1I1XA

1.11 a atomic resolution structure of a thermostable xylanase from thermoascus aurantiacus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
302
structure length
302
Chain Sequence
EAAQSVDQLIKARGKVYFGVATDQNRLTTGKNAAIIQANFGQVTPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIRGHTLVWHSQLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVNEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYINDYNLDSASYPKTQAIVNRVKKWRAAGVPIDGIGSQTHLSAGQGASVLQALPLLASAGTPEVAITELDVAGASSTDYVNVVNACLNVSSCVGITVWGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermostable xylanase from Thermoascus aurantiacus at ultrahigh resolution (0.89 A) at 100 K and atomic resolution (1.11 A) at 293 K refined anisotropically to small-molecule accuracy.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
total genus 120
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1i1xA00
2WW5A 1QBAA 1F4HA 3AHZA 4MPKA 1E3ZA 4QP0A 4AYSA 3RDKA 3MSGA 1HXJA 1UHVA 1VEMA 4OZOA 2WXDM 4GXPA 2CPUA 5JBEA 4U2ZA 4JHZA 4Y7EA 2WNWA 2J8FA 4D6JA 2FGLA 1BTCA 1WNOA 4X0VA 3UERA 3M7SA 3WUEA 4OBRA 3UR8A 3WQ8A 5BXRA 3A3HA 1PIGA 5HBFA 2XGIA 5C71A 1E4MM 3WFZA 2Z1KA 2D22A 3GXDA 3AHVA 2Y2WA 1GVIA 1TVPA 3SUTA 1ZJAA 2E0PA 5BXSA 5E0CA 3MSDA 4U5IA 2V3EA 1C7TA 4Z2KA 3WD3A 5FIPA 1XRVA 1UQZA 4OJYA 4CN1A 3PZQA 4KRTA 3VGEA 2D3LA 1W3KA 4U31A 1BF2A 5CSYA 1IT0A 3CZ8A 1KXHA 4D71A 1XC6A 3AIBA 1JZ4A 2WK2A 1E4LA 1JF5A 1UD6A 5CG0A 4MDPA 5I79A 2HISA 1W2PA 4MB4A 3SUSA 2QMKA 4HZ8A 2J74A 3NDZA 3B9EA 2OYLA 3CUHA 4BS0A 4CCCA 5A6BD 4B3LA 1OGBA 1WB0A 3CUIA 4AD3A 4D1IA 2GDVA 3FAWA 2O9TA 3IK2A 2YDRA 3WD0A 3WF3A 2UY5A 1NP2A 1DWJM 5E6YA 5C8BB 1QHZA 3M46A 1LQ0A 4UQDA 1ZBCA 2W91A 2WM0A 1CBGA 3FHAA 2VVSA 3ARUA 2O9OA 4MNLA 3PZIA 1VEOA 1J11A 5D9NA 1UKQA 3CHCA 2Y4SA 2CNCA 2QLYA 2WC4A 3CO4A 3FNDA 1G0CA 3WQWA 3F5JA 5DO8A 1DWAM 5A2BA 1E1FA 5IDIA 2OYMA 2WZEA 4DWSC 4GIAA 4EKJA 3W37A 2CBUA 2GJXB 1JDCA 4E8CA 1FH8A 4H04A 3WL1A 2YBUA 1N82A 3THDA 1LL7A 5BXTA 3ARZA 5DMYA 3IJ8A 4HPGA 3BH4A 3BSGA 4V28A 3BAXA 2X09A 3KEHA 2J4GA 2UY3A 1MW1A 2DIEA 1O7AA 1H0GA 1XGZA 1B30A 3WH5A 1MFUA 3TTQA 5AYIA 4PTMA 4FK9A 4KH2A 4EAMA 4E8DA 2J47A 2CETA 4P7QA 4N42A 1OM0A 4WKFA 1GOWA 3SIMA 4AD1A 3FY1A 4F79A 5BXPA 1TG7A 3WD1A 2CBIA 2WC3A 4WJXA 3F4VA 3MMUA 5ABGA 4LQ1A 3THCA 3VD3A 4GKLA 4P7LA 5A8QA 4HA4A 3CPUA 3RO8A 3L2LA 1W32A 4LGXA 5I77A 2ZX9A 1KR1A 1OIFA 1C92A 2D3NA 1RP8A 2J79A 4YN5A 1EDQA 2CYGA 5F7UA 2ZX7A 3QHNA 3WUGA 3SUVA 3WQ5A 2YDSA 3BAYA 4ZE4A 2BNJA 1SR0A 2MANA 1MXGA 1GJUA 2X2YA 3VGGA 3D5HA 1VAHA 5ABFB 3UG5A 3L4WA 3VM7A 2J8GA 1XH0A 2E40A 3TONA 3AS1A 1R87A 1IZJA 5HXMA 1XHGA 4OOUA 3VMNA 1C90A 1JZ5A 3LPFA 2CCRA 3F5LA 4HU0A 4WIWA 2CKSA 4FLRA 2EPOA 1Z32X 2JFEX 2BXYA 4OUEA 1JL8A 1KR0A 2WPGA 4ZXLA 4W89A 4M82A 4MNJA 4C7FA 1HT6A 2CHNA 4CU8A 1QI2A 4P7NA 4UQCA 1GCYA 2G3MA 3QOKA 3OGVA 5GNZA 4JHOA 2WHJA 2PWHA 4M8UA 3BCDA 1V3KA 1WP6A 3AQUA 3CUJA 3MANA 2YBTA 4LPCA 3EYPA 1MVYA 1UWRA 3APGA 1WE5A 2GFTA 4Z2GA 1CECA 5LA0A 1V02E 1JAKA 5LYRA 3AZRA 1H09A 3L4YA 1ISVA 3KE0A 3VILA 1BYDA 1UKPA 3K46A 2O9RA 3D3AA 5DF0A 1KB3A 4JCLA 3ZMRA 1GQKA 1R7OA 2OSYA 4E2OA 1CXEA 1EXPA 1NWRA 2QF8A 4P8UA 4JAWA 2VTFA 3WSUA 1DWFM 3IANA 1WPCA 1TMQA 2Y8VA 4GZEA 3K8KA 2YL8A 4YHEA 7A3HA 5AYBA 2VT0A 4MNMA 3CHEA 5I0DA 3A6OA 3AICA 3VGBA 4D6CA 1MFVA 1KXTA 4OIFA 1LG1A 2YL6A 3G6LA 4X0NA 1WZLA 1MXDA 2FH6A 2CBJA 1QOXA 2J7BA 4A3YA 3S6TA 5AY7A 1OGGA 1H0IA 1UKTA 1PZ2A 3AMCA 2ZX8A 4TVUA 4MAVA 3MMWA 4V2XA 2E9LA 4H41A 1G01A 4UQAA 1F4AA 3EDKA 4HP5A 2D23A 2DT1A 4QCFA 6TAAA 4AZHA 2PBGA 1OINA 4Z2LA 2VZVA 5HPCA 2NT0A 4UZSA 2DSVA 3WH7A 1WDSA 3DYMA 2DT3A 2VJXA 5GNYA 3WNMA 2YL9A 1SYTA 4DUVA 2UWFA 2J7EA 3DECA 1Q4NX 1MQRA 3SCSA 2F61A 2ZUWA 3ZJKA 4D6IA 5EBAA 4P7RA 3AIUA 3GNOA 5M17A 2E9BA 4BZYA 4Z2JA 1YQ2A 3AXHA 1B31A 2WVSA 4WKHA 1W3JA 2VCCA 3L4XA 4BQ4A 4AIOA 2CERA 1JZ7A 5A6BA 2VR4A 2YDQA 2ZUUA 5JIWA 3BMVA 4KRUA 4R27A 5DFAA 4HMCA 1E43A 2BVTA 2WCAA 3OIHA 3T0AA 4J3SA 1ISZA 3UR7A 2DSWA 5D9PA 3DHUA 1UD2A 5ECUA 1TZ7A 1VF8A 3GXFA 2XTKA 4CU7A 1ZU8A 1BG4A 4PTWA 5A8PA 4PMUA 5GNXA 3CMJA 3CLWA 4H8VA 3AIRA 1L8NA 4MAZA 4PEEA 2BV9A 1C8XA 4J28A 4W8LA 4F9JA 4ZENA 3VO0A 4DUXA 1J18A 2XM1A 3GBEA 1VEPA 1E6SM 1H41A 4JZ5A 4OKDA 2VZTA 4X9YA 1TUXA 4D6GA 5IFPA 4JFWA 3VNYA 2XSAA 1PZ3A 1VRXA 4PMYA 3CZGA 3AIVA 4W7VA 2VO5A 3AMGA 2YKKA 3AIEA 3MMDA 2JF7A 3EMQA 1D2KA 5LA2A 1B2YA 2A3CA 1UH3A 2WHLA 1BLIA 1XSJA 4M56A 2G41A 3KL3A 2ZUTA 3VD7A 2BY1A 3WN6A 1DWGM 1CGXA 3AZSA 5BRQA 3N18A 1E3XA 5A2AA 1NH6A 1PBGA 4HMDA 4QLKA 1UA7A 4PMQA 1CNVA 2VL4A 2G3NA 1A3HA 4TTUA 5M3WA 5GPRA 4PMNA 1OT1A 3NDYA 3BAWA 3CGTA 3WENA 3PTKA 2W62A 3K4AA 4WKAA 3OBAA 5BRPA 3EDEA 1KGUA 2XGBA 4BQ2A 2NT1A 4W8AA 5AC4A 8A3HA 1HIZA 4F66A 3L4TA 1EDTA 1HJUA 2GK1B 1UWIA 1UWSA 4LX4A 4AZCB 2ZX5A 1GOIA 1TVNA 1HVXA 2J78A 1PPIA 1E6PA 2J7CA 1EQCA 3VIMA 4MDOA 4W86A 1GHRA 3CTTA 2NW0A 3OZOA 1GVYA 3WF0A 4JFSA 1RPKA 2J25A 4U3CA 3VIKA 1KWKA 3T0BA 1CENA 2W4XA 3WUBA 5ABEA 1W1PA 4EANA 3O9NA 5CQ1A 3WL0A 5CPSA 2X8RA 4W5UA 3BMWA 4UR9A 2O92A 4F9DA 2CBVA 5I23A 1Q6EA 1LWJA 1VFMA 5A6KA 1Q6FA 1B1YA 2WAGA 3VMPA 1CDGA 1E0XA 2WMIB 4PUDA 2DGAA 3FXYA 2WZHA 1FP8A 