4UOQA

Nucleophile mutant (e324a) of beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
689
structure length
683
Chain Sequence
b'HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMAQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-GALACTOSIDASE
publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
molecule tags Hydrolase
total genus 241
structure length 683
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uoqA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uoqA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uoqA02
1K6AA 1QNOA 3VKKA 1JFXA 4J3XA 4OGZA 5SY4A 3SF8A 4UFKA 4B3LA 5A6JA 4D6CA 2QPUA 5ABGA 1DWAM 3UK7A 4JIEA 3RJYA 4K2HA 2D3NA 2OW7A 1MVYA 2F7OA 3OA5A 3CUGA 3WF2A 3AYSA 1JYNA 4N0RA 1R7AA 4PTWA 3WQ4A 2VX4A 3FN9A 1E0VA 4CD7A 3POCA 5I6SA 4Y1EA 2QLYA 1E56A 2EPNA 3AIVA 4M1RA 1G1YA 8CGTA 2CEQA 1W2PA 2FDMA 2BY3A 3MUIA 3ARZA 3NJ3A 3I3BA 4L8YA 3BC9A 4AC1X 4JCMA 3VMOA 4J3SA 2D22A 4L8FA 3CMGA 3F5JA 5CPTA 3SCWA 1FY2A 2VXOA 5D9PA 3CZ9A 1R46A 5A3HA 1I1XA 3BVWA 4P7QA 2XWDA 3S5YA 1JVNA 2VZUA 2ZOXA 2WLZA 1L0PA 2CHOA 3OT1B 3A4WA 1XSJA 1JZ8A 4AEFA 3TP4A 4ZENA 2YL8A 3AYRA 3G6MA 4QYXA 5IHRA 1OSEA 2F7PA 4Y1GA 1C92A 3NORA 4RE2A 3PZVA 2PC8A 2JFEX 3ZR5A 1JAKA 3T0BA 4GE0A 3QOMA 1BGGA 3AFBA 2QMKA 1UZ1A 1QNRA 2CCRA 1CEOA 4GZJA 2EO7A 4R5EA 5A2CA 4RKYA 1J0JA 1B3WA 4BQ3A 2WB5A 3K8LA 1VF8A 2XVKA 2WCSA 1U33A 2JE8A 4B2YA 1KCLA 3GBDA 5EB8A 1JF6A 4PUEA 2IXVA 1E6NA 2VX6A 1TQTA 2ZIDA 1O7AA 3AIUA 1M03A 1B3VA 5LA1A 4HMCA 3ZR4B 1CXEA 2C8NA 1GPWB 4FNRA 3WEZA 5A8MA 2DPEA 4Y1FA 4KRUA 1N57A 1A47A 2BXYA 4A3YA 3KZSA 1H4PA 2J79A 4XZWA 1ITCA 2O9OA 1Z32X 5E09A 4CD4A 3BUDA 3BUPA 3WDIA 5JBDA 3WBAA 1CS0B 4QLJA 3BAXA 2W61A 4AZ7A 3PZQA 1WDPA 2J25A 2W4XA 5E1QA 3BUQA 4AUNA 2V3DA 3UR7A 4ACZB 5ABFA 3WL1A 1VJSA 1DWFM 1UH4A 1DWIM 1E5JA 1GOIA 2JALA 3CZJA 3AS2A 3ZIZA 4AWEA 1BLIA 1FH7A 2XVPA 4YN5A 1WB0A 2ZICA 3CTTA 1GQJA 4XV0A 4RKWA 4P2GA 1UD8A 5IFTA 3H53A 1E1FA 1I75A 1FFQA 1HNYA 3AHVA 2J7DA 3TTQA 2VOTA 4UFHA 5A8PA 2ZE0A 3GBEA 4B5KA 1C30B 1UWSA 1LJYA 2G3NA 2WMIA 2EQDA 2VZOA 5E0CA 1X6NA 2ZUSA 3EBVA 1W1TA 3S2CA 4IPLA 4D6EA 1XV8A 4CCDA 2D24A 4CN1A 3N18A 1KTCA 5A1AA 1QI4A 3WEMA 1CXFA 1HKJA 4F9DA 1EQCA 3WY3A 2WBKA 1GVYA 1BSIA 3VO0A 2R1TB 3MU7A 2J62A 3FW6A 3WF1A 4H8HA 1CGVA 3SCRA 3EWNA 1US2A 1SR0A 1EO7A 3WN6A 3ZT6A 4B9ZA 3UMMA 4P34A 1OWQA 3WMSA 1NWRA 1QNQA 4ATLA 2MANA 3D4ZA 3SCSA 2Z1SA 3IAPA 1AVAA 2NV0A 1QHZA 3AHYA 2BHUA 1C90A 2XHYA 4MJ2A 1GJWA 2PF0A 3SCOA 1TA3B 1TQVA 3BLBA 1J11A 1JAEA 1BF2A 2C0HA 3ZMRA 2CBIA 1NWSA 2VZTA 2A3AA 2D23A 4I2NA 1CLXA 3L4TA 1KB3A 3CC1A 4IPNB 3N7TA 3TTTA 4FLSA 1ISXA 1IV8A 1B90A 3A21A 5E6ZA 1EDTA 1KWKA 1UR1A 1H49A 4C7FA 3VX0A 2O92A 3D54D 4NZJA 2ZWYA 1KXHA 1L8NA 4V2XA 5FD0A 3BMVA 2VTFA 1S46A 1BYCA 2OWWA 1EXPA 1J0KA 3OGRA 1CXIA 2IXUA 1JNEA 2XVNA 3DC0A 1ONSA 2J7GA 1K9DA 4WKAA 2HVMA 4BIMA 3RO8A 1C8QA 1QVZA 4ZGGA 1R75A 5CLTA 1UWTA 1UH2A 4WSKA 1WZMA 4PMVA 4NXKA 3CUHA 3CHDA 2YL9A 1ZL1A 3ARRA 4AD0A 5CSUA 4TOQA 3WF3A 3DX1A 4QLKA 4FLQA 2G3JA 3WUFA 3HG4A 3GXFA 3RM4A 2XIIA 1W3KA 1HXJA 1FA2A 2E9MA 2Y8KA 2V4UA 1V6YA 1H1NA 3EZGA 1WPCA 2WVSA 1B30A 3EMQA 3CY6A 5A6LA 3PZIA 3LXAA 1NOUA 3SUTA 2WAGA 1TE1A 5AC4A 1I1QB 1CYGA 4AD5A 2WC4A 1PV2A 3NDZA 3VIMA 4JKKA 1QVWA 4NX0A 1VJZA 5BCAA 2WSPA 3VNZA 3GNRA 1W2VA 3OBAA 2XUCA 2WKLA 2CBVA 1JZ6A 1BG4A 2DT1A 3MMDA 1PAMA 3I3DA 2VMFA 1EHNA 1ZBKA 4GQRA 3VTRA 1PIFA 1OBAA 1BHGA 4MB5A 3WD4A 4HCJA 3AXXA 4U2ZA 2ZUTA 3NSXA 1CXKA 3VU3A 2UWFA 1P5FA 1TVPA 2G41A 3IJ8A 3BAJA 3W29A 2WVUA 5CGMA 1OGGA 4MPKA 1KA9H 3PTMA 2F2HA 2UY4A 4GO9A 1UG6A 3OGVA 3ARTA 3FAWA 2AAAA 2J8GA 3M6DA 2W66A 1HIZA 3VIFA 3F4VA 5HPCA 5A2BA 4MAVA 1C93A 2F1BA 3L4UA 4UQBA 2W7TA 1HF6A 3GYCA 2FHBA 2ZX7A 7TAAA 2EPOA 4LXFA 2V3EA 1WDSA 3KKLA 2ESCA 1JZ2A 4LQ1A 1V0KA 3DDFA 3QR3A 3WD3A 4S3KA 3WD1A 3VSUA 4JFTA 4HU0A 2JIEA 3CLWA 4CU7A 2Z1KA 1CNVA 3A4AA 4PMXA 1HT6A 4E08A 1ITXA 5F7UA 3SCTA 3CZKA 3W53A 1JF5A 2RK4A 3WNOA 3MIIA 3WEOA 2XFFA 1EDGA 2YDQA 2GJXA 3OLIA 2W5FA 4OOZA 1P7ZA 4PMZA 4U31A 5E6YA 4Q7NA 4W89A 1KBKA 1J12A 3HG3A 3ZR6A 1WL8A 1GQLA 1PZ2A 3OGSA 1UASA 3MSGA 3BLPX 1VBRA 1VRXA 1JI1A 3BAYA 4UQEA 3CHEA 4YPJA 4OOUA 1ZJBA 2CKSA 5A6BA 1QHOA 3M7SA 1UD3A 2OSXA 4AEEA 4PXYA 1UHVA 2R1UA 3IK2A 1KR1A 3DX2A 2WC7A 2BXZA 2OWXA 2J7BA 2XPKA 3BCDA 3MV01 3PBGA 5A6BD 1CBGA 1CPUA 2DT2A 2OYLA 5D9OA 4W7VA 1H41A 4E2OA 1HTYA 5ECUA 5LA0A 1K9TA 1E4LA 2E8YA 3BWEA 2B31A 4B3KA 3CUFA 2WWDA 4RE3A 1UCFA 1GGKA 2DQXA 5A8QA 4CD6A 1V08A 1OT2A 3NVAA 3D52A 2FHCA 5I79A 1OX5A 4BQ2A 1JDCA 6TAAA 2WPGA 1LL4A 2X8RA 3QOKA 1X6LA 1ZBVA 1M6VB 3OZOA 1DWGM 3SF8B 4CD8A 3NOOA 2GVYA 4BA0A 1UYQA 3U7VA 1AQHA 2WZIA 1JZ4A 2YWCA 5DO8A 1V6UA 1E40A 2Y2WA 3T08A 1PX3A 3AJ7A 2Y4SA 4RL3A 2E0PA 2WVTA 2EJ1A 3AQUA 5BXTA 3CZEA 4OIFA 5EMYA 3NYDA 4ENPA 3AS3A 3AIWA 4Q22A 3LPGA 3VU2A 3EJRA 1T36B 4MNMA 3EDFA 5CQ1A 5I23A 2PWEA 1KTBA 4W8LA 4W8BA 4MNLA 4NI3A 2NV2B 1T0OA 3AICA 5SY9A 4AD3A 4TTGA 2X0YA 2WVVA 3A24A 3D51A 3ARYA 5CPQA 1QOXA 1KXJA 4MNJA 3WDPP 2D0GA 1DWJM 4DM1A 3L4EA 1CGWA 5D8WA 3M3PA 4B40A 3BMWA 3K46A 1KGXA 3VGDA 4N42A 2OSWA 1WZLA 4WXYB 4KMQA 