3EWWA

D312n mutant of human orotidyl-5'-monophosphate decarboxylase in complex with 6-cyano-ump, covalent adduct
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFENRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine-5'-phosphate decarboxylase
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 100
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ewwA00
4NQ1A 1KFKA 4FIQA 3HB9A 4O57A 1KFBA 2GPTA 4XTDA 4FNTA 1MZHA 3HO8A 5AYXA 2FJKA 4FO4A 2NV2A 1B9BA 3W7DA 3L2IA 4A2RA 1K3UA 2J6XA 2G95A 4OV4A 2UV8G 5AC6A 3TAOA 4O0ZA 4Y96A 4WOQA 3R2GA 4O13A 4ZQNA 4I7UA 1TRDA 5J5DA 3ATYA 2E5DA 2NXGA 1OFEA 4PODA 5K4XA 3OA3A 1EWEA 4JX5A 5D04C 3LHTA 3WJSA 3TW7A 4Y90A 3DKJA 2QDGA 3W7OA 4M7TA 2E6FA 3C52A 3CU2A 1TPB1 2BX7A 3R13A 5F4SA 2PRLA 3N3MA 2NUXA 1AMKA 3S1UA 1JJKA 1G67A 4O0KA 1TV7A 4UTWA 4GC4A 2V5LA 5EL1A 3T7VA 2QCFA 1MSSA 4UCGA 4LOCA 1EB3A 2RKXA 4GFSA 2CLMA 3OVRA 4FXSA 2C14A 4IWWA 3KVJA 5I3JA 1ZNNA 2P0OA 2ZZ6A 3B8DA 5D02A 1XDMA 4GJ1A 2BWGA 3FS2A 5LKYA 4ORMA 2WSQA 4NVTA 4PEKA 4QITA 4LC6A 2Y70A 1ICPA 3EXTA 2TRSA 1Q6QA 3L67A 3BW2A 1C8VA 1TV5A 2A21A 1MEWA 3HPSA 5HQEA 1TPH1 3W7QA 1OF6A 2WNZA 3W1PA 1I2NA 4Z1AA 4DO5A 2QAFA 3P62A 5G4WA 3HGJA 4IMEA 1LYXA 4EOUA 4CCCA 5AN7A 3O63A 1TTQA 2H8ZA 3NQ2A 4X9SA 3TFCA 1TTIA 3S1XA 1FWNA 3A5FA 3FYOA 3QJAA 5DXYA 4IPIA 5F4WA 3IGXA 1VH7A 2CW6A 4LU0A 2CLOA 3LI1A 3NL3A 4GRSA 3JR2A 4IX2A 4FX7A 3PBUA 4Q32A 1N55A 4M6QA 4FNSA 3CPRA 3NL5A 3F1QA 2PC4A 1S5VA 2R91A 3IRDA 3W72A 4TIMA 4O1AA 3GR7A 5DY3A 2CLEA 3GKFA 4LT9A 4Z1CA 4JTKA 1H1YA 3IGSA 3LCLA 3TK7A 5LGXA 5KSWA 1HFBA 5EA9A 4MLRA 2QUVA 5IBXC 3L5MA 1BWKA 3GXTA 2A6NA 3NQAA 3EXRA 3KAOA 5HUOA 1GVOA 1ZAHA 1GOXA 4K36A 3HGRA 3LLDA 5K2ZA 1SO6A 5EKYA 3EXSA 2B7QA 1LM1A 3TE9A 3EX1A 1JUKA 3EX6A 1YXYA 5I3GA 1QOPA 1FQ0A 5EBUA 5EY5A 3TXVA 3QMTA 1VPXA 5G1TA 4U28A 2CFFA 2ZZ7A 2P10A 3W7EA 3G18A 2WNQA 3Q58A 4Z08A 3ABSA 4UTIA 4JYDA 3UY7A 3E0IA 3G1YA 4AH7A 3SI9A 1TO3A 1MXSA 1P0NA 4WY0A 3PB0A 4KFPA 3O6YX 3UWUA 4LNYA 3W7HA 3UZJA 2QDHA 5CZSA 5CG7A 4M19A 3NEVA 4O1DA 4YXGA 1TPDA 2VFIA 3PUDA 1ALDA 4YMZA 2FFCA 4RJEA 5KZMA 2ZYFA 1VGAA 1NSJA 4JEQA 1RQEA 4K7YA 3W7PA 5D03A 4O14A 5A8GA 2EKCA 3GX9A 1SZGA 4IXXA 4N9CA 1EP2A 3OBKA 3C2OA 3M16A 1THFD 4DBEA 2YZRA 1PL9A 5AYZA 1K7FA 3B0PA 4ICNA 4UNLA 2G96A 3W7RA 3E02A 2I1OA 4OQVA 1H7XA 2O7SA 2WJZA 5FEPA 1OYCA 5MHBA 4YL2A 4BFAA 3P67A 3SECA 4E2DA 2VOMA 3W85A 1OK4A 1WXJA 1NEYA 1DV7A 3UWQA 3W23A 3GB6A 4O4WA 3LXBA 1DVJA 3O6CA 3W1NA 4GE8A 4BI6A 1W54A 4P2VA 4QNEA 4KWVA 2ZTJA 2WQPA 4BWLC 1SFJA 1GVQA 1CX9A 5FI8A 3H55A 2X1TA 4KKXA 2E6AA 4RV8A 3C8FA 3W22A 2ZA1A 3NM1A 5AYYA 1IIGA 2C16A 1FXPA 1MO0A 1VR6A 2E6YA 1OFQA 3O15A 1L6YA 1BKSA 1FWTA 3MUXA 2B7OA 4CNOA 3EKZA 1OYBA 3BLFA 5IM51 5D09A 3LHWA 3W2NA 4RZ6A 2NXIA 2AGKA 1GVRA 1O5XA 1Z41A 2VFDA 2QKFA 2VXNA 1OX6A 5D2YA 4XTIA 3TJLA 4S2CA 3W2UA 1W56A 1D3HA 1UBSA 2E77A 3DFTA 4QJ1A 1L6WA 1LTDA 3IIVA 4GNJA 1JQXA 2J9ZA 4OWGA 3TW6A 1FDYA 2VFGA 3CEPA 1DL3A 3S5OA 2QCHA 1W37A 3N9SA 3HF3A 2NX9A 1TIMA 3MI3A 3B03A 4KFNA 4IGHA 4Y8FA 3USBA 3O6DA 3NPXA 2RDTA 4HPJA 3IV3A 3M5XA 1K8XA 4NT0A 2X1RA 1X7FA 4CCEA 1L6SA 1JR1A 2A1YA 1F74A 3PB2A 1A5CA 1OF8A 2GVGA 1FCVA 1I8JA 3M44A 1OJXA 3G22A 3WFAA 4BF9A 2ABAA 4MPQA 5DCBA 1KFEA 3N2MA 3TQKA 1G4TA 1DJNA 1GTHA 5A5WA 1JRBA 1F76A 3W1XA 3QZEA 3TUUA 1OG0A 2ZQ0A 4WQ6A 3TX9A 3VKJA 2BZNA 1KM5A 3O8AA 4JTUA 3QSRA 1PE1A 1Q6OA 1T96A 4WD0A 4JTGA 3EWBX 4NNAA 1ZJIA 3LRKA 2TPSA 3PVFA 5D30A 4Y9AA 2Y85A 4IXHA 3GDRA 2ZRWA 3ABOA 3P84A 1W5OA 2EHHA 3CM4A 4UR7A 3M41A 4RLIA 1VS1A 2V81A 3N19B 5D38A 2DZTA 3B05A 3S9YA 3GXNA 1OABA 4RXFA 1SUXA 1JVNA 2Y7GA 3TSDA 2TSYA 5ABTA 2JK2A 4LTSA 2YYTA 1KLYA 4AWSA 3UPBA 5I3IA 4O4VA 4IMDA 1QFEA 5J5RA 1IXOA 3F4NA 3S8HA 2DP3A 3NPWA 2WKJA 5HWNA 5I3HA 1L2UA 3HIJA 3EKLA 4JIPA 3LBMA 4FNPA 1JCYA 1F6PA 3SGUA 4I7VA 1YTDA 5FF4A 1GZGA 4UXDA 3RNDA 3KRUA 1TSIA 4MY9A 4R7JA 1AK5A 1VZWA 1E51A 3GNDA 3EEGA 4AWTA 2DJXA 5IBXA 3P5YA 1LOQA 3O05A 3QPZA 1K8ZA 4ADTA 3GXPA 2VFHA 5LNUA 3K30A 4UMBA 4DBDA 3LCIA 5F2LA 2YDAA 1K7XA 3UY8A 4S2BA 4MFDA 3S1VA 3UXAA 5BNKA 3FKKA 2NXHA 3TKFA 4N9EA 3BW4A 5K4ZA 3CQ0A 2GQ8A 2DORA 2J27A 2V8ZA 4LV9A 3HG2A 2NWRA 3L5AA 3A24A 3RLVA 1H7NA 4OE7A 1O94A 4QQ3A 5CGQA 1W3NA 2CZ5A 3EWYA 5AFDA 2BTMA 8TIMA 1EPXA 3MW7A 3ZS4A 3SZ8A 1DKWA 3W7KA 1SO5A 1ZFJA 3P61A 4OHQA 1DJQA 3A5VA 3LB0A 1O4UA 5HWJA 1YDOA 4UC5A 1RR2A 1QO2A 3PAJA 2QF7A 1XI3A 3LCGA 2GQ9A 4UTKA 3M5VA 4MY8A 2FLIA 3FJLA 1FWRA 3G1SA 4LC8A 1IXPA 2EGZA 4O19A 3RLUA 3W88A 1XFBA 3B04A 3IEBA 4B5NA 5DBUA 1T99A 3LLFA 2ISSA 1FUYA 3LXCA 1F2JA 1ONRA 1VCGA 2ZRXA 3UXDA 4O52A 1FX6A 3PM6A 2PCQA 1HUVA 4UNKA 1W5MA 3NOEA 5BMWA 1VYRA 3PY2A 4ZZ9A 1YDVA 1CI1A 3TV8A 3S5YA 1TPC1 5LZLA 2NLIA 1TV8A 5D33A 2JGQA 5LSMA 4U4MA 2VEMA 1JCJA 2E6DA 4IQLA 3MI2A 1PHQA 4DEFA 1VYSX 1HO1A 2GOUA 2XN2A 4UTLA 2V30A 3I68A 5FF7A 2XN0A 3VE9A 3PC0A 2J9YA 1H51A 4WY0B 1XBYA 4ORIA 3KFTA 5DCDA 5HJLA 4BWLA 3BLEA 4K6AA 3GAYA 1GWJA 3W2JA 2QR6A 2D73A 3IIXA 1TYGA 4AAJA 7TIMA 4GUGA 1B4EA 3I7QA 2C13A 1X8FA 2A7PA 1F5ZA 3U6WA 2V2CA 2QJIA 3UYCA 3TQVA 4NX5A 4JR5A 1FWSA 4YWIA 1GEQA 