3EWWA

D312n mutant of human orotidyl-5'-monophosphate decarboxylase in complex with 6-cyano-ump, covalent adduct
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
257
structure length
257
Chain Sequence
b'MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFENRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine-5'-phosphate decarboxylase
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 100
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ewwA00
1O94A 3QSTA 3CIWA 1X7FA 3U6WA 1K7XA 1W0MA 5HWMA 5K2ZA 4MKNA 1B4EA 4GBUA 4QNEA 1R30A 1VYRA 2GUUA 4BI6A 3G0XA 3LB0A 1KFCA 4IJBA 3S1WA 1T99A 3W1UA 1TV8A 3CT7A 1F73A 1AL8A 3PUEA 4DBDA 5DCEA 5DELA 2DORA 3W87A 2Y7DA 3N19B 2TMDA 1EPXA 4JXCA 1VRDA 2XN1A 3EX1A 3PBVA 1GVQA 4X22A 4JNMA 1H5YA 3C6CA 3ATZA 3Q2DA 4I7VA 4DEFA 4K37A 2H3BA 3A24A 4RXFA 5I3IA 2YGYA 4FNRA 4Z0SA 1O4UA 5E0KA 2GOUA 1LLWA 1ADOA 2I14A 4UTIA 1H7XA 5F2IA 2XFWA 1H61A 2EF9A 4EOUA 1L6WA 1D3GA 3HGJA 1QAPA 4O52A 2Z2UA 4BI5A 3USBA 2VEKA 2YFNA 4ZQCA 4K8EA 3KVKA 4UR7A 1B4KA 3L68A 3JS3A 5EMUA 4IMGA 3SFKA 2QEZA 5F2GA 3A22A 2ZZ7A 1ZAHA 3GLCA 4LS0A 3R89A 1SZNA 1LM1A 3SI9A 2ATMA 3GX9A 5F4WA 3P80A 3ZS4A 4AAJA 2V81A 1EUAA 4ALDA 5KZEA 3TSBA 3LV5A 3DAQA 2WSYA 4AWSA 1VYPX 2WO5A 2C0AA 2WJZA 3HPXA 1JCXA 3PAJA 4DO4A 1CW2A 4UCGA 3HG5A 2CZFA 1KV8A 1W5OA 4XKYA 4QAIA 4X3ZA 5KITA 2YR1A 3M41A 2JKEA 2E6AA 1OABA 1TJRA 3UXAA 4JX4A 3GDTA 5HJLA 3W9ZA 2OJPA 4RXGA 5I3JA 4FO4A 3M47A 2V2HA 5FF7A 5DCDA 4NT0A 4N9BA 3L0GA 1KV5A 3NR0A 2BXVA 1EEPA 1OYBA 4TIMA 5AC6A 3PB0A 4WX2A 2D73A 2YPIA 3CWOX 3SJ3A 3NG3A 1JQVA 2FTPA 1FBAA 1HL2A 3CLMA 4AXKA 2A6NA 3OBKA 1KFLA 4OBTA 5G5IA 1OVDA 3KAOA 2DZPA 5D2VA 2ZRZA 1H51A 1H7NA 4Z1CA 4N6EA 1LCOA 5G2IA 5F1UA 4HNNA 5SWUA 4L4MA 1H60A 4JDYA 3DGRA 3W1XA 1JCYA 1MO0A 2GJNA 1DORA 2ZRYA 2X2GA 5F2MA 1P0NA 4FX7A 1KTCA 1OX4B 3FA5A 5D38A 3W2NA 1PIIA 4NQ1A 2EKCA 4LV4A 2V9DA 2QF7A 4DO5A 4JX6A 4JX5A 1JR1A 3W74A 4ZQNA 1VZWA 3NL3A 4PL1A 5U7SA 4TMCA 5G1TA 2YCEA 5G1YA 4C1LA 1GYLA 3W72A 2G5WA 1OK6A 1SPQA 4HSNA 4XBKA 1X6UA 1GG0A 2OT1A 2EGZA 4HSOA 4DXVA 4AH7A 3GAYA 1U83A 3W22A 1LRNA 1AW2A 1FWNA 5CSSA 4JS3A 3EXRA 1XDMA 3TH6A 3W7OA 3R13A 3Q58A 2DP3A 4DELA 1TTPA 1AG1O 1JUEA 8TIMA 3JRKA 4ZQOA 1H7PA 1JULA 1JCMP 5CSRA 4K39A 4UUIA 3TQVA 3DFSA 3DZ1A 1QDSA 3SECA 3P82A 3LI1A 1IIGA 4FXSA 5DN1A 1WAUA 3TAOA 3EWWA 4QNWA 1OFPA 3TU9A 3HPSA 1TPWA 4Y90A 4ICNA 3C2VA 5BMXA 1EP3A 2QR6A 1Q3NA 2WNQA 3A21A 4IPJA 2RH9A 3MW7A 3W7DA 3R5EA 1W5PA 4GWEA 3DI1A 1TPFA 3NQFA 3QM3A 4BK9A 3BG5A 4QITA 5DBTA 4JYEA 4LNYA 1X8FA 1K8XA 4I7UA 4N2YA 3G1SA 1YTDA 4MY8A 5EY5A 4IMDA 1FWWA 3MHFA 2G96A 2NUXA 3B0PA 4AF0A 4NJIA 5AHIA 2YXGA 1B57A 1ZCOA 4CLMA 4POCA 3EB2A 1HO4A 1MEWA 2FQIA 1W5QA 5AYZA 3NM3A 3BV4A 1QPRA 1ZAIA 4Q32A 2R8WA 3LOTA 1G67A 1WX0A 2Z6JA 1WV2A 5K3VA 1PVNA 3PBUA 1ZY9A 2OX1A 3KFTA 5BMWA 3IIVA 1H63A 4OU1A 2RDWA 3OEXA 1RQBA 1JUBA 1OYCA 2QCDB 3NZRA 2ZA2A 1SW7A 1GJPA 4ZL1A 4YMZA 3S1UA 1YPIA 3G18A 4O0ZA 1OJXA 4K38A 1I2RA 5FF4A 4NJKA 5D33A 3GDRA 4ZMGA 1KFJA 1MXSA 4NNCA 4O8RA 1OFOA 1YLVA 2DZXA 1TYGA 2BLEA 2QUUA 2TPSA 3SIZA 3HGRA 1H7RA 4WUIA 3S5OA 1A5CA 3I65A 3EXTA 4DPQA 2E1DA 4O50A 1TO3A 3NPUA 2ZZ6A 5ABTA 2A5HA 2E6DA 2HMCA 2Q8ZA 3ATYA 3LCXA 1T8XA 1Z41A 4JTFA 3TUUA 4EF8A 2H3DA 4GFSA 2DU2A 5AC8A 3S1XA 3TROA 5DXXA 2ZRWA 1FCUA 1I45A 3W7KA 1JCJA 1GTHA 4X2RA 3HG3A 3NQEA 1W56A 3GK0A 1SZEA 3KRZA 1V7YA 2YW4A 3Q94A 4NZJA 5F2LA 1NFBA 4JICA 3UPWA 3KOFA 4NNBA 3BLFA 3EX4A 1RD5A 1EP2A 1R2TA 4AVFA 4LC8A 1RR2A 3ABSA 4CQ9A 3WJZA 2BWGA 3W1RA 4GC4A 2Z0IA 3VNDA 5DXYA 1QR7A 3KVLA 1LZOA 3K30A 3NL5A 2PRHA 1FXQA 1J4EA 3NZ1A 4EIVA 5A5WA 4JTEA 3PSVA 3QZEA 3T78A 2I9EA 3MHUA 3UQNA 4O1AA 4MZ8A 3VFLA 3M9YA 4AWTA 1NVMA 1SO4A 2CLEA 4XUGA 2O7QA 2VKZG 3CQ0A 3BLEA 3E12A 2CWNA 1KM6A 1Q45A 1QNVA 3FKKA 1FCVA 3O06A 2QCGA 4I7WA 1NF0A 5CZJA 3SR7A 3QF0A 5CZTA 3CB8A 2YZRA 3TK7A 1O95A 1H1YA 4LVAA 1LRTA 2JKPA 5AHEA 3MP4A 3P7YA 4JTSA 4LRTA 3T40A 4ZQPA 5D03A 1TPEA 2GQ8A 2NUWA 1Z44A 2WSRA 4UTKA 3GDKA 4Z0JA 2GVLA 3GIYA 2B0MA 4FXRA 3S1VA 4WQ6A 2RHGA 4UTLA 2B4GA 3LHWA 3TJXA 3EWYA 1NF7A 5C6MA 4H3DA 1SFJA 3I7SA 1N8FA 1L9WA 1EA0A 4HNTA 1XDLA 2DJXA 1XXXA 2E68A 3GVGA 3IIXA 1LBFA 3A23A 1X1ZA 3QEZA 3LGEA 2JK2A 5AHNA 3FYPA 2GPTA 3N3MA 1G4EA 1X1OA 3I7RA 3LHYA 3LLDA 3W7JA 1ME9A 5D2TA 2NX1A 3O1NA 3LBMA 4FIRA 2ZA1A 4O11A 4JTGA 4JTJA 5CPMA 1KW1A 3DXIA 3O6DA 5K9XA 3M6YA 3E0IA 2Q3RA 5BRBA 2CFFA 5HQEA 1IXOA 2VFGA 4XTDA 4KFOA 5DY2A 3M16A 5FEWA 1VCGA 1VLWA 4RZ4A 1O60A 5DLCA 5AYXA 3R8RA 3CM4A 4UTHA 3UWQA 1F6PA 5KMYA 4TR9A 5CZSA 3HG4A 3PR2A 1P5BA 4IMCA 3MUXA 2ZZ2A 5LNWA 5FESA 4IXHA 4ZQMA 3ELFA 2Y85A 3LRLA 3S5YA 3GDLA 5AFDA 3QJAA 3QPYA 4LVDA 4WD0A 4RV8A 1FWTA 1IXPA 1R2SA 1DVJA 3HBLA 5J5RA 2C6QA 4NX0A 3O6YX 1ICPA 1FXPA 2CZ5A 4FB7A 1UB3A 3CU2A 5LNRA 4O4WA 3TSMA 5EPDA 3W7RA 4MOZA 4N4QA 1I8JA 4XWUA 1Q6QA 1XL9A 3E02A 4ADSA 4OV4A 3G1HA 2NZLA 2HS6A 2PURA 3BW4A 3PG8A 3PWAA 3O05A 1SW0A 4AHOA 1TRDA 3OVQA 3MYOA 4UFHA 4KFNA 3NPWA 4TMBA 5CPLA 4UFLA 5CKSA 2VELA 3A9IA 2WPBA 2ZTJA 3PVFA 4OV9A 3NYZA 1ZFJA 1TRIA 4XTIA 2NV2A 1TV7A 1O5KA 3N34A 3QRHA 3G1YA 5DBUA 