4UOQA

Nucleophile mutant (e324a) of beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
689
structure length
683
Chain Sequence
HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMAQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
molecule tags Hydrolase
molecule keywords BETA-GALACTOSIDASE
total genus 241
structure length 683
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uoqA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uoqA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uoqA02
2GJXA 4X9YA 4BS0A 1PIFA 1UQYA 4CD7A 1J0KA 4AMWA 3WF0A 1TFVA 3DDFA 4EE9A 1KEEB 2O9RA 1CGUA 3SCQA 4L8WB 3RIKA 3EMZA 1V0MA 1PDVA 2CHOA 4WSKA 3T2QA 3QHOA 1BG9A 4TVCA 1XGZA 3WNKA 3GZAA 5ABFA 3RJXA 1ZJBA 1BYAA 4AZHA 1IZYA 2QMJA 1HJWA 4PYSA 2WBGA 3MSGA 5SY6A 5SY9A 1UA7A 3ARXA 1KCLA 3CY6A 2H2WA 3BLKA 4XLLA 1DWAM 2VCAA 4BQ2A 2W62A 1GG9A 4M1RA 3CGTA 4IPLA 5M5DA 1EA9C 4J3TA 1UZ4A 2V4UA 3ZR6A 1HNYA 4ENSA 4J3XA 2WPGA 3GXDA 3BUDA 1TE1A 3WEMA 2X0HA 1TQSA 3ZO9A 2VDJA 1V6XA 2ALWA 3TTQA 1KR0A 1C3FA 2XFFA 3UEQA 4HZ8A 4UFJA 1K9FA 4BCEA 5KZ6A 4GXPA 4XX6A 3QR3A 2IGTA 3CLWA 2VCCA 2ZICA 3VU2A 1BFNA 2EABA 2VX7A 3ZJ5A 5ABGA 2GSJA 2X2YA 3PZQA 1OX4A 4PSPA 2W66A 3EDDA 5FD0A 3RO8A 1J42A 4AD2A 1GPWB 2YIHA 2YA0A 1OD8A 1CTNA 3SCUA 3VIMA 4PTXA 4Y7EA 1WDPA 2D3NA 1S1MA 1E0VA 2WXDM 4W7UA 1V3KA 1NARA 2NV2B 4J3SA 4MJ4A 5AY7A 4UOZA 1ZBWA 1KXVA 4P7QA 5A6KA 3H53A 2F1BA 1RH9A 2CCRA 4XZBA 4IISA 1OIFA 4J3UA 2VTFA 1B31A 4DUWA 4P34A 4P7LA 1B3ZA 5M03A 1UG6A 1TR1A 1JDDA 4FK9A 2E8ZA 1W1VA 3AHTA 1XD0A 5D8ZA 1E0WA 4KH2A 2BNJA 1J0YA 4K2HA 3OLGA 3EJ6A 4ENVA 1UKSA 1BGGA 3PQ2A 1Q6FA 4AULA 2DSKA 2PWGA 2XJ7A 4MB1A 1BAGA 1I1QB 4UQBA 3BVVA 4GO9A 1OD0A 4U5KA 1G2IA 2BY3A 1JZ7A 2X0YA 3U5YA 1PAMA 3GRAA 4DO6A 4WKFA 6TAAA 1EO7A 1JYNA 3P9SA 4DWSA 1SR0A 1QW8A 3IGUA 4AEEA 1JDAA 3SUUA 2VVNA 5LA0A 1R87A 1VF8A 1HVXA 5BYWA 3BUQA 3CUIA 1JNEA 3W26A 1UWUA 4FLQA 1V02A 1GUVA 1J0JA 3W6MA 4MTCA 1NOWA 4F79A 1C8YA 5A94A 3R74A 2VZUA 1QWSA 3THCA 1QHOA 2WCGA 2XF2A 4A3YA 1X6LA 4CVWA 4URIA 3QOMA 4IM4A 4FNRA 3PZ9A 4ATWA 4XZWA 4AZ6A 3PN8A 2WVTA 2XHYA 4PMXA 3U57A 1JDBC 2R1VB 1PX4A 3WY2A 3TV8A 2JIEA 1V3MA 4PMUA 5IXEA 2VQTA 3NORA 2CITA 1WZAA 3VX1A 1V3IA 1QI4A 2ZXBA 1Q2UA 4FMVA 1MXGA 2PBGA 3BSHA 5HPOA 1XH1A 1JZ4A 1JAEA 2G3IA 1C8XA 3M6DA 1QHPA 3IJ9A 4EANA 1LL4A 2NW0A 4P35A 1G01A 4JHOA 4NI3A 2YDRA 3VDCA 4AISA 4RE4A 3N7TA 1FH7A 5CPSA 5A2AA 2VKTA 5IFPA 1PS3A 5CXPA 3D3AA 1KWKA 3BCDA 2YL8A 5BV2P 6CGTA 1UR4A 1E1FA 4LX4A 2J7DA 3DX4A 2QV4A 4LPCA 1WP6A 3EN0A 4EAMA 2GK1B 4OOUA 2F7OA 1RD6A 1CWYA 4Z2JA 1V08A 2JIWA 5FL1A 3UK7A 3SCPA 3PZMA 1QDLB 2A9VA 2V3GA 3RM4A 2X1IA 1EDTA 3AMGA 1OX4B 5A3HA 4ADSG 1US3A 1BYBA 2G4FA 2CPUA 1Q7RA 1TQUA 1CEOA 1Q6GA 3NDYA 2XYLA 1K9VF 1TVNA 1TQVA 2CESA 4B3LA 2OWWA 1C7TA 1C8QA 2VX5A 1VFOA 8A3HA 3CTTA 3UESA 2X8RA 3VIGA 3L7NA 4OFWA 3FN9A 4JL2A 1B3YA 1LWHA 1HP4A 1V6WA 1DWJM 4PTWA 3VD9A 2FHFA 5A8PA 1VJSA 2VC9A 1GQIA 2JE8A 4QFUA 3EDFA 5A6AA 3QHMA 4NF7A 1JD9A 4ZENA 1U33A 2J7HA 3NSXA 3POHA 4GI8A 1E5NA 5IHSA 3MUZ1 2DH3A 2Y4SA 4FNPA 1E72M 1W91A 1GOIA 5DFAA 4BTEA 1CGXA 2V38A 2V3DA 1FOBA 1R46A 3D51A 4PCSA 4CCEA 3W28A 1L0PA 4L7QA 1GCYA 1QX1A 3BVXA 2YFNA 4MPKA 1L9XA 3TOPA 2O9PA 2XN1A 1GQLA 1K6AA 3BVUA 5EFFA 4D71A 2VRKA 5EFDA 1G5AA 4HCJA 3CZGA 2XVNA 4S3JA 1KBKA 3CUHA 1DP0A 3TTUA 3PTKA 1JIBA 2YL9A 1CE8B 1S46A 4QAWA 1SYTA 3VIOA 2D2OA 2VMFA 5E70A 5D9MA 1OGSA 2FGLA 1SY7A 2AB0A 4PRWA 2DEPA 1HIZA 3P9RA 2RK6A 2WHMA 3WF3A 2OSXA 3VIPA 2WSPA 1B2YA 1E4NA 1P6WA 1V6UA 1UD8A 2YKKA 1W3HA 5DEZA 1GJUA 6A3HA 4R27A 3FY1A 5EBAA 1R33A 1HJUA 2DDXA 4L78A 2OSWA 2RGMA 3B38A 2IUZA 4J7RA 3MUIA 1KBBA 3DX2A 3E1F1 5K4AA 3T0BA 3VSTA 2FE0A 1QVZA 1UA3A 5A69A 3VSUA 4B2YA 1B30A 4DWSB 3SCVA 1UD6A 1VJZA 2W67A 3ZT5A 1UWQA 4UCFA 4CVUA 1EHNA 3K8KA 2X05A 1KFWA 4LXFA 3PQ3A 2OW6A 5AC4A 3HJEA 2D73A 4J3WA 4IUGA 5I2UA 4LRUA 4D6GA 4W85A 2EEXA 3ZR5A 3O6AA 2G3JA 2D22A 2GJXB 2WHLA 3FHAA 3CUGA 2YL5A 3P9PA 5LA1A 3LRMA 3SCOA 2YBUA 4AZCA 1OX5A 1M01A 3FAXA 1V6YA 1G0CA 3SURA 2W4XA 1V3LA 2GK3A 2WKGA 1NWTA 1N57A 1W9DM 4NSBA 1D7FA 2ZX6A 3MSDA 4ZE4A 1H41A 4TTGA 4XUYA 3W0KA 2XM2A 5HNNA 4AIEA 3GH4A 4MDOA 3PZOA 2WM0A 1MFUA 5D4YA 3EJRA 1TCMA 5C71A 5CLTA 3ZT6A 2OW7A 1AQ0A 4AMXA 3CZNA 1OT1A 5AYBA 3W27A 1ZB5A 1HJSA 3UG3A 4L8FA 1IT0A 2WMIB 3GNPA 2J7FA 2WK2A 3VD4A 3UOWA 2NV0A 2VXOA 1V02E 1XSKA 4P8XA 5JBFA 4JAWA 3AXHA 3L4WA 2YWCA 2Y2WA 5I6SA 2XPKA 3H55A 1DEDA 1E73M 1QBAA 4Z2HA 3CHEA 1NWUA 1DWFM 3FNDA 3A24A 3F5DA 2VZVA 2WMFA 3RHTA 4N42A 4H8VA 1GPMA 1P7ZA 4FNSA 2HISA 2VPIA 2ISSD 4J3VA 4GI6A 2QF8A 3BVTA 1OY1A 1JXJA 3D52A 4OGZA 4PMRA 4QLLA 5HBFA 2YA2A 5M17A 1EXPA 1P80A 1TQTA 1ITCA 4GKLA 1VFMA 4MADA 3KL5A 5D9NA 1FH9A 4PMZA 5AYIA 2VNCA 5SY4A 3BVWA 4MNTA 2BS9A 1OIMA 4Y1GA 2D24A 1O7AA 3MUY1 3CUFA 1WPCA 5CGMA 1JDCA 1O6IA 2XTKA 4AD1A 3O9NA 5I24A 8CGTA 1PE0A 2FYVA 2PB1A 3WNPA 5HPCA 5JIWA 2ZUWA 1NWSA 2UY4A 1ISZA 1HJXA 5E6ZA 1PZ3A 3ARVA 1RP8A 2VJXA 4DWSC 3ZJ4A 1D3CA 2E8YA 4CKQA 4HZ6A 1O1YA 3WL1A 2YJQA 1L8NA 3M7SA 1LQ0A 4AZCB 1JD7A 2V3EA 2BY2A 4UFLA 4R5EA 2R1VA 4PMQA 2F7RA 3NVAA 4LYPA 3SCRA 1BSIA 