1I60A

Structural genomics, ioli protein
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
278
structure length
278
Chain Sequence
MKLCFNEATTLENSNLKLDLELCEKHGYDYIEIRTMDKLPEYLKDHSLDDLAEYFQTHHIKPLALNALVFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIVKEEIKKSSVDVLTELSDIAEPYGVKIALEFVGHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAMGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVWPGQGAIDLDAHLSALKEIGFSDVVSVELFRPEYYKLTAEEAIQTAKKTTVDVVSKYFSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus subtilis ioli shows endonuclase IV fold with altered Zn binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords IOLI PROTEIN
total genus 110
structure length 278
sequence length 278
ec nomenclature ec 5.3.99.11: 2-keto-myo-inositol isomerase.
pdb deposition date 2001-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1i60A00
1CLKA 3DX5A 4J4KA 2G0WA 1XIJA 2GLKA 5FA5A 2NQ9A 1YX1A 3M0LA 4OVXA 4HHLA 4A8RA 1GW9A 1XLFA 1XYLA 3JU2A 2OU4A 4US6A 1MUWA 4XISA 3QC0A 4PGLA 1BXBA 1QT1A 1XYAA 8XIAA 3M0HA 4Q7IA 3BDKA 5EMJA 3UA4A 3UVAA 4QE4A 4XIAA 2GUBA 3LMZA 1DE6A 4A8IA 4YTSA 9XIMA 4YTUA 1XYCA 3BZJA 3VNMA 3ITOA 1XLKA 4GLEA 2GVEA 1XLCA 3CNYA 1XYMA 1MNZA 5EMKA 1XLLA 3KBJA 3QZAA 2Q02A 3AYTA 3NGFA 1O1HA 4A8LA 1XISA 3TC3A 3UXIA 3M0MA 3M0XA 4YTRA 3ITXA 1XIEA 3QYSA 5H1WA 4XKMA 5TNVA 3CQKA 8XIMA 1S5MA 1XLMA 3VNIA 3WQOA 4HHMA 5J8LA 1A0DA 4LNCA 4E3VA 3IUDA 1XLHA 4QE5A 3VNLA 1XLAA 2ZDSA 1XLDA 1XINA 6XIAA 2QULA 4W4QA 5B7ZA 3AAMA 3BZGA 4KW2A 1QTWA 4X60A 3L23A 1QUMA 1DXIA 5XINA 3XISA 4GJJA 4ZB5A 4XSLA 1BXCA 3CWHA 4K3ZA 3BWWA 2G4JA 1OADA 3C0SA 7XIMA 3BANA 1XLGA 2HCVA 2I56A 3DBNA 2XIMA 3AALA 2ZVRA 2QUMA 1XIFA 3IUIA 3ITLA 3KBSA 4HGXA 4ZB2A 3IUHA 3P14A 3VYLA 3KCOA 1XLJA 2QUNA 4X61A 4EACA 3C0QA 4YTTA 4K1GA 3FVMA 1I60A 3M0VA 3CQIA 3KBVA 1XIMA 3KCLA 3N4AA 3U0HA 3XINA 4GJIA 3UU0A 1S5NA 1XLBA 4QEHA 1K77A 5XIMA 4DVOA 5AVNA 4HNOA 4X63A 3GNXA 3KBWA 3M0YA 5I7GA 1TZ9A 3UA3A 1XICA 3AYVA 1I6NA 4XSMA 3ITTA 3ITYA 2J6VA 4EAYA 4PFHA 2XINA 5EMMA 5H6HA 3CQJA 3VNKA 3VNJA 3KCJA 3KBMA 3XIMA 5EMLA 4A8NA 3P6LA 4ZBCA 4QEEA 2XISA 1XIIA 4QDWA 1XLIA 3CQHA 3KWSA 3OBEA 5B80A 5C9ZA 1XLEA 2X7WA 3QXBA 3C0LA 4YTQA 2QW5A 4G56A 1D8WA 6XIMA 1XIDA 2X7VA 2GYIA 4QE1A 1XYBA 1DIEA 4XIMA 4DUOA 4ZB0A 1XIGA 1A0EA 2NQHA 3ITVA 1A0CA 3U3HA 9XIAA 2HK0A 3KTCA 4GQBA 2HK1A 3KBNA 5AVHA 1DIDA 3TVAA 1DE5A 1XIHA 5B7YA 2I57A 1XIBA 5XIAA 2NQJA 4QDPA 1XP3A
chains in the Genus database with same CATH superfamily
1V3IA 3F4NA 3W3OA 3CUFA 1WO2A 5F4WA 1S46A 4AB4A 2H8ZA 3KUMA 1Q6EA 4TOQA 2I16A 4PCNA 3QKZA 1EXBA 4S3DA 5I5RA 3LA4A 3VNMA 4DM2A 1FWGC 3N2TA 1PKMA 3LNPA 2FPYA 3KTXA 5HQMA 1VPQA 1TIMA 4GPNA 2VCBA 1SO4A 1XH1A 4DBEA 5TQLA 4RDYA 2FFIA 3JUGA 2PTYA 1ZPTA 1FFQA 2PDGA 3BLDA 1EBGA 4MADA 3LGDA 1PDYA 3WNMA 5AHNA 3WLPA 2V63A 1ISWA 3VOCA 2C3ZA 4PEEA 2PZNA 4O8RA 3POHA 4M0XA 3DYPA 1I60A 3C3NA 4FXJA 1US0A 4UTTA 3BAJA 4FF5A 4L1WA 3GDTA 2MNRA 1Z32X 5HMEA 1VIZA 2CHOA 1TPDA 2RDXA 2FH6A 3EGJA 2PC4A 3ONCA 2D0FA 2TYSA 1OX6A 3N9SA 3EWCA 4RJEA 4A8NA 2H9AA 5LA0A 2OR2A 5BOEA 3QV6A 3VIHA 4O57A 5G4WA 1B9BA 4IPNB 4IX2A 2YR1A 1LWHA 4UFMA 1X1NA 4QDPA 3TYCA 2WZEA 4REQA 4WF7A 5FAJA 3QGVA 4MZ8A 5CPOA 4ZOCA 3BLKA 3LPGA 1NU5A 2W92A 3B8SA 4F3HA 1D9EA 4RNIA 5PTDA 1R2TA 3WUFA 1FH8A 3N4FA 4R7WA 4DRSA 3CASA 1O94A 3CAKA 3PBYA 2XIBA 1J0IA 2CZ5A 2CZFA 1TJ0A 1JPIA 4OOZA 2I7GA 1ZAIA 4DQWA 2OJPA 1H1NA 1OC5A 2CWXA 1A5SA 3WN6A 4CVWA 4GE8A 3GBEA 3NPVA 4JX5A 1UMYA 1Z9AA 2FMNA 3Q37A 3GFZA 4XAZA 3APTA 1PX8A 1KB3A 1KKRA 3WD0A 1ZBKA 4WY0B 2OZ8A 2DSZA 2VI0A 2WPBA 3L4WA 2IXVA 3V18A 1KBIA 4GQ0A 4F2TA 1XUUA 2XINA 1NOFA 4PMRA 3BLIA 3EMCA 6PTDA 4QEEA 3NSXA 4LAZA 4UBPC 5C9ZA 2AAAA 2Y70A 1SQ7A 4AY1A 1JPDX 3I68A 2PWUA 4V2XA 3E5PA 1R3TA 2V3FA 4B5SA 3S2CA 2WZMA 3C2RA 3CTTA 4B3LA 4S3BA 4Q3MA 3W7DA 2D2HA 2QJHA 4GMEA 1GYLA 5FL0A 1FA2A 3GC5A 4U31A 5LXXA 5F7UA 1DIKA 4J3UA 4ATWA 4HOZA 1CCWB 5HINA 4LS1A 2R8WA 1VBHA 1XLLA 2XSAA 3CGTA 3KOWA 3BPWA 5AHLA 5LKYA 5AY7A 1EC8A 3V16A 3HA1A 3I7SA 1W1B1 1EX5A 2NLYA 4IP4A 5H8UA 3G6LA 4RXFA 5KITA 2H3BA 1ZAJA 3B4UA 1C91A 1YDOA 3EOUA 3M5VA 2GVGA 3VDGA 3R8RA 3LBCA 2CLMA 5HWJA 3ANYA 1W3KA 1YNQA 1UB3A 1OM0A 5ABHA 4LV9A 4G2DA 1FCUA 4DB7A 2D3NA 1D3CA 3PNUA 3USBA 2QLYA 3ITYA 4NXSA 2W5FA 4ADSA 4LBSA 2RDTA 4GVHA 3GRIA 2NXHA 3OBAA 3UXAA 2VEKA 1RA5A 2G3FA 4IGNA 1NWRA 4JYFA 4DZ5A 4UTHA 1OFBA 1OIFA 2Z7KA 4K6AA 3PBGA 4AF0B 1ZZMA 1YADA 3MUZ1 2GVYA 5I6SA 3OW1A 3E2VA 1YYAA 2X16A 3LY0A 4CCCA 8A3HA 4NP7A 5U4NA 5LNWA 3QR0A 4J1OA 3JS3A 4AWEA 3T0TA 4ZQCA 2B7OA 4A8IA 4Y7EA 3KW3A 1CB7B 1DJIA 4G1NA 4PUEA 4PMNA 1CDGA 1Q7ZA 1ECEA 3GR7A 2YKKA 4D6EA 2WLYA 1TPEA 5A6SA 1W1PA 4W8AA 2FJUB 2Y8KA 4AIOA 4K2SA 1UZ4A 2DZVA 1R8LA 1XINA 4B91A 1XH2A 1PYMA 2E6DA 4MYXA 1F07A 1BXCA 3OZPA 3ZMRA 3N6JA 2PURA 4PTNA 1KQZA 3LLDA 4GKTA 4GI8A 3II1A 1XRSA 4GH3A 5DRIA 4PC8A 3MO4A 1LROA 3S5YA 1TA3A 4UOZA 4DBSA 3P5ZA 3ZJ8A 2E9MA 1SW0A 3B3DA 1OEPA 1ZTVA 3WLRA 3HJZA 2J7FA 4JTDA 4LQ1A 1CXKA 3EEZA 4JTIA 2BGQA 2YLAA 3OHIA 1RK6A 1KW1A 3VNKA 4JQ4A 1MDLA 3NXFA 4LC6A 1Q2SA 3EWUA 1K4GA 1EB3A 1XIDA 3R0KA 1VD6A 2JKEA 3B40A 2EPNA 5D32A 4I9TA 