4GUIA 2TSYA 1T0OA 3LXCA 2QCLA 2QAPA 5LNVA 4JYFA 3L0KA 3FIGA 3QC3A 4IOTA 5HR7A 1OYAA 2QCNA 2OCZA 3UWUA 3I6RA 1GZGA 3LBCA 1PCWA 1GG1A 4AMAA 3L65A 3LCLA 5AHLA 5A8GA 3W1QA 4OE7A 3CPRA 1VJIA 1NEYA 3TE9A 4UTJA 3G22A 4HNUA 3F1QA 3BARA 3IIOA 3C2EA 4JIPA 4TX9A 3W2UA 4WZHA 3TFXA 3N9SA 3W7GA 4AF0B 4DF1A 5GVJA 2X1UA 3LXBA 1QMLA 4MFDA 4O13A 3EKLA 2R94A 3DFPA 5AB3A 4GJ1A 4JR5A 4K6AA 3PBWA 3L67A 3O63A 3STEA 3N14A 1UUMA 3JR2A 1VPXA 1WQ5A 2VEPA 4NJGA 3ANYA 1KBIA 3FFSA 4OT7A 4RK8A 3L2IA 2YYUA 2A21A 3UWVA 3C2OA 4NXSA 3TW7A 3BLIA 2V8ZA 4UC5A 2Y63A 4O0KA 1F5ZA 2G95A 2NLIA 2KZHA 1FQ0A 1QOQA 3H55A 5FI8A 3M43A 3DHFA 5HUOA 2FJKA 4LW7A 4CNPA 4N9EA 1KFKA 3NO5A 3AO0A 4N02A 4M6QA 3FJLA 2PRMA 3NQGA 2G97A 3BW2A 4YCOA 2V2CA 4O54A 1DHPA 2QCFA 1XCFA 3T7VA 5LHFA 1W3IA 1BKSA 4UFIA 4K36A 1LLZA 1AW5A 3NDOA 1DBTA 3ZFHA 1RVGA 5IBXC 4O1CA 1QO5A 3R2GA 4OWGA 1VHCA 3G3MA 2W79A 4FNQA 5F4SA 1KM2A 5HULA 4CCCA 1QPOA 4WY0A 3MO7A 1ICSA 3W2MA 3W07A 4TU1A 1W31A 4RZ6A 2E5DA 4JTTA 4UR8A 4K8HA 3NNTA 2BSLA 1Z48A 2ZA3A 3IEBA 4M7TA 1WYIA 1W3TA 1ZNNA 1DOSA 3DFTA 3MP5A 2CLKA 1D3HA 1AMKA 1CI1A 4YXGA 2QJGA 3BW3A 3LHZA 3UWYA 3OG3A 3PF3A 1XBXA 4LC6A 5CGQA 3B06A 2CU0A 3LCGA 4NU7A 2YX0A 4IMFA 3W7HA 1LOLA 3LTPA 3UXDA 4I9AA 3LCIA 4MJMA 5FF3A 3RU6A 4O28A 1E51A 2NV1A 2ZRVA 2ZZ3A 1THFD 4JD4A 4IQLA 3ABOA 3PS7A 4O1DA 5G4WA 1RV8A 1DJNA 5G4EA 4OGZA 4RKAA 1I4NA 7TIMA 1LYXA 1SZGA 2A0NA 4JTHA 1OF8A 3VE7A 5EKYA 3QMRA 1QPNA 3GXTA 4G1KA 4AWUA 1AL7A 2F84A 1W5NA 4S2CA 1S5WA 3C52A 1I2QA 3MI3A 3L0NA 4MFEA 5I3FA 4YL2A 3N9RA 1IIHA 2CLLA 3ABRA 1W1ZA 4ZZ9A 4MVAA 3TR2A 5C54A 4O15A 4ORIA 2HS8A 4MZYA 1ZENA 4CNNA 4EVZA 2X1RA 4ML9A 2C14A 4HHPA 1JQXA 4FHAA 3PULA 4JTUA 1OX5A 4YLWA 3KHJA 1TV5A 3P5ZA 3DI0A 1WDWA 2PCQA 1XI3A 3N2XA 1WBJA 1ME8A 4R53A 1TCDA 1P4CA 2ABAA 3Q37A 5EYWA 1OG0A 4KKXA 2DZSA 3KXQA 1KLZA 3S6DA 4WXYA 3TFCA 1O5XA 3V75A 4CNOA 2ZZ4A 4BF9A 1MEHA 2NUYA 4LY8A 4UTTC 2PE4A 3UWZA 2LLEA 3W7NA 5L9FA 3RMJA 4LTSA 3RK8A 5K9DA 5C5YA 4DPPA 1S5VA 2FLIA 3W1NA 2QCCA 1YDNA 1LTDA 3L5AA 3HOJA 3N73A 3P67A 1YXCA 1DKWA 4ONVA 3HJZA 3RNDA 1YADA 1Z42A 3W1PA 4AB4A 2ZYFA 3WJYA 5HNRA 5BNKA 1TPB1 4RZ5A 5G2HA 4M5PA 3PB2A 3WFAA 4NVTA 1M6JA 1L2UA 5LHEA 4WOQA 2BZNA 3EXSA 1NSJA 2BX7A 4A3UA 1LROA 4PA8A 2E09A 3NQAA 1WOAA 1F2JA 1ME7A 1ONRA 1H7WA 4HPJA 4QJ1A 4OQVA 3TC6A 2EPHA 1HTIA 4M19A 2C1HA 2J9ZA 1FX6A 3KRSA 3TC7A 4PEKA 4TO8A 1DQXA 1YTKA 4NXKA 1K8YA 3CC1A 4KFPA 3EX2A 3KVJA 4ORMA 1JCLA 3EWZA 5HWJA 3IVUA 3GNDA 4WXZA 5AYYA 5K4XA 2Y88A 3LM7A 3HGOA 4LS1A 1YXYA 2Y6ZA 2Y7EA 1K3UA 1J2WA 4N9CA 1EWDA 3TQ0A 3B8DA 3LRKA 4PFMA 1MEIA 1PV8A 4O19A 3PC0A 2TRSA 3TW6A 3L5LA 3H54A 3UNDA 3QW3A 2DZWA 2ZRUA 4UNKA 1K02A 2UV8G 5FF2A 4BI7A 3UWWA 1EP1A 1L6YA 1PE1A 3PM6A 4UIOA 1CX9A 3W85A 3DU0A 3W71A 3QPZA 4E0CA 2W0UA 4JIQA 2VFEA 4MZ1A 1HO1A 1OFBA 1KLYA 1BTMA 2C16A 2B7NA 3MHGA 6ALDA 4IUOA 4ADTA 1JJKA 3NQ2A 4GUJA 3I7QA 3HB9A 2V0TA 1G7VA 3TKFA 1F76A 4MIMA 1NAL1 2RFGA 3VI2A 4GUGA 2TYSA 5IBXA 1PHWA 2A4AA 1R2RA 1BWKA 1JUKA 4UFJA 3DKLA 4BFAA 1VCFA 4QIUA 5C55A 1OFAA 4MJZA 4NJHA 4PCFA 5U4NA 2C19A 4LWWA 3TA6A 1GVFA 4FF7A 3W76A 1JRBA 1PCKA 1WXJA 3CTLA 1VYSX 4X9SA 4PC8A 1K03A 1EUNA 4LVGA 3UZJA 2C13A 2CZDA 3CIXA 3M5ZA 4MYAA 5F1VA 1OX4A 4UTMA 3TXZA 3DENA 3C8FA 1TREA 1KTBA 3M7WA 4MLRA 2NXIA 2H90A 4M6PA 3G24A 3S5NA 1Y0EA 2YYTA 4N6FA 5FF0A 2BTMA 4Q33A 2GQAA 4PL2A 1GWJA 5KTLA 4LT9A 2ZQ0A 1DQWA 2RKXA 3THQA 3SSJA 2OT0A 1LOSA 4DF2A 3M5VA 1OF6A 4HT3A 4BWLC 2F7FA 3UY7A 3FS2A 1LOQA 4DO6A 2PC4A 3QMSA 4GUFA 3HF3A 3LCHA 5TQLA 3L21A 4H6KA 3TMQA 2FPTA 1W3NA 2FFCA 2QUTA 5K7JA 3DFNA 4AHQA 4PODA 1FCBA 1ZAJA 3TV8A 3MP3A 2Q8LA 1ZALA 4O53A 5CG7A 5H2ZA 2QJHA 4MY1A 2H6RA 3O16A 1G69A 5D2WA 4UTUA 3G0SA 2J88A 1SUXA 1MSSA 2X1SA 2JGQA 3W1MA 2AGKA 4XKYB 1XM3A 2NX9A 2YFOA 1DJQA 1SW3A 1TPUA 3L66A 3MMTA 2Z1BA 3IVTA 2X30A 4O12A 1Q6OA 4QSHA 5I3KA 4Q4KA 4O1BA 3GR7A 5TIMA 3TX9A 4E38A 1KM1A 4NJJA 2C15A 4Y8FA 4NNAA 4E2DA 3W7CA 2QUVA 4ZVJA 5KSWA 3C3NA 4Z1DA 4O4VA 3FOKA 5HR6A 2QCMA 4WJEA 1W54A 3BVJA 2OMAA 3IGXA 2WSQA 2V5LA 3GYEA 3UZ5A 2Y62A 5L6UA 5KINA 5BOOA 3ABQA 3QMTA 4JEQA 2GJLA 3L5MA 3WK2A 3IGUA 4UTTA 3WK1A 1UCWA 1SSDA 1SSGA 1OFDA 1ALDA 2WNNA 3E9AA 4FNSA 3OA3A 1WA3A 2VEIA 2W6RA 2ZRXA 3NXFA 1G7UA 3QQ1A 2Y7FA 1H50A 3EWBX 4W9TA 2CLIA 2FDSA 4GXMA 1GPWA 4UXDA 2ALDA 4UMBA 2ZFAA 5I3GA 3WK3A 1F05A 4HKPA 1TPC1 3P61A 4JN6A 2FB3A 4MPQA 4JDBA 2C3ZA 3NQ8A 1I2PA 2CLMA 2A7RA 1UASA 4IWWA 5LKYA 1XUUA 1N55A 3DKJA 3W23A 4O16A 3T44A 4P61A 4ZQRA 3GKFA 1G4PA 5E93A 3G1XA 3F4NA 1AW1A 2X1TA 1KFEA 1JCNA 4HPXA 1TTQA 3NGJA 2AAMA 4LS2A 3NQCA 4PH6A 5EL1A 5D05A 3B04A 2VXNA 3W2JA 5AN7A 1YPFA 5C2XA 1G4SA 2O7SA 3TCEA 1YDVA 4MLJA 1KM5A 1VR6A 1B9BA 4R7JA 1F7BA 1FDJA 4N4PA 3LLFA 1EIXA 3SGZA 3WJSA 3TJLA 3LI0A 3GZ3A 3B0UX 1TJPA 3S5ZA 3W7IA 2VFDA 2FIQA 4O10A 2IQTA 2B7PA 3PY2A 4JTLA 1G4TA 1LRQA 3BGGA 3N2MA 3TMLA 1SO5A 2Y89A 1TPDA 5KZMA 4QQ3A 3LCFA 3O6CA 3ZR4A 5HWNA 3EX3A 3TSDA 3QSRA 3O15A 2Y70A 3VCRA 1LBMA 2A7PA 1GT8A 1RQHA 3UYCA 4N9DA 1C8VA 1UBSA 3RFAA 3THAA 3TDFA 1OK4A 4UTWC 3C2RA 4S1FA 2QDGA 5LNSA 2A6LA 1A53A 1VC4A 1GOXA 4D2JA 4XQ6A 4Z08A 5BW6A 