2J7DA 1M01A 3HJEA 3A47A 4KGLA 4HOWA 5I24A 1QNSA 5TD4A 3SEPA 4BQ5A 1OT2A 4PMDA 1HKMA 3AMKA 2XVLA 2B31A 3AXIA 1E15A 2FGZA 4AW7A 3WKZA 2C7FA 1K9FA 3AHXA 3QHMA 3WDIA 3WEZA 1UKSA 5A3HA 4LYQA 5IXEA 2ZIDA 5EB8A 4UFIA 2XWDA 1V3IA 2X0YA 1A47A 3VIIA 3BCFA 4PBGA 1CPUA 2J77A 1FOBA 2EPKX 4GO9A 4W5ZA 3A4AA 4QAWA 2ZXDA 4FLOA 5A6LA 1HJQA 3VGDA 1NQ6A 2BVYA 5LA1A 1NOUA 2CHOA 4TUFA 1CGVA 2GUYA 1HN1A 4GPNA 1SFSA 2XSBA 3AIQA 1WCGA 4D6EA 3TTOA 2D2OA 2WANA 1JZ3A 2F2HA 1TR1A 2XVNA 1E72M 5KZ6A 3CHFA 3WF1A 4UOJA 1OCQA 2TAAA 4W7WA 2EBNA 3WMCA 5I2UA 1CIUA 3UEQA 2WMHA 2YIHA 4RE3A 2PWFA 4XX6A 3WFLA 1UR8A 2PC8A 3BLPX 1JD7A 3II1A 5ABHA 1RD6A 1NM9A 2W61A 4H7VA 3VDCA 3EDDA 4UFJA 4F8XA 1JFHA 5HPOA 5BWFA 2A3AA 1EOMA 4CD4A 1JD9A 3CZJA 5EFDA 1W9UA 2JIWA 3IAPA 3MV01 4KWUA 2F8QA 1FHDA 3ALFA 3VD9A 1VBUA 3FAXA 1PAMA 1V3LA 1UD3A 1I75A 3T08A 4PCTA 4TVCA 5CSUA 1QHPA 2RGMA 1UA3A 2YLLA 3W29A 3SCPA 1JZ8A 1KBKA 4AZBA 5D4YA 2Z1SA 3ARQA 5E0FA 1WKYA 3WNPA 4A4AA 4CVUA 1EDGA 5A6MA 4BQ3A 1UQYA 1VFFA 1BVNP 3AFBA 1TFVA 4IPNB 2XIBA 4AZIA 5FL1A 1E56A 1E4NA 3WF2A 1Y7VA 2ZXAA 2ZUSA 2WWDA 3ZJ8A 2D0FA 2A3BA 2QHAA 4Z2HA 3KL5A 1LL6A 3DC0A 5BCAA 3FN9A 4UOQA 2WLYA 4ACZB 2VUYA 3FW6A 3GBDA 3WBAA 1WZMA 3ZT6A 4IPLA 2WB5A 2WKLA 2FHCA 5FL0A 1H49A 2D20A 4LYRA 1W3HA 1X1NA 2GK1A 3DYPA 3W38A 5IFTA 1C7SA 4ACYA 2FDMA 3ARPA 2BFGA 4AZ7A 4MJ2A 2BXZA 1UR1A 1GHSA 1AVAA 1Q6CA 2BHZA 5A8NA 1JZ6A 3CZEA 4QLJA 3W81A 3WBEA 6A3HA 4ML4A 2WMJA 1UZ1A 4AZCA 4U2YA 3OLEA 1R8LA 2WC7A 1V6UA 1K6AA 4B16A 1V0MA 1US3A 1UZ4A 3L4ZA 4XUYA 3A4XA 4AD5A 2XYLA 4U3AA 1E5NA 1QI5A 3W53A 3IAQA 3W82A 1NOWA 3ARXA 1V6WA 3PZGA 1UD4A 1EQPA 4E4PA 1Q6DA 3RM9A 4AWEA 1E73M 5A8OA 1BQCA 4ACZA 1HKKA 3RPMA 2OLHA 4ZXOA 1V03A 2DQXA 2ZXQA 2O9PA 3WQ4A 3BXWA 2ZUNA 3EDFA 3DHPA 3WY1A 5I5RA 1S46A 3WH6A 3GDBA 2ZUMA 2XFFA 3VM5A 3CHDA 1WO2A 2E8ZA 4W84A 1C93A 1DHKA 2OYKA 2YLAA 1M7XA 3F5KA 2XG9A 3NCOA 2VZSA 2C0HA 3GXIA 1CYGA 3W24A 5DT5A 1B3VA 3CH9A 4UFKA 3MO4A 3MS8A 3ZJ7A 1UWQA 1SMAA 2DSUA 1GONA 1L0PA 3RCNA 2WMFA 1GOKA 1AQHA 1FA2A 2BY0A 3T2PA 5CPTA 1B3WA 2JF6A 4PUEA 5FCZA 3UG3A 2UY4A 1D3CA 4GO8A 4MJ4A 3FHQA 5A95A 4XZWA 3N9KA 1ZB5A 2GSJA 3WH9A 3MUZ1 1KQYA 2DDXA 4JIEA 1E9LA 3W6MA 3WF4A 1XV8A 1GOOA 3OLDA 1E6QM 1PEZA 5JBDA 1MWOA 4AZ5A 1J0HA 2V5CA 1PX8A 2WSKA 3VDAA 1QPKA 1U33A 2J7HA 2WVVB 3WDPP 3BC9A 3GYCA 4U5KA 2WCGA 1QI3A 4WSKA 2QPUA 1K9EA 1B3YA 1JYXA 4BF7A 1UR4A 2XPKA 1V6YA 2VX6A 3WDRA 3U57A 4UFMA 1BSIA 5JUVA 1E71M 3WDJA 3LPPA 1CXIA 3UG4A 2DIJA 1BG9A 2V3DA 1NOFA 2VX7A 1SMDA 1H4PA 1CTNA 1V3HA 3PZTA 1DWIM 1JG9A 4HPHA 3RM4A 2V3GA 4J3UA 1R85A 1V6VA 4H8UA 4UQ9A 3RJYA 1LL4A 1OB0A 3VX0A 4CGTA 3POCA 3CBWA 3WQVA 1UWTA 4AD4A 1AMYA 1OGSA 1W9PA 2ESCA 1W9DM 4ZFMA 1GQLA 1BYCA 3PZVA 1ODZA 2VVNA 1MYRA 5A8MA 3BLKA 1PX4A 2X1IA 4RL3A 1BGAA 2A3EA 2JE8A 5C70A 2VCAA 5FOOA 1RH9A 1MW2A 2V3FA 5A6JA 4H2CA 1D7FA 3WEOA 1OIMA 4K68A 3VKKA 1I1XA 2XVPA 3PHAA 2JEQA 1V0KA 2VQTA 1BHGA 3PTQA 1XYZA 3W6LA 3EMCA 3WD4A 4PMOA 3GZAA 1C3FA 2VOTA 4Z2IA 1GOQA 1KGXA 3U7VA 4PSRA 1KFWA 1VBRA 2VX4A 3I3BA 2JALA 1CLVA 2J7GA 3VX1A 4HU8A 3GH4A 1CGYA 2EPNA 4L4PA 4URIA 2G3IA 4NZCA 2E3ZA 4CKQA 4P8WA 3MUIA 4TVDA 1UR2A 3KZSA 1J0JA 2UY2A 4DWSA 4GI8A 4JCMA 1US2A 1JYVA 4M80A 3SCQA 1ISYA 5I3DA 3WNOA 1EH9A 2YL5A 1CWYA 1G5AA 1E6XM 3VPLA 3OG2A 1BVZA 1R86A 2EEXA 1KWGA 4AMCA 3T0DA 1JNDA 4JFTA 1JAEA 2DEPA 4BA0A 3CUGA 4R5EA 2G4FA 2XHYA 1E6RA 2CEQA 1WZKA 1GW1A 2EJ1A 2W67A 3ZQ9A 4HA3A 1ZBVA 2FHBA 1LLOA 3HU7A 3AHYA 2BY2A 1X6LA 1HJWA 4DWSB 1MQQA 1B9ZA 3PZOA 1E6NA 4DM1A 2WHKA 3WELA 3RIKA 1C91A 5D9MA 4NRSA 2YA0A 1OWQA 1FFRA 1TE1A 4AIUA 2E8YA 3ARTA 1KQZA 4AEFA 5FD0A 2EO7A 2X05A 4PMZA 4J7RA 3VIOA 5CLWA 1W1YA 2XVGA 1LG2A 5A6AA 2ZWZA 3L4VA 3N17A 3OGSA 2AOSA 4AEEA 5A2CA 3VTRA 5M03A 4M1RA 1K9DA 3UCQA 2EPLX 3TTYA 4AZ6A 3PZUA 2PI6A 3ARYA 4ATDA 1V08A 1QW9A 2WYSA 3ZT7A 5IHSA 1W9VA 3AHTA 1FHLA 4UCFA 4NI3A 4LYPA 1CZ1A 4UQEA 4QFUA 1QNRA 4W93A 5E09A 4ZEPA 2JEPA 2WMIA 2PWDA 1CLXA 3N1AA 2ZWYA 2DPEA 3AOFA 1CGWA 2Y8KA 5BROA 2WBKA 1H5VA 3ZM8A 2DSZA 4AD0A 3BGAA 1KCLA 2ZUVA 2WVUA 1J0ZA 4UNIA 2CESA 1WZAA 2NSXA 2VC9A 1M53A 3SCUA 1JI1A 1UH4A 3SCWA 2J75A 3S2CA 5CZKA 1VFOA 4M24A 4PYSA 1YHTA 4CD6A 3N11A 2JIEA 1V3MA 4AC1X 3WDHA 3TA9A 1QVBA 3AXXA 1ZS2A 3BAJA 3TP4A 1HL9A 5CJ5A 1BAGA 2J7FA 3PZ9A 2OWCA 2W63A 1CXHA 3W4RA 1J0YA 1Q6GA 2W5FA 3ZR6A 1E0VA 4YHGA 4TTGA 1QNQA 3N15A 1XCXA 3AROA 2E9MA 4MNKA 2IXUA 1KBBA 3K1DA 3TTSA 2QPSA 1BGGA 2BY3A 1LF1A 3ZO9A 3VGFA 3T2QA 5I6SA 1E1EA 2VZOA 3AYRA 4GI6A 1QI4A 3SUUA 3VDHA 2AMGA 3PBGA 3AMLA 3PN8A 3ECQA 4JFUA 3WDQA 3WMSA 2CKRA 2IUZA 4HMEA 3VUPA 3NYDA 2OWWA 2XFYA 3OLGA 4J27A 2BHUA 2OWXA 3O6AA 4OBSA 1XSKA 5D8ZA 4PCSA 2W66A 2XFRA 2G3JA 3NUKA 2WSPA 3AS2A 3VOCA 7TAAA 4B3KA 3AISA 4RE4A 5JIPA 3KWXA 4AIEA 4UOZA 2D1ZA 4IM4A 2XJ7A 1ECEA 2E4TA 3QOMA 3E1F1 1UH2A 3WIJA 1DEDA 4KGJA 1GQJA 3VIPA 2GDUA 5KEZA 3L4UA 5CGMA 3RJXA 4HOXA 1ZBWA 1FH7A 2CITA 3CMGA 1E5JA 2GJPA 5HOSA 2EQDA 1JGIA 1XD0A 1CEOA 4BCEA 1DWHM 4NSBA 5I78A 1BPLB 1VENA 1EO7A 1J9YA 3NIYA 1QHOA 3VU2A 3OLIA 2VMFA 3ARWA 3EDJA 1EGZA 1H3GA 1NWUA 2YOCA 4UTFA 2XM2A 1EOKA 1LWHA 3W26A 5FKYA 4XB3A 3GXMA 4H8HA 1J01A 4TXEA 1HVQA 2A3HA 1MW0A 4ZE5A 4D72A 