3ABQA 3BPWA 5G2IA 1LDCA 1DORA 1FY6A 3LCHA 3IIPA 1KFJA 3PSVA 1I2OA 3MBFA 3P60A 5DLCA 3M5YA 2HS8A 2C1HA 3FJ6A 4QM1A 2R94A 1KA9F 3PS7A 3QMRA 3STFA 4MJZA 3WK2A 3DFQA 3G1VA 1H62A 2JKEA 3HG4A 2Q8ZA 4I7WA 2LLEA 4G1KA 4WZHA 3C2VA 1L9WA 2KZHA 4HSOA 4LS1A 3B4UA 5D2XA 4IPJA 1AL8A 1DBTA 2E09A 3GDMA 2WSYA 3V75A 5FEWA 4DQWA 5EMUA 3PG8A 3N9RA 1KBJA 4N6FA 1TRIA 4IOTA 2ZCGA 1GVSA 4XQ6A 3W2MA 2QAPA 4O18A 1RZMA 4LRTA 4Z1DA 3W7CA 1O95A 3HPXA 3DHDA 2A85A 1OX4A 4NJHA 1LBFA 3ABRA 1I2RA 1IGSA 3L65A 3NXFA 3UWZA 3KXQA 2V5BA 1OK6A 1FDJA 2H3DA 2R14A 2F84A 1LLZA 3NQ6A 2ZZ2A 3T40A 1TREA 4K7VA 1AG1O 3O1NA 4OU1A 3TFXA 4IMCA 4UTTC 3LERA 3GLCA 3LXAA 4ZQMA 4YCOA 4MKNA 3PUOA 3WK1A 4RCXA 3LHVA 2OT0A 2A5HA 1QAPA 4TMBA 1A5AA 2WNNA 5CSRA 5KINA 1GG0A 1KV5A 3P8JA 5I3FA 4KWWA 4JYEA 4XZ9A 3G8RA 3G1FA 1N7KA 4QAIA 1WA3A 3TSMA 1KM2A 4RK8A 3VNDA 1QO5A 3M6YA 2QCDA 4H4IA 3MO7A 3PF3A 3B0UX 4W9TA 3WK0A 3NM3A 4IJBA 3QFEA 2QCGA 1QOQA 3DI0A 3QQ1A 2NX1A 3QF0A 2ZRUA 1OFAA 5BMXA 4Q4KA 4TMCA 4Z1BA 5DN1A 3DFSA 3MP3A 1KLZA 3PR2A 4DPPA 1QMLA 1MEIA 4BI5A 3SY5A 3CWOX 2WO5A 1N8FA 1R2TA 1WYIA 4UTHA 3P8IA 3LDVA 5SWUA 3S0CA 5LNWA 1SO3A 4RXGA 4JY8A 4UFLA 4HNTA 1BTMA 1H7WA 4K8HA 2ZDRA 4LVGA 2VELA 1OX5A 3CC1A 3S5ZA 3FYPA 4MLJA 1EP3A 1GYLA 3SIZA 1P4CA 1K7EA 3W70A 2C15A 3ANYA 1CW2A 4RZ5A 1YLVA 1JCMP 3UZ5A 1SR9A 1TPEA 2QUTA 3OVQA 3NQDA 3N2XA 1SW0A 3GYEA 3I7SA 2AAMA 5KZDA 1EEPA 1KM0A 1SZEA 1WX0A 3M1ZA 3QRHA 3Q37A 2FDSA 5D2WA 4UTMA 1M7PA 1H5YA 4PCFA 5C55A 2CU0A 2QJHA 1XXXA 2CLFA 5AC7A 4HNUA 4PL1A 5CSSA 5E93A 1XUUA 3I6RA 4HSNA 4FF7A 3CB8A 4CQ9A 1UB3A 3TC6A 4EWND 3PWAA 3FLUA 3I7RA 2FQIA 1XCFA 4JTLA 3HG5A 3UQNA 3NAVA 3DFNA 3RMJA 1M5WA 1NFBA 5D05A 3MP5A 2Y61A 4JTSA 5DBTA 4ZVJA 2FTPA 1NF0A 1Z42A 4ML9A 4XBSA 1Y0EA 3A22A 1YDNA 2BSLA 3W1MA 2VFFA 1QR7A 2PE4A 3KVMA 1G6CA 5DXXA 4EVZA 4PA8A 4Y6GA 4ZMGA 2CLIA 2ZBTA 4O11A 2CLHA 1P0KA 1K03A 1JCXA 3HBLA 4L4MA 4O54A 1KV8A 3GAKA 3LRLA 3NO5A 3BARA 5LNVA 3IIZA 2Y6ZA 1TCDA 1OFPA 2YSWA 2ZZ1A 1M7OA 3G1AA 2QCCA 3BG9A 4R33A 4KFOA 3C4UA 3NQMA 1SO4A 3HPZA 2DU2A 1H7RA 3RU6A 5DELA 4ZQRA 5CPOA 2YPIA 4NZJA 4HNVA 3LBCA 1OVDA 5U4NA 4E38A 2WPBA 2ALDA 4J9JA 1B57A 1AW2A 1XL9A 5F2MA 3E49A 3VE7A 4NJIA 2OCZA 3W7GA 4CNPA 1R2RA 5G5IA 4JTIA 3LCXA 1WV2A 4WXZA 2CLLA 4EF9A 1G4EA 3PBVA 3NQ8A 2TMDA 3L68A 5G4EA 1UUOA 2R8WA 3W1AA 4AMAA 3LV5A 1YYAA 1VQTA 5AHIA 5K9DA 3TAKA 3F4WA 3TROA 1TMHA 2FB2A 1NF7A 3WJZA 1W5NA 3NPUA 1GJPA 3NGJA 4DXVA 3I65A 1O5KA 3BG3A 5LHFA 3TMLA 1W31A 1QWGA 4HIBA 4O17A 1ME8A 3W7JA 1LP6A 3G0SA 3TCEA 1H7PA 2A4AA 5CZ0A 1UJPA 3QW3A 2PURA 1EIXA 3LOTA 3TIMA 2YFNA 3L66A 1H7OA 3CIXA 4JXCA 5HR7A 3MYPA 3QEZA 5E0KA 5LHEA 1OHLA 1QCWA 4O53A 3NQ7A 5KTLA 3EX3A 2YW4A 4O10A 3FKRA 3N34A 4CNNA 4S1FA 3GDTA 1S5WA 2Z0IA 4LRSA 4C1LA 4K8EA 3H53A 3PSWA 4UTTA 1J2WA 1J5TA 4N4PA 3W84A 2C0AA 1NVMA 4O8RA 2FIQA 2JBMA 1XBVA 2DZXA 5CPNA 1G69A 5BOOA 3A9IA 4E0CA 1H1ZA 3AJXA 4QIUA 2Y88A 3TQ0A 3W1UA 3KHJA 3GKAA 4LVAA 3EWXA 5D2VA 3G0UA 4YLWA 4C1KA 4JY9A 1LORA 5H2ZA 1PV8A 4N9BA 5F2GA 3MHGA 2CZEA 1A5SA 1VLIA 4O28A 3D0CA 5KZEA 2OJPA 1Z44A 1HG3A 2GVJA 3LCWA 1WAUA 3C0JA 3QW4B 3GIYA 4R34A 1HL2A 1J4EA 4GUIA 4MOZA 3C2FA 3RK8A 3U2OA 3PUEA 4JX6A 5AB3A 4O1CA 3HQ1A 2OT1A 3MI6A 5K9XA 3WJXA 4UFMA 3OHIA 3T78A 3RFAA 2B0MA 3NQGA 3TSBA 3W2KA 4K37A 5L9FA 4MJMA 3H54A 3TMQA 5HR6A 2DZWA 3MMTA 1GPWA 3THAA 3KRZA 1G7VA 1P1XA 1WQ5A 3STEA 1YADA 5U7SA 1JCNA 3F03K 2ZRYA 3OG3A 5CPMA 2ABBA 2A0NA 4HN4A 2A7RA 2ATSA 4M7SA 5FEXA 1QDSA 3TXZA 4BR1A 2DZPA 5BW6A 1C9DA 4FIRA 4IMGA 4TU1A 4AXKA 5TQLA 3DXIA 4ADSA 1XM3A 3NQEA 2Z2UA 1IXNA 1JRCA 4UR8A 1XBZA 2QCDB 1TTJA 3W7IA 3LCFA 4M6VA 4UMCA 5LNRA 1TQJA 1SQ7A 1B3OA 4EF8A 1EA0A 3VI2A 2J9XA 2HSAA 3EX2A 3W7LA 1W3IA 5D37A 3UNDA 4XBKA 2NWSA 4NUWA 3LRMA 1XKYA 3TJXA 4JYFA 5L6UA 5GVJA 1XDLA 4LUJA 1KFCA 3W1TA 3W3OA 1RV8A 4HT3A 3NPVA 1U83A 1LLWA 2VFEA 4TX9A 3NR0A 1H61A 3BO9A 2GJLA 1SSGA 5CZTA 4XUGA 5T26A 1JUEA 5AHMA 1KFLA 4ONVA 1DOSA 4HHPA 2OZ0A 3MHFA 3T44A 3PG9A 2CZFA 4WY0F 3QSTA 5DY2A 3HMJG 5AHEA 3E12A 3R89A 2EAWA 2OX1A 4UFKA 3LTPA 3EWZA 4TO8A 3HGOA 3R5EA 4LS2A 3GNNA 1KTNA 3HJZA 3L0KA 4XKYA 4QSHA 4L4LA 4NNBA 4A2SA 3CWNA 4FXRA 1S5TA 4JX4A 1TTPA 1YXDA 1A53A 3L5LA 4GWEA 3WJWA 1QNVA 2Y7EA 4N02A 5G1YA 1U5JA 3C6CA 4MZ1A 4AB4A 3DI1A 4NXKA 2H3BA 4AVFA 1LBMA 2X1UA 4ZQPA 2DZUA 1I2QA 3DU0A 3GDLA 1SW3A 2ISWA 1D3GA 3W2LA 3A21A 3CHVA 4O16A 2YGYA 3ZFHA 1UASA 4PTNA 4MZYA 1GG1A 1JUBA 4JD4A 4ZL1A 2G5WA 4X3ZA 2X16A 3IVTA 3P74A 4GBUA 3SGZA 1IXQA 2WSRA 2E5CA 5C5YA 4ZQCA 3GZ3A 4MIMA 3MBDA 3Q2DA 2J24A 3QC3A 3ZR4A 2Y7FA 3G1XA 4WXYA 2G97A 3SFKA 1VHNA 3NZRA 1KM3A 4NX0A 3ATZA 3O07A 4H3DA 3LI0A 4GUFA 3T4CA 3G8EA 3IGUA 5HWMA 2ZRZA 2I9EA 4N2YA 3W83A 2QEZA 3S6DA 5LGZA 2OMAA 5KMYA 1V7YA 3MWAA 5FESA 2B7NA 1LOSA 2Y89A 1QPOA 3DKLA 1Z48A 5FF2A 4ALDA 2A2IA 1FCBA 4CCDA 3U8GA 1O60A 4Z0SA 3MP4A 2W6RA 4FHAA 2Q3RA 3TU9A 2O7QA 1LRTA 2ZFAA 1RD5A 2C6QA 1VHCA 4AHPA 1W1ZA 3W76A 1ZAIA 3FA5A 3LHYA 4NJGA 4A3UA 2B7PA 5F1UA 2QCNA 4O1BA 3BGJA 4WJEA 1XC4A 5C6MA 3M5ZA 4IUOA 2C18A 3SW6A 2Z6JA 4O50A 4GUHA 4UMAA 2ZA2A 4RX0A 1ME9A 2GVLA 3TH6A 1YTEA 3P81A 