3EWWA

D312n mutant of human orotidyl-5'-monophosphate decarboxylase in complex with 6-cyano-ump, covalent adduct
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFENRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine-5'-phosphate decarboxylase
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ewwA00
4E38A 3LV6A 1LRNA 3PG9A 4XKYA 1EA0A 1RVGA 2Y85A 1H1YA 3C2VA 1N7KA 4FEZA 3DI0A 3Q37A 3TK7A 4O53A 3EWWA 4HN4A 4KFOA 3N3MA 2Z0IA 4N9DA 4RJEA 2NX1A 5F4SA 2OJPA 4UTMA 2V2HA 4D2JA 1CX9A 3O16A 4OV9A 2ZQ0A 3LCGA 1M5WA 2AQWA 2JGQA 3QJAA 2Z1BA 2V82A 1XL9A 5C5YA 1LCOA 2CLHA 3CEUA 2NUYA 4R33A 3L0GA 2PURA 3GIYA 1IXPA 3P62A 2E1DA 4FHAA 1GG0A 2PE4A 1SO3A 4NNAA 4TMCA 4RZ6A 3L0KA 2NZLA 3C3NA 3LLFA 3QMSA 4JX6A 3W1XA 4CCDA 3R13A 1QMLA 1SW7A 1TMHA 1OF8A 1J2WA 2GUUA 1MEWA 1X6UA 1OJXA 1N8FA 1GTHA 4FX6M 5K4XA 4LVBA 4UCGA 3W1PA 2WSRA 3NQ6A 5FF4A 4YXGA 4MY8A 4ORMA 1IXNA 4CCEA 3MI6A 3HG2A 2OCZA 3T78A 2FB2A 4M6VA 5HWJA 3R8RA 1FY6A 3NL5A 3R89A 3NEVA 4MOZA 3QMTA 4DF1A 1BEUA 4E2BA 4M6PA 3NQ7A 2YW4A 3TMLA 1KFCA 4PC8A 3GNDA 4Z1DA 1DQXA 3KXQA 1X7FA 3GX9A 1JRBA 1ZNNA 2G97A 3GAKA 4JS3A 4WXZA 3DFQA 1O60A 4JR5A 2DZWA 4O12A 3S5ZA 1QNVA 3GZ3A 4BI5A 5D2YA 4Y9AA 4BF9A 2YCEA 3UWUA 1KM3A 5E1QA 5G2IA 3PBUA 5GVJA 2BXVA 6ALDA 4O8RA 4O10A 1TRIA 5BOOA 1NSJA 2EKCA 5D32A 3O6YX 1LOQA 2CZEA 2ZRUA 1QCWA 4CQAA 4HNNA 1H51A 2E5BA 2A7RA 1OF6A 3T44A 2Y61A 5KZDA 1L6YA 3SFKA 4NNBA 1A5BA 2B7PA 2Y7DA 5CSRA 4JTJA 3KVMA 4RXFA 1K3UA 4FNQA 1M7OA 3M5YA 3QM3A 1WA3A 5LNUA 4LRSA 3N9RA 1M7PA 1OFEA 3W6YA 1YDVA 2OZ0A 2ZCGA 1VZWA 1KTCA 5ABTA 4UR8A 1T96A 3GB6A 3LHWA 2ZRYA 4NJHA 4FF7A 3TW7A 3DFTA 3IIPA 4AWUA 4O19A 4HIBA 5D2XA 1C29A 2CFFA 4LC8A 4IPJA 5C55A 3PAJA 2TSYA 3P8IA 1JRCA 5LZLA 1UCWA 4X3ZA 3NQ8A 2YYTA 2W79A 4RLIA 2NUWA 4O17A 2GVGA 1PV8A 1KFLA 1PHQA 1VH7A 2VFEA 1WYIA 1VHNA 4NNCA 2GQAA 3I7QA 4UFLA 4PH6A 3TMQA 2DU2A 2PC4A 1SUXA 3M9YA 1YPFA 3LHYA 2XN1A 1KLYA 4QAIA 1AW2A 1WOBA 3G1XA 3LOTA 5F4XA 2W6RA 2Q8LA 4ML9A 3C2RA 1R2SA 4OU1A 4XWUA 2PCQA 5FEPA 4MY1A 3C2FA 3DZ1A 2QCLA 5LNSA 3P80A 2X16A 3SZ8A 2I9EA 5CPMA 1FXQA 2B7QA 3QSTA 3O1NA 1P0KA 4MUZA 1LDCA 1A53A 1JULA 3L5LA 4IOTA 4M6QA 2YZRA 3LDVA 1ZFJA 1WDWA 4JIPA 1A50A 3NPXA 3LXAA 1H7NA 4JY9A 1DHPA 3TFCA 1T99A 3UNDA 4O1DA 1VRDA 3Q58A 1YXCA 3WFAA 3OVPA 3EXRA 1Z48A 3HG5A 1UUOA 2NLIA 1EP3A 5T26A 1ZALA 2QF7A 5H91A 5MHBA 1JJKA 2ZBTA 3GR8A 4UTHA 1XCFA 2RH9A 2EHHA 2HS6A 4O52A 1SZGA 1I2PA 4HSNA 5K2ZA 1TPDA 5LHEA 1EB3A 4GNJA 3W1RA 3IIVA 3PC0A 3ELFA 3EWYA 3EWXA 2CLOA 2QEZA 1MSSA 1W5MA 1XFBA 4ZQOA 3WJXA 3P82A 1I8JA 1LROA 1QFEA 4IGHA 3TFXA 1CI1A 1KFEA 5LNRA 5CG7A 2NXIA 3QFEA 1DBTA 3QPYA 5TBOA 1Q3NA 4AHPA 2QAPA 1RPXA 2KZHA 4PCFA 3GLCA 5I3HA 3ZWTA 3QMRA 4NU7A 3OVQA 5HNRA 5F1VA 1A5SA 2Q3RA 5CPOA 2X2GA 4DELA 2VENA 3PUOA 2NX3A 3EX1A 3C2EA 4JX4A 4AHOA 4AMAA 4EVZA 2YR1A 3QW4B 4FIQA 2E6YA 1LRQA 1OHLA 5EYWA 2E5DA 3HQ1A 3BLIA 4R7JA 3NQDA 1TPC1 3NZRA 1W3IA 3USBA 5I3IA 4K36A 3W74A 1FCUA 1W8SA 5EKYA 1TYGA 3IV3A 1S3HA 3QC3A 4XQ6A 3HMJG 5AHEA 3L65A 4FO4A 3FEMA 2HMCA 3LCIA 3W75A 4Q33A 1KBIA 4QJ1A 3M47A 1YADA 3CU2A 1O5XA 3NQCA 3DHFA 4LC6A 5CZ0A 3FA5A 3BV4A 2C0AA 1TIMA 3DU0A 2WNZA 3GVGA 3LXCA 3LXBA 4OQVA 2DP3A 2RKXA 4UR7A 3W1AA 3WJYA 3U8GA 4JICA 1QO5A 1NAL1 3LHVA 3PR2A 3OEXA 3F1QA 1FWSA 3ABOA 4P61A 3ZR4A 2CU0A 1VLIA 3C8FA 3YPIA 3G0SA 5CPLA 1W3TA 3MP3A 1K8ZA 4LTSA 3QSRA 3ABSA 3MI2A 4K8HA 5D09A 2VFDA 4OE7A 2XN0A 1VYPX 3LI0A 1H60A 3DXIA 3W2JA 3OA3A 1TRDA 4UXDA 1Z42A 1UASA 4O16A 2DZVA 3B0VC 1AL7A 4O15A 3LCLA 2NWRA 1GVRA 3W22A 3W1UA 1W1ZA 1ZENA 4DO6A 4N6EA 2RHGA 4Y8FA 1YXYA 3UWQA 1S5WA 2R91A 4EF8A 3NQVA 3G18A 3O8AA 1G7VA 3SY5A 4YMZA 4LUIA 2V9DA 1W5NA 3M5VA 3A21A 3W1MA 1KW1A 1ZAJA 1W5OA 5EY5A 4JYFA 5KINA 2R8WA 3MBFA 1YYAA 3H55A 2QCEA 3GKAA 4PFMA 5CZSA 4XZ9A 5E0KA 1YDOA 4MFEA 2C16A 1HO4A 1LOSA 2VC6A 4GUJA 1WOAA 3TNOA 5FF7A 1MEIA 3SECA 3T7VA 2QDGA 1XUUA 1LLZA 3RF9A 4JTIA 1AMKA 3W7HA 4POCA 3L21A 2OX1A 3P5ZA 4JYDA 3UPWA 5KITA 2P1FA 1JCYA 3QF0A 1OFDA 4NQ1A 3HO8A 3W1TA 3TDFA 4DF0A 3W9ZA 1U5JA 1THFD 2JKAA 3S5YA 4JY8A 1QO2A 2D73A 1EUAA 3W86A 1LBMA 4BWLC 3M44A 1DKWA 3PUDA 3UWVA 1SW0A 5BMXA 2Q8ZA 3BW2A 3DI1A 3TE9A 1IF2A 4AAJA 3C2OA 4WY0B 3B05A 3IVSA 3NQMA 3E96A 3TC6A 1JUEA 3KOFA 1I2OA 4NUWA 3BPWA 4UMAA 4JTSA 2YX0A 4RKAA 3SI9A 2P0OA 3HGRA 2OMAA 3KX6A 1UUMA 5A5WA 4UNKA 1TREA 3G3MA 2NXHA 1QOQA 1ME8A 5EA9A 4UMBA 4C1LA 4UMCA 1K8YA 5LGZA 1JQXA 2DZXA 2V0TA 1JVNA 2VFGA 2HS8A 2X1TA 3Q94A 3WJWA 3NL6A 4DO5A 3TXZA 5K9XA 1PIIA 3E02A 3PM6A 4K8EA 2Y63A 3GYEA 4GBUA 1XXXA 2J9XA 1OYCA 3CC1A 3QRHA 1AK5A 4WOZA 1JR1A 3EKLA 5SWUA 4Q32A 1XI3A 5A8GA 4FNUA 4MLJA 2NV2A 2Y6ZA 2JKPA 3LBMA 3KVLA 2DZTA 2H8ZA 1YXDA 4UFHA 1W37A 1K7XA 2CLKA 3V1PA 4Z08A 1XUZA 1GWJA 4FB7A 2GQ8A 5AN7A 3CIXA 4S1FA 1ICQA 2WQPA 2FIQA 3PY2A 4Z1CA 5HUOA 2Z6JA 1WBHA 3G1VA 1WV2A 3LTPA 3GDTA 4X2RA 3NXFA 1FXPA 4EIVA 4BI7A 1PVNA 1X1OA 2Y89A 3N14A 2JGYA 4UTLA 3MW7A 4IXHA 2BX7A 3G3DA 2CZFA 4KWVA 5DCEA 4GFSA 4JN6A 2TRSA 3FYPA 2G5WA 3LERA 3G0XA 4JYEA 4N4QA 3D0CA 3LCWA 2ISSA 3E12A 2I1OA 1TPWA 1W56A 4O14A 3WK1A 3ABQA 2CLFA 2ATSA 