3CMJA 5HDRA 1G7UA 1SJBA 2GSHA 3MC5A 1KM0A 2IS7A 2XVKA 2UZ9A 1EF3A 4J7RA 1ZFJA 1IIGA 1FP8A 2FVMA 3LRLA 4KEZA 1L6GA 2WM1A 2EG7A 3K4DA 4M7TA 1YXYA 3CHFA 3W4RA 2WPGA 2A0NA 4KFOA 2Q8LA 2BVWA 3R2GA 2AQWA 4JTKA 2Z1SA 3NVTA 2EPLX 1E9LA 5IBXC 5T91A 2VGFA 1EZWA 5KINA 4WEVX 5BNKA 5AC7A 4H04A 4QJ1A 3JR2A 4MDOA 5REQB 3ICJA 3CU2A 3FVMA 1K8CA 5T8GA 1WB0A 4TX8A 3EA2A 1KFBA 4MAZA 3RX4A 4X63A 3L21A 4C6JA 4IHCA 1O5KA 3G18A 4ZFMA 3FVDA 3GNNA 3QPYA 1AW5A 1YDYA 4UMAA 4S1FA 3WDQA 1ZENA 2NZLA 2Y63A 1V02A 4ZXOA 3N34A 2BG5A 2DJLA 3S2LA 3WLMA 1GVYA 3GTXA 4QG9A 1RCQA 3EPNA 4R85A 1FY6A 3IJ7A 5F2MA 1GKQA 2WJDA 4IMFA 1TPB1 1YTDA 4DZAA 1J18A 3RR1A 2JE8A 2JF6A 4LAKA 2DVXA 3LD5A 4DN1A 2QCGA 1B1YA 3QW4B 5CPNA 4US5A 5CSYA 3V3WA 4RX0A 1TA3B 2DZAA 1S38A 2EJ1A 3M07A 4Z2KA 5CGQA 1G01A 1KFKA 3UPBA 1S5MA 4B5NA 2FLIA 4O16A 1EJSC 1ITQA 3LHWA 1XLAA 2VHLA 4FR6A 3AZRA 5CBIA 4FX6M 3UPMA 4GRSA 2XSXA 5HUPA 1Q8AA 5E0CA 5D2WA 3BG9A 2V3EA 1MYRA 1NTHA 2ZE0A 1KXHA 5GVJA 2X30A 1J2WA 1BPLB 4RDWA 2NVCA 3G0UA 4DAFA 7REQA 3JZEA 1UJQA 1XSIA 2W6RA 1NH6A 4Y8FA 2ICSA 2YOCA 4UQAA 4DO6A 4YWSA 1QW7A 3AYVA 4AD1A 1PIIA 1G4SA 1TREA 2BBFA 1CX9A 2XFYA 5KSWA 4UR7A 1Z8AA 1SFSA 2QVHA 3WNLA 2Y5JA 1JJKA 3DG3A 5A2BA 2ZA1A 3W2NA 3LHZA 3QLLA 2YLLA 3A3HA 2XFFA 2V38A 3V0SA 3CUXA 4IJRA 1R7AA 5CAHA 3NFUA 1JULA 4FOUA 1VPYA 2WC4A 1F73A 1HKWA 4MNLA 3NEHA 4QROA 1OJXA 5LGXA 2X05A 1L8PA 4AFYA 1KTNA 3AMLA 4IQDA 4IL2A 2B4GA 3CEPA 2XM1A 4MOZA 4S39A 3UXLA 4FLRA 1I1WA 1UWQA 3DGRA 2ZZ4A 5TIMA 1KM2A 4X0NA 3TNOA 1GG0A 1XQLA 2ZX6A 3TLLA 3G3MA 4AU0A 1HKJA 3KVMA 2AMXA 5FOOA 4I3GA 4KWVA 4Q4SA 3BG5A 1KFEA 3GDMA 4ZZ9A 2Y5SA 4IGMA 2ZFAA 2QGYA 1VJSA 3KBSA 5IDIA 4AW7A 1S2AA 3GFYA 2Z1VA 2WMJA 3DH7A 4TMCA 6CGTA 3H2FA 4N9DA 2PP0A 3VGBA 1BQCA 2E3ZA 1BSLA 2ABBA 3FK4A 3EXTA 1E4NA 3STGA 3NO1A 4UQ9A 3V0TA 4IGHA 4JTHA 1ADOA 1MW3A 4U3CA 3NSNA 4JD4A 5A8PA 3GXMA 1KD0A 3E2RA 3L4TA 3UR7A 3CWNA 1S2VA 3RGTA 4YIWA 1QNSA 4KRZA 3M7SA 2PLMA 4CQBA 2UY2A 2J9YA 3A23A 4IP5A 3LPPA 1JEZA 1YKWA 2VVNA 4RNJA 2YW4A 1KRMA 4PGLA 1CEOA 1FOBA 1NFBA 2PDFA 3U48A 3HFYA 1XF0A 4JN7A 4DWSA 5JBEA 3LHVA 1Q66A 1SJAA 3W75A 2PDUA 4XWUA 2ESCA 4LEFA 1K8YA 5AC6A 2P0OA 4KIRA 1F4AA 2OZ0A 1RCOB 2Y2WA 2BOGX 2FTYA 5C8BB 3VD5A 6TIMA 1DWAM 5HAOA 1TE6A 3FEMA 1NELA 3TFXA 5HNUA 3L4UA 3IARA 5J8LA 3UD6A 1HQTA 3WSUA 1FTXA 3UCQA 1UA3A 4JTCA 3GNRA 5A2AA 3PZGA 1FXPA 4DJED 4EOUA 3C2OA 2XIMA 3AALA 4BCEA 2X40A 3L4ZA 3GDRA 2Z4GA 1W9PA 1GT8A 3AMCA 2X0SA 2V30A 4HK5A 1EJ7L 3NURA 1SM9A 2WB5A 3F2BA 2Y5EA 3LRMA 3PZMA 2CHRA 3LV5A 3W88A 2B31A 4HOWA 1OD0A 2E5CA 2YA0A 1CGUA 1K4HA 4UXDA 4DEFA 1A3HA 1V3JA 3EZ4A 1KRAC 4UB9A 4ZB0A 4MLJA 2NV1A 2V5DA 3G0XA 4YJ5A 1OX4A 2FZBA 5M1TA 4MWAA 5FA5A 1F6YA 4GACA 4YL2A 4R27A 4AH7A 1EO7A 3PBUA 3KRSA 1RXOB 2XIOA 1N2VA 4B90A 2FQIA 4GYPC 3ARUA 4I8YA 4HTBA 3LCGA 4JX4A 3AFBA 1MVYA 1QK0A 5JXQA 2J4GA 4FXFA 5J5DA 2XIJA 4F2UA 4DX3A 3RNDA 2W3ZA 4JL2A 3ISIX 3G5EA 4LAOA 4UC5A 3BGGA 2IQ0A 4QE5A 3FFSA 5FF7A 1HKKA 2QJGA 3S2MA 1P43A 1M53A 3IJQA 1QWGA 4H00A 3CAVA 4Q8QA 3W6MA 1TPH1 4IIFA 1RBOB 4PMOA 3CB3A 4WKFA 1FWEC 1AK5A 2C15A 3CWOX 1S5NA 4UWMA 5A6LA 1TZZA 4M8UA 4BA0A 2J78A 4HU0A 4WHBA 5AC4A 2DVUA 2C79A 5CZJA 3CUIA 1RPKA 3TROA 3DG7A 4JXCA 4PFHA 3H24A 1UC4A 4FA3A 4YS1A 1IZKA 2J25A 5JIWA 3FNDA 3I10A 4QITA 2VOTA 3FYOA 4KH2A 3BCJA 4O1AA 1E0UA 1NAL1 3WK3A 3C2EA 1ADDA 3Q58A 2A1YA 3AIQA 4Z17A 2PBGA 4J3TA 3OO2A 4TIMA 1B3OA 1AH4A 3GKFA 1PL9A 1TYGA 4BF5A 3R12A 1L6YA 2HBXA 4JIQA 2YDQA 5JVLA 2G3NA 4CVUA 1LL7A 4Z1CA 4B2DD 3F4CA 1LWJA 4NJGA 2HPIA 4GOAA 1E3ZA 4IQEA 2BNJA 3LSCA 1WP6A 4GQQA 5MKGA 1MW1A 2EG8A 4ZQRA 2PD9A 3CBWA 3TC7A 5AC5A 5D9PA 4PTWA 1XSKA 4GKLA 3OZYA 5DMMA 4CD5A 3Q67A 1R3QA 1K03A 2PDMA 3WQOA 4NZCA 3TSMA 1OGBA 3T2OA 3K13A 4Q6XA 4D6IA 3NA8A 4B3ZA 2Z1KA 1WKYA 5LIXX 4O11A 4HA0A 3ITLA 2QXWA 4RW5A 4FK9A 4IMDA 5BOOA 2VQUA 3FYYA 1U1HA 4IIHA 4HIBA 2XU2A 3HQNA 2ZZ3A 4IWWA 3BXWA 3QRHA 3BSGA 2IUZA 3EKLA 1T8XA 3TH6A 5K3VA 3AICA 5BROA 3IGHX 3VDBA 3WENA 2ONEA 3CS2A 5CC6A 3TFCA 3AIWA 4ZMGA 1LT7A 2WSYA 3UEQA 2DP3A 3T0DA 3VCRA 3RAOA 4D6DA 1GKPA 1PWLA 4JCMA 1ZJAA 5D30A 4H8NA 5B7YA 1XIBA 4BQ2A 1CLKA 1LUCA 2W66A 3V7PA 2CC0A 1LT8A 5CPMA 3W1MA 1FWSA 2ZX5A 1GKRA 1J96A 5HNRA 2PDCA 1QT1A 2ZUTA 5JQ9A 3A4JA 3NQMA 1Q3NA 3LMZA 1E4LA 3EOOA 1GJPA 3TQKA 2I17A 3APGA 1Z42A 2VEGA 1Z6KA 4GX9A 1XIEA 2ISWA 4MNKA 3UZ5A 5AHEA 4F0SA 3SM0A 2ZXDA 1W6TA 3N12A 3UWUA 5HPCA 1D2KA 4FX7A 4QAIA 3TTOA 4XD5A 4AY7A 1X8FA 1LRQA 1EIBA 3SGZA 5FIPA 1DJZA 3WEZA 4I9AA 4P8UA 3IAQA 3U2CA 2GPTA 4HYWA 1EO5A 4P7OA 4O0QA 2BY2A 3SCUA 3CQIA 3NQ8A 3VIJA 4UFHA 3MV01 3NDZA 2FIQA 2JK2A 2J24A 1ELSA 1B4EA 1K7EA 4IPLA 1QAPA 1CGTA 3D6NA 4YHEA 4OTKA 4XAYA 3KP1A 4ZO8A 3BAKA 3AS0A 2QCFA 4JOMA 1TVNA 1GJUA 3VO0A 1WYIA 3ELFA 3I7RA 4DF0A 4B4HA 5KMYA 1PKNA 3S42A 3HPXA 1GOMA 2WK2A 3MCNA 1HN1A 3GHRA 3H2EA 2G0WA 5BMWA 3N4EA 3QR3A 3M47A 1EP3A 3ZJ6A 3N2MA 1VEOA 4BFAA 2ZKMX 3UG3A 4WOZA 4YTSA 5A6BA 4KGLA 4IMGA 3NQ2A 1DL3A 1MW2A 4G7EA 1ME8A 7CGTA 4TVUA 1IYXA 1IR1A 1M7OA 4P7QA 1KWKA 3WFAA 1H3GA 4LGXA 4BQ3A 3VTRA 3RPMA 4JHMA 3W1UA 1OGGA 3H12A 1UR2A 2VXNA 4JNMA 3NPWA 4PTDA 2VO5A 3KX6A 3WIJA 1B31A 3L66A 3WQFA 2ZX7A 2E5DA 3ARTA 2EJAA 1TWIA 2PTDA 1DWGM 1EA0A 1PBGA 4ZE4A 5K7JA 1G0CA 1WDRA 4HCDA 5HULA 3KXQA 2ZRVA 3IEBA 1E55A 1VPXA 3M16A 5L6UA 1G4TA 2HE8A 1JZ6A 4W5ZA 2EPKX 1LZOA 2F6UA 2GGGA 4QCFA 3GHTA 1KCXA 4E8CA 5BXRA 2NLIA 4LEQA 3EOLA 4CN1A 3ZJ7A 4GY0A 4YYCA 1G5AA 3VDAA 1SPQA 1HGYA 1YQ2A 2DH2A 2I5QA 4BEQA 4BQ5A 4XAPA 1QOPA 4JQ2A 2VURA 1BVWA 1A0CA 3GBDA 4LRSA 1ZGDA 4ZTXA 4G5DA 1Y7VA 1LBFA 1GW9A 4XZBA 1XYLA 1HJXA 2AL2B 3ITGA 2EGZA 3WLLA 3R43A 3HGSA 3N9RA 2BB0A 2Z27A 1KFCA 3W71A 1O1ZA 1CGXA 2A3BA 2W62A 3GU9A 1I2PA 4A4AA 3U2EA 3W7IA 2PCQA 3G1VA 4Y9PA 1UBPC 1FP9A 4AEFA 3SUUA 2FZDA 4F0MA 4G8TA 2Z00A 3IUIA 1ZJBA 4MSSA 5JBDA 5MHBA 1O5RA 3WF3A 2VYOA 3DC8A 4JTQA 1H7NA 3UU0A 3WY1A 1ZJHA 2EXOA 5CXPA 5HR6A 4K7YA 5FSEC 1UD8A 2G3JA 2VWSA 3M0KA 3PULA 1OGSA 1V08A 1X6LA 1P0DA 1HZYA 1FX6A 2RUSA 5D8ZA 3TSBA 5J04A 4DUOA 1A53A 3SCWA 3VIOA 4KF1A 2X42A 3T8QA 4NKCA 3T09A 3MKCA 3RX3A 4U28A 3SI9A 2C0AA 2R6OA 3B9DA 2Y8VA 4IQJA 3ZVIA 3SCPA 1Y5VA 4IICA 3TOYA 1Q13A 2W91A 3WMSA 2VWTA 4CD8A 1GVIA 1BLIA 1Z7AA 4GFIA 4GVIA 2C1HA 1ZP3A 4Q4OA 4Z0SA 4MM1A 2DH3A 3H7VA 1SU5A 4ERAA 1R9XA 2EBNA 1TTIA 3A9IA 1JD9A 1XLHA 3NQEA 4ZSTA 1F05A 4AZGA 4YHGA 2PP3A 2AKMA 4MFDA 2NV2A 2ZX9A 1QUMA 1UHVA 1RJPA 3H21A 1MZRA 1S3HA 1LLWA 3GC2A 4HGXA 1N82A 3FJ4A 4IQLA 2FTWA 5IOBA 4L4MA 4KBXA 5BZAA 4DI8A 3IVUA 1OF8A 1PYFA 3UY8A 2YXGA 5IM51 3SSJA 5BXPA 1EYWA 4WKHA 1G94A 2PC8A 1JI2A 1PX3A 3DOPA 3QJAA 1TRIA 3LDVA 3T40A 3NXLA 4LV4A 5CKSA 3IRSA 1B2YA 1QW8A 3P84A 3C6CA 3LCIA 3NUKA 2GDVA 4IFKB 3WNKA 7REQB 1ZBCA 2D24A 3WFLA 3AHZA 1K1DA 5CPTA 2X7VA 3DYOA 2PRLA 3H26A 4R9OA 4MNJA 4XD4A 2HPMA 5DXYA 3SRHA 3EX6A 1KRCC 3PPHA 1MMFA 5I2UA 4HNCA 1ISZA 1TPWA 4DXXA 2WQDA 1XLFA 2ZWYA 1XH0A 4A29A 4RXGA 3DC0A 3RRXA 3ZIZA 2VFIA 4NX5A 5EPDA 4XUYA 1O4UA 1Z41A 4LX4A 4FF7A 1MNZA 4JTTA 1OY0A 2PGWA 1X8CA 4O12A 2R1PA 1M5WA 3D46A 3NGFA 1KLZA 4O4VA 3OEXA 4ZVJA 1EGVA 4QX4A 2A4AA 4H6EA 4H7VA 4DXKA 3GX9A 2J88A 1T0OA 4MNMA 4AZBA 5HWNA 3PJTA 3UBPC 4W89A 1OZMA 3P14A 1CXFA 3N13A 3W7QA 2A7PA 2VR5A 1GOXA 3CO8A 4FPSA 2VTFA 3FAWA 1ONEA 3BGAA 2VGGA 2VX4A 4Q4PA 1HO4A 3ALFA 1HKVA 1H0GA 3GHUA 1HNYA 3U5YA 1EDQA 2OT0A 4I7VA 2OLHA 1OCBA 1DV7A 1V3KA 2AMGA 4GBDA 4XD3A 1XL9A 4EX4A 1GOQA 5A1AA 1TB3A 2OZTA 1DE5A 3RHGA 4QG6A 4JTFA 5EA9A 3STEA 1I4NA 5A6AA 3WQVA 3LN3A 1XD1A 3W2LA 2PFHA 2WZTA 2QKFA 1BEUA 3V4BA 4DO5A 5FKYA 3ME3A 3K8MA 4GC4A 2QJMA 2V2CA 1M65A 3U7VA 4YTUA 2B81A 4HPGA 3MUAA 4O1DA 1J8VA 1RK5A 3AXIA 4DYJA 4R88A 2Y62A 4A8LA 1VLWA 1HL8A 2Y8UA 3WH5A 3I6RA 2PLCA 3SDOA 4NJJA 1FWHC 3CZKA 1VGAA 4FR1A 1ENUA 3IIXA 4H19A 1JI1A 4CU7A 4MB1A 4I9MA 3UYIA 2OGYA 2LLEA 4WCJA 2J8FA 5CG7A 4DNMA 1RY0A 1DKWA 4L65A 5I78A 1E5JA 2FYMA 3MWCA 1OT1A 2POZA 2WNWA 3ATZA 3HF3A 2E77A 2DZXA 2BVYA 2YCEA 4AX7A 1UMLA 3EA3A 4FNTA 1EJUC 4CNUA 4AVNA 3L2IA 3FDKA 1ALDA 3W2JA 2I14A 3W81A 3D0CA 2Z24A 5JU6A 1GOWA 1IGSA 1C92A 3N6QA 3BMWA 5EGRA 2VZUA 5A5WA 1JNDA 3T2PA 1UG6A 1QPQA 3H22A 5FF4A 3VNZA 3AS1A 4AZHA 4FXRA 4JIRA 1E6QM 2R14A 1F9CA 3A24A 5M3WA 3F2DA 3CZ8A 3FJ6A 2BV9A 1RQBA 1JDFA 1UASA 3FXYA 1UZDA 3HV8A 3VILA 1S3TC 1JZ3A 4DWSD 2CLKA 1FRBA 4UTWA 2G5WA 4ZO6A 4A35A 2PEVA 1NF0A 1X98A 1ZLPA 2A5HA 1XIMA 4N9BA 3IRDA 3VD4A 1YLVA 3AISA 2V6AA 2OYLA 1CZ1A 2IKIA 1Z89A 2A3HA 2J8TA 3SCNA 3W22A 1S2TA 1LM1A 5LNUA 2IKHA 1XCXA 5AC8A 1TRDA 3AU2A 1U5JA 3LX9A 2XWDA 2DDXA 1XYFA 4AEEA 4FP1A 2VVSA 3NQVA 4PH6A 4UCGA 3L7RA 3KOYA 1HF6A 3B8VA 2WMFA 5FCZA 1ZBVA 4WGXA 3NOEA 3TUUA 4LW7A 3E0WA 3U9IA 4RNFA 1JQXA 1B57A 1TJ1A 4WJ8A 1JYXA 3GO2A 1OYCA 3MHUA 5GPRA 3PZTA 3QC0A 4MB3A 2CFFA 1JZ8A 1GORA 2PU0A 1JAEA 4LS2A 1XWYA 1PWMA 1QBBA 3T6CA 3TYZA 4X0VA 3BGJA 4GXWA 4GYKA 1PHWA 1CLXA 4PSPA 2RGLA 3OLEA 1AH0A 1DJHA 1X1OA 1BYDA 2QS8A 2EPHA 5I3DA 4HZMA 3AXHA 3SO7A 3AHXA 3AJXA 5CJMA 2YGYA 3CWHA 5HNNA 1XJBA 1WDWA 1DQWA 3N11A 4AQLA 3TAKA 1GVEA 4M1RA 2NX3A 1UD4A 3CHEA 4MDPA 3DHDA 1QK2A 1W1VA 3EMZA 1VJZA 1XS2A 4MYAA 3LB0A 3BARA 4HBKA 1U30A 3UWZA 4JYDA 1A5AA 5EMMA 3QY7A 3KAOA 2Z29A 3CZJA 4LFYA 4LSBA 4OBSA 3HO8A 5C55A 3LSBA 4QLJA 1GHRA 2XWEA 1H5YA 6XIMA 3KLLA 4L1XA 3VM5A 1QI3A 1IZJA 2WNNA 3BCFA 2NQJA 1R3RA 2HSAA 1H0IA 3SCRA 3QTGA 4RPQA 1AG1O 3AIEA 2E6FA 3SGGA 3E9AA 2DY3A 2UY5A 2QJJA 2XDFA 1U1UA 1W3IA 1UWRA 7TIMA 3TJIA 3PUDA 4TTUA 3O9NA 2QCLA 1ZAHA 2XH7A 1X39A 1PIGA 3PC0A 3KBJA 3TYAA 3BMXA 3BW4A 5CSSA 1O6IA 2VCCA 2YL9A 3GSMA 4YTRA 2NUWA 3B8UA 4AYSA 4FO4A 3LCHA 2NVAA 1B54A 3VNLA 2OSXA 2YBUA 1NDZA 3PF3A 2E8YA 4DPQA 3GUGA 5AYBA 4ECLA 3L23A 3ARSA 1VLIA 2W63A 1UYQA 1VBRA 1OADA 3EPMA 1H7PA 2HJPA 4GI6A 2GSEA 3FXGA 4Q32A 1SFTA 3CHDA 4H01A 4E4UA 1PVNA 5C7HA 4DUXA 3S6OA 1BF2A 3KBVA 4KEUA 3VABA 1MDRA 1NSJA 3W53A 3RCMA 4IM4A 1R3YA 3AO0A 5AVNA 1UKOA 3GW3A 4H1ZA 1I2QA 2OMAA 1OT2A 4HJFA 2BVDA 3HG5A 4AWTA 4OOUA 5E0KA 3PAOA 2A6NA 3E2SA 5BYWA 5MKGB 5GQBA 3S46A 4HPNA 4PL2A 1N8WA 1XRVA 2SFPA 4DJFC 3ZLGA 3W73A 1E9ZB 3RM4A 5I02A 2NUXA 4B9ZA 2ODOA 1OSEA 4E2BA 4FIQA 3UFYA 3K1DA 3UW6A 3GIYA 2QCEA 4NAFB 2VJXA 4UTKA 4L1GA 9XIMA 2BGSA 2PDLA 1YIXA 3MJMA 4DWDA 1OFAA 1F3EA 1XW8A 2XGBA 4L4LA 3OTRA 3WF1A 4PBGA 2YXXA 1PTGA 3VKJA 1KRBC 3NTYA 1B3YA 2GSJA 5JIPA 1KR1A 3CQKA 4PMYA 1F8MA 3VNIA 2ZZ6A 3V5CA 1R9YA 1BSIA 3U57A 4O1BA 4NVTA 1VFFA 1V5XA 4FZIA 3OHMB 4MY9A 4PMZA 1QI2A 3KP0A 4X2RA 1NDVA 3M0ZA 3VD3A 4KCUA 1UIPA 4F8XA 3PJWA 3W1NA 1TMQA 2G41A 2VD9A 2W4XA 1NDWA 1Z3NA 1VFTA 1E0VA 4E8GA 3H2NA 4JDYA 3ZXWA 2C6QA 4CNSA 1I2OA 4E6MA 1F4HA 5EYWA 2EHHA 6ENLA 5IFTA 1YPIA 4UR8A 4YCPA 1TR9A 4N6FA 2X09A 1VBJA 4V1XA 4X2PA 5FEZA 2PA6A 3K8KA 2DZBA 2XGIA 5E5CA 2GGJA 2Y7GA 3EDJA 3PY2A 1QI5A 1PS9A 3O7UA 3HG3A 3KOZA 3S2JA 1RP9A 5H8PA 3ITCA 3J7HA 3WJZA 1FH9A 4NYUA 4BF7A 1WUFA 3W83A 2GDUA 2V5BA 4LRTA 1C3FA 4LY4A 3KS6A 4E0CA 1J5TA 2QAPA 1XLKA 4MHBA 2ZRZA 1CLVA 3GH7A 3IAPA 1YDNA 1V79A 3UXIA 4XB3A 3VD9A 4NQ1A 2P50A 1XLMA 3P82A 1Q6DA 2QCDB 4HOXA 5AZ1A 5EB8A 2E67A 4HYRA 2BSLA 1EYEA 4H9TA 4FNUA 4UTIA 3CUHA 2HE5A 4WDUA 4DPPA 1VQTA 3M64A 3FSTA 1A3WA 3TW9A 1DVJA 3VKKA 4GZIA 5C9UA 3L0KA 3GTFA 3VPLA 2DT3A 1VCGA 1G9HA 1QNQA 4DVOA 2P3ZA 5TD4A 1YTEA 3WDRA 1AODA 1THFD 1RLCL 4GXPA 3RLGA 1JPMA 1ONRA 3E96A 2X1TA 1KC7A 2J7GA 3CIXA 3RM9A 2XISA 3WLHA 3QMSA 4B5UA 4YTQA 4LOCA 4R5EA 5AHIA 4PMDA 3URBA 2IPGA 1I2RA 3DYMA 4LCQA 1DHKA 1IV8A 3BTNA 3CK5A 2DEPA 4G1KA 5CPLA 3DFOA 2ZIDA 5G5IA 3WQ8A 5E6YA 1QNOA 2CLFA 5CSRA 3VC5A 3WQCA 3UR2A 4ATDA 4OJYA 1ZNNA 2FTPA 3NQGA 3TX9A 4L9ZA 3PZUA 3SIMA 3LTYA 1S1PA 3GXDA 4C6DA 3VOIA 4N0RA 1PV8A 2DSVA 2VP8A 4TQTA 3WNNA 2FVLA 5D05A 1XQKA 3LUTA 4MY1A 4S3EA 3GKAA 5C9XA 1DWHM 2BTMA 1DWJM 2V69A 1H63A 2QUMA 3CT7A 5G1TA 3F03K 3OQ8A 4WUIA 1U5VA 4IT1A 3SN0A 1HVQA 2DIJA 4PA8A 5D2VA 3VOGA 3LQGA 3LZ5A 3S9IA 4AHQA 2QDGA 4EP8C 3H4XA 1VKFA 3AZTA 1V0KA 1KTBA 2D20A 4PULA 2WVSA 1UP0A 2ZE3A 4LUSA 4PMUA 3KL5A 1SZRA 4ML4A 3UZXA 3LENA 4TR9A 3D3FA 1EFZA 5BOFA 1K70A 3VXGA 3SIZA 4ICNA 1KFWA 1DWIM 1X6UA 3MV11 1M7XA 1BAGA 4GI9A 4MKNA 3TK7A 2E6YA 3KDNA 4GD0A 4AD3A 4JN8A 1RCXB 4JX6A 4M19A 1UOZA 1E70M 4H9ZA 1JRBA 2ISDA 1AUSL 3EXRA 4Q33A 3O0FA 1GQLA 1TG7A 1YE4A 3AYTA 2DIKA 3E5BA 2OTDA 2PF8A 5DANA 1XI3A 4O54A 2EQDA 2HNHA 1QBAA 2O4QA 4ZTYA 1HVXA 4CNPA 3VA8A 4HMDA 2QMJA 1BVNP 4G6CA 1QTWA 4YVXA 3T8LA 4JNZA 4NXKA 5FSDC 2JKPA 4ACZB 4C1LA 3NOYA 2ZVRA 4YU1A 1FKWA 1J0ZA 2QCMA 3UCDA 3A4AA 2PWVA 4KMQA 3C2FA 2OODA 3UXKA 3FCPA 5AZ0A 3GUWA 1D3HA 4NYYA 5H6HA 4Z42C 1XGZA 1GVOA 4AX6A 1RALA 1IEVA 1IXNA 2PGFA 1WOBA 4L6HA 4WRHA 4ES4A 1TV7A 3DDMA 4EWJA 2J7HA 2NQ5A 1Q5MA 3PBWA 4GIAA 4LVDA 4FI4A 5D2TA 1V7AA 2E0PA 2GJPA 5AVHA 3TVAA 2BLEA 4JIIX 3KLKA 3ZT5A 3KS5A 2Q8XA 1C9DA 2CBUA 5I3HA 1E4MM 1W3LA 2P10A 4HZ7A 4AWUA 3E12A 2O9RA 1V4YA 3MA8A 5FF0A 2QJNA 3MI3A 4IF2A 3S5SA 1SSGA 3MKVA 3GFXA 2ZA2A 1EDTA 4IISA 2FZMA 4Q6JA 1GQKA 1XLCA 4Y9OA 1BYAA 1I8JA 3HQOA 2YCLA 3QGAC 1E51A 3GK0A 4MJ4A 2QR6A 1GEQA 1UR4A 2OKOA 2ZVIA 3VOFA 4JKLA 5FJOA 2JFEX 1L2UA 2VX6A 4CQAA 1JZ7A 1K8XA 3RU6A 3K4WA 3DHFA 4UTFA 1I9CB 1WE5A 1JCTA 1P1MA 3A22A 5FF3A 2BY1A 3H4WA 1CW2A 1PPIA 2GFTA 1BD0A 1E0XA 4UQBA 1JZ4A 3RN6A 3PS7A 3VVGA 1UH4A 3PSWA 1L9WA 1M04A 3RYSA 3L5MA 1LORA 3STCA 4P61A 4HSHA 4A2RA 2OO0A 3ERPA 4BKNA 2G95A 2GQ8A 2INZA 3LMYA 1LL4A 1Z69A 1OCJA 1R7OA 4RKAA 2ZCGA 4ZQNA 1P5BA 1C8QA 3LXCA 4MJ2A 1KV5A 3UZWA 4GC3A 2PGRA 5D9MA 4PUJA 3EA1A 3KTCA 1J2BA 3QLDA 4A6GA 3JRKA 4AXKA 8TIMA 2J79A 4BI7A 1KM1A 2VZSA 2ON3A 4DBDA 3DN5A 1KCZA 4GQRA 3FY1A 1KBLA 2F9RA 4OKDA 3RR4A 4XZMX 4KEMA 5KZ6A 4DO4A 2HXUA 2FKPA 4HN4A 4JYEA 2OOGA 5HNTA 2VC5A 2ZUNA 4Y90A 1FCBA 1XBXA 4GYPA 2OX1A 1JG9A 1V8EA 2VNCA 2WM0A 5I24A 3KHJA 1OABA 1GOOA 4ONVA 1UA7A 4O15A 4XZNX 3WLTA 2PS2A 3VIPA 2I56A 4WD0A 1V77A 1XIFA 3OBKA 4C6QA 1AVAA 4FEZA 2ISFA 2ZRUA 5CBJA 1LWIA 3ES8A 1GVRA 3T7VA 3MUXA 4Z2JA 3N04A 3PUOA 4TXEA 1ITXA 4ICMA 3QPEA 5ECUA 4AHOA 1IGWA 1AFSA 4L64A 5A8OA 4RK8A 2EG6A 5CLWA 5DT5A 4DJFD 1JFXA 1F8IA 2JGQA 1ZY9A 3CC1A 4ORIA 2QT3A 4U2ZA 3VIGA 1HL9A 3QF0A 1R47A 5GJPA 2R91A 2TMDA 5DCDA 4D2JA 3WQEA 1JDDA 1JFHA 3MYOA 1SMAA 2HNEA 2OVLA 4AD0A 4IFOA 5C9RA 1PZ2A 2FJKA 4UNKA 1X7FA 2OO6A 4S2BA 1TR1A 1FHDA 2YCLB 1LP6A 1IF2A 3SRFA 1LF1A 4GQGA 1Q6CA 2VEIA 4BS0A 4MF4A 1VCVA 4HHLA 4L5ZA 3WNPA 3DU0A 3VMNA 3AZSA 4K8GA 4J3XA 2CBVA 4X3ZA 1ISVA 2VMFA 4JTEA 4GLEA 4B4FA 1RBAA 2NX1A 3QZAA 5E9AA 1SO5A 3TC3A 2BASA 3SY8A 1K9FA 4UTJA 1SFLA 3BICA 2DT0A 2A6LA 3ANUA 4NI8A 1V93A 4FOJA 2CLLA 4Z1YA 4YYFA 4QG8A 4CN6A 2V5LA 3IK2A 5EU9A 1W5NA 2Z1XA 4H8HA 4UFIA 1Q7MA 4PBEA 4PR4A 3LHUA 2FGBA 1A47A 2FZNA 1CI1A 4CEUC 2C0HA 4XO6A 3C0QA 3Q45A 3KEHA 1G67A 3E0VA 3TZNA 1MEHA 2ALDA 3W1TA 4QRNA 4GINA 3KFTA 5I3IA 5HUOA 1XC6A 1E4IA 4LXFA 3R13A 3HOJA 4FLQA 5AHMA 4ADTA 3MYPA 3O2LA 4RUBA 5E9XA 4F9DA 4UR9A 2C7FA 4NNAA 3TWAA 2J62A 4AWSA 1D3GA 4NI3A 4IL0A 2PTWA 4HK7A 3LOTA 1ISYA 3BQ5A 4UIOA 1J6OA 3CTLA 3CT2A 2E28A 4NRSA 6A3HA 2ZYFA 3H70A 3CZGA 4IIBA 1RVKA 3M0HA 4Q8UA 3W24A 4GUJA 3W01A 2GDQA 4KWOA 3PJUA 1Q6FA 2WMIB 4L4PA 4M6QA 1R3SA 2E40A 1W1A1 5A8GA 4NAEB 1VJIA 1FUYA 1YW1A 4IZGA 1GGOA 3BOXA 4AXNA 4LNCA 2VENA 1CXHA 3R0UA 1Y65A 4X60A 3MUCA 4NAEA 3WUGA 1R6WA 3GR8A 2FHBA 2X2GA 4FSAA 4QLLA 1OCQA 4GIYA 4YTTA 1TCMA 3URQA 4H6KA 3OZOA 2WANA 4PRRA 4DO7A 4KS0A 5HK4A 1VHCA 4AY8A 2YL6A 4IPIA 4H6QA 3GNXA 1S2UA 4E2DA 3RILA 2ISSA 5I3KA 1C8XA 3GXPA 3VFCA 3TYEA 5GNYA 2JEQA 4O8AA 4W87A 3W28A 3R11A 3PTKA 5AHFA 3CIVA 3TCEA 2QIIA 1GEHA 1EPXA 1K6AA 1W37A 3ECQA 4JN6A 3VIMA 3ARZA 4CNTA 1AZ1A 1PEZA 5G4HC 3LM3A 4ILSA 4A3HA 1JDEA 3EX1A 4F0KA 6REQA 3CV2A 1KM3A 2YFOA 5DCBA 4L61A 5KZEA 2W0UA 3OVGA 5M03A 1GTEA 3ORWA 3KHDA 3TDFA 4M81A 4HA1A 4V1YA 4M6UA 2AQOA 7A3HA 5ABFA 2GVJA 3UVIA 1WA3A 2O9TA 4JL1A 1BXNA 1ZSXA 5DBTA 3Q65A 4O52A 3EDEA 1A5BA 3DFSA 4E4PA 2OEKA 3E49A 3P8IA 4AZCB 4ZEPA 4I5RA 2VX5A 4D8AA 5DLCA 3V5OA 4GH1A 2B0MA 3L67A 3KCOA 3WUEA 4RPPA 2PDKA 1FKXA 4L80A 3SRKA 2E8ZA 1TWDA 1DQUA 1XLBA 2AL1A 4V28A 2R1NA 1CXEA 1XBVA 4ALDA 3ARWA 4JTRA 4H9UA 3KBWA 1TPVA 3ATYA 4GFSA 3H23A 3ABQA 1WBJA 4Q4RA 5FJIA 1I0BA 1F76A 5FL1A 3H7UA 3PBVA 4XK2A 5CGTA 1RBLA 3DEQA 1A5MC 2DSKA 3FA4A 4W7WA 5HR7A 3F5LA 4POCA 2PPGA 4UTMA 4MY8A 5HMFA 1MZHA 1G1YA 3ES7A 3ITVA 4GQBA 1OFEA 4FNSA 3AXKA 3S1GA 1ZJIA 4HNUA 1OFDA 4DBUA 2XHYA 3AUOA 3OYXA 3M44A 5GNZA 3TONA 4GY1A 5E70A 5DY3A 1JGMA 2QDHA 3RCNA 5E93A 4GUGA 3GG8A 1E40A 1DORA 1Q6OA 1MQRA 2JQXA 2HV5A 4Q4MA 3GXTA 4UQEA 2YBTA 4DJEA 1OB0A 4K7VA 1WDPA 2FGZA 1XDMA 3HN3A 3BG3A 4JEJA 3ZJKA 1KXTA 3SSZA 2ZDSA 3PNZA 1AD1A 1DQXA 4I5UA 2Y24A 1XYZA 1PZ1A 5FEPA 3R1ZA 4XSLA 2DU2A 3BH4A 3A3WA 3HM7A 1EOKA 3BE7A 3BAIA 3VU2A 4AD5A 4LU0A 1QPKA 4XZIA 1VHNA 4U3AA 2JEPA 1JCXA 4PUUA 4WSKA 3OG3A 4RZBA 3LI1A 4NT0A 5FJTA 1UCWA 4W88A 1H61A 4NZ4A 1M68A 1HP4A 2FMOA 4HKPA 3O6AA 4XTIA 3VMOA 4IOTA 2KZHA 4LAUA 4IXHA 1KCLA 3QXBA 2GL5A 3NVDA 3WFZA 7PTDA 3U4FA 5M2FX 3DERA 1ONWA 3CUJA 3LXAA 3IJIA 3IS4A 4I8DA 2ZUSA 3N14A 3PP7A 1GW1A 3NPXA 4U5IA 2YDAA 1LDCA 1Q6LA 1UR0A 2CPUA 1N8IA 2ZADA 1W0MA 3GYCA 4X22A 1W3HA 3G1FA 3DFTA 2VRKA 4S23A 4PCSA 3T05A 2YCKX 1ISXA 3IIZA 4HA4A 3N9KA 1WQ5A 4B3KA 2PUZA 3GM8A 4ZOAA 1DXEA 1SO3A 1XISA 3VNYA 4GZ7A 2B7NA 1IZCA 4XBSA 1DJNA 1G4PA 2OGJA 1UZ1A 2E7FA 3EWXA 1NWTA 3JVAA 3RXZA 3RX2A 5JBFA 2YXOA 1ICSA 4GNJA 4K37A 4XUGA 3W7JA 4Q7NA 2PDBA 2TRSA 4L56A 4OUEA 2EEXA 1TV3A 1GK8A 1UD2A 1OC7A 1V7YA 3WK0A 4KT2A 2DT2A 1TE1A 4IJCA 4PTMA 2FPTA 4EKJA 3N29A 4I9JA 4AMAA 4K68A 3WD1A 4HP5A 4DELA 2J9XA 3RITA 2P3EA 4MGGA 2UY3A 2GJXB 4O0ZA 1SJCA 3BLLA 4GABA 2WLZA 2BP1A 3L5LA 1BGAA 3TMQA 4AG0A 3QH2A 1MI3A 2DVTA 2W27A 3F4DA 1MRQA 2OWCA 1A0EA 3V36A 1XIHA 2I57A 3WF2A 1E1CA 1NIUA 2QCDA 2XSBA 3B0YA 4O14A 3W7OA 2GLKA 1CPUA 3IGXA 4C6LA 2ZBTA 2ZUUA 3KL0A 3UA4A 4RV8A 4QFUA 3VM7A 1A80A 3WJSA 3M0JA 1W3JA 3MANA 4JR5A 4DJDD 3V5FA 3M43A 1UQYA 3W85A 3CUZA 1A5OC 1B5TA 4OU1A 5GNXA 4KERA 3ITXA 2WOQA 4HU8A 1RLDA 3GYEA 3THCA 4H9MA 3GQYA 1E9YB 2XN0A 3PANA 2C18A 3ZR6A 4IG2B 4W4QA 4ATLA 3N2CA 1HFBA 3IJDA 3AS3A 3WDHA 3G1XA 1EEXA 2PBOA 1W5OA 4RR4A 1OK4A 3IJ6A 1KFJA 1V6WA 3VINA 1REQB 4C6EA 4HNVA 3OOQA 1F7BA 2QNEA 2WZIA 2NQZA 4Q8VA 3RDKA 2RDUA 4JY9A 3NL6A 1XC4A 3G1AA 3BURA 4UMBA 1ZP4A 5HJYA 4CCZA 4E4FA 5DMYA 1V3LA 3T0BA 3S1XA 3G8EA 3O1NA 3O16A 1RR2A 3SZ8A 2PI6A 3QHMA 1X38A 2PLKA 1XIGA 3UT0A 1A50A 4MTVA 3U5UA 2CLIA 3WH7A 1HKMA 3PJXA 1I45A 3R89A 4HU4A 1ZQ5A 4H7ZA 4S3CA 4US6A 4TX6A 1UZHA 2DW7A 2E1DA 2YIHA 3UVAA 1XKJA 3I7QA 3RJYA 1DE6A 1BGGA 2OQHA 3UR8A 3NDYA 1AQHA 1NFPA 5LIWX 3WK1A 3B0XA 4IFKA 3TIMA 5LYRA 1GTHA 3KRZA 2R9RA 3PZVA 3HZ3A 2OXNA 2BWGA 4RDZA 3F2CA 3FX4A 4C65A 2YDSA 3L0NA 5F2IA 3W76A 2C8NA 5AYXA 1NJJA 3NZ1A 3OGRA 3NQ6A 4AEOA 1Z44A 1A5LC 3MUIA 2X8RA 4N42A 4P8WA 3W1LA 3UJSA 2ZQ0A 4RW3A 1DOSA 2WV8A 4BR1A 3FS2A 1EIXA 1QVBA 4CUCA 3XINA 4YMZA 3QGKC 3ARXA 4XKYA 5G1YA 4H2HA 3LQLA 3B9EA 2IKGA 1AA1B 3B8TA 1HL2A 4Q4KA 5ABFB 4JTSA 5KZDA 1T99A 2HEJA 3ZSTA 4JPGA 2DZWA 4WK9A 1XG4A 1JYNA 3ZR4A 2CZDA 2GQ9A 2DFAA 1KQYA 2GYIA 2NQHA 4JICA 1W3NA 3IJ9A 1Q6GA 1EHNA 2OB3A 3FKKA 3W00A 5GJNA 1BKHA 1QDSA 4XBJA 2OT1A 2XH2A 3VDCA 1VIWA 4J35A 4ORMA 1BWVA 3OGSA 1B4KA 4Z2GA 1Q65A 4LS0A 3TQPA 2GK1B 3GU2A 1K9DA 1RZMA 4Y8EA 2Y85A 3PR2A 1X7IA 3TW6A 3P61A 2R82A 3IIOA 1ZU8A 2QJIA 1AZ2A 3LS9A 1SZEA 1W5MA 1BQGA 4PCTA 4ZENA 4GO9A 5BU9A 1A0DA 3UG4A 3A5FA 1OFOA 2VM8A 5L9FA 4JTUA 3ABSA 4PE8A 3UJFA 3BWWA 1FDYA 1C29A 1EEPA 2WMIA 2YYUA 4QHRA 1EZ2A 3K5XA 4WY0F 1H1YA 2GGIA 3LXBA 4W84A 4O1CA 3STFA 1NWSA 3PG9A 3OVRA 4ZL1A 1QR7A 3UZYA 1W9DM 3GTIA 4LYKA 3B9OA 1PKYA 3T42A 2CERA 3K2GA 4IMCA 3B4YA 3TW7A 3FGCB 1OBAA 3EWWA 2D2JA 4DYEA 2DUAA 1RH9A 5IDZA 5EFFA 1Q85A 4AIBA 1V0MA 3RUBL 3EWZA 4CQ8A 3MDWA 3NQFA 3WJWA 4JTJA 4ASTA 3W82A 1HT6A 2YX0A 1P1XA 4UNIA 2ZC1A 1W8SA 4HQVA 5FJUA 1WXJA 2QQ6A 2DZPA 3DFHA 4YWIA 3CMGA 4LC8A 2WW5A 1KTCA 1M9HA 1FWBC 4O17A 4PUDA 3RLHA 1EX1A 1VFHA 4HYVA 2ZUVA 3QKEA 5G2HA 3WD2A 1YXDA 4I7UA 3MP5A 5FACA 2V9DA 2G4FA 4S3GA 5AYZA 3TNBA 4P2VA 3SECA 1P7TA 4FAMA 3DFYA 5F2GA 4F0RA 2QULA 4S3FA 4N2YA 3SUVA 4YPJA 2PDQA 2BODX 5BRPA 4JIHA 3WLQA 4BK9A 1KCKA 4WR3A 2WMGA 3O15A 4O1EA 4ADUA 4GA8A 1TFVA 1TTJA 1BTCA 4W85A 4OUIA 2PD5A 1VC4A 1QPNA 2C1GA 1JNEA 2VFGA 4W8LA 3S2NA 2G8ZA 3UJEA 4HNOA 1X96A 4IP7A 2OWWA 2VEFA 4WJXA 2XH0A 1JRCA 4KCTA 2FZ9A 4ACYA 1WXYA 4CQ9A 1XHGA 3I4KA 1MW0A 3N3TA 1R2RA 3BW2A 4CCDA 3CL7A 1YBQB 2PDJA 2EKGA 3PPGA 4ZO9A 5XIAA 4CLMA 1EUNA 5G2IA 4R7OA 3NGJA 3BDKA 2B7PA 2HISA 3GWQA 4AIUA 5I77A 4AZ7A 2O56A 1BRLA 1F61A 5EMKA 1XSJA 3WBYA 2WWDA 1O1HA 4U10A 1AJ2A 2PWHA 2Y7DA 1ZCCA 3TE9A 5D38A 4IXXA 3ZOAA 4FNRA 1JXJA 2XFRA 1R0MA 3IK4A 2BGNE 5XINA 3O6CA 3WDPP 7XIMA 2YZ5A 3EB2A 1OQFA 4S3JA 4WX2A 5U7SA 2NXGA 1B3XA 3W2KA 1U22A 4RE0A 3B05A 1LTDA 2QCHA 2TSYA 4JGDA 3IVSA 2HWGA 5A6MA 5CJ5A 1ZUAX 4LH8A 3N19B 2QIWA 3OVPA 1XR2A 3WKZA 3WBAA 1SVDA 1QJWA 2IQDA 3BO9A 4GCXA 1UWAA 1Q6QA 4K8HA 2QEZA 2V3GA 1EQPA 2TPSA 4YCOA 3ALGA 3T81A 3N6HA 4O18A 4D6HA 3FLUA 5C2GA 1VFUA 1W1YA 4AC7C 2CBJA 3T2QA 4FIRA 1RVGA 1YDVA 3RRAA 4LVBA 2C16A 2J7EA 4TVDA 2F2KA 4XISA 1XYAA 4FB7A 3WQ5A 1UWTA 3TR2A 5EMUA 4CU6A 2I5IA 4Q8PA 1PJ9A 3DFNA 1GPFA 2REQA 4GZEA 1TMHA 3AU6A 1YEYA 4EXBA 3DG6A 2VR4A 3G2GA 4MAVA 3MTWA 3ABOA 2WJEA 3G8RA 3NZPA 4QNEA 2GWGA 2GGHA 3FKRA 5AYYA 4QP0A 1CGYA 4XZHA 3K46A 4JFVA 2AL2A 1GZ1A 1T96A 5LNRA 3GG7A 3GTNA 5A3HA 2CW6A 3GE7A 3VNDA 3C5QA 3LV6A 1U83A 4GJIA 4QNWA 5IRPA 1V3HA 3EMQA 2F8QA 3AIVA 2RJHA 3WH6A 1JF5A 1SMDA 3AIRA 3UXDA 2OYKA 1IIHA 2HDJA 3PFRA 4ZA0A 2VZVA 2P88A 4TU1A 5DQPA 5DX7A 2QAFA 1TVPA 4NG3A 3VGDA 2CYGA 4QDMA 1HJQA 1NEYA 5IFPA 2RFGA 3BL3A 3ZWTA 1FHUA 4C7FA 2WWCA 4JTLA 1S2WA 4IIEA 3W7EA 2H9AB 3N18A 4H41A 3URNA 4GCAA 1M1BA 3W38A 3R6IA 1YX1A 5DBUA 1UR1A 2GJXA 1LOLA 3CAWA 3UF9A 4E2OA 2FDMA 3MSDA 2VL4A 4W86A 4QR6A 3ZT7A 2RDWA 2HVNA 3VX0A 1MQQA 2CBIA 3DI1A 1WZAA 3SJNA 3FHQA 3WLKX 1C90A 4H8VA 3QEZA 1XV8A 4HMCA 1UW9A 1TV5A 5C70A 3SAZA 4REQB 1PUDA 2XYLA 1QO2A 1DXIA 4GJJA 3NZGA 2ACUA 5C9WA 4P8XA 1QNVA 2VZOA 4C6IA 4BQ4A 4RL3A 4ZB2A 1J5SA 1V6UA 4GYFA 4IPJA 1GYMA 4FXSA 4NHVA 3WLNA 3LHTA 4GG9A 4KRTA 1R30A 4QEHA 3E02A 5JMUA 3REQA 5RUBA 1KO0A 1EF2A 4CNOA 3BMVA 3ZO9A 3GU1A 1WZLA 2EO7A 2PE4A 3MMUA 1LQ0A 4DHGA 2O55A 3HG4A 1QNRA 4URIA 4KWWA 4LJ3A 1DJWA 3GVWA 3R0DA 1TTPA 3ZQ9A 1D8WA 4HPJA 4V15A 3THDA 2HK0A 4M5PA 4QIUA 5CAKA 3MP3A 1FXQA 5CBBA 4W8BA 3DHUA 3QOKA 3VKBA 4C6PA 1XKYA 2WSPA 3SR7A 4J40A 4A8RA 4HU3A 3JU2A 3WQWA 4U4MA 1AJZA 1AW1A 3QZEA 4H2CA 4AHPA 3TTSA 3K8LA 2Y4SA 4R34A 3QYQA 3K1GA 5I09A 3UYCA 2J6XA 3KZPA 2PWEA 2Y7EA 3DIPA 1W1ZA 3EXSA 1JPHA 2XM2A 3WBEA 4PEKA 2CZVA 3ENLA 1UKTA 2H8XA 4LWWA 1EJXC 3EWYA 5HA7A 1PCKA 3PWAA 4C60A 3HPFA 1WXZA 4CD7A 3WL1A 1O66A 3QY6A 1H49A 3EX2A 1AMYA 1YBQA 1YNPA 1EL3A 1O5QA 4P7NA 5K4XA 3QQ0A 1ITCA 1SR9A 3UG5A 2P8CA 3PB0A 2V0TA 2FHCA 3CYVA 5HQEA 4PUMA 4O0KA 4BHYA 3LI0A 2WAGA 5AECA 2PWDA 3BLEA 3WQ4A 3WEMA 4MLRA 5I0DA 4XIMA 5I3GA 1QFEA 2G97A 4LUIA 2JALA 2PB1A 1CT5A 1S5VA 1MQPA 5M5DA 5IBXA 2DPEA 3BV7A 1ODZA 1OINA 4OV4A 3NZQA 3UNTA 3V1PA 3KOXA 4N9EA 2A85A 3PWIA 2WVVA 1E6SM 1M03A 3AHVA 3N2XA 3OZMA 3BAXA 2DZTA 2Y0FA 2V5JA 3TN6A 4HT3A 1EQCA 4W9TA 4AVFA 1MSSA 1K8ZA 4QISA 1T7LA 4UOJA 1C7TA 1LG2A 2P1FA 1E6PA 4C6KA 4UUIA 3STPA 3SQLA 1VCFA 1UC5A 2D1ZA 1TZ7A 3IUDA 3P5YA 3UGVA 3LYEA 1DJQA 3T1GA 3W7MA 3TZFA 2OWXA 1ODUA 3REQB 2VUNA 4P8VA 2F6KA 1MUCA 5D33A 3DBNA 4KQNA 3IIVA 1PHQA 4F0HA 2A3CA 3N17A 5SWUA 5JH1A 3CMFA 1RPXA 3QPZA 5H8MA 3FW6A 4FOKA 4M7SA 1FH7A 4J2MA 4IG2A 1XBZA 3PK7A 1OX4B 3WQPA 3S9ZA 4IFRA 1VFOA 4M51A 4DUVA 4J27A 5CPQA 6ALDA 1K7XA 1NQKA 1W5PA 3W2MA 4E3TA 5K4ZA 3RPTA 4ENLA 2VFHA 3GD6A 3VD7A 1TSIA 4FS9A 2R1KA 4XVDA 3ABXA 3TP4A 3MHFA 3LPFA 1MEWA 2I9UA 3CHVA 2AKZA 2BDQA 3O07A 1I2NA 1DIDA 1TV4A 1RP8A 3TC6A 2ISVA 3TN3A 1F5ZA 1H51A 3PB2A 4L7ZA 4EPBC 3L4XA 4H6RA 1CIUA 2OEJA 1G6CA 4WGHA 3GIQA 1K9EA 3ZT6A 4IMEA 5FD0A 3WH9A 1VYRA 3AMKA 4BJHA 5D9NA 1O12A 3FV9A 3TJ4A 1H41A 1BWLA 5AOUA 1EUAA 4P7RA 3R8GA 2VFDA 1OCNA 1QI4A 3SURA 4Q7BA 4Z2LA 4I90A 2PODA 3B0VC 3P3BA 4WSHA 1UJPA 2H90A 2Q01A 3LNMA 2H6RA 1XLJA 1XPGA 3SEPA 5BWAA 5KEZA 1E5NA 3AIUA 4LBRA 4MMWA 4CQCA 5ECVA 1HXJA 1VEPA 3GVGA 2AQVA 3B0PA 4MVAA 1QATA 1WDDA 3EYPA 4JY8A 4C6CA 1WDSA 2ASHA 4AZ5A 3I6EA 5CLTA 3CPUA 3QM3A 2D69A 3FA5A 1ZHAA 1P6BA 3AMGA 3PZNA 1EHAA 2Y1HA 3C3UA 2UWFA 1DJYA 2QYGA 2Z7GA 5FJPA 1VYPX 5HANA 2CHNA 1HP5A 4EXAA 4OBTA 4JFWA 3KVJA 1XDJA 1Q4WA 3DFQA 3KTSA 2GGEA 1LRTA 3E38A 2Q09A 1LL6A 1DHPA 3WEOA 5A8QA 2GVEA 4NNCA 3H4GA 3W86A 2YA2A 3KDOA 2XGZA 5H1WA 1MO0A 4K36A 1DPMA 1S1RA 3QFEA 1QPOA 2XUCA 4AYGA 3HMJG 1TVLA 2WCAA 3SRDA 3AIBA 1SO6A 1OVDA 2HCVA 2CNCA 3RLUA 3VCCA 3BSMA 4YVVA 2DUZA 3W1QA 1LG1A 3SCOA 4EACA 3VDHA 1IWPA 1WV2A 1PSCA 3VC6A 3PSVA 4KFPA 4O53A 1R86A 1HX0A 1NARA 5HJXA 1DBTA 3UERA 3QC3A 5HPOA 3WG6A 1VBGA 3EWBX 3ID7A 3UJ2A 3XIMA 1IWBA 3INPA 4ZBCA 1V6TA 4D6GA 4QCEA 1B3ZA 2YA1A 1JZ2A 3L68A 2VFFA 1F3XA 3VX1A 1J79A 2EPMX 1OG0A 3CPRA 4L9YA 3VZXA 2F7FA 3MZ2A 3GS6A 2QMKA 1GUVA 8RUCA 2D2GA 4DF1A 3A4WA 1NVMA 1R5YA 3HU7A 3WLOA 1CECA 1XRFA 4EXQA 3W2UA 2P53A 3CV6A 3OB8A 4AVOA 1RV8A 3AWOA 2WNQA 3HURA 5FEXA 5D9OA 4JQAA 3VMPA 4C7DA 3T9PA 4HMEA 3E6EA 3UGRA 3P74A 4S3AA 4KETA 3HPSA 1JCYA 2CETA 4WLCA 4J3ZA 2XTKA 3I4EA 3OP2A 1TV2A 3IJ8A 2CU0A 3F7JA 1KKOA 3SCQA 1HGWA 3PZIA 3TTEA 2PLJA 3IGUA 1TCDA 1ADSA 1S5TA 3A4XA 1BVZA 3TYUA 2INFA 1F74A 4WDXA 4U2YA 4HNTA 3WJYA 2DIEA 3VOJA 4R9XA 3G77A 3SJ3A 4HPHA 1S5WA 3PBMA 3EAUA 3M7WA 4LPCA 1R46A 3QN3A 3WF0A 3G1HA 5AYIA 1EPVA 2I1OA 3N25A 3R58A 3C2YA 3U4AA 1ZCOA 3LTSA 4XAGA 3P7YA 3AS2A 3DX5A 3W23A 3MVIA 3WDIA 3ZS4A 2RJGA 3O6YX 3VK5A 4FMVA 2KAUC 4EF8A 5J5RA 4M24A 3OJGA 4LAMA 1L6WA 3NM3A 4WXZA 3R25A 3ZLFA 3HGOA 1W91A 3HMCA 1E56A 4HHPA 3R5EA 3M0MA 2PDIA 3QYSA 2BY3A 2E5BA 4H83A 1VRXA 4HN8A 2DZSA 4INFA 1LBLA 3ZVHB 5DN1A 3GNDA 3IVTA 4NZ5A 1JCMP 1EJVC 4PB3A 1GONA 3CV7A 5CZKA 3HFTA 2ZZ2A 4AF0A 4K1WA 1P0KA 4LCRA 3QVQA 1T8QA 3B9NA 3TQVA 2RAGA 4MG4A 3E3HA 1W54A 1DIOA 1FWFC 1I75A 1UUOA 1H7OA 4LTSA 2QUUA 2FZ8A 1HO1A 2P5NA 2X0HA 1ICPA 4KGJA 1MWOA 2R1MA 2H3DA 1TZ9A 3S5OA 2ZZ7A 2XN2A 2IMRA 1ZB5A 4H7CA 5IHSA 2ZXQA 3WUBA 4DJDC 2RHGA 4WXYA 3FAXA 1QW9A 4G56A 2GWNA 2VQTA 3BVJA 4KEVA 2Z28A 3PAJA 3BC9A 3HPAA 2Q3RA 3O6DA 3T55A 2OQLA 4PTXA 4KKXA 1E0TA 4MKVA 1KNWA 5I79A 1WBHA 4J28A 3CH0A 3M0LA 3IJLA 1OYAA 4KWUA 3G1SA 4JFTA 1TMLA 3QR1A 1TUFA 1ITUA 3E1F1 4GO8A 2ZA3A 3MCOA 1W2PA 2QHAA 4RE3A 2EKCA 3GZAA 1JDCA 4XG1A 3TKFA 1WKFA 5TNVA 5A6BD 4HHMA 1DEDA 3QY8A 1CGWA 2ZDRA 3V35A 2QDEA 3S6TA 4KPLA 3O3RA 6XIAA 3OPSA 2A7NA 1ZBWA 3SW6A 2VFEA 4OECA 3GG0A 5CC3A 3Q2DA 1CBGA 4EK7A 2EAWA 1YTKA 4GXMA 2ZZ1A 4O4WA 1I0DA 1W32A 4YXGA 4LF1A 3KCLA 4AZCA 3C52A 4OT7A 2OX4A 3VGHA 5I03A 3LK6A 4MFEA 1QHOA 3CL8A 1EBHA 2BOFX 1IXPA 3OA3A 2NSOA 4L6DA 2VDIA 4F66A 3ITTA 3O06A 3WLIA 4EAYA 1DJGA 2Z26A 1RA0A 4CEXC 2WQPA 1HJUA 1BG9A 3H54A 3EPOA 2XVNA 4XZ9A 2VGIA 1KR0A 4RV3A 3ZVHA 1GG1A 2PWGA 4FHAA 4EPDC 4MUPA 2OLAA 1FQ0A 4C1NB 5AFDA 3I65A 5C6MA 2V3DA 3F5KA 3EB3A 3W84A 2DUXA 1BXBA 2E25A 1BYBA 3NM1A 2WC7A 3H2CA 4O50A 4BZYA 4ML9A 2A21A 5A6TC 2X1RA 3B03A 2ANUA 1RD5A 3I6TA 5CGMA 1JGIA 4DJEC 2E68A 3GDKA 3QBUA 4PUNA 3VKAA 3WMBA 4BEUA 2YDRA 1GHSA 2GOUA 5A8MA 2W67A 3CXOA 4O28A 1G4EA 2J7CA 2GZXA 1KXQA 3RMEA 3CL6A 1TTQA 3D3AA 4LYRA 3BZGA 3BV4A 1GVQA 4G9PA 1FWRA 3C0SA 4GUIA 3GH4A 4JHZA 1LRNA 2V2HA 3ANVA 5D02A 3ARRA 3GH5A 3R7MA 1J9YA 4DNHA 4JIPA 2CCRA 5I00A 1NP0A 2FB2A 4QJ5B 3AHYA 3W70A 4X9YA 5G4EA 5HMDA 1OF6A 4I7WA 2YCJA 1UWUA 3SCVA 4CN4A 4Q8MA 3DXIA 3L12A 1UH3A 1YRRA 1XYBA 4GNVA 2ZOXA 3QV7A 5FJRA 4BI6A 4LB4A 1EGMA 1HJWA 1J0JA 3TJXA 4PZVA 4CD4A 3NQDA 4IJBA 4MZ1A 1EJTC 2QGHA 3LCLA 4ZR8A 1E1FA 2QUTA 4AD4A 3OGVA 4JHOA 3BLFA 4ACZA 4GX8A 4Z1BA 3FJLA 1HUVA 1E6ZA 4OWGA 3GC4A 1R9ZA 1W9VA 1RD6A 2PMQA 3W7CA 5F1VA 4C90A 1SW3A 2ZZ5A 1Q63A 4QLKA 4WDTA 1KWGA 3USZA 3UG8A 3HGJA 1PXGA 4R3UA 1X1ZA 4W7VA 5DFAA 1Y5WA 1XXXA 4GNKB 4KFNA 5A95A 4R7JA 4UNLA 4GVFA 3G1RA 3UJRA 1J0YA 5DCEA 1W9BM 2ZRXA 1NF7A 4ZSUA 4PUWA 1ONXA 1UD6A 4HSNA 1EWDA 3JW7A 5EBUA 4M1BA 3M41A 4B16A 3NO5A 4FLSA 3VKDA 3M5XA 3WQDA 3U0HA 2PDHA 1A3XA 3EB4A 1AL8A 4ZQOA 1ECQA 4MPKA 2FVKA 3ARYA 2G96A 3L4YA 4QM1A 3C2VA 2D3LA 2XFWA 4JFUA 2OFJA 4K38A 5CQ1A 4K39A 3CO4A 2X1UA 1C8YA 3BAWA 4H9XA 4Q8OA 1VFSA 4I5XA 3F4WA 3KCJA 1VBUA 2FFCA 1F2JA 4XD6A 4XZLX 4PRWA 1WNOA 2OSWA 2QW5A 4UFLA 3T78A 4ZQPA 1M6JA 1CGVA 2D23A 3BJTA 1NFGA 4QXIA 3C4UA 3F1QA 1SJDA 2NUYA 3ABZA 3R8HA 2GUUA 1UPMB 2G3IA 1UWSA 1GVFA 4PL1A 1EA9C 1HJVA 3MBFA 3L4VA 1RUSA 4CU8A 4HSOA 3K30A 5C0QA 3P81A 3TV8A 4P7LA 3S1UA 1GQNA 3CLWA 1XYMA 3EX4A 3GR4A 2O92A 2Q02A 4QQUA 4KESA 3P60A 3GY1A 4XKMA 5E09A 1IQ8A 3GVQA 3RJXA 1YMYA 3HJEA 4C5ZA 2CESA 3W07A 1GPWA 2WSKA 1UR3M 3NQCA 1R85A 4EWND 3S5ZA 1EP1A 4PFMA 2E9BA 2EPOA 2D22A 4C7GA 1B3WA 2C1IA 4I6VA 3UWYA 1IHIA 4YVPA 3BANA 1OHLA 1J12A 3UWWA 2BOEX 4AIEA 1KM6A 2HRWA 1W56A 1FFRA 4UZUA 1TJRA 1TQJA 1L2QA 2YPIA 3TLQA 4F9JA 2BX7A 4D1JA 4J5NA 1JCLA 4RDVA 1SGJA 9CGTA 1HJSA 2VZTA 4WJEA 3W02A 3M46A 1D7FA 1O60A 4GJ1A 3PZOA 6TAAA 4N02A 1QHPA 5H2ZA 1MUMA 5LA2A 3ARQA 3MZNA 3P2VA 2XVPA 1JCJA 4NY2A 1IR2A 2O4MA 1EWEA 2BHUA 2BHYA 3MVTA 1VFLA 2BXYA 4F79A 3SGUA 4GHRA 3M5YA 3DGBA 1RAKA 2PDPA 4B5XA 3W29A 4WVXA 1GOKA 4DF2A 4YLWA 1M7PA 3H2OA 2HS8A 1UP3A 3CHCA 5BMXA 2XPKA 3NQ7A 2WKJA 2GVLA 2NQLA 3WMCA 3G3DA 2INEA 8XIMA 3MBDA 4WOQA 2HQAA 3M1ZA 2EF9A 3T4WA 3MMTA 1OX5A 2PAJA 4MKSA 3LEPA 2IW0A 4TMBA 2NVDA 4D6FA 4D6JA 4JDBA 5D09A 2BXVA 2PDYA 1J01A 2WMKA 4S38A 5HJLA 1F6KA 3O63A 2PU1A 3VI2A 4TX9A 2GOKA 1K77A 1UBSA 1JUKA 1UP2A 3WQGA 1OWQA 1PO9A 3M4HA 3S0CA 5DXXA 2UY4A 1ME9A 4AUBA 2VUYA 2Q3OA 1XBYA 3WLSA 4FX8A 5FI8A 5DT7A 3LGGA 1WZMA 3QV9A 3P93A 3MJYA 1U2YA 3TQ0A 1TWSA 3ZR5A 4B92A 1VENA 1IE7C 5BCAA 4ZFCA 4OV9A 2NX9A 1XD0A 3RCYA 4NAFA 3NZRA 4W5UA 3W26A 3U3HA 2G37A 4HHHA 2HK1A 3MO7A 1UOKA 5LIUX 1DTNA 3O0KA 2J75A 1REQA 3OLGA 5HBFA 4LUTA 4MWAE 4DYKA 3CV1A 2NWRA 4NRRA 2Z1WA 3PPCA 4MUZA 2IKJA 3KVKA 1PTAA 1H2JA 1FHVA 3PTMA 4A05A 3MDUA 3U8GA 4A22A 3VIKA 3HQ1A 1KM5A 3LCXA 3B06A 3SBFA 3DKLA 5A94A 4GGHA 2E9LA 4ZO7A 5CCZA 3MI6A 5CZ0A 4QQ3A 2WYSA 2YZRA 4HK6A 4FNQA 4OHQA 5BRQA 1C9WA 1O95A 2WMHA 1XUZA 4ZB5A 4K3ZA 3WCZA 1H60A 4OGZA 4OQVA 1EGZA 3VYLA 2W61A 3N73A 4CKQA 2Q6ZA 5HATA 4N9CA 4RLIA 3ZYZA 2VKZG 2A3LA 3VUPA 2P76A 3TXZA 3T07A 3AQUA 1RY8A 1US3A 3W87A 4TV5A 3B97A 1I6NA 1AW2A 1VR6A 5HQLA 2J6VA 4OBRA 3RM8A 4XVEA 5I07A 2Z1BA 4KCVA 1MXDA 1GNXA 1IEQA 1Q4NX 5K9XA 1XIIA 4IX0A 2UBPC 1WUEA 3C0LA 1XFCA 4HA3A 3VE7A 1Q6RA 4LUYA 4ICCX 1E72M 3LHYA 4P5UA 2ZC8A 2GJLA 3P0XA 4J4KA 2YB1A 2XIQA 1VFMA 3TOPA 1EDGA 3KRBA 3W6YA 3GXFA 3F4VA 5EMJA 1V6YA 1H09A 4XIAA 3BZJA 5CJNA 3NDOA 1VZWA 1H7WA 1M3UA 1P6CA 4ZOBA 1GYNA 4IUGA 5D03A 2PDXA 3WD3A 2BZNA 1B30A 2OKTA 2OYMA 4AZIA 1M01A 1AQFA 4DUWA 3QQ1A 2BFGA 4A3YA 2C71A 2Y88A 1BWKA 2DT1A 3GNPA 3QMRA 1TQXA 3GLCA 1SZFA 3THQA 1V03A 4C1KA 2BHZA 4EPKA 1K6WA 1LBMA 5ABEA 3KE0A 4RCXA 3U2ZA 2YCIX 1V6XA 3D5HA 4EANA 4IMAA 3W1AA 2OCZA 3L5AA 1E71M 3MKKA 1EJRC 3EWDA 4BY3A 4IH3A 4OE7A 3BSHA 1DP0A 1TELA 3H53A 2FHFA 3B04A 4JQ1A 1JPKA 3ZWSA 2Q8ZA 3QHNA 3P0WA 4LUTB 2J66A 4HB7A 1Z48A 4MWAB 2QF8A 2Q71A 4PYSA 1Y0EA 4WSJA 1EP2A 5A69A 2F6XA 4OIFA 3TR9A 4ZCWA 2CXEA 5EMYA 3EKGA 1P6WA 3VKCA 4ZODA 5CZSA 4WKAA 5LA1A 1WOAA 3E74A 1FWAC 3FIGA 2OSYA 2Y61A 1XCFA 3BQ6A 1XYCA 3AXMA 4LB3A 1V51A 1F3WA 2HMCA 3PZ9A 2BMBA 2YFNA 5KZMA 3S5NA 2Z6IA 1LJYA 1FHLA 3TYDA 2MANA 2A2IA 1ML1A 1J10A 1GZJA 4OZOA 3Q94A 3P67A 4U33A 4B9YA 4KWSA 4PCFA 3HB9A 2ZICA 2WVVB 4Z2HA 4LUSB 1W17A 2PDNA 1FWCC 2VRJA 1FCQA 3MU7A 2VT0A 4GZJA 3GNOA 2V8ZA 3TCSA 3UPWA 1EXPA 3W7RA 3B0UX 2KX9A 5A2CA 3SN4A 3RG6A 2DSWA 5ABGA 3BCDA 3S83A 1H7RA 1L6FA 5DO8A 1VF8A 2YYTA 4XV0A 1BTMA 3CQJA 2V5CA 3B9AA 3KBMA 4IIGA 2VELA 3EDKA 3W6LA 5TAOA 5DF0A 4D72A 1W5QA 3ZFHA 1NDYA 2IPFA 4CNNA 4X9SA 3BJSA 3RLVA 5REQA 4DLMA 2HXTA 3TAOA 4GI4A 4J9JA 2FDSA 1IT7A 3SUTA 3WL0A 3HPZA 3FHAA 1M41A 3EBVA 1C8VA 3H2MA 1HW6A 4UTTC 1AMKA 4CCEA 5JH2A 1LQ2A 3KM8A 3C8FA 1ESWA 2QV5A 2YL5A 5ABTA 1GQIA 1R2SA 3S1VA 1TO3A 1XLDA 4WDWA 5DEZA 4DJDA 5B7ZA 1JL8A 3BLPX 1H62A 5TF0A 4B2DA 5HWMA 3NSMA 5EBAA 2AGKA 3AMDA 2BS9A 3G24A 3RK8A 1P4CA 4C91A 3WJXA 3FGCA 1VH7A 2J8GA 2IPJA 3FN9A 4C6BA 5LNSA 3WO8A 5G1MA 2Z0IA 5LIKX 4US5D 5FEWA 1Y8BA 1XRTA 1NM9A 1Q7QA 5GJMA 3SFWA 2I9EA 1SZGA 5EFDA 2W9MA 3CQHA 4A3RA 5B80A 5LHFA 3MW7A 4UOQA 3MP4A 4HNNA 4QBXA 4MPQA 1XPYA 3AHTA 3CJPA 1CYGA 1DJXA 4XO7A 1QMLA 3VGEA 3TN4A 4H8UA 4IIDA 4HZ6A 1XCWA 3FYPA 4QGCA 1JAKA 2G50A 2A7RA 4H3DA 2VC6A 5F4SA 4GWEA 3R79A 1P0NA 2C91A 1PTDA 4H9VA 3COTA 1E6RA 2ACSA 1W2VA 4NZ1A 2PF0A 3NL3A 3BLOA 3PWGA 2FGLA 1U5HA 2E4TA 2F84A 1GZGA 3LZ3A 1W1IE 3N1AA 3LM7A 2J74A 2XIIA 2VX7A 4UTUA 4RZ6A 4I6KA 5LGZA 2YSWA 4EAMA 4NZ3A 1A5UA 4Q22A 3CIWA 1PB0A 1PIFA 3T08A 1GQJA 2Y89A 1H50A 5CZTA 3GXNA 2C19A 3HG2A 1FBAA 1QU4A 2G4JA 3C61A 3A47A 4UFKA 1BKSA 4MWAD 2ZRWA 3W37A 4X61A 2CLHA 3S1WA 3C86A 3W7NA 3I3EA 1F3TA 4IPPA 2QZRA 4Z1AA 3LLFA 4O1FA 2E6AA 3G0SA 3NYZA 5D04C 3JZUA 1UROA 4EPEC 4LUJA 3LLXA 1DWFM 1XGEA 4NJHA 4H4IA 3G1DA 3UNDA 1XM3A 3WDJA 3UWVA 4BI5A 1VS1A 4UQCA 4AAJA 4QDWA 5EKYA 1HG3A 1UIOA 1XLEA 2WZHA 2E1WA 4RZ5A 1H4PA 2QF7A 9XIAA 1LQAA 2CITA 5ENLA 4JQ3A 4PB5A 5K2ZA 1F6PA 2NXIA 3CM4A 1XP3A 3UESA 3EX3A 3S8HA 4A3QA 5AKQA 3CAQA 3AWNA 3M5ZA 2OG9A 3WMLA 1Q2RA 3M6DA 4LVGA 4AD2A 4D71A 1CXLA 2XH4A 1XFBA 3PUEA 1WPCA 5BXSA 3SB0A 3W74A 3W7KA 5C5YA 3VZYA 1A4MA 4TUFA 3W1XA 1WKEA 2Z6JA 1TX2A 2YBVA 3VE9A 1RHCA 4DI9A 1P0EA 1S2CA 1KBJA 3IGSA 4UFJA 1H5VA 3A5VA 1JYWA 4HPXA 4Z1DA 4NILA 3N15A 4M80A 4JKKA 4F40A 2ZWZA 4ZXLA 3BW3A 3LTPA 3RMJA 3N4AA 1QHZA 4Q4QA 3ZLHA 3OYZA 3WH8A 2XZ9A 3E0FA 3VUSA 1JDAA 2A79A 1KXVA 2J7DA 2HTMA 3M0YA 3VIFA 2QVNA 4AZ6A 3UWQA 4QJ3B 4HCHA 2DZUA 2Z2BA 4V33A 1QWKA 5T9BG 3CLMA 5DRCA 3UWEA 2O9PA 1D7KA 2VGBA 1FCVA 3O8AA 4NX0A 2L5HA 1R3WA 2V5KA 2DORA 1PCWA 3M6YA 3ZZ1A 1O7AA 1TPC1 1B0IA 3VCNA 4F48A 3GHSA 1SR0A 3CUGA 3TTQA 1XIJA 3HIJA 3L0GA 5BXTA 3A12A 2A3EA 3ARVA 2WBKA 2V68A 5FJJA 5CG0A 2JF7A 4GGBA 3MB9A 4N7QA 3WD4A 4JTGA 5C71A 1W9UA 1OD8A 2XJ7A 4HZ8A 1PKLA 1JD7A 1BF6A 4UQDA 3M0IA 1EJWC 2WBGA 7ODCA 1QI0A 1EH9A 3DHPA 4W7UA 4MJMA 1FDJA 4IGSA 3GZ3A 5LNVA 2J7BA 4DLFA 1TPUA 4C6OA 3NQBA 4MB5A 4A21A 3MWAA 1FWIC 3OODA 1UKSA 1XLGA 1X6NA 3N2BA 1JVNA 1WAWA 4L4OA 4HD5A 1EC9A 1E0WA 3AYSA 3HQPA 1B3VA 1QASA 2QCNA 2YW3A 3UZZA 3AJ7A 1UKQA 3QOMA 1VP5A 1LUCB 4WIWA 4S3KA 1ME7A 3QW3A 3PHAA 2VDGA 4XSMA 2IXUA 4Z08A 5A6KA 3TXVA 1E15A 3THAA 4D9PA 2WKGA 2X0YA 4DZHA 2ZTJA 5LIYX 3A9BA 2X7WA 1MXSA 1FWTA 3PZQA 1J4EA 4M6PA 4M82A 4FLOA 3LBMA 2X2YA 4C5YA 3KZSA 4NZJA 2Z2UA 5E0FA 3CZLA 1UPPA 3NJ3A 1OC6A 2G3MA 4LF2A 4D8ZA 3VOHA 2NQ9A 1IEWA 4PMQA 1A4LA 1NOUA 4CQDA 1VAHA 1V3MA 3TU9A 1T6MA 4QTGA 1YPFA 1C93A 2PTXA 2J77A 3H8AA 1QPRA 2VEMA 3DFPA 1XX1A 3HBLA 1NWUA 3GDBA 3PM6A 5D37A 3H2AA 3NL2A 3PG8A 3WELA 3QMTA 4Z0JA 4GUHA 3SFKA 1IXOA 4KW2A 2I5GA 3B8WA 4O10A 1D8CA 2WO5A 4F4RA 1YHTA 3FDGA 4NF7A 5C7VA 3WYZA 2W79A 4JIEA 1J6PA 4RNHA 4N4QA 5XIMA 2WJFA 3N2OA 4EVZA 5BW6A 3IANA 3C8NA 3KOFA 2GK1A 2E09A 1KGXA 1RJQA 3UA3A 1G69A 1KBBA 3H7RA 5BWFA 4ZQMA 2O7QA 5E6ZA 1VYSX 2X1SA 3W25A 3IV3A 3APYA 2MUCA 4MB4A 2C13A 2WXDM 3TWBA 2WHKA 1OZQA 3NEVA 2ALRA 5MF5A 3P6LA 1E9IA 4LVFA 1V02E 5AB3A 2FPVA 3KWSA 5LSMA 1MXGA 3POCA 1WX0A 4EF9A 1UR8A 5F1UA 3ABRA 4YN5A 2YL8A 4NSBA 3P8JA 5DY2A 3KBNA 4E38A 4QS5A 4UZSA 5I3JA 2UV8G 1SZNA 4C6MA 2J27A 4D6CA 2WC3A 5JUVA 4QJ4B 1SW7A 1JUBA 1YXCA 3U2OA 3MSGA 3DCPA 4Q7IA 1SSDA 4Q8TA 5G2WA 3MI2A 3AROA 1GWJA 2DJXA 3ITOA 1K02A 5EL1A 2P8BA 2V2DA 4A2SA 3NNTA 3HGRA 2WKLA 5C54A 1GJWA 3EEGA 2V82A 1A5KC 3LRKA 4PODA 3PN8A 5E1QA 3W7PA 5I3FA 4PMXA 2JGYA 3EOSA 4Y96A 3A6OA 4D1IA 3AYRA 4Y9MA 1VB9A 7TAAA 2B7QA 1QNPA 2WJZA 2R1LA 2Y6ZA 3BOLA 3A13A 5FAGA 2HS6A 4F2BA 1JZ5A 1WZKA 1UH2A 2QV4A 2NSXA 1TKKA 3NYDA 3SQMA 1E73M 1A5NC 4EIVA 2PTZA 1UD3A 1W9XA 1XGDA 3KL3A 3V75A 2OLSA 1EC7A 2X41A 4Q8NA 3IACA 2BY0A 4DIAA 8CGTA 2VD8A 1UKPA 1AQMA 3H55A 3AUJA 4KRUA 3VAVA 4LCSA 3P62A 1J93A 5K9CA 2ACQA 4DJFA 4NIRA 1JXKA 3OA5A 3UQNA 2HROA 2ABAA 1MFVA 4E8DA 3LCWA 2AGTA 2IPWA 5BU6A 2WHMA 3GDLA 3UETA 3E0IA 2NWSA 1TV8A 1DTUA 2CLEA 3OVQA 2JBMA 4QS6A 1I1XA 4Y9NA 4J2PA 1LLZA 1CWYA 1M7JA 1SUXA 3CNYA 3M9YA 4XTDA 4TTGA 3W0KA 2IQTA 3O05A 2ZUMA 1E6XM 2RGMA 1QXLA 1L8NA 1IXQA 3M0XA 1O5XA 1WAUA 3TTYA 1OFPA 3L2MA 1X97A 2ZUWA 3L65A 4KIEA 4WY0A 1QOQA