3EWWA

D312n mutant of human orotidyl-5'-monophosphate decarboxylase in complex with 6-cyano-ump, covalent adduct
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFENRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Orotidine-5'-phosphate decarboxylase
total genus 100
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ewwA00
1XDMA 1I2QA 3GKAA 2VEPA 2GQAA 3BW3A 3W7CA 1BWLA 3SFKA 4WXYA 4GUJA 2OCZA 2X30A 2ZZ7A 3O15A 1P5BA 4NZJA 2DZPA 3FEMA 2CZ5A 3HIJA 1QPOA 4K39A 2VFFA 3TK7A 1FWWA 5CKSA 5A5WA 2PE4A 4K38A 3E9AA 3GLCA 3KAOA 5DELA 4O1AA 2ZRUA 3NG3A 3LHTA 3MI3A 3FYPA 2YR1A 1KTBA 1SW7A 2VELA 1H61A 1TB3A 1KV8A 1U83A 4AWUA 3F4NA 1A53A 3IVTA 1KA9F 2PC4A 1UBSA 2C3ZA 3N9RA 1DQXA 2JKAA 3NQDA 2LLEA 2YXGA 2X1RA 1ZCOA 2JGYA 1GYNA 3EX1A 1OVDA 3W2UA 4UTWC 3MW7A 2CZDA 1KM3A 5EY5A 1D3GA 3IIXA 4O4WA 5K3VA 2FFCA 3PVFA 1VS1A 2HTMA 1NFBA 1WV2A 3O6CA 5D04C 1BTMA 3MO7A 2TSYA 1XL9A 1WOBA 4XTDA 2D73A 1JJKA 3CEPA 5F1UA 4BWLC 2ZRWA 3LERA 4O14A 5HNRA 1YDVA 1C9DA 4WZHA 3OBKA 1MXSA 1DHPA 1K8YA 3PWAA 1PL9A 1KM2A 3U6WA 1PHWA 3E49A 1ADOA 4QSHA 3OVQA 3UWQA 4PH6A 3W1NA 1PE1A 1F2JA 4LW7A 3GVGA 1ZALA 4O1CA 2ABAA 4HSNA 5FEPA 1W5NA 3L5LA 1G7UA 3E0IA 3MP3A 1YXYA 3SGZA 2JKEA 2C19A 2ABBA 3C8FA 1OHLA 3LDVA 1RPXA 4R53A 3LRKA 1Z44A 4Y6GA 3TQKA 4IMGA 4DF1A 4YLWA 3B8DA 4JX4A 5DCBA 4N9DA 4O19A 2OT0A 5AC7A 2QUTA 1ALDA 3U8GA 4E2BA 4FXSA 2A7NA 3HOJA 5CPOA 4LS1A 3T40A 3P60A 1RZMA 2QJHA 4JDYA 5HMSA 4Z0SA 4O10A 5C2XA 2YFNA 1G4PA 2DORA 1LBFA 5BW6A 3QEZA 2EPHA 2X1SA 3PUEA 3I65A 2Q3RA 2UV8G 4A2SA 3V1PA 1TREA 5LHFA 1AW5A 2ISVA 3ABRA 3RLVA 4IMDA 4HPJA 1G69A 2WSRA 4BK9A 1UB3A 4O0ZA 3HQ1A 4O57A 1O60A 4RZ4A 2J27A 4Q32A 1OX4B 2BXVA 4TR9A 3IIOA 1GQNA 1GYLA 1SU5A 2YSWA 4UFKA 4NNAA 2H6RA 1IF2A 4JD4A 1I2PA 3MHFA 3W86A 1JRCA 4KFPA 3H53A 1TPWA 1MO0A 3TAKA 3N9SA 4LC6A 1LOQA 1EP1A 1G4SA 2YDAA 4TU1A 2NUXA 3W7RA 4UTTC 5DXXA 5CZJA 1F6PA 2QEZA 3SI9A 1OYBA 1AW2A 1WOAA 4PFMA 3LV6A 5C5YA 5EPDA 3W84A 3DGRA 4E2DA 4LS0A 1FDYA 5D38A 4AWSA 1TRIA 1TJPA 1JR1A 1N8FA 3TJXA 1JUBA 2WSYA 4XZ9A 1Z48A 1TO3A 2EF9A 2A85A 2TPSA 3FJLA 1Z42A 5D2YA 4A29A 1YLVA 2GVLA 3VE7A 3QJAA 4PODA 1JCLA 3HG2A 2DZVA 3B04A 5G5IA 2GJLA 5U7SA 3RNDA 4YXGA 1J4EA 1JQVA 2WV8A 3CB8A 4HNVA 3DH7A 2JGQA 2G97A 4ZQOA 1YPIA 1VCVA 5D30A 1TYGA 2NX3A 3MMTA 1ML1A 4YCOA 1TTQA 3PSWA 3QMRA 5KZDA 2ISSA 4AHPA 4JGDA 1OG0A 3MI6A 3WK1A 3W71A 2QR6A 4Z08A 4MIMA 3ZS4A 3NM3A 1XDLA 3G24A 2DJXA 1YXDA 4FNSA 3L66A 1WQ5A 2RDTA 1T99A 1VYSX 1O95A 4H4IA 1TMHA 3I7QA 4Y90A 1EPXA 1IGSA 3IIPA 4UXDA 5I3JA 4UC5A 1IXQA 1W56A 3OIXA 3PSVA 2YX0A 4R34A 4CCDA 3FKRA 3MI2A 3BLEA 1LRTA 2QDGA 4K6AA 3DXIA 4QIUA 4H3DA 2CLOA 4NNBA 3LXAA 3LCHA 4CNPA 3P80A 1JULA 4AVFA 3PC0A 3OVRA 3CIXA 4POCA 1OF8A 3G18A 5AHIA 1KFCA 4JYFA 3W70A 5K9CA 3LHVA 3TIMA 1O5XA 2NXIA 4IGHA 5HWJA 3WJSA 5FEZA 3TQ0A 3A5FA 1TPEA 3BGGA 3C2EA 2ZTKA 3BPWA 3QQ1A 2Q8LA 2ZRZA 2NXGA 3KVMA 1LP6A 4JR5A 3W83A 2CW6A 3GR7A 3W6YA 3LRLA 3SECA 2A1YA 5G4EA 3STFA 3A22A 4FHAA 1PHQA 4FIQA 1VH7A 3UY8A 4P61A 5U4NA 3BO9A 3NQ2A 1QOPA 4MLRA 4KWWA 2GVGA 5LGZA 2WPBA 4LUIA 1B57A 1WBJA 4U4MA 3BG3A 5AC8A 2CLEA 2FPYA 2ZBTA 2ZRYA 1SSDA 3FA5A 3W76A 3PM6A 4H6KA 4E38A 1ZY9A 4RJEA 4UFMA 2C1HA 4EIVA 3R89A 1TPC1 3KVJA 5E1QA 4WJEA 2BWGA 3O63A 3W1XA 5D03A 3EX2A 3M5VA 4FB7A 2R94A 4RKAA 1NAL1 3MYOA 4A22A 3AJXA 4I7UA 1F73A 3O16A 1GVFA 4MLJA 5EMUA 2VOMA 5AFDA 3LLFA 5G4WA 3M6YA 1XUUA 3GDLA 3NL2A 3G1YA 4LUJA 3TMQA 3I7SA 3GIYA 4R7JA 4OV9A 4RV8A 4GNJA 4GFSA 2QJGA 4I7VA 3TSBA 4LU0A 1XKYA 3G22A 4HN4A 2J24A 4OHQA 1PS9A 2A2IA 3N14A 5DN1A 5CZ0A 1VYPX 5DBUA 3WFAA 3NZRA 3W85A 2RDUA 2FB3A 2NWRA 4JIPA 2ZCGA 1P1XA 5G2WA 1XBXA 2V2HA 4JTEA 4PTNA 3F4WA 1OFBA 1A5CA 1QWGA 3TDFA 2DZUA 4JX5A 4S1FA 3UZ5A 1W0MA 4M6QA 1FWRA 3T55A 2FB2A 2Z0IA 3NVTA 3CEUA 4LVBA 4S2BA 1SO5A 3NQ8A 1KFLA 1ICSA 2V5BA 1G4EA 1TTJA 2JKPA 1SW0A 1FXPA 3PBUA 4RXFA 4O4VA 4WX2A 1VLWA 1LDCA 1TPB1 3T78A 3L21A 4RK8A 4WOZA 1MEIA 1F5ZA 2JK2A 5DXYA 3KRUA 3W75A 4O18A 1V7YA 3LCLA 3NA8A 3P5ZA 5C55A 3NM1A 4DO6A 3L0KA 4GUGA 1LRQA 3GZ3A 3W23A 4BF9A 4K7VA 3G1AA 3NQVA 1M7PA 3LHWA 4CQ9A 4CNOA 3RFAA 1ZFJA 4U28A 5C54A 2CZFA 3L65A 1FBAA 3LX9A 1VR6A 1B9BA 4PC8A 4M6PA 4JY8A 1LM1A 4MZ1A 3KHJA 3NNTA 5TIMA 4MFEA 1J2WA 1KM0A 3NR0A 5AYYA 1OYCA 1M5WA 1OX4A 1ZAJA 4KWVA 3THAA 5D05A 3DI0A 1JCXA 1B4EA 1QCWA 3EWYA 5D02A 1FWSA 3H55A 1WX0A 3LTSA 4LWWA 5HWMA 3O1NA 3HMJG 4PA8A 5EA9A 2QKFA 1KW1A 1TCDA 1W1ZA 1RVGA 1W37A 2V30A 5CG7A 1Q6QA 1TTPA 5FF7A 4LV9A 3ZR4A 5KZMA 1LOSA 2C6QA 1LROA 1FUYA 1QNVA 1C29A 4O11A 4OGZA 4MYAA 4XWUA 1W5PA 4ORMA 3PB2A 3S9YA 3EX6A 1OFPA 3UQNA 4ADSA 2W0UA 4PL1A 2EAWA 4AAJA 1KM1A 3GX9A 1FWNA 4O0KA 1GZGA 1PVNA 1YXCA 3EXRA 3QSRA 1K3UA 4RR4A 3SSJA 1JCMP 4UMCA 1QPQA 5AYZA 4HNTA 3W7MA 1BEUA 4UNLA 3ZWTA 1W8SA 4K36A 1H7XA 1QO5A 4YL2A 4K8EA 1CX9A 4UTHA 3F03K 3BVJA 2B0MA 3TV8A 3KRSA 5IM51 2ZDRA 4OT7A 5CZTA 4LRTA 1OYAA 3CLMA 3TKFA 4D2JA 1TQXA 2V81A 4Z1DA 2E5DA 1CI1A 5F4SA 1YTKA 1FCBA 3QYQA 2C18A 3C61A 3B03A 2H8XA 2RKXA 4FNQA 3FIGA 1LYXA 3G1VA 4IJBA 2ZFAA 3MHUA 2VFEA 3NQAA 1H60A 1AG1O 1OF6A 3W7DA 1XI3A 4CCEA 4DPQA 