1SR9A 2E5CA 3W73A 2A6NA 3IIZA 4M5PA 5DY3A 3NPWA 1LLWA 2QJIA 4ALDA 4AWTA 4YL2A 3UY8A 1KFKA 4RR4A 1FCVA 1LBLA 1G4EA 3IVTA 1IIGA 3NM1A 3BLFA 4UTWC 3M6YA 4IMDA 3SGZA 1SFJA 3TH6A 1OFOA 4O4VA 2GJLA 1XBYA 2H3DA 3DENA 1GYLA 1NF7A 4HSOA 2TMDA 2TPSA 2A4AA 4G1KA 4QNWA 3GDKA 4DO4A 2Z6IA 1CW2A 3LCHA 4JXCA 3G24A 1YTDA 3QW3A 1TTJA 1VPXA 3VCRA 3W2LA 3TKFA 1MZHA 2XFWA 4N9EA 3FKKA 2A0NA 4LUJA 3G22A 3GK0A 1QPOA 1YPIA 3EWZA 1QWGA 1LRTA 1GOXA 3EWBX 2I14A 2O7QA 1T8XA 1TPEA 3TV8A 3O15A 4UTTA 4X9SA 1ALDA 3NNTA 4GUIA 5J5DA 2CLEA 5IBXC 4IWWA 3LLDA 3B04A 3N9SA 3EXSA 2VFFA 4WXYA 5AHNA 4FNTA 1ME7A 1XKYA 1HFBA 3DFPA 4MVAA 3S8HA 2FB3A 4FXSA 3TU9A 3UWYA 3BG3A 2O7SA 4LS2A 1TJRA 4LT9A 1TQJA 2X30A 4LV9A 3S0CA 2V5LA 1Z44A 5G1YA 2QCDB 3B0UX 2FLIA 1TPFA 1TV7A 4YWIA 1OX5A 2WSYA 1AG1O 3FOKA 4OGZA 3EX2A 3NYZA 4LWWA 4A21A 4C1KA 4U28A 4MPQA 3IGXA 1F73A 1FWRA 1OX4B 4KFNA 5CZTA 4MJMA 2ZA1A 1G69A 4LU0A 4MLRA 2GJNA 4O0ZA 3MJYA 4MJZA 3CQ0A 4OV4A 5FF0A 2V2DA 3B4UA 1SQ7A 4L4LA 5AOUA 1EWEA 3EX3A 3M16A 4E0CA 4EF9A 4OT7A 4LVFA 3OIXA 4ADSA 2A7PA 2CZ5A 1EIXA 1IXQA 1O94A 1SO4A 3G1HA 4H4IA 5KMYA 5TIMA 4WUIA 4I9AA 1KV8A 3IGUA 3UXAA 3NQGA 3LCXA 2ATMA 1SZNA 1UB3A 1G67A 7TIMA 4JTUA 4XTDA 5HR7A 1KFBA 2ZFAA 4YCOA 4PL1A 1HUVA 3VFLA 3STCA 4O11A 4O57A 1OK4A 5G4WA 3MP5A 2WNNA 1H7PA 3BG5A 3T55A 1Q6LA 1GVFA 4UTKA 3KVKA 4M19A 3L67A 3A5VA 2J24A 1FWTA 1SZFA 3KRUA 2Z2UA 4KFPA 1QOPA 2YSWA 4AVFA 2WPBA 3LX9A 3FKRA 3W7CA 2A6LA 5AYZA 2EPHA 3LI1A 4XKYB 1TTIA 1ZHAA 4KWWA 2FJKA 5AC7A 3TIMA 2VELA 3FIGA 5D30A 5HWNA 4BFAA 1ADOA 1LORA 1HG3A 2YPIA 3BGGA 5D04C 4Z1BA 4Y90A 2H3BA 2R14A 1I2RA 3KHJA 4PEKA 1GPWA 3C6CA 2RDWA 4H6KA 3W1NA 1EUNA 3HGSA 3GDLA 2PRHA 3OHIA 3PULA 4QSHA 1K03A 2VEMA 3W2MA 1L2UA 3P7YA 5AC6A 2HTMA 1F2JA 1P0NA 1QAPA 5LNVA 4ORIA 3HIJA 4HNTA 2QCGA 3CWOX 3BW4A 1O5KA 3K30A 4ZQPA 2B4GA 3B0PA 2C13A 4Z1AA 3W7JA 3WK0A 1RQHA 4IMCA 4NX0A 3OVRA 1YDNA 2A1YA 1DL3A 3W84A 1PCKA 1G6CA 1C9DA 4MKNA 3STFA 1X8FA 3HG4A 3BG9A 4U4MA 1VCVA 5DBUA 4WQ6A 4NT0A 4PL2A 2J6XA 4XUGA 1GVOA 3IIOA 5F2IA 2E6AA 4ZQCA 3W07A 1V5XA 3SGUA 2YXGA 1FWWA 5D37A 1G7UA 3W7OA 3R2GA 3IGSA 3AO0A 1NFBA 3FJ6A 2ZZ2A 2X1SA 4IX2A 4CCCA 1MO0A 2FPTA 1ONRA 2ZTJA 2WOQA 4DXVA 3P67A 1JCLA 4UFKA 4AF0A 3PBVA 4CNOA 3TQKA 5I3KA 3C56A 3NL2A 1MEHA 5LSMA 1EEPA 3DH7A 1JCMP 3M0ZA 3UD6A 3WJSA 2C18A 4UFMA 3BW3A 3O63A 3RLUA 1H50A 1SPQA 2FPYA 2ABBA 5BRBA 1SO6A 3P84A 4UTWA 2ABAA 1P5BA 2UV8G 1XDLA 3THAA 5FI8A 3BO9A 4NXKA 1G4PA 3VE9A 1MXSA 3JRKA 4I7VA 3SR7A 2E6FA 4DEFA 3RNDA 3S5NA 3PB2A 2RDUA 2ZA3A 1FCQA 3Q2DA 3WK3A 2V81A 1F74A 4NVTA 4O18A 2QCCA 3H54A 3KRZA 4LS1A 3C4UA 1VGAA 1S5VA 4N4PA 3LHTA 1LTDA 1L6WA 4FIRA 4O1BA 3CB8A 1A5CA 3W7KA 3MI3A 2GQ9A 4K39A 2QCFA 1VLWA 1RV8A 3AJXA 5I3JA 1OFQA 3O07A 1W0MA 4LVAA 2H6RA 2GVLA 1D3GA 2BZNA 1TO3A 4NZJA 1GQNA 3C61A 4TIMA 3QH2A 4TR9A 4RZ5A 1TSIA 3THQA 1WAUA 3W2KA 4RX0A 3W7GA 1LZOA 3W72A 2CWNA 3EX6A 4WOQA 3GNNA 2WKJA 1H62A 1K7EA 2YGYA 4ONVA 5KTLA 1YTKA 5EL1A 1DQWA 4JTLA 4JDBA 5D02A 5LGXA 5H2ZA 1F76A 1LOLA 3MYOA 1JUBA 3SJ3A 2H8XA 4DBEA 3O06A 1BKSA 2QUTA 4TX9A 4A3UA 1VC4A 1K8XA 2A5HA 1G4TA 1J4EA 1H5YA 3G0UA 3MYPA 2DZUA 3W87A 3QEZA 4UFJA 2OT0A 4M7TA 3P8JA 4W9TA 4IXXA 1K7FA 1H7WA 4RXGA 2ZZ7A 3CWNA 4O28A 1ZAIA 3NPUA 1WBJA 2YDAA 4ADTA 1GG1A 2EF9A 3EXTA 1NF0A 1KBJA 1TPVA 1T0OA 1FWNA 3A23A 4MFDA 4TO8A 5DXXA 2VFIA 3ABRA 2V8ZA 4GUFA 2WO5A 4K7VA 1R30A 1LM1A 1I45A 4N9CA 3DGRA 3PBYA 5U7SA 3QYQA 3TQVA 1D9EA 4E2DA 2ISWA 3BK0A 1LBFA 2QCMA 2VFHA 4PTNA 1TTPA 2Y62A 3MBDA 3B8DA 1KM5A 4RK8A 3QZEA 1OVDA 4Q4KA 3LGEA 5CSSA 2ALDA 2H90A 3S1XA 4BK9A 4IQLA 3LV5A 1W5QA 5J5RA 2ZRVA 4GWEA 3PWAA 4LNYA 4XBKA 5F2MA 1GTEA 3G1DA 1TB3A 3R12A 5G2HA 1BWKA 1R47A 1U83A 3HB9A 4K7YA 5LHFA 3WJZA 3W85A 4MZ1A 4AF0B 3FFSA 1VS1A 2ZZ3A 4FX8A 4AWSA 4ZMGA 3MMTA 1OYAA 3V75A 2V30A 4DQWA 1TV8A 4EWND 2B7OA 2CLMA 2QUUA 2CLLA 2F84A 4YLWA 1QPNA 1NEYA 3G1FA 1FDZA 4IX0A 3L66A 4LVGA 3W3OA 3TROA 2G96A 2E09A 1B4KA 2C1HA 3M1ZA 5AHFA 3QQ1A 4UNLA 2Y7FA 3N34A 3NG3A 4MZYA 3W1QA 4GE8A 5G4EA 4Z0SA 5F2GA 1BWLA 4WY0F 2CZDA 3EX4A 1W5PA 1YTEA 1W31A 3S1VA 3NL3A 3NM3A 1W54A 3SW6A 1F6PA 3T40A 3ZFHA 4UTJA 3UZ5A 3PSWA 3U2OA 1KFJA 3R5EA 3T4CA 1KM1A 5G5IA 2B7NA 3ANYA 1ML1A 1VCGA 2XN2A 5AYXA 3TXVA 1PL9A 3MO7A 4JD4A 3L2IA 4N9BA 5FEZA 3DFOA 3PF3A 1GEQA 1JCJA 3TW6A 2FPVA 3I68A 3W88A 1XBXA 3W71A 5D33A 5C6MA 1KV5A 3DKLA 5AHLA 3W83A 1SFLA 4XTIA 4NJIA 1XM3A 5AYYA 2NUXA 2FQIA 1OFBA 5HULA 4HPJA 4Y6GA 2C6QA 4WJEA 2AAMA 4KKXA 1KTNA 1DORA 3U6WA 1ICPA 1OABA 5CZJA 3TSMA 4GRSA 2C19A 5K7JA 3CM4A 2ZDRA 3FLUA 3LRKA 4IUOA 3CHVA 1ZJIA 4UC5A 5D2TA 1I2NA 3RMJA 4A29A 5AB3A 4LY8A 3DKJA 4RV8A 4CNPA 1OFRA 3CTLA 3PS7A 4OHQA 5I3GA 1VQTA 4MYXA 1YLVA 3IVUA 2W0UA 1KTBA 1QPRA 4YCPA 1TTQA 1GVSA 5CGQA 4CLMA 1XBZA 3W7IA 4GXMA 5AHIA 1F7BA 3W76A 1FQ0A 3I7SA 2BLEA 1B9BA 3NAVA 1S5TA 2IQTA 1I4NA 3E9AA 3TJLA 2ZRXA 1SW3A 1TPUA 4O1CA 4K6AA 5DN1A 4MZ8A 3TX9A 4QITA 1VCFA 3I6RA 2BTMA 2LLEA 3NVTA 4LRTA 3LRMA 1VYSX 4MYAA 4N2YA 4ADUA 3HJZA 3HPZA 3NPVA 4GJ1A 4O50A 4AXKA 3IIXA 4UTUA 4BI6A 1G4SA 2QCNA 1O95A 4ZL1A 3BGJA 4OBTA 1FDYA 4UIOA 5HJLA 