3SCUA 1B2YA 1GHSA 1W3HA 2GFTA 4ENWA 1M01A 4WF7A 1AQ0A 1DP0A 3OB8A 3FAXA 5SYAA 1BVZA 3U7BA 5A6AA 1NP0A 1GGJA 5D9MA 4UNIA 4EKJA 4Z2GA 3PQ4A 1IPHA 1MQQA 2VPIA 4E8DA 1LLOA 5JBEA 5A6KA 3BSGA 2JEQA 2WMGA 4OJYA 1LL7A 1J18A 4AMCA 3SUVA 4CUCA 3PQ5A 4H41A 4ML4A 2PWGA 5M03A 1J9YA 4F9JA 1QF7A 3RJXA 9CGTA 1Q6EA 3AHTA 1LG1A 1VEOA 4AZIA 2CKRA 3WY1A 1UR9A 2Y8VA 3BVXA 1QNPA 1O6IA 1NOFA 3WIJA 2ZX5A 5AY7A 4JFWA 5ABFB 2IUFA 4LPCA 1GQIA 4ZE5A 5FCZA 1NWUA 1OY1A 1R7OA 5M3WA 1CGYA 1JD9A 1BTCA 4QLLA 1R8LA 5GPRA 1E72M 2CESA 3SUUA 3U57A 1W9UA 5HNNA 5ABHA 3AZRA 4Y1RA 3W81A 2VX5A 3VD7A 4EK7A 4MDOA 3H54A 4HP5A 5I5RA 5C8BB 1XH2A 4HMDA 2VRQA 3WNPA 2X09A 3FY1A 2VR5A 2X2JA 2FH8A 1QBBA 2WMIB 1B3YA 3WUBA 4W93A 5HDRA 2GSJA 1B1YA 3CNEA 4GZIA 2YBUA 2VCCA 4PUDA 3WD2A 1UR0A 1NOWA 2RK3A 1JGIA 5I77A 3GXTA 5CXPA 4B31A 4DO4A 4W8AA 3APGA 4AIEA 3NCOA 4AZGA 2X1IA 4C7GA 4B15A 2J7EA 1Q7RA 2WZEA 1W91A 1IZYA 1XYZA 5DFAA 1OD8A 3UOWA 2NT1A 2VUYA 3MSDA 4AZ6A 1JDDA 1E0WA 2WHLA 1DHKA 4P8UA 3EJ6A 4L4PA 3BH4A 1R85A 3T0AA 3WSUA 1VFUA 3N9KA 2E9BA 3BHNA 1TQUA 4MNTA 3SOZA 3LRKA 2J74A 4CGTA 4B9YA 1CGUA 2BS9A 4ZXLA 1V3MA 3UGJA 1QDLB 2QV4A 3M46A 5A8NA 2WLYA 4IISA 2V38A 5DT7A 4LYPA 4X0VA 2ZUMA 1BVNP 3PZNA 1PEZA 4L78A 4L95C 2WCAA 1V6VA 4EANA 4PCTA 1UKPA 3EDEA 3T2PA 1UD5A 2DIEA 1E4MM 4DWSA 2D0HA 5JUVA 1EA9C 4NSBA 1KR0A 2FHFA 1J0HA 1E15A 3G6LA 1E0XA 3ALGA 5BWFA 2CXGA 4X9YA 4HU8A 2EACA 4HA3A 3SCVA 4DWSD 7CGTA 4ENVA 3FSEA 2WNWA 2WC3A 3EFEA 1IZJA 1V0LA 1W1VA 5D8ZA 1XSIA 2YWJA 1B31A 3W6MA 2Y5EA 1SMAA 3CZAA 2FGLA 3BAIA 4BS0A 2XIBA 4JZ5A 4J3VA 3WNKA 4R7GA 1MW1A 4TTUA 4D6JA 2ZXQA 3K8KA 2F7QA 1KBBA 1K9FA 3HN3A 3J7HA 3AMGA 3AXHA 2JF6A 2OWCA 2E9LA 1G0CA 3WDRA 1V3KA 4NXSA 1I1WA 2WCGA 4KGJA 3CPUA 4BQ5A 4NRSA 1S1MA 3SCPA 4JKMA 1L9XA 2A3EA 1ODZA 4C7DA 1OINA 3OIHA 1C8XA 2A3HA 3WNLA 2DH3A 3KEHA 1VB9A 4M80A 3VILA 3L7NA 4ENQA 2XTKA 1HN1A 3BAKA 2H2WA 1G9HA 2WSKA 4FNQA 2XVGA 3LX9A 2PWHA 1QWNA 2WBGA 1QI2A 3W6LA 1I7SB 2TAAA 4J28A 1KGWA 3B36A 2ALWA 1B3XA 3AXIA 4JCLA 4HA1A 3P9SA 3B3AA 2YA2A 4RE4A 4P36A 1E3XA 3W24A 3GNOA 4KGLA 2FH6A 3BCFA 1XCXA 3N12A 4ADSG 4Z2HA 1VHQA 3VSVA 1VFOA 2AOSA 4MTVA 4NRRA 4OFWA 2ZUVA 1ODUA 3W4RA 3UERA 4LRUA 3I3EA 4MTCA 1OX4A 3B9DA 1YQ2A 2XSAA 4UFJA 1XH0A 2E4TA 1CE8B 2VI0A 1UD2A 2BY2A 3ZQ9A 1T3TA 1QVBA 3VNYA 3O9NA 2E3ZA 2XVLA 1JD7A 4DUXA 4HOWA 4PMNA 2VURA 1HP5A 4CVWA 4M29A 3L4WA 7A3HA 1TUXA 2J8FA 2X2YA 1BAGA 1G01A 5CGTA 1XYFA 2GJXB 2W63A 5CG0A 2V3GA 4YHGA 3RHTA 1ISYA 4MJ4A 3A5VA 2E40A 1TZ7A 2CERA 1J0IA 3BUIA 2NW0A 3NOVA 1IZZA 1HVXA 4TVUA 4ACYA 2EPMX 1HL8A 5HXMA 2FEXA 4P8VA 1V02A 4ZDKA 3TV8A 2DT3A 3MUY1 3ARQA 3F5LA 4I46A 1HWWA 4H8UA 2ZUUA 2E8ZA 3IANA 3VX1A 1MQRA 4ATWA 4FLOA 3ARXA 1B0IA 2VX7A 4L7QA 3TONA 2VCBA 4GPNA 4ZFMA 1GPFA 2OLHA 2X05A 1NP2A 2GK3A 3A4XA 1Q2UA 3W0KA 1EIBA 2YKKA 5ABEA 1E55A 1GG9A 2D3LA 2FYVA 1KCKA 4UFLA 3WQWA 4LYQA 3B38A 2A3BA 3VM7A 4Y7EA 1LF1A 4AZCA 1QW9A 2YIHA 1R34A 2BVDA 4CN4A 3ZJ4A 2YOCA 1E5NA 3L2MA 1W3JA 2J47A 2DSWA 1KQYA 1GGHA 1RD6A 3WDHA 3OLGA 2W62A 1TCMA 2DEPA 1E6QM 3CO4A 1UKTA 1CWYA 3CYFA 4UQAA 2XG9A 1CF9A 3GXNA 3W28A 1CXLA 2X0HA 1KXTA 3EDDA 5JZOA 4DUVA 4TX8A 3UR8A 2BHZA 4TVDA 1R9GA 1GUVA 1SFSA 3ARSA 1DEDA 4CVUA 4UR9A 5FIPA 2EABA 4HZ7A 5JZMA 2YLLA 3SUWA 2XN1A 1M53A 4FNSA 2AMGA 2G4FA 1PBGA 1UH3A 4PSRA 4DM2A 4MB1A 2EPKX 2X2IA 3RIKA 1V6XA 4UFIA 3WY2A 2BY0A 1NQ6A 1GONA 4OBRA 3PQ3A 3BVUA 1FYEA 1A3HA 3CUJA 2J7FA 3MMUA 2EEXA 3VDAA 1HX0A 2WMHA 1HKKA 5FL0A 4JL1A 4MDPA 1XCWA 2XM1A 3F5KA 2O9PA 2NSXA 3UG4A 3FHQA 1G94A 4CKQA 4MGHA 1M7XA 2O9RA 2UY5A 3VIJA 4BCEA 4UTFA 1GGEA 2WVVB 1NWTA 2UY3A 1FHDA 2D1ZA 1I7QB 1KEEB 2XN2A 4WIWA 4OZOA 2J7HA 1TQSA 3MUAA 2J77A 3AMCA 4GE3A 4U3AA 2WJZB 1D2KA 3AIQA 3VIGA 2LXNA 4HOZA 2ZWZA 1H5VA 1WNOA 1LG2A 3ALFA 4F8XA 4XZBA 3GH4A 1PJ9A 5A95A 3WBEA 3DHPA 2WMKA 4OGGA 1QHPA 4UQCA 1UR2A 2W67A 1UD6A 1C3FA 4M24A 1GCYA 1EHAA 3ZJ6A 1V3JA 4FMVA 4PTMA 3MUZ1 1LWHA 4LYRA 3VVGA 1GOMA 1GOOA 5LIRA 3HMCA 3OLEA 3THDA 1GZJA 5D9NA 3SURA 2WKGA 2AB0A 1GOQA 1MXDA 1DWHM 1CTNA 3L4XA 4L4OA 2A3CA 3GTNA 5IP5A 1J10A 2F8QA 5C70A 4HOXA 4HA4A 1Q4NX 2CHNA 1RP9A 2YFNA 4ZDJA 1QI5A 4AYSA 1EO5A 4WKFA 1W3LA 3EJSA 4GI9A 2YL5A 5DF0A 1CZ1A 3NDYA 4GI6A 3AIBA 4XX6A 5LA2A 1ZS2A 3NSNA 2VRNA 3ZJ5A 1Q6CA 4E5VA 1E4NA 4TUFA 4WSJA 1MW3A 1GNXA 4Y1RB 2FE0A 3L3BA 2ZXBA 1DTUA 3B9EA 1OM0A 2ZX8A 2DSUA 3EJTA 3L18A 3WD0A 3SIMA 4EAMA 3T09A 1QWUA 4MAZA 3VD4A 4GI8A 1Q6GA 4JFUA 4AULA 1P7YA 1B3ZA 2WK2A 1R47A 1PPIA 2PI6A 4J3UA 3D5HA 3K4AA 3WDJA 4AY1A 1WO2A 1OD0A 1V3HA 2IUZA 4TVCA 1W9PA 1ESWA 3BLKA 4XUYA 2RK6A 4PMYA 1GGFA 2HISA 2QMJA 3K1DA 3AMLA 4FF5A 1OGBA 1VEMA 2ZUWA 1EH9A 4U5IA 4WKHA 1HKMA 1X1NA 2XFYA 2D7JA 3D50A 3KLLA 3LRMA 1PX8A 4TXEA 1XC6A 3LXCA 3S6TA 3CGTA 4P7LA 2C7FA 3CHCA 3L4YA 3CZLA 3AHZA 3AI0A 1BYAA 2PWFA 3L4VA 3FIJA 4S0ZA 3LXBA 1VAHA 2VC9A 4JHOA 3EDKA 2CYGA 3WFLA 1GORA 1JIBA 2OW6A 3HU7A 1R86A 4NF7A 2EPLX 4M56A 3BAWA 1JXJA 1W9DM 5M5DA 3CZSA 1WKYA 2CBUA 2AD5A 4AD2A 4Z2KA 3HZ3A 3VDHA 4AIOA 6CGTA 3CUIA 3U5UA 3UG5A 2OSYA 3PZ9A 3PZTA 4JFVA 3ZSSA 3AS1A 5GNZA 3WNNA 3KLKA 2RGMA 5FKYA 3WKZA 3SCNA 5FOOA 1MFVA 5JBFA 1CLVA 5CSYA 