBFA 1G0CA 2J47A 3N13A 1E0XA 1XV8A 4AIUA 4AZ5A 1G2IA 3WH7A 1UQZA 3EDKA 3CH9A 3ZJKA 3P9SA 4HPHA 5A2AA 1E4NA 1QNRA 3AIQA 4UTFA 2VNCA 4GI9A 3BH4A 4MGHA 2VRQA 4MTCA 2XF2A 2WKGA 1JXJA 4QYXA 3FHQA 4D6DA 4AD3A 1BSIA 1XH0A 2PWHA 1TUXA 2E3ZA 2W62A 3WSUA 1HKMA 3MUIA 2QHAA 1D3CA 1E55A 1VEOA 4MNLA 1GOQA 3MUY1 1VFFA 1MW2A 3W25A 2E0PA 1U30A 2XN0A 1SY7A 5DT7A 2D73A 4W8AA 2X1IA 4MNTA 4UZSA 1TR1A 1ISWA 2X0YA 2J79A 3CZLA 4JQSA 1KQYA 4RE2A 4EK7A 4DWSB 2VX6A 3D4ZA 5CGMA 1QBAA 4CU6A 4FNPA 4PRWA 3EDFA 2J78A 2XVPA 3I3DA 3TTUA 3I3EA 3GH4A 4AJ9A 2NSXA 2VRNA 1OM0A 2BY2A 3AS3A 3AS2A 3EYPA 1J0YA 1ESWA 3UG3A 1FFRA 1R33A 2EPNA 2EPKX 5DT5A 1E72M 3WNLA 3H54A 1LL4A 3IJ9A 4AIEA 2BS9A 1IZKA 2WZIA 3WF2A 1UD5A 1ZJAA 5AYBA 4J7RA 1IPHA 2VPIA 1QI0A 1QVVA 3BCFA 4H8HA 1KTBA 4K2HA 5HDRA 1CF9A 1J0KA 4N0MA 2YL5A 4TX8A 4AZIA 4D6IA 1HL9A 3CUJA 3CHFA 3EDJA 1E4MM 2WMJA 1W2PA 4YHGA 5CSUA 1E1FA 4WSKA 4ENVA 1KXHA 1UHVA 1UQYA 5ABFA 1GONA 3VPLA 4HCJA 5A8OA 2X2HA 1M7XA 2EXOA 3D3AA 5JBDA 1JD9A 1QHPA 3OG2A 3GTNA 4Y1EA 2RGMA 2ZE0A 1PX4A 2DIJA 1QHOA 2V3GA 1PV2A 2ISSD 1TVPA 4D1JA 4C7FA 1A3HA 4EAMA 4M1RA 1B2YA 4N0RA 5BRQA 2J7GA 4M29A 5BCAA 2FGLA 2D2OA 3IAPA 1GOWA 2YIHA 2QMKA 3AMKA 1GHRA 1VENA 1JYWA 3ARTA 1HT6A 2J77A 2ZX5A 2J8FA 3SEPA 1RP8A 3K8MA 4J3UA 5A8QA 3GXPA 3QHNA 3VKKA 1MW1A 2DDXA 2DIEA 3VIHA 5E6YA 3U5YA 4MTVA 3WDRA 1ISYA 2YKKA 1MXGA 4ENPA 1OIMA 1GGKA 1WZAA 2VURA 3MS8A 1FH8A 4PYSA 3EDDA 4ML4A 4AUNA 4JKLA 3AS1A 2WLYA 3DHUA 3GXNA 2PF0A 1HIZA 3VSTA 3CC1A 1ITXA 1P6WA 2WJZB 1JG9A 1LG2A 3IJ8A 3WMCA 4HOZA 4GQQA 1JZ4A 3ZJ6A 2QPSA 4RL3A 4B9ZA 4OGFA 2R1TB 3ARYA 1V6UA 1A9XB 5E6ZA 3DC0A 3W6MA 3HJEA 3WDIA 1E15A 1CZ1A 2YLAA 3EJUA 4AUMA 5E09A 3VIIA 3QR3A 2OW6A 3L4UA 4E4PA 5I2UA 3MSDA 3MV11 3B9DA 2R1UA 1CENA 2BV9A 4AD4A 3WUBA 3SCPA 3MMWA 5SY4A 4D72A 2O92A 3RCNA 3EDEA 3MANA 3F5LA 5HNNA 4ZFMA 1OT1A 1JYNA 1GORA 4FNRA 2OSWA 1QVBA 1GOMA 3CMJA 5JIPA 4PSPA 3W53A 4HPGA 3DX2A 2PWFA 1PE0A 3D5HA 4B15A 1GQIA 1CGVA 1V02E 3VNYA 3U7BA 5FCZA 5BRPA 1X1NA 1JD7A 2CBIA 1TCMA 4YHEA 1P80A 3WIJA 4CD5A 2D7JA 2YWCA 5A69A 5BXRA 1HF6A 1V6XA 2WMKA 3PQ5A 3W4RA 3MMDA 1QF7A 2CHNA 5M17A 2QV4A 3AMCA 5E0CA 3PQ4A 1OD8A 4ENWA 4P7OA 4BQ3A 4FLQA 1I1QB 2PI6A 1MVYA 1JDAA 2NT0A 4U33A 1AMYA 3FY1A 3UOWA 5DFAA 2VX5A 2XG9A 4PEEA 1QNQA 1E73M 2ZUUA 1R9GA 1I7QB 4AY1A 2YDRA 2G41A 1UOKA 3BC9A 3S6TA 5A6BA 4AZBA 2VXOA 1OGBA 5DEZA 3WDHA 1MYRA 2UY4A 3WUEA 3W28A 2YA1A 1C91A 2DSKA 1C30B 2W63A 4HOXA 3WBAA 2XGIA 3LPPA 5A8PA 1IT0A 2O9RA 3OLEA 1JYVA 4R7GA 1V3LA 4TVCA 3VD9A 2JE8A 4L8WB 1J12A 5GNZA 2ZUWA 4CGTA 1R34A 1OY1A 1BAGA 4CCDA 3VINA 2WCAA 2FE0A 1PS3A 1OD0A 4QLKA 1CEOA 1HKJA 4LRUA 3RIKA 4CVWA 4OKDA 3L2MA 4X0NA 2HVMA 3PQ3A 4XUYA 1DWIM 1JZ3A 3FIJA 2LXNA 1MWOA 4B2YA 1EO7A 1CXIA 5CLTA 2F18A 1BHGA 3N18A 3HZ3A 1KGWA 1Q7RA 4PSRA 1MQQA 4DO6A 4KWUA 4PTWA 3SOZA 3N7TA 1C8YA 1YHTA 1WDPA 2WK2A 3NOVA 2WANA 1GGHA 4Y1RA 4LYPA 4JL2A 5A6JA 1C8QA 2X2JA 3BUQA 1HN1A 1BYBA 3W37A 3WD3A 1HVQA 3WNMA 4L8FA 3UCQA 5D8WA 1CYGA 1VEPA 1W3LA 1DWJM 5TD4A 1K9TA 2Y8VA 3WH9A 2D22A 1GGEA 4P8XA 1WZKA 2NW0A 2FH8A 1TMQA 3CBWA 1UD2A 5HXMA 4QCEA 3UESA 1C8XA 3WQ5A 3TTOA 2W66A 1TVNA 4AIOA 2BY1A 3AYRA 1VB9A 3GBEA 3WFZA 3B8SA 5GNXA 2ZWYA 2AOSA 2VMFA 1V0KA 2X0HA 4J3XA 4CN1A 4OGGA 4MNJA 3CHEA 1EHAA 2BVTA 5JBEA 1ONSA 2J7HA 3AROA 5EBAA 4ZXOA 1VCMA 3VSUA 4Z2GA 2XFYA 5A2BA 1HJXA 5IHSA 2E4TA 4IISA 3NJ3A 2DT0A 4FNSA 1GQKA 2DT3A 4H8VA 3VGHA 3SUTA 4AD5A 1EQPA 1PDWA 2Y24A 4XX6A 4RKYA 4WINA 1C7SA 1XHGA 1PPIA 4PMNA 1R85A 2GK1A 4W7UA 1GUVA 3TTTA 4U5KA 3VDHA 2XUCA 5M3WA 5E9AA 1DTUA 1TA3A 4U5IA 1E6ZA 5ABEA 4OFWA 4A3HA 3O6AA 2G3IA 2J7BA 4WKFA 3IGUA 3PZQA 4PTXA 1IZJA 1NM9A 4NZCA 2YLLA 3HU7A 3NSNA 3W81A 1UUQA 1CGYA 1BQCA 2WM0A 3MI6A 1M03A 2VZSA 3CZEA 3EJTA 1AQMA 1CBGA 1QNOA 5BXPA 1LG1A 1GPWB 3M3PA 4AYSA 3AI0A 3B9AA 3ZO9A 4W85A 4F8XA 3PTQA 2ZX7A 9CGTA 1GOKA 1JDCA 5JUVA 2ABWA 1A47A 2BHUA 5I3DA 3ZMRA 4AXNA 1JDDA 3TTQA 4MB1A 3CUGA 4FLOA 3KLLA 3ALFA 3VGBA 3AZTA 4BZYA 3OGVA 3SCVA 3ZIZA 2VL4A 1UH2A 5DO8A 1M04A 3VD7A 3VIJA 5SY6A 2BXZA 2FHCA 4JIEA 1UH3A 1J0ZA 2GJRA 1HJVA 3WQ6A 3CLWA 3SURA 4PMQA 3BLBA 1VFMA 1V6WA 2YJQA 3IJ7A 5A2CA 3K4AA 1CS0B 2XIBA 2A3CA 1Q4NX 3OA5A 1B9ZA 2J7FA 1E6SM 1W1YA 4W84A 4W7WA 4L8YA 3ARRA 3NUKA 5LA1A 3VUPA 4Z2LA 3CIVA 1TQSA 1W3KA 1JYXA 4BCEA 2JF6A 3EZGA 1W1VA 1ZU8A 1JIBA 4WK9A 4CN4A 1CXHA 1G9HA 1IZZA 3FAXA 2FH6A 1VFUA 3EN0A 2UY5A 3AHTA 4FLSA 3RM8A 1KCKA 5M5DA 3RJXA 1W32A 4NSBA 3ECQA 1EGZA 2D0FA 3W27A 5GNYA 3KWXA 4OQ4A 2ZXBA 3DHPA 3W24A 1K6AA 3P9QA 5IFPA 3AXXA 2F7QA 4KRTA 5A6MA 5KZ6A 1PX3A 1SFSA 2RK4A 8A3HA 1E0WA 2O9TA 4MJ2A 3ZR4B 3HG3A 1TQUA 4ATDA 5F7UA 4A3YA 3W29A 2O9PA 4M80A 4B3LA 1FOBA 1VBUA 3GXFA 6TAAA 2WBKA 4NI3A 3PQ7A 2EEXA 3A23A 3D52A 3K8KA 4CUCA 5I24A 4J27A 3SF8B 1UA7A 4UNIA 1KEEB 4E8CA 1BLIA 1UKOA 4DUVA 3CZJA 1GNXA 2EPLX 3ARVA 2GSJA 4BA0A 4UFIA 3CZNA 4CD8A 5I77A 3UEQA 2CBJA 5SYAA 3PQ8A 1EIBA 2GJXB 2XTKA 3SCWA 3AZRA 2JEPA 5CPQA 1PDVA 4NXKA 1NOFA 5A8MA 3WUFA 3WH8A 1JI2A 1NP2A 4GPNA 4QLLA 4RE4A 3AIBA 