3G1VA

Crystal structure of the mutant d70g of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5-fluorouridine 5'-monophosphate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAGFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 80
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g1vA00
4K7VA 2GJLA 1TO3A 3GDLA 5I3HA 3A22A 4R33A 4AXKA 4JTTA 1I45A 3SIZA 4GC4A 2BWGA 4FHAA 4O53A 1JUKA 3U6WA 4G1KA 3N3MA 1KBIA 3W73A 3UWWA 5CPMA 3NL3A 3CT7A 4MKNA 4IUOA 2Z2UA 1GG1A 2V82A 5FEXA 1JR1A 1JUBA 2X30A 4DF1A 1OK4A 2F7FA 2VFHA 3A21A 2Q8LA 3LHWA 1FY6A 1ONRA 2ZRWA 3MI3A 2WNZA 4UR7A 5EMUA 2TMDA 5J5DA 1TB3A 3OVPA 1K7XA 1VYSX 2X16A 3LRMA 3LLDA 4AWSA 1KM0A 2FB3A 4LWWA 1TPDA 2DZWA 4BK9A 2VELA 2TYSA 2NXHA 2C6QA 3QRHA 2Y62A 3W7IA 4GUGA 2PRLA 1X8FA 3S1UA 4JX6A 4H3DA 3NAVA 3BG5A 4NJGA 1EP2A 4OBTA 2Q3OA 1KBJA 3DHDA 4IOTA 1NVMA 1P5BA 3TXVA 3T40A 4NNCA 5DELA 2NV2A 4CQ8A 3M0ZA 1LBLA 1OX6A 3MP5A 3W86A 1PS9A 5FF3A 3E12A 2J9YA 2E5CA 3KX6A 4JYEA 3PM6A 1F05A 3HF3A 3PBWA 1H60A 5DXYA 4PCFA 4K8EA 5EYWA 3HPZA 4IMEA 5CSRA 4XUGA 4L4LA 1GVRA 2J24A 3NDOA 4TIMA 5K9XA 4N9BA 1BEUA 3R8RA 2HTMA 1YPFA 3I6RA 1HUVA 2FJKA 3W2KA 4CCDA 2DZSA 1F6KA 3NQ6A 1VZWA 3G18A 3KRUA 3A24A 3QFEA 1OFEA 1FQ0A 2KZHA 4YL2A 5LSMA 3TU9A 1J5TA 3LB0A 3M41A 2PRMA 4GRSA 1MEIA 3P8JA 3NXFA 1ML1A 2ATMA 3SJ3A 2O7SA 4NZFA 2RDUA 4DO5A 4CNOA 4IPJA 4QITA 4X2RA 2NZLA 2J27A 1Z42A 1LP6A 4Y90A 3UPBA 5FESA 3TC6A 3DH7A 4A29A 3ANYA 3FYPA 2VOMA 4HNUA 3BG9A 3C2RA 3BLEA 3KRSA 4JTEA 4E2DA 4CNPA 4NU7A 4ZQOA 1H7NA 5HWMA 3RNDA 3LTYA 4MY8A 4R53A 5LHFA 1TPVA 3GKFA 1KFJA 2V81A 5EKYA 3VE9A 3NPUA 1AW1A 2ZA3A 1GQNA 4OU1A 2A4AA 1DORA 1OFQA 3MUXA 4FX7A 2OT1A 3G3DA 1UJPA 2WO5A 2WSRA 3GIYA 1A5BA 1C9DA 2YX0A 3E02A 1LORA 3W7HA 1NAL1 1D9EA 3P62A 3QMTA 1XBVA 3RLVA 1OG0A 2Z0IA 3TJLA 4YMZA 1TCDA 4AH7A 4LS1A 1R2TA 1WA3A 3W1RA 3W83A 3B4UA 1LROA 3L5AA 1KFBA 3W71A 1DOSA 3IIVA 3PBUA 3MJYA 2WNQA 8TIMA 3O6YX 2I14A 1B9BA 4GUIA 1WX0A 4QSHA 1QOPA 3RK8A 1F5ZA 4Z1AA 3KHJA 3B0VC 3W23A 1GTEA 5C5YA 1TQXA 5KMYA 4R34A 4UUIA 4UTWC 4LVGA 2E6FA 3NQMA 3SY5A 1B4KA 3ATZA 1OYBA 1UUOA 1TJRA 5FI8A 3KRZA 3DFTA 1MXSA 3N14A 3TUUA 3WK1A 4FIRA 2WKJA 4NVTA 5DN1A 2FB2A 4CCEA 4PODA 1SO6A 1LCOA 5HR7A 3GXTA 3GNDA 3G8RA 4OV4A 5CZ0A 2ISWA 1DKWA 3C2OA 3S5NA 2X2GA 3M9YA 1LM1A 3Q58A 4Y6GA 4RV8A 5I3GA 4ZVJA 1YPIA 3EX4A 2E09A 1PHQA 2NXGA 4KFPA 3S5ZA 1B4EA 1Q3NA 2ZZ6A 2XN1A 3FLUA 1H50A 4FXRA 3WK2A 3GB6A 4ORIA 1S3HA 3ABQA 5IBXA 1S5VA 3DKLA 4I9AA 4FX8A 3TQKA 2Y7EA 1ME7A 3LXAA 3T44A 3V1PA 4RLIA 3TK7A 3TW7A 3DFSA 1FDYA 3W7GA 1A5CA 1YXDA 2JBMA 1SZFA 2PE4A 4JY8A 1F2JA 2E6DA 4Y8FA 4EIVA 3IVUA 2ZRVA 3S5YA 3FS2A 3TFCA 5H91A 4O10A 4O54A 4M6PA 2HSAA 1UCWA 3M47A 1QPQA 5LNWA 5CPLA 4WOQA 1RPXA 3W1MA 1EP1A 3HG2A 5HWNA 4GUJA 1LLZA 3VE7A 2E6AA 1GTHA 4LC8A 4KWVA 1KM6A 1ICPA 5K9DA 2ISVA 1RD5A 2OX1A 4O18A 3MW7A 4RXGA 1KFEA 4N4QA 3QH2A 3IGUA 3KVMA 3LHUA 3W2LA 4KFOA 1XL9A 3EXTA 2GVGA 3JR2A 1L6WA 3W9ZA 4MY1A 4HSNA 1EB3A 3KVLA 4EWND 3HPSA 1P0NA 4U4MA 1D3GA 2RH9A 4NNAA 3MP4A 3MBDA 1WV2A 1SW0A 3M7WA 4ALDA 4MVAA 4KKXA 2NWRA 4UR8A 4U28A 1EP3A 5HULA 3M1ZA 3N9RA 3EKZA 2YZRA 3IEBA 3G0XA 1G67A 3WK3A 2WPBA 1JCXA 5D2WA 1L6SA 1YXCA 2QUTA 1B57A 4XTIA 4JTGA 4OGZA 4PL2A 1GOXA 4HPXA 4W9TA 3VNDA 3DU0A 3W1PA 3BW4A 2VKZG 4HNNA 2ZQ0A 3G1HA 4H4IA 3MI6A 1TJPA 3STEA 1VCVA 2Z6JA 4LW7A 3CC1A 3NQEA 1LTDA 3M5VA 3WK0A 4Q4KA 1K7FA 3DI1A 4JX5A 3TIMA 1LDCA 4L4MA 2JKPA 1OFBA 4OWGA 5BMXA 1K8XA 5T26A 5C54A 3TKFA 4JDBA 2FDSA 3LM7A 3C2FA 4ADUA 1ZFJA 2ZTJA 4OV9A 1NF0A 1KLZA 1EWEA 3P61A 1M5WA 3DFPA 3LOTA 4FX6M 5EPDA 3P5ZA 1WOBA 4LC6A 3NNTA 5CGQA 3T7VA 5AN7A 3SZ8A 2ABBA 1ZAJA 4YLWA 4FNRA 1K8ZA 5BMWA 5AC8A 1MEWA 3FJ6A 1CX9A 3NOEA 2X1SA 4AF0A 1H7OA 3BPWA 2QAFA 1K3UA 4MYAA 1IXNA 5LNSA 4JTJA 4TR9A 3LCIA 4WQ6A 1T96A 3EX6A 1G4EA 1XCFA 5TQLA 1LYXA 2Y63A 2A6LA 3S8HA 3E0IA 4FNUA 2JK2A 3GX9A 2JGYA 3GDTA 3S0CA 2NX3A 2LLEA 3ELFA 4ADSA 3GXPA 2Y85A 1ZCOA 2B7OA 5HNRA 3MBFA 4JTHA 1VCFA 2E5DA 3NGJA 1IF2A 6ALDA 2E1DA 1YTDA 4IJBA 5K4ZA 3G1VA 3IRDA 3L65A 1KV8A 2ZZ1A 5K7JA 2EKCA 1H51A 4N6EA 1KTBA 5HJLA 1NF7A 4N02A 3W1NA 1OK6A 4O57A 2X1UA 3I7RA 3L68A 1I8JA 2FPTA 2DJLA 4IX2A 5DXXA 2EPHA 1ZHAA 5AC6A 3O16A 1TV7A 1XDLA 3HGRA 2FQIA 5D33A 5K2ZA 2BZNA 1G4SA 1OYAA 1BKSA 1GJPA 1K8YA 3LCHA 5D02A 1Z41A 1SW7A 1DQWA 3W7MA 5AHNA 1RQEA 1PCKA 5E1QA 4ZZ9A 1TPB1 2YXGA 1JQVA 4XKYB 2C19A 3B05A 3GDMA 1I2QA 3KFTA 4JTLA 1W5OA 4FF7A 3S1XA 4Z0SA 3E9AA 4UXDA 3LERA 4FEZA 4CNNA 4CQ9A 5DY3A 1OYCA 5F1UA 1KM2A 4C1KA 2ZRZA 2ZZ4A 1I2RA 1M6JA 4MJZA 2ZYFA 4WY0F 3ZFHA 1FWSA 3EWXA 5BRBA 4O19A 1ALDA 1X7FA 4C1LA 2DZUA 3W07A 1H5YA 3NQ8A 3TW6A 4E38A 1D3HA 1RR2A 1L6YA 1S5TA 2CZ5A 5CG7A 4JDYA 3C2VA 1XKYA 5CKSA 1K7EA 2QEZA 5HINA 4NQ1A 3M43A 2CLKA 3L0KA 1J2WA 3W84A 3P8IA 3VCRA 1V7YA 3G1XA 4M7SA 2QF7A 5L9FA 1P1XA 3PB0A 2GVJA 3F1QA 1P0KA 2R8WA 3I7SA 1XBYA 5C55A 4O0ZA 4UMBA 1QO5A 3BV4A 1W5NA 4O12A 4BR1A 3P74A 1VGAA 3DI0A 1X6UA 2J88A 2CW6A 2H90A 1TTQA 2W0UA 1R46A 2GPTA 3UZ5A 2EHHA 4LUIA 4DPPA 3F03K 3LI1A 3NL6A 4Z08A 3G1FA 2QCDA 3LX9A 3BO9A 3TC7A 2CLFA 5EY5A 3DBPA 4YCPA 