1I60A

Structural genomics, ioli protein
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
278
structure length
278
Chain Sequence
MKLCFNEATTLENSNLKLDLELCEKHGYDYIEIRTMDKLPEYLKDHSLDDLAEYFQTHHIKPLALNALVFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIVKEEIKKSSVDVLTELSDIAEPYGVKIALEFVGHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAMGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVWPGQGAIDLDAHLSALKEIGFSDVVSVELFRPEYYKLTAEEAIQTAKKTTVDVVSKYFSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus subtilis ioli shows endonuclase IV fold with altered Zn binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords IOLI PROTEIN
total genus 110
structure length 278
sequence length 278
ec nomenclature ec 5.3.99.11: 2-keto-myo-inositol isomerase.
pdb deposition date 2001-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1i60A00
3QC0A 3JU2A 3U3HA 5H1WA 3UXIA 1XLFA 3ITOA 1XLBA 4X63A 1XYAA 2QUNA 3KBJA 3TVAA 5XIMA 6XIMA 1XIIA 1XLIA 1XINA 4GQBA 2OU4A 1BXCA 3KCOA 3OBEA 4OVXA 1DXIA 4QE1A 5EMLA 1XISA 3XISA 5EMMA 4YTTA 4GLEA 3KTCA 3UA3A 4LNCA 4Q7IA 2J6VA 4E3VA 3AAMA 1QUMA 1I60A 3KBWA 2NQJA 3GNXA 3VNMA 5FA5A 2X7WA 3M0VA 3DX5A 2XIMA 3XIMA 2ZDSA 3M0XA 4HGXA 4XIAA 3AALA 3C0LA 4HNOA 4K1GA 2GLKA 4PFHA 3CQHA 1XIBA 1DIEA 1S5NA 3KBSA 3P14A 4YTUA 2GUBA 5AVNA 3UA4A 3M0HA 6XIAA 3ITVA 1XIMA 3VNLA 5XIAA 2XISA 3VNIA 3ITLA 4QE5A 1K77A 1XLEA 4US6A 3IUDA 3BZGA 1XIJA 2QW5A 1DE6A 4XIMA 1S5MA 3UVAA 4KW2A 5J8LA 4A8IA 4ZB5A 3KWSA 3KCJA 1XYCA 3AYVA 4ZB0A 1XYLA 4XSLA 4A8NA 2Q02A 2X7VA 3C0QA 3QYSA 4QEEA 4ZBCA 4ZB2A 3P6LA 5I7GA 4QEHA 1D8WA 2NQHA 9XIMA 5B80A 2ZVRA 1XIDA 3ITTA 5EMKA 4HHLA 3KBVA 4A8RA 5B7YA 3BWWA 4QE4A 3CQKA 3KBMA 4J4KA 1XYMA 1TZ9A 5C9ZA 1A0EA 2XINA 3IUHA 1XIEA 3VNKA 1XLMA 3M0LA 1A0CA 4G56A 3VYLA 4EAYA 3M0MA 2G0WA 1XLLA 5B7ZA 3DBNA 4DVOA 4DUOA 7XIMA 2HCVA 3AYTA 3NGFA 1XLHA 3BZJA 3BANA 4QDPA 1XYBA 8XIMA 3CNYA 1XIFA 1XIGA 3QZAA 4XISA 1BXBA 1XLDA 3ITYA 5XINA 3VNJA 3CWHA 1XLJA 3CQIA 4X60A 4HHMA 3N4AA 4GJJA 1DE5A 4X61A 2G4JA 2I56A 3L23A 3ITXA 4QDWA 3XINA 4YTRA 1QTWA 3IUIA 2QUMA 4K3ZA 3BDKA 2GYIA 1XLKA 2NQ9A 4XKMA 1GW9A 5EMJA 1CLKA 3FVMA 1XLCA 1XP3A 4XSMA 1XICA 1XLGA 2HK1A 2I57A 1O1HA 9XIAA 3QXBA 5TNVA 4A8LA 1I6NA 4YTSA 1DIDA 1XLAA 3M0YA 4W4QA 1A0DA 1QT1A 2GVEA 4PGLA 4GJIA 3CQJA 1MUWA 3KBNA 3C0SA 5H6HA 1MNZA 1YX1A 2QULA 2HK0A 1OADA 5AVHA 8XIAA 3TC3A 3WQOA 4EACA 3UU0A 3LMZA 3U0HA 4YTQA 3KCLA 1XIHA
chains in the Genus database with same CATH superfamily
1W5QA 1HGWA 1RAKA 1FRBA 3AYSA 2XGIA 5I79A 1A5MC 2F38A 2QDHA 4AAJA 3AU2A 3W37A 1CBGA 3PZNA 4MIMA 3BE7A 1OBAA 3M0VA 3W1UA 1TIMA 4LH8A 4XIAA 2GGHA 2PS2A 3KVMA 3GD6A 2R91A 4HSNA 2VCBA 4S23A 5I3HA 4K68A 4GNVA 3UPBA 1E4NA 3GB6A 3PZTA 2FVMA 3JZUA 4NRRA 3PFMA 4XUGA 3NVTA 3BGJA 3T81A 4NX5A 4LPCA 3ZFHA 2A3CA 1RK6A 4C6CA 1JZ6A 4YVXA 4ZQRA 4GWEA 1E72M 4PUKA 4L7ZA 1R9ZA 4FNUA 4AYSA 3KOFA 3NURA 4IGMA 3ME3A 1TWWA 3EDKA 4D6CA 1VYRA 3UWUA 1EUAA 4F8XA 3ZWSA 1K02A 4W86A 1SVDA 3I6RA 3B9DA 3QKEA 1QAPA 3GDLA 3WQCA 2Y1HA 4TMBA 1RY8A 2XH4A 3L2LA 5DO8A 3S2CA 4O1DA 1SZFA 3PBYA 2O9RA 4W7WA 2QHAA 1VBHA 4KGJA 3SN1A 1JCJA 1MXSA 1GEHA 5I00A 4LEFA 1WX0A 5DMLA 4R9OA 4KKXA 4PBFA 1SJBA 1EBHA 1LQ2A 3STPA 5D38A 2DUXA 3GYCA 4D71A 2OZ8A 4I9MA 4JTSA 1GVQA 3B06A 3GDBA 3V3WA 3VIJA 3VGEA 1QNSA 4RZBA 3N9SA 3O2LA 1VHNA 3KTCA 4DNMA 1Q6FA 3Q94A 1JVNA 1T7LA 4AD3A 4CNNA 3GWQA 5G4WA 1O5RA 3REQA 3CQHA 2C6QA 3H23A 3V7PA 2DZTA 3F4NA 3V16A 4MWAC 3H2FA 1UOZA 3AFBA 1AMKA 3EX6A 2QIWA 4JY8A 4JIQA 2VC6A 4F4RA 4ZXOA 4B92A 1GOIA 4A29A 1XG3A 2WLZA 1EFZA 2OG9A 3UWWA 4PSPA 2CYGA 1Q6QA 5I7GA 1PHWA 5F4SA 1WQ5A 4UQBA 3WQVA 5HAOA 4E5TA 5IHRA 5FF4A 5E9AA 3N13A 2VR5A 1X8FA 1KRBC 3W82A 5AC6A 3FEQA 2DZBA 3DKLA 2F6XA 2POZA 4TIMA 1FH9A 3VKJA 2VFDA 3PWIA 4XAPA 4JFWA 4MPKA 5D37A 1XLJA 4J2PA 3T0TA 2I56A 5BOFA 4EOUA 4UFJA 4XO6A 1OZMA 3IWPA 1FWRA 1DEDA 5C8BB 1XGEA 1W1ZA 4RE0A 4GNKB 4L9ZA 2PDHA 2V38A 1XM3A 1Z48A 2D73A 1UZ1A 3RLHA 3H2NA 3H7VA 3GUGA 4H8NA 3S5OA 2V0TA 5D2VA 1FX6A 2GVYA 2YBVA 1KD0A 3KWXA 3WUFA 1UIOA 2C91A 2J88A 3BOXA 2VX5A 2WJZA 3BG9A 1YNPA 1UR9A 2PGRA 4JTDA 3TSMA 1FWEC 2XU2A 1SJCA 5I09A 1A47A 3DZ1A 3HU7A 1JCNA 3KFTA 3D47A 3NQDA 1QFEA 4B15A 3DECA 3QMRA 4O19A 2WNZA 4GKTA 3CL8A 1WZLA 4Y2WA 4IJBA 1BGGA 3MW7A 4HK6A 4RDVA 3EMCA 3GM8A 1Q4NX 2VRQA 3EDEA 3K4DA 4WKHA 4B5VA 2QJIA 1HJQA 2B7QA 4ZB2A 2JF7A 3W7EA 1GZJA 4DZ5A 4K1WA 5EMKA 3NDOA 5CPMA 1NDZA 3UESA 1ZZMA 3FGCA 4V15A 1IT8A 2VEGA 1AQHA 3LHWA 4O10A 5KINA 1PKNA 2J24A 1A4MA 3AJ7A 4GC3A 3KHJA 4Q8UA 1PKLA 1WBJA 3NZQA 2ZKMX 4WEVX 1L8PA 4BY3A 2RDWA 4JYFA 3W3OA 4PUNA 4EVZA 3QLDA 1HUVA 1ODUA 1YEYA 2VZUA 4L6HA 3W2JA 2MANA 3I7RA 3PUEA 5IFTA 4PMQA 1EBGA 3SCTA 2VOMA 4M1RA 2Z00A 1PYFA 3IGHX 4ICMA 3QR1A 2CFFA 4LVFA 1C9DA 4M7TA 1L6GA 3BLEA 5HPOA 2E6FA 2VI0A 4O1BA 4O13A 1JPHA 3CHFA 3RGTA 3SIZA 6XIMA 2VELA 4PE8A 2PD9A 5DANA 3OW1A 4JIPA 3NZRA 1O60A 5FI8A 3KX6A 4TO8A 4AWUA 4QTGA 3GTFA 3SDOA 2ZUNA 1EJVC 3KRZA 2EXOA 2BZNA 5A6BA 2R82A 1YDNA 1NM9A 3U9IA 2GSJA 3T0BA 2A3LA 2DIJA 2KZHA 4PL2A 1H62A 5CG0A 2DORA 5BXTA 2YXXA 1AL8A 1A0CA 2XZ9A 3KZSA 3IEBA 4LRTA 4ICNA 4XD6A 2P1FA 2BHYA 