1ICQA 3NNTA 4WX2A 3JRKA 2ZZ3A 5H91A 1VYPX 2PRHA 3BV4A 2ZRVA 1HTIA 3E9AA 4H6KA 5C2XA 4LV4A 2E68A 1SU5A 4HPXA 3S42A 4I9AA 3GR8A 1ZAJA 4K38A 1K8YA 5CPLA 5K7JA 1KTCA 6TIMA 4M6PA 3INPA 3V1PA 3LX9A 4JIQA 3KX6A 4JICA 1Q6LA 3G3MA 1LRQA 2C19A 2EPHA 1IF2A 1FDZA 2PRMA 3DH7A 3W75A 4AF0A 2RDUA 3QH2A 3QM3A 4M5PA 3G1HA 2NV1A 1EWDA 3FFSA 4X2RA 3OEXA 5G2WA 5HNRA 5LNSA 4UFHA 1TQXA 2V9DA 3BVJA 1X6UA 2A6LA 1EP1A 1QPRA 1H63A 2DZVA 2E5BA 1G7UA 3IVUA 2JGYA 1PCWA 1HO4A 3UWYA 3L0GA 3NL2A 4NJKA 3S5NA 2Q8LA 3BLIA 1TJRA 1W0MA 3NYZA 1VC4A 4DF0A 2A7NA 3UPWA 3GVGA 3MYOA 5AOUA 1R47A 4QNWA 4LW7A 4DO4A 3QYQA 2NX3A 1P5BA 3TC7A 1JULA 1IIHA 1YPFA 1ZY9A 1DHPA 3CTLA 1G4PA 3LGEA 2TYSA 4O15A 1B4KA 3L21A 4LS0A 1GYNA 1ICSA 2DZSA 2YYUA 3C2RA 3ZWTA 5C54A 4PC8A 3SR7A 4ZQOA 1WBJA 2WV8A 3EWUA 1F7BA 4YCPA 1NAL1 2CLKA 4HNNA 4PL2A 2VENA 2V0TA 3M7WA 4CQAA 1Q6RA 3P5ZA 3DENA 3R8RA 3W73A 4LVBA 3Q94A 1H60A 1KM6A 3O06A 5F2IA 4HKPA 5EPDA 2EF9A 5F4XA 3W1LA 1SW7A 4N6EA 4UTUA 3NQCA 1XUZA 2V2DA 2J88A 5TIMA 2JKPA 3LHZA 1MEHA 3MHUA 4R53A 1D9EA 2QCLA 5AC8A 1UCWA 1M6JA 1AW1A 3E96A 2RHGA 4JTHA 5CZJA 1PS9A 4UFIA 4JGDA 1LROA 3P80A 2XN1A 1AW5A 3M43A 4DPQA 1ZCOA 3PBYA 5EYWA 5AHNA 3W7MA 1H50A 2VEIA 5D2TA 1QPNA 2ZZ5A 2C3ZA 4NZFA 3W9ZA 4AEOA 3HOJA 1W5QA 3FOKA 1KBIA 3M47A 3HG3A 5K9CA 1YTKA 4NNCA 3OVPA 1KM4A 1ADOA 3C2EA 1PIIA 4AWUA 1KM1A 1WDWA 4MYXA 4LVFA 1I45A 4RR4A 4WUIA 1SZNA 1PHWA 3C3NA 4TR9A 3G1DA 3DHFA 3G3DA 1ME7A 1DQWA 3LTYA 3NA8A 1T0OA 3WJYA 4JN6A 2BXVA 2RH9A 2IQTA 2FPTA 4JDYA 1A50A 3P82A 1W3TA 1JQVA 1WBHA 1FXQA 2RDWA 2YXGA 3ELFA 4QISA 4UTWC 3S1WA 1K02A 2YW3A 1VLWA 1I4NA 4DF1A 4O12A 3N73A 4OV9A 1LRNA 3QMSA 3R12A 4FNRA 3DFOA 4CQ8A 4K39A 2JKAA 1I2PA 4AHOA 3FIGA 5HUPA 3KVLA 3SJ3A 3LM7A 3AO0A 3B0VC 1BEUA 4XKYB 4JTFA 1SZFA 1GT8A 1OYAA 1A5BA 1TPFA 1GQNA 3NVTA 2CZDA 4X22A 4NU7A 3JS3A 3HGSA 1V5XA 2DJLA 2VC6A 3TDFA 1RPXA 3IVSA 4FB7A 2P1FA 2FB3A 3CT7A 4JS3A 4A22A 2WOQA 4MZ8A 3VCRA 5FEZA 1LOLA 1FWWA 3GK0A 3L9CA 1AL7A 1DQXA 3LV6A 2AQWA 2BLEA 1VRDA 4A29A 4MFEA 5E1QA 3MJYA 2CWNA 3BG5A 5G2HA 4GXMA 3UWVA 4RZ4A 1X1OA 5TBOA 4OT7A 1KW1A 2E1DA 3NG3A 4FX6M 5HULA 1R30A 2QJGA 4WOZA 1QPQA 2ZTKA 4Z0JA 3THQA 4LVDA 3EB2A 1ZALA 4Q33A 1EUNA 2QUUA 1YPIA 4POCA 3C56A 4UIOA 4UUIA 1OFDA 3DZ1A 5CKSA 1GVFA 4FNQA 4MY1A 1SSDA 4OGZA 3W7NA 4DELA 3N14A 1WOAA 4PH6A 2H90A 1TPWA 4A21A 4AHQA 2H8XA 1ML1A 3DFPA 4FX8A 2QCMA 1OFOA 3KRSA 5FF0A 3NL6A 4UTJA 4ADUA 1RQBA 3DBPA 3PBWA 4FEZA 3STGA 1R46A 1RVGA 4E2BA 2HTMA 1EUAA 1OFRA 3M9YA 5I3KA 1YXCA 2GUUA 2H6RA 1EX5A 2X30A 3W6YA 1OX4B 4PFMA 1F6KA 2VEKA 2ISVA 4CLMA 3TR2A 2HS6A 1BWLA 2FPVA 5D32A 1T8XA 3DGRA 4UFJA 1C29A 2Z1BA 2ZZ4A 5K3VA 4BI7A 2XFWA 3W1QA 3W1RA 3BGGA 1F73A 3UD6A 3C61A 4D2JA 3ZWSA 2F7FA 3RF9A 2YCEA 1SFLA 1VJIA 4LUIA 4MUZA 3P7YA 4FNUA 1FCUA 4OBTA 2X2GA 4DF2A 3QQ0A 1Q3NA 3T55A 3YPIA 3BW3A 2X1SA 1OFBA 2QCEA 3NDOA 4MVAA 1F05A 4IMFA 4N4QA 1G4SA 3G24A 4JNMA 6ALDA 3O16A 3W86A 4EIVA 1LZOA 4DO6A 2I14A 3NQFA 4XWUA 3IIOA 1LCOA 5FF3A 2GJNA 3KVKA 3FEMA 3PULA 4GUJA 1GTEA 3W07A 3GDKA 4JDBA 3EWWA 4BK9A 4JTEA 3OIXA 1SPQA 3STCA 3EX4A 1UUMA 5F1VA 5KITA 2YX0A 3W71A 1TPUA 1TB3A 3NQVA 4NXSA 2NUWA 1Q45A 2NUYA 1PVNA 3M0ZA 3SSJA 3DAQA 2Z6IA 2NZLA 2Q3OA 5HINA 3B06A 2GQAA 2ZA3A 2YFOA 1KTBA 3W87A 1RQHA 1TPVA 4N9DA 5BRBA 5DCEA 4LY8A 4RKAA 3UWWA 2V2HA 4AF0B 2FPYA 1VCVA 1ZENA 2VEPA 1JCLA 3CLMA 3BK0A 3W74A 1TJPA 2B4GA 3A23A 2Y63A 4IX0A 3TNOA 3KOFA 4LWWA 4JTTA 2W79A 1W5PA 2V82A 1FBAA 3WK3A 1WOBA 1XBXA 2ATMA 2YR1A 3L0NA 5AHFA 1R2SA 1X1ZA 4NJJA 1FCQA 2W0UA 5HMSA 2HMCA 1VCFA 3CEUA 3NZ1A 4JTJA 4MYAA 5AHLA 2VKZG 3TA6A 3LTSA 1S3HA 2Y62A 1LBLA 1W8SA 3G0XA 2Y7DA 1PCKA 3VFLA 2RFGA 3LHUA 3CIWA 1ZHAA 3QPYA 4P61A
chains in the Genus database with same CATH superfamily
4PMQA 2VTFA 4FSAA 3HB9A 4O57A 2GPTA 4FNTA 1MZHA 3HO8A 3VVGA 4FO4A 4IGMA 2NV2A 3GBDA 3W7DA 1UP0A 1RD6A 4A2RA 4WGXA 4AZ5A 2J6XA 4DXXA 3TAOA 2DDXA 3OHMB 3WDQA 3HM7A 2FHBA 1KR0A 2E5DA 2NQJA 3VD7A 2E28A 3U0HA 4PODA 5K4XA 5D04C 3LHTA 3WJSA 4P8UA 4UOJA 2E1WA 4REQA 3NFUA 3CBWA 2PDGA 2WK2A 3SCRA 1V77A 4IISA 1VD6A 2BX7A 3JZEA 2PRLA 3WLSA 3A6OA 2E9LA 1YQ2A 3GU2A 3ORWA 2OWCA 4E4UA 2XGIA 4KEVA 2A3BA 3S1UA 1V03A 3TTEA 3FXYA 1U30A 4GC4A 2V5LA 4BQ2A 3T7VA 1Q7ZA 4AUBA 4UCGA 5FACA 3BJSA 2AL2B 3KVJA 4OZOA 1WKYA 4KQNA 2P0OA 4PBEA 4WKHA 3FS2A 1XQLA 2OYLA 2WSQA 3L4YA 3BSGA 3EXTA 1UW9A 3HPSA 1JYNA 5H8UA 3V3WA 3OBAA 3EOLA 2OX4A 5IRPA 4JZ5A 2QQ6A 2NSXA 4CU6A 5CGMA 4EP8C 2E4TA 3ZSTA 3HGJA 4EOUA 3BL3A 3O63A 1EFZA 1XYZA 1Z7AA 2W27A 1FWNA 4V28A 1F9CA 5DXYA 4IPIA 3IGXA 1RCXB 1P43A 1X6NA 1Y8BA 3OA5A 3HQOA 4LU0A 3CWHA 4DAFA 4LJ3A 1DQUA 2UWFA 4PTXA 1RPKA 1S39A 4JFVA 4DYJA 1CEOA 3F2DA 2VX7A 4MKSA 3CPRA 1CT5A 4DYKA 1CGWA 1EJVC 4CQDA 1S5VA 1WCGA 1VEOA 1OGBA 1XLEA 4I8YA 3W72A 3QN3A 2X0SA 2V5DA 4ZO9A 2J62A 4D6CA 2O56A 5DY3A 1JDCA 2CLEA 4Z1CA 4JTKA 1H1YA 3IGSA 1B3XA 1HKJA 3WD1A 5LGXA 4G9PA 2C71A 1TR9A 4KCVA 2QUVA 4ZSTA 2CXEA 1BWKA 3ITVA 3NQAA 3EXRA 1ZAHA 2PLKA 1J9YA 3R0KA 3M7SA 4XV0A 2YDQA 4O0QA 3LLDA 3ZT7A 4C6KA 3M0JA 5EKYA 3EXSA 1E6XM 3WBWA 1LM1A 4QLKA 3MU7A 2P8BA 4H9UA 5I3GA 3MMWA 