2WSQA 4S2CA 4CQ8A 5F2LA 1NVMA 1JCXA 1KLZA 1XDMA 5I3FA 3W7EA 2JBMA 2B0MA 3KAOA 4RCXA 1L9WA 3NA8A 5HR6A 4O13A 1FUYA 5KSWA 4K38A 3W2NA 3B03A 4OWGA 3C52A 5E93A 2QAFA 3STGA 3NOEA 3IRDA 3M43A 4JTEA 3HGJA 3KFTA 3VNDA 1KM4A 1TPB1 1L6SA 4LOCA 2Q3OA 4JIQA 4JTGA 4N6FA 4IMGA 4TU1A 3A5FA 2WJZA 1AW5A 2J9ZA 1TJPA 2YW3A 3TSDA 1PE1A 2DJLA 4HPXA 2QR6A 4JEQA 3E0IA 4Z0JA 3VE7A 1XC4A 2EAWA 3HGOA 3KRSA 1K02A 5HUPA 2A85A 1HO1A 6TIMA 5IM51 4FXRA 1DJQA 1VYRA 3PG8A 2A7NA 3G1AA 3UY7A 3INPA 4LV4A 4PODA 2QDHA 5D2VA 5EPDA 4P2VA 2NV1A 3VI2A 3TAOA 4BWLA 3P61A 1VJIA 4J9JA 3OBKA 1HTIA 5LKYA 2CW6A 1UBSA 1KA9F 2ZA2A 1H7XA 2C14A 3S5OA 4JGDA 3G1SA 1WXJA 1TCDA 3N73A 1WX0A 3NQFA 1FCBA 3ATZA 3L68A 3HBLA 4GUGA 2ZZ5A 5D03A 1ZCOA 1IIHA 2FDSA 3DFSA 3MHGA 3I65A 3UQNA 3BVJA 2QKFA 1Q6QA 5FEXA 2NWSA 1EPXA 1N55A 1GVQA 5FEWA 1D3HA 1VHCA 2V2CA 4UTIA 2Y88A 4TMBA 1DV7A 5HQEA 1JUKA 4QISA 2VXNA 2G95A 1IXOA 3RU6A 1J5TA 2YYUA 4HNVA 1QR7A 3A24A 3UPBA 2NXGA 1RQEA 3TJXA 5D2WA 3E49A 3GXTA 5K9CA 1KM2A 1FDJA 1V7YA 2E68A 4JTKA 1QDSA 2TYSA 1F05A 3TA6A 3CT7A 3W7LA 3GDMA 1C8VA 3MUXA 2NX9A 3OG3A 1BTMA 1Q6OA 2EGZA 4H3DA 3JS3A 3F4WA 2X1UA 4JTHA 3SIZA 3NDOA 2ZRWA 4R53A 3L0NA 4UFIA 2BSLA 1EX5A 3L9CA 1H7RA 3GDRA 3HOJA 3F03K 1TPH1 1PS9A 1GZGA 3M7WA 3P60A 4QQ3A 3S1WA 5KZMA 3MHUA 3VKJA 4WY0A 1ME9A 3FYOA 1Y0EA 2QJHA 5DCDA 5DXYA 2DORA 4WD0A 2Y7EA 3LTSA 1ZY9A 1OK6A 3FJLA 4GC4A 2ISVA 5DBTA 2AGKA 1ICSA 4MY9A 4NJGA 4JNMA 3W2UA 3IEBA 4FNSA 4AEOA 5BMWA 3TAKA 4IPIA 5F4WA 3JR2A 2X1RA 3C0JA 4A22A 4ZQRA 1F5ZA 4R34A 3LM7A 4ICNA 2Y70A 2VOMA 1A5AA 3CEPA 3N2XA 1OX6A 2QJGA 3P74A 1GJPA 3HPXA 3RFAA 3W7DA 2VKZG 1RQBA 3KVJA 2Y7GA 4FNPA 1R46A 3H53A 3EKZA 3DHDA 1Q45A 1FX6A 1ZAHA 1IGSA 1SU5A 1SSDA 5K3VA 1AL8A 2QCHA 3G8RA 5HMSA 5DLCA 3ZWSA 3DBPA 3S1UA 3CLMA 5FF2A 1O4UA 3RK8A 3B06A 4HKPA 5DCBA 4I7WA 4MIMA 3G8EA 3UZJA 3FS2A 2ZZ4A 1LP6A 4NX5A 5AFDA 3G1YA 3MHFA 3NZ1A 1H7OA 1EWDA 3LHUA 4NZFA 3NQ2A 3M5XA 3W7NA 3GXNA 4QM1A 2DZPA 1PHWA 4FX7A 4JTTA 4ZQMA 3MWAA 1SO5A 5HWMA 1RZMA 3N2MA 4O54A 4WX2A 4NXSA 1OFAA 4UTTC 2RFGA 5EBUA 1AW1A 4FNRA 3PUEA 3W1LA 1R2RA 5IBXA 2GOUA 2QUVA 1VR6A 3L5AA 5EMUA 3STEA 4ZZ9A 2J27A 4AB4A 5CPNA 4HHPA 3LBCA 4BR1A 1E51A 3A9IA 2YFNA 1H63A 2WV8A 2DJXA 5F1UA 3W23A 4A2RA 2YFOA 2RDTA 3NQEA 2VEIA 2J9YA 1W3NA 3LRLA 4AHQA 5CKSA 4DF2A 5L6UA 5FF3A 4ZVJA 3F4NA 3EWUA 3TSBA 3TR2A 3O05A 4A2SA 2PRLA 3S42A 2BWGA 1R2TA 3LTYA 2PRMA 4JX5A 2GPTA 4S2BA 1OYBA 1XBVA 3NR0A 4CQ9A 1I2QA 3QPZA 5AC8A 5D38A 5C2XA 5K4ZA 4I7UA 3TUUA 3TC7A 1KM6A 3GAYA 3M5ZA 3DAQA 1X1ZA 3PSVA 5L9FA 2JK2A 1Z41A 4JTFA 5TQLA 4IMEA 3WK2A 4GUHA 3P81A 3EB2A 3LHZA 3PBWA 1RR2A 1P1XA 4O0KA 3W7PA 4DBDA 5BNKA 3A22A 1JQVA 4DPPA 3M41A 1Q6RA 3MP4A 2E77A 1UJPA 4X22A 4PA8A 5D05A 1LYXA 4B5NA 5HINA 3L5MA 4O1AA 4Y96A 5U4NA 2R94A 3NO5A 3O6CA 1H1ZA 4M7SA 3HPSA 2ZTKA 2OT1A 3BARA 2C3ZA 3TCEA 2DZSA 4NJKA 3I7RA 2A2IA 1B4EA 1GT8A 5C54A 1P4CA 1HL2A 1PCWA 4O4WA 5AHMA 1FBAA 3CPRA 1KM0A 5FESA 2V5BA 2C15A 3S6DA 3UWZA 5LNWA 1QPQA 2QCDA 1SZEA 4EOUA 3GR7A 5KZEA 2VEPA 3ATYA 2WNQA 4LS0A 4LW7A 3W7RA 3ZS4A 2A21A 1TQXA 3UWWA 3GKFA 2ZRZA 2ZZ6A 3UYCA 1OX4A 2E6DA 2P10A 4QNEA 2J88A 4IJBA 4JDYA 2ZYFA 2JKEA 3NGJA 4WZHA 3CIWA 4LVDA 4AH7A 1EP2A 2F7FA 3SSJA 4HNUA 2CLIA 3NQAA 3W7QA 5G1TA 3LCFA 4K37A 4HT3A 3GXPA 3P5YA 5K9DA 4RZ4A 4IMFA 3PVFA 5G2WA 1OG0A 3EEGA 2FFCA 4ZQNA 3O6DA 1GYNA 1JCNA 1DJNA 3W70A 3DFNA 3HF3A 3UXDA 4L4MA 3PB0A 1DVJA 1EP1A 2FTPA 8TIMA 3QQ0A 1TV5A 3TQ0A 5DELA 2HSAA 1RD5A 1M6JA 1F6KA 5DY2A 1H61A 1WQ5A 3HG3A 1DOSA 4NJJA 3RLVA 4XBSA 2VEKA 1OFPA 1B57A 3LB0A 4QIUA 3BLEA 3W7MA 4UUIA 1B3OA 2GVJA 4DPQA 2ZZ1A 3S9YA 4N02A 4CNNA 1SSGA 3N19B 5BW6A
chains in the Genus database with same CATH superfamily
1E1EA 4J4KA 4XKYA 1ONWA 3AZTA 3TTQA 4DRSA 3SSZA 1SFTA 1GKPA 1N7KA 4JQ1A 3TK7A 3EWWA 4J35A 2QPSA 1EX1A 1J0HA 2Z0IA 3BMWA 3U9IA 2V2HA 4D2JA 3CLWA 1UA7A 4AD3A 1M5WA 2AQWA 2XJ7A 1XL9A 1XCXA 3B8UA 1JDAA 2VRJA 3CEUA 2UZ9A 4R33A 3UZZA 4GINA 3AWNA 2PURA 2W27A 4FHAA 4QE1A 2BVTA 1KGXA 3QGVA 4L80A 3SADA 4RZ6A 4JX6A 3L0KA 3C3NA 3DFYA 3QMSA 1JZ5A 2PZ0A 1WDQA 3WUEA 1MEWA 1X6UA 1N8FA 3TTOA 4LVBA 4UCGA 1RUSA 4YXGA 3ARZA 3AHVA 2C1IA 1IXNA 2MUCA 2NT0A 1L8NA 1C3FA 2PWFA 1FWIC 4P5UA 5HWJA 3R8RA 4RDYA 3R89A 4MOZA 3QMTA 3U48A 1UR4A 3NQ7A 3TMLA 3SN4A 1EBGA 1DQXA 1X7FA 3B97A 2G97A 2Z26A 3HU7A 5IFTA 4JS3A 3CUIA 4O12A 5JBEA 1QNVA 3KLLA 4Y9AA 3B9EA 2YCEA 1JZ7A 6ALDA 4O10A 5BOOA 3CL7A 2EKCA 2PTZA 1LOQA 4F9JA 4UQBA 1CPUA 1QCWA 1QHZA 3PAOA 3SO7A 2QNEA 1QBAA 3PFRA 2Y61A 4KPLA 3W82A 3SFKA 1YHTA 2B7PA 2QVNA 3W6MA 1KKOA 4JTJA 3KVMA 1K3UA 1UWQA 3TWBA 1IGWA 3WH6A 2DQXA 5LA0A 3CMJA 3MDUA 4WDXA 3ZJ6A 1KBLA 3N9RA 1M7PA 2DH2A 4JQAA 1OFEA 4BEQA 3K8KA 4IPPA 2PEVA 2RGMA 4HA1A 1VZWA 4D6FA 3EEZA 3T8LA 5RUBA 3WLRA 4JTCA 4UR8A 1DXFA 2Z7KA 4IPNB 2DFAA 1M9HA 3DFTA 2I9UA 4O19A 4C6MA 3VMPA 1MXDA 2BHUA 1C29A 4PMUA 2YCLB 1S2CA 3GU1A 2TSYA 3ARRA 1E6SM 4FR6A 4ZA0A 2YYTA 2W79A 4RLIA 1S2AA 4QXIA 2NUWA 4HNOA 3GG0A 1RCOB 1VH7A 4NNCA 2GQAA 4UFLA 4HHMA 5MF5A 3P3BA 4PGLA 1YPFA 4FF5A 3LENA 3VC6A 2XN1A 2F9RA 1VBJA 1PO9A 4H41A 3MVIA 3TNBA 1WOBA 