2VRQA 2D24A 4AISA 2V5DA 4V27A 1ISXA 2WWCA 3MU7A 2VQUA 4QDMA 1CGUA 1NWSA 1W91A 5CGTA 9CGTA 1B0IA 2DT0A 1JFXA 3N04A 1W3LA 4B15A 4D6FA 1O6IA 3DYOA 4GQQA 4FLSA 4XV0A 4W85A 1I1WA 1TA3A 3AJ7A 1EA9C 4CCEA 1W9XA 5M5DA 1FFQA 1UYQA 2QMJA 3SCVA 4S3JA 4HZ6A 2FH8A 4TX6A 4J3XA 4KMQA 4PTVA 2WZIA 3VVGA 5D9OA 1WDRA 3GTNA 4WF7A 2HVMA 3VGHA 1E70M 2VCBA 3KL0A 2BHYA 1JYWA 3N13A 3T2OA 1UUQA 3AMDA 3ZSTA 2AAAA 4Q7NA 1HP4A 3LPOA 1OD8A 1UG6A 3MUY1 1CXLA 4JFVA 1E4IA 1W9BM 4CD8A 3GM8A 4AY1A 3VIHA 3AS3A 3VINA 4WSJA 3W0KA 1V3JA 1UWUA 5GQBA 3TOPA 3AIWA 2X0HA 1BFNA 4GQRA 3U5YA 1JI2A 5ABFA 3NJ3A 2VNCA 3IJ7A 4EE9A 4JKMA 2WCSA 2BVDA 2VR5A 5EMYA 4OOZA 4ATLA 3SCOA 3QHOA 2DH2A 1XCWA 3UESA 1MQPA 2IXVA 3ARVA 3CIVA 4L4OA 4HOZA 1WDQA 1XD1A 3OA5A 1CGTA 4PTXA 4GZJA 1R7AA 3GH7A 2WVTA 2PB1A 4M29A 3T09A 4JL1A 1H2JA 5A1AA 1KXVA 1WAWA 5E70A 2V38A 1J0IA 1G94A 1ZJBA 4TX8A 2ZX6A 1U30A 1JNEA 4AZGA 3HN3A 4C7DA 1JYNA 1G9HA 2XVKA 1UOKA 3VIFA 4W87A 1GUVA 1RP9A 1HF6A 3RILA 3WNKA 1ODUA 4CD7A 4A3HA 1J12A 2PBOA 1JDDA 4HA1A 2VURA 1LJYA 1MW3A 2DT2A 2PWEA 7CGTA 4P8VA 1JXKA 1B3XA 3ZSSA 3AI0A 4UZUA 2XUCA 1FP9A 2BS9A 3LMYA 5A69A 4YPJA 4DUWA 1QBBA 5E6ZA 2XIIA 4WK9A 3RMEA 4PSPA 5DEZA 1KXQA 2WBGA 1GQIA 1VB9A 4DWSD 1TA3B 1GJWA 3BAIA 4UQBA 3QR3A 4AXNA 4MTVA 3AYSA 1E6ZA 2VZUA 4D6DA 2VX5A 1XH1A 4CVWA 1J10A 4MB3A 4UFHA 3JUGA 3NSMA 3POHA 3ZR5A 1BYAA 4DM2A 8CGTA 4CD5A 1NWTA 3WMBA 4MADA 1UR0A 1G1YA 5CLTA 5CPQA 1P6WA 3CZLA 1TCMA 4PRWA 1HJSA 2VRKA 4W88A 4P7OA 3ZOAA 1ZL1A 5E9AA 3ZT5A 3B9AA 4W7UA 5HNNA 1HL8A 4CU6A 3GNPA 5JBFA 3WH8A 1B90A 4GZIA 1E0WA 4LXFA 3ZIZA 3SCNA 3ZJ6A 3I3DA 2DH3A 3GNRA 1IV8A 4Q22A 1JF6A 2WLZA 4J3VA 1VJZA 5A94A 5DT7A 3ARRA 1HJXA 1XSIA 5BYWA 1H1NA 1EHNA 1GOMA 2WKGA 2EXOA 1ITCA 4MB1A 1C8YA 3B8SA 1X6NA 5A6SA 3BAKA 3L2MA 2VI0A 4FF5A 1GNXA 4MB5A 3QGVA 1E40A 3GH5A 3PZMA 2Y24A 4QLLA 1V0LA 3A4WA 3SUWA 3W25A 3MV11 1M04A 1J0KA 3AS0A 1PIFA 5EFFA 3O2LA 1UD5A 2VRJA 4GI9A 5CXPA 3VD5A 4AD2A 4C7GA 3PZNA 4JL2A 2PWGA 3UETA 4CUCA 1XYFA 2FHFA 2ZXBA 4FMVA 1KCKA 1HJVA 1IZKA 3MUAA 4J3WA 2WMGA 3CUFA 4IUGA 2RGLA 1UR9A 1EHAA 4W8BA 4EK7A 1GPFA 1V02A 3EBVA 1CXKA 4PN2A 3N12A 4HZ7A 5AC5A 2PF0A 3IJ9A 3RM8A 3WEMA 4CN4A 2C8NA 2GJRA 3CZKA 1B3ZA 1DTUA 4QCEA 3M6DA 3WQ6A 2ZICA 1PX3A 4GINA 4D1JA 3WD2A 4UFLA 3SCRA 1E55A 4RE2A 1V6XA 4WLCA 3NSNA 2WVVA 4M81A 1UD8A 1VIWA 3WNLA 1ZBKA 1OBAA 1BYBA 3W27A 4TOQA 2ZE0A 3HMCA 3J7HA 1HKJA 5IHRA 1ISWA 4U33A 2J62A 2WHMA 4N0RA 4P8XA 1H11A 1ESWA 1AQ0A 3U5UA 1NARA 3ALGA 4PMXA 1NP0A 2CXGA 3BSHA 3U7BA 1U2YA 3VDBA 1C8QA 2W92A 4D6HA 2OSXA 2WMKA 3VNZA 3K8MA 4NRRA 1QI0A 2G8ZA 1GORA 4PMVA 1HX0A 1OSEA 4CCDA 4J3TA 3W28A 1EIBA 1JXJA 1W1TA 4FLQA 1JIBA 1HKIA 5D8WA 1QNOA 1W2VA 2XWEA 3OZPA 4JKKA 1QNPA 2QV4A 4S3KA 3VMOA 1HP5A 1V0NA 3SURA 3K8LA 2Q8XA 1EO5A 1AQMA 2YA1A 1XH2A 1PJ9A 1VJSA 2D0GA 2YA2A 3PTMA 2ZOXA 1M03A 4ATWA 3I3EA 1HNYA 1OD0A 3B9DA 1JDAA 4PMRA 3OB8A 1VFUA 1QW8A 2YJQA 1WDPA 3VIJA 3VIGA 2DSKA 3OGRA 3AZTA 3SCTA 6CGTA 3NSXA 3VD4A 2D0HA 2OSWA 1DP0A 4B9ZA 3G6MA 4IISA 3WUFA 1W1VA 1K9TA 4NF7A 1KGWA 3LPGA 1FH9A 3MKKA 4JKLA 1CXFA 3M07A 2CIPA 3ARSA 2GJXA 3WNNA 2Y5EA 4B9YA 1JZ2A 1ITXA 5HDRA 4CN6A 1GZJA 3EMZA 2GVYA 2EPMX 4HTYA 4XZBA 3K4DA 1UKOA
chains in the Genus database with same CATH superfamily
2Z2BA 3GTHA 3LDVA 1HXJA 4LS2A 4JTJA 4LAKA 5JBEA 1M65A 2MNRA 4NAEA 2WNWA 5FJPA 3WBXA 1M5WA 1BTCA 4X0VA 2Y85A 3WUEA 4OBRA 1MDRA 1PIGA 4K38A 5LNSA 2XGIA 1E4MM 3WFZA 4IMEA 3C0LA 2G50A 3MYPA 1EZ2A 4NKCA 4LC8A 1XR2A 2VHLA 3MSDA 4JEJA 2V3EA 5FIPA 4DNMA 5LNRA 3LQGA 4KRTA 1W3KA 4U31A 4YYCA 2F7FA 4KCTA 4NNBA 1DPMA 2OZ0A 1IT0A 1QDSA 1KXHA 4D71A 3AIBA 1SJBA 1JF5A 4L1XA 2HISA 2Y62A 5DCBA 4NZ1A 3BUVA 2QMKA 3ELFA 1VJIA 4KWSA 4L9XA 3B9EA 1K7FA 2OYLA 2DZXA 3FSTA 5FI8A 4ZA0A 1M3UA 3CUIA 4AD3A 3H4XA 2O7QA 1KCXA 2YDRA 3F03K 2I57A 5AFDA 4FPSA 4JX6A 4UQDA 3R94A 4Q6XA 3FHAA 2OGJA 4LT9A 4JIIX 4ZCWA 2IKIA 1UKQA 3FJLA 3TC3A 3VOFA 3NQMA 1W31A 2WC4A 5DXYA 1OADA 2BGNE 3LZ5A 3PWIA 1OC7A 5FAGA 3T78A 3UYCA 3NPWA 4GA8A 4BF9A 5IDIA 2HPMA 2OYMA 4EKJA 2VGIA 4GNJA 2W3ZA 4MZ1A 1TE6A 4AVOA 1N82A 1LL7A 2P50A 1XS2A 4Q3MA 1IF2A 1OYAA 3BH4A 3BSGA 1J5SA 4V28A 2IPJA 3N29A 2X09A 5G1YA 2UY3A 3W1LA 2DIEA 1XGZA 4IL0A 1XUZA 3TTQA 2PZ0A 4EAMA 2DFAA 5L6UA 1OM0A 4WKFA 1GOWA 2XZ7A 3SDOA 2VR2A 4AWUA 3FY1A 3N2OA 1TG7A 3WD1A 2WC3A 4FXFA 4NASA 1LCOA 4JYEA 3SRDA 4HD5A 3THCA 4QJ3B 1VR6A 5LNVA 1Q63A 4MYAA 3JR2A 4FOKA 3S9IA 4X3ZA 3RO8A 3L2LA 3WBYA 3WJWA 1ZPTA 3UJSA 1FVPA 2BMBA 3E2SA 3H53A 4GFSA 3UR2A 4IP5A 2PTWA 4YN5A 5BZAA 1O95A 1W3IA 3QHNA 3WUGA 1AA1B 4HTBA 4ZE4A 3F2CA 1MXGA 1GJUA 3GRIA 3D5HA 2QUVA 3AO0A 1IWAA 3A64A 4MUPA 4AXKA 3L4WA 3QY7A 1TTIA 1XH0A 3O06A 1RR2A 3BV4A 4RDWA 1H61A 4JN7A 4AUBA 1R87A 3RCYA 1IZJA 1GPWA 4QEEA 5HXMA 3ITLA 3GK0A 2A5HA 3VMNA 3LPFA 4Q4PA 4WIWA 1V77A 3MQTA 1S5VA 3N14A 2PDHA 3RR1A 1K8ZA 3DFHA 4OUEA 4PFHA 4B5XA 1YMYA 1W56A 3OODA 3CLMA 3V1PA 3BLEA 2Y0FA 2CHNA 3KDNA 4P7NA 3VNJA 4UQCA 3CWHA 2G3MA 3T8LA 1G7UA 1YX1A 3BLDA 1H5YA 2WZMA 4F0RA 1V3KA 3AQUA 2OKOA 3MANA 3LK6A 2YBTA 3STEA 3WLKX 5K3VA 1JCXA 2FPYA 4DJED 2BP1A 4XG1A 1BRLA 2Z27A 3W2LA 3HGSA 1RVKA 5FF4A 1XIMA 4I8DA 3M5ZA 1U5HA 1ISVA 1KKOA 4RXFA 