4MAZA 1QPKA 4TUFA 1XGEA 3W7EA 2WNQA 4Z08A 3SUSA 3D46A 4OOZA 2VX5A 5T91A 3P14A 3ZR5A 1I9CB 5DANA 4IH3A 3RM4A 1TO3A 1P0NA 1MXSA 3PB0A 4KFPA 3O6YX 4DAIA 2QPXA 6TAAA 2NQ9A 2WAGA 3TWAA 3W7HA 3UZJA 5CZSA 1W9XA 4PCTA 4M19A 3MUIA 2BGSA 2VFIA 3S47A 3PUDA 2INEA 3OW1A 1GVYA 4YMZA 1E70M 1UWSA 2ZYFA 5DRCA 1VGAA 2PPGA 2XGZA 3QOKA 4O14A 4IXXA 1UWAA 4HPNA 1EP2A 3N15A 4CD8A 3VKBA 1QT1A 4GIEA 4Q4RA 1K7FA 4AC1X 1HL9A 3B0PA 5I77A 4GO8A 5BROA 1XR2A 1E4IA 2AQVA 4MB1A 1VBUA 2H9AB 1R8LA 1G01A 2I1OA 4OUEA 1TV3A 4XB3A 1VF8A 2Y8UA 5MHBA 4LCRA 4BFAA 3SECA 4P5UA 3WH5A 1UMLA 2V3EA 3GB6A 3DX5A 4NRRA 2XH2A 1W54A 4QNEA 1H0GA 1SFJA 4Q3MA 3WDHA 2BFGA 2WVTA 3WUGA 4TVCA 2WBGA 2C16A 3K13A 1MO0A 1BKSA 2P50A 3BZGA 3THUA 4DIAA 2O9PA 4HCLA 5D09A 3W2NA 3TTSA 2AGKA 3HJEA 1O5XA 2CEQA 2VXNA 3BOFA 1EZWA 1A49A 4S2CA 3VC5A 1W56A 4U31A 3DFTA 3MUY1 3QY7A 4DI9A 1L6WA 3IIVA 5CPTA 3O3RA 2D0FA 3S5OA 4OBRA 1W37A 4V1XA 4NF7A 1PYFA 1PKMA 2AKMA 4GYFA 4S3DA 3RCYA 1K8XA 3RPMA 2X1RA 3QHOA 2AL1A 5C9ZA 1JR1A 1JD9A 1QNRA 3PB2A 1OJXA 3WFAA 4BF9A 2ABAA 4GX9A 4R7WA 4RW3A 4MPQA 5DCBA 1KFEA 3N2MA 4DBWA 4HN8A 3K4WA 2GGGA 2PWHA 3SCNA 2ZQ0A 4IG2A 4X0NA 1TWZA 3E1F1 1PX4A 4QX4A 4TX6A 3PP7A 4XZNX 3OLGA 1XDJA 3E2VA 4MADA 4WD0A 2DSVA 3RO6A 3AXMA 3LRKA 3RN6A 4IPNB 1FHDA 3GDRA 4NAFA 3AMKA 1XS2A 3KOXA 7PTDA 4JIHA 1US0A 1VBHA 2C1IA 4UR7A 4GX8A 1E1EA 3UNTA 4L5ZA 3ITTA 3S9YA 1VPYA 3V36A 1Q4WA 2BXZA 4IQEA 2JK2A 3RAOA 2YYTA 1MQRA 1YDYA 2PLMA 3WBXA 3DYMA 4JHMA 3CT2A 3K2GA 5GJPA 5DFAA 4GISA 5TAOA 4O4VA 1MWOA 1QFEA 5J5RA 5CLTA 3S8HA 1TZ7A 4Q4MA 1XIFA 5HWNA 1KKOA 1L2UA 4IQDA 3VU2A 4F0HA 4XIMA 2WJFA 4GY7A 1JCYA 1F6PA 1XIEA 4K3ZA 4PCNA 3SGUA 1JPIA 4KESA 1QBAA 3UXIA 1W91A 5REQA 3RNDA 4EANA 4C60A 1EBGA 1E0VA 3U57A 1AK5A 1E51A 3WFLA 3BMVA 3GNDA 4AWTA 3QVQA 4I9TA 4J2MA 4MWAE 4ADTA 2CIPA 3TJIA 7CGTA 5I09A 2Z1VA 4UMBA 1JFHA 3IARA 4BEQA 1K7XA 3UY8A 3UXAA 3FKKA 4XBJA 1B5TA 5C9UA 2DORA 4WRHA 2DSUA 2EPNA 2INZA 3L5AA 1XH0A 3GHSA 4OE7A 3RLVA 5DT5A 1DJIA 1CGVA 4GPNA 3MSYA 2UY5A 1EPXA 5A3HA 2PLJA 4M6UA 3I3DA 3W7KA 1W1A1 1ZFJA 5CBIA 4KW2A 3V7PA 4JBRA 1FKXA 2DZAA 1ZRQA 2ZE0A 3REQB 4ROQA 4G56A 3QLLA 4KIRA 1QO2A 3AXHA 1JZ6A 3BMWA 2WLYA 4MY8A 3FJLA 3G1SA 1C93A 3W88A 1ODZA 1XFBA 3B04A 3URNA 3IEBA 2QUMA 1T99A 3GH7A 4RNJA 5ECVA 3AWNA 4HU4A 3VM5A 4Z17A 2WVVA 2CBUA 5ECUA 1FX6A 3FHQA 4NKCA 4ZZ9A 1YDVA 3WNMA 1UD4A 3S5YA 3DEQA 3EA1A 3WH7A 1OT2A 3Q65A 2VEMA 3ONCA 3N3TA 2PLCA 1PHQA 1FRBA 3O0FA 4H8VA 3BAYA 3LZ5A 3I68A 1YIXA 3FDKA 3HQPA 2EJAA 2J9YA 3IANA 1LG2A 1RXOB 4US5D 3GAYA 3W2JA 1PYMA 4AAJA 2PWUA 1B4EA 2PU1A 2G3MA 1XG3A 3R0DA 1C3FA 2V2CA 3QZAA 3WQPA 1GEQA 1DORA 3LCHA 2V67A 1KFJA 4D8AA 2I9UA 3PSVA 3CUXA 3MBFA 3H2FA 1R7AA 2HS8A 3DUGA 3PPHA 4QM1A 4GG9A 1KA9F 1QHPA 3QMRA 4MJZA 1SVDA 1H62A 1S46A 4G1KA 1L9WA 2KZHA 2YCJA 1OC7A 4IPJA 2E09A 2V63A 4MUPA 3N29A 3V75A 3PG8A 1S2AA 2ZCGA 4L9ZA 3ONBA 4XQ6A 4LRTA 1H3GA 3HPXA 3DHDA 2A85A 3ABRA 3NZPA 3UWZA 3KXQA 1HJVA 1OK6A 2F84A 1W1TA 1LLZA 1TREA 1AG1O 3O1NA 5FJUA 3XINA 4PMJA 1FHVA 3VNLA 3GLCA 1J0HA 4MKNA 3WK1A 3LHVA 2OT0A 4IP4A 2A5HA 4TMBA 3B40A 1R38A 5DX7A 1A5AA 4X63A 2WNNA 2VCAA 1KV5A 3P8JA 3L23A 4JYEA 2GYIA 2XVLA 4XZ9A 1B31A 1A4LA 4JEJA 1DJWA 2DY3A 4RK8A 3Q45A 3CUJA 2QCDA 2D2JA 5HA7A 4H9XA 3MO7A 3PF3A 4W93A 3VM7A 4W9TA 3RPDA 3WK0A 2J7FA 2PBGA 4R5EA 3WY1A 3QF0A 4LUSA 2ZRUA 1J6PA 1OFAA 1QXLA 5BMXA 1WDPA 3DFSA 4QQUA 2XISA 4CU7A 2WSKA 1OADA 4BI5A 4QJ5B 1FWFC 3CWOX 4LAKA 5EMYA 1DTUA 1A0EA 1N8FA 2GUBA 4PUWA 1R2TA 3T8QA 4Z1YA 2OOGA 3S2JA 3RRAA 3T42A 4AZCB 4XZHA 5LYRA 1DIEA 4JY8A 4NZCA 4UFLA 4ZEPA 3O0KA 1RCOB 2VELA 4H9YA 2IPWA 3ZIZA 1EP3A 3W70A 4IJCA 2YDSA 3PZQA 1FH8A 2P3EA 4RZ5A 1YLVA 4E3VA 1HP5A 2WVUA 2WBKA 1PTDA 4H04A 4KCTA 3PPCA 3LA4A 1SW0A 2R6OA 2PP0A 1RBAA 2OYMA 4TTGA 3MCNA 2FDSA 1WDSA 1M7PA 4FOKA 3R94A 2CU0A 1U1UA 1XXXA 3WH6A 4GVGA 2KAUC 4HB7A 1FH9A 4QBXA 5CSSA 5T9CE 1XUUA 4KWSA 3CB8A 3KS5A 3BICA 2DGAA 5A8NA 1B9ZA 1LQ0A 4EWND 3EPMA 4PUJA 1ZCCA 3FLUA 1KXVA 4F9DA 3MA8A 5A6BA 1V3HA 2RDXA 3AIVA 1QU4A 4GY0A 4N42A 1K4HA 2Y61A 4QXIA 4Z42C 1Q66A 4ZVJA 1Z42A 1Y0EA 2VP8A 2PF8A 3WDIA 2XVGA 2QGYA 1UH2A 4M24A 3T6CA 4MSSA 4ZMGA 1K03A 1P0KA 1JCXA 2WXDM 3F4VA 1KV8A 3GAKA 3LRLA 3V4BA 1JCTA 3CB3A 3NO5A 1J0IA 2DUXA 5LNVA 2VD8A 3IIZA 4LF1A 2Z4GA 4PYSA 1MW1A 1IZJA 3UJSA 3VUSA 3CL6A 3EMQA 3N12A 4L1GA 2W4XA 1UKSA 1DJZA 3RU6A 1Y7VA 3S5SA 4A3RA 3N17A 2YPIA 1PTAA 2XIMA 1D8CA 2ODOA 1EGVA 1OVDA 2RAGA 4FP1A 3WN6A 2ZXDA 3V0SA 2FGZA 4H6EA 4PMUA 1B57A 1XL9A 3VE7A 1FWIC 1PX8A 3PK7A 5CLWA 1R2RA 2VR2A 1XYMA 4LFYA 4WXZA 4C7DA 3V0UA 4EF9A 1XPYA 1DXFA 4L4PA 2VZVA 2YXOA 1FWCC 3DERA 2FVLA 1VQTA 1XLIA 1TMHA 2FB2A 1RJPA 3QV9A 3T9PA 4CD5A 2BHUA 1FHLA 3GVWA 4B3ZA 1DP0A 4PUEA 1Y5WA 4F2TA 3M6DA 3TMLA 1W1VA 4BQ4A 4DWSD 3UERA 2XSXA 1ME8A 1XYBA 3G0SA 3TCEA 3P3BA 5C2GA 2FZ8A 5CZ0A 2JEQA 4EPBC 1UJPA 2CXGA 2P8CA 3OLEA 3QW3A 3SDOA 2Q6ZA 3LPGA 4HP5A 3S2MA 4RNFA 2FVMA 3L66A 5B80A 1H7OA 1NELA 2J77A 1EO5A 1SJDA 3SB0A 3A3XA 4IIDA 1JZ4A 1UYQA 2EQDA 4HSHA 4DVOA 1OCNA 3QEZA 3N2TA 2X0HA 3NQ7A 1XYLA 3OZYA 5KTLA 3EX3A 4X61A 1M03A 4H8UA 1S5WA 1WKDA 