3G1VA

Crystal structure of the mutant d70g of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5-fluorouridine 5'-monophosphate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
b'VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAGFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
molecule tags Lyase
source organism Methanothermobacter thermautotrophicus str. delta h
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
total genus 80
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g1vA00
2FB2A 4IJBA 5BMWA 3CEPA 2A85A 3U6WA 3DXIA 3EKZA 3IVSA 1I2OA 3W83A 2CLMA 5LNVA 1ZALA 3BW3A 3VE7A 3C2EA 3LX9A 4UFMA 2HMCA 5HULA 4JYEA 3EWWA 3WJZA 3S5OA 1AK5A 2QCEA 3F03K 3LCLA 1DV7A 3UPWA 3GK0A 5C6MA 4MZYA 2ISSA 4LV9A 2X30A 4KFOA 1LM1A 2QCMA 1LBFA 3UZJA 3C2OA 1OABA 4QAIA 1N55A 5LNSA 3W6YA 3R5EA 3TROA 1IGSA 2VFFA 2YYTA 3OA3A 3GAYA 1UBSA 1ZY9A 1KBIA 3GNNA 3NQEA 5G2HA 3MO7A 1KFEA 3TNOA 2CU0A 1TV7A 1TQXA 3GNDA 4LVDA 5CSSA 4PFMA 1A5CA 2YXGA 1PHWA 2GPTA 5FEPA 3BLIA 4CCCA 2TRSA 4OQVA 5ABTA 2EF9A 3NPVA 4O19A 2ATSA 2V81A 1H61A 3LXAA 3DHDA 4RZ5A 1XM3A 1IF2A 2J9ZA 3ANYA 1XXXA 4MFDA 4XTIA 1W37A 3W2NA 1JULA 3BPWA 3NNTA 4GUFA 5CPNA 3PY2A 5AYZA 4L4LA 3DU0A 2DZSA 4K38A 1JCLA 1D3GA 4O28A 3VCRA 3PULA 3C2VA 3DZ1A 1GPWA 1OFAA 3P60A 3SW6A 2RDUA 4I9AA 5FESA 1LRTA 2QUTA 4ZQPA 1O5KA 2GQ9A 1SUXA 4CQAA 1V7YA 1H7WA 4LOCA 4JTKA 4ONVA 5LKYA 1TV8A 2P10A 3C2FA 1XDMA 1EEPA 1OFRA 2FLIA 2J88A 4NZJA 2J27A 2ZRWA 1OHLA 3UWQA 5K7JA 2CZFA 5EPDA 1HG3A 5F2MA 1LTDA 3LHZA 1QMLA 2GJNA 4C1LA 4JTUA 5HINA 3MP3A 4S2BA 4N9CA 1S3HA 5AC8A 1TPB1 3C3NA 1ICSA 4UMAA 3ABOA 1FDZA 1XBVA 5HR6A 3W7MA 2WOQA 1BWKA 2JKEA 3HJZA 2C19A 3W7PA 2DORA 3EXRA 3ZR4A 3F1QA 1LZOA 4BFAA 4O10A 1Z48A 5U4NA 2Y7FA 5CG7A 5L9FA 3TFXA 3M47A 1A50A 3EB2A 4LT9A 1ZCOA 3G1HA 3SSJA 3HGJA 3HPXA 1GJPA 4Y8FA 5LHFA 4JGDA 1PVNA 3TR2A 2RH9A 2R94A 1KV5A 5D30A 3O07A 3LERA 4JY9A 3WK1A 3GKFA 4Q4KA 2C14A 3PUEA 1KM1A 3BGGA 3LRMA 5FEZA 1UJPA 1MXSA 1I2NA 2YZRA 2EGZA 1A5SA 2QUUA 4FXRA 5DCDA 3MP4A 1TRDA 3RFAA 4GUHA 5TIMA 2ZRYA 4O4VA 3LHVA 4N9DA 1YTDA 3G18A 4UFLA 4H4IA 1XBZA 2P0OA 2E1DA 3LXBA 1L6SA 5FF0A 3KVJA 3CQ0A 4UFHA 3EX6A 4UTTC 2J9YA 2Y62A 2Z6IA 3GDMA 4CQ8A 2X2GA 3WJWA 2Y7EA 1A5AA 5A5WA 1TB3A 2E68A 1CI1A 1JCNA 1L6WA 2A5HA 3L5LA 2YSWA 1OYAA 4JS3A 3B06A 2VELA 3PBWA 5D38A 3IGUA 1L6YA 1X1ZA 4O18A 1J5TA 4BR1A 2GUUA 2QJIA 3M0ZA 3GB6A 4O8RA 4GFSA 1AG1O 1OK4A 5KMYA 4FHAA 4ADTA 3KXQA 4Y96A 4LS0A 1LRQA 3INPA 3GIYA 2I14A 4DPPA 4MIMA 3W1AA 4PL1A 2WKJA 2ABBA 2D73A 3LHTA 4XBKA 1I2QA 1LOQA 4XKYB 2W0UA 3PSWA 4FIRA 1W54A 3PG8A 4X22A 4FNSA 4HPXA 1VYRA 4NX5A 4AHPA 2CZDA 4CCEA 4UTLA 1M7PA 2YFOA 1XC4A 1O95A 1VCVA 3CC1A 5D03A 1H63A 3GZ3A 3B0PA 1WYIA 3SY5A 1W8SA 3FJ6A 3TW7A 3P61A 3KRZA 2WSQA 1ML1A 1RR2A 1R46A 1EIXA 3UY7A 4Q33A 3QFEA 5I3FA 4KWWA 1G4EA 1UASA 3C0JA 4UC5A 4WOZA 3GXNA 1OX4B 2A7NA 3CU2A 3W07A 4JIPA 2LLEA 3NQMA 1MO0A 1EPXA 3DBPA 2Q3OA 5F1VA 1TCDA 3UXDA 3MW7A 2H6RA 2HS8A 3CLMA 4IUOA 3NQDA 2F84A 3BG3A 3C4UA 4IX0A 4UR7A 3L68A 3TJLA 4AMAA 2VXNA 1XI3A 1ZNNA 1B9BA 3LTYA 1GG0A 4GC4A 1GOXA 2PC4A 1RPXA 2NX3A 4DF2A 4O17A 3NEVA 2WPBA 3B8DA 2HS6A 2CLLA 4ALDA 1T0OA 4M19A 3W1PA 2ZA2A 1TMHA 3C56A 4IPIA 2QCLA 1G4SA 1H62A 1GG1A 5I3HA 3P7YA 1LP6A 2VKZG 2WJZA 3E0IA 4POCA 4OWGA 3VI2A 2RDTA 1T8XA 3W9ZA 1EP3A 5DELA 6ALDA 2ZDRA 2C6QA 3O16A 3HQ1A 1OG0A 4G1KA 1VGAA 4JDYA 3O15A 3LGEA 1X7FA 1RQBA 1KLYA 1RV8A 1JJKA 3PF3A 2CLKA 4NVTA 1QOPA 1LLWA 3DFQA 1O60A 3S1WA 4H3DA 2GVJA 4JX6A 4E2DA 1UB3A 3LB0A 1H50A 1HFBA 3NQ7A 4OV9A 4K37A 1O4UA 5EBUA 3BG9A 3LV6A 1IIHA 4GWEA 4UMCA 4DXVA 4M7TA 5C55A 3W85A 3RK8A 2CZ5A 3B05A 3T44A 2VOMA 4BI5A 2X1SA 3TV8A 4DBDA 3O6DA 4CQ9A 1G69A 4IQLA 4TIMA 3RLVA 1D9EA 3PM6A 3DFOA 2RHGA 4OE7A 3HG5A 1DHPA 3EKLA 5AOUA 4JIQA 4A2SA 2JBMA 4AWUA 1YTEA 5LNRA 1VHCA 3BG5A 2WO5A 3B03A 1JUKA 1TTJA 3E9AA 4N9EA 1JUEA 3P74A 5G1TA 5F4SA 4FXSA 1C9DA 3LTSA 5CGQA 3W1MA 1OFDA 2JKPA 1K7XA 4HNVA 3EX2A 4N2YA 3A23A 3NQ2A 3A5VA 1MEHA 3W7DA 8TIMA 3S5ZA 4IMEA 4ZVJA 4CCDA 4O15A 1LYXA 1PCKA 1PL9A 1VC4A 3GXTA 3NPXA 4LTSA 1WDWA 2NLIA 5T26A 3M43A 4BI7A 2C0AA 3OVQA 5K3VA 4IMDA 3W87A 3VKJA 1PIIA 1GYNA 1IXQA 2GQAA 3QZEA 4X3ZA 3M5XA 1QFEA 2NX9A 3I7SA 1SPQA 3M16A 4RK8A 5AHIA 4FX7A 3UQNA 2WNNA 2GOUA 4O52A 4OU1A 3SECA 4ADUA 3G0SA 5DXXA 2E5CA 4UTUA 1TRIA 2E6AA 2JGYA 3GAKA 3EWYA 4JEQA 3NQCA 4O0KA 5AFDA 3ABQA 1I45A 1FX6A 4A29A 4WQ6A 5MHBA 1K03A 2PRMA 1SO5A 4QITA 1J2WA 3BLFA 1QR7A 1KTNA 3STCA 1GTHA 1H7RA 1RD5A 2WV8A 2QCDA 1SO4A 1WXJA 2BLEA 4IOTA 4ZQRA 2A6NA 1SSGA 1VRDA 3ATZA 1W3IA 2XN0A 3HGSA 3NM1A 2QCFA 2VFHA 4XBSA 3N2MA 5EYWA 3V1PA 3BLEA 2CLEA 3DI0A 5DLCA 4UCGA 3A9IA 4R33A 3LI1A 3ATYA 1JRBA 3TKFA 2Q3RA 4UTWA 4WXYA 5HWNA 3PBUA 3EWZA 1U83A 1TTIA 1YLVA 4YWIA 1XDLA 3UWZA 4O1BA 2YGYA 3GR7A 4AF0B 4MZ8A 4PC8A 1QAPA 3IEBA 4FNPA 4ICNA 2J6XA 1SZFA 2E77A 5D2XA 5LHEA 5D2TA 2VFDA 1W5QA 1W56A 5CPOA 3W2KA 2WSRA 2QAFA 1VZWA 3E12A 3QC3A 4N9BA 3DH7A 3QPZA 1QWGA 4AVFA 5C54A 2QF7A 5HNRA 1DOSA 2YPIA 1YDVA 4UNKA 1VYPX 5HWMA 4EOUA 3ZWTA 1QPRA 1PV8A 5E1QA 1MZHA 3I65A 4JTFA 3M5ZA 1YDOA 3NR0A 4ZQCA 3W1UA 