1I1XA

1.11 a atomic resolution structure of a thermostable xylanase from thermoascus aurantiacus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
302
structure length
302
Chain Sequence
EAAQSVDQLIKARGKVYFGVATDQNRLTTGKNAAIIQANFGQVTPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIRGHTLVWHSQLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVNEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYINDYNLDSASYPKTQAIVNRVKKWRAAGVPIDGIGSQTHLSAGQGASVLQALPLLASAGTPEVAITELDVAGASSTDYVNVVNACLNVSSCVGITVWGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermostable xylanase from Thermoascus aurantiacus at ultrahigh resolution (0.89 A) at 100 K and atomic resolution (1.11 A) at 293 K refined anisotropically to small-molecule accuracy.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
total genus 120
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1i1xA00
2V5CA 1IZKA 5A8NA 2Y2WA 1BAGA 3O6AA 3CHCA 1EOKA 2D23A 4HZ8A 2VRJA 1QW8A 4IPLA 1H4PA 2PBGA 4DM1A 1XHGA 4LYQA 4UFHA 3PZ9A 1SMAA 3WUEA 3VGFA 1QHZA 4MDPA 3WUFA 3ZT5A 1BPLB 1GVYA 2D0GA 4AW7A 1H3GA 5AYIA 2CBJA 1ZU8A 2ZX8A 2XSBA 5BXPA 1NWSA 2EPKX 3EDKA 3FNDA 2FHCA 3OB8A 2DIEA 1ISYA 1W1YA 1G94A 1YHTA 5M3WA 2WSPA 1YQ2A 3AICA 3WNOA 1JXKA 3ZQ9A 3GZAA 2RGLA 1UR9A 1XD0A 3AXHA 2OYKA 2WANA 4UFIA 1XYFA 2WMFA 3N13A 4H04A 1JYNA 4WKHA 4UCFA 1BVZA 4AD3A 5E70A 1DWFM 1E1EA 5TD4A 3QOKA 1W91A 1EA9C 3IJ9A 3VGEA 6TAAA 1XYZA 2WW5A 3L4YA 1D7FA 2XFYA 1W3JA 4IPNB 4XB3A 3FXYA 4KGJA 3MANA 4BS0A 1W32A 2JEPA 2Y8VA 3J7HA 2J7DA 4XZBA 4Z2JA 3TTOA 3MUY1 3OGVA 3VD3A 4HPHA 4LPCA 4QFUA 3NJ3A 2NT0A 4IM4A 2OWCA 3CZEA 1TVNA 2ZUNA 3SCNA 4ATWA 1K9FA 1W9PA 4JFTA 1UR4A 1UA3A 4ACZA 1V0MA 4CD5A 1MW0A 5AYBA 2Y4SA 2VQUA 4W89A 4MNLA 3MMUA 3TA9A 4W84A 4WSKA 2QHAA 4AC1X 1ZJBA 3WBAA 2D3NA 4PBGA 3U7VA 5IHRA 3W24A 1EH9A 2G3MA 1WB0A 4N42A 1VEOA 3VINA 1UD8A 1F4AA 4P7RA 1CGTA 1LG2A 4GQQA 2O9RA 2ZUTA 1KXTA 1K9TA 3T09A 2DH2A 4KMQA 2CITA 1V3HA 4PSRA 1B1YA 3SCUA 1EGZA 5DF0A 1OT2A 2BXZA 1FP9A 1CBGA 2W67A 5D8ZA 5BXTA 7TAAA 1JL8A 4B9YA 1E73M 1WZKA 2XM2A 3THCA 2BVYA 2D2OA 2XVLA 3TTSA 5A1AA 4H41A 2YLAA 3GXFA 4PCTA 4RL3A 3IK2A 4OBRA 3AMDA 3AYRA 2GVYA 1W3LA 2DT0A 5LA1A 1QPKA 1LL4A 3BAWA 4CD8A 3WNPA 2EQDA 1QI0A 3VIPA 4X9YA 3VKKA 1NQ6A 2D3LA 2DSKA 5D9NA 1LQ0A 2J7BA 4F66A 2A3BA 3RIKA 1R8LA 3AMKA 2AOSA 1JAKA 4WF7A 5I2UA 4AY1A 3SUUA 2YBTA 1CNVA 4H2CA 4M56A 3N15A 1UH2A 5CPSA 5JBEA 1KCLA 2C8NA 4GZEA 4D1IA 1ZBWA 2BXYA 3SUVA 1WDPA 2E9LA 1HP4A 2FH8A 3WQ8A 3E1F1 4FMVA 1ZJAA 4UQDA 4BCEA 7CGTA 3CO4A 1UKTA 3VD7A 3ARXA 2QLYA 4MADA 4FLQA 1UR2A 4U33A 3RJYA 3CHDA 3BMWA 3CBWA 5AC4A 4C7FA 2J7CA 1LF1A 2XVPA 2JIEA 2X2YA 4PYSA 2WK2A 3THDA 2GK1A 3CUFA 3W81A 1OGSA 4AD5A 1QI4A 4ATLA 3CZKA 3WDRA 3L2MA 2BHUA 1V3MA 1AVAA 1QNSA 4HZ6A 1NOUA 4W86A 1XCXA 3AIQA 1ZBVA 2W4XA 3ZO9A 3RDKA 3GXMA 4OBSA 3W29A 5A2CA 4IUGA 3ECQA 4MAVA 5HPOA 2WWCA 3LPGA 4PTWA 2IXUA 4S3JA 1VENA 2WC7A 1OIMA 1S46A 2CKSA 3T08A 1RPKA 3OZPA 3ZJKA 1BYAA 1ITXA 4YHGA 2E8ZA 2J8GA 1KR1A 2WVTA 1E6XM 1KR0A 1QVBA 4N0RA 2ZOXA 2EJ1A 5HNNA 4JL2A 1Z32X 1HVQA 2AAAA 3WF4A 1BYDA 2BFGA 4EANA 2WKGA 1LG1A 1UA7A 3UEQA 3ZOAA 4GINA 1UR1A 1E9LA 1B90A 2CYGA 4UNIA 1GJWA 3OGRA 4LYPA 4J3XA 2JIWA 3WL0A 2YOCA 3SUSA 4CCDA 2BVDA 1B3WA 1CLXA 3RM9A 3OZOA 2JALA 3W25A 4PN2A 4UQCA 4P8UA 1VEPA 1PIGA 1UWSA 4CU6A 2RGMA 2CERA 1AQHA 2Q8XA 2YDSA 4JHZA 4WKFA 3A47A 5DO8A 2PI6A 3QGVA 1DWHM 3PHAA 2CHNA 1WZAA 1UZ4A 1PBGA 2WVVA 3PZOA 1E3XA 3AOFA 3WELA 4UTFA 5BXSA 2E0PA 4GKLA 4JFVA 3AXIA 5EFDA 1MQQA 3VNYA 2PC8A 1DWGM 2D22A 1EQPA 1E0XA 4XZWA 1QBAA 4P8XA 2WCAA 1FA2A 3WQWA 2UY2A 4PSPA 2OWWA 3WDJA 2XG9A 1G01A 1CXLA 4OUEA 1B3ZA 4JFUA 1JFXA 2VO5A 4D72A 5HPCA 1UHVA 2X09A 3EMZA 4JKKA 1WZMA 1E3ZA 3OLDA 3RILA 4UZSA 3EDDA 3UG4A 2BY3A 1J9YA 3BSGA 4DM2A 1JNEA 4GPNA 5ABGA 1E43A 4AISA 2E8YA 4A3YA 4H8VA 4R5EA 1LWHA 1H0GA 5JUVA 2VR5A 4GZIA 3RPMA 3AZRA 4GI9A 2V38A 4LQ1A 3OG2A 3VMNA 3RMEA 3M07A 2WCSA 1ISZA 5D8WA 5CQ1A 2CESA 1Q6GA 3I3EA 5C70A 5I23A 2F8QA 1EO7A 3WH9A 4D6CA 1HKKA 4FLOA 3BH4A 1PZ3A 4E8DA 1WDSA 4CU8A 5BROA 1CGXA 4NSBA 4D6HA 2OSWA 2WMIA 3RO8A 1JAEA 3PZMA 1BG4A 1MWOA 4RE4A 1W2PA 5CPTA 1G9HA 5A6AA 2J62A 3AHVA 1MFUA 3PZIA 1UOKA 2ZE0A 1E1FA 1GOOA 4F79A 3AIEA 4AZHA 3WH5A 2XWDA 1MW1A 3NDYA 2ZXAA 3LPOA 2WVVB 8A3HA 3AI0A 2J78A 4YPJA 4JCLA 4WJXA 4CKQA 4W93A 3ZR5A 1D3CA 4P8VA 4HOWA 3VIIA 3AZSA 2CHOA 4Q7NA 5FD0A 3WEOA 1HJVA 3ZJ6A 1V6YA 5C8BB 2J8FA 3MO4A 1KGXA 3MMWA 3HJEA 5LA0A 1B3XA 2FHBA 2PB1A 1NP0A 1XSJA 5BCAA 4FF5A 1XSKA 3SCWA 2WMGA 4PMDA 1SFSA 4J3UA 2PWHA 2BY1A 2WYSA 2VCCA 3U57A 4QCFA 1CEOA 2XGBA 3SEPA 2O9PA 2CIPA 2CBIA 4DUWA 1E0VA 1H41A 1OBAA 2XVNA 4E4PA 2GFTA 3A6OA 4W7UA 4AZCB 3GNPA 2UY3A 1NARA 2DSZA 4GO9A 1EXPA 5KEZA 3GTNA 4PTVA 1CDGA 1GORA 4YN5A 1P6WA 1UKPA 2XGIA 2EPLX 3SUTA 1JYVA 3POHA 5LA2A 5A2AA 4E8CA 1TVPA 1CGVA 5A8PA 3CTTA 1QI2A 1NWRA 5I3DA 3BCDA 4U3CA 4TTGA 3EDEA 1H09A 3RJXA 1UWQA 3ALGA 4JZ5A 4K68A 1BGAA 3AMGA 1GOIA 1XV8A 1XH2A 2F61A 2VRKA 1XD1A 2X0YA 3WMSA 3VGHA 1XRVA 4BQ4A 1JDDA 3CZJA 2CBUA 4MAZA 4MJ4A 2XVKA 3WQVA 3ARUA 2WB5A 1U33A 2XWEA 1V0KA 3WKZA 2WHKA 4GI6A 3VVGA 3WFLA 1NOWA 2GJRA 4M82A 4ZE4A 