3MI6A 1BG9A 4N12A 4DWSB 4P8WA 4Z2IA 2ZUNA 3CHFA 2CBJA 3EDJA 3LPPA 1ZBWA 4AUMA 5BRPA 1E73M 3OLDA 1P6WA 4D72A 3MS8A 1H0IA 3WH9A 4N0MA 5GNXA 1UD4A 3VD3A 3N15A 3TA9A 3EJPA 3NIYA 4J7RA 2VO5A 1G2IA 1JI2A 3FXYA 1QW8A 5EFFA 4AZ5A 2F1AA 1GPMA 3VIPA 3QGVA 4UQ9A 5HPOA 3CH9A 2ISSD 3MGKA 3AROA 1OB0A 2XJ7A 3R76A 4QYTA 1VENA 6A3HA 2XYLA 1W1YA 1EGZA 1ISZA 2GK1A 5A69A 4QAWA 4CCCA 4HTYA 2VRKA 3W82A 3RCNA 4AZHA 3K4DA 4LX4A 4W84A 3WQ8A 4R27A 2V3FA 4P7NA 3GM8A 2GJRA 4AW7A 2XFRA 5I24A 2CPUA 2XN0A 1XSKA 4HPHA 2WYSA 4AYGA 1TVNA 3GNPA 1CGTA 4D71A 2ZX6A 3ZSTA 1UKQA 1ZB5A 1TMQA 3L4ZA 3DYOA 5GQBA 4CN6A 4OGFA 3CZNA 3ER6A 1WAWA 2XGIA 2YL6A 3BGAA 3VGFA 1BYBA 5I2UA 2ZXDA 3LMYA 4ATDA 2DT0A 5JIPA 3GDBA 4M82A 1VCMA 3UEQA 4F66A 3OG2A 1H0GA 3HG2A 5E70A 4W7WA 2J4GA 2BV9A 4PRWA 3F5DA 3VD5A 1JYVA 3W38A 1NH6A 2D73A 1H2JA 3FHAA 4CU6A 1PS3A 5IHSA 1HJXA 1GJUA 4W85A 3ZT7A 1V02E 3L2LA 4KRTA 5C71A 2XF2A 3GXPA 4WK9A 1XD1A 4UQDA 3BSHA 2EBNA 3W25A 1E71M 2R1VA 4J27A 5KEZA 4TX6A 1UKOA 3WH8A 2VR4A 1OX4B 1E6ZA 4K68A 4J3TA 2V5DA 2DDXA 3ZJKA 3F71A 3W27A 3R75A 2VT0A 4MB3A 1C7SA 3TTSA 5DT5A 2PB1A 3RPMA 3IGUA 2WXDM 5IDIA 3VGGA 3A23A 2VQTA 1UA3A 4AD4A 3TTOA 4IUGA 2ZX9A 3UESA 2VL4A 1WZAA 1E43A 1FH9A 4AXNA 1MW2A 4D6FA 4CU8A 3TTVA 3PQ8A 4W87A 4URIA 1GQKA 1QI3A 1LWJA 1KWGA 1FP9A 5E0FA 4WINA 3DX0A 4DWSC 4QP0A 2WHJA 3IJ7A 5BXPA 1GHRA 2XSBA 2YDSA 2GDVA 1CXHA 1F4AA 4X0NA 2VCAA 2GJPA 3P9RA 2J78A 4GZEA 3WENA 3HG5A 1HJUA 2PBOA 3VUPA 2D2OA 3ARWA 3VM5A 1E6PA 4PMQA 1QX1A 4HZ6A 1QI0A 3N11A 3RM8A 3ZJ8A 3T2QA 3T2OA 3II1A 3GXDA 4GO8A 3ZJ7A 1JDBC 4AZCB 4D6GA 3AIEA 1PIGA 5CJ5A 3BVVA 2YJQA 1FP8A 3B8SA 4BQ4A 3THCA 4U3CA 4E8CA 4P5PA 4D6DA 3HJEA 2ZXAA 5GNYA 2FGZA 2WANA 3DX3A 2D0FA 3VSTA 4EE9A 1EQPA 3BVTA 3PTQA 1E6RA 4OKDA 2J7CA 2WZHA 2F61A 1C91A 2X2HA 4QDMA 1GW1A 1UA7A 1OIMA 4AMWA 1JNDA 1CENA 4BFLA 3LPOA 2EAEA 4BF7A 4WJXA 5I3DA 2GDUA 5KZ6A 2YWDA 3PQ7A 3EN0A 4P7RA 1ECEA 1OGSA 3WMCA 3WUEA 4ENTA 1PDWA 5EBAA 2OYKA 4M81A 1ISVA 2QF8A 1JZ5A 4FNUA 3N1AA 2QHAA 5AYBA 1W9VA 1HJQA 1R33A 4ZXOA 1ZU8A 1V6WA 2BVTA 1JL8A 1HJSA 4ZDIA 3ARPA 3QHNA 4LGXA 1UQZA 4PN2A 2BNJA 5I0DA 2WMFA 4PYSA 4QCFA 3ARVA 4ENUA 2YA0A 3GRAA 2DGAA 4S3JA 3WQ5A 3PZMA 4F79A 1E6XM 1ISWA 1CGXA 1ZJAA 3O2LA 3VGEA 1JDAA 2F7RA 4GKLA 4MNKA 1W9BM 1OI4A 5SY6A 1FFRA 1WDQA 2CETA 3WFZA 3O6AA 1PX4A 1UWUA 4A3HA 1HVQA 3CV5A 1Y7VA 3QHMA 3ZM8A 3OT1A 1OIFA 3FNDA 3TQIA 5A94A 4ENSA 1C3OB 3NUKA 2G3IA 2WWCA 4L8WB 2DH2A 3DX4A 3B9AA 3DYMA 3N13A 4DO5A 2W91A 1WDRA 1E3ZA 1CDGA 2Y24A 1E70M 3A3HA 3VIOA 3S5ZA 1HL9A 1O7DC 2NT0A 1R87A 1JYWA 4J3WA 1XH1A 3WELA 5CPSA 3RMEA 1JZ7A 4ZE4A 1P81A 1SMDA 5DMYA 1QBAA 4FK9A 3VIHA 5DEZA 2BVYA 3VIIA 1T0BA 3TTYA 1EOMA 4W5ZA 4OBSA 1VEPA 2JEPA 1US3A 1E4IA 1OX6A 1QNSA 4AZBA 4MADA 2Q8XA 1JXKA 4PCSA 2VDJA 4V28A 2A9VA 3VGHA 1BFNA 1QVVA 4Z2JA 4LGYA 3CZGA 3A6OA 4H8VA 2WHMA 1UWIA 1FHLA 2WW5A 4B7AA 3VDBA 1PDVA 1HXKA 3IJ9A 2YBTA 3VMPA 3EYPA 4GUDA 4P35A 1B9ZA 5IFPA 1V3IA 2VZVA 1D7FA 4M8UA 1K9VF 4GIAA 3MV11 4KWUA 3RILA 3N04A 1G5AA 1TG7A 1E9LA 5BROA 2ABWA 4W88A 4ACZA 1JFHA 1GOKA 1N82A 8A3HA 2UY2A 1TR1A 3ARUA 1LL6A 1A9XB 3AOFA 4U33A 4HPGA 4H04A 3NONA 3NOQA 3VPLA 4U2YA 3WQ6A 3VGBA 1U30A 2F18A 2BHYA 2QPSA 1EOKA 1MFUA 1V03A 3W26A 3UG3A 1FOBA 4JQSA 4NZFA 1J0YA 3LPFA 3WQVA 5FL1A 4A4AA 1C8YA 3E1F1 1KQZA 2VNCA 1VCNA 4QFUA 3CIVA 4AIUA 1U2YA 2R1TA 3WL0A 3EJQA 2DSVA 3TOPA 4HZ8A 4ZEPA 3WNMA 1UUQA 2YLAA 3N17A 1SY7A 4Y0NA 1UZ4A 3VIKA 1UQYA 1MWOA 3MKKA 4UZSA 5HOSA 5I78A 1QPKA 1F4HA 2RGLA 4PTVA 3VDCA 3CBWA 1ZBCA 1V0NA 1UWRA 1TA3A 4XB3A 4AUEA 1HJWA 2YFOA 2VJXA 3ZOAA 3OZPA 3DHUA 4UZUA 3DDGA 1E1EA 4V27A 3VD9A 3NSMA 2PBGA 2VVNA 3BXWA 3VINA 1RH9A 2JF7A 5IXEA 4AISA 3D4YA 3UETA 1QWSA 1AQMA 1KXVA 4D1IA 5HBFA 3TTWA 3A22A 4GXPA 2IGTA 2GHRA 3ECQA 3MMWA 5A6SA 1E6SM 1RP8A 4D6HA 1J01A 1WCGA 4CD5A 5AC5A 5A2AA 1MXGA 5D4YA 2JIWA 3EJUA 4JL2A 4H7VA 3WUGA 3GXIA 5E9AA 3AZSA 2OR3A 3WF4A 2GK1B 4WLCA 4D1YA 4JKLA 4PSPA 4OQ4A 3ZT5A 4MB4A 3PZUA 1O1YA 3M07A 3AZTA 1WE5A 3H55A 3KL0A 1HJVA 1J0ZA 4FNTA 1MQPA 3PQ6A 2VKTA 1WP6A 1GVIA 3WF0A 3P9PA 4PMOA 4I4NA 1SZNA 1V3LA 2V5CA 1SOAA 5LYRA 3ZO9A 3KL5A 1NARA 2XM2A 3MANA 2G3MA 3LRLA 2G8ZA 3IAQA 3SEPA 2WHKA 4ENRA 2EADA 1YHTA 3GH5A 2CIPA 3WY4A 3EMZA 4HMEA 4P7OA 4W5UA 3WH7A 2DIJA 3DECA 1H11A 1JZ3A 2DSKA 4W7UA 4B16A 1V0MA 4PMDA 1KGUA 3VMNA 3VOCA 1BYDA 4UOZA 4PEEA 1C7TA 3AMDA 3SUSA 1FH8A 3R74A 4NZCA 1HKIA 2O9TA 4QCEA 2BY1A 3BUBA 2XGBA 2GUYA 3PHAA 3T0DA 4OUEA 3DYPA 4XLLA 1VFFA 2BFGA 4FNPA 5AYIA 1TFVA 4W86A 4PMUA 4GQQA 3POHA 5BYWA 5TD4A 4AD1A 5M17A 1VBUA 1RPKA 3AHXA 4JFSA 4DO6A 1JYXA 3PN8A 3P9QA 2R1VB 1UWQA 5BV2P 1CECA 3RDKA 3QHOA 2VZSA 1PZ3A 2WMJA 2YA1A 2D20A 1LQ0A 2XWEA 1IT0A 1KXQA 4AJ9A 3WMBA 5BXRA 1XGZA 4FLRA 1HP4A 4U5KA 2VRJA 1IZKA 1W9XA 5JIWA 3GXMA 2VVSA 1TQWA 3JUGA 1OT1A 3WH6A 4D1JA 5A8OA 3PZOA 1XHGA 3PZGA 1CIUA 1H3GA 3CZ8A 2CNCA 1AMYA 1EDQA 1MYRA 2WM0A 3CMJA 1VIWA 4JHZA 4UOQA 2VQUA 3U5YA 3K8MA 1W1PA 1OCQA 4D6IA 4E4PA 4H2CA 2W92A 1XRVA 2DSZA 3KWXA 1VFMA 3D3AA 4UCFA 3GZAA 4UFMA 3A47A 3TTUA 1MW0A 2EXOA 5BXSA 1UOKA 2CITA 5CLWA 3UCQA 4KH2A 5A6MA 1UR8A 1BPLB 1XD0A 1BGAA 1U9CA 5BRQA 1WZKA 3AS0A 4PBGA 1VCOA 3KL3A 1W32A 4Z2LA 3MO4A 4DUWA 3AMKA 1Q6FA 3TTXA 4IM4A 4PMRA 1KFWA 4YHEA 3EMCA 1P80A 1UKSA 3AIRA 4P8XA 1UR4A 4JAWA 3SCQA 1BQCA 5EFDA 4UOJA 3WDQA 2OYMA 3PTKA 3WH5A 5CZKA 1SYTA 1K9EA 3UJNA 5K4AA 1H09A 3PQ2A 4PTXA 1Q6DA 1GOWA 4CCEA 1NM9A 3RM9A 2J75A 1JG9A 1J42A 3GH7A 2YWBA 2PWDA 4BZYA 4BTEA 3AISA 4GINA 1PE0A 1D3CA 2YDRA 3KE0A 3W37A 1M04A 1BXRB 4AMXA
