1I60A

Structural genomics, ioli protein
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
278
structure length
278
Chain Sequence
b'MKLCFNEATTLENSNLKLDLELCEKHGYDYIEIRTMDKLPEYLKDHSLDDLAEYFQTHHIKPLALNALVFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIVKEEIKKSSVDVLTELSDIAEPYGVKIALEFVGHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAMGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVWPGQGAIDLDAHLSALKEIGFSDVVSVELFRPEYYKLTAEEAIQTAKKTTVDVVSKYFSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IOLI PROTEIN
publication title Crystal structure of Bacillus subtilis ioli shows endonuclase IV fold with altered Zn binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 110
structure length 278
sequence length 278
ec nomenclature ec 5.3.99.11: 2-keto-myo-inositol isomerase.
pdb deposition date 2001-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1i60A00
1S5MA 3FVMA 1XYLA 4GQBA 3U0HA 3CQJA 3CQIA 1XLGA 3KCJA 4GJIA 5I7GA 4A8LA 4K1GA 3DBNA 3IUIA 3M0VA 3UXIA 1XYAA 1O1HA 2J6VA 1XLBA 3AYTA 1XLCA 8XIAA 3VNJA 3XISA 1XLEA 5H6HA 4HGXA 3IUHA 3UA4A 4GLEA 1I60A 3KBWA 3QYSA 2HK0A 2G4JA 2OU4A 4YTQA 3VNKA 5B7ZA 2QW5A 4K3ZA 1XIGA 3KCLA 3M0XA 3NGFA 6XIMA 4QE1A 2I56A 4HHLA 3BDKA 5XIAA 1D8WA 4ZB5A 5EMLA 3CQHA 4QE5A 4E3VA 2NQJA 3VNMA 3ITLA 4YTTA 3QZAA 3KTCA 1XLJA 1A0DA 1XIFA 3KBNA 4YTRA 3P14A 1CLKA 1XIJA 2NQ9A 3KBVA 4A8NA 3JU2A 4XKMA 1XINA 4Q7IA 2X7WA 3QC0A 4XIMA 2NQHA 2GUBA 3C0SA 3KBSA 5C9ZA 4ZBCA 1BXBA 3M0MA 1XLAA 3VYLA 1XIMA 2HK1A 2GYIA 4A8RA 2Q02A 2XISA 3M0YA 1S5NA 3C0LA 3KWSA 4J4KA 3CWHA 5EMMA 3WQOA 3AYVA 3KCOA 4OVXA 4DUOA 4YTUA 4KW2A 1DE5A 4DVOA 4QDWA 1OADA 4XSMA 4XIAA 4GJJA 1BXCA 2I57A 3ITVA 1XIHA 2XINA 3UU0A 1XIEA 1XIBA 1XLHA 4HHMA 5B80A 3OBEA 5XIMA 1XIDA 1XLKA 2XIMA 3CNYA 7XIMA 1A0CA 2G0WA 8XIMA 3M0HA 1GW9A 3C0QA 3UVAA 3XINA 2ZVRA 3DX5A 5H1WA 1A0EA 1XISA 3TC3A 3KBMA 1XLFA 3CQKA 3GNXA 3ITYA 9XIAA 1QUMA 5AVNA 5XINA 3BZGA 4XSLA 1YX1A 2QULA 1XLIA 3ITOA 1XLDA 4QEEA 5EMKA 1XLLA 3LMZA 3AAMA 4US6A 1K77A 2X7VA 3IUDA 4ZB2A 1TZ9A 5TNVA 1XIIA 4PFHA 9XIMA 2QUMA 3N4AA 3KBJA 1XICA 5AVHA 1XYCA 4QE4A 4HNOA 2GLKA 1I6NA 4G56A 3XIMA 3AALA 5B7YA 3L23A 3QXBA 3BZJA 4QDPA 1XP3A 3ITTA 1DXIA 3ITXA 4EACA 4YTSA 4QEHA 2ZDSA 2QUNA 4LNCA 1MUWA 1DIEA 3VNIA 1XYBA 5FA5A 1XLMA 2GVEA 3BANA 3P6LA 3U3HA 4EAYA 6XIAA 3M0LA 5J8LA 1DE6A 4W4QA 4X61A 1DIDA 4XISA 5EMJA 4X60A 4ZB0A 4A8IA 1MNZA 1XYMA 3UA3A 4X63A 1QT1A 3TVAA 3BWWA 3VNLA 1QTWA 2HCVA 4PGLA
chains in the Genus database with same CATH superfamily
5HNNA 2W4XA 3WK2A 3OLGA 1LT7A 2BY3A 3OG3A 3AOFA 4FXJA 3GW0A 5HJXA 4HOXA 1V4YA 4TX6A 4QJ5B 4N9EA 4CQ8A 4MNKA 1C7TA 3VE9A 2FMOA 3SW6A 2QR6A 4JQ4A 3FAWA 5BZAA 1JF5A 4ZSTA 2PDYA 3UPMA 4Q7IA 4H2HA 3LCWA 3CUXA 5CKSA 3APGA 5TQLA 3KL5A 5H8MA 3LGGA 4LTSA 3SB0A 3HMCA 4DWSB 4DBUA 3DDMA 3T1GA 1TJRA 4LAUA 1B30A 2CZFA 1G7UA 1G67A 1NDWA 2FFIA 3D47A 1XXXA 3ZJ7A 2JBMA 5JUVA 4HNLA 1ZFJA 3TZFA 1EX1A 2B7QA 5DFAA 4J3ZA 1MXSA 3MU7A 5AC4A 1XD0A 3HM7A 4MG4A 3EOUA 5C6MA 3LY0A 1RZMA 1TPUA 4X9YA 4C7GA 2MNRA 3B40A 3CT2A 3AIVA 1KBJA 4W84A 3WQVA 3VIHA 3SR7A 2FZNA 1EEPA 4BWLC 1MWOA 3EMQA 1F3EA 1ONWA 3GB6A 4JTSA 2FIQA 2GVJA 5MKGB 4CUCA 2ZX9A 3P61A 5CC5A 3PZIA 4NL1A 4Z0JA 4O10A 1EZWA 3IARA 4LC6A 3MI2A 2A79A 5FEXA 1KKOA 4HYVA 1JCNA 5F2IA 1DQXA 3UZYA 3S2JA 3SBFA 2EKCA 2BXYA 2VYOA 4RJEA 4Z1AA 3D6NA 4UFKA 4IISA 1VQTA 1QI5A 4ZOEA 3URQA 4WY0A 3SRKA 2EQDA 3PZGA 1CGWA 3GTNA 3CGTA 4F48A 4ATDA 4ZA0A 1P0EA 4LT9A 4I5XA 2G41A 4AG0A 1DOSA 1QI3A 1VFUA 2V5LA 3ABSA 1TPB1 1Q8AA 5G4HC 4QBXA 1ZZMA 4ZQRA 2ESCA 1SPQA 3NYZA 5HDRA 2BHZA 2QS8A 3NSXA 4GUJA 1ENUA 1NP2A 1TZZA 1XDJA 1BRLA 3N73A 2GOKA 3CYJA 1QO5A 4QQUA 3CTLA 3TH6A 1FP9A 4IH3A 2G95A 1DTNA 5C0QA 1MUWA 2FZDA 1Q7MA 2J9YA 2Y85A 3P6LA 2VR2A 1GK8A 3IJQA 4WOQA 1VF8A 1ITQA 1FWBC 1AD4A 1QOPA 1GTEA 1Z89A 2AAMA 3UR8A 2YW3A 3K13A 1CBGA 4BS0A 4XX6A 1VCFA 3NL6A 4EE9A 2NUXA 3ZR6A 4HGXA 1W0MA 2NLIA 5HWNA 5A6TC 3TC6A 1ISZA 6XIMA 3OGVA 4D8AA 1DIKA 1ODZA 3UP8A 3RHGA 2HPIA 4HVXA 4XZNX 1NDZA 4KKXA 5CAKA 1IR2A 2Q8ZA 5AYZA 2YKKA 2X40A 5AHLA 1O66A 5I3HA 4ZCWA 3IVUA 3HG2A 2JKPA 4HHHA 1JG9A 2GDVA 3L9CA 4O1FA 3IVSA 1TV3A 4Y9MA 2WSQA 4RUBA 2DW7A 2KZHA 2PLMA 1EJRC 3GXDA 1WX0A 3CNYA 1R2TA 3GH5A 1RJQA 2HPMA 3V5CA 5C7VA 1YTDA 1EQCA 4ZFMA 3G1HA 5E6ZA 5LNWA 1VEMA 1DPMA 2CBVA 1W1YA 3PZOA 1TWWA 3B4YA 5K9CA 5AHMA 4FX6M 4R88A 1SGJA 2A3AA 1RD6A 1PCWA 3Q2DA 1HJQA 3W73A 1ZBWA 1KB3A 3O3RA 3GQYA 1TV5A 5G1YA 1PBGA 2NLYA 2OZTA 4FK9A 3R13A 3F4VA 3NO3A 4KIEA 2XYLA 2Y6ZA 1ICSA 3II1A 3PB0A 4ATWA 3NFUA 1EJSC 3E5PA 2G4FA 3CM4A 2E5CA 3TUUA 3BMVA 3PUGA 3N25A 1T6MA 3ATZA 1S39A 3ARXA 4E4UA 3WJSA 3ITLA 3TWAA 1E1EA 2FJKA 2ZXDA 3EOOA 1WUFA 3HPAA 3QPZA 1KQYA 2ZBTA 1SJCA 4IQLA 4KT2A 2CBUA 1IXQA 5EU9A 2A2IA 3RR4A 1BYAA 2WBGA 2XZ9A 4GISA 1KFKA 2Q02A 1F7BA 4S3FA 3UERA 1AL8A 2WMIA 1HJXA 2FHFA 1G5AA 3REQB 4WKHA 4CNTA 3STGA 4P5UA 2YA1A 3VIOA 2W9MA 3SCUA 3AXHA 1H49A 2YBTA 1LORA 4NP7A 5HULA 2XH2A 4KERA 1RVKA 5HMSA 1Z9AA 3GXPA 3UWEA 4N9DA 1TE6A 2QAPA 5B7YA 3QHMA 4H6RA 1KFBA 3RDKA 3VNDA 4X3ZA 1RSCA 4K1WA 3K4DA 1REQB 3DCPA 3ENLA 4LVGA 3G1VA 2R1NA 3MS8A 1EDGA 1EO5A 2ISDA 4WY0F 