3M0KA

Structure of oxaloacetate acetylhydrolase in complex with the product oxalate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
294
structure length
289
Chain Sequence
DEPFSGAKKLRHLLENTDELIVCPGVYDGLSARTAMELGFKSLYMTGAGTTASRLGQPDLAIAQLHDMRDNADMIANLDPFGPPLIADMDTGYGGPIMVARTVEHYIRSGVAGAHLEDQILTKRCKKVVSRDEYLVRIRAAVATKRRLRSDFVLIARTDALQSLGYEECIERLRAARDEGADVGLLEGFRSKEQAAAAVAALAPWPLLLNSVENGHSPLITVEEAKAMGFRIMIFSFATLAPAYAAIRETLVRLRDHGVVGTPDGITPVRLFEVCGLQDAMEVDNGAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxaloacetate acetylhydrolase
publication title Structure of oxalacetate acetylhydrolase, a virulence factor of the chestnut blight fungus.
pubmed doi rcsb
source organism Cryphonectria parasitica
molecule tags Hydrolase
total genus 109
structure length 289
sequence length 294
ec nomenclature ec 3.7.1.1: Oxaloacetase.
pdb deposition date 2010-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3m0kA00
4JPGA 1E0UA 3LG3A 3LYEA 1DXFA 2L5HA 3BJFA 2E28A 3E0VA 3QQWA 2DIKA 2VGIA 3GR4A 4B5WA 1T5AA 3VAVA 4IQEA 3HQPA 2HRWA 2KX9A 2VWTA 4MG4A 3QV6A 4QG6A 1A49A 1O66A 3ME3A 4MF4A 3SRFA 4L9ZA 4B5TA 2OLSA 3QLLA 3EZ4A 4IMAA 4IP7A 4QG9A 1S2TA 3E5BA 3SRDA 1KC7A 2V5JA 4WJ8A 4TV5A 3PP7A 3QV8A 3I4EA 1S2VA 1PKNA 4B2DD 1F61A 3GG8A 1A3WA 3MA8A 3SRHA 1SGJA 1PYMA 3T0TA 5JVLA 4RPPA 3M0KA 4KCUA 1UJQA 4TV6A 4HYVA 1M3UA 4B5UA 1OY0A 3HQNA 3E0WA 1A5UA 4YNGA 3KTXA 2XDFA 1OQFA 2VWSA 1F3WA 1PKLA 1S2UA 2XZ7A 4KCWA 2VGGA 2BG5A 3SRKA 1XG4A 3FA3A 4QG8A 3M0JA 2QIWA 2VGBA 4B5XA 1PKYA 1F3XA 3B8IA 3QTGA 2V5KA 3QV9A 4FXFA 1A3XA 1U5VA 1IZCA 2R82A 2HJPA 4B5SA 4KS0A 3EOLA 1DXEA 4IQDA 1M1BA 3N25A 1GGOA 4YJ5A 1VBGA 3T07A 4LSBA 3FA4A 4HYWA 1S2WA 3KHDA 3GQYA 2HWGA 2DUAA 2X0SA 3H6OA 3IS4A 2XZ9A 4L7ZA 3EOEA 1U5HA 4G1NA 1XG3A 1MUMA 4L9YA 1VBHA 4ROQA 3BJTA 2ZE3A 1DQUA 2VGFA 1DIKA 4B5VA 1PKMA 3P0XA 3OYZA 1Z6KA 4KRZA 1F8IA 3OYXA 3QZ6A 1IGWA 3G2GA 1AQFA 4QGCA 1F8MA 4KCVA 5TAOA 4FXJA 4L80A 3U2ZA 1O5QA 1O68A 3QV7A 4KCTA 1ZJHA 3T05A 2HROA 3PUGA 4DRSA 3HQOA 1ZLPA 1KBLA 3R4IA 1E0TA 2WQDA 1JDEA 3EOOA 4B2DA 2G50A 3OQ8A
chains in the Genus database with same CATH superfamily
2QF7A 1X8FA 3CV2A 4Q7BA 1R8LA 3K4AA 3W9ZA 1SW0A 1F76A 4XG1A 4UTTC 3N4FA 3DFSA 3ITTA 2F6XA 4LUSB 2FB3A 5HMEA 1XW8A 4HQVA 2G3JA 2XVPA 1M04A 4CKQA 3WLLA 2ZVIA 3COTA 5FF2A 3T0DA 4FLOA 3ANYA 3VNDA 3I4EA 3ARSA 4MJ4A 2Y0FA 1I2PA 1H4PA 1XJBA 1Q85A 1IT0A 1K4HA 3BL3A 4JX5A 4QEEA 1HN1A 3PZNA 5BROA 1E3XA 1I6NA 1W1VA 2ZRYA 5EMYA 5LA1A 2RGMA 1JUEA 1ZTVA 3UU0A 2J7CA 1B0IA 3GUWA 4QHRA 3T2OA 2JEQA 2GUYA 3QTPA 1KFCA 2IS7A 3NDYA 1IXPA 4C6IA 1MWOA 3TROA 3FCPA 3DOPA 3DXIA 1MUMA 2E09A 1QW8A 1UC5A 3KL0A 5HAOA 1P7TA 4O57A 3PZ9A 4YTQA 3GK0A 3UZWA 1C92A 2I14A 3CEUA 1RHCA 3NQDA 2J79A 1OC6A 3FEMA 3P7YA 2XGIA 1KCKA 3A47A 1O5KA 1DWHM 1NTHA 1MW2A 3VNYA 3GU1A 2VVNA 1TPFA 1ZENA 3S5SA 4BCEA 1S38A 2Y2WA 1JCMP 3N6JA 4EXQA 1XXXA 2GZXA 1XLLA 2PBOA 4OJYA 3GU2A 2WSYA 4GZEA 4LCSA 4PB3A 4MGGA 3ARRA 3VOJA 4JTQA 1HKJA 2V2CA 2AQVA 4GHRA 4HHLA 2VEKA 4AWTA 4FX8A 2WNNA 4IG2A 1E6XM 3GVWA 1XC6A 3LLDA 3QBUA 2CLHA 1P43A 5A8PA 3EEGA 2NUWA 4B4FA 4O52A 2OQYA 1GW9A 4Q8MA 3KAOA 3T42A 1TR1A 4OV4A 1QO5A 2XWDA 5A3HA 4UZUA 3QHMA 3W83A 2ZXDA 2AAMA 2NT0A 9CGTA 1VRXA 2BHZA 3DFYA 3FK4A 4YPJA 4OOZA 3IS4A 2XZ9A 1UKOA 4AVNA 3SCRA 2OOGA 4R34A 5DFAA 4GO9A 4ACZB 3WQVA 4I6VA 1CB7B 4RL3A 4ECLA 3DN5A 2V81A 5C0QA 3DCPA 1SJAA 3ARXA 1EO5A 4A6GA 4O12A 5C9ZA 1YNQA 1FCQA 1W91A 4BS0A 5F4SA 2OKTA 3GZ3A 3KBMA 3PFRA 1KBIA 4Y9OA 4MAZA 4P8VA 1MYRA 5G5IA 3NQBA 3UCQA 3M5XA 3EZ4A 2B81A 1YDYA 3EOSA 3C2OA 3QZEA 4HOWA 3VX1A 3WYZA 3GDMA 1I8JA 3ARUA 4IICA 1UKPA 2J8GA 5G2WA 4JEJA 1MQPA 1IIGA 3AZRA 4HYVA 4DB7A 1GQLA 3C3UA 3HG2A 2IXVA 2QUTA 1W5MA 4FP1A 4Z0SA 1Z3NA 2D20A 4EK7A 1OG0A 4ENLA 3OIHA 1EGZA 3HPFA 1UWSA 5RUBA 1UIOA 4EANA 3O05A 5LIXX 1H49A 1O6IA 5EFFA 1YNPA 2VEIA 3LEPA 4YN5A 4W5UA 5AKQA 3SGGA 4N0RA 2O9OA 4L1WA 3QPZA 4CQ8A 2ZA2A 3BLFA 4YTTA 1H1ZA 4GNJA 2GGJA 1S2WA 2RDXA 2ACQA 2FZNA 3SB0A 1OCJA 1DJHA 3ARVA 3TW6A 3PUDA 3L7RA 1PXGA 2WJDA 2CLPA 4O14A 2RH9A 8RUCA 4KIRA 2BBFA 3QFEA 2A7NA 4GGHA 1ZLPA 3C0SA 4P8WA 1W5OA 6TIMA 2J7FA 1S5TA 3F7JA 5FJPA 4U10A 1KFWA 3NSNA 4GXPA 3QC3A 3MWAA 4X2PA 1P6CA 3SCQA 1TQJA 5CPSA 3H22A 4K8GA 1ZBKA 2YL9A 2EJAA 3T44A 3WSUA 4LBSA 4CD4A 2ABAA 3HQ1A 1C3FA 3LSCA 3ALFA 2D24A 2QPSA 4MY8A 5AHFA 2X40A 1TV3A 5T9CE 4JD4A 1GOMA 1WO2A 1KBKA 1OFPA 3LDVA 2FKPA 2QGYA 4P7QA 1ICSA 4J3UA 1EQPA 1E4NA 5D9OA 4PTNA 4JKKA 4HCDA 2CLLA 1SR0A 3R1ZA 1XGDA 3PY2A 2EPOA 4HMDA 2Z6JA 1CGVA 1FWGC 4NAFB 3GW0A 5TIMA 3NOYA 3UJEA 3P3BA 1W31A 2D1ZA 3SJ3A 1XIMA 1E6RA 3VXGA 3VUSA 3QR3A 4YHGA 2OR2A 2J74A 1EJUC 3VTRA 2VFHA 5XINA 2BS9A 1GJWA 1ZPTA 4MPKA 2Z1WA 4GBUA 3R4IA 2XN2A 2QCDB 3G8EA 1H3GA 4ZB2A 3R8GA 3B8TA 1SJBA 3CMGA 2Z7GA 3VKBA 4U31A 2WAGA 4YU1A 3SIZA 4ZQPA 3M9YA 4MY9A 3A3WA 3NDOA 1S5WA 3M0LA 2A85A 4W8AA 3S1VA 3KVLA 3BMXA 2XSXA 4TO8A 1HP4A 4US5A 4HB7A 2EG8A 2GSEA 3EDJA 3V1HA 2PTZA 2DUZA 2FLIA 4PCTA 1RCXB 4JTCA 4LNCA 2WCGA 1DJZA 4K39A 4GLEA 5IXEA 4J9JA 1NFPA 3R5EA 2R9RA 3RR4A 1ZP4A 1FWJC 5XIMA 2XWEA 4BWLC 1J0JA 4AYGA 1OX4A 2PRHA 5EMKA 3F2DA 1CI1A 2BXVA 3UWVA 4UB9A 