4UOQA

Nucleophile mutant (e324a) of beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
689
structure length
683
Chain Sequence
HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMAQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
molecule keywords BETA-GALACTOSIDASE
molecule tags Hydrolase
source organism Bifidobacterium animalis subsp. lactis
total genus 241
structure length 683
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uoqA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uoqA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uoqA02
3OIHA 4CN4A 3VIIA 3EN0A 4L8FA 1VCOA 4DUVA 5I2UA 3BGAA 2WVUA 1KXVA 4W93A 2WHKA 1Y7VA 4M81A 2G8ZA 3B8SA 2NT1A 3NONA 2E8YA 2QPUA 3CZKA 5A95A 4XV0A 3L2MA 2QLYA 1A9XB 4OGGA 2DQXA 1FH9A 3AJ7A 3RPMA 3CO4A 2R1VA 4M80A 1LWJA 3QHMA 3RIKA 4HU8A 2F8QA 1GPFA 1E6SM 1WDSA 3NSXA 3DX3A 1CXFA 3LPGA 2X0YA 4F9JA 4AUEA 2GHRA 4L7QA 4D1YA 1Q7RA 4P5PA 2GVYA 4H8VA 2CITA 1B1YA 2JEQA 4NZJA 3B36A 1CECA 3VDAA 4Z2LA 3WD2A 4W85A 3AOFA 4DO5A 1E3ZA 1JIBA 3WMSA 1UR0A 3LPFA 1GG9A 3CZ9A 3I3DA 4UFIA 3K8LA 3WD4A 1ZJAA 3K8KA 4HTYA 4TVCA 1NH6A 2H2WA 4UNIA 5M5DA 4F66A 4Z2GA 5ABFA 3AMLA 5D8WA 3WFZA 2LXNA 4D71A 1H3GA 4A3YA 3KWXA 3CZNA 4ZGGA 3POHA 3OT1B 3D50A 3WL1A 2CIPA 1W9PA 1BGGA 2J25A 2VX7A 1W9UA 3T2OA 2R1VB 2D7JA 3G6MA 4D6JA 2CEQA 1PE0A 1J01A 1E56A 3R74A 4AZHA 1JD7A 2JF6A 4B15A 4AXNA 1CGVA 1KGWA 2FYVA 2EADA 2Y8VA 4PMXA 4TUFA 3DX0A 1HIZA 2V3GA 4FLSA 2XN1A 1UKOA 2CNCA 5ECUA 1UKQA 2ZUTA 4AD5A 2WHJA 1UHVA 3MV11 2ZE0A 4BTEA 4TX8A 3EDEA 5I5RA 2VT0A 3O6AA 1K9EA 2ZXQA 1H11A 5BYWA 5LA1A 4F9DA 1BG4A 3VU2A 2VPIA 1GPMA 5ABFB 4P8VA 1VEMA 4KGLA 1XCWA 2ZX8A 1W3KA 3AXHA 1UH3A 3L3BA 1ODUA 2YDRA 3BSGA 2NT0A 4WSKA 5E0FA 4K68A 3SCSA 3M7SA 3PZIA 3DHUA 1KTBA 1VF8A 1FP8A 3VM5A 3W24A 4CCDA 1JF6A 4AEFA 1IZJA 3WDRA 4B16A 5HBFA 1JYWA 1L9XA 2WKGA 2F7PA 5A8OA 1B9ZA 2O9PA 3PN8A 4AUMA 3WNLA 2G3IA 3SF8B 3WQWA 1W2VA 1QX1A 1H09A 1CF9A 1TQSA 2WZEA 1BLIA 3VNYA 1JDCA 4AMWA 3AFBA 4DM1A 3BVVA 3BAIA 3VU3A 5BROA 1MVYA 3IK2A 1W1PA 2CBUA 3TONA 5CZKA 4ENQA 1KXQA 1Q6GA 4UQEA 2HVMA 1CGTA 1F4AA 1QI0A 2W62A 4NXSA 3W4RA 4B7AA 4RE4A 4DO6A 2WB5A 3AIWA 4HOZA 3ZIZA 4GKLA 4ZE5A 3T0BA 1DWAM 4GI6A 1OIMA 2G4FA 1H1NA 2XN0A 4MB5A 3WQ8A 2ZXDA 1V6WA 3EYPA 3CGTA 2J7HA 4GI8A 1QVWA 2EPKX 4UFJA 2CHOA 3GXTA 3A47A 4W89A 4W5ZA 3CTTA 4AYSA 4GINA 3ZJ6A 4I2NA 4GO9A 2AD5A 3SCVA 1UA7A 1WZKA 3BSHA 1C92A 4FK9A 3WF2A 2V5CA 1QVVA 3DC0A 3THDA 1UH4A 4XZWA 4UFHA 2RGMA 1R33A 2YDQA 1J10A 1XGZA 1VJSA 1C8YA 2WMIA 1MXDA 5JBEA 4U5KA 2EABA 1W9BM 3PTQA 1BQCA 2YA0A 3L4VA 5A8MA 2WVTA 4PMYA 4D6FA 3QHOA 1E3XA 4PUEA 3UOWA 2X0HA 1Q6EA 3VSVA 2ZX6A 4HOXA 1B30A 2PI6A 2WAGA 3L18A 3BUBA 4OFWA 4U31A 3U7BA 4CN1A 4W7WA 1IV8A 1JXKA 3PQ4A 2WMKA 4CU6A 3FNDA 3TA9A 3VGEA 1KQYA 3GXFA 6TAAA 1UQYA 1J9YA 3AIQA 2V38A 5BXSA 4PYSA 4CU8A 3ZJ7A 1E4LA 1PS3A 1W3HA 2D1ZA 1P80A 1J18A 5EFDA 5A2BA 1RD6A 3WUBA 4UOQA 2W7TA 1BYBA 1EOKA 2DIEA 1N82A 4MJ2A 2WM0A 3JUGA 1I1XA 1HVQA 2YL6A 4RL3A 3SCPA 3RJXA 2WC3A 1CGUA 4AD4A 1GZJA 4CD6A 1IZYA 3A22A 1TA3B 1Q6FA 1PIGA 4WJXA 2J7DA 4BZYA 4K2HA 3WF3A 1JZ7A 2ZOXA 2YFOA 3SCWA 3L4ZA 3AMKA 3ALGA 1WDPA 4MNTA 3OG2A 4W8AA 4UQ9A 3BAWA 3AS1A 1HT6A 1BHGA 4U3AA 1ZS2A 1XYFA 1OI4A 4JAWA 2VX4A 1OGSA 3LXAA 2FGLA 2WMHA 1MQQA 5JUVA 3GBEA 1UWUA 3H54A 2OW7A 4J28A 4P8UA 4FNPA 3LPPA 3NSNA 3SURA 4L95C 1X6LA 1XHGA 2EBNA 3B9EA 3N15A 2DT0A 5C8BB 3K4AA 1EA9C 2XUCA 2ALWA 1QHPA 1V0LA 2IUZA 3ZT5A 4BQ2A 3TTOA 1WDRA 5M03A 3ARQA 3M07A 1IZKA 1UR8A 4JFVA 1K9DA 3AZSA 4PN2A 3T2QA 4PTVA 5GNXA 1QWUA 3MGKA 1WO2A 3AHYA 3W81A 3DECA 2XVPA 1PAMA 1MWOA 1G1YA 2XGBA 2A9VA 2R1TA 1CXIA 1VRXA 1ZBCA 1BTCA 3WEOA 4GQQA 1QNRA 2ZWZA 3CZGA 3WEMA 2VCBA 1QI5A 5E09A 2F18A 4HOWA 1J0IA 3CUJA 2WLZA 3WMCA 4PMRA 2EPNA 1US3A 1EQPA 3VMNA 4H8HA 3WQ4A 3PTKA 1GUVA 1QHZA 4IISA 1OX4A 5A6LA 2XGIA 2WANA 1GPWB 2J79A 4EAMA 4ENTA 3CZAA 2D22A 2JFEX 3RMEA 3TOPA 5HNNA 3A23A 2XIBA 2DPEA 3VX0A 1E1EA 3WQ6A 5FD0A 2QMJA 4JZ5A 5A8PA 1TQTA 1E6RA 3GZAA 1V6YA 2VURA 3POCA 3PQ8A 1TE1A 2BY1A 1HJVA 2YKKA 2WW5A 3B9DA 1HWWA 1CEOA 1HTYA 1EIBA 3EJSA 3AQUA 3NUKA 4JKLA 3EDDA 1WPCA 1V0NA 3S5YA 3WNNA 1VCMA 4LXFA 3NOVA 1KBBA 3R76A 2BS9A 1HP5A 3W26A 4OKDA 3AICA 1Q4NX 2F7RA 3WF4A 3ZQ9A 3VSUA 3L2LA 3A6OA 4QCFA 2J7CA 4P36A 4ENWA 2Q8XA 2VZTA 1ESWA 2BVDA 4LRUA 1RH9A 4B31A 4ZE4A 4CVUA 2GJXA 1OX4B 3DDFA 3BUDA 2GSJA 1OT1A 1UQZA 3DX2A 5A2AA 3NYDA 1JZ5A 3BAJA 2OSXA 5FIPA 1E6NA 4GZEA 2W92A 3L4WA 4DM2A 1PPIA 3ZJKA 4CKQA 4Z2IA 3BLKA 2XF2A 3VX1A 1DWHM 3K1DA 2VCAA 1BVNP 4Y1EA 1EDGA 1NWRA 3RILA 2NW0A 1KCLA 2UWFA 3OB8A 1KXTA 3WY2A 5CPQA 2VX5A 1UWTA 2E8ZA 1KFWA 1XRVA 2VQTA 3WY4A 1XSKA 1TCMA 2FE0A 2XFRA 3EDKA 3KL3A 5A6BD 4L4PA 1JDBC 2DGAA 3FW6A 1CXKA 5LYRA 3ZT7A 2WK2A 1CBGA 3WD1A 4RKYA 5SY9A 2GUYA 2QMKA 2A3AA 4HPHA 1I1QB 2OWCA 3S5ZA 3VGBA 2C7FA 3VD7A 2WHMA 2BXZA 3AXIA 2GJXB 5CGMA 4WIWA 2DDXA 4TTUA 5BRPA 4QLJA 5F7UA 1E5NA 3PZ9A 3AS3A 3LRLA 1HKIA 3CHDA 1W3LA 4JCLA 4M56A 1RP9A 2ZXBA 2O9OA 3ARUA 3NORA 2G41A 3EJPA 3H53A 3SUUA 2YWCA 2W67A 4JFWA 3N9KA 2VJXA 2W4XA 2OLHA 3IJ8A 4WINA 1SYTA 1XH1A 1VBRA 3BVUA 3MSDA 1QW9A 4MGHA 