1I60A

Structural genomics, ioli protein
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
278
structure length
278
Chain Sequence
MKLCFNEATTLENSNLKLDLELCEKHGYDYIEIRTMDKLPEYLKDHSLDDLAEYFQTHHIKPLALNALVFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIVKEEIKKSSVDVLTELSDIAEPYGVKIALEFVGHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAMGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVWPGQGAIDLDAHLSALKEIGFSDVVSVELFRPEYYKLTAEEAIQTAKKTTVDVVSKYFSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords IOLI PROTEIN
publication title Crystal structure of Bacillus subtilis ioli shows endonuclase IV fold with altered Zn binding.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 110
structure length 278
sequence length 278
ec nomenclature ec 5.3.99.11: 2-keto-myo-inositol isomerase.
pdb deposition date 2001-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1i60A00
3OBEA 4G56A 1TZ9A 4US6A 4XSLA 2NQJA 5EMJA 4K3ZA 1MNZA 3DX5A 5XIMA 3AAMA 4HHLA 3C0SA 3QYSA 1CLKA 4XIAA 3BANA 3KBVA 3KCLA 4XKMA 3VNJA 3ITTA 3BZGA 1XYLA 5TNVA 2I56A 1YX1A 2QW5A 3QXBA 2HCVA 3M0HA 1XINA 4QDWA 3NGFA 5EMMA 5B7ZA 1XIIA 5H6HA 5C9ZA 1XIMA 3XINA 3UXIA 4OVXA 4ZBCA 3C0LA 2ZVRA 3IUIA 1XIJA 1XIBA 3P6LA 4X61A 2X7VA 1XLDA 4GQBA 5AVNA 1XLJA 4A8LA 3ITVA 3XISA 4J4KA 2X7WA 1O1HA 1XLGA 2XISA 1S5MA 5FA5A 2NQHA 3GNXA 4EACA 3U0HA 1D8WA 2GUBA 4GJIA 4HGXA 5AVHA 1XIFA 3VNLA 1XLMA 3U3HA 6XIMA 5EMLA 1DE5A 3KBSA 2GLKA 9XIAA 3KBWA 3CQJA 4Q7IA 1DXIA 3M0VA 1XLKA 1XLCA 5B7YA 4E3VA 1QTWA 1XLIA 3M0LA 4QE4A 1XLAA 1S5NA 3VNIA 2G4JA 4XIMA 4X60A 3ITOA 3L23A 3KTCA 3VYLA 1XLEA 8XIAA 2HK0A 3CQIA 1A0CA 5XIAA 5XINA 2XINA 1XYCA 4HNOA 1DE6A 1XLBA 1XIEA 3ITLA 1DIEA 4PGLA 3WQOA 4ZB0A 4A8IA 1XLHA 3XIMA 1A0EA 3LMZA 3M0YA 3CNYA 5I7GA 1MUWA 2QUMA 1BXBA 3IUDA 1QT1A 1XYMA 1A0DA 1XICA 9XIMA 3CWHA 2GVEA 4QEHA 4XSMA 1I60A 3ITXA 4A8NA 5H1WA 3P14A 3AYTA 3KBJA 1XYBA 3M0MA 2Q02A 3KBMA 4K1GA 4QDPA 2QUNA 3IUHA 1QUMA 1XP3A 4YTSA 4HHMA 3UA4A 1XLLA 3N4AA 2I57A 2J6VA 2OU4A 6XIAA 7XIMA 4YTTA 3UVAA 3KCJA 3QZAA 4GLEA 2G0WA 3AYVA 3KBNA 3M0XA 5EMKA 4PFHA 3TC3A 3TVAA 3UU0A 3VNKA 1BXCA 4DVOA 3AALA 3BDKA 1XISA 4X63A 1OADA 2XIMA 4XISA 4YTQA 1DIDA 4EAYA 1GW9A 2HK1A 4GJJA 5J8LA 3BZJA 4W4QA 3CQHA 2NQ9A 3FVMA 8XIMA 4YTUA 3JU2A 4QE5A 1XLFA 1XYAA 3CQKA 3KCOA 3KWSA 2QULA 1XIGA 4YTRA 1I6NA 5B80A 3UA3A 3BWWA 3ITYA 4KW2A 4DUOA 1K77A 3C0QA 1XIDA 1XIHA 3QC0A 4QEEA 4LNCA 2ZDSA 2GYIA 3DBNA 4ZB5A 4ZB2A 3VNMA 4QE1A 4A8RA
chains in the Genus database with same CATH superfamily
2PP3A 4Q8PA 2CLMA 3TLLA 5XIMA 1NP2A 3AS1A 3ISIX 3N9RA 1VP5A 1WZMA 3C2FA 1UKSA 2BVTA 4BQ2A 1OINA 4KMQA 4XBSA 1E71M 2D20A 4B5SA 1LJYA 4DZHA 4DJFD 3GXIA 4ZFCA 2B4GA 1N82A 4XD3A 4C91A 4CVUA 3B0YA 2A6NA 1KFEA 1J6PA 3AIBA 3V7PA 1HKWA 5F4XA 3RCYA 3VD9A 5AHIA 1JPMA 5FF7A 1JZ5A 2WHKA 2CBIA 2ZA3A 4IFRA 3S83A 4FX6M 3CAWA 1FCQA 1VFOA 5CJNA 3B9OA 5U4NA 3GXFA 4JGDA 1EHNA 3BOXA 3LHVA 1Y5XA 2YDRA 1IWPA 4HU3A 3VD4A 3KOZA 4D6HA 1VEMA 5CSUA 1QOXA 1XBZA 3B04A 3GVVA 1UWQA 1XW8A 1Q5MA 2ZUUA 1TUXA 1K70A 3K8MA 5HJYA 3HPXA 3CEUA 4NIRA 4PMNA 2GYIA 3SGZA 2WYSA 3W2MA 2HE5A 2ZZ7A 3GC2A 4H8NA 1I0DA 2EQDA 4AWEA 2DGAA 4YXGA 4Q4OA 3ARPA 1R3YA 4MAVA 1QI5A 4CLMA 3HGRA 3VO0A 4Q8MA 3LM7A 5E0FA 3LBOA 5BWFA 1VBGA 1E6SM 2ABAA 4J3SA 3OLIA 3DHPA 2PDYA 3LLXA 4B3ZA 2PRMA 3GIQA 2H3DA 3SBFA 1AA1B 2EPHA 4YWIA 1O95A 2G3FA 3QJAA 2XSBA 4C1LA 3B0XA 1V02E 4G1NA 4O1CA 2RKXA 4ORMA 5AB3A 4J2MA 2D0HA 2WMKA 3AICA 2HV5A 2J6VA 1RA5A 3SN0A 1CGTA 3P2VA 4A6GA 1DOSA 1RK6A 2X41A 1TPFA 3WDHA 5I07A 3VOGA 3EWBX 2GUUA 1B3OA 1QXLA 1PZ1A 4Q3MA 4CKQA 1T8XA 4DX3A 3JU2A 3S2MA 1UP2A 3URAA 1S2WA 4S2CA 1KBKA 3GR4A 2A3BA 1YTKA 3VIHA 5CH9A 2NSOA 3BJFA 5H8PA 5I3HA 2ISSA 2VD8A 5M17A 3I4KA 1UUOA 2AL2A 1V6TA 1X6NA 1OEPA 3GTXA 3GNPA 3USZA 2WBKA 4MFEA 3R43A 1R46A 2QF8A 2Y1HA 2HNHA 3RO6A 4NJKA 1J10A 1D9EA 2Y5SA 4KWOA 4WXZA 3F7JA 1KXTA 4ZOAA 3L7RA 4A29A 4BJHA 4ZE4A 3IVSA 4KFOA 1XLGA 4IG2A 4O13A 1S5MA 3CYVA 3QR1A 2IXUA 3KOXA 3SCQA 4JPGA 4U31A 1DHPA 3EX3A 3U7VA 2CLHA 3OA5A 4EVZA 1VJZA 1BXBA 3TONA 3CHFA 1UB3A 2OEJA 3Q94A 2Y5EA 5H1WA 1R3SA 4ZQCA 4LCRA 3KBMA 2VFHA 4JIQA 1EJTC 5A6BD 3CZ8A 1XLLA 3BAJA 4UB9A 4AHPA 2C3ZA 4J3VA 3W6MA 4N02A 2VURA 3NTYA 4JFUA 2ALDA 3OW1A 2R24A 2QHAA 4NQ1A 3CH9A 2IKHA 3NQAA 3ALGA 4JTUA 3PBYA 1H7RA 1JCJA 4GUFA 1US2A 4N0RA 3T1GA 5HNNA 2DIEA 4O1AA 1G0CA 1HL2A 2D3NA 5IFTA 2NXIA 3WELA 5K9XA 5DRCA 4JTJA 4AVOA 3SRFA 3U6WA 1SZGA 1XH2A 1OSEA 4GI6A 4XAFA 1RBAA 2RUSA 4MNJA 3NA8A 5G2WA 1QMLA 4HU0A 4Z17A 3HPZA 2OYLA 2Z2BA 4GH3A 4A3YA 2TMDA 5E9XA 5C9WA 3T2PA 2E6YA 3LCIA 4N4QA 2CLKA 3O06A 1UD4A 1XYCA 4JY8A 2J88A 1EJVC 3KFTA 5IFPA 3WDJA 1PWLA 5CSYA 4G6CA 1Z3NA 2PDPA 2CWNA 2GJXB 3WQCA 2BXVA 4H04A 4AF0A 3B4UA 2PWHA 2B7PA 1I4NA 3K2GA 5EY5A 1SJCA 4LNYA 3GXPA 3WNLA 4PFHA 1VR6A 3B9NA 3TR9A 3N25A 4U3CA 3AHVA 3DH7A 3VKBA 1E4IA 3USBA 3O63A 3OVGA 3UZWA 3N19B 5FOOA 1W3LA 5H8MA 4RPPA 5K2ZA 1GVEA 1TMHA 4V1XA 1VBRA 1H62A 3EPNA 3IJQA 3HZ3A 2YOCA 1F05A 2E6FA 4US6A 3DX5A 2PDKA 2DSWA 4ZOBA 1BF6A 4F3HA 2UY4A 3ITTA 5FF3A 2Q01A 2UV8G 2GGIA 4QSHA 3ALFA 1VHNA 2F9RA 4LVDA 4H9MA 1H61A 2FFIA 4QRNA 3L4WA 