chains in the Genus database with same CATH superfamily
1DHPA 1QAPA 3TF7C 5BNKA 2W6JA 4U3SB 3FZGA 3RJ5A 1PTAA 2DJSA 1Z35A 3WIFA 1M6VA 4PJ8D 2XQ0A 4MR9A 4DCVA 2DFLA 4D6CA 3DZ8A 4HNVA 1D5BA 1XMWA 5CEZH 2VAJA 1FUEA 4OD2B 2C8KA 2G5RA 3ANVA 4F57H 1P0EA 1A9RA 1BS9A 4GRLD 1PQYA 1U92B 2HK7A 4LF7B 4EGCB 2X9WA 1E56A 2IF0A 1VLMA 5FIUA 5KETA 4M1RA 2D2FA 2Q4RA 4RETA 1WZUA 4PWGA 3NJ3A 3B2QA 2PR4L 4EB6B 3RX5A 3VC6A 3TO2B 5IFAL 4ADIA 2BDNL 3LVRE 2Q45A 1LK0A 3V6ZA 4ENLA 4FXRA 4M1OA 4NAVA 3N7AA 3JVDA 4MR7A 5A3HA 1XBXA 3BVWA 3RG2A 4BC1A 5JEEA 3FCEA 4H9XA 3OQHA 1XTBA 5ITFA 2IZZA 2CO1A 2FMIA 3Q2VA 3OIYA 4EI6A 2FPOA 4ZENA 5IVNA 4MNQD 4QYXA 5BXYA 3I1IA 1OVGA 5AB0A 1OG0A 3OTOB 4OK6A 3HFJA 1EA0A 4MPPA 4P5MB 2WJYA 3MLEA 2XZTA 3S27A 2WSLA 3ETHA 2ESVD 1T8XA 3FLBA 5FO7A 4K8RL 5EMJA 3PUIA 3TSBA 4DG8A 4BQ3A 1FW8A 4AEHL 2V5TA 3K8LA 2XH8A 2C2KA 1P5RA 1V0JA 5B7GA 1EB9A 4ZMBA 2WAMA 4PUEA 2VX6A 1NAIA 3CGWA 3QH3B 4B6PA 4YHKH 3K2QA 3RF7A 2C7OA 1AGEA 1M03A 3PQDA 3ZR4B 1H6AA 4P4KD 1GPWB 5E8OA 3MSXA 4RV9A 3ABZA 1RMQA 3ONDA 3KHTA 2GFHA 1T2CA 4HWGA 4ZP1A 3EC1A 2VH5H 5EF2A 3I74A 4QLJA 1OB2A 3BKML 2HMWA 5EQFA 4AMBA 2FGWH 5DK4A 4F8LA 1IQDB 1QYGL 2A6JB 5GRUL 2IVZA 3ZTWA 3L6EA 1M6UA 4PLKC 2X4TB 3H2QA 4Z4QA 1DQNA 2WN3A 4EARA 5K05A 4HNUA 4N0YL 2Y27A 3NVDA 1XRTA 3SO7A 3AHVA 3MCMA 1Q83A 2OMWA 4B5KA 3DX6B 5E8DH 1C30B 4FQ5A 4LY4A 1EJUC 3N76A 1X6NA 4N18A 2HG5A 1TTCA 4OQTH 4GP8B 4PGZA 5FGRA 3ZHBA 3W2DL 1GNLA 4RDHA 4APQD 3RUCA 3MC5A 1ZM7A 4MV9A 1HKJA 3P80A 1PGJA 4X5WA 2R1TB 4K9KA 3O9ZA 1J5PA 1MB0A 1FFDA 5T3XH 4XPHH 3Q0IA 5P21A 3MBIA 4RGND 3OM8A 3L9WA 2B4CL 1EBPA 2AVGA 2N42A 4GS7C 4P4SB 4TNEA 4Y2XA 3CXFA 4UJ3A 2VQ1A 2CUIA 4J75A 2JCWA 1YEHH 2PDAA 4H2DA 1TQVA 1UODA 4G97A 4PICA 2PD9A 3OCCA 2AEMA 4NQED 3OY7A 4DH2A 3L02A 3L4TA 4D9IA 1SVCP 4EJSB 2Q0HA 5EINA 1FH5H 3A21A 1VGAA 5E6ZA 2D7OA 2QL9A 3OHMA 1RZ7L 4EVSA 1W72L 4I1YA 1VE5A 1J5TA 3BP4B 4Y8VA 1DANT 4EABA 4MJLA 4JZJC 4HIHB 3RYHA 5FX3A 3GSWB 3N2LA 5F21B 2P0IA 2XVNA 2J7GA 4L4RA 4J3OC 2UZIR 4KXFB 3ULVE 5LJYH 3KDNA 1E1RA 4RPCA 4A0GA 2A1WL 3UWUA 5D5HA 4EIZC 3D6TB 3UMNA 1GR0A 1L1QA 3KR9A 1AD1A 3DVAA 3IJLA 1WTLA 2H7YA 1CG9A 3L16A 3F49S 3WF3A 3F64A 1ZENA 4PRAA 3EEFA 3SECA 1XZ8A 1DE6A 1DUZA 3CSTA 5EMKA 3W7QA 1AW2A 3RM4A 1KI4A 3QIWC 2LVEA 3NB0A 3WGKA 4HB4A 3CVOA 3RT9A 3FTGA 4YJ3B 3GSQA 3QO1B 4LCIL 3KHSA 3IE1A 1ZA2A 1DKUA 2OKCA 3G2QA 2D7MA 4BWVA 2DM7A 3UENA 4QXQA 2C4KA 2YAMA 2VF2A 3AILA 1WIOA 5JPNC 3DI2B 1ZN7A 1M5UA 2WCPA 4KKZA 2E6JA 2W0FB 5DUML 3S4TA 1P4JA 4OAOA 5B1AB 4V2CB 3F62A 2A94A 1BG4A 4II2A 4LYYA 2G97A 3D7LA 2ECFA 2G75B 3O3UN 5HRAA 4LHEA 3MLYL 5B8CC 3T78A 1U8UA 2K87A 3EOLA 2AFRA 3AXXA 4U2ZA 4P57A 5C7HA 5DN6A 2MMCA 3Q05A 1TVPA 2DVXA 1E60A 5CGMA 2P1DA 5F78A 3QOWA 3AVVA 5DNWA 1EGVA 4E2WA 2FX8H 1KU6A 1VBHA 3AXLA 1H0DA 2PM8A 5GJVC 5IBUB 5KTRA 5CEXB 2VSMB 4IM8A 2ZROA 3OKNA 3GFOA 2W6IA 4RR4A 2BSEA 2XN9A 2GOYA 4UPEA 5K0BA 3HCWA 3QOFA 2AKRB 1C93A 1UFRA 3EVAA 1EVKA 4OGXL 1NW3A 3F4NA 3UTSA 3DI1A 2EL9A 1AKJD 1Z4KA 4PJDA 2FHBA 1K6QH 3QVKA 4M62H 2XYQA 1ZSDA 4WUVA 2A7XA 3T7VA 3V0HA 3KJIA 4KCGA 2EXYD 1EO8H 5MEND 1DN0A 1QQDA 2CAKA 3RX9A 5J43A 3LRPA 2YCLA 5TQJA 3FIGA 4Q4RA 4GQIA 3IDUA 2E1PA 1GQOA 1OP4A 3NC0C 4WUUB 2ZZ1A 3NTRA 2NY4C 5DQDH 1P5UC 4PJ6A 4LV5B 1HXHA 1Z88A 3PDCA 4MYUA 2G8NA 3S0JA 4MR8B 1KTVA 2FPIA 3TFCA 3DG3A 2VHZA 2F53B 5IDYA 5IVZA 3BAEL 2WGNB 3OGSA 2OHOA 2QQ0A 3ATZA 3O3OB 1EMTL 1MLCB 3H2EA 4O5LH 2HBVA 4YRRA 1LJUA 3BAYA 5ADOL 2CVPA 4B53A 1P3JA 1QHOA 3U30B 1N8OE 4YMVA 2Y07L 1FCVA 3WIIH 2PVCA 5EU3A 2OJZH 4M37A 3DURA 1IBKB 3QXGA 4JYDA 1FRGH 4B90A 2NZJA 4IAOA 3ZZSA 1I4WA 4K6CA 3KLBA 2PUTA 1MDTA 3SDAA 1JDTA 2DT2A 2YZKA 3B4YA 4OXIA 4UTRA 2OYLA 1KM4A 2DICA 3BERA 3WLIA 3E74A 3A6LA 1W1ZA 2AC0A 4BE6A 1UCFA 5SYMA 5LAXB 2JLYA 2AJXH 1ABBA 1V08A 1Y6NR 4YRDA 5CINL 2R6FA 1K03A 1PNRA 1X80A 4HKJB 5HQ3B 3RVQA 5DI9A 3EYFB 4G43A 3ZC3A 2X10A 3OZWA 2IAND 4YBZA 4BA0A 1ZOSA 4RSGA 4JROA 2CUMA 1YCFA 1JZQA 2Z1DA 1SEQL 4XJSA 3GZ3A 2IQTA 3M82A 1TTFA 2R59A 5EORL 4UBIA 4YBQC 5GV7A 4RYLA 4LMBA 3UHAA 2YPVL 2NU6B 4N0DA 2C9VA 1KZHA 4G9PA 4XTRC 4PCLA 2ZUCA 4W7IA 5EMYA 1HUVA 1M6JA 2ZCUA 2FECL 4X95A 3VYRB 3D6NA 1SXJD 2ZWPA 1Z15A 2OMXA 1YJBA 2C3GA 5KNDD 3IU3B 121PA 5HGBA 3VI3B 2OR9L 1NOIA 4XX1E 2OO7A 5JW6A 1ADYA 2HRDA 2XUJA 5JW3H 2WU1A 1ZT1B 2QD3A 3G22A 2GPYA 4N42A 3INPA 2VZEA 2PU5A 2R2BB 1JQXA 3SDOA 1T04B 2IO5A 3CE1A 4H9UA 2AXGA 4DEPC 1BZ7A 3MV7D 2QB5A 1ZISA 1U8IA 2CJSA 3QYQA 3GGOA 1W31A 1ETZA 1ENZA 1IPHA 2ZUFA 2YFHA 1AHIA 2NW2B 1DSFL 2ZXEB 3QEGL 2OM2A 3DLPX 3P2MA 4WHMA 1NNI1 2QTBA 4DM4A 2WMGA 3H9HB 3VXRD 3KG5A 5J0BA 4C0BA 1WAEA 4I4TA 3W9EB 3ZPDA 4GXMA 3TEJA 3WSQH 4UU9B 3ISJA 4CR6A 4H9TA 4L4ZA 4IHKA 4G23A 5JT1A 3DOFA 3W1WA 4NBYB 