4ATLA 3GXFA 2CBJA 2TAAA 1B1YA 4DWSD 1E5JA 4Y1FA 2PWDA 5JZMA 1YHTA 4Z2IA 4ACZB 2J8FA 7TAAA 4MNMA 4OJYA 4YHEA 4PTVA 4CCDA 2VR4A 1EGZA 3WMBA 4QCEA 4H41A 4ACZA 2WHKA 5I78A 1XV8A 3LPOA 1EOMA 2DT1A 3GNOA 4RKWA 4ZEPA 1YQ2A 3CYFA 2A3BA 3VGHA 1CLVA 2BXYA 2ZOXA 3AS3A 1B0IA 4P5PA 3NOQA 1OGBA 2R1TA 1ISWA 4L4OA 3VTRA 3WDQA 4H2CA 3VNZA 3VGDA 4HOZA 1HWWA 4GUDA 3N11A 1LWJA 4NXSA 4HU8A 5ABHA 1R34A 2ZE0A 3DX3A 3WQ6A 4S0ZA 4KRTA 1VCNA 2A3EA 3VD5A 3WH5A 1CXLA 2J7EA 3F5KA 1H49A 4HTYA 3ZJ8A 1DWHM 4WF7A 2XIIA 4QCFA 4ENRA 3ZQ9A 4FLSA 2ZXQA 1GOMA 4CU8A 1T0BA 4GQQA 1LL6A 2O92A 2VQUA 1J12A 3MMDA 4MB3A 3IK2A 1KQZA 1V03A 2IUFA 3W4RA 2PC8A 1WKYA 3VO0A 3NSMA 3DYPA 3VINA 3TA9A 1EO5A 3OT1A 4CD8A 4ZDJA 4J28A 2YWBA 4QYXA 3OT1B 3VGGA 1IZJA 1BG4A 3AZSA 3BAXA 4D1JA 3LPGA 1W32A 5E0FA 3ALFA 5LA2A 1WO2A 2BVDA 1PJ9A 1AMYA 1ZU8A 4A4AA 4Y0NA 2PWHA 2GFTA 2A3HA 3HN3A 4NRRA 1E6RA 3K8LA 1Q4NX 2XG9A 2BHUA 4CCCA 1G1YA 3OZOA 1KXTA 1P81A 4E08A 3AS2A 2C7FA 2YLLA 4PSRA 3WN6A 2YL6A 1GONA 1QW9A 1M6VB 4HZ7A 2FH6A 5KEZA 3B3AA 4BQ4A 5ABFB 1ONSA 3HG5A 3EDEA 4JZ5A 3I3EA 3WD4A 3BSGA 3VNYA 5A95A 4MNKA 1M53A 3MUAA 1GPFA 4TTUA 3WUEA 3W24A 1JVNA 1N82A 4HU0A 4AZIA 2ZUNA 3WUBA 3WL0A 4L4PA 1WDQA 2EQDA 2F18A 1E4LA 4HMDA 1I1WA 4LYQA 1A3HA 1GOKA 1E15A 1WL8A 1QI5A 1WZMA 3IJ7A 3N13A 3EBVA 2GK1A 3VKKA 3EDKA 5I5RA 3F5LA 4OKDA 3BWEA 1F4HA 3VM5A 4UQCA 3N12A 4BZYA 4QP0A 1AQMA 4AIOA 4FF5A 2D3LA 3VD3A 4JIEA 4RE3A 4GINA 4LYRA 1HKIA 3SUWA 1BVNP 1B3VA 3K46A 2ZUSA 5BWFA 2XWDA 1DTUA 3TTOA 1QNRA 1JZ3A 2WYSA 4N0RA 4ZFMA 3ZT7A 1TMQA 1XCXA 4J27A 3WF2A 4JHZA 2WB5A 1GZJA 1CXHA 2VT0A 1KB3A 4OQ4A 1MVYA 3WMSA 1NOFA 2CNCA 1PV2A 2FHCA 3WENA 5DT7A 4DM1A 1KGWA 4ENTA 2J7GA 4FLRA 3WDHA 2F2HA 1TG7A 4MAVA 1LLOA 3DECA 2E9BA 3WH8A 4UZUA 4M24A 5A8NA 5LIRA 1W3KA 2IXUA 5BXTA 1J11A 1UCFA 2E40A 4AUMA 4D72A 5CSUA 5IFTA 4NZJA 2Y8VA 2E4TA 1GVIA 5CSYA 3K8MA 3CHDA 3D4ZA 1MQPA 1W2PA 1PIGA 2D20A 5JIPA 3S5ZA 1UH3A 3CBWA 3WD0A 3EDJA 5JBDA 4JCMA 3UG5A 4ZDIA 5C70A 3WBEA 1ISYA 3WQVA 1BXRB 4W5UA 4U2YA 1Q6EA 4WXYB 1OBAA 1NP2A 1K9DA 1TZ7A 5JUVA 5CPQA 1FP9A 1TUXA 4L8YA 3BXWA 4GZIA 1E43A 1E71M 2RK3A 4PEEA 2CXGA 3VGBA 2ZX8A 1GVYA 4UQDA 1OX6A 3WKZA 3AIWA 4OOZA 2G3MA 3FHQA 5E6YA 4EK7A 3BGAA 1HL9A 2GDUA 2W5FA 1C7SA 1JFXA 3L4TA 1RP9A 2VX4A 1CXEA 4BQ5A 2XFYA 2XSAA 2WMIA 1R47A 1WAWA 5JBEA 1HKJA 1VFFA 4AIUA 5E09A 3AYSA 4B7AA 4KRUA 5FIPA 4AZBA 1CGTA 1R85A 2BY1A 4P7RA 1OI4A 4M80A 2XVLA 4P36A 1HX0A 3LX9A 4E8DA 1GQJA 5CLWA 4Q7NA 4U2ZA 2EBNA 3IANA 1C92A 3VIIA 1H09A 3GXMA 3CIVA 3MKKA 2EPMX 1SFSA 3WELA 2FDMA 3TTYA 1LG1A 1E70M 1XYZA 4TVUA 4B9ZA 3AMCA 2VCBA 3LPFA 3R75A 2ZWZA 3OGSA 3LRKA 5A6BA 4DUXA 2ZUMA 1PZ2A 4D6HA 1GW1A 3MO4A 1E6XM 2X2IA 3OLEA 2YDSA 3L4UA 4JKKA 4W89A 3CPUA 4ENPA 3WF1A 1E40A 4IPNB 2FHBA 1CLXA 4MDPA 1EDGA 4AC1X 3UGJA 1WDRA 4DUVA 3FXYA 1UKTA 1XSJA 4AUNA 3SUVA 3GYCA 4X0VA 1T3TA 1OM0A 3ARYA 5CQ1A 1E6NA 2Y8KA 1JI1A 3B8SA 3SCNA 3OIHA 3NOOA 1OB0A 5CPTA 4I46A 2J7CA 4W7WA 3GH5A 2J4GA 4H8HA 1ZBCA 4U33A 3SCSA 3ARSA 1J18A 1ZBVA 2V5DA 3PZTA 1ESWA 1XSIA 2BXZA 3DX1A 4GQRA 1VRXA 1UD5A 1E56A 2C8NA 4E4PA 4GIAA 1R75A 1P5FA 2ZXDA 3T0DA 3A23A 1H2JA 3I3BA 2UY2A 3L4ZA 1I75A 2JALA 3MV11 4AD0A 3WY3A 4WIWA 2ZX5A 3ECQA 1HF6A 3BLBA 4FNUA 4KGLA 1CECA 1TA3B 1G9HA 1W9XA 3AIQA 3EWNA 3TQIA 4GZJA 2D0FA 2XFRA 2QLYA 2X09A 3ALGA 2WVSA 2WWCA 2CBVA 4WINA 2GJRA 1W9UA 1CGVA 3ZOAA 4HPHA 3KKLA 1B3WA 2DSWA 3LXBA 3LXAA 2BHZA 2EPKX 3U7BA 2WC3A 2J78A 5DMYA 1FP8A 5ABEA 3FAWA 3WQ5A 3CZEA 4GO8A 1SZNA 3FSEA 3HG4A 4RKYA 2UY5A 1VEOA 2XN2A 4UTFA 1HL8A 1QOXA 3AS1A 4P8WA 1E4MM 3MS8A 3W81A 1WCGA 2BVYA 4AD4A 2YBTA 3AI0A 1JFHA 4Y1RA 3TTTA 1VHQA 2OYMA 5LYRA 3VOCA 4WKAA 1C30B 2V5CA 3JUGA 3CH9A 3KL0A 1UASA 3L4YA 4UFIA 2W63A 3PZGA 3ZSTA 3BUBA 3VD7A 3CUJA 4E8CA 1OWQA 4PN2A 3ARZA 2ZX9A 4HP5A 3N1AA 1UD3A 5GNXA 1VCOA 3VGFA 2YLAA 5A6SA 2VL4A 2J25A 1UD4A 4TOQA 4F66A 5M3WA 1CXFA 2ESCA 3AFBA 1BLIA 1MW2A 2WW5A 1BVZA 1ODUA 2CEQA 2WCSA 4U31A 1VFUA 4PUEA 2J7BA 1XRVA 1I7QB 1QF7A 2VRNA 1V6VA 4WSJA 1E3XA 4UNIA 4AD5A 2OR3A 1JL8A 2ZXAA 2CERA 3THDA 1QI3A 1PX3A 4N12A 1VB9A 2VO5A 2CKSA 1C3OB 4W8LA 3L2LA 1B9ZA 1OT2A 2FGZA 3F5JA 1O7DC 3LRLA 3MMWA 3WMCA 1FY2A 1BPLB 3HZ3A 1V0NA 4W8BA 2F7QA 5HDRA 2EPOA 3VGEA 3WUFA 3WD3A 3TTXA 1H0GA 1GHRA 1GNXA 5I77A 2JF7A 3AIEA 1UR2A 1V0LA 3KZSA 3PHAA 4F8XA 2G41A 5D9OA 4BIMA 3OGRA 4HA3A 4ENWA 3WSUA 3SF8B 2W7TA 4OBRA 2J77A 4ZXOA 3VIFA 3ZIZA 3BUPA 3RILA 4AYGA 2CKRA 5FL0A 4TVDA 3J7HA 1X6NA 2VUYA 4KMQA 1R9GA 2WLYA 1KXJA 1CGWA 1UD2A 3PZVA 3AOFA 4W86A 3W6LA 3MIIA 3VILA 1R86A 5A8MA 3VMNA 3AIRA 2EAEA 3AICA 3MANA 2GDVA 2G8ZA 5BRPA 1C91A 2V3FA 3NSNA 4U3AA 1KWGA 5EB8A 5DT5A 1H4PA 1MW1A 4GPNA 3VDBA 4PMOA 1KGUA 3KLKA 1BGAA 1QVBA 1TVPA 4D6FA 2GVYA 4C7FA 2G3NA 1PPIA 3MU7A 4AUEA 2XM1A 3TTWA 1MFVA 1M7XA 2YA1A 3MGKA 1FFRA 1J01A 2AD5A 2WC7A 3A4WA 1VAHA 5A2BA 2E3ZA 1W9VA 2C0HA 3TTSA 1CYGA 3GBEA 5IP5A 2WVVA 3CZLA 3VMOA 2WMGA 1UQZA 1G94A 2VX6A 4Z2KA 3T0AA 5A1AA 3SOZA 1QBBA 3DYMA 3GDBA 3T2PA 3WH6A 4F9JA 2EO7A 1OGGA 2F1AA 3WD2A 4UZSA 4MTVA 1OSEA 3BCFA 1UKOA 2R1UA 2BY0A 1GOOA 3NIYA 3WEZA 4ZXLA 1CXIA 3K1DA 2Y24A 2FH8A 3VSVA 1WE5A 3EJUA 