4UOQA

Nucleophile mutant (e324a) of beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
689
structure length
683
Chain Sequence
HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMAQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-GALACTOSIDASE
publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
molecule tags Hydrolase
total genus 241
structure length 683
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uoqA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uoqA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uoqA02
5GQBA 3WDQA 3M6DA 3AIRA 4EK7A 3W53A 3VGBA 2YWBA 2CPUA 2VR5A 1CYGA 3W29A 4MPKA 2V3DA 1H41A 2XUCA 4GXPA 2J79A 4Z2JA 3BXWA 4MJ4A 4AIEA 1G5AA 1CE8B 1CXEA 2XFYA 3W27A 4JIEA 1KTBA 4XB3A 1A3HA 8A3HA 2G3MA 1W1YA 4K2HA 1G1YA 2GUYA 5A6JA 3VTRA 3AMDA 5I6SA 3KEHA 1H0IA 2QPSA 3EDEA 4MB3A 3S5ZA 4K68A 1HP5A 4AZBA 1QW8A 3U57A 1W91A 5A2CA 4CCEA 5SYAA 2EPLX 2D3NA 4GINA 8CGTA 1P5FA 2QV4A 2ZUVA 2VCBA 1I1WA 2WSKA 3ZJ8A 1PDVA 3EDJA 4PMUA 2WVVA 1V6WA 2GK3A 3SUSA 3WDIA 1GOKA 1ZJAA 1MQPA 2WCSA 3WF0A 1R87A 4E5VA 3FXYA 4B3KA 2YLAA 4P7NA 1M53A 2OLHA 1CZ1A 3QR3A 3WENA 3LPPA 1LL4A 2QPUA 4P7RA 3VO0A 4UFKA 1GHSA 1GOQA 4Y1EA 1CPUA 4IISA 3L2MA 1E4NA 4Y1RA 2C8NA 4M80A 4MTCA 1GQJA 4W8LA 4P8UA 3WH8A 5ABFB 1JYVA 3NIYA 3AYSA 3CZLA 3WDRA 3BHNA 4WF7A 1UQYA 1TQUA 4N42A 4UOZA 1TQWA 3TTQA 3VGDA 3D5HA 4MDOA 3VILA 1W2VA 2W61A 5D8WA 3OT1B 2VI0A 2VX7A 2YOCA 3RCNA 3VMNA 1EH9A 1I7SB 5A6BD 3ZR4B 1E9LA 9CGTA 3ZSSA 1BYDA 4KRTA 1XSJA 4XZBA 3ARSA 4EKJA 1QNRA 2F1AA 1CWYA 4PUEA 2VRJA 3WELA 1XV8A 2BVDA 4D72A 2GK1B 1EHAA 4LXFA 5E6YA 3U5UA 2E9BA 3CHDA 1QX1A 3SOZA 1ZS2A 4AD5A 4D6FA 5IP5A 4LGYA 2A3HA 4X0NA 1A9XB 3CO4A 1KR1A 1O6IA 3WH6A 3ZJKA 5DEZA 2ZX5A 2VRQA 2GJPA 2OYKA 5BV2P 1AQMA 1X6LA 2DEPA 2DSVA 2YA0A 5CPQA 1QVZA 1UHVA 5A6AA 1V0NA 1CGWA 2R1UA 5E70A 2DGAA 1W1TA 3VIKA 3NUKA 2J7HA 3PZVA 5AYIA 4AZGA 5A6KA 2WJZB 3B36A 4ATLA 1XYZA 1GUVA 1UKPA 4PTVA 4XUYA 3ZJ7A 4TVCA 4U5IA 4B9ZA 4BIMA 1K9TA 4PTXA 4BFLA 4ENPA 1CGYA 4YHGA 3GDBA 3OB8A 4ML4A 5JIPA 2XWDA 1UG6A 1B9ZA 2J7FA 4URIA 2DT0A 3T0AA 3EBVA 4QP0A 3SCPA 1BLIA 1KGWA 3AXHA 4D1JA 2GJXB 2E4TA 3UG3A 1WKYA 1E1FA 4DWSA 1DTUA 3SF8B 5HOSA 3TTWA 3L4WA 4AYSA 4MB5A 5M17A 1W9DM 3WEZA 1NM9A 4OOZA 1KGUA 2PC8A 1UYQA 5I2UA 3J7HA 1FH9A 5FCZA 3OGRA 3WF2A 3CZEA 1MW2A 5F7UA 1IZKA 4DWSC 3WFZA 1CGTA 4GQQA 1QNPA 2PWEA 1L8NA 4CCCA 1SFSA 4NRSA 1JAKA 1OBAA 1Y7VA 4CVWA 2VDJA 1EDTA 1JNDA 3R75A 3LRLA 3QHOA 2FYVA 1AVAA 2DDXA 3WQ4A 2CEQA 2AB0A 5JBFA 3L2LA 3CGTA 3MI6A 4I4NA 4ZDIA 4R5EA 2A9VA 4PTWA 1W9BM 2OYLA 4IPNB 1TG7A 1MXGA 4J3TA 5BWFA 2F61A 4HZ8A 1KBKA 2LXNA 4CN6A 1E43A 2EABA 5HBFA 4PMDA 1J0YA 3L4TA 2C0HA 4RE4A 3CPUA 2ZUNA 3D3AA 4CN4A 4CCDA 1HP4A 1OI4A 1KCKA 4N0RA 3FW6A 4LYQA 3PZMA 2W67A 4EAMA 1V3JA 1IV8A 1JXJA 2Y5EA 1TVPA 3R76A 1I1XA 3AZRA 3P9QA 4ENQA 5JZMA 4DWSD 3AHZA 3D54D 3VGEA 3BSGA 1UZ1A 5A6SA 2ZXBA 2QLYA 5A8NA 2PWDA 3ARZA 4CD5A 3F5LA 4LX4A 2VCAA 1J01A 1U2YA 2OW7A 1KFWA 1ISXA 4AD3A 3GTNA 2D23A 3G6LA 3F71A 2PB1A 4JFTA 2E8YA 1ZBVA 4YHEA 3VD5A 4H8HA 2VCCA 4D1YA 4NZCA 4NZFA 2WXDM 4AYGA 3W25A 4Y0NA 3WMCA 1E3ZA 3WNNA 4XV0A 1VJZA 4Z2KA 1QF7A 1V02A 3CTTA 1TA3A 4AISA 4GQRA 4J28A 1JI1A 2WPGA 3BAXA 5BXSA 1ONSA 3D52A 1CS0B 2J4GA 4KRUA 1FH7A 4AD4A 1R46A 2HVMA 1GOOA 2VC9A 2XF2A 1UOKA 5TD4A 2A3AA 3QGVA 1HT6A 1WDPA 3RDKA 4Y1GA 3VDBA 3TTXA 3AOFA 4PMZA 1KBBA 1BQCA 1FH8A 3QHNA 1C7TA 3NJ3A 2WW5A 4Y1FA 1CENA 2J75A 2OWCA 1ECEA 1QHZA 3MO4A 1H0GA 2XGIA 3EYPA 3FSEA 3WF4A 1R47A 1U30A 2PWFA 2J77A 2BXYA 1E5NA 3GBDA 2D0GA 3KE0A 6CGTA 1WCGA 1QNOA 4BS0A 3B38A 1OINA 1KXHA 4FLOA 1LWJA 2D0FA 3WF3A 5K4AA 1J0ZA 4L7QA 3H55A 1UR1A 2X09A 1E6NA 1HJXA 4U31A 2EBNA 3AHVA 1GNXA 2DT3A 2R1VA 2OSWA 6A3HA 1UD2A 2J78A 4GI8A 4W5ZA 2DH2A 3UOWA 2DT2A 3ZT5A 1VEMA 5C70A 2BFGA 4X0VA 1V0MA 4ATDA 4P2GA 3HG5A 2ZE0A 1LLOA 4S3JA 3ZOAA 2GFTA 1R8LA 2UY5A 5ECUA 4L8WB 1EOMA 4H7VA 3VM7A 1RP9A 4CUCA 1WE5A 2E9MA 4W8AA 1B3VA 3MV01 2Y8KA 4R27A 1EO5A 2EO7A 3WUGA 1JZ2A 2DSKA 3W24A 5E1QA 1XRVA 1CTNA 2ZUWA 2J25A 3MMWA 1PEZA 4PMNA 2O9OA 1UD5A 3PTMA 4WJXA 2VRNA 1MW3A 4ENVA 4H04A 3AIBA 4CKQA 1I7QB 3OA5A 3BLBA 4MNJA 3DDGA 1GGJA 5JBDA 1R7AA 1R9GA 3MUZ1 1AMYA 3AQUA 2VX4A 3AHYA 5GNXA 2WMFA 4FMVA 1XD0A 3IAPA 2F7OA 2WWCA 4HA4A 3SCOA 3DYOA 1PIGA 1JAEA 1JXKA 1XH1A 5KZ6A 5I77A 1MFUA 3CIVA 3CYFA 3LXBA 1DWJM 1F4AA 2J7EA 4HU0A 4W7VA 3T0BA 4AWEA 1JDBC 3PTKA 2PF0A 1US3A 1JF6A 3TV8A 1QNQA 3WDJA 3WUBA 5A1AA 2BY3A 2E8ZA 5LA1A 3ZR5A 2W5FA 2XPKA 3QOKA 1ISWA 2A3EA 2XGBA 1ZBWA 2FGZA 2WM0A 2BY0A 4J3SA 3VGHA 1UQZA 1KA9H 4CU7A 4U33A 2J47A 1GORA 4GE0A 4D6GA 4WK9A 1Q2UA 3N17A 2YL6A 2WVUA 2VX5A 3VIFA 2XM1A 4QLKA 1QWUA 4JFWA 3WBEA 2DIJA 4U2YA 3UMMA 3N13A 1WO2A 2DPEA 4DUWA 5FOOA 2WVTA 1AQ0A 1W9PA 4J3VA 1H11A 2FDMA 3LPGA 4D6IA 1BPLB 3DHUA 3BUQA 5IXEA 2CBIA 3BVWA 3L4ZA 5CXPA 4PN2A 2JFEX 2CHOA 1E40A 4ENRA 4JCMA 2YWDA 2FE0A 3I3BA 2ZOXA 4Y1RB 1J42A 3SCTA 1BSIA 1D2KA 2NV2B 4UFJA 3AISA 1SZNA 1UH3A 3ZSTA 1CGXA 5FIPA 3JUGA 3DX1A 4FNQA 2D24A 1TQVA 3WNMA 1ODZA 4PBGA 1CXHA 5FL1A 4J3UA 3UETA 2VJXA 1WZLA 3L4XA 1J0JA 2G41A 1HF6A 3ECQA 4OGGA 3IJ8A 