4ONVA 3R2GA 1W5MA 1F7BA 2CWNA 1TPUA 1VLIA 3Q37A 2HSAA 2PRMA 2XN2A 3LBCA 1Z41A 3W7KA 2H3DA 1DORA 2DZWA 3PY2A 1DJNA 5TBOA 5HUPA 1LBLA 3EWUA 2B4GA 5LNRA 4LRSA 3NL3A 3ANYA 4NX0A 2H3BA 4DXVA 3UY7A 4BWLA 5LSMA 1T8XA 3UZJA 1HO1A 2G95A 3W07A 5T26A 1XBZA 3BLFA 1H7RA 3UWZA 1ZHAA 3C2FA 1KM5A 4FNUA 4UR8A 1XM3A 3G1XA 2OMAA 3P81A 3HG3A 4WXZA 4OQVA 3M9YA 1L6YA 3ZWSA 2E1DA 4GUHA 4CCCA 5IBXC 1L6SA 3QFEA 2PURA 3TNOA 1D3HA 5E93A 4O53A 2GQ9A 1OK6A 1TV5A 1FQ0A 3ATYA 3DENA 2J9YA 3C0JA 2F7FA 5I3GA 4A3UA 3B06A 3EWBX 4O52A 1DKWA 6ALDA 1Y0EA 4UTJA 1CW2A 4NXKA 3PG9A 4EF9A 1KV5A 1RQBA 3W73A 3DU0A 5FF0A 2YPIA 4X3ZA 3DFQA 3R12A 4NJIA 1YDNA 1L6WA 4DELA 3VE9A 3W2MA 3TXZA 1X1OA 2G96A 4Y9AA 1S3HA 2E6DA 3EB2A 5I3KA 3FKKA 4M7TA 3YPIA 1I8JA 3TC7A 1OFDA 5BMWA 4Q4KA 3B0VC 3CHVA 1H1ZA 2HS6A 3NPVA 2V2CA 3NGJA 5KITA 5CZSA 1Q3NA 2FTPA 3L68A 4RZ5A 3P8IA 4JTGA 1TPH1 5D2XA 4BI6A 3BG5A 3W2LA 3BGJA 4NJHA 2YZRA 5LZLA 3DFPA 2DP3A 5D32A 5G2HA 4Z1BA 2VENA 2J6XA 1X8FA 3NL5A 5J5DA 3QZEA 4E0CA 1K02A 2CU0A 2NV2A 3W7LA 3HPZA 3LCGA 5BRBA 1RV8A 4A2RA 5FEWA 1ZJIA 3CTLA 3G3DA 2PRHA 1ZAIA 1GOXA 3OHIA 4LT9A 3W7OA 4AB4A 3D0CA 2ZRXA 3NQEA 3QH2A 5AN7A 3STEA 3W1MA 1AL8A 3SR7A 3DHFA 2Y7DA 5LNSA 1M6JA 4XKYB 1LZOA 4JNMA 3RU6A 4IX2A 4NZFA 4HKPA 1NEYA 1QOQA 2YW4A 3E02A 5D2TA 4NJKA 4ZQMA 4HHPA 1C8VA 1JCYA 4UFHA 4X22A 3GXNA 2ZYFA 4XQ6A 2WO5A 2FPVA 1WYIA 1M7OA 1D9EA 1RQHA 4ALDA 2HS8A 3TQVA 2X1TA 4FX6M 4UFIA 4ZZ9A 4UCGA 3E12A 3C3NA 2Z6JA 3W7GA 1GG0A 4UTMA 3EKLA 3MJYA 3K30A 3HB9A 4LNYA 3PB0A 2WNQA 5AHMA 1QO2A 2NXHA 3PG8A 2P1FA 4Z0JA 4IMEA 3UWUA 1VZWA 1QPRA 4PL2A 1H5YA 4WY0F 2QCGA 1GTHA 1Q45A 5G1TA 3QPZA 3B4UA 5H2ZA 1FX6A 2J9XA 3L5MA 1DL3A 3BW4A 3TXVA 2V82A 3Q2DA 1R2RA 1X7FA 1FY6A 1F05A 2NWSA 4PCFA 3EX4A 3G1HA 2NX9A 4FNTA 4C1LA 4IPJA 5AB3A 3GDRA 1KM4A 3P84A 3A21A 3UXAA 5CPLA 3QW4B 1TPFA 3S1UA 1H1YA 4HT3A 2X1UA 4RLIA 1FDZA 3HF3A 1S5VA 1X1ZA 4JY9A 3Q94A 4QJ1A 1N55A 5G1YA 4M7SA 1SZNA 4M6VA 3DI1A 1R2TA 1KBJA 4FO4A 3DZ1A 2R14A 5FF4A 4DQWA 1H51A 3N34A 1EA0A 3LXBA 2IQTA 2XN0A 5C6MA 4IXXA 3MP5A 5AHNA 2CLFA 2PRLA 3FOKA 1WDWA 1IIHA 3C2VA 1Q6RA 3HGOA 4ZMGA 1B3OA 3LOTA 3P74A 3KX6A 2Y63A 3P7YA 1W31A 4NUWA 3W1PA 1AK5A 1SZEA 1JRBA 2A0NA 4ADUA 4JICA 2ZZ2A 3W7EA 1LOLA 3TH6A 1ME8A 3H54A 1YYAA 3M5YA 8TIMA 3KRZA 1KTCA 1UJPA 5ABTA 1KTNA 4N9CA 4GUFA 4UFJA 5AHLA 2AQWA 4IMFA 3IVSA 1OFRA 2ZRVA 5HUOA 2QCNA 3CPRA 4N6FA 4GUIA 2O7QA 5HR7A 5MHBA 3IGUA 3N2MA 4NNCA 5K9DA 3GR8A 3I6RA 3KVLA 3NQFA 3C2OA 1I2RA 3IGSA 3MUXA 4RX0A 2E68A 4IQLA 2RFGA 5LNVA 3CIWA 3TFXA 1BWKA 3EX3A 1IIGA 2C15A 2W6RA 2DU2A 4MJZA 3S1WA 4QNEA 4TMBA 1G67A 4O1BA 3EXSA 2I9EA 3LGEA 4IWWA 1EUNA 4KFOA 3TAOA 1EIXA 4NX5A 3LHUA 3HPXA 4NQ1A 1EP3A 3G0UA 1P4CA 3NQ6A 3M41A 1GEQA 1XXXA 1DOSA 3DFOA 4O50A 5HJLA 3QSTA 3O8AA 2ZA2A 2FPTA 3L0GA 4NT0A 3TC6A 4AH7A 3ELFA 3NAVA 1LCOA 1TPVA 1OX6A 3T4CA 1VJIA 1Q6LA 4I9AA 3HGJA 2PCQA 2X2GA 3CT7A 4RCXA 1XFBA 3WK0A 1K7XA 2GOUA 2H90A 4O17A 4JTSA 4HIBA 3W7HA 4MJMA 4CLMA 3BK0A 4UTTA 2XN1A 4LS2A 2V8ZA 4YCPA 3UWWA 5CSRA 4FEZA 4ZQNA 2W79A 4UR7A 5LKYA 1VHCA 1HO4A 1SO4A 4P2VA 3RK8A 5LGXA 4K7YA 3G3MA 4AMAA 5FEXA 3CM4A 3BARA 3W7IA 4ZQRA 1H7OA 4GJ1A 5L6UA 4WQ6A 4JXCA 4MYXA 1EUAA 1ZENA 5J5RA 2OZ0A 1YTEA 3O07A 3STGA 3HG4A 3W7JA 4ADTA 3NEVA 3HO8A 6TIMA 1JUKA 2ZZ1A 3DKJA 5DY2A 2YW3A 2WJZA 4N2YA 4O13A 3S5OA 5I3HA 1FCVA 4AHQA 2QCHA 1GPWA 1PIIA 1GJPA 1U5JA 4FX8A 3VKJA 1JCJA 5F1VA 1SUXA 4IUOA 3MBFA 1GWJA 3WJXA 1VC4A 4N6EA 4NJGA 1TV7A 1TQJA 1WXJA 4WOQA 1SPQA 3PBVA 2A5HA 2Y61A 4YWIA 3QPYA 2EGZA 3W1LA 4ZQCA 3S5NA 5KTLA 1AW1A 3SIZA 1WBHA 4XKYA 3I7RA 1QAPA 4DF2A 4N4QA 3SGUA 1LLZA 1P0NA 3GNNA 5I3IA 5BNKA 1I2NA 4QNWA 2AGKA 4TIMA 1PCWA 3THQA 3UWVA 3EWXA 2Z6IA 5GVJA 4LVFA 3CU2A 2Y89A 3SW6A 3WJYA 2QAFA 5HINA 1FCUA 3B0PA 5AC6A 3W87A 2CZEA 3S1VA 3M43A 1QFEA 3DFTA 4ICNA 1AL7A 3STCA 1ZAHA 1ONRA 3C2RA 5BMXA 3PBYA 1I2OA 1SFLA 2AAMA 5F2IA 3FLUA 5FESA 2RHGA 4MZYA 1H7WA 5AHEA 1ICPA 3JS3A 4LC8A 4TMCA 3NO5A 2GVJA 3FFSA 2CLHA 4JTFA 2H8ZA 4O12A 3O05A 4A21A 4AWTA 3EEGA 2CLLA 4FNRA 2YYUA 3HG5A 3L5AA 3KVKA 3VCRA 2C0AA 2VEIA 3GAYA 2VEMA 2WNZA 3DBPA 1TV8A 3IVUA 3O06A 3KFTA 1HL2A 4JS3A 2Q8ZA 3KXQA 1F6KA 2Y62A 3C52A 3W1TA 4JX6A 2E77A 3PAJA 2NUWA 1TJRA 3TR2A 3TMLA 2G5WA 5F2MA 1H7PA 2E09A 5KMYA 3VFLA 5AHFA 4JTJA 3NPWA 3LM7A 2ZTJA 3PR2A 2J9ZA 5F2LA 2E6AA 3W74A 3ATZA 2ATMA 1GVOA 3GK0A 2X16A 1V5XA 4QITA 1YTDA 3LXCA 1J5TA 3QQ0A 2WQPA 4JEQA 3UD6A 3Q58A 1I45A 1KFKA 5A8GA 3MHGA 2Y7GA 3P67A 3QRHA 3W2KA 5EL1A 3NOEA 1DQWA 1KFJA 1QPNA 1NSJA 2QCMA 1ME7A 3LI0A 2FQIA 2DZSA 2ZA1A 2ZZ6A 1W3TA 1H63A 2ZZ3A 2ZZ5A 3PS7A 4MY1A 2A6LA 1OFOA 1KLZA 2YGYA 5HR6A 3GAKA 3BLIA 1NVMA 1UUOA 1K8XA 1MZHA 3LB0A 5LNUA 3S0CA 2NUYA 3TE9A 3V75A 1ICQA 3MP4A 3PF3A 1O5KA 4I7WA 3M16A 5KZEA 3W2JA 4UMAA 2Q3OA 4QM1A 3CWOX 4KKXA 2I1OA 5CGQA 2TRSA 3PULA 5K2ZA 1EEPA 4B5NA 4ZQPA 4Z1CA 2Y70A 2OJPA 1KLYA 5F4XA 4GC4A 1YPFA 4TX9A 4EVZA 1TSIA 5K7JA 4MFDA 2QCDB 5I3FA 4XBSA 2C14A 1EX5A 2ATSA 1OABA 1A5AA 1SR9A 4Y8FA 3TA6A 4DF0A 2QDHA 1B4KA 1W3IA 1W5OA 5HQEA 4UFLA 4DO5A 1OFQA 4GBUA 3UPBA 4JTLA 1QR7A 4K8HA 4BI5A 1HUVA 1MEWA 3INPA 