4AJ9A 2WANA 3N18A 1UWRA 3WDIA 3PTQA 4NRSA 5I0DA 5E9AA 3KLLA 2O9OA 2XIBA 2DQXA 4BA0A 4KGJA 2VZOA 4A3HA 3AS0A 3UR8A 4M29A 3W37A 4N0MA 2ZIDA 1I7SB 2QHAA 1H3GA 3PQ8A 1KCKA 1QWNA 1JYVA 3DDGA 1F4AA 1FFQA 3WNMA 2D7JA 4YPJA 2WVVB 4MB5A 3G6MA 3EJPA 3FIJA 4E5VA 3BUIA 4P7OA 3RJYA 3W82A 2NT0A 2HVMA 1NM9A 4P8UA 2MANA 1PDWA 3BLPX 3GM8A 3WDRA 5F7UA 1M03A 1RPKA 4W93A 4MNJA 4HOXA 4W5ZA 4W84A 1VBUA 3SF8A 1W9BM 3NONA 4UR9A 1X1NA 3ZJKA 2OYKA 5IDIA 4W88A 1W3JA 1XCWA 4AW7A 1E6QM 3ZM8A 3OLDA 3A22A 4V27A 4DM2A 1UR9A 4ENUA 4WK9A 3ZJ6A 3AZRA 1D2KA 2VI0A 4PCTA 3WD1A 3PZUA 1JZ2A 2NT1A 4PMNA 2XUCA 1H5VA 1H11A 2BV9A 2DGAA 1HKKA 2XVKA 1SMDA 3EJSA 4JL1A 1WNOA 2ZUUA 1CGYA 2DSUA 3R76A 2D1ZA 4B9YA 4B3KA 2WC4A 5GQBA 1ZBKA 4OIFA 1U30A 1HN1A 5EMYA 1K9EA 5I79A 1VENA 1MW0A 3QOKA 3HMCA 3W29A 2W92A 1IZZA 4FNQA 4AD3A 3WY4A 4W7VA 3W25A 3A6OA 2F8QA 1DWGM 1E55A 1GORA 3EJTA 2WHJA 4OZOA 3SEPA 1KQYA 3WQWA 1T36B 3IAPA 2PI6A 1H1NA 3DX0A 5I3DA 3WQ8A 4EKJA 2Q8XA 3AIUA 2OWCA 1A9XB 3EZGA 3ZR4B 1LJYA 3RDKA 4UQAA 4JFUA 3N17A 3BHNA 3MMUA 4B31A 4GZEA 1IZKA 4JCLA 1HXJA 4JFTA 1MQRA 2J74A 1UWSA 2XGBA 3ZJ7A 4AWEA 2FEXA 1QWUA 4FLOA 4MAZA 1FHLA 4BFLA 2AOSA 4D6CA 1GGKA 5HOSA 3SCTA 4GI9A 2VR5A 3GXNA 2WSKA 3WUGA 1V0KA 4MGHA 3LPPA 2OYLA 4U3CA 5ECUA 3AIBA 1V3HA 4ML4A 5AC5A 4UOJA 4PBGA 4D6DA 1A47A 3F71A 1Y7VA 1CENA 5C8BB 2BFGA 1GGEA 1H0IA 1GQKA 1HXKA 1ISVA 1ZJAA 5A6LA 2DT3A 3U5UA 1JF5A 7A3HA 1BYDA 4PUDA 1MQQA 2IXVA 4UQ9A 3CZSA 4CGTA 1KXQA 2QPUA 3HG3A 2B31A 3PZIA 3UMMA 3EFEA 1GGJA 1W2VA 1BYCA 1KA9H 2JFEX 7CGTA 2XSBA 3I3DA 3OA5A 5BXRA 1E1EA 3A4XA 4UOQA 1W1TA 1OINA 2O9TA 4F9DA 2WMHA 4BF7A 4CN1A 4P8VA 5GNYA 2VRJA 3A47A 3O2LA 3KL3A 3S5YA 4AZ5A 1AVAA 5DF0A 1U9CA 1HJVA 4D1YA 3HU7A 1XC6A 3DYOA 2OSYA 4AEFA 3VX0A 2WWDA 9CGTA 3VDHA 3AXXA 4CU7A 2XGIA 1K9TA 5IHRA 3CNEA 3EJQA 1KGXA 2DSZA 1P7YA 4NXKA 1E4IA 5GNZA 1HVQA 3VDAA 1WZLA 5A6BD 1W1YA 1EQPA 3A21A 4B5KA 4V2XA 3UJNA 4PMDA 5CG0A 1EOKA 1EH9A 2CHNA 2EJ1A 4CUCA 3PZNA 1CDGA 3D54D 1MYRA 3CC1A 2YDQA 2WZEA 4Y1RB 5DO8A 4CN4A 3K4AA 3BMWA 3IAQA 4R7GA 3APGA 3MI6A 1E6PA 3MV01 1FHDA 3GXTA 3UG4A 2X2JA 3H54A 2AMGA 3D5HA 1JXKA 4H8UA 3TTVA 1W3LA 3M07A 1QPKA 4HMCA 4WJXA 3AHVA 4P7NA 3ARRA 4RL3A 1R7OA 5BROA 1US2A 3PQ6A 4HPGA 3BC9A 3B9DA 2R1TB 2YWJA 4W87A 4JFSA 2YWDA 3EMQA 1UWTA 1Q6CA 1JZ6A 1HTYA 3WEOA 1MW3A 3WDPP 3N15A 3W53A 1E6ZA 4MJ2A 3UR7A 2BHYA 4LQ1A 1U2YA 1UR8A 3ARPA 4TX8A 1SMAA 2XVGA 4B15A 4HMEA 1QVVA 2QPSA 3D4YA 2GUYA 2YFOA 1JZ8A 1J9YA 4XV0A 3PQ5A 5A2CA 2DT2A 1ECEA 2A3AA 3GH7A 3OG2A 3CMJA 4AZ7A 3CV5A 2VVSA 3HG2A 5SYAA 4GE3A 2A3CA 2VURA 3T2OA 1J0IA 2F61A 5I23A 3A5VA 4HOWA 2DT0A 3A3HA 5BRQA 3VM7A 3A4AA 4M81A 3G6LA 1UUQA 1J10A 1E6SM 2NSXA 3AHZA 3WNOA 3SUTA 4ZGGA 3M46A 4M56A 1NOUA 1UZ1A 3L3BA 1FYEA 2J62A 5CZKA 2PBOA 3AZTA 1JZ5A 4PXYA 3ZMRA 4LGXA 1GOWA 3ER6A 2F7PA 3NOVA 2OLHA 2DSVA 1UR1A 4CD5A 1GJWA 1CNVA 2WAGA 5BXPA 4AYSA 1XD1A 3UERA 4WKHA 3DHPA 1XH0A 4S3KA 2UY3A 3WNNA 5A8QA 3OB8A 4TXEA 4BQ3A 2UWFA 3POCA 1QI0A 2D0GA 1JF6A 2WVUA 1PBGA 2EPLX 3BH4A 2EACA 1ZL1A 5JZOA 1E3ZA 2RGLA 4D6IA 5HXMA 3UETA 2W61A 2PWFA 5CJ5A 4ENQA 1GHSA 2LXNA 3T08A 3CHFA 4Q22A 4C7DA 1CF9A 3OZPA 2XVPA 3VIHA 1DWIM 4KWUA 5CGTA 5D8WA 3DC0A 3RMEA 2VZTA 4X0NA 2WNWA 1GGFA 3ARQA 3BAWA 4ACYA 2XN0A 1JYXA 2QMKA 5A6JA 1J0ZA 2EADA 2VRQA 4UQEA 4YHGA 3P9QA 1KTBA 3BAYA 4L95C 2XWEA 1FH8A 3RPMA 3AISA 1R7AA 4FNTA 1QNSA 3OBAA 3WIJA 3B9EA 2JEQA 1Q6DA 1UKQA 3KEHA 4QLJA 3AROA 1HKMA 3L18A 1QNOA 2J8GA 1VIWA 3WFZA 1BTCA 1GGHA 4DO4A 5FOOA 3AIVA 1V3JA 2Y5EA 1R8LA 5TD4A 4NX0A 3U7VA 4D1IA 1MWOA 1C93A 1AQHA 3AQUA 1ISXA 3AMLA 3RM8A 4H7VA 2JF6A 2GJPA 4OGGA 1ODZA 4NZCA 1KXHA 2Z1SA 1DHKA 4B16A 4JQSA 4B40A 4CU6A 2WMJA 2VOTA 1TA3A 3F4VA 2CYGA 1IPHA 2ZUVA 2WJZB 5E0CA 3ARWA 3PQ4A 1C90A 3GXIA 1NH6A 4D6JA 1CS0B 1ZS2A 2E9LA 2JEPA 2PF0A 2WBKA 1XH2A 4CD6A 3D50A 3VUPA 4PTMA 1EHAA 3BAJA 1E0XA 2J79A 4CD4A 4P2GA 2X2HA 4JKMA 3NDZA 4JFWA 3PBGA 1VBRA 3ARTA 4OBSA 2E0PA 1QHZA 3CZ8A 4D6EA 2VZSA 4UFKA 1QNPA 4MB4A 1EDQA 2BVTA 3EYPA 1UH2A 2OWXA 3VMPA 4ZE5A 4PMYA 1TQWA 3SUSA 2DIEA 3AYRA 1UKPA 3GXPA 3CZKA 3UCQA 4QYTA 1MXDA 4QDMA 4GE0A 3WH7A 2Z1KA 3VIJA 3ARUA 3CO4A 1JI2A 3LXCA 5BXSA 2W91A 3SCWA 1BQCA 1W9PA 4UFHA 3W38A 1UHVA 4V28A 2EXOA 1QVWA 1J0HA 1NWRA 1E9LA 4AMCA 1HP5A 2DPEA 2RK4A 2E9MA 3B36A 3II1A 4E2OA 1XYFA 5FCZA 4DO5A 3CZAA 4CN6A 2ZUTA 4H04A 4K68A 1I1XA 3L4VA 1SOAA 4YN5A 4NZFA 5D9PA 3L4XA 4Z2GA 3BMVA 1UWIA 2EPNA 3QHNA 3NUKA 3WF4A 1FA2A 4UFMA 5FKYA 2CBUA 5GPRA 1IV8A 3L4EA 4RE2A 3SIMA 4I4NA 3GNRA 3AMKA 5BCAA 3KWXA 3RCNA 4Z2LA 3NCOA 2GHRA 2D0HA 3CZJA 1KR1A 4AZGA 1JNDA 3QGVA 1LF1A 4U5IA 3CMGA 3BAKA 2ZWYA 4M82A 1EIBA 5A8OA 1T0OA 2WZHA 1BF2A 3WFLA 1CZ1A 3M3PA 2CETA 1JYWA 3L2MA 4HA4A 1EQCA 1LG2A 4TX6A 1JG9A 2PWEA 3N04A 1JGIA 4QLKA 2DIJA 1HT6A 1UYQA 1PEZA 4ATDA 3IJ8A 3TONA 1VEMA 1W1PA 1VEPA 1NP0A 4W8AA 1CPUA 3AHYA 1CIUA 3GBDA 2ZX7A 4XB3A 1CBGA 3T09A 1KTCA 3AHXA 1BHGA 3DHUA 3OGVA 3TP4A 4LGYA 4AY1A 3K4DA 3VPLA 2J75A 1QNQA 1LL7A 4C7GA 3WQ4A 4OGFA 3VIKA 3GTNA 1M04A 2CBIA 3N9KA 4HA1A 4OUEA 1VCMA 3NJ3A 4Y1EA 2WMKA 4TUFA 1UR0A 3PTMA 3BAIA 3WBAA 1JAKA 1WDSA 1HJQA 3OLIA 1PX8A 3CHCA 3RM9A 4JKLA 3AXIA 2WZIA 4ZDKA 1NQ6A 1UOKA 2D23A 3S2CA 1B3XA 3B9AA 1B90A 1XHGA 4WLCA 3CZ9A 2WCAA 3VU3A 3S6TA 2WLZA 5E1QA 1CXKA 1GOQA 3PQ7A 1UH4A 3LMYA 2WKLA 3FW6A 1WZKA 3EMCA 3NYDA 2DH2A 3ZSSA 1Z32X 3WH9A 1ITXA 2CIPA 4I2NA 4PMVA 3AJ7A 3WDJA 3WNLA 4MNLA 3KE0A 5A6MA 4AXNA 1QI2A 3AMDA 2AAAA 2YOCA 1WB0A 3VVGA 3WY1A 2ABWA 1OCQA 2J47A 4JFVA 4M8UA
chains in the Genus database with same CATH superfamily
2PAJA 3GLKA 4BS0A 3LU1A 2IKIA 2O7RA 2B6NA 1N34B 1ST2A 1OAJA 5G02A 5GS0H 2CJYA 4I0WB 2IH8A 1YCDA 2O3TA 3HIZA 3NIDE 1YXDA 1KLFB 4KPYA 3FSAA 4UTXA 2ZT9C 4LE1A 1M5WA 3QW3A 1G1OA 3RSLA 1ZJBA 3TIEB 1N2RB 4OF7A 5FUYA 1QLFA 5LG6A 3UBTA 1XGEA 2YXPX 3AXTA 4DEVA 2R4RL 3MSGA 4QG8A 1Q7CA 5SY6A 2QPLA 2VZLA 3BDAA 3RS4A 3MWAA 2J6CA 1WBYA 2X6TA 3FWNA 2XB4A 2AJZB 3H6JA 4XGZA 2E6JA 2W79A 3UBFA 4ENSA 5DTFB 1TJRA 3M0HA 4D44A 4IGBC 2O1XA 4NE9A 3WG7B 3O9VA 2VDJA 3RARA 2C2MA 3TTQA 4HFJA 3VA8A 5DLCA 2PUTA 5DK0A 4F45A 2PZGA 5AJWA 3GYGA 3NXLA 4UCXA 5JCPA 3CLWA 1HILA 3VU2A 1BFNA 1XZKA 2O07A 2GSJA 4WEOA 1ORWA 2I29A 3EH1A 3B9RA 3ZE6A 1IEWA 1GPWB 4Y88A 4GYFA 4M4RB 4XIGS 3WGYA 3IFOA 2VHWA 2N59A 3L3DA 2QAJA 3CVBA 4AY2A 4MJ4A 4C6RA 1YMHB 3BICA 3U19A 5AY7A 1ZJ4A 2GX6A 1Z9SB 1H0SA 4DW8A 2NUPB 2PLAA 3AM5A 4KPUB 3JS5A 1E6UA 1P60A 2FWNA 1CI3M 1TJGL 4JZOA 1OIFA 4NHCL 4KRXA 1MJJA 3QZ6A 1M2VB 1GNVA 4AF8A 2B8JA 5GGRB 4B7XA 1X4ZA 5AW4B 3S8HA 2G72A 1EFRD 3TNFA 3X1ZA 5K3EA 4L51A 4TZ0A 2QADC 4NM8H 1M2FA 1WVMA 1L7RA 2J32A 4LVUA 4QECA 2WIGA 3WDSA 3GLZA 1EDYA 3JWHA 2IIQA 1MZVA 4P46B 2R97A 2HA3A 4MB1A 2C14A 4ZPTB 4DEXA 5J6HB 1LCIA 1PG7X 1XF2A 5KUTA 3W73A 3SW6A 1C0IA 2ITCB 5LKNA 4BFXA 4M55A 4K03A 5SV2A 1Z75A 1VIDA 5C0BD 3S2FA 3G2QA 2WM3A 2NX5D 3WE7A 3W3OA 3RGVB 4J94A 2HKFH 2VDMH 1Q0XH 4FFNA 1JNEA 1E3LA 1Y1DA 4D9QE 3K20A 3ML8A 4AP6A 3FBWA 4XBGB 1DKNA 1NOWA 1YJAA 2VOEA 4YAWA 5MEQB 3VH3A 2VK4A 3OQPA 4JBLA 4W9FC 2O4EA 1P9MA 4MQXD 3IAS1 5HYJB 3VNJA 3VWKA 4GA8A 1Z4LA 3QSYA 2GFIA 4XZWA 3D3QA 1RJPA 1Z5ZA 3QNZB 2XWPA 3PPXA 2DQ4A 3WY2A 2WUFA 5KNCH 1UXLA 5EZJB 1LD9B 4G6FD 1JWAB 3CDYA 3ANMA 3IAM1 3SM0A 4M8SA 4AQ8A 3AM1A 4JFYA 3WGHA 2DQSA 1IGCH 3O6LH 3DL0A 5BXQC 1IC7L 1UXWA 3ZWWA 4FFBA 4DVBA 1PKEA 5BPFA 2FJGA 3BJEA 3D1VA 3SHTA 4TMCA 2PGNA 3TW4A 1OPGL 3H5LA 3IE1A 1JRCA 2Q5IA 3N7TA 4JK3A 4GXWA 4JJZA 1UM5L 1AZTA 1QYXA 3FM9A 2ONCA 1D6EB 5IJZA 1G67A 4G56A 2R6GA 4HHAA 3LV8A 2QUUA 1KWKA 1QNFA 4LZLA 3WRVA 3CXHK 3FR7A 4GVPA 1E2VA 2ZE5A 3QXJA 1EQUA 4XIFA 4CVXA 1USVA 1J8MF 4YUYA 3HPQA 2YGQA 3JUYA 2C5AA 4WNCA 4WWKC 3LNEA 2JIWA 1JRHI 2NLIA 3NA8A 1WFJA 1UC5B 2VCHA 2JTDA 3ZLHA 5EU4A 3FTPA 1JK8B 2V3GA 3K0BA 4DREA 2W6NA 1OX4B 1W8IA 4GRLC 5AYTA 3VTFA 3WK2A 1JF1A 3DVNA 3IXLA 1ABBA 1XDLA 4INAA 5GVRA 4EHFA 3RTGA 1RKBA 5G2WA 2C1OA 1VFOA 1TDJA 1FZMA 4Z3GA 4YSSA 1GYNA 4WQMA 2ARWA 1TRKA 2I07A 5DHUA 4X50A 1VG0B 4Q1AA 2VUNA 1IGYB 2XFXB 2NXZD 1I3VA 4JRYE 1K6QH 1M3SA 3SDYL 3DTVD 3GSNB 1GVSA 4HAFA 4FHAA 5B3JA 2VC9A 3QHMA 2B0SH 3RLFA 3FQ2A 4PGZA 1EC9A 3IKJA 2QQFA 1QPQA 4ECLA 3EBHA 3WFIA 4U49A 4IMLA 3VZRA 4E6EA 2UZYB 1C1EL 4X9IA 1KVSA 4GG8B 1T2VA 1NZRA 1WE2A 4R7DB 2AEQH 1N5YH 1FOBA 1QFUL 3H23A 1ZHNB 4TVPH 3DK0A 4K73A 5H94B 5IBTH 4KVZA 3Q0IA 3L40A 4MYDA 4X6FA 1GPAA 3GIZL 3SS8A 4J8RB 3QWOB 3BVXA 1AKNA 3WS3B 2Q7DA 3F4BA 1L6RA 3LBAA 3W04A 2DM7A 1VSCA 4NC2B 3ILDA 1VFHA 3NNSA 2X1WL 5EOTB 4B3VA 1EAMA 5FOSA 1HXMB 5G4HC 4YZWA 4MI3A 4D71A 2XZLA 1YKGA 4IDLA 1WPXA 4G80B 1H1TA 1IVSA 3ZL1A 5EUMA 2G3ZA 3QA3A 3V4PB 3B9BA 2PRSA 1D6EA 3IRPX 5T3XH 4M99A 4YRDA 5I7GA 3Q8EA 2DEPA 1EJUC 1I10A 3U60B 3L4SO 1VHPA 2IX3A 4GOJA 1TMHA 3FN0H 3FQUA 1RUPH 1X2BA 1F76A 4EKDA 1CU1A 1SVSA 3FF7A 3MWGA 1JNNH 2Q09A 3NPSB 5M95B 1QQTA 1JWUA 1E3IA 1GYMA 3PY9A 3IPXA 3GRRA 1CLOH 2UYHA 3R9XB 1KQFA 1XFDA 5DK2A 1S8DA 3F7PC 1DSFH 5G1NA 3HFSA 3V18A 3NH7H 1CW2A 4TO8A 1VKZA 1B30A 4PJIA 1OAOA 3N2JA 4IKJA 5D1XA 2QEQA 3DTYA 4Y2XA 1C7JA 3NFNB 3ZT5A 4ONGH 3LQYA 2I34A 1RWWA 1Q65A 3A9SA 3WL3A 4ECEA 1QZXA 3ABOB 3PQ3A 2A9CA 4JHWH 4G80A 3WLJA 5IRCD 3NPZB 4LRUA 3BK7A 1WQ5A 3BISA 1PCWA 1NMZA 3ZI0A 3A0RB 1KEVA 4INPA 3LTPA 1PYWB 2JGRA 3SBRA 2J3IA 5CW1A 3P9PA 1O9ZA 4PO9A 1K5NA 3H4VA 4PMFA 4APQB 2C9DA 4BVLA 4HIQA 5C0NC 5AUNB 4LHSA 4RZ3A 2II6A 1I31A 1NOAA 3TW7A 3BI9X 1MIHA 2PPCA 4PB0L 2GK3A 3P80A 4HEHA 2DUWA 1N57A 4JJ4A 1GGCL 5D86A 5BSMA 2Q2LA 2ZX6A 1UZHA 3TEUA 4WKOA 5D72L 4FZRA 4V0RA 3AL3A 3DAPA 5FUZH 4BLOA 1JWLA 2JKNA 5F35A 3FNGA 4YDNA 4I0PB 5F3RA 2NUBA 2WD7A 3ZT6A 3KPJA 1MRFH 3SLRA 3UCRA 4JZOB 5JCXA 3SYAA 4WVXA 1OH8A 1IT0A 2CRZA 4O3FA 3AIMA 1KJJA 5ICYB 3SGUA 2ST1A 4Z0NA 4QNWA 4UYPA 3SCMA 2JMRA 4Z7WA 2FPSA 2ZBDA 2H47C 4A66A 2NYYC 3CF0A 1BVHA 3SDDC 5GRXG 4X5QA 3L0SA 2Y68A 4N8EA 5I3IA 1NWUA 3MGOA 2F54B 5EHNA 2A99A 5FBWB 1YRLA 3OMZA 3PE3A 1GPMA 3T6WA 3B2NA 1RM3A 3KRZA 1QRTA 2ACVA 5C4IA 3K73O 3FT4A 3DX7A 2ZTJA 1VG1A 3HXOA 4NJKA 3C3UA 5LBGA 1Y6QA 1LQSR 4XI5C 4PLVA 1S7XA 1VJRA 1EZUA 1ZL0A 4KUGA 1QANA 3OJCA 4BNZA 1ITBB 1INDL 1NBCA 2O8BB 1GYLA 1CJYA 4NV3A 4B92A 5HCNA 2FWBA 2P24B 4QPCA 3PWSA 2GIXA 3GFOA 5I24A 1MQ8A 2R2GA 5JT1A 2JBMA 2PB1A 4H1LG 4NQZA 4R8MA 1TMCB 2WNSA 5JIWA 2BM8A 4FNLH 1NAKH 2W0MA 1AB6A 