3QOMA 4J3XA 4M24A 3W0KA 3GRAA 4ENTA 2J7BA 1EDGA 4AIUA 4QLJA 5E09A 4V28A 4W8BA 1Z32X 4OUEA 3MKKA 1P7YA 4GZJA 1HJQA 1TMQA 5A2BA 3BVXA 4PRWA 1R85A 5A69A 4BQ4A 1Q6FA 3WMSA 4X9YA 1VFFA 2O9RA 4YPJA 2RK6A 2E0PA 1TUXA 3VIMA 1W1VA 3HJEA 3MV11 1UKOA 4PMYA 1VB9A 3WD4A 1LF1A 5HDRA 1BFNA 3CY6A 1J9YA 3WD0A 3O6AA 3EJSA 2JE8A 1V6XA 2YDSA 4DM2A 4WXYB 5CSUA 2CIPA 3PZTA 3D51A 5DT7A 1BYBA 2XN1A 2ESCA 2YBUA 1KR0A 1UA7A 4P34A 3NVAA 4GZIA 2X05A 2F8QA 1JL8A 2VT0A 1GQIA 3WL0A 1OX4A 1NARA 3WY2A 2XWEA 2EADA 4TOQA 1OY1A 3M07A 2Z1KA 1UR0A 5CPSA 3BSHA 3EFEA 4AMWA 2NSXA 2BXZA 1Q4NX 2ZWZA 3EMQA 1P7ZA 2YIHA 2EPMX 2XHYA 3VIHA 2ZUUA 2CYGA 2TAAA 1KEEB 3VMPA 4HTYA 3WH5A 1UWUA 3EJ6A 2WCGA 4A3HA 4ACZA 2F7RA 3PZIA 1I1QB 2V38A 4W5UA 1BYCA 1OCQA 5CQ1A 3WNLA 4TTUA 3EMCA 1SMDA 4B9YA 1FP8A 3THCA 1O1YA 1R75A 1BGGA 2DSUA 5A6BA 1U9CA 2D22A 1QVWA 3EJUA 3APGA 3ZQ9A 3GXDA 4JHOA 4MNKA 4UCFA 1WB0A 3GNRA 5EFDA 3ZJ6A 4Z2IA 5CZKA 4B7AA 1EO7A 4CN1A 1US2A 1JDDA 3W28A 1M6VB 2PBOA 5ABGA 1BTCA 3BVTA 4U2ZA 3ZT7A 1R33A 5DFAA 2AOSA 3PZQA 3L7NA 4CGTA 3MUIA 1JNEA 3G6MA 5DMYA 2WANA 2WYSA 3AZTA 1QWSA 1MFVA 3EDDA 3MSDA 3OZPA 4OIFA 4QLLA 3CZAA 1HWWA 2XFFA 1JG9A 1V02E 5E9AA 3VM5A 1H2JA 4PMVA 3NOQA 1O7DC 4B5KA 2W92A 5A8PA 2BVYA 2VPIA 1PPIA 4JCLA 2J8FA 3L4EA 2JEQA 3WY4A 1PDWA 5HPOA 3U7BA 1NWUA 3RJYA 4HP5A 3UR7A 3B9AA 2V3EA 2ISSD 3SCVA 2ZUMA 2FHFA 1UZ4A 1X1NA 2V4UA 2WC3A 3RM8A 3VDAA 5BRPA 2F7QA 2D3LA 3AIWA 1VRXA 4V2XA 1RD6A 1NWSA 5AC4A 2FHBA 4AZ6A 3ARYA 4ADSG 3TTYA 3VU3A 5GPRA 1ZB5A 1V3HA 3PQ5A 2ZWYA 3W4RA 3ZJ4A 3GXNA 3WNPA 2YL9A 3MIIA 2D1ZA 1T3TA 3VINA 3UK7A 2NT0A 3A24A 3DX0A 4HU8A 1LL7A 4D6CA 2NW0A 4NI3A 4WKAA 7CGTA 4OJYA 1NWTA 4UFHA 4P5PA 3K4DA 5LYRA 1QI3A 1HNYA 5HPCA 4UNIA 1DWIM 4UZUA 3GXPA 3A22A 3CZKA 1EOKA 1R7OA 5A8OA 1HXJA 3MSGA 1CDGA 2CCRA 1FHLA 2X0HA 1E3XA 5HNNA 1EHNA 1XYFA 3W82A 3MGKA 4D1IA 4F9DA 3AYRA 2UWFA 4TVDA 4GI6A 1TA3B 2QF8A 4P8VA 4QCFA 4L95C 1Q6CA 1HKKA 3EDKA 4IM4A 3WH7A 1HKIA 1TZ7A 3ER6A 3WQWA 1UWSA 3CHFA 4JKKA 2V3FA 2WKLA 1PZ2A 1UD8A 3CUHA 1T36B 2D73A 4WKFA 2XFRA 2XN0A 2WMIB 1VCOA 2EPKX 5IFPA 5IDIA 4JFUA 3WY3A 4RE2A 3N18A 2BY1A 1M01A 3ZMRA 5BXRA 3UG5A 1UUQA 5C8BB 4PUDA 1GQLA 3PZOA 2VQTA 2UY4A 1N57A 2EPOA 3VIOA 5EFFA 2O9PA 2ZX9A 4DM1A 1PV2A 3CUGA 3VIGA 4UZSA 1TQTA 4ZXLA 4CU6A 3EJPA 3AMKA 3BLKA 3VOCA 2ZIDA 3KL0A 5A6MA 4UTFA 1CXLA 1TQSA 1GZJA 3BAKA 1C91A 3WD2A 4FNRA 3TTUA 4ZENA 1WDSA 1WZKA 1B3WA 2ZX6A 3IANA 2G3IA 5JIWA 4MAVA 5D8ZA 1MQQA 1T0BA 4W89A 1YQ2A 2PBGA 1CECA 3KZSA 2OSYA 2R1VB 3WFLA 4JAWA 3SUUA 4D6EA 4ZDJA 3GXIA 1GPFA 3B3AA 3BGAA 2XIBA 5A8MA 1NWRA 2A3BA 1E4IA 2ZX7A 1GCYA 3NSMA 1W9VA 3WUFA 1P6WA 4AZIA 1UKQA 1V0KA 1SR0A 4QCEA 3AJ7A 5IHRA 2YJQA 3VNYA 1UWRA 2VR4A 4AMCA 3MUY1 4H8VA 3HG3A 4GO9A 4B3LA 1CNVA 3WSUA 4P36A 1XHGA 3IGUA 1NOUA 5D9PA 1BF2A 3NYDA 2CERA 5ABFA 2WVSA 1B1YA 2GSJA 5ABHA 3POCA 5E0CA 3OT1A 3NSXA 1W3JA 1FHDA 4Q22A 2CKSA 1W9XA 4AD2A 2DIEA 5I3DA 3E1F1 4ZEPA 3L4VA 2ZUTA 1XH2A 3L3BA 2BS9A 2EQDA 3U5YA 4UQBA 1OGBA 4W88A 4HMDA 3ARUA 4F66A 3GBEA 1OGGA 1JGIA 5ABEA 3WIJA 2MANA 1OIFA 4FNTA 5FD0A 4OGFA 4KWUA 2FH6A 1K9DA 3DYPA 4TUFA 4OKDA 4NSBA 3NDYA 3LXCA 1LG2A 1ESWA 2YWCA 2GDVA 4HOZA 1JZ8A 1CF9A 1J0IA 3VIPA 1J0KA 4GE3A 2RGMA 1LWHA 2QMJA 2X2JA 4S0ZA 4ENSA 2X0YA 1ZL1A 4FNUA 1HVXA 3AZSA 2X2YA 3AS1A 1UR9A 3AXIA 3P9RA 1VBRA 3POHA 3IAQA 1ITCA 1J18A 3BC9A 3GNPA 1B2YA 5A3HA 1LQ0A 4UQ9A 3ARXA 3PHAA 4ZE5A 1FY2A 2JALA 4NRRA 3VKKA 3MS8A 1VEOA 4M81A 4P35A 4GKLA 2XN2A 1M03A 1HKMA 3ARTA 4CU8A 1GW1A 1GVIA 3S5YA 2G4FA 1C3OB 1P81A 1XGZA 5BROA 2W91A 1E0XA 1JF5A 1H4PA 4AZCA 2O9TA 4QFUA 3WH9A 3OGSA 3RM4A 4M1RA 3RPMA 3N15A 4CD7A 1QPKA 3GXFA 3F4VA 3WMBA 2G8ZA 1V6UA 3K46A 3VGGA 4E8DA 1BG9A 3ZM8A 3VSTA 1J12A 4HA1A 4D6DA 3VPLA 3KKLA 1E5JA 1QNSA 2FHCA 1E6ZA 4V27A 1WDRA 2VVSA 2WNWA 4RL3A 1KXJA 1UH2A 4L4PA 1VCNA 5CG0A 2G3JA 2IXVA 1MXDA 3CBWA 2JF7A 1UCFA 3EJTA 3AROA 2ZUSA 3KLLA 1P80A 5LA0A 4GO8A 1BHGA 3PQ6A 3ZJ5A 3AS3A 1PE0A 3RMEA 1PX8A 3GH4A 1Q6DA 4XX6A 3NOOA 4JQSA 4PMOA 1KWKA 3VIIA 4PXYA 2X1IA 2WC7A 1VF8A 1V6VA 3EMZA 1UR4A 1JZ3A 4WSKA 1TE1A 2A3CA 4OFWA 2BV9A 7TAAA 1OD0A 4JFSA 4AIOA 4JZ5A 2DSWA 1GQKA 3PQ4A 2YWJA 1E1EA 5EMYA 1EXPA 2V3GA 4UOQA 3M46A 4U3AA 1OGSA 2DH3A 1EQPA 2YA2A 1JZ5A 5I23A 1QI5A 5CPTA 4E4PA 1CGUA 3CZGA 1WZMA 3TTSA 4HMEA 1JZ4A 3CUFA 4HA3A 3N9KA 3AHTA 1IZZA 2BVTA 3SCRA 1TFVA 3NSNA 4D6JA 2XVGA 4L8FA 5GNZA 4R7GA 3AIQA 4AC1X 1E71M 1BG4A 2W63A 3WQVA 4UQAA 4UFLA 4PSRA 3ARWA 3TP4A 3VDCA 1QW9A 1E55A 4N12A 4AUNA 3RM9A 2CETA 2H2WA 3T2PA 3GXTA 2FEXA 2W66A 3MUAA 4W7UA 3S2CA 3BWEA 1NP2A 1CXKA 4FNSA 3CV5A 1MWOA 1KWGA 4MJ2A 2WVVB 4UOJA 4UQDA 1EA9C 3WDPP 2XJ7A 4MNMA 3RIKA 3ALFA 3W6MA 2R1TA 1FA2A 5M03A 4PMXA 4XZWA 4AD1A 3AMCA 2XYLA 1IT0A 4E8CA 4MTVA 4JKLA 3NORA 3WD3A 1V0LA 3W26A 2X2HA 2CITA 2WCAA 4RKYA 3OG2A 2D0HA 3OGVA 4WSJA 5M5DA 5A6LA 4PCTA 1Q6GA 4FF5A 1GVYA 4DO5A 3PZUA 2Z1SA 2PWGA 1ZJBA 4BZYA 4OZOA 1JD9A 3CNEA 5EBAA 4GZEA 3NONA 4F8XA 3BAIA 5SY6A 1ISYA 2WC4A 3AIEA 1E0VA 1GOMA 1BGAA 1XSIA 2GVYA 1GPMA 2W62A 1TCMA 3M3PA 5D9MA 2JEPA 2OWXA 1E72M 2VURA 1AQHA 1V3LA 3K4AA 3F5KA 3AXXA 4FLSA 3VSVA 1E73M 4S3KA 1J11A 3PBGA 