2Y89A 4UTHA 3M41A 1G6CA 4QSHA 1Q45A 4FF7A 2QUVA 2DZWA 5KINA 1KFKA 1C29A 3CWNA 1TREA 4LNYA 2FB3A 4UTJA 1WBJA 3TSDA 2ZTJA 1Q6OA 2NXGA 2Y88A 2EAWA 2W6RA 1YPFA 3CIWA 1B4EA 4UR8A 4UUIA 5D05A 4JTGA 3GDTA 3W7GA 5AC6A 2A7PA 2VEPA 2DZTA 1F6PA 3MI2A 1VQTA 3K30A 4MJZA 5LSMA 3KHJA 5LGZA 3P80A 4AHOA 4I7VA 1RZMA 3G1FA 4K6AA 3UWUA 1H7PA 2FJKA 1OVDA 4DO4A 2QR6A 2B7QA 1YTKA 2QCHA 4UTIA 3R2GA 4NU7A 2BZNA 4RX0A 5K2ZA 4X9SA 1W31A 2NUXA 5CPLA 3TC6A 1U5JA 2ZYFA 1Q6QA 3QH2A 1R47A 3VE9A 1JCXA 4RCXA 2NUWA 3P8IA 5BRBA 1VLIA 1I8JA 3DFTA 3ZFHA 3LCFA 1I2PA 1TQJA 2PRHA 3NL6A 3S42A 1K8XA 2X1RA 1TIMA 3ZS4A 3BW4A 2YDAA 4ZZ9A 1K3UA 4Z0JA 2GVLA 1C8VA 2E6FA 4O11A 5DBUA 3CM4A 3G1VA 1Q3NA 3C6CA 1GQNA 4RXFA 2NWRA 1G7VA 1DBTA 4LU0A 3LI0A 3WJSA 2ZQ0A 3SJ3A 4MY9A 1Z41A 3HPSA 2P1FA 2Q8ZA 5E93A 1LROA 3UWWA 4LS1A 4AEOA 3IVUA 3LTPA 1H7XA 5D2YA 1F7BA 3CWOX 2A6LA 5D32A 2Y63A 4ZQNA 3G8RA 1G4PA 1PCWA 3FEMA 1A53A 5CPMA 3O8AA 4DO6A 2YW3A 2H3DA 1AW1A 3Q94A 5CSRA 1JUBA 1W5NA 5U7SA 3LM7A 3L0GA 3U2OA 2ISVA 4RJEA 3TXVA 3PSVA 3MI6A 3C52A 3G0XA 1KM3A 3BO9A 3O63A 4FIQA 1YYAA 3HMJG 2ISWA 2CFFA 4IXHA 2CLFA 3QRHA 1NVMA 3W84A 5DBTA 3GDRA 1TPC1 1XKYA 5AB3A 2FPVA 3LHWA 5HUOA 3W1RA 1B4KA 3G1XA 1KV8A 3S8HA 2NXIA 3L65A 1XUUA 2QAPA 4NJHA 5AHNA 1MEIA 3NM3A 4Z1DA 1M5WA 3AJXA 3MHGA 1J4EA 4A2RA 2NWSA 3NZRA 3G22A 1SW3A 3U8GA 5KITA 1EWEA 3DENA 2JKAA 2V5BA 1F2JA 1R2TA 1KTBA 1TV5A 2R14A 1KW1A 4ML9A 3TAOA 1FDJA 3FFSA 3NA8A 4LC8A 1ICPA 2XFWA 1JR1A 1LRNA 5D33A 3SIZA 3NDOA 3PUOA 4UIOA 4O1DA 2NUYA 4ORIA 5BMXA 4PL2A 4ADSA 3F4NA 5AHFA 2Z1BA 5F2LA 1YPIA 4Z08A 4AAJA 4HPJA 2OZ0A 3P67A 2PCQA 3FOKA 1GZGA 4K8EA 3BARA 1EWDA 4GJ1A 4RLIA 3B0UX 1ZJIA 5G2IA 5BOOA 4WX2A 3QPYA 2G5WA 3M44A 5FF3A 3C8FA 3FJLA 4S1FA 1I4NA 1YXDA 1ICQA 4XTDA 3UXAA 1YXCA 3NZ1A 1T96A 2DJXA 3A5FA 4WJEA 2FQIA 4KWVA 4O57A 4EWND 1LCOA 4JTJA 2ZZ4A 1FXPA 1KFCA 3TQVA 3QQ1A 5D02A 3O06A 4JNMA 4DF1A 1EUNA 4Z1BA 1VS1A 4HT3A 3HF3A 4Z0SA 4LW7A 3B4UA 4MVAA 3HIJA 3UZ5A 3M5VA 3HOJA 2O7QA 3A21A 3S0CA 1QPNA 3NAVA 2V9DA 3TMQA 5K4ZA 4JX4A 3OBKA 4IPJA 3W7JA 1UUMA 4O1CA 3L0KA 5G2WA 3Q2DA 2X16A 1H60A 4WZHA 2PRLA 2QKFA 1E51A 1F73A 4O50A 4UFIA 2QDHA 1W3NA 3MHFA 1XL9A 4EF9A 1DVJA 3QF0A 2G97A 2H8ZA 1QDSA 3EWXA 2YYUA 1AL8A 5HR7A 3S1XA 1OYBA 1TPH1 4HSNA 2ALDA 2ZA3A 4DEFA 1Q6RA 3SGZA 3SZ8A 1THFD 4OGZA 3S6DA 2ZZ2A 3W7CA 1FCQA 4O53A 2OJPA 3P8JA 4CNOA 1W0MA 4NZFA 3WJXA 2BXVA 4UTWC 1OF8A 1KTCA 1R30A 2IQTA 3BV4A 4MLRA 1XFBA 1OFPA 2BX7A 4LVBA 1VJIA 2QCNA 4PODA 4LRTA 3NQAA 4YXGA 1FQ0A 4LUIA 1OFOA 3GX9A 1X6UA 1P0KA 4PCFA 3LBMA 1SU5A 4QIUA 5I3JA 4EIVA 1DORA 3DKJA 4AWTA 1K7EA 3PBVA 3QMTA 1KM6A 3EEGA 1FCBA 2F7FA 4MLJA 2V82A 4MKNA 3LRKA 3HBLA 2E5DA 4YCPA 4OV4A 3VFLA 4LV4A 4DF0A 3CT7A 4EVZA 3DFNA 4MZ1A 4JTIA 3TK7A 3O6YX 3IGXA 3NL2A 1M6JA 2G95A 3TU9A 2A1YA 3THAA 3IVTA 1BKSA 2ZCGA 3S1UA 4OT7A 3LBCA 2ZRVA 4JDBA 3L66A 1G7UA 5HMSA 2CLOA 2DZXA 3T55A 3A22A 4FNTA 1R2SA 3MP5A 1TTQA 2B7PA 3HGOA 5EMUA 2YX0A 3W23A 2QCDB 4ORMA 2NXHA 4O4WA 1WOAA 4IMFA 3HO8A 1HO4A 3BVJA 4FX6M 2YR1A 3PVFA 3C2RA 4MJMA 1WAUA 2Z0IA 3WK0A 1H7OA 4HNUA 4DBEA 3QW4B 1VYSX 3GDLA 3PAJA 4M5PA 2DZPA 4GBUA 2VEKA 4N4PA 1TJRA 1ME9A 3HGRA 3EX3A 4PA8A 1LOSA 1OX5A 3MJYA 5CZSA 5EA9A 1OFQA 4LWWA 1KM5A 1BEUA 3G1SA 4OHQA 1KA9F 4QISA 4RV8A 3QMRA 4GUJA 3B0VC 3G1YA 5CZ0A 1AW5A 1L9WA 3EX4A 1PE1A 4K7YA 1GVSA 3NO5A 4P61A 3G3DA 1TPVA 4YLWA 2NV2A 5SWUA 4XQ6A 4LC6A 3OVPA 1ZAJA 4B5NA 3V75A 4O0ZA 1JVNA 3I7RA 4NNAA 3PUDA 2CLIA 3KFTA 2FPTA 3PG9A 3TE9A 5I3GA 3W22A 1CX9A 5BW6A 1SO6A 3IIOA 4U4MA 1W5OA 2ZRZA 4JTEA 1SW7A 1DL3A 1KM4A 5D04C 3HG2A 1TPUA 4HN4A 1B57A 3W73A 5LZLA 4JN6A 1NF7A 1FWSA 2ZRXA 2HSAA 3MBDA 2QDGA 4FNUA 3N9SA 3ABSA 3FA5A 3P5YA 4JICA 1Z44A 2Y61A 2B0MA 1TSIA 3FIGA 5D2WA 2DJLA 3STEA 4OBTA 5TBOA 3ELFA 1XCFA 4N02A 3QEZA 5LNWA 1EB3A 4N4QA 3QMSA 1P5BA 3TJXA 5AC7A 5BNKA 3G3MA 2C1HA 3H54A 2E6DA 4NJJA 3KVLA 2ABAA 4IWWA 5HWJA 2EHHA 4K7VA 2O7SA 3D0CA 1WOBA 4AB4A 4BF9A 2JGQA 1TPDA 2C3ZA 4IX2A 4ZQMA 3RF9A 3TMLA 3GR8A 1SQ7A 4XWUA 1SR9A 1VH7A 4NXKA 5EKYA 1IXNA 3L2IA 2A0NA 1TPEA 4LVAA 5H91A 3EWBX 1LBMA 3W1QA 3MHUA 5KZDA 3LRLA 2I9EA 5I3IA 5G5IA 4JXCA 3M1ZA 4TMCA 4QM1A 4Y90A 1MSSA 4JYFA 3IGSA 1BWLA 3W72A 3EWUA 1K02A 5LGXA 3L5AA 3S9YA 4MUZA 3N73A 4GNJA 2C18A 3MYPA 3P81A 3WK2A 4RZ6A 5DCEA 4WXZA 3Q37A 1TJPA 4UXDA 3LV5A 1EA0A 1GVQA 2VEMA 1D3HA 1EP1A 2RKXA 3HPZA 1H5YA 5F2GA 4JD4A 1GTEA 1LBLA 3UWYA 1ADOA 4D2JA 3GDKA 4GXMA 5AYYA 3W7RA 5HUPA 2AGKA 5F2IA 3W76A 3H55A 3LXCA 3W1LA 1TTPA 3G0UA 4UNLA 5K9DA 4JTHA 2XN2A 3TX9A 3P84A 2JK2A 1S5VA 2QJHA 1NAL1 3GVGA 3W7LA 2PURA 1O5XA 3TAKA 4UTTA 3QW3A 1FXQA 3PB2A 4I7WA 1F74A 1KFBA 4GUIA 4LVGA 5F4XA 1FUYA 3TQ0A 3N3MA 4HNTA 3W3OA 4IGHA 3W86A 4P2VA 1SZGA 3HG4A 3LLFA 1FWNA 1SSDA 3PS7A 5CZTA 5H2ZA 3OG3A 1HUVA 3NQFA 4UFKA 5EL1A 3G1AA 5EY5A 1G67A 3IIPA 3TC7A 3BW2A 2AQWA 2H8XA 2VEIA 1TYGA 3E49A 3USBA 3IV3A 4QQ3A 3W7OA 3N34A 1B3OA 2Q8LA 3N9RA 4YMZA 4LVFA 1PHQA 4O13A 3M5YA 3KX6A 3T40A 2HTMA 1K8ZA 4BK9A 3EXTA 4KFPA 1UCWA 1NF0A 2FFCA 2V5LA 5AN7A 1JCMP 4KKXA 3W2UA 2DP3A 4AWSA 2J24A 1FBAA 4YCOA 1MEWA 1NFBA 4DQWA 1ZHAA 4PTNA 3FYOA 4UMBA 3DFPA 