3CUHA 1MQRA 1HJWA 1HKJA 3CHFA 2ZWYA 2ZXBA 2ZUVA 5I6SA 1C8QA 3K4AA 3WD0A 4Q22A 3FN9A 3RCNA 1HL9A 1C7TA 4GIAA 1HVXA 4Z2KA 1UQZA 2BS9A 4LXFA 1J11A 1QI3A 3FHQA 2WNWA 1VBRA 1GONA 2G41A 1CTNA 2ZX9A 2CNCA 4MB4A 1NP2A 4PMXA 1UWUA 1FOBA 2VC9A 3LMYA 3MSDA 5E0FA 4CD7A 4IISA 1JIBA 3AYSA 5GNYA 5CLTA 2GJPA 3NDZA 3WBEA 2C0HA 1PAMA 2B31A 4CD4A 3NSMA 4GO8A 4EE9A 3W27A 3SURA 4B9ZA 1HN1A 1GQLA 3PZQA 3CMGA 1GOWA 3K46A 3WUGA 3UERA 3A4AA 3NCOA 3PN8A 4UQAA 1CYGA 3EDJA 2PWDA 2VQTA 3AHTA 3AIVA 2WZHA 2J25A 1X6LA 4Z2HA 5A6LA 3ARYA 3K8MA 1GQKA 3A3HA 4AZ6A 2WMJA 4Y7EA 2WC3A 3AHXA 4HMDA 1NWTA 4V2XA 1J0YA 2PF0A 1O7AA 3N04A 2FGZA 1UD2A 2XM1A 4XV0A 2W62A 5E09A 1J0HA 1MXGA 3VM7A 4Z2LA 1BYBA 1H0IA 1H2JA 1JZ5A 3WD2A 6A3HA 2X8RA 1UKQA 2J77A 2EPOA 4P7NA 3EMCA 1E4MM 1JI2A 1J12A 4D1JA 2X0HA 3WDHA 2PWEA 3OLGA 3ARPA 1VJZA 3TTYA 1CXHA 3WD3A 3PZUA 4PMRA 1GCYA 3CZLA 1UYQA 3LPFA 2WVSA 3KWXA 5JIPA 2ESCA 5IFTA 1E56A 4KRTA 2W66A 8CGTA 3SCOA 4E2OA 4UOQA 2O9TA 3OLEA 1E4LA 1ODZA 3MV11 4ACYA 1VAHA 3MUAA 3VUPA 5F7UA 4ATDA 4MB5A 5ECUA 1GPFA 4MB1A 3W37A 1JYXA 1UQYA 1VFMA 4MNMA 1LWJA 2WVUA 1NM9A 4U3AA 1FH8A 3A4XA 1JF5A 1OD8A 1W9XA 4KRUA 3VIJA 5E6YA 1UD5A 1AMYA 1HF6A 2XYLA 1Q6FA 3WSUA 1PJ9A 1UZ1A 2BY2A 4DWSD 1FHLA 3OBAA 4W8BA 2WPGA 4M1RA 4U5IA 3VX1A 1KGWA 4RE2A 1W1TA 2HVMA 1JZ4A 3BSHA 4M24A 3ZT7A 2QPSA 1BTCA 4U2ZA 1Q6DA 1E0WA 5DT7A 1J0KA 1GOQA 4CCCA 1Q4NX 4HPGA 4P7QA 2XFFA 4C7DA 1G5AA 1UKSA 2VZSA 1KCKA 1IT0A 3BAJA 1QNOA 4ZE5A 1V3KA 5CSUA 2VX6A 4TX6A 4KGLA 4JKMA 1TA3A 5A3HA 2J4GA 4UQEA 2FGLA 4CU7A 1C8XA 2XIBA 5CSYA 4BQ5A 4X0NA 1E72M 1NWUA 3T2OA 4U31A 3DECA 2DQXA 3FAWA 4D71A 1OINA 3SIMA 1RP8A 1RP9A 3ZJ7A 1V3IA 1HX0A 4TVUA 2AMGA 3UG3A 4MNJA 3VD5A 1XSIA 3EBVA 1XH0A 3WIJA 2WLYA 3KL0A 4W88A 4TVCA 4OOZA 4TXEA 2GUYA 4DUVA 2PBOA 1CPUA 5A6JA 4UR9A 1GW1A 4NI3A 1C8YA 5D9MA 3WH6A 3QHMA 3IJ7A 3L2LA 1MFVA 4CGTA 3F5JA 4AZIA 4D6GA 4HP5A 4W85A 3WNKA 3NYDA 5JBDA 2VURA 1OM0A 2VZUA 3BC9A 1ECEA 4P8WA 3ZMRA 5I24A 1W3HA 1XGZA 3CGTA 3AFBA 1V6WA 1GQJA 3TOPA 1QNPA 4HTYA 3S6TA 3ARRA 3N17A 4W87A 3AHZA 1B3YA 2XSAA 1JZ6A 1TR1A 1OSEA 3K1DA 3CLWA 4JIEA 1K9DA 2YDQA 4OJYA 4PUEA 2YL8A 2VZVA 4AD1A 3M6DA 4LYRA 1B0IA 3WH8A 3W82A 5LYRA 4R27A 3GBDA 4XUYA 3VILA 6CGTA 4YHEA 5A6MA 5C71A 2E9BA 3ZJ8A 2QV4A 1M7XA 1F4HA 7A3HA 1WO2A 3WF0A 3VDAA 3WQ5A 1L0PA 4PMUA 3VTRA 1TG7A 1FHDA 1CGYA 4CD6A 2GJXA 1QI5A 3AZTA 1BLIA 4MPKA 5I5RA 2VT0A 3LPPA 1IZJA 4AD4A 2DT3A 1C93A 1KGUA 2JFEX 3AROA 1W1VA 3DHPA 5JBFA 4PMNA 5HDRA 2VI0A 5E9AA 3GYCA 4FK9A 1R7OA 3B9AA 4B3KA 3VIOA 2XFRA 4PMYA 2W63A 2WMKA 4M80A 4UFKA 2W91A 2XPKA 2X05A 1QW9A 4DUXA 5JIWA 1V0NA 3WMBA 4AYSA 3I3BA 4HZ7A 5A94A 2QF8A 1J0IA 1HL8A 1R85A 4BA0A 1E55A 4D6IA 3N11A 2C7FA 3NUKA 1CXIA 1X6NA 2WSKA 3AIUA 1AQMA 3VO0A 1VFFA 2V3FA 4DWSC 3F4VA 5AC5A 1HKMA 1C90A 4ZXLA 4UOZA 3CMJA 1WDRA 3ZSTA 1KXVA 2V5DA 1KXHA 1WE5A 3CZ8A 3WY1A 1UWIA 2D0HA 2EO7A 2VX4A 5IXEA 2VX5A 3CIVA 4C7GA 1EDGA 1C3FA 5D9OA 2G3NA 2FHFA 4AEFA 1H11A 2DSWA 3CHEA 2UY4A 3M46A 3VIGA 3O9NA 3BGAA 1UD4A 2Z1KA 2WXDM 1FH9A 2JF7A 1SMDA 3VD9A 1C7SA 5DFAA 3WN6A 3WL1A 5IFPA 1HIZA 2W61A 1E5NA 3BLKA 4EAMA 1TA3B 2E4TA 3FW6A 1B30A 4MNKA 5DMYA 3PZNA 5DEZA 3K4DA 1E4IA 1HJSA 5AY7A 2QPUA 3AS2A 1NOFA 1OWQA 3ZT6A 2V3EA 4UOJA 1D2KA 4CVWA 2OSXA 4M29A 1WCGA 1DHKA 2DSUA 1OD0A 3W26A 4Z2IA 1UG6A 2ZUMA 3OLIA 4QP0A 2XVGA 4PTMA 1JXJA 3CZGA 5FKYA 4H8UA 4ML4A 3GH4A 2X1IA 1TZ7A 3MMDA 3VGBA 1Q6CA 1UD3A 1PZ2A 3BAKA 4TX8A 3ZR6A 2G8ZA 3PBGA 1H5VA 4A4AA 4EKJA 1E71M 4MDOA 3W4RA 1W9BM 3SCSA 1V6XA 4ZENA 1MQPA 1VFUA 2J7HA 3IAPA 1VIWA 3SCPA 1PEZA 3AXXA 1BFNA 3BAIA 4PMOA 2QMJA 2VNCA 5ABHA 1OIFA 3L4TA 3KL3A 2J7FA 5FL1A 2DEPA 1FP8A 3GH5A 4EK7A 1R86A 1XC6A 3DYMA 3DHUA 4ZFMA 2WAGA 4RE3A 4B15A 3GBEA 1BG9A 1JZ3A 2D24A 3ARQA 1VEMA 1US2A 1WKYA 5CG0A 1QNQA 5DT5A 3TP4A 1E6QM 3POCA 2DDXA 1LL6A 1GHRA 4QLKA 5EB8A 5A6BD 4AIOA 3O2LA 2XHYA 2DGAA 1KFWA 2WZIA 1CXFA 4JFWA 4KWUA 2WHLA 1PX4A 3QOMA 3SCQA 1HJUA 1JGIA 2YDRA 3II1A 5A69A 1K6AA 1MVYA 2J7GA 3T0AA 4J3WA 1ESWA 1PX3A 1B3VA 3EMQA 1WDQA 1JZ2A 3SCRA 2A3AA 3KE0A 3L4ZA 5CGTA 2WHJA 1UKOA 3D5HA 4PMZA 1RH9A 2EBNA 3HU7A 1GHSA 1OGGA 1CXKA 4BQ3A 1M03A 3OA5A 3VU2A 2CKRA 3VDHA 2TAAA 1MXDA 2QMKA 4D6FA 4NZCA 1J18A 4W5UA 2BHYA 4H7VA 1E4NA 5ABFA 2DSVA 3MS8A 4JL1A 4QLJA 2DH3A 1R87A 2BHZA 4H8HA 2J74A 5EMYA 2CPUA 2GSJA 3VM5A 1Y7VA 1HNYA 4HMCA 5A2BA 3BAXA 5ABEA 5BRPA 4PUDA 1V08A 3IJ8A 1TCMA 1V02E 1QBBA 3F5LA 4QAWA 3WENA 1UH4A 2YA1A 3UCQA 3G6MA 4AMCA 1MYRA 1GNXA 2GK1B 4UQ9A 3VIKA 5GQBA 3VOCA 1KQYA 1ZB5A 2VX7A 5CJ5A 1O6IA 5I77A 2OYLA 1UR8A 3AIBA 1CXEA 1JDAA 3WQ4A 3B8SA 1GZJA 3K8LA 3N18A 4OIFA 2UWFA 1BSIA 1EO5A 2ZUUA 2ZUSA 4U2YA 2ZX5A 2WWDA 4F9JA 1CWYA 4W8AA 1MW2A 3WF2A 3VIHA 1JDCA 4Z2GA 2WC4A 4GQRA 1BYCA 3W6LA 3U5YA 2WM0A 2YBUA 5FOOA 1VRXA 2VUYA 3MSGA 1TFVA 4AZ7A 2E40A 1ISXA 1AQ0A 3TTQA 1GOMA 2EPNA 2XJ7A 3AS1A 5A6BA 4HU8A 3W6MA 2WCGA 5HBFA 1DWAM 1KQZA 3MUIA 3CH9A 5CLWA 1JZ7A 3VGDA 4TTUA 4JKLA 1CGUA 1HT6A 2ZICA 1EQCA 3HMCA 4HA3A 5EBAA 4J3TA 3WNLA 3WF3A 4AZCA 1CENA 1GJUA 5M03A 5I0DA 3L4XA 2MANA 3NSNA 2XIIA 2CXGA 3PTMA 1W9VA 1J0ZA 3AIWA 2VOTA 1QNRA 1VF8A 3VX0A 3WDPP 1UWTA 1DP0A 1W9DM 1E6ZA 2YA2A 3GNOA 4MB3A 4UFJA 