4WR3A 5F4XA 1ZBCA 2DSKA 2Q8LA 3BMXA 5FEPA 4XAFA 3K13A 2X16A 2I9EA 4OFCA 5CPMA 3ERPA 1FXQA 2FZNA 3O1NA 3WO8A 2WANA 4QBXA 1LDCA 1JULA 2HWGA 4IOTA 2XIOA 1UG6A 2YZRA 3KCLA 3I4EA 3NPXA 3VUSA 1DHPA 4IIBA 3M0KA 3KP0A 3KM8A 4JAWA 3L12A 1YXCA 1BXBA 1XLGA 4FA3A 4IIDA 5I24A 1K8CA 3EXRA 1QHPA 2NSOA 1S1PA 4HK6A 1WKDA 1VFSA 1PDZA 4L9ZA 1ITCA 3T0AA 3HQPA 3S9ZA 1XCFA 5FJJA 4HSNA 5LIUX 5LHEA 1EB3A 4QDPA 1NWUA 5CPQA 4C6QA 3IIVA 2FVLA 5HOSA 3TYUA 1IT8A 2J74A 1KR1A 4J28A 4FLQA 2J7FA 3POHA 1QFEA 3RM9A 3TFXA 4I8DA 3VOCA 5EMJA 1KFEA 4C91A 5LNRA 4GIRA 5CG7A 1AQFA 3GNXA 2NXIA 5CJMA 4DJED 2GWNA 3QPYA 2VX4A 5TBOA 4WDTA 2KZHA 4KS0A 3PZQA 3GLCA 3UA4A 3OVQA 7CGTA 5HNRA 2POTA 3GW0A 2PDJA 2Z25A 5CPOA 4DELA 3KBJA 3KCOA 3S2LA 4TV5A 4AMAA 4L6OA 4PUKA 3SUSA 3QW4B 1XYMA 5CC5A 4IISA 5MKGA 4MM1A 2WVUA 4CD6A 4GCXA 2E5DA 3HQ1A 4R7JA 1TPC1 1RJQA 2WC7A 3OO2A 2PTXA 3FY1A 1FCUA 1W8SA 1HW6A 1TYGA 3IV3A 1S3HA 4XQ6A 4AD2A 3L65A 4AZCA 4DWSC 1KBIA 4O0QA 4XUYA 4GNKB 3EMQA 3FA5A 3BV4A 1TIMA 3ICJA 4CVWA 4GACA 4HHHA 2DP3A 4UR7A 4XAGA 4JICA 3UW6A 2YIHA 1FWSA 1MDRA 4EPBC 2GVEA 2CU0A 3C8FA 3YPIA 3AIEA 1QJWA 5A6TC 3QV7A 3UEQA 3W27A 4OE7A 3OA3A 4UXDA 3KZPA 3OBEA 2P50A 3B0VC 2ZXAA 3LCLA 3W22A 3S47A 1N8WA 2IS7A 1YXYA 2RHGA 5DF0A 2OLHA 4EF8A 2ISFA 4N0RA 1QW9A 2JEQA 1DJZA 3BTNA 5KINA 3WMSA 5M5DA 1ZB5A 2DT1A 4DYKA 3BANA 3GKAA 4PFMA 2INZA 2A3HA 3TOYA 3W25A 3TVAA 1VEOA 4C6LA 1LLZA 4IICA 1JZ8A 5EB8A 2OPJA 4E2VA 2R6OA 2WQDA 3IJLA 1RBOB 3QF0A 1KC7A 1CYGA 3EMZA 2V5CA 4Q8UA 4OUIA 4NQ1A 4MDPA 3KS5A 3UYIA 2VWTA 1L6GA 2JKAA 2VCAA 3E74A 5M1TA 5FJUA 3QY7A 4DUWA 3W01A 4PRTA 3CXOA 1GVEA 2WZIA 3C3UA 1DKWA 4ES4A 1ZS2A 2V3DA 4IIGA 3H21A 1AFSA 5B7YA 3MCNA 3E96A 3MY9A 3BAWA 1JUEA 4AMCA 1G94A 1I2OA 3SB0A 4JTSA 4GYKA 1HJVA 3LZ3A 3HGRA 4CEUC 3H7VA 1TV3A 3QTPA 3KDOA 4OOUA 2VVNA 4QGCA 1QOQA 5EA9A 3QY6A 4HYRA 2V0TA 4US6A 2HS8A 2X1TA 3LM3A 3NL6A 5I06A 4M56A 1V0LA 4KGLA 1QW7A 4DZ5A 1U30A 1AK5A 4G7FA 2PGWA 4JTRA 4S38A 2D2GA 2DQWA 3D47A 4S3FA 3WBEA 1YXDA 4UFHA 1H11A 3VKDA 4LF2A 4F8XA 4FB7A 4M0XA 5AN7A 4S1FA 4Z1CA 4ZFCA 3G1VA 1RA0A 1L0PA 2REQB 4PRWA 3MMDA 1VJZA 3UCDA 5JH2A 4B9YA 4KWVA 1GK8A 2WBKA 4ZCWA 4D9PA 2ZWYA 3REQB 4JYEA 1DWAM 2DT2A 4NZCA 1TPWA 3W38A 2CKRA 4O14A 4PMNA 5AKQA 3UU0A 5DY3A 4ALDA 4AWTA 3CK5A 4YL2A 2D69A 3HZ3A 1WXYA 2OODA 3D3AA 4PSRA 4RNHA 5HJYA 1D7FA 1CXHA 1R7OA 2CYGA 3M6YA 3SQMA 7ODCA 3GH5A 4M82A 1SFJA 3TH6A 1EXBA 2YBVA 2H3DA 4W89A 4HSOA 2WVVB 2TPSA 2VZTA 4XO6A 3UGVA 1CNVA 2A4AA 4LUTB 1FHUA 1TG7A 4DO4A 3LCHA 3BSGA 3G24A 1YTDA 1XRSA 3AMDA 3PJXA 1MZHA 1JXJA 4LUJA 1V79A 7REQB 1Y65A 3AIQA 5IRPA 2CKSA 3EWZA 1LRTA 1AODA 2FGLA 4IL0A 8CGTA 4DLMA 2O7QA 4ROQA 3TV8A 1UYQA 4W8BA 5CJNA 5CAKA 1ALDA 1UPPA 3MB9A 3ZLHA 1F6YA 2OWXA 3BAKA 3K4AA 2A3BA 2VFFA 4JEJA 4WXYA 4XD3A 5AHNA 4FNTA 5KETA 1ME7A 1EC9A 1GVIA 4MVAA 3S8HA 4FXSA 1AD1A 3UGRA 4PMZA 3KWXA 2O7SA 4LT9A 2X30A 2H9AB 1Q6DA 5HANA 4A3HA 1Z44A 3W24A 4YTSA 2BOFX 3B0UX 2FLIA 1TV7A 1OX5A 3BMVA 1EJXC 3M46A 2PDKA 3EX2A 4MPQA 4R7OA 4MAVA 1F73A 4JIHA 1OX4B 3RRAA 3F5KA 1HQTA 1PZ0A 2FVMA 1G69A 1RVKA 5AC4A 2X41A 2DVTA 1BQCA 3CQ0A 5FF0A 2V2DA 3T0CA 1SQ7A 3M16A 1MW2A 3CUHA 1UMLA 5DRIA 4CU8A 3W02A 1O94A 3AJ7A 3T08A 4EPDC 2Z24A 3M6DA 4ZO6A 1KV8A 1BXNA 2R1MA 4QROA 1QWKA 4R85A 4MNMA 7TIMA 2PLMA 1KFBA 4MB5A 3I3EA 1XW8A 2J66A 2Y5SA 4H9ZA 4PL1A 5DRCA 2D0HA 3S6TA 1EGMA 3TYCA 3HN3A 4O57A 3HQNA 1WZLA 3L67A 3A5VA 1SZFA 4Q3MA 4AVFA 3GC5A 3K8MA 3H7RA 2EPHA 3LI1A 4XKYB 1TTIA 1ZHAA 4KWWA 3TIMA 3FIGA 4JQ4A 5HWNA 1FWGC 1JPKA 4ZSUA 1LORA 4C6CA 2YPIA 4I9JA 4EP8C 2H3BA 1I2RA 3KHJA 4I5RA 2RDWA 2QW5A 3GDBA 1L2UA 2XFRA 3CAWA 2OYKA 4DZHA 2HTMA 4O8AA 1ISVA 1P0NA 3DG7A 4NF7A 4HCDA 3CQJA 3CWOX 3AU2A 3K30A 4LEQA 4ZQPA 2BFGA 3B0PA 1BQGA 1GJWA 2Z4GA 4B91A 2C13A 2XH7A 5HXMA 4PMRA 3N11A 1GZJA 1TVPA 1HJXA 3BCDA 1G6CA 4PMXA 2V5JA 3STFA 2E40A 1PDYA 3WEOA 1VCVA 1GYMA 1CLXA 2XVKA 1GKQA 4WQ6A 2J6XA 2HEJA 1R3WA 4NZ4A 3KL0A 1TJ1A 5FJTA 3W07A 3U7BA 3B0XA 2IXVA 1G7UA 2PWVA 4NP7A 4AZGA 2JEPA 3AO0A 1JNEA 2OQLA 4HOWA 2E9LA 3PWGA 3KBNA 2WCGA 2XGIA 2INEA 4AF0A 1EDTA 4CNOA 3IJ8A 3NL2A 1MEHA 3M0ZA 3WJSA 2E67A 6XIAA 1S1RA 2XH4A 3LSBA 3RLUA 1GOQA 1SPQA 2G8ZA 2FPYA 4TUFA 4GLEA 5BRBA 1XLHA 5FSEC 1J10A 2ZC1A 3ISIX 2ZXDA 3I4KA 2UV8G 3THAA 3WFLA 3BO9A 1KCKA 1G4PA 3VE9A 1MXSA 4X0NA 3WL0A 4I7VA 3SR7A 1QASA 1VBRA 2E6FA 2J25A 1XG4A 2O9RA 3BOLA 3CV2A 3WK3A 3LMYA 4IMAA 3TQPA 1F74A 2Z2BA 5GJMA 4O18A 4Y7EA 1W1YA 1VFUA 2FMOA 3LHTA 1LTDA 4FIRA 5DO8A 3HFTA 2QCFA 1U5HA 1VF8A 4WIWA 2O9PA 2AL1A 2H6RA 1A5MC 2MANA 3GSMA 4NZJA 2QPXA 1GQNA 3C61A 3BLLA 3WDPP 3L2MA 4TIMA 3QH2A 2SFPA 4BQ3A 1E5JA 3OA5A 4MB3A 4B5XA 2E0PA 3T0DA 4C1NA 3SQLA 3WIJA 4WOQA 4ZO9A 1JDDA 5KTLA 1YTKA 4K1GA 4QCFA 3WLKX 5D02A 2WM1A 2Y24A 4HP5A 2YCJA 4DWSD 2ZX7A 4DBEA 3O06A 3PK7A 1BKSA 2G3JA 1XICA 2PI6A 1R9ZA 1K8XA 1A3XA 4GQQA 4I9TA 1KBKA 3G0UA 3QEZA 4UFJA 3P8JA 2ZADA 1P6BA 4MTVA 1KXHA 1V51A 3V16A 2VVSA 4OJYA 1H7WA 4Q4MA 2DH3A 3NPUA 2D2JA 1XRVA 4LB4A 1GG1A 2EF9A 4ADTA 1KBJA 1QW8A 1FWNA 3A23A 4MFDA 5DXXA 3ABRA 3AICA 1A0CA 4C6PA 4YN5A 3KTSA 1LM1A 1X97A 4TXEA 3OZMA 5U7SA 1UH4A 2VFHA 3EA2A 1TTPA 3MBDA 1Q6GA 1AH0A 3B8DA 4Z2LA 1KM5A 4RK8A 3QZEA 3NTYA 3U4FA 3LGEA 3APGA 3FNDA 4IQLA 4PTVA 5J5RA 4LNYA 1DWIM 3G1DA 1TJ0A 1XG3A 2IKHA 5CBJA 3HB9A 1QTWA 5MKGB 3WH9A 1HN1A 4F0HA 4K7YA 2XM1A 3H12A 5LHFA 3WJZA 1WCGA 3W85A 1BYCA 1NP2A 4FX8A 2IKIA 2W91A 2J79A 7PTDA 2G4FA 4L64A 2QUUA 5CBIA 2CLLA 1BHGA 2F61A 1GZ1A 3AI0A 3KLKA 3S4TA 3CMFA 3W3OA 2G96A 2E09A 2XVPA 5A95A 1PTGA 3RN6A 3M1ZA 4PBEA 1J5SA 5AHFA 2D20A 3QQ1A 1XLEA 3NG3A 3IAPA 2IQDA 4RZBA 4B2DD 4H7CA 5G4EA 5F2GA 3TZNA 1I75A 4GKTA 1BWLA 1W31A 1MXGA 1W54A 1DWHM 4I5XA 4M1RA 3THDA 2DVXA 5AECA 4UTJA 3USZA 1NOUA 4CD7A 2VT0A 1NY1A 1E40A 2VI0A 1KM1A 5G5IA 2MNRA 3ANYA 1ML1A 4A6GA 3AC0A 4HZ6A 3TXVA 4B16A 2C7FA 4U31A 4N9BA 4H01A 4RE3A 3H2NA 3KBSA 2OLSA 5CQ1A 3VNLA 3QZAA 1E0TA 3TW6A 3WNOA 3WQPA 4BA0A 3H8AA 3W83A 4JTDA 4Y9MA 3AIUA 4BCEA 2YLLA 2XGBA 4AIUA 4X0VA 2NUXA 2NQ9A 1SYTA 2AGTA 4QLLA 4Y6GA 1Y5WA 4WJEA 1DORA 3ARPA 1OABA 4C90A 4LBSA 4GK8A 4GIYA 3DKJA 4CNPA 3B40A 2B31A 4TX8A 1VQTA 4MYXA 3IVUA 1QPRA 5CEWA 4YCPA 2UWFA 2PWEA 1TTQA 1KKRA 4DZIA 2X0HA 2J7DA 5D8WA 4CLMA 1XBZA 4HCLA 3W7IA 1US0A 3GRIA 4GXMA 3I7SA 3C8NA 1FWBC 1S5TA 1TPUA 5DN1A 1EZ2A 2YA2A 2GGEA 1B3YA 2BTMA 4LRTA 4MYAA 3LGGA 3VDHA 3VX1A 3AYTA 3WNPA 1P48A 5GNYA 4C6FA 3IIXA 3BGJA 1XIBA 3VAVA 4IQJA 4K1WA 4CQ8A 5F2LA 3WF0A 1JCXA 1UH3A 1UQYA 3CS2A 3G77A 2GSHA 5H6HA 3EA3A 1TX2A 1QI2A 4RCXA 2VMFA 4IFRA 1ENUA 3F4CA 5HR6A 4O13A 3M0XA 4K38A 2J75A 4OWGA 3IRDA 3M43A 4JTEA 3LEPA 1KM4A 1FHLA 1TPB1 2WMKA 1QBBA 2DZAA 2PDXA 3RUBL 2Q3OA 2HNHA 2Z1VA 2WJZA 4MSSA 4FOUA 1OQFA 4ZBCA 2J9ZA 3WF2A 2HISA 1QNOA 4NZ5A 1TCMA 2QR6A 1W9XA 4Z0JA 1Z7AA 5BXSA 1J9YA 3HGOA 5FACA 2CIPA 2QVHA 4AEFA 2A85A 5IHSA 3ME3A 3IK4A 6TIMA 1VYRA 2FHBA 3G2GA 2C79A 2CNCA 4PODA 3VMNA 3QGKC 1LWJA 3VI2A 4BWLA 5C9WA 3PTDA 5CJ5A 2WK2A 1VJIA 1FWCC 1UBSA 1UWTA 4L7ZA 3K8LA 2C14A 1B0IA 3S5OA 3G1SA 1UKOA 1ISYA 1GUVA 3KW3A 3L23A 1KGUA 4D1IA 2FZ8A 1IZKA 2CITA 5D03A 4Q6JA 3UA3A 2P88A 3IUDA 2QUNA 2WVTA 3I65A 1LUCA 3R8HA 3UQNA 4IGSA 4IM4A 2QKFA 4YVPA 3ITGA 3EDDA 2HVNA 3F2DA 5LYRA 4BEUA 4H2HA 4C6JA 4TMBA 1FRBA 4F0KA 4AZIA 4K3ZA 1VFTA 1DV7A 5HQEA 2JALA 1JUKA 1J01A 5JBFA 3FYYA 2YYUA 3V0SA 1QR7A 3A24A 3LU2A 2Z1SA 4HOZA 1DTNA 1XSJA 4H8VA 5K9CA 1KM2A 1QDSA 3AISA 4OOZA 3TA6A 1YNYA 3W7LA 1C8VA 1BTMA 3WYZA 3L4YA 3AUJA 4NILA 2ZUTA 2Q8XA 3NDOA 4WKAA 2ZRWA 1JI2A 2D3LA 4UFIA 2BSLA 3MKCA 2OFJA 3WBWA 4DWSB 1X1NA 1ZGDA 4GZJA 3HOJA 5DX7A 4KT2A 3F03K 1TPH1 5T8GA 4KEMA 1UUQA 1Z6KA 3P60A 2W4XA 4F3HA 1UOZA 3S1WA 3VNKA 2KX9A 5KZMA 3MHUA 3VKJA 4WY0A 1ME9A 3FYOA 1Y0EA 5DCDA 1LG1A 2DORA 3NJ3A 2ISDA 3SCTA 1OK6A 4D6IA 4UBPC 4MY9A 1IQ8A 3NDZA 1C8XA 5BMWA 4ZTYA 3TAKA 1BYAA 3OGRA 3BWWA 4GI9A 4J5NA 4A22A 1RP8A 2C91A 1PZ2A 1PZ1A 4R34A 2VX7A 1I1WA 4ICNA 3U0HA 2QJGA 3MZ2A 2VD9A 3P74A 1KBBA 1GJPA 3HPXA 1JPHA 1HF6A 2EPOA 2VKZG 2Y7GA 1K9FA 2A3AA 5FAJA 3H53A 2J7GA 3OW1A 4Q8PA 4DLFA 1SU5A 4J3VA 1AL8A 3FW6A 4HMNA 5DLCA 4E4FA 3DBPA 4ZB5A 3AXKA 4P8XA 4KF1A 1LLOA 5FF2A 2R1KA 4HKPA 4I7WA 4MIMA 3AIVA 4IJRA 2VM8A 3CZJA 3H23A 5AFDA 3MHFA 3NZ1A 1EWDA 5E0CA 4NZFA 3M5XA 1VBHA 4EE9A 3F4VA 4X9YA 1B54A 2WHKA 4WX2A 1VENA 4XD4A 5EBUA 4FNRA 3UG4A 2ZKMX 3W1LA 1HJUA 3RCYA 2V5KA 2WLZA 1E70M 4FLOA 2UY3A 3GXFA 3A9IA 1H63A 5F1UA 2YFOA 4G7EB 1WDPA 1EZWA 2VEIA 1MUMA 4Q22A 1VB9A 4DAFA 4ZR8A 5FJOA 4DF2A 3FDGA 3TR2A 3S42A 2BWGA 1R2TA 2OX4A 3E3HA 1MYRA 1KM6A 3ITLA 3WG6A 2JK2A 3AIBA 5DFAA 1AH3A 1GQJA 5TQLA 3P81A 1WAWA 3EB2A 3KDNA 2Z29A 3PBWA 1PKNA 3VX0A 1P1XA 4O0KA 3W7PA 2RUSA 2G0WA 1JAKA 1U1UA 3BZJA 4DPPA 3CAKA 1EA9C 3MSYA 2NQ5A 2X40A 2OTDA 3SCNA 3MP4A 4D6EA 4PA8A 1MWOA 4ML4A 3VD9A 3S3GA 2OGJA 4ZEPA 3NO5A 1H1ZA 4F0SA 5LIYX 1YNQA 1D8CA 3BARA 1R9XA 3TCEA 1RLCL 2A2IA 1GT8A 1VFOA 2GDUA 1P4CA 1HL2A 2C8NA 3PZOA 4O4WA 4JHMA 5AHMA 5HQLA 2C15A 3S6DA 2QCDA 3KL5A 5C9RA 4ZE5A 3ATYA 4LS0A 3ZQ9A 3GKFA 3UYCA 4RW3A 2P10A 1TWIA 1EO5A 2ZYFA 3NGJA 1EP2A 1UD4A 3RR1A 3LCFA 1KWKA 4HT3A 3P5YA 2BVDA 3UF9A 2BV9A 4JKLA 5G2WA 1W2PA 3EEGA 1GOIA 1MUCA 1E1CB 1GYNA 4Q4OA 4E3VA 1DJNA 3DFNA 1WDRA 4S3GA 4GNVA 1M01A 2QV4A 3TQ0A 4ERAA 1PWMA 4GXPA 3BH4A 2HSAA 2CXEA 3VOIA 3RX2A 1M6JA 1ZPTA 4HZ7A 2I56A 5I3DA 4NJJA 3RLVA 1C93A 1AJ0A 1YDYA 4UUIA 3DYOA 1B3OA 2W92A 3UCQA 2BVWA 4HU4A 4DPQA 3LS9A 4CNNA 5BW6A 3UXKA 1F3XA 4E3TA 3CYVA 2CPUA 4E38A 3LV6A 5I02A 3PG9A 1EA0A 4G8TA 3C5QA 1H1YA 3C2VA 1QU4A 4FEZA 4O53A 1WKYA 4KRZA 3N3MA 3V4BA 1V6XA 4N9DA 4PCSA 4RJEA 3E2SA 3E0VA 5IFPA 3GVRA 3DIPA 5IDZA 3WUGA 4OV9A 3L4VA 2JGQA 3QJAA 5HDRA 1X6NA 1EGVA 3UNTA 1QVBA 4YHGA 2NUYA 4XD6A 5HBFA 7A3HA 4C1NB 1FTXA 2E1DA 4J40A 2OWWA 4NNAA 5JU6A 3EA1A 3LLFA 2NZLA 2D2HA 4CCDA 3W1XA 1JZ4A 1SW7A 1TMHA 1OF8A 1J2WA 2QUMA 1OJXA 1HKVA 1GTHA 5K4XA 1YW1A 1XKJA 4I8YA 3FN9A 4HOXA 3APYA 4C5ZA 4ORMA 1ZSXA 3MI6A 5A69A 3WQWA 3T78A 2FB2A 1Q8AA 4IH3A 4M6VA 3RYSA 3LD5A 1FY6A 4AUBA 2V38A 4GHRA 1UH2A 1BEUA 4LUSA 1W32A 1P7TA 4GZIA 3GXIA 3AS3A 1ZNNA 3H2MA 3GAKA 4N42A 2VURA 3Q45A 3DFQA 1O60A 1UW9A 2DZWA 4JR5A 3S5ZA 2Z27A 3GZ3A 2GJXA 4BI5A 1IWBA 4BF9A 3UWUA 2CZVA 5GVJA 1TRIA 3QHNA 4Y9OA 1NSJA 