4ZFMA

Structure of gan1d-e170q in complex with cellobiose-6-phosphate
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
474
structure length
459
Chain Sequence
HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNQQNIFISFGYRLGLHPPGVKDMKRYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVGTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Putative 6-phospho-beta-galactobiosidase
publication title To be published
rcsb
source organism Geobacillus stearothermophilus
total genus 184
structure length 459
sequence length 474
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4zfmA00
1XYFA 3IJ7A 3PZOA 3NSNA 4AZ7A 5GNYA 2DPEA 1CXFA 2W61A 1PX4A 1M01A 2WVSA 2BHUA 1O6IA 1GPFA 1E0VA 1JDAA 2QMJA 1IZJA 2VJXA 1MW0A 3CUFA 1JFXA 4BA0A 1ZBKA 4XB3A 1E40A 2J7FA 1MQPA 1I1WA 2UY5A 1EDTA 4Z2HA 3TP4A 1Q6FA 1ISWA 4HPHA 3NJ3A 2BV9A 2XWEA 2WMIA 2YL6A 1TVNA 4R5EA 1GUVA 4CCEA 1W9VA 1XGZA 1EGZA 2VVNA 4HA4A 3N17A 2BHYA 1SMDA 4F9DA 5FOOA 1HKKA 3RO8A 1OB0A 1ISXA 1H0IA 1VAHA 3W82A 2VQTA 2WSPA 3FXYA 4UFHA 5IHRA 2PWHA 4D6JA 4AZCA 3AISA 5ABHA 4OZOA 4HTYA 1J11A 4UFMA 3T0BA 3VIFA 3GBDA 4BQ4A 4UOQA 4HZ8A 4XZWA 8CGTA 4P7RA 4M29A 5A6AA 2G8ZA 1LL7A 3LMYA 3L2LA 3VUPA 4RL3A 5HDRA 3MMUA 3OGVA 4E8CA 1J0HA 2UY4A 4LPCA 1FH8A 3ZQ9A 4AIOA 1C93A 4JFWA 2XYLA 5A2AA 4WJXA 1CGWA 1GONA 2VX7A 1KXVA 2DIEA 2CHOA 1EOKA 4FF5A 3K8MA 1E6ZA 1HJUA 3BAYA 1PX3A 3WNPA 1E6NA 3QR3A 1QBAA 1M04A 4PMQA 3FN9A 5A6MA 1KGWA 1D7FA 3O2LA 2BY3A 2WZEA 1BAGA 1TFVA 4Z2GA 5BRPA 4PRWA 3PZUA 1OM0A 3BGAA 1R7OA 1AMYA 1ECEA 4HOXA 3GNOA 3PZVA 1HP4A 2UWFA 1EIBA 2ZUVA 5CSUA 4U2ZA 2WLYA 3EMQA 3IK2A 4EANA 1P6WA 2W91A 3AHVA 4D6GA 5C70A 1V0KA 5E0FA 1OD8A 2BY2A 1KGUA 4TXEA 4AWEA 3RPMA 3VX0A 1V6WA 4B3LA 5JBEA 3VINA 2Y5EA 4H2CA 4W93A 1RPKA 2DGAA 5GPRA 3CHEA 1M03A 3OBAA 1OGBA 2DH3A 1RD6A 2A3AA 1E1FA 1W9XA 1DWGM 1WDQA 3NUKA 1HL8A 2BVYA 2YIHA 3GH4A 2V5DA 2OWCA 3VDCA 5GNXA 1EDQA 1R8LA 4RE4A 4S3KA 1W3KA 3B8SA 4UQAA 1TA3B 4MJ2A 1V02E 1J0IA 2JEPA 4GI9A 4P8WA 3F5KA 4FLRA 3A4XA 1C8YA 1UQYA 2XVNA 3TTYA 4GZIA 3TONA 3MU7A 2DIJA 3KL5A 1FFQA 1WE5A 2ZIDA 3PZTA 3VDAA 2VL4A 5A2BA 3WDJA 1LJYA 2ZX5A 2CKSA 1Q6EA 1DHKA 3AMCA 2EO7A 4GZEA 4M8UA 1BGAA 4XZBA 2E0PA 4MNLA 4PSPA 1V6VA 1UZ4A 1J12A 1WZMA 2BVDA 2GK1B 1UWSA 3KL3A 4AC1X 1WDPA 2OWXA 4CD4A 1QW8A 3K4DA 3GNRA 3K46A 4IPLA 4UQCA 3AIUA 1CPUA 4PMDA 2PWFA 1ITCA 2WM0A 3ZT6A 1PIGA 3U5UA 3CZEA 4GPNA 5I79A 1PEZA 1CENA 2VRQA 3GTNA 4MB3A 3VMNA 3L4XA 1HIZA 1FP9A 1EHNA 1E6XM 3AFBA 3ECQA 4JFSA 1LL4A 1AQHA 1M53A 3AI0A 5IDIA 2BS9A 3EMCA 1V02A 1V3LA 4JAWA 4KH2A 4AW7A 3ARRA 1J0KA 1E5NA 1GQLA 1JZ7A 3VM5A 2W92A 3FY1A 1UD6A 3GM8A 1V0NA 4W88A 4D1IA 3NIYA 2WKLA 2Q8XA 4QAWA 3W27A 1W9UA 1XH1A 5DEZA 2DT3A 1JAEA 3IANA 3CLWA 2XFRA 6A3HA 4LYRA 4W7WA 5CXPA 4UQ9A 1GQJA 3WQ4A 3LPFA 5A6KA 3ZSTA 1E4LA 5D9NA 1B90A 3GDBA 5FKYA 1JXKA 2XIBA 2DQXA 3VIHA 2WW5A 2DT2A 3EDKA 3AZRA 2XIIA 2ZX7A 2ZICA 3AYRA 2V3DA 3BLKA 4AXNA 2BXYA 5HPOA 3VILA 4JCMA 