3M0KA

Structure of oxaloacetate acetylhydrolase in complex with the product oxalate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
294
structure length
289
Chain Sequence
DEPFSGAKKLRHLLENTDELIVCPGVYDGLSARTAMELGFKSLYMTGAGTTASRLGQPDLAIAQLHDMRDNADMIANLDPFGPPLIADMDTGYGGPIMVARTVEHYIRSGVAGAHLEDQILTKRCKKVVSRDEYLVRIRAAVATKRRLRSDFVLIARTDALQSLGYEECIERLRAARDEGADVGLLEGFRSKEQAAAAVAALAPWPLLLNSVENGHSPLITVEEAKAMGFRIMIFSFATLAPAYAAIRETLVRLRDHGVVGTPDGITPVRLFEVCGLQDAMEVDNGAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Oxaloacetate acetylhydrolase
publication title Structure of oxalacetate acetylhydrolase, a virulence factor of the chestnut blight fungus.
pubmed doi rcsb
source organism Cryphonectria parasitica
total genus 109
structure length 289
sequence length 294
ec nomenclature ec 3.7.1.1: Oxaloacetase.
pdb deposition date 2010-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3m0kA00
4KCWA 1S2WA 1F61A 3OYXA 2VWTA 1M1BA 2X0SA 2XZ7A 1MUMA 2V5KA 2WQDA 3SRDA 5JVLA 1KBLA 2QIWA 5TAOA 4B5WA 2VGGA 1XG3A 3GR4A 3QV8A 3B8IA 1PKYA 2KX9A 1GGOA 3HQOA 4B5UA 4B5TA 4L7ZA 3PUGA 3QLLA 4B5VA 4WJ8A 3T07A 1PKMA 1T5AA 1E0UA 2DUAA 1O5QA 1S2VA 2G50A 3SRHA 3LYEA 3EZ4A 4L9YA 2VWSA 1KC7A 4YJ5A 1OQFA 4B5SA 3M0KA 2R82A 3QV7A 4MG4A 1IGWA 3KTXA 1PKLA 2XZ9A 3E5BA 4IQDA 1S2TA 2HWGA 3FA4A 1DXEA 2HROA 4IQEA 4KCVA 4HYWA 3E0VA 3IS4A 1S2UA 2ZE3A 3E0WA 1PKNA 3T05A 4B5XA 1F8IA 2VGBA 2DIKA 1ZLPA 1O68A 3N25A 3GQYA 2L5HA 4MF4A 1UJQA 2VGFA 1M3UA 2HRWA 4KCUA 3ME3A 3QQWA 3P0XA 4FXJA 2V5JA 3BJFA 3QV6A 4JPGA 2HJPA 1AQFA 1SGJA 4QG9A 3SRFA 3HQNA 3I4EA 4KS0A 1DXFA 4FXFA 1OY0A 3LG3A 3EOEA 4QGCA 3OQ8A 3EOLA 3KHDA 1F3XA 2OLSA 4TV6A 4G1NA 4LSBA 3FA3A 1ZJHA 3QV9A 1A3XA 1DQUA 2VGIA 4YNGA 1Z6KA 2BG5A 4L9ZA 3SRKA 3R4IA 3MA8A 1DIKA 1VBHA 3G2GA 4B2DA 4IP7A 4IMAA 1A49A 1F3WA 4L80A 4QG6A 3GG8A 4ROQA 3T0TA 1JDEA 3PP7A 3U2ZA 4RPPA 1U5HA 1VBGA 4KRZA 1A3WA 2XDFA 3H6OA 3M0JA 3OYZA 3VAVA 1O66A 4KCTA 4DRSA 1A5UA 3BJTA 4TV5A 1PYMA 3EOOA 1F8MA 3QTGA 4HYVA 1IZCA 4B2DD 1U5VA 3HQPA 3QZ6A 1XG4A 2E28A 1E0TA 4QG8A
chains in the Genus database with same CATH superfamily
4D6FA 3NDOA 4LWWA 3P0WA 7XIMA 4HHHA 3PZNA 1DORA 2V2CA 3S47A 1OX5A 4QDMA 2GDQA 4AQLA 3W83A 3LOTA 4Z1CA 1W1ZA 1OABA 1A4LA 2CBUA 3PR2A 1J01A 1A5KC 3B0PA 2ODOA 1S38A 1ZAHA 1YMYA 4QP0A 2F2KA 1Q4WA 1GJWA 4DNHA 1E6NA 1ONRA 4GXWA 1XS2A 1M6JA 4CUCA 2PDWA 1XQKA 4L4MA 4DJFD 4KETA 3WUGA 1UBPC 5J5RA 3PZGA 3BGGA 1JJKA 1QPQA 1V93A 4C6OA 3GHTA 1EJSC 5A8MA 3TH6A 2D0GA 1IWBA 3W74A 1UKOA 3BG3A 3T09A 3W7OA 1TPH1 5DY3A 3KL5A 1AG1O 1UR1A 1KR1A 3SN4A 1CXIA 3W3OA 5LXEA 2FVLA 3QMRA 2VL4A 4PUEA 3U2ZA 3P5ZA 3I68A 3WF0A 1EC9A 4DRSA 3W1QA 1B3YA 4HN8A 3IUIA 2C8NA 3W0KA 2Q71A 4HHPA 3R58A 4IZGA 2FZ9A 4M0XA 2CYGA 3VM7A 4EOUA 3VNLA 3FAXA 3GVVA 2WZTA 5AC5A 1C29A 1TJ0A 2PRHA 3MUY1 4GYJA 1X1NA 5C2XA 1QVBA 4LGXA 4D1IA 4HCHA 5I07A 1KTBA 3M0IA 4ZXLA 5BMXA 3W81A 4KFOA 1YX1A 1XYZA 3U2OA 3DESA 4Z2LA 4L6OA 3V1PA 3TZNA 2UY4A 1CGYA 2BX7A 1UJPA 4Y8EA 2IPJA 2WVSA 3FGCA 2Y5EA 3WF2A 5FESA 3S9IA 2A3BA 4GVIA 3FV9A 5I0DA 1BQCA 2FZ8A 3WELA 2EHHA 1DTNA 1R9XA 6TIMA 2JKPA 3BO9A 1W9DM 3G1DA 4KCUA 3ME3A 4JZ5A 5FEZA 4UMAA 1JRBA 4LANA 1J8VA 2E6YA 1YXDA 1VLWA 2IW0A 2H8XA 1A5BA 3H54A 3SUVA 5AN7A 1L6SA 1MO0A 4S23A 3TN3A 3HG2A 1R7AA 1PVNA 3PZMA 2TODA 4GD0A 2NV9A 2GVJA 2YW4A 1ITXA 2Y7EA 2BWGA 4D6GA 1CGUA 2XTKA 4OHQA 1ZBKA 5DF0A 4E4FA 1JXJA 3KP1A 1NEYA 2I56A 5IM51 2MUCA 3TXZA 2VZSA 5JIPA 4NI3A 3O05A 1A0EA 2V5CA 4WJEA 4BEQA 2P88A 4FLQA 3BSMA 3JW7A 4JYFA 2V5KA 3KW3A 5CSSA 5LIUX 3ZM8A 3GZAA 4C1KA 1OBAA 1RVKA 1VBUA 4NKCA 3ZWSA 2JIWA 3BPWA 4HMEA 3OU8A 4WEVX 2Z26A 3KTCA 4B5VA 4O1EA 4YVPA 1TA3B 1XBZA 4MPKA 4IFKB 4BI6A 3KOZA 3UWYA 2G95A 3UPWA 3VIIA 2ALDA 3ITTA 3L4VA 5DCEA 3T7VA 2JF7A 2HPMA 1QWKA 1W8SA 4QLLA 4HJFA 4IX2A 3CZ8A 1O5XA 2F2HA 3EXSA 4NJJA 3CZJA 3SRFA 1YDNA 3S5ZA 2HNHA 2WMFA 5CKSA 1H7OA 4QLKA 3AMKA 2CEQA 4QGCA 3V0UA 1DKWA 1XBVA 4I5XA 2Q3RA 3O3RA 4CN6A 3PPFA 1V3HA 3M0VA 1WNOA 1FWRA 1KM4A 2VT0A 5DBTA 3KOFA 5IXEA 1Q2RA 3FVMA 5FOOA 4A8LA 1Q65A 3A3XA 2HVNA 2PPGA 5HR6A 3MPGA 3VO0A 3HPSA 5BYWA 3V5OA 2WLZA 2YA1A 4PUKA 1LBLA 4CU6A 4AUBA 2V6AA 1V6UA 3QTGA 2TPSA 3CC1A 3UR8A 1MXDA 4DI9A 1UR2A 1DJNA 1IYXA 3B9OA 1NP2A 1UW9A 1EX5A 1QNSA 2OCZA 3SUWA 3LERA 1OIFA 5JBFA 3FXYA 3NIYA 1EJUC 3C2RA 2J8TA 1KQZA 5CC6A 2VENA 3NPWA 4AWTA 2ACQA 5CPSA 4WXZA 2WHMA 1O1ZA 5H1WA 1PZ2A 2WNZA 4EK7A 3W2NA 4S3GA 4BFAA 4HPXA 4M8UA 1J6OA 5HWNA 3GU1A 5FEPA 2FTYA 4REQA 4HKPA 3CBWA 4PUWA 3WD2A 1YTEA 1ZLPA 4IWWA 4QAIA 2ZX9A 3MO7A 3STGA 1GZGA 4JTSA 1YE4A 2XVNA 1TWWA 3QM3A 1HGYA 2V5BA 3AJXA 5K7JA 1GQIA 4K6AA 3KWSA 1XW8A 4G2DA 4IMCA 1GG1A 3HA1A 3G77A 3UWQA 1MMFA 5KZMA 2I9EA 1B3WA 4B90A 1JQXA 1UYQA 4LBRA 1VS1A 4NL1A 4WY0B 3G2GA 3R7MA 4XD4A 4NVTA 3GUGA 2G37A 1PZ3A 3P6LA 3J7HA 4DBUA 5DFAA 3WMBA 1O94A 3BG5A 3DFNA 3DYMA 4Y9MA 3WN6A 5I3DA 1E0TA 4JFSA 4DO7A 1JPHA 4L4LA 2XN0A 3AO0A 3WNPA 4HOWA 3KFTA 1A5AA 2C13A 1I4NA 1EXBA 1WDPA 1SZRA 3WQ8A 2WZEA 3O8AA 1EL3A 4QX4A 5CPNA 1WPCA 4L7ZA 3URAA 1BSLA 1E5JA 2QR6A 1XHGA 3CUIA 1IXNA 1ZAJA 1EHAA 2NQ5A 2Z1VA 4UQAA 1F4HA 3LPOA 3GAYA 1OFEA 4ONVA 3UG3A 1R3QA 3MI6A 3WQOA 