3M0KA

Structure of oxaloacetate acetylhydrolase in complex with the product oxalate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
294
structure length
289
Chain Sequence
b'DEPFSGAKKLRHLLENTDELIVCPGVYDGLSARTAMELGFKSLYMTGAGTTASRLGQPDLAIAQLHDMRDNADMIANLDPFGPPLIADMDTGYGGPIMVARTVEHYIRSGVAGAHLEDQILTKRCKKVVSRDEYLVRIRAAVATKRRLRSDFVLIARTDALQSLGYEECIERLRAARDEGADVGLLEGFRSKEQAAAAVAALAPWPLLLNSVENGHSPLITVEEAKAMGFRIMIFSFATLAPAYAAIRETLVRLRDHGVVGTPDGITPVRLFEVCGLQDAMEVDNGAGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxaloacetate acetylhydrolase
publication title Structure of oxalacetate acetylhydrolase, a virulence factor of the chestnut blight fungus.
pubmed doi rcsb
source organism Cryphonectria parasitica
molecule tags Hydrolase
total genus 109
structure length 289
sequence length 294
ec nomenclature ec 3.7.1.1: Oxaloacetase.
pdb deposition date 2010-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3m0kA00
3OQ8A 3FA4A 1F3WA 4QGCA 3M0JA 2VGIA 3GR4A 1Z6KA 1M1BA 2HWGA 3HQOA 1AQFA 1PKYA 4RPPA 3P0XA 3OYXA 2DUAA 4HYWA 4MG4A 2HJPA 3OYZA 1S2VA 3EOLA 3H6OA 3U2ZA 2E28A 3EOEA 1PKMA 1PKLA 3SRHA 2QIWA 4IQEA 4KRZA 3EZ4A 4KCWA 3QQWA 4B5SA 1T5AA 3BJFA 3PUGA 1KBLA 1A5UA 3T05A 3T07A 1O66A 1PKNA 1F61A 4WJ8A 1E0UA 3MA8A 3N25A 2KX9A 4B5WA 3LYEA 4ROQA 3VAVA 3GQYA 4L7ZA 3KTXA 5JVLA 1O5QA 1A3XA 3B8IA 4QG8A 2ZE3A 3SRKA 3G2GA 4QG6A 1IGWA 4FXJA 4B5TA 1VBHA 1U5HA 1DXEA 4HYVA 2HRWA 4L9ZA 4KS0A 2VWTA 1F3XA 1E0TA 4G1NA 3EOOA 3E0VA 2OLSA 3QV7A 1JDEA 3IS4A 3QV8A 3QLLA 2VWSA 1DXFA 1F8IA 3I4EA 4QG9A 1SGJA 1DQUA 1XG3A 3E0WA 1OQFA 1ZJHA 3E5BA 4IP7A 4TV6A 3SRFA 2HROA 1S2TA 3LG3A 1VBGA 4JPGA 1M3UA 4MF4A 4IMAA 1GGOA 4B5VA 1S2WA 1OY0A 3ME3A 3QZ6A 2VGBA 1A49A 3KHDA 1UJQA 4KCUA 3PP7A 3QV9A 1F8MA 1S2UA 1U5VA 2BG5A 2XZ7A 3QV6A 2WQDA 4LSBA 4L9YA 2V5JA 2L5HA 3T0TA 2R82A 3M0KA 2DIKA 2XZ9A 4YJ5A 3HQPA 2XDFA 3R4IA 3SRDA 4TV5A 4B5XA 1KC7A 3GG8A 2VGGA 4KCTA 4YNGA 4B2DA 1PYMA 4DRSA 3QTGA 4B5UA 4KCVA 3FA3A 2X0SA 1XG4A 1DIKA 4B2DD 1O68A 3HQNA 4L80A 3BJTA 5TAOA 2V5KA 4FXFA 2G50A 1MUMA 2VGFA 1A3WA 1ZLPA 1IZCA 4IQDA
chains in the Genus database with same CATH superfamily
2VEMA 4NY2A 1JCYA 3CIWA 4IPJA 4HU0A 3TX9A 1HX0A 1ML1A 4NASA 4FSAA 3DECA 3C8NA 4NAEB 1MO0A 3RU8X 2VMFA 3U2ZA 3WJZA 5A8OA 5CC3A 3QR3A 4OGZA 5KTLA 2TYSA 3RITA 1PJ9A 3GG7A 3IVTA 2VC7A 5G4HC 4GRSA 2QCDA 4PMZA 2QT3A 1XIGA 4XUGA 3EEGA 2ZX8A 4QE1A 3GVWA 4YTSA 4GHRA 3VD7A 4ZBCA 4U28A 2V8ZA 4U3CA 3BGGA 3RGTA 3WD3A 1T6MA 4GC3A 4U5IA 1Z44A 3GW3A 1H11A 3UG8A 3ATYA 1JJKA 1P48A 1VIWA 1S46A 4IP7A 1HP4A 1U1JA 5BW6A 3PBWA 5L9FA 2CLPA 3U5UA 2PWVA 2FPYA 1J0KA 5FJRA 3LI1A 2G95A 5LIYX 2PTWA 2D73A 4LVAA 1DTNA 1FDJA 1R3WA 4M0XA 2GWNA 4X60A 2PWEA 1KLZA 2OZTA 3PZIA 2CZDA 3BWWA 2PBGA 2GQ9A 1M6JA 1EZWA 1GVQA 2PP0A 3M9YA 1OC5A 3TSMA 3W1XA 3U2EA 3S1WA 5LNRA 3B06A 3IJ7A 5E6ZA 3GNOA 3BW3A 3E2VA 1QRQA 2DUAA 3APGA 4ML9A 3IJ6A 1LRQA 1KR0A 1V51A 2P53A 4L61A 1JUKA 4QITA 2DFAA 4UOQA 3S1UA 4ZCWA 3NL2A 3UPWA 2UV8G 5D9MA 1ITQA 3AU2A 1NY1A 4UNKA 2XPKA 3P81A 2A3BA 1NQKA 4D6HA 3B0XA 3QZEA 3E2SA 4GI8A 2CIPA 4HD5A 1OK4A 4OV9A 2CZ5A 4G1NA 2E7FA 2C16A 1XLGA 4MIMA 3IARA 1MWOA 1PZ2A 3P0WA 4AWUA 3E5BA 2B7NA 3B0YA 3NQMA 4O16A 2OKOA 4HOZA 5F4XA 1H5YA 3TSBA 1JFXA 4S3DA 1QBBA 5D04C 2QUVA 5CSYA 1QOQA 1HVQA 4NJHA 4CD8A 4R9OA 3L4UA 5C9XA 3FSTA 4PZVA 3ZLFA 3UWUA 3V35A 2DZVA 4AMCA 2V2DA 3TNOA 2KZHA 4Z0JA 1OFPA 1N2VA 3KS5A 3WJWA 4I90A 1ZHAA 2QR6A 3E0LA 3O0KA 3UY7A 2NT1A 1BWVA 2F84A 3E1F1 2W91A 4D8ZA 4QNEA 5LA0A 5REQB 5KEZA 1JZ6A 3NQDA 3V4BA 3C2RA 4CD7A 1YEYA 1PX8A 3AMDA 3PB2A 1RUSA 1W5MA 4WX2A 2KAUC 4IGSA 3MP4A 3FEQA 2NQ5A 3CPUA 4HHHA 3C61A 3WDJA 4GQRA 3HJZA 1CYGA 1KFJA 5AC4A 3VI2A 4NAFA 3F03K 5C54A 2OYMA 1V3MA 1ZZMA 1TWDA 1U5HA 3EDDA 1NF7A 3WQVA 5K3VA 3MANA 4XWUA 1S5MA 4MZYA 1X1ZA 2Y5JA 1WUEA 4OT7A 1TZ9A 1G9HA 2CLMA 1YYAA 4TUFA 1XRVA 2QUTA 3VYLA 1UW9A 5H8PA 4CQBA 5K4ZA 1CX9A 1WX0A 3PZNA 1OD0A 3TN3A 4LALA 4XKYA 3IVUA 3UVIA 2FZDA 3WQFA 4R53A 4DZ5A 2OEKA 2ZZ7A 2V68A 2QGHA 3ARWA 5HXMA 1EXPA 3GDBA 3K1GA 4P7QA 1SFSA 1FWBC 2CETA 4H83A 4G5DA 4I9AA 3VD9A 4B90A 4HZ6A 3QFWA 1BYAA 4GUHA 3IEBA 5GNXA 4YMZA 1D7FA 5HMSA 3M4HA 2F6XA 3W9ZA 3WELA 5DBTA 2IS7A 3W7QA 7A3HA 4Q7IA 3UD6A 3EBVA 3CUFA 2PDQA 1Y65A 4U4MA 2J8FA 3R43A 4OFCA 3WMSA 2PFHA 3OGVA 5LHFA 1XR2A 2E28A 1THFD 1I0BA 5C9RA 3I3DA 4H6RA 4CD6A 3M5YA 4CN1A 1GJWA 4JGDA 3W00A 4X63A 5EPDA 1F2JA 1CPUA 1EHNA 2FB2A 4HSOA 4OZOA 3GTFA 1JD7A 3PNZA 4K68A 4ZTYA 3K4DA 1JCXA 3E74A 1UMYA 1BXBA 2D22A 2EAWA 1JYNA 5I7GA 1OFAA 1XD0A 1WAUA 3G1RA 3SW6A 1B3OA 1EGMA 1JCNA 2JBMA 3ITGA 4AEOA 3IGSA 3AIBA 3GX9A 4E3TA 5HJLA 4PMRA 2CLFA 4EPDC 1BF2A 3FIGA 2YA2A 4WSKA 3SGGA 4ZA0A 6TIMA 5CKSA 1W3KA 4H04A 1PIIA 4U33A 1YE6A 2QMJA 1O4UA 2YL8A 4HKPA 4NAEA 4EOUA 4QJ4B 2J78A 1F9CA 3AMLA 2Z1VA 1HKIA 3N6QA 2V5KA 3KDNA 3ANUA 2YW4A 3OW1A 5JBEA 4FNUA 1I2NA 4F8XA 3PJXA 3M0VA 4G9PA 1B4EA 4JHOA 1M68A 4YXGA 1E0VA 2GYIA 5U7SA 3RCNA 1CDGA 1KM5A 1TO3A 4NZFA 3QGAC 3IK4A 3GDRA 1E3XA 2D3NA 2E9MA 1XHGA 3WQCA 1ZCCA 4IHCA 3BCDA 1ZY9A 3DCPA 4IP5A 3RRXA 1XUZA 6A3HA 1KBBA 3U7BA 3BAKA 4H7VA 1UCWA 3COTA 3IAQA 5TNVA 3SZ8A 3MUZ1 1C3FA 4C5YA 3SADA 