4ZFMA

Structure of gan1d-e170q in complex with cellobiose-6-phosphate
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
474
structure length
459
Chain Sequence
HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNQQNIFISFGYRLGLHPPGVKDMKRYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVGTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title To be published
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Putative 6-phospho-beta-galactobiosidase
total genus 184
structure length 459
sequence length 474
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4zfmA00
2FHFA 1XH2A 1HT6A 3II1A 4MAZA 3WEZA 1V6XA 3WF2A 5E9AA 4V27A 2CNCA 2WBKA 1VFMA 1IT0A 2IXVA 1KQZA 1DP0A 4MNKA 1VJSA 3VGHA 5A94A 2W62A 1XV8A 2XJ7A 4D6GA 4M82A 2DH2A 2XUCA 3CMJA 4PTVA 1XYFA 2V38A 3SUWA 2D0GA 1BAGA 1J01A 2VMFA 3CZEA 3T2QA 4C7DA 2X8RA 3CPUA 3WNKA 4PSPA 1WZKA 2BHUA 5D9PA 5LYRA 3EMQA 5A6BD 3NCOA 1VF8A 4ML4A 4W84A 2A3CA 1BVNP 4DM1A 2UWFA 3PZUA 1WKYA 2FHCA 3QHNA 4MNMA 1C90A 1J0KA 1H11A 1WDQA 2D20A 4E8DA 5AYBA 3GBEA 5A69A 2BY1A 2XM1A 2VRJA 3WY1A 4HU8A 1OM0A 6CGTA 3T0BA 4JFSA 3WQ6A 3AYRA 2ZXBA 3OG2A 2AOSA 2EPNA 3A6OA 1R86A 3BH4A 1V3IA 4KGLA 1ZBCA 1UD8A 1QI4A 1KR1A 3WMBA 1JL8A 3AXIA 4PBGA 4WKAA 1LJYA 3A3HA 4U2ZA 1VFUA 3LPOA 1UOKA 3PBGA 4W8LA 3K1DA 2JALA 2A3BA 1KWGA 3WD0A 1ECEA 4NRSA 4U3CA 3EDKA 4AEFA 4MDOA 2Y8VA 1B0IA 2WMJA 4MB1A 3O6AA 1TR1A 3ARXA 1DWIM 3HJEA 2WVUA 4WKHA 1W1VA 3CZGA 3MV11 2CERA 3OGSA 2TAAA 1R85A 5A8NA 3WIJA 2YL8A 4D72A 1G1YA 1VBRA 3WH9A 3W38A 4OUEA 1BYBA 5E0FA 1PBGA 4W86A 1UWIA 2XVNA 4M56A 1V02E 3THCA 5FL0A 3TOPA 3MMWA 1HJWA 5D8WA 1QI2A 2PWDA 4WIWA 4OOZA 4GXPA 1CGXA 2WHLA 1HL8A 4QDMA 5GNXA 4AD0A 2WSKA 2VR4A 4H8UA 1JZ8A 5ABFB 3KL5A 2BY3A 1PZ2A 2Q8XA 3UEQA 5A3HA 5CQ1A 2DSVA 3W81A 2BY2A 3NDYA 2A3AA 3BGAA 2DT2A 5IFTA 1EQPA 4PYSA 1GOIA 1OGGA 3VIKA 2D0FA 3PZMA 2XWEA 1JFHA 1V6UA 3BAIA 1UD2A 1JXJA 4MADA 3B9DA 2OSXA 4JHOA 4UFKA 1E3ZA 4F9JA 5D8ZA 1HKMA 3VIJA 1GCYA 1CIUA 3CO4A 4UQBA 2JFEX 1E40A 3VMOA 5LA2A 1M04A 1KXQA 2J4GA 5IXEA 1UA3A 3RIKA 1XGZA 1H0IA 2VVNA 1KFWA 5DO8A 1C8YA 1XCWA 4UQ9A 1LG2A 3EMCA 3OBAA 4HMCA 3GXFA 4RL3A 4HPHA 2YDRA 2J7FA 4AD1A 4TVUA 3WQ8A 5DFAA 4AIOA 4HZ8A 1Q6DA 1BSIA 4J7RA 2VX7A 1HN1A 2ZUMA 1QW8A 1E4LA 1XSJA 3U57A 1BLIA 3TTQA 1WZMA 2YA0A 4EKJA 1MW0A 1CENA 3PHAA 2J7HA 5AYIA 2DIEA 2WVVB 2VX6A 5AC4A 2YLLA 2ZUNA 3DYPA 3F5JA 1C93A 2VR5A 5TD4A 7A3HA 1G5AA 3W26A 1MXGA 1E6ZA 3W0KA 3VDBA 5A1AA 4KMQA 3CBWA 1MW2A 3WDIA 3VM5A 1Z32X 4AISA 2FHBA 4B3LA 3VGDA 1CGVA 1VIWA 3NSNA 2XVKA 1W2VA 5CJ5A 4V28A 4PEEA 2Z1SA 2YL9A 3S6TA 3FN9A 2YKKA 5DF0A 3VGGA 4PTMA 1W1PA 2PBOA 4EANA 1GORA 2W5FA 2G41A 3ZQ9A 2DH3A 2CPUA 4D6CA 2J47A 3WD2A 4H7VA 4CUCA 1B30A 2WM0A 3T0AA 3WENA 4J3VA 3GBDA 4UQAA 4CGTA 1FP8A 2F2HA 3OLDA 2ZUWA 1PEZA 1NOFA 2W63A 2E0PA 1HJXA 4XV0A 2CIPA 2WVTA 2V3GA 4H8HA 1EXPA 2VRQA 5BRPA 2XFYA 4HOZA 1KGWA 1UKQA 1BGAA 3VD3A 3GXDA 1TVPA 3MUZ1 3N9KA 1CXIA 1O7AA 1GOMA 1UD6A 5HOSA 4GO9A 2A3HA 2VRKA 4CN1A 4LXFA 2WZIA 4CKQA 1JDAA 1V6VA 4FLSA 2GJPA 2GJRA 3FHAA 2VZTA 3BCDA 3POCA 1UR0A 1KXHA 3AHXA 5E6ZA 3K8KA 1ITCA 4Z2LA 1BYAA 5DT7A 3AZSA 3PZOA 1FFRA 5CXPA 4HU0A 4DWSD 1CXHA 4X0VA 4GO8A 3THDA 1E6PA 1JXKA 2MANA 1CGYA 1ITXA 1KWKA 1XRVA 3WF0A 4AZHA 5BXSA 3WBAA 2C0HA 1RD6A 2J7EA 1V03A 5KEZA 1AMYA 5BYWA 4UFLA 1V3KA 5LA1A 2X05A 1JDCA 1GVIA 4QLJA 3ZSTA 4M1RA 3U5YA 4AWEA 1GHRA 1K9TA 1OT1A 4W8AA 2WPGA 2WVSA 1E4IA 1Q6GA 3VD5A 2EBNA 4HMEA 3PZQA 1DEDA 3IAPA 1JAEA 1W9VA 4PN2A 1OIMA 2BY0A 1GQJA 2QLYA 1CBGA 4P8VA 1W3LA 3UG5A 4DWSB 1V0LA 4FLOA 4BQ2A 1HP5A 1GOKA 3SEPA 4FLQA 3WH7A 4F8XA 1VAHA 3WEOA 4H8VA 2BVTA 1JDDA 1UYQA 2WLZA 4U31A 2VQUA 3MS8A 1C92A 1B1YA 2CHNA 4OJYA 5EFFA 2E4TA 4ATLA 3VGFA 1WZAA 1XSIA 5I79A 3KWXA 3VTRA 1IV8A 1JI2A 3POHA 2PI6A 1OGSA 1GPFA 1NP0A 1Q6CA 1B3WA 4QLLA 4W85A 1HKKA 4QCFA 1V02A 2DT0A 4WSKA 1E73M 4ATDA 3WKZA 1OIFA 1ISXA 4D6FA 5CSYA 1BF2A 1V08A 3WL0A 4UFMA 3WH8A 1HVXA 1L0PA 3CZJA 2XTKA 5ABFA 4HOXA 1MQRA 4JKKA 3ARPA 4QCEA 2XVLA 1UZ4A 1PPIA 3MMDA 1AQHA 3PZNA 2VJXA 1TZ7A 3IJ8A 4D6IA 1LLOA 3WQVA 4LYRA 2UY4A 4X0NA 2YLAA 1UKSA 1X1NA 2W61A 3PN8A 2XIIA 3VD9A 3WBEA 4URIA 4M81A 2E9LA 4UR9A 4TUFA 2WHKA 3O2LA 1QBAA 3N04A 3TTYA 1OD0A 3OZPA 3AXHA 1GQLA 1PX4A 2CBUA 1DTUA 1KR0A 1F4AA 3T2OA 2D3NA 5IFPA 2YL5A 5ABEA 5FOOA 6TAAA 2GJXB 3RILA 3BLKA 3SURA 1K9EA 1X6NA 1LWJA 5A6BA 4KGJA 3A4WA 5BXTA 1XCXA 2YIHA 2VX4A 1E6NA 1I1XA 4PMXA 1EOMA 2BXZA 5JUVA 3WFZA 3ARVA 3W82A 1JI1A 1UR9A 4ATWA 3QHOA 3PZVA 4Z2GA 1UR4A 1PAMA 3AQUA 3QHMA 2GJXA 3VD4A 1UWQA 1U2YA 5A6MA 3BSGA 2XGIA 4GI8A 4B9YA 4H2CA 1EOKA 3CUIA 3MMUA 4PMUA 1GOQA 1QPKA 5BWFA 3CLWA 3SCOA 1WDRA 2PWFA 1E3XA 3ZIZA 3GH4A 1GONA 2Y2WA 4A4AA 1XYZA 4HA3A 3KEHA 2GFTA 4PMQA 3AHVA 1UWRA 1TFVA 1VJZA 2BXYA 1B3VA 3NJ3A 3RPMA 3K4AA 2C7FA 1E72M 3UERA 1UH4A 3MUIA 2EPMX 2E9MA 2OYMA 4K68A 1NWRA 3CHCA 3GNPA 4PCSA 1U33A 3WDPP 1EHNA 4N0RA 5CLTA 1BFNA 3UG4A 4GZIA 2D1ZA 3EBVA 4N42A 3PZTA 3WQ4A 4MPKA 3L4WA 1WP6A 1XSKA 2OWCA 4Z2IA 4TX8A 1AQ0A 2WAGA 5CG0A 1DWFM 3VIIA 4U3AA 1XH1A 1CDGA 5CZKA 2UY3A 4W5ZA 5M03A 3L4ZA 5HXMA 5M17A 2DSUA 2J8GA 3RCNA 3WH6A 1SFSA 4DWSC 