3LMYA 4MWAA 3S42A 2Z24A 9RUBA 4O16A 4QITA 4BQ5A 2FGLA 1GQNA 1EKOA 3N4FA 1NOFA 3QHOA 1I2PA 4UMCA 2J7HA 4JX6A 1E4LA 3NCOA 4PUDA 2E3ZA 3FJNA 2KZHA 1G4SA 4ZB5A 3HG4A 3OHMB 3LHTA 3GVGA 1X96A 2ZE0A 3VZYA 2QEZA 1SVDA 1Q63A 2GK1B 3WJWA 2BNJA 4WF7A 1QRQA 3SR7A 4PUMA 2W92A 2QMKA 3IIXA 3R1ZA 2KAUC 5GPRA 3H6OA 4F66A 4Q8OA 1JZ5A 1MDLA 1W1VA 3AYTA 3FEMA 3BSHA 3CV7A 3W2JA 3MBFA 1TVLA 4GMEA 5CGTA 3MUCA 1YRRA 3IACA 3PZTA 1FOBA 1OADA 1XLEA 1GORA 4JQ4A 2VZOA 1WBHA 3BDKA 3CHVA 3NL6A 4JQ3A 3AHTA 3WY1A 4WY0F 1YBQA 3NEHA 2GSHA 2ZRXA 2QCDA 1DTUA 4IUGA 3LM7A 4DPQA 2UY2A 1E1CB 3PWGA 1DEDA 3W7IA 1AA1B 3PZ9A 1DOSA 4A35A 2DQXA 5D37A 1XLGA 4RW3A 1TMLA 4WGXA 4HYWA 2DT1A 4O15A 2QQ6A 4GVFA 3W22A 3G6MA 3O2LA 1RK5A 1KM1A 1J5TA 1H3GA 1PTDA 3HQNA 3I4EA 3BOXA 3H8AA 4LUTB 2W0UA 2AKMA 3VDGA 3B05A 2CWXA 4UNLA 1C90A 4TTUA 1MVYA 3HV8A 4AMCA 4JTGA 3F4DA 4ERGA 5EMMA 3QGKC 4S3BA 3KHJA 1FQ0A 1XSJA 2XIJA 3OBKA 3VM5A 3UJSA 4HOXA 2GL5A 4TIMA 3UZXA 2J79A 3I7SA 5IOBA 1UOKA 5E1QA 1V51A 3R25A 3T2PA 3RM9A 5CEWA 1V6TA 3LPFA 4UFJA 1F07A 4JTTA 1UG6A 2NVCA 1YXYA 3OYXA 2PZ0A 3RCNA 1W9UA 5BOFA 4UOQA 5DT5A 3IV3A 3O1NA 3SCSA 5A8GA 3QV8A 1PDYA 5HMFA 1UIOA 2QCNA 3TJIA 5E0FA 1CT5A 4JOMA 1LRQA 1AW1A 4B15A 1KXQA 1MQPA 3RU6A 3NQGA 2NQ9A 3VOJA 2Y4SA 2IQ0A 1HKIA 1W5MA 4DWSD 5F2MA 2NT0A 1V3IA 4D6JA 4DJEC 4ATLA 4X3ZA 4N7QA 3BW4A 1JCLA 3UG4A 3NL2A 2PBGA 3NPUA 3M0YA 1IEQA 4CD6A 1OM0A 3NFUA 4INFA 1K9DA 3KCOA 2CC0A 3AUOA 5AOUA 4CD8A 4IPIA 5F4WA 3VNIA 4LS2A 3DGBA 3CQKA 3DKJA 3WDPP 1VGAA 3AMCA 4AYSA 4R7WA 2ZZ1A 3V3WA 2WMJA 5G1YA 5CBIA 3MSDA 4NJIA 3TN4A 1DP0A 1OFPA 2YX0A 1KM6A 2A79A 1J0IA 3OZMA 1JYNA 2G3JA 2X0SA 3G1HA 1LLWA 1V0NA 4QS5A 4AFYA 1VEMA 4O4VA 4YU1A 4EXQA 4N6FA 2FH6A 3EX3A 2ZC1A 1YE6A 4LRSA 3CQIA 1VFOA 1GVSA 4AD4A 4ZQOA 4MSSA 4IMGA 4HNTA 2D2OA 4R3UA 1SZGA 1UKSA 3RR4A 2PEVA 1NM9A 4MZ8A 3AIUA 3OG2A 2V0TA 1XGEA 1VFFA 4GIAA 3WQFA 2WSQA 1FDZA 1T0OA 1QNQA 4OV9A 3JRKA 3L21A 4NZ4A 4YL2A 1A5MC 1J12A 4V33A 2Z1SA 2FGBA 3SJNA 4E3TA 1M5WA 1H7PA 3W7HA 2D24A 4ML4A 2XH4A 2WM1A 1OZMA 4W5UA 1R2TA 3MDUA 1BVNP 3QZAA 1ZGDA 3C2EA 2VZUA 3WQ4A 3PZVA 1ISWA 1B30A 3NYDA 4Q7IA 3SGGA 3IK2A 2O4MA 3K4DA 3VGBA 1ECQA 3WNOA 1ZJHA 1ISXA 2VX4A 2Z2AA 1KBIA 1OFAA 3WLLA 1RSCA 4D2JA 4IM4A 4IG2B 2J74A 3IARA 3UQNA 2XSBA 3IJ9A 3PF3A 3W27A 1VCGA 2DZAA 3WENA 4YVXA 2EJ1A 4AYGA 4H9VA 3VYLA 4P2VA 3VNYA 3NXLA 2YA2A 4XZ9A 2PDPA 4A2SA 3THDA 1H7RA 1H11A 4GG9A 3MBDA 1LRTA 1M9HA 2VGGA 1ITCA 1F05A 1LORA 1ZU8A 3BV7A 4MIMA 5AFDA 5FSEC 1YLVA 5BXTA 4PB4A 3M64A 1JPDX 1FXPA 4WDTA 2C0AA 4LS0A 5JUVA 2NVAA 2DW7A 3SQLA 1HKJA 1QPKA 1C92A 1OD8A 1RCOB 1DWAM 4EF9A 2QZRA 1BEUA 3W75A 2EPLX 4JGDA 4AF0B 4LXFA 1VAHA 3WL0A 1F74A 1XINA 1LM1A 3U9IA 2WBGA 1LCOA 4FOKA 2XM1A 2IXVA 3KXQA 4PGLA 1VPYA 4DBDA 4NASA 2PDQA 2OWWA 1NVMA 4MY9A 4TOQA 3MSYA 3GNOA 4O50A 3E0LA 1M65A 3GXPA 4H6KA 3DI1A 3GHRA 3W71A 1H5VA 4GUFA 1KWGA 3FNDA 2GGHA 2AL1A 3N2OA 1QFEA 4QNEA 3H2FA 4H9YA 1XRFA 3AAMA 4H4IA 3MMWA 4DBSA 3ABRA 3ALGA 2E6DA 4HPGA 1G67A 1PYFA 1EX1A 3ONCA 4JS3A 2C7FA 4GNJA 3PBMA 2CZDA 4J9JA 3UYIA 3BLDA 3KOYA 2QGHA 5C2CA 4W8BA 1LLOA 2IPGA 3MHUA 4CNSA 5JQ9A 3L4TA 3SFKA 2HVOA 4KEZA 4Q8TA 2A0NA 4PMXA 2CBIA 3G0XA 4R85A 3EDJA 4C6BA 4GVGA 1V0KA 4HMDA 2QV4A 4IQDA 4M6VA 4URIA 1H0GA 1K77A 2XUCA 5AZ0A 4P8WA 4JKLA 4JN7A 1PDZA 2PU0A 1S5MA 1T7LA 4FMVA 4O13A 4MPQA 3CWOX 1RK6A 4X0NA 4XKYB 4WSJA 3F1QA 4FR6A 4JHMA 3ZVHA 2ZRVA 3N19B 3AALA 2O7SA 4ML9A 1F3WA 4WDWA 2Z4GA 4HU4A 3KL3A 4LCSA 1DHKA 3HGSA 2OU4A 3H4XA 1I75A 2YCLA 1GZJA 2CLMA 2QJJA 5GNXA 4HA4A 4MKVA 2ZADA 4QG8A 1WZLA 4B5NA 4KCWA 1S2WA 3PANA 3LLDA 2UWFA 2CKRA 2Y0FA 3RHGA 1XCWA 2Y8UA 2HK0A 1QPRA 4OUIA 4IIGA 5B80A 3IUDA 1XKYA 2POTA 2I17A 2Y89A 1ML1A 2UY5A 2PDBA 2ZRZA 1EDQA 3I6RA 2ZKMX 1ME8A 4JNZA 1X1OA 2V3GA 4W85A 3E5BA 3N3MA 2C14A 3RLVA 1EUNA 3INPA 3T05A 4E2DA 3S1XA 3QOKA 1BRLB 3B8UA 1S39A 3W1AA 1L0PA 2QDEA 4A2RA 3QV6A 1I1XA 3EPMA 3AC0A 3SDOA 5T8GA 1KRBC 4R34A 4ADUA 2XIMA 3P3BA 3WCZA 1NJJA 4J3VA 1UH4A 3H24A 4GFSA 2WCGA 2OLSA 3ARTA 2PWHA 3CV1A 4FOJA 2J9YA 1B3XA 4NNAA 4QIUA 4Z1AA 4QTGA 3ZJ7A 1GOQA 3HIJA 3TK7A 3G1VA 3HZ3A 3RLHA 1N2VA 2XGZA 1SSGA 1IQ8A 3GKAA 3MUZ1 4YHGA 4AZ6A 4UTTC 4AD3A 3F4CA 5M17A 1GOIA 2QPSA 3VGEA 1KCKA 3N6HA 3TOYA 2E5CA 1E15A 3ZJ6A 1YIXA 1ZS2A 2YXXA 5LA0A 3RM8A 4E4UA 1W1PA 2DDXA 4H00A 3A21A 2Z7GA 4DJEA 3CM4A 3B0XA 2BHYA 3UZ5A 3C0QA 1I60A 1ZB5A 4B5UA 1RXOB 2HEJA 4Q33A 5K3VA 1M7OA 4MY1A 3ATZA 1QNRA 1W5NA 1WZMA 3NYZA 4MFDA 1BYCA 3GY1A 1M03A 3VINA 1EJXC 3AICA 2XJ7A 1W1A1 2WWDA 1FWGC 1UQZA 1LUCA 3CEPA 3JS3A 4GQ0A 2R1PA 1TYGA 2Y7FA 4L5ZA 2A3HA 2ZVIA 1EUAA 4KH2A 1ONWA 1JCYA 3SCUA 3AHXA 2E9LA 4LAZA 4X2PA 1EEPA 3UG5A 2AOSA 1BYBA 2QUMA 1DIOA 1TRDA 1FWSA 3XISA 4C5YA 3VIOA 4AHPA 2VVNA 1CXKA 1RUSA 1R87A 1VCFA 2CZFA 2OB3A 3S5NA 2A85A 3CV2A 4NZ3A 1IWAA 4MWAD 4EAMA 5E0KA 2PDYA 2VDHA 3MDWA 1GWJA 1ISYA 3LRKA 3ABOA 4Y9OA 2F8QA 4MAVA 4XZLX 5AC7A 2FPYA 2GWGA 3PULA 5HWMA 3NQVA 4U33A 4DZAA 3LHWA 3ARUA 1OG0A 3JVAA 4DO4A 1CEOA 2ZXAA 5CLWA 2QCEA 3L4YA 1HJWA 4O0ZA 1X8CA 3G1FA 2A3AA 2IKJA 1JIBA 3WLNA 4D6EA 4FA3A 5B7ZA 1UD3A 3LXBA 1KBBA 1S2TA 2QVNA 4XKMA 4NZJA 4B9YA 1BKSA 5LHEA 2FDSA 1TPFA 2X16A 3ORWA 1C8YA 1B0IA 