5CAKA 2Z1SA 5CPNA 4LOCA 2DSUA 3I6RA 2C1GA 3GQYA 4MZ8A 2HWGA 1XLGA 3U0HA 1XR2A 1EF2A 3B9AA 3GNDA 2YLAA 3PNUA 4K7VA 3S47A 3VDBA 3BK0A 1ZY9A 3AI0A 1WAUA 1X96A 1KW1A 3GC5A 3V5FA 1ISVA 3W73A 2OO0A 3IIXA 4RNHA 1Z48A 3QQ0A 5CEWA 4JQ2A 2PGEA 2DZTA 2BHYA 4MNLA 1VZWA 1K6WA 5F2IA 1B57A 3BLEA 3WG6A 4JXCA 4XIMA 3C2FA 2WSKA 1VB9A 4F0SA 2A6NA 5I09A 4XAYA 5F4WA 2OSYA 3ONCA 4DN1A 2JFEX 3SCUA 2VO5A 3CZJA 2V67A 1YPXA 1W3NA 1TWZA 4A3UA 3HJEA 4JTFA 4FOUA 1A5MC 5E9AA 3HZ3A 4O8RA 2WVVB 2XH2A 2VZOA 4PBEA 1L6WA 1TVNA 1AD1A 2J9YA 2WZMA 3CC1A 4OZOA 1FP9A 1XH2A 3HG4A 4HCHA 5EBUA 4N9BA 4LPCA 4EACA 3R58A 1KRBC 2DW6A 2PWGA 3IIZA 1NDVA 2F61A 2NT1A 1J0IA 4RK8A 1E1CB 4NZ5A 2DSWA 1XIHA 4MYXA 4AH7A 3EOEA 2EEXA 5HDRA 1KGUA 3UR7A 3OPSA 5K9XA 2V82A 1ALDA 1KV5A 4HHHA 3WF3A 4JTEA 2E5DA 4KMQA 3TQ0A 3WUGA 4DUXA 4O28A 2VEFA 3QEZA 4UWMA 1OCNA 3FGCB 3IVUA 3STEA 3CPUA 2V6AA 3ORWA 2Y88A 1WYIA 5H2ZA 5GNXA 1UMLA 2HEJA 2PDKA 4LYPA 4ERGA 2RDWA 1O12A 2QULA 1L9WA 3O2LA 3DG6A 1HO4A 1TPB1 3EWZA 3HV8A 2GJXB 3C6CA 1J11A 1RA5A 2YW3A 3THDA 1R7AA 3VU2A 2FGBA 4FNSA 3MUXA 3U6WA 3WZ0E 1F6PA 3VO0A 2AGTA 1E6NA 3BANA 3A21A 2YA2A 3UR5A 3VGGA 3ISIX 5EU9A 5MKGB 4R9OA 2JE8A 3MZNA 1E70M 2XDFA 4NZ4A 1E5JA 3PF3A 5FCZA 1CB2A 4KCWA 2VGGA 3TYEA 4JTRA 3STFA 2VUYA 4JL1A 3GXDA 1ZRQA 1CXKA 3EDKA 4ZQRA 5I02A 1RA0A 4GKTA 4LBUA 4JX6A 2KAUC 1BRLA 5AHEA 1BTCA 3O6DA 1B2YA 3JS3A 4EIVA 4H3DA 1VGAA 3ZZ1A 2Z1XA 2PPGA 4ROQA 1U33A 3PWAA 4AZIA 3DHDA 3W7MA 1M01A 2XFWA 2XH7A 4CQ9A 4HYRA 4BY3A 1K8YA 1YPIA 3OLIA 1GKPA 2PWUA 4HA4A 1XIGA 3M0ZA 2W61A 3LYEA 3QMSA 2E28A 3OZYA 1RD6A 3E0VA 3TYAA 4YVXA 1ZBWA 4NKCA 1TMHA 3EXTA 1UD6A 2HMCA 2VMFA 2FGLA 4QG6A 4TX8A 2FZDA 1JCXA 2CU0A 4JIRA 3QKZA 1K9TA 1UR1A 2Y5SA 1AFSA 2EO7A 2PF0A 3TLQA 3OU8A 4DBSA 3VKCA 2VRQA 3CL7A 4JCMA 2Q8LA 3QVQA 2QLYA 4IP5A 1J5TA 4B5UA 2FZ9A 4KEVA 1VJSA 1R3SA 1Q7ZA 5AN7A 1XD1A 1G4SA 4GVIA 1T41A 5HMDA 4R3UA 5A6BA 2G96A 4X60A 1XIIA 4QE1A 3P93A 3MMUA 4O19A 2XPKA 2CLKA 5AC6A 1JF5A 3PJWA 4OBTA 1VH7A 1CGTA 2VFFA 1QATA 5PTDA 3DBPA 4FS9A 1RBAA 1IQ8A 4GE8A 4KS0A 4V15A 3WQWA 4HMCA 2W5FA 4KRUA 3WNOA 2I5QA 2GQ3A 2VEPA 2POTA 1Z8AA 3W6LA 3UJ2A 5FAJA 3C86A 2VFIA 4Z2LA 1YDNA 1RCOB 3GHRA 4V28A 4QEHA 1TTIA 4RR4A 3UNTA 3RN6A 3CZEA 3CASA 1B5TA 2YB1A 3KVMA 3NEVA 3LPGA 4GH3A 3VA8A 1ZHAA 4BK9A 2J24A 3V7PA 3WDHA 1AK5A 1KQYA 5AC7A 2GJNA 3BAWA 3LHTA 3ITOA 2BY1A 4MJ2A 1EUAA 3HF3A 4QE5A 5ABTA 3T2QA 1REQA 3SCOA 3VMNA 4TV5A 3WQGA 2PGFA 1Q2SA 1TJ2A 2VQUA 2J7HA 3FOKA 4RZBA 2JK2A 3U48A 4V1YA 4JQ1A 4L6HA 1YBQA 3KOYA 1PSCA 4GBDA 1IWPA 4FLRA 3SJNA 3V16A 2Y8UA 6CGTA 1A50A 4UFIA 3M6DA 4O4VA 4AD4A 4Q8QA 5K4ZA 2AQOA 1I2NA 3GVQA 2FTPA 4N9EA 4I7UA 3BG3A 1RSCA 1K77A 4IG2B 3NSXA 3LQLA 1X98A 4AZCA 1XLHA 2QMJA 4QTGA 4GQRA 1X38A 2VX5A 2CLEA 1R6WA 3UJSA 4EKJA 6REQA 1UA3A 3T8LA 2WQPA 1BYBA 3QZ6A 4LY4A 2VCCA 5A8QA 3A4XA 1XFBA 1AW2A 2DY3A 4CNOA 4KGLA 4PUNA 3CHEA 1XYLA 3TJIA 3M46A 1RJPA 3DGBA 1IXOA 4WEVX 3VD4A 3F4CA 2UV8G 1EGVA 3R11A 1X1NA 2R1NA 3AMCA 4BI6A 3ZVIA 3M5ZA 1HX0A 3OVQA 1AZ1A 1JFXA 6ENLA 1IXNA 1YXCA 2CLIA 4DYKA 1A0EA 1HQTA 3FHQA 3WY1A 2HXUA 2VZVA 1T40A 1WOAA 1JI1A 4REQB 4IX0A 1AD4A 2OT1A 2F8QA 1GZJA 4IIDA 1B3YA 1PYMA 5HPCA 5JVLA 3PJXA 1WDSA 4CNNA 1FY6A 2VOMA 4H04A 4GYFA 3WQCA 4ZA0A 1MXGA 3BV7A 1MNZA 3C2YA 1BKSA 2VX4A 1ML1A 2QCHA 2ZBTA 1TFVA 4D6FA 4B5XA 2QJJA 3ITXA 4MKSA 4S3JA 1P0KA 2V5KA 4H9ZA 1C29A 3B04A 1JFHA 5I3KA 3RJXA 3O3RA 2YIHA 3G1VA 4QFUA 4KW2A 4S3DA 4F0RA 2Q3RA 1UD8A 3CUGA 1JPKA 4A3HA 2IPWA 4R5EA 5KEZA 3GVGA 1LQ2A 4C6KA 3QSRA 1UUMA 2OELA 3MC5A 3BAXA 5HUOA 2A3AA 1VF8A 1DE6A 4O1EA 3GYCA 3QYSA 1Z89A 2FVLA 4OUIA 2WMGA 3AROA 1A5BA 2RGLA 3KOFA 3GX9A 3G1AA 4G2DA 2OB3A 1CGWA 4H9VA 2C14A 5HNNA 3GAYA 3WF1A 3FV9A 3LCWA 2G37A 4JFSA 2CHRA 2INZA 4MVAA 3BW2A 4NAEA 1NSJA 3QGAC 4JAWA 3AIEA 1GKRA 1R3VA 4KBXA 1QOXA 3AALA 3SRHA 3BLPX 3TQVA 4M19A 3P0WA 4IPIA 3RLHA 1OK4A 1SPQA 1TQXA 2WHJA 3PBYA 3AUJA 3JUGA 1E55A 1HJXA 2W3ZA 2QIWA 2C1IA 5HJYA 4AEFA 1T7LA 1AJ2A 4JICA 2PE4A 1ITCA 4RNFA 4CNPA 4CEXC 3FX4A 2ZX9A 1PB0A 5FL1A 5EBAA 1VFHA 2IPGA 3SGUA 4DJFC 1E73M 1V3HA 4HK6A 4L7ZA 4RKAA 4N6FA 1S5VA 3NPUA 1J0HA 1S1PA 2F6UA 2QF8A 4Q8TA 4YTRA 2ZE3A 3IJLA 4P61A 5KITA 4J27A 2FMOA 3GFZA 1RP8A 1FCVA 1HKMA 2PD5A 3OZOA 2YSWA 3BSMA 4UBPC 3UGVA 3ZIZA 5C71A 2G0WA 2OOFA 4WD0A 4H01A 2YCJA 2GJPA 3W02A 1E1EA 4TIMA 1FKXA 3EXRA 4ZXOA 3PB0A 3ARZA 3KTCA 4X0NA 5CC6A 4IQEA 3EX1A 1F73A 1WZAA 1AVAA 2PLJA 4QRNA 2QDHA 1XLIA 2QYGA 2GSJA 2RDTA 1YRRA 1RQBA 4IMCA 3R8RA 3IPWA 1SQ7A 3H12A 2WVSA 2WMKA 1VPQA 2DVTA 1AQMA 1RQHA 3NYDA 3PZOA 2I57A 4I7VA 4N2YA 1RJRA 1A5SA 3OLDA 5AY7A 4F0LA 4AIEA 2DJXA 3AHTA 3ENLA 5ECUA 1Q6EA 3VNKA 4HTBA 5K2ZA 4ZFCA 2RJHA 2FZMA 4F0MA 1AH4A 1IF2A 1UKQA 1LLOA 1UYQA 4M6UA 4DBDA 3QR1A 2PWEA 4E38A 4UFHA 3VOIA 3XINA 5LNVA 2PMQA 3R7MA 3KHDA 4IX2A 2J25A 2QUUA 3WX7A 2E6YA 1PHQA 4AC7C 1CDGA 5I3GA 1QASA 2ZOXA 4D8AA 2WKGA 1UIPA 3QW3A 4TMBA 3NQ8A 5CG7A 1W3LA 3PG9A 3ARPA 1Q63A 1UC4A 3B0UX 2FZ8A 1W3HA 4LVDA 5I3FA 2J8FA 4KWOA 4EAMA 2BY2A 4GMEA 4GI4A 4FX6M 1WP6A 1QBAA 3TUUA 3LNMA 3MYOA 1VIZA 4IFKA 1OIMA 3CL8A 1V3LA 1M6JA 2XH4A 3RPMA 9XIMA 4RDWA 1EDGA 1XLMA 2X1TA 2QJGA 1WUFA 1LTDA 4HOXA 1MFUA 1JZ7A 3AXIA 