1I1XA

1.11 a atomic resolution structure of a thermostable xylanase from thermoascus aurantiacus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
302
structure length
302
Chain Sequence
EAAQSVDQLIKARGKVYFGVATDQNRLTTGKNAAIIQANFGQVTPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIRGHTLVWHSQLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVNEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYINDYNLDSASYPKTQAIVNRVKKWRAAGVPIDGIGSQTHLSAGQGASVLQALPLLASAGTPEVAITELDVAGASSTDYVNVVNACLNVSSCVGITVWGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Thermostable xylanase from Thermoascus aurantiacus at ultrahigh resolution (0.89 A) at 100 K and atomic resolution (1.11 A) at 293 K refined anisotropically to small-molecule accuracy.
pubmed doi rcsb
molecule tags Hydrolase
total genus 120
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1i1xA00
3CZGA 4J3SA 1FH8A 1LWJA 2V38A 4B15A 3IJ9A 1JI2A 3ARZA 3CH9A 3QOKA 1G5AA 2YLAA 3WF4A 4V2XA 2WVTA 5BXRA 1VBRA 1JAKA 2CYGA 2DT1A 2QLYA 1JZ7A 3EDEA 2X0YA 1JGIA 1M01A 1C92A 1KFWA 3WDJA 4AYSA 3IJ7A 2AAAA 4LQ1A 1BLIA 3QOMA 4JFSA 3BCFA 1V0NA 2YL5A 3PBGA 3FNDA 1JZ6A 1B3VA 5LA0A 1HJQA 4X0VA 2UY3A 5I79A 2RGMA 1IV8A 4H8VA 4NI3A 2ESCA 2WC3A 1HNYA 2ZX8A 3SCUA 2E4TA 1JD7A 2VX5A 3EDFA 5D8WA 4CVWA 1CLXA 4L4PA 1XGZA 1XV8A 1E6RA 2W61A 4QLKA 4LPCA 5C70A 1UD8A 2XUCA 1E4IA 5ABFA 2BVYA 3WF2A 3PZGA 2XIBA 4P8VA 3BSHA 1BAGA 3UETA 3POHA 1QI3A 5HPCA 2DEPA 3J7HA 5M03A 4UFLA 5FKYA 1UR0A 1QNRA 2WLYA 1PIFA 4FLSA 3W24A 3EMQA 5C8BB 3CZEA 4JFWA 1BYCA 4MDOA 1E70M 1OGBA 1EQCA 2D2OA 2FHFA 1XH2A 1SMDA 1QBBA 3DYMA 4JCMA 1JNDA 2G8ZA 3AIWA 4YHEA 1V02E 5ABFB 1UZ1A 2CBUA 2WHJA 4MPKA 4AZ7A 4OZOA 3A6OA 1J01A 1ZJBA 4NZCA 1XC6A 5GPRA 4TVCA 1B3YA 1K6AA 3W29A 3SCWA 3WIJA 1MQRA 3DC0A 1G94A 1HN1A 4AD3A 4EK7A 1B31A 3AIUA 2XWDA 1BSIA 2WXDM 2XSAA 4LXFA 1VENA 3MUAA 2QHAA 1JNEA 2AOSA 4U2YA 4IM4A 1R86A 3L2MA 1KXQA 3F4VA 5GQBA 4AD2A 1D3CA 3AHXA 1W1TA 2DGAA 4CCDA 5I5RA 3GYCA 4IUGA 3ALFA 5A8QA 3SCNA 3QHNA 3DYOA 5LA2A 1XHGA 1FOBA 3K4DA 3W6LA 3WNMA 3EMZA 4A3YA 4NSBA 4HMEA 3OB8A 3KL3A 1GQJA 4P8XA 4YPJA 2CHOA 2VQUA 1KCLA 1HVXA 4FMVA 5BXTA 3PHAA 2A3HA 3VILA 2BVDA 3N15A 3N18A 3SCVA 4TVUA 4CKQA 5HBFA 5EFDA 3W37A 2O92A 3NDZA 1WO2A 1LG1A 2XFRA 5CPQA 1HJUA 2W4XA 4PMUA 2VT0A 1VEMA 3G6LA 1XCXA 2WMGA 4E8CA 2PB1A 2Z1SA 2J8GA 3SURA 2ZOXA 3WY1A 1ZBVA 4GKLA 4M80A 3VD3A 2CNCA 2DSVA 2XJ7A 2XM1A 3L4UA 4WIWA 2CPUA 4MB5A 1LJYA 4X9YA 4CD7A 1UWQA 4U31A 5DO8A 3TA9A 4D6HA 4ZXOA 2Q8XA 2ZWYA 1V3MA 4B9YA 4ZFMA 2WVUA 2F8QA 4W8LA 2CKRA 4IPNB 3CZKA 3MO4A 3TOPA 3RDKA 1JYVA 3CIVA 3UERA 2VOTA 4TX8A 2J25A 3VIPA 1W32A 1OD8A 4EKJA 1QOXA 5A2AA 2VZTA 1QW8A 3VGHA 3WENA 2VTFA 3HU7A 5DT5A 2ZUUA 4HOZA 1E5NA 1B3ZA 4W87A 1GUVA 1WKYA 3PZOA 1GOMA 2YIHA 2GDUA 5EBAA 3AXIA 1X6LA 3CUJA 5A8PA 4H8UA 1OGSA 2Y8VA 1EDQA 2WANA 2D0HA 4D6FA 2XM2A 1QI0A 4GXPA 4AZCA 1O6IA 1CGUA 4J3TA 3A4WA 5E09A 3W82A 1HJWA 2D0FA 3NSXA 2PWFA 4HU8A 2CBVA 3VVGA 1B3XA 2QPUA 4B9ZA 1JIBA 5A2BA 3GNPA 3MV11 1RP9A 3CGTA 4URIA 1E55A 2NW0A 3W0KA 2DH2A 5HDRA 3L4VA 4B16A 1HKIA 3WQWA 1ITXA 5A1AA 2VMFA 5E9AA 3WEZA 5I6SA 2YLLA 4JCLA 2OYKA 1MQQA 2GUYA 5CSYA 4CU8A 4DUVA 2YBUA 1DWGM 1DEDA 4AZCB 2VX6A 1J0KA 4MAZA 1GOIA 3AJ7A 3OLIA 2WC7A 1W2VA 2G3NA 1UD4A 1WZMA 2JF7A 1E6NA 3ZMRA 4W5ZA 2G3JA 4UR9A 5D9OA 4PMNA 1V08A 2WMFA 1VF8A 4LYRA 4HU0A 1SFSA 5HNNA 4PMQA 3MUY1 3N1AA 4DWSD 1U2YA 1KCKA 4S3KA 3AZRA 4Q22A 1H4PA 4AZ6A 1KWGA 2WVVA 1FA2A 1E0VA 1PX8A 5LA1A 4P8WA 2ZUWA 3UR8A 2E0PA 2W63A 3II1A 4PMZA 1G01A 1TVPA 1IZKA 3ZJ7A 1ISZA 2BXYA 3RJYA 3VGDA 4UNIA 2D24A 2Y2WA 2GFTA 3OG2A 4TUFA 3FXYA 4LX4A 4BF7A 3K8LA 1X1NA 4AIOA 4JL1A 4BQ5A 4AD0A 4JKKA 1K9FA 3WBAA 1YQ2A 1TE1A 2FGLA 5JUVA 1D2KA 4UFHA 3K8KA 1CXLA 3AXXA 4WKFA 1J18A 1QNPA 4P7NA 3WQ6A 3WMSA 3O9NA 4U2ZA 3GXFA 1H11A 2XFFA 5E70A 5BRQA 1UKQA 3UG4A 4UOJA 3VINA 2WK2A 4KH2A 5D9PA 3K4AA 3OIHA 3GDBA 1P6WA 1E6XM 4W89A 1U30A 1UD6A 2WMHA 1US2A 1QHZA 3UESA 2V3FA 3AXHA 4AZHA 1EA9C 2BS9A 1HF6A 3L4TA 3WH5A 2MANA 4R27A 1WCGA 5DMYA 3WH7A 3W81A 1WE5A 3BH4A 2WCAA 3AS2A 5DFAA 2PWDA 1VFUA 3VIOA 1WDPA 2EPOA 3N17A 5I24A 1JYXA 1FFQA 3N12A 1JF6A 1KGXA 4PSPA 5A95A 4GZEA 2NT0A 1ISXA 5EMYA 4ZXLA 1XCWA 3CUIA 3N9KA 2ZX7A 5IFPA 1CWYA 4W84A 1KWKA 4A3HA 2EQDA 1VJSA 1OD0A 3VD4A 4UFMA 1C7SA 1GZJA 1UZ4A 1CGYA 3CMGA 2JEQA 3NIYA 2OSYA 3JUGA 1NM9A 4BQ3A 3B8SA 3NJ3A 1GW1A 2E9BA 1VEPA 2ZWZA 3PZNA 3AIBA 1VFMA 3A4AA 4OUEA 2AMGA 4RL3A 4UQEA 5JBDA 1UD5A 3LPGA 1XSIA 2WWCA 1K9EA 1C8YA 2VO5A 1JZ3A 4D6IA 1WZAA 5M5DA 1V0KA 4GQRA 4KGLA 4TTUA 1LLOA 6CGTA 5A94A 5BYWA 3DHUA 1PZ2A 4MAVA 3GM8A 3GBEA 3F5JA 1WP6A 3GXMA 1EO5A 3AMCA 1UWRA 3VIMA 4MB4A 4BZYA 1GVYA 4PBGA 1VFFA 1V6WA 3WNOA 1KQYA 1LG2A 4WKAA 4GZIA 4M8UA 4FK9A 5ABGA 1MW2A 1C8QA 2DIEA 3AIQA 1BG9A 1W9PA 3AMDA 3VMOA 4B3LA 2QF8A 3VIIA 1V3LA 2PWHA 1UKSA 3ZR5A 1RPKA 2C0HA 4ZENA 3ZJ6A 3MS8A 1OCQA 4HOXA 1GPFA 3GXIA 4AZIA 1LL4A 4PTMA 1CBGA 1KXVA 5A6SA 1GORA 1CGXA 3ZT6A 1CIUA 1E72M 2ZICA 2YA2A 3B9AA 2HVMA 1V6YA 2VJXA 3AMKA 1R7OA 2EEXA 2YDSA 4PMVA 1MWOA 3D5HA 1VB9A 4L4OA 3CHFA 2G41A 3CLWA 3ARWA 3N04A 1HJVA 1E6PA 1H09A 3QHMA 1XSJA 3M7SA 4UQAA 1MW0A 