4Z1AA 5D2XA 3PSWA 5K4ZA 3E96A 5H91A 1PHQA 3W6YA 1YDOA 3MI2A 3TQKA 2CLOA 2RDUA 4FNTA 4B5NA 3MWAA 3W70A 4GE8A 1S3HA 1H1ZA 3LHUA 1GQNA 2C18A 1KM3A 3QFEA 1SO3A 1FWRA 1U5JA 1FY6A 2GVGA 4OHQA 5G2WA 2J6XA 1XFBA 2FB2A 3A5FA 3I68A 4IGHA 4NZFA 3C4UA 2ZTKA 3BK0A 3BO9A 1P0KA 1ICQA 2PRLA 1GVSA 3IVSA 2R14A 3PG9A 3KVMA 3G8RA 4BWLA 3W86A 4IX0A 3NVTA 2B7OA 1HFBA 3M1ZA 3GR8A 3R12A 4H4IA 3EKZA 1IF2A 4DBEA 4RX0A 1F74A 3QQ0A 4MY9A 2VFHA 3LRMA 3PBYA 3W75A 3NOEA 2J24A 2E5BA 3PUOA 2NWSA 4K7YA 4LU0A 2R91A 4MUZA 4XBSA 4A22A 1PS9A 3H53A 3RLUA 1YYAA 4A2SA 1OFQA 2JBMA 2QCEA 3NQ7A 1TTIA 2HSAA 3M44A 3KX6A 1N7KA 2WOQA 1H7OA 1W5MA 3NM1A 4JYDA 3DHDA 3HMJG 2DZUA 1K7EA 1ZHAA 1ZJIA 1VGAA 3LHTA 3CEPA 3P81A 3G1AA 3P84A 5AHMA 4DF0A 4IXXA 3KRUA 1KBJA 1R47A 2NX3A 4FNUA 1QFEA 3P74A 1SO6A 3TXVA 1SQ7A 1R46A 4BR1A 3RLVA 3M0ZA 3W7PA 3WJWA 1BWLA 3OHIA 4JTIA 3WJXA 2GVJA 2DZVA 1ML1A 3MYPA 2CW6A 3LV6A 3NPXA 2WNZA 5K9CA 3HG2A 3NAVA 4JY9A 1MZHA 1QO2A 4PTNA 5FEPA 5AOUA 1PL9A 5HMSA 4QISA 1UJPA 1XBYA 1B3OA 4R34A 5CPNA 2DZTA 4WY0F 3DH7A 3UY8A 4RR4A 4KWWA 5CZ0A 3P60A 3W2LA 3STFA 1LBLA 3HPZA 1VLIA 3STCA 4NUWA 1M5WA 1OHLA 3V1PA 4A29A 3LDVA 4GNJA 3P62A 1KM4A 3CEUA 1LDCA 2J9YA 3HO8A 2GQ9A 3LX9A 3W83A 3W7QA 3IGSA 5DCBA 4Y6GA 1C29A 4UMAA 1QOPA 3DFOA 4O18A 1TIMA 5D32A 3SZ8A 2XN2A 4LRSA 5LGXA 5D2YA 4C1KA 3HGSA 1FUYA 2VFIA 4HN4A 4UNLA 2ZZ1A 4J9JA 2ISVA 3FJ6A 3G0UA 1KM0A 3AJXA 4EWND 3S0CA 1SZFA 3W73A 2YW3A 3QW4B 1C9DA 4E2BA 3C56A 1OX6A 2EAWA 3C61A 3NL6A 1OFEA 5E1QA 4P2VA 4O17A 1LP6A 4YCPA 1WOBA 3VE9A 3MJYA 5DY3A 1RPXA 1XBZA 1GYNA 1SU5A 3IIPA 1I2NA 3GB6A 3BPWA 2WV8A 3FKRA 3BG3A 2A2IA 3CHVA 2P0OA 2VEMA 2QJIA 5F4XA 3GDMA 1A50A 5LGZA 5D04C 5I3HA 2E5CA 2V82A 4LUJA 4HIBA 4GRSA 1YXDA 4FEZA 4FX8A 3F4WA 2NXGA 3MI6A 3LERA 4AHPA 1H62A 3WK0A 1IGSA 2CLFA 3OVPA 1JVNA 4CQAA 2HTMA 3W84A 5LNUA 1K7FA 3RF9A 3G3DA 2OZ0A 3NL2A 2YDAA 1G6CA 3GNNA 4U28A 2J27A 4AEOA 4FX6M 2I1OA 3DFQA 3C2FA 4UTWA 1XC4A 3HIJA 2FPVA 3GXNA 1EX5A 2EHHA 3FEMA 2Y61A 2NXHA 1TTJA 1QCWA 1DV7A 4JGDA 3NA8A 3HQ1A 3W2KA 2E6FA 1QWGA 1YTEA 1GVRA 2V5BA 2ZDRA 3OVRA 2VFFA 3LTSA 3NQDA 1GTEA 1W8SA 4IMEA 5D09A 5FEXA 4MYXA 1A5SA 3G1VA 4CCEA 3W88A 1M7PA 1XUZA 3M5XA 5AC7A 5J5DA 3DBPA 3QH2A 3G1FA 2A1YA 1SR9A 1UUOA 4NX5A 4FNPA 4IPIA 1TSIA 2B7QA 3FYOA 4KWVA 3O8AA 1A5BA 3NQMA 3EWXA 2ZBTA 3S8HA 3VKJA 2E77A 3D0CA 5D30A 1RZMA 3W3OA 3TIMA 3UD6A 2CLHA 4RLIA 3CWNA 2P1FA 3T55A 3GKAA 3NPVA 1EB3A 3U8GA 3ZWTA 1TPVA 2Y7GA 3C0JA 3QYQA 3W1TA 2E6YA 1GEQA 1T96A 5D02A 4UFMA 4LOCA 1FCQA 1TQJA 2VC6A 4CQ8A 3BG9A 3NQVA 1IXNA 3MBFA 5LSMA 2WKJA 3P8IA 3F03K 1J5TA 4Y9AA 4U4MA 2CZEA 3G1DA 3L9CA 2FPYA 1KTNA 3LCWA 4UFKA 1JRCA 4RJEA 3W1LA 1WBHA 3B03A 4RCXA 3W7EA 5MHBA 4GUHA 2ZCGA 3OIXA 3MBDA 1F6KA 1TB3A 3BGJA 1HUVA 2NWRA 3E49A 2V2DA 4ADUA 3TAKA 5IM51 3G8EA 3SW6A 3W1AA 4JY8A 4QM1A 3GAKA 6TIMA 3LXAA 2A85A 3ZWSA 1EWEA 4XZ9A 4A21A 2ZZ5A 4M6VA 1SFLA 4LVBA 3IRDA 5KZDA 2DJLA 3LHVA 3M5YA 4Z1BA 3IIZA 1FDZA 2P10A 3GXPA 2Q3OA 1W37A 1TPH1 3B05A 1AK5A 3W7MA 4WY0B 2ATSA 3SY5A 3S42A 3U2OA 1K8ZA 2ISSA 3P8JA 3SGUA 3T4CA 1TQXA 3A5VA 2QAFA 3EWUA 5AHFA 4M7SA 1I2OA 2ISWA 1A5AA 1L6SA 1TMHA 1V5XA 5EA9A 2YSWA 2A7NA 4Y96A 3UPBA 4YWIA 2VOMA 4CCDA 2ABBA 3P5YA 5EBUA 2X16A 5TBOA 3TNOA 4IX2A 4K7VA 1KA9F 4DQWA 4A2RA 5HINA 4EF9A 3NQ6A 3EX6A 4FIQA 5HUPA 1S5TA 5LZLA 1M7OA 1P1XA 4O14A 5D37A 2RDTA 2Z6IA 1XBVA 4R33A 4HNVA 1OFRA 2V30A 1HG3A 3PUDA 1FWSA 1VH7A 1QPQA 2QKFA 2J9XA 4L4LA 3IV3A 2QCDA 1DL3A 2VENA 3B4UA 1IXQA 3S9YA 1D9EA 1VHNA 3O07A 1Q6LA 1BEUA 2JKAA 4O57A 1VS1A 5FEZA 3LTYA 2XN0A 3STGA 1Q6RA 3FLUA 3EEGA 1RQEA 3NEVA 4WOZA 1LORA 4JTKA 5T26A 4LVFA 2JGYA 3INPA 4UMCA 2WQPA 3B0VC 2H8XA 1XKYA 1GVOA 2QDHA 3YPIA 2AQWA 1VCVA 5CPOA 4LV9A 2H8ZA 3W7LA 4S2BA 2QCHA 1KFBA 4LUIA 1VQTA 1FDYA
chains in the Genus database with same CATH superfamily
1O94A 3AI0A 4IF2A 3R7MA 1SJAA 4NG3A 1X7FA 3U6WA 4I8YA 1R30A 4GOAA 4BI6A 3UT0A 3CV7A 3C2YA 5CBJA 1QPKA 3CT7A 3GD6A 1ZBCA 1TG7A 1KRBC 1OB0A 3RR1A 1PKNA 1WKYA 5FSDC 5DELA 3IJDA 3CQKA 5IFPA 3H2NA 4PMQA 2ZVRA 3H2OA 1P6WA 2PODA 3C6CA 2FGLA 2WZHA 5JXQA 2WCGA 1JPKA 4Z0SA 4CD6A 1H3GA 3OLIA 1LLWA 4PR4A 4MWAE 1S46A 1ADOA 1ENUA 2EF9A 1MUMA 3ZMRA 1Z3NA 3PTDA 4QJ5B 1QAPA 2ZWZA 3GTFA 4Q8OA 4C90A 3JS3A 1ZS2A 3AISA 2QEZA 3A22A 2ZZ7A 1RUSA 2D69A 1LM1A 3SI9A 3GX9A 1XISA 2KX9A 3MPGA 2W67A 1UH4A 2INZA 4LBUA 4AAJA 4HPNA 3NSNA 4ALDA 5KZEA 2XGZA 2Y2WA 6ENLA 3H2MA 1ZPTA 2FJUB 4A6GA 2ZOXA 4E6MA 4IIEA 3NQBA 5A3HA 2VNCA 2C0AA 5CCZA 2AMGA 4IL2A 3VNJA 3UYIA 3TCSA 3GW0A 2GGHA 3S5SA 3A64A 1W5OA 4S3JA 4B4FA 4S3GA 1PIGA 2Y0FA 1PYFA 2JKEA 2E6AA 3UXAA 4JX4A 2XIOA 4ASTA 2J8GA 4RPPA 1ITCA 2BNJA 4RXGA 4FO4A 3GTHA 3M47A 4Q4SA 2E8ZA 1R85A 1UW9A 4WX2A 2D73A 1W1B1 1GONA 4HGXA 3RM4A 4B90A 1AH3A 1FBAA 1HL2A 3CLMA 3RGTA 3U7BA 3KTXA 3EWCA 2DH3A 2Z4GA 4HNNA 4PZVA 3ORWA 1BFNA 2WM1A 1GYMA 1JCYA 1MO0A 5DT7A 1DORA 5F2MA 2BGSA 4HA0A 1Q6FA 5E5CA 4JX6A 3W74A 3NL3A 4C6LA 2D2HA 3LK6A 1HKIA 3VD9A 1R3SA 3T4WA 3W29A 5G1YA 3L23A 4C1LA 2G5WA 2BHUA 2GJPA 1BD0A 4PFHA 4XBKA 1TZ7A 5JUVA 4KETA 4RDWA 4GYPA 2EGZA 1MYRA 4ZOCA 4DXVA 4AH7A 3RRXA 5BYWA 4DWSB 