2BV9A 3AMLA 2ZX7A 2WBKA 4UQBA 1BQCA 1I1WA 4D6JA 2Y24A 1KBKA 1KWGA 3DYOA 3UR8A 3GDBA 1V6UA 3BAYA 4PEEA 2PWFA 4V28A 4LGXA 9CGTA 1JD9A 4ACZB 3WQ6A 4A3HA 1HXJA 3ARWA 3AS0A 3DYPA 5BRQA 4ZEPA 1VBUA 2G3JA 5M5DA 2Z1SA 5I78A 1X1NA 1E6RA 1JG9A 3PTKA 4F8XA 3T0BA 4MTVA 1ISVA 3WDIA 3EDFA 1V02A 2O9OA 3A4WA 2D20A 1UH3A 3CPUA 1SR0A 4W5ZA 1EDTA 4X0VA 1HKIA 2VZOA 4CN6A 3EYPA 1PIFA 3KEHA 5HOSA 5EFFA 4MJ2A 5CXPA 3WFZA 4D6EA 1E40A 1OCQA 3BCFA 1PPIA 4B16A 4PTXA 1BGGA 1DWJM 5GNZA 1DTUA 2G3IA 2V3GA 4GI8A 4U5KA 4HU0A 3GM8A 1V0LA 4GZJA 2F2HA 3UETA 2EPMX 3VPLA 2VMFA 2OYMA 3U5UA 4PCSA 3OGSA 1B31A 3WEMA 4TOQA 1J10A 1E70M 1CIUA 1LL7A 4CN1A 4JCMA 4M8UA 2DT1A 4PMVA 3GH7A 5KZ6A 3VDCA 3U7BA 2A3CA 3TONA 1QHPA 3ALFA 1UR0A 1US3A 1UUQA 2WHMA 1G1YA 2JE8A 5M17A 4J3SA 3T0DA 2Y8KA 1LLOA 3SUWA 3W38A 4QLLA 2WKLA 4PRWA 3UR7A 1BHGA 1JFHA 3ZM8A 4JAWA 1FFQA 2A3HA 5GPRA 3AJ7A 1PX8A 3AHYA 4CVUA 3NSXA 4M81A 1DEDA 3L4VA 3AQUA 4FLRA 2E9MA 4NF7A 2VL4A 4P7LA 1EOMA 2DT2A 2BVTA 1OT1A 1K9EA 3WNNA 1E6NA 3GXIA 3VMPA 1UD6A 1WAWA 5FIPA 2VR4A 1NH6A 2J7EA 3W28A 1E5JA 4J7RA 5A8OA 3APGA 4ZXOA 1A3HA 4KH2A 2YIHA 1XH1A 3AIRA 4OZOA 3VMOA 2CEQA 5A8QA 2CCRA 4CCEA 1M01A 1FH7A 1ZBKA 1KXQA 5D4YA 3GXDA 2VRQA 3MV01 1EDQA 2YJQA 3VGGA 5IHSA 1B2YA 3WEZA 4FLSA 4J28A 3WUBA 1WZLA 3W53A 2VJXA 1VB9A 2YKKA 3IAQA 1ODUA 3F5KA 4AD2A 3VIFA 4GXPA 3RM4A 4URIA 3QHNA 3IANA 4W7VA 1EIBA 4BF7A 1TUXA 3WDQA 1GQIA 3PZVA 4CN4A 2D0FA 5CPQA 1IV8A 2ZWZA 1CGWA 1G0CA 1B9ZA 2IUZA 1OGBA 3PZGA 1TE1A 1WNOA 2D1ZA 3CUIA 1MW3A 3MUZ1 5E6ZA 3AS3A 1E15A 2JEQA 5FL0A 2OLHA 3D3AA 2ZIDA 3PZTA 3WNMA 1ZBCA 1GOKA 1UWRA 4AWEA 1CZ1A 1N82A 2GDVA 1H49A 4BQ2A 2ZX6A 4TUFA 1RD6A 2UY5A 3B9EA 2VTFA 1ISWA 5BYWA 2YLLA 3ZIZA 2J47A 2EEXA 2XTKA 3UG5A 2VCAA 1I1XA 2WLZA 3K8KA 1JI1A 1JD7A 5A6SA 1WPCA 1QHOA 4L4PA 1GUVA 1WP6A 2ZXQA 4J27A 4NRRA 4QDMA 5A8MA 5FCZA 2V3DA 5GNXA 3OIHA 4AZBA 1JZ8A 3DC0A 4NRSA 4OOUA 2CETA 1SYTA 3VDBA 1ZS2A 2ZXDA 1QOXA 3M7SA 3N1AA 1V6VA 1HJQA 4HOXA 4AIEA 3KL5A 1M53A 3I3DA 4DWSA 4JHOA 2CBVA 3UESA 2DPEA 1U30A 5IDIA 3SCTA 2YA0A 1JF6A 3AISA 2ZUWA 3KZSA 5I79A 4AIUA 3MKKA 1C92A 2J79A 2NT1A 3S2CA 1W2VA 2O92A 1I75A 3WH7A 5BWFA 1CLVA 3CUJA 3BMVA 3VIMA 1H1NA 4AEEA 1KBBA 3ARTA 3G6LA 4AD0A 3T2QA 1E6SM 1ITCA 2EXOA 4UFLA 5CZKA 2YL5A 1L8NA 4BZYA 3JUGA 2J75A 3WMCA 3ARSA 4J3VA 5A6KA 3HN3A 1VFOA 1CECA 1ZL1A 5BXRA 2FDMA 1KWKA 4W8LA 3QHOA 2G4FA 2W5FA 1J0JA 5HXMA 4S3KA 4P7OA 4XX6A 4B3LA 1JNDA 2NSXA 4L4OA 3T2PA 3BXWA 1Q6EA 1V3LA 1JYWA 2BY0A 2PWGA 5ABFB 1GVIA 4CUCA 4HMEA 1BF2A 2A3EA 3FAXA 4JFSA 3PTQA 2VVNA 2E3ZA 1TMQA 1M04A 1OB0A 5CGMA 3ARVA 2JF6A 3WD1A 4TVDA 1R7AA 2DIJA 4PMQA 4AZ5A 2OSYA 4AXNA 2NW0A 4AZGA 4UFMA 2W92A 1HJXA 3AMCA 3N9KA 5D9PA 4F9DA 1V3JA 3SCVA 1J01A 4WIWA 3WF1A 2WMHA 1V03A 4HOZA 2VCBA 1EHAA 3MU7A 4WKAA 1HP5A 1W3KA 3N12A 1W1PA 2WZEA 1EHNA 4WK9A 3VNZA 4QCEA 4DWSB 4WLCA 2WMIB 1FFRA 3B9DA 3NIYA 5E0CA 5A95A 2OWXA 1KB3A 4D6DA 1W9UA 3WD4A 4HA4A 4OKDA 1LJYA 3ZSSA 1VJSA 1U2YA 2IXVA 4V27A 1BVNP 2VVSA 2GJXB 3BLPX 3L4WA 4W7WA 2Y5EA 3RM8A 2GDUA 2YL6A 3W0KA 1C91A 1XCWA 1DWIM 1E6PA 1A47A 4LX4A 3QR3A 3FY1A 2HISA 3GNRA 3VD4A 2XUCA 2FH6A 2VZTA 3CUGA 3L4UA 4HA1A 2WBGA 2YL9A 4UZUA 4WSJA 3ARZA 3FHAA 2BNJA
chains in the Genus database with same CATH superfamily
1AJZA 1IZKA 2Y2WA 4FF7A 3O6AA 4JTSA 1EOKA 1Q8JA 1A5BA 3QN3A 4DM1A 4DVOA 1J5TA 2PE4A 2JBMA 5KTLA 4E2VA 2OKOA 1QHZA 3DU0A 5EBUA 1R9ZA 1SZGA 2OR2A 4QNWA 1IYXA 4LAZA 4XAYA 2CBJA 1MDRA 4GABA 2NLYA 3FJ6A 5HUPA 5BXPA 3OW1A 5ECVA 4IIBA 1IEIA 3E02A 1G94A 1RPXA 4JTUA 1W3IA 3KCOA 4O54A 3NZQA 5M3WA 2WSPA 1OHLA 5MHBA 3HM7A 5JH1A 3AXHA 4JIHA 3UZJA 1OC5A 4AHPA 1UROA 3ZVHB 3CL8A 1AG1O 1R46A 1XYFA 4DBEA 3LLDA 3N13A 3B3DA 4H04A 3GXTA 2W9MA 4WKHA 4AD3A 2FKPA 4QX4A 1GKRA 4JTCA 5C9RA 3VI2A 3NQEA 3TH6A 3L4YA 2HPIA 5HULA 3O06A 4DF0A 4MKNA 3BLEA 4KGJA 3A4JA 3LM7A 4IX0A 4Z2JA 3TTOA 3MUY1 3OGVA 3WLRA 1EPVA 4NL1A 2OEKA 3LV5A 3W1RA 4B2DA 2ZUNA 6ENLA 1QATA 3BQ5A 1UIPA 2XH2A 3A24A 1V0MA 4JQAA 4PODA 1OF6A 1IWPA 4MNLA 3TA9A 2JKPA 1J6PA 4WSKA 1GW9A 1TCDA 4WGXA 4FIQA 3QR0A 3I6RA 3WBAA 1AUSL 2D3NA 4IXHA 5IHRA 2HRWA 1VYPX 2G3MA 4AIBA 5I7GA 2INFA 1SFLA 3TJLA 1P0DA 2INZA 4KF1A 2ZUTA 3AYVA 4LJ3A 3GDTA 1RLCL 4LUJA 4H6EA 1B1YA 1P0KA 3UA4A 5DF0A 1V77A 4ZOCA 4DQWA 1SR9A 5D8ZA 4OUIA 1QDSA 4GUFA 2XM2A 3TR2A 2D2OA 3S4TA 3W70A 3RRXA 3GXFA 4PCTA 4RL3A 2DZBA 1TIWA 2DT0A 3RPDA 3WQOA 4H9XA 1S3HA 2NLIA 1AJ2A 4FOKA 4YS1A 3CWHA 3RU6A 2D3LA 2J7BA 5GJMA 2D2GA 3RIKA 1IF2A 1R8LA 3K5XA 1O66A 1Z48A 1MI3A 3GTXA 3NQVA 5I2UA 3VKAA 3KVMA 3NR0A 3MZ2A 1UH2A 1TV8A 3S1VA 3LCIA 3GLCA 3W9ZA 1JVNA 5CPSA 3TE9A 1U5VA 5JBEA 1GVOA 4MHBA 3HURA 4DWDA 2BXYA 1WDPA 3D6NA 1UP0A 4FXJA 4PMJA 3E1F1 4FMVA 4IFKA 1OX4B 1ZJAA 1MUMA 2DVUA 2E6FA 1XYAA 7CGTA 3KTCA 4G6CA 4LVBA 4INFA 4IMDA 1EXBA 1Z7AA 5FJTA 2HNHA 4X22A 4MFEA 5EYWA 4UNLA 1SW3A 1MMFA 4HQVA 1LF1A 4XTDA 1OG0A 3DERA 2JIEA 1X97A 3THDA 2P53A 2GK1A 3RNDA 3USZA 1KNWA 1HO1A 1OGSA 3AAMA 3WLOA 2Y5SA 3CZKA 3OYZA 1VBHA 3W83A 3FKRA 2INEA 4C91A 4UXDA 1ZBVA 5AC8A 2D73A 4ZQMA 3ZO9A 4Y9PA 2Z1VA 2YYUA 4B5NA 3GXMA 4OBSA 5C0QA 3IEBA 2QVNA 4MAVA 1NFGA 2PMQA 4GNJA 5HPOA 2WWCA 3W2MA 2PFHA 1PS9A 1FDYA 4S3JA 