2A5HA 4XZBA 4ICNA 4N9CA 3LV6A 3S1VA 3W0KA 1NWTA 1MQRA 1Q8AA 5JXQA 1QW9A 1QI4A 3LK6A 4HNNA 3U2ZA 5E9AA 2RDXA 1XLMA 2J13A 3VOIA 4QDMA 4BQ3A 2FZBA 3KHJA 4PUMA 4DYEA 4IMGA 4NF7A 1OWQA 1F3TA 5EFDA 2WOQA 5DANA 5DY2A 5M03A 4FNUA 5HUPA 3IUDA 1W1IE 1X8FA 4MIMA 5I78A 3DG6A 1HIZA 4M3PA 4UOQA 3VMNA 3DESA 2E9LA 3UA4A 4MKSA 3DGBA 3L4UA 4DNHA 1AD4A 4C7GA 1W1TA 4AU0A 1GVRA 2VTFA 1E1CA 3RRAA 1O94A 5A8NA 1I6NA 4PMUA 5HQLA 4JFVA 4S3FA 4JX6A 5HR7A 4QISA 1KW1A 1EX5A 1DWHM 1GPFA 3M0KA 1BYBA 3Q67A 3BV4A 4NXSA 3HURA 3S1WA 2WSPA 3C4UA 1CXEA 1SPQA 3GXMA 4PULA 5REQB 5FJRA 1AL8A 2DORA 4PTXA 3C0LA 1DEDA 1KKRA 4QXIA 4ZCWA 1QK2A 1G4SA 3GVGA 4FI4A 4J4KA 5HPCA 1B4KA 2DU2A 4GISA 4POCA 5AVHA 5FEPA 4QBXA 1QAPA 1E55A 3ITOA 3E2VA 1JYVA 4JHZA 1K9FA 4DXVA 2FZ8A 1KGWA 2ZRWA 4OHQA 1RVKA 3P3BA 3VGHA 3AI0A 4DJEA 1E72M 3R8HA 2X1SA 2J75A 4GUJA 1KD0A 2WKJA 2HXUA 4I7WA 3BPWA 2YL6A 4KWUA 3O6DA 1V02A 4LUJA 5I6SA 1WNOA 4GYPC 4GG9A 2XJ7A 3O7UA 4GA8A 1JCMP 2UY2A 3TVAA 5I24A 1OABA 4LB3A 3UCDA 3PPFA 3FNDA 1AK5A 5HQEA 4FLOA 3LD5A 3LHUA 1F61A 4XWUA 4Y9AA 2ZA1A 2PDGA 4Q22A 3EDJA 1RVGA 1FXPA 4H7VA 3OVRA 4UQ9A 5HJXA 3O3RA 1CX9A 3SGUA 3M4HA 2DY3A 4FNSA 1J0HA 3WLMA 3C0JA 3UXKA 1J12A 1TA3A 5D09A 3L4XA 2ZUMA 3T81A 5CBJA 3UZYA 3QGKC 3PM6A 2PDUA 2WJDA 4PMXA 4C1NB 1SZFA 3C8NA 3H7RA 2V3EA 4HPXA 6XIMA 2C1GA 4HPHA 1DXIA 1ZALA 3BGGA 4HCDA 2VR2A 1JCXA 3WDRA 3NOEA 2BV9A 1KFWA 1VCGA 1EQPA 4MZ1A 5CEWA 4DPQA 3IAPA 1V03A 4RNIA 3ZWSA 4PBGA 4JCMA 2R1LA 3ZIZA 3EWZA 3IGXA 1E1EA 3QH2A 1IEVA 1HGYA 4Z08A 2OR2A 4Q8TA 5HDRA 1OZMA 1W1PA 3QLLA 4GVGA 4FA3A 1Q6GA 3TQPA 3EXSA 3PPCA 3TOYA 1UWTA 2E9MA 4K7VA 5D04C 3PSVA 4AIBA 4Q33A 1FVPA 1UD3A 3Q2DA 4KETA 1LLWA 2DQXA 4EXAA 2HSAA 1EJSC 5C5YA 4S3CA 1VBUA 1SZRA 4NZ3A 4N4PA 1AH3A 3WJZA 4YPJA 1Q7ZA 2DZVA 3DYPA 4R88A 3BTNA 3S1XA 3CT2A 3V0UA 1CENA 2PZNA 3W7JA 3GHUA 1G01A 3VC6A 4ZO6A 2FVLA 3VI2A 3BG3A 1T5AA 3WENA 5LA1A 3ZT5A 3HU7A 5TNVA 4S39A 5DMNA 5HA7A 3AS0A 5GVJA 1IV8A 1FDYA 3MSYA 5AHMA 3G22A 4EOUA 5DO8A 4EF9A 1UMYA 5JQ9A 5AC5A 4C6IA 1MFUA 3L9CA 3ME3A 4AHOA 3WJSA 2EKCA 2VUYA 5HOSA 2DEPA 1HXJA 3KTCA 3IIPA 2DT1A 3OZPA 1Z44A 3PPHA 1OX5A 3A4WA 3H2CA 2XGZA 3L5AA 5HNTA 2AMXA 2VZSA 3CC1A 2V3FA 4K39A 3BMXA 3URBA 1D8CA 3G6MA 2VM8A 2WZIA 1ODUA 3F5JA 4UQBA 1KRMA 2PZ0A 3UZZA 1QPOA 2FVKA 2YB4A 5I3GA 3COTA 4DXXA 4Y9OA 1GVSA 1XUZA 3QY8A 3BSMA 2XIMA 3GC5A 1FFQA 1GQKA 4FNTA 3T4WA 1QASA 4L9YA 1VHCA 4HP5A 3DDMA 3G1SA 1PTDA 3KM8A 3I3EA 3A4JA 4UIOA 2C15A 3N4EA 1KTCA 1GJWA 2DPEA 3GIPA 4MB4A 5AOUA 4C6MA 5AY7A 4NAEB 1B1YA 2WK2A 5T26A 4J35A 4BCEA 1QHPA 3R0DA 3R8GA 2C71A 2Y5JA 4DJFA 1M68A 5G1YA 4RE0A 3KP1A 1TWDA 3CHCA 3NQFA 1D7FA 1BVWA 4QE4A 3TYEA 3V1PA 2VFIA 3G8RA 1L9WA 4OTKA 5XIAA 3GW0A 1GQLA 4PMQA 4RZ4A 1Y0EA 4GZ7A 5JBEA 4LAZA 1C7SA 2QCCA 1PZ0A 1IXNA 1OFEA 3U5YA 4ATWA 4NNAA 5D9MA 4EANA 2ZQ0A 4I9AA 3K5XA 4E38A 2CIPA 4ZE5A 3TMLA 4E4PA 2YXGA 3RFAA 1G69A 3CJPA 1ZJBA 1RSCA 3N9KA 3I68A 2VX7A 5CKSA 5HINA 4FX7A 3TA6A 5BXTA 1TTQA 5CCZA 7TIMA 1VFUA 3AHZA 2NLIA 1OG6A 2V5KA 4HHPA 4RE2A 1F73A 3C0SA 4Q32A 4UTJA 2GJPA 3NL2A 4D6JA 3PULA 2JF7A 2QJHA 2DSUA 1U30A 4ZVJA 3T8QA 3UJ2A 4ML4A 2Y61A 4HHHA 3CLWA 3TAOA 4LXFA 3W07A 5GJPA 4F0HA 1GZJA 3QQ1A 3AIQA 3MS8A 2VMFA 3O16A 4Z1YA 2WC7A 1QNRA 3QPEA 2R1NA 5M1TA 4AY8A 1EXPA 5F4WA 1WDDA 2NSXA 1MDRA 5F4SA 3MJYA 1OYBA 2VENA 1P4CA 2VELA 2QLYA 2V2CA 3E0FA 2ZA2A 4E2BA 1ZHAA 1P7TB 1W9BM 1ICPA 1R30A 4DBDA 4LRSA 1M41A 1I60A 1GOXA 1OD8A 5CGQA 3HFYA 3HBLA 4LAMA 3GU1A 5CJ5A 1JG9A 4JDYA 4S3KA 1MRAA 3MZ2A 4L9XA 2YDSA 3D46A 1NDWA 3WF0A 2PDIA 2AKZA 1EYWA 1XBVA 4IPPA 3ZWTA 1HF6A 5K4XA 4GJJA 2AGKA 1A47A 4NAFA 2A4AA 2PCQA 5DEZA 2FMNA 5FL0A 3R5EA 4FR6A 3G1RA 3TU9A 3WK1A 3CWOX 3LN3A 1WOBA 1UZ1A 1QI0A 3QSTA 3UFYA 3VVGA 3N11A 4FB7A 1M5WA 2Z1KA 4FXFA 3H4WA 4UTWC 3E6EA 4D8AA 1R9YA 1TPWA 1TSIA 2EPKX 2UY5A 2O9PA 3QPYA 1IWBA 1NWSA 1EZWA 3W29A 1SO6A 1Q6DA 2X16A 3U7BA 1JDFA 3W84A 2VX5A 3ZVIA 3CV7A 3UJFA 2WSRA 1RCQA 1UJQA 3WL1A 3CHEA 4NVTA 1M9HA 1BQCA 3L0GA 1DE5A 1YMYA 4PE8A 3NQCA 1XWYA 2QQ6A 2VCBA 1OFAA 2E3ZA 3K4DA 2NW0A 2WVTA 1H63A 3MDWA 4JY9A 1KR1A 1EBHA 4LALA 3S5ZA 1XH1A 4U5IA 2DJXA 2YDQA 1TTIA 4ZB0A 3MMWA 1KR0A 4OT7A 1ZB5A 4TTUA 3ZJ6A 3LHYA 4D6GA 3NO3A 4CD6A 5ECUA 4PMRA 2HVOA 3QV8A 4F2UA 4RL3A 3DBPA 1QUMA 2FPYA 3G5EA 4FALA 2D2JA 5M2FX 1AL7A 3P74A 1SFJA 3HMJG 1I2RA 1ADSA 4UCGA 3CO8A 4QHRA 3W2JA 3QY6A 2ZBTA 4D8LA 3PUDA 5KZDA 5AZ0A 3W1LA 2PA6A 3TQKA 2YW3A 1JR1A 2BB0A 4PMJA 1ICQA 1WBJA 4B5NA 3LCXA 4DNMA 3PJUA 2ZZ4A 1EJUC 2XVGA 1DV7A 2XVLA 3PN8A 1RBLA 5T91A 3T55A 5C2CA 3TP4A 4E8DA 2QYGA 3OU8A 2ZUTA 2ATMA 2BOEX 1T8QA 5BOOA 5FF4A 4HCLA 2PWDA 2BY2A 2BHZA 3WK2A 3B8TA 4L64A 1DJHA 1MWOA 3LSBA 1BHGA 2GUBA 3C5QA 1CTNA 3MHUA 3WFZA 9XIAA 1WDQA 3NL5A 4JTFA 3PNZA 1C93A 1F74A 3AZTA 4DJDA 2J9XA 3N34A 2E25A 5AC8A 3GG7A 4MY8A 3W9ZA 3VCCA 1ADOA 3IIXA 4IPNB 3XIMA 3S2JA 1EP3A 4I3GA 2QV5A 3BLIA 3VOHA 4JS3A 4Y8EA 1XICA 4XZLX 1XD1A 3W86A 4D6DA 1M04A 1OVDA 3DHUA 3A64A 3B0VC 4LAUA 4DJDC 1LOQA 4O14A 3O6CA 3T07A 1R2RA 3EXRA 3OYZA 4BFAA 5LA0A 3HA1A 4IP4A 2G3NA 1RJQA 4KPLA 1R3RA 2E77A 1PX8A 3W7QA 2QJNA 3W28A 1CZ1A 2XIJA 1QO5A 4CD5A 1I2OA 1W1VA 1UUQA 1ZAHA 4ZL1A 2Z29A 3SCNA 4C60A 