1TPUA 3GNRA 4QSFA 3CL6A 3PK7A 2MNRA 2HZGA 3U4FA 1JCXA 4HSOA 5F2GA 3TC7A 4UBPC 1FUYA 1BGGA 5FCZA 4RNFA 2DSUA 1K4GA 4JFUA 1VBHA 3VZZA 3W1UA 3WLIA 1EC7A 4GH1A 3G0SA 1SJAA 4LJ3A 4AVFA 1CENA 5C7VA 3EX6A 1WKDA 3RN6A 3IGSA 3TV8A 1T99A 4CLMA 3ZQ9A 1UPPA 4OIFA 1R46A 3HMJG 2OPJA 3CAVA 3M44A 5DT7A 1UZ4A 1CX9A 1R3TA 4MJMA 1PCWA 3IGXA 2QJIA 2DFAA 3E12A 1N7KA 1PS9A 4DZHA 2F38A 4AC1X 5HUOA 4X61A 2AQWA 3W07A 4FR1A 4DELA 4UTIA 1E6RA 3QGAC 4BWLC 2CFFA 2DUZA 2PLMA 4JXCA 2AMXA 3ISIX 3AXKA 1SMAA 3NSNA 5U7SA 4PULA 3PNUA 4DYJA 4ZE5A 1O12A 1KTCA 1JZ7A 7TAAA 4C6MA 2QCLA 2J8GA 3QOMA 3AIVA 1OCQA 4G56A 4P8VA 4C6LA 3M07A 5F4SA 6REQB 4OBSA 3CL7A 4KCVA 1TA3A 2NQJA 2YZRA 4IFKA 2RAGA 3L4ZA 3P8JA 4JL2A 1VFLA 4GPNA 4W5ZA 4AZCB 4OUEA 1TSIA 2RH9A 4AZBA 4W7UA 4P8UA 1B3OA 4N02A 4Z0SA 3CZKA 2X1UA 1A5SA 5CZTA 5DCBA 3GDMA 1JGIA 1GCYA 1CTNA 4D8AA 3LTSA 1EGZA 2QDGA 1JPMA 1AVAA 2PODA 4M29A 4ZEPA 1IXPA 4TVCA 1KBKA 3R4IA 3K8MA 1CW2A 2VC6A 1CXHA 1E4NA 5BOOA 4XBKA 3TCSA 5A2CA 1LBFA 2XVKA 1PYMA 1I2RA 4PEEA 3WNMA 1J18A 1HKMA 1BPLB 1FDJA 2J66A 2WJDA 2DZSA 3CO4A 1B3ZA 5KSWA 4JTJA 1X7FA 3W7GA 1EDGA 3DU0A 4UMBA 3S6OA 1Q6FA 4ATWA 5CSYA 3WBAA 4QDWA 2ZXBA 4HNUA 4WRHA 2C79A 4TR9A 3UFYA 1U83A 2BOGX 5CPMA 4RE3A 1LQ0A 2WQPA 2ZUWA 3OODA 3KOWA 4HNOA 1KQYA 4UC5A 4S3AA 3GVWA 2VEGA 3HFTA 3BOLA 4NZ1A 1WA3A 1HO4A 3OGSA 1GEQA 5CCZA 1EJRC 1W5OA 3LD5A 4EP8C 5BXRA 3N4EA 3K4WA 3ZLHA 4JL1A 3N25A 3TX9A 4A3UA 3FFSA 4EACA 1WKFA 3M16A 1K7XA 1E6QM 2OSWA 4ORIA 2CERA 4R27A 1OY0A 2JKEA 1W3HA 3GDBA 1UD8A 2H8ZA 1T96A 3AIEA 3NAVA 2FPVA 4PBGA 2QV5A 3CB3A 2YGYA 1SSDA 2JEPA 2BY1A 4A22A 3GBDA 1YPXA 1PE1A 5U4NA 4S3DA 3E6EA 3VD5A 3WD0A 1RBOB 3RG6A 1KRAC 9XIMA 4ZSTA 1BWLA 3E1F1 3THCA 3MB9A 3N6JA 1FHDA 4OGZA 2POZA 2WBKA 2ZXDA 1UH2A 2XGBA 3PB2A 1NF7A 1XCFA 2R1NA 4MB3A 4LUSB 3SM0A 4WDXA 5DLCA 2OX4A 3KVMA 4NUWA 1PZ1A 3HPXA 3A13A 4NU7A 3LGDA 4N6EA 4EPEC 3C61A 4MB5A 3B8IA 2C15A 4XB3A 4LAKA 1NARA 1WDSA 1I45A 4H41A 5M03A 1BXBA 1UC4A 2CLEA 1IHIA 2QUTA 1WKEA 1BLIA 3DG7A 3V35A 3OVGA 3BGAA 3PC0A 2I5IA 3ARRA 5FF4A 3SIMA 2ASHA 5JH1A 2YFNA 4LW7A 4MTVA 2ZFAA 3PZUA 3PPGA 1FDYA 1UUQA 5ABFB 2VX7A 1OJXA 1SZNA 2EG8A 2DUXA 4D71A 3CQJA 2HRWA 4JTHA 3VNJA 4UTTA 3RPDA 2GGGA 1KFKA 1WAUA 1H4PA 2CZEA 2PCQA 3AI0A 3GXMA 1DPMA 2VZVA 3UY7A 5D09A 4G1NA 4AVNA 2H3DA 4XISA 5C54A 1UP3A 1G01A 4KKXA 3BLFA 3IGHX 5T9CE 4PBFA 1NY1A 4LBUA 4WLCA 4R7JA 2Y88A 2GK1A 3Q2DA 3TDFA 4CGTA 1HJUA 1JYVA 1H51A 2YL8A 3CHCA 4ZQPA 5HQMA 3EXRA 2J7GA 4S3EA 2G3MA 2Y1HA 4IL0A 2X8RA 5MHBA 1VC4A 2W5FA 3QN3A 3BCDA 1JI1A 1XC6A 2RDWA 5LXXA 4D6CA 3WMSA 2DZTA 4U5IA 2P76A 2FFCA 4BK9A 1IR2A 5A8QA 3FW6A 2VC9A 3V36A 4A21A 4IMEA 3PFMA 1P6WA 2HMCA 3QV7A 4JIQA 1Q7QA 3UERA 1IT8A 2QCFA 1PO9A 3NM1A 3KBWA 4Q8QA 2ZUMA 4MM1A 6CGTA 1E1CA 1RQBA 3T78A 4OBTA 3E3HA 3GXNA 3C8NA 3V5FA 2HSAA 4JHZA 4W8LA 1MW2A 3BUVA 4EXAA 2PD9A 1J79A 3PFRA 3UNDA 4K7VA 3AIBA 2OO0A 1LOSA 2XVPA 4Q4SA 1RAKA 3PUOA 4HQVA 3MWAA 4WXYA 4LSBA 1AW5A 2HTMA 4JTKA 3N6QA 5CBBA 2GUUA 4RJEA 4B91A 3S2CA 1JEZA 3CPUA 2WSKA 2YL6A 4QXIA 2EPHA 3EMCA 3E2VA 3O07A 2FGZA 1WOAA 1EJTC 2A6NA 3NQ8A 4CD7A 3CYJA 4DZIA 4BQ3A 2JQXA 2J25A 1C9DA 1XH1A 1E9YB 1HQTA 4O1DA 4ATDA 3FHQA 4LAMA 3WDJA 1VJZA 4QBXA 4DQWA 3D0CA 4PTMA 1EHNA 3RAOA 4ZO9A 3TJ4A 4AZGA 3ES8A 4YN5A 4YJ5A 2LLEA 2X2YA 2UV8G 4EPDC 3KUMA 2R82A 3VZXA 5K9CA 3EB4A 5EMKA 1GOKA 5FF3A 1OCBA 2YFOA 1K7EA 1ZL1A 1H1YA 2QGYA 1JUKA 3U6WA 1QBBA 4UFHA 3VIHA 5D9OA 4C7GA 1F2JA 3QQWA 1A50A 2R1LA 2ANUA 1AQFA 1NWRA 4B16A 1NSJA 1Z89A 1JCMP 3EOLA 3K5XA 1AD4A 1VLIA 3NO5A 2J24A 1UA7A 4TO8A 2PSNA 2WSYA 2AL2A 3LBCA 1FWHC 3OVRA 3RO8A 4LH8A 4B2DA 4IP7A 5AY7A 4MVAA 5D03A 4BWLA 1JF5A 1JDEA 3OLIA 4CCEA 4RDYA 1D8WA 4J3TA 4GQRA 1O66A 3R0UA 2TYSA 3AIRA 4A3YA 2Z6JA 4BF5A 1F8MA 3ID7A 1EGVA 1X7IA 1TR9A 1IZCA 2AQVA 2Z1BA 5J04A 3FJ6A 4RDVA 4AX7A 3BVJA 2VDGA 4C6JA 4V15A 1DIDA 4J27A 3RR1A 2BLEA 1XYFA 4IXXA 2ZDSA 4C6IA 1XLIA 4YCPA 1I2QA 4MKSA 1W3NA 2QMJA 2WNWA 1G6CA 4IJCA 4HIBA 4PMOA 1G1YA 1L6YA 4XD6A 3F2DA 4ZFCA 3WFLA 4JTEA 4I6KA 1GPWA 1JCJA 4ZBCA 4EPBC 1DWGM 1WZAA 4PMYA 4B5SA 4IPLA 1W54A 5XINA 2VEPA 1MZRA 4GQBA 4DNMA 4JQAA 5B7YA 2HV5A 3S1GA 1OCNA 3S6DA 1GYLA 5AYZA 2HK1A 5BXPA 3BURA 3UXKA 4DUVA 2DZPA 2JK2A 1OFRA 3I7QA 4GX8A 4DJED 3ZWTA 3LCFA 2ABAA 4LOCA 4RKAA 3FLUA 4GIYA 4BQ4A 5SWUA 5HMDA 1MYRA 2WYSA 1O5RA 1E5NA 2HCVA 3RLGA 3PG8A 1NAL1 3VKAA 3VOHA 4N9BA 3RFAA 4MJ2A 3IIVA 2WJEA 2XDFA 4CN4A 1T6MA 3VC6A 4O14A 4IT1A 4CKQA 4WOQA 3M0MA 4IG2A 1SUXA 1W37A 4LEQA 4FHAA 4JY8A 1NDWA 2XIBA 2O9OA 1F61A 1P43A 3MW7A 1KCLA 3V18A 3P7YA 3R10A 4C1NA 5CZJA 3CWNA 3E49A 1K9TA 3BARA 3GNPA 2QJNA 4L56A 1DVJA 5CZKA 1AK5A 1YNPA 4LUJA 3QF0A 1T5AA 1JYXA 3ZO9A 1NQ6A 2ZYFA 1TPEA 4OKDA 3W1LA 2VX5A 2E0PA 4CD4A 2QDDA 3KTXA 4PL1A 1WB0A 1W1TA 3RLUA 3DHFA 1H49A 1DWHM 1PKNA 4UQBA 1TWZA 4QAWA 5BRQA 5T91A 3VI2A 1U5JA 3WMCA 4M80A 1XLDA 3PBWA 2X1TA 3LHUA 1R2RA 4K3ZA 3WQPA 4CD5A 4OECA 4OWGA 3W01A 3BH4A 5BU6A 2ZUTA 2FTPA 3ITXA 4XAPA 4Q8WA 4CCDA 3GC4A 2BXYA 2BG5A 4CQAA 3MA8A 3VTRA 5I3FA 2PA6A 1E56A 4PMRA 4UNKA 2AKZA 3DYOA 4A29A 5GNZA 1QOPA 3BXWA 1BHGA 4B92A 4M51A 3NVDA 3K13A 3VKBA 3W37A 4HVXA 3F5LA 3N9KA 1D3CA 1AJZA 1QJWA 1UUMA 3IRSA 