3L4UA 2X2HA 1GGJA 4P7QA 4KGJA 1R7AA 4LQ1A 3BVTA 1GVYA 1W1TA 3W0KA 3WKZA 5JIWA 3VSTA 4B40A 3ARWA 2WJZB 4CCEA 3RHTA 1PX3A 1W9DM 4IPNB 3VPLA 1KWKA 1LLOA 2OWWA 1PZ3A 1QDLB 3W28A 4XZBA 3VD9A 3ARSA 1JFHA 1QBBA 4QFUA 4JL1A 1C30B 3A5VA 2J47A 1QI2A 1HJXA 1MW1A 4W8BA 4F79A 1NOFA 1B3YA 2YWJA 3UR8A 1PEZA 1KA9H 2UY5A 1LL4A 2V3FA 2PWGA 4TVUA 1KXHA 1DWIM 5D9OA 3EMZA 3AMGA 4UZSA 3LX9A 3D3AA 5CSUA 3BXWA 3NJ3A 2J77A 4DO4A 3PQ2A 4AULA 2VZOA 3MU7A 4TX6A 4W7UA 1UYQA 5AC4A 2QF8A 1HKKA 1FOBA 1HKMA 4Z2KA 3N04A 5A6MA 4Y1RA 2UY4A 1JZ4A 3UG5A 3BCDA 3J7HA 4TVDA 2XJ7A 2XN2A 3CBWA 4NF7A 1ISXA 1YHTA 3GXDA 5DT7A 3OT1A 7TAAA 3GTNA 3KL0A 1V6UA 2CPUA 1K9TA 3KEHA 3AIVA 2W66A 2QPSA 1KCKA 1OSEA 2W5FA 1M6VB 1B3XA 3HN3A 2YLAA 4DWSD 4TXEA 5LA0A 3P9PA 1V0KA 1E73M 4P7RA 3APGA 1VENA 1F4HA 3W38A 1HJUA 4HZ6A 3VMPA 5CXPA 4ACYA 3BHNA 2VOTA 2ISSD 3TTXA 1FH8A 2G3NA 1MQPA 2EPMX 3UJNA 2YA2A 3K4DA 2XFFA 5EFFA 1GOKA 3CY6A 3L4EA 3O9NA 1BF2A 5JBDA 1O1YA 3VDHA 2CETA 3RM4A 1JGIA 1G94A 4Y1RB 1AMYA 3UCQA 1OY1A 3H55A 4D1IA 3A4WA 4L8YA 4FNQA 1K6AA 3IAQA 1XH2A 4LYPA 3R75A 1R75A 2Y24A 1UKPA 2FH6A 1NP0A 5JBFA 1X6NA 2J4GA 4DWSB 2GDUA 3NOOA 2DEPA 1UZ1A 4V27A 1XSJA 1H0GA 1MFUA 3D4ZA 1TZ7A 2WBGA 1CXLA 4D6HA 2DSUA 1TQUA 2DH3A 1BFNA 4AEEA 1AQHA 4P34A 5KZ6A 4YPJA 4QYTA 5CPSA 5D9PA 3BUIA 3VIFA 1UWIA 5FKYA 1V3LA 4X9YA 2VKTA 1WZLA 1VEOA 3SF8A 3WH6A 2OSYA 1PDWA 3VIKA 3W27A 2FGZA 4AMXA 1UKSA 2V3EA 3CZLA 3UEQA 3CZ8A 4H04A 2A3EA 1OGGA 3GH4A 4WXYB 4UZUA 5GQBA 3WH8A 2ZUMA 3GRAA 4E8CA 2XVLA 1J0JA 2EACA 1KB3A 3FIJA 4NZCA 1G5AA 2VX6A 4HCJA 2C0HA 3RM9A 3EFEA 1HNYA 3W82A 2CBJA 4AIUA 3NSMA 1GOOA 5I0DA 3ALFA 3T2PA 3RO8A 4OGFA 5A8NA 1L0PA 3GXMA 1HF6A 2JF7A 2WMGA 2Y8KA 3VNZA 1V3MA 1TUXA 4D6GA 1QNQA 4PTXA 1R85A 3K46A 2YIHA 1T0OA 2R1UA 4BIMA 4OOUA 3N11A 3CC1A 3BVXA 3CH9A 1P5FA 1K9VF 3B9AA 1JL8A 1LWHA 2XSAA 3U5UA 1HL9A 3CMGA 1UR2A 4J3UA 3T09A 3BAKA 2J8FA 1D7FA 1BVZA 3GXNA 1VIWA 2WSPA 2VVSA 4V28A 3SUTA 4EKJA 2WKLA 3ARYA 2VZSA 3AS0A 4W7VA 1GVIA 5HDRA 2VZVA 1UKTA 4S3KA 5I24A 4PUDA 2JIEA 3OGVA 3VKKA 1CS0B 3FAWA 4AD1A 2XM1A 5A69A 4AWEA 3SCUA 4AD0A 3ARRA 3U57A 1P81A 4AD3A 4V2XA 4W84A 5BXRA 5JIPA 1R47A 3TTUA 2YL8A 3WF1A 5I79A 3KL5A 2X2IA 3VD3A 1AQMA 1GW1A 3DYMA 4J3VA 4J3XA 1GNXA 8A3HA 3ZSSA 1DWGM 3VIPA 2WYSA 4AYGA 4DWSC 1GCYA 4HZ7A 3RJYA 5A94A 2F2HA 5CG0A 4J7RA 3WY1A 3WY3A 2BFGA 2YFNA 4P7LA 5I3DA 3TTQA 4ENRA 1JZ8A 3EMQA 1C3FA 3WH9A 4WKAA 3NDYA 2EJ1A 1PDVA 2XVGA 3T08A 1UD6A 3F5DA 3AS2A 4CVWA 1VCNA 1LG1A 1R9GA 1TA3A 1HJWA 2Z1SA 3ARPA 4BQ3A 1SY7A 1LL6A 1E15A 1ZU8A 4FF5A 1GOIA 1FH7A 2TAAA 5IHSA 2BHZA 4AZBA 4ZEPA 4PMVA 1G9HA 4JHZA 1EXPA 2D20A 2YL9A 2J75A 2FEXA 2XTKA 5I23A 1GGHA 2A3BA 3GH5A 3ER6A 5HPOA 4B5KA 3OLGA 4N12A 2DIJA 1MFVA 1TVNA 1IPHA 1ONSA 1RP8A 2FDMA 3GYCA 3HG5A 3MI6A 3WMBA 2JALA 3PHAA 3W25A 1QVBA 2XHYA 4QLLA 3VUPA 3D5HA 2WLYA 3N1AA 1B0IA 1H4PA 1E72M 1JAEA 1GHSA 1E6XM 4BQ4A 1CXEA 1CTNA 3SEPA 1VEPA 4UFMA 5HOSA 3D51A 3QR3A 1GOWA 5DT5A 1M01A 4IPLA 3W6LA 1G0CA 2VXOA 1J0YA 3MKKA 3TQIA 2FHBA 1K9FA 1J0KA 3GNRA 1E55A 2EO7A 4Y0NA 4CCCA 2V5DA 3DDGA 1OCQA 1H2JA 1TFVA 1WCGA 1YQ2A 3KE0A 1KR1A 1TVPA 5EBAA 1CPUA 4ADSG 4H8UA 2CBIA 3WH5A 3ZT6A 2Z1KA 5IDIA 3WDHA 3EJUA 4P8WA 4S3JA 4HP5A 2ZUWA 2IXUA 3CUGA 3CHEA 1UD5A 5BXPA 1LF1A 1ISVA 2IUFA 5I6SA 3RDKA 4OBRA 4PMQA 4WK9A 2BY2A 3UG4A 4UFLA 1FFRA 1UR9A 4AUNA 4R7GA 1GQKA 1V03A 4PMNA 3SUWA 1KBKA 2OR3A 1W1YA 1QVZA 1JAKA 4B3LA 3TTSA 4R27A 5KEZA 1PX4A 1CE8B 3GH7A 3L4XA 4JL2A 3GNOA 1VB9A 4U3CA 1AVAA 3ARXA 1KEEB 4UCFA 1P6WA 2RK4A 4L8WB 2YA1A 3EJRA 3WN6A 3UG3A 3O2LA 3PZUA 4I4NA 2EQDA 3HJEA 3OLIA 2ZICA 1M04A 4J3TA 2JIWA 3VTRA 3T0AA 4Z2HA 4M1RA 3PZTA 3CUIA 4GZIA 5E70A 1WL8A 2J8GA 2VRJA 1JYVA 1NWSA 4CUCA 4AZ5A 1JDAA 3PZOA 1OT2A 1WE5A 2ZUNA 4B3KA 6CGTA 5IFPA 1JG9A 1B3WA 4ENPA 2VTFA 2Y5EA 5IXEA 1DEDA 4GXPA 1JZ2A 1JD9A 3OGRA 3ARVA 1W2PA 2PBGA 2BY3A 1EGZA 2VZUA 1E1FA 1GOMA 3MS8A 2WSKA 4ZENA 3WNKA 1HJQA 5A6AA 5A8QA 5CLWA 1HJSA 3VILA 7A3HA 1B2YA 4UOZA 5A6JA 2ZIDA 3IJ9A 1GGFA 3PQ7A 1ISZA 1VJZA 1KQZA 2VRQA 4CU7A 2OW6A 1KTCA 1G01A 2J7GA 5D9NA 1VBUA 2F7QA 1X1NA 2GDVA 2BHUA 5I78A 1QWNA 4TTGA 1KGUA 4A3HA 2FHFA 3BLBA 1FP9A 1W1VA 4PCSA 1EDQA 2ABWA 3UK7A 1E40A 3QGVA 4W88A 1WAWA 3EDJA 5AYIA 5FOOA 1FA2A 4JFSA 4AY1A 1UR4A 3IJ7A 3TV8A 1E4IA 3QHNA 1PBGA 3ZOAA 1E71M 4ML4A 1DP0A 1WDQA 1JNEA 1VFOA 2XYLA 5BV2P 4JFUA 1QPKA 4LX4A 1Q2UA 4P7NA 4PBGA 4N42A 4FLQA 2IGTA 4Y1GA 5DFAA 2OYLA 1CYGA 1AQ0A 5A6BA 4PMZA 1D2KA 3BUPA 1GQJA 3VGHA 2D23A 1CGWA 1OD8A 2EPOA 2NV2B 2F7OA 1HVXA 3SUVA 3UMMA 1C8QA 2VVNA 4URIA 1TR1A 2VQUA 3P9RA 1V3JA 1N57A 4YN5A 1V6XA 3OLDA 3I3BA 1CLVA 3WUEA 5M3WA 4QP0A 5I77A 2X2JA 1GOQA 1DTUA 4HMEA 3OA5A 2VMFA 3OLEA 4AISA 3MUY1 3FHQA 2CXGA 3N13A 4MTVA 4GQRA 4E2OA 4ACZA 4MAVA 1RPKA 2C8NA 4M82A 5FL0A 3SCQA 3NOQA 2FH8A 4Z2JA 4E4PA 4FNUA 1UCFA 4ATWA 1UA3A 3FY1A 3VM7A 3WELA 4QLKA 4WKFA 4FNTA 3SCRA 4D6CA 1PZ2A 1ITCA 2GK3A 1U30A 3BVWA 1R86A 3EJQA 2CKSA 3CYFA 3MUZ1 1ZBVA 5FL1A 4QYXA 2GK1A 2VC9A 3LMYA 4MNJA 1IZZA 3PZNA 1FHDA 1NOWA 1ZBWA 4D6EA 4JFTA 4PMDA 1SFSA 2WMJA 4OUEA 1TQVA 1V3HA 2E40A 5GNZA 4UTFA 1E70M 3N12A 2ZXAA 1MW3A 4BCEA 1HX0A 4U2ZA 