4TX8A 1C3FA 1X6NA 4H41A 5BXTA 1W32A 1M04A 1CXFA 4ACYA 3LX9A 1BAGA 2VZTA 3EDFA 1CGVA 3FNDA 2XSBA 2VVNA 4JKMA 2D20A 3PZNA 3AS0A 3VX0A 5LA2A 1CLVA 2QHAA 3GH7A 3CMGA 1PS3A 3VD9A 2WZEA 1MVYA 5GNYA 3THDA 3K8KA 5EB8A 3F5DA 1QOXA 1WZAA 3VU2A 1QI0A 4B40A 2DQXA 3CZNA 2VZSA 3VX1A 1KXTA 4KH2A 1CXIA 1RPKA 4LYRA 4DUVA 2F1BA 3EJRA 3OBAA 2PWHA 2J74A 1JIBA 4OBSA 2E3ZA 2WK2A 1QWNA 3LMYA 4XLLA 3IJ7A 1H09A 1UH4A 1XCXA 3PTQA 3PZGA 1KXQA 3WDHA 3VUPA 1UD6A 3AMGA 3H54A 3DHPA 4JL1A 4ZXOA 1E6RA 1H5VA 2W4XA 5E6ZA 2VUYA 2E9LA 1V3KA 1UWQA 1PAMA 1FYEA 4LYPA 3EJQA 4NF7A 2CESA 1UR8A 4DWSB 3GM8A 3I3EA 1JYWA 1ODUA 3AS2A 2WBGA 5M3WA 4BF7A 4J7RA 2WHJA 2EJ1A 3U7VA 1V6YA 1JZ7A 3BAJA 1JZ6A 1E4MM 3K8MA 3LXAA 5CGTA 3AHXA 3RILA 4DO4A 4GI9A 2EACA 3CZ9A 3BUDA 1VFOA 5SY4A 4L8YA 3OIHA 2XTKA 4KMQA 4HZ6A 1BVNP 2Y2WA 2XVLA 5IFTA 2YFOA 1E6XM 3FAXA 1WL8A 1IPHA 4M8UA 4U3CA 3BVVA 4JHZA 3SCWA 3BLPX 1QBBA 4I46A 2YDQA 3A4AA 1KQZA 3GYCA 3M7SA 3T2QA 1S1MA 4D71A 4C7FA 4FK9A 2W7TA 4AMXA 1DEDA 4PCSA 1VBUA 3A47A 3OLDA 4DO6A 3ZO9A 3CH9A 2GDUA 2Y24A 1E4LA 1V08A 1NP0A 2WBKA 4EE9A 1HXKA 4W86A 1UR2A 4UR9A 1EDQA 4YN5A 1JFHA 2AAAA 5CJ5A 4HPHA 1R86A 5I0DA 3D4YA 5JBEA 1OIMA 1WAWA 2WAGA 2DT1A 4E08A 1W3HA 4J3WA 3PQ3A 2Y8VA 1QI2A 1UD4A 3AFBA 2V5CA 1JYXA 2J7DA 1KB3A 1QHOA 1H1NA 1JYNA 1RP8A 1XC6A 2CBUA 4W7WA 3TQIA 2BNJA 5CLWA 2XG9A 1E0WA 1VHQA 2AD5A 5A95A 4BA0A 3EN0A 3WEOA 5JUVA 3HG2A 4CD8A 1OB0A 2J7CA 5AY7A 4H8UA 1PX4A 1FOBA 3FY1A 3SUTA 4CD4A 1VCMA 4CD6A 3ARQA 3DDFA 3O2LA 3WY1A 4BQ3A 3VD4A 1HN1A 1B3ZA 1MYRA 1JVNA 3RHTA 1UWTA 1H3GA 2J62A 5A2AA 3UERA 3A6OA 3N1AA 4TVUA 3AICA 1EGZA 1VFUA 3AMLA 1J0HA 1GOIA 2ZX8A 5I24A 4I2NA 3NDZA 3BUPA 1DWFM 1VEPA 3SURA 4WKHA 5SY9A 3D50A 1OWQA 1K6AA 1D3CA 4W87A 1IZJA 3CUJA 4PMRA 1PIFA 3SCNA 4MADA 5A8QA 3AIVA 3MMDA 1L0PA 1I75A 4PEEA 5AC5A 3CZSA 1OX6A 4ENWA 2VO5A 1K9EA 3SUWA 4B31A 3EZGA 2CBJA 4AUEA 3UGJA 3BAWA 1PZ3A 5BXPA 1G01A 1QVBA 2JF6A 3IK2A 3VD7A 4TTGA 5IHSA 1MQRA 2YFNA 1V3IA 4ZFMA 4NXKA 3L4UA 2ZXAA 2JIEA 3TTTA 3B9EA 1U33A 1KCLA 3MU7A 5LIRA 1B30A 4IUGA 3KWXA 4TX6A 3OZOA 2Q8XA 1WP6A 2VNCA 3UEQA 2CXGA 1TR1A 3BCDA 1JFXA 1T0OA 2YDRA 2IXUA 4P8WA 5JZOA 1HKJA 1RH9A 4AZCB 1UD3A 3PQ2A 3WQ5A 3CLWA 2IUFA 1HL9A 2XVPA 3VD3A 2VMFA 1JD7A 5DO8A 3R74A 3TTVA 4GPNA 1C30B 4W93A 3ARRA 1KTCA 1Q7RA 2QMKA 4P7LA 3NOVA 1WNOA 2XVNA 2F18A 3SEPA 3L18A 2HISA 1SOAA 4FLQA 1C7SA 3A21A 1CEOA 3HZ3A 4EANA 2YLLA 2WKGA 3TOPA 5C71A 1XH0A 3FAWA 3RJXA 2WB5A 2BY2A 1KXVA 1E6PA 1CLXA 4JL2A 4AY1A 3T2OA 3BCFA 2D2OA 1GGEA 1V3MA 4LGXA 2C7FA 5CLTA 4A3YA 4AULA 4BQ5A 3DC0A 1QDLB 1QVVA 1D7FA 4B15A 4Z2LA 3GZAA 1VAHA 3WN6A 3UESA 3K8LA 1E70M 3LPFA 3WQ8A 2XVKA 4ZDKA 1S46A 2WMJA 1B3XA 1UKSA 2WHLA 4MB4A 3BVUA 4AEFA 4TXEA 3ZT6A 2CKRA 4PTMA 3WD1A 2VKTA 1DWHM 1SY7A 1HJVA 4HPGA 3HN3A 4E2OA 2YBTA 2GK1A 3WNKA 1UASA 4MNTA 2WHMA 1W9UA 2ZXDA 4W84A 4IPLA 2OYMA 3CHCA 4AD0A 1JDAA 1PX3A 1FFRA 1V03A 1W2PA 1HIZA 2EXOA 3VGFA 1J10A 4BCEA 4AEEA 4LPCA 4U5KA 3DX4A 5I78A 3VMOA 1HJWA 3IJ9A 1B3YA 1WDQA 2B31A 1GJUA 1OT1A 4W85A 3I3DA 2ALWA 2BHUA 2WLZA 2FH8A 5BCAA 4NXSA 4OGZA 1B90A 1DWAM 1OD8A 4HZ7A 4BTEA 4MAZA 2F2HA 2YL5A 1ITXA 1XCWA 3W38A 2ZICA 3BMVA 2R1TB 2EEXA 3SCUA 3F5JA 1SMAA 3GNOA 4B16A 1YHTA 1W3KA 4Y7EA 4H2CA 5BYWA 1OT2A 5BRQA 2J8GA 2BHZA 3AIUA 2VQUA 3N04A 3P9SA 1VFMA 2IUZA 4GIAA 2VOTA 2WMHA 2CNCA 5AYBA 3T09A 4Z2GA 5E0FA 1FP9A 2GJXA 3TONA 2WMIA 2VZOA 3WUEA 1ZBCA 1ZU8A 2RGLA 2BHYA 2VTFA 3T0DA 3SF8A 2YKKA 4LQ1A 1NOWA 1TVNA 3SCQA 1NQ6A 7A3HA 2WWDA 1MW0A 2WSPA 1K9VF 1EQCA 4C7GA 3BUIA 3KL5A 4L78A 1PBGA 2EAEA 1C93A 1C8YA 3PZ9A 2NT1A 1C90A 3T08A 1E6QM 2UY2A 1C92A 3W6LA 1ISVA 4UQEA 1QHPA 2VZUA 3DX3A 3A4WA 3SUVA 1QI4A 1WPCA 3FHQA 2GHRA 3A5VA 2OSXA 5D9OA 3RO8A 4WIWA 4C7DA 1HX0A 4RKWA 1HTYA 1F4HA 3FIJA 2XIIA 4P8XA 1GOWA 5CGMA 3MMUA 4CVUA 1EIBA 3VDHA 2WMKA 4MGHA 1ZBKA 1ISZA 4A4AA 1DP0A 3UJNA 2RK4A 3WBAA 4AZ5A 3DYMA 1XSKA 2X8RA 2JIWA 1BYAA 4OQ4A 1GGFA 1GONA 4FNPA 4KGLA 2OWWA 3HG4A 6TAAA 4AZ7A 2ZXQA 5D4YA 1OX5A 3H53A 4QAWA 1GGKA 3BH4A 4WLCA 1OX4B 2CHNA 3BAYA 3CZJA 4P7QA 1G94A 3ZR6A 2XM2A 4PSPA 2WZHA 5I5RA 4LRUA 4M29A 3P9PA 1E15A 3OLGA 3NCOA 3WQ6A 1UA3A 3B9DA 1UKTA 3GH5A 1BXRB 4MDPA 3TTOA 4ACZB 4L4OA 3N7TA 2VRKA 3CC1A 3UCQA 4QDMA 1GPWB 1B31A 1GJWA 4P7OA 1VIWA 2DSZA 3WNOA 2Y4SA 3W81A 2F7PA 4OBRA 3S6TA 2WLYA 4BQ2A 3LRKA 1E56A 1CIUA 1H49A 3UG4A 2E40A 2FGLA 2YA1A 3PQ8A 4M82A 1R34A 3D4ZA 3PQ7A 4FLRA 4B2YA 1LL6A 1B0IA 3FHAA 1GGHA 1NH6A 3AI0A 3WL1A 4PYSA 4OOUA 3DECA 4D6HA 1G9HA 1VJSA 1QBAA 1LJYA 3B8SA 4AJ9A 3O9NA 3VVGA 1E6SM 1K9FA 4AUMA 1GHRA 3QHMA 3VIJA 4M56A 4NX0A 2NV0A 3WEMA 3ALGA 2WZIA 4HOWA 2VXOA 3DX2A 3A4XA 1N82A 1Q6EA 1UWIA 4UFIA 2CBVA 3CMJA 1HL8A 3A23A 4NZJA 3UR8A 5HXMA 1KGXA 3W37A 3VNZA 2O92A 3ZIZA 5KEZA 2G3NA 4MNLA 4UQCA 5D9NA 4AZHA 3ARVA 3HU7A 4HMCA 5FKYA 4QYTA 1IZYA 3HMCA 4Z2HA 1G0CA 3LRMA 1PJ9A 2WHKA 5FL0A 3BUBA 4AW7A 1BVZA 2X2IA 3N12A 4N0MA 1GG9A 3KL3A 1O7AA 1DHKA 3OLEA 2YL8A 2UY3A 3FN9A 4F9JA 4HCJA 1M7XA 1OM0A 4ZE4A 3WKZA 2WMGA 3TA9A 3PN8A 2OR3A 1C8XA 2XSAA 1DWGM 2PI6A 1L9XA 1W3LA 1HJSA 3BMWA 1G2IA 2J7GA 4RE3A 3SIMA 4KGJA 3SCSA 1MW1A 1HJUA 3VSUA 1OSEA 4HOXA 2ABWA 5I79A 2VZVA 3CZ8A 4JFVA 2VL4A 3WF1A 2OW6A 2AMGA 1VENA 4AXNA 4Q7NA 1JI2A 4ZGGA 3L4YA 4J27A 1W1PA 1JDCA 3OLIA 2GJRA 3MANA 1NOFA 1HVQA 1SYTA 2V5DA 3N11A 2IGTA 4WINA 4F79A 2D7JA 1LG1A 4GUDA 4UFMA 1C8QA 5DT5A 3EWNA 3CHEA 1KQYA 3GXMA 1CBGA 4PMQA 2VX6A 1XD1A 3CUIA 3K1DA 1FFQA 2EPNA 5CSYA 4DUXA 4ATWA 3KLKA 4MB1A 3A3HA 4ENUA 4QYXA 3LPOA 5A94A 3ARPA 5DF0A 2RK3A 1A47A 3II1A