3UEQA 3WL1A 3PZTA 2BY3A 1CDGA 2WBKA 4GPNA 5KEZA 3BLKA 4FLQA 3WQ8A 2IXUA 4B3KA 2XGBA 5M17A 5E6YA 3LPOA 4S3JA 4AY1A 4BS0A 2CBIA 3HMCA 1E4NA 1W91A 3T2OA 2ZXDA 1B0IA 1JAEA 4BQ2A 4FLOA 1KBBA 2RGLA 3ZR6A 1JDDA 1HL9A 4DM1A 1Q6EA 4J28A 2Y8KA 5CGTA 1F4AA 1CGVA 1XH1A 3VTRA 2ZIDA 4TTGA 1XSKA 3CZ8A 4PMOA 1CECA 2JIEA 1ISWA 1M04A 2X2YA 2X0HA 2W62A 1KXTA 1E4LA 1VAHA 1W9XA 3WFZA 2VCCA 2VVNA 4PRWA 3WNPA 3VOCA 1QVBA 4DWSA 3L4ZA 5D9MA 3T09A 4W88A 4WK9A 3WN6A 3EDKA 1QNOA 4J3WA 2VVSA 4YHGA 2ZUTA 2F2HA 3WF1A 1GJWA 2VURA 2J78A 2CBJA 3DECA 1H0IA 2XYLA 1RP8A 1IT0A 2ZXAA 1LF1A 3TP4A 4MADA 3MMUA 3SUSA 1MFVA 4AXNA 1AQHA 3CUGA 4V27A 4D72A 4XB3A 2ZUVA 4F8XA 1CGWA 3AMLA 3WQ4A 2V5DA 2JIWA 3A47A 3I3DA 1MQPA 3AIVA 4FLRA 2BHUA 2DSKA 3ZSSA 4HPHA 4F66A 3AIRA 2WC4A 4DWSB 1CLVA 4GI6A 3EDJA 3SEPA 1RD6A 2X1IA 4MDPA 1ITCA 3VGGA 3QHOA 3ZQ9A 3AFBA 4W7VA 4LYQA 4Q7NA 4GIAA 4D1JA 3SCOA 1D7FA 2DSWA 1KR1A 4GZJA 8A3HA 3FAWA 2EXOA 2QV4A 1HL8A 5A6JA 1WDQA 3GTNA 3WNNA 2EPNA 2XGIA 3SCSA 5HPOA 4HOWA 1ZS2A 3T2QA 4PCTA 3WBEA 4PUEA 1XD1A 4DM2A 5M3WA 1E6ZA 2WB5A 4AEFA 2C7FA 1UD3A 2WMKA 1WZLA 1BVNP 1MFUA 3E1F1 4UQ9A 1JDCA 2EPLX 3AROA 4PMDA 1JF5A 3O2LA 1V0MA 3IJ8A 2J7CA 2ZX9A 1CNVA 1VIWA 2VRJA 3VDHA 3U7VA 4WLCA 2WZHA 2BY2A 4HZ8A 7TAAA 4HMCA 2EO7A 3L4XA 2DSZA 2VNCA 3ZJ8A 1UWTA 1EIBA 1FFRA 2UY5A 4ML4A 4KRUA 4CD4A 4CD5A 4EAMA 4JHZA 2WYSA 3VPLA 2D3LA 2JE8A 3EDDA 2XPKA 3WUEA 3PTMA 3TTQA 3I3EA 1MVYA 4AD1A 1S46A 1NP2A 3LPFA 3W27A 3K46A 4PCSA 3ZJKA 1PEZA 2DT3A 2GJPA 3ZOAA 4DUWA 3PZIA 1J12A 3OGRA 2OSXA 2BHYA 1E56A 4F9DA 2D20A 1H1NA 3N13A 5AY7A 1HXJA 1FP8A 5CXPA 2E9MA 2YJQA 5FIPA 2J4GA 4W8BA 3SCPA 1US3A 1O7AA 1BQCA 1CEOA 5EFFA 1JD9A 3BXWA 1Q6CA 2D0GA 4CN6A 1UKTA 1W1YA 2CESA 3T0DA 4ZE5A 2WZIA 2VCBA 1ODUA 3NUKA 3G6MA 3QGVA 4PSRA 1C8XA 4HZ7A 3FAXA 3WD3A 2PWEA 1EHAA 1GOWA 1DWIM 3ARQA 3NYDA 3RCNA 1N82A 2QPSA 3CUFA 1UYQA 3VD5A 3AZTA 3OLDA 5A8NA 1C7TA 4PN2A 3U7BA 2NSXA 3WEMA 2EJ1A 4PYSA 3CZJA 3AMGA 1HX0A 4HPGA 4J27A 1H2JA 5CPTA 3WH8A 4JFTA 3PN8A 2OWXA 1GHRA 4QAWA 2XHYA 1OGGA 1NP0A 2YDRA 3FY1A 2FGZA 2WMIA 1UR2A 3OZPA 1C3FA 3WSUA 4Z2LA 4AISA 2VRQA 2XVPA 1UD2A 4QP0A 4CUCA 2G4FA 1PIGA 3MANA 2X05A 3MMWA 1EDTA 5E0FA 2WHKA 3NDYA 1QI5A 4GO8A 2GK1A 4OOUA 3NCOA 5DF0A 2WBGA 5ABHA 1NOFA 2XFYA 3PTKA 4Y7EA 5I0DA 2YKKA 3TTYA 4JZ5A 1G9HA 4W85A 1K9TA 3AHZA 3ZT5A 1MW3A 2FDMA 3UG3A 4C7DA 2CKSA 1ECEA 1J0JA 2WWDA 1EXPA 1OB0A 4UFIA 2J8FA 2WMIB 5D4YA 1EOKA 3VD9A 4QCEA 4D6GA 3O6AA 1F4HA 2PBOA 3TTOA 4R5EA 4BA0A 3RM8A 1SR0A 3S2CA 2OLHA 1W9BM 3RIKA 5A8MA 4NF7A 2WKLA 2VQTA 1CPUA 5AYIA 2GSJA 1LL7A 3T08A 4AZBA 2DT0A 3OGSA 2E8YA 5KZ6A 1BGGA 1GQKA 1FH7A 3PTQA 2XVLA 2JFEX 2F61A 1HP4A 3ZT7A 5IDIA 4AMCA 1W9UA 4CVUA 1OWQA 4AZGA 2B31A 1I1WA 4UQDA 3WDQA 1Q6DA 3CUHA 4UQCA 4C7GA 4W5UA 3FN9A 2YA0A 2V3GA 2WVVB 1H0GA 2YDQA 2WLZA 1SMAA 1XRVA 2D1ZA 2ZUSA 3VIGA 2YBTA 3OBAA 2XG9A 2BFGA 1J0YA 2PI6A 1V3JA 5C71A 2OYMA 1HKJA 1FH9A 3HN3A 4P7OA 4ZEPA 2D3NA 3BAJA 4PMXA 1TFVA 2OSWA 1NQ6A 3PZQA 1QNSA 3AYRA 3A3HA 3PZ9A 1TA3A 2XVGA 3DHPA 4GI8A 3BAWA 1BYDA 1KGWA 3OLEA 3VM7A 3ZSTA 1V02A 1AMYA 1ZJAA 1UKOA 3AS3A 1NWUA 1PX4A 3MSDA 3U5YA 2Y4SA 4XZWA 4AZ5A 2XIIA 1W3HA 3B9EA 5JBEA 4K68A 2WKGA 4IISA 4YN5A 2Z1KA 1Y7VA 3VKKA 1AVAA 4QDMA 1NARA 3VO0A 7A3HA 4P7QA 1JFHA 3B9DA 1A3HA 1TR1A 3CHCA 3MUZ1 1B2YA 3APGA 3EYPA 3BAIA 3WUBA 4X0NA 2BY0A 1Z32X 3WELA 1DWFM 3VIKA 3VDAA 3VNYA 4KMQA 2ZUMA 1W3LA 1E0XA 4J3UA 3TTSA 3UCQA 5F7UA 4ATWA 3GH7A 4BQ4A 3WF0A 4W8AA 2YL8A 5A3HA 1W9DM 2A3EA 2V3EA 5TD4A 3QR3A 3AS1A 5A6MA 4JAWA 4LYPA 5GNXA 3RMEA 1FHDA 1UWIA 3VU2A 4D71A 1BPLB 1BGAA 4CU6A 1BG4A 1BYBA 4H04A 4M56A 1NOUA 5CQ1A 3KZSA 2G3IA 5IXEA 1KXHA 4AIUA 5BCAA 3VUPA 2VR4A 3EMCA 2OWCA 3RM9A 3VIHA 2WSPA 4D6JA 1JXJA 1TZ7A 5JIPA 4D6EA 4QFUA 1CTNA 3AQUA 1CXHA 4OKDA 3ARYA 1W2PA 1UHVA 3TONA 1J0ZA 3GNRA 3L2LA 3T0AA 2V3DA 4UFKA 1UA3A 5CJ5A 2GVYA 3CO4A 3PZMA 3FHAA 4PTVA 1V6XA 4M29A 1OM0A 5CSUA 4U33A 1KGUA 1AQMA 2D23A 1XYZA 3CZLA 1B1YA 2CITA 5BXPA 4FF5A 2VR5A 5CGMA 2VL4A 5D9NA 3T2PA 1E4MM 1U33A 3AICA 4M1RA 4NRSA 2BV9A 3D3AA 1R7AA 2WZEA 4W93A 5A69A 3HJEA 4AD4A 4V28A 3VIFA 1DWAM 1TG7A 5CZKA 1QPKA 3L4WA 3VGFA 4D1IA 2O9RA 3W28A 1BHGA 4RE4A 5BXSA 1FP9A 2J7GA 3WQ5A 3VIJA 3GXDA 1E3ZA 1UKPA 2J74A 1HJSA 2FHBA 4TOQA 5I77A 1B30A 1QNQA 4HTYA 5E0CA 1LL6A 1BYAA 4ACZA 1UH3A 3AHTA 2CIPA 4XZBA 1TUXA 1UH2A 5AC5A 1ISVA 2J7EA 4JFUA 3RM4A 1CXEA 1GVIA 3SCRA 2OWWA 3F5KA 3VMNA 2DSUA 4QCFA 2XWEA 2WAGA 1E9LA 3VGEA 2E3ZA 4AC1X 4DUXA 3WUFA 1M03A 1PZ3A 1B3WA 4W7WA 5FCZA 1JZ8A 1UA7A 3BMVA 4PTWA 3RJXA 3W25A 3GNOA 1VEOA 3GBDA 4H7VA 3ZIZA 4U5KA 5GNZA 3ARRA 3MU7A 2CEQA 2VZOA 4GI9A 4ACZB 2WM0A 4UZUA 1QBAA 2J7FA 3SUTA 3RO8A 4PEEA 2W66A 3WDIA 2O9OA 4OJYA 4UCFA 5JIWA 3L4YA 1KB3A 3VD7A 2W67A 4KGJA 1OT2A 3OLGA 1ZB5A 1H3GA 1C91A 1W3KA 2YA1A 5A6KA 1EH9A 4RE2A 3PZUA 2E40A 4UOZA 1E3XA 3WD2A 3IK2A 2VRKA 3K8MA 3PZVA 1CENA 1JXKA 3WD1A 5CG0A 3ARPA 4CN4A 1Q4NX 1GNXA 2VZVA 4AW7A 5I3DA 1C90A 1CXFA 2OYLA 2WHMA 4P7RA 2GJXA 3VM5A 4JIEA 1DTUA 5CLTA 1M7XA 5JBFA 3NSMA 1WDSA 3ZM8A 3U57A 4U3AA 3WD0A 4XX6A 1NWSA 2A3CA 3KL0A 2G3MA 1V6UA 1L0PA 1EDGA 1B9ZA 1FHLA 2WNWA 2WCSA 3EBVA 1DP0A 3CTTA 4JL2A 1R8LA 1UH4A 4W7UA 4F9JA 4TX6A 3WF3A 1UQZA 5IHRA 2V5CA 1J9YA 1QHPA 5BROA 3VX0A 2VUYA 4Z2IA 2FH8A 2Y24A 3IANA 1H5VA 2ZE0A 5GNYA 1OBAA 1JI1A 1DWHM 4Z2HA 1OIMA 4PTXA 1GOKA 2GJXB 4LGXA 4HMDA 2DDXA 3A4XA 6TAAA 1WB0A 1NWTA 5I78A 1VRXA 1SYTA 1BTCA 4EANA 1H49A 1GQLA 3AYSA 1ZBCA 1GQIA 3VDCA 2WW5A 2VX4A 1JZ2A 2J62A 1OIFA 2YL6A 3AS0A 4CCEA 1QHOA 1IZJA 3VNZA 2IUZA 2PC8A 5A2CA 1EO7A 3KE0A 4CCCA 2EBNA 1JG9A 1UR4A 2CETA 2WVSA 1CXKA 2VC9A 1ZBKA 3WUGA 2DQXA 2J75A 3SUWA 2WPGA 2VI0A 1V3KA 7CGTA 3GZAA 1WPCA 1E6SM 4HA3A 4EE9A 3W38A 2DT2A 1VBUA 1MYRA 3BSGA 2ZXBA 4PMRA 1Q6GA 3M46A 3THDA 1V6VA 5A6BA 4ACYA 3W26A 4MNLA 9CGTA 2X8RA 5BWFA 2D22A 3WH6A 1UWSA 2BY1A 4GINA 1JZ5A 1CGTA 2YOCA 1JFXA 3NSNA 4M82A 4E8DA 3F5LA 4ATLA 1E6QM 5DT7A 3OA5A 4Z2KA 3KL5A 2W5FA 2J77A 3THCA 4D6CA 3SCQA 3VGBA 1BF2A 3WQVA 2PF0A 3T0BA 4ATDA 1W9VA 4RE3A 4OIFA 3W6MA 1JYNA 2UWFA 1M53A 3LMYA 3FW6A 1R85A 5DEZA 3GH4A 1EQPA 3VMPA 5HOSA 4KWUA 5I2UA 4A4AA 4J3XA 1ZBWA 2WMJA 2WCGA 1BVZA 4MNMA 1J11A 4MJ2A 4WF7A 4Z2JA 4J3VA 2ZUNA 1MXDA 4JHOA 3LPPA 1WNOA 1GOOA 1PX3A 3WMBA 2DPEA 1XD0A 1OT1A 1PAMA 1PJ9A 4HP5A 4U5IA 4WJXA 4KRTA 4AD5A 3OGVA 3WMCA 1E73M 2A3BA 2ZX6A 4JKLA 1Q6FA 1E1EA 3ARVA 3M07A 5AYBA 3WEOA 1JYWA 1UR8A 3I3BA 3AHYA 3DYPA 2W92A 1W1VA 1V03A 4M24A 1EOMA 3BAKA 2JF6A 4GO9A 1JZ4A 1MXGA 1CXIA 1DHKA 3RILA 1E71M 4H8HA 1AQ0A 5CLWA 3BAXA 2QMJA 1DWJM 1C93A 2ZXQA 3WKZA 2GK1B 1ISYA 4MNJA 3ARUA 1LWHA 3WNLA 4Z2GA 1E43A 3WD4A 2WHLA 3KWXA 5CPSA 2E9LA 2XSBA 3WDHA 4WSKA 1UQYA 1I1XA 2UY2A 2CERA 5ECUA 3ARXA 1ZU8A 1UR9A 4OBRA 1JDAA 3CHEA 3N11A 3UR7A 2EPMX 3AISA 3WFLA 2E8ZA 5D8ZA 5ABEA 1HJXA 4CGTA 1VJZA 5IHSA 3CBWA 2VCAA 2BHZA 3ARSA 5A6LA 4BCEA 4NRRA 1HVQA 3BCDA 4J7RA 2X09A 4ZE4A 1ODZA 5A8OA 4AEEA 2J7HA 2ZX5A 1CYGA 2HISA 3W4RA 2YL9A 2JEPA 4H2CA 4QLJA 3SIMA 4PMYA 5E6ZA 4WSJA 4MB1A 3BC9A 1GCYA 2VX7A 2O9TA 1TMQA 2FH6A 2IXVA 3AOFA 1UG6A 1UWUA 3CPUA 5BRPA 3UG5A 1X6NA 4GQQA 3VX1A 2QMKA 3FHQA 4CU7A 2J79A 4DWSC 1K9DA 1RH9A 3SCTA 2BVTA 2WSKA 3U5UA 1V0LA 4QLLA 1V3HA 4WKHA 3BLPX 5FOOA 1A47A 3CHDA 3GH5A 2CHNA 1NWRA 2EPKX 1OSEA 4HA4A 2VZSA 2GJRA 2XTKA 1NOWA 4MTVA 3IAPA 1NH6A 1J0IA 1E40A 5LYRA 3WDRA 5A6AA 1TA3B 8CGTA 1UOKA 2TAAA 1W1PA 3POCA 4CD8A 4H41A 5IFTA 4U3CA 2J47A 1L8NA 2FHCA 3ALGA 4F79A 4CN1A 1WZKA 1PPIA 1KBKA 3W53A 4OBSA 1KQZA 1E1FA 1GONA 2O9PA 5I23A 3MKKA 4C7FA 5FD0A 6A3HA 3BAYA 4N0RA 3CMJA 1QI4A 1HT6A 4UQBA 2DH3A 3ARTA 2DIJA 2GDVA 1OINA 1HIZA 4D6DA 4N42A 4MB3A 2C8NA 3MUIA 1GOQA 1H41A 3WL0A 5HXMA 1QI2A 1HP5A 4TXEA 1UR1A 1I75A 1ZL1A 4JKMA 3K1DA 3MSGA 1W3JA 3MV01 4XV0A 4TVDA 1G0CA 3WNKA 5AC4A 2XVKA 4E2OA 4UOQA 3KEHA 3WDPP 1VFOA 3S6TA 1B90A 4PUDA 5A6BD 1V3IA 3MMDA 5EB8A 3VDBA 1HKKA 1UUQA 1YHTA 5FL0A 4CD6A 4AIEA 3AI0A 1HKMA 2NT1A 1J0HA 4UTFA 4OOZA 1E5JA 4UZSA 3AIEA 1E0WA 3M6DA 1KR0A 1MW1A 5FL1A 1WDRA 1EHNA 3SUUA 2Y5EA 2BXZA 2JALA 4HZ6A 4P8UA 4E4PA 3ZO9A 1TCMA 4HA1A 3IAQA 2PBGA 1EGZA 2W91A 2BNJA 3SUVA 3AZSA 1GHSA 1G1YA 1JL8A 3RPMA 1WAWA 1R87A 3ECQA 2XVNA 1PBGA 1QW9A 2J7DA 4W86A 1ESWA 1LQ0A 4M81A 4JFVA 4P7LA 1XH0A 2VZUA 1J10A 3AHVA 1XYFA 4XUYA 4MNKA 3OZOA 4IPLA 2UY4A 3BGAA 4AWEA 2A3AA 3WH9A 2J7BA 1GJUA 1CZ1A 2CXGA 3BMWA 4MJ4A 1BFNA 2PWGA 2CCRA 1TVNA 1E15A 4UFJA
chains in the Genus database with same CATH superfamily
5FF0A 3NQMA 2Z6JA 4GC3A 4DNMA 4H2HA 1OC6A 1R6WA 3B8VA 4KKXA 3WF4A 2HK0A 2G4JA 4S39A 2PDJA 5BXRA 3QY7A 3W02A 3FEQA 3W01A 1KFWA 2ABBA 2AAAA 1SSDA 2I9UA 4LQ1A 1L6FA 1MZHA 4JFSA 2OXNA 2PMQA 3PBGA 3JZEA 1B3VA 5LA0A 2UY3A 2RUSA 2DORA 3G77A 2ZX8A 3EDFA 1CLXA 4FXSA 4L4PA 2QJMA 1UD8A 1E4IA 3ITXA 1OJXA 2BVYA 1X7IA 5BMWA 2H9AB 1HZYA 4QE5A 3CUZA 3PZGA 3GC5A 4P8VA 1US0A 2DEPA 5M03A 1K4GA 5FKYA 3DGBA 4GX8A 2VDIA 5A8GA 2WLYA 3UVIA 3W24A 4NZ4A 3CZEA 4JFWA 4DAFA 3M16A 1E70M 2Z1WA 1OGBA 1EQCA 3TDFA 1XH2A 3U2CA 1UCWA 2VELA 4C6CA 1JNDA 4YHEA 3RR1A 4FOUA 1R38A 3QYSA 4LSBA 1P43A 2CBUA 4IQLA 3A6OA 3M41A 3IEBA 1J01A 4NZCA 3ONBA 1XC6A 5GPRA 1XLJA 4TVCA 2W0UA 3R0KA 4MJMA 3WIJA 1MQRA 1O1ZA 2JKAA 4AD3A 3HG5A 4RXFA 4CNPA 2PCQA 3H4XA 5DN1A 1B31A 1Z8AA 5C9RA 1V6TA 2WXDM 1VENA 2O0TA 3VE9A 2AOSA 4IM4A 1JQXA 3B8TA 3E74A 4HU4A 3ALFA 5A8QA 5LA2A 1CI1A 2XH0A 4Q8MA 4MY9A 2OVLA 3EMZA 3STFA 4QX4A 2OELA 4HMEA 2R1MA 3W1AA 2DZPA 3UXIA 3WQDA 2YB4A 1W5MA 4DYJA 2WPBA 3PHAA 1VFHA 4Q8NA 3W37A 2QKFA 1M7OA 1B3OA 1XXXA 2BMBA 4C91A 1B4EA 4PMUA 1F6PA 1VEMA 4V33A 4OUIA 1XCXA 3LM3A 2Z1SA 3GK0A 2ZOXA 3BPWA 1ZBVA 3CWNA 4M80A 2CNCA 2DSVA 2XJ7A 4O54A 4X9YA 1UWQA 3UU0A 3WLSA 1XUZA 3TK7A 4NX5A 1EX1A 3A9IA 2WVUA 2CKRA 5PTDA 1OG0A 4A8IA 1W6TA 4F0LA 1SFTA 1VPQA 5EYWA 3VIPA 2WNNA 1W32A 1VC4A 2HMCA 3LENA 1IF2A 3AUJA 5A2AA 4A2SA 4IIFA 2FZ8A 2VTFA 5DT5A 2ZUUA 4W87A 2Z1BA 1YTDA 3W70A 2GDUA 5EBAA 5A8PA 1QNVA 5GJNA 2DY3A 4L80A 5K3VA 2WANA 4D9PA 2D0HA 4GXPA 5JU6A 3RCMA 1CGUA 2CZFA 3A4WA 3NSXA 3TUUA 2WJDA 2PRHA 1B3XA 2QPUA 4B9ZA 2FVMA 3ABRA 4H01A 2OKTA 3MV11 4LAOA 4AYGA 1YXYA 4URIA 3WLLA 1E55A 2NW0A 3DBPA 2DH2A 3L4VA 1QATA 2PP3A 1NIUA 1DORA 3H55A 3WQWA 5A1AA 2YLLA 1EBGA 1MQQA 2GUYA 4CU8A 1DWGM 2XDFA 2VX6A 3S6OA 1P6CA 3F03K 4IL0A 1UD4A 4I5RA 4OFCA 3ZMRA 3OZYA 1RA0A 3DFOA 4UR9A 4B90A 5D2TA 4OWGA 3FYOA 1JPMA 1PHWA 2BOEX 1SFSA 1J93A 