1XV8A 4HA3A 5CPTA 2E9BA 2E9LA 2ZX9A 4JCMA 3WNPA 4JIEA 4MJ4A 4Y7EA 5LA2A 1WZMA 3DX4A 1OWQA 1L8NA 4GI9A 1BG9A 3MUIA 2JEPA 5A1AA 2A3HA 2WC4A 4PSRA 1NWUA 1E6QM 3W6MA 3EJTA 1MQRA 4GZJA 3CNEA 3F5LA 3N17A 2G3JA 1GJUA 3SCNA 4DUXA 4ACZB 4W86A 2MANA 5AY7A 2AMGA 1B3VA 3L4YA 5ABGA 2G3MA 3AHVA 5CQ1A 5BWFA 4MNKA 2O92A 5A3HA 1Q6CA 3EWNA 2IXVA 2DH2A 4CD7A 1CDGA 3CPUA 4AZ7A 4E08A 4FLRA 3VDBA 2GK1B 4Y1FA 3LRKA 3AZTA 1G2IA 1UD2A 1UR1A 4LGXA 3VIJA 1ZB5A 2J7BA 3LXCA 2WCAA 1SMAA 3VIOA 5E6YA 3TTWA 2CERA 4AMCA 3SCTA 2PC8A 3VGGA 1C91A 3WF0A 1BXRB 1W32A 2YWDA 3WEZA 1E5JA 4HMDA 1OBAA 1J12A 2WCSA 2WVSA 4X0VA 4DWSA 2UY3A 1R8LA 2PWDA 3VGDA 1OB0A 1CGYA 4AC1X 3RM8A 5BXTA 3WNMA 4B9YA 4PCTA 3N18A 4CD4A 1GQLA 3VINA 1A47A 1EO7A 1P7YA 9CGTA 2RK3A 2VR5A 1E43A 1NM9A 2XWDA 4PEEA 2PBOA 1ZL1A 4L78A 4M24A 1O7DC 4YHGA 4S0ZA 5JZMA 1R34A 3ECQA 2WWDA 1XH0A 1CXHA 3ARTA 3FSEA 2WVVA 4OZOA 1E4NA 5CLTA 5C70A 5HPCA 3EBVA 1T0BA 3QOKA 4KMQA 3PZMA 5EMYA 2O9RA 3G6LA 3GDBA 4DUWA 2HISA 2O9TA 2VI0A 4GUDA 2X1IA 4JKKA 4BF7A 3WL0A 5DMYA 3VD5A 4LPCA 2XPKA 4JHOA 5A6KA 2YLLA 3GM8A 5DEZA 4OOZA 3W53A 3W29A 3TTYA 1UWSA 3MUAA 3VIGA 2J74A 2PWHA 1E9LA 1PV2A 4HMCA 2VNCA 4OIFA 2WWCA 3BAXA 3ZSTA 2WHLA 1ITXA 2XWEA 1CENA 3PZGA 3U7VA 1UWQA 4KH2A 4UFKA 3A21A 3ZO9A 1W91A 4GIAA 2YDSA 1QF7A 4B2YA 3VOCA 1BYCA 2RK6A 3WDJA 1SMDA 1HXJA 5DF0A 3MV01 2PB1A 3WH7A 4MTCA 2PWEA 3WBAA 2WVVB 1E0XA 2XSBA 3IANA 4XUYA 1UG6A 4MB3A 2OSWA 4AIEA 1HKJA 1JI2A 1T3TA 4AZCA 1XYZA 3HG2A 4Q22A 1JYXA 7CGTA 4P7OA 3MANA 1JI1A 3OZOA 1UD3A 1ECEA 1J11A 1JXJA 5AC5A 1EOMA 1MW0A 3CZSA 1H49A 2YBUA 3K8MA 1BAGA 2BY0A 2ZUSA 4NSBA 4BA0A 3MMDA 5CGTA 4IM4A 3KLKA 1J0HA 3ZR5A 3FHAA 2PWFA 4D72A 1US2A 1UH2A 1PIFA 3HG4A 2BVTA 3A4AA 2W91A 4GE3A 4KWUA 4AZGA 4W5UA 5SY4A 2ZUVA 1JYNA 2VDJA 3AHZA 4C7FA 3B3AA 1E0WA 1HN1A 3IGUA 3SUSA 3AIRA 1E4MM 4IUGA 3AHXA 3UETA 4HA4A 2VRNA 1MW2A 3UGJA 2WZHA 3B38A 2DSZA 2DSVA 3AXXA 2DSWA 3GNPA 3D52A 5E1QA 3LRMA 1LL7A 4L4OA 1R7OA 1U9CA 4ZDKA 3VIHA 2VRKA 4X0NA 4AZCB 1OX6A 3AMCA 4QDMA 1BSIA 1UD8A 2J78A 3HMCA 2DT3A 5JZOA 4UR9A 1HL8A 2OWXA 4NX0A 5FCZA 5M17A 2BVYA 3F71A 3EZGA 2WCGA 2X09A 4NRRA 1QNSA 4H2CA 2W63A 4E5VA 1GGKA 1M03A 2OYKA 4OQ4A 4GE0A 2DT2A 4GPNA 3MSGA 2F61A 4MAZA 4AJ9A 3A3HA 3BC9A 2ESCA 4ATLA 2V4UA 1TG7A 3I3EA 2E0PA 1OIFA 4ZXOA 1M7XA 1V6VA 2CESA 4AW7A 3RCNA 4AIOA 3N7TA 1EO5A 5D8ZA 4ATDA 1QI3A 3WD3A 3WDQA 1CLXA 3OZPA 3PBGA 4MDOA 1QI4A 1PX8A 3WQVA 3PZVA 3PQ6A 4PTMA 2BV9A 4ZXLA 2CYGA 2D0FA 1FFQA 4MNMA 2Y4SA 4PSPA 1XD1A 1HXKA 3AROA 4PXYA 4CD5A 3EMCA 1XCXA 4YHEA 3FXYA 1V3IA 1QNPA 1JZ3A 2GJPA 3KKLA 1A3HA 4LGYA 4FMVA 3A24A 4FNRA 3S6TA 3ZJ8A 2D3NA 2W61A 4U5IA 1O6IA 3AZRA 5CJ5A 3GBDA 1JNDA 4LYRA 2XFYA 4QAWA 1KR0A 1H41A 2QHAA 3FN9A 4PTWA 5D9MA 1C7SA 1VFMA 1S1MA 1VAHA 4WF7A 1DHKA 2ZUUA 2YBTA 3VGFA 2RGLA 5IP5A 3CZEA 3P9SA 5DO8A 3PQ5A 1C3OB 5C71A 3WENA 1BYAA 1IT0A 1UWRA 1B3ZA 4JKMA 3WUFA 4LYQA 5E0CA 3L4TA 1NWTA 1S46A 2BXYA 3PZQA 4UOJA 3UESA 2VUYA 4W87A 1D3CA 3BMWA 3WDIA 1W9XA 3KLLA 1ISWA 3DYPA 1I7SB 2PF0A 4BFLA 2Y2WA 4WSJA 3S2CA 1HP4A 4W8LA 4P2GA 2WMIB 3EJ6A 2JE8A 3DX1A 4RE2A 1NP2A 1JF5A 4CN6A 5K4AA 2EPLX 1C8XA 1B31A 4CD8A 1U33A 3CUHA 3CHCA 1KWGA 4Q7NA 1MYRA 2E9MA 1TMQA 1WZAA 3BCFA 2CBVA 3ARZA 1EH9A 3SOZA 8CGTA 2ZX7A 2D24A 1V02A 3QOMA 3ZM8A 3U5YA 3KZSA 1JFXA 3T0DA 3P9QA 1CIUA 2AOSA 1E6ZA 1ODZA 3BLPX 2WBKA 4XX6A 3HZ3A 2OYMA 1UOKA 2ZWYA 3AISA 3GXIA 4HPGA 4TOQA 2VO5A 1XD0A 6A3HA 1H5VA 3AMDA 2EAEA 2B31A 3CZJA 1I7QB 3MIIA 1UZ4A 3VVGA 4HA1A 3MO4A 2X8RA 5AYBA 3D54D 5TD4A 1ZBKA 2D73A 2DSKA 1SOAA 2EEXA 1GORA 3OGSA 4UQAA 3NIYA 3AIEA 3CLWA 4OJYA 3PTMA 3ZMRA 2VCCA 1QOXA 5GPRA 3ZR4B 3F4VA 1GQIA 3CIVA 4E8DA 1SZNA 4MNLA 4EK7A 2J7EA 3AIBA 2WC7A 3FAXA 1Q6DA 4UQDA 1VFFA 1C7TA 4RKWA 3NDZA 4AZIA 1P7ZA 3L7NA 5BRQA 4H7VA 1QW8A 2F1AA 3WDPP 3HG3A 2CCRA 2WZIA 1UASA 4OGZA 4J27A 3WNOA 4AD2A 4C7GA 3DHPA 3WFLA 3VMOA 2XIIA 1EHNA 3WUGA 1NQ6A 4PRWA 4AZ6A 2X05A 1QWSA 1FYEA 1C93A 2D0HA 3UR7A 1W9VA 3AIUA 1VFUA 3AYSA 3M6DA 3WQ5A 1QHOA 1XC6A 2WXDM 1JVNA 1R87A 4MPKA 4QCEA 4U33A 1V0MA 1EQCA 3AI0A 5CSYA 2R1TB 4ZDJA 4UQBA 1SR0A 2XM2A 3M3PA 2CHNA 2XG9A 3WIJA 3MMWA 2NV0A 5E6ZA 4EANA 3BMVA 3WSUA 4P35A 1GGEA 4F8XA 3NVAA 3BWEA 2D3LA 4ENVA 1BGAA 4MB4A 4WKHA 3VDCA 3BUQA 1R46A 3LPOA 1BYDA 3II1A 1ZJBA 5A6SA 3CMJA 3HU7A 4ENSA 2J62A 3E1F1 1XSIA 1W3JA 4FNSA 5EB8A 2DT1A 4KRUA 4OBSA 1DWJM 2XVKA 1V08A 1MXGA 1M53A 4HU0A 1NOUA 4J3WA 3SCOA 1GJWA 1GONA 2UY2A 1QBAA 4C7DA 4NZFA 2WPGA 2A3CA 4HZ8A 1E6PA 5D4YA 3PQ3A 4M29A 3W37A 2WNWA 2YJQA 3CUFA 4CGTA 3TTTA 1O7AA 1WKYA 4R5EA 2NSXA 3TP4A 2X2YA 1FY2A 5A2CA 2FHCA 5ABEA 3VD4A 2EXOA 4P8XA 5IHRA 1T36B 4I46A 2CKRA 1TQWA 1CNVA 2QV4A 1WP6A 1LG2A 4N0RA 3BAYA 3DYOA 5GNYA 1OD0A 1EDTA 2XVNA 4J3SA 1KGXA 2GFTA 2E4TA 1PJ9A 1C90A 1QNOA 4RE3A 1FHLA 1WB0A 3UERA 5E9AA 2J7FA 2V3DA 1B90A 3BH4A 5LIRA 1V02E 1LJYA 4ZFMA 2VR4A 3TTVA 4FLOA 1U2YA 1ISYA 4U2YA 3VO0A 4H41A 4MADA 4NXKA 4D6IA 1OM0A 3WBEA 5HXMA 2GJRA 3IAPA 5SY6A 2YL5A 1VHQA 3NCOA 5ABHA 4MB1A 1UD4A 3GXPA 3LXBA 3VIMA 3AHTA 1BPLB 1UUQA 1CGXA 1NARA 3OBAA 2VL4A 4JQSA 4PMUA 4GO8A 2F1BA 1JDDA 2AB0A 1GHRA 2WMFA 3ZJ4A 1E0VA 1H0IA 3D4YA 3SIMA 4N0MA 1LQ0A 2E3ZA 3ZR6A 4KRTA 1CZ1A 3MMUA 3ZJ5A 4XB3A 4MDPA 5BCAA 4A4AA 4D6DA 2D2OA 4WLCA 3CV5A 4B9ZA 2YWBA 4ENUA 1V3KA 2BHYA 2ZX5A 2AAAA 1KXJA 3EDFA 3A4XA 1JZ6A 3CHFA 4PMOA 1DWFM 4EE9A 1J0ZA 1J42A 4M8UA 3WD0A 3AYRA 5SYAA 1EHAA 2D0GA 4BS0A 3M46A 4NRSA 4UQCA 3F5KA 4XLLA 4NI3A 4ZDIA 5IFTA 1WNOA 4D1JA 1I75A 1I1WA 2BNJA 1Z32X 3THCA 1CWYA 3F5JA 4BQ5A 1OX5A 1OGBA 1OINA 2YOCA
chains in the Genus database with same CATH superfamily
5DJ6B 3EN0A 4ALMA 1FJXA 1N0VC 4EJMA 3ROOA 1TQJA 2CV1A 3I01A 1FU7A 4P4GA 1GNVA 2QZRA 3K0FA 1G8AA 3G9VA 4W93A 4KIFA 1Y7VA 3KCJA 3TCNA 2VC2H 4B3JA 2PV7A 2B3DA 3N9IA 3UFXB 3SYPA 1OO2A 4UOW0 4KWIA 3PPVA 5DS2A 2WYHA 5IVOA 3ETEA 5FFGA 3NQFA 1NR7A 4AN4A 2NWQA 2DS4A 4RMQA 1XGDA 4PYKA 1T1ZA 3GAYA 2F59A 4KQ9A 1G7LA 4YVPA 3OXSA 5E1DA 2X42A 3N70A 3BSWA 1TQCB 1EWEA 3L2NA 3UTQA 1ACXA 5B3SB 1M8JA 4KDRA 3MINB 2QM7A 1RLBA 5D3MA 1XTKA 1FSKB 3JWDC 1PWMA 3KEMA 3FS9A 2C7OA 3IFOB 4I9WD 3LSYA 3I3DA 4MICA 1MAUA 2ZJ3A 3FBWA 2WU3A 4BAGA 2BOGX 1NURA 5AM3A 1ZRQA 3FTCA 1RIFA 1VHTA 4DUGD 4MYDA 4Y7DA 4NCC2 1Z3IX 5DELA 1QP7A 1BU5A 4G2AA 2JJYA 3HU1A 4KDTC 4JYZA 3T2OA 1DOZA 1QUFA 2IT1A 1LQTA 4TSCH 1QLFB 2JF6A 4NYIQ 5I3JA 5T1JA 1E6KA 1EWRA 4XAKE 1E1LA 2FYVA 3BP5A 4CUZA 2EADA 4K1GA 2R97A 2F8VA 1FUEA 2QPAA 2Y2TA 3DTXB 3IAFA 1JNXX 5JW6A 3WWOA 1WFJA 1LOQA 4I89A 3M3DA 1OC4A 3RODA 3TC9A 2OOSA 4FOOA 2X89D 4JH0A 5J0BA 2DLCX 1LK3L 2WBJA 2VTVA 4Y8EA 1VSTA 2A30A 5EPMA 2VAXA 4B09A 4KGLA 2OCBA 5EJ9A 3CZ4A 1TVHA 2ZI4A 4YVVA 4LCBA 4KXVA 5EC1A 2FUG6 5FDFA 2W6ID 4Q8PA 4J0CA 3W1LA 2VN7A 3BD5A 2EIZB 1ZPTA 3KZOA 4Q16A 3CH1A 1YPZA 1OAZH 4Y2TA 1R4NB 5JA8B 1B0ZA 1KTBA 2C03A 2JKTM 3QMWA 1K89A 3GLTA 5DS1A 2ZVDA 2Z2XA 1Q9OB 2LU5A 4UEKA 5IKXA 3HVNA 3M0HA 5CURA 4G43A 2G25A 3HS3A 4AUMA 4XPAL 3VXSA 3AW9A 4UT7H 1ZSHA 2QL6A 1BS1A 1W2VA 4CQLA 1BG6A 3JZFA 3URMA 6FABL 2O3QA 5JXHA 3SE9L 2OMUB 1D6JA 1BLIA 4X3OA 2FSEB 4PYOA 1O94A 1BYUA 2VN8A 3N4EA 1HZYA 2PMQA 3FPLA 2CBUA 2HT6A 1IAMA 3I58A 1SHSA 1RXOB 4EKYA 3BGFC 3IQZA 3GLAA 3UAJC 2ZC8A 1JHZA 4LASL 5DXJA 3X1KA 5FTKA 4GKLA 4RFSB 3LX6A 3ZLBA 2DFAA 4HPYL 2AG1A 3HHSA 1H2HA 4LQCA 1C4OA 5K3CA 4GVHA 2XJ4A 2XN0A 4A10A 3F7JA 2QMEA 2J7HA 4GI8A 4NQDA 5MEQA 4YIHA 3I6MA 2I32A 4HKZB 1THFD 3FRPB 1KOGA 3U1PA 2PZNA 4GO9A 1D5MB 1AD9A 1SURA 1BAFH 2J3QA 4LXYA 1NM5C 4XWGL 2WE7A 2XH8A 3DAGA 4LY9A 4OH7A 4LBAA 2V5CA 2J6EL 4WA7A 1WGVA 3N42F 1E77A 2IYSA 2ZG6A 2ZWIA 1Z5LB 1RSYA 2WYOA 1MG3C 2PNDA 2NTVA 1CLEA 3PUYA 3T3MB 4YRBA 3E2RA 4KWCA 1U3HC 1DO6A 1JV2B 2HUPA 2P6PA 4ND8B 4FI6A 3UO8B 4N65A 4HFNA 2P91A 3WNIA 2OJPA 4H27A 2FEDD 4FOKA 4Q8QA 1KIRB 1H8ED 4U1NA 4COOA 4JRLA 3U7BA 3E6FA 3KM1A 2I7GA 1LLFA 2WT8A 5EESA 4JFYB 1KJ3L 4KK9D 5EFZA 5DD1H 4JJ5A 4HK7A 5E3JA 4J0IA 4F7MB 5EEXA 3AT1A 4DHWA 3UPAA 1P84J 3HGQA 1QBLL 4OHBA 2IZ7A 3BIWA 1E63A 1XDZA 4I99A 2FRDC 4WLUA 4D0CB 3C5ZC 2X7VA 1P80A 1PIWA 4L5BA 1TELA 4RE0A 3EF1A 4HXAH 2W2NA 1Q1EA 3BCRA 3RS9A 4I7WA 3SZRA 3AOEC 1QQDB 1X92A 3T6KA 4L4TD 1A9TA 5K6TA 2XSKA 4WJXA 3D2LA 1QGUA 2DTSA 4Z7OE 2H8PA 3KYMB 3UGTA 4FIZA 4W8AA 4MUJA 4LKXA 4M0FA 4M7OA 3BAWA 3AS1A 1JHRA 3TNYA 2OXCA 3OCVA 1ZS2A 2QVBA 3FCCA 3A27A 1RQGA 3FTGA 2P7TA 1JV5B 3NTYA 5GM1A 1FO0H 5IQMA 1PDKB 1IBFA 4FDTA 2Q4RA 1Z4QA 2AI1A 3OJXA 3UB3A 1ZNZA 3QNMA 1BGWA 4EHJA 2KDYA 4J28A 2BHLA 4X65B 1P2CB 3NSNA 1OH7A 2IWKA 4L95C 2H0PA 4IGBC 2OZPA 3K8QA 1LEGB 4J94A 2YN0A 3KALA 5ESDA 3VDNB 1D7KA 2HV5A 2IS1A 4ZMNA 4L4TB 4ZUVB 1O1ZA 5AXDA 5GNXA 5HKKD 2GN8A 3FZNA 1Z2DA 3SO5A 3D0KA 4BN4A 3AHJA 3NZHH 4YUAA 3DLBA 3VE0B 3FMGH 4RGMC 5CVJA 3P3SA 4UHCA 5K2OA 3FONB 1Z2KA 4TVSA 4HOWA 3DLQR 1MCPH 2K78A 1Q7QA 4XN8A 3VVCA 3CLRD 3PTKA 1GUVA 4HX2A 3SG0A 1RXUA 3RFZC 2ZTSA 1H7XA 4O12A 2QVIA 1FWEC 1XGUB 2CYBA 1TTJA 4WXHA 4BLWA 5SWSE 4NHCL 4MQXD 3IALA 3IDYC 1FFAA 4LOEA 2P50A 1QGED 5T1LA 1WBJB 3L0PA 1A7NL 1HWWA 5DNCA 4O9HL 2I6UA 1TPFA 3ZOZA 3CHYA 3EPHA 1NUDA 3PJRA 1SFRA 4KV5F 4JLBA 3EKCA 4EI5C 1NCWL 1MVFA 4RZCA 3H2NA 3K5HA 3C5VA 1V7YA 1OOAA 3RUGE 2EJTA 4MPJA 2BS9A 1HP5A 2FFJA 3OCCA 1ULTA 1CBVH 1OXSC 1E60A 3ME3A 2O8EB 3UMBA 3KLQA 3L2LA 4Q4CA 2ACVA 4ENWA 2C0AA 3P1JA 2ZZNA 2JHGA 3DDFA 3D3VB 2EIXA 5HHVL 1L4FA 5IHWA 3LKPA 2VG8A 4XPBH 3L4WA 4JSRA 3A2LA 2NNRA 4NQEB 1ZV5A 3VX1A 1WMDA 3VNBA 1NCJA 1YUNA 2NW0A 2OY0A 3ZW9A 2AN1A 4DW8A 4TTVA 4N2IA 2Z26A 4GLOA 3NN8A 3S6OA 4GZ7A 3H1PA 2F19L 1BG1A 3WY4A 4JLRB 3QK7A 1RQ5A 3KL3A 1RI3A 5A6BD 4ECAA 3N0XA 1AR1C 5E2JA 5FUOH 1SZGA 4NVRA 2HPZA 5HBGA 4S3EA 1QACA 3CT6A 4BFGA 4ZW3A 3P9YA 2XYPA 4OLZL 1FDLH 1E9OA 4XMTA 4J0FA 3K0KA 1OBOA 3HJNA 4G7VH 3PPIA 2UXDB 3BB4A 4N3UA 5KWVA 5C7LO 1NYRA 3TN0B 1QEWB 1Q2RA 2EZ9A 2ZRMA 4Q9RH 3FQ2A 5U1PA 3WHPA 3V9PA 1F73A 1CRZA 3IOCA 3ETTA 3ZDCA 1W3LA 5KHAA 2XN9A 3EVZA 2XPGB 4HKBA 1YHYA 5AP9A 1B73A 3JV4A 1HY3A 1W5FA 2VLJA 4M1GL 4BJHA 4CTOA 2ZPKL 3VI4B 4ML3A 3IJ8A 4KTEH 1OFBA 1PKEA 4EG7A 2BFFA 1LVGA 4R4BA 1HL5A 1MJJA 2DM2A 5D6CB 2JGIA 1H2EA 1QKJA 1TD1A 3KUDA 3G9AB 2D7TH 2B69A 4L65A 1OXUA 3E0FA 2ECOA 3TMLA 5DXXA 2DBVO 3W85A 4RD3A 1MB9A 3VXRD 4XXDB 1XLFA 3OE4A 1G0DA 2H0JA 4LNVA 3N1FC 4CDGA 4R7JA 1UBLS 1D2PA 1B1AA 5T4BA 5CDTA 4M8RA 2L8AA 4DK3A 3GVWA 3OA3A 1DO8A 4ILDA 4YYCA 3A36A 1F41A 3SU8A 1ODTC 5J7CC 2YSSA 3G6JE 5M95B 1HJXA 2DQGH 4Q4KA 2P76A 4GSDL 2XR1A 4PODA 2GHIA 5AVJA 2BMKB 3WB1A 1YB6A 1H2AS 4UAHA 2ZYWX 1GA1A 1ZKAA 2FV8A 3OWRA 4O4WA 1YIAA 4XX5A 5B1HA 2GN9A 5BZDB 3STVA 2FE4A 2E37A 3NJNA 2H51A 3EO0B 1Q1QA 5B1CA 3BQUC 2D8KA 3N7UA 3O9WD 1ZJ5A 2C0CA 2GG1A 3W7GA 1A97A 1ZCRA 1UMLA 4GVXA 4HDNA 3N19B 1ZHHA 3VXRB 2ZZ5A 2XN2A 2WWVD 4ADJA 4QO1A 3IBFA 4ZSOA 2BI8A 2IU4A 1I4TD 1NKVA 4NMMA 2OCCB 5HQJA 3IS1X 4J2MA 3S3PA 1FMLA 4K7PY 1OAXL 3TH5A 2GQ9A 1M6VB 1YACA 1YEEL 2ZUDA 4U2BA 5MGBA 3F01A 5DO2C 4YFLF 3CN2A 3KXFB 3HIZA 4GM1A 1KTKE 3APGA 3ZY6A 3B2XA 1QHSA 4NKIH 3JR2A 2WIIB 1DJPA 2W81C 1E2NA 2RH4A 3BWVA 4HGWA 5L3QB 3MRGB 2IHKA 3O9WB 4L5ZA 4HC1L 5LA6A 1PEWA 4LDPA 2A73B 4RW3A 1N0LA 2XFFA 5EFFA 3GFRA 1NCOA 2FK8A 4DC0A 4E9QA 4Y9GA 1BF2A 2YKLL 1U2SA 3HN7A 3NAGA 2WNQA 1VZ2A 1UJTA 1PLAA 1U8LA 2D7PA 3ELFA 1O87A 2CRMA 4PJIA 4J40A 1P74A 5JHHB 4XTRC 4O0QA 1IY2A 5AUNB 2J4GA 3GS4A 2Q99A 2CKBA 2TSYB 5HGHA 5I7UA 1OE3A 3T4AB 5DMHA 3FN0L 3Q37A 1N64H 2BFNA 3AAMA 4F4IA 5ABAA 1W72L 2PTZA 2BFOA 3NM6B 2FRVA 2V2CA 1I4WA 3KJXA 3AY7A 4RA9A 3PHSA 4RXGA 2CDBA 2JI3A 1WC7B 4JQIL 1LTKA 5GZOC 4PQFA 3QFJA 2Q4EA 4P2AA 1LNUA 2PKDA 1J23A 2XCSB 2PX3A 1OGGA 2I2WA 3P5SA 2L04A 3LQMA 3NIBA 2YC1B 2FWSA 5A5GA 1WA1X 2FVLA 1OIXA 2YVAA 4UJ3A 1G5AA 2VX6A 1IUKA 1OFVA 3T1FB 2V98A 1XPYA 4WVRA 3VFGL 4YA6A 4OIMA 2QR5A 4F92B 4S2CA 3JVVA 5FF9A 2YBDA 3BMNA 1SEPA 5DB4A 3CJPA 3OAUL 5HHOB 1P4LB 2VQ3A 4C6TA 4IFOA 2YIHA 4NZUL 4NC2B 5E0OA 1ZI9A 2NV9A 3SBWA 2NSHA 4WNIA 1I1OA 1P2SA 1E9EA 1J99A 3FPKA 2VQ1B 4LW7A 2FZGA 2FA9A 1FQOA 5E1BA 2FFAA 4I87A 3AEUB 1RCYA 1TADA 5C5DA 1G4EA 3MLVH 1K8YB 1DBML 4QRPA 1NLFA 1H1DA 4R2LA 3H2FA 4MWZA 2HU8A 4HIXL 3WTTA 5JECA 1IXYA 1R9NA 4F8JA 3AUKA 4U6NA 2EE6A 3GBVA 3LTNC 2JJ2A 2LLNA 3MJRA 3D5QA 5BSKA 4F06A 4UQ2B 3I3OA 1PYWB 3SAZA 4WV1C 4J3XA 3ULVF 4CKWA 4DV7B 2WYSA 4F7WA 5E9QA 2YQBA 4LE0A 3B9RA 5JOEA 3BP4B 4ENRA 2YJZA 1VLMA 2WZTA 5HZHA 1Z0JA 3NATA 1P2TA 3DHWC 2XVGA 3LHAA 4TN5A 1CL7I 1O6SA 4EZLA 3BGDA 4L51A 1R9GA 1HESA 3HNRA 1JQXA 3DI3B 5I0YA 2IQ0A 5BYKA 1LH0A 1MUWA 4ALJA 1AIZA 4FXGB 3Q2IA 1X98A 2X0WA 2UWEB 2FEXA 4YHML 1UWEL 1LB1B 4P80A 4AJKA 1IPHA 2CK0L 2RMKA 4CE6A 4WUUD 1M1XA 2MSNA 1HL7A 2OCDA 4JQOA 1OAKH 1RURL 4BUZA 4JQ2A 1XQLA 3COYA 3MGGA 4QLLA 1DEXA 3U9WA 3T65B 4R9SA 4UTXA 4Y2LA 4Z0BL 3DFFA 4L22A 1E6XM 2DHEA 2MIZA 4FGJA 1PCSA 4N2GA 3VVMA 1JPEA 5GGVL 3EFFB 4ZALA 3CNLA 5C9KA 4IPLA 3O8DA 4C7VA 4P4KC 5KBLA 1XLLA 1OAYH 3GNRA 2BLFA 4BMYA 5EUKA 2HVBA 4CCCA 5AVHA 2DR3A 2YPVA 1H42A 3VVBA 2R9HD 4A6YL 4K5OA 4TQTA 1YQ2A 4LXQA 3QUKB 4ZJ9A 3IQHX 4RV5A 4UU1A 3BXNB 1RJCA 3FJ4A 4DF0A 3GD6A 3BH7A 5DBGA 4LE2A 1NRIA 4LESA 4JG5A 3X1WA 4ATTA 1QAPA 1D6EA 3NJMA 3ZGHA 1C1EL 1B26A 2SODB 2AOTB 3AFGA 4MI9A 5FF3A 1MG0A 3TW8B 2E5WA 2JAQA 1A8QA 2G3YA 3NNSA 4GI3A 1SGKA 3SC3A 5DEGB 1LO0H 2PZFA 3IFSA 3QIVA 3WFBH 4FX5A 1ZR4A 1NDMA 3IR7A 5MI0B 1FI8C 1PX4A 1CW2A 2D8AA 4GP9A 1TCCA 2PGOA 1VGRA 1HEIA 4E9TA 4F7DA 1XCJA 1DVZA 1RJ9B 3K1YA 5KBYA 5KSVB 3UTZB 4I4NA 1G55A 3QPQD 3TUUA 2CXXA 4DGQA 1RKUA 4O4YH 2GJ9A 4L9AA 2JIWA 1EUQA 5J5RA 1K68A 5FK9B 4LYJA 4ZQKB 2Z4TA 3WQSB 2P8CA 4MKGA 4AY8A 3CF0A 3P32A 5BU6A 3L4CA 2C83A 1FYWA 5D2YA 4X5OA 3OX2A 4WBNB 2H26A 4JJ4A 3NT5A 5T7BA 4JU8A 2PBGA 1UJ2A 4GX9A 3W39A 4OGYL 2NSOA 2H2PC 1F2UB 4QXPA 1NCDH 3HPRA 5A8QA 1Y7LA 4N6EA 4GLBA 4E3TA 4W1QA 5J5CA 4IRSD 3LHPH 3VA8A 1W19A 3RH0A 2BZSA 4DIEA 4GH5A 2VLLB 1YNTB 1HZZA 4B80A 1U7TA 3KVDD 4B2LA 2XV3A 4QRSB 4B5ZA 1ISZA 3LQLA 3TA6A 2YMQA 2P77A 3QMTA 3HVDA 2QPXA 1OCZB 1RNLA 1HAUA 1WF6A 4BH7B 2YZ7A 4UOEA 1X1NA 3ZTJG 3T9WA 4IJCA 5I7GA 1NM4A 3DX9A 1Y80A 1KZHA 3EFOB 4PTTA 3ZU4A 4F84A 1GPH1 4N87A 2HF8A 4AMYA 4NRYB 5AW4A 1A7QL 1WB4A 3UZVA 1E4IA 3GFUA 2QA5A 4LSPL 4KE7A 4Q1AA 2DHRA 1H3VA 4TNGA 3LHSA 3W6NA 2AFHB 1YMQA 1CR2A 3H18A 3QQ0A 4B9CA 5C0JA 4IRSB 1ZWLA 1UM6L 1C8VA 1EWDA 2P3SA 1DQLH 5FKPA 2YXOA 2R4RH 5KC9A 4C6KA 4N6QA 2ZG2A 1EA7A 4MS3B 3E5RA 4LNHA 4QIHA 2POZA 2Z92A 4QOHA 1BHSA 4NO0D 4QXOA 4EZMA 4TLEA 2XE4A 3EBPA 3X2EA 1TT5A 1BSLA 5MKGB 1H1TA 4ZVLA 1SFDA 3QFDA 4PJBF 1V6XA 3I0NA 2GLUA 3NJ4A 3S55A 3DJZA 5PCYA 3ZK9A 1QQ7A 3WL7A 1QHIA 4MQFA 3U1SH 4IINA 4M3NA 3BUYA 4ASUA 4MDFA 3MJ4A 2VMFA 3ZO0A 1YEFL 3RSLA 4JZNB 2C1HA 2IQIA 4EQ6B 4PV7A 3USBA 4U7FA 3NTXA 1RFGE 1RWOA 4EN3B 4LFAB 3OSUA 4Y4KC 5BO5A 1KT2A 1DSYA 3FU8A 1OHZA 1OAAA 1F07A 3VGPA 3WI9A 5FLXA 2WTRA 5JIHA 1D2MA 5FOUA 4GYYA 4NO0B 2VD9A 1QO3A 5C0RL 1B43A 1SA0B 4KDVA 2B4GA 3M4HA 5GGQH 4LL9A 1FHDA 1XGRB 5E08H 1RUAL 3RK1A 1V48A 1H65A 2YNMA 2HT3D 4K2UL 2VUKA 1L7EA 3LGDA 2BTOA 2FN4A 3PABB 4TU1A 3GK0A 2OYRA 2CNLA 1DWQA 1THTA 2ATEA 4R3UC 2XG4A 4GS7B 1Z0ZA 2CYCA 3LLMA 1H60A 1MLCB 4PYGA 5C5CA 4INFA 3MUIA 1U5HA 2A3HA 2ZBUA 4OCYL 4P0DA 4UMSA 1TTAA 5DC0A 4YHLH 1BXNA 2TYSB 5F96L 5JV5A 1RXEA 2GN2A 4L76A 3L4YA 1OAJA 4IILA 2QGBA 4ARUA 3W57A 1WEHA 5FF4A 1WXYA 3INUH 4ROSA 3B6SA 3MHGA 4EF5A 3EEBA 1FL5A 5IJWA 1G43A 2NY1C 3CPUA 3ZHZA 2J6HA 4MWAE 4PLOB 3GQBA 2H7XA 1KTIA 5T3ZD 4PM1A 4WO4A 1K2VN 2DQTL 2LW7A 3R0VA 3MOQA 2E82A 2IVFC 2QWXA 1GPAA 5IVKA 2VYCA 4I5BA 2PCXA 2PXCA 2UZIR 