3MY9A 3AWNA 3W29A 3W28A 1EFZA 2BZNA 1Q7MA 4LAUA 4CGTA 2AMXA 1PDYA 7CGTA 3BARA 4TVDA 3CQJA 3W74A 1W2PA 3W1RA 1XS2A 1A0CA 1OINA 4DX3A 5BU9A 2V38A 3SUVA 3MUAA 3W82A 1UASA 4BEQA 4U5KA 5C9XA 4GYJA 1QPOA 3BCFA 5CJ5A 2GPTA 3BOXA 2G3NA 1EC9A 2VFEA 3PAJA 4CQDA 5CGMA 2DQXA 3P82A 1D3HA 3VFLA 1GORA 5DCEA 2F6KA 1OGGA 4KPLA 2DUXA 1NAL1 1D7KA 1S3HA 1WV2A 1LT7A 1HIZA 2FPTA 2WKLA 3GNXA 4PFHA 4MB1A 3W6MA 2BLEA 3FJNA 1HNYA 4EE9A 5JBFA 4Q4RA 2QJNA 4B91A 5A8GA 3NQAA 3ZR5A 1Q7QA 1OSEA 2FDSA 5H8MA 1OCQA 1HP5A 4UTIA 2P88A 1O7AA 2OGJA 2ZDSA 3UXKA 5IDIA 5AYYA 2E9BA 3LY0A 2FZBA 3UZZA 1E51A 3W7OA 3D47A 4HA0A 4DXXA 1KC7A 1J96A 1WXJA 3UBPC 1DTNA 1I45A 1XH1A 4JR5A 2HNEA 1V6TA 3IAQA 2TPSA 4URIA 1I75A 1K8ZA 2PEVA 1FWDC 4LVAA 5SWUA 4NNCA 1XLCA 2WC3A 2WMFA 1B1YA 4AHPA 2GOUA 4ZO6A 1QAPA 4C5YA 3S2CA 2W63A 2DZUA 2D2JA 1PIIA 1VCFA 2PDBA 4DNMA 4IF2A 1QOPA 3WMCA 2Q8XA 3E49A 1A5NC 1E15A 1N82A 3NVTA 2R82A 4JHZA 2ZX6A 3OIXA 4O0ZA 1XICA 1EA9C 4AZGA 4YTUA 4YHEA 2GDVA 3TWBA 1WBJA 3BLDA 2IKJA 2NWRA 4G1NA 1KM1A 4NX0A 3N2CA 3QOKA 1NVMA 5HMFA 1BSIA 1EL3A 3DUGA 3BXWA 4IPNB 2PDMA 3FKRA 3BAYA 1BG4A 4KKXA 4TUFA 2VZUA 1KFBA 4DJFD 1AQFA 1LYXA 4IPPA 4HHMA 1PWLA 4Q33A 5REQA 3HG3A 4FLQA 4HVXA 1VCVA 1FWHC 1HVXA 3AXHA 4JTDA 1SU5A 3S0CA 4I5RA 2Y63A 3NQEA 4F4RA 1QTWA 3G5EA 5H8UA 3N2TA 5ABEA 3QGKC 3W88A 3BLOA 1A49A 2GWNA 2C8NA 5A1AA 3W85A 4R53A 1C7SA 2QJHA 1WA3A 3CL6A 1K7XA 5GJMA 3GZAA 3GKFA 1AJZA 1QCWA 4Z2HA 4PTWA 2HE5A 1NOFA 1G1YA 1NY1A 2YZRA 4UZSA 1UR0A 2UWFA 5JIPA 1T8QA 4DWSA 1W1IE 4EOUA 3SFWA 4CN6A 3P60A 1UOKA 2A7PA 4PODA 1BVNP 1L6FA 5AB3A 3WNMA 3S46A 4DO6A 1VYPX 4PMDA 1MUWA 4Z42C 1VRDA 4YWIA 3DYMA 3MDUA 3CNYA 3ABSA 5CQ1A 4UTHA 3T07A 1GG0A 1VFTA 4M6QA 3NQCA 1CLXA 5EYWA 1K7FA 4Z2JA 1E9IA 3EMCA 2VELA 5HR7A 3NXFA 2PF8A 3B40A 4Q22A 1GJUA 5IFTA 2P3ZA 3N4AA 3TCEA 4FK9A 3HFYA 3EX6A 4JYFA 4UR9A 3NPVA 1CBGA 2J9XA 7TAAA 4KCVA 1C8VA 3EXSA 2DVUA 4KCTA 4LANA 1V5XA 5FSDC 4GQQA 3DESA 1RJQA 1DIEA 3PPHA 2BWGA 1BXCA 2G50A 3OQ8A 5G1TA 4AZ6A 5DMMA 2DIKA 1VHNA 3PVFA 3LRLA 3PNZA 3CUZA 1BWKA 1VS1A 3WLJA 1VYSX 1Q8AA 9RUBA 1JYWA 5D38A 3LCHA 2NZLA 4C6MA 1LOSA 2EHHA 2XSAA 2EPLX 3PP7A 4JTIA 4Z1AA 1NDZA 3KM8A 4CCCA 4JN6A 3LUTA 4QJ5B 3CO4A 5I3DA 4H7ZA 1LRQA 1A3WA 4CEUC 3E02A 4RPPA 2PC4A 5CSSA 3AYRA 3P8IA 4L61A 3QGVA 5D9NA 3UGRA 2YR1A 2QCLA 4J3TA 3FJLA 4ZQOA 4LF2A 5EMJA 4MDOA 4WX2A 4E2OA 4C1NA 4U3CA 5LNUA 3W23A 2HZGA 3QN3A 3LI1A 1IEVA 4OE7A 1ZSXA 1F74A 1LWIA 4HA1A 5AOUA 4DQWA 3UZJA 2D0FA 1EX5A 3ABZA 2W67A 2G3IA 4XBSA 4ES4A 5D33A 4H41A 3ZVHB 3E12A 1JCTA 3LENA 4GIEA 2GGEA 1E0VA 1KRAC 3TXZA 3T6CA 3S1GA 3KCOA 2BVYA 3H70A 1V7YA 2H9AA 1UHVA 4PB4A 2YXOA 4KWSA 4S3AA 1J01A 3M1ZA 1E56A 3VZXA 2Z4GA 3GH4A 1TX0A 3TLLA 3NPWA 4UR7A 1C8XA 2ZXAA 6REQB 3QLLA 4M8UA 2ZXBA 3ZFHA 3W72A 2YCEA 1P1MA 3VGDA 1I0DA 1E9YB 1LRNA 4XBKA 3WF4A 3O06A 3TWAA 1SZFA 4ERIA 2JGYA 3UR8A 3PJUA 5BOOA 4QQUA 2ZRVA 2VDHA 3A5FA 4MNJA 4MZYA 3IACA 2X41A 4KRTA 2D3NA 4HSOA 4UTWC 2XJ7A 1FWIC 4MADA 5FF3A 2MUCA 2HISA 3TEVA 5LA2A 3UWWA 4G56A 3SUWA 1ECQA 2WJZA 4C91A 2DT0A 3CAQA 7ODCA 1QO2A 1UJPA 3B4UA 3W53A 4KRZA 4FXSA 3E6EA 3L2LA 1LZOA 4HU3A 3WH9A 1IGSA 4AMAA 1WDDA 3FA5A 3SEPA 1JVNA 3H4GA 4MPQA 5U4NA 3EPNA 4ONVA 1VFSA 3KZPA 5FJJA 1DJNA 4JTGA 3THAA 1FCBA 2DU2A 5I07A 1HKVA 2VQTA 2BHUA 4UOZA 3WMSA 3KL3A 1KWKA 1M03A 1NQ6A 3CJPA 3I3EA 1J18A 3LCGA 2OMAA 1PL9A 2WBGA 3F1QA 4Q8NA 4DHGA 3VCRA 3MUCA 1G4EA 1JDAA 3L5AA 3L9CA 5EY5A 1VHCA 2OZ8A 4L6DA 4HT3A 4OGZA 4M1RA 4WOZA 1E9LA 3W7NA 3VD5A 3BTNA 2ISSA 3H7VA 1GVRA 3KX6A 3MYPA 4XZIA 3IJ6A 1XV8A 4PZVA 3FA3A 4KWVA 2Z1KA 2C7FA 1HFBA 2Y85A 1WKDA 3V4BA 4PMNA 4NAEB 2EPNA 2DZBA 1IYXA 1EEXA 3LSBA 3CB3A 1MXSA 4NI8A 4DPQA 3VMPA 5A2CA 5KZ6A 2OGYA 3UEQA 1ZUAX 4GC4A 3AOFA 3E0FA 3FA4A 3WBXA 5ABFA 3U5YA 1ONRA 1J0YA 2DSVA 2EG7A 1XIFA 5HMSA 4QX4A 3QR0A 3QSTA 1LL7A 3UG5A 1TPEA 4HNCA 4JTSA 1BFNA 3NQ7A 3RK8A 4ATLA 2PWHA 3ABOA 2QDDA 4CD8A 1H7RA 5HJXA 5E70A 3HPSA 1PYFA 4LWWA 3W37A 5I24A 4C1LA 4RE2A 4AVFA 4GY0A 4WR3A 2ZE0A 4YMZA 2BNJA 4RCXA 1UUOA 4DLFA 1BWLA 5AHLA 2R1KA 7REQB 4ML9A 5BMWA 3HPXA 4K2SA 1EXBA 1H7XA 1UKTA 2BFGA 4X9SA 1WZKA 3KWXA 1CWYA 1X97A 5C54A 3ITLA 1AODA 2C0AA 4GJIA 2PZ0A 3WLIA 2WNWA 4LAKA 1P1XA 1FQ0A 4XAGA 3GW3A 3B8DA 1QW7A 4FOJA 3S1UA 3DG3A 1H7WA 2ISVA 3L5MA 2WV8A 4TX6A 1XKJA 3ICJA 4IHCA 1JAEA 3A4AA 1UZHA 2H90A 1YEYA 3E2RA 1V3JA 1ZP3A 2QUVA 1LRTA 3I6TA 3OZMA 1A3HA 1GGOA 3UFYA 1VBGA 1KBJA 3BG9A 3H6OA 3O0KA 1SFSA 5CC5A 3S9IA 3ARTA 5D2YA 5A6MA 1DL3A 4XZBA 4NVTA 1EBGA 1ESWA 3OA5A 7PTDA 4IIHA 5CPQA 1O1HA 1V7AA 1HKWA 4BF9A 2AGKA 2FTYA 4NHVA 4WQ6A 4AB4A 1B9BA 2V0TA 4ZQNA 4LS0A 1J2BA 4HZ8A 4NYUA 1QMLA 4UNLA 3SW6A 3NEHA 4JKMA 4GXMA 3PHAA 1HJVA 2W62A 2EXOA 4RE3A 6TAAA 4LYKA 5E1QA 5A6SA 1EZ2A 2FH8A 2YLLA 4NI3A 1BF2A 4UQDA 3EWBX 4S38A 2GJRA 1NM9A 4J3VA 4UFMA 3VNMA 3JZEA 3NQ2A 1I4NA 2PDLA 2X2YA 3JU2A 5DX7A 2NV2A 4AHOA 3REQA 4WJEA 4DNHA 4Y2WA 3C8FA 4U3AA 1CXHA 3BV4A 1VYRA 4YXGA 1UR9A 3THUA 1TRDA 1OY0A 1S46A 4LCQA 3H53A 5AC5A 1EJTC 2WZTA 4IFKB 1E4IA 2Q3OA 2BG5A 3RLUA 3K1GA 3CMFA 1W0MA 5A95A 3S3GA 4LUSA 3ITYA 5GVJA 4AD0A 1TELA 2QCGA 1TWDA 1QRQA 1MQQA 2V30A 2VNCA 4HZMA 5L6UA 3UXIA 4FR6A 4IWWA 4DLMA 3RYSA 