4XZWA 4B5TA 1BTCA 4AISA 1EJUC 3FFSA 2XGZA 3SR7A 3GXDA 3G1DA 3NOEA 5HMDA 2XPKA 3WD0A 3GDTA 3APYA 4L6OA 4DYEA 2CHRA 3AISA 2FTWA 2BXYA 3H21A 2DY3A 4N42A 1BRLA 2QCLA 4JTHA 3SB0A 4U2YA 3ZYZA 1P0EA 5H1WA 3QPZA 1F8MA 4CNSA 2X1IA 5HDRA 3B9OA 3DFOA 3BAXA 4C60A 1JZ5A 1FCQA 2OJPA 3WH8A 3BV4A 5HK4A 2E6AA 3VIFA 2HROA 5K9XA 1TTJA 2UWFA 2QT3A 4J9JA 3NPVA 4IIBA 1XD0A 4P7OA 4REQB 1PXGA 1QPKA 3VINA 4IQDA 1HJSA 4CN6A 2R24A 3APGA 2IPJA 1JQVA 1RA0A 1XDLA 2G3MA 4TVCA 4IFOA 1JCMP 2EAWA 3B0PA 5LNWA 3HPAA 1S5WA 3C2FA 3AYVA 3TYUA 3E2RA 2QCNA 3A6OA 4LUTB 1PWMA 3OO2A 3P6LA 1QBAA 4N9EA 4IX2A 4DWSB 4NJKA 4E38A 5KEZA 3N17A 3OU8A 1ADOA 2REQA 1TPEA 2X2GA 5C9ZA 4C5ZA 3DFSA 2DZWA 1Z32X 3BMWA 1EC9A 2QCFA 1BVNP 4FOKA 4DBWA 1YPIA 3STEA 4JQ4A 4U10A 2DV0A 1QTWA 1E4LA 4AZ5A 4D6DA 4GYJA 1OX4B 4WIWA 3WZ0E 3OVRA 4F0RA 1FTXA 3M0KA 2HEJA 2VQTA 4Q8TA 3E9AA 4PMDA 2X09A 2E0PA 1R2RA 2V82A 4LGXA 3UXLA 3LHVA 2ZC8A 3VFCA 3M7WA 1CIUA 4I7WA 5ABGA 1V5XA 2E6DA 4QJ4B 4HJWA 4JTKA 4UNKA 2PWGA 3BLKA 1HL8A 5F2LA 2C3ZA 2FTPA 5CZKA 1W56A 1E6ZA 3L21A 1I0DA 3DKJA 4LW7A 4PN2A 4US5A 3LDVA 1H7RA 3P8JA 4N02A 3S6OA 2CLFA 1FWCC 4PR4A 2E67A 4KWWA 4US6A 2C13A 3MCOA 1UR3M 4UCFA 2CEQA 1DJQA 4CN1A 3GU9A 5C5YA 3W53A 1IHIA 1W9UA 3TYAA 3NIYA 1CCWB 4UFHA 4FX7A 1OF8A 4WSJA 4DYJA 2PCEA 1XBVA 1FUYA 4HB7A 3B4YA 2O0TA 2GSEA 4AEEA 2DIEA 3QTPA 3CASA 3IS4A 2NZLA 4QRNA 5CGMA 3T0DA 3NQFA 1W1TA 3W01A 3K4AA 3OHIA 3CHEA 1MMFA 3RAOA 1R86A 4IIEA 1Y8BA 1GVIA 4FEZA 2P3EA 2ZRUA 3MT1A 4GVIA 4W8BA 5FJRA 2VGGA 4JEQA 2IS7A 1XGDA 1Y5VA 2F61A 4G7EB 1VFLA 3U4AA 1Q6OA 1YQ2A 4PA8A 2OTDA 1AH0A 3ZQ9A 3TJLA 1XLBA 1UUOA 1ZLPA 1JXJA 1JDDA 1OC5A 1XLIA 1OIMA 3Q4DA 4JTRA 1ICPA 1QWKA 4JTCA 1LG1A 2J47A 2D0HA 5I07A 5D9PA 6PTDA 2B81A 1CI1A 4GIEA 3P14A 1U83A 2OSXA 2PDQA 3PAJA 2G3NA 3MC5A 3UVAA 2HS8A 2ZADA 4P8UA 4LAUA 3WD2A 1GORA 1TWSA 1Q8AA 5KZDA 3S5ZA 4GE8A 2GPTA 4HU3A 4TTUA 4K8HA 2YW4A 1CX9A 3DG7A 4OGZA 3WLIA 4OV9A 4EAYA 3CUZA 3OG2A 3CIXA 4GY7A 3P93A 2HBXA 3BXWA 3M5VA 3PJXA 3THAA 1GVOA 5I03A 1KTBA 4X0VA 1JRBA 1P6BA 5IRPA 1FDZA 3L9CA 1GW9A 4ZOCA 2WAGA 4NVTA 3AHVA 3W7LA 2PC8A 1DIOA 4JHZA 3KTSA 1E0XA 3WNMA 5IDZA 1QI0A 1AJ0A 4S3BA 6A3HA 4DX3A 1EP1A 1TVPA 1LJYA 3ITOA 1V8EA 2BY0A 2VKZG 2QUNA 4FX6M 2DVXA 4EKJA 3KRBA 4PUUA 1TIWA 1FWBC 1FWDC 2FLIA 5FKYA 5HMEA 3ZM8A 2Z1WA 2JIEA 1SSDA 3E02A 2Y2WA 2WSPA 4DZAA 2GJPA 4E3VA 3IVSA 5DQPA 3DGBA 3PSVA 4G7FA 5HOSA 3UY8A 1XLEA 1V6UA 1R0MA 1QCWA 4NXSA 3PSWA 2BOFX 4KW2A 3WL1A 4A22A 4BHYA 3R8GA 3RG6A 1XYCA 2IUZA 2X8RA 2NXHA 3PTQA 3RMJA 3EOUA 2EBNA 1LUCA 3PG9A 3CV7A 1VFSA 4FIRA 3VFLA 3W7IA 1C93A 2BP1A 4HNNA 3BURA 4ZQOA 2WZEA 2DPEA 4DN1A 1BAGA 1DQUA 1Q63A 2YCLA 5CQ1A 4RE2A 1LWIA 3VOHA 1EWDA 1E9YB 4CQ9A 2HE5A 3TQ0A 4Y9PA 1CTNA 3WJXA 3O6CA 3H53A 1HKKA 1GVRA 4Q8NA 4O50A 4ZQCA 4HA3A 2VDHA 1VQTA 5I24A 2E6YA 1U2YA 2QCDB 2HK1A 4PH6A 3P81A 2WK2A 3PPCA 2FDSA 3WNNA 4I8YA 1E5JA 1AFSA 2AKZA 4DPPA 2YOCA 3MHUA 5DMNA 2WQPA 1XSJA 2ZWZA 3O63A 1LROA 3K13A 3WLOA 4WCJA 1BKHA 1BHGA 2ZXAA 1LP6A 3DAQA 1QUMA 4HSHA 2D0FA 4NASA 1H63A 1UZHA 1LQ0A 1E55A 4YTUA 3TN3A 3URQA 3W83A 2XG9A 3S1XA 1DIKA 1ZBWA 1T41A 2QDGA 3EXTA 1Q6RA 4I6KA 3UZ5A 3DG6A 4A8NA 3WH6A 4QEEA 3LCIA 3SRFA 2I9UA 2QPSA 5HMSA 4G9PA 4XBJA 4HD5A 3BCJA 2DW6A 4XAGA 1JXKA 1E56A 4L4PA 4Z1CA 2C1HA 4K8GA 1XIEA 3DU0A 2XFWA 1BYDA 2CKSA 3LV5A 1ZSXA 2VX6A 1FXPA 3BG3A 3U5YA 3J7HA 3B97A 1TCDA 1V7YA 1QOXA 4GJ1A 4WVXA 1EZ2A 1HO1A 3FKKA 1TZZA 1X96A 2EPMX 3HQ1A 1EYEA 2BHZA 4L1GA 3L0KA 3EDFA 1B3OA 2ZQ0A 2BY1A 2VZVA 1UPPA 3JZEA 3N6QA 4JX6A 1UYQA 4YS1A 3VMNA 3TYZA 1F4HA 1HW6A 1V6YA 2P50A 5DN1A 3CH0A 1PZ3A 4CQCA 4K38A 1IZJA 4E4FA 1TV8A 4MUZA 5SWUA 3NXFA 2OYMA 5D2TA 3AALA 4RX0A 4WXYA 4RW3A 1US0A 4FLQA 3VAVA 4AIBA 3ZIZA 1UMYA 1M01A 2YB1A 2FDMA 1JIBA 4OV4A 4YYCA 2QW5A 3WUEA 3ZOAA 1KBKA 3IGUA 1VJZA 1LQAA 4XWUA 3WD1A 4JHMA 4ILSA 2ZE0A 2BVWA 1AA1B 4F2UA 3U48A 3IUHA 3VOIA 3EWXA 3BLDA 1XG4A 6REQA 3CC1A 3WQPA 1RR2A 4UR8A 3VIKA 1VRXA 9CGTA 3BANA 1JGIA 3AWNA 3NM3A 3AIBA 3QGKC 3R5EA 5A6TC 2PLMA 3E2QA 2NVAA 2O9OA 2H8XA 1ZTVA 1WPCA 3R0DA 1S1PA 4H6RA 1O1HA 1JYWA 1O94A 4FXFA 2J4GA 3ARWA 3WLNA 1T99A 4OOZA 3C4UA 1XSKA 3UETA 2RDTA 4AZ7A 4C6MA 5DY3A 1ZALA 1F4AA 3ARYA 1S2VA 2INZA 5D2WA 2P3ZA 1H7WA 1CXEA 3S6DA 2QIIA 4YLWA 2ONEA 1PUDA 3KBWA 3B03A 5AYIA 4YXGA 2XIMA 1FH7A 4IIHA 4QAIA 3CV2A 2PMQA 1GZ1A 1XIBA 3A4WA 4RK8A 5I23A 1KXVA 3TWAA 1LT8A 2AMGA 4UC5A 2XVPA 1E15A 3POHA 3ZXWA 1W1IE 3E0IA 1OFOA 1G6CA 1CGXA 1DP0A 1XR2A 2IKGA 4JFUA 1FWNA 3GC4A 4RXFA 3IVUA 1GG0A 1UBPC 2OWCA 1YBQB 1N7KA 1HJVA 5CGQA 1DPMA 5G4HC 4PMNA 3FAXA 4LAMA 1EXPA 1NVMA 2PU1A 2GVLA 2NUXA 2ZICA 5FF7A 4FNTA 4G56A 3S1WA 2CLLA 2VC7A 3GAKA 2PDLA 3I65A 1AQMA 5LGZA 5KZMA 4JNMA 4X61A 3TJIA 4AZCB 2P5NA 2D3NA 1MZHA 1ZJBA 3GYEA 4GABA 5JIPA 1DHKA 2YL5A 1QW8A 4GK8A 1A5OC 1ONXA 4AD0A 1NH6A 3TYBA 1F05A 1TR1A 3T78A 1VP5A 4WOQA 3TC3A 3I3BA 1J6PA 1GOOA 1W9VA 3NEHA 1EWEA 4X2PA 1GYMA 1K7XA 5D33A 2RJHA 3NZ1A 5LSMA 2GJRA 2QJJA 1X7FA 1IEXA 2EG7A 1C8VA 4HIBA 3O0KA 4B3ZA 3LK6A 3KVKA 2J75A 4H9UA 4B2DA 5A2CA 5FJOA 3GTNA 4PFHA 3EB2A 5T26A 2ESCA 3B05A 2OO6A 4LY8A 2XISA 2QCEA 3QY6A 3IIOA 1XWYA 2WHMA 3L5MA 3CUFA 4H6KA 1I75A 1W91A 3M43A 