3WD3A 2WWCA 1QBBA 2BVTA 2G3MA 1QI5A 1XCXA 3OLEA 1VF8A 4XV0A 3RDKA 3D3AA 3MO4A 5C8BB 3WH8A 1CGUA 1JIBA 1ZBCA 3A4WA 2WWDA 1TA3A 1JL8A 2VT0A 1L0PA 3ZT5A 3ZO9A 2EPNA 3NSXA 3WEZA 1XV8A 2XJ7A 3CZGA 3SCWA 3VIPA 1BVNP 1PJ9A 4PTWA 3II1A 4QLLA 3MS8A 2EPLX 4OUEA 1FP8A 1UWTA 4PCSA 1NP2A 1OD0A 1K9TA 4JL2A 4B15A 3SUUA 4HU8A 1W1VA 4W86A 4HOWA 3N13A 1CEOA 1GOOA 1MW3A 2BFGA 2JIWA 4CKQA 1MW2A 3ZOAA 2C7FA 2XSAA 4LXFA 4JHOA 1GJWA 1UR0A 3PZIA 4WKAA 2RGLA 4AD3A 2J25A 3AIRA 2GK1A 3BCDA 3QHMA 1EHAA 3DC0A 2CERA 5A95A 5I3DA 2GJRA 1BSIA 2BNJA 2ZUTA 1Q6DA 3UG5A 1KQZA 3SUVA 3WD1A 1XH2A 4MB4A 3WBAA 2WANA 1B3XA 4CD8A 2OSWA 1JNDA 2JIEA 2NW0A 3FW6A 1FH7A 3L2MA 2VOTA 2FDMA 4W87A 4E4PA 2PBGA 3EDDA 1GW1A 1HT6A 6TAAA 1K9FA 3TTSA 4B9ZA 2CESA 1FHDA 1W1PA 1L8NA 3NSMA 4CVUA 3GXIA 4JIEA 1BG9A 1E15A 2EEXA 4U5KA 4P8VA 2XM1A 2F8QA 1UUQA 3MUZ1 4OIFA 1LG2A 3S2CA 1R87A 1QNOA 4KWUA 3SCUA 1UWRA 3WUGA 4D1JA 4W8LA 1KCKA 1XH0A 3SCVA 1A47A 3MSGA 2PB1A 2AAAA 1H1NA 1B1YA 1PZ3A 1VB9A 2J79A 3ZJ6A 2XGBA 1UH3A 3W28A 2GVYA 3LPOA 2JFEX 2XVGA 1E6PA 2OSXA 4F8XA 4HZ6A 3MSDA 2XFFA 5I24A 4HZ7A 3VGEA 3SCTA 3THDA 1V3IA 2VZVA 3D5HA 3E1F1 5AY7A 3MV11 2XVPA 1SMAA 2J7CA 4PYSA 5GNZA 1XSKA 3L4ZA 3WUFA 1WNOA 5D4YA 3A3HA 1KGXA 1LG1A 2ZXAA 1VFMA 2CIPA 4N42A 1ESWA 3T2OA 1GOMA 1KBBA 4J3SA 3PHAA 3QHOA 1KQYA 2VMFA 3MUAA 1D3CA 2A3EA 3VIOA 1UH2A 3FAXA 2FHBA 1NWSA 2AOSA 1B3VA 2GDUA 4W5UA 5A94A 2VRKA 3U57A 3K8LA 1U33A 1E6QM 3ARXA 4UR9A 2GJXA 5HPCA 4Z2LA 5A6LA 2XFYA 1BHGA 4NI3A 3VIKA 4GINA 2QPUA 2ZUSA 3UR7A 1VFOA 3BC9A 1OGSA 4LQ1A 4ATDA 1EQCA 5IFTA 4CN6A 2D3NA 4CGTA 1WKYA 2V3EA 4XUYA 1CXHA 1PIFA 1U2YA 1J0JA 1QI0A 3F4VA 4D71A 2FHCA 2ZUWA 4K68A 3TOPA 4U3CA 3VNZA 4M82A 2W4XA 3AZTA 1BYCA 4MJ4A 3RJXA 4U3AA 3AROA 4CCCA 4YPJA 4M80A 3QHNA 1EDGA 3RMEA 3PZQA 1VBRA 4P8UA 4WIWA 2J7HA 3AMDA 2XPKA 4PMYA 3EDEA 1UR2A 3WQVA 3A6OA 1V08A 4JFTA 3AQUA 4QCFA 2DSKA 2ZXQA 2VZTA 1CLXA 1MWOA 1QI2A 4YHGA 3WDRA 4EK7A 3WKZA 1GVIA 2D22A 2DT0A 2CNCA 2VC9A 3VNYA 1CIUA 4FLOA 1HL9A 2D24A 1PBGA 4PEEA 5BCAA 1ZU8A 4AZBA 2XTKA 2CYGA 3F5JA 3W25A 4HA1A 5GQBA 4ACZB 7A3HA 3ARTA 3K8KA 2X8RA 3UERA 4ATWA 5A6JA 1CDGA 1W3JA 5BXTA 5JIPA 2WZHA 3BCFA 3TTOA 1JDCA 2WHLA 5CGMA 3CTTA 4DWSC 1E3ZA 4M56A 3DECA 1OIFA 2VX6A 4W89A 5HBFA 1W2PA 1JYNA 1KWGA 1GQIA 2VCCA 4GO8A 3CHCA 3DYPA 3WH9A 3TTQA 5AYBA 1UH4A 1HXJA 9CGTA 3VVGA 5IHSA 1CNVA 4GO9A 1R86A 1XYZA 3B9AA 2J75A 1E4MM 5CGTA 3MMWA 2WMHA 1ZBVA 2ZX9A 3BAKA 4D6IA 3N18A 1B3WA 4TTGA 5A3HA 1Y7VA 1CGVA 4WSJA 2O92A 3IAQA 1LL6A 2E9LA 3EBVA 4CU7A 2PWGA 2ZUMA 3SCOA 3VOCA 1E5JA 2YL5A 1ISVA 1I75A 3ARUA 1CYGA 1LWHA 4MB5A 1CXIA 4U31A 5F7UA 4D72A 3SCPA 4H8HA 3WIJA 4UOJA 1K9EA 1SYTA 2E9BA 3AMLA 4M24A 3K4AA 3WY1A 5M5DA 1G0CA 3RM9A 3SCNA 1G94A 3WH6A 5D9PA 4PMOA 3ALGA 5E70A 4AD1A 2Z1KA 3DYOA 1GORA 4DM1A 1IT0A 1E4NA 1E6SM 3CGTA 3WF3A 4MAVA 4AISA 3PZNA 1BLIA 4WF7A 3UETA 1ZJAA 1KB3A 1YQ2A 1J9YA 1OINA 1BYDA 4UTFA 1CWYA 4X9YA 5DT7A 4J7RA 1WZLA 4JHZA 4U2YA 1V3KA 4FMVA 