chains in the Genus database with same CATH superfamily
4IMPA 2PU1A 1CUAA 2DMCA 1LWNA 3G1UA 4QOHA 5HDQL 4PMJA 5LWHA 5I18L 4PP1D 4KRZA 1V6AA 2CPUA 4PJHA 2Z08A 1N6OA 4Y1AB 1PBYA 5D1XB 1H41A 3ZLFA 1IOVA 3MBOA 1TYEB 3DUWA 1C9JA 2J79A 5J12C 5AECA 3FFBA 5AW9A 2D2EA 1ZLPA 3BXWA 4S23A 1EDYA 3TBWB 1U7OA 1FFOA 4WXEA 3V6LA 1ZH6A 3Q8KA 2G2PA 5FFGA 3RB5A 2QKSA 2MDTA 5D7LE 3QXAB 4EJ1C 3RFZC 3AMDA 4BP1A 5JMRA 3T3HA 3VKWA 2CO3A 2ENQA 4P2OA 3GRYA 2IH2A 5G0WA 4ZMAT 2VP2A 3P4NB 2A9CA 1DO8A 3TOYA 2FLWA 1J8YF 1YDGA 3SBQA 1VJTA 3PUCA 5EOQH 4JG9A 1VM6A 2H63A 5E3JA 2DUAA 4Q66C 5JQWA 2XWBF 4L27A 3O6DA 2PC4A 4O6VA 3KQVA 3JWDL 3PWVB 3HG7A 3LW7A 4P4KB 3IIOA 3CH7A 4WWKB 4NV1A 2ERJB 4UU9A 3EY9A 1BLNB 2QPUA 5I8OH 1EXVA 3B1TA 2QSCH 3F05A 3U2JA 4N7JA 2QE6A 3NBQA 2C8NA 5B1DA 1UIMA 2A7QA 2C7BA 2AEQH 3RJMA 1FH5L 3ASZA 2O8FB 1FNSA 3HURA 4ES6A 4GLOA 1MAJA 1JYVA 3RR1A 5LKAA 2EC9T 1J9EA 3CZLA 1EHIA 3UGTA 1NJGA 1P7QA 4QM7A 2O6PA 3AG5A 3P9NA 3O3AA 4TXLA 1KI6B 3S1SA 3TU6A 4TKZA 4S24A 4E2DA 5GGYA 5F21A 4WZAA 2M8XA 5JD4A 3GA7A 4AZ8A 2P78A 4J4PC 1VGQA 5E8EB 3B1FA 2CD9A 1OLLA 1E2EA 4JJIA 1SRRA 4PCLA 2KZ1B 3L4BA 3BUTA 5HVFB 1YJBA 3VD0A 5JUWA 2B1AL 2PYED 4F2MB 4PJ6A 3UYOD 2CFFA 4OW6A 1L8XA 4G23A 1IBCA 3KVLA 4LXFA 1TU3A 5ALEA 3LTVA 2QPLA 3I4LA 5J5DA 2XXMB 4LF3B 1MFBL 4QXTA 4KVZA 5HYQB 4LGYA 1WS8A 2CXNA 1XCGB 3ZJKA 4PW4A 4CCWA 3RROA 3UDWC 1ICSA 1ZL2A 5CVJA 1FV1A 2YPVH 1CL7L 3JV7A 5FB8A 5CIQA 3JQQA 5D7JB 3IKMB 3LLCA 3RVLA 4AQEB 4F20A 4KQCA 5E70A 2DGAA 1TZ9A 4RA9A 1YLBB 1YB7A 5T3YA 4JLJA 4AZGA 3ZJ7A 2GIMA 3IBTA 5DJAA 3P82A 1AGYA 3R5KA 4ETNA 5HOEA 4TRJA 2UYYA 1OOAA 2XKKA 1XGQA 2PGJA 4NS0A 3GRCA 2RGBA 1RQRA 1KGWA 1Q15A 5I8KH 5C3IA 3L4WA 3MFGB 1OV6A 3CX5K 3OGCB 1W5NA 5G3YA 1GTL1 4MITA 3CFNA 2PNDA 3OKMA 1I7DA 4MJIE 3IUIA 3EZ8A 4BVHA 1I7RA 5FCZA 4F93B 2OB2A 5JQ9A 2IKQA 3QXDA 1ULHA 2IQIA 2ZP0T 2WZPA 4MYRA 1VRVA 2PWEA 3FHCB 4I14A 3EB2A 5ALRA 3BJTA 4RE0A 2C2HA 2Q21A 3UGKA 2FIKB 4TS1A 5E0KB 1QFXA 4YMTA 1KFCB 1NQVA 5FULA 3TVMC 4YYEA 1D4AA 1XO1A 2O0LA 4GY0A 1PNQA 5I6OA 3WQ4A 3RWGB 2BH9A 2RJNA 2D2CC 5E08L 3LRPA 1U1CA 3ZYOA 3LL7A 4KIJA 3LS2A 4HLDA 3HA0A 3QKWA 3WLKX 3W39A 3R3UA 2X6CA 2O5ZL 1J33A 4IPNB 4QPZA 2FZ3A 4HZ8A 2JLWA 4N9DA 3D8HA 5DNCA 4RIGA 3SHSA 2NW2A 5LWYL 3V95A 3S5LB 2AQ2A 1HYHA 1QA9A 4AW4A 2ZUNA 4GSYA 2VLME 3KXFA 5C7VA 2PCFA 3MUGA 5B7YA 2D4FA 1OFPA 4FL4C 1YRRA 2CLZB 2J0VA 4OZ4A 3CRMA 1FFNB 1VQ1A 4XR8C 1Z15A 2Q41A 1K3ZA 1A9YA 3N9SA 2Z35A 3R4IA 1WXIA 4P5MA 1TENA 1UZ1A 3QUZB 4UULA 2V7GA 4PQYA 3ZV7A 2ZUXA 5A5GA 3EOTH 1QSEA 1ZA3B 2E37A 2JJMA 1QP7A 2OMUB 4PH6A 4F7CB 4YJ2A 5EIIG 1II0A 2HBQA 4EPYA 3VKDA 2VJNA 1C9NA 5C0AD 3VNRA 4YL2A 1LNUB 4KC3B 2R4RL 1OD6A 4Z7IA 2RQ8A 3LU1A 4RSMA 3VFSB 5CDUA 1KIPB 4HS3A 1T1ZB 4Z53A 1FUEA 4XP5H 1NC4A 3ZE1E 2GTWA 3OKYA 2XMRA 1Q1PA 1A4IA 2HF7A 3TL6A 4R2GB 1W8SA 4KIUA 5JWOA 2X2OA 5KINB 1U4FA 4XD6A 3VNAA 3HV8A 1HH4A 1SO4A 4XX1A 2OC9A 5C9UA 2XW6A 4MZ2A 5T3ZH 4HNTA 1ICPA 2CDNA 1ONSA 5K9JL 1ADJA 3MQ4A 3LOTA 2QEZA 1JG1A 3T1YB 3QDGA 1KI9A 2CM6A 4S3BA 1QIKA 1FVOA 3P4XA 4OGXH 4AIZA 1WDPA 4JBHA 1HY3A 2CXHA 1A1MB 1AIPA 1XJ5A 2VDML 3FCSA 1JFQH 1YZUA 5ID1B 4IJ3C 4MS8C 1XZIA 4MV7A 2J75A 1UZUA 2ODQA 5JH7A 3A6LA 4ROQA 4PY8I 1BU8A 4DYKA 4OV6F 3EYPA 3PJRA 3VI3B 3N4AA 1Z82A 2RGUA 3ATAA 3RIYA 5DT1L 4HTFB 4P7GA 3AF3A 2F58L 2C03A 3P93A 1Q14A 1PKXA 3QQDB 4RZ3A 3G59A 3NEVA 1EO8H 3QNFA 3C0SA 1QM5A 1J0ZA 1XEWY 5AWFC 1ESDA 4KFNA 4NV3A 4NRXB 1SNYA 3V8RA 5FD8A 1FFDA 1QC5A 1KYYA 4KJYB 3RU9A 2R0LL 2QGDA 3RU3A 2OSWA 2W98A 3N59A 2OJPA 2ACQA 1RQEA 3UJJL 2AJ3B 1FMJA 2W6ZA 2G9VA 2XBMA 3ZVMA 3PPGA 2UXVA 1V0MA 1LLOA 3VNBA 1DBTA 4ZUWA 4KXDA 2WSRA 2Y1WA 4LCUA 1UZAA 2R8ZA 4LLWB 1REIA 3A13A 4BK5A 1SOMA 1OLZA 4WEBH 1OQFA 2OK0L 2XLBA 5AICA 4X3ZA 3FU8A 2PYDA 4LOUD 2WO3B 2JGKA 2DZBA 2TS1A 2ZIGA 4GQIA 1B3VA 3LD8B 5B1HA 3RBGA 1Q0PA 3NZEA 1EHCA 4PMNA 1R74A 4KAFA 1FBIH 1MW3A 1OJLA 2HLDA 3AIBA 4OBEA 4I0WB 5BQXA 2J33A 2YV1A 1ZRUA 3P9XA 1WYIA 4OV4A 1GYPA 3UJTH 3S9DB 1G8SA 2IXTA 5L3QA 2J6HA 1WX0A 4EUNA 2OXIA 1OXVA 2WIIA 1EX6A 3DYOA 1U0FA 1KJ2A 3T0FA 4AU1A 4KZCA 4MMXB 1MUWA 4GICA 5DSZA 1DO5A 4HAYA 1ANUA 1PD1A 4TV9B 3FI9A 1ZXXA 4ZSTA 3AIMA 4AEIH 4KU1A 1GRWA 5I02A 5B53A 5E4JA 5LA1A 5IBCA 2GUWA 1HL3A 2FQFA 3PCYA 2A3EA 3DCJA 5CFMA 2XGBA 1FG9C 1DSYA 1XTIA 2FE1A 4U33A 4D6GA 4EI9A 3K4QA 4K6GA 3SDAB 1Q2UA 3VIFA 3O83A 1TNMA 3CCCA 3MJ9H 1YVUA 1MEXL 1WUNT 1I8MB 1RZRA 1L0QA 4UTBH 5ICXA 1K88A 1SVCP 2QDHA 3DCYA 2WTRB 4G5YA 1AQ0A 5CK5A 2C99A 2YQGA 4N5EC 4HLQB 4BQIA 2PO6C 3PJFA 2YW9A 1YRLA 3LXXA 3PIQB 2CBIA 3OKNB 1LMIA 3UJAA 2JFEX 2NIPA 4JTEA 4PN3A 3CHRA 4PJAA 5F9JB 3G23A 1IAIL 4WTZA 5D5MA 3OQ8A 1WICA 4I66A 4RS4A 2BI7A 5A4KA 4UTWC 3L1UA 3FT1A 2E7LA 4N7RA 4V39A 4HQLA 3TZNA 