1R3RA 4EAYA 2YBUA 3WDRA 1IEIA 3CPUA 1KRBC 1H51A 2VCBA 2A7RA 4LUYA 3WLMA 1O1ZA 1EPVA 3TA9A 1L6YA 4NNBA 2PDHA 4FNQA 1Q6CA 4AD0A 4LRSA 5BU6A 3W6YA 4X2PA 1W3JA 1KTCA 5ABTA 4H9VA 3IJDA 1J93A 1K9TA 2HROA 4AG0A 3MKKA 4L6HA 2ZRYA 4NJHA 2OEKA 3OGSA 3VIIA 1PAMA 2WJFA 3N2TA 3VOJA 1J2BA 3GHUA 4LC8A 4IPJA 1OGSA 3PTQA 4GGHA 1IE7C 1JRCA 2XIJA 4X3ZA 1FA2A 4GABA 5F7UA 3ANUA 4O17A 3VO0A 2GVGA 5J8LA 4PB3A 3I7QA 4PH6A 4OKDA 4GYPC 1OG6A 1K77A 3UR5A 4QAIA 1IV8A 3U2EA 3LOTA 2W6RA 6ENLA 2VRKA 4MY1A 4LAOA 4HB7A 2J7HA 1MUWA 7ENLA 1ZRQA 5LNSA 4JCMA 2NQJA 3SZ8A 1W9BM 1Q2RA 1LQ2A 4PYSA 3QOMA 1P0KA 4DZAA 4KEVA 4HYVA 1DE5A 1KCZA 4JNYA 4LQ1A 1H7NA 1WKFA 3UVAA 4O1DA 5PTDA 1IEQA 1VRDA 3Q58A 4QAWA 1ODZA 4Q8OA 2AKZA 3STPA 2P76A 3HG5A 1EP3A 5D8ZA 1G01A 1ZALA 2OOGA 5MHBA 4US5D 3A13A 3V3WA 4BS0A 1XLCA 2EHHA 2HS6A 1SZGA 4PMQA 3T0TA 1I2PA 5K2ZA 4JHZA 4DJDD 4V1YA 5I5RA 3TTYA 2G3NA 3TJIA 3MCMA 2JIEA 1OB0A 5FAGA 1RP9A 3OLIA 2GFTA 2VR4A 4PMDA 1BD0A 4AY1A 5XIMA 4LH8A 1XFBA 3OIHA 3NGFA 4ZQOA 3OQEA 3WJXA 1I8JA 3MSGA 4L1GA 2XSXA 1DXIA 3QFEA 4I90A 4IL2A 4F2BA 4Z1YA 3H2FA 2QAPA 1YE6A 4D72A 2I5IA 3SUVA 3ZMRA 1PEZA 5I3HA 3ZWTA 1QI4A 3QMRA 1N2VA 2P0IA 4NU7A 5EU9A 5T9CE 3RX3A 5JIWA 2UY4A 2VENA 2NX3A 3EX1A 4F2UA 4JX4A 1TV4A 4AHOA 1OT2A 1FP8A 2D0GA 4EVZA 1UKPA 1UKTA 4RUBA 2YR1A 3P93A 4A4AA 2VX5A 1OHLA 3MUAA 3USBA 1W3IA 1IZJA 4WGHA 1E6QM 3QXBA 2PU0A 1U33A 1W1B1 3VDGA 1RCXB 5AHEA 5KEZA 1J0IA 4H9MA 3N6HA 5AYIA 2GGHA 4Q33A 1IT7A 3M47A 1YADA 3CU2A 1JPIA 4IIFA 3DHFA 5FCZA 2FYMA 3AXHA 3LXCA 4OQVA 2RKXA 4GMEA 3W1AA 3TLQA 3WJYA 3VABA 3U8GA 1QO5A 1NAL1 3W26A 3ABOA 1SVDA 4U5KA 1VLIA 1ONEA 1CGUA 1BVWA 5CPLA 1QI5A 3P2VA 4AD1A 3WQ8A 3ABSA 8XIMA 1ESWA 2XN0A 1B30A 3C0QA 1TRDA 3EB3A 5AVHA 1Q13A 1UASA 3GH7A 3W53A 2DZVA 1AL7A 1OY0A 1Q7ZA 3H26A 2NWRA 4AISA 1GVRA 1WUFA 3W1UA 1R7AA 4LFYA 4N6EA 1Y7VA 1GW9A 2R91A 5TNVA 3SUUA 3WLQA 4AY7A 1MFVA 3G18A 2ZXBA 1DWJM 1G7VA 1MZRA 3SFWA 4KWOA 1HKWA 4NSBA 5I79A 1OCBA 4IJCA 1DIEA 1Q65A 3JU2A 3MBFA 3SRDA 1YYAA 5CZSA 3SDOA 2VDGA 4XZ9A 1YDOA 3EYPA 3AIWA 2VC6A 2NV9A 3E0LA 1MEIA 3ANVA 1R3SA 1R5YA 1XUUA 3S2NA 4KEZA 4JTIA 3W7HA 5FIPA 1XYBA 2YL8A 3CT2A 1OWQA 4R9XA 2OX1A 3PZVA 3UPWA 2P1FA 3NSXA 3CH0A 3ITOA 4HMEA 1TELA 4S3CA 3WQ4A 1BG9A 3W1TA 4DF0A 3W9ZA 3BSMA 1THFD 1UR0A 2GUBA 2VGIA 4E8GA 1CB2A 3TYEA 2EG7A 3MSRA 4TTUA 3BW2A 3UT0A 2ZXQA 3C2OA 4WY0B 3B05A 3LBOA 1MQRA 2WMIA 3KOFA 2PDFA 3BPWA 4CNUA 1RY8A 2YL9A 3H2EA 2YX0A 1G0CA 4ERIA 2P0OA 2OMAA 3KX6A 5A5WA 4GISA 1G5AA 2NXHA 3I6EA 4UMCA 4C65A 5LGZA 3R6IA 1JVNA 4J2PA 3ZR6A 1VRXA 3OLGA 1CXLA 3ONBA 2VFGA 1RK6A 1F9CA 1CIUA 3WJWA 3VMOA 3BL3A 5K9XA 1PIIA 2QLYA 2OZTA 2Y63A 4GBUA 1XXXA 2WM0A 1JAEA 2O92A 1JR1A 1YE4A 1XI3A 2XIQA 5A8GA 3E6EA 3KVLA 1EBHA 2DZTA 1K7XA 3V1PA 3CV1A 1QI0A 1XUZA 1UPMB 1GWJA 2BBFA 3K4WA 3WH5A 1RCQA 3RJYA 1ICQA 4DUXA 5HUOA 3VIHA 3WUBA 2Z6JA 3H4XA 4I3GA 3WNLA 3FGCB 3SN1A 4X2RA 1NM9A 2I16A 2DT0A 4BI7A 4HJWA 1ZL1A 2FMNA 1X1OA 4M29A 2JGYA 3GE7A 3MW7A 1XYLA 4IXHA 3G3DA 2CZFA 5DCEA 1VFMA 4JN6A 3HFYA 3FYPA 5BXTA 4N4QA 4MNKA 4XAZA 3W81A 1XLBA 1UR1A 4G1NA 3ABQA 2PUZA 3GW3A 2CLFA 2ATSA 2QPUA 3EOSA 1SR9A 2E5CA 3W73A 2A6NA 2PDBA 4M5PA 4W85A 1SM9A 1J0YA 2PDQA 4HMCA 2ZUWA 1I0BA 1ADDA 2HVOA 3HMCA 4RR4A 2JQXA 4H6QA 1G4EA 4F4RA 3IVTA 1ITUA 4UTWC 4IMDA 1R0MA 4EPEC 3O6AA 2Y2WA 1XLDA 1XISA 1XBYA 4LCSA 3BJTA 1E6RA 1NF7A 2OQHA 1IEWA 3BCFA 2PTWA 1CW2A 5JVLA 3VNYA 2A0NA 3GK0A 1DP0A 1YPIA 1QWGA 4LB3A 1PB0A 1TE1A 1E55A 4UTTA 4X9SA 3DGBA 3NNTA 4QFUA 4GUIA 3VIKA 2VZVA 2EPLX 2CLEA 1E6PA 3B04A 3L4XA 1JFHA 1SR0A 4GO9A 1XKYA 2DSUA 3O7UA 3TU9A 2PDGA 4B5WA 3B8TA 3G1RA 1UHVA 4F79A 1TQJA 4C5YA 4NKCA 4LV9A 3AS0A 2CHOA 2OOFA 4PTMA 3N25A 1OBAA 2QCDB 5DQPA 1TPFA 4PMJA 3PPHA 3FOKA 2BGSA 3R7MA 1A5KC 4OGZA 1GVYA 4C1KA 1HL9A 1B3XA 2R9RA 2OKOA 3VNZA 4PR4A 2PWHA 5CZTA 4F40A 2I57A 3SY8A 1EYEA 1BRLB 4E8DA 2ADAA 4MJZA 3B9OA 2XWEA 3EX3A 3D5HA 1UD6A 3OIXA 3P0XA 2A7PA 2J13A 2W5FA 1IXQA 4H4IA 5KMYA 1XLFA 2O4MA 4I9AA 2WC4A 3IGUA 3HJEA 1E71M 1SZNA 1HP4A 1G67A 4XTDA 3GUWA 2PLCA 2FH8A 3WLHA 1PYFA 3STCA 3CUZA 3GVQA 1Q85A 1FWDC 1TWWA 3T6CA 3MP5A 5HK4A 4WSHA 1XGEA 1UOKA 1GVFA 4Q4PA 1OZMA 3AQUA 1U5VA 1ITXA 2Z2UA 1YRRA 4NHVA 2PA6A 2WPBA 1TWZA 3LX9A 2WXDM 3VZYA 2AMXA 3W7CA 5AYZA 3JZEA 1J0ZA 2QF8A 2PP0A 3RCNA 3UVIA 3P6LA 1SFSA 2AKMA 1KQYA 1VIZA 1BF6A 1HG3A 1REQA 2FGZA 3BGGA 5D04C 4Z1BA 1ZBWA 3QR0A 4Y90A 2R14A 2ACUA 2XPKA 3OHMB 4PEKA 1GPWA 1NWSA 2FHFA 4M3PA 1EUNA 3HGSA 1M03A 2F8QA 3W2MA 5GPRA 1TKKA 3R1ZA 4FLRA 3TN3A 1QAPA 2QV5A 3HIJA 1PJ9A 2C71A 3CZLA 1O5KA 1I0DA 4GQGA 3W7JA 2W62A 1RQHA 3GC4A 4IMCA 3OVRA 1AQ0A 1PCKA 1C9DA 1X8FA 4U4MA 1VFFA 1RXOB 4NT0A 4PL2A 3TWAA 4NYUA 2W67A 5F2IA 2QQ6A 5BRPA 2E6AA 1P7TB 4ZQCA 7TAAA 1DJYA 3E1F1 1V5XA 4PUJA 3SGUA 1FWWA 5HMEA 3RCMA 2Z1WA 4BKNA 3IGSA 1VIWA 2AAAA 2VRQA 4XZNX 1LQAA 1TJ2A 1US2A 2IMRA 5A8MA 3MKVA 1E0UA 2WZTA 1GQKA 1SMDA 4IX2A 4PTXA 3WQOA 4CCCA 4DY1A 2FPTA 2ZTJA 2WOQA 1KXVA 4DXVA 3P67A 4UFKA 3PBVA 2UY5A 4KW2A 4L4OA 1EEPA 3ZJKA 3DH7A 1MDLA 5HJXA 2OQYA 3T2OA 4XZHA 3O63A 3QQWA 4YU1A 2ZVIA 4JIEA 2DZBA 3P84A 4UTWA 