5EB8A 4IUGA 1W1IE 3EXRA 3T0TA 3WQFA 3E0FA 4W93A 1TTPA 2YCLA 1BWVA 4TQTA 1EXBA 2D2OA 1H7PA 1JCMP 3LG3A 4WDWA 2IXVA 1QDSA 1V8EA 3P82A 1A5KC 2G37A 3ITTA 1IIGA 1Q6DA 2WMIA 3AAMA 3TAOA 3EWWA 1QK0A 3MKVA 3MVIA 3TU9A 4FLOA 3L12A 4PUDA 4Y90A 3VMPA 3D5HA 4PCPA 1KXVA 2XISA 5H8UA 3AIBA 5LXXA 3MW7A 5HQMA 3H22A 5CLWA 1W5PA 4GWEA 3ARYA 3NQFA 3QM3A 3CYJA 4PTVA 4I7UA 3STPA 4N2YA 3G1SA 2REQA 5EY5A 1A80A 4IMDA 3MHFA 4GQQA 3BAKA 4L6OA 4NJIA 3KZPA 4HPHA 1SMAA 2NQ5A 1MRQA 1HO4A 4HMNA 4PMDA 1ZAIA 3LOTA 1WV2A 3CAVA 1PVNA 2QIWA 1M03A 3USZA 1P6CA 2OX1A 3RM8A 1P7TA 1IWPA 3OEXA 4B5VA 1RQBA 1PXGA 1XICA 4XZHA 3XISA 5I0DA 2JQXA 2QCDB 3WMBA 1X98A 4AZBA 1EF2A 1GJPA 3N2TA 1QI3A 3WF1A 3DHPA 4YMZA 1CLKA 1YPIA 3IJ9A 3G18A 2YB4A 1I2RA 1XLJA 4ZB0A 4PE8A 1NFGA 1RVKA 4M29A 3TYAA 5FF4A 4NJKA 1TJ1A 2MUCA 3VMOA 1UD2A 4IMAA 1KFJA 1NARA 1YLVA 1MQQA 4UTFA 1AZ2A 1TFVA 3KTSA 4NAEA 4GVGA 2TPSA 1XW8A 4GD0A 1H7RA 1E0XA 1R6WA 4DAIA 3ZT7A 5CJNA 4DPQA 4NY2A 2GK1A 2VZTA 4WGXA 4PMZA 2HMCA 2ONEA 1V3KA 2TAAA 4HTBA 4PTMA 4P7OA 1I75A 2DU2A 3M0KA 3RHGA 3E5PA 3TROA 1FCUA 4GIRA 1ZJAA 4F4RA 1GTHA 4X2RA 1R7AA 3POCA 1EXPA 3H2CA 5F2LA 1NFBA 4JICA 3KOFA 2J4GA 3EX4A 1TX2A 2WHJA 4AVFA 3OQEA 3DUGA 1TZ9A 3K4DA 1W3KA 5DXYA 3KVLA 2H9AB 1ADSA 1LZOA 1Z32X 3P6LA 5FOOA 3FGCB 4F0LA 2NLYA 4EIVA 4E3TA 3QZEA 3UQNA 1ZBKA 3TNBA 4AWTA 3R25A 1NVMA 1E0WA 3CQJA 1L6FA 4XAFA 3AUJA 2PDIA 3LYEA 4XUGA 1EL3A 2JF6A 2DGAA 3E12A 1RHCA 1Q45A 3FKKA 1FCVA 2R24A 4I7WA 3CAWA 3QF0A 3TK7A 1JNDA 3N15A 1PWMA 2DUAA 4JTSA 3T40A 3TYBA 3GXIA 4UBPC 1Z44A 2WSRA 4UTKA 4QG9A 5D9OA 3GIYA 3CYVA 1W9VA 1NM9A 4WQ6A 3U2ZA 1V3JA 3W01A 2PLJA 4UTLA 2RUSA 1Q66A 4FOKA 3TJXA 1PSCA 3EWYA 1US0A 1XRFA 5GJPA 3A3XA 4H3DA 2BS9A 3N2BA 2QJNA 1WXZA 1XDLA 4LEQA 1KR1A 3CMGA 3H2EA 5ABGA 3IIXA 3A23A 3QEZA 2VC9A 4I6KA 4LAMA 3N3MA 1G4EA 3N12A 3SCSA 3NTYA 1B3XA 1E6NA 2VRQA 3WNKA 3AHVA 5G4HC 2BASA 2NX1A 3BSMA 3UZZA 3EDDA 4J3SA 5CPMA 5LIYX 3REQB 5LIKX 5BRBA 4JHZA 1IXOA 5TD4A 4KFOA 4MPKA 1XIEA 3MO4A 5FEWA 1VCGA 4RZ4A 4UTHA 5CZSA 3PR2A 1P5BA 3N04A 3GFZA 1W1VA 3ELFA 3S5YA 2AQVA 3QJAA 2FZNA 1VFLA 2EPMX 3QPYA 2AQOA 4WD0A 1UKOA 1D7FA 4RV8A 3AFBA 2DQWA 3KM8A 1DVJA 3O6YX 2NVCA 5A6JA 2NSXA 5IFTA 3TSMA 4QDMA 3I6EA 2VYOA 3M64A 4PBGA 1I8JA 4CN4A 3WLRA 4CKQA 5EU9A 5I7GA 1KBKA 1LT8A 4R9XA 3O05A 1HZYA 2J7FA 4AUBA 4Q4QA 3OA5A 3MYOA 1GQJA 3OYXA 4KFNA 3GBEA 3ZVIA 1QU4A 2VELA 1VFSA 1XKJA 3A9IA 1EJWC 2VI0A 3V3WA 4C6MA 2BHZA 4OV9A 3CUZA 3NYZA 1ZFJA 1TRIA 3WBAA 1E3XA 3KOZA 5CGMA 3QRHA 4QGCA 3VC6A 3G1YA 4GUIA 4TUFA 3A47A 2TSYA 1T0OA 1DHKA 2QAPA 3T2PA 3MMDA 4JYFA 1AZ1A 1FHLA 3UWUA 4KRZA 2OQHA 1B31A 2ICSA 4AMAA 3LCLA 2GJXA 4QG8A 4ML4A 5A8GA 2WMGA 2W62A 3CPRA 1RK6A 2VVSA 3AIQA 3KL3A 3M4HA 6REQA 3G22A 4HNUA 5E0CA 3BARA 3N9SA 3W7GA 3AIUA 1V51A 4RDVA 2E0PA 2W9MA 3DN5A 1UA3A 4JEJA 1V93A 1HJUA 4GJ1A 3BLKA 3PBWA 1XYMA 1QATA 3STEA 3JR2A 3MY9A 3ANYA 2P0IA 1S2VA 3OVGA 4RK8A 2WYSA 2UWFA 3TW7A 3BLIA 1VBUA 4GY1A 4C6NA 4UC5A 5FCZA 3DG6A 2ZUMA 2NLIA 2QUMA 3H55A 3SRHA 1EOMA 3DHFA 5A6SA 1X38A 1AJ0A 1XF0A 4IG2B 4LW7A 4A8NA 4N9EA 1KFKA 3NO5A 4N02A 2V68A 3URQA 1GHSA 2CESA 2PRMA 3H24A 3POHA 4YCOA 4O54A 1E73M 2C1IA 3HQOA 2PWHA 4MHBA 2BOEX 3PJXA 1EA9C 4K36A 4UFIA 1LLZA 2VR4A 2DSKA 3L4YA 3R2GA 5E9AA 3E0LA 4FNQA 4C7DA 1KM2A 3B8SA 4UCFA 3W07A 3FVMA 2YL8A 3BQ6A 4LUTB 5H1WA 3VC5A 1XX1A 4RZ6A 4JTTA 3MWCA 4K8HA 2PP1A 1W3HA 1K1DA 6A3HA 4I6VA 3GG7A 2DT3A 1DE6A 1CI1A 4FF5A 3PF3A 1PB0A 5CGQA 1XRTA 1OIMA 1BTCA 1UWQA 3BLDA 4IMFA 1HIZA 3LCGA 3LTPA 3G5EA 4BQ2A 2ZUVA 4MJMA 2E40A 3UGRA 1E51A 2NV1A 3O3RA 4FALA 1JZ7A 3ITVA 3BC9A 3WLLA 3GXMA 2ZE0A 2OG9A 1DJNA 5G4EA 2VWSA 4RKAA 1VD6A 1XIIA 5CSYA 1JYXA 1LYXA 1SZGA 2ZKMX 2PFHA 3HV8A 5JH1A 2UY3A 4B5TA 3K5XA 4A05A 1KD0A 1I2QA 1XJBA 4DVOA 1OADA 3E1F1 1UR8A 1IIHA 3ARUA 2CLLA 2O9PA 4ZXLA 4ZZ9A 3S2JA 2EJAA 3MSGA 4HVXA 1SFTA 2R1LA 3N29A 1TIWA 4CD4A 2YBTA 4YLWA 3KHJA 1ME8A 4P7QA 1Q4NX 2PUZA 1P4CA 3Q37A 4KCUA 1KRMA 3OYZA 2JE8A 3LY0A 1WZLA 1W2VA 2HBXA 3SCRA 4B5WA 4WXYA 1J11A 1O5XA 2EG6A 1MEHA 1ISZA 4UTTC 2X40A 4LTSA 3RK8A 2W27A 4DPPA 1C9WA 3MUIA 1S5VA 1HXJA 3EDJA 1X1NA 1LTDA 4DJDC 2QQ6A 1ITXA 3RNDA 1Z42A 5HPOA 2ZYFA 2V3FA 4DNHA 5BNKA 1TPB1 3DYOA 4RZ5A 5JIPA 4UWMA 1MI3A 2WZMA 3WD2A 1EHAA 3WFAA 1XPGA 4W7UA 2CNCA 1L2UA 2BZNA 6CGTA 2Z29A 6XIAA 1E0VA 1CYGA 1JDFA 2VRJA 3P93A 2GDUA 4F66A 4QROA 3NQAA 2DVTA 2PDNA 1ONRA 2IPGA 5LIXX 3GVRA 3OO2A 1AQHA 2NT1A 1M41A 1T41A 3TC6A 3E2RA 4QS6A 3MS8A 1TMQA 4M6UA 4TO8A 1DQXA 3KOXA 2BV9A 1K8YA 4HMCA 4F8XA 1ISXA 3R1ZA 3SQSA 1J93A 4XK2A 4MJ2A 1PZ0A 3FDKA 4C6DA 3GNRA 5AYYA 3CV1A 4RW5A 3HGOA 3TTEA 4ZO7A 2V3DA 4PFMA 2QZRA 1PV8A 3PC0A 4Y2WA 2PF0A 4YHGA 2G3FA 3L5LA 4JKLA 4GVIA 2ZRUA 3VGDA 2EPOA 2OWCA 4UNKA 1K02A 4PMVA 5FF2A 4HOWA 4PUWA 3UWWA 3WKZA 5I79A 4GY7A 1VKFA 3UWEA 3GU9A 1NP0A 3VNYA 2O4MA 1GNXA 4AVOA 1GJUA 1REQB 4MSSA 4ZFCA 6ALDA 4NZ4A 4GUJA 2V0TA 3KLLA 1G7VA 4YIWA 4MIMA 2VHLA 4XIMA 2RFGA 3IUHA 5GNZA 2A4AA 4UQ9A 3CWHA 1BWKA 1JUKA 4UFJA 4DWSD 3DKLA 3II1A 1JPHA 1Z9AA 1HJXA 1GVFA 2WNWA 3M5ZA 4MYAA 4GACA 4ZOAA 2XIJA 1EC8A 3MDWA 7A3HA 3C8FA 1I0DA 4HYVA 4D8ZA 1W1A1 