2EPHA 2CWNA 5C2XA 1ZFJA 4JTTA 1DJNA 2C13A 2V8ZA 4LY8A 3E02A 1RQEA 1UUOA 1QO5A 1OX6A 3IIVA 2V2DA 2ZTKA 2A21A 4M6VA 4PEKA 1KBJA 4LRSA 3PWAA 2V0TA 4Z1CA 5I3KA 1ZAIA 4IMCA 3QYQA 1H51A 2TMDA 1KLZA 1JCYA 1W3TA 3LDVA 3KAOA 4JYDA 3OVRA 3FS2A 3I7QA 4R34A 2A2IA 4DELA 3KRUA 3R13A 4TU1A 3DHFA 3I68A 2RDWA 4TR9A 3QJAA 2E5BA 3NVTA 3SI9A 3W7HA 3L5MA 2YCEA 3LCIA 1IXPA 2DZVA 1LLZA 4O12A 4DO5A 3MWAA 3QSTA 1SO3A 2R91A 2J9XA 5D09A 4M7SA 2ZZ6A 2Z6JA 4ZL1A 4NNCA 1HL2A 5FEWA 5K4XA 1M7OA 2A4AA 4WY0A 4R53A 1DKWA 1F76A 5KZMA 3W2LA 2NV1A 1GYLA 4RKAA 3T7VA 2YW4A 3W2JA 1FWWA 3RLUA 2WQPA 3GLCA 3W70A 4FNRA 3DAQA 1R2RA 3NL5A 3DI1A 1X1OA 3L21A 1P1XA 1S5TA 3FYPA 3MBFA 4TX9A 4LS2A 5G4EA 2XN1A 3W88A 4FNQA 5G1YA 1LORA 3RNDA 3KOFA 1WBHA 3TH6A 2C16A 1ME8A 2B7NA 4Q32A 1SW0A 1O94A 1GVRA 1KFJA 4QNEA 4MOZA 4K8HA 5GVJA 3N2XA 1K8YA 5DY2A 3UD6A 3GKAA 3QM3A 1H7NA 2FIQA 1ALDA 5E0KA 4FB7A 3G8EA 2WSYA 1P0NA 3UWVA 3KRSA 3THQA 3S1VA 3NQ8A 3PB0A 2NX1A 1LOLA 1ONRA 1WV2A 1QO2A 3JS3A 2OMAA 2Y7GA 3L9CA 5FF4A 4AHQA 5HJLA 4WY0B 1I2RA 4E2BA 3GXPA 1RQHA 4NJKA 2VFGA 1VHNA 4DPQA 3B04A 4NJGA 1OFBA 1QNVA 3IIZA 4MPQA 4PH6A 5L6UA 5K9XA 2VC6A 2ZZ3A 2TYSA 3S5YA 3O05A 2EKCA 4ZQOA 3W7EA 2AAMA 1BTMA 3W75A 2I1OA 3KVMA 4JY8A 5FF7A 3GYEA 4WUIA 4YL2A 4JR5A 1L2UA 4ZMGA 3G24A 3HG3A 2TSYA 4NX0A 3R8RA 1CW2A 1HO1A 5AHMA 3M6YA 2OCZA 3TSMA 1H1YA 3E96A 4HIBA 3CIXA 3W1NA 3DKLA 1GVOA 3LCGA 4UTMA 2E09A 3LOTA 4GRSA 4LUJA 4MFEA 2H90A 2X1UA 3AO0A 3T4CA 3PC0A 4BWLA 3OEXA 3A24A 4NXSA 3NG3A 4XZ9A 5TQLA 2GJLA 3LHUA 1Q6LA 3KVKA 1AMKA 4BI6A 4JTLA 1FWRA 3NOEA 4KFNA 2QCGA 2FPYA 1AW2A 4JTSA 4R7JA 2Y70A 3STFA 1ZAHA 1NEYA 5CZJA 1H1ZA 3TCEA 2QEZA 3TSBA 1TPFA 2V2CA 7TIMA 1FY6A 1YADA 3FLUA 4S2CA 1OF6A 2CZEA 4GUGA 2ZZ1A 3SFKA 5IBXC 3M9YA 1FCUA 3IIXA 4MY8A 3RMJA 4X2RA 3W1XA 4A3UA 3NQVA 1NSJA 1W5PA 3T78A 4RR4A 3STGA 3R89A 1GT8A 4N6FA 1JRCA 1VR6A 2WNQA 4QJ1A 2FDSA 3I6RA 5KTLA 2A7RA 1SZNA 3DFSA 1W5MA 2E6YA 1TO3A 1F05A 1VPXA 4Y9AA 3BGJA 3FKRA 3O6CA 1OYCA 4CNNA 3LHYA 1OX4A 4MY1A 3YPIA 4MYAA 1PS9A 2X1TA 3DGRA 4K39A 1XBXA 2ATMA 2G96A 3UY8A 1Y0EA 2TPSA 3OIXA 4O16A 3TXZA 3NQGA 1QOQA 1JCJA 5F4WA 5HQEA 3NYZA 3NPWA 3CB8A 4UTKA 1X8FA 3W7NA 1FDYA 2CW6A 3P62A 2V2HA 2Y6ZA 1G4TA 4A22A 5CKSA 2VFIA 1TPWA 3CHVA 4NT0A 1S5WA 4TMBA 2OX1A 2YFNA 1HTIA 5J5DA 3N14A 2PE4A 2Y7DA 4E38A 2QCCA 4XKYA 1GWJA 4Z1AA 4CLMA 3QSRA 2ZFAA 3W2MA 3PR2A 3EXSA 4FX8A 5DY3A 3EX1A 3F4WA 1DQWA 4GE8A 4NNBA 1N8FA 4FEZA 2DU2A 4W9TA 3BK0A 3M7WA 3ZWSA 2ZBTA 1SFLA 3OHIA 1VLWA 5F1UA 4H6KA 3UPBA 3ABRA 1AL7A 1F6KA 4XUGA 1JQXA 1EX5A 4Y6GA 2CLHA 2BTMA 3UNDA 2C15A 3P82A 4TO8A 4RXGA 3NL3A 1YXYA 3SGUA 1DJQA 3L0NA 1OFEA 3MI3A 2OT0A 4WD0A 3CEUA 5AHEA 3P5ZA 1GEQA 3TQKA 5KZEA 4NJIA 4O14A 3LLDA 4HKPA 2GVGA 2VFEA 4FO4A 2W79A 1W1ZA 3O1NA 6TIMA 1WX0A 2QJGA 1KM0A 5IM51 2B7OA 4MYXA 3VNDA 3W1TA 1FWTA 3HB9A 1EP2A 3S5NA 5LNUA 1T99A 4U28A 3R12A 3JRKA 3W7QA 3NPUA 4I7UA 5DN1A 3TUUA 1VCFA 5DXYA 3MUXA 1SFJA 5D2VA 3RU6A 1KM2A 5K9CA 3FKKA 4HSOA 4O54A 3Q58A 1P4CA 3JR2A 3C61A 4L4MA 3WFAA 5C5YA 2NZLA 4WY0F 1XUZA 1SZEA 5A8GA 4J9JA 4O1AA 4E0CA 1ZENA 4N6EA 1XBYA 3CTLA 3LCWA 3W71A 1IXOA 2OT1A 1IIGA 1RVGA 5AHLA 3TA6A 5KSWA 1EUAA 3IRDA 1F5ZA 5FEXA 1FCVA 3SR7A 3UYCA 1WQ5A 4NQ1A 1DQXA 4IXXA 3N19B 4CNPA 3L67A 5DCBA 1QCWA 3LCHA 1K7FA 3G1DA 5J5RA 4WOQA 1GVFA 2ZA1A 3MYOA 3NQ6A 5IBXA 4M6PA 2UV8G 2R8WA 3NGJA 2WNZA 4AXKA 3MMTA 3W74A 4JX5A 1A5BA 2ZZ7A 4AF0A 2Y85A 5AYXA 4K36A 3WJYA 2RFGA 2B4GA 2Z2UA 1V5XA 5FF2A 1QPQA 5D37A 4RZ4A 3TDFA 2H3BA 3LCXA 2FTPA 2BWGA 3W7IA 4C1KA 1Z42A 1VCGA 4HNNA 4HHPA 4NUWA 2VENA 1N7KA 4EF8A 1LDCA 4M6QA 1OK6A 5G4WA 2BSLA 1KFLA 1WA3A 4BWLC 1OJXA 3TW6A 3H53A 3PBYA 1QPOA 2ZZ5A 3NXFA 3W7KA 1JQVA 4AH7A 3WK3A 4UFJA 4IMGA 5FI8A 4QNWA 1YDNA 3QQ0A 2ZRUA 2V30A 1ME7A 2KZHA 3TIMA 2DZUA 2GQ8A 4A21A 3TFCA 3CPRA
chains in the Genus database with same CATH superfamily
1IEXA 2PTZA 5CSYA 2DZAA 1JNEA 2A85A 3U6WA 3EKZA 1XLCA 1IQ8A 3MV01 3VE7A 3ENLA 3THDA 1HGWA 3EOLA 3GVRA 3LCLA 3CZ8A 3GK0A 1DIKA 1H11A 4MZYA 1BFNA 1LWIA 1XH2A 1DWIM 1IZJA 1XIHA 2INEA 3ITCA 3LD5A 4QCFA 1CXIA 3URAA 1IGSA 1W1IE 2ODOA 3NCOA 4LYRA 5EBAA 2PTDA 4J3VA 1ZY9A 3TJIA 2OKOA 3CASA 3ZOAA 3CO8A 5G2HA 2CBIA 3TNOA 1MFUA 1TQXA 4LVDA 2GPTA 5FEPA 4OECA 4LNCA 3APYA 2EF9A 1PIFA 4KBXA 4GINA 3GY1A 4OKDA 1TCMA 4DWSC 2J9ZA 4M82A 1PIGA 4NASA 4DHGA 3ANYA 4MFDA 5FJPA 2QXWA 1O1ZA 1UWQA 4ZOCA 4GGHA 1D3GA 4O28A 2VC7A 3PULA 3SEPA 1E9YB 4H9MA 1OFAA 2BVWA 4G56A 1PYFA 3SW6A 3V35A 3WCZA 2DVUA 3ZLGA 3A64A 4K68A 1SUXA 1V7YA 3CL6A 1H7WA 1UKPA 5HDRA 3CQHA 4ONVA 3WDJA 3C2FA 1XDMA 1OFRA 2J88A 4NZJA 4IPPA 4J7RA 4RL3A 3GSMA 3UWQA 4F0SA 2GVEA 1HG3A 2ONEA 4Z42C 4YYFA 4B4FA 2R1KA 4KIEA 2DT2A 2FGZA 4EKJA 1TPB1 2GVYA 2PUZA 3ABOA 1J0JA 1FDZA 1XBVA 2FFIA 2WOQA 5F7UA 4IMAA 1TR9A 3W7PA 3F1QA 1HNYA 3UXKA 1V0KA 4IP4A 4D6HA 5U4NA 1JYWA 3EB2A 3U2EA 4QLJA 3G1HA 2OYLA 4EXBA 5LHFA 2OR2A 3V5FA 2PDUA 2RH9A 4A8LA 3LBOA 1E4IA 5EGRA 2PDIA 5IHSA 1OD0A 3NDYA 2PDHA 3QR3A 2C14A 3GHTA 5FEZA 3TOPA 2FMOA 4FXRA 1A5SA 1MWOA 3LHVA 1YTDA 3G18A 2GLKA 2P0OA 2E1DA 1GQKA 1L6SA 3OP2A 4JQ4A 3BV7A 3DFYA 3OQ8A 5FF0A 2WKLA 2UWFA 