2FYMA 4WR3A 1R3RA 3EKZA 2GGEA 1JYWA 3H2FA 4I9TA 1XYAA 2E6FA 4JHZA 1KWGA 1W37A 3GVRA 1I60A 1DJNA 2WJZA 3B4UA 1QU4A 4XZ9A 2V38A 3LCHA 4C1NA 1QCWA 2WHJA 4DUWA 4ZO8A 2X42A 2I5QA 2J4GA 1FKWA 3AHVA 1JULA 4QFUA 3WCZA 3UG4A 5K4ZA 2AQVA 3UNDA 4ZOAA 1BF2A 2GGJA 3GM8A 5HPOA 1C8XA 3DKLA 6A3HA 2J7EA 1FCBA 4RX0A 3P84A 2ZUVA 1FOBA 2O9TA 3W1PA 2X1SA 1W3JA 3N9KA 1JFHA 1VH7A 2XINA 1ECEA 2PTZA 3RPDA 4LALA 4RDYA 1FCUA 1FQ0A 1DYSA 3IWPA 4P7RA 2Y8KA 3A21A 5C2GA 3MANA 3CC1A 1XUUA 1RH9A 2Y7FA 4FHAA 1CECA 2ZUSA 3OIHA 5A6JA 3T08A 4H3DA 3BC9A 3FN9A 4W86A 2WVSA 2WMFA 4GBUA 3JR2A 4FI4A 2DZAA 3JW7A 3KRZA 3IPWA 3KZPA 2GVEA 1YTEA 4UOZA 1AVAA 1G69A 4QJ4B 2C13A 3FGCA 3ALGA 1QT1A 4MWAE 1IT8A 4AZ7A 4GYPA 1V6TA 1ZALA 1QW9A 3JZEA 1IGWA 2DQWA 1HT6A 1DIOA 4LS0A 1AW1A 3AS3A 4PB3A 3FOKA 1CXIA 2NQJA 3OA5A 1M7PA 3TFCA 2E4TA 1PSCA 1JPHA 3L5LA 3ZT6A 3TSDA 3R1ZA 1NOWA 5I07A 4CEXC 1Q6FA 1VJIA 2D0GA 4K8HA 5FAJA 4RW3A 4MOZA 3SIZA 1UD6A 2BB0A 2QPXA 2E6AA 4XVDA 1WQ5A 3QFWA 4JKLA 4Q33A 1R6WA 3T2PA 5AECA 1A5UA 3GYEA 3T81A 1RLDA 3KS5A 2PMQA 1GT8A 3E0IA 4B16A 3QKZA 1PTDA 1BQGA 3HG4A 5M1TA 2E09A 5AHNA 4U2YA 2GJXB 5EY5A 1GVSA 2QULA 1AH4A 5DMLA 1OCJA 1ALDA 4NG3A 4PMYA 1PTAA 1NWSA 3DG6A 3DHFA 3VIFA 3AUOA 1XF0A 3VDCA 3GU2A 5I3IA 1TJPA 2UY5A 4A3RA 2Z0IA 3TCSA 3FKKA 1ODUA 1BVNP 1QR7A 1HNYA 3AMLA 4D6DA 4N9BA 3CIXA 4E2OA 3BH4A 1FWGC 3WN6A 1W54A 4C90A 3W00A 3UXKA 3MPGA 4AVOA 3K2GA 1JZ6A 1AUSL 3MHUA 4R33A 1LBLA 1M53A 3CHDA 1ZAHA 2WVUA 3B8IA 1X7FA 4NZ4A 2VC7A 3GIQA 3L4YA 1SZGA 3O9NA 3TA9A 3IUHA 1UD2A 5A94A 3IGHX 4UCGA 1Q7ZA 3STFA 2J62A 1Q6OA 1W3IA 3WBAA 3KDNA 1R46A 3QPYA 5T8GA 3C2EA 4A3HA 1ADDA 3KDOA 3TN5A 2FGZA 1M65A 2PDWA 3NXFA 4K7YA 2X09A 3HGRA 4MDPA 2D73A 2PGEA 3WIJA 1OD0A 1WBJA 1B5TA 5AB3A 3GDMA 5T26A 1Y0EA 3KS6A 1U83A 5D2WA 1WKFA 5KSWA 2NX3A 2QV5A 2NSOA 3I68A 5DF0A 1ZS2A 4MAZA 1OVDA 2V9DA 4V1XA 3ABXA 3DFOA 1ONRA 1S1RA 5LGXA 1R2RA 4ERIA 4AB4A 1FWCC 3O6CA 3CV1A 1KCZA 4ACZA 1W9UA 3FYPA 3PG8A 3BANA 2FQIA 3MZNA 5ABHA 2GGHA 1D3HA 3LRKA 1HKVA 3H21A 6TAAA 3LXAA 1OFPA 4KGLA 1QNVA 3LYEA 2J6VA 2Z2BA 3CMFA 2QJIA 4IMFA 4I6KA 2OG9A 4CVWA 1AQFA 1WDDA 4PN2A 1ZB5A 4B5SA 2XSAA 3K8MA 3RJXA 3W81A 3GUWA 4PRWA 3VK5A 1WKEA 1MVYA 4O57A 3CV2A 2BOGX 4L4MA 5I24A 3SIMA 2ZX6A 2PDKA 3L5MA 3LEPA 8CGTA 1BLIA 3SRHA 3C0JA 3G1FA 3TTSA 4CNNA 3FEQA 1R9ZA 1TTIA 1MZRA 3T05A 3UZXA 4BF9A 1TPWA 8XIMA 4C6CA 4AQLA 4MAVA 2D22A 5CXPA 2DZXA 3OA3A 2NXGA 1OFRA 2YLLA 1NJJA 1E73M 3HOJA 1EO7A 2VD8A 3THUA 2R1MA 3VKBA 1PEZA 4QX4A 3H22A 4WJEA 1B3XA 2BOEX 3AS1A 1KBIA 2ZZ2A 2ZRZA 1AK5A 2DSUA 3LB0A 5EFDA 1LUCA 1VC4A 4HA3A 4X61A 3BCDA 2D2GA 2XIIA 3KRUA 4WGHA 1E5NA 4XQ6A 1YDVA 1Q85A 4LY4A 4BR1A 3B9NA 1XLGA 2B7PA 1S5TA 4CQBA 3QQ1A 3GG1A 3GLCA 1OCQA 1FWRA 4KS0A 4AXNA 5F1UA 2YCEA 1M68A 3WJYA 2W66A 2XWDA 2A3BA 3HPZA 3I6EA 4C6FA 3COTA 4MB3A 2WWDA 3SAZA 4K36A 1RP8A 2PCQA 1XIFA 1JCTA 4AWEA 3WJWA 4KETA 4PB4A 4IGSA 4PODA 3W7EA 4BWLA 1M01A 3GDTA 1ZL1A 1JZ2A 3GG7A 3WD4A 2YL9A 4DZ5A 1OB0A 2Y24A 1BXNA 5EBUA 2F2HA 4OOZA 1KGWA 3M6DA 2OWWA 3WF2A 3EWYA 3ZFHA 1GW1A 1WUEA 2V6AA 4HMEA 3M5VA 3VGFA 3SUTA 3ZJ6A 3VZZA 4R53A 1WZMA 3K4AA 3S5SA 2OQHA 3TR2A 1ZBVA 1XICA 3SUWA 3W3OA 1V0NA 3TYBA 3RPMA 4DF0A 3MB9A 4CQCA 2DSKA 2XIBA 3U3HA 5T9CE 5J8LA 5K9DA 3G18A 3OW1A 3FA3A 4JBRA 1UOKA 2CC0A 1A5OC 1YPIA 3HG5A 3AICA 1E6QM 4AMCA 5DMYA 3W76A 3B9OA 4HA0A 2V3DA 3VCNA 2Y5JA 3UYIA 3LLXA 1BGAA 2Z1BA 3M64A 4E0CA 1W1IE 1B0IA 1TV7A 3C3UA 3V0TA 2IW0A 3CL6A 1VLIA 3B8VA 3KOWA 2P10A 1PS9A 1UR4A 1Q2SA 5DXYA 1P6BA 5FKYA 3OYXA 2ZZ4A 3W28A 5DT5A 2G8ZA 1THFD 5E0FA 2OX1A 1HFBA 1MDRA 2G97A 4XWUA 5C9WA 4MNMA 1ZSXA 2PTYA 3RX2A 3EXTA 3RMJA 3HURA 2C15A 4S3BA 4PL1A 3C5QA 2WSKA 5EMMA 5JBFA 3UPWA 3WDRA 3OHMB 4OQVA 4FNRA 4LOCA 3WF0A 2OOGA 4IMAA 1VCGA 1B31A 2HBVA 1XIDA 1UQZA 2Y5SA 2ZC1A 1TWZA 1Y5XA 1SUXA 4IMGA 4MZ1A 1XISA 4F9JA 1G7VA 1IYXA 3EA3A 3ARPA 5CQ1A 4ML4A 2PDJA 3TYDA 1WXZA 4EF9A 1RBOB 1AZ2A 4M5PA 4P8VA 1K6WA 3FHAA 3IV8A 3W88A 2GQ3A 1U2YA 4GGBA 4O17A 4W85A 1DIEA 3TTQA 2BASA 4WSHA 3M0LA 3CYVA 3TN3A 1QW7A 1XGDA 3MUCA 5DN1A 3HFTA 2QUVA 3LCFA 3GNDA 3AUJA 1XYLA 2J77A 1GVQA 5C71A 3TYUA 5JBDA 2CZEA 2ANUA 2O0TA 3WJXA 1XCWA 3RLVA 1JXJA 3KVLA 1C3FA 4H6KA 5T9BG 3TC7A 3IJ9A 1GEQA 4OUEA 3ELFA 1RK5A 2W92A 4DJFC 3TU9A 4NY2A 4R7WA 5IHRA 3WQGA 1J18A 4JZ5A 2O4QA 1LOQA 4X22A 4RPPA 4ORIA 4XVEA 1CXLA 3RILA 8RUCA 3GR7A 5E9XA 1W2PA 4OGZA 1GUVA 2OWCA 3VNYA 3W25A 4AAJA 5E1QA 2C71A 3HU7A 2O4MA 2WHLA 3AYRA 3LRLA 4N0RA 3GXFA 4M6PA 2YW4A 1XBZA 1EHAA 4O0ZA 1V3HA 2C19A 3GNPA 3PZTA 1CLXA 3NEVA 4O15A 1JPDX 2UY3A 4ASTA 1NIUA 3W7JA 2H90A 4WF7A 5FF2A 3B9AA 1YNPA 5D05A 5AC6A 3VGBA 2WAGA 1A3HA 3O0KA 3N4FA 4FF5A 4I90A 4R7OA 2O55A 5A8NA 3WQCA 4ZQOA 6REQA 4REQA 1OD8A 4YPJA 2VTFA 3SCOA 2PDUA 3W53A 4X0VA 3N6QA 4L9XA 4MSSA 1SQ7A 2WZEA 1R3SA 4J3UA 1K8YA 1KGXA 3WK3A 4W7WA 3H4GA 4YTRA 2GK1A 4FOKA 3S46A 3TYZA 3DG3A 1W5QA 1NP0A 3G2GA 4J3VA 5GQBA 5FESA 3OLEA 1EUNA 2DW6A 2I7GA 2CYGA 3TMQA 1GOXA 3WK0A 3TXZA 2YGYA 3ZIZA 3A12A 4RNFA 1PDZA 3MDWA 4HNNA 1SU5A 1V6YA 4DF2A 1YRRA 4GGHA 4AC1X 5BRQA 1QPOA 3W7KA 5MHBA 1SSGA 1L2UA 2BVWA 3UR5A 1A53A 3CXOA 4I8YA 2NQZA 3PBGA 3CZ8A 3NQFA 1UROA 2QJJA 5CLTA 4RPQA 