4O1CA 2ZZ7A 3PUOA 3LRKA 4M6VA 3E49A 5CPOA 1JRCA 1I2PA 1JUEA 1Q45A 3BW2A 1THFD 5IBXC 2VXNA 3EXSA 3QZEA 2DP3A 3TX9A 3W1UA 4Y9AA 1KM4A 3N34A 3TR2A 2NUWA 5D30A 1SO3A 4ORMA 5DCDA 2JGQA 3PBVA 5K9CA 1OFRA 1OABA 1W8SA 3CU2A 3ABRA 3W7RA 4O16A 3G0UA 5KZDA 1TPH1 2H8ZA 4DO6A 4UTUA 1FWTA 4LOCA 2WSQA 4KFNA 1VS1A 3QPZA 2Q3RA 3HQ1A 3W75A 1SFJA 1ZJIA 3DAQA 4UTKA 3LCXA 4NJHA 3T55A 1XI3A 3RLUA 1JJKA 4CCCA 5I3FA 3B8DA 3NVTA 3SR7A 1GZGA 5LGZA 2NV1A 4QJ1A 1XC4A 4DQWA 3W1TA 4O1BA 2JKAA 5D32A 3ZS4A 3LCFA 3NQDA 2G96A 1YDOA 3L2IA 4JTFA 4OHQA 3TV8A 4FNQA 5KZMA 1NSJA 4GJ1A 4IMCA 1GVFA 3OIXA 4QQ3A 4X3ZA 1AG1O 1TSIA 3H55A 1GVQA 4K36A 1UB3A 2H6RA 3GYEA 3C4UA 3VI2A 3G1YA 5KITA 5J5RA 4UFJA 3I65A 3INPA 2JKEA 1Q6LA 1PHWA 5AFDA 4LU0A 1FXPA 1LOSA 5BNKA 4O1DA 2GQAA 3VKJA 1TMHA 2V5LA 3M16A 1VC4A 4LUJA 5A8GA 2UV8G 2TSYA 2RDTA 4H6KA 3EWZA 4MLJA 3GDRA 4IXHA 4IGHA 4UCGA 1FWNA 4ZQMA 2IQTA 1BTMA 1V5XA 4PFMA 3MO7A 4GXMA 2YPIA 1I2NA 4AVFA 3B04A 3W88A 4RXFA 1SZGA 3W6YA 3BK0A 3PULA 3P82A 3IGXA 4WY0B 4A3UA 5I3IA 4AEOA 1UUMA 5AB3A 4O14A 3GVGA 3LRLA 1SU5A 4N9EA 3C56A 1OFPA 1OX5A 1RZMA 2Y89A 3UQNA 1GEQA 4IMGA 4JR5A 1W54A 3NEVA 3TE9A 1XBXA 3LXBA 1FUYA 2ZZ5A 3RMJA 1HFBA 3TNOA 5A5WA 5HWJA 3G3MA 3FEMA 1OF8A 3H53A 4K8HA 3UYCA 3TSMA 1F6PA 2XN2A 5BW6A 4AWUA 2YW4A 2PURA 4TO8A 3UD6A 1IXPA 4K37A 1QFEA 1EIXA 1LZOA 4BI5A 3LHYA 3NPVA 3W2UA 3O63A 1KM1A 4PA8A 2D73A 4EOUA 3MHFA 2DZVA 1F7BA 1DVJA 2CWNA 4ADTA 3OVQA 3TSBA 1EUAA 3HG5A 1OX4B 3LTSA 3QMRA 1TPFA 3LCGA 3EEGA 3EB2A 3QQ0A 3O07A 1KFCA 2QCLA 3NPWA 5DCEA 4EVZA 3W2NA 3NPXA 4UTHA 4DF2A 3MMTA 3W7EA 4AHOA 2E77A 2WQPA 3RU6A 3BLIA 1JRBA 1QPRA 3S9YA 2QUVA 1VR6A 1YTKA 2VFEA 4JTSA 2FPYA 4FXSA 3JS3A 4X22A 1WDWA 4RK8A 1O5XA 3G1SA 2C15A 3Q2DA 2Q8ZA 2ZZ3A 3CWOX 4MZ1A 2CU0A 5FF2A 3TAOA 2B4GA 1TREA 1TPEA 4BF9A 2XN0A 4BWLC 4TX9A 3P80A 5F2GA 3TAKA 4JTUA 2ZA1A 1AW5A 4UTIA 4GE8A 1T99A 3AJXA 2DZXA 3QMSA 5D2XA 2B7NA 4NNBA 3HB9A 2RHGA 1LRQA 2V5BA 2ZRUA 1RQHA 3CB8A 1X1ZA 3QF0A 4O50A 3GK0A 1YADA 4JXCA 4IMFA 5FF7A 3DHFA 4XWUA 5MHBA 4YCOA 4TU1A 2QCCA 3F4NA 2QJGA 3F4WA 1QPNA 1KV5A 2GVLA 1XUUA 3LHTA 2RKXA 4QNEA 2J6XA 5GVJA 1R47A 4J9JA 1AL8A 1KTCA 1VRDA 1W3IA 1G69A 3EXRA 4ZQNA 4IX0A 3NYZA 1QDSA 5AYYA 2CLLA 3W87A 4UTLA 4UFKA 4FO4A 3HJZA 3CHVA 5LNRA 3NZRA 4IXXA 2H8XA 3CEPA 1C29A 2C3ZA 4UMAA 4HKPA 1FCQA 2VFGA 1Q6RA 4NJJA 3P5YA 4JY9A 2J9ZA 3HOJA 3CM4A 3QM3A 3LDVA 2CZEA 3IIZA 4IMDA 2QCGA 3HGOA 4R7JA 1FX6A 3G8EA 3L0NA 3C3NA 1VYPX 3CIXA 3W72A 4EF9A 3DFOA 3QW4B 3GAYA 3STFA 2G97A 3WJXA 1FDJA 3ZWTA 5DLCA 3P60A 5LKYA 4JIPA 1JCMP 3NZ1A 4LS2A 1BWLA 1Z48A 4EF8A 1R30A 1XM3A 1K03A 5HUPA 3TCEA 4DBEA 3DFQA 3DZ1A 5TBOA 4OE7A 2VEPA 1TIMA 3W2JA 3V75A 2C1HA 4GWEA 2CLIA 3N2MA 1TTPA 3D0CA 1SSDA 2GQ9A 2R94A 4S2CA 4N9CA 3GZ3A 2VENA 3P7YA 2CZFA 4DBDA 4MLRA 1PE1A 4P61A 2EGZA 4DF0A 1FCBA 3BW3A 3ABOA 1SUXA 1S5WA 3UNDA 4LVDA 3BGJA 4A2SA 4Y96A 3PF3A 2V30A 2CLOA 2YYUA 4O0KA 3PY2A 2YGYA 4YWIA 1UBSA 4UFLA 1JCNA 1VHNA 1WBHA 4O4WA 3W7JA 4PH6A 4MOZA 1KTNA 2A0NA 5EBUA 1G7UA 2C14A 3SFKA 3CWNA 4TMCA 1W31A 2V2CA 3P84A 3O06A 1KM3A 3HBLA 3L66A 2GJNA 3GDKA 4UTWA 3WJSA 3A5FA 3BGGA 2V0TA 3NR0A 3NQAA 5DY2A 2QR6A 1OJXA 1W5QA 1N8FA 5C2XA 4LTSA 3NQCA 4MPQA 3LV6A 1GYLA 4M7TA 3MI2A 1ICSA 1SPQA 4HNTA 2HS8A 1A5SA 2A2IA 1T0OA 4N6FA 1HTIA 3K30A 3PSVA 4BI7A 3GAKA 3FYOA 4NZJA 2VFIA 3EX1A 5F4SA 5AYZA 3CEUA 2A7PA 4A22A 2X1RA 1JULA 2YDAA 3S42A 3W2MA 2NXIA 4M5PA 1O60A 5F4XA 3FJLA 2YSWA 2YFOA 4O11A 1TQJA 4WXYA 1EPXA 1X1OA 3HGSA 5BOOA 3HIJA 1H61A 4GBUA 2QUUA 2WJZA 3DXIA 4JS3A 3W7DA 1ICQA 3SSJA 2AAMA 4JD4A 2Y88A 3NG3A 2A85A 1GT8A 4XZ9A 5HUOA 3B0UX 3HG4A 4S2BA 4MUZA 1OF6A 3O1NA 1GVOA 3IIXA 2Y70A 4OT7A 1OFAA 1KM5A 2ZTKA 3ATYA 3THAA 3W22A 4UFHA 2E6YA 3W7KA 1ZNNA 5AHEA 5TIMA 3FOKA 3C52A 2H3BA 4UFIA 3PVFA 4O52A 3EWUA 1W5MA 1DHPA 3LBMA 4E0CA 3N9SA 2YCEA 5HQEA 4UTMA 4FNPA 3STGA 1XDMA 2C18A 3O15A 4POCA 3CTLA 4JNMA 3USBA 5D38A 5F2MA 2QCNA 2VEKA 4ZQPA 3EWWA 3W3OA 5G1YA 3UWYA 1HO1A 4LS0A 4N2YA 1M7PA 1DV7A 3LHVA 1SFLA 2QCEA 4PTNA 5D04C 3IIOA 2Y6ZA 2W6RA 5SWUA 3H54A 4AMAA 1G6CA 4LVFA 1KW1A 4GUHA 4Z1DA 2WSYA 3LCLA 6TIMA 1H1ZA 1DJQA 2NUXA 2QAPA 3ABSA 3TA6A 1TPC1 4TMBA 1PCWA 2OCZA 4CQAA 3W7NA 3PG9A 1SSGA 1B3OA 4WXZA 2NX9A 5E0KA 3KOFA 2BXVA 2P1FA 3MHUA 3Q37A 3TFXA 1GYNA 4K39A 3UWQA 3A23A 3NL5A 4HIBA 2ABAA 3N19B 1H7WA 3L0GA 2Y7DA 2ISSA 4K38A 1WXJA 3L21A 4WJEA 4HPJA 1H7RA 3G1AA 2DU2A 4XKYA 1TV8A 5LZLA 1R2RA 3BG3A 2ATSA 4RZ4A 5FEWA 3KVJA 1RVGA 4O28A 5G5IA 4MFDA 2VEIA 4RX0A 3KVKA 4JTIA 1VCGA 4UTTA 4K7YA 4HN4A 5E93A 3B06A 3LV5A 4LV9A 4ML9A 4CLMA 3IV3A 3NL2A 1L2UA 3PSWA 5H2ZA 1PIIA 3W7OA 3CQ0A 3OHIA 3MYOA 3DFNA 4Z1CA 3DKJA 1I2OA 3PG8A 1QCWA 3WFAA 1W0MA 2DORA 3LLFA 2RFGA 4WZHA 2GOUA 5IM51 4DEFA 4Z1BA 3UZJA 3PC0A 1FCVA 1XFBA 5D2YA 4M19A 4GNJA 5F2IA 1H63A 1KLYA 3S5OA 3NA8A 1QO2A 5L6UA 2FLIA 2OT0A 4JYDA 5D37A 5U4NA 1YXYA 4N4PA 3MP3A 4LV4A 4HNVA 4UNLA 1FBAA 3C8FA 4JGDA 2CLHA 3QSTA 4Q32A 2QKFA 5KZEA 3WJWA 5DBUA 3PWAA 1QMLA 5G1TA 2A6NA 4NXSA 4UFMA 3R89A 2ZRXA 3W70A 4NXKA 3OEXA 1WAUA 4IWWA 3W7LA 2Y7GA 1LOQA 5G4WA 4JIQA 3U8GA 4PL1A 1VHCA 