1LP6A 3EEGA 3G1HA 4L1WA 2Y88A 1VYSX 1XFBA 3KS6A 3U6WA 1KB3A 3ZMRA 4JIHA 5LZLA 2OSYA 3OOQA 1LORA 3UP8A 1NWRA 1P0EA 5TNVA 4IXHA 1XF0A 7REQA 2QCDB 7A3HA 4MNMA 4MWAE 5I0DA 4HPNA 3AICA 2YYUA 2NQZA 1SSGA 3VGBA 4D6CA 1MFVA 1UMLA 3S2NA 2YL6A 1WZLA 1OX4B 4Z0JA 2PGRA 1OGGA 4L9YA 1NF0A 1KBLA 3N9SA 3UFYA 5BNKA 7ENLA 1P0NA 2QNEA 2GGIA 2GPTA 1F4AA 4IL2A 2D23A 2VFIA 2FB3A 3DI1A 2O4MA 3TZFA 1XISA 1KD0A 1OYCA 1TV5A 1FWHC 5EKYA 1P1XA 1N7KA 3KVLA 2D2GA 2DSVA 1GVSA 3DYMA 1SYTA 4KEMA 4G9PA 4DUVA 3L68A 2QCMA 2E09A 3KHDA 3AIUA 3H2AA 1YQ2A 3E5BA 3G5EA 1GYLA 2ZC1A 4WKHA 1FCUA 4DJFC 4BQ4A 3CTLA 3R7MA 3RLHA 6XIAA 4H9XA 1VIZA 3KW3A 1PWMA 3M0IA 3PNUA 4AH7A 2BVTA 2WCAA 2JBMA 5C7HA 1PYFA 4GXWA 3T0AA 3UR7A 4I7VA 1Z8AA 5D9PA 3DHUA 3CL7A 4H9UA 1EWEA 5ECUA 4DQWA 2ISWA 2XTKA 4D9PA 4HHHA 4PMUA 3VK5A 2CLLA 2AKMA 3CMJA 4H8VA 3TOYA 1AG1O 3TXZA 2PLJA 2P10A 4K36A 3MJYA 1GK8A 3L21A 4F9JA 4ZENA 3VO0A 3HZ3A 1A5CA 2PDMA 1J18A 2XM1A 3NQEA 5DRIA 3GBEA 1F74A 1VEPA 1E6SM 1J8VA 4INFA 1NEYA 5IFPA 4GIRA 3M1ZA 4PMYA 2X42A 1X1OA 2VM8A 3AMGA 2R1PA 3BQ6A 5LA2A 3W75A 3P67A 1UH3A 3LCIA 1JCLA 4A8RA 4OTKA 1DIEA 3VKJA 2ZRXA 1LRQA 2ZUTA 1RXOB 4GXMA 3T55A 3ERPA 1E3XA 5A2AA 1NH6A 3GKAA 1XICA 4HMDA 2YCIX 1GTEA 1C9WA 1A3HA 3AUOA 3L9CA 4FAMA 5M3WA 4PMNA 3RMJA 3NDYA 5J5DA 3WENA 2WNQA 4WY0A 2W62A 3DFTA 2GQAA 1R3YA 3OBAA 3MW7A 4R88A 4GYJA 4IMGA 4BQ2A 3BGGA 2G4JA 2Z29A 1HIZA 2QVHA 4LFYA 1WKDA 2XH2A 4OGZA 3P62A 4IIHA 2J78A 1Q66A 2J7CA 1JCTA 5J04A 3KVKA 1NIUA 2Y89A 1RA5A 3D47A 4JOMA 2J25A 3TXVA 4U3CA 3W1XA 2V2CA 3NXLA 4C5YA 3WUBA 3HPSA 3GYEA 5ABEA 3B9NA 3USZA 5CPSA 4HU4A 3NEHA 3W7JA 3GUWA 2O92A 5D04C 1YDNA 5DX7A 1YLVA 3E74A 3BURA 1Q6FA 3VOJA 4GRSA 5FF2A 1SM9A 3QC0A 1QT1A 2WMIB 2ZVIA 2WZHA 1FP8A 4E4FA 1CLKA 3ZS4A 3T07A 2DZVA 2PRHA 2EJAA 3FS2A 2XVLA 3UPBA 3AXIA 3PBVA 2FGZA 3WKZA 4ZTYA 2C7FA 1K9FA 4CQ8A 3QHMA 5H91A 3WDIA 4AY7A 2DZWA 5K9DA 4E0CA 3WEZA 5CC3A 4M6VA 4GLEA 2CWXA 5A3HA 4LYQA 2I9EA 1NAL1 3WQOA 1F6PA 3GSMA 4N7QA 5EB8A 5H8PA 2G96A 4FNPA 1V3IA 1OZMA 2X0YA 4UTTA 3VIIA 4PBGA 1VBJA 2J77A 4GO9A 1M41A 4GH1A 5C7VA 1B4KA 3SM0A 1OX6A 4L7ZA 4H6RA 3N2CA 2BVYA 1CGVA 1HN1A 1EFZA 3GDTA 3TTOA 3VCNA 2F2HA 1TR1A 1E72M 4L65A 3QMSA 5CCZA 5KZ6A 2A85A 3WF1A 4W7WA 2EBNA 5I2UA 3O1NA 2OZTA 3UEQA 1Q45A 5CKSA 2WMHA 2YIHA 3M0MA 4RE3A 1A5LC 2PWFA 2FVLA 5C54A 3GY1A 4OFCA 3H54A 3OA3A 3CIXA 1XIGA 2PTZA 2ADAA 3FEMA 2J6VA 5BWFA 2OQHA 5EFDA 3VE7A 3NQDA 3SSJA 4B4HA 1PAMA 3RCMA 1GZ1A 3HG3A 2Z6IA 4I9AA 3MBFA 4TVCA 3GD6A 3DXIA 1T40A 5KZMA 2PGFA 5CEWA 3IACA 4DPQA 2O0TA 2Z1SA 1W54A 4PUKA 3MSYA 2QUNA 2B7NA 3GVWA 3RPTA 3AFBA 1TFVA 2Z00A 4R34A 2X1SA 1E4NA 3IJIA 2ZUSA 3W7OA 5B7YA 2D0FA 1DV7A 1O4UA 4HNTA 3TKFA 3DC0A 3ONCA 1I2PA 1V7YA 1TZ9A 4UR8A 3FW6A 1K6WA 3GBDA 3BANA 3NNTA 5CBBA 3ZT6A 3PSWA 4KEUA 5FL0A 3QKZA 2D20A 2I17A 4KT2A 1C7SA 4LCQA 2GL5A 3CV2A 3S2LA 2IPFA 4NG3A 2JQXA 1Q6CA 2B4GA 3MZ2A 3W81A 3OU8A 1R8LA 1V0MA 4AD5A 2PGEA 3A4XA 1E5NA 3DU0A 3W82A 3EX1A 1KBJA 4LAMA 3NWRA 3ARXA 2R14A 3S3GA 1UD4A 2WSYA 4F3HA 2PDBA 1Q6DA 3RM9A 3UWEA 3EB4A 1BQCA 5ENLA 1HKKA 3Q67A 5T8GA 1FUYA 3GTIA 4ZXOA 2DQXA 1E0TA 1J5TA 1FCQA 3BXWA 3VNDA 2GGEA 4O50A 1FKXA 2NX3A 3GDBA 3G24A 1KNWA 2OYKA 1UUOA 1EB3A 3NCOA 2C0HA 3GXIA 3W1UA 3W24A 1B3VA 4V15A 1Z7AA 3WLIA 3QR1A 1ZP4A 3HPXA 3HQOA 4HNUA 2DSUA 2XN2A 3KOWA 3HQ1A 1GOKA 1H50A 1AQHA 1S5NA 2BY0A 1D8CA 1T8QA 4FXJA 5FCZA 3B4UA 1Z42A 4DEFA 1P6BA 2G5WA 4MJ4A 3FHQA 4MG4A 4NYUA 4XZWA 3N9KA 3UA4A 2GSJA 3GHSA 4LALA 3CL8A 1SZRA 1EJVC 4BEUA 3MUZ1 4LBSA 2EKCA 1KQYA 2DUXA 4LUTA 1T99A 1GOOA 3OLDA 3A3XA 1JRCA 1PEZA 3S5SA 5JBDA 1MWOA 4AZ5A 2V5CA 4O10A 1GG0A 2HPIA 2YXXA 4RNJA 4WSKA 2QPUA 3OYXA 5BOEA 3P74A 1K9EA 2GSEA 4BF7A 2C1HA 2QV5A 1KTNA 3S4TA 3DFOA 4UFMA 1TKKA 3UWZA 3W7EA 3WDJA 3LPPA 3BG3A 3I6TA 1W8GA 3FX4A 5HMDA 3MWCA 2YR1A 2J6XA 1CTNA 1Y0EA 3N25A 3RM4A 2V3GA 3FFSA 4IFKA 1H1ZA 5G2IA 4KESA 1PKNA 1RV8A 4NJGA 4ML9A 1LL4A 3VX0A 1ITQA 4GC4A 1FWRA 1XKJA 1YE6A 5C2GA 3WQVA 1OGSA 1XGEA 5AHNA 1BYCA 3IWPA 5DBUA 4QS6A 2DZTA 1XIEA 4JTFA 2Z28A 1DKWA 1BGAA 1QFEA 2A3EA 3A9IA 5FOOA 1Q6LA 4MKVA 3TYZA 3L67A 3IARA 4GY1A 4PC8A 4GVHA 3E0WA 3VKKA 2XVPA 2EPHA 3PHAA 4R7WA 1BHGA 1XYZA 1G4SA 1PVNA 1N8WA 1GT8A 4KIEA 4PMOA 4RXGA 2VOTA 5JXQA 2ZZ1A 4ZR8A 4OVXA 4N9EA 5XIMA 2A6LA 4RDYA 2X7VA 1SZFA 3DFQA 2PDLA 3P5YA 4IP4A 4PSRA 2NXHA 1KFWA 4F4RA 2RDXA 5AYZA 2A6NA 1OFAA 2J7GA 3VX1A 3GH4A 1CGYA 2FGBA 1DIKA 1A5KC 3S9YA 2DUAA 5G1TA 4LCRA 4NZCA 5CH9A 3PJXA 2DU2A 4TVDA 4C6DA 3W7IA 3KZSA 5F4XA 3KBJA 3W84A 4GD0A 4IGHA 1VCGA 2P1FA 4RZBA 4QITA 3LXAA 1US2A 2E7FA 2CHRA 4M80A 1S2AA 3PBWA 4C6BA 5I3DA 1EH9A 3W74A 2YL5A 3OG2A 1BVZA 3CUZA 1TPC1 3T0DA 3HF3A 4D8AA 4A21A 5K2ZA 1XRTA 3RO6A 1FCBA 1JAEA 4BA0A 2ISFA 1ITUA 1XYMA 4YU1A 2XHYA 1Q7MA 1GW1A 3IUHA 3ZR4A 3G3MA 2FHBA 4C6NA 1LLOA 3AHYA 3B4YA 2BY2A 3B8WA 2DP3A 1HJWA 1MQQA 1E6NA 2A3LA 3APTA 3MUCA 5D9MA 5LHFA 4F0KA 4B2DA 1OWQA 4YYFA 1DXIA 5KETA 1TQJA 4C6CA 3DBPA 1AW5A 4WCJA 4IHCA 1SFTA 2EO7A 2X05A 2I5QA 2P0IA 1ZRQA 1LG2A 5A6AA 1DE6A 1DXFA 4G2DA 3VTRA 5M03A 2QAFA 4C6JA 3M5XA 1SUXA 2JGYA 3UCQA 3QW4B 4B2DD 2IMRA 3PZUA 2PI6A 3ARYA 4LUSB 2RFGA 2YCKX 3N2TA 4X2PA 3ZT7A 1KO0A 5IHSA 1FHLA 4UCFA 1NFGA 1ZQ5A 3EZ4A 4V33A 3VKCA 3B04A 4R7OA 5H1WA 3DBNA 1FWSA 1NFBA 2JEPA 3A13A 3WQPA 4MY8A 1JDEA 2NV1A 2ZWYA 1FXPA 4RZ6A 3W1AA 4Z1CA 3PUDA 4V1YA 2Y8KA 3ZLHA 5C55A 3JW7A 3WLLA 1IXOA 1SW0A 2VC6A 3ZM8A 2DSZA 3GS6A 2VD8A 1RQHA 3DC8A 3BLIA 1KCLA 2YZRA 2WVUA 5DBTA 4UNIA 1WZAA 4ZQCA 3LCWA 3TSMA 1M53A 4WDUA 3SCWA 3OHIA 5FACA 2J75A 1NQKA 4K8EA 1VFOA 4M24A 4CD6A 2JIEA 2C71A 3GXNA 3ZXWA 3TA9A 3AC0A 3BAJA 2J7FA 3PZ9A 1HGYA 4NILA 4FX7A 3ZR6A 4ZODA 1ZZMA 3A5FA 3AWOA 4TTGA 1RVGA 2PLMA 1KBBA 3TR9A 1DJGA 4E2BA 4BJHA 1BWLA 3VGFA 3T2QA 5I6SA 4CQBA 1LRTA 4EX4A 4GI6A 1QI4A 3SUUA 3VDHA 2AMGA 5CJMA 3CT2A 4ROQA 3ECQA 4JFUA 3PBMA 2CKRA 1TZZA 2VFHA 4HMEA 1TJ1A 4FR1A 2XFYA 4EWJA 1MI3A 2BHUA 3W83A 3OEXA 2OWXA 3O6AA 1RCOB 4OBSA 3TJIA 4RX0A 4K1GA 3L2IA 1JUKA 3AS2A 4QDWA 1SO4A 4DXXA 4RE0A 1XG4A 4RNFA 1ECEA 3R10A 3ZWTA 1F76A 3WIJA 3HG5A 1DEDA 1TPVA 3H26A 4IQLA 4DUOA 3I7SA 5KEZA 1KRAC 3MC5A 3RJXA 2PZNA 2Z7GA 4HOXA 2GOKA 1ZBWA 2R6OA 1XD0A 4YIWA 2CLEA 1DWHM 4LEFA 4NJKA 2W9MA 4M6PA 2E77A 3RHGA 2NVCA 4KCWA 3ARWA 1VFTA 4ES4A 2J9YA 3RU6A 2QT3A 1NWUA 3I6EA 4UTFA 2QGYA 1EOKA 1LQAA 1TVLA 5AOUA 5BOOA 1N2VA 2P53A 3SFWA 4ZE5A 2A3HA 4QSFA 3IV8A 1FWAC 4F0SA 1OG6A 4UTTC 4V27A 8RUCA 1IEIA 4K6AA 4QG6A 3THUA 4QJ4B 3NQ7A 2PWUA 3OPSA 3R13A 4NAFA 4QDMA 1CGUA 1IGWA 3CAWA 2JGQA 3ABQA 3MSRA 3KOZA 4LUIA 4Y9PA 5MKGA 4DX3A 3D46A 4PB3A 4S3FA 3WFAA 2QCCA 1TA3A 2OQLA 1EA9C 3AJ7A 4GX9A 4DELA 3SCVA 2C91A 1HO1A 4W9TA 4J3XA 4PTVA 3IIPA 3VVGA 4HB7A 1BQGA 1S5WA 2HJPA 2F9RA 3CQKA 1R3TA 5H6HA 1MO0A 3I4KA 3TWBA 3KL0A 1JYWA 3G3DA 1UUQA 3LGDA 4Q4KA 4Q7NA 1HP4A 1OD8A 1CXLA 3W76A 3NL6A 3GM8A 2XSXA 2ZTJA 3W0KA 5GQBA 1L2QA 3TOPA 4GQRA 3NQ2A 2Y7FA 1H63A 2X1RA 3F4WA 1A5BA 1JI2A 3QJAA 4JD4A 3NJ3A 2VNCA 3IJ7A 2QDDA 2WCSA 2BVDA 4OOZA 4ATLA 3N2MA 4NZ3A 2PA6A 4RZ4A 1PCWA 3D6NA 3IJDA 4AHOA 4REQB 4CEXC 2ISSA 1V7AA 8XIMA 1XD1A 3T4CA 4UTMA 2WSQA 1HW6A 4IJCA 4M29A 1H2JA 2QCHA 5LGXA 4D8ZA 4IFKB 4YLWA 2ZYFA 1ZJBA 2PDUA 1A49A 2NLIA 2ZX6A 1Q65A 4MFEA 3HN3A 1JYNA 4TU1A 1G9HA 4UXDA 3VIFA 1LUCA 3DG3A 2NV2A 3GHTA 1TWSA 1W17A 3RILA 1J12A 3CQHA 2PBOA 2QUUA 2HBXA 1B3XA 1JPDX 1Q13A 4FOUA 3UQNA 3PWGA 4A6GA 4YPJA 5AVHA 5E6ZA 2BOGX 5CPOA 4O11A 1O5QA 3RMEA 4PSPA 2WBGA 1GQIA 4XISA 1TA3B 3CUXA 3PR2A 3H8AA 3QR3A 4NJIA 2NLYA 3PC0A 1G4TA 4D6DA 3M0JA 2VX5A 4QHRA 1XLFA 4J3ZA 2BXVA 2G37A 3JUGA 3NSMA 3UU0A 1YTEA 3WMBA 2TSYA 1UR0A 2QKFA 3BWWA 4ZBCA 2XZ9A 2VRKA 4P7OA 1ZL1A 5E9AA 3TUUA 3B9AA 1TREA 4W7UA 4GI4A 3WH8A 1B90A 4GZIA 1YW1A 4JTCA 3QLLA 4RNHA 4LUYA 3SCNA 4PUWA 4IIEA 3UWUA 3M16A 4J3VA 4O28A 3GX9A 1W5NA 3HMJG 5DT7A 3ARRA 2WNNA 1H1NA 1XJBA 1EJRC 3ES8A 2GGJA 1ITCA 2VXNA 3B8SA 4HU3A 4YJ5A 1EIXA 4M7TA 2ZZ4A 3ITOA 3FEQA 3QGVA 2Y5SA 3A4WA 3SUWA 3MV11 4FHAA 3HG4A 3HV8A 3ANUA 3AS0A 5EFFA 2HBVA 3O2LA 3H12A 1P4CA 3PZNA 4JL2A 2H9AA 1KRBC 5RUBA 1EP3A 3T81A 4YXGA 3SN0A 4J3WA 3MUAA 4FP1A 2WMGA 2VOMA 3WCZA 3ICJA 1QO2A 3CUFA 3PBYA 2RGLA 4EK7A 3LA4A 1GPFA 5FJJA 1L6YA 3EBVA 2H8ZA 3W7RA 3RM8A 2WQDA 3CT7A 1B3ZA 1G7VA 4GOAA 3IVSA 3WQ6A 2BSLA 3CEPA 4QISA 2ZICA 1OFPA 1PX3A 4UFLA 4S2BA 4RE2A 4WLCA 4BK9A 3PUOA 5REQA 2VFGA 3M9YA 2ABBA 1BYBA 3KBVA 3CS2A 4Q8PA 4TOQA 1VPYA 1HKJA 2YFNA 2WHMA 4N0RA 4M1BA 3U48A 3GTFA 1RBLA 1B9BA 3HV9A 1TPFA 3GB6A 2E6DA 3ALGA 3PG9A 3NOEA 4S39A 3BSHA 3MVIA 1L9WA 5I07A 3VDBA 4QBXA 5HMSA 2E68A 4L80A 3F4DA 2CFFA 3NL5A 4A3QA 3USBA 3K8MA 5K7JA 3PFMA 1R30A 4C6EA 2XDFA 1QI0A 1BF6A 3EA2A 4GACA 1S2VA 4PBEA 4JTDA 1FRBA 1XDMA 4MWAD 5D8WA 4WDTA 3RFAA 2XWEA 1I6NA 1P1MA 3TYEA 2TRSA 4S3KA 4KBXA 2PDQA 3W73A 3K8LA 3DFSA 5E0KA 3I3EA 1TIWA 1VZWA 4PMRA 3BG9A 2GSHA 1QW8A 3FKKA 3VIGA 3LSBA 3TWAA 3ONBA 6CGTA 2NWRA 3QPEA 1Y5WA 3SRHA 2D0HA 4GUGA 2OSWA 3KHJA 4B9ZA 3LCXA 3G6MA 3CV1A 1PIIA 1K9TA 4LVAA 3NQCA 1CXFA 2GJLA 3EWUA 3GW0A 4XKYB 1UOZA 1YPFA 2CC0A 3W70A 1VC4A 1XQLA 1TQXA 3UBPC 3URAA 3S47A 3K4DA 1UKOA 2WW5A 1QBAA 1F4HA 3EGJA 3SECA 2OEJA 2PEVA 3LLXA 4QP0A 3RDKA 3MSGA 2OCZA 2ZKMX 1UHVA 4OZOA 3PSVA 2WXDM 3GVRA 2CPUA 4U2ZA 2POTA 2YZ5A 4C6KA 5IM51 3LGEA 3UYIA 4LV4A 4O1CA 2FGLA 3MB9A 1AQFA 1WNOA 2NVAA 4IG2B 3UERA 3M7SA 3M0KA 3UR8A 3A3HA 1QASA 1JQXA 1FY6A 4X60A 3GXDA 1UIOA 2Y2WA 3BJFA 2OPJA 3SUTA 2BODX 3E2QA 3T8QA 3VNIA 5BXSA 5HQMA 2PC4A 1C7TA 1OX5A 1QPRA 4E2DA 3QW3A 1XRVA 2E6YA 4MJMA 4P5UA 3PK7A 4XZMX 4CN1A 3PZQA 4QXIA 2D3LA 3HGJA 4O53A 3KWSA 3C2OA 4UWMA 5LGZA 1W5MA 3CZ8A 3UXDA 1JZ4A 2WK2A 1DORA 1KRCC 1K03A 1W2PA 4MB4A 3SUSA 2GWNA 2J74A 3UCCA 2P8BA 3CASA 5A6BD 2BASA 1OGBA 2ZRZA 1SPQA 3VA8A 1AD4A 3FAWA 2O9TA 5LNUA 3IK2A 3WD0A 3WF3A 3UVIA 1ME9A 5C8BB 4Q8OA 1QWKA 3P93A 3GQYA 2VVSA 1TV8A 3C52A 3PZIA 1VEOA 1GJPA 3CHCA 2I7GA 1NDZA 3GVVA 3CO4A 3FNDA 4YMZA 1G0CA 1ZFJA 4KEVA 3WQWA 1TJ2A 1DWAM 5A2BA 1LWIA 2VDIA 4M6QA 4DBUA 2IS7A 2P0OA 2WZEA 4GIAA 1SGJA 5HINA 1K3UA 3WK1A 4E8CA 3VNMA 2W79A 3L5AA 4H04A 5AYYA 2GVLA 4YNGA 4IPJA 4TV5A 3ARZA 5DMYA 5HWMA 4HPGA 4FF7A 1TTJA 4KQNA 1MW1A 2ACQA 1H0GA 2TPSA 2RJHA 5AC6A 2QR6A 1MFUA 4AG0A 3K30A 4PTMA 4DYEA 4NQ1A 1XPYA 4GWEA 3ATZA 4N42A 1IHIA 3T40A 2ALRA 4AD1A 2DUZA 4GIEA 3TX9A 5BXPA 3RK8A 2CBIA 5C0QA 3F4VA 5ABGA 3W1PA 1NJJA 4GKLA 4A35A 1Z69A 2BB0A 5A8QA 2QIWA 5E5CA 1IEVA 