3ZVIA 3GZ3A 3GTIA 4MHBA 1TPC1 3LXBA 1JZ4A 1NWUA 3H2EA 1Q5MA 2WMIB 3CWNA 3UG4A 4IMAA 1GUVA 1XHGA 4Q4MA 4DF2A 4H9TA 4N9CA 4C6FA 5LIKX 4JS3A 5B7ZA 1NFGA 1BF6A 1MQPA 2HTMA 2C0AA 3EAUA 4QAWA 1Q6LA 1JPDX 1TTPA 3UYIA 1JAEA 4Q6JA 1MW0A 5K2ZA 3IJIA 3IUIA 1RCXB 1US3A 3W7JA 1U1JA 3AHYA 4RZ5A 4F9DA 1PBGA 4JTTA 1HT6A 2J8TA 4ZA0A 3DIPA 3AHZA 4BI5A 5ABTA 4IP4A 4EANA 1H50A 3CQJA 3NCOA 3RILA 3DHFA 4KFPA 4ASTA 1XD1A 2PF8A 3PZVA 6ENLA 3ATYA 3W4RA 3VIGA 3N04A 4Q4QA 3STCA 4UBPC 3NQGA 3NZPA 4M81A 4WOZA 2DW7A 3UWVA 1C29A 1X6NA 5EMMA 1SO6A 3WUBA 2YPIA 2WBGA 4TU1A 2PUZA 3DFYA 3OLDA 1T40A 5U7SA 1IR2A 5CBIA 4P8XA 2GUBA 1UWUA 3IRSA 4WR3A 4MPQA 2EPKX 3TTOA 3FX4A 4U5KA 1K70A 2YYTA 1V6VA 2A79A 3LBOA 2EF9A 3T1GA 4W93A 4K6AA 1DJHA 2PLJA 2WHLA 4IGSA 4AD4A 1P48A 3QBUA 5AC5A 1Q85A 3AXHA 1QR7A 3SJ3A 4QNWA 4K2SA 5T9CE 1POKA 4UR9A 5IXEA 1TWIA 4IMGA 5AHFA 5C9WA 2Y7DA 4MWAE 4MUPA 3R4IA 2C0HA 5EYWA 4GHRA 3CNYA 1XIGA 3G2GA 3MJMA 3WL0A 4MJMA 4AHPA 2BFGA 3C3UA 4YTRA 5FF0A 1OJXA 2DEPA 4HA4A 1Q65A 1OFRA 3CZEA 4LQ1A 4CU8A 2TAAA 2IW0A 5CPNA 3W87A 4GUFA 4NI3A 3ZVHA 1MEWA 1XDMA 1IEWA 3D6NA 1X6UA 1AJZA 1UD3A 4UMAA 1B54A 1HQTA 1DKWA 3HG3A 3WSUA 3U3HA 3SM0A 4AZIA 1VBRA 3P0XA 3SQMA 5XIMA 1UB3A 4NSBA 3OVPA 3A4XA 1ISXA 3LM7A 2Y5JA 2NVDA 1B57A 3HBLA 4MKNA 2YCIX 1J0KA 2W9MA 1GOWA 4HZMA 5C9RA 4IISA 3DHDA 1M7PA 2J7CA 4PTMA 2GUUA 3CZKA 3VOJA 1G67A 4MZ8A 1ZGDA 3QFEA 2CKRA 3UEQA 3E6EA 2OEMA 4J3ZA 1UWAA 4RNHA 1NWTA 4IGNA 1QPOA 1W3LA 2GVJA 2CU0A 4DQWA 3O05A 4AH7A 3LPOA 3HV9A 1UWRA 5AFDA 1VC4A 2C1IA 2EG8A 4KF1A 1TSIA 3NUKA 3UXAA 3PPHA 3FVDA 3ABOA 1L6SA 3OZPA 4GYKA 2WJEA 1AW1A 4GVGA 1P5BA 2EPNA 1ZP4A 4X60A 3TTSA 2ABAA 5AOUA 3UXDA 4CCCA 4G7EA 1NY1A 3CYJA 5GJNA 1W17A 4DB7A 5D09A 3NFUA 4E3TA 4EX4A 1BSLA 2A3BA 5A2BA 4LAOA 1TQJA 1M68A 1TVNA 1UW9A 4UTLA 3C2EA 1KV5A 1VD6A 5TBOA 5FL0A 3U6WA 1PZ0A 2I16A 4EPKA 1ITCA 3WLJA 3FN9A 1PX4A 1PTGA 1RK5A 2HPIA 3NQMA 2NQJA 1NARA 4RW5A 4PCTA 4PYSA 3DX5A 5BROA 3T08A 3CUXA 4AMCA 5IFPA 2NV2A 2W67A 1XDJA 5CLTA 4H3DA 2XWEA 3T9PA 3QV6A 4WZHA 3U2OA 3A23A 5EY5A 1CXLA 1XQKA 1VRDA 1XV8A 5D2YA 2G95A 3P5ZA 3PF3A 2PDFA 3CZJA 3F7JA 4XIMA 3BOLA 2ODOA 1GEQA 4UTFA 1R30A 1B90A 3L4WA 3W71A 2NWSA 2WMFA 3MO4A 1FKXA 2NUWA 1R8LA 4GI4A 5FAJA 2C19A 1D8CA 1UR1A 2VFGA 2PWEA 5A8OA 3OP2A 2FJKA 4IXXA 4UTHA 4TV5A 2FHCA 3MS8A 1HG3A 4C90A 1JG9A 4DJDA 3UNDA 4ATDA 1P6CA 5A5WA 4QROA 3BJSA 1R5YA 3CMGA 4GC4A 2PP1A 3A47A 2XH0A 2QUMA 3QZEA 2GWNA 3W1XA 5BRBA 3ZT7A 3ARTA 2OZ0A 3IIPA 1JYVA 5I02A 3W6MA 1G9HA 5GPRA 1PIGA 4FXSA 2FHFA 3MVIA 1ODZA 2BXZA 2ISDA 1T8QA 3BLIA 2HK0A 1L0PA 2MUCA 3LMZA 1UZ4A 1WDDA 2GUYA 1A3WA 1OFQA 2VC9A 3WLHA 3HJZA 3ABRA 4UFLA 3D46A 3T42A 1I1XA 4ZOBA 1E1CB 1F8IA 4HTBA 4ZGYA 3AAMA 1TV5A 3NQEA 4P61A 4AZ6A 1LWJA 8TIMA 3IGXA 2ZDSA 1AD1A 1KB3A 4ZO9A 1J96A 3CBWA 2FMOA 1FWWA 4HCLA 3QHMA 5HWNA 2HVOA 1F07A 1ISZA 2QNEA 4MKVA 3W28A 3EWZA 2Z26A 1TJPA 4KIEA 1W9XA 4WDUA 1XJBA 3GVRA 2OB3A 4MMWA 3LTSA 3K8KA 3ANUA 2R94A 1KTCA 3IJ9A 4AD2A 3V35A 3C2YA 2GJLA 2ZZ3A 3S2LA 1OD8A 2VO5A 2Z25A 2PLKA 3MWCA 1O12A 3ZT6A 4Z2LA 4YN5A 1NELA 1QNQA 3W9ZA 5AHEA 2G97A 4GJJA 2OEKA 3L4UA 3ANYA 5CJNA 1UH3A 3L0NA 3LS9A 2QXWA 3GTXA 1L6WA 3FIGA 1ONRA 1M1BA 1KCKA 1OY0A 3AZTA 1C7TA 4ZQPA 4YJ5A 2QCHA 3W76A 1W3KA 4LBRA 3WH5A 1ECQA 5BXPA 5D9MA 4C6NA 3NL3A 1EO5A 4POCA 1GYNA 1D3GA 2XDFA 3RRAA 3PHAA 4OVXA 4E2DA 2CXGA 5HR7A 3MMUA 4LUSA 2BVDA 1I8JA 2G4FA 2PDMA 3CJPA 3UVIA 2C79A 2O56A 3M0ZA 3TCEA 1ISYA 4H00A 4MLRA 3S5SA 2GK1A 4IHCA 1GVFA 1XIMA 3MKKA 4IMDA 3MUAA 3OZOA 1UQZA 1RA5A 3P84A 3PPFA 1MUMA 2I9EA 3NQVA 2Q8ZA 3U57A 2OGJA 3V0UA 2DH3A 2IXVA 5G2WA 3DN5A 2OPJA 4GO9A 4QX4A 3RO6A 4UMCA 3W2LA 1VFFA 4Q4RA 1NF0A 4J3VA 3ZMRA 3QSTA 3HPFA 4NXKA 1I2NA 4GI8A 1XCXA 2ZA1A 4LTSA 4IUOA 4LRSA 2NXGA 4MFEA 3U7VA 3B8TA 1ZCOA 4Q8PA 3R10A 4LS2A 4N4QA 4ZFMA 4MM1A 3VDAA 4RPQA 3LG3A 3M16A 4QLLA 3BW3A 5D05A 1QO5A 3QY8A 4KWOA 4UTMA 4O0ZA 4W84A 1E71M 1G4TA 1SZRA 3DHPA 2QPUA 3B9AA 2B0MA 1LT7A 1SMDA 3EX2A 3AO0A 2WYSA 3LPPA 4YTSA 5H6HA 1HXJA 4ENLA 2C15A 4HPHA 4FLSA 2BDQA 2J7FA 2J13A 3NSNA 2O55A 1R3WA 3M5YA 3GNPA 1J5TA 1DJYA 1A49A 1Q66A 5A8NA 3G1RA 4BWLC 1UIPA 4IJRA 5EBAA 3WDQA 1O7AA 2P88A 3B04A 4XZLX 5FAGA 4J7RA 3HQNA 1Q2SA 4REQA 4DXXA 3UR7A 1V93A 1JL8A 1DE6A 3TA9A 3A3XA 4I5XA 8CGTA 3H2AA 5BXSA 2PRMA 1IT7A 4JTJA 6REQB 1MW1A 1F3EA 4IUGA 5KZ6A 1SFSA 1MEHA 4JY9A 1W32A 2WWDA 1XLMA 4NAEB 3AROA 3CH9A 4B91A 2VOTA 4H7CA 2GZXA 2PWFA 1G0CA 1JPIA 1GG1A 3A24A 3RPDA 3H4GA 3C0JA 3ZO9A 4XQ6A 5GQBA 4TTGA 3VM7A 4ZXLA 2DT1A 1V3IA 2DT0A 2IPGA 3B0UX 4PCPA 2I57A 4A8LA 3OIHA 1X1OA 1Z9AA 2VD9A 5DCBA 3KBNA 1YYAA 4S3KA 3HPZA 2VT0A 2PODA 5LNSA 3U2ZA 4L56A 4FB7A 2GOUA 4BWLA 3H70A 3N25A 5D9NA 3S83A 1ZFJA 2ZC1A 4XAYA 1UKSA 3FY1A 1QK0A 3VKBA 4CUCA 5BU6A 3Q67A 2AAMA 5I3GA 2VDIA 4CD8A 4Z42C 1JDCA 3N34A 1YRRA 4DJDD 4KS0A 2VR4A 2O9PA 1YBQA 3HMCA 4AZHA 4I7UA 2PEVA 1OCBA 3QM3A 2OX4A 4LEQA 1JDEA 4IZGA 5HQMA 1QBBA 2VGBA 1Q6GA 2D2HA 1VBGA 4ZR8A 3S2JA 1PE1A 2OLAA 4JN7A 4M82A 5CBBA 3QR0A 5C7HA 2ZZ4A 2RGLA 1GKQA 5ABFB 4GUJA 5TQLA 4KEMA 3TLLA 2VFHA 5HQEA 4AWEA 2E4TA 3H22A 3TH6A 2WO5A 2QV5A 3GR8A 4FR1A 3EEZA 2WM0A 3GHUA 2VQUA 3TYCA 1R85A 3MB9A 