3I7RA 1KCKA 4S3KA 5C2GA 3AZRA 1H4PA 2WVVA 1E0VA 5LA1A 3UR8A 4FSAA 4Z42C 3IGHX 1W31A 1IZKA 1RSCA 3WK3A 1ZP3A 3VGDA 2D24A 1A0CA 2GFTA 4NZFA 2R1KA 2ZC1A 3FXYA 3GC2A 1X1NA 4JL1A 1EJSC 5H8UA 3F7JA 3WBAA 4Y2WA 3HIJA 1D2KA 4UFHA 1CXLA 1RZMA 1WKEA 4P7NA 3O7UA 3GXFA 1H11A 5BRQA 3LLFA 1N8WA 2Q09A 3WJYA 4KH2A 3IARA 1YYAA 3NXFA 3OIHA 3TFCA 1QU4A 1O5KA 1KM3A 3AALA 3KS6A 5F4SA 6XIAA 2XN0A 1US2A 2O7SA 3AWOA 2NLYA 3TC3A 3AXHA 3FS2A 2MANA 4R27A 4H9UA 4XK2A 1HO4A 3WH7A 1WE5A 2X41A 5DFAA 1EP1A 2PWDA 3TN3A 4GI4A 2OGYA 2GWGA 2ZX7A 2J6XA 4BWLA 5D30A 3H2MA 4IMFA 1A3XA 1FWDC 4DJEC 4GGBA 1S2AA 3VD4A 4UNLA 1C7SA 3BW2A 4L1XA 1AODA 4OE7A 2JEQA 3FJLA 1OX4A 4R53A 1NM9A 1ZJIA 1OF8A 3B8SA 3BQ5A 2Z1XA 4QJ3B 5KITA 1Q3NA 2ZA1A 1VFMA 3IUDA 3A4AA 4LUIA 5CCZA 2FTPA 1RHCA 5JBDA 1PKMA 1UD5A 2CLOA 3LPGA 1YADA 1H1ZA 4G7EA 5I3KA 3CL6A 3EXRA 3W07A 6CGTA 5A94A 1O5RA 5BYWA 3LSBA 4MAVA 3V0SA 5AHIA 3F5JA 1RBLA 3UCCA 1O1HA 1VBJA 3G0XA 1X39A 3LXCA 4BZYA 3WNOA 5A5WA 1U1HA 3GVQA 4YLWA 1EUNA 1VD6A 4GIEA 1BG9A 5LKYA 3VMOA 2A6LA 2QF8A 1MSSA 2PDHA 1W3IA 4FXFA 5HR6A 4ZENA 4TMBA 1GJPA 3MS8A 3VK5A 3OPSA 3G0UA 3GXIA 1LL4A 4DO7A 2OODA 1CIUA 1E72M 2IPGA 3PG8A 4JGDA 2PTWA 5TAOA 1V6YA 3AMKA 1R7OA 4DF0A 4PMVA 4Y6GA 3CHFA 1UPPA 1ADDA 3S5SA 2ZC8A 2GGJA 3ARWA 4Q8OA 3LMZA 3KZPA 3UZXA 3QZAA 1H09A 3QHMA 5HMEA 3M7SA 4UQAA 1QPQA 4UB9A 5DMMA 4YJ5A 3B9OA 4WY0F 1KTBA 4MWAB 3H21A 4Z1AA 1MZRA 3QKZA 4HHMA 2XGBA 1NVMA 3HQOA 3LPOA 1RV8A 4S3JA 4AY1A 1TCDA 1YDOA 2CBIA 3W1QA 3NPWA 2VFEA 2ZXDA 1UPMB 3ABSA 1ZRQA 1VBGA 4Y90A 1XUUA 4FALA 4DM1A 2J6VA 4R3UA 4Z1BA 1F4AA 1CGVA 2ZIDA 1XSKA 1R9XA 3CZ8A 3ABXA 1M04A 2VCCA 2VVNA 3WNPA 3D3FA 3VOCA 3NQBA 5CC5A 2AQVA 4U28A 3WN6A 3EDKA 4J3WA 2PSNA 3NPVA 3P61A 2QCNA 2IS7A 3HJZA 4JR5A 3GR8A 3DECA 5FJTA 5B7ZA 3THQA 2XYLA 1VH7A 3S9IA 1LDCA 3GIPA 2A3LA 3EWUA 1TKKA 3TJ4A 3ITCA 3TNOA 1JPIA 2GLKA 3PC0A 5HANA 3USZA 1QO2A 4M0XA 3SUSA 2BLEA 5IBXA 3D46A 1CGWA 3AMLA 3PP7A 3GG7A 3SGZA 4HYWA 1XLDA 3AIVA 1SO5A 2WNQA 4DWSB 4JYEA 3WK1A 1E0UA 2QCDA 3BLEA 2OQLA 1W5QA 4I9AA 3BZJA 4JTLA 4WDWA 4HD5A 1YNPA 1PKLA 4JY8A 4DO4A 3BDKA 2PD5A 4AHOA 5XINA 1REQA 2PWVA 4LYQA 3TSDA 4C65A 3QMRA 4D1JA 3NVDA 1S2VA 2QPXA 2DFAA 4XSMA 1Z69A 4J40A 1D7FA 1GWJA 1RY0A 1GG0A 2ZCGA 1KR1A 3RRAA 4G8TA 1NTHA 2EXOA 1FKXA 1UC5A 3WCZA 2XGIA 5HPOA 2PDIA 2HQAA 5HUPA 3KFTA 4QGCA 4PUEA 4RDYA 4QBXA 5AZ0A 5M3WA 2HEJA 1XYBA 3B0UX 2C7FA 2CXEA 1XBXA 1WZLA 3EPNA 1MFUA 4HK6A 3BTNA 1TV7A 4UQ9A 1K7FA 1AK5A 1SW0A 2YDAA 3AROA 3O2LA 1R2TA 3HPZA 4IGHA 3ZVIA 3A64A 2X1SA 5T26A 2VRJA 4K2SA 3VDHA 1Z3NA 2WZHA 1RALA 5E0KA 3CQ0A 4HZ8A 7TAAA 3OYZA 4LBRA 5HQEA 1UWTA 2QCGA 1EIBA 1Q6QA 2WNZA 5DXYA 3TV8A 1E1CA 4DZAA 5FSDC 1I0DA 4EAMA 1XIMA 3GTHA 2D3LA 1YDYA 3AWNA 3PTMA 2O4QA 1RY8A 1K3UA 1DPMA 3W7GA 1JCTA 1S46A 3B97A 3W27A 4PCSA 2Z29A 5C7HA 4N2YA 1J12A 3OGRA 4IP7A 3H70A 2BHYA 2NUXA 1H1NA 5AY7A 1XQKA 3V0TA 4Q4QA 2YJQA 1HG3A 5AVNA 1EGVA 4IH3A 4L61A 4PGLA 3RR4A 3SCPA 1US3A 2VR2A 3LSCA 3NM3A 2D0GA 1PZ1A 2CESA 1LOQA 2C1GA 4ZE5A 3TAKA 2YFNA 4HZ7A 4Z1DA 4BFAA 6REQA 3QPYA 4B5VA 3WD3A 1VGAA 2PWEA 1EJXC 1TE6A 4LWWA 3RCNA 3KX6A 2PP0A 1E51A 1UYQA 4H8NA 1L6GA 2VWTA 2DZAA 4U4MA 3NEVA 1C7TA 3Q94A 5LIWX 3WEMA 4XVEA 4GQBA 4QRNA 4KWSA 1DJWA 4F2TA 3VFLA 4XKYA 1IEXA 1HX0A 4HPGA 4S23A 3WH8A 3R0DA 5EBUA 2OEKA 2QIWA 5F1UA 1NP0A 2WMIA 5D09A 1PE1A 1KM4A 3NR0A 3HF3A 1C3FA 4QG9A 4Z2LA 1JPKA 1PIGA 1PTAA 1F74A 2X7WA 3C0QA 5D2WA 4DB7A 5LNSA 2X05A 5IM51 3MMWA 5XIMA 2WHKA 3NDYA 2CW6A 3OZMA 4GO8A 4GGHA 5K4ZA 3NCOA 5DF0A 2WBGA 5G1MA 5I0DA 1UWAA 3TTYA 3S8HA 3TYUA 1DIEA 1K9TA 3LK6A 3U2EA 3QRHA 1JPHA 3ZT5A 2FDMA 1A50A 2PDYA 8XIAA 3BV4A 3QV8A 3F2BA 1ZAJA 4GCXA 2CKSA 2V9DA 4LS1A 4QDPA 4DJFA 3C0JA 5K9DA 1HL2A 2X42A 1SUXA 4JD4A 2VWSA 4E4UA 3R2GA 3RM8A 1SR0A 4ZR8A 3RIKA 1LROA 3W7CA 2VQTA 5AYIA 4DJDA 2B7OA 2E8YA 1RQHA 1ZSXA 3C6CA 2PLKA 1FH7A 4AB4A 3PTQA 2JFEX 4FIRA 2F61A 2JQXA 2ZTJA 1NDYA 3BSMA 1MNSA 1MUWA 2B31A 4RW5A 3NOEA 4QM1A 4UQDA 4RW3A 1Q6DA 4UQCA 4W5UA 1RVKA 4Y9PA 1O66A 2ISWA 3FX4A 1ME9A 3KCOA 1EJUC 1SMAA 1XRVA 1W56A 2BFGA 2QJGA 3DESA 3M0IA 2PI6A 4XAYA 1HKJA 3U8GA 4AH7A 4ZEPA 1RK6A 4DYEA 2VDGA 5DX7A 4OT7A 3HBLA 4C6JA 2AQOA 3B05A 1TFVA 3GDKA 3UY8A 1NQ6A 3CWOX 3AYRA 3LLXA 2FZ9A 4JICA 3M0KA 3L0GA 3PJUA 1XICA 4QG8A 1K6WA 4GI8A 4PR4A 2J24A 1KGWA 4WGXA 2HCVA 3W7LA 4AHPA 2PDPA 4EPBC 3G1YA 1AMYA 3AS3A 1UKOA 2XZ7A 1NWUA 4K7YA 3MSDA 3CEPA 3CV1A 3U5YA 1IWPA 3TW9A 1OZQA 3B9EA 3EWCA 1LRQA 5JBEA 3W1PA 2PAJA 4YN5A 2Z1KA 4PUWA 4PUMA 4QDMA 3W9ZA 4KFOA 3PB0A 3SJNA 2C18A 3BAIA 4IGMA 3IUHA 1Z32X 1KBIA 1ZNNA 5I03A 1KTNA 2VC7A 3VIKA 2YYUA 4Q3MA 2Z27A 3PJTA 3W88A 4NNAA 4GIRA 2BXVA 4OBTA 3S2JA 4W8AA 2YL8A 5GVJA 2QIIA 2A3EA 2V3EA 2VC5A 4O15A 1DQXA 1PTGA 1EXBA 2PDXA 2RAGA 1P0NA 3NZPA 3ID7A 4UWMA 1BGAA 4CU6A 1NOUA 4LVGA 2G3IA 3WLOA 4JN8A 2VR4A 4H9MA 3BLOA 2ZZ1A 3MHUA 4D6EA 3U48A 2FDSA 2HTMA 4JTKA 3GNRA 1Z6KA 1B57A 4UR8A 5H6HA 4ZODA 4QTGA 5CJ5A 1SO3A 3QZEA 4LUJA 1VRDA 4MLJA 4Z0SA 1XYZA 5I3JA 1B1YA 1M65A 4ZOAA 4WDUA 1E9YB 3UCDA 2VD9A 4M1RA 4NRSA 4CQDA 3G24A 4RXGA 1JCNA 1R7AA 4E2BA 2V81A 2GOUA 5A69A 5LXXA 5D05A 3E02A 4Y96A 2V5LA 5CZKA 4AC7C 2Z2AA 2X0SA 3L4WA 4CNTA 