1M7XA 3WFAA 1TCDA 3UJEA 1YQ2A 1J96A 1SPQA 2QCMA 1CXLA 4Q8MA 3OQEA 1G7VA 3B0YA 1P1XA 1ONEA 2OO6A 2QDHA 3O63A 4TTGA 3R12A 2REQB 4AG0A 4JFVA 2ZA3A 2NQHA 3M0XA 1CLXA 3F4VA 2I9UA 1UWRA 3LV6A 1S5WA 1UP2A 1W17A 3VGHA 3S0CA 4PFMA 1R30A 1AW2A 1QTWA 3IJ6A 4F0RA 1YW1A 1JQVA 1KM3A 4EVZA 1O6IA 4HJWA 5HXMA 4TX6A 1QU4A 4BS0A 3F5KA 3A9BA 3NXFA 4DY1A 2OYKA 5K9DA 3M6DA 3MJMA 2OG9A 3LPPA 1C7SA 4HPHA 2P50A 2NZLA 2BTMA 3LM3A 2VD9A 3QV9A 2G4JA 2DVXA 5DCDA 3K4AA 3T6CA 3Q94A 4XKYA 4OOUA 3IAPA 2XIIA 3STFA 1C91A 5AVNA 1QOXA 1UWIA 4FF5A 3DFPA 4NRSA 3CPGA 3MYOA 1C8VA 3ZSTA 1XUZA 3M5ZA 3QZ6A 5C9WA 4K8HA 1K70A 2WKJA 3P14A 3WQCA 3PAJA 3P93A 1ZAIA 1H1NA 4R7OA 5C5YA 4YMZA 1KFBA 4XZNX 4AWUA 4DUXA 3RO6A 3WLKX 5M3WA 4TX8A 4LB4A 1D2KA 4G7EB 1ADSA 1TMQA 3VOIA 3FXGA 1JCNA 4JYDA 1AZ1A 2D2HA 3G6LA 1FWJC 1CXFA 2P8CA 1QATA 3W1XA 3N2CA 1I6NA 4CNOA 4IIEA 3TE9A 1KRMA 2WZIA 3KBJA 1GVFA 3TNOA 3FCPA 1DWFM 3QTPA 4CQBA 1BRLA 4O52A 4ENLA 3E2SA 2VOMA 3NL3A 3LBOA 3O9NA 3BZGA 4CN1A 2YDSA 3F2BA 4OJYA 4LVBA 3WH9A 2PWDA 1EOKA 4PSRA 1ICQA 1ITUA 3MY9A 5H8PA 1XD1A 1F6YA 3CUJA 3OGRA 3IRDA 4H04A 4TVUA 1WV2A 1QWGA 1ZRQA 1XRSA 1J10A 3QHMA 1J11A 3RGTA 3N11A 4QCEA 3R2GA 3LDVA 1ISZA 1F3EA 2NX1A 4D6DA 1H7WA 2ISSA 2QJMA 2VC7A 3N2TA 4JQ1A 3SIZA 3ZMRA 4ZOEA 2WMGA 3LUTA 6ALDA 2Z0IA 1CDGA 2J7FA 2VOTA 5D4YA 3PSWA 3LBMA 3QMSA 3B9EA 1BYAA 4GJIA 3KRZA 1A5NC 1OC7A 2QT3A 5FL0A 3CQ0A 2Z2UA 3BAXA 2OWXA 4DYKA 1GYNA 2GJXA 3UCDA 3T4CA 2PGFA 1X97A 4GLEA 2ZWZA 2DZXA 1IEIA 2CWNA 3F03K 3A4JA 5AZ1A 3P62A 3LY0A 1XICA 4DO6A 3HPAA 5FJIA 3DFSA 4MY8A 4NXKA 1EZWA 4P7QA 2PDLA 3LSBA 3W6MA 3QY7A 2NUWA 1Q6OA 2QJHA 3FKRA 3PTQA 4YTQA 5AHMA 1AODA 4WDUA 3AXMA 3W1PA 1UB3A 2YXOA 2W67A 2E40A 1W9BM 4P7LA 4FI4A 4KW2A 3WQEA 2G97A 1DIKA 1XYAA 4HZMA 2NUYA 5CC7A 1DE5A 4JN8A 3UGVA 1M53A 1ZJAA 3A5FA 4CNTA 2OSYA 2YDRA 4WKFA 1Z8AA 1UC5A 3P74A 3IIPA 4X0VA 1TZ7A 1S3TC 1GYMA 3NQBA 1V77A 1CGXA 3VDAA 8TIMA 5LNVA 3GFZA 3LEPA 2VHLA 5EMLA 1X6UA 1Y8BA 2PDUA 4TQTA 4JTLA 4P5UA 5HJYA 3EWCA 5C0QA 5A6MA 2VFEA 2ALRA 2PCEA 3GFYA 5C8BB 4C6EA 5LYRA 4Z2GA 3S9YA 1ITQA 1LOLA 1O1HA 2DZVA 3F4WA 4J7RA 1P7TB 1UPMB 3WJSA 4WOZA 4LF1A 1MRQA 2VFFA 3TR2A 1PIGA 2W61A 3MHGA 4B5XA 3OLDA 1ZJIA 5LIWX 2L5HA 2FLIA 3VIKA 2CLLA 5I3GA 4FP1A 3LCIA 1GONA 4GZJA 1DYSA 4QNWA 1WYIA 5AHLA 1IF2A 3UW6A 1SU5A 1UIPA 5E5CA 4BF7A 3MHFA 1PB0A 5D9MA 3WH8A 4IP4A 3T1GA 3W23A 1Y5VA 3C5QA 3REQB 4JHOA 1IIGA 3KVKA 3KRBA 1KFEA 1V3JA 3EGJA 4LRTA 1V02A 3WO8A 4XBJA 4H9MA 4G5DA 4Q22A 5D05A 3LX9A 3ZVIA 3ITLA 1I0BA 3GXFA 2FH8A 3PPHA 1K9FA 1LZOA 4LVDA 4J3XA 5D8WA 3VCNA 5D9NA 4MNLA 2WXDM 3E96A 5HINA 2X7VA 3RF9A 1T40A 3LRLA 4C91A 3O6DA 3UYCA 1EWEA 1L6WA 4KGJA 3W9ZA 3G3DA 4RUBA 4DM1A 1H62A 4S1FA 2W62A 2ZXQA 2BVDA 3ABQA 1XPYA 4H7ZA 3U5YA 5CXPA 2QCCA 4ROPA 3B8DA 3A23A 4C6FA 3N3TA 1EQCA 1YTKA 3SUSA 1IGSA 5D30A 1VYPX 4FXRA 2PDMA 3ATYA 3STPA 4LS1A 3NPVA 1F4AA 2GQAA 1LF1A 2J6XA 2PDNA 3BV4A 4PSPA 2CBJA 5CJNA 1PXGA 3TXVA 3GKFA 3VABA 1NP0A 2DZBA 2ICSA 4Z08A 4RZ6A 4AIOA 3BJFA 4JPGA 3LA4A 5GJMA 6REQA 1UOZA 3R11A 2GJLA 2IKGA 2FPTA 3R89A 1US3A 4AZCA 4AY7A 3OPSA 1F3XA 3WLOA 1PPIA 3QC3A 2RDUA 1JPKA 2QUUA 3NZGA 1U2YA 1ISVA 4UZUA 3CUXA 4C6DA 5HOSA 4FLSA 1UUOA 1W3KA 3BMWA 3KBNA 4C6NA 3P60A 1V03A 3H53A 4K36A 1D9EA 3A64A 3G1RA 5AYBA 3RJXA 2W9MA 3HQPA 1XG4A 1H5YA 1LOQA 4CEXC 3T2OA 3TW7A 1PHWA 2X0HA 3BW2A 2Q09A 2D23A 1JDCA 4DWSB 1XRVA 1FBAA 2YDQA 3PBGA 5M1TA 4WJ8A 2D0FA 4GACA 4KIRA 1CCWB 4H8UA 1ODZA 4AWSA 2I5GA 2OTDA 4WIWA 3CGTA 4I6VA 4Q4RA 5G4EA 5REQB 2EO7A 2ADAA 4Z2JA 1QNVA 4LY4A 2NQLA 2OXNA 4YHEA 3I6EA 3VD7A 4FLRA 1XLHA 4AZIA 2C71A 2XPKA 2UZ9A 1UR0A 5TQLA 3M7SA 1KR0A 3R5EA 4CCCA 4L4PA 1XLJA 4PCTA 3WF3A 5XIAA 1TG7A 2Z00A 4AZ5A 5BZAA 1GK8A 5EMJA 3RX4A 1I9CB 3FK4A 1UWUA 2WHJA 2DY3A 1VPXA 1C7TA 1CBGA 4FO4A 1YHTA 4W8AA 1PV8A 4PFHA 2XGIA 4H6QA 1V7YA 1R2SA 5I00A 3ARZA 4DHGA 3AWNA 1A3WA 4C6PA 2GOUA 3WNKA 3N18A 3UGRA 4E5TA 3B03A 4AMAA 5I5RA 3LQGA 2PUZA 2VTFA 5FJPA 1EPXA 4I5RA 3DECA 3LK6A 2XU2A 1UH3A 3FYYA 2NSOA 2BB0A 1N8FA 2VUYA 3N9RA 4HTYA 1OF8A 3TP4A 4GH3A 1X6LA 4J3WA 1V0LA 4LUSA 1S3HA 3QLLA 1OEPA 4BI7A 1YYAA 3KBSA 3A4WA 3MSGA 4DI8A 3OIXA 2RKXA 4QS6A 4KT2A 2Z28A 4O0QA 1GG0A 1FCBA 3ANUA 2INZA 3MP4A 1RA0A 4OFCA 4Q7NA 4G6CA 3WEOA 2HXUA 2PLCA 3QZEA 1WXJA 5BNKA 5KEZA 1OYCA 3ZR6A 1KGWA 3RXZA 2VR2A 2J6VA 1PX3A 2ZICA 2P10A 4EX4A 1UMYA 3JU2A 2PLJA 3EKLA 3P67A 5F2IA 1K8ZA 1L2QA 1TPDA 4PMJA 1UD4A 3U3HA 3PJXA 2CXEA 1R5YA 3FOKA 3OEXA 4X9YA 4EANA 3M0LA 1VH7A 1L2UA 4JTFA 3OLGA 3T0TA 1XLCA 4YWIA 4C1LA 3WLJA 4DWDA 3HPFA 2RFGA 5KITA 4HA0A 3EOOA 2FZBA 2XWEA 3ARWA 4O1BA 3TYZA 1PEZA 3WL1A 1DWIM 2WHKA 1SO4A 3WBEA 1B9ZA 1RP9A 1DJXA 2HISA 3W2KA 5C9ZA 2CETA 5JXQA 3AROA 1V79A 5DRIA 3L67A 4GY1A 4M56A 5MF5A 3C2YA 3L68A 5G1MA 2J8FA 1V6VA 4MKNA 1SMDA 4MOZA 1B1YA 3BSGA 1GGOA 4NZCA 2OT0A 4E8DA 1QBAA 4IFRA 4PUUA 4H83A 2ZOXA 1TWDA 2YBTA 5E6YA 4HK6A 1R9ZA 4Z0JA 4XK2A 2FQIA 3V0TA 2AAAA 1TIWA 2R1MA 4EWJA 3BLLA 2O92A 4ZA0A 3TR9A 1P6CA 1HTIA 4J3SA 3EB2A 3CQHA 3GFXA 2WHLA 1C93A 5AC6A 1XWYA 4RR4A 1AMKA 3L5MA 3WX7A 4NAFB 4DJDA 3BMVA 3GG0A 1XFCA 1FWIC 1HVQA 2EGZA 1EH9A 5LIYX 1ZPTA 1TPB1 3GB6A 5H2ZA 4PBEA 2CLOA 1MFUA 4YTUA 1FFQA 