1PZ3A 4W89A 3ZOAA 3NDZA 3CZ9A 3MMUA 3DX0A 1EQCA 2JFEX 1SMDA 2E9MA 4UFMA 2AB0A 5AY7A 2BHZA 1UD6A 2ZXDA 4Q22A 4ZGGA 1BYCA 3L7NA 3GH7A 1E3XA 4CD6A 1YQ2A 2V4UA 3GDBA 3K1DA 3TONA 3WQ8A 1L8NA 2IXUA 3CZKA 3MU7A 2R1VB 3BLPX 1UR0A 3LRLA 3VMPA 2WBGA 2Y2WA 4GI6A 2XIIA 2ZWZA 3KL5A 3EWNA 3WNOA 3CHDA 3M46A 4J3SA 1B3XA 4U31A 4B16A 2NV0A 5K4AA 3BAJA 4D1YA 1OB0A 1C3FA 3WD4A 1RD6A 1P7YA 4D6CA 1LQ0A 2J4GA 1RP9A 4WJXA 1E6RA 2R1VA 2BY0A 5I5RA 1W9DM 2YL9A 4B31A 3T2OA 3VD4A 3LXCA 1V0LA 3WL0A 1NWRA 1QW9A 4UOJA 4PMOA 3AMLA 2BNJA 4IM4A 3ZSSA 2VC9A 1CXFA 4MADA 2X2IA 1UWUA 4P8WA 1KBKA 2F7OA 1W9BM 3DX4A 2DGAA 2OR3A 5CQ1A 2IUZA 3DX1A 1E6QM 3WY4A 3OLIA 2A3HA 1QWSA 4HOWA 4MAVA 3EMQA 5A8NA 3BVTA 3CZSA 6CGTA 3AS0A 1LJYA 5I6SA 2YA2A 1KR1A 3LMYA 4F66A 3TTXA 3DYOA 5LIRA 2G3JA 1UKPA 1JDBC 2WAGA 3EMCA 4GXPA 1OI4A 2W91A 4PTMA 1AQ0A 1EDTA 3AIWA 3BSHA 2VCCA 4PMUA 3EJSA 4OIFA 3UMMA 5CG0A 4HU0A 4DWSA 3A4WA 2WPGA 2OLHA 3G6LA 4GI8A 4AZHA 3W38A 1VF8A 4QDMA 4TVUA 3L2LA 3SCSA 4ATLA 1HXKA 2V3DA 2VCAA 2OWCA 1B30A 4MPKA 2X2YA 2J7EA 3VDBA 1VIWA 1OX6A 1VRXA 4AUEA 5IHRA 4KMQA 4ATWA 4JCMA 2D20A 3D50A 1AVAA 1CECA 1DWFM 2WC4A 1Q6EA 4HZ8A 1UR4A 2WVVB 3UJNA 1MFVA 2EPMX 2CCRA 3OZPA 1UD3A 1KFWA 1UZ1A 1HJSA 1OBAA 2ZICA 1HP4A 2BVYA 1WAWA 2VI0A 2VX7A 4HZ7A 3UG4A 1BG9A 4W87A 1IZYA 1P5FA 3N04A 1GJWA 1CPUA 5E0FA 3AHVA 1KB3A 2C8NA 4E5VA 1WE5A 3L4ZA 1XSIA 4WLCA 3CO4A 1EO5A 1T0BA 2XN1A 3BMWA 1DWGM 2VR5A 3AFBA 1J42A 2X05A 2X8RA 2XSBA 3HN3A 3APGA 1T0OA 4AEFA 5HOSA 1QI4A 4PUDA 2EO7A 3MKKA 3WKZA 1VCNA 4HZ6A 4BIMA 1LLOA 5A6BD 2WXDM 1QI5A 4TVDA 1QDLB 1WZMA 4N42A 3OGRA 3GH5A 3WD1A 1JXKA 2Z1KA 4IUGA 3O2LA 1H1NA 1UR2A 4HTYA 1O1YA 1QVZA 1CNVA 2J25A 1J9YA 1OWQA 3KZSA 3VD5A 4N12A 1W3HA 1E3ZA 2OSXA 1X6NA 2J74A 1CWYA 5M03A 3KL0A 1BFNA 2QF8A 2CPUA 1JI1A 1W1PA 3VM7A 1HJUA 2FHBA 4ZENA 4BTEA 3L4VA 3MV01 5D9MA 1OIFA 2VCBA 1KBBA 4FK9A 3NSMA 3SUWA 4MDPA 2VX4A 2D3LA 2E8ZA 3M7SA 1V3MA 2R1TA 4GE3A 2Y4SA 2D24A 3DX3A 4KRUA 5I78A 3VDCA 1UR9A 1C3OB 4FNTA 2WHKA 1HXJA 3UG5A 2W7TA 5EFFA 4YN5A 4P7LA 5JZOA 3FHAA 1HTYA 4YPJA 3TTVA 4UFJA 4W5UA 1V02A 3WL1A 1QWUA 4JKKA 1M6VB 1R7OA 2WHMA 4ZE4A 2ZX9A 3II1A 1KA9H 1ZBKA 3GYCA 1UCFA 4A4AA 1OCQA 2JIEA 1GPFA 3ZSTA 3GXMA 2V38A 3VOCA 3VIMA 3LRMA 2VQUA 4ACZB 1EDGA 1H4PA 1NOUA 3JUGA 1QX1A 2ZUTA 4CU7A 3CMGA 3EJRA 3PZGA 3WENA 3L3BA 1NWSA 2YL8A 4M81A 3FXYA 3PTKA 3WD0A 4AC1X 1U33A 2IXVA 2W5FA 4P35A 3CPUA 5CXPA 4P7QA 1CXLA 3NIYA 1ODUA 4PTVA 4HMEA 4F79A 4XZBA 2V3EA 4TTGA 3PZOA 2E40A 5BYWA 5LA0A 3RDKA 1V0NA 1PEZA 1ZBCA 3OLDA 4NX0A 3F5JA 4U2YA 3RJYA 4AD1A 2WMHA 1HKKA 4CVUA 1M01A 3PZ9A 1S46A 4OUEA 1Q6CA 1K9DA 1DEDA 2G3MA 3D4YA 1OGGA 1UKTA 1HJQA 4S3KA 4JL1A 3G6MA 2XVNA 1DWHM 4DWSC 1V3JA 4XV0A 1HWWA 4IPNB 2EAEA 4V27A 4DM2A 4P34A 4UCFA 3VGGA 2Y5EA 5IFTA 3WMSA 4AZCB 3CZGA 3WF0A 4LQ1A 3WDPP 4LYRA 2XN2A 3AIVA 3AZSA 3MUAA 3PZVA 2VKTA 3M07A 2VZOA 4AEEA 3MGKA 3CUFA 4JFTA 1JL8A 4TX6A 3SIMA 4MDOA 4AZ7A 4UQAA 4P8UA 4PMZA 3ARSA 2XM2A 1U2YA 3NVAA 1PJ9A 1VFOA 1NWTA 2ZX8A 5A6SA 4CU8A 3BWEA 3BUBA 1J0IA 4FLRA 1V08A 1W91A 3L4EA 4M8UA 1B3WA 2RGLA 2ZXAA 1W9VA 5C70A 2WC7A 1L9XA 3TP4A 3LRKA 2AMGA 4W7VA 1S1MA 4DO5A 4ZE5A 3B9EA 3CZ8A 1BF2A 3HG2A 2G8ZA 2ZUNA 4LPCA 2V5CA 4XB3A 2DT2A 1UASA 2VRJA 4Z2HA 4PXYA 4Z2JA 4R27A 3THCA 1D7FA 2YWJA 3BAKA 3L4TA 1UZ4A 3FN9A 1FHDA 1JZ8A 1B1YA 4ZEPA 1B90A 4E8DA 3EFEA 2VVNA 4F9JA 3I3BA 1DP0A 4MJ4A 3EJQA 4PMYA 2EQDA 1GOOA 5I23A 3LPGA 5I0DA 2DQXA 1E6PA 4PMVA 2IUFA 4MAZA 2FGZA 2WB5A 2ZUSA 2EABA 1I7SB 1B3ZA 4P36A 1K9EA 3VGDA 3ZQ9A 3WDJA 1ISVA 1BYDA 1VEMA 1EA9C 4TXEA 3VTRA 3BLKA 3AMGA 3ARXA 2OYLA 1CXEA 3FW6A 2A3BA 4AISA 1H49A 1WPCA 1E9LA 1FP8A 4J3VA 1XSKA 1QI3A 3F71A 4JCLA 3CHCA 2WZHA 2D0HA 2WVTA 2H2WA 1J10A 3BAWA 3VIOA 4NZJA 4UQCA 2E9BA 4W93A 4JHOA 2DSVA 3AHYA 3TA9A 3OZOA 3WELA 2GDUA 2WNWA 3CYFA 1H2JA 1WDSA 3KEHA 4AW7A 2BXYA 3QGVA 4W5ZA 4WSJA 3AIEA 1TQTA 1GVYA 3CTTA 2E9LA 4BS0A 2VT0A 1EDQA 5AC4A 2FDMA 2FYVA 3VGEA 1SOAA 4MNKA 1KGXA 4PBGA 4P5PA 2F61A 1PIFA 3UETA 4BQ2A 3BUIA 4JFSA 3OB8A 4L4OA 1GPMA 1HX0A 1JAKA 3VIFA 5DF0A 3DDFA 3OT1B 1WCGA 2FEXA 1TQWA 1UR1A 2VO5A 4AULA 1OX4B 3VM5A 4CD7A 3WNPA 2D23A 2NV2B 4GO9A 4UQDA 1N82A 1CIUA 4GUDA 2C0HA 2UY3A 3VIKA 1Q2UA 3WH5A 1WB0A 4LGXA 3IK2A 4D6FA 2YA0A 4AMXA 3ZT7A 1GG9A 5LYRA 3T2QA 1W2VA 3ZM8A 1US2A 4ENTA 3A4XA 3CZAA 3VGFA 1LL7A 1P7ZA 2QPUA 1E4LA 3WF3A 2A9VA 4OZOA 4X9YA 4W86A 1JZ6A 3A47A 4M56A 4F9DA 3K8LA 4M82A 1WDRA 5D9OA 2PWDA 3DYPA 4GO8A 2J7DA 4J3WA 1XCWA 1V03A 3RM4A 1TFVA 1JF6A 5HPOA 4FMVA 3BAIA 1BGGA 3L4YA 3FSEA 3B36A 3OGSA 3LPOA 1JNEA 1B3YA 5C8BB 3NCOA 2DH2A 3THDA 1WZLA 1W9PA 5CPTA 4HP5A 3FNDA 5D9PA 1US3A 3VIPA 3SF8A 4JZ5A 2VVSA 3QHOA 3QOKA 5AC5A 3NDYA 4UQBA 1CE8B 3ARZA 4D6GA 2TAAA 1JNDA 3AIRA 3BAXA 5CPSA 4ZDJA 3NONA 3N11A 3WEZA 4EKJA 3NOQA 1GJUA 4DWSD 3R75A 1ZJBA 1WO2A 1G01A 2YFNA 3T0BA 3LXAA 3L4XA 5E70A 1JZ2A 4CKQA 2BVDA 2GJXA 1T36B 4IPLA 1NP0A 1XYZA 3KLKA 1HP5A 5ECUA 4D6JA 1QW8A 3GBDA 1MW0A 4QYTA 4PCTA 2PBGA 3POCA 4Y1GA 4QFUA 4WF7A 5I79A 4ENSA 2W4XA 2MANA 3B3AA 2XGBA 5JZMA 1JGIA 4OOZA 4W88A 2J8GA 2BY3A 1KXJA 1UR8A 1UYQA 1HKIA 4Z2IA 2V3FA 4C7DA 4HMDA 3UERA 3MSGA 1QVWA 1BYAA 6A3HA 2C7FA 3WNNA 4QAWA 1VBRA 1H11A 1QBBA 5CLWA 2PB1A 2BFGA 1F4AA 1RH9A 3CV5A 1KWKA 3QOMA 1UWRA 5A6AA 4PMDA 4LXFA 2Z1SA 1RPKA 4OJYA 2RK3A 4Y0NA 5BV2P 5D8ZA 1UWIA 3RM9A 4H04A 2CETA 1ODZA 3BSGA 2XWDA 2EJ1A 2GVYA 2CIPA 3VNZA 3VX0A 4JHZA 5BWFA 1PZ2A 2GUYA 4R5EA 3U57A 1E56A 1ZS2A 2WMGA 3WDQA 1VJSA 4PMRA 3PZTA 3ZJ8A 1GQLA 3WBEA 4UOQA 1EHNA 1CLVA 3MUZ1 2V5DA 3CUHA 3PN8A 5ABGA 1EOMA 1V6VA 1E0VA 4B9YA 1W1TA 1XD1A 5BROA 3K46A 1LL6A 3WEMA 1I1XA 4EANA 1OT2A 2WMIB 1QI2A 1AQHA 4V28A 3VU2A 2A3AA 1KCLA 4D71A 4UFLA 3VO0A 4ENUA 4NRSA 4C7GA 1DHKA 1MW3A 1KGUA 3SUVA 2GHRA 4UZUA 3SCTA 3GNRA 1OINA 3A6OA 1W9XA 1HVXA 1MQPA 1SMAA 2WMIA 1UWQA 3A21A 1GW1A 5ABFB 4WXYB 1PAMA 4QP0A 3UK7A 1SR0A 3N15A 2AAAA 4UFHA 3WEOA 2ZX6A 3GRAA 2NT1A 2D0GA 4DO4A 1H0IA 1D2KA 3ARUA 2XJ7A 2WC3A 1GCYA 1E40A 3WY2A 1JAEA 3D51A 5FL0A 1KXQA 4S0ZA 3KKLA 1QWNA 2VOTA 2A3EA 3CY6A 3WQVA 4L4PA 1R87A 3RO8A 3SCRA 4GKLA 4ADSG 4RKWA 1FH9A 5E1QA 3PZMA 4KGLA 4Z2KA 2WVVA 1R75A 1U9CA 4U3AA 4W8LA 1R7AA 1E70M 1H3GA 3BVUA 1R46A 2CBVA 4WIWA 5FKYA 1BPLB 4OOUA 2GK3A 2DPEA 2XFRA 1B3VA 3VSVA 4AYGA 1E1EA 2XVGA 4U2ZA 3F5DA 3ZJ5A 3TOPA 1UH4A 3SUUA 3AOFA 3CNEA 1WL8A 5EMYA 2VQTA 2EPOA 3GNPA 3WFLA 2CYGA 1PIGA 4HA1A 2EACA 2VRKA 3L18A 3PQ6A 4GZJA 5EFDA 4XLLA 2OSYA 3BMVA 3AQUA 3N1AA 4MB5A 3PTMA 3TTYA 3U7VA 3EJPA 4DUWA 2JALA 5CSYA 3FAWA 2CBUA 3NOOA 2WVSA 2XFFA 3GXTA 4UR9A 2XHYA 4UQ9A 1CDGA 3BUPA 1KR0A 5C71A 1N57A 1UG6A 1NWUA 2XVKA 4FNQA 1G94A 2HISA 3B38A 3ZJ4A 1ZBWA 4TOQA 4CCCA 3MIIA 5GQBA 3WY1A 2UWFA 4AZ6A 3ARPA 2EADA 7CGTA 1V0MA 1QHZA 1JVNA 2ZXQA 1XSJA 3SUSA 1I75A 4PN2A 1Q6GA 2XYLA 4M24A 2CXGA 1XGZA 1LWHA 4HA4A 2YWDA 1MFUA 1I1WA 2PC8A 3BCDA 2Y8KA 4WKHA 1HJWA 4HA3A 4DUXA 2CKRA 3SCNA 5HBFA 4Y7EA 5HPCA 1E6NA 3GXDA 2B31A 3PQ2A 1V3HA 3W26A 4TTUA 1UD8A 4JFWA 4ZDIA 2WSPA 1UA3A 2J75A 1BVNP 5D9NA 1TZ7A 1BGAA 3F4VA 1GQJA 3U5UA 2VJXA 5IP5A 4HMCA 2VZVA 1GZJA 2GDVA 3S5ZA 4D6HA 1KXVA 1OX5A 4Q7NA 1SZNA 2W61A 3PZIA 3UR7A 1GOIA 3VVGA 2WMFA 2VTFA 4X0VA 1XH2A 3E1F1 5FD0A 3WH6A 2QMJA 1R8LA 2ALWA 4PUEA 3K4DA 4B7AA 2WCGA 1O6IA 2E8YA 1R86A 1M53A 2CEQA 5CJ5A 1CGWA 4I2NA 3GM8A 3A5VA 4URIA 2X09A 1E5NA 4ACZA 1L0PA 3WUGA 4PCSA 4JFVA 3M6DA 1J18A 4BF7A 2AD5A 3H55A 3RHTA 1WNOA 1OGSA 1GVIA 2XVLA 3AHXA 2CESA 1C7TA 3HMCA 5GPRA 2VZTA 2DEPA 4ZXLA 3WD2A 2WWDA 1BXRB 3MO4A 1VHQA 3KL3A 1QNPA 8CGTA 2WKLA 1J0JA 4OBRA 1NQ6A 1G1YA 1FHLA 3AJ7A 3SCOA 5A94A 4FF5A 1G5AA 3VDAA 1FP9A 3P9PA 2WSKA 4LX4A 2PBOA 3LPFA 7TAAA 1GHSA 1B0IA 3WF4A 3W6LA 5CGTA 1XD0A 4B40A 4Y1RB 1E6XM 4JFUA 3BAYA 2OWXA 1EH9A 4KGJA 3BVXA 2YFOA 2G3NA 2W67A 1UWSA 2DSWA 2YL6A 3UR8A 2YWBA 2OW7A 1Q6FA 1HL8A 3VD3A 3POHA 4MNMA 3GXIA 2DH3A 3NORA 1LWJA 3ZR5A 4D6EA 4I46A 1EOKA 3ZJ7A 4JAWA 3RPMA 5BXSA 1W9UA 1H0GA 4ENQA 3NSXA 1K9FA 4GIAA 1ZB5A 3ZT5A 4ACYA 1FA2A 4AMCA 2WZEA 3F5KA 3WQWA 2WHJA 3HG5A 4AZCA 4QCFA 1CXKA 3L4WA 2WHLA 3TQIA 2VDJA 1C90A 1PX8A 4J28A 3NYDA 1NH6A 2OWWA 4ENRA 4AWEA 1ISZA 1T3TA 1DWAM 1PBGA 4GINA 4L95C 3AICA 3IANA 1FH7A 3BUDA 1KWGA 2JEQA 1Z32X 3WY3A 3H53A 2XWEA 5D4YA 3O9NA 3WNKA 7A3HA 4MB4A 4TUFA 1J11A 4Y1FA 4B5KA 3LX9A 3EJ6A 3LXBA 2GK1B 4B3KA 1FY2A 2VUYA 4UOZA 1KXTA 3KE0A 1CGXA 3CGTA 2GJPA 3AXIA 3SCQA 1TA3B 1JFXA 1JZ5A 1CGUA 1ZBVA 3AXHA 3VIGA 3QHMA 3SCUA 5FOOA 4CN6A 3T0DA 4H41A 2D1ZA 2ZOXA 1ITCA 4J3TA 4W8BA 5A3HA 3AISA 1K9VF 4NZFA 1WP6A 4H7VA 3DYMA 1O7AA 3OBAA 1ISXA 1OSEA 3R74A 1TE1A 3AIUA 3D54D 2ZUVA 1F4HA 2DSUA 3RMEA 3VU3A 1QNSA 4AZGA 3UGJA 2CNCA 3WMBA 3RILA 1WKYA 4WKAA 2F2HA 3N12A 3ARWA 1XRVA 2VZUA 2CKSA 1XC6A 1H41A 1O7DC 1FFQA 1HNYA 4KH2A 1NARA 3CUIA 1QPKA 1Y7VA 2VR4A 1TQVA 1H09A 3ARQA 4H2CA 4U3CA 5A6LA 2YOCA 1BG4A 1CGTA 4DM1A 3VILA 1Q6DA 1E43A 3EMZA 1XCXA 3S2CA 5KEZA 4UFKA 3WN6A 2EBNA 1UD4A 2WW5A 1BTCA 1JF5A 3BHNA 3GZAA 2W92A 1UKSA 1KQZA 5AYIA 1ZL1A 1B31A 3BVVA 4P2GA 1CTNA 3S5YA 4E2OA 5A6KA 4MB3A 2PWEA 1QOXA 4NRRA 4S3JA 3N17A 3N9KA 1J01A 2WYSA 2CERA 3A24A 5FIPA 1JZ7A 3A3HA 1JFHA 3AHZA 1C92A 1C93A 4BQ5A 2J7CA 3GNOA 2FHFA 1W3JA 4P7RA 4OBSA 4BFLA 3AYSA 3T2PA 4P7NA 1SYTA 1MXDA 1X6LA 4QLJA 1KTCA 2CITA 1LF1A 4CD4A 2O9OA 2G4FA 1VAHA 3BXWA 3VX1A 3A4AA 3OLGA 5FL1A 3TV8A 4RE3A 1ECEA 2ZIDA 1E5JA 2J62A 5JIWA 3OT1A 4ZDKA 5LA2A 3BGAA 3ER6A 5EB8A 4CCEA 2ESCA 3HG4A 5ABHA 1OX4A 4FNUA 1TG7A 4HU8A 1H5VA 5A95A 3WF1A 4NF7A 1VCOA 1WDQA 3TTWA 1E4IA 1V3IA 5IXEA 4BQ4A 5BXTA 3J7HA 4GZIA 3PHAA 2WVUA 4UQEA 3ZT6A 4K68A 3PZUA 2PWGA 3P9RA 2YDQA 5A1AA 2UY2A 1P81A 4XZWA 3IAQA 1UWTA 1VJZA 3ALGA 4LGYA 2OYKA 3TTSA 5CZKA 3OIHA 5SY9A 2CHOA 2YDSA 1FYEA 1MQRA 4P8VA 3A22A 1J0HA 2GFTA 3PZNA 4LYQA 3T09A 1NOWA 3EBVA 1V3KA 4I4NA 2JIWA 2BHYA 4NXSA 3R76A 5DMYA 4EE9A 4AD0A 2YBTA 1EXPA 1XYFA 1R47A 2JF7A 3T08A 2IGTA 4GZEA 1E71M 2DT1A 3PBGA 4L78A 4JKMA 4L7QA
chains in the Genus database with same CATH superfamily