4J3WA 3VGHA 2QMJA 2HPMA 3KL0A 5IM51 4B5UA 4CU7A 3G1AA 1I9CB 1GQNA 1OABA 1BKSA 2RHGA 4PUMA 2JF6A 2ZZ5A 3T0AA 1J93A 3BK0A 1YTKA 5BCAA 3LN3A 1SSGA 4I3GA 2BGQA 4I8DA 4RCXA 1GJUA 1SW3A 3QC0A 4A3YA 3LOTA 3IIZA 2C7FA 4JTUA 3VKAA 1YXYA 4IPJA 3VD5A 4NI8A 1GW1A 5HULA 3ZR5A 1HJXA 4W9TA 3W84A 1KFLA 4KCUA 1JPMA 3OVGA 5I3IA 1XUUA 3CWOX 4IXHA 2D22A 4ZEPA 1EOKA 3EDDA 3N15A 4FLOA 1ME8A 3A22A 3UD6A 4HCDA 2WMIA 1ZJAA 3CO4A 4A8IA 3WF1A 1QI3A 4ML9A 2C14A 4K7VA 4FALA 5HWMA 4AF0A 2VR2A 4V27A 1QDSA 4WLCA 3DUGA 5M2FX 4PMUA 4LC6A 4M0XA 2EHHA 1E0VA 1QK2A 1ZQ5A 2NSXA 2P8BA 1WDRA 2W4XA 3HMJG 3QQWA 1IWBA 3C5QA 4CNTA 3PR2A 4LYRA 3BJFA 2ZUWA 4QDWA 3A5FA 1RBOB 4JD4A 5BMWA 2Z1SA 1QW9A 5D9OA 7PTDA 5A6LA 2A3HA 1FWAC 1OX6A 2PURA 4FX8A 4QXIA 3STGA 2HXUA 4RL3A 4O53A 3W7QA 3UWQA 3L4ZA 2E5CA 4OUEA 1CZ1A 1PDZA 3AJXA 3C2VA 3SCWA 3W7MA 4IQLA 4GH1A 1KFJA 3TJXA 4IICA 1SQ7A 1XISA 2KAUC 2I7GA 4R3UA 5LYRA 4O52A 1L2QA 3VX1A 2FB3A 2Z29A 1VBUA 3BAKA 3FYPA 3N2CA 4BI7A 2FJUB 3IV8A 5C70A 1Q3NA 2Y85A 3WQDA 2QGHA 4DBEA 3WELA 3OGVA 2XIJA 5REQB 3LQLA 1OK4A 2CLKA 4GYPC 1A3HA 2QQ6A 1U33A 3HFTA 2VX4A 4HMCA 3TV8A 1JQXA 1XC4A 1J0JA 1RBAA 1H3GA 2IXUA 3CEPA 3DOPA 5AHIA 2W6RA 2IQDA 2XVKA 3YPIA 2X1RA 4XD4A 3EWUA 3KM8A 1CLXA 5XINA 2CW6A 3MI2A 4A6GA 5M03A 3VKCA 4HN8A 5AYXA 2J77A 3LY0A 2PPGA 3WLMA 1PL9A 4M1BA 4HPJA 3IVTA 3PJWA 3T8LA 3VGFA 1E43A 3HPSA 1J0HA 2PDBA 1IZCA 4GMEA 4XK2A 3GE7A 4HNLA 3EKGA 2PDUA 4H9XA 3VZXA 1FQ0A 3R94A 4KEVA 1TREA 2CC0A 2Y7EA 3VOFA 3D0CA 2ZTJA 4WGXA 3QGVA 5CBJA 3R13A 4H6EA 2FIQA 5LIWX 2YL9A 1K03A 2YCEA 4A3RA 3FOKA 3ABSA 1Z6KA 3G1VA 3WQGA 2D24A 3GC5A 3XIMA 3PFRA 4P7NA 1PB0A 1A5UA 3USBA 4Q4PA 2NT0A 4KMQA 4E4UA 5LXXA 1QOQA 3P74A 3H12A 1QPNA 5AN7A 4DJEC 3A5VA 3M46A 2C18A 4AY7A 4MWAA 4AX6A 2OGYA 1Q8JA 3LZ5A 3CAWA 3COTA 4MKSA 3S1GA 1E6SM 3CLMA 1W9DM 4J4KA 4HA0A 2QJGA 1VCGA 3WG6A 2IKHA 1UKPA 3E2VA 3VYLA 3WLRA 3W6LA 2B7OA 3BQ5A 3TW7A 1N8WA 2Z2BA 1UC4A 4P7LA 3NQ2A 4HVXA 1PYMA 2RJGA 4NYYA 2BB0A 4NZ1A 4IH3A 3L5LA 1GNXA 3SFWA 4C6OA 4Y9NA 2A3EA 4IPPA 5BYWA 5H8PA 5G2HA 3RM8A 1LL4A 1FCVA 5T9BG 3VNZA 3HM7A 1OC6A 1XBXA 3RM4A 4F66A 1ZL1A 1C8QA 4UUIA 1UD8A 3B8WA 3M64A 3H7UA 1X1NA 4Q22A 2XFFA 1G5AA 3JR2A 4JR5A 1TPWA 4DJEA 3GXNA 3F2DA 3SGUA 1QW7A 1KM5A 1EJRC 1UPMB 4RNJA 1K6AA 4PCFA 5A94A 2VWTA 3UGVA 2V3EA 3N4EA 1UJQA 2BVYA 4D2JA 1ZPTA 4C6QA 1GVSA 1OX4A 3HN3A 4JDBA 3UY7A 1IWPA 3M0IA 4HOZA 2XUCA 5D32A 1S2UA 3QW3A 1HFBA 2E7FA 3QJAA 4CD6A 1PJ9A 5C0QA 3HZ3A 3IAPA 1A5CA 4WHBA 4D1IA 3AMGA 4LBUA 1VFTA 1B3WA 3CMFA 4KEZA 3OLEA 3FHQA 3FJNA 4B16A 2ZRYA 5FJIA 4S2CA 1J6OA 2WCGA 4X22A 3I7SA 3CQ0A 1CLKA 4G1KA 3V1PA 1C3FA 3GBEA 1E3ZA 4GY0A 4JFVA 5EBUA 3MHGA 3DXIA 3LXAA 4GBUA 2VTFA 3U0HA 2YX0A 4JN6A 3EPMA 4W8AA 4Z2GA 4TX8A 2DT3A 4MYXA 3GR7A 5I5RA 1ZRQA 3EA1A 3TQPA 4HPXA 1ZP3A 2INFA 1GOXA 2E1DA 1ZBVA 2R1MA 1BG9A 1PSCA 4IPLA 3UNTA 5G2IA 1Z41A 4PTWA 2WM1A 3RNDA 3LNMA 5A95A 3SUSA 1E9ZB 1FDJA 3QRHA 3QEZA 1ZJHA 3I4KA 3SO7A 3N2BA 1X7IA 3CUJA 3NSMA 3MSRA 1OHLA 3UT0A 3DYOA 3IJDA 1KXQA 4U3CA 3VNYA 4JTIA 1Y5XA 4DBSA 4W5ZA 4AD5A 2E28A 1EUNA 1UHVA 2IKJA 3WFLA 4EE9A 3T2OA 4HMEA 3NPXA 3ALFA 2QEZA 4GYFA 5M1TA 4GPNA 2QJHA 4RZ6A 3SCUA 1PIIA 4PUEA 2HSAA 3F4VA 1DWJM 2GQ8A 1R2SA 4GZJA 2WZIA 3ICJA 4PTNA 5CSSA 2GDUA 1FH8A 1A5BA 2RFGA 1AH4A 4R85A 3PZIA 3SW6A 4LUSB 1XIHA 3RRXA 4KIRA 2WXDM 2VC5A 4ZENA 2ZA3A 2ZRXA 1IV8A 2XFYA 4ADTA 2CHNA 3B40A 3GQYA 5CC3A 3ID7A 3SCVA 4CQ8A 1ALDA 3FEMA 2E25A 1FFQA 2QUVA 3B0XA 1EC8A 1TZ7A 1CXKA 3LBCA 3TZNA 3QR3A 1DJNA 1UD6A 1TPVA 3RPTA 3N12A 4M29A 1IR1A 4H9VA 4WY0F 4UCGA 1HX0A 3CIVA 1ESWA 4IFRA 1DOSA 4JFSA 1CB2A 4FNPA 2VEFA 4L61A 5FEXA 3F4WA 4A3UA 4O18A 1XIDA 3K4WA 1N82A 5AHMA 3UJEA 4B5NA 2W0UA 5K7JA 1Z7AA 2A0NA 4QCEA 3B8IA 5HUOA 4IIDA 1GGOA 1V02A 1BYCA 7ODCA 1UC5A 4UXDA 3DENA 1TWDA 4MWAB 3IPWA 4IX0A 1D3CA 1FHDA 1DE5A 1G4EA 3W74A 1KA9F 2PA6A 5FD0A 4CD7A 4QISA 3FA3A 1GKRA 4MGGA 1AZ1A 2V5LA 3AMLA 3RMEA 4DWDA 4E8GA 4I6VA 4KRTA 5CC5A 1YX1A 3CS2A 3PZGA 4CD4A 1WDSA 2YDAA 2XVLA 1RY0A 2WKLA 1RLDA 3F5JA 4GCAA 3AIQA 1V02E 1MDLA 3GIQA 3WFAA 5E09A 3GXFA 2V3DA 1WOAA 3ITCA 1XRFA 1IEVA 3TUUA 1K4HA 3WMLA 3RLUA 2ACRA 3PZ9A 3PB0A 3VO0A 4JGDA 3SY5A 3M47A 2ATMA 2DSZA 1S5NA 4PTDA 2Y62A 1W5MA 3W1PA 4DBDA 3PNZA 3LHYA 3URNA 1MYRA 1PZ2A 3W1MA 1R9YA 4NRSA 5BW6A 2CBVA 1Q7QA 1PKYA 1E4IA 2R6OA 1PKMA 4R9XA 4B5WA 3GXMA 4L6DA 3MUCA 3M0MA 3WYZA 3I3EA 1MW3A 3EEGA 1LBMA 3BC9A 5AYYA 3W22A 1NOUA 3HQPA 4IIFA 1XW8A 1B0IA 4YMZA 1F76A 3OZMA 3CPUA 4ZO7A 1CXFA 4UQEA 3M7SA 2ZRZA 2EKCA 3W86A 2O4QA 3ZJ8A 5FJJA 4S3EA 2GWGA 1FWFC 1T6MA 3ZLFA 4ROPA 5DRIA 2QAFA 2FFCA 3GW3A 3W7OA 4DNHA 5BZAA 2PDJA 3GNRA 1YW1A 3IV3A 4ADSA 1I45A 1GTEA 3N3MA 1P4CA 1W5PA 1UA3A 3FA5A 3LGEA 5LXEA 1F61A 4CQBA 3ABXA 4Y8EA 4C6PA 5DMYA 3A3HA 1RLCL 3TMQA 1AL7A 3K1GA 5M5DA 2Z7KA 3PS7A 3EA2A 3TSDA 4AU0A 2XIOA 3VNLA 4S1FA 5XIAA 3TKFA 4PULA 3MBDA 5JBDA 2MNRA 2WVVB 1Y5WA 4XV0A 2DZAA 3QN3A 1UD5A 2VDGA 5F2MA 3HGSA 4GY1A 3SUWA 1HIZA 4D8AA 1JCTA 5E5CA 4A2SA 2W91A 3BOFA 3Q2DA 4CCEA 2BXVA 4DI8A 3AUJA 4B9YA 1F74A 5J5RA 2DZPA 4MY9A 4CNUA 4EF9A 3FA4A 1VIZA 2OLHA 1FWJC 4H4IA 2RAGA 4LVDA 4JTGA 4Y8FA 5TIMA 1EOMA 3TTEA 3W1TA 1XCWA 1AQFA 4E2OA 3ZLGA 3T0CA 3S47A 2OX1A 3SY8A 3FSTA 4HN4A 2FPTA 1B3VA 1WV2A 1KM6A 4HHPA 3KRSA 1EP2A 4WDWA 1KM1A 2Y5SA 2R14A 1F7BA 3RJYA 3W02A 1E9LA 4DY1A 1WKDA 1HKWA 4HYWA 4XBKA 1KCXA 2NQ9A 1C8YA 1FWHC 2W61A 3G77A 4GXWA 4ERAA 3R6IA 5DT5A 2VRJA 3VXGA 2OU4A 1IT0A 3DYPA 3RHGA 2QR6A 3U5UA 4LVBA 3VKDA 4AY1A 5AHNA 1BEUA 3C0LA 2BVTA 3L5AA 4J40A 4ZTXA 1UR4A 3W72A 3W29A 1QO2A 3R79A 5E70A 4MZYA 4LUYA 3KL5A 3AIEA 1UBSA 2A4AA 3WD3A 4PB4A 1KM0A 3GG0A 4GUGA 2P0OA 1E70M 4GKLA 5AB3A 1LRQA 3SEPA 3KBMA 1REQB 1P1XA 4G1NA 5AC4A 1WKEA 2V69A 3UXKA 4NF7A 1B4EA 4HKPA 1W54A 4G5DA 3SCQA 5DRCA 3ISIX 3KAOA 3TN6A 4KCTA 4UTUA 4NL1A 2VX7A 2EEXA 1IIHA 4ZE4A 1SR0A 3R43A 1YXCA 4D6HA 4C7DA 4Z1DA 3WH9A 2ZZ7A 3UJRA 3VDCA 1A5NC 5CZTA 2GVEA 3NQBA 4DJFD 3C0SA 3V5CA 4EXAA 1OYAA 4RDWA 4BR1A 3DEQA 3G8EA 1E5NA 1VBJA 3N2OA 4LC8A 3MSGA 5CSRA 3KLKA 1OQFA 2YBTA 1PHQA 1QWGA 2V2DA 4A21A 2NLYA 4Z1BA 5C7VA 3LM3A 4Y6GA 3H4XA 3CPRA 4CKQA 3C52A 4WK9A 3TZFA 2A6LA 3B8DA 2J7DA 4V1XA 2WC7A 3E2SA 2E40A 3I6EA 4H6QA 2ZX9A 3BLOA 2JBMA 3PWGA 1CDGA 4NZJA 5CJMA 4UOQA 1LRTA 1XIJA 1L9WA 2ISFA 4JX5A 1U5HA 2PDKA 3NOYA 4FXJA 2WSYA 4O8RA 1BWVA 1PVNA 4K7YA 4PCSA 3GH4A 3MA8A 2E5DA 1D8WA 3UWYA 2BG5A 1EGMA 1YTEA 9XIMA 1XC6A 3UQNA 3O06A 3VCRA 2DVTA 1EPXA 3RK8A 2FZDA 2ZTKA 3PP7A 1DWGM 4EF8A 4TV6A 4IMEA 1E6RA 4IJCA 1RPKA 2Y5EA 5F4XA 4XVEA 2DZVA 2V5KA 5I3JA 4U28A 3TP4A 5LIUX 4ATWA 5A2AA 3CZGA 2GGGA 3CWHA 2NX3A 3FNDA 3B0YA 2E3ZA 3QLLA 2PDYA 2PD5A 1H7NA 2X1TA 5FF2A 3T7VA 4N6EA 1JDAA 1OCJA 3BVJA 2OT1A 3RCMA 3FDKA 4Z2KA 3NEVA 1O95A 4E8DA 1YDYA 4LWWA 2QAPA 1W0MA 4DHGA 2VUYA 3UWEA 3CO8A 4F79A 4CLMA 5HNNA 3W70A 1OFBA 3LU2A 1MVYA 4E4PA 3S5NA 4GX8A 3MI3A 1BQCA 4HZ8A 1UZDA 1JUBA 4L64A 1GHRA 4ADUA 1I4NA 3G3MA 1E1FA 4QE1A 1XSIA 2OYLA 2RDXA 4AIOA 3MSDA 4AVOA 3LXCA 1VIWA 1S2WA 1VF8A 4WKAA 2NV1A 4Y90A 5DLCA 5IBXC 1THFD 1UH4A 2J8GA 1M9HA 1B3YA 3GBDA 1KR0A 1LZOA 1ZJIA 4BS0A 4OFCA 1BYAA 3ITVA 2NSOA 2E9LA 5ABEA 1P0DA 1NOFA 3QOKA 3OQ8A 2JGQA 5F4WA 1EF2A 5AY7A 3M5ZA 2PDIA 1HTIA 5E93A 3TN5A 3NTYA 4PMYA 2VM8A 4AXKA 2G3FA 3PBWA 4QG8A 2V2CA 3GFXA 3ZSTA 1ZAIA 4NNAA 1DBTA 4NYUA 3DFQA 1UP2A 3CEUA 2J62A 3QZ6A 4NX0A 5ECVA 4NZ4A 2Z6JA 2WSKA 3WNKA 3PZUA 1VEPA 1TCMA 4HMDA 1NP0A 1IEQA 3MO7A 3QZAA 1YDOA 2A6NA 5E0FA 3QHOA 1TMLA 2BNJA 1XL9A 2QV4A 2PRLA 5BRQA 1WKFA 4GNJA 3RU8X 2PDNA 4EWJA 2DU2A 3RCNA 1EHNA 1DQXA 2OQLA 3PZOA 1LG2A 1UQYA 3UU0A 4GUIA 2VWSA 5HUPA 3WLQA 4MDOA 2OO0A 3SQLA 1MWOA 3P3BA 4FSAA 4TR9A 5FESA 1RJRA 4IMCA 3VCNA 2XM1A 1UUQA 3IACA 2VFFA 4I5UA 2ZZ1A 1MO0A 5A8PA 4LALA 2DSUA 1MQRA 3TJ4A 4J2MA 3F4DA 3G0UA 1KFCA 5JQ9A 2FH6A 2NW0A 5FOOA 5MF5A 2Y8VA 1K9TA 2OODA 3ES8A 3UCCA 5AC8A 4H9MA 2HRWA 2R9RA 2ZXBA 3TNOA 2X0YA 3B8SA 3PNUA 5I2UA 3CZ8A 2VURA 1MFVA 4P7QA 1VJSA 2H9AB 4DM2A 1BWKA 1TTQA 3QHNA 2XYLA 1OG0A 3WMBA 3A4AA 1TA3B 2AAAA 3PBMA 4ZOEA 3WCZA 3N4AA 4UIOA 5A6SA 4AX7A 5CEWA 4JQAA 1US2A 4HNCA 4XSMA 2VEIA 1HJUA 3UWZA 7CGTA 2YFNA 3HF3A 1YE4A 4IQJA 1R3RA 2YLAA 1ICQA 1V0KA 4CCZA 2Z6IA 3EWDA 3PTMA 4IFKA 4P2VA 3T8QA 1H0GA 3LMYA 4N9BA 4YTQA 2ALDA 1TTIA 4FP1A 4N2YA 2OYKA 2XH7A 3L2IA 3F1QA 1BXCA 3ANVA 4JTAA 5AKQA 3ES7A 4H7ZA 4MY1A 5KSWA 3QF0A 4MNLA 3VNMA 1NOWA 3EGJA 4O1FA 4URIA 3LLDA 3W07A 3PZQA 1HZYA 4A4AA 1SJDA 3R0UA 4KH2A 3LERA 2DVUA 3WH7A 3DH7A 1RQBA 2GDQA 4OBTA 2ZA2A 2JIWA 3OB8A 3TFXA 1QNPA 4QIUA 3M5XA 2QKFA 3WJYA 2D1ZA 4JX4A 1PX8A 4FA3A 1N8FA 5HR6A 4H2CA 6CGTA 2XZ7A 4Z08A 4GD0A 8RUCA 4OBSA 3MP5A 3EMZA 2XINA 3MYOA 1WYIA 4D6JA 3K8LA 3W7DA 1GVYA 3TAOA 1QHZA 2AQVA 4F0MA 4JIEA 2X30A 1IZKA 1V6TA 3WBXA 3W81A 2ZUVA 3AS3A 3WDHA 3N3TA 2KX9A 4LAKA 2DSWA 2Y61A 3F4CA 3CLWA 2E1WA 1XICA 2EPHA 3E5PA 6ALDA 4MTVA 1A80A 4EACA 3LV6A 3GHTA 4ACYA 1VAHA 1OYCA 1LM1A 3UR2A 4KCWA 3VILA 3AHXA 1JD9A 2WCSA 1H7XA 4GGBA 1UD2A 4C1NA 2TMDA 1WA3A 4I9JA 5D8WA 3KEHA 2QYGA 5F1UA 3TAKA 2BY2A 1XKYA 4GH3A 2PWHA 4BF7A 5IOBA 4PMRA 3GVQA 3UZWA 4Q8MA 2OSYA 4UQAA 1RXOB 3S5YA 3LQGA 3ZS4A 1XF0A 5I77A 1XI3A 8A3HA 1RQEA 3O1NA 4HU8A 1G69A 1R3VA 5AYZA 1FP8A 1UR2A 1XH2A 4QSFA 2QMKA 4AHQA 4KGLA 3PBUA 3SN0A 1TG7A 2Z2UA 3JRKA 3CGTA 1J0ZA 1T0OA 4NZ5A 2H90A 3LPGA 2OR2A 4C6LA 2B7NA 4DVOA 3VIOA 1XPYA 1EX5A 5KZEA 1HL9A 1BD0A 1TPUA 3SCNA 4IIGA 1UKQA 1IF2A 1KXTA 2Y0FA 2WMJA 1G01A 5HXMA 1UR0A 3O6AA 3QOMA 5TD4A 1C7SA 2TRSA 1B2YA 4LYPA 5AZ1A 3ARPA 4OZOA 1S46A 4XAZA 3VIMA 2Z0IA 1F2JA 1MNZA 4KCVA 1KM4A 3NQ6A 2E9BA 1WP6A 1M7JA 1P7TB 3R7MA 5FEPA 4UTTA 1BRLB 3MBFA 1NTHA 4UQ9A 1ME9A 3U2CA 1IYXA 4D9PA 1EB3A 5ABHA 3EWYA 3SUVA 4Z1YA 1A53A 4L1XA 1Z44A 4ACZA 1K4GA 1RPXA 3E3HA 3LSCA 4HT3A 4JCLA 4GX9A 3GNXA 2WANA 1OVDA 4H1ZA 4O4VA 1WE5A 3R0KA 3DESA 4YVPA 3R8RA 5BWFA 2O7QA 3M6YA 3TONA 1UMLA 4BA0A 2AL1A 2X1UA 1JJKA 5C2GA 3RN6A 3V4BA 2B4GA 1ITXA 3O0FA 1AW5A 3NXLA 4MJZA 1LBLA 4HPNA 3T09A 1JNDA 2BOEX 2DZUA 1KBBA 3PVFA 4DYKA 1CT5A 3P2VA 4DWSA 3GG7A 1SUXA 3VNKA 4FK9A 4DUVA 3UG3A 2FVLA 2PCQA 3I7QA 3PPGA 4XUYA 1CPUA 4R27A 4YCPA 3C2OA 4R34A 2WMGA 3WD4A 4UTJA 1XS2A 4O0KA 5CC7A 2WPBA 1TPDA 3ITXA 2YZ5A 4BQ5A 2DQWA 3AIWA 2HXTA 1Y7VA 3D3FA 2GGJA 4YWSA 1OFPA 4LF1A 1CGVA 3PJUA 4P8WA 3NL2A 1J8VA 2GK1B 2PTWA 5K9DA 3HFYA 1H60A 5GJPA 1N8IA 4QS5A 4D6FA 5DF0A 3FXYA 4KERA 3S46A 1EEPA 4INFA 3G1XA 3NG3A 3HGRA 2CZEA 2QF8A 1FWTA 3SJNA 4NP7A 3VC5A 2H3DA 2UBPC 1AK5A 2W62A 5BRPA 1W3JA 2YZRA 3WDRA 1WOBA 3G1YA 4LNYA 3RU6A 1PPIA 4WGHA 1WKYA 2F2HA 1WAUA 2Q01A 1O5QA 2GJXB 2TPSA 1E1CA 3EX1A 4FR6A 1OD0A 2PSNA 2ZUSA 2A21A 5DFAA 4HOXA 4YYFA 2GFTA 1MW2A 1S3HA 4LCRA 3UJ2A 5CSUA 5G1YA 3WENA 1BXNA 3DYMA 2WNQA 1XFCA 4LVGA 1CXIA 3NDZA 1JUKA 1Q6EA 3RM9A 1R3TA 5EKYA 3GW0A 1EKOA 3G1FA 2Y7FA 2C16A 3G1SA 3URAA 1J12A 3ABZA 3Q37A 4WQ6A 3SGGA 1NEYA 1SYTA 2AL2B 4V2XA 2NXIA 3W7CA 3WBEA 5AC7A 2VNCA 1X39A 1CGYA 3Q45A 5HA7A 3REQB 5A6MA 3UG8A 1OADA 1WO2A 1AJ2A 1V7AA 1DJGA 3VM5A 4NJHA 2FMNA 2ISVA 1V3JA 1WCGA 1MXGA 3E38A 3NWRA 4ICCX 1CW2A 1J11A 3LB0A 1W3HA 1S5TA 3NO3A 1CNVA 4PC8A 1KBIA 3EZ4A 5HATA 1E73M 1V3HA 2E8YA 1O6IA 4IL0A 4QITA 2BX7A 3W2KA 3MZNA 1S5MA 1KFEA 4HMNA 1SJAA 1MNSA 3WN6A 3CU2A 4OU1A 2ZVRA 4ORIA 4HHLA 3TOPA 4LU0A 1GOQA 2OWXA 2W5FA 1EEXA 1KTNA 2YDRA 3W73A 3LCWA 2P10A 4MNKA 3TYDA 5C55A 2QLYA 3FCPA 1WXZA 1KR1A 4L9XA 5DELA 3GNOA 1M03A 1V4YA 3PN8A 4H8UA 3UPMA 5I06A 4R7JA 2OQHA 5HJYA 3WF0A 1QXLA 1NDYA 7TIMA 2J7BA 1OFEA 3WMSA 1XLAA 4ZQNA 2PWDA 4JICA 4U5IA 4K36A 2V9DA 4GCXA 1OGGA 4L65A 4C65A 3WQ5A 3WLPA 3PUOA 2QS8A 5ECUA 3JU2A 4IG2A 1DJIA 3V0SA 1OT1A 1XINA 4ZFCA 1G7UA 5BOOA 1EJSC 3V36A 2RUSA 4PTVA 3DI1A 3OOQA 2VCAA 2FPYA 2YGYA 3M07A 1O4UA 1FBAA 3WY1A 4ZVJA 1EHAA 1J9YA 4HNOA 1LWHA 4B5SA 4CNPA 1SFTA 4YL2A 1K8XA 4DJFA 1PV8A 4PBGA 3WLTA 1M5WA 4O16A 5HWJA 4HZ7A 3RLGA 3RITA 3RJXA 4LB4A 3QYSA 1H7PA 1M04A 2R1NA 4QEHA 3DERA 3K1DA 1SGJA 3BQ6A 1ITQA 1LL6A 3FYYA 3MMTA 3BSGA 3AYTA 1B9BA 5MHBA 4JTFA 4Q3MA 3ITYA 3RX3A 4TOQA 3STFA 3LX9A 3ZVHB 3L23A 3SI9A 4RPPA 3E96A 4HU4A 3PUGA 4PZVA 1GQIA 4ZOAA 2AQOA 4S3CA 1EH9A 4C6EA 4PB3A 1KFWA 2O4MA 1WUFA 1HJWA 4GJIA 3B9NA 4LS0A 4BF9A 4HNTA 3TR9A 1ENUA 3A9IA 4AC7C 5LHFA 4L80A 4CVWA 2RH9A 4XZMX 3W7PA 4GACA 4S38A 4MB5A 4D72A 3OG3A 3TR2A 1ME7A 4OQVA 3MYPA 1V0NA 4MF4A 4YTTA 4LUJA 5CH9A 4AF0B 2ZUUA 2NWRA 4R7OA 5C9XA 5RUBA 4DF1A 4XZHA 3ARVA 2Q09A 3A9BA 2IPWA 2FHBA 2ISWA 3BZGA 3M44A 3KL3A 4NZ3A 4DF0A 4ZB5A 1U5JA 5IDIA 1VZWA 2J27A 3QSRA 1RVKA 4W5UA 3WBYA 3SURA 1A5LC 3HG5A 3R12A 3TW9A 3DBPA 4S3GA 2ZBTA 1J2BA 2V8ZA 4H8HA 3FDGA 1PEZA 2GJXA 3TYEA 2O92A 4UFMA 7XIMA 3D5HA 4LY4A 3SIMA 3LNPA 3JS3A 2ZX5A 3AMKA 3B8UA 4FF7A 1TE1A 5L9FA 3VNJA 2D23A 3W0KA 4FO4A 1MSSA 3B8VA 3FJ6A 5LA1A 1JAKA 1LUCB 1FHUA 1C90A 5CPLA 4B3LA 2HQAA 1V3MA 1EX1A 1U1HA 3CHDA 4IP5A 4OWGA 1W8SA 3A21A 9XIAA 4UTTC 1SFJA 4MAZA 5C9UA 1BG4A 4S2BA 4X3ZA 2BGSA 2YR1A 3B4UA 3WDIA 2E09A 3H4WA 3LGGA 4A3QA 3H55A 5MKGB 2HWGA 2W3ZA 3TN4A 1HKMA 2EPOA 3G18A 1UA7A 3QH2A 2NQZA 4YWIA 3VI2A 3PY2A 4AD1A 4RNFA 5IHSA 4KWSA 4X9YA 3V5OA 3LI1A 3HA1A 2J7HA 5EFDA 2DP3A 5FJTA 2TYSA 4ZMGA 2EKGA 5J8LA 1TPH1 3BJTA 4NU7A 1FP9A 1E0UA 4LOCA 4QGCA 4M6QA 5CAHA 4J3TA 4PMZA 3N2XA 2R1LA 1B3ZA 2F7FA 2UZ9A 1UD4A 3NPWA 2IKIA 5FL1A 4WSKA 4A2RA 3GVVA 4BFAA 2XSXA 3DDMA 4W7VA 3P61A 2AQWA 2VP8A 3VZZA 3CQIA 4MJ2A 2EQDA 4Y9MA 5GVJA 1XBYA 3WJSA 2YCKX 3Q65A 3K5XA 4D8LA 4CVUA 1YADA 4F48A 4PBEA 3WF4A 2YDSA 2CIPA 4H01A 4P7RA 4XZNX 4F9JA 3M0YA 4ERGA 2Z2AA 1EP3A 2J9XA 3C8FA 2FZ9A 1HVQA 2R1PA 3NYZA 4XTDA 4HYVA 1YLVA 3IGSA 3AI0A 3KOXA 1XBZA 5A3HA 1YPXA 3VMOA 1KM2A 3S4TA 5CZSA 2VUNA 1IXNA 3CYVA 3OYZA 1KC7A 4OOUA 3M1ZA 1PCKA 3RIKA 5AECA 2FZ8A 3VPLA 3W1RA 4XB3A 4FAMA 1CWYA 5CC6A 3LCGA 1LDCA 4LCSA 4LUIA 1ONWA 1QATA 2OFJA 4QG9A 4H7VA 1VKFA 4RXGA 3S1VA 4ZB0A 4QHRA 3GDKA 3TFCA 4Q7NA 1HKIA 2VEMA 4AUBA 1T5AA 4TVDA 1TRIA 4LXFA 3W85A 3BLPX 1XRTA 2QDEA 4HBKA 2YFOA 3TXZA 1KNWA 3H7RA 1NDVA 4PUJA 3K30A 1BXBA 1XLDA 3LHTA 2ACSA 1KWGA 1XYFA 2A85A 3GXTA 1V08A 1YXDA 3MQTA 2WKGA 1X38A 1S2AA 4Q32A 2H3BA 3UZJA 1QMLA 2GJNA 2QGYA 3HGOA 2QUUA 3ALGA 1P0KA 4IQEA 4B2DD 4C1NB 1FA2A 3LEPA 3VKKA 2ZUMA 3BLFA 1TPB1 3UCQA 1VCFA 1QVBA 2A7PA 2X1SA 3WNPA 2V5BA 5LNRA 1XYAA 2ZRWA 3EOOA 5M17A 2Y7GA 2PB1A 4JEJA 4XAFA 1FWGC 1JZ7A 4YVVA 4FS9A 4NQ1A 5H8MA 3GVGA 5HQLA 2B7PA 3T40A 4UTWC 3S1UA 1DIEA 4KRZA 3UZXA 1R47A 5A6KA 1HGYA 1ZENA 4QSHA 2D69A 3TC7A 2FZMA 1E51A 1F3XA 4RE3A 5I0DA 1S2CA 5EGRA 1U5VA 5JUVA 3POCA 1EL3A 2D3LA 4RKAA 1SO5A 3EWWA 5HBFA 3FJLA 4GVHA 3NQAA 5D04C 3IJLA 2GGEA 4LVAA 2WZMA 2J8FA 5CJ5A 2CLIA 1RHCA 3N19B 4F0SA 2JE8A 4HP5A 3O15A 2GQ3A 1ZAHA 2NT1A 3KLLA 3UYCA 4RUBA 1TWZA 3B0VC 1OT2A 1SMAA 3NYDA 3UR5A 5K9CA 1LBFA 3G22A 3F2CA 1JD7A 3S9IA 2XFRA 4LT9A 1LOSA 1J79A 4QLJA 4PL1A 4M6UA 5CG7A 1KBJA 3BICA 4XD5A 2QPXA 1SW0A 1XLGA 3TLQA 1LORA 3W7NA 4KQNA 1K6WA 3MHFA 3CM4A 1VPQA 1FHVA 4S3DA 3ENLA 5LIYX 1KCLA 5CPQA 5HJLA 3IAQA 3WQWA 4PRTA 4GIAA 4DUWA 2DH2A 4IPIA 2ZIDA 3QTGA 1TVLA 1R9XA 4AMAA 4F0KA 1QHOA 3BCFA 1RUSA 5JVLA 1B30A 1WDWA 1GKPA 3CTTA 3WIJA 1KCZA 1TKKA 1HNYA 3O8AA 5BXRA 4AB4A 2G41A 3A13A 3SADA 6XIAA 1JPKA 5MKGA 4OIFA 3A4JA 3PTKA 4XZIA 1GONA 2V5CA 2VFEA 1H7OA 2OT0A 4NUWA 1D7KA 2GL5A 1WZMA 4NAEA 4AZGA 3GIPA 2CZVA 3MDWA 3TE9A 3R8HA 4MLJA 3GS6A 2X41A 1AD4A 3E49A 1TV4A 3N29A 4M6VA 4JNZA 3G3DA 2V63A 2HMCA 3AZRA 5E0CA 2ZX8A 2Z4GA 1QNVA 4HNVA 1RJPA 2QVNA 2PGWA 4QBXA 1IXOA 4HA1A 3LSBA 1AVAA 1S2TA 1BTMA 4M7SA 4M56A 2NX9A 1FKWA 1NIUA 4YPJA 1TMHA 4BI6A 1K1DA 1UKOA 2UV8G 2WZTA 4PEKA 3BH4A 5EU9A 1QNOA 4NAFB 4OECA 2PRHA 