3M0KA

Structure of oxaloacetate acetylhydrolase in complex with the product oxalate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
294
structure length
289
Chain Sequence
DEPFSGAKKLRHLLENTDELIVCPGVYDGLSARTAMELGFKSLYMTGAGTTASRLGQPDLAIAQLHDMRDNADMIANLDPFGPPLIADMDTGYGGPIMVARTVEHYIRSGVAGAHLEDQILTKRCKKVVSRDEYLVRIRAAVATKRRLRSDFVLIARTDALQSLGYEECIERLRAARDEGADVGLLEGFRSKEQAAAAVAALAPWPLLLNSVENGHSPLITVEEAKAMGFRIMIFSFATLAPAYAAIRETLVRLRDHGVVGTPDGITPVRLFEVCGLQDAMEVDNGAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of oxalacetate acetylhydrolase, a virulence factor of the chestnut blight fungus.
pubmed doi rcsb
source organism Cryphonectria parasitica
molecule tags Hydrolase
molecule keywords Oxaloacetate acetylhydrolase
total genus 109
structure length 289
sequence length 294
ec nomenclature ec 3.7.1.1: Oxaloacetase.
pdb deposition date 2010-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3m0kA00
1O68A 3QV9A 4HYVA 1O66A 4IQDA 3OYXA 2VGBA 3QV8A 2ZE3A 3T0TA 2X0SA 4YJ5A 2XDFA 3GQYA 1XG3A 3P0XA 2WQDA 4JPGA 1PKYA 4G1NA 3T05A 2G50A 3HQNA 4KRZA 1KBLA 1PYMA 4MG4A 4HYWA 1AQFA 3M0JA 1F8MA 2VGIA 1DXEA 4QG9A 1M3UA 3PP7A 4IP7A 4TV5A 4B2DA 3H6OA 2V5JA 4KCUA 4KCVA 1F3WA 1PKNA 1IZCA 3U2ZA 3MA8A 1A3XA 1ZLPA 3OQ8A 1SGJA 1PKLA 3QTGA 4TV6A 4KS0A 2KX9A 1A3WA 1DQUA 1E0UA 2E28A 3HQPA 4RPPA 2DIKA 4IMAA 4L80A 3I4EA 4WJ8A 4ROQA 3KTXA 2XZ7A 2L5HA 3OYZA 4B5TA 2VWSA 3KHDA 3IS4A 4QGCA 1S2WA 1DXFA 4MF4A 3M0KA 1UJQA 4L9YA 1IGWA 3QLLA 3BJTA 3N25A 1S2TA 3E5BA 3QZ6A 5TAOA 3T07A 4L7ZA 4B5WA 2DUAA 3G2GA 3GG8A 4LSBA 1PKMA 4B5VA 4FXJA 2VWTA 4FXFA 3QV6A 3HQOA 4KCWA 1DIKA 1JDEA 1A49A 1VBHA 4YNGA 3SRFA 3ME3A 1A5UA 3E0WA 2HJPA 2VGGA 1S2VA 1U5HA 3SRHA 3EOOA 1M1BA 5JVLA 4B2DD 3FA3A 1MUMA 3QV7A 1VBGA 1O5QA 2V5KA 2BG5A 3EZ4A 2OLSA 3EOEA 1XG4A 4B5SA 3FA4A 1OQFA 3R4IA 4QG6A 4DRSA 1S2UA 4QG8A 2HRWA 1U5VA 3B8IA 1F3XA 2HROA 1GGOA 3EOLA 3LG3A 1T5AA 2VGFA 2QIWA 3SRDA 1Z6KA 2HWGA 3SRKA 3E0VA 4KCTA 4B5XA 3VAVA 2XZ9A 4B5UA 3GR4A 1F61A 1E0TA 2R82A 4L9ZA 1KC7A 3LYEA 3BJFA 4IQEA 3PUGA 1ZJHA 1F8IA 1OY0A 3QQWA
chains in the Genus database with same CATH superfamily
4WKFA 1I2QA 4M81A 4LBSA 1SQ7A 1V7AA 1VH7A 3O8AA 4I9AA 1PKYA 3W4RA 4QQUA 3KOYA 2VR2A 3SUUA 3W7CA 5FF7A 4QG9A 2G3IA 3W2LA 3RPMA 2D2JA 4IXXA 4HMDA 2W9MA 3UPBA 4ILSA 3ZM8A 1RA5A 3RO6A 2O4QA 1P43A 3WQ6A 1D8CA 2XZ7A 3DC0A 1S2CA 1JXKA 3C2RA 1LOSA 4UFMA 3L65A 1NAL1 1UJQA 6REQB 4NUWA 4C1NA 3KE0A 3CO8A 4A3QA 2CLOA 2J7GA 3RG6A 4JCMA 3BSHA 4MUPA 3HQOA 1YPIA 4HTYA 3B9NA 2ANUA 2WKGA 1V6TA 4D72A 3WNOA 3TC6A 4G7FA 5JVLA 1PTGA 3L5AA 1QNVA 1QBAA 4N6FA 4GUJA 4F48A 1N8WA 3HGOA 3EOLA 2YCIX 1UH4A 1I75A 2J9YA 1TJRA 4B5XA 4XSLA 4JS3A 5A69A 4HHMA 4POCA 2UBPC 3ELFA 3CZKA 3DDMA 4LF1A 3N1AA 1WPCA 3OTRA 1E6ZA 3R79A 1KV5A 1KD0A 1IQ8A 1JEZA 5T26A 1W3LA 5CKSA 1OADA 5EMKA 3O16A 3P8IA 3G3DA 3PBUA 3AZTA 4YHGA 3S2JA 4US6A 1Z3NA 3R8HA 1KR1A 4HVXA 1E3ZA 2XFWA 3WJYA 1NWSA 1VF8A 2FKPA 4C91A 1Q66A 4US5D 1XYLA 3UXKA 3TOYA 1I2PA 3BLIA 4JTDA 1DOSA 4DNHA 1G1YA 4ZVJA 2GVJA 3MSRA 1EO7A 4KEMA 4NHVA 5BMWA 2GVLA 5AFDA 4AF0A 4H7ZA 1RP8A 1V5XA 3G1RA 4E3TA 4J3WA 4E8CA 3E5PA 4DWDA 1YBQA 1PIGA 5A6JA 1TA3B 4GVGA 3ZWSA 3UVIA 3NDOA 1XLCA 4AZ5A 3GXPA 5E6YA 3TTSA 3DFHA 2RDXA 2WNWA 2Y1HA 3UQNA 1BKHA 2CBJA 1OFOA 3TTQA 3IV8A 3GNDA 3LY0A 3AWOA 4B4HA 4MJ2A 4EXQA 4DELA 4RZBA 2WMFA 3PPFA 2GJXA 2GJLA 2RJHA 4HCDA 2YDAA 2J7BA 4ERIA 1PEZA 2PLKA 4LY8A 4PTWA 3GHUA 4HA3A 3ITXA 3VGHA 2WKJA 4EF8A 2YDQA 5GPRA 3VD3A 1H63A 3KRUA 5AYIA 2WNZA 2KAUC 3TONA 1X39A 1BYBA 2C7FA 4V1XA 2JE8A 3XINA 4J4KA 1UUMA 3LV5A 1SW7A 4ATDA 1ZNNA 2J62A 2H8ZA 4PA8A 3LM7A 2DIEA 3L5MA 1OSEA 5DBTA 2XSAA 4MFEA 1E6XM 3AS2A 1CGTA 5EMJA 2CZVA 4GABA 4YTSA 3UCQA 2BXYA 2TPSA 2Y8VA 3QZEA 1JDEA 4YHEA 3JRKA 4QLJA 3A4JA 3FA3A 1V6VA 4A3HA 4L6OA 3NSXA 3A21A 4LVFA 4HHHA 3IGUA 3K8KA 1W0MA 3AIBA 1Z7AA 4IL0A 3W1UA 4DXVA 1C92A 4M7TA 3IGSA 3VOHA 1XKYA 1AQMA 3LYEA 1M01A 3W1TA 4XUYA 1FQ0A 3M0LA 3USBA 5TNVA 4U3CA 2E1DA 4E3VA 1EKOA 2RDWA 2NXGA 1QUMA 4NRRA 1XDMA 1XW8A 1U2YA 1CXFA 1W3IA 1FFQA 2FIQA 2FZBA 3ITOA 2E6FA 1XLHA 2IQ0A 4CCZA 1UR9A 2DZXA 4BA0A 1KA9F 3OGRA 2P53A 4XVDA 4QXIA 1CGUA 1NOUA 4JQ3A 4XB3A 5H1WA 3DYOA 5I5RA 3WDRA 1MW2A 4QGCA 1K70A 1Y65A 4J3ZA 3GNPA 2DVUA 3CPUA 1OINA 4DM1A 3IJ8A 2EPNA 1HFBA 1T41A 4Q4SA 2IPJA 4N42A 2VGGA 1U5HA 4GPNA 3SGZA 3W01A 3QQ0A 1EBHA 4WOQA 3U2OA 1R2SA 5EFFA 1K4GA 4IMGA 4D71A 3LRKA 4MYAA 1JCYA 4JDYA 3KP0A 2QCLA 4ZBCA 4FSAA 2G97A 1O95A 1DWJM 3NO3A 4E5TA 2XINA 3EMQA 3ITYA 4LJ3A 4L65A 2Z6IA 1S39A 1VPQA 3PB0A 3TE9A 1M03A 1Q63A 4JIPA 2JF7A 4AEOA 2B7OA 3CV1A 3HBLA 3W83A 4EF9A 1GVRA 4NZ3A 1TWSA 2J25A 2HMCA 4AMAA 2V38A 4RLIA 3G1HA 3OGVA 1UD2A 3AJ7A 3ITTA 3TYZA 2O9TA 2GGGA 1FCQA 5H8UA 4DO4A 3L0GA 3I4EA 3C52A 2WCSA 1SFTA 3L4TA 1W1TA 3EEGA 4HZ6A 3LNPA 1DXFA 2F84A 1Q6LA 1V02E 3MMTA 1LP6A 2I1OA 5I00A 4GHRA 1QNOA 1YMYA 5DY3A 1JZ3A 4GNJA 2VRJA 2WJEA 2W91A 4IJCA 4GD0A 4KERA 3S9ZA 2BOGX 3SADA 3W84A 4HP5A 4H00A 5F4WA 2EKCA 3QGVA 1TMLA 4DJFC 1E51A 5CC7A 4MPKA 4GISA 1VS1A 3HPFA 5KMYA 1D7FA 5LA2A 1IT8A 1E6NA 2CBUA 4FLOA 3KAOA 4M6VA 4TX6A 3F2BA 2V3FA 2VFGA 3NQFA 2ACRA 5U7SA 1XICA 3UETA 3EDKA 3MHGA 2AMXA 4F2BA 3NOYA 4GVIA 3QV9A 3T2QA 3S9YA 2NQJA 3TSBA 1L2UA 3ZXWA 4DUOA 3K30A 1ESWA 1LRTA 3DBPA 3S1GA 2Y85A 4N4PA 1UH2A 4E4UA 1US2A 2ZRWA 3TYUA 4U33A 1OGBA 2VELA 4GGBA 1EOMA 3BQ6A 2O4MA 1XHGA 4JTLA 3IS4A 2QUTA 1K7XA 1H60A 4AC1X 4DJDA 1SZNA 3WUGA 1JCXA 3NXFA 4DNMA 1W3HA 3UXDA 2ONEA 3AHYA 3EMCA 2ATMA 2WW5A 4MSSA 4Z0JA 2OR2A 1W1YA 5FEXA 2FZDA 3GRIA 1POKA 1OGGA 1EPXA 3O6AA 4JNZA 1RUSA 1QT1A 3WEMA 1V08A 2P3ZA 4U5IA 4DJDC 4GUGA 3RLHA 1W9PA 1UC4A 2HRWA 4AWTA 3MZNA 3TAKA 3EKLA 2VFIA 2Z28A 4RE4A 4QE1A 3UZWA 2Z27A 4H19A 3O7UA 5FL1A 1XR2A 2WSPA 3T0CA 3WLPA 2G50A 4DEFA 4KRUA 1J8VA 4F9DA 5GVJA 3PFMA 3NAVA 4RNIA 4BQ3A 2FB3A 3WH7A 1J18A 1AQFA 5I24A 2WCAA 3H26A 3W7KA 1GOMA 2PTZA 1WO2A 2V5LA 3MA8A 3N11A 1QO2A 3URAA 4P7OA 2WSQA 3RNDA 1GQIA 1H7RA 3NL5A 2BS9A 3NR0A 4L80A 5CSYA 5J5DA 1M7JA 3RM9A 2L5HA 5I09A 2OLAA 3S2CA 4AEFA 4O53A 1LL7A 2ZXBA 2FGBA 3FHQA 1KLZA 4CN4A 3R58A 1J9YA 1Y5VA 2WKLA 2WMGA 5LZLA 3NPVA 1XYZA 2XHYA 4QS5A 4NIRA 2UY4A 4AZGA 4IH3A 1B4KA 2PDQA 1AK5A 2O9PA 3W37A 2NWSA 3R13A 3VABA 1HX0A 1UP0A 3LLXA 3WK2A 3WNKA 1ZAIA 2J7HA 4GLEA 3NSMA 1G7UA 1EDTA 2E9LA 3D0CA 3L4ZA 1B0IA 4RE0A 4R3UA 3V4BA 3WQGA 1WZAA 4BI5A 3C4UA 1EBGA 3W38A 5D33A 2A6NA 1DJYA 1CECA 1E1CB 4WDWA 2Y2WA 4NZ4A 3VOGA 4NX0A 1PXGA 2PP1A 3ZJ8A 3RCMA 1CPUA 1SO6A 1JUBA 4H9UA 4CNSA 1WUEA 2ZE0A 4F4RA 1U1JA 3RAOA 4QAWA 3KP1A 1Q7QA 4DO5A 1KGUA 3KFTA 1K02A 4LH8A 5KZEA 2J9ZA 8XIMA 4GVFA 3CTLA 4C5ZA 3SCVA 3VILA 4L4MA 3PZQA 4ZB2A 2RJGA 1RPXA 2GLKA 3C2YA 5A2BA 3HQPA 1UQZA 3NGFA 4AIEA 3H7VA 1FCVA 1TWWA 4B5TA 4A4AA 1UWUA 1SZGA 2ZBTA 2VEKA 1ECEA 2J7FA 3O3RA 2DZBA 1V77A 4AZIA 1QPRA 1JPMA 1NFBA 1HVQA 3WLLA 3IK4A 1NF0A 4XAGA 3DKLA 2OYLA 1AH0A 4MB1A 3IJ6A 1L6YA 2V5KA 4QFUA 3JZEA 4PGLA 2ZYFA 2ISVA 4X9YA 4ML9A 3V35A 1QW7A 1SO5A 4JY8A 4QHRA 5FEWA 4E2DA 4LU0A 3HN3A 1EJTC 3ZO9A 1OX4B 1W3JA 1D3GA 3DAQA 4HPXA 4R33A 1EC8A 2YL9A 4GCAA 3P7YA 1GQKA 2DW6A 1XXXA 1GOIA 1VFMA 3ITLA 4Q6JA 1GYMA 4LEQA 3BVJA 3TWAA 1EH9A 2DVXA 1HJQA 3U57A 4GYPC 2XH2A 2E6AA 3HG5A 4R34A 1JCMP 2QPSA 2CU0A 5CSRA 1E0WA 1CB7B 1QK0A 1XSIA 1UZHA 2AL2B 2WSYA 1D3HA 4W8LA 1LLOA 3FKRA 5LKYA 1W5QA 3R12A 1C93A 2XJ7A 4JYFA 4RDZA 4D1IA 4KF1A 2FVLA 4L9YA 1XIEA 1V79A 4QE4A 1L6GA 2WHLA 2YXOA 3TAOA 2PP0A 2WSKA 4OJYA 3W7OA 3CBWA 4B9ZA 2EHHA 4UR9A 5LIYX 2G3JA 4XAZA 4FPSA 2YB4A 3K46A 2CHNA 1KBIA 1JYVA 1KRMA 3MDWA 3W1NA 1RCQA 4FX7A 2WCGA 1J0KA 4B4FA 3Q37A 2ZX9A 5D2TA 3O07A 4QNWA 1FCBA 2CLMA 3EMZA 4ZGYA 3TW6A 1QTWA 1KXTA 2A7PA 7REQA 1N82A 5HOSA 1NFGA 1TJ0A 1VAHA 1MVYA 1TCMA 4ZQPA 2CESA 2JK2A 3WUFA 1T8QA 3N17A 1MZHA 1Q6QA 1YKWA 3LLDA 3BZJA 2YCJA 1J79A 1NSJA 3GU9A 2PCEA 4GYJA 1GONA 3SQMA 2WQDA 4XD6A 1UASA 4Z42C 1UMYA 1XGEA 3L23A 3M44A 5D2WA 2Y4SA 3MSGA 1DXEA 1HTIA 1XH0A 3DCPA 5AHIA 4CNUA 2PFHA 4UTLA 4GNKB 4BY3A 3EXTA 1GT8A 1XC6A 1W32A 5FF3A 4ZXLA 1J0YA 2QAFA 3I7SA 3QHMA 3ARVA 4ERGA 3GTHA 2QW5A 4DHGA 3GWQA 4EK7A 4MM1A 1HJXA 3SQLA 3BG9A 1UOKA 2TSYA 4QEHA 4ZZ9A 1W6TA 4E6MA 5C8BB 1A5SA 1W2PA 1CXEA 4RNHA 3MKKA 4FHAA 5HMDA 3UA3A 3WJWA 1QHZA 5EY5A 4JX5A 2PWEA 3NQVA 1WKDA 2E6YA 3VYLA 2YLLA 4Y90A 5I0DA 4JTGA 1CENA 1NIUA 3OVPA 1GYLA 2VX5A 2QCFA 3VZZA 1J0JA 3EX6A 4KIEA 1ZQ5A 5D38A 1HJUA 1XIGA 4K1GA 1AG1O 4IUOA 2GQ9A 4GIRA 5HJYA 4QBXA 1OG0A 2AQOA 4H6KA 3WL1A 4CQDA 2ZDRA 1ZJHA 1HJVA 2ZIDA 5DELA 2VDIA 1HJWA 3CC1A 2O7SA 5C5YA 1FWHC 1BG9A 4K8EA 3UXAA 2W3ZA 5K4ZA 1ONWA 1FKWA 1TWZA 2GWNA 3SGGA 4C90A 3SSZA 1EYWA 4OWGA 3T05A 3VMPA 2DT2A 2H3DA 4RKAA 1PWMA 3GY1A 1H50A 3GW0A 3NYZA 4IGMA 2HS8A 4DWSD 3G1FA 3CMFA 3MKCA 4AC7C 1OFPA 3QKZA 2Z0IA 3QY8A 3VOFA 2QDEA 3VNZA 5CBBA 2D69A 1RBAA 2BHUA 2X7VA 1TPUA 1G4SA 2GUUA 4XX6A 2C1IA 3KRZA 3FGCB 1V7YA 3NSNA 4QITA 1JUEA 4WKAA 1B9ZA 2OX1A 1TPFA 4QJ5B 1HZYA 3TN4A 1LQAA 3MVIA 3I6EA 3BPWA 4FX8A 4H9MA 4WJXA 3VMOA 1BVZA 3LZ5A 4YNGA 3B8SA 3E0WA 2XTKA 5IXEA 4QSHA 1BVWA 4NNCA 4C6BA 1E9IA 1QU4A 3VI2A 3PPGA 2Z6JA 1XV8A 1X96A 3G0UA 2XVLA 4YCOA 1U83A 2CYGA 3HA1A 3WBXA 2R8WA 2QJJA 5EA9A 3HGJA 1Y5WA 2JALA 4JIRA 2WMIB 1KC7A 2YW3A 4RZ6A 1TCDA 2DORA 4YLWA 1TMQA 2PGRA 3W2UA 1MUCA 4ZO9A 2ZRUA 2CLEA 2ZQ0A 3RLUA 4ADSA 4Q4KA 2F7FA 2DZSA 5T9CE 4REQA 3C8FA 4IIDA 4EP8C 4MDOA 4BF5A 4L6DA 3CU2A 2PTYA 3ZOAA 4QAIA 3LLFA 4XBJA 4DYKA 4YTRA 1NWTA 3OIHA 1P48A 1VBUA 1F4AA 1DJHA 4S3KA 3NEVA 1P6CA 3M0YA 2VFHA 2SFPA 4QDPA 1ZRQA 1CDGA 2PUZA 2XIJA 4GRSA 3UR8A 3B0VC 5XIMA 1XD1A 5CGQA 5C70A 1UZDA 5L9FA 4A3YA 3AIEA 2EO7A 3OA5A 4GGHA 5F7UA 3AMKA 1JRBA 3BLEA 1UA3A 2PS2A 1KO0A 2Z1VA 3QEZA 2HISA 3GTNA 5AYYA 3EOSA 2HBVA 3B3DA 3SCOA 3A24A 3W9ZA 4Q3MA 4C6QA 2OJPA 3RM8A 4B5SA 2ABAA 1RK5A 3L7RA 1H7OA 2RFGA 2WZIA 4X2RA 3RR4A 1QI5A 3FAXA 4WF7A 4X0VA 5IM51 3KTCA 3LB0A 1OABA 5CGTA 3WQCA 4ADUA 1A53A 5JIPA 1MXGA 3ARZA 4Q33A 4B92A 4OFCA 5EU9A 3VD7A 4MB4A 2CHOA 3F4DA 4GYFA 3UWZA 4JL1A 4MADA 4J3SA 4KGJA 5AOUA 1GKRA 3PBWA 3RX2A 2IPFA 4AYSA 3VNKA 5AC6A 5FESA 3T0AA 1GPWA 4PMUA 1DQWA 3QR3A 4TU1A 2X7WA 3NO1A 3PNUA 4NL1A 1I4NA 4INFA 1I1WA 1RBLA 2DDXA 4A8RA 3AYRA 3BCJA 3EPNA 2UY3A 4R53A 5CBJA 2XIIA 2NXIA 3WG6A 3T1GA 1ELSA 3VDAA 1X1NA 5ABFB 3NPWA 4MMWA 1VBRA 1KXVA 3VD4A 4RE3A 1UH3A 3WMSA 3NL6A 3C2OA 1V6UA 2DV0A 2Y7GA 1F9CA 4Y9PA 1OVDA 3LUTA 1O5QA 1K6AA 3N73A 1X6UA 2CWXA 1FRBA 2C15A 4Q7BA 2X1IA 1ITUA 4AY8A 4A21A 3A47A 3OZPA 3HPZA 1EP1A 4NASA 2PDFA 5J5RA 2EPKX 4AX7A 3CQJA 3GIQA 1EJUC 3MY9A 1H51A 1QI0A 4CN1A 4HN4A 1PZ0A 2CLLA 1FWGC 3F7JA 4GJ1A 1FTXA 5LIUX 2WZTA 2ODOA 3NYDA 4PBEA 1XYBA 2OT1A 3A3HA 2MNRA 1CIUA 1GVQA 1MQRA 4TVCA 1E9LA 4LANA 2INEA 3V1HA 1B31A 2PDLA 2PC8A 3GVWA 2ICSA 1OD0A 1BG4A 3OBKA 7PTDA 1DQUA 3PNZA 1FWCC 4XUGA 3IWPA 3SFKA 1YNQA 4FZIA 3AMDA 3AC0A 3QW3A 4BJHA 2VUYA 2OQLA 3VNJA 1T99A 2E7FA 4M80A 5KSWA 2D2GA 4AZBA 3DG7A 3T55A 4IJBA 2NWRA 1R87A 4JHOA 1RLCL 3RF9A 2DSZA 4IIEA 1Z89A 1TZZA 5JMUA 5AYZA 3TVAA 2PDBA 1VLWA 2CLPA 1CNVA 1EP2A 3CMGA 2GVGA 2PF0A 2ZC1A 3C5QA 3V7PA 1OCJA 3R43A 5FI8A 3PM6A 2R24A 4NJHA 3RU8X 1HW6A 2XYLA 1OCBA 1UPMB 2X8RA 4LS0A 4AZCB 5JH2A 2DJXA 4JTIA 6TAAA 3AHTA 4CEXC 1MQQA 1LORA 3R5EA 3BSGA 3BAXA 4Q22A 1R9XA 4UQCA 3CNYA 4KCVA 2GPTA 3LXCA 4OT7A 1V0LA 4KETA 1IWAA 4PE8A 2PSNA 4H9ZA 3NURA 3S6OA 2PC4A 3DG6A 4M6QA 5D04C 2ZZ1A 1HKWA 4JTFA 3DERA 5D4YA 4KIRA 2I5QA 2QZRA 3PZGA 3R6IA 4I90A 2G3MA 4ZQNA 1DIDA 2CZDA 1Z48A 3WF2A 3BARA 3MUIA 2Y0FA 2W6RA 2X41A 4PB5A 4LV4A 4M82A 4W7UA 1BF6A 2Z1WA 1T7LA 3A4AA 3ARSA 4LW7A 5B80A 4C6DA 4UR7A 3TYEA 4L64A 3UD6A 4XBKA 5I3HA 3TYDA 4F0HA 1HN1A 2ZXDA 2VZTA 4GOAA 2PEVA 1I9CB 4XTDA 3AIVA 1UOZA 1RCOB 3N3MA 1SJDA 1EHNA 2GJNA 2IKGA 3MJYA 3A23A 5FA5A 1GCYA 1L8PA 3BJFA 2GZXA 5BRQA 5DLCA 4LPCA 5KETA 4PYSA 3LPFA 4HK7A 1JZ4A 5LYRA 3PZMA 1RY0A 1EX1A 1XBXA 4P8WA 1NU5A 4ZXOA 2YOCA 1QNQA 3VX1A 3GD6A 1TTJA 1XQLA 4AD1A 4O18A 1SZFA 5LNRA 4D6GA 1XKJA 5TBOA 1O12A 4HZ7A 2YGYA 4REQB 2XGBA 3VDBA 1UUQA 4DN1A 2P76A 3SGUA 2YSWA 3WY1A 4U2YA 4A8NA 2WNNA 4G56A 2NT0A 4LC6A 3HG2A 2EPMX 4M1RA 2V5DA 3AUOA 4E8DA 4GQBA 4GZIA 4O52A 4LRSA 4WZHA 1IF2A 2A3BA 2J4GA 1BRLA 4GI8A 1C9DA 2QJGA 3JUGA 4IP5A 2PRHA 5EFDA 4Q7IA 3QZ6A 1XRVA 5HMEA 2CITA 2QJHA 1J0IA 2YBUA 4KGLA 4OV4A 2OELA 3OJGA 3WQ5A 2D22A 1JI1A 5DT7A 1H2JA 3TN6A 2EPOA 3BLDA 1K8ZA 2DP3A 3LI1A 5D05A 2DZVA 4O8RA 3THUA 4HNOA 8TIMA 4MNMA 3SECA 3AJXA 3E2VA 1LL6A 2AGKA 2BY3A 3N4AA 1H1ZA 1A5BA 3LD5A 3M47A 4WDXA 3SEPA 4ZQCA 2YX0A 2NLYA 5D9OA 1KTCA 3IACA 3PHAA 2OEKA 1UR8A 5CEWA 4HA0A 1PTDA 3O15A 3TOPA 4AD0A 1QASA 1XRFA 2OMAA 4C7DA 2BVYA 4ZEPA 2QCDB 1DXIA 1PX8A 4W86A 5MHBA 2PLJA 2XUCA 1ISXA 2INFA 4LVBA 5FCZA 3ANUA 2XISA 2WMHA 1TRDA 4UFLA 1KCLA 3W71A 1VHCA 1ZENA 4ZA0A 4GY7A 2ON3A 5BU9A 1JPHA 3T4WA 3TQPA 3LI0A 2PB1A 3NZQA 4PCSA 4IMAA 2VQTA 1HKIA 4H1ZA 5FF0A 5CZJA 2BVTA 4X63A 3ZWTA 1W1IE 1ONXA 3O1NA 1S5NA 2ZTJA 2WVTA 3IVUA 1ZUAX 2Q01A 1OCQA 1GQLA 1JPIA 4L1GA 1JF5A 4LUIA 2GUYA 1G67A 5IOBA 2ZRXA 1SW0A 1PX4A 4CVUA 1N8IA 1IXNA 4F0RA 4ZR8A 2X1TA 4GA8A 4CLMA 3W6YA 2HZGA 2QT3A 3ISIX 1OGSA 2WZEA 4IGNA 3P62A 1UWRA 2OPJA 4DXXA 5BWFA 2FFCA 3TMQA 3TQKA 3VCCA 4W7VA 5DMLA 1TPVA 3GG0A 4O0ZA 1P1MA 3QZAA 1TR1A 3GYCA 4AD4A 2GK1B 3UZ5A 5F2IA 4AIUA 3TN5A 4UQAA 4H2CA 2ALRA 2GDQA 1R86A 4UFHA 3U5YA 3QJAA 3ZMRA 3O6YX 5TD4A 1TV8A 1FA2A 3CV6A 3I7QA 1DV7A 5EMUA 1L9WA 1OFRA 3ZVHA 2CWNA 2YA2A 4NJJA 4OTKA 1IZCA 4EANA 4TXEA 1LF1A 1NH6A 1GZJA 2QVHA 4J3UA 4CN6A 1XINA 3NQDA 3DGBA 1CX9A 1TR9A 1WKEA 2BMBA 3CAVA 3FXGA 3TP4A 4IFKA 3H2NA 5LNUA 2WNQA 3V3WA 1EWEA 5H6HA 1DIOA 3V1PA 1AQHA 3ZVHB 4WSHA 1TVLA 3ZJ7A 3DUGA 3NFUA 4GBDA 3FVDA 1QXLA 2DIJA 4CNPA 3TLLA 3GE7A 4PMVA 5FOOA 2HDJA 2OEJA 3ARTA 1O5RA 4LAUA 3DI1A 4W5ZA 4ACYA 3IIZA 4PR4A 3BMXA 2CLIA 1YE4A 5EMMA 4YPJA 4IISA 5CG7A 2CXEA 3ABZA 2X09A 4GG9A 2HVOA 4TVUA 3GC2A 1PCWA 2CZ5A 1JYWA 4O28A 2GJPA 2IUZA 4BFAA 2YW4A 5IFPA 5DO8A 1B30A 3A9BA 1BYDA 1GYNA 4E4PA 3SBFA 1FBAA 4W93A 3UXIA 5JBEA 3STPA 2YCKX 1PTAA 4K1WA 1FFRA 1HGYA 3PJXA 4IX2A 4Y2WA 2ESCA 4MZYA 2G96A 1OT2A 1UB3A 5FJIA 3VM5A 4Q8TA 7ODCA 3PTKA 4IPIA 5LHFA 4BHYA 4W9TA 5A6SA 3FOKA 4J3XA 2GUBA 1GPFA 1PPIA 4ZB0A 3VIKA 5I06A 1NDVA 2DT3A 5CH9A 3HTWA 3BAIA 2VFDA 1TYGA 3NVDA 1XPYA 1RR2A 2FVMA 4BS0A 3W26A 1CBGA 3F1QA 3K5XA 3IIOA 3GVGA 3A4XA 3IJIA 1EIBA 3DFPA 1UR2A 2ALDA 3W7PA 3BDKA 3TLQA 4ALDA 1EUAA 3AU2A 4GMEA 4J3TA 4GH3A 4KFNA 5C9RA 1MSSA 4IG2B 3SRFA 1ISVA 3BLKA 2I5GA 3GLCA 1KNWA 4L1XA 4BI7A 3QHNA 4MAVA 4MGGA 3W7HA 3CZLA 4HU3A 1KFWA 3EDDA 2G5WA 2HROA 2V2CA 3P2VA 1L6FA 4DJFD 4Z2KA 4J2MA 2ZOXA 1H0GA 1YPFA 4I7VA 4C6NA 4H9YA 3ZLFA 4B5UA 1H62A 3NEHA 1KQYA 1E15A 2WQPA 2VZSA 3UERA 1PB0A 3D5HA 5E93A 3P61A 1YQ2A 2VC5A 3UJRA 5CC5A 2VQUA 5I3GA 4WXYA 1B3VA 2PZNA 4F8XA 2FPTA 3L4VA 1QMLA 1IZJA 1VCGA 1QDSA 1TV4A 3VC5A 2QHAA 1JIBA 2PE4A 2PDMA 1XH2A 2HVNA 5LA1A 1UC5A 2I16A 4IFRA 1AFSA 3F03K 1BXBA 2NXHA 1VHNA 1YYAA 2PDPA 1QOQA 2Y8UA 3ARXA 1YADA 4XWUA 1Z8AA 3VU2A 2ZXQA 2ZZ7A 1AJ0A 3KCOA 3W70A 4HOWA 4QROA 4J27A 1AMKA 5CG0A 5K7JA 2GQ8A 4MTVA 1ZALA 4CEUC 4PMYA 4IICA 3ES8A 1K6WA 3N4FA 4JXCA 3FSTA 3ZSTA 1R0MA 3GXFA 1P0DA 1W1PA 2HTMA 1GVIA 1JNEA 4ZTXA 4C5YA 2Z2BA 4BI6A 1V3HA 3DU0A 3UZXA 3DG3A 5AC7A 1TVNA 3EOOA 5JQ9A 3AQUA 2YLAA 3WQVA 2QIWA 8RUCA 4TX9A 3AS0A 4GQRA 1F5ZA 4P7RA 3F5JA 3WQ4A 3B0UX 1VYRA 2QUMA 2PBOA 2R82A 1LQ0A 1NQ6A 1AD1A 4IP4A 3OYXA 3MPGA 3I3DA 4LX4A 3QV8A 5RUBA 2NQLA 2B4GA 4OQVA 4GE8A 3CQ0A 3M46A 3XIMA 2GGJA 3H21A 5C71A 1VB9A 1TX2A 3VKJA 1YRRA 4I9TA 1SR0A 4HA1A 1XIJA 1XLAA 3N2BA 2DZPA 2RDUA 2Z1BA 2KX9A 3OG2A 3LHUA 3R0DA 3NQ7A 4HIBA 4K2SA 4MWAC 1OG6A 2VWSA 4GC4A 3CZGA 5J04A 4AD2A 2ZC8A 3EBVA 4PB4A 3WLJA 5CXPA 1X7FA 4G1KA 1LL4A 2ISFA 4Q4PA 4FXJA 4NKCA 4H83A 2PODA 4DJDD 4AD3A 3PULA 2VD9A 3EXRA 4IF2A 3T81A 5DRIA 1WQ5A 1QWKA 2B31A 4C6CA 3V16A 2Y89A 1TPB1 1VJSA 2ADAA 3GHRA 3IJQA 4C60A 4LCQA 1U5VA 1R3QA 1RXOB 1FDYA 3E0VA 3AXHA 3NPXA 1QI3A 4S3FA 7XIMA 1EYEA 3RN6A 3SR7A 1VJZA 1ADOA 5HJLA 3LTPA 4IJRA 1TPEA 5FL0A 4D6HA 4EX4A 1US0A 3SCRA 4JFSA 3TNBA 3THCA 4JTAA 3VIHA 4M29A 1LT7A 2J8GA 4AH7A 1IGSA 4NILA 1NJJA 2FH6A 2FB2A 3VIMA 4IUGA 3VGGA 2BGNE 2EEXA 2CLFA 2LLEA 3RRAA 2DIKA 4H9VA 1NP2A 3TFXA 1YTKA 6TIMA 3T42A 4TMBA 1KXHA 3U5UA 2VHLA 5C9XA 2YDSA 3BC9A 1RVKA 3POHA 4H2HA 4PB3A 2GGHA 4A2RA 4BR1A 4NNBA 3K2GA 1DBTA 3WSUA 3ARPA 4B5VA 5CPSA 1XSKA 4PMDA 3FCPA 4S3GA 1TZ7A 2XVPA 1KLYA 5B7YA 4LFYA 5D9NA 3REQB 5CBIA 4NI3A 5HXMA 3S1UA 3E1F1 4HNVA 1D7KA 1FXPA 3RX3A 3BH4A 1KFEA 4PMXA 3MW7A 3F5LA 5I3IA 2DGAA 3A22A 1KFCA 1QHOA 2VC7A 2E8YA 3N2XA 1BXCA 2C0AA 2FQIA 3PPHA 1BXNA 4YCPA 1OB0A 2HXTA 3ITCA 3VM7A 1B9BA 1G0CA 3N34A 4A8IA 3ZS4A 1VYSX 4EWND 2QVNA 2VURA 4LVGA 2FYMA 1UR3M 1ISYA 4H8VA 3PJUA 2BB0A 3WLSA 1VD6A 4I9JA 1C8XA 1JRCA 1R3RA 2WM1A 1JZ8A 1EOKA 1XUUA 1ZY9A 3TU9A 1ALDA 1XLKA 2XG9A 2WVVB 3LSBA 3QTGA 1XIFA 4D1JA 2CHRA 5CGMA 2XIMA 4O12A 1MWOA 2R1NA 3QMSA 4WD0A 5HQEA 3N2TA 3B4YA 1Q2SA 1S2WA 2DU2A 6XIAA 3F2DA 3IJ7A 1DTNA 2W27A 1AA1B 3EX3A 3ID7A 1X38A 1JPKA 1B3OA 1HO4A 1YHTA 3GNXA 4EAMA 5C9WA 1ZP3A 5A8GA 2E6DA 1EZ2A 2WSRA 4LYPA 4WX2A 4N9CA 1OWQA 3MP4A 1W1B1 1Z41A 6A3HA 3S46A 1PX3A 1XF0A 4GINA 2HS6A 2VJXA 4IMCA 4HJFA 3L66A 5A5WA 1XYCA 1EO5A 2XH0A 1K1DA 1C8YA 4OHQA 1E0VA 1HL9A 1KWGA 2P88A 3VTRA 4XBSA 3APTA 3OB8A 1KRAC 1U1HA 4AWEA 2YXXA 4NZCA 2V5BA 1H7NA 1QVBA 2TAAA 4H04A 1E55A 4MHBA 3CAKA 2VR4A 3UY8A 3SCQA 4V27A 1WBJA 5FJJA 1PKNA 1UQYA 4TV6A 1MUWA 2UWFA 4UNLA 3ZR5A 3EX4A 3EWWA 3BLOA 1VCFA 2Q71A 3ITVA 4WKHA 3N04A 3S6TA 1EDQA 3GB6A 1BRLB 4LTSA 4LYRA 1K9FA 3EWZA 1FWWA 1XLLA 5BXRA 5JUVA 1C91A 3QKEA 4A2SA 3LQLA 4C6KA 1ME7A 1FWFC 3PWGA 2DSVA 4QQ3A 3KX6A 4DLFA 3LCXA 3OLIA 3KDOA 1ZJAA 3R10A 5F2LA 2RGLA 1XDLA 3EB4A 2ZTKA 2Y7EA 3G1YA 4U31A 4RDVA 3DOPA 4ZOCA 1NARA 2CKSA 1PZ3A 1F3XA 1T5AA 1CZ1A 1FH9A 1H11A 4UTUA 3MHUA 4PH6A 5ABGA 5CPLA 3M5ZA 5AZ1A 3C2FA 4KKXA 1KGXA 3WCZA 1GVSA 3V0UA 2OOGA 4NJGA 1WDSA 3QXBA 4S3EA 2V63A 3EWDA 3WBYA 4JHZA 4A6GA 4U2ZA 2ISDA 4JPGA 1R46A 5HUOA 1YW1A 2BBFA 4OE7A 5I78A 4E0CA 1XLIA 4WSKA 3MUY1 5JXQA 2WHJA 1RQHA 1P5BA 3TKFA 4FOJA 2Y88A 5CAHA 3QC0A 4J40A 3EDEA 1O5KA 3UFYA 5D2YA 1KFJA 4AXKA 3WLQA 3RK8A 5AC8A 1A47A 3CO4A 4IWWA 2E28A 1JZ6A 2G0WA 4M56A 2E5BA 3GH5A 3MYOA 3O63A 3TTOA 4HSOA 2OKTA 1XBZA 5A6BA 1JYXA 4QM1A 2FFIA 1E6PA 1SYTA 4I5UA 5TQLA 1KFBA 1S3HA 2P8BA 3B97A 2CC0A 5U4NA 4LUSA 1V0MA 1ODUA 1XBVA 2ZXAA 4UQEA 8A3HA 3OLGA 4H8NA 1GWJA 1MNSA 4KH2A 2DVTA 4UTIA 1EP3A 1CLKA 3Q65A 3TMLA 3QHOA 3FYPA 1ZBCA 2FDMA 3WMLA 3PUEA 3B9EA 2ZCGA 3C6CA 2OLSA 3OPSA 2YYTA 3W72A 3EPMA 3FIGA 2BWGA 1CGYA 3CM4A 4XZHA 1PUDA 5HPCA 4HPHA 1TREA 3IAQA 4GUIA 1F61A 3W7EA 3WMBA 4M0XA 3AYSA 1PO9A 2QMKA 3OHIA 9RUBA 4PZVA 2CETA 3NJ3A 2WJZA 2BLEA 3H4XA 5B7ZA 2X2GA 2NQHA 3QR0A 2NVAA 4XAFA 2ZE3A 2XN2A 5DMMA 3E96A 3MJMA 4ZTYA 3G1DA 2BSLA 2DY3A 2PWHA 3AFBA 4PC8A 4DWSC 4Z0SA 3S5YA 3W02A 1TPC1 2J27A 4ZOBA 2VP8A 3GXMA 5LHEA 1HKJA 2EJ1A 3WFAA 3INPA 1NQKA 2Z29A 3W7MA 3VUSA 1XJBA 3GDKA 3PZOA 1GTEA 3B8UA 3EKGA 4P5UA 4PBGA 1MEHA 4MFDA 1FWBC 3UJFA 4DX3A 3GHSA 4F2TA 2Z26A 2FH8A 3WLKX 3KUMA 4RNJA 3TQ0A 1UBPC 2QJNA 1Z69A 3BW2A 2ZZ6A 2G3NA 5C54A 4W84A 2QKFA 3LBMA 1KCXA 3BAYA 3RLGA 4CU6A 3H7UA 3CUGA 3NL2A 2YB1A 3LGGA 2UY2A 4XV0A 2V67A 2Y6ZA 1OBAA 3E2QA 4BWLA 1Q6FA 1QPOA 1GUVA 4N9BA 4ZB5A 1BWVA 2NUWA 2EG6A 4KQNA 1EJVC 4HSNA 2ISWA 2HNHA 1Z32X 2WVUA 2ZZ5A 1SSGA 3FXYA 1ONRA 3TC3A 3WNNA 1ICQA 4MOZA 1G4PA 1X97A 1FY6A 5FJRA 2AKZA 2FZNA 2IKJA 1KKOA 1CGXA 2AOSA 4B9YA 3OODA 2JQXA 1UP3A 2NUXA 3NQBA 3A3XA 4XVEA 1Z44A 3MUCA 4EVZA 4CCCA 1H1NA 2VZOA 4IZGA 3H54A 1F7BA 2QIIA 1XLGA 4O8AA 1K4HA 3N2CA 1MYRA 2CEQA 3MKVA 3U7BA 1XL9A 3CLMA 1SFJA 1T0OA 4H6EA 3THQA 3OQ8A 8CGTA 2A3HA 4D6FA 2VEFA 5IBXA 2OZ3A 1AUSL 3VZXA 3A6OA 4MKSA 2YDRA 4HMCA 1XPGA 4HOZA 4G7EA 1J12A 4LNCA 2PDIA 3URBA 5ABFA 3CB3A 3BTNA 2CIPA 5C2CA 3W7GA 2DEPA 3B0YA 3MMWA 2WV8A 2HEJA 2YCLB 3N25A 2BNJA 3FJNA 2A6LA 4B3KA 2Y24A 3KRSA 4I6VA 1ZHAA 1JF6A 1DIKA 4Z2JA 3SRHA 4OIFA 4LVDA 1WV2A 4D9PA 1A5LC 3M0VA 4PMQA 1S1RA 3QV7A 4L5ZA 3GKFA 3WO8A 3FSUA 1BWKA 3EEZA 2A1YA 3I6TA 4LUJA 3SUWA 1CTNA 3V18A 3C0SA 1VKFA 4D6EA 4ICCX 2FJKA 3GIYA 2QDDA 4NZ5A 1EJRC 4XIMA 2V69A 3LCFA 2BHZA 4HCLA 3VK5A 3KLKA 4X61A 3S5OA 1C7SA 3VOIA 2VX7A 3HZ3A 3C2VA 3VNDA 1Q6EA 2V5JA 2NV1A 3B06A 2O7QA 3CZ8A 2WMKA 1SJAA 1E5NA 4ZFMA 4CNOA 3W82A 1FHUA 1HF6A 5CSUA 1EC7A 4YYFA 4CQCA 5MF5A 2PTWA 1AVAA 3KCLA 3L67A 4ZO7A 3MI6A 3S5ZA 2HSAA 1SUXA 1TO3A 2BHYA 1WYIA 3O0FA 4IFKB 2VKZG 3TWBA 3N2OA 2OT0A 2VEGA 2B7NA 1C3FA 2XM1A 1YE6A 1EGZA 4CQ8A 1CW2A 2PDKA 1F6YA 4F0MA 3QF0A 4LYQA 5A2CA 4ZSUA 1R8LA 4B2DD 1MUMA 2FZ8A 1W2VA 3WEOA 1R7AA 4HKPA 3CEUA 5AC5A 2C1GA 3UG5A 3WLOA 4KFPA 3L21A 2JIEA 2Z24A 3A64A 1AW1A 1ZZMA 3FYOA 2H9AB 2VO5A 3H2MA 2NX3A 3UWUA 5CC3A 1MFVA 3PUDA 3MP5A 1EJWC 5FIPA 3H8AA 3PUGA 3L9CA 5M03A 1GKQA 1E56A 1L2QA 1IT0A 2V68A 1ZU8A 3S2MA 2F8QA 1CGVA 4KWSA 1Y5XA 4KRZA 1HNYA 5AB3A 3NM1A 1KKRA 2Q8XA 1K7FA 4H8HA 1IT7A 5REQA 1Q6RA 3CGTA 1PV8A 1QNPA 3POCA 2VI0A 3ATZA 3D3AA 3ENLA 5F2MA 3W22A 3TIMA 1S3TC 1VFHA 5K9XA 4RPPA 3SUSA 4K8GA 4N4QA 5DCDA 3UYCA 2FDSA 3PJWA 4MNLA 2QPUA 2YCLA 3DFOA 1E0XA 4JYDA 4JQ1A 2QGHA 2JIWA 1LWHA 4D8ZA 1HKVA 3CQIA 1BKSA 3MP3A 1YXDA 1BGGA 5AYXA 1EDGA 2WPBA 4UR8A 4FAMA 1DWAM 4UTWC 3WX7A 4H8UA 3HJEA 4NVTA 3GTXA 2VWTA 1TA3A 3N6QA 9XIAA 1UIOA 3E12A 4GUFA 4UUIA 4M6PA 4WJEA 2OGYA 4I8DA 1A4LA 3EWUA 1TKKA 4HJWA 2X1UA 2Z00A 2I9UA 2OFJA 2AKMA 4MWAB 3GG1A 1BF2A 4YXGA 1XISA 3KZSA 4OBTA 1RZMA 4IIHA 4UTKA 1YXCA 4LS1A 3GVRA 3TSDA 2I7GA 2NVCA 5AHMA 3DIPA 1B3YA 1B1YA 3STFA 4W87A 4DB7A 1HL2A 3ANVA 4MJMA 1JD9A 1ADDA 1CEOA 3IIVA 1A0DA 3IVSA 3GH4A 1LUCB 4MNKA 3H6OA 2J75A 2RAGA 4G8TA 1AL7A 3PANA 5ENLA 2PDGA 1I60A 5DXXA 4QE5A 2PDWA 4US5A 2WXDM 4HN8A 1HP4A 3W88A 5M2FX 3U6WA 4DF0A 3BAJA 4KMQA 4GC3A 3V36A 1CLVA 4F79A 3MO7A 3ZYZA 3BGAA 1H49A 5FACA 2OB3A 3F5KA 1EJXC 5AHFA 3C3NA 1JZ2A 1A50A 2Z2UA 4PCPA 2O56A 3FAWA 3VXGA 4PRWA 3T6CA 3WMCA 2J6VA 3NQ8A 4J9JA 4H7VA 2OXNA 5CLWA 2EJAA 3PS7A 2Y70A 1XIMA 5FEZA 1EXPA 4ZQMA 1XGZA 3S83A 1E6QM 1TIWA 4AISA 3OG3A 1XIHA 3TR9A 4LRTA 4CQBA 3QFEA 1K8XA 3BZGA 1PAMA 1RHCA 1TB3A 3FW6A 4G9PA 2IQTA 4RV3A 5H8PA 1DJZA 1TX0A 1ZAHA 1YXYA 2QLYA 2VVNA 4S3BA 1ONEA 1Z9AA 3GQYA 5E0KA 5AVHA 3E2SA 1TSIA 1GVEA 5BYWA 1UWTA 1VEOA 2B7PA 4PCFA 4GO9A 1ZLPA 1G69A 1KRCC 3P67A 1OCNA 3TCEA 2HVMA 3SN0A 3G6MA 1BYCA 1RQBA 5T91A 4MY9A 1I0DA 1TELA 2E25A 4EXAA 5HPOA 3GIPA 4IOTA 4PUEA 4J28A 2ZWZA 2ZX7A 4TTGA 4UTWA 1XDJA 1UA7A 3S2LA 1A5OC 2Z2AA 1UCWA 2IW0A 3C86A 3BLLA 4IFOA 1WXJA 2NUYA 1N55A 3GNNA 1R9YA 2P10A 5HDRA 4AVOA 1AZ2A 1UUOA 2NV9A 1GOKA 1W1VA 1JZ7A 2OYKA 4N2YA 3STCA 4PSRA 1UWAA 1MMFA 4HU8A 3NQAA 5FSDC 5GQBA 3WLTA 6XIMA 5F1VA 4GI6A 5HNTA 3JR2A 3NIYA 3B04A 4JQ4A 3THDA 1D3CA 4R7JA 3TJXA 1GVFA 5A8NA 3CASA 3VNIA 4A3RA 1ZB5A 4FXRA 2TYSA 5I3KA 1FWRA 4UQ9A 3OW1A 1R5YA 1E71M 1JDDA 2QV4A 1O6IA 5DRCA 3QTPA 3SCPA 4OUIA 1C29A 4FXSA 3BANA 1UROA 4ENLA 1DJIA 1OFEA 3AMGA 2Y7DA 4C1KA 3LHTA 3W7RA 3AO0A 1JPDX 3KL5A 4L1WA 2XIOA 1BWLA 3ERPA 4UFJA 1TPH1 3MB9A 3W87A 2DH2A 2QCEA 5CZTA 1ZBWA 1GVOA 1FVPA 4LUYA 3WNLA 3ZJ6A 3N18A 3TXVA 2X0HA 4W88A 1SO4A 4HNCA 3WBEA 5CPOA 3S1WA 3AWNA 1IGWA 4K38A 1DE5A 5A6BD 1S2TA 4CNTA 3CUFA 1HGWA 1RD5A 4ZMGA 1H7XA 5CZSA 2B0MA 1YPXA 3AXKA 4YL2A 2X30A 3WDQA 4QLLA 1KM5A 3F4CA 3RJYA 4H6RA 1W9VA 1FXQA 1JR1A 1BEUA 4A35A 4I5RA 2B7QA 4OBSA 3M43A 1DPMA 2QCNA 4DRSA 4GJIA 3GTIA 3LTSA 4XISA 4GKTA 2FTYA 3VAVA 4JTHA 1O60A 1VRDA 2OYMA 2ZZ2A 4XZMX 1W5MA 3L0NA 3SW6A 4AUBA 3FEQA 6ALDA 1W31A 3VVGA 1W54A 4DZAA 3ATYA 3K4WA 1R9ZA 1OM0A 1XQKA 3QW4B 2ACQA 1KM0A 4HMEA 5MKGB 4MWAA 3GNRA 1FWAC 5AHLA 5HWJA 1J2BA 1FH8A 4L56A 3U2EA 1FP9A 2CBVA 2GVEA 4B15A 1NWUA 5IBXC 3BCFA 2W66A 4M7SA 1Q6OA 2X2YA 4BF7A 3GKAA 3W28A 4CVWA 1QPNA 3HB9A 5I07A 4R5EA 1MFUA 1V3LA 2POZA 4ORIA 2PF8A 5BNKA 2DH3A 5F2GA 4PULA 4XKMA 4CD8A 5BXTA 3CH9A 3VIFA 1XYMA 2DFAA 3GO2A 1JD7A 4H9XA 4LVAA 2WBGA 2PDJA 3KBWA 2Z7GA 3UEQA 1PIIA 1QJWA 3LPPA 3U3HA 3YPIA 2OWWA 3B40A 3OZYA 3UNDA 4NSBA 1MI3A 5AZ0A 2W61A 1H61A 4PFHA 3U8GA 4AZ6A 3TC7A 4JFUA 1GGOA 2WHMA 4ERAA 2PAJA 5A8PA 4DBDA 4D6IA 1UWQA 2WJDA 1K9DA 4IGSA 3ONCA 1A5KC 4O1FA 2WB5A 1PHQA 1JG9A 1GK8A 4WCJA 3LMYA 3CUJA 3M0ZA 2EG8A 4YTUA 4MWAE 4XTIA 4EPBC 4V33A 3RGTA 1GOWA 4H3DA 2DW7A 1RQEA 2VDGA 2MANA 2QCDA 5EB8A 3DFTA 2BODX 4DUXA 4RXFA 3WH6A 5I79A 1BLIA 3A9IA 2F38A 1T6MA 1EUNA 2Q6ZA 1UD5A 3PFRA 1IEXA 4GQGA 3MWCA 2Z4GA 3O05A 5CPQA 5D32A 2Q8LA 3HMCA 3S3GA 5D02A 4UNKA 4EWJA 2VMFA 3M64A 5E0CA 1J10A 1S38A 4JL2A 4JFTA 4G2DA 1POJA 1O7AA 2EQDA 2WC3A 2PTDA 4PTVA 2BVDA 1A5MC 4OZOA 1W3KA 2W67A 4PCTA 3HQ1A 3ONBA 3RR1A 5A6KA 3RJXA 4A05A 4A22A 3GC4A 1H3GA 4UTFA 1XYFA 3U4AA 3GDMA 3PTDA 1RK6A 4RX0A 3UWYA 4RZ5A 3UWQA 2Y5EA 4W89A 3ZT7A 4YTTA 1FWNA 4BF9A 3TA6A 1DWGM 1EX5A 4UQDA 3TW7A 3W0KA 4N6EA 1BGAA 2HNEA 2WJFA 4HCHA 3ZR6A 4YU1A 3DN5A 4K68A 4EPKA 1RY8A 3RHGA 5A94A 3WD2A 1Q13A 3W6LA 2JGQA 4Q8VA 5G5IA 2QULA 3WIJA 4QEEA 4O11A 3VCNA 1HL8A 1TV7A 1GZ1A 3MSYA 5E6ZA 2D1ZA 5KEZA 1ICSA 1H5VA 1VEMA 3ARYA 4NRSA 2CCRA 4JGDA 5C2XA 3CL7A 1P0NA 5BU6A 1MDLA 1QBBA 4ZO8A 4NI8A 3C3UA 2ZDSA 3N6HA 2XSXA 5DF0A 2E3ZA 5HNNA 1RJRA 4DF2A 3S5SA 4AF0B 3W7IA 4BKNA 4DPPA 3DHDA 5A8MA 1F07A 4PSPA 3OGSA 3G2GA 4F0LA 1QWGA 2AAAA 2E40A 4HK6A 3OZMA 1QW8A 1CYGA 1RAKA 4J5NA 1VBHA 1JAKA 3CAQA 3L68A 3E0LA 5D9PA 2V81A 1MRAA 1DIEA 2NW0A 3FA4A 1C90A 3BG3A 1N8FA 2DSUA 2PA6A 3KZPA 2J88A 4Y9OA 2WLZA 1W8GA 3DFYA 4U4MA 4HYRA 3KVKA 3QYQA 3SSJA 3WH8A 2CZEA 2OWXA 5EPDA 2WMJA 7TIMA 2VX4A 3L5LA 2R9RA 2PU0A 3TYAA 3R0UA 4M5PA 4GX9A 1O1ZA 3LPOA 4C7FA 3NUKA 4QNEA 1XH1A 3VGBA 4MLRA 5G4WA 3ARRA 1F8MA 4NAEA 5DCEA 4LGXA 1G4TA 2R14A 1WP6A 3RRXA 1I2RA 1IWPA 4L4OA 1M53A 3EYPA 2P5NA 4MWAD 4ES4A 3WLHA 3WNMA 4KS0A 5EBUA 5HINA 1U33A 1ODZA 2E9BA 5G1TA 2R1MA 4YN5A 4R7OA 1PS9A 2ACSA 4O4VA 3LHYA 2PCQA 4O19A 2R1KA 3RFAA 2OVLA 4FK9A 3STEA 2R1LA 5F4XA 1VFSA 4FOUA 1ML1A 1XLFA 1UIPA 4UTMA 2G41A 2F2HA 3U7VA 1GJWA 1KXQA 3VA8A 1I1XA 4GYPA 3NQ2A 1J01A 1LRQA 1L8NA 1OZMA 2XM2A 2ZUNA 3R0KA 4P8UA 3GS6A 1M7XA 4OOZA 2BTMA 3PAJA 2ISSA 4B16A 5IDZA 4DPQA 3TA9A 2HWGA 3GXTA 1W17A 1RPKA 3NA8A 4IMFA 3APYA 3FKKA 1VQTA 3AIWA 4IPLA 1S46A 4GX8A 5I3DA 3PWAA 4N7QA 1NDYA 3P0WA 3WQPA 3W7DA 3EDJA 3ARQA 2BVWA 4GIYA 2Z1SA 2IKHA 2E09A 2DUXA 1EPVA 2WVVA 4HYWA 2GK1A 3AZRA 4GXPA 3DZ1A 4L61A 1S5VA 4JEJA 3QGAC 3L2LA 3EWXA 3BW3A 4MUZA 4B5NA 5E9XA 1RJPA 1LG2A 2EF9A 3WUBA 3M07A 2OGJA 3W07A 4JZ5A 1BQCA 5EYWA 3CHFA 1V0NA 3GFZA 3W73A 5TF0A 3BLFA 3QPYA 5E1QA 5I3FA 3A5VA 3BLPX 2GQ3A 4S1FA 1F3TA 3CAWA 1OJXA 2QPXA 3N2MA 4NZJA 5BZAA 1H4PA 3V75A 1MXDA 5FF4A 2QV5A 3MU7A 3NPUA 1V3IA 3QLLA 1W5OA 4UIOA 3TSMA 1UD4A 3OU8A 3T4CA 2VFEA 3SFWA 1HVXA 3GAKA 5FF2A 4GZ7A 1E72M 4V1YA 5FJOA 3PG8A 3SY8A 2A0NA 3M4HA 1IE7C 5M17A 4ONVA 3FA5A 1DL3A 4Q6XA 3NQCA 1B54A 1ICPA 3UT0A 3GR4A 3ICJA 4JN6A 3BICA 4A3UA 2I56A 2QF8A 2C71A 4Z1BA 1SMAA 2PWDA 3VD9A 5JBFA 4PTMA 4AFYA 4HNLA 5MKGA 3WD0A 2XVGA 2V82A 3L12A 5BXSA 4ZQRA 3RMJA 1R6WA 1UPPA 4OOUA 4D8LA 1OK6A 3KBNA 3FJ4A 4HHPA 3L0KA 2J47A 4NYYA 3K1GA 3WK0A 3Q94A 2W92A 2HQAA 1LQ2A 2VTFA 3G0XA 5DT5A 4FI4A 2J6XA 4EPEC 3TDFA 4ADTA 4CNNA 1UJPA 1F76A 4L7ZA 3BGJA 3DECA 1IZKA 1K77A 2IS7A 3PSWA 2PDUA 1J11A 4CD6A 4WLCA 4O50A 3T8QA 4AU0A 3IGHX 3WJXA 1GW1A 1O1HA 3BO9A 4WY0F 4JN8A 3VOCA 4GI9A 1EEPA 4KESA 1ENUA 4HU0A 2UV8G 2H6RA 4LS2A 3BE7A 4QIUA 4XK2A 5HANA 3TV8A 3AROA 4S3JA 1GVYA 5HAOA 1FOBA 2OLHA 3NCOA 1K7EA 2Y61A 3WLNA 2VGIA 3KWXA 1BHGA 3M16A 4PN2A 3QSTA 2QJMA 3LMZA 4FO4A 2H8XA 4JKMA 4K39A 4P61A 1TUFA 1VPXA 5D2VA 3K8MA 3EPOA 1BPLB 2X1SA 3RIKA 4U10A 3IUIA 3CHDA 2ZVRA 4ZE4A 2OTDA 4O57A 4GJJA 2Q09A 4YS1A 3PG9A 5EGRA 7A3HA 3K8LA 4RDYA 1PWLA 4CU8A 3P80A 4HPNA 6CGTA 1YNPA 3W6MA 2VOTA 1O5XA 3OVGA 4C6OA 2NLIA 1XSJA 2ZKMX 4LAZA 5LXEA 4C1NB 1PKMA 3G1SA 2J7EA 4Q4MA 3QV6A 1WDPA 4R9XA 4PMRA 1UZ4A 3RCYA 3RM4A 2QDHA 1LM1A 4Q8NA 1WZLA 1GQJA 5E9AA 4AIBA 2WVSA 3M0IA 5CAKA 5I02A 3UA4A 4UZSA 1HUVA 1ZTVA 3E49A 4IMEA 1V6XA 2YL8A 3PZ9A 4JIHA 3HOJA 1XCFA 1VGAA 1SMDA 2VYOA 3K4DA 1SO3A 5CJMA 1X98A 3QBUA 4FF5A 4FIRA 1G5AA 1LWJA 2VGBA 5DEZA 1LLZA 2XGIA 4LC8A 2VCCA 3R89A 2PLCA 1R3VA 1SZRA 1HO1A 4DZIA 4JTSA 4AZCA 4YTQA 3KLLA 1RV8A 2W0UA 4B2DA 3UPMA 4PUKA 4C6PA 2NQZA 3E2RA 2P8CA 3FK4A 4QCFA 4IMDA 4CD4A 1UHVA 5LNSA 2OZTA 3UJ2A 4B3LA 1VIZA 1GG1A 1V03A 4GVHA 1SPQA 4S39A 3FY1A 4GACA 1IIHA 3GDLA 1EIXA 4CCEA 3GDBA 4AAJA 2Y62A 4YVPA 1ITCA 3W81A 2GL5A 4QTGA 1I45A 4LYKA 3UW6A 3OP2A 5TAOA 3T40A 3UF9A 4B5WA 1DORA 3UCCA 4DZHA 1W3TA 2J8FA 4FNPA 3SUVA 2HJPA 3SN1A 4DJEA 4X0NA 3KWSA 3MUXA 3WENA 4AQLA 2PMQA 4QCEA 4WDTA 2VFFA 3JU2A 3NDZA 4GWEA 1EWDA 2V3DA 3CUIA 2O0TA 4BQ4A 4HMNA 1VJIA 3MCOA 3H4WA 3VKCA 1QNSA 2XFFA 4WHBA 2XH4A 1AJZA 2NT1A 4DWSA 2JGYA 5DBUA 2OSXA 2ZA3A 1QW9A 1TZ9A 3G6LA 3AOFA 1N2VA 2YXGA 2C79A 4R9OA 3H55A 3LGDA 3LBCA 1C7TA 5AVNA 5D9MA 1X7IA 3WEZA 1F6KA 4BQ5A 2OQYA 2YFNA 5F1UA 3GU2A 3GW3A 4PBFA 3LENA 1ZP4A 5IDIA 2FHBA 3A12A 1VIWA 2V8ZA 4DO7A 1XLMA 3CT7A 5IHRA 2V30A 4JTRA 1OD8A 4Q8OA 3NZ1A 3ZLGA 1S1PA 3NTYA 5CCZA 1XIIA 3UWWA 4LCSA 3KOFA 3MT1A 1D9EA 3ABRA 4E4FA 3KHDA 2C19A 4I8YA 3W2JA 3RXZA 3SDOA 4JNYA 1JULA 3L4UA 4RW3A 4S3DA 5HQMA 4X9SA 4Q7NA 1I0BA 4F40A 1WKYA 4MPQA 1KCKA 3CLWA 1SU5A 1HXJA 3BAWA 1V93A 1F6PA 2PDCA 1FUYA 2BFGA 2F2KA 5I3JA 1V6WA 1Q4WA 4CKQA 2WMIA 3TTYA 3NWRA 4QP0A 1MW3A 3SN4A 3W74A 5DX7A 4AEEA 3BAKA 2A5HA 2DPEA 3S5NA 2MUCA 3SRDA 3AAMA 4EXBA 2Y63A 3HG3A 3GR8A 4Z2LA 6ENLA 3S2NA 2A79A 1M7PA 4NNAA 5EMLA 4QS6A 3MANA 4JTUA 4U5KA 3DC8A 2DQWA 1TFVA 3WL0A 5G1YA 4O0QA 5E5CA 5FSEC 3DFSA 5A1AA 3GR7A 2PWUA 4XSMA 4C6JA 3P93A 1YEYA 3AHVA 3NL3A 1VPYA 1ZCCA 3PZNA 3BCDA 3DFNA 5PTDA 4IL2A 1JCTA 1FWJC 2V0TA 3ARWA 4JFWA 4K7VA 4TVDA 1T96A 4DZ5A 2YZRA 1AH3A 1W5PA 1UP2A 4V15A 4PL2A 1LOLA 1EEXA 4XQ6A 2QCMA 3MS8A 2X16A 1E4NA 3AZSA 1VFOA 3C2EA 1P1XA 2EKGA 3JS3A 3GC5A 3UU0A 4UCGA 4X60A 5A6LA 3LX9A 4DF1A 1YX1A 4DJEC 4LQ1A 2AMGA 1SJBA 5M3WA 4J3VA 3WK3A 2TRSA 1G6CA 3HO8A 4O54A 1M65A 2G4JA 1EC9A 2D24A 4XZNX 3E9AA 1BTMA 2WK2A 3IJ9A 2NVDA 4U28A 3OOQA 4RNFA 1JDFA 1AW5A 3H2CA 4K6AA 1QNRA 1WX0A 1YTEA 2RGMA 5FJUA 1OFDA 4HA4A 2QCHA 2Y5JA 5CPMA 1B4EA 4FA3A 4UB9A 2DSKA 3CL6A 4QJ4B 4KWVA 4DBUA 2XDFA 3DGRA 4AX6A 3P3BA 4WDUA 3KTSA 5E70A 1PYMA 1Q65A 2OZ0A 3L2IA 5BCAA 3EOUA 4IPPA 4TV5A 1NF7A 3CUXA 1T40A 2Y7FA 3WYZA 3U2ZA 2H90A 1FDZA 2PDYA 4IX0A 4HT3A 4IIGA 4YIWA 3LRLA 4HPJA 5LA0A 3MSDA 3TCSA 3UJSA 3ARUA 1E4MM 3W53A 3THAA 3WQFA 1Q6DA 3MVTA 4DY1A 4L6HA 3W1PA 3NZGA 1J2WA 1WB0A 3VKAA 2PDHA 1TQXA 2REQA 3R8GA 3LU2A 1DEDA 3BMWA 1F73A 3EDFA 2ABBA 1UKOA 3WDHA 1K3UA 5BRBA 2BX7A 3NDYA 4Q4OA 1BFNA 3IRSA 2JKEA 2VNCA 5C7VA 1DKWA 3NNTA 1HT6A 1YDYA 3LCGA 3FVMA 1R3WA 5CZKA 3O06A 3R2GA 3ZSSA 2P0IA 4FB7A 4O16A 1F05A 2QAPA 4UBPC 4HHLA 1UWIA 3N14A 1G94A 3IARA 5REQB 1EF3A 2VL4A 1TJPA 3L4XA 3GG7A 4AWUA 2IQDA 3O9NA 4Z2IA 1XIBA 1CXKA 1JFHA 2XIQA 1HKKA 3PC0A 5KTLA 4D8AA 4Z1CA 3UZYA 2NX1A 1JCJA 2BV9A 3M0MA 5C6MA 1NOWA 4EIVA 3BOXA 3CZJA 1TG7A 2A4AA 4PL1A 3BOFA 1L6WA 4JIQA 4Z2GA 2EPLX 2BOFX 3CYJA 5KINA 1DTUA 5E09A 4PTXA 4CUCA 5AN7A 2IPGA 4TO8A 1OZQA 2E5CA 1GHRA 1XLBA 1WZMA 3P5YA 1PVNA 3UR7A 3BOLA 3HMJG 3HV9A 3S0CA 4LF2A 2PPGA 2ZUVA 3W86A 3WH5A 2CZFA 4UQBA 3AALA 3KBMA 1DYSA 1AODA 