1FLDA 1GGFA 1IM9D 3DV6A 4GQRA 3AI1A 3JVGC 3LNFA 2AI0H 4Y7MA 3W82A 2FOLA 3FSGD 3R7AA 2NNRA 2VLJA 4KU1A 2DQCL 4OV5A 3VSDA 3A36A 2DS4A 4ZA2A 1Z9PA 4Y2XA 4PG8A 2WCSA 4H1VA 1HY3A 4LV8B 2HEGA 1DJHA 3U1SH 4HH4A 4AS1A 2BEUB 4ODSL 5ENZA 5BW4A 3R7QA 1FTWA 1M56B 2A86A 5GZOA 1ENUA 4H19A 3F47A 4ZT7A 4L5IA 2DQWA 4LAUA 4V02A 4AIIA 1NANI 3ODPA 2PDKA 1EDYA 3WFAA 1L4MA 5C4GB 2CO7A 2J47A 3DXXA 4YS6A 1H3XA 1LSOA 3H5WA 5F72S 4U1NB 4FJZA 2C04A 2Q3CA 2FUG6 4BWLA 2BFNA 2RGXA 1AK5A 2FVLA 2Y1GA 3E1GA 2L4OA 3F7MA 4IHOB 4M8VA 4BLUA 4QQUA 3P0IA 3KE8A 2P2SA 1ECBA 4PAOA 1L5GB 3AHDA 4Z7WE 2Z8YA 1O94C 3BW4A 3AIMA 3O0DA 4PZDA 2JEOA 4QYXA 5FA4A 4IIJA 4AAJA 2YBDA 3KEDA 3TLXA 1XRTA 5DZLA 4O1FA 5CEXA 4M7KL 1VG8A 2FCRA 4IDJL 4MJ5B 5T91A 4UB0H 2X1HA 5J4YA 1CE1L 4LJRA 3OZYA 2IH9A 3UJIH 1M9NA 5KVVA 4B3EA 5JTWA 2QRKA 2X0YA 1U8NB 3OG4B 3DROA 3HXQA 4UBLA 4IQ8A 5TX7A 3N42F 2OENG 4AENB 1AK9A 1PSCA 3TTUA 3MYPA 5C52B 1PD6A 5BP7A 5DHVA 5AWNH 2XUWA 5AC6A 5HK8A 3WNLA 1FIGL 4K9NA 2ZZ2A 2DBLL 1LL4A 4FYYA 1ZGAA 2X9QA 3Q2DA 4C6FA 2SFPA 2NIPA 4YO8A 2GEJA 4FFBA 4PYKA 2VR2A 2VPIA 2J7PA 1F61A 4HNHA 4JUBA 1QI0A 4QQFA 2VRBA 5AVWA 1ZD3A 4MJLA 5BV7L 5L7XH 4KR9A 5EE1A 4TT8A 1WW2A 1OAKA 4LE2A 2JWYA 1YN6B 3KOWA 1FWJC 1E6UA 5B8CC 2CNBA 2I2BA 3JQ8A 4PB4A 4MP6A 5LLTA 4R7LA 1MJ5A 1JZFA 2YMQA 1G16A 4KSBA 4ZRNA 1NFIA 1XG5A 4A8PA 2ALJA 2LHAA 3L4CA 2V6BA 3KZCA 3T3HA 4DESA 5CYGA 1K7EB 2OHFA 4R1LA 1Z26A 5CMLA 4P9NA 3B7GA 4LX0A 1HE5A 4LXIA 3MLEA 4XNMA 1KE1A 2CIKA 2F74B 2ROQA 1EEYB 3HYNA 3ZV7A 1RZ7H 1MDLA 2F6XA 3P4NA 2EIMB 4XH2A 1JYWA 1U0JA 2CKBL 3LXMA 5D3MA 2PXYC 3COJA 4QBGB 4NCKA 3PFMA 3GPEA 4HUQA 4MVYA 4Y9UA 4B83A 3VIHA 3GLTA 1A21A 3R10A 1VHCA 4Z4HA 5KQRA 3FPAA 4ORGA 3MS8A 3UWSA 4AKIA 4IFKA 2X8AA 1MFMA 4QTHA 4NI6A 3B34A 2DWEA 1P4BH 2B0CA 3DL7A 3L84A 1P4BL 3DD1A 4GLBA 2WJZB 4LY0A 4M7OA 3HB7A 4KE9A 4Q7QA 2FHPA 1SUFA 4KROB 2ONCA 4K7PL 3S2JA 3D25A 4Z17A 4ABWA 1EZUA 3SB0A 4EJSC 4RABA 1T10A 2V37A 3LW7A 1DAGA 2QPOA 4AQ8C 4YAGA 4Q1VA 2VAAB 1BMTA 4PGMA 1EZ4A 7PAZA 1HE7A 3BW9A 3WGYA 2ZQ5A 3U4FA 1EMDA 4LXUA 3W22A 3KPWA 1AG6A 2D2HA 1VFBA 3MJGX 1ZEAL 1ZMBA 5TNXA 3MRSA 3TLRA 2CHDA 1I31A 4YT4A 4ZFMA 3V2GA 3SO3B 1L5LA 1IKNC 2FFAA 1YTEA 5A9RA 1MHEB 3FJYA 3U9TA 4EGFA 5LBSA 4D4KA 4AQDA 3OAAD 3TLKA 4ZW7A 4EDFA 1X1NA 1MI3A 2CBIA 3M0VA 1FYWA 4PBDA 1E8DA 1H93A 3T44A 2I4OA 4C08A 4YWGL 4RH1A 3GBNH 4LS3A 2FPSA 5D70H 1EO8H 3GROA 2NZWA 3CRRA 3V75A 3WJSA 5B4UA 3KEFA 5DK6A 2DOKA 5TK2A 1WA0X 3NPSB 2AKAB 4KAQL 3QU9A 3UBGA 2Z6QA 5BORA 3GLDA 2FF7A 3I6BA 3NAMA 1JPEA 1OFIA 1DVSA 4KDEA 3EADA 2YDRA 2BZDA 5F51A 3IR5A 4QYIB 1G67A 4GBGA 3IE0A 3TL3A 5HNTA 3TEWA 1VADB 3W6NA 4TV8B 5IM5A 4QKQA 1JZIA 3MU3A 2OESA 2CXXA 1CX9B 4EHNA 4DR6B 4N87A 2DJMA 3WLHA 5EWMA 3OJDB 5C31A 1I2RA 4GQBA 1W1UA 2BG5A 2YZ5A 1KEMH 3OOYA 4RPKA 1KEML 4R8SA 4CVWA 2Z4TA 4RD0A 3F58L 4X0NA 1N7GA 1KJ3H 2A7XA 5IBUG 4UV7L 4YL9A 1ZVKA 3OPZH 1QDUA 5AK5A 3HZ3A 3OPZL 3G89A 2V2TA 4IMPA 1JZTA 3LT5A 2PDQA 3Q3GB 1XB3A 3KVDD 3BZ4A 2CO1A 3NFPB 1QHIA 2WSLA 2WANA 4N0UE 1KJMA 1NDGA 4OZHE 2PF6A 3ZU5A 1V5EA 4NN7B 4NK5A 2VH5R 3P84A 4RRPG 4KAXA 3CF2A 2R7MA 1S5TA 4L8FA 3RFCA 1MX5A 2QT0A 4MRAA 2JLSA 5L3QB 2D22A 2QNRA 4KI5D 3VZPA 3W85A 4H26B 2X22A 4K9OA 3J8F7 5GZ6A 5FIEA 2W66A 3B7UX 3IS1X 5CD3A 1QFSA 1Z5LB 4XSHA 3EUAA 4BQQA 3WFZA 3T9CA 4WJLA 3ZZTA 4DUGA 5TY0A 4Q9RH 3I9NA 3DO5A 3ZZ0A 4Q9RL 2XIOA 2QVBA 2V1XA 2AXGB 5BZZA 2BT4A 3SI7A 1L7TL 1EFAA 3H6AA 3DJTA 1UBUS 4KN8A 3LIZL 2BP8B 2PPEA 3PVFA 4E5UA 3EXSA 3V8NA 4BCBA 1IGTA 4F8JA 3X43A 4EECA 3GS7A 1F51E 4Q3BA 1QORA 4KR2A 4C56D 1N6VA 3W88A 3G8CA 1AW1A 4Y8AA 3M1AA 4OK3A 4BK4A 2DUAA 4JS3A 4LF5B 4PLCA 4Y2UA 3E6FB 2R9VA 1QNFA 2WSYB 5HRCA 4S1VA 1B8OA 4H7HA 3H2YA 1C7ZA 3JV6A 1JHRA 1NEPA 2G3IA 4MA0A 3FUCA 4B3MB 1EX7A 3CFNA 1JDJA 5EZ6B 2Z91A 3ICVA 3IUYA 3HU7A 1KK2A 2A9DA 2R27A 1ESEA 2FPRA 2BHSA 3WEAA 1EFCA 4W9DC 4PCFA 5KTTA 5BMVB 1PT9A 3C43A 5IVXA 4AKEA 1AQMA 1D2CA 1CBGA 3L3GB 1QNOA 3TWOA 1UWFA 3GMLB 4LSPH 3MLUL 3C8NA 3GXOA 3M3PA 4NNPA 4K71B 4LSPL 1WXFA 4ZAGA 5JPMA 2PO5A 4NQXB 3FU7A 3I53A 4Q1AA 4MS3A 1BSLA 5I9LA 2A6DA 1A47A 4YSOA 4PRTA 5CSSA 2G77B 1U9IC 4MB1A 3G0CA 3IAHA 5I6KA 3P97A 3DZCA 4DHGA 4BZYA 4TYPA 1ZSVA 3N87A 4NQDE 2NU7B 3OQIA 4L2IB 5EJ7A 3BK1A 1NZDA 4HAKA 3G5EA 3I6YA 3HBMA 2WWRA 3CQ0A 3OEHA 3NXFA 2F8VA 1NQOA 4Q9LA 4AM8A 3UHOA 4DMUB 4A8TA 3FL7A 3OA5A 4YGXB 1D9KA 1PUXA 2CDCA 3ZKAA 2HDNB 4R8KA 3MZNA 3G1WA 4BH8B 2OLSA 1GUDA 3JWHA 5CS7A 4ZMVA 1L8AA 2LLEA 4BKSC 2X2EA 3SFTA 4NC9A 1GMIA 2CJSA 4HIEA 1CB2A 3I6RA 1JEOA 4F6LA 1HNNA 3ITDA 1NW8A 4B33A 5IUSA 3U0BA 1KCKA 2H1RA 2UUDK 5DURB 4LHUA 1PNQA 5GNYA 5AEAA 1SKYB 3CQKA 3PA6A 1VZ2A 4LUCA 4C78A 3V9AA 1FTSA 1GYQA 3KLOA 1M1XB 4H77A 4DLPA 4PJIF 1BTOA 1U3NA 5IFPA 2VK1A 3EWUA 4KRTA 4EPEC 2FSHA 3B37A 4NASA 4PZ0A 5ER9A 3EQZA 2XYHA 4Z4FA 4HLUA 4BU0A 5ALLA 3TVMC 2HPHA 3V5OA 4X20A 1A8IA 4DIOA 3QXWA 1VKFA 2HXUA 4JQ2A 4CQLB 3V6LA 1SBZA 3RI5F 1G7JA 2CM6A 4PS4H 3FZYA 1G21E 4O0LA 1ZLVH 3BZUA 4JQ4A 4PS4L 4U2CA 1UC8A 4A66A 2GPBA 2R8SH 3BANA 1PUIA 1Q6YA 5EY5B 2R8SL 1GNXA 2N47A 1PJQA 2V30A 3X1KA 1W9MA 1FFDA 1UGNA 4PP1C 2FJGA 2AN4A 1UBSA 4YAQB 