3KH4A 4ZRGA 5DGCA 2Z91B 4AZWA 2PY6A 1L1FA 4RHEA 2F7FA 3IC5A 4DDHA 4LNVA 2P9BA 4FXKA 2EZ8A 3NMUF 1NL0L 4YRNA 4TKUA 2IT1A 5M3WA 3A9CA 1P7PA 1IAVA 2GC7C 1UAYA 2OMKA 4UMAA 4OJDH 2Q7OE 5MEQA 4O4YL 4G11A 4TQPA 5T9BG 4PGJA 3IK4A 1BIFA 1FYHB 3INNA 2W11A 2JBMA 5FX2A 1DBIA 2E6UX 1EP1A 5JRDS 4OUDA 3VD7A 4IDLA 3PDIB 1TCCA 1J5SA 3M49A 4G36A 1DYZA 1YMUA 2X9NA 1NBVH 1DZBA 3NESA 5HI5C 2DGDA 5F93C 2DQUL 3EPPA 3BMNA 1RAKA 5CLHA 2CGRH 1K92A 4W93A 2HMAA 4KVNL 3DX9A 3KAOA 2QORA 1X5ZA 1B3OA 3NIFF 2E5DA 4KQCA 5HS4A 1QFUH 1C41A 1J1XH 3K8QA 3IVKB 4K3JH 4UHKA 2Y1KA 3Q9LA 1NIEA 1TZBA 3BYYA 1SG0A 4EYSA 4BOYA 1B4JH 3HUJA 1W91A 3P1VA 1TPVA 3GSVA 2ZTSA 1AL7A 1RWVA 1OXBB 4XCNB 3C7CB 4MPRA 2V7BA 1NFAA 3K0BA 2B4KA 1JWAB 3L93A 4NCBA 1SFLA 4F11A 3D8NA 3L4KA 5T41A 1LX6A 1XAIA 4FQLL 5D7JD 5BN5A 4FC7A 3TZ6A 5A3QA 2CALA 3L0NA 3K92A 2P4AB 3FRHA 3BGDA 3M46A 4ZT2A 1IUOA 3CRMA 3KD4A 5D51S 2ZUDA 3MJ8A 3QLJA 2DWYA 3V4PL 2CHRA 3KWWA 3T3PE 2L0XA 5CSZB 4MINA 5LN1A 2C9AA 4NO2B 1GG0A 2VC2B 5KZDA 4TQTA 1W0YT 3FCXA 3WCYA 1RYEA 3E3HA 3ESNA 1FMCA 5JRZA 3ST7A 4FHCA 1XG4A 1SWVA 3NJRA 1KYAA 5LU9A 3HC3L 3FSEA 3ZL1A 1EP2A 3TL3A 2FT8A 4JA0A 2ZRFA 2GEFA 1AI1L 3X1BA 2FH5B 1AMUA 2R0KL 1EC8A 5DTIA 4DWDA 3CF2A 3U9PL 4EGAA 5F7WC 1K63A 4B4DA 3GPBA 1D2NA 3FQUA 3EB9A 3P1JA 4EKEA 1DAPA 4NVTA 3NBMA 3AW8A 3CW9A 3IDAA 3GEFA 5C5IA 3QOXA 5IQ9B 3SSOA 2GEKA 1OAUL 3BH6A 2R44A 1DKQA 1L9XA 1DBKL 3JTTA 3NAAH 1MHCB 5HANA 3G1XA 2HJGA 5HKKD 1L4GA 1L7OA 4FTVE 1CCWB 1R50A 5ANMA 2F74A 1HUQA 4Q6JA 1RJFA 5I1EL 4LS1A 4B5WA 2JIQA 5IHXA 2XVGA 4Z7AA 3H42B 5FV1L 4HWTA 3T5AA 3DRTB 1NLZA 3BIXA 5IANA 1I7SB 3LDVA 2IY8A 4D81A 2NU8B 1T1WB 4JNZA 4P36A 5INCB 1CDIA 5GQSA 3HI6L 3AUAA 1J49A 4AMGA 1CE6B 3W2KA 1N70A 4Z9AA 3VSVA 3CT6A 4MTVA 4DCJA 4OFWA 4X7BA 4WIQA 1TEHA 5K0ZA 2V63A 1Y3BE 1OX4A 3GFTA 5ENDA 5IY5B 4QVIA 3X1NA 4D3FA 4HZUB 1IJNA 1XF3B 5KOYA 3FONA 3DTVB 1D2RA 2Q1XA 5I1IL 1MCKA 5TE4H 1A5BA 2V0CA 4HEJA 3L4BC 4R9VA 2BUBA 3D5OF 3NCCB 1M66A 5H6HA 1K06A 1HP5A 2HU7A 3RX7A 4LLDA 5A7BA 4YRKA 4QJ3A 1EDOA 3KPUA 1RZUA 3S8WA 2J8FA 3DKIA 3RGTA 1KV8A 2P1ZA 4PIPA 1XUUA 1II0A 4JAMB 3GRCA 4ZXFA 2IV2X 3I61A 1L5KA 5I7RA 4B9IA 1MIEH 1DJWA 1T0IA 1OG6A 3CXDH 1ZIPA 4MZXA 1P5VA 4DQAA 1TZ7A 4OKNA 1SBTA 4KLCA 1JPKA 3B9OA 5HTOA 5CHNB 3WTWA 3WV0A 4ZTXA 2FEXA 1NUUA 1XLTA 1E6OL 4P84A 1O5KA 1GZGA 2PDKA 4MM1A 4DAIA 4E70A 2LDBA 3RVVD 3O1HB 2A1YA 1TR7A 2YJGA 5IW1A 4JP3A 4KPHL 3KZ8A 4J1UA 2G5PA 2Q6TA 3UXHA 4TPRL 4WQ6A 3I9AA 5D2YA 1VL2A 1B3BA 4UMFA 1RWMA 1N5MA 2XRYA 2YXOA 1KJ9A 2RGAA 3VXUD 1DEOA 2VIRB 3U0TB 2QVNA 3TGPA 2SODB 5C08E 1J2UA 5ENWA 4FQQA 2BVDA 5C3LD 5DSCB 4BP1A 4P3KA 4P5DA 5GGXA 2DSWA 3T0WA 3QEOA 4MW4A 4ZQKB 2FSVC 1WCQA 4DS3A 1CWVA 4EPYA 4XKJA 1E0JA 4TWRA 1KCWA 2EG5A 4UBPC 3HY4A 3O7UA 1R9MA 1K70A 3MV8B 1ELSA 3FDZB 5EU6D 3IS0X 1FYVA 1U95A 3AQZA 1I10A 2YLLA 4TYUA 1PSKH 5D03A 5BS0B 1J8VA 4M7JL 3RIKA 1SOSA 1QWKA 4ZZ2A 1OAZL 2ETVA 1Z48A 3O0KA 4OGLA 5HJXA 1BHSA 2OAGA 3QNYB 3OPQA 2QZZA 2NCEA 3U0BA 3U2SA 1HKKA 3FPCA 2I5GA 1L5YA 4KKCD 4KTEH 4JL1A 4MDPA 2IOQA 4BVEA 5FV4A 2XE4A 2VJOA 2NSQA 1ZZMA 4OBTA 1U2GA 3N5KA 2O9RA 1SHSA 1LLQA 2EKZA 1KT2A 4BCEA 4WCFC 3V0SA 3W5JA 5HHOE 5KJCA 1GCOA 3ARBB 2PWPA 2UY3A 2ZGVA 3CQ9A 1SJ9A 3DVLA 2ZC8A 5EDSA 2J7HA 1FQWA 4DLXA 3NEHA 1FSZA 1Y5LA 2J77A 1OYYA 2X19A 4PRZA 4B3FX 1WVGA 3GJEB 2B0CA 4JBNA 5BRNA 4UTWA 4F8XA 5JIMA 4ZT3A 2XZOA 3K0CC 1X7GA 2A3NA 1IH8A 3NV7A 4M00A 2W5UA 4EJSC 2C9BA 2XH2A 1H6BA 3PNKA 4BV8A 1F6YA 1R5IB 1KKLA 3QO0B 5DYGA 1QWHA 1IC7H 4O2BB 1KGJA 2IKIA 1BX2A 1FBTA 1KXVC 3RVTC 2I34A 1LWHA 1E6EA 4E5XA 3CIAA 3I1FA 4OJFL 4QHKJ 2B4GA 1IAQA 1FFXA 3U3ZA 4UQLA 4PWIA 2IUEA 2E59A 4CNIB 3VNBA 4CL3A 2ONJA 4HHGA 4FE4A 3TZKA 4XQEA 5L7TA 5D1XC 1D9KD 1Y63A 2YZMA 2YYAA 1UOVA 5DGQA 4Y9TA 1G9XA 2NYYC 4OM1L 1CFZA 2C5HA 2CM5A 1PD1A 3S8GB 1XQ4A 3PHCA 3PXDA 5DQPA 3WI9A 1ZO8A 3LIZA 4KHXH 2AEFA 5C7YA 1DTUA 1VCVA 1NXTA 3C7KA 3B9EA 4O33A 4XO4A 3GRWH 1G98A 1ZLWK 2QUMA 4GI8A 3T4WA 4A2WA 1P7YA 1ZGLA 5FPYA 3C8NA 3NABL 5M04A 4IBUA 1IGIH 4YDNA 4GY0A 1HFEL 3GIWA 3SC4A 1AUXA 3TINA 1TPC1 1THGA 3NRBA 3DM9B 5EUQB 4BFEA 5E08L 1CR9H 4X2PA 1LDPL 3FUTA 5AJXA 1GGFA 1ASPA 3Q43A 2VISA 1O2DA 2QIWA 3IAXA 3BYTA 1QO3B 4QUOA 2IK8A 4TXEA 4H20H 1FRVA 1COBA 3CGTA 4Q6IB 5I74C 2ZJ5A 3HPZA 3T9EA 2C5SA 3L4VA 3LTSA 3WNCA 1DQYA 3IQEA 3ZK0A 1BECA 3BUYB 1AO7B 3LQFA 4YHPB 1AH2A 1KBJA 3ZQJA 1WV1A 4OHXA 1TVDA 3KLDA 4QEKA 1AD0A 4JQIL 3STVA 3PJGA 1AK1A 4FT2A 3L8CA 3KFTA 1FAIH 3T7DA 4D46A 3C8HA 4CQMD 1A1OA 1CUHA 4J6RH 1SXQA 3VXTB 1ND6A 4GJTB 4AE1A 4WKPA 2PMFA 3U4BH 1KI9A 4GW3A 2VLJD 5TPWA 4N0UB 5HJBA 1H50A 4U5XA 3ESZA 3HJGA 5BRBA 1FRNA 2ZP9A 1CLVA 1LEHA 4HGRA 1YMVA 4LVNA 4D42A 2F8VA 3L3KA 2D7CA 4WNAB 2NY2C 1XEUA 3QJTB 1ZEAL 3EOUA 4L4TE 3CFEB 4LF8B 3E5RA 4ZB2A 2ZUNA 4X7PA 3X2QB 1X4XA 1LF0A 4DGQA 1A6AA 3D25A 3JTSB 1ZBWA 3GTTA 3BA1A 4YHLL 1CURA 1NN0A 3BRWD 3H13A 2ZAMA 3PWUB 1OYWA 2WVAA 2ZB8A 2BJHA 3NIYA 1G2IA 2ZWOA 3ER8A 3C61A 1DCTA 4HGPA 3IF1A 4HNAA 2PAFA 1RAMA 4BP9A 3HADA 4UQ9A 3PJTA 2WNZA 1N8NA 2HFFB 1F0KA 4LJ3A 5H35B 4YFVA 3WB9A 3DGEC 2B7NA 3CRZA 1YS4A 4F4HA 3GFYA 2PGIA 2VW7A 4PLVA 4Q9RH 