1MO0A 3N3TA 1VEPA 4L1XA 3VNDA 4CCEA 5C55A 4UC5A 4R27A 3WEMA 1E6PA 2FHBA 4LYQA 3F4CA 4D6EA 3W53A 4PCPA 3CBWA 3TTOA 5T8GA 4GCAA 2BXYA 1JD9A 2IPFA 4HTYA 1Q6OA 4FF5A 5LYRA 2WB5A 4OBSA 4A05A 1X7IA 1ALDA 2IKIA 4JTKA 4IIBA 4AD3A 3NQ8A 5FD0A 3T7VA 2YCLB 1DJYA 3FDKA 4O0QA 5EB8A 1UBSA 1CLXA 5HR6A 3V5FA 1QHOA 2QAFA 4WR3A 4FHAA 5ENLA 3DKJA 3U3HA 3PC0A 4HMEA 1PHQA 1A5CA 4EPBC 2OZTA 4QROA 3P8JA 1FHDA 3HQ1A 5GPRA 1AODA 1HNYA 2A7NA 4X60A 1FWRA 1J5TA 1JAEA 5PTDA 2QPSA 4QCEA 3OLEA 2BS9A 1BXNA 4RK8A 2BG5A 1H0GA 3CNYA 3UG4A 1OF8A 3H55A 3WMSA 2QDEA 4XSMA 4FOUA 4BWLA 3WD1A 3ARXA 4XKYB 3PZTA 1PPIA 4IQJA 1W32A 2BASA 2VFDA 3VKDA 2NQZA 4TO8A 4YTTA 4JTQA 2YBUA 1H51A 9CGTA 2E1DA 2A0NA 1REQA 5E0CA 2E5CA 4IL0A 3PSWA 1VCFA 2NLYA 1JZ8A 2QPXA 2WMHA 1YIXA 4DBSA 3AIWA 1CDGA 5JBDA 1QCWA 3ID7A 2YSWA 2PODA 2Q3RA 4QS6A 1BD0A 2A3AA 2CNCA 1ZUAX 1UR0A 4CU8A 4FLQA 1UZDA 2V68A 1ML1A 2XGBA 4KIEA 4BY3A 3R0UA 4W5UA 2YZRA 4LUSB 2OOGA 4PCSA 3AYSA 1IYXA 4WDWA 3XINA 3KZSA 4AC7C 3P60A 1DJZA 2OSWA 1XIJA 1B3XA 2CLEA 2QPUA 1XCWA 4KKXA 1J8VA 4HCHA 4J2PA 4BS0A 1E3ZA 1ZCCA 1J01A 2QMKA 2Y2WA 4PCNA 4QJ4B 4RNFA 1XFCA 4P7LA 1IZJA 2V69A 3OP2A 1QR7A 2QS8A 2J7CA 1FKWA 4CQ8A 3AWNA 2PTYA 3H53A 4M29A 4JTSA 2C14A 4JQ4A 2CLOA 1TPEA 2YL5A 4HZMA 3W2KA 4CCDA 1JQXA 1L6YA 3VC5A 3N17A 1EEXA 4O15A 2ZRUA 3BARA 3IV8A 2CZFA 2YW4A 3EKZA 4Z0SA 3WMBA 2WVVB 1F8IA 2ZX5A 4W89A 3S46A 4ADTA 3VGBA 2KAUC 4ICCX 4NNCA 3BJSA 1Q7QA 1SGJA 1K7XA 2GVJA 3ICJA 4AB4A 1V93A 3OBEA 4Q8WA 1R85A 4ZA0A 1HJVA 1WDRA 2Y7EA 5EMYA 5IRPA 3LHZA 2DJLA 4JTHA 1XYLA 4UOJA 1SR9A 3WH5A 2ZUSA 3PTMA 2ZZ2A 5A2BA 1ZBWA 2ODOA 5G1MA 4JKMA 4MAZA 3T44A 3HQPA 4EE9A 4IXHA 3VU2A 3FA4A 2O7SA 1NOUA 1Q6QA 2QF7A 1KCZA 1XSJA 3R58A 1JI2A 2WSYA 4XG1A 3FKKA 1UROA 1J0IA 2VNCA 1UWAA 3NM1A 2X0HA 3E12A 2P0OA 1P0DA 3WLLA 5BOFA 4O52A 1SSGA 4AZHA 2YCEA 3LX9A 2GQ8A 4M1BA 3U48A 1TWWA 2CCRA 1QPQA 4O1FA 4EWND 1E4MM 2O9RA 5LNRA 2HMCA 1YYAA 2GSEA 1E40A 1EWEA 3L5MA 4XB3A 4ZSTA 4AD1A 1NAL1 3KOWA 2DUZA 3ECQA 2L5HA 1R3TA 1XH0A 1ISVA 1QK0A 4QLLA 2W6RA 3P62A 3A5VA 4CEUC 3FX4A 1K9EA 4L6HA 2BXZA 1UG6A 1L6WA 1UKTA 3LTPA 1LZOA 2X0SA 2VD9A 3MWAA 2J8GA 4ZOEA 5M5DA 4AH7A 1CT5A 1JZ4A 2Z1XA 2VZOA 4GD0A 1WX0A 1ZJAA 4W7VA 4M19A 1JL8A 2Z6IA 2RJHA 1BGAA 4LUTB 3BAIA 1UPMB 3GG8A 4HKPA 3EB3A 4W86A 1TTJA 3L4ZA 5KETA 2V3DA 4I9JA 3VOFA 1JAKA 2I5QA 1V3KA 3UNDA 3ANYA 2QVNA 4MSSA 3TCSA 3MVIA 4NX5A 3U0HA 1FH8A 4QQ3A 2HZGA 3S8HA 4DYKA 3MDUA 2Y4SA 1EDGA 2Q71A 3UNTA 1GJUA 1QW8A 3EX4A 3OEXA 1TPVA 2Q8LA 1V3JA 4Z2JA 4AZ7A 3C2VA 5D02A 4L6OA 3UWZA 4UTKA 3C61A 4UNIA 3W75A 4TX6A 4XZ9A 3MUXA 2OGJA 2VHLA 4JEQA 4S1FA 4HZ6A 2OU4A 3C6CA 4MB1A 1E0WA 1TPH1 2XTKA 3QMSA 3G24A 3P80A 2W61A 2WMIA 1KQYA 4K36A 3LI1A 1K6WA 2FHFA 2NQ9A 1C29A 4RE3A 2BWGA 3GTFA 2Z7GA 4DUOA 1O5QA 2QCNA 1FWDC 1UPPA 3THDA 4BI7A 2FMOA 3Q58A 5DY3A 2H9AB 2DH2A 1VFLA 1W0MA 3OGSA 1YRRA 3GIYA 3QGVA 4R53A 1CLKA 5J04A 1HKJA 1Y8BA 2PWFA 3LU2A 3MKVA 1ISYA 4R85A 3D3FA 1J6OA 1K8ZA 1VPYA 1EPVA 4MNMA 5HK4A 4R5EA 3ZLGA 4PBFA 3DKLA 5TD4A 2QT3A 1PL9A 1GYNA 3MO4A 2BFGA 3UF9A 2V9DA 1K8CA 1OFRA 3CEPA 2C7FA 3SAZA 4YL2A 4DO7A 2V82A 5GNZA 1Q6EA 5FCZA 2SFPA 4C6CA 1LM1A 4JTGA 5FIPA 3G1FA 5I7GA 4AZCB 3W7RA 2C91A 3P5YA 1RQBA 4K37A 3W26A 5CPMA 3UJRA 5M3WA 5BXPA 1J11A 2OWWA 5K9DA 3FXGA 3ABSA 5JIWA 2ZXQA 4FAMA 4QITA 2BNJA 4S3BA 4CNSA 4HN4A 4I7UA 7REQB 2VR4A 2RAGA 1EA0A 2VO5A 2BVDA 1LLOA 3R4IA 4AC1X 1TQJA 3ZJ7A 3QY7A 1FWBC 2WVSA 1W2PA 1E51A 3FJNA 4R7OA 4QE1A 4J3XA 1HW6A 3VUPA 1L0PA 5AYIA 1OFDA 3CTTA 3FKRA 2ZZ1A 3SCSA 5KINA 4JR5A 1ZSXA 4XK2A 1LWIA 1XIIA 4HU8A 2G95A 4WSHA 1BFNA 1F4AA 4XZNX 5IBXA 2VDIA 4GIAA 3W70A 3BAWA 4GABA 3UZXA 2A3EA 3G1HA 3P84A 4WZHA 1XLIA 4ZTYA 4JQAA 4W5ZA 3TNBA 1GW1A 3W87A 4OJYA 1EDTA 4M1RA 2P50A 1UH4A 5GQBA 1DIKA 5GNXA 1EYEA 5TQLA 3NYZA 5F1UA 2RDUA 2Q8ZA 3CT7A 1V0MA 2PAJA 1RR2A 3BURA 3NVDA 4MOZA 3REQA 4FLSA 3WQVA 1YE6A 3R7MA 2WKLA 1QNVA 2NUYA 4NHVA 3M44A 4RX0A 2FFCA 4M6PA 4EWJA 3L68A 4Y9NA 3KWSA 2PDFA 2G3JA 3EOEA 4PB4A 4U2YA 1A50A 4O54A 3T2QA 4QEEA 1KBIA 4QIUA 1CXHA 1ZP4A 4C6BA 3WBYA 2WZMA 3A23A 3TXVA 1DPMA 5EMJA 1KBJA 4F79A 5E6ZA 1NELA 2FJKA 4E4UA 1K8YA 2EXOA 2HCVA 1JXKA 3RJYA 4B4FA 2I1OA 5D05A 2CKSA 1S46A 5EL1A 3SN1A 3CTLA 2XH0A 2HS6A 5CPTA 1GOQA 2QUVA 5F2GA 2VFGA 1UWIA 2J62A 3N2BA 4NYUA 2WJEA 3VZYA 4BI6A 3NCOA 4WD0A 3WEOA 2W63A 1H7WA 1IEXA 2PS2A 1WPCA 2FPVA 1EC9A 1DE6A 2QGHA 3DU0A 3I65A 4AWSA 4J1OA 1KM3A 3LTSA 1RPKA 1VFHA 1GOMA 1MYRA 4K6AA 1HVXA 1QO2A 2A6LA 4DELA 4P7QA 2PTWA 2ACRA 3HQNA 1P48A 3NZQA 1LBFA 3PBMA 2Y89A 3G1AA 3VIMA 1FDJA 4NZ5A 2DUXA 1W3JA 1ZU8A 5D32A 3KVMA 3N4AA 4XAPA 3OIXA 2BY0A 2VGIA 3OA3A 3BLFA 2Z0IA 4CNTA 3AOFA 1B31A 3CZJA 1YEYA 3L66A 2DVXA 3ES8A 2MANA 3PUOA 3TJLA 2ALRA 2FIQA 1WUEA 1UOKA 1U83A 1AZ2A 3EPOA 2DZXA 3MUIA 3ZYZA 3IVTA 2EGZA 1PX4A 5LNUA 4YJ5A 3W24A 1E6XM 2Z2UA 3QOKA 1EC7A 4QGCA 5EMMA 3S6TA 1QPNA 4HA4A 2WCAA 1LWHA 5JMUA 2QDGA 2JKEA 1HN1A 2FTWA 3CQ0A 3WIJA 4ADSA 1PAMA 2ZRXA 3ZS4A 1UIOA 3RX4A 2D23A 3WDPP 1Q13A 3GXTA 4CNOA 4JHMA 2RGLA 3DFYA 3CAKA 5BXRA 2DH3A 5AC7A 5HWMA 1RQEA 4G7EA 4YCPA 1Q6CA 4HNOA 5H8UA 4IOTA 3E5PA 4NUWA 4YS1A 4AD5A 1PTGA 3MSGA 5T9CE 2XH2A 3E2RA 2G37A 4N2YA 