3WEMA 1VEPA 1OSEA 2Z1KA 2VCAA 4S3JA 2DEPA 3NIYA 3NYDA 1QI5A 2HVMA 3CTTA 3B9AA 1H1NA 3WNLA 3RJXA 3A4XA 2O9OA 1QNQA 1WB0A 5FKYA 2O9TA 1HKIA 2RGMA 4HZ7A 3KL0A 3WNMA 1E4NA 5FIPA 5I23A 3W27A 2BVDA 1N82A 2F61A 1W9DM 4CVUA 3UR7A 4BF7A 3OLEA 4ZENA 3MANA 3ZJ8A 1NWTA 2WWDA 3OB8A 4P8UA 3WD3A 5GQBA 1CXFA 3CH9A 4KWUA 1HJQA 4M29A 1DWHM 4Y7EA 4MB4A 1MFVA 1TMQA 1XH0A 5BROA 1W1TA 3TA9A 5HDRA 2PWEA 5EMYA 1V3JA 5IHRA 2YJQA 4RE2A 2GDUA 3RO8A 1YHTA 1HVQA 1OWQA 3D3AA 1CGUA 3BMVA 2JF7A 1W1YA 1ZBKA 4CVWA 3VDHA 4OKDA 3ZJ7A 3DHUA 1HKJA 3AIUA 1W91A 4PMOA 3UG3A 3VIHA 5CGTA 3ZT5A 2D0HA 1JZ4A 5DT5A 3AIEA 3SCSA 3OGVA 3BAKA 1HL9A 2JEQA 3DECA 1RH9A 3AMLA 3DC0A 3WMSA 1NWSA 2WC3A 3I3DA 2E9BA 1MW1A 2PC8A 4J27A 3L2LA 1LL7A 4R5EA 2AMGA 3N12A 1J0YA 2J7CA 2XHYA 3TONA 5HNNA 2XVPA 1QOXA 2CEQA 3PTQA 2ZXAA 4IISA 3CHDA 2EJ1A 1XD0A 1V3HA 5HPOA 1ZBWA 4KRUA 2PBGA 4UFJA 3SUUA 3LPFA 3CZKA 4AZ5A 4NRRA 3GZAA 1BG9A 3W24A 4AMCA 4OBSA 3ZR5A 4H41A 2XG9A 4IPNB 2WW5A 8CGTA 5A8QA 1EIBA 4XUYA 3GM8A 4J28A 2VZUA 3L4VA 5C70A 3SUSA 1H2JA 2WSPA 1L8NA 3GXMA 3VX0A 1H09A 3EYPA 1JYXA 3VPLA 1OINA 4QAWA 2B31A 4AIEA 3T08A 4W8BA 1B31A 1J0ZA 3VD7A 2YA1A 1R7AA 1VBUA 2HISA 1LF1A 1FP9A 1E56A 3BAYA 4S3KA 2WK2A 2XVGA 2CETA 3CZLA 1QHOA 1WO2A 3MUAA 1NOUA 1W9UA 1W9XA 1E4MM 3VIOA 3AHTA 3WQWA 2DSZA 4MAVA 4PSRA 4D6EA 1V0KA 4AD5A 1E6QM 2G3JA 2G3IA 4J3TA 1JYVA 2G8ZA 3D5HA 4QFUA 1JZ5A 1E71M 5FL1A 1F4HA 2XSBA 2DT3A 1MQQA 1CGTA 4XX6A 2G3MA 1UD5A 2WMFA 1WZLA 1G94A 5CPQA 4U5KA 4AC1X 1HP4A 1W3HA 4B15A 1C91A 3IJ7A 1CGWA 2WC4A 2J7DA 2FDMA 4M80A 4HZ6A 4GI6A 2PWGA 3ARTA 4PUDA 2CKSA 2BHYA 1H49A 3CIVA 4AD2A 5I77A 3AMKA 1JYNA 3G6MA 1UWUA 3IAQA 2XFFA 2QPUA 3VDCA 3AFBA 3AJ7A 3WELA 1EDTA 2D22A 1NP2A 2WNWA 2ZX5A 4D6JA 4DM2A 4FK9A 1VFOA 1US2A 2ZWZA 4TVCA 1W32A 5M5DA 5E6YA 4OOUA 2Y5EA 4GINA 4PTXA 2NT0A 4QP0A 7TAAA 4ACZA 5E0CA 2X0YA 4CN4A 3AIRA 4GIAA 3ZT6A 4IPLA 1V0MA 1TA3B 4LQ1A 3EDDA 4TXEA 1UQZA 4UQCA 4DWSA 1MVYA 2CCRA 5JBFA 3TTSA 4UCFA 1QBBA 1K6AA 3KE0A 3MO4A 4LYPA 3CUGA 2WZHA 2ZWYA 3MKKA 5A95A 4PCTA 5D9NA 1JZ3A 4FMVA 1Q4NX 2PB1A 3N1AA 4JIEA 4YN5A 3VX1A 3WDHA 4P7RA 1C3FA 3CGTA 3GH7A 1A47A 3LPGA 4P7QA 1NQ6A 1JZ6A 1B90A 1E1EA 1KGUA 2DSKA 1C7SA 1UH2A 3APGA 4FF5A 2AAAA 1OCQA 1CYGA 3OZOA 4J3SA 2VOTA 1VFFA 3RMEA 2QMKA 3WF1A 2VZVA 1Q6EA 3N18A 5A6KA 3CUHA 4ZEPA 3ZM8A 5I5RA 3TP4A 1P6WA 1FOBA 2EPKX 4B9ZA 3NSMA 4GI9A 1UA7A 2VT0A 2VZSA 5JIPA 1DWJM 2DT1A 3AMDA 2JIEA 5GNYA 2E3ZA 4UOJA 2D23A 3AS3A 4TTUA 3GTNA 1E0XA 3VDAA 1FH7A 5FCZA 1UZ1A 4JFTA 5ECUA 5DEZA 6A3HA 1XD1A 1ZU8A 4JCMA 1GW1A 3ZT7A 3VO0A 2WXDM 1U30A 3N17A 2YL6A 1ODZA 4QLKA 2VVSA 3SUVA 1GHSA 4JL1A 4AD4A 2O92A 1JD7A 2ZUVA 1UD4A 5A2BA 1J10A 4MJ4A 4GZJA 2D2OA 2BV9A 3NSXA 4WSJA 3W6LA 3CZ8A 4TOQA 4HA4A 5FD0A 1WDPA 3WDJA 2EO7A 2ZX9A 3FHQA 2CITA 7CGTA 1D7FA 1KBBA 5A6JA 5LA0A 1S46A 2WHJA 4EAMA 4AZGA 2WKGA 3AZRA 2DPEA 2VCBA 3M07A 2EPOA 4AY1A 2X2YA 3ZJ6A 2QV4A 4Q22A 4W7UA 1JYWA 2OSYA 4NF7A 4P7OA 2EPLX 3ALGA 3FXYA 4PTWA 1G01A 5CSUA 4YHEA 3U7BA 1KB3A 1X6LA 1J0HA 3WDQA 2WMIA 4UOQA 1UG6A 3QR3A 3JUGA 3ARSA 2Y4SA 1HJUA 2WCGA 2G3NA 4P7NA 3VIGA 1G0CA 1AVAA 5JBEA 1TVNA 4XZBA 5CLWA 2WCAA 2G4FA 3W29A 4XB3A 4MDPA 1RP8A 4Z2JA 5A2CA 4XZWA 2GVYA 5A8OA 3QOMA 4PMYA 4NI3A 2VX5A 3I3BA 3NDZA 2XIBA 1WPCA 3L4TA 3ARQA 2V3DA 1V6YA 4W88A 1MFUA 3S2CA 3UETA 1UR8A 3N11A 2W66A 4EK7A 4UTFA 4GQQA 3O9NA 1JGIA 4CD6A 2WZEA 4HPGA 1LWHA 1W3JA 3AOFA 2J79A 1CPUA 1SR0A 3VOCA 1TUXA 4J3WA 1JZ7A 4W5UA 1TG7A 1HF6A 3WNPA 5A8PA 4ZFMA 1B3XA 4UFHA 4B3KA 3BC9A 1FH8A 3ARWA 1Q6FA 3DYOA 3RM9A 3ALFA 1UR1A 3VIFA 4HMDA 4PMNA 5D9MA 4JFVA 2NSXA 4MB3A 3VNZA 3SCWA 4AYSA 1JFXA 1PX3A 3K8MA 2VL4A 1V3MA 4D1IA 1M7XA 1EDGA 4BS0A 4W89A 4WLCA 3CHEA 4JFUA 1EO5A 1OD8A 5D4YA 1KGXA 1FH9A 2CBJA 3PZ9A 2DGAA 1M01A 2E40A 3ZSSA 1BHGA 2BHZA 3AMCA 3PTMA 4WK9A 3VILA 3ZR6A 4UZSA 1RPKA 1CXLA 1QNRA 4WKFA 2QF8A 1WAWA 1H41A 1DWGM 1WDSA 3I3EA 4E8CA 3HMCA 3SCNA 1V6WA 3WSUA 3RM8A 1J0JA 2OWWA 1UQYA 5I24A 2E8ZA 3G6LA 4CU6A 1J12A 1NWUA 1AQMA 3HU7A 2ZUUA 4MB5A 3CMGA 2XWDA 1R8LA 2WWCA 2E8YA 3UESA 1GZJA 2ZX6A 3HN3A 4JZ5A 3AIBA 1MXDA 3AZTA 3K4DA 2YOCA 2XM2A 4PMZA 2VURA 3MU7A 4V2XA 4LX4A 1B3ZA 3MV01 3N13A 4UQDA 3AICA 2UY2A 3WDRA 3E1F1 3BXWA 2C8NA 1B2YA 2DIJA 1VB9A 3AISA 3K8LA 3T09A 1QI3A 2IXUA 2V5CA 3SUTA 4DUXA 2EEXA 4HA1A 4MTVA 2BVYA 4BQ5A 1B9ZA 1UR2A 1K9DA 1OB0A 3ARUA 4BQ4A 3K46A 3EDJA 1CXEA 3AS2A 2J8FA 4JAWA 3SCPA 1ODUA 3AIQA 5EB8A 3VMPA 4CN6A 1EO7A 4HP5A 1NH6A 3GXIA 1UH3A 1EQCA 4AZCB 2O9RA 3BAWA 2JF6A 4UQEA 3AI0A 3FAXA 3ECQA 1KXTA 2GK1A 3UR8A 1GNXA 4P8XA 4J3XA 3VIMA 3WF3A 4H04A 1FHDA 4A3YA 4C7GA 1E0WA 2OYKA 1JG9A 1QHPA 3PTKA 5DMYA 2WVVA 1PJ9A 1DHKA 2YDQA 2D24A 2O9PA 1D2KA 4JHZA 3VGEA 5A6LA 4DUWA 3AMGA 4J3UA 4P7LA 5BXPA 4CD8A 4RE4A 3BAXA 1HNYA 1US3A 2WKLA 1BGGA 3WFLA 4HOWA 5JIWA 1OGBA 2JIWA 3QGVA 4TX6A 8A3HA 1ZJAA 2XFRA 3ZO9A 2WLYA 3A47A 1ZS2A 1QHZA 5GNZA 4PMDA 3FNDA 1VEOA 1C8XA 2JE8A 4KH2A 1BVZA 4W7WA 1DWAM 2Y8KA 3AHYA 4RE3A 1RP9A 1ZB5A 4NZCA 1KBKA 3B8SA 5BCAA 3M46A 1E9LA 1ZBVA 5A6AA 1IZJA 1CLVA 1W9BM 2XYLA 4FLRA 3IK2A 2ZIDA 3L2MA 2WBGA 2EXOA 2A3EA 4JFWA 1QW9A 3OA5A 4C7FA 1KQYA 5I6SA 4AZ7A 4L4PA 