4JFOA 2GJXB 3RLHA 5BR4A 4LCRA 3SCWA 1EDDA 3H87A 4J4PD 2XB8A 3CWHA 3ZWPA 4YK7A 3L5KA 4APQC 4BE5A 3G6AA 2GESA 5EZJA 1QANA 1B0AA 3T40A 2CLEA 3DGGA 2QZ9A 3NDYE 5KZEA 1NMZA 1PS8A 4OFXA 4ZT4A 1AFSA 1BKDR 5IG7A 4WENB 3CZ9A 4DKEH 1JN0A 4RV4A 4QLRA 1QZUA 2JDID 4J0HA 5CJXA 3D7MA 1HTWA 5CTAA 2X3BA 4EHKA 2AB0A 4WKGA 4ERNA 2WPDD 1UIRA 1I8LA 4KZCA 1YZUA 2FWPA 3L2NA 2TODA 5I6PA 4UTCA 3PR2A 3FM9A 2WIGA 2IBZX 1M3UA 1TAGA 3IJ5A 3K1DA 4M4RA 1ZP3A 5IABA 1Y8QA 5I48A 4OXNA 2W8BB 2R1WB 4LQLA 2XIIA 1MREH 4QRPB 1M7HA 4WT7A 3NJRA 1T5HX 3R7SA 1FVPA 5LCXA 5JZVA 2PDIA 1Y9DA 4A73A 2G7MC 1XGYH 2FQFA 5DFVD 1XGYL 2FSDA 3ARGC 2PKEA 5EXXA 3KB2A 2EX0A 1Z4NA 3MLWH 3BT2H 3T2OA 5ITFA 1NJGA 2ZE8A 1KVUA 3LXCA 1MNUH 2C7QA 1K8YA 1T0IA 3KVYA 4HJUA 1ECYA 5D7JC 4E9XA 3VKGA 1PFWA 4L5FL 4MIKA 3A4FA 1F90L 1A02N 1EQ2A 1U99A 1Q20A 4KQHA 4COOA 4N8VG 4RNJA 3S6JA 2EKDA 4BEIA 1MRQA 2BDNL 3GZPA 4D80A 3BVNB 2DR0A 4CQDA 4ZB5A 4KVCH 3L7IA 3HRZA 4ELKA 4XHQA 1ML3A 2AGJH 4KH0A 1ORDA 3DVGB 2AGJL 5MEOB 1LRQA 1HKUA 2A99A 5JHLH 3PRKE 4FD2A 5CZJA 1WCIA 4M0FA 3S3SA 1GVQA 2CHQA 4ZI7B 4NULA 1X9QA 1YR7A 5DWUH 1P73A 3F96A 3ETDA 3OUTA 4FINA 4PA8A 4EPBC 2JW5A 4ODHL 1BVUA 2ZCLH 2WBJB 5FF6B 4AWUA 1ISRA 3PE4A 4EI5A 2ZCLL 1VRXA 5BRJA 2K2WA 2NNLD 4C6SA 4UAOC 2J4CA 2J0EA 5BYAA 3IB3A 4FI3F 1B9KA 1QPXA 3D5QA 3QJOA 5C0GA 3U9LA 4Y19D 3QC5X 4BJLA 3X1FA 4HZ8A 1E6JL 2FL5A 5AVRB 4N5IX 1H2YA 4Q14A 4XVSH 2EPMX 4J4HA 1PYWA 2BNRA 1E9SA 2CK2A 4HQVA 1F8GA 1YZHA 1AR2A 5EPMA 1MFCH 4ZUSB 4D3FA 2XUIA 2JI2A 4OFPA 4Y5XB 1WAWA 1JLMA 4M98A 1MNZA 2HM7A 4DZAA 1QCZA 3TH6A 2DEXX 4G8FB 3AIOA 1Z2NX 3DBLA 5HZGA 3EJYD 3N04A 2G5PA 5C8JA 2QN6A 3RVWC 4K2UH 3H2ZA 3S99A 4A0SA 1DYSA 5HYIA 4YTUA 3EBLA 1SRRA 3MS4A 2ONKA 1M2FA 5B1YA 3B4UA 3ITGA 1IXOA 5H5JA 2EEFA 3NVTA 3GD6A 1J42A 2R23A 1FLRH 5JR1H 1FWSA 3C8HA 4BAGA 5JR1L 1DX6A 2HSZA 3QQ9C 4RZ6A 5FM4A 1QI4A 3IVRA 1VCNA 3TFKD 1G7QA 4DP5X 4HZ6A 2Y1WA 3O95A 4OHKA 3L0NA 1FJ1B 4B4KA 4WI0A 4V03A 3U9SA 4FDUA 4FN5A 1C0IA 2YBRA 4B91A 2NQ8A 3MHZA 4ZVMA 3QA9A 2MQCA 4LWWA 3W4JA 1BZYA 2OSXA 5C0JA 2X4SB 3M17B 3WIHH 3E2RA 2PO6D 1UBRS 3VQ1C 5FL3A 3S48A 1B73A 3CTLA 4IWWA 3G0UA 1KBBA 4FK9A 3NSMA 3MBIA 2R1TA 4HSHA 1UM4L 1C8VB 3TUJC 1M05A 1BGXL 5KSBF 3IUMA 1LJUA 3FKQA 4LX8A 3JZUA 3NL5A 4MRVA 5HD8D 4W5UA 1S0UA 1ZWIB 1ETA1 1E9VA 4MR9B 1S96A 3IJHB 3M7OA 2AYXA 3ROZA 3COTA 3A6CL 5EKUA 5EUOB 4NNOA 2F6UA 3VIMA 3JXAA 3RTQD 4MTMA 4JROA 2D3JA 2MCPH 1AGBA 3LZOA 1EDGA 3G08B 1X7TA 3BPNC 3PT5A 1NLMA 1I32A 1OLXA 5KTRA 1F4YH 1KC3A 2Y89A 2CVZA 3B3BA 3I4LA 2HP4A 1A2YB 3S40A 4QRAA 4HD5A 1WXEA 4PJ6A 5KX5F 3BJRA 4ODUA 3GZOA 4Y8VA 5HHVL 4Y89A 1MD9A 2Y7EA 1K88A 1T6BY 2GFQA 2WZMA 1V6AA 3T2NL 3NZQA 2PX4A 4RDQF 5IB4B 3HZVA 5C8YB 4CKEB 4YDJA 4OLAA 3T6XA 1KYOK 5EZPA 2Y1FA 4JIPA 4HUWA 4XX1E 1MRSA 3E6AA 3TG2A 4JO1H 2AEQH 4CKCA 2YAEA 4JO1L 4RYDA 2GI0A 5GGRB 4QY8A 1H0SA 4ZDHB 3VR3A 4OUEA 4BLWA 5ADOH 1OGGA 3S1XA 1MHPL 3VC6A 1EP3A 4XPBH 3B6IA 5HIIA 1AP2B 2VE6B 2VH5H 1K5DA 3R3ZA 2OPCA 3ZBUA 2VH5L 2UVPA 4G11A 1X38A 1E7VA 3R12A 1SBBA 1HWWA 3O1JC 5F9JB 4QT0A 1WUIS 1CDZA 4LP8A 1E3IA 4GP7A 1RC1A 5AB2A 1QOQA 4Z99A 4IJ6A 2PCPB 3WMSA 4ZTYA 1X7QB 2AXFB 3TBWB 4PS0A 3VCLB 4II3A 4P2OC 1TK2A 2GAIA 4DXVA 5DGTA 2VYQA 4CGYA 1WKVA 1FN4A 3MA7B 1R5JA 4LJAA 2G9RA 5DSZA 4BNWA 1PGOA 3E9MA 2VHVA 4N8UA 2K7QA 2DD8H 3VWJC 3BWEA 2DD8L 2Q7YA 3AZOA 4JQVA 1KXTB 4NBYB 1L9XA 3OZIA 1DVJA 1JEYA 5DZVA 3S5LA 1F3OA 2GYVA 3U49A 1WZIA 1H23A 3UWUA 5ICZA 3B9EA 4ZXBD 2XVXA 2X8LA 3Q2OA 3A6JA 2ADIB 2R56H 4NQVA 4OCRL 3DBIA 4PXYA 4NP9A 1V11B 2DRUA 2BWIA 5MHTA 4C89A 3H1EA 4C0BA 1W72A 1ZH2A 1ZICA 1DFGA 1TM4E 4EHDA 1DP0A 4WGWB 3V4PH 1BIIA 3PC2A 5HBGA 3LX5A 1X7XA 1EQWA 2GBLC 4H20H 3CSGA 3MKCA 3EXAA 4H20L 1MCLA 4URWR 5BUCA 4PMVA 2X0WA 2IOYA 3MYYA 1RXSA 4BV3A 4GNJA 2HCRA 1URZA 2V97A 3KM0A 2I6UA 5K0TA 3LLXA 2EPHA 3FQ2A 5H7XA 2FK7A 1FDVA 1ZAKA 3EO1B 3RASA 4BSVB 1KI7A 3GRIA 1SD5A 3S2MA 2JANA 4PV8A 2A3BA 4GBJA 2CO6B 1J8KA 2O06A 4XKJA 2FWUA 3AWOA 4ZS7L 4BB6A 2EXWD 1IC4H 5TDOB 4YSAA 5JPNC 3UWOA 1C7IA 5C08B 4EG0A 1ZL2A 3PLYA 1XS2A 2QCNA 1GT6A 3OF3A 1NPUA 3QJYA 6NULA 2GN8A 4WOZA 2WM9B 4WFFE 1IN4A 3DUWA 3PHOA 4PZ9A 1Z5VA 4J8QA 1G7VA 4YX2L 3R77A 1N4XL 4UDTA 3WNBA 2BZSA 2GM9A 1JSYA 1XQLA 3F6YA 3KOYA 5B8CB 3I2CL 3VFDA 2VLJD 2BXYA 4W9FC 5T7BA 3I28A 4KI5E 4PREB 2QELA 1LPOA 1NP3A 2H7XA 4ENZA 3QHFL 2CXNA 3LZNA 1KLFA 2WOQA 3FN0L 4MNKA 5HDBB 4B2DA 3OFKA 2WTUA 2CO4A 3NBUA 4XWGA 3NP3A 4JW3A 1Z37A 1XF2A 4XXDB 4I5XA 1FTQA 3P4OA 4JBSA 2VO5A 1BQHB 3V6OE 2R4RL 3MROA 3RRAA 3R0DA 3EWXA 4IGNA 1OP9A 4X1KA 4IH4A 2WTNA 3DKRA 3HU3A 1GPJA 1YAJA 3OE7A 2PXYB 3QVJA 2R6ZA 1J05A 4G6AD 3VIKA 3R6DA 3A0RB 4LGXA 2I6TA 3IK2A 2A35A 1Y3DE 1W15A 1DBMH 2QTFA 3SQOA 3WTSA 3WKDA 4C56E 3QIAA 1DBML 1US2A 2ZI3A 1U1HA 5FNVA 4ZSOB 5K01A 2HA2A 2QTVB 5GJPA 3MQ2A 1KLGB 4JTAA 3CPSA 2VQ6A 5BRNA 1NC2A 1NGYA 5DQPA 1PT5A 3C6MA 5F4BA 4EG7A 1KJZA 4P7GA 1ZT4A 3B5JA 1BHJA 1RU9L 2ZYVX 4J12A 4UQ3B 3ZE9A 4XUDA 2MPAH 3GAKA 1DIRA 4EJSB 2NTVA 2MPAL 3RM4A 1P7CA 1TFVA 5GGVL 