5A1AA 4M6PA 1LT7A 2FVKA 1Q6EA 4B16A 4YTSA 3S5NA 4GI4A 3SFWA 3TYZA 1BXBA 2YYTA 1Q63A 4Q33A 3SRFA 2ZQ0A 2EBNA 3SSJA 2OT0A 1VFMA 4DF2A 2EPKX 4XZLX 4IISA 3ARWA 5I23A 4PMNA 2F7FA 4DWSA 3ARRA 4DO6A 5DRCA 4Q8UA 4ACYA 5TQLA 4GPNA 3TMQA 1W3NA 2FFCA 3FN9A 4K1GA 3FJ4A 2NV9A 1V02E 3GIPA 2INEA 1FCBA 3WDJA 1V6UA 2GUBA 4IFOA 4LX4A 1ZALA 4QE5A 3RXZA 1E43A 2QJHA 4MY1A 3O16A 4L61A 3H6OA 3ZSTA 1G69A 5D2WA 1IR1A 3AC0A 4AZ5A 3W1MA 2AGKA 2YFOA 2BVWA 3WDQA 2A79A 1TPUA 3QY6A 2WVUA 3TYDA 1I6NA 4O12A 3BMWA 4KGJA 1VFOA 5I3KA 4Q4KA 1MWOA 3VZXA 2NQHA 4P7NA 4U5KA 3TX9A 3H21A 4AYGA 5G1MA 4Y8FA 3W7CA 4ZVJA 1I1WA 5B7ZA 4HTYA 4AC7C 5AKQA 4M0XA 4WJEA 3GFXA 1W54A 3BVJA 4WHBA 3UCCA 3GYEA 3UZ5A 3IUDA 3B0XA 5L6UA 5KINA 3KCOA 2VL4A 3WK1A 4YVPA 3AYSA 2PTZA 5IHSA 4FXFA 1EBGA 3E9AA 3UVAA 3OA3A 2O9RA 4WSHA 3MMWA 2PDGA 4F79A 3QQ1A 4M81A 1AMYA 5D9PA 3DG7A 2FDSA 3LNPA 4P8WA 3CB3A 3IV8A 1E6SM 2AL2B 2BODX 1AUSL 3K46A 4RL3A 1F05A 2ESCA 4Q22A 5FL0A 3P61A 4JN6A 1S1PA 2C3ZA 4JOMA 2VCCA 4M8UA 4IWWA 2DFAA 3DKJA 3GNXA 2P8BA 3T44A 1G0CA 3SGGA 1G4PA 4G5DA 3F4NA 5JVLA 2X1TA 3WN6A 4HPXA 1XV8A 1AODA 1XYZA 3W26A 2AKMA 3NGJA 2X7VA 2CERA 4OJYA 3S2LA 2ZUTA 3NQCA 4JIRA 5AN7A 3OLEA 4KT2A 3F4VA 1PWLA 1G4SA 5HDRA 1KM5A 3CUXA 1TV4A 2PP3A 1GVEA 4R7JA 1V3MA 3NIYA 2GDQA 1FDJA 3LMYA 1VFUA 3GVWA 2ZADA 3SGZA 2VEGA 3WJSA 3LI0A 3GZ3A 1JDAA 3LBOA 3B0UX 4Z1YA 4L4PA 2FIQA 4O10A 4F0SA 1UHVA 4Q8MA 2X7WA 2FFIA 4J3TA 4WDXA 2P50A 3RLHA 3N2MA 1TPDA 5KZMA 1DIDA 2X42A 2H9AA 3FGCA 2CPUA 3ZR4A 3BWWA 3EX3A 3TSDA 1QOXA 3BZJA 7REQB 3O15A 2A7PA 3HV9A 4M1BA 3UYCA 3QZ6A 3ONBA 4IIHA 1OK4A 1V77A 3C8NA 4XO6A 1G9HA 2A6LA 3GUWA 3P0WA 3VKBA 3QN3A 2XVNA 4AIEA 5C9RA 1VBRA 4Y9NA 3KCJA 1YDOA 2CC0A 3TQKA 1B9ZA 4RNJA 4FNTA 4CQDA 2SFPA 3E38A 3SCWA 1UR0A 1H1ZA 3WQ8A 1GQNA 4FPSA 3AZTA 2QULA 3QFEA 4LH8A 3WH6A 1UR2A 4D6EA 2ZX9A 1JZ5A 1L0PA 2Q02A 1NIUA 3W27A 1VRXA 3I68A 2EXOA 4GXPA 3C4UA 1UMLA 2ZC1A 4GIYA 2UZ9A 2DZAA 1CGWA 3IVSA 1BQCA 2R14A 4HZ6A 1W1YA 4C6OA 1EHNA 1KXHA 2Y4SA 3ARQA 1PBGA 4BEQA 3BL3A 4ICMA 3NVTA 3QGAC 3EA2A 3SO7A 3GQYA 2OLAA 3I3EA 1IF2A 4MY9A 2VFHA 3W75A 2J24A 3PUOA 3OZMA 1UKSA 3BUVA 2NWSA 4AY7A 4K7YA 1ZRQA 2G50A 4TXEA 3RILA 3CTTA 1JEZA 4ZTXA 2D3LA 2PTWA 2WW5A 2VGFA 3W53A 3UJSA 4ROPA 1PS9A 3EDEA 1CB2A 3KCLA 1OFQA 1B5TA 3NQ7A 1TTIA 1FWCC 4R88A 5DQPA 1W8GA 1OCNA 3NM1A 4REQB 2QIIA 3GXDA 3M6DA 3P81A 3L4VA 2VWTA 1A4MA 4KBXA 1D7KA 1YNPA 4IHCA 2FZDA 2NX3A 1B54A 1QFEA 3DBNA 2FMNA 1ODUA 2XUCA 1EBHA 3RLVA 1MFUA 5I07A 3WJXA 2CW6A 3NAVA 1A3HA 3H4WA 1K77A 1BRLB 1IZCA 1PL9A 2VDGA 2OU4A 3NOYA 4QISA 5MF5A 3B8VA 1B3OA 4WY0F 3UY8A 2OSXA 5CZ0A 2FHBA 1CENA 1LBLA 1DWAM 4A29A 4NUWA 1OHLA 4G8TA 3LDVA 3PP7A 3HO8A 2GQ9A 3W83A 4UMAA 4Z2LA 4O18A 3SUSA 2PI6A 3N25A 4ZSTA 2VO5A 4LRSA 2XVLA 1DJIA 2VX6A 4GHRA 2VFIA 1S3TC 4IPLA 3WMSA 4AX7A 3OBEA 4DI8A 3G0UA 4PRWA 4EWND 4JFVA 4KQNA 2X8RA 2Y5EA 3S9ZA 2EAWA 1PTGA 3C61A 2IXUA 3ISIX 2L5HA 3VCNA 4G1NA 2Z1SA 3NL6A 4E8CA 3JZEA 4US6A 4P2VA 3ABXA 1XYAA 4HZMA 4O17A 4BY3A 3QFWA 4AC1X 3VE9A 4HJFA 4GX9A 1LF1A 3CZKA 3PZIA 3FKRA 1UR3M 2A2IA 5F4XA 1JD9A 1OG6A 3GDMA 4FS9A 5D04C 1ZLPA 2ZX7A 1DJGA 4LUJA 4HIBA 3PK7A 1YXDA 2ZXQA 3U2EA 3MI6A 3WK0A 3PZUA 2DSWA 3OODA 3B8UA 2EG8A 5A8QA 1OC5A 4H01A 5LNUA 3RF9A 1UC5A 3BSGA 4GZ7A 4V28A 3CT2A 2OZ0A 3G3DA 2YDAA 3NL2A 4IG2A 1F4HA 3IRSA 1ZGDA 3GNNA 5CXPA 4U28A 4H9YA 1CLVA 3RU8X 3N1AA 2I1OA 3AZSA 4Q6XA 3GHSA 3DFQA 1X39A 4GVFA 1UMYA 1GKQA 1XC4A 2ACQA 2PU1A 2X05A 1NY1A 1V0MA 3QQWA 1A0DA 4LB4A 1JFXA 2GSJA 1TTJA 4QBXA 1DV7A 3ICJA 1AVAA 1MUCA 4JGDA 4UOQA 1P48A 4DBSA 2E6FA 3GVQA 4LUTA 1YTEA 3SUWA 3HTWA 2ACUA 1GTEA 5E6ZA 4IMEA 5DO8A 4K68A 5FEXA 3VABA 2WKGA 1KCKA 3QH2A 3WLMA 4WKFA 1UUOA 3KBWA 4NX5A 3AS2A 1TSIA 1J01A 2DW7A 3O8AA 1XLBA 2O4QA 3OJGA 3B8TA 2R1NA 1RCOB 1TWZA 3T08A 4Q7IA 3MC5A 1O1ZA 1H0IA 3W3OA 3RM9A 5XIMA 2WKLA 5ABFB 2EEXA 3CIVA 1EB3A 3ZWTA 4F9DA 1TPVA 3L4WA 3W1TA 1GEQA 1T96A 3GDBA 4ZCWA 4DAFA 3C5QA 2JF7A 3FY1A 3MBFA 2WKJA 1LQ0A 3IAQA 3P8IA 3H4GA 3QYSA 3P3BA 4Y9AA 3B3DA 2CZEA 1W9PA 4U4MA 3G1DA 3L9CA 3GU2A 1P43A 3LCWA 3ITCA 4Q8TA 3W7EA 4ZE5A 1EC9A 3EMQA 2WVVA 1HUVA 2AKZA 2NWRA 2V5JA 3BH4A 3E49A 4QLJA 2PMQA 2V2DA 1DJYA 3G8EA 1V0KA 4JY8A 3GAKA 3ZWSA 3PWGA 4AZCB 4CN1A 4HK5A 1IHIA 1XSJA 2PWUA 4LVBA 4OBSA 5FIPA 1RP9A 2BDQA 4DO7A 2IKGA 1YRRA 2ATSA 1TX0A 1KRAC 3RIKA 3EMCA 2ZVIA 5I2UA 3EWUA 1A5AA 1L6SA 3A4AA 1TMHA 5H8PA 2A7NA 3P5YA 2BHYA 4IFKB 1DXFA 1V0LA 1JG9A 5DT5A 4PUMA 2PP0A 1KA9F 3V7PA 5HINA 3LPFA 3R43A 3FVDA 3NQ6A 3EX6A 5HUPA 4AVNA 4M82A 1PZ1A 1Q7ZA 1GOMA 4GYPC 2DPEA 1J0IA 5FJTA 5A94A 2RDTA 3HQNA 2Z6IA 4G2DA 1GEHA 2V30A 1CLXA 3S2MA 1HG3A 1FWSA 1FOBA 2QKFA 4L4LA 1XRSA 1PIFA 5I09A 3RPTA 3U57A 1DTUA 1PUDA 3U4FA 2EPNA 1BYCA 4GH3A 5FEZA 3AYRA 2XN0A 3WQVA 1Q6RA 1R3WA 3EEGA 1RQEA 1G01A 3NEVA 1RXOB 3HMCA 4GBDA 1W17A 3INPA 3URNA 2PWVA 3YPIA 2AQWA 1VCVA 2RGLA 2QCHA 4J28A 4C5ZA 1CZ1A 1VF8A 3EOOA 2D0HA 1FRBA 2YCJA 2P88A 1W0MA 5HWMA 4MKNA 3O2LA 3NDYA 1A5LC 2ISFA 4X0NA 1NDWA 3G0XA 2XDFA 4UZSA 3ARVA 2ASHA 2QNEA 3S1WA 1ADDA 1GZ1A 1REQA 2I5IA 1V6XA 3F7JA 1I9CB 3IK2A 3PZQA 4DZHA 5FKYA 5DCEA 4IL0A 