1I1XA

1.11 a atomic resolution structure of a thermostable xylanase from thermoascus aurantiacus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
302
structure length
302
Chain Sequence
EAAQSVDQLIKARGKVYFGVATDQNRLTTGKNAAIIQANFGQVTPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIRGHTLVWHSQLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVNEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYINDYNLDSASYPKTQAIVNRVKKWRAAGVPIDGIGSQTHLSAGQGASVLQALPLLASAGTPEVAITELDVAGASSTDYVNVVNACLNVSSCVGITVWGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Thermostable xylanase from Thermoascus aurantiacus at ultrahigh resolution (0.89 A) at 100 K and atomic resolution (1.11 A) at 293 K refined anisotropically to small-molecule accuracy.
pubmed doi rcsb
molecule tags Hydrolase
total genus 120
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1i1xA00
1Q4NX 1C92A 1XSJA 1E5NA 3VO0A 1ISZA 1WE5A 2ZXDA 3RILA 3W4RA 4BQ5A 1K6AA 5A8PA 1UH2A 1EDTA 2ZWZA 4EK7A 1JZ2A 3ZM8A 4HZ7A 4J3XA 1KFWA 5FKYA 3W0KA 1W2VA 5CXPA 1LJYA 1HJQA 2E8ZA 1JZ4A 1FH9A 3RMEA 5LA1A 2EJ1A 1MQPA 2UY2A 1C8YA 1NOWA 2XIIA 1LLOA 3AISA 3ZIZA 3IJ8A 2YLAA 4PEEA 1H49A 4H7VA 2Q8XA 3WQ8A 4ZE4A 1HJSA 2DT0A 4N0RA 3WSUA 3WMBA 2FHCA 2GDUA 1KB3A 1UQZA 1UOKA 3SCWA 3VIGA 1NWTA 3RM8A 5CQ1A 4WKFA 2G41A 1V02A 4AMCA 2JIEA 1NOFA 3WDQA 4UNIA 2XIBA 1ZU8A 1EDGA 5E6ZA 4JFTA 3PTQA 5A94A 1E70M 3G6LA 1UKPA 3PZQA 3SEPA 3MUAA 1E4NA 1UR8A 4LGXA 1XCWA 4JKLA 2J7EA 4AZCB 3A4AA 1J10A 2BXYA 3POCA 4PMZA 4CCEA 3T0DA 4KGJA 1UH3A 4BQ2A 2XSAA 4AD4A 1AMYA 1E3XA 1JFXA 2FGLA 3VD7A 4MJ2A 1A3HA 1B3ZA 1HP5A 3WNMA 4WSKA 1ECEA 3N18A 3T2QA 1GW1A 1ZB5A 4KGLA 4KWUA 4ATDA 1VBRA 2WVTA 1QNQA 4KMQA 1QI3A 1W9PA 3WH6A 2O9RA 4P8UA 5DF0A 3AHTA 5BYWA 2ZE0A 1MW3A 1VRXA 4NI3A 5FD0A 1J0IA 1V3IA 1UD6A 4OUEA 2YA2A 4FK9A 2JALA 6CGTA 1NP0A 3ARXA 1ZBWA 3OA5A 2VVSA 3S6TA 4PCSA 1ZL1A 3AIWA 4TXEA 3RJYA 2CNCA 5IFTA 1OIFA 4XZWA 3ARPA 1KWKA 3AROA 4HA3A 1H5VA 4AEFA 1RH9A 3RCNA 1BGGA 1W3KA 5AYIA 1UKSA 3MMWA 1QBBA 3D3AA 2YDSA 4W7UA 1UKOA 3SCUA 3GXDA 1X1NA 3VD4A 1DWAM 3HN3A 2UWFA 1EA9C 1E6RA 3AMKA 5FOOA 3MV11 5EFFA 2NSXA 3CIVA 2VO5A 5HOSA 2XGBA 2DEPA 4PMQA 1EH9A 4BS0A 3K8LA 1GOWA 2YDQA 2V5DA 1BSIA 3W27A 3WMCA 1E6QM 3VIIA 3L4UA 4AD1A 2C8NA 1J11A 1CZ1A 4Z2JA 1KCLA 4AD2A 5I6SA 3AQUA 1UWUA 1U30A 1HX0A 1MFUA 1OGGA 3VGBA 4M29A 1XH1A 3GNRA 3U7BA 2XM2A 3DC0A 1RP8A 5A6JA 1US3A 1GOKA 4WJXA 2X0YA 2XVLA 4WSJA 3WL1A 2NT0A 1W9XA 6A3HA 1BYCA 4CGTA 4X9YA 1AVAA 1J0ZA 2XPKA 3VMPA 3ZSSA 5TD4A 1NH6A 1NP2A 1JF6A 3AJ7A 1Q6FA 3CLWA 2VVNA 1E15A 4ATWA 3VNZA 5I77A 4R5EA 1QNRA 2VRKA 3VINA 1CGYA 1BYBA 2OWCA 3PTKA 1H11A 1NARA 1CXHA 1MXGA 4IPLA 4AZ6A 1JD7A 1V6VA 4WKHA 5A8QA 2VOTA 2ESCA 1V6UA 2WHLA 3I3BA 5FIPA 4Q7NA 4M56A 3PN8A 1E73M 1ISVA 4P8VA 3RM9A 4LQ1A 3RIKA 2YJQA 4TVCA 1UR0A 4WK9A 1TA3A 1JYVA 4JHZA 5A6BD 1BHGA 1UD3A 2FGZA 2VMFA 3WQ4A 1TCMA 3GXFA 4J3SA 4AW7A 2BFGA 2YKKA 1A47A 1NWRA 2DT2A 4K68A 3TTOA 2ZOXA 4H04A 3LPGA 3QHNA 2EPLX 1GCYA 2J75A 3WL0A 1HF6A 1UR2A 2EXOA 1OT1A 2WB5A 3KL0A 4M81A 4D72A 5HBFA 4LPCA 2V5CA 4X0NA 1ISXA 4P7NA 2ZUNA 3LPFA 2FDMA 4JFWA 5CG0A 3OGRA 4PN2A 2J7FA 5IHRA 3ZR6A 1BQCA 3QHOA 3VM5A 5JIPA 3K4DA 2GJXB 4MB1A 3TTSA 1JI2A 2BY1A 1BF2A 2J8FA 4GZIA 4MPKA 5CZKA 3BAIA 3RPMA 5E09A 3EMZA 1QVBA 5CSUA 1LQ0A 4CKQA 2E3ZA 1JZ5A 1VJZA 4UQCA 4JHOA 1C7TA 2AOSA 4YHEA 3CO4A 4MNKA 4HMCA 1E4LA 3CUJA 2PWFA 1I75A 1UWIA 3MUIA 2PWDA 4NRSA 1SYTA 1E40A 1BG9A 4E8DA 1CEOA 1HKJA 2JFEX 2WWCA 2VR5A 2J4GA 5I78A 4PTMA 2ZX8A 4U3CA 4L4OA 1NWSA 1M04A 4J3WA 1JZ6A 3TTQA 2BVYA 3ARRA 2WC3A 3AIVA 5I2UA 3W53A 3PZIA 1DHKA 4D6IA 3PZNA 2E40A 2PWHA 4D1IA 3N12A 2HISA 2DIJA 5IDIA 3VOCA 2OYLA 4WIWA 3KL3A 3IK2A 5I3DA 2XHYA 3AXIA 3VUPA 1WDSA 4QCEA 2YIHA 1ZBCA 1VBUA 5GNZA 4GZEA 4UTFA 3PTMA 3FW6A 1VFFA 4Z2KA 3GH5A 1FOBA 3VIMA 4NRRA 4OOZA 7TAAA 1O6IA 4B9YA 1XD1A 4U31A 3WD1A 1CLVA 3UETA 3WF1A 4LYRA 3WQ6A 3KEHA 3NJ3A 2E9LA 4B3KA 3RM4A 4AZ7A 1VEMA 3VPLA 1R8LA 4JIEA 1E71M 3CMJA 1UHVA 4YN5A 3M6DA 2WMKA 2CKSA 3L4XA 1EDQA 1VAHA 1OGBA 3OLEA 4PMNA 4Z2IA 3T2PA 3KE0A 4URIA 2D24A 3DHUA 2G3IA 5CPSA 4AXNA 2E9MA 2F2HA 3KWXA 1QPKA 3AIUA 1TZ7A 1OCQA 5I79A 1JD9A 3WDRA 3APGA 1XHGA 1JGIA 1YHTA 1EGZA 5HPCA 3VD5A 2A3HA 1HKMA 4HPGA 1VEOA 1WCGA 3TTYA 4TUFA 5ECUA 1TR1A 3CPUA 3ZO9A 1LL6A 3NDYA 2FHFA 3VU2A 4DUXA 4MB4A 1WAWA 2BHYA 3ZT5A 1ISYA 1H4PA 1DTUA 3AYRA 2A3AA 3QGVA 4AZCA 4JL1A 4LX4A 3BLKA 4C7FA 1ZBVA 1ESWA 3VILA 1M7XA 3BCFA 3EDEA 5HXMA 2Y4SA 5A69A 2ZXBA 2VL4A 1B0IA 1PX4A 3AS3A 3NSXA 4QDMA 2DSVA 1HJVA 4HOXA 1QI5A 4JFUA 2J62A 3A47A 1QHOA 3ZQ9A 5BRQA 3BAJA 3W29A 5M5DA 3VDBA 4U33A 2MANA 9CGTA 4HOWA 3WQWA 4E2OA 1DWHM 4IUGA 3WMSA 3T2OA 1B3VA 4H2CA 4W89A 4W5UA 3QOKA 1GPFA 1U2YA 3HU7A 3VMOA 4W85A 3GBDA 3RJXA 1VJSA 1TUXA 4XV0A 4J3UA 4FMVA 1PEZA 2Y5EA 1P6WA 3ARYA 4CU8A 4C7DA 1J0YA 1KXVA 1R85A 1ISWA 1BVNP 4W8AA 3VGDA 2HVMA 4GI9A 2CETA 5C70A 4E4PA 1WZKA 1CXFA 2VX5A 3M7SA 3BGAA 5C71A 3NIYA 5A95A 2ZUWA 2VNCA 1R87A 3ZJKA 1UKQA 4MDOA 3W26A 4D6EA 4P7RA 3VDAA 2ZIDA 1UZ1A 1XRVA 4BA0A 3U5UA 4D6CA 2OYKA 2OWXA 3WBEA 1J18A 3F5LA 5BXRA 3ARQA 4ACZA 1HJXA 5BXSA 5ABGA 4GIAA 4W7WA 2VZUA 1UD4A 