1I1XA

1.11 a atomic resolution structure of a thermostable xylanase from thermoascus aurantiacus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
302
structure length
302
Chain Sequence
b'EAAQSVDQLIKARGKVYFGVATDQNRLTTGKNAAIIQANFGQVTPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIRGHTLVWHSQLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVNEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYINDYNLDSASYPKTQAIVNRVKKWRAAGVPIDGIGSQTHLSAGQGASVLQALPLLASAGTPEVAITELDVAGASSTDYVNVVNACLNVSSCVGITVWGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQNLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Thermostable xylanase from Thermoascus aurantiacus at ultrahigh resolution (0.89 A) at 100 K and atomic resolution (1.11 A) at 293 K refined anisotropically to small-molecule accuracy.
pubmed doi rcsb
molecule tags Hydrolase
total genus 120
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1i1xA00
4HPHA 4N42A 4BCEA 1E0XA 1HT6A 3OB8A 1E0VA 2BV9A 2NT0A 4C7FA 3WFZA 1JZ4A 3BAWA 2J7BA 1HJQA 2Y4SA 1JAKA 2AMGA 1BGGA 1W9PA 3AYSA 3L4TA 3DYMA 5E9AA 1W9BM 2V3FA 1B3WA 2WLZA 3VD9A 2EEXA 2DT2A 3TTSA 2WMIB 1UKTA 3WQVA 5A8PA 2E3ZA 3K8LA 1E43A 3GM8A 1WPCA 3WIJA 3AI0A 4LYPA 2G3IA 1X6LA 1HKIA 3B8SA 4F79A 2Y8KA 2GSJA 3PZ9A 4EE9A 3TTOA 4MB3A 1JYNA 2XHYA 4PSPA 3ZJ7A 3A3HA 4NSBA 9CGTA 3I3EA 1H09A 1J01A 1E4NA 2FGZA 4GKLA 5CQ1A 2HISA 1E6ZA 4PMNA 3B9AA 2WK2A 5A69A 2WPGA 5IHSA 4GIAA 2GJXB 4F9DA 1W1YA 4YN5A 1HX0A 5A2BA 5I3DA 1E15A 4JFUA 5E0FA 1E6QM 1J9YA 3NSNA 2WWDA 3AFBA 1XHGA 4HA3A 2VCCA 4AIOA 2XIBA 3VMOA 1W9VA 3ZSSA 1QNRA 3ARXA 4IM4A 4IISA 3N15A 4HZ8A 1UR1A 4DWSB 3AIVA 1NWUA 2YKKA 1B9ZA 1FFQA 1K9TA 2VJXA 4B16A 3N18A 4H8HA 3DHPA 4FLRA 5ABHA 4F66A 5IXEA 1UH3A 1K9FA 5IFPA 4MAVA 1CXFA 1KQYA 4MNMA 3RJYA 2YL9A 2J8GA 3VGBA 4HOWA 2D3NA 4GI6A 2AAAA 1E4LA 1CGTA 5A3HA 2BNJA 4HOXA 4W93A 4CU7A 2D0GA 5GNYA 4GZEA 3CZ8A 4CU8A 1H0GA 3UEQA 3RM9A 2WXDM 5CGMA 1C91A 3CHFA 3VOCA 3M6DA 4XB3A 3MO4A 1CBGA 1E1EA 2F2HA 1J0IA 1JNDA 1MW1A 1XC6A 4PMXA 3I3BA 2VX6A 2ZX5A 1JDCA 1WE5A 3BSGA 3D3AA 4UFLA 1VEMA 3VKKA 4A4AA 4UZSA 1PX3A 1I1XA 4DUXA 3L4WA 3KEHA 4H7VA 1KR0A 7CGTA 3CPUA 3NCOA 4WIWA 4D1JA 2A3EA 1CXLA 5CPTA 3CTTA 4QLLA 3WH5A 2D22A 1VJZA 2Z1KA 3WMBA 1E4IA 3IJ7A 4GQQA 4AEFA 4RE2A 3PZGA 3AMDA 3L2LA 1NM9A 1W1TA 4TTUA 1M01A 1SYTA 2J7FA 5CSUA 3AQUA 2ZUUA 1JYVA 3CZGA 2J78A 2VL4A 3NSXA 3LPPA 1QNSA 1CECA 3WSUA 3DYPA 3WD4A 2WVVB 5I77A 4QLJA 2WW5A 3AMGA 2VVNA 3HU7A 2IUZA 2VR4A 3AOFA 5I24A 3SCTA 2XGIA 1WZKA 2CPUA 2C8NA 2XG9A 1C93A 4UCFA 1GPFA 1QNQA 1BHGA 2ZWYA 1A47A 4BQ4A 5I79A 1GHSA 1GVYA 2J62A 2ZX7A 2BY3A 3VD5A 3EDKA 1MYRA 1K9DA 3ZR5A 1LJYA 2QF8A 3MMUA 1BFNA 4AZBA 1B1YA 3G6LA 1EQPA 3GNOA 3T2QA 1E6PA 1C8YA 1PIFA 3AMKA 1XRVA 2VX4A 2J7EA 4XV0A 2GK1B 2IXVA 3S2CA 2WVUA 3M7SA 1W1PA 4D72A 1GW1A 3VIPA 3BH4A 2VZUA 5A6BA 1UR4A 3BCFA 4AISA 2JIWA 3NDYA 4HA4A 3SCPA 1CLXA 4D6EA 2PWHA 2CITA 1OBAA 4CCEA 2GJRA 1E71M 2VTFA 4PMDA 3ZQ9A 4ACYA 1GHRA 2DGAA 3QOMA 4AZ6A 1JZ3A 1JL8A 3SCVA 1QOXA 4V2XA 1PAMA 1EHAA 2YBUA 2WHMA 3KWXA 2WZHA 4MDPA 3VDAA 1RP9A 1UR2A 2ZX9A 1PX8A 3T09A 4L4PA 3B9EA 1JZ5A 3CIVA 3KE0A 4J3UA 3W25A 2XSAA 5BYWA 3GYCA 3MMWA 5D9MA 1FA2A 5BROA 1MFUA 1UWUA 1V6WA 1BF2A 3CZEA 4AZIA 3CZJA 1W1VA 1CXIA 3ARSA 1J18A 5C70A 4W8LA 1V6YA 2VQTA 3WD1A 1GORA 3EDFA 2GDVA 2BXYA 1V03A 4WKFA 3OG2A 1RPKA 1V02E 4A3HA 3F5JA 4UOJA 1C8XA 3AXIA 3AJ7A 1QI3A 3WF2A 3RMEA 3GXMA 3WQWA 1V3HA 1V6VA 1F4AA 3UG5A 5I5RA 1WZAA 2W66A 4D6GA 1QNPA 4Z2KA 4CGTA 2WWCA 3VIGA 4AEEA 2WVTA 3SCSA 5CLTA 1E40A 4TUFA 2ZXDA 4IPNB 2DH3A 5A8QA 5E09A 4CU6A 3VIHA 3BAKA 2J7DA 3EDDA 2D1ZA 3WQ8A 2WMIA 4JKKA 2QPUA 5DO8A 3VD7A 3OZOA 3SCUA 2UWFA 1HIZA 3DC0A 4FLOA 1W3HA 2JF6A 1C8QA 3T0AA 3ZR6A 1YHTA 1HKKA 1HP5A 4JFVA 2J8FA 3ZT6A 4WSKA 2DSVA 1EO7A 2YLLA 3AROA 2PWDA 2YDQA 5HDRA 3PBGA 3WDPP 1KBBA 2YBTA 3QOKA 1CLVA 1BYDA 1DWGM 3L4ZA 3ARRA 1BTCA 1R7AA 5A6MA 3PZNA 1VRXA 2GJXA 5D8ZA 1CNVA 1ZBWA 3ARPA 2NW0A 4BQ5A 1H49A 2V3EA 2W5FA 4GO9A 1JF5A 4P8VA 1V08A 3CO4A 2PF0A 1E5JA 1D7FA 4TVDA 5CGTA 3HMCA 3NSMA 1JDAA 3RPMA 4NI3A 4D6IA 3CZLA 2CBVA 4JL2A 3CUHA 4MDOA 2Y5EA 3THDA 4UFKA 2YA0A 2BVDA 1PPIA 4P7QA 4CVUA 1UOKA 4JFWA 4X0NA 3K8KA 1XH0A 2D3LA 4UQBA 1H11A 3AS3A 1EIBA 3ARUA 5A95A 1EHNA 3VGHA 1S46A 3SURA 2E9BA 2CYGA 5A8NA 2JF7A 3BAYA 4UFJA 4H41A 3NYDA 5I23A 1BVZA 1Q6CA 4MB5A 1OB0A 3VIIA 3BAJA 3KL0A 1V3JA 2EPOA 2QLYA 1H3GA 1VAHA 2XVKA 3ARQA 2W4XA 2ZX6A 2BVYA 4S3KA 4E4PA 1CTNA 1L8NA 3AIWA 1WZMA 2O92A 3CUGA 2WMHA 3IJ9A 2OWCA 4K68A 1JZ7A 3ZIZA 5BXRA 3FAXA 1XSIA 4PTWA 3VM5A 3ZT7A 3LMYA 3ARWA 4X9YA 5F7UA 1TZ7A 4U3AA 4GXPA 4PMYA 4Q7NA 4TVCA 3WQ5A 1ZBCA 2CCRA 4JFTA 4QAWA 4PTXA 2YIHA 3SUTA 2V3GA 4UQEA 3W4RA 1G1YA 5EB8A 2E0PA 1RP8A 4UOZA 2YA2A 2ZUMA 5A6BD 2QHAA 3A47A 1CENA 4U33A 1KWKA 1ZS2A 1EH9A 5AC5A 1UA3A 3W37A 3B9DA 5HNNA 1QBBA 3CUJA 4OOUA 2WAGA 3F5KA 2YL6A 5EFDA 3AMLA 2D24A 4CVWA 2EO7A 3BLPX 1ECEA 1CZ1A 3WNLA 2XWEA 4JZ5A 3SIMA 2QMJA 1OGGA 3WF3A 1E3XA 5IDIA 4PUDA 3GDBA 5I2UA 4W8BA 1V6UA 4ACZB 4P7LA 2UY5A 2J25A 1AVAA 1IT0A 2PBOA 1LG2A 4J3WA 5DF0A 3A4XA 2W62A 1M53A 2EPMX 1J10A 4WKAA 2E8YA 2GDUA 3VIFA 1W3LA 2VX5A 1UWRA 