1Y65A 2Y7DA 3N19B 4NP7A 1EPXA 3H26A 4JXCA 3TYUA 1RD6A 4W86A 3PPCA 2GDVA 2MANA 3SCPA 4JNMA 1H5YA 2BGNE 3L7RA 2WC4A 2FZBA 4GX8A 2R1PA 1VAHA 3RJXA 4RXFA 4LCSA 1PJ9A 4U3AA 4PMXA 4DWDA 1XINA 3MKKA 2QVNA 4JTQA 4AISA 1H7XA 3F4CA 3HGJA 3RAOA 3BJSA 4PCSA 4DYJA 2XM2A 3GHTA 2YFNA 4ZQCA 5I02A 1Q2SA 3TLQA 3KVKA 5C70A 5EMUA 1JAKA 3SFKA 4HMDA 2O92A 5F2GA 1HQTA 1ZAHA 3CZJA 2CKRA 3U3HA 1SZNA 1EDTA 4DI9A 5F4WA 4YPJA 4RDZA 2W5FA 1MRAA 1WDSA 4LUYA 1W3JA 3P80A 2V81A 4H7VA 1EUAA 3D3FA 4DB7A 3WH5A 4OOZA 4INFA 1F4AA 2WO5A 1VBGA 2G3NA 3HPXA 3GSMA 2WZEA 3EOUA 4IIGA 4UCGA 4AXNA 4JN7A 2W66A 3L2MA 4LQ1A 3GR4A 2WB5A 3WYZA 1TJRA 4OTKA 2QGYA 3W9ZA 5I3JA 4J27A 1FFQA 3SN4A 3BAYA 4FAMA 5CPSA 4EWJA 3BTNA 5XIAA 1ZZMA 5DCDA 4NT0A 5FF7A 3QHNA 4N9BA 1BVWA 4IP5A 1KV5A 1CIUA 3PB0A 2YPIA 3CWOX 2VMFA 2XIQA 3CZGA 4CGTA 4OECA 1CWYA 4OVXA 1DJHA 3OBKA 3ZJ8A 4TX6A 2DZPA 4B3KA 3H7UA 1R9YA 3TQPA 5BU6A 3HFTA 3VINA 4L4OA 4GA8A 2GSEA 5SWUA 5I3DA 1R9ZA 3W1XA 3ZVHB 2GJNA 3GH7A 4FX7A 1OX4B 1QJWA 5D38A 3W2NA 1GUVA 4LV4A 2QF7A 1JR1A 5CC7A 3K8KA 1VZWA 3VZYA 1HGWA 1ONWA 2YL9A 5G1TA 1OK6A 1SPQA 3V36A 1X6UA 1DJXA 1EZ2A 3DFYA 3TVAA 1R9XA 1ZSXA 3RLGA 1O12A 4JL1A 1H1NA 4UR9A 1CECA 5CSSA 1E6PA 3TH6A 3W7OA 3RRAA 1Y8BA 3RX3A 3I4KA 1AG1O 3TJIA 2BY3A 4ZQOA 3VIKA 4F2BA 3DFSA 5HXMA 1TJ0A 3SECA 5A8PA 5AZ0A 5CBIA 2WJEA 1DWFM 4FXSA 5DN1A 5C7VA 3MSYA 4ZODA 1KC7A 2V3GA 4QNWA 1KGWA 4ICNA 5BMXA 3KTCA 3PNUA 4A4AA 3OBAA 2WNQA 1DIEA 3QOKA 4IQEA 4ZENA 3A21A 3FCPA 1CGYA 2RH9A 4I5XA 2DV0A 4H6EA 3R5EA 3DI1A 3AXIA 3UG3A 2Q6ZA 3WL0A 4JYEA 4LNYA 2HXUA 3QHMA 4ZXOA 3TZNA 4MY8A 2G96A 3WMCA 4AF0A 1V6YA 1WO2A 3J7HA 4POCA 1MEWA 4GK8A 3OOQA 1V6WA 1W5QA 1YMYA 1J0ZA 3BV4A 4Q32A 2R8WA 3B0YA 1WX0A 2Z6JA 1UJQA 2CXGA 1IYXA 1ISWA 1E71M 3ARSA 5BMWA 2RDWA 1ECEA 1J9YA 4NZ3A 1EO7A 2CBVA 3RPDA 1QXLA 3QKEA 1UP3A 1M7JA 1SW7A 5I00A 4ZL1A 2PU0A 3MCOA 3R94A 1YKWA 3LN3A 3L4TA 3LUTA 4NNCA 1GOOA 1OFOA 2HDJA 1VBHA 3EWDA 1TYGA 2QUUA 4NAFB 2WCAA 4TVUA 2HE5A 1VJZA 1M01A 3S5OA 2EKGA 4W8AA 3EXTA 3PPGA 5HANA 2E1DA 4O50A 2ODOA 1UD5A 5C71A 1TWDA 4F0RA 5ABTA 3ATYA 3LCXA 3VIPA 1GCYA 1Z41A 4JTFA 4NYYA 2I56A 1GOQA 9RUBA 2Y24A 5DXXA 3CMFA 3NQEA 1W56A 3KRZA 2J47A 2VQUA 4DUXA 3LZ5A 3QY8A 3PBGA 1JYVA 3WLHA 1FWJC 4LC8A 3ABSA 2OGYA 1JD7A 3W1RA 5HMDA 4CNTA 3NL5A 2QV5A 3Q4DA 3APGA 3MHUA 1A3WA 3M9YA 1XHGA 1W9UA 3WD1A 4IPPA 4R7OA 1N8IA 2GWGA 3O9NA 3QR1A 2O7QA 3BLEA 2CWNA 4GKLA 3F2BA 1QNVA 3O06A 5CQ1A 2QCGA 4WJ8A 4F0MA 5CZTA 3CB8A 1O95A 2AOSA 3ARXA 5AHEA 3P7YA 3MUAA 5D03A 3KW3A 4KEMA 2ZICA 2PTDA 4Z0JA 2GVLA 4R9OA 2B0MA 4NI3A 4XV0A 2GSHA 3QV7A 4FXRA 2PLCA 2FH6A 2B4GA 2CHOA 3LQLA 3CQIA 1MFVA 3PANA 1SFJA 4DXKA 3I7SA 1N8FA 4HNTA 1S2UA 2QHAA 2E68A 2ISDA 4DJDD 3RYSA 3UR5A 1LBFA 3I4EA 5IDIA 3LGEA 2HVMA 1HT6A 3S3GA 1J79A 4QRNA 3U2CA 3U7VA 2JEPA 1MUWA 3W7JA 1ME9A 5D2TA 3MV01 3O1NA 2Z25A 1J0YA 4O11A 4JTJA 1LL6A 3DXIA 4CU8A 3AYVA 1XLHA 3M6YA 3EKGA 2Q3RA 1FWBC 1PTDA 1I1XA 2CFFA 5HQEA 4XTDA 4X2PA 4HHMA 4I5RA 3FJNA 2XGIA 3AWNA 4Q8PA 3TC3A 3UWQA 1F6PA 3IACA 3BICA 3MUXA 5BRPA 4KF1A 2VC5A 1AQMA 4DJDA 1R7OA 1FWTA 1IXPA 2I17A 4MDOA 3VPLA 3GO2A 2C6QA 1E4LA 1FXPA 1ZBWA 5LNRA 4O4WA 5EPDA 1W32A 1IGWA 3NEHA 4ILSA 2GLKA 2Z7GA 1JF6A 3VIIA 4OV4A 4ADSA 3S6OA 2X0HA 3G1HA 2E4TA 2NZLA 2PURA 2WWDA 3BW4A 3PG8A 2C8NA 3Q45A 1WKFA 3ZJ6A 1PZ2A 5C2CA 2P76A 1V0NA 2QJMA 4HOXA 5HMEA 3WBXA 4UFLA 4AIBA 1SFSA 1XH0A 3WQGA 3SCNA 2R1MA 1A4LA 1XLCA 1SZRA 3PVFA 2WMIB 2ZXBA 3N34A 4V33A 3CL8A 5DBUA 3KWSA 4J2MA 2D24A 5TAOA 1CGTA 1E1FA 1UZDA 4P7LA 1FH8A 4D6CA 3FIGA 1OYAA 4YTUA 2OCZA 4LEFA 3I6RA 1FWIC 1PCWA 3LBCA 3GTIA 2V67A 3WBWA 2G3IA 3L65A 1TE1A 5BWFA 3VYLA 2J7BA 3IPWA 3WQPA 3LLXA 4TX9A 4IFRA 3W2UA 2REQB 5ABFA 3TFXA 3S83A 4DF1A 1E9LA 4W8LA 1QMLA 4MFDA 4DYEA 1VP5A 4C1NB 4O13A 3QGKC 3VU2A 3EKLA 2R94A 4MDPA 1V7AA 5AB3A 4HHLA 1FWDC 4JR5A 4K6AA 3O63A 3N14A 4NJGA 1YE4A 3N9KA 4OT7A 3UW6A 2A21A 3WNPA 4NXSA 1A5UA 2V8ZA 1P7TB 4OBRA 2KZHA 5CG0A 2OTDA 4XG1A 5HUOA 4CNPA 3VDBA 2J7DA 3OLDA 5GPRA 4E4FA 1UWSA 3NQGA 3BW2A 2OSYA 4B5UA 2QCFA 2Z27A 4WRHA 2WM0A 1TZZA 1E6ZA 1W3IA 1BKSA 1AW5A 4DNMA 4E2OA 2G4FA 1RVGA 1QO5A 2GL5A 3IGHX 4A8IA 1NWRA 4W7WA 1PKYA 3ZLFA 4H9UA 1QPOA 1ICSA 2AMXA 4TU1A 4NAEB 3BSHA 3EDFA 3CUIA 5I5RA 1Y5VA 2E5DA 2ALRA 3CMJA 3KE0A 4W4QA 2GK1B 5EGRA 2ZA3A 2PD5A 3IEBA 4KH2A 4LAOA 1WYIA 2YBVA 2CLKA 1D3HA 1MW1A 1U5VA 1UKQA 3CPGA 4ZO9A 2QJGA 3BW3A 3LHZA 1ZP4A 3OG3A 1XBXA 5MKGA 2P53A 1AJ2A 3CHFA 3KZSA 2DEPA 2YX0A 1Z7AA 3VD4A 3K13A 5FF3A 4O28A 4C6EA 4FOUA 1UWUA 3AS3A 2CWXA 4JD4A 4IQLA 4O1DA 3K8LA 5G4WA 7ODCA 4DWSC 1B30A 4OGZA 3G2GA 1XLAA 1B90A 7TIMA 5BROA 5D9MA 4J2PA 1K9FA 2A0NA 1XH1A 5EKYA 3AIEA 3V5CA 3QMRA 1IEQA 3W28A 3FSTA 4MWAD 1AL7A 1GQIA 2F84A 2DVUA 5LA2A 5DX7A 5I3FA 4LGXA 3TOYA 1FTXA 2O9OA 4MVAA 1C92A 4MZYA 3KDOA 4CNNA 3U0HA 4ML9A 2C14A 4HHPA 3S46A 5T9CE 2O0TA 3GUGA 3PZTA 1WDWA 2E9LA 2ZWYA 1F8MA 3WNNA 4A3HA 4R53A 1TUXA 3ABZA 4DRSA 5EYWA 1OG0A 4KKXA 3WLPA 1U30A 3KXQA 1WZKA 1KGUA 5FJUA 2ZZ4A 1IT8A 4YYCA 4MWAA 3T2QA 2NUYA 5L9FA 5K9DA 3CL6A 3UJRA 3TN4A 1M65A 3N73A 2OLSA 1DKWA 8A3HA 4AD1A 2IPWA 3A4JA 4AB4A 3UNTA 