1BYAA 1ZL1A 1UD2A 3BSGA 3GH7A 3WBEA 3ZIZA 1GCYA 3T0AA 1JYWA 3ZJKA 4NRRA 2ZOXA 2GUYA 6CGTA 2OLHA 1KXQA 2X1IA 4LX4A 4YN5A 1ISYA 3VGDA 4BQ3A 3VD5A 1CGXA 3WEOA 4IISA 1UA3A 1UZ1A 3IJ9A 1E6RA 1HKIA 3RM4A 3PZ9A 1NWRA 3J7HA 3W24A 4DM2A 5M3WA 1Q6GA 4ACZA 4H7VA 3W6MA 8A3HA 3AICA 3WUEA 2Y8KA 1DP0A 2YA1A 3WNOA 3VD9A 1UR9A 2YKKA 3AIBA 1F4AA 2O9PA 5A6SA 1UKTA 2WYSA 3VGBA 5IXEA 1DWIM 1WB0A 3WQ5A 3N04A 4HU0A 1CZ1A 1OCQA 3ARVA 1E71M 5E0CA 4W84A 4CU6A 3CMGA 4FLQA 4UZUA 4KMQA 5CPTA 1HVXA 4YHEA 2QHAA 1V03A 5ECUA 2ESCA 3ARSA 3UESA 4KRUA 4URIA 4ZE5A 4UQEA 4P7QA 1JD9A 4AZ5A 2V3GA 1V6XA 4MNMA 1WCGA 5CZKA 4D6EA 5A2CA 2J77A 1H11A 5JIWA 4D6DA 3OZPA 1JZ6A 1XSJA 1AQ0A 2WZIA 3AIQA 3U5YA 3WDHA 2PC8A 1HF6A 3N9KA 1W32A 3KWXA 2FH8A 3SIMA 3MUIA 1G9HA 1HX0A 3BMWA 5CPQA 3WD2A 5E9AA 3WH7A 2WLZA 3WL0A 5D8ZA 5BXPA 1W3HA 3VMOA 2DSUA 2A3BA 1GOIA 4RE2A 3W81A 4BQ5A 5AC5A 1HJWA 2O9RA 5EMYA 2D0FA 3WQ8A 1B9ZA 1NWUA 4ZE4A 1E0WA 2DSZA 4AMCA 2D2OA 2EQDA 3RIKA 3SCQA 1VEMA 2MANA 1E1EA 2GDVA 2EBNA 3AS1A 3ZR6A 4R27A 3IJ8A 1W1TA 1JI1A 2CHNA 1UD4A 2PF0A 2Y8VA 4CCDA 1NP0A 1FFRA 4MNKA 1E70M 2WVUA 4PMXA 3W26A 1CXLA 3WMBA 3QOKA 1CECA 1G5AA 2HVMA 3PN8A 3BAWA 1SR0A 4AYSA 1C7SA 3G6LA 2EPMX 4GI6A 1JZ3A 3W38A 4Z2JA 5CLWA 4X0NA 1V0LA 1W9PA 3WENA 4QDMA 2BXZA 3AJ7A 5A8OA 3N1AA 1C7TA 1TE1A 2OYKA 2C0HA 2UY3A 1WZKA 2QMKA 2V5CA 1UKOA 4JKKA 3ZT7A 3MV01 2G4FA 1HKJA 4TUFA 1FOBA 4D6FA 2A3CA 3GNPA 1ZBWA 1UR1A 2WC7A 1XD1A 3VDHA 4OBRA 3WFZA 1PPIA 3BSHA 3PTMA 1R85A 1JF6A 4TVUA 4UQDA 1GZJA 3CUGA 3CZKA 4Q22A 4J27A 2YJQA 1DTUA 1WDSA 1H5VA 1OWQA 1JD7A 1K9DA 2X2YA 1HVQA 1GOWA 3SUSA 3S6TA 1XRVA 1QI3A 1NOUA 2VQUA 1E55A 4GKLA 2NT1A 1B0IA 4IM4A 4D6HA 1R7AA 2WCAA 1CXKA 1B31A 1NH6A 4GQQA 4AZ6A 5A1AA 4UNIA 2VI0A 4PCTA 7CGTA 3VD7A 1UWIA 5C71A 3W6LA 5JUVA 2WMJA 4WKHA 1VFFA 1W2VA 2W5FA 4L4PA 4AZHA 1UKSA 2YL9A 4TX8A 5FL1A 5CPSA 2GJXB 2J62A 3N15A 5FD0A 5A8MA 1BVZA 2PBOA 2ZUNA 2OWWA 4ZEPA 2G41A 3VGGA 2G3IA 1U30A 5BWFA 2TAAA 3AS3A 3ZMRA 2G3JA 4F9JA 5AYIA 3GBEA 3QGVA 3UG4A 3CH9A 3EMZA 1HJXA 4JFUA 3AXIA 3OGSA 2YDRA 2EJ1A 3G6MA 4OOUA 3N12A 3SEPA 2IXVA 1QNSA 1XD0A 3AIWA 2WAGA 3WNNA 2VX5A 2WHKA 3PZGA 4CVWA 3NDYA 4BS0A 3AYSA 4TOQA 4PMVA 4AZIA 2X09A 1OIMA 1MYRA 3WN6A 2ZE0A 4TVCA 1US2A 2J7EA 2CETA 1S46A 2J7GA 4J3XA 4V27A 1JFHA 2CITA 1QNRA 2VR5A 3CZLA 2HISA 3SCRA 4B3KA 2W66A 4JCLA 2NT0A 5A6BD 3T2PA 4E2OA 1ITXA 1CBGA 4GZJA 1MQQA 1ZB5A 2D1ZA 4DWSD 1C8XA 1UYQA 1WP6A 4L4OA 1W91A 1GQKA 3M07A 5ABEA 5CLTA 4AZGA 3ALFA 1H4PA 4M1RA 2J47A 1GHRA 3WDIA 3BAIA 2VCBA 1I1XA 5CJ5A 1VFUA 1UD8A 4DUVA 1IZKA 1VEPA 3AZSA 4RE3A 5KZ6A 4QFUA 2X05A 1KBKA 2OYLA 2ZXDA 1UWUA 3SURA 4HPGA 3VPLA 2J7DA 4C7GA 2D20A 4EE9A 4J3TA 4HMCA 4OJYA 1VJSA 4UFLA 5HNNA 2CCRA 4UQBA 3WNKA 3WF0A 3WUBA 3UCQA 3L4YA 4J3WA 3VMPA 2WHMA 2WKGA 3L4WA 3FHAA 1H09A 1MQRA 5I5RA 1NM9A 1HJVA 4CD6A 4ACYA 1DWHM 1M7XA 3T0DA 5FIPA 4AY1A 3PTQA 2XHYA 2WC4A 2XVKA 3T08A 5E09A 1BGGA 5LA0A 1CGYA 2DDXA 1QHOA 1V3HA 3I3DA 5EB8A 