3IEBA 3GSMA 4DZ5A 3SRHA 1KGXA 3W73A 1TIWA 3CMGA 2DSVA 3S5OA 1XRFA 1XYFA 3NQMA 2VRQA 3E0WA 3H70A 5BRBA 2WM0A 4Z1DA 3HFTA 2AL2B 2DP3A 4L7ZA 5BCAA 5DMYA 2P88A 4HBKA 3GYEA 4H9ZA 4D1IA 4KBXA 4LVBA 4CQDA 3ZFHA 1V6UA 3NO1A 3TROA 2ACUA 2GJNA 1Z9AA 3PZGA 1HZYA 3N2OA 3W00A 4U4MA 3KBVA 1S5TA 1UR1A 1F5ZA 4ZQNA 3P93A 2ISFA 4IG2B 1H7PA 2OZ3A 5TAOA 3W74A 4TVDA 3G0UA 4C6OA 1Q6FA 2HNEA 4X61A 1N7KA 3L2IA 3TKFA 2O7QA 3FHQA 4TX8A 1UD2A 2A79A 2X30A 4Q7IA 4GIYA 1N2VA 4BEUA 4O1DA 4DBEA 1D3GA 3PTDA 4MVAA 4MUPA 1ELSA 4JTIA 2BVYA 1TV8A 3DFHA 3FGCA 1WXZA 4IX0A 1M03A 3UPBA 4YN5A 3B03A 3TLQA 3V4BA 4CN4A 3BQ5A 1DWAM 1XQLA 4LOCA 1E5JA 1OCNA 1XP3A 4UFIA 4DWDA 4PR4A 3DOPA 4GZIA 1MQPA 4Q4PA 2E1WA 3EOOA 2D2HA 1GGOA 4MZYA 4W93A 2FZDA 3VNKA 1A80A 2GGGA 2JBMA 1DIDA 3BMWA 3OPSA 3UP8A 4XUGA 1PKYA 1N8WA 4W4QA 3WQDA 3WBXA 1KFLA 4CNUA 3Q65A 4D71A 7ENLA 4FX8A 4D9PA 4QJ3B 5CSRA 1W5NA 2FKPA 2W0UA 3KL3A 1RV8A 3VNMA 1EDQA 4MWAA 4ML9A 5EBUA 4REQA 4G5DA 1DJXA 1KM6A 4TXEA 3RNDA 3BZGA 3O0FA 4JOMA 4KERA 1XCXA 4F40A 3C52A 3WBWA 4MPQA 3NQ7A 4Y9PA 1XSKA 3PAOA 3IJDA 3PBUA 1IEIA 3AS2A 1TG7A 1W56A 5FJUA 4A2RA 3WJXA 3UR2A 3S9YA 1S1PA 1KM1A 1ZENA 4F2BA 3EEZA 3WJWA 3IPWA 3R11A 4XVEA 4JN8A 1TRIA 3OBAA 3KZPA 3Q37A 4IPLA 4J3TA 2E40A 4AX7A 2E5BA 1JPIA 3IVUA 4KWWA 1ITXA 1TPUA 1U5HA 3TTQA 2ZKMX 1ME8A 3EOLA 4DIAA 1RHCA 2A3LA 4AF0B 3MUCA 4IMAA 4JFWA 1OB0A 2QUMA 1EC8A 4ASTA 3BL3A 2FZMA 1TUFA 3CIVA 1HO4A 4LEFA 1SVDA 2D2OA 4D72A 3VABA 1WKYA 3W7NA 1SO5A 1UD5A 4DVOA 1P0BA 3WF2A 3RHGA 1SW7A 1Q65A 1XC4A 3VZZA 3A9IA 4TIMA 3G1XA 8XIMA 3W22A 4AXKA 2EPLX 4O12A 2DZUA 1OC5A 2GOUA 3APTA 3WQWA 4XD5A 1WZLA 1YXCA 1H4PA 1W6TA 4P8XA 1Q4WA 4CVWA 1I75A 1F6PA 1G94A 3GHTA 5DCDA 5LNVA 2WVUA 2AKMA 2CLIA 2I56A 3H12A 3R10A 1VRDA 3K8KA 5FF2A 4RZ6A 1US0A 3BAKA 2Y7GA 5G4EA 3GG1A 4B4HA 2X7WA 1CEOA 4GOAA 3GBEA 1BSIA 1VS1A 2W79A 3TYZA 1UR2A 3QMTA 1EO7A 3ZM8A 3VA8A 3GBDA 2YL8A 3KXQA 3A9BA 4JYDA 5D9NA 3BV7A 2CBUA 3UR8A 4DPPA 5I23A 3R25A 2EAWA 3MC5A 4XUYA 5A3HA 3PJTA 3CPGA 1UP0A 4Q8VA 3TDFA 1KCXA 2VKZG 4IIFA 1FP8A 1AZ1A 4KEVA 1X1OA 4HHMA 2JE8A 3V18A 3A4XA 3QW3A 3RCMA 1XD0A 2XIQA 3G6LA 3HTWA 1E1CB 1DORA 4B2DD 1NDZA 2CZDA 3VKKA 4DWSB 1UW9A 3RM4A 3KTSA 4ICMA 1XIGA 1M3UA 2NUXA 2ACSA 2YCKX 3T0TA 5C71A 4O10A 4K7YA 3QZ6A 4KH2A 3TIMA 2J9YA 4NILA 4NASA 1GCYA 4JAWA 1TJPA 3E1F1 4K8HA 3A3XA 2EG7A 2PDMA 1THFD 4LS1A 5DXXA 4HSNA 1WCGA 4WSJA 2PLMA 1Q2RA 1JFXA 2TODA 3W23A 2PP0A 2VEFA 1TREA 3VFLA 1LT8A 1DJGA 2VOTA 3F5KA 4LAKA 4HOZA 1K4GA 3QV6A 4M8UA 3LQLA 1YXYA 5IDZA 4L4MA 5HULA 4XV0A 2ADAA 3KUMA 3AMKA 4AXNA 5CXPA 4A3RA 4BF5A 1FWAC 1XBYA 3VPLA 3MY9A 4LY4A 1UWRA 2X1RA 4Y6GA 3VD7A 1K7FA 1X39A 5IHSA 1EKOA 1D7KA 1EPXA 3QV9A 1GYMA 4H9UA 3TTEA 2PDWA 3W7KA 2G3MA 2Y0FA 3WQFA 3OIHA 4ZMGA 4UBPC 4HNVA 3LPGA 3N6QA 2OQLA 1UP3A 1HX0A 1TJ1A 1L6SA 2YCIX 3S2NA 1TVPA 4XISA 4CU6A 1UQYA 1G7VA 1ONRA 4ERGA 3LB0A 1M7XA 3RX2A 3VDBA 4QE5A 1PKNA 2I5GA 3N73A 3I6RA 4Q8NA 2V38A 3FY1A 3LS9A 2OYMA 1JD7A 1W1B1 3EXTA 3BMVA 1M7JA 2PGEA 4DXKA 2VVSA 1TA3B 4FO4A 3WNKA 1JYNA 3DG7A 2P1FA 4LANA 3VKAA 4TVUA 1RJRA 3KLLA 4JYEA 5I02A 1AMKA 4E2DA 3N1AA 1GQIA 3CUHA 2Z24A 2OEMA 4GY0A 4CGTA 3H8AA 4GINA 1ZGDA 1UD6A 2WSQA 5HQMA 5FSDC 4UFKA 2AQVA 1YE4A 4HU4A 1HO1A 1IWAA 3B8WA 4XZMX 3FSTA 4LBUA 3M6YA 5CC3A 1ZY9A 4MFDA 3VD3A 3WLHA 2HROA 3C2EA 1MUMA 2ZCGA 5HMEA 4PCTA 1NOWA 2J27A 3TQ0A 3VIPA 3W1MA 4ROQA 6A3HA 4W84A 1XLHA 2W3ZA 4ZO9A 2XFYA 2D24A 1KQZA 3BC9A 5C9XA 4CD4A 1J96A 1X97A 4S3EA 4GO9A 2WLZA 1YTEA 2BVWA 1I45A 4O28A 4GGHA 3FS2A 3BXWA 2GSHA 4GX8A 4GE8A 3TYAA 4LYPA 4XAYA 2Z7KA 2OT1A 3W85A 2YA2A 3BUVA 1FWEC 1M65A 1ZP3A 5CC5A 1PCWA 5RUBA 2BGSA 3FW6A 2XZ7A 2KX9A 2ZXBA 1U1UA 1EX1A 2HEJA 4GY1A 3Q45A 1FX6A 1PB0A 3PP7A 1Z69A 1VFMA 4ZQPA 4E2OA 3I10A 4KCTA 3TSDA 4H1ZA 2INFA 5CC6A 1H5YA 2GDUA 1XPGA 3CB8A 1EHAA 1WE5A 1MW3A 2PSNA 1NFBA 4UXDA 4AG0A 3O07A 1UIPA 1WYIA 5D2WA 3FV9A 3MSDA 1XQKA 2X40A 2Z26A 4DI9A 4GXWA 2P0IA 2YB1A 3R94A 4H8VA 3QHMA 5ABEA 5K3VA 2C0HA 1EIXA 2HISA 1E4NA 2A3CA 4GQ0A 4IL2A 3DEQA 1GT8A 4UZUA 2JKPA 4S3JA 3BVJA 4MNLA 4UNKA 3VNYA 5DFAA 3B0PA 1PXGA 1CGVA 2ZX7A 4L61A 2XFRA 2R1PA 3WLPA 1GOOA 2J7DA 3SFWA 3VM7A 3WQOA 1GOIA 6PTDA 3UU0A 1Z41A 3ERPA 5A95A 1NVMA 4Q4SA 3W7IA 1QU4A 2DV0A 2E0PA 4S3AA 4MF4A 2OXNA 3ITCA 1JRCA 3N3MA 4US5D 3IJLA 1PIIA 1J4EA 1PZ2A 3QLDA 4R7WA 3LOTA 1YNPA 1JCYA 3L21A 4JTCA 4OECA 3TX9A 1TZ9A 4A35A 5G4WA 3B05A 3G0SA 5KZMA 5C7HA 4O19A 1P5BA 5BOEA 2IPJA 4PBEA 4OBTA 1TE6A 2PU0A 3L4VA 1AJ2A 1W3IA 3N2MA 1XGDA 3TR2A 3WJYA 3BLEA 3JR2A 3WFLA 1R9XA 1V5XA 3KS6A 3C2OA 1FHLA 3TJXA 4A3QA 2W67A 3OBKA 5EYWA 2PDLA 2WHJA 1V3IA 3QQ0A 4C6DA 4EACA 3EDDA 1DWIM 2GLKA 2VX4A 1JDDA 2Y8VA 4B9ZA 2F2KA 1MNSA 1S5NA 5JIPA 4GXMA 3NL6A 1IXQA 4MB5A 1AQHA 2YYUA 1E0XA 4P7NA 3OGVA 2AAAA 4UWMA 1G7UA 2HRWA 2P8BA 2QCLA 1DWGM 2FTPA 4R7JA 1QT1A 4PRTA 3GHSA 1IT0A 3W7LA 4ROPA 3TN5A 5BU9A 3EMZA 4E0CA 3SRDA 2VEIA 2C18A 2F6XA 5GJMA 2PDBA 1Q7MA 1P0NA 4L80A 3S3GA 4JCLA 4QJ1A 2O0TA 3LG3A 2X09A 3AALA 4J7RA 3IRDA 2ZX9A 3LPPA 4FMVA 3KL0A 4Q8UA 2FHCA 4E2VA 3DFQA 4IIHA 3UVIA 3TN6A 3GB6A 3L2LA 2ZX8A 3ANVA 5A6KA 4JTLA 1U2YA 3NQBA 2CERA 1U1JA 3M1ZA 3M07A 4QG9A 3NSMA 4U5KA 3SIMA 