2XIIA 2VURA 1E4MM 1RY0A 5C0QA 1A5OC 3WEZA 4B5SA 4MTVA 4A3UA 3BCJA 2WQDA 4M24A 5LIUX 1WOAA 1ME7A 2VGGA 3OGRA 2IPJA 2WMJA 1LWHA 4AD3A 4OQVA 1XIGA 3F4DA 5CZKA 1HTIA 4M19A 4PTDA 5FJPA 4AG0A 1QNPA 3QBUA 1IE7C 5FSEC 1E9IA 2EJ1A 4EE9A 3GBDA 1E3ZA 3CC1A 4KFPA 3KVJA 1OC7A 1M7XA 3EWZA 4TOQA 3WLOA 1DXIA 1XG4A 5K4XA 3LM7A 1UQYA 2Y7EA 4FA3A 3T0CA 4N9CA 1EWDA 3H8AA 3TQ0A 3CNYA 4O19A 3TW6A 3QW3A 1P6BA 2DZWA 5BCAA 2UV8G 3WUGA 1EYEA 3CUGA 4Y9MA 4YVXA 4RNHA 4C6IA 1PE1A 2F61A 3E0WA 4S3KA 1PYMA 3W85A 4HQVA 2E28A 3DU0A 2PDMA 2VFEA 1OFBA 2CKSA 1KLYA 3MHGA 4PB4A 4EP8C 4I9TA 1Q13A 3LEPA 1FWEC 1F76A 1P0BA 3VI2A 4JNYA 5IBXA 1PHWA 3QC0A 1TVLA 3CUHA 4PCTA 4PSRA 4UOZA 4BFAA 4MJZA 2C19A 4LWWA 3NUKA 1JRBA 1WXJA 3CTLA 3T42A 1VYSX 4MGGA 4LVGA 3KWXA 4H9TA 3UZJA 2C13A 3CIXA 1LL7A 1YIXA 4AIUA 1MW3A 3ZVHA 1AH4A 1BPLB 1OX4A 4QJ4B 3TXZA 2DY3A 2PDKA 4WR3A 4KMQA 1KBBA 1L8PA 3M7WA 4MLRA 2NXIA 2P3ZA 5FA5A 3PHAA 3HZ3A 1MDLA 3VK5A 4K2SA 1UZ1A 1XS2A 4LT9A 3FYYA 2UY2A 3THQA 2CLPA 2D20A 4XZWA 3R8HA 4MNKA 1LOQA 1XGDA 4YS1A 5K7JA 3M07A 3DFNA 3SN0A 1YPXA 3F2DA 3OLGA 3UP8A 2F9RA 1HNYA 1B3VA 3TV8A 3MP3A 2Q8LA 3R10A 4O53A 2D0FA 5H2ZA 2H6RA 3S47A 4QLLA 2OXNA 2XH4A 3LPGA 3G0SA 1SUXA 1MSSA 2JGQA 3QOMA 4GI9A 3EB4A 2NX9A 1SW3A 1R5YA 2VP8A 3H70A 1FVPA 1NDYA 1OT1A 2Z1BA 2V6AA 4QSHA 5DMLA 3GR7A 3A3HA 1R38A 4H8VA 5A8MA 4E38A 3BQ5A 4DM1A 3BZGA 2HROA 4Y7EA 3C3NA 3DDMA 3C0SA 4LF1A 4O4VA 3FOKA 2VCAA 2QCMA 1ZB5A 1QWKA 1BGGA 3BV7A 2OWWA 2QV4A 3IGXA 4FP1A 3WELA 3V5OA 2UY5A 5BOOA 2GJLA 3WK2A 3IGUA 4U31A 3HFYA 1QASA 2J79A 1SSGA 1ALDA 4D71A 1OZMA 1WA3A 2XIMA 5CGTA 3MU7A 2VVNA 2XM1A 3SQMA 3MANA 4CVWA 3VGBA 2CLIA 1MZRA 4GXMA 1KO0A 1C93A 1W1TA 2HNHA 3EA3A 3WK3A 1MW0A 3VX1A 1TPC1 3CV6A 3VGEA 4JDBA 2CLMA 3E2VA 2A7RA 5ABEA 3AICA 5LKYA 4S3DA 4IGMA 1POJA 4HCHA 3MKCA 2Z1KA 1JGIA 4ZQRA 3IK4A 2VJXA 5H6HA 4LB3A 1ZP3A 2PZNA 1HKVA 5GJMA 3WIJA 1BF6A 2AAMA 3ARTA 2VT0A 4LS2A 2YLAA 2J74A 5C9XA 3CZEA 4PH6A 3V1HA 4AIOA 3B04A 4JN8A 3VUPA 1YPFA 1AQ0A 3HURA 1BG9A 1HX0A 2O7SA 3TCEA 3BOFA 2OYMA 1VR6A 2F6KA 4I5UA 3QR3A 4H2CA 4JBRA 3T0DA 1SR0A 5ABHA 3LLFA 3TJLA 1TJPA 2CEQA 4NILA 1G4TA 1UD8A 3GVVA 1LRQA 1SM9A 5LXEA 2OOFA 3R6IA 3BGGA 1E5JA 2Y89A 4QTGA 3TA9A 4UOJA 3XINA 2CHRA 3O6CA 4W5UA 3E2SA 3QSRA 2Y70A 1EC7A 2VZOA 5BRQA 5HNTA 3NWRA 2QDGA 4G6CA 4XQ6A 7TAAA 4JTAA 5D2XA 3PSWA 3E96A 4OZOA 1GKRA 3T8LA 3ANUA 2YOCA 3WNMA 1HJQA 2RDUA 2WPGA 4W7VA 5DFAA 2Q01A 4LAZA 5CBBA 1SO3A 1QW9A 1FWRA 4DJED 4JIIX 4AWEA 3OU8A 3AWOA 3TJ4A 4NRRA 1UH2A 4E5TA 3LQGA 1XFBA 3SB0A 3A5FA 1RBOB 1XWYA 3WDRA 3BO9A 3PG9A 4YJ5A 3G8RA 4QP0A 4BWLA 3W86A 2QPXA 4H9XA 3R12A 4DBEA 1JI2A 2BGQA 1LL4A 2I5GA 3IAPA 5JBEA 1D8WA 5D4YA 4DJEA 4LU0A 4L80A 2R91A 2HISA 1KR0A 4MUZA 1V6TA 4XBSA 2QPSA 1YYAA 4MNMA 1OINA 1WUEA 2WBGA 2HSAA 1N7KA 4YU1A 1ZHAA 1ZJIA 1VGAA 3CEPA 3P84A 5AHMA 3WQCA 4DBWA 1TE6A 2WBKA 3B4YA 1OEPA 4Q8QA 4HYRA 2XJ7A 4FNUA 3CUFA 1SO6A 3TXVA 4X63A 2CHNA 3ALFA 1KQYA 3M0ZA 2W61A 1XGEA 1ML1A 3URAA 3NPXA 3WLJA 4JY9A 3KP0A 2VX4A 2Z1WA 5FEPA 5AOUA 3NVDA 1UJPA 4DUVA 3UPMA 3T6CA 1CT5A 5CPTA 3CPUA 1XBYA 3IANA 2DZTA 3DH7A 4FK9A 4QE4A 4RR4A 3SAZA 4G7FA 1P0DA 3STFA 2PLMA 3V1PA 4GNJA 3P62A 2I9UA 5IRPA 3LX9A 5DCBA 1XGZA 4Y6GA 2C71A 3P14A 1TIMA 1VBJA 1ECQA 4D8AA 3IJLA 3PTQA 2A3LA 5LGXA 3BLPX 1F07A 2POTA 3HGSA 4DY1A 1FUYA 4YVVA 4HN4A 4R7WA 4KIEA 4NHVA 1H2JA 3R58A 4TV6A 4JFTA 3ES8A 4B5XA 4GLEA 1KM0A 3S0CA 3RUBL 3EZ4A 1E0UA 3QW4B 1FP8A 1DYSA 4RZBA 4DZ5A 1Q85A 4GNKB 4LJ3A 3MUCA 3CBWA 3MJYA 1GYNA 1SU5A 3GB6A 1R3RA 2E25A 3THUA 3L4XA 3IJ6A 1A50A 1A0EA 4C1NA 2WHLA 3MT1A 1CXKA 4GRSA 4FX8A 5ECUA 2D3NA 3F4WA 2NXGA 1H62A 3GU1A 1UWAA 1IGSA 1TCMA 1PZ3A 2PDQA 3DX5A 4HPGA 3B8IA 4ERGA 2HTMA 4H04A 4QE1A 3D47A 1K7FA 3ID7A 4FR6A 8XIAA 5D9NA 1G6CA 2OZTA 4W87A 3V0SA 2WJDA 4FX6M 2PDYA 3EPMA 1KXTA 4LAKA 2WC7A 4WJXA 2DIEA 2F6XA 3ALGA 1EX5A 2EHHA 1XP3A 3FEMA 2Y61A 4AEEA 4XZIA 1ZTVA 3VTRA 2FTWA 3HQ1A 3W2KA 1QWGA 3OVRA 2XFFA 2VFFA 3LTSA 4HCDA 3NQDA 5D09A 2XVPA 2YXOA 4BQ5A 1G1YA 4H6RA 5AC7A 4NF7A 1JXJA 1SR9A 4QX4A 5LA1A 2B7QA 2WZTA 4LY4A 4EK7A 4H00A 5AYBA 3EWXA 2ZBTA 4JAWA 3S8HA 5AY7A 2E77A 3D0CA 1AQFA 1QVBA 1S2CA 5D30A 4YNGA 1E6XM 4HYWA 2O55A 3CWNA 2HK0A 1TWSA 3WENA 5RUBA 3C0JA 4JZ5A 4DYKA 4UFMA 4LOCA 1FCQA 4PUUA 3NQVA 1IXNA 4P8XA 1Y5XA 4YHEA 2AGTA 5LSMA 4QLKA 4ERAA 2IKIA 1J5TA 4DXXA 2YZ5A 3OPSA 2OSWA 2X0YA 1JRCA 1TMLA 1OGGA 5MHBA 1PPIA 4PBEA 4HP5A 1TB3A 3R11A 1U5HA 3CQHA 2QT3A 2AAAA 4MJ4A 1PDZA 3BOXA 4ADUA 5JIWA 4ECLA 1EFZA 4D6GA 1IZKA 1BYDA 3WX7A 3WQEA 5C9ZA 2RDXA 3IRDA 5KZDA 2DJLA 5B80A 3LHVA 1FDZA 3GXPA 2DUZA 1W37A 4QXIA 3UA3A 3W7MA 1JL8A 3R79A 2W4XA 4PULA 3P8JA 3T4CA 3SGUA 3A5VA 1R3YA 4CEUC 3FNDA 1DP0A 5AHFA 4M7SA 3COTA 4KWUA 3ITXA 5BOFA 4GYJA 4AZIA 5EA9A 1VENA 2YSWA 4Y96A 2ABBA 2X16A 5TBOA 2OFJA 1GW1A 1V4YA 4GH1A 3K8MA 4IT1A 4K7VA 4BQ4A 3DIPA 4DQWA 4A2RA 2E9BA 1IT7A 4UQAA 3VM5A 3DEQA 1QBBA 3U4AA 1ZQ5A 3CAQA 3EOEA 3KBJA 1T40A 1AJZA 1UWRA 2J7HA 4HNVA 1OFRA 1JYNA 2EPLX 3MSDA 1RLCL 1QPQA 5I03A 3WCZA 3WUFA 3AHTA 5T91A 1DL3A 3LM3A 2OQYA 5I77A 1IXQA 3S9YA 2PTXA 3O07A 4IJCA 4ATDA 3BE7A 1LG2A 1EF3A 