4V2XA 2WV8A 1EJ7L 1Q8JA 4F2BA 3XINA 1VPQA 4LVFA 2X41A 2IXUA 3HTWA 2O7QA 3MVTA 5A8NA 1JDAA 3DX5A 3WQ5A 1TPC1 5E9XA 1FWTA 1SZFA 1W3LA 1E6XM 1RQHA 3IGUA 3AS2A 3DXIA 2WNNA 3VKCA 2FMNA 3QEZA 5FEXA 4IFOA 2X40A 4E3VA 1Q7ZA 4IF2A 5KZEA 3GTHA 4XUYA 3AMGA 3QSTA 4X60A 2HQAA 2E09A 3SCQA 3C0SA 2JALA 1E6ZA 1D3HA 4E38A 4GGHA 2RGMA 1XIEA 3C3UA 3H7UA 3KCJA 3VOGA 2OZTA 2WVTA 3DAQA 3G1XA 2FKPA 4JNYA 1VRDA 2FJKA 3K2GA 4F2TA 1DXEA 5D9PA 2CZVA 4XIMA 1L8PA 4HP5A 4LAOA 4PR4A 4LCQA 4F79A 3CT2A 3CUGA 1B3VA 1ICSA 3GX9A 5I3JA 2BFGA 4U4MA 3CHDA 2IQTA 2JE8A 1DBTA 2HJPA 4UFIA 5A3HA 3ANYA 4IJRA 3VNKA 1RP8A 3WG6A 1BG9A 3BW3A 3RJYA 4KWVA 3SECA 3LCHA 4D72A 3H55A 4Q4QA 3CXOA 1EEXA 4ZB2A 4HNLA 4Q4KA 2FHFA 4GZ7A 1SFLA 3NM3A 1TZ9A 3GG7A 1NWUA 2ZQ0A 3W2UA 1OG6A 3WUFA 4E8CA 2G3IA 2B31A 3P82A 4ERAA 4F40A 1HG3A 1O95A 3MYPA 3OA3A 4LEFA 3H2OA 1M7PA 1KLZA 1E51A 2D0HA 3TUUA 3VU2A 3W25A 4HZ6A 3V75A 1RY0A 4FIRA 2DV0A 2G8ZA 1ZBCA 1UMLA 3SGUA 1R9YA 1J2WA 2CPUA 3JUGA 3U2CA 3WUBA 2XFWA 2EPOA 4OT7A 4GJ1A 4AWEA 3E0FA 9CGTA 2R9RA 4CNNA 3L66A 3L65A 3I3EA 5EY5A 3RILA 2EF9A 4BJHA 4QJ5B 3QW4B 2WAGA 3BLOA 5C7HA 2QS8A 4HNNA 4Y2WA 4ACYA 1F5ZA 1O4UA 3E0WA 2E8ZA 2R6OA 4WX2A 3DOPA 1W5PA 4FXSA 4REQB 4OQVA 5FL1A 1I2OA 4FXJA 2V5JA 3GYEA 1W32A 1FKWA 2R94A 4M1BA 4I5UA 1QI2A 1FWBC 4NYUA 3NQFA 1DJIA 1JNEA 2WPGA 5RUBA 5E0CA 3TKFA 4H1ZA 4NP7A 3QFEA 1W1IE 4M6PA 1H63A 5AB3A 2PDIA 1NOWA 4GZIA 3W7EA 3VGGA 4QE1A 4AY1A 5JMUA 4AD5A 4TX9A 5DQPA 4Q4PA 2VFDA 3LHYA 1RCQA 1PTAA 3MU7A 3UA4A 3R0DA 4W4QA 2ZX5A 3PTKA 1ZENA 3KS5A 4JTDA 3WK0A 1NFBA 1HKKA 2P1FA 1Q85A 5JVLA 4YYCA 4NJKA 3TZFA 1RALA 4JAWA 3GVRA 4S39A 4DUWA 1P6BA 1NFGA 1VIWA 2A7RA 4KESA 3A47A 4W88A 4JIIX 3O6YX 3POCA 1LL7A 4PB3A 1N8WA 3IJLA 3RX3A 5D2VA 2OQYA 3S2LA 2V3EA 1PIIA 4UTHA 1BGAA 1ESWA 5FJUA 3LCXA 2A6LA 4A8NA 1THFD 4IGMA 4RE0A 3VKKA 1WO2A 1FX6A 4K1WA 1TE6A 3LXCA 4LV4A 4MWAB 3SN1A 3ECQA 1VENA 2RDXA 4BI5A 1FH7A 3BL3A 1RJQA 5I3IA 3NURA 3NQ2A 1TVNA 1XIJA 3H2AA 3HGRA 2C19A 3SADA 1PTGA 3U2EA 5A5WA 3LG3A 1W9XA 5AYIA 3HBLA 3AXHA 1DHPA 1CLKA 3C0JA 3CTLA 4Q32A 3TWAA 4D8LA 4KRTA 3OIHA 1OX6A 5AC8A 4NF7A 7A3HA 1XDLA 2OLHA 2EEXA 3TSMA 3UF9A 1MEHA 5F7UA 3W26A 3BJTA 1WE5A 5A6TC 4LV9A 4O4WA 4NNCA 3GDTA 4F48A 2OLAA 1EC8A 4F8XA 1MDRA 2E8YA 1U30A 1HO1A 1XIFA 1E71M 1XBYA 3UWEA 1Z7AA 4US6A 4FB7A 2Y5SA 3ZR4A 2Z6IA 3QSRA 1E72M 3ZSSA 2OSXA 2R1KA 1ZY9A 4L1XA 2TRSA 2DUAA 4MMWA 3EBVA 1IXOA 5A6KA 3BOFA 2OT1A 3PZQA 2E6AA 2I14A 3N17A 3M43A 2REQA 4JDYA 3C6CA 1QHPA 1H09A 4RDWA 4N9DA 2WC7A 4AD1A 1PUDA 4WKHA 1AL8A 5AKQA 4JKMA 2I1OA 2NLIA 3VC5A 1D8CA 3S8HA 1GKPA 1JCTA 5CAHA 1H60A 1RV8A 4LUYA 4HHMA 5A94A 1M3UA 8A3HA 3IEBA 2CLIA 5C70A 3ALFA 5A6JA 2YL9A 5CGQA 3U0HA 3R8GA 1TX0A 4H7CA 4Q6XA 3BK0A 1TUFA 3O15A 4ALDA 3R79A 3VNZA 3ZT5A 1TMHA 2PTYA 3H4GA 1VKFA 1FWFC 2Y5JA 2WKGA 4EPKA 2E6FA 4O28A 4GCXA 4MWAE 3W76A 4LBSA 1POKA 2EG7A 3B9DA 3U7VA 1UR9A 1JULA 2V2HA 4ZE4A 1ME7A 5D2YA 4GRSA 4LT9A 1LJYA 2OFJA 2HVMA 1GKRA 3BC9A 3FSTA 4FX6M 3VUPA 3LU2A 4Q4MA 3SY5A 4CEUC 3O7UA 2BY2A 1KBJA 2ON3A 3QPYA 4PN2A 2YLAA 3DBPA 4BKNA 2DGAA 4GBUA 1VIZA 2KX9A 3RMEA 1W1YA 3AS1A 3CNYA 3B3DA 1PKMA 1QNOA 1XLKA 2PGRA 3KDNA 2B0MA 3WF1A 4XTIA 3UXDA 1XH0A 3ARPA 3NO1A 1ALDA 3W4RA 4GVHA 2A2IA 4G7EA 1QW7A 3ITCA 3DFYA 3URQA 2B4GA 3EPOA 5LA1A 4WGHA 3W7NA 2CLHA 4RXGA 1V4YA 1XSKA 2AAMA 1XGDA 3P0XA 4ZVJA 3W02A 1XYCA 1K9EA 1V3MA 3R13A 2IKHA 1XFBA 1BKHA 1X6NA 4G1KA 3AS0A 2XINA 5DN1A 1UHVA 3LZ3A 3AQUA 1B2YA 1K03A 4LVAA 2GUYA 1EGMA 1JZ6A 4PTWA 3TQ0A 4MLJA 2JFEX 4KCTA 2OR2A 2PURA 4RCXA 2ZZ6A 5CZSA 3WDHA 3T0CA 1J5SA 1Z42A 4FLOA 1YPFA 3D47A 2EJAA 2TMDA 4KIEA 2FDMA 3M4HA 3IPWA 3W1TA 3UR2A 4CQCA 1DL3A 3SZ8A 4A8IA 4R33A 2PDXA 3VIMA 1KBLA 3IIOA 1E9IA 1ODUA 1OINA 2ZVRA 5L9FA 1P0KA 3ARVA 3PTMA 1M41A 2CITA 2VDIA 1TQXA 3OA5A 1E4MM 2Q8XA 3LYEA 3QPEA 1QPOA 1E0WA 5HNNA 5FD0A 5HNRA 3GH4A 3SCRA 2HWGA 3AZRA 4LYKA 4L6HA 2XH0A 3GNDA 1TTIA 1EB3A 1TIMA 1JR1A 4GWEA 3E38A 3LENA 3WMLA 1BD0A 1EYEA 4W93A 4E2BA 1Q7MA 3DG3A 3EA3A 5JBDA 1Q6GA 4ICCX 3GU2A 1W91A 2FHCA 5AYYA 3KVLA 2Z25A 1J0JA 3VA8A 5EBUA 1KFCA 3EMZA 3VPLA 1MFVA 1G4PA 1OYBA 3TMLA 1BSIA 2Y6ZA 3GR7A 2NXHA 2A4AA 2R24A 1P0BA 2ATSA 3VCCA 1EF2A 1KFLA 1FH8A 1BXCA 2Z2BA 4FOUA 3UY8A 2DVUA 4ZCWA 2PWVA 3BAKA 5D2XA 6PTDA 1JZ3A 3H4WA 4PH6A 5E09A 3N73A 4KRUA 2X1SA 3ZJKA 2A7NA 2DT0A 2VCCA 4Q4OA 1S5NA 1LROA 5GNYA 1EBGA 3MVIA 4B5TA 1JAEA 2PGEA 4GQQA 4HBKA 3TIMA 3T07A 2ZA2A 3VE7A 4DLFA 1W2VA 5T26A 3URNA 4O1CA 5HATA 3L2IA 2C18A 1TUXA 5DMNA 3MKKA 4AZ7A 1JZ8A 2BP1A 4XAFA 1FCQA 3FYOA 3GM8A 1XKJA 1TV7A 3FJLA 1ZNNA 3GS6A 3EEGA 1JL8A 1OGGA 3EYPA 4DO5A 4O11A 3WFZA 1UR4A 1R7OA 4FX7A 2F9RA 4KWUA 3A4XA 3NG3A 3BAIA 3W72A 3DGRA 3TNBA 1S2CA 3TA9A 4V1XA 5TD4A 2Q01A 4LVGA 4NJGA 3EPNA 2H9AB 3HV9A 4ZO8A 4JTCA 4J3UA 1RD6A 4MGGA 2WC4A 4PMZA 3MI3A 5FI8A 1WKYA 4DUOA 4MZYA 2Y2WA 1BFNA 1ZJBA 4IH3A 3REQA 3QR3A 4DJDD 3DZ1A 4LQ1A 3GDKA 3W85A 2CCRA 2PC8A 2YR1A 3OHIA 2F61A 2ACSA 3KM8A 5DXXA 3MC5A 2DZUA 3ZLFA 4GGBA 4OBRA 5HAOA 2PLKA 2BGQA 1V5XA 3NGJA 3NWRA 1E3XA 4NX5A 3NQMA 1NU5A 2EPMX 1EA0A 4MHBA 1UR3M 2CLKA 1IT0A 3O16A 1REQB 2G50A 1WDRA 4ILSA 1SYTA 1HL2A 4C6KA 2G3FA 2ZWYA 1LLZA 4RZ4A 4O57A 1XM3A 5MKGB 3ZT6A 3W7LA 2DIJA 4QLJA 4XZIA 2ZE3A 3BQ6A 1P0NA 1X8FA 3S83A 4KWOA 3KL0A 3I7RA 4IISA 3CL8A 5A2AA 4XZBA 2VGFA 5DMYA 1E1FA 3TYBA 3TEVA 2FFIA 1ADOA 4IIFA 1LDCA 3UG8A 1EQPA 1VEPA 4JTAA 4PCSA 1HJSA 2XYLA 4NNBA 4QFUA 2QUNA 4UTUA 1YTDA 3HFYA 3NZRA 2X42A 2QW5A 2R8WA 1N55A 1JDDA 3QR1A 1FCVA 5FF7A 3MI2A 5BW6A 2A7PA 3CLWA 5BROA 3EOSA 3PZIA 3WUEA 2F7FA 4HA1A 4EF8A 1UD2A 1W31A 2BY0A 2INFA 2PE4A 5KMYA 1PBGA 3U5UA 5IRPA 5A6LA 5A6SA 2GPTA 1U5VA 5HULA 3PSVA 3WLTA 3CH0A 2X30A 1EJVC 4Y7EA 4M82A 3I3DA 2YL5A 3DYPA 3MZNA 5EFFA 1JFXA 2I7GA 1HIZA 2XM2A 5D38A 1TO3A 1I1WA 3ARYA 2FTWA 3RDKA 4N42A 1OFBA 1KB3A 1F76A 4HPJA 2A3CA 4NYYA 5EPDA 5E9AA 3B97A 1H7XA 1YKWA 5KETA 4GE8A 1VRXA 2D69A 4LCRA 4RK8A 1TPWA 3COTA 3RPMA 1JVNA 4ZO7A 4YYFA 2CKSA 3P2VA 4NG3A 4QJ1A 4POCA 1H41A 2BZNA 3K1GA 3M5XA 4LY8A 2P8BA 4PZVA 5KZDA 1MI3A 5KZ6A 4UZSA 1KM5A 2J78A 2VR5A 3T08A 4H19A 1KV8A 1XJBA 4NRRA 4UUIA 3IIZA 2Y8VA 1XYMA 4IIHA 2FYMA 2DIEA 4LALA 5FACA 2OQHA 3VNMA 6XIMA 1UROA 2BGSA 2VNCA 2JEQA 2E9BA 1DWJM 3BWWA 2UBPC 1NDYA 2NWRA 4H2HA 4FEZA 4Y90A 3AIWA 3M0ZA 1TE1A 1NIUA 4PODA 4GYPC 4E0CA 3C56A 3MANA 3R0KA 3SQMA 3AMDA 1XV8A 1SFJA 2HDJA 3CEUA 4F4RA 4IGNA 1QI5A 3NTYA 2VUNA 4MWAC 4FNRA 2YZ5A 2WQDA 4IX0A 3GYCA 3ITYA 3TC6A 3H7RA 2QPUA 1RQEA 2PTDA 2FZMA 3U48A 3UWZA 4S2BA 3G1AA 2DSZA 2NSXA 1FWNA 2HBXA 2FJUB 1L8NA 4I7VA 4DVOA 1DQXA 1GHSA 4PCPA 3L0NA 3BAYA 3CB8A 4JKKA 5JBEA 1DJGA 1OWQA 3VX1A 2DT3A 2VEFA 4MUZA 3FDGA 4L6DA 1C8QA 4BF9A 2CZ5A 1EP1A 4MF4A 2FVKA 3VIFA 4M6QA 4JCLA 1LUCB 1AMYA 1XDMA 5DMMA 3HJEA 4HA3A 3OBAA 1TTQA 4RE2A 2P3ZA 4O17A 1W2PA 2ZRWA 2XSXA 3VMPA 1OVDA 5F1VA 3USBA 2NW0A 4GOAA 4QQUA 3CMFA 3TYAA 1IV8A 3ABSA 1J4EA 4LF2A 2GQ9A 3VFCA 2XISA 1XIHA 1AH4A 2QAFA 3RITA 4IGHA 2CXGA 3S1WA 2WW5A 1TQJA 1XQLA 3QJAA 3STEA 4F9JA 4JX4A 4ZZ9A 5FEWA 1AJ0A 1R3RA 4L4OA 1TV4A 4J35A 3SCOA 3L7RA 2IPWA 3M47A 4YCOA 4U2ZA 4CCZA 3T0AA 1EXPA 1FFRA 1GPFA 2W63A 1E1EA 3T55A 3A3WA 4RW5A 1GTHA 1VFSA 1ENUA 2J13A 3VGFA 4DBEA 3EDFA 1D7FA 3CUFA 3KZSA 4EXBA 6A3HA 1C3FA 4XAZA 4PL2A 2EBNA 5C55A 1S2VA 2Y8KA 5A95A 1YADA 4F0KA 1XYBA 4L9YA 1XCXA 1YNQA 2ONEA 4A05A 4AXNA 3W1NA 1KGUA 3G3MA 2WB5A 3EX4A 4K8EA 4BQ2A 2WMHA 4AX6A 5IFTA 3VILA 1J93A 3B40A 3CASA 1W5QA 1IIHA 4GI8A 2VURA 3BLIA 3NZQA 1AUSL 4C6QA 2J77A 3A12A 3TSDA 4BA0A 1NWSA 7TIMA 5H8UA 3IJDA 2VCAA 2NV2A 2EPKX 3OZOA 2E1WA 3QW3A 5HJLA 3GTXA 4NAFA 4KEMA 5CPQA 3SSJA 4AISA 5AYXA 4OZOA 3ELFA 1UBSA 2D1ZA 5HMSA 3N29A 1J0KA 3AZSA 3TTYA 3NGFA 1UWQA 4DX3A 3CUZA 5DEZA 5T9BG 4K2SA 3TN6A 1XIBA 3BANA 3LB0A 5LSMA 3N4AA 3ERPA 3O06A 3WLPA 3A22A 3AJ7A 4GYKA 4OOZA 2RJGA 3RX2A 1TV8A 5H91A 5HJXA 4B5WA 1V6WA 1NFPA 1IEWA 3V0SA 3TAOA 2X09A 3ES7A 1A3HA 2NV1A 4I9MA 4RNHA 2YW3A 2INEA 1UZHA 1IEVA 2Y24A 2YB1A 3EWBX 1QOQA 5FAGA 4JFTA 3ARQA 2C3ZA 1B90A 1M7JA 1R47A 3QQ0A 4RX0A 5I02A 4ZB0A 1P0EA 5DBUA 4AEOA 1ZQ5A 3FS2A 5G2WA 4GYFA 1SO3A 3MQTA 4GABA 4P7NA 2DSVA 4V27A 4L65A 2YDAA 4H6EA 1HGWA 1VP5A 3SW6A 2YCEA 4ICNA 4QG9A 1G4TA 2PB1A 1XLFA 1OZQA 1HFBA 1AJ2A 2PDJA 3SO7A 3EDKA 1Z6KA 2BV9A 2MANA 4GCAA 1VYRA 1G0CA 1B4KA 1H2JA 4NZFA 4QEEA 2C1GA 3FKKA 2JBMA 4Z2HA 3TTEA 4N0RA 1LL4A 4FNTA 1W3JA 3OP2A 3ZYZA 3MO4A 4GUHA 2WOQA 3TYCA 2BMBA 1XIIA 3EWUA 3M0JA 3GXTA 3BLPX 5FF2A 3TJXA 1HJXA 3IJQA 3KS6A 4IPPA 4YWSA 1Q6RA 3T8QA 2QAPA 4RE4A 1RJRA 3FA5A 4FNPA 3QYSA 2ZZ5A 5HUPA 3TOPA 4O18A 1LTDA 3DFHA 3IVUA 1AD1A 4F0MA 4ZL1A 3HO8A 3VOFA 4WSKA 1NOUA 3N15A 3W87A 2QUVA 5G4HC 2C91A 2PDHA 4F0LA 1XIGA 3VD9A 1RH9A 4C5ZA 3LTYA 1U1UA 1LT8A 4TMBA 1E6SM 2DH3A 2DVTA 3URBA 2VJXA 2QULA 3GRIA 1Y0EA 3MKCA 4NXSA 4PUNA 4XZHA 4FNUA 4A6GA 3DHPA 2V67A 2DU2A 2DQWA 1A5OC 1UJQA 3EWDA 2P53A 3S2NA 2GWNA 4KEUA 4AD2A 1G5AA 2V9DA 1OT1A 1FP9A 4HCDA 4P7RA 4V28A 5LNWA 2V69A 2BHUA 2XVGA 3OQ8A 3SGZA 2NX9A 1WXZA 2EAWA 3ZJ8A 2X1IA 1ZSXA 1SJCA 1Z9AA 3NQCA 1MNZA 5I79A 1JGMA 3TONA 1FRBA 5A1AA 2VP8A 1LT7A 4MYXA 3ZXWA 3DEQA 3ABXA 4RZ5A 3THQA 5CG0A 4ZQCA 1R8LA 1YPIA 1F9CA 4YXGA 4Q8PA 3EAUA 3CAWA 5J8LA 4QHRA 2DSKA 1OGSA 4A4AA 4ZFMA 4WQ6A 3EXTA 2ZRYA 1E43A 1CYGA 1JPIA 3MCNA 4HNCA 1OIMA 3GIQA 1HKVA 4ZO6A 3ONBA 4GI6A 2OYLA 1FP8A 1WDWA 1HJQA 1XL9A 1PSCA 3Q65A 4DAIA 1S5VA 4HSNA 2WO5A 3VDCA 1RPKA 1ME9A 2WLYA 4FNSA 4PCNA 1E6PA 4RPQA 1QT1A 2XFRA 4XO6A 4RDZA 3UJ2A 1NDVA 1O5QA 5K2ZA 1NTHA 3B8WA 5JU6A 1BF6A 3HOJA 5FA5A 3NEVA 5DANA 3PUDA 1TR1A 1H61A 5LKYA 2PTZA 4N2YA 2E68A 2DJLA 2Y7GA 3EOUA 4M81A 2ZUSA 3KBMA 2NXGA 1FWWA 5CBJA 3OBEA 3UPMA 5EKYA 5A6BA 3I3BA 2ISFA 4GYPA 4QEHA 3VKJA 4FZIA 4PE8A 1KTNA 2YPIA 1TVPA 1KFJA 2E5BA 1BWKA 1SGJA 4ZR8A 1NELA 3ITOA 3VDHA 4Y9AA 4WY0A 2ZC8A 2Q8LA 4W9TA 3GDLA 3IAQA 3EWXA 3TAKA 3FHAA 2ZZ7A 3CZEA 4I7WA 2CLPA 4IHCA 2I57A 3TYDA 3OOQA 4ZQMA 1ZALA 3S46A 2ZZ4A 3BQ5A 2OELA 1BQGA 3LSCA 3QYQA 2EKCA 1HL8A 4Q3MA 5FJOA 2GLKA 1FA2A 1D7KA 2F6UA 1R38A 1ZBWA 4L9XA 2P5NA 5KTLA 1XYLA 4D6HA 4NY2A 2GQ8A 3Q58A 5I3HA 3SUUA 3VXGA 1RHCA 2GZXA 1UWSA 1SR0A 3NSMA 1HF6A 3VVGA 2PP1A 2Y63A 2PD5A 4JIRA 4LNCA 3IJ8A 4UB9A 2PAJA 2J7EA 5EGRA 1XIMA 2P0IA 3LCWA 1G69A 5DRCA 3FA4A 2PI6A 2DSWA 2A5HA 5CPOA 2W6RA 4PRWA 3ZOAA 4JICA 3APTA 4O0KA 2XG9A 2WSRA 3W82A 3QKEA 1WZKA 4ACZB 2PDGA 8CGTA 3L5AA 1HN1A 4OV4A 4MB4A 4MYAA 4R9XA 2BBFA 5CPTA 5BRBA 3G18A 3GO2A 3VE9A 1V8EA 1I8JA 5LNRA 3W7RA 3L12A 5TIMA 1GKQA 2YYUA 5HANA 1US2A 1VHNA 3FVDA 3UVAA 3MWCA 5CAKA 2QJGA 1MRAA 5FIPA 3T9PA 4UOZA 2NXIA 2VO5A 2VR4A 5KINA 3M46A 4AIBA 3VIPA 3D3AA 4XBSA 4XX6A 4KRZA 2J7CA 3PJUA 2WMIB 3GDRA 2FB2A 3L4XA 2QVHA 3K8KA 1SFTA 3D5HA 1J9YA 3O6CA 5D32A 4MNKA 3HM7A 3M1ZA 4IMDA 3WBXA 1MSSA 1V0MA 3GZ3A 2D2GA 1EYWA 4CQDA 4UFMA 4IPJA 4V1YA 3TC3A 2XHYA 3I65A 1EJWC 2VRKA 3MV11 3P81A 5CH9A 2CU0A 1EO7A 1Q6DA 4YIWA 5G1TA 3SFWA 1E3ZA 1VCVA 4OVXA 5ABTA 3GH7A 3AFBA 1HP5A 1R3SA 3N9SA 2YSWA 1BXNA 4U2YA 2ACRA 4K39A 5EMUA 3HPZA 4ZQRA 3H2NA 3KDOA 4AD0A 1HJVA 1RD5A 1VBRA 4XVEA 2NX3A 3E5PA 2GUBA 3FAWA 2OMAA 2PRMA 3IS4A 2FVMA 3Q67A 4B3LA 1QI0A 2ATMA 2GJPA 4LUTA 3EKGA 1M01A 4EIVA 5TBOA 2X7WA 4MLRA 1OCJA 4AEFA 3PS7A 2V3DA 4JD4A 4JNMA 1DQUA 5D33A 3GG1A 2VRJA 1MWOA 2AL2B 1TELA 2XFFA 5D8ZA 2X05A 3EDEA 3QHNA 4ORMA 3ARXA 5LGZA 3T81A 1QPNA 1QUMA 2J9XA 3LNMA 3DFOA 1TCMA 3T44A 2CESA 4KERA 4KEVA 1AQMA 1CECA 3EX2A 1E55A 4Z17A 5FJTA 3AHVA 1EZ2A 4DF0A 1RJPA 5CLTA 4K1GA 5DO8A 1J0HA 4XVDA 3IUHA 1XRTA 5IBXC 2XH2A 1A0CA 2ISWA 1GQJA 4LC6A 4UQEA 3IVSA 5CJ5A 3CTTA 3OB8A 3TYEA 4F3HA 4X9SA 1XPGA 3N2XA 2O9TA 4YLWA 1BTCA 3TQPA 1I2NA 3VCRA 4TVDA 3WD1A 1PWMA 3SEPA 4JCMA 1Q3NA 3BG9A 1WUEA 3CZLA 4LC8A 3RK8A 2PP0A 1CB2A 5PTDA 4A8RA 4X63A 3ZT7A 1OFOA 3C4UA 4HYRA 4HMNA 2PWUA 3D6NA 4HK5A 4PRRA 4XZMX 1F6KA 4UTWC 3L4UA 4NJHA 4WD0A 3LPGA 1W56A 4H2CA 5C6MA 2HXTA 1MEIA 4WJXA 3WKZA 3ITVA 5C9UA 1JD9A 1WBJA 3H21A 2E28A 4BR1A 5EU9A 3FYPA 2WJFA 4DAFA 5EB8A 1OK4A 1WUFA 4NT0A 2VFIA 1P4CA 1FVPA 2W27A 1EP2A 2C16A 5G2HA 3SUTA 4RXFA 2QPXA 4R9OA 2VZTA 3KVJA 3NZ1A 2AGKA 4C1NB 4HTBA 3LTPA 1TV3A 3GHUA 3QKZA 3USZA 1QMLA 2ZUNA 3EWYA 4LNYA 4M5PA 4QQ3A 4J28A 1GOWA 1V7AA 1L9WA 4IQEA 1VHCA 4YTSA 2VEKA 3CWHA 2VGBA 1OFQA 3OZYA 3DKLA 1QASA 3N14A 4US5A 2ZX6A 5AVHA 4NIRA 4CVWA 1SW7A 3UT0A 1N82A 3TN5A 3WLRA 3IANA 4P7OA 4KFNA 3EA2A 3EOEA 4U5KA 2PZNA 5I7GA 4CQ8A 1R0MA 3N2BA 5F2LA 2VRQA 4CQ9A 2QKFA 4CVUA 3HG5A 3NJ3A 2AGTA 4UTLA 3H2MA 4ZTXA 1RLCL 4IQLA 3AYVA 3F7JA 4DN1A 3T2QA 4WSHA 1Y5XA 3LS9A 3MMTA 1R86A 3DENA 3HGJA 1GZ1A 4Y9NA 3KLKA 1YDVA 3CZGA 4WZHA 4XAGA 4WVXA 3AYRA 1QHZA 3TTQA 2H9AA 5IFPA 2WK2A 5DY2A 3MZ2A 3LQLA 4GNKB 3VD4A 3GLCA 5K4ZA 4O8RA 1FWCC 4UR9A 4DM2A 3L5LA 4Z42C 3W00A 3WJZA 1CPUA 1AH3A 3R8HA 3HQOA 4JR5A 4RL3A 3R6IA 4XV0A 4QSHA 3UVIA 2JGQA 2D3LA 4KPLA 3L0KA 3SI9A 1OHLA 1SW0A 3EMQA 4TMCA 3E02A 1RLDA 2GFTA 4ECLA 3B9NA 3WEZA 4FX8A 3A3HA 1QCWA 2OEJA 3WNNA 4AF0A 1W8GA 2WVVB 3PAOA 1REQA 3N34A 1VJIA 2PWFA 3DHDA 3N12A 1JI2A 4XWUA 5GVJA 4ZENA 1TV2A 3LHVA 5HNUA 1TZZA 5I3KA 5MKGA 4UR8A 1GVEA 1LG1A 4Y96A 4ZXOA 3WEMA 3BLKA 5E70A 4YPJA 2E67A 4IMFA 1SJDA 1TPVA 2OJPA 1XLAA 3C2OA 1TJPA 2NLYA 1Q6QA 1TJ2A 1QK2A 3IJ7A 3UEQA 1E9LA 1KO0A 1OGBA 3OTRA 3RU8X 2G4FA 4GXPA 3HJZA 2GVEA 3W7CA 4TU1A 2QLYA 2C1HA 3YPIA 3UXIA 3PY2A 1SQ7A 1HUVA 4I90A 2BS9A 2D2JA 4LPCA 4DLMA 1DV7A 1XIDA 2VCBA 5TAOA 3SCVA 2YBUA 3CU2A 2IPFA 2CW6A 3U57A 1R3YA 1VQTA 3OGVA 3H2CA 3UPBA 1BVWA 2YLLA 1NWTA 3WK1A 4PA8A 4N4PA 4NILA 1NH6A 3EZ4A 4H3DA 3A9IA 3QFWA 1KC7A 2YYTA 1Q6CA 3WH6A 4S2CA 4O8AA 3RMJA 1J0YA 4C90A 3TU9A 1T8XA 2NQZA 3O0KA 1GNXA 3QVQA 4XG1A 4MJZA 1S2UA 5HR7A 4IOTA 5GQBA 1V6XA 3KRUA 5HPCA 4B9ZA 2XSAA 3CT7A 5I78A 2QYGA 1AFSA 1M68A 3DC8A 3H2EA 1K6AA 1WP6A 4FPSA 4MFEA 1S46A 2HE8A 2PP3A 5I06A 3S5OA 2VC5A 4I9TA 3LI0A 2YCIX 1UZDA 1Z44A 3G5EA 5CSRA 5AHNA 3WDIA 2A21A 1V3LA 3GSMA 4J5NA 3TMQA 3VAVA 4RV3A 1OD0A 3KRSA 4AEEA 4YTTA 2ZIDA 2VD8A 1B9BA 1V6YA 1VBJA 3L2MA 2VMFA 2XFYA 3OW1A 5DXYA 3LHZA 2FZDA 1M1BA 4GK8A 3FDKA 1BWVA 3F4NA 1CNVA 3PVFA 1GOXA 3AOFA 3VK5A 3TVAA 1GW9A 4C7DA 4Q7BA 3MS8A 4HMCA 1FHLA 2H3BA 3NPXA 2WCSA 5D02A 3NQEA 1CLVA 4CNUA 4HZ7A 2GJXB 3CK5A 5JIWA 4H9ZA 1K3UA 2HROA 4GINA 3KX6A 4HB7A 2Z7KA 1AH0A 4FK9A 4J2PA 1S2AA 3CS2A 3R8RA 1KKRA 1R6WA 5L6UA 3OVQA 5LNUA 4EE9A 2E9MA 3QR0A 4FXFA 4QE5A 3S3GA 2Z1XA 3TSBA 1FHUA 2D20A 3KCLA 1P5BA 5HA7A 1C8XA 1PZ0A 4Y9PA 3GU9A 3SB0A 3SRKA 4YS1A 5I6SA 5HDRA 3MT1A 2RJHA 4W87A 2Z27A 4O1FA 3ZS4A 2C1IA 2PFHA 1HT6A 3DH7A 1RBLA 1J2BA 3W1MA 3UCQA 1ZCCA 2Q6ZA 4DB7A 3CV6A 3NNTA 1AQHA 5A6BD 5A69A 3T42A 2PDCA 4J4KA 2CNCA 4WHBA 1VD6A 4PTNA 5IBXA 4ERIA 3IWPA 5F4XA 2OWCA 2ZX8A 4WK9A 1E9ZB 2W3ZA 1POJA 1ADDA 5IDIA 3PM6A 1K1DA 3T0BA 4N4QA 1A4MA 1LWHA 1MW3A 1UWAA 1LG2A 3AXXA 4RNJA 1UD6A 4GO8A 3SY1A 8XIMA 3S2MA 3TQVA 1H1ZA 3M5YA 4UCFA 2I5QA 3W38A 1GJPA 4DXVA 4J40A 4G9PA 3WQ6A 2PF8A 1KV5A 4ADSA 3NQAA 4J1OA 3GNNA 4LYQA 4E2VA 1OT2A 3M0KA 4HGXA 5EA9A 1JUEA 3AISA 1IGWA 4LFYA 2YJQA 4UTWA 1FWEC 1E73M 3TFCA 1VFTA 4HCLA 2WC3A 1VFUA 5BWFA 3PTDA 2V38A 2OKTA 4IIDA 3IK4A 1CGVA 3RCMA 4GHRA 3CLMA 7PTDA 1GOOA 4GIEA 2VKZG 2J7DA 4TV6A 1WCGA 2ZTKA 3AU6A 4Q8NA 2VEIA 3ZFHA 4I8DA 3DIPA 4RPPA 2Q02A 4S3JA 5ABEA 1TTPA 5TF0A 2GGJA 1MW0A 3WLSA 1X39A 4MJ4A 1KRCC 1DIEA 2WM0A 3GHSA 3GTIA 3H70A 1JUBA 1B57A 2ZCGA 3RPTA 3B8TA 4I3GA 3S9ZA 4M6UA 3O6AA 1XG3A 1LWIA 2IMRA 3W24A 2V63A 3B8VA 3CUHA 3EDDA 3W2MA 4Z1BA 3WIJA 4OTKA 1DJWA 4QM1A 3PUGA 3NR0A 1RPXA 1WDQA 3BE7A 3G24A 2B7PA 4YTRA 3W84A 3SCTA 4PC8A 5CGMA 3UU0A 3UZWA 3UETA 1GQKA 1PHQA 2OEKA 4B3ZA 4JQ2A 4KF1A 3SCNA 4MG4A 5EMYA 1CGTA 