5JDIC 3SW6A 1N10A 2ZSWB 3S6CA 3MY9A 5IRCD 4NO5A 2PMQA 1TQVA 4HBQA 1TJIH 2UUPA 1TZGH 3HVUA 2WIDA 2ZBEA 5HGJA 3LY9A 3PFKA 4AV5A 2G41A 5FH9A 1JSZA 1UW9A 4ACAA 3QOMA 3EW3B 3WI7A 1DSWA 4C6FA 5E09A 3QV9A 3FMGA 1DJNA 5D84A 4JQOA 2H9AA 4K9KA 2BUAA 5HK4A 2O5EA 4KIEA 1SXPA 4IMKA 4KWVA 2GNOA 3OI7A 3N2GB 2DD8L 4IBVA 5IVHA 2E0PA 3T3PE 3NTLA 4PMYA 1CV2A 4INAA 3K30A 3NZUA 2G50A 1N8NA 1RBMA 1E6JH 2NU8A 3TZBA 5JU6A 1DARA 2QG9A 3FUFA 1E28B 2QNBA 3BORA 4P34A 1L5ZA 2ZVQX 5EHZA 2QZ5A 3NVQA 2EP8A 4N3CA 3C0KA 1AS3A 4ALAC 3F2BA 1H5NA 3SIZA 1JWAB 2DMHA 1GQIA 4EOGA 5FUYA 2YJ4A 4ZAZA 4ME6A 3NM3A 5ILGA 5AAPA 1N78A 4W6WB 5IKCB 2UXBB 1PGQA 3O4FA 1SEVA 3RYTC 2Y85A 2WYHA 2R66A 2GAIA 2VAWA 4KE9A 1MQKL 2HEJA 3O31A 4TTUA 1AKRA 2PPVA 1PV4A 5K8JB 3THCA 4TYUA 4K6AA 1FUYB 3DIVA 4RISL 1U9CA 3EJUA 1V7NL 1AH1A 2ZVRA 1NBME 3LO5A 4LJLA 4RA6B 3W5BA 1C5DB 2FVKA 2BM9A 4GOXA 3NQGA 1SKYE 5CZKA 5K4XA 1W72B 2PYEA 3UAJC 4Q9LA 3NDBB 4YT5A 1M6VB 5ISMA 4ZYKA 1T5HX 3SP1A 1IGTA 1SLXA 2XVAA 4HHAA 2ZVPX 1UBSB 5L8LB 1N0LB 2Z2AA 2Q5OA 3TL5A 2I2DA 2EIEA 4PRNA 1G18A 2HTLC 1PCSA 3GMQA 5EQTA 4EXBA 3MPOA 4O4JF 3VSAA 3W6NA 4QTHA 2UZ3A 4NAJA 2Z0MA 3QUQA 3ND8A 5EYPA 1TT5B 3ONDA 3VNQA 1U8CB 3ZDXE 1PPIA 3TVAA 1LE5A 4TLTA 4BRSA 1YRYE 1CUYA 1IAKB 3UR7A 4NZRL 2Y4OA 3A9UA 3UFBA 2XITA 4L4TB 6YASA 4TYQA 2HLAB 3QZAA 3WIIH 5GS0L 1FAKT 4MJ5A 4OPMA 1Q6LA 4NCC1 4OF7A 2I9EA 4NFSA 4ZX4A 5TVGA 1NCBL 1FKWA 3PQ5A 1JGDB 1LNQA 3KPOB 2LLNA 4DTGL 2R48A 3ULUH 1M76A 4CMHB 4WK2B 3OXRB 3BFXA 3ZQUA 3PX7A 4ZT5A 2PGFA 1P19A 1HHIA 4JPWL 4F2UA 2FKNA 4P5PA 2OJEA 4YWHA 1HTIA 1ZDSA 3PY2A 1MHEB 1NX6A 1A80A 1J5HA 4D2IA 3HMJG 4PHZA 5DMJB 4JB9H 1EOKA 4M93C 4BLRA 2XSZA 3S2SA 4QPEA 2D9CA 4JUBA 4PWIA 1XRPA 4X4MA 1IC7H 3KPQB 1NONA 2VO8A 3MGKA 5JD6A 3AU9A 5FPHA 5EJMA 5FYKH 1I85C 2B36A 3AFIA 3N8IA 2J9GA 5KC8A 4GC4A 4RBPK 3COPA 2DQGL 3KPNB 3CG0A 3OQJA 3EOBA 4MYWB 4NNXA 3ER6A 4O2FB 3O41A 3WQWA 4YYZA 4AJEA 3GZJA 4JKKA 4HKTA 4KR7A 3LC0A 4K23H 5EFZA 4CEJA 3LH5A 4KREA 4BCCA 3A0RB 3N6QA 3VFOA 4E07A 4AQDA 4B9GA 5IMMA 2B1IA 3HMXH 1ORVA 1XMVA 5I16A 1Q22A 2ODWA 2BGGA 4N8VB 5CLLA 4KEAA 3N18A 1M01A 4NZTH 1TQBC 2OZ4L 4ADJA 3UG5A 5C8BB 2EKSB 1B3JA 4AO8A 2AK1H 4YH1A 5CAYB 3E80A 2IZZA 5LNRA 1N6RA 3SYNA 2QTHA 4BVGA 3KQPA 5TMPA 1PV2A 4XNXL 4KZDL 1MAMH 2AJBA 2XZLA 2XPGA 1N5DA 4BJHA 4MWAC 3VOCA 3MHTA 4AJKA 2IYYA 1SJEA 2RIKA 1T2FA 2B0CA 3WKAA 4WU7A 2VH1A 2WIKA 1M4KA 4OKNA 4UNSA 3Q9QA 3HFYA 4BWFB 3RNKA 2GSEA 4ICWA 1HH9A 2DTSA 5ALVA 5DGQA 1MMFB 2PPGA 4PBXA 4EVRA 2WO5A 2R2GA 2COUA 4XCFH 1RPJA 5LDHA 4H2AA 4EO5A 3R1GL 2OCCB 4UMSA 4G1EA 2P5SA 1X3LA 3P0WA 5IJ9A 1JGMA 2NQZA 4MO2A 1X94A 4U1IA 3H22A 1XF5A 4TF4A 1E58A 2OKTA 2J08A 5AVUA 3MYRA 1OCBA 1U58B 2I16A 1OZGA 3G6DH 3KRSA 2EJVA 5HZMA 4C6QA 1TYDE 3FCTA 3IRSA 4QCEA 1GGIH 1OP3H 4AMCA 4R1PA 4LJ6A 4H8VA 4KFPA 3V4PB 1U8JA 5C7IO 1BXCA 3S2LA 1D4FA 4HK3N 3B78A 3FRPA 4XH9B 1VG1A 4RGOH 2VXTL 3H4TA 1CUXA 3NFYA 1ZVMA 3NSXA 3E3HA 2ZRLA 4EZBA 3EPJA 3QSRA 4WIQA 2NXYC 2ED9A 1S3KL 4NDMA 3ZIUA 2JF0A 5DNWA 1EGJA 1LLUA 4EXKA 4ANUA 3OPSA 1GTG1 5G2WA 3RY6C 5HA7A 1SEBA 3JYLA 3KZXA 4UTXA 3V6MA 3KTAB 3RV4A 3LBOA 2EQDA 2WXLA 1UZ8A 2FFQA 5GGVL 1RFGE 3ARUA 3HQNA 4DBEA 3WS3B 4LXXA 3TRJA 2G9HB 1HESA 1CICD 2HK9A 1PWLA 2PTZA 5H0IA 3VCRA 2XTJC 1AJEA 4LCCC 1WK0A 1WCXA 2RDXA 4WGGA 2BOFX 1UTDA 3STZA 3WJLC 4XBKA 3IMKA 4HH1A 1JCJA 3PUIA 2R7EB 3DGEC 1DYSA 3ELFA 5IOPA 3DRTB 5T8IA 2QRLA 2A79A 2IZ0A 1J7VR 2RGMA 3AEQB 1TGVA 2GCPA 4F2GA 2V7XA 3PLRA 1FNEA 4DQOH 5K1ZA 3WK9A 1KLGB 2YXGA 3NGMA 2MWMA 4L6OA 5GSVB 4ELMF 5JIMA 1B2WH 1XYMA 2WA1A 2OT3B 3DOHA 5EJGA 1CEYA 1FDLL 3K81A 3EO0A 1NATA 2C5GA 3KBSA 5FWQA 2X8JA 5I1AB 1FQJA 5PTDA 5LYJA 4EF8A 4R31A 1CDBA 3N2IA 4RQTA 4E2YA 4M0KA 2AS0A 4AY6A 4X7SH 4YECA 4OUUA 3LKOB 1BE8A 2ODAA 4HVTA 3OJ2C 3CFKB 5DLMH 3IA2A 1BGXH 1RJ9A 2L17A 4KK5C 2VL7A 2G4FA 1C3OB 1ZLXA 2VGLM 4XPBL 5DDHB 5EPMA 1DBIA 2KQUA 4P04A 1F8MA 2R56H 3DFFA 4YA6A 3CSDA 2FEPA 4GRDA 2ITEA 2ADJA 4J3OF 4FG4A 3RPMA 3QJOA 1BEEA 1LK5A 2YD8A 2OCFD 3KG5A 5BRNA 3KSMA 1WWAX 3GUZA 5GGUB 3G0IA 1KLZA 1QACA 3B7WA 1FC2D 2G3JA 4I5GA 3LQZA 4ICNA 4XMUA 1ACYH 4TS4A 4EG4A 4UHKA 1BHGA 4G0OA 1XYAA 1M2EA 2G3YA 4PSKA 1XR9B 4WY0A 1EBFA 2VHJA 3PYLA 3GQBA 1JLMA 2CDEA 3UJSA 4H4EA 4OFWA 4E5PA 2X6VA 1XNHA 1QV6A 4MLSA 3QEQB 1QUNA 1CY7A 4NBRA 2V67A 1EQPA 1Z6JT 3LC1O 5I3CA 3HR5A 4DM3A 1W96A 4P3OA 2C8JA 2O6CA 3TW4A 2HV5A 3M5WA 3CNYA 3FR7A 4RMTA 4ZVKA 2IEDA 1R5IA 4G80B 1A1NA 4N40A 1E6MA 4HUCA 4XMKH 5JMTA 4OCYH 1G4HA 5GS1B 4FFVD 1CLOH 1Y1DA 4PM1A 1MY7A 4DLWA 1KK2A 1DLFH 2WF6A 4RJEA 1OPXA 3C48A 4NIKB 4ND1A 4N12A 1CP3A 3QDME 1CXKA 5H37G 1C8VA 2A0NA 5H6HA 2EZ9A 4OD2B 4DIAA 2QVXX 4A6XA 5ERGB 1HGYA 1N8ZB 3RT1A 1I31A 1QU3A 1R66A 1ZNYA 3GUTA 1PT5A 4OCRL 3Q8MA 4HMNA 4GVLA 3D1MC 2E6QA 4QPNA 1XEUA 4NC1C 2FATH 3C5JA 1MX1A 4A7GA 1FWEC 5F2EA 3PGXA 1UAYA 3E7FA 3N7AA 5DSXA 3WP0A 1HQRB 4WJG3 1ZPLA 5JPNA 1DQIA 3RTLA 4EFNA 3P2IA 4MJID 5E8RA 4F8XA 2GBLA 1F6YA 2V9RA 3EGOA 3VJ6B 1VOTA 3OCXA 4JQIL 4QYMA 3QMSA 3PFFA 1A76A 2PZEA 1GPMA 4WCYH 2RHGB 4WV1C 3N44B 1AQHA 4AP9A 2B8OT 1CIDA 3I7RA 1K4MA 2AK4B 1FTWA 4QKTA 4HQOA 2ICEA 1X86B 