1LQ0A 2W91A 3EMZA 3SCUA 1EDQA 2FGLA 2OSWA 2WYSA 1E55A 1HIZA 3AXXA 4UZUA 1ZL1A 4Q7NA 1ISYA 2WCSA 3MUY1 3A4AA 4MNJA 1XC6A 3W53A 2OYLA 3WNOA 1K9FA 2BNJA 1BYDA 4AZBA 3T0DA 4AW7A 5HPCA 3RJYA 5GPRA 3SCRA 1QNOA 1WE5A 1ISWA 3TTOA 3EDFA 4U5IA 1E43A 1GJWA 1ZJBA 1GUVA 3IJ9A 2ZX7A 3F5LA 4P8WA 1JIBA 2WMGA 4CU8A 3MSGA 1M03A 2DQXA 3L4UA 1HJVA 1SYTA 2FH6A 4E2OA 4NSBA 5EFDA 3RM4A 1W9PA 3J7HA 3KZSA 3L4XA 1M53A 5AC5A 4CCDA 5KZ6A 3VM7A 3GNOA 3CUJA 2ZXDA 3WN6A 3U5UA 2OLHA 2CXGA 4F9DA 3PZGA 3CHFA 1EH9A 1A3HA 2YBUA 1E1FA 4ACYA 3RDKA 1CECA 3BMWA 4R27A 1PIFA 4LGXA 1J9YA 5F7UA 2WMHA 2ZUSA 4PMRA 5EBAA 5I3DA 3BAJA 4JKLA 3QOKA 2WHMA 5IHSA 1VRXA 3OLIA 1CNVA 2DDXA 5M3WA 2V3FA 2VQTA 2ZX8A 1TE1A 1CEOA 1JD9A 4W93A 3BLPX 4MNLA 2VO5A 3WUFA 2BS9A 4UNIA 4LPCA 2F8QA 2VCCA 4YPJA 5I78A 2CKRA 3WH5A 1IZKA 3LMYA 2XGBA 1OT2A 1MYRA 1QVBA 1MW3A 3MSDA 3SCTA 3WQ5A 3ZJKA 4X9YA 2YDSA 1UD3A 4HTYA 3W25A 1KXVA 2J62A 1LL6A 1W2PA 4ZE4A 3GNRA 5HBFA 3WUBA 2J74A 2VNCA 3ARYA 4PMVA 3WD1A 1UHVA 3W28A 1E0VA 3AS0A 2J78A 5I0DA 3WNNA 3BSHA 1TA3A 3AS1A 4TVDA 3VIPA 2WMKA 2J7BA 1QNSA 4E4PA 1D3CA 5AY7A 1H5VA 1Y7VA 2WMIB 1CXKA 5A6SA 2WB5A 3KL3A 1LL4A 1UKPA 3WF4A 2X1IA 3UCQA 4W87A 3WL1A 3W4RA 3WD4A 3AYSA 2CESA 1GVYA 9CGTA 1FA2A 4GKLA 3VINA 3VMNA 5I2UA 2J75A 4AEEA 4DUVA 1GOWA 1QI0A 3W37A 4AD3A 4M24A 4BQ3A 1NOWA 1E6RA 3GH5A 3M6DA 2ZICA 1JNEA 2ZXQA 1WCGA 1UUQA 1H0GA 1C8QA 2RGLA 2D3LA 2GSJA 1J11A 4JKMA 1PIGA 2QHAA 1LG1A 4CU7A 1PX8A 2PWHA 4L4OA 1FFQA 1MQPA 3VUPA 2GK1B 1SMAA 1E70M 1VEMA 5ABHA 5A2AA 1SMDA 4TTGA 5A8MA 3AROA 4W7VA 1V0NA 4F79A 3GYCA 3SCVA 5C8BB 4JL2A 2WC7A 1GQKA 2VC9A 2V3EA 1BQCA 4GQRA 1KCKA 3T2PA 1GQIA 2YA2A 4MJ2A 3VVGA 5CPTA 2FH8A 1UKOA 2CBIA 4A3HA 2ESCA 4CD4A 3ARRA 3NUKA 3AIVA 5BRQA 1ISVA 3LPPA 1TCMA 4BCEA 1QNPA 2JEPA 2W92A 3WMCA 1JF5A 3AIWA 2WANA 3CUFA 4KRTA 4D1JA 1UWSA 1PZ3A 1JAKA 1R87A 4OIFA 4D71A 1EGZA 1WNOA 3EDEA 4M8UA 2X09A 3ARZA 3VKKA 1EHAA 1E6SM 1BG4A 5JBDA 2GUYA 2J77A 1ESWA 3AHZA 4LYQA 3M7SA 1GOOA 1J18A 1CTNA 2NT1A 2UY5A 3ZOAA 3OIHA 4AIUA 4BZYA 2PF0A 1W3KA 1J0IA 1FHLA 3IANA 4IM4A 4OBRA 2CHOA 4AZIA 4UFIA 5E70A 3WUGA 2J7GA 3F5KA 3ZMRA 2J25A 4UOZA 3F4VA 4OZOA 2VZOA 2XPKA 1CZ1A 1JNDA 1HXJA 1R7OA 1C7TA 2YBTA 3VNYA 3VU2A 3DHPA 1NM9A 4CD7A 3VGBA 4ZE5A 2VTFA 1H3GA 4ZXOA 1MWOA 1NARA 4EE9A 1BTCA 2NW0A 3PZIA 1CLXA 1E5JA 4YHGA 5E09A 2X0HA 4PRWA 4CCCA 1JF6A 4D6HA 4CCEA 1BPLB 1E15A 2W4XA 3SCQA 4Z2KA 2XSAA 2V5DA 5D9OA 2VI0A 1E6XM 4BA0A 2Y24A 4AXNA 2QPSA 1B3YA 5BXRA 4ZXLA 3L4YA 4Z2HA 2ZOXA 1BYCA 3FY1A 2ZUTA 4D6DA 1XHGA 5C71A 2VUYA 4AZCA 1ISZA 4CD5A 1KCLA 3BCFA 5CGMA 1HX0A 5CPSA 1GJUA 4U33A 2QMJA 3W6MA 1OBAA 2ZE0A 2W67A 3FAWA 4GPNA 2EQDA 4F66A 1EA9C 4B16A 3WUEA 2CBVA 3N15A 1JZ2A 2IUZA 5ABGA 3GDBA 4IUGA 1YQ2A 2BFGA 4GZEA 2DSWA 4U2YA 3DYMA 3OLGA 4WF7A 1I1WA 3SIMA 2OWXA 4JCLA 1O6IA 1VENA 3FW6A 1UKTA 1E5NA 4WJXA 3U7VA 1HJSA 1CWYA 1H4PA 1UWTA 4PUEA 1V3LA 2GDVA 3B9EA 2CYGA 2FGZA 4ACZB 1G9HA 4AZ6A 3OGRA 1I75A 5IDIA
chains in the Genus database with same CATH superfamily
4ZB5A 3II1A 4MAZA 1X7IA 2WBKA 4ONVA 2IXVA 1IHIA 4HQVA 4MNKA 1VJSA 3VGHA 1L2QA 2W62A 4OGZA 4D6GA 1LT8A 1REQA 5MKGA 2WPBA 3CMJA 2Z26A 4K37A 1GG1A 3LCLA 2FTYA 2V38A 3A3XA 2V81A 2QF7A 3RRXA 3T2QA 3LXBA 1YX1A 4NY2A 4IX2A 3ATYA 1WZKA 1LBLA 2BHUA 5LYRA 3EMQA 3W7HA 3O16A 1IGWA 4HB7A 2A3CA 3FGCB 3FDKA 2E6FA 1WKYA 4MNMA 1J0KA 1H11A 1T0OA 4E4FA 2VWTA 4JDYA 5AYBA 5KETA 3GBEA 2ANUA 2BY1A 2XM1A 1HO1A 3CWHA 2YW4A 1TJ2A 4B91A 6CGTA 1QJWA 3AYRA 1DIEA 2I5GA 3MCNA 3LCXA 1QCWA 3TC3A 1V7AA 2R24A 3BH4A 4IPIA 5K9XA 3UWVA 1MXSA 5CC3A 1UD8A 3ZVHA 3GD6A 4DJEA 3ITCA 1NJJA 1JL8A 4GVGA 4WKAA 5F4SA 3MP4A 4U2ZA 1H7NA 2ISWA 3F4CA 3PBGA 3PTDA 3QR0A 1A5SA 4C6CA 3FX4A 5FJUA 1PTGA 3WD0A 4J9JA 2P3ZA 3WX7A 1J5SA 4MWAA 3G24A 4MB1A 3VOIA 1TR1A 1AH0A 3AU2A 3HJEA 2WVUA 4WKHA 2X42A 3MV11 3ITLA 2CERA 3EWDA 3LRLA 3IGSA 1R46A 4PE8A 2RDXA 3ATZA 1XIBA 3WIJA 1LUCA 2YL8A 4D72A 4CNOA 2NWSA 2XH4A 3WH9A 1FY6A 4NNBA 4OUEA 2Z7GA 1F6KA 1K8XA 1LRQA 3UG8A 1SQ7A 2GSEA 1W56A 2PWDA 5IM51 1DORA 4OOZA 3BDKA 1M68A 4QDMA 4GX9A 1B4KA 2X41A 1TPEA 3GNXA 5DBUA 3KVKA 2BY3A 3OJGA 3WK3A 1PZ2A 2V2CA 1W3NA 5CQ1A 3NDYA 3CQ0A 3AXMA 2NUXA 3RRAA 3WO8A 2PLJA 3KVJA 5DRCA 1EJXC 2NLYA 4BWLA 3LNMA 1TTJA 3N4AA 2FIQA 1GW9A 3BAIA 4DZIA 1UD2A 1D9EA 3TMLA 1WDDA 3PNUA 1CT5A 4L61A 2DUAA 1Z9AA 1MUMA 1HKMA 3S1XA 2C19A 2R1KA 2QJNA 3QYQA 3W7RA 2CC0A 1O12A 4LVGA 4QEEA 2J4GA 3FKRA 1KM2A 3LA4A 3RIKA 3QXBA 1XGZA 2YB1A 4NT0A 4UQ9A 1EJVC 1I2OA 1ZJIA 5D04C 2YDRA 3HGOA 1QPRA 3G1YA 4JTGA 2J7FA 4K39A 3C6CA 3G8EA 2VYOA 3T9PA 3TYDA 4HZ8A 1BSIA 2F9RA 4C6EA 1VFHA 3XISA 4R88A 2C18A 3N3TA 4Q33A 1XSJA 4LNYA 2A2IA 5HJYA 1C8VA 1CENA 4D2JA 2DIEA 2WVVB 2Y5SA 3WQFA 5AC4A 1C93A 2VR5A 5TD4A 3FCPA 4QHRA 1MUCA 3D6NA 4DBDA 1MXGA 3RLVA 2A1YA 3VDBA 1XS2A 4U28A 4DJFD 4PGLA 3WDIA 2MUCA 2OG9A 4DI8A 4NIRA 3USBA 1CGVA 1VIWA 3W2KA 1RJRA 1Q45A 5C9ZA 5G1YA 5CJ5A 4PEEA 2Z1SA 1H63A 2YL9A 3FN9A 3OP2A 5D2WA 3R0DA 3S2LA 4DI9A 4N7QA 1B4EA 4CCZA 4QQUA 3ZQ9A 3SM0A 1TJPA 2CPUA 1XR2A 3KW3A 5F4WA 4P2VA 3NL5A 4D6CA 4LUSA 1DHPA 1B30A 3HV9A 4J3VA 2AGTA 4CGTA 1KCXA 1ONWA 4K2SA 3TR2A 1WXYA 3TW9A 