2EP6A 5AM3A 4LX4A 3ZNOA 4OVXA 4FFTA 2FZ9A 1J70A 4HH1A 4HS4A 1TRDA 4DXAA 2QP4A 1ORSA 4ALJA 5EHFA 4O4JA 4HDIB 3V4LA 2C20A 2WD0A 1UK6A 1TVNA 3GNPA 4JX8A 4PV8B 3FYHA 4MGYR 1JHXA 4K7PH 3JYHA 2FBRA 2AQ2A 2RUSA 3ER6A 4S11A 2PURA 3BGAA 1Q91A 4Z7NF 5IVXA 2QRGA 5AW7B 4HH9A 2HA2A 1GOTA 3IFOA 1QKZH 2P24A 3EIHA 4X8XA 4KDTC 2BGNA 1YDPB 4ABYA 4CU6A 4WHTA 4WOZA 2BP7A 3IMSA 1VE3A 4EN3A 1PJ8A 5F1PA 1Q5MA 4W85A 5HKOA 2MIIA 4ZJUA 2FEDD 4A7VA 3M0KA 4GKZA 3EGDB 3QGMA 4IOLA 5BW7A 3K0EA 1PKNA 1DUYB 1VPXA 4LJKA 3TUUA 1YB5A 4X4XA 1UKOA 2L69A 3OJLA 3ZWAA 2CLLB 1ORRA 4L0MA 3DETD 4GL4A 1Z5WA 1DCEA 3THWA 1C1DA 2J3IA 5C7ZA 4AF6A 1Z69A 2LR0A 4IDGA 3GDWA 1K8XB 1NPUA 1EXBA 2VLKB 1YN6A 3F12B 5F9DC 5LUBA 5DJ2A 1LUCA 3KBSA 1GPOL 3D1VA 4LO9A 4YDMA 3V7NA 5IR1A 5AVVA 3M0HA 4O02A 2PS3A 4UINL 4NI8A 1AM4D 1HMPA 4AWUA 2CL0X 4LLMB 5C6WH 5CN3A 5KVMC 3AY4C 3KPRD 4LLYB 1TMGE 2V3WA 3TAHA 4HATA 1U7ZA 2QROA 1ZP4A 3LH2H 3DX0A 1TYJA 3KAQA 3NFPA 4POAA 4PJBA 3KYNB 5C3TA 1FORH 1O9WA 1WV0A 4LDNA 5IH3A 1V5IA 4JO3L 2GJPA 1VRVA 5UKDA 4INZA 1EV2E 5EJ7A 3W0WB 2YHAA 5FLUA 4ILSA 3U7HB 1IQ0A 1WXWA 3VM5A 4OZIF 1E6PA 1E30A 1JP7A 3GLHB 2EX1A 4FXFA 3CPHA 4GO8A 5BSWA 3IETB 5KVFE 2PJUA 5LGHH 2J6CA 1TUBB 2Q49A 1CFBA 1FP8A 1NMEA 1DO2A 1OC4A 3HG0A 2HAZA 1DOAA 5HGXA 3CZCA 4L3EE 1Z2KA 4U0RC 3BUSA 2R9HD 3HJEA 4GZ5A 3OZBA 2PSEA 3K1TA 5AOIA 3VH8G 1JJ7A 4I18A 3BVTA 3MUOA 3RDJA 3HVKA 2PRKA 5JXAL 5EPUA 2JARA 2BVOB 2NX1A 4YT2A 4GXUM 1YDVA 2J31A 3UUEA 4TX9A 1S9VB 1LK3H 1W4RA 4EITA 5EI5A 2EDXA 1P44A 2FKAA 2IPKB 3AJ9A 3IR5A 1FJ1A 2D0DA 3WWPA 2VRWA 4BUJA 2EC8A 4BF7A 1ONBA 4K3UA 5C1BA 4C0JA 1SBNE 3CL7A 1T2QL 3VNSA 3NM5A 4IJRA 1BXRA 5DNVA 4J2PA 4BQQA 3FB5B 3Q4DA 1B4DA 5HUJA 2C79A 4G5FA 3QEBZ 1ZVYA 4DGYL 3LWZA 1I1YA 1U7UA 4C7OB 2VUSA 1JHRA 2J3EA 2V7XA 5IIEA 4GBMA 2PZBA 1LVGA 2FAXA 4LYDA 1PEKE 3ABLB 4DOHB 1JQAA 3FR7A 1MVUB 1HJSA 3HHSA 1UQRA 3WL6A 4OJCA 2NIPA 1HT2E 1LLAA 2GQ8A 2WLNA 4LSPL 1FVHA 3T06B 2YA0A 2PNJA 3BKJL 2PCLA 4GGPA 2IW0A 3JR7A 1GUZA 3IIZA 1YRAA 3ID7A 2C9DA 3CFTA 1QAMA 2FMNA 4HVCA 3DVFA 4XC3L 1W5TA 3LQKA 3LDBB 4JLAA 1QSVA 1QSEA 3JAWB 3QXWA 3TN6A 3NHWA 4IGIA 1PX4A 4A3HA 1P5HA 3O2WL 2UXTA 5EQTA 3OT1A 2OXIA 5KQSA 2OBBA 3FNDA 3DBXA 1I8JA 1BYOA 2G3IA 1K7CA 5CLGA 4I1RA 3X11B 1JK8B 3B9AA 3DFHA 5DM2A 3N13A 3H97A 4A37A 1CDGA 5DNCA 4AUJA 3RK1A 1KNOB 3ME0A 3VIOA 2YY5A 1HT3A 3AF0A 3HN7A 5E7QA 1VFBB 3KJ4B 1QUEA 4FOSA 2P6NA 2PPDA 5DMYA 5T3YA 1YNLL 3QKRA 2I60L 4XPBL 5D3MA 4YBRA 3CHSA 4X6CF 2HE8A 4GB9A 1Z5GA 2OBFA 4OBSA 3DXZA 4FR0A 1B43A 4P38A 3TZQA 1KJNA 1O96B 2YAOA 4PCSA 5B3JC 2A9ML 4FZEL 3R8RA 3KSMA 4XVJH 3VDBA 4O4IA 1E9EA 3GU9A 2W0PA 1QFYA 4X4MA 1XNGA 1S9YA 2B1OA 1V3IA 2QE7A 2Z3VA 3PIQA 2G6BA 4GIAA 4B4WA 1ZK0A 1BM7A 3OF5A 2XI9A 4G59C 4RNFA 3P11H 1KJ8A 1DEEA 1JFHA 1USQA 4NPKA 4A3SA 4LRIC 3U7EB 3ZDZE 2FETA 3KWMA 4DZTA 4QUDA 2I9UA 2KQUA 4QFCA 1J8HA 1COWD 4MYSA 3N55A 2H1XA 3N53A 3S5OA 3IIXA 1IBHA 1DXIA 3VR2D 1KJMA 3U6XS 5K3AA 4IW3B 5BSVA 4YL9A 3VPLA 1R38A 1COZA 5KJRL 2F18A 3BILA 1DQLH 1OAXH 4YMLA 2ICEC 1YBVA 3PWPE 3TJMA 1IGFH 3GPDG 2VTKA 4J0QA 4JZOA 1H6UA 1VCNA 3VXOA 4JFDB 2X9QA 3DX8A 3CM0A 4DTIA 3NGFA 4X7FC 1L6GA 3LOUA 3RLUA 1CFSB 7PTDA 1TZJA 3E2MA 1A7PH 4X2UA 5HWNA 4BKOA 5C5EA 3O9WB 2ZCLL 1DTWA 1V7CA 1QT1A 4NVRA 4OTXH 3R1IA 4MDYA 3ATEA 4H9MA 4I7ZC 1EZVY 2XBTA 2P48B 4W5RA 4Q8BA 3SPXA 4BK5A 3BJTA 3GUYA 2W93A 3EMVA 3DDGA 3I04A 2HJ9A 4Y2RA 2YVAA 2XOTA 3IDXH 1NXOA 5ES4B 5LNEA 2QK4A 1RH9A 3O2JA 2CKBB 3MXVL 4AENA 2HLDD 5H16A 3UMFA 5KHLB 1B2WL 3FA5A 5HBFA 4Q12A 3L3DA 3E22A 1I8LC 3EYQD 2MCPH 3DX7A 2KHAA 5A04A 3II3A 3P9ZA 1TETL 1B6SA 4MI1A 2ZF9A 1BXZA 4L1HA 2FT6A 5TT1A 5FFMA 1SM4A 2CK0H 5C09E 2IF7A 2W70A 2HJKB 4UMCA 1S2NA 1FTGA 4PZUA 2ZJSL 4DLYA 1QK0A 3NFSH 4XWTA 3ZO9A 4JQAA 4ZZFA 5REQB 1SCUB 5BRAA 1IR2A 1U5CA 5AZ2L 3H3PL 2ITDB 4R84A 1OK8A 1VLHA 4XMLH 4IY1A 4DMRA 1DZ0A 2BFBA 4WDWA 1T2FA 4FLEA 3ZRFC 3H22A 1NMBL 2NNAB 4UOZA 3C6SB 1RAHA 1TQDA 3SUSA 3REOA 4HF5L 4NZCA 4WNYA 4BPBA 1T8UA 3T0DA 4LF2A 1KRMA 3FVRA 1UBSB 5EOCL 1JL3A 3PUHA 1VFFA 2WXHA 4RVCA 3TBWB 2OSBA 3L9XA 1WD9A 4V1DA 5JC8A 2WJGA 4D6XA 3FNBA 4E9YA 1QV9A 1PK7A 5KYWB 1GMIA 2AG8A 4LUSB 1EUYA 3BPSA 4XO5A 4YUYA 2Z8VC 1CL7H 5EEGA 3NIDF 1URZA 2LBPA 1OO2A 2R1VB 4QRRD 2WLLA 1QM5A 4V0RA 2VZ9A 4Z8FL 2IG2H 4MLDA 3C4VA 1E1NA 4V03A 4JVLA 3P77B 1M72A 2WKPA 2YA1A 3MS4A 3P62A 1ILUA 1GUDA 1ZAGA 3ZI4A 2VQ6A 5BXRA 3AZQA 4OHVA 2HGZA 2VBFA 4OZFG 2ZRNA 4M38A 1CDZA 4A7GA 4R8KA 3J81k 1L5GB 4QNPF 3QYAA 1DUVG 2CNCA 4YNBA 3N41F 3GZPA 2PDMA 1FIGH 5JD6A 3ILPA 1FKWA 4DVOA 1MAAA 2DORA 4B96A 4NUJA 1BMTA 2JHCA 2HH9A 1UUMA 3O3MB 1U4NA 1OCQA 1R5VA 2VC2L 4GH3A 4E4PA 3VXQB 3ODPA 2GBLA 4OD0A 1N26A 5IZCC 1F00I 1AXGA 4QPDA 5FUXA 5CIPA 3QV9A 4XP9H 4FFOA 1RK0B 5TE9A 3P32A 3S2UA 3CHPA 4FFSA 1TNDA 3N58A 5ERWB 1A80A 1WZKA 2VHYA 4LASL 1KM0A 4ENZA 3D9AH 2ZTLA 3JXEA 1KKRA 5IK2D 4X85A 1BXVA 1EK3A 5CG2A 3ANNA 2BD0A 1UKSA 1MJ8H 1ZW1A 4E0RB 1E4WL 4XDZA 2Q76B 3ZUPA 1LNQA 1M6HA 3UZEC 2FIRT 3IMRA 4R0LB 4L8SA 4YAUA 4X90A 1XAUA 3W1UA 2XZDA 4A36A 4EEKA 2VCEA 2J1XA 1KO8A 1GSOA 4YQZA 4B0MB 4AK9A 3QKUA 1PGQA 4FFVC 1YQUA 3EOOA 4RHFA 4CTJA 