1TMQA 2WVVB 2E40A 2O9TA 3WEMA 4MB1A 2YBUA 3GH5A 5ABGA 3CZ8A 1ODZA 2J8FA 1UG6A 3DYMA 1HN1A 4CN1A 1A3HA 2CKRA 4DUXA 1RH9A 2WXDM 3OG2A 5BXRA 2ZXBA 1QI4A 4S3JA 1EH9A 2F2HA 1KR0A 2WPGA 2WC3A 3WDQA 2CBJA 1C8QA 3L4UA 4J28A 1QNQA 1E73M 1NOFA 1GNXA 1PX8A 1E72M 3ZSSA 3CUIA 1FHLA 3OIHA 4HA3A 4WK9A 3M46A 3EYPA 3WH5A 1OT2A 4XX6A 4A3HA 2PWEA 4ZENA 1AVAA 5BYWA 4PTXA 1EOMA 4PN2A 3KEHA 4CU8A 3CO4A 3BLPX 1XC6A 4V2XA 2XG9A 4AIUA 2WCSA 4JKMA 1HNYA 1MFVA 4MNJA 2C8NA 2E3ZA 1JXJA 2GSJA 5I78A 1JZ5A 2YOCA 1NQ6A 4P7NA 1WO2A 4A4AA 4LYPA 5BROA 2XM2A 3CMJA 5CSYA 1JZ8A 3ARQA 3CBWA 1H2JA 1NWTA 1B30A 1E4IA 4B16A 1W1YA 4H8UA 3WD4A 5ABFB 1BFNA 3M7SA 4GI8A 1H49A 3CIVA 2BHZA 1CTNA 4BCEA 4EAMA 3AS0A 1C91A 1MXDA 4HMDA 3MKKA 2IUZA 5A8NA 1RP8A 1QHZA 4M81A 5HOSA 1CGTA 3B9EA 2WB5A 2Y24A 1C92A 1BPLB 2VTFA 4AIEA 2ZX8A 4BQ2A 3VD4A 4AD5A 2QLYA 1PAMA 1K6AA 1WDRA 7TAAA 3AMKA 1UKQA 2V3FA 3WMCA 2VR4A 1V6UA 4JL1A 2JF6A 1W9DM 4UFJA 4H41A 5A8PA 4PMRA 1CXEA 4Z2IA 3BH4A 4X0VA 4ML4A 2JE8A 2OSYA 5EFFA 1MXGA 3VIJA 3WFLA 2WVVA 3THCA 3ZR5A 4AD0A 2Y4SA 4LYQA 4PUDA 2PWDA 4HP5A 1BYBA 1QW9A 3ARZA 4MDPA 3VGFA 3OZOA 1JZ4A 1ZJBA 1VIWA 3WQWA 1XCWA 1US3A 4J3VA 1V3JA 1XHGA 4V28A 3POHA 1JNEA 4W5ZA 4TTUA 5I0DA 2YLAA 3MUY1 2PI6A 3IAPA 4KRTA 4W85A 4NSBA 2JF7A 1OT1A 1YHTA 3EDFA 3W4RA 3LPPA 3OLIA 3CPUA 3VO0A 1GOKA 4CD7A 2VO5A 3AXXA 3SUTA 2VURA 4QLKA 3N11A 4QLJA 3OA5A 1CLVA 2EPKX 1DEDA 2XWDA 1LF1A 5D9OA 5IFPA 5LA1A 2QF8A 2E8ZA 3FHQA 3T09A 4A3YA 4J3UA 2WBGA 1VBUA 1RP9A 2WMFA 3KL0A 4BF7A 3WF4A 4GXPA 1VENA 3VM7A 2FH6A 5LYRA 3RJYA 3W37A 2DSVA 3ZJ7A 3VKKA 4GIAA 5BRQA 3A4AA 3AXHA 4WKFA 2V38A 3LPGA 4AD2A 3HU7A 4NZCA 2NSXA 3CUJA 5I2UA 3PTKA 3M6DA 2BY1A 2WVTA 1H3GA 1WZAA 3I3EA 3U7BA 5ABFA 3MANA 1EO7A 1H0GA 2E9MA 2CBIA 2DH2A 4JFVA 4DUWA 3VU2A 2DT1A 3CHFA 4AEEA 2E4TA 4PMNA 5CQ1A 4KGJA 4OOZA 5JBFA 1PZ2A 3KZSA 1KCLA 2J7BA 1XSIA 3O6AA 2Y2WA 2W62A 4EKJA 1EQPA 2D23A 3SCSA 1JYXA 1E3XA 5I77A 2XSBA 1IV8A 1MW1A 2VVSA 5D8WA 3RM8A 3AHXA 1E9LA 3DHPA 2JEQA 3AOFA 1UKPA 2W67A 1VRXA 2CEQA 2YDSA 4TX6A 1DWFM 1EXPA 1KWKA 4TVDA 3RILA 1KXHA 4IPNB 1UA7A 4D6CA 3WNMA 3L4VA 4BZYA 2J74A 1QVBA 5FL0A 4PMZA 4MADA 1QNPA 1JAKA 4ZFMA 1WPCA 4KGLA 2GJPA 2CBVA 3WSUA 1UR4A 5DFAA 4HMEA 4MTVA 4H04A 1D2KA 3FNDA 4Z2KA 1B2YA 1UQZA 1N82A 2E8YA 1X1NA 4ATLA 2CXGA 2VZSA 4CD5A 3AMGA 1JZ2A 1ISZA 3MMDA 3L4TA 1LQ0A 4CN4A 2XUCA 1C90A 2UY2A 3WD0A 4LGXA 3VDBA 2A3HA 1E56A 1BF2A 1JF5A 2D3LA 1HJSA 4FLSA 5AC4A 2ZWZA 4F66A 3DHUA 4PSRA 5FCZA 1W9BM 2YDQA 3POCA 2WNWA 2WSKA 2DEPA 1BQCA 1UD5A 4AEFA 4UFKA 1TR1A 2AMGA 1LLOA 1GJUA 1O7AA 2XGIA 4E8DA 1J10A 3CZJA 3VGHA 1AQMA 5EFDA 3APGA 3I3BA 3ZM8A 3B9DA 5DF0A 3BXWA 4MAZA 1JG9A 2VNCA 3A47A 5CG0A 3FAWA 4Q7NA 3BAJA 2ZUUA 3U7VA 3BMVA 3KE0A 5M17A 1J18A 1GVYA 1UWQA 5E6YA 4ZXOA 1QOXA 1C3FA 4FK9A 2YBTA 4C7DA 1V0MA 3AIEA 1OGGA 3CHDA 2O9OA 3W0KA 1Q6CA 1B3ZA 4DWSB 3VD3A 4QCEA 1UD3A 2VZOA 3WELA 3HJEA 4GQRA 2J4GA 4B9YA 5A69A 1ZS2A 1V3MA 2VX4A 4PMUA 1QHPA 2WCGA 1OSEA 