3BLOA 3CV1A 4K8EA 3WD2A 1UQZA 3EDFA 4N4PA 1V0MA 1EJTC 2C0AA 4J28A 3W27A 4WDWA 2JBMA 4IQJA 1OIMA 1TX2A 1K1DA 1G69A 1Q85A 3SUTA 2ADAA 3R0UA 3R7MA 1W1IE 5BOEA 3G0UA 4EXBA 2FMNA 4N9BA 5F2GA 3CHCA 2EBNA 4D8LA 1T6MA 5KZEA 1RAKA 6REQB 4GXPA 3LCWA 3AMDA 4K68A 3VNKA 2J7DA 4H7VA 3IUDA 4K8GA 3C2FA 3STPA 3RK8A 4IFRA 4AIBA 4JX6A 3ZYZA 2CKSA 4PCPA 2FZMA 3T78A 3W2KA 4DZHA 4K1GA 3TSBA 1YRRA 5DF0A 4AZIA 2W66A 3PANA 1VEPA 3HA1A 4I9MA 4AEEA 3KRZA 2QZRA 3KW3A 1G7VA 2OSXA 4PGLA 2UY2A 5HMDA 1TG7A 4EPDC 2Y1HA 1BYBA 4E3TA 3QZ6A 4H2HA 3GTNA 5FKYA 4DUWA 1QI5A 3GFXA 5BZAA 2ZE3A 3OG3A 3T0CA 5HBFA 1GORA 2ABBA 5D8ZA 4BCEA 2ATSA 4AX6A 2VYOA 3WCZA 5FEXA 3UU0A 4LAZA 5BW6A 2QUNA 1J18A 1Q4NX 3B8SA 2PDCA 5GJNA 3T0BA 3A3WA 2Z2UA 3CPUA 1Q8JA 5I2UA 3OU8A 1EQPA 4UMCA 3HV8A 1JZ8A 3IK4A 1FVPA 5JBDA 5A2BA 2WSPA 1EA0A 3W7LA 4D1JA 1W3IA 4XBKA 3IS4A 1E4NA 1XKYA 3TJXA 5GVJA 3VOHA 4HT3A 2XIOA 4ICMA 4F0SA 1MDRA 4TX9A 2PWDA 1J0KA 4FXJA 4XUGA 5T26A 2IW0A 4M82A 4DM1A 4ONVA 3VA8A 2DH3A 3VCNA 4O8AA 4WY0F 5DY2A 5AHEA 2EAWA 2OX1A 4Q4SA 3EWZA 4TO8A 3QBUA 3HGOA 3R5EA 3GNNA 2BG5A 2HROA 4NNBA 1DWIM 3W4RA 5I02A 2AOSA 4MHBA 3R8HA 1S5TA 2XM1A 2OLAA 1Z6KA 3DHPA 4QG8A 3L5LA 4NAEA 2FJUB 4GWEA 1QNVA 3GZAA 1U5JA 1T41A 3CZKA 3VDBA 2EEXA 3MCOA 1EC7A 2Y5JA 1LBMA 1WZAA 2X1UA 3DU0A 1I2QA 3VGGA 1QI3A 1D3GA 4I3GA 1MW2A 3A21A 4O16A 3R10A 2WHJA 3ZFHA 2VWTA 1ZJBA 3AIWA 3NTYA 4JD4A 2G5WA 2HEJA 1PDZA 2E8YA 3ZR6A 4GBUA 1IXQA 5C5YA 2XM2A 4LANA 2CESA 3MBDA 4CKQA 4HMNA 3BCJA 3PTKA 4S3FA 3TQPA 2QGHA 4HNCA 4PMZA 2CZVA 2Z26A 3KL3A 3TZFA 2I57A 1VHNA 4G7EA 4PTVA 1TKKA 4H00A 3H6OA 4CUCA 3AS2A 1F3XA 3IGUA 4F8XA 2VDGA 1IWPA 2OMAA 3UG5A 4M80A 2Y89A 4OKDA 4ALDA 2A2IA 4C1NB 4ATWA 4DLFA 4Z0SA 3ITGA 3CAVA 3TU9A 1LRTA 2VRJA 1RD5A 2ZUUA 5JQ9A 1CLVA 3K1GA 4CD4A 4FA3A 1S2TA 3UETA 4GVFA 2PGRA 4YVPA 1W1ZA 1ZAIA 1E1CB 4NJGA 5HPOA 3CHDA 1SMAA 1XC4A 1UJQA 2QT3A 3OG2A 1ME9A 3SCOA 2ZICA 4G5DA 2PDXA 3GFYA 2ISFA 1KCLA 2VJXA 1MRAA 3KUMA 3JRKA 2ZZ3A 5H91A 4L4OA 2VRQA 2PRHA 3BV4A 3FVDA 4LV4A 2E68A 3OP2A 1SU5A 2C1GA 1ZAJA 2X42A 4E8CA 4M6PA 3V1PA 1HKVA 2F38A 3KX6A 4JICA 1Q6LA 5ABHA 5EBAA 4GIRA 2EPHA 2WMJA 1XSJA 4QDPA 5IOBA 1I1WA 3H2NA 3APGA 4X2RA 1W3HA 5G2WA 5HNRA 3OODA 1QPRA 4I5XA 3OZOA 3KBSA 4B5VA 1G7UA 1BTCA 2V3DA 1HO4A 1GNXA 3NSNA 3IACA 2J75A 5EGRA 3HURA 2E9MA 1FHUA 1W0MA 3CV7A 4CGTA 1VC4A 3UA4A 2A7NA 1CLXA 4XAGA 4BF5A 3MYOA 1R47A 4QNWA 3U2CA 4NAFB 4LSBA 4DO4A 3QYQA 4XD4A 3AOFA 1JULA 2G3FA 1TJ1A 3T1GA 3IAPA 3LGEA 5TD4A 3L21A 1DJGA 1PPIA 1X98A 1C7TA 1E6QM 4LS0A 1ICSA 3DC8A 2OQYA 3SR7A 2OGJA 4CNTA 4YCPA 2CLKA 4HNNA 4PL2A 4S3AA 1KCXA 2V0TA 3M7WA 4JFUA 3P5ZA 2PP3A 3GH4A 1BYCA 3Q94A 1XCXA 2GSHA 2IMRA 5CJNA 5F2IA 1XYCA 5IFPA 2QLYA 4U3CA 3CAKA 3FDGA 1SW7A 2J66A 1BRLA 1B0IA 3OBEA 2JKPA 2VDIA 3EEZA 2P5NA 3WDJA 1ODUA 4OTKA 2QJMA 1D9EA 4IFKB 1M6JA 2E3ZA 4D6FA 2RGLA 5CZJA 4MF4A 1KKRA 3URQA 1IWBA 4QGCA 4OECA 4DPQA 1GONA 3SRKA 4CN6A 2OSYA 4WSJA 4QLLA 2NQ5A 2WW5A 3W7MA 2VEIA 4DJDC 1UWTA 2A3CA 3BJFA 4HCDA 3HZ3A 3MVTA 2C3ZA 1BSIA 1UP3A 3FJ4A 1KBIA 1BQCA 3RLGA 3W81A 5GNXA 5K9CA 1YTKA 4NNCA 4PRWA 3OVPA 1ADOA 1TVNA 4FMVA 3QQWA 3C2EA 1EL3A 4LVFA 3W24A 1EEXA 5H8MA 2XG9A 1SZNA 1C8QA 4J35A 3AUOA 1ME7A 1ONWA 1QK0A 3LTYA 1FOBA 4NZ3A 5MF5A 3D3AA 4JN6A 1R9XA 2BGNE 2BXVA 3P82A 1WNOA 4Q6JA 2WM1A 1WBHA 1JI2A 4QISA 4TQTA 5CAHA 3M0XA 2W91A 4PE8A 1GOQA 2G41A 3N73A 3RM9A 3ISIX 2JKAA 4R88A 4Q8WA 4AYGA 4AHOA 1E9YB 1CXLA 1MZRA 3FIGA 2E25A 5HUPA 3B0VC 1BEUA 4XKYB 3VK5A 1SZFA 1OYAA 2XFYA 1UD8A 4C5YA 3HGSA 2DJLA 2VC6A 3IVSA 2XVNA 1XLCA 2CNCA 1V6XA 9CGTA 1B3VA 3CT7A 1DWFM 4A22A 3EOEA 4GQ0A 3WLRA 3C0SA 1AL7A 1VRDA 3H22A 5E1QA 3BUVA 4YS1A 3QLDA 4GXMA 5TBOA 3LPOA 2D2GA 4GI6A 1R30A 2QJGA 4M1RA 3RCNA 4RPQA 3THQA 4OFCA 3EB2A 1ZALA 1MXGA 1SMDA 2QUUA 4POCA 4HA4A 4DZ5A 3LN3A 2OQLA 4UUIA 4C6PA 3DZ1A 3K4AA 4RNHA 4PH6A 1EKOA 3E6EA 1Q2SA 4V1YA 3NL6A 2GGIA 3TN5A 3WG6A 2HTMA 3GC5A 3M9YA 1YXCA 1EX5A 4KCWA 1F6KA 2ISVA 2HS6A 5BCAA 5ABGA 3ZM8A 3DGRA 4R7OA 3A4AA 3CHEA 3IV8A 1DXEA 4RNIA 3N2OA 3BGGA 3HMCA 4GQBA 3TP4A 3BAKA 3BCDA 2IPGA 4CQCA 4MUZA 5AVHA 1FCUA 3CK5A 1NDWA 4KETA 1PZ2A 3WLOA 5JH2A 2X1SA 2PP1A 3NDOA 3CZGA 6ALDA 3W86A 3TYUA 3VDAA 4JCLA 2I14A 5FIPA 3L2MA 5JUVA 3NQFA 4XWUA 2GJNA 1TV2A 4MAVA 3FEMA 2V5JA 4KMQA 1UR3M 1GTEA 1QW9A 4JDBA 1V7AA 1DE5A 1SPQA 5F1VA 5KITA 3H70A 3G1RA 1E3XA 3EKGA 4PB4A 4LUSB 1F3TA 3VYLA 3RIKA 3GC4A 1RY8A 3NUKA 2NUWA 4BY3A 3GXMA 1HT6A 2E67A 4W7WA 3SSJA 2TODA 4QCFA 2Z6IA 3A3HA 2GQAA 1XP3A 3W87A 2OYKA 4I5UA 1GPFA 5DCEA 4LY8A 3UWWA 4WIWA 4AF0B 4V33A 1YBQA 2AKZA 3BDKA 3A23A 2Y63A 1UD6A 2JIEA 3QY8A 1ELSA 3WMBA 4HK6A 4YJ5A 1TZ9A 3CQKA 1EHNA 3NXLA 4G2DA 2PZ0A 2R82A 1DJYA 1FCQA 5KEZA 1MVYA 3CEUA 2YIHA 2BY2A 1VJZA 4Q6XA 2POZA 5AHLA 2VKZG 1JD7A 5FJIA 2V3GA 3GXDA 3R25A 3AMCA 4HNLA 2QDDA 1Y5XA 4P61A 2VEFA 2YL9A 1KFBA 1RJQA 1SFSA 3FEQA 3N4FA 3L2IA 4QAWA 1K3UA 1KXQA 1H5VA 1NJJA 4DJDA 1VFUA 2QDEA 4H8NA 5BOFA 3ARYA 1RJRA 4Y96A 3R2GA 2C91A 2CCRA 1TRDA 4NYUA 1GKRA 2PB1A 2F61A 3E0LA 3RGTA 3DG3A 4GH1A 3PBMA 4Y90A 2QDGA 1TMLA 4M7TA 2E6FA 3C52A 2IPFA 2R9RA 1JDFA 4KWOA 