2Y62A 3GDMA 2X2GA 3V1HA 1TB3A 4H00A 1SJCA 1CI1A 4EXAA 1L6WA 3L5LA 4D8LA 1OYAA 3E2VA 4R9OA 4JS3A 2VT0A 5EMYA 3PBWA 1L6YA 4HYRA 1F8MA 3RIKA 2QJMA 2GUUA 5FD0A 4O8RA 4OOZA 4J35A 1AG1O 4A3RA 4FHAA 2WWDA 1UD2A 1JPMA 4GH1A 3VD7A 4DPPA 3E1F1 1VFMA 4N42A 2WKJA 4J3XA 2ZC1A 5H8UA 3CO4A 3DN5A 2CWXA 4B4HA 1I2QA 5I7GA 4YTQA 4FNSA 2JEQA 1FP9A 1V4YA 4NX5A 4CCEA 3LGGA 4PUNA 4CQBA 1O95A 1VCVA 1RCOB 1I0DA 5D03A 4JFWA 1V6XA 1W8SA 2VWSA 3FJ6A 2G41A 1ISXA 4JFVA 3P61A 1CPUA 1WB0A 1J6OA 2DSUA 1E0WA 1R46A 1EIXA 2PD5A 1CDGA 1QXLA 4RNIA 2A7NA 3QKEA 2LLEA 2QMJA 3A12A 1EPXA 4OTKA 4CNTA 3UXDA 3BDKA 4PUUA 4V2XA 4I6VA 3IJQA 3DYOA 4AMAA 3QHOA 1ZNNA 1B9BA 1J0HA 3ID7A 2VP8A 1GG0A 7PTDA 3H2CA 3B8DA 4UOJA 1L8NA 2ZA2A 1AUSL 3P7YA 1LP6A 5FJIA 4PMNA 1H5VA 1MUWA 4JBRA 3SN1A 4RDVA 2C6QA 3U5UA 5CC6A 1KC7A 4H01A 2BXYA 3O15A 2PGWA 2Z7GA 3PF3A 3E0LA 1OEPA 2CLKA 4DBWA 2PDCA 1QOPA 1LLWA 1EJUC 1O60A 4H3DA 2GVJA 4JN7A 4GI9A 2HPMA 3VIKA 2A3BA 1JEZA 3NQ7A 1VFSA 2G3IA 3BG9A 4DN1A 1Q6DA 1S5NA 1TMLA 3ARUA 1OCBA 1IT7A 3MANA 3E0WA 3FDGA 1EJ7L 1G1YA 4FP1A 4DXVA 1H0GA 2OWWA 2WBKA 5C55A 3W85A 2CZ5A 3T44A 4LUTB 3QHMA 4BI5A 2WKGA 2X09A 4CQ9A 1G69A 1XPYA 1U30A 2GGGA 3PM6A 5FSEC 1XV8A 2WJEA 3H2AA 1NU5A 4AWUA 5LNRA 1Q85A 1T41A 3H4XA 4PUEA 1JUKA 3VMOA 1TTJA 3IV8A 2EKGA 5I24A 4FXSA 4WKFA 2D20A 3W1MA 3S83A 1OFDA 2JKPA 3NQ2A 3MC5A 3A5VA 1MEHA 1MW2A 1V08A 4PRWA 4IMEA 3WLPA 4XO6A 4GYKA 1PCKA 4LTSA 3GXTA 4U5KA 3M43A 3OOQA 5A6BD 3URNA 2C0AA 3E6EA 3W87A 3VKJA 1GYNA 1IXQA 2GQAA 3QZEA 3VIMA 4ICCX 2GGJA 3M16A 4RK8A 4FX7A 6REQA 3P2VA 2WNNA 4OU1A 5DXXA 4JEQA 4O0KA 4RE4A 4ZODA 1BXCA 4XVEA 4LSBA 1I45A 4A29A 1OWQA 1WKYA 5MHBA 5GJPA 2VUNA 4QS6A 4F79A 3ABXA 2NQHA 3EPOA 3QXBA 1KTNA 1H7RA 3VUSA 1WXJA 3TTOA 1H4PA 4REQB 1BRLB 4RE0A 5D9PA 3KS5A 2VFHA 1UC4A 1XLFA 1S2UA 4KRZA 2OU4A 3ATYA 4WXYA 3EWZA 3UT0A 4DYJA 1P48A 3VD5A 3ZSTA 1YLVA 4YWIA 3LPOA 4CNUA 3ONCA 4AF0B 5FACA 4PE8A 4FNPA 5EMMA 4ICNA 3TTYA 5CPOA 3E12A 1VZWA 2QV5A 3BLOA 2OEMA 1HGYA 5A6MA 3MUZ1 4KIRA 1A3XA 2Y4SA 3UGVA 1SJDA 3EB3A 3B8VA 1EF2A 4GJJA 4KGLA 2IXVA 1VPQA 1MVYA 4UQ9A 3VOJA 1AJZA 4ML4A 3NR0A 3F4DA 4PB5A 3UXLA 1IHIA 2Y89A 4BA0A 1Q45A 1J8VA 1JPKA 4GPNA 5IFTA 1K6WA 2YBUA 1KFKA 3CWNA 1QUMA 3GIPA 2OQYA 4A3YA 2FB3A 3AYTA 4WSHA 1Q6OA 1Z8AA 2Y88A 3T0CA 3DESA 4YVPA 3ZJ7A 1YPFA 5B7YA 4Q8QA 3AZSA 4JTGA 4MAZA 1R87A 4GY0A 3VIHA 3B40A 1DXEA 1VQTA 5M1TA 5LSMA 3E2RA 5M2FX 1RLDA 3ARWA 3S3GA 3PNUA 4ZR8A 4K6AA 3N4AA 2AQOA 4PUDA 3T1GA 1H7PA 1M3UA 4DO4A 2O9TA 4AW7A 4PYSA 4NU7A 1Y65A 2BZNA 5K2ZA 1R85A 1XYLA 4MKSA 3EMCA 1ZSXA 2J7CA 3USZA 4G8TA 3P8IA 5BRBA 3GTIA 2DSKA 1BG9A 1BWVA 1RA5A 2PRHA 2C1GA 3R0KA 5CPQA 1FH7A 3AI0A 4H04A 3S42A 1M9HA 2JE8A 1TIMA 4DM2A 4YHEA 1KCXA 2C1IA 2JALA 1K3UA 3OVGA 2DH3A 1WZAA 1C8VA 1J96A 2D0GA 1JNDA 3UCDA 2NWRA 2XINA 4AZ7A 1Z41A 2Q8ZA 1B1YA 3NZPA 4DAFA 1J2BA 3BGAA 4LS1A 3IVUA 1H7XA 1F7BA 5A94A 2QDDA 2Y63A 2J6VA 4ZQNA 1EBGA 1G4PA 3FEMA 4US5A 2YW3A 3TONA 1AW1A 3R6IA 3OGSA 4LEFA 1W5NA 3MV11 4B90A 5U7SA 3L0GA 4PBGA 3PSVA 2YCLA 3C52A 3KLKA 4IF2A 3RJXA 3BO9A 3AOFA 4J2MA 3HMJG 1VFLA 4IXHA 4QJ5B 5A2CA 3VGBA 1JG9A 3GDRA 5AB3A 2XIMA 1ODZA 2PEVA 3PP7A 3WMCA 2Z4GA 3S8HA 1KV8A 3S4TA 2NXIA 1OGBA 4FA3A 1JYVA 3NM3A 2BHUA 4Z1DA 1M5WA 2VO5A 4W89A 3S46A 4C6LA 3G22A 1SW3A 1M68A 3ZM8A 4D6FA 3QGAC 3TN5A 3DENA 4DJDA 2JKAA 2V5BA 1KTBA 3FGCA 4JQ1A 3PFMA 1RCQA 5JH1A 3TAOA 1E71M 4OBSA 4ZO6A 2OSWA 3NA8A 2OZ3A 4EACA 1XYAA 1EQCA 1NQKA 1K9TA 5D33A 3SIZA 1EDGA 3PUOA 1W2VA 3H23A 4O1DA 1W1TA 5HPOA 5AHFA 3LM3A 3W6MA 3TLLA 2E8YA 4MB3A 1ZPTA 4HPJA 2ZX5A 1GZGA 1C8QA 1UHVA 1ZJIA 4KW2A 4Q4SA 1EC9A 4AIUA 3QPYA 4LBSA 1JL8A 1HP5A 3C8FA 1I4NA 2ZE3A 3BANA 1YXDA 4IIFA 1YHTA 1T96A 2DJXA 2GJPA 4PUKA 3A5FA 3RRAA 4B16A 4XKMA 1QK0A 1FXPA 1CB7B 3GU9A 5D02A 1ITUA 3GU2A 2VCCA 3GZAA 3MCMA 4ATLA 2YA2A 2ZXDA 1RXOB 4UR9A 4F0RA 4ZSUA 5XINA 2J79A 4AVNA 3WQDA 3STPA 3M5VA 3N13A 4H7CA 5CC7A 1A47A 1EZWA 2P5NA 3S0CA 1XLKA 1V0LA 4UNIA 4JOMA 4IPJA 1UUMA 2R1LA 4O1CA 3M0VA 1F73A 4O50A 3SRKA 4UFIA 1T6MA 3WUFA 4Q8OA 3WH8A 4GIAA 2OEJA 4YNGA 2GUYA 3V0SA 2G97A 1QDSA 2VGIA 5HR7A 4Q8NA 4JIEA 4JFSA 1DHKA 2D0HA 4UB9A 2ZA3A 4DEFA 3QLDA 4U33A 3SZ8A 1THFD 3MVTA 3PWIA 4Z1YA 4F40A 3P8JA 1Y8BA 3PPHA 2BXVA 2HNEA 3VNJA 4QFUA 3PZGA 3AMCA 3BV4A 1EJTC 1XFBA 1XW8A 1OFPA 3LN3A 1W3LA 2ACUA 2C7FA 5I79A 1VJIA 3TN6A 2QCNA 3ZSSA 4ENLA 5MKGA 4Z2KA 4HOZA 5C9WA 3WLJA 4L7ZA 4HOXA 1CGYA 3GX9A 2DVXA 1FHUA 4ACZA 2EPKX 1SU5A 4KQNA 3VD4A 4QIUA 5I3JA 4ZXOA 4EIVA 2W4XA 3DKJA 1K7EA 1OC6A 1KM6A 2FZ9A 2Y2WA 4MLJA 2V82A 1DTUA 2XVGA 4MKNA 2B31A 3QLLA 5LIXX 3U7VA 3VFLA 3IUIA 4LV4A 4DF0A 4IZGA 3JW7A 4MZ1A 5C9UA 3TK7A 2OFJA 4Y2WA 1M6JA 2A1YA 1KXHA 3PFRA 3M4HA 3GW3A 5HMSA 2CLOA 4J5NA 1CZ1A 2DZXA 3NZQA 3H6OA 3A22A 3A9BA 4CU7A 2V38A 3CQKA 1TTQA 3W23A 2QCDB 4NRSA 3TZFA 4ORMA 2NXHA 5A8PA 4IMFA 3B9OA 1VPYA 4KEUA 4S3EA 5T9CE 3C2RA 2Z0IA 5I03A 3VABA 2VCAA 4L80A 4B5TA 4NAEA 4DBEA 1N2VA 1VYSX 1XYMA 2Y5JA 4GBUA 3AXIA 4FOUA 1ECQA 3HGRA 3MSDA 3FVMA 1YRRA 3RMEA 1OFQA 2E7FA 2V3GA 3W37A 1GZJA 3PPFA 3B0VC 1U5VA 4V27A 1AW5A 3IWPA 4K7YA 2RJGA 4PTXA 2CERA 1GVSA 3MUCA 1FWCC 