1JL8A 1PZ3A 2JEQA 3HMCA 4HP5A 2VJXA 2J7HA 4LXFA 4PMVA 2EPNA 1D3CA 4F79A 1CGXA 3ARVA 2Y8VA 4TVDA 2Y8KA 3G6MA 1WO2A 5D9OA 3DYOA 1OINA 3U57A 2XVPA 5DEZA 1K9FA 2WC4A 1R7OA 1CECA 1JG9A 1C93A 2CEQA 3TP4A 1MW1A 2XUCA 2ZUSA 3WUEA 1J0HA 4YHGA 1UR4A 1HP4A 2WVVB 1KQZA 3RDKA 5I5RA 3ZMRA 2WBKA 2ZX5A 1C8XA 1C7SA 5ABEA 4GZJA 3UG5A 4WF7A 2ZX7A 2CPUA 3POHA 1QBAA 3WD0A 2DSUA 1OT2A 3AYSA 3GDBA 4D6JA 4LYPA 2IXVA 2DT1A 1JDDA 3FY1A 2XVKA 4DWSD 2GVYA 4XZBA 1XD0A 7CGTA 1GNXA 3N17A 2GFTA 3M46A 3QHMA 3VGHA 3PBGA 2W91A 2YA0A 5BCAA 4L4PA 2V38A 3L4WA 1UYQA 4GINA 4AD0A 1MW2A 1F4HA 2DSZA 3UR8A 3OZOA 3WBAA 1LL4A 1EO5A 1BTCA 2WYSA 3UERA 2BVTA 3GNPA 1NQ6A 1EOKA 2WPGA 3BLPX 4PMUA 1OD0A 5FCZA 1B90A 1Q6CA 2WKGA 4BQ4A 1TMQA 3NDZA 1GQIA 4KRUA 4DWSA 3FN9A 3VGFA 2XGIA 2DQXA 1H1NA 3AIBA 1RPKA 1JFHA 3WH8A 4JFSA 4D1JA 3MU7A 4D6DA 2JF6A 4M8UA 2D1ZA 4HA1A 5BROA 3VIFA 3K46A 2VX6A 2VT0A 4AD3A 4Z2GA 3N15A 1N82A 2PF0A 3B8SA 1BFNA 5M03A 1G01A 1GOQA 1WZMA 1CTNA 3GBEA 4PSPA 4NF7A 4EANA 2CBIA 3OLIA 4CN1A 4YPJA 3W81A 5A6LA 3WD3A 3A4XA 2ZXQA 1OSEA 2BVDA 3WDHA 2F8QA 3UCQA 3VMNA 4Z2LA 1V0NA 4W87A 4ZFMA 1B31A 3O9NA 1GJUA 2GJXA 3AFBA 5CPTA 5HDRA 3AICA 4JKMA 4QFUA 4V2XA 1HVQA 1Z32X 2WSPA 2ZUUA 4U2ZA 1W9VA 3I3EA 2WM0A 2BXZA 3NSNA 4MAVA 3IJ9A 3FAXA 3OBAA 1UKTA 3CUGA 4U5IA 3B9DA 4ACZB 3BH4A 3GYCA 1J12A 1V0MA 2WK2A 3FAWA 1DWFM 2J7GA 4JCMA 4PMYA 4UQBA 1VFMA 4RE2A 4CD6A 5EFDA 3AMGA 3NSMA 2ZXAA 2J25A 1QI0A 1WB0A 1OGSA 4W84A 1B3WA 1DEDA 2WLYA 3BAKA 1U33A 2BNJA 4A4AA 3WF3A 1I1WA 4FLRA 4BQ3A 2VZSA 4QCFA 5A6AA 1D7FA 1US2A 2GUYA 4TOQA 2EO7A 1H0IA 3THCA 2WVUA 3PZ9A 1AQHA 3S2CA 4H41A 1CGWA 3K1DA 4XX6A 3E1F1 3N1AA 2UY3A 3OGVA 3CTTA 4DUVA 3SURA 1W1PA 5E70A 5A6SA 4W8BA 1PPIA 3WD4A 1FFQA 2CHOA 4ZEPA 1ZJAA 2WHKA 1XH0A 2J74A 2QPUA 4GO8A 3W6LA 4UFMA 3WQ5A 3EBVA 2WW5A 5E0CA 2WZHA 3SIMA 4CCDA 3SCPA 4ML4A 5D9MA 3VD9A 3WFZA 4IM4A 4FLQA 1EXPA 3MMUA 3OZPA 3DHPA 2WBGA 4GO9A 2WC7A 1JAEA 3MKKA 4F9DA 1J0KA 1FA2A 1PX8A 3VIPA 5A8MA 3F5JA 4MB5A 5CLTA 2D0HA 2ZX6A 1X6LA 2CHNA 2WKLA 1LL7A 4TX8A 1W9UA 5I0DA 3KZSA 2W5FA 1CNVA 1TG7A 4AISA 3BMWA 2VRQA 1VB9A 2WZEA 1QHPA 1UZ4A 4J28A 4DWSB 1YQ2A 2RGMA 2XM1A 3N11A 2X05A 5DO8A 4B9ZA 3A4WA 3UESA 1JIBA 2YL9A 1UR1A 2X2YA 3AI0A 2XFYA 3IAQA 3PZMA 1RD6A 3WD2A 3TOPA 3VGGA 2CBUA 1V03A 2WHJA 1C90A 3ZSTA 2BV9A 3WF2A 5A6BA 2BS9A 2DPEA 2G3JA 2G4FA 4AZ5A 2WMJA 2VRJA 2J7CA 1CBGA 3AXXA 1ODZA 5BXTA 3WDPP 1XH2A 2WHMA 4XUYA 1JXJA 3EDFA 4LYQA 5CPQA 3SCVA 4B16A 1L8NA 4PTWA 1DWGM 1XSKA 2EQDA 1MWOA 3ARWA 3AMDA 4N42A 1WPCA 3U5YA 4PYSA 1QOXA 1IZKA 2WMIB 1JYXA 4UCFA 3VX0A 2DSKA 1KXHA 1MQRA 1LG2A 4QAWA 3MMDA 3WNLA 1CWYA 1OBAA 4MNLA 3PZVA 1Q6EA 1BG4A 3L4YA 3T0BA 1C8QA 3AXHA 1QW8A 2D3LA 3K8MA 2ZICA 1QW9A 2CERA 3ZJ7A 1KR0A 1HXJA 1W1VA 2CESA 2WZIA 1I1XA 3N04A 5C8BB 3I3DA 4UQDA 4F8XA 2YL6A 3N9KA 1TFVA 4AZIA 4D6HA 3SCSA 4BCEA 1E56A 4OOUA 2EPMX 3LMYA 4UZSA 1WNOA 1CXLA 1QNOA 5GNYA 4CU7A 4QLKA 4H8VA 4D6FA 1R86A 3W6MA 3CHCA 5CLWA 1WDQA 4M80A 2GK1A 3ZR5A 3WF0A 1G5AA 2ZUTA 3WQVA 3WY1A 3QR3A 1OIMA 4E8CA 5HPOA 4UQAA 2GJRA 2YLLA 1EQCA 4BF7A 1W1YA 3AHVA 1JDAA 2XVGA 4J3TA 2Z1SA 4W8LA 2OYMA 2XJ7A 3ZJ8A 3GNOA 3TA9A 1E0XA 3VDHA 4P7QA 1E4IA 1FHDA 5LA0A 1MW0A 4W86A 3F4VA 2JE8A 2RGLA 3GXMA 3AHXA 5BXPA 4UOJA 1E4MM 2BY3A 3AZRA 1GOIA 3GZAA 4PMDA 2QF8A 2WVSA 2OSYA 4PCTA 3CMGA 2IXUA 2VC9A 3VNYA 3PZTA 2OSXA 4MNJA 2XFRA 3BC9A 1W2PA 4M24A 2WVVA 4J3VA 1JNEA 3MSGA 2JIWA 3AMCA 4U3AA 2WLZA 2PC8A 5A8NA 4AIUA 3GM8A 1VIWA 2D23A 1G1YA 4OKDA 4DM2A 5DT5A 3BAWA 2E8YA 1E6ZA 1JF5A 3ARSA 4AZBA 3LPOA 3AOFA 4QLJA 3W24A 1LWHA 1TVPA 1XGZA 2YL5A 3WEZA 3CZLA 2WCGA 2NW0A 3ALFA 3AIQA 4HOZA 1XYZA 2E0PA 3A3HA 5I24A 3BXWA 1BAGA 4HTYA 1UH4A 3L2MA 3SCQA 2VTFA 1W9DM 3WELA 4S3JA 1FP9A 5DMYA 1HKIA 4W88A 3EDKA 4MAZA 4W7VA 4AD5A 1KXTA 4P7OA 2YOCA 1NOUA 1JAKA 1E5JA 1LWJA 1MFVA 1HT6A 3ZT6A 2YA1A 3OIHA 1CXIA 1ITCA 3AZTA 2VX7A 3SUSA 1AQ0A 3A6OA 5LA2A 1E6SM 2XWEA 3W25A 3ZJ6A 2PI6A 1BGAA 2EPOA 3KL5A 3IAPA 3WNOA 3PZGA 2C7FA 1J0JA 1E6XM 2W62A 3HJEA 1FH7A 1O7AA 4J7RA 2C0HA 1JNDA 2X0HA 4W93A 3THDA 3MUZ1 2BHZA 3CZGA 1XYFA 5A8OA 5IHSA 3WDJA 2DDXA 3AS2A 3VM7A 4FF5A 4GI8A 1W1TA 3SCRA 4RE3A 3MSDA 1BVZA 1V3JA 2CXGA 2QV4A 1LG1A 3W38A 2GK1B 3D5HA 4PTXA 3UEQA 3VIKA 5E6YA 5A6KA 1GORA 1W91A 2D20A 4BZYA 4F66A 4HZ8A 5JBEA 1GVYA 1GOMA 4HU8A 1IV8A 1V3LA 3SCOA 2CBJA 2GJPA 1E72M 3ARZA 4OJYA 2XYLA 3AHYA 3M07A 2EBNA 1QNPA 1V02E 3OLDA 1S46A 4KH2A 1H41A 3AIRA 4GPNA 2ZWYA 1FH8A 1UD8A 1BYDA 3AIEA 2Y24A 3GTNA 3OGSA 1KBKA 1E0WA 4WLCA 5LYRA 1GZJA 1M53A 2WCSA 1NM9A 1HN1A 4RE4A 1VENA 1UWQA 1JXKA 3NUKA 1W3HA 1MXDA 3L4TA 2F61A 3WNNA 3WH7A 1UQYA 1B30A 3CUIA 3WNPA 3TONA 5CJ5A 2G3NA 5EMYA 1GQLA 5JUVA 1E55A 1E6PA 1E9LA 4GQQA 2J78A 3PZOA 3BAXA 4IISA 3F5KA 1JZ8A 4Y7EA 3CUHA 1D2KA 1K9EA 1OB0A 4C7GA 3FHQA 3MANA 3B9AA 1CGVA 5GNXA 3SCTA 2WNWA 3CUFA 2J7BA 1AQMA 2EEXA 8A3HA 4UQ9A 8CGTA 3UG3A 4ZE5A 5ABFA 1V08A 1PIGA 4QLLA 3BSHA 5FL1A 1K9TA 1IZJA 4UQEA 4JCLA 4CD5A 3CZKA 2PBGA 1V3MA 4P8WA 4U5KA 3EDDA 4AYSA 4XB3A 2VCAA 3EYPA 1SMAA 1EHAA 5EBAA 4AY1A 3WUGA 1V6XA 1JDCA 4S3KA 1C3FA 1BPLB 4TX6A 4AIOA 1PBGA 5A3HA 3BCDA 2D0FA 2VQTA 1UR9A 1HVXA 1ZJBA 4JFVA 3LPPA 4ZENA 3CH9A 