3CU2A 4DUOA 3U7VA 1TPB1 3R13A 3T2PA 3XISA 3N3MA 1JJKA 1RCQA 1E3ZA 2PI6A 2QCFA 3KCOA 4AMCA 4LOCA 4MDOA 3KBVA 4PMOA 1CYGA 5I3JA 2HVOA 3MKCA 2ZZ6A 3B8DA 4L9XA 4GQRA 2VC9A 1UPMB 2Q02A 1ICPA 2TRSA 1Q6QA 2EG8A 3BW2A 3L67A 2A21A 4J1OA 1MEWA 5HQEA 1U2YA 4FXFA 3V0TA 3W7QA 2ALRA 1OF6A 2CETA 1HJXA 2XWDA 4X0VA 3ZZ1A 2WNZA 3W1PA 1I2NA 1V3MA 4Z1AA 4DO5A 1JNDA 5G4WA 3CAWA 2R1NA 2MUCA 4ZB5A 4JFWA 1VP5A 1LYXA 3BJTA 5AN7A 3WF1A 1R3QA 3NQ2A 2Z28A 3TFCA 1TTIA 3TZNA 3S1XA 3P2VA 4MG4A 2G3NA 2CWXA 3WLQA 3TONA 4ATLA 1M7JA 1ITUA 5DRIA 2CLOA 5MKGA 3JR2A 1UKTA 4FX7A 2FVKA 3PBUA 4FNSA 3NL5A 4M51A 4URIA 2YLAA 1DWAM 2Y24A 3AAMA 2D0HA 4XK2A 4UOZA 3WEMA 2BVTA 1KRCC 3GKFA 3EOOA 2WWCA 3EWCA 3E0VA 2P0IA 1VAHA 5KSWA 1HFBA 4MLRA 3ES7A 3L5MA 5HUOA 1GVOA 2PMQA 4NZ5A 1GOXA 3VMOA 4K36A 1E56A 1BPLB 2DQXA 4L9YA 5K2ZA 2VVNA 1GQLA 1YEYA 2JEPA 3EX1A 4G6CA 2EPLX 2VR5A 3EX6A 5CBBA 1FQ0A 1A5UA 3TXVA 1VPXA 4IT1A 2CFFA 2Q09A 1CDGA 2F8QA 1ISVA 3Q58A 4UQ9A 4UTIA 3CUIA 1Z3NA 1SJAA 2JQXA 3G1YA 4M56A 3IJ6A 4A3YA 4WY0A 2OGYA 5A6BD 1WKEA 5HATA 3UWUA 5GPRA 3CHFA 3UESA 2I5GA 4YXGA 2FFCA 2PDWA 3IAQA 2JF6A 3W7PA 5D03A 1AJ2A 5A8GA 2EKCA 3ZT5A 3GX9A 3SN4A 4W88A 3C2OA 4DBEA 1THFD 1REQB 4LEQA 1UHVA 4QHRA 3WBEA 5AYZA 2WMIB 2V69A 1DIKA 4DUXA 4ICNA 1EHAA 3N13A 2G96A 1E71M 4F0KA 3E02A 1W6TA 1RLDA 3KWSA 2XH4A 4L6OA 1H4PA 5FEPA 2V6AA 2GFTA 3P67A 1PO9A 3W85A 1QUMA 1O68A 1US2A 1WXJA 1E0XA 3W23A 3VOJA 1K9EA 3THDA 3O6CA 3W1NA 2QXWA 4BI6A 3KBWA 4P2VA 2WZIA 2BHYA 4FOJA 3N2BA 1CECA 2WQPA 4BS0A 1CX9A 3DC0A 2PC8A 3C8FA 4RV8A 4UQCA 3NM1A 3SCUA 2FZNA 1OFQA 1FWTA 3MUXA 2X2YA 5TF0A 4CNOA 1GVIA 4HA0A 1V6UA 5IM51 2WKGA 4BQ3A 3WLPA 5I00A 1EC8A 1Q7QA 2Z29A 5I78A 2DUAA 2VFDA 2XIBA 2ZX9A 4FLSA 1OX6A 2QNEA 4PZVA 1XLLA 3TJLA 3MB9A 1JPKA 1UBSA 4GVHA 3B3DA 4W84A 5CBJA 1C91A 3TW6A 1MFUA 3CEPA 4KGJA 1V0LA 2JIWA 3HF3A 2NX9A 2X1IA 4KFNA 4IUGA 1W9BM 3O6DA 3NPXA 4PUKA 1J10A 3IV3A 8CGTA 5M2FX 1T8QA 1X7FA 1DIDA 3IUIA 2A1YA 2YLLA 3LM3A 1OF8A 4KBXA 2GVGA 3M64A 5HDRA 1PDYA 1G4TA 3K46A 5A5WA 1JRBA 3TUUA 3TX9A 3M07A 3VKJA 1HJSA 5RUBA 3VOGA 3CZEA 1KM5A 3O8AA 4QSFA 1NWTA 1Q6OA 1T96A 4JTGA 1ZJIA 4KRZA 2TPSA 5D30A 4R3UA 2ZIDA 1W3JA 1JDEA 2CBJA 3HTWA 3ABOA 2DZBA 3P84A 4D8ZA 3AUJA 3CM4A 3S4TA 2HK0A 3N19B 1WXYA 3QFWA 2XJ7A 2W67A 1Q5MA 1JVNA 4C90A 4B2DA 4LTSA 1OEPA 1XICA 1KLYA 4L1WA 5A6KA 4AWSA 3PJUA 3GU9A 1Q6EA 1UA7A 4EAMA 1TFVA 4YHEA 3WQDA 1NP2A 1XX1A 4HK5A 3F4NA 1XFCA 3PUGA 5I3HA 3HIJA 3LBMA 4FNPA 2YBUA 1C92A 1PXGA 3KRUA 4ACZB 1ZUAX 2VX6A 3AS3A 3SRFA 4MY9A 5CCZA 4R7JA 5EFDA 1VZWA 3KOWA 4TVDA 3P5YA 4DM2A 1K8ZA 1S1RA 4WCJA 1Z32X 5LNUA 3K30A 3LCIA 4H7ZA 4AFYA 2NXHA 3T0AA 2GQ8A 4R27A 2EXOA 2V8ZA 1BXNA 2NWRA 1ZL1A 3WL1A 1J79A 1H7NA 2GGJA 1W3NA 4HHLA 1HJQA 3MW7A 5EMKA 1SO5A 4OHQA 1DJQA 3LB0A 5HWJA 1YDOA 3AMGA 1P7TB 2QF7A 3ZVHA 1XI3A 1OWQA 4UTKA 4H9MA 1AH3A 1UIPA 1POJA 4LC8A 1IXPA 4B90A 3ZT6A 1XINA 1UWRA 5DEZA 5DBUA 1XRTA 1EJUC 2OFJA 1E0UA 3MPGA 5FD0A 1OC5A 2WKLA 4AU0A 8XIMA 1OSEA 1VCGA 3RXZA 1JF6A 2ZRXA 5ENLA 3UXDA 1R3TA 3CUZA 1BVZA 4MB3A 2PCQA 1EGMA 3WYZA 1VYRA 1CI1A 1IWAA 3NZGA 2ZUTA 1TV8A 4CN1A 4ES4A 1JCJA 2E6DA 1HNYA 4GBDA 3TA9A 3MI2A 4AD4A 4DEFA 3W00A 2BV9A 2V30A 3UF9A 5FF7A 4KRUA 1NIUA 5JIPA 3AHVA 3BTNA 5HJLA 3FSTA 5BWFA 3TOYA 3WMLA 3SO7A 2C13A 2J7CA 4GC3A 4U3AA 2DV0A 1EZ2A 4NX5A 4JR5A 1FWSA 4XISA 7TAAA 5I06A 1AZ2A 1FY6A 1R3SA 3AROA 4US5A 4CQBA 2HE8A 2W9MA 3IGHX 3P60A 1BGGA 5DLCA 3FJ6A 3ZXWA 3PS7A 2HPMA 1AZ1A 3STFA 1JEZA 3GVQA 4XZMX 2DUZA 2VUYA 4WF7A 3GG0A 3HG4A 5D9MA 4I7WA 2LLEA 3VDGA 2WZTA 3C2VA 1O66A 3MDWA 3TYDA 4LS1A 3VNMA 5D2XA 1E6ZA 3GDMA 4PUMA 4CU8A 4DQWA 5EMUA 3N9RA 1KBJA 4N6FA 1YNQA 2EPOA 3FX4A 1GVSA 1IV8A 3W2MA 5M03A 1RZMA 1H0IA 1L6FA 4NJHA 2HDJA 1I2RA 1AJ0A 1IGSA 2YKKA 1FDJA 2H3DA 4FLQA 2G0WA 1V51A 3NQ6A 1ZP3A 1BHGA 1EDTA 4K7VA 1P6WA 1M53A 4OU1A 4IMCA 3T0DA 3LERA 4DJFD 3LBOA 1B1YA 2DIEA 1QAPA 4NI3A 4IIBA 2J25A 5I3FA 4KWWA 1DE6A 3W53A 4I5RA 2QJNA 1N7KA 3CV2A 2EPKX 1US3A 3PBGA 1QO5A 3BOLA 3M6YA 3WLIA 2JF7A 1QK2A 1LJYA 2FMOA 3AJ7A 1XC6A 4M8UA 3ZJ6A 1MQQA 5I24A 1D2KA 1N82A 5E6YA 4HK7A 4FLOA 3QQ1A 1W17A 2XHYA 2ZWZA 1EH9A 4Q7NA 1O5RA 4TMCA 3LLXA 3U4AA 4DPPA 4S3JA 1MEIA 1UD3A 3SY5A 2D2HA 1MYRA 4FPSA 1T40A 3PZGA 1SFTA 1WYIA 2VNCA 1XPGA 3ZSSA 5D4YA 1JPHA 4GHRA 4J5NA 1SO3A 2OKOA 1UQYA 3QGKC 4K8HA 4A8LA 3F2BA 1WDQA 2C15A 1ZS2A 2XH7A 3UZ5A 1X96A 2OQHA 2AAMA 4U2ZA 1EEPA 3C8NA 1SZEA 3QRHA 3M1ZA 3FAXA 3Q37A 4UWMA 4XKMA 1GJUA 4HD5A 5E0CA 2ON3A 5C55A 2PTDA 2CLFA 5AC7A 1IEQA 3XIMA 4PL1A 3EYPA 1WPCA 4GCXA 5FSDC 4CQ9A 2ZC8A 4F48A 2FGLA 1BVNP 3I7RA 2FQIA 1QRQA 1XCFA 4JTLA 3HG5A 1QVBA 3FVMA 2X8RA 1NFBA 4MWAC 2VCCA 5CC6A 4JTSA 4Z2HA 4HU3A 1NF0A 4ML9A 4XBSA 3A22A 4QCEA 3VOFA 2ANUA 2VFFA 3H23A 1B3ZA 4GA8A 4D6HA 1HXJA 2PE4A 4FALA 3KVMA 1UZ4A 1O7AA 3I10A 3W02A 2F6KA 2CLIA 3AYTA 4LPCA 1QW7A 1YNYA 4LUTB 5FAGA 1FWDC 3BARA 3WLHA 4HBKA 4FS9A 1BF2A 1W1B1 1O1HA 1M7OA 4EACA 3JUGA 4E2OA 1JPMA 3ZLFA 2PD5A 2JFEX 3W01A 1VIWA 2HJPA 1H7RA 2E7FA 2FFIA 4AXNA 4NZJA 1EO7A 2OXNA 4E38A 5U4NA 3H7RA 2O0TA 3OVGA 1R3RA 5CSYA 2OCZA 3T09A 2DH2A 4HZMA 3UP8A 