4IF2A 2AQOA 4XZHA 1VEOA 1OG0A 3VNJA 4YLWA 4N6FA 1BYCA 3DIPA 2AL1A 1O60A 1SU5A 1E3XA 5AN7A 1JF5A 1R2TA 1H49A 1CB7B 2JIEA 2NWRA 2PBOA 1S2TA 1E9ZB 1XIFA 1J9YA 1DVJA 1DXEA 1R7AA 1ECQA 4ADUA 4INFA 4ZEPA 1W5PA 3SCWA 3W81A 3N6HA 4PTVA 2PCEA 2ZOXA 5A1AA 2VQTA 3TYBA 4DAIA 2E8YA 1ZBCA 3S6OA 1G1YA 1OYAA 4OKDA 1M1BA 1K9TA 3K8LA 3O05A 3H4XA 4NAFB 3KX6A 4YYFA 4H41A 3CHDA 1Z6KA 2IXVA 2NX9A 3UZ5A 1GZGA 2QGYA 4KEUA 1J0JA 3U57A 4TOQA 5BXSA 3I6EA 2GL5A 5LXEA 2JFEX 2FJUB 3II1A 3U4AA 1HJUA 2X42A 5IHRA 3AJXA 2VEGA 2D73A 3S4TA 2RJGA 4Q7BA 4UFLA 3MZNA 2NT0A 3UGRA 3H7VA 2BOGX 3PVFA 1WP6A 3ZQ9A 1L6GA 3RXZA 1SMAA 2GUYA 4OV4A 1B3VA 1A4LA 1O68A 3PTQA 1Q4NX 3PJXA 3NPVA 1O5RA 1CW2A 4BKNA 3BAYA 3WNPA 4MTVA 4PMDA 2NX1A 3VNLA 5CQ1A 1H1YA 2FPTA 1PE1A 1H09A 4BHYA 2IQTA 5B7YA 2FGBA 4HYWA 1T99A 5AHNA 4IIGA 3TC6A 3GKFA 4YHEA 1OY0A 3TWBA 5D37A 2F7FA 1UWSA 3CZLA 3M0YA 1OX6A 3YPIA 1UCWA 3DFSA 2VXNA 2JALA 4GVFA 4BZYA 2VRJA 4ENLA 1RPXA 2OPJA 2PI6A 3LHWA 3QHNA 4IPIA 1UMLA 4QM1A 2ANUA 6ENLA 1AW5A 5DX7A 3EZ4A 1KNWA 3PPGA 2CXEA 4NNBA 1PKMA 4YU1A 5D9PA 4JL1A 3EB2A 3R12A 1CLVA 4JXCA 1NARA 3STFA 1F07A 2ZUWA 2GJRA 2OVLA 3DG3A 3H2AA 1MEHA 3OOQA 4URIA 2WAGA 1JNEA 3QM3A 1NF7A 1W9UA 3KVLA 4FOKA 2XU2A 4LCQA 2GSJA 1W5QA 4UMBA 5FEXA 3GDTA 1BVZA 1W9VA 5E6YA 2BGNE 2JKAA 4AZIA 3EMQA 1W31A 1FTXA 3QKEA 4K2SA 1TQXA 3PWGA 3RLUA 1LT7A 4GFSA 4DF0A 1XLJA 2FH8A 2R1KA 2WMGA 2FGLA 4PTMA 4XVDA 3IV3A 3O15A 2XFFA 4WOQA 1HL8A 4PUDA 4AZ5A 3IGHX 4JIPA 1MSSA 1H7NA 4H9VA 7CGTA 1GOKA 1WB0A 3FAWA 2GK1B 4GFIA 4X9SA 1FWWA 3QHOA 2I17A 2CFFA 3LUTA 4B15A 4FIQA 4IIEA 4L6DA 1WZAA 5LHEA 4H6RA 2EG6A 4HA1A 3W7CA 3NZGA 3NDZA 3AUOA 1NF0A 2FZNA 2YLLA 3QQWA 2INZA 3IJ9A 2WXDM 3ARSA 3M7SA 1RBOB 3FA3A 1EH9A 1I2QA 3SUUA 1QNSA 2C19A 4YTUA 4IQDA 3RF9A 3NFUA 3W37A 1UR4A 1IEWA 2YJQA 1HKIA 2J74A 3VOJA 4ZODA 1EZ2A 1YBQA 3IANA 4WF7A 1LOLA 3D0CA 1POJA 4RV8A 1FH7A 1WBHA 3OZMA 3URQA 1CGYA 3G18A 3THCA 3KW3A 4PUNA 1QOPA 5C9ZA 3R8RA 4KCVA 1F6YA 2QUUA 5KSWA 3MB9A 1GKPA 3BE7A 2CZVA 3VCNA 2XZ9A 4JQ1A 5C70A 3S9IA 3VGEA 4HNLA 3ES7A 5TIMA 3MCNA 3F2BA 4P2VA 3R89A 3N15A 3RGTA 2E6AA 2OQYA 1LP6A 3I7QA 4HN8A 3NEHA 3WN6A 3EA2A 2CLPA 4PMYA 4O4WA 2CC0A 2ZVIA 3IGUA 3QFEA 4XAZA 3B40A 1QFEA 4ORIA 2I14A 3I3BA 3WF1A 4XD4A 1REQB 4D1JA 1FUYA 1TJRA 3IARA 1JJKA 1XKJA 1V0LA 1TR9A 5F2MA 4AD2A 1H11A 1PCKA 2DIKA 3LM3A 2HVMA 3BZJA 3HGSA 4O0ZA 3CQHA 3LGDA 4EIVA 2JGQA 1KV5A 1W9DM 2ISVA 3TMQA 4AZGA 4RXFA 4DN1A 1HQTA 3MUAA 1LLZA 1XL9A 4ZB2A 1GHRA 1FWCC 4WRHA 2EPOA 2AMGA 4NY2A 1OFPA 4XTIA 3POHA 3QR3A 2WBGA 2WC4A 3NSNA 2HBVA 1KFCA 1PX3A 2BHUA 1K4HA 2RFGA 4GACA 4PZVA 1RAKA 1IF2A 4GXPA 2ZZ6A 1NH6A 5D8WA 3IACA 1YPIA 3JW7A 3KRUA 1S2UA 1FWFC 3FJ4A 4IISA 4PUKA 3KOFA 1SJDA 2FTYA 3RR1A 3PFMA 1Q3NA 4UFMA 3FAXA 3P8IA 2WNWA 1ZCOA 3OHMB 3STCA 1JYXA 2PD9A 4BQ5A 1UC5A 3RCNA 1MXSA 1AUSL 2PTZA 4UR8A 1OT1A 3MV11 4DWSA 4Z2KA 1XC6A 7XIMA 1MEWA 1V79A 3B8UA 3MHGA 5ABHA 5KZEA 2R1MA 3WLTA 4GI4A 4PEKA 5F2IA 1SSDA 2PPGA 3WF3A 5I0DA 5LIYX 3WZ0E 2F61A 3BSGA 2QXWA 5IM51 2R8WA 1CIUA 3GG0A 3LNMA 4X3ZA 3LMYA 3MT1A 1KB3A 3GVWA 2OTDA 4DWSC 3WO8A 3E74A 1E6ZA 3PK7A 4R34A 2WZEA 1GTEA 2WM1A 4G8TA 4U10A 1MNZA 1LL6A 3TQVA 3P67A 4JTTA 4V2XA 1HFBA 3EDFA 5A6AA 3UJSA 3M5VA 3I7SA 1GVOA 3AMDA 2HS8A 1JEZA 2BSLA 1A5OC 5B7ZA 2VT0A 3B8SA 3CAQA 3URNA 1VJSA 3IUIA 1JFHA 2ZZ3A 3A13A 4FPSA 3CZEA 1SFTA 1W3HA 2OQHA 3B4YA 4GPNA 1JUEA 2B31A 2V63A 3SCUA 3WUBA 1GVIA 8CGTA 1RK5A 3LPFA 3MSRA 4L1GA 2IUZA 5ABTA 3M0VA 3MP3A 1K03A 1QNOA 3P0WA 5CGMA 3WNMA 1CXKA 2FH6A 4I5UA 1TJ2A 3KRZA 1A0CA 1K7EA 3ITLA 1JUBA 2ZICA 4GUGA 5F1VA 2ZRVA 5AHEA 5HANA 4DJEC 3H23A 1OJXA 1RZMA 3GDKA 4G9PA 4NZ4A 3DN5A 1M6JA 2DT0A 1B0IA 3B9DA 4OGZA 4QLJA 3E0LA 4ZZ9A 4QDPA 4PTDA 3M9YA 3RLGA 3DHFA 4F0LA 3PBGA 4MDOA 4GLEA 1C90A 5ABFA 1R87A 4NRRA 4YMZA 5CAHA 4CCZA 1WKFA 3RRXA 4X2RA 1OGBA 1S38A 2XYLA 3UG8A 3WMCA 1Z48A 4GH1A 3VGGA 1Y5WA 2CESA 2VP8A 1CXFA 3WLNA 2DZBA 4PL2A 1EA9C 3AMLA 4NZFA 2OX4A 3KAOA 3G1VA 4HJWA 1EUAA 3W1XA 1KC7A 1BVNP 3BLOA 1R86A 4PRRA 2QVHA 1AMYA 3LZ5A 2E68A 4QP0A 1FWGC 4ZENA 1R2SA 1ZRQA 3ARTA 3HV8A 3EDKA 3A5FA 4IGHA 3EKLA 4NI3A 1O4UA 4HNTA 1KBBA 4PA8A 1IGWA 2ZZ5A 1ZJIA 4LUYA 1GEHA 4JYFA 1KGUA 1RLDA 2Z2AA 1JI1A 5DCEA 4Q6XA 1FRBA 3MO7A 2G8ZA 1DJQA 2DUAA 3AROA 4PUJA 4GUHA 3U2OA 2HJPA 4NJGA 2F2HA 3B06A 5CPOA 2I9EA 2V2HA 4WSKA 5DBTA 1CYGA 1H7OA 1LQAA 1P0KA 1ISWA 3DC0A 5HNRA 1C8VA 1K3UA 2XSXA 4B5VA 1K9DA 2X1TA 3BQ6A 4M82A 2WMIB 3RN6A 4KS0A 4QJ5B 2FDSA 3KCJA 1NTHA 1XPYA 4G2DA 5AC4A 2YXOA 1V0KA 1ONXA 5DBUA 3L5LA 4P8VA 3W4RA 1E15A 4UCFA 4BI5A 2GVGA 3LNPA 1FDZA 2YA1A 2BTMA 3A3HA 2Y8KA 2YCJA 4GQQA 1KBLA 2WHLA 1SFLA 4US5A 3C86A 1A5SA 3TN3A 3WD4A 4G56A 1VBHA 3UT0A 3BCFA 1TMLA 1QPRA 1AFSA 1MI3A 2D22A 3UCQA 1CBGA 3M0HA 3CO4A 2WZTA 1HP4A 4TMCA 3RIKA 1TWSA 4KWSA 1KWKA 4ZSUA 4A8LA 4C65A 2W66A 1HGWA 1A5BA 5CBBA 1V3LA 2W91A 4AYSA 1UASA 4UTMA 1TO3A 2WNQA 5FL1A 1VAHA 3GRIA 2EF9A 2IS7A 1FWSA 4B16A 1M7PA 2AOSA 3H7UA 3CWNA 5DQPA 2PUZA 3LBCA 1L2UA 3ZO9A 1HJQA 1TPC1 1TV4A 3DUGA 4S3DA 1UKQA 5AKQA 4ERAA 1K8XA 3EWUA 3WDQA 9RUBA 1JQVA 1VKFA 4KCWA 2HDJA 3PUGA 4ACZA 2XUCA 2UZ9A 2GVLA 4IFOA 1ADDA 1PJ9A 2A3HA 4DJED 4DO5A 4C6NA 