4C7FA 5LKYA 1VEOA 1TX2A 2WCAA 5HNTA 3CUGA 3O7UA 4KT2A 1JF5A 1JULA 2CLPA 3KBJA 4TX6A 1X97A 1CGWA 5HPCA 4YIWA 4H8VA 4ZZ9A 3OPSA 4L4MA 1DHPA 1SZNA 5LA0A 3SRHA 3VD7A 4BEQA 1IWAA 3GHRA 1DWIM 3TIMA 1SO3A 5M3WA 3N6JA 3OIXA 2XH2A 4WF7A 3FV9A 1JZ3A 1MI3A 4RNIA 1B5TA 5CCZA 1AZ2A 2J9YA 1E0TA 1GCYA 3CL7A 2BGNE 2PTZA 1I2RA 4R53A 4FMVA 4F2BA 5H91A 5DY2A 3IJQA 4GFIA 4O4WA 4Q4OA 1VENA 5ENLA 4UZSA 1OWQA 4MB3A 4CEUC 1YTDA 3AICA 5BWAA 4TVUA 5C2CA 4QE4A 1RP8A 3GSMA 3E0VA 1VYSX 1A5AA 4Q6XA 3PZMA 4W7UA 2WHJA 4UR7A 3W24A 1NP2A 4I9TA 3WLSA 2Y8UA 2ZFAA 2AL2A 2BV9A 2YA0A 2Y4SA 1NFPA 4DEFA 4MVAA 3FSUA 1KM3A 1ZY9A 3MCMA 1GJWA 2A3AA 3EWBX 1JNEA 5CKSA 3FW6A 2CZFA 4EIVA 2X16A 1LLWA 2P53A 3VU2A 4H83A 2BMBA 3AS2A 1EDGA 2XM2A 3ORWA 1I6NA 3GH7A 1IGSA 3TX9A 3OTRA 4ZSTA 3NL5A 1QHPA 2UY2A 1H2JA 3WK3A 3B3DA 5LZLA 2J6XA 3NZGA 3KRUA 2ZDRA 1V6XA 2BLEA 2AMXA 2CNCA 4Y96A 5JU6A 4BQ4A 2J7EA 3UF9A 4GBDA 3LBMA 2YYUA 4F2TA 4X9SA 5DBTA 2ZVIA 3RLVA 3O16A 1B3XA 3PUDA 2V81A 4GISA 3CZLA 2PC4A 3AUOA 2VCCA 3LRMA 1LL7A 3AZSA 3CL6A 2FVKA 2WJDA 2E8ZA 3EDJA 1QOPA 1W1A1 1MUCA 2JEQA 2FFIA 4BKNA 3WEMA 3MVTA 5E1QA 1MZRA 1F6KA 2V30A 4Z17A 2W79A 3IK2A 1ZBKA 1W1VA 1AUSL 3W2UA 3ARQA 2R8WA 5JMUA 5F7UA 7REQA 4R88A 1W3TA 1D7FA 3DC8A 4LX4A 5B7YA 5BNKA 2WVSA 1TZ9A 1XKJA 3E0WA 2V67A 3HTWA 3OBKA 3ONBA 4ALDA 3DG3A 3AXXA 1J18A 1L6FA 1JYNA 1V0MA 2WJFA 3H2CA 4G6CA 2ZX6A 3NA8A 3K2GA 2WC4A 3GNDA 4MADA 7TAAA 1DWAM 1S1RA 3QMSA 3H8AA 4GINA 2YKKA 1KGUA 1X8CA 5U4NA 5L6UA 4YHGA 4Q8VA 1T8XA 1JRCA 2A5HA 3MDUA 1L6YA 1ADDA 1HP5A 4YNGA 3UJSA 2OCZA 4L9YA 3AC0A 2ZZ6A 3DHUA 3MUZ1 1PAMA 1WB0A 1TPFA 4QJ5B 1ZAJA 4ES4A 1V3KA 4AEFA 3FYOA 3GX9A 1W9BM 3MI6A 3FK4A 5FIPA 5EA9A 1KKOA 4R33A 1S39A 3PBVA 3KVLA 1R3QA 3BO9A 2BBFA 4A35A 2G5WA 1NSJA 3W1AA 2Q8XA 1Z69A 2PGEA 1SFLA 3TQKA 3NJ3A 3ZJ7A 4JQ3A 1V79A 3ITLA 1K77A 2EGZA 3DFNA 4DPQA 3GDRA 2DDXA 3U8GA 1VS1A 3WEZA 4JYEA 2VEKA 3VDHA 1OGBA 4M6PA 3II1A 3CPGA 3GIYA 2VMFA 2B31A 2AGTA 4W8LA 2FH8A 4UWMA 3KBVA 4A8RA 1VLWA 1MRAA 4FOJA 1QI5A 3M0LA 1P43A 1A3XA 5CPSA 4CN4A 1W37A 4DUOA 1EPVA 1VFUA 3GLCA 1P0NA 5CXPA 3HO8A 4EAMA 2X0SA 4WJEA 4S3JA 3THQA 1E0WA 3P5YA 4GIRA 8XIMA 1I0BA 3NO1A 3AU6A 1KGWA 1R6WA 2NX1A 3TU9A 1K7EA 2VL4A 3XINA 1J01A 2I14A 4MB4A 3RR1A 2VVNA 4FF5A 3FVMA 3SCRA 2FPVA 4OE7A 5D4YA 2PAJA 1B31A 4TXEA 1DWHM 5FCZA 3LUTA 4N9DA 4WXZA 2BASA 4FI4A 3LHUA 3KCLA 2GSHA 2RKXA 3WMCA 1KWKA 3OBAA 3TVAA 3U2EA 5I3DA 4UTKA 4GQBA 3THDA 4XKYB 2L5HA 3AQUA 4AQLA 1LLOA 1BQGA 5CZJA 2WZHA 1K9DA 4WKFA 1IE7C 2PU0A 1REQA 1WDPA 4HTYA 2IPFA 4JKKA 5E6YA 2Z1VA 2F9RA 3E0LA 3CT2A 1NJJA 4EPDC 5BMXA 1VPYA 1WDQA 4YU1A 4AVFA 3G6MA 3VGGA 2Q02A 4ORMA 3M0JA 1NWSA 2NQHA 3ARSA 1F3TA 3VOGA 4QNEA 5G4EA 3WK0A 4QR6A 5D2XA 2YL6A 3LPFA 1TUFA 2WVVA 1XQLA 3WUGA 1EQCA 3W25A 3VMPA 1W1B1 4JFTA 3MUIA 1IQ8A 2J74A 3N4FA 1KV8A 4DWSD 4M5PA 1G4SA 4GO8A 2JK2A 3GR4A 5EMJA 4JCMA 3CMJA 4V28A 2I5QA 3VIHA 3NNTA 2C71A 1JYXA 1MUWA 1CECA 1DVJA 1JZ2A 3GFZA 2ZE3A 5DXYA 3TNBA 5A8QA 1XUZA 1H1NA 3F5KA 1UROA 2CWXA 4UTIA 4XO7A 4NZFA 3VCCA 4EXQA 4N6FA 3BUVA 3VNIA 1F6YA 1W2VA 4JTLA 1MEIA 1HVXA 4E2VA 1S5VA 3DFTA 4FLRA 4W85A 1EO7A 3HPXA 4G8TA 5FACA 1EJWC 3OODA 1XYZA 3NQ8A 2C1GA 3QC3A 1YIXA 2UY4A 3VUSA 3UPWA 1EA0A 3N11A 4RV8A 4NJGA 3NQ7A 3N2MA 3OGRA 1FHLA 1XLHA 4DUXA 1UR8A 4Z2HA 2NVCA 2WBKA 5F2IA 1EZWA 4R5EA 4R7WA 3KOYA 3L7RA 3GY1A 3WQ8A 3MV11 1DYSA 4E0CA 1XLCA 3KHDA 3APTA 1A5KC 1DIDA 4XX6A 4WSHA 3ZJKA 5DEZA 5GNYA 1QI2A 4IOTA 1HO4A 3W7GA 1F5ZA 3UXIA 3EOLA 3ARRA 3OLGA 1DORA 3SSJA 3OBEA 4IPNB 3OEXA 1RCOB 4F0HA 1YDVA 4GLEA 3TOYA 2DSKA 4LNCA 2EJ1A 4DIAA 4GQQA 3MV01 4B5XA 4QJ1A 3FKRA 4PMOA 2EPLX 4N4PA 2CHOA 4B9ZA 3MANA 1RD6A 4DM1A 4NNCA 2F6KA 2Y70A 2QUTA 5J04A 4PMXA 4JIHA 2OKOA 3NM1A 4MAVA 1M6JA 1XYLA 2BWGA 3LI0A 2HZGA 3VK5A 1KGXA 4H41A 4ZE5A 3E0FA 3L12A 3W1QA 4C6DA 4PSRA 2HJPA 3RO8A 3RFAA 4GA8A 1DTUA 4JPGA 4AW7A 2ZXQA 2JFEX 1UP0A 3AMCA 4OTKA 3GKAA 4ZSUA 3TK7A 2J7GA 3NL6A 3HGJA 1RH9A 1XIFA 1ZNNA 2WQDA 4IM4A 2H6RA 3LHZA 2G8ZA 1V6WA 3THUA 4DAIA 4B4FA 2UY5A 4CNOA 2XSBA 1Q7ZA 1A4LA 4GQRA 4XZ9A 2QULA 1H51A 1I2OA 2X05A 3SCSA 4JQ1A 2XVNA 3TEVA 1GT8A 4QCFA 4O57A 3VNDA 3TC6A 3WK1A 1JCLA 3C8NA 3V18A 4ZO6A 3V0TA 3O6YX 2JEPA 4GZIA 4GGHA 3NSXA 4MFDA 5EPDA 3HB9A 1ISWA 2CESA 3OVQA 3LA4A 4Q7IA 1KO0A 3PM6A 1ZUAX 1FOBA 3HQOA 4HGXA 2WMKA 2YDQA 3EWCA 1OFAA 3UA4A 3N73A 3AXIA 3DGRA 3CIWA 3RF9A 2CCRA 2JKEA 5DCDA 3C56A 3WNLA 1SU5A 2PWUA 2X2YA 4J3SA 1XFBA 3VABA 3AIVA 2OQYA 5F1VA 2TSYA 4DAFA 2DUZA 1ICSA 2OVLA 1KXHA 4PMVA 2YSWA 4LJ3A 4C7GA 1WNOA 3CK5A 1E1EA 2ZOXA 3DBNA 4O0QA 2HCVA 4Q4SA 5CZ0A 3LYEA 1TELA 5HJXA 3HOJA 3VC6A 3WQFA 4DO7A 4GZ7A 4JOMA 1ZBCA 3BGAA 1PX3A 1K9EA 2NUYA 1YMYA 4FPSA 2D2OA 2DIKA 3E74A 1GJPA 2Z28A 4KWVA 3VE9A 5EL1A 2DGAA 4D8ZA 3VGDA 3MWAA 2XVGA 3NVDA 1PZ1A 3R11A 5TNVA 5AHLA 2YA1A 3S9YA 5A69A 4ZTYA 3SRKA 1UJPA 1NAL1 1UASA 5E0KA 4BJHA 1RP9A 1AQ0A 1QRQA 3TW6A 4IMFA 4U33A 2DSVA 1EIXA 3W2NA 4EP8C 4M3PA 4PUDA 2A2IA 3WKZA 1E6XM 4NY2A 4V33A 4C5YA 5IBXA 3SBFA 4JKLA 1P6WA 2A7RA 2J6VA 4LUTA 1KRMA 5JH1A 2Q3OA 3M41A 3UERA 1G7VA 1PWLA 1GOKA 2PFHA 1C9WA 1WXYA 2VFIA 1JFHA 2VXNA 3WDPP 1JFXA 3G24A 3EOSA 4JXCA 1NU5A 1FY6A 4RLIA 1VR6A 3CUHA 3P67A 3ZT5A 4Z2JA 2F8QA 4JAWA 1XXXA 4KETA 2XTKA 1BVZA 3S6TA 3IJ6A 4Q33A 3BWWA 4U4MA 4KRUA 1YKWA 3CV1A 3EPNA 2HBVA 1M3UA 1ITUA 1MDRA 3TTYA 3WO8A 1W31A 2ZXDA 3DC0A 2YW3A 4MY8A 2ZUTA 4ERIA 5F2GA 3GDMA 1MQQA 1FDYA 4NAFA 3CAKA 3D3AA 2YA2A 4NILA 3MY9A 4HQVA 4P8VA 1LLZA 3EA3A 1EJTC 3NR0A 3W7KA 2Z1BA 4O14A 3P62A 3N18A 3O9NA 1QU4A 4C1KA 3ZR6A 2WVTA 4M24A 3CB8A 1R3SA 3KVJA 4PGLA 2P8CA 2UY3A 2RDUA 4B90A 2HNEA 3VD3A 1CXHA 1J2WA 1FCBA 1RALA 4JNYA 1ML1A 1HL2A 5C54A 1EDQA 2CBIA 2I1OA 3SZ8A 3OA5A 3QMTA 1OSEA 1XIIA 2OZ3A 4Q8OA 2OEJA 1PO9A 4MDPA 3E1F1 4W87A 2PLCA 1ISVA 4PRRA 4XTIA 4IFKB 3IK4A 3T2PA 1IXQA 4FNQA 4DI9A 1TV2A 4B3KA 3PTDA 5EFFA 5KMYA 4ZL1A 1GQJA 4LYQA 1PTDA 4JQ2A 3QPEA 4WJ8A 2CZDA 2G96A 1W3NA 2XGBA 3ABQA 2WVUA 1XH0A 1GOMA 4A05A 4W89A 3OJGA 4LYKA 4RJEA 2Q71A 1KW1A 1BYBA 2DUAA 3CQKA 2VZOA 3PULA 2I17A 2QF7A 3IARA 3JUGA 1W2PA 3PB2A 4Y7EA 3W7HA 5EMUA 1K9FA 1N2VA 1CGUA 1OG6A 1X6LA 1JR1A 2WV8A 5DBUA 2BOGX 5D30A 4K3ZA 4DELA 1XRSA 3RR4A 1AMYA 4ACZB 4DJDC 2FTYA 4CQDA 4AZCA 1QT1A 4P5UA 4OBRA 3URBA 3EB3A 1VJIA 3F03K 1RSCA 3GZAA 3MSYA 3CAVA 3ONCA 3UBPC 3BAIA 1UUMA 1H61A 2VZTA 4DJED 4Y9OA 2NQLA 4C91A 1H0IA 3BAWA 3RPMA 1FWSA 3KP0A 1KRAC 1Q13A 3UP8A 2AGKA 1EGZA 4AIEA 4AYGA 2QJNA 5FA5A 1OM0A 1OZQA 1GPFA 2JALA 3BPWA 1N55A 2W27A 4GI9A 2Q8LA 4KPLA 3UZYA 4ZQMA 4DO6A 1VH7A 4XG1A 4Q8QA 1U1UA 2D2JA 2FZNA 1W5NA 2X7VA 4UFIA 3W26A 4RE4A 5DCEA 5TAOA 4XD3A 2BTMA 2DJXA 3C3NA 2ATSA 3SSZA 1KRCC 1UKTA 4JBRA 5FEWA 4OKDA 2VEPA 1CLVA 3WEOA 3VD4A 3C2RA 2PTYA 1NDWA 1H1ZA 4H2HA 4TX9A 2X42A 3W88A 1VCVA 3FS2A 3AIUA 4J28A 2WB5A 4H04A 3GO2A 3USZA 6TIMA 1O66A 2HVMA 3SN4A 5E6ZA 4FOUA 3C6CA 1OCQA 2WOQA 2QCCA 3BMVA 4XKMA 1LOQA 4J5NA 3OQEA 4IP7A 3DI0A 4UQDA 1M41A 4WD0A 4IGHA 4IWWA 3WQEA 1SPQA 4JKMA 1P1MA 2FGZA 1KQZA 1Z3NA 4L4LA 1OX5A 4EWND 3LLFA 2EJAA 1EXBA 4O28A 3E12A 3E5BA 1E4MM 3MU7A 4HNUA 6TAAA 5ABFA 1CENA 1M7XA 1SO4A 2CLOA 4Q8WA 3ZZ1A 3EXRA 3HV8A 1NF7A 2OMAA 2YB4A 3LCHA 1YPFA 4QP0A 4XSLA 2XN2A 5D02A 1GQLA 4U31A 2INEA 4O15A 3DFHA 4DJFC 4C6BA 4O1CA 4PODA 4Z0SA 1TX0A 2I5IA 1XYMA 5TF0A 1J4EA 3QQ1A 4M80A 2G3IA 1Y65A 3LGDA 4FIQA 1XX1A 3TXVA 4XISA 1C8XA 4WDTA 4LB3A 3WQ4A 4JIIX 1DJWA 4U3AA 3BDKA 3K8MA 4H19A 3IJ8A 3L66A 4FNSA 1H49A 2RGMA 2IQ0A 4QG6A 2PDXA 1P0BA 1OC7A 4CCDA 3AIRA 1CB7B 1J0YA 4Q4KA 4C6KA 4CEXC 3CXOA 5FEZA 2CBUA 3V75A 2V2HA 5A1AA 1JDFA 4US5D 4UOZA 3G6LA 3GAYA 1SW7A 3ECQA 4MG4A 1DXIA 1OCNA 1JI2A 3XISA 1PDYA 3VIIA 3TROA 3MCNA 2ZRVA 3WFZA 4QQUA 3BGGA 3H24A 3T4CA 3LLXA 5LGXA 3S8HA 2OOGA 1JGMA 2VRKA 2J78A 4LCQA 4AWSA 1RZMA 5A8GA 2DFAA 1FFRA 4OUIA 3KCJA 4N0RA 4RDZA 4J3UA 1IEIA 2Y63A 4E6MA 3UR8A 3WBWA 1XCFA 3W00A 5JH2A 4FNRA 3QQ0A 4UMBA 3WBAA 4LV9A 5J5DA 4ONVA 4AEOA 2Q6ZA 2P0IA 3AHTA 3OZYA 2A7NA 1Q6DA 2V6AA 3MKVA 1ZB5A 3U7BA 5KETA 1FWIC 5D8ZA 3UG5A 5JXQA 1B1YA 1JCXA 2ZWYA 1E6NA 1LRNA 2G50A 1G94A 2G3JA 1FVPA 3WF2A 4I9AA 4M8UA 4UZUA 1CYGA 1BLIA 3KOWA 3F2BA 3TCSA 2CPUA 1RCQA 3BW4A 1Q4WA 4LF2A 4QQ3A 1XLFA 2LLEA 5CLWA 5G1TA 5REQA 1AG1O 1K3UA 2Y88A 3HG4A 4KBXA 3UA3A 2QZRA 2V3GA 2QCDA 4LAZA 4MB1A 3ATZA 1PCWA 3WX7A 2VENA 5AYBA 5AZ0A 2DJLA 3RYSA 5HNRA 4K39A 3PBGA 4ATLA 4D6IA 4H9ZA 4ZO8A 3W38A 1O1ZA 4AXNA 5FJUA 1CEOA 4ROQA 2Y6ZA 1H5YA 3W2MA 3SRDA 2CWNA 2W92A 2I5GA 3NDYA 2F2KA 4NG3A 2Y8KA 1D3HA 1W9PA 3M6DA 3VUPA 4HK5A 5I6SA 1KFKA 3MZ2A 1Q7MA 1TA3A 1RV8A 3P7YA 3QKZA 4C6IA 3KE0A 2G0WA 3CV6A 1YNQA 3K46A 2V3FA 5C6MA 3GHSA 2PF0A 3G5EA 4HHMA 1LOLA 4QDMA 3S42A 4IF2A 3U4FA 1C92A 4MZ1A 1QI4A 4XZBA 3GXPA 4JL2A 3OHMB 3FLUA 3W1LA 2PP3A 3SAZA 5LNUA 5FJPA 4PUWA 3P0WA 2YJQA 3BG5A 1XGZA 2VD8A 1LCOA 3GUWA 3EKLA 1SM9A 1Q2RA 2DZSA 2GQAA 4M19A 3VDGA 1D2KA 3IJ7A 3R2GA 5CSYA 2FB2A 1O5XA 1K7FA 2V5DA 3OLIA 3BL3A 3CB3A 3BARA 3S3GA 3TA6A 3DCPA 3N1AA 3TMLA 1X1ZA 5E9XA 4QE5A 3HIJA 3CUIA 1V3LA 5C71A 2EO7A 2V68A 1TFVA 3KWSA 4ZODA 4AC1X 1ECEA 5FSDC 1GK8A 2WHKA 1QNRA 3LENA 4Z1AA 4NJIA 3MMDA 4GOAA 1BSIA 5CPTA 5I78A 3A64A 3MTWA 3VD9A 2HS6A 2HVNA 1EDTA 1HKVA 1RJQA 1W5OA 4QDPA 4GI6A 4K8EA 4O11A 4GXMA 3VDBA 3VTRA 3L4XA 3AWOA 3UGRA 1E6PA 1DTNA 3LCLA 4WX2A 1B9ZA 3N6HA 1XLKA 1NQKA 1TJ1A 2OKTA 4WRHA 4CGTA 5HANA 3AMDA 2ICSA 1H5VA 1T96A 3UW6A 1KKRA 5LNVA 1BF2A 7A3HA 2YIHA 1GPWA 3AOFA 3SECA 4D6GA 2XSAA 2GQ9A 4BK9A 1I2QA 5CAKA 1MRQA 1TUXA 3JVAA 3UZZA 3RUBL 1E40A 1OFDA 1GVEA 2YXGA 2XJ7A 1QPRA 2ZCGA 2EG6A 1A50A 2ISSA 3SUUA 2JQXA 2ACUA 4BZYA 2O7SA 3SY1A 3AS0A 5DT7A 2XIQA 2YXOA 1E6QM 4O54A 3SQSA 2BY3A 3L4YA 2GVGA 3KDNA 3L68A 4X2RA 1EA9C 4UOJA 5GJMA 1S38A 4GQGA 1OK6A 4LV4A 3GTHA 4ZBCA 1R38A 4JZ5A 3NGJA 5DXXA 3C61A 2AOSA 4DXKA 3KXQA 1VFMA 1JZ8A 1C91A 4ECLA 1W3IA 2WWCA 4L1WA 4J27A 4DLMA 4XBSA 7REQB 4HSOA 2XHYA 4DBUA 3S0CA 1TJ0A 3R89A 1KQYA 4MWAD 4GFSA 1PTAA 2FYMA 1POJA 3VZYA 3LTPA 3QY7A 4DO5A 3I68A 3V5FA 3QW4B 3QV8A 4IT1A 2Q3RA 4AHOA 1Q45A 5C2XA 3UCDA 1P7TA 2YLLA 3OGSA 1AW2A 2CERA 1HF6A 4TMCA 4RZ4A 3RX2A 1EJXC 3ARZA 2FQIA 1R87A 3KOZA 1TE6A 3H2OA 2BS9A 1XRVA 2VGFA 1TJRA 5H2ZA 3M9YA 1TO3A 1O5KA 1TRDA 1UH2A 1TJ2A 5JBFA 4DZHA 4B4HA 2HISA 2PDGA 1VLIA 3GVWA 3LCFA 1EF3A 4I90A 3I10A 2D20A 2OZTA 3W75A 3QGAC 1XPGA 3LD5A 2J79A 2XIBA 5T8GA 2W66A 3MKCA 5EB8A 1JI1A 4AG0A 3M0HA 1KLZA