4HNVA 1PDZA 2W63A 2NQJA 3WJZA 2E68A 4XV0A 4G5DA 3DEQA 4ZQCA 2VEPA 5EY5A 5LGXA 1KGWA 4MF4A 4JTDA 1RQEA 4INFA 4Y6GA 2H6RA 3EXRA 3MUZ1 1O7AA 1GOMA 1UD6A 5HOSA 4LCSA 4MZYA 1UROA 3M43A 5HWNA 4LXFA 2VDGA 2FLIA 3MWCA 4UTHA 3DHDA 3GIYA 1SZGA 1TPDA 3TOYA 3POCA 3AHXA 4XO7A 2E6AA 4AMAA 3QRHA 2PDYA 3ID7A 3FFSA 5CXPA 4PUNA 1E6PA 2MANA 2VFEA 4AZHA 3MSYA 1JCJA 1AMYA 3FV9A 3VA8A 4Y2WA 4GY1A 1GK8A 3SI9A 3QQ1A 2WVSA 1E4IA 4GQ0A 4LBUA 3ICJA 4X9SA 1DEDA 3MKCA 2V30A 3MVIA 4L6HA 2C0AA 4Q4QA 1OIMA 1B9BA 3Q37A 4WY0B 3GC5A 1HP5A 1GOKA 3SGUA 1UIPA 1PUDA 1LTDA 1D8WA 1K7XA 2BVTA 3H12A 1TMLA 4ZSUA 4U31A 2VQUA 4ZGYA 2FZ8A 3GVWA 2CHNA 5EFFA 4N4PA 1F5ZA 3VGFA 3D46A 2ZTJA 4XKMA 3KWXA 1FWAC 3L0GA 4OE7A 3M5VA 2PI6A 1OGSA 5G5IA 4KPLA 3TJXA 3TSBA 2C1IA 4QCFA 4DXXA 4K36A 3ZWSA 4WSKA 2WJFA 2GVJA 4DO5A 5BZAA 3N14A 5CSYA 4UFMA 1TV3A 3P7YA 1JCYA 4HOXA 2PURA 3M0JA 3ARPA 4G9PA 3H53A 3DBNA 4JTIA 4REQA 3MZ2A 5LGZA 3PZNA 3T8LA 2UV8G 1MEWA 3E0VA 2VJXA 4D6IA 4NUWA 4LYRA 4X0NA 3PBWA 5IOBA 2W61A 3PN8A 2QKFA 5ENLA 4O52A 4URIA 5HA7A 4ZR8A 2O7QA 2WHKA 4AWTA 1XKJA 3LK6A 1O95A 5HANA 1QBAA 3NPVA 3TTYA 4FB7A 3VKBA 3AXHA 3H4XA 2JBMA 1POKA 1SFJA 4DO7A 4X22A 1AJZA 2D3NA 1OX4A 4A22A 6TAAA 3KTSA 3UPWA 1SJCA 3SURA 1KFLA 1X6NA 1LWJA 1E9ZB 1ONEA 4KGJA 5BXTA 1VFLA 4I7VA 4O15A 3GY1A 3KCLA 1PKMA 1E6NA 3P60A 4AWSA 1W5OA 1FDZA 4H6EA 2BXZA 4LAUA 4JX4A 2AQVA 4S3AA 1JI1A 1OFOA 4L4MA 4HK7A 1W8GA 5F2IA 3M0HA 3V36A 3QHMA 1KC7A 3VD4A 4LFYA 1UC5A 5K2ZA 1S1PA 4GI8A 4B9YA 3DI0A 4RK8A 4B5UA 5B7YA 1FWIC 3GDTA 3WMLA 3TX9A 3S2MA 1RBLA 1QPKA 3NXFA 6XIAA 2ABAA 1CCWB 2WNNA 3CQJA 4LH8A 4A4AA 3KEHA 3IWPA 3B03A 2BXYA 3MW7A 4IIEA 2A5HA 3UZJA 1F3WA 3RPMA 4L65A 2PDLA 3TYCA 1E72M 5JXQA 2X1SA 1S3HA 1TJRA 3RUBL 4K68A 4IQLA 3HQPA 3GNPA 3F4WA 3WDPP 1EHNA 1SJDA 1RBAA 1WOBA 1UW9A 3PSWA 4Z0JA 1XSKA 3UGVA 1A5UA 4TX8A 2QUUA 9XIAA 1HZYA 3C8NA 3DGBA 4JTTA 4NZFA 4ZO7A 2OXNA 1XH1A 2GQ3A 5CZKA 2AAMA 5B7ZA 5M17A 1YKWA 1SFSA 1W31A 1VEPA 1OSEA 2VCAA 5FJIA 4S3JA 4I9TA 4RR4A 3TMQA 3KHDA 3CTTA 3B9AA 4DJFC 4YVVA 2O9OA 3AO0A 3HTWA 3A23A 4JIPA 1IGSA 1WB0A 5FKYA 2O9TA 1Q6QA 3QLDA 3FA3A 3W27A 4MLJA 4IXXA 1XQKA 3NZQA 3U4AA 3UR7A 5C6MA 4N6FA 5FJTA 3B06A 5GQBA 3FYPA 1CXFA 4QE4A 1DWHM 4IL0A 4MB4A 1ZJHA 2LLEA 3CB8A 1UASA 2PWEA 5F1VA 1V3JA 5L6UA 2YJQA 4RE2A 4I6VA 1FCVA 2XH2A 4ZOBA 1YHTA 1OWQA 3RXZA 3NTYA 4CVWA 4GJIA 4OKDA 5FEPA 5C5YA 1ONXA 1ITUA 1F8IA 3UG3A 1M7OA 1XIFA 4H8NA 3SCSA 5T8GA 3DG7A 5LNWA 4LANA 3P82A 3BAKA 2JEQA 1K03A 3AUOA 1VFTA 3AMLA 3DC0A 1NWSA 2NX9A 3ABZA 3KDNA 2PDGA 2PC8A 4JQ3A 3HBLA 1LL7A 3GIQA 2OCZA 2XHYA 4WOQA 3TONA 1QOXA 2ZXAA 4IISA 3CHDA 2PWUA 1V3HA 3TE9A 5HPOA 2QCGA 1FKWA 1ZBWA 1IEQA 3LM3A 3TAKA 3CZKA 3MHFA 4NAFA 5JH1A 3T05A 4XZNX 5JMUA 1VLIA 4NRRA 3EX3A 4NP7A 2P5NA 4IPNB 5A8QA 1EGMA 3GM8A 3EB4A 3DU0A 3L4VA 3BOXA 3SBFA 3VNMA 3BJFA 3EYPA 3MUCA 4AHOA 2XU2A 3T08A 3BLLA 2P0IA 1PV8A 1R7AA 2HISA 1LF1A 3EA3A 4XIMA 1FP9A 9XIMA 1E56A 2WK2A 4JN7A 2XVGA 2Q02A 1QHOA 3MUAA 1NOUA 2CZVA 4LOCA 3QGKC 1RA0A 2DSZA 4HN4A 3S5ZA 4GIRA 1V0KA 3TXZA 4J3TA 3D5HA 1BWLA 1F4HA 2BGNE 3JS3A 3IGUA 5IBXC 4XX6A 3WJWA 1XGEA 1IEWA 4PRRA 2ZZ3A 2PF8A 1VPQA 4L1XA 4AC1X 1W3HA 4JNZA 1C91A 4HBKA 4NJGA 2FDMA 3E2SA 5E0KA 4HZ6A 4K6AA 4GI6A 2PWGA 3I10A 2CKSA 4AD2A 4MLRA 1DQWA 4ZCWA 3KOWA 1UWUA 3IAQA 3B0YA 1T41A 3H54A 3VDCA 3AFBA 2PD9A 1ONRA 1NP2A 3LLXA 2VC6A 4FK9A 4XTIA 1VFOA 4G2DA 2PC4A 1US2A 1OYBA 3UJEA 4TVCA 1W32A 4OOUA 5BU9A 4GINA 1Q65A 4ACZA 1EA0A 3KBSA 2NXHA 2HSAA 4RV8A 5CPOA 3AIRA 4GIAA 3ZT6A 1TA3B 3LBCA 4LQ1A 3EDDA 3TKFA 4DWSA 1MVYA 2Z1XA 5T9BG 1K6AA 4AH7A 4NYYA 1QTWA 2PTDA 4PCTA 2TRSA 4FMVA 1JPDX 2C1GA 4RDYA 3A9BA 4YN5A 3VX1A 3WDHA 2BGQA 5LSMA 1HQTA 3GHRA 1T8QA 1PSCA 1B90A 4O8RA 4S39A 3VKJA 3EWYA 4IGSA 1C7SA 1W54A 2WNQA 4F40A 3UJFA 1BRLB 3AWNA 1W6TA 3M41A 4FIRA 4QDWA 3MPGA 5HJLA 3PANA 3RMEA 3HPSA 2VZVA 3WF1A 3N18A 5A6KA 3UNDA 3CUHA 3ZM8A 1YDOA 3MQTA 2VEIA 1DJZA 1EYWA 5HQLA 3WK0A 2OKOA 4ZOCA 3E0IA 3AMDA 4EP8C 3MWAA 2D23A 2BG5A 1SGJA 3CV1A 1K8YA 2YCJA 3AS3A 4TTUA 2Y6ZA 3B4YA 1UZ1A 6A3HA 1XD1A 4WDWA 2H9AB 2CLFA 2Z4GA 1IQ8A 2WXDM 3NZGA 1TV8A 2E1WA 3NM1A 3LHZA 3W71A 2GQAA 2HTMA 2PDMA 3CO8A 4QNWA 4MJ4A 2BV9A 4WSJA 3UY7A 3W6LA 2Y8UA 4IXHA 1YIXA 1OADA 4TOQA 4HA4A 1A5CA 4DZ5A 4ZQRA 3WDJA 3K13A 3M0MA 3N9SA 1OK4A 4PULA 1RCQA 3LRKA 2CZEA 2WKGA 1I2NA 1XWYA 2DQWA 4MWAB 3AZRA 4H9UA 2VCBA 2QV4A 3LI1A 1TV2A 8TIMA 2FJKA 1ZENA 4UIOA 4PB4A 1H1YA 1YNPA 2HZGA 5CSUA 4XBJA 5E93A 4O19A 4YHEA 3U7BA 4DN1A 3W7CA 3WDQA 5F1UA 3LCWA 2WMIA 3H8AA 3QR3A 3TYEA 2Y4SA 3ZVHB 2R14A 1HJUA 2QIIA 2FVLA 1UB3A 3VIGA 4AAJA 3PC0A 2WCAA 4XB3A 4MDPA 3EWXA 4Z2JA 4XZWA 3BARA 5HAOA 1FCUA 3NDZA 1YE4A 1WPCA 2P1FA 1ZLPA 4PTNA 3I7RA 3H7UA 1UR8A 1JCXA 2W66A 3SN0A 3CV6A 4WDUA 1EP2A 1O1HA 4GQQA 2B7OA 3OVQA 4DPPA 3C0LA 1TIWA 3R2GA 3UJSA 4LF1A 1OFPA 1W3JA 3G22A 5A6TC 1R2SA 4OVXA 1YADA 2Y89A 3U6WA 1TUXA 3VOCA 2J9ZA 1L2UA 1HF6A 2YR1A 3AUJA 4UFHA 5XIAA 3DYOA 2YPIA 2HE8A 5CZJA 2BWGA 1SUXA 4PMNA 3TJ4A 4MB3A 3VNZA 3SCWA 4AYSA 1VKFA 1V3MA 1Q4WA 4BS0A 4D1IA 4FR6A 1XLAA 2YFNA 2B7PA 4JFUA 1OD8A 1KGXA 4EACA 3B40A 1TPH1 4Y9NA 1C29A 1BHGA 2PWVA 3AMCA 1QRQA 1EX5A 1SZEA 1Y0EA 3ZR6A 1RPKA 3IUDA 4NQ1A 1GZ1A 2FTPA 1J2BA 1H61A 1M1BA 3HMCA 3S8HA 3ABSA 3QEZA 1L6WA 1V6WA 2JKEA 3RM8A 2OWWA 2Z00A 1K8CA 1J12A 4GFIA 4GVFA 4FAMA 2ZUUA 5K4XA 2XWDA 1R8LA 1DPMA 3TR9A 2ZX6A 5CBIA 3KOFA 3C0QA 1MXDA 3SRDA 4GC4A 4D9PA 4PMZA 2QUVA 5MF5A 2VURA 3MU7A 2Y70A 4V2XA 3S0CA 1B3ZA 3M6YA 3AICA 2F7FA 1EEPA 2V5LA 3UJ2A 3PPFA 3VOFA 4YXGA 3KBMA 2DIJA 1VB9A 3K8LA 3T09A 1QI3A 3VABA 2CLMA 4DUXA 4YYCA 2EEXA 3LMZA 3W7NA 3G8RA 3UWUA 2FZNA 1Z6KA 4XD4A 3SCPA 4UC5A 1A3WA 3SSJA 1ZUAX 4YCPA 3RX4A 1EO7A 1KM1A 4N6EA 2IKHA 4FNSA 2BBFA 5G4EA 3FAXA 1KXTA 1JCMP 2GK1A 4P8XA 3PWGA 1QATA 4PBEA 4BI7A 3VIMA 3SQLA 3G1SA 3WBYA 1RJQA 1TX0A 3DFHA 3BURA 1FQ0A 2YDQA 2D24A 1D2KA 1F2JA 3VGEA 5A6LA 5AECA 3F7JA 4RZ5A 4DYKA 1RV8A 4O18A 3LHUA 4YLWA 5HMEA 1AD4A 3BAXA 1LM1A 4IMEA 3DX5A 3NYZA 4O4VA 3WFLA 5JIWA 2XFRA 2DZAA 3GU9A 2WQPA 3ZO9A 2WLYA 4NU7A 1QHZA 4PMDA 1C8XA 1EYEA 3UGRA 4FPSA 2W3ZA 1BXCA 4NASA 1BVWA 3AHYA 4BJHA 4RE3A 4PFMA 3FJLA 4JX6A 1UP0A 2INZA 1W9BM 5L9FA 3UYIA 4C5YA 2EXOA 3WQEA 1OC6A 4JFWA 5U7SA 5CSRA 4C7FA 5I6SA 1Y5VA 4AZ7A 4A3RA 1EZ2A 1CX9A 3EMZA 1XLLA 2W91A 2OSWA 1HIZA 4M3PA 2X1TA 4C6FA 4FI4A 1ZL1A 4V1YA 2YSWA 3UZYA 5CBBA 3C61A 3L0NA 2OYLA 2Z27A 3N2BA 1Z89A 3EWCA 3WQPA 3U2ZA 4AZBA 3ES7A 4Y9MA 1QO5A 3KBWA 2E7FA 3RJYA 3W07A 2Z29A 1PHQA 1ISWA 4O1CA 4O4WA 3RCYA 5TBOA 3IJ9A 1G4PA 2RUSA 1NFPA 4U10A 3N29A 3P0WA 4DNMA 1F3TA 1H7PA 3BLIA 5TF0A 3GR4A 4DY1A 5FACA 3V4BA 4UTWA 3LSCA 2V2DA 4JQ4A 2QCLA 4AHPA 5AC5A 3SRFA 5KZ6A 1EL3A 1QO2A 2NQ9A 3CUJA 1UOZA 5FJRA 2ZXDA 3KRSA 3QMRA 4Y9AA 3FVMA 3TWBA 2R82A 3WN6A 1VBHA 3TXVA 5C9RA 1GYNA 4F9DA 3PZGA 1P7TA 3CHFA 3KRUA 1HL2A 1CECA 3WJSA 4CQDA 1LYXA 3M0YA 1AH4A 3WBWA 2NZLA 5F7UA 3KS5A 3MDUA 5I3DA 2WHMA 4QM1A 1V5XA 5CKSA 1XIJA 2Q3RA 1TPFA 3GC4A 5M3WA 4EPKA 3GKAA 2VQTA 4XVEA 4L80A 1LZOA 4MNLA 2BS9A 1X7FA 4LPCA 2ZTKA 4WJEA 5I78A 1AZ1A 4H3DA 1A49A 3LMYA 3W74A 7ODCA 2H3BA 2XGBA 1OT2A 4OWGA 1MYRA 3WQ5A 3TV8A 4LVAA 2YDSA 2OMAA 1LL6A 1W2PA 5HBFA 3QN3A 2CW6A 4WGHA 2J74A 1XDMA 1E0VA 1UMYA 3URBA 4W9TA 2NLIA 1V79A 2YYTA 1R2RA 5JH2A 3CHVA 1GWJA 2WV8A 5I3GA 2J7BA 3NA8A 4H9ZA 3Q45A 2WMIB 3TTEA 4Q8OA 1CXKA 3GHTA 3KL3A 3IEBA 1G7UA 3GNNA 4UTLA 2X1IA 4G1NA 1B3OA 4YU1A 4ZB2A 5T9CE 3V5FA 3W4RA 1GVYA 3SZ8A 3RR1A 4GKLA 3VMNA 4DUVA 2ONEA 1QI0A 3W37A 3TDFA 4UMBA 1WXZA 2EPHA 2WOQA 5CPNA 5HINA 1VJIA 2ZICA 3W2MA 3OBKA 4JKMA 5CJMA 1W37A 4ZSTA 1J79A 1U1HA 3QH2A 3U3HA 4KIRA 1GPWA 4E38A 4L4OA 4LEQA 2QJGA 4HJWA 1FFQA 3VUPA 1R0MA 5H1WA 5ABHA 4HU4A 1SMDA 3BLEA 3LXAA 4ML9A 1J4EA 3NQ7A 4Q4KA 3P6LA 5C8BB 2DVXA 4TX9A 2WC7A 2GL5A 2V3EA 4WUIA 1BQCA 3XIMA 4NZ3A 3GHSA 1S5WA 3FVDA 1Z42A 4HSNA 3T2PA 1GQIA 3RFAA 4NXKA 2FH8A 3ZS4A 1VYSX 4IMDA 1UKOA 1V7YA 2ESCA 1RXOB 3NURA 3LOTA 1KCZA 2ISDA 4JTKA 1ISVA 2PU1A 1DVJA 4BCEA 1KLYA 1KRAC 3CUFA 4RZ4A 2A79A 4KRTA 4RE0A 4Z1YA 3TQPA 4OIFA 4D71A 3W76A 3DXIA 3VKKA 1EHAA 5JBDA 4QTGA 2J77A 1ESWA 4Q6XA 4QSFA 2X40A 2BDQA 3WLKX 3NQ8A 4OU1A 4Q8VA 1UMLA 1QU4A 4ZO8A 3L23A 3VKCA 3W7JA 3IANA 4IM4A 4C6DA 1Q6OA 1ZALA 4FO4A 4UFIA 4B90A 3N2OA 3WUGA 1UUOA 1O4UA 2J25A 3CLMA 5C9WA 2DUZA 2FVKA 3VNYA 3VU2A 1QWGA 4ZE5A 2VTFA 4ZXOA 5M1TA 3W7PA 4FA3A 1MWOA 5G1MA 1JCTA 1RALA 2DP3A 4YHGA 3WQGA 4CCCA 5H6HA 3WLOA 4D6HA 1MUWA 3OHIA 1WV2A 4C6JA 1XLMA 5JQ9A 5D9OA 2VI0A 1PTAA 3B4UA 1E6XM 3W1AA 2QPSA 5C0QA 5BXRA 4C6LA 4TV5A 4Z2HA 3RX3A 3G3MA 2GOUA 2VGGA 3W1LA 1QOPA 3I6RA 3DZ1A 4XSMA 1ISZA 1KCLA 3EOSA 3BCFA 3W83A 5EA9A 1QDSA 1WQ5A 5AYZA 5CPSA 1LLWA 3W6MA 2CZFA 1EBHA 1Q63A 4US5A 1Y5WA 3N6HA 4BI6A 1EA9C 4B16A 1JZ2A 4IUGA 2OQLA 4B5XA 5TQLA 4GZEA 4FNPA 4C6PA 3RAOA 3DYMA 4WF7A 3C4UA 4JCLA 1Y65A 1N7KA 2IKJA 1VENA 3RR4A 3FW6A 3VCRA 4Q8TA 1HJSA 3IK4A 3V1HA 4IPJA 3H24A 3H4WA 2GDVA 3QW3A 4OTKA 3F03K 1HUVA 1I75A 5CG7A 3DFNA 3K1GA 1AJ2A 3HMJG 2Y63A 1HT6A 4MFEA 1V6XA 2IS7A 3QY7A 4N4QA 1KBLA 3R79A 4NNAA 3CT7A 1DP0A 1W5NA 5A94A 1RD5A 1MI3A 3BLFA 2P8CA 3PBMA 1EUNA 2CZDA 3OBEA 2CU0A 3UWZA 1FXQA 1YPXA 3EGJA 4WY0F 2D0GA 3W9ZA 4LJ3A 1BAGA 2J9XA 2VMFA 4QS5A 5CBJA 4RXGA 4C7DA 2WM1A 2X8RA 3CPUA 3WNKA 1QXLA 3HPXA 1QW7A 1VF8A 4L5ZA 1BVNP 3W1UA 1AFSA 3PZUA 2FHCA 3EPOA 1ZGDA 2V63A 4JNMA 1R3TA 4A8RA 4LY4A 2BOGX 3F4NA 2E25A 4HU8A 1OM0A 1LBMA 3T0BA 1V8EA 4HYWA 3OG2A 4XKYA 3QYSA 3WBXA 2AOSA 2EPNA 3BSMA 4HMNA 3TYUA 2OKTA 1EJRC 4KGLA 1ZBCA 2QGHA 5FSEC 5FEXA 3PBVA 2B7QA 2QQ6A 3A3HA 1HG3A 4QITA 3BL3A 1PE1A 1UP3A 2PGEA 2KZHA 4NG3A 4X3ZA 2HE5A 1WKEA 4MSSA 1ECEA 4U3CA 4ZO6A 3EDKA 4NJKA 5REQA 2P50A 3R12A 1FCBA 4O57A 2PODA 1C9WA 2WMJA 2W6RA 3O6AA 4IG2B 1DWIM 1W1VA 3CZGA 3K2GA 1R9YA 3U48A 4DUOA 1V4YA 3ONBA 1X96A 2RHGA 4OHQA 3V3WA 4LUIA 4FEZA 1XGDA 4LBSA 3LI0A 4JHMA 4PCPA 3W38A 1J6PA 3VNJA 5ECVA 2RDTA 4DO6A 5E0FA 3T40A 2GPTA 4W86A 5CAHA 4C1NB 3MMWA 1J93A 1EJUC 4YVPA 1HJWA 1QI2A 3EB3A 3LHVA 3EB2A 3LRMA 4LC6A 1CGXA 1EUAA 3URNA 5GNXA 3FA4A 2AKZA 3F2BA 4JXCA 2WSKA 2BZNA 2VR4A 2HBVA 2HDJA 3LTPA 1VZWA 4H8UA 4NILA 5I07A 3L5LA 5ABFB 2VDIA 5BRBA 2ZE3A 3Q94A 1MEHA 1TV5A 4MKVA 3VKDA 2DSVA 1Z44A 1A3XA 3DFOA 5IFTA 3PUOA 3S5NA 4FXRA 5FJOA 1AJ0A 4PYSA 2J6VA 4MYAA 5I3JA 5EMJA 4Q8MA 2XWEA 3KAOA 2DZVA 3JW7A 2Z2AA 1R2TA 