4MDPA 1MXGA 3EWWA 2ZTJA 3E0IA 3WLQA 3WBYA 5EBAA 4O19A 1ZP3A 4H9UA 5CQ1A 4GQGA 1F6PA 3GK0A 2QNEA 2BVYA 1E70M 3V4BA 2VELA 1OFDA 3ICJA 1VJSA 2OKOA 4XZWA 1A3XA 2VGIA 3AXIA 1ZBVA 3H7VA 4Y6GA 3VUSA 5ABGA 5DX7A 5BXSA 2IKIA 4LUIA 1A53A 4EWND 2BXVA 1ZTVA 3UWVA 1EA9C 3W7KA 2GVGA 3LRMA 4UFKA 2ESCA 3WJYA 4I8YA 4NSBA 1XUUA 1UKPA 3CPRA 3GXIA 1DJHA 4PMVA 2V5LA 1MEWA 2YBVA 3U4AA 4HK7A 4KMQA 3BMXA 4LTSA 4OU1A 4Q8VA 4UIOA 2ISDA 5BRPA 3D46A 3U7BA 2YCJA 4O54A 4K37A 4GI4A 3GTFA 2GJRA 1P0DA 1K6WA 2P0OA 4K38A 1MW1A 1YNYA 3R43A 1PJ9A 2PRLA 2DT2A 3AMLA 2YA0A 4UCGA 1V02E 4M3PA 1OC5A 4CU8A 2G3NA 4UTJA 5I77A 3RM4A 1CZ1A 1US0A 3MTWA 3PUEA 4AW7A 7REQB 2ZZ2A 4FAMA 4GI9A 3V7PA 2BOFX 2VVSA 3S5YA 3P84A 3AHYA 3WDQA 3CAKA 1Z3NA 4AIEA 4ZOBA 5CZ0A 2G96A 1FH9A 4GJJA 1GVYA 1IWPA 4L61A 1DQWA 4D9PA 1GVOA 1ONXA 2DH2A 5IDZA 2J88A 2SFPA 4GC3A 4W89A 3W86A 4D1JA 5HBFA 3FJ4A 3UR5A 2QIIA 3W53A 3LMZA 2GVLA 2WSPA 3VIGA 4OE7A 4X2RA 4UOJA 3TFXA 3MCMA 2DW6A 4WCJA 2OZ8A 1TJRA 4KFPA 1SR9A 3VX0A 4X22A 4B2DD 4AHOA 4AZHA 2VYOA 3GH5A 2UY3A 1KCXA 2BDQA 4GBDA 3BAJA 4UQDA 9XIAA 2BODX 3CIXA 4WKAA 2VQUA 3G22A 3P80A 1A0DA 2DORA 4JX5A 1PAMA 5FF0A 4PMUA 3G1SA 3T4WA 2E5DA 5TNVA 3CH9A 2W4XA 4NAEB 2O56A 3UBPC 5HWJA 3H12A 4UFLA 3PN8A 4PTXA 2B7QA 3F2CA 1KXVA 3POHA 1LP6A 1SZEA 1CXEA 3HF3A 2OVLA 1EF3A 4QROA 1XR2A 4DJFC 2GDUA 3RYSA 2OX1A 5AHFA 3DUGA 5BOEA 1UD5A 3UJRA 4R88A 4DF2A 1KWKA 2X0YA 3UA3A 3KBVA 2PU1A 4DYEA 3WYZA 2HS8A 2E7FA 1E0XA 5LHFA 1IT7A 1OX4B 5BCAA 3W7DA 1TV5A 4IQJA 3LLFA 4ZMGA 3DFTA 1JZ4A 1RCXB 3B8SA 5BMWA 1TRIA 1E0VA 4S3FA 2OGYA 3S1VA 4XAYA 2F6KA 1Q5MA 2PWGA 4QISA 3SQSA 3E2QA 3VKDA 3HGOA 3DCPA 4LX4A 3MSRA 3GW0A 4PRTA 2DZWA 1H50A 6ENLA 5HQLA 1RVGA 1FWAC 4US5D 3GAKA 4IICA 2Y70A 1JRCA 3QMTA 3VDBA 3MJYA 4C7FA 5HMEA 3C0LA 4XSLA 3IV8A 3KP0A 1GT8A 4F2UA 7ENLA 5A2BA 2J75A 5HK4A 3TTSA 3NSXA 4MB1A 4GUJA 1X1ZA 1XLMA 1YDOA 1W3TA 3TLQA 3UJFA 3WLHA 3PBUA 1KLYA 4U31A 3NDZA 5ECUA 3EB3A 1QXLA 1ZCOA 2W66A 4HU3A 3NQ6A 3P8IA 4UR7A 3M9YA 1PX4A 4AB4A 3G8EA 5ABFA 1XISA 4GC4A 4GUIA 1EBHA 3W29A 5ECVA 1XSIA 1F8IA 3HN3A 4U10A 4D6IA 3W1RA 1EPVA 1KXTA 2BASA 1KNWA 1KFWA 3B4UA 1RY8A 3DHUA 1XLBA 3Q45A 3L9CA 3C8FA 2HBVA 1Q6EA 2BHZA 2WPBA 1U22A 1W1B1 1ZZMA 3C2FA 3GIYA 1T41A 3DBNA 2W91A 2Y61A 3PWAA 3TCEA 2QF8A 4ACZA 1Z69A 4IJBA 2WZMA 5BU9A 1TREA 5FSDC 4UNIA 3DG6A 3NDYA 1KGXA 3BCFA 4XIAA 4L9ZA 3TW9A 4U3AA 2JF6A 3W7QA 1A49A 2BVWA 4L80A 3GIPA 3K30A 1PWLA 1U5HA 1S5TA 5HQEA 3OYZA 4PMNA 2G41A 3FEQA 1HL9A 2R14A 4E6MA 3E9AA 5JH2A 4NZ5A 1MZHA 3BCJA 3SBFA 4L1WA 3FX4A 3GVQA 4PTVA 5C2GA 4BEUA 1WXYA 2WMIA 3PPCA 1UA3A 5D04C 3RIKA 5K4XA 4JY9A 2Y85A 3SCPA 3FGCB 4H8HA 1IZKA 3HU7A 4P61A 4Z2IA 3I4KA 3UESA 1XF0A 2DEPA 4R5EA 1TTJA 4HPNA 5K9XA 3BAWA 2VM8A 3WK3A 3N04A 3QXBA 2OOGA 2VWSA 3K1DA 3BGJA 1JNDA 1PX8A 4U3CA 1DXIA 4ZODA 1UCWA 4ZOCA 2JKAA 2AMGA 1O68A 4JN6A 3BJSA 3LLXA 2ZZ3A 3VFLA 1NF0A 1P48A 1U1JA 1K8CA 1A47A 4GIRA 3WQVA 3EKZA 1FHVA 3ZLGA 4JDBA 4AIUA 4A3HA 1LWJA 4H8NA 4NX0A 3H23A 1XP3A 4JTQA 1MNSA 3NQDA 3QLDA 4MZ1A 2J27A 5LIXX 2C6QA 3DN5A 1B54A 5LIKX 1YDYA 1O60A 2W79A 2WJZA 3B06A 4E8GA 1CI1A 3VMNA 4BCEA 1TWSA 4UTMA 6XIAA 5CC3A 1GUVA 3PJWA 4S38A 2PTXA 3UWWA 3G0UA 2J62A 3RCYA 1DE6A 3CO8A 4HOZA 1K8YA 4CU7A 4GKLA 3GNXA 5M5DA 1X38A 3GR4A 1LQ2A 3S1UA 1FTXA 1VZWA 3JR2A 3RRAA 2IS7A 1K8XA 2F84A 5A8PA 2D73A 1V08A 1GJUA 4JBRA 4LYPA 2PWEA 3W88A 3XIMA 1PKLA 4IP5A 3ITGA 1CIUA 5CC5A 4RV8A 1EWDA 1G4EA 4KBXA 4AC7C 1UWTA 3OG3A 1Q66A 4O10A 1EFZA 1RZMA 3FY1A 1K4HA 2Z1KA 2DJXA 2V3FA 2IQDA 2FZNA 4LU0A 3GXDA 3HQ1A 4GISA 4R53A 2PC4A 1IEXA 3OLEA 1XH2A 1QO2A 2E1DA 3FA3A 3WZ0E 1XDJA 3TJLA 3S6TA 4B4FA 4WR3A 3QY6A 4A3QA 3MCOA 1JF6A 1LL6A 1QK0A 4IXHA 1Z48A 4TXEA 1OYAA 3PP7A 4GX9A 3A6OA 3PBYA 1EIBA 3TA6A 3N13A 1A5UA 2HE5A 1IXQA 5I03A 3SSZA 3T0DA 3VGDA 3TYUA 3MUAA 3GTNA 1MQQA 3H22A 3ENLA 4C65A 1A5CA 2EPNA 2XH7A 4F0HA 4Z1YA 4FALA 3G8RA 3SURA 2VI0A 4W7WA 5LNSA 1SFSA 2VEMA 1G7UA 5M2FX 3QQ1A 3I6TA 1W0MA 1IZJA 5ENLA 6TAAA 3ANVA 3CJPA 2ZRUA 5H6HA 1I0DA 1IE7C 4M7SA 1RR2A 1PIFA 7ODCA 1GVRA 2OODA 3O0FA 3W7MA 1HX0A 3BICA 1O5KA 3ZIZA 1RA5A 2EQDA 1WDDA 3K8LA 1L6GA 5E93A 4MNMA 4KGLA 4G7FA 3LCLA 1VYSX 1GEHA 3THAA 1XGZA 4ADTA 1U33A 5G2IA 4ES4A 4HU8A 1E40A 5LGXA 2QF7A 4KS0A 2B7OA 1Q2SA 4AHQA 3MUXA 3KHDA 4KQNA 4GXMA 1JDFA 4PTDA 3LCGA 4S3CA 3B4YA 1Q45A 4XSMA 3PNZA 2WANA 1ELSA 4RZBA 2H90A 2NWSA 2ZUVA 1EOMA 1BYDA 2PS2A 3UZYA 1SW3A 1Z32X 5EFDA 4NHVA 4H7VA 2NT1A 1FWDC 3MMDA 3MKVA 2A3EA 5HPOA 2JGYA 4IIBA 1F7BA 4WUIA 1CWYA 4DJFA 1F3TA 3T8LA 1FXQA 2VWTA 3LXAA 3NQ7A 5DELA 2WMKA 2FMOA 3GR8A 3THUA 4AAJA 3NVTA 5FKYA 1E0UA 1GVQA 1P1MA 2V2DA 4MDOA 4O12A 2BVTA 3RUBL 3H26A 4UTKA 2WVUA 1UKQA 5DMLA 1QI3A 4BHYA 3II1A 3L2LA 1VR6A 1Y5WA 1S1RA 3CIVA 1KD0A 4UTFA 2B81A 1XD0A 1ZHAA 3C52A 1SO6A 4K7YA 5EYWA 5A6AA 5AHEA 2AQOA 2NUXA 3HG3A 1ZUAX 3L0GA 5A8OA 5XIMA 1EDTA 1OSEA 1GHRA 1QW9A 3EEZA 4H9XA 3QGVA 3AS3A 2WVVA 4GY0A 4A3RA 1D3GA 2FHBA 2G5WA 1KM2A 1LYXA 3CHEA 2PF0A 1NDZA 3M0HA 3VD3A 4ZOAA 2NVDA 4DIAA 4RLIA 2O0TA 3D3FA 2QCHA 1Q4NX 4QG6A 2BOEX 3AYSA 3QH2A 3NUKA 3UNTA 1R85A 3CAQA 3DI0A 4IGSA 1J6PA 4HYVA 3B0UX 1YBQB 1YEYA 2QCDB 1AL7A 1GW1A 2VFGA 2WCAA 4GZEA 2X2GA