1FHDA 3W81A 5CZKA 2PWGA 2VI0A 2JEQA 3EBVA 3QR3A 4PSRA 2GJPA 2XVPA 4OBRA 3HJEA 3IAPA 1UD8A 4DWSD 5GPRA 3RO8A 3ZOAA 1BVNP 4D1IA 4QCEA 4QFUA 2CBJA 4M82A 2WBKA 5IHRA 2AOSA 5AC4A 1W9DM 4M24A 5JBEA 1GJWA 3DHUA 1B3YA 3OA5A 1VFMA 3VTRA 1XYZA 3CH9A 3WQ6A 4WK9A 1R8LA 3PTMA 2BHZA 3TTYA 1B3VA 4J3XA 5FD0A 4AZHA 4LX4A 2J47A 3WMCA 1XCXA 2DT0A 1Q6DA 1X6NA 5FKYA 3FHAA 1TVNA 1GQLA 2BY0A 5TD4A 4C7DA 1V3KA 1QPKA 2VR5A 1BQCA 2ESCA 1KR1A 4TVUA 1QHOA 4XX6A 1CGWA 1CWYA 1KFWA 1JD7A 3FW6A 3OGRA 2VNCA 4WSJA 1JYXA 1DWJM 4B9YA 3WH6A 2VUYA 2BHYA 1LLOA 1DWIM 3WQ4A 5IFTA 1PIGA 3HN3A 3AZTA 4U3CA 1VB9A 4W7UA 3D5HA 2G3NA 1WO2A 4UFHA 1AQMA 4AD4A 1GNXA 1VFUA 4TTGA 1TUXA 2PC8A 2F61A 5FL0A 1R87A 1OCQA 1TMQA 4RE4A 1K9EA 1BYAA 4W88A 2DPEA 5A6JA 4GZIA 3N1AA 2QMKA 3MANA 3AHTA 3WL1A 1H41A 2BS9A 1DWAM 2CBIA 3A4AA 2JFEX 3UR7A 1V6XA 1E9LA 2EBNA 3L4XA 3PZUA 3WY1A 4AZCA 1UKOA 1XCWA 1UWTA 1L0PA 1IZKA 1HVXA 3SUUA 4FF5A 2DSZA 5HBFA 1FP8A 1OWQA 4PTMA 4W87A 3T0BA 2OYLA 3O6AA 3ZO9A 4HMDA 3U7BA 3WEOA 2VT0A 3WNNA 1GOQA 1NOWA 2VOTA 3ZMRA 4Z2IA 1GQJA 1C92A 6CGTA 1XV8A 5HPCA 4KWUA 1QI4A 4WJXA 1A3HA 2IXUA 3J7HA 1V0MA 3PHAA 3U5YA 2EPLX 4HPGA 3K8MA 4F9JA 1UHVA 2VO5A 3K4DA 2DIEA 4PEEA 4JAWA 5JBFA 1BSIA 1J0YA 1OT1A 3MSDA 1XH2A 1ISWA 3WNMA 5M5DA 3IK2A 2XM2A 3OLIA 4JIEA 1XSKA 3N11A 1HJWA 4ZXLA 4ATLA 2ZWZA 4HU0A 4D6CA 2A3CA 5CPSA 1E1FA 2X05A 1KXHA 4FK9A 1W2PA 3WNPA 3IJ8A 1F4HA 5BRQA 1UQYA 2E8ZA 3AMCA 2G41A 3VPLA 4FLQA 1ZBVA 1CGXA 1R85A 1SMDA 1UR0A 3PZVA 2QPSA 5AYBA 4FLSA 3RM8A 1E6SM 3PTKA 3VM7A 4MADA 4Z2GA 2WB5A 3EYPA 3WL0A 3MS8A 2CHNA 1PJ9A 1WAWA 2YJQA 4JHZA 5CLWA 1UWSA 4Q22A 2O9TA 2W92A 3E1F1 3SUWA 4PBGA 1TG7A 4W84A 2YDRA 4HMCA 5BXSA 3WNKA 2CXGA 3II1A 2X0HA 2PBGA 4M8UA 1W32A 4LGXA 3AS1A 3VUPA 1JXKA 1E56A 2YL5A 4HMEA 4KH2A 4YPJA 3M07A 3VINA 4OKDA 3SCRA 1US3A 4PMZA 3JUGA 1BG9A 4ZFMA 3L2MA 1B0IA 1JFHA 1AMYA 2A3AA 1QHPA 1D2KA 1M03A 3AISA 1QI2A 3RCNA 1HP4A 1E0WA 4BQ2A 3U57A 3W6MA 2VZSA 1UWIA 1DTUA 4AYSA 4J27A 1C7TA 3W0KA 1ZJBA 2ZICA 3WD2A 3CHCA 4UOQA 5CXPA 4LXFA 4E8CA 3WMSA 5I0DA 2WCAA 5GNXA 1LWHA 3WUFA 2WHKA 1CYGA 1FFRA 2E9LA 1KXTA 4V28A 4ZE4A 4MJ4A 5C71A 3LPGA 2PI6A 1BAGA 2XFYA 1UH4A 2XVLA 4CD5A 3BXWA 4FMVA 3K46A 4H8UA 3FNDA 4CD8A 4F8XA 3AIBA 3ECQA 4BA0A 1GOIA 4UNIA 5DEZA 1WCGA 3VVGA 3WDJA 2FHBA 3W26A 2WC7A 3OZPA 4HA1A 2ZE0A 3OLDA 4QP0A 1QI0A 1UUQA 1Q6GA 4DWSA 1J0ZA 4AZ7A 5A6SA 2XUCA 1ISYA 4XZWA 3AIUA 3PN8A 4ZXOA 3WENA 1HXJA 1PX4A 1BYBA 3GTNA 3VIMA 4M81A 4NRSA 3WDRA 1NQ6A 1SMAA 5EBAA 3UR8A 1DEDA 3ARTA 3SCOA 1UYQA 1C3FA 1VJSA 4C7GA 4MJ2A 4PTVA 2DEPA 1KGUA 2WNWA 2QV4A 3PZTA 1E3ZA 2JALA 1XD1A 1UWQA 2Y2WA 2VRQA 3ZJKA 3WF1A 4AD0A 4W7VA 1AQHA 1EO5A 2VQUA 1NP0A 1CEOA 4GQRA 1NOFA 1GOMA 1W3JA 1CXHA 2F8QA 4IPLA 4M80A 4MAZA 4KGJA 3AZSA 3GXFA 1VBRA 3VILA 1DWHM 3ZM8A 4W5UA 3W27A 2OLHA 2J7HA 4P7RA 1CGYA 4IUGA 4PMOA 1UKQA 5ABGA 2D0HA 2XPKA 3BMWA 1GJUA 3CZKA 1WZLA 3WF4A 1W91A 3POHA 5HXMA 1PBGA 3MUAA 1UZ1A 1ZBKA 2EXOA 3FXYA 4B3KA 4PMUA 2WCSA 2EPNA 5JUVA 1BGAA 2EQDA 1HJVA 1I75A 2ZOXA 3NDZA 4AIUA 1E6XM 1H4PA 4AIEA 1JZ8A 2W63A 2EPKX 1VENA 4ML4A 1OT2A 1G5AA 3VNZA 4Z2JA 1ODUA 5HOSA 3AXXA 1BPLB 1CIUA 2EJ1A 4P8XA 3EDEA 4AD5A 2BFGA 5LA0A 5A6LA 1DP0A 3M46A 3AHVA 4MNJA 3SCNA 1J12A 3GBDA 5BRPA 3TTQA 2DH2A 3AIRA 1KQZA 3T08A 5LA2A 1NWSA 5CG0A 3UERA 1LQ0A 1EA9C 1ZU8A 4V27A 1WDSA 2V3DA 3GXIA 5D8WA 4ZE5A 1JI2A 3WN6A 2WMKA 4CN1A 4WLCA 1DHKA 1CPUA 2WMFA 2DIJA 1LL7A 3UESA 3KZSA 1OINA 3CUIA 1BG4A 4D6FA 2DT1A 3BC9A 2XTKA 2C7FA 2W67A 1M7XA 2CERA 1YQ2A 2WSKA 1E5NA 2XVNA 2ZUTA 2O9OA 2WM0A 1MWOA 1JI1A 5DT5A 4PRWA 2Y8VA 3PZIA 3MKKA 3AHXA 1ESWA 3RDKA 3N13A 4P7NA 7A3HA 1E72M 3A4WA 1UA7A 1WDPA 2GVYA 3KL3A 1TFVA 4UQDA 4QLKA 3WBAA 1GOWA 2WVVA 3PTQA 4KRTA 4U2YA 4AD3A 3WFLA 5A6AA 3ALFA 1UD2A 4KRUA 3T2OA 4U5KA 3TA9A 4JKMA 3VDBA 4W7WA 3OLGA 4BF7A 5E70A 1UD3A 4DUVA 4UZUA 5JIWA 1HVQA 2CKSA 1GZJA 3BMVA 3MUY1 1GQKA 1IZJA 3OGVA 2VRKA 3AIEA 3QGVA 3BCDA 1LWJA 4TX8A 1SFSA 4JKLA 3GBEA 3L4UA 2BHUA 5D9NA 3RJXA 4TX6A 3LPFA 5ABFB 5BXPA 2WHJA 1V0KA 2GK1A 2XFRA 4HU8A 1U2YA 2X8RA 1UZ4A 4J3VA 4W85A 3MMDA 1OD0A 2ZXBA 2CIPA 2NT1A 3T0DA 3OBAA 5CPQA 1KCLA 3BGAA 2DDXA 5KEZA 4DUWA 3I3DA 1CGVA 4YHEA 3MV01 4MB4A 3BAXA 4B15A 4CN4A 2UY4A 4L4OA 6A3HA 1WDRA 4PN2A 2Q8XA 1B2YA 2CNCA 4AZGA 4LPCA 1VFFA 4JCLA 1PZ3A 2ZX8A 3FY1A 4UR9A 4J7RA 3MUZ1 7TAAA 2FGLA 3U7VA 2J4GA 1V0NA 1QW8A 3AICA 1QVBA 2XIIA 1OM0A 4UQ9A 1HJUA 2WMGA 4P8UA 1WB0A 4D71A 4EANA 4M56A 2DQXA 1ZB5A 3GH7A 5ECUA 2FH6A 3AXHA 1JFXA 4Z2HA 1E6RA 3MUIA 4EAMA 1EXPA 1EOKA 2A3HA 2D2OA 3ALGA 4J28A 5D9OA 1WDQA 4S3JA 3W38A 3AS0A 5GQBA 1JF6A 1NOUA 2WC3A 4R5EA 4J3TA 3VIOA 3EMZA 3WDHA 3EDJA 4AMCA 2ZUVA 5AY7A 4B9ZA 2V5CA 2G8ZA 1KB3A 1J0HA 3F4VA 3W29A 3W53A 3CLWA 3SCQA 1Y7VA 4NRRA 5BCAA 4CD7A 3N9KA 3IANA 3CHDA 3ZT5A 2BY1A 1P6WA 4AC1X 1U33A 1JXJA 5I6SA 1W2VA 1NARA 3DYOA 5A94A 3WD0A 3AIQA 3PZOA 2FH8A 5HPOA 5JIPA 1B31A 1OSEA 1HJXA 1W9UA 1SR0A 3ZSTA 3VX1A 4AY1A 4JL1A 3FN9A 3TOPA 6TAAA 4ATWA 1HL9A 1GONA 3L4YA 1UH2A 2OWWA 3VGDA 3WH8A 4AD2A 4H8VA 3TP4A 3ARYA 2ZUSA 1HKMA 2CESA 1G9HA 4TOQA 4DWSC 5LYRA 4AWEA 4BZYA 2WMJA 3VD3A 1GCYA 1WKYA 5EFFA 1FH7A 1UD6A 2D0FA 1Q4NX 4KMQA 5AYIA 1LF1A 3AYRA 1US2A 