3RK8A 2OSXA 3OYZA 1JGMA 4PC8A 1ITQA 1R38A 3GTFA 3MTWA 1KNWA 5DCDA 1RLCL 4C6BA 3VIJA 1GCYA 1SZNA 4NZJA 1CIUA 1US0A 3CO4A 4N9DA 3VMOA 5LA2A 4DJED 3SJNA 1H0IA 1KFWA 1P0BA 4HMCA 4CNUA 4UNKA 4H01A 5D30A 3QPZA 3G1DA 2A21A 4TVUA 3WQ8A 4I9MA 4J7RA 3FDGA 2DW7A 3KS6A 3HM7A 4IX0A 3W86A 2PCEA 4JD4A 2YA0A 1O60A 3V75A 4EKJA 4AVFA 3GAKA 3PHAA 1GVSA 1KKRA 2YLLA 2ZUNA 4CEUC 1IXNA 7A3HA 4BK9A 1E6ZA 4NAFB 4DVOA 1OVDA 2TPSA 5A1AA 3V0UA 1SJAA 2QZRA 1Z32X 4GZ7A 3ANYA 4MPQA 2FHBA 5BOFA 5K7JA 2OELA 1W2VA 2RJGA 4WR3A 4V28A 3S6TA 2YKKA 3MT1A 5DF0A 2A3LA 4PTMA 3L9CA 4UTMA 2W5FA 1DL3A 3WD2A 1A50A 3PS7A 3T0AA 4WDXA 3GBDA 1S2TA 5FEZA 4XD3A 3I7QA 1PEZA 3RF9A 4G7EB 5DXYA 2YXOA 2CIPA 2DW6A 2ZC1A 1ZTVA 2WVTA 3VYLA 1EXPA 1XM3A 3DIPA 1E0TA 4AX7A 1UIOA 2PDJA 2XFYA 2CLLA 2QEZA 2VFFA 3VD3A 4DXKA 2R8WA 4S38A 3O15A 2R94A 2NV1A 1AUSL 2H8ZA 3IV3A 3QFWA 4CKQA 1JDAA 4MWAC 2ASHA 3FA5A 4CNNA 2VC5A 2G0WA 1KFJA 3K8KA 1FHVA 4IOTA 4JYEA 4LUJA 4Z2LA 1KV8A 5DT7A 7TIMA 3PZOA 3EWUA 1FFRA 1VFSA 4HU0A 4DWSD 1CXHA 4JPGA 1VGAA 3THDA 1ITXA 3RU6A 4DJEC 3BZGA 4LY8A 1MNZA 1YTKA 4F2TA 4B5SA 4UFLA 1V3KA 2QAFA 2HJPA 2X05A 2PTZA 4LT9A 4WHBA 3ZSTA 5LHFA 1K9TA 1OT1A 3HJZA 1XFBA 2WPGA 4KEZA 3VD5A 2NSOA 2C16A 4HCLA 3IAPA 1W9VA 3LCHA 3SAZA 2PDUA 4UTWC 2QLYA 2WSRA 1CBGA 5CPMA 1W3LA 1V0LA 3QLLA 4BQ2A 3W1XA 2OJPA 1UBPC 3UWQA 1W3TA 3W1PA 1VAHA 4H8VA 1JDDA 1XLDA 4ICNA 4M6PA 2XIJA 3EOOA 4JEQA 3STGA 1C92A 1KTBA 5GJNA 4CEXC 4J2MA 4ATLA 2ZKMX 1I2QA 1FCQA 1WZAA 1UJPA 2R6OA 1IV8A 3DENA 3HG3A 3DUGA 4IP4A 2YYUA 1NP0A 1Q6CA 3GB6A 1V02A 3B9OA 3JU2A 3R13A 2FZMA 4UXDA 1OIFA 3WLNA 4D6FA 4DHGA 2P88A 1BF2A 3MZNA 2DVTA 2OO6A 1HVXA 3CZJA 4JICA 2XTKA 3T55A 3BTNA 4R3UA 3H4GA 4HYVA 4QCEA 4E4UA 3QZAA 1AQHA 1AODA 2A7PA 1PCWA 3IJ8A 3V16A 3IJLA 3U2EA 3H21A 2YLAA 1UKSA 1X1NA 3O3RA 2XIIA 3QKZA 4M81A 2EF9A 3BW4A 1F3XA 4NXSA 2IKGA 4UBPC 2PSNA 1IEIA 1A5BA 2Z6JA 1XBZA 4HNUA 1GQLA 4O0ZA 1PX4A 3FLUA 1WA3A 2QUNA 1DTUA 4A2RA 3T2OA 1KM3A 3INPA 2CLPA 5ABEA 5FOOA 3E9AA 2GJXB 4KFOA 3BLKA 1K9EA 5CJNA 5A6BA 3PSVA 3M0ZA 2YIHA 3JRKA 1I1XA 3IIZA 4GFSA 2ATSA 5JUVA 1V51A 3WLIA 5AZ0A 4DLFA 3W82A 1UR9A 1KLZA 4ATWA 3QHOA 4Q4PA 4Z2GA 5MHBA 1UR4A 2R1LA 1XLKA 4ZQMA 3WLLA 3RLGA 4REQB 3BSGA 2XGIA 3WQCA 1A4MA 3WK1A 2YCLB 4H2CA 1KFKA 3T8QA 2OT1A 1G6CA 1QNVA 2ISSA 5C55A 3E6EA 3BCJA 1YBQA 3CLWA 4GYPA 4H7ZA 4R33A 1E3XA 3ZIZA 3GH4A 2FPTA 2Y2WA 3R8GA 1RQBA 2X7WA 3NO1A 4M1BA 3W22A 1UWRA 1VJZA 2VENA 3NJ3A 5J5RA 3TYZA 1NDWA 3S6DA 4C6NA 4O1BA 1BWVA 1UH4A 2FMOA 3LTSA 1WUEA 4U4MA 3O8AA 4YJ5A 4YTUA 4KCTA 1U33A 4N0RA 3VE9A 5CLTA 3EBVA 3FOKA 3KBVA 4N42A 5HNRA 3PZTA 3GG8A 2OWCA 3GTXA 4Z2IA 5CG0A 3VIIA 4U3AA 4QJ5B 2UY3A 4GK8A 2J8GA 5FJJA 4DWSC 3Q65A 1ZCOA 4PCNA 4Y96A 3N4EA 4J3ZA 3NIYA 4LVDA 1TRIA 1QI5A 2C1HA 4HYRA 3IVSA 2YXGA 1H1NA 4MG4A 3N2TA 3A4XA 4KFNA 4J4KA 5D2TA 1QNQA 1JDFA 1J8VA 4JTQA 1LQ2A 2EKCA 3N2MA 1Q7QA 3WNMA 1E4NA 4FP1A 4GOAA 3SADA 3NL3A 4UR7A 3B97A 2O0TA 4GNVA 3OLEA 1M41A 4ZENA 3MANA 3OB8A 4P8UA 3WD3A 3T4CA 3JR2A 3AXKA 4KWWA 1MFVA 1XH0A 5REQB 4JTRA 1XIDA 5EMYA 3BMXA 4MWAE 5IHRA 2GDUA 3T07A 1BXBA 3IRSA 3ITVA 4XIAA 4ZA0A 3BMVA 2JF7A 1W1YA 1ZBKA 3W7EA 1BEUA 1VRDA 1AW2A 3AIUA 4PMOA 3CUXA 4A6GA 3OTRA 1SW0A 5CGTA 5GVJA 1JZ4A 1IF2A 3LDVA 3OGVA 4L9XA 4QISA 2JQXA 1HL9A 4I5XA 1S5TA 4C1NA 1XFCA 3CC1A 4AG0A 1F05A 1E9IA 1FWWA 3P81A 2WC3A 1R3VA 3IUHA 2E9BA 3T6CA 3L2LA 2G95A 2GDQA 1E0UA 4RPPA 2J7CA 1K4GA 4JTUA 1EJTC 4H1ZA 1ZAHA 3GW3A 2EJ1A 4E5TA 1XD0A 1QK0A 2I16A 1WBJA 3WLTA 4KRUA 4MMWA 3A24A 4ZZ9A 1N8FA 1PCKA 3A5VA 4HZMA 1QFEA 3LPFA 1EZWA 2VGFA 2Z2BA 1S5NA 3V18A 1IXQA 3M0XA 1I6NA 4OBSA 4GD0A 4H41A 3G1RA 4XQ6A 2BLEA 4LF2A 2FJUB 4JQAA 4XBSA 3KFTA 1PXGA 1AW1A 5F2MA 1UZDA 3SUSA 1H2JA 1L8NA 1H09A 3VPLA 1P4CA 4HIBA 1OINA 4QAWA 2B31A 3HFYA 2PS2A 3K5XA 1B31A 1EJ7L 3VD7A 1PTDA 3NQEA 4RDWA 4S3KA 1NAL1 3CS2A 1WO2A 1XCFA 1W9XA 1W9UA 4GIYA 4M6QA 1H7RA 3VIOA 3WQWA 4MAVA 3S9YA 1YYAA 4DBEA 4D6EA 5AN7A 1E6QM 2G3JA 2G3IA 5D2VA 2G8ZA 3LG3A 2XSBA 1MQQA 4AY7A 3ENLA 1XDLA 2PDWA 2OLSA 2WMFA 3HZ3A 4TIMA 1G94A 5CPQA 1HP4A 1XKYA 1ZHAA 2WC4A 1UCWA 4E6MA 4M80A 1AQFA 1RZMA 3NGFA 3P2VA 4PUDA 5I77A 5LIKX 3S1GA 1RAKA 2XFFA 5BMXA 3E0WA 2NXIA 1TV7A 1R3RA 2HWGA 3BW3A 3FS2A 2ZA2A 2DVUA 2ZWZA 1XINA 3NQGA 2VELA 3L5AA 2Y5EA 4PTXA 2NT0A 5E0CA 4YS1A 1Q5MA 3MSRA 4XBKA 1TPWA 1SO5A 4IPLA 3WQOA 4ZMGA 4WY0A 4V15A 2EG7A 2KX9A 3MBFA 4LW7A 3B8IA 4PL1A 2X1RA 3U0HA 4J1OA 4UCFA 1FWGC 3MO4A 4LYPA 1WKDA 3MKKA 3S1WA 1OX5A 3KVLA 1S3TC 5U4NA 3N1AA 3HPZA 2AL2A 3JVAA 5FJPA 4JIEA 1WKFA 3EKZA 5D2YA 1C3FA 3CGTA 4PA8A 1VS1A 2XN2A 1NQ6A 4RLIA 3VOJA 1KGUA 4C1KA 2ZRVA 3IVUA 4GYFA 1UH2A 3APGA 2TSYA 2AAAA 1OCQA 3QR1A 1SZRA 3UZWA 2HBXA 3OZOA 1RR2A 3IV8A 4QG9A 3S2NA 2VOTA 2DZSA 1HW6A 2PCQA 4O1FA 5FF4A 3RGTA 5I5RA 2X30A 4JTLA 1F76A 1ZQ5A 3C2EA 2EPKX 4GYJA 2V8ZA 4GI9A 3W7DA 3G3DA 1PB0A 5FSDC 3TJIA 3PJWA 2IKIA 3LHWA 3GTNA 3NZPA 1E0XA 3QY6A 3I4KA 1U5VA 1ZCCA 4IIHA 2BSLA 2Z25A 4N02A 3NDOA 5DEZA 1ZU8A 4JCMA 1OYCA 1GW1A 1ZFJA 3W7MA 1U30A 2WSYA 3LQGA 2YL6A 4NNCA 2VVSA 1NY1A 2ZUVA 3DESA 3E12A 3VOGA 2INEA 4A8NA 3GYEA 3LGGA 4H9XA 1KA9F 2D2JA 3BLOA 4N9CA 5A6JA 4PL2A 4EAMA 