5G5IA 1XIGA 3LCXA 1WV2A 2CLLA 3NQ8A 3H7VA 4DB7A 3L68A 5G4EA 3WUEA 3W1AA 4AMAA 2QV5A 2QIIA 3TAKA 3F4WA 3TROA 1PEZA 4TOQA 3V5CA 3NGJA 4DXVA 3GNXA 1ONXA 3W26A 3BG3A 1OZQA 4HIBA 4O17A 2J8GA 2Z1SA 1J96A 3VINA 4F40A 4ZGYA 4IGNA 6XIAA 1R86A 3LOTA 1PKNA 4YTRA 1XJBA 3CIXA 2YA1A 4JXCA 1UR1A 3MYPA 3BMXA 2IPJA 4JN8A 5E0KA 5LHEA 1OHLA 4O53A 4AY8A 2GJXB 1S3TC 2YW4A 4JFSA 4TV5A 5AKQA 3URAA 3WF2A 3FKRA 1FWJC 3VKKA 1K8CA 4B5XA 3B8VA 4YTQA 3TN6A 4LRSA 3H53A 3LEPA 3PSWA 1R6WA 4B16A 1NVMA 2X7VA 1XBVA 3K8MA 2PTWA 2WZEA 5JXQA 4NASA 4GNKB 7ENLA 3SRHA 3A9IA 4E0CA 3VMPA 2F2HA 2Y88A 3D6NA 5A6SA 4LVAA 3PZOA 2X09A 3HFTA 5D2VA 1E4MM 3SADA 3DFHA 4HOWA 5T8GA 4O28A 3GHRA 3D0CA 1N8IA 1Z9AA 1WAUA 3C0JA 4DHGA 3GW3A 3GIYA 4LBRA 1HL2A 1J4EA 2O92A 3LGDA 3EB4A 2PZNA 4C6DA 3HQ1A 3HN3A 3MI6A 3EA2A 3WJXA 1O12A 3OHIA 4YVVA 1XD0A 2B0MA 4K37A 3OJGA 2BOGX 3TMQA 2XSAA 3MMTA 4ILSA 3SAZA 1P1XA 2J74A 1NDVA 3GM8A 1YADA 1VFFA 4I9JA 1JCNA 4Q8PA 3QTGA 2A0NA 4HN4A 2A7RA 1HVQA 4BF7A 1XH1A 4GI9A 1WDRA 2VGIA 5CC7A 2D1ZA 2UZ9A 2RGMA 4BR1A 1K9FA 4HQVA 4HA1A 3GBEA 3M0IA 2WYSA 4GKLA 4X2PA 3TYZA 1QNOA 4TU1A 4WJXA 3DXIA 1M3UA 5C9WA 3PN8A 3F2CA 2VZOA 3W7IA 3ERPA 3U5UA 1OD8A 3VZYA 3LCFA 3GIQA 1BYAA 4JNYA 1SQ7A 3QY6A 4EF8A 4HYWA 4JFTA 2GOKA 4LYKA 3EX2A 5D37A 4QJ3B 5GJMA 2NWSA 3LRMA 5L6UA 1KFCA 1IZKA 3W1TA 1CXKA 3W3OA 3MSDA 1RV8A 3MO4A 1LLWA 1YPXA 3NR0A 3L4TA 2GJLA 1SSGA 4DNHA 5AHMA 4MWAA 1KFLA 4LNCA 4HHPA 2J6VA 2OZ0A 1GOMA 5T9BG 4DJED 2J78A 4LALA 3SIMA 3PG9A 3CZLA 4MTVA 3QSTA 3WQGA 2ZWYA 1BFNA 3VNJA 5BXPA 3FN9A 4HVXA 4JTCA 2DSWA 4H9ZA 5CH9A 4PUNA 3EDDA 1KTNA 4D6GA 4QSHA 4L4LA 1L8PA 4A2SA 3CWNA 2ZVIA 1TTPA 2Z27A 2VCBA 4JQ3A 1A53A 2O9TA 2Q8XA 2Y7EA 1IT0A 2BVYA 1JZ3A 4ZQPA 2DZUA 5DMNA 2REQB 3GDLA 3W2LA 2NW0A 4PUDA 2YGYA 1UASA 4IF2A 1GG1A 2GVYA 1B54A 2VT0A 3VGHA 4X3ZA 2X16A 2C0HA 2L5HA 2OKTA 1X8CA 3CLWA 3QC3A 2Y7FA 4WXYA 2SFPA 4H41A 2Z7GA 3MS8A 1I6NA 3ATZA 4RV3A 3CL7A 4H3DA 4KEZA 1GOWA 3LI0A 4EXAA 2V3FA 2BOFX 5HWMA 2WJEA 4EE9A 1WB0A 1TX0A 3MMDA 1FA2A 3TTYA 3AXKA 3S2CA 1V7YA 2W62A 4M1BA 1TA3A 1CGYA 1LOSA 2NQLA 3DKLA 1FP8A 3WNPA 2QPUA 1RP9A 4CCDA 4S38A 1GUVA 3HV9A 4JTRA 3MP4A 2W6RA 2AGTA 3FCPA 3UG3A 2C6QA 1XGZA 4GIYA 2YL5A 3DG6A 3N4EA 2ZX7A 3IRSA 3LHYA 4A3UA 1XLBA 4WJEA 1QWKA 5JMUA 4JKKA 3SW6A 3AXIA 4GUHA 3S6OA 4PRTA 1F8MA 3WUFA 1E6PA 3TH6A 1YTEA 3P81A 5FA5A 1R3VA 5XIMA 1V02A 1ZBKA 4WX2A 2WMKA 1RLCL 1W2VA 2UBPC 1HTIA 4Z2LA 4H6KA 1HN1A 4QE4A 4JOMA 3S42A 2YCLA 4B3KA 4AEFA 1XIDA 4K38A 2B81A 1V3LA 5HANA 4LYRA 3INPA 4AZ7A 5BRPA 1W32A 3LX9A 3IUHA 3ARTA 1ADSA 1CXFA 3DH7A 2PRMA 5D9OA 3UBPC 2Y0FA 1EJ7L 2NV1A 4Y2WA 3ZJKA 4F79A 1ZSXA 3OEXA 5LNSA 1MXDA 1TQXA 2V9DA 3BVJA 5CC3A 3L7RA 2HV5A 2BNJA 1H63A 2JALA 2ZUMA 4Q8NA 2JGYA 3L0GA 3NL2A 4INFA 1XRSA 4NJKA 2Q8LA 1TJRA 1A0CA 3RR1A 4DF0A 3UPWA 4LW7A 3FGCB 5E5CA 5LA2A 1XHGA 3E5BA 3TC7A 4PTMA 3C5QA 1ZY9A 2QVNA 3VIMA 3FK4A 1VJSA 3T0TA 1GOIA 2TYSA 4PB3A 4O15A 4MPKA 2Y4SA 4CEXC 2IUZA 4CN4A 2DZSA 2YYUA 3EPNA 3ZWTA 1B30A 5HK4A 1DHKA 3EWUA 1NAL1 2XUCA 1G0CA 2VENA 1SJCA 3AS0A 1Q6RA 1U1JA 1NTHA 5GNYA 4LVBA 3TNBA 2DW6A 1QNPA 3O06A 1XKJA 1J8VA 2WCGA 1ITCA 4GO9A 1K9TA 7A3HA 3SFWA 4JKLA 5EPDA 3PZMA 1XF0A 4ZE4A 4QS6A 3OGVA 1HW6A 3UPMA 3NQCA 1XUZA 1T7LA 3LK6A 3B8WA 3VILA 1MEHA 4MJ2A 3MHUA 2PWVA 5AC8A 4WSKA 4FR1A 4W8LA 2RHGA 1K6WA 4JGDA 4QDMA 3NO1A 2AL2A 3C86A 1UIOA 1E72M 1ZCOA 4N7QA 3PBYA 5AHNA 2YB4A 1UR9A 1H50A 5D2TA 3BLDA 3PPGA 5JH1A 2PFHA 3W9ZA 3LENA 1I0BA 2D0GA 3M47A 3HG3A 2PF0A 1UZ1A 4EWJA 1HX0A 4AWUA 3BGAA 1KM1A 1WDDA 2MNRA 1I45A 4E8DA 4RR4A 4ERGA 4A6GA 3RG6A 2IQTA 2FPTA 3PWIA 2DQWA 4TV6A 5A2AA 1U33A 2ZXBA 1OB0A 4RDZA 1VLWA 1J0JA 4DF1A 4O12A 1TUXA 1LRNA 3QMSA 1MFVA 4B3LA 4JAWA 3Q67A 5CPSA 1I2PA 2XIJA 2ZX8A 1QOXA 2HVNA 3H12A 4MJ4A 2PDQA 4WK9A 2ZOXA 1TPFA 2CZDA 4NU7A 4M29A 3TDFA 2P1FA 3VCRA 3R1ZA 5FEZA 3VIOA 2XVKA 3I6TA 1LOLA 1FWWA 3S9ZA 3HPFA 4AZ6A 3LV6A 4A29A 5ABFB 4AD0A 2VZTA 3BG5A 4B5WA 5E09A 3R6IA 3UG4A 2YA2A 3AMLA 4OT7A 2E1DA 4ICCX 1UKOA 3LMYA 4JIEA 2G37A 5GNZA 4ZCWA 4C6CA 2PDJA 1XD1A 4HZ8A 1MDLA 2CBVA 3MQTA 1OFDA 3ARRA 4B2DD 2B31A 3L4ZA 2V68A 4MY1A 4B4FA 4EPKA 3RLHA 3WLJA 3N14A 1WOAA 4QG9A 2H90A 4PBFA 1TPWA 1I1XA 1DJHA 2C8NA 4AHQA 2H8XA 4FR6A 4EPEC 1ML1A 3DFPA 1J0ZA 3KS6A 2I5IA 4FX8A 5M5DA 2QCMA 4UTJA 4FEZA 3STGA 4E2BA 2RUSA 2OR2A 5EU9A 1OFRA 1NWRA 1F4AA 3TR2A 1CTNA 1ZP4A 3FHAA 2FPVA 3CJPA 3GXFA 4E4FA 1IR2A 1C29A 5K3VA 3CMFA 2XFWA 1PWMA 2WZHA 1ISYA 5A8QA 3OPSA 2H9AA 4GXWA 4UZUA 2NVCA 4D2JA 2DVTA 3SRDA 2F7FA 2YCEA 2YJQA 4LUIA 1UH3A 3P7YA 1RHCA 1LL4A 4DF2A 2VOTA 3T55A 5DT7A 3YPIA 4UTFA 1NOWA 1OFBA 2QCEA 3PZNA 4IMFA 4N4QA 1G4SA 3O16A 2D24A 1UD5A 5B7YA 1QHOA 4PRRA 4GUJA 1O1ZA 4W87A 4P8VA 2DT1A 2PGEA 1AUSL 3L4WA 4LQ1A 3STCA 3EX4A 1UUMA 2OB3A 2YX0A 3W71A 1TPUA 2POTA 1KCKA 4NXSA 2NUYA 1ZBWA 4EAYA 1PVNA 2HXTA 4OUIA 1N2VA 2NZLA 5HINA 5I23A 3CPGA 2ZA3A 1ZGDA 5BRBA 1PZ0A 1PIFA 4IP5A 2FH6A 4Q4PA 2AMXA 2V2HA 2VMFA 1JCLA 3CLMA 3EMCA 3W74A 4A3HA 3OB8A 3SBFA 4RDVA 1PUDA 3R79A 4LB4A 3L4VA 4JTTA 3NVDA 1CXIA 3WK3A 1WOBA 3KLLA 5IFTA 2YR1A 3GYCA 5AHFA 3SURA 2OZ3A 1R7OA 