3W6LA 2INEA 3QKZA 1ONEA 3SJNA 2V81A 4KIRA 2BZNA 1OADA 1SYTA 3THQA 1GW9A 3N9SA 3A24A 1E1FA 1Y5VA 2YA0A 1FWNA 1YQ2A 2CXGA 1IXPA 5EFFA 2DW7A 3EX1A 1BKHA 3KVKA 1C3FA 1WAWA 4I6VA 4HHLA 1U22A 3VKCA 3JVAA 4E6MA 5EBAA 2Q8XA 3RUBL 1XI3A 3F1QA 1J93A 1V3MA 1DQUA 2VWTA 1SZNA 1WV2A 5D4YA 3MBDA 1XKYA 4UFHA 4DBWA 4MYAA 4DJFC 2Y24A 4GI9A 3RILA 5FI8A 1DKWA 1ZS2A 3DFOA 4FF7A 1B2YA 1T41A 1XLAA 3NDYA 3CUXA 1XLEA 2YBVA 4GGBA 1Q8JA 1YPFA 3V3WA 5FSEC 5KITA 3MUY1 4XTDA 2CU0A 4N9DA 2X8RA 2YBTA 3REQB 1XYMA 1GONA 1KCLA 2ZXDA 1UUMA 2Z00A 4IPJA 1X6UA 3LI0A 4IM4A 2QCDB 4E3TA 3MI3A 3U9IA 2D69A 2I57A 1OK6A 4RNJA 2PURA 5CG7A 1UKOA 3B3DA 3TWAA 2RHGA 1V6XA 1TX0A 3TH6A 1D3CA 3LCLA 4LYKA 1VJIA 4GMEA 2Y7DA 2CWXA 2QUTA 4HSOA 1Q2SA 2RDTA 2OO6A 1P0EA 3GKAA 1CNVA 4Q8OA 4C7DA 2ZDSA 3NIYA 5I06A 5F2LA 4D8ZA 3MHFA 4ZQMA 5FJPA 1VFFA 3CK5A 2QDDA 1JDEA 3WLKX 2PLCA 1F7BA 2XGIA 1R7OA 2LLEA 3AIEA 5DMMA 3RPMA 2B0MA 1MRQA 2PWUA 3QN3A 5C6MA 1PIFA 3THAA 3F4WA 4TV5A 2NV2A 3W2NA 2WHMA 3NPXA 3APGA 5LIWX 1XUUA 4U2ZA 5HUOA 3BCDA 2VCAA 3WQEA 1GEQA 5KMYA 3K30A 4OFCA 2HK0A 3GDBA 1UA7A 4KRZA 4AY7A 2DVTA 3TTSA 2VC7A 4JEJA 4PB3A 2ISDA 4JKKA 1KTBA 4QFUA 4TMBA 4W8BA 4H19A 3P14A 2Q02A 3IK2A 4XAGA 3ZZ1A 5C2XA 1R9ZA 5FJJA 3L4TA 3WQ4A 1SO4A 4OWGA 5JU6A 4AMAA 3KDOA 5FEWA 3UWYA 4NP7A 3W7GA 4L1WA 1B5TA 1VC4A 2OEKA 4NI8A 2HTMA 4O57A 1WO2A 3NOYA 4O17A 4TU1A 4F0KA 5TBOA 3DBNA 2WCGA 4GK8A 3SADA 4Z1BA 4Z2HA 5K9CA 2A1YA 3W2LA 2W4XA 2GGJA 3W88A 3WL0A 5EMUA 1LBLA 1QNQA 3UGVA 3PR2A 1YX1A 4N6EA 3T6CA 3TSMA 4PTNA 2OX1A 4O0KA 1J18A 3AXIA 7ODCA 2R82A 3VAVA 2YGYA 3AJ7A 5A2AA 5DT7A 1TV2A 2I7GA 3FFSA 1XRSA 3AXKA 3GD6A 3MMDA 3OJGA 3ATZA 4G7EB 3TN4A 4GJ1A 1OK4A 5D2TA 3NQDA 3GYCA 1ITUA 4FXRA 3U2EA 4NG3A 1IZKA 1QBAA 5DF0A 4V28A 1ITQA 5GNYA 1YPXA 1JCNA 2XH7A 1UZ4A 2H8XA 2J77A 3LCFA 2TPSA 3ARZA 5LGZA 1L2QA 3V36A 5A6BA 1U33A 4Y9MA 2GDVA 1V6YA 3WYZA 4H2CA 2Q6ZA 1EXBA 1LBMA 1FKXA 3AHYA 4QCFA 4PUUA 3C2RA 3KWXA 2V6AA 4LJ3A 3QRHA 3WCZA 1H1ZA 3WNOA 1XYZA 3CL6A 3GFXA 2W62A 2V8ZA 2GOKA 2VZVA 3B8DA 1BWKA 3T8LA 1BXCA 2OELA 4YTQA 5DLCA 3W25A 2H3BA 1W1YA 3CQKA 4L5ZA 3SQLA 2IPWA 1R8LA 3UBPC 3UWEA 2V0TA 2V5LA 4L4OA 4AIEA 1VIWA 4I9MA 1Z89A 7PTDA 4RW5A 4M0XA 2J7BA 3UG3A 3GXDA 3T09A 1UR9A 1ZTVA 2PU1A 4UOZA 1BTMA 1F6KA 4OVXA 3TW9A 4E4FA 1H7XA 4FEZA 1FBAA 3AU6A 1TMQA 3OVQA 3P6LA 3GFZA 3ZR6A 4P5UA 1T7LA 3PZMA 4HK5A 4IQEA 3AC0A 1A5UA 3IWPA 3RX3A 1CGXA 1XLKA 4IMEA 2EBNA 2HPIA 3FGCB 2HWGA 2GK1A 3SY8A 3CMJA 3SSJA 1US3A 3CIWA 4FR1A 2O56A 2G50A 2OG9A 3M41A 1J0KA 1LUCA 1HVQA 3GNNA 4WKFA 2J7FA 1LRQA 5LA2A 2WNNA 2VYOA 3PFRA 2OZ0A 2HPMA 4HOXA 1IHIA 1RD5A 1OQFA 2XIIA 1DJWA 4EAMA 4J9JA 1ICSA 1XDMA 4K1WA 2VUNA 1Q66A 3WQ8A 1C9WA 3O2LA 4MWAB 3V16A 4N9BA 3LCWA 3VIKA 3W1TA 4REQB 3FN9A 3CMFA 1K77A 2QKFA 1J79A 4MJZA 1FXQA 1BQGA 3UXIA 1OHLA 1S3TC 4HK6A 1G4PA 1B3ZA 4KCUA 4B91A 4UTHA 2REQB 3LRMA 5DRIA 1AH0A 1I2PA 2VC6A 2NZLA 3BK0A 1GORA 4H2HA 4C5YA 4WXYA 3H26A 3KHDA 2X7VA 3BOFA 3OTRA 1VLWA 3EMCA 1TJ0A 3E2SA 3EEGA 2ZE0A 3E0IA 3ARVA 3EYPA 2DIJA 3HPAA 3T40A 3T42A 3ZLFA 4IUGA 3GU2A 1L8PA 4Q4KA 2J7HA 5AZ1A 4ZO8A 4LW7A 3CUGA 2IKGA 3VFCA 3T78A 1E5NA 1XLBA 4I9TA 3WEZA 2J6XA 2I16A 4DB7A 1A0EA 2HBXA 3DFPA 3RLVA 1X98A 4IJCA 1UBPC 1C8YA 4BWLC 3J7HA 3TEVA 5A8GA 3ITGA 1S3HA 3ZR4A 4C6KA 2VQUA 3KE0A 3FK4A 4DM2A 3ZVHA 4LSBA 1HUVA 5LIKX 2GWNA 5H91A 1XJBA 3S1UA 1JYWA 3FXYA 1ZZMA 3E0VA 3ONBA 4WGXA 5DMLA 2Z1BA 1RJPA 2QULA 3A6OA 2A7PA 2WZHA 3OO2A 2G3IA 3VK5A 5I00A 3W7HA 4RZ5A 3ZT6A 4ZB5A 3F03K 3D5HA 2PWVA 5D03A 4C6JA 8TIMA 3HG2A 4X2PA 4AWUA 2PWEA 2PDJA 5I77A 4GC4A 3TW6A 1CXIA 2KZHA 1RUSA 3EPMA 4W7WA 3T2OA 4AEFA 2TAAA 1W1A1 5G4HC 4DLMA 1NP0A 2QAPA 3CH0A 1XIBA 2WW5A 1C8XA 3MA8A 4GBDA 4LS2A 4KRTA 4RW3A 2PWGA 1V08A 3HPFA 4HQVA 1RA0A 3NQGA 4J5NA 3E49A 4RV3A 1F9CA 2IMRA 1JCLA 4GYJA 1LQ2A 1W9XA 1VF8A 2FGZA 4GVHA 2V67A 3PNUA 1FFRA 1XHGA 3GDLA 2D3LA 1WAUA 4F0SA 4DJDD 3DERA 4QNWA 4PMVA 2CHRA 1HKKA 1SR0A 4IMDA 4DZIA 3WH8A 1NEYA 3C8FA 4D2JA 3L0KA 4O16A 1MEIA 3VNZA 1N8IA 4LVAA 1HTIA 1PYMA 4I8YA 1A3WA 1PV8A 3R79A 3QTGA 2WC3A 5DELA 1E9YB 4JICA 5B80A 1GHSA 1YADA 4PL1A 4RDZA 3LZ3A 1AJZA 2EJ1A 4QAIA 3SUSA 3QPZA 4IJRA 3TCEA 4GNVA 3F4VA 2QCHA 4K3ZA 5E70A 2AGTA 4PC8A 2QJMA 5MHBA 2JK2A 1CXLA 2VFFA 3FCPA 3HQOA 3BANA 2GJLA 1B30A 1YDOA 1S1RA 1BGGA 1EJWC 3O6YX 4CQ9A 1GYLA 3TAKA 1TCMA 4U33A 2ONEA 2XN2A 4LB4A 4PMZA 2VVNA 3HGOA 2E6DA 3NQVA 4AQLA 8RUCA 2PDQA 4RNHA 4Z2IA 1VH7A 1EGMA 4PFMA 1L8NA 2FDMA 2VEPA 3AHXA 6TIMA 2EKGA 1QJWA 1R5YA 3H6OA 1LG2A 3PF3A 3WX7A 3NAVA 2GVEA 3U8GA 1RY0A 4O8RA 1OD0A 3PUEA 2YKKA 1TCDA 2VGBA 1PYFA 1IT7A 1X96A 3BLKA 3CM4A 4DO6A 3WLSA 4E8CA 5AYZA 3PZIA 4LCSA 4QAWA 3PHAA 3GM8A 1DTNA 4WJEA 1E4LA 3OHIA 1AQMA 3ARQA 1IR2A 3GZAA 4H9YA 3MP5A 2CEQA 1P1XA 5JBFA 3UY8A 1W9PA 1ZQ5A 2XM1A 4KW2A 6REQA 1U5JA 2B81A 4KF1A 1IZCA 1VLIA 3EX6A 3GFYA 3A4AA 5HXMA 2O9OA 5C8BB 2PE4A 3W1QA 3PANA 4RE4A 2OSYA 3TXZA 3V75A 4XZIA 1DTUA 4IP7A 4R9XA 5I2UA 3W2UA 1WXYA 4DF1A 4QR6A 2I5IA 3WKZA 5AHLA 4O4VA 4IICA 3MI2A 2E67A 4TQTA 4GO8A 4IHCA 3DI0A 3FYYA 2QNEA 3MYPA 3CQJA 3M64A 1NY1A 5LZLA 1NJJA 3OQEA 4JTDA 1BKSA 4H01A 2VGGA 1PVNA 3OODA 4QSFA 5A8OA 3DAQA 3U2CA 4LAOA 2J7GA 