3OBEA 3SADA 5I77A 1KR1A 1R5YA 4HQVA 1KM6A 3EX6A 1F07A 3SUVA 2Q8ZA 2QCGA 3O3RA 1IEWA 1W5PA 2BNJA 3BZGA 3G0XA 1QU4A 2A79A 1KLZA 4IF2A 3BLLA 2PODA 4PULA 1K8XA 2V30A 4AF0A 2E40A 3LS9A 1OK4A 3VKBA 5DANA 4OOUA 4N4QA 4OWGA 1UP3A 3G1SA 1JZ5A 3LRKA 5E93A 1SQ7A 2CKSA 2EPOA 3OQ8A 3H7UA 4L1GA 2QJIA 1S5MA 1Z3NA 4AWSA 5HUPA 1JL8A 1KR0A 1ZTVA 1XL9A 4W89A 4UB9A 3M41A 4FS9A 5HK4A 4MNJA 4C7FA 1FKWA 1HT6A 1QI2A 4ADSA 1UBPC 3NPVA 1GCYA 5LIKX 1P0BA 3OGVA 5GNZA 4UTKA 2DY3A 1S2UA 4M8UA 3JZEA 2OMAA 3EWZA 1WP6A 1GKQA 4L5ZA 1X1ZA 4LPCA 1KM0A 1MVYA 3QGKC 3APGA 1WYIA 3OBKA 4ERIA 2V2HA 1WOAA 4Z2GA 4WDWA 4UTHA 2C79A 4NAFB 5LA0A 3KOYA 1JAKA 3DEQA 1MRQA 3GDRA 4WGXA 1YBQB 4IGSA 3VILA 1A50A 2RH9A 3TQKA 3S5OA 2O9RA 3D3AA 3EKGA 1AH4A 2PMQA 1S1RA 2HS8A 3PWAA 3S8HA 5AZ0A 1XX1A 3FJ4A 4I5RA 5GJMA 1R7OA 4E2OA 4FNRA 1CXEA 4P8UA 3WSUA 4C6FA 1AJ2A 4J40A 4PRTA 1WPCA 5BW6A 1TMQA 2Y8VA 4AVFA 3G2GA 4DI9A 1EYEA 5AYBA 1TPH1 5CAKA 3GDMA 4Q8WA 4NX0A 3SN1A 1TRDA 1O94A 3TZNA 1KXTA 4LVGA 3VZXA 3UXKA 2FH6A 4O17A 1UPMB 3P5ZA 5A5WA 3CWNA 5F2LA 5F4WA 3GC5A 1E0UA 1WDDA 2QCFA 1PZ2A 4J2PA 1NTHA 3AMCA 3W7HA 1TB3A 4V2XA 1Y5XA 5AC8A 1G01A 4UQAA 1PWLA 2GUBA 4AZHA 2PBGA 1GYMA 3NM3A 6PTDA 1OINA 2ONEA 2XU2A 2NT0A 4UZSA 4HSOA 5I3GA 1V79A 3PBUA 4RNIA 5GVJA 4UTLA 2QEZA 4IIDA 2D2JA 3KRBA 1U1HA 4AQLA 2UWFA 2CW6A 4IMDA 2HNHA 3DECA 4H7CA 1EX1A 1MQRA 1YADA 4WD0A 1YXCA 2F61A 1KA9F 2ZUWA 3UF9A 3ZJKA 3TYUA 1Y65A 3SRFA 3RNDA 2E9BA 4Z2JA 3AXHA 3IIXA 3TFXA 1TV2A 1K8CA 4QAIA 3R0DA 4LV9A 2I16A 5T91A 4R27A 3BCJA 3U8GA 3OIHA 1EP2A 4J3SA 1BWVA 2Q3RA 1VLWA 1UD2A 1TZ7A 1VF8A 1QATA 4UTWA 2X7WA 1PDYA 4CU7A 1XLMA 1RUSA 2EKGA 3AIRA 4MAZA 1O66A 2Z1BA 4FALA 4PEKA 2NUYA 3SY8A 1H41A 4JZ5A 3IRDA 2AQOA 2VZTA 1TUXA 4NNCA 4JFWA 1YIXA 1EPVA 4S23A 3KCLA 3GG7A 2RHGA 2VO5A 2YKKA 1OFDA 3MMDA 4HK6A 1D2KA 2NX9A 3UNTA 2WHLA 1K70A 1BLIA 4AU0A 1ZAIA 4M56A 3N9RA 3V18A 2UZ9A 3KL3A 3WN6A 3THAA 3HQNA 1ONXA 3LCGA 3AZSA 5KZDA 3LEPA 4KFNA 4EPDC 1UMYA 1B54A 3PPHA 1JGMA 1ME7A 5GPRA 1XLKA 4XD5A 3S1WA 4DYJA 1T6MA 4G6CA 2RUSA 1IGSA 3HA1A 4WKAA 1EJWC 5BRPA 1X8FA 1ICQA 1S3HA 3LN3A 4GJIA 8A3HA 4F66A 3L4TA 3ABXA 4AZCB 2FJUB 1TUFA 5MKGB 4LYKA 3W9ZA 5EGRA 4K3ZA 2ABAA 4UNKA 3NAVA 4QJ1A 1EQCA 1XG3A 2OX1A 4RDZA 1KFLA 4C5ZA 4MSSA 1PKMA 2VC7A 2X41A 4X61A 5I3KA 1RPKA 1ZSXA 1SJDA 3EXRA 5IBXC 3O6YX 1KWKA 3CB8A 1CENA 2W4XA 2NQ9A 1UWAA 4MHBA 3ZVHB 1W1PA 3U4FA 1KC7A 3O9NA 4JN6A 3W1QA 1RLCL 3M0ZA 4W5UA 3BMWA 2OOFA 3WLJA 2CBVA 5I23A 3H2CA 3UZYA 1QPQA 1Q6EA 1LWJA 4JQ4A 5A6KA 2C3ZA 1B1YA 2UV8G 1O5RA 2EG6A 1CDGA 1E0XA 2R1LA 3FKRA 4PUDA 3FXYA 4P2VA 1JPKA 2J7DA 3HJEA 4KGLA 3RITA 5SWUA 4FNTA 1QNSA 3SEPA 1IYXA 2ACUA 3AMKA 5JMUA 4JTEA 1QW7A 4AW7A 2AGKA 3TYCA 1VCFA 2YDAA 3VFLA 3VC5A 4LJ3A 4XAPA 4JN8A 2Y1HA 1OF6A 4XZ9A 5I09A 1ZUAX 1A47A 3BCFA 3S1VA 1CPUA 2A21A 3UWVA 5D32A 3U4AA 3IGHX 1AH3A 3QLDA 1RAKA 2RDWA 1KFJA 4XD6A 1O60A 1J4EA 2GUYA 2NXGA 3DHDA 2R82A 2VGFA 4CNNA 3GIPA 4HNCA 5EL1A 2DV0A 2WANA 1JZ3A 2XVNA 1OVDA 3UZXA 3CHFA 1OCQA 1CIUA 4PRRA 3JZUA 1HTIA 3NQGA 3P84A 4AC7C 1WKFA 1FWFC 4FSAA 4Q4MA 3IIVA 1UR8A 2PC8A 3BLPX 1JD7A 3B03A 3C8NA 1K4GA 4LH8A 3PM6A 3EDDA 4UFJA 1HKVA 2FPVA 3UZ5A 1EOMA 1QPNA 1JD9A 1S38A 3CZJA 3MT1A 3RRAA 2JIWA 3IAPA 2F8QA 1FHDA 2BTMA 1XLBA 1VBUA 3FAXA 3WK3A 3A3WA 4GX8A 4QGCA 5CZSA 4UC5A 3W00A 1I75A 4OUIA 1UZDA 4PCTA 3LHTA 5CSUA 1Z89A 2RGMA 3T44A 2AKZA 3MKVA 3W29A 1LRNA 2QZRA 4LUSA 5U7SA 1PS9A 4AZBA 5D4YA 3WNPA 9RUBA 4A4AA 4CVUA 1OCJA 1UQYA 1VFFA 3CQJA 1BVNP 2PF8A 4XWUA 4LAUA 5HNRA 1XIHA 3WF2A 3LV6A 3LCFA 3ZJ8A 3KTXA 1OEPA 4Z2HA 2I5GA 3MCMA 5BCAA 4UOQA 5FJRA 2WLYA 3H24A 3TSBA 4FR6A 1XBVA 3WBAA 1V4YA 1JCYA 3GG8A 1UZHA 4IPLA 4OECA 2PAJA 2FHCA 1I60A 5CSSA 1W3HA 1X1NA 3GUGA 4LYRA 3W38A 3CM4A 4RV3A 5D37A 3ARPA 4S2CA 2BFGA 3TYBA 4AZ7A 3GXPA 2BXZA 3H2EA 3B8IA 3PUEA 1EX5A 1UR1A 3I6RA 4FNUA 1JULA 4C6IA 3W2MA 1XC4A 3LOTA 4GYKA 2NUWA 4ERAA 3AXMA 6A3HA 5M2FX 3A23A 2F6KA 3SGUA 2WMJA 3MPGA 4O1AA 3H6OA 1K6AA 4B16A 4HSHA 1AZ2A 4U3AA 2CLFA 1NOWA 4RKAA 2VDHA 2PTXA 3C6CA 5XIAA 3PAOA 5A8OA 1T8XA 2QCEA 3EWXA 2EG7A 2NQJA 2ZXQA 4FO4A 2O9PA 2DW7A 3WQ4A 1I2RA 1U83A 5B7ZA 3P82A 3DHPA 3KP0A 1E9YB 3WH6A 4D8LA 2ZUMA 4I7WA 5CC5A 2FDSA 3BZJA 4E4UA 1HFBA 1WO2A 1EBGA 1DHKA 2YLAA 3LTSA 3L0KA 1M7XA 3AYTA 2ZRUA 1CYGA 3R0UA 3KM8A 5DT5A 3FYOA 1GVEA 5C6MA 2HK1A 3LHYA 1J2WA 1OFOA 2YPIA 3FIGA 3VI2A 3IIZA 1L0PA 2WMFA 5IBXA 7ODCA 1A0CA 3MVTA 2BX7A 3UG3A 1XBZA 3C61A 4LVDA 2UY4A 4H6EA 5A95A 3SJ3A 3EA1A 5D33A 1O12A 1JPMA 2J88A 4MWAC 3WJSA 4GYPA 1G4PA 2DDXA 4ZO9A 2RKXA 4PUJA 1DJIA 3C2EA 1E6QM 3R8RA 2CZEA 1QPKA 2J7HA 4U5KA 2WCGA 3FA3A 1QI3A 3R8HA 4HPXA 3LI0A 4L6HA 2PDXA 2NX1A 4IQDA 1UR4A 3MI3A 4GUFA 1DQXA 2PCEA 2VX6A 4QR6A 5I3FA 4H01A 1J93A 3UG4A 4DJFD 1QMLA 1NOFA 2P76A 5J5RA 4EF9A 3KCJA 5FESA 1SMDA 1V3HA 1P7TB 1JG9A 2HVOA 4Y90A 4HPHA 4NHVA 2CLHA 2PD5A 1R85A 1V6VA 4UQ9A 3TC7A 1G67A 3PS7A 2O55A 3REQB 1IT7A 2R1NA 3TV8A 3QV7A 4C1KA 2BG5A 1JQVA 1OK6A 3NR0A 6REQB 4RJEA 1NELA 2PLCA 1W0MA 1GQLA 3CEUA 4PA8A 5HQEA 3W1TA 1YPIA 1ODZA 2VVNA 3BGJA 2V2DA 4IWWA 2QDGA 1M7JA 1FWEC 3TW6A 2J9XA 2JE8A 5C70A 3SY5A 3NM1A 3ITCA 2PS2A 3UJEA 4BF5A 3GIYA 5A6JA 1F5ZA 3PANA 