3M44A 2DPEA 4IZGA 3PULA 2EPOA 5JU6A 3YPIA 1JYWA 1TE6A 3VC6A 1KRCC 3FXYA 5HNTA 5FA5A 1G01A 2F2KA 3A64A 1YW1A 3O06A 4ROPA 4R53A 4PBFA 4I8DA 4Y90A 4UR8A 2QGYA 4XAZA 3EWWA 3ARSA 4PEKA 4ZO9A 3GLCA 3IGHX 2G3NA 4QXIA 1QR7A 4P7NA 1HGYA 3NQCA 1YDVA 1AVAA 4XZBA 4DBSA 1RP8A 5A2CA 2AGKA 3NQBA 3QOMA 4PMYA 4NI3A 2VX5A 3I3BA 3TZFA 3ZLFA 2QIWA 4IIDA 2WQDA 4W88A 3CH0A 1F73A 3NZRA 4EK7A 4UTFA 2DY3A 4Q4MA 4GG9A 1NDYA 2A4AA 1TJ1A 4CD6A 1RK5A 2WZEA 3I4EA 1PKLA 4TMBA 3V35A 1I4NA 1DE6A 4W5UA 2FB3A 2Z0IA 3LHYA 1S2VA 5LXXA 4B3KA 3OEXA 4H83A 3BC9A 1FH8A 4JTFA 2QW5A 5D9MA 4JFVA 4HVXA 3I65A 5HWMA 5DRIA 3K8MA 2VL4A 4KWVA 2EJAA 1ICSA 4LALA 2TMDA 1VHNA 2PRLA 3DFPA 3NO3A 2Y5JA 3PZ9A 4A29A 1M01A 2E40A 4DO4A 3BQ5A 1TQXA 4WK9A 2BVWA 3VILA 4UZSA 1QNRA 3NGJA 2QF8A 1H41A 1DIKA 3IJDA 2PEVA 1WDSA 1EP3A 3W7LA 4GIEA 3S5OA 2E8ZA 3G6LA 1L6GA 3NQAA 4MB5A 3M5ZA 4FS9A 2E8YA 1GZJA 2Z28A 4ASTA 1PKNA 3PM6A 4KQNA 4KRZA 4AVNA 3AZTA 3U4FA 1KKOA 2XM2A 3CYJA 4O10A 1KM5A 4LX4A 3N13A 1XUUA 3WDRA 1Q2RA 3CK5A 2Y61A 2C8NA 1B2YA 2ZFAA 3AISA 4NVTA 2OB3A 3SUTA 4WZHA 4HA1A 3BPWA 4BQ5A 1RPXA 7PTDA 1K9DA 1OB0A 3ARUA 4BQ4A 2YX0A 5C54A 4BHYA 1X39A 1CXEA 4Q4OA 4JAWA 1EJSC 3VMPA 3R10A 4YTRA 4AYGA 2RDUA 3EAUA 1M65A 1NH6A 3BAWA 5HUOA 5T91A 3WLSA 2JF6A 3WYZA 3AI0A 4JY9A 1OX6A 3W88A 3E49A 1GNXA 2CHRA 1XRSA 3M7WA 4A3YA 1YLVA 4WXZA 4PTDA 2GUUA 4JY8A 3G0UA 2WVVA 3CAQA 2FFCA 4QEHA 3C5QA 3WJXA 4XISA 4LBRA 4J3UA 1MRAA 1F61A 4P7LA 5CZTA 3KP0A 1OCNA 4GQBA 4RE4A 1OZQA 4C6MA 4QROA 4RCXA 3QGVA 4TX6A 2Y62A 4Z0SA 4HSHA 4M19A 5LZLA 5CC5A 4QE1A 3M0IA 1ZS2A 2B7NA 4GBDA 4KH2A 3UP8A 2XIMA 1BVZA 1XX1A 1DWAM 4FALA 2Y8KA 2RJHA 1KFBA 1E9LA 1ZBVA 1IZJA 3TYAA 2ACUA 2XYLA 1NEYA 1KBIA 4FLRA 3IK2A 2ZIDA 3L2MA 1P6CA 1TB3A 3FJNA 2OEKA 1YNQA 1QAPA 1E55A 5EBUA 4I7UA 6TIMA 1JEZA 4M7TA 4UZUA 4Q7NA 4TO8A 4DLMA 2B4GA 4NAEB 5HUPA 1G67A 3H2OA 4JN8A 4MNJA 1Z41A 2BNJA 3HF3A 5LIYX 5GPRA 1WE5A 3PPGA 5FF0A 2GVLA 1PWLA 2R91A 1GUVA 3STCA 3P74A 4O13A 1P7TB 2YGYA 2GGIA 1LROA 3F5LA 1JIBA 4R34A 2WMGA 3TA6A 3MSGA 2HRWA 3L4UA 1HJVA 3N19B 2QT3A 4E2OA 2C3ZA 1LUCB 4NSBA 1W9PA 3J7HA 3KZSA 3EX2A 1NF0A 4MGGA 4JS3A 2QDDA 1GGOA 1M53A 3LY0A 2XH0A 1EPXA 4LVBA 3BV7A 1KRMA 3U5UA 4O17A 1EH9A 3A13A 1ME7A 2IPJA 3UT0A 1J9YA 2WMHA 4PMRA 2ZA1A 1CNVA 1M9HA 2DDXA 5RUBA 2ZX8A 3RG6A 1JD9A 5TNVA 4LTSA 3WUFA 3BE7A 1F7BA 4YPJA 3F4DA 1VQTA 3O6YX 4GYKA 4AX6A 5HJXA 4BY3A 1A0DA 1QVBA 3ZJKA 3PK7A 4GH3A 1LOSA 1UD3A 3W25A 2J62A 1KBJA 3CIXA 4NI8A 1E1CB 1TWDA 3QC3A 3S6OA 1NDVA 4MJMA 1ALDA 3B0UX 2UBPC 2NUYA 1UHVA 1WX0A 1DJGA 3ZZ1A 5I0DA 4DEFA 2E6YA 3BSHA 2VGBA 2QXWA 1QNSA 2WJZA 5AY7A 3ONCA 3V1PA 2XGZA 1AZ2A 2VM8A 3ELFA 1UKPA 5MKGB 3WL1A 3ES8A 3GS6A 4B5TA 3HURA 4GABA 3ZR4A 3VINA 2PD5A 4AD3A 3BLDA 1NOWA 3KOYA 3NQ2A 3SSZA 3GH5A 3M6DA 4NL1A 4LYKA 1FBAA 3GDRA 3CPRA 6XIMA 3G1AA 1TTPA 2QHAA 2ON3A 2E6DA 3CYVA 3OIXA 3QF0A 4UMAA 3G1HA 2GK1B 1SMAA 3CQKA 1YEYA 3V0TA 1MZHA 3AROA 3BG9A 4LV4A 1TMHA 3HPAA 4FOUA 1NELA 1GQKA 2D69A 5E1QA 5D38A 3R4IA 4MHBA 3HG4A 8XIAA 5CPTA 5XIMA 3UU0A 3NOYA 4CD4A 3E2RA 3T0CA 4KT2A 5HMSA 4I9JA 1QNPA 4Q7BA 5CSSA 2WANA 4D1JA 4AF0A 1UWSA 4H19A 4AB4A 3VUSA 1U5JA 1KTCA 1JUBA 2X09A 3ARZA 1BG4A 1H7XA 3ITXA 4L56A 4F48A 2X0SA 3TCSA 2PZ0A 3AHZA 3M5XA 2QVNA 4S2CA 4EIVA 4ALDA 1TTIA 2BMBA 1CTNA 2GSHA 2OTDA 2FKPA 2V0TA 4LUTA 1J0IA 1FHLA 4ZFCA 2FDSA 3DCPA 4AZIA 3N34A 2G37A 3RYSA 3URQA 4DB7A 3M4HA 1NFGA 5CZ0A 3F4VA 4OZOA 2HV5A 1HXJA 5J8LA 1C7TA 4EX4A 2OEJA 1WYIA 4ADUA 1NARA 4EE9A 1N55A 2VC7A 3PUEA 1THFD 5E09A 1CLXA 4PRWA 2FMNA 2I7GA 1JF6A 3C2FA 1BPLB 4AFYA 1E15A 2F84A 3SECA 5GJPA 4Z2KA 2XSAA 1C9DA 2VD8A 1RCOB 4DYJA 4JTEA 4PODA 1R9XA 5CPLA 2Y24A 3PBYA 3IIXA 4ZXLA 4POCA 5PTDA 4IL2A 3P3BA 4MY1A 3TH6A 4BWLC 3WFAA 1TCDA 1HX0A 3N6QA 5CGMA 1S5VA 3B8UA 3KLKA 1JPHA 4IMCA 4YCOA 3PPCA 1OBAA 2ZE0A 4F0KA 4DYEA 4I6KA 5G2HA 2W67A 1TZ9A 4UNLA 3LXCA 3UCDA 1VHCA 1LT7A 2CBVA 1NF7A 3DFTA 4J2PA 2NV9A 3V7PA 3TZNA 2DSWA 4U2YA 3H6OA 3OLGA 2X1UA 1I1WA 2P53A 3GNDA 4GCAA 4KCWA 2OWXA 3EXSA 3TUUA 2J66A 1UKTA 1E5NA 3T44A 3EKLA 3U7VA 4Q8NA 1UWTA 4QG8A 2GUBA 4GXMA 2FGZA 1MRQA 2VKZG 4N2YA 5DMNA 1DJQA 2XFWA 2OX4A 3S83A 3V5OA 3WEZA 4V27A 2CNCA 4I3GA 3W6YA 1VFMA 1IT0A 2V9DA 4GNJA 1G7VA 4M82A 2PGWA 3T0TA 1JPKA 2DH2A 2XUCA 3W3OA 3MVTA 1I2PA 1XYFA 2ALRA 4DQWA 1PHWA 3QW4B 1G69A 4FOJA 1I60A 1J01A 2OVLA 4JIQA 2FPYA 1VLWA 4CQ8A 4DJDC 4DELA 5D9PA 3NCOA 4IMFA 2PDIA 4W84A 1DXEA 4Z1AA 4K3ZA 4OBTA 4LAZA 1XIIA 3BZJA 2ZZ6A 2V5BA 1H7WA 4MUZA 2VRJA 3M16A 2ZRZA 3BANA 3A6OA 1K8ZA 1M7JA 1KR1A 3AAMA 3WMBA 1XQLA 1WUFA 3AXIA 4PBGA 3I6TA 3MY9A 4GNKB 3LPOA 2HCVA 4W8LA 4MUPA 4I9AA 3K1DA 4FX7A 2A3BA 4HPXA 1KWGA 2CZ5A 3BO9A 4DF1A 1EGVA 1GVRA 3IVTA 1XG3A 4MDOA 1KO0A 2QJIA 2Z2UA 4Z42C 3CL6A 3WLQA 2PGRA 4EPEC 3ARXA 2E5CA 1F3EA 2WNZA 3PFRA 3PVFA 2YFOA 3UPMA 4AEOA 5A8NA 5AC6A 3KUMA 3H23A 3W2LA 3MBDA 1VBRA 2JGYA 1P6BA 3PFMA 1BYBA 4GQGA 1PBGA 2GGHA 2A6NA 1V02E 3TIMA 1TELA 5D8WA 4WIWA 3CXOA 3QBUA 4GXPA 2WHLA 4Y8FA 2AL2B 4IGHA 2PLCA 5DELA 2FTWA 3PJXA 3NAVA 1IWBA 3KL5A 1AL8A 1X8FA 1SSDA 2A3AA 4LS1A 2V82A 2DT2A 3E5PA 5BW6A 1V6TA 4FHAA 1H50A 2D0FA 3PZMA 2GYIA 1SPQA 3UBPC 1JXJA 3B9DA 4EOUA 4UFKA 4QIUA 1ICPA 1T5AA 1GVFA 4AC7C 1VIZA 2JFEX 1E40A 3V5CA 3B3DA 3W70A 3AYTA 1KXQA 5I3FA 1TWWA 5IXEA 3SY8A 2H9AA 2JGQA 4S3CA 1XCWA 3SIZA 4B5NA 1LG2A 3EMCA 3OBAA 4RX0A 3GXFA 4RL3A 3E2VA 2D2HA 1ZZMA 3N2CA 4FNTA 3VCNA 3H7RA 4AD1A 1H51A 2UZ9A 5DFAA 4AIOA 3RPDA 1FWSA 3IACA 4QR6A 2ZUMA 3LQLA 1QW8A 3QFEA 4FOKA 1VYRA 1IWPA 3NVDA 2PTWA 2QR6A 3B9NA 4DPQA 1LORA 3P0XA 3D3FA 1AG1O 1MW0A 1R9ZA 2ZADA 3QZEA 4IFKB 4R9XA 3DYPA 3F5JA 4A8LA 1TWSA 3W26A 3R0UA 2GWNA 3R0KA 1SZFA 4KMQA 2ZVRA 3CBWA 2IQ0A 4QJ1A 3VM5A 3DBPA 4AISA 5I7GA 1O5QA 3PWIA 1S38A 3VGDA 4QE5A 3KM8A 6ALDA 3CAKA 3NSNA 2XVKA 1CW2A 5H8UA 1XLEA 3CU2A 1WOAA 4XD6A 2GGGA 2YCIX 3MYPA 1BD0A 3SJ3A 1GORA 1K7EA 3APTA 4US6A 2DH3A 5KINA 5J04A 4H7VA 4FF7A 3U2OA 2WM0A 3WENA 3NEVA 3Q67A 4O16A 3BGJA 2ZUWA 3STPA 3LERA 1O1ZA 4IUOA 5IRPA 1HJXA 3BW2A 2YW3A 3SN4A 1OFRA 2FZBA 4H8HA 5BRPA 1UKQA 3QY8A 4PZVA 1BGAA 7REQA 4IP5A 1TVPA 4XAYA 1O5KA 3LV5A 1CXIA 1XISA 2A3HA 2VRKA 4CN1A 4FSAA 4JYDA 1U5HA 4M0XA 1V6VA 1CB2A 5IDZA 2H90A 2GJPA 3PAOA 2GJRA 3FHAA 2VZTA 3WZ0E 5AVHA 5E6ZA 4GMEA 4LB4A 2BB0A 1YTEA 3WLRA 1ITCA 1LLZA 5HR7A 3JZEA 3AZSA 4J40A 4NKCA 4X0VA 3ITGA 4QG6A 1JXKA 1CGYA 4PUMA 1M6JA 4F2BA 3WF0A 4HK5A 1FWBC 1TPVA 2Q6ZA 3R6IA 5KEZA 2RDWA 2OT0A 3CM4A 1JDCA 1XLFA 4Q4RA 1GVIA 3BK0A 4QLJA 1TWIA 3TROA 1VCFA 4JX5A 1XYMA 4M1RA 3U5YA 2XZ7A 4AWEA 1GHRA 4W8AA 2IPGA 2QV5A 3LZ5A 3BG3A 1CB7B 4H7CA 2EBNA 3EEGA 4HMEA 3PZQA 3M64A 2B81A 4PN2A 2BY0A 1GQJA 3ITTA 3O63A 3P14A 4DWSB 1QOQA 2DZWA 4HU3A 5FF2A 3SEPA 4M5PA 4F8XA 3WJYA 3VK5A 4LCQA 4JQ2A 2BOFX 1IR2A 2WLZA 1VC4A 4XZ9A 4GLEA 2VFGA 3GK0A 4GBUA 3VNLA 1B1YA 4JIIX 4OJYA 3VNDA 4MZ1A 3FXGA 3VE7A 4BF9A 5I79A 3VTRA 1IE7C 4US5D 4UTIA 3POHA 2QCFA 1ZNNA 1GPFA 2P0OA 1T40A 1B3WA 4TMCA 4W85A 3PG8A 5F4XA 4I5UA 3GG0A 1E73M 3CTLA 4ATDA 3WKZA 1L6SA 5DY2A 1R30A 3WL0A 3VNIA 3WH8A 1L0PA 4C1LA 1EWEA 1L8PA 4OV9A 3Q58A 5HATA 5ABFA 1RQHA 2REQB 4JN6A 1UZ4A 1PPIA 3EOUA 4O1DA 3HQ1A 2AL1A 5F2GA 1ADDA 1I2RA 1LLOA 4D8ZA 3SW6A 3OVRA 1IIHA 3VD9A 3VC5A 3EOLA 1LP6A 3AWOA 4UR9A 3E0LA 4TUFA 3C0JA 3O2LA 5DBTA 1GEQA 1OD0A 3OZPA 1TIMA 2FPVA 3R11A 2GZXA 2CBUA 2YCLA 4RPQA 4AU0A 1D8CA 5IFPA 2VDHA 2YL5A 3SO7A 3RILA 4WEVX 3CB3A 3A4WA 4A05A 2ZBTA 1XCXA 4EAYA 4L6DA 2Z24A 3O6CA 2NQLA 1XLBA 3ARVA 4GUIA 4X61A 3PZVA 1BQGA 4DBUA 1NQKA 1PAMA 3NL2A 2F6KA 2GJXA 4K8GA 2PE4A 3RO6A 1UWQA 1GVOA 2Y1HA 1OJXA 1GKPA 3QTPA 1EOKA 3H2CA 3MMUA 1FWJC 1VR6A 2GGJA 1VBJA 1WDRA 3UW6A 2I9UA 1GONA 1IEVA 1XYZA 2WSQA 2GFTA 3STEA 3GDLA 4XSLA 3FSUA 1PWMA 1W1IE 3I7SA 1TFVA 2NV2A 1FDJA 1B3VA 2HEJA 1K7FA 3DOPA 5KZDA 1P43A 3VZZA 2P3EA 1XICA 3UERA 3MUIA 5LIWX 5LXEA 1WAUA 2HVOA 4MFDA 2EPMX 4NX5A 3GC2A 3F2DA 2ICSA 4ICMA 1XW8A 4PCSA 5AHIA 5D37A 1BFNA 3TN3A 2F6XA 3UG4A 3KOXA 3H2EA 2YCEA 3WQ4A 1WP6A 1AQ0A 4LCRA 2P10A 2NX3A 3QV8A 3IJIA 1CDGA 2A85A 2OEMA 2ACSA 3L4ZA 5CC7A 5HXMA 1G4SA 2DSUA 5FESA 3QPYA 5FI8A 2Z1KA 2GVGA 4KBXA 3PR2A 2Y7DA 2DEPA 1RHCA 2G3FA 1TV4A 1LOLA 1TR9A 2E5DA 3LGEA 4FZIA 3WNLA 3W7OA 4HN8A 3W84A 3G0SA 5BOEA 4C65A 4F0RA 2RGMA 5I23A 3LX9A 2BVDA 1N82A 3SY1A 3TW6A 3GZ3A 2F61A 3GG1A 4BF7A 1OX4B 4HNOA 4GY7A 3ZJ8A 1NWTA 3L65A 3ANVA 1AK5A 2WWDA 1H5YA 4JNYA 4ZQPA 1FWDC 3CH9A 4O1AA 4KWUA 1HJQA 2OOGA 4M29A 4UTTA 1IXOA 4Y7EA 5BROA 1BF6A 1W1TA 2VEGA 1A0CA 1XP3A 3S42A 2ZDSA 1OZMA 1VPYA 1Z7AA 2GLKA 3DHUA 3ABXA 1HKJA 3GRIA 1W91A 4L9YA 3DHFA 3GE7A 3VIHA 5HR6A 1JR1A 3APYA 2D0HA 4NZ4A 1TYGA 4EWND 1F74A 4C5ZA 2NX1A 3O05A 1JPMA 3H2NA 1RH9A 2ZZ2A 3EX1A 3NEHA 2GGEA 3SN1A 3WMSA 2OOFA 3I3DA 2DV0A 4J27A 3NNTA 1GEHA 2PMQA 2AMGA 3CEPA 3CEUA 4JDBA 2CEQA 3PTQA 1YPIA 4G7EA 4R7JA 4A3UA 3KHJA 1P0NA 4H4IA 3BUVA 3QMSA 1XLJA 2PBGA 4UFJA 1DBTA 2POTA 4J35A 3GDMA 1XPGA 4PUJA 4AZ5A 1YDYA 1QPNA 3P61A 4BF5A 3GZAA 1BG9A 3NPWA 3W24A 4AMCA 1XRFA 5D02A 3ZR5A 2XG9A 3TK7A 3C56A 1ZPTA 3DG6A 2XN1A 1B57A 3OVPA 3UWYA 9RUBA 5AHNA 5E9XA 5D05A 2VFDA 4QS6A 2J6XA 2WSPA 2VFIA 3VX0A 1JYXA 3UVIA 4RKAA 4PUWA 1EWDA 3MYOA 4O0QA 1O68A 1MSSA 1M5WA 1OF8A 4LUYA 4EPDC 3HG5A 2V6AA 2CETA 3GFZA 2GOKA 2RAGA 2PA6A 4AD5A 4HHLA 7XIMA 1JYVA 3ABRA 1FWEC 1RBOB 1E71M 4NZ1A 2DT3A 3LENA 2I5QA 2QDHA 4ZB0A 2YDAA 1Z8AA 1TQJA 1PZ1A 4BI5A 3P62A 1YMYA 2Z1WA 1LQAA 1UP2A 3DG3A 3ZYZA 1UD5A 1WZLA 3N25A 5XINA 4U5KA 1GQNA 4G1KA 3IJ7A 1CGWA 3ME3A 1W8SA 4M7SA 1H49A 3CIVA 4OUIA 1JYNA 1OFDA 3CL8A 4L64A 4RDZA 1Q7MA 2QPUA 1EDTA 2D22A 4RJEA 4MKNA 2E1DA 3ISIX 4IICA 4RW3A 1S2CA 3W1RA 3SFWA 3TQVA 5M5DA 2A0NA 3GVVA 4LV9A 3T78A 4PCFA 2EAWA 3UJRA 1LDCA 2X0YA 4CN4A 1LWIA 3Q4DA 4RV3A 4L7ZA 4DBWA 1YNYA 2A7RA 3NPUA 3TQ0A 1GG0A 2CCRA 5JBFA 3TTSA 4HHPA 3UA3A 3PWAA 1W5PA 5LNRA 3FYOA 3F1QA 2WZHA 2OU4A 2ZWYA 4RNJA 5A95A 3H55A 4MY8A 5D9NA 3ZWTA 1Q4NX 1NSJA 1B5TA 2I9EA 2IMRA 3OPSA 2W79A 2J9YA 4P7RA 1XIHA 1A47A 2IQDA 1RUSA 4P7QA 5I00A 3DN5A 1JZ6A 1E1EA 7REQB 1LRTA 3TN5A 3T4WA 3B0XA 4GCXA 4GY0A 5LIUX 1CYGA 4DX3A 2PTXA 4J3SA 5CC6A 4F0SA 4GUHA 4HNNA 3LGDA 1GTEA 4M51A 1P6WA 3UR5A 2PAJA 5I09A 4B9ZA 2VZSA 1D3GA 3W01A 5JIPA 4H6QA 1JQXA 2JIEA 5GNYA 3EA2A 3CQHA 2QCDB 5FAJA 2C13A 3TVAA 3TYBA 4RZ6A 4I8YA 2IPFA 1DJNA 5ECUA 4E8GA 2FFIA 2DZBA 3NOEA 5EGRA 3ZT7A 3VO0A 3LEPA