3BQ6A 3QLLA 3FV9A 2QJNA 4GFIA 4DX3A 4Q4SA 3I6TA 3VA8A 4Q8VA 2CERA 2CHRA 3MDWA 3WQEA 4Z2IA 4Y8EA 2QXWA 1BGAA 2YCIX 1DTUA 3Q2DA 2V81A 2QCCA 3KRZA 3WX7A 2YA0A 3C4UA 3FSUA 1VGAA 1S5VA 1C9WA 4N4PA 3T0BA 2G37A 3N6QA 3ALGA 4QDMA 1A5CA 2UBPC 3VKCA 4K39A 3C2YA 8RUCA 1IYXA 3O07A 1W0MA 1XLIA 1V3IA 1D3GA 2XVLA 1TO3A 3ZT5A 4B15A 2Y4SA 5E09A 2D3NA 2DSZA 3WQVA 4HK5A 3THQA 3N15A 3NZGA 4C6OA 3QOKA 3U5UA 3NSNA 4KIRA 4AIEA 3W7GA 1LZOA 1PXGA 3W72A 2HBXA 3EX6A 3LYEA 2OELA 2WKJA 1K7EA 4GIAA 4ONVA 1DQWA 3WQFA 4JTLA 4H04A 5JIPA 4ACZA 1F76A 3BLPX 1FVPA 1POJA 1JUBA 2WBGA 1GPFA 3WKZA 2QUTA 4A3UA 4BZYA 2AL2A 1P0EA 3MMWA 3DBNA 3L4WA 3A3WA 1EC8A 1DJIA 1G4TA 3D46A 4MWAA 1CLKA 3EWDA 2DZUA 2DGAA 2XVNA 4GZ7A 4MWAE 2OT0A 1K7FA 2J8TA 1UWSA 3CWNA 4H6RA 1WBJA 1TFVA 3A6OA 1GQLA 1AQMA 1NF0A 2WWDA 3N6JA 1TPVA 3RR4A 1T0OA 3W0KA 4W7UA 1X98A 1TX0A 2V8ZA 4K7VA 4ZE4A 1R30A 4PEEA 1AZ1A 1I45A 3MPGA 1QK2A 3QYQA 3HV8A 1CCWB 2QCMA 1UWAA 4I6KA 4AZ5A 4Q4KA 3GR4A 1XPGA 2FHCA 3N9KA 5F2MA 2PSNA 1BWKA 1R47A 1U83A 1FWFC 3UBPC 2GDQA 4RPPA 1VS1A 3SBFA 3AALA 1W3KA 4FR1A 2WC3A 3V75A 4DQWA 4LY4A 3ALFA 3AROA 3V0TA 1DIOA 1FDZA 1JXKA 4M51A 4LVGA 2E9BA 2X09A 5CG0A 4HSHA 1P1MA 2C1HA 4HGXA 3GQYA 3HTWA 3W28A 1UQZA 3VDBA 3CH9A 4GE8A 4ZXLA 2CEQA 5FL1A 2CZDA 3PPFA 3AU6A 3DHPA 3S1VA 3NL3A 3NM3A 3SW6A 1F6PA 2GYIA 4XSMA 4Y9PA 3UZ5A 4M80A 1CB7B 4NAEA 5REQB 5IHRA 3FA3A 2XN2A 2GJRA 4JD4A 2WCSA 3NZPA 5FEZA 2DSWA 1P0DA 3PF3A 1JCJA 3PANA 4UNIA 1O12A 5D33A 3ZLFA 2BVYA 1CXFA 1SFLA 4LYKA 4XTIA 4NJIA 4LNCA 5AYYA 4A3RA 1IR1A 2FQIA 1XRTA 2W61A 2J6VA 3A9BA 4MPKA 3N4EA 2C6QA 2W63A 3EDKA 9CGTA 4RDWA 3U6WA 4HA4A 4YTQA 2ZX5A 1ICPA 4GI8A 3TSMA 4GRSA 4WDUA 5EBAA 3WL1A 2ZDRA 1VFHA 3RHGA 4IUOA 1ISXA 1ZJIA 3RMJA 4QEHA 5AB3A 4LY8A 1OFRA 2E28A 3CTLA 3LSCA 1XIDA 3GO2A 4GQ0A 5I3GA 1BVZA 1YLVA 3V35A 1KTBA 1GVSA 2BGNE 2IPWA 3OYZA 3RX4A 1FQ0A 2BLEA 3NAVA 3TN6A 2IQ0A 1XCWA 3E9AA 4G5DA 2ZRXA 5JQ9A 1MVYA 4K6AA 3TX9A 1EGZA 4RE0A 1HKMA 3LRMA 4IGMA 4S3EA 3O0FA 4XD5A 3EMCA 1TA3A 3NPVA 2VC7A 4ZB2A 2IPFA 1RJRA 1S2TA 3L4ZA 5I78A 5D9OA 3WDIA 3BUVA 5A8OA 1O95A 1A3HA 1FDYA 2XIMA 1MFUA 4XG1A 4K8GA 1JCTA 3UPMA 2WMIB 4J7RA 1NVMA 1KLZA 1XDMA 2Q71A 5I3FA 4NG3A 2B0MA 3N4AA 1VKFA 5CZKA 3BGAA 2OXNA 3N2BA 3STGA 2OLAA 3HGJA 3VNDA 3R58A 4GYFA 2QJJA 1L6SA 1UR9A 3OLEA 3TC3A 3P0WA 4JIQA 2GSJA 4N6FA 1W1TA 3SURA 4C60A 3ARVA 1XGDA 2INFA 3M0MA 1TJPA 3APTA 1HGYA 5E5CA 4B5UA 4E4UA 5A8PA 3SAZA 1B3ZA 3VGHA 3VE7A 3GYCA 3F2CA 1CTNA 1XC4A 2EAWA 1Q6FA 1ZUAX 1K02A 4GKLA 4P8VA 1TUXA 3A4AA 5IM51 4NAFA 3PG8A 3QV6A 2A7NA 3G6MA 3S9IA 5GNZA 1M7XA 5JH1A 4CQBA 3AYRA 2NV1A 2HDJA 3MTWA 2O9OA 3JW7A 4J9JA 1HTIA 5FOOA 1M1BA 2CW6A 3ARXA 4PN2A 1JYWA 1UP3A 3AHTA 1TCDA 1PKLA 3NQFA 2PBGA 3CUFA 1F8IA 3BURA 3M7SA 1IIHA 3IPWA 4JCLA 3GHSA 1TUFA 2FDSA 3DFHA 2YZ5A 3MHGA 2VOTA 1ADSA 5JXQA 1NDZA 4D6HA 1N55A 1GVQA 2V2CA 1K4GA 1HJWA 4UTIA 2DIJA 1XLLA 3MUY1 1XJBA 2VXNA 1DHKA 3FXGA 4MADA 1IEXA 1UR2A 4HNVA 4IP4A 4LBRA 1D7KA 3E49A 5EGRA 4QRNA 2W3ZA 2TYSA 1UD5A 4DJFC 3BAXA 2EGZA 4H8HA 1R86A 4W8LA 4NIRA 1TWDA 4PCNA 3RLHA 4JTHA 4YVXA 3L0NA 3L9CA 4W88A 1H7RA 5LA2A 1A0EA 2PDUA 1PS9A 3RPMA 4EANA 1GZGA 4PB5A 1QUMA 4ROPA 4QQ3A 4ZO7A 3ARQA 4L4PA 1C7SA 2QJHA 2Y7EA 1ZY9A 3FJLA 1HVXA 1T6MA 5DBTA 1S2UA 3WZ0E 4AEOA 1M7JA 2PLKA 2XZ7A 4IFKA 2J62A 3L2LA 2YBTA 1F8MA 3GG7A 4IPLA 1CGTA 3OLDA 4QDWA 5IXEA 2Y70A 3KBWA 3CEPA 1A5AA 2WMFA 1OX6A 1ZJHA 2RJHA 1TV2A 2Z00A 3AHZA 3W7DA 1RQBA 1FKWA 1NWTA 1R46A 3EKZA 3DHDA 1Q45A 1FX6A 2PGFA 3CBWA 3N17A 1IGSA 3AIRA 5K3VA 4FMVA 4W84A 3EPMA 3CLMA 2P8BA 1O4UA 4RDVA 2CCRA 5AVNA 1XS2A 4GGBA 3FS2A 5I00A 3WD1A 3G1YA 1TVLA 3CO8A 2X8RA 3LHUA 1LG2A 4UQEA 3NCOA 1XD0A 3GXNA 2OZ3A 1KR0A 2DZPA 4ZQMA 3VM5A 5FSDC 5BZAA 3N2MA 1PX8A 1E6ZA 3NIYA 3MV01 1LL7A 4WRHA 5IBXA 4PTDA 1GHRA 3OTRA 3L5AA 4DYEA 1B2YA 3LBCA 4Q7NA 4BR1A 1E51A 1LL4A 2YFNA 3UZXA 2WV8A 3ZYZA 2G3IA 2RDTA 5E70A 1MQQA 3R0DA 4J27A 2PDNA 4HHLA 2B81A 1GHSA 4D6DA 3VIOA 4MB4A 3MQTA 4UOZA 4AHQA 5CKSA 3TSBA 2WJEA 3O05A 4XZMX 1UC4A 2PRMA 2GPTA 1XBVA 5K4ZA 1I2QA 5I7GA 3U2ZA 4I7UA 3TUUA 3ZM8A 3TC7A 3GAYA 1X1ZA 3S83A 3PSVA 3NEHA 1RY0A 4JTFA 9XIAA 4GUHA 3BE7A 1S2WA 4P7NA 1VPQA 1RR2A 5BNKA 3WQ6A 5C9ZA 1E4MM 4DUOA 5CXPA 4YYCA 3AZSA 4AC1X 2E77A 4YJ5A 4DIAA 4MNLA 5HINA 1W8GA 4YNGA 1YX1A 4WSJA 3O6CA 4M7SA 2OT1A 3UR2A 2C3ZA 4EXQA 2DZSA 3WEMA 4IQEA 1OIFA 2BS9A 4U2ZA 5C54A 1OC7A 5HATA 4ZODA 1FBAA 2AOSA 5FESA 4QTGA 4L6DA 3PNUA 1SZEA 4H9XA 5KZEA 4U2YA 4JHOA 1UBPC 4LW7A 3V5CA 3W7RA 2A21A 1TQXA 1P6CA 3UWWA 1VBGA 1EOKA 3UR7A 3EOUA 2ZRZA 2ZZ6A 2E6DA 2J88A 4IJBA 4JDYA 4WZHA 3RPDA 1UD8A 4JN8A 3FAWA 1EFZA 2CLIA 2POZA 4A3QA 2YCLA 3GNRA 4MF4A 4PUEA 5K9DA 3GXMA 1OG0A 5M17A 1Q66A 4ZQNA 1XLAA 3QY8A 2X7WA 1UWRA 1QNPA 1JCNA 2PF0A 4L4MA 4R5EA 5C71A 2ACQA 1EP1A 2VZOA 4DJFA 2JFEX 3QQ0A 4AZBA 3VTRA 2OEJA 3FVDA 5GJPA 1RD5A 4V2XA 2Y5JA 3R8GA 4G6CA 3M0YA 3NSMA 3WDJA 4JFUA 1OFPA 1B57A 3I10A 3LB0A 4OVXA 4CD5A 1WO2A 2ZUVA 2QDEA 4IF2A 1FHVA 2GVJA 4H19A 2Z2AA 3S9YA 2FZBA 4WVXA 5FD0A 1DIDA 1LRNA 2DPEA 4LANA 4FI4A 2Y85A 3VZZA 1A4LA 3Q37A 1XRFA 4W8AA 4PUDA 1F4AA 