2DUAA 4QE1A 1TPVA 1JI2A 4YLWA 3DHPA 4ZA0A 4GIRA 5HQMA 4XQ6A 2IKJA 2ZUWA 4B5NA 1HJQA 4O0ZA 2CLPA 1MNZA 3WH6A 2FPTA 5I3GA 3AXHA 3WQOA 5A2AA 1W1VA 2D69A 1P6CA 3WMBA 4U4MA 3VX1A 1W5OA 1DL3A 1YNPA 4A6GA 4DZAA 1TPUA 3H22A 3CL8A 1YEYA 5AC5A 4Z2LA 4B5XA 1UD8A 2HSAA 3MBDA 4IUGA 2FZNA 3FA5A 2WVTA 4NHVA 4N7QA 1EYWA 3FIGA 5D2WA 3STEA 5E5CA 3MKKA 4GMEA 5TBOA 3ELFA 1XCFA 3CZLA 1EB3A 1V7AA 4JQ2A 1VEPA 2E6DA 4CN1A 2ZUMA 3KVLA 2P8CA 2QMKA 4YVVA 3ZMRA 3KDNA 2ISDA 5LYRA 2JGQA 3L2LA 3T09A 3WNMA 4ZQMA 4U3CA 3EMZA 3TMLA 2DPEA 4HU4A 4P7RA 3S2CA 1SR9A 4L61A 2VYOA 1KD0A 3L2IA 4JEJA 2A0NA 3A3WA 3EWBX 3U2ZA 1LBMA 3MHUA 1DYSA 1NFGA 1DJIA 1VBHA 4HK6A 3GVQA 3SUTA 4B2DA 1OC7A 4JXCA 1N82A 3QZAA 3G6MA 1BWLA 3EWUA 4Q8WA 3UU0A 4GNJA 3RLHA 2C18A 1SFSA 2KAUC 5DCEA 3BURA 3HPZA 5F2GA 3ZR5A 1ADOA 3AS0A 3DOPA 2CCRA 5HBFA 4GVFA 4GXMA 2AGKA 4D6IA 3LXCA 4BS0A 4UNLA 4YWSA 5K9DA 5A3HA 1NAL1 2WK2A 4UTTA 1KFBA 4S39A 5F4XA 1FUYA 3N3MA 4WRHA 2FZDA 4KEMA 1SZGA 3N25A 3LLFA 3H7UA 3PS7A 3PPGA 4UFKA 1RJPA 5EL1A 2Z1WA 5EY5A 3TC7A 3H2OA 7XIMA 1AJ0A 4IFKA 4QQ3A 3RRXA 1KXVA 3ARSA 1B3OA 3N9RA 5H1WA 5FJRA 3T40A 2HTMA 2D2OA 2PDQA 4QCEA 4QG9A 2D24A 3EXTA 1TWZA 2Z1SA 1NF0A 5AN7A 1V6YA 3N6QA 3ZYZA 5LIUX 4GYPC 2O9PA 3W02A 4AWSA 1UH2A 2FTYA 4F0MA 1ZHAA 1RLCL 3DFPA 3MSYA 1AA1B 2EPHA 5DF0A 2YCLB 5C2XA 3VM7A 5ABEA 4IISA 3PBMA 2YL8A 1EQPA 1DJNA 1U1JA 4LY8A 4B15A 2VZUA 1UUOA 2FMNA 3IIVA 4D1JA 1VJZA 3WL1A 3KOWA 4M6VA 4HMDA 2VHLA 1ZAIA 1G5AA 3QYQA 3S5SA 1M7XA 1KLZA 1UPMB 2OQHA 1VBUA 4DELA 1JDDA 3C86A 3KRUA 2YA0A 3VDHA 3DHFA 5XIAA 2Y8VA 4HNOA 3LCIA 1LLZA 4O12A 1B3YA 5DMMA 2E3ZA 4V33A 4WY0A 1DIEA 3VA8A 1F76A 4H2HA 1EYEA 3MQTA 3W2JA 3NSNA 1S1RA 1FWWA 3ARYA 3W70A 3NL5A 1CBGA 1XPGA 3DI1A 2ZIDA 3MBFA 4GO8A 3VGEA 3W88A 3A4JA 1DE5A 2XDFA 3GD6A 1FTXA 3ZJ8A 4HGXA 4QAWA 4QNEA 4MOZA 4L9XA 4P7NA 3CZKA 1FFQA 5D8WA 1HW6A 3UD6A 5E0KA 4FB7A 3G8EA 3THQA 3NQ8A 2NX1A 3PB0A 1LOLA 2Y7GA 4AHQA 4YS1A 3GXPA 1RQHA 4MPQA 4J3WA 2XSXA 3POCA 5CEWA 5K9XA 2VC6A 3N15A 3MUAA 1QNRA 3AQUA 4X2PA 4ZQOA 3RCMA 2YXXA 3KVMA 2VX7A 4JR5A 2P3EA 3RCNA 1TA3B 4QROA 3DFHA 3TSMA 1KR1A 4HIBA 1W9PA 4H8UA 1GOOA 4Z2JA 4JIIX 3CUGA 4NI8A 3ZR6A 4UQBA 4YTRA 2H90A 4AX7A 1RPKA 3T4CA 3TYUA 4BWLA 3A24A 3NG3A 2WVUA 1NDWA 3KBJA 1Q5MA 1UD3A 1XGDA 3KVKA 3BXWA 3RR1A 1EC8A 1FWRA 3NOEA 2ZXBA 4KFNA 1UR8A 1PDZA 1AW2A 4JTSA 4NY2A 2PWUA 1TWDA 1FP8A 2VURA 2XGZA 5CZJA 1H1ZA 3TCEA 2QEZA 3WQ8A 2V2CA 1HJUA 1G0CA 1ZS2A 2ACQA 1FY6A 2JQXA 4HMEA 1W32A 3HPAA 3DDMA 4RNHA 1UH3A 1OD8A 5DMYA 4E6MA 3RR4A 3RMJA 4E4PA 1DJGA 3B0YA 4RR4A 1F9CA 4W88A 1MRAA 4GX8A 3N2OA 5FSDC 3GG0A 3DFSA 1W5MA 3FSTA 1F05A 4MWAE 3UF9A 3FKRA 3DGBA 3O6CA 3BCJA 1B2YA 3MS8A 1LG2A 4MHBA 4UTFA 3UY8A 1Q2RA 3OIXA 4R88A 4DM1A 1IWBA 4L1GA 2WHKA 3PJWA 1XSJA 2D3NA 1EPVA 3CL7A 1M1BA 3CB8A 4IGNA 3BOLA 4UTKA 3EDFA 3W7NA 4V15A 2PDPA 2VFIA 3CHVA 2X0SA 2YCKX 2YFNA 1TWWA 1YPXA 3MDUA 3FEQA 4PCNA 3ARZA 4FZIA 2ZFAA 1BKHA 3N1AA 3PR2A 3EXSA 3F4WA 4W8LA 5E0CA 3OIHA 4HMCA 4W9TA 1R3SA 3ZWSA 1A5KC 2YB4A 2ZBTA 3FNDA 3OHIA 2AL1A 2KX9A 1P7TB 2NVDA 3SADA 2X1IA 4H6KA 1AL7A 2QYGA 2ZUTA 4C7DA 4Y6GA 6REQB 2CLHA 2BTMA 5LA2A 3UNDA 3S2NA 1VKFA 3MI3A 2OT0A 3D5HA 1RD6A 4WD0A 5J04A 4C6KA 5LXEA 4O14A 3LLDA 2BY2A 3AIWA 2TODA 2DGAA 2W79A 3TJ4A 3R4IA 2PF0A 3N18A 3PZMA 4D6EA 5TD4A 1C91A 4MYXA 3VNDA 3W1TA 1T99A 3WQWA 3JRKA 3W7QA 1R3RA 3HA1A 4I7UA 4PMRA 4BJHA 4DUWA 5DN1A 5G4HC 1EZ2A 3ITVA 5KETA 3MUXA 1EO7A 5D2VA 2G37A 3RU6A 5K9CA 3AIUA 4J3SA 3T08A 4MB4A 4TV6A 3F4VA 3WFAA 2NZLA 1YNQA 4DJFC 1SM9A 5M5DA 3NTYA 2Z7KA 4E0CA 3LCWA 3W71A 2QVHA 3GBEA 1IIGA 4CD4A 1EUAA 5AC4A 1F5ZA 5FEXA 3UYCA 4L9YA 1K8CA 1QJWA 1DQXA 4CNPA 3L67A 3GTFA 1B54A 1US2A 4WOQA 5H6HA 1GVFA 3MYOA 1FWDC 1DWGM 3NGJA 3MMTA 3W74A 2NLYA 2A3HA 2B4GA 1V5XA 2XYLA 5A6AA 1QPQA 5E9XA 3TDFA 2H3BA 3GG1A 1V51A 2BWGA 3LQLA 1SR0A 3GH4A 2PDJA 4NUWA 3RGTA 2VENA 3PWGA 1N7KA 2J7DA 2F38A 1OK6A 3CUIA 4WEVX 5JVLA 1K77A 3AYVA 3TW6A 2ZVIA 3U2CA 4Q3MA 3AHTA 3NXFA 3WK3A 2V68A 5HMEA 4QNWA 2ZRUA 3VK5A 3G1RA 3CV7A 1I0BA 2DZUA 3TFCA 2AL2A 4EXQA 4MAVA 4NZ4A 1O5QA 3CEPA 5GPRA 4TX6A 4GGBA 1KGUA 3W0KA 3W83A 1BGAA 2CLMA 5LNVA 3BW3A 4E4UA 5D9OA 3KP1A 3C2EA 3DEQA 3E2QA 3LX9A 3OA5A 2W61A 3WJZA 5CG0A 3S5OA 1AK5A 1H3GA 2ZXQA 3F03K 3AALA 4JNZA 4A3QA 1DV7A 4JTQA 2O9OA 2CBVA 2ISSA 1RUSA 1DWJM 4LV9A 2VZTA 1XLGA 4PN2A 3UZJA 1PZ1A 3C2OA 5LNSA 3V5CA 3EA3A 3CHCA 2PCEA 3POHA 4GBDA 3T2QA 3DIPA 1T5AA 3CUHA 3OA3A 3GAYA 1ONEA 2GQ3A 3QGKC 1UBSA 1KBIA 4O1FA 2E9MA 4F2UA 1WUFA 4ZCWA 2CU0A 1PB0A 1Z6KA 3GNDA 5CSSA 3K8LA 4QG8A 1A5CA 2YXGA 3SCRA 2FHFA 3RLGA 3JVAA 2TRSA 1FH9A 4F48A 1MMFA 3I4KA 3F4CA 4O19A 3MY9A 2V81A 1R86A 2WC4A 1H61A 3LXAA 4RZ5A 1XM3A 2PU0A 4I9JA 4GABA 1FVPA 3B8IA 4TOQA 1XXXA 2F6UA 4XTIA 4YU1A 3SUUA 1JULA 4GUFA 4IGSA 1E1CB 3TN4A 4PMQA 4US5D 2DZSA 1JCLA 3VCRA 1CXKA 3B9EA 3WQ5A 3KBMA 1LRTA 2QUTA 4ZQPA 1EXBA 4CU6A 4XZWA 4X0VA 5C9ZA 4RNJA 1TV8A 2P10A 2FLIA 2J27A 4JZ5A 2ZRWA 1XLIA 5EPDA 3EYPA 5C9RA 4PTMA 3KTCA 1UG6A 4P8XA 3UNTA 3PTDA 5IRPA 4PFHA 1GQIA 4DJDC 2WMGA 4MADA 1S3HA 4RDYA 1AQFA 4HK7A 4N0RA 4G2DA 1GNXA 1OGGA 3W7MA 1NFPA 1DJWA 3T4WA 