3W7NA 1OIMA 5E9XA 3NGFA 3S47A 1S46A 4FSAA 1RPKA 1XL9A 2V2CA 4CQ8A 4CEXC 4YHGA 2J8GA 4N4PA 2YXOA 4TX9A 1E6XM 3CIWA 3ZXWA 1QVBA 4N0RA 2NV9A 4ZODA 5AOUA 4RLIA 4DZIA 2G97A 3QQ1A 4MSSA 1BYDA 1H7RA 2HS6A 2WKGA 3S0CA 1A80A 8RUCA 1B90A 4RW3A 4UNIA 4LYPA 4DJED 2JIWA 2YOCA 1Q7MA 2RJHA 3OZOA 4A05A 2JALA 2GGHA 1QR7A 1AQHA 1ENUA 2YDSA 5G1MA 5DO8A 2PI6A 3QLLA 2CHNA 3PHAA 2E6DA 1UZ4A 5AZ1A 1C9WA 3AOFA 6XIMA 3WQGA 5C6MA 1K7EA 1XLLA 3EWBX 1ZAHA 4LFYA 3NZRA 5BNKA 1UC5A 2XU2A 1IR1A 5J04A 2NVDA 2UBPC 3B9NA 1ITUA 1K3UA 2QKFA 4JNMA 1EL3A 1CXLA 4OUEA 2ZADA 3DN5A 2Y62A 1W3TA 5C2GA 4JFUA 3STCA 4B5VA 2ODOA 4D72A 1UHVA 3QM3A 4XBKA 4JKKA 1XX1A 5G2HA 3EDDA 3BSGA 3U2CA 4O8RA 1FCBA 1R9XA 4A3YA 3NQFA 1WUEA 1H0GA 1FHVA 2A5HA 3HV8A 5IBXA 4Q8PA 1EF3A 4A2SA 3LA4A 2ZDRA 3NEVA 2F8QA 1XDLA 4U4MA 1HKKA 3NTYA 4E8DA 1WDSA 1TPVA 4JTTA 4ADTA 4JYFA 4YTQA 2WMIA 3TV8A 3ATYA 1GOXA 1JAEA 3PZMA 4KFPA 1DJXA 2BZNA 4DO7A 1LUCB 1XPYA 4OU1A 2O0TA 3UA3A 4DIAA 5HUOA 4OFCA 4GVIA 4RE4A 2J62A 1MFUA 5GJPA 3PZIA 4NNCA 3NVTA 1EGVA 1GOOA 3R10A 3BG9A 5DELA 3W01A 4O0ZA 3WH5A 5TQLA 1IWAA 2ZXAA 3W88A 2DZAA 3LPOA 1KTCA 1OX5A 3LQGA 4CLMA 4W93A 3ZR5A 4P8VA 4I7VA 4HOWA 3N3TA 3QXBA 3VIIA 3NO3A 5I3FA 2F38A 1RXOB 4F0RA 4O1BA 1O5XA 1XDMA 1HJVA 4L1GA 4ML9A 3S42A 1EP1A 3TEVA 3CAQA 3PP7A 1NP0A 1XSJA 1ZSXA 4HIBA 5BCAA 2NX9A 4ZTYA 3SCWA 4PMDA 3WCZA 2PDYA 3QF0A 4Y9NA 1OFDA 2XGBA 4AVFA 3P80A 1E0VA 1H41A 3W7MA 3CAVA 5F1VA 4GYFA 4LW7A 3A6OA 4NZ5A 3GNPA 2DSZA 2QR6A 3ZR4A 1S39A 1JCNA 6TIMA 4DI9A 1PO9A 3GTNA 4PTVA 1CDGA 1KCXA 1UKPA 3HBLA 3SUTA 3R0DA 4L6OA 3POHA 5LA2A 2G50A 2V9DA 3INPA 4Z1CA 3V4BA 1AJ0A 3G18A 5M2FX 2WJZA 4Z1DA 3NXLA 1QTWA 2Q01A 4GX9A 3ALGA 4JZ5A 5C9UA 4L9YA 4DYEA 3CT2A 3AMGA 1XV8A 1F3XA 4AHQA 1XD1A 1XRVA 1TJ0A 3NNTA 3E6EA 4O28A 4GUGA 1R30A 2VD8A 1O68A 4X63A 4BI7A 4PUNA 3KAOA 3EAUA 2V5LA 4FNSA 2WB5A 3WK2A 1H7OA 2H6RA 1HW6A 1FWFC 4CQAA 1EA0A 3KOZA 3KVKA 4IF2A 3GE7A 4NZJA 2O7SA 2JGQA 1HJWA 3RK8A 3TYCA 3CHFA 3UZ5A 1VHNA 5I6SA 3A12A 3FLUA 3W22A 2GGIA 4H3DA 1HL9A 4OE7A 2YXGA 1BWVA 3VZXA 4Z2KA 1UQZA 1QI3A 4QJ5B 3NOEA 2J9XA 2WKJA 3MCOA 2OMAA 4XD6A 4MB4A 3W1NA 1WV2A 3LMYA 3MSDA 4UUIA 1A0EA 4CD7A 3JR2A 2TSYA 2AQOA 1OZMA 1Q8AA 3QVQA 3GR7A 1EWEA 1GEQA 1KLZA 2XIQA 5IBXC 4GO8A 3DKJA 3WUGA 3UERA 4UQAA 3HQPA 1CYGA 1X6LA 4Z2HA 4AZ6A 1YXDA 3QPEA 4RW5A 3SI9A 2PGEA 4I7WA 1P0BA 4YXGA 2FTWA 1UD2A 2XM1A 3ITYA 1MXGA 3I7QA 5I06A 3VM7A 3CQHA 1S5MA 1TE6A 4I5RA 5D33A 4YTSA 2E6YA 1H0IA 3WD2A 6A3HA 1CB2A 5A6TC 1QW7A 1KBLA 4IOTA 3I65A 5REQA 2BVWA 4IL0A 4MVAA 5MKGA 1XIBA 4D1JA 2NQJA 1T99A 3OLGA 3ARPA 2AAMA 1CXHA 2EKCA 4E2BA 3T55A 1GCYA 3LPFA 2WVSA 4JYDA 3WQFA 4O52A 3NQ6A 3PBUA 2Z2UA 1ODZA 3MV11 4QDWA 4ACYA 3BWWA 3VUPA 1A5OC 3B0PA 3PAOA 4G5DA 3W75A 1YBQA 1YTEA 1VFTA 4AX6A 3C2FA 2DUXA 1W9XA 1UD5A 4QDPA 2V30A 4HHMA 4GI4A 3W1AA 3TXVA 2BY2A 4DWSD 4UMAA 2QJGA 3TW6A 4KCVA 4JGDA 4AF0B 2CU0A 4WDUA 4M1RA 2VDGA 2NV2A 1JZ4A 4C6PA 3ZT7A 4DBUA 1MEIA 1LRQA 7ENLA 2PC4A 1Q6DA 1E0WA 3UVAA 4WY0F 3RO6A 1G5AA 3TXZA 3CUXA 4JQ3A 4ERGA 3M0HA 2VX6A 5JU6A 1DIOA 3HB9A 1REQA 3XISA 3TWAA 4JKMA 4O15A 1F7BA 1UMLA 2C0AA 4YL2A 3MKCA 4F3HA 2YDAA 5CSYA 4BQ5A 3M0IA 5CZ0A 7ODCA 4LSBA 2DQXA 1XQLA 4F2TA 3B4YA 4B5TA 5HJYA 3F4WA 4TVUA 1XH0A 3W07A 3CEUA 4NX0A 3NQGA 1DJQA 4W88A 5AHLA 3RHGA 3YPIA 4TVCA 1GYNA 4TXEA 2GUYA 4Q4SA 4DUVA 1XIJA 2H3BA 3H6OA 4IJBA 2PBOA 1Z6KA 4NVTA 3T4WA 3QHMA 1YADA 1QAPA 3IJ7A 2YZ5A 4OVXA 4LAUA 3F5JA 4AZIA 4DYJA 1ZHAA 3GQYA 1JCLA 2VZUA 5LXXA 5J8LA 1WKFA 3MW7A 4DJDC 2YB1A 4RZBA 2OQHA 1W3HA 4RPQA 3BPWA 4GKTA 3S6TA 3ARRA 2VOMA 3N17A 2V68A 1S2CA 1JZ6A 3IJIA 1TWSA 2BODX 1OSEA 3K1DA 3QY6A 2ZQ0A 3EPMA 1Y0EA 2DZVA 3G1SA 2BXVA 3M6DA 3WK0A 3NGJA 2F2KA 2ACSA 3QYQA 1JUKA 4H00A 3VILA 6CGTA 2E9BA 2QV4A 1N8FA 3DZ1A 3C2RA 3ICJA 3H4XA 4R3UA 1WO2A 3WF0A 3VDAA 3RXZA 3WQ5A 4Z17A 1L0PA 4NT0A 2GPTA 3KVLA 4PMUA 4AVNA 1FHDA 4O53A 4R34A 5U4NA 1YMYA 1OJXA 2ZBTA 4LF2A 4EWND 1KGUA 3KTSA 1UOZA 2VI0A 3BCJA 3SDOA 4JQ4A 1OCBA 1R7OA 4LS0A 4ERIA 5L9FA 2HTMA 5HQEA 3TYUA 4ZTXA 3W7JA 2X05A 2W91A 4GLEA 1HG3A 1YNYA 2FIQA 4GXMA 3I3BA 3M0VA 1NF7A 2GGJA 3ID7A 3QPYA 1YBQB 4DUOA 3T0CA 4HJFA 3N11A 1I2PA 1MRQA 4DELA 1AW2A 1X6NA 2NX1A 3A64A 1AQMA 5K9CA 4QE5A 5AC5A 3U4AA 2NVCA 1I8JA 3EKGA 1EC8A 1WDRA 1KXVA 4LNYA 3MC5A 2V5DA 3QQ0A 1KXHA 1WE5A 3CZ8A 3WY1A 1TMHA 1UWIA 2ZZ4A 2D0HA 2EO7A 3GIQA 2VX5A 3LK6A 5JMUA 4C7GA 4KEVA 2FDSA 3CHEA 1YDYA 3S5ZA 3BGAA 2DUZA 1FH9A 2JF7A 3SFKA 1ZUAX 3UU0A 3S6OA 4WVXA 1E5NA 1YE4A 5C2CA 1KKRA 4EAMA 1PDZA 3PZNA 1DBTA 5EKYA 1E4IA 1HJSA 3EEZA 2QPUA 1TJRA 1NOFA 2DVXA 3REQB 2V3EA 1WCGA 1DHKA 4DLFA 2ZRYA 4Z2IA 2W79A 1T96A 3OLIA 4RJEA 3VKBA 4QP0A 4B91A 1M5WA 2Q71A 3CJPA 3RR4A 3O6YX 1XLCA 5FKYA 1Z89A 4YTRA 1P7TA 3CV1A 3MKVA 4J2MA 4MMWA 1PZ2A 4F2BA 4TX8A 4LCQA 3ZR6A 3BVJA 2Z25A 5I3KA 4F48A 1P1MA 1ZENA 3W6YA 1SSDA 2J66A 1V6XA 2D69A 2OU4A 4ZENA 1ZLPA 2J7HA 4HU3A 4ORMA 1Z3NA 8XIMA 4IGMA 3TC7A 2VFGA 3I4EA 3IAPA 4M51A 4KFOA 1LBFA 3PVFA 4QE4A 4UC5A 1OX6A 4GGHA 1OIFA 1XLIA 2PDQA 4K36A 2NQHA 3OO2A 4FHAA 2DEPA 4GCXA 1FP8A 3FVDA 1R86A 2YR1A 2VDIA 3HPZA 3M5ZA 1XC6A 2XSXA 2Z4GA 1F3WA 2ZA1A 4RE3A 1I60A 1BG9A 3STFA 4HNNA 4H9TA 2PDGA 