3RLUA 3ZFHA 1F74A 3C56A 2QUVA 1SO3A 1XBVA 2GQ8A 4LVGA 3EXTA 2YCEA 2V0TA 1XCFA 3P61A 1K8ZA 3W88A 2E6YA 4XTIA 3GXTA 5LNWA 3MBDA 3IEBA 2P10A 3TW7A 4MOZA 3AO0A 2QUUA 3OVPA 1A50A 3WJWA 2GUUA 1BKSA 2GJNA 2VFIA 4Z1AA 4LOCA 1DVJA 3UWYA 3CC1A 1JQXA 3LLDA 3HBLA 1R47A 5K4XA 1VCGA 5G2IA 1GVSA 1RQEA 4OBTA 4UTIA 1G6CA 2QF7A 3M5XA 4JTUA 1EWEA 5KINA 1EWDA 5K4ZA 1JCNA 3BV4A 4K37A 3P8JA 1JUEA 3TU9A 1OJXA 1GG1A 1LLWA 3DKLA 3OG3A 2ZQ0A 5D37A 1G4TA 1JVNA 3QMTA 3W3OA 3QMSA 3BG9A 4OV4A 5F4WA 5FF3A 1I4NA 1A5SA 3LBMA 5DCDA 1H62A 3TUUA 3M1ZA 2VFHA 2VKZG 4M5PA 2RH9A 3WK2A 4LY8A 4O1DA 1IXPA 1VYRA 2BX7A 3N3MA 2A4AA 3OA3A 2V9DA 3DFNA 4DO4A 4MUZA 4WUIA 2QCFA 3TROA 2QCEA 3GXPA 3LHZA 4GE8A 1HG3A 3L67A 1LRNA 3NZ1A 4RXGA 2J88A 1O94A 3CWNA 4N4PA 3PUDA 4IPIA 4DBDA 3EKZA 4JIQA 3C4UA 3VI2A 4LVAA 1OX5A 4JTKA 4GWEA 3QF0A 3S6DA 1L2UA 3M47A 2V5LA 3HPSA 1R30A 1YDOA 1OFEA 2FLIA 1GT8A 2HMCA 3W7PA 3LI1A 3DFSA 3OEXA 3TSDA 2A7PA 4R33A 5F2GA 4MVAA 3TFCA 5HULA 4MKNA 3UNDA 4N9EA 4CQAA 3LCIA 2Y7EA 4MY8A 3NL6A 2Y88A 3FS2A 4O28A 3BW2A 1K03A 4O15A 2C16A 2QCLA 2BTMA 1HFBA 3LHYA 4GXMA 4N02A 1QMLA 2FIQA 2DZTA 3G0SA 1F76A 4LTSA 5DCEA 3W1RA 5D33A 4UMBA 1LORA 5SWUA 4JN6A 4NXSA 1SO6A 1W5QA 2NV1A 2CLIA 4UIOA 3GKFA 3E96A 3IV3A 5FF2A 1NF7A 1R2SA 2WOQA 1XUZA 3W7NA 2XFWA 1VRDA 4ORIA 3A9IA 4WY0B 1N7KA 3PUOA 4HNUA 2WSQA 1TIMA 3LRMA 1VHNA 2QJIA 3O6DA 3R8RA 3RMJA 1P0KA 3GB6A 3VNDA 3SY5A 4ZL1A 3MWAA 3M7WA 2VEKA 3QM3A 4IXHA 2F84A 4GRSA 1RR2A 4WD0A 5AOUA 1KBIA 4DEFA 4MZ8A 2QAPA 3W22A 2FJKA 5K9XA 1QDSA 2R8WA 2NX1A 4L4MA 3S8HA 1NF0A 2B7PA 3G0XA 3EWZA 3FJ6A 1KM6A 3LCWA 1RD5A 1VQTA 3M44A 2OX1A 5D2WA 2OT1A 4N9BA 5FI8A 3PBWA 1H50A 4AF0A 2ZZ4A 2VFGA 2O7SA 1KFEA 4FX7A 3S42A 4W9TA 3NQGA 3KOFA 3A23A 5TQLA 2A21A 2DJLA 4CQ8A 5CPNA 4FF7A 3IIVA 3S5YA 3ABSA 4QQ3A 3W1UA 2Y7FA 1SZFA 5L9FA 3LV5A 4G1KA 4AF0B 4HSOA 2CFFA 1K7EA 3N73A 4BR1A 2Z1BA 4HPXA 3LCXA 1UUMA 3NDOA 3UYCA 3W72A 3SZ8A 3W9ZA 1UCWA 1TRDA 3QC3A 4IOTA 5E0KA 4OE7A 2GPTA 2E5CA 1LBMA 5D09A 3T7VA 3M5ZA 3TSMA 3HGSA 4O54A 3LCFA 3QW3A 3N19B 4AEOA 4ML9A 1XBYA 1OK4A 3NQCA 3NYZA 4M19A 3NPUA 1EP2A 3B05A 3LTPA 4MPQA 4S2CA 5LHEA 5H91A 4AXKA 1IXOA 3USBA 1KFBA 2YFOA 2C13A 4FXRA 1GVQA 1SSGA 1GVRA 4UNKA 5EKYA 3HJZA 4CNNA 1S5TA 1W3NA 1WA3A 3G8RA 3L9CA 2CLMA 2V2DA 3WK3A 1S5WA 3P62A 2I14A 3JR2A 4JYDA 4AHOA 5DLCA 1SZGA 4Y96A 2E5BA 4UTKA 4Q33A 1SFJA 3S1XA 4BFAA 1L9WA 3GDKA 3O6YX 2QCCA 1MSSA 3G1FA 3NXFA 4TO8A 3FYOA 3G1DA 3T44A 2A7RA 1UASA 3W1QA 5CSSA 4KFNA 4YMZA 1GTEA 3SJ3A 4C1KA 3P82A 3TX9A 2TYSA 1VGAA 4MY9A 4XBKA 2ALDA 5CPMA 2ISWA 2Z2UA 3IGXA 3C6CA 1ME9A 2TMDA 1SW3A 1LTDA 4JTTA 3IRDA 3WJZA 2E6FA 1YADA 3GNDA 3CQ0A 1ZNNA 2BLEA 4RZ6A 2FDSA 3TW6A 1AMKA 1Q6OA 2VXNA 1IXNA 1DJQA 2Y85A 3UXDA 1TPDA 4J9JA 3NQMA 3P5YA 4O16A 1DV7A 4DPPA 2B7QA 2YYTA 3F1QA 1PV8A 1W54A 1MEHA 2B7OA 2JBMA 2BSLA 2R91A 3HGRA 4JDBA 5DY3A 3L2IA 3GDTA 3B0UX 1HTIA 2NLIA 1X6UA 1TTIA 4EF8A 1OFAA 2CLKA 5EYWA 3U2OA 2VC6A 3G1SA 4ZVJA 5KSWA 5IBXA 4FIRA 2EHHA 3TJLA 3A24A 2WKJA 5HWNA 2DZXA 4UTUA 3DHDA 3ABOA 3R5EA 4NU7A 2ZA3A 4UUIA 2EKCA 4JTIA 2WNNA 2KZHA 1A5BA 1T0OA 4XUGA 2NZLA 1K7FA 4JYEA 3S5ZA 1VCFA 1R46A 4NJJA 3TCEA 4BI7A 3LTYA 4FNPA 1WAUA 4X2RA 3M0ZA 4LV4A 3W2NA 1THFD 4EOUA 1O4UA 3W7QA 1FCQA 3NPXA 3A5VA 4X9SA 4OWGA 4HNNA 4QAIA 1E51A 4O8RA 1G7VA 1FWTA 1SQ7A 3GYEA 2BZNA 4L4LA 5D2VA 3IIZA 1FDJA 3GDMA 4UTLA 3MYPA 4EWND 2QCDA 5BOOA 4IX0A 4QISA 3N2XA 3R13A 2P0OA 1H7NA 3G8EA 1DBTA 4NVTA 1FXQA 4JTHA 1VPXA 2B7NA 3UPWA 3DAQA 5DBTA 1XC4A 3RF9A 3I68A 5AYXA 4OU1A 3JRKA 5EBUA 2VFDA 1EB3A 2RDWA 4UTWA 3ABQA 4PEKA 7TIMA 1T96A 4IMCA 4WY0A 4DBEA 2A6NA 3L0NA 2Y6ZA 3EWWA 4LVDA 3NQ7A 3W1AA 1PCKA
chains in the Genus database with same CATH superfamily
1YNYA 2XDFA 1VFMA 4BQ4A 3DFHA 2GQAA 4D6GA 2PLJA 3LG3A 1QWKA 3SFKA 1TELA 1EJRC 4GUJA 2ZZ7A 3WDPP 1P5BA 3RITA 2VHLA 1O66A 2H9AB 1QPOA 3WENA 4OVXA 5JUVA 4G8TA 3TK7A 1FWWA 5CKSA 4Q22A 4DJFD 5DELA 4O1AA 4LBSA 2GZXA 3NG3A 3LHTA 3MI3A 4NKCA 2VGFA 4DWSA 4HA1A 4AD0A 3R0DA 1U83A 4AWUA 3F4NA 4PMUA 4AX6A 3N9RA 2GDVA 1I75A 4ZR8A 2BP1A 1L8PA 3LMYA 4V2XA 1OVDA 1R3YA 3W2UA 1RXOB 2I57A 3EDEA 1D3GA 3G5EA 1W9BM 5A6LA 2YCIX 3VIIA 1VS1A 1R5YA 1NFBA 1K77A 4L65A 4XTDA 4V15A 3BANA 2OVLA 5I03A 3KWXA 4KERA 1LLOA 5BOFA 3E0WA 3DHPA 1JPHA 1MXSA 1K8YA 3JZEA 4JIEA 3OW1A 2OO0A 3E49A 1U2YA 1ZU8A 2X41A 4M8UA 3UWQA 2XH0A 1W1TA 3EDDA 1F2JA 3LPPA 1V0MA 4HPGA 5FEPA 3MTWA 4IMAA 5BXRA 4ZTXA 1YXYA 3DBNA 3N1AA 1X7IA 1RPXA 4IIGA 1XRSA 2ZXBA 1ENUA 2OFJA 2WLYA 1V93A 2CBJA 1DJGA 4O19A 5XIAA 4E2BA 1IHIA 3M0XA 3HJEA 1XRVA 3BCFA 1AJ2A 3LYEA 3AIBA 1R3VA 1FWHC 3WBWA 2DORA 3THCA 1ITXA 3HPAA 3QEZA 4BZYA 1R3RA 3C0LA 3W53A 3GNXA 3V1PA 2E9MA 3H12A 3AIWA 1TREA 1M3UA 1AW5A 2ISVA 3RLVA 3W0KA 4HPJA 3K1GA 4O0ZA 2FMOA 3HQ1A 2CPUA 3AMCA 4Q32A 1TA3B 4AZIA 3IIOA 4D6IA 1GYLA 4GCXA 1UKSA 1SU5A 4UFKA 4GY7A 3H2FA 1ZZMA 1I2PA 3M7SA 3W86A 1JRCA 4KFPA 1M01A 3ONBA 2V63A 1CDGA 3GHTA 3VVGA 4EK7A 4LC6A 1JAKA 5AC5A 3SCUA 2FTWA 3ZSSA 2YDAA 3MCNA 2NUXA 3W7RA 4UTTC 3U4AA 5A8PA 2IXUA 5T9BG 1F6PA 1QPKA 2QEZA 1OYBA 3B8VA 3PK7A 1P7TA 3LV6A 2IUZA 5EPDA 