4QP0A 4AD4A 3NDZA 2WHJA 4OKDA 3W53A 2D0HA 3WMSA 4H8VA 4HOZA 1DWAM 1G01A 2J78A 3SUWA 1TG7A 3VTRA 1NARA 2VZUA 3ARYA 1E0XA 2WK2A 3UR8A 2J8GA 1TZ7A 1KR1A 3GYCA 1HKMA 2VRJA 3AIVA 5EBAA 3AHYA 1HP5A 3EDJA 4F79A 1V6YA 2ZWYA 1DWJM 3ARPA 1JGIA 2EPOA 4MPKA 5A8QA 3BAXA 1GHSA 3PZMA 3NCOA 2X0YA 1B3YA 2WBKA 4UOZA 1J0YA 2YA2A 4N0RA 4C7FA 1JYVA 3F5LA 1Q4NX 3GXDA 1JDDA 3AHTA 4W7UA 2DSWA 3HMCA 1Z32X 1FH9A 3RCNA 4JKLA 4P7OA 2W63A 1F4HA 3WQ6A 3GXFA 4Y7EA 5LA2A 4UFIA 1VJZA 3VX1A 1UOKA 3VIMA 1SFSA 2B31A 1BTCA 3W29A 3WDPP 5DMYA 3HN3A 3WNLA 3WF2A 2OYMA 3WL1A 2CBUA 1BG4A 1J01A 5JBDA 5I6SA 4P7LA 1G1YA 1KXTA 5M03A 3ARWA 3PBGA 3TA9A 4MDOA 2WMIB 1E43A 3VIGA 2F61A 1TUXA 3GZAA 5E6ZA 2RGMA 1HJQA 1X6NA 4UCFA 1LWJA 5D9MA 3QOMA 2WMGA 1J0ZA 4WSKA 4JZ5A 3UEQA 4W7VA 1OBAA 2FHFA 1H41A 1TCMA 2FGZA 4UZSA 2VUYA 4IUGA 2Z1SA 5TD4A 5DO8A 3AHZA 2YLLA 2ZX6A 4PBGA 4U33A 5A6BA 4W8BA 1JI2A 4AZCB 1W3LA 2YA0A 4PTVA 3T2QA 2GFTA 1NOWA 1X6LA 4OBSA 3JUGA 3K1DA 3WF1A 2G3NA 1EO5A 2QV4A 4DWSA 2CPUA 2D0GA 5HXMA 3OLDA 1EA9C 5DT5A 2VCAA 1MFUA 3VIIA 2XVLA 1QPKA 4PTMA 1KFWA 4NF7A 2WMKA 3NYDA 2FGLA 4U5IA 1ODUA 1WAWA 5I23A 1UHVA 2QPSA 3OB8A 2EXOA 4NRSA 1VEOA 4WLCA 3UG3A 2YL8A 1UR8A 2X0HA 3AS2A 2BY0A 2JALA 4CUCA 5BXSA 5KEZA 3ZJ8A 4PUEA 1GOQA 1MVYA 4W8AA 3GXMA 4ZXLA 3O9NA 2IXUA 3OLGA 3OGRA 1FA2A 1TVPA 3CUHA 4P8XA
chains in the Genus database with same CATH superfamily
1XYFA 3PZOA 4AZ7A 3STGA 2VM8A 2EG8A 1PX4A 2WVSA 4N7QA 4DB7A 2YBVA 1RLDA 1VPQA 2RUSA 3ITYA 5AN7A 1JFXA 1XXXA 1E40A 2J7FA 1MQPA 4GMEA 3H26A 4Z2HA 3GU1A 1UIOA 4ZVJA 3LTPA 1VCFA 5J5DA 3H22A 2C71A 1TVNA 4REQB 4UBPC 4Q8QA 1W9VA 1XGZA 1EGZA 2VVNA 4HA4A 3N17A 2HS8A 4QITA 3G8RA 1SMDA 3KWSA 5FOOA 3REQB 4GGHA 2XIOA 3S42A 2YCKX 3DFPA 4ZTYA 2VQTA 2V2CA 1DV7A 3B3DA 3NEHA 3O06A 1QXLA 1XINA 4EXBA 3T0BA 3OVRA 2A7PA 4M19A 1XQKA 1PCWA 3IV8A 2BMBA 3URQA 4XVEA 8CGTA 4RNHA 3UP8A 1K8CA 1LL7A 3L2LA 2WV8A 2GQAA 2E68A 4E4FA 4FP1A 2PUZA 3GAYA 1ZJHA 3ZXWA 3C4UA 4GH3A 1X8FA 3M43A 3VXGA 5M1TA 4KW2A 4KF1A 4QE1A 3Q65A 3CXOA 2PDYA 1FWGC 3E02A 2OX1A 2XYLA 4IIEA 4WJXA 5T9BG 1DORA 1OCJA 1Z89A 2BTMA 3GU9A 1XLGA 1ICPA 2DIEA 3LBCA 4GCAA 2CHOA 4FF5A 3H4WA 4H2HA 3BAYA 1PX3A 4B5NA 1E6NA 4RE0A 3H2EA 3QZEA 1UBPC 4PL2A 3FN9A 3OZMA 3S6OA 1H7WA 4HA0A 1D7FA 1CT5A 4LCQA 4QNEA 4I9MA 2WZEA 1BAGA 2PF8A 5BRPA 4PRWA 3PZUA 1F6YA 3P8JA 1AMYA 4HOXA 3N2XA 3O0KA 3PZVA 4IX2A 4DELA 3Q2DA 4HNLA 4ML9A 1NIUA 1AJZA 4DO6A 3W7NA 4KT2A 1V0KA 3F4WA 1VYSX 1KGUA 3RPMA 3VX0A 5JBEA 3R10A 5BW6A 3T1GA 2XH7A 4H2CA 2Z6JA 2X0SA 4PRRA 4ZB0A 2EG7A 1XYLA 2PTDA 3LCLA 1PB0A 1VS1A 4GNJA 1L6FA 1RBAA 1W9XA 3PPHA 3UYCA 3NUKA 1HL8A 3GH4A 4YJ5A 4S3KA 3TA6A 3W7LA 3T40A 1V02E 4MKVA 4FLRA 1NFBA 2OO6A 3GG0A 5D09A 2Z28A 3THUA 2ZIDA 1RV8A 3VDAA 2VL4A 5FEXA 1LJYA 4S3FA 3C2RA 1PHQA 4L1GA 3AMCA 2EO7A 4M8UA 2GVEA 3BLEA 4A2SA 1JCMP 2VC7A 4QBXA 2E0PA 4PSPA 1V51A 1UZ4A 1JR1A 4QHRA 1WZMA 3IARA 2G0WA 3KL3A 1A53A 3U0HA 2I16A 4UNKA 2OWXA 4GVHA 2WNNA 1IT7A 