1DP0A 1RP9A 2PBOA 3NYDA 4D71A 1V6WA 3DYPA 4CU6A 5KZ6A 1B3YA 4AEEA 2QPSA 2W63A 1QI2A 3SUTA 1KR1A 1B9ZA 5DT7A 4HMDA 4GI6A 3WH5A 2VX4A 3CHDA 4MDPA 1JZ3A 4P8XA 2OSWA 2O9OA 2J7DA 3WEOA 1BYAA 3AS1A 3SUVA 5F7UA 5D8WA 2ZX9A 4Z2HA 4QP0A 2VI0A 1B3XA 1Q6DA 4PMRA 2WMIA 2E4TA 4B3LA 5GQBA 4A3HA 1XCXA 2A3BA 2DIEA 4CN6A 2JEPA 1UUQA 1UWSA 3W37A 1UG6A 4X0VA 3CHFA 3FNDA 7A3HA 1HL8A 3WUFA 1ITXA 5FL0A 2DH3A 1KWGA 5KEZA 1PIFA 3AZSA 1GOOA 1IT0A 4UFJA 1UA3A 2G3MA 1SFSA 2W61A 1KQYA 3WENA 4EKJA 3WNKA 2DT3A 4TVUA 1F4AA 2E9BA 1HJWA 1H0GA 1SR0A 2FH8A 1Q6GA 5E0FA 2EPKX 3T0AA 3ECQA 1KCKA 4HA4A 1OD8A 1J9YA 1PJ9A 4FLOA 1EOMA 1VF8A 1JI1A 3WUBA 1G94A 2BY0A 4UZUA 4AZGA 2WMHA 4UOZA 4B15A 3U7VA 3OB8A 2VURA 1CENA 4UFHA 4PBGA 2XWDA 4GKLA 2J77A 3O6AA 1WZAA 2WWDA 3WKZA 3VIJA 5JBDA 1M01A 1G0CA 1MVYA 3PHAA 3OG2A 1E3ZA 3WFLA 3VD3A 1C91A 4CUCA 5IFPA 3L2LA 1E1EA 2X09A 1UWTA 3L4ZA 1FFRA 1MYRA 3PZUA 2UY4A 1VFOA 1G9HA 3EMQA 2V3EA 2YBTA 5ABFB 5D8ZA 4RL3A 2VUYA 3BMVA 1FP8A 1H2JA 2JF7A 3N13A 2O9PA 1E1FA 1CLXA 1GJWA 3IJ7A 2D2OA 3CZJA 5ABHA 4IPNB 4AZHA 1HJUA 5M3WA 5A2CA 2XFFA 3OLGA 3VTRA 1QHZA 4AWEA 5IXEA 4F9JA 2WCAA 2V3FA 1BLIA 3GH7A 4V27A 3FHAA 2ZUVA 3VDCA 4A3YA 3W82A 1KBBA 2W4XA 1PAMA 4NZCA 1KGUA 4PUEA 5I23A 4AC1X 2W67A 3DECA 4V28A 3VX1A 5D9PA 2PB1A 4CVWA 1E0VA 3ZOAA 3ALGA 1UD2A 1V3HA 4UFLA 3WIJA 1CIUA 3JUGA 2FH6A 5CSYA 5GPRA 2FHBA 1W3LA 2J79A 3WDIA 4ATLA 4UFIA 2AMGA 2X1IA 5D4YA 1ZBKA 3MS8A 4MADA 2XVNA 3W28A 5D9NA 2VZTA 2IUZA 2W92A 2V3GA 1DWJM 2GSJA 1GUVA 1Y7VA 4CCCA 4UOQA 1TE1A 4PMOA 1LF1A 4AIEA 5A2AA 3T08A 4R27A 1EIBA 3BAYA 1KGXA 5HNNA 4CD7A 2YL8A 2VCBA 3GXIA 3K4AA 4EAMA 4PMXA 3VIOA 1DWIM 3VVGA 1CGTA 4GXPA 1E6NA 2Y2WA 1XC6A 1HKKA 1V0KA 4CD8A 3ARTA 1WDPA 1R7AA 1VEPA 2O92A 4PSRA 3T09A 1JYNA 4M82A 1CXKA 4UFKA 3NCOA 2VZOA 4OZOA 4FLSA 3MO4A 4KRTA 1HIZA 2CCRA 3AMLA 1EO7A 1GVIA 1ODUA 2AAAA 3MV01 2W66A 3VKKA 4DUWA 3DYMA 2QLYA 2D0GA 2X8RA 1PX3A 1L0PA 4WKAA 5DFAA 1V0LA 2DH2A 1W32A 5BWFA 1OM0A 1WP6A 4UR9A 1WDRA 1HL9A 4MTVA 1CPUA 1ZS2A 2V3DA 4ACYA 4GQRA 5AY7A 1B2YA 4OBSA 3EDJA 1UWRA 3K8KA 2XTKA 2QMKA 3ZT7A 1W9BM 2YDRA 3UR7A 1KXQA 2CIPA 2TAAA 2DGAA 3CHEA 2CBVA 4HPHA 5JBFA 4PTVA 2WXDM 3WN6A 4JKKA 2OWWA 4PRWA 4TTUA 2O9TA 3CBWA 1SMDA 1OWQA 1XV8A 5CGMA 1TA3B 2G8ZA 1HNYA 3WEMA 3CGTA 3L4VA 4JAWA 3GH4A 1X6NA 4MB3A 1GQKA 4EE9A 4HMEA 2QMJA 4D6GA 3RO8A 1CGUA 5AC5A 3BSGA 4JL2A 1H3GA 2OLHA 5JIWA 1JZ7A 2WANA 3WF4A 4DWSC 1CYGA 2D3NA 5M17A 1QI4A 5CGTA 2XG9A 1EHNA 1UD5A 3WH9A 4W5ZA 2Z1KA 3MUY1 3CZEA 4H8HA 2VZVA 4HU0A 4OBRA 1NWUA 1E43A 2WAGA 1GHSA 1CXEA 3UG4A 1QNSA 4MJ4A 3SUUA 3AHZA 1M03A 5AYBA 1WKYA 2NT1A 4ZXOA 2PWEA 4DM1A 2J47A 5A2BA 4MNMA 4M1RA 1EQPA 2A3EA 3B9EA 3II1A 3O2LA 4NSBA 2WMGA 1V6YA 2VCCA 2DSWA 5A1AA 1MQQA 1J01A 2CITA 5AC4A 1FHLA 3VGEA 2WMFA 3SUWA 1UA7A 1CDGA 1XSIA 2VR4A 5BRPA 2VQUA 1PZ2A 4P7LA 1JYWA 2ZUMA 1K9DA 1W3JA 2A3CA 4CVUA 1B1YA 3AS0A 1H09A 1V3KA 4U2YA 1KGWA 2BHUA 3ARUA 4J27A 2BY2A 1TVNA 3VIHA 4PUDA 4Q22A 5E9AA 4OIFA 1GQJA 2GDVA 2J8GA 2PWGA 3CZ8A 4CN4A 3IANA 2B31A 6TAAA 4ZXLA 2WSKA 4TTGA 4H8UA 2CYGA 2CKRA 4HZ6A 1WZLA 3QOMA 1GHRA 1VFUA 2UY5A 4CD4A 1GONA 2YBUA 3EMCA 5EB8A 4JZ5A 2D22A 2QHAA 3J7HA 3SCNA 3FXYA 2XSBA 5A6MA
chains in the Genus database with same CATH superfamily
5FJOA 1LORA 1Q13A 4N2YA 3VO0A 2ZXDA 4NUWA 2OKOA 4GH3A 1YADA 2IQTA 1TJ2A 3TC6A 3F4WA 3ZM8A 3E12A 1RHCA 3SQSA 4EXAA 5FKYA 5C7HA 1HJQA 3P7YA 3HFTA 4JTIA 3TAKA 3IS4A 5LA1A 3L5LA 1LP6A 1C8YA 4Z1YA 1EPVA 4MJMA 4H7VA 4ZE4A 2HRWA 1XLKA 4N0RA 1LM1A 1TQXA 2OVLA 5C55A 3NZRA 3NAVA 3S83A 3UG8A 1DL3A 3LQLA 2VC6A 4O54A 1R47A 1UOKA 1S5NA 5AYYA 5I00A 1NWTA 2VENA 2A85A 4DEFA 5JMUA 1JPDX 1V7YA 2G41A 3W7CA 3PM6A 3LDVA 3S1GA 2XIBA 4K37A 2Y8UA 1ZU8A 1F9CA 2QCNA 2NUWA 4O0ZA 1E70M 1UKPA 3CMFA 2VEGA 1TTPA 1E4NA 4FXFA 4JKLA 1YW1A 2VR2A 1J10A 1YDYA 1M6JA 4BQ2A 3L67A 1RA0A 4N9EA 5LGXA 4WSHA 3ABQA 2V6AA 3C8FA 3TN6A 3WJXA 4B5VA 3C0QA 1B3ZA 3URBA 3SRFA 1US0A 3ANUA 1RJPA 2FPTA 3RR4A 2I9EA 1EFZA 1ZB5A 4ATDA 3DFPA 3ANYA 2O9RA 4P8UA 5DF0A 3AHTA 1W8GA 3RYSA 4HKPA 4N9DA 1HO1A 3GAYA 1G4TA 1XYBA 2BVWA 3FXGA 4O14A 2JALA 3QKEA 4BKNA 4JXCA 1ZBWA 2F6UA 3CK5A 4S38A 4MY9A 3AIWA 4TXEA 1SO4A 1FWNA 1OIFA 4XZWA 1F74A 4Y2WA 1H5VA 3B8VA 3RCNA 1BGGA 5AYIA 1PZ1A 3RCYA 3QM3A 4Q4OA 3SCUA 2BTMA 1ONEA 3HN3A 3GR8A 4US5D 1E6RA 2C3ZA 5FOOA 1RY8A 3PUOA 4LV9A 3VYLA 2PD5A 2NSXA 2VO5A 5HOSA 3P5ZA 3N6JA 4G8TA 2GJLA 2V5DA 3W27A 5J5DA 4PA8A 3APTA 4AD1A 4HA0A 2YCJA 2C8NA 5EBUA 3W1LA 5I6SA 4ZB2A 1U30A 1HX0A 1UC4A 3W73A 1H7OA 4J1OA 4M29A 3VUSA 1XH1A 4TU1A 1EJTC 2VFFA 1RP8A 1XLGA 4WJXA 2X0YA 1XIFA 3V75A 4LWWA 4UTKA 3T42A 1I60A 1IWAA 1W9XA 3GAKA 4CGTA 4X9YA 1J0ZA 4GRSA 3BPWA 2DJXA 5TD4A 3AJ7A 1LOLA 1KTNA 2WZMA 5C9XA 2OEMA 4ZB0A 3T6CA 3DBNA 1E15A 3PSWA 4ATWA 4MYXA 5I77A 4AHOA 3VINA 2YBVA 2OG9A 1H11A 1JD7A 2VOTA 5C5YA 1SZNA 2FZBA 5HNRA 4WZHA 5FIPA 1EP3A 3CEUA 4LQ1A 1UR0A 2YW4A 1DJHA 4JHZA 5A6BD 1XLCA 1QDSA 3L12A 4OWGA 3ELFA 1F2JA 1RAKA 2BWGA 1A47A 1NWRA 4LNCA 4N9BA 3LPGA 2CLFA 4LT9A 3IVUA 4JTHA 3E5PA 1JRCA 4NT0A 1HF6A 2EXOA 3U3HA 4M81A 4FNQA 1GEHA 2VOMA 1ISXA 3PJUA 4L6HA 5B7YA 1VPYA 3OGRA 3PNZA 3TV8A 3L0GA 3O05A 3HQNA 1XG3A 3IARA 