5HAOA 2O4MA 4Z42C 3LMZA 1G4EA 5I5RA 4QTGA 3T0AA 1P6WA 4QEHA 3ITXA 4A8NA 3R1ZA 2GGEA 4JIRA 3T0CA 4M6UA 3CL8A 3W72A 5BMXA 1EO5A 3BJTA 4GYPA 3VD5A 1E43A 1W91A 4QG6A 5MKGA 1MMFA 4EXBA 4L4LA 4GKTA 3WMLA 4FNPA 1TV7A 4B5XA 3NQEA 3IIOA 3UETA 5AECA 1M53A 4QNEA 1PIGA 3ONCA 2J47A 3NDOA 4YTRA 2YFNA 1LL7A 1UJPA 1EGVA 4ZGYA 5A8PA 1CGUA 3VDCA 3WSUA 1EB3A 1P6CA 3PBVA 1A5MC 1EFZA 5CZSA 4JN7A 1S2CA 3P81A 3QYSA 4HMDA 3IIZA 3N13A 1A49A 1R38A 2NQLA 3D47A 1Q6LA 1A5LC 1TVNA 4MYXA 4MUZA 2Y62A 3GY1A 4RXGA 1AJ0A 4AIUA 5IOBA 1FCBA 4Y2WA 3B8IA 3UXLA 1XLDA 3VCRA 5G1TA 1PHWA 1O1HA 4G7FA 1ESWA 3OG2A 4GZEA 3N18A 4DLFA 5IXEA 1MQQA 1TYGA 3UXAA 1MW1A 1ZL1A 4F8XA 2G5WA 3V0SA 2CHOA 2NVCA 3ZLHA 2YIHA 1XIEA 4P61A 4LVGA 4F9JA 4AW7A 1XF0A 4D6FA 3L65A 3SQSA 3IJ7A 1SUXA 4MG4A 4Y96A 3TE9A 2ZFAA 1NIUA 3LV5A 3HJZA 4MWAE 2WNZA 3M6DA 3G8EA 1DL3A 4Y8FA 2Q3OA 4EPKA 4KQNA 1U1HA 3LENA 4MLRA 4ATDA 1B4EA 2E5DA 2X2YA 2EO7A 4UR7A 4EPDC 4PTWA 3AIRA 3RO8A 3UY7A 4WKHA 2V2DA 4H00A 2PC8A 4H7CA 1MZRA 5A6MA 4JTEA 1ZBVA 1LTDA 4MDPA 1CWYA 3SW6A 1Y65A 2J8TA 4MM1A 1VGAA 2MNRA 3IS4A 1JULA 1HT6A 1EGZA 3A21A 1S2VA 1OF6A 2UWFA 4M24A 1CB2A 5AYXA 1BRLA 1C91A 5IBXC 4ZO7A 3HF3A 3QSRA 4WDTA 3TC7A 4W7UA 4GRSA 2AAMA 3UYIA 3G77A 4F48A 3AU2A 2FZ9A 3T0DA 3W27A 2PLJA 4IJBA 4NX0A 2QCDA 3CYJA 1BWLA 1QNPA 1GVYA 4MGGA 4ZOCA 1A3XA 4W9TA 5D8ZA 4JX5A 4IZGA 2XPKA 3AYTA 3C2YA 1G6CA 2P3ZA 1J2WA 2NVDA 2BODX 3E2QA 4R3UA 1JZ6A 1KM2A 1XV8A 1BSLA 4DM1A 2PD5A 1GQNA 4NJJA 3FEQA 3GTIA 1MDLA 2G41A 4IGNA 4U28A 4LU0A 5FAGA 3GS6A 4GHRA 4S3GA 2Z4GA 3N29A 2YZ5A 3RPDA 3KS5A 1PEZA 2CITA 5CZTA 1JGMA 2IW0A 2PRLA 1ZFJA 4I7VA 3QTPA 5I03A 2D0FA 3GUGA 3H24A 4DY1A 5D38A 1I1WA 4IFKA 1W5OA 3BLLA 5EU9A 3SR7A 4Q4RA 1AVAA 5H2ZA 5H6HA 4X0NA 1O1ZA 3P7YA 3AMGA 1RP9A 4WJXA 3OGRA 1GVFA 2W9MA 3V0TA 2DZWA 3B97A 2Z1WA 2TRSA 4RJEA 5EMLA 4LC8A 3BAXA 5HMDA 3DFNA 1LF1A 3RK8A 4PEEA 2XN1A 1XGEA 4H4IA 3FHAA 4IUOA 3CQIA 2XINA 3G2GA 1ZAIA 4XO6A 3WBAA 1VYPX 3AXHA 1GJPA 4NZJA 1MUWA 2QEZA 2E28A 4D6IA 3OG3A 3SIZA 2XVKA 4AX6A 1RP8A 4RPQA 4EP8C 4KFNA 5LIXX 1FP9A 1A5AA 4V33A 1C92A 3A47A 4B3KA 1F8MA 4JKLA 5BRPA 2VC9A 2XM2A 5CZKA 3GTHA 1OCQA 3WQ5A 4RCXA 4WY0F 3CUIA 1MFVA 1KKOA 2XDFA 3PZQA 4C1KA 1UR8A 1MZHA 3BG5A 4WY0A 3NZ1A 3PB0A 4JDBA 3A12A 1OX4A 3HM7A 4CD7A 3N6JA 3S5SA 3CXOA 3N12A 1B9ZA 1UQZA 5LIUX 1K6AA 4YIWA 1JPHA 3QEZA 2PTXA 1D3HA 4GCXA 1XIMA 1R3QA 2GQ3A 1ISXA 1JRBA 1XRTA 5D2YA 1ODZA 3CV2A 1HL9A 1SM9A 4MY1A 4LPCA 2OWCA 3FDGA 3RR4A 5JH2A 4JFTA 1XX1A 3UR7A 2VDHA 1XLCA 1JZ3A 3RJXA 2CBJA 4I5RA 2IPGA 3FA5A 3NURA 4PB5A 4WCJA 3H2EA 4KFPA 3UR5A 4JNZA 3CV1A 4A2SA 3TZNA 1P6BA 2YFOA 1S5VA 4F0MA 5KTLA 1E0TA 3AWOA 4JFSA 3WK0A 4HMNA 3R6IA 2CBVA 4O50A 4JIHA 4GIEA 2BP1A 8A3HA 4MJMA 5E93A 4HPNA 4C6LA 4EAYA 2BY1A 3SFKA 2E09A 4P8WA 1R3VA 1E0VA 1JXJA 3S2CA 3VOCA 4AEEA 5FF0A 2CZ5A 1GUVA 3STEA 4M81A 4CNPA 1V8EA 3UQNA 3CHVA 1VENA 4UTWA 1EP1A 3E38A 1Q85A 3DZ1A 3P82A 3KCLA 2FVMA 3MWCA 4MZ8A 5I3FA 1LOSA 4OUEA 4MMWA 1WOAA 4NRSA 1J2BA 3LSCA 4IQLA 3WD2A 4W88A 3PZUA 3VIOA 2FB3A 3GU9A 5A6JA 1IGSA 3TSBA 1X1NA 1GPWA 3MCOA 3ZT7A 3ZOAA 2OKTA 4J3WA 5JVLA 2VOMA 4AIOA 4W87A 2PBGA 1YNQA 3HPSA 2JF6A 2ZYFA 4UQDA 5AYBA 4WUIA 4UZSA 3R2GA 3SY1A 3AQUA 3UERA 5HNUA 5JUVA 1YNYA 1IT8A 5J5RA 4JHOA 1KFBA 2H90A 1VB9A 4ES4A 2EEXA 1DQWA 2NX3A 2JGYA 2JQXA 3AUJA 3MKCA 1QHZA 1FY6A 1GTHA 1QI2A 4UQEA 4JNMA 1OCBA 5EMKA 1WDPA 4AY1A 3WQPA 4AWTA 7A3HA 1SW0A 1XISA 2VL4A 1VRXA 4ECLA 1KXVA 1TR1A 3PTKA 1XYAA 3W1NA 1HJXA 1YBQB 4WIWA 3QR0A 1LCOA 3TTYA 3CUJA 2REQA 4MWAC 4B3LA 4JIEA 2WPBA 4WDXA 2GQ9A 2A7RA 2HXTA 4YYCA 3T9PA 4UMAA 2ZIDA 1QW7A 3ABXA 4HOWA 1C8QA 2CLFA 5BU6A 1BF2A 1KXHA 4F9DA 4HYVA 4LV4A 1P43A 2P76A 5BMWA 2Y70A 3DENA 4GNKB 2YX0A 1OGGA 3ARRA 3WF4A 4HIBA 4H6QA 1T0OA 1JF6A 1LRNA 2Q09A 4S23A 2ATSA 4NJHA 3A3WA 2ABBA 2CZEA 2VI0A 3GE7A 1EIBA 3BH4A 1DJNA 3UPMA 3L23A 2I9UA 2YR1A 2ZWZA 3HOJA 4Q6JA 4GUIA 1DYSA 1OGSA 4W85A 5C9UA 2Y7FA 3GDMA 4R9OA 1VFSA 1EJ7L 4AYGA 3E3HA 3WLQA 1FA2A 1O7AA 1WZKA 3M5XA 1E70M 4GC3A 2ISWA 4YVPA 4GVIA 2XVNA 3N14A 4QG8A 1DBTA 3AMCA 3S9ZA 3TC3A 4N42A 3GVQA 3HB9A 4GZJA 3ARWA 4HPGA 1YKWA 3T4CA 3V35A 5A6TC 4QX4A 1X7FA 3R13A 2EPNA 4WQ6A 3WUGA 3QBUA 5G2HA 2NWSA 3L0NA 1PWMA 4HA0A 2FYMA 1K1DA 3WFAA 4DO4A 3EKGA 4A8RA 1A5KC 2VEMA 3GH4A 1H60A 3GAKA 3MYOA 1KTNA 4PMOA 3QXBA 4QDWA 2G96A 3VIIA 4QS5A 3O8AA 1R3WA 3OZYA 2P53A 3F2CA 3DGRA 5JH1A 2R91A 3JZUA 2X1UA 3T05A 4HGXA 4MKNA 4PUWA 5ECVA 1FQ0A 1KM0A 4FS9A 1OM0A 4H8UA 2YL9A 4I5XA 3RU8X 2J25A 3BW3A 4DAFA 4CCCA 2P10A 2OFJA 1YDVA 5BZAA 3D6NA 2DW6A 4IIDA 4FNQA 3P5ZA 1OCJA 4QQUA 1GNXA 4PN2A 3S2LA 5FACA 1I1XA 4AD0A 5HATA 5HMFA 5L6UA 5DXYA 2WCSA 1Q6RA 1K02A 2XFWA 2ZXAA 2Z28A 2V5JA 3SCVA 3OLGA 1SO3A 2GJXA 1R6WA 4M51A 1QVBA 2E7FA 5E5CA 1C9DA 2WQPA 4KGLA 4X63A 4JL2A 3WG6A 1B57A 3RPTA 1S39A 2WPGA 2QJGA 3HN3A 5CAKA 3W82A 1XIDA 3WLJA 2PTDA 1KFKA 1XBXA 3LLFA 3P61A 3UJEA 4Y7EA 4M6QA 3S42A 3SB0A 1HP5A 3AAMA 2W92A 2VR5A 5G2IA 2EHHA 2H6RA 5C0QA 3LDVA 1B54A 3STPA 1EP2A 3AISA 4MWAD 4YHGA 3C3NA 3W83A 4P8UA 2Z1SA 3NL3A 4EX4A 4WHBA 4M7SA 1IIGA 3EWCA 3K1DA 3W7PA 2R9RA 4JTAA 4ZQOA 1KA9F 1TV5A 2FQIA 1V51A 1F76A 4FNRA 3O0KA 1T40A 2V5BA 1F3XA 1YXDA 