2P2CA 4AJ1A 1J12A 4KRMB 2RHTA 5D9SA 4DLBA 2NZXA 1KZQA 2ZJYA 3IQFA 3LWBA 5JAQA 3EFDH 1S01A 2J6WA 1DFXA 3ZOKA 1WD7A 3VTMA 4AC1X 2DORA 3GY1A 1Y8RB 4RHEA 4PCTA 2P68A 2AW5A 1CI3M 1F8YA 2C9BA 4Y5XC 3IUNA 5EZLB 2NIPA 3JQ8A 1JI3A 3L5IA 2XW6A 3FNHA 2RK3A 5FHAH 4EELA 3U0WH 3TPCA 4DGIH 1N5RA 3BPSA 4WKCA 2ANBA 2CD7A 2QGZA 5BMOA 5CEZD 1H2WA 3T3OA 1Y8QB 2BD0A 1XH0A 1KQNA 2OX5A 4KKXA 2X7JA 4OZOA 3MLRH 1XHLA 3S4SB 2BFBB 4CRWB 3S5LB 3IRSA 4DDHA 3UJJL 1DQWA 3CHOA 2O9RA 3E05A 2XAAA 1WD5A 2IGBA 1QF9A 1E9ZB 3K70D 1I7PA 1INEL 4I2XA 4R2GC 2DF3A 4QRTA 3U7AA 4JHOA 4OLVL 2D2IA 3Q67A 2OFXA 3CMOL 2WFAA 2QEQA 3WIBA 3SPVA 1A3QA 2A6NA 2UXCB 4QDPA 3DGGB 3E3MA 1PVHA 2QCFA 3ROOB 2BOCB 1TJ1A 4IIHA 3PWVB 1WAAE 5KNBA 1PG2A 1Q22A 2OL3A 4UUJA 3ZVIA 1K97A 3Q9UA 4ABVA 1STOA 2OMVA 4L4YA 1CENA 4B5EA 1UWQA 3R4IA 1KAHA 3DBHB 1FJGB 5JAPA 2YDSA 3RQSA 1GS8A 2XDYA 3OP1A 5CINH 1JQ5A 1TEFA 4XXCA 4HBKA 1OFEA 4OJFH 1T1ZB 5B39A 3W01A 5F97E 5H8DA 2PVCA 2CLSA 2C84A 3E6HB 2B82A 2OSWA 5H82A 4KJPD 4AZCA 1O4UA 3RWCB 2P4EA 3UTQB 5BPHA 2IPTL 2AQ1A 3A2NA 5D3MB 2RCNA 5ULLA 4BATA 2H3NB 2WYIA 3UQYS 5EORL 2ZTUA 2AUNA 1D2EA 5EKUA 1TPDA 2GRAA 3FCUB 3UGUA 1KIQA 1YN6B 3KEQA 3WLNA 2D7DA 2WBJD 3P9KA 5JMOA 5DHUA 3M4NA 3C74A 3LM8A 1R66A 1A0QL 2R1PA 1QFUL 4AZGA 3S35H 5CX1A 1JYNA 4ACAA 3R3UA 4C4RA 2XHNA 4AF8A 3L17A 1MD9A 1HILB 3AHXA 3V46A 3D43A 4IAOA 3FQXB 2IG2L 2HBQA 1SU7A 1Q8MA 4K3EL 4R31A 2FSDA 1I53A 1T20A 5IMLA 1INLA 2Q20A 2DI8A 3HTLX 2DT3A 4WAUA 2R4QA 4ZK2A 3B1YA 2RG1A 3BPLB 1E2WA 5CJPA 3TJEH 4NRRA 5FPSA 3VXSD 1IBBA 1MUCA 3NT2A 4UMEA 3E74A 5ETUA 3PXJA 5EPMB 2B0CA 1L5HA 4YALA 3BDBA 1SBTA 5B1BB 5JPDA 1O94D 1QR1A 4PQGA 3D0LA 3UWEA 5EJ8A 1Y9JA 1OE2A 3USZA 4IWXA 2I4OA 2HIAA 2OODA 2V6HA 4JI7B 3WYBA 3W7DA 3IXTB 2I69A 4ZDWA 3CH1B 5CAYB 1YPZB 4BGVA 4WGKA 5I7RA 2R2HA 1NP7A 3BD7A 3TIXB 1NEZA 2HGZA 1XQYA 4P3NA 2F6AA 3MRQA 5C8YF 2JCCF 4LCWB 4NQDD 2ONKA 3AT0A 3PFRA 1JHOA 5IBPA 3ZEIA 4G43B 3MGBA 4PGJA 1E0KA 3EVDA 3FO1A 3KR0A 5TX7A 3SJUA 4XMZA 2X1UA 4CQLB 3KCQA 3MW7A 4JVPA 3NANA 2GLXA 1K1EA 4XMUA 1V6TA 3WFAA 1RBMA 2EFGA 3CPEA 4RTNA 2ZREA 3Q87B 1A7AA 2GJPA 4B5UA 4OB6A 4AY0A 1UFVA 4U5IA 3AZRA 4UM7A 1R9FA 3P9IA 1RZUA 2G9HA 1KR0A 4MMYB 2C5GA 2FX2A 1YC2A 1X5GA 5IM5A 4J0KA 2V96A 1BMDA 4PCYA 5BOOA 4O02H 5I7EA 3EIHA 1G3QA 3E22B 4UW9A 1SMKA 1T83C 2X8LA 1SAYA 4N02A 3GDLA 3T5PA 5MEQB 1H3WM 1B3ZA 3B2VL 5E0CA 5C8VA 3GEHA 3MLEA 3W88A 4LIQH 2WWYA 2C3HA 1XIJA 2ITEA 2XD4A 2EXXA 5LGXA 3D7NA 1P9OA 2TRSA 2VFDA 4P7BA 3MXVH 5D1ZC 3CQKA 3I6RA 2ZG1A 1GVNB 2FUKA 2Q5LA 3CASA 1E1NA 4HJWA 1E9YB 2O1SA 3RTLA 4GRLC 3KB1A 3OPVA 2IV3A 3KDOA 3S2LA 4GGOA 2P6NA 2V2HA 3OZRA 3TROA 5AI5A 3JAMA 2CPCA 3M8KA 4P0TA 1KBLA 1EPUA 3LDBC 2DPXA 1J20A 4U1NB 3T41A 1DCFA 1R3RA 3H24A 4PSCA 2ZUXA 2GQ8A 1JCNA 1V02A 3QOMA 4YK7A 1EVQA 5CEYA 4L4MA 4Z8FL 3TGPA 3B7WA 3F6SA 1PEYA 4PB9L 2GVEA 1P5JA 4S10A 2QVNA 3ONDA 1U7HA 5ALEA 4E7PA 1U28A 4OKNA 3BXXA 3ZLHA 1ACLA 4QXUH 1RYDA 3IKKA 3L1IA 2FQQA 4DCTA 5C52B 1TCAA 4QMEA 3OE1A 3HDVA 2PLJA 2C3GA 2YJ6A 3FFSA 2NY7L 2QZPA 3HY4A 5EEHA 5HA5A 3BO8A 5JBIA 1FNSH 3OKEB 4XSLA 5LLSA 2H8PB 4G42A 4J4BA 4ZHSA 1LO4L 2WTOA 1Q77A 4WDRA 3MJDA 3I2GA 4ELME 4MXVF 5D6OA 1GAXA 3DSRA 5K1ZA 4AZIA 4KZDH 4E2DA 3GIVB 5BRQA 4RETA 3ZGVA 5LGYA 2EU8A 4JFHD 1RJGA 4DDTA 1MB3A 1WLSA 4EA6A 1XGPB 3HO1A 1A53A 1IAOA 3VMOA 3NWPA 1A6VH 3QSTA 3NXSA 2D1TA 1VBNA 2AZAA 2V17L 5BR4A 4OLUH 5JCXA 4MBRA 4RK4A 2V1UA 1FMCA 5JOQA 5T1LD 3QIUC 3GFXA 3D0RA 1RK7A 2RARA 3I9AA 4FGZA 1CY4A 1Z66A 4X5LA 1BMWA 1TTCA 2NV0A 5H2ZA 3WJAA 1LPOA 2P0EA 3T4EA 4P35A 2CO7A 3H2EA 4S35A 1RRCA 1KM5A 3IWVA 3U5TA 2X9XA 2WQVA 2E1WA 1BD3A 3F62A 3T34A 4XBPA 4XX1A 1WUTA 4C06A 3O95A 2OZ4A 1KBIA 1CIPA 3JZYA 4OLBA 4LP5A 2PDKA 1XIWC 3T5BA 4F0SA 2CUNA 7AT1A 1IIIA 3B12A 2UY2A 4O4LF 2YS6A 3M5XA 4KBFA 1M7JA 5IFJB 2H7YA 3V5HB 2ZB4A 4N03A 4LX8A 1JX6A 1LDCA 1UUSA 5C35A 2HZBA 2VSFA 4H5SA 4QJ3B 4AC7C 1PJ8A 4MVJA 3VD4A 4RZCB 3I6LD 4LK3A 1RFDL 3NMUF 1I3OA 2CSPA 4MDJA 5GISH 4YR6B 4MAUL 1RZRA 2GJZA 1QNOA 1WCQA 3RSQA 1CNFA 3KVPA 4MVBC 4KCUA 5EP1A 5L0QC 4H13C 1ETZA 1J24A 2VENA 1Q6ZA 4WFJA 4WNJA 3VO0A 5E4EC 3CG8A 1D9KA 2WNSA 2X4GA 5JMRA 3BXPA 2HFEA 3Q11A 4DV5B 2ORED 5J6GA 4PGDA 2XN9D 1ONPA 3GGWA 3H17A 1RC8A 2B4KA 4P5RA 5HHME 3VIMA 5DJ6A 3OURA 2IX3A 3RKPA 2GSHA 2VLJD 3PNUA 5BW6A 1X0XA 3HDGA 4IG4A 3UH1A 5K6AA 3MRDA 1S7QA 2IBZY 2PDPA 1RCOB 1A4CA 2L2QA 5F1SA 2QAFA 2JAWA 3SIMA 1YRBA 2NQ9A 1N7GA 3LWNA 4IBTA 4IS6A 3ZG6A 1ZLUK 4AEOA 3TWYA 3K0CA 3UMTA 4J1TA 1E9OB 3QEQE 3WKYA 1XTTA 4FEGA 2JLLA 1EXUA 4RDHA 5DQJB 4LF3B 1E1DA 1EMTL 2IEBA 1Z88A 4ER3A 2G5CA 2ZJ2A 4HUQA 3K6RA 1NJ5A 1G0NA 4GH7B 1I1RA 4KNUA 1TKKA 2A58A 3GIQA 1TO1E 2XN9B 3JWDL 3O8LA 4HKBB 3A04A 2CD0A 4XBEL 4PE8A 2CJPA 3MB8A 4LYHA 1Q15A 1E3WA 2VLJB 4BJHB 1OX5A 2GJ6B 3F1KA 5TDHA 3QXXA 3HSYA 4R7WA 1UOQA 4BB6A 3IFOA 4DUVA 4JPKL 4HWTA 1EJ8A 3D31A 2WXNA 1QXSA 2HY7A 2FTYA 1CX9A 1YXCA 4AT6A 1TCDA 3U7QA 4DK5A 4DV0B 1WICA 3EA1A 4ZV7A 4E0RA 1RMFL 4HWRA 2G4JA 1MC5A 3LIZH 1R3YA 1SKUA 5HDWA 4FAAB 3AJ7A 1Y9EA 4C43A 3X0DA 5D3ZA 3TKFA 3RPMA 1JPST 3FTEA 3IPCA 1VS1A 1SYVB 3FU5A 1HEYA 2W38A 2AEJA 3EYUL 1QLFA 2AL2A 3NSXA 2C1ZA 2WHRA 2YSSB 1CXFA 3PAJA 5IHZA 4F9JA 1VPWA 2A77H 2TMKA 3RS7A 4XD4A 3PNQA 3VYUB 3DTXA 4Z7WA 4NZ8A 1U1GA 4N6RB 3OL2A 1EA0A 4Z2LA 1VJ1A 1WEJL 3CC8A 4W85A 1I0ZA 2D62A 2C3WA 1DANU 2CHQA 4FFTA 4KIEA 3LRTA 5I8CA 5DTIA 2CCWA 2Z8VC 4DWHA 1UR0A 4PJDF 2YV5A 2WAHA 4FDMA 1XF1A 3O16A 1NH6A 4H0GA 1I7ZA 2Y36H 4HDNB 4X6DE 1N8WA 4IP7A 2H0FA 3ZTEA 3PNZA 1E32A 1J5OL 4D71A 3AZQA 1H3GA 2DI9A 4QO1B 4ZSOB 4FYJA 4J6FA 4YV0A 5T1MB 1W7AA 1RHHA 1T80A 3Q0HA 3P9XA 1IC7H 3FBQA 4QYWA 1K85A 2R1VB 3G6MA 2VAVA 4FTVE 4OQEA 1J01A 4GO1A 1EWVA 2B98A 1R4NA 4ME6A 4B15A 3ADCA 1O97C 1Y4UA 4F1ZA 3QQ1A 1Q9OA 2Y8VA 1PX2A 4K6CA 5E5UB 1HIZA 2QUVA 5I4CA 1ZALA 2AQHA 2BDUA 3LPMA 3LNHA 1U2TA 4YO7A 4JIHA 5GZNC 4HGWB 1XF9A 5ADVA 1JGTA 1N0LB 5EVJA 2FSEA 3EBIA 3BXZA 5IKCA 3O6AA 2I6FA 5FFMA 5LN1A 3QFJD 5IGXL 4OQTA 5BYWA 5LA1A 3MJ7A 1V8DA 5H94A 2EJAA 1KU0A 4J0GA 4M5PA 4HB7A 1MRSA 2C4NA 4P8VA 4K03A 3CMCO 1VEMA 5EUQB 3LX4A 3EO9L 5LQNA 4D94A 3BKJL 4PJIB 4TTDC 1Y48E 3FWZA 2VHCA 4P3CH 2I5PO 9PCYA 4RFSA 4B7CA 1TQ8A 3MJ9H 1K4MA 1XZBA 2CKBB 3II3A 2JLPA 1X5LA 1XU9A 3PJWA 4Q8UA 1XKJA 4WY7L 3Q2KA 4BQ6A 1O96A 3DCYA 1Q7MA 4HKZA 3FRPA 2V6BA 5ABDE 1PR1A 1P4GA 1JYWA 2G9KA 4BRZA 5BMFH 4KUZL 2QPLA 3EXJA 3OY7A 1DL7H 3UGKA 3V7AG 4K6AA 4MHSA 4Z0JA 4YWSA 2GA8A 3FUHA 3NYZA 4H8QA 5KVEE 1Z5LA 2C26A 2VSQA 1TM3E 1QX1A 4ZUWA 1FTYA 1GOHA 3BPOB 2RB5A 1W2GA 4MY8A 5IBLD 3DMTA 1LNUB 3SCMD 1GUDA 1J0XO 3K92A 3MQFA 1S2GA 5CZKA 3VC3A 1Q6GA 4GO6B 2GJLA 3S5UA 4F4DA 1KIRA 4C6JA 1QB8A 3LN3A 5KOIA 3HLTA 4U05A 4FXJA 3N0RA 4M9CA 3EPJA 1ZG3A 4JNCA 4QRPD 1DLJA 5JAHA 4WGHA 3F3HA 4EHBA 1HDOA 4D3CH 1CF8L 4F7MA 1H8HA 3EIXA 2Y5QA 4M00A 3BMNB 2AEEA 3SX0A 1DVYA 4S1VA 4BZ2L 4QQFA 2YGYA 2JJ2D 3SF0A 1KYYA 1WS6A 3UAZA 4HAVA 2F5AH 5BNWA 1FXUA 4C6TB 4D0CA 3SCVA 1T5IA 3W1UA 3UJTL 2ILVA 2ZE5A 2LT9A 2MWCA 5T8KC 2VMJA 3WF2A 4YGXB 4QE1A 1JPNA 4R5MA 2VP3A 4V03A 3O3RA 1R33A 1Z9NA 5I71C 5A2GA 2M8XA 3SCMB 1KRBC 2BWQA 4BEJA 1CDJA 5BORA 1FVEA 1QQDA 3OLWA 3WQCA 2PUFA 4Z7VE 1ZLVK 1MEWA 3AR5A 5EO1B 1V6AA 1M3UA 3GI9H 3UOWA 4Q9JA 4M6NL 2HVJA 1B30A 4F40A 3HKCB 3KYMA 4EFMA 5B6IA 1VE9A 1U1UA 1KYUA 3IMVA 2YQZA 2IH4A 3NGJA 3ITTA 1KV7A 2DKUA 3JVGC 1RZ7H 3BGIA 4YUXA 3VGEA 1T26A 1JV5A 1SEQL 2IPKB 4IRJC 4F0RA 3IPYA 4QUKA 2OKGA 4YMGA 1PDKA 5L2KA 1KRXA 2X0KA 2I99A 4FQ5A 4CKWB 1JNLL 4A21A 1CLUA 1E4LA 3W05A 1WTLA 5B37A 3MD0A 4JPWH 1X7XA 4IIJA 3T1TA 5F2FA 4KE6A 5A2BA 1LEGA 4EI2A 3T3DA 1NW3A 4IMLB 4GX1A 4Z1MA 4MJ2A 4ZUVA 2DICA 4KERA 2QAIA 4ZFFA 2NDGA 3UBPC 5FUMA 4BB5A 1O6SB 2E3JA 3F5SA 4KAAA 4JK0D 4WGGA 3IIVA 3IRUA 1GZPB 2WXJA 4F7TB 4UE3S 3VE0A 3L4ZA 3FSTA 2WSMA 3AMKA 3ALGA 1XSOA 1J8SA 1ADYA 3FDZA 5CLHA 3RIAF 3NEAA 2ZRJA 5EKTA 1YBHA 2A9DA 2DLIA 2VKXA 1LFDB 4E3ZA 3GFBA 2Q5IA 2XUPA 2XQGA 1WPQA 2WJEA 1M1XB 1F2QA 4YDKL 3FHCB 5LP1A 3U2IA 1ZLYA 3U3ZA 5CVDA 4RFNC 1JDBB 2R48A 2LP4Y 4G72B 3KZKA 1WBJA 4KQNA 4MDIB 1TA0A 5M03A 5JPMC 1FP7A 2PGJA 1JUEA 1K9DA 1SGWA 3KYDA 4B1FA 5C81A 3DE6X 4PTVA 1LQUA 1LWNA 1XCMA 4NRZA 3S7ZA 4X1OA 1OI3A 1RZJL 5EUKB 4U63A 2JFWA 3CEAA 3CS2A 3ZCVA 2ZWZA 4DEFA 1ULBA 2F18A 3F6YA 3CUJA 1AI1H 5IRPA 1EQPA 4XNMA 3LK7A 3BWUF 5TMEA 5BRNA 3VXQA 2H32B 5ENWB 5AXCA 5U4QA 3U56A 3W7RA 3P9CA 4A7UA 3D3VA 2H63A 1O0BA 2XGIA 4W9NC 2IBGA 2AK4A 1XLVA 5BVPH 3RSGA 3I2HA 3ZWXA 1QWHA 3HPAA 1NGYA 4NQEA 1MIEH 3R79A 3IESA 5HJ2A 5DVNA 4MKFA 2CMKA 1L7RA 4F9PC 1FVXA 4CC1A 1HT0A 1VTKA 2BFVH 2H2SD 1AC6A 1ANKA 3ZDYB 2PFHA 3LRPA 4KVCL 1OU0A 5AHXA 3GEMA 1PK8A 4RD6A 1FH5L 3WRXA 3CBJB 2AKRA 2QU7A 4R7NB 4JKLA 1ZA6A 5D5MB 4G1NA 3NZ1A 1WGOA 5AHRA 1KI7A 2B8WA 1VRSA 2COEA 4OEHA 1M6UA 4OV9A 2YD7A 4XNXL 3VHXA 3AICA 2B9EA 2KS0A 3IA7A 5I48A 1ESWA 4N4QA 3DVFA 2IWFA 1DFHA 1NTRA 3OFSA 1FS4A 4ZE4A 2B34A 1AQKH 4JOSA 5F3FA 3TN0A 5JD6A 4DJFA 4L07A 4W5TA 1OH5A 3AR9A 3HJHA 1MFMA 4EBFA 2VELA 4E9WA 1TC1A 1VE1A 4MGYR 4DG8A 4TSBH 3PWUA 3W39B 3CLMA 5I0VA 2NQTA 3ETCA 4TUJB 3SD5A 4O1FA 1GVEA 3JZAA 1BOOA 4F1WA 3W73A 1Y37A 2QUKA 4ZMAT 3NL2A 5D6CA 4TQHA 1GTEA 3Q6IA 2PPCA 3QNXA 3MLYH 2IP2A 4IJ3B 3P94A 1CWVA 2IP1A 4UBKA 4BBZA 2WK2A 3A13A 3BFQG 1DJYA 1BXBA 2CNNA 3K2BA 2GUYA 5AQEA 1IBSA 4C7OB 5BV8A 3MNDA 2OWCA 4AIXA 2VK4A 3VZZA 2C7FA 2WSLA 2HQRA 5AKKA 1D1PA 3ELBA 2JKLA 2I33A 2D4DA 4N2DA 4HNCA 4ASUD 2XETA 1C81A 4LY6A 2G88A 2P53A 1WMBA 4G5OA 2CZDA 5IM4A 3E3QC 3FETA 4RZHA 1RP9A 1K3IA 5C0JB 3I5YA 2HR1A 2ZXBA 2AI3A 1C8VB 3INGA 2VTEA 1UPXA 3N05A 2WZ5A 5FKPB 2ZIVB 5FF7A 2X41A 5BZDA 1L7BA 3ZDFA 4N9DA 4I9FA 3ZE7A 1SLWA 4EVNB 1CY0A 2FN7A 2Z92B 1B93A 3DVQX 4EJFA 2XWQA 4RU1A 3UTDA 5EOQL 1DKUA 4MHHG 3L4UA 5E7BA 4FN5A 5JH2A 1A6WL 5K2MA 3ARGC 1TT5B 1OTSD 3W0KA 5T5NG 1QASA 1KOFA 2YNMD 3RGVC 4YS1A 5F3BA 4ZFOA 4LC1A 2HADA 2DMCA 1MIMH 2A0LC 4G25A 3IBCA 1YC8A 3Q40A 4J7CA 3NCYP 3ND8A 2JFXA 1QBBA 1VH7A 3MCOA 1V77A 4PUJA 1G69A 1AGYA 2G9VA 1AURA 4W9JC 4WTZA 3CXDL 1ISJA 4RRPG 4W8BA 1WEKA 4OHFA 4PI0A 3FDFA 4DM4A 3KXFA 4NZ4A 3TEMA 1ODFA 4I5RA 1KT2B 4MLIA 3ASWA 2WIIA 1MHCB 3NKVA 3F90A 5SZKB 4JR1A 4F8OA 1QO3B 4FFWC 5AYUL 3O9WA 4IGMA 2HJFA 2A73A 3FTVA 1C0EA 2H0AA 1CFZA 4LDEB 2X8BA 5KU1A 1FOBA 4JBWA 1RI4A 5FHBL 3I8SA 3W11C 3T8XA 1IAIM 2QLNA 5D30A 3UG5A 3N39C 3D46A 3R3YA 2XJ7A 3Q0EA 4Q9KA 4WO4D 1LD3A 3HIJA 1LBTA 2XG4B 3L0ZA 2E5DA 2FSHA 4XZIA 3FO2A 1E9CA 3DE3X 4Y98A 1T40A 2CGRL 1VIVA 5CKGA 5KZCD 2QD1A 4I3RH 4G0PA 3Q7EA 4O10A 3T4UA 5U9CA 1R6TA 5IT2L 3O8AA 2V2XB 1RHKA 2CLRB 2HKAA 3UJFA 1J7KA 3SR3A 4B7XA 2P7IA 2C0PA 1XEFA 4AE0A 2UZ9A 5SZHB 3NPSC 3KE8A 4HZ6A 3K31A 3VMPA 2JHPA 3NHBA 1WC7A 5EXXA 2BHSA 1VI2A 1FH8A 1OXTA 1M54A 1R12A 2RJ3A 1GD1O 5JNLA 2OK0L 1GOKA 2GHTA 3KG5A 2Y1YA 3TPZA 4L75A 4L8CA 1U3VA 1RZMA 8TIMA 1OY1A 2CVPA 3I6BA 3WXMA 2YC1A 1K6AA 2QSZA 1KJMB 4E14A 2FH6A 4F58L 1TJ0A 3LMKA 1VJ5A 5ALCH 1CMOA 3HLKA 4HWEH 5J3JA 3ENNA 4P82A 1FSSA 1DJGA 4NERA 4LWOA 4LUTB 3TLEA 4GOXA 5HHOA 1P4LA 1A4AA 4K3JL 5KNBD 4FGMA 3JQ8B 3IM1A 2AS5M 1FZJA 2P28B 3S46A 5I6NA 2A5DA 3G5UA 4UQ3A 4PM4A 2G60L 4IKJA 3ULVC 3JWPA 4Z4QA 3H2PA 2I2BA 1G20E 1L4KA 1O5RA 1WDWA 5H5JA 2RIRA 4A36A 1S3RA 3L8ZA 2OX5B 1T2QL 4KKXB 4H7HA 1LP9F 1C7QA 2L3BA 4UMBA 3WSVA 5D4JA 4ESOA 1O0VA 3U2EA 3KUXA 3CZ5A 4M1DL 3GRAA 4B74A 3FNGA 1K8YA 2R25B 2G5RA 4KFRA 3PP8A 2XBMA 3MSPA 2MSKA 3ILXA 1M73E 2D03H 2PP8A 2NQ3A 3SPVB 4DCPA 2PKYX 3W82A 2CBJA 3TEVA 3NSMA 5DRYA 4WZAE 2PTWA 3DIPA 1IHXA 3FF4A 1F8MA 4F11A 1IEQA 4A2DA 2XT9A 1PYWA 1XCQA 5TGDA 2OL3B 4UUJB 2ZRLA 4DF2A 5EEYA 2R1ZA 1I9JL 3LKRB 1YXDA 3KJZA 2ZTJA 1C0PA 3BP4A 2QXTA 2G82A 5JXQA 3WDKA 4GW1A 2WG1A 1PYDA 1QFWM 1KY4A 4G36A 1GTZA 4F3CA 5IY5B 2EG6A 3SUTA 4EKJA 5B39B 5CH8A 3ARYA 4W7VA 3CEMA 1XH3B 4JGJA 3UBXI 1A5FL 2O0HA 4G4IA 2IDUA 4AD1A 2IXEA 1UDRA 4OD3L 2PTVA 4CNSA 2I78A 5IKEA 2X1PA 5IB2A 4FXGA 2INEA 4V11A 3KOOA 2PD5A 4XO5A 4PD4J 2SBTA 4KLRA 4DN3H 4MX7B 4BMCA 1P4BH 1AZZC 5K4ZA 5JIPA 1U6JA 5AZEL 4XODA 4QISA 3KL5A 4N1HB 1T1EA 4WOJA 1KIQB 1EWHA 4DREA 4RY0A 3OKPA 1GH7A 3U2ZA 2FPMA 2XKSA 3ZSSA 5UKDA 3BMQA 5EZYB 2C7UA 4I9UA 4RDWA 3TYUA 3RJYA 4CV3A 1W6WA 3T65A 1SM3H 1NJJA 3BIOA 1DIBA 2D2JA 3B51X 5A4JA 3EFFA 1VPYA 2PLMA 1F9EA 2OBLA 4B2IA 4TL5A 1TA3A 3BTUA 1LL6A 3O6ML 1FCVA 3IGAA 2BP8A 4WHMA 4WI4A 4ZXBA 1EBUA 2WP3O 1T20B 1UUOA 5IMLB 1GYUA 4M54A 4ZEPA 3MPCA 4L6AA 3LEPA 3PC0A 1NNLA 1QV7A 1MAJA 2I71A 3GFQA 4YHZH 4PYHA 3CV6A 4HC4A 3ET9F 2G71A 5I23A 5FYLH 3FZYA 4X45A 1GEQA 1DQMH 2C16A 3QUHA 3CO5A 4AM8A 4ZB2A 1PL7A 1X42A 3MLTA 1VG1A 5CYOA 4EIBA 1E66A 1NBMA 4QD3A 5F7EH 1GUBA 3D0LB 2CZQA 5J3HC 2DPLA 3V3KA 4WWPA 4LVHB 1OC5A 2HKHL 4KXUA 4O50A 5DEGA 2JF0A 3EYOA 3M45A 3VAEA 5C0NC 1BZDA 2ZT8A 2JKWA 3D6JA 4NNPA 2R2HB 4YJ5A 1DSFL 1NEZB 1MVNA 5DT5A 3MRQB 1JP5A 1EDOA 1UCTA 4LCEA 5DUPH 4MJ3A 4HCRH 4G8DA 1RJ9A 2BF7A 2IYRA 4KO8A 3UTZA 2R8SL 1K8ZB 4IFEA 4CMGA 4XCCH 3SPJA 2GUUA 1K75A 1ZLUH 5FK9A 2J43A 4ADSG 3HNVL 1NAMB 2DV6A 1IO4C 1J8FA 2R7MA 2OKOA 3TBSA 4TQEH 1EGMA 4N8CH 4US5A 1P60A 3WR5A 5SZIA 1RZPA 2IUFA 4WBNA 2GC4C 2F54B 3ITVA 4P2OC 4W4OC 3VGAB 2AMXA 4PL2A 1L9TA 4NPJA 3FV9A 4FILA 4GMDA 3FULA 1CVSC 2R44A 3GFFA 3HI1A 5GS2H 1GU1A 4P5DA 1OAOC 4HUUA 1OLOA 5IUNC 4GSLA 3OZ7A 3R2JA 4MO9A 2VLLA 3E7PA 3SKMB 2AQKA 2FZEA 3L4KA 4QRSA 4AVOA 1X6UA 3GYGA 1N3LA 2TRSB 1SELA 1QDUA 3OEHA 3MBXH 4BH7A 4A7SA 2RDTA 1AAJA 1JFLA 3SYRA 5SX5K 1EUDA 4DW2H 2MPAL 3EFOA 1R3WA 2PETA 1WL8A 2XA8H 4NRYA 1IKOP 3WICA 5ALJA 2ZANA 4HIHB 4NC9A 3W1XA 3U1TA 1H66A 4B3KA 4GG1A 1CWUA 4DR6B 3OUZA 1R3IL 3OT5A 3WBWA 2J3MA 2AFHA 3SSJA 2VTFA 4HJ1A 5IXEA 2GK0B 1P0PA 1E50A 4TWIA 4X80H 2XB6A 3VV2A 4POYA 2RBEA 4K0KB 4PHCA 3PC6A 2XZPA 3UROR 1VI5A 2CEKA 5CEYB 4PTDA 4U0KA 3L4JA 4HXYA 3U30C 2WLTA 4MS3A 5B8CB 3EWBX 2JVKA 2CIIB 3IDNA 4WKNA 2VYVA 5AM4A 4ZNCD 16PKA 4MB6A 5E6RB 3NBXX 4DN1A 3I12A 1WMAA 1ZTMA 1ZCAA 4CMJA 1VBUA 4NDNE 3RNLA 1M6EX 3GJ3A 4R9OA 4JFQA 1U8AA 5CLIA 3Q4GA 4A3HA 3MS4A 1XK7A 5HZGA 2YCEA 3GG9A 5F1KA 3R8FA 3RDTB 1TTIA 4TLUA 2I7CA 1OAZL 4FQLH 4AY1A 4H2AA 4JZNA 4DZZA 2CHZA 4EQ6A 3LO8A 1VESA 5C7IO 3BO8B 2WPDA 1TZ9A 1N9GA 4EN3A 1ZU4A 1GHTA 2WZDA 1VFOA 4UT7L 3D7LA 3W79A 4NL4H 4LRTA 2A5FA 1SA0A 2CGEA 3TOXA 3TEZA 1I9GA 3F7TA 4KSYA 1FCBA 3QGAC 4Q21A 2D7CA 1R27A 1XGYH 3PABA 1N57A 2FPPA 5KQPA 5IKOA 2J4FA 1JA1A 2LE0A 4FZEL 4YNYB 3M1ZA 5HPYB 3WMPA 2Q2WA 4FB7A 4IKLA 1Q65A 4Z7JA 2PQ6A 4J4KA 1FX1A 2PCPB 1GVFA 5EIEA 1C30A 3TZFA 3CXHJ 1U6IA 1Q94A 2DWTA 4Y1AA 1CNMA 1Y1UA 1BAFL 1YDNA 3N3TA 5AHNA 3QV1A 1NN5A 5BOJA 2FH8A 5EEVA 4MVJD 1TVEA 1GZGA 2CO7B 4NEQA 4QO8A 4C5CA 2O56A 1NUNB 3LYEA 4Y2VA 5F2NA 4YTRA 4QYXA 3CKYA 3JWNC 4XBPB 2VC9A 3PC8C 3IVTA 1RZRD 4KRGA 1HG3A 3PJUA 2WMJA 5CT8A 3TLGB 3E4DA 1E5AA 3U9PH 1HX0A 5TNXA 4L3CA 2E9LA 3UB2A 4BNFA 1RKXA 3H23A 5B21A 1D9KD 2P42B 1QZTA 3JATB 5DD1L 2W94A 3D6FA 2G36A 4R4JA 2YIMA 2HQAA 4O1HA 4QECA 1PRYA 4LSVH 3PYCA 2VDKB 2DFDA 4KLAA 2ZXUA 5IBXA 3SCNA 2YY6A 3WG9A 4RTLA 1AXTH 2MANA 2CUMA 5EZLA 4MVAA 4MDJB 4E09A 1OYWA 3WDLA 5JANA 1UCBL 4YTQA 5DTFA 3EWNA 4O00A 4XVRA 2GJZB 2GAIA 4EA8A 1S3TC 3O2QB 4U00A 2WSSA 4E3WA 1ONWA 2XZQL 2GK1B 1C9EA 2Y88A 3GNTA 1Y8QA 2OMBA 3LRKA 3UJPA 3JRKA 1ETZB 2ZQ0A 1FA9A 2VZ1A 4KI5E 4Z0XB 4FCAA 5CPFA 3S5LA 3TTWA 1IKFL 1XEDA 3CFYA 4JEIA 3H7LA 1D9KB 3PP3K 4OFPA 3G5TA 3HZMB 1WP9A 3MWJA 1F6WA 4CC4C 3QOXA 1GSMA 5H4YA 3TRHA 3DA8A 4JQAA 3GH3A 3DGGA 1K77A 5BW6B 1UP3A 2BOCA 1NPJA 3PWVA 1HXYB 3MRDB 1S7QB 2EZ4A 3DWGA 4U39A 5CM9C 1L9WA 1ENOA