4FZIA 3QHOA 2BP1A 1K02A 3M6YA 1TTIA 1P1MA 1JI2A 1BF2A 3KW3A 3H53A 4MPKA 3OBEA 5E09A 3EMZA 2YCLA 3EPOA 3BW2A 2EGZA 5CSUA 4CKQA 4OT7A 2E3ZA 3RCMA 3CLMA 1C7TA 2AOSA 3FS2A 4HNVA 1XYAA 4YHEA 3UR5A 1FUYA 4HMCA 4IQLA 1W17A 1ALDA 3APYA 3BLIA 3MUIA 3QJAA 1SYTA 1F3TA 5HJLA 1BG9A 4E8DA 1CEOA 1AZ2A 3M64A 1QAPA 4HPJA 2VR5A 1NFBA 2Z4GA 1Z9AA 3BZGA 1LQAA 5GJNA 1M04A 1JZ6A 4US6A 2WC3A 1PHQA 3S5ZA 2YZ5A 3OVRA 4NASA 2BOEX 3PZIA 1DHKA 4D6IA 4NX5A 3G22A 3PZNA 2PWHA 5DLCA 5F2GA 1LDCA 3BMXA 3UT0A 4NQ1A 1I2QA 3KL3A 3IK2A 3GDTA 4ZOEA 1L6YA 4QCEA 3QN3A 1ZBCA 4WGXA 3BWWA 4UMCA 4UTFA 3E6EA 1VFFA 4M51A 3A23A 4Z2KA 3GH5A 1YE6A 4OOZA 3EOOA 2GSHA 4U31A 6XIAA 3BSMA 3UETA 4GUGA 4S3CA 2ZRVA 1SR9A 4B3KA 5FAGA 3RM4A 5E0KA 3BGGA 3LLFA 4MJZA 3A9IA 3UWVA 4DJEA 1WA3A 1EXBA 4IQJA 5AVNA 2VYOA 5DY3A 1VFLA 3NNTA 1P6CA 1T8XA 3S5SA 1XICA 3W3OA 4Z2IA 3KE0A 1KRBC 2D24A 4MY8A 5B7ZA 3RRXA 5CPSA 4AXNA 4GJ1A 2F2HA 3KWXA 4FOKA 2QKFA 2I14A 4C6FA 1Y65A 2BSLA 1XHGA 3SQLA 2QCHA 1JGIA 3LUTA 4J4KA 3IJDA 3LTSA 4EWJA 3ABSA 4LNYA 1TR1A 4FXJA 4PFHA 4U4MA 2A6LA 3MKCA 2DJLA 3QQ0A 4MB4A 1WAWA 3UWWA 2BHYA 1KCXA 3ZT5A 1FWHC 1SZEA 3L2IA 1ZJHA 1OX6A 4EF8A 3HGOA 3QR1A 3BLKA 1ESWA 4G2DA 3SY5A 3EDEA 5HXMA 2ZXBA 4GE8A 3AS3A 3GU9A 2ISSA 2DSVA 3QH2A 1HJVA 3M0LA 5BMWA 4WGHA 3P84A 1O94A 3GTFA 1OYBA 4L9YA 1Q3NA 3W29A 2BB0A 2MANA 9CGTA 4NZ5A 2GSEA 7XIMA 4IG2A 3R25A 3QLLA 4S1FA 4W85A 4NXKA 1Y5WA 3MJMA 1TUXA 3KXQA 1UIPA 4XV0A 2Y5EA 2EKCA 5DXXA 3OA3A 3T44A 4QTGA 2XIJA 3WMLA 1QJWA 3LN3A 3DFOA 4FIQA 2DV0A 4RV3A 5F1VA 3G0UA 4PB4A 4IMEA 3M0IA 4MWAC 3LHYA 5C9ZA 4D6EA 1L6SA 3QRHA 2GOUA 2PSNA 2DP3A 1D8WA 1P0BA 2IPFA 1CCWB 4KFOA 5I09A 4QQUA 3BZJA 4W7WA 1JL8A 2VJXA 2EPNA 1XP3A 1CGXA 2PDCA 5L9FA 2J13A 4TVDA 3G6MA 1WO2A 5D9OA 1D9EA 3K1GA 2WC4A 1R7OA 1UPPA 3SGGA 3QYSA 3ENLA 5CBIA 3DG3A 4XK2A 3I10A 1WAUA 1UR4A 2WVVB 3MQTA 5I5RA 3EB2A 1GKRA 2Y62A 4JNMA 4GZJA 3M0KA 3R6IA 1B5TA 4DI8A 1OT2A 3KLKA 1QU4A 4M5PA 3D46A 4ROQA 1GYMA 4LYPA 2IXVA 2ZA3A 8TIMA 1BWKA 3FY1A 4A35A 1GYLA 1DJQA 7CGTA 2GFTA 3LCHA 5BCAA 3FGCB 4L4PA 4O1EA 1XLFA 4DBSA 3C0JA 4GC3A 1EA0A 1F4HA 3GUGA 1N55A 1LL4A 1EO5A 1J8VA 4L1XA 3SSJA 2WPGA 2PLKA 4HT3A 1Q6CA 3TDFA 3NDZA 4OHQA 4L6OA 3BJTA 3PBWA 2C1IA 2OCZA 2XGIA 2P1FA 3AIBA 1RPKA 3QMTA 3MU7A 3CEPA 3IIOA 4QXIA 4MIMA 2D1ZA 4L9XA 5LXXA 2P0OA 3K46A 3AWNA 5I3GA 4AD3A 3N15A 1EJ7L 4Y6GA 1H1ZA 1BFNA 1GOQA 4QISA 1JUBA 4RPPA 4IXHA 5E5CA 4PSPA 2HK0A 3ZLFA 1IYXA 5D2XA 4EANA 3PFRA 4LJ3A 4YPJA 2D2JA 3WD3A 2NXIA 2R9RA 3BL3A 1FHVA 3UCQA 3G1HA 2WM1A 4W87A 3MYPA 4ZFMA 4F48A 1B31A 3MP5A 1QK2A 4JKMA 4QFUA 2I9UA 2XINA 3OODA 1XUUA 2ZUUA 3I3EA 3NSNA 2WJZA 1YPFA 3LU2A 4PUMA 3FAXA 3V5CA 4F0MA 4O53A 4Y8EA 5TQLA 4QITA 2J7GA 2DUAA 4JCMA 1YXDA 3W85A 1VFMA 4CD6A 1BXNA 3R10A 3NSMA 3RPTA 2ZXAA 1AW1A 2J25A 4DXKA 1K70A 4HTBA 1B3WA 1DEDA 2WLYA 2YSWA 5T9BG 3BAKA 4A4AA 3UNDA 1S3TC 5A6AA 1W5PA 5F2MA 2Y7GA 3FK4A 1R3QA 1ENUA 4XX6A 3N1AA 2UY3A 3OGVA 4DUVA 1TMHA 3SURA 4CQCA 4Y90A 3RUBL 3C86A 3UZYA 5EMMA 1ZJAA 3LNPA 2QPUA 3WQ5A 3LBOA 4ML4A 5D9MA 4QG6A 3VD9A 3MMUA 4XKYB 3DHPA 4GO9A 1EJRC 2Z24A 3JW7A 5BW6A 3F5JA 2VFIA 1VH7A 2ZX6A 5HK4A 1UBSA 2WKLA 4TX8A 5U4NA 1W9UA 4E0CA 1Q8AA 4NJHA 4AISA 1Q7MA 4XAGA 3PJWA 2PDPA 3UVAA 2WZEA 3C2RA 4IXXA 5LNSA 1QHPA 4J28A 1K7EA 3TX9A 3LGGA 2Q09A 3VNLA 2YL9A 2X2YA 1TRIA 5LIKX 3IAQA 3PZMA 4X60A 4F40A 3TOPA 2CBUA 3G1VA 3R79A 4IJRA 2WHJA 1C90A 1JQVA 4K1WA 3ZSTA 4LF2A 4PL1A 5A6BA 1X97A 4H6QA 4KWWA 4BR1A 4PUJA 1THFD 4H9MA 3LRLA 4AZ5A 1PSCA 3ITVA 1MMFA 1EZWA 3W1PA 4LF1A 1CBGA 4ICNA 2PDYA 5BXTA 2HS6A 3W7OA 2A2IA 5AECA 2WHMA 4XUYA 4H01A 5CPQA 3BANA 4R9OA 1KW1A 8RUCA 1WPCA 3U5YA 4PYSA 1Z41A 2GVGA 4GMEA 1QOXA 1IEVA 5H8MA 3WLQA 1JYXA 1MQRA 3C52A 1LG2A 3WFAA 4FA3A 3N2TA 5CJNA 2ZRXA 4KCWA 4GK8A 3AXMA 1QT1A 3T0BA 1T96A 4QEHA 3AXHA 4C5YA 3EEZA 1HXJA 1W1VA 1DIEA 2XSXA 1VQTA 2CESA 2WZIA 1I1XA 2WSRA 1KM3A 4UQDA 2Y88A 3N9KA 3B8DA 3PBUA 1TFVA 2PPGA 1A4LA 3GW0A 4A21A 4DXXA 4D6HA 3SCSA 2PDXA 5DN1A 4BCEA 4XBSA 3DFYA 4C1LA 3IV3A 5GNYA 4RZ4A 1PTAA 3IJLA 4D6FA 4FR1A 2YCKX 4DQWA 1A5AA 2ZZ4A 3T8LA 1IIHA 5CLWA 1WDQA 1FDYA 3N6HA 1G5AA 3R8HA 1XC4A 4IHCA 3TSBA 4KEUA 3VNIA 4C6IA 2QVHA 4UQAA 4D8ZA 1EQCA 2BXVA 3Q65A 2WSYA 2DZAA 2Z1SA 2X2GA 1Q6OA 3KHJA 2OYMA 1LT8A 2XJ7A 4Y96A 4DLMA 3ZJ8A 3OZMA 3TA9A 1A5KC 3VDHA 1E4IA 4CQBA 1FHDA 4JIPA 1EP2A 3G1SA 4W86A 2PLCA 2RGLA 2YDAA 4CNTA 3A3XA 3KDNA 2QUTA 2OSYA 4WDXA 2FZ9A 2IXUA 4JN8A 3VNYA 4M1BA 3C5QA 3BJFA 2TSYA 4B92A 4MNJA 2XFRA 4E4UA 4M24A 1WXYA 4HZMA 3E0IA 3GM8A 4DYJA 2HCVA 1VIWA 4DM2A 4OKDA 5DT5A 2HEJA 1JF5A 1LBLA 3BW4A 1CB2A 2X7WA 4AZBA 4ZSUA 3AOFA 3F4DA 2VFHA 3SSZA 3S2NA 1MNSA 3QTPA 3L66A 3TJLA 3ALFA 4S23A 2F6KA 3LHZA 1XYZA 1VBGA 1TMLA 4PRTA 5I24A 3SCQA 3WELA 1H63A 1FP9A 3NFUA 5FAJA 2ANUA 1LWJA 3NA8A 3ZT6A 2YA1A 2QCEA 1CXIA 2Q01A 1ITCA 1AQ0A 5LA2A 4IQEA 2XWEA 3W25A 3S8HA 2XDFA 2PI6A 1KFLA 3NQCA 3ZWSA 3IAPA 1FH7A 4Q8VA 2X0HA 2BHZA 4V15A 4C6PA 3PG9A 2DDXA 4LEFA 1AH0A 3PBYA 1BVZA 1V3JA 2QULA 1MUCA 1OFOA 1A80A 1LG1A 2GK1B 4GH1A 1F05A 3MWAA 3T4CA 4PTXA 2D20A 1HO4A 4HZ8A 1QMLA 1PUDA 4G7EB 4DPQA 3ITOA 2ZC1A 1V3LA 2GJPA 4LTSA 2PDUA 3M07A 3NQ2A 4E6MA 1H41A 3GU1A 1A5UA 