2C19A 2HRWA 2PLMA 1JXKA 3ZR4A 6XIAA 2PBGA 3H2EA 4BFAA 1YKWA 4QR6A 4Q4PA 3VDBA 4XZLX 1A5OC 2Y8KA 3M47A 1A50A 3WQVA 4S3DA 3SSJA 3AHYA 3HGJA 4GYPA 3HPXA 4Y8FA 5RUBA 4R7WA 1HKMA 1VF8A 4XISA 3WLKX 2EXOA 4QJ3B 4GYFA 3GKFA 3PUEA 1KM1A 4UWMA 3LRMA 3D6NA 2QIIA 2OOFA 3EDEA 1Z89A 2J77A 3N2CA 2BS9A 3M0MA 2V5KA 5DCDA 4BHYA 3MP4A 3TC3A 2CEQA 1TRDA 3RFAA 5TIMA 4CD6A 3M6DA 4H4IA 1XBZA 3S9IA 2OVLA 3LXBA 3I6EA 4E8GA 3UVAA 5I02A 4P7LA 5JH2A 1UBPC 3UEQA 1XQKA 1S38A 3ISIX 3UWEA 3HQOA 3R7MA 3CQ0A 4UFHA 2OEKA 4C6JA 4H9ZA 4UTTC 3C0SA 4AXNA 1W9UA 4UZSA 3L4UA 5A5WA 5CSUA 2A5HA 2EQDA 2YDRA 2QUMA 2IW0A 1XCXA 4I9MA 2GUBA 4PRRA 5D38A 3KBWA 4ERIA 3A6OA 1ZLPA 4BR1A 2QJIA 4YVXA 4DJED 3GB6A 3AZRA 4B5SA 4HU8A 5KMYA 1EXPA 3INPA 4J28A 4MIMA 4PSPA 4PL1A 3QQWA 2D73A 3LHTA 4E3VA 4RUBA 1E4NA 1VAHA 2E28A 1LOQA 3UCQA 2W0UA 4FIRA 3PG8A 4HPXA 3ABZA 4UTLA 2YFOA 3CC1A 1K4HA 1GUVA 4DZ5A 3Q65A 3GZ3A 3CYVA 3TW7A 4M81A 3MMDA 1ZP3A 1PZ0A 3KRZA 4F66A 2IS7A 2BVDA 2OB3A 4Y8EA 1E5JA 3QFEA 3QTGA 5I3FA 2ZVRA 2RJHA 1G4EA 4UC5A 4WOZA 3GU1A 3W07A 4NIRA 1KXTA 4P5UA 3NQMA 1MO0A 5HATA 3L4WA 1TCDA 1LWHA 2H6RA 3HM7A 1XIIA 2R1NA 3CLMA 1TVPA 4IUOA 1A0EA 4IX0A 3NQDA 1BSLA 2WQDA 3C4UA 3L68A 2VXNA 1A4MA 1XI3A 2Q02A 3LENA 4HTBA 2O55A 3NFUA 2OSYA 2PC4A 5CJ5A 4O17A 3BAYA 3NEVA 4ZE5A 4ALDA 1T0OA 3C56A 2WZEA 3WSUA 1P0BA 4LEQA 1UIOA 3PUGA 2VKZG 4ZOBA 2RDXA 2WJZA 3M46A 4I9TA 1UWUA 3VI2A 2PS2A 3BC9A 4H9XA 4LAZA 5CJMA 1A5MC 1KGWA 5DELA 4JFTA 4WDUA 3HQ1A 1OG0A 4G1KA 1E43A 2Y5EA 3ZT7A 1KLYA 3DFQA 3S1WA 2JIEA 4O1EA 3IUDA 4HPNA 1KBKA 4PR4A 1Q13A 1O4UA 3LV6A 3RAOA 4X61A 4HMNA 4IT1A 1BLIA 4J3TA 2CZVA 2ZXAA 4DBDA 1R3TA 1RJQA 3B9DA 4IQLA 4TIMA 3RLVA 4MDPA 5DMNA 3DFOA 2RHGA 4OE7A 1DHPA 4RDWA 1ADDA 3GW0A 4K1GA 4MM1A 3EKLA 3SUSA 2QF8A 2JBMA 3PZTA 1YTEA 1SJBA 3B03A 3AYRA 3H7VA 2J75A 4QHRA 3U4FA 3E9AA 3AIQA 5CBBA 4QGCA 5E6ZA 1POKA 2WLZA 1K7XA 3HZ3A 4HNVA 5I23A 1J11A 3W7DA 3S5ZA 3IJ7A 1J10A 2X0HA 3N9KA 5DRIA 3GVVA 1YNYA 4CCDA 4O15A 4KPLA 1VC4A 3NPXA 4D9PA 1WDWA 3C5QA 1Q63A 4BI7A 4EPKA 3OVQA 4IMDA 2DIKA 4X3ZA 2NX9A 1SPQA 3UQNA 3HJEA 3RUBL 3CUXA 4REQA 2GOUA 1E9ZB 1DWHM 1UZ1A 1P7TA 3G0SA 4GVHA 3GAKA 3NQCA 5AFDA 4ZTXA 4Q22A 1IT8A 4EPEC 1EH9A 1GTHA 4KGJA 1RD5A 5FOOA 1SO4A 3K2GA 2BLEA 2W91A 3CUFA 3MU7A 1GCYA 2DT3A 1VRDA 5BYWA 1W3IA 4B9ZA 5A6LA 3N2MA 1J93A 3BLEA 3DI0A 4GCXA 4B5WA 4UCGA 4R33A 3W38A 4AQLA 5C0QA 3LI1A 1PJ9A 1G9HA 1TX0A 2Q3RA 3UG8A 3VFCA 1HQTA 2VX4A 3PBUA 3PTMA 1E1FA 3GYCA 2VX6A 4GG9A 1M04A 2XTKA 3AIVA 4O1BA 3GR7A 4FR6A 5LHEA 2E77A 1M03A 2ISFA 2QAFA 3R10A 1UD4A 3DH7A 3QPZA 1QWGA 5AVNA 1XLMA 1I75A 2QF7A 1VIWA 4BQ2A 1KXQA 1Q8JA 3AC0A 4DWSD 1T7LA 4CD8A 2QUNA 3W01A 1Y7VA 3WDQA 4EOUA 3MMUA 4U2YA 1MZHA 4PCPA 2J8FA 1IWAA 2DW6A 4ZQCA 3R25A 2GGIA 3WUBA 3ARXA 2HXTA 4QSFA 1BPLB 3QVQA 5CJNA 4FF7A 2IPJA 4L56A 4W84A 4YJ5A 2CNCA 1CT5A 1JDEA 2QUVA 5C8BB 2DZWA 2NSOA 5KINA 1C29A 1TREA 4LNYA 3VKCA 5HQLA 4UTJA 2HXUA 3BQ6A 2ZTJA 3RU8X 4AWEA 1NJJA 3CJPA 2FGLA 3XISA 1F3WA 4H9TA 5D05A 4NAFA 3W7GA 3CGTA 5JIPA 1VENA 4TVCA 2PMQA 1DIDA 1VBGA 5AC6A 2A7PA 3A4XA 2DZTA 3P80A 4QG6A 3CS2A 4CQCA 1E0UA 1OVDA 2PWHA 1HKVA 1RHCA 3L7RA 5BOFA 5BOEA 4LCSA 4DNMA 3DG7A 1YTKA 5I2UA 3L4TA 4IQEA 1Q4WA 4IH3A 2OGYA 5DFAA 2A3EA 1W31A 1IR2A 3TC6A 4WDXA 1U5JA 3MA8A 1ZU8A 3AHZA 1JCXA 4PSRA 4AD3A 1VLIA 3LCFA 1TQJA 3WNKA 1IEIA 2X1RA 1TUFA 4PUMA 4L6DA 1E4LA 2YDAA 1JPDX 5I09A 4FPSA 2XFFA 4NG3A 2GVLA 4R7OA 5DBUA 4PMYA 3AHXA 1BVWA 1Q3NA 3C6CA 4MWAA 3ZIZA 3V3WA 1GQNA 1LF1A 4RXFA 1ODUA 4CKQA 4LU0A 4CEXC 2BB0A 2ON3A 3SJ3A 3HPSA 2P1FA 3B9NA 1RVKA 4G9PA 3UWWA 4AEOA 3LTPA 3UW6A 5D2YA 3CWOX 2JFEX 2Y8UA 5D32A 3WD1A 3G8RA 3N4EA 4MNLA 4WGXA 4DO6A 3N2BA 3ZQ9A 4OVXA 1U5HA 1W9BM 3BJFA 1X97A 3TXVA 4XSLA 3WF4A 3MUIA 4WSKA 1UC5A 1MDRA 1NVMA 7REQA 1TPC1 3M0XA 3G1XA 4CUCA 1GQJA 4ZB0A 2QAPA 4NJHA 5AHNA 1Q7ZA 3PTQA 3VIIA 3G6LA 2NWSA 2ICSA 2HCVA 3RCYA 2BY1A 3JU2A 1EWEA 1J9YA 3VD3A 3PZIA 1R2TA 1KRAC 1MXGA 1FDJA 4JTAA 4KETA 3SDOA 4JTDA 5D4YA 3TYAA 1LRNA 3ITOA 1ZBKA 2NUYA 1BSIA 4EAMA 2UZ9A 4PL2A 4ADSA 4GA8A 2PDLA 4KEVA 3B3DA 4DUVA 5F2LA 4Z08A 3NVDA 4AAJA 3P67A 4K8EA 3H21A 2Q6ZA 3WNNA 3BARA 1EWDA 1A0CA 8RUCA 4BQ3A 1UQYA 4CN6A 3N11A 2CETA 4XAGA 3GFXA 3UXAA 1BRLA 4JTCA 3ZVHA 3NZ1A 1GONA 3LPGA 4WJEA 5HK4A 1PXGA 4KWVA 4PTWA 4QXIA 1LCOA 4JTJA 5CCZA 2G8ZA 1PEZA 2ZZ4A 4R3UA 1KFCA 1XYBA 3QQ1A 2ZICA 4QRNA 3UP8A 4L9ZA 3LK6A 1EX1A 4DF1A 1EUNA 3UZ5A 4M24A 1S39A 4D1IA 2WC7A 1V0MA 1JZ3A 2F8QA 1UR9A 1QPNA 3NAVA 4AY8A 3T6CA 5K4ZA 4C91A 2X41A 4RV3A 4JX4A 3OBKA 1HJWA 4RE3A 3FAWA 3L0KA 1WDDA 2X16A 1H60A 4WZHA 4ASTA 5BCAA 4IL0A 3UZZA 5FJUA 2Q8XA 3GDBA 2QDHA 1REQB 1W3NA 1XL9A 1PUDA 4ZE4A 4IHCA 4YTSA 2YYUA 2P88A 3S1XA 3IJ8A 1JYXA 3OTRA 3K8MA 3IARA 4GO9A 3CHDA 4H8NA 1KRCC 3SGZA 3W7CA 2IMRA 1FCQA 2XM2A 1M41A 2QQ6A 3KLLA 1IT0A 3UFYA 1OF8A 1KTCA 1AFSA 1AMYA 5A8QA 3DHUA 3U0HA 4XX6A 3RDKA 2DIJA 3VOCA 2A79A 2HJPA 4FLRA 2FZMA 4PODA 5FAGA 4LRTA 2IPWA 1FQ0A 1X6UA 3E2SA 3OU8A 1P0KA 1ZBWA 2XFRA 4PCFA 4BF5A 5AY7A 3K46A 1WUEA 2XZ7A 2HE8A 4AWTA 3QMTA 3EEGA 4OFCA 4XSMA 3HBLA 2XIOA 5I6SA 1UWIA 2BNJA 3MCNA 3TTEA 2I57A 1NTHA 4AZHA 