1QW8A 2QCDB 3K46A 2QVNA 4IPLA 2OCZA 1TQXA 2A0NA 3UWYA 4ZL1A 1REQB 3M41A 3TSBA 1YTDA 1BSLA 2EKGA 4B5TA 3ZT6A 2OPJA 2JKPA 5LIYX 4B2DA 1DQXA 2Y7GA 3R13A 1T96A 4HNVA 4MFDA 1HIZA 1FCVA 1FP9A 1E6XM 1AQHA 4XD3A 2C79A 4XSMA 5IDIA 2CU0A 2OQYA 3INPA 3N6JA 3EXRA 1I2OA 1V3LA 4JAWA 1KFJA 4LV4A 1J0KA 3FY1A 4NJKA 1C8VA 2NVDA 1W9UA 1XH1A 1YXDA 3H4GA 2V82A 4FI4A 2DT3A 1JAEA 1RK6A 3TR2A 1UPMB 2XFRA 3UNTA 3MYPA 3W7MA 3I6EA 6A3HA 5JH1A 2ZC8A 4W7WA 4UQ9A 5F4SA 5G1YA 5A6KA 2QAFA 2QJHA 2YYTA 5T8GA 1XR2A 2DT2A 2XIIA 1GZGA 1OQFA 1EJTC 1BXNA 2V3DA 1YIXA 2HXUA 2BXYA 5HPOA 1QBBA 4R53A 1UWAA 5G4WA 1QI5A 5LGXA 1YADA 3G1YA 4QQ3A 3CUZA 4HBKA 4BF5A 2IPWA 4XV0A 3RDKA 1KBLA 5C8BB 4KWWA 3WH8A 5ECVA 1CGUA 4RZ5A 4LUTA 3A4WA 4CNNA 2WWDA 1TA3A 1AQFA 4IMCA 3L68A 4FNRA 2EPNA 3NSXA 3NL3A 1FVPA 3SCWA 2ON3A 1P5BA 4QLLA 4OVXA 1EBHA 4PRTA 3W1LA 2G3FA 3VCCA 1O5RA 4PCSA 1EKOA 3QTPA 4JL2A 4E8GA 1L6SA 3UZJA 4WSHA 3URNA 1WOAA 2WNQA 1U5HA 2JIWA 1MW2A 4L65A 1FWEC 1W37A 5HQLA 1O1ZA 3QRHA 1TPH1 2WNZA 3EAUA 1RAKA 1P43A 1IGWA 3W7EA 1UASA 4HK7A 4E38A 4IFKA 3WBAA 4FZIA 1UJPA 4JQ1A 3MW7A 3G1FA 5I09A 3L2MA 2FDMA 1FHUA 3HM7A 3QY8A 1HT6A 4DHGA 3TTSA 4UB9A 1W1PA 1U1JA 4AHQA 3DKLA 3L21A 1IWAA 1BG9A 4U5KA 2BDQA 4HN8A 5BU9A 2OKTA 3L23A 1DJYA 4C5ZA 4GUGA 3K13A 1UUQA 2G37A 4ZO8A 3P82A 1R87A 1QNOA 4PTNA 3CV2A 2C1GA 1XYMA 2WJZA 3MSGA 2X30A 3ANVA 2PB1A 4DO5A 2QS8A 3VZXA 1M6JA 1WBJA 1B1YA 4DJEA 1P0EA 3F2DA 5JH2A 4OGZA 5DCDA 2XGBA 3W28A 2GVYA 3MCMA 1S2UA 2XVGA 5D32A 3LCGA 4HZ6A 1KD0A 3MSDA 4DRSA 2A4AA 1TYGA 4HZ7A 3LHUA 3MP4A 3O07A 3QMRA 4IIHA 3KZPA 1V3IA 3D5HA 2Y62A 3G0UA 4PYSA 1GOXA 3LV5A 2AMXA 3W70A 3H7VA 3EOEA 5GNZA 3EKZA 3P7YA 4L9ZA 3L4ZA 3S5SA 3U9IA 5D4YA 1KGXA 5D05A 2Z7KA 9RUBA 4GKTA 1K6WA 2EJAA 5DN1A 2C15A 1GOMA 3E74A 5LZLA 3VKJA 4DNMA 3URBA 3WLQA 3PBWA 3N14A 3CB3A 4PUUA 2XDFA 1KQYA 1D3CA 3JZEA 3FAXA 1NWSA 5HMSA 3N9RA 1B3VA 4GC4A 2ZTKA 3TU9A 4EPEC 3GTHA 3DAQA 2Z26A 2XFYA 1BHGA 4GJ1A 1VLWA 3UFYA 3FKRA 3LERA 3W88A 4I7WA 3GW0A 3NG3A 3V4BA 1EQCA 1KM1A 5IFTA 5HJLA 4CQCA 1RBOB 2VC6A 4XUYA 1CXHA 3G77A 3WQGA 4J40A 2RAGA 1QI0A 1R2TA 3T7VA 3AZTA 4U3AA 3AROA 1SU5A 3GS6A 4YPJA 5F2MA 4ZOEA 2J9ZA 3BDKA 3IV3A 4UIOA 4P8UA 3QZAA 2CLLA 4WIWA 3DESA 1XBVA 4Q8MA 3HFYA 3S2JA 5D04C 1GEQA 1RR2A 3SJNA 1PCKA 1YNYA 4DJEC 1V08A 1CLXA 3GVGA 2HBVA 1NFGA 4YHGA 3W2MA 5HMFA 3P5ZA 4OECA 3VNYA 3PAOA 4GABA 4Z1BA 4PEEA 2PDCA 4AZBA 2P5NA 4C5YA 3F5JA 3ID7A 3ITLA 3W25A 7A3HA 3K8KA 3LI1A 1ZAHA 3MHUA 2X8RA 1CDGA 1XDLA 2WZHA 3BCFA 3CTTA 4X9SA 4M56A 1OIFA 3Q4DA 2VX6A 3BLIA 3UZXA 4W89A 1J4EA 2GQ9A 2V68A 5HBFA 1JYNA 1K8XA 2VEKA 2PLKA 2VCCA 3O63A 3UNDA 3WH9A 5FI8A 3XISA 4KEUA 1X1ZA 4JTLA 4H3DA 3ATYA 3W7HA 5DXYA 3C2EA 4KCUA 1E4MM 2QUMA 1OZMA 3LCHA 3MMWA 1ZBVA 2ZX9A 3BAKA 3N18A 1OX6A 1Y7VA 3R12A 4LRTA 4CNPA 4S3AA 1I9CB 1TV4A 1V5XA 1LUCB 3LGDA 3P84A 3SCOA 1OG0A 1NDZA 1KC7A 1I75A 3ARUA 2ZZ2A 3B8VA 4U31A 5ENLA 4D72A 2MNRA 4H8HA 4QJ4B 3Q94A 2OGYA 1EGVA 3UXLA 5M5DA 1G0CA 