2JKEA 3WEOA 1RK6A 4K68A 1I1XA 9XIAA 3PTQA 5FEWA 1KLYA 3GZAA 4GY0A 4Z2IA 3A21A 1S3TC 1GOQA 3W7GA 1KGXA 1FWNA 1D7KA 1JCNA 2INZA 1DQWA 4Y2WA 3L12A 4EIVA 1SVDA 1VBRA 2VX4A 3I3BA 2JALA 1CLVA 3G1FA 4URIA 1YXYA 4N9CA 4CKQA 5G2HA 2VELA 1OFBA 3MUIA 1GYNA 2JK2A 3WQEA 1M6JA 3RX3A 2ZQ0A 1LOSA 4JCMA 3LHZA 3SCQA 1NDWA 2P3EA 3IGSA 1E9IA 4XAFA 1KM4A 1EEXA 4PFMA 3RU8X 4AMCA 1JNDA 5EMKA 4BY3A 3PP7A 4JFTA 5D03A 3UY8A 3W1NA 4UTIA 3W02A 6TIMA 2G4FA 1D3HA 1LUCB 4GBDA 1LDCA 2CEQA 3BJSA 3AU6A 4MY9A 1R9XA 3ZQ9A 1ZBVA 1IXNA 1SZNA 2O4QA 1HG3A 4C90A 1B9ZA 2PTYA 2Z1VA 1SFLA 2A7NA 4MF4A 1IZCA 3GFXA 3D0CA 1C91A 4LVBA 1FFRA 2OFJA 2Z7KA 1TE1A 3ISIX 4AIUA 5L9FA 4AEFA 2F84A 4DI8A 3PUGA 2XVGA 4XBKA 5I06A 3B9OA 4S38A 4HGXA 1M1BA 5DRCA 1N8IA 3DOPA 4GVIA 4GUJA 4A3RA 5JU6A 4IIGA 4M1RA 1K9DA 2WNZA 1F8MA 1XP3A 4RZ5A 3B8VA 4ATDA 3WLOA 3AHTA 3LBOA 3QRHA 4PR4A 3N19B 1QPOA 4NI3A 1CZ1A 2TMDA 4IFRA 4QFUA 5HANA 3O8AA 3V36A 4TR9A 1EGVA 2FZMA 2WMIA 4EPKA 3N1AA 2C15A 2UBPC 3TDFA 3GZ3A 2WBKA 1H5VA 3GVQA 1JEZA 1W37A 2OVLA 2YXGA 2V5LA 3C0JA 3EB3A 2C6QA 1PL9A 3QN3A 2ZUVA 1W1A1 2PDIA 2NSXA 1P0DA 2VC9A 4FEZA 4POCA 3ITGA 3SCUA 1JI1A 2XIOA 3S2CA 5CZKA 3BOLA 4LU0A 4PYSA 1YHTA 3N11A 1V3MA 4XO6A 4GISA 3LX9A 4M51A 5KITA 4ZQMA 4ICNA 4US6A 1J0YA 1Q6GA 3WQCA 1I0BA 2CLMA 4YHGA 3E12A 3R79A 1SJCA 2E9MA 2FTPA 4MNKA 3TTSA 2QPSA 1BGGA 3OHMB 4O52A 3F4CA 2OEMA 1OCNA 4HNLA 3GR7A 3PBGA 4IICA 2DZAA 3DKJA 2IUZA 4AIBA 3VUPA 3NYDA 3Q45A 3EEZA 3Q37A 4JIPA 1R2RA 4JDYA 4PCSA 2PUZA 3O6DA 4ZB2A 1TX2A 1DJZA 3CK5A 4RE4A 5JH2A 1AD1A 1O1HA 3KUMA 3EWDA 4OU1A 4AIEA 4UOZA 2D1ZA 4O1FA 4ZQPA 2E4TA 4L64A 2VEIA 5C9WA 1UH2A 2YCLA 1HL2A 1QOQA 4M3PA 2GDUA 3CXOA 4L4LA 3H2NA 3PF3A 3LTPA 3KRUA 3QQ0A 4BCEA 3TMQA 3NIYA 3VU2A 3TMLA 4OV9A 1LWHA 1EC9A 1J01A 2E5BA 5AHLA 1X39A 3FVDA 1FDJA 2ACRA 4D72A 1KM2A 3ATYA 4AISA 2A7RA 4H9ZA 3E0IA 4I3GA 1VP5A 4JIQA 3QV9A 1T5AA 4DF0A 2IPGA 4GCXA 1IWBA 5HULA 2AL1A 5CGTA 1B0IA 2DT0A 1JFXA 4ALDA 1W3LA 3IGXA 4Y9NA 2AAMA 4GQQA 4CCEA 4H00A 3HFTA 4HZ6A 2FH8A 3AUJA 2ZZ6A 2QDEA 2V81A 2YW4A 5D9OA 1MZRA 1XINA 4WY0B 2PRLA 3UJRA 5IRPA 3C86A 4UMCA 5EY5A 2HVMA 3UZWA 4I8YA 1UP2A 1E70M 1SR9A 5LXEA 4DJEC 3AALA 3ZSTA 1XLAA 3FSUA 2PDGA 3MUY1 1OZQA 3GIQA 2P3ZA 3L66A 1E4IA 2AL2A 4HYVA 2QF7A 4M19A 3VINA 2V0TA 4WSJA 1R2TA 1UWUA 1TMHA 4IJRA 3P81A 1TIMA 2QJHA 4Q4RA 4WOZA 1KM3A 3XINA 4RLIA 4ILSA 4JKMA 4FXRA 2VR5A 1W6TA 5E1QA 3F2DA 1UW9A 1XCWA 3UESA 2RDUA 3IVUA 5KZEA 2DVXA 4XD3A 1F3EA 3OA5A 1QAPA 3RX4A 4C91A 1CGTA 4PTXA 4NVTA 4GBUA 3GH7A 2PB1A 3T09A 2I5IA 5A1AA 5E70A 3RUBL 2Q3OA 2PDCA 3UGRA 1JNEA 2Y63A 3SB0A 4AZGA 5D2TA 3R89A 3TW7A 3CC1A 6ALDA 3GDKA 1GUVA 1YBQA 3MP3A 3KBMA 3IV3A 3EAUA 4HA1A 2VURA 3W3OA 1JXKA 3ZSSA 5AHIA 4UZUA 3NYZA 1A5AA 1BRLB 1FP9A 3LMYA 7PTDA 2H3BA 3SI9A 4GUIA 4B5UA 4DWSD 1WBHA 1GJWA 3BAIA 2IKHA 4NZ5A 3B8DA 3AYSA 4NI8A 1ADSA 3TAOA 2VYOA 4Q8NA 3DIPA 1H60A 3POHA 8CGTA 1A3WA 1NWTA 4MADA 3DH7A 1P6WA 1PSCA 1TCMA 4XKMA 3OG3A 2QW5A 4W88A 1KV5A 3QPYA 1HL8A 1XLHA 4WGHA 1NF7A 8TIMA 4LXFA 3TR2A 3VUSA 3ZJ6A 1A0DA 3I3DA 1ZALA 4H9YA 2DH3A 1IV8A 1ENUA 1H7OA 4LANA 1VJZA 4F2UA 3DFPA 1R9ZA 3HTWA 2V6AA 4LS0A 1GOMA 2EXOA 2FYMA 4GQ0A 5A6SA 4F0LA 2KAUC 3BAKA 4K8HA 2ZVRA 1JVNA 1M04A 3TN6A 3Q94A 2ANUA 1A0EA 2ZRWA 1Q2RA 4GI9A 3VD5A 4C7GA 1QRQA 2PWGA 3TCSA 1AL7A 4J9JA 2LLEA 3T05A 1Q7QA 1DE5A 1DL3A 1F8IA 3AU2A 4IUGA 3LUTA 3ANVA 1EHAA 4Y8EA 3H7RA 1CXKA 3KAOA 5AC5A 5KINA 3IJ9A 4IQEA 4LW7A 2GJRA 4NU7A 2ISVA 3UXAA 4MPQA 3M6DA 4OV4A 4ZGYA 1YKWA 5BMWA 3WG6A 5FF3A 4B91A 3NPXA 1E55A 1GVQA 4ICCX 5FEZA 1VD6A 3AAMA 1VIWA 3V0SA 4AB4A 3C8FA 3BMXA 3KOFA 4D2JA 2Q02A 3PVFA 3T42A 1NY1A 5DN1A 3MZNA 4P8XA 1ESWA 3M0XA 3NZGA 1AQ0A 1NARA 3S9ZA 3NVDA 1RSCA 4Z42C 3SSZA 3U7BA 1C8QA 4YWIA 1VFHA 3NA8A 1QK2A 3V16A 3VCCA 4KPLA 4NRRA 4DF2A 4JHMA 3GC2A 4ADTA 1HX0A 4CCDA 2R91A 3E3HA 1X98A 2VUNA 1M7OA 1TPDA 3DFYA 4W4QA 1JXJA 2HQAA 3WO8A 1TPB1 1HKIA 1QNOA 1QNPA 3S6DA 1EO5A 3S1GA 2YA1A 1XH2A 1EJ7L 2Z24A 2YA2A 3W85A 5K4XA 1Q3NA 1BKSA 2D69A 1HNYA 5LIYX 1YE4A 1Q6RA 4FZIA 2QJNA 1R47A 1VFUA 4GVGA 3M4HA 4A8LA 3OGRA 3AZTA 4I9MA 3B0XA 3SCTA 2FB2A 5CZJA 3GHUA 3VD4A 1YEYA 1DP0A 1PKLA 4FIRA 4JX4A 3N4EA 4ZQRA 1PE1A 1P43A 2C0AA 1KGWA 3BOFA 4AVNA 4KCVA 4PB4A 2GJXA 4C6LA 1PKYA 2Y5EA 3N3MA 4KS0A 4O1EA 2V67A 3E2RA 2E1WA 5HDRA 4CN6A 2XINA 1FWDC 3EMZA 1RCXB 3IGUA 4B90A 1P48A 3T7VA 1CX9A 3FLUA 4HIBA 3AHZA 4MPKA 3MDWA 4NZFA 4AYSA 3P6LA 1Q5MA 3Q2DA 2PE4A 2JKAA 4Y7EA 5C71A 2Z1KA 2D22A 5EMUA 1GVIA 4XQ6A 4LRTA 1ZJAA 2ZRVA 3VYLA 3TROA 4U5IA 1AK5A 2QJJA 5CZTA 1R3QA 3NL2A 1EUAA 1OYBA 1BF2A 5CSYA 5DMNA 4ADUA 1XC6A 5A8GA 1E4LA 1WQ5A 1UD6A 4MDPA 5I79A 2A2IA 3LD5A 1BXNA 3NDZA 3NXFA 3CUHA 2A4AA 4CCCA 4B3LA 3PAJA 1K7EA 4D1IA 1ZHAA 3G1YA 3R2GA 3UWQA 1LOLA 1CB7B 1DWJM 4HZMA 1QHZA 4ROPA 1M68A 2ON3A 3M46A 1LQ0A 1ZBCA 2W91A 4DO7A 3A22A 3M47A 1Z6KA 3GG0A 3W86A 2YB4A 1EEPA 2O9OA 4JEQA 4GK8A 5D9NA 3O07A 2CWNA 3WMLA 4QG9A 2CNCA 1GKRA 2B81A 4UNLA 3KBNA 1JCJA 3B8TA 3F5JA 5DO8A 4NJHA 3O7UA 1N8FA 4GJJA 1U22A 3W37A 2CBUA 2GJXB 1V5XA 4J35A 3P61A 3RYSA 4YTRA 2YBUA 1L2UA 3M5VA 4HN4A 4H1ZA 3G0SA 1XLLA 3M0LA 3QVQA 4S3GA 2J4GA 1MXSA 1B30A 3WH5A 5AYIA 1XLDA 4Q33A 1FWJC 