1B90A 4GI9A 2YOCA 2VZOA 5E6YA 1EQCA 4BQ3A 1XH1A 2OWXA 3TONA 3OIHA 4DM2A 1K6AA 3VDCA 2XYLA 4HP5A 1EGZA 2WHLA 2WC4A 4BS0A 3G6MA 1B3ZA 2UY2A 2YLAA 4W5ZA 2HVMA 2X1IA 2OYMA 1R86A 4OOZA 1JYWA 1PEZA 1HL8A 1GUVA 4YHGA 1MQRA 4Y7EA 3N04A 5M3WA 1HF6A 1WNOA 2VURA 1KXQA 2G3JA 4QCFA 3WH9A 3VX0A 2UY3A 1VEOA 3RM4A 8CGTA 1NWTA 2WZIA 1TA3B 1MQQA 5A6KA 4PMRA 1AQ0A 2DSUA 1FP9A 1MQPA 1XGZA 1G0CA 5CJ5A 1W9XA 1UQZA 3ZJ8A 4U31A 1H2JA 3AHYA 3VMPA 1KBKA 8A3HA 1Q6EA 4PMQA 1ISXA 2BY2A 3ARVA 1GOKA 3CUFA 3NUKA 2Z1SA 1H0IA 2XJ7A 4R27A 4W89A 4CD6A 1IV8A 1J11A 4EK7A 2CBUA 1CXEA 3UG3A 2ZXAA 4P7OA 5BXTA 4NF7A 5C8BB 2FHCA 4Z2LA 4PUEA 1MW2A 4E8DA 2J77A 4PYSA 1FH9A 1MW3A 3S6TA 3SUSA 2JIEA 1QNOA 1VIWA 2J7CA 1UG6A 3WNOA 1UD5A 4CCCA 3CMGA 2J74A 2CEQA 1O6IA 3ARZA 3VD4A 5CSYA 5GNZA 4CN6A 4HTYA 4D6HA 1ISVA 4U5IA 3F5LA 1UD4A 1KGWA 3VGGA 3W28A 2RGMA 5E0CA 1NWRA 4OBSA 1V3MA 4J3SA 3WH7A 3UETA 5EMYA 4UQCA 1JDDA 3K4AA 2VVSA 1E73M 2OSWA 3WUEA 4AXNA 2WBGA 1OIFA 3PZMA 4ACZA 1ZL1A 1R7OA 1E70M 2ZIDA 3WDIA 4PCSA 4GI8A 1EOMA 3ZJ6A 3GH5A 3AZRA 1QW9A 3SEPA 2XSBA 4D6DA 1NH6A 5ABFA 1JGIA 5DFAA 1VF8A 3BLKA 1KXVA 2DSKA 4HZ6A 1GOOA 4W8AA 2XWDA 1TE1A 2JE8A 2GFTA 1OGSA 3VO0A 1J0KA 2J7GA 3MU7A 2YA1A 5A8MA 5D9PA 1M04A 1VFOA 1ITCA 1XSJA 4A3YA 4HOZA 2VMFA 3CBWA 1KGXA 1BYCA 3O9NA 2V38A 4P8WA 1UKPA 3K1DA 1I1WA 2XM1A 4W86A 1JZ2A 2VZTA 5A1AA 4MPKA 3VIKA 4LYQA 3WBEA 2J79A 4X0VA 3SCWA 5M17A 2E4TA 1G94A 4CCDA 2WYSA 1G01A 1QI5A 1TCMA 2W61A 3EMCA 2BVTA 1XD0A 2WSPA 1E4MM 4KGLA 2XGBA 4AZCB 1UKSA 2D20A 2CHOA 3WDQA 2G4FA 1H1NA 1BLIA 3QHMA 2J75A 3UCQA 2VCBA 4AZ5A 2WLYA 4UFMA 5BWFA 1V02A 1CXKA 1JD9A 1HJSA 3BSHA 1UR9A 3NJ3A 1U30A 5A2AA 1JNEA 2Y24A 2OSYA 4ATDA 3VU2A 1FOBA 2W91A 4WF7A 1VEPA 3VMNA 3GXDA 2WANA 2X0YA 1EDTA 5LA1A 1Q6FA 2TAAA 1UR8A 3MV11 3CMJA 2WZEA 5FL1A 1CGUA 2E40A 1JIBA 1KWGA 3N12A 3PZQA 2ZUWA 1B30A 3DECA 3SUVA 5FCZA 3T2PA 1JG9A 3N17A 4MTVA 1ISZA 1FH8A 3WF0A 4AD1A 4PMVA 2C0HA 1N82A 4OUEA 3WEMA 1EDGA 1Z32X 3KL5A 5I78A 4U2ZA 4NZCA 1XYFA 2WCGA 2CKRA 4CD4A 3U5UA 3QHOA 1C90A 2A3BA 3GZAA 4QDMA 4TXEA 3NIYA 1OGBA 1MFVA 1LL4A 1KCKA 3OGSA 2JEPA 3LPOA 3RILA 3CHEA 2VRJA 3A6OA 4EKJA 2NSXA 4H2CA 2GUYA 3W6LA 4XZBA 1C7SA 2RGLA 2OYKA 5M03A 3W82A 1B3XA 4OJYA 3AHZA 1MXDA 4JFSA 4D6JA 3WEZA 2O9PA 4MNKA 4URIA 3OLEA 4ZEPA 3WUGA 2YDSA 3GNPA 1JZ6A 2ZUNA 2FHFA 3CGTA 4RE3A 2VCAA 1DWFM 4N0RA 3QHNA 2PWFA 1HN1A 4PCTA 2VX7A 4LYRA 4GZJA 1OIMA 2YL8A 1TR1A 1GVIA 5JBDA 1E6NA 3RIKA 3IAQA 4XUYA 1V3LA 5D4YA 1H5VA 4JCMA 2XFFA 3GH4A 1LL6A 4RL3A 2BXZA 1GQIA 1MVYA 1E55A 3VNYA 3WELA 4HZ7A 1V3IA 1JAEA 4LQ1A 1CDGA 4UFIA 2DSWA 3VIJA 2WKGA 2WKLA 5KZ6A 1WP6A 4H04A 4CKQA 1LG1A 1ODZA 1W3KA 3BAIA 4JHOA 4ZENA 2MANA 4WKHA 3WD3A 3MSGA 5A2CA 5DT7A 3W24A 1MXGA 3POCA 4GPNA 1J0JA 2G3MA 3EMQA 1O7AA 1QHZA 1PZ2A 2O9RA 2V5DA 3WUBA 1TA3A 2E9MA 1RH9A 2FDMA 5A8OA 4UQAA 4M1RA 1D3CA 2OSXA 3L4VA 2CETA 4OIFA 3UG4A 2VC9A 3FAWA 3VDHA 4OZOA 4AW7A 3WKZA 3GNRA 4GO8A 1RD6A 3O2LA 4CUCA 5FOOA 2X2YA 4B3LA 5E6ZA 2PWEA 1X1NA 5ABEA 1HKJA 3AS2A 2D23A 1NP2A 2DT3A 3VGEA 1MW0A 1FHLA 2PB1A 3VGFA 4UTFA 1TVPA 2XVGA 4M29A 1V0LA 2X09A 1OD8A 4E2OA 4MB1A 4DM1A 3FHQA 1ZJAA 1VBUA 2B31A 4GINA 2ZXQA 5FIPA 3APGA 2VZVA 1EDQA 4MNLA 5DMYA 1ITXA 3THCA 1HNYA 1QBAA 2WVSA
chains in the Genus database with same CATH superfamily
4BCEA 1KV8A 3EOEA 3CPRA 1E0VA 4MLJA 2Y7GA 4FAMA 2IKHA 1YE4A 2PZ0A 1DORA 3WJSA 2J7BA 1IT7A 3GKFA 4O1DA 3W7IA 4A8NA 1BGGA 2WNQA 2GGHA 1ZLPA 4JX4A 2CZEA 4OT7A 3AYSA 1MI3A 5H8MA 5PTDA 3T4CA 4AYGA 2OPJA 3N29A 2QUMA 2FLIA 2WMIB 5AN7A 2HPIA 4KIRA 2HRWA 2DVUA 1W5PA 4WY0F 4FNTA 1WPCA 1TIMA 3I4EA 3IIXA 4OU1A 3HG2A 3VC6A 1HKIA 3PBWA 2KX9A 4C91A 4O10A 2PGRA 3TE9A 1H5YA 4EE9A 2YYUA 3GE7A 2PF8A 2XHYA 1K7FA 4LW7A 3PULA 4JYFA 4K8HA 5K7JA 3OO2A 2QULA 3VNDA 4PMNA 4KWVA 2WK2A 5EY5A 2P88A 3LENA 1ALDA 1TQJA 4IWWA 1E15A 1LRTA 2XZ7A 3AFBA 3EOUA 1MZHA 3LZ3A 3EB4A 2EPHA 3B0PA 4AIOA 2XIBA 4ZO6A 1W9VA 2ZADA 3ITOA 2QYGA 4JYDA 3GU9A 3ARXA 1FCQA 2E77A 3L65A 2YKKA 3FKKA 1K9TA 2VJXA 3EXTA 5ABHA 4F66A 4MAVA 2YFOA 3KWSA 1KQYA 4WHBA 2YL9A 3W85A 3O8AA 1DQWA 1A53A 3MB9A 3LQLA 1KBIA 2Q09A 2OZ0A 4IP5A 1UZHA 2GPTA 3LU2A 4L61A 4G6CA 1S5TA 3TN6A 5GNYA 4GZEA 1KRBC 1H0GA 4AY7A 1OF8A 4FI4A 5DCDA 1KTNA 4IPIA 1TZ9A 1J93A 3VOCA 3M6DA 1SJCA 4DZ5A 2F2HA 3LHWA 3WQDA 4C1NA 3QSRA 3NZGA 4AH7A 5C9XA 3VKKA 5DX7A 5CKSA 2PTXA 4DUXA 4X63A 5HMFA 4F0MA 4D1JA 3NCOA 4WIWA 3USZA 1CXLA 3MZ2A 1S5NA 1R3WA 2A85A 2D22A 1VJZA 2Z1KA 4QE4A 1B3OA 1JQVA 3VCNA 4GQQA 1WDDA 3TQKA 1G6CA 3L2LA 5K4XA 4C6CA 4YNGA 1X96A 5MKGA 2J78A 2QT3A 2QS8A 4UTHA 1JPDX 2YFNA 4UB9A 4QLJA 3I7SA 1ITQA 2PTDA 2IUZA 5T91A 3AOFA 5J04A 1YADA 3SCTA 3TNOA 2QPXA 4DJEA 3OYZA 2C8NA 4UCFA 2P10A 1A47A 1ZFJA 1GVYA 1R9ZA 2ZX7A 1IZCA 1MYRA 3SQLA 2ZZ3A 4BI6A 4NUWA 2Q01A 3T2QA 2BSLA 1W1ZA 1XRVA 2VX4A 4LV4A 4XV0A 2QF7A 4YU1A 5C7VA 1QPQA 4JTQA 3VIPA 1UR4A 1DIDA 3BCFA 1NELA 2ON3A 3SCPA 3H4WA 4D6EA 4JXCA 4RR4A 3ERPA 1P6CA 4IX0A 3TROA 2QDDA 9RUBA 4CQDA 1E71M 1H61A 2PTYA 2VENA 3EWBX 2GZXA 1WKFA 4ACYA 2DGAA 3DFSA 3BQ5A 3QTPA 3R0KA 4CNUA 2QUTA 4J40A 2E6AA 4RXFA 4UC5A 2VEMA 5EPDA 2ZX9A 1FHVA 1ZUAX 2ABBA 1K70A 3B9EA 1TV4A 5BYWA 2TSYA 2OLAA 5BROA 