4GXPA 2E40A 3AMGA 3DFNA 4W8AA 4JTIA 5JUVA 3O6YX 3IGXA 3NL2A 3TYBA 3OZYA 4JIHA 3THAA 4NZ5A 2PFHA 2YBTA 3TTSA 2EPNA 4QE5A 1CLXA 4XV0A 4CEUC 1NWRA 3LBCA 1RP9A 3L66A 3MMWA 5T9BG 1GHSA 3FHAA 3WD3A 4WDTA 1NH6A 3LNMA 2OO6A 2VQUA 4FNTA 3VZZA 3VOHA 7ODCA 2E9LA 2J25A 4ECLA 4O4WA 3WL0A 1WOAA 4XZIA 3HO8A 5I3DA 4FX6M 2YR1A 5IDZA 3PVFA 1EHAA 2PP0A 3VKBA 4BF7A 4MJMA 1WAUA 4WVXA 3WK0A 2CYGA 1H7OA 4H9YA 1B31A 4M5PA 4JL2A 1BXBA 4N4PA 1TJRA 5C2CA 3EX3A 1LOSA 1OX5A 5EA9A 5H8PA 4WCJA 1EEXA 4LWWA 4W85A 3UR2A 1BEUA 3G1SA 1HKJA 1S1PA 1DWFM 3EX4A 1L9WA 4CD7A 1J5SA 4AY7A 4EX4A 3NO5A 4P61A 3FVDA 2NV2A 4MNMA 1AODA 2E67A 4A05A 3VOIA 4AYGA 2VRKA 3E3HA 2I5QA 4C60A 5AKQA 3URBA 2WCGA 3T8LA 1WCGA 4D8ZA 2BFGA 3KFTA 5HNNA 3M0JA 3PG9A 4C90A 5CPSA 1CX9A 2CPUA 3VOGA 3AAMA 3GUGA 2ZRZA 4AD0A 4DJFD 2IQ0A 2UY3A 3GBDA 2BASA 3W00A 1XSIA 3VNLA 4I3GA 5LZLA 4LF1A 2V67A 1NF7A 1XP3A 2QLYA 2ZRXA 3ABSA 3WELA 3ECQA 3P5YA 3ZXWA 8XIAA 1Z44A 3DYPA 4F4RA 2R24A 2W63A 2B0MA 1TE1A 3CAKA 1VD6A 1E0TA 3I3BA 4E8CA 4AYSA 4MB1A 5HNTA 3QMSA 2ZKMX 5BNKA 3G3MA 2C1HA 3BICA 4Q7NA 3BE7A 3RITA 5HWJA 3JUGA 2PD9A 1DTNA 2EHHA 3D0CA 3A3HA 2DIEA 4BF9A 3PZ9A 1TPDA 2C3ZA 4IX2A 1Q7QA 2ESCA 3GR8A 4DI8A 1VH7A 3WNLA 1CIUA 2GSHA 1TR1A 1TPEA 4LVAA 3WX7A 4HPHA 3W1QA 1GKRA 1TE6A 3LRLA 2VVNA 2I9EA 2POZA 5G5IA 1UR0A 3H2NA 3CZJA 4F0KA 3M1ZA 1WE5A 3RPDA 3C0QA 1EGMA 1F3XA 4QM1A 4H7VA 3IAPA 4Q8PA 4DBUA 3W72A 3BAKA 3S9YA 1Z9AA 4MUZA 1QOXA 1CGTA 1XD0A 3S9ZA 3P81A 3UCCA 4WXZA 1D3HA 1S2WA 2RKXA 2Y24A 1QK2A 2RGMA 3W81A 4W8BA 1LBLA 5I78A 1DE6A 4M0XA 4MPKA 5A69A 3W7RA 1TTPA 1Y5VA 2FTWA 3FYYA 2XN2A 4G7FA 3P84A 2JK2A 5XIMA 3GVGA 3WG6A 2HE5A 3A4WA 3W7LA 2PURA 4HB7A 3TAKA 4RNFA 1P43A 4AD1A 4LVGA 4LB4A 1ADSA 1R0MA 4HCLA 3W86A 3RM9A 3HTWA 3HG4A 3BLLA 1FWNA 1SSDA 5CZTA 4H6RA 3BJTA 1KRMA 3WLNA 4Q8UA 4M6UA 4NAFB 1LL4A 3IIPA 2AQWA 2ZX6A 1UROA 3IV3A 4A8NA 1XRFA 3N34A 3U9IA 2ZOXA 5I0DA 1U22A 1PHQA 4LVFA 3M5YA 4C6PA 4US6A 1K8ZA 1E0XA 4HHLA 1J6PA 4LF2A 2FFCA 2O92A 3AXXA 1JFHA 3IJDA 1FBAA 5BXPA 1M53A 2GGEA 3FSUA 3DG3A 5KEZA 1MEWA 1PTGA 1NFBA 4DQWA 2W5FA 1YE6A 2F2HA 3LNPA 5JIWA 4AX6A 2CWNA 2D0FA 1ZFJA 3CIVA 2J7EA 2V8ZA 1RQEA 3EPNA 2V2DA 2Z2BA 1IR1A 1TV4A 3HN3A 3APTA 3PWAA 2HEJA 2V0TA 4Z1CA 7TAAA 3KOYA 2VRQA 4WHBA 4JKKA 1JZ6A 3LDVA 4UQAA 1JZ4A 4OIFA 3CV1A 4TU1A 3I68A 2I7GA 2W62A 2Y0FA 1UKTA 5E9AA 2E5BA 3NVTA 2YCEA 3GIQA 2YCJA 1IXPA 2DZVA 1MXDA 1TZ7A 2ZWYA 1R9YA 3VKDA 2ZZ6A 2Z6JA 5K4XA 2A4AA 5DEZA 3GR4A 4GHRA 5KZMA 1LT8A 4MNJA 2NV1A 4RKAA 2VZVA 3TNBA 2I17A 1V3HA 3DAQA 3SN4A 1R2RA 5AECA 1X1OA 3UERA 5CC3A 1P1XA 4TX9A 5G4EA 4HZ7A 2GYIA 4FNQA 2QIWA 4IIHA 3B8UA 1C8YA 3TH6A 4DWDA 5EMLA 1O94A 4FLQA 1CXEA 1KFJA 4HP5A 4HHMA 1GVYA 1L8PA 1Q6GA 4YHGA 1F3TA 4Q8TA 2CBUA 3GKAA 2PDYA 2FIQA 3MSGA 4JAWA 1P0NA 2UY5A 3WDHA 4OUIA 4XUYA 1ONRA 1R3VA 3JS3A 3VZYA 1GK8A 3L9CA 1NY1A 5FF4A 5HJLA 1I2RA 1BYAA 4AEFA 3P0WA 2XIJA 4NJGA 1QNVA 2OO0A 3S6OA 1E73M 1ISVA 1C8XA 5M17A 5A1AA 1GOQA 5L6UA 1RK5A 3TYDA 2TYSA 4HPGA 1PBGA 2DVTA 5TNVA 5E70A 1BTMA 2I1OA 4JY8A 3AROA 5FF7A 3W25A 4YL2A 1NIUA 1L2UA 3NSXA 4NX0A 3R8RA 3SURA 4C6FA 1HO1A 1XINA 1X7IA 3ARTA 2GK1A 1H1YA 3LMZA 1XIDA 1X39A 1HX0A 3T2PA 1N8WA 4LAOA 1RBLA 1RAKA 1TWIA 4QS5A 3ZO9A 4XD4A 4E2VA 7ENLA 4LUJA 3AO0A 4LCQA 3GNRA 7CGTA 1W2PA 1MQRA 4XZ9A 4C6DA 1E6ZA 3LHUA 1B90A 1AMKA 1CENA 9XIAA 3UZWA 1PX8A 3GNPA 1RA0A 3LZ5A 4E3TA 4Y9NA 3TSBA 3AS3A 1TPFA 4S2CA 1WXYA 1OF6A 1HKWA 2CZEA 3L4ZA 4GUGA 4MJ4A 1ITCA 1TVLA 1CEOA 1EOKA 2QS8A 4HZ8A 3M9YA 4K8GA 3LY0A 1QRQA 4TTUA 1RH9A 4TUFA 3W27A 4A3UA 3NQVA 1NSJA 1W5PA 1NQ6A 1LWJA 3T78A 1GEHA 1QW7A 2XFYA 3STGA 3R89A 4LYKA 1VR6A 3WDPP 4QJ1A 4J27A 1NWUA 2D23A 2PDNA 1U1UA 1TO3A 4C6IA 2H9AB 8A3HA 2INFA 4HNCA 4JTRA 4JCMA 5BXSA 2QHAA 4MY1A 3LHYA 4L5ZA 3YPIA 2YBVA 4MYAA 2G96A 4FLOA 4TV5A 3IPWA 3TXZA 3GXMA 3NQGA 4NZCA 3KL0A 1XSKA 1W9VA 3FW6A 2WZIA 1QHPA 1HP4A 4V1XA 2CW6A 3VIGA 4H19A 1GW1A 1UZHA 2QNEA 1BG4A 4TMBA 4NT0A 1S5WA 2ZDSA 3RX4A 1ELSA 5J5DA 2PTXA 4INFA 2H9AA 3MUY1 1UZ4A 4AC1X 3MWCA 3GC5A 1PKYA 3T8QA 5E6YA 3MCOA 4PCSA 1YE4A 2QT3A 4NNBA 1D8CA 1N8FA 3UYIA 3WLHA 3IK2A 3M7WA 5HNUA 1E0VA 3HFTA 5EFDA 1VLWA 3PZVA 1JGIA 2WHLA 1JQXA 1CNVA 2WM0A 3BAJA 1HVXA 1OCNA 2C15A 3P82A 2XH4A 4RXGA 4AZIA 1YXYA 3SGUA 3H24A 3VC6A 2AQVA 3WMLA 3HURA 5AHEA 2PZ0A 3TQKA 3COTA 2VR4A 1UWAA 4QJ4B 5KZEA 2PDMA 4NJIA 2X40A 1BYBA 2GVGA 3BQ5A 1XGZA 3OLDA 4HBKA 1JD9A 1WX0A 2QJGA 1S2AA 5IM51 3TW9A 3TUUA 5A6JA 4C6MA 2J8TA 2VX5A 1SFJA 4M8UA 1KM2A 4HSOA 3RM4A 3Q58A 3SRFA 3CXOA 3JR2A 4DO7A 4KRTA 3KBSA 3LLXA 1LG1A 3LPPA 4B3ZA 3BMXA 4WY0F 3TYEA 1XUZA 3ERPA 5A8GA 4J9JA 4O1AA 2NT0A 1IEQA 4QP0A 2OSXA 2CESA 3CTLA 2OT1A 5MKGB 4UOZA 1RVGA 4WKAA 5AHLA 3AMLA 3GQYA 2XVLA 1AD1A 4DB7A 4NQ1A 3N19B 1XX1A 3BZGA 4AG0A 4JQ3A 1K7FA 3WLQA 1BF6A 1WAWA 4AY1A 5IBXA 4M6PA 2UV8G 1CXHA 2PP3A 4AXKA 1A5BA 1PX3A 4WK9A 4U3AA 5FF2A 3VDAA 1UP0A 4RZ4A 4DNHA 1B0IA 2MNRA 2OGJA 2B81A 1S5MA 4MMWA 3G77A 4XZHA 2E4TA 1C93A 3W7IA 4C1KA 1VCGA 4HHPA 1O6IA 1FWIC 2DH2A 3DYMA 4EF8A 1LDCA 5G4WA 4CNSA 5CBJA 1E4MM 2PA6A 3GUWA 3QYSA 3I3EA 4C1NA 3PBYA 3CAVA 1O12A 3W7KA 4AH7A 2XVKA 3AUJA 