3R5EA 1IXOA 2V8ZA 3S1VA 2ZA2A 3HMJG 4Z0JA 1XBZA 4QAIA 3RFAA 2WV8A 3NQ7A 1JCYA 3TXZA 5D09A 3YPIA 2B7PA 2EF9A 3HGJA 1FXQA 1O94A 2C13A 4XTDA 2ZZ2A 1WBJA 4UNKA 2ZDRA 1OVDA 2YYTA 3FA5A 3CLMA 4NJKA 4O1AA 5D05A 2C16A 3B03A 4UIOA 3TDFA 3N2XA 3STCA 3WJZA 1OHLA 5LGXA 3PAJA 3UXAA 2W79A 1TTJA 3I7QA 5AC7A 5AYXA 1JCLA 3QC3A 1DL3A 3QJAA 4XBKA 3TMQA 3HPXA 3NQ2A 5ABTA 4PEKA 1SQ7A 5DCBA 2ALDA 1G7VA 1QNVA 2V2DA 3IVTA 4FNTA 4YXGA 3HO8A 5FF0A 2P10A 3O05A 5F4WA 2FIQA 4BFAA 3GXNA 4UTJA 1IIHA 3UWUA 4JEQA 5DBTA 5G4EA 2CLEA 4QIUA 5AHMA 3UWZA 2A5HA 2TRSA 4NT0A 4ZQCA 3UWVA 3BLFA 1EWDA 2ZRYA 3A5VA 4I7VA 3MYPA 3B0PA 2J9XA 3UY8A 4A2RA 1EUNA 1W3NA 1OFOA 4NX5A 5FEPA 5FF4A 3O6DA 4GUFA 2NUYA 4RZ5A 4UC5A 1TPWA 2X1TA 4FB7A 4Q33A 1JCJA 4HSOA 5G2IA 5KTLA 1RQBA 2QJHA 1GG0A 3W74A 3W7CA 1L9WA 1AL7A 1DJNA 2YW3A 3OVRA 1LRTA 3W85A 4P2VA 1EA0A 1Y0EA 4AWTA 2HMCA 3M5XA 1F76A 1WYIA 4NUWA 5CSSA 4WY0A 2HS6A 5KSWA 3A9IA 2ZBTA 3G22A 3L67A 1O5KA 5I3KA 3NQFA 4RJEA 1AMKA 2VEMA 1W3TA 1ZENA 5AHFA 4AAJA 2VFFA 3KAOA 3G24A 5HR6A 3L5LA 1FCUA 1VJIA 3QEZA 1YTEA 2E5BA 5FEZA 4AHPA 3GR7A 1Q6QA 3PUDA 4ZMGA 1E51A 3G0SA 4JICA 4O15A 3UY7A 1SR9A 2CFFA 1W37A 1DBTA 3W1LA 1QR7A 1WOAA 1JQXA 4FIQA 2G5WA 4LVAA 2V9DA 4HHPA 2OJPA 3P81A 3EX2A 3PR2A 3TQ0A 4O17A 4MZ8A 4MYXA 3TSDA 3L5MA 4M6QA 4PC8A 4AHQA 3M6YA 3QPYA 3NM3A 4KWWA 5AHLA 3S6DA 3TMLA 5EL1A 2OZ0A 4JN6A 4I7WA 4FNSA 1G4TA 4JX4A 2PCQA 2QCFA 1N7KA 2A7NA 1CI1A 1VPXA 1FWRA 3DGRA 1F74A 2YR1A 3LI0A 1W56A 3G1DA 4DXVA 1CW2A 1OX4A 3NQVA 2CLMA 3O8AA 4RR4A 1U5JA 2TPSA 2Z6IA 3P67A 4O8RA 4DELA 5F1VA 5CZJA 3CPRA 1O95A 3TH6A 2C0AA 1HG3A 2RDWA 3NO5A 3EWYA 2B0MA 4MZYA 2P0OA 5CPNA 1T8XA 3N73A 3GKAA 1AW2A 1VH7A 1LOLA 2QJIA 2WNNA 3GNNA 4S1FA 1BWKA 2ZFAA 1MEHA 4WOZA 1LBFA 1QAPA 4IQLA 4K6AA 1O4UA 1J4EA 1R2SA 3GLCA 3C61A 4JYFA 4B5NA 3MWAA 1SZEA 3E96A 2BTMA 1Z44A 4RCXA 2R91A 2BLEA 3LGEA 4ONVA 3IIPA 3UPWA 2QDHA 1ME8A 7TIMA 5LNVA 2CZDA 4XBSA 1WQ5A 1KFKA 1GVSA 5AOUA 2DZTA 3ZWSA 3NQGA 1LLWA 4RKAA 5CZSA 1HO4A 3FKRA 3T78A 3LBCA 3FFSA 3BARA 1ZAHA 5C6MA 3W7QA 1QOQA 1GPWA 1VLWA 1TRDA 3M5ZA 3QYQA 3BVJA 4O4VA 1IGSA 2FFCA 1QWGA 2NLIA 4AB4A 1VLIA 1YLVA 2NX1A 3Q94A 3NM1A 4E2BA 4LRTA 4HT3A 4AF0B 1XXXA 1H62A 3C2EA 1F73A 2EAWA 3TQVA 4RZ6A 2Z1BA 4UTTC 3R13A 3M5YA 1H1YA 3EX3A 2AQWA 3THQA 3PBYA 3M44A 4ICNA 4X9SA 2QDGA 1ZAIA 3EWBX 3IGSA 3OBKA 1MZHA 5HMSA 3W1XA 1I4NA 3CIWA 3O6CA 2YFNA 1IXQA 5LHEA 1HL2A 1SO5A 5LNUA 2PC4A 5AHIA 2I1OA 5G2HA 2A21A 3TJXA 2DJXA 3C0JA 1MO0A 2H3DA 4I7UA 4DO4A 1C8VA 1RV8A 1TV5A 2R14A 3C6CA 3SECA 3QSRA 1SO4A 1TPUA 4A21A 1G4PA 1DQXA 1VQTA 1PV8A 3IVSA 3W1QA 1AK5A 3OG3A 3I68A 3LXCA 3QQ1A 3QW3A 3W7PA 1H7PA 1W5PA 3U2OA 1K02A 4O13A 4DPQA 3LTPA 3UXDA 2Y7FA 2B7QA 5I3JA 1SZNA 1N55A 5CZTA 3SW6A 3TROA 2A1YA 4WX2A 1SW3A 5KINA 2BX7A 3GR8A 3WJYA 2AGKA 1XUZA 3PUEA 1OFDA 3T4CA 3JRKA 4LRSA 5U7SA 3SGUA 3DENA 3R12A 2E68A 2GQ8A 2OMAA 1ME9A 2VC6A 2ZCGA 1PVNA 4ZL1A 1ADOA 3L9CA 2G95A 4N9DA 3PS7A 1LRNA 5G2WA 3FIGA 1JVNA 5F2LA 1KA9F 1FWWA 4QNWA 1A5AA 1QPOA 1TRIA 3R2GA 4JTKA 4LVBA 1YYAA 4MJMA 3VFLA 3RF9A 1EEPA 3LCWA 1P4CA 1IIGA 1NEYA 3SI9A 3W76A 5D2TA 2O7QA 4LT9A 1W1ZA 3OA3A 4BWLA 1NFBA 4IPIA 4GFSA 1ZY9A 4ZQRA 1A50A 4MIMA 2V2HA 3EKLA 1VYRA 1FDZA 5D03A 2VFDA 4OQVA 1GWJA 2QCMA 2Y61A 1U83A 4QM1A 2FPVA 1A53A 4XQ6A 2I9EA 2PRHA 5EA9A 3S1WA 2DZPA 3HG3A 1Q6OA 4BI6A 3KXQA 4D2JA 3LHZA 1TTIA 1LBMA 2NWSA 1H7XA 5K3VA 2F84A 2A7RA 4WD0A 1EX5A 3PB2A 2BSLA 1ZALA 4LNYA 3SGZA 2XFWA 1YDNA 4UMCA 3ZR4A 1MSSA 1YDVA 4WUIA 3W1AA 3AO0A 3MHGA 4NJIA 1UASA 3FKKA 4MY9A 5D2VA 2QCDB 2QCHA 2WOQA 4LY8A 1TYGA 1PL9A 2FTPA 1M7OA 4MFEA 5K4XA 4QISA 1KFLA 2GUUA 4NX0A
chains in the Genus database with same CATH superfamily
4K7VA 1QK0A 1QHZA 2F8QA 3GDLA 1BLIA 5JBEA 4IL2A 2JQXA 1L0PA 4AXKA 4CQCA 2QNEA 3E2SA 2FH8A 3TTQA 5TAOA 3E0FA 3S2MA 1I45A 3FXGA 2BWGA 4PMQA 4NIRA 2O9RA 4G1KA 1KBIA 5CPMA 5AC5A 5LIKX 4R9OA 4HNOA 2GLKA 4IUOA 1JUBA 3ZT7A 4KQNA 4DF1A 1UR2A 1OK4A 1DJZA 2VFHA 1BQCA 4A3YA 3RILA 2Q8LA 3KTXA 2TMDA 1YPXA 5D8WA 4F8XA 1TB3A 1SJAA 1OT2A 4W7WA 1UHVA 5A8QA 2X16A 3LRMA 3LLDA 3W00A 3TA9A 1TPDA 2PWGA 3UETA 3L2MA 2TYSA 5JBFA 4HCLA 1OQFA 3BG5A 3WLSA 3TTYA 4NJGA 2F61A 2Z26A 1P5BA 4L1XA 3ZJ7A 3RM9A 4CQ8A 3FW6A 1OX6A 4ZB0A 4DM1A 4AUBA 3KBMA 5ABGA 2J7HA 3PBWA 4PMVA 1CXIA 1BF2A 1FWAC 3R0KA 4GVHA 1W1A1 4L4LA 1O1ZA 1M7XA 3NDOA 1BEUA 1IEVA 3AS0A 3GC4A 5DRIA 4F0KA 1OFEA 1FQ0A 3H2OA 3QHMA 2WBKA 3TU9A 1J5TA 1KR0A 4XD5A 3VYLA 4H00A 1EH9A 4L5ZA 4GRSA 2D69A 3I3BA 4Q8QA 1W3KA 4US6A 4CNOA 4QITA 1KXTA 2J27A 1Z42A 1LP6A 4ZFCA 5AYIA 1CGTA 2Q02A 2O9TA 4ZEPA 4A29A 1DEDA 4PSPA 4HNUA 3BG9A 3C2RA 4XZIA 3KBWA 3CTTA 4NU7A 3OYXA 1JZ6A 2YDRA 1VPQA 1GZJA 4MY8A 2PDJA 3GTNA 1CCWB 5A6TC 2ZOXA 5BOFA 2V81A 5EKYA 4D6DA 1AW1A 2A4AA 1PEZA 1DORA 2GDQA 1RCQA 4QG8A 3TC3A 1JFXA 1OFQA 3RMEA 4LFYA 2OT1A 1JNEA 4Q4MA 4OBSA 5KETA 1LORA 1CB2A 3W7HA 3GIPA 3NO3A 3P62A 3ZLFA 4W93A 5I78A 4AZ7A 4AH7A 3IACA 3L5AA 3W71A 1A3WA 1J01A 3WLRA 4L4OA 8TIMA 3O6YX 2I14A 3NZPA 4GJIA 1QOPA 4J2MA 4J3ZA 2YL5A 3B0VC 3GSMA 2GFTA 4BCEA 1PO9A 1TQXA 2BHUA 4WDWA 5KMYA 4R34A 4UUIA 