1LQ0A 4YCOA 1GNXA 1TX2A 1IR1A 1UWRA 1EOKA 1DVJA 4GQGA 1ZAIA 2FJUB 5DN1A 1KXVA 4LVBA 4QISA 2CBVA 3TR9A 5FI8A 2G97A 3AJXA 4IM4A 4W86A 3FXYA 3QH2A 2NV1A 4E2BA 1IZKA 1LLZA 2XVNA 5D4YA 2GQAA 1O5QA 2VRKA 4JTTA 2V9DA 3IRDA 4H8HA 1R2TA 4Y6GA 1DBTA 1E0UA 1QWKA 4FNUA 1IWBA 5TD4A 4J28A 1WE5A 5M17A 3C8NA 4PTDA 1LOLA 1OK6A 2A3HA 3A12A 4NNAA 1KXHA 4J3WA 1YX1A 2W0UA 2X7WA 2CESA 2VFGA 1Y0EA 3UVIA 3LB0A 4RV8A 1ZQ5A 3WFLA 2OPJA 1Q6OA 3URAA 3W7DA 3QY8A 2CETA 2KZHA 1ISWA 2V2HA 2X1UA 1V0NA 3H54A 2DPEA 5DELA 4Q4MA 4AF0B 4BI5A 4JFWA 2ADAA 1H61A 3BC9A 2HVMA 5C6MA 2EPHA 4WIWA 3LHUA 2CBIA 3MBDA 4NJJA 1B3VA 1Q65A 5D2VA 3OBKA 3KVKA 2Q01A 5BOFA 3LV5A 1QXLA 2ZUWA 4MAVA 1UR3M 2HJPA 2J7GA 3TSDA 2PLCA 3DBNA 5JMUA 2FHFA 5AYIA 2E1DA 3B0PA 3PUOA 4RZ5A 2CKRA 2DUAA 4LUTB 3MP5A 1YTKA 2VFDA 1B30A 3N17A 1VBHA 4HNUA 2B4GA 2P5NA 4MWAA 3LOTA 4C6LA 1QW9A 1KKOA 4TU1A 3GH7A 4OUEA 3ARQA 1X1ZA 3GVVA 3SSZA 1W3JA 4ADSA 3NUKA 3VCNA 8CGTA 1Z41A 3VABA 3T0BA 1K02A 1EDTA 2VVSA 1X6NA 2PU1A 3TX9A 4DVOA 4CN1A 3NZRA 3V3WA 1KFLA 2I5GA 4NASA 5DANA 1JXJA 2WZHA 4DWDA 1DQWA 2WC7A 1MDLA 3CIWA 4GABA 3AXKA 5E93A 5JH2A 4L5ZA 3N12A 4ILSA 3SI9A 1EJRC 4WUIA 2YFOA 4XAPA 3VIOA 1QR7A 2YXXA 3FIGA 4S3FA 2Q8ZA 3CU2A 3QV8A 2YCIX 2XTKA 5E0CA 4P7NA 4JTJA 4WK9A 3IJ8A 4JX4A 2P10A 1V4YA 4PMVA 2CITA 4J35A 3MHUA 4E2DA 2XZ7A 1R38A 4E8DA 1J93A 2VC6A 1DV7A 2ZRZA 3MTWA 1NP0A 4XUYA 3TMLA 2EPMX 4CVUA 1MZHA 2UY3A 3QV9A 4XZWA 1DWGM 2DIEA 4FA3A 1Q4WA 2WWCA 4GNVA 4J3ZA 5EL1A 4B5SA 4PB5A 4GUJA 3N25A 2HE8A 3MB9A 2WW5A 3MSYA 4IGHA 1A53A 2X0SA 4NG3A 2ANUA 4PSPA 1P5BA 3ZJ7A 1BGGA 3UWYA 5LIUX 4D8ZA 1JCLA 3BJSA 2PC8A 3W1XA 4QSHA 4NRRA 2BOEX 1B90A 3BZJA 3E2VA 5AVHA 1P48A 3W2UA 1MXDA 1XIBA 3NZQA 3ABQA 4M80A 4LALA 2WXDM 1YDVA 2Y5JA 4GWEA 5CSYA 3CTTA 4OVXA 5KETA 4EPEC 1GPFA 3RM9A 4RUBA 3W76A 3NSMA 3B8VA 4DO4A 2DH3A 2PDPA 1AQHA 4GIYA 1AL8A 3STPA 4IMGA 3GXMA 2WLYA 3E5PA 5IOBA 3GNRA 3OBEA 2ZA1A 3PSVA 4RNIA 1CXIA 4FIRA 1V0MA 1W3KA 4B2DD 2OT0A 1FWNA 3VGBA 3WD1A 1LM1A 1XLAA 3IGUA 1H63A 3U5UA 4DF0A 2C91A 3TH6A 3KDNA 3LK6A 8XIAA 5F2LA 1FWEC 3N29A 4HGXA 3G0XA 1RK6A 4WKAA 4UUIA 5LSMA 5A2BA 1JXKA 4Z2IA 1M65A 3W6YA 1IV8A 1S2CA 4XKYB 4DI9A 2GYIA 1S2AA 3K8MA 3M5YA 3LMYA 4FXFA 4CLMA 4Q6XA 3UP8A 4Q8WA 2VR5A 1D9EA 3R0KA 3R12A 5HNUA 5K9DA 2Z26A 3HN3A 3CH0A 2NW0A 2DT3A 2IMRA 3RJYA 1EF3A 3W2LA 3A64A 4XTIA 2Y7FA 1ZJBA 4JIPA 4H00A 5G2HA 5U7SA 2WZEA 1EC7A 4HU8A 3I4KA 4W8LA 1BTMA 4JTLA 1J2WA 2WNZA 4GXWA 4GKLA 1TE1A 3VDAA 5F1VA 4MIMA 2AQWA 4IIFA 3Q58A 1F3EA 4B2DA 2BVWA 4C6EA 4PSRA 1AA1B 2OQLA 2WMJA 3M16A 1DXFA 3KEHA 3NL6A 1VJIA 4LAMA 3VIJA 1NFGA 1GOOA 1NWSA 4MB3A 4WY0F 4NAFA 2QCNA 3W7KA 2AKMA 5CZKA 4QNWA 5BXTA 1IIHA 4KWWA 4YIWA 3PPGA 1C9DA 5C9WA 4U33A 2UZ9A 5CZ0A 1W1B1 1UH3A 5FF7A 2QCDA 3AIQA 3E38A 5HJLA 3WK2A 2OG9A 4KH2A 1N55A 4FZIA 4LEQA 2OU4A 2INFA 1KTNA 2YL8A 1L6GA 1C8YA 1PTDA 3MVIA 1OT2A 1XIJA 1VAHA 4WGHA 4D6DA 4AD1A 1TE6A 3WBWA 1JF6A 1TCDA 5I3HA 3I7SA 2R1LA 8TIMA 1U5VA 3NURA 2J4GA 4LB4A 4UQAA 5C55A 1UROA 4AUBA 4CCZA 1K70A 3LGGA 2PWDA 1XIDA 5JH1A 3LCXA 4FF7A 2NX9A 2FJKA 5AZ0A 3V75A 4FB7A 3CQHA 4H7VA 4RV3A 3S83A 3F5LA 2C18A 2VOTA 3GE7A 1NQKA 4ORMA 1AMYA 4G1KA 4MLRA 3ZT7A 1LROA 1R9YA 4B4HA 5B7YA 4MM1A 4WDXA 3UG8A 4TOQA 5LNSA 6PTDA 3A24A 3TA9A 3RU6A 4PMQA 4AQLA 4RDZA 4I8DA 4PMYA 1XP3A 3LMZA 2D69A 4TX9A 1EP3A 3PANA 3O0FA 4R27A 2XFYA 3PG8A 1XUUA 4RPQA 1UZ1A 3G3MA 2HCVA 3HIJA 3NR0A 3TVAA 1HJUA 4L9ZA 2UBPC 2WYSA 3T4CA 4WY0A 5LA0A 4N02A 1IE7C 2ISFA 1GKQA 3TK7A 1R3WA 2DV0A 3P84A 2ZZ4A 3DFQA 2H3DA 1F4HA 2YPIA 2HV5A 3HPAA 3KHJA 4MFDA 4AIUA 5LXEA 3R43A 4H8UA 2HPIA 4KT2A 1P6WA 3NO1A 4M6VA 4J2PA 4OV9A 2Y5EA 1ZS2A 3BDKA 3WN6A 3PWGA 1W6TA 2OX4A 1NARA 1NWRA 3B8WA 5F7UA 1G94A 5CSRA 4GYPC 1RCQA 1QJWA 3T0CA 4F0KA 4UTKA 1E6ZA 2P8CA 1PUDA 1WX0A 1DJGA 5FEXA 3AIBA 1JULA 4C5ZA 1J12A 5G2IA 3UXLA 2PDIA 2WVVA 3WKZA 4NXKA 1I1XA 1GQKA 4HA3A 2ASHA 3B06A 1G9HA 3LRMA 5G1YA 1GQNA 5TF0A 5AHNA 1RALA 3NPXA 4O10A 4R7JA 4AY8A 3W7HA 1SSDA 2IKGA 3BJFA 1ODZA 4IH3A 4UXDA 1HZYA 1E1CA 4FI4A 3P8JA 1Y7VA 4Y8FA 4YYCA 5FD0A 1UB3A 2V5LA 3PM6A 3CUHA 3CAWA 5FJOA 3GS6A 1BG9A 4B5TA 5CZTA 3B03A 2Q6ZA 3RM8A 4QE4A 2V5JA 1HJSA 2DFAA 3ID7A 3RCNA 3FGCA 4C7GA 2DZVA 2BSLA 3S4TA 4H6RA 2TYSA 2ZUSA 4NZ1A 5D32A 3O8AA 2VENA 3LA4A 2CLMA 4KQNA 1E43A 3DDMA 1BXNA 4AY1A 4EVZA 1KKRA 3NCOA 1UWUA 3KFTA 1YLVA 3MBFA 3OGVA 3UF9A 2E7FA 2GJXA 1W1A1 4NX5A 1FXPA 3N04A 2Z25A 3P5YA 3WLPA 3MMWA 2NXIA 3R2GA 2ZA3A 3W1QA 1XCXA 2ACUA 1OHLA 2W91A 1TJ1A 3CZLA 1XG3A 4XIAA 2PD9A 3WEOA 4DJDC 3TJ4A 4F66A 1ZFJA 5MHBA 4AW7A 5MKGA 4HMNA 3TN4A 3AISA 7XIMA 2H3BA 2OKOA 1SMAA 3PBGA 5D9PA 2X7VA 1H0IA 4BF5A 3TJLA 2A7RA 3MANA 3AHYA 4JNZA 1K9FA 4XZHA 1F05A 4RDVA 2GDUA 4PUMA 3TTEA 4GO8A 1DJXA 2HTMA 4G6CA 4DEFA 4Y9PA 4XWUA 4L9XA 1QT1A 4H83A 2QQ6A 1HO1A 4JTAA 1AQ0A 2JIEA 2NQLA 1KFKA 5I2UA 3UNDA 3WH5A 4AD2A 4LNYA 4H2CA 2ZYFA 3SQMA 1KM5A 4GK8A 1V3KA 2E3ZA 4B90A 1OBAA 3VUPA 2OXNA 1FHUA 1V51A 4XVEA 4CD6A 5CGTA 1MO0A 3G18A 2CWXA 4HCLA 5I03A 3OG3A 1CXLA 2AKZA 4BQ3A 1TTJA 3LLFA 3QMTA 2BODX 1MDRA 2ZZ3A 3W1AA 3LHYA 4I5XA 3W71A 3L4YA 2CIPA 2QHAA 3REQB 3RPDA 5FKYA 2QV4A 4BQ4A 4AXNA 1XYZA 1W1TA 1M1BA 2A6LA 2XN0A 1J6OA 1H1NA 4AHQA 2NQHA 4DZ5A 4FNTA 1CGYA 4IFRA 2VC9A 3SBFA 1XLKA 3IJDA 3GG7A 4PTMA 4LTSA 1V02E 3E0LA 3TC3A 5F4XA 1V77A 1UPPA 3SAZA 1JL8A 2XISA 1FOBA 1F8MA 4O0KA 3GXPA 2XUCA 2Q09A 1UH4A 2DGAA 1WKFA 2JF6A 3D3AA 3GBDA 2JIWA 1Y65A 1JYNA 1R7OA 2TSYA 1WB0A 4Y90A 3UESA 3EYPA 4JHOA 4BZYA 3OZPA 4PUKA 3O7UA 3SCPA 4NIRA 3U4FA 1KGWA 1A5LC 3CQKA 3ME3A 5LGXA 3VZYA 3CGTA 4ZB0A 1JQXA 1QPRA 4F79A 1KFEA 2EJ1A 1DWFM 4EWJA 3LQGA 4J3XA 2PRLA 3GKAA 4E3TA 1F61A 6ALDA 2DORA 2OODA 2ZWYA 2X16A 1MVYA 4WZHA 5C9UA 4QJ3B 2WSPA 6XIAA 7TIMA 2O55A 3E74A 2NX3A 1VQTA 2PDWA 3W7RA 3M0VA 3G8RA 1C91A 5B7ZA 1FWTA 1XYBA 3VIMA 2RKXA 3UWQA 1OX5A 4GPNA 1L2UA 2HDJA 3LM7A 4UOJA 1JDCA 1Q6GA 3TC6A 4AIBA 1SVDA 1QNQA 5BOEA 1OM0A 4LT9A 1R2SA 4GX8A 4DUVA 1F6YA 1MEHA 3J7HA 2EQDA 2A4AA 3V5CA 1NJJA 1S3TC 4LV9A 3UQNA 4K68A 1Q13A 3OB8A 1UUQA 2ODOA 5FJRA 4AVOA 3NTYA 5G4WA 3TYUA 3LPOA 2DP3A 4LC8A 3F4VA 2DIJA 1YQ2A 2J7DA 4LGXA 4ZQCA 3T05A 1YKWA 3K4DA 1C7TA 4LU0A 1QVBA 1CGXA 1QPKA 3VKDA 2C0HA 2DSZA 3CZGA 4OECA 5EFDA 3RMJA 3ONBA 3L4XA 4ROPA 5CBJA 4V33A 1FTXA 1RLCL 5M1TA 1SJCA 3MV11 4KWUA 2QW5A 2J27A 1QK2A 2A3BA 1E9ZB 4QCFA 1VBUA 3KLLA 3F5JA 4MWAB 1UWIA 3TZNA 1ZCCA 1E72M 1JGMA 3UZXA 1O94A 1EZWA 2NQ5A 2B7NA 5DXXA 1I2RA 3W84A 1EO7A 5DY2A 4ADTA 4OQVA 2CLOA 3WD0A 3EDDA 2ATMA 2PWFA 4PMXA 4M81A 3ABRA 4AZBA 1FH8A 1VFFA 1KLZA 3E0IA 1OZQA 1YNYA 4GYPA 3PBWA 2A21A 2OYMA 2OLAA 1UP2A 4ZVJA 3ANUA 4L64A 1GOQA 4NQ1A 4LH8A 3SM0A 3QZAA 4E0CA 2ZRUA 2INEA 2ACRA 4REQA 2FPYA 2VI0A 2WPBA 3FAXA 3ZMRA 2BASA 3THQA 1EHAA 4CU8A 3HPZA 2H8XA 1RK5A 3Q2DA 2TMDA 3S2NA 1DQUA 2ZRWA 3CLMA 2CXGA 2YOCA 3QPYA 3DEQA 4DJDD 1G4PA 1F6KA 1RQEA 3GFXA 1EPXA 5JBEA 3NQ6A 1GUVA 2YKKA 3GSMA 4JKLA 4UQBA 2BV9A 2OWCA 3T8QA 3VGHA 1HGYA 1GG1A 1KM2A 3IIOA 4PE8A 4WXZA 3WQ8A 1OFQA 4LUIA 2ZX7A 1DJYA 3SRDA 4D6HA 4DUOA 2FFCA 1CXEA 3K2GA 3C4UA 4GZ7A 1MW0A 3QXBA 3CS2A 3V35A 2ZFAA 3VIFA 1FFRA 1M3UA 1T8XA 1R47A 1KGXA 4GI6A 1A5UA 1TV8A 4YNGA 4NT0A 2FIQA 1W8SA 3WLQA 5HANA 1WUEA 1XLDA 4W85A 3CO8A 3NGFA 2C6QA 3CUFA 1L6YA 1UBPC 4DJDA 1UR8A 3BZGA 3WQ6A 3AZSA 1ONXA 2PDXA 2ACSA 3FLUA 4A3RA 5I79A 1VLWA 4OFCA 4N9CA 1TWIA 4HTYA 4L9YA 2OX1A 3GDLA 4IJRA 2W27A 2FYMA 1RH9A 1MUCA 2GVLA 4WSHA 3CZ8A 3NYZA 3IVSA 2PDJA 3S42A 7A3HA 3BMVA 2VTFA 1H50A 2J62A 2PRMA 2WQDA 3M0XA 1JRBA 4JOMA 1BQCA 1UPMB 5AHMA 4UTUA 4EPBC 3MZ2A 4IPJA 4C60A 2Y61A 5ENLA 4W5ZA 3M0YA 4PMJA 1VLIA 2UY4A 4UMAA 2WSRA 3OG2A 2FTWA 4JQAA 4D6CA 4EPDC 3U7VA 1GVQA 1OZMA 2ZUVA 2ZZ7A 1LL4A 3M7WA 5FESA 4DYJA 3PBVA 1ITUA 4GJ1A 1QNVA 2HPMA 4GY7A 4US5D 2QCEA 3GG1A 4W88A 3UPBA 2YXGA 3KCLA 5CG0A 1ZU8A 5BYWA 1CIUA 3P5ZA 4GZIA 4DIAA 2REQB 5BRPA 1QI2A 1W37A 1FFQA 2GVEA 3KZSA 4PBGA 3UXAA 4CUCA 3ZWTA 3NL5A 3CPGA 2VZTA 2ATSA 2CZVA 1VD6A 3BICA 3T55A 3WEMA 3NNTA 5CLWA 4G7EB 1NWTA 4WDUA 3CUIA 3DHUA 4HNTA 3PC0A 1BPLB 4OBRA 3P80A 2IQTA 3N4EA 4PCSA 4AYSA 3NO5A 5A69A 2PU0A 4XSMA 3GXFA 1ZNNA 2NQZA 3WJSA 3UZ5A 4MB4A 2R1MA 4ZXLA 3VIKA 4M29A 3S6DA 3LHVA 4JY9A 1R5YA 1HKIA 3YPIA 5FEWA 3L2MA 4TTUA 1FXQA 1A47A 4HSHA 3ZLGA 4H9MA 3MKCA 5A8OA 5H91A 3G1XA 2Z1VA 3MI2A 3GXIA 3WQPA 2O4MA 4FNQA 2C13A 3F4DA 4I9JA 4GUIA 3ZT5A 1PKNA 4V27A 3NM1A 3H7RA 3G6MA 1GONA 1S39A 1OJXA 2VP8A 3PUEA 4JDYA 4YTSA 1XBXA 3H2MA 4RXGA 3ZQ9A 4E3VA 3SADA 2PZNA 1BEUA 1OFEA 4NJHA 4PN2A 4Q8OA 2O4QA 1QWGA 1UOZA 4WY0B 1W54A 1VFOA 3HGRA 4S3BA 4XO6A 2CC0A 1UBSA 4E8CA 3POCA 5G4HC 1H41A 4IGNA 1PS9A 4LAZA 2NSOA 1LG1A 3R0DA 1XL9A 1JIBA 1GQIA 1WDRA 3D0CA 3TFCA 1EYEA 2EPKX 2XG9A 4HU0A 2H8ZA 2RDUA 1PO9A 1XLFA 2R8WA 1AH0A 4Q8UA 1V03A 1QFEA 3GG0A 3FSTA 3KWSA 3KOWA 3QFWA 1R9ZA 1EX1A 3OA3A 1O5RA 4O18A 4L4MA 4M5PA 4X2RA 1XRTA 4E4FA 1VP5A 5CZJA 3OEXA 1FWCC 1KBLA 4GUGA 2PP1A 3VE7A 4GNKB 2GOKA 4ML4A 4JGDA 2YDQA 2GSHA 2VWTA 4C6CA 4K36A 1U1UA 4LVGA 3L0NA 1OFRA 1QPQA 3P6LA 4QP0A 1FUYA 1JCNA 2A1YA 3CXOA 1JCJA 3AU6A 1ZALA 2G3MA 1K1DA 5BRQA 1SO6A 3DG7A 1FWAC 1S2UA 2JKEA 5ABGA 3CHCA 1GOXA 1DWJM 1UR2A 4Y96A 5IFPA 1AJ0A 2WM1A 5D04C 5F2GA 1GVEA 1OD0A 4HJFA 3AHVA 4HPHA 3S1WA 4AZ5A 1XBZA 4CQBA 1WXZA 4OIFA 4W9TA 2PP0A 5FSEC 3WCZA 4DYEA 4HYWA 3IVTA 3MJYA 4H1ZA 4CN4A 1I60A 3WJYA 2RAGA 2WHMA 3DX5A 2TODA 4AD3A 2EKGA 3A3HA 2QUNA 1PZ2A 3FYOA 4IISA 4HPXA 5AYXA 3M0IA 4A3YA 1CPUA 4OOUA 4QGCA 4EWND 1PE1A 4H8VA 4ZODA 2QAFA 3P81A 3C3NA 4AIOA 1BF6A 4UR8A 2OEKA 1TJPA 4DM1A 5KTLA 2PFHA 3PS7A 1CZ1A 5GQBA 4IP7A 3EDFA 4GG9A 3D3FA 5TBOA 3LV6A 3WFZA 2H6RA 5CC7A 3OBAA 3S9YA 4KETA 3FVMA 3UA3A 1DXIA 1ISYA 4JHMA 2IXUA 3B9NA 3IV3A 3N18A 2RHGA 3FS2A 3VD3A 4HIBA 3L21A 3LBCA 3MWCA 1EYWA 3A13A 1MW3A 1TWSA 2F2KA 2ZZ6A 5A6BD 3DKJA 1F2JA 3KVJA 4MDPA 4K1GA 3EKLA 3MUY1 4JEQA 1GYNA 4IQDA 4HK7A 1F7BA 3HTWA 1A5CA 3V36A 2Y8VA 4GVFA 1OIFA 3ITGA 3UR2A 5I78A 2ZVRA 2VGFA 1DIKA 4CQCA 4AD5A 4U5IA 4R85A 4JCLA 5KMYA 2G4JA 3K8KA 4UQEA 5E6YA 1WDPA 2XYLA 3W1TA 4WRHA 2BOFX 5LNRA 2V8ZA 2Y6ZA 3VIGA 1W17A 4FNRA 2R14A 1F07A 3HJZA 2I1OA 4DPPA 3FXGA 2P8BA 1TO3A 3WL0A 1HGWA 3OVGA 4A22A 1XSJA 3SUSA 4XKMA 4J40A 3AIWA 3EWUA 3CPRA 4K8EA 1QU4A 1CYGA 2Y7DA 3BAIA 3VYLA 4GRSA 4ZFMA 3EGJA 1TTPA 4QROA 1EHNA 3VDGA 1S2VA 2YYTA 5E0FA 3MUZ1 1TVPA 5HWMA 1RY0A 4Z08A 1CENA 1GVFA 4E8GA 1UWQA 1V6WA 1V3MA 1XQLA 1ZBVA 3KTXA 5H8PA 2YZ5A 2P3EA 2D3LA 3CHFA 1QNPA 4ZQMA 5EPDA 1XGZA 5EKYA 5I00A 1AL7A 3GTIA 1FWRA 2C3ZA 1WPCA 3G1HA 1DXEA 5IM51 3WNPA 5HXMA 1JZ5A 2Z29A 1OFAA 3CBWA 3VDHA 4YYFA 1NP2A 1Z32X 5FACA 1UWAA 3USBA 4C6BA 2ALRA 1UW9A 3GLCA 4MOZA 5DO8A 3DFHA 2ESCA 4W84A 3R8HA 4AXKA 4Y9NA 5JBDA 2Z2UA 5D03A 5HNTA 3BE7A 3SN4A 3WO8A 3IUDA 4AEOA 1LWJA 2I17A 1I0BA 2E5BA 2QPUA 4B15A 3K1DA 2FPVA 4D8LA 4HMEA 1PHWA 3TU9A 3HM7A 1CEOA 4ZTXA 2WZIA 3OGSA 3BO9A 1T5AA 1TZ9A 2OSWA 4GCXA 2Z2BA 1Q6CA 2AL2B 6A3HA 1KV8A 4QG9A 1S2TA 3ZVHA 5M2FX 4QLJA 1EWEA 3LTSA 1EIXA 3H24A 3T4WA 1OFOA 1WBHA 3AXMA 4LQ1A 5LNWA 1D8CA 1DIDA 2VD9A 1XDJA 2YW4A 3Q94A 2DVXA 3WLNA 4NL1A 3QHOA 3EKGA 5L9FA 4POCA 4Z17A 2E8ZA 1R46A 2V2DA 1A4MA 2J6XA 2MNRA 2O9TA 4B3ZA 4ACYA 4C65A 4GGBA 1F3XA 4M82A 3W07A 1FDJA 4AFYA 5HQEA 3H2OA 1NELA 4JFTA 4K37A 1OFDA 3WF0A 1XISA 2DT1A 2MANA 2GJLA 2OQHA 4KF1A 2GUUA 3A22A 2WMIA 1B54A 1LJYA 2HBVA 2PAJA 1RBLA 1OX6A 4X3ZA 3EX3A 1XM3A 1JZ6A 1VENA 4I7WA 3WBYA 1W1YA 4FSAA 5A6LA 4UQ9A 1EOMA 4CQAA 3ITVA 3DERA 4BA0A 3G1YA 3SDOA 1EC8A 3HQOA 4GQ0A 4X22A 1E0TA 1WAWA 2B7OA 1TV5A 4Y7EA 2Q71A 1HG3A 3WUBA 2QXWA 3TJXA 5EMLA 1KCZA 2ZDRA 4YVPA 4Q4PA 4QNEA 3QJAA 1XWYA 4UQCA 3ITCA 3L0GA 3KP1A 1EB3A 1R86A 3MDWA 2WKJA 1IEQA 3EWDA 4O1BA 3NDZA 4H9TA 1HJWA 1UH2A 5BU6A 2X8RA 3VZZA 4IGMA 3KCJA 3WK0A 3WBAA 3GR8A 2G95A 4CU6A 3UPWA 4UFKA 1I2OA 5M5DA 2GQ8A 2E6DA 3AO0A 3AMKA 4UTFA 1E4LA 3CM4A 5A6KA 2G8ZA 3IEBA 2GVYA 2NLYA 5BCAA 2B7PA 4FALA 4GOAA 3V0SA 4J7RA 2VDIA 2ZZ1A 4QG8A 1KCXA 1OG6A 4V2XA 5LHEA 4CNTA 1YHTA 4MLJA 3CQ0A 4M24A 4GY1A 4ZO8A 3H26A 3BGJA 3EWCA 3JVAA 5M03A 1YE4A 4RJEA 1CT5A 5EB8A 3AHXA 1J4EA 1W5PA 4F3HA 4NZFA 3W75A 4LV4A 1BLIA 2V3EA 3CHVA 4FMVA 1EJSC 5J5DA 2NUXA 3GR7A 1P0EA 1V93A 1GZGA 4O1DA 3TN3A 1GK8A 5GJNA 3JR2A 1S1RA 2O0TA 3G2GA 4PC8A 3FJ4A 1VBRA 2VX7A 1W5QA 1HL9A 3TAOA 4P8XA 1OCBA 4A2SA 3RILA 1GVOA 2QEZA 1B4KA 3SCNA 4A8IA 1MEWA 2ZUTA 3N2BA 1FH7A 1Y8BA 3VAVA 4B9YA 2F84A 4MSSA 3S2MA 3VINA 3RMEA 5CC3A 5GNYA 3H55A 3S2LA 1KRCC 1W8GA 1CECA 2BDQA 4B16A 2WPGA 4WGXA 1XQKA 1U5JA 4HD5A 9XIAA 2VRJA 5HQLA 4LAOA 4DELA 1OADA 3APYA 3WD4A 4DWSC 1FBAA 3W3OA 4DBEA 3I7QA 1H11A 1A5AA 2G3FA 3I7RA 3DFNA 1HTIA 3GB6A 3N2MA 2CWNA 3A9BA 1GQJA 2I56A 2D73A 1JYVA 4G8TA 1HKKA 3M4HA 5HR6A 2E25A 3SECA 2R6OA 1ADOA 1SSGA 4BR1A 5CAHA 4JNYA 2QCCA 5D30A 3PK7A 1W2VA 7REQA 3BQ5A 2BTMA 4AISA 1O1ZA 3GC4A 4HNVA 3UXDA 1VFUA 2VJXA 3O9NA 5HK4A 1OABA 2Q02A 3RHGA 4PTVA 2D0HA 3URNA 4LW7A 1R3QA 2NLIA 1BKHA 3M43A 1EP1A 1A5OC 1ONWA 1D8WA 1Q4NX 3LTYA 2HQAA 1IR2A 3S1XA 3SCTA 1Q6FA 1C93A 4V1XA 4M51A 1TSIA 3GAKA 4QCEA 3R0UA 3BAJA 5EGRA 5T91A 3TTOA 2TAAA 4HZ6A 1XUZA 4PL1A 1E1FA 1XYCA 1X7IA 1YMYA 1W5NA 2D22A 3ATYA 4KFOA 3VC5A 3ZLFA 5JU6A 3L4ZA 1JAKA 3Q37A 4GVHA 3TYZA 4N4PA 2IKHA 1AH3A 3CAKA 3KXQA 3HMJG 3CT2A 1FHDA 1ZL1A 2EAWA 3KP0A 3ZT6A 5LKYA 4L4LA 3AXXA 4DY1A 1DPMA 3DI0A 2J66A 1SYTA 1ADDA 2HS6A 3MT1A 4U4MA 1U83A 4P2VA 1KCLA 1XINA 3MCNA 3N9RA 3RM4A 2W66A 4GIRA 4KERA 3SY5A 3WENA 4BKNA 3TSBA 2YJQA 3OTRA 2PP3A 4NILA 3TV8A 1JPMA 5DEZA 5DF0A 4Q8PA 2WCAA 3B97A 1BQGA 3UPMA 2IKIA 2ON3A 4N42A 1YXDA 3Q45A 2V3DA 2HSAA 3GDTA 4ZSTA 5JUVA 2HS8A 3T0AA 3VD9A 4YCPA 3RXZA 1F3TA 2D2OA 2VEMA 5AYBA 3R89A 2VKZG 4FXRA 3L23A 2VC7A 4PMUA 3OJGA 2RUSA 1O68A 2ONEA 2ZIDA 4DRSA 3FY1A 2FHCA 4F48A 4D71A 4WJXA 3ES7A 3W7CA 3T81A 5EMUA 3G22A 1XLJA 1R85A 3W81A 1V3IA 1L6SA 5CXPA 2YB4A 3AYSA 5DXYA 3GY1A 1RR2A 3VGFA 2ZTKA 1G7VA 3OHMB 2W6RA 3H2FA 3TNBA 3IRSA 1PX4A 4A8RA 3E5BA 4KEMA 1QI5A 1BVWA 5A6JA 1QI0A 1OF6A 2DZWA 3A5VA 4AX6A 3WDJA 2ZX8A 1UWTA 1DHPA 5I3IA 3VNJA 3WLHA 5I7GA 1F5ZA 3LZ5A 4GUHA 5LZLA 3MCMA 4QDMA 4IUOA 4GIAA 5FJTA 4NJGA 2BX7A 1BSLA 1MFVA 4IQLA 1M9HA 3PSWA 3CB8A 4BF7A 3ABXA 3NQGA 3MSDA 3UW6A 4UOQA 1JUBA 5KINA 3IV8A 2X30A 2ZQ0A 1XIEA 2A3EA 3QHNA 4AF0A 2JKAA 4GQBA 3QQ1A 4ZCWA 1BYAA 1ZAJA 5IHSA 5C7HA 2I5IA 4HNOA 1B9ZA 4LCRA 3EWWA 4RZ6A 3WDPP 3LPFA 1G6CA 4M56A 4JS3A 5CLTA 4ICNA 5AECA 3MS8A 1K9EA 4D6GA 1TPUA 4LUTA 4WDTA 3L4VA 3PTKA 2CNCA 1HF6A 1N8IA 4PFMA 2I9UA 4XBJA 3SZ8A 1AZ2A 5FF4A 1U30A 4ZOCA 3H4WA 1FWSA 3CQIA 1U2YA 3WLOA 2ZKMX 2PDUA 3WK3A 4TV6A 1H62A 4DAFA 2WVUA 1TV2A 2D2HA 4E2VA 2VEGA 1RXOB 3WH8A 3DYOA 1YADA 3LGEA 3M7SA 1XG4A 3TN6A 4LYQA 3VX0A 1UP3A 1ITQA 2WMHA 3VKKA 4DWSD 1D3GA 1H7PA 1EPVA 3ZYZA 1HUVA 1VFLA 3WQOA 1PX8A 3ERPA 3INPA 2O56A 4E4UA 4YS1A 5JQ9A 1QUMA 4S1FA 3PZMA 1G67A 1EDQA 1L0PA 2DZAA 2O9RA 4AZHA 4XZLX 4B9ZA 2QR6A 1XPGA 4B3LA 3WD3A 1P0DA 3B0VC 4X61A 3RRXA 4RXFA 3MP3A 4AC1X 1Q45A 1KXQA 3S5YA 3C61A 1W1ZA 5K7JA 1TV7A 4O16A 1H7NA 3UCDA 1AUSL 4L65A 2BGNE 1OYBA 3L67A 2P0OA 4UTTA 1L8NA 2NQ9A 2QJIA 1DORA 4I9MA 2XH0A 1G01A 1VR6A 4AY7A 1OC7A 2ZZ2A 5I23A 1SO3A 1TMQA 4JQ4A 3W24A 3TMQA 1YTDA 3C56A 3CLWA 4LUYA 5KSWA 1U1HA 4OU1A 3BPWA 5DBTA 4KESA 1JNEA 2E0PA 5J04A 2Z00A 1EJVC 1PCWA 2V5DA 1CCWB 4UCGA 3TYCA 4LS1A 5XIAA 1LUCB 2PDQA 2FHBA 1KM6A 3MVTA 1WQ5A 3URQA 3RX3A 1F9CA 4NYYA 3HG5A 3IWPA 1TTQA 4IP4A 3G77A 3W38A 2WNQA 4WVXA 1RBOB 3S6OA 1PKMA 4BQ5A 5T8GA 3VFCA 3UZYA 1SMDA 3ZJKA 4Q7NA 1T99A 1SZEA 1LL6A 4FXJA 3N34A 1A4LA 2E8YA 2A3CA 2QKFA 4JL2A 4XKYA 3ZR6A 3W26A 3AWOA 1US2A 4QITA 5EMMA 3NG3A 5AC8A 2OCZA 3E2SA 1R3RA 4DXKA 3PJTA 3UETA 3GR4A 2YCLB 3FEQA 4NJKA 2BY0A 1R3YA 4IJBA 1DTUA 4ZOAA 1ME7A 1VFMA 1NH6A 3KRZA 3RX2A 3HGOA 3UY7A 1UP0A 3DAQA 1HW6A 4QDWA 4JYDA 3H2NA 3B9EA 3NAVA 2ZXQA 1E0XA 1E0WA 1M7XA 5AHIA 3N1AA 5E6ZA 2CZEA 5DCDA 4KFNA 4O1CA 3BGAA 4P7RA 4R7WA 1TUXA 1X7FA 3DENA 2VZSA 1Y5VA 2PDCA 2DZSA 1EUNA 1SFTA 4R7OA 3BMWA 3SIMA 1TR9A 3L66A 3H2AA 5LIYX 1QHZA 3RNDA 2WO5A 1D7FA 5J8LA 2JQXA 5BXPA 1XYFA 3ATZA 2QPXA 2VR2A 1PVNA 1TRIA 2JF7A 2NXHA 3IGHX 3LERA 4FO4A 8XIMA 1XLEA 5ECVA 3CV6A 1LDCA 1IZJA 4E4PA 1LG2A 2PWVA 5FIPA 2AL1A 3GC2A 2WMIB 1CNVA 2ZC1A 1UA7A 2BVDA 4HNLA 2SFPA 4PRRA 2X1SA 2YBTA 1V08A 2AMGA 4KEZA 1W3IA 1UD4A 4Z2GA 2XM2A 1GOIA 1YXYA 2FVMA 4D2JA 2ISDA 3WNKA 3MSRA 2NUYA 1DEDA 4KCUA 4KEUA 2G41A 3W7EA 3G6LA 3N6HA 1US0A 3TZFA 5FJUA 2VCAA 4ZO9A 5DRCA 2RFGA 3N73A 3GVRA 5HATA 5A8MA 1JDDA 3QTGA 2GGIA 2DEPA 3O1NA 3C0LA 5A2AA 1JZ2A 3WQEA 3PR2A 4WOQA 4MWAC 5HA7A 1RY8A 3W86A 5DMYA 2PDNA 2FQIA 1R3TA 4O8AA 2GQ9A 3MQTA 3OYZA 5LXXA 3LLXA 4Q4OA 4YL2A 5BMXA 5CGQA 3S5NA 2POZA 1U22A 4CVWA 3BQ6A 3GIYA 1ZJHA 3PPFA 1E71M 1PEZA 3D5HA 4HPJA 1ICPA 4ERAA 3EOUA 4I6KA 3OVRA 4GX9A 1I2QA 4PULA 1TIMA 4O17A 2F9RA 4M6PA 3PTDA 3FYPA 4E6MA 4ZSUA 4Q7IA 3B4YA 3NQVA 3WDRA 2YGYA 1IHIA 2Z7KA 4ATDA 3QYQA 4CNUA 4XQ6A 4JQ3A 4UCFA 3CK5A 1P4CA 4MJMA 1BGAA 2PTWA 2A5HA 3M47A 1SM9A 3OLEA 3RX4A 3O15A 2BOGX 1LORA 4B5NA 2CYGA 1B4EA 4PRWA 4XISA 3WUFA 2BXYA 1RP9A 3WQ4A 1TPWA 3RUBL 3UJFA 1K8XA 1MSSA 5A8NA 2OEMA 3NJ3A 2XGZA 1PZ0A 4DXVA 4PEKA 1RZMA 1UQZA 4PMOA 1K3UA 3KRBA 4O0QA 3STGA 5LIWX 4XO7A 1ONEA 2WANA 1B3XA 1XPYA 1I1WA 1TJRA 3S5ZA 2ZCGA 3S8HA 1V6YA 3VE9A 4GZJA 5JIWA 4DJEC 2E68A 1H7OA 3KBSA 1XCFA 3P14A 5CPMA 4MKVA 3QMRA 3W0KA 3TP4A 4S3GA 1FWWA 3F03K 3TQKA 1M68A 3QPEA 2A3LA 1TKKA 1N7KA 2QMKA 3CTLA 3TXVA 2V5CA 1EIBA 3ALGA 4DF2A 4H7CA 3ZSSA 4JPGA 3IUHA 1JZ3A 1H1YA 3UD6A 4F2BA 3VK5A 3T09A 2R91A 3A3XA 5J5RA 5IHRA 3Q65A 1Z42A 2CZ5A 2JBMA 3L2IA 2OLSA 1KTBA 4AEEA 2O9PA 1Q5MA 3WD2A 4JTHA 3GTFA 2YBVA 3SSJA 1CLKA 3MA8A 2WBKA 3S5OA 3VIPA 3M0KA 3TYBA 3AIUA 3QRHA 1WXYA 1P7TB 3R79A 4AWEA 3B9DA 4R9XA 3CUJA 3H23A 1YTEA 4DAIA 1S5NA 1SFJA 4IFOA 3EA3A 1K03A 2HK0A 1UKSA 4ZL1A 2Z24A 1KWGA 4Z1DA 4UFLA 5IBXC 3M44A 4BWLA 2NXGA 4ZO7A 3KLKA 4GFIA 1V6UA 2G4FA 4LUJA 1Q6DA 3MI3A 4P7OA 5HINA 1DP0A 5HOSA 1RAKA 4MB5A 3AUOA 2Z28A 4MNKA 2YDRA 3WLTA 3N2XA 5TAOA 3VM5A 4UTLA 1ZAHA 1PX3A 1VBJA 4IMDA 4Z1YA 4ICMA 4PL2A 5E9XA 4BI7A 3PBUA 4J4KA 5A6TC 4O53A 4J1OA 2I9EA 5C9RA 1UG6A 3LBMA 4FAMA 3M6YA 4CD5A 3HMCA 4Q3MA 2CERA 5AFDA 3GDBA 1GCYA 4QIUA 4J3SA 1A80A 4QBXA 3MSGA 3BAKA 2C16A 4LX4A 1PJ9A 1W1PA 2E40A 3O63A 1C9WA 3SFKA 2OEJA 4RW5A 3CV1A 3WMLA 3IIPA 4FX7A 3OP2A 4CNSA 3RFAA 3GU9A 3M41A 3SR7A 2R1PA 1M7PA 1BAGA 1PTGA 4IOTA 5BNKA 3R10A 4TTGA 3VCCA 1WOBA 2Y7EA 4IQJA 2YL6A 4QM1A 3AYTA 1SJDA 3TR2A 2DH2A 5BW6A 4KGJA 3KBVA 4ADUA 1XRFA 2Y24A 3VKAA 2XIIA 3C2RA 5BWAA 4MNMA 1E4MM 1SZRA 3EB3A 3S6TA 3BW3A 5D8ZA 2V69A 5I5RA 4R33A 1FVPA 3QY7A 3RF9A 2IQDA 3ZR4A 3EPMA 1Q6LA 2P50A 4MWAD 1IEIA 3KOZA 3G1SA 2QS8A 4PCPA 1L8PA 3EMQA 1SZGA 3JZUA 2W4XA 3IJQA 5CKSA 4DI8A 1TA3A 5FJIA 3TE9A 3K5XA 3XIMA 8A3HA 3RO8A 3GXNA 4IUGA 3P74A 3VDCA 3DI1A 3WDIA 3UJRA 4DBWA 4L4OA 2V3GA 3RR1A 4HSNA 1UZDA 3WLSA 2X0YA 2J75A 3TW7A 1PZ1A 2HRWA 3SQLA 3IJ7A 4O15A 1F4AA 1M53A 4MMWA 5TNVA 2YA1A 4W8BA 1XRSA 3W2NA 4FIQA 1KR0A 2A0NA 1AG1O 1O4UA 1EBHA 2CBJA 3QLDA 4QR6A 4DM2A 2BMBA 1GYMA 3QY6A 3E2QA 4C6OA 4NNBA 3F4NA 1P0BA 1RPXA 3GTHA 3VM7A 2XM1A 2FMNA 1GW1A 5DBUA 1M5WA 4U2ZA 2F7FA 3ECQA 2I7GA 1LP6A 4RZ4A 5B80A 3RLGA 2PLMA 3M64A 1EJWC 1VEOA 1G4TA 4ZGYA 3WK1A 2IQ0A 3EBVA 3EDEA 1Z6KA 2ZADA 1DIOA 3PZQA 1KB3A 2P0IA 4A2RA 1F8IA 2ZUNA 4QLLA 2NQJA 2GGHA 4W89A 5GNZA 4DJED 3AS2A 1PDZA 4ZZ9A 4H9UA 3T1GA 2OZ0A 5MF5A 3AMLA 4L4PA 2PS2A 3IJIA 2Y7GA 3SO7A 2GUBA 2WVTA 1CW2A 1U1JA 2VGIA 3DU0A 5I0DA 2PTYA 3VIHA 3HGSA 1BD0A 3GRIA 1JPDX 4MF4A 4Z1CA 4H8NA 3GD6A 4DZAA 3KBWA 4N6EA 1JJKA 1X1OA 3MV01 1PIGA 3T0TA 1KNWA 1G5AA 3AJ7A 5BXSA 1XYMA 3R25A 2BGSA 5LYRA 2ZWZA 3WH7A 3DC8A 1OQFA 4PMRA 3IIVA 3OODA 1Y5XA 2EGZA 2W79A 4NUWA 3PZTA 3G24A 3DIPA 1Q6RA 3LD5A 5HQMA 5I6SA 1T0OA 1LOQA 3LHWA 1ZGDA 4DJEA 1DWIM 1QHOA 4JYEA 3EOLA 5C70A 1NU5A 2QNEA 1K7EA 3NQMA 1VPYA 3AMDA 3WQDA 3WNNA 3EMZA 4FLSA 1VC4A 2Y70A 4XK2A 3LBOA 3TSMA 4EXBA 3GTXA 1W3TA 1V0LA 4JIHA 2Y1HA 4IIEA 4PEEA 2BGQA 3BJTA 1Q8JA 1BXBA 4R88A 5D09A 2WSQA 3MMTA 1MEIA 3UG4A 2HXTA 3WJWA 3EB4A 4LRTA 3T7VA 3AIRA 2YA0A 3HV9A 1JD7A 2X2GA 1OF8A 3GHUA 3K13A 3FFSA 1EXPA 1FDZA 3M0HA 1S5MA 1SFLA 3LU2A 2VXNA 4HHPA 3AQUA 3P61A 3WMBA 2IPJA 3DHPA 3K30A 3HQPA 4LB3A 3SY1A 1EGMA 3WDQA 2QV5A 3T9PA 4PUDA 3W1PA 5HPOA 1OX4B 4JFVA 1KM4A 4H6QA 3B8SA 5K4XA 2DW7A 1J0ZA 4QXIA 3WIJA 3E1F1 3GHSA 1Z9AA 5DT7A 2FVKA 3VVGA 1WNOA 3ZSTA 4L1XA 5E5CA 2GVJA 2I16A 3TTQA 3KRSA 1T96A 1WDQA 5EA9A 1BWVA 4GD0A 4P8UA 4XZ9A 2FGZA 4NZCA 1ME8A 4ZBCA 5IBXA 1OC5A 5G1MA 2UY5A 1DJWA 5LHFA 1LLWA 4FR1A 1JGIA 4HNNA 3SUUA 3FDGA 1ODUA 2X42A 5BWFA 1KO0A 4GH1A 3WL1A 4ZR8A 1JCYA 3LCFA 2XU2A 1Z7AA 2WLZA 4GYKA 5FAGA 4C6FA 1UZ4A 3AS1A 5H1WA 1GYLA 3R6IA 4DF1A 1JRCA 1KR1A 3W70A 1XCWA 3EWXA 3KOXA 1TPVA 1K8CA 2P53A 1A5KC 4UIOA 1MRAA 3RITA 3OO2A 1J0KA 3L0KA 4JY8A 3BH4A 1OD8A 3M5VA 2RJGA 4F40A 3E9AA 4F2TA 4EPKA 2OTDA 2REQA 2V63A 3RGTA 3QV7A 1HXJA 3EPOA 2ALDA 3NM3A 2O7QA 3H7UA 3U2OA 3FKKA 1ITXA 3GTNA 1JD9A 3VGEA 5DMLA 1UD5A 3B3DA 3L68A 4D6IA 1Z44A 3KS6A 4G7EA 3NO3A 5D05A 3TIMA 2GFTA 2J77A 4B5WA 1DHKA 5T9BG 2KX9A 4MG4A 4LYRA 3U9IA 4HK5A 4XD4A 3AIVA 3T40A 5HUPA 4Q4SA 2VURA 1UD3A 1SR9A 5C2XA 3GFYA 1TPDA 4GA8A 1RLDA 2PDGA 4KIEA 3GWQA 3UWZA 3HQNA 1N8FA 4WF7A 4IGSA 2CZDA 3GHTA 1K4GA 4I3GA 3WBEA 3LN3A 1XYAA 3ZO9A 5E09A 3SCSA 5C5YA 1XC4A 3B0YA 2CEQA 1MMFA 2OWXA 3SN0A 4F0HA 2Y8KA 1H60A 4CD7A 4OT7A 2JGQA 2E77A 3ELFA 1HJQA 3RG6A 5LGZA 3D46A 4N9DA 1JG9A 1W56A 4PBFA 3W2MA 2GWGA 3HO8A 3UVAA 2CZFA 3BWWA 3IANA 4QQ3A 3PZVA 4NU7A 4U28A 3RU8X 1GOKA 3UYIA 4O11A 3T78A 1G69A 2X1RA 3SQSA 4XB3A 3N6QA 5BRBA 4FEZA 1TZ7A 4ZEPA 2PDHA 3BG5A 3PZGA 4A4AA 3VD7A 3VIIA 4D6EA 1XDMA 4H2HA 1TV4A 4O50A 1J5SA 1X6LA 1W9UA 3LCLA 1EH9A 4K38A 1MRQA 4LC6A 2QIIA 4HKPA 1BRLB 5FF0A 5CJMA 1KBBA 3LZ3A 1ENUA 1VEMA 3Q67A 1V6XA 3KE0A 4U2YA 3G0UA 1E3ZA 1SUXA 1KQZA 2E9MA 1UR4A 1H09A 1XBYA 1RPKA 1H0GA 4C6PA 1V02A 4W93A 2YX0A 3I10A 3JRKA 3TTSA 2EKCA 3GBEA 4NJIA 4EXAA 1DJQA 3R94A 1IZCA 1TREA 5CBBA 4BHYA 3W22A 4MUPA 4M7TA 3CHDA 2OYKA 3WNLA 4DO5A 4JZ5A 4LSBA 3U8GA 3RCYA 1YIXA 2NWSA 5HBFA 4DJFA 4NRSA 1E5NA 1FHVA 3W87A 3I68A 3N15A 5TQLA 3U2ZA 1LF1A 3PUGA 1TUFA 3C52A 4UNIA 4Z1BA 1BHGA 1GEHA 3QOMA 3BW4A 3LI0A 5K3VA 1PAMA 4NZ3A 2AAAA 4XX6A 2PBGA 4OBSA 2W92A 4B3KA 4FF5A 5FEZA 1N8WA 1CLVA 5H6HA 1VKFA 4UMBA 4XTDA 3LS9A 2PSNA 3F2CA 3H2CA 2XIOA 3BLKA 3BCDA 3I3DA 1PTAA 3ZJ6A 5GPRA 1J10A 4OKDA 7ENLA 2GGGA 5C2CA 1XGEA 3NWRA 5DLCA 4IMEA 2QVHA 1XKYA 3N9KA 3KL5A 1EQCA 4MFEA 3PTQA 4LS2A 2PDFA 4DZHA 4PGLA 3W1NA 3M0JA 2VGBA 2WHKA 4NZJA 1GT8A 1NWUA 1RVKA 3PBMA 1XLBA 5I77A 4HU4A 4EF9A 3DC0A 1CTNA 2EG6A 3PZUA 5KZEA 2J7BA 1SW7A 3L5LA 1G7UA 2PODA 1FHLA 3F4WA 3EB2A 4XD5A 3C5QA 4DBUA 4QS5A 4QAWA 3UWUA 2NVDA 2BY3A 4MTVA 2YYUA 1REQB 1KRMA 3WLKX 3B8UA 1JYXA 4JBRA 1SW3A 5AVNA 4WSKA 3O6AA 4L80A 1FWBC 2XIQA 3W1UA 1LBFA 1XF0A 4IXHA 5A5WA 4OTKA 3L4WA 4Q32A 3AZTA 4HOZA 1OVDA 1YBQB 2F38A 4NY2A 4XUGA 3C2EA 5D2XA 2A2IA 2VYOA 3FNDA 4GUFA 4XZMX 4C1KA 1DKWA 4GACA 5A6AA 1R2RA 1KA9F 2YBUA 4G7FA 3MHGA 4WCJA 1JQVA 4AZCB 1YPFA 1UJQA 2ZTJA 1Q2RA 4S2CA 2QZRA 2YCKX 1PBGA 3K46A 3PB2A 1DQXA 3TAKA 3G1FA 2AOSA 4ZOBA 4O13A 3O16A 2WOQA 4W7WA 4GINA 3O6CA 3UA4A 1LBMA 1GEQA 2IUZA 3WJZA 3T08A 2XVKA 1PIFA 2HVNA 3SGZA 5M3WA 4AWUA 1SO5A 2EBNA 1W9VA 4AG0A 1VJZA 3IK2A 2E6FA 3OGRA 2Z27A 3C0JA 3HFTA 2QDGA 4Q4QA 3FDKA 4GVGA 1TB3A 3MPGA 1GVYA 4HN4A 5DQPA 3L4UA 3E96A 2FH6A 3HU7A 3W00A 2GK1A 2P1FA 4FPSA 1O60A 2HROA 2E6AA 3CYVA 1NDYA 1IWAA 3ES8A 1TG7A 3AFBA 3FHAA 4QSFA 1UQYA 4M0XA 2DQWA 1E40A 3VNIA 4G9PA 3H2EA 1EEPA 5IDZA 2VDGA 1PWMA 1JPIA 2XGBA 2BVTA 1NFBA 4UFJA 3ANVA 4C90A 4D1JA 3PAOA 1O66A 4K6AA 3MCOA 3EA2A 4LJ3A 4JN8A 4PCFA 2CBUA 3MMDA 4JN7A 3TFXA 3LXAA 1TZZA 3BOFA 1TA3B 3GG8A 4C6JA 4CU7A 2BP1A 1JI2A 4A05A 3S2JA 2J13A 1TWWA 1MI3A 4GFSA 3SN1A 4WSJA 1PKLA 1W9DM 1B3ZA 1TYGA 1J6PA 5D02A 1KXTA 3SCWA 3BUVA 1OYAA 5ABHA 5KZDA 3UG3A 2UY2A 2AL2A 4K8HA 4FNPA 3TONA 4H9XA 1ZBCA 4DUWA 4UMCA 2X1IA 3KUMA 2NVCA 5FA5A 3K8LA 3NZGA 4BJHA 2XFRA 4NF7A 2W9MA 3URBA 2V5BA 2D23A 2XINA 2X05A 1IEWA 1MZRA 2OLHA 3LPPA 3POHA 3UT0A 4JTUA 4W7VA 4ZE4A 1V79A 3KDOA 3GH5A 2A79A 2YL5A 5D2WA 2FFIA 1JDEA 4JIIX 2VM8A 1THFD 6XIMA 3IK4A 4N4QA 4WDWA 3KS5A 1GPWA 1YDOA 4GCAA 4ORIA 3LM3A 4NP7A 4P7LA 3MHFA 3IJ9A 3QV6A 2NV9A 2NSXA 4IPLA 3SCVA 2YDAA 3UY8A 3BLIA 2ISWA 2DZPA 4XV0A 4JTKA 4WHBA 4GISA 3UWEA 4YWSA 4JIEA 1C90A 3EX4A 3QC0A 2O7SA 4D1IA 2HK1A 2PTDA 1KD0A 3MP4A 4HPGA 1KLYA 3DFTA 4QAIA 1KFJA 3N9SA 2OSXA 3CT7A 1XBVA 1F3WA 1TCMA 3BSHA 1V0KA 1XSIA 3UERA 2TRSA 4LRSA 1B3OA 4LEFA 5CZSA 1A3XA 2J88A 3CWHA 1Q3NA 1ZJAA 4S2BA 4TVUA 4PTXA 1WCGA 1X6UA 3N3MA 4I5UA 3RRAA 3CUXA 4UTMA 4MKNA 1HL2A 2E5CA 2J7EA 3PZIA 3WJXA 1RUSA 4IL2A 3CH9A 4OHQA 4EAYA 2DZXA 2XN1A 4S23A 3VOCA 1ME9A 5HNRA 1R30A 3BVJA 3RDKA 5CJNA 4O54A 4H6KA 4QJ4B 1TPC1 5BZAA 3CV7A 4WKHA 1HL8A 3LGDA 5AYZA 2PCEA 4M7SA 2DT2A 2V68A 1VCGA 3TC7A 4IZGA 1W9BM 4CCDA 3DZ1A 3SRFA 1FDYA 2NVAA 3MU7A 3DKLA 1H5YA 3N3TA 1ZB5A 4O1FA 2ZUMA 2C15A 4N7QA 2ICSA 4GC3A 4O1AA 3Q4DA 2PDYA 4HJWA 1TIWA 4RNJA 1QNSA 4WXYA 4L56A 3DFOA 1YE6A 2CCRA 1HVQA 3LTPA 4TQTA 3PWIA 1WZMA 3I6EA 1V6VA 3GXTA 3DGRA 1OGSA 1SZNA 3FN9A 4ZMGA 2QUMA 3A9IA 2CHNA 2C1HA 4PH6A 5A94A 1GZ1A 1VEPA 3BURA 2WHLA 1GOWA 4H4IA 3RIKA 4C7FA 5F2MA 1RV8A 3W2JA 4I9TA 2XVGA 3H21A 2Z6IA 2GLKA 1FX6A 3MUIA 3B9OA 1PPIA 3VNZA 1POJA 4INFA 4MZ1A 1W9PA 2WK2A 3VOGA 4MHBA 2J47A 3MJMA 2Y62A 3W2KA 1OEPA 1MQRA 2OJPA 3OHIA 1JR1A 1YW1A 3DYPA 1BVZA 2BXZA 3TQPA 1ZCOA 4UC5A 1DOSA 2J6VA 2WC4A 5DMNA 4UTJA 3NZ1A 1DWAM 1US3A 4BEUA 1MW1A 2Z1BA 4XAFA 3QW4B 4JNMA 4L6OA 3BSGA 3MKKA 3B05A 4DZIA 4ZENA 2EF9A 3KBJA 3NXLA 1NOWA 4QDPA 1D2KA 4HP5A 1XX1A 3RCMA 2OO6A 5D37A 1XI3A 3PPCA 3OOQA 3VILA 1OWQA 1E6QM 2F2HA 4PUUA 4F2UA 3H4XA 4Z0JA 4AMCA 3IGXA 1QOQA 2Z0IA 3HOJA 3G3DA 4K1WA 4A21A 1EJ7L 5G4EA 4WKFA 3T2PA 4F9DA 2R24A 1EJXC 1OFBA 3APTA 3CYJA 3WLMA 3C2VA 1E6SM 4PUJA 4X0VA 3APGA 1UD2A 3G0SA 4K7YA 1EP2A 3NZPA 4UTWA 3RLVA 4I9AA 2QJMA 2VD8A 2CPUA 4H9YA 2PURA 4OWGA 4TVCA 2WCSA 4G5DA 3P0XA 2FDMA 2HBXA 2QGHA 4PMZA