1V02A 2NX1A 1V93A 5F4SA 2OJPA 4UTMA 1V02E 1CX9A 4J3WA 4OBSA 2ZQ0A 3LCGA 3JZUA 2V82A 3WDQA 3CHEA 1LCOA 2CLHA 3OPSA 4BQ2A 3PTMA 3GIYA 3P62A 3TCSA 1E9ZB 4AY8A 1J6PA 2PE4A 3SCSA 3ZZ1A 1QXLA 1ECEA 4XIAA 2D23A 3R13A 1QMLA 4G2DA 4ICMA 1S38A 1EKOA 2GUUA 2O56A 4FX6M 4ACZB 3W1PA 2RGLA 2WSRA 4JNZA 5FF4A 3M0VA 1SJAA 4KESA 1EJRC 3VD3A 1W3HA 4CCEA 3HG2A 1NDYA 4JTAA 6XIMA 5E0FA 1YPXA 1WZMA 4DF1A 2YW4A 4L1XA 3GNDA 2J8FA 4Z1DA 3A12A 3KXQA 3VOFA 2GGIA 1JRBA 1V6VA 3GX9A 1EQPA 4WXZA 4ZB0A 4AD5A 5D2YA 2NQZA 4FPSA 3MO4A 4W5ZA 5E1QA 4CQCA 2YA1A 1OD0A 1PIGA 4O8RA 5A8QA 2NQHA 4WK9A 4IHCA 3O6YX 2CZEA 4QG6A 3PJUA 3MJMA 4PZVA 3MCOA 1POKA 3PJTA 4YTRA 4GVGA 2E5BA 3E5PA 4EPKA 1OF6A 5KZDA 2BG5A 1GONA 2Y7DA 3EOOA 4RXFA 2ODOA 4IGNA 4TV6A 3M5YA 3RPTA 1WA3A 5CPTA 5LNUA 5ENLA 3CUGA 3PZNA 1BAGA 1Q7MA 3BV7A 3XINA 1ZBKA 2ZCGA 1W17A 3GHTA 5E9AA 3SEPA 3GB6A 4HK7A 2HNEA 3VGBA 4FF7A 3TW7A 3SCPA 4ZTXA 3IIPA 2PB1A 2VTFA 2IKJA 2CFFA 2WMGA 4DXXA 3PAJA 3P8IA 4DVOA 2PLJA 1D2KA 4XZLX 3ZVHB 1UCWA 3NQ8A 3FJNA 3GS6A 1ITQA 3KWSA 1PV8A 3DC8A 2ZUMA 1WYIA 3SCWA 4JFTA 3TMQA 1A47A 1SUXA 1UJQA 2PC4A 3M9YA 1EHAA 1RAKA 1WPCA 3WDHA 4JOMA 1AW2A 4CEXC 2XH2A 1R2SA 4HNCA 4OU1A 5CCZA 4XWUA 2PCQA 4ASTA 3C2FA 4OUEA 2NSXA 2QCLA 1YQ2A 1I9CB 4NAEB 1OT1A 1Q7QA 4CVUA 3L5LA 4FSAA 5DMNA 3LDVA 1CDGA 4JIPA 1A50A 4RPQA 3DN5A 3TFCA 2G50A 2PD9A 3KCJA 3UNDA 1XIJA 3LY0A 3PZMA 2YXOA 3BJFA 1Z48A 3T09A 1BPLB 2XM2A 1X39A 1RD6A 2PTYA 5LXEA 5T26A 2QF7A 5H91A 4HU3A 2RH9A 1TPDA 3W1RA 3AS1A 4B4HA 3EWYA 3EWXA 2CLOA 2QEZA 3ARWA 4JZ5A 2XFYA 4W4QA 1W5MA 3CJPA 3KTXA 4HQVA 2EG8A 3P82A 3KOWA 1LROA 2Y8KA 2A3CA 1V7AA 1LT8A 4IGHA 4INFA 3KHDA 1HKKA 1Q3NA 4PUWA 1RPXA 3ONCA 1UROA 4DM1A 4LX4A 1J18A 1KO0A 2IXUA 3LGDA 3MA8A 4XX6A 4KRUA 1TA3B 2CHNA 1A5SA 2X2GA 3QBUA 2QULA 2CBUA 1EH9A 1N82A 2I5QA 2DW7A 1G9HA 4P7OA 3NZQA 4Q7BA 4GVIA 4FIQA 1LRQA 4J3XA 3LPPA 2BXYA 3KTCA 4RL3A 1J0JA 2EPMX 4ACYA 4UQ9A 5A1AA 3QC3A 3HMJG 2CWXA 4UWMA 1JF6A 3UR8A 2ZUSA 3FEMA 4FO4A 2HK1A 3W75A 1EDGA 2BHZA 4PCTA 1O5XA 3NQCA 3UG8A 3UCCA 5CZ0A 2C0AA 3DU0A 1BSLA 3EPOA 1IR2A 3E0FA 3CIVA 5DT7A 5AZ0A 4GZEA 2REQA 3LHVA 2Y8VA 3AXXA 3IAQA 4JTQA 5B7ZA 1QHOA 1DJXA 1W3TA 4E8CA 3QSRA 1PTAA 2HZGA 3TYDA 4ZGYA 1EJWC 2VFDA 5LXXA 5M03A 2V69A 1VYPX 3LI0A 3KP1A 1H60A 3W2JA 1BYBA 2Q09A 4GQRA 5A8NA 4IUGA 3F7JA 4XISA 4JQ2A 2OYMA 1BTCA 4NI8A 4PSPA 3LZ5A 4U33A 2G4JA 1GORA 1W1ZA 1ZENA 3UWQA 4P7QA 3SUTA 1AA1B 1T5AA 4M1BA 4YMZA 3B9NA 2EJ1A 2F38A 2V9DA 3M5VA 3A21A 3W1MA 1ZAJA 5CC7A 4LUTA 2R8WA 4I6VA 4EX4A 3H55A 3QR3A 2QCEA 3ITVA 5E0KA 1EIBA 4MFEA 3ARTA 2C16A 1HO4A 1LOSA 2VP8A 2DIKA 4GUJA 3TNOA 3VK5A 1XIHA 2F6KA 2AQVA 4Z2JA 1AMKA 4POCA 5I03A 4Q8QA 2XFFA 5A3HA 3VZXA 5KITA 4E4PA 4HMDA 1OFDA 1TE6A 3HURA 3TDFA 1U5JA 4RNFA 4IG2A 1PTDA 3T4WA 1QO2A 2NT1A 1EC7A 1EUAA 2Y5EA 3VD5A 3BXWA 4V33A 4BWLC 4V15A 1CENA 1X8CA 3UWVA 1SW0A 5BMXA 4L1WA 1U2YA 4DJEA 2XINA 1JNDA 4F48A 4WKFA 4JFWA 4ERGA 1IEVA 1Q5MA 4UMAA 4W5UA 5KZ6A 1V77A 3A4WA 4RKAA 3SI9A 1F3EA 3AYSA 3CHCA 4UNKA 4X63A 4UQDA 1MW0A 1TREA 3BJSA 1ME8A 3GXDA 4UMBA 1K8YA 1RBAA 1XWYA 1JQXA 1K9DA 2DZXA 2GSEA 3COTA 4PBFA 1W6TA 1A49A 4DHGA 3E02A 3OU8A 9XIMA 3A47A 4AQLA 1ODUA 1OYCA 3QRHA 4WOZA 3EKLA 1NOFA 4Q32A 5C0QA 1NIUA 4JKKA 4FNUA 4MLJA 3CPGA 3LBMA 2H8ZA 1XH1A 4HPHA 1MW3A 2CLKA 3S1GA 1C92A 4Z08A 4H00A 2GQ8A 1X96A 4AZCB 1GKRA 2WQPA 4CQDA 1BLIA 1TZ9A 2V63A 3I3BA 3ITYA 3SCVA 3N2OA 3AXMA 3LTPA 5AY7A 3GDTA 2GJPA 1FXPA 4KRTA 4EIVA 2HCVA 4V27A 2IPGA 3WLOA 3VD7A 1PVNA 1CGWA 5EMMA 2Y89A 1KGWA 4UTLA 2FFIA 2BX7A 4IFOA 4KWUA 2TRSA 3CZEA 3ITCA 3MANA 2G5WA 1Z69A 2R24A 3D0CA 3G6LA 2PAJA 3E12A 3SCUA 1W56A 3SQSA 3TYZA 2BOEX 5CGMA 3WK1A 1UIPA 4TTGA 4EK7A 3BOXA 1FFRA 1UA3A 2PFHA 3IIZA 1LLWA 2QJIA 3UY8A 3LQGA 3TP4A 3AZRA 4RW5A 3B9AA 2EPKX 3B4YA 3HPAA 4F0RA 2J4GA 1IIGA 3NM1A 3SGZA 2VWSA 3TR9A 2V3EA 4QHRA 2WYSA 4XV0A 1GYLA 2TMDA 4QNWA 3SM0A 3GDKA 1IWPA 4XZIA 2Z6IA 2VX6A 3ZVIA 1LWHA 3W2LA 1MNSA 1Z32X 3AMKA 3G22A 1QPOA 1XYCA 1HT6A 2PWDA 4R9OA 1GOXA 3VCCA 2I14A 2PP1A 1A5UA 4C6EA 1B5TA 1T8XA 1AZ2A 1TPEA 2YB1A 4DI8A 3O15A 3F4DA 1Y5VA 1V03A 4ZENA 4GPNA 4L65A 4QJ5B 3WLLA 1S5NA 5HNUA 3N9SA 1KD0A 2FB3A 3EDFA 3SRHA 1TJRA 3S0CA 2FZMA 2V5LA 3FHAA 5G1YA 3OQ8A 2VGGA 3ITTA 3WH8A 4AX7A 4YWIA 1KB3A 2WAGA 2WSYA 1H5VA 4XZWA 1W9VA 1FWJC 3NYZA 4A21A 3RJXA 1W9UA 1KQZA 2GVYA 3VIFA 1DQUA 4LU0A 4MLRA 2JE8A 4OV4A 3B4UA 4JL2A 4NZ3A 1IT0A 5AOUA 4E0CA 3H4WA 3GFYA 4LVFA 4CNTA 4YTTA 1QI3A 2CZ5A 1KRAC 4UQAA 2CBJA 3G1HA 5TIMA 4WUIA 5EMYA 1C8YA 1XLJA 3NQGA 3WQDA 1W2VA 1UB3A 4ZOBA 4JTUA 4YCOA 4PTWA 1HUVA 4PMYA 1PWLA 4O11A 1OGGA 3T81A 3KRBA 4TVCA 3T55A 1Q6LA 4OIFA 4B90A 1F07A 2GK1A 3D3FA 3WQGA 3ECQA 1M04A 3VNJA 4KFPA 2YSWA 3CMGA 4D1JA 3H2OA 5C9UA 2A6LA 4F2TA 3FSTA 2R82A 2FJKA 3UESA 3R0UA 2JF7A 4MGGA 5D30A 4BFAA 1E5NA 3GIQA 3IJ6A 1M3UA 1MQPA 1TZZA 4PULA 3C6CA 2FTYA 1JGMA 4H6KA 3W1NA 3OHIA 3PULA 4QSHA 1K03A 3B8WA 3P7YA 1K1DA 2V68A 4JFVA 5AC6A 1XQKA 1RK5A 2GZXA 2WHLA 4ORIA 4HNTA 2IPJA 1A0DA 3UZYA 1XYAA 4S3JA 4Z1AA 5DMLA 3WK0A 1UP0A 4NX0A 4S3KA 1JD7A 1YDNA 1DL3A 3W84A 2WLYA 5M3WA 4MKNA 1DJWA