2V5CA 4YVVA 5CC7A 1PO9A 3IAQA 4P7RA 1UR3M 3LCGA 4LEQA 2W27A 2BY3A 4AMCA 3MCMA 3LGEA 3CAVA 3OYXA 4ZXOA 1Z7AA 3RLHA 1YLVA 4DI8A 3STGA 3QMRA 3W1PA 4OZOA 4FXJA 4O8AA 4YWSA 3SO7A 5CPNA 2R6OA 2TYSA 3EOUA 4OUIA 2PLKA 1PKLA 2WANA 4LVFA 5IDIA 5ABFB 1OFOA 3HMCA 3KRBA 2ZX6A 2VZUA 2PF8A 1JZ7A 1HKVA 4K8EA 4LGXA 2V3GA 3CZGA 5C9RA 5CLWA 4BF9A 3G3DA 2XH4A 5I79A 1B9BA 2VEKA 2PMQA 1V6WA 4LTSA 2C1HA 4E8GA 1RCXB 4UQCA 2UBPC 4O18A 4H9XA 4M7TA 4OE7A 4O53A 1LL4A 3KP0A 5FJTA 4N7QA 3K4WA 1TELA 3MW7A 3RDKA 4FSAA 1FWTA 1WDSA 2Y8UA 5HBFA 4CUCA 4LS0A 1RCOB 4WOZA 3M47A 1Q63A 3DHDA 3I4EA 5J5DA 2YDAA 3MP4A 1AQFA 3NQ6A 3E02A 5REQA 3V5CA 3GHRA 1D8WA 4TX9A 4JN6A 3QZEA 1W2VA 1JUKA 1GVQA 2OSXA 3EWXA 1VYRA 1RLCL 2VRKA 1EUNA 1NFGA 3KVJA 3QVQA 2E4TA 1DIEA 4UFJA 2OGYA 3WLRA 1LG1A 3M16A 4CEXC 2OT0A 3BGJA 1Z8AA 4Z1AA 4JZ5A 1FCUA 3GH7A 1J5SA 1U5VA 1ECEA 1ZAJA 4DEFA 3PWIA 1E6RA 4L65A 3FYPA 4CNNA 5HWNA 1OC6A 1T96A 2HK1A 1H41A 5DN1A 3IRSA 1FHUA 3ORWA 3EGJA 2IKJA 1XR2A 3WH6A 3JUGA 3ZSSA 4AEOA 1RH9A 1GQJA 3DXIA 3ABQA 4TV6A 3K4AA 1BG9A 3TNOA 1KRBC 1UA3A 5LKYA 1Q45A 3CIXA 2PDCA 1PTAA 3FEMA 3CLMA 1EL3A 3TJIA 4B5UA 3NM3A 1BYAA 5LHFA 4HB7A 2TSYA 4OU1A 3SQMA 2WJZA 3ZMRA 1XINA 3OLDA 4GBUA 5C2GA 1P1MA 2ZVRA 3V5OA 3GC4A 1JPKA 4DUXA 1ME9A 1VCVA 3SUTA 3VX1A 3S0CA 1B3YA 5FA5A 3H2MA 1RQHA 5CBIA 2C0AA 4J27A 3SJ3A 2OCZA 4GYFA 5U7SA 3BSHA 3OZOA 4C1NA 3VDGA 1XFBA 3L67A 4AFYA 2DVUA 2OKOA 4ACZB 5EKYA 1KLZA 3NXFA 4IT1A 3ZXWA 3WLOA 2VZTA 1LROA 4CQBA 3G1YA 1F4HA 3AFBA 2BDQA 3RG6A 5HMSA 2OMAA 4C6EA 3GW3A 5AC6A 3O9NA 1AW1A 1M7OA 4ZQRA 3VINA 4IH3A 4YTSA 3KEHA 5D2VA 3VIFA 4XO7A 3S1GA 3BGAA 4V27A 5LNWA 1SJAA 4PODA 1X1ZA 1TWZA 3I3DA 3W7MA 2CPUA 3UEQA 4AUBA 1MVYA 3IJ6A 3VMPA 2F6KA 3HV9A 4PSRA 1CECA 4IP5A 2OODA 1Z32X 3WQ6A 3BWWA 2ICSA 2YPIA 4NL1A 1KCKA 4DBUA 4IWWA 1H50A 3AZSA 2C6QA 3UD6A 2F6UA 5K7JA 4V1YA 4F0RA 1OFBA 3NZRA 4HZ7A 3H2FA 3HJEA 1BTCA 3UWUA 5CPLA 4WKAA 3LTYA 3AYRA 3SCPA 2EG8A 1F3EA 3BLDA 1GWJA 1O6IA 2RGMA 4C6QA 2D0GA 4PYSA 3SCTA 1WKEA 1CPUA 4WDUA 3PG9A 3FJ6A 4FOJA 4I6KA 3GNRA 3DYOA 1E6QM 3QOMA 2QJJA 3TUUA 2BOFX 2NQ5A 3KDNA 3VE7A 2ASHA 2OOFA 2OWXA 6CGTA 3QW4B 4JNYA 4Q4MA 2VJXA 4A8IA 4MHBA 4OIFA 1H3GA 4DUVA 3APYA 2RH9A 2PF0A 3NSXA 1H0IA 3TFXA 5A2CA 2DT2A 3W01A 2V5DA 4RDVA 1HG3A 5FESA 4IMCA 3BG9A 1C7TA 2BLEA 3QZAA 3N2XA 3VTRA 1LYXA 4XBJA 5FEZA 5D2XA 3W7EA 4AISA 2P5NA 3WY1A 1WXJA 3DFTA 2WMFA 3GLCA 2XWDA 5BWAA 3LLDA 3PZNA 5BNKA 1FHVA 1UD8A 4DRSA 3S6DA 4H3DA 4C6PA 4KGJA 4GI8A 2ZC8A 2NQJA 1N8FA 1S2AA 2HE8A 3LA4A 4OQVA 1TX2A 1EOMA 3PBWA 4UTFA 4Z0JA 4HVXA 4XIAA 3THUA 3ARYA 1XXXA 2DZAA 3NVTA 2WJFA 4B5TA 3NYDA 4WGHA 1XRVA 4TUFA 4UTIA 2Z6JA 3MUZ1 3LRKA 1DWJM 3QFWA 4ZBCA 3PJWA 4NAEA 3TW7A 4AZBA 3AXMA 3R0KA 1JPDX 2NV9A 5AVNA 4AAJA 1QWGA 5E0KA 1YHTA 4UNLA 3GTNA 3T0BA 4C6FA 4EF8A 1LDCA 4PUEA 3H2NA 1X6LA 4E3VA 4RKAA 2X1IA 2PGWA 1WUFA 4H8HA 4WLCA 4QLKA 1FWJC 1MW0A 2XIBA 1XGZA 4NSBA 2ZUNA 1KV8A 2WQDA 3LEPA 1A0DA 9XIMA 1JIBA 3HG5A 3VMOA 2J78A 2POZA 4G1KA 4KRUA 1XYBA 4PSPA 1EBGA 3JRKA 3A22A 1TZZA 2NXGA 4DYJA 2PGRA 5I3KA 3VDHA 4DUWA 4H6EA 3KLKA 3QYQA 3HG3A 4P7OA 1UOZA 1O5KA 2YLAA 3NO5A 5KZ6A 1DJIA 4V15A 1VIZA 1CCWB 3N2CA 1GOWA 3M43A 4JIIX 1YDYA 3B9AA 3WNNA 1VPXA 3MMTA 3RU6A 3ITYA 2OO0A 1ME7A 2ON3A 3UWVA 1ZPTA 2Z25A 1J0ZA 1TRDA 3WLIA 2DSKA 1SJBA 4M56A 2QIIA 4W8LA 4MY9A 1IIHA 2NV1A 3H54A 2BBFA 3VGDA 3M0JA 4S38A 2GDQA 3W02A 1W54A 3F2DA 1PUDA 3SY5A 1KM5A 1BLIA 2WWDA 3EWYA 1FH9A 3W76A 2JEQA 5I3IA 4K8GA 5CLTA 2NT1A 1IE7C 3GWQA 1V3HA 4PCFA 1I9CB 2NVAA 4X9YA 3CASA 2FB2A 2BX7A 5GJNA 3LYEA 1W1ZA 4PGLA 3MJMA 4MB3A 3CUZA 2POTA 1UKPA 1W3TA 2OLAA 3FYOA 1ZNNA 1NM9A 4EK7A 5C7VA 1RXOB 2QR6A 3ARUA 3LERA 1NDYA 4DQWA 4HA3A 1IR1A 2IQ0A 5CSSA 1P7TA 4XQ6A 1TIMA 5AFDA 4LH8A 3F4NA 3SUVA 3TA9A 4CN6A 1ZBKA 2QCEA 3BDKA 1B3WA 4LYRA 2QCGA 3NG3A 3RMEA 3ABZA 3N2TA 1Z42A 2QIWA 2J66A 3CGTA 3UPWA 3MV01 2PFHA 2HQAA 3AS3A 5F7UA 3MVTA 5LSMA 1XCFA 3S5NA 5C54A 2C8NA 3TYDA 2Y85A 2J79A 4RZBA 3IGSA 3S5YA 1ONWA 4ONVA 3K1GA 4NU7A 4H9TA 1S5WA 4C90A 1JVNA 2BGQA 4F4RA 4TTGA 3PB2A 1TKKA 2VFEA 4XD6A 5LXXA 1RY8A 3OVPA 3SGGA 2YXXA 1SFSA 1NWUA 3RITA 4GJIA 3JZEA 5A94A 4O1BA 5A6SA 3KBSA 4UTUA 3UESA 4OOZA 1VPQA 1QTWA 4Q8QA 5EA9A 1JDAA 4DZAA 1LUCB 1O12A 4HYRA 1RD6A 4K38A 3TOPA 1D2KA 1L6FA 1CGWA 3M7WA 1SZEA 3AIUA 4HK7A 4HMCA 4KT2A 2F84A 3TZFA 1NU5A 4KEMA 4XZWA 2PDHA 4OBRA 1E73M 1EF2A 3AO0A 2XN0A 4LFYA 3H4GA 3W7OA 3I6TA 2P3EA 2QUNA 2WLYA 4AHQA 5A8MA 3PS7A 1EF3A 4NZCA 4AVFA 1OFQA 3GNOA 5CZJA 1FCVA 1OYCA 5D9OA 4L56A 1ISZA 3NXLA 4EKJA 1EEPA 4NXKA 2VDGA 4LBSA 1G9HA 3JS3A 1TVLA 5T9BG 1QPKA 2VC5A 3D3AA 1ZJHA 4GQGA 3DYMA 4PRWA 4NKCA 2PDXA 1QRQA 2XVPA 3G1DA 4WEVX 1NWRA 3HG4A 3WUFA 3SM0A 3CUFA 2CETA 1NFPA 2O4QA 3W38A 5CZ0A 2OZ8A 3MBFA 1FWIC 1OIFA 1F2JA 3W6YA 2ZTKA 1LQ0A 2VWSA 2WV8A 3W7DA 4HZ8A 2EPMX 1W8GA 1UYQA 1VZWA 3CV6A 3ATYA 3NZPA 4UTLA 5E1QA 1PSCA 3K46A 4LF2A 3UZJA 2Y88A 4BQ4A 3PZ9A 4JQ3A 5A5WA 5BROA 1DQXA 4J40A 1EJRC 4LY8A 2QCMA 1E0UA 3W3OA 3VKJA 2C16A 3I7RA 1G4TA 4IGMA 2GZXA 4H7ZA 4UR9A 4B2DA 3ZVHB 1H2JA 4GY7A 3CS2A 3N4FA 1PS9A 2CKRA 2DQWA 3WUEA 3IUHA 5L9FA 5FKYA 3KTXA 4RR4A 1KRAC 2ACQA 3ZJKA 5D33A 3ABRA 5CPQA 5HWJA