2ARWA 2PG3A 3FJTA 3NANA 2H5EA 3SDCD 4XVDA 4O2LA 1BQGA 4MH0R 3KFXA 2X4NA 1ONOA 4BO1A 1N77A 3GEEA 2D20A 5E93A 1DBBH 4OAWB 2P79A 4HN2A 1NVUQ 3TG2A 3GEFA 4NNPL 5DEOA 3H2QA 1LCOA 1RXLA 4DPQA 3R9XB 4M9ZA 4Q1EA 3AM3A 3DTXA 2DGDA 2VLMD 2OMXB 2A21A 1V41E 2R1WB 2QVCA 4BTVA 2VZSA 1OE2A 4ZMQA 3AETA 3JZAA 1A7BA 1LTXA 5AVYB 4WI6A 2XY1A 1YUHB 2DKFA 4Q4RA 2PGLA 3BTSA 4N85A 2FPGB 1WEJL 1F97A 4MRMB 3GELA 2F54E 3MNMA 4UINH 2GDZA 1KW1A 1ZC4A 1JFRA 3V7UA 3V4VL 4M1EA 4G1FA 4K1GA 3Q2NA 4YXWD 4LLYB 4P61A 1R2QA 4TVOA 3GNNA 4WD3A 1MRAA 1LLQA 1O6ZA 3AS2A 4JZOA 5JG7A 3DP9A 1RJLA 2ICCA 5K1JA 1J20A 1SUBA 1NGQL 4K73A 4N0UE 3BVPA 4P7BA 1IT9H 2Y69B 1Z2OX 2Y0EA 1I9CB 1A8PA 2ODBA 5AW8A 4E12A 3CSGA 4GISA 1GG2A 2C78A 4KMQA 2HK6A 2QXYA 3FAXA 4MYHA 1GNPA 2Q4RA 4CSSA 1N9ZA 1IE3A 1RUKH 5DJYB 4O2CA 2AQKA 2GGGA 3PBMA 1VG9B 5G0UA 2PFSA 2ANUA 3Q94A 1N0UA 3TSDA 4OHOA 3QWHA 4D8ZA 4NTZA 1UB6A 4HX9A 1T2XA 3N43F 1O6CA 1J1XH 5IJVB 1N6KA 4G42B 1XG4A 3RU8H 4QUAA 3FQTB 4X9XA 3TU9A 1ACZA 3VK5A 1KTKE 2ZRGA 3NBFA 4PJIE 1XRLA 3AHGA 4GMXA 4M9CA 2QQ6A 3F7KA 4G36A 5AQ0A 3L67A 1KCRL 3K6JA 2AVGA 1FWFC 1H1NA 2V5BA 1NCDH 2F2TA 5D1ZI 1J21A 3V52H 2Z8SA 3DBHA 1H0DB 2GNPA 2HA3A 4Y6OA 4PX9A 1JNHB 4DTCA 3AGQA 1P4UA 1Y6FA 3H6AA 3VKVA 4CJ0A 4PIVA 1YI8A 1FOBA 2MFNA 1V7CA 1VCMA 1A7OH 4KODA 3BTNA 3LNMA 4RAVB 3IAFA 2XHNA 2C9DA 3WY1A 2PVCA 2GD1O 2HX1A 2OTWB 5KSOA 3LH8A 4OI7A 5DRWA 2EC9U 5I0WA 4KTGA 2VJMB 1DAIA 3RYIB 2XEXA 1R5VA 3UP6A 5IBTH 2ZX8A 3U0VA 4OLFA 1W0VA 4WXRA 2CFTA 1FSKC 1DAPA 4XUGB 1RMQA 2XZCL 3U9IA 3HUTA 4YX2H 3RE1A 3SCNA 1KO5A 1TEHA 2P5TB 2IGFH 2J4DA 1DQNA 1HQYE 4AXWB 1QGZA 5LSMA 1MWAA 3RX3A 2Q9AA 1J8HE 3H4FA 5DTFB 1PZ3A 4GABA 4WUUE 2B7PA 1AHPA 1SZEA 5E9QA 3B6KA 5KS2A 2FPIB 4N02A 2JD1A 1TPZA 5KAMA 5LBGA 2ARKA 2X8AA 1EJOL 3SE8L 4M5YL 4QWMA 1PS0A 4NP7A 1BREA 3UZVB 4Q7DA 1M6OA 3STBA 1KJMB 2XDFA 5GJTH 1GXSB 3MLAA 2LVCA 3FSOA 3ASNB 3LLXA 1UFOA 2WAMA 1CVLA 5CN2A 5FW8A 2BKEA 4FKMA 1PX2A 1HE5A 1VL2A 2ZCLL 3CQPA 1TR1A 4QG3A 3WFEL 3SSNA 4MMYA 4ILSA 1E27B 4WFKA 3ZE2B 4M4PA 1SKMA 3R4CA 4OF0A 3QBVA 1PLBA 2DUZA 4R97C 2Q2NA 3AEUB 1N6PA 3K1TA 5IM5A 2I66A 2ZITA 3GUYA 5EIVA 2XVPA 3CDZB 2V33A 3GVPA 1CFJA 2EVJA 2C7QA 3GK8L 5U4NA 2UYLB 1KTCA 1FLVA 3L3DB 4FA8A 3NOVA 4YXLL 2EF1A 4LUJA 5G1PA 5D4JA 3U7GA 2HISA 3QZOA 2PWUA 5LXXA 4F91B 1YTDA 3HZ3A 3I09A 5DGXA 2P28B 2GYUA 4I5BA 3QUBA 2P5WB 1U0QA 3JWNH 1CLXA 2X1TA 2F43A 1G3QA 3FEQA 3UXHA 3MFFB 3WJ7A 4YMHA 3K09A 4UEOA 3MLXL 4NZ5A 3N2NA 2HRQA 3Q3HA 2FR4B 5H94B 1SUSA 3I0MA 1I3RA 3TSCA 3U9SA 4RSVA 3WQ8A 1AMNA 5EU5B 2RD0A 1CSEE 4ZDKA 4TXNA 1XQ6A 4FZ8H 4CVNA 3D9QX 4PQRA 5E6SB 5J2UF 3BRGC 1BQHA 1QNVA 2UZXA 5EOCL 1QYVA 2GK1A 2R4TA 5CB8A 3BXXA 4JMLA 1L0XA 4OP2A 3B6ZA 3UCXA 1CD0A 3TNLA 4FDWA 1JTTA 2GZXA 2PTTA 5IM51 4NV0A 5IFAH 5JPMB 4X4XB 5DMIH 1QSGA 3HZZA 4ZNEE 1HJWA 1GJUA 1IJBA 3HFMH 3L6BA 4JR9L 1V48A 1B90A 4JLOA 2PIDA 1DIOA 4ZQBA 4OB5L 2NZ1A 1I3CA 3TGXA 3VW3L 1MPXA 3ESOA 3OFKA 3IRUA 2WWKT 3K9HA 5ALUA 5IASA 3Q8WA 3PWUB 5JIKA 3SCUA 1OTXA 2DECA 3BXNB 4S04A 3RB7A 3E5HA 4HUXA 2R83A 3H8VA 4HRXA 4AU0A 5I76A 3LRXA 2VQUA 2K70A 3BE1L 3SCMD 1TR9A 5I4IA 5C8JB 1VFMA 2VOTA 4GIAA 3T09A 2WMHA 2I29A 4L74A 4MVCA 4EA7A 4GQ9L 4F0KA 3JT2A 3GQYA 3FNHA 5ALBH 1XGYH 2KHAA 3BKJL 1BKHA 1PWHA 2GF9A 3W9YA 3M4YA 2NTVA 4LL4A 4LQ1A 5T41A 3QBUA 1NBMD 3PFQA 3SR7A 5E4FA 3R3XA 4JB2A 4DYDA 4IMDA 1KFKB 4LPYA 4R84A 3QG6A 3E9DA 1UBOS 1KENL 3T08A 5CT6A 5H2BA 4X20A 3CLMA 4ZV7A 1EIXA 2YAOA 4CV2A 8FABB 3DX3A 4X45A 1TK2A 1QV7A 5AKLA 3ME0B 3G3EA 4UR8A 4FFVA 2IKHA 1KI3A 7ENLA 4BP8A 1F2VA 2VDGA 4CVUA 5KHLB 4MGHA 1X8LA 3VR1A 3VPFA 3L65A 2YMPA 2YJZA 1MRSA 2Z9BA 3Q7EA 4LUTA 4QG8A 3A6FA 3AACA 5E9DE 5KIAA 1FYFA 3X2QB 1WG3A 1RBZA 1GTHA 1BROA 3V1KA 4XQ0A 1GNRA 2BWGA 5ELMA 3ZX1A 1H6DA 2I1LA 4MD0B 3U7YH 4HO1X 1J1OL 3N6XA 3BFOA 4NRYA 1DX4A 3V6OC 4H27A 2ZP8A 1I6MA 1YNKL 1AD2A 1PT9A 3JWNG 5HHNB 5CJNA 3WRYC 1T2JA 3WN5C 4HULB 3EQ8A 2F90A 2AW5A 3KEFA 2EXXA 3OLGA 1ZCCA 4EBQH 2R65A 1ZK0A 3MHPA 4MJIA 3CQQA 4ACZB 1VF5C 3A6JA 2F9MA 3OETA 1WAPA 2LU3A 2DSZA 2EVGA 1M1YB 2BRRL 4OLYL 5D86A 4DLSA 2DF8A 2R44A 2QLLA 3HLAA 4I7WA 3WYBA 2BHNA 5J6HB 2AZAA 1LL6A 3QF7A 4P38A 1QLEL 2ESVE 3TIDB 4Z7WF 4EYEA 1OYCA 2A7PA 3QWFA 1G9HA 4IKNA 3EHDA 3R4DA 3ZUPA 1JYSA 3SDCA 1AFVH 3GDHA 5AXCA 1BFDA 4G8BA 1NDGB 4Q9AA 4NX0A 3L81A 4L5FE 1T2NA 2QR3A 1Q6EA 3VC3A 1GZ6A 4KNYA 1QZUA 3JAWB 4JOBA 2XUQA 1AMXA 3ONBA 4LGRB 2AJXL 4I13B 4FQ8A 4PRPB 1RAEA 4KRMB 3TQKA 1UG9A 3N2LA 4OAQA 4BFVA 4IJMA 5DHRA 5ITFA 3R0JA 1KELL 3FONA 2ZCZA 2GYSA 4YGVB 5BQPA 1LBHA 3EGXA 4OCSL 4X1IB 3CVHH 2UY3A 3RX7A 3ANMA 3JASB 1K63A 4PRYA 1JWMB 4LV9A 4HCDA 4PJDF 3FCPA 3H97A 1TM7E 1XB8A 2Z2IA 4ZGWA 2PI6A 4YXWA 1HJSA 4YQFA 4LEQA 1UMKA 2Q3MA 3BRSA 2OV1A 4Y2GA 4XOAA 4MWAE 2IHUA 2QZ9A 1LGYA 4LNCA 1H85A 1S78C 1TB4A 1QDEA 2ID9A 4EFKA 1C08B 1Q84A 4PWHA 1MFCH 1GRQA 1XWWA 3R79A 1XWYA 5FBZA 4GHWA 3TQRA 1UFRA 1EV2E 5KSZA 1MRDL 1EUZA 2ZAIA 1UEIA 5IMLB 4B8YA 3PL6D 2W43A 1FORL 1FFXB 2FI1A 1R0YA 3JZ7A 4UFMA 2H6PB 1S02A 4IK6A 5FKAB 1Z34A 3IAM6 1ID1A 2MHAB 2GRJA 3LHPH 1UEXC 2IBSA 5CVUA 1MCDA 3D8SA 4CBZA 2OZ0A 1KU6A 4BNDB 3SXPA 1U8FO 