1RY0A 5BOOA 4BWLC 1FH8A 3A9BA 3B4UA 3AXKA 3GTNA 2PDWA 2ZE3A 3DIPA 4Q8MA 1KBKA 2HZGA 2QDHA 4XD4A 1PE1A 2PFHA 5KINA 5KITA 4JEJA 1UWQA 1TTJA 3F2CA 1VLWA 5ECVA 1B30A 2DW7A 3VZYA 3TONA 2GJNA 1VIZA 4WDTA 3E2RA 4GIYA 5JUVA 3TA6A 4RW3A 2VEPA 5E9XA 4BFAA 1ECQA 1IEWA 4HSNA 3PZOA 3F5KA 2LLEA 1JZ8A 3CO8A 3FDKA 3WQOA 1PVNA 4Z42C 2NQLA 1K9EA 4EVZA 4C7GA 4GIEA 2PRHA 2PP0A 3ABZA 4GBUA 1CGVA 3FYOA 5GNXA 3SCTA 1M68A 1E51A 3LBMA 8A3HA 4K7YA 3OVGA 4O18A 5K3VA 3UG3A 3A3WA 3SECA 5HWMA 1VGAA 1EJXC 5IBXC 1TPWA 2E5CA 2GVLA 4M3PA 3KBVA 5FL1A 4UTJA 4KBXA 2GGIA 3CZKA 4U5KA 1GWJA 4GC4A 4QE5A 3W71A 2FDSA 4JYDA 2FMNA 3GG0A 4NX0A 3W1AA 1AL7A 2JKAA 4IGSA 1PBGA 5AC8A 4JFVA 1UR9A 1XBXA 3LPPA 1DP0A 3V5FA 4RZ5A 4AF0A 4H1ZA 4HYVA 2W63A 3W7IA 4AYGA 4HMDA 4MDPA 1JZ3A 2O9OA 1ICPA 3EGJA 3ICJA 1F6YA 3WEOA 1GQNA 4IGNA 2ZX9A 2ZRZA 4O1BA 2W6RA 3W7EA 3LCGA 1T7LA 2O7SA 3LB0A 1GW9A 4FX8A 1TWZA 1KKOA 5FEZA 1XKJA 2VFDA 4FO4A 2JEPA 1UG6A 4X0VA 4HNUA 3S9IA 3S5OA 1IGWA 4Q8NA 2IPWA 5FL0A 1SZFA 1L2UA 5HINA 1GOOA 1IT0A 2Y63A 1XRTA 1Y5XA 3QKZA 2V63A 4EKJA 3P80A 1RLDA 3U2ZA 1I2PA 2B7QA 3O7UA 1QR7A 2G0WA 1SR0A 4OECA 3W23A 1KFBA 3KBWA 1Q6GA 1OFPA 4ICMA 5E0FA 2EPKX 3T0AA 2QCCA 4D2JA 1R9ZA 1DPMA 3KTCA 1NDVA 4C1KA 3RHGA 1N8WA 3QZAA 3WUBA 1FWEC 3OB8A 2VURA 2OOGA 2XWDA 3T0TA 4UR8A 5I02A 1FWDC 5XINA 3ABOA 3VFLA 3O6AA 1WZAA 2WWDA 3WKZA 1JCXA 5G1YA 4NJJA 1MEHA 3FA5A 4LUJA 1C91A 4H9UA 3H7VA 3L2LA 3TW6A 1FFRA 3PZUA 3PC0A 4DNMA 5EMKA 4IZGA 2YBTA 5ABFB 4LVGA 2GDQA 2I56A 4R7OA 3B8IA 1HZYA 4O12A 5DELA 3EWXA 1RQHA 2O9PA 4KW2A 1LOSA 1HJUA 5A2CA 2XFFA 4K8HA 3EKLA 3VTRA 4AX7A 2ADAA 2V3FA 3GVQA 4NILA 4PH6A 3GH7A 4B90A 3KRUA 1KD0A 4CNNA 1KLZA 5I23A 4AC1X 3WJZA 5HAOA 4ZO7A 3EA3A 4C6CA 4CVWA 4I3GA 3C2EA 2OZ0A 1VCVA 5GJPA 1CIUA 1Q66A 2P50A 4HYRA 1D3GA 5HUOA 3TLQA 5D2VA 2FIQA 3LTYA 3ITLA 4UFIA 4W9TA 1OQFA 3V36A 2AMGA 1MZRA 4MADA 1H5YA 2FTYA 5BU6A 2XVNA 3KS5A 3UYCA 3W28A 5D9NA 2VZTA 5DQPA 1XRSA 3BTNA 2V3GA 5AKQA 1TJ1A 4UOQA 4AB4A 1LF1A 2QYGA 3HA1A 3T08A 1DYSA 1KGXA 2YCIX 2C16A 3GXIA 3K4AA 3UY7A 2V5BA 2A7NA 3VIOA 3HURA 5FESA 4GXPA 4YVXA 1XC6A 4QJ5B 3IV8A 1VKFA 3ARTA 1R7AA 4ZQMA 2ICSA 3GLCA 5FF3A 4OZOA 2ISFA 4LVDA 3D3FA 1HIZA 1EO7A 2ZC8A 1JCJA 3E0FA 1PIIA 4QM1A 1KFJA 3MTWA 3GD6A 3P3BA 3DYMA 2X8RA 1F8MA 5DFAA 1UWAA 3CV6A 4N4PA 3VOFA 2VUNA 4E2BA 1WP6A 3QMSA 1F8IA 3GTXA 4J2MA 1ZS2A 2J66A 2V3DA 4JTQA 4OBSA 4H83A 2R94A 3K8KA 1XW8A 2QMKA 3ZT7A 1W9BM 1IXOA 1RBAA 1E9YB 3UY8A 1BWLA 4UTWA 2CIPA 2Z2AA 4O4VA 1VLIA 1W5MA 5MHBA 4R33A 5JBFA 3WN6A 4JKKA 3MZ2A 3MB9A 1SMDA 1OWQA 1TA3B 4JTAA 3GW3A 1DJXA 4JAWA 4QAIA 1X6NA 4MB3A 5I06A 4O1AA 1CGUA 3ORWA 3BLDA 4JTEA 1WUFA 2D3NA 2ZZ5A 1EHNA 1AQFA 4K1GA 3P60A 2PCQA 2Z1KA 2V30A 2F7FA 4FHAA 2VZVA 4EWND 1RD5A 5DY2A 4XSMA 1HQTA 4O8RA 4QBXA 1GKPA 3QV7A 4OQVA 3DFSA 4L1WA 4S39A 4JPGA 3SUUA 3WLHA 3LA4A 3PB2A 4M7TA 2AGTA 4GACA 3WG6A 3W2UA 4MNMA 3A13A 2A3EA 3SB0A 3B9EA 4ALDA 4WVXA 4I6KA 2VCCA 3PTDA 3IRSA 4TR9A 5A1AA 1MQQA 4O10A 4IGMA 2OODA 2Q3RA 1TKKA 4XTIA 1UA7A 1CDGA 1XSIA 4KFPA 1ZNNA 1PZ2A 4GXMA 1ADOA 3VOGA 4A8RA 2EAWA 1QW7A 3U0HA 3F2BA 3AS0A 1H09A 2NWSA 2QJMA 3UD6A 2BHUA 2QZRA 4J27A 2BY2A 5E93A 4TV5A 4JDBA 4OIFA 5F4SA 2GDVA 1XDMA 1OCJA 3AU6A 2ZYFA 2B31A 4H8UA 1VZWA 3LXCA 4JZ5A 2D22A 2HROA 3MPGA 2XSBA 3KP1A 3LBCA 2VGFA 3V7PA 4RNIA 1XWYA 3RILA 1P48A 3FJLA 1U5HA 4BQ5A 1K6AA 2BGSA 3W07A 4B5XA 1D3HA 5HULA 9RUBA 3S5YA 3I4KA 3NQ8A 5CC6A 1O95A 3H22A 4EK7A 1JZ2A 1PCWA 2ABBA 3KLLA 1KFWA 2NV2A 3GC4A 5HQEA 3W0KA 1LJYA 2QEZA 5J8LA 1BRLB 1JZ4A 1FH9A 3RLGA 2P3ZA 1GVQA 1TX0A 2RHGA 2XIIA 1LLOA 4LY8A 3OTRA 2YLAA 4PEEA 3TE9A 2Q8XA 3DZ1A 1HJSA 4IMCA 3KTXA 2DT0A 5I03A 3WSUA 4I7VA 1T6MA 3MUCA 1XPGA 2Z7GA 3LYEA 2QQ6A 3LRKA 3RM8A 1X96A 4WKFA 3DH7A 2V2CA 1NOFA 3WDQA 1TJPA 5HMDA 4DJFA 3KBJA 1EDGA 5E6ZA 5FJRA 4PCNA 4Q8OA 2B7NA 3UWEA 4L56A 4F0LA 3KFTA 4AZCB 3POCA 3T0DA 1R3WA 1UH3A 3HV8A 4AD4A 1AMYA 4X3ZA 2A79A 2FGLA 3IJIA 4NVTA 4IMDA 3N3TA 5H6HA 4TMCA 2UZ9A 3QY8A 1ZENA 5KMYA 2YCEA 4GYPA 3T2QA 4H9XA 4KWUA 1DJGA 4MPQA 2R6OA 3G1YA 4AUBA 3T8QA 3HM7A 4NJKA 1VRXA 4NI3A 1J0IA 1UD6A 3SY8A 1I4NA 3DBPA 4KCUA 2A6NA 1EJSC 4L80A 2E6AA 2VVSA 4PCSA 2L5HA 5G1MA 3DERA 4NZ1A 1QRQA 4I8YA 1ZL1A 1KRMA 4LH8A 5IFTA 4HA3A 1W3KA 3CL8A 2OGJA 3DGBA 2PC4A 3K4WA 1TPUA 1S2TA 4F4RA 3VD4A 1DWAM 2UWFA 3WK1A 2GVJA 4OV4A 3MV11 1W3IA 4L5ZA 5EFFA 3W7JA 4WCJA 1OX5A 2GUUA 3TXZA 3CIVA 4GY0A 5IM51 2GGJA 2DEPA 1ADSA 1EH9A 2FPYA 3GXPA 1GOWA 4YL2A 3WMCA 1B57A 1XIIA 3TTEA 4Q4RA 1OK6A 4Z2JA 3COTA 2J88A 3F03K 2REQB 3MVIA 3AQUA 5C2XA 2OELA 2YR1A 3A64A 3CH0A 5F4XA 2NLYA 3CV7A 3TJXA 1MFUA 2Z2BA 2XM2A 2X41A 2OLSA 4XAFA 5AHIA 3JVAA 3BJSA 4NNCA 6A3HA 4CQ8A 1BYCA 3S6OA 4XAZA 1OYCA 5CC7A 3GDMA 1NH6A 2RDXA 1JF6A 1XCFA 3RMJA 1A0DA 1GEQA 2VVNA 3PG8A 2OGYA 1EL3A 2E7FA 4R5EA 4MYAA 2VRKA 1CGYA 2WOQA 1CXHA 1V6VA 4WKHA 1XYLA 1ZCOA 3KRSA 4JQ3A 5DBTA 3I3BA 3LD5A 3B97A 4M56A 1ISVA 3HG4A 3RIKA 4TVCA 3PJTA 1ZLPA 4IL0A 4WK9A 1DE6A 3KRBA 1UD3A 1PTDA 3WQ4A 1TCMA 4I8DA 3LRMA 2J9ZA 2E5DA 3MCOA 4J3SA 4N6EA 2YKKA 1YPXA 2HE8A 4K68A 2ZOXA 1LQ2A 3NQVA 2R1NA 4ZQRA 3L9CA 3W7MA 3FVDA 4JTRA 1OT1A 2TMDA 4L9ZA 3KL0A 4XISA 5HBFA 4LPCA 3WJSA 3SI9A 4NZJA 1EF3A 4X0NA 4P7NA 3FYPA 4AVNA 5CG0A 2PDFA 2AQVA 1TIMA 2AKZA 4PN2A 2OO6A 4WJEA 4JDYA 3ZR6A 4WOZA 1BQCA 4IIGA 2Q71A 5JIPA 2GJXB 3TTSA 2BY1A 4A29A 2J8FA 4PZVA 4QG9A 4QE1A 4FIRA 3EOSA 3FV9A 2RDWA 3LERA 2PA6A 4HU3A 1QVBA 4ZZ9A 5TNVA 4Q4MA 3SRKA 1VJZA 4JHOA 3CQKA 4UXDA 1TV7A 4MNKA 2V5JA 3CUJA 2BMBA 3KOZA 3STFA 4M6QA 1I75A 4ORIA 8XIMA 1AMKA 6ALDA 1HKJA 3S9ZA 2JFEX 3DUGA 1RPXA 1EWDA 3ABRA 4RKAA 3KVJA 4PTMA 2ZX8A 5HNUA 1H7XA 4EPDC 2DZUA 3EOUA 2BVYA 1GZ1A 4K2SA 3LCWA 3T9PA 3UW6A 3JRKA 5CZJA 1DORA 4D1IA 3EXTA 3L5MA 2ZCGA 2HISA 4X2RA 5IDIA 3VOCA 1IWPA 3TN3A 5HMFA 4UC5A 4BI5A 1NELA 1WDSA 4R3UA 4XIAA 2YIHA 1VBUA 3PTMA 4PODA 4QJ1A 3VIMA 1TX2A 1O6IA 1KBLA 3QYQA 4B9YA 3PVFA 2QT3A 1H7NA 3W1UA 2A0NA 2WV8A 3WF1A 4LYRA 1TE6A 1K3UA 2G5WA 4IIFA 3R11A 5D2TA 1E71M 3CMJA 5MKGA 1UHVA 1H62A 2H90A 3GTIA 5MF5A 1VAHA 1P0NA 1OGBA 3MO7A 4KEMA 4URIA 3P5YA 3VDGA 1QPKA 1TWIA 3ZFHA 3AIUA 3U9IA 1H61A 1OCQA 3UQNA 1JD9A 3WDRA 3APGA 1YHTA 5HPCA 4RCXA 2NQ5A 2R1LA 4TUFA 5ECUA 4MFEA 3IGSA 3AAMA 4JQAA 3ZO9A 3SM0A 4AMAA 4IUOA 4YIWA 3NGFA 1DJZA 2Y1HA 5KETA 2I7GA 1RBOB 1H4PA 1DTUA 3OZYA 2HE5A 1CX9A 3QGVA 1DQUA 4JL1A 4PBEA 3TR2A 5A5WA 4XZIA 5LSMA 3UPWA 1U5VA 1B0IA 2I1OA 2YXOA 4ECLA 2J62A 3LTPA 3ISIX 3I7SA 3MJYA 5G4WA 1QHOA 4IFOA 2UBPC 3N14A 5BRQA 4ICCX 1VRDA 4Y9MA 4HOWA 3WQWA 4IX2A 1DWHM 3T2OA 4H2CA 4W5UA 1REQA 3QOKA 1U2YA 3HU7A 3I6EA 3RJXA 4XKMA 2ALDA 4F2UA 2FB3A 2JGYA 1P6WA 3GKAA 1J0YA 1KXVA 3ERPA 5LNWA 2HVMA 5C70A 1WZKA 1PTGA 4AIBA 3T07A 5C71A 4DZ5A 3NIYA 2ZUWA 3AYVA 1R87A 1HW6A 3V18A 4P7RA 3L68A 1UZ1A 1GZGA 1XRVA 3CB3A 3GDLA 4D6CA 1W3TA 3WBEA 5BXRA 2ZZ7A 1HJXA 5CCZA 4HGXA 4GIAA 3D0CA 2J7HA 4C1NB 4UTMA 2NUXA 4IMGA 2Y8VA 3E0WA 2QW5A 1TPDA 1FVPA 1OINA 1SUXA 2XVPA 3GFZA 1R0MA 1RCOB 2GZXA 3WQEA 3N2XA 1VFHA 1L2QA 3WUEA 1FCQA 3PK7A 4WY0F 4XWUA 2CU0A 1MXSA 4Z1DA 3U4AA 3MI2A 3LHUA 5TAOA 4GY7A 4B3ZA 2EJAA 3WLJA 3W1TA 4DAFA 1VCGA 3N4AA 2ZX5A 1WDWA 3R8GA 5C0QA 3H8AA 3NPXA 1PKMA 1QBAA 3H4WA 1I9CB 1VYRA 3LLDA 3MT1A 3QZEA 1XLBA 4M6PA 2DT1A 1JDDA 2DVXA 4HCDA 3PBMA 2XVKA 4ZOBA 4XZBA 1XD0A 3U48A 4GISA 3KBSA 3QHMA 1NSJA 3TSDA 3PBGA 3T40A 1XGEA 1JPMA 4P2VA 1UYQA 4GINA 4AD0A 1MW2A 1XLIA 3OZOA 1TSIA 3RLHA 4O57A 3UERA 2BVTA 3GNPA 5EA9A 5CC3A 1EOKA 4C6JA 5LKYA 1EIXA 4BQ4A 1F5ZA 2WKGA 3W1XA 3G8RA 3OQEA 1GQIA 4KRUA 4DWSA 2XN0A 1GVEA 2AMXA 3FN9A 3DKJA 4GXWA 4HK6A 4JFSA 4D6DA 2JF6A 2OKTA 5BROA 3VIFA 3W7DA 2VX6A 2VT0A 5M03A 1V79A 3S0CA 1FRBA 4Q4KA 3TW7A 3JR2A 1RXOB 4NF7A 4B4HA 2CBIA 3WJWA 3OLIA 4FB7A 1KA9F 5AC7A 4OU1A 1V5XA 2X1TA 2ZXQA 2BVDA 3WDHA 2Z2UA 4MWAE 1V0NA 3FYYA 5CPTA 5HDRA 4NL1A 3AICA 3M0XA 1NVMA 2WSPA 4U2ZA 1UBPC 1W9VA 3N6QA 3BLFA 1KM6A 5G2HA 2BXZA 3NQFA 1M1BA 1WOBA 4QJ3B 1DJWA 3IJ9A 4E3VA 3T0CA 4QDPA 1PHWA 3CUGA 2PRLA 2VEKA 1FKXA 3W7KA 4H7CA 1NIUA 4RE2A 5EFDA 4A22A 1QI0A 4N7QA 1OGSA 5D37A 3REQA 2HS8A 1M3UA 4W84A 1O66A 3E2VA 1U33A 1KM0A 3WF3A 2BOGX 1JPKA 3HGRA 4AHPA 4BQ3A 2VZSA 3AC0A 4IQDA 1D7FA 2GUYA 3H7RA 3GG1A 4H41A 4LUYA 3K1DA 3CTTA 2QPXA 5A6SA 5CEWA 4G9PA 2CHOA 4A8IA 4MM1A 2WHKA 1XH0A 2J74A 3GVVA 4GO8A 1UP0A 3R8RA 3E5BA 4F2BA 4TX9A 1PYFA 3SIMA 4CCDA 3G2GA 1C9DA 1DJYA 5DMMA 3WFZA 4FLQA 3W2KA 1IEXA 3WLMA 2WBGA 3VCRA 2EF9A 1JAEA 3MKKA 5DRCA 4LUTB 4XAYA 2GQ3A 3VIPA 1LRNA 7PTDA 3AYTA 3O8AA 3FKRA 1X6LA 4H7ZA 2FQIA 2PD9A 2CHNA 1LL7A 1TG7A 4JTDA 3Q67A 3BMWA 2QCLA 1B9BA 1L9WA 3W88A 1UZ4A 1YQ2A 5FEWA 4HCHA 3N11A 4CQ9A 2CZFA 5FF7A 1JIBA 1TJRA 3O6DA 1A5LC 1R30A 1FWTA 1YDOA 3IEBA 1S2VA 1IXQA 2V69A 1V03A 1K8ZA 3MI3A 3EWCA 3WF2A 1OABA 2BS9A 2DORA 2FGBA 2GGHA 3W75A 1EP1A 4NIRA 3M44A 5TIMA 3EPNA 2Y7FA 3F7JA 4ML9A 2J7CA 3AXXA 2V8ZA 3VNKA 1XJBA 3A12A 3Q4DA 4XZMX 4JYFA 4ZBCA 1JXJA 4B16A 1L8NA 1DWGM 3N4EA 4E5TA 3TH6A 1LROA 1MWOA 3AMDA 2ZVRA 4QROA 3IK4A 1UASA 4UCFA 4O16A 2DSKA 3OW1A 4QAWA 2CLIA 4JICA 3MMDA 3QFWA 1XYMA 3N9RA 4R7JA 1LLZA 3M7WA 1Q6EA 3I7RA 4DI9A 4AY7A 3L4YA 4PUKA 6TIMA 3WX7A 4D8LA 4OFCA 1QW8A 3P0WA 3K8MA 2PF8A 2ZICA 1QW9A 1MEWA 2CERA 3NVTA 1R38A 4X22A 3IIPA 3RAOA 2HK1A 1YDVA 3N04A 1TWDA 3UZZA 3I3DA 2YL6A 3ITCA 3TOYA 1R2RA 4AZIA 4NAFA 3TZFA 1E56A 1B4KA 3G0SA 4OOUA 9XIAA 1KRCC 2EPMX 1WOAA 3LMYA 5BRBA 1OFBA 4UZSA 1WNOA 1QNOA 2QCGA 1KC7A 3R89A 1R86A 4I7WA 3W6MA 1A0EA 3S42A 3UGVA 1MEIA 3E49A 3LV6A 1I6NA 3KUMA 1QUMA 1S5TA 3ZR5A 3UVIA 3G8EA 3QR3A 1OIMA 4HNNA 6REQA 1MDLA 7REQB 4IWWA 2OJPA 5A6TC 3UA4A 1EJUC 4BF7A 4J9JA 1ONXA 4UMBA 4GWEA 1YEYA 4W8LA 3GYEA 3GTHA 5LHEA 3GNOA 1ONWA 4P7QA 4C6KA 3UGRA 1UPMB 1EEXA 5M2FX 5BXPA 4DO4A 1E4MM 3WO8A 3AZRA 3RXZA 1DHPA 1GOIA 2OTDA 2QF8A 2WVSA 3UJFA 2VC9A 1MNZA 1IT7A 3PZTA 4XD5A 1JVNA 2P88A 4E4FA 3BC9A 3G1FA 2WVVA 3WQPA 4J3VA 3MSGA 3AMCA 4U3AA 1CLKA 2PC8A 4K39A 4XO7A 3H26A 4LBUA 3USBA 4AFYA 1G1YA 3M1ZA 4JD4A 1NDWA 3MSYA 3GFYA 2E5BA 3UPBA 3AUOA 2FKPA 4K8GA 3BLEA 3W24A 4KQNA 4BJHA 3RK8A 3A21A 1Q85A 2YL5A 3WEZA 3NQMA 1AFSA 4HOZA 4YLWA 1IF2A 2QJNA 3R58A 3SY1A 1UW9A 4B5SA 1UH4A 4PUUA 3WLTA 3INPA 3EOEA 4S3JA 5DMYA 2ZZ2A 4JTUA 1PXGA 4W7VA 4AD5A 4P7OA 2YOCA 2PU1A 4JIRA 3UJSA 4LCRA 3EX1A 1WQ5A 1Q7ZA 1E6SM 3ZJ6A 3JU2A 4A05A 2EPOA 3UWYA 2ACQA 4GY1A 3CWHA 1J0JA 3CV1A 4GNJA 2W62A 3HJEA 1O7AA 2G97A 1SFTA 2GGGA 2C0HA 