3RM9A 3SCNA 3WH6A 4PMOA 4LUYA 1FWBC 5BRBA 3CGTA 1YE4A 3S5ZA 4O52A 4WF7A 4H4IA 3GLCA 2R1KA 3E49A 1BYDA 4UTFA 4WCJA 5DT7A 1WZLA 1V3KA 4FMVA 1BYAA 1ZL1A 1ITQA 3RAOA 2OEJA 4ROPA 4WJEA 4IIDA 1HZYA 2G50A 3ZIZA 1GCYA 5J04A 3MDWA 3B0VC 4PB5A 1M7PA 3SW6A 2ZOXA 2TYSA 1AH4A 2OLHA 6CGTA 3CU2A 2VUNA 1P4CA 2ZRZA 1CGXA 3WEOA 4XISA 1C29A 4HCLA 3IJ9A 1HKIA 2FPVA 4NYUA 2A79A 3MBFA 2BX7A 3R8RA 4DM2A 4ACZA 3BVJA 3NM3A 4H7VA 5EMLA 1W3TA 3SO7A 3TC6A 2ZVRA 3GO2A 1JQXA 4UTJA 4QR6A 3GR7A 3PSWA 3A5VA 4K8GA 1WQ5A 4LCRA 4LCSA 2TPSA 4OUIA 1WB0A 4RXGA 4HU0A 1CZ1A 2VFIA 4GJIA 2WKJA 2IPJA 4LW7A 3M1ZA 4FLQA 2OKOA 1K4GA 4I7UA 3G1HA 4US5A 1VKFA 2QDDA 3KDOA 1G4TA 2NQZA 3ARSA 4YCOA 4ZE5A 4P7QA 2HVNA 3HTWA 1SJBA 1RALA 1WCGA 5CZKA 1JDFA 2J77A 1XLAA 2CLKA 2POTA 5DRIA 3OZPA 1SSGA 1JZ6A 2QCGA 1AQ0A 2PDKA 3UVAA 5KSWA 3KWXA 5HQMA 3SIMA 2OU4A 4QEHA 4BEUA 3BMWA 4WXYA 2XINA 3LN3A 1MRAA 1YPXA 4EVZA 4JN7A 1A5SA 4ADUA 1THFD 2A3BA 1P0NA 1W31A 3VNIA 5EMYA 3NR0A 2RDUA 1E0WA 2DSZA 3S2MA 3OA3A 4DBDA 1EEXA 1W1TA 4BI6A 2CHNA 5KMYA 2PF0A 3A24A 2Y8VA 3V1HA 3LZ5A 2QIIA 2P88A 2ABAA 3LTYA 1XIBA 2LLEA 1Z3NA 3HMJG 5LXEA 1CECA 2OJPA 3P62A 3PN8A 1EJWC 4D9PA 1VCGA 2EPMX 2P3ZA 2OODA 3CAWA 3GDRA 1QASA 1V0LA 1W9PA 4PULA 3TX9A 3N1AA 1GYMA 2C91A 1TE1A 3W87A 2VEPA 2QMKA 2DJXA 3KS5A 1S5VA 4JKKA 4IQJA 3TJIA 1FWHC 1XD1A 1T99A 4OBRA 3WFZA 1R85A 5PTDA 3KOWA 3ZVHA 1JPIA 4IOTA 5F2LA 2PDPA 4Q22A 4J27A 2V81A 1PZ1A 1DTUA 1WDSA 1W8SA 3IK4A 1VHNA 3W83A 1EA0A 1XRVA 2NT1A 3OBEA 5FJUA 3EX2A 4TMCA 1VCVA 5A1AA 3RYSA 4MY8A 4PCTA 3EOSA 4XK2A 4IJRA 5C71A 5L9FA 3HPSA 1N7KA 1IXOA 4HHLA 2WMJA 2W5FA 4L4PA 4AZHA 2PAJA 4IFOA 5FL1A 5CPSA 2XFWA 2DZPA 1PSCA 1BVZA 2ZUNA 1FRBA 3VGGA 2G3IA 3GYEA 4QE5A 2YR1A 3N4EA 3ZMRA 2L5HA 4D8LA 3QGVA 4CEXC 1RJPA 1QJWA 3FLUA 2NX3A 1XWYA 1EJXC 3V16A 2A6LA 2Z6IA 5BOOA 1XBXA 2CLOA 2WAGA 4MOZA 4CVWA 2PDQA 3NDYA 4DJED 4Q4PA 4CLMA 4K3ZA 3ANUA 1OIMA 1AH0A 1I2QA 3WN6A 1XIJA 1XBZA 1US2A 1IEXA 4ERIA 1S46A 1QPRA 1XICA 3BK0A 1JFHA 5HMDA 5EMJA 2VR5A 2HISA 3OYXA 4B3KA 1QR7A 1SJAA 1FWRA 2NT0A 3QMSA 4ZOAA 1TPDA 3T07A 1MQQA 2Z2BA 1IZCA 3OO2A 3GFZA 3TFXA 2DZUA 3O0FA 3DERA 3R89A 3FDGA 1TV2A 4L4OA 1GQKA 1H4PA 4HJFA 2J47A 1DJNA 1I1XA 4MPQA 1GEHA 1KRMA 1VFUA 1UD8A 1Q6QA 1IZKA 3AZSA 3S9ZA 3KHDA 5KZ6A 4QFUA 5DRCA 1O5XA 1GKQA 2X05A 2OYLA 1TV7A 4I6KA 2ZXDA 4LAZA 5M2FX 1W17A 2D20A 3B0PA 4EE9A 3W73A 1S3HA 4XG1A 3LS9A 3AWNA 3KLKA 4MFEA 4KWOA 5DY2A 1MUMA 3FOKA 2CCRA 4LUJA 3W75A 3MJYA 3QQ0A 4UQBA 1VYPX 3WNKA 1FWDC 3WF0A 4KQNA 3QLDA 3VMPA 1MQRA 5I5RA 1HJVA 1J96A 3CTLA 1XQLA 4MYAA 4B92A 2NLIA 3MPGA 4AY1A 3PTQA 3DHFA 2XVKA 4ASTA 4LS0A 2A5HA 4O1FA 4C6PA 1DXEA 5EB8A 3NL2A 1YNPA 2WVVB 3KP1A 2O9TA 2J9XA 3HB9A 4MB1A 3RR1A 1SJCA 3GH5A 1ODZA 4MG4A 1ZSXA 4I7VA 2CKRA 3MUCA 3NL6A 1TIMA 3LNPA 1TTIA 3OG2A 1QI4A 3VE9A 2F2HA 1KR0A 2WC3A 5LGZA 4FR1A 2MUCA 3R6IA 2PDLA 1GNXA 3VNKA 3CYVA 3ZSSA 3G18A 3CUIA 1GVQA 5IM51 3OHMB 3IIOA 1FKXA 1Y5XA 4F0HA 2VYOA 1SZEA 2WPBA 2PWEA 