3MI2A 4DPQA 2O9RA 1BHGA 2F9RA 4RE4A 1FP9A 1IEQA 3WQ5A 3VIJA 3GTFA 5HR7A 1UKPA 4GFIA 2EG6A 5I77A 1YKWA 1RCOB 3UY7A 1B30A 1UP3A 3BLFA 4HTYA 1LL6A 3E49A 4WVXA 3G2GA 2PA6A 5HINA 3AHTA 3TC6A 5BMXA 1GPWA 2CIPA 3L21A 3W2MA 1EL3A 4JTQA 3RM4A 3MCNA 4XAZA 1R9ZA 2OWWA 3VMNA 2DSUA 1AJ2A 2XWEA 2WAGA 1E9LA 3I68A 3QM3A 5CC6A 4B4HA 2DVXA 3RLUA 4AC1X 5ENLA 1M03A 1PZ3A 3P7YA 1JZ8A 3W84A 1VP5A 2HE8A 4S1FA 5KZDA 1A80A 4OTKA 4MY1A 1VEOA 3SGUA 5LNRA 3GBDA 4H7VA 3ZIZA 4U10A 4UZUA 1QBAA 1AJ0A 3A22A 3PBVA 3BICA 3G22A 2W66A 4DNHA 3FGCB 4QQ3A 4EWND 2O9OA 5JIWA 3SO7A 2HXTA 4MY8A 4P61A 3LXAA 3SBFA 1I8JA 3ISIX 1H3GA 5A6KA 3QW3A 4RE2A 2AL2B 1FHUA 2YZRA 3B8WA 4L1WA 4LEFA 1SM9A 3DI1A 3QC0A 4C6BA 3IACA 3WD1A 4LV9A 1XI3A 2DQWA 1KFCA 4X9SA 2VEKA 4S38A 3JVAA 2INFA 4AW7A 5I3DA 2RJGA 4PRRA 5E1QA 3GR4A 3VM5A 4FXRA 1DTUA 5CLTA 3ABQA 4NQ1A 2VEGA 3U57A 1Y65A 3C4UA 1J4EA 2G3MA 3UW6A 1B9ZA 3MT1A 3MP5A 3VYLA 2CZEA 5D33A 3CTTA 1R8LA 3UPMA 4H4IA 2FPVA 4F9JA 4TX6A 4N4PA 2Z2BA 1J9YA 3KLLA 1RD5A 4O1EA 2VUYA 2ZE0A 5GNYA 4O18A 2ZZ3A 1J5TA 1LWIA 4KF1A 4FA3A 2NUYA 2J9YA 4PL1A 3D0CA 1WB0A 5T8GA 2I14A 4C6NA 4XD4A 1NWTA 5I78A 1VRXA 2E5BA 4RJEA 3HGJA 3JRKA 2Q02A 1GQIA 4PUKA 1JZ2A 3P0XA 3AS0A 3CV7A 3R4IA 2IUZA 1EO7A 3TIMA 3PNUA 2E5CA 4W4QA 2CETA 1JUEA 1TX2A 2WOQA 1CXKA 1ELSA 2DQXA 2E6DA 3SUWA 2P10A 1DIOA 1EJRC 2A2IA 4OVXA 3EOLA 2IKIA 3RCYA 4HA3A 3DZ1A 1MYRA 4N7QA 2Y6ZA 5HWNA 2ZXBA 3M46A 4CEUC 3THDA 2HNEA 3T40A 3W26A 2X8RA 3WH6A 1GZ1A 1VJIA 1TZ9A 3CAQA 1S1RA 8XIMA 2W9MA 5DELA 4C90A 2AAMA 4E8DA 1D3GA 4Z2KA 3QC3A 3KL5A 2J77A 4D6CA 2V82A 2EG7A 1XGDA 4ATDA 3LCWA 4OIFA 1TWWA 3W6MA 2QULA 2YBVA 3LMYA 3FW6A 2ICSA 1M5WA 1SO4A 2PTXA 2VGIA 2O56A 2WCGA 3TN5A 1JCJA 3T4WA 3HM7A 2ZUNA 3RAOA 5FA5A 1MXDA 3HQ1A 4TIMA 4LBSA 2ACQA 1BKHA 3PK7A 4KEVA 3WMBA 1F8IA 2DPEA 4HA0A 3PB2A 4JTTA 4HP5A 4U5IA 3I6EA 2O55A 4I90A 3L0KA 1Q6FA 3ATZA 3GNNA 5CPLA 5D03A 4JIIX 4C6IA 5C54A 4PRTA 1PHQA 1DJYA 1TWIA 4WY0B 1JYWA 2D2JA 3QZ6A 2VFHA 2CLEA 1YPXA 3AHYA 3WYZA 1W1VA 4YTSA 1AW1A 3TEVA 3W7HA 2OZ8A 3MY9A 1Q6OA 2JF6A 3DHDA 2QR6A 1CXIA 3RILA 3CXOA 1E71M 3L23A 3GW0A 1KM0A 4RZ6A 5KETA 5J04A 2GK1B 3ARUA 4ADSA 3RF9A 4LUTB 5G2IA 4GCAA 3H23A 5CPSA 2JK2A 4WSKA 3NG3A 1UQYA 4KPLA 3MUCA 1JGMA 2FZNA 1O5QA 4HJFA 1UR9A 4XQ6A 3CHEA 6ALDA 3N11A 3UR7A 4BI7A 3AISA 2E8ZA 4ZO9A 1HJXA 2H8ZA 3K5XA 4DQWA 1OF6A 3CBWA 5FI8A 1PS9A 3N6QA 3NTYA 3MUXA 2FZMA 2G95A 2X09A 3B40A 4EIVA 1ODZA 5C9UA 4AEEA 1HQTA 1CYGA 2HISA 5JXQA 3MO7A 1JDFA 2E1DA 3G8RA 4DLFA 1OCJA 1JQVA 4F0MA 2VX7A 4AWSA 1TMQA 3UWQA 3ES7A 1UG6A 1XDMA 4ZB0A 1OCNA 1DJZA 1DQUA 4GQQA 3VX1A 3FHQA 4O11A 1K9DA 3TLQA 1V0LA 4QLLA 5DRIA 2F7FA 4WKHA 2EPKX 1OSEA 2I5IA 1HW6A 1D8WA 4MTVA 2VZSA 1OFEA 2GJRA 3IAPA 3DU0A 2ISVA 5A6AA 3M0YA 4Y9NA 3POCA 4CD8A 3E2VA 3E3HA 3LNMA 3ALGA 1JUBA 1TV5A 1AFSA 1PPIA 4OBSA 1E1FA 1GONA 3MKKA 4C7FA 1TPEA 2QDEA 1EPVA 1FWGC 3TWAA 5LNUA 4EF9A 3S1XA 3O15A 3MUIA 3VDGA 4GY0A 1G6CA 3EXSA 1GOQA 3B4YA 2DJLA 3LHWA 1GKQA 1HP5A 3AAMA 1Q66A 4V15A 3S5OA 5JMUA 1VPYA 4IGSA 3NWRA 3HTWA 4H9TA 4XV0A 1OFQA 1QPRA 2E28A 4DXVA 4E2OA 3LI0A 1HUVA 3HA1A 4PUDA 2NQJA 1V3IA 1WXJA 5EB8A 4ZTXA 4RKAA 4L4LA 1U1JA 4AIEA 1G4SA 3AI0A 2NT1A 5G1YA 2IQDA 3H54A 1BQGA 4UZSA 3TYZA 1KR0A 2NUWA 4K8GA 3CL7A 1QXLA 4HZ6A 1UW9A 4XWUA 4E4PA 1TCMA 2AQWA 1IEIA 2E09A 4GZ7A 4D8LA 3SRDA 4WX2A 2PF8A 4EOUA 2I57A 1G1YA 1JL8A 4QAIA 4XO7A 3LHYA 3C2VA 1R87A 1LBMA 4KWVA 2PPGA 3C61A 1QW9A 2TODA 1S2TA 3KBNA 2J7DA 3ABZA 5F2MA 1XH0A 3AHVA 4MNKA 2NX9A 1AW2A 3OZOA 3BGAA 4GA8A 3SY8A 4XAFA 1GJUA 1FWHC 2OZTA 1UMYA 2HBVA 1H7WA 5REQA 5GJMA 4R9XA 3SM0A 1FH8A 3LHUA 1X8FA 2PLCA 3IJ9A 4YCPA 4ZQOA 4KCVA 1T40A 1G5AA 2YLAA 3L5AA 4QDWA 3KBMA 5RUBA 1JAKA 2CYGA 3N4AA 2DT1A 2QLYA 1JZ7A 1M01A 4A2RA 5MKGB 4AYSA 3IJ7A 4TO8A 2A79A 2YL5A 1ME7A 4J4KA 3V4BA 5I79A 5CBJA 1RUSA 2WC3A 3SCUA 1JPDX 1JD7A 2VX5A 2HPMA 3TE9A 1XV8A 3NL2A 2IKJA 1MMFA 4GE8A 4LPCA 2XUCA 3IIZA 1G7VA 2VYOA 4ADUA 4AEOA 4EWJA 4EXAA 3TFXA 3WF2A 5F4XA 3W71A 2XIBA 1KRCC 3BSHA 1BAGA 3UETA 1K8CA 4WZHA 3W7DA 3POHA 2RDXA 1AMKA 3GG0A 3HZ3A 2XH2A 4UFLA 4IX2A 3UZWA 1QNRA 4GKTA 2IKGA 4GUJA 4FLSA 3BW3A 3TQVA 2PU0A 4K1WA 3OEXA 4XIMA 1WOBA 5DRCA 3AU6A 2D2OA 1LZOA 4K3ZA 1FUYA 1EP3A 3LNPA 2RHGA 4JQ1A 4S3BA 2V2CA 2WHJA 1WKFA 3GKFA 3UWZA 2OGJA 1EC7A 3MKCA 2EG8A 3LV5A 2NV2A 3UFYA 1HN1A 4EPEC 4NZ3A 4ICMA 1UZHA 2V67A 4LXFA 1JNEA 4U2YA 4AD2A 3F4VA 1D3CA 2IPJA 3G1HA 2DGAA 3SJ3A 3SCNA 3QHNA 3WNMA 3E12A 1X1ZA 3W73A 4JTSA 4NSBA 2BBFA 3OB8A 3FXGA 3KL3A 1W3TA 3E0FA 4TX9A 2VQUA 5BXTA 4FNRA 1OYAA 5I3HA 2O92A 1AH0A 3NQAA 3NDZA 4FHAA 3TNBA 1XFCA 1LG1A 4GISA 2XFRA 4NG3A 2IQTA 1HJUA 1FRBA 2W4XA 1AH4A 5LNVA 2CLPA 3FYPA 4F2UA 4E8CA 2PB1A 2J8GA 3SURA 4FO4A 3IGSA 4JNYA 5D2VA 3VD3A 3KOXA 1TJ2A 3MTWA 3NL5A 3FFSA 2E68A 4A05A 1NFGA 2CPUA 4C6OA 1J6OA 1A5BA 3HFTA 4U31A 4D6HA 3MHGA 2ZWYA 2A4AA 1MDLA 4B9YA 4W8LA 4TU1A 4HSOA 4IPNB 3CZKA 3OBKA 4N9EA 3GIQA 2WV8A 3GNDA 3E2SA 3CIVA 3UERA 3CASA 2VOTA 4KETA 3W22A 5ECVA 4EKJA 4BKNA 2VZTA 1IXOA 5I02A 4B5TA 4DZHA 1XYAA 5HNUA 2BB0A 4HOZA 1E5NA 3M7WA 1B3ZA 1L2UA 3LA4A 3N29A 4RX0A 1AD1A 2EHHA 1F76A 2YIHA 2OT1A 3CUJA 4H7ZA 4H8UA 1OGSA 2DVTA 2Y8VA 4AZCA 