1I1XA

1.11 a atomic resolution structure of a thermostable xylanase from thermoascus aurantiacus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
302
structure length
302
Chain Sequence
EAAQSVDQLIKARGKVYFGVATDQNRLTTGKNAAIIQANFGQVTPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIRGHTLVWHSQLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVNEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYINDYNLDSASYPKTQAIVNRVKKWRAAGVPIDGIGSQTHLSAGQGASVLQALPLLASAGTPEVAITELDVAGASSTDYVNVVNACLNVSSCVGITVWGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Thermostable xylanase from Thermoascus aurantiacus at ultrahigh resolution (0.89 A) at 100 K and atomic resolution (1.11 A) at 293 K refined anisotropically to small-molecule accuracy.
pubmed doi rcsb
total genus 120
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1i1xA00
1HJWA 1DWHM 2WMHA 3AXIA 3CLWA 3IJ9A 3ARTA 2OWWA 2TAAA 1W1YA 1TVNA 3TP4A 4PMNA 4PMZA 5ABHA 3BSHA 1U30A 1DEDA 1CWYA 1UKSA 2JALA 1GZJA 1YQ2A 3FHAA 3K1DA 1JNEA 2DPEA 1V3JA 3CUFA 4A4AA 2YJQA 3WEOA 4BQ5A 3MMUA 1OT1A 4JCLA 4ZE5A 2V3DA 2J4GA 2WKGA 5DT5A 2CBIA 4M82A 4AZHA 1JAKA 1A47A 1R7AA 1KB3A 5ABFA 2ZX6A 1B3ZA 1TA3A 1W3HA 2ZX8A 5C71A 1C3FA 1E1EA 5IFPA 1ZJAA 2WHLA 1B3WA 1KQYA 3OBAA 4AYSA 4AW7A 5EFDA 3O2LA 3AMGA 2YIHA 4Q7NA 4DM1A 1D3CA 1CGXA 4IPLA 3WNNA 1FH7A 3OLDA 2XVNA 4E8DA 3O6AA 4P7RA 1UWSA 3KE0A 2VR5A 1MXDA 3UR8A 1CENA 2GDVA 1PX8A 3K8KA 3WUEA 1D2KA 2DT0A 2XPKA 4PTWA 3CZKA 4B3LA 1E6ZA 3CBWA 1S46A 1OCQA 1HL8A 4LYQA 1BYCA 1CYGA 4GZIA 1C93A 4HA1A 1B3VA 3RILA 1E4LA 5BCAA 1PAMA 5A8MA 4D6FA 2PWDA 3FHQA 1GQLA 3NJ3A 4ZXOA 1H4PA 1KGXA 4W7UA 1SR0A 4MB4A 2CYGA 1M53A 2E40A 1BG4A 1KXQA 2WC7A 4S3JA 4AZGA 1JFXA 4AIUA 4X0NA 4MPKA 3BAJA 1VFUA 2XWEA 3AMDA 3L2LA 5I0DA 3I3BA 1MWOA 1MFVA 2WMJA 3PZQA 3PTKA 2FHFA 4Y7EA 3WH8A 7TAAA 3WDRA 1XCWA 3VGFA 3A4XA 1GPFA 1KGWA 2XUCA 3WBAA 4QLKA 3U7VA 4QLJA 3D3AA 3OGSA 4MDPA 5A3HA 1CGYA 4Z2LA 4GI6A 4XZWA 1MQPA 4NF7A 2V3GA 5DEZA 3AXXA 1C91A 2CERA 3ZJ7A 4KWUA 1WPCA 2E8YA 1ISWA 3FY1A 3LPFA 4YN5A 4KRUA 3WY1A 4E4PA 1E56A 4AD2A 4D6CA 2PC8A 3CMGA 1QBBA 2VQTA 1G5AA 4P7LA 5LA0A 1O6IA 3MO4A 3VDHA 5HXMA 1LG1A 5BROA 1ZB5A 5A69A 5GQBA 1AMYA 2PWHA 1V3LA 3UEQA 1N82A 3KL0A 4JFUA 2GJXB 5A6JA 4MB1A 3WQVA 2VRJA 2BVDA 5JIPA 2DSVA 3KEHA 4TX6A 2E3ZA 4PTMA 2DGAA 1TR1A 2WVVB 3A3HA 3GYCA 2QPUA 2CPUA 1AQMA 5AYBA 2F61A 8A3HA 1J11A 3BAYA 1V3MA 4UQCA 5BXTA 1JGIA 4E2OA 5GNZA 1E55A 1QNOA 3DHUA 4H2CA 3U57A 1H1NA 4BA0A 1JNDA 2YBUA 1QI0A 3W4RA 1KWGA 1US3A 5TD4A 1FH9A 5CLTA 2BHZA 4JAWA 1TG7A 1UWRA 1UD8A 3PHAA 2ZUMA 5ABEA 2FHCA 4PMVA 2VRQA 3TTYA 1KR1A 2X05A 4F8XA 6A3HA 4AD5A 1K9DA 1W9UA 4H04A 2DSKA 2VT0A 4IISA 3PN8A 1FP9A 4DUWA 1PIFA 2WMFA 1OBAA 1M04A 1MYRA 1H0GA 4CD8A 1CBGA 1HVQA 1WDRA 1HJQA 2EXOA 4TXEA 1TCMA 2WBGA 4PSPA 1Z32X 1UR4A 1XV8A 4Z2IA 2WW5A 1VFFA 4MB5A 3AZSA 2XVPA 4JKKA 4WJXA 1DP0A 5A8NA 3BC9A 3WENA 3WDHA 4P8VA 1EXPA 1UWQA 3VNYA 1OSEA 2WC4A 3GBEA 3WD3A 1ITCA 4NRRA 3CH9A 3AIEA 4HMDA 4RE2A 2OYKA 3EMQA 1KCKA 1W9PA 3B9DA 1E4MM 3RJXA 3WUGA 5ABFB 3WQ8A 1BF2A 1Q6DA 2YA0A 3WF0A 1PZ3A 1HVXA 3QHOA 2XIBA 4X0VA 1XD1A 2O9PA 1UOKA 4DUVA 3W24A 1HJXA 2PWFA 2YL9A 3WH6A 2GDUA 5A1AA 1TZ7A 2QV4A 4WKFA 4F79A 3OA5A 3FN9A 5D9OA 4HOZA 4EE9A 1W9BM 2D0GA 3GM8A 4N0RA 5CPQA 3UG5A 1TFVA 2XGIA 3AICA 3MSDA 4MTVA 4D72A 1W1PA 3VMNA 1VBRA 2VCAA 3ARWA 2W92A 4YHEA 1LG2A 5IHRA 1HKIA 1E0VA 1UH4A 4JL1A 3N04A 4Z2KA 1J18A 4CU8A 5BXPA 2GK1A 4W93A 4AZCA 5GNXA 1CPUA 4LXFA 4ZENA 1E70M 3RM9A 1XSIA 1ISZA 5A6BA 1KWKA 1DWJM 1JI1A 4AZ5A 4JIEA 3VIHA 1XD0A 5JIWA 1JYVA 4OOUA 1FA2A 2XYLA 1W3LA 2F8QA 3OGRA 1GQJA 8CGTA 3EBVA 4UZSA 1LF1A 3WDPP 4QAWA 4FLRA 2PB1A 1J0KA 2D3NA 3A4WA 1HXJA 4GI9A 4F9JA 1BAGA 1J12A 1PX3A 1LL4A 2ZX9A 1QOXA 1E6XM 4M29A 1UQYA 2FDMA 1W32A 4HA3A 1KR0A 2J78A 2Y24A 5F7UA 2A3BA 1J9YA 1JZ3A 3CMJA 2CKRA 2A3CA 3CPUA 2ZXBA 3L4ZA 3WEZA 5FL1A 1VBUA 5HBFA 3RDKA 1GOWA 4W88A 3RM4A 3ARVA 4WF7A 2AMGA 3MANA 1UD3A 4PUDA 1XSKA 2AOSA 1CXLA 1QNRA 4BCEA 1L0PA 1GOMA 2WCAA 4KMQA 4MJ4A 3RMEA 4CKQA 4EANA 5DF0A 1E0WA 5EMYA 4UOJA 3T09A 4JL2A 5DMYA 2A3AA 3AFBA 5M17A 2EPKX 1GNXA 4D6EA 4JFTA 4QLLA 1VFMA 1C8QA 3WDQA 2WZEA 3UG3A 1KQZA 3SCUA 3SCVA 1G94A 3CZ8A 1NARA 3F5JA 4WK9A 2CIPA 1FHLA 3SCOA 2EBNA 3A6OA 2J74A 4P8WA 2W67A 1JZ5A 4D1IA 2J7HA 2ZX7A 3W28A 1JF5A 2MANA 5LA2A 3TOPA 1XC6A 3VD9A 5HPOA 1E3XA 3THDA 1JAEA 2UY5A 2WPGA 3NDZA 1CLXA 4JFSA 3SCWA 1H41A 2WHMA 2VX7A 2Z1KA 3CZJA 4ZFMA 1Q6EA 2YKKA 5I79A 4AD4A 1ISVA 1VAHA 1R86A 3WD2A 4OKDA 2W91A 4PMUA 2ZUVA 1K6AA 5I5RA 2D3LA 3AYRA 1R8LA 3L4TA 4AC1X 2BVTA 3QGVA 4QDMA 4TOQA 5E09A 1LL7A 2WLZA 1WZLA 3PBGA 2NT0A 1W2VA 3WF3A 1VB9A 4W8LA 3N1AA 3SCQA 1KBKA 2IXUA 3SCRA 2O9RA 1JYNA 3AIBA 3L4VA 1G01A 1A3HA 2E9MA 2ESCA 2FH6A 4DWSC 2Y8KA 3CHEA 5FIPA 1EO7A 4ATLA 2WAGA 1G1YA 3I3EA 5A2CA 4BQ2A 2ZX5A 4R5EA 1ISYA 2QF8A 1EHAA 2C0HA 2XIIA 5M03A 4UQAA 1AQHA 3ARPA 2YLAA 2DDXA 3KWXA 2ZUWA 2WVTA 1B3YA 1JFHA 4BF7A 4HA4A 1WB0A 3MSGA 3VTRA 3L4WA 1HP5A 1JDAA 2FH8A 4GINA 4J27A 9CGTA 3DYPA 1B90A 2GUYA 4OJYA 1CXIA 5A2BA 3CIVA 3HN3A 2YL6A 2JFEX 3PZNA 2FHBA 1UWUA 2DIJA 2ZUUA 3DYOA 3D5HA 5EBAA 4ACZA 1LQ0A 1UR8A 2O92A 2G3NA 3PZMA 2YBTA 4KGLA 1UH2A 3AS3A 3VUPA 3AI0A 1MQQA 4HP5A 1V02A 4GIAA 5E6YA 4V28A 1HX0A 1RP8A 3I3DA 3CZGA 1XSJA 4XV0A 1SYTA 2D20A 1R7OA 1JD9A 2G3IA 2DSUA 5FCZA 1KFWA 1JZ8A 3ZM8A 4LYRA 1B30A 3ZT6A 3AXHA 3VMPA 3EMZA 1GHSA 4JKMA 3WF1A 4PBGA 1TMQA 1V3IA 3DC0A 3ARYA 7A3HA 3NYDA 3WQ6A 5FL0A 1JZ7A 5HOSA 3CTTA 3ZMRA 2DEPA 4DWSD 4OOZA 4AZCB 5A8QA 3WMCA 1W9VA 1I1WA 4MAVA 1JXKA 4D71A 3ARRA 1PEZA 2WANA 1DWIM 1OIFA 1KCLA 3TTOA 1MW3A 1BYBA 1E73M 3AZRA 2Y5EA 5D9MA 4J3VA 2YOCA 1W2PA 3IANA 3BCDA 2WMKA 1UKPA 2ZWYA 4J3WA 1ITXA 1QW8A 3T0DA 1DHKA 1H2JA 5LYRA 5HPCA 1L8NA 1J0JA 5IHSA 2OLHA 2G3JA 3VIPA 1GOIA 2J7FA 1BVZA 3RJYA 4ATDA 4F9DA 5LA1A 1UR2A 4J7RA 5M3WA 4U2YA 2JF6A 5DT7A 1CEOA 5I78A 5A6AA 1BG9A 3ARUA 4JHOA 1BFNA 2IXVA 1IV8A 3AHZA 4XUYA 2VNCA 2G41A 2J75A 1B0IA 4JHZA 3VD3A 1CLVA 1E3ZA 1W9DM 3CO4A 3ALFA 5JBFA 1US2A 3F4VA 3MMWA 4M81A 3W27A 1OGBA 1KGUA 1PX4A 2XM1A 1E71M 2V3FA 2PF0A 4AZ7A 2YA2A 1V0MA 1E72M 2DH3A 2UY2A 3OB8A 3HJEA 3DHPA 4K68A 1UUQA 1V0NA 2BNJA 3POHA 5BRQA 3OLIA 5A95A 1Q6GA 3WQ4A 1JYXA 1WZAA 1H09A 4XB3A 1EQPA 1GCYA 3EDKA 1JZ6A 3IK2A 1K9TA 2XVLA 4BQ3A 3AIQA 1H5VA 2QMJA 1RP9A 3J7HA 2X0HA 4H8UA 2E9BA 4GQQA 4P7QA 1CXEA 3LPGA 4JFWA 4EKJA 2WMIA 1E6SM 1LL6A 3AMCA 4CUCA 1J0IA 1GUVA 1ZL1A 4PUEA 1EDTA 1WDQA 3SUVA 1V3HA 5AC4A 3W37A 1XYZA 3VIFA 3MS8A 1MW0A 3QHNA 2CBJA 2PBOA 3N17A 5E70A 1CIUA 2EPOA 3LPPA 2DIEA 3ZSSA 5I3DA 3QHMA 5GPRA 2W4XA 1I75A 2NT1A 3NSNA 4UR9A 1B9ZA 3WL1A 4GO9A 1HN1A 3OIHA 1OM0A 4D6DA 1C8XA 4S3KA 1HP4A 1OWQA 3FAXA 3WUBA 1LJYA 2FGLA 1X6NA 3VO0A 2ZWZA 3N15A 1VEPA 3SUUA 3GZAA 2XFYA 4JZ5A 3VVGA 2WHJA 1J10A 3UERA 1JDDA 2E9LA 4H7VA 3PZ9A 4W8AA 1ZBWA 2VX6A 2D1ZA 3UETA 3CUGA 1JI2A 2YA1A 1J0ZA 3CUHA 2CXGA 2VVSA 3AQUA 4NI3A 3KL3A 1BTCA 1GW1A 1GQKA 2CKSA 3FAWA 4PMDA 3WDJA 5A8PA 2ZXQA 3WFZA 4U5KA 1ZU8A 3BMVA 4FK9A 4TTUA 2CITA 1CDGA 2X8RA 3GNOA 1UKOA 3LMYA 4J3UA 3THCA 1UWIA 1PPIA 1W1TA 2JEQA 3O9NA 2ZE0A 2VCBA 1E1FA 3GXDA 1VIWA 3AZTA 5A94A 1R85A 1UWTA 2XWDA 4GO8A 4HMCA 1UZ4A 3CZLA 3AISA 4ACZB 3SIMA 4H41A 5I6SA 1GVYA 3GH7A 4WKAA 2C7FA 2X2YA 1Q4NX 3SCSA 2VURA 1VEMA 3II1A 3AYSA 5I77A 5CGMA 1OIMA 1CTNA 4AWEA 4FLSA 1H49A 1UYQA 3PZIA 2GJRA 4MJ2A 1SMDA 5CSYA 2VTFA 3VDAA 1BGGA 2PI6A 3GNPA 5ECUA 3BAIA 1DWFM 4J28A 3WH5A 1E43A 3WMBA 3N12A 2XJ7A 4V2XA 1TA3B 3VMOA 4FLQA 4EK7A 2UY4A 3NSXA 2J7BA 4UOZA 2WSPA 2A3EA 1JG9A 1KBBA 1C7TA 1V6VA 4AISA 3OLEA 1V6XA 1K9FA 3UG4A 5BXRA 4MDOA 2J8FA 3BH4A 2W5FA 3ZT5A 3CHFA 3VU2A 3GH4A 1G0CA 5A8OA 4Z2JA 1TE1A 4UQDA 1WCGA 3AJ7A 1ODZA 3WQWA 5FKYA 2XM2A 3A47A 5D9NA 1XH1A 5A6KA 3S6TA 1E15A 3SUTA 2PWGA 1W1VA 3N11A 4ML4A 4PRWA 3VDBA 4J3SA 1M7XA 3W29A 1DTUA 2VZTA 3ZSTA 1WKYA 1VFOA 2WYSA 2VO5A 4CU7A 3IJ7A 1FHDA 2D23A 2WHKA 3HMCA 2OYMA 4EAMA 2VZSA 3ARZA 3WBEA 1E9LA 2XG9A 4QCEA 3MV01 1SMAA 4AD1A 1JYWA 3RO8A 3ZR6A 5AC5A 4CCEA 1WE5A 4W89A 3VM5A 3ZJ6A 3PZVA 3WNPA 5CJ5A 3AIVA 3BLPX 3UR7A 1NWRA 4CGTA 1HNYA 4Z2GA 4B15A 4W8BA 3EDEA 3VIJA 5A6MA 3SCTA 2IUZA 3T2OA 1WDPA 2VOTA 4U3CA 3AS2A 1UQZA 2VZUA 1RPKA 4D6HA 2WMIB 4YHGA 1ODUA 1EGZA 3WUFA 1GORA 3VILA 2BY1A 3AHYA 3TONA 2HISA 1HKKA 1NOUA 4TVCA 4TX8A 1DWAM 2YDRA 4CCCA 1AQ0A 1WZKA 1PBGA 2DT2A 1HT6A 3G6LA 3T2PA 2X1IA 1E6QM 3MKKA 3VGGA 1IZJA 1EH9A 1LWJA 1J0YA 3VX0A 1ECEA 2X0YA 4GQRA 3T0BA 3OLGA 3AIWA 5D8WA 4UQBA 3MUIA 4JFVA 5DFAA 3EMCA 1G9HA 3W26A 1V6WA 3CGTA 5JBDA 4MNLA 2XSBA 3W53A 1WO2A 1JF6A 1GONA 1NWSA 5AYIA 3VIKA 3U5YA 3VDCA 2EO7A 1ZBKA 5A6BD 2VR4A 1NP2A 4CVUA 2VX5A 1EHNA 1R87A 3PTMA 4KH2A 3PZOA 4PSRA 3RM8A 2D0FA 4U31A 1E6PA 2V38A 1KXVA 3L4XA 4RE3A 1Y7VA 4MAZA 4MADA 4AY1A 2GVYA 3AHXA 2JF7A 3BSGA 2EPLX 3NDYA 2DSWA 2WB5A 1FP8A 1PIGA 3VPLA 2BY2A 2C8NA 2BHYA 1QHOA 4F66A 2DT1A 3EYPA 1CXHA 4A3HA 1HIZA 2DSZA 3VINA 3B9EA 2EPNA 3UESA 1BVNP 1H0IA 1DWGM 2YL5A 3AMLA 3VD4A 1MXGA 2BY3A 1EDGA 2Y8VA 2WVUA 4HMEA 1C92A 3APGA 4D6JA 4DWSA 1BSIA 4YPJA 3WL0A 4CD5A 2Q8XA 4PTXA 1XRVA 1EDQA 2G4FA 4HU0A 5E0FA 2BXYA 1QNPA 4M80A 4AZIA 3OGVA 1QHZA 1EIBA 1YHTA 4JKLA 3U5UA 3VGBA 5BYWA 4CN4A 1H11A 3T0AA 1RH9A 1UA3A 1ZBCA 3QR3A 2ZUNA 4UFMA 1W9XA 2B31A 4HPGA 2CNCA 5CG0A 3EDDA 3WNOA 1NM9A 3UCQA 1QHPA 3QOKA 3ARQA 3WNKA 1UH3A 5C70A 2WLYA 4UQ9A 2D0HA 4FLOA 1JDCA 2D22A 1EA9C 5C8BB 3ALGA 2PWEA 3LPOA 3BGAA 5IFTA 2PBGA 3G6MA 5CLWA 2BS9A 4W7VA 3MMDA 4GXPA 3VM7A 3VIMA 2ZUTA 3SCNA 3CUJA 4Q22A 2XVGA 1JZ2A 1GHRA 3F5LA 1B1YA 4AIEA 1OT2A 1QI4A 3N9KA 3SUWA 4UTFA 3WN6A 3WFLA 3W6MA 2YL8A 4MNKA 2J47A 3TTSA 1UD5A 4GI8A 2ZUSA 1E6NA 3CHCA 2DQXA 1ZS2A 3IAPA 2GK1B 3L2MA 2BV9A 2WKLA 3NUKA 1UD4A 2J77A 5BRPA 4R27A 3VGDA 3DECA 4W5ZA 1NQ6A 3L4YA 1M01A 3EDFA 3M07A 3BMWA 3TA9A 2JIWA 1JXJA 3GXIA 2JE8A 5ABGA 4P8UA 2XTKA 3W81A 2WSKA 3AHTA 1AVAA 4ZXLA 3ZOAA 5A2AA 4HZ6A 4M24A 1QI2A 3ZJ8A 4UCFA 1F4HA 2V5CA 3CHDA 1EOMA 1BHGA 2W63A 3W38A 3AOFA 3VD5A 2WK2A 1IT0A 4RE4A 1O7AA 1J01A 3ARXA 4UQEA 1VRXA 3N18A 3K8MA 4ZEPA 4TTGA 4ACYA 3EDJA 4CN1A 4P7OA 2VCCA 2A3HA 1PJ9A 3ZT7A 4PMQA 1QNSA 3AHVA 2XGBA 2E0PA 4KGJA 4NSBA 5E6ZA 3W82A 4CD6A 1ZBVA 1XYFA 3VNZA 2Y4SA 1NWUA 2WXDM 1CGWA 6CGTA 3BXWA 1UA7A 1E6RA 1C90A 4AEEA 2WM0A 2YDQA 1W3JA 2D24A 4OUEA 1B3XA 1Q6FA 4LQ1A 2FGZA 5HNNA 3WD1A 3FW6A 1F4AA 3VIOA 1UHVA 4OBSA 1J0HA 2VZVA 1X1NA 2J79A 4MNMA 4BZYA 4UFJA 3WH7A 1XH0A 1HL9A 5D4YA 2BVYA 3BLKA 4LX4A 4UOQA 3U7BA 4B16A 3AMKA 3E1F1 4PMRA 4XX6A 3BAWA 4D1JA 3WF2A 2CEQA 2VMFA 2Z1SA 4P8XA 1V0KA 3VIGA 4U3AA 5I23A 1EOKA 3ZIZA 1MQRA 5D9PA 1EO5A 2CCRA 1CZ1A 4U2ZA 4TUFA 1NP0A 1P6WA 1Q6CA 1FFRA 3SEPA 1ZJBA 2VI0A 5GNYA 4V27A 1VENA 2Y2WA 1V03A 1UG6A 5BXSA 1B2YA 5I24A 1HJVA 4PTVA 1WZMA 1NOWA 1V0LA 3VIIA 1OINA 2VJXA 1ESWA 3TTQA 4HZ7A 1IZKA 3WD4A 3FNDA 1UR1A 1TVPA 3DYMA 2XSAA 3WNMA 1UKQA 1UD6A 1UD2A 4DWSB 2F2HA 2OSXA 2V5DA 2W66A 4W7WA 2QHAA 4HZ8A 4DM2A 4FF5A 3AIRA 1D7FA 4W86A 5CPSA 5CZKA 2X09A 2VRKA 1E40A 4QCFA 2CETA 5A6SA 4GZEA 1V6UA 2BY0A 2EJ1A 3VX1A 3GXFA 4PMOA 1BLIA 3WSUA 1NWTA 2WMGA 3N13A 4X9YA 1HF6A 3K4DA 4W5UA 3GDBA 3VKKA 5D8ZA 4PEEA 1C7SA 2ZXDA 1JZ4A 1LWHA 2JIEA 3WELA 1V02E 3CZEA 4W85A 2HVMA 2J7GA 1U2YA 2E4TA 1UZ1A 3RIKA 1U33A 1XCXA 3KL5A 4KRTA 4N42A 3M7SA 2CBVA 4W87A 3BAKA 1RD6A 3IAQA 1OD0A 4CVWA 4C7DA 4GZJA 2ZIDA 1JD7A 4NRSA 4PMYA 1OB0A 2J8GA 4AZ6A 2OWCA 2J7EA 4D6GA 5DO8A 1FH8A 4CD4A 4DUXA 3B8SA 3WD0A 2NSXA 2QPSA 1GQIA 3ZQ9A 2RGMA 3B9AA 2DH2A 4PN2A 4B3KA 5CQ1A 3W25A 2UWFA 4NZCA 4UNIA 4H8HA 2J7DA 4BQ4A 4XZBA 3SURA 2G3MA 2QMKA 1K9EA 3BCFA 4MNJA 3SUSA 1VF8A 3VOCA 4AD3A 1WP6A 1CXKA 1V3KA 2AAAA 1OD8A 2VC9A 1UR9A 4AEFA 4ATWA 4AIOA 4Z2HA 2WZIA 1WDSA 2CHOA 3T08A 5EFFA 4W84A 1W3KA 3NSMA 2J7CA 3GNRA 1BYDA 2WWCA 3SCPA 3OZOA 3A4AA 4L4OA 1W91A 1XHGA 1JIBA 4URIA 1GJWA 1OGSA 4UZUA 3GTNA 1BGAA 1BQCA 2EPMX 5M5DA 4QFUA 2EEXA 1KXHA 3ZO9A 1GOOA 4IUGA 3AIUA 2XFFA 1LLOA 4IPNB 3M6DA 4H8VA 2VUYA 2BXZA 2EQDA 4WSJA 2VX4A 3ZR5A 2WWDA 2RGLA 4RL3A 3S2CA 5E0CA 3M46A 5BWFA 4FMVA 3ZJKA 4HTYA 5CPTA 2GFTA 4AXNA 3GXMA 1WNOA 1FOBA 1XGZA 2VL4A 4WLCA 2NW0A 3OZPA 4C7GA 3RCNA 1C8YA 7CGTA 1GOQA 1KXTA 4TVDA 1QBAA 2UY3A 1VJSA 4B9YA 2GSJA 2OSWA 1HKJA 3OG2A 3MUZ1 3MV11 3PZGA 1JL8A 4WKHA 1CXFA 2J62A 4IM4A 3POCA 5E9AA 1QW9A 4D6IA 4PCTA 4P7NA 1HKMA 1E4NA 4LYPA 2YDSA 1GVIA 2DT3A 5IXEA 3QOMA 1H3GA 4CU6A 3MU7A 5I2UA 3VGEA 4PCSA 3ECQA 5CSUA 3K46A 3T2QA 2BHUA 3WDIA 3WEMA 3VGHA 3PZUA 1GJUA 3NCOA 5HDRA 3IJ8A 1HJUA 4L4PA 4UFKA 1I1XA 4CD7A 1VEOA 4TVUA 5CXPA 4PMXA 2CESA 3FXYA 4GKLA 2ZXAA 3WKZA 3WH9A 1CGUA 4J3XA 4M56A 1B31A 1OGGA 3AROA 3GBDA 5FOOA 1CGTA 3K4AA 4UFIA 5EB8A 2WNWA 4OIFA 1X6LA 5A6LA 4QP0A 2D2OA 1MFUA 4AD0A 1UKTA 1M03A 4M8UA 5AY7A 2JEPA 6TAAA 2CHNA 5CGTA 1PZ2A 2ZOXA 4J3TA 2WCGA 4PYSA 2YLLA 4JCMA 2VZOA 1WAWA 4UFHA 4CN6A 3VD7A 3L4UA 2OWXA 2OSYA 2V3EA 3W0KA 1HJSA 1GOKA 3WNLA 2GJPA 1CGVA 3WQ5A 1BYAA 4LGXA 4HOWA 3MUY1 4AMCA 4LPCA 3RPMA 2J25A 4HPHA 5IDIA 2ZICA 2WVSA 4M1RA 3PTQA 2E8ZA 3CUIA 3AS0A 2XVKA 4WSKA 5KZ6A 1QVBA 4A3YA 1NH6A 4U5IA 3NIYA 2GJXA 5JUVA 2CBUA 4BS0A 1TUXA 2W61A 1E0XA 2WCSA 1QI5A 2WVVA 3GH5A 3BAXA 1UR0A 4MB3A 3F5KA 3JUGA 5FD0A 1CECA 1QNQA 1MW1A 4ZE4A 4U33A 3K8LA 1BPLB 1CNVA 4HU8A 3WMSA 2OYLA 3PZTA 1V6YA 2O9TA 1FFQA 4WIWA 3WIJA 2XHYA 1E4IA 1NOFA 1VJZA 2WC3A 4UFLA 3AS1A 1XH2A 3MUAA 5KEZA 2VQUA 2BFGA 3WF4A 1E5NA 2O9OA 3W6LA 4GPNA 5JBEA 4OBRA 1V08A 1MW2A 1QPKA 2WBKA 3ARSA 1SFSA 1ISXA 3KZSA 2QLYA 2W62A 3HU7A 4C7FA 2VVNA 4HOXA 1E5JA 4B9ZA 2XFRA 2WZHA 1EQCA 2G8ZA 1QI3A 1MVYA 4E8CA 4AZBA 4CCDA 4OZOA
chains in the Genus database with same CATH superfamily
1HJWA 2QCMA 1P4CA 4IP4A 3AXIA 1VFHA 2ZFAA 1EJRC 4LBUA 5E9XA 2OLAA 1W1YA 3OA3A 3FVMA 1W5OA 3DFNA 1U30A 1VYPX 4NAFA 1YQ2A 4K8GA 3VZYA 4A4AA 3TU9A 2YJQA 5LIWX 1OT1A 4KFNA 5DT5A 3PSWA 3QZ6A 3C0LA 4AZHA 3ITGA 5HULA 1IE7C 1Z41A 1SUXA 5I3FA 1KB3A 2W6RA 1YNQA 2RUSA 2IQ0A 1BRLB 1TA3A 3G77A 2R1PA 1E1EA 1X7FA 3N2BA 2ZRVA 2WHLA 1B3WA 1KQYA 3UZ5A 2EKCA 4AW7A 3MI3A 3O2LA 3AMGA 4TO8A 3CL6A 1A50A 1CGXA 2ON3A 4OHQA 2DZWA 3ZLGA 1V6TA 3KE0A 2VR5A 4D8AA 1MXDA 1MI3A 2BOGX 2OZ8A 4QSFA 3BW2A 3GVQA 2O4QA 5EMLA 3K4WA 5DQPA 2NVDA 1DV7A 4ICNA 3L67A 1HQTA 3WQFA 3CZKA 1YBQA 4AG0A 1GKQA 2AQWA 3CBWA 4YTTA 1DXEA 1BYCA 1DE6A 5D02A 1C93A 3H8AA 2PWVA 1NIUA 3DHFA 5BCAA 4ZB5A 1VFLA 3WJXA 4I8DA 4NG3A 4MB4A 1M53A 2PU0A 5K9DA 1I2NA 3GY1A 2E40A 5C2GA 1IXOA 3LD5A 5F4WA 1KXQA 3UJRA 1GVEA 2IW0A 3BQ5A 3PJXA 3BAJA 3GDTA 2ASHA 3N2XA 4LBRA 1MWOA 2WMJA 3PZQA 3MTWA 1H60A 3A23A 4PUJA 5JVLA 1LLWA 2E1WA 3A4XA 4HHLA 1U1UA 4QLKA 4AC7C 5BU9A 5A3HA 1CGYA 4ML9A 1K3UA 1MQPA 4ZODA 1H1ZA 3GHUA 4FHAA 3NG3A 1G69A 4YN5A 4KRUA 4AD2A 3CMGA 1QBBA 1RVKA 3DI1A 1KFCA 5D2WA 3C56A 4JTHA 5HXMA 2ZBTA 1LG1A 3R43A 1ZB5A 4YWSA 1L2QA 4UR8A 4CQAA 3KL0A 4F2BA 2BVDA 3M6YA 3KEHA 2E3ZA 3WK2A 2WVVB 2QPUA 2V0TA 8A3HA 2PFHA 1J11A 3BAYA 2P3ZA 5BXTA 1SFLA 4YJ5A 1JGIA 4I90A 1AD4A 3TJIA 1QNOA 3DHUA 4H2CA 4Q8PA 4ASTA 1H1NA 1JNDA 2YW3A 3P67A 1FH9A 3VNJA 2BHZA 1TG7A 3GFXA 3HGJA 4R33A 3AWOA 4G56A 3TTYA 1KR1A 6A3HA 4AD5A 1K9DA 1Q8JA 1GOXA 4PE8A 1KD0A 4JTIA 1NU5A 1PIFA 1EGMA 4LJ3A 1OBAA 1M04A 3H2NA 3UXAA 2FGBA 4LF2A 4QXIA 4TXEA 1NVMA 4PSPA 3GLCA 1UR4A 2QJMA 4ICCX 3F4DA 3W1QA 1G6CA 3OBKA 4GNVA 4IGSA 4MB5A 2I7GA 2XVPA 3P2VA 2QZRA 4JKKA 5A8NA 4OECA 4ZFCA 3KW3A 4P8VA 2A3LA 5TIMA 2ZQ0A 1U5HA 3B05A 2PTXA 4NAFB 2GLKA 4DN1A 1OSEA 3DG7A 2ZRUA 3EWZA 1RV8A 5HANA 4CQ9A 1YXDA 3CL7A 3RITA 4FR1A 4HMDA 5C9RA 4JTQA 3BO9A 4DZAA 1W9PA 3B9DA 3LTYA 3IVTA 3EWBX 3ELFA 3RJXA 3ES8A 1ICQA 3NYZA 2YA0A 3WF0A 4Y6GA 1HVXA 2XN0A 4N02A 3NTYA 3QHOA 4X0VA 3B40A 1XD1A 3LB0A 3EWWA 1ONRA 1ME9A 4Y8FA 2ZRXA 2INFA 7REQA 2B0MA 2PDGA 4YL2A 1TZ7A 4AHQA 3FN9A 4EE9A 1XF0A 2D0GA 3UG5A 4P61A 1JQVA 1LDCA 5HQEA 3VMNA 3WBYA 1YBQB 2W92A 4YHEA 1LG2A 4Z17A 1VFSA 4AFYA 1X7IA 5JH2A 4CU8A 3B3DA 3WMLA 4FF7A 4ZVJA 5GNXA 1CPUA 2GQ8A 2GDQA 4Q4RA 4GYPA 1KTBA 4JX4A 4DBEA 1DWJM 1XD0A 4KIRA 3FVDA 2B7PA 5XINA 1K4GA 3F7JA 1TCDA 1XYCA 2XYLA 2VXNA 4FNSA 1W3LA 2HDJA 4DZ5A 4AVOA 3OGRA 4O1DA 1GQJA 3EBVA 3WDPP 3DOPA 2OFJA 1M5WA 2ZA2A 1J12A 1LL4A 1S2VA 1QOXA 3N25A 4HCHA 2Y24A 3PANA 1X8CA 2CKRA 3HM7A 2A3CA 4RX0A 2ALDA 4W88A 3RM4A 3BV4A 1YRRA 4WF7A 1UD3A 4IF2A 1XSKA 5H8PA 2AOSA 6ENLA 2KAUC 3MKVA 2PZNA 1GOMA 4YU1A 2XGZA 4LNCA 2Y5SA 3HBLA 3UA4A 1NDYA 3KZPA 2J66A 2A3AA 3NQBA 4AWTA 1C8QA 4K38A 3MSRA 2PLJA 2WZEA 1LTDA 4JTRA 5C9XA 3SCVA 1G94A 2BOFX 3F5JA 1EEPA 2CIPA 3SCOA 3HFYA 5KTLA 2DQWA 3CWOX 1UPPA 4CNUA 2P8CA 3THDA 3LM7A 3QM3A 4HSHA 1H41A 1ONEA 1F3EA 1Z89A 2WHMA 3DX5A 3IS4A 3RUBL 2B7OA 3S4TA 2Z1KA 1IWAA 4YTUA 5REQA 1PZ0A 1EX5A 4HIBA 1Q6EA 5AVNA 3LM3A 2QF7A 3RPTA 4OKDA 1PKMA 1O1HA 3AYRA 4ZOBA 3W01A 2BVTA 1OY0A 4NAEB 3TYEA 3GC4A 3W70A 2J24A 3N1AA 4J35A 3SSZA 4R3UA 5LIXX 3SCRA 2O9RA 4QE5A 1S5VA 3MZ2A 1G01A 1O12A 3C3NA 3ZWTA 3PS7A 2WAGA 5G4WA 1JPKA 4M5PA 3TH6A 4BQ2A 2ZX5A 3A12A 2XIIA 3K30A 1IZCA 1GTEA 1TVLA 5EGRA 3MO7A 3W7LA 1QO5A 3C61A 1AQHA 2YLAA 4Z1CA 1XC4A 3S3GA 1R2TA 4JIRA 3KWXA 1JJKA 1JFHA 4BF7A 1TJPA 2YXXA 4HA4A 3MSGA 4RDYA 1JDAA 1OEPA 1ZCOA 4A8LA 1PL9A 4OJYA 4H7ZA 3HN3A 4FX6M 2VEMA 1O66A 2YCJA 5LZLA 4D8LA 2J6XA 1OFRA 2DIJA 2ZUUA 1MZRA 3CPRA 4LRTA 3TDFA 1LQ0A 2O92A 3DI0A 3W1LA 3PZMA 2Y8UA 1DJZA 4X3ZA 1XG3A 2Y0FA 7REQB 3AI0A 4ZA0A 1IXNA 2QGYA 5EMKA 1RP8A 3I3DA 1XSJA 4XV0A 2GVEA 1XLIA 3OJGA 5JH1A 5I00A 2QUUA 3UWYA 1KFWA 3P3BA 4W4QA 3WZ0E 3W2UA 5FCZA 4LYRA 4NJJA 1A53A 2CLFA 4MSSA 1GHSA 1KBIA 1S2TA 3LGEA 1K1DA 4FI4A 1YW1A 1AH0A 1R2RA 2BDQA 3LV5A 4DWSD 3W7HA 1OZQA 4MAVA 1JXKA 4C1LA 2ZA1A 2IKGA 1BYBA 3EWCA 2OB3A 1LOSA 2Y5EA 1W2PA 3LG3A 5DELA 2J9ZA 3MT1A 1JGMA 4JD4A 1UKPA 4J3WA 1QW8A 1DHKA 1VCGA 2Y7GA 1FQ0A 3A64A 2WJZA 2KZHA 2OLHA 1B9BA 4BI5A 3KRBA 5LA1A 4AHOA 4QGCA 5DT7A 2JF6A 4IT1A 2Y63A 5A6AA 1XLFA 3WJWA 3AHZA 4LVAA 4O53A 1B0IA 4JHZA 2J88A 5JBFA 2R9RA 3F4VA 4M81A 3W27A 3UG8A 2IKJA 1KGUA 4GQGA 1E71M 4H8NA 3LXCA 3U3HA 3KOYA 1EUAA 1E72M 2UY2A 3OB8A 3HJEA 1BWVA 1V7YA 3OLIA 1B54A 5C55A 1I8JA 1XPGA 1EJWC 3EDKA 1TWWA 3W23A 5LGZA 4MZ1A 4PULA 1UP3A 3E6EA 2X0HA 1H50A 3KCJA 2E9BA 4GQQA 3W7QA 1FWSA 3E74A 3OU8A 3P8IA 4F0HA 1E6SM 3AMCA 2V5LA 4BK9A 1JQXA 1ZGDA 1ADDA 4JQ2A 2POTA 2FKPA 3VZZA 1J0IA 1GUVA 1IT8A 1EDTA 3IGUA 1WDQA 5I06A 4DJDD 5D37A 3L12A 4FXJA 4RK8A 5FF4A 3VIFA 3N17A 3OOQA 1K6WA 1YXCA 4OV4A 3H26A 3A5VA 4M1BA 2EPOA 3MB9A 3IVUA 1SO5A 1XYMA 2NT1A 4MY1A 4WRHA 3RCYA 1HN1A 1PUDA 3LTSA 4IIFA 1W1ZA 4MWAC 1SFJA 2FGLA 3VO0A 2BMBA 4JICA 2ZWZA 4L80A 3GZAA 3RU6A 3VVGA 3H54A 2WHJA 2PDHA 4H83A 4XVDA 2GQAA 3PZ9A 3PNZA 2IS7A 4H00A 2VX6A 2HVOA 2OZ0A 3G0XA 1JI2A 1TWZA 2XN1A 4INFA 4EX4A 3R79A 1SJBA 4DNHA 1P7TA 4FOUA 3KL3A 4LUJA 1BTCA 1JULA 1GQKA 3PSVA 3WFZA 3S42A 3BMVA 3T78A 2CLEA 1TJRA 2A0NA 1UWIA 2NV2A 1PPIA 3O9NA 4JTAA 1VIWA 3AZTA 4O1BA 1UWTA 3R58A 3SIMA 2FZNA 4F0SA 3G1FA 5I6SA 4WKAA 3GH7A 4LS1A 1OADA 1SW0A 1P1MA 3II1A 5CGMA 2ICSA 1OIMA 1VBHA 3M9YA 1TPVA 1SZRA 3H2CA 4AMAA 4FLSA 1UYQA 5BW6A 4MJ2A 2VTFA 3LRKA 1C9WA 1DKWA 3BAIA 4Q6JA 4J28A 1E43A 1VBJA 3WMBA 2E25A 4HYRA 4V2XA 4FLQA 4QG6A 2UY4A 2BODX 1PKNA 4UOZA 2WSPA 3LERA 3CQIA 1MRQA 1JG9A 1KBBA 5TF0A 3ITOA 4TMCA 4CCZA 1V6XA 1K9FA 1RQHA 5CPLA 4JN7A 3NQ7A 4MDOA 1WUEA 3SADA 4IIGA 2W5FA 2C3ZA 3ZT5A 4RZ6A 3VU2A 2FJUB 4B5SA 1LOLA 3M41A 4F3HA 3QRHA 2X16A 2QDEA 3O15A 2PDPA 3WQWA 2E28A 3P8JA 2V67A 1TUFA 4O10A 1EIXA 5A6KA 2PWGA 1W1VA 4PRWA 4N4QA 3ZSTA 1XYAA 3QMTA 3N2OA 5HNRA 3W7JA 3E5PA 1KFJA 2PRHA 2D23A 1POKA 3UCCA 2OYMA 3PJWA 1VJIA 4IJBA 1Y0EA 5IRPA 3MV01 2BZNA 4AD1A 3VNLA 3E0VA 5SWUA 1L2UA 3LHWA 1F2JA 5CBIA 5EKYA 2QEZA 3KAOA 3I4EA 3KUMA 3GZ3A 4HK6A 4JPGA 4NIRA 3V75A 3N2TA 4B15A 4A3QA 3O05A 4IMEA 3JZUA 2F2KA 3NZGA 1A5NC 1T5AA 1UQZA 3NL6A 3WO8A 4D6HA 4YHGA 5LHFA 3WUFA 1GORA 2E68A 2BY1A 1Y5WA 1PDZA 3GFZA 4HNVA 2VFHA 3TONA 1HKKA 2Q02A 4TVCA 2Q01A 2YDRA 1AQ0A 1A80A 1PBGA 3M43A 1HT6A 1EP3A 4KRZA 5DBTA 1I0BA 1EWEA 3T2PA 3F03K 4DO5A 3MHUA 4R7WA 5RUBA 3MKKA 4D9PA 3SGUA 4J1OA 2WQPA 5KETA 1LWJA 3VX0A 4KS0A 3LI0A 2WNQA 4GQRA 2W27A 3QY6A 1BXCA 1I9CB 4RKAA 3KTCA 3FA4A 4UQBA 4LEQA 3VNDA 2PA6A 3JW7A 2B7NA 4IHCA 5DFAA 1BSLA 4MNLA 1MNZA 5HR6A 5AYIA 1JEZA 4O28A 1ZQ5A 4R9OA 4NU7A 5CC5A 5B7ZA 4ALDA 2VX5A 3PTMA 4ZOCA 2D0FA 1YNPA 4TV5A 2V38A 1KXVA 3UZXA 4B5WA 2P88A 3MUCA 3E0LA 3KVJA 1XKYA 1Y7VA 4MAZA 2Y62A 5BMWA 4AY1A 3IIOA 2QAFA 1Y8BA 2PP3A 3ZVIA 2F38A 4NXSA 3DESA 2Z2BA 1W31A 2DT1A 1CXHA 3O0KA 2EPNA 3UESA 1DWGM 3CQJA 3F4WA 1FCUA 4D6JA 2PDBA 1EDQA 1XYBA 2G95A 2VC5A 5E0FA 2BXYA 4M80A 4QBXA 2PSNA 2ACRA 2V6AA 3GTFA 5H91A 3R0UA 4YTSA 1EIBA 1NELA 5BYWA 2GVJA 1OFDA 4L7ZA 1NTHA 4UC5A 4CN4A 2ZZ4A 1ZY9A 4Q4MA 1ZBCA 3FIGA 3TWBA 4WY0F 1LROA 3WNOA 2E6FA 1QHPA 1EBHA 1UH3A 2Z1BA 3QV6A 3AJXA 4UQ9A 3P0XA 2PZ0A 1I45A 3LPOA 3I6EA 4AX7A 5IFTA 3G6MA 2A85A 3BANA 5D05A 1OFOA 3MMDA 3S2LA 3W7NA 2VFGA 3GU1A 3BOFA 1R6WA 2CLIA 4HSNA 3WJYA 3UWQA 4L9XA 4GYFA 3WFLA 1US0A 4HGXA 2J47A 1UD5A 3PK7A 2V69A 2QVHA 3KRSA 2VDHA 1S5TA 3IAPA 1UWAA 3QR1A 3WK3A 1OF6A 4S3GA 2BV9A 1BKSA 2B7QA 4LY4A 1UD4A 3ZS4A 3T8LA 2VR2A 3C5QA 5FSDC 4K6AA 3M07A 3BMWA 3TA9A 5D30A 2INZA 3MUXA 3AHTA 1AVAA 1CT5A 1A5UA 1F8MA 3G24A 3G18A 3ZOAA 3NQ2A 5A2AA 3N6JA 1IEIA 4HZ6A 4JX5A 4NL1A 4O1EA 3GAKA 3LUTA 4GIEA 4ZB0A 3VD5A 1T96A 2WK2A 2AMXA 1KFEA 2PF8A 2VFIA 4RE4A 1O7AA 3ARXA 3TYCA 4K8EA 3G3DA 1OYAA 4RV8A 4DAIA 3EKGA 4TTGA 2VFFA 1FKXA 1M65A 4IIEA 2V5JA 4AY7A 1EUNA 3W1UA 1QNSA 3T4CA 2E0PA 2H8ZA 3O7UA 5FJRA 1ZPTA 1AMKA 1XYFA 4B2DA 1OX6A 4GVHA 3QV7A 3E02A 3BXWA 1C90A 2JGYA 2WM0A 3BVJA 4OUEA 2EJAA 1ML1A 1B3XA 1Q6FA 4LVGA 1QW7A 1YEYA 1WKFA 2XINA 3WD1A 3NPXA 3VIOA 2NQHA 4BF9A 1KBLA 2J79A 2V2CA 3R94A 2CHRA 4DYEA 1F3TA 3BLKA 4ZSUA 1R5YA 4GIYA 3EEGA 3APYA 2CZDA 3N19B 1J4EA 2DZTA 3M44A 3S46A 3WF2A 3W7CA 3FJLA 3BV7A 4R7OA 4R7JA 4U3AA 3NURA 4IH3A 1NSJA 1V4YA 4ZCWA 4JTUA 2WSRA 1I2PA 2CCRA 4Z08A 3RYSA 1CZ1A 3KHJA 2TYSA 1VENA 2Y2WA 4LUIA 1NFGA 1NFBA 1LORA 1SU5A 3UYIA 3VIIA 5CC3A 1KM4A 4NNAA 2RJGA 3R11A 5AHNA 4LS2A 5GJNA 4O1AA 2RAGA 3P84A 1KRAC 4JDYA 1RCXB 2V5DA 2VGIA 1XFBA 2Z0IA 4W7WA 4HZ8A 4DM2A 2DP3A 1W8GA 1PZ1A 1W3IA 4W86A 5CPSA 3PFRA 3CAKA 1XGEA 1Q4WA 2IQTA 4GZEA 1RD5A 4LB3A 1GJPA 1KM0A 1J5SA 4HHHA 3VX1A 1RHCA 3WSUA 1NWTA 3N13A 4X9YA 3BUVA 2HRWA 4W5UA 4Q8NA 1M9HA 2VDGA 4CEUC 3B9OA 3VKKA 2PDCA 1C7SA 3KX6A 5CZ0A 1V02E 2I5GA 4LSBA 2HVMA 1U2YA 3L66A 3HG5A 2ZC1A 3TK7A 1YMYA 3M7SA 4HD5A 4IIDA 2D2HA 2YCLA 3C3UA 4C6DA 2J13A 4IGMA 3BAKA 3EX4A 3HZ3A 2ZDRA 4LALA 2OODA 5H1WA 4XUGA 3RLUA 3QW4B 4MY9A 4AZ6A 2J8GA 1D3GA 3GYEA 2PTYA 4U10A 1PO9A 4D6GA 1FH8A 1A3XA 1GEHA 3B8SA 3C4UA 3EPOA 3AU2A 3OZMA 1WA3A 3V0UA 3LHTA 3WYZA 1PHWA 2C1IA 2XIMA 2RGMA 3G1YA 3IJ6A 3OYZA 3N9RA 3ABOA 4XVEA 2Z4GA 4H8HA 3F4NA 3SURA 1K9EA 5IDZA 3IJLA 2FB3A 3N3MA 3UCDA 3GXNA 1FXQA 3ABQA 3E9AA 4Z2HA 1Y5VA 4EP8C 6XIAA 5K4XA 3NSMA 2E77A 2J7CA 3GNRA 4C6IA 1YPXA 1XRSA 4UXDA 3TQKA 1S39A 1F74A 4L65A 5FAJA 1LZOA 5T9BG 4URIA 1OGSA 1BGAA 2EPMX 5M5DA 4QFUA 2EEXA 1DQXA 3CWNA 1KXHA 1LLOA 1I4NA 2VUYA 3SJNA 1OCBA 5E0CA 2NLIA 4Y96A 1XBXA 1W5QA 4BEQA 4HTYA 5CPTA 2GFTA 4AXNA 2W9MA 4UTWC 2ZZ6A 1XGZA 3DAQA 1UIPA 2NW0A 1C8YA 3W2JA 4DJEA 3GD6A 1QBAA 2UY3A 5CAHA 1UZDA 4B9YA 4DYKA 3WLHA 4L9YA 3UPWA 2F6UA 3QPZA 3R89A 4H9VA 3T6CA 3VKJA 1TPC1 1X97A 1R9XA 4PCTA 4NX5A 3EB2A 1H3GA 1Q8AA 1YYAA 4FOJA 3QZAA 3LCGA 4HSOA 3ECQA 4LVDA 2BHUA 2Z6IA 2PTZA 3PZUA 4LH8A 1L6SA 1Y5XA 3B0YA 4DRSA 3IJ8A 4UFKA 2QGHA 2P50A 4TVUA 1ITUA 4GWEA 4E38A 3I7RA 2Y7FA 3UWZA 2DZAA 3WH9A 3AROA 3GBDA 4HPXA 3BG5A 3CUZA 3OQEA 4OIFA 2XH0A 3WQPA 4QP0A 4AD0A 1QT1A 4C1NB 4M8UA 4F0MA 3VFCA 3Q37A 5L6UA 5CGTA 1YX1A 4J3TA 3NQFA 2WCGA 3W7RA 3UWUA 2VZOA 3OIXA 2F9RA 3FXGA 1WAWA 5I3HA 3PPHA 4CN6A 3MC5A 3BLIA 4DYJA 3L4UA 1BF6A 4GBUA 2OSYA 3WG6A 3IJDA 1GOKA 1PV8A 2GJPA 3H4WA 2J27A 1A0EA 4IQLA 2VP8A 3M4HA 1BVWA 4QJ4B 1Q2RA 1EL3A 2DV0A 3S8HA 4WSKA 1QVBA 4NJGA 3CIXA 1Z48A 1KFBA 4U5IA 4E3TA 5JMUA 5JUVA 1LT7A 1R38A 1OC7A 1TUXA 3I7QA 2YCLB 5BZAA 3WQCA 2DJXA 1UR0A 4MKSA 1F61A 1TRIA 2HBXA 3OBEA 1P43A 3T7VA 3QC3A 4U33A 3Q4DA 1BPLB 2Z7GA 5HINA 1KA9F 2XHYA 1VJZA 4V33A 4XO7A 1H7RA 3AS1A 3MUAA 1HZYA 3SN0A 1LBLA 1IWBA 4I7UA 4FIQA 4Y9MA 2EHHA 2IKHA 1E5NA 1GZGA 3WF4A 2O55A 2HPMA 3LRMA 1SJCA 1VRDA 1MW2A 3GU9A 3ARSA 4EF9A 3KZSA 3PULA 1RUSA 4C6KA 1DORA 3QF0A 2XH2A 4B9ZA 3Q45A 4GABA 4UTJA 1QI3A 4Q8UA 4CCDA 4OZOA 5I79A 1DWHM 5H2ZA 1W1B1 2NQZA 3E49A 3CLWA 3IJ9A 3ARTA 3ZWSA 2Q6ZA 5IBXC 5AZ0A 4C6LA 1NQKA 3MWCA 2Z6JA 1D7KA 2I57A 3TP4A 4O54A 2NVAA 4PMNA 4PMZA 3VYLA 1GZJA 2OO0A 2I5IA 2XSXA 1F07A 3QPEA 3QLLA 1AH3A 3JS3A 3WEOA 2CBIA 3HPFA 1CLKA 1JAKA 1A47A 3HGSA 3G1AA 2ZX6A 1FX6A 3MYPA 1B3ZA 9XIMA 3FV9A 5AKQA 1M41A 2JKPA 1C3FA 1HGWA 3IGSA 1SPQA 3QN3A 4AYSA 1HO4A 5EFDA 4GVFA 4DJDA 4DM1A 3UR5A 4UBPC 2O7QA 4GNJA 4E8DA 3O6AA 2C13A 1QO2A 3MCMA 3L0NA 3PJUA 8XIAA 3UR8A 3VOIA 5FJTA 1CENA 2FZDA 3M5VA 1O5XA 3BLLA 5XIMA 4S3CA 1YPIA 1QWGA 3BOLA 3IUIA 4EVZA 5AHIA 3MY9A 4PTWA 1AZ1A 3CWHA 4O4VA 1OCQA 1YADA 2ZYFA 1CYGA 1XLJA 4QSHA 1B3VA 2OVLA 2V63A 5A8MA 4QJ5B 4IGNA 2PLMA 4Y2WA 2PWDA 2QUMA 1GQLA 3FHQA 3NJ3A 4ZXOA 3MMTA 1H4PA 1KGXA 4WJ8A 5KMYA 3O3RA 2WM1A 3LBOA 3REQB 2PGWA 2OOFA 4AZGA 5AHFA 1OABA 2G50A 3V4BA 2XWEA 3L2LA 1I0DA 3W1XA 1MFVA 1R9ZA 3S5NA 2WOQA 3PTKA 3BLDA 1S1PA 3A9IA 4TU1A 3WH8A 4O11A 1POJA 2H6RA 7TAAA 4EIVA 5HQMA 1GPFA 1GQNA 5CSSA 1KGWA 1B4KA 1WV2A 3L0GA 1S2UA 1T40A 1WXZA 2QCEA 2PGEA 1HG3A 4NF7A 5DEZA 4H01A 2C6QA 3ZJ7A 4KWUA 3WLNA 1JCNA 1K4HA 1WPCA 3FY1A 3RX4A 3M0HA 3WY1A 4E4PA 4B5UA 1YKWA 2PC8A 3F2BA 4P7LA 3GTHA 3S5OA 4G1NA 4GBDA 3MO4A 1PWLA 1OG6A 2BSLA 5BROA 5GQBA 3WQGA 2P10A 2R1KA 2PWHA 5U7SA 3UEQA 3VABA 3COTA 1U22A 1OCNA 3IUHA 2ADAA 5FF7A 2NX1A 4N6EA 4GY7A 2VRJA 4JQ4A 3UZYA 5JIPA 2I1OA 2DSVA 3QEZA 1TR1A 4V15A 5ECVA 2QJHA 4TIMA 3GYCA 3NQGA 4XTIA 2YCIX 5ENLA 1V3MA 4UQCA 4E2OA 3S5SA 1QI0A 3G8EA 1XLGA 3R10A 2G37A 4ZO6A 3TKFA 4GVIA 3TN4A 3PHAA 2OEJA 4RW3A 2X05A 1DJNA 4HK5A 3HB9A 5FJOA 3RNDA 2Z2AA 2FPYA 3MP3A 3LSBA 2Q8ZA 1JCXA 4AVNA 2RDUA 3LHYA 3OODA 2VT0A 3ENLA 1D3HA 4IISA 3PN8A 5J04A 4HQVA 2BB0A 3BQ6A 1H0GA 4CD8A 4ZR8A 3NGFA 3PUGA 4UTTA 5GJPA 1TCMA 4XBKA 3H2EA 5I03A 1Z32X 5I3GA 1W54A 2WW5A 1JDFA 3U6WA 2NV1A 4MUPA 3AZSA 3G5EA 4WJXA 1I2OA 3PPGA 3ES7A 3WDHA 1FWGC 4S2CA 1YLVA 3NO5A 3LOTA 4OUIA 3UU0A 1UWQA 3CK5A 4LYKA 4L6HA 3GBEA 1Z3NA 3WD3A 1AH4A 4NRRA 3AIEA 2OYKA 1KCKA 4MMWA 1QPQA 1E4MM 3WUGA 3CB8A 3WQ8A 1Q6DA 4K7VA 4KKXA 4MF4A 2FFCA 2I16A 4L5ZA 1IWPA 4C6JA 1T6MA 2YGYA 2A1YA 2XDFA 4XD5A 4XAYA 3MZNA 3O63A 1QAPA 4Y9NA 4YLWA 2PWFA 3UP8A 3WH6A 3H22A 3KOWA 3PG9A 1EP1A 2PDXA 1KW1A 2QV4A 2HXTA 3L2IA 3QY8A 5D9OA 3SB0A 3GM8A 1OX4A 2VELA 1TREA 4ES4A 3TIMA 1TFVA 1ENUA 5DMMA 1DPMA 3NAVA 4MTVA 4D72A 1FWEC 2ZA3A 4B4FA 4RE0A 3DU0A 3CC1A 3ARWA 3G1SA 5IHRA 1W0MA 3NXLA 3HMJG 3EXTA 3N04A 1P0KA 4Z2KA 3QJAA 1L8PA 1XCFA 3QGKC 5BXPA 3I4KA 2D2JA 3B8IA 1XDJA 1C8VA 4AZCA 3UF9A 2NUXA 4IMAA 4L9ZA 4O1FA 2C19A 4NI8A 4L1WA 5BRBA 1ISZA 1Q65A 5F1VA 1PYFA 3P62A 2R1NA 4JIEA 1XLAA 3VIHA 5JIWA 3GIQA 1JYVA 3UT0A 5HJXA 3OP2A 3W74A 1Q5MA 4MIMA 5MHBA 3QMRA 1Q7QA 4XISA 8CGTA 4QG8A 5MKGA 2QULA 4FLRA 3NZPA 3TUUA 1W5MA 4M7TA 1HXJA 1E1CB 4DWDA 1PX3A 1E6XM 1UQYA 5F7UA 1JZ3A 2PS2A 3CAWA 3DIPA 4GKTA 3L4ZA 4KETA 1FBAA 1AJZA 2TODA 3RDKA 2AMGA 3DFOA 1A4MA 4PUDA 2VD8A 3WLPA 1KM3A 1CXLA 1XQKA 1J6PA 3PY2A 2Z26A 1ADSA 4WY0A 3RMEA 3NQ8A 4CKQA 3TAOA 5DF0A 4UOJA 3T09A 4JL2A 5DMYA 1C9DA 3AFBA 5M17A 2Y89A 1JCLA 1GNXA 4D6EA 2QJGA 4H3DA 3IIPA 3UG3A 1KQZA 3GX9A 2QYGA 1XIMA 4WK9A 1K7EA 3GUGA 1FHLA 3VI2A 2EBNA 2OU4A 4U4MA 4ADTA 2J74A 3CB3A 1JZ5A 1M7OA 2VEKA 3BLFA 3TOPA 5C7HA 3VD9A 3W71A 1L6WA 1JAEA 1RQEA 2WPGA 4I9TA 1CLXA 5I3IA 4EXQA 1J79A 4IMCA 5IM51 1LCOA 2YKKA 3SBFA 4AD4A 1ISVA 1SO6A 4HT3A 3WD2A 2I9UA 3HG4A 5BNKA 5I5RA 1R8LA 1YTDA 3M47A 4EXBA 3L4TA 4FOKA 1U5VA 2O7SA 5A8GA 2C0AA 3SRDA 3ONCA 1LL7A 1WZLA 4RR4A 3WF3A 5J5RA 2OG9A 1F6YA 1XI3A 4PA8A 3DZ1A 1KBKA 4WZHA 1BD0A 4GE8A 4QTGA 3AIBA 3N73A 3GU2A 3PR2A 1A3HA 2Y61A 5H8UA 1VS1A 4DWSC 5FIPA 1ZCCA 4V1XA 1G1YA 1NY1A 3U0HA 3UJ2A 3KFTA 2Y7DA 4FS9A 5A2CA 2TMDA 3T55A 1EA0A 4N7QA 4RDZA 5M03A 4UQAA 1GWJA 3ANYA 1WB0A 5AZ1A 4J27A 3RMJA 3R12A 1ZLPA 4I7VA 2P3EA 2PD9A 2WNNA 1B90A 3LQGA 2VEGA 3TVAA 2YL6A 1DBTA 3CTLA 2JFEX 4LU0A 3H2FA 1KV5A 2DUXA 1ZENA 2DW7A 3AUOA 4OE7A 3USZA 3D5HA 2G3NA 3LS9A 6XIMA 4XD3A 3H2AA 4GFIA 3BJTA 4V28A 1HX0A 2D20A 3TYDA 1R7OA 1OZMA 3WLTA 1OX4B 2G3IA 3W83A 3NO1A 3ZM8A 1H63A 1B30A 4X9SA 3ZT6A 1AW2A 3BG9A 4HNCA 3VMPA 2AKMA 1Z42A 3WF1A 3KRUA 3W7EA 1V3IA 3T0TA 2VD9A 7A3HA 1JZ7A 1S3TC 1KM6A 3N6HA 4OOZA 4AZCB 3UXIA 1SZGA 3ARRA 1VC4A 2WANA 3FA3A 3SN4A 3BGGA 1OIFA 4Z1AA 1Z8AA 4JN8A 1AJ0A 3ZVHA 3SECA 1SQ7A 3RU8X 1E73M 3ATZA 4FNTA 2Z27A 1GYMA 2WMKA 4OU1A 2ZWYA 3LZ5A 5CCZA 4DJDC 1IT7A 5FEXA 1XL9A 1Q6LA 3GC2A 3LI1A 1L8NA 3CT7A 5IHSA 3UXDA 4DLMA 5MKGB 1PKYA 3KBSA 1OC6A 2J7FA 4QEHA 1MMFA 4F9DA 4N9CA 1UR2A 4X2RA 3SFWA 3D3FA 3O06A 2FPTA 2QIIA 5H6HA 5CJMA 1YDNA 2VNCA 1GW9A 5CJNA 3VD3A 4KFOA 1VGAA 3TROA 3GXTA 1E3ZA 3CEUA 4AF0A 1CI1A 3IK4A 4IGHA 3CO4A 3ALFA 4OTKA 4YTQA 4WY0B 2X2GA 4HJWA 1PX4A 2NLYA 4HU3A 3L5MA 2ZRWA 1AUSL 2QUNA 2XM1A 3UWWA 3GTIA 2PF0A 7PTDA 4IFKA 1UW9A 1V0MA 2AQVA 3THUA 1W37A 1WDDA 4K68A 1UUQA 2Z7KA 1YDYA 3TQVA 3L5AA 3WQ4A 1WZAA 2FDSA 5C9UA 1A5KC 1GCYA 5M2FX 3TCSA 3G22A 1K9TA 3AIQA 1RP9A 3G0SA 1J2WA 4H8UA 4A35A 3W88A 4JFWA 1UASA 3TYAA 5M1TA 1ZL1A 5DX7A 3ZLHA 4PUEA 4ZMGA 1V3HA 4M6UA 3M1ZA 4WOZA 5AC4A 3NL5A 5BOFA 4R34A 2PBOA 3WLSA 1Z44A 4ROQA 1OVDA 1IQ8A 3LPPA 4YVXA 3ZSSA 3QHMA 1N8IA 4UR9A 2Z2UA 4D6DA 1C8XA 4QNWA 3G1RA 4NY2A 4EPKA 1HP4A 1OWQA 4QRNA 3FAXA 4WUIA 1LJYA 1X6NA 1TQXA 2NX3A 3N15A 1VEPA 3QH2A 3ERPA 3C52A 2VEPA 3W1TA 3WLIA 1NFPA 1J10A 3LSCA 5CZSA 3UERA 4TX9A 4PRRA 4W8AA 1WDWA 3CHVA 3TYUA 2D1ZA 4C90A 3TJ4A 2P76A 3NQMA 5CKSA 3AALA 3W2NA 1VZWA 3M0KA 3W2MA 3CQHA 4JHMA 3AQUA 1REQA 1DJQA 4J2PA 2PDIA 3FAWA 4PMDA 2CKSA 4MJMA 3W76A 1L6YA 3GAYA 4FK9A 1ICPA 4IPJA 2X8RA 1PKLA 3LMYA 4J3UA 4GISA 4Q4OA 2NXGA 2JEQA 4HU4A 2ZE0A 3TW6A 3CPGA 3H12A 2XWDA 4GO8A 5DRIA 1UZ4A 3CZLA 3AISA 5HJYA 5LGXA 3TC7A 3BMXA 3STCA 3GS6A 2C7FA 1Q4NX 1V8EA 5AHEA 3GO2A 3GW3A 2Z00A 4DI8A 3CEPA 4PEKA 4BWLC 3PZIA 3B03A 1SMDA 4GUFA 5CSYA 1BGGA 5GJMA 2PI6A 1O68A 3ITYA 1TX2A 3WH5A 3LBCA 3GW0A 2XJ7A 1LM1A 3VMOA 4JTJA 2GJLA 1EZWA 4KT2A 4YVVA 2CWXA 3OTRA 3VA8A 4QJ3B 3ZVHB 2WQDA 3OLEA 3U4FA 3UG4A 4IMGA 2A6NA 3EA2A 2J8FA 3BH4A 3GH4A 3R5EA 5A8OA 4UQDA 3BJSA 4HN4A 1ONXA 4LNYA 5KSWA 1ODZA 3GNNA 4JIIX 1V77A 1L6GA 5DY3A 1FHVA 5D9NA 4NXKA 1XH1A 1PTGA 4WDUA 1LYXA 4IFRA 3W29A 1DTUA 5BOEA 1VFOA 2QPXA 2WYSA 4DIAA 3IJ7A 4YMZA 2GOUA 4UIOA 3TX9A 2WHKA 4AF0B 3HMCA 4LCRA 3BCJA 3E38A 2CC0A 3W6YA 2VEFA 2GQ9A 1W3TA 2XG9A 4QCEA 3FCPA 1FCVA 1BRLA 3GNXA 4I6VA 3ZR6A 1VH7A 5AC5A 2BG5A 5KITA 2FMOA 5F2MA 5F2GA 4IFKB 2FZ8A 3PZVA 3B8DA 3E3HA 3AIVA 3BLPX 3UR7A 1FCQA 4I3GA 1R3TA 1HNYA 4Z2GA 4FNPA 4RNHA 5KINA 2XZ7A 4W8BA 5LNSA 3DG3A 1FY6A 2IUZA 4U3CA 3AS2A 2UZ9A 4NZJA 4I5RA 2VZUA 2YXOA 3EWXA 3NR0A 1N8FA 4R9XA 1N8WA 2A21A 1S2AA 3AHYA 1VR6A 1FWRA 1OFAA 1KKRA 3TLLA 3GR4A 5HA7A 5DXXA 4IICA 4K1GA 4MWAE 1I2QA 4C6EA 3CAVA 3VGGA 3W3OA 6REQA 1IZJA 1EH9A 3HG3A 4DEFA 3W1RA 1ECEA 1QOPA 3SR7A 3AIWA 5HR7A 5D8WA 1FWTA 5E5CA 4H6QA 3KXQA 5LNWA 1X6UA 3CV2A 2ATSA 5K9XA 3W26A 1V6WA 3CGTA 1W3NA 3P80A 1JF6A 1GONA 1XLDA 3S1WA 2IPGA 1NWSA 2FB2A 3RLHA 2EO7A 1M3UA 3N4AA 4Q4KA 1Q2SA 4JX6A 4ADSA 4A6GA 1EHNA 2DIKA 4KH2A 4QS5A 1TPDA 4L6OA 4A8RA 4RE3A 1VBGA 2ZVRA 2HBVA 3S6DA 3AHXA 4WXYA 3CXOA 2WB5A 3OQ8A 1PIGA 2BHYA 1QHOA 1UBPC 1EX1A 1UP2A 3HPZA 3XISA 1TWDA 1K8XA 1OFEA 1IF2A 4XIAA 1DIDA 2WVUA 4HMEA 3H7RA 1C92A 4QE1A 1XRVA 1XXXA 3OGVA 5G1MA 1YTKA 3V16A 1XBYA 9RUBA 4MHBA 1AW1A 1VPQA 1LLZA 4FNUA 3U5UA 1HUVA 1H11A 4M0XA 4NKCA 1H51A 1UA3A 3TXZA 3QR3A 4MZ8A 2ZUNA 1P6CA 2CNCA 3EDDA 1R3SA 2AQOA 4CQ8A 3QYQA 4DXXA 4NZ3A 1QDSA 1DXFA 3P5YA 2BS9A 4W7VA 1FVPA 1QJWA 3VM7A 1UR3M 3KTSA 3RX3A 1GPWA 4Q22A 3F5LA 1UOZA 1X38A 1QI4A 3SUWA 1CB2A 4ENLA 3WN6A 1AJ2A 2YL8A 4MNKA 1BWKA 3KBJA 1PE1A 1E6NA 3PB2A 4WXZA 4AUBA 2ZZ2A 1GVOA 3CHCA 1ZS2A 5XIAA 3PUEA 1EBGA 4PRTA 1THFD 2GK1B 3L2MA 5D2VA 2WKLA 5LSMA 1YNYA 4QX4A 3O16A 3V35A 4R27A 4C6FA 4U28A 3M5YA 1NQ6A 3UA3A 2EPHA 3ZXWA 4E4UA 2JIWA 5EBUA 3EZ4A 2JE8A 1G7UA 4P8UA 1F8IA 3W81A 1Q3NA 3TC6A 3MW7A 4DY1A 4O57A 1ZP3A 3ZJ8A 2RJHA 4UCFA 1ZNNA 3LGGA 1RCQA 4ZSTA 2W63A 1EYEA 3W38A 1KRCC 4US5D 3MDWA 1IT0A 3L9CA 4LCSA 1UROA 3B8WA 1RSCA 1TR9A 4L1GA 4UQEA 1PHQA 1VRXA 2YZ5A 1Q6RA 2PDFA 3QV8A 4IFOA 2CXEA 3QW3A 4JYFA 5T26A 4KW2A 4ACYA 1HO1A 1TIMA 2Z1XA 3QTGA 4GQ0A 4PMQA 1SSDA 3AHVA 2XGBA 3B4YA 3TSDA 4B5NA 4NSBA 5E6ZA 3VKCA 3GVWA 6REQB 4EF8A 1UA7A 2XH4A 2OGYA 2PEVA 3SZ8A 2RDWA 1S38A 2FPVA 5HNNA 3H4GA 4ROPA 4DXKA 1ZP4A 3H70A 1PCKA 2I5QA 3FJNA 3W2KA 2W3ZA 3SN1A 3N4EA 4BZYA 3WH7A 4GH1A 1XH0A 1HL9A 4C5ZA 4UOQA 2NXHA 4LB4A 4UTLA 3URNA 2V9DA 1EJUC 2CEQA 4LAKA 2Z1SA 1YE4A 2GWGA 3TWAA 5I23A 1VP5A 1ADOA 3N3TA 3ZIZA 4IP7A 2NQLA 1EC7A 3BDKA 5F2LA 1NP0A 1Q6CA 5BMXA 1FFRA 1V51A 4HKPA 5I24A 5JQ9A 2W79A 1WZMA 4A8NA 1NOWA 1V0LA 4G1KA 3NQCA 1OINA 3IARA 2YX0A 3LK6A 1OFBA 4GJJA 1B57A 3DENA 3FNDA 4A29A 4MWAA 2QR6A 4QITA 1UKQA 3RRAA 2OSXA 2QHAA 4FF5A 3AIRA 3W00A 3P7YA 1D7FA 5CH9A 4Q32A 3B04A 2CETA 3UPMA 1N55A 2BY0A 2EJ1A 4XBJA 4E2VA 4PMOA 1HF6A 1W5PA 3PM6A 3DKLA 1EKOA 1TMLA 1UUOA 3RRXA 3SJ3A 2ZZ7A 4F40A 2ZXDA 3WELA 4YCOA 1EB3A 4NAEA 1T41A 3CZEA 4W85A 2J7GA 1ICSA 2E4TA 3C8NA 1U33A 2POZA 3BARA 4KRTA 3NL2A 4N42A 3MJYA 4GC3A 3I68A 3R0KA 3ITLA 4RV3A 3Q94A 3NQ6A 3IAQA 3HJZA 4B91A 4A8IA 4C7DA 3KTXA 2ZIDA 2OT1A 3O6DA 4H9XA 1QU4A 2Y85A 4PMYA 1OB0A 3GFYA 3HIJA 1TPFA 1P0DA 5DO8A 1FDJA 5CPMA 3ZYZA 4NYUA 3W7GA 1QK2A 3B9AA 1L9WA 3S6OA 4KEUA 5DN1A 2CZ5A 4B3KA 2X42A 2YYUA 2G3MA 3BCFA 1XLBA 3S2NA 3K2GA 3SUSA 1VF8A 2GZXA 3VOCA 1WP6A 4GFSA 1V3KA 3VKAA 2AAAA 1OD8A 1UR9A 3HO8A 1WDSA 2CHOA 3T08A 1TV2A 5EFFA 1SZNA 4W84A 1W3KA 1V7AA 4MFEA 3SCPA 3VKBA 3APTA 1IHIA 3V36A 4YYFA 2XISA 4XZ9A 1R30A 1XHGA 5AOUA 3DKJA 4JTEA 4UZUA 2V5KA 3QQ1A 3GQYA 4KCUA 2QUTA 5F1UA 2OX4A 3AIUA 2I9EA 4IPNB 3M6DA 4H8VA 2UBPC 1ME8A 3IVSA 2EQDA 4WSJA 3ZR5A 4CNPA 2R1LA 3GXPA 5G4EA 3S2CA 3FEMA 3MHFA 4I8YA 4LUTB 2Z24A 4LVBA 1WNOA 2ACUA 2VL4A 4GX9A 4DZIA 2B4GA 4B3ZA 4YIWA 4C7GA 3RCNA 4LV9A 3UZJA 1C29A 3QXBA 1VJSA 2OSWA 1HKJA 3OG2A 1RR2A 3MUZ1 2FZMA 2RKXA 5B7YA 1JL8A 1O4UA 1A5OC 3EWUA 3H23A 3MHGA 4HZMA 1O5RA 1RBAA 1CXFA 4C91A 2WKJA 1VLIA 1P5BA 4O0QA 3LXBA 3W7PA 2Y88A 3K1GA 4P7NA 1HKMA 3KP1A 4UTIA 1LBMA 4E6MA 1MEIA 4GH3A 2DT3A 4Q8VA 4JNMA 3QOMA 3MU7A 3KOFA 3L65A 1XR2A 4JS3A 2QDGA 3K46A 2OJPA 1H7NA 3PBVA 2AGTA 4H6RA 4FXFA 1F7BA 4GUHA 3VGHA 1ITQA 1RBLA 3NCOA 1XISA 5HDRA 3S2JA 1I1XA 3U2OA 1B5TA 1S2WA 1VEOA 5CXPA 3TNOA 1PVNA 2CESA 3GVGA 1JPDX 1XIIA 3QLDA 1OGGA 3KCOA 3UY8A 2BGSA 1CGTA 3PWIA 5EY5A 3V5FA 4UFIA 3CQ0A 1YIXA 1VYRA 3B8TA 5BU6A 2D2OA 1MFUA 4PUKA 4MWAB 3UQNA 4XZHA 2PDLA 3LZ3A 3VCNA 1IXQA 1NDZA 2CHNA 2HMCA 5HUOA 4UNLA 1PZ2A 3S1UA 3C2VA 1F6KA 2YLLA 1XRFA 4LAMA 3UJSA 1Z7AA 4N9EA 2OWXA 1WOBA 2QCGA 3GKFA 4K37A 3PTDA 4IL2A 2PDMA 1HJSA 3WQ5A 3BW3A 4AMCA 4LPCA 4L61A 1XLHA 2DZPA 3PFMA 3LA4A 4ERAA 2UV8G 3W72A 3GIPA 4IPIA 3UNDA 2ZICA 3LHUA 3LMZA 2E8ZA 5CZJA 5KZ6A 3QVQA 4XG1A 2GJXA 2CBUA 2VUNA 4BS0A 4XQ6A 1DIEA 3CH0A 1E0XA 3TV8A 1K7FA 3N6QA 2BP1A 4MB3A 2G4JA 5A6TC 3JUGA 3EOOA 1JUEA 2Z1VA 3M5XA 4HU8A 3WMSA 3PZTA 3EB3A 5DMLA 4G8TA 1V6YA 2O9TA 1FFQA 4FXRA 4WIWA 4LC8A 5T9CE 1OC5A 4L4LA 3R4IA 4UFLA 3RCMA 5KEZA 3G3MA 4O18A 1RBOB 3NQVA 5HATA 3W6LA 5JBEA 2VM8A 1V08A 4OBRA 3RHGA 2VWTA 1XKJA 4GMEA 1QPKA 2WBKA 3ITXA 1F3XA 4TMBA 2QLYA 1R0MA 1RAKA 4KBXA 1E5JA 2CWNA 2XFRA 3URAA 1EQCA 2ZKMX 2G8ZA 4UTHA 3L21A 4AY8A 4Q7BA 1W6TA 2WMHA 2ALRA 2OWWA 1X8FA 2WPBA 1TVNA 2ZZ5A 4WDXA 1UC5A 1MUMA 1P1XA 2JALA 3I10A 1XLEA 3K1DA 3ABXA 4IWWA 2MUCA 1TX0A 4Y8EA 1R47A 4MZYA 4BQ5A 3KBWA 4JCLA 4GC4A 2V3DA 2J4GA 2WKGA 4KWSA 1XIDA 3R6IA 1R7AA 3M0IA 5D32A 1SVDA 1OFPA 4HYWA 4C6QA 1W3HA 2CZVA 4PUUA 2ZX8A 1WYIA 1RQBA 3PAJA 1ZJAA 3CLMA 3G8RA 3OBAA 3IRSA 3RX2A 2OQYA 2YIHA 3HQNA 2NWRA 3EX1A 1D3CA 3WNNA 3OLDA 5AYYA 4JQAA 5D03A 1UWSA 1FDYA 2GDVA 3S5YA 3G1DA 1PX8A 2CU0A 4K8HA 3WUEA 1D2KA 2OCZA 2DT0A 2OZTA 2XPKA 1A5SA 1PTAA 1S46A 3BJFA 2PRLA 1HL8A 4LYQA 4GZIA 3NWRA 4HA1A 3RILA 1E4LA 1PAMA 4D6FA 3S1VA 2NWSA 1JVNA 1CW2A 4W7UA 1KFKA 2CYGA 4UNKA 2JKEA 4B5XA 2WC7A 2HJPA 4S3JA 2A5HA 1JFXA 3OO2A 4X0NA 1GVQA 4D8ZA 1VFUA 4MLRA 3AMDA 5I0DA 3I3BA 4J3ZA 4C65A 2EKGA 5C0QA 4MLJA 4Y7EA 5HJLA 1KRBC 3DFYA 3VGFA 4JIPA 3EOUA 3LRLA 4O14A 5CGQA 4JNZA 5HWMA 4CNOA 4QLJA 3D3AA 3OGSA 2V2HA 4GI6A 4XZWA 4XIMA 1ZHAA 1RCOB 2E5DA 2FZBA 2V3GA 1OF8A 1Z9AA 3AXXA 4WVXA 3O6CA 3C0JA 2CERA 3OZYA 4PCNA 4MGGA 3BL3A 3P6LA 2ZADA 3LPFA 3L68A 3QQWA 3U2CA 2PDNA 4D6CA 2AGKA 2VQTA 5LA0A 1KCXA 4DO7A 3WQEA 2YBVA 1ELSA 5A69A 1TE6A 1N82A 1TJ1A 2E5BA 3PPFA 4O15A 4C5YA 2GJXB 1SSGA 4MB1A 5A6JA 3WQVA 1JDEA 4DBDA 4W9TA 4PTMA 2DGAA 4KCVA 3VK5A 3V5OA 3NVDA 3FSTA 7ENLA 5AYBA 2F61A 1XPYA 4UTMA 1AD1A 4NILA 1E55A 3U57A 4BA0A 4HCDA 2YBUA 5AVHA 4M6QA 3W84A 3W4RA 2EG7A 1KWGA 1IEWA 1US3A 1X98A 2MNRA 1XLMA 3BOXA 1UWRA 3T40A 1UD8A 4KCWA 2ZUMA 2FHCA 1UBSA 4XD4A 2CW6A 3TAKA 3M7WA 3D6NA 1NDWA 5D04C 4L56A 1FP9A 1FWJC 2QJJA 5LKYA 3IIVA 1HJQA 2EXOA 4GK8A 2WBGA 3VOGA 2V8ZA 3BICA 4DELA 4B5VA 4DAFA 3BC9A 1KO0A 4AB4A 3F2DA 4LW7A 3W86A 2ISDA 2GOKA 2FTPA 1EXPA 1T7LA 3VNYA 5I7GA 2X40A 4E0CA 3EGJA 4JTSA 2WC4A 4EAYA 4M19A 1NJJA 3N2CA 2VENA 3HPAA 1DJXA 1G4PA 4RE2A 1PCWA 1SFTA 3HG2A 2X1UA 4O4WA 4PFMA 3MPGA 3T05A 3OVRA 3W02A 1PZ3A 4YTRA 1KM2A 4FALA 2Q09A 1EJ7L 2XIBA 2HS8A 4PBFA 1UB3A 2O9PA 3TSMA 1HJXA 1FWWA 3M5ZA 2YL9A 5HMEA 3WFAA 2GDUA 5A1AA 2P53A 3TR9A 3KM8A 3OA5A 2F6XA 4F79A 4GJIA 1X39A 1PYMA 3T9PA 1M7PA 4RUBA 1KKOA 2XGIA 4GY0A 4S3BA 4QE4A 1VBRA 1XP3A 2VCAA 4QR6A 4GUIA 3M0VA 4IL0A 2NUWA 1HKIA 2FVKA 2R14A 3P61A 3NZ1A 3RLGA 3UW6A 4ZENA 3TJXA 1OJXA 1XSIA 2A7PA 2GL5A 2QW5A 4AXKA 4FAMA 2FZ9A 2QCCA 1KWKA 2G3FA 3NO3A 1JI1A 3LV6A 4UTWA 2E6YA 3B0PA 1VKFA 5DY2A 1E0TA 2R8WA 3VAVA 1FA2A 2V82A 3W1MA 1TV8A 4UZSA 1TRDA 4QAWA 1DVJA 4MJZA 2PB1A 4QG9A 1EC8A 3W07A 1J0KA 2D3NA 3A4WA 4F9JA 1V93A 4FO4A 4LY8A 4M29A 2FDMA 1W32A 2Z1WA 1DJWA 2YCEA 3GNDA 3P5ZA 1XIFA 1KR0A 4JY9A 2DZVA 4O52A 3CPUA 1W1A1 3WEZA 5FL1A 1VBUA 5HBFA 2VGGA 1GOWA 3LLDA 3MANA 5FSEC 3W22A 4BCEA 4S3AA 4E5TA 4KMQA 4MJ4A 5D09A 4OQVA 4MKNA 1TPUA 4EANA 1E0WA 3P82A 3NZRA 3EEZA 2CLOA 2EPKX 3KBNA 4KIEA 1VFMA 4R53A 3WDQA 3S47A 3H2MA 2HNHA 4S3DA 3AUJA 2ZE3A 4P8WA 2J7HA 2ZX7A 4R88A 5FF0A 1JF5A 5LA2A 4RJEA 1XLCA 2WZTA 3KVMA 3SY5A 1XUUA 2UY5A 4J40A 3G1HA 4HNLA 4DBWA 2VX7A 4LUSA 1A3WA 3UGVA 4NNBA 3CZJA 4J4KA 1S1RA 7ODCA 4ERGA 1LBFA 1U83A 1VAHA 3WLLA 2FVLA 1KLYA 3HURA 3IIZA 4PMUA 2QKFA 3PC0A 1GZ1A 4JTGA 4AC1X 2EF9A 3EA1A 3IV3A 3LCIA 3QGVA 4QDMA 1O60A 3PF3A 1ZAHA 5E09A 1VPXA 2O56A 3SCQA 1W56A 2IXUA 3RR4A 1RJPA 2DVTA 4JXCA 4ZQPA 1TPB1 1RZMA 2E9MA 3PVFA 5HUPA 2ESCA 1VIZA 3QBUA 3CHEA 1EO7A 3U8GA 3DFTA 3I3EA 2HROA 2P5NA 9XIAA 1ISYA 2C0HA 4BHYA 1F5ZA 3V18A 5AC7A 3ARPA 2Q3OA 3H21A 2DDXA 1XICA 2ZUWA 1ZALA 2WVTA 3B9NA 3VTRA 5AYXA 3L4WA 1HP5A 2FH8A 5HNTA 5A5WA 4GINA 4US5A 4PUMA 9CGTA 3TZNA 2GUYA 4Q4QA 1CXIA 2QJNA 3CIVA 4HA0A 3PG8A 3S1XA 4UTKA 3BPWA 1QASA 2FHBA 3KDOA 1UWUA 4DX3A 5EBAA 1RK6A 4ZQMA 3AS3A 4OFCA 4TQTA 1UP0A 1MQQA 4HP5A 4GIAA 1VCFA 1N2VA 4C6BA 3CZGA 3EAUA 1SYTA 4E8GA 3R2GA 5IBXA 1JD9A 3LTPA 5AN7A 2OEKA 1SGJA 4GYJA 3GVRA 3TMLA 3RFAA 5AC8A 2GPTA 3ARYA 5HQLA 3FX4A 3MBDA 3NYDA 1KC7A 3B4UA 5KZMA 5A8QA 1KBJA 1SJAA 1O95A 7XIMA 3WMCA 1I1WA 1TPWA 4D71A 1DWIM 2VC6A 4K1WA 3TTOA 3OG3A 1MW3A 3AZRA 4C6PA 3VNMA 4GHRA 1ITXA 3LNPA 1H2JA 5LYRA 2NSOA 3IRDA 1VQTA 2G3JA 3LCWA 3E12A 2J9YA 3VIPA 4F0RA 4CQBA 3R25A 1FWBC 3XINA 4ATDA 2ABAA 4U2YA 1CEOA 5I78A 2A79A 1BG9A 1BFNA 2IXVA 3EX3A 1ALDA 4HPJA 1DOSA 2G41A 2J75A 1CLVA 2DUZA 4C1KA 1W9DM 1XINA 3W1PA 2WSYA 3MMWA 3TQ0A 2XZ9A 4ZO9A 1RA5A 1W8SA 5G2HA 3MQTA 4JGDA 1NAL1 3ITVA 3T81A 5EL1A 4AZ7A 4K39A 3U9IA 2YA2A 4IQDA 1XBVA 1MUWA 3CMFA 5C2XA 3OVPA 4EACA 2C1GA 2IPJA 3DHPA 4GXMA 1V0NA 2P0IA 2BNJA 4QQUA 5BRQA 5A95A 4M6VA 1H09A 4XB3A 1EQPA 1JZ6A 3IK2A 4BQ3A 2PCQA 3KVKA 1H5VA 2QMJA 3TFCA 1CXEA 3LPGA 3ME3A 1LL6A 3AAMA 3NQAA 4CUCA 4LUSB 3SIZA 2HQAA 3ITTA 3Q67A 3VCRA 3W37A 1MW0A 3QHNA 2CBJA 5F4XA 2C1HA 1CIUA 2A2IA 1SO4A 4XKMA 1R46A 4H9TA 3V0TA 3QY7A 4AX6A 2DIEA 5I3DA 5DLCA 2W4XA 4ORMA 4O19A 1T8QA 2QQ6A 4GO9A 5K7JA 4AWUA 4H9UA 1LOQA 2ZZ3A 4EWND 1AL7A 5EYWA 4S3KA 1IYXA 3WUBA 5CC6A 3SUUA 3W85A 3LCXA 3GHTA 2V30A 4JZ5A 3JU2A 3GR8A 3V1PA 3ZLFA 3URBA 4C1NA 4B2DD 1JDDA 2E9LA 3O07A 4DVOA 3SQMA 1ZBWA 4BI6A 3UETA 8RUCA 1VFTA 4LV4A 4KQNA 4LTSA 2YA1A 4S3FA 5CEWA 3EA3A 1H62A 2CLKA 4NI3A 3KOXA 1TPH1 2HPIA 4UCGA 1GKRA 1GW1A 4GYKA 5A8PA 2ZXQA 1ZU8A 4TTUA 1CDGA 2PPGA 3ABRA 4OGZA 2ACQA 4QDPA 2YDAA 5C9WA 3AXMA 4WD0A 2X41A 2NZLA 4DPQA 3KLLA 3NPWA 3GXDA 3DGRA 3UXKA 5A94A 1R85A 1VHNA 1LRNA 3P93A 1XYLA 3R0DA 3B97A 1IEVA 3FJ4A 3RR1A 4H41A 4X22A 3LHZA 1O5QA 4K36A 2X2YA 4A2SA 3SCSA 3TXVA 3WLRA 4RPQA 1VEMA 2XFWA 4LF1A 3IUDA 3PNUA 3AYSA 1DIKA 1G4TA 3QC0A 4AWEA 1E51A 1WXYA 4O12A 1H49A 3MI6A 3HV9A 2YFOA 4R85A 3C86A 3GNPA 5ECUA 4X2PA 5GVJA 1AK5A 3GDLA 1DWFM 2OOGA 3N12A 3TLQA 1TA3B 2VWSA 4EK7A 3NSXA 2J7BA 3T42A 1KFLA 3NQDA 1V6VA 4AISA 4ZQRA 3W7DA 1MDLA 4HMNA 3NFUA 2Y7EA 3MA8A 2A7NA 8XIMA 3CHFA 4ZZ9A 1ECQA 1G0CA 3KS5A 2G96A 1VPYA 1DIOA 1WCGA 3AJ7A 4Z0SA 1IEQA 5FKYA 3UD6A 4FX7A 4XZNX 3E2SA 1H1YA 4PBEA 3UXLA 1LP6A 4UB9A 4S1FA 3S6TA 2E1DA 4ML4A 3VDBA 1HKVA 3HA1A 3M16A 1WKYA 5G2IA 4AIBA 4UWMA 1XLKA 3V7PA 4EAMA