4R8VA 5CSYA 3TL3A 3PJXA 4QD3A 1CY6A 3SGDH 3O05A 4LBEB 4RY9A 4V2CB 1FP4A 3DONA 1Z7BA 4YP6A 4N3BA 2R2HB 3K71B 1QK2A 4KRYA 1QNZL 4L0YA 1GU0A 1H6UA 3C8KA 2GJZA 1HH6A 2Z7ZA 4G2NA 3D7RA 4PZAA 3NWRA 1M7BA 1F0NA 5P8WA 2DLIA 1OLUB 3ASYA 4KWEA 2XFYA 1VKXB 3T4CA 4XB3A 4PTUA 1L4NA 2BBTA 3WS6A 2AANA 1IAIM 1S7WA 3PKZA 2RE8A 4U5QA 4B0PA 2D0PB 1YI1A 1ZX1A 3P9YA 2C07A 1DQDL 2OP4H 5MEPB 3STGA 2XUIA 2QCDB 1JZGA 3TBSA 1H2RS 4PJ9D 1VE3A 1IJ9A 4CCEA 2QRHA 1RHCA 2E46A 4NJAH 2GHQA 5FWYB 8CGTA 3URNA 5HWSA 3UT0A 2L0DA 4LI3X 4E5TA 3S40A 4MUZA 5K1NA 2PT6A 3K2UL 4C6TB 3VTKA 5EBUA 4XEUA 4A2SA 5HAOA 1ZOPA 4FXOA 1GOKA 1IGWA 2GFBA 2IPKB 1Y37A 3LKSB 3F6YA 3O5AA 4PFHA 4JE0A 4FONA 5DMKB 3IAS1 3KVOA 3H13A 2H85A 5JSUA 4RPCA 4KEMA 1CPUA 2DTXA 4DHGA 3DMTC 3KJ4B 1WKVA 3L2MA 4NN7C 3CLHA 1E4NA 4MULA 4MJMA 3CR3C 1BHSA 1G98A 1QUMA 5DI9A 2GZ1A 4C1NB 1N3YA 4LEXL 1UM8A 5ABFB 1FFYA 3ADOA 3P2YA 4KYTA 3KH4A 5SV4A 4ZB2A 3PRKE 5AW5B 5IC5A 3VILA 4MVAA 1D7KA 1IPFA 2VX7A 1P1IA 4GAYB 2PLTA 1XTJA 1OM3L 3GU1A 1UWXK 3EBGA 4ARVA 4LCWE 3MTQA 1M7PA 4DBZA 3S4SG 4YCOA 1YVRA 4GRMA 2VXUL 4E32A 3KPPA 4N2OA 1XV8A 2EDJA 4K3HA 4AJJA 1SUWA 5E6YA 1T2DA 1XMSA 9XIMA 2BW4A 2AV7B 1I6KA 1J2UA 4WXYA 4WR3A 4XZHA 2R1LA 3SX4A 4RFLA 1Z2AA 2J2ZB 3CO4A 2E3VA 3HV2A 3D18B 2AQIA 5I9NA 2KLBA 1MDLA 4PLKD 4S38A 2QUMA 1A3RH 1L1RA 5IMSA 5BV2P 1IHDA 3SKXA 1X7TA 2R23A 2JGNA 2ZT8A 3RARA 4I6JA 2XKJE 4CADB 5IVXB 3BLEA 1D2EA 1SU4A 2G5GX 4NQCA 1F9CA 3UCCA 3M0KA 1S38A 3QUHA 4CMEC 3LUGA 4QTFA 8RUCA 2CLVB 1K85A 2YC4C 4U28A 3NIGE 3GDBA 4LPWA 4JOSA 1D2RA 1UCBL 1L4EA 1HX7A 2YZRA 1R0LA 4N7BA 2AG6A 4MRVA 4G1MA 4NESA 1CUIA 2ONEA 2MSPA 4Y6QA 3H24A 1N9GA 1PTGA 3J7HA 4DWWA 1B6TA 2NVUA 1XPOA 4HSQA 1A9VA 2A74C 5J13C 4Y6LA 4L37B 4ZUUB 1IZKA 2X6TA 4HZUA 2PETA 2K7QA 3BC1A 3BULA 3B9KB 3QZ6A 3BT2L 2DSTA 1S2MA 3QDMD 1XFAA 1LBIA 3HKCB 2W2PA 3OPUA 3VJRA 4M03A 3H16A 2PRMA 4OU1A 1VGKA 2EVFA 1Z0DA 2XAAA 3R75A 3OKOB 2D2GA 3U48A 2FVYA 3FVVA 2AEJA 2P11A 3MV9E 1P9NA 2AB0A 4OAOA 4I4NA 2DWPA 4KHXH 4YWJA 3WNDA 4FJ0A 3F3MA 5ALXA 2OEPA 4AFNA 5C1OA 2DLTA 4RJLA 4NC1E 5DSCB 1Z08A 2GEVA 3DLBA 2O8EB 2C0HA 5FO9B 4NRZA 3NT2A 3GKWH 3Q4GA 5I6DA 3PREA 1DVXA 4ZUTA 2NPLX 3OY7A 1Y9ZA 1GSKA 4I55A 1FXWF 3IUEA 3TQSA 1I2RA 4X1YA 5AVTA 5FBLB 4IIGA 2J8ZA 1NBMA 2DQUH 2GI0A 3QDAA 4GSDH 5JSZA 4MA7H 5KBLA 2QTZA 3I5UA 5C08B 3U9WA 4EUFA 1U2YA 4W5QA 3TVMD 4L22A 5FPYA 4EJSA 2XQGA 2L82A 1ABFA 4LGSB 3URAA 1E1QA 1ISSA 1S7TB 4HDNB 2IELA 3WGUA 1URLA 2WO2B 2PB1A 2RCNA 4U7WA 4NWTL 4OCLC 1H9BA 3AQZA 1U8PA 2WY2D 2Q02A 2SNIE 5AVQB 4Z76B 3N85L 3ZHYA 1XYGA 3G0GA 1PK8A 3FQNA 2QBYB 3R94A 2KMWA 1Q9WA 2OR8A 5BV7L 3MVIA 4DABA 3ZY3A 4Z2KA 2C91A 1WEHA 2GTHA 3UT5B 4F15C 1Q21A 4MJ6A 2DQWA 3IJLA 1B8VA 3WMEA 3DROA 3SGKC 1WXQA 1KMHB 1P7TA 5GV8A 4JDEA 2GGSA 4CM4A 1A1OB 2HTKC 4LOHA 3AITA 5CP3A 3TIEA 1SZCA 3U0BA 5D8JH 4LFCB 2F54D 3U4FA 2CCVA 4U1JB 3ORQA 3D47A 4JLRA 4LSVL 3BVNA 1BQCA 2NY3B 3KETA 1KZYA 3IVTA 5CTJA 1W19A 4CR6A 1JJKA 3QEUA 1SPQA 2RB8A 1QHZA 1IY2A 4JVLA 4CQ8A 1DAEA 1D3HA 1BD4A 3WF4A 1R47A 1MG5A 5L0QC 5T5NF 4NKDB 5FBRB 5H91A 1N1EA 1JPUA 3QLUC 4HQRA 2QJJA 3CPGA 2DDQL 4PCYA 3MJWA 4EO4A 3KHOA 4OQZA 3ZWDA 1QRQA 1IXQA 3ZIDA 1JQKA 1O57A 1Z5LA 5E3HA 2W2QA 1N59B 2XCSB 4RSYA 1AODA 4GXUN 5IREA 3ED1A 4HCRL 2QEQA 1DQLL 3BYTA 4N2IA 1BO6A 1VPLA 2DH2A 2MRYA 2H4JA 4F6CA 1VP9A 4H9XA 4X0VA 3QAZC 4LMPA 1HSZA 3G5ZA 2A59A 3MYJB 2WTPA 4ROPA 4L8WB 2JKTM 5JZVA 3S37X 5LQCA 1DBJL 5DY2A 1BGWA 3O11A 4W8AA 4Y9PA 5KJ6A 3RHWK 4XIYA 3UZQB 1HDRA 3SSMA 1LLWA 5A7GA 4BH8A 5MN6A 3ZMNA 4P8QA 3D2LA 1UD5A 3MN8A 1O08A 5ALFA 4RZ2A 1X5FA 5EZOH 3VFWA 5HS4A 1U2SA 4OD3L 1O87A 4LOIA 1GZSA 1E6OL 1NMCB 5CBEB 4DMFA 2VX4A 4CVXB 2C7PA 5EU3B 3U6RA 1DJOA 3DN5A 3OKDA 3VFTA 1ZK1A 3DB2A 2JLXA 3V75A 3H3JA 4X6BB 5E1GA 3RWEA 1EWDA 3L06A 1ZHAA 1DWJM 3HKEA 1C9EA 2V5SA 1NV9A 1WAAE 3P7YA 4MSUA 2ZS8A 1U8KA 1SVKA 4FNOA 5A1AA 2HFGH 4BKOA 2R51A 2LZ0A 3UWUA 3IU3B 3UBMA 3C5ZB 3TLCA 5KAQF 2DY1A 4WK9A 3SVZA 4QLKA 4BFOA 1GZQA 3NVDA 4U2YA 4G1NA 2R00A 2RKWA 4DDKA 5JSQA 3IUMA 2BSTA 4N25A 3C86A 1J8HD 4GX8A 4GQ0A 1U4SA 1ZTXH 1NNSA 4BLSA 5MF6A 4WUUD 2VPTA 3OB0H 1L5KA 4ITRC 4J3VA 5DASA 5GGTL 5JNLA 1HT1E 1BPLB 4QYOB 1V11B 3H2YA 4RWYH 3LNTA 3WADA 1MI3A 2XQIA 1I2AA 2IHKA 3FJ6A 4HAKA 4PLJD 4HMQA 1CQKA 1T8RA 2OSLA 4ZO6A 3HN5A 5CH3A 2M6SA 4P9HC 3E3QC 4N9EA 2ECKA 3FQWB 4JFFA 7FABL 2IQ5A 1KEWA 4LV8B 1A5TA 4XIAA 2HJGA 1TYBE 2DQHL 3KG2A 2HRWA 1EQAA 1QLRA 4IGSA 2CBQA 1IR2A 3S8MA 4CIYA 4OQFA 1Y5IA 2DYKA 3DUUA 1L9TA 2E5FA 3ERCA 4O1AA 3GCXA 3CFUA 1JILA 1OE3A 1GY1A 3T4AC 1N2CB 2I4MA 2YUIA 3GMNA 1P7YA 2D7MA 4WW1A 4PJ9A 4FFNA 4BWUA 2CSXA 3CZ5A 3OLVA 5FO8B 1NFFA 4N5ED 1DKRA 2PO6D 3NTOA 4Q4DA 4HS8H 5JW4Q 1R0RE 3MV11 2BL4A 4ZI8A 1F3TA 4DEPB 2P44B 3HIZA 4BVFA 4I89A 3WD0A 1ZQ1A 3MKGA 3UB2A 1OSPL 4NRDA 3D51A 3F2IA 1BYBA 4QDGA 3QVSA 2D8KA 4ZV9A 4QRPB 2CF5A 5LXTA 4EJFA 1QABA 4P2QE 1YS4A 3KALA 1Q0YH 4ZTYA 3I58A 2WLLB 1T8PA 1FRZA 3ORHA 3QLVC 3EG9B 2CMKA 3WY2A 1NFIB 4MWEA 1CJMA 2HCBA 4UAVA 1NC2D 3GO1H 3I6EA 4FZJA 3A3XA 2ZZ5A 3EFEA 5I6XB 1LO5B 4G7FA 1Q4NX 2I5YH 1P7ZA 3L1OH 3CZ4A 4Y1TA 2R9HD 5IK2D 2YY6A 2CJUH 3H1GA 