1EA9C 3GXDA 4XUYA 3PULA 3BGJA 3QSTA 2R14A 1CGTA 1R9XA 2ANUA 4FOUA 3WL0A 4ZXLA 4DZIA 2XISA 3T55A 3DGBA 1FKXA 1QK0A 2Z2AA 5E09A 3DC0A 2R1LA 4TX6A 1M7OA 1E6XM 2P3EA 4XB3A 1V6YA 3V18A 3N14A 4CEXC 7REQB 3UBPC 1DJXA 1NDZA 3C0JA 3MW7A 4BI6A 4M6UA 2VQTA 2YYTA 3HQNA 3QEZA 2XVGA 2FZ8A 1HKWA 4GPNA 4MGGA 3GTXA 1U5JA 3V36A 4M6VA 4KQNA 4CEUC 1D3GA 3ZT6A 4GXPA 2NXGA 2YDAA 2CU0A 2ZRXA 3HMCA 4QTGA 2I56A 1TJ1A 1Q13A 2Q71A 1TZ7A 1XKYA 4IPIA 1DWFM 4W87A 3MMUA 4O8RA 1FHLA 4LXFA 4O14A 5C70A 4F4RA 3HG4A 4C65A 3RM4A 2Z2BA 1K9EA 5FESA 1B3WA 3R2GA 4E8GA 3UG3A 3TZFA 1GTHA 1IIHA 1EKOA 4GIYA 3NM3A 4NRSA 4DPPA 3SR7A 3OP2A 3ZZ1A 3FOKA 3RILA 1TTPA 2QJGA 1SMAA 1UR3M 1EX5A 2BDQA 5M03A 1B5TA 2QIIA 3EWZA 2YBUA 3BAWA 3QR0A 1BWLA 2QPSA 4Q4OA 1RP8A 4JPGA 5I23A 1XQKA 2QMKA 2I57A 3PS7A 1QHZA 2DZUA 4AVOA 4QQUA 4PEEA 4KF1A 3CWNA 2X7VA 3RJXA 3UG4A 1D8WA 1XDLA 1AL8A 1XYBA 4LSBA 3R10A 7CGTA 5CLWA 1OADA 2ISVA 1DP0A 2EPHA 3QHOA 4YJ5A 1W91A 3P67A 3UCDA 1TX2A 4PCSA 4IFOA 4X0NA 3VKCA 1LYXA 3TLQA 1UB3A 5REQA 4RCXA 2CLOA 1VCVA 1KXVA 2PUZA 5IDZA 3C2VA 2NX9A 3VDBA 3PJWA 2Z26A 3DU0A 4IGHA 1BVNP 4JYFA 5FAJA 4HPXA 3FW6A 3BSMA 2HVOA 2VC5A 1ALDA 2DQWA 4O0ZA 4S3CA 5D4YA 3ZLGA 3H4GA 3GO2A 4GE8A 3RPDA 2PDGA 3NR0A 4Y9OA 1IEXA 2A3HA 1JGMA 3ZFHA 1UWQA 4WJXA 1VS1A 5EFDA 3AMGA 3XIMA 1JEZA 3A9IA 3MPGA 1HKJA 3W7JA 4YVXA 4DXVA 5C7VA 3DOPA 3DAQA 3C6CA 3KTCA 3DFSA 2VWSA 4YTTA 4ADUA 3SBFA 4GI9A 1GQLA 1FHVA 4BI7A 2QCMA 3CJPA 1JZ8A 2GDUA 1HL8A 5LNWA 2INFA 2PCQA 5M1TA 3S6OA 2CLIA 3WLHA 2YCIX 1PIFA 1GHSA 3NL3A 1R0MA 4GINA 1A80A 3IRDA 2OMAA 1QCWA 1XLLA 4FEZA 1VRDA 4ORMA 2BY0A 3L9CA 3F7JA 4GY7A 1DIOA 1U30A 4P2VA 5CBBA 1XSJA 3EXSA 4G2DA 3LY0A 1Y5XA 1KO0A 4NI3A 2J24A 1I0DA 1UIPA 3Q4DA 1EJ7L 4AIOA 5H8MA 1Q6OA 3CM4A 5G1MA 5JQ9A 3KBNA 4JIQA 2I5IA 3B04A 4ZODA 4JR5A 1QTWA 4A8NA 3AMKA 3HQOA 1TMLA 3WO8A 1W31A 4JFSA 2WBKA 3RCYA 3T0CA 4WXYA 3DG3A 3D3AA 2Z29A 3QY8A 3GNDA 3LHVA 3PZOA 2C8NA 2YBVA 3OEXA 2YGYA 3LLDA 3KFTA 1UKOA 4I8DA 2NWRA 4RXFA 1XYMA 5SWUA 1F74A 4W5ZA 2DY3A 4UIOA 2FYMA 5LNUA 1RJQA 4XZBA 1UWIA 3LGGA 1E1CB 4A05A 4AEEA 4JYDA 1XP3A 3AIQA 3RUBL 3AIEA 5LNVA 3H2NA 3B05A 1ZUAX 3W28A 4XAGA 4BY3A 1XBXA 1U33A 3CT2A 1AD1A 2WC3A 1S2CA 4CN6A 1C91A 2JF6A 1NM9A 1GTEA 1W0MA 1P0DA 3P5YA 1W2VA 2OOGA 4FX6M 2HTMA 1P0BA 3NFUA 5FF2A 2WVSA 4C7DA 1EHAA 3AHTA 2BXYA 4DBSA 4EWND 3KOXA 3GY1A 3CWOX 3CHFA 1EEPA 3PNUA 3THAA 5I78A 1SZGA 2NLYA 3NUKA 1HF6A 3PK7A 4EWJA 1W9PA 4AYGA 3VC6A 3A9BA 1MI3A 3W23A 2NSXA 4BEQA 3MHUA 4JTJA 1TJRA 3P0XA 1GNXA 2BB0A 1M9HA 1F4AA 1X38A 1K02A 1KR1A 3CV2A 4WQ6A 3DKJA 4QFUA 5DMYA 3PBVA 4Z2GA 4KRZA 2XSAA 4UUIA 3TC6A 4LUSB 4JDYA 4MNLA 3VGFA 1YMYA 3MKVA 5BZAA 1RXOB 4JNYA 3GKAA 2XVKA 2OSXA 1P7TB 2YW3A 5ABFB 4V2XA 3N3MA 5IHRA 4IMCA 1DXEA 4BCEA 1E72M 1CXFA 2WC7A 1FDYA 4EKJA 3V1HA 5DMMA 4D9PA 4S38A 3WQ8A 7REQA 1TV4A 2VD9A 1UWUA 1Y5VA 3PPCA 1ISXA 2YFOA 3R0KA 1RP9A 2PTYA 2I9UA 3TAOA 2PODA 1IT0A 4LGXA 4Q33A 5K9DA 4IPNB 5H6HA 2R82A 3EWWA 4XK2A 3HQPA 3S1GA 4P7LA 4HIBA 3H12A 3GG8A 3JU2A 1FWFC 1CECA 1J96A 3FAXA 3WK0A 1VGAA 2CYGA 4E4FA 2O56A 1QNSA 3TH6A 1JG9A 1K8XA 4UFIA 2YL6A 4HN4A 1Q6GA 2W9MA 4GUFA 1XIFA 3WSUA 4N2YA 4JTEA 5JH2A 1QW7A 3VIFA 4YCOA 4P61A 1ONXA 3VUSA 1A0EA 4AWEA 4ZENA 3L4YA 2JQXA 4RUBA 3VE7A 1E3ZA 4AIUA 4QLJA 2QCCA 3GC2A 3P93A 4LUYA 4A3UA 2EJ1A 4AZ7A 1GJPA 1KKRA 2DSVA 4N9EA 2A6LA 5IFPA 4PCPA 1V0NA 4B5TA 4IJRA 2PTDA 3S42A 3P61A 4RZ4A 4A2RA 3B0PA 1BPLB 5XIAA 1JPDX 4WHBA 3IGHX 3W87A 4WKHA 3S5NA 3OJGA 2EG7A 1EB3A 4JAWA 4CLMA 3WF3A 4L1XA 3PUDA 2YXXA 3NCOA 1WXZA 3B8UA 3KL0A 2FJKA 1XCFA 3NXFA 3VIIA 2WNWA 1JAKA 2QUMA 2H9AB 3KWSA 3VIJA 2XVPA 3QKZA 1D7KA 2WB5A 3GHTA 4XZMX 4AZHA 2XM2A 1TQXA 4TTGA 5I06A 3L0KA 4YVPA 3AXHA 4TU1A 4ZB5A 3MUXA 4IGNA 4QS5A 3GH5A 1MDRA 3KCLA 2DUXA 1Q4NX 3AC0A 1I2OA 1SPQA 3O0FA 1LCOA 3CHEA 3PZ9A 2PPGA 3UXKA 1HJUA 4OHQA 4HK7A 3GZ3A 1I75A 3II1A 5BRBA 3P80A 5I3HA 1OGSA 1E51A 1VFHA 1T5AA 2JEQA 2E5DA 4DBEA 3OZYA 2AKMA 4QIUA 2TPSA 4M29A 1VR6A 2CWXA 4KETA 3GXMA 2O4MA 3SUVA 1G7VA 3CLMA 4YHEA 3W74A 4ROQA 1E70M 4H19A 1R38A 5JVLA 4FX8A 1B9BA 2E40A 1HO1A 2HRWA 3O3RA 4KGJA 3MQTA 1FH7A 5D9OA 1KBKA 5IBXA 4CVUA 1FY6A 4FXSA 3AYRA 2ZUWA 2F6KA 2DSWA 2PDHA 1HNYA 1LL7A 4GVIA 3AIVA 5HA7A 3TR2A 3WK2A 1XRTA 2J27A 3WK3A 4GMEA 3TYCA 1H7OA 1R9ZA 4TIMA 2XZ7A 1PCWA 3RFAA 1GPWA 3G8RA 4DY1A 3B8WA 5K2ZA 1OFOA 4XZWA 1SO6A 2QJIA 3RJYA 1J4EA 1TR1A 4PTVA 5HANA 2PU1A 1Z89A 1G4PA 4EPEC 1JYVA 2YLAA 3POHA 2O9OA 3TP4A 3OQEA 1J6OA 1L6SA 3H2CA 4A3YA 8TIMA 1JNEA 1ITCA 4RV3A 3NM1A 1E4MM 3ABSA 4F2BA 3T42A 3W1AA 1E1CA 1WOBA 1XC4A 1E4LA 3TYAA 3PB0A 1UWTA 2VR4A 3GDTA 2YXGA 4BQ5A 3GNPA 4K6AA 3UVAA 1H49A 4UBPC 1ZSXA 2WV8A 4XX6A 3P82A 1LT7A 4Q4KA 4R9XA 4W84A 4H1ZA 5AKQA 2Y85A 1CTNA 2PCEA 4O1DA 1XLFA 1KWKA 2DSUA 5I79A 4NIRA 5K9CA 2PDFA 1YQ2A 4AD5A 1Q6CA 2ZC1A 3TTOA 1L8PA 4BZYA 3ZR6A 2IUZA 3R5EA 3GVGA 3U8GA 4K2SA 4POCA 4X2RA 2DW6A 2CZVA 3UZZA 1HW6A 3W75A 1GQIA 3TIMA 3N1AA 4LCRA 1AW2A 1E56A 1EH9A 3H54A 4DZHA 1GGOA 5A6BD 3BQ6A 1MW3A 4RDWA 2WCAA 4HPNA 3WCZA 3AZTA 3XINA 1BFNA 3UNTA 1AD4A 3TXVA 4HMEA 1M65A 2Q8XA 3PY2A 4LCQA 4S3FA 2BX7A 1CB2A 4D8AA 1HKKA 1K6WA 2HS8A 3NNTA 2C71A 2W27A 3UF9A 4UNIA 1FQ0A 3TROA 1ENUA 3IRSA 3WBXA 2D2OA 1LLZA 3MMDA 4LUSA 3OQ8A 3CQHA 1AUSL 1KXQA 1XIBA 4Q4PA 1EZ2A 5LGXA 1P7TA 4OTKA 2IW0A 5ABFA 1K8YA 3VKJA 2E9BA 4AVFA 4JCMA 3W3OA 2DVUA 1VC4A 5DQPA 1XLMA 2VDIA 3T2OA 3NZGA 3QPEA 1QNRA 3KP1A 3YPIA 3L66A 1CGVA 3LEPA 4DNMA 4A3RA 3O2LA 1JCJA 3R12A 4RXGA 3UQNA 1O5QA 1GW1A 5EMJA 1IWPA 4KEUA 2ICSA 3W02A 4FB7A 1B90A 5HQEA 3AYTA 1KCKA 3N17A 2P5NA 3UWWA 1EL3A 2RGLA 4CNTA 1TWWA 1ZAJA 1GG0A 3E0VA 3W7EA 2PD5A 3DG6A 3GH4A 4GVFA 4LU0A 1E1EA 1EIXA 4TV6A 3OG2A 4Q8PA 2CLLA 4FLOA 1J18A 4M5PA 3M16A 3M0HA 4IXHA 1YLVA 2FPVA 3SSZA 1W9XA 5AC8A 1BVZA 1V0KA 4Q22A 3MKKA 2IXUA 2V5JA 1P6BA 1OYBA 1TWZA 3GDLA 3NVTA 3S5SA 2QF7A 1VAHA 5I09A 3URAA 5I3GA 3W7DA 4R88A 2NUYA 3EDEA 5B7YA 5GQBA 1B4KA 4C60A 3WMCA 3SB0A 4C1KA 2EQDA 4E8DA 1PVNA 3A3XA 3QC0A 1WE5A 3HN3A 2CERA 4JTTA 4U3AA 3VDGA 1Q8JA 3EXRA 5A8GA 4DUWA 4LB3A 4MDOA 2GUYA 1P1XA 2E1DA 1K03A 3VIKA 1FHUA 2ONEA 5AHNA 1SJAA 1PKMA 5G4EA 3BG9A 4PCFA 1EGVA 1X1NA 1UA3A 2GLKA 3ABRA 3OVRA 3URQA 2FDMA 1ZBKA 2DPEA 1ZFJA 2D3LA 2NT0A 1GCYA 4Z2JA 5GJMA 1GJUA 4S2CA 1UD2A 3IJ9A 5I3JA 4JTDA 4L9ZA 3W2MA 3VMOA 2E5CA 3B8SA 1AA1B 2BVDA 2R91A 3BOXA 2NSOA 2H9AA 4Q3MA 1JYXA 1AL7A 2A7RA 5PTDA 1OFBA 3LBOA 5FJUA 3IUHA 3WBEA 1DORA 5DO8A 4TX8A 3WN6A 1TV2A 3FK4A 4OECA 3STGA 2YOCA 1NEYA 1WPCA 4V1XA 4PA8A 2YZ5A 1F3EA 4M24A 4UTWC 5CC5A 4D72A 2XIQA 1C7SA 3T78A 3WLIA 1TPEA 4ZQPA 2GQ8A 2BOEX 4OV4A 5CSUA 2B4GA 1NOUA 3M0XA 3IUIA 3MU7A 6XIAA 2JFEX 4WDWA 4QNWA 1ICQA 4IFKB 3B3DA 4MM1A 3IVSA 5I00A 4H9XA 3BZJA 2PLMA 1Q8AA 4C6CA 3A4WA 4H8VA 4H7ZA 1UWAA 2DV0A 4JNZA 2PP3A 2AQOA 2VNCA 4US6A 3H2FA 2FTYA 9CGTA 3PZVA 1E73M 2CEQA 3H4WA 1E5JA 1UPMB 1PKNA 3MA8A 4GJJA 1K9TA 4HPHA 4H9UA 2ZE3A 1EIBA 4HYVA 3QC3A 2CBIA 3VNDA 4R3UA 4O1BA 4W85A 1A5KC 1VLIA 4YYFA 3B8VA 2DZAA 2PDCA 1H1YA 1TRDA 4IIDA 2DVXA 4RPQA 1QBAA 3GXNA 1XL9A 2YZRA 1B3XA 2ZOXA 3W26A 2RGMA 2DH3A 3MV11 4N7QA 4QDWA 1KGXA 1A49A 3BANA 4KWWA 3EB4A 3IJLA 3NVDA 2D0FA 4IX0A 3LA4A 1JF6A 3EMCA 1W37A 3NTYA 3W1UA 5EBUA 3BDKA 3EWBX 4CQ8A 4LH8A 3MDUA 5TIMA 4MUPA 1WB0A 4ACZB 2CCRA 2PMQA 8A3HA 3IANA 4EPKA 3L23A 3W53A 2JKAA 3HA1A 4PH6A 4MZ8A 4B4HA 2Z1BA 3CBWA 4AU0A 1E4IA 3DI0A 1EJXC 2GSEA 1GUVA 4Q7NA 4XG1A 1P1MA 4BK9A 3W83A 1X39A 2WMKA 2H6RA 2O9PA 3PG9A 1CWYA 1B57A 3EGJA 3EMZA 1CGYA 1GKQA 1SZEA 4FNRA 3TJIA 3QOMA 5DCBA 1IT7A 4NNAA 5M2FX 3NL6A 4ZR8A 2ESCA 3IUDA 2ZUTA 1OD8A 4WLCA 2POTA 2Y1HA 1MMFA 3OHIA 5AHMA 5KSWA 3DG7A 1WBJA 3TU9A 3M64A 3VMPA 1KM0A 3DHFA 3O07A 5AHEA 1ZNNA 2C3ZA 4ZQRA 4QR6A 3BJSA 4A6GA 1CCWB 2VOMA 1E6RA 4RNHA 3WLOA 2HNEA 3S9IA 3VOCA 3N04A 1VBRA 1YTDA 1ZRQA 4TVDA 1KM6A 4D2JA 1NELA 2BODX 1HJSA 3FLUA 1RPXA 1ZALA 4UC5A 3VIGA 3VX1A 1Y5WA 2TSYA 1CIUA 1HKVA 3QZAA 1BYBA 3BAYA 2ZXQA 3GSMA 3NPWA 4H9YA 4ZQNA 3WD4A 3N15A 1PAMA 3W2KA 3CIVA 3HG2A 3KOWA 1LT8A 1W1TA 1KBJA 4XZNX 2ZWYA 2FZMA 3OOQA 5CEWA 4PUJA 3PPHA 4AB4A 1OFEA 3RG6A 5A2CA 1NDYA 4HNCA 4WK9A 3R11A 3SFWA 1P5BA 3RU6A 1P6CA 3DZ1A 4JCLA 3QR1A 3KXQA 1QW9A 4AX6A 4KRTA 4JKLA 3VIPA 3L5AA 3GWQA 4GX9A 1YXCA 2HWGA 3R58A 4QAIA 3RHGA 5CZKA 3BOFA 2I7GA 3I7QA 3W7MA 1FXQA 1V3KA 3K30A 3L12A 1T99A 1HJWA 3UETA 3FS2A 3F4DA 4RZ5A 3TYDA 1LQ0A 3LK6A 3E02A 3LZ5A 3W0KA 4EE9A 3TZNA 2XHYA 3BLLA 3KDOA 5D02A 4DBUA 3VAVA 4ZO9A 3GQYA 3WF4A 2F9RA 4F0RA 4WKAA 3UXAA 3PC0A 1K4HA 3EPMA 3L21A 4J3TA 1KM2A 3IJDA 2G0WA 4IXXA 5I3KA 4UCGA 1ESWA 3DHDA 5EB8A 1KFWA 1JDEA 4FOJA 3OGSA 5F2LA 1DXFA 3R8HA 1EC8A 3PTKA 5CQ1A 3W38A 4PMXA 2J7DA 3MS8A 4JOMA 2XM1A 5I5RA 4QS6A 2NVDA 3O7UA 1GPFA 3BLPX 1OY0A 4E4PA 3ME3A 4V28A 5HWMA 4QBXA 3CUHA 2QULA 2VGBA 4XZHA 4FLRA 1KGWA 1TVLA 4TVCA 4HCHA 4H6KA 1YDYA 5LZLA 1KWGA 3N4AA 2BTMA 3M0MA 3RN6A 3O63A 5FJJA 4CU8A 1GW9A 2BY1A 1GZGA 1KD0A 3H23A 3DBNA 2BWGA 3CMGA 1XRFA 3M0JA 4RE3A 3NQCA 2FQIA 2D2GA 3EPOA 1M7XA 3AZSA 4UTKA 2XN1A 1TJ0A 2VX7A 3I10A 3QHMA 4RDVA 3ZT7A 4PBFA 3I65A 3LGDA 1TZZA 4O15A 3S1VA 1FP9A 4MSSA 4XO6A 3W7HA 2NX3A 2WWDA 1OYAA 3T07A 3S5ZA 2V9DA 1J6PA 1LJYA 2DEPA 1MSSA 2I14A 2HK1A 2VT0A 4NX5A 2QEZA 2ZC8A 5LXXA 1OB0A 3VNKA 1L2QA 1BD0A 2BGSA 3SUSA 2WVTA 2F38A 1NSJA 3HTWA 2FTWA 4LF2A 3LPOA 4KEMA 4S2BA 4IGMA 4Z1YA 3S6DA 4CD5A 3MVIA 3ZR5A 3L65A 4EF8A 2ZCGA 1HJVA 4GIAA 4RR4A 4GY1A 2BS9A 1L2UA 4HHMA 1KRMA 4IFKA 2OODA 1U22A 3V16A 5F4WA 1H61A 3VO0A 2ZZ2A 1AODA 4F2TA 4N0RA 3H2AA 5GVJA 1QDSA 2YX0A 4WY0A 3QOKA 3KRBA 3W6MA 1G4SA 2OWWA 3G0UA 5DXXA 1Y7VA 4MB4A 1FWSA 3PWIA 3DI1A 3NSXA 2WM0A 2CBVA 5XIMA 1YHTA 3T7VA 3DFQA 4JTLA 3P74A 2ACUA 4TXEA 3W1RA 4TOQA 5I3DA 4RNJA 3M5XA 5DX7A 1H0IA 3W7CA 2R1PA 2RFGA 2WC4A 3FKRA 2I5GA 4WR3A 4ZOCA 1SJDA 3POCA 2ZX5A 1PDZA 1K1DA 3PF3A 3BL3A 3TTYA 2DZPA 3M43A 3OZOA 3MVTA 3ZWSA 2EPNA 3QV8A 1AG1O 3G3MA 4Q8QA 1ICSA 1DQXA 4GABA 4ACZA 4DB7A 1VPXA 2OO0A 5C9ZA 4JS3A 2OZ3A 3LHYA 4K8HA 4AVNA 1ONEA 1SZRA 4FIQA 1RBOB 4GK8A 1K3UA 2BXVA 4XZLX 2WWCA 5DT7A 3DGRA 1MZRA 3C56A 4G56A 2D2HA 3EB2A 2OZ0A 1A0DA 4H9TA 3SAZA 4BS0A 3U7VA 1KFBA 3VZYA 4DM1A 2Y62A 3IIVA 3LQGA 3AXXA 3F4NA 2HV5A 3B03A 3UZXA 4ASTA 1XIJA 1NP0A 4IMEA 4JL1A 1R47A 2OX1A 1I2RA 1XGEA 4V15A 2G4JA 1EJSC 3AS3A 2IXVA 4W86A 2A3EA 3BARA 5CPOA 4NG3A 1BQCA 3VU2A 1BRLB 2AL1A 4LAUA 3G77A 4RV8A 3HZ3A 4HA1A 5J8LA 3HF3A 1VH7A 3DFHA 3DN5A 1VEMA 2XGIA 2J77A 2GFTA 4HJWA 4O19A 3VK5A 1TV7A 1YNYA 3BUVA 3M44A 4W93A 3KVLA 2WZTA 4P7RA 3HGSA 1JUBA 3A5FA 2MNRA 3OLEA 5MHBA 2CBUA 3K4AA 5CAKA 1UOKA 1C8YA 3W7IA 4PCNA 1R3RA 4Q8VA 1MVYA 1ZJIA 4FA3A 1TTJA 2A5HA 3BK0A 3E3HA 3WNKA 5C55A 3OVGA 3GNRA 3H53A 4TQTA 4ICNA 3ITOA 4QP0A 1WKFA 1OC6A 1WDRA 4B5XA 4DXXA 4HA4A 3LV5A 4RJEA 5A3HA 1EUNA 2XH4A 1MDLA 3B0UX 4HGXA 4IJBA 4LYKA 4ORIA 1RA0A 2BVYA 2C0HA 1XYLA 1MXSA 3OIXA 1EJWC 4IZGA 4HZ7A 1CB7B 5ECVA 1Z3NA 2VGIA 1OCQA 3M6DA 1FWCC 2GVLA 1AH4A 3KVJA 2PF8A 3WLKX 1D9EA 3DYMA 2E8YA 2E8ZA 1OFRA 3PM6A 3TQKA 2VM8A 3SCPA 4IICA 2QW5A 3M07A 2DT3A 1MW0A 3W72A 1I2QA 1OC7A 1JQXA 1FWHC 3F2CA 1Q66A 4P7OA 4QROA 1RV8A 4M3PA 4M6PA 1V5XA 5HPCA 3T09A 2EPMX 1ZJAA 3R25A 3K2GA 3DHUA 4WUIA 2NUXA 2OO6A 1HKMA 1R46A 4KIRA 3HMJG 1TWSA 1Q65A 2IQTA 1VKFA 4IMFA 3QSRA 3UGRA 4O11A 2DVTA 2ZX9A 3LV6A 2VZSA 3GUWA 4S3GA 5GPRA 3OBAA 4UFKA 4JEJA 3QM3A 1W6TA 1POJA 2HVMA 3UT0A 3L0GA 3PPGA 1X7IA 2PDUA 3DFNA 1S2UA 2OOFA 2OG9A 3NIYA 3EA1A 4DUXA 5HOSA 3RX4A 1QJWA 1PHQA 3BURA 1JZ3A 4K8GA 3KZPA 4F0KA 1AMKA 2B0MA 3K13A 2XFRA 4PULA 2PDWA 1W5PA 1V79A 4G7FA 3NQVA 1AK5A 1GHRA 3W07A 1VHCA 4W5UA 1KKOA 1LUCB 5BMXA 1TUXA 4UTTA 3W22A 2IQDA 3CGTA 3SCVA 4QE5A 2VRKA 1BWKA 1VBUA 1C90A 1MQQA 1ZPTA 3DC8A 1V6WA 1W1PA 4Z1CA 3UXIA 1FVPA 3ITXA 1EO5A 3GB6A 4Y9MA 5B7ZA 4RE2A 1KRBC 3TYUA 3O06A 3T05A 2ISDA 2Y63A 3GAKA 3Q2DA 5FI8A 2P3ZA 2TODA 2VD8A 3ES7A 2VWTA 3L5MA 1BTCA 1HL9A 3UCCA 1L6GA 3K8KA 1KCXA 1O5XA 1ZJHA 3THDA 1XD1A 4FMVA 3LHZA 5G2HA 4MF4A 4GGBA 4Q32A 1NP2A 4DM2A 3QYSA 2OT1A 2PRMA 1DWJM 4NXSA 2WVVB 2C18A 5BCAA 4BEUA 1EQCA 2DIKA 4MFDA 1NFPA 4AF0B 1CGUA 1K6AA 1VFMA 4DRSA 3IIXA 1RBLA 2NV2A 2ZX7A 1PX3A 2YA0A 4Z2KA 3TVAA 3BMWA 3DESA 2VGFA 3DDMA 2A85A 1NOFA 2WANA 5D30A 3FYOA 3WYZA 2Z7GA 1IZJA 1WKDA 3T6CA 4JYEA 1TMHA 4XZIA 1XIEA 3EKLA 1T0OA 1OWQA 4EAYA 3WDRA 5CH9A 4KFOA 1TJ2A 3W1PA 5CG7A 4CGTA 5AVNA 4C6BA 5FEZA 3FDGA 1IWAA 4QSFA 3GU2A 4Z42C 3KTSA 5EA9A 1RCOB 1A3XA 3WENA 1M7JA 2G97A 5HJXA 1OVDA 2PEVA 4P5UA 3E0IA 3NGFA 4EACA 5AFDA 3O16A 4J3VA 4S3EA 2GJPA 3TE9A 3QJAA 4MY9A 5BWFA 5DXYA 3BLFA 3IPWA 3KE0A 2GQAA 4IWWA 3AHVA 3UYIA 3ARPA 2B7PA 1XDMA 4RE4A 3LCXA 1Q5MA 3BCFA 5A8NA 2E68A 2RH9A 3NSNA 1TA3B 4F0LA 3QQ1A 4GACA 3QGKC 1GONA 5HULA 3SI9A 2X05A 4LC6A 3LZ3A 3UR8A 2Z4GA 3NPUA 2XGBA 1W3IA 5L6UA 2DGAA 3TWBA 4XISA 4NZJA 4ZQOA 3HJEA 3RO8A 2VCCA 4BKNA 4HHPA 3VGHA 3PR2A 1BRLA 3EOSA 3K46A 3LB0A 3LLFA 1ZU8A 3T4CA 2E6DA 1FCVA 1JDFA 3WLSA 4UQCA 1VJIA 3MT1A 3MO7A 1MUCA 5E6YA 1Q2RA 4H00A 4FZIA 1WXYA 1WO2A 3SRHA 4BF7A 5HR6A 2QCGA 2C19A 4B9YA 1HJQA 3B9NA 1DIDA 1SUXA 3CK5A 3GXPA 1EWEA 1A5BA 3UU0A 1TPB1 2ZZ5A 5AZ1A 5KETA 3ZVHB 2J62A 3FHQA 1GZ1A 1YXDA 1QMLA 3T44A 1QI3A 2J7GA 1GVEA 4ROPA 2OWXA 4BWLC 1A47A 4AW7A 4MAZA 3KRSA 2CNCA 2C1HA 1OF8A 1PO9A 3QHNA 4BQ2A 1BG9A 3BO9A 3WJXA 2AGTA 1V7AA 1JD9A 1K8CA 4X0VA 4UWMA 1DJQA 2NUWA 2YXOA 2VC6A 2G3JA 1PPIA 4XD5A 3MP3A 1G1YA 3W76A 5E1QA 3KBVA 4R85A 4Z0SA 3IGXA 2V82A 3QFEA 1OCNA 3W7GA 3M7SA 3TYBA 4O53A 4HCDA 3W1MA 1TQJA 3WQGA 3E2RA 3NQFA 5BMWA 2R1NA 4MDPA 4A21A 3WDPP 3WZ0E 1DWIM 4PUDA 3EA3A 1L9WA 1JL8A 4WXZA 4JN6A 1TUFA 1D3CA 3H7VA 3SCWA 3LRKA 4GQQA 3BICA 1SSDA 4PMOA 4LYQA 3N9SA 4OBTA 2AMGA 3N2CA 3EDJA 4W8LA 4K38A 1W9DM 1A53A 4J7RA 1TTQA 1JFHA 2WHMA 4Y9AA 7TIMA 2GUUA 1SJCA 3TC3A 4DHGA 2Q3OA 1C7TA 4UNLA 3N34A 2C91A 4C5ZA 5D2XA 1FFQA 4LYRA 3OODA 3AWOA 3VOGA 2PDLA 1NWTA 3IIPA 2F7FA 3BVJA 3UA4A 5HMDA 3SECA 5U4NA 3R7MA 1QO2A 4MLRA 1MZHA 3SN4A 1B3ZA 1JPKA 5AHIA 4JDBA 3GYCA 1X8CA 3G1VA 1DJIA 1KTNA 2YLLA 2EJAA 4N42A 4DBWA 1XGZA 3GVRA 4MMWA 2INEA 5AYIA 1OX6A 4QLLA 2CLEA 3H7UA 1HP5A 3SN0A 3U6WA 1LUCA 3WNMA 3UZJA 4FAMA 3T0TA 1TB3A 2IKHA 4GX8A 3S2NA 3WIJA 4B3KA 3AFBA 1YW1A 1ZQ5A 2NXIA 5E93A 3ANYA 2WNZA 4O13A 1WBHA 2BSLA 4NSBA 3KLKA 2D2JA 4JQ1A 4LF1A 2Y89A 5F1VA 1H0GA 2ZVRA 5CPMA 1AW1A 1KM4A 4Q8WA 5C5YA 2XG9A 4LNCA 1QNOA 3S5YA 2GJRA 2ZRUA 2PC4A 4Z08A 1SQ7A 1BGGA 3TJXA 4PMYA 1Q6RA 3EOLA 3LCLA 1LBFA 5FL1A 1AQMA 3WLQA 5H2ZA 1UZDA 2QLYA 1PZ1A 1MUWA 4JY9A 3WD2A 3GIYA 2E5BA 2BHZA 3HB9A 4LUIA 4AZ5A 1F61A 3N25A 2FVLA 1UIOA 2FZ9A 4UQDA 3G6LA 2CFFA 3ORWA 4DYEA 2ZA3A 4RE0A 5IRPA 1OCJA 2J13A 2WVVA 2UY2A 1Q7QA 4DJFC 4DVOA 3HURA 4H2CA 5JXQA 3VCNA 1M01A 8XIAA 3AYSA 4DX3A 1GZJA 4R7JA 3C2YA 3AS2A 3MV01 1DTUA 4AF0A 4E3VA 2R6OA 3VOHA 3ARQA 3DX5A 4DLMA 3KUMA 3ISIX 3EX4A 2EBNA 3W2LA 4GLEA 5CLTA 5DF0A 3RM8A 4C6OA 4JTSA 1Q7ZA 1EPXA 2XSBA 4LTSA 2ZDSA 4E2OA 4XD4A 3VGDA 3TTQA 3W1QA 2Z6IA 1PZ0A 1AQFA 5C2CA 3ONBA 1OK6A 2QPXA 3IV3A 2ON3A 4W7WA 4Z17A 4RX0A 1FWTA 2Z6JA 1M41A 2V0TA 3I68A 1CENA 4UQEA 1VLWA 3CIXA 4XO7A 2Q09A 4PB4A 5CCZA 1TPVA 1E0UA 1J01A 1I1XA 1IEQA 2RJGA 4N6EA 6PTDA 5K9XA 4DPQA 4JFTA 1EP1A 4ZOAA 1IIGA 2P0IA 3VE9A 1TA3A 2DT1A 3WKZA 1C8VA 1BVWA 4JZ5A 2CXEA 1XWYA 3VKAA 2PZNA 2QDGA 2DUZA 2OGYA 1TTIA 5HK4A 3LCFA 1VFOA 2QDHA 2VFHA 3PBGA 4GOAA 4LVGA 1VEPA 3UWZA 3VCCA 1V4YA 1NTHA 2PBOA 4ATDA 2ZX6A 1T8XA 3VGBA 3NQBA 3TN6A 2QAPA 5DCEA 2GQ3A 5KZEA 3SGUA 2J8TA 2WPGA 1QPNA 3ARZA 3KL5A 1OABA 1T7LA 2V5CA 3E96A 2YA1A 1GVFA 4L80A 1ONRA 1RPKA 2Q02A 2NWSA 4FNTA 1RCQA 2CHOA 3S47A 1WCGA 1PCKA 4KBXA 3P7YA 3GS6A 1KGUA 3EWDA 4PUUA 3UYCA 4REQB 5AYBA 9RUBA 3OBKA 3ZQ9A 1PB0A 1UP0A 1GOOA 3ZVHA 2VHLA 2FGZA 1XYFA 3UW6A 1F6YA 1VFLA 3OYZA 1RQEA 1XIMA 2JE8A 3F5KA 2C7FA 2QIWA 4K36A 4AZIA 3A3WA 1WDWA 4CNUA 9XIAA 3BJFA 1NOWA 2WKLA 4LRTA 1DE5A 1H60A 3MHFA 4WCJA 4CQCA 1LG2A 5G2IA 1VBJA 1XIIA 2GGJA 4C6KA 4S3AA 1KFKA 2VI0A 1JCMP 4UFJA 4ECLA 4W8AA 1OT1A 4AZCB 3TQ0A 1QI0A 3TTSA 2Z1KA 4M1BA 2HROA 3M0YA 1CXHA 2PDXA 4D6GA 4UCFA 1T40A 3Q65A 5B80A 3CPGA 3LRLA 4DWSC 3SGZA 1LG1A 1OEPA 3HPFA 3GHSA 4LVDA 3TA9A 2HXTA 1G0CA 1PEZA 4ZL1A 2L5HA 1TPC1 1P0NA 3LERA 3LCIA 4O4VA 5AHLA 4GXMA 5F2MA 5LA2A 4C6LA 1RZMA 1XYAA 3TFCA 2YCKX 3EEZA 1FDZA 2XINA 1XG4A 3FFSA 4ZO7A 1XIHA 2H8XA 5C9UA 2JK2A 2V5DA 3R79A 4E5TA 1WDPA 1GK8A 2CC0A 2HNHA 4LX4A 2R24A 1A3WA 1ZLPA 4WY0F 1G7UA 5CPQA 5DELA 3QN3A 1IEWA 4LB4A 4PE8A 3UXDA 3W4RA 3CB3A 3OGRA 4L1GA 3IK2A 4H9VA 1RY0A 3BH4A 3C2EA 3R1ZA 4GUJA 5TF0A 2PA6A 2YSWA 5C0QA 3THCA 3WK1A 3RYSA 3CQKA 4PODA 5I02A 1G01A 3TLLA 4O52A 2QF8A 3UFYA 5A6BA 4QJ1A 4US5D 4BF9A 1KTBA 1TFVA 1SU5A 3VKBA 3W1LA 2GGEA 3RDKA 1F3XA 1UH3A 4HZMA 1J0ZA 4Q4QA 4OUIA 1BTMA 1JRBA 3A64A 4IIEA 3THUA 1TWIA 1UD8A 3DFOA 1EWDA 2YDRA 3P60A 5FL0A 4U2ZA 3M47A 4KFPA 3PFMA 1DXIA 4C6IA 4N9BA 1E6NA 1V03A 4HOXA 5CPNA 3CTLA 3D5HA 3W84A 4M81A 1XCWA 2PF0A 2DZXA 1YDNA 2D20A 2ADAA 4JEQA 4G8TA 2WSRA 2DU2A 3SO7A 3QPZA 5BXPA 2V5BA 3WLRA 4M6QA 3C3NA 3L4WA 4NJIA 2GL5A 4MTVA 2VUYA 3KLLA 2B31A 2V3FA 4QEHA 4QEEA 5DLCA 1EJRC 1PE1A 1GOMA 4JY8A 1UD3A 4WDTA 2HK0A 2X1RA 4ZB0A 2Y4SA 1XIDA 5I77A 3U9IA 4F0SA 1WDQA 4ACYA 1R3SA 3E6EA 1UR8A 1C9WA 2W0UA 4F48A 1IR2A 4GY0A 4XVDA 4ZFMA 5XINA 4DQWA 3VTRA 1UD4A 3TFXA 4Y7EA 4PUWA 4LUJA 1BQGA 5MF5A 2XYLA 3W85A 2VURA 1NWSA 1N55A 1QT1A 3EPNA 3EOOA 1FUYA 1E43A 3W6LA 2CPUA 2R9RA 2WSPA 3OHMB 4L4MA 3LS9A 3BAIA 3PTDA 2F2HA 3G3DA 3J7HA 1QATA 4I9MA 4AC1X 3H70A 4DEFA 1REQB 1MQRA 4O18A 4HJFA 3FAWA 4NL1A 2O55A 5EMLA 4H8UA 3NQ6A 4ZFCA 3HQ1A 2WSQA 1OIFA 6XIMA 1KV8A 1WKEA 4F79A 1C29A 4M80A 3FJNA 3L2MA 4DJFD 2PDNA 4QHRA 5FKYA 3TWAA 4E38A 4N6FA 2QV4A 3W6YA 1RVGA 4OBRA 4DAFA 2GGIA 1V02A 3MZ2A 3V5CA 3W1TA 2VZVA 3Q94A 1GOWA 5M5DA 3JVAA 3AUOA 1QI4A 2OCZA 1PSCA 5AECA 3I3EA 1ODUA 1TSIA 5EYWA 5FJPA 1VFSA 3HPZA 3N2XA 5DFAA 1L6FA 2QCFA 2X7WA 3G1HA 5M17A 3W70A 4GQ0A 4LC8A 1EP3A 4FOKA 4Y8EA 1QNQA 4K7VA 4HYRA 4XD3A 4ONVA 5A8QA 1LBMA 4IUOA 3EA2A 4LVFA 4UTIA 3VDHA 5TD4A 3BG5A 2CZEA 3F4CA 3GDKA 1F6KA 1XLAA 1KTCA 2HCVA 1KBIA 3EMQA 1GQJA 3MC5A 5LXEA 4Y6GA 5IHSA 2A4AA 2OYKA 3CHVA 3SQSA 3FDKA 1SW7A 3GFZA 2J47A 2VCBA 3ZJ8A 1OSEA 4C1NB 4KRUA 2Z2UA 4REQA 1KC7A 1RJRA 3LCHA 2VGGA 3QKEA 2Z24A 3T08A 3ARTA 4PB3A 4AZBA 1ADDA 1CI1A 5DCDA 4O1FA 4K8EA 3ITLA 2NV1A 2HPIA 3OG3A 1QPOA 1VD6A 1IF2A 1XQLA 3CUZA 3Q58A 1EF3A 3QPYA 4E0CA 3ALGA 2Y8UA 3NG3A 1ZP3A 2O92A 1SO3A 2NZLA 4KWOA 3HBLA 2FZNA 2VXNA 4JTAA 1VJZA 2J7CA 1J8VA 1TYGA 3W24A 3ZT5A 3A47A 4ZO6A 5HQMA 3GFXA 3QMSA 4AZCA 3TNBA 3IJ8A 3R94A 1NFBA 2VP8A 3EDFA 2O9RA 3P3BA 4I3GA 3T81A 3S9ZA 3GU9A 3LGEA 1FWNA 1UP2A 4LFYA 4KIEA 2ATMA 3A4JA 1VFFA 4TR9A 3SY8A 4AY8A 4Y2WA 2EPOA 4QG9A 4MWAB 1E0XA 3WH6A 2DW7A 1H09A 1E9ZB 3QMRA 4W4QA 3TAKA 1WZLA 3AS1A 1UQZA 4LW7A 4AIBA 3VUPA 4Q4SA 3G24A 1PS9A 2PDMA 3PWAA 3LN3A 3BLOA 3L7RA 2XZ9A 2WLYA 4UFLA 3FX4A 4KCTA 1VYSX 3RRAA 4CQAA 1G67A 4N4QA 4GNVA 4GYFA 4KCVA 1LZOA 1WP6A 4AD0A 4I6VA 1YBQB 1IR1A 3H8AA 4NRRA 1V7YA 1MQPA 1MUMA 2PLJA 4DWSD 1WKYA 4M8UA 1Z9AA 3NO1A 3STFA 3GU1A 5J5RA 1W1VA 3IV8A 4XTDA 1JZ7A 3C8FA 5CG0A 4GCXA 1RALA 4NJKA 1MNSA 3TW9A 1FBAA 4DYJA 5ENLA 2E6FA 3NDOA 2VRJA 3UXLA 2DT2A 3C0LA 4LS2A 1RA5A 2AOSA 2P8BA 1I45A 4NUWA 1NJJA 3AOFA 1KFEA 3H2OA 5FCZA 1ADOA 5FA5A 1YPIA 1JCLA 3FYYA 2OQYA 4PBEA 1W5OA 4ICMA 3NQEA 1AJ2A 4DI9A 4UTHA 4Z1AA 1FFRA 4YL2A 3AALA 3EX2A 1YDVA 4NQ1A 2X2YA 2OFJA 3MJMA 1UR1A 4ZMGA 4YVVA 4QXIA 2ZZ6A 1VBGA 4Z1BA 1RK6A 2Z1XA 3MI3A 5A1AA 1S2WA 4UR7A 1I9CB 4Y90A 4KWSA 4IIBA 5HWNA 3WX7A 1OYCA 4K1WA 4AY7A 3GVVA 3VA8A 4PL2A 2XN0A 1D3HA 2OPJA 4A8RA 5HMFA 3TCSA 7PTDA 3D46A 2FHBA 4C6PA 3FJLA 3E49A 3UNDA 3PG8A 2OJPA 2YL5A 3NO3A 3VIMA 4Q8TA 5D9PA 3ZJ6A 2ZRWA 3DYPA 3WQEA 3V5OA 5D32A 1WZKA 5IFTA 5T9CE 3CLWA 4LY8A 1F3WA 4D6JA 1S1RA 2BP1A 4HU3A 1MEIA 4LYPA 1WUFA 3LTPA 1UJPA 3W81A 1A5OC 2Y2WA 4YHGA 1QHPA 3AICA 2I5QA 4CUCA 1DQWA 1XJBA 3HGOA 4AD2A 2A7NA 4I5UA 4EK7A 2P8CA 2X0HA 1FWGC 3BC9A 4M82A 1VYRA 1REQA 1YIXA 5GNYA 1UH2A 4HK5A 3IAPA 4PRTA 2NLIA 4KEZA 3LSBA 4J40A 4H9MA 3NPVA 2HVNA 5G5IA 2AQWA 5D2YA 2W61A 1KV5A 4OQVA 2BGNE 3REQB 1K9DA 2W5FA 4AWSA 1F4HA 3OVQA 4CQDA 4L4OA 4GUGA 1EDTA 1TPUA 4JTHA 2HBXA 4EXAA 3WF1A 3VVGA 5DEZA 3QV9A 3T2PA 1M03A 2G3NA 5A2BA 4ERIA 3H24A 3PJTA 3MMWA 5F2IA 1JIBA 1KLYA 1JDCA 3V7PA 3AYVA 4S1FA 4J35A 4C6FA 3CASA 3CS2A 1JVNA 3GBEA 2VO5A 3SUUA 2GVEA 3Q37A 4JTUA 2E3ZA 5A2AA 2ABAA 3GIPA 2F61A 1OZMA 2RAGA 1EEXA 2XIBA 1SM9A 3FA4A 1RQHA 3WH8A 4ADSA 3WD0A 4E8CA 2PTXA 1PKYA 1ZJBA 3V5FA 1R3QA 3CUJA 4J9JA 3OZPA 3WFZA 1CEOA 3ABXA 3G0SA 5BU9A 5FF4A 3EZ4A 4PTWA 4YWSA 3V3WA 1MXDA 1X97A 1UD6A 2PDBA 4NI8A 2RDWA 4IM4A 3KRZA 1QFEA 1MRQA 1XF0A 2Y7FA 2X1UA 3VMNA 5LHEA 4JNMA 1K7XA 3MHGA 3STCA 3GLCA 1VPQA 1AJ0A 3KX6A 1UROA 4HPGA 5CSSA 4IOTA 1OG0A 3BTNA 4C1NA 1FH9A 2V67A 1F05A 3O15A 3UZWA 2C1GA 1J79A 3KOZA 3MI2A 1CBGA 2C13A 3W7OA 5FSEC 3SRFA 3LRMA 2J66A 5BU6A 3WF0A 4WSHA 1YKWA 2ZADA 5E5CA 4K37A 1NH6A 4LPCA 2HS6A 3N2MA 1VP5A 3I7SA 3WH7A 1MYRA 4MKSA 4UTWA 4JKKA 3TR9A 4TV5A 4B16A 1NQ6A 1CXLA 4NU7A 1ME8A 1VQTA 1OZQA 1S3TC 3GNXA 3R8RA 4O57A 4HNNA 2BOFX 4DNHA 1MFVA 2NQ9A 4I7VA 3VDCA 1U83A 2R1MA 5LA1A 3VOJA 1IXQA 3CAKA 1Q85A 2WBGA 2Y6ZA 5HAOA 1SFLA 2E6YA 4RZ6A 4P8WA 2QCNA 3UR2A 4C91A 5I03A 4DWDA 5BRPA 3B0VC 1YTKA 1CT5A 1D2KA 4B5SA 2EG8A 4U5KA 1MW1A 1QPQA 4MWAA 2Y61A 1FCQA 4O54A 3U2OA 4JD4A 1O60A 4Z2IA 2ZTKA 4N9CA 4JIPA 2DJLA 5DN1A 2WM1A 1XINA 3ONCA 1H7RA 1W3NA 4GG9A 1DPMA 2ALRA 3O9NA 1CXKA 2PD9A 1E4NA 5H8UA 2B7OA 1ISVA 1F8IA 5HNRA 2JKEA 4KESA 3E0WA 3VIHA 1QXLA 5BNKA 4B4FA 4NNBA 2F6UA 3NZ1A 4ICCX 3HU7A 1YBQA 3WBWA 4ATLA 2DT0A 1VPYA 3MSYA 3CAWA 3EXTA 2ALDA 3LOTA 5EBAA 1EYWA 2PAJA 4ZQMA 1A0CA 1G4EA 3K5XA 4ERGA 2OLAA 2ZFAA 1DJNA 1W8GA 1G5AA 4RL3A 3RPTA 1B30A 2GSJA 4KWUA 3OA3A 3TN4A 1SSGA 3UPMA 2VFGA 3P8JA 3O8AA 5JUVA 4JIRA 3LX9A 4RNFA 5KMYA 1TMQA 4R34A 3L4XA 3E5PA 1O95A 5EFFA 2CKSA 3D6NA 5G1YA 3U57A 1FOBA 3LNMA 3W01A 3APTA 1TPWA 3UZYA 1AFSA 2ISSA 3CQJA 1CLVA 2BY3A 2HMCA 1HVXA 4E6MA 3OZMA 3WEZA 5LIKX 4YYCA 3H55A 3CH9A 3ENLA 1NU5A 4DJDC 2ZZ1A 1OF6A 2AGKA 3MWAA 5BOOA 3BSGA 1OIMA 4LWWA 3N6JA 5AC6A 1M3UA 3JZEA 3T1GA 1E9YB 1PWLA 1B9ZA 3BW2A 4H4IA 4QQ3A 1K7FA 4MFEA 2F8QA 5CXPA 3QV6A 3NZQA 2HBVA 3GAYA 3C3UA 1NVMA 3L2IA 3M41A 3CZEA 4CU7A 4QRNA 3WLTA 4UTFA 3GBDA 3UP8A 4P8XA 3DERA 1F6PA 3UERA 2QUNA 2Z0IA 3M6YA 3WD1A 3K8LA 1VHNA 1XH2A 7ENLA 3HV8A 3S0CA 1A5CA 1F5ZA 3RR1A 2CWNA 3B9EA 4MG4A 4IP4A 3TQPA 4ZTXA 3OLIA 4I8YA 4AZ6A 2J9XA 5A6JA 2VZTA 1LWJA 4UQBA 2IKGA 3P5ZA 4O0KA 1IYXA 1OCBA 3REQA 4L65A 2PWFA 3DH7A 4AFYA 2W6RA 2QYGA 5EU9A 1IEIA 4UTJA 4OKDA 4UXDA 1WV2A 4TTUA 1EO7A 3QLDA 2VR5A 1PX4A 2OB3A 3WY1A 2DIJA 4FHAA 3FCPA 2E77A 3MYOA 4ZSTA 4AHQA 3N11A 4WKFA 3LPPA 4URIA 1Q6LA 3A4XA 5CGMA 5D05A 1J93A 3SUWA 4UR9A 4LBRA 2VJXA 2W92A 3T0AA 1RQBA 4JFWA 4KCUA 2OQHA 3O6DA 1R86A 2XSXA 3CUIA 4JX4A 1QK2A 2E4TA 4DYKA 1ITXA 3MZNA 1XUUA 3W7PA 1MNZA 1A50A 5A69A 1FH8A 1XCXA 4IJCA 3UJ2A 3G0XA 1W56A 4PCTA 5DBUA 3NZRA 2XWDA 2ZRYA 3WLJA 1E6ZA 3RLVA 2I16A 4GGHA 1US0A 3PANA 2V69A 3S46A 3HV9A 2GVYA 4HMCA 2POZA 4A8LA 4PUMA 5RUBA 1PXGA 4Q8NA 4H8NA 1IXNA 3RAOA 3JUGA 4NZ3A 2ZZ4A 1J5SA 1L0PA 1V3LA 3OA5A 3VFCA 1GG1A 1HIZA 2FMOA 3TJ4A 2OVLA 2FHFA 4A29A 4B5WA 2KX9A 3SM0A 4CVWA 1GQNA 3MB9A 4NF7A 1IGSA 1HG3A 3CC1A 1TJPA 4DF2A 4QG6A 4YWIA 1BGAA 4PMJA 1O6IA 1W3LA 2ISFA 3VD3A 1XLCA 1DV7A 3N4EA 3BLIA 3GKFA 2QZRA 3F2DA 4H6EA 2CZFA 1DOSA 2ZUMA 5ABHA 3AWNA 2WNNA 3AXIA 1O7AA 5A6KA 3NAVA 3IACA 1TX0A 3FEMA 1Y8BA 4DF1A 2EPKX 1OX4B 4D6FA 5D8ZA 5G1TA 4K3ZA 1UR9A 3TEVA 1HGWA 3ITTA 3TW7A 1SO4A 1LOQA 4RW5A 1QWKA 2PZ0A 2H3BA 4ZZ9A 2X0SA 4J3XA 1EXBA 3KVMA 4CCDA 1UD5A 4LV9A 1RJPA 5JIWA 9XIMA 1DKWA 4ZGYA 2GGGA 4WEVX 3ZO9A 3SEPA 4UMAA 2XH0A 3K4WA 1WQ5A 2J7EA 5HUOA 1R87A 3GTIA 3TW6A 1F3TA 2AAMA 2VC9A 2JIWA 2P0OA 1PKLA 5CC6A 1ECQA 2XIJA 5K7JA 1XLJA 4I5RA 1ZCOA 2W79A 3UGVA 1YTEA 4E4UA 1AQHA 3W25A 4G7EB 3U0HA 2CESA 4JICA 5BROA 4QG8A 2OQLA 3G2GA 5FJIA 4PUNA 3R8GA 1L8NA 1E15A 2R1KA 1Q6DA 4LUTB 4M56A 4CNSA 1E6SM 4IF2A 2VEKA 2P76A 5DY3A 2Y7GA 1XFCA 4I9TA 4AYSA 4R7OA 1KCLA 4WJEA 2EF9A 3FNDA 2MUCA 4KH2A 3BW4A 3WQ4A 2OEJA 4D71A 2V30A 4GNKB 1LLOA 1OGBA 5CPSA 1EDQA 1IXOA 4I7UA 4UR8A 4D6DA 3W88A 1KFLA 4HNOA 5CBJA 1GT8A 1WDDA 3R4IA 2O7QA 1XBZA 1DJHA 4ADTA 2JEPA 2GJNA 5FEXA 1A5AA 3WJYA 1H2JA 4PRWA 2J6XA 2WJEA 2RDTA 1G4TA 2J7HA 1SMDA 4AC7C 2CHRA 3CAQA 4YIWA 4XZ9A 5IXEA 5KZDA 4IQLA 6CGTA 3SCUA 2EEXA 3SCTA 2X09A 4OUEA 2GOKA 4Q8MA 3F5JA 4QX4A 3IIZA 3ABOA 3LENA 4RW3A 2INZA 1UUOA 4MB5A 3VPLA 1Q3NA 4C90A 4NXKA 3VABA 3QRHA 4HB7A 2VYOA 3HPAA 4N9DA 4GYPC 3B9OA 2BGQA 5AVHA 3S4TA 1V8EA 3FVDA 5CBIA 1KBLA 1F7BA 1QI5A 1UWRA 3MTWA 5CPTA 4HZ8A 3EB3A 2H90A 2ZUVA 3W1NA 1FKWA 3WUBA 4XKMA 4MNJA 1JPIA 3ABQA 2PDYA 4GI6A 4WD0A 4HSNA 4OVXA 2BXZA 1LQ2A 3G1YA 1VRXA 4GD0A 4JFVA 1W5NA 1R5YA 1PL9A 3GM8A 1XW8A 3PZUA 3MCMA 2QJNA 4AMAA 1JCTA 3PP7A 3ZSTA 1PYFA 4LRSA 5KINA 3MSDA 4LS1A 4NT0A 5A6MA 5CZ0A 1UWSA 5IM51 1K77A 4X2PA 1KRAC 4S23A 4DJDD 1RCXB 3KWXA 5JU6A 2R94A 1S5TA 2ZQ0A 4HA3A 2TAAA 1HXJA 1R2TA 3CZKA 4WY0B 4LBSA 1E55A 4MWAC 4LT9A 5C71A 3NDYA 3MDWA 5CZJA 1X6NA 1GVSA 3W2NA 4AISA 1UKSA 3P8IA 4NNCA 4GQBA 1TG7A 3T0BA 1UHVA 3UG5A 1NIUA 1UC4A 3EX3A 3UJFA 3ZSSA 2C0AA 4H7CA 5K4XA 1UP3A 4F0HA 1Q4WA 2O0TA 3A23A 1XISA 4CD4A 1SO5A 3F1QA 2BNJA 5FD0A 1SR0A 3CUXA 2MANA 1O12A 2VFDA 3PZTA 3BCJA 3ATZA 3GFYA 3DBPA 2QCHA 3BGAA 2J9YA 4WOZA 4NILA 4PTNA 3QLLA 3OB8A 5AC5A 2C79A 4L6DA 3GD6A 3ARVA 1N8FA 5CGTA 3MSGA 3UR7A 3CMJA 4I7WA 4DJEC 2OTDA 4GQGA 2H3DA 2Y24A 4KEVA 6REQB 2WJDA 1W1YA 4PEKA 2YDSA 3CB8A 4E2VA 2X2GA 3MUY1 2Q6ZA 3CL6A 1L6YA 3HO8A 3JS3A 4NZ5A 4O17A 3STPA 5A6AA 5C6MA 5CZTA 2VRQA 2QJHA 3TSDA 4O10A 3DEQA 1JZ5A 3LD5A 5HPOA 2WHLA 2YR1A 5GNZA 1V02E 3ARSA 1CGXA 4RK8A 3CL8A 3S1XA 3WQDA 1E6PA 3D0CA 4F66A 4J2PA 3RO6A 2FVMA 1CLKA 4PTMA 5I0DA 4IQEA 3AXMA 1DHPA 2W67A 3BXWA 2HE5A 4QE4A 5CGQA 5E0FA 3SY5A 1R9YA 1XPGA 4DZAA 4HTBA 2TRSA 3GH7A 2PI6A 1V0MA 3LM3A 3RPMA 3WMLA 4RLIA 1AZ2A 2QDEA 3ARYA 4YTUA 4J28A 1OX4A 2ZA2A 4W7VA 3K1DA 2QCEA 1UKPA 3IJQA 1W5QA 4Q4RA 3TA6A 4XBJA 3FV9A 2VUNA 1U1HA 3NEHA 3O6CA 3VOIA 2O9TA 1TPH1 3URBA 1R3TA 4GC4A 3G5EA 3SCOA 2GUBA 4EF9A 1D8CA 2LLEA 1FRBA 1GYMA 1V93A 2WQPA 2EGZA 1RBAA 1CGWA 1ZBVA 1UJQA 1LQAA 3DKLA 3S2MA 1CW2A 3BQ5A 5F7UA 3U4FA 2GWGA 2ZXAA 1XI3A 2XDFA 5E9AA 4JTFA 4AUBA 4TVUA 4DBDA 4GXWA 1GVRA 1JUEA 2BMBA 2IKJA 5D2WA 3A13A 2ZZ3A 4LANA 1DJZA 3AIRA 3WFAA 5FJOA 3ARXA 3KVKA 3TONA 4EXQA 4J5NA 3QH2A 2A3LA 4M7TA 2BFGA 1BSLA 4YTQA 3NQAA 4UFMA 4JKMA 3TYEA 3PTQA 4G7EA 2PC8A 3WNNA 4L6OA 1GEHA 4MY1A 4F9JA 2FJUB 3F2BA 4HU4A 2NQHA 4JL2A 4LUTA 3DHPA 1K8ZA 1EC9A 4OBSA 4WDXA 1JPMA 3W7KA 3P14A 3KCOA 3PAJA 1XBYA 1LROA 1SFJA 2ZUUA 1E9IA 1QVBA 3CV7A 4OJYA 3WQ5A 3NYDA 4ZVJA 4J3WA 2VDHA 3EWXA 3LNPA 3ITVA 4MJMA 3IS4A 3QY6A 1LM1A 4C6DA 1VJSA 4J3UA 3R0UA 1PDYA 1IQ8A 2ODOA 4PSRA 4MJ2A 3GRIA 1UH4A 4JQ3A 1OT2A 4JX6A 7TAAA 1C9DA 4W89A 4I5XA 3GR7A 3PVFA 1GQKA 1BKSA 2VX4A 2JALA 3C5QA 1S1PA 1ODZA 4QCEA 3LBCA 3N19B 1J0JA 3U3HA 4ZXOA 2V63A 1V77A 3SURA 5I2UA 2W66A 4B5UA 2YKKA 4W8BA 5A8PA 4DUOA 4NP7A 3KEHA 1IV8A 4GKTA 2WW5A 2GK1B 4IQDA 1QHOA 2OU4A 1Z7AA 4C7GA 2WOQA 5D2VA 1JR1A 3GG1A 4EX4A 1JXJA 4L64A 3RLHA 1EF2A 3CHDA 3ZJKA 3H6OA 3KHJA 1MXGA 2C1IA 3L5LA 1EBGA 5D33A 4O28A 2VKZG 3A24A 3HG5A 4S3KA 4UQAA 1HL2A 1OX5A 3WQWA 2PP1A 4LAZA 4LQ1A 3PSWA 1A3HA 4ZE5A 3MUAA 1H63A 4BWLA 2OEMA 1JXKA 1E0TA 3N2BA 4LEFA 4LNYA 2IMRA 3S6TA 4RDZA 5FIPA 2Z1SA 4D1IA 3H21A 2WKJA 5T91A 2B7QA 2BASA 4JTKA 1G94A 4FO4A 3B4UA 4AWTA 2WMHA 4J3ZA 4GO8A 2JIEA 4NKCA 3ZOAA 3UESA 3UJRA 1A5NC 2WMGA 1FHDA 1XLDA 1AQ0A 2J8GA 4FF7A 1POKA 4XD6A 4BFAA 3R89A 1R8LA 4DWSB 1HGYA 3XISA 4GWEA 3ES8A 2G37A 4US5A 3QQ0A 2WNQA 2WLZA 4AX7A 1BKHA 3CTTA 1P4CA 1EJVC 4YLWA 4S3BA 4NVTA 4DI8A 3QW3A 4N4PA 3ZM8A 1UG6A 4CCZA 4JIIX 5A5WA 4KFNA 2FH6A 2WAGA 4A3HA 2FPTA 3ICJA 1R30A 4DXKA 3N73A 3QYQA 5AOUA 1TE6A 4MWAD 4WRHA 4V1YA 2FTPA 1ICPA 2WZEA 3AHXA 2OR2A 1TELA 1YNQA 6REQA 1ECEA 2E0PA 1PTDA 2ZWZA 5HR7A 4OWGA 2I9EA 1VF8A 3A3HA 2GJLA 1XG3A 3GXIA 2GGHA 5AHFA 4FLQA 2YB1A 1MEHA 1DIEA 3DIPA 3NGJA 1LF1A 3ID7A 3C2OA 3MP5A 4HSHA 1FCUA 4L9YA 4GJIA 2WZIA 3ZXWA 3G6MA 4XSLA 4TMBA 2J88A 3ZR4A 4B3ZA 5T9BG 2J4GA 4X61A 1OINA 3CZ8A 2A7PA 2PSNA 4AXKA 1LWIA 2QVNA 4JTQA 4DJED 4C6QA 4AHPA 5D38A 2YDQA 3E0FA 1TCMA 2ASHA 4JIHA 4UOJA 3VDAA 3FXYA 1HFBA 3PWGA 1EBHA 4RPPA 3WNOA 3EWCA 3NA8A 3T8QA 2D1ZA 1O5KA 2ZXBA 2Q01A 2PURA 2BLEA 5FF0A 3QMTA 2Z7KA 2ZRZA 1JDAA 2ZKMX 3A6OA 2PGEA 1Q2SA 3LCWA 2NQLA 4QAWA 3I3BA 4X9SA 3V0TA 1A5UA 4E2BA 4LVBA 1UASA 2OT0A 3CU2A 8RUCA 1KB3A 1XKJA 2NQZA 1VEOA 2EO7A 2QKFA 4ZEPA 4E2DA 2PWDA 3TOYA 2P10A 3CT7A 1W3TA 4R7WA 4DJFA 4MKVA 4AEFA 4EAMA 4Q6XA 1H5VA 2SFPA 1J11A 1S2TA 2VEIA 3HM7A 3CZGA 4AQLA 2VENA 1O94A 3QZ6A 1X6LA 2X8RA 3CO4A 1DL3A 4ILSA 3MMTA 2G8ZA 2VFEA 3OLGA 2XIMA 2QHAA 2BOGX 1Q6FA 3R13A 5HNUA 3B97A 2PGFA 1JZ4A 3NOEA 4RNIA 2YPIA 4Y96A 1FWDC 2PLKA 4DELA 2WO5A 2FB3A 5T8GA 1V08A 2X1IA 2GZXA 3LU2A 2FVKA 4P7NA 1TE1A 3WBAA 4JX5A 3KAOA 2A6NA 3BG3A 1FA2A 1LLWA 1TV3A 2PE4A 3JZUA 3WBYA 1TKKA 2OLHA 4WVXA 1S2VA 3HOJA 5EY5A 5F4SA 3N3TA 4PMUA 3STEA 2BHUA 2FLIA 5FSDC 1I8JA 2XWEA 3VC5A 3B8TA 3CL7A 3ZWTA 1HT6A 5FF3A 2ZBTA 3ITYA 1GOKA 4M51A 4JTRA 4O1CA 4MWAE 3PAOA 1FX6A 2F2KA 1HJXA 3FXGA 2XH7A 4JHMA 1OG6A 3RNDA 3O1NA 1IT8A 4LY4A 1UZ4A 1R3YA 5H91A 5JBDA 4UOZA 4J3SA 1BXNA 1GORA 1H7PA 4PR4A 1K70A 1X7FA 3H26A 4PN2A 4BA0A 5G2WA 2JGQA 4JBRA 1XLIA 4S39A 1I60A 3HG3A 3R6IA 4LJ3A 1YPFA 3KCJA 3TYZA 3S2JA 1VCGA 5T26A 3AMCA 4FXRA 1BSIA 1KNWA 5LIXX 3GVQA 4PUEA 3AI0A 3GHRA 2GK1A 2WMIB 2VEPA 3ERPA 3I4KA 1QNVA 1V6TA 4F0MA 2Z00A 2ZIDA 1UYQA 1SFTA 5CSRA 4D6IA 1RK5A 2E09A 2GPTA 3VZZA 2NXHA 1SYTA 3SJ3A 2Z25A 3WMBA 2PS2A 2VZUA 2WSYA 2XVNA 5EGRA 3MYPA 1GVYA 1ZTVA 4RKAA 5HDRA 4EANA 5F2GA 3DXIA 4ENLA 3PN8A 2X42A 4WZHA 3W27A 1HTIA 1OHLA 2QPUA 3S83A 4ALDA 3PBYA 3P84A 4ZOBA 3WNLA 1ONWA 1KFCA 5AYZA 3N13A 3G1SA 3H4XA 4C6MA 1H7WA 1W17A 2WMFA 1RR2A 4BHYA 2VDGA 4BJHA 4ZB2A 2CHNA 3P6LA 1W1A1 3EX6A 4AD4A 3PZGA 2HPMA 4HBKA 2OLSA 2WZHA 3OTRA 5LIUX 5F1UA 1C8QA 3CEUA 5D37A 2X30A 3O6YX 1OQFA 2EHHA 4D8LA 3AQUA 3NQGA 3QBUA 4IIFA 4PUKA 4GKLA 3WUEA 3N18A 5E70A 4DWSA 3EAUA 3GXTA 4WOQA 3UWVA 4O1AA 2Y5EA 2HE8A 3VFLA 3A12A 4I9JA 3EWUA 4MB1A 1UZ1A 3NQ8A 1TPFA 1VENA 2ATSA 2VFFA 1EPVA 1E6QM 5DANA 1DVJA 3RMEA 2OYLA 1KXHA 3VNLA 1BAGA 1X6UA 2YYUA 1NAL1 2PRLA 4Y9NA 4MUZA 3WL1A 4A3QA 4TMCA 2IQ0A 4IUGA 3W7LA 3G1AA 3SCNA 3T2QA 3H7RA 1F76A 4GH3A 5DT5A 4NJGA 2NVCA 4HT3A 2HJPA 4O1EA 5DMNA 1XH1A 3C52A 3EOEA 1ZL1A 1UMLA 4V33A 4GVHA 1BXCA 3TQVA 2AQVA 1J0IA 4BF5A 3ARRA 5ECUA 4B9ZA 3QY7A 3GTNA 3PUGA 3V75A 4BQ3A 1DBTA 3MJYA 1QW8A 1IE7C 4L7ZA 3LTYA 1AH3A 4B3LA 4UMCA 3FYPA 3NXLA 1TPDA 4QDPA 4J4KA 1M53A 4WGHA 1PTAA 1JQVA 4PMNA 4YPJA 5KZMA 3A4AA 1DQUA 4A4AA 2QCLA 3F4VA 4J27A 3O6AA 3WLPA 2G4FA 1XLKA 4G1KA 3B4YA 2DZSA 2PGWA 4CN4A 4EP8C 3KL3A 2VTFA 3N9RA 4WSJA 4DO7A 1LRTA 1LP6A 3LCGA 3LLXA 1AMYA 4MYXA 2RUSA 1IWBA 4XBSA 1FXPA 3TDFA 3SN1A 4KT2A 4HVXA 5DRCA 4UTUA 1CXEA 5LYRA 1XH0A 1AW5A 5A8MA 4KMQA 1HUVA 1GWJA 1XLBA 1N8IA 3WQPA 4W7UA 3VM5A 3BLKA 4IMGA 2UY4A 1YRRA 1BYDA 4H9ZA 2CBJA 1WZAA 4DLFA 1RD5A 2PDPA 1TIWA 2REQB 2IKIA 1N82A 3L0NA 3TN5A 2VX5A 4NZ1A 3I7RA 5HJYA 2Y7DA 1U2YA 2AAAA 2G3IA 2JKPA 3AZRA 1Y0EA 3OLDA 1HN1A 2CW6A 3CWHA 4JHZA 3CXOA 1KXTA 2A1YA 8XIMA 1E0WA 3MCOA 4UTMA 3DENA 4PBGA 1FWJC 2HEJA 2ACRA 3SRKA 3QGVA 5CAHA 1W1IE 1J0YA 1K9FA 1EJUC 4KS0A 2Y0FA 4ATWA 1J10A 1YX1A 3HGRA 2V2HA 1SW3A 4O4WA 5CJ5A 4IMDA 4DIAA 4AAJA 2G3MA 1QPKA 1YADA 3UWYA 1WOAA 4M7SA 5BOEA 2X0YA 1O1HA 1KQZA 1RD6A 4GIEA 1LDCA 1V6UA 1W1ZA 1XGDA 2WVUA 3A5VA 1W1B1 4F3HA 5H1WA 2XFYA 4MB3A 3SIMA 3USZA 4Y8FA 4B15A 1VIZA 4YN5A 1EC7A 4F40A 3GC5A 3RK8A 3GW0A 1TRIA 1AZ1A 4HNLA 2QS8A 1IZCA 1XRSA 3LHUA 4LEQA 3T8LA 5A6TC 3VNYA 2X1TA 4FNQA 1M7PA 1I1WA 3BV7A 3RIKA 4MJZA 3AHYA 1ISZA 2RJHA 1FWRA 1JGIA 4FPSA 3C0QA 1DWAM 5D8WA 3WLLA 2Y88A 3VKKA 4PTDA 3W7RA 3BE7A 1VB9A 4GYKA 4HN8A 4AD3A 3WJSA 1WA3A 4JQ2A 3LMYA 2WYSA 5G4WA 2WJFA 1TV8A 2HSAA 3URNA 1VCFA 1IGWA 5EKYA 5FOOA 1QAPA 4RZBA 1OGGA 4NX0A 2ACSA 2ABBA 2ZRVA 3TC7A 3GUGA 2WMIA 4KW2A 5DMLA 2PDKA 3TOPA 1JAEA 5EMMA 4B5VA 2XN2A 4ZE4A 3QTPA 3CNYA 1YPXA 3KRUA 3GYEA 4FP1A 3RX3A 4PMDA 1EX1A 2CXGA 2AL2B 4C6NA 2ZUNA 2QAFA 2NQJA 2P50A 1JYWA 3FKKA 4V27A 4EIVA 4GZJA 4CU6A 1B0IA 2V81A 4A8IA 3JR2A 1EFZA 4JTGA 1O68A 4FR1A 1WYIA 3UA3A 2XIOA 2YCJA 3BAXA 2XGZA 4W9TA 2DSKA 4LAMA 1E9LA 3GZAA 3GIQA 2J75A 2NV9A 1BLIA 5MKGB 3PPFA 3PBUA 1QR7A 4PFMA 2J25A 5HNNA 1NWRA 2J74A 3EYPA 4D6EA 2V2CA 3U4AA 3QQWA 1XFBA 4CNPA 2P1FA 2ZYFA 4S3JA 5DRIA 1DEDA 4WJ8A 3OVPA 3PUEA 4GH1A 1LL6A 1QASA 4HK6A 2PGRA 4PMVA 3B9DA 1JI2A 4O12A 4XBKA 4FNSA 2XH2A 4HPJA 2Z28A 3SDOA 1H50A 1WDSA 2ZXDA 3IWPA 5J5DA 4Z2LA 3HFYA 4HNTA 2OZ8A 1SGJA 1JZ2A 1PZ3A 2Y7EA 1TCDA 4YU1A 3V1PA 3UCQA 3F4WA 3CPRA 4INFA 4IT1A 1H62A 3LTSA 4QJ3B 3TTEA 1PHWA 1H1NA 3SCQA 3PTMA 2OXNA 3Q67A 2VVSA 5EL1A 4MNKA 2BY2A 1PIGA 3V0SA 4MHBA 3H22A 3WDIA 4B2DA 4HTYA 4GJ1A 1ISWA 1DIKA 3ELFA 5J04A 2XUCA 1M04A 1QU4A 3CAVA 3GHUA 1MRAA 3QF0A 1XSIA 2VVNA 3CQIA 4LBUA 4QJ5B 4J2MA 1BF6A 3RF9A 4DN1A 2Y70A 3AAMA 3SY1A 4U2YA 5CPLA 1S5NA 3SCRA 1X96A 3I6EA 4ZSUA 2UBPC 1H7NA 1EQPA 3UPBA 2J79A 5BOFA 3PUOA 4DAIA 1ZS2A 1ZENA 1GKRA 2IPJA 4MLJA 4UZUA 2A2IA 3RLUA 1W3HA 5GJPA 3KOFA 4FXJA 3L4VA 4JIEA 1RH9A 4NYUA 1PUDA 5IBXC 2J9ZA 3NPXA 4BR1A 4Q8UA 4IPPA 3M46A 1JNDA 5A94A 1Q7MA 1RVKA 4L4PA 3OPSA 2WZMA 1LOSA 3WUFA 5E0KA 3VNIA 3W7NA 1FWIC 1XLHA 4WDUA 3FJ4A 1ISYA 2YBTA 3BPWA 4PFHA 1W9VA 2AMXA 2VZOA 1UUMA 2DZWA 2REQA 3AJXA 2FFIA 1S3HA 4HOWA 3B9AA 4CKQA 3G18A 5FAGA 5ABEA 5TAOA 4L5ZA 5AN7A 3IJIA 3T0DA 3TCEA 1QOPA 3CMFA 2A79A 1S2AA 2X40A 1HO4A 3GE7A 3QVQA 3M0ZA 2UWFA 3BMVA 4GBDA 1MEWA 3VGGA 3CYVA 4ZQCA 3NDZA 4HYWA 3VIOA 3IGUA 2YCLB 5D9NA 3MY9A 3SCSA 5D09A 2PWUA 4D6CA 2YJQA 1VZWA 3E38A 2QV5A 3UWEA 4XQ6A 3A21A 1V3IA 4OIFA 4R27A 4HNVA 3E2QA 4NHVA 1RHCA 2IPFA 4JXCA 1ZGDA 5AYXA 1SJBA 4M1RA 5LSMA 3GK0A 5I24A 3CQ0A 2Y8VA 1PBGA 2PWHA 2V3GA 4PB5A 5TQLA 2WHKA 2ZDRA 1ITUA 3P62A 1GOIA 3R0DA 3TV8A 1UR0A 4B92A 3EOUA 4GFIA 1Z32X 3I6TA 2CLKA 3M1ZA 4FK9A 4GYJA 2PB1A 1R2RA 2XU2A 1OBAA 4QCFA 5TBOA 2ZA1A 5BXRA 1TVNA 1CLXA 4JN7A 2OSWA 5EMUA 1F07A 1OFQA 1H41A 2ZE0A 1A4MA 3MCNA 3SSJA 1Z42A 3SFKA 4D1JA 4Q7BA 4PTXA 3N29A 4AG0A 4L1WA 1A4LA 4HCLA 5A6LA 4PYSA 2OKTA 3EDKA 5C2XA 2DIEA 3E9AA 3SUTA 1Q45A 3MO4A 4HQVA 4ML4A 1KA9F 2PU0A 4NYYA 1NDWA 4OOUA 1O66A 4OE7A 1DWHM 2W62A 4GFSA 1ZBWA 4X9YA 4OU1A 3AIWA 2QGYA 4L56A 4K7YA 4NZ4A 3WF2A 3BV4A 1K4GA 1KM1A 4NZCA 3LSCA 1E71M 2G41A 1B31A 3MSRA 4B5NA 3CH0A 3VD4A 2AL2A 4GVGA 1UKTA 2PDJA 1ADSA 4TO8A 1EJTC 4MZ1A 2ACQA 4CCEA 2WCSA 4IQJA 1DE6A 4MADA 2BVWA 4PSPA 2DP3A 3UEQA 5C7HA 4YTRA 4GIRA 1EUAA 2GOUA 2OGJA 2DZTA 4Q4MA 3LQLA 4RDYA 1E5NA 4O0QA 4XAFA 1GOXA 2QJJA 1B54A 1T96A 4YNGA 5MKGA 1B2YA 2HXUA 3IIOA 3W2JA 2DZBA 4GZEA 1GEQA 1WZMA 2XFFA 3GDMA 1R3VA 3DFPA 5HBFA 4NJJA 5HNTA 4FXFA 2VX6A 1YE4A 1XS2A 2GDQA 4AH7A 1M1BA 4H3DA 4Z1DA 3RCMA 2E9LA 2VCAA 2CKRA 4HMNA 2QDDA 1MFUA 1FTXA 2XTKA 4LAKA 1V3JA 3ABZA 5GJNA 2FHCA 3U2CA 1PWMA 4FR6A 3VX0A 2JGYA 7ODCA 3MKCA 4MNMA 2ISWA 2X16A 1SZFA 4Y9PA 1Z48A 3UJSA 5BRQA 3KP0A 1BHGA 3B8IA 2BHYA 2PTZA 4P8VA 1VBHA 6ALDA 1FP8A 3LUTA 4K1GA 1E40A 2V38A 2D0HA 3CHCA 3UY8A 4MPKA 3KBWA 3EWYA 4IMAA 4XV0A 3KZSA 4PL1A 5C2GA 3M0LA 4PMQA 4Q8OA 1UUQA 3KBSA 2YCEA 3AU6A 1XPYA 3BMXA 2XVLA 4G6CA 1ZAHA 3SRDA 3BSHA 3W2UA 3TK7A 1Q63A 1XV8A 3OU8A 4EVZA 1GYLA 1J2WA 4UZSA 3QTGA 5LKYA 1GVIA 1W8SA 3KW3A 1KQYA 5HINA 4O8AA 3TMQA 1EGZA 3I6RA 2IPWA 4HA0A 2C14A 3KOYA 4IISA 2E67A 2VELA 5AZ0A 3EKZA 1XBVA 3WDQA 1ZB5A 3H2MA 4IG2B 2PWGA 5EMYA 4XIAA 3FGCB 3RXZA 1ME9A 2NVAA 3N9KA 1E1FA 3OBEA 1PV8A 1U1UA 4QDMA 2QJMA 1V3HA 4GZ7A 1AH0A 2BBFA 3NURA 1WAWA 1FWEC 3GTHA 4DUVA 4MPQA 2ZICA 2GSHA 3PZQA 2DDXA 3ARUA 2WCGA 4F9DA 1DJWA 3C0SA 5KZ6A 4HU8A 3K8MA 4DJDA 4AZGA 3NEVA 2PLCA 1VYPX 3QW4B 5A6SA 1DHKA 3TXZA 3VNMA 1R85A 2J7FA 2VL4A 4AY1A 4JTIA 2GVJA 4IIGA 2IPGA 4LS0A 3ANVA 4X22A 3KM8A 5LNSA 3ZMRA 1KM3A 3CZJA 3N2OA 1R6WA 1WXJA 2G96A 3S2LA 2FZBA 1K7EA 3U5YA 2EG6A 1Z41A 4IL2A 3AISA 2QXWA 2WK2A 2V3DA 2YCLA 2YFNA 2WKGA 3N12A 1B3VA 6ENLA 3TKFA 2QVHA 3CYJA 4IIHA 3BLDA 2YB4A 4HHLA 1QNPA 3ZYZA 2VEFA 3WQOA 1M5WA 1VFUA 3VZXA 5CC7A 2R8WA 2WPBA 3LBMA 1JRCA 3PZMA 3CV6A 2Q8LA 3WH9A 1Z6KA 1UKQA 1QWGA 2W3ZA 1LWHA 2D23A 4QLKA 3WFLA 1XYZA 2FH8A 2HQAA 1RSCA 5FF7A 2DSZA 3LDVA 3B40A 1KRCC 2NX1A 4HMDA 3GG0A 2VQUA 1N8WA 5IDIA