3W84A 3WLNA 1TJPA 4WCJA 4HB7A 4A8RA 1XPGA 5CZKA 3TJXA 1JUBA 2WSYA 3UETA 5IFPA 1WDRA 3TN6A 1NOUA 1Q6EA 3EWCA 2GVLA 3VE7A 4PODA 4C91A 1R85A 4ZOAA 4FXFA 1Q7MA 3RNDA 1JQVA 5PTDA 3CB8A 3WELA 4HNVA 4JHOA 3DH7A 1E4MM 1A5OC 1VCVA 1SFSA 4KEUA 2NX3A 3DX5A 1TTQA 1J6PA 1XYLA 4XO6A 1V3IA 2FZDA 4JGDA 4W7UA 4MIMA 2EBNA 1A5MC 2QUMA 3ZS4A 5CC3A 1ESWA 1XDLA 4KGLA 5HK4A 1YXDA 2E1WA 3L66A 4GD0A 2Z26A 1O95A 1TMHA 4C7FA 2EO7A 1K6WA 3KOWA 3CPUA 1JIBA 1AJ0A 1MXGA 1OIFA 2YX0A 4CCDA 1X96A 3MI2A 3QZ6A 4NILA 1LRTA 4XVDA 2QDGA 3OZYA 4QIUA 4H3DA 2CLOA 2QXWA 1D8CA 5CJMA 4AVFA 4ACZA 3PC0A 3OVRA 3CIXA 1ITUA 2IQ0A 4C6BA 2Y1HA 4XSLA 1NOWA 2HBVA 3SSZA 2FFIA 1TVLA 3G2GA 3LHVA 4G2DA 5FEZA 1K9EA 3TQ0A 3A5FA 5C2CA 3L12A 1KRMA 2ZTKA 4JFVA 4PUNA 5CEWA 3T0DA 2REQA 2Q8LA 2ESCA 1A4LA 3W83A 1XHGA 3GR7A 4CU7A 2PDLA 1ODZA 3W6YA 4LEQA 1C8XA 3LRLA 2A1YA 2QPSA 3STFA 4PTDA 3UA3A 1XYAA 1IYXA 2XFFA 2E0PA 1ZL1A 3N4EA 1PHQA 3UY8A 5U4NA 4MLRA 1DWJM 3WQ5A 1YBQB 1H4PA 4LUIA 4IPPA 1B57A 1WBJA 1QNRA 1E9LA 5T9CE 1EX1A 4F66A 4GQRA 5CBIA 4S23A 1DJXA 2FPYA 3GTNA 3RHGA 2OEKA 4JQ1A 3FA5A 1TVNA 3OOQA 4E38A 5HXMA 1KCKA 4DUOA 2VZVA 3R89A 1TPC1 3KVJA 3WLMA 3IAQA 1VIZA 3O63A 3W1XA 3S2MA 2BY1A 2BGSA 1AODA 1YQ2A 3FDKA 3GXIA 3ZM8A 1HVXA 3AJXA 1GVFA 4MLJA 3IGHX 4B5XA 1ISXA 4UOJA 4WGXA 1WUEA 3LLFA 2OYKA 1KWKA 3NL2A 1A5KC 3G1YA 3KOZA 3I7SA 5LIWX 2DIJA 4HTYA 4RV8A 4YTSA 2ZUWA 5IFTA 2QJGA 3VILA 2ON3A 5CLWA 1WDSA 2A2IA 3WFAA 2F6UA 3NZRA 2RDUA 3EYPA 1W1YA 2FB3A 3HQNA 4YNGA 5E9AA 1P1XA 2ACQA 2V2HA 4PTNA 1KWGA 4INFA 2Q01A 2WAGA 1A49A 3T55A 2Z0IA 3CEUA 4S2BA 1SO5A 1JYVA 3AROA 3WQEA 1TTJA 2JKPA 4UCFA 4NZ3A 3PBUA 2C91A 4O4VA 4WX2A 4OBRA 3T78A 4U3CA 3JW7A 2YL9A 1W9XA 5DXYA 1V7YA 3OZPA 4B3ZA 3NA8A 1PKLA 2W63A 1E4IA 3OTRA 4PEEA 3ZLHA 4BF9A 2JF6A 5C0QA 1M7PA 1RAKA 2FHFA 1CNVA 4CNOA 5C7HA 1OZQA 1X6LA 1FHLA 3LX9A 3IJDA 1TZ7A 1B9BA 2B81A 4KQNA 4Q4QA 3ZR5A 1KM0A 3NR0A 5AYYA 4JN7A 2YOCA 1M5WA 2VR5A 1ODUA 5D05A 2WVVA 1B4EA 5AYBA 1GOMA 4FR6A 1R9ZA 1QCWA 2F8QA 3WMCA 4ERAA 2BMBA 3H55A 4I6KA 2F2KA 3WDQA 4G7EA 3N25A 2ZC8A 5CG0A 1TWDA 3WD0A 4ZB0A 1KW1A 3SCSA 2DGAA 2HZGA 5I07A 2VEGA 1Q6QA 4TVCA 2MNRA 5EFDA 4HZ7A 4IG2B 5GNYA 3QV8A 2Y8VA 1O5RA 4C6LA 1JYNA 4ORMA 2XM2A 3PB2A 1MUMA 3LQGA 4PCTA 3UQNA 4L1GA 3KDOA 4H7ZA 4W84A 1KM1A 2VX5A 4IQEA 1NH6A 1NQ6A 2WQDA 4O0KA 2BY3A 1GZGA 4RR4A 3SSJA 4DYKA 4XIMA 4C6CA 4F2UA 1XGDA 4FLOA 4HCDA 1H7XA 4ATWA 4GYJA 4GQBA 5KZ6A 1P1MA 2BOEX 5FAJA 1CX9A 4QSFA 3BVJA 2C79A 3V0SA 3KRSA 5CZTA 4EXQA 2VX7A 3NIYA 3DCPA 3GG0A 1TVPA 1GJUA 1CI1A 2FGZA 4JTRA 1VPQA 3PWIA 3B03A 2H8XA 2RKXA 5FL0A 4FNQA 4WSHA 1LYXA 1XICA 1EZ2A 1W9PA 3MHUA 3UU0A 2VFEA 3NQAA 1H60A 1OF6A 1CCWB 3WLSA 4HJFA 5EGRA 3R2GA 1W5MA 1OD0A 3DDMA 4B91A 1TPUA 3WMBA 1VLIA 3WBYA 1TE1A 2PRMA 3LBCA 3HN3A 1Z41A 1IGWA 3WF3A 1DORA 2DZWA 1DJNA 1S2AA 5HUPA 4JN8A 4PRTA 1IEIA 4HOWA 3MSYA 3D3AA 4CGTA 5LSMA 1CLKA 1XP3A 2PDJA 3W07A 3GR4A 4U5IA 1H7RA 1KM5A 4UR8A 1KB3A 1JPMA 3I3EA 4U3AA 1ECQA 3F5KA 4PGLA 4H1ZA 3QV9A 3EPOA 4PUDA 3WFLA 1L6SA 2OQLA 1D3HA 1OK6A 3ATYA 1XFCA 3EBVA 5I3GA 2PB1A 4WSJA 4RPPA 3C0QA 2J25A 1QVBA 1O5QA 4UTJA 1CW2A 4OUIA 6TAAA 2VJXA 4EF9A 3W73A 3DU0A 4X3ZA 4NJIA 5AZ0A 1X1OA 1EO7A 3A4JA 3FJNA 1F6YA 3ERPA 3VZZA 4ACYA 2FVKA 3TC7A 5CC5A 4Q4KA 2GWGA 4A3YA 2HS6A 3NGJA 1Q3NA 4RZ5A 3L68A 4XV0A 4JTGA 2YL6A 1EBHA 3BGJA 4NJHA 5BCAA 2DP3A 2FH8A 2WB5A 1FWFC 3W6LA 1MQPA 4E0CA 2QQ6A 2D0GA 2YDSA 4DIAA 3W7LA 3W6MA 1R3SA 2EPOA 5FJUA 5I6SA 4AC7C 1WDDA 5FEWA 3OZOA 1ZJIA 1D7KA 1W1IE 1W1VA 3OHIA 3SADA 1UWTA 4PUKA 3STEA 3RX2A 4MDPA 1XLJA 4D8ZA 4XKYB 1LZOA 4IX2A 4NZFA 3AXXA 1T6MA 4J3SA 1NEYA 3E02A 5D2TA 4NJKA 1C8VA 3VYLA 3T2OA 1UD2A 1JDDA 2XSBA 1ZGDA 1S39A 1H0GA 1LQ0A 1RQHA 1D9EA 3OLEA 3TQVA 2X1TA 3P2VA 4ZZ9A 1ONWA 4UCGA 1XLCA 3W7GA 1XLHA 4UTMA 1OC5A 1CWYA 1SJBA 3K30A 3PB0A 2WNQA 3NZPA 2NXHA 4URIA 3NFUA 4MJ2A 4PMNA 3QBUA 1VZWA 3SQLA 1QPRA 4WY0F 1H5YA 2QCGA 4XZWA 2VR2A 3KCJA 2XINA 3HPFA 3CZJA 1ZBWA 3QPZA 1R0MA 1FX6A 2J9XA 4B92A 2PDPA 5HQLA 1PDZA 3U5YA 1DL3A 2V82A 3GBEA 1RCOB 1RBAA 1FY6A 1LJYA 1BGAA 1Q7ZA 3G1HA 4HZ8A 4FOJA 5MKGA 3FY1A 5C8BB 1V6WA 1RJQA 3APTA 5CPLA 3QW4B 3HF3A 4AMCA 1S5VA 2YL8A 1Q2RA 1BRLB 3Q94A 4NP7A 3NQBA 4DJEA 4G7FA 1OBAA 3MDWA 1SZNA 4QE4A 3WQPA 2C1IA 2V5KA 4DQWA 3WN6A 1EA0A 4KWSA 2P5NA 4AW7A 4P8WA 1XLGA 1IIHA 3TTYA 4FXJA 1P6BA 3F5JA 3P74A 4UWMA 4Y9OA 1UYQA 4HVXA 4NUWA 3W1PA 1ZLPA 3CO8A 3TH6A 1ME8A 3MA8A 3H54A 5DRIA 4M6UA 4PYSA 2VRQA 2IMRA 3KRZA 5ABTA 2ZUMA 3LNPA 4ZGYA 3QVQA 4N9CA 4GUFA 2R1LA 1UWUA 5HUOA 1XYBA 1QRQA 3WMLA 3QLDA 5I79A 3IGUA 3N2MA 3GHUA 4NNCA 4DN1A 4EAYA 3KVLA 2WBKA 1I2RA 4RX0A 2DT0A 3ARSA 1BWKA 3EX3A 1IEXA 3K8MA 2DU2A 2C1GA 3ITVA 4OBSA 3FXGA 1B31A 1A3HA 2ZX6A 2I9EA 3N15A 1EUNA 2WPGA 3PJWA 3L4WA 2WC3A 2R9RA 3LHUA 1EP3A 1YNPA 3BSGA 1GEQA 3TTSA 1V6UA 1YRRA 3O8AA 3USZA 3DFYA 3TC6A 4TTGA 2VNCA 3NAVA 1LCOA 1OX6A 5DF0A 4QLLA 1JGIA 1I60A 1SMAA 1JGMA 3CT7A 4Q7NA 4PFHA 3WQWA 3RCNA 3CMGA 4O17A 4WGHA 3W7HA 7ENLA 3BK0A 2XN1A 4LS2A 1HJXA 5EMKA 1KNWA 2BODX 2X05A 5CSRA 3PPHA 4FEZA 4ZQNA 4DI9A 4LUYA 5I09A 5B80A 1EDTA 1PEZA 4R9OA 