4DAIA 2I57A 2P0IA 2V6AA 4DI8A 3WLNA 3RGTA 3OPSA 3R2GA 1W0MA 5DT5A 2FZ8A 3ZLGA 1MUWA 4KWOA 3W2NA 3NQCA 3FYOA 4AIOA 2Z27A 3GW3A 1Q63A 3ITLA 1GG0A 2WZIA 3R6IA 3MYOA 3S5NA 1RCOB 1PX4A 3SCQA 1HJUA 2YZRA 2W27A 1R3WA 4RE0A 1LDCA 3G22A 1FWAC 3II1A 4YTUA 3CYJA 7REQA 3S2MA 4J3WA 1WQ5A 3EMQA 5LGZA 2G96A 4M3PA 1JZ2A 4HBKA 1VCVA 3KZPA 3UY8A 3K1GA 2E5CA 3L4ZA 4RNIA 3F2DA 2WHJA 1POKA 1ONRA 3CV7A 4HJWA 3HU7A 3K4WA 4UR8A 5K9DA 2VGIA 3ABRA 3L65A 4R33A 3VU2A 3VDHA 7TIMA 1ZQ5A 4LNCA 3MO7A 2WOQA 2DZTA 2QUUA 5HNTA 1ZALA 1JULA 4W5UA 2BHYA 1E4NA 2H3DA 2Z29A 3U4FA 5I07A 2BHZA 1LP6A 1XKJA 5EMYA 1DXFA 1Y7VA 4HMCA 5A2BA 3EXRA 3GVQA 3BAXA 4Q4MA 4L5ZA 1V08A 1LZOA 5HMFA 5AC6A 1V02E 2PLCA 3UZZA 1QBBA 3QW4B 4AWTA 1RK6A 3A23A 1XR2A 4M6PA 5C7VA 4AMCA 1MYRA 1A4MA 1GNXA 5GQBA 4UTWC 1ZB5A 3GG8A 1O6IA 2BMBA 4POCA 2OYLA 1GYLA 1UR8A 3KBVA 4DO6A 2ZZ3A 3KDNA 1EYWA 2Z0IA 3NM1A 3N18A 5FAGA 1EO5A 2ZUUA 3SADA 4U2YA 1YEYA 2ZX5A 3IWPA 4W8AA 5FF2A 5F2IA 5K4ZA 3WF2A 4A8LA 4OV9A 4QHRA 2WC4A 4LC6A 1SZEA 3W1XA 3ABOA 1EPXA 3V18A 4AF0A 1XLBA 1BYCA 2A6NA 3W6LA 2WM0A 3TIMA 3MSGA 5AHFA 1ISXA 1QWKA 4MWAD 3TTQA 2BGSA 3WZ0E 4HGXA 3UPMA 3R1ZA 4MUPA 1KM1A 5IRPA 3W6MA 1VJIA 2WCGA 5HBFA 1KQZA 3UXDA 3VFCA 3RYSA 3ERPA 2PDUA 5CZSA 3VGDA 4TTUA 2ZICA 1MUCA 1EQCA 3N2TA 4MLJA 2E67A 2ZC1A 3FSTA 1XCFA 1OCNA 4I90A 4AZCA 2RH9A 5I0DA 2Q3RA 3L4XA 1QU4A 3NQBA 3PTMA 1TQXA 3L0KA 5KINA 1MNSA 3DHDA 2A1YA 1DP0A 3AALA 4XBSA 2KZHA 2QUVA 1DOSA 3C0SA 4YMZA 3GNOA 1HO4A 4MJZA 2HV5A 4MB3A 1RQEA 1G67A 4K8GA 4IP5A 4D6JA 2QF7A 5C9XA 4IPIA 1PCWA 1V6UA 2QZRA 3DAQA 3HZ3A 2PWFA 3PWAA 3S6DA 1ICQA 4A3HA 4LEQA 1HXJA 5G1YA 5D37A 1R38A 4HSOA 4REQB 3SJ3A 3DFSA 4MJMA 1X1NA 2A7NA 4F8XA 3S1GA 1G7VA 1V02A 4LV4A 3A4WA 3G3MA 3NQMA 1P6CA 3P8IA 3U3HA 4B5XA 4H9UA 5CXPA 4I9MA 3O63A 4GA8A 1JCTA 4Q4OA 4QR6A 4PTXA 1PTDA 2HS8A 5GNZA 1DTUA 4N7QA 5TIMA 4DF1A 1I9CB 4LVFA 1V0LA 3TROA 2TMDA 3UETA 4S38A 2VMFA 2ZA2A 4PCSA 2FZ9A 2Z1XA 3LD5A 2V69A 3F1QA 4MZYA 1LL7A 2ZRVA 4PMVA 4S3AA 1J93A 1M6JA 5KZ6A 3U7BA 2RDXA 3PC0A 3ALFA 4WQ6A 1UR0A 1RAKA 2OOFA 2X42A 3EX1A 2ISWA 4JTHA 4EPBC 2DZUA 3MJMA 3U8GA 3QMSA 4ZO8A 2WHMA 1WOBA 3BUVA 5M17A 2ALRA 4FIRA 1PKYA 4N02A 4QLLA 2WKLA 1R3RA 3UR7A 1FWHC 1F8IA 3ZM8A 4BJHA 4O1DA 1F3TA 1SQ7A 1W5QA 1GWJA 3AJ7A 3V75A 1TJ2A 3UW6A 1YXCA 5CPNA 2WO5A 3U6WA 4CVUA 4JTFA 5C55A 3O15A 2IPWA 3LENA 4IXXA 1EOMA 2BVTA 3WNNA 2V81A 1TJ1A 4H2HA 1WAWA 1ADSA 2ZRUA 4LRSA 3N14A 3F03K 4B5SA 4Y2WA 2WJEA 1A3HA 3AIRA 3SSJA 1T0OA 1LYXA 2CEQA 4O11A 5JXQA 2CCRA 4GWEA 1FH7A 1L9WA 3GXDA 2VRQA 2WPBA 3N19B 1EDQA 4N6EA 2RDUA 4J28A 2W3ZA 2WSRA 1YNPA 1U1JA 1WZLA 2YKKA 3QYSA 2QNEA 3F4NA 3IANA 1XW8A 3H2OA 1K7FA 4UCGA 2Y8UA 3QZEA 2ATMA 2YW3A 1RJQA 4D8LA 4AY8A 3R12A 1YLVA 3QV6A 4L80A 4CN4A 2PWVA 2VEIA 1IV8A 1B9ZA 3B06A 4TO8A 3W7EA 1DIEA 4YVVA 3PZGA 1X38A 5E0KA 3CUIA 1TIMA 1L6YA 2ZC8A 3MUZ1 3N34A 3DH7A 3E0LA 2JEQA 3KLKA 3PZTA 1GOKA 4AWEA 3AO0A 3DBNA 4TUFA 4F40A 2ZZ7A 3PUEA 1DJZA 1ISWA 2YLLA 3S9ZA 1TWDA 2XTKA 2WLZA 1JI1A 2PCQA 1QHOA 4L4PA 5TF0A 3AXKA 1P6BA 4J27A 5HWMA 5FCZA 3RG6A 5G5IA 3GW0A 3DC0A 1RV8A 4NI8A 4WUIA 5CZTA 5I3JA 4EX4A 3DCPA 2ZXDA 4FO4A 3TYAA 2CXEA 1DJIA 3OZYA 1QASA 3M7SA 2HWGA 3EEGA 1M53A 4H4IA 4MYAA 3B97A 1ONWA 1MEWA 3GR8A 5I79A 4AIUA 2J79A 3LQLA 1KM2A 5BWFA 3SY8A 1JUEA 3VIMA 1TTPA 1H1NA 3UJ2A 2X1UA 4LY4A 3NQ8A 1OYAA 1QK2A 4IMCA 1S2TA 3RF9A 3T2QA 1ITCA 4ZQPA 2EXOA 4UFLA 3IJLA 3WQPA 4H01A 2I9UA 1SZNA 3QTGA 3JUGA 2IQ0A 3CB8A 4J3VA 2QDDA 4OECA 5A6KA 4Q8OA 1CECA 1TPDA 3OODA 4O1AA 1EWDA 1XYBA 3IIZA 3GHTA 2W5FA 1J0JA 5HXMA 2IQTA 2VC5A 2H8XA 4ZB2A 2NSXA 3KRZA 1XG4A 2FTYA 2QAPA 4ZOBA 3PPFA 2GOUA 1GVIA 4C65A 2AL1A 4JFSA 2A6LA 1FDJA 2Y7DA 1N55A 4PCPA 5CGMA 4HHHA 4Z1YA 1LLZA 4TVDA 2DIJA 4AXNA 3LHTA 3BLIA 1VKFA 1HJXA 2CLEA 3N9KA 4H9MA 4PR4A 4F9DA 1V3JA 3P82A 3WF1A 1RK5A 4H9ZA 3MU7A 1W3KA 1W1PA 4KWSA 3QZAA 2DU2A 3WYZA 4QCEA 2HZGA 4NYUA 2IKJA 3B9DA 3DIPA 4D6DA 4UWMA 4IPJA 3QQWA 4OKDA 1U2YA 1Q3NA 1RUSA 2IXVA 5DX7A 2HEJA 2O55A 4JXCA 4ASTA 2YL6A 1C91A 4NNAA 2VEGA 4C6QA 2OO6A 3CM4A 5FF0A 1E6PA 1LTDA 3M5VA 3MBDA 1F6KA 1FX6A 3VD4A 1GZ1A 1G69A 3CUGA 2WJDA 4HA1A 4WSJA 3GWQA 3C0JA 4LUTA 3BQ6A 1BAGA 2PDWA 2B4GA 2VRJA 3TQKA 4LH8A 4IPLA 1WXZA 2PBGA 1XHGA 4ZQCA 4LYQA 3PZ9A 1VFSA 1G4PA 3KCLA 3VGFA 4D8AA 4AQLA 5LNRA 2CLPA 4NX5A 4A35A 2EF9A 1GVYA 2D0GA 1M41A 1ZP3A 3GG7A 2TYSA 1ZU8A 3CLMA 4NAEA 1NWSA 3EDKA 3OB8A 2FHCA 3I6TA 3AU2A 3A21A 2A7RA 2DIEA 1SJBA 1W1YA 3V0SA 1YHTA 4CNUA 4GUJA 3AICA 3WNOA 1ZAIA 1OFAA 5F2GA 3NZGA 1XD0A 2WANA 5I09A 1PYFA 4ONVA 2NXIA 2WMFA 2QCEA 5CSRA 4FXRA 3R0UA 1XLHA 4AU0A 1KRCC 4UCFA 1JEZA 1J2BA 2BSLA 5LSMA 3LI1A 3WMLA 4XBJA 2DQWA 1EJTC 1W91A 3H24A 3IJ9A 3VGEA 6TAAA 1S2VA 2XFYA 4IPNB 3SY5A 5BW6A 4KERA 4QJ3B 4I5XA 3J7HA 4Z1AA 1KKOA 4XZBA 4HPHA 1FHUA 3W1UA 3PBVA 2RJGA 4Q7BA 2PD9A 3CZEA 1NDYA 4WJEA 3KFTA 1S5VA 2O7QA 3G0UA 3HV9A 3D0CA 4OV4A 1UA3A 3T07A 1TTJA 2VQUA 2HE5A 3BMXA 1F73A 3GG0A 1B5TA 1RBAA 2QHAA 4A21A 2HJPA 3BICA 4K1GA 3LXCA 4XZLX 3W24A 1WB0A 1F4AA 2QAFA 3KP0A 4GQQA 1TV4A 1X1ZA 4RKAA 1K9TA 5LIYX 8TIMA 1OQFA 2A21A 1J5SA 1EGZA 3N6HA 4O1FA 4PULA 1CBGA 5BXTA 1AMKA 3GC5A 4B9YA 1E73M 1WZKA 2QT3A 4I9JA 