4BWLC 4LSBA 3HPXA 3LQGA 4ZE5A 1DP0A 4KWUA 5IFTA 2GOKA 2C8NA 1B3ZA 1OX6A 3H70A 2FGLA 4WUIA 4TMCA 2EGZA 3VNLA 4JR5A 2INZA 3BK0A 4S38A 4XZIA 4UFKA 1E9ZB 5D8ZA 5ECVA 2OWCA 1OQFA 1PZ1A 2GGIA 1MXSA 1UKSA 1MQPA 1QOXA 2CFFA 2XSBA 9CGTA 3NZPA 4QDMA 2R6OA 2ZZ4A 1LDCA 4C65A 4JKKA 3P14A 1PBGA 2XFYA 1EQCA 4PTNA 5BROA 3MI3A 2VDHA 3FEMA 1QR7A 1QOPA 1FP8A 2V9DA 2X0SA 4YJ5A 4JTKA 1R85A 1AW2A 3ZFHA 3NQGA 2J78A 3MDUA 2AQWA 2QDGA 2XWDA 3COTA 3MUAA 3R11A 3PSVA 4KEVA 1CXIA 5H91A 2WAGA 1IEQA 2A7RA 3LCWA 4TX8A 2E9MA 4E38A 1KCZA 2D0HA 3GBDA 3DHFA 3ABQA 2BY1A 1EF2A 3BMVA 3N13A 4HB7A 4MNJA 4OECA 4LXFA 3VIPA 1W9XA 3W85A 4XZLX 2A3EA 1RD6A 3HFYA 4RCXA 3J7HA 1S5WA 4JD4A 5FD0A 3W2KA 3M0KA 4FNUA 3RILA 1QHPA 5BMXA 1XD0A 3VGFA 4BZYA 3S4TA 1JCLA 5EKYA 4XKYA 4GY0A 2BY0A 1P4CA 4UNIA 5FAJA 1V02A 4MB5A 1A49A 2PWVA 2UZ9A 4HSHA 4YYCA 4WRHA 5C55A 4P7NA 4X2PA 2VEPA 2HPMA 3UP8A 4DAIA 2GFTA 3EZ4A 2AL2A 3LXBA 4XKYB 4S23A 4MYXA 3SUTA 2ZRYA 5G2IA 5C9UA 3QY6A 2EG7A 3BXWA 4FNTA 4GK8A 2R94A 2WWDA 4W7WA 3RDKA 1JZ5A 1E0TA 1HP5A 1EGMA 1ZBKA 2OEMA 3DI0A 3H53A 3PVFA 1GTHA 3G5EA 4HYVA 2J77A 2POTA 3WFZA 2VENA 2FZ9A 4M6UA 3QH2A 1EJSC 1R2TA 3I6RA 2VX6A 3TN3A 3SCUA 1W91A 3WF0A 4DBEA 3UCDA 4KPLA 4KCUA 2E67A 2Q8ZA 3LN3A 5XIAA 3EAUA 4P2VA 1PHWA 3WFLA 2JF6A 3BW4A 2PU1A 5AHEA 3QC3A 5F4SA 4NYUA 4ATLA 5BOOA 3VINA 4I9MA 3DEQA 4ROPA 1VYPX 4F2UA 1TIMA 1YNYA 1IIGA 4Y8EA 2IXVA 3T07A 2WYSA 2JBMA 4HOXA 3VMNA 3FYYA 2QYGA 3GVQA 1JNDA 2JEQA 3WD1A 4JTJA 2FMOA 1M1BA 3BL3A 3WNPA 1O4UA 4Z1DA 4I6KA 3MUZ1 2GDUA 1FWDC 1J6PA 5KITA 2XWEA 4FLQA 1W3NA 2ZZ3A 4J1OA 2D3LA 1TRIA 1F8IA 2PTXA 3AHZA 4UOJA 1I8JA 1L0PA 4GZEA 1DJXA 1UD8A 3FS2A 4RR4A 4MKNA 1E6SM 4JTEA 4DVOA 5LSMA 3UJEA 1WNOA 1DE6A 3AXMA 3CUHA 2VC9A 2PGFA 4RPQA 3XISA 2BASA 1A3XA 2FHCA 3GZ3A 5I7GA 3M9YA 3N19B 2D2OA 3IVTA 3E0IA 2F6UA 1LBFA 4ZODA 3CHVA 4FMVA 3RPDA 4DBWA 4NF7A 5DXYA 3DH7A 4LUTB 1EA0A 5HWMA 1KM6A 2IMRA 4UFIA 3VD5A 2HK1A 3KVMA 4AD5A 4IIBA 4TTUA 5A2AA 2X40A 4LV9A 1S5MA 4YMZA 5D37A 5XINA 1AZ1A 4KCWA 3M0XA 4EAYA 2Q3OA 3UWVA 2Z1KA 3A13A 2PD5A 3T2PA 2FGZA 3CQHA 1EQPA 4Y6GA 3N9SA 3RYSA 4FNRA 3Q58A 5M1TA 4LB3A 4EE9A 1TJ2A 2ZADA 3QPEA 3TYCA 2A2IA 2RUSA 3SIMA 2OSWA 7CGTA 2O9OA 2IPWA 3CWNA 1H5YA 4QRNA 1FH7A 4RW5A 4QJ3B 3CJPA 3HPAA 2DJLA 5HR6A 1UW9A 4UWMA 3ES7A 3C8NA 4QLKA 3TFCA 2PDXA 1A5AA 3M6YA 3Q67A 3MYPA 3CIXA 3CV2A 1WAUA 1M5WA 2C6QA 2FLIA 2E8ZA 3QMTA 3WQ8A 1ZBVA 4I5XA 3ZZ1A 1R38A 1J0ZA 1Q85A 3EB3A 3UESA 1LROA 1UBSA 3QLDA 4H9TA 1YDNA 1J6OA 4ZENA 3KS5A 3B8WA 4AHPA 5HJXA 3V5CA 1WOAA 5L6UA 3GVVA 3P74A 4JQ2A 4CD7A 4LOCA 4UTTA 1QFEA 4WVXA 3M7WA 3NQEA 3V0SA 4DUWA 4FX6M 4HZ8A 2C0HA 4MF4A 3NXLA 4GXWA 3WLIA 2C1HA 3SB0A 4AIOA 3PBMA 3WQOA 2C18A 1LZOA 3RITA 3CPGA 3T78A 1AH4A 1RBOB 3Q4DA 1K8YA 3CS2A 5LXXA 1H7WA 3WUEA 3D46A 2YKKA 4C1LA 4ML4A 2I14A 3A3WA 3G1XA 1UR0A 1J93A 1PE1A 4F0SA 2G95A 3QM3A 4LAMA 4TUFA 3LSCA 5AC4A 5ABTA 1JDAA 3PF3A 3T0DA 4PUJA 1T8XA 3ABOA 3WLMA 3KBVA 3CPRA 3IPWA 5E0FA 3PN8A 3B8VA 5G1MA 4PFMA 3I3BA 1KTBA 3WBAA 5BXPA 3ITGA 1RA0A 4Z17A 4JX4A 4DIAA 4J2PA 2WBKA 3HQNA 3GM8A 2HPIA 3LPGA 1W9DM 1LOQA 5SWUA 3SI9A 1NWRA 4GXMA 3W2MA 3OZOA 5ECUA 2OOFA 5DY2A 4Q8WA 1K8CA 5AHNA 1C8VA 3CQKA 2Z25A 5M5DA 1A3WA 1LT8A 4WJ8A 4Q8UA 4S2BA 3VUPA 2WC7A 4Y7EA 5HNUA 4ZSTA 1R3SA 1J5TA 3DESA 1PSCA 2VRQA 2J7CA 5HWNA 2HE5A 3URQA 1VRXA 1XCWA 5KZDA 4B90A 1V6YA 1PDYA 3GXNA 1KM2A 3E5BA 3I3EA 3B05A 5CJ5A 2HK0A 3VKBA 3M5YA 3WDPP 1GOQA 3HPSA 1IR1A 3HGRA 4RV8A 3VDHA 1SSDA 2G3FA 4OBRA 3CYVA 4FR6A 5AKQA 2XPKA 3R1ZA 2CERA 3BURA 1J96A 2BG5A 3KOXA 1KV8A 2FZMA 2C3ZA 3W24A 4LBUA 3FJLA 4D6DA 4FNQA 1KTNA 3I68A 3LK6A 5AECA 1TWDA 1E5JA 3JW7A 4IQEA 4AHQA 4XD4A 1WAWA 3PZVA 1OX4A 4GUHA 4RZ4A 1B57A 2GSJA 1GW9A 1QI2A 7ENLA 4GFSA 1W8SA 3OLEA 4LWWA 2YL6A 4DQWA 4K7YA 1EL3A 4FLRA 3GSMA 1YDVA 3OEXA 1IXQA 1DJGA 3MBFA 5AY7A 2AAMA 4HBKA 3E38A 3TTEA 4XZWA 3QOKA 3VO0A 4FOKA 3R25A 4Q4QA 1HQTA 3EGJA 1L6SA 4EACA 1X6LA 1P0KA 2OG9A 1GJPA 5LIWX 4ROQA 4P8VA 1OT1A 2VVSA 2FPVA 3EA1A 4NAFB 5BOEA 1OFBA 1YLVA 2ZRZA 2FTWA 4DI8A 4JFVA 4RK8A 3KHJA 5C7HA 4DWSB 1SVDA 3TJIA 4HK5A 4GIAA 1R30A 4IHCA 2X05A 4WOZA 4CQAA 5HQLA 1GOOA 1QPQA 3GHTA 3UG8A 4ZCWA 3DYPA 4KWWA 3C56A 3VIGA 1EZWA 1ZCOA 1EGVA 3RUBL 3M6DA 2BOEX 1V4YA 4LB4A 3CWOX 3PZIA 3LV6A 3M1ZA 1ZL1A 4KEUA 4WY0A 2V2HA 1KBKA 4JTTA 4PUMA 3CEPA 3AMLA 4IPJA 4CU7A 1W5NA 4C6IA 3IUHA 3PTMA 5CLTA 4UZUA 3OVRA 5K3VA 4AB4A 2Q02A 4RDWA 5LNVA 1A0EA 4EPDC 1O68A 1IEIA 1KM1A 1ADSA 3K4AA 4GYKA 3VKDA 3OLDA 1H09A 1XM3A 3W76A 1UKQA 1BVNP 3HURA 2NSXA 1H0IA 3VDGA 2QCCA 2D2HA 3P8JA 1LG1A 2A3AA 4DBSA 4D6JA 1OHLA 1E43A 5GNZA 3AXXA 5CQ1A 4NT0A 3V5FA 3D3FA 2OU4A 4WEVX 1B90A 5LNWA 2A3CA 1OC6A 4IIFA 3AIRA 1PKLA 2WZMA 4Z2HA 5D09A 4W5UA 3PR2A 3LCIA 1OX5A 1DJNA 4WR3A 3OHMB 5CPNA 3H2AA 5GNYA 1KRBC 1ME8A 3GXDA 2CXGA 2GWGA 2PGWA 2WM0A 1JDCA 1TVPA 4GO8A 3M41A 1PDZA 3JVAA 4JX6A 2RH9A 4WXZA 3SCNA 3W27A 4AMCA 3UR5A 3W1AA 1U5JA 4FIQA 4JDBA 4C7GA 5H2ZA 4E2BA 3HG4A 1DJQA 4B91A 3AICA 1VLIA 1VR6A 3MV01 2ZA1A 1D8WA 1S2UA 1PYFA 4DYJA 2XH7A 2YJQA 3S47A 1P6WA 3H22A 3AS3A 4JAWA 1GG0A 4LAOA 4MKVA 2DUZA 4PMJA 4BCEA 2GOUA 3CUZA 5I2UA 2ZWYA 3GH7A 3QQWA 4IPNB 3MZ2A 3B8TA 1MEIA 3A4WA 