3OODA 4DJFC 3WBEA 3WD3A 1J0IA 3G3MA 4AMAA 3AU2A 1UR2A 3FV9A 4FAMA 4M1BA 3N3TA 4MYXA 1CZ1A 5FD0A 5A8MA 1B3WA 4GYPA 1XLMA 4F8XA 2ONEA 1JUKA 3TWAA 4HNOA 3AYVA 4N2YA 3SUVA 4YYFA 1FCVA 2QCHA 4P7QA 2QZRA 4FX8A 1JCJA 3H26A 3UW6A 2PDNA 2I9UA 4E6MA 1I6NA 2PDKA 4GPNA 1WCGA 3WJXA 6XIAA 2GSJA 1GK8A 4N6EA 4NJGA 4NI8A 1KKRA 1X1NA 4A35A 1M65A 4XD5A 1WXJA 3Q65A 2X1IA 1SPQA 3PBVA 3F4DA 2Y61A 1IR2A 4YWIA 1VIWA 5AKQA 3QPYA 4PB3A 2BB0A 3S5NA 3SIZA 1WBHA 5I2UA 3I7RA 4OTKA 1UROA 4N4QA 2OU4A 3AMDA 1P0NA 4B15A 3IJ7A 1PX8A 3V36A 3THQA 4YVVA 3RILA 4S3CA 4NYYA 5GVJA 3PN8A 3SW6A 3L2LA 3WJYA 1G1YA 1E6ZA 4HMCA 3VKCA 2GYIA 2HCVA 5LA1A 2CXEA 2CZEA 1QFEA 1UG6A 4ICNA 1VBRA 1WNOA 2QVHA 5HNNA 1EJVC 1I2OA 5FESA 4GBDA 2RHGA 5D9MA 4XKMA 1E9ZB 5AHEA 2EPKX 1H7WA 3JS3A 1RHCA 4LPCA 2Z27A 3FFSA 2CLHA 2O4MA 4MB5A 3EEGA 4V27A 2YYUA 3A3XA 1G5AA 3Q4DA 3L5AA 3KVKA 2C0AA 3H2MA 3BAIA 1BHGA 2PGRA 1TV8A 3O06A 3WZ0E 1F6KA 5A8NA 4UQCA 4JX6A 3O3RA 2E77A 2NUWA 1E73M 1V6XA 3ZVHB 2WNWA 2G5WA 5F2MA 1EZWA 3QZAA 4LF2A 4AZ6A 3PR2A 2ATMA 3XINA 3GK0A 3APGA 1U1JA 4L1XA 2GFTA 3SUSA 4QITA 4GNVA 2WJEA 3LXCA 1J5TA 1ZCCA 2WQPA 4JEQA 1KFKA 2Y7GA 2FJUB 1KFJA 2DZSA 1EXPA 1PKNA 3BDKA 1QATA 2ZZ3A 4QCFA 4HU8A 2ZZ5A 4EXBA 4MY1A 1GW1A 2A6LA 1KLZA 2YGYA 5GJPA 3BLIA 1NVMA 2J8GA 3S0CA 2NUYA 3V75A 3N6JA 1TFVA 3R6IA 1VFTA 4L9YA 4B4HA 2I56A 1D8WA 4QM1A 3AS0A 4FF5A 1VBJA 5XIMA 1B2YA 1EEPA 4Z1CA 2Y70A 3VOFA 2VWTA 3KE0A 1FWBC 1E6PA 4TX9A 3E2QA 1CYGA 4XBSA 4MG4A 2FZMA 4E2VA 4ZE4A 4DF0A 1B4KA 4OFCA 1Z32X 2PZ0A 3PNZA 1MEWA 3ZFHA 2WMIB 4PCPA 1SO3A 1XBVA 2J13A 5CAKA 3EXTA 2YCEA 3PZTA 1XYCA 2X40A 2EKGA 3BSHA 3W88A 5REQB 2O9TA 3IEBA 4WDXA 3TONA 3TR9A 4X2PA 3AO0A 4HYVA 4FLRA 3OVPA 2X0HA 1BKSA 4HYRA 4KCTA 3UWYA 4XAFA 3HBLA 1RQEA 3GVVA 4JL1A 1RP9A 1EGVA 5A6TC 4W86A 4ZB2A 4JTUA 1EWEA 1OQFA 3BV4A 4K37A 3GH4A 5A69A 2V3FA 3TYAA 2DIKA 3FAXA 3CV1A 3N17A 2ZQ0A 5D37A 5FJPA 4I3GA 4OIFA 1TJ0A 2QVNA 3QMSA 5F4WA 4TX6A 3BAYA 1XD0A 3L4ZA 2VRKA 1A5SA 3LBMA 2VFHA 2RH9A 1HGYA 3WK2A 3OQEA 8XIMA 4C5YA 4O1DA 1VYRA 4RE2A 2D0HA 2GSEA 5IDZA 3DFNA 4V1YA 3R43A 2J47A 2QCFA 1DWHM 3VU2A 3VX0A 4GE8A 2O4QA 2HE8A 2PTWA 9CGTA 4CNTA 1E1CA 3CWNA 3V7PA 2V3EA 3CV7A 3PUDA 3S47A 1OCBA 3EKZA 3PBGA 1RA5A 2PP0A 3C4UA 4PUJA 3VI2A 4HA4A 1KO0A 4LVAA 5GNZA 3SJNA 2P50A 3RDKA 5ABFA 3VPLA 2NSXA 3S6DA 3M47A 2V5LA 4GI6A 3WNKA 4V28A 3EOOA 4L1WA 4DZ5A 1J5SA 4PUEA 3ZJ7A 3W82A 3BAKA 3KP1A 1WE5A 3BCJA 3WNMA 4CQAA 3LCIA 2L5HA 1SFTA 1Q6CA 1K03A 3DN5A 4XX6A 1G01A 1J0YA 3FNDA 3UP8A 4DYJA 2QCLA 4PMJA 5DMMA 1FRBA 2BTMA 3LHYA 3MKKA 2FIQA 1J01A 1M53A 3JVAA 5IXEA 3G0SA 3W1RA 1LORA 1EGZA 3G6LA 2HEJA 1SO6A 2CHOA 2NV1A 4LYKA 2CLIA 2PDWA 3ES8A 3ES7A 3VKKA 3NO3A 1XUZA 3CAQA 3N29A 4I9JA 2XFWA 1JFHA 1TUXA 3O6AA 1FVPA 1N7KA 1CXFA 3LS9A 4XAYA 2OKTA 1TIMA 2WSQA 2BY0A 1KBLA 1TWIA 1VHNA 1EHNA 2QJIA 3NSNA 3RMJA 3SY5A 3NSXA 3M7WA 2Q8XA 3EA3A 4HHMA 3QM3A 1M7XA 4DJFA 2MUCA 4GZIA 1TWWA 2R8WA 4QCEA 3WDHA 3EWZA 1OB0A 3M44A 1ZJBA 4JKKA 4N9BA 3D6NA 1PX4A 3THDA 5FI8A 3ITOA 1DPMA 3PBWA 4AF0A 3UVAA 1KFEA 2XVPA 4Z2LA 1V6TA 3S42A 4KRUA 4W9TA 4A3QA 4AXNA 4A3RA 1RJRA 1VJSA 2VQTA 3ABSA 1BVZA 3T2QA 1MUCA 3MS8A 3KTCA 3WQ6A 4HSOA 2YIHA 2Z1BA 4E8GA 2HNEA 3ISIX 4W8LA 3AHZA 5H8PA 3SZ8A 2V69A 3QC3A 1JZ5A 4JFTA 5E0KA 4GZJA 2E5CA 3T7VA 3KTXA 3W4RA 3VMPA 3VNKA 3QW3A 3AXHA 4ML9A 1OK4A 2PA6A 4UNIA 1UD6A 4GX9A 3LTPA 4FMVA 4S2CA 2G4JA 6A3HA 1Y5XA 1TZZA 4QJ4B 3ARRA 4FXRA 4PBEA 1GVQA 5EKYA 1GVRA 3PTQA 3WQOA 4BEUA 2HNHA 1W3NA 2XH4A 4BKNA 2V2DA 1S5WA 1SMDA 4XZHA 4NAFB 4AHOA 4B9ZA 5BROA 1R7OA 4Q33A 1B90A 3WF4A 4MNMA 2PWUA 2QCCA 4LAKA 3ZYZA 3MSRA 3FYOA 2A7RA 4CQDA 3DC8A 3V5CA 1MW0A 1GTEA 1LQ2A 3SJ3A 8A3HA 3TX9A 3VC5A 5J8LA 3IGXA 1K9FA 3M64A 4GO9A 2TMDA 2DIEA 1SW3A 2D23A 3ZT5A 2VZTA 4JTTA 4JCLA 4C6EA 2FMNA 2E6FA 1XLEA 4NASA 1PWLA 3TW6A 4AY8A 1PZ0A 2WCGA 3MPGA 3GVRA 3MQTA 4E4PA 1LT7A 1JYXA 2NT1A 3UXDA 1VFOA 3B0YA 2FH6A 2XIJA 4J9JA 4IGNA 3NQMA 3KLKA 5HQMA 3P5YA 5AVNA 4Q8VA 3VDAA 3EZ4A 2ZICA 1E6SM 2B7QA 1PV8A 5TNVA 1JCTA 2R91A 3HGRA 1KCXA 3H21A 1HTIA 1ISYA 1X6UA 1TTIA 4HZMA 4EF8A 4AD5A 5EYWA 3G1SA 4FIRA 1Q6GA 3A24A 2WKJA 5HWNA 3ABOA 3AS3A 1JPKA 5M17A 3R5EA 4UUIA 2EXOA 1HGWA 2WNNA 2KZHA 2GJXA 2WZHA 1T0OA 4XUGA 1RPKA 1U1HA 1BTCA 4MPKA 1PBGA 3MANA 1DP0A 2NZLA 1VCFA 4NJJA 3LTYA 1G94A 1RJPA 3VNLA 3PAOA 4LV4A 4EX4A 3XISA 5BWAA 2PDYA 1FCQA 3RU8X 2VOTA 1HQTA 4OWGA 4CD8A 1GHSA 1Z69A 2UBPC 2HJPA 4HOXA 1FHDA 1BYCA 4L4LA 5CAHA 4OUEA 2ACSA 3ANVA 3GDMA 1EC7A 4E8DA 3HV9A 4IX0A 3N2XA 1DXFA 3R13A 1H7NA 1NP0A 1MWOA 1EA9C 1FXQA 4ASTA 2B7NA 4AZ5A 1NY1A 5HNUA 1XC4A 3A12A 3QHNA 5AYXA 1RCXB 4OU1A 4HSHA 5EBUA 2VFDA 7ODCA 3ITCA 2OYLA 1JNDA 1GQIA 3ABQA 4L64A 2PCEA 4IMCA 2PLCA 2WMJA 2Y6ZA 4KBXA 3EWWA 1BLIA 4ZO9A 3MZ2A 3GKAA 2AGTA 3NWRA 1R8LA 4GINA 3UESA 3BW3A 3W7CA 1BWLA 3R94A 4K8GA 3VCNA 4O8AA 4WXYA 2OCZA 2ANUA 3O15A 4Q6JA 1V7AA 3EWDA 1EJSC 2X42A 2VD9A 4K39A 2PZNA 2PE4A 4K38A 3GLCA 1XYMA 4B16A 3KAOA 4XAZA 1V77A 1B1YA 1UD4A 3PHAA 1SW7A 2PP3A 2VELA 1H61A 1IEVA 3IUIA 5JMUA 1TB3A 4F48A 3IVTA 4Q8UA 3ARTA 4A8NA 2GOKA 3U7VA 4BQ3A 1UBSA 1VEOA 