4URIA 4B3ZA 4W89A 2QDEA 1RPKA 3H7RA 4WOZA 1LORA 3RX4A 4C6JA 5T26A 3PWIA 1OCBA 2WQPA 3B0VC 2H8XA 1XKYA 1GVOA 2QDHA 4LV9A 2H8ZA 4LUIA 4H7ZA 1VQTA 2J75A 2YL5A 4KGLA 2BY1A 4QJ3B 2DUXA 4KCWA 3CIWA 1K7XA 4TV5A 3WSUA 4DX3A 4QEHA 4QNEA 1VYRA 2VX7A 3SM0A 2GUUA 3U9IA 3LB0A 1POKA 3VDAA 2XFYA 5JBFA 1T99A 3W1UA 3JZUA 2YIHA 1F73A 1HVQA 1P0EA 1AL8A 3PUEA 4DBDA 4WSJA 3QLLA 2DORA 3W87A 1CTNA 2XN1A 2YA1A 1DEDA 3PBVA 2UY4A 3NJ3A 4J3VA 3Q2DA 1KBLA 2OYKA 2DT2A 4DEFA 4K37A 1E4NA 3A24A 4FNRA 1QI0A 3CH0A 1O4UA 5CAHA 2GOUA 4JQ1A 2XFWA 1FFRA 1WE5A 4EOUA 4QHRA 1HKJA 1D3GA 1L6WA 4C6BA 1N82A 4O52A 1FKWA 4J40A 1KQZA 1V02A 2CCRA 4K8EA 5A2BA 3VIOA 3Q65A 1IEVA 3L68A 4EAMA 5BWAA 1V03A 1XIMA 3DYPA 3PFMA 2YKKA 3GLCA 2WCSA 3H2AA 1GVIA 3AJ7A 3F5LA 3CHDA 3ME3A 4KIRA 1U1UA 4GI6A 1SYTA 3JVAA 3ZS4A 3UCDA 3DG3A 2QMKA 3TSBA 1DQUA 4AWSA 3VGFA 4XD5A 3LGGA 3M0MA 1W9XA 2WMFA 1UD4A 2WJZA 4BF7A 4ZO8A 1XC6A 1JCXA 3PAJA 1EGVA 1MXDA 1CW2A 3HG5A 2YA0A 2QGHA 3UZXA 4QAIA 4X3ZA 5AC5A 4Q3MA 3M41A 1PO9A 3MTWA 2HQAA 1OABA 5F7UA 5LA0A 4AQLA 2C7FA 3PJTA 1N2VA 5HJLA 3ARPA 1TWWA 2BVYA 2VX5A 1VB9A 2V2HA 3OIHA 5IXEA 3H12A 1EEPA 5AC6A 4XAGA 3SJ3A 3UJ2A 4N7QA 2J7GA 2A6NA 1KFLA 2XTKA 4OBTA 2CBUA 3VAVA 3GG1A 3KL5A 4RE0A 3WMLA 2OWXA 2QUNA 1UIOA 1H51A 1VPYA 4S23A 4PMJA 1H7NA 4Z1CA 3QTGA 4PGLA 4N6EA 1P1MA 3E0VA 3EYPA 4PUKA 5F1UA 2B81A 4JDYA 1I60A 3DGRA 3GYCA 2ZRYA 8CGTA 1P0NA 1KTCA 1L8NA 3FA5A 1EEXA 2EKCA 3AXKA 2V9DA 4JX5A 3L4UA 4ZTYA 4TMCA 2FGBA 2C91A 1GYLA 1O7AA 4AD5A 4WVXA 2G3JA 2IQ0A 3LS9A 2OT1A 4C6PA 2QDDA 3FHQA 2OVLA 3GAYA 1U83A 1TUFA 3G77A 1QI2A 1H41A 1AW2A 1FWNA 4JS3A 1XDMA 5HATA 2WVVB 2IKJA 3Q58A 4DELA 2PWFA 1JUEA 3UESA 8TIMA 3JRKA 2XU2A 1JULA 4LUSA 1B2YA 4LCRA 3NDZA 3MUZ1 1ZUAX 3R8GA 1VEPA 1WAUA 4LBRA 4G7EB 3RN6A 1OFPA 4CU6A 1JDCA 1TPWA 3ZQ9A 3C2VA 2QR6A 1Q3NA 3KP1A 4LSBA 4NZ1A 5A8OA 3URBA 4L56A 3P2VA 1TPFA 1C7SA 3EBVA 5DBTA 3C0LA 2EG7A 5T9BG 1X8FA 1PX4A 1YTDA 1K6AA 1XD0A 1FWWA 1E15A 4ZB5A 3AU6A 4KEZA 4AU0A 1B57A 4H9MA 1ZCOA 4I3GA 3S4TA 3EB2A 4XB3A 4X60A 4GGBA 3UFYA 2DT0A 2FQIA 3CXOA 5AYZA 3NM3A 1DWIM 1QPRA 1TELA 4QR6A 1FWFC 1US3A 4S38A 3PBUA 1NP2A 3IIVA 1H63A 4OU1A 2ON3A 2FZMA 2NQ9A 4XSLA 1OYCA 3CGTA 3NZRA 2Z00A 4GY0A 1C91A 3AXMA 3S1UA 4K38A 4AW7A 1BKHA 3N2CA 1Q6GA 1M53A 5D33A 3GDRA 3OZYA 1C8YA 1MXSA 4O8RA 5BXTA 1H11A 4A3QA 2DZXA 4LF2A 4C6QA 2BLEA 1NOUA 3TLLA 1ONEA 3PBMA 1ELSA 4WUIA 5DEZA 3CH9A 4DIAA 3AIWA 3SEPA 4GYKA 1TO3A 3UG5A 1J0HA 3GH4A 3VNIA 3MCNA 4KRUA 3WUEA 4IP4A 4W85A 3K4WA 4B2DD 5LIWX 1T8XA 2HRWA 5CJ5A 4EF8A 2H3DA 4GFSA 3WLQA 3S1XA 2I7GA 3V35A 4YTTA 2ZRWA 1ITQA 1JCJA 3TN6A 3HG3A 1SZEA 3Q94A 1V7YA 2YW4A 3UPWA 1OGSA 3V5FA 1EJ7L 4NNBA 1RK5A 4L64A 1DTNA 1RD5A 3VD3A 1EP2A 2BP1A 1R2TA 1RR2A 4CQ9A 4GC4A 2Z0IA 1EJRC 4RV3A 3VNDA 4XBJA 3K30A 4FXJA 2PRHA 3GC4A 4HJWA 1FXQA 4RW3A 2FVLA 3PSVA 1VJSA 3APYA 1QW8A 4EACA 3KBVA 1LUCA 3SRKA 1IWAA 3VXGA 2XWDA 4MZ8A 3VFLA 2HK1A 3RO8A 4F40A 4HN8A 4B2DA 1SO4A 4XX6A 4S3EA 3ITYA 4S39A 1HL8A 1KM6A 1OT2A 1X6LA 5CZJA 2YZRA 3W82A 1CXIA 1K4HA 4LVAA 1LRTA 2YBUA 2XYLA 4ZQPA 4XISA 3B9AA 2NUWA 3C86A 1IWBA 1T8QA 1UOZA 1XYBA 2E8YA 4GISA 4XUYA 1ZJBA 2FKPA 1BSLA 4J3UA 2D1ZA 3WF0A 2VZSA 4HHHA 3GWQA 2OQLA 3VOCA 3KHDA 1EA0A 1W3LA 3GVGA 4LYPA 2OOGA 3O7UA 4JQ3A 1KXQA 2WXDM 4XKMA 3FYPA 2GPTA 1H5VA 1X1OA 3LHYA 4BCEA 1M68A 2PF8A 2OZ8A 4GABA 4P7RA 4HZ8A 1FWGC 1M04A 3O6DA 2BY2A 4B91A 3E0IA 4HMEA 2VFGA 4H9VA 3WF3A 4XZMX 3VGHA 4E8DA 4Z2GA 1JXKA 3WBYA 4J4KA 1X7IA 5DLCA 2OODA 4L6HA 5KMYA 3HG4A 5LNWA 4EXAA 4ZFMA 2J25A 4IXHA 3HPAA 5AYIA 2Y85A 4EKJA 3LRLA 3GDLA 4HU3A 1J10A 5E0FA 5AFDA 4LVDA 2R9RA 3HBLA 5J5RA 3VNMA 3OHMB 4NX0A 1ICPA 1SVDA 4DLFA 4IH3A 3CU2A 2WHKA 2V3EA 3W7RA 5J04A 3N4EA 4N4QA 1CXLA 4XWUA 1Q6QA 3E5BA 4MWAC 3E02A 2XFRA 1IQ8A 2HS6A 3VFCA 1K8CA 3PWAA 4AD0A 4AHOA 1TRDA 1CB7B 3OVQA 2PTYA 4UFHA 1VFFA 5CPLA 3KRBA 3UU0A 1UROA 1YW1A 3AXXA 5DF0A 2R6OA 4DUWA 4Z17A 3ITLA 1UUQA 2WPBA 3R0KA 2J62A 3NGFA 3NURA 3KUMA 1O5KA 5M2FX 3WEOA 4MG4A 3LXCA 5LNVA 3WDIA 1NTHA 1T5AA 3QC3A 5HR7A 1VEOA 2QCNA 3UF9A 1GG1A 4U33A 5AHLA 3TE9A 1NEYA 4UTJA 3F1QA 3TWAA 3N11A 4DHGA 3ZT5A 4WZHA 4GZEA 4AF0B 1JZ3A 1XIBA 2R82A 5HQLA 1XDJA 5GVJA 2X1UA 1IEXA 1NFPA 4D72A 4R3UA 4NRSA 1RCQA 1UIPA 1VPXA 1WQ5A 4LANA 1KBIA 2OLHA 2HXTA 3I3DA 3DC8A 2BOFX 4O8AA 2PZ0A 1V3IA 5CJMA 4MKVA 2HVNA 4NZ5A 1F5ZA 5HJYA 2G95A 1H4PA 2E7FA 3EB3A 1QOQA 3M43A 3WUBA 3AO0A 8XIMA 4M51A 4M6QA 3FJLA 4DBUA 2G97A 2V2CA 1DHPA 1EKOA 1XCFA 3A4XA 3SUUA 2HZGA 2WSPA 3ZFHA 5IBXC 3WNLA 3EMZA 1VHCA 3G3MA 2W79A 2Y5SA 5F4SA 2XINA 5HULA 3MO7A 3W2MA 1W31A 1UBPC 4MM1A 4U5IA 3DESA 4UR8A 3NNTA 2YLLA 2BSLA 1Z48A 2PBGA 2QMJA 4I9MA 1DOSA 3DFTA 3MP5A 3M0JA 3UWYA 4LC6A 4B3LA 3B06A 4NU7A 4B92A 2D22A 4NKCA 4MB5A 3MZNA 3UXDA 3LCIA 4US5D 3RU6A 3CZ8A 2ZRVA 4GQRA 2ZZ3A 2PDUA 1THFD 2WSKA 3TEVA 3ABOA 3PS7A 5FJRA 1QI4A 3QVQA 1TWIA 3E6EA 4JQ2A 1I4NA 1T7LA 4NIRA 3SADA 4HU8A 4JTHA 1OF8A 3M0XA 4EPDC 3GXTA 4G1KA 4QDPA 3ZT6A 1WNOA 3TTQA 1W5NA 3C52A 4GYFA 3MI3A 4CD7A 3L0NA 4WLCA 1VPQA 3NCOA 3N9RA 3VNZA 1B0IA 3ABRA 3SJNA 1W1ZA 3TR2A 3RITA 5C54A 4US5A 1ZENA 4MNLA 2X1RA 1UP0A