3L65A 1KV8A 4C60A 5EMJA 5FJPA 3CZGA 4REQA 4E8GA 4HB7A 4QHRA 4CCZA 4AG0A 5C6MA 4UTTC 4OVXA 4FF5A 1W1TA 2PZ0A 2E25A 4RE3A 2CLHA 3TYAA 4LVBA 2SFPA 3W38A 3TVAA 2PU0A 1YIXA 3UEQA 4EXQA 1RK5A 1OFDA 5A6KA 4F66A 2INZA 5JBEA 2A3LA 3RG6A 4DBUA 1VBHA 4HU8A 1IV8A 1E72M 4OJYA 2XYLA 2EBNA 2HSAA 1S46A 4KH2A 3CM4A 3KZPA 4NG3A 4I7UA 1BYDA 1QFEA 2PODA 1XIHA 4MFDA 1E0WA 3VCCA 1UCWA 1GZJA 1M53A 4IP5A 2GUBA 2WCSA 1NM9A 5H8UA 3P81A 1HN1A 4OBTA 1MXDA 4DJDC 4Q6XA 3WNPA 3CUIA 5L6UA 2A4AA 1AJ0A 4ZQNA 3NYZA 2QJJA 4H9VA 5CJ5A 1XLDA 4POCA 3D47A 2OZ3A 3DESA 4J35A 4UIOA 4R88A 1J5SA 1ZCCA 3H54A 5FF4A 1C8VA 2J78A 4H4IA 3WLIA 4KIRA 4V1XA 4IISA 4R85A 4RPQA 2F84A 4OUIA 3CUHA 1D2KA 3SW6A 4KT2A 1V7AA 3H4GA 4KCVA 4XZNX 3S4TA 1QCWA 3TQ0A 4IIEA 1EEPA 1LBFA 1V08A 1PIGA 3BSHA 3PFMA 5CSRA 1AD4A 1K9TA 1KM5A 4LAMA 3KOYA 1SFLA 3R0KA 2QUNA 4EXBA 2VCAA 1SMAA 4AY1A 1V6XA 2EG7A 5CAKA 3EWWA 3ZR4A 1ZSXA 1QTWA 1GYNA 3LM7A 3NO5A 1FDZA 4TX6A 4AIOA 5A3HA 2VQTA 1HVXA 2Z28A 3CH9A 1RP9A 1GJPA 3TSMA 4O28A 3UF9A 4D71A 4IIBA 3KCJA 1X39A 3DYPA 1ML1A 3IJQA 2C1HA 2QPSA 4NNAA 3SUTA 5J04A 4RDWA 5CC5A 4GI6A 3CHDA 3LV5A 2NUYA 1W56A 2OSWA 3WBWA 4YTQA 3JS3A 2FTWA 3AS1A 4GVFA 5F7UA 1BKSA 3B8TA 2VI0A 1XLJA 3PULA 1Q6DA 2E4TA 3WK2A 4B3LA 2O0TA 4A3HA 2I5QA 2A3BA 2DIEA 2Z6IA 4CN6A 5K2ZA 1PYMA 2ASHA 1JCMP 1Q63A 3W37A 2AL2A 3FNDA 1J2WA 1HL8A 3TFCA 3NQBA 1OG0A 3MDUA 4YVPA 3S2LA 4WX2A 1PIFA 2R1MA 3FJ6A 4DF1A 4FX6M 4UFJA 2QCDA 2G3MA 4NXSA 3C2YA 3S3GA 4GCAA 4RX0A 4TVUA 2E9BA 1HJWA 4LEQA 3KCOA 4PCPA 3URNA 2QR6A 3TROA 3I6RA 3OHIA 4HA4A 5BWAA 4MWAA 1ZGDA 1J9YA 1FDJA 2DZVA 3TKFA 5D04C 3TNOA 3UXIA 4YTSA 3QZ6A 4BEQA 5FJUA 4UOZA 3VKBA 3U7VA 3G5EA 4UFHA 3TR9A 3MP4A 4GKLA 3O07A 5CGQA 3HGSA 1ITUA 1Q6LA 5DANA 2D2HA 3GVRA 1OF8A 1RUSA 3H6OA 3VIJA 1M01A 2HNHA 3PHAA 3WFLA 3VD3A 3ZXWA 5IFPA 2J9YA 1E1EA 3L4ZA 4IH3A 5AZ0A 5HWJA 2UY4A 1TV3A 3AUJA 3EMQA 1G9HA 3N2CA 3NR0A 3S1WA 2V3EA 4RL3A 2ZTJA 4TO8A 1RK6A 3BMVA 3UPMA 3N13A 4ERIA 1NF0A 4OGZA 1S2WA 2D2OA 3GK0A 3NZGA 2WNNA 4UUIA 4XBJA 4AY8A 4AZHA 3OLGA 2CZEA 1XDJA 1QPRA 2E77A 5IXEA 1A5OC 1D8CA 1OFEA 1ZJIA 1JR1A 3GC5A 5TBOA 3IUDA 3KBNA 4V27A 4HSOA 3PF3A 2JK2A 3B0VC 3B05A 4A3YA 3W82A 1KBBA 4O1CA 2DY3A 1XFCA 2W67A 1QWKA 3W9ZA 3VX1A 5D9PA 1LLWA 1J96A 3ZOAA 4AVOA 4RDZA 3WBYA 3IWPA 4UFLA 3SGZA 2FHBA 1AJZA 2J79A 3VZZA 1ADDA 1IT8A 1FKWA 3WDIA 3FSTA 3NL3A 4Z0SA 1E1CB 1EX1A 1X98A 1Q65A 3NGJA 2IUZA 4CQDA 3S1VA 2NVAA 2GSJA 4CCCA 2ZRWA 3KM8A 4EIVA 4AIEA 5A2AA 3OG3A 2C91A 3QY7A 5HNNA 2YL8A 1V4YA 1X6UA 2VCBA 2QDGA 2CZDA 3TAOA 1EUAA 4EAMA 4PMXA 2X1RA 1CGTA 2Y2WA 1V0KA 2OQHA 4KRZA 4CD8A 4MY1A 3LM3A 1A50A 4UFKA 2DU2A 3QLDA 3IJ6A 4KRTA 4X61A 1ODUA 4G5DA 2AAAA 2ZBTA 1YYAA 3VKKA 1XG4A 1IEIA 2W27A 4BHYA 2WJEA 2CWNA 4WKAA 2DH2A 2RJHA 3GHTA 4GUFA 4UNLA 1OM0A 2BLEA 3HPAA 1HL9A 3CIXA 3UBPC 2CLKA 3LCXA 1EC7A 4GQRA 1B2YA 5AY7A 3TYCA 2QJIA 2XTKA 1I2RA 3EEGA 1V8EA 2D73A 2INEA 5KSWA 1JPHA 4GA8A 3ONCA 3GVGA 2DGAA 2CBVA 4HPHA 2GOKA 5G4HC 4R7WA 2WXDM 3WQFA 2O9TA 2PDKA 4UTHA 2G8ZA 1HNYA 3WYZA 2QJHA 3CGTA 4UWMA 3L4VA 3GH4A 3OQ8A 5I3IA 4LAZA 4EE9A 4HMEA 2QMJA 4D6GA 3RO8A 3GIPA 4UB9A 3BSGA 3W1QA 4HIBA 1H3GA 5JIWA 1XL9A 5HMEA 2QCMA 3FA3A 5CGTA 2XG9A 3LSCA 4W4QA 1DVJA 3QPZA 3CZEA 3GWQA 1V6TA 3S1UA 4OBRA 1ME7A 1GHSA 1CXEA 3HIJA 1AJ2A 1UR3M 1QNSA 2PP3A 3AHZA 3NXLA 3NL2A 4NJIA 4ZO6A 5AYBA 4DX3A 4F2TA 2NT1A 4KFNA 1GKQA 4DM1A 2J47A 4JTCA 4NSBA 2WMGA 2VWTA 1FWRA 1V6YA 1TV5A 3E02A 3LI0A 2FYMA 5AC4A 3TCEA 2QIIA 4FNSA 4LALA 3PPFA 3ATYA 2AQOA 2POTA 3NZPA 4RNHA 2VR4A 1BKHA 5BRPA 4DWDA 4B5NA 1K9DA 2GPTA 4I5XA 2GLKA 4ZB5A 1W31A 3EXRA 4GQBA 1B1YA 2XIOA 3ITTA 1D7KA 4KKXA 5D05A 2FZDA 1R2SA 1TVNA 4PUDA 4FP1A 5H8PA 4JX6A 1IXNA 1XYCA 2WO5A 3UXLA 6TAAA 1E0UA 2WSKA 3CPGA 3CWOX 2CKRA 3QOMA 2VD8A 1GHRA 2UY5A 3EMCA 4EF9A 2YW3A 1F61A 1T99A 2QHAA 3J7HA 2E6FA 5PTDA 3N2MA 4LCSA 1KM2A 5A6MA 3F4NA 3WLKX 4A3RA 2B81A 1Q4NX 1C92A 1XSJA 4PCFA 5IDZA 1X1OA 3W4RA 2C71A 4ES4A 2V82A 2V67A 1U83A 1UH2A 1XXXA 1EDTA 2ZWZA 2RH9A 3PANA 1OCNA 5ENLA 5JVLA 1GGOA 3VC5A 3P67A 3RMEA 3UCCA 2YFOA 2JKPA 3UWZA 4EACA 1NOWA 2P76A 2VELA 3AISA 3IJ8A 1K6WA 2R91A 4ONVA 5JH1A 1H49A 4DN1A 3TC7A 1FQ0A 3WQ8A 1XBYA 3B4YA 3TIMA 4H6RA 5T9CE 3R4IA 3L5AA 3LGEA 3BUVA 2OXNA 2GDUA 1KB3A 1UQZA 4FI4A 4GKTA 5DRIA 2JGQA 4KIEA 1YBQA 4LC8A 3ZZ1A 3GE7A 2X40A 4JOMA 4AMCA 2JIEA 2V81A 3EWBX 4S3DA 4GYFA 1AD1A 3B0PA 4JFTA 5A94A 3G6LA 3PZQA 3SEPA 3MUAA 3LZ5A 3VK5A 4LGXA 1XCWA 4HNTA 1B3OA 2DZTA 2J7EA 4PMZA 4KGJA 3URQA 2XSAA 1E3XA 1JFXA 1EBHA 1O5QA 4LUSA 1A3HA 5DX7A 3O0KA 1ECEA 3V0TA 4A3UA 4HK5A 4HHMA 3USZA 2PDLA 1A49A 4KGLA 4C6LA 3S2MA 3S5NA 1SVDA 1VBRA 1SJAA 1W9PA 4GGHA 2RDTA 3UZWA 3M5VA 1VD6A 5TF0A 1MW3A 3BG9A 2DVUA 5FD0A 5FA5A 5D09A 4AEOA 2BOFX 1VJIA 4FS9A 4GOAA 4OUEA 4JEQA 4PMJA 3WLRA 3QR0A 1IQ8A 2QIWA 6CGTA 3SIZA 3QTGA 4AWUA 3OA5A 1QO2A 1YX1A 5B80A 5LZLA 2VC7A 1I8JA 1KWKA 3AROA 1RH9A 3RPDA 1UKSA 1NJJA 3DU0A 1F07A 1QBBA 3EA1A 2IPGA 3D3AA 2YDSA 4W7UA 1UKOA 3GXDA 4RXFA 1NFGA 3GY1A 4H9ZA 4YTRA 3QC0A 2PTZA 3MHUA 4JIHA 4TQTA 3WQGA 4HHLA 4BS0A 2ZA1A 2YDQA 2Z26A 1E6QM 3C2OA 4ZOCA 1M7OA 3L4UA 5EU9A 2C1GA 3VNJA 1XQLA 1M41A 4JNZA 1OYAA 4US5A 4B5UA 1UWUA 4QQ3A 3SR7A 4ROPA 1OGGA 3VGBA 1LOQA 2Q8ZA 1EB3A 4BY3A 3CIWA 3BVJA 3EKZA 3DC0A 1US3A 3PUDA 3WL1A 3P61A 2NT0A 3E9AA 3MY9A 2XISA 3VABA 4R34A 4DRSA 3C0SA 2Y7EA 3GSMA 1AVAA 5LNVA 2EHHA 3CJPA 3ZSSA 4GCXA 4DHGA 4MF4A 1P0KA 1P0EA 2CC0A 3DXIA 3R43A 1Q6FA 4BWLA 3VNZA 2AL1A 3WK0A 1BYBA 5A8GA 2PGRA 3PTKA 5C9RA 1VPXA 4LVFA 1MXGA 2R82A 2P10A 3LLXA 1RQEA 3CT7A 4ENLA 5A8QA 1F3XA 1K1DA 2ESCA 1V6UA 2WHLA 3P14A 3H4XA 1R9YA 4K3ZA 3PN8A 1E73M 4DO5A 4P8VA 2YJQA 1AW2A 4QJ4B 1W37A 2OPJA 1TA3A 1JYVA 2OU4A 4XD6A 1BHGA 5BOEA 3W83A 1P5BA 2FGZA 2VMFA 5C7VA 3GXFA 3MYOA 3FX4A 2BFGA 3V0SA 3MKVA 1TREA 1X7FA 4XO6A 3TTOA 4H04A 3PS7A 1N2VA 1SPQA 1FCUA 4CEXC 2INFA 1P4CA 3O63A 1AA1B 2EPLX 3S1XA 3VNDA 3WL0A 3CQJA 3Q94A 4Q4PA 1UR2A 3U2CA 4LBRA 2Y7DA 4UTUA 2WB5A 3XIMA 2VFEA 3M41A 2GL5A 3B06A 4IICA 2OMAA 3V5OA 2RKXA 3H2MA 5IBXA 1DXEA 2WPBA 1FBAA 4WHBA 3UZJA 2B7OA 4H00A 3VM5A 2CLPA 4O13A 3SFKA 4MB1A 3SO7A 1WBHA 3BAIA 2X0SA 3RPMA 1A4MA 3ITXA 4LAOA 3NL6A 2HPMA 2G4JA 3LZ3A 1KFKA 3T78A 5DCBA 4Q6JA 3QQWA 1IE7C 3T4WA 2OT0A 2PGEA 3U8GA 3QMRA 2RUSA 3CO4A 3OYXA 2IS7A 3TQPA 3L23A 2PWFA 4E2VA 2BGQA 3MC5A 3NZ1A 1XPYA 3N25A 4S3FA 4FOJA 1RVKA 2WWCA 3H55A 5HQLA 3RLVA 5I78A 4U3CA 4ADUA 4GABA 1NWSA 5DMLA 3ARRA 4L4MA 3AIVA 2EG8A 5I2UA 3W53A 2X16A 3G3MA 2DQWA 3LCFA 3VKDA 2Y70A 1MUMA 4EX4A 2DIJA 4NYUA 2PDJA 2ZZ3A 4RLIA 3UP8A 3I4EA 4DJED 1SGJA 1XUZA 5XIAA 5I3DA 1O5RA 3AXIA 1YXCA 4BK9A 5GNZA 4GZEA 4GGBA 3FW6A 3BOFA 3S46A 3PWGA 1K7XA 4R9XA 1OF6A 4NRRA 1LWIA 2FZMA 3WQ6A 1HGYA 1RCXB 4XQ6A 1EGVA 2E9LA 2I5IA 3SDOA 3EX6A 1OVDA 4DYKA 3TXVA 4AZ7A 1FHUA 1VEMA 3N4FA 3O6YX 1A5SA 3VPLA 1R8LA 1JJKA 4JIEA 3DCPA 2Z7KA 4AWTA 1WV2A 4HHPA 3B03A 1S2AA 1EDQA 2A1YA 3FFSA 3OLEA 3OU8A 3T2PA 5GVJA 3UR2A 3E74A 3DHUA 2G3IA 1FWCC 3ITGA 1TZ7A 3W7RA 2Q02A 5I79A 3DKLA 3DN5A 3VD5A 1RR2A 2A3HA 3CASA 4LRSA 4HPGA 3KS6A 1WCGA 4KS0A 4PBFA 1UC5A 3W72A 4DUXA 2PZNA 5AZ1A 3LHTA 2VP8A 1ISYA 2VDHA 3H2NA 3B9OA 4FXSA 2A3AA 3MBFA 1W5OA 2XZ9A 1L6FA 6PTDA 3C2VA 4AZCA 4YYCA 2NZLA 1ZBVA 3GDKA 1M7XA 5A69A 2Z0IA 3GNXA 4JY9A 1GVSA 1PX4A 3CAKA 2Z1VA 4QDMA 3MCNA 3A47A 4JGDA 4PE8A 3SFWA 4GNKB 4XZ9A 4GD0A 4IL2A 1TPFA 4U33A 2VC5A 4I6VA 3CT2A 3RNDA 4IJCA 4W89A 3IVSA 5REQB 4AVFA 3ES8A 2PTWA 1DQXA 4C65A 3VMOA 1PV8A 3THAA 5FJJA 4JIQA 2OO0A 1PEZA 3ARYA 2C19A 4CU8A 1OEPA 4WR3A 1ZAHA 2D69A 1OC5A 1R5YA 4HPNA 3GZ3A 1R85A 1ISWA 3B9NA 3CXOA 3VGDA 4GI9A 2CETA 4DB7A 5LIXX 4E4PA 1CXFA 3M7SA 1YE4A 3BGAA 4PRRA 5A95A 2VNCA 5KTLA 2OZTA 3T1GA 4D8AA 3H2FA 4G1KA 4MLJA 2IW0A 2ABAA 4PTDA 3DX5A 4FOUA 4MDOA 3TJIA 4O17A 1BTMA 3HV9A 1CT5A 4BA0A 2R8WA 2Q8LA 1OFQA 3S6DA 4FNRA 1R3VA 2OYKA 2W0UA 2OWXA 2VFGA 3F5LA 2PWVA 2HJPA 2TPSA 5AOUA 5HR7A 4ACZA 3VC6A 1HG3A 2JQXA 5ABGA 1J6PA 1UD4A 2H9AA 3MCMA 1PZ3A 3HMCA 4HP5A 4GQ0A 2CHRA 4LXFA 4WRHA 5MKGB 4MKSA 1ZAJA 4PMVA 1D3CA 2Z29A 4F79A 3H7UA 3ARVA 1A5CA 4L7ZA 2Y8KA 4B5TA 3M16A 4WD0A 2PUZA 1OY0A 3NPVA 1K9FA 1X1ZA 1M65A 3V0UA 1CECA 2REQA 3LCIA 4HN8A 4GX8A 2CEQA 3URAA 3TP4A 3TMQA 3CYVA 1MW1A 2IKIA 1J0HA 1HP4A 3KX6A 1KQZA 3HG5A 3RDKA 3BOLA 1J2BA 5JQ9A 3TEVA 4JY8A 4KWSA 1POKA 5FSDC 2ZX7A 5JU6A 3POHA 4BF5A 4C6DA 4ZVJA 3HO8A 3WD0A 3QV6A 1VCFA 2DZSA 1X8FA 3UWUA 5CPOA 4U28A 4D6JA 1W1IE 5AHLA 5T26A 1RALA 2CZ5A 3UYIA 5FF2A 1GVFA 4ZCWA 1Z69A 2ACSA 3M46A 3OO2A 3U6WA 2W91A 1FWGC 2HWGA 3IGUA 5CZSA 4DY1A 3L7RA 4WOQA 2HNEA 1WYIA 2DSZA 3TC3A 3BV7A 3UR8A 3WBAA 2WYSA 3UZXA 4MZ1A 1OD0A 5FCZA 5I3JA 5H91A 4P61A 1R3RA 2YB4A 3THUA 5LNUA 1REQB 2DQXA 1JFHA 3GU2A 4D1JA 1MZHA 2I5GA 4M8UA 4I9JA 3TQKA 2FMOA 4WDUA 4HA1A 1RJQA 5AC6A 1TELA 1B54A 1N82A 5HJYA 1XINA 1G01A 3CV2A 1WZMA 1CTNA 3IUHA 4HNOA 3GBEA 4CN1A 3W81A 3A4XA 2F8QA 2GGEA 3VKAA 3G0XA 2GJXA 3AFBA 1GJUA 4QNWA 4V2XA 1HVQA 4GUIA 1ZY9A 1O4UA 3DHDA 2FVLA 5D30A 4MAVA 1P7TB 5HATA 3OBAA 1UKTA 5LHFA 4IP4A 3HB9A 4U5IA 3S2JA 5ABTA 1JEZA 3GYCA 1J12A 3OYZA 1SJBA 1V0MA 2WK2A 3FAWA 3EOLA 4PMYA 3SN0A 1PO9A 1ZUAX 3W01A 2W79A 1WB0A 3G1DA 2ZDSA 1I1WA 4FLRA 5AFDA 3KHDA 2QNEA 3C56A 3GHRA 4N6FA 4WQ6A 1NQKA 3PZ9A 1K4GA 1GTEA 3S2CA 4LANA 2C6QA 4MOZA 3QFEA 4UBPC 1XIJA 1W1PA 5E70A 1W3NA 4JTGA 1PPIA 1FFQA 3KOFA 1SFJA 1QWGA 3WLPA 1M5WA 4Q32A 3Q45A 2PDNA 4ZSTA 1QOQA 4UFMA 6XIMA 1TV2A 2WZHA 1R9XA 4IM4A 1EXPA 3E96A 4MGGA 1JUKA 3DDMA 2WC7A 4KF1A 4F9DA 1J0KA 1EC9A 4FALA 1PX8A 2PLJA 2PGFA 3A5VA 1V77A 1VYPX 4S2CA 5EL1A 3RN6A 3TW9A 2D0HA 2P8BA 4FNTA 4DO6A 5I0DA 3KZSA 2W5FA 1CNVA 2VRQA 2CLMA 4AU0A 1OHLA 4F0RA 3SGUA 4Q7IA 1QK0A 1HKVA 4DWSB 1PWLA 4HD5A 1TRDA 2NX1A 3B04A 2XM1A 2QUVA 2X05A 5DO8A 4B9ZA 1LYXA 3A4WA 1KBJA 3UESA 1UR1A 2R1PA 3JZEA 5LXEA 2XFYA 3AI0A 3QXBA 3WD2A 3VGGA 4NAEA 4C5ZA 3G1RA 2CW6A 2NX3A 3DFHA 1EGMA 2G3JA 2G4FA 4JIIX 4JQ2A 1DJIA 3M5XA 2FJUB 1SJDA 4RK8A 3H23A 5HWNA 3PBVA 4HNLA 4L64A 3MI6A 1XH2A 2VXNA 3EDFA 4RJEA 3SCVA 3LK6A 1X38A 2EQDA 3ARWA 4N42A 3DFTA 1EC8A 4K6AA 1I45A 1TZ9A 1IZKA 2QGYA 2WMIB 3BG5A 3KAOA 2G96A 1QOPA 3VX0A 3QGKC 3GUWA 1FWAC 2CWXA 3WJYA 4LC6A 1CWYA 1LBMA 2QAFA 1MUWA 4MNLA 1BG4A 1AH3A 3KTSA 1XI3A 2H3DA 3N34A 1C8QA 1GTHA 2D3LA 2Z1BA 3NVDA 3H2OA 3REQB 1G4EA 2QS8A 3T7VA 3M4HA 3WBXA 1N8IA 5JH2A 4F8XA 2YXGA 4FF7A 3FJNA 1ZP3A 4FPSA 4H19A 1OJXA 3DG6A 5I07A 4QLKA