2NLYA 4NJJA 1LL6A 4L6HA 1TUFA 2PDKA 4JTJA 1DJXA 3QR3A 4P7RA 5A8OA 3Q4DA 3LTSA 1S3HA 1JAKA 1LBLA 1W8SA 3VFLA 3LHUA 1ISWA 1ZHAA 4L1XA 4NQ1A 3WBAA 1KFKA 4GFIA 4XTDA 1JPDX 4J3XA 3S83A 3CMJA 5AYXA 2FJKA 1OCJA 4W89A 1LLOA 4Q8UA 1B2YA 3ARQA 1HIZA 3CL8A 1AQ0A 3F5LA 4CNSA 5D9NA 1BVWA 1LT8A 4G1NA 4WOQA 2HE5A 4RE4A 1UR8A 5J5DA 3VNIA 1L6GA 1OFEA 3OA3A 3SQSA 1C8XA 4ASTA 3H4GA 4JQ2A 3APTA 3DKJA 2XSBA 1MMFA 2GUYA 4JCMA 1EYWA 3RR4A 5F4SA 1UC4A 3MTWA 1BXBA 4D9PA 1AMKA 4O0KA 4GJJA 4XD3A 1A0DA 1MSSA 1EB3A 2RKXA 4GFSA 3N1AA 3OVRA 2C14A 3WLNA 5HNNA 1JGMA 1ZNNA 5I0DA 1XDMA 4GJ1A 4HJFA 1UZHA 2BWGA 1PSCA 4PTWA 4R9XA 4ORMA 3KEHA 2Y5SA 4LC6A 2Y70A 1EXPA 1C8VA 1TV5A 1TPH1 4M0XA 2VGBA 1YW1A 1A4MA 4G8TA 1JZ5A 3UXLA 1C9WA 4HU0A 1BYDA 2QAFA 2PDYA 7REQB 4E2VA 3PTQA 1U5VA 1EX1A 2YDRA 3DYOA 1NFGA 3RITA 4GI4A 2A3EA 2H8ZA 3ZVIA 3QJAA 2XIQA 3DG7A 3VIJA 3A4JA 2W92A 4RPPA 5F4WA 4HMCA 2YXXA 4QFUA 1R3YA 4X9YA 4GRSA 3NL3A 1UKPA 3UXKA 4B5SA 2ASHA 1G9HA 4IX2A 2PUZA 1RA5A 3PWGA 3WENA 4JKMA 1KGXA 1N55A 4M6QA 1AJZA 3F5KA 3F1QA 2PC4A 3IRDA 4JIIX 3GD6A 3REQA 4TIMA 2D3LA 4O1AA 3A4WA 1IR1A 2O4QA 4DWSB 4LT9A 2GDQA 2OLSA 3ANUA 3SCVA 1NDYA 5EA9A 1B3WA 3ABXA 3GXTA 3KAOA 1OT1A 3H7UA 1E9ZB 3I4EA 3EZ4A 3WD3A 4ML4A 1CZ1A 1SO6A 1OINA 3OTRA 9RUBA 1YXYA 3PJXA 1A3WA 3WQFA 1OBAA 4L80A 2WHKA 3QMTA 3M46A 2FKPA 5G1TA 2QF8A 3WO8A 2P10A 4QS5A 1M65A 3J7HA 2PDHA 4JYDA 3UY7A 1GW9A 3L2LA 4PB5A 1S2UA 3SI9A 2OWXA 3VDCA 4LNYA 3I3EA 1MQPA 4E4PA 2QDHA 5CG0A 1XGDA 3NEVA 4O1DA 1TPDA 4IICA 3U7BA 5CC5A 1ALDA 1NSJA 3IJ9A 1TJ0A 4JEQA 4K7YA 4WDTA 1W8GA 4N9CA 3OBKA 3QKEA 2YZRA 1QI0A 4QDWA 1XYFA 3RHGA 5EB8A 4NYYA 3QOMA 3BXWA 1M1BA 2OOFA 4KCUA 5DO8A 3OQEA 6ENLA 1S38A 5DMMA 3GW0A 3W7RA 3M0YA 5LIUX 4KWUA 3NEHA 1XG4A 3B8UA 4F0LA 3GSMA 4O1FA 1BG4A 2O7SA 2WJZA 1OYCA 3SEPA 1HL8A 3VKDA 4E2DA 3G2GA 3M0LA 2VQUA 2XZ7A 1VPQA 1DV7A 1EJXC 1RALA 3UWQA 1OM0A 4QTGA 1KRMA 4ACYA 1DVJA 4GE8A 3AICA 3AIQA 3B9EA 2WCAA 3IJLA 3UCQA 4BWLC 2BODX 1J6OA 4V2XA 5FI8A 1VKFA 1V6VA 2X1TA 3H55A 2E6AA 3W22A 2PTXA 1XW8A 2ZA1A 3QTPA 4AQLA 1IIGA 1VR6A 2BBFA 2QIWA 3SY8A 2B7OA 3EKZA 3BLFA 4UOQA 1QHZA 1OC6A 1GOOA 1GVRA 1R9ZA 5D2YA 4XTIA 2XINA 3W2UA 1D3HA 2E77A 4QJ1A 1HKWA 1JQXA 4GNJA 3T2QA 4OWGA 1FDYA 3BQ6A 2VFGA 1BKHA 1DL3A 2QCHA 2J47A 3N9SA 1TIMA 2ZUNA 3MI3A 3SSZA 1GZJA 5BRQA 3B03A 4IGHA 4Y8FA 3MZ2A 4ERAA 4UQBA 2V38A 1JXJA 3M5XA 1LT7A 4CCEA 4B5TA 1L6SA 8RUCA 5M3WA 3S6TA 3CQJA 3WNOA 4CD6A 1I8JA 3M44A 2BP1A 3G22A 4RUBA 3TQKA 3OLIA 3UW6A 4D1IA 4MDPA 3KL5A 3UYIA 5AECA 1BF6A 1F76A 1JF5A 3KCLA 3QZEA 1EXBA 4WSHA 1OG0A 4WQ6A 1GCYA 1BQGA 1TELA 5D8WA 3H2CA 3T2OA 2CLPA 4IFOA 1UZDA 2HNEA 1PE1A 4DJFC 1RA0A 4GLEA 5LIXX 3EWBX 4NNAA 5M1TA 3WD4A 3O2LA 1KWGA 3KLKA 3VXGA 1J5SA 1UUQA 5G1MA 3CGTA 4NHVA 3BAIA 4REQB 3M41A 4RLIA 1VS1A 2V81A 4PUUA 4BJHA 5D38A 2HRWA 4ZODA 2ACQA 3GXNA 3RX3A 4KEMA 1SUXA 4F2UA 2TSYA 3KE0A 1NP0A 3ZOAA 2VD9A 3PJWA 1BWVA 1IEVA 2WPGA 5I3IA 3VCCA 4L56A 2ZUWA 1TA3B 1XLAA 3NGFA 5A95A 4IMDA 4MNKA 1K9DA 2DP3A 3KL0A 4D6EA 2OSWA 3UCDA 3NPWA 2IKIA 5FJRA 2WKJA 4HGXA 3EKLA 1XH2A 3UVAA 1YTDA 2XPKA 5FF4A 2YBVA 5FL1A 4NP7A 2ACRA 1F07A 3OLDA 4GH3A 3RRXA 2DJXA 3O05A 3QPZA 4IIGA 3GXPA 2VFHA 1Z89A 4DBDA 1PZ1A 5F2LA 2PDNA 2WJDA 4N9EA 4EK7A 3BW4A 1XLHA 1LL7A 2WQDA 2J27A 3I3BA 4MGGA 1UROA 1HKKA 2YCLB 3HG2A 1HKMA 2Q01A 3A24A 1O94A 1WUEA 4JTAA 5CGQA 3AI0A 2CZ5A 2BTMA 3AYSA 3GDBA 1NARA 4PTDA 3E0WA 4S3EA 1DKWA 5I03A 2GLKA 1DWGM 1UOZA 3NIYA 1OCQA 3A5VA 4KH2A 4MWAD 4UC5A 1RR2A 4RDYA 2R1MA 4GINA 3KCJA 1ZBCA 2UY4A 2EGZA 4O19A 1AD4A 3TYAA 1CGXA 4B5NA 3EDJA 4W8AA 2ISSA 4AVOA 4CD7A 4XO6A 2J7HA 1NWSA 2DPEA 3CUHA 4LBUA 1F2JA 1RK5A 4HTBA 1WZMA 1NOFA 4UNKA 1W5MA 5BMWA 2ZUSA 3PY2A 5H1WA 2BVDA 3TV8A 4C6IA 5LZLA 3UZYA 2JGQA 5LSMA 4U4MA 3SUUA 2CHNA 2GOUA 2XN2A 3VIGA 3CH9A 1Z69A 3VE9A 2FDMA 3PC0A 1H51A 4ORIA 5DCDA 3BAJA 1C90A 4BWLA 4B4HA 4AISA 5A6JA 3TC3A 2PWEA 7TIMA 3T05A 3I7QA 3VGFA 1X8FA 2A7PA 2NQZA 3U6WA 3UYCA 4YWIA 3ABQA 3H2EA 3QV6A 3EDKA 2IQ0A 3IIPA 3SGGA 1I2OA 2R94A 1L8NA 5CPQA 3DFQA 3UZWA 3SCSA 6REQA 2PU0A 2IXUA 2JKEA 2Q8ZA 4DN1A 3B4UA 3GE7A 5FJPA 3FA4A 3KDOA 5EMJA 2FHCA 2WSYA 3WF3A 3S1GA 4QR6A 1TRIA 3B9NA 3MUCA 1W1YA 2QAPA 4O18A 4MMWA 1V08A 5CQ1A 1LBFA 2OWWA 3LYEA 4A4AA 1F61A 1OIFA 2V5BA 2R14A 2UY3A 3O9NA 3TFXA 3HQNA 3E2SA 5IXEA 4PMXA 2GSJA 4R85A 4YCOA 3CV6A 1ZLPA 4RCXA 4P7LA 3GS6A 5CSRA 1Q13A 5DQPA 3UFYA 3B8IA 3G8RA 4US6A 4DJFA 4L65A 3TSMA 3VNDA 3U48A 4GIAA 3DCPA 1A5LC 1IT8A 1P0BA 3K8KA 4GYJA 1IE7C 4B9YA 2Y5EA 4GGBA 3VMNA 3DI0A 4PMVA 4S23A 2NX1A 4LGXA 4XZLX 3E2QA 3VIHA 4YN5A 4Z1BA 1KLZA 1XSIA 1IEWA 2GSEA 1CGUA 2WO5A 1XLFA 2J4GA 3P8IA 1ZPTA 5BWAA 1L2QA 4BHYA 3TYBA 2DT3A 2DT0A 4RXGA 4GMEA 1BTMA 4IG2B 4LVGA 4NRSA 1OX5A 3CC1A 1W2PA 3FYPA 4MLJA 3SIZA 1K7EA 3UR5A 3ITCA 2HVMA 1EJRC 1CW2A 1FKWA 1PX3A 1SR9A 2QUTA 4GY1A 1EF3A 3NQDA 2O55A 3W38A 5HJYA 3VD5A 1TVLA 1Q6CA 3VZXA 4D6IA 3UJRA 5KZDA 1KM0A 1WX0A 2EJ1A 4TX8A 4ZOBA 3MSRA 1FWGC 2QJHA 2I17A 3DN5A 1J11A 3H8AA 3VGEA 4HNUA 5J8LA 1JDDA 1HKIA 3WFZA 4W85A 3I6RA 1XV8A 1AVAA 1UB3A 3GO2A 3URBA 3PZ9A 3PWAA 2PCEA 2I16A 3GQYA