4BY3A 4XK2A 4XG1A 5C7VA 5DMLA 1TJRA 2X0YA 1EJ7L 5BXRA 5IFPA 2GSJA 3KRZA 1P0BA 2BY2A 4XAGA 4UQBA 3N14A 5KZ6A 4FIRA 2W9MA 1K9TA 4NVTA 4JBRA 3A6OA 1UQZA 4CCEA 5BU9A 1KRAC 2I57A 1NY1A 4ECLA 1QUMA 1A0CA 3OGSA 2MUCA 4OV4A 4MJ4A 5CZ0A 2AMGA 1DKWA 4O1EA 1LWIA 2V6AA 1LM1A 3Q58A 1JFHA 1H49A 4Y6GA 1YPIA 4CNUA 3IJQA 3BZJA 1ONXA 1PHQA 1M65A 3LENA 4QG9A 1B4EA 8XIMA 2XN1A 3CGTA 1LL6A 2ZWZA 1S3HA 3ABQA 2J13A 4S3AA 3GNXA 3DKLA 3TQKA 7PTDA 1ME7A 3T44A 1IR1A 3RPDA 4RLIA 5I79A 8A3HA 3TW7A 3IANA 3DFSA 1FDYA 1NWTA 4WKHA 4MB1A 6XIMA 1A5CA 4GFIA 2PE4A 1F2JA 2WLYA 5M03A 1OM0A 1LUCA 3PZMA 4EIVA 2A3EA 3CK5A 4CU7A 1FWEC 3FS2A 4BS0A 3LD5A 3CL7A 4PRTA 1OCNA 4MWAE 3IJIA 3IWPA 3WQVA 1KXVA 2HE8A 3C2YA 4JPGA 4HTBA 4FALA 4FPSA 1F9CA 3QR1A 4GACA 2BGNE 4LC8A 4U3AA 2WMKA 3BMVA 3OZMA 2IPWA 4K2SA 4N4QA 3CZLA 4AIOA 1VF8A 3QH2A 4PTWA 1T7LA 3FHQA 4YWSA 3W2LA 1XL9A 4GIAA 4YU1A 4CNSA 2PU0A 3W9ZA 4PCTA 2INEA 4HSNA 1V77A 3KVLA 1XLBA 3HPSA 3MUIA 1P0NA 4U4MA 1D3GA 4PTMA 4M51A 3MP4A 3TWAA 4AY8A 3WELA 3ITGA 4KKXA 2F2KA 2ON3A 4GI9A 3C8NA 4RNHA 1P43A 3N9RA 1AD1A 2XGIA 4W84A 3IEBA 3G0XA 1G67A 3WNLA 3WL0A 3W02A 4XZNX 5FIPA 1IWBA 1ONEA 1NIUA 4IF2A 4JTGA 4QRNA 4MGGA 2OVLA 3LPOA 1MXDA 1V7AA 4HPXA 3KM8A 3N2CA 3BW4A 1N2VA 1X38A 2R6OA 1ISZA 4M0XA 3G1HA 2BODX 1TJPA 2QDEA 5DFAA 3STEA 3UZZA 2Z6JA 3NQEA 3VMNA 2DIJA 4Q4KA 2ZXDA 4I5RA 1EQCA 4JX5A 1OC6A 5BMXA 2FDSA 1TX0A 3LM7A 3C2FA 4ADUA 2ZTJA 1XLCA 5FJPA 1NDZA 3WNNA 3OLDA 1EO7A 3CO4A 3BJFA 3CUGA 4FX6M 3IV8A 5BXTA 3NNTA 1QI2A 3SZ8A 3URNA 1LF1A 1NM9A 2ABBA 3WH6A 2GSHA 4ZE4A 1ZAJA 4FNRA 2OZ3A 4OUEA 3GFYA 2X1SA 1H7OA 3BPWA 2QAFA 1ZPTA 4MYAA 1IXNA 5LNSA 4V15A 1GPFA 2NQHA 2JALA 3EX6A 1EOKA 1XCFA 5TQLA 3CMFA 3IJ7A 5IRPA 2XG9A 4GNKB 3GDTA 2E0PA 2NX3A 3MMDA 5FL0A 3ZQ9A 2B7OA 2CITA 3MBFA 1VCFA 2CNCA 6ALDA 1QNOA 1YTDA 1FH8A 2BY1A 3U5YA 3G1VA 3L65A 1KV8A 2D3LA 2ZZ1A 2DW7A 2AOSA 2W3ZA 4N6EA 2WZEA 2OB3A 4PFHA 3CB3A 4N02A 4UCFA 4Y7EA 4O57A 3BH4A 3IUIA 1SM9A 1Z89A 3MSYA 4IX2A 1VJZA 2C1GA 2EPHA 1EC8A 1IGWA 3O16A 3VILA 3HGRA 2FQIA 3Q65A 2PCEA 3RRXA 3T05A 1OYAA 3DYPA 3PP7A 2ZC8A 1SW7A 3VC6A 1BRLB 4KIRA 3MSDA 4ZZ9A 1J0KA 3LPGA 4CU6A 3N12A 4ZO7A 4Z2LA 2C19A 3GDMA 1W5OA 4Z0SA 3E9AA 3LERA 1RCXB 5F1UA 1GOOA 1M6JA 2ZYFA 3ZFHA 1EXBA 1R86A 1HKIA 3ZLGA 4W88A 3KDNA 5B80A 4C1LA 2DZUA 3W07A 3TW6A 2PP3A 1D3HA 4DYEA 1S5TA 2CZ5A 2GUBA 4J27A 3UXKA 5CKSA 5HINA 3VZZA 1AUSL 4NQ1A 3M43A 2CLKA 1J2WA 2X05A 1PSCA 3G1XA 4H1ZA 5L9FA 1KWKA 3OLEA 5FJTA 1E0UA 4B9ZA 2GVJA 3H24A 3H2AA 2GL5A 3WLMA 1P0KA 2PDUA 5C55A 3I6EA 4HN8A 3NCOA 4BR1A 2KX9A 1VGAA 2WLZA 2IPJA 2Z4GA 2CW6A 4QP0A 4QFUA 1TTQA 1R9ZA 1R46A 3SFWA 2EHHA 4LUIA 3LI1A 1J11A 3WD4A 3LX9A 3BO9A 1KBBA 1UZDA 2CLFA 2CYGA 1QNPA 2ZZ7A 3PUOA 4RNJA 2HCVA 2OEKA 2VDHA 3GE7A 3LRKA 1US0A 3ITCA 2DUZA 3ARQA 1ZQ5A 2WJFA 3JZEA 3A3XA 3PNZA 3QZEA 2DP3A 2W61A 3W1UA 4ATLA 2IKGA 1W2VA 5D30A 1SO3A 2G4JA 1BYBA 4U33A 1NOFA 1OFRA 3UR2A 1PZ1A 2Y8VA 3ABRA 4O16A 1ZTVA 3G0UA 4HYRA 1FWTA 1BFNA 1M01A 1M7JA 4QE5A 1CTNA 1VS1A 2ZUVA 1GQIA 1SFJA 4UTKA 3LCXA 3T55A 1SFTA 2QLYA 3WQWA 3I4KA 1Q7ZA 1WDPA 3B8DA 4XSMA 1GZGA 2VURA 4IHCA 5LGZA 3CL6A 3B3DA 4QJ1A 4DQWA 3K5XA 5GNXA 3W1TA 3BTNA 5D32A 1EDGA 5AC4A 5KZMA 3WDHA 4IMCA 3AAMA 1AG1O 4M24A 2BOEX 1HW6A 4FXJA 5HJXA 3I10A 3BOXA 4K36A 3CV1A 1XC6A 2AL1A 3GS6A 4GYPA 1BVZA 1DXIA 2MNRA 2BVWA 5JU6A 5KITA 3INPA 2JKEA 1PHWA 5AFDA 4DUOA 3VNLA 1LOSA 5BNKA 1X39A 1UD3A 3HMCA 5MKGA 5D9MA 3EOOA 4YIWA 4OJYA 1VC4A 3WDPP 4UQAA 3WEMA 3EEZA 4HPGA 3FV9A 2WVSA 1V79A 2RAGA 3EWZA 3LUTA 4JFTA 4EAMA 4IXHA 4IGHA 2BOFX 4C60A 2VX4A 1UKQA 2D1ZA 3WF1A 4D9PA 5LXEA 4PTVA 3H12A 4PMNA 3G77A 1SZGA 3P82A 4Q8TA 4WY0B 4A3UA 2PF0A 2I17A 4N9EA 1KO0A 3CUHA 1MDRA 1OFPA 1RJRA 1RZMA 3UBPC 4C6LA 2Y89A 2PTZA 4IMGA 3VKKA 2IQ0A 1QI3A 3W24A 1QK2A 3TE9A 1MFVA 3RMJA 1HFBA 3TNOA 3FN9A 1G1YA 1ESWA 5A5WA 5HWJA 4TTGA 3CHFA 3G3MA 3FEMA 1JD9A 3UYCA 3CHCA 1A47A 2QQ6A 3B8UA 4FSAA 5BW6A 4QCFA 5HK4A 3QTPA 2ODOA 3OVGA 3V3WA 2AQOA 4U5IA 1LZOA 3DFHA 3NPVA 5A69A 3UZXA 4JEJA 1QNSA 2JE8A 3VIGA 4Q8VA 4E5TA 4QR6A 2FZMA 1GW9A 1Q63A 5DT5A 3GH7A 2WWDA 1EA9C 3QMRA 3EEGA 3DG3A 3LPPA 4G56A 4M1BA 5IHSA 3O07A 1KFCA 2QCLA 3NPWA 5DCEA 3CPGA 3NPXA 2Y2WA 4DF2A 1E4MM 1ZBKA 3BSMA 2XHYA 4DY1A 3R25A 1A3HA 1JRBA 1BVNP 3UA4A 2V67A 3U2EA 2D20A 4XZHA 1JZ5A 1Q7QA 4JTSA 2FPYA 3JS3A 2XUCA 4J3SA 3AHXA 3WSUA 4W4QA 2X0HA 2BV9A 2ZZ3A 2BS9A 4MZ1A 1Q7MA 1TPEA 2XN0A 1V02A 4WIWA 4DUXA 3P80A 3TAKA 4FMVA 1AW5A 2PDGA 3QYSA 3ME3A 1J5SA 1EHAA 4C6EA 1R9YA 1JI2A 3ICJA 1IQ8A 3BLKA 2YBUA 5FF7A 3BCDA 3JU2A 3C3UA 1S2VA 1P7TA 2OWWA 4L56A 3LHTA 4KWOA 1M68A 1E40A 3PZUA 3EXRA 3ITTA 1CNVA 1B54A 3IK2A 2POTA 2CLLA 4UFKA 4FO4A 3HJZA 4IXXA 5FSDC 4MMWA 3VIFA 3APTA 4UMAA 1LT7A 1TR9A 2OXNA 5ABFB 3GG0A 4GI4A 4JIHA 2J9ZA 1E0VA 3V18A 3CM4A 4P8XA 3QM3A 3LDVA 2CZEA 2WCAA 2VI0A 5EGRA 2NQLA 5A95A 3OIHA 5H6HA 1JZ4A 1E4NA 1AJ2A 4WJ8A 2G97A 1R3WA 4C6MA 4V1YA 1FDJA 3S4TA 4Q7IA 4GQ0A 5DLCA 3GM8A 4H9XA 3E2VA 4RDVA 1BWLA 1XM3A 3WNKA 3DZ1A 3MZ2A 1YIXA 4Q4OA 5TBOA 3BOLA 1TMLA 3EDKA 3UFYA 3VNJA 4N9CA 3P7YA 4MLRA 4PMDA 3FY1A 4REQB 5LA2A 1PE1A 2XH0A 4P61A 1RAKA 2VCCA 1FCBA 2PTDA 1SUXA 2QGHA 5LA0A 3UNDA 4LVDA 4L61A 1XIDA 3PF3A 1N8WA 1Q2SA 1SMAA 2YGYA 4UFLA 3W7JA 4KEUA 3ZR5A 4IMAA 1G7UA 2ANUA 1EXPA 1LG2A 2V2CA 1KM3A 1M03A 1ZS2A 3GDKA 3A5FA 2V0TA 3NR0A 3PBGA 2X40A 5C2XA 6TAAA 1ODZA 3MI2A 1SPQA 1TUXA 2HS8A 1A5SA 2AMXA 2EG6A 4DWSB 1XYCA 4BI7A 2Y8UA 3FYOA 3NZQA 4NZJA 2P8CA 5F4SA 5AYZA 1EZWA 4HMEA 2A7PA 4W85A 2WAGA 2VL4A 3NFUA 1FWHC 4M5PA 5H8MA 5F4XA 1E1EA 2V69A 3DGBA 2YSWA 2YFOA 4O11A 4GQGA 4WXYA 5BOOA 1H61A 5A8MA 4FR6A 4GBUA 2OTDA 3DXIA 3W7DA 3SSJA 2XGZA 2Z28A 2Y88A 2OKTA 1VIWA 3BCJA 3OLIA 4IFKB 2YL9A 4MUZA 4I8YA 4M8UA 1H11A 3WUEA 4PCNA 4M80A 1OFAA 4YTQA 2ZTKA 2E1WA 4GO9A 3THAA 2PWEA 1XICA 4UFHA 3W22A 2BNJA 3KBNA 3GVVA 2GGIA 2J4GA 3C52A 4GIYA 2QT3A 4DJDC 3PZQA 3WBYA 1U5VA 3PVFA 3EWUA 2WMHA 3EA3A 4KEZA 4E0CA 3N9SA 2WSKA 4UTMA 1CXKA 1XDMA 3VTRA 2C18A 2AGTA 3EZ4A 4JNMA 3AYVA 5D38A 4LPCA 3RX4A 4IG2A 2Z1KA 4LXFA 1BHGA 1VBHA 4LS0A 3MDUA 2DT2A 1M7PA 1DV7A 1SFLA 4E3TA 4LX4A 2Y6ZA 1RP8A 2W6RA 4AMAA 4GYFA 1G6CA 2WSYA 3LCLA 5FL1A 3CH0A 3WFLA 1JDDA 4PUEA 1TPC1 4NSBA 3GWQA 3BMWA 3W7NA 2NX9A 3FGCA 2EXOA 2V3EA 2IMRA 2YL8A 2P1FA 3GHTA 1GYNA 4J2PA 1W8GA 3WMSA 1H7WA 2Y7DA 4HHMA 2VD8A 4K38A 3WF2A 1KKOA 1KBKA 3IAQA 3RAOA 4HPJA 3TZNA 5J8LA 4XKYA 3BG3A 5FJIA 3PPFA 3MQTA 3T2PA 4O28A 1CDGA 1NWSA 2VEIA 4RX0A 1TWZA 4FOUA 1R9XA 4C6KA 1JF5A 1B3YA 4JTIA 1VCGA 3N6HA 4K7YA 1RY8A 1HJUA 3B06A 1BKHA 3LV5A 3RR1A 4QBXA 9CGTA 3W7OA 4B5VA 4HOZA 4WJXA 4OOUA 3MYOA 1I9CB 1S1RA 3DKJA 1I2OA 4TOQA 3LLFA 4C91A 4KESA 3WO8A 2GOUA 4Q8MA 5IM51 4Z1BA 3UZJA 5BZAA 3PC0A 1XFBA 4M19A 4NZCA 4GNJA 1KLYA 1QO2A 5L6UA 5AKQA 2VC9A 3OG2A 4AX7A 3TYBA 4PMRA 3UU0A 5DEZA 1FWDC 3TN4A 3BAKA 1BQGA 2J75A 3R89A 2FMNA 4F2UA 4B4FA 1EDTA 2J74A 1PUDA 2PTYA 3AHVA 1AODA 5G4WA 1F07A 3SN4A 4PB5A 2QMJA 3R0DA 4G7EB 5E9XA 3ALGA 4KRUA 3S1VA 2ZA2A 1S2AA 3V5CA 5J04A 2PGEA 2PZNA 1C90A 3NQ7A 1JCYA 3PPHA 1Q6CA 2JF7A 1FXQA 2QHAA 2WHKA 4XO6A 4LAUA 1DWFM 2C13A 4XTDA 3QLDA 2ZZ2A 2Y24A 4HZ8A 1OVDA 2YYTA 2QPXA 2V5CA 3GG8A 3POHA 3SN0A 4GHRA 1QI0A 3T0AA 3PAJA 3UXAA 5EFDA 2W79A 5AC7A 3K4AA 3VCCA 1NOUA 2GJRA 2ZUSA 3QJAA 4OUIA 3GTHA 3RCNA 1SQ7A 5DCBA 1JYNA 1J9YA 5JIWA 1L8PA 3O05A 3KOZA 4JL1A 4GCXA 1KB3A 1HL8A 1IIHA 2AL2A 4JEQA 4UTJA 3UWUA 5G4EA 2CLEA 4URIA 1E6PA 5AHMA 4L7ZA 1D7FA 4A8NA 1IT0A 3MWCA 2HJPA 1EWDA 4I7VA 3B0PA 5JXQA 2J9XA 4CQDA 2X1IA 3SRFA 1R3QA 1OFOA 4NX5A 3SURA 5FEPA 4R85A 3O6DA 2NUYA 4RZ5A 5CAKA 1JYXA 1JCJA 3WLTA 1DYSA 3VGFA 1MQPA 2QJHA 4P8WA 3W74A 4GABA 4Z2HA 4LUSA 1VIZA 1WXZA 3EB4A 1WB0A 2OYKA 3W7CA 4B5WA 2DQWA 3W85A 3WLIA 4US5D 2WSPA 1WYIA 2O4MA 4NUWA 2DIEA 2HS6A 1YDYA 3A9IA 3SIMA 3G22A 5HANA 2ZADA 1O5KA 2XWEA 3RJYA 1AMKA 3BICA 2HXUA 1E43A 2VFFA 3KAOA 3G24A 3QEZA 1YTEA 3THDA 5FEZA 4AHPA 1JI1A 3MKCA 3DX5A 3G0SA 4RW5A 3W1LA 3RIKA 3AMGA 4RE0A 1M41A 4FIQA 4GVGA 4C6DA 3TSDA 3AS1A 4KERA 3BSGA 3PFRA 1CEOA 3NM3A 4US5A 3S6DA 3TMLA 5I03A 4RZBA 2OZ0A 2PODA 4FNSA 1MRQA 3V5OA 3LI0A 4QGCA 4ZR8A 1CW2A 2OQHA 4H6EA 4DZIA 1UWSA 3F7JA 3CT2A 3NQVA 4RR4A 1TWSA 4MB3A 2Z6IA 3P67A 3F4VA 2BP1A 2OZTA 2C0AA 1HG3A 3GFZA 2P5NA 2FGZA 3IAPA 2PDMA 1DXFA 2YXXA 3UESA 2QJIA 2HPIA 2C0HA 3VVGA 3MZNA 1TX2A 2ZFAA 1MEHA 4DNHA 3EOLA 1J4EA 3C61A 4UBPC 4J28A 1K77A 4U31A 3MMWA 4RCXA 3ITXA 3FDKA 3KL5A 4J40A 3RLGA 2YIHA 2BLEA 4D8ZA 3UPWA 3BUVA 3PPCA 3AQUA 3OQ8A 4UOZA 3K8MA 3NQGA 4E4UA 3VM5A 2DH3A 3TYUA 2WVVB 1HO4A 3T78A 4XX6A 4NI8A 4MNJA 4GCAA 1ZAHA 3BMXA 3Q4DA 4R3UA 1GPWA 1UWAA 3M5ZA 1N82A 3SEPA 5LIUX 3FJ4A 1VLIA 5LIXX 4HT3A 4AF0B 2DSZA 1F73A 1AH0A 1GOKA 4RZ6A 2Z1BA 3R13A 1H1YA 5FAGA 1SYTA 2PPGA 3THQA 4XD3A 2O56A 2ZXBA 3EWBX 3OBKA 3IGSA 5HMSA 2XIIA 3GY1A 1I4NA 3UG3A 2YFNA 5LHEA 1HL2A 3SADA 5LNUA 2DSUA 2PC4A 2I1OA 5G2HA 3TJXA 3T07A 4NASA 4B9YA 3NVDA 1C8VA 2J62A 1RV8A 1TV5A 4L6DA 1V6VA 1JAKA 1UR4A 1HP5A 1G4PA 2FHCA 1H7PA 2MANA 3AS3A 5I3JA 4HGXA 1SZNA 2W62A 5CZTA 3SW6A 1UPMB 1WXYA 1DJXA 3WJYA 1XLFA 1XUZA 3IJ8A 2ZDSA 1C93A 3PUEA 3G6MA 3T4CA 1EJUC 3LEPA 3JRKA 3ABXA 1HGYA 1UD2A 4LRSA 1Y7VA 5JVLA 3MS8A 2E68A 1KRCC 4DI8A 3QV8A 3AWNA 2OMAA 3EA2A 4G8TA 2CZVA 3WDJA 4ZL1A 2G95A 4GI8A 3PS7A 3UEQA 1RK5A 3BDKA 1QW8A 3FIGA 5A1AA 3R94A 1A5AA 1TRIA 4MJMA 3RF9A 3UCDA 3MO4A 3NQBA 1H41A 4LT9A 1W1ZA 4XZMX 1K9DA 4GFSA 4CN1A 1ZY9A 4ZQRA 3VGEA 4MIMA 3OGVA 1H09A 2QCMA 2FPVA 1A53A 5EA9A 3H70A 2YCLB 3HG3A 1MW0A 1UQYA 2YKKA 3BOFA 5D9OA 4ZOCA 4D2JA 4IFRA 4JFVA 1B9ZA 4X63A 4GZIA 2BSLA 2IKIA 3L4YA 2E9BA 2XFWA 3P14A 3ONBA 3LGDA 2HVMA 4WUIA 3OP2A 3W1AA 1J12A 3LZ3A 4NJIA 3F4DA 4MY9A 1UC5A 1AQ0A 4LY8A 1T5AA 2O92A 4HA1A 2PFHA 4Q4PA 2GJLA 3WQ8A 4JTTA 2YJQA 5A6KA 2Z1WA 2H9AA 4GC4A 2C79A 1Q6GA 1GQJA 3W73A 5FKYA 3UWWA 1ZBVA 1W1PA 2J78A 1M3UA 2Z2UA 3AI0A 3HM7A 1B2YA 1JR1A 3UZWA 3UG5A 3SUVA 1J93A 3WUFA 1UP3A 1G01A 3MVTA 5C9XA 1UROA 3LHWA 1FY6A 2ZRWA 4QEEA 1PTGA 5EMUA 1ZBCA 5J5DA 1VAHA 1K7XA 4AWSA 2VELA 4HZMA 4ZB2A 1ZCCA 2ZUTA 3GD6A 3LN3A 2D23A 2BY0A 3MTWA 1EP2A 3LY0A 2G3FA 4IOTA 1NARA 5DELA 4OVXA 1P6BA 3MP5A 3AOFA 4B3ZA 5FF3A 3PM6A 2VRQA 1PZ0A 5DXYA 2J7BA 2I56A 4AD5A 1UA3A 2QZRA 3GRIA 5CSRA 4XUGA 5IOBA 4TXEA 1UIOA 2J24A 2XH4A 4N9BA 5K9XA 2HTMA 2FJKA 2CCRA 3W2KA 2RUSA 1YNPA 3PZTA 3VO0A 3G18A 4AY1A 1C9WA 3A24A 4MNLA 1XDJA 4JHZA 4K1WA 3LB0A 3B8WA 3TCSA 1HP4A 5DRCA 1RLCL 4RE2A 1MEIA 4LAOA 3P8JA 3C5QA 2ATMA 4DO5A 2RDUA 4NYUA 4XB3A 4QJ4B 3F5KA 2XSXA 1LJYA 2NZLA 1F61A 4YVXA 3UPBA 5FESA 3MVIA 2G3NA 4Q8WA 5FOOA 4LNCA 3TC6A 3PZIA 3BZGA 3BLEA 3SDOA 4CNPA 3Q67A 1H7NA 2J7FA 1PAMA 3HQPA 3RNDA 2I5IA 1TPVA 3VIIA 2DEPA 1VP5A 4EXBA 2Q6ZA 1Q2RA 3NPUA 2ZA3A 1GQNA 1S38A 1XISA 3QKEA 3U3HA 3VMPA 1REQA 4FX7A 4AZ5A 2WO5A 2WSRA 3GXFA 3B4YA 1A5BA 6REQB 2OU4A 3CUFA 2FYMA 1JPKA 3R11A 1NAL1 3KZPA 4OIFA 5I0DA 1XBVA 2UWFA 2D2HA 2RGMA 3U2CA 1TCDA 2ADAA 3ARWA 3U4AA 3WUGA 1F8MA 3UVAA 3B4UA 5AY7A 1LROA 4AU0A 4PMXA 2YBVA 4AC1X 3IIVA 3PBUA 4D6HA 2WNQA 2WMFA 2GJXB 1IV8A 4GMEA 1UOKA 1ECEA 4GUIA 3L2LA 3RK8A 1F5ZA 4Z1AA 3KHJA 1GVIA 3LU2A 4MKSA 4UTWC 1AJ0A 1YBQB 3H22A 1TE6A 3SY5A 1PDYA 1MXGA 3R4IA 3ATZA 3QHNA 1OYBA 1UUOA 5FI8A 4I3GA 4WGXA 3P6LA 1MXSA 1EF2A 1NELA 1UWQA 5EMKA 5DN1A 3FSUA 2FB2A 3NO1A 4AZCA 2EPNA 1SO6A 3S2CA 4KRZA 3DG7A 3GXIA 3SQMA 2PDPA 3AMLA 5A8NA 4Q22A 1W1IE 2X2GA 3M9YA 3BV7A 4C7DA 1B31A 1QBAA 4IGSA 3WQEA 4KBXA 4RV8A 2E09A 2P3ZA 4KFPA 1CXEA 1SFSA 3S5ZA 3VXGA 1E55A 5GNYA 4NILA 3FLUA 4LAMA 4FXRA 4LBUA 4ORIA 3SCQA 1OT1A 4I9AA 3IUDA 3LXAA 4BQ5A 1D3CA 4N7QA 3TYZA 5E70A 1S5MA 3ITOA 1SJDA 1SZFA 2E6DA 2QJJA 1FWJC 4WHBA 3S5YA 2PEVA 2EEXA 3TFCA 4M6PA 3ANUA 4PGLA 1W9UA 5LNWA 4YNGA 3QY8A 4RE4A 1EP1A 3HG2A 5HWNA 1LQ0A 3QPEA 3ZVHB 1LLZA 4AZ6A 3GVWA 2E6AA 4KWVA 3UF9A 1KM6A 5K9DA 3P3BA 1BXNA 4RXGA 4GY0A 1S5NA 7XIMA 2WYSA 1SGJA 1VPYA 1XRTA 3O3RA 2GVGA 3JR2A 4AC7C 1VRXA 1BF6A 3GZAA 5A6AA 3VOJA 4EWND 1OCQA 3T2OA 2FVLA 1L6GA 2VWSA 1R38A 4M6UA 4JQ3A 3UVIA 5HQLA 2C8NA 4MVAA 2IXVA 1PTAA 4PE8A 3AIBA 1HKJA 2NWRA 3SCRA 3DUGA 3D46A 3PNUA 2VWTA 3WD1A 4CEUC 1UA7A 3TWBA 3WK3A 2WPBA 4V1XA 1JCXA 4FI4A 3GUGA 3CHDA 2QUTA 4AYSA 1B57A 4XTIA 1ONWA 1E9ZB 4OGZA 3B9AA 2VT0A 4PL2A 2CERA 1SJBA 3N6QA 1ZJAA 3V16A 3W1PA 2VKZG 1M1BA 3UG4A 4AEFA 1VCVA 1T6MA 4PBFA 2QUMA 3MV11 4KPLA 4HU3A 1UYQA 2GDUA 3RU8X 3CUZA 3T0TA 1T8QA 3DI1A 1L6FA 3TIMA 1EYEA 2DY3A 1J0ZA 2JKPA 1E4LA 3GH4A 1OFBA 3WNPA 4OWGA 1K8XA 5T26A 3WQPA 4JDBA 2VEGA 4LEQA 4OECA 3WL1A 1SR0A 1ZFJA 3TQPA 1M5WA 3CZEA 3DFPA 3LOTA 1H0GA 4CD6A 4AWEA 2Y0FA 1WOBA 2R1PA 4G7FA 5AN7A 4Z42C 4YLWA 1OGBA 1MEWA 1EF3A 3FA3A 1OIFA 4JTJA 1PYFA 4DWDA 3LCIA 4WQ6A 4XZBA 1PTDA 4FXFA 2DFAA 3E0IA 4FNUA 4NF7A 3S0CA 2XVGA 8CGTA 3UJ2A 4R5EA 4ADSA 3EKGA 3GW0A 3AU6A 2E5DA 3THUA 3RJXA 2INZA 2ZUUA 3SCUA 1CENA 3TYAA 2V5KA 1U22A 3IRDA 3GVQA 3DC0A 1PWMA 1CXLA 3AMKA 1H51A 3KW3A 1B3VA 5HJLA 1XIBA 3RYSA 1Z9AA 2DQXA 1I8JA 3N2TA 2FPTA 3QLLA 5DXXA 1B30A 1E70M 1ZHAA 1TV7A 3GH5A 4HU4A 1EDQA 3VIJA 3L4XA 5D33A 3AHZA 2BZNA 3GTIA 3E0LA 1HN1A 1VBGA 3M0VA 1BKSA 4H8VA 4MB4A 4ZCWA 5D02A 1DQWA 3W7MA 1PCKA 3V1HA 3IARA 3OZYA 5A6SA 4UQDA 3VIMA 2VVNA 3OJGA 1M9HA 4XAPA 1I2QA 3F5LA 1NWRA 3FX4A 3S1XA 3UCCA 1GUVA 4UXDA 3W82A 1IEXA 3REQB 1OYCA 1KM2A 4FA3A 4C1KA 1TR1A 4NZ3A 4EANA 5RUBA 4AZBA 1X7FA 5M17A 1IR2A 4E38A 4W86A 1RR2A 3EPMA 3E5PA 1QPKA 1WDDA 3FEQA 1J96A 3CL8A 3WDIA 3PB0A 4HB7A 2F38A 3WQGA 1S1PA 1Z8AA 4ATDA 2OG9A 3F1QA 2PDKA 1JIBA 2IQDA 1QO5A 1V6TA 3BV4A 1BXBA 1W5NA 4O12A 1XLJA 3P74A 3PJUA 2J47A 2VC7A 4HK6A 5JH1A 2H90A 4JN7A 1IZKA 2W0UA 3AJ7A 2Q71A 2XFRA 4DPPA 3NL6A 3G1FA 2QCDA 3TC7A 4YN5A 4JQAA 3BQ5A 5EY5A 4D6IA 4O1CA 5IHRA 2AQVA 2OO6A 4M6VA 4JQ1A 1QASA 1JUEA 3K2GA 1Q45A 1THFD 3BW2A 1GW1A 3BXWA 3EXSA 4HQVA 1HKKA 3ARUA 1PX3A 1KM4A 1D2KA 2Z25A 3TR2A 4JFWA 4ORMA 3KBVA 3LGGA 4J35A 4BEQA 2GSEA 3E6EA 2YB4A 3EDDA 1W8SA 3FCPA 4WK9A 5KZDA 3M6DA 1TPH1 4DO6A 3VGHA 3R10A 3ZSSA 1FVPA 2WSQA 3MDWA 2DT1A 3WH9A 3HQ1A 4GH3A 2E9MA 3W75A 1J6PA 1ZJIA 2GOKA 1JGIA 3RLUA 3BAYA 4RPPA 1JCTA 2YA0A 4L6HA 2OEJA 2YA2A 4ZB5A 4BQ2A 3QVQA 3ZS4A 3LCFA 1GKPA 3NQDA 1TA3B 3L2IA 2B81A 4JTFA 4OHQA 2BB0A 1NSJA 1I60A 3OIXA 1ZJHA 1JNDA 4M56A 4QQ3A 2P0IA 1S39A 4WEVX 3TR9A 2PAJA 4KETA 3N13A 2R1MA 1FHUA 3H2EA 5IDZA 2H6RA 3ARVA 3VKCA 3VI2A 1E6RA 4PCSA 1VENA 4EAYA 2VZTA 3N4AA 4C6BA 1Q6LA 2DT0A 5HNUA 4LU0A 4G5DA 4O1DA 5BRQA 7ODCA 3VKJA 1TMHA 2HISA 4LUJA 2PBGA 4OBRA 3TVAA 2DUXA 2UV8G 4HD5A 3AMCA 2IQTA 3M0IA 1BTMA 3MO7A 1UZHA 1GORA 4DJFD 1MMFA 3W6YA 3PULA 5BOEA 5I3IA 1UUMA 5AB3A 1HXJA 3VABA 3VKAA 1OX5A 2PWFA 1XSIA 2OODA 3DECA 1YNYA 1W54A 2V68A 3W53A 3WLHA 3NEVA 2QMKA 2D24A 4LJ3A 3LXBA 1PWLA 1LT8A 3W37A 1NDWA 5GPRA 4JFUA 1Q4WA 1UMLA 4I5UA 3H53A 3NUKA 1EL3A 4H2HA 4DBUA 2XN2A 2PURA 1GJWA 3K46A 4K37A 1QFEA 4XV0A 3VDAA 3LHYA 4J3UA 1KM1A 2FFIA 4PA8A 4U3CA 1WO2A 1F7BA 1DVJA 2CWNA 1GHRA 3OVQA 3TSBA 1V0LA 4KCTA 3XIMA 3SCPA 3LTSA 2YB1A 1G0CA 1TPFA 3LCGA 5D8ZA 2D2GA 3EB2A 2Q8XA 2WZHA 1WKFA 2PWVA 1JPHA 4EVZA 1EC7A 3W2NA 1W1B1 1HF6A 2Y5JA 4UTHA 3AZSA 3W7EA 3U0HA 3S9YA 2QUVA 1C3FA 2Z2BA 1YTKA 4S3DA 3GBDA 4ICMA 3A4XA 1TZ7A 3Q2DA 1S2WA 4PUDA 3SRDA 2XVLA 2CU0A 3DYMA 5HAOA 2FZ8A 4TX9A 5F2GA 1EJVC 1EIBA 3GG7A 4GE8A 1OINA 1VB9A 3N17A 3CAWA 3KCOA 4WDXA 1K1DA 3QMSA 4TVDA 3QOKA 1F4AA 2FTWA 2PLJA 1LRQA 1M53A 4ZOBA 3CB8A 4PRWA 3QF0A 4O50A 2GUYA 5GJPA 3VD4A 3GK0A 1YADA 4IMFA 1WCGA 3FK4A 3QXBA 4CCZA 4TU1A 2QJGA 3F4WA 1CGYA 2ZKMX 3CUJA 1WZKA 3QV9A 2RKXA 4QNEA 2QIIA 4WR3A 2DVXA 3VNZA 1XLMA 5E9AA 1GQLA 2J6XA 1V3IA 1MWOA 1AL8A 1XYMA 4MSSA 1W3IA 1XRSA 4ZQNA 3RN6A 4OTKA 4ROQA 3CHVA 3WH8A 2H8XA 3B9OA 3CEPA 1HNYA 1C29A 2C3ZA 4W8LA 5C9WA 2VFGA 3OB8A 1Y5WA 3NDZA 2HNEA 1KGUA 3ITLA 2F9RA 3G8EA 2X41A 4MUPA 5HNNA 1W2PA 4H6RA 3W72A 3DFOA 3U9IA 2EKGA 4DUWA 3ES7A 5LKYA 4JIPA 3CQJA 4EF8A 1R30A 3TCEA 1K03A 5HUPA 5CSUA 2VEPA 1TIMA 2C1HA 4UR9A 1GK8A 4E8CA 3LMZA 5FJJA 1KWGA 2F2HA 3GZ3A 1EFZA 2XIMA 1W9XA 4DF0A 1ISXA 1VFFA 1SVDA 2UY5A 4MWAC 2V30A 4NY2A 2YYUA 3MJMA 4NG3A 2HRWA 4YWIA 1DWAM 1VHNA 3L4TA 1NP2A 6XIAA 4AFYA 4YTUA 2VD9A 2A0NA 5CGTA 5EBUA 1FWBC 3AU2A 1WP6A 1IYXA 2C14A 2PTXA 1W31A 3WH5A 4L1WA 3P84A 4CKQA 3HBLA 4GXWA 1WKYA 1GOWA 3NQAA 4IPPA 2QR6A 1N8FA 3WCZA 4LTSA 3NQCA 4MPQA 1KBLA 3WNMA 4WSJA 4AZGA 1GYLA 4D8AA 4HNTA 2IUZA 2X7WA 1T0OA 3RPMA 1HTIA 3K30A 3PSVA 4JIRA 2DT3A 5A8OA 4WSHA 5CGMA 2VFIA 3VNMA 2XGBA 2HPMA 2XU2A 1MNZA 3CQIA 3CEUA 3GNRA 4A22A 2X1RA 2NXIA 5CPTA 2V3GA 1XF0A 4X0NA 5CSYA 5PTDA 1ZL1A 5A2AA 3QV7A 4JS3A 2AAMA 2CKSA 3LQLA 3VDCA 5HUOA 3HG4A 3SRKA 4H9UA 2IKHA 3ZO9A 4FLQA 2NQ5A 1GVEA 1H2JA 1DHKA 4KCVA 5CC3A 1Q5MA 4FF5A 5GJNA 3KLLA 4J4KA 3FOKA 2H3BA 1V02E 5CAHA 4O52A 1TKKA 4ZO6A 1Q66A 1V51A 2J79A 5M5DA 1XYBA 3G5EA 3STGA 3B8TA 2WK2A 3O15A 5I2UA 4IJCA 2E3ZA 1FWIC 1A49A 2JFEX 2VCBA 4CVWA 5F2MA 2QCNA 4IT1A 3IJLA 4Z2IA 4JKKA 3W3OA 3UWYA 1Z69A 2XIBA 3W6LA 4GINA 2CIPA 2PA6A 4LVFA 1XLDA 2CHOA 1DIEA 1VBJA 3E38A 4MDOA 6TIMA 4JKLA 2NUXA 1GNXA 2QAPA 2YOCA 3TA6A 3KL3A 2QJMA 4CQAA 1FTXA 3MCOA 3PG9A 1OB0A 3QQWA 2OX4A 4MWAB 4WXZA 4B3KA 4DJFC 2BXVA 4CD8A 3RHGA 3UW6A 1MRAA 3ECQA 3TFXA 3UWQA 3SUWA 4YYCA 2D2OA 4NZ4A 2D2JA 4PUJA 2G3JA 1T40A 4EPBC 2ISSA 1WXJA 1UD6A 1BRLA 4WJEA 4GZEA 2BBFA 5AYBA 2GGHA 2W63A 1TV8A 5LZLA 1ITUA 5AECA 2ATSA 4RZ4A 2NVAA 3VX1A 1R8LA 1UR1A 3U5UA 1FP8A 3VIPA 4BKNA 4YTSA 3CPUA 4HN4A 5E93A 4FLOA 4IJRA 4LV9A 4ML9A 4CLMA 2UY2A 3V35A 1CT5A 3M7SA 1F3TA 4AD2A 3CQ0A 3PG8A 1WPCA 3M46A 3UXIA 2DORA 4Q8OA 3VOCA 4DEFA 1FCVA 1CB7B 5D2YA 1H63A 2GZXA 2XZ7A 2FLIA 2UY3A 2WNWA 3WYZA 2Y1HA 3AS2A 3LG3A 4AIUA 4DZHA 4G1NA 5D37A 1B0IA 1YXYA 4N4PA 1VBRA 3MP3A 4HNVA 4JOMA 1E3ZA 4UNLA 4JGDA 1XLGA 1NJJA 2IPFA 5KZEA 4NXSA 3ITVA 2UBPC 1CGWA 1B3ZA 3GXDA 4UQEA 1WAUA 4CGTA 3DESA 1GZ1A 2Y7GA 4JIQA 3KS5A 1JXJA 2YDQA 3CXOA 3R5EA 2QVHA 1IXOA 2V8ZA 4EXAA 4LGXA 4Z0JA 5I09A 1V6WA 3RFAA 1GOQA 3TXZA 5D09A 2DZBA 2CEQA 1O94A 4MPKA 3TW9A 3FA5A 4NJKA 4O1AA 4UIOA 3WJZA 1OHLA 3L4WA 3T0DA 2V63A 1E6ZA 3T0BA 1TTJA 4K8GA 3LA4A 1VD6A 4ACYA 4PEEA 1D8CA 1Q8AA 1PX8A 2PF8A 3BJTA 1DL3A 1RALA 3T81A 3VOGA 3TMQA 1XG3A 4XBKA 1XG4A 3S9ZA 2GJPA 3NQ2A 1TZZA 3K1DA 2ALDA 1XQLA 4TTUA 4PTDA 1S2CA 3HO8A 5FF0A 1X97A 3T1GA 2P10A 4PUWA 5F4WA 3BE7A 2FIQA 4GZ7A 4ZA0A 3WQ4A 1Q65A 5HATA 3CS2A 1YE4A 2FZNA 1UZ4A 1OY0A 4J3TA 3UWVA 3SCOA 4QJ3B 3EA1A 4W7UA 2ZRYA 1RPKA 2FH6A 3GNPA 2VM8A 3KCJA 3ZJKA 4A2RA 1EUNA 2PDHA 2QW5A 3UP8A 5T9CE 3LLXA 5FF4A 1TJ2A 1TPWA 4FB7A 4Q33A 3NSNA 4HSOA 4UNIA 4F79A 1QJWA 1UKOA 4H8UA 2XH7A 3MSGA 1PKLA 3E2QA 5CJNA 1Y0EA 2WJDA 4AWTA 4AY7A 3R79A 1F76A 3RO6A 4WY0A 4JKMA 2J8TA 4GYKA 4WKAA 1RCOB 4GKLA 7TAAA 4R88A 1VFUA 1W3TA 1ZENA 2A3AA 4E4PA 5HR6A 3L5LA 2DDXA 1GCYA 3C86A 3GR7A 4GC3A 1Q6QA 4ZMGA 4H6QA 4JICA 1W37A 4MAZA 1MQQA 3GTXA 2PWUA 2A3CA 2CETA 1WOAA 2DSWA 1V6YA 3NURA 4HHPA 4PMJA 3EX2A 3TN5A 2ZVRA 2OO0A 4YTRA 1IZJA 5AHLA 4MDPA 4JN6A 4JX4A 2QCFA 2PDYA 3PN8A 1FWRA 1F74A 1W56A 4UQ9A 5A6MA 1C7SA 3B40A 4HP5A 2AKZA 3O8AA 1C91A 4O8RA 2W4XA 4NZ1A 5CZJA 3H6OA 2ZUNA 2E67A 3NO5A 4C6FA 2ZC1A 3N73A 1K6WA 4INFA 3GKAA 5CZKA 2OLHA 1VH7A 1NFPA 4I9TA 4LF2A 2J77A 1LBFA 4IQLA 4K6AA 1O4UA 4FLRA 1RD6A 4JYFA 2V5JA 4E3VA 3QN3A 2A3HA 4AIEA 2BTMA 2VRKA 2CXGA 4HPNA 1XH1A 5CPQA 4DX3A 4LUTB 1V3LA 4DVOA 2C71A 5BWAA 2QV4A 5BCAA 1EOMA 1GVSA 4I6VA 1UD8A 3ZWSA 4RKAA 3FKRA 1J8VA 3LBCA 4R7WA 3W7QA 2YXOA 1VLWA 1TRDA 4ZXOA 3H2NA 3QYQA 2OELA 3CIVA 3E0VA 2CBUA 3Q94A 4E2BA 3KOYA 4W8BA 3M5YA 3EX3A 2CC0A 2AQWA 4PMOA 1XSKA 1Q13A 1RBOB 2PDXA 3CYVA 3M0XA 9XIMA 1E5JA 4ICNA 3DYOA 2QDGA 4W7VA 1W1TA 1E71M 1JDCA 1VEMA 1DE5A 5ABFA 1I0DA 4XD4A 4D6GA 1XYLA 3JUGA 2A21A 1LWJA 1KFWA 1OIMA 3L4ZA 3PWIA 3SQSA 3GC2A 2EG7A 1OCBA 3S6TA 2P76A 3SECA 3QSRA 1US2A 3UWEA 1SO4A 1TPUA 4A3HA 1E0WA 1VQTA 2NLYA 2NQJA 4QE1A 3AHYA 3W1QA 3OG3A 3A3WA 3LXCA 3QW3A 3KP0A 3WLNA 1K02A 1AFSA 2VGFA 2Y7FA 2B7QA 3ENLA 4BQ3A 4P7OA 4M3PA 5KINA 3ERPA 3GR8A 3ZMRA 4UOQA 4REQA 4ES4A 5I24A 5H8PA 5U7SA 4LYRA 4DWSD 1W91A 3VOFA 4PMZA 2WZMA 2VC6A 4K3ZA 2ZCGA 1PVNA 3L9CA 1JPIA 1P0DA 4Q4SA 1JVNA 2PLCA 1GQKA 2XIOA 5DMMA 4JTKA 3H2CA 3VFLA 4KGJA 3LCWA 4NHVA 1NEYA 5CC5A 1E6QM 4JIEA 1JZ7A 2GWGA 3EKLA 5D03A 2QJNA 4OQVA 2WHLA 2I9EA 3ARXA 5JQ9A 4BA0A 2DZPA 1ZBWA 3DBNA 2PDNA 4S38A 2UZ9A 3KXQA 4QDPA 3LHZA 4DWSA 2NWSA 3OOQA 3PZOA 2F84A 1EX5A 3VGGA 1ZALA 5REQB 4UMCA 4LB3A 1MSSA 4ZODA 1FHLA 5C2CA 3N29A 3MHGA 2GQ3A 5D2VA 3M4HA 2QCHA 2WOQA 1TYGA 1PL9A 1M7OA 4MFEA 4JCLA 3CZGA 4KS0A 1X8CA 1XR2A 4IFKA 3OQEA 1R7OA 4R33A 2E8ZA 3KWXA 3SIZA 4AD3A 2OR2A 4E8GA 1K4HA 5M1TA 3GR4A 3WD0A 2A3BA 2P53A 3CT7A 5AZ0A 2X30A 2F7FA 1HIZA 3WLKX 1ONRA 5A3HA 2WNZA 2X2YA 3W0KA 3VOIA 2PU1A 1MZRA 1VYSX 4QG6A 4YPJA 2FB3A 4LWWA 3QY7A 4BK9A 2WMIB 2FVKA 2NXHA 1QOXA 1HJWA 4DO7A 4QS6A 1X8FA 4JX6A 4H3DA 1OD0A 3NAVA 3E3HA 2VC5A 1FH9A 1QNRA 1QI4A 1J0IA 2J7CA 2OLAA 4OBTA 3WQCA 1ITCA 1NVMA 2PB1A 3TXVA 4NNCA 1LBLA 5CBBA 4B90A 1PS9A 2E5CA 3TN6A 3UYIA 5HMDA 1ZP3A 5D4YA 4PCFA 3VU2A 5EYWA 5LA1A 2YLLA 4DZAA 3TYEA 1GVRA 3T8LA 4TIMA 3R8RA 4P7LA 1YPFA 4UB9A 3I6RA 1HUVA 2BASA 3GDBA 4KEVA 4CCDA 2DZSA 1JZ8A 1F6KA 1WDRA 4HVXA 1VZWA 5CXPA 3F5JA 3GU2A 2PDWA 4BJHA 5LSMA 4LF1A 4ML4A 3AIEA 2PRMA 4ACZB 3WDRA 4DJDD 2F6XA 1PKNA 3B0XA 2WBGA 3WD2A 1KNWA 3IJ6A 1EEXA 4B92A 2VO5A 2WHJA 3BWWA 3S5SA 4ZO8A 2WW5A 2PLMA 2GGEA 3DH7A 3ANYA 4JTEA 1B3XA 4ZQOA 5HWMA 4DI9A 3LTYA 4NAEB 4R53A 4C7FA 5LHFA 4D8LA 5EFFA 2W66A 4HZ6A 3ARSA 3QOMA 1RLDA 1IEQA 1KGWA 1KR1A 2NVDA 3G3DA 1UJPA 3GIYA 2O4QA 3VGDA 1ZJBA 2BHZA 4DJDA 1DJIA 1MW2A 1SJCA 4AIBA 2Q09A 1D9EA 1XRVA 2WMGA 3QMTA 2ZX6A 3H4XA 4DRSA 2D0HA 1DTUA 3RLVA 3HV9A 1OG0A 2Z0IA 3ZXWA 2FKPA 3CLWA 2ESCA 4G7EA 1R2TA 1WA3A 3TZFA 3DERA 1V0KA 3W83A 3CAVA 1KFBA 1DOSA 3MJYA 4ZOEA 3M0HA 3POCA 4GX9A 3ANVA 3NJ3A 4HBKA 2J8GA 1B9BA 1TFVA 3EMZA 1P6CA 5BU6A 4DXXA 1WX0A 4LCRA 2DSVA 1GTEA 5C5YA 2XH2A 1RH9A 5BROA 1QVBA 3NQMA 3DDMA 3EGJA 4X9YA 3EOUA 4AD1A 3RRAA 3G1RA 3WQFA 3B8IA 3H4WA 3WK1A 1Q85A 1IEWA 7REQB 1DJGA 5XINA 1PZ2A 2V3DA 4PODA 5I5RA 2Z1SA 1EC9A 5HR7A 3GXTA 3GNDA 3T4WA 2ISWA 1POJA 3FJNA 3K1GA 4X60A 3C0LA 3VNYA 1U1HA 2WWCA 2HDJA 4EACA 1Q3NA 2ZZ6A 1W17A 5HOSA 3VX0A 3WK2A 4FX8A 2HBXA 3M0LA 3WN6A 4C6IA 3KHDA 1LLOA 3R43A 1R3SA 1YXDA 2JBMA 4JY8A 4H19A 2VUYA 4C6OA 4GKTA 3IVUA 1OEPA 2ZRVA 5A6LA 1O5RA 4QS5A 3SCVA 4O54A 1JF6A 1L8NA 1E73M 2PDIA 2HSAA 1UCWA 4TUFA 7ENLA 5CPLA 1TV4A 1RPXA 3WF3A 3W1MA 4DWSC 1OGSA 2CWXA 3SCNA 4E2VA 3AC0A 2I5QA 1C8YA 6PTDA 2G0WA 4LQ1A 3WQ5A 4AQLA 4I5XA 2WCGA 4RDZA 3W38A 2RJGA 1XYFA 1RD5A 1ZUAX 2ISVA 1YRRA 4A4AA 1A5MC 4D6EA 3IGUA 3KVMA 2JEQA 4C90A 4KFOA 1GKQA 3EXTA 4BF7A 3O2LA 1MW1A 1L6WA 1EB3A 2BGSA 4IP4A 2RH9A 3OTRA 4NNAA 3MBDA 1WV2A 2ZX9A 4RUBA 1ZSXA 1SW0A 4LYKA 4TX8A 4ALDA 1XLLA 2Z2AA 3VZXA 3BC9A 2GGJA 4U28A 5HULA 3M1ZA 1BG4A 4PUUA 2GK1B 4A3QA 2YZRA 3FDGA 4B5XA 1HVQA 4A3RA 3AROA 5D2WA 4JNZA 2CKRA 1L6SA 1YXCA 5FCZA 3GVRA 2J7EA 4HNLA 2CBJA 4C6NA 3WLQA 4CUCA 1E6XM 4DM2A 3WFZA 4W9TA 5B7YA 1J2BA 4J5NA 1R3VA 4QCEA 2XM1A 2PLKA 3QR0A 4H4IA 4JN8A 3ARYA 1HZYA 2EO7A 3OYZA 4ZSTA 5IFTA 2ZUWA 2HVOA 4LW7A 1QATA 5ENLA 3A12A 1LTDA 1V3JA 3M5VA 5AVNA 3WK0A 2VYOA 4A05A 1K7FA 1A80A 1E1CB 4C1NB 1PZ3A 4DUVA 4D1JA 1LDCA 3W81A 1S46A 3AIWA 5DT7A 2WVVA 3TKFA 4NL1A 2Z7GA 2EBNA 3HFYA 3K8KA 1NF0A 1EWEA 2NSXA 1V03A 1A4LA 3A13A 3P5ZA 5LIYX 3S47A 2R24A 4LC6A 5CGQA 5EMYA 5BMWA 1K8ZA 1NWUA 4Q7BA 3FJ6A 4ZTYA 4AF0A 4C65A 4QXIA 1DP0A 4LH8A 4TR9A 5T9BG 3AXXA 1G4EA 2REQB 2Y63A 3S8HA 4H41A 2F6UA 3GX9A 3VNKA 2JGYA 4HPHA 4NAFB 1XIJA 2LLEA 1ZCOA 2VGIA 3SY1A 5HNRA 3RCMA 3VM7A 3LPFA 4HHHA 4MKVA 3KRBA 1IF2A 2E1DA 4IJBA 4DZ5A 4JTCA 5K4ZA 1BGAA 1DIKA 3HPAA 4Z17A 1V08A 4V2XA 1E4IA 1XRFA 3RX3A 1NF7A 1OK6A 3UXLA 2X1UA 3WMCA 1KD0A 3CQKA 3FNDA 3F4CA 4PSRA 2CBIA 2DJLA 1C8QA 3GIQA 1VJSA 2PD9A 4FOKA 3ZT6A 1Q6FA 1G4SA 2XTKA 5I07A 3AXMA 1K8YA 3LCHA 3OODA 1Z41A 5BRPA 2HK1A 4Q8UA 3MUCA 5AHNA 1RQEA 1TPB1 3ZJ8A 2FMOA 3J7HA 5C0QA 3B05A 3AISA 1WAWA 4FF7A 3GHUA 3CAKA 4S3JA 2VCAA 2OPJA 4HMNA 5DY3A 4IFOA 5EU9A 2ZRZA 1RUSA 4MJZA 2G50A 4WY0F 1UJQA 1FWSA 3ITYA 1F3WA 3RR4A 4GVIA 3PZVA 1ALDA 2ACRA 1H5YA 3PZNA 1UP0A 1L6YA 1PKMA 2BVYA 3VKDA 3C2VA 4AMCA 1XKYA 1UKPA 3R1ZA 3OA5A 3W84A 4QX4A 1FWGC 1V7YA 4WDUA 5G4HC 2QF7A 5LYRA 2R82A 1P1XA 4AXNA 2YCLA 1EJSC 3NSXA 4D6CA 2AAAA 2R8WA 3I7SA 5A6BD 4O0ZA 2O9PA 4IIFA 1ZLPA 3GU1A 3T8QA 1GKRA 4IP5A 2NV9A 3L7RA 3DI0A 2J88A 1XINA 1TMQA 5A6JA 2Z24A 1NOWA 1AQFA 1VFHA 2GPTA 2VX7A 4GIEA 1EJTC 1SMDA 3UZ5A 3F03K 4Z08A 3WNOA 4YCPA 1BSLA 1XLKA 2WXDM 3D3FA 1HJQA 1JRCA 5XIAA 4OZOA 1EHNA 1CIUA 1R87A 4EX4A 5FJUA 1J0HA 1HT6A 2NUWA 3B9EA 5A6BA 2JGQA 3PBVA 3ZT5A 1WDQA 1CLXA 4HNCA 5K9CA 1OABA 4QSFA 2WKLA 3W7RA 4UTUA 2QPSA 2XVNA 3CHEA 4WGHA 4RDYA 3SGGA 3QPZA 1AZ1A 4DNMA 5E6YA 2RJHA 4NJHA 1PX4A 3BAXA 5JUVA 5I3FA 3SR7A 3WLLA 3KTCA 2G41A 3GHSA 1O66A 3NTYA 4O1BA 2DZAA 2JKAA 4FNQA 4F0SA 4GJ1A 3H7UA 4X3ZA 4PTXA 2FJUB 3JVAA 5HJYA 4S3FA 4DJEC 1V6UA 3H55A 1C92A 4TQTA 5DMNA 3MY9A 1H3GA 4X0VA 3GYEA 1HJXA 3I3DA 4RV3A 4HOWA 3O0FA 1Q6EA 4IPNB 3I65A 3RM4A 1FXPA 4DBWA 1Y65A 4B2DD 2GQAA 2VRJA 1QBBA 2PTWA 3M16A 3IPWA 5A8GA 2RDTA 4B5UA 4UCGA 1FWNA 4PFMA 5I6SA 2BVTA 4ILSA 3B04A 3W88A 3BK0A 1BSIA 3IGXA 4AEOA 3DHPA 3GVGA 3LRLA 1C8XA 1SU5A 2ICSA 3C56A 4ERAA 4UZUA 1W9BM 4FAMA 2HQAA 4Y9NA 4JR5A 3V0TA 4U5KA 1XBXA 1FUYA 3ZM8A 2ZZ5A 3CUXA 4B2DA 3HQNA 3EPNA 1OF8A 4K8HA 3N4FA 2VOTA 3TSMA 3EB3A 2HBVA 4AWUA 4XSLA 1JEZA 4TO8A 4PN2A 1W9DM 1IXPA 2WANA 4BI5A 3RDKA 3W2UA 1UD4A 3O63A 4HCHA 5EB8A 3URAA 3MHFA 3RGTA 4EOUA 1HJSA 4IQEA 3VIOA 2INFA 4GJJA 3SUUA 4ADTA 4G2DA 1KCZA 1UKTA 3WBWA 1EUAA 6REQA 3HG5A 2ZXQA