5L2KA 4QISA 3B6SB 1BS2A 4NOLA 3L5OA 1F3DH 3FSEA 3BAEL 4OLVL 1EWYA 2JBWA 2ZRMA 1J2EA 1VFAA 2QCEA 3SE3C 3WSTA 4A7GF 1ICSA 4FSHA 4KQEA 4LRQA 2GTZB 4E4YA 4LSVL 2D0OB 3SMVA 4WY0A 1VDZA 2Q6KA 2HCFA 3BAXA 2A0KA 4PFHA 3B7PA 1S3FA 4LAQH 3GRRA 3FTCA 3X14B 4AXXA 3DTVB 2IOOA 3G04A 4DWSD 1DKNA 1SCUA 1C7RA 1N6UA 4NVRA 2J7PD 4B92A 1PYGA 2VDMB 5EN4A 5ISZD 4JUSA 4IT1A 2QQFA 4D6XA 4D6JA 2IU4A 2J3EA 1NGWA 3EGWA 3AM8C 3EKGA 1G6RB 4WH0A 4R68A 4UHCA 4XCVA 4R8LA 5EHIA 4RPLA 3R6TA 2VLBA 3WGZA 3KJFA 1XDDA 4DF1A 1BVKA 5D2WA 3FBWA 3O9VA 1TMCB 4JN6B 2P5NA 3QOWA 3KBPA 5JW4N 5C7YA 1BCRB 5ICUA 4GKOA 1WG8A 1MCRA 2YMMA 2DWDA 1GG0A 3KLAB 3PXGA 2BHNA 4U6YB 4B6GA 2V3FA 3N2KA 5C0DB 4M02A 4U1SA 1RAMA 3DMMC 5DEIA 4OECA 4YPOA 5DUBB 3SRDA 1KVQA 3RGTA 2H4YA 2Q1WA 3II6X 4OJYA 5EFIA 2GBFA 3ARFD 4OHWA 4JRXD 2G04A 3V6MA 1JN6A 4MA8H 3FFOA 4MV6A 3CLTC 4JYCA 3D05A 4R0NA 2GUOA 2VNJA 3JVAA 4JQIL 3PCTA 1GRNA 3CF4A 1Y3CE 1HQYE 3MJ4A 4EXAA 5I28A 1LBFA 1WT5C 3W7NA 3L4JA 4QG3A 4PJXF 3DAOA 1C5DA 2OM5A 5K9KA 1OG6A 4G5OA 3C3YA 1A5TA 4NKRA 4PJEA 1UEIA 3T7SA 4ARIA 4H7PA 4J2TA 2DTEA 2G88A 4Q6BA 2DFNA 5ABZA 1WZNA 1TOAA 3S47A 5EINA 1G4RA 3PP3K 2BFWA 2A3AA 4D71A 3TBTA 2FEDD 1D2EA 3ES6A 3TFCA 4NZTL 3P9NA 2ZRNA 2Z7ZA 1KGUA 3O2DH 2E49A 3Q7PA 3EYFB 4PGLA 2IYPA 2WUDA 3GFVA 2J5WA 2NLIA 4B2PA 1A6PA 2XG5B 2LTQC 4BEQA 2Z09A 3FTEA 3ETTA 3QVQA 4ER5A 2RH5A 1M7IB 4PUBH 1T2QH 4OX9Y 3SPIA 1XRNA 4PUBL 1OH5A 2JKLA 5CDYA 5JFOA 2Y6SC 4AX4A 3S81A 2A57A 4EIGB 1M1NB 1S2GA 3O3MB 4BP1A 2X70A 3RWCB 5AR1A 3IGSA 3A1NA 3E9QA 2EEPA 4LNAA 1DXEA 3QFDB 5T1KD 5B39A 1GKIA 4YJHB 2R29A 2YZMA 3C6LA 2B83A 1MLCB 3HUJF 3S7ZA 1ZHFA 1P3JA 2G1AA 3K74B 1OZAA 2IDZA 2VTBA 3WGTA 2H52A 4PJ5A 5JSHA 3VHXB 1XTMA 2YIDA 3IUEA 5EB9A 1R7AA 2EFCB 5FUVA 3AX6A 3KYOA 4X65B 1JR1A 3ESZA 2OO5C 2J57A 2FFJA 4DMLA 2Q76B 4CLMA 3GCGA 2I60H 2QTCA 3EBPA 1W34A 3SGUA 4HHLA 4P81A 2BMWA 5DHSA 5AI8A 2ZIAA 2P5WB 3B7YA 3VU1A 3KNZA 721PA 3VR4H 4D2IA 4P83A 1MF2L 2XWCA 2GJSA 1F02I 1QNIA 4FYXA 5I1DA 1VZGA 4IQ0A 4WE3A 4F37K 3SG0A 5ACMA 3OAZH 3RSLA 2B1AL 1S2DA 1MEJA 3L67A 4IP5A 3QCVL 5CSYA 2RARA 1D0IA 3HS3A 5U1PA 3V0VA 3U83A 3NTCL 2QKIB 3EOTL 4XP1H 4FOJA 5KVFL 2WTAA 5DVOA 3I09A 3W57A 2ZONA 2OTUA 1G94A 2GG1A 5CILL 3MIIA 5MEPB 4F0LA 1YBFA 1V0MA 2ZXQA 3KPNB 2YV2A 4HKBB 2FBJL 4ETWA 3NTYA 5DW0A 1VYTA 2XYLA 5KTEH 1X5LA 3OQ8A 5CFOA 1X5AA 1EBUA 4HA3A 3IR7A 3RYCB 2F43B 3AJ8A 2PCEA 3PJSA 4G0VA 2YUZA 2YD9A 3PQ2A 1KU6A 4WSOA 4Y19E 4LDAA 1SCNE 1D2MA 1C3OA 1GCIA 3W1XA 4PQFA 3ULUF 5EEUA 3VNDA 2FHSA 2ECPA 5DGHA 5AW0A 2DLCX 4FA7B 4U6VH 2H9AA 2OB2A 5DLEA 3V2UA 4M0DA 1KO4A 4K5NA 5KOJA 1RUMH 5CCKL 2FR1A 2GSWA 4GSLA 3QAZC 4O2CB 4OQQA 1CGSL 2BOGX 4DRXB 1RUML 4PJ9C 4MWCA 4KWSA 3OCYA 4DUGD 5LMZA 3L7FA 1BWWA 3V4VB 5T9BG 1EUCA 3UMCA 5LBVA 2YPLE 1GL4B 3WH6A 1XJCA 5CC6A 1SR9A 4XVHA 4C59B 1XGRB 4XZNX 5DGXA 2BSSA 3RVMA 3FQWB 2CEQA 4Q82A 4HMQA 4A16A 3BEWA 1B41A 3WE7A 4IMKA 4JO4H 1RS0A 2W8CA 4O8CA 4R5VA 3NBMA 1NKGA 1UXLA 1H50A 4JO4L 3UYLA 1N68A 3BEDA 4OHQA 4MQUA 2PLCA 1CWVA 2BFDA 1SHWA 2XVLA 3DGBA 2G1UA 3QLUA 3WBWA 1U5HA 4YHOH 3ZH2A 4F04A 3LENA 3SKNB 1TUBB 4YHOL 3F3YA 5JY6A 5AK3A 1E6OH 2WKLA 2ZAYA 4TMKA 5I8EB 4AG4H 2HX8A 3V0DA 3QV1A 5JMPA 4P82A 3GG1A 3AVVA 2AP2A 5EZLA 3C52A 3D07A 1E9OA 5DBFA 2DLDA 5L4SA 3EYWA 1B0IA 3OEYA 3N2ZB 5DXWA 1N18A 3EFDH 4P7FA 5FFOA 4OBWA 3WIUA 2DLHA 1WVIA 1ZM2A 4APQB 1ZBDA 1UQSB 3UXEA 1UWSA 1R5OA 2BIFA 3IKVA 1AZRA 3TIVA 3UBMA 5JSYA 2E25A 2ALAA 3RP1A 1POJA 3AY2A 2WT9A 2QJGA 5D6NA 1YCDA 3PU7A 3SKOB 3TSBA 2GSMB 2VEOA 3D5EA 1J1IA 4J3OD 3ITKA 1YGYA 2ZBFA 1XGUB 5C0AA 3GJEB 3TESA 2EQAA 4WACA 3WQWA 2V7GA 3FCXA 1CXKA 3DNKA 1ZUNA 1FFBA 2OJPA 2CF6A 2BO0A 4ENRA 3MTBA 2R1LA 3GN2A 1HHIB 3MQIA 3P80A 3AEQB 4GPD1 3V8RA 3D7PA 4X6DB 3O3BB 4N0FA 3BUDA 3UJCA 2VLRD 5KAQF 1A5SB 3GSMA 1KARA 3ARGB 3AQXA 2PW2B 3APDA 4IRSC 4Y1FA 3FPEA 4TSRA 5FDWB 3ZY5A 1FY2A 1H8OA 5F7LB 1XLCA 4RESB 5D7JB 2X4QB 4TUJA 1WAMA 4DWOA 2XLCA 1HILB 2LW3A 5TIIA 1GR1A 3RGBA 2BFFB 6PTDA 4WA7A 1E51A 2PSNA 2YV4A 1L5MA 1QZXA 2ZS7A 3WJXA 3Q5DA 1N19A 4HA0A 5FOOA 3DAHA 4F2UA 2X86A 3MB5A 2PNJA 3QPYA 4HQOA 3HI5H 1H6DA 2ZGVA 1L6GA 3IJQA 3DURA 2XY2A 1GC1L 3RSQA 3NESA 5GM1A 4PN7A 3WBJA 4WGKA 4HDCA 2OSLA 1SUAA 1ISXA 1AUSL 1Z35A 4CT4B 4MIYA 3AF5A 1SFJA 3G8YA 4CSZA 4MKIA 1W29A 5CEJA 3Q1LA 4PFKA 3CC5A 1V16B 1YNSA 4FA8A 2PZMA 2OTWA 2AVNA 2JGJA 4F5EA 3LVRE 2IPKB 3TF7C 3HXTA 2ZJ5A 1FFQA 4FQJL 1P4RA 1KY6A 3M0XA 2W79A 4MP3A 1IB6A 2IDCA 1I9IL 1OVDA 3WOHA 1XI3A 3VFWB 4ZK6A 3DBXB 3TL2A 1DC7A 1PKQA 4GKSA 2JFZA 3UXHA 1ID1A 3QUXC 2IEGA 4GY4A 4LI3X 4UAOB 1GPNA 1QRUA 4O6VA 1JZSA 2F3PA 3NKVA 1KYVA 4KNTA 3B9BA 1FK8A 4UCWA 1SLWA 1YI8A 3MUCA 1NONA 5BXFB 4R0VA 2LVEA 5AYIA 4PJDF 1ONNA 1EU1A 3WGNA 1VRWA 2VLIA 4EVQA 3BVVA 4ICNA 4BLQA 4E2OA 1UFRA 3PBMA 3A3NA 2EDMA 2OBGA 4J16C 3ILXA 1VA5A 3W9BA 3VCNA 3AERA 4KRNA 4GUGA 3W1AA 4P7RA 4UMVA 4GL2A 4XAPA 4XW2A 4G4JA 5LVAA 1UROA 1Q0RA 1DORA 2VPTA 4AO8A 5HPMA 2FJHA 4DN4L 2A84A 4Q02A 2WHXA 2NQ2C 3IJIA 4XDZA 1QYGH 1OVZA 5FL1A 1Z4MA 