3L4YA 1DWFM 4MDPA 4F3HA 3A5FA 3FV9A 1WDQA 1TE6A 4Y9AA 4ZQOA 4HU4A 4TIMA 2P1FA 4E2OA 2PP3A 3GNOA 3ZR4A 3WF1A 4P7QA 1OYAA 1D2KA 3S1VA 1ZJIA 3SJNA 2XGZA 1JI2A 2GSEA 2ZX8A 1E40A 1KFKA 1US3A 4PTDA 3GAYA 1LUCA 5AYBA 3VE9A 4MZ8A 1H1YA 4HNNA 4DJED 1OC5A 1IR2A 3AUJA 1VEPA 3BJTA 7REQB 2J79A 3E02A 1SR9A 3PZUA 2ASHA 1Q8AA 1G01A 4A8LA 2W63A 3GFXA 3LOTA 4WK9A 4RXGA 3CHCA 5A3HA 4S2CA 3LM3A 4PMZA 1ECQA 4ATWA 4NZFA 2PZ0A 3OQEA 1FKXA 2CLKA 3SCSA 4WGHA 1HKMA 3N3TA 1VP5A 3O2LA 1DJWA 5JU6A 1YBQB 3E6EA 2VRKA 3KCJA 3CZEA 2B81A 4KFOA 3IIPA 3WBWA 3G8RA 3W25A 4ZOEA 3RCNA 2WO5A 2DZAA 2YZ5A 2PLMA 3GDRA 3R7MA 1UR4A 3G0SA 1OF6A 3AHXA 3B8DA 1KGWA 5DCBA 2F9RA 3QQ1A 3VCRA 2FVKA 3Q2DA 1GHSA 4P8XA 2XVNA 4ICNA 2J9XA 3VGDA 3FN9A 1RJQA 4H7CA 1XFBA 1FWTA 1F3WA 3PBYA 1GNXA 4L4PA 3T9PA 4LAKA 1XBYA 3UR2A 4ACZB 3P6LA 3KL3A 3ECQA 3JZUA 1K9EA 4RL3A 2DZUA 1J4EA 3LA4A 1KM4A 3GTFA 2IXUA 4UCFA 4MJ4A 2QJIA 4AHOA 4UC5A 1WCGA 3SM0A 3VDCA 4QR6A 2E5DA 4QSFA 2V6AA 1FDJA 1M9HA 4BEQA 3GG8A 1SFSA 1JGIA 3P81A 3L4WA 2CPUA 2PRLA 1VFUA 4R85A 3PK7A 1R3TA 3T7VA 3C0JA 3CXOA 1Q45A 3EOEA 3URNA 3C0LA 5IHSA 5DMNA 3KBSA 5CZ0A 2PD9A 3LG3A 3VKKA 5LGXA 3VE7A 4D6CA 3SRKA 3BUVA 4ASTA 1G7VA 2XZ9A 2AGTA 2GJXB 2P0OA 4DUVA 1C9WA 3B9AA 3WD3A 1W37A 3CB8A 1TTQA 1X1OA 6PTDA 3O6CA 5C9ZA 1UKPA 5KZ6A 1O94A 3W29A 3NG3A 1XG3A 4XO6A 2JKPA 1ITQA 3TUUA 3NOEA 2OKOA 3B9OA 1TPWA 2AL1A 2TMDA 1Q8JA 1Q3NA 1NOFA 3T09A 2I57A 2QUUA 4CCDA 4FR1A 2GVYA 5DANA 3USZA 3CV7A 4QDWA 2PURA 3N29A 2VT0A 5DQPA 3S6DA 1OYBA 3MV11 1BQGA 3GUGA 3ZT6A 3KRBA 1CB2A 3UZZA 1U22A 3OIXA 9XIMA 4FNSA 4AG0A 4JEQA 2NV2A 3EA2A 3KVJA 3TZNA 1LJYA 3DKJA 4FF7A 1AJ2A 4XIAA 4PUNA 3TH6A 1RSCA 4FXFA 2I17A 4C6LA 1A3HA 1RALA 3IUDA 2J7DA 3E3HA 2WOQA 3TW9A 3DXIA 3REQA 3ME3A 1E6RA 1ZGDA 3ZT5A 1VCVA 3HU7A 2VC6A 4L9XA 2AQVA 2ZFAA 1FHDA 1XLJA 1JCNA 4LALA 1UG6A 2ZVIA 4PCNA 5K9DA 1ZS2A 4O4WA 2RKXA 1HIZA 2WLYA 3W7JA 2RHGA 1XGDA 3IANA 3LBOA 1A5NC 1E1CA 1WKFA 5JBDA 2D20A 2YL5A 1SJCA 4YVVA 2QXWA 1B3XA 3K1DA 2YBTA 1H41A 1A4MA 2ZUSA 3MI2A 2YBVA 1GKPA 2YYUA 4ACZA 3B0PA 3E0FA 8XIAA 1NVMA 3DENA 2FTPA 2EAWA 2W62A 3R8RA 5A8QA 2J13A 3GBEA 1B3WA 2YR1A 2D0GA 1QATA 4GNVA 3PUOA 1J5SA 2PGEA 5GJPA 1I6NA 1EXBA 1GOXA 1P0BA 3KTXA 4CGTA 4WQ6A 3LNMA 4IT1A 4R7WA 2JKAA 2ZA2A 2F61A 2CNCA 2ZRVA 3TQVA 4AWSA 1JFXA 4C6EA 2YPIA 5EL1A 3B9DA 4JOMA 1UR1A 5DFAA 4HTBA 4IQJA 4RJEA 1OFAA 3G18A 2I9EA 3HJZA 5K2ZA 1JXJA 3GK0A 4JICA 3RLVA 3VC6A 3UG3A 3V5OA 3W7LA 1XS2A 2GDVA 3WQWA 2QQ6A 3WF3A 2VZVA 1SW3A 2W5FA 4PUWA 4EKJA 3AIQA 4PEEA 1REQA 3VFCA 1NTHA 1M6JA 4Z08A 3CMJA 1WUFA 3GZAA 2O9RA 2JFEX 2W79A 1MW0A 1GJUA 3AIUA 4AZHA 3KL0A 1R2RA 4F66A 1K9TA 5JH1A 2F6XA 1ZAJA 3FDGA 3E74A 1REQB 4BK9A 5HMFA 2KZHA 3T08A 4MY1A 2X0YA 1UYQA 1TJ1A 4M51A 1AMYA 5A6MA 3QGKC 2G37A 3KW3A 1TPDA 2OZ8A 2D0FA 7TAAA 1LBLA 4Y8FA 4M24A 1WOBA 1SGJA 4HNTA 4E2VA 2CBIA 4JHMA 4LY4A 4W8BA 4LCRA 1XX1A 1Q4NX 3QSRA 3W1MA 1FWSA 3SCWA 4C6MA 3FDKA 3CIWA 4UMBA 3AISA 3QYSA 2VR5A 5LGZA 4DM2A 1Y0EA 1CCWB 1P6BA 2BGQA 3U9IA 4A29A 1WDDA 2VEMA 4DJFA 1XWYA 3BV4A 3VPLA 3HF3A 1XIDA 1RCXB 1X8FA 4I7WA 4PUUA 4QJ1A 1MRQA 1W1A1 4UMAA 2A3LA 3LGEA 1PL9A 3PJTA 3VX0A 3II1A 2YFOA 4O1AA 5DN1A 2NX9A 3FLUA 3WKZA 1E4IA 1FHLA 3F4WA 5FKYA 4QG6A 1WA3A 1X6NA 1QK2A 4KRTA 2F6KA 3UZJA 4W4QA 1SM9A 5HK4A 1PIFA 4IXHA 2GSHA 3BGGA 2HXUA 3GFYA 1XRSA 1MZRA 2ACUA 2H3BA 4QISA 4ZOAA 1OFQA 4PRRA 3WLRA 3I7RA 1JAEA 3PB2A 4TQTA 2HV5A 1ME9A 1THFD 1AQ0A 1CXHA 4XZBA 5FEPA 3SQSA 4U3AA 3HM7A 3T0TA 1JUKA 4B3ZA 1WZKA 3P0XA 2FPYA 2QGYA 3RO8A 4N9EA 1A0CA 5ABEA 1XI3A 1MDRA 1M68A 3N9RA 1FCUA 3Q45A 3SJ3A 2V3EA 1HG3A 4OU1A 4K8HA 2E1WA 3UNTA 3SO7A 1WDWA 2X42A 1NDWA 1TWIA 3LCHA 4GQQA 4ECLA 2IKIA 2QUVA 2QS8A 3MQTA 5BRPA 4UXDA 3EX2A 1S2AA 3PBGA 2G8ZA 3PWIA 2QF7A 2WANA 2J8TA 3MCMA 3N4EA 1XUZA 4O17A 2ZUTA 3MC5A 4DLMA 4BQ2A 5BOFA 3WN6A 4UTHA 4Q8MA 4GKLA 3OBAA 1WDRA 5BW6A 3WK1A 3OVQA 3WQEA 1TUXA 4NAEB 4HPGA 1NELA 1AL8A 1XG4A 5GJNA 4Y9NA 1X1ZA 3GXIA 3ORWA 3KOZA 2I5IA 3QPZA 4H6QA 5GNXA 4O10A 3MCNA 5C0QA 5CSSA 1OIMA 1WXYA 4LT9A 2XN1A 5HATA 3ZLHA 2PRMA 1LLWA 3NO5A 3H2FA 1CLXA 3CL8A 4KWOA 1JQXA 3P60A 1E1EA 4H4IA 3LERA 2GGEA 1PCKA 3NVTA 1BTCA 4JKLA 2XN0A 1IV8A 3IGXA 3MO4A 4GI4A 2R1PA 4JNMA 1KQZA 3VNMA 3G1AA 4N0RA 2V3GA 1G4EA 1WBHA 5FAGA 5CC6A 4DI9A 4O1DA 5JIWA 3H23A 4RUBA 1OK4A 2O92A 3OYZA 1TTPA 3LHVA 4M8UA 2ZUMA 1JQVA 4NXKA 2P50A 1G9HA 1MW1A 4Y9MA 1NEYA 4TOQA 5EMYA 4NG3A 1FWIC 3UXLA 3RX4A 3D47A 3NQ6A 3EWBX 4XO7A 1RH9A 2C13A 1A5UA 1Q6GA 4MY8A 4HQVA 3PY2A 1C8QA 2FMNA 3PTQA 3QRHA 3F4VA 4I7UA 1IWBA 3KDNA 1CXLA 3KXQA 1JL8A 3T2OA 2FJUB 1BSLA 1E70M 2BGSA 2G4FA 2YIHA 4NX5A 4QX4A 4XG1A 4GZJA 3FNDA 4MZ1A 4KCTA 1FX6A 3QVQA 1ISWA 2NZLA 3QFWA 3STGA 4L9ZA 4JBRA 1Q6CA 3N12A 4H41A 3DX5A 4R88A 1KBJA 4TR9A 4ZFCA 4S3CA 3IEBA 1QI4A 4OGZA 3IAPA 5I03A 4LUSB 4Q32A 4OVXA 1KBLA 2O55A 5C2GA 2BDQA 3M0JA 4O1BA 3IIXA 3T0BA 2QMJA 3BSMA 4W8AA 1J0HA 4IG2A 2VD8A 4GCXA 4MJZA 3CT2A 1U1UA 5G2WA 3WD4A 1V3KA 2YA1A 1NM9A 3ZQ9A 3M0HA 1E0UA 2WWCA 1KM3A 1DWHM 1ZFJA 2NSOA 5GJMA 1ITXA 3EWCA 1Q5MA 1QRQA 1XYAA 3EKZA 4YWIA 1AD4A 3NQMA 4I3GA 5G4HC 4AVNA 4GFIA 1IYXA 2DZTA 5FJPA 3HV8A 3CIVA 1GZGA 1V8EA 3TYBA 3WH9A 2DUAA 3LS9A 5HULA