4IQJA 4QROA 2YB4A 2BVYA 4DAFA 2GVLA 5A1AA 3A22A 4H41A 3DKLA 4MY8A 3AYRA 5F4XA 4GMEA 1UR3M 2GVYA 4HNOA 4JHMA 1XLMA 3WNPA 2EQDA 3K13A 3VKKA 2Q02A 4NILA 3DFTA 1OF8A 3GVGA 1IIHA 1LQ0A 1SFTA 1L6GA 1NFBA 1IR2A 3AMKA 1OEPA 2AOSA 1JAKA 3DBPA 5AB3A 3SUUA 2YBTA 4H6RA 1KRBC 1PIIA 3CAKA 2NQ9A 4XO7A 3C0QA 4Q8NA 1KCLA 4GZEA 1UW9A 2A3LA 4WY0A 3C56A 3GS6A 5FESA 3GB6A 4FX8A 3KUMA 5HATA 4QRNA 3APTA 1DJWA 3CASA 2DW7A 3LI0A 4BCEA 2DJXA 3A3XA 2FFCA 4B92A 3VD7A 3ARXA 3TJXA 4K7YA 2DUAA 4E8GA 3USBA 4U33A 1PKNA 4A3QA 4XAPA 3DI1A 2PP3A 3CBWA 5AC4A 4C7FA 1WKDA 4Q8QA 2J88A 2XVPA 1XC4A 1BXBA 3G24A 2X2YA 3QW3A 4AWSA 2PP1A 3W81A 4AD5A 4HMNA 1X8FA 2OT1A 3L2MA 1V3MA 1Z41A 4B4FA 4HZ6A 4I6VA 2C1IA 2PDMA 3GX9A 2QDGA 4XZMX 3BV7A 3LPGA 5D38A 1U1UA 3V7PA 4PTWA 4OGZA 2R1KA 2WC7A 5KITA 2CKSA 3T08A 3EKLA 4NNBA 5T26A 3RCMA 2HQAA 1UIOA 4XVEA 2F9RA 5HNNA 1RCQA 4TIMA 2AAAA 2PDCA 4GH1A 3WF4A 3V36A 3EWXA 4EANA 4DBSA 1LG1A 3ZZ1A 3UEQA 3C3NA 3TN6A 4Q32A 2VWTA 4E6MA 2CYGA 1KTNA 1KTBA 3GVRA 4UBPC 4AWUA 1W56A 3QSRA 4WDXA 4CU6A 2Q8XA 3I4KA 3RR1A 3FDGA 1H1YA 1YTKA 3MWAA 2E6AA 5DRIA 1DWHM 3W72A 1LCOA 4GBDA 3PZOA 3WELA 2PU1A 1FBAA 2E0PA 5LIWX 3RLHA 1DWGM 2D22A 3RX4A 1E0XA 3LHYA 3GU1A 1ZTVA 3T9PA 3KBNA 3OVPA 4P8XA 1FA2A 3WQWA 2OWWA 3GFZA 2IMRA 2XG9A 5DCDA 4S39A 3T8QA 1JFXA 2VO5A 2J9YA 4LUTB 3DENA 1QO5A 5HJXA 1RJPA 1KO0A 1MNZA 3P61A 3RILA 1QK0A 1J9YA 4ROPA 3P81A 1EJ7L 3S1XA 3NYZA 3WBYA 1VPQA 3MHFA 5FJPA 4R5EA 1LWHA 5DMMA 2VR5A 3EWDA 4GZIA 3RPMA 3AUOA 4GI9A 3VMNA 3FA5A 1W1IE 3M07A 2WCSA 5DQPA 1ISZA 5CQ1A 1PSCA 3E0IA 5I23A 1IGSA 3LS9A 3QV8A 1NELA 4DXXA 4FLOA 5HMSA 5BOOA 4DJFD 1TTIA 1PHQA 1CGXA 2BASA 3OQEA 3N6QA 3GTFA 4WY0B 3CV2A 4AUBA 3GSMA 2OSWA 3QZ6A 3MB9A 2C3ZA 2ZE3A 1XBXA 1AW5A 2Q09A 4HT3A 1EEPA 1VQTA 3UPWA 3S2NA 1UOKA 2ZE0A 5KETA 1E1FA 4N9EA 4IIEA 3AIEA 4AZHA 1FY6A 1VGAA 5PTDA 5AYYA 3NDYA 2PTZA 4C6JA 2C1HA 3AI0A 3PJUA 4CKQA 2XZ7A 4C90A 1D3CA 1KD0A 3UGVA 4Q7NA 3MPGA 3OG3A 5FD0A 4FNUA 4LCSA 4S3DA 1RR2A 2JKEA 5CPOA 1KGXA 3NEHA 5I3GA 3MMWA 3HJEA 2QIWA 2PB1A 3GVVA 3G1AA 1N8WA 5AZ0A 3N6JA 4DO4A 1U1HA 4J3UA 3KBSA 4IFOA 2VCCA 4QCFA 1RY0A 3GTIA 3A3WA 4GY1A 2O9PA 1XINA 3IV3A 5D05A 4DUWA 1OX4A 2PODA 1IHIA 4JN6A 4H83A 3UY7A 1BRLA 3S46A 4AZCB 4ECLA 4HKPA 4J9JA 5KZMA 3LHVA 1NDWA 3IIVA 5LIUX 5CBIA 1GORA 3HGJA 3BW3A 1P6WA 1X6UA 1JYVA 3OOQA 4J35A 3VKDA 4E8CA 2V2DA 3Q45A 2PDPA 4QSFA 5I3DA 1UP2A 1EJRC 3RJXA 3TK7A 1R0MA 3C4UA 1GOIA 3G0XA 1OFOA 1PKLA 2X0YA 3WMSA 5FF4A 3M0ZA 3CZJA 4EP8C 1R6WA 3ARUA 3IK4A 1U33A 3LZ3A 2XN2A 4XISA 2XWEA 3LSBA 1Y5XA 4C6OA 4MYXA 3WKZA 4LOCA 3VVGA 2FMNA 4M82A 1O60A 4JTAA 4EXBA 4J5NA 1BKHA 1NEYA 2ZXBA 2ZUVA 4HB7A 1Y65A 3NWRA 3STGA 3K4AA 4PUMA 1ITQA 3H54A 3WD0A 2Y88A 2P5NA 3EWZA 2P8BA 4IG2A 1C7TA 3UWQA 3CS2A 2BS9A 4ZSUA 1J11A 1VH7A 4L64A 4WEVX 3FHQA 3W1MA 1V8EA 3HPXA 1CTNA 3T4CA 2CNCA 4RDZA 1EZ2A 1XYCA 2VC9A 5E0FA 3MWCA 1FCQA 5GNYA 1UASA 3WBEA 3NDZA 2B31A 4CD4A 1OFQA 3SURA 2RHGA 3PZQA 3CMGA 2FB3A 1LUCA 1QPQA 3K46A 3A4AA 3NCOA 3PN8A 1UUMA 3URNA 3EDJA 4PB5A 3EGJA 2WZHA 3LTPA 2ZDSA 4FALA 5A6LA 3ARYA 1ZGDA 1GQKA 1PHWA 1OC7A 1S2UA 2WMJA 4AYGA 1KV5A 4Y7EA 3ITTA 2VC7A 1H7PA 3KOWA 1NWTA 1XIIA 1J0YA 2PF0A 1O7AA 3N04A 3H2FA 3SFWA 2Z7GA 3OVQA 2PDIA 3C2YA 1DL3A 3L0GA 1QO2A 4RXFA 3RITA 2X8RA 4JQ1A 3EMCA 2AKZA 1SZRA 2CWXA 5K2ZA 3WQDA 4YWSA 5LKYA 5LNUA 1J12A 2CWNA 2X0HA 4GIEA 3WDHA 2PWEA 1EUNA 3TTYA 3O1NA 3KBWA 3AU6A 3B8TA 3PM6A 3CZLA 3GHRA 1UYQA 2ESCA 1S38A 2POTA 2PRMA 3NA8A 4X61A 3WLMA 2AKMA 3TYDA 4E2OA 4UOQA 2O9TA 3OLEA 4LBRA 2O56A 3BJFA 1E4LA 1XYMA 1W1B1 4PTDA 4ATDA 5ECUA 2V5BA 1MO0A 3BG5A 4ZB5A 3TLLA 3B8WA 1UQYA 1LWJA 4MNMA 1A5SA 3MI2A 1PUDA 1F05A 2ZVIA 5T9BG 1Q4WA 5AVNA 1OD8A 3URAA 2VGGA 3VIJA 1XYLA 3QMTA 3WSUA 4MUZA 3JZEA 4QG9A 3TX9A 3A5VA 2Y0FA 2IPJA 3OBAA 4W8BA 1C9DA 2WPGA 3F4DA 4NZFA 4HTBA 3VX1A 1W5NA 4RE2A 1RCXB 3Q4DA 4XWUA 3BSHA 4M24A 1X7IA 2QPSA 4JY9A 2NWSA 5DT7A 4WOQA 3CL7A 3H21A 3NPUA 1Q4NX 4OBTA 4RZ4A 1B3OA 4JPGA 4QM1A 5C2XA 1I4NA 1UKSA 2GJNA 3E3HA 1JQVA 2QJJA 1ICSA 2P3EA 3CWOX 4S3EA 4E2DA 1W31A 3TAKA 2J4GA 3PANA 2O4MA 4LVAA 2VHLA 2FGLA 3N4FA 1PZ1A 4KS0A 2BDQA 5CAKA 3CK5A 2HK1A 4IQEA 1E72M 1XLJA 3P74A 4U31A 4D71A 1OINA 1EZWA 1HUVA 4AMAA 3SZ8A 3MDWA 1HX0A 3EBVA 2E5DA 1GGOA 3KL0A 1KBJA 4XIMA 1Q66A 5D04C 5D03A 4OOZA 3L21A 1CPUA 4UR9A 2AQWA 1O94A 3EA3A 1KM6A 1C8YA 5D9MA 3TTEA 4CGTA 3ABSA 4NUWA 5I03A 2IPGA 1IGWA 2WV8A 1OM0A 1Q5MA 3BC9A 4OQVA 2PDJA 3ZMRA 3PPHA 5H91A 5I24A 3TFCA 4HCLA 1V6WA 3S3GA 3TOPA 2GVEA 3WBWA 3LHWA 3G1FA 1DJGA 3R5EA 1V79A 4JIEA 2YDQA 4MG4A 1QJWA 3KX6A 4HNVA 1X8CA 2YL8A 4L61A 3CHVA 3DG7A 4LYRA 1B0IA 5H1WA 3WH8A 4E4UA 1M68A 3W82A 1OFEA 4R27A 4QTGA 1IEXA 1ZZMA 4XUYA 4O4VA 5CCZA 4F0KA 5C71A 3BL3A 4TU1A 4XQ6A 1KRAC 1XWYA 4M0XA 3UR5A 4WRHA 2R14A 3SW6A 3GNXA 1TG7A 2CZ5A 4V15A 1CGYA 3NZ1A 5BMWA 4HPJA 1J79A 1KM3A 2PDLA 2VT0A 5I5RA 4PE8A 2DT3A 3AROA 1W1VA 1OABA 3P3BA 1EBHA 5J5RA 1M7OA 1D8WA 3P2VA 3VIOA 3UXAA 4PMYA 3AWOA 3Q94A 1VFHA 1ADOA 1ME9A 5C54A 3KP1A 3LM3A 1V0NA 4UTHA 3VABA 3H53A 3L12A 3BW2A 3NUKA 2CFFA 3GD6A 2ISDA 2NWRA 2DJLA 3VO0A 4DWSC 1O4UA 4LBUA 4UOZA 3EPNA 3E5PA 4HPXA 3ZSTA 5JH2A 3EX6A 2MNRA 1XLGA 4G56A 5IXEA 2ALDA 3TOYA 1YDNA 2WSYA 3HIJA 3WQCA 2AQVA 4LB4A 5D9OA 2CZVA 2DSWA 4IFKB 2UY4A 1E9YB 4LYKA 1JUBA 2PZNA 1W5PA 2GUBA 3QV7A 4GXWA 4LS2A 4CQBA 2Z1KA 1SMDA 4ZQNA 3I7SA 3ANYA 4GH3A 3VE9A 2W61A 3BLKA 3GU9A 4DJDD 1B30A 4XD3A 4WHBA 2JQXA 2NSOA 3MP3A 4ICCX 1OWQA 5AKQA 3ZT6A 1D2KA 1A0CA 4Y6GA 2YYTA 5HNUA 2A2IA 2G0WA 3CO8A 1D7KA 3W26A 1XLEA 1Q65A 1UG6A 3M6YA 1A5UA 3FFSA 4XTIA 4ZZ9A 1XXXA 2XVGA 2NUYA 1JXJA 3CZGA 3QSTA 4H9VA 1Q6CA 5HMEA 1Y5WA 1XGEA 2HMCA 3LGDA 2Y63A 3M9YA 1FKXA 2Y70A 4PUWA 3PBGA 4DNHA 3PK7A 3BG3A 3TYZA 3W4RA 4XKMA 3MDUA 3FYPA 2QQ6A 1VFUA 1UC4A 3UGRA 4LTSA 1DIDA 2FLIA 1ICPA 4LV9A 3SCPA 3AXXA 2QYGA 1P43A 3BAIA 3E2VA 4LRTA 2QMJA 3L4TA 3IUHA 4IUOA 3KL3A 4HHLA 1JPMA 4M6UA 5GJNA 2XINA 4ADUA 1TUFA 1WXJA 3DYMA 3DHUA 4ZFMA 3H70A 3GFYA 4IMEA 1JZ3A 2D24A 3ARQA 1VEMA 4DO5A 4G9PA 5CAHA 3NO1A 1Q6QA 3H23A 5CG0A 1Z44A 2VEFA 3DFNA 3HFYA 5EB8A 5A6BD 1U5JA 1J96A 3W2JA 4JTIA 3PNUA 3LBMA 2DGAA 4BY3A 1PWMA 5LNVA 1CXFA 4JFWA 3WFAA 4Q8WA 2KX9A 3PG8A 4QE1A 4L1WA 2J27A 4UTTA 2VFFA 4M6QA 3M0MA 5A69A 1MVYA 2J7GA 2HBVA 3T0AA 3IS4A 1CLKA 2PA6A 3W1LA 1BXNA 3G5EA 3LOTA 3VE7A 3W00A 2YBVA 1RH9A 3GAYA 4WDTA 1O95A 1OGGA 3MI3A 5EMMA 2TPSA 4C6MA 2QMKA 3QR1A 3B4UA 4JL1A 2DH3A 4G1NA 1R87A 4H8HA 2FZDA 2CPUA 1HNYA 4M6VA 3W7GA 2YGYA 4HK6A 1XFCA 3C5QA 4S3CA 1E51A 3WENA 4MM1A 3VIKA 4IZGA 4EPEC 1BEUA 3W7IA 5I77A 3QV9A 4HN8A 1WUFA 1I6NA 1CXEA 1JDAA 4UIOA 2EHHA 3G8EA 3B8SA 4AEOA 4Q7IA 3K8LA 1BSIA 4FEZA 5D09A 4N9DA 4F9JA 2XZ9A 1WX0A 5HR6A 1AH3A 4Z2GA 3FEQA 3EX2A 4GD0A 2VFEA 1F76A 4FPSA 4GQRA 3GIYA 3U5YA 2YBUA 5FOOA 4KPLA 4RV3A 1TFVA 3M5YA 1I2QA 4REQA 3DOPA 4Y90A 3AS1A 2ASHA 5A6BA 1PDYA 3QLDA 4WCJA 3N73A 3MUIA 2XIJA 5CG7A 4XUGA 4GVGA 4QXIA 5D2TA 4ERAA 3EXTA 1CGUA 5F2MA 3HMCA 1O12A 1RQHA 3ZVHA 4QG6A 2PF8A 2A4AA 3REQA 5D32A 1N8IA 5M03A 2P50A 2YXXA 4JYEA 3Q67A 1P48A 3NSNA 2ZA3A 3AIWA 3ANUA 2VOTA 1QNRA 4S2BA 3S9IA 3M44A 4H6QA 1W9DM 2YA2A 2C79A 2J6VA 4UFJA 2BV9A 1VBJA 2Y24A 1KBKA 4ICNA 3MCMA 1L6WA 3G3DA 4GVHA 4IQLA 4WGHA 3HFTA 9CGTA 1T5AA 3MTWA 4R9XA 2G3JA 2ZVRA 2Z1SA 3B05A 2VELA 5I78A 1JG9A 3PTKA 2GYIA 3T0BA 4MTVA 3EDFA 4A8NA 3W7CA 1V7YA 1QPNA 3CPUA 3VXGA 2DZPA 1UZDA 2WM1A 1SR0A 2Y61A 2ON3A 4X0VA 4H7ZA 4LEFA 3UPBA 1XLKA 1YIXA 5EFFA 2Y1HA 3URBA 2AL2B 4MJ2A 4DPQA 3CQIA 1G4EA 1E40A 4HHPA 3BCFA 4FZIA 1PPIA 4B16A 1LBMA 1A3XA 1DWJM 1RLDA 3PWIA 4LALA 2G3IA 2GL5A 1T6MA 4U5KA 3GG1A 2EPMX 3GNNA 5TAOA 3VPLA 2OYMA 1SVDA 3OGSA 4IH3A 1TO3A 1J10A 3CUZA 4H6KA 1CIUA 3HG2A 3WBXA 4M8UA 3U0HA 4O18A 3RLVA 4GJJA 4E3VA 2A3CA 3TONA 1KM0A 4O0QA 2EGZA 2E5BA 2I16A 3VDGA 5G4EA 4G1KA 4RK8A 2HK0A 2REQA 1US3A 1UJQA 1UUQA 3OBKA 5I3IA 2NQLA 4Q4QA 4H8NA 1WA3A 4S3FA 1BWKA 3FSUA 3EOOA 2B81A 1OADA 2FZBA 1BQGA 2RAGA 1BHGA 1YX1A 3TA6A 2XGZA 3STEA 3E96A 3BE7A 4FXSA 2C13A 3LU2A 4JAWA 1RD5A 3WLHA 5GPRA 3UQNA 1DKWA 4H9YA 1SO6A 1AH0A 5KZEA 4K3ZA 1BSLA 4E38A 2VC6A 4BHYA 1DEDA 3HPFA 3OQ8A 4JDBA 3IV8A 4FLRA 5E5CA 4NF7A 1RA0A 4J3ZA 3LRMA 3LBCA 1QUMA 3ZLHA 1OT1A 1E6NA 3IUDA 1UD6A 3ZS4A 3W28A 4YWIA 1E5JA 4CCZA 2DIKA 2I5IA 3L68A 1KCZA 2YIHA 2PSNA 4MIMA 8XIAA 3HTWA 1YDOA 2Z24A 1M01A 1DJYA 2YJQA 4CNPA 3BGGA 5FEPA 3M16A 3W02A 3WEZA 4AAJA 1K8XA 3KM8A 4KFNA 1EFZA 3W53A 2I5GA 4O17A 4GZ7A 3VIFA 3S1WA 2RDWA 3BURA 3GDRA 3RM4A 3OHMB 3NL3A 3QHNA 3S1UA 3LBOA 1DQWA 3Q2DA 4HK5A 4JBRA 3BTNA 4BF7A 1R47A 4DNMA 2QCNA 3PZVA 5K4XA 2D0FA 2R1PA 4CQCA 2ZWZA 1CGWA 6REQA 2IUZA 1WNOA 4JIIX 4ZO7A 1AH4A 3M41A 5D2XA 4A2RA 2OLHA 3D3AA 1ZBCA 4C1NB 3C2OA 3ITXA 3RUBL 4GFSA 1N82A 1H49A 3HF3A 4HA0A 4FR6A 2ZRWA 1RD6A 2UY5A 3KOXA 5BYWA 1TQJA 3ZIZA 4N6FA 4NXKA 3TZFA 4ZOAA 4YYFA 1RALA 1RY8A 1ZJHA 2VCAA 1JD7A 3IACA 1KM5A 2ZXQA 4NRRA 2XISA 5A8MA 2FPYA 2Z2AA 3UJFA 3U48A 5GNXA 1AQFA 3OIHA 4AZBA 1JZ8A 4NRSA 2CETA 1SYTA 3VDBA 2C19A 1YTDA 2E09A 2REQB 4GNVA 3LB0A 1HFBA 2WQPA 3S5YA 5FI8A 5A8GA 1HJQA 3IARA 5BMXA 3UF9A 3QKEA 2CBVA 5MF5A 3KVJA 2DPEA 4YNGA 1U30A 1DXEA 3AISA 1JF6A 1OK4A 2ZRXA 3KHDA 4C6CA 3TMLA 1A53A 1I75A 1WDDA 4JIQA 4JY8A 1TJPA 1DORA 3BMVA 3IRDA 4IP7A 4AEEA 1L8NA 3W7LA 3W76A 1KFLA 2J75A 3B9OA 5AYXA 4JIPA 3HN3A 2HSAA 1ZL1A 4EAYA 5BXRA 3W87A 1KWKA 3QHOA 2GVGA 1R3SA 5I02A 4XX6A 4NU7A 1O5KA 3BZJA 2PS2A 4IMGA 2QCMA 2TODA 4ZBCA 3EB4A 2GUUA 1LBLA 4S2CA 2BY0A 2EG7A 5AFDA 4CUCA 1BF2A 3FAXA 4DZAA 2PWUA 3PTQA 4O50A 2VVNA 4H7CA 1TMQA 1M04A 5XIAA 3LEPA 3ARVA 3WD1A 3QRHA 1R7AA 4AZ5A 4UFMA 3IVTA 1FWGC 1ZJIA 2W92A 5B7YA 2B7PA 4ROQA 3EXSA 3R11A 3TQPA 4WIWA 2WMHA 1MZRA 3NG3A 1V03A 4HOZA 4WKAA 2DZSA 2WZEA 1RQBA 3PUGA 2V5JA 1EHNA 2D2JA 3CIXA 3LCLA 1H63A 4WLCA 5MKGB 3TN4A 2OG9A 5E0CA 2P10A 5A95A 3E49A 1JPIA 3CL6A 4HA4A 3QKZA 3RFAA 3ZSSA 1VJSA 4DJFC 1WDWA 1BVNP 5CJNA 3L4WA 4W7WA 4ZL1A 2GDUA 5DANA 3VUSA 4CNSA 4P2VA 4JTEA 3QR3A 4HCHA 2HISA 3GNRA 2VZTA 1IT7A 2WBGA 1HTIA 5U7SA 2YL9A 2H8ZA 1UPPA 3CHCA 1QW8A 3LERA 3F7JA 2H9AA 1V7AA 4LCRA 3B0XA 3N2MA 2QJHA 4RUBA 1R2RA 1YKWA 3WUEA 1VLIA 3WUFA 2GWGA 3L0NA 2X41A 1L8PA 1W6TA 3PFRA 4F0SA 1US0A 1H3GA 2GQAA 4C6BA 3WQEA 3KOFA 1CI1A 3C8FA 2XSBA 3CPGA 3HGOA 2EPKX 4UMBA 1ISYA 1FWNA 3LRKA 3ITCA 1YQ2A 3ZQ9A 1JXKA 4GNKB 4K7VA 5E93A 5LZLA 2CLHA 2RGLA 1UR9A 3ZLFA 2CLIA 3UJEA 4UFIA 4MPQA 5HQMA 1EP3A 