1UWAA 3E38A 1PDYA 2XSXA 3RR4A 3ARSA 3SSJA 4EOUA 3VKCA 3W86A 4LVBA 2PU0A 1V02E 3CT2A 3WF2A 2FZ9A 3GXMA 1GOXA 1L9WA 5I5RA 3IJDA 1QNPA 3H7VA 3W7GA 3FEMA 2WWCA 2PDNA 2WVTA 4GVFA 3SCSA 1QMLA 1G4SA 2PS2A 3B4UA 3ISIX 1Q7QA 4TUFA 4L65A 3B3DA 4MUPA 2J66A 4AWSA 1YYAA 2DH3A 2O56A 3TMQA 5A8QA 2AKZA 3VIHA 2J7DA 4JDYA 3EDDA 5AHMA 3LHYA 2B7OA 3IVTA 1YX1A 1MNZA 1FCVA 2GSHA 3B03A 3SCUA 1KRAC 1IIHA 3FSTA 1D3HA 3VE9A 4L80A 1W3HA 3T0AA 1YHTA 2AGTA 2G97A 1B5TA 2OXNA 2A5HA 2A6NA 3O16A 1V79A 3VABA 3LQGA 2DSVA 4WJ8A 3AROA 5HDRA 5FEPA 5HR7A 2VKZG 3QOKA 3W7RA 4M5PA 1DWGM 2Y7FA 1GJPA 2GJXA 1TQXA 3DFPA 1G4PA 2DY3A 3ITLA 1H49A 3B8UA 2W5FA 3NO1A 4LVDA 1JF5A 3QR1A 1V08A 3U2ZA 1E5JA 3PWIA 3HMCA 4IF2A 3ONBA 5FF7A 1D9EA 3CUHA 1QFEA 3THDA 3IGHX 2OQHA 4PC8A 1DBTA 2TPSA 4CVUA 1U5VA 1VFTA 3TZNA 2FPTA 2D3LA 3BICA 1H11A 3QBUA 1OHLA 1FQ0A 3GVWA 4DY1A 1JPKA 1YDYA 2E9BA 3E2SA 3MBDA 2JF7A 4I9JA 1EPXA 4UFJA 3BJSA 3TIMA 2H9AA 4LUTB 3T8LA 4KEVA 5AYZA 1BVZA 3ANVA 1ME8A 5RUBA 1ZGDA 1A3XA 3KL0A 5D2VA 2ATMA 3S2LA 2R1KA 1EP2A 2KAUC 1BQGA 4XK2A 4TQTA 4H83A 2NQHA 2YXGA 2O92A 4DQWA 2OWCA 1JRBA 1JZ7A 3ZIZA 1V77A 4OE7A 2PDYA 3ZT7A 2GOKA 1RALA 3ARWA 6ENLA 2DZPA 1TZ7A 4Q7NA 4NZ3A 1FWTA 2WJFA 3BLEA 1KTBA 3DG3A 1ZBCA 1EEXA 4JFTA 5FEZA 3CEUA 2YIHA 4E0CA 3W4RA 2E0PA 1RP8A 4UOZA 2WQDA 3P84A 1W5OA 3MPGA 5A6BD 2C19A 5HNTA 1CENA 2C15A 4U33A 1BRLB 3NDOA 3E5BA 1X38A 4ZOBA 3B9DA 5HNNA 4S2CA 5J5DA 4OOUA 2DVXA 4XZMX 3R12A 1PZ0A 3W87A 4CVWA 2EO7A 3DBPA 1CZ1A 3WNLA 3P62A 3CV6A 2FPVA 5IDIA 4ZQPA 1WAUA 5LIWX 5LIXX 1F6YA 1GTHA 1XQLA 4J3WA 2INFA 4GYKA 1M53A 3QPZA 4OQVA 3F4DA 2EPMX 4UTWA 1W3LA 2VX5A 4LCRA 1Z6KA 4XZNX 2VYOA 5C7HA 2PWGA 2JEQA 2Z24A 3N6JA 1U1JA 2GJPA 3P7YA 1KLZA 5GPRA 3QV6A 1EYWA 3PANA 3RO8A 1BVNP 4GKTA 4QCEA 1KM1A 1RBLA 3BVJA 1ZNNA 2WBKA 1UC4A 4XD6A 4XO7A 2VEFA 1M1BA 4LANA 3QVQA 1SO4A 2W27A 4C6QA 4JIHA 1B3YA 5HQEA 1GVQA 1EX1A 4HCDA 1R8LA 2B7NA 2YW3A 4MG4A 1F3TA 4LC8A 5FD0A 4AHOA 4LX4A 1XCXA 1Q6DA 3VKAA 1C9DA 2Z2BA 3NNTA 1N8FA 1OX5A 3FHAA 4DJEC 1GQLA 1AJ2A 3EOLA 3EAUA 1CGWA 1JD7A 3FW6A 2VNCA 3U4FA 2JQXA 3I7RA 1JYXA 1EJSC 3WH6A 3LERA 3HN3A 3B8VA 3GDKA 3CEPA 2VELA 4Q8PA 2GWGA 3N2XA 3UA3A 2NVDA 4OFCA 2EF9A 4TTGA 4ZQNA 4PB5A 1EXBA 2PC8A 1TMQA 1FCBA 1BYAA 4W88A 1IIGA 3QQ1A 5FEWA 3FEQA 3N1AA 3WL1A 3I65A 4HHLA 1UMYA 1IR1A 1TIWA 3MMTA 1TPUA 3S4TA 1KFLA 2CLIA 2PLMA 5HBFA 2PC4A 3P93A 3MBFA 4W87A 3ELFA 3CHVA 3C8NA 4O54A 3U7BA 2NUWA 3CWHA 5A8GA 1NOWA 3GXPA 1O12A 2VOTA 4UTJA 2ISFA 3NA8A 3NYZA 3LZ5A 6CGTA 1R5YA 1TVLA 2YGYA 3J7HA 3PHAA 4DB7A 2B0MA 1JPHA 3EEGA 1EJ7L 3EWYA 4Z17A 5KINA 1SUXA 4X22A 3MCNA 1ZZMA 3QPEA 4K1WA 4HU0A 5CC6A 3LCGA 2X05A 5K9CA 1KXHA 3FKRA 1F4HA 1UQYA 3L9CA 2Z0IA 3CPGA 3ZR4A 2PFHA 2G41A 2NLIA 2YW4A 4P61A 1K1DA 3PZVA 5K3VA 4LV9A 4ML9A 4FLSA 4RZ6A 3RM8A 4XD3A 4PE8A 3PK7A 1GG0A 3MS8A 3FYYA 3RHGA 2O9TA 3SUWA 4W84A 2PLJA 2YDRA 4LU0A 4NU7A 5BXSA 3WNKA 1EUAA 3TX9A 2X0HA 4M8UA 3VOGA 1JXKA 4HTBA 3UXLA 3MW7A 2OFJA 3DBNA 4H7CA 1WUEA 3BV7A 1Y5VA 4PMZA 3L2MA 4UTUA 3T6CA 3TN5A 1JFHA 1AMYA 1QHPA 3Q67A 3P81A 2GJNA 2C1IA 4IJRA 2ZA2A 4B92A 1M03A 3L5LA 3RCNA 4BQ2A 3DIPA 1T41A 5DY3A 1HZYA 1DTUA 4UXDA 5E93A 3MHUA 4O50A 3CHCA 5CXPA 2F2KA 2BP1A 2ZZ5A 5I0DA 2F6XA 4DYEA 1LWHA 2P50A 3GXTA 2WHKA 4DF1A 1K02A 2E9LA 5C71A 3U2OA 1X7IA 1UJQA 3BXWA 4KCVA 1PB0A 5FF4A 5AHNA 1W8SA 4CD8A 2YXOA 3VOIA 2DZVA 1SJBA 5DEZA 1WCGA 3VVGA 3WDJA 3W26A 2ZE0A 2POTA 1A0EA 1J6OA 4HZMA 4K39A 2XUCA 1ISYA 2OEJA 1W1B1 2GDQA 3WENA 3GC4A 3CUXA 1A3WA 1BYBA 3VIMA 1I8JA 3WDRA 3UR8A 1DEDA 1FDJA 4PL2A 2FZMA 1C3FA 4E2VA 1KC7A 1W6TA 3JR2A 4C7GA 1S2AA 2WNWA 3PZTA 4GA8A 4S3BA 1UWQA 2Y2WA 2VRQA 4C60A 5GJNA 3TQPA 4HVXA 1SSDA 5F1UA 1F07A 3G1VA 2VQUA 3THAA 3VA8A 5HWNA 2FGBA 3V5CA 4AB4A 4GYFA 1CEOA 4J35A 3CAQA 5IBXC 4EWJA 4O11A 4M80A 3V1PA 5CCZA 3AZSA 1TV2A 1EGVA 3GXFA 3M16A 2FFCA 3ZM8A 4DLMA 1DWHM 3GG7A 4DWDA 2CWXA 1OK4A 2J88A 4KCWA 3F4WA 4EPKA 1P0DA 4YIWA 2GQ9A 1H7WA 4EX4A 2IKIA 4DNMA 2VHLA 3H2MA 2XPKA 2QDGA 4CQ8A 1WQ5A 1GJUA 3WF4A 1W91A 3L0KA 5G4EA 3POHA 3W2LA 4ADTA 1KTCA 3OODA 1Q6LA 2BZNA 2VGFA 1XPGA 3GY1A 3M5VA 2EPNA 1UR3M 4XAPA 4HNVA 2Y88A 2EQDA 2QCCA 1HJVA 1J2BA 5K9DA 4FX8A 1XIEA 4AIEA 1JZ8A 2V5JA 2EPKX 1VENA 2JGQA 4JY9A 2NUYA 3PG9A 1OX4B 4JTUA 4GISA 3LSCA 5HOSA 5E9XA 3G1DA 4JIRA 1A49A 4GOAA 3OQ8A 1UPPA 1CIUA 2EJ1A 3UWYA 4AVFA 1Q66A 1W3NA 5EKYA 1J12A 5FF0A 3GAKA 4KF1A 3GUGA 4ECLA 5AC6A 1KQZA 3H8AA 1XFCA 1NWSA 4S3CA 3MT1A 3JS3A 4V27A 2MUCA 3PTDA 2A6LA 4ZE5A 3T81A 1QUMA 4RNIA 4WLCA 1NFGA 3WLQA 4CEUC 3R25A 1J6PA 3CUIA 3GZ3A 1Q6OA 2DT1A 4A3QA 2C7FA 1LOLA 2FMOA 2WSKA 3TW9A 1XLFA 2ZUTA 4B5XA 1MWOA 4FZIA 5DT5A 3EWUA 2OZTA 5FACA 1POKA 2IKGA 1T7LA 1UA7A 2EG8A 1L6FA 2GVYA 4ICMA 3HF3A 1R3QA 5AFDA 1GVSA 1VBHA 4J4KA 3RUBL 4U2YA 3WFLA 4M7SA 3ALFA 2V6AA 4AEOA 2YCKX 1CLKA 1Q6QA 4UZUA 1TX0A 4PCPA 5AHFA 3TXVA 2DORA 5HUOA 5BOFA 3QY6A 3IIOA 1M7OA 1TJRA 5TF0A 3G22A 3MUY1 4B5NA 1TWZA 3UG8A 2VRKA 3AIEA 1LWJA 4ASTA 3AC0A 4CNPA 3GBEA 2PUZA 2XN1A 2WHJA 1BEUA 2E6FA 1UZ4A 1XYCA 1ZCCA 2ZXBA 2ZZ7A 2QAFA 2NT1A 2IQDA 4ONVA 4KFPA 1KKOA 2DDXA 5DBUA 3H2FA 1OFOA 4JIIX 4LAMA 5KEZA 4YHEA 1NTHA 4MB4A 1AJZA 3BAXA 4B15A 4CN4A 2GL5A 1WDRA 3ITVA 1XLBA 3XINA 2ZX8A 4JQ3A 3W1XA 4J7RA 7TAAA 1F3XA 2FGLA 3U7VA 4B4HA 2QJHA 4DBDA 4U4MA 1R46A 2QAPA 2JGYA 2R8WA 1QATA 1RQEA 1XG3A 3RG6A 1C29A 1GEQA 4I7VA 2HBXA 2WMGA 3P5YA 4CNSA 4EP8C 3ZVIA 3GTXA 5ECUA 3GNNA 4QG9A 3NFUA 4DZIA 3NQGA 3MUIA 1EXPA 3ZLHA 4CQCA 1EOKA 3S6OA 2A3HA 3NO3A 3IGXA 1ZAJA 3C2VA 2VOMA 1MEHA 3KBWA 3G1HA 3AS0A 3ZYZA 1NOUA 2WC3A 4A2RA 4R5EA 3PSWA 1BTMA 2XIJA 1PO9A 1BKSA 4J3TA 4WDWA 5DQPA 3WDHA 2NUXA 4O28A 4GVHA 4LB4A 2OKTA 2J24A 5HAOA 1KB3A 3QKEA 1TPWA 3R0UA 3CLWA 3SCQA 1XBZA 1PYMA 4XWUA 2RJHA 3DFOA 2BY1A 1P6WA 3N2MA 1K03A 1P7TB 3TWBA 5I3KA 4XKYA 1S1PA 3CAKA 1XDJA 3DYOA 3U9IA 3WD0A 3WLNA 2PEVA 3AIQA 3PZOA 1F8MA 3RR1A 3OVRA 1HJXA 1IR2A 1W9UA 1SR0A 2J9YA 1OYBA 2EAWA 1AW1A 1P5BA 6TAAA 1GONA 4IFKB 2PPGA 2DZXA 1IEIA 5DXXA 1RCXB 4Y9NA 3WLJA 5I09A 1EFZA 4X61A 3DI1A 3QH2A 5EGRA 1OVDA 5LYRA 4AWEA 4BZYA 2WMJA 3EXRA 4HYVA 1OFPA 4BFAA 5H1WA 4Q3MA 1LF1A 4F40A 4A29A 4XD4A 4BR1A 1A5CA 3ATZA 5FJIA 2G37A 2OWXA 3TONA 1JPMA 4ZSUA 4HNLA 1FXPA 3HG5A 2WHLA 5JMUA 2WC4A 1MXSA 4BS0A 2UY2A 2YLAA 4JX5A 4JQAA 1TV8A 1W5QA 3IV8A 2HVMA 3GDLA 2OYMA 3WQFA 1K8ZA 4O4VA 2OLSA 1YTEA 1WNOA 3NVDA 1TPFA 2CZ5A 2L5HA 4LVFA 1TA3B 4XSLA 5A6KA 2DSUA 1FP9A 2A0NA 1G0CA 1XL9A 2BOEX 2ZZ1A 3S9YA 8A3HA 2BY2A 3CWNA 3DFQA 4LAZA 4FO4A 8XIAA 2F6UA 3NPWA 1DTNA 1J11A 3IRDA 1CXEA 3UG3A 4YCPA 1IHIA 1WXZA 4NAEB 3T78A 4E8DA 1AZ2A 2DP3A 3SN4A 4MZYA 3SUSA 1UG6A 1EBHA 1M9HA 4Y90A 1REQA 3H26A 2Y85A 2CEQA 4X60A 3RRXA 3ARZA 3VD4A 3WO8A 5GNZA 1BRLA 4CN6A 4QAIA 1W0MA 4UWMA 1ISVA 4GC3A 2QVHA 4PTDA 5E0CA 1NWRA 3WH7A 5EMYA 2BODX 2YCLB 2VVSA 1FXQA 2OSWA 4JTDA 4NZJA 4B90A 1NSJA 1OIFA 2QIIA 1GVFA 4HHHA 2A2IA 1JUEA 5AHLA 2Y70A 2YB4A 2X1SA 1RBOB 5CC7A 3Q37A 4OBTA 3T1GA 1QW9A 4FALA 1EJWC 4D6DA 1YNYA 2Z25A 1NH6A 2DW6A 1QO2A 1VF8A 4QNWA 2OB3A 4N9DA 4YWSA 2NWRA 5TAOA 3I6TA 1GOOA 2JE8A 1XF0A 3A9IA 3NOYA 3KVMA 4QTGA 3MU7A 2YA1A 3THQA 2G3FA 3L2IA 1ITCA 1IWAA 3M6YA 4RK8A 1XWYA 1I1WA 4FXSA 2XM1A 2ALDA 2VZTA 5A1AA 4MPKA 4YLWA 4CEXC 3BJFA 1YDOA 3E96A 4CCDA 2WYSA 2PLKA 5CSRA 1G01A 1QI5A 1TV3A 1DJQA 3G0SA 4IIHA 1E4MM 1FTXA 4KGLA 1I2PA 2HNEA 3FJNA 4QR6A 3WLKX 2O0TA 4F0LA 3O06A 2QNEA 2FJKA 3JRKA 2ZBTA 2WLYA 2ZRWA 3DKLA 2VC5A 1U30A 5A2AA 4DJFA 2W91A 3SY8A 4GYPA 1VEPA 1DJXA 2X0YA 1EDTA 1SFLA 4AF0B 1CT5A 1ZJHA 2TAAA 4LVGA 2WZEA 3S5SA 2YSWA 3SGGA 4V15A 1TR9A 3VKJA 1X98A 2XH7A 1KWGA 1AG1O 3PZQA 3CAWA 3O3RA 4IL0A 4RPPA 3N17A 1YXYA 3UJSA 4OUEA 1Z32X 3DN5A 2ZRUA 4M1BA 2PA6A 4F48A 4NIRA 3A64A 3IVSA 2WCGA 1DQXA 3ITGA 3R13A 4CD4A 2VFFA 3F03K 4ZB5A 4IQDA 1O1ZA 1MFVA 1LL4A 5KETA 2PRMA 8RUCA 3LPOA 3A6OA 4PA8A 2VEPA 3S1XA 3O6DA 3WJWA 1NQKA 1B3XA 1QPRA 4C6DA 1JCYA 4URIA 3UPWA 3C56A 3TJIA 1JZ6A 4YTSA 2JBMA 4I9AA 2PWFA 4PCTA 5BU9A 3GNXA 4KPLA 4LYRA 6TIMA 4BEQA 1Q2SA 2YL8A 4R7WA 4Z08A 1TR1A 1SVDA 1XBYA 3G5EA 3QZAA 3KOYA 1EGMA 2DUXA 4JCMA 3TKFA 4RL3A 1H62A 2X30A 3DKJA 1XS2A 3HQNA 5F4SA 4LQ1A 3GC5A 2DSWA 2WJZA 2WKLA 1QK0A 3LHVA 3MVTA 1LG1A 3BAIA 4JHOA 3N3TA 5ENLA 3WD3A 5A2CA 5C9RA 2PURA 3MC5A 5DT7A 1MXGA 3POCA 4JTKA 3A22A 1XC4A 3HTWA 1DHPA 3AALA 5A8OA 1TYGA 4KESA 2NLYA 1D3CA 1JVNA 4BI7A 3B8IA 2HQAA 4CNOA 1LBLA 2W9MA 3FAWA 3UPMA 1RVKA 3MYPA 4GO8A 4CUCA 5FOOA 4B3LA 2QCFA 4RX0A 5E6ZA 3N4EA 2DT3A 1MW0A 3VOHA 2ZE3A 3VGFA 4I9TA 4IG2A 1LTDA 4HCHA 2XVGA 4M29A 2X09A 4MB1A 3FHQA 1VGAA 3NL5A 2B31A 1VBUA 4DX3A 4TMCA 4MNLA 1ZENA 3E2VA 4H00A 1NDWA 2WVSA 4WOZA 4HN4A 1RQHA 2BWGA 2A3LA 4EPEC 1HJQA 2QCMA 5AVNA 3V0TA 1A5UA 3C0JA 3DXIA 5TIMA 1G7UA 4L56A 1YKWA 3H23A 1W9BM 3RK8A 1SSGA 5H91A 3VD9A 2EEXA 4YCOA 1MUCA 5HANA 2BOGX 5A8PA 1ZJIA 3C61A 3GM8A 4G7EA 5GJMA 3ENLA 4H01A 3PFMA 5I7GA 3PZ9A 1GZ1A 4MB3A 1JYNA 4PSPA 2JK2A 3SECA 2DQWA 1R9XA 4NHVA 3I3EA 1RK5A 2Z6IA 4KWSA 4AVOA 1E4NA 4GKLA 4JTFA 1LROA 4XIAA 2BGSA 1E6ZA 3FJ6A 1PTAA 2QCDB 3LCLA 3LTYA 3CMFA 5IHSA 5D04C 2QR6A 1W1YA 1SW3A 3TOYA 4GVGA 5E0FA 5G1TA 1E6QM 1XHGA 5E5CA 1MRAA 3VMOA 3ZSSA 1E9YB 4AVNA 2PDHA 2V63A 1OC6A 4O19A 3F4NA 3PBMA 4HZ8A 4Q8TA 4O1EA 2X16A 3DHPA 3D0CA 4FLRA 1TPDA 1UH3A 3HB9A 3EPMA 1B9BA 3BGGA 4TV6A 3ZVHB 4MNMA 3LLDA 1WKDA 3BOLA 4LS0A 4ZMGA 3VGBA 1N8WA 4GI6A 5U4NA 4NYUA 2AAAA 1E4LA 3VFLA 3LB0A 1ZHAA 2BNJA 4RPQA 4O1CA 3CZ8A 5D33A 2PAJA 2EJAA 2P53A 2WXDM 5CGMA 4C6BA 5B7ZA 1DJHA 1E1EA 1Q5MA 1J0IA 3CTLA 1JNDA 1MW1A 4PMXA 2WJEA 3W7JA 1F6KA 3QC0A 1QWKA 2VX6A 1K8CA 1XLAA 1JDCA 2PDWA 3BSGA 1V8EA 4CCZA 3AYVA 1XRFA 1I2QA 3EX2A 4LUIA 3L4WA 4H7VA 7CGTA 4BF5A 5TBOA 4QLLA 3RLVA 3WH5A 3SJ3A 3N4AA 3ANUA 4RE2A 4R9XA 3AMDA 1NM9A 5LHFA 3C3NA 1M01A 1SYTA 2J7FA 3W2MA 4GCXA 3DUGA 3LXCA 3T0TA 3TVAA 1X1ZA 2VL4A 3DENA 4WOQA 3BPWA 4J1OA 4FB7A 3WSUA 5I77A 4AY8A 2WW5A 3HU7A 4K37A 4DJFC 2O7QA 4LEFA 3CJPA 1LT8A 4ZOAA 3HGJA 1YPIA 1C93A 1GPFA 2ZWYA 5I79A 1TO3A 2PDIA 4JOMA 4LUYA 1BFNA 3BMXA 2NVAA 4WDTA 3IJLA 3MDUA 1E6PA 4AWUA 3MA8A 2GK1B 3A4JA 3H2AA 3S2CA 3QV9A 4YTUA 1UPMB 2WVUA 1OEPA 3M7SA 1IWBA 5A6BA 1B54A 4AISA 2JIWA 3N34A 4UMAA 4HA4A 1CLXA 3R8GA 2WSQA 2PWHA 3M41A 3FA3A 4GCAA 2GJRA 2VTFA 4PMDA 2AQWA 4DLFA 4HNTA 5I00A 4AZ6A 3GR7A 1HL2A 4Q4PA 4V2XA 1PAMA 3VNKA 1AW5A 2YBUA 2WHMA 3KWXA 4QQ3A 4IMEA 1I60A 1PX8A 3T09A 2XIQA 1SZRA 3CLMA 1DJWA 3S8HA 4J3UA 2VC6A 3W25A 2NV1A 1AA1B 3WJXA 2WM1A 4YXGA 5D9MA 1FA2A 1FWFC 1UWUA 1V6WA 2RDUA 1BF2A 3V0UA 5M2FX 1W1VA 1DV7A 2NQJA 5C70A 1EZ2A 1V6YA 4W8LA 1GORA 2GDVA 2BXYA 2Z1BA 1RPKA 3F5JA 1C8XA 3AJ7A 1QI3A 1TPEA 4PCFA 1J79A 1DKWA 1V3HA 1F4AA 1WZAA 1YDVA 3R4IA 2PDQA 3K5XA 4ZCWA 5IOBA 3TK7A 4JTIA 4PUJA 3G2GA 4O13A 3DHFA 3CM4A 5CLTA 1S2UA 2TYSA 5E09A 2PWVA 4CU6A 1R3RA 4NP7A 3BAKA 2C1GA 3FFSA 3WQ8A 1LLWA 4JKKA 2QPUA 5DO8A 3OZOA 3ITCA 4FPSA 2REQB 3BZJA 1TPVA 1VPQA 1RCQA 2UWFA 1HIZA 3DC0A 4C65A 1C8QA 3PUEA 3ZR6A 2P76A 1ICQA 1UIPA 1X7FA 3VZYA 3RLHA 2XISA 4JFVA 4WSHA 4ERIA 2GVGA 3S46A 4WY0B 2ISWA 1W8GA 2YLLA 4FNSA 3ZLFA 2YDQA 5BOOA 3GU2A 1QASA 1BYDA 4IIFA 2I1OA 3RNDA 1BTCA 1R7AA 5KMYA 5CZSA 2NW0A 4UBPC 3VI2A 2C1HA 1JDEA 3AAMA 3AUOA 3EWXA 5CGTA 1JDAA 4D6IA 4A2SA 3UJ2A 2CBVA 4EXQA 4K3ZA 3OVPA 2I14A 4EWND 3INPA 2AL1A 3N9RA 2BVDA 1PPIA 4P7QA 1UOKA 5TQLA 4JTRA 1XH0A 3GG8A 1TPB1 1EIBA 5I02A 3O63A 3FA4A 2OZ8A 2OX4A 5A95A 4MMWA 2UZ9A 3HPAA 2PDCA 3L12A 1SR9A 3QC3A 3CUZA 3WK0A 4QEHA 7ODCA 2FKPA 1EJTC 2A7NA 1RY8A 4RLIA 3H12A 4AX7A 1EBGA 3VIIA 3BAJA 1V3JA 1K3UA 3EX6A 2QLYA 3G1XA 1H3GA 4D9PA 1FWJC 3TSBA 4QEEA 2BVYA 3G1AA 1QCWA 4S3KA 3KHDA 2WKJA 4XBJA 3UXDA 3AIWA 1WZMA 1JPIA 4F3HA 2WMHA 4CQAA 4DF2A 5BXRA 4M7TA 4LBSA 4IQEA 5GJPA 2XU2A 4PTWA 4X9YA 5F7UA 1GYLA 4U3AA 4GXPA 4PMYA 1VH7A 3MI3A 2Z4GA 4NX0A 3WQ5A 1S2CA 5DMLA 6REQA 1S2TA 3BO9A 4PTXA 1XGEA 3SUTA 4I6KA 3G0XA 4KS0A 3L7RA 4RW5A 3R79A 1ZS2A 4F2TA 5DCEA 4L9XA 3MHFA 5SWUA 1FDZA 4RV8A 4PH6A 4QG6A 1W3IA 3FDGA 3P2VA 3BLPX 1ECEA 4K38A 2DV0A 2XWEA 2QMJA 4GD0A 4OHQA 4BK9A 4U28A 1F05A 4PUDA 3GDBA 3V7PA 5I2UA 1JCXA 4ACZB 4P7LA 3TSMA 1IT0A 3L5AA 2QVNA 3FIGA 3A4XA 2G95A 2W62A 1TJ1A 3IVUA 1SFJA 3QSTA 4WKAA 4LTSA 5CZJA 4RNJA 5H8UA 1UWRA 3IEBA 1FHDA 3W81A 5LGXA 1IEVA 2HK0A 4NZ4A 3CK5A 5CZKA 5CC5A 3QR3A 3VXGA 4KCTA 3IAPA 2P1FA 3HGSA 4BEUA 4TIMA 1DJIA 3ZOAA 4E4UA 1VBGA 1O5QA 2CBJA 4E3TA 1GW9A 3PNUA 5IHRA 2YCLA 5AC4A 1W9DM 1HKWA 1IT8A 3DHUA 3IPWA 3OA5A 3VTRA 1VFMA 1XYZA 4KERA 3WQ6A 3F2BA 4WK9A 4GUIA 3IGUA 2BHZA 1OX6A 3PTMA 1VD6A 1B3VA 3HPFA 2GGIA 1YXDA 4A05A 1FWCC 1U5JA 4KEMA 2BGNE 1QXLA 1VYPX 1AK5A 2GVEA 5JH1A 5TD4A 4C6LA 4C7DA 1V3KA 1QPKA 2VR5A 4JNYA 1BQCA 3VAVA 4TVUA 4XX6A 3SBFA 1XUUA 4R7JA 4ZOEA 3APYA 2PE4A 3WQ4A 3T44A 1OQFA 3JVAA 3HPXA 4FOJA 1K77A 4N7QA 1NU5A 4Z0JA 5KZDA 2OEKA 4PUNA 1TUXA 2VFIA 3KVLA 1R87A 2QGHA 4AQLA 5HNRA 2DPEA 5BMXA 4A35A 3C2OA 4Q32A 3NZRA 1DWAM 3A4AA 3LRKA 3QPYA 3A3WA 4MM1A 4WGHA 1FX6A 2Y7EA 1XLDA 2GGEA 3HFTA 1L0PA 3DU0A 1HVXA 3UVAA 1OWQA 3IIPA 2BX7A 4PTMA 2OYLA 3PBVA 3RRAA 3NQAA 1AD1A 5C2GA 3WEOA 2VEIA 3BLLA 3ZFHA 1PV8A 2Y89A 5IRPA 4G5DA 4Z2IA 1W5NA 3OZMA 2IW0A 3LCIA 4V33A 5HQMA 3NXFA 4O52A 2SFPA 1V0MA 2EPLX 1K4HA 5TNVA 1I0BA 1R2RA 1XH2A 1ISWA 3MYOA 5I3FA 2W6RA 4M6PA 3OLIA 4AHPA 3A5FA 4JIEA 3Q58A 4GK8A 3RLGA 1HJWA 4MLRA 4ATLA 2ZWZA 3PPCA 4D6CA 2A3CA 1ECQA 3PF3A 1XXXA 5D03A 1W2PA 4FK9A 4GJJA 3IJ8A 5D09A 3AMCA 1ZBVA 1Y5WA 3PBUA 1R85A 1SMDA 1UR0A 1RY0A 3BSMA 5AYBA 2OELA 3GAYA 3VNJA 3PTKA 4NZ1A 3VM7A 3S3GA 4Z2GA 4PMJA 3WL0A 3BL3A 2YJQA 5CLWA 1ADOA 2W92A 4PBGA 4XZLX 4E5TA 3M44A 2CXGA 1O66A 3WK3A 3PNZA 4YWIA 3FGCB 3LLFA 3QM3A 1NDZA 3BQ6A 1XCFA 2EHHA 1W17A 4GC4A 3JUGA 1BG9A 1AH0A 2DJLA 1B0IA 2XH0A 4RDWA 1JGMA 3W1AA 1S38A 2IPGA 2A7RA 2GUBA 1DL3A 3DG6A 2C0AA 3W6MA 1P4CA 1XKJA 2CLFA 2XDFA 4AYSA 3E49A 4P2VA 4H9VA 3WQPA 3I68A 4C6MA 4O53A 1LZOA 1EZWA 5CPMA 3V75A 5IDZA 5LNUA 1KXTA 4V28A 4MJ4A 3EGJA 2ALRA 2PI6A 3LPGA 2XFYA 1UH4A 4CD5A 1W31A 2ODOA 3S1GA 3N6QA 1LDCA 3K46A 3NXLA 3O6CA 1G67A 4Q8UA 3RU8X 2HPMA 3ECQA 3NURA 4BA0A 4Z42C 4B5WA 5DBTA 4UNIA 4PB4A 1TSIA 2ACUA 1F74A 1U5HA 2B4GA 4HA1A 3OLDA 4Q8OA 1UUQA 1Q6GA 1OG0A 3LUTA 3W76A 4AWTA 1SO3A 2FPYA 4NAFA 3QQWA 1J0ZA 5CAHA 3W2NA 3F2DA 2AGKA 3HZ3A 4KT2A 4XG1A 1TJ2A 3PN8A 4ZXOA 2NX1A 1PX4A 1EEPA 1OCNA 1KFJA 1T40A 4NRSA 3CV7A 1SMAA 3M0ZA 2C79A 4X3ZA 1OF6A 5EBAA 4LUJA 4FHAA 3LHTA 1O95A 2X1RA 4LRSA 1SO6A 1VJSA 4WUIA 1KGUA 1E3ZA 4A3RA 2FJUB 4XVEA 1QTWA 1VR6A 1VS1A 4AD0A 3VCRA 4UTLA 1AQHA 1EO5A 4YYCA 3QQ0A 1PZ1A 4BJHA 5KZEA 3PPFA 4LAOA 4S3DA 3TMLA 1PE1A 3UCCA 1NOFA 4Y9OA 1OADA 2VP8A 3U8GA 2F8QA 4RZ4A 1MSSA 3W27A 2OLHA 3P3BA 2OX1A 3QY8A 4KCUA 3BUVA 1KM5A 1ZPTA 3SO7A 4PMOA 5HJYA 1KBJA 2D0HA 1O1HA 3CZKA 3FJLA 4LAUA 4IMFA 5I03A 3MUAA 1VYSX 2IKJA 4ADSA 1LUCB 2VEGA 2YZ5A 2EXOA 4XAFA 3B40A 4PMUA 2NXGA 3H22A 1I75A 3NDZA 2E09A 1GKQA 1F61A 4LNYA 2PSNA 3O7UA 2WOQA 2HCVA 4Z2JA 1FWIC 4JIPA 4N02A 3LN3A 3OU8A 1L6WA 2P3EA 3AXXA 3L0NA 4H7ZA 3V16A 1BPLB 2DU2A 5FI8A 2ZC1A 4P8XA 3EDEA 4AD5A 2DJXA 3NQVA 1T5AA 2CZFA 1JJKA 1S5VA 1ZP4A 1IYXA 3R89A 2PDKA 5BRPA 2DH2A 2Z1WA 5BOEA 5LA2A 1E0UA 4GX9A 3UERA 1LQ0A 2Y8UA 1EA9C 3QZ6A 1ZU8A 3G24A 2V3DA 3GXIA 5D8WA 2CZVA 4PB3A 4CN1A 1CPUA 1LL7A 3AWNA 1OINA 4UNLA 4LRTA 4D6FA 4LF1A 2XTKA 2OTDA 2RKXA 4DO7A 4UUIA 1JEZA 3E2RA 1E5NA 3FK4A 2A21A 2O9OA 3L67A 3UFYA 2WM0A 1JI1A 1TWWA 4PRWA 3AO0A 2E7FA 4ZQMA 1QOPA 2EG6A 3TH6A 3C0SA 4ZO7A 1WDPA 3KL3A 1DYSA 2ANUA 2B81A 3WBAA 4IICA 4EPBC 2YR1A 4AD3A 1QPNA 2PP1A 2RHGA 3T2OA 2QKFA 4JKMA 2Z7GA 3B97A 3PG8A 1F6PA 3R43A 3OLGA 3LM7A 4BF7A 5E70A 2GWNA 2F84A 1HVQA 1X39A 2CKSA 1QO5A 1IXNA 3R10A 3BMVA 2AMXA 1JULA 1IZJA 3OGVA 3UCDA 3WLOA 2O7SA 3BCDA 3IGSA 1POJA 4JKLA 4K8GA 4HPNA 1XLLA 1KKRA 3EA3A 1UCWA 2JKPA 5D9NA 1TREA 2GK1A 2XFRA 1U2YA 3CQJA 3GDTA 3W07A 3CYJA 1SO5A 2CW6A 1J4EA 4JD4A 3OBAA 1F76A 4G2DA 3QR0A 4X2PA 4DI9A 4FX7A 3QKZA 1BVWA 1E51A 2IPFA 4LPCA 4GH3A 4JCLA 4L64A 4UR9A 3MUZ1 5D2YA 2I5GA 4Z0SA 2GQ3A 2XIOA 1I2RA 3QEZA 1Z48A 4FR6A 2J6VA 1QW8A 4WXYA 3N2OA 4IGMA 4JQ4A 1HJUA 4NASA 2DW7A 4EANA 2Z6JA 1BWVA 3W1PA 3GNDA 3L21A 1YBQA 3SB0A 4Z2HA 3KFTA 1RJQA 1E6RA 2RH9A 3UZWA 3E0WA 2V68A 4AAJA 3ALGA 3AJXA 4J28A 1AJ0A 3PVFA 1WDQA 3E02A 2Y63A 2PGFA 1V5XA 2QCGA 1L2UA 5REQB 4L5ZA 2I7GA 5AHIA 3VIOA 3LGGA 3EMZA 4DJFD 3V3WA 3TCSA 3HV9A 3O0FA 3EDJA 4AMCA 4ALDA 4JN7A 2BOFX 3PM6A 4NVTA 4ZQOA 3W72A 1GVRA 3THUA 3W29A 3UWVA 5BCAA 3RCMA 4CD7A 3N9KA 3ZT5A 4E38A 5AC7A 3GFXA 1VCGA 4PL1A 1JCTA 4AC1X 4AMAA 3FV9A 2R6OA 3GB6A 3UY7A 3M5YA 1I6NA 2FH8A 4QRNA 4DJDC 4BY3A 4JS3A 3P0XA 1VCVA 3M5ZA 3W7KA 3ZSTA 4HK7A 4AY1A 4ATWA 1HL9A 1RLDA 2V2CA 3DZ1A 1BXCA 1V6TA 2A4AA 3ZXWA 1LP6A 4AD2A 3SY1A 5HWMA 2OT0A 2ZUSA 1DXFA 1G9HA 4H2HA 5EU9A 1KFKA 1QU4A 4P5UA 1WKYA 4Q7IA 2PDMA 2FFIA 1MMFA 4KMQA 3AYRA 2H90A 2XFWA 1US2A 1B90A 3KRSA 3VCCA 2YCIX 2YOCA 3CB8A 1XBXA 1ZSXA 3QYSA 4ZTYA 4FF7A 3TYDA 3NQBA 1Z44A 2Z1XA 1IGWA 2QW5A 1YLVA 1RR2A 1YNQA 1W37A 3P6LA 1PEZA 1HL8A 1HW6A 1MQRA 3N04A 4Y7EA 4A8IA 5M3WA 4IX2A 2E28A 1KXQA 3PPGA 3WH9A 2BB0A 2C14A 2OO0A 3RFAA 3OEXA 1XGZA 3R11A 2LLEA 1LYXA 3VFCA 1GKPA 1H2JA 3UZJA 1AFSA 2BBFA 5CZTA 3REQB 4PMQA 4RXGA 3EX1A 1S2VA 1VLWA 1ZCOA 3W7MA 4W89A 4CD6A 2QIWA 4NF7A 5C8BB 2FHCA 3FJ4A 4DBUA 4FNRA 3ABZA 2RDWA 1HO4A 4JGDA 2Q71A 2NV2A 1MW2A 3TUUA 2BGQA 3QW4B 2DUAA 4PYSA 5EMJA 3CU2A 1PKNA 1P0BA 2JIEA 1VIWA 4RDVA 3WNOA 1UD5A 2J74A 1O6IA 3GG1A 4D6HA 4HGXA 4IHCA 4IFRA 4IMAA 3GD6A 1Z41A 4OBSA 1JDDA 3K4AA 3B06A 1H7XA 4WX2A 1VFSA 3OZYA 3T9PA 4LYKA 4EF9A 2WBGA 1QR7A 3SAZA 2I17A 4ACZA 1R7OA 2ZYFA 1E70M 4XBSA 1L2QA 5LKYA 4NILA 4PCSA 2VFEA 4GI8A 2QJNA 2X0SA 3AZRA 3SEPA 5J5RA 5FSEC 2OGJA 1NJJA 5ABFA 3M0YA 4REQA 1Q2RA 1H7NA 3UT0A 2Z29A 3BLKA 2DSKA 1B57A 4TU1A 3VO0A 1J0KA 2J7GA 3MDWA 1M04A 1AD4A 1F3EA 1TWSA 1DJYA 2PWUA 4HOZA 4BI5A 5FESA 1O5RA 1BYCA 2V38A 4P8WA 2PGEA 3K1DA 5C55A 1JZ2A 1Q45A 3WQGA 2E4TA 9XIAA 1ADSA 3FXGA 4Z1CA 3WQCA 1PKYA 2BVTA 5LXEA 2R82A 1XD0A 3TQ0A 5DY2A 2XGBA 2GSEA 4AZCB 4Y2WA 2D73A 3V4BA 2D20A 5FJRA 2CHOA 2HMCA 3STPA 4GABA 4JN6A 5I06A 3C2RA 1PTDA 3C2FA 3UCQA 2DZBA 4AZ5A 3H2CA 3W1QA 1Q3NA 4R34A 1E1CA 1CXKA 1UR9A 7XIMA 4I3GA 1XUZA 5LA1A 3MO7A 3IV3A 4L9ZA 3GS6A 4KQNA 2V69A 2IQTA 5FL1A 1XYAA 3TFXA 2E40A 3IRSA 2ZZ4A 4K36A 3LHUA 4C1NB 3DECA 5FCZA 4H9ZA 3T2PA 1JG9A 1VHNA 4V1XA 2GLKA 2CFFA 3NL3A 1R3TA 3ITXA 1FH8A 3YPIA 4AD1A 4MGGA 4PMVA 5D37A 4DELA 1XYFA 4IGHA 1DOSA 3R58A 5HJXA 1FWWA 2A3BA 4TXEA 3IUDA 3U2CA 3ZLGA 3RF9A 5AC8A 1KM3A 4Q4QA 2ISDA 4ADUA 2DUZA 5DRIA 3MI6A 3B0XA 3TQVA 1AH4A 2GUYA 3W6LA 4XZBA 1M68A 2RGLA 5M03A 3EWZA 5MKGB 3AUJA 3AHZA 1JUKA 4JFSA 2Y0FA 4MNKA 3FDKA 1ENUA 4ZEPA 2YDSA 4PUWA 4ZR8A 3GHSA 2ZUNA 3S2JA 2ZC8A 4NQ1A 3LYEA 4RE3A 4N0RA 4TX9A 2ONEA 3H21A 3T40A 5C2XA 2AAMA 2NX9A 5F2LA 1GVIA 4H9XA 3PUGA 3B4YA 1E6NA 6ALDA 5MF5A 4HU4A 1H5VA 5D38A 1PXGA 4PODA 1B4KA 1MVYA 1HO1A 1E55A 3KCOA 3BURA 2X2GA 4Z1DA 2PDUA 3UVIA 2OR2A 1JAEA 2QJIA 2FVKA 3MP5A 2V30A 3GW0A 5KZ6A 1P6BA 1WP6A 1W1IE 1UJPA 4H04A 4AHQA 5BRBA 3S1UA 5D2TA 1W3KA 4ZENA 4NJJA 1VKFA 3PY2A 4WKHA 2R9RA 3GW3A 4R88A 3EA1A 1FRBA 4XD5A 3MUCA 1KM0A 3W02A 4H6EA 1PZ2A 5A5WA 2VD8A 5J8LA 4V1YA 3N2BA 4NJHA 4MKSA 4UQAA 3SRKA 3NEHA 2OSXA 1XIHA 3IUHA 5LIKX 2VC9A 3VDHA 4OZOA 4AW7A 2PZNA 1PUDA 1EC9A 1XPYA 4ZB2A 2QJJA 1X1NA 1FWNA 5HMSA 4M6VA 4UTIA 4B5VA 1OYAA 5IBXA 1FHLA 2PB1A 2P5NA 3GIPA 3B0UX 4QE1A 1V0LA 1WYIA 1OD8A 3BCJA 4LAKA 4E2OA 3DFNA 3JU2A 3QV7A 4JTHA 1ZJAA 4GINA 3I10A 5FIPA 4DXVA 2VZVA 1ITXA 4L1GA 4WZHA 4H6KA 3THCA 3MWCA 1HNYA 4GQBA 3SR7A 4DWSB 4N42A 1E0XA 3OB8A 2BV9A 2NT0A 3D6NA 4FIRA 4C7FA 3WFZA 3T7VA 3NQDA 2QGYA 3BAWA 2HJPA 4DIAA 2Y4SA 3W88A 1WOAA 2FZBA 1JAKA 4MF4A 4DO5A 2DZAA 1XLIA 2Z2UA 3DYMA 5E9AA 3TV8A 2V3FA 3NEVA 1B3WA 2VR2A 4O16A 2DT2A 1MZRA 1ZY9A 1UKTA 3WQVA 4HYRA 4MWAB 1E43A 3WIJA 3CWOX 3HO8A 2E6YA 1H7RA 3C3UA 2G3IA 1X6LA 4XKMA 1XW8A 3B8SA 2NV9A 4F79A 3S42A 4KETA 3G1RA 3TTOA 1NY1A 1X8FA 2F38A 3A3HA 4NSBA 1TKKA 1I9CB 5CQ1A 3DEQA 2HISA 3VKBA 1Q7ZA 4D2JA 2WPGA 5L9FA 3PB0A 3CNYA 4HIBA 1TJ0A 3N14A 4GIAA 2GJXB 4Y9PA 4F9DA 5A2BA 5I3DA 1OFDA 7REQA 3NTYA 5EYWA 4IZGA 2YX0A 4DF0A 4BWLA 4HA3A 5DLCA 1HQTA 1DIOA 5AHEA 4IM4A 3VK5A 1UR1A 3KLKA 3AIVA 4RDZA 1NWUA 4ZQRA 1FFQA 1M41A 3W71A 3N18A 4N9EA 4MJMA 3KRBA 1T96A 1K9FA 5IFPA 4M19A 2RJGA 4JTSA 3OOQA 4Q8NA 3ZS4A 2CU0A 2Y6ZA 4HOWA 4GUFA 2Y62A 5A3HA 1HTIA 4HOXA 2WJDA 2PU1A 4CU7A 2D0GA 3ME3A 3U6WA 4Y8FA 4UMCA 3RM9A 2A79A 2CWNA 2D69A 3H4XA 3TN3A 4H9MA 1R6WA 1XI3A 4XB3A 1DPMA 1CBGA 2QCHA 3LI1A 1SZFA 4LBRA 4QISA 1XC6A 3ABXA 2ZX5A 1US0A 4GFIA 6XIAA 4I6VA 5DMMA 3BLFA 4A4AA 5D30A 3GXNA 1ME7A 4UZSA 3KTCA 2HSAA 3CPUA 2A3EA 5CPTA 3CTTA 3PWGA 4OTKA 4AX6A 4MJZA 1F9CA 1TZZA 1E4IA 3VZXA 3IJ7A 4INFA 4O17A 1R9YA 2BG5A 4TTUA 5AOUA 4FIQA 2Y5SA 4ZQCA 2R1NA 1Y0EA 2ZUUA 1JYVA 3CZGA 4RCXA 1HUVA 1QNSA 1IXQA 3DYPA 1RLCL 3WD4A 3H7RA 5D2XA 4A3UA 3DX5A 3AMGA 2VVNA 3TLLA 1ELSA 4XQ6A 3H70A 1WZKA 2J8TA 1QDSA 4FXRA 2X1UA 3M5XA 2XG9A 1GYNA 4G9PA 4CQ9A 1QNQA 1BHGA 4BQ4A 1GHSA 7ENLA 4FS9A 4GBUA 2BY3A 3VD5A 4YTQA 3EDKA 2VGIA 1K9DA 3ZR5A 3MMUA 3RN6A 4EAYA 1OFEA 3KP1A 1B1YA 4LF2A 3W7HA 5C9ZA 3G6LA 1SZNA 1EQPA 1KCXA 3GNOA 3PFRA 3QYQA 2HXUA 1A4MA 4B5TA 4Q4SA 4GJIA 3MTWA 4FX6M 2GQAA 4QQUA 3ZZ1A 1VLIA 3WMLA 3EPNA 2WO5A 4K6AA 3NDYA 3S6DA 2BXVA 3NR0A 4R3UA 3SM0A 1O4UA 2CITA 1OBAA 3QXBA 1GYMA 3ZQ9A 4LWWA 3DESA 3W1MA 4A6GA 1VQTA 3LRMA 1JL8A 1RPXA 1AUSL 4DHGA 4R53A 4PZVA 1RJRA 1QOXA 3SDOA 2P8BA 4TV5A 1EHAA 1LRQA 1DJGA 2CLPA 3GU1A 4MDPA 3VDAA 3GTIA 1UR2A 4L4PA 1KV5A 3VOJA 1A5OC 3GYCA 5FSDC 1DIEA 2ZFAA 1IF2A 1A4LA 3CZEA 4AZIA 1L8PA 3LY0A 3ZWTA 3TTEA 1R3YA 4GUGA 3TYEA 1A5NC 4GGHA 3ANYA 1V03A 1W5MA 4Q4KA 4O15A 3OG2A 2OO6A 4A3HA 4GMEA 2Y5JA 1A80A 1S39A 4MFEA 2FTYA 3P5ZA 4IH3A 4D6GA 3T07A 4LOCA 1RAKA 4Z2KA 3VIGA 1GK8A 3HGOA 4YL2A 4YJ5A 1OYCA 1E40A 4FXJA 4XO6A 2ZXDA 4HSNA 4IPNB 4IIDA 3PAJA 3O07A 5JU6A 2OG9A 1BD0A 1P1XA 4MKVA 3TWAA 3LXAA 3IWPA 2W3ZA 1M6JA 2WMIA 3QMRA 4M6QA 4NZ5A 3EX4A 4F0KA 4LC6A 2JF6A 4C6PA 1HKKA 1HP5A 3DFHA 5A6TC 2X1TA 3HQOA 3OJGA 4WSKA 3UZ5A 3BW2A 1EO7A 2HVNA 3M64A 3GHUA 2XH4A 2G0WA 1P0EA 1XIIA 1Z89A 3C6CA 3BLDA 5DN1A 4QM1A 3PZNA 1VRXA 2V3EA 3QLDA 4I5RA 3E0IA 4GO9A 2HXTA 4PCNA 3CO4A 4L7ZA 1D7FA 4TVDA 3G77A 3RPMA 4NI3A 3CZLA 2FTPA 4JL2A 4MDOA 4JTGA 1QAPA 4UFKA 4O1AA 1ME9A 4C1KA 4JFWA 4X0NA 2ZRXA 3K8KA 2V5BA 2CLLA 1EHNA 3H53A 3HJZA 1S46A 3IACA 1O5XA 3OBEA 3USBA 2X40A 3TSDA 4S3FA 2CYGA 3CL8A 3NO5A 4H41A 4YYFA 5JXQA 5I23A 2XH2A 4HYWA 4O0QA 4UNKA 2E25A 1Q6CA 3R0DA 1FHUA 4MB5A 3H24A 3LBMA 2ZZ6A 2ZZ2A 2MNRA 2XVKA 2Q8LA 2W4XA 4PBEA 2CLHA 2ZX6A 2O55A 1W3TA 2ACQA 3KBVA 4NJKA 2OQLA 3UU0A 1CTNA 2BMBA 3KBMA 3CUGA 3SJNA 2VDGA 4QNEA 2ICSA 3VNIA 1YRRA 4BWLC 4DPPA 1XSIA 4JTJA 4GIYA 3VM5A 3LMYA 2JKAA 1K4GA 1RV8A 2PDGA 3PBYA 4N9CA 1MRQA 3PAOA 1VYRA 3RPDA 2CCRA 2NXIA 2V3GA 3ABQA 3OPSA 3W7EA 3RAOA 1G1YA 5EB8A 2BLEA 2YA2A 1A50A 2ZUMA 3RX2A 1DJZA 2QHAA 3IUIA 3EKZA 3M0IA 2VEKA 3KCJA 4S3GA 4O4WA 1EH9A 3NQEA 1UA3A 1WOBA 1QBBA 3CUJA 4IGNA 3F5KA 3REQA 4HNUA 5I3HA 1IGSA 4R7OA 1YDNA 3KM8A 4JZ5A 3SIMA 1OGGA 1DE6A 5CC3A 4R9OA 3WF3A 4DYJA 2R94A 4HSHA 3STFA 1P0KA 1V6UA 1TWIA 1LRNA 5D32A 4MKNA 4I90A 1GGOA 1AVAA 4DJDD 2RAGA 3BLOA 1LG2A 4RNFA 5FAGA 4MVAA 2GDUA 3XISA 3V36A 5C9WA 3HFYA 2VI0A 3W2KA 1LCOA 3B05A 4PSRA 2XVPA 3M0LA 4OBRA 1UD8A 3BG9A 3HA1A 4B4FA 4LJ3A 4D1IA 2INEA 3M0KA 4QFUA 2FZNA 4HKPA 4M82A 4Q7BA 5HINA 4DNHA 3B8TA 2AOSA 1X1OA 5JBEA 2OT1A 1KFCA 3RO6A 3CH9A 3H4GA 3RX3A 4LY4A 1YTKA 4DAIA 2IS7A 4J3XA 4OV4A 4AZHA 1BWLA 3WMCA 1UP2A 1X6NA 2YXXA 4LBUA 1TVNA 4ZA0A 4S3AA 2BY0A 1EKOA 1NDVA 3IS4A 2ESCA 2WNZA 3OW1A 2QCNA 1QHOA 3NGFA 1KFWA 3NQ2A 3OGRA 4G56A 2BHYA 5ABTA 1DWIM 5IFTA 1PIGA 3EWDA 2WV8A 4W7UA 3D5HA 3QW3A 4S1FA 1EP1A 4N6FA 3UD6A 3WLSA 4UFHA 3S1VA 4HK6A 3RPTA 1GNXA 4AD4A 1VFUA 3S83A 2VFGA 3TCEA 1MNSA 3UBPC 5GVJA 2HTMA 5FL0A 3CT7A 3FYOA 2QMKA 3AHTA 1H41A 4IIEA 1J5SA 3UR7A 1V6XA 4ZSTA 2EBNA 3L4XA 3R8RA 3PZUA 3WY1A 4AZCA 1XCWA 1UWTA 3BARA 4FP1A 1EA0A 2Z28A 1K6WA 4IJCA 4FF5A 2DSZA 4E2DA 2CC0A 8XIMA 1FP8A 1SZEA 1TTIA 4AUBA 1O94A 4PFHA 3TYZA 3T0BA 3A3XA 3ZO9A 4WD0A 3ABOA 2DZTA 2WSYA 5T9CE 2QV5A 1GOQA 2E5DA 4PTNA 4RUBA 5DMNA 4M51A 3MSRA 1VFHA 4RKAA 5AECA 2DZSA 3LTPA 1GQJA 4XIMA 5LIUX 3GTHA 3E74A 5DELA 1H50A 1XV8A 2GQ8A 5HPCA 2OMAA 4X9SA 3U5YA 1LWIA 2EGZA 3N73A 2ZCGA 3K8MA 2GUUA 1LOSA 4F9JA 3MUXA 4PEEA 1AL8A 1R38A 5LNSA 1BSIA 2I56A 1AODA 3QRHA 5M5DA 4Y8EA 2XM2A 4UTKA 5I3IA 3URBA 4EIVA 3KTXA 3QMTA 3CYVA 1WXJA 3N11A 4ZXLA 2PMQA 5CPSA 4G7FA 2I9EA 3KHJA 5BRQA 5C6MA 1QOQA 4QITA 1CGXA 5E0KA 2PP3A 1ITUA 4MADA 2WB5A 3GG0A 3EYPA 4LUTA 3TYBA 2Z00A 1PJ9A 1WAWA 4JHZA 3T05A 3DFYA 4G1KA 1TG7A 1I4NA 1PVNA 3I4KA 4KWOA 3N9SA 5E1QA 2PBGA 5G4WA 1W32A 3AS1A 3VUPA 4HMEA 4KH2A 2PLCA 3AXKA 3M07A 1UC5A 4Y96A 4OKDA 3SCRA 3BOXA 3GIQA 2NQLA 5CZ0A 4LY8A 1NEYA 3WCZA 4H8NA 4HJWA 1UMLA 3WQOA 3OHMB 2CXEA 4ZFMA 3GVVA 4AG0A 2A3AA 1XLHA 3V5OA 4RW3A 3O1NA 5LSMA 3AISA 1MUMA 4FNPA 3TAOA 1QI2A 4QSFA 1G7VA 1E0WA 3U57A 3M1ZA 4GHRA 4IT1A 2V5LA 4GUHA 1UWIA 2PP0A 1RD5A 4A8LA 4J27A 1WBJA 1I2OA 3W74A 1C7TA 4W4QA 3W0KA 1ZJBA 4UOQA 3F4CA 4LXFA 3S0CA 3WYZA 1BSLA 3B9OA 1VHCA 3AWOA 3WMSA 5C0QA 2WCAA 5GNXA 3TR2A 3WUFA 2Z27A 1FFRA 2D2HA 1BXNA 5HMEA 1UOZA 3QV8A 5EA9A 4FMVA 5AZ0A 1CW2A 4O1BA 1A5KC 3HG4A 5BU6A 4H8UA 1XX1A 3SIZA 4H6RA 1DE5A 3RGTA 3QZEA 3FNDA 4F8XA 3NL2A 1F2JA 5D05A 1PCWA 1GOIA 4E3VA 3EB2A 2KZHA 1IXOA 2EG7A 2HV5A 2WC7A 1UROA 5ECVA 1I0DA 4DXKA 1L6GA 4QP0A 3TR9A 1FWAC 1OFQA 3BOFA 1TJPA 4DWSA 2R1MA 3KCLA 5A6SA 5LHEA 4AIBA 3PB2A 2INZA 4XZWA 4EACA 3AIUA 2Q8ZA 1HXJA 1U1HA 4HT3A 3GTNA 2FVLA 1NQ6A 1P48A 2ZVRA 3QN3A 4DZAA 2V5KA 3SCOA 3Q94A 4PTVA 1XIGA 2QV4A 1O68A 3P80A 2HK1A 3M0XA 2JALA 1XD1A 4MWAA 3UJRA 4XKYB 5FAJA 1RUSA 2R1PA 1TRIA 7TIMA 3L68A 3TA6A 5U7SA 4IXXA 3UJFA 2POZA 1EIXA 4GQRA 1TWDA 3A24A 1H60A 5DXYA 2YPIA 1NDYA 5KTLA 1K7EA 3A23A 1GOMA 3MJMA 2B7QA 1CXHA 3FA5A 1TUFA 3TJXA 4MAZA 4KGJA 3TN4A 1XYMA 4YTTA 1XG4A 3VILA 3UF9A 1XM3A 1S1RA 4YS1A 2J7HA 2HS6A 1CGYA 3H2NA 4IUGA 1UKQA