3FVMA 4J3TA 4PMJA 2HZGA 1HJWA 3MA8A 2PWFA 5C5YA 2PDUA 3VVGA 3GXTA 4XAPA 1EX5A 1XWYA 4W9TA 4GABA 4D2JA 1JIBA 5A2BA 2RFGA 5F2IA 2Z4GA 3CGTA 4HNOA 1GKPA 5HDRA 2ISDA 1HKIA 5LZLA 3BCJA 1O4UA 1YDVA 4JCLA 3BARA 1EIXA 4C1KA 5EMJA 4DUVA 3SY1A 1XRSA 2XSXA 3KVJA 4GVFA 3B06A 1KBLA 1XLLA 4JIRA 2WC7A 1RAKA 4CQBA 2G3NA 1WZMA 2JF7A 3BGJA 3QFWA 4I9TA 1V08A 2WMFA 3ES8A 2QGYA 4UTLA 3M47A 4JNMA 1SGJA 4ZFCA 4LF1A 2VP8A 1HO1A 2A85A 2D2GA 4UCGA 4Q22A 1C9DA 4AZ6A 1KWGA 1IGSA 2ZUWA 1IQ8A 2VM8A 4PMZA 1E9ZB 1G01A 3AU2A 3FDGA 2BXYA 2WKJA 2ZYFA 1RJPA 1W1ZA 1YNYA 7ENLA 2Y2WA 5DMLA 5FJRA 1TWSA 3PBMA 2GL5A 3DAQA 4AD0A 2QS8A 3UZZA 1YQ2A 3A5VA 2IKHA 5IOBA 3K8KA 4H00A 5TQLA 3AXXA 2R14A 5AB3A 4WKFA 1J96A 3WQ6A 1DYSA 2GYIA 3O9NA 2XU2A 1VYRA 1R3QA 2NQZA 3MW7A 2OTDA 3UJSA 3I65A 4KCUA 5E70A 3KRUA 1UKQA 1RXOB 5C9XA 2PLJA 5D9PA 4GMEA 4K8HA 3FYYA 5DXXA 1E6XM 2OLAA 3W85A 1U30A 1UROA 2V3FA 4LTSA 4MYAA 4S3GA 4RDZA 4JDYA 3WH5A 4M19A 5EPDA 3TCEA 3W81A 3BH4A 3WLMA 3M0MA 2C19A 3V75A 5I24A 1JF6A 3N12A 4PSPA 5A95A 4CEXC 1XCWA 3WLQA 1FHVA 1LLWA 4LVAA 5IFPA 1TPWA 1CWYA 1VS1A 3CL8A 1WX0A 1FWNA 1WV2A 1NJJA 3CQHA 1KWKA 4PB5A 1EUAA 1VJSA 1EJWC 3BK0A 1OD0A 1M3UA 3CMGA 2DUXA 2OSYA 1VQTA 1GW1A 2E9BA 3I10A 3S2LA 3AIBA 3FCPA 3GVGA 3QKEA 4RL3A 4IP5A 2OB3A 2FMNA 4NZ1A 3MQTA 3LLDA 3BO9A 1T8XA 2WWCA 1VHCA 1C8YA 3EOOA 1F5ZA 4RCXA 3GU2A 1QUMA 2C16A 5M5DA 1NFBA 2X2GA 1PZ2A 4MFDA 3CAKA 3O06A 2PDLA 3GXMA 3ZXWA 1EO5A 1J2WA 3AMCA 3VIMA 4MB4A 4PBGA 1V6WA 3TQKA 3W1RA 1LG2A 3TJLA 5ABGA 3GDMA 4G7EB 2PUZA 2POTA 4B3LA 2L5HA 4I7WA 1RPKA 2C0HA 4HOXA 1GPFA 1CBGA 1EFZA 1SSGA 1KXVA 5A6SA 1CGXA 5EMLA 2ZICA 4HNNA 2PWUA 3IPWA 1KD0A 1X38A 4A3QA 3D5HA 3W7NA 1WDWA 1PO9A 2G41A 1H63A 2NQLA 3GAKA 3B8DA 2PRLA 1W0MA 2GGIA 3GO2A 2INZA 1BXBA 1R3VA 1XSJA 2Y88A 3UEQA 1RBAA 3WL1A 2PGFA 3PZTA 3MC5A 3W7OA 1FDJA 5HNTA 4KQNA 3E9AA 3EEZA 7TIMA 2Y7GA 1CDGA 4S3FA 3UJRA 4DVOA 5KEZA 2PDGA 2HK1A 1ZY9A 4FLQA 3WQ8A 2GQ8A 2IXUA 4B3KA 2NV9A 5E6YA 4IIGA 2OO0A 4QXIA 3Q65A 4A29A 2EKGA 1W91A 1B0IA 4PA8A 2F2KA 4FLOA 1R5YA 2PURA 3P60A 4HPNA 1JDDA 1XC4A 4J28A 4XG1A 4I6KA 2VEFA 3C0SA 3MDUA 4JX5A 1XH1A 2GQ9A 3VTRA 2OEMA 1Q6RA 2W62A 3MBDA 3OHIA 2QZRA 3FGCA 4JEJA 5CKSA 3KLKA 2G96A 3L4ZA 4YS1A 3KBSA 1UB3A 3IRDA 3HFYA 2VXNA 4W88A 4RZ4A 2GJLA 1R0MA 2P8CA 2AL2A 4F0SA 1V8EA 3R7MA 1RP8A 5AECA 2ZXAA 3RU6A 4MADA 3UA4A 3RN6A 4B2DA 3MMUA 1MFVA 3RLHA 3TWBA 4D72A 4EVZA 1A4LA 2V5DA 3SFWA 3AJXA 3VC5A 1M7PA 1VLWA 2FJUB 2BHUA 1H61A 1K1DA 3AIRA 2WC4A 1UZDA 2PLMA 1ZAIA 5F1VA 2Q3OA 3N2OA 3NO1A 4HNCA 1JCMP 1LQAA 4L56A 3SEPA 2POZA 4FI4A 3I6RA 3PSWA 4HMNA 3ZQ9A 3QHOA 3UNDA 1QWKA 4FAMA 4YTRA 4Q7NA 1OFRA 3DX5A 3O0FA 4AU0A 1PV8A 2G5WA 2GOKA 3BLLA 4H9XA 6TIMA 4IMAA 4DJFC 2I17A 3TYAA 3REQA 3GUWA 4NILA 3FAWA 4NY2A 2R6OA 1IT8A 2QV4A 2QCDB 2XH7A 1HL8A 5HQMA 4K36A 4J35A 2NQ9A 3PPFA 3GTNA 2EPNA 4HOWA 1ZS2A 4ERGA 4N6EA 3WBEA 3RHGA 4JIQA 4IPIA 4NJHA 3W2LA 1B4KA 4DJDC 4IT1A 1XD1A 2QDHA 1E6ZA 1REQB 3ANYA 2WB5A 2CLIA 4PUJA 1UD3A 2WMKA 1S2WA 4PB3A 3UJFA 1BVNP 3MYOA 3E1F1 3N34A 1JDCA 1JF5A 4KIRA 1V0MA 4ZBCA 1CNVA 1LOLA 1TTPA 1VIWA 3BOLA 4K6AA 3R11A 3LGGA 1UR3M 1XLEA 3L4XA 3P84A 5F2LA 3CM4A 4S3CA 3MDWA 1AJZA 1FWCC 1V7YA 4KRUA 5TF0A 4CD5A 2WYSA 2JE8A 2HBXA 2PDMA 4O4WA 2G97A 1MVYA 2QUMA 1GVRA 1XLHA 7REQA 3VNJA 3LCXA 5G4WA 2VEMA 2OSXA 2ZRYA 3DBNA 4F9DA 3UGRA 3WJWA 3G1RA 3PAJA 4JS3A 2QJJA 1A0EA 3GG1A 2QT3A 5FAGA 4GG9A 1YW1A 4GC4A 1RQBA 1R47A 3MCOA 3MBFA 4LFYA 1BQCA 5EFFA 3H7VA 1NF7A 1UKTA 1W1YA 3KTCA 2WZIA 2VCBA 1ODUA 3NUKA 3G6MA 3TYBA 1C8XA 3T0CA 1JULA 3T07A 1PZ0A 3FAXA 4DO6A 4IXXA 4ORIA 1ME8A 2I7GA 5LIUX 4DRSA 3VD5A 3AZTA 1XKJA 1JCYA 3OLDA 2NVCA 5A8NA 4M6VA 5HQLA 2ACSA 4LV4A 3FEMA 1H50A 3P6LA 2NSXA 4MOZA 1F07A 3H12A 3PBYA 2QUTA 3AMGA 3E2RA 3VI2A 1LTDA 4NAEB 4JFTA 1GHRA 3TJIA 5A6TC 1K77A 1HKVA 2FGZA 6REQB 4GY1A 4AISA 1G4TA 5FJUA 1BRLB 3QTPA 4CUCA 4QEEA 1S39A 4XSLA 5EMUA 1VZWA 4UR7A 1EDTA 4B5XA 1K03A 2GK1A 4OOUA 4S3DA 4Q7IA 1X8CA 3PTKA 3QR0A 4LUTA 2YKKA 3EWYA 4JZ5A 4XKYB 1WXZA 3AHZA 3H4GA 3T78A 3CB8A 4FR6A 1MW3A 3NL3A 4IMCA 1BXNA 3TKFA 4C7DA 1ECEA 3HV8A 1EXPA 1XP3A 4GLEA 2J8FA 2WMIB 2YSWA 1FCUA 1EOKA 1TTQA 3RK8A 3NVTA 4IFOA 3TTOA 3UYIA 4BA0A 3QR1A 3S2CA 1ZPTA 5A8MA 3TX9A 4NNBA 3LUTA 4M7SA 4QJ4B 2DT0A 3W1LA 3ZVHA 2ONEA 4HNTA 5KZ6A 1GQKA 3XIMA 4LCRA 3UJ2A 3DFSA 3R1ZA 4Q4MA 4ML9A 4C6EA 3OQEA 5JH1A 5AFDA 1KLZA 1EJTC 3GTXA 4O10A 4AZGA 3O6CA 3S1UA 1I1WA 1TPDA 3CUHA 4IIDA 4C7GA 2VEPA 3FN9A 3RRXA 4CNNA 2YA0A 3QYQA 1H0GA 2QF7A 2YDQA 3DFHA 3NZ1A 3EPMA 2D1ZA 2C1HA 3EX1A 3VIGA 2XG9A 4ASTA 3HB9A 3D6NA 4GJ1A 1WAUA 1KC7A 1PXGA 3HN3A 1GVOA 2H3DA 5FJJA 4CNSA 4PZVA 3IK4A 3BAJA 4ZO8A 2OSWA 1P0DA 3R89A 1POKA 2QEZA 1OC5A 2NQHA 4IHCA 1DJNA 1PIIA 1BYDA 3OLEA 1YBQA 1A5AA 4RK8A 4CQ8A 3P82A 2Y4SA 4XZWA 2XIIA 3S2MA 2DV0A 1NU5A 3WBXA 4FNPA 1GGOA 3EX3A 3VO0A 3P8JA 4O50A 3TSBA 3B9DA 4JY9A 1B2YA 1G67A 3APGA 3WUBA 1P4CA 4X0NA 2BY0A 1PYFA 4HCDA 1DWFM 1G4EA 3BV7A 3SADA 4R7OA 3VNYA 1RR2A 1FDZA 3QMSA 3DH7A 4PCNA 4I9MA 3GVVA 1W3LA 4J3UA 3TTSA 3UCQA 2AMXA 1JRBA 5F7UA 1TJRA 4ATWA 3WF0A 3NPXA 5TD4A 1H5YA 1T7LA 3TCSA 3AS1A 4JAWA 1FHDA 3IJIA 4DF1A 3VU2A 1OFPA 1B9BA 3W7RA 3M0VA 1SZFA 2PDNA 4REQB 3W76A 4M5PA 1BPLB 1ENUA 1FX6A 1BG4A 2O7QA 5BNKA 4UTTC 3MWAA 4M56A 3KRSA 2A7RA 1U83A 5BCAA 3DFNA 5BOOA 2I1OA 3VIHA 2WSPA 1V7AA 4E6MA 1TZ7A 1T6MA 1J2BA 3SGGA 4JYFA 4GXMA 4C6FA 4OKDA 3ARYA 3PFMA 4RE0A 5T9BG 4M6QA 1J0ZA 3HO8A 4WR3A 1IXQA 1T5AA 1W37A 4DX3A 3PULA 2F6KA 3S3GA 3FHAA 5CSUA 1KGUA 5DLCA 2CZVA 3CZLA 1FXPA 1XLFA 4FF5A 4UTUA 2VR5A 2YCKX 5H91A 6PTDA 2VL4A 1BXCA 3NGFA 3AICA 1IGWA 3D3AA 3PWGA 5BU9A 3HJEA 4AD4A 4V28A 1DWAM 1YIXA 3VGFA 4D1IA 2Y8UA 5BXSA 2C79A 2J7GA 3O07A 1S2UA 3LU2A 4WHBA 1HJSA 5MKGA 1LCOA 3RXZA 4TV6A 3W1UA 1QNQA 1SZRA 3DCPA 3S46A 2BOGX 5E0CA 3PJXA 1BYAA 3CYVA 4ACZA 1R3RA 1UH3A 3DI0A 3H22A 4NAFA 2P0IA 1XYLA 3W7PA 4XZBA 5CJMA 3U0HA 1TUFA 2CHRA 2NSOA 4BR1A 4GUIA 3DERA 2BWGA 1TUXA 4MUZA 4A21A 5AC5A 1ISVA 1K8XA 4QE1A 3SQSA 3GFZA 4I8DA 3O0KA 3OTRA 2C6QA 1IXNA 3VGEA 1WXYA 3QPEA 3B0YA 3NQDA 1B3WA 5FCZA 4ROPA 3V35A 3BMVA 4L9XA 2V63A 2RKXA 2Y7FA 2G37A 5GNZA 4LCSA 2CEQA 2PTDA 5M1TA 3VNMA 4ZA0A 4M1BA 4DJEA 4IXHA 5FSEC 4PEEA 5HMFA 3WDIA 4E4FA 3SSZA 3VD7A 3IWPA 1YMYA 2ODOA 3T81A 4IPJA 3WBWA 1ZB5A 1W3KA 3OW1A 1S3TC 4H9ZA 4FZIA 2R24A 4QEHA 4QJ1A 3OJGA 4L4MA 3WD2A 1W5PA 1WOAA 2G50A 3IV3A 1TSIA 1UBPC 1ZCCA 3K8MA 1QPNA 3ARPA 4GNVA 3TQ0A 3MI6A 4ZCWA 4XISA 1Q4NX 3LTYA 1GNXA 4O8AA 3V5FA 1XLGA 3OU8A 4P7RA 2GJXA 3EOUA 1P1MA 4RNFA 1TV2A 1M7XA 4IPPA 1C8VA 1BF6A 3BJSA 3ZM8A 3G0SA 4Y9AA 2OZ3A 4GYPC 4XX6A 1NWSA 2Y63A 3KL0A 2VEIA 2MNRA 3EBVA 3MB9A 1DP0A 4JL2A 1UH4A 1XKYA 4I8YA 4FX6M 3LD5A 3PSVA 3WLTA 4HPJA 1OBAA 2DZUA 1BKSA 4YMZA 2ZADA 4Z2HA 4FS9A 3Q67A 4JTCA 1V51A 4LGXA 1X7FA 3LTSA 4AF0A 2Q3RA 4LY8A 1EP2A 2DDXA 4YNGA 2PDKA 2ZZ4A 4RDVA 1WQ5A 4HN8A 3QEZA 1QK2A 1SYTA 1BTCA 4K37A 2Z28A 3L67A 3UA3A 5CPMA 2WW5A 2VX4A 4XBJA 3CYJA 2V5BA 1OIFA 1KFJA 2I16A 3B4UA 1QHOA 1TQJA 4WUIA 4WQ6A 4Q33A 4NIRA 4IJCA 2V6AA 2QVHA 1DXEA 3KE0A 4CCCA 3N3MA 2WVSA 2VC9A 4J2MA 1W54A 5TBOA 1V3KA 7CGTA 2ZZ6A 4NJIA 1E6SM 2V2HA 3UT0A 4LAUA 1VBUA 4H6EA 4PMRA 3GHUA 4M51A 1OQFA 3QXBA 5BWFA 1PL9A 1UWSA 2BY1A 3CPRA 1CGTA 4D8ZA 1JFXA 3B0PA 4ATLA 4KWWA 2D2HA 3LQGA 1QAPA 4RPQA 1XGEA 4UTHA 1ADOA 3THCA 4DBSA 3SFKA 2YYTA 1GVFA 3UXDA 3P67A 3SCQA 3VGBA 3IJDA 2PF0A 1TPB1 1W9VA 3SAZA 4RE3A 3ANUA 1JYNA 2UWFA 1M53A 1Q8AA 3RUBL 1KKOA 3VMPA 1GTEA 3B0XA 3RX4A 3H53A 2C71A 4JTGA 1J6PA 2WMJA 4HSNA 4L9ZA 4ZL1A 3ITVA 2QJIA 1BVZA 4WEVX 4J3VA 3S5YA 3LN3A 3PNZA 5D38A 2D69A 2NX3A 1VCFA 4QHRA 3SRHA 1WNOA 4HHPA 2G3FA 3P5YA 4JIHA 1PTDA 1PAMA 4ZSUA 2REQA 3ITGA 4C1LA 3OGVA 4N6FA 4LS2A 1QMLA 1OG6A 1LUCA 3M0JA 2ZX6A 4JKLA 1TX0A 3TLLA 4UXDA 1DJHA 2YW4A 3CEUA 4Z0JA 4LW7A 5AYBA 3DG3A 1M68A 1UR8A 2OX1A 1XPGA 3U4FA 1F8MA 3N4EA 3QH2A 4O28A 1A5MC 1F61A 2ZFAA 4E3TA 3O1NA 4GO9A 1JZ4A 4MWAC 1DHKA 3DG6A 4H8HA 5DY2A 4C5ZA 4LC6A 1JCLA 1KV8A 3A21A 3R10A 2VUNA 4L5ZA 4ZB2A 2QUVA 4Q8QA 4IG2A 1AL8A 2ZE3A 3W6YA 4O13A 3M0HA 2E67A 1TPUA 2XSBA 4YYFA 2QW5A 4R7WA 2XIMA 2UY2A 4ECLA 3HPAA 1Q2SA 2BP1A 3GHTA 4OBRA 3E5PA 3OHMB 4JTAA 3UXAA 1O12A 3HURA 4B5UA 1KRAC 5AHLA 2PODA 2BTMA 4NRRA 2E7FA 2ZBTA 4L7ZA 5A8OA 5CBBA 3DIPA 3NURA 2GVGA 1TTJA 2J7HA 2ZX5A 2PZNA 3W4RA 5F4WA 4GUGA 4QLJA 3RPDA 3SIMA 1SZGA 4H6KA 3VOHA 4G1NA 1TQXA 1GW9A 2O9TA 2R94A 4RUBA 5AYZA 2FH6A 2UBPC 3UWWA 2IXVA 3I7SA 2GPTA 3LGEA 2DUAA 3S1VA 3M5YA 2QMKA 3TU9A 3C56A 2J79A 4DWSC 2BVTA 3U5UA 3FOKA 1QRQA 3BG5A 3BLPX 4H9YA 5FOOA 3CHDA 3ONCA 5FJIA 3GB6A 4HA4A 5I3GA 2DZBA 3VZZA 2NQ5A 3OA3A 1J0IA 2J13A 1E40A 4O0ZA 5LYRA 1TA3B 1UOKA 2P88A 1XG3A 3IV8A 2FHCA 1WZKA 4OHQA 3KTSA 5E93A 1XS2A 3AYTA 1LYXA 4O0QA 3ZR4A 4MUPA 4I7UA 4ERIA 3CMJA 4GHRA 5FAJA 2DH3A 3PM6A 3A13A 2DIJA 3ARTA 5DMNA 3W75A 2KAUC 1OINA 1GT8A 1T99A 4E2DA 4D6DA 4KIEA 4JN6A 3WL0A 5G4EA 5HXMA 3OBEA 1QASA 4HBKA 4NJGA 1W3JA 2P76A 4TVDA 1G0CA 4HB7A 2XVKA 4GNKB 1NDWA 3WDPP 1VFOA 5A6BD 3MMDA 3IGUA 5J5RA 4Q8TA 3CPGA 4E3VA 3VDBA 3TR9A 1XIBA 1YHTA 5FL0A 4FX7A 4CD6A 4R34A 4YCOA 4C60A 4UTWC 5CPOA 3M6YA 3LCHA 4LJ3A 3M6DA 1Z89A 1VKFA 2PTYA 1I6NA 1WDRA 3SUUA 1BTMA 3WLNA 5E9XA 4UTIA 3CTLA 3LCIA 4TV5A 4P8UA 1ZFJA 3MHFA 4QR6A 5AVHA 5U7SA 4HA1A 3RNDA 5C7VA 2BNJA 2ANUA 3VUSA 4IOTA 2RH9A 4HK5A 5HUOA 4IWWA 4PBFA 1LQ2A 2TPSA 1Y5XA 1ITUA 3R13A 1TREA 2IPWA 4W86A 2PZ0A 3G3DA 1J10A 1YRRA 1XYFA 4XUYA 3LCFA 4IPLA 2EPHA 2UY4A 3F1QA 4IIBA 5I3FA 3LOTA 5LGZA 2FPYA 4NKCA 3G1SA 2OT0A 1AG1O 1BFNA 3Q58A 2PWGA 4LVBA 4OGZA 2NV1A 5HMSA 4HNVA 3CZGA 3OODA 2YCIX 2HNHA 4QNWA 4HIBA 4B15A 1GZGA 3ARZA 4K8EA 4ZQMA 5FEXA 4V2XA 3KOZA 1Y5VA 4FX8A 3FV9A 2XZ9A 2PGRA 3EDEA 4QSFA 1JGIA 4BF5A 1V5XA 4PTDA 3WDJA 2C3ZA 1F6YA 1V0NA 2WZMA 1JZ6A 3QY8A 4M7TA 1HJQA 3EB2A 3HG4A 2BOFX 2J88A 1IV8A 4NI3A 4N9BA 2ESCA 3CUXA 3LRKA 5REQB 1HNYA 1ADSA 2E4TA 4ZQCA 5D8WA 3MP3A 1XGZA 9RUBA 4H9VA 1E6RA 3KW3A 4QLKA 2C91A 2VFIA 1XLMA 1Y8BA 2VOMA 5ABFA 1R3TA 3M4HA 4G56A 2FVLA 1EKOA 1QI3A 1FKWA 1O60A 3URAA 5HPCA 3J7HA 3WQFA 1H51A 4DAIA 3EMQA 3LBMA 2DZXA 1BYCA 2X1TA 3FVDA 4MDOA 3QLDA 4GYJA 4XD5A 3PPGA 2FHFA 3FKKA 1QBBA 4MIMA 2QQ6A 3DYMA 3S6DA 2G8ZA 1V02E 2QCHA 3BG9A 1UZ1A 2QJHA 4MPKA 4OZOA 2DZWA 3L9CA 1DJXA 4NYYA 2Q71A 3SY5A 1B3YA 3W29A 3SCWA 1TWDA 4PEKA 3N3TA 4YVVA 3V5OA 1SR9A 3DC0A 4Q4KA 3HPXA 2X40A 3GAYA 3KUMA 3W1TA 2QHAA 5GQBA 