4C90A 1NDYA 1DQXA 4H9UA 3ENLA 3NQDA 2YXGA 1H11A 4AZCA 1M03A 1XD1A 2X1RA 1ZCOA 2JGYA 3KBSA 3MW7A 2CZDA 1KM3A 3NZGA 1BXCA 1I9CB 2WMHA 3VNJA 1YW1A 1C90A 1US2A 3IIXA 2FFCA 2Y8KA 4RDYA 2HTMA 2PDUA 3ZJ6A 1WV2A 2D69A 5D04C 7REQB 4PCSA 2TSYA 4GG9A 2AMGA 5G4HC 1WOBA 3SBFA 1JJKA 1DQUA 4BWLC 5H8UA 3BLKA 4U5KA 4IFKB 4OZOA 4O14A 1ECEA 5JH1A 4MAZA 1YDVA 5HNRA 4PN2A 4WZHA 3OBKA 2EJAA 4NIRA 2VRJA 2D3LA 2HXUA 1PL9A 3UJRA 3I4KA 2P3ZA 5T8GA 4J35A 3WUGA 1ADOA 1R3TA 4QSHA 2QUNA 4PH6A 1ELSA 4DHGA 4LW7A 3B40A 3N2TA 2ABAA 3R8HA 4BJHA 3KL3A 3BL3A 1W5NA 3LGGA 2R82A 3FN9A 4LNCA 3ITYA 3UYIA 4GISA 3LRKA 5A6KA 3RM4A 3GM8A 2HVNA 3TQKA 2WCAA 3B8DA 2J74A 2QUTA 3DG6A 4PMDA 3HZ3A 4GACA 4FXSA 2A7NA 4I8DA 3CAWA 5CPOA 1RZMA 4JDYA 1TJ2A 1K6AA 3E3HA 4Z0SA 5T91A 1PYFA 5C2XA 3UGVA 1O6IA 3O0KA 2VX4A 1OGGA 1R7AA 1LBFA 3OVGA 2X1SA 1BG9A 3U7BA 3I65A 2UV8G 3CV2A 3UG8A 3RPTA 2G3MA 2DV0A 4EE9A 4JFWA 1MVYA 3ABRA 4B5WA 1G69A 2WSRA 4L6HA 3T9PA 4MDOA 5BYWA 2ZVIA 4MHBA 4AZHA 3T6CA 4O57A 1O60A 2J27A 2BXVA 2QPUA 3RYSA 1BQCA 1BWVA 3CHFA 1RSCA 4NNAA 2F2HA 2J75A 2H6RA 1IF2A 3MHFA 3MSDA 3EGJA 1ZS2A 1P7TB 1TPWA 3S6OA 2PFHA 1SYTA 4GQ0A 1UMYA 3U5UA 4H8VA 3P3BA 5D38A 3W26A 1YE4A 4QEEA 1JR1A 3KBJA 1ZTVA 4XZ9A 1Z48A 2QYGA 5I06A 2A85A 4OJYA 4UZSA 3C0SA 1Z42A 4A29A 2QGYA 3BURA 4BA0A 3M0VA 4R85A 3KBWA 3NTYA 1XGEA 4YXGA 2DPEA 2G97A 3P0WA 1EQCA 2QF8A 4W5ZA 5A94A 5LXXA 2XIMA 3B0XA 1TYGA 1ML1A 3QR1A 4KEVA 5KZDA 3RX4A 3MUCA 4BY3A 3N2BA 4LYPA 1OG0A 1S3TC 4H8NA 4K2SA 1XF0A 4Z08A 4MB3A 2DJXA 4E2OA 4CD4A 2RDTA 3OHMB 3T09A 3F4VA 4H4IA 1C3FA 1IEWA 2RGLA 3EPMA 4ACZB 4UXDA 4UC5A 1IXQA 3PZUA 2F6KA 5DT7A 5A8QA 1N82A 3S1GA 1W2VA 4R34A 3FKRA 3BLEA 3SFWA 4DUXA 4DO7A 2XM1A 4BS0A 2CEQA 4K6AA 4JOMA 4Q7BA 2IPWA 4CNPA 1JULA 1E0TA 3AZTA 1OF8A 3HMCA 1W8GA 3UA4A 3A4XA 4LQ1A 1KFCA 1TJ1A 3W70A 1MRQA 4PUUA 1O5XA 3EDFA 4IGHA 5HWJA 3WJSA 1V51A 1SJAA 1TPEA 5A6SA 1ONEA 3SCWA 4C6IA 3WIJA 4EACA 3QQ1A 1EJWC 4I5UA 2NXGA 5A6BA 1TV4A 4H83A 4HJWA 2CW6A 1NWRA 4F0KA 1QNQA 3B8WA 3VOIA 4FZIA 1E4LA 3A22A 4W8BA 4RNJA 2QDEA 2Y0FA 3FJ4A 4P61A 4C7GA 2P88A 3S2JA 5I3DA 3QKZA 2GVGA 1AH3A 3VGEA 1GJWA 4U4MA 2AAAA 3BG3A 3GC2A 4YYCA 4YIWA 3N2OA 3PM6A 4H6KA 1OT1A 2PI6A 4GCAA 1UKQA 1QI5A 5JBFA 3V1HA 4NRRA 1NAL1 2VQUA 3UCDA 3AI0A 3CBWA 1Q65A 4A22A 1E6XM 1CXEA 3O16A 4U31A 1US0A 2GGEA 1PZ1A 4UQEA 2AL2A 3M6YA 4LUJA 4DJDC 2QJMA 3ABZA 5F7UA 1XLAA 2DT1A 4OV9A 4I7VA 1PJ9A 1R9XA 1POKA 1NWTA 3LEPA 3WD4A 3N14A 2XGBA 3E6EA 4L6OA 3W85A 3HQOA 3U48A 4JIPA 1DJWA 4IJCA 2NQHA 4XZIA 2MANA 3F4WA 3SQSA 1A5CA 2DZUA 3ITLA 1UD8A 3UF9A 4M6QA 4KT2A 4TX8A 4UQDA 2BVWA 1XSKA 3PFRA 4LVBA 1KFLA 1LWJA 4X61A 1ICSA 1A0EA 2DSZA 5HANA 4RXFA 1VLWA 4AYGA 1UIOA 1F5ZA 2JK2A 3W75A 4O18A 2ZXAA 4Q4OA 3P5ZA 1TE6A 3NM1A 4DO6A 3RRAA 2G41A 4TOQA 2E8YA 3G1AA 3NQVA 1MRAA 3RFAA 5C54A 4U28A 2CZFA 1FBAA 1OWQA 4M6PA 1P0BA 3NNTA 4XB3A 2KX9A 2I17A 3R7MA 3RLHA 4F9JA 4KH2A 3VX1A 1ZAJA 3THAA 3S2NA 4HTBA 1IWAA 4WEVX 4HA0A 3V35A 4H2HA 1FWSA 4PMVA 2WSPA 1WX0A 4LWWA 4J3VA 3ZJ8A 2DT3A 3O1NA 3PTKA 5EA9A 3WF1A 2W62A 2RDXA 1W37A 1FHVA 1TTPA 1Z8AA 1BGGA 5FF7A 4R9XA 3ZR4A 1J11A 5KZMA 2C6QA 3SGGA 1FUYA 4O11A 2R1NA 4W7VA 4MYAA 8XIAA 1GOOA 1MDLA 3VD9A 3UFYA 2OO6A 1OFPA 4ADSA 1VF8A 4PL1A 4AAJA 1FWNA 4PUWA 3B4YA 3IS4A 3AIQA 3EXRA 1KGXA 3M0KA 4H9ZA 3LPFA 3TTOA 5CBBA 4HNTA 3W7MA 4UNLA 1W8SA 4YL2A 4PMOA 4IGMA 4K8EA 1VFLA 3L4VA 3CJPA 3F03K 4BF7A 1XC6A 2B0MA 2WSKA 4LRTA 1OYAA 3TKFA 5GNXA 4D2JA 1UIPA 3TN5A 3WD2A 2V81A 3VKBA 4Z1DA 1D3CA 4ZFCA 3CZKA 2XUCA 4RW3A 3QYQA 2D2JA 1NDWA 1U30A 2GGGA 3D3FA 3EEZA 1NM9A 4WK9A 2JEPA 3KOXA 2VC7A 4ML4A 1R3WA 4RZBA 3Q37A 1XKJA 3VK5A 2VZOA 3VD5A 3PPCA 1UP3A 1LBLA 4NX0A 3ANYA 4DXVA 3OPSA 4GI4A 4BWLA 3LD5A 1T8XA 3AALA 1RD6A 4PE8A 1EDGA 1HO1A 3T08A 5BXPA 3UWZA 3AQUA 1CGUA 2NLYA 3MMUA 3TCSA 1MDRA 1UKOA 2JE8A 3AZSA 3D47A 2E1DA 4IIFA 4CCCA 1J6OA 3U57A 5IBXC 3SN0A 3QFEA 4DZIA 4TUFA 5E93A 4LEFA 3LMZA 1S2CA 1TV5A 3H22A 2J9YA 3HU7A 5D9OA 1DJYA 3EWBX 3TN4A 2P53A 4GIYA 1CGWA 1OD8A 1KV5A 3BZGA 5FF0A 1E0UA 1YDNA 2OG9A 5HAOA 3VE9A 1QHPA 3C8NA 3R11A 2E6DA 1A0DA 3SIMA 3SQMA 3YPIA 1I8JA 4NL1A 4C6KA 1TR9A 2PLMA 3ZXWA 4XAGA 3KW3A 2QNEA 1QXLA 3DFPA 4Z1BA 5G2HA 2DW7A 1X8FA 1VFHA 1CLVA 3QZEA 2XSAA 3K4AA 1K02A 1W1B1 3SDOA 4QAWA 3LCGA 5BRBA 1HXJA 4L61A 1XIBA 6ENLA 4EPBC 3E2VA 5GJNA 4A2RA 3CTLA 3G3DA 1J0KA 2PRHA 1PO9A 4LT9A 3NQEA 4HK7A 4R3UA 3QH2A 1O68A 2PAJA 3TVAA 3EPNA 3VUSA 2R1MA 4UQ9A 2Y7DA 5LNSA 7CGTA 3WNPA 4AVNA 1JCYA 5BU9A 4KCUA 3GXNA 2WO5A 4I6VA 2FPVA 4JTCA 4X60A 1OG6A 3WG6A 5ABHA 1M7OA 4ALDA 2HS8A 3M0HA 2Z6JA 1OEPA 4L9ZA 2ISFA 3MJYA 3ITTA 4GQQA 3VMNA 3B9OA 4J2MA 1QW8A 2DW6A 4G56A 4LNYA 5AHMA 1QO2A 3PG8A 4IIHA 1JDFA 3KCOA 1W3JA 1GTHA 3GDBA 3TW9A 1Q45A 4DWSC 3CIVA 2GK1B 3B4UA 2J8FA 2Q09A 3L5MA 2J7CA 3UG5A 1KXVA 1AQMA 1R2RA 1F05A 4HZ6A 2XGIA 1PZ3A 1JFXA 4MNJA 2NX9A 3IV8A 4M24A 4C1LA 2Y2WA 5AB3A 2WM0A 3W37A 1MZRA 3P84A 4DAFA 3A21A 5HJXA 2DVTA 3S1UA 2X1UA 4IISA 4RLIA 4Q8TA 4PMRA 2JALA 3H8AA 4M6VA 3DI1A 3BWWA 5FF4A 3WDJA 4CQBA 5BXSA 3VIPA 1QI2A 9RUBA 3KDNA 4Z2KA 3UJEA 1BRLA 4HMEA 5AHNA 2CLFA 5ABFB 3W38A 5MF5A 4ZMGA 3UZWA 4TXEA 4MWAE 1IWPA 2Y8UA 2DSKA 3P14A 4FLSA 3P7YA 4KRZA 1FH8A 2A0NA 2CIPA 3VIGA 2ZZ2A 1PX3A 4RE3A 8TIMA 1LG2A 1UJPA 1BSIA 2XFYA 3QQWA 2P3EA 3VOGA 3A4WA 2FKPA 4JTDA 2WYSA 5BRQA 2AQWA 4QRNA 4FOUA 1OFRA 2ZRVA 4JQ4A 1UQZA 4PUMA 4N6FA 1RBOB 1WKYA 1YX1A 3WLRA 3GR8A 3NQFA 3C2OA 3IGSA 1GKRA 2C15A 1Y7VA 2HPIA 4TMBA 4O1BA 3VZYA 3EXSA 4IWWA 3BCDA 3TLLA 1EIXA 3QOMA 3HPXA 2DUAA 3G0UA 1P4CA 1JZ3A 2PWDA 1DOSA 1X6NA 1E4NA 4IH3A 1NELA 4J7RA 2BG5A 1D2KA 4GJJA 2VZSA 1DIKA 5JXQA 3BJTA 3DIPA 2QIWA 4I9AA 2PCQA 4W85A 3WK0A 2G0WA 1BXNA 3VOJA 3RCYA 4JTSA 2PGEA 1DEDA 1HJSA 4XISA 3K46A 4LUSA 2FDMA 2OEJA 4RPQA 4YCPA 3IK4A 3UWWA 3KL0A 4YU1A 1AQ0A 3CK5A 4XAPA 3GTFA 1RP8A 2WVTA 4B3LA 1U1UA 1HO4A 4G7EB 4Q4MA 3NDZA 1S5NA 1OCJA 1SO4A 3RK8A 5LGXA 1KC7A 1BF6A 3MUY1 1TWSA 4OOZA 2RAGA 2UY3A 4H6EA 5L6UA 3GU2A 1EUAA 2OZ0A 3STGA 2OSWA 3W7JA 4ADTA 3P0XA 1E1CB 3A3WA 5HOSA 4IFKA 2J79A 3VGHA 3VKJA 4EKJA 1HKJA 4IUOA 4ZBCA 1VEMA 4DJDA 3WSUA 1VC4A 4ZEPA 5DO8A 4PMZA 1TV7A 2PEVA 2CESA 3E0LA 4AUBA 2A5HA 2B31A 3KEHA 3MMWA 3VKAA 1ISZA 3W1LA 4ZQCA 5KTLA 1Q5MA 4D8LA 1XJBA 2YCLA 1LLZA 3SN1A 3URAA 2CNCA 4S38A 1XS2A 2AGKA 4TIMA 2YCKX 2Y89A 3VAVA 2QAFA 5CQ1A 2PDFA 4GIAA 1A3XA 1F3XA 1W3LA 1FCUA 3S1VA 3M43A 2IKIA 3ECQA 1ZAHA 4CD5A 4JNZA 1ICPA 2Z7GA 4LC8A 3NO5A 3VIOA 3PZNA 4S3AA 4LX4A 4JTFA 2H8ZA 2HE5A 3O05A 3ARWA 3N6QA 3F2CA 1H5VA 3VGGA 5CC6A 3VCRA 3GAYA 2ZIDA 1L0PA 3SUUA 2NV9A 3IVUA 2Q8ZA 4DUVA 3KBNA 3KXQA 1X97A 3UGRA 4N7QA 4DBUA 3EAUA 1VP5A 1TJRA 1DWGM 4WKFA 5EMYA 2E09A 2OWWA 3LNMA 3VFLA 1KKOA 3SCVA 4JTJA 4LB4A 1P0EA 3LM7A 2X0YA 2ZTJA 2ALRA 3W74A 5C70A 3ATZA 4RE0A 1V5XA 1YTDA 3QQ0A 3UD6A 1QI0A 5EL1A 4UOZA 2QCMA 4W8AA 2ZA1A 2PDXA 2E9BA 4TVUA 1CXHA 3PS7A 3VNIA 2J4GA 2NVAA 1ITCA 4PRRA 4H00A 3QY6A 5LNUA 2X7WA 1AVAA 4L56A 3TE9A 4B2DD 1ICQA 1MFUA 1E55A 4YTRA 1O5KA 1HL9A 1EEXA 3W2JA 4ZFMA 4KKXA 2FGLA 5K2ZA 1KR1A 1MFVA 3MT1A 3L4YA 1XCXA 3PZQA 5F4XA 2VX6A 2POTA 1TSIA 4MAVA 2C14A 4PTVA 1A5AA 3EOSA 5FCZA 3KP0A 2DY3A 3TA6A 2QDHA 1W3IA 5HQEA 1OFQA 4GBUA 4H9MA 4PBFA 2VWSA 4BI5A 3INPA 1F74A 3C56A 2QUVA 3OB8A 1SR0A 3WQDA 2V0TA 3OU8A 1XCFA 1EFZA 3H2CA 4AIUA 1K8ZA 1QK0A 1UPMB 3CUGA 1A5NC 4XTIA 5LNWA 3MBDA 4JHMA 5A6MA 3TW7A 2Z7KA 2WK2A 3WJWA 4CN4A 3ITXA 3WQCA 4WLCA 3AAMA 4Z1AA 2YLAA 1C7SA 1JQXA 5REQA 5IOBA 2YDRA 1ZPTA 5G2IA 1KRAC 1GVSA 1VBUA 3VM5A 5CPQA 2DEPA 4Q8PA 1G6CA 3M5XA 3RG6A 2D22A 1NARA 1T40A 5KINA 5K4ZA 3GU9A 1JCNA 4LCSA 4GKTA 3DKLA 3VUPA 4H19A 3WMSA 1G4TA 3KLLA 3W3OA 2WMGA 3DHUA 4XZLX 1EH9A 4JNYA 3SRKA 5DCDA 1H62A 1DHKA 2WVVB 2VKZG 1H09A 3DESA 4LY8A 1IXPA 4XSMA 4DO4A 2AKMA 4WUIA 3ALGA 2QCEA 4E4UA 3N18A 3L67A 1L6GA 4ILSA 1XR2A 4H7CA 2W61A 3CGTA 1CGTA 4RXGA 1O94A 2E3ZA 4N4PA 4S3EA 5LIXX 4F0HA 3WDRA 1GVYA 2ODOA 1W6TA 2G3JA 2CITA 3QF0A 4S3GA 4GC3A 2HBXA 2R1PA 1WXYA 1YDOA 1OFEA 2F38A 3PZVA 4QR6A 1EC8A 2FLIA 1GT8A 1GOIA 2BV9A 4AY1A 3EMQA 1JD9A 5F2GA 4MVAA 2QPXA 3T0AA 4N9EA 2E67A 2DDXA 3BMXA 3FS2A 3EOLA 3HQPA 3VDGA 5D4YA 1OCQA 3AZRA 4IL0A 4AVOA 3SRFA 2A3EA 2XYLA 1A4MA 2PDMA 1QMLA 2WHJA 4RE4A 1FWJC 4JAWA 2CBIA 2WJDA 4R27A 5DCEA 3GE7A 2O56A 1UW9A 2W27A 5A6AA 3GKFA 4QJ3B 1SJCA 3IV3A 5FF2A 1R2SA 3ZVIA 3CYJA 2XWEA 1ZUAX 2ACRA 4ORIA 1UQYA 2GJRA 1RK6A 4G6CA 3LRMA 3R8RA 3VNDA 1TR1A 1W1A1 5A2CA 3MWAA 1IZJA 2E8ZA 3WLJA 4IXHA 2F84A 1UH3A 1UD3A 3N12A 2PMQA 2Q02A 3W27A 2QAPA 3W22A 5K9XA 1QDSA 3S8HA 4CNUA 3DYOA 3CZ8A 5EMLA 4DJDD 4IPNB 5GQBA 3LCWA 4AQLA 2UY4A 3H7UA 1KQYA 4PB5A 2ZZ4A 2O7SA 3A6OA 2Y5EA 1XYFA 3NQGA 3KOFA 1W3KA 3OZMA 5TQLA 2A21A 1XLBA 2OZ8A 4CQ8A 2QGHA 1TCMA 4QQ3A 3KZPA 2Y7FA 1SZFA 3GQYA 5L9FA 3LV5A 4JQ2A 4AZCB 3DUGA 3PBMA 1AJZA 4BR1A 4QBXA 3RR4A 4AG0A 3WCZA 5EMJA 2EPNA 3NUKA 4IOTA 3TWBA 1R6WA 3CZLA 2GPTA 4DXXA 1UBPC 3V5OA 3TSMA 1ZBVA 2QHAA 7REQA 1CGYA 3AHXA 4AEOA 3TZFA 3NYZA 2W92A 3FVDA 4M19A 1LL6A 3NPUA 3GW3A 1PXGA 4IIBA 1XLLA 5C9RA 5LHEA 1OC7A 3WUEA 1IXOA 2C13A 3QY8A 1IV8A 1SSGA 4UNKA 2PTXA 3T81A 3HJZA 3ZJKA 4L6DA 5JU6A 4CNNA 1S5TA 1E3XA 4KF1A 3R58A 2ZUNA 1WA3A 2OSYA 1UP0A 1T5AA 2CLMA 1FOBA 2ZXDA 2I14A 3JR2A 4JYDA 5DLCA 4Y96A 1NIUA 4UTKA 3GIPA 4S39A 3S1XA 4BFAA 1RUSA 1UWIA 3O6YX 3RIKA 3G1FA 4HHHA 1NJJA 5A2AA 3KUMA 4KFNA 4YMZA 1E6QM 3BOFA 3GC5A 5EMMA 2HDJA 2XG9A 5CPMA 2ISWA 2E9LA 2Z2UA 1EC9A 1EL3A 3V3WA 4ICMA 1UZ4A 4F0LA 3GNDA 2BLEA 4LCRA 3ZLGA 1PUDA 4PB4A 1S38A 1Q63A 1ZP4A 4DAIA 1Q6OA 2VXNA 1IXNA 2OLAA 4M0XA 3AICA 2Y85A 4TV5A 4QG8A 1W1PA 2ZE0A 2O9PA 4O16A 4G1NA 3S9IA 3BOXA 2BSLA 3CYVA 2XVNA 4JDBA 5DY3A 1LL7A 4I5XA 3L2IA 3B0UX 4AIBA 1GHRA 3ZVHA 2EPMX 3LPOA 2CLKA 2O9RA 5KSWA 4IL2A 2EHHA 3TJLA 3DHDA 1FWEC 1JZ6A 1JXKA 1MQQA 4PZVA 3N4AA 5JH2A 4Z42C 2XISA 4C6OA 2AL2B 4LCQA 4JTIA 1UA7A 4YJ5A 4LSBA 1K7FA 3TCEA 4BI7A 3CPGA 1H3GA 3VD4A 1RLDA 3M0ZA 1JF6A 2DUXA 5GPRA 1ITQA 3A13A 3A5VA 1TKKA 2CERA 3AHYA 1G9HA 2PGFA 3LQLA 1SQ7A 3GYEA 3VZXA 1BXBA 1PTGA 3IIZA 2QLYA 3MYPA 3ARPA 2QCDA 2VUNA 5LIUX 4QISA 2Z00A 4Q6XA 3AIVA 2OODA 5C2GA 3TZNA 1DBTA 4NVTA 3B9DA 4YVPA 3RX3A 4M1RA 5CPTA 4J3XA 5HPCA 3K4DA 1A5LC 2HQAA 3BLLA 3DAQA 4AFYA 1BG4A 3RF9A 1UWSA 1HP5A 4B9YA 3MY9A 4C60A 3VGBA 4C1NA 1AZ1A 4GYFA 4PEKA 4FSAA 5FA5A 4WY0A 1F61A 2A6NA 3L0NA 3NQ7A 4GA8A 1PCKA 3GTXA 3PNUA 1I2QA 3GRIA 2VEPA 3BJSA 4LF1A 3IJQA 4D6JA 3FCPA 2NQJA 2W91A 5ECVA 3PTMA 2DZPA 2CZ5A 2D2OA 4IM4A 2VFFA 1PTDA 5A5WA 4P7RA 1F8MA 1WZAA 2ZRUA 3FYPA 3ZZ1A 2I5GA 2V5JA 4REQB 3T07A 1KXTA 4AEEA 1KA9F 3AFBA 1ZRQA 1YMYA 1US3A 2EPLX 4AEFA 5LIKX 1UPPA 1TZ9A 2LLEA 1P43A 3GFXA 1XSIA 1GYNA 3GHRA 1E56A 1EJTC 1UZDA 3S4TA 3CH9A 3H4GA 2OXNA 5EY5A 1V08A 1BAGA 2VP8A 3C86A 4D9PA 3O9NA 2CCRA 1XL9A 1S2UA 3BOLA 4PSPA 3H70A 1HJWA 3F5LA 4FK9A 3CEPA 3ARQA 1DIOA 1SGJA 3GNPA 2V3GA 2PDQA 3LERA 4Y9NA 1DJHA 1PKMA 5IRPA 1C9DA 4E3TA 1B0IA 3MVIA 3WH7A 2VMFA 1PHWA 4DBSA 3OVQA 5DFAA 1K9TA 2WJFA 3W1NA 3K8KA 1L2QA 1ZALA 4O1CA 3L5LA 3MP3A 3GG1A 4HU3A 1EGMA 2JKEA 3SGZA 2ABBA 1OHLA 3LDVA 4R53A 3WQ4A 4C7DA 1IZKA 1Z44A 1SM9A 3T42A 2W3ZA 1NWSA 4ZSTA 3T2PA 2ZUSA 4N9DA 2OT0A 3ZR6A 2ACUA 4LBUA 1ALDA 3U8GA 4YTUA 4LS1A 3AYTA 1PB0A 5HMSA 4O10A 5BU6A 1XW8A 1G4PA 4J40A 2WANA 4DYEA 5BW6A 2EPHA 3PUEA 5AY7A 7XIMA 2Q3RA 2INZA 2PODA 3URQA 2P8BA 3WQ8A 4M80A 2J62A 3UPMA 3W02A 5LHFA 3O0FA 1IT0A 4IMDA 2XZ9A 4E3VA 1RALA 1GQNA 4B5UA 1WPCA 4X0NA 3MSGA 4US6A 3H53A 3TAKA 1LOQA 2UWFA 1XG4A 3FX4A 2OB3A 5CZJA 1AW2A 2CBUA 4FR1A 5C5YA 4E2DA 4LS0A 4KMQA 4AWSA 4HOZA 1S2VA 6REQB 3TJ4A 1TO3A 2OWXA 3CLWA 3FJLA 1GKPA 2OWCA 5D2YA 1YLVA 3QJAA 3HG2A 2DZVA 2BXZA 1B30A 3B04A 2PDCA 1E5NA 1J4EA 5FACA 1NWUA 5I0DA 3RRXA 2XH7A 4AC1X 3MUZ1 2JGQA 1YPIA 4J3ZA 3VMOA 5D30A 2BVDA 4LXFA 1KGUA 3QPEA 4PMXA 4CVUA 3MI6A 3WK1A 1QK2A 4IT1A 5KETA 4I90A 2CLPA 3TTQA 4MKVA 3G24A 3NM3A 2Q6ZA 5D8WA 4KEZA 1QJWA 1NFPA 2X7VA 4E5TA 1WQ5A 3C3UA 1FKWA 1S5MA 3I7QA 3IIPA 4NAFA 5I3JA 3FA4A 2VGGA 1W56A 3OIXA 1JZ2A 2DZAA 3RUBL 2RJHA 1MW3A 3DXIA 2ZE3A 4NNBA 4D71A 3AUOA 4KEMA 3LCHA 3IAPA 3CMJA 3P80A 1OGBA 5LYRA 4D6CA 4POCA 3G18A 4GI8A 5AHIA 1M41A 1NOFA 3SRDA 4JYFA 3PJTA 2OLSA 5K9CA 2NXIA 1Q13A 2EG8A 3K5XA 4NYUA 3C2EA 1V3HA 3CWHA 3R0UA 2WWCA 4YVXA 4K1GA 3KVMA 1AD1A 2BY2A 3SECA 5G4EA 1KCLA 3UXIA 4FHAA 4FIQA 5M2FX 3VOCA 1VH7A 4W93A 1GNXA 3BO9A 3NQ2A 1IT8A 3IUHA 5LGZA 2WPBA 3NEHA 4D6EA 2G50A 3UXLA 4WF7A 5AC8A 2E40A 2CLEA 2ZBTA 1RA0A 4JFUA 1SSDA 3W76A 3IARA 4QGCA 4UFMA 3WLQA 2XJ7A 4EIVA 4HMDA 4GFIA 2XSXA 4WJEA 2BWGA 5GJMA 5D03A 3M5VA 4FB7A 2R94A 1JI1A 5FJRA 4RKAA 3B9NA 4U2ZA 4I7UA 1F73A 3IJIA 3NSMA 2VOMA 3ICJA 4JTAA 1OADA 5G4WA 1LT8A 1XUUA 3EA1A 2VCAA 4GMEA 2QIIA 4GNJA 4LU0A 3CUXA 3G22A 2J24A 4WDWA 4OHQA 1PS9A 5DN1A 1EQPA 4Q8NA 3N6HA 1UR3M 3CASA 3UXKA 2CHNA 2NWRA 3HM7A 4N0RA 4D72A 2ZCGA 4K1WA 4MWAC 1XBXA 2QJNA 1OFBA 1Q7QA 4KCVA 1XIMA 4S1FA 1LWIA 3LK6A 1FWRA 3NVTA 3QV7A 1N2VA 1FWDC 2V5BA 3N13A 3NGFA 2ZWZA 2D3NA 2I5IA 1SW0A 1LDCA 1F3TA 3LCLA 4GH3A 4D6HA 3H2NA 1HX0A 1A0CA 3L0KA 4GUGA 2YA0A 2VL4A 4DWSD 3GZ3A 1JZ8A 3BQ5A 1O1HA 3GD6A 3W23A 3ABXA 3LHWA 4CQ9A 1ZJHA 3I10A 3LY0A 4XIAA 1R3QA 3KCLA 4JY8A 3MV01 3EA2A 3VOHA 1B3YA 4I9TA 1V4YA 4MFEA 1J2WA 5ECUA 2BHZA 1OYCA 1OX4A 2F6XA 1UH2A 2J7DA 4DM2A 4KWVA 5IHRA 3DI0A 3A64A 4M29A 1UR0A 2GK1A 3K4WA 2IKGA 4WR3A 4F9DA 4FS9A 4NZ5A 2CHRA 5FOOA 3LTSA 2DUZA 1Z3NA 5EU9A 1P48A 4PA8A 4D6DA 2D24A 2PBGA 4GK8A 1CEOA 2OZ3A 3BAJA 2FVLA 5CG7A 3VO0A 3IJ9A 4LV9A 3LN3A 3C2YA 4MM1A 1LOSA 1OIMA 1XLFA 2I5QA 3UERA 1KFWA 3VDCA 4OGZA 4XWUA 1CGVA 1W5PA 1T7LA 1YEYA 4GGHA 4H04A 3S9YA 5B7ZA 3J7HA 1EJ7L 2EAWA 3GX9A 4U2YA 1Q8JA 1PVNA 5I02A 3QSRA 2PP1A 1K3UA 3PPGA 1K1DA 1F07A 4UMCA 1QPQA 5AYZA 4KPLA 3ZWTA 3RMEA 2WZMA 2Y24A 1EOMA 1Z6KA 2PLKA 4K36A 3FVMA 4IHCA 3E38A 4UTHA 4AZBA 1QUMA 5HATA 1EJUC 2DSUA 5IM51 2ZDRA 4OT7A 1VJZA 2WLZA 2FHCA 3CLMA 1KBBA 4GX8A 2V38A 4IJRA 1J0JA 2WMKA 3QLLA 2E5DA 1EXBA 2IXVA 1KQZA 5F4SA 3MCMA 1FCBA 3AS2A 2C18A 5IDIA 2ZX9A 2XPKA 3G1VA 1E3ZA 1VFSA 4KWUA 4YPJA 5LA0A 5M3WA 3DERA 5JVLA 3NYDA 4H6RA 1XI3A 3M0MA 3N4FA 3IJLA 3REQA 4GYPC 2CWNA 4IP7A 3FK4A 2XN2A 1UOKA 1CGXA 3CS2A 1MXDA 2H3DA 3RM9A 1K9DA 1QI4A 2NSOA 4MKSA 2D20A 1V3LA 3EWUA 4JPGA 4LAUA 4LRSA 1T8QA 1PIFA 4PCNA 3UY7A 5A6JA 2JIEA 3H2AA 5CH9A 3F2DA 1CBGA 1E40A 2NVDA 1AQFA 4FNUA 4MF4A 3WL1A 1XM3A 2VD8A 3G1XA 3P81A 3HG3A 2PTDA 3E0FA 4OQVA 3M0JA 1N8IA 3KBMA 3LA4A 3ZWSA 4GUHA 1CLXA 4R7OA 3SM0A 3OGRA 3QR3A 4O53A 2GQ9A 5G1MA 1UZ1A 3MU7A 4MWAD 3C0JA 1VRXA 2F7FA 1VB9A 2P76A 2ZUUA 1UP2A 3B06A 5DX7A 4O52A 4LUTB 6ALDA 1Y0EA 2GLKA 4X63A 3RR1A 1ZB5A 2OGYA 1HIZA 4HPHA 1RQBA 3WQVA 1GVIA 1M68A 3G1RA 3DFQA 3R12A 4B90A 4DELA 3TXZA 3UT0A 1HKMA 1M1BA 1S1RA 3GC4A 4Y9AA 1S3HA 3O2LA 3FKKA 3NO1A 4M7TA 3ARYA 1XH0A 3SY1A 5BMWA 3B0VC 1C7TA 3UCCA 1DTUA 2V2CA 5KITA 5CZSA 1FKXA 2DVXA 1LWHA 2FTPA 1QW9A 4MGGA 1TPH1 5D2XA 4BI6A 3BG5A 3CHDA 2YZRA 3TOPA 5D32A 1E6NA 3NZQA 4BCEA 1XWYA 3UR8A 2BASA 4US5A 3SN4A 3IRSA 2NV2A 2O92A 3B8UA 4M82A 2J77A 3H2EA 1RV8A 4DVOA 1V0NA 3NXLA 1ZAIA 3W7OA 3TQPA 4ZOEA 1N8WA 2ZRXA 1GZJA 3W1MA 3BH4A 3A47A 3KWSA 1AL8A 4LYRA 4ZA0A 4JNMA 2PBOA 3QV6A 1UA3A 3MKCA 2YW4A 4ZQMA 4UFHA 4XQ6A 4X22A 2ZYFA 2GJPA 4C5ZA 1A5UA 3BJFA 4GNKB 3APYA 4UQAA 1T41A 1Q85A 4FX6M 5D9NA 1GGOA 4UFIA 3E12A 1DYSA 3ALFA 3ZLFA 3EKLA 2XIOA 2PDGA 2CWXA 3HB9A 1YHTA 3S9ZA 2OELA 4Z0JA 1BPLB 4IMEA 3UWU