3MV01 2EPOA 5JU6A 1KXHA 2FHCA 2IQTA 2ZDRA 3M4HA 4H4IA 2YFNA 3O1NA 3U7BA 3H24A 4HP5A 1YMYA 2V3FA 3N6JA 1WA3A 1IIGA 3DC8A 4PMDA 3UWQA 1TPDA 4GLEA 1SJBA 5B7ZA 1Z3NA 4F40A 3C2OA 1YHTA 2CCRA 3LBOA 1JCYA 4CN1A 4QGCA 1RXOB 5D37A 3F4NA 3L67A 4Q8TA 2QDGA 1FDZA 3GHUA 3UT0A 1AQHA 4AHQA 1KTBA 2C8NA 1H61A 4ZE5A 1KWKA 4CU6A 1JZ5A 1G4EA 3GC4A 3PJXA 2BGQA 2I17A 2J75A 1TMLA 4UTJA 4GJJA 2VZOA 4CQ9A 1T5AA 4W5ZA 2XUCA 2CBJA 3U2CA 3W2KA 3MDUA 3T8QA 1ELSA 4J28A 1MQRA 3WDHA 4CD8A 1RA0A 3HBLA 3M0IA 4XZMX 4LSBA 4CEUC 3WF3A 3T4WA 2VENA 2FVMA 3W1UA 5D9NA 3U2OA 3S9ZA 3BL3A 3AU6A 1JGIA 3QM3A 1I1WA 1OYBA 4ENLA 4GY1A 1GQLA 3ALFA 3TTYA 1Y5VA 4Y96A 4AYSA 3E2VA 4XZLX 2Z29A 1Q6LA 4QP0A 6TIMA 4LCQA 1EDTA 4P7OA 2NWRA 5AYYA 1OJXA 1GPFA 5HQMA 2BTMA 1NARA 4XB3A 3V75A 5I00A 4LF1A 3M0JA 1VBRA 1TCMA 2ABAA 2NT1A 1ZUAX 2B4GA 4EIVA 4D1IA 1LG1A 4XK2A 1IT0A 1TV4A 2IQDA 3EPOA 3DU0A 4LAZA 5FACA 4CNOA 4Y8FA 2V2HA 1V77A 3H12A 3STPA 3ZLGA 1IQ8A 1I0DA 4JKMA 3CQHA 4M82A 4EVZA 4G6CA 4PL2A 2ZX7A 3NL5A 4AHPA 4WOZA 3SCTA 4HK7A 4IP5A 4BQ5A 3MY9A 5G2WA 1J6OA 1XCFA 3SDOA 3C86A 1SMAA 3ANUA 2I57A 4AXKA 2R1PA 1W9VA 4JTRA 2A7PA 2Q09A 1XSIA 3L2IA 4DLFA 4YU1A 4AEOA 1FHVA 4UXDA 3E5BA 3MA8A 4DM1A 3GZ3A 1M3UA 4AFYA 3PSVA 1H50A 2YR1A 4YS1A 4LB3A 1UH4A 2P88A 4OTKA 1EWEA 3ECQA 3NXLA 3ARVA 1WV2A 2W91A 3ZSTA 2V3GA 5ECVA 3WH9A 1XD1A 3UR7A 2O7SA 1HQTA 5A6MA 4M81A 1J0IA 1BAGA 4PMJA 4UNIA 1TIMA 3CO4A 4HCLA 5CSYA 3AMCA 5EKYA 2ZUUA 3FEMA 3I6RA 3AMKA 2O92A 1IWBA 3LNPA 3MSDA 2NV2A 1J10A 4LY8A 3GTFA 5I77A 1SFJA 3OGSA 1JGMA 5LA0A 4M7TA 4JCLA 3QC0A 1OF8A 5F4WA 4ZO6A 2OTDA 3NZQA 5AYIA 1X7IA 1YTKA 4B5VA 4IJBA 4UQCA 2BVTA 3QYQA 4GI4A 3NQGA 4DJDA 4FLRA 3TR9A 4YWIA 1E4LA 1RHCA 3IAPA 5AFDA 2AGTA 3WQ6A 2VCBA 1QATA 4RE3A 1RAKA 3D46A 4E8CA 2ZE0A 2PZNA 3H2NA 1A5MC 4WIWA 4NSBA 5REQA 4QJ3B 4NAFA 1PX3A 4YHGA 3UXDA 3WFAA 3TOYA 4XAFA 1V3JA 1F05A 1FWTA 1AFSA 4K6AA 4AIBA 2QCFA 3NO5A 1DE6A 4PBEA 2VX5A 4HCDA 2XFFA 3STCA 4C5ZA 3AIWA 3IIVA 3UJSA 2WB5A 3UXLA 3D0CA 3QV6A 4D71A 1J11A 3V18A 3K8KA 4ZEPA 1YBQA 1NDVA 1S3HA 3TDFA 3PBWA 3N9RA 1C8QA 1PHWA 1X8FA 2QGHA 4JIPA 4ZFCA 3BK0A 2FDSA 4YTQA 4M6VA 3C2RA 1V0MA 1O5RA 4R34A 5LHFA 1F74A 1L8NA 1XRVA 1EJUC 3CBWA 5HR6A 1ZAJA 2CLFA 3LLFA 1CTNA 5K2ZA 2PA6A 3PUEA 1FFQA 3UF9A 4FOUA 4S38A 1EWDA 3YPIA 2WYSA 2VFEA 4I9MA 1ZNNA 4ONVA 3N2OA 5TIMA 3SCQA 1M04A 1Q2RA 3PK7A 3SY1A 4DBWA 3E0FA 1XLIA 4Z2LA 3S5ZA 4KFPA 4O54A 4LAMA 3LPOA 1MDLA 3SUUA 4CKQA 4MB5A 1W9BM 4Q8UA 2C14A 3V4BA 5K9XA 1YPFA 2VO5A 4ECLA 4HPJA 2G3IA 5A1AA 3VZXA 1UA3A 4W7UA 4PTMA 3UZZA 5AC5A 5E9AA 1J6PA 2Z1WA 4LS2A 1HVQA 3OO2A 3SRFA 3SGZA 5I23A 5C2XA 1XFBA 3LDVA 5L9FA 1P1MA 3RU8X 5H6HA 2DH2A 4QM1A 2QMKA 3NQEA 3ME3A 4FLSA 4KWWA 3POHA 4HK6A 4IUOA 2AQWA 3W75A 3KTCA 1MEHA 1F3TA 1KFLA 1JUEA 3NQDA 2OZ8A 5FI8A 4MHBA 3HMJG 1XINA 2VR5A 4KRTA 4AX7A 3ONBA 4QLJA 3BARA 4XZHA 5AKQA 3D5HA 3AXMA 2A6NA 1E4IA 2WVVA 3ID7A 3KFTA 5FSDC 2INEA 4WD0A 4UQDA 1DE5A 3VD7A 1W9XA 3WQEA 1M7XA 3QGAC 1PPIA 3QOMA 4AZ5A 4GKLA 4FA3A 2D2JA 1FHDA 3B06A 4JD4A 2CW6A 3KP1A 5CH9A 4B3LA 1TPH1 2IMRA 1K1DA 4FSAA 1C92A 1SYTA 5AHIA 3RITA 3IUDA 3DZ1A 1QNOA 1PWMA 3A5FA 4JHMA 4ZVJA 5LZLA 4G56A 3T0TA 3AALA 3M7WA 3S2MA 4QDPA 2QHAA 3PNUA 3EDJA 4DZAA 2PE4A 3CLMA 3GC2A 1J9YA 1B3WA 4A8IA 4GIAA 3VA8A 1SMDA 4H01A 3NDYA 5CGQA 1W3LA 2FH8A 1EXPA 1Z8AA 4S3CA 3CQIA 1Z7AA 1OG6A 5LIYX 1NWUA 1SZRA 3TN6A 4E3TA 3QV9A 1ITXA 1ZBCA 2DIKA 4IOTA 3VGDA 1E55A 3OHIA 2E5DA 1FVPA 2ZVIA 3PBMA 1O95A 2WKGA 3F1QA 1KM6A 3ES7A 4JGDA 2E5BA 2PLCA 2ZZ7A 1PDYA 4GYKA 2ZZ5A 3C4UA 4PMUA 1NQ6A 5EFFA 1TVLA 3N34A 5F2MA 1UASA 3IRSA 3K46A 3TTOA 2VGIA 2D3NA 1W3NA 3DYOA 1OT1A 4YWSA 4W8LA 1UBSA 2CZVA 4I8DA 3B3DA 2HWGA 2HRWA 5FL1A 3UVAA 1UUOA 2PDXA 3C2YA 2VQTA 3EEZA 1TQJA 3Q37A 3WLNA 2B7NA 1J5TA 1FX6A 2B0MA 1LLOA 4Y90A 1ZPTA 3S0CA 1KBKA 1CX9A 3TK7A 4XAGA 3VDGA 3VX0A 3OZYA 3WH7A 7REQA 2FB3A 2QUNA 4JTUA 1K8ZA 1DWFM 4DJFA 3N15A 3BUVA 3M43A 2REQA 2PDGA 5HWJA 1YDYA 4UCFA 2CLOA 3LHWA 4FX8A 2C1GA 3TLLA 2WSPA 2A1YA 1U22A 3U5UA 3W9ZA 3WUGA 3NL2A 3LX9A 3U0HA 3MTWA 5CPLA 3U9IA 4DHGA 2QKFA 5I3JA 3O6AA 4IG2A 3NOYA 1X97A 1XLCA 1GJPA 2IPFA 1M41A 1ZLPA 2OLAA 3QKEA 4URIA 4NAEB 3CUZA 3PJUA 1XIGA 2JK2A 3H2CA 4L7ZA 1JNEA 3FW6A 4GKTA 4IL2A 2R6OA 4NRSA 1X1NA 1OF6A 1RPKA 3IRDA 4EPEC 4ILSA 2F9RA 4KFNA 1JRBA 3LD5A 3RRXA 2XGZA 4LXFA 4F8XA 3NM3A 4V27A 1Q45A 4GACA 4C6DA 3H4WA 4YVPA 2C7FA 3LGDA 3N13A 3PFMA 3VIJA 4TTGA 1XI3A 1C93A 5CZTA 1MQPA 1AJZA 3NO1A 3F4CA 2PGRA 1LRQA 5A8MA 1Q3NA 4TO8A 4PFHA 4LV4A 1SFSA 1YADA 1AW5A 1KM1A 4A4AA 5H2ZA 2DZPA 3WLMA 4KQNA 3IGSA 2XTKA 4E4PA 1A5KC 3H2MA 2OLSA 1J2BA 3KTSA 4MM1A 4Q4OA 2YX0A 3QSRA 3CHFA 1VFMA 3R4IA 3W72A 3S1XA 3F03K 3W2JA 4U28A 2HS6A 5G2HA 3LCGA 2XSXA 1FH8A 2ZFAA 4L9ZA 1QPRA 3R0DA 4LUJA 1B90A 1VIWA 4ZENA 2Y1HA 4JX4A 1ECQA 3QTGA 1PIFA 1Q6DA 2BY1A 4LUTB 3QQ0A 2GSJA 1K7EA 2VELA 3UJFA 3G3MA 3E0LA 1GONA 3CK5A 3R10A 3WLIA 2DVXA 2G3MA 4US5D 3VDBA 3WQ4A 2A3HA 4ZO7A 5A69A 3CUHA 4JOMA 4KF1A 1NU5A 1UA7A 1UUMA 3QW3A 1OCNA 1F2JA 3B8DA 2WNWA 3DXIA 2TPSA 4D8LA 2XFRA 3N3TA 1GCYA 3O6DA 1SW3A 4JTCA 3GTIA 5FJUA 5FSEC 4GVFA 3BZGA 1HW6A 4S3EA 1H09A 1I1XA 3W27A 2C3ZA 5HMEA 1E71M 1XH0A 1JXKA 4OWGA 4M6UA 2XVGA 4JR5A 3TQVA 3UWWA 3RM9A 2F7FA 1H7PA 4I7WA 3R94A 2HEJA 3OG2A 4Q8WA 4EPKA 3DH7A 3F5JA 3WJZA 4EAYA 4WXZA 1T99A 4G1NA 1P6CA 1UUQA 4FX7A 3GFXA 3TSBA 3ZT7A 1QNSA 3NOEA 3VOCA 2W0UA 5F7UA 1ZCOA 2WZMA 5E09A 4CQDA 1OBAA 3M5ZA 2PF8A 4A8LA 4LBRA 1UJPA 2F38A 2Z4GA 3VD4A 1JCJA 4DYJA 1JUBA 2VX6A 3AYTA 2AAAA 3CAWA 3M1ZA 4A3UA 1UW9A 1CDGA 3N2XA 1QOXA 3EDFA 1QWGA 4AD1A 2Z6IA 2BOFX 1KCLA 1IXNA 3H7UA 4JEJA 3DYPA 3NAVA 5CC3A 1PJ9A 4HPGA 1GHSA 3GZAA 2WNQA 1EA0A 3W24A 1HL8A 1CNVA 1CPUA 2OSWA 3BMXA 4HSOA 3BG3A 4IX2A 3WQPA 8TIMA 3LLDA 1M1BA 2BHUA 5DCEA 4WDTA 3H23A 1DBTA 4HU3A 1TFVA 4ERAA 1IF2A 2VUNA 3KXQA 1MYRA 1XG4A 5A2BA 2PDPA 3ITVA 3G8EA 2GJPA 2W3ZA 3WMSA 4CU8A 3PZ9A 3MUAA 1H2JA 1ME8A 1TVPA 1ME7A 4MUZA 5LHEA 4NHVA 3VGHA 3VUSA 1SFTA 1VPYA 5I3FA 4LUSB 4FF7A 4AZBA 5GPRA 4J7RA 1MMFA 3RMEA 5CBJA 1GG0A 4O13A 5I3GA 1OHLA 4DO6A 2A4AA 3ARZA 1TR1A 3WY1A 1XP3A 4NX0A 3M0ZA 5J5RA 4CD6A 1EDQA 2ASHA 5BRBA 1V02E 3DECA 3RO8A 4R9XA 5AVNA 3FVMA 2UWFA 1GZJA 3NQ8A 3G1YA 1KFEA 1NF0A 1DXEA 3H54A 2V69A 3GU1A 3WFZA 2QCEA 2YCLA 2QF8A 2YZRA 4WVXA 1JZ3A 4DYEA 2JGYA 1QI2A 4ZOBA 3GG0A 2VEPA 1I2PA 2IS7A 5G4EA 1Z44A 4GINA 2PD9A 3PFRA 4OECA 5AHFA 2EKGA 5DEZA 1ZBKA 1US3A 1US0A 3VOIA 3MJMA 5DMMA 1IHIA 3M0YA 1KRBC 1YNYA 2F6XA 2PFHA 1TUXA 2ZRUA 1A3WA 5CCZA 1JRCA 4IT1A 3WMBA 4BQ4A 1XX1A 1GW9A 4P8XA 5JIPA 3GNXA 3EOLA 1GZGA 2ACSA 4M1RA 1Q6EA 3EPMA 3SURA 3QOKA 2DUXA 1DEDA 1KW1A 3OP2A 2OZ3A 1KV5A 2A3EA 5M03A 3GG8A 3NCOA 4FLQA 3PJTA 5ABFA 1NAL1 3MCNA 2Z7GA 1VJSA 3NURA 3H4XA 5LXXA 2OOFA 4QEHA 4LNCA 1QW8A 2RDUA 4HZ7A 5D32A 4DN1A 1RCQA 1M5WA 2E1DA 4HOWA 2X41A 3S47A 1Y8BA 3UG3A 4HJFA 4D72A 2BXZA 3WEOA 1LWJA 3GDRA 2EGZA 4G8TA 4GQBA 3WH6A 2RUSA 1H3GA 1HKIA 3CJPA 3A22A 4DZHA 1O12A 2YA0A 3UETA 3GKAA 3W7MA 2OXNA 3GIYA 3PBVA 3UWUA 2IPJA 3WLOA 3U7VA 5CSRA 1ME9A 1RY8A 1UG6A 3W7QA 2RGMA 4S39A 1W1TA 2C0HA 3HIJA 1BPLB 4PRTA 1VBJA 2VOTA 2QZRA 1E0XA 4MWAA 3NEHA 1R85A 4MZYA 3B9EA 1EXBA 1UYQA 3AIRA 4H9YA 4Y6GA 3TQ0A 3WQDA 4A8NA 1C91A 2QCHA 1GVYA 1IXPA 1BGGA 4GG9A 3EOSA 3UGVA 2G96A 1UD3A 3SCSA 1KQZA 4HHMA 1RD5A 3ZYZA 5LIUX 4WKAA 3RXZA 2J47A 3VM7A 3O63A 2RH9A 4QHRA 3AS2A 1EF3A 1XLLA 4J40A 5I06A 1LP6A 5KZMA 1PX4A 1Z32X 1XIIA 4PUMA 2C79A 4WRHA 4LU0A 3DFPA 2VX4A 1GQJA 2ZUWA 4ZO9A 3V7PA 3OPSA 1H7WA 3M5YA 4JTAA 2V5CA 2WK2A 3S3GA 1FWAC 1DXFA 4NQ1A 2PGWA 4BQ2A 2EAWA 2V8ZA 1E6RA 4RZ5A 2J27A 3MO7A 1XYMA 3WYZA 2NWSA 2HNEA 5HJYA 2E6YA 1EA9C 3E0WA 1TTQA 4PEKA 2D23A 1YW1A 1S5MA 3UCQA 1UD4A 2QEZA 4B9YA 3GVVA 4IWWA 2Z1SA 4AD5A 1UWIA 3UA4A 2Z25A 4AD4A 4O28A 1CGXA 1A80A 4IL0A 1DHPA 3CT7A 1B57A 3AHZA 1PTGA 4Q8NA 3LQLA 4Z17A 3TLQA 2VNCA 1JYVA 5CZJA 1E51A 4GVHA 4DI9A 1TYGA 1QI4A 4IIHA 2OZ0A 5AHEA 5BU6A 3WNPA 3AYVA 3GVQA 3E74A 2QCDA 2OWXA 4RXFA 3CB3A 4CD7A 1VFLA 3CAQA 1BKHA 4L1GA 1EC9A 4AEEA 1DWAM 4QS5A 4FXRA 4MYAA 2XIOA 2V67A 4MY9A 1FTXA 5TNVA 1VRDA 4CCZA 5AVHA 2NUWA 4KFOA 3XIMA 2YYUA 3N29A 3V0SA 5C9RA 4KWUA 3NQCA 4MFDA 1H51A 1Q6CA 3CMGA 1VFHA 2IKJA 3DBPA 2PLKA 4UTUA 4W4QA 4NZFA 1AA1B 1AH0A 3LSCA 3W7OA 3MVIA 4QRNA 2PS2A 1K7XA 1LWIA 2IPWA 3B0XA 4R85A 4N9CA 5F1VA 2ISSA 1D3GA 4I5RA 5LYRA 1JCMP 4E6MA 1W1VA 5C54A 4WKFA 4M1BA 3RNDA 3DFHA 3DGBA 3LHVA 4K7VA 3E9AA 4BHYA 1GQIA 3PB2A 4BEUA 3LHYA 3IJDA 4EAMA 5D03A 3A6OA 4JY9A 2YL6A 1SVDA 4RLIA 3N2TA 2X7WA 2QPSA 3GDBA 3IAQA 2BXVA 3KVMA 3BG9A 4PCNA 5JH2A 1R9YA 1S5NA 3KWSA 4MFEA 3PPFA 4O1EA 3IIOA 4RNHA 3GIPA 3IIPA 3GNNA 1LG2A 3AXKA 1JD9A 3HQOA 1YLVA 2BS9A 4V33A 1KXTA 4NJHA 1HJSA 1G4PA 1XR2A 5HNRA 2O56A 4GQ0A 2BV9A 2X2GA 3ZR5A 1R0MA 3FKRA 4GC3A 2BHYA 4L4OA 2I5IA 1W3KA 1DJYA 3DC0A 3RPTA 3QF0A 2NT0A 3O8AA 3KL3A 3HGJA 2CHRA 3NIYA 2FKPA 4J9JA 3SY8A 2C0AA 2O9OA 3KRBA 1R7AA 1F8IA 5HOSA 3ABQA 3GXMA 4MY8A 1WZLA 2Q8LA 3RN6A 1LBMA 1TPFA 4OUIA 1X6LA 5E93A 1NF7A 2PTXA 1HL9A 1TREA 2ABBA 2NUYA 2YZ5A 1VENA 3ZS4A 2V68A 4S3GA 4JYEA 3M7SA 1D7KA 4AVNA 2O7QA 3A47A 4XAZA 3VOGA 2J8TA 1FP8A 3VPLA 1A5NC 4K8EA 4Z0SA 3BQ6A 5LSMA 3EAUA 3FJNA 2QUTA 5BXRA 3A5VA 3WK1A 4ZB5A 2AQOA 5D8ZA 2AL2A 5CEWA 3P62A 3S9IA 2PP1A 1VPXA 2EPMX 4PUWA 1QJWA 1WDPA 3VVGA 1VP5A 3IJ6A 4Q7BA 3WDJA 2DSZA 4GXWA 1SO5A 2HXUA 4NVTA 4DXKA 1G01A 4YMZA 4WJ8A 4DX3A 1OFOA 3S4TA 2HXTA 4OZOA 2J7CA 1RJPA 3U2ZA 1K9DA 4KCTA 3G1AA 5LNSA 6ENLA 3TA6A 4W87A 3UYCA 2NXHA 2GWNA 4US5A 5BOEA 2ODOA 3WNMA 3FNDA 3LTPA 1DP0A 1Q6GA 4GY7A 2PP3A 1TJ2A 2X05A 3ITTA 4D9PA 3VGEA 4XD5A 1A5SA 3VD5A 2VRKA 3WSUA 4DELA 1OGGA 3S42A 2AKZA 3EKGA 1WKYA 3S6OA 9RUBA 3NGJA 3MJYA 3AHTA 3D3FA 1ITCA 3ONCA 3KLKA 3NZRA 2QV4A 1X39A 2WMKA 1UKPA 4MNJA 2C91A 1L6SA 4S2BA 3QEZA 2CLPA 1S3TC 1AMKA 1UPPA 4F2UA 3QY6A 3TJXA 1VEPA 3R2GA 3SQMA 2X2YA 5LGZA 3A64A 3P7YA 1GOOA 1JYXA 3ZO9A 2FTPA 2IQ0A 4AZCB 1SR0A 2OMAA 2R1KA 2I5GA 1UZ4A 3GR4A 3T78A 1E40A 3NDOA 2VXNA 2P0IA 1XSKA 2OKOA 4AD0A 3FLUA 3OTRA 4F3HA 3AWOA 2PI6A 4UFLA 3APYA 7PTDA 1AODA 2DEPA 1VR6A 1T8QA 3U2EA 3VIGA 5J04A 2ACRA 1OX4A 2OGJA 1CYGA 3WDIA 5K3VA 1LOSA 2R94A 1FUYA 2HJPA 3LPFA 4LQ1A 3OZMA 5CC6A 4EX4A 1V6XA 3MSYA 3UG8A 3U48A 3IJIA 5E5CA 1E72M 4GFSA 1YE4A 4X2PA 2JFEX 4GIYA 4HPXA 4OU1A 1AJ0A 2OLHA 3G1DA 2VC9A 3NG3A 4UC5A 2XSBA 2R9RA 3PTQA 4H9ZA 2QAFA 3AQUA 2ZRVA 4HQVA 3CHVA 4MB1A 