4MYXA 2J47A 2CETA 4QTGA 4F79A 2PTDA 1KTCA 4LQ1A 2Y5JA 1MEHA 3VD3A 2CLOA 3PULA 4YVPA 3B3DA 5C2XA 3BV7A 4FNSA 3M6YA 1XI3A 4DLMA 3WLSA 1W32A 3IPWA 2ZX9A 1OIFA 1OC5A 2D3NA 3TK7A 1RP8A 2J79A 1EDQA 3CYJA 2CYGA 5F7UA 4K1WA 5KSWA 1ADOA 5CG7A 3WQ5A 2YDSA 5M1TA 4P61A 3C4UA 2MANA 4AYGA 2X2YA 3BICA 5ABFB 4PL1A 1Z44A 1Y5VA 3MWAA 3VM7A 4GYFA 3TONA 3AS1A 3MJMA 3WLMA 1XHGA 3UWYA 2Z1XA 1C90A 2YFOA 3W7CA 1TWIA 4IX0A 4HU0A 4FLRA 3MY9A 4AWTA 1DTNA 1Z32X 3W23A 2BXYA 3R8GA 4ZXLA 1A5SA 4BEQA 4C6MA 4K8GA 5C2CA 4OBTA 4E6MA 2PWVA 1DJHA 3QOKA 3INPA 4H8NA 2PWHA 4A8NA 4Y96A 3CUJA 4JYFA 1UWRA 1WE5A 4US5A 3GU1A 1CECA 1HUVA 1DYSA 2A7PA 5LYRA 5TF0A 3I7RA 3TJXA 4NL1A 3APYA 1BYDA 3BL3A 4S3CA 1UKPA 4B5WA 3U2CA 2J8TA 5DF0A 2BOFX 3FDGA 2W27A 4HK5A 2J27A 5PTDA 1JUBA 3W7DA 3O6CA 2RJGA 5TBOA 4HK7A 1OJXA 2VTFA 2ZA2A 3N2BA 2SFPA 1XGDA 3B0UX 3K8KA 1EC8A 1B57A 3TLQA 2VT0A 3CHEA 4BI7A 4F0HA 4OE7A 1XIJA 1H7NA 4LY8A 4Q8VA 3A6OA 1KRMA 1LG1A 4X0NA 2QULA 2CBJA 1QOXA 2J7BA 4A3YA 4GKTA 3FA4A 4IPIA 1H0IA 2FIQA 1YDOA 1EF3A 3U2OA 4WQ6A 5AC7A 2WZTA 4TVUA 4MAVA 4WUIA 3F1QA 3MCOA 2VFEA 3G22A 3KDOA 2DT1A 1K02A 2YSWA 4QCFA 6TAAA 3EPMA 1C9DA 4N02A 4MWAB 4YWSA 2VZVA 6REQA 1TPEA 1MZHA 1UIPA 1H62A 2DT3A 5GNYA 4EACA 3QTPA 1GW9A 4IQJA 4AMAA 1HZYA 3MDUA 3MKCA 4HYRA 1WV2A 2KX9A 3RLUA 1BWKA 3CV6A 1H7WA 3CJPA 5A6TC 1Q6QA 4LEQA 4BZYA 3W07A 3RLVA 4DIAA 1W3JA 3L4XA 1EL3A 3NG3A 3NTYA 4AIOA 5DMMA 2CERA 5DLCA 1JZ7A 5A6BA 4WEVX 5FEXA 4H9TA 2E1DA 2VR4A 2YDQA 2ZUUA 5DY2A 5JIWA 2OEKA 3BMVA 5DFAA 4C60A 3MP4A 1MNZA 2GQ9A 3TYAA 4K39A 4QSHA 3OVRA 2DSWA 1EUNA 1BG4A 5A8PA 4HN8A 5D2XA 3S42A 2VP8A 4CCZA 3CLWA 4WVXA 3ENLA 1L8NA 4PEEA 2BV9A 3P0XA 2G3FA 3RX2A 4FXSA 4W8LA 3EOUA 1W5QA 4DAIA 4DUXA 3KTCA 1PV8A 3TNOA 4DZIA 5CBIA 4QIUA 4X9YA 3VNYA 2XSAA 1PZ3A 1VRXA 3AIVA 1U5VA 4QM1A 4W7VA 1REQA 3NGFA 1LZOA 2JF7A 3EMQA 3H70A 1B2YA 4TV6A 3VKDA 3AYVA 4TIMA 5EMJA 1XSJA 2AL2B 4E38A 2G41A 3W22A 7TIMA 2BY1A 4I9TA 4HMNA 5FA5A 1IR2A 3N18A 3O63A 4QLKA 3MTWA 4PMQA 1QOPA 1CNVA 4L9ZA 3LZ3A 1IXPA 3LBMA 5FEPA 3IJ6A 1V6TA 2OOGA 2RDTA 1OT1A 4FOJA 3PTKA 4O15A 3W7NA 3TQ0A 3K4AA 2REQB 3IUIA 4O4VA 3EDEA 1KGUA 1I0DA 5AC4A 1UWSA 3C3UA 3NO3A 4LX4A 3VDGA 2ZX5A 1TVNA 1A53A 2QGHA 1PPIA 3C2VA 1E6PA 3QEZA 2DJLA 4Q8TA 4Q8MA 1RALA 4C1LA 4YCOA 3VIMA 1TPUA 1GHRA 2OO6A 4PCNA 3WF0A 1GVYA 4CQDA 1WA3A 1XKYA 4JQ1A 3T0BA 1PTAA 3IRSA 3TTEA 4EANA 5CQ1A 3EWYA 3CQIA 5D2YA 2OKTA 4UR9A 3A24A 1S2WA 4DJFA 5HA7A 3KLKA 3EOEA 3FOKA 2DGAA 3V5OA 3TEVA 1OQFA 3H22A 1PO9A 4DO6A 3E38A 3DCPA 4HOWA 5I24A 1OT2A 4PMDA 2OZ8A 2B31A 2NWSA 1E15A 4DJDD 4GABA 1JDFA 3AHXA 2Q6ZA 3QPZA 2HVNA 1DOSA 5IXEA 4UFIA 2XWDA 2HWGA 2WM1A 2E6AA 3MHUA 4DXVA 4G7FA 2WSRA 4W5ZA 3A4AA 4QAWA 2ZXDA 1O5KA 4FLOA 5A6LA 3VGDA 1NDYA 1NQ6A 5LA1A 4TUFA 3QKEA 3U9IA 2GYIA 4PMJA 4Y9OA 4HCHA 5EMMA 1YRRA 2C1IA 2CLIA 2D2OA 4HSNA 4DXKA 2DVUA 3ABOA 5REQB 1IEXA 1T7LA 4UOJA 2TAAA 3CL6A 3OYZA 3EX4A 2GOUA 1TTPA 3DGBA 4ZZ9A 5F1VA 4XX6A 2V82A 3FYYA 3WFLA 3II1A 2XGZA 1RD6A 2GLKA 2W61A 3BDKA 3TYDA 1RHCA 2C1GA 5I02A 1SSDA 3VDCA 3FGCA 5HPOA 2FLIA 4LTSA 1WBJA 1VYRA 2EAWA 5EPDA 3MV01 3LI1A 4KWUA 3ALFA 3VD9A 5LIXX 4AX6A 2INFA 1S39A 3G1XA 1AW2A 4GMEA 1V3LA 1UD3A 1TYGA 1QHPA 1SU5A 2YLLA 2VEFA 4N2YA 2OB3A 3SCPA 4WXYA 1KKRA 1JZ8A 5AHEA 3CO8A 3CAQA 3ARQA 1WKYA 2OR2A 5A6MA 2TODA 1F9CA 3QXBA 4IPNB 2QS8A 1RJPA 2INEA 2PP1A 3AWNA 3OZMA 5LIUX 1F6YA 5FL1A 1W5OA 1E56A 3KBSA 1Y7VA 2ZXAA 2WWDA 1RPXA 2VWTA 3UZJA 2A3BA 1T41A 1LL6A 4DBSA 3CB3A 2Y7GA 3CWOX 1EYWA 4B5VA 4ACZB 2VUYA 4X9SA 2WJZA 1DBTA 2YCJA 3I10A 3G0UA 1GVFA 2WB5A 2WKLA 1OC6A 3K4WA 5DCDA 1RZMA 2GK1A 4HYWA 1OFEA 4JTGA 1K8YA 1LBFA 2FDMA 4NZ4A 2X16A 3TE9A 4LY4A 3SGZA 1AVAA 2QAPA 5H2ZA 1ZENA 2HZGA 1KW1A 3BLFA 3LCLA 3EWWA 3CZEA 4BHYA 1ONWA 1UJPA 5EBUA 2YW3A 4ML4A 2G0WA 1MUWA 1UZ1A 4PGLA 1XWYA 3W2UA 4AZCA 3OLEA 5HJLA 2WC7A 4QEHA 3UR5A 1YXDA 3L4ZA 4XUYA 3W53A 3NVTA 3VOGA 3R12A 4CNOA 2KZHA 4E4PA 3GDLA 3HFYA 3UCDA 3PPCA 2FZ9A 3LLFA 4ACZA 1Z41A 3RPMA 3UT0A 5CAHA 4N4PA 1THFD 3M0YA 2FVMA 4C6PA 4YVXA 1JUEA 2ZDRA 4J4KA 2ZUNA 1L6SA 3H7VA 4MLRA 3WY1A 5I5RA 1S46A 4A22A 4Z1AA 1POKA 3VM5A 4I5UA 4GNKB 3E2VA 2E8ZA 3GE7A 1C93A 4W84A 1KM1A 3MP5A 1WX0A 2XG9A 2VZSA 3SQLA 3IEBA 1W1ZA 3GU9A 4GNVA 4MFDA 3S0CA 3MI6A 1EA0A 3ABZA 1XLCA 3MS8A 4FA3A 1UWQA 1SMAA 3TLLA 3NFUA 1GONA 4RPQA 3RCNA 1EJSC 3R11A 2WJFA 1FA2A 3DESA 2JF6A 2X30A 2VC5A 1AZ1A 5G4EA 4XAYA 1D3CA 4XZNX 3P3BA 3EKLA 4FX8A 2EG8A 3WH9A 2PPGA 3W71A 3PTDA 3L0GA 1L6WA 2NVDA 4Y9AA 3R25A 1EF2A 1E9LA 1T96A 3WF4A 1ALDA 2BVWA 1J0HA 1PX8A 3LM3A 4XAGA 2WVVB 3WDPP 3BC9A 2QUTA 4HBKA 4PUMA 3RG6A 2FZBA 2XH7A 2F6XA 1YNPA 4WHBA 2XPKA 1V6YA 3U57A 3FYPA 3BW3A 4HJWA 2O56A 1VFLA 1TR9A 1CXIA 2DIJA 4H6QA 4R53A 2VX7A 4E3TA 3LMZA 1H4PA 3SAZA 3UPMA 2FTYA 4X63A 3TSDA 4MOZA 3U2ZA 4DYKA 3TVAA 2OODA 1A4LA 3BJTA 4AX7A 1AUSL 1IE7C 2F2KA 1H1YA 1OB0A 1HGWA 5TAOA 3POCA 4QDPA 1S1PA 1UWTA 2OZ3A 3MCNA 4AD4A 1AMYA 1W9PA 2J13A 1JCMP 1LTDA 4KCUA 4ZFMA 3PZVA 4KIRA 4JDBA 4JQ3A 1NSJA 5A8MA 3BLKA 1PX4A 1X7IA 4X2RA 3YPIA 4RDVA 5F2MA 1MW2A 5C9RA 4H2CA 1D7FA 3VOIA 1OIMA 1A4MA 1V0KA 4LBRA 2VQTA 3W6LA 3EMCA 3WD4A 1J96A 4DBWA 1C3FA 3IUDA 1N55A 3CAVA 4BKNA