5EPUA 3QE9Y 1BQEA 2A79A 1XLIA 1QYGL 1NL0L 3OT1A 5U4NA 5JAHA 4UJ5A 1MB0A 1D8WA 2ZIWB 4H6QA 5TDNB 3IEKA 2WQRA 4IBLT 5CP3A 5KOMC 5C9JA 2VOJA 3S1VA 2BGLA 1SUDA 2GN6A 4ECLA 1JIKA 1HKHA 5EXSA 3S46A 4K68A 4HWOA 3SYTA 3OZVA 4PS7A 3TBBA 4H5SA 1TF2A 1L5SA 5CEWA 4RPJA 1E2IA 1S01A 3O31A 4NDNE 3QEUA 2W38A 3GRZA 4ARSA 4KO7A 1UL1X 4JODA 1FV1A 4P8VA 1I1AA 2X1PA 3H4TA 4LB8A 2C9SA 3PZNA 3II2A 3M81A 4AHPA 4W5QA 2Z65C 4K9KA 2IPUG 4BO5A 1TUFA 1XF5B 4EB8A 5HHNA 2PJRA 1OE2A 4EE9A 5AYVA 1MXHA 1TFUA 5ETJA 2POTA 1HH6A 4O51A 2O6CA 2BDQA 3PBGA 5I76A 2QV0A 1KY2A 3STCA 1E7WA 5K4GA 3LNPA 3RVVD 4BZ2H 1Y9EA 3GIVB 4ADIA 4PYNA 2F1AA 1OAYH 1Q0TA 3TEYA 2IIJA 1B3BA 3QWOA 5D30A 3ET4A 5FV4A 1VHJA 4NHEA 4ZVVA 1G1KA 3KJZA 1Y6MR 3MD9A 1V5GA 3MCVA 3V7YA 1QHSA 4QNPE 3V1MA 1IV8A 4C4RA 3VMNA 4I5EA 1D2GA 4EMSA 2CSUA 3CH5A 3PPCA 3WBYA 2C2MA 4O02H 2CUZA 3HS0A 1RCQA 2I2WA 3BPNB 1E9AA 5D00A 2IU3A 1PJRA 3TS8A 4H9ZA 4M61B 3A2KA 5DLLA 1G8JA 1G5TA 5IJZA 1E0UA 1AV7A 1TZJA 1KV8A 1E9QA 1VPOH 1WUZA 1I7DA 5KSAA 1CY4A 2FR4B 3FOKA 1UJNA 2IFGA 1OAKL 1DBBH 4ROPA 4KSYA 2CT8A 4LESA 1KCXA 1PHWA 4LDQA 1SKBA 1T8YA 5JW5B 2X9ZA 3ESOA 2AQ3A 3T5BA 3BJMA 2PWHA 5LZ2A 1QHHB 3GMOA 1F06A 3FXAA 3DPDA 1OFQA 4OLWL 3NHFA 1XR9A 1U8MB 2H26B 3C3UA 5E1BA 4GMSL 2F8XC 5BW6A 2UXVA 3EF7A 1SM9A 3MRLB 2XN0A 1X9GA 2J9YB 1TETH 2ODNA 3F3MA 3AEXA 3KJXA 3CZLA 1TETL 3STLA 4Q1EA 3KU4A 4Z7AA 3QEMB 2C5AA 4Y18A 3LNDA 2OZPA 3ICPA 3LN3A 4LMQE 3LTSA 1D9EA 4GI7A 2B1IA 3F7PC 5EG5A 2DTXA 2EPNA 1E72M 4N2KA 4FMFA 1RZGA 4OM1L 4P2OB 3TB6A 4XX0A 2BMKA 3LHWA 4E38A 4OMUA 3P4UA 3TAOA 2J6EH 1XWVA 4A3QA 1IXSB 3ZVVA 3MSPA 1VFTA 3VWJB 1JMYA 2PYED 3KUUA 5EN2B 3FQ4A 5ISZE 4X5WB 4F6RB 4GG6B 5B3JE 1HHGA 3TH4T 3DMHA 3THXB 2AYYA 1UHVA 1K8ZA 3PQFA 1TQ4A 4FS8A 5K8VA 5DJCA 2HTKD 4B6PA 3ZC3A 3BIXA 5LDGA 4DBUA 3OUUA 2X2HA 2FK9A 1M7XA 4QYAA 5JBDA 1E9FA 1SXHA 3AR3A 3LS5L 5F35A 3MRPB 2RGMA 5CDFE 3LEYH 4Z8FH 4R2JA 3VNRA 4OGXH 2GYSA 3PUOA 1TVPA 4Z1BA 3ZVKA 1A3HA 4J8RB 3KDNA 3OP2A 5KBMA 2AFIA 3DLCA 5DM2A 3PFWO 4M29A 2QX8A 3N6RA 3AI2A 3J81A 1LGVA 1J2YA 3AZUA 3KQKA 1YKFA 5LQDA 1WLHA 1Z5WA 4XE5B 4Q1DA 3EEYA 1JTTA 4JRXE 2RHLA 5CG1A 1KKMA 4FJ2A 4BDTA 1QX3A 1T1RA 3D3QA 3WNCA 4D4HA 4QRHA 3VKKA 3HJUA 1L3WA 5G4WA 1FZTA 3U9UA 1CQJA 2XCQA 4R6UA 2P8BA 5BSFA 1JWBB 4KHTH 3PJFA 1FH8A 4Y1TA 3O8QB 3OMIB 5D5HA 3ZGIA 4ML4A 3QPBA 4OIAA 1JPTL 1XNHA 3I50H 1LVUA 3NB0A 4OQYA 1PWEA 3VSTA 2YWGA 2HHAA 1XQYA 3A12A 3KCPA 3VR3D 4GGHA 4IKPA 4JOCA 2V6HA 2ETWA 1L6WA 5ES3A 4RL3A 1YEGH 4B9ZA 1EJXC 1V8EA 4M9ZA 1YEGL 4NT6B 4WFHD 2PTTB 3W6MA 3W1UA 3KB8A 2UAGA 3GAMA 4YYEA 3E9EA 2QBYB 3E74A 4JJHA 2DKSA 1HFBA 1RBOB 4TV8F 4BUHA 1E4KC 1ZNNA 2P0AA 4NE2A 4WD0A 5AB1A 4E4PA 3MV11 1H3VA 1MO3A 1QCYA 3EO0A 3IIVA 3DYBA 2FECI 1RXVA 1XXDC 1BEZA 4YTTA 5JASA 1T5BA 2W2LD 4Z7QB 1VCBC 2WQAA 3QYAA 1P2TA 2HRZA 2NTFB 4UUPA 4YRNA 2VL7A 3FO0L 5JRDS 3VFRA 1GORA 1G9NH 3P26A 3JYOA 3W53A 3C4JA 4KCVA 3TFWA 1JGVH 2ODIA 2R1ZA 3BXHA 1JGVL 1IJBA 1T43A 1KCVL 3BE7A 3AR9A 1T1WB 2QGYA 1HCFX 5BWBA 2OUIA 4MZDA 5C7OO 1KBGL 1DELA 3FWPA 3AREA 2OOKA 4ZYKB 3CW2A 3UWPA 5E5RB 1YEKL 2EF1A 1PLLA 3VQ2C 3OLYA 2XUZA 2HNHA 2EJAA 1HQRA 1INQA 3U79A 4XISA 3QEQE 2VJBA 4YI5A 1ICQA 3QZ6A 1U92A 4M0MA 4FGWA 3PV6A 5D6DA 3WEBA 2R7NA 3GX1A 5GRUH 3UOWA 3U0TA 1AD2A 3PC6A 5GRUL 2QL9A 2ZUUA 2QYGA 4N24A 3RS2A 4MI1A 2VXOA 4URKA 3OI7A 1OGBA 4H0CA 2CRYA 3UVEA 4PBEA 3W28A 4Z3FA 1C30B 1KULA 3D4OA 1YFLA 4LXHA 2X4NA 3QGKC 1IT0A 3U16A 1UBFA 1O89A 2HSAA 4JDUA 3IJEB 4L8WB 3ADCA 4GGPA 1J12A 3OXRA 3STYA 2HPIA 4MWZA 2R1XB 1ULBA 4NAEB 2NY5L 1CEOA 5HQLA 1XLFA 4JI1B 1F86A 2AHOA 3C6CA 1MT0A 1NEZG 3FQTB 4KQIA 2VZ8A 4E5XA 4ZTOL 4XD7A 3W7IA 3QNZB 2CVPA 3PEFA 2XY1A 2YHAA 2NX2A 5LKRA 4PJ8A 5I07A 4M2LA 1W7AA 4TM7A 3FH5A 4IS2A 5CLXA 4GAYB 5T33H 4H4IA 1V45E 2G9ZA 2X8WA 3P1VA 2ZYWX 1W0WA 5F93C 3FAKA 1RM3A 4L28A 2XQBH 4NNPL 1DIBA 1JPGA 4GVLA 2FDSA 3ZW8A 4PJCA 1C8XA 4AXKA 2QUZA 3G68A 4FFVC 4FOUA 1RUSA 4QXOA 3QMPA 2VSCA 2I7DA 3DMMB 1DRKA 4HC4A 2Y2YA 3KLBA 3W6ZA 2OR9H 3EVEA 1FP1D 5TGDA 4J3OH 1T2AA 3Q7IA 2B3DA 4NMHA 5ANMB 5FM5O 3CHEA 2Q7XA 2X9LA 2BVTA 5JBEA 3AROA 1ZGLA 3MRTA 4Z2GA 5JLAA 4L8SA 4P4SA 1ESMA 3TNNB 4MQ6A 3RITA 2JIRA 2GI4A 3RUGB 1EDBA 1RYMA 2VN3A 1BWVA 4TRMA 5BWLA 1WUYA 5BWAA 1MEHA 1U8KB 1XZNA 4W7UA 1E79A 2WIAA 2GOKA 4IS6A 5DYNA 2WQ7A 2F8TA 5E9AA 1XIEA 1E6ZA 2VKXA 2VUIB 5MGBA 1QHQA 1MA3A 3FHLA 1NC2D 1X7DA 5KVDH 2EX4A 4LYGA 4JZKA 3I7RA 4NRXB 2Z8RA 2ZTJA 3I5AA 2VHYA 3CURA 3LC2O 5KSZA 1FVCA 1MDFA 3W5HA 3ZLBA 1OGTA 3H6KA 2PX6A 1Z5PA 3M1IA 5CINL 3LX8A 4JYBA 3ABLB 1G9XA 2PYZA 3RS3A 4M7PA 1JR3A 5D4QA 5TQ0A 2FLRT 3B9AA 3ZTYA 1ORQA 4G83A 2LTQB 1OSNA 1ZD1A 2CHVA 1G1CA 2XZAH 2F48A 1JDSA 1C1DB 3DPSA 1F1GA 4B50A 2WJDA 4ZAWA 4JA2A 1W5AA 4KROC 1LDPL 3CLSC 4ISBA 5EOQH 2XFXB 2FWRA 2QKFA 4XUGB 2BINA 2H4EA 4GR5A 4K1LA 4DV5B 4C4SA 3TMLA 4EI2A 4RK1A 4JZNA 2OXHB 2XNAB 4GW4B 2OORC 4WL0A 1W96A 3H4FA 5KOIA 7REQB 3EXTA 4YC7A 4ROQA 4FD3A 2AOUA 3Q7TA 2R8RA 4ZUTB 3I4FA 2NXIA 3EAKA 4YDKL 4Z95H 1CR6A 4APXB 3EPNA 1Z1WA 4K0RA 3WTXA 5COAA 2Z6UA 1BKYA 3MRFA 1O54A 4OZGE 1Z3RA 4M48H 2PD3A 2Y9RT 2YJZA 3NIDB 2VLRE 4FI7A 4S1DD 1KM0A 3OC0A 2YOGA 4FLSA 4GPAA 5FV1L 3NHZA 3S8GB 1OLSB 1OM9A 1WD9A 3MWEB 4XEUA 1INLA 3VTFA 4ZDWA 5KVDE 4D8LA 4MBRA 4OK5A 4KIRA 1ZH8A 3A1FA 2EEZA 4R40A 1HORA 4NK4A 4OZ4A 1GYRA 2NO6A 4OXKA 1H3TA 1GTRA 5A6MA 1LPPA 2P45B 1HTTA 3D6UA 8A3HA 1KGCD 3MO1A 5EZOL 2UWEE 3Q7EA 4A3YA 1W19A 3H9SA 1ODKA 5EFOA 3UJBA 5JXQA 1ZCFA 3OIDA 2BTQB 3EJWA 1GRRA 4TYWA 4DQUA 4JLBA 3QRWA 3O6YX 1XTPA 1BDMA 4TN9A 1E0JA 4JFDB 5JEDA 1UKOA 4GP6A 4U1HB 4A7UA 4W4TA 4P23A 3JVVA 4AW4A 5JXAH 5EJFA 3ZUGA 4AC4A 4JT8A 2OA9A 4CM7A 1WYJA 1TCDA 5IW3A 5I3GA 4EN2A 5GADl 3L7EB 2WQWA 3AZRA 3ISIX 4ENEC 4AROA 2N56A 2ZVJA 5C80A 4KLCA 3SYKA 2AXEA 1OTYA 1FXUA 1KLUA 3GO1H 1NP2A 1UKYA 1OFOA 4OF3A 5HRUA 4D99A 2Q71A 3ARDD 5TE7L 5KDDA 1MQKH 1TC1A 2X2GA 1IZCA 1OHQA 1SMDA 3L49A 3HH8A 2WYWA 5AY7A 1Q6OA 1G9EA 1JBEA 5E9QA 3QAZB 1NSNL 4PJ9B 1A1NA 4BX8A 1UPBA 4ZALA 4CD6A 3EA0A 4ZI7F 2RKXA 2JLAA 5THXA 3PXUA 3CRNA 4ARZB 2GM4A 2O30A 2Y2WA 4AC9A 1ZUIA 4LQCA 4OOFA 3C6LD 3LGAA 4OGKA 2VKQA 4PY7B 4H2HA 4P61A 2MSPA 2PA0A 3MRDB 2Q8AH 2B4CC 1FCUA 3E5NA 5IESL 4MCYA 4LRSA 4FP1A 3GA5A 1FQ9C 2ENWA 4RKQA 4YR6A 4JTJA 3VDGA 1SU7A 5CCHE 3CJJA 1JUFA 2D7MA 9XIMA 3IPYA 1S5IL 4OXRA 4RENA 3BGMA 4LAOA 3IDZA 4IM4A 3NTXA 2OYPA 3IBYA 4NZNA 1CXFA 4MADA 4DLVA 5KEIA 3RY4A 2DLGA 4Z7IA 2XWSA 3R6LA 2D06A 1AG0A 4I7ZC 3I37X 3H9ZA 2I33A 3DENA 4NSKA 6FABH 1DEOA 5G5IA 4Y6RA 2ZK7A 1R3TA 1GQOA 5KJCA 1QIKA 4QWWC 4PTMA 4KPHL 1AQ0A 1OXMA 1XZ0A 3CPLA 3M0LA 1UZHA 3O8OB 1LQAA 2Y7FA 4IIUA 3U4EB 3L9RA 3RA7L 2C59A 5CIPA 3OCWA 3HIJA 1GW9A 5L3SB 5CB6A 4GAGL 1PQ4A 2NZJA 2R751 4TUUA 2OV4A 1VIWA 1OX6A 4KB5A 3UZQB 3DOSA 1PT7A 5DJAB 3S8FB 3C6SA 1UZAA 3TCSA 4PLNC 3AR5A 1CY2A 1HI6B 2Y7MA 2ZYHA 2E1WA 2G3FA 4Y6QA 4JT2A 4CBVA 4W6WB 1RHJA 1GCGA 1JLHA 5CNMA 5B7ZA 4XD4A 4M55A 4GWGA 4V0NA 1RFDL 2ZICA 1PTJA 3E03A 2C2WA 4AG6A 3MZGB 1P2BA 4WDQA 3HWWA 3LXXA 3MMXA 3ANMA 4DR1B 3MW7A 1YBQB 3JTTA 1LH0A 3BMQB 4X6EB 3TE7A 4B82A 3PFRA 2G2RB 2NUAA 1OFHA 2OYCA 1LK2B 2Y07H 1MMFB 1XLMA 3A58B 2HNEA 1X19A 2XCIA 1DCEA 4TQEL 5ICYB 4LKCB 3SZLA 4MNGA 4YSDA 3KLDA 3AFBA 3EIFA 1BBDH 1WF5A 5AIBA 3H5LA 3TAKA 2OTCA 5K8TA 1M72A 5LCVA 1NE7A 4N54A 5EUOF 1U28C 4A22A 1DQJA 2BMJA 3WQBA 1YMVA 3W5AA 1DVYA 1PWZA 3B89A 1XCJA 5IT9A 4UTBA 1LLOA 5EKYA 1XRMA 5IK3B 3W2NA 1D2OA 2VEGA 3NO1A 3F6LA 3B9VA 1QDLB 4US0R 1UH5A 2KLHA 3FQXA 5EGNA 1BA9A 3LNMA 5IJ0A 1OY3B 3JV4B 3N9GH 4QEHA 3B1TA 2J3IA 5GRWA 2HZBA 1VSCA 3TEXA 4DYDA 3QUXB 4CF4A 4M1MA 4KNQA 3AUJA 1BFNA 3UAOA 2L2QA 3K6SA 3O4IA 3UMTA 1YYLH 4TWBA 5DVMA 3INRA 1TWZA 3T0XA 4JAVC 5HJGA 3OAYK 1D3GA 1HG3A 2I4RA 4LCEA 1B6TA 3DAFA 4GE3A 2Y4SA 4MHTA 2D24A 2CFOA 2FBOJ 3BOVA 1P0CA 1ED3B 5FUCE 1PDKA 1PDOA 4XZLX 2WHKA 3ZI4A 2BEVB 2PX0A 4P7LA 2X2OA 3TGXA 2PYEE 1N3BA 4DDKA 1SIUA 5CJJA 4U1LA 3EOBB 5ENDA 2AQHA 2YN5A 4JX0A 2B0SH 2YN0A 4BFRA 1QDSA 1MJ8H 2UUOA 1U2DC 3L3IB 4BLSA 3WAGA 1RWPA 2QY6A 4WVXA 3QJFB 5JXJA 4M6WA 4OM7A 3KR3H 1U1UA 1UCFA 1ZPLA 3CFEB 5FK9B 1GPFA 3DX6A 4U02A 3W9YA 5FFFA 1GZHA 3RPDA 2ZYDA 2KZHA 3IACA 1QPNA 1KJ2A 4ZREA 5HYSG 2MSCB 4TNWF 1NCHA 3LQAL 2KS0A 2OV3A 2YW9A 4F4JA 3V4BA 4LVGA 4PB9L 4S3AA 1LTKA 3CPUA 5AICA 4O4HB 2JKJA 4KK8C 3PKIA 2FJFA 1AZ1A 4BXOA 5EZIL 1SM4A 4O8RA 4DK3A 4F3FB 3R25A 3OECA 1E28B 4EJFA 1M41A 1E98A 3K3QA 2DWPA 4WJ5A 3X2QB 3P0HA 1I4LD 1APBA 4DGWC 3I6GB 1UFGA 2PMZA 3VABA 4HS8H 1S2AA 3O74A 3UXKA 1SZEA 2EYSB 3FCOA 4MJJA 2DZDA 1K9DA 1XR8A 5T1LD 3LNTA 3D4IA 2ZXEB 2F54A 1W72L 3W1NA 4JL1A 2VPYA 3WIEA 3CH8A 4CLRA 3HDYA 1AKPA 1RI1A 1WTLA 3CVBA 5C7LO 4R84A 2BSXA 4TTVA 1KFJB 1E3SA 5C0BB 3TNOA 1ODIA 3GZ4A 1FYHB 4WUUA 2PGEA 4QXMA 2HKIA 1YDPB 4QRUB 4H0FA 3NZRA 5DCLA 5FKPA 1T1YB 3HV2A 5AUQA 3MUAA 1IT8A 2HQSA 1I6LA 3MGKA 1DSWA 3SIMA 1WZ1H 3G6JB 3ZE0B 4MDOA 1RH8A 1EJWC 4P8UA 2FO8A 4CODB 2DKNA 4HX5A 3BJEA 5AVQB 3D8RA 1A8UA 4KQ2A 5I7FA 1WJGA 3EHBC 1N7KA 3IAXA 2RGLA 2N1KA 5EZQA 2H3NA 4RPPA 4QDJA 4YT2A 1VYHA 1V0JA 1X1BA 1WKDA 4CDGC 1Z08A 1RZPA 4KRMB 1ZZEA 3U80A 2ZKLA 4I2XE 3NVMB 4GXVL 3NJHA 1XR3A 1CYEA 2CKNA 4XB3A 5JH1A 4GKZA 2GL5A 3VZDA 3RD5A 3IEAA 4PW4A 4CDHA 4IWNA 3DMGA 4HWSA 2XSKA 2Q6LA 1FHDA 2YHUA 5D6OA 3WZMA 2GNAA 4AH7A 3CKLA 5HDBF 4JIMA 5SX4I 4XWGL 1L6RA 1Q1QA 3QWHA 2F1RA 2XQJA 5ALSA 4IBQA 4M00A 4NICA 3TPFA 4U7PB 5J63A 3GG8A 1NXPA 3KYCB 3CBJB 3M4JA 1WDLA 2EQDA 3C6XA 2GCOB 3BP4A 4WTXA 2P9TA 2G50A 4DG5A 4XNQB 5C86A 2ZUSA 5HMDA 2VWSA 5J5CA 2HADA 1RUPH 3GEHA 5H37H 4BFVA 4ZYWA 3PVZA 3VGDA 4X61A 2A58A 1Q14A 3THRA 3FI9A 3M0HA 4HWUA 4RS3A 5H2BA 5KQSA 2Q4DA 3SQOL 3IWPA 2OYLA 4PUMA 4QEEA 3VDXA 3PWGA 1R12A 5IDWA 4AISA 1WPCA 2P27A 4RSHA 3B9RA 2DJSA 3PKJA 1Z0MA 1FQ0A 3F71A 1QO0D 4PV7A 4WIAA 3DBOB 4F8LA 4RJ2A 2FWMX 5DGDA 3QHAA 4RDXA 3A6PC 4MHHG 3SC2A 5LD2C 3RWHB 1UGKA 3LPLA 5K6AC 2HBZA 1RZVA 3DPUA 2HLNA 3S44A 3L6BA 5CZTA 5GWXA 1B43A 3FT1A 3GDFA 2Y7GA 4Q7BA 3SGKA 2O2HA 5TQ2B 1UOZA 4DT1B 3AIEA 3V55A 2PSFA 5AC4A 2LU5A 3LSOA 1MAKA 3BMCB 1W1B1 3ZW3A 4JFSA 2PZEA 3CV6A 2J9ZB 1