1KEEB 5HJ5A 4I9HA 3HB3D 1V8PA 3GJ6A 5LN1A 1ONWA 1TMGE 2ENJA 3RKSA 1BYCA 1MCPL 4WOBA 3E5PA 3AYVA 4URXR 3C6EA 5EBWA 4EW6A 1A4JB 5JO5A 3APGA 1QH9A 4RC9A 2Z3FA 5F70A 4GG8B 3VCLB 3VR2A 1JAZA 1C8LA 5KTSA 2W60A 4Z7QB 3P9ZA 3GMRA 2ZRCA 4PAGA 1JDDA 3F7OA 4K9SA 2WLIB 3VWKB 5JCJA 1BXGB 2YCJA 5CJMA 1MIOB 5DV9A 5WRFA 3H42B 4CGTA 3IJ5A 3MUIA 3QYAA 4LHXA 4MYDA 3V1TC 2NDGA 4MKMA 1BW8A 3U8GA 1YDYA 4KNUA 2QIPA 4PPGA 2VP3A 1O9VA 4JGMA 1U6AH 3N0TA 5EOQL 3P8IA 1KRAC 4JLKA 4CKZA 3TRKA 2VSNA 4YDKH 1IWBB 5JO0A 1RUSA 1XVAA 3X1ZA 4CNQA 3NOQA 5IP4A 1UXSA 5K2ZA 3H2EA 1Y63A 1OVGA 1G7SA 3U36B 5HPOA 1CXZA 1I2BA 2XFXA 3WGJA 3C52A 4Q8OA 4D82A 3SHTA 1HMYA 5H4ZA 3AB7A 1BQ3A 1UZ4A 1GOHA 2QSCL 5K01A 3H5VA 4DRXB 2B8WA 5HA5A 2UZPA 4UVGA 4XN8A 2H29A 4V2XA 1CQJB 4X6EB 2I8LA 3UAJD 1RV8A 4Q8UA 2FHBA 4GQBA 1TVEA 4RYLA 2AEQL 4X6UA 2HSJA 2VL5A 4IF4A 2ZWYA 1U3ZA 4ACPA 5IFKA 1DAGA 5AW3A 3THOA 1PZXA 4NI3A 2OKGA 3HC0B 3QDMA 2QSTA 1XLKA 2HTLD 2OLEA 3AL3A 3A9RA 5I5GA 1E2LA 5E9DD 1KS9A 4C0KA 3NPAA 4LHSA 4G1UC 4WUKH 2YICA 4H0NA 1ECCA 2Y6TE 1MHPH 4QAMB 4NYJR 4NBWA 4URHA 3PPWA 1NURA 1I45A 1O6GA 3DOSA 2IW1A 1SC3A 2NLYA 2C4WA 3MRFA 4RF3A 2X9XA 1HSOA 4FZEH 3V6OE 4XVSH 4YCPA 1YX1A 2QDXA 2WKLA 3PRYA 2DTEA 3WDMA 4HKBB 5CEJA 3SDDB 1PJRA 3WMGA 2YPVL 2CBTA 2YWEA 2WMIB 2GITA 2RAMA 3HPJB 4X1OA 4U1GC 1LV8A 4PINA 3TAOA 2F00A 5MDHA 2ESVD 1PX0A 4FQPA 2XGSA 1L5MA 2Y7QA 1ZY2A 1E0UA 4ZYXA 1KF9B 3VIOA 1IB0A 1ODFA 4OQNA 1BZEA 1NINA 1KG0A 4MMZC 3EJPA 1D9KD 1FZMB 1AKYA 1FQ0A 5I8KL 3HJHA 4X80H 3RTQB 2DM6A 5DYWA 1AG6A 5D55A 1WZKA 5CR8A 1KB5H 2EDRA 2NNAA 2DYPA 1DEKA 4FI7A 1MQQA 5CBAA 2PBGA 1Y5LA 1BN7A 5CA0B 3TD6A 2DFTA 3K70B 2CHXA 3RUGF 1FWWA 5JHAA 2W07A 2ZX7A 3V80A 1NLFA 1I8AA 3C6LD 3TAKA 4NQTA 3FT3B 1D5WA 2I22A 3ITOA 1FJGB 2AL7A 5E23A 2F54A 4IBZA 2CLHB 3VU0A 1P1CA 4H6QA 1II9A 3HG3A 5IW1B 2ZWNA 2C3HA 3GCWA 4QVKA 2ZOWA 1YDMA 4L9DA 4HB3A 1XX1A 1LEHA 3VKBA 4KUZH 1GT91 4ZK8A 4MWAD 1U4NA 3RVVD 1ZVHA 2ZQKA 4DMKA 4WHCA 3TB4A 1GVQA 5EXSA 2DQKA 3NEYA 4LRYA 4N0UA 4RSHA 4R71A 4N3GA 4F4JA 2Q3EA 3HR7A 3MLPA 4ZDWA 1D9ZA 1UWVA 4BKQA 1ITUA 3DIFA 1AURA 3GBSA 5DWPA 2AQTA 4H60A 1WHPA 2A1TS 1E2NA 3V4LA 4AXXA 4XBGA 4Q56A 3HLTA 5GM2A 4WOPA 1JNNH 3DZ1A 1V1JA 4LVGA 3W2TA 4AQ1A 3EOTL 5B1EA 1AZTA 5K39A 4NFYA 1BVKB 1OGGA 2IIQA 4I5DA 5CIWA 2A1UB 2OXRA 3BG9A 4GC5A 4FHFA 1MVUA 1OGPA 4DPLA 2JZOA 1AJ2A 2PKXA 5I3IA 1G66A 2X7HA 4MHHI 5HFJA 4BQRA 1XDWA 2A9FA 2VP5A 5DELA 3LNDA 2GDVA 2AQQA 4K2AA 4EA6A 4R4BA 5LG1A 4PG2A 4QGBA 1D5XA 3V3TA 4OXXA 4L4RA 4XP5L 4A6YA 1H05A 4RA3A 4PJIA 4B7LA 4AK2A 4EPKA 3K1ZA 4YVPA 4FNUA 5T3ZL 2NXYD 1LUCB 1C3VA 4PBTA 4TLLB 3VXME 1T6MA 4HEJA 3F6PA 3C16C 4DR7B 1E67A 2Y7EA 1I1AC 1YK0A 5A3HA 5IZ4A 5CBJA 4UQ9A 5D7EA 1IEXA 2AZDA 1U3HC 3NOIA 4L3WA 1VTKA 4MFHA 4FQ1H 4OGXL 2E5CA 4GKLA 3P5SA 1LJLA 4RLIA 1GW1A 4LY4A 5C5DA 1JFQL 2W8BA 1HEYA 1N5IA 1QKJA 1R9NA 1ZA2A 3E81A 2RHEA 4GBXC 3A1VA 2V5MA 1MX5A 3VXUA 1U8QA 2Z4SA 1BDIA 2XU9A 3CKYA 2XVZA 1W8EA 2Y3IA 3F4VA 2YUXA 2JLZA 4IT1A 1C30A 1V6UA 1S7RA 2R1MA 3ZM8A 3RWJB 1EO8L 1M6NA 3Q0EA 3ABSA 3UUWA 3A1SA 3UTSE 1ULVA 3LEXB 1N75A 3HQOA 2Z6QA 2P0OA 1ID8A 5TJHA 2IUEA 3W5IA 3MYZA 3H9UA 1EM8B 1J8HA 4LUYA 3CUXA 3E6AA 4WUUA 3BOSA 3K9FC 3M7WA 3R13A 1P1VA 3CLEH 2F8MA 1B3OA 1INLA 4PXYA 1YEHH 3WHXA 3Q6MA 1RSYA 1TE1A 1RXVA 3TC6A 1AD4A 1L6IA 2Z56A 4UM9B 2IXQA 3PG9A 2AP2A 4HJ0D 3EIQA 3MUNA 1Q74A 4JASB 4M53A 2XT9A 2JJUA 4WEBL 2RALA 1DUIA 2OHIA 2Q8AH 4HJJH 1F7UA 2YTZA 2A9DA 3KLBA 4MIKA 1W5BA 3DLCA 2X0KA 3O8OA 2JFPA 5F64A 3MR9B 4LCWD 4X7DC 3OO0A 4QYWA 2CWRA 1G5FA 1FBIL 2RR3A 4EG3A 1GNSA 5CAHA 2BVTA 5JS6A 2IYQA 3UJTL 5AUQA 3RRAA 4NO3A 4YROA 3NSJA 4G1VA 1INEH 4HWKA 4L6HA 1DN2A 1Y1SA 2NLOA 1AKTA 1P0QA 2QM7A 3TO4A 5TE6H 2PO6A 3E5BA 1M1ZA 4W7UA 2Z3ZA 4TWIA 2GH1A 1QLHA 4AEIL 5K9QI 3HPRA 3PE4A 1BIFA 4UQDA 1M2GA 1B4JH 3AVOA 4K8RH 1CZKA 1EA9C 4IV8A 1K8DB 5HMMA 3LKNA 5DLEA 2GD6A 4JVNA 5DBHX 1GDHA 1PDZA 2J48A 3HN6A 3X2EA 2NWQA 2J27A 1C29B 4DDUA 3DTDA 3LQRA 5C0IB 4KNWA 4KIGA 5L53A 1E5AA 4DKDC 3G2NA 3WLBB 4J8RA 1LEIB 1QH8B 2CCWA 3MJ9L 5JORA 1NC2A 4XWYA 4RGQA 3BKXA 1U8LB 1L6ZA 4QT5B 1S8AA 2HL6A 4IDBA 4UTBL 3DFQA 5HBRA 1BEYH 1Q6GA 2ZF9A 4FF5A 4DLRA 5GRZA 2E09A 4DSNA 3QARA 3P5ZA 5A5FA 2EIZB 4MD4A 2QS8A 2JGQA 1G7RA 5EHXA 2DE0X 2QMHA 4LSZA 1RD5A 4M8RA 2H18A 3CPSA 3DFMA 1MO2A 2CM5A 5C0DA 1PAZA 4UC5A 1E0KA 2HEGA 2IAMA 3CQHA 2QSJA 4XBPB 2OWXA 4WACA 1MB2A 1BN6A 5P21A 3NALA 4D8UA 3UK1A 3L2IA 2EL9A 3E9YA 2WZ0A 3F5KA 1QGOA 4RZSA 2UU9B 1E73M 5CSZB 1NY5A 4GYWA 3NJRA 1D5BB 2CV1A 1W32A 3ZKQD 2ADFH 4BNMA 4J16C 3MV9D 4LHUD 4IIQC 1JJFA 1TJPB 1TJIL 1DTEA 1YZGA 1TZGL 4Z7VF 3SQBA 3QB7C 4X62B 2V4LA 1DAFA 4NHEA 3PGJA 3WMPA 4APQA 2NXHA 2NY5C 3DVAB 1CLVA 1NW4A 1XQXA 5EKTA 3CFIC 5GNYA 4JIHA 1ED3B 5DW3A 1BH2A 1QOXA 3QH4A 3BPNB 4JGJA 1JJVA 4RY2A 3E9CA 4JUTA 4H08A 1IONA 3JZUA 1WW2A 1A3WA 2C4KA 4MVWA 3OBAA 4LVHB 4E9QA 5A4DA 2E3ZA 2HBRA 1OOWA 2C18A 1E6JL 3IQFA 4YFLI 3PZGA 2QQNH 3LFTA 4PFSA 3HS3A 5HHOB 1J79A 4YDZA 3W1MA 2A5DA 4EOUA 1JB9A 4JL1A 5C0EB 2NYUA 3GSOA 4YFYA 1E6RA 3L3IA 1LVEA 2Z8ZA 2GGJA 1WXFA 3ABOB 4QL3A 1JQLB 4CMIA 5JNVA 4FQCH 3FOBA 5LOVF 4NF7A 3