4UFJA 3EWDA 1UZDA 3QR1A 3G2GA 5AVHA 2VOTA 4GZIA 4IP5A 2FB2A 4NRRA 5LA0A 4IJBA 5BMWA 4JCLA 2F61A 2OLAA 3DXIA 3IVSA 3O9NA 2E8ZA 1FWBC 3ZVHB 3KCOA 1ZZMA 4UFMA 1IZKA 3EWWA 3M07A 1W1A1 2QJNA 3UPWA 5C6MA 2F6XA 3LPFA 2J7HA 3SCUA 4E2OA 2X30A 2A3CA 3AZTA 4KFOA 5FIPA 1LM1A 1HL9A 2REQB 3KW3A 2QCMA 3HQPA 1UKSA 4QAIA 1JF6A 2Q09A 2QZRA 3EKGA 4W93A 1QI0A 2G50A 3R5EA 3TROA 4HVXA 2VFFA 1XLHA 5J8LA 1E6RA 2WCSA 2XJ7A 1OINA 4HA4A 1CYGA 3MO7A 2FVMA 2PSNA 2DQXA 2BGSA 2VEFA 3OQEA 4IJRA 2E9BA 3FGCB 3BLIA 4CCCA 2OLSA 4IPNB 1GJWA 5ABTA 3NPVA 2PB1A 1I9CB 3M0YA 5CQ1A 1IF2A 4C7GA 1C90A 2FHBA 3W2NA 1FRBA 5CPNA 1UJQA 4DJEC 3DU0A 3LZ3A 1S2CA 5HOSA 3C2VA 3DZ1A 2DFAA 3P60A 3VGFA 4KH2A 2RDUA 4I9AA 3ARPA 5FESA 2VR2A 4EANA 1HJXA 3UA4A 2GJXA 4CQAA 3I3DA 4JTKA 4MB5A 5LKYA 4L1XA 1Y5WA 1EEPA 3RO6A 1PSCA 3THUA 1OHLA 3GNOA 2CZFA 1TV2A 3EGJA 1CLVA 5CLWA 4I8YA 1MQQA 2PLCA 5F2MA 5AYIA 3LHZA 3B97A 3BTNA 1XD1A 4CVUA 4BZYA 3IJ6A 5HINA 3MP3A 4S2BA 3HU7A 1UWSA 5AC8A 4LYQA 3OLGA 5M3WA 4UMAA 2VRJA 1KWKA 1YIXA 3CQJA 5FL0A 3HJZA 1LJYA 2DORA 3EXRA 3VDGA 1LZOA 2XIIA 4O10A 1UIPA 1Z48A 3B4YA 4WJ8A 3SY8A 3TFXA 3WDRA 9RUBA 4LT9A 3W82A 1GJPA 4JGDA 2MUCA 1TVNA 4GACA 4XD3A 1PVNA 1UKQA 3PHAA 2WHJA 3TR2A 1US3A 2R94A 1KV5A 5D30A 3QY7A 3LERA 3D3AA 2WB5A 4K3ZA 3WK1A 1Z3NA 4Q4KA 3NDZA 3WD0A 1K4GA 5CH9A 1LQ2A 2OZ8A 3K4WA 1I2NA 2EGZA 1TWSA 2HROA 4D71A 2XPKA 1TJ2A 4GUHA 2ZRYA 1O7AA 4O4VA 2VI0A 4QDMA 4N9DA 3NURA 4UFLA 5AZ1A 2QGHA 4MWAC 1N8IA 3UESA 3FV9A 3FY1A 4DIAA 3VX0A 2ZUUA 1TMQA 4C6QA 4F9JA 3W6LA 5IXEA 4GQQA 3EX6A 2Z6IA 4CQ8A 2GDVA 1A5AA 3AS2A 4R5EA 5GJMA 1JCNA 2YSWA 4Q6XA 2VELA 1X1ZA 4DI9A 1J5TA 3M0ZA 3KE0A 1XRVA 4GFSA 1OK4A 3KXQA 3UG4A 1ZBVA 4GOAA 3GIYA 2HK0A 3AIBA 3GHRA 1HN1A 1SYTA 1E70M 2QVNA 4XBKA 3SIMA 3PSWA 3PNZA 3C3UA 1VYRA 2CZDA 2D2GA 1M7PA 2EEXA 4JFUA 1US0A 1W1PA 3B0PA 3S47A 3SY5A 5GNXA 1NELA 4FK9A 1ML1A 3FA4A 3TP4A 3UY7A 2XUCA 1XF0A 1EL3A 5I07A 1OX4B 1EGZA 3WUGA 3WKZA 3BAIA 5CGTA 2I5GA 2Z29A 3MW7A 3R94A 2BOFX 1WZMA 4KCWA 1WDQA 3BG3A 4UR7A 4DUXA 1FWHC 2WZMA 4AISA 4GC4A 2YLLA 2NX3A 4XD5A 3WEMA 2WPBA 2HS6A 2CLLA 1P0DA 4M19A 3W1PA 3R0DA 4IL2A 1TMHA 4IPIA 1G4SA 1H62A 5I3HA 2ALRA 3VKKA 4RPQA 4M51A 4POCA 4OWGA 1H41A 4WIWA 5G1MA 2RDTA 1T8XA 1XC6A 5HAOA 4DVOA 1XKJA 1EP3A 3EOUA 3OZOA 4LYPA 4GD0A 3ZJKA 2PC8A 1JF5A 4BQ4A 4JDYA 4B9YA 4MWAD 1TJ0A 1MNSA 1RQBA 1JJKA 4NVTA 1OT1A 3UR5A 1LQ0A 3GTXA 4JX6A 2J78A 3VKAA 4L65A 3PZNA 2VM8A 1RY0A 4ES4A 3LB0A 2DY3A 1Q2SA 4K37A 5IFPA 4YTTA 5GQBA 4PMDA 2WMIA 4GWEA 3URQA 1K9FA 3SM0A 5ABFA 2VOMA 2X1SA 7A3HA 2NQ9A 3O6DA 3LUTA 1D9EA 2VGBA 3EDKA 3HG5A 1QI5A 4KCUA 3UETA 4AD5A 1V02A 4TXEA 3WQGA 1RJRA 1A49A 3OGRA 1VHCA 4TX8A 3DG6A 2WMIB 3SCVA 1JIBA 5DT7A 3REQB 1QT1A 1R9XA 2GFTA 3SQSA 5EMKA 1EGVA 3WENA 5G1TA 5F4SA 1EBHA 3LTSA 1TZ9A 4LAUA 4J1OA 2FZBA 3EX2A 4N2YA 3A23A 3EAUA 3AXKA 2HVNA 1MI3A 3OZPA 1KFWA 3EWCA 3QN3A 4PMVA 4GVIA 3W28A 1PL9A 3PK7A 4GCAA 1S3TC 4FR1A 4UBPC 2PLKA 2DV0A 1JZ8A 3IJ9A 1QFEA 4NZ1A 3I7SA 3BCDA 1QW8A 5AHIA 1MZRA 2CKSA 3CV6A 1XGEA 3SECA 5FA5A 4HK5A 2E5CA 1NOUA 1GOKA 1FWJC 2E6AA 4GI4A 3EWYA 5REQB 1FX6A 1MUMA 4WQ6A 1F4AA 3AWOA 1K03A 2PRMA 1XS2A 4TVUA 5ECUA 1SO5A 4QITA 3BLFA 1QR7A 2R1MA 3VAVA 2QCDA 4URIA 4B92A 3BSHA 4ZQRA 4C1NB 4DWSB 1SSGA 1XRTA 1Q6EA 5M03A 3ATZA 2XN0A 3IUHA 3VO0A 5EYWA 1ISWA 5DLCA 4ZSTA 4QQUA 3FXGA 1JRBA 4UTWA 5HWNA 1Q6FA 1TTIA 4H41A 5C70A 1XIJA 4HNLA 2EPLX 2X7VA 4MZ8A 1QAPA 4HU0A 2J6XA 1W5QA 3TVAA 3W2KA 4I5UA 2WSRA 1BD0A 1EF3A 3QC3A 2FH6A 4N9BA 3PJTA 3SCNA 3GM8A 4PMJA 3RG6A 1V8EA 4QTGA 2YPIA 3MPGA 1TA3A 2Z27A 3ARVA 1VYPX 2XH7A 1QI3A 3EMQA 3NQBA 3QHNA 1J0KA 1PV8A 3I65A 4JTFA 2BVYA 3M5ZA 5ABGA 5LXXA 2YA1A 1YDOA 2Z28A 1FOBA 3W1UA 3M41A 1G6CA 3EOEA 3PZOA 4OBRA 1GGOA 3UR7A 4RE2A 1HL8A 3ITYA 3VMPA 2JIWA 4JKMA 3CPUA 4ZB2A 2GSEA 2ZADA 3TSDA 9CGTA 1R8LA 2EAWA 2BODX 2W6RA 2I5IA 1UA7A 4BKNA 4UUIA 4O8AA 3GDTA 2ANUA 2D2HA 4Q7BA 1KCKA 1S2TA 1W8GA 1DXIA 4M1BA 1F6PA 4HJWA 3K30A 1E72M 3BMVA 3KHJA 4ZO7A 5LGZA 4AHOA 4HCDA 1CTNA 2I56A 2HPIA 4GQGA 4I7VA 1RZMA 3QV9A 3BZJA 4MSSA 4AIEA 2QCHA 3R2GA 2V5JA 1D2KA 4X9SA 4AZ6A 5CPLA 1E3XA 2NVAA 2V3FA 4W7UA 3T07A 4PMUA 1R47A 3VE9A 3VVGA 4RCXA 3S6TA 1CLKA 3EBVA 1I2PA 4EP8C 1K8XA 1J0ZA 4C6NA 1XWYA 1V6UA 3ZS4A 1UD6A 4AIBA 3H26A 2GGHA 4Z0JA 4QLLA 3ITXA 3QPEA 4LH8A 2E6FA 3ZJ6A 2PODA 2QJJA 4PMZA 1G7VA 1DBTA 5C9XA 4QEEA 3A47A 1H49A 4XO7A 3L4YA 2CITA 1QHOA 1UWTA 2A6LA 3D46A 4NF7A 3AMKA 4AC7C 3AXMA 1PCWA 4KWUA 1A53A 3E5PA 1ECEA 3CHFA 1C3FA 3Q94A 5CSRA 1JUBA 4JHOA 4PRTA 2VQTA 4M29A 3U2OA 2FJUB 2GJXB 3G0XA 1KM3A 4ZO9A 2JF6A 3O63A 4U10A 4FIQA 1QPKA 1YYAA 5HA7A 2BOGX 2CLFA 4J2PA 1QI2A 4JNYA 4G6CA 5DBTA 1QNOA 1XKYA 2C91A 2FPVA 2NV9A 1B4KA 1IGWA 4ATWA 1XUUA 2WAGA 4L4OA 1R3YA 2ASHA 4L64A 3QY8A 3FK4A 3MHGA 1J4EA 4IIBA 3NZRA 2X8RA 2CXGA 3U8GA 5KITA 1CECA 2XGIA 1PTAA 3B8WA 4E8DA 3H2FA 4DRSA 1TV5A 2AGTA 1W6TA 4ML9A 2Z25A 2V3EA 2YJQA 4MTVA 1J12A 3SQMA 4MKVA 4MUPA 3OLEA 4LC8A 2XFWA 1JR1A 1H09A 3R58A 4UIOA 5BMXA 3FA3A 3GS6A 5EU9A 4I5XA 1XIFA 2Z1BA 1ZUAX 1R5YA 2OZ0A 1ZJBA 3FOKA 1ZJAA 4GJ1A 1CXFA 3B0UX 1DJHA 5G2IA 2Z2AA 4L6HA 4A8RA 2PI6A