4JQ3A 1POJA 1AVAA 3RO6A 5BYWA 3ERPA 5BMWA 3JW7A 1EOMA 4C60A 3KEHA 3MWCA 4XBJA 4AIUA 4XKYB 1PKMA 2W6RA 1XS2A 3RLHA 3ES7A 4G6CA 1P48A 2X1UA 2E3ZA 5G1MA 1JZ5A 4ADTA 4A4AA 4FNQA 4LYPA 3CEPA 1VRDA 4LOCA 2OQHA 1JZ8A 4OBTA 3ARQA 4QSHA 3VC5A 1H2JA 3ITOA 1B30A 5DBUA 1E4IA 2YCLB 4H8UA 1J2WA 3WD4A 1M3UA 2OZ3A 2Y88A 4E2DA 4HSNA 3RRAA 2QKFA 4BCEA 4EAMA 1C91A 4FS9A 4CQDA 2P10A 2PCEA 2Y24A 3A22A 4D8ZA 1TV5A 3QW4B 1PAMA 7TAAA 2V3FA 1EYWA 1EPXA 4GIRA 4JL1A 2JF6A 1P7TA 3TYEA 4WDXA 3S9IA 4PGLA 3CIWA 1DL3A 1H1ZA 1UC5A 1MEHA 1X39A 2JE8A 1W6TA 2OSYA 1FX6A 1VHCA 4AD0A 1RXOB 4HKPA 4MGGA 4H9UA 3BARA 1C9DA 4UXDA 1TPWA 4K8HA 4YTQA 1TJ0A 1VIWA 3C8NA 3IGSA 3VKAA 3C86A 4GVIA 1LOSA 3POHA 3NPWA 1TE6A 2FZNA 4AWTA 1R38A 5I0DA 3B40A 3IAPA 4W85A 1OT1A 1YHTA 5D2YA 2EHHA 3VO0A 3DI0A 4E4UA 3AXXA 3SUTA 1E1CB 4XAGA 1VGAA 3N11A 3OA5A 3VOIA 1KM0A 1G7VA 2XH4A 4S3DA 2AAMA 4FA3A 1ONWA 1S1RA 2WBGA 2JK2A 1F5ZA 1R3WA 4DJFA 3MKCA 4US5D 3KL0A 4BF7A 1R46A 1VENA 1P0BA 3UG8A 1DOSA 3RJYA 2ISWA 3LBOA 5JMUA 1L6GA 4GIAA 3VKKA 1QRQA 2J6VA 3PK7A 1FY6A 3P0XA 4AU0A 4AD2A 3HU7A 2QUNA 3CUJA 4AX7A 2QCHA 3PTKA 2BY1A 2WVTA 1POKA 3GHTA 3LX9A 3TOYA 3U7BA 3MANA 1U22A 5HNTA 2PRLA 4N6FA 3V18A 2QCEA 3S2NA 3GWQA 4IQLA 4NQ1A 2DT1A 4LT9A 3CHFA 1QOQA 3LSCA 5CC5A 1HGWA 4WXZA 1G4SA 1Q3NA 4EKJA 3TWBA 4ZA0A 1EQPA 1DE6A 4DQWA 4NKCA 4WR3A 5CG7A 3SCSA 1JYXA 5FF4A 3NVTA 4QIUA 3WBYA 1EJRC 5CC3A 2CWNA 4JTGA 2PDBA 4H9TA 3VZZA 1MNZA 3V7PA 3NVDA 3QSRA 3DHPA 2JEQA 4JY9A 4TX6A 2ACQA 5DANA 1T5AA 1NF7A 2O4MA 3M0HA 3G24A 4IPNB 4NZ5A 5AHMA 3L4VA 4LVDA 4FHAA 1TMLA 5FL0A 4LVGA 5DX7A 4MADA 7TIMA 2OXNA 2CBVA 1U5VA 1WXJA 1UR4A 3FCPA 3FEMA 3KOXA 3TW6A 4H04A 2PA6A 3GDLA 3FNDA 2VGGA 3SGGA 7PTDA 1YTKA 3HQ1A 1X1NA 2UZ9A 4ROQA 4MF4A 5LSMA 2NQ5A 3FJ6A 2QCLA 3MMDA 4DIAA 5MHBA 4CN4A 1FQ0A 4GHRA 2UY2A 1OFRA 4ES4A 3VDBA 2E6FA 4AWSA 1BF2A 1NTHA 3W23A 4FLSA 2VEFA 4F4RA 4US6A 1W9BM 4E6MA 4UMCA 5D33A 1WKDA 1BQCA 1EBGA 5DMNA 2QDEA 2AMGA 4L5ZA 4GH1A 4O57A 3AC0A 1OVDA 4J5NA 2XGIA 3W1MA 4E8DA 3I4EA 4IXHA 2ZC1A 3BXWA 3E12A 3A47A 4IHCA 4FIQA 3U7VA 4S2CA 4A8IA 5M17A 1GVYA 2XN2A 1QOXA 1C3FA 4C7DA 1V0MA 3W1XA 2IKGA 5HNRA 3W0KA 4CEUC 4QCEA 5F1VA 3WELA 4NYYA 1XIHA 3HJEA 1V3MA 2VX4A 4PMUA 5FAGA 1QHPA 2WCGA 4QP0A 4Z0JA 4JYFA 4OKDA 3M5XA 1D7KA 3HQOA 2D0HA 3WMSA 4LALA 1G01A 5FJPA 1NARA 2VZUA 3UR8A 3MYOA 1B9BA 1KR1A 5EBAA 1KLYA 2H3DA 3B04A 4JX6A 4O1BA 1HP5A 3EDJA 4W4QA 1JGIA 5A8QA 3BAXA 3USBA 3GX9A 1XLLA 4PCPA 4J35A 1B3YA 1CB2A 8TIMA 3RU6A 1EJSC 1FWSA 2J66A 1FH9A 5H1WA 5LNVA 1F4HA 1HO1A 3WBWA 4UFIA 1VJZA 4X2RA 3ABOA 2PP1A 6REQB 4GNKB 3N2OA 3F03K 4Y96A 3TXVA 2GGGA 4GK8A 2CBUA 4ZGYA 3CWNA 3JVAA 5HR7A 1KXTA 1XPYA 4IWWA 5M03A 3TA9A 2WMIB 3QJAA 3VIGA 1TUXA 1E9IA 1BTMA 1F3TA 2NUXA 3C0QA 1RY0A 4WSKA 3LXBA 4GFIA 4HPJA 1S2AA 1PKLA 1UZDA 3HG4A 1OBAA 4IUGA 5FJTA 5DO8A 3TYUA 2B7NA 2YLLA 1M65A 4YNGA 3W00A 4ILSA 3RPDA 3MB9A 4XZNX 4MZ1A 2FZDA 3NWRA 5JQ9A 1BD0A 3K1DA 1EO5A 2QV4A 4DWSA 1TWIA 5HXