1I1XA

1.11 a atomic resolution structure of a thermostable xylanase from thermoascus aurantiacus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
302
structure length
302
Chain Sequence
EAAQSVDQLIKARGKVYFGVATDQNRLTTGKNAAIIQANFGQVTPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIRGHTLVWHSQLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVNEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYINDYNLDSASYPKTQAIVNRVKKWRAAGVPIDGIGSQTHLSAGQGASVLQALPLLASAGTPEVAITELDVAGASSTDYVNVVNACLNVSSCVGITVWGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermostable xylanase from Thermoascus aurantiacus at ultrahigh resolution (0.89 A) at 100 K and atomic resolution (1.11 A) at 293 K refined anisotropically to small-molecule accuracy.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
total genus 120
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1i1xA00
1OCQA 3FHAA 1WP6A 2X8RA 3THCA 1JZ6A 3PZIA 1EIBA 1X6NA 1OINA 1V3IA 2J7HA 5A2BA 4CCDA 5A95A 1FH9A 1WAWA 1PX8A 1UR2A 1ISZA 5JIWA 3BLPX 1XH1A 4KWUA 2CKRA 2E0PA 3ZIZA 1KXHA 2DDXA 3CUGA 2Z1SA 1BVNP 3VDAA 4CCEA 3GXDA 2YL9A 1KXTA 2E40A 3WF4A 3VM7A 4UOQA 3QGVA 1GVYA 4B16A 4R5EA 4TVCA 1EQCA 3MKKA 1WZMA 1TZ7A 5EB8A 1JDDA 3TTYA 5HPCA 2OLHA 3NYDA 4FLQA 4EAMA 3QR3A 1DWAM 1HJVA 2J7GA 1HP5A 4HMDA 1UKQA 1JG9A 1JFXA 1H2JA 2VMFA 1CXLA 4HMCA 2XYLA 1J10A 1V6UA 4WKFA 1KFWA 3VNYA 2D3LA 4V28A 3APGA 2OSWA 1W9VA 1OWQA 3FXYA 2EO7A 5CXPA 2EBNA 2VO5A 1K9TA 3WQ8A 3II1A 1HJQA 3BMVA 2PBGA 3W53A 2FGLA 1W1VA 2O9TA 1M7XA 1VB9A 3B9DA 1CBGA 5A6JA 1BYCA 2EPLX 1JAEA 2CHOA 1PIFA 2DIJA 3WQVA 4CVWA 1E6RA 1CECA 4D6JA 4QLJA 3VDCA 3AZSA 1UUQA 3QHMA 2ZXBA 4AIUA 3U7BA 4N0RA 3WF1A 2PWGA 2WVVA 3VKKA 4HOZA 2WAGA 2FH6A 1E4NA 1KR0A 1FH7A 4HZ6A 2WXDM 5I24A 1CPUA 3HU7A 3MV01 2WLYA 4DWSB 2VRKA 3WNPA 3SUVA 2UY4A 1ISYA 1ECEA 1QW8A 3MSDA 4PUEA 2ZUTA 1W2VA 3VIIA 1GZJA 4OZOA 4KMQA 1HX0A 2VOTA 4UFJA 1US3A 2J7FA 3GM8A 2PC8A 2VX5A 2ZUSA 3GBDA 1MVYA 4CKQA 4HMEA 4PMQA 3AMLA 3ARQA 2RGMA 2WKGA 1Q6CA 4UFLA 3AIBA 2WBGA 2W62A 3BCDA 3UR7A 4PMXA 2XGBA 3WDRA 3VIGA 1D3CA 1ITXA 1HKJA 4CD7A 1HVQA 2Y8VA 3POHA 2A3EA 1TG7A 1QNSA 3PZMA 3CUJA 3AS2A 3SUUA 2OSYA 3VGBA 3WY1A 3E1F1 5DT5A 4V2XA 4LXFA 4DM1A 2EPMX 3WDQA 2ZE0A 4YHGA 4A3YA 5A94A 1EGZA 1UQYA 5HBFA 1JZ8A 2GJRA 5M5DA 1W1YA 4MB1A 1ODUA 4NRSA 4W5ZA 1HN1A 4UFIA 3WN6A 1KGUA 3VIKA 1U33A 1B3WA 3AZTA 4UTFA 4E8DA 2O92A 4HU8A 3EYPA 1QI3A 1B3XA 3PHAA 4LYPA 2BVDA 4AEEA 5ABFA 1HKIA 2XVPA 1V6YA 3WD0A 4W7VA 4D72A 3OGRA 3W28A 1J9YA 3TTSA 2WNWA 1PAMA 1BLIA 1NQ6A 2O9RA 2BHUA 2ZICA 3UR8A 3SUTA 2UY5A 1Q6FA 3UETA 4PSPA 4R27A 2RGLA 2WZHA 3AHXA 1BFNA 4B3LA 3PTKA 4XUYA 5DEZA 1MW0A 2VR5A 3AHVA 2XIIA 4YPJA 3BSGA 5A6BD 1NM9A 2J78A 4ACYA 3O9NA 3N12A 1OBAA 2GJXB 2YJQA 2W61A 1VJSA 3WIJA 4U3CA 4TXEA 4UQCA 2EPOA 2W91A 1H1NA 1R7AA 4GXPA 4AD4A 1V6VA 2WHLA 4XV0A 2WC4A 5A3HA 2J7EA 2XFRA 4IPNB 1UZ4A 1UR9A 2FHCA 5A6KA 3M7SA 4MPKA 2DT0A 1UA3A 3SURA 1QI2A 2V5CA 3B9AA 3SCWA 4H8UA 3PZTA 3VIHA 3WFLA 5FL1A 4W89A 5EMYA 3U7VA 2Y24A 3TTQA 4E2OA 2XIBA 1CWYA 5IFPA 3ZJKA 1W9DM 2CYGA 2V3EA 5GNZA 5I6SA 4DWSC 1KR1A 3IJ9A 4PCSA 4HA4A 4AW7A 2WHMA 2AAAA 2J74A 1PEZA 1PBGA 3RM8A 4IPLA 1MWOA 4W7UA 1KXQA 2VVNA 1VBRA 3ZJ7A 1K9EA 4MDOA 1WDRA 2GVYA 4F9JA 3AQUA 2GK1A 1J0HA 2VC9A 5GQBA 2QF8A 2XPKA 3WUGA 1QI0A 3ZSSA 1QBAA 2J79A 4P7LA 4HOXA 2VL4A 1MW3A 2WHKA 4WJXA 3MMUA 1E1EA 3DYPA 4UCFA 3SCUA 3G6MA 4JL1A 5BWFA 4EANA 1QHOA 3PZGA 2G3JA 1XRVA 3GNPA 1HVXA 3N18A 3EDEA 2WZEA 3MU7A 4EE9A 1WB0A 1UWSA 3U5UA 1W9PA 5ABFB 4EK7A 5A2CA 5E9AA 1B90A 4PMZA 1OSEA 3L4WA 5E09A 2OWCA 2ZOXA 1EDGA 3CMGA 4PSRA 1MFVA 3VGHA 1WCGA 3ZMRA 1E4MM 4D71A 4HA1A 3NSXA 1UA7A 2DPEA 2V5DA 1DWIM 3D5HA 1BPLB 2J8GA 2JF6A 2VQUA 4K68A 4W7WA 1C90A 2BY2A 1L0PA 2XG9A 3VGFA 2E9MA 4CD5A 3RO8A 5I0DA 5D4YA 3OGVA 4C7DA 2WB5A 3CZLA 3VM5A 3M07A 2G41A 1G94A 2ZUWA 1E70M 4PMDA 1KXVA 2PI6A 1W3HA 1S46A 2VZOA 1M01A 3CH9A 1V0MA 2WANA 2ZX5A 4WSKA 1WO2A 3ARWA 1VENA 3VMNA 1G01A 3CZGA 2E9BA 5GNYA 2EPKX 4DUXA 1XGZA 2WSKA 2VQTA 4M8UA 1V3KA 1ZB5A 2WSPA 1UD2A 2YDRA 2PB1A 1WZLA 1JYVA 3VIPA 1Q6EA 4PN2A 1F4AA 1JI2A 5LA2A 1E56A 2D3NA 4IISA 5A1AA 3GNRA 4JFWA 4RL3A 1LL6A 2C0HA 5EFDA 1UH3A 4WIWA 2NSXA 4A4AA 4HPGA 4DWSA 3AFBA 4AMCA 3PBGA 3VUPA 1GQIA 2J47A 2ZXAA 5F7UA 3GZAA 2W63A 1E4LA 3GH7A 2WCAA 3OIHA 1J01A 1RP9A 2WBKA 2BVTA 3SCOA 4S3KA 3VDHA 1OD8A 3AIWA 4HP5A 2WHJA 4D1IA 5IXEA 3BAIA 3BAYA 4ZXOA 1K9FA 1MFUA 5D9NA 2CETA 1E6SM 1ISVA 4UQBA 1GUVA 1EO7A 5AY7A 1E0WA 1NP0A 3EDKA 3VO0A 3VMPA 4ZENA 2J77A 1E3ZA 5C8BB 2WZIA 4CCCA 2ZX8A 4AZCA 3DHPA 3N15A 1BQCA 3EMCA 3RM9A 1UD5A 3L4UA 1JYNA 1VJZA 4D6IA 1FP9A 3B8SA 3NDYA 5CSUA 3QHOA 1CGXA 5A8MA 1TVPA 1O7AA 3VD7A 2WW5A 4P8XA 4UQAA 1C92A 3WKZA 1GOKA 1NH6A 5I78A 1GOIA 4AD1A 3TA9A 1QPKA 3CUFA 3SIMA 1ISXA 1EDQA 1E73M 1Q6DA 3SCSA 3AS3A 2J7DA 5IHRA 1V02A 4NSBA 5BXRA 1I1XA 4DUWA 4KRTA 3WF3A 3AROA 1GOWA 2ZX7A 3MV11 3SCVA 5I2UA 2VX7A 4CGTA 5CG0A 3CHEA 1GVIA 1R87A 1JD7A 2PWHA 2BY0A 2YL5A 3AJ7A 4H8HA 2GJXA 4W88A 3RPMA 4Z2GA 2A3BA 3W37A 5EBAA 1EDTA 1WPCA 1JZ5A 4RE3A 4Q7NA 4C7FA 4ATWA 1I75A 2FGZA 2J7CA 3BC9A 1E6ZA 3WQ5A 1BYAA 4B15A 5BROA 1GQLA 1KWKA 3BAKA 4UOZA 3CHDA 4XX6A 3SUWA 5CLTA 4PMOA 3POCA 4P7RA 1CXKA 3RIKA 1D2KA 1CXIA 4AZGA 4IUGA 4GO9A 4CVUA 3L4XA 4LQ1A 3AMGA 4Z2JA 1JDAA 2OYMA 4U31A 2DQXA 4L4OA 2WMGA 1NWTA 2CEQA 2XVGA 2CKSA 3WNKA 4D6DA 3BMWA 3PZVA 1VEPA 1E40A 3IJ7A 4DUVA 1EQPA 4KRUA 3AYRA 2VRJA 5CGTA 4AD3A 2IXVA 3EDJA 3AOFA 2DT1A 4X0VA 2V3DA 1VBUA 1OB0A 1GJWA 2ZUVA 3KEHA 4JCLA 2OWWA 4FLRA 4UZSA 2A3CA 3KL0A 4FMVA 1JXJA 1B0IA 4FLSA 4QAWA 3T0BA 1ZBKA 3WQWA 4BS0A 4NRRA 3WDIA 1XYFA 1Q4NX 3ZT6A 1N82A 4M29A 1KBKA 1UKTA 3M46A 1GJUA 2X2YA 1EHNA 4URIA 1KCKA 3K4DA 3SUSA 4BQ2A 2GDVA 1US2A 2E4TA 4XB3A 3FAWA 3DYOA 1DWGM 4CN6A 3WH6A 1CGTA 2WVSA 1E5NA 3UERA 2NT1A 1QOXA 5LA0A 3ZM8A 4P8VA 1E4IA 1IT0A 1AVAA 2WMHA 5BYWA 2JALA 4W8BA 3ALFA 4W8LA 2XM2A 3VGGA 3PZNA 1E72M 5CPTA 3VVGA 1V3HA 2CITA 4MNJA 3VD4A 3ECQA 1SYTA 4D6HA 3W29A 3S2CA 3W6LA 4PUDA 2J4GA 4GZJA 2XJ7A 2C7FA 5CPSA 3WF0A 1H49A 1XV8A 1GONA 3W0KA 1ZBCA 4J3XA 1B30A 1K6AA 1W1PA 3WNNA 1RPKA 2CERA 1H0GA 1WZAA 1OM0A 2WVTA 1GOQA 1HJSA 1BTCA 1JXKA 1PX3A 1JF6A 2DT3A 1KCLA 4QCEA 3VDBA 4FLOA 3WL0A 2X0YA 1CLVA 2XWDA 3SCNA 4BA0A 3GYCA 3QHNA 3VD3A 1ZBWA 4GQQA 4U2ZA 2BXZA 1ZL1A 4OOUA 1UD4A 1JI1A 1H3GA 3WH8A 4CU8A 4PCTA 4GPNA 1LLOA 2PWEA 4A3HA 1AQMA 1CIUA 2JFEX 2JIWA 2VTFA 2WM0A 3CTTA 4KGJA 5A69A 1A47A 1QI5A 3FN9A 1HP4A 3OZOA 3ZO9A 3AS1A 2HVMA 1W9UA 3AXXA 3RM4A 5HXMA 1H41A 4UFMA 2WCGA 3ARUA 1EO5A 1EXPA 1V03A 1W3JA 4AZHA 1HIZA 1E15A 3AIEA 1MQPA 2XWEA 1C8YA 1LF1A 3ZR5A 3BLKA 4QP0A 1DWHM 2G3NA 1UKOA 2DSUA 1TCMA 4JFTA 3FHQA 1CTNA 1WZKA 4N42A 1RH9A 1VFMA 2JE8A 5A2AA 1RP8A 5DMYA 1GQJA 3VGEA 4J7RA 2VUYA 4GI8A 3VNZA 3NDZA 1R85A 3MMWA 4HZ8A 1LWHA 5HPOA 1DEDA 1EH9A 1MQQA 1W3KA 4OBSA 1QI4A 4HTYA 3WD3A 1KWGA 2YL8A 4M1RA 4U5IA 5M03A 1E5JA 2XTKA 2EQDA 1UG6A 2CNCA 3CGTA 1GQKA 2VX4A 3BXWA 2WMFA 1JFHA 7A3HA 3A4AA 4CD6A 3CHFA 1HJUA 1LG2A 1OT1A 1BG4A 4AD0A 2Y4SA 3L4VA 4ATLA 3AMDA 3WEOA 2CXGA 2PBOA 2OWXA 1QW9A 2X05A 1V0LA 3W27A 4AD2A 1J0JA 3VIFA 2CHNA 2E8YA 4XZBA 1EOMA 1JZ7A 1PX4A 1WE5A 2YBTA 1J18A 5AYBA 3W24A 1E6XM 1H09A 5KEZA 4H8VA 1TUXA 3A4XA 3U5YA 4UR9A 2BY1A 1LL4A 2BS9A 4JHZA 2ZX9A 1DTUA 3OLEA 1M03A 2Y8KA 1V6WA 4H7VA 1ZS2A 2YLAA 3AZRA 1WKYA 4ZFMA 1BAGA 1SMAA 3WUEA 1MQRA 3KL3A 2WC7A 1SFSA 3ARTA 3I3EA 2DH2A 5DFAA 5IDIA 1ZBVA 1RD6A 3N17A 2GK1B 1BSIA 1C3FA 3W25A 1CGWA 3AIQA 1XHGA 2YDSA 1SMDA 3NSNA 2ZWZA 4J3VA 4JCMA 5CSYA 1BG9A 1BF2A 1MXDA 3A3HA 1GOMA 1NARA 3WH7A 1E9LA 2GSJA 2VR4A 3N04A 1QNQA 1JF5A 1PZ3A 3L4YA 1ESWA 2DH3A 1WDSA 2W5FA 2Y5EA 1W91A 5I23A 4YN5A 4PTVA 1SR0A 1EA9C 2PWDA 3AS0A 2QPSA 5HNNA 2CIPA 2Z1KA 4Z2IA 3CZJA 1XSJA 5JBEA 4PBGA 1W32A 4PRWA 1UWRA 5E0CA 1AQ0A 3U57A 5D9MA 3PTQA 5EFFA 1PJ9A 2DSZA 2QHAA 4X9YA 1IZKA 4OIFA 3UESA 4NI3A 3DECA 3ZSTA 2ZIDA 4B9YA 3BAJA 3AMCA 3MMDA 1JNDA 5LA1A 1HXJA 4E8CA 4TTGA 4LPCA 1J12A 2CBIA 1G5AA 5DF0A 7CGTA 4E4PA 3CBWA 5ABGA 4TVUA 4U2YA 1DHKA 3ARVA 5BXTA 3VIMA 2EXOA 1B1YA 2DSVA 3HJEA 3TOPA 1J0YA 5DO8A 4KGLA 5KZ6A 1KGXA 3CPUA 1DWJM 3O2LA 4CD4A 1QVBA 1KQYA 3T0AA 1E3XA 5CQ1A 3EDDA 3FW6A 1G1YA 1KGWA 1J11A 3PTMA 2YBUA 3SCQA 3ZT7A 1CZ1A 1UR8A 8CGTA 3OA5A 1HL9A 1R86A 3WENA 4AXNA 1PPIA 4MAVA 4W84A 2NW0A 2XFYA 3WMSA 1OT2A 1U30A 4UQ9A 3I3DA 3D3AA 3CHCA 7TAAA 4ATDA 2ZWYA 3GDBA 4JL2A 4MB4A 3L4ZA 3MUAA 2DT2A 2WC3A 5DT7A 3LPGA 2HISA 2FH8A 3VPLA 4F8XA 2BXYA 3UG4A 4U3AA 5TD4A 1HT6A 1PZ2A 3N11A 1VEOA 1XH0A 4ACZB 3VTRA 4W86A 5I77A 4QLLA 5ECUA 3LMYA 4HOWA 3WD4A 2WWCA 2Q8XA 3B9EA 5D9PA 3RDKA 2UWFA 3AXHA 3BAXA 5GPRA 5E6ZA 4PMVA 3VD9A 1CEOA 2OYKA 5A6SA 2BHYA 4ZXLA 2O9PA 2GUYA 4MAZA 1GW1A 6A3HA 2CBUA 1GHRA 1MYRA 1ODZA 5C70A 1MXGA 4ZEPA 2JIEA 4MB5A 1HKKA 5FOOA 4F79A 2IUZA 3ARZA 3OZPA 5A8QA 4J3WA 1F4HA 2XM1A 5FL0A 5CPQA 4GI6A 1BGAA 4AZ7A 3BCFA 3WNLA 4PEEA 4UOJA 2BFGA 3NSMA 1J0ZA 4TX6A 3JUGA 1W1TA 3RJYA 4HU0A 1OGGA 3CZ8A 3GTNA 3IJ8A 1ISWA 1HL8A 3BH4A 5M17A 3ZQ9A 1NWSA 3OBAA 1H4PA 5HDRA 2WKLA 3BSHA 3SEPA 4B9ZA 4W8AA 1CNVA 1VFFA 1B9ZA 3MO4A 2W92A 4P8WA 5D9OA 3WBAA 3VX1A 4C7GA 4WLCA 2QPUA 1C8QA 1GPFA 4JKMA 4WKHA 3ALGA 4H04A 2XHYA 1V0KA 1XCWA 3BAWA 1ZJBA 2Y2WA 4AEFA 1FA2A 4AZIA 1X1NA 3T2OA 3UG3A 2VNCA 3AHZA 4BQ4A 3K8MA 3VD5A 5BXSA 1FP8A 2DIEA 1BHGA 1FHDA 1AMYA 1UYQA 4PMNA 4KH2A 5D8WA 3WQ4A 1GORA 1BGGA 2IXUA 3PN8A 1KBBA 1NWRA 3AXIA 2JEPA 1MW1A 1MW2A 3WMCA 5A8NA 4JIEA 3AISA 3A47A 4TVDA 2JEQA 3VILA 1XCXA 1OGSA 4H2CA 1K9DA 4JHOA 4OOZA 3GXIA 3MS8A 3OLDA 1GNXA 2VI0A 2WWDA 4Z2HA 1CYGA 3K46A 5CGMA 4NF7A 2V3FA 4MDPA 4P7NA 4B3KA 2V3GA 1OIMA 3EMZA 1YHTA 1UD8A 2YLLA 5JBDA 3N13A 2DGAA 4AC1X 1QHZA 4AZ6A 1C93A 3GXFA 2DEPA 4PMYA 3N9KA 4AYSA 3WF2A 4P7OA 3KL5A 5AC4A 2YL6A 2A3AA 2WMKA 2VZSA 1QNOA 1E6QM 3O6AA 4F66A 5A8OA 3W81A 1NWUA 2YIHA 1W2PA 2D2OA 2G8ZA 2VCBA 4LX4A 4HPHA 4GIAA 4W5UA 4P8UA 2WPGA 2PF0A 2D0GA 1Y7VA 1U2YA 1JAKA 4JFUA 3K1DA 2V38A 3DHUA 5CLWA 3AIRA 2J25A 3LPOA 3ZJ6A 1L8NA 5FIPA 1LG1A 1ZJAA 5JIPA 2ZUNA 4MNKA 3TTOA 1XSKA 4GO8A 1XC6A 3PZOA 3MANA 3CIVA 2D0HA 5E70A 2WVVB 3L2MA 4PMRA 1CENA 1I1WA 4MNMA 1IV8A 3WH9A 1XH2A 4GZIA 5FD0A 1B3VA 1HKMA 1UKPA 5M3WA 1VIWA 1IZJA 4HZ7A 4JFVA 3GXMA 3ZT5A 3ZOAA 3F5LA 1HF6A 2CPUA 4QDMA 1UWUA 3WDHA 1JYXA 2WMJA 3ARXA 2PWFA 4S3JA 3K4AA 1UH4A 1V3MA 1P6WA 1BYBA 2J7BA 3M6DA 4OBRA 1E1FA 1LJYA 1V08A 1BYDA 1NOWA 4JFSA 1XD1A 3ZR6A 4CUCA 1EOKA 6CGTA 2FHFA 1E6PA 2D23A 3OLIA 4ZE4A 2OSXA 2YKKA 3WELA 3UG5A 4M24A 5IFTA 1CXEA 2W67A 5FKYA 1ZU8A 2EEXA 2XVKA 2XVLA 2VZTA 3AHYA 2ZXDA 4M82A 1WDPA 1Z32X 3VINA 1H5VA 3K8KA 3IAPA 1UOKA 3GH5A 5I5RA 5E6YA 1E71M 3VMOA 1GCYA 5E0FA 3PZUA 1FH8A 3W6MA 4RE4A 2G4FA 1E43A 3CO4A 1JGIA 4Z2LA 1QHPA 3CLWA 2AMGA 2F8QA 4PYSA 1B3YA 1J0IA 4UFKA 4J3SA 1D7FA 2A3HA 2ZX6A 1M53A 4X0NA 4D1JA 1LQ0A 4GINA 2QLYA 3GBEA 1JYWA 3J7HA 3T0DA 1CGVA 3CUIA 3W38A 2CBVA 3F4VA 4WF7A 4U5KA 1A3HA 4PMUA 3WNMA 3MUY1 5D8ZA 3WEZA 2BNJA 3EDFA 4ML4A 2G3MA 2CESA 4XZWA 1C91A 2YA0A 2VURA 4AZCB 8A3HA 3NUKA 3THDA 3GH4A 4AWEA 1VF8A 2F61A 5HOSA 1AQHA 1CGUA 2VT0A 1R8LA 3WUFA 4PTWA 4PTMA 3ARPA 3W82A 4GI9A 3EBVA 1DWFM 1GOOA 1CXHA 3F5JA 3KE0A 2GJPA 2XFFA 3QOMA 1UR1A 1V0NA 3WL1A 2WVUA 4AZBA 4MADA 4MNLA 2CBJA 2F2HA 2E3ZA 1Q6GA 1OD0A 4J27A 3WD1A 4BQ5A 3ARRA 3RMEA 3AIVA 2EPNA 3FY1A 5BRQA 2VCAA 2D22A 3FNDA 3WFZA 4UZUA 2WMIB 4AZ5A 4EKJA 3OGSA 4D6GA 1H0IA 3SCTA 2JF7A 3W4RA 2XUCA 4M81A 4OKDA 5AYIA 2OYLA 2VZUA 1C7SA 3L2LA 3FAXA 3G6LA 1JZ3A 4CN4A 3OG2A 3DC0A 2AOSA 2QV4A 4LGXA 3MUIA 5A6AA 1XD0A 1C7TA 1PIGA 4GQRA 3OLGA 3CUHA 4J28A 5CJ5A 2WLZA 1NOFA 5IHSA 1LL7A 4WK9A 1FOBA 1YQ2A 1OGBA 1OIFA 3HMCA 4H41A 4F9DA 5A6MA 5BCAA 2D0FA 2VVSA 4U33A 2O9OA 5ABEA 1V3LA 1CLXA 3PZ9A 2E8ZA 3MUZ1 2ZXQA 1E0XA 4OJYA 3ARSA 1C8XA 2BHZA 2GFTA 1ITCA 2W66A 1LWJA 3DYMA 2VZVA 1V6XA 5FCZA 3RILA 2XSBA 3CMJA 1W3LA 4M80A 4J3TA 4IM4A 3VGDA 2VRQA 2YA1A 3QOKA 3SCRA 1JL8A 3ZJ8A 5GNXA 9CGTA 4WSJA 3CZKA 2NT0A 1UZ1A 3CZEA 4HA3A 1UWQA 3NIYA 2DSWA 1NP2A 2ZUUA 1H11A 4JKKA 2J62A 1UH2A 3EMQA 5I3DA 4JAWA 1QNPA 4W85A 3F5KA 1BVZA 4AISA 2UY2A 3T08A 1J0KA 2BY3A 2YA2A 3TP4A 3UEQA 1UWTA 3RJXA 4YHEA 1VFUA 4UQEA 1WDQA 4JZ5A 2VCCA 2BVYA 4W87A 3K8LA 3IANA 3AI0A 4UQDA 4JKLA 3T2PA 3NJ3A 1JDCA 1E55A 4MTVA 4M56A 3L4TA 1G0CA 3MSGA 2XGIA 2J8FA 3WH5A 4CU6A 1R7OA 2EJ1A 1TVNA 4AIEA 5A6BA 4FK9A 3KWXA 4BQ3A 4Z2KA 1JZ4A 1CDGA 1XSIA 5BRPA 1JNEA 3SCPA 2UY3A 4QFUA 4GKLA 1FFRA 3VX0A 3LPPA 1TMQA 1B31A 4FF5A 3W26A 4MJ2A 1JZ2A 3AICA 2X0HA 4QCFA 3TONA 2BV9A 1HNYA 1WNOA 2XVNA 1HJXA 5AC5A 3VOCA 4Y7EA 3WD2A 1VEMA 3I3BA 4DWSD 2WMIA 2YOCA 4V27A 3UCQA 1G9HA 2D24A 3BGAA 1EHAA 3PZQA 5A6LA 2MANA 2X1IA 2E9LA 3AHTA 4ZE5A 2C8NA 2XSAA 1M04A 1UR4A 2DSKA 1TA3A 4UFHA 4D6CA 3OB8A 1KB3A 1QNRA 1GHSA 3VIJA 2W4XA 4BZYA 1V02E 1CXFA 1X6LA 6TAAA 1B2YA 2WK2A 2ESCA 2X09A 3RCNA 1KQZA 4TOQA 4QLKA 5A8PA 5JUVA 1TA3B 1NOUA 1V3JA 3S6TA 4CU7A 1XYZA 4TX8A 1B3ZA 1UD3A 3AMKA 4ACZA 2WYSA 4BCEA 3KZSA 1TE1A 2QMKA 3WDJA 1E6NA 5C71A 4J3UA 1JIBA 3NCOA 3IAQA 3A4WA 3WDPP 3WSUA 1DP0A 2WCSA 2FDMA 4PTXA 2ZUMA 1QBBA 4CN1A 1HJWA 2TAAA 4LYQA 1FHLA 1TR1A 4AIOA 4OUEA 1W9XA 1VFOA 4AY1A 4D6EA 1E0VA 3VIOA 5ABHA 5JBFA 3A6OA 2J75A 3T09A 2GDUA 4GZEA 2QMJA 2FHBA 1VRXA 1UKSA 1UQZA 3LPFA 4P7QA 3HN3A 4RE2A 1FFQA 3WMBA 2CCRA 3GNOA 5I79A 5CZKA 3WEMA 5BXPA 1W9BM 1UD6A 4L4PA 4TUFA 1O6IA 3IK2A 4WKAA 2D20A 3AIUA 4NZCA 4UNIA 3WQ6A 1CGYA 4MB3A 4CD8A 3WNOA 4D6FA 4LYRA 3WUBA 4BF7A 4Q22A 1TFVA 4MJ4A 1UWIA 3N1AA 1JD9A 1UR0A 5LYRA 1VAHA 4W93A 1UHVA 2G3IA 4AD5A 2VX6A 2D1ZA 2B31A 3T2QA 4TTUA 2YDQA 3WBEA 4DM2A 2VJXA 3VU2A 3AYSA 3ARYA
chains in the Genus database with same CATH superfamily
1S2CA 1OX4A 4KEUA 3PZIA 3C0SA 3M0YA 3QYSA 3GXNA 5A2BA 5A95A 3IJDA 1I45A 3RX4A 4M7SA 1I2QA 4TX9A 3NVDA 2PDUA 2GVGA 1WAWA 1PX8A 1XH1A 4L5ZA 4EVZA 4KERA 4JTKA 1Q7MA 5C2CA 3BUVA 2Z1SA 1BVNP 3A9BA 4CCEA 1KXTA 2E40A 3PUOA 3VM7A 1GVYA 4B16A 1V5XA 1WZMA 5EB8A 2H6RA 1JDDA 5HPCA 5AHIA 2OLHA 4O28A 2WNNA 1DWAM 1HJVA 1HP5A 3MO7A 3JW7A 3OP2A 1DJWA 4D8AA 1KM6A 4UTLA 2ABAA 1V6UA 4NJGA 3L2IA 3VNYA 2P3ZA 2D3LA 5B7YA 4A2RA 2OSWA 2P10A 1H1YA 1OWQA 1VRDA 1XIFA 2Z26A 3FV9A 2QV5A 5CXPA 5FJIA 2VO5A 4KFNA 1QK0A 4PC8A 1TWZA 1H51A 2CLIA 1PE1A 2PBGA 3DDMA 4CCZA 1EPVA 1W1A1 1W1VA 3PUDA 3STCA 4DWDA 2E6YA 3LYEA 4WDUA 3B03A 3LTSA 3C2EA 3M4HA 4JEJA 3MY9A 3W2JA 2EHHA 4D6JA 4LW7A 1OZQA 3T0TA 2JKAA 1UUQA 3DOPA 4A8LA 3EWDA 3V5OA 1KFBA 4QG8A 2G50A 1E9YB 4ZTXA 3IACA 1KR0A 1JPHA 2WXDM 5I24A 3HU7A 4JR5A 1H7NA 2WLYA 3AYVA 3H4WA 3PUEA 3B9NA 3SUVA 2UY4A 1ISYA 1ECEA 4PUEA 1XG3A 2ZUTA 3DGBA 2CLMA 5CG7A 3AU2A 4Q32A 2ZFAA 3VIIA 1L6SA 2CLKA 3WJSA 4JD4A 2P88A 3GBDA 2ZUSA 4C6CA 3EGJA 4S39A 4CKQA 3DERA 1Z44A 4OU1A 3AIBA 2QULA 3BCDA 1QPQA 3OBKA 2XIOA 3POHA 4ADSA 1TG7A 1QNSA 3CPGA 3CUJA 5I02A 4C6MA 5RUBA 2PFHA 2VGBA 4OT7A 4JDYA 4DM1A 1UQYA 5HBFA 5M5DA 4H19A 4W5ZA 2I5IA 2OT1A 3P60A 4FX6M 1UC5A 3W1RA 1PXGA 2QUNA 1KGUA 3UXIA 2Z1XA 4HU3A 1U33A 5H1WA 3BANA 3W83A 2O92A 4Y6GA 1GVQA 3NQDA 5SWUA 1RJPA 3R1ZA 2OQYA 2I5QA 3PHAA 5ABFA 5LHFA 3ITLA 2XVPA 3W28A 4Q4PA 1BLIA 4KFOA 3UR8A 3SUTA 2UY5A 4S3FA 1Q6FA 4PSPA 2WZHA 4K7VA 4ZA0A 1MW0A 1Q6LA 5AVHA 1DQUA 4YPJA 5HWMA 3BSGA 5LGXA 2DUXA 4L4MA 3N12A 1BXNA 3SECA 2I7GA 3NO1A 4HYWA 4JGDA 3I7RA 4AD4A 3EOEA 2J7EA 2XFRA 4IPNB 3UD6A 1UR9A 3T78A 1AZ2A 4MPKA 2V0TA 1VFTA 1S5TA 2OPJA 4Q8MA 3STGA 3G24A 3VIHA 2IW0A 3WFLA 3M47A 5EMYA 2A7PA 3TTQA 4E2OA 2CYGA 1RJRA 1ME9A 2HPIA 4B4FA 3T8QA 4H00A 4UTWC 3N6JA 1PEZA 4XD3A 3RM8A 4OTKA 1MWOA 4CQAA 3EB4A 3B4UA 1O5RA 4F9JA 3AQUA 1J0HA 1TV2A 2PC4A 1DORA 4NUWA 3WUGA 1QI0A 3ZSSA 4MLJA 4H1ZA 2VL4A 1MW3A 2WHKA 5TF0A 3URQA 1QATA 3V75A 5BWFA 4FXFA 3WLTA 4EANA 3LGDA 3G0UA 3R13A 2WZEA 4EE9A 1WB0A 3GZ3A 1UWSA 5T9CE 3ZVHA 5E9AA 3WBWA 3QKEA 2OWCA 3CMGA 3WQPA 3ZMRA 2ZZ6A 1SZRA 4HA1A 4POCA 4CNSA 1XP3A 3F2BA 2J8GA 1LBLA 1C90A 2BY2A 4C1LA 3VGFA 2ISVA 1V7AA 4OECA 1XLLA 4N02A 5FA5A 3S9IA 4RLIA 2INZA 2AQVA 3M07A 3W74A 2XISA 2PDJA 5LIXX 1F74A 2WO5A 5JXQA 1IE7C 4DO5A 4MGGA 1F5ZA 1UUOA 4NJHA 4A3QA 1R2RA 5CSSA 4BF5A 1LWIA 1IGWA 1RVGA 4PB4A 3VMNA 2E9BA 3OYZA 4FNRA 4I90A 5GNYA 2I5GA 1IQ8A 1HL2A 2Y5SA 2GQ3A 4JTRA 1XLEA 2VQTA 1GEHA 5FJJA 3RU6A 4XZ9A 4JN6A 1V3KA 2VFIA 1XYBA 2YDRA 2PB1A 1JYVA 1Q6EA 2A79A 1GQNA 3DZ1A 4GFSA 6XIAA 5LA2A 1XBYA 1E56A 3UQNA 1U1HA 1V7YA 2QCNA 3WG6A 1I0BA 2NSXA 4NYYA 4HPGA 3AFBA 5JH2A 3NZ1A 3KFTA 5FJTA 2ZA2A 4GZ7A 1GQIA 1R9ZA 5F7UA 1SJCA 2QKFA 2W63A 2QCLA 1KRCC 3MBFA 2X40A 5G1MA 1RP9A 4S3KA 3L5LA 4NKCA 4DVOA 2B7OA 5CEWA 4F4RA 2ISWA 4HP5A 4D1IA 3BAIA 4ZXOA 3IVTA 2CETA 3MSYA 1TVLA 7TIMA 3UWYA 2GWGA 1VHCA 2ADAA 1W1ZA 4EPBC 4CCCA 2ZX8A 4MKVA 4AZCA 4D2JA 2Z6IA 1OX6A 3EMCA 1IEVA 4D6IA 4JYFA 3E0FA 1TVPA 3C2YA 2WW5A 3CH0A 4UMAA 1QPRA 3W7JA 1C92A 4LANA 5C9RA 2RDWA 4FXRA 3W85A 1EB3A 4Z08A 4J2MA 1QPKA 5G4EA 3MC5A 3O16A 3SIMA 3SGGA 4I8DA 1TPVA 3T44A 4IMFA 2Y7DA 3LCHA 1V02A 4NSBA 1LYXA 3N6QA 1W8GA 1V4YA 3DFPA 1JD7A 4O8RA 2VD8A 2YL5A 5AVNA 5HMDA 2VFFA 4ROPA 4Y8EA 3RPMA 3W37A 2WJZA 4S38A 1JZ5A 4XAYA 3ZLGA 1I75A 4FXSA 3BC9A 1F3XA 4DNHA 1AW5A 2TPSA 1BYAA 3L66A 4RZ6A 2ATSA 1R3TA 3SUWA 3W02A 3IUHA 4P7RA 4G7EB 4ZB0A 5BMXA 4HPJA 3BGJA 5C55A 1TV8A 5AHEA 4GJIA 4S3GA 2WM1A 4HMNA 3TOYA 4U31A 4UTKA 2DQXA 3FXGA 2BASA 1Z6KA 1XLHA 3HFTA 2CKSA 4JTEA 1I2PA 1VEPA 2VGFA 3TW9A 1K02A 1EQPA 1WV2A 4HVXA 3AYRA 3R10A 3KS5A 2GWNA 1P43A 2FPTA 3T81A 4ZO7A 3KEHA 2HVNA 2ZZ2A 1KLYA 1B0IA 4QAWA 3L0NA 4GY0A 4RR4A 3S2NA 4NRRA 4YTRA 3WDIA 3B06A 4GMEA 4M29A 2IMRA 2J6XA 1DJHA 4WY0F 1UKTA 3GAYA 3M5VA 1SVDA 1GJUA 4YYFA 4GX8A 1EHNA 2Q02A 3QPEA 4B2DD 5F1VA 2D2JA 3K4DA 4H9UA 2GDVA 4HNUA 3FAWA 3NR0A 4GYJA 3DYOA 1DWGM 2OU4A 1CGTA 2WVSA 1E5NA 1AJ2A 1QOXA 2NT1A 2VDGA 3ABSA 4GQGA 3V0TA 3A3XA 1AL8A 1IT0A 3GUGA 1QFEA 4GKTA 1X97A 2WMHA 3UWWA 5BYWA 5EBUA 2PLCA 3GHRA 4BFAA 1K70A 4GCXA 3OG3A 2VWTA 3W29A 4AH7A 3OA3A 2ZA1A 2J4GA 3WLKX 4NZ4A 1ELSA 2C7FA 5CPSA 2A21A 4GVIA 5FSDC 2R91A 1H49A 1K77A 1ZHAA 3GIQA 2IQ0A 4LFYA 5EPDA 3W0KA 1YXDA 1W1PA 3KZPA 3ITGA 4MIMA 1RPKA 3UJEA 1B4KA 3B0PA 4N9CA 3TN3A 5LKYA 1GOQA 1BTCA 3QH2A 4LNCA 4PULA 4UNKA 4QCEA 3VDBA 2YCKX 3IIPA 3CPRA 2PLJA 1KFLA 4K8HA 3G1XA 3SCNA 5EGRA 3ZVHB 1EL3A 3VD3A 1PKNA 1DTNA 3L0KA 4F2TA 4D9PA 4GQQA 4JHMA 1N55A 3A12A 1UD4A 1TV3A 1AH4A 4FNUA 4MVAA 4ZQCA 5HWNA 1FWGC 1LLOA 2PWEA 1A0DA 2W0UA 5C7VA 3F2CA 3QW4B 3DESA 3GDTA 5IRPA 3CTTA 3TKFA 1A47A 4FOKA 4LBSA 3AS1A 3QTPA 4HHHA 3LGEA 1L6FA 4UFMA 1L8PA 3W73A 2DUZA 2PP3A 1W3JA 4AZHA 4IIEA 1E15A 3VE9A 1DIEA 5CJNA 2BTMA 1LF1A 1Q65A 3BLKA 4QP0A 3GTFA 2B0MA 2C91A 2X16A 2BOGX 5FF2A 2VFDA 3GNXA 5FF7A 1WZKA 2RUSA 2GDQA 4LBUA 4P5UA 4YLWA 4AVFA 1Q85A 2JE8A 5DMYA 1GQJA 3VGEA 2GGIA 3USBA 7REQB 4MKNA 4J7RA 1WXYA 2XIMA 2V5JA 1UZDA 4Z1DA 2MUCA 3NDZA 2P8CA 3K1GA 1QOPA 1LWHA 3R12A 2XZ7A 3PUGA 3KTSA 1A5AA 4M1RA 5M03A 3LK6A 1HUVA 3LBMA 1GQKA 4MMWA 5E0KA 2WMFA 1JFHA 4PTNA 2NUYA 2AKMA 3A4AA 1B3OA 5LSMA 1OT1A 4RV8A 2XN0A 1BG4A 4GUJA 4DAFA 3NZRA 1OFPA 3AMDA 3U9IA 3UY8A 2OWXA 3MYOA 1V0LA 1SJDA 2CHNA 3F4DA 2E8YA 2H9AA 4GVGA 3KLKA 3BO9A 1WE5A 1KKOA 5AYBA 2GUBA 1H09A 5KEZA 1XWYA 3EX1A 4QG6A 3U5YA 3A4XA 4UR9A 1LL4A 3ZWTA 1JPDX 3FFSA 5DX7A 1IXQA 1ZS2A 1XCFA 4HTBA 1H1ZA 3KL3A 4BY3A 2VR2A 3RCYA 2V8ZA 1EWDA 3ARTA 2DH2A 5EMLA 2YYUA 2H9AB 2YDSA 4K36A 4ADUA 4J3VA 4JCMA 2DW6A 5CSYA 3TC3A 1BF2A 3JVAA 3A3HA 3WH7A 1E9LA 1YKWA 2ZVRA 2CWXA 1LOSA 1WBHA 4HN8A 1BWVA 3L4YA 3O8AA 1ESWA 4YCOA 1F3WA 4YN5A 4PTVA 1SM9A 1RQHA 1EA9C 3SY1A 2GQAA 4F3HA 1VYRA 3IS4A 4Z2IA 5JBEA 1F2JA 4PRWA 3AWNA 4RDWA 1AQ0A 3NPWA 5B80A 2KZHA 5GVJA 5D9MA 3WJWA 3PTQA 3C61A 1SJAA 4DXKA 3UESA 4NI3A 5HMEA 1DPMA 3I6TA 4HK5A 3BAJA 1VYPX 3MMDA 4E8CA 1EJ7L 4LRSA 2CBIA 5ABGA 4TVUA 3U4FA 1VCGA 2IKGA 3ARVA 3RU8X 2EXOA 3TOPA 2A5HA 3LXCA 1J0YA 4XBKA 2OKTA 3CJPA 4Y96A 3E2QA 1OK4A 3QQ1A 4KCUA 1KQYA 1TPEA 3EDDA 3WLJA 3FW6A 4R85A 1G1YA 4EIVA 3PTMA 1FCVA 3ZT7A 1P6CA 3OA5A 3WENA 3LRKA 2E6FA 3BLIA 3BW3A 3TJXA 4TU1A 3MVTA 1OT2A 4UQ9A 1RUSA 4ATDA 3GDBA 1GTEA 4ZFCA 1OQFA 2V2HA 2XINA 2DT2A 3YPIA 2WC3A 1LQ2A 5K3VA 3W9ZA 4MF4A 5MKGB 1TQXA 3LN3A 4Q4OA 1PZ2A 3N11A 5TAOA 1L6GA 4W86A 4QLLA 3R7MA 3W72A 3OPSA 3W22A 3BAXA 3A64A 4ZQMA 5H6HA 4I6VA 1IEIA 4AFYA 3N34A 3DFHA 3G0SA 5C70A 1MXGA 4I9JA 3EA1A 1HKKA 2IPJA 2IUZA 4IOTA 1HO1A 1F4HA 3BCFA 1VKFA 3PFRA 3IGSA 2BFGA 4UOJA 3M0VA 4HU0A 4LAOA 1OGGA 3GTNA 3IJ8A 4PTDA 1W5QA 4JTAA 3ZQ9A 3NYZA 1ZGDA 1MO0A 3GDLA 5D2WA 2WKLA 5TNVA 3TZFA 3ZLHA 4GA8A 1CNVA 5HNRA 1M5WA 1B9ZA 3LBCA 1GT8A 2PDXA 4P8WA 4WQ6A 2QCDB 2J24A 1IHIA 3G3MA 3W3OA 4C60A 1GPFA 4E0CA 5HQEA 1UBPC 2PZNA 3KTCA 2ZCGA 4LS0A 2Y2WA 2XIJA 1FWTA 4P2VA 4BWLC 2VNCA 3K8MA 3OHMB 3QV7A 1BHGA 3R6IA 3HZ3A 1FHDA 5LXEA 4KH2A 3WQ4A 3VCRA 2ON3A 4JDBA 3JRKA 2ISDA 1OABA 3V18A 1HO4A 1Q6OA 2OR2A 3PN8A 2P0OA 4Q3MA 1MW1A 5A8NA 1PCKA 3A47A 3G18A 3UZZA 4LCSA 2QQ6A 3VILA 3M5XA 4BI5A 1OGSA 4ZOEA 1K9DA 4WR3A 1QW7A 1EC8A 3DX5A 4S23A 3GXIA 2VI0A 4A2SA 2Z7KA 4C6DA 4R9XA 3K46A 5CGMA 4MLRA 4MYXA 4F2BA 4Z1AA 1YHTA 1UD8A 1EX1A 2YLLA 3N13A 2IKJA 3IEBA 1QHZA 4AZ6A 4LT9A 2VGGA 5FEXA 4PMYA 2PE4A 3WQCA 4C1NB 1EPXA 4AYSA 3FIGA 3QVQA 2WMKA 3OVQA 3PVFA 3C2VA 2YIHA 5I3JA 1W2PA 1YRRA 3MKCA 3DI1A 4LBRA 4W5UA 3W2NA 4DBDA 4AEOA 4JIRA 4I7UA 1A53A 4J35A 5LNWA 4RJEA 1G4TA 3K1DA 5CLWA 4IMCA 3L23A 4ZOCA 1LG1A 3CUXA 5DELA 4UCGA 5JIPA 3VA8A 3TTOA 5MHBA 4GO8A 1XC6A 2YZRA 2D0HA 5E70A 3UJSA 4PMRA 3QKZA 1I1WA 1UPPA 5FD0A 2NUWA 4QROA 3C4UA 1HKMA 1UKPA 5M3WA 2UZ9A 1VIWA 1OC7A 3WZ0E 4GOAA 2VELA 3GXMA 5C0QA 4GC4A 4A3UA 1PWLA 2CPUA 2PTXA 3MDWA 3N29A 3N2XA 4O17A 4QDMA 3ZXWA 1JYXA 4LALA 4S3CA 3ARXA 2PWFA 3DFOA 3EWWA 1P6WA 1BYBA 4HCDA 4OBRA 4XKYA 3VNJA 3TFCA 2PD9A 1BYDA 3G77A 3ITXA 1TJPA 4E3VA 2PGFA 3ABRA 2D23A 3OLIA 2PDGA 3SJ3A 3WELA 2QCCA 3UG5A 4ZQOA 4O0ZA 1XI3A 3BDKA 5IFTA 3DC8A 3FYPA 1N2VA 4QGCA 1NFBA 1ZU8A 2EEXA 3WK3A 4V1YA 3AHYA 2XVLA 2PU1A 2X0SA 3VINA 3EPOA 2ISSA 4FEZA 2ZA3A 2EPHA 3HGSA 1T8XA 2CZVA 3R43A 2JBMA 1MEWA 4MWAA 1EYWA 2YBVA 3ZYZA 2BOEX 2G4FA 2AMGA 1FY6A 1ZTVA 1X98A 3HG2A 3S4TA 1D7FA 2ZX6A 1LQ0A 1EC7A 2F38A 3J7HA 1CGVA 3T0DA 1OX4B 4Q8UA 3C0LA 5AYZA 3AAMA 3BQ5A 4LUIA 1VBGA 2DZBA 4L1WA 3WNMA 5D03A 4UNLA 3EDFA 3EX6A 2VURA 4AZCB 3NUKA 3THDA 4AWEA 5LNUA 3JZEA 5I7GA 5BU9A 3SR7A 3ARPA 3W82A 3EBVA 4H9ZA 3WL1A 1UR1A 4QSFA 1K3UA 5E93A 2OEJA 3B3DA 2DQWA 2PGWA 3WD1A 4BQ5A 1YPXA 2NVAA 3MSRA 2Y61A 3FY1A 5BRQA 5MKGA 4IIFA 2PURA 1EJTC 4I8YA 3WJYA 2HQAA 1IEQA 4EKJA 4Q4SA 1S2TA 1G7VA 3KVMA 4M81A 4OKDA 1PS9A 2WPBA 3IGHX 3QR1A 1FDYA 1JZ3A 4CN4A 1ENUA 4X60A 3A3WA 1VPYA 2IPFA 2QV4A 1F3TA 1XD0A 3OLGA 4J28A 3F4CA 5CJ5A 2WLZA 4IFOA 1US0A 3DFTA 4YVXA 4Q8PA 1LL7A 3S5OA 2OB3A 4KWVA 4UTTA 4F9DA 5A6MA 3S42A 5BCAA 1J5SA 4ICCX 3ISIX 1V3LA 4RW3A 3AYTA 2IKIA 5D38A 3CUZA 4AAJA 5T9BG 1ALDA 4OJYA 4S1FA 4WDWA 3TCEA 4NYUA 2VZVA 3E49A 5FCZA 2ACQA 3RILA 3RXZA 3EKLA 4PUNA 2HBVA 4J3TA 3VGDA 3QOKA 3AC0A 3ZJ8A 1JUEA 3SAZA 4XO6A 2NV2A 3LBOA 1YX1A 1UWQA 2OGYA 3OVGA 3QGKC 3EX4A 1QWGA 1H11A 3P0XA 1FDZA 1WYIA 1QNPA 3WYZA 4J1OA 4W85A 1OX5A 1BVZA 4PEKA 4AISA 2UY2A 2BY3A 3TP4A 1M7JA 3LHZA 2PDHA 1UWTA 2OEKA 1FHUA 3VC6A 5KMYA 4UQEA 4M5PA 3KOFA 3K8LA 3CTLA 3GW0A 1XDLA 4UQDA 1XR2A 4H9TA 3IUDA 1JDCA 4WJEA 3LRLA 4MTVA 1ZP4A 3MPGA 4NQ1A 4M56A 4O1DA 4EWND 2BGNE 3PFMA 2IPWA 5CBIA 3KWXA 2ZRWA 2PLMA 4BQ3A 4Z2KA 3E96A 3TR9A 4IJCA 3HPSA 3RLGA 3SCPA 3RUBL 1VD6A 4GKLA 3UA4A 3VX0A 2PTZA 1B31A 5F2IA 4FF5A 3CV1A 5CPLA 2QYGA 4C6BA 1A49A 5G2WA 2NX9A 1RSCA 4QCFA 3DIPA 3TONA 1NELA 1WNOA 4LV9A 2DU2A 5AC5A 4OBTA 1VEMA 2WMIA 4C6LA 1ICQA 1SUXA 4JQAA 4B5NA 4V27A 3UCQA 1G9HA 4UTTC 1SJBA 2MANA 1FKWA 1VYSX 3N6HA 4ZE5A 1M04A 2DSKA 4HNCA 1GZ1A 1K8XA 2XU2A 2W4XA 3KHDA 3LOTA 3EX3A 2ESCA 4XAFA 3HTWA 1IZCA 1KQZA 3KBMA 1HGYA 5A8PA 1NOUA 3NEVA 1I8JA 3VFLA 3T9PA 3G1DA 3QY7A 4EPKA 2ZVIA 1B3ZA 1UD3A 5JVLA 4ACZA 4DIAA 1ML1A 1VLWA 3QJAA 2Q01A 2YR1A 3KRUA 1ONWA 1JRBA 2G37A 3FOKA 4ZBCA 3W1AA 3SSZA 3CIXA 1QRQA 1XQLA 2YYTA 1DP0A 2FDMA 2D73A 1YMYA 4CN1A 1V6TA 3UWUA 1Z42A 3G1VA 5EMKA 1SPQA 4OUEA 1H62A 1KNWA 5K2ZA 4EPEC 1E0VA 1JDFA 3C8FA 2OZTA 1CLKA 3T09A 4ERAA 3T0CA 2J8TA 2QMJA 2FHBA 1VRXA 4IQLA 3LPFA 4J40A 3HN3A 5CAKA 4QSHA 3UVIA 1W5OA 4QS6A 3GNOA 5CZKA 2C14A 3Q58A 3UXKA 1W9BM 5D32A 5K7JA 2E5BA 4G5DA 1B4EA 2C13A 1O6IA 1F07A 3GVQA 3WQ6A 1VFHA 1CGYA 2QIWA 1TTPA 3OQ8A 4MB3A 3TN4A 4JTUA 4UB9A 3TLQA 3I7SA 3WNOA 3WUBA 3QSTA 4Q22A 1Q2SA 4YXGA 4NJJA 2Y89A 2OFJA 5I3GA 1UHVA 2G3IA 2B31A 3S8HA 3ARYA 4B4HA 3LLDA 4CQBA 3THCA 1JZ6A 5ABTA 1X6NA 4CCDA 1AUSL 1IT7A 5DANA 1EYEA 3LHTA 1TPFA 1ISZA 1LDCA 5JIWA 2E0PA 3EPMA 3T07A 4IJRA 4A29A 3HV9A 3VDAA 4F0SA 2X42A 3TFXA 4O15A 5I00A 1OFRA 1TPC1 2RDXA 5I3HA 2X7WA 1OHLA 1TZ7A 4DXVA 1TZZA 4UUIA 1O1ZA 2VFEA 1TZ9A 4A35A 2B7QA 3NYDA 5KZMA 4GVHA 1RD5A 1JFXA 1ZAJA 3JU2A 4YVVA 1VR6A 1J10A 2YW3A 5DCBA 3T40A 1MUCA 4MY1A 1REQB 4ZOAA 3EOSA 2Y7EA 2PP1A 1W9VA 1DVJA 2QPXA 1WKFA 4OWGA 3FXYA 2EO7A 2IQDA 9XIMA 3NGJA 5FSEC 3N4FA 4NZFA 3W7IA 4XZNX 4HJWA 3M43A 2XN2A 4E5TA 4O4VA 2O9TA 1T41A 1M7XA 4D8ZA 1VB9A 3MYPA 2V5BA 1YTDA 1BYCA 3LCLA 2FZMA 4HHMA 2HROA 2EPLX 1JAEA 2X41A 3NQVA 2ZKMX 2QF7A 3WQVA 2J6VA 3KBWA 4QLJA 3BE7A 3AZSA 3QHMA 4AIUA 1XBZA 2X1TA 3SSJA 4ZZ9A 3RX3A 3N14A 4RZ4A 2WVVA 3VKKA 1C9DA 4HOZA 5J5RA 2FYMA 2FH6A 4HZ6A 3MA8A 3KOZA 1IT8A 3S3GA 3MV01 2HXUA 2JGYA 2I16A 4Y9PA 4CQDA 1B57A 3UWVA 4P61A 1X7IA 2HE8A 2HSAA 3MSDA 2F2KA 3W2LA 1W2VA 2PAJA 3GAKA 3PBMA 1GZJA 1N8WA 3PWAA 2VOTA 2VX5A 1TWSA 3AMLA 1PCWA 2WBGA 4QISA 1D3CA 2SFPA 1ITXA 1HKJA 1SO6A 3WLSA 2Y8VA 2WV8A 4LUYA 4RK8A 3N2CA 5C7HA 3CL7A 3VGBA 5T91A 4IH3A 3P0WA 3WY1A 2BDQA 3WDQA 3IVUA 4YHGA 3WJZA 3VOFA 3VUSA 2Y70A 3E2RA 2GJRA 5C54A 2FVKA 4FNQA 4I7VA 4MJZA 2HK0A 4DJDD 5F2GA 4E8GA 3TXZA 4UTFA 4E8DA 1PIIA 3EYPA 1TUFA 2A6LA 5C9XA 3MB9A 1B3XA 3PBUA 4O57A 4PE8A 3LHVA 1H5YA 3DEQA 3O06A 1U5JA 4L9XA 4HZMA 1FWCC 4KESA 3WD0A 4W7VA 5BWAA 4D72A 1J9YA 3TTSA 1J8VA 3KVLA 1PAMA 2VHLA 2O9RA 4N4QA 4EX4A 4R27A 2RGLA 3AHXA 1BFNA 1WUFA 4B3LA 3H4GA 1QK2A 2WKJA 3IRSA 2VR5A 3AHVA 1QTWA 1HG3A 1QJWA 4DYJA 2J78A 2NQJA 1SZGA 3EPNA 3KBJA 2GJXB 3M0XA 3QXBA 3W7CA 1VJSA 1DJGA 4U3CA 4WDTA 2W91A 5BOOA 1RZMA 1H1NA 3GFZA 3B40A 3UFYA 3EZ4A 3SADA 1V6VA 3CIWA 2ACSA 2OLAA 1FBAA 3AJXA 3V0SA 4DF2A 3UXLA 4EXQA 1UMLA 5A3HA 3UNDA 4L61A 5A6KA 3NPUA 4AHPA 1FWHC 3SURA 1QI2A 5IDZA 3B9AA 3C86A 3GD6A 4MUPA 3U7VA 1CWYA 1P4CA 3C8NA 3GHUA 1YTEA 3SZ8A 1K8ZA 5IOBA 3QY6A 4UBPC 4N4PA 1KR1A 1OFBA 3HV8A 3MDUA 4HA4A 1SSDA 2WHMA 3ANYA 3KCJA 4BJHA 2ZRXA 4IPLA 3XINA 1VBRA 4IXXA 1KFKA 4ML9A 3GU1A 1WDRA 2GVYA 2AGKA 4A8IA 4XVEA 5DLCA 2EG6A 2XPKA 3BLEA 4E4UA 4B3ZA 5M1TA 1QBAA 4P7LA 4XZLX 1EJVC 3IJLA 4WJXA 4EXBA 5EKYA 5F2MA 3H23A 3QV9A 4UCFA 3TN5A 3SCUA 3G6MA 2X1RA 4XSMA 8XIAA 3M9YA 1TR9A 3KVJA 4K37A 1QHOA 3PZGA 3GNPA 4JIPA 2RJHA 3N18A 3GW3A 3ZFHA 3PB2A 4F0KA 1W9PA 4EK7A 3GR8A 4NJIA 1B90A 4PMZA 1OSEA 3L4WA 3DI0A 4YU1A 2ZOXA 4XKYB 3SY5A 1UA7A 2C3ZA 5HUPA 2VKZG 3O07A 1X7FA 3W71A 5GJPA 4AG0A 4GYKA 2V5DA 3BMXA 2J9YA 3CK5A 4K68A 3T8LA 3TQ0A 2VEMA 1JQXA 3RO8A 3W2KA 4C7DA 4IXHA 2RH9A 4EOUA 2Q6ZA 3CZLA 3VM5A 2YXGA 3PBWA 3KHJA 3LS9A 2ZUWA 4PMDA 2X2GA 1EC9A 4DHGA 5AZ0A 2PI6A 3M0HA 1S46A 1A0CA 2VZOA 5FAJA 3CH9A 2YCLB 1L2UA 3WJXA 2ZX5A 1G01A 4MYAA 1XGZA 2WSKA 4M8UA 1EWEA 3RLHA 4G7EA 3W7MA 1UD2A 3RRAA 1WZLA 3VIPA 1F4AA 2YFOA 3UJ2A 2D3NA 4V1XA 1VFSA 4RL3A 2C0HA 4OE7A 3BGGA 1UBSA 3MHUA 4DWSA 1N8IA 4H6EA 1OJXA 4AC7C 3FX4A 3VUPA 5DCDA 2J47A 3GZAA 1ZUAX 3GH7A 4QTGA 3OIHA 3ONBA 1G4EA 3SCOA 3PS7A 3AIWA 3BVJA 2Q09A 2WHJA 5IXEA 1OCNA 4IWWA 5ENLA 1TIMA 1EUNA 1L9WA 3E2VA 5LIYX 2DIKA 1ISVA 1SO3A 1EO7A 4JN7A 1YNQA 4JY9A 3S5ZA 2CLEA 1E0WA 3REQB 1S2UA 3VMPA 2NXGA 4LC8A 5C8BB 4L1GA 4ZVJA 3R0UA 1MNZA 5J8LA 3NQEA 3TEVA 1BQCA 3W7HA 2HPMA 1K4GA 3L4UA 1GGOA 4R7OA 1VJZA 1DXEA 3A24A 4H9YA 3WLPA 5A8MA 2QAPA 3SO7A 2Y1HA 1SW3A 4P8XA 2FZNA 3ME3A 2V68A 3HG4A 1NH6A 4Q8VA 5I78A 3W84A 4WUIA 3ID7A 3RAOA 1XFCA 2GJNA 4FIQA 5IHRA 4C90A 3ICJA 1KO0A 5BXRA 4JNMA 1E0TA 4KRTA 3WF3A 3AROA 1GOWA 3NZQA 3MV11 3E12A 3SCVA 5I2UA 4CGTA 3GRIA 1I0DA 3SQLA 1TQJA 2BY0A 1OFEA 7REQA 2VUNA 4NX5A 2GJXA 2F84A 1DE5A 2A3BA 4J4KA 2FTWA 1LT7A 3QYQA 4EWJA 4PFMA 1X39A 3F7JA 2J7CA 1P0EA 1Q5MA 4BK9A 3N19B 3TJIA 1M41A 3WQ5A 4FOUA 3GVRA 1GQLA 2PGEA 3BAKA 2ICSA 1BWLA 3JZUA 3POCA 2W27A 4UTJA 2R9RA 1CXKA 4JEQA 4ICNA 4DQWA 1D2KA 3GC5A 3TJLA 4WDXA 1P6BA 4IUGA 3ZVIA 1SFTA 3CL8A 4Z1BA 1G6CA 1ZQ5A 2TRSA 3ELFA 2C1GA 4LQ1A 2HNHA 2OYMA 3IGUA 3KOYA 5EY5A 3ZS4A 2O55A 3L9CA 1DJQA 1IYXA 2WMGA 2CEQA 4GUFA 2PZ0A 1ICPA 2XVGA 3WNKA 4C5YA 1E40A 3SJNA 3IJ7A 2E5CA 4DUVA 1A50A 4KRUA 1E51A 2OG9A 3NO3A 3GLCA 3GTIA 1TELA 2DT1A 4X0VA 1VBUA 1GJWA 2X1UA 2ZUVA 3S2MA 5AYYA 3SDOA 2QGHA 4GNKB 4CLMA 3BSMA 4JCLA 1AH3A 2A3CA 2R6OA 4FMVA 4AWSA 4FLSA 2QJNA 3PK7A 3P61A 3T0BA 1XYFA 2WZTA 1Q4NX 2FDSA 2D2HA 4ZGYA 1FQ0A 2OKOA 1KBKA 4NG3A 4UTIA 5K9XA 1P1XA 4RKAA 4O50A 4JTSA 4BQ2A 2E4TA 4NXSA 3WH6A 3P14A 1R3RA 4XK2A 2XFWA 3EWYA 2Y7GA 4HNNA 3QF0A 3UCDA 5HANA 3G1AA 1NDYA 2XM2A 3VGGA 3WO8A 1XISA 2PLKA 3PC0A 5CPTA 4AVOA 1TPDA 2QCMA 3U4AA 1V3HA 1SYTA 4D6HA 1KV8A 3C3NA 1ZCCA 3W6LA 1ADDA 2A85A 1TSIA 2AAMA 1XX1A 4MHBA 4GHRA 3M64A 3FA4A 1XLBA 2ZDSA 4N9BA 3L21A 4LVBA 1ZBCA 2PRMA 1XBXA 2CERA 3MW7A 2VDHA 1WZAA 1OM0A 3AXMA 1JXKA 1JF6A 4ICMA 3NXFA 3IK4A 4RZ5A 2E5DA 2NX3A 2D2GA 4US6A 5CCZA 3GYCA 3UG8A 3V16A 4U2ZA 3BG3A 4OOUA 1EP1A 4GY1A 5FJUA 4CU8A 4GPNA 5XINA 4IF2A 2F6KA 4WY0B 1CIUA 4LUSB 2JFEX 3PWIA 4HHPA 1TJRA 2RKXA 2PMQA 4R7JA 3ZO9A 2V9DA 3IPWA 3R8RA 3MCNA 3RM4A 5DY2A 5HXMA 1XYMA 2WCGA 3ZWSA 3NPVA 1V03A 4QBXA 1HIZA 3DN5A 5D2XA 3C5QA 4IGSA 2RDUA 3KM8A 1MQPA 3H7VA 4Z42C 3S83A 1DWHM 1IWBA 3OOQA 2Z0IA 3Q65A 1YPIA 4LNYA 1UKOA 1TCMA 4O1EA 4QAIA 3LM7A 2QAFA 1LBMA 4XAZA 1RH9A 2QCEA 2CFFA 2P8BA 3FEQA 4C91A 2FZDA 2V5KA 1XYCA 4O52A 2XH7A 3E74A 2VUYA 3LHUA 3VNIA 4GI8A 3HPXA 4AY7A 3MMWA 1LUCB 2QUVA 2A2IA 4I6KA 1W3KA 3MUCA 4LVAA 3N2OA 1POKA 2VEIA 1V51A 4HTYA 4HNOA 1KWGA 1XC4A 1EZ2A 2XTKA 2EQDA 1UG6A 3CU2A 1EF2A 3CGTA 3B8TA 4A05A 3BXWA 1D8CA 4ILSA 1KBLA 1MUWA 1HJUA 1F61A 1EJUC 4U28A 3LQGA 4AD0A 1S3TC 1W1B1 4JNYA 1C8VA 4FO4A 4ATLA 5AC6A 1GJPA 1ADSA 1WUEA 3HO8A 3WEOA 4KF1A 1UW9A 2ZZ7A 3GG1A 3NQ6A 1OC6A 2R82A 3W27A 4AD2A 4IG2B 3VIFA 3VKBA 4MJMA 4H7ZA 3UT0A 1BD0A 2PTWA 4H8VA 2FMNA 2OMAA 2OOFA 3Q2DA 1JR1A 3D46A 1M03A 1TTQA 5XIMA 2GGHA 3AZRA 4GBUA 3RNDA 4WJ8A 4GRSA 4HYVA 3KBSA 4DYKA 1SFSA 3I3EA 4HSNA 1SR9A 3QTGA 1ZBVA 3OEXA 3W00A 1BSIA 3GWQA 4GQBA 3PAJA 1CGWA 1XHGA 2DVXA 2ZWZA 4H3DA 4QITA 2Q71A 1BG9A 4DBSA 1NARA 3D3FA 3N04A 3ABZA 3DFSA 3W1QA 2ALRA 1PZ3A 3E0WA 2W5FA 5I23A 2WOQA 1SR0A 3R79A 1KKRA 2PWDA 3AS0A 3UW6A 2QPSA 5HNNA 1IR2A 1D9EA 1JCMP 1XSJA 4PBGA 3H2AA 3WX7A 5E0CA 1ITUA 3GNNA 4C1NA 3O6CA 4CNOA 4LUJA 2HWGA 4JTIA 1PJ9A 2P0IA 3WLMA 1XPGA 3WLIA 5CBJA 4G6CA 4OIFA 1PHQA 4ZB5A 1S1RA 1AD1A 4DELA 2HZGA 3NGFA 2ZIDA 1JPKA 4B9YA 1YADA 1JNDA 5LA1A 4LPCA 4HK6A 5C6MA 1G5AA 7CGTA 4Z1YA 4DLMA 1DHKA 3OODA 3QM3A 5BXTA 3REQA 3H55A 3TNBA 2W3ZA 4AWTA 3O6YX 1R3WA 3A4JA 4IMGA 4KGLA 1KGXA 4M0XA 1TPH1 4JS3A 2DVUA 3C0JA 3CPUA 2HBXA 4CD4A 1QVBA 3HQOA 4AXKA 1O60A 3TJ4A 3TMLA 2V2DA 5CQ1A 1Z89A 4XWUA 3VFCA 3SCQA 1CZ1A 1R86A 4AXNA 1FWFC 2LLEA 4CQ9A 5DRIA 4MAVA 