1NLDL 4RZKA 2VDVE 2YUZA 1EDYA 1X77A 1KKOA 3QIBD 1WUYA 1U3CA 1Q6DA 2QD1A 1NCBL 4MUKA 3CIWA 1NIFA 1JZEA 3GH7A 4DI8A 1NN5A 3V6OE 2XB4A 5EMHA 1BIHA 4J91A 3V18A 1ND0B 2PR4H 3E6FB 5IFAH 2BDNH 4FYPA 4BTEA 3GGPA 3H42L 2EBFX 5J9FA 25C8L 4NKIL 3AWEA 3PP7A 3LUDA 4TSAL 1JJBA 5G0VA 5EU7C 3A4MA 3S6DA 1PG5A 3LYLA 2JCXA 3QMVA 2QPUA 3EWBX 4IIHA 4G89A 1WS7A 4HZLA 4GCAA 2HRQA 4Y4KD 3ANUA 2J5LC 5JDSA 4R1QA 1H23A 1BQSA 3NN8B 5CJPA 3LN5A 1XIWB 4LLAA 1JT2A 2NMSA 2MYTA 4K8RH 4LDZA 3FKJA 1QPRA 1Q6RA 4OA8A 5AUMA 2C07A 3CZQA 4XB2A 5E0QA 2VYQA 3ULSA 3PRHA 1WNTA 3CK0L 3SBWC 2I6FA 2QLBA 3RU8L 4NT6B 4XI5D 4QGSA 3PJRA 1KV5A 2RGBA 1I51A 1TV5A 3N75A 3OF2A 2CWWA 3BKMH 2ZP8A 4P9HL 2UZ1B 3I0MA 4J4PA 1H1ZA 4E9WA 3FUEA 1ST2A 4GX9A 1QYGH 5GRUH 4EMTA 1ZALA 4PJCA 4QXPA 4TU1A 3AEXA 4O2EB 2IZOA 3BH9A 2ZLBA 3LHDA 2EO7A 2XU2A 2RBKA 3MCVA 5J1SB 4ODUA 2EOAA 4N0YH 4CEIB 4XWYA 2LLNA 1Y8CA 4Y19E 5KAQF 3VTFA 1O7AA 4JYAB 5LYYA 4UAHA 1PFKA 4ML9A 3DWGA 1ZUNB 2WEKA 3KCOA 2BXYA 3W3ZB 4KTGA 4UB0L 2WXIA 3W2DH 1OZTG 2GAZA 2NY3B 4RO0A 2IAAC 3KKKA 3I01M 4YTRA 1IBCA 3N28A 4WH0A 2EBUA 4FE9A 3BUQA 2XWTA 3EBAA 1HQ4A 1ZD5A 5J2TA 2X6UA 4AQ7A 3LQQA 1ROWA 4G84A 4YUAA 2KYRA 3WBYA 4PRYA 4Z3TA 1S5VA 4R8VA 3IKMB 3L8QA 2B4CH 5EN2B 3KQPA 1GKOA 5LXVA 4LGVA 2XAUA 2VK2A 3PX3A 5HYVA 5DA0B 1H3WM 3A6CL 2CT8A 4B6JA 2ZS8A 3Q2WA 1J06A 3G77A 4WESB 1NOAA 2JQAA 4XA8A 1AGDA 4LHUG 3FTWA 1OFTA 4QRHA 1B0GA 2ZUSA 4JELA 2H4JA 5A5DA 3AR3A 2H1LA 3N2MA 1TMYA 1JNLL 4NZ5A 4I7EA 3NG3A 1RZ7H 1W72H 3D8RA 4AJ1A 1R9FA 3JQ6A 3CM4A 3FUCA 3M1BB 4NFSA 1K6IA 1J1ZA 3F4BA 3IWUA 1XLVA 4OMCA 4Y5YA 5L6MB 2RD2A 3KXIA 4EB3A 4P34A 4B3EA 3QLDA 5ER6A 5DI3A 1P1ZA 5ELLA 3G5TA 3VXGA 3KXQA 4G67A 4Z42C 1OGYA 2CIKB 4YWJA 2A1WH 4W9FC 4ZUTA 4IIJB 4MVJM 2V03A 4PRLA 3RU2A 4ZQHA 1YNQA 3FT2B 1CR6A 4KKNA 3GR4A 5T3ZD 4TYYA 1ISXA 3VXNB 1BVKA 5T33L 1TU0A 4Z0PA 5YASA 2WJPA 4FHZA 2XWQA 4KUCF 5TPZD 4LNUA 3U1VA 3DBRB 3EGIA 3N2OA 1WM1A 1FDOA 3HG1A 3JVFC 4LCIH 3CWCA 3CLSD 2PEYA 2DQ6A 3HPJA 4AI6A 1CXIA 2IXUA 2R84A 4Y8FA 3PRJA 3P19A 2ODTX 2GN9A 2XUHA 2WZMA 1T20B 2QN7A 4KGZA 5DUMH 3LQMA 4CILA 1T2VA 3K94A 3KYCA 1ZCJA 4NOJA 3GG7A 4JX9A 4PAZA 2NZ1A 2CO7A 4JPSA 4BCZA 4P2RB 3L0IB 2WQVA 3GIZL 3Q3CA 2PZEA 3MLYH 1U63A 3DVIA 4LYGA 1HKVA 5KVAA 4JR9L 3MCKA 3TBYB 2XLCA 2Q0QA 3T9AA 2RGRA 5FAXA 1O4VA 2XIIA 1G4RA 1O75A 1YUHB 5DELA 4UMGA 4JFOA 3KQOA 3UGUA 3M4XA 4AG6A 3KZKA 4LSWA 3LCUA 3T1WA 3HKZA 3PKIA 3RTBA 3EAGA 1NOUA 1ODIA 5IBXC 1HYSC 2XQYK 3P0RA 5HG0A 2O2ZA 1S4IA 2B8OT 1UZNA 3NJFA 3RHWF 3F7PC 1BU8A 4OGXH 4NX0A 3VHQA 4FOTA 2IYQA 2GLTA 3INYA 5EFIA 3HE7B 5BZWB 5IOPB 2DT1A 1LXCA 1PFGA 5CT8A 3LZCA 1QQ5A 1UR5A 1P9MC 1RBLA 3P02A 3ASNB 4DN6A 5KWEA 4L3OA 4OCXL 2Y68A 1EEZA 3HQ4O 4EL0A 4HCJA 1CI3M 3UJRA 3H2SA 4AF0A 2DP3A 1T7LA 2CWNA 2P88A 4M3JA 2WZBA 8FABB 5FV2A 2G41A 4EI9A 1TM4E 3B5HA 5BV7B 1NUNB 1XDJA 3GJTA 1X8KA 3OGVA 1P7QA 1R4XA 3U62A 2Z93B 1P9OA 2IE0A 4X6DF 2PGOA 4KUHA 4MHSA 4KKLD 2PP7A 3VHXA 4D0SA 4LDQA 3BAEH 1VMAA 3UP8A 1EMTH 1CMOA 2DU8A 4WJ8A 2ENJA 4X3CA 4AAYA 1Z9PA 5ADOH 2CFCA 3B7PA 2NSJA 4N5NA 2WSYA 3RR1A 2Y07H 1OGAA 3U7AA 4J9JA 4GWKA 2P41A 4PZLA 3LDBC 2QCCA 4F24A 3GJSA 4UPVA 1V0KA 2GLKA 3ASZA 4URWR 3T0GA 4JJ5B 4NOMA 1HZZA 1HZHL 4E08A 4Z76A 1XSEA 4DVBB 3KUXA 3Q3VA 3G7TA 5EZYA 4HQVA 3IT1A 2BC9A 5K8CA 3WEXB 2GQ3A 4U3HA 4JO5A 1NDHA 1XTPA 3TYFA 1XAHA 4JQOA 4EWLA 5CINH 2PUCA 3WX0A 1UQTA 2ZANA 2I1LA 4JP8A 5I3IA 1J2WA 4EDWL 1RK5A 1PZ2A 1VSBA 2YN2A 4ABQA 3BEOA 4KDVA 4C20A 1VBRA 3THRA 1OZHA 1JI1A 4GQAA 2Q5QA 3LERA 2GZXA 4XX5A 2ISWA 4YR6A 2XNCA 3TNYA 4YJ3F 3IMFA 3ARED 4DN1A 5EORH 4A39A 3P96A 1FFAA 2YPVH 4ZOBA 3BHBA 1DC8A 4BS9A 2C1EA 2RSLA 1QV6A 5AHEA 4M7KL 4A0RA 4YLYA 4KXNA 2QZ9A 2G08A 1K9TA 4KBGA 1IGTA 3UAJD 3V4VA 3CUFA 4ARZB 1A5AA 4J5VA 3V1YA 3AEQA 2XYCA 3EXHC 2BTMA 5JZ7D 2F54D 3BD8A 1NR7A 1U1CA 2Q2LA 3W22A 1M7DB 2VDLB 4WOCA 5CK5A 2OR9H 3OA0A 1MW8X 2QAJA 4NOFA 2H1WA 3TS1A 3VPFA 4TRPL 2FOIA 4R1LA 2OJEA 3T08A 4KPEC 3NZQA 3WLLA 3ZWOA 1W0WB 3AHIA 3VD2A 4L4VB 2EIMB 2K7ZA 4NAFB 5DI8A 1TO2E 3PGXA 3LA4A 4JTKA 5FF9A 1ADFA 1E28B 5IFKA 4BNLA 3OKKB 1KSRA 2KLBA 1C16A 2BGUA 2ZE6A 4EAQA 4OIFA 5DO2D 2JCCB 3CN2A 2ZB2A 3DWFA 1DSFH 3DV0B 4HAOA 4A8JA 3QEGH 4XAKD 1J8DA 2WA1A 1K4CB 2M6SA 3O8QB 4WGKA 3TN4A 4B3IA 1EWKA 3IFNL 3WE6B 4IMPA 2CIIB 3P2JA 5IMMA 2IPJA 2BBSA 4GG6A 1EEXA 2WFZA 1DJYA 2CCLA 1P2CA 4JRXB 2GOKA 4YX9A 1VR6A 3BT7A 2VL5A 1DWJM 2OCZA 5JLZB 2UYLA 2XACC 3MRJA 4MAFA 1TVHA 1NL0H 1QHSA 1C50A 1YDHA 4WXYB 3H2MA 5F0MB 4D8YA 5COAA 3RSGA 5KWSA 4ISVB 2W94A 1GUFA 2FRXA 4NQCE 3RI3A 1DP0A 3ETEA 1GSHA 4JUIA 4O4YH 3UWZA 1WEHA 4YS6A 1RA5A 4H0GA 2W6PA 3IOYA 3TNBA 4Q47A 4EPRA 3BWAA 2PCQA 2E0IA 5FADA 1AZUA 4ZX6A 5FO9B 2QSYA 4F8PA 3JZIA 2XCQA 4XVUC 2G40A 5IB5A 1P8JA 5I7AA 2WNSA 2DQUH 3JQOB 3STTA 5J2UA 1IB6A 2JAXA 4KVNH 1R8SA 2XINA 2A3TA 3SBQA 3GAKA 2E4XA 3DXAD 4M76B 3Q6FA 1E2DA 3H99A 1JDBB 3ORWA 1R66A 3QI9A 1C8KA 3HKCA 1Y1PA 1U2PA 3WY1A 3TDNA 1IC5L 4HUWA 4AYXA 1E9AA 4PP2A 1BJMA 4HGKC 1HCFX 3UAFA 1FNMA 3NCHA 3RDTA 2VC6A 2E4FA 2WOBA 2IUFA 3THXA 1G6KA 3NP9A 1OY1A 3B6IA 2O30A 1OAOA 4J8RB 3BCSA 3SUUA 4WJEA 5GGRB 1RLMA 1UANA 2ZOSA 3GX1A 3S96B 2XQVA 1L5HA 4M3NA 3DIDA 4OZIB 5ABHA 4XZ9A 4X63A 2FR8A 5DJ8B 1MC1A 2G5BA 3PV0A 3SZRA 3H54A 3MZTA 2P4UA 3HDTA 5ABDE 5CA1B 4N02A 2DLTA 3MRGA 3GUHA 5F1OA 2PUAA 2QCHA 3AV0B 2X2JA 5IROD 3TO4B 3TBSB 1HA3A 3HR7A 3MUGA 1E6LA 3B9QA 4FQLH 4M7LL 2AOTA 4OGAD 3CNEA 2VLME 4X8CA 4PUDA 2ZSJA 1SJVA 3I5XA 2O4EA 4HKTA 1OZMA 1QMGA 4MA3A 3Q37A 3WLPA 4PAOA 3V4PH 1S7SA 2OAQ1 1VZIA 1MRAA 4WK4B 4MV0A 4CRPA 3J27A 5DURB 2FCRA 3VACA 1HDZA 3VI3F 3H1GA 4GYWA 1F8YA 3INGA 2YXMA 4QOGA 1WYIA 3OEEA 1UJ6A 3ABMB 3AETA 3NKVA 5IJCC 4FBMA 3WWEA 3W4KA 1A9VA 3HC3H 1B74A 4QYAA 2G0NA 2C9QA 2BJML 5JV5A 3QPKA 3M1LA 1PG7W 3T1HB 4WFHD 3RJOA 1I1FA 3WISA 2Q5LA 4PHHA 3HCDA 2YY7A 1DT3A 3D48R 4XN4A 5KVVA 2R0KH 3KVMA 3OVGA 4NERA 3VFMA 4BK8A 4NZRL 2QSTA 3U9PH 3V4ZA 1QW7A 4XVHA 4OPMA 4DTCA 3G8CA 3R41A 5JAHA 5DT7A 1H6CA 3IHKA 1S02A 4W7SA 5D2LE 3H0CA 4IL0A 3VXMD 4UXDA 3NDZE 1D5IL 3BEWB 4D02A 4DNLA 5D05A 3I1YA 2D0HA 3U3RA 2VEIA 4ZJYA 1OAUH 3DUFB 1AX9A 3LLSA 1XLKA 1KR0A 2FLKA 1DBKH 4YEFA 3V7FA 5EP3A 1AL8A 2IOOA 3N29A 3S29A 4C89A 5FA4A 1KY2A 4YJGB 4HOMA 2Z8XA 4KYUA 4DBLC 2D3JA 5I1EH 3U6BA 2C8JA 2QPEB 3AFNA 4KHZA 3A67L 4W9TA 4FGLA 3OBIA 1IIBA 3S35X 3FW1A 1MW1A 1F4VA 4E33A 3FCYA 3QF4A 2NV1A 3R79A 2GXUA 3ZDBA 3HI6H 1W1IA 1UJCA 1EI9A 5DMGD 5I6NA 5BOOA 4EYEA 1HE5A 4LYAA 2NVCA 1IU9A 1I1WA 4N25A 3ELWA 4PMEA 2R8RA 4LQFL 2PU1A 3ZFHA 3CZ4A 1AR1D 2BIQA 2Z35B 4F9PC 4LVGA 1DC3A 3V5KA 5LGXA 2FLRT 1XBYA 5H9VA 2H32H 3W7AA 5I1IH 1YE3A 3EIOA 1YFJA 3U19A 1GMEA 4PJFF 3ZHUA 2Q7YA 4OQEA 1NZJA 2FPGB 2G76A 3L8HA 2B4QA 5FUOL 2FQEA 3A1SA 2OBXA 3IDIA 4QF1A 4IHOB 5KAPA 4G7YL 2XRMA 1PLAA 3W6LA 4PS4L 3W5NA 1MCIA 1YMYA 4KIRA 4LJ4A 3NSCA 5E2JA 5AECA 1WQ4A 5ESQB 1WWBX 1E6OH 4JDVA 4ZSOB 3RWJB 2DFPA 3BCFA 1IUZA 1KVSA 4JI3B 2CV2A 2NVUB 1P4IL 2OYRA 3JD1A 2GK6A 1U3TA 2DUAA 4C30A 1RALA 4KPHH 2HJPA 4F9TA 4BUGA 5D5MB 1RU9L 3DFUA 4HTFB 4TPRH 3L1HA 1CE8B 4B81A 4P9NA 4LEBA 4P3WA 5DZJA 9RUBA 1F4XL 1T3ZA 3O9NA 3ANYA 1U3HD 2CKBL 3OSUA 3OOHA 3LOQA 3RC1A 5K9DA 2M1KA 3WG6A 1VYUA 5KU1A 3D18A 3ETTA 5IF0B 4OLVL 3FUDA 1XWWA 2ZDQA 5JYCA 3MBED 5CGTA 4L0CA 1BDYA 2HT3D 2AF2A 4HFJA 4GAAA 1QSFD 5L3VA 1J0IA 3BUIA 2QZPA 3TQHA 1RHCA 3QENA 4ZDKA 1R5NA 4IP0A 5DX8A 4DOMA 2FMUA 4K9OA 1SBZA 3MUJA 4FQJL 4HWZA 2ROQA 2Y1CA 3A58B 2WV3A 4I46A 4E42A 1MX5A 3I28A 3KPQB 1Y81A 2BDTA 3HS3A 1JBJA 3QDGE 4PC7A 5C0DB 3VX1A 1M3UA 2VX7A 5A4JA 2VCBA 4JM2A 4ZFMA 1UZ8A 2ONCA 4M7JH 4EBFA 5D33A 2X30A 4PP1C 2QUVA 1JSYA 1OAZH 3H8WA 3DMHA 4YNYB 4PW9A 5C6PB 2DH5A 2NY3C 5CPNA 5D2VA 3W2LA 1HAWA 3ITDA 1OK0A 4M22A 2WFLB 5A5WA 4CN4A 2YXNA 4BAUA 4ZUUB 1AQDB 3F6EX 5BVGB 2VA8A 2A4CA 3NJKA 1H2AS 3CPEA 5D1NA 3PGFL 3CO4A 3NQ7A 1F05A 3X14B 2C8VA 2C3UA 1CXLA 3NCEB 2RH9B 3Q0EA 4FYIA 2CJ3A 2BEUB 4ZYYA 2ONZA 1SFSA 4H0CA 1GN9A 2P10A 4F2ME 3F5FA 1IC6A 1S4MA 2Z25A 1EZUA 2AMGA 3KBMA 3MRTA 1ES9A 2WIIA 3AL3A 4DJ5X 2IVFA 1YX1A 2RHCA 3COWA 1C7EA 4EP8C 3LMKA 4Y4FB 4XOUA 2J7FA 3GG9A 4IUCS 1BYNA 4JQCA 2VITA 1XGEA 2I3ZA 2DQJL 2IH1B 2VEOA 2QKFA 4DJMA 4KI1A 4O6VA 1Q7MA 3AG1B 3ZZ1A 3KUUA 1M8GA 3CDGA 4OJFH 1Y1KE 2ZBUA 1Y65A 4AUUA 3FHQA 3I5UA 3HE6D 3K0AB 3G8RA 3ORYA 1EINA 4FJ2A 4G8GD 3AUKA 4QNNA 3LKSA 1A27A 4YN3A 4EGFA 2YUVA 3NIDB 4RANA 1MO0A 2C0QA 1PD6A 3OE4A 1HEZA 3HRZC 1Y80A 3Q8KA 1O94C 2AL1A 4WFJA 3MTXA 1FP4B 3CHRA 4OM1H 2VWHA 1RXCA 4GE3A 1WDKA 5F7EL 5K6RA 3K32A 1FGVL 3ROGA 2ODNA 2PLCA 2P3OA 2VQEB 3DO7B 1P4LB 1Z0AA 2ZZ5A 2HA5A 3CBQA 4OGGA 2X9ZA 1EJBA 2PMZA 1C8BA 4PBXA 5AALA 1L5NA 2AL2A 1NLMA 3N41B 5I7SA 1L4EA 3EHBC 5IB4B 1V48A 3W1QA 1FLAA 3T2LA 5DDHA 4FA8A 2R1YA 1ZXLA 3NABH 1JLMA 1MPAL 2HV5A 2WKGA 2DCMA 2WTPA 3QNXA 3IELA 1G7MA 3VXSD 2C1IA 1JHVA 3RQ3A 2AOXA 5E08H 1LDPH 4E09A 2A3CA 1UVQA 2OLAA 4QO1B 3UT5A 3VFSB 5DHPA 3TOZA 1E64A 1JPSL 4ARUA 4AY6A 2P5WD 1HY3A 5LD2B 5ULLA 1N33B 5I6XB 4N5DA 3IKCB 3GPSA 2ICES 2IBTA 5DCBA 1HHKB 3BX1A 1LI7A 4ETMA 2JHAA 2FE0A 3G9AB 1K86A 4HEA6 3M4YA 3E3MA 2OSLA 3KAKA 1WBZA 4MAZA 3QBTB 4MRMA 3LA6A 5FH9A 4MJ5B 1FU4A 2C5FA 4JU8A 6REQA 4HGNA 4KQ9A 3D5HA 1NQ5A 4FDMA 4KRGA 3GFPA 2X86A 1XUOA 1T1EA 1OD0A 4XPIA 3W3AD 3RVXC 1N2SA 4XUYA 2QP3A 5IKEA 3IUMA 2GDQA 1P6CA 4GX2A 3AY7A 2W71A 4JTRA 4S3EA 2XFYA 1TJMA 3C6ZA 4TV3A 2ZRQA 3OC6A 3S6TA 3LRGA 3EUFA 3LL4A 1XGTB 3BZEA 5AKQA 5I0XA 2VW6A 3TB6A 3L9BA 2OT3B 1XFDA 3QA3A 3CBRA 4GZLA 3QQ9C 4FK8A 5ACZB 3XIMA 4QJ5B 1ME9A 2ZJ7A 5F4SA 4IDHA 4RQBA 1GTEA 3NVKI 5T1LD 1TEFA 3D81A 3EOEA 3ZLFA 4QDXA 4YHLH 1LD9A 1X70A 2HFGL 5HHQA 1ECJA 3COTA 3H8VA 2K78A 3GR8A 1MCSA 3QWBA 3GBNL 4OCWL 3H18A 5ISZD 1R4MB 2IIVA 1PS0A 4QBGB 1UJ4A 3GS6A 1CFNA 4RY2A 3AR7A 3AS1A 4R90L 1PVHA 2BFFB 3OYXA 5FKYA 2HNAA 2I3AA 4BFUA 1KDOA 1A6WL 1CL7I 1GYRA 5KNCH 4L5JA 2OFJA 2DFAA 4OHOA 5JBFA 4XUCA 1ZN2A 5CAKA 2J1YA 2W83A 2J46A 4EYGA 5FULA 3JD0A 5LQBL 4NL4H 1P77A 2B4CC 3EO9L 3W5IA 4ALIA 1WAAE 5HVWA 3DO4A 4QXTB 1A8IA 2ICSA 3V0IA 4HX2A 2CNNA 2VCYA 1NCUA 2EE0A 3GEIA 1L7BA 2MJWA 3TEYA 3LX8A 5MFZA 1J5DA 5GNXA 4PY7A 4FOKA 3UXFA 2Q99A 5C9ZA 1MH5B 4RGNE 4QQNA 1H0KA 1NJ9B 5EL0A 1XEDA 1OE1A 1JV5A 4PJAA 2KX7A 4HW6A 1THMA 4TZTA 1T1ZA 2UUAB 2MPVA 2ZCKL 5DP1A 4IBYA 1PZGA 1YY8A 5CGYD 4FS9A 4AQYB 2LTQC 3AXSA