2QCFA 1Q7ZA 2R9RA 1BVZA 2OGYA 3LCGA 1DWFM 1E1EA 5TD4A 3QOKA 5HAOA 1EA9C 3O0KA 1D7FA 3W7OA 2NX3A 3AYTA 1QFEA 1GVRA 3FXYA 1AK5A 2CHRA 1PE1A 3C61A 1YXYA 3OJGA 1W32A 3MUXA 4MWAB 3VD3A 4LPCA 4JX6A 4IM4A 1TVNA 3DDMA 4ZCWA 1SZFA 4F0HA 2YCLB 1WOAA 1W9PA 1H1ZA 1ELSA 1UR4A 4ENLA 4ACZA 2AL2A 1H60A 1Q13A 4JR5A 2Y7EA 4IIGA 4TV5A 1MXSA 1KFEA 1S5TA 4HNTA 3PJXA 2PAJA 4MLRA 3MMUA 3IGUA 1HL2A 3MYPA 1C29A 1LT8A 1TSIA 4AC1X 3G0SA 3W2UA 1W8SA 4HVXA 4HNUA 3LMZA 5G4WA 3SR7A 3KWSA 4PBGA 1M9HA 4XZHA 3QH2A 4K8HA 3U7VA 1OFPA 3V0TA 1XUUA 1VEOA 3VA8A 1EYEA 4J40A 4M19A 4P7RA 2PTXA 1CGTA 1LG2A 5C5YA 2CLFA 3HMJG 4FI4A 1X1OA 2J13A 2CITA 4PSRA 4QITA 3SCUA 1V5XA 1OT2A 1XBYA 1ZNNA 1FP9A 2W67A 1JL8A 4TMBA 2QCLA 3BLLA 2H90A 3I6EA 3TTSA 3IK2A 4OBRA 1R3QA 3AMDA 1SU5A 4IJCA 1W3LA 5LA1A 3HQ1A 5CGQA 4MFDA 2C15A 1QI0A 3VIPA 4WOZA 4X9YA 4Q6JA 4AHOA 3R13A 2VR2A 2A3BA 2PGWA 3U9IA 3RRAA 3STPA 1N7KA 4DJFA 3W86A 3UR2A 4QQUA 3E5BA 5JQ9A 2Y89A 4AY1A 3MVIA 1VD6A 5LGXA 4LAMA 2E1WA 5FA5A 3N15A 2GQ8A 5HR7A 3P67A 3F2BA 2C8NA 1NTHA 4D1IA 4Q4RA 4DLMA 1ZBWA 4NJHA 1Q2RA 1PWLA 2E9LA 1HP4A 4UQDA 2BG5A 2OX4A 3NQAA 2R91A 3CO4A 3M0JA 4MY1A 4IMFA 1UKTA 2QLYA 4G2DA 4MADA 3RJYA 2WSQA 1ECQA 5EGRA 3BMWA 3NURA 2J7CA 3DEQA 2VENA 1GTHA 1VCFA 4PYSA 2WK2A 3EX4A 3CUFA 1AD1A 1QI4A 3WDRA 2BHUA 4KBXA 3ZWTA 3V35A 3XIMA 4W86A 1JPKA 2QVHA 2W4XA 1L2UA 3DHFA 3IIXA 3N4AA 1VZWA 5L6UA 4IUGA 2JK2A 3TN3A 1EEXA 2OXNA 1YPIA 3CXOA 1PV8A 3LNMA 1Z69A 3ISIX 3OZPA 1B9BA 1BYAA 1ITXA 4IL2A 2E8ZA 4PBEA 4EOUA 2I5QA 1GT8A 2OZ3A 2EJ1A 2R1MA 2FMOA 4JL2A 4I7UA 1W1ZA 1Z32X 1A5MC 2BFGA 4HU4A 2EG6A 1ADDA 3DGBA 3FKKA 1UA7A 3ZOAA 3V5OA 4GINA 1UR1A 1E9LA 3PBWA 1L6FA 1GJWA 3OGRA 3FVMA 4TQTA 3WL0A 3SUSA 4CCDA 2BVDA 3RM9A 4UQCA 4P8UA 1PIGA 2GGEA 1UJPA 2OFJA 5FJIA 4JHZA 4PCNA 3A47A 3QGVA 2HE8A 4ZB0A 3P0XA 1WZAA 2WVVA 1E3XA 1O5RA 1NU5A 1XM3A 1YPXA 4GKLA 3AXIA 5EFDA 1MQQA 3VNYA 4F2UA 3PNZA 4DXVA 1QBAA 1UCWA 4PUKA 1Q6OA 3P93A 4IICA 4PSPA 3FOKA 4PC8A 1G01A 1B3ZA 3IIOA 2YX0A 1H51A 2QUMA 4XZ9A 4EACA 3OLDA 4UZSA 3UG4A 2BY3A 3BOLA 4HSHA 3DXIA 1S1RA 2E7FA 4DM2A 1JNEA 4GPNA 5ABGA 4AVOA 4LUSB 1E43A 4RX0A 3I68A 4AISA 3ONCA 2E8YA 1SO4A 4H8VA 5EPDA 3A9BA 3MJYA 5B7ZA 3ABXA 5JUVA 3AZRA 2V38A 3OG2A 1XLAA 2H9AB 2GQ9A 7PTDA 5D8WA 1QCWA 2ISVA 3WX7A 5I3HA 2CESA 2ZKMX 1VLWA 4AG0A 3I3EA 2PDHA 2QCCA 3Q37A 1EO7A 4D6CA 4MZ8A 5CC3A 3BH4A 1PZ3A 5BROA 1SFJA 1Z42A 4NSBA 5CZJA 1NAL1 4GRSA 1XICA 4D6HA 3OZMA 2HNEA 3WLLA 4GFIA 1LM1A 4US5A 2HROA 1MWOA 1FCVA 3H4GA 1W2PA 3FA4A 5CPTA 1G9HA 5A6AA 3AHVA 1X96A 1JJKA 4FP1A 3QPZA 4NJGA 4O1EA 4F79A 5K3VA 2XWDA 4NZ4A 1MW1A 4G7EB 4GK8A 3EOEA 4M5PA 4JCLA 3C0LA 1OVDA 2ONEA 3V0UA 6XIAA 4V1YA 3AZSA 3QGKC 3CQJA 1A5AA 3UXIA 3WEOA 3U2EA 3O16A 1V6YA 3BARA 5C8BB 4WSHA 3MUCA 4JN8A 4FNRA 3MO4A 4U28A 4GHRA 4ZQRA 2HBXA 2FHBA 3G2GA 1KFJA 3V3WA 2A85A 2OLAA 3W7HA 4FF5A 4MOZA 4KEZA 2WMGA 4Y9AA 2PWHA 3UWYA 2BY1A 2WYSA 2IS7A 3SEPA 2CIPA 3FGCB 2CBIA 3EB2A 4IWWA 4GBUA 1OBAA 4E4PA 3XINA 2GFTA 3FJ4A 4W7UA 4GY7A 1GVQA 4JIRA 3PR2A 3JRKA 1NARA 3JVAA 4GO9A 4WJ8A 1F8MA 1EXPA 5KEZA 1A5CA 4YN5A 2XGIA 3LLFA 4EF8A 1DYSA 2ZYFA 3IIPA 4IGSA 4KWVA 3TZNA 2QUNA 1TVPA 4GQGA 3T40A 1DE5A 3LZ5A 1CGVA 4QEEA 4IGNA 3B8DA 1A5NC 1NWRA 1AODA 1GPWA 4LY8A 1UWQA 2FVLA 3B40A 2VRKA 1ZY9A 4IPPA 4BQ4A 1XIFA 2XVKA 1F07A 3KHJA 3LGGA 1EP2A 3T8LA 1E9IA 4YVXA 3NOYA 1D8CA 3H26A 1NOWA 2GJRA 4ZE4A 3LGEA 3CUHA 3CU2A 3V5FA 2UZ9A 1JR1A 3EOSA 3H12A 5FJRA 3T05A 4NQ1A 2YW4A 3MT1A 3H7RA 2AGTA 1HVXA 1S3TC 4D9PA 4LXFA 3LHZA 4JEQA 1F2JA 4L6DA 1W1A1 2WNWA 3NAVA 1X7FA 1OC6A 1VBRA 1GONA 1NJJA 1TREA 2G41A 4NJIA 1NP2A 1UWUA 1FOBA 3O0FA 3P14A 3OBEA 3ME3A 4IISA 1JIBA 3AYSA 3S2JA 5CLTA 3AUJA 2GJPA 2C0HA 1PAMA 1TKKA 3E38A 4EE9A 2YFOA 4B9ZA 1GQLA 1IWBA 2VYOA 4NZ3A 4JS3A 3AHTA 1I2NA 5CPLA 4E4FA 2J25A 3A3HA 3SQSA 2PP0A 2V0TA 4HMDA 1MRAA 5B80A 5K7JA 4XV0A 2W62A 5E09A 1J0HA 4IJRA 1Q45A 1FWSA 3W2LA 1JZ5A 3JW7A 2J77A 2EPOA 4P7NA 1E4MM 1TV5A 4HYRA 4XKYA 1BF6A 3GFXA 4NJJA 4FA3A 5C9ZA 3QBUA 3M0KA 5G2WA 2DZWA 1TVLA 3UWWA 3HGRA 3WD3A 3PZUA 4YCOA 4ZOEA 3JZUA 5IFTA 1E56A 5JVLA 1QPOA 3MVTA 2W66A 1PL9A 3SCOA 3VOJA 1TPEA 3NDOA 2P76A 1R5YA 2FTPA 3O07A 3S5OA 1VAHA 5F7UA 3QJAA 4GOAA 1EIXA 4MB5A 1GPFA 4ZFCA 2ZTKA 2GZXA 5A5WA 1VS1A 4L9XA 2OODA 4FXFA 4LUYA 1QOQA 1NM9A 3QY8A 3L66A 1FH8A 3TSDA 3A4XA 1JF5A 3E0WA 2X7WA 5E6YA 1UB3A 2EAWA 1Q6FA 2XYLA 3TLQA 4Y9MA 4IX2A 1PJ9A 1FHLA 4ZVJA 4G7FA 4YTTA 4U5IA 3P5ZA 4LT9A 1W1TA 3FXGA 1TELA 4U2ZA 4C5YA 1MSSA 1V6TA 1J0KA 1DVJA 4CCCA 3N2CA 4PZVA 4HCDA 3RLGA 4DBDA 2XFFA 4P7QA 3SY1A 4K38A 3W7PA 3DFHA 4EWJA 3PB2A 2PDKA 3VZZA 2O4QA 1TPWA 2FGBA 1LQ2A 3TWBA 2Q8ZA 3UBPC 4DJEA 1Q7QA 5A3HA 4UQEA 3APYA 1C8XA 3OYXA 5GVJA 3TQ0A 4X0NA 1NWUA 3T2OA 3DECA 5LHEA 3FAWA 3SIMA 1H62A 1RP9A 4N4QA 3ZJ7A 4DZHA 2AMGA 3VD5A 3O6CA 3WIJA 2PU0A 3QGAC 5A6JA 1JGMA 1GW1A 4NI3A 3QTPA 4WXZA 3WH6A 1TTQA 1MFVA 1G4SA 3LN3A 3PPGA 3UCDA 4D6GA 4M1BA 3B0UX 4ZA0A 4RXGA 4JEJA 1U22A 1UBSA 3W71A 5AYZA 3QY7A 5AC7A 5K9XA 3AFBA 4BR1A 4Q8TA 4FR1A 1GQJA 3VNMA 1LRTA 3H22A 4HTYA 1T40A 4W87A 4HYVA 1B3YA 2CLLA 1TR1A 4YYCA 1F9CA 3CLWA 1K9DA 4RR4A 4OJYA 4PUEA 1TV7A 3I10A 2VZVA 4L6HA 2Y85A 4PUUA 4AD1A