4W84A 3HJZA 3CXOA 4H6QA 1F05A 3WMSA 4FALA 3D3AA 8RUCA 3VE7A 3CHCA 3DCPA 6TIMA 2BSLA 3DXIA 5DT7A 1OADA 4ZQNA 1XLDA 3RMJA 2FH8A 1YBQB 2BXYA 3UG4A 1XIGA 2Q8LA 4AF0B 2PDNA 1I4NA 2V5LA 4KT2A 5ECUA 3LMYA 2J66A 4HOWA 3WD4A 2WWCA 4L9YA 4JQ1A 2UWFA 1P0NA 4KFPA 1XIDA 1KM1A 3DG6A 5A6SA 3B8WA 3LZ3A 4ZXLA 6A3HA 2CBUA 3NWRA 5FJRA 3QBUA 4F79A 2FPYA 1UJPA 1FCQA 2XM1A 1PKYA 2PDFA 2FMOA 4PEEA 1J0ZA 2C1IA 4TX6A 4OVXA 2TYSA 3T4WA 4E38A 4HNVA 2EJAA 3BH4A 5M17A 1PZ1A 4GJJA 3MJYA 2Y85A 3TAOA 4H8NA 3BSHA 1QO2A 3FS2A 3LU2A 3HG5A 4W8AA 3M6YA 2V82A 2OQLA 4ZL1A 1R0MA 2E6AA 3IIZA 3W75A 5D9OA 4RNJA 3VX1A 4IZGA 4C7GA 4WOQA 1W17A 1MRQA 1WKEA 2ZZ3A 4WKHA 2G5WA 2Y7FA 1IGSA 1V0KA 1XCWA 4AEFA 2XH0A 3LZ5A 1FA2A 2BP1A 2EAWA 4MSSA 4CQ8A 4QM1A 4AZIA 4NI8A 1GVEA 3AHZA 1LLWA 3VD5A 3HQ1A 4JTTA 1MMFA 2OLSA 1MZRA 3EWCA 3ANVA 1JUKA 4FR6A 2QCFA 4MG4A 2NVCA 3AXIA 4TV6A 4WXZA 3WMCA 3MJMA 5C9WA 5LXXA 3VC5A 5KTLA 3FK4A 5M2FX 3KDNA 1F8MA 2YZ5A 3QN3A 2QVHA 2WWDA 3LGGA 1XUUA 2Q3OA 2QVNA 4DJEA 1Q7QA 4NF7A 1TJ0A 3GK0A 3NQFA 4IGNA 2VEPA 1G69A 5A6TC 2DGAA 3L67A 2FLIA 1VJIA 3P3BA 1C93A 2OTDA 5A5WA 1IR1A 5L9FA 4TMBA 3N9KA 1L6WA 3KL5A 5D02A 5AC4A 5KITA 5D2VA 1R2TA 1E6QM 3GKFA 5FF3A 3S1XA 3O6AA 3FLUA 3CC1A 4LX4A 5HQLA 2NLIA 2WPGA 3BARA 3QV8A 4NAEB 2PF0A 1Y7VA 1LORA 5DY3A 4HPXA 2V38A 3DHUA 1QOQA 4JX6A 2C6QA 3DBNA 4H83A 1ZJAA 4MNKA 3M0MA 1UIOA 3COTA 4UTUA 3ITVA 4H4IA 3E2SA 3LMZA 4DO7A 1CENA 4MNMA 3WH9A 4D8LA 1XH2A 1P0KA 1P0DA 1RAKA 1I2NA 4G56A 2I1OA 4JFVA 1QDSA 1ONXA 3ZT5A 3AALA 3ZOAA 6ALDA 1HZYA 4UTMA 3E0IA 1RCXB 3VZYA 1IEXA 3NQ2A 1V3MA 3SN0A 1JCJA 2HEJA 4ORIA 1NOWA 4JFSA 1XD1A 2QUUA 4GUGA 4B2DA 1EOKA 6CGTA 4ONVA 2PGRA 2YKKA 4IQEA 4PR4A 1CXEA 3L5MA 2GVEA 3N73A 4M82A 3W7RA 5G2IA 4ZR8A 3PPHA 1KFEA 1Z9AA 3GH5A 3K30A 2OT0A 5D09A 1GCYA 2GGEA 3PZUA 4UR8A 1I60A 4RE4A 4LAZA 1E43A 3KWSA 1WDDA 1FVPA 3CLWA 5AN7A 3PTDA 2QJIA 2V63A 4PYSA 4TIMA 4J3SA 3H70A 2A3HA 7PTDA 1G4PA 3L68A 2QDHA 2BOFX 3LX9A 1XKJA 4DJFD 1QPNA 2QLYA 3M0IA 2NWSA 3B05A 1J6PA 2EG7A 3H12A 4QEHA 4WF7A 1WXJA 4C6NA 4FHAA 4QJ3B 3WEZA 5I3KA 5G1YA 2G3MA 1YLVA 4XZWA 3EEZA 3I6RA 3ERPA 3TWAA 2F61A 1OFAA 3HFYA 3LI1A 3L5AA 1R38A 4KWSA 4PTWA 4QEEA 3LRMA 4Q7BA 4X2PA 4FX7A 1XXXA 3F5JA 2GJPA 2XFFA 3QOMA 1V0NA 4YIWA 3R0DA 2ZZ1A 4UC5A 4MNLA 2CBJA 2QCHA 3LENA 4UXDA 5HINA 1OD0A 3BLLA 2GGGA 3ARRA 1WOAA 2VCAA 4LS2A 3UZWA 1G7UA 4MUZA 4LCRA 1HKWA 4KS0A 3GNDA 3N3TA 4IT1A 3OGSA 4D6GA 3G1RA 1OG0A 6REQA 5DQPA 4LV4A 3SCTA 1L6YA 2JF7A 3I4EA 5I09A 3HBLA 2XZ9A 2VZUA 3L2LA 4KIRA 3HQPA 3VK5A 3S1GA 1PTGA 1NVMA 3LTPA 3DC0A 2AOSA 3G8EA 2P3EA 4LGXA 3UCCA 3MUIA 5A6AA 3W7GA 4JQ2A 1GK8A 1EJWC 1VS1A 1F9CA 2NQHA 4XBJA 1VP5A 2PODA 2X7VA 1CX9A 2WQPA 4M6UA 3RR4A 4YTUA 4JX4A 1OGBA 1OIFA 4UMCA 1SW7A 4QIUA 5ABEA 3KRSA 3PBYA 1E1CB 1CLXA 1GYMA 3MUZ1 3PZ9A 4IMAA 5AHMA 1E0XA 1R47A 4XIAA 3V7PA 4M7TA 2J9ZA 1ITCA 2W66A 3FJNA 1V6XA 3XIMA 2XSBA 1EF3A 4N6EA 1YW1A 2VRQA 1F76A 2F9RA 9CGTA 4HQVA 4NU7A 4WSJA 2NQ9A 4GLEA 1WQ5A 1OY0A 4HA3A 1UZ1A 3CZEA 3TWBA 4GNVA 3NIYA 3M41A 1NP2A 4Q33A 2ZUUA 4XKMA 2J62A 4Q4KA 1S5MA 2I56A 3IARA 5HULA 1J0KA 2ZC8A 3UEQA 3CM4A 3N3MA 1VFUA 4AF0A 3BJSA 3DGRA 2VCCA 4GK8A 1R9YA 1JCNA 3ATYA 1QAPA 3PJXA 1PKMA 2B81A 1G0CA 3MSGA 1R46A 4DN1A 2XGIA 3D0CA 2J8FA 5CC7A 1R7OA 2C0AA 4XG1A 2EJ1A 3DAQA 4IL0A 4FK9A 5T8GA 3NFUA 1VBHA 1XSIA 5BRPA 3M5YA 1TMHA 2WSQA 2A3LA 1XIHA 3TYEA 1TMQA 2P53A 3ES7A 5HWJA 3SRDA 3LLXA 3L12A 4KWWA 1F6PA 4JQ3A 5CJMA 2BV9A 2XVNA 4MFDA 4FPSA 1HJXA 3VNDA 3NG3A 3I3BA 4FX8A 4X63A 2YOCA 3WBYA 3A5FA 3QZ6A 2NQZA 3PZQA 5A6LA 2E9LA 3AHTA 1UR4A 4GFIA 4XSLA 1SSGA 1GHSA 4XZIA 1MEIA 3R8GA 1OCBA 2ASHA 1CXFA 1X6LA 4IPJA 5EYWA 6TAAA 1B2YA 5FF0A 2WK2A 4DZHA 3OJGA 3LSCA 4DAIA 4GI4A 4TOQA 2Y5JA 2PRHA 1TA3B 1V3JA 3CWHA 3GHTA 3S6TA 5F1UA 3HIJA 3NL6A 4WD0A 5DMLA 4TX8A 2WYSA 4Q8TA 4BCEA 2PUZA 3N9RA 3OQEA 3PG9A 3H8AA 4OGZA 6PTDA 2CHRA 2INEA 1CT5A 3NCOA 5HAOA 2HDJA 4JYDA 3UWZA 3WDPP 3WSUA 3BW2A 2WCSA 3ZR4A 3K13A 1LZOA 2ZUMA 1FWDC 4L65A 5F4WA 1QBBA 1HJWA 3AXKA 3FJ4A 4YTTA 1SZNA 4G9PA 2OQHA 1W9XA 1VFOA 2PDYA 3STPA 4D6EA 3VIOA 5JBFA 3A6OA 4FIRA 3W1LA 1I2RA 1PL9A 4NNAA 1CCWB 3B04A 3GFXA 4RE2A 3BLDA 4BKNA 2A4AA 3ONCA 3MWCA 4IIHA 5I79A 2O56A 3DFQA 3IIVA 2A6NA 3M0JA 4NT0A 4L4PA 4LOCA 2A1YA 4LUTB 1TRIA 3FDGA 4FNPA 4UNIA 3W1TA 4CD8A 3CQHA 4C6IA 4GH3A 4LYRA 1OYBA 4BF7A 1UP2A 1ZJIA 1TFVA 3MI3A 1JD9A 3VCCA 3KTXA 2POTA 4S2BA 4WEVX 1UR0A 2GJLA 3WLQA 5LYRA 4W93A 3PPFA 2VX6A 4DM2A 5LNVA 3FKKA 3VU2A 3AYSA 1OCQA 5DBUA 4JTHA 1WP6A 4R88A 4ZQRA 2X8RA 4ZTYA 1EIXA 5KZDA 1OINA 2QJMA 1FH9A 3DBPA 4RV3A 1ONEA 1UR2A 4BI7A 1X6UA 3LSBA 4KWUA 2CKRA 1XLGA 3ZIZA 4Z1CA 3G22A 3M7WA 2AL2B 5AC8A 2BX7A 3GXDA 3C2RA 1WXZA 3LCXA 3WF4A 1LOLA 3OZYA 4RE0A 4TVCA 1S2VA 3M16A 3NDOA 4JTLA 3TTYA 1RCQA 3O3RA 2AL2A 4Z0JA 4FLQA 2J7GA 4HMDA 3EA2A 1JG9A 1H2JA 1VH7A 1W8SA 2L5HA 2VMFA 3UVAA 4O18A 9RUBA 2XYLA 2DZPA 4WKFA 1KFWA 1NFPA 4PODA 4DRSA 3NM1A 3MWAA 3VOIA 1ZZMA 2WZMA 2EBNA 4M1BA 1LROA 5IM51 2HTMA 1K9TA 3I10A 4QE5A 3II1A 3BMVA 4FOJA 3G1YA 1ZP3A 4MM1A 3G1SA 3QZAA 5A6JA 4EAYA 4CEUC 4Q8OA 3UJRA 2ZZ4A 3C3UA 3B9OA 3E5PA 3EKZA 5I3IA 1AQFA 4JY8A 1QCWA 1EKOA 3O0KA 3U7BA 4N0RA 1TWDA 3WF1A 3E3HA 4RNIA 1QASA 1S5NA 4JPGA 4A8RA 3IJ6A 3TYAA 3UZ5A 2WAGA 1JEZA 3VOGA 1E4NA 1FH7A 3VABA 1CPUA 5K9CA 3B0XA 3HM7A 4LRTA 3WNPA 3MZ2A 4N6FA 4K7YA 3HA1A 2C15A 1QW8A 4IG2A 2FZ8A 2E77A 3WQGA 3E0VA 4ERGA 4OZOA 4KMQA 1HX0A 3S1WA 4NXKA 4NIRA 2J7FA 2PC8A 3TAKA 1MVYA 3S5SA 3QQWA 3ARQA 4H01A 4JBRA 2RGMA 2WKGA 1Q6CA 3GC2A 4Q8WA 4GUIA 2H3BA 4PMXA 2XGBA 2GUUA 3VIGA 2JKPA 4UTWA 4CD7A 3RN6A 1HVQA 4YS1A 4JX5A 2DZUA 1UPMB 4TQTA 5HNUA 5H8UA 3PZMA 2Z28A 4EPDC 3SUUA 3N25A 5DT5A 1RBLA 4LXFA 5A94A 2B4GA 4A3YA 2PD5A 1LUCA 3NEHA 1MEHA 1MI3A 1JZ8A 2PDQA 4KCVA 1W1YA 1HN1A 3UXDA 3DG7A 3SFWA 3LNPA 4RUBA 1XDJA 3GX9A 3GSMA 3AZTA 2PS2A 5AB3A 4HU8A 1QI3A 1AW2A 1HW6A 4S2CA 3WFAA 4RX0A 3MKVA 4OFCA 1ZFJA 2BVDA 1OC5A 2MNRA 4HU4A 4J5NA 2REQB 1HKIA 5EMMA 1NTHA 3B4YA 4NAEA 2W79A 1H7WA 1SFJA 1EJRC 5IBXA 4KKXA 2ZICA 4US5A 3UETA 3A5VA 3PTKA 4XUYA 2PSNA 1J93A 2A7NA 4ACYA 4ZSTA 3O9NA 1T99A 3DH7A 1KW1A 4QE1A 3WLRA 1ITQA 2W61A 3STEA 3T05A 1E9ZB 4TXEA 3GXPA 4UQCA 2EPOA 4O54A 5HMFA 1R7AA 4GXPA 4R9OA 4HIBA 3TQPA 1OK6A 3OVPA 3TCSA 3DENA 3M1ZA 3TV8A 2D69A 4ZODA 2FHCA 3M7SA 2FGBA 3T55A 3MCOA 2PDWA 3KAOA 3W2MA 1GWJA 3FJ6A 2V5CA 4H8UA 4L4LA 3LV6A 2Y24A 5IFPA 2XIBA 4KPLA 4AWUA 1W9DM 4ROQA 1MZHA 2V3EA 5GNZA 2PWVA 4DI9A 1W37A 4GD0A 4AW7A 3RITA 1KFJA 4QJ1A 1PBGA 3IRDA 4W7UA 1S2AA 1DYSA 2VVNA 4RCXA 3F2DA 4ERIA 2GK1A 2VC9A 1AD4A 2BLEA 4ZO9A 4XIMA 4IIBA 5C5YA 3H2MA 4HOXA 3P93A 3MMUA 3S6OA 4MY9A 1E1EA 3BJFA 3DYPA 3CMFA 3I6EA 2G3JA 5JH1A 1UP3A 1XRVA 2GVLA 1XINA 5E1QA 3EDEA 3PAOA 5JMUA 1Q2RA 3U5UA 2DORA 3CYJA 5A2CA 5BMWA 3EEGA 1D8WA 4AIBA 1RK6A 3S1VA 1EDGA 3VGHA 2G0WA 1E4MM 1F7BA 1KBIA 1B9BA 1O68A 4D71A 1IXNA 3TK7A 3PJWA 1I6NA 3EXRA 3W6YA 1DWIM 3D5HA 1BPLB 4B5UA 3NVTA 2JF6A 5AECA 1L0PA 4GISA 4CD5A 5I0DA 3MP5A 5D4YA 3H26A 1PHWA 3V4BA 1PV8A 2G41A 2C71A 1G94A 3SGZA 1KXVA 2YW4A 2Z2AA 4IL2A 3WLHA 3E5BA 3EWXA 3CQIA 1V0MA 3W1NA 1WO2A 1VENA 2EPKX 4DUXA 3PPCA 1MSSA 2INFA 2WSPA 1RCOB 4PN2A 1FX6A 1JI2A 3CASA 4Q4MA 1PWMA 5DRCA 4IISA 5A1AA 3GNRA 2HXTA 1LL6A 1UH3A 2AKZA 4WIWA 2E67A 3ITYA 4N7QA 4I3GA 2Z2UA 4A4AA 4GIRA 1QMLA 3W7EA 1TREA 4AMCA 1PUDA 4K8GA 1KLZA 3PBGA 5FEWA 1GYNA 3N2TA 2ZXAA 1U5HA 4R7WA 1BXBA 3TYUA 2WCAA 1REQA 3VOJA 3I65A 5CPMA 3K5XA 1SZFA 2BVTA 3UA3A 2OX4A 4WVXA 4R53A 3ABOA 2CW6A 1FUYA 2DFAA 1E6SM 3LQLA 3GKAA 5JQ9A 4PUJA 3SM0A 4UQBA 1GUVA 1HFBA 4O1BA 1YNYA 1NP0A 3EDKA 3O1NA 1XLIA 4ZENA 2J77A 5FACA 3TQKA 4GGBA 2REQA 4NVTA 4HT3A 1AZ1A 1S5VA 4DB7A 3N15A 1DXFA 3RM9A 1BWKA 1JYNA 1A5LC 2QEZA 1FP9A 3B8SA 3TUUA 3DUGA 3NDYA 5CSUA 3QHOA 4YWSA 1GVFA 1RA0A 4QNEA 2Z2BA 2QCDA 1WBJA 2GSEA 4UQAA 1GOKA 1EFZA 3S5YA 1VZWA 1DIOA 3I4KA 2X1SA 4NX0A 3CUFA 5KETA 4Y8FA 1E73M 3SCSA 3V36A 1XYLA 3AS3A 1R30A 2J7DA 3MMTA 4I5UA 1VIZA 4JTJA 1I1XA 5HATA 1ZAHA 2QNEA 2HVOA 3KOWA 2GL5A 2EKGA 3CHEA 1R87A 1X8CA 3GB6A 3W87A 3AJ7A 4H8HA 3QPZA 1FCUA 4Z2GA 2ACUA 5EBAA 1EDTA 1WPCA 1Q7ZA 3FDKA 4ATWA 3Q45A 4JTGA 3NZGA 4B15A 5U4NA 3BJTA 5BROA 1KWKA 4UOZA 3CHDA 4XX6A 5ECVA 5CLTA 4Q8NA 4PMOA 4ZB2A 3RIKA 3BICA 1CXIA 1E9IA 2YGYA 4MFEA 3AMGA 2VWSA 4O4WA 4L4OA 2E1WA 4GY7A 1R3YA 1NWTA 4ORMA 3V35A 2O7QA 2PCQA 4S3BA 3WQDA 4D6DA 1NEYA 3BMWA 5HA7A 1UJQA 1TJ1A 4QXIA 3BOLA 1K03A 1BVWA 3EDJA 4K1GA 3GY1A 1OB0A 1OYCA 4E3TA 2OWWA 3P62A 3SN1A 4UZSA 4DJDA 1XYAA 5BNKA 1JXJA 3FCPA 5K4ZA 2AGTA 3H7UA 3WQWA 4BS0A 4FZIA 1NU5A 3ZT6A 3PNZA 1EZWA 3KXQA 1VFLA 3GQYA 1UASA 3M46A 3W07A 4NZ1A 1KCXA 2CZEA 4DXXA 4URIA 1KCKA 3SUSA 1W1IE 1KRAC 1NFGA 1OEPA 5BOEA 2FQIA 4CN6A 3IIOA 4GXWA 4JQ4A 4AYGA 3S2LA 3UERA 5LA0A 4P8VA 3TNOA 3C56A 5CC6A 1J2BA 1JCTA 2JALA 4W8BA 1TB3A 2G96A 4MOZA 4EP8C 3PZNA 3VXGA 2PP0A 3VVGA 4PZVA 1O4UA 3HF3A 1YIXA 1UR3M 3ECQA 3PPGA 4REQA 4Y9NA 3VD4A 3S2CA 4B91A 4PUDA 2XJ7A 4PUUA 1BXCA 2RAGA 2WNQA 3U2EA 3BZJA 1XV8A 3G2GA 3TR2A 3TA6A 1T0OA 5HR6A 4RPQA 4MY8A 5FJOA 3WLOA 3QSRA 2PEVA 1H0GA 2V67A 1VLIA 1HJSA 2DT3A 1PX3A 4LB4A 4NNBA 3EB3A 5HMSA 4FLOA 4CNUA 2OZ8A 4HB7A 4ADTA 1AJ0A 3H21A 1CB2A 4BA0A 3QHNA 1ZBWA 1ADOA 3R0KA 2QDGA 1ZL1A 5C2XA 3TC6A 1JI1A 1D7KA 1H3GA 1MXSA 3WH8A 2YSWA 4PCTA 4A3HA 3QZEA 5BW6A 1XIBA 3HGJA 4WXYA 1RXOB 3SRHA 4HA0A 1H63A 2ZZ5A 3FGCA 2V81A 4LH8A 2I14A 3FN9A 3OZOA 3W88A 2FTYA 1JCLA 5CKSA 4GX9A 4IP4A 3LM3A 2HVMA 1W9UA 1K7XA 4DJDC 1K6WA 2CXEA 1RK5A 2PPGA 3SN4A 3AIEA 2BVWA 1C8YA 3UXAA 2NQLA 3BL3A 3ITOA 3CT7A 5AOUA 5CH9A 4OQVA 1CTNA 4N42A 5A8GA 1TTIA 1FWRA 1VFMA 2R1KA 4YYCA 2VEKA 4U10A 3UR5A 4PCNA 3UYIA 4HZ8A 5CAHA 4KRZA 4XD6A 1I2OA 1MQQA 4IFKA 2VDIA 3U2CA 3BWWA 2HRWA 3WD3A 2YL8A 4U5IA 2I9EA 1E5JA 2CNCA 3TIMA 1BRLA 1DKWA 1TPWA 1T7LA 4C6PA 5EU9A 2RJGA 3LCFA 4PH6A 5EA9A 4R3UA 3CHFA 2A0NA 1LG2A 3OHIA 4MZ8A 3LCIA 1V79A 4TR9A 2R1MA 4HCLA 5GJMA 2E09A 2CLPA 3KP0A 3P81A 2W6RA 2CXGA 2PBOA 1J0JA 1F8IA 1EOMA 1PX4A 9XIAA 3WLLA 3FJLA 4F0MA 4C5ZA 3FSTA 2FFIA 2R1LA 4DBEA 1LRQA 4JHZA 4GYFA 3LV5A 2TMDA 2ZX9A 2YX0A 3UWQA 5AZ1A 4IMDA 2Y8KA 5EMJA 1PSCA 1V6WA 4NZJA 3RLUA 3RPTA 1GZGA 3THUA 3BV7A 1SMAA 2OOGA 1PDZA 3WUEA 1L2QA 2QUTA 3CB8A 2WC7A 3GR7A 2DJLA 5DFAA 1RD6A 3SW6A 2GK1B 3PWGA 2PU0A 4IQJA 1SMDA 1LCOA 2QXWA 4LYKA 4YNGA 3NSNA 4A22A 1LTDA 4EACA 4NY2A 1MXDA 2ISFA 3NXLA 3URBA 1E0UA 5HR7A 1DQWA 2ZE3A 1KA9F