3S0CA 1TVLA 3TW7A 3AHXA 3FIGA 2OLSA 4CCDA 4IICA 1Z48A 3DYOA 1FOBA 4AQLA 5H1WA 3M64A 4IJRA 5BOEA 1IR1A 3H2OA 4P8XA 2CHOA 5EU9A 4ADTA 3R58A 5TIMA 5L9FA 2A3HA 2BVDA 1AW5A 4GFSA 4TVUA 3L0NA 1OYCA 5HJXA 3KVKA 1DQWA 1P1XA 2VT0A 3GVWA 4NJKA 1S5NA 1UUOA 3WY1A 1EWDA 4GKLA 4E8GA 2WSYA 2XM1A 4WIWA 4DI9A 3TA9A 4MLRA 1KNWA 3PJWA 4ZXOA 2Q8XA 1V3MA 3UPBA 4XBKA 1FWTA 2XIOA 1B5TA 1RBOB 2OPJA 2Y89A 4JQ2A 1YPIA 4K1GA 3TOPA 3JZUA 3RDKA 1JYVA 4ZOBA 2J25A 3M44A 1NDZA 1OD8A 1HGYA 4MHBA 1QOXA 3YPIA 3WENA 3LI1A 4KRZA 4NAEA 3B9NA 1GUVA 3ITLA 2YCJA 4IFKB 3AXIA 1A49A 3KRBA 1X6LA 2DVUA 1K8YA 1BRLA 3P14A 1EDQA 4LF2A 3PY2A 2XM2A 1QI0A 1O6IA 2VGGA 5E09A 3W82A 3UBPC 4HU8A 2NXHA 2CBVA 3S1WA 1AL7A 1JUKA 3GNPA 1F05A 1RP9A 2VD8A 3KHJA 1T96A 1SFLA 4F4RA 3FK4A 1OK4A 2VMFA 1EJVC 2R1PA 5I6SA 2F84A 2OYKA 3ITTA 3HQPA 1XDLA 4AZCB 1Q8JA 4GVGA 1J0KA 3EB4A 3VOIA 2P1FA 5CSRA 1W2VA 4XIAA 1XIEA 3T05A 5ABTA 1E6NA 4PULA 4W5ZA 4PC8A 1WUEA 4X61A 1JR1A 2HJPA 1XLCA 3O6YX 1EYEA 3QMTA 1IIGA 3D47A 4LYRA 3PF3A 4HU0A 4QQUA 3ORWA 2AKZA 1JDEA 3UNTA 5HNNA 4PMQA 2OG9A 3WZ0E 1U2YA 4GUFA 1YXCA 3DN5A 2OOGA 1PX8A 3PUGA 2C15A 4HN4A 2W63A 2QCCA 2NWRA 3ZJ7A 5EMKA 3UWUA 1QPOA 4LVDA 4UNIA 3ABOA 1KBJA 3OG2A 4LX4A 2PDWA 4LCQA 3MVIA 2GQ3A 2V30A 4AIOA 1GYMA 3EKZA 1K9FA 1TE1A 3GS6A 3B0VC 4GVIA 5JUVA 3EX4A 3BVJA 1W8SA 3CV2A 4NUWA 3LB0A 1QNPA 4AIBA 3EKLA 1H62A 4PFHA 3UG4A 1VYPX 4UOJA 4WJ8A 2WK2A 3SQLA 4FIQA 3DGRA 3GDBA 1P6WA 3PWAA 4LNCA 3UR2A 4W89A 1AQFA 2WMHA 1L6WA 5HNRA 1EEPA 3UESA 4HYVA 3B03A 3W00A 3ANVA 1EA9C 4Q7BA 3L4TA 3QVQA 4BK9A 1OFAA 1UMLA 5C2XA 1FWWA 1VFUA 2G0WA 2DU2A 3VIOA 4NZJA 2EPOA 4NP7A 1JYXA 1FFQA 1KGXA 4LB4A 4GZEA 2NT0A 5FACA 1F3WA 3NM1A 2P5NA 1R9YA 4JEQA 1LBLA 3A3WA 2QDDA 4A3HA 1MNZA 2ZKMX 1T8QA 1N55A 1GZJA 5C9ZA 5BRBA 4P5UA 3C8FA 2BVWA 4BQ3A 3E0LA 1VEPA 2ZWZA 4REQA 3TJXA 3GE7A 4OUEA 5DCEA 3VXGA 1CW2A 3T9PA 3RLVA 3GWQA 4JOMA 5AOUA 3KP1A 1K9EA 3W87A 2VO5A 3DFTA 3MZ2A 4B3ZA 4HJWA 4D6IA 1WZAA 2P3ZA 3C8NA 3FA5A 3N6JA 4TTUA 3NO3A 5K7JA 4KFPA 1SVDA 2LLEA 4I5UA 3STPA 1XF0A 2Z0IA 2P0OA 4H1ZA 3C3NA 1UWRA 3G1XA 1KKRA 2C13A 1KQYA 2XFWA 3P8IA 2ALDA 4WKAA 4M8UA 1MW2A 1C8QA 1OCBA 2DIEA 2XH4A 3AIQA 3MCMA 4GJJA 3RG6A 1Q85A 1BVWA 2QXWA 1UKSA 3B04A 3ZR5A 3H8AA 5CZ0A 2Q6ZA 4AZIA 4AUBA 4PTMA 1V77A 4JTDA 3IRSA 2WJZA 2YA2A 4G5DA 3B9AA 3MJYA 2HVMA 2OQYA 1PCKA 1MWOA 1VB9A 4ZOCA 3LBCA 4ILSA 3CV6A 4HT3A 2H6RA 3PBWA 3CHVA 3ZYZA 3N04A 3TXVA 1E6PA 3LDVA 1H7OA 4LAZA 4HGXA 4I6VA 2H8XA 3QSTA 2BY3A 3KXQA 3H2AA 1OK6A 3NXLA 2ATSA 3N25A 1KCZA 1UOZA 1MEIA 5B7YA 3CIXA 3UJEA 5M17A 4LUYA 2ZRXA 3GG8A 4G9PA 2GGHA 4BS0A 3HMCA 2C14A 3WLKX 4ALDA 4H6QA 4BQ2A 3NFUA 4J9JA 3GDTA 1KBBA 1F6KA 3ZR6A 3DHFA 1FWJC 9XIAA 5CGTA 2Z1VA 4PMOA 4TQTA 1MO0A 2X2YA 2X0HA 3T4CA 1VAHA 1W9XA 3LG3A 4PRWA 3TSMA 3B8UA 3MZNA 3A23A 5D9MA 2BG5A 3T09A 3M43A 4L6HA 4WK9A 2VVSA 2ZUTA 5C0QA 8RUCA 1GJWA 2VURA 3R5EA 1WKDA 2A5HA 5D2XA 1IT0A 3DFYA 1LF1A 3TP4A 4JTHA 3WMLA 4AXNA 1AQHA 1G69A 3CUGA 1R46A 4C1NB 4V27A 1H7XA 4XB3A 3VZXA 3R94A 4Q6XA 3WQ4A 1MUCA 4INFA 3A47A 4MKNA 3WQEA 2X1RA 1J5SA 4FLRA 4HPHA 2B4GA 1K02A 3R6IA 1QW7A 1CLVA 4GI6A 3E0VA 1RD6A 2HPIA 2X1IA 5LIYX 4DPPA 1ITCA 3TW6A 4W7VA 1U22A 1DVJA 3N2CA 1W8GA 1QK0A 3SCOA 4IL2A 4IMGA 4WGHA 4GZJA 8A3HA 1JJKA 1SJBA 3W23A 3GNXA 1U5HA 1WDQA 3WNNA 3TMLA 2Y5JA 1IYXA 4PCTA 1ZLPA 1NQKA 4DM2A 3FSUA 5HJLA 2FIQA 3KP0A 2EF9A 3KOYA 4NASA 1CB2A 2PDCA 4EXBA 5C2CA 3DFQA 2F38A 4DIAA 1YE6A 1YE4A 4PMDA 2YGYA 3V0UA 5AHNA 3IJ8A 2ZX9A 3CIWA 5FEPA 3KVLA 3REQB 1L2QA 4GIYA 3G1FA 1DBTA 2BY2A 4YYCA 1XIFA 4HMCA 1XG4A 4GNJA 2W3ZA 1DHPA 2VNCA 3NAVA 4XZMX 4ML4A 2UY5A 4CD4A 5FEWA 3BANA 4JHZA 3WQOA 1FY6A 3EDDA 4BI5A 3E0WA 5CC7A 3AUOA 3WUEA 3NOYA 1DXFA 3TTQA 3I3EA 2VC6A 4A3RA 3CO8A 2W27A 2FKPA 3W7QA 1NP2A 3LPFA 3HGRA 2DZTA 2PP1A 3KRZA 3PTDA 3ZJKA 1PEZA 3ZS4A 2DT3A 3N2TA 3CU2A 3ZOAA 4DUWA 3BZGA 1GYLA 1E56A 2D20A 3EWBX 2OFJA 3N13A 1HXJA 1FWFC 1FP8A 5CXPA 2E9MA 2PGEA 4ENLA 2WJEA 2QAFA 1O7AA 1CEOA 1JD9A 1M9HA 1VHNA 1Q6CA 1Y5WA 4CN6A 5I06A 2C0AA 4UUIA 5F2GA 2DP3A 4RLIA 4XUGA 4PSRA 1IWAA 2FB2A 3KAOA 4F0KA 3EKGA 7REQB 1EHAA 1DWIM 3CUFA 2ZQ0A 1KM1A 2FVKA 3DEQA 4XVDA 3UQNA 3COTA 3TXZA 5CAKA 1NELA 4A22A 1QJWA 3SSJA 4PYSA 3CZJA 3GFXA 1TPC1 1OY0A 2Z7KA 1I9CB 1UBSA 4J27A 3DKJA 5CPTA 3PN8A 3NQGA 4AAJA 4B92A 1OGGA 3VOGA 2YDRA 3FY1A 1P7TB 1KFLA 1UR2A 3OZPA 3WSUA 1I2RA 1YTKA 2VRQA 1UD2A 2QCMA 3KBWA 4GK8A 3N2XA 2PDBA 4S3EA 1RJRA 3MANA 3WQGA 1VFTA 3IS4A 4JX6A 1Q7ZA 3MP4A 2A6NA 2QUUA 1NOFA 2XFYA 5JH2A 4MF4A 3NGJA 1FWSA 4DO5A 4POCA 2B0MA 3JR2A 3UG3A 1J0JA 1OB0A 1RCXB 2CLLA 4QIUA 3C2FA 4QCEA 4D6GA 3O6AA 2PBOA 2IMRA 1W1A1 3SN4A 1S5TA 2GZXA 3CQKA 5K2ZA 2WKLA 1ICSA 1CPUA 3PR2A 3T08A 4QNEA 4AZBA 4JQ4A 4O52A 3OGSA 1BGGA 1SJAA 1BSLA 5CJNA 3BGGA 2XVLA 1F2JA 5CSSA 1UJQA 1NFPA 1HP4A 5IDIA 4Z1CA 3QV7A 5CBIA 1OWQA 1PKYA 9XIMA 2WSRA 3RGTA 5CZJA 3WDQA 3PANA 3NQEA 1CT5A 5KZMA 4KBXA 3SW6A 3IJ6A 2Y70A 3K4WA 5D37A 6XIMA 1QT1A 4V1XA 4ZVJA 2YBTA 2R1NA 4I5XA 3ZVHB 1J0YA 4XKMA 1S3HA 2JBMA 3BMXA 5C71A 1FH9A 4P7OA 5FJOA 2D3NA 5CZSA 1VCVA 1NAL1 3UYCA 2YXXA 4JTUA 4WDTA 1BD0A 1PWMA 3PZ9A 1TA3A 3M5ZA 3V5CA 3WJZA 3BAWA 3VM7A 1XRFA 4B5NA 3GDLA