4QAJA 2IE8A 5K3SA 5G4MA 3ZIMA 2PCXA 3RFAA 3LQFA 1L5QA 1XIWD 3RUGE 5T1KA 1NX9A 3OR6A 4YAEA 2VKQA 4ILKA 5C09A 3D5OF 3DX8A 1UJ3B 4R2GB 3U37A 5B38A 1WD5A 4Q6IB 3TEFA 4IV8A 4X7FC 2YMLA 2BGJA 2HX9A 2H8PA 4ZGYA 1Z4NA 4MWEA 6AT1A 4EACA 5FHAH 4CVZA 3PWNB 1MEXL 3UZZA 1EX1A 3CSPA 5JDJA 1AHWA 3FCPA 4UHFA 2ZRDA 1PD0A 1IF2A 2P41A 1CTQA 1JNLL 1ACCA 4G84A 2BAGA 3VTRA 2C4FU 5BN1A 3VNZA 4HEA6 1TPXC 2NU9A 1IHXA 1WUTA 4COKA 4U0JA 1DCFA 3UGVA 1KRXA 1W30A 3FOLA 2VDNH 3ZY5A 4OQ1A 2Q20A 2AQSA 1EDEA 1NF8A 3TYDA 2OLJA 4V3CA 3BMNB 1QZUA 4QIHA 3CQ0A 4HD8A 2QJJA 1D0IA 3MGGA 3RYFB 1BU5A 4CM8B 3KDMB 4R2MA 1LL6A 1LEKA 3JWDH 4MGXA 1XYGA 2PGRA 4WO4C 2PO6B 1T4CA 1XRSB 1IGCL 3W4RA 3MJWA 4DDUA 1XRSA 1P3JA 4JFFE 1K92A 4CKCA 3RROA 3LOWA 3UJTH 2X14A 5IREA 4WIAA 4EA7A 4EN3D 5AM3A 2X4LA 2CNYA 4PQEA 3HHSB 1XC4A 4L4VE 3VGGA 2G97A 2VMEA 5GXBB 3BAXA 3VYTB 4ZHQB 5CJQL 2XNCA 4N0CC 2VQSA 2CZFA 4BFRA 1KTRL 2YC1B 1MFCH 4AQ7A 1A4CA 1XDTT 1UW9A 3K2GA 3GEGA 1C7QA 1U7TA 4ZMZA 1U8PA 5LBVA 2F1IA 3CO0S 4NJOA 3QQ1A 1X3SA 5IB3A 1I4FB 2IHKA 3GC4A 3FTNA 1K77A 1ZV9A 4TVBA 5DF1A 1CUEA 4Y1TA 3ZZQA 3DTNA 4KJWD 2CWWA 4RF3A 3NUZA 1YVLA 4KXVA 5E94A 3ZY3A 4L0PB 3ELFA 3C6LA 1IY1A 4BGIA 3J8F7 2WUGA 3DE6X 2QJOA 1N82A 3AL2A 2CF5A 4BMCA 3LLCA 1YWGO 4R26L 4U1GB 4MWGA 1Z3RA 4LYQA 3LGEA 4KJPD 4AZ8A 1TCUA 4CTNA 3BXGA 3IJ7A 5AAWC 1K8XA 1GGMA 3X3GH 3HC0B 2JGJA 3VKCA 1I8JA 1JXFA 3VD3A 2F5BH 3EVFA 1YOVA 4DLAA 4XMPL 4OTZA 4RE3A 5AYZA 3SDYH 1RXEA 5I3KA 3FB7B 4DQXA 1BVNP 2W07A 1VE6A 4DUYB 4IOSD 4BUQA 4XN2A 3Q3EA 1DTUA 1JZ3A 4US6A 4WNAB 2OOGA 2XLCA 4E5XA 1C1EH 2E89A 1RQGA 1OT4A 3C6SB 4J35A 2JW5A 4MP6A 4K5OA 4IJ3B 1PV2A 4YSRA 3LDVA 2O2SA 4BQFA 5K8LA 5J1SC 3NQ6A 4LV5B 5I6OA 5ICUA 3NHMA 5B1KA 2J24A 1PBTA 3GELA 1YUBA 3DUFB 3MBWA 3L1HA 1MFBH 1T0IA 1L5SA 2KLSA 2RGBA 4KO9A 4ZPJA 5HJLA 2ILLA 5IFTA 1IJEA 1R0XA 4CW1A 4P0PB 1V7AA 3PQYA 1YR6A 1T9ZA 5HDBF 1PIGA 3QZUA 2NXWA 1P7QD 3S37X 3KKKA 3N41B 5J6GB 2DUNA 3EDJA 3AB3A 5A6SB 1WRBA 3BW3A 2ZUDA 3FCSA 2XV3A 4UFOA 1RUPL 5IV2A 3KD3A 1QPXA 1R3WA 1TF4A 3C5CA 2D2HA 3L0GA 3RJQB 1KRMA 5FHBH 5HGDB 3FFBA 4ZFZA 1L9PA 2CXGA 5CAEA 4O4HB 4HU4A 4ODIA 1N26A 4FB7A 2ON6A 1XQXA 4QJ4B 1DO2A 3I74A 1KGCE 4C7BA 3PHBE 2CXRA 2WA2A 1CI1A 5BRZD 2CO2A 2CUAA 2XFYA 2R23B 2CQVA 5JBEA 2O0LA 3ZWYA 2BMEA 3QDGB 4FXGC 1DQRA 5I1HL 5DD3L 2CD7A 4AQEA 3GB7B 2IA5A 4XXCC 4AZBA 1RLCL 1RSZA 5A62A 3H1FA 1T13A 2P0IA 3NQMA 1EK6A 2NY5C 1VTKA 1OI4A 5AI5A 2XVLA 3P0IA 1STOA 1CBJA 4BE4A 2MMXA 4FQQB 4FBLA 1NDHA 5J4MA 3IDJA 4ER5A 2G9HA 2EPMX 2WZPD 4IMKC 3CUUA 2Z92A 1SVKA 5AHLA 2BMKB 3TIIA 2BM3A 3LRKA 5F2LA 2RUSA 1W5FA 4K3HA 4RHUA 3FBGA 3L23A 2P0AA 5DM2A 4I1YA 1IGMH 1MCJA 3WLPA 3TT3H 1F9AA 5FJOA 2QLMA 1CLXA 5CGZA 1JDJA 5K3BA 4RDVA 1I4EB 1EC8A 3RUCA 1R5WB 4H44C 4DUVA 3GW8A 3HR4A 5DQDL 5U9CA 3R3YA 5D3KA 3GYCA 4D2NA 5AVOA 4OCZA 4L3EB 3KKPA 3R40A 5B37A 3AXSA 1G7SA 2RR3A 3OKLA 3QV7A 1SOKA 4MD4A 1GG5A 1XYYA 4MGZR 4HVTA 4HN8A 4Z3EA 3ARSA 2V5DA 5FBLB 4X97A 2H3BA 2ZETA 1BD2B 4IKLA 1DFBH 3OQEA 1EJWC 2DTML 4NQDD 4KO7A 4AJNA 4ANVA 4Z7WF 2ZXDA 4IQ8A 1AGFA 4XRCA 2YZRA 5JSHA 7FABL 2ATCA 2OMUA 2NOAA 3V4OA 2BC9A 3VNIA 2H1PL 1DX4A 3MV7B 1ASPA 1JXOA 3S9YA 1JDBB 2ZKHL 5FYJU 4KGLA 3GEWB 1IVTA 1OA1A 2PPGA 4AX6A 4F8OA 1WY5A 1AB5A 2RDXA 5IM51 4YP7A 5LBIA 2D0FA 3AJAA 2XFRA 4WUUE 2W4QA 2RMNA 4L3AA 3H7VA 2B8OT 1NBVL 3QRGH 2D03H 3PWIA 1K4DB 3EZ9A 1UXOA 1KFBB 2OJEB 4UU9B 4JI0B 4OZFA 3FAWA 2IXGA 3KB2A 4XYGA 4XXWC 4ZOBA 1MV5A 2FUNB 1YQWA 1QACA 3KU1A 2I7OA 3EY4A 3N86A 5J2UF 1HK6A 4IQHA 3BSZL 4OMFG 2GEEA 5CHYA 1GQOA 1P84K 1VL1A 1IN4A 2P3YA 4CDGA 1CF1A 5JLZA 5D3MB 2WLNA 1FHGA 2YC4C 2INFA 5LDUA 5AUOB 5HNRA 1CFJA 3PT5A 1HNFA 4G42B 2MYUA 4LHJB 2BMWA 3A2KA 2VPZA 1OE3A 3TQVA 4ZVTA 3CB8A 4GVIA 3C56A 3M0JA 4XWKA 2DI7A 5C2JB 3VGFA 2DLDA 3EOSA 5DTMA 1UD4A 4PC7A 1O77A 4PY7A 1Y33E 2F59A 4DW2L 4Z1CA 4PFQA 5GP1A 4EI8A 1XRQA 9XIMA 4WSJA 3PX3A 3E9DA 3PWGA 4AB4A 3GS6A 3P11L 1M1YA 4XN1A 4Q24A 4N6QA 3R8RA 2YGYA 1ZS9A 2D3TA 1ZIDA 3A3YB 1R2TA 4KODA 2FGZA 2BCMA 4YI3A 2X0VA 3E0QA 3A9CA 4BEUA 3WD3A 1DEHA 3ZD8A 3K4PA 4K9DA 5KYGA 1U3GA 3HFYA 1MWAA 2E5DA 3JQ6A 4HOYA 4GR5A 3IMEA 3RJZA 2KPOA 4CVXB 1AH1A 4RV8A 5HBGA 2HHCA 3ETNA 3R23A 1E2UA 2XYHA 4X8OA 1P0BA 2Q5LA 5ETUB 1W8NA 1SU7A 3GSRA 4YRIA 3HXLA 4XWGH 2WFZA 1N6KA 1FDVA 3EW9A 1R86A 7REQA 3N7UA 1E4XL 4LV8B 2AS0A 3BJ91 5KSVA 2ECOA 3B03A 2GDVA 5AZ2L 1PNOA 3C1TA 5CR8A 3V0SA 2FPOA 2GM5A 2HRLA 5TDOA 4WEBH 3TASA 1A04A 1J7KA 4FE9A 3FKSD 2OTPA 1HDGO 4N6RA 3HNSL 3PPEA 4JPIB 1H6CA 1II9A 3LP6A 3OO1A 2A0KA 1QGDA 2J5LC 5DNVA 2R59A 1LPBB 3U7WL 3ULKA 1T21A 2UZIR 2IXQA 4ES9A 1WDAA 1KB5B 4OZFH 3C7CB 2P9QA 1RCYA 3A05A 3UT5A 3EXRA 2A57A 1HZJA 4UHDA 3N14A 2DU2A 3QJ5A 5KYNA 5ETJA 3WV4A 3WJXA 1S7QB 3DYMA 2OT0A 3GNTA 1OGGA 1IH8A 3GF8A 3O21A 4YGYA 4UZSA 2EUWA 4X6CE 2BHTA 2BY0A 1GOOA 4XO5A 2APJA 5IM5A 3F9IA 4BFIA 2QROA 3DWIA 2JH3A 5IB4B 2WKPA 2VXBA 3BRGC 2P4AB 4J8PA 3IX7A 1AKQA 2VYCA 2DHDA 1J1XH 3IDIA 1KI9A 4A3HA 1BVNT 1NIUA 3QMTA 1BE6A 2XQYK 2ZSWB 1VJ0A 1YEHH 3VR5A 4H8PA 4JFPA 4IGEA 1LTQA 4YPJA 5CNJA 1Z5PA 2J6EL 1SW3A 2CK0L 4AYID 3GOQA 3NGXA 1QWGA 4YJZL 4HOMA 1XIGA 2JLXA 3E6AA 4MA7L 3FQ1A 4X6YA 3GEFA 1M03A 5JXEA 1PGPA 1KM2A 1M7JA 3NONA 3NHPA 3EB2A 4G6MH 4U6XA 5IDIA 3S27A 4Z76B 2CXUA 4IRSD 1MR3F 1K7CA 4RZKA 1TELA 4ZG1A 3N5CA 4YECA 4FMBB 1AIFB 3CEPA 4H0GA 3IAGC 4GT0A 2EUXA 1UBTS 3Q9NA 1EGJH 4PW3A 1T7LA 1N6HA 5INDA 1LRNA 4PUBL 3RWEB 1U30A 1QHFA 5KTYA 4R7JA 3R06B 4RVDA 4GBED 1K9EA 3PUJA 2MNWA 1VE7A 1W8EA 4OIIL 1H8OA 5D00A 1PCXA 3WY4A 1EFDN 3JTSB 1FZJA 2JA2A 5FA5A 5B3KA 1RW4A 3TJIA 5LYJB 4EVNB 3M6WA 4RMNA 4E6PA 2EG5A 5B1SA 4KQHA 3BUSA 4UAJA 1CLYH 5AKIA 1Y34E 2C1HA 5FP0A 5GGQH 2YD9A 2RACA 5I3DA 4MLSA 4JEGB 1DFHA 2GN9A 1L7OA 5BRZE 5IVDA 1UDRA 2XITA 1B6GA 2W8BB 2CW6A 3DMTA 3QKIA 3N17A 3GD6A 3MMUA 4IDGA 4YIQA 4B31A 1XAUA 3GNML 5IHUH 2HX7A 4QBFA 4WWHA 2B7NA 3DHJA 1NDQA 3FHEA 2W2VA 3S2EA 2O8CA 1Z0FA 2FZ5A 4EJ2A 1MQRA 1UWSA 2WAMA 4WI3A 2W6ID 4IDCA 2C1OB 2M6KA 3QE9Y 5DCYA 4OXRA 2VF8A 4I2VA 2YNMA 1GTG1 4LBVA 1E4WH 3AG5A 3WUGA 4P7KA 5TJWK 2X2UA 4U3CA 1LEGA 1UBFA 1ECYA 5CKSA 1AKWA 4FCWA 3BZ4B 1V3HA 5GV7A 3V9AA 4FHGA 4BZZA 5CJJA 5J04A 1JHDA 4UOJA 1R0WA 2WGNB 3PRJA 1H3UA 4KFNA 3QW4B 2OZ3A 3WLNA 4FFOA 1TCDA 2YD8A 3ZK0A 3HZOA 2EEZA 4TNEA 3WO0A 2VGFA 1G64A 1B76A 2B0MA 3M1BB 1MSPA 1BHO1 1KAHA 1P5JA 1Z0UA 4WNIA 1UJ2A 2JLYA 2AJUL 2H54A 3QQPA 3TZ6A 2NY5L 1FLRL 4LVFA 4IIUA 2V5RA 3T99A 4ERAA 1EJVC 3GP5A 3I09A 4AECA 4RR4A 4XCNA 5LZLA 1JEQA 2PSNA 4YK4C 4UOQA 3ABRA 4LJ7A 5BW5A 3NTRA 5JAMA 5IDQA 4G09A 4M6WB 2QMHA 2B4TO 3DZFA 3TPCA 5JRJA 1S7VB 3DMRA 2K9UA 2JKYA 3W2GA 2VPWA 4Z51A 4N0UB 4YX9A 4S1DC 2XTLA 3V42A 1CD0A 1EC7A 3B9QA 2YN3A 3VDHA 4CU7A 4OGXL 5TPWB 1VERA 4KK9C 2LU5A 3VOTA 1ES0A 3OZXA 3SGLA 4EX6A 1WIOA 2VN6A 2WWYA 4ISCA 5ALMA 4XO4A 1MWAL 3KJGA 1IOWA 3MT7A 3NEYA 3OAAD 5DS8B 3RRQA 1EH9A 4H1WA 3S35H 2DBZA 1RLBA 4ZI2A 5B1DA 3D6TB 5K0NA 2UVPA 3SZ8A 5T1KD 4D3ZA 4X4KA 1KRCC 3I9AA 4PJDE 2HKHH 2Y27A 3CWZA 1EGVB 2NADA 3GXTA 3RGVA 3G85A 4ZMTA 2VUSA 4YC2B 5H6HA 4BFEA 2GBCA 5LAPA 5E9JA 2MCG1 5F6HJ 4YO7A 4DZRA 3BEOA 1P43A 3OIDA 1QPKA 2Z7ZA 4ODUA 1TF7A 4YV0A 1AGEB 5KZMA 1E5AA 1HT1E 3L7JA 2RB8A 1QIMA 1R7OA 1Q45A 4KFOA 3V0TA 2D62A 3PHQA 2JGDB 1P1JA 2IPFA 2J5LB 1I6WA 1YACA 1NVKA 5F3WB 5CN1A 1GRRA 1SJ9A 4HYWA 3O73A 3VA7A 3GMRA 4K40A 5F2FA 3UA3A 2ZYRA 3ARBB 4AGLA 4RMGA 1QJ4A 1Q5MA 3FPBA 1P2TA 3ZGHA 4DW2H 3MREA 3KXQA 3ZXAC 3KSRA 4RXGA 3E3OA 2ZRPA 3BEWB 3ZV4A 1QVVA 1R3SA 1RC1A 1B0AA 4YDSA 5LWQA 4MQ4A 4FYTA 4CI9A 5GIRB 4H0HB 1LF0A 2DPYA 3MDJA 3EIWA 1WD7A 1R0ZA 3T3ME 1CQPA 2AR0A 2BFBB 3WHXB 3OHIA 5BWOA 1TFPA 4M81A 2Y1OA 5HQTA 3HJAA 5KVFE 3CK0H 4GC5A 1GSAA 3FNFA 1YB2A 1V7ZA 3LSYA 5CEXA 3M46A 1YAJA 3KB6A 2NUYA 1RM4A 4C4TA 1FYEA 4V3BA 2HLFD 3LRXA 3QUSA 1TPYA 3ZRFC 1ZI9A 3SSAA 3LY0A 2NY1C 3R1GH 2Q3DA 1OJXA 4UTPA 4B2PA 3W9SA 4IFEA 5LNRA 4IIHA 4XBEL 2MEJB 3TF7C 1Y8BA 2M6SA 2JQAA 1MC5A 3HB9A 3M4NA 1HSAB 2PNJA 4XWGL 5CWSB 1XEWY 3JTTA 3I6LE 4Q33A 1DDHB 2COVD 4XKYB 5D03A 3NKFA 2QTVA 2NW6A 1N59B 2A6KB 1KYUA 3NIFB 1UIPA 4ZVQA 4EIWA 4ENQA 5CJ5A 4E5TA 3ACDA 5KJCA 3M83A 3W1WA 5BV7A 1CF9A 5DI3B 4Z08A 5J9PA 4RTNA 3TLEA 4HWNA 4KY2A 5I1AA 2PV0A 4X4YA 3RMEA 1S8AA 2XE6A 4BB5A 2QX6A 2RJ3A 2ZRMA 5FWYA 4W5HA 2GJ8A 2CM5A 2BCKB 1IZCA 3UY8A 2EADA 3VDQA 2V6HA 2ZWAA 3UWZA 3VNRA 4PZEA 4B3JA 4FOUA 5CA0B 1MZRA 1NLUA 3JS3A 1XUOA 4LJ6A 2P6PA 4NCNA 4ALNA 1RQNA 5J1SB 1A1OB 1YHPA 5E0QA 2B20A 2NY0D 4P31A 5IW3A 3HN8A 1J5OL 4QLJA 3AUWB 4OCNC 4ZAFA 3SPIA 3VRHA 1XKTA 4JM2B 3L7FB 5CCKL 1HI9A 5FUOL 3SBWC 1BTCA 1Z6YA 4MUFA 1MIEH 4Z7UA 4NX0A 4J8RA 1W0CA 4X5LA 3DJZA 3WR5A 1PV4A 2F68X 4R5XA 1YZYA 4KEUA 4IG2A 1J1XL 4QO1A 3MV7E 4KX3A 1FUIA 4YHHB 4DR1B 1Q15A 2FL5A 4UWQB 1RRKA 1ZO8A 2D5IA 5DURD 3RU6A 1YJ5A 2Z83A 1G38A 4JBIA 4IPTA 3UR5A 2FMHA 1FUEA 3RB8A 4UEJA 4KR3A 3AGQA 3P8IA 3U4DA 5DHMC 3LSBA 3G88A 4M1SA 4NKIH 4BDTA 4D3XA 2OHGA 4D3FA 1RVGA 4OXQA 1AD2A 2Z31A 2WBKA 4CDHA 3WNVA 1UMBA 4PJ5D 2OFOA 3Q0HA 5KNLA 2E5EA 2Y2YA 3WX7A 5BMVF 2WAYA 3E8UL 1KLZA 2PL3A 3PDOB 3V7MA 3LLUA 1KZ7B 4G9BA 2ISSA 1IU9A 5BV0A 4O4IA 2WMPA 2P0YA 5EPMA 2OZ4H 3SVTA 3GWQA 5E1DA 3FJ4A 3OAYH 5E6SA 4R3UA 4GSUA 2E5WA 1SN7A 2BIHA 3CDZA 3K74B 4BI7A 4RAQA 2VFIA 3SE3C 4C58B 1CRQA 2PVPA 5K4XA 4PC8A 3KPPA 1SN2A 3AYRA 3D6MA 5JFOA 1Y4AE 3NO1A 5DMJB 1H5BB 1QT1A 2E9GA 3QOFA 4MAYA 4PUBH 3OU7A 1Q0PA 4HRAA 3QU2A 3PX7A 2QNRA 3QCTH 4I4TB 5CIPB 1HT3A 1RTKA 2P5NA 4WLEA 2J8TA 1UHVA 3PJEA 4I4TA 3MRFB 1B0GB 3LPNA 5MN6A 1HP5A 1NPNA 5CBPB 3RTCA 1G6CA 1Y5WA 2I65A 5KU1A 5IAOA 3BPCA 1YOBA 4XVCA 1XYFA 3QHFL 2F9FA 3VKUA 4L2YA 2ZC8A 5KO2A 2ZJFA 2YD5A 4ZYWA 4M21A 1NFDE 2DLFL 2BH9A 4H5SA 4L29A 4Z4IA 5L2KB 4HEJA 4RCVA 4AWBA 4RY0A 1QRNB 3HS9A 2WBJD 2XQJA 4J7AA 4NR0A 4P5TC 2YO3A 3LN5A 2J41A 3CLEL 1U36A 3VNUA 1SDAB 1B8VA 4AVOA 4PQYA 6PFKA 4HDIB 3EH4B 3D34A 3EA4A 2VAJA 4UMAA 4AWSA 2GHRA 5HJXA 4XIYA 3B6IA 3QGVA 3P27A 4BSWA 4LSRL 4XE0A 2H6PB 5ENDA 1XLMA 4H3HB 5JSQA 1SEVA 4AXKA 1PQUA 1BEYL 3X14A 2VC6A 3H13A 1UMDA 4Y16B 3VXMB 4C9BA 3W7MA 1OZFA 1FWSA 4WCVA 1UUFA 1GG1A 1H2WA 2B14A 3C15C 3WOVA 2P10A 3RDJA 5K2MA 4KGDA 2I9UA 2A77H 3LD8B 3AHXA 4E3VA 3VD2A 1TZ9A 1KH1A 1DCEA 3NTQA 4U1IA 2QL9A 4K9PA 3OJGA 3FJLA 1W8SA 1MU0A 4A7SA 5CEYA 4IHOA 1FPTH 3MCVA 2P80A 2AJUH 1H1YA 5E6IB 4QTFA 4Y4HA 2NY5H 2GESA 2O5CA 1FIGL 1OYCA 1FLRH 3S3SA 4JN2A 5AK5A 3LNMA 3TN6A 3FTYA 1HYQA 3QWNA 1I2MA 1MH5A 3FRPA 3KH3A 5JOPE 1UR0A 4Q8QA 2VP5A 1SFDA 4PWIA 1SJHB 3CVYA 4NRZB 3QELA 2Z2ZA 4EVQA 3CNYA 4TUJA 3CSFA 3RKDD 2WZIA 3SDXB 4LS1A 3NTVA 4IXNA 2OL3H 1CLEA 5PNTA 1J22A 4A29A 1OGJA 4B5ZA 4KRPC 2XN9A 4O4IB 4G7YH 5EN2B 1NGQH 1AS0A 3CZ9A 2WCAA 5D1ZC 4HIIB 9PCYA 1NKSA 4LSGA 4AS1A 1CQYA 2HDHA 3B8IA 1C1XB 3NG3A 2DERA 2V03A 3W74A 3FFDB 5HI4D 4JVPA 4BKSC 2W2OA 4PJIB 1LT8A 4RMJA 1JTVA 3GKWH 1QP8A 1YNTB 1RR6A 2BSXA 2IL1A 2ZCUA 2BCEA 4AYEC 4C6IA 1K89A 3VH1A 2O2EA 4LJ8A 2P8PB 3E2PA 3C3PA 4YS4A 1JKJB 4FOLA 3II2A 4BDVA 2QDHA 2F8TA 1T22A 3E35A 4RBPK 3IDMA 4MIEA 4TM8A 1UG9A 3WIVA 1RWXA 4QEEA 3LYRA 1BXVA 4J9UE 2R0ZH 2GVJA 3RE0A 3CT7A 1YBVA 4JIRA 4JJ5A 4LF7B 1RWBA 2UZIL 4WHTA 3AU6A 1QG6A 1LTXA 4FOTA 2F6KA 5L2KD 5CLGA 4AUJA 4X4MA 1BWRA 2HMUA 2W0SA 4Q3DA 1HJCA 2EEBA 4Z5RB 3GZAA 1A9YA 2NLJA 1JWMA 1P4IL 1CBVL 1M1YE 4J49A 1ADBA 1YC7A 3OE7A 3L4KA 2BSRB 2EW1A 4AYFB 4R4FL 1V79A 4AJPA 3B51X 4PYSA 1DKMA 4OQYA 1CMOA 2ORED 1ZR2A 1JTFA 3WB9A 3S44A 3Q11A 3L3KB 4UXJA 2FZ3A 4EQ6B 2CSPA 4A39A 3OXRB 2G3YA 4FAAB 2FO4B 5D7SH 3JTEA 4BQ2A 4R0MA 4B4HA 1TNNA 5D05A 4J3TA 3WGVB 2WIIA 4OSPA 4P54A 4A67A 2Y5TB 4DJ5X 3W22A 3NACL 1GKOA 4MMYB 1Q14A 3S2NA 3VZSA 1NC4B 4B7UA 4X6CF 3VUAA 4G71B 2QN9A 5L7XH 3UEQA 4C29A 4K8RC 3V6OE 3P0XA 4EITA 1U8ZA 1Q6RA 1RJRA 2IGTA 5EZOL 5FL7A 1AH2A 1PS0A 4EP1A 2NXYD 5C6PB 5FD0A 5B80A 4TPRH 2J9ZA 3IHWA 5K0BA 2YD4A 4DV3B 3APFA 3UJBA 5FI3A 3SCUA 4Y7EA 3DEJA 2PTXA 3ANYA 5KMGA 4FGMA 4K5LA 4TMKA 5CDUA 3NZHH 1JDZA 1ZBWA 5T6MA 5I48A 1HEHC 1CB7B 2Q9AA 4PRPD 4BZ2L 4YJKA 4XZBA 2BGLA 4IMKA 4EDXA 4YZFE 2Z7YA 1RM0A 2ZQKA 3APYA 3SJVB 3FTQA 4FK9A 1W1VA 1V4NA 2X87A 2LGJA 3ELDA 1E0WA 3ZDFA 4Q9JA 3KPSE 4E88A 1E3TA 1XP5A 2ANCA 1LJ8A 2L19A 3VXSA 1XTJA 1KIPB 4R1NA 2HU2A 2ADIA 1JZ7A 2O5RA 2H7YA 3G1VA 3NP3A 2WOJA 2DQUH 5DBGA 1OC5A 1PAUA 1QW8A 1J39A 4Q4HB 3EOAA 1JDAA 4QUEA 5JHDA 5ER9A 2CXTA 2PR7A 2P8LA 4DSOA 4GYBA 2DYPB 1VYPX 4LQLA 3VZDA 3ZCSA 4P32A 1RZ3A 3DBHA 3B82A 4A2HA 5LQBH 4R8WL 3JU2A 3WYGA 3SSNA 3INUH 1QHOA 1TJ4A 2WLHA 3B4NA 3BJZA 1MVFA 4HKBB 2ICEC 2PMZA 4C7VA 1EQ2A 4FNRA 1GGOA 2Z24A 2D0OB 5FO7A 4H8WL 4Y9OA 2WVTA 1YD7A 3FCXA 2FZEA 2A79A 4TUUA 3MB8A 1XS2A 4PMXA 4WJ5A 4J7XA 3I3SR 4Q97A 4YE4H 3E49A 2C96A 3V4ZA 4N4QA 3KW7A 1K7XB 1XZ0A 1YDPA 1E2FA 1TFUA 3GTVA 3BA1A 4ITUA 4L5BA 3QY6A 3KYNB 2LU7A 2W1NA 5D96B 4URWR 5IYZA 3IJEB 1WPGA 2GK6A 1XH1A 2B4GA 4AV0A 1JALA 1VLJA 4O57A 3I6GA 3B52X 3U30B 1TTPA 5K59F 1EUNA 1T1EA 3R6IA 2FWJA 1JPJA 2J7PD 4BK5C 3GR6A 5DRNB 4PB5A 1W4BA 2G80A 2QIOA 4GIYA 5ANMB 5BQDA 2F1HA 1S7VA 3EH2A 4UBMA 4WCFC 3G2MA 2YL8A 3DDMA 2XGJA 1QIGA 2JA1A 1RLDA 3TMKA 4GE8A 1I1FB 3ERXA 2FWSA 1SULA 4HHMA 1BMFA 2F5AH 3U2SA 1EUTA 2DJUA 3LEVL 4DPRA 4LCWD 3IIOA 1EHCA 2QYOA 1JCLA 3AR3A 3IOMA 2X4IA 2PANA 4A5OA 5E4FA 1NXPA 1J8FA 3AMGA 5F7FA 2GF0A 4PH6A 4JT9A 4HLCA 5CX4A 1Z9SA 4QS6A 2VDPB 4N9CA 1Q7RA 1KJQA 1A1NA 3PHLA 3HWWA 3RY4A 5LR6A 3C5ZD 3L79A 3UKOA 3JQFA 4B3LA 1A21A 3KWWA 4BMPB 1XX9C 2LR4A 3I9LA 3V7PA 5EP4A 4DWWA 4Z78A 3MV9B 2QXWA 3GUYA 4BBWA 1B3YA 5JAZA 4PJGE 4P2CG 2H32B 1ISIA 2J6IA 1NFDA 4AX4A 1YJCA 5HYJD 1KIQB 1RZFH 4HYTA 1WS6A 4LSRH 1MLDA 2A4ZA 2YNMD 2LVCA 1D5BA 1Y6GA 5I30H 2PDUA 3KP0A 3MUZ1 2WJEA 2DMCA 4U6VH 4LUSB 1GOIA 1BFTA 1IM2A 4O25A 4ZOLB 1COWD 3MGTA 1ETJA 4YRMA 3Q06A 2W8BA 2PU7A 3IHKA 4NFDA 1RAAA 3GG0A 5DYNA 1IULA 4JHMA 2IYAA 1HO3A 1KIAA 1RBMA 4HD5A 4W8HA 1QVAA 4W5RA 2FZ8A 5AW8A 4QL3A 4B47A 3D4IA 3G7SA 2J33A 4JO4H 2AJDA 4UW9A 2FJHB 3ITVA 4FOSA 5IU6A 4HGPA 3PTKA 3T2LA 5LUBA 2LCFA 3IAXA 5I17A 1RURH 3TWYA 2W65A 3QG7H 3CLVA 4IU3A 3T7SA 4UNVA 4X45A 5DFWH 2XH7A 1C4XA 3ZDYE 1JHTB 5G1YA 1BQ4A 4GEGA 3LM8A 2QQQA 3VIPA 1EX0A 3HUEA 5B3LA 3GLCA 2VM3A 4HFUH 4LJAA 1IXKA 3LO5A 4IH9A 3SDCD 3WJZA 2HA7A 5IEHA 1J2WA 4GLFA 5MKGA 3MJ9A 2AEPL 3DOCA 2A3RA 4X95A 3AQXA 3F5WA 4UBIA 5FLUA 3JASA 3ABMB 4G7VH 4NJAL 1XQLA 1YRKA 2ZJ8A 2ORVA 1CCZA 5U7SA 5K0JA 3FNIA 3KS0H 1H4SA 1FKXA 1RZGB 4GKNB 4FG2A 2W67A 1UWQA 3WKBA 3ATEA 2A9KA 3DV9A 2J8UA 2X05A 4DY4A 3EX4A 2VYNA 2YHGA 4MKZA 1CVRA 1XLFA 2R94A 2HPAA 4UFPA 1FFDA 1R9NA 3GUGA 2XKBA 2P5TB 2NLOA 1IONA 3EGVA 4DPBX 2C3UA 2C0AA 2X0KA 1Z3NA 3BHBA 2WR8A 2X2OA 5H7XA 3OM3B 1FFNB 4KFCA 1JFQL 4D4GA 2JD1A 1FUYB 2Q6KA 2W70A 1WC7A 2DL9A 5EWMA 3DIFB 5GS1B 1SR8A 1F6YA 1E9YB 1V51A 1ZH6A 1KO5A 4UUOA 5JYLA 1IT7A 3KYNA 4XNYL 5EA0H 2X58A 1TQJA 5IM7B 2PRKA 1MFUA 2Q01A 1TCMA 4X6CB 3HYRA 1I6MA 3FLEA 3AEZA 1CCWA 3BEDA 4LMQI 1BOYA 1PJ2A 2NV1A 5HQ3B 3UG3A 2MSWA 5F12A 3LCMA 2BW4A 3FU6A 4PX2A 2NZLA 1TQCC 4HV8B 5F52A 2NO1A 1MELA 4IM7A 4EJSC 1LUCB 2OX1A 3M7IA 3MV8E 3PDGA 1NAHA 3FNDA 3O2VL 1IUPA 3VPBA 3LTSA 3C0QA 4TRPH 4O4WA 4YIKA 4FBGA 2C84A 3PKJA 5L7XL 2AMYA 4OZGB 4Z3IA 1HZHH 4Y2UA 1U8NA 3QIWD 1ZA3B 1IU1A 3TK7A 3KQNA 3UH8A 4BKLA 3FVRA 2YA2A 5M17A 5EXPA 1P80A 1TQTA 1DRJA 4F1KA 1LK3H 2JI2A 1MO4A 3K0FA 1ADJA 1BKHA 4MXDA 4E31A 2RHJA 4LHUG 3F67A 5IS2A 4E41D 4OVXA 4WVLA 4L4LA 2XZCH 3O9WD 4E5YA 5DHTA 3WOHA 2VN5A 4FFZL 3QUZB 4HQFA 3EX1A 3WNPA 1CKEA 4BD4A 1FYTB 3FB4A 3BIJA 1T7YA 2IPUK 3MCOA 4C4BA 1EKXA 3KJEA 3Q3JB 1OWWA 1KMCA 2FPIB 1SU6A 2F9BT 3L65A 1MY5A 1HXYA 3QO0A 4FKHA 1KS2A 4HWGA 1LQ0A 4HGRA 1JD7A 3B6KA 4JR5A 3NSCA 1J5TA 1IM3B 4OXNA 3I42A 3EC2A 4OMCA 5TGDA 3SCRA 1W76A 1INQB 4PNHA 2I25N 3GXFA 1Y37A 2WVGA 3VOGA 1RJ9A 1UKEA 1QH0A 1FJ1A 2Q5BA 1YHTA 1NMQA 2H7XA 2DQUL 5J06A 1TEXA 1DQIA 4O2CB 3GC2A 2XAUA 3OE1A 3PL6C 1W88A 2J87A 5DJCB 3LAWA 2BFWA 2HK6A 1W94A 2R1KA 4D0SA 3NBNA 3V0DA 1FO0H 3WTBA 3RTQA 5LXXA 2WSMA 5GM1A 2KB0A 3T81A 4HJUA 3TOSA 3ZDXE 5LQBL 2Y7DA 3N2KB 4EVNA 3NGLA 1OWNA 5C92A 3RQIA 3F6CA 3N11A 3L2IA 1ZAIA 3W88A 5ABHA 1AVTA 1CYXA 1FZJB 3M6YA 4KRTA 1F07A 1A8PA 4WW2C 4UFNA 3U9PH 4WUUA 5EBLA 1BU8A 5H02A 2AK4B 1CX9A 4O4VA 3IGFA 2DQCL 3DKLA 2CFSA 4HNOA 2Z31D 5HHNB 2DG2A 4DRXA 2PDYA 4Y98A 3UJSA 1Z6ZA 3ZKAA 5EN3A 1V7CA 5EFOA 4POCA 4KRPB 3PP4L 1YY8A 2BEJA 3DYPA 3QAQA 5F3FA 1GW6A 4BWLC 3KJIA 2Y36H 4KAQH 3LHPL 4C2UA 2DBLH 2F6UA 3UJ9A 4Y6OA 1I9GA 2IF7A 4PD4K 5EU6D 4YXKH 1W88B 1GXSB 3LPGA 4ZYZA 3BG9A 1N2JA 4J2HA 3HVNA 1IAII 4CV0A 4WGVB 1YR1A 4HKJA 3LUKA 3NRCA 2R2HB 2VN3A 4A7GA 1KR2A 1OBHA 1FW6A 1W85A 3DERA 2CLEB 3U39A 1Z16A 4KR2A 4ER0A 2EDOA 4HIHB 3B3AA 3HG5A 1O66A 3UTOA 1NEPA 2HTMA 3MRGB 2GDQA 4Q7MB 1XXDC 2ODPA 2IEIA 3FPXA 4HU0A 2DT5A 1XZAA 3KJNA 2Q2QA 5E8DH 1VF5C 4DMLA 4MCAA 5KTRA 4IBYA 3KJZA 4NBSA 2JV6A 1WL8A 4X7TA 3TD2A 5G41A 1HE5A 3EBVA 4D8YA 4OCXL 1CVIA 2JLLA 3BWEA 3VPGA 1JXQA 3TLRA 5THQA 2H63A 2FFHA 3N85H 1HOTA 1A25A 4QXIA 3SUWA 4PLPA 3K46A 2RH8A 2Y7NA 3MX0A 1KB9K 5JHDE 3H12A 1T0NA 1MJHA 4B0PA 1REIA 5F6IB 1G7TA 3GCZA 4QD3A 3F5FA 4JEIA 4QYOB 3D6NB 3P60A 3SHSA 1UPXA 1IQWL 4AH2B 2POTA 3UADA 4MNGA 3FLBA 3H2IA 1WSDA 3L9EA 1EP9A 3TQHA 5EOQH 2NY4C 5JIHA 3K2IA 3QDJA 4ELMB 4S2EA 1HYRC 4S2SA 1BVLB 1RK6A 4M6UA 2IXUA 3SPJA 5BXTA 1KFEA 4JUAA 4OH1A 2IMRA 1E5CA 3JRWA 3CUPA 3RS5A 2EFEB 1A9VA 3BSYA 1EGVA 3KWSA 2ZC1A 4Q4JB 2NPFA 1ZY2A 1V6AA 4C01A 3O6FB 3IPAA 2O3SA 3K9WA 2DE0X 1OAOC 1ND0B 5DCEA 5E8OA 1U0BB 2I24N 3ZNOA 2GM4A 1CZRA 3T94A 5C2XA 3BEVA 3UG5A 1FVFA 2FYMA 1KP2A 3UTSE 2TS1A 3W5NA 4KACA 3LV3A 2GQ8A 1K9DA 3ECSA 5T5NG 1P7PA 3RPBA 3ZLQC 4L8BA 1F3DH 3G2KA 2CLFA 4FCCA 4DCQB 3BGAA 1I3MA 2GF2A 4K3UA 5L9DL 2ZPUA 3FYPA 1RY7B 1SIWA 1TQCB 1Q0HA 2XBLA 4MWCA 4ZCPA 4BQ5A 2XUKA 5A4FS 3O11B 4KIEA 2EYUA 3MWJA 3QWQB 1JAXA 1N2EA 4MP3A 4YAQB 1UJ3C 5EYPA 1N9GB 2PW2B 2V7PA 1E5VA 3ZCXA 1I1AB 1FCVA 1CUXA 3MSPA 4BWGA 2ZZMA 5SWZB 1DBQA 1QYGL 3VU0A 1S9WB 3FNEA 5LP6C 4P7RA 4DWHA 2QU8A 2ZA3A 4E9VA 1C92A 1VQ1A 5EBMB 1PTDA 1B6RA 2EX0A 2WHRA 4QQ8A 3RVVD 4D0CB 4D0BA 1WZ1H 2ZUMA 1J1PH 1Z6KA 3UPAA 3QXWA 3ARFD 3U9LA 3AY3A 2H2HA 5FYDA 4ETQA 5HR7A 1DUZA 2XNAA 4JDZB 4HJGA 1R3LA 5CCJA 3MRRA 2PP9A 2E49A 4YMLA 5BZWB 2XNDD 4J2OA 2DP3A 1U8PB 1KY4A 1E6NA 2BSLA 5A3JA 1GW0A 3HMWL 4JX5A 5P8WA 1ENPA 3TESA 4G24A 2V5KA 2DI8A 2MSCB 4FHFA 2JH2A 4A6YH 2PCYA 4LOUD 4NOLA 1ZBVA 1V5XA 3KBPA 2HHHB 12E8L 1Z6TA 7PCYA 3GMIA 3MJ8B 2ONKA 4F21A 4CIDA 2G9ZA 1WBJA 4C0HA 4MJMA 3R9IA 2EGUA 4RFSB 4KXCA 1JPDX 2H1WA 3RITA 2AL7A 3PXEA 5IB3B 2VXUL 1ILSA 5SWSB 4RGBA 5C0QA 4D0BB 2UY2A 1C9SA 3BAEH 4WMLA 1XGUB 4E7PA 2JALA 3AU1A 1OAZL 4YDRA 1A7NL 3L7BA 4HYVA 2WUDA 1G9MH 4JDBA 2UYOA 1MBZA 4F5EA 1S5HA 1NGWA 4J6EA 1A27A 3M17A 4YDJA 3QDGD 1YLVA 1R5OA 4J43A 3DC8A 4ALDA 4ZVNA 1UXSB 3TQIA 1TA0A 4GLOA 2H2PC 2XRMA 5GONF 1WQ4A 3V4VB 2JNZA 2CBVA 1X7XB 1AZSC 2G88A 3OWRA 4HK5A 1W9UA 5FPIA 2XMSA 5DJCA 2QUNA 4PA8A 2BHZA 2EJCA 2WC3A 3HO6A 5AOUA 1JEYB 3STVA 2GY5A 1PZ1A 4ZUSA 1G7QB 1RQPA 1TX4B 1I9CB 3HG4A 2FPTA 4HGXA 3USCS 1N5KA 4BFWA 4OHZA 3STEA 5HJ5A 3ORSA 3BPOC 4NM4H 1AS7A 4JR1A 1XVIA 3PC8A 3VOCA 4GM1A 5JHDB 5LDGA 2GWRA 4O51B 2I14A 3TLMA 4PVLA 4BJ1A 1OVZA 4W9MC 4BEBA 5DMIL 1CLKA 4P5EA 1F17A 3ZHOA 4HJGB 2VO8A 5FYLH 2OBMA 3CKKA 5HDQH 4RF4A 2EF1A 5SWZD 2QRZA 4AK9A 3WSQL 3LG3A 4JKPH 4JQ3A 2YVLA 5FA6A 2HG5A 3QNWA 1YL6A 3QJSB 4JFOB 1LLDA 4KRGA 3LB0A 1QQ7A 3BD8A 3UG7A 1TYZA 1KBIA 4FDTA 3IUNA 4DV5B 1PYFA 1J5DA 4Q4IA 1ODUA 5L9AA 4S2CA 5HJ3B 4FZ3A 4NQDB 2HXSA 5TF1H 1XIFA 1I7QB 3ARFB 4GYKA 5G5DA 1Y8RB 5FI8A 2ZJAA 1TZAA 2BP0B 5AXCA 4WI5A 2IQIA 3AR2A 3VDRA 3ORWA 2HWZL 5FTNA 3IVCA 1LTHR 4I0PA 4N12A 5DNWA 4E5UA 3DSRA 1BKSA 4AJLA 1JLKA 3Q2KA 3OV6A 4XCYA 1LPSA 5AKJA 1IC4H 4PJCA 2C2KA 2PRYA 3MMWA 1O7DC 1FY2A 4JX8A 5GJWC 2G5GX 1OC2A 5HDRA 4BQQA 3MJ9L 3ZW8A 3NZUA 1H66A 1KO0A 1M2OB 3FW1A 4C6HA 1BYUA 2F19L 2SCUB 1ZG3A 3TYEA 2GSMB 5LIXX 4EI6A 1KTLB 1BCSB 3JPYA 4P3WA 4X7TB 4K3EH 1A02N 2OFPA 3OIUA 1FA9A 3L5XL 5FL0A 4FKMA 4Q3BA 4CQCA 3D47A 1BP3B 3KLAA 2J7KA 1OYVA 4IT1A 2FYTA 1A9XA 3TIDA 1W72A 2BW5A 4Z95H 5AW2A 2VBIA 5D5MA 3UWUA 1H69A 4U6YB 3STFA 2BSDA 1N7HA 4Q8PA 5B3SB 1H7PA 3OX2A 4OLBA 4QOHA 1AL8A 3WYRA 4TSBH 3I4EA 3WICA 3OLXA 1OK6A 1HYBA 3GG2A 2OJPA 3QR2A 3O0FA 4FM9A 3NI2A 3MGKA 3RY6C 4BQBA 1J01A 3WFAA 4H7HA 1HG0A 15C8H 4RZ5A 3M4ZA 4GYJA 1Q0UA 2WQ7A 4ZCQA 3QFJB 1K8IB 1N67A 2MSPA 3CYVA 1NNI1 5JW5B 1YT5A 3UYIA 4JGDA 2EXYC 3TWCH 4G8TA 1YOVB 2AX4A 3CQ9A 3KFXA 1VE1A 1T2QL 3ICJA 1E8ZA 2GCYB 4DP2X 4Z2YA 2JFCA 1FDIA 3ZHXA 4B6JA 4TWZA 2V0AA 4G8EB 4Z3JA 1ZBQA 1V8OA 1HSBB 1P7TB 3VFWB 2ZNWA 4YDKH 2O9OA 5FOVA 5JUWA 5DX0A 5LNUA 4AURA 4KGJA 5E23A 2PH3A