4OHQA 3V16A 2XFWA 3LZ3A 2BGSA 4M19A 3G77A 2OR2A 1HF6A 4TX8A 4HYWA 5D9PA 5JH1A 1BVWA 3I7RA 2R24A 1ADOA 1WZKA 5GVJA 4L5ZA 3VDHA 1KCKA 1K6AA 1QAPA 1E9ZB 5I2UA 4GUFA 5C9UA 4HU0A 4W93A 3RLHA 4EANA 4ES4A 2CETA 1F73A 4ZZ9A 2V81A 1XLJA 4FAMA 2D0FA 3RAOA 5I5RA 1PYMA 2J7DA 4JIHA 2WZHA 1BXBA 1DKWA 3G6LA 5HBFA 4LB4A 1G4TA 3PBUA 3TEVA 3WQ5A 4KIRA 1UR9A 3F5LA 2OB3A 3EWWA 2QJNA 1RA5A 2DSWA 3A4WA 3TONA 3A3WA 3GC5A 3MVTA 1ZCCA 1KV8A 3LM3A 1F76A 4UZUA 4ZQNA 3F2DA 4G5DA 1VBGA 4QG8A 1C8YA 3IIXA 1UWSA 3DFSA 3VKJA 3ZXWA 2PDBA 1AW2A 3LENA 3W7CA 1WXJA 4HA4A 3TQPA 5D9OA 1EFZA 3MCOA 3KBJA 2EG6A 4QS6A 2BY2A 2BNJA 4JTIA 5A6SA 3GO2A 2GLKA 1CB2A 1B2YA 2FGBA 4BCEA 4I3GA 2GJNA 3GHSA 4PBFA 1UMLA 3OZPA 4RNIA 5HUOA 1LLZA 1NQKA 3LHTA 5FJRA 3TMLA 1OFEA 1EC8A 1V79A 1M7JA 1Q4NX 2VQUA 4JN7A 3CWNA 4HNUA 1PXGA 1K03A 4JIIX 4AWSA 4IXHA 5PTDA 2V2CA 5I7GA 4MKSA 2Y63A 2QIIA 2WLYA 4QROA 3P2VA 3QYSA 2HK0A 1DV7A 2V63A 2GDUA 1QNRA 4PMVA 1GQNA 1FXPA 1RALA 3WBXA 3NQVA 2GGIA 1G94A 1PO9A 1SW7A 4HBKA 1BTMA 3W85A 2QXWA 1ONEA 3AZRA 4ML9A 4AD3A 1IZKA 3EWZA 3OB8A 2IUZA 1H7NA 4IQDA 2VDGA 1XBVA 4XIMA 4HD5A 3LBCA 2E25A 1NFBA 4PSRA 4GCAA 1SZFA 4ZQPA 1Q13A 3DUGA 3M44A 1IEQA 2ZUMA 1O7AA 5AY7A 2XVKA 2QYGA 3MC5A 3N9SA 2PB1A 1SO6A 2VUYA 1JAEA 1ZAIA 2VM8A 1B3OA 2WMJA 4L65A 4Z2GA 5EMKA 1V6UA 1ZJIA 3LMZA 2YYTA 1TZ9A 1R3YA 4LGXA 3QR1A 2I9UA 1CWYA 4KESA 4LVBA 4DXXA 4HNOA 4ZE4A 3WD3A 3WUBA 4AIEA 4JYDA 4Z2HA 3LTYA 1FWEC 4P8WA 1VHCA 3MYPA 4DWSA 4Y9OA 4IFKB 2RFGA 1EGMA 4B92A 3TN4A 3HF3A 2EJ1A 1OY0A 3FXYA 3ARYA 2JQXA 2NQLA 5DMNA 1J0HA 3PR2A 2Q6ZA 4GQRA 1QMLA 3CUGA 3CTTA 4DPPA 4NI3A 2ZQ0A 2CLMA 3CPGA 1LYXA 2J7HA 1FH7A 2G4JA 3K5XA 1VYPX 5K4XA 1DVJA 3A9IA 3KVJA 4J2MA 1OIFA 1BWKA 3CASA 2CKSA 4E3VA 1S38A 4HA1A 2AKMA 4K38A 3MI6A 4GYJA 1LQ0A 1EX5A 7A3HA 1SR9A 3SM0A 4U4MA 3NNTA 4C6PA 3QGKC 2CZ5A 1K02A 4LEQA 5MKGA 1S2VA 3CHCA 1IEIA 1RBAA 4QTGA 4AW7A 3FCPA 4H9TA 1KD0A 4JKKA 3OBEA 5XIMA 3I10A 4LC8A 5K7JA 2X1RA 3ZLFA 2GZXA 4TR9A 1CGYA 1KBBA 3L0NA 4Q4SA 5KZDA 4GCXA 1FWFC 3UZ5A 4ZSUA 1R9XA 2HVNA 3GHTA 4GXMA 2Q8XA 2Z24A 4O53A 1ZHAA 2E8ZA 3IJ8A 1TA3B 1OX5A 5DBTA 2H6RA 4NJJA 2EPLX 3GK0A 5M17A 1E6ZA 3F4DA 1TTPA 2Z1KA 2FVKA 1GNXA 1U1JA 2HDJA 3B05A 4F0SA 3TYEA 1KM4A 5D04C 3G22A 2FZMA 3GNRA 1MW2A 1UC4A 3FVDA 3S1GA 3VE7A 1OABA 4YVVA 4AIUA 2PDCA 5CLWA 1GVFA 4GO8A 1DHKA 5FEPA 1C9DA 3PTDA 5AYXA 3LQGA 7TIMA 5A6KA 1UP2A 4JTTA 2HISA 3AZSA 1CXKA 3SY5A 2XVPA 3B0PA 3UZWA 3W2LA 4GC4A 3CV6A 3CZKA 1S2TA 4ZTYA 3WF1A 4WHBA 3UVIA 3KZSA 4RL3A 3R12A 4PRRA 3M0MA 3VYLA 1N82A 3BSGA 2YCKX 4HU4A 3QW4B 4S3AA 3C0LA 2OYLA 3VCRA 3E2SA 4NXSA 2JEPA 4PR4A 3VABA 4DJEC 1IIHA 3NZ1A 3LSBA 4AZ6A 3ES8A 2XVLA 1NH6A 2ISWA 1BVZA 4OT7A 5ABFB 2FH6A 4JL2A 4JTJA 3MKKA 1BF6A 5AC7A 1E6XM 3UWZA 3W6MA 1K7FA 4ICCX 4H1ZA 5KMYA 1W3TA 2W27A 1N2VA 3QZEA 4IJRA 4DYKA 5C2CA 1TMHA 2VGFA 4JCMA 2YDSA 2WCAA 4IPNB 1GG1A 3UR2A 3BZJA 2A5HA 2ON3A 3BLPX 4FNTA 4AMAA 2ZXBA 1BWLA 3S2CA 1AD1A 4CQAA 1DIDA 4XTIA 3QTPA 3OEXA 4QDMA 2YPIA 1GVIA 3SN0A 1SO4A 3P60A 3QSTA 3CL7A 4AUBA 3IUIA 1V93A 1K8XA 3USZA 3VNKA 3S8HA 4Q4RA 1IEXA 2RJGA 2GUUA 1U5VA 5I0DA 4M56A 2YJQA 5CPOA 1MUCA 5A8OA 3WFLA 4JQ3A 4YVXA 3BLFA 1NELA 2WOQA 1LRTA 2QDDA 3IVTA 2WSYA 4XKMA 3EX2A 1XJBA 4QLKA 2GVLA 1XKYA 1Q6RA 2C1HA 1LZOA 3MMTA 1TELA 3KOYA 4Z1CA 5L6UA 1CGUA 1QPNA 3AZTA 3AJXA 4UWMA 3CWHA 3NUKA 4J3SA 4E38A 4DUOA 4HNTA 2WXDM 3QV8A 1JQVA 5FIPA 1TIWA 1NOUA 4G7FA 3MUZ1 4W88A 4UTWC 5C9XA 1POKA 1C90A 3PHAA 2CXEA 4JFUA 4R3UA 1ISWA 1PZ0A 3P5YA 5CPSA 3W2UA 1EUAA 1XW8A 4YN5A 1W8SA 3KE0A 2Y7DA 1MUMA 4DJED 1LOLA 3AAMA 3OQ8A 1SFLA 1XRSA 2QVNA 4XO7A 2PBOA 2DV0A 1DTUA 3L4ZA 2CLLA 3SCNA 5G2IA 1E1CB 4A3YA 3SZ8A 4KMQA 1UQYA 1ZY9A 1EJ7L 2ZCGA 5FEZA 3LUTA 3L2LA 4HYRA 4XBKA 3W7HA 1S5WA 3THDA 1J12A 3REQA 3DHUA 2ALRA 2VX7A 1NFGA 2XGIA 1UWQA 3B03A 1W2VA 4BZYA 3M5XA 2DQXA 1K4HA 1V5XA 4J2PA 2OQLA 1H1YA 4HZ8A 1XH2A 4DWDA 4B3ZA 1P5BA 3WL0A 4BEQA 5J5DA 3NGFA 3NZGA 3TV8A 3ZVHB 1J01A 5CG0A 3WUFA 3KHJA 3W38A 3R7MA 3WLLA 2OT1A 1MXGA 1AH3A 3KOFA 4IICA 1O5QA 1XWYA 1REQA 4I9AA 2XH4A 4DBEA 2FDMA 2J9ZA 3GX9A 4FO4A 3CUFA 3QBUA 3D3AA 1TMQA 3G1SA 3EWUA 2Q3OA 1UZ1A 3S5YA 3F2BA 4DRSA 2QCLA 1DJWA 2J24A 5EBAA 2ZA1A 4D6EA 1L9WA 2VGBA 5A6AA 4GIRA 1TB3A 2BODX 3MI3A 1RBLA 4N42A 3EA2A 4ZOCA 4PBGA 1J4EA 2PDHA 2Z7KA 3VU2A 2EEXA 1CCWB 2ZADA 1W1PA 4H9XA 1LDCA 1MQQA 3QJAA 3T0DA 4EACA 3PSWA 2PCEA 3RLUA 2NSXA 1HGWA 4JIRA 1GVRA 2DZTA 1CXFA 2J6XA 3E49A 5D4YA 3TX9A 3LA4A 1EB3A 1HUVA 4O11A 2ZRWA 1EP1A 4JTHA 5G5IA 5HNTA 1ZRQA 3BLKA 1KXVA 2ZTKA 4QSFA 4UMCA 5BYWA 3W1TA 4BA0A 4PYSA 3EX6A 2EPHA 3SGUA 3EOEA 4XZIA 1OC5A 4W5UA 3BAKA 3SCPA 1T41A 3DESA 3P81A 3H7RA 1TRDA 3SQLA 2PDMA 1KM0A 4IMDA 2Y7EA 1H4PA 5GJMA 3GBEA 4H7CA 3MKCA 4KEZA 3BURA 3WMCA 1O5XA 1W5OA 4RE2A 4KGJA 3PWGA 4TTUA 3P5ZA 3NQMA 4KCWA 3SN1A 3W74A 3NVTA 4O0QA 4NU7A 5FF7A 3C3NA 2R14A 3TW6A 5LA2A 3T9PA 5I6SA 2DJLA 1ZU8A 3WF4A 1XYZA 4A22A 4DJDC 3V5OA 3H6OA 1QASA 3GAYA 3FA5A 5FJJA 4LBSA 1W17A 5C55A 4G7EA 3MHFA 3URNA 1TR9A 3TIMA 1PZ3A 2CWNA 2JGQA 5D38A 2CBIA 4O18A 4R9OA 5U4NA 1OM0A 2CU0A 5EMJA 4GD0A 4H6QA 2ZZ3A 3LI0A 1XRTA 4KEVA 4BY3A 2ZE3A 1J0YA 5HMFA 5BNKA 3GS6A 3W86A 1LL7A 4DM2A 2P5NA 4RZ6A 4K39A 2GJXA 3WLQA 1RLCL 3QHNA 5AYBA 5CPQA 3UJ2A 3W1QA 4JX5A 3VKAA 3NSNA 1PKMA 5EL1A 1ML1A 1YPXA 3O7UA 5BOFA 2DJXA 3DENA 1N7KA 1MO0A 3VXGA 3E2QA 1OFDA 5D33A 3KX6A 1UD5A 4CCEA 4PA8A 2J7BA 4D6IA 5C9ZA 3GWQA 4ICNA 3SJ3A 3UWVA 4XKYB 1ZJHA 3BAWA 3WO8A 1VYSX 3QV7A 2TYSA 3AFBA 2R82A 3WG6A 2BFGA 4D6FA 2PU0A 2V82A 1KA9F 3P82A 4S23A 4M8UA 3A23A 3RLGA 2ZVRA 3TC3A 1JDDA 3ARRA 3UGRA 5FOOA 1O6IA 1AL7A 3BAXA 4ZQCA 4GK8A 4XBSA 2O9RA 2ZRYA 3TE9A 1XDLA 4W89A 3WEZA 5F2GA 3DI0A 4UR9A 4WDUA 3BG5A 2GJRA 4AF0B 4HOZA 4RV8A 1BG9A 4RV3A 1GOMA 1GJUA 1HX0A 4DJDD 2WBKA 2PRLA 3DFTA 3AIQA 3C2FA 1ZJBA 3BV4A 3A4JA 5HPCA 3B8UA 3CQJA 1HO4A 2Z27A 4ZGYA 3EZ4A 3OYZA 2Y5EA 1JDAA 1XPGA 1BEUA 3OIXA 2NVAA 3SRDA 3GU9A 1WDRA 3GH7A 4XZWA 5A5WA 5DXXA 4AU0A 4UQBA 4O0KA 2Y0FA 3G5EA 2FFCA 3VAVA 4C6NA 1I2RA 4CN4A 3IS4A 3LU2A 4EWJA 4DEFA 1B3ZA 1QHZA 3W07A 4YL2A 2E0PA 2Z1VA 4MDOA 4Q8QA 2BVYA 4WEVX 4F0LA 2GQ9A 4B90A 1XH1A 1OX4B 4FB7A 4XSMA 4MLJA 2XM1A 1UKSA 1P7TB 1L2QA 4F0MA 2AMGA 4XAPA 5HJLA 3Q65A 1KRAC 3I7QA 3XINA 5KITA 3RM4A 1U5HA 3AU2A 3BVJA 3IK2A 1EOKA 3OVGA 1V0KA 3L4TA 1SZNA 1F5ZA 1T40A 3GFYA 4KCVA 4IQEA 1KCXA 3U4FA 1EJXC 1ICPA 3VC5A 4U3AA 4U31A 4TVUA 2VFHA 2ZYFA 1PVNA 4H2CA 2UY4A 2XZ7A 4UQAA 3J7HA 1KFCA 3LV5A 1KO0A 1G6CA 1VBUA 5JVLA 2NX9A 4LAOA 4GJIA 3KCJA 4K1GA 3AXIA 5IRPA 1YXCA 4AWTA 3E02A 3IJ7A 4DIAA 5FJOA 4EK7A 3AMGA 4JNYA 4RDVA 5D2VA 1TJ0A 1GEHA 5DCDA 4CNPA 2PDLA 3ZZ1A 4R7JA 3QFEA 1L6FA 1K3UA 3RIKA 2POTA 2WHKA 4GFIA 1B3VA 3UCDA 4X0NA 5IDZA 3BQ5A 1UR0A 1POJA 3AHXA 2PWDA 2CWXA 3CL8A 1Q63A 3QPEA 3W1RA 1LWHA 3B9DA 4UQEA 5DY2A 1FWDC 4K68A 3AS0A 3OVQA 4C60A 2P53A 4LYPA 3EB4A 3R8HA 2FHBA 4Z2KA 1D7FA 4Q3MA 4IXXA 3QC3A 3VOHA 2YSWA 4MF4A 1G4SA 4W7VA 4K37A 3FIGA 3ZLHA 2Y8UA 3E1F1 4LNYA 2Q3RA 1V03A 1TWSA 2OVLA 5A6BA 1UCWA 1F9CA 3N3MA 1PV8A 4M7SA 4Q32A 4AEFA 3QZ6A 3C2VA 1KKRA 1FCQA 2GL5A 7ENLA 3DYMA 3RK8A 1WP6A 3C8FA 2E9MA 3PZQA 4WY0B 7ODCA 5D2XA 4HIBA 3VIIA 2BMBA 3U5YA 3VZYA 1OFQA 1P0KA 4F2BA 4HNVA 5HWMA 3O06A 4MGGA 2H8ZA 4FZIA 4AZIA 5JBEA 4RXGA 4IPJA 5D02A 3W4RA 3PPCA 1LCOA 3UWYA 4LS1A 4QAIA 2BWGA 1BRLB 3NDZA 5KZEA 2PWUA 4O8RA 3ZJKA 1OSEA 3L4WA 2VFIA 4A2SA 1FDYA 5DANA 3VDAA 3S1WA 1VB9A 3ITCA 4FOJA 3BV7A 4C7DA 4NI8A 2W61A 3VMNA 4WK9A 1FFRA 3VM5A 3N18A 7XIMA 4RE0A 2WC3A 3WEMA 3WNNA 4UOQA 4D6HA 4CNUA 4N4PA 5H1WA 1PIGA 2ZC8A 4B3KA 4YHEA 4KWOA 3N4EA 3P3BA 4F0RA 4WZHA 1UR2A 2GQAA 4HPNA 4LVFA 4BI6A 4DO5A 3SUVA 2FB2A 3WMLA 2XWEA 3LOTA 2J79A 4MPQA 1EYWA 1C29A 4INFA 3ZVIA 3GVWA 1W5NA 2XM2A 1F4HA 2HVOA 2HE8A 2PWVA 3ARSA 3T0CA 4GX9A 1MRAA 3LCXA 3A24A 3LXCA 4A6GA 1F6PA 1D2KA 1OX6A 3L66A 4XO6A 3NQAA 3GR8A 3BWWA 3T0BA 2ZX5A 3ABOA 4DJEA 1ICQA 2YL5A 2IKHA 1CEOA 3AIUA 1GGOA 2FPTA 2ZKMX 1JZ8A 1J2WA 2E28A 3MMDA 4ZL1A 1GYNA 1Q5MA 1S2UA 4IUGA 5HXMA 2XH7A 3FAXA 1I2NA 4M80A 5HATA 1V02A 1VFTA 1K9TA 1W5MA 2EG8A 4QQ3A 3VD3A 4LRSA 4DJFD 4NX5A 4BI5A 1QNPA 4CN6A 1MW3A 4NJKA 1H7OA 1OCBA 4GHRA 4WQ6A 1NFPA 4UTFA 1XLAA 3GYCA 1A47A 2ZA3A 3R5EA 1J0KA 2NV1A 3V3WA 4MB4A 2QLYA 4FEZA 2PC8A 2Y4SA 1XIEA 2H9AA 1CLVA 2ZZ6A 4U5IA 2YLAA 4BK9A 1A0EA 1JI1A 3CB8A 1LM1A 3TYCA 1HZYA 4JFVA 4J1OA 4ZXOA 3SFKA 3S83A 3TNBA 3L7RA 4TV5A 5F4SA 5C70A 2OGYA 1V3KA 1E0WA 3RYSA 1E9LA 5CPNA 2AGKA 4MY1A 4D6JA 1PKNA 2VC5A 5HK4A 3F7JA 4Z1BA 5LA1A 2Z2UA 5HQLA 5GJNA 3G3DA 1P48A 2SFPA 3DOPA 3H8AA 4QAWA 1UZHA 5I3KA 4DBDA 4UTWA 2ISVA 2WMIB 2DIJA 4HMDA 3UG5A 1X1ZA 3VNJA 2V0TA 3W71A 1P6WA 1G9HA 4ORMA 3B0YA 2OQYA 1H63A 4WDWA 4GQGA 2HZGA 1W56A 3MBDA 2EHHA 4PMZA 4U10A 2E77A 2NQ9A 4AWUA 2WM1A 4IIGA 3LZ5A 3CAKA 4LV9A 3FJ4A 1IWPA 5FD0A 1PX8A 2R1LA 4A8RA 1DJIA 3KLLA 4JPGA 4OVXA 2ALDA 3NPWA 4H41A 2OO0A 1XS2A 4PULA 3U57A 5CJNA 4WCJA 3UU0A 1QPKA 4LW7A 5A8QA 4P2VA 5EYWA 3DX5A 3G0SA 4Q8VA 5LIWX 3WENA 1XGZA 1L0PA 2YXOA 3PANA 4IF2A 4XSLA 1BHGA 3VI2A 1LQAA 1B54A 4BFAA 1KFWA 2V3EA 2DVUA 2P3EA 2VC6A 2IXVA 4C1NB 4HK5A 1W91A 4OJYA 4XV0A 2X0SA 3IEBA 1OFAA 2WW5A 3L2MA 3M9YA 4NJIA 3LM7A 1EP2A 1CXHA 4EXAA 3R0KA 4XZBA 4D6CA 4F0HA 2QQ6A 3L0KA 2W5FA 3L5AA 1M03A 1LT8A 1E9YB 1GKQA 5CSUA 3AISA 3XISA 5BMWA 2VFDA 4DLMA 1Y7VA 2EXOA 2HV5A 3IANA 4ACYA 5I79A 4L80A 4IPIA 1MW1A 4JTEA 1GQKA 2G3FA 1FDJA 3BMWA 2IKGA 2GVYA 3TXVA 1GVEA 4D1JA 1U30A 4NNBA 1XIMA 1W31A 4O4WA 3WQOA 3M07A 3MWAA 1GOIA 3STEA 1WDSA 1Z69A 2BY0A 3FGCB 2CXGA 3W2NA 1EBHA 1QBAA 2PODA 4UNKA 3OGRA 3SADA 4OE7A 1MFUA 2G0WA 3I6TA 4Z2JA 2VRJA 1XLFA 3UESA 1A5BA 1PKLA 4UQ9A 1XL9A 2KX9A 4W8BA 1RCXB 2BDQA 2NXIA 3QHOA 4MKNA 1LL4A 3WLKX 5AN7A 3S6TA 1WBHA 2QUMA 5E0CA 1EZ2A 4L4PA 2VVNA 3U4AA 3FK4A 2PLJA 4UTHA 2B7OA 1HKJA 4YTSA 1JI2A 4F79A 4JFSA 4E2DA 4MLRA 5HINA 3WELA 2WQPA 3V0UA 2AL1A 4DO7A 2WJDA 2WPGA 3DEQA 1NDYA 2C16A 3W1NA 3FX4A 3ZMRA 4AC7C 2VR4A 1PZ2A 1GPWA 3T8LA 4NZCA 4QIUA 3W1MA 1MZHA 2WZTA 4S2CA 3BOLA 4LVDA 3UEQA 1XLBA 3RCMA 8XIAA 3A13A 4P7QA 4C6MA 3ZOAA 1PIIA 3NPVA 3TJ4A 4QJ1A 2QW5A 2AMXA 4GUIA 5A2CA 2F6UA 3OLDA 5BOOA 4LF2A 3MCMA 3BW4A 4C6LA 1NY1A 5ABTA 3VMPA 3LI1A 3ZR4A 1B4EA 3IJLA 5CG7A 3SCVA 1HKWA 1XC6A 3CZJA 3Q4DA 4C6EA 2OFJA 1QBBA 5FF3A 3TQKA 2P1FA 1EGZA 3S9YA 1JZ4A 4MWAC 2QCCA 2PTDA 4P7NA 3CAVA 1IZCA 2PSNA 4UTTC 2YBVA 3ZT5A 3FFSA 1WOAA 4C6IA 4KWVA 3VC6A 3TKFA 4Y7EA 3EDDA 4GO9A 3KBMA 4UFHA 3TTEA 2QT3A 4R27A 3BJFA 2OX4A 1OC7A 2ZXAA 4HNCA 5EA9A 4GVGA 1WDQA 3PZVA 3KRSA 2J66A 1TZ7A 1ISXA 3BCJA 1FXQA 4BF5A 3W84A 5KZ6A 5MF5A 2VD9A 1B9ZA 4ZB0A 4UFIA 3SFWA 3GXIA 2YB1A 2OJPA 2Z2AA 4J3WA 3ZM8A 2WSRA 4PGLA 4AY7A 2ZOXA 3LPPA 5FL0A 4M29A 1E9IA 1UKQA 2H3BA 1WB0A 4C1KA 2YDQA 3UJRA 3M0VA 4H19A 5T91A 4PTNA 1I8JA 1K8CA 3PN8A 4AY8A 1N55A 5IBXC 2OU4A 3QLLA 5GJPA 4IGHA 1FH9A 1K9FA 3THQA 1JUKA 3F2CA 1HP4A 3QZAA 4IP7A 2EF9A 4DF1A 1R2SA 2X8RA 3T6CA 3R43A 3K4WA 1A49A 1H5YA 4B2DD 2GUYA 3R0UA 3WZ0E 4ACZB 4CNSA 1XCXA 3CH0A 3GHRA 5B80A 3L12A 2FTYA 3W7IA 1JPIA 1FCVA 1OGSA 1MRQA 4G7EB 1LROA 1AQ0A 1CZ1A 4MWAD 2Z26A 5C7HA 3HGOA 3PUOA 3WD0A 3OBKA 4YYFA 3NR0A 1TKKA 1EF2A 5HA7A 1IGSA 1PCKA 1YXDA 1DXIA 3RFAA 3IV3A 4P7LA 5CC7A 1EL3A 1KM2A 1XLMA 3WLJA 4TU1A 5BRPA 4LPCA 3B8TA 3FJ6A 4GY0A 2E6DA 3N11A 1SJAA 1UBPC 3UZJA 3PTMA 4NASA 3N1AA 3UXIA 1XG3A 3EWCA 3TW9A 3UXAA 2Y89A 1T8XA 4XG1A 4Z1YA 2Y61A 4JDBA 2IKIA 1M7OA 4GWEA 1KM3A 4FR6A 4NILA 4QE1A 4Q4PA 3ZQ9A 3EB3A 2P50A 4I9JA 4HMCA 5CPTA 4UNLA 2BG5A 4K2SA 3WQFA 2DZWA 4TMBA 4LBUA 4JTDA 4IFOA 2VGGA 3BCFA 4IX0A 1PHQA 9CGTA 1CIUA 2MUCA 2W62A 4M0XA 1LUCB 4YTUA 1V8EA 3R11A 3CS2A 2IPGA 1E56A 3VKCA 2V5BA 1UP0A 4MNLA 3B97A 3E12A 1LQ2A 3LS9A 5HMDA 1E4NA 4TUFA 1CGTA 1CGVA 1Q66A 3QMSA 3MT1A 1TTJA 4N6FA 2D1ZA 4MJMA 2XGBA 4QITA 2ZUNA 4QISA 1EKOA 1L6GA 3P8IA 5IHSA 1I6NA 3A9BA 3ITXA 3QN3A 4ICMA 1K9EA 1OZQA 2NX1A 2EBNA 1VFOA 4QG9A 3PM6A 2RDWA 1MNSA 5G1MA 4O1DA 1PKYA 4HTYA 3WQWA 3RO6A 5D9MA 3ARUA 3H2AA 4MADA 2OELA 4IJCA 1QK2A 4L6OA 5G4WA 2TAAA 4AHOA 3AO0A 1W6TA 3FHQA 2E3ZA 1US2A 1XBYA 4QXIA 2BP1A 5DO8A 3RRAA 1GKRA 4L9YA 1WZAA 2DORA 1T96A 4BF7A 1I2OA 3L21A 1EOMA 1BG4A 3W26A 2J8FA 1R86A 3GTXA 1ISYA 1OIMA 3PWIA 2DIEA 1I2QA 2JIWA 4AZGA 4F2TA 3V35A 3RR1A 3I4KA 3NSMA 3NQ7A 1BKSA 3PWAA 2E9LA 2W67A 3GDLA 4HJWA 4Y9NA 3KM8A 1VHNA 4LUIA 1E43A 3ICJA 2EG7A 5BCAA 4CLMA 3HTWA 3ITOA 1HJUA 3GTHA 1B1YA 1EJVC 1QHOA 4OFCA 1KNWA 1K70A 1F8MA 2Z00A 2VZVA 4CCDA 3NYDA 1I9CB 2VZUA 1UWRA 1MNZA 4WX2A 3SQSA 3EX1A 3OVPA 3DGRA 4X63A 2OT0A 4GZEA 4ADTA 1JPMA 2DP3A 2F6KA 2Q71A 1DWHM 3NQ2A 5JMUA 2BVDA 4F4RA 3MUXA 4YYCA 1D8CA 2DZSA 4U3CA 4H9MA 3KP0A 4GZ7A 3LK6A 2J7GA 2YXGA 4N6EA 4S3DA 4YTTA 3JS3A 1WNOA 4LCRA 1FWJC 1U1UA 2INZA 3K1GA 3TNOA 3MYOA 1C7SA 1IXOA 3C8NA 2BGNE 1DWIM 3WL1A 4UB9A 3QVQA 4KRUA 1EYEA 2ISFA 2J74A 2XISA 4PC8A 2B31A 4IFRA 2F61A 2PP0A 2HBXA 3E96A 1BTCA 4JQ2A 2XIMA 2WNNA 3QMRA 2ZZ1A 2WKJA 2GVGA 1J93A 5BROA 2FLIA 2G3NA 1R3QA 3CIWA 3W23A 1E6NA 1DJHA 3POCA 4H00A 5I02A 1JR1A 3HV9A 2PURA 4JIQA 4B5TA 1TX2A 4V1YA 1V51A 1G1YA 4WGXA 1JFXA 5RUBA 3DKJA 3W70A 1KXQA 4YCOA 1E0TA 4O19A 2E1WA 2XIQA 2VWTA 5JXQA 3E2RA 2Y2WA 3RGTA 3HQPA 4D2JA 1UC5A 1BD0A 2XN2A 4OIFA 3HJZA 5LXEA 4IPPA 1U33A 3O2LA 3MMUA 5C5YA 3SN4A 3DFYA 4IMEA 3MHGA 1WAWA 3UQNA 4DNMA 3MZ2A 1KC7A 1TUFA 4I6VA 6CGTA 1R3TA 5GNXA 3GVGA 4POCA 4QE5A 3T2OA 3VNMA 2PC4A 5IXEA 1S46A 4M24A 4UR8A 1W1A1 1GWJA 2WMGA 1BSIA 4U33A 5IFPA 1FWIC 3HZ3A 4DUVA 1VJZA 4ZR8A 2G3JA 4ATLA 3R8GA 1L6YA 1C9WA 4JTLA 3WKZA 3A3XA 2QDEA 2ZXQA 3P8JA 5CBIA 4TVDA 2FGLA 4DVOA 4GNVA 2GOUA 4TOQA 1XIBA 3MP3A 4NAEA 5FEWA 1ZENA 3N2CA 6REQB 4REQB 4UBPC 4LWWA 4I7UA 3WQ8A 1A4MA 3MP5A 9XIMA 3H53A 3WX7A 1QOQA 3O15A 3LNMA 2OYMA 3TCEA 3KVKA 4H8HA 3OVRA 3L23A 2NW0A 1A5CA 3L68A 1LBFA 1OK6A 3HB9A 4B15A 5BMXA 2DT2A 4QCEA 2GK1B 1VKFA 5KTLA 3SSJA 3ANYA 4DB7A 3BLIA 2PWHA 3ORWA 1L6WA 3CEUA 4HN8A 3H2EA 2HTMA 3LV6A 4L4LA 1YXYA 2P3ZA 4C6JA 5D09A 5G1TA 2VT0A 4FS9A 1KRMA 5HQEA 2P8CA 2TMDA 3USBA 1GJWA 1D9EA 1TPEA 4UIOA 3DN5A 2E68A 2YOCA 4H8NA 1HIZA 1FHLA 6ALDA 3RJYA 3PAOA 3UY7A 3W82A 1RR2A 3EWDA 3BDKA 5TAOA 5XIAA 5FCZA 1XSJA 1O68A 2E7FA 4A29A 3IK4A 4LYQA 1V3IA 5CBBA 2VURA 2D2OA 3KL0A 2H9AB 5D2TA 1FWHC 3BLEA 5F4XA 1N8IA 4MJ4A 3WBWA 2GGGA 4EXBA 3W37A 1FA2A 4U5KA 2C1IA 3QMTA 4S3KA 4DZIA 1VFSA 1V7AA 1X98A 1A0CA 4C91A 4HSHA 4LCSA 1T7LA 4DUXA 4RK8A 1KRCC 4LUTA 3N04A 1FWNA 1YX1A 3O0FA 3ABRA 3LCIA 4QLLA 1OEPA 4YXGA 3PVFA 1JDCA 3I3EA 1TCDA 2ATMA 1RUSA 2JF7A 2J88A 2ZX8A 2JF6A 4GXPA 2RKXA 1BQCA 4PUEA 3TAKA 4B4FA 3GH4A 1R3VA 4V28A 2NV9A 4HCHA 4Y9PA 5I03A 3JVAA 1JF6A 1N8FA 1AMYA 4Y8EA 3FV9A 2QPUA 1E3ZA 2VP8A 4DWSC 1O1HA 3FDKA 1ZQ5A 5JQ9A 3W02A 1YDOA 4GRSA 5BXSA 1JVNA 2VDHA 3SI9A 1OINA 1J0ZA 3MUIA 2PEVA 2CERA 3THCA 1EJWC 3M47A 4Z1DA 3PTKA 3CV7A 3P93A 3VTRA 5HANA 4CGTA 2BSLA 1DL3A 3G6MA 3H7VA 7TAAA 1VLWA 4JQ1A 4MKVA 3TJIA 2Z1XA 2DT1A 1O5KA 4H83A 2GSHA 1EP3A 1JIBA 4NRRA 2QJGA 3MO4A 3WLHA 2J8GA 3DHPA 5FF4A 2V5KA 4LFYA 4KH2A 4UMBA 1NTHA 3A4XA 4W8AA 3TW7A 2FZBA 3N2MA 3KUMA 3GBDA 2GDQA 2E40A 1S5VA 3AYSA 3HQ1A 4H7VA 5CZKA 6PTDA 2JKEA 4B2DA 4HPHA 3FY1A 2WM0A 4FXFA 5EGRA 3H26A 1XQLA 1RP9A 2I16A 3CZEA 3RX3A 1J0JA 3WBYA 4L6HA 3NA8A 3I7SA 2ADAA 2WC4A 2XHYA 1HN1A 3GUGA 2JE8A 4FNUA 3P67A 5DCBA 3WD2A 3WNLA 1DJGA 4H6EA 3NQ6A 2F84A 3T07A 2WCSA 1CENA 4GMEA 2YB4A 2QMJA 4UTTA 1UH3A 3KAOA 2FMNA 3PUDA 4LUSA 3HA1A 1DWGM 1WOBA 1HJWA 3N6HA 1YNQA 3UJEA 3FYYA 1VRXA 5M2FX 2W79A 1F07A 3CPUA 4FR1A 4HKPA 1TPC1 3DG7A 2WVTA 2XDFA 2DDXA 1V0LA 3PP7A 5E0KA 4DWSD 3TP4A 1QI0A 1GVOA 1JPKA 2HMCA 3NL3A 4D6GA 1BYDA 4Q22A 3DIPA 3S5OA 1EQPA 2QCMA 2PF0A 1H62A 1E6SM 3N14A 5IDIA 3FS2A 3PBYA 5D2YA 1OZMA 3ANVA 3BGGA 1CW2A 3S2NA 1JEZA 1VAHA 1QWKA 3V1HA 3BOFA 1W8GA 2O9PA 4JFWA 2ZWZA 3NZPA 3BJTA 2XN1A 4JNMA 5IBXA 1I75A 2ACQA 2TODA 2OCZA 4DPQA 3H70A 4WXYA 1UJQA 4XUGA 4HMNA 3SECA 2FJUB 3M6YA 2YA2A 2VEGA 4JNZA 2OPJA 2QVHA 3VNIA 2WCGA 1XYBA 1HKMA 2CHNA 1Z42A 4IPLA 2ZWYA 4XISA 5IOBA 5TBOA 1VGAA 2X1TA 3AJ7A 3UA3A 1IV8A 1AG1O 5LIKX 1E1FA 1YKWA 4E4FA 2PDNA 2ZICA 3I4EA 2PRMA 5BXPA 2IXUA 3M41A 2GWGA 4GE8A 1ZGDA 2V5JA 3WLSA 4Q7NA 4UR7A 3RUBL 1OGBA 4ZTXA 1UKTA 1QPQA 3DFNA 3EYPA 2HS8A 2YCJA 5CPMA 3C6CA 2G37A 2W63A 3PULA 1OQFA 3P80A 3CUJA 5REQB 4L6DA 3BW2A 4NAFB 3R89A 3LN3A 3UD6A 1GOKA 1GHRA 4MTVA 3BGJA 3CLWA 3WLTA 2NQHA 3VFCA 3C0SA 3GKFA 4M51A 4G1KA 3KEHA 3KOXA 1D3CA 2NZLA 2F2KA 3DFQA 2PDQA 3BAJA 4NNAA 4XIAA 3PZNA 5M5DA 1ZP4A 1OK4A 2DUZA 4IIEA 4L64A 2BZNA 4B4HA 1YBQB 5GNZA 1XM3A 3W7LA 4ALDA 5XINA 3TWBA 2DY3A 1F3WA 2PZ0A 4GUGA 3BO9A 4US6A 4ZB2A 1NSJA 1DJQA 1RY0A 4QE4A 3AXXA 1T0OA 4G9PA 4H7ZA 2WMHA 2PD5A 3O05A 4PB5A 4DAIA 1MEIA 2XVNA 4O1BA 3P74A 3HQNA 3LG3A 1PUDA 5F2LA 1P4CA 3MSRA 1RVGA 2XG9A 5BXTA 4O1AA 3GSMA 1KBLA 3S5NA 3W87A 4IM4A 2PRHA 2JEQA 1UWUA 4DI8A 1VBHA 4PTDA 3BTNA 3OZOA 4MPKA 3V1PA 2A6LA 1A50A 3INPA 4OBRA 4GIEA 2PBGA 1EPVA 2VHLA 5EB8A 5LNUA 3AROA 2C6QA 2CESA 1XLHA 4ROQA 3B8SA 2FZ8A 4V15A 4UTLA 2UV8G 3PNZA 3K1DA 3BSHA 1P1XA 3L4VA 3EWXA 3W22A 3RM8A 3ERPA 4HZMA 2TRSA 3R25A 1TV8A 2CNCA 1QHPA 1EIBA 4OBTA 4E8GA 4ROPA 3UFYA 3EXRA 4NF7A 1FHUA 1QNQA 4U2ZA 4TIMA 2GSEA 3QXBA 2D69A 4F0KA 1A5LC 1EPXA 2CEQA 4PMOA 2HQAA 4NZJA 1IZJA 2X1UA 2CITA 5A3HA 2EPKX 3MV11 3EGJA 4A05A 2X1IA 2JKAA 3K30A 3N12A 4P8UA 2WVVB 3FSUA 4IIFA 1MI3A 4EPBC 5LIXX 1Q6QA 3W7GA 3KTXA 3W7PA 4B9ZA 1XLEA 1Z48A 1XGEA 2I9EA 3ARWA 1RPXA 1UP3A 2CLKA 3KCLA 4KEMA 3T0AA 2J25A 3MWCA 2ICSA 4EOUA 1UIOA 3PPHA 3AHYA 2ATSA 5IFTA 2OYKA 3V36A 3KBVA 1W5PA 4FIQA 3UNTA 4W9TA 1ZJAA 1TSIA 3E38A 3VGGA 1OYCA 3QH2A 4J4KA 1R7OA 2X0YA 1J96A 1N8WA 4NZ1A 2VEMA 3R58A 1BXCA 3WNKA 1F3XA 2D3LA 3PZMA 4GI9A 3QY7A 1SW0A 3ITYA 1V6VA 2YDAA 3VOFA 3FDGA 4PTVA 2JIEA 3OLIA 2WZIA 4IQJA 2ZRXA 2OODA 1LTDA 2OEJA 3EMCA 4OBSA 4YJ5A 4WSKA 1X38A 1UKOA 1Z41A 4GPNA 1ESWA 4O50A 5HR7A 3QY8A 3BW3A 3WLRA 4RDWA 1JQXA 4X60A 3CZGA 2A21A 1CT5A 1UR1A 3GY1A 2ZUTA 1PL9A 1GTHA 4H8VA 4FNPA 3O16A 2J9XA 4ERGA 4TX9A 1O94A 3HN3A 2QCGA 2Y7GA 3WNOA 3RG6A 2X16A 1YQ2A 1UOZA 3EPNA 2Q01A 4NNCA 1WXYA 4ZODA 1QK0A 2BLEA 5CAHA 4GZIA 3LHZA 1XC4A 2AOSA 1BFNA 5JIWA 1PZ1A 3WLPA 1ONXA 4H9UA 3SJNA 4D8ZA 3KBNA 3P14A 1CLKA 4N7QA 3EMZA 3M16A 2DPEA 1QO2A 3JU2A 3P0WA 4TXEA 4GUHA 1TO3A 3DHDA 2A85A 2QCNA 3HPSA 4TV6A 7REQB 2QNEA 4BQ3A 2PTWA 2E9BA 2I14A 5ENLA 4L56A 2REQB 4QDWA 1O1ZA 3AWNA 3QR3A 2Y8VA 1X6NA 3M0KA 1XLKA 4GI8A 3URAA 1J8VA 1KTCA 1H41A 1K4GA 2UY2A 4JAWA 1NWRA 4J35A 4PUNA 1JCLA 4IG2B 4C5YA 3C61A 5LNRA 1XLDA 4AVFA 2NVCA 4ADUA 1TRIA 3AMDA 2PUZA 2QJMA 3LHUA 4AY1A 1EIXA 1IT7A 3IACA 4O4VA 1E6PA 2WHMA 1HP5A 1W32A 2FPVA 2DT3A 1W3HA 4UTKA 2QJHA 2Y70A 1MFVA 3CPRA 2R8WA 4B91A 2DVTA 1VPQA 3WDPP 1QRQA 4JHOA 1X96A 1TX0A 3ZJ8A 5D30A 1AJ2A 1NM9A 4GNJA 3W1XA 2HVMA 3Q45A 1LRNA 4H04A 4PSPA 1R5YA 1QXLA 3L4XA 1WDWA 3B8WA 5H8PA 2F8QA 4YLWA 4BKNA 4JN8A 3M46A 5HUPA 1H0IA 1H7RA 4LANA 4E5TA 2VKZG 5DY3A 2FTWA 4PH6A 3SSZA 4HZ6A 4NKCA 1OG0A 4Q8OA 2GYIA 4LYRA 1XBXA 2KAUC 2XN0A 3NTYA 3APTA 2WO5A 3H55A 5IM51 3NJ3A 1FBAA 4B5UA 1UWAA 3T2QA 1EGVA 1KFJA 4PMXA 4RZBA 5CJMA 9XIAA 1W1B1 3R8RA 4XD4A 3GDKA 2XH0A 4PCSA 3ZWSA 3KOZA 3NPXA 1EC7A 2X7VA 1UMYA 4PFMA 2RHGA 2PWFA 4JEQA 4AZCA 4PEEA 2Y62A 1OC6A 4HB7A 5I09A 3NPUA 4FLOA 3VFLA 1M9HA 5LNVA 3PJWA 3VOJA 1E4MM 1Q4WA 4H9VA 2ZA2A 1J5SA 3N2BA 3V5FA 3W0KA 1BWVA 4QSHA 3FYOA 1HG3A 3A4AA 1R8LA 1OYAA 1UIPA 1UH2A 3QGVA 4FNSA 4KWSA 2J13A 3KWXA 1RK6A 4L61A 3TFXA 5H8UA 2WV8A 1A0DA 3N19B 1WO2A 4JY8A 1OT2A 4QG6A 1BSLA 1PYFA 4GI6A 3HGSA 3EA1A 1XPYA 3VNZA 3L65A 1HKKA 1M6JA 3DAQA 2QUUA 1WAUA 2GPTA 1OADA 1ZTVA 2DT0A 5BW6A 4XUYA 3E6EA 3OU8A 4MYXA 1SZEA 1O60A 4C6BA 4I7VA 1S1PA 2YL8A 3ATYA 1TG7A 4O14A 1X1OA 1OFBA 1RQHA 4KCUA 3SO7A 2X0HA 4LX4A 3BJSA 5AZ0A 3W01A 3W7DA 1V3MA 1PWLA 2WLZA 4UMAA 4S1FA 4B5WA 1H0GA 1E3XA 4GH3A 3W6LA 1FKXA 2VI0A 1JYNA 1UB3A 4WJXA 1WKDA 5AOUA 3EX3A 4GX8A 1AZ1A 5KINA 4HN4A 4CVUA 2RDTA 2BX7A 2PDFA 4LEFA 1E15A 4LH8A 1RQBA 4N02A 2PPGA 3ITGA 2ZIDA 4X9SA 3VUPA 1JAKA 4KEUA 4Z42C 4JDYA 3GRIA 3G0XA 3M0XA 5DELA 2PAJA 4CCCA 2Z6JA 5ABGA 1H7XA 1IEVA 5EMUA 1EJTC 2JALA 2P76A 1C8VA 2YXXA 4UFMA 4Y2WA 1XIJA 2UBPC 3MW7A 3NWRA 5E6YA 4JTGA 3CIVA 5DT7A 4Q8PA 4J3TA 1VIZA 2DUAA 3F5KA 4FALA 1QDSA 1HGYA 1XIHA 1TV2A 1YIXA 4Q6XA 4NYYA 4JQAA 1WPCA 3A3HA 3AI0A 3ZWTA 3MMWA 4UTIA 3EDKA 4FPSA 4XD6A 4PTWA 4BJHA 2YCLB 4R5EA 1K77A 5DBUA 4Q4QA 1UR8A 4JICA 4NZ3A 3DI1A 2GFTA 4UTMA 1XV8A 5BU9A 1RCOB 1RV8A 1YE6A 4IIBA 3CQ0A 1ZP3A 2V30A 3GXTA 4J5NA 4JFTA 2VVSA 1F6YA 5AZ1A 3VIKA 4FP1A 4GH1A 3VNLA 2HCVA 2DZUA 4NXKA 2PWGA 1VD6A 1XQKA 1ISVA 5A6BD 2D20A 5FJTA 4E2BA 3HFYA 4RW5A 4DQWA 3T7VA 3KBWA 2DFAA 3W1AA 1U5JA 3DERA 1F61A 5EPDA 4P61A 5EMLA 4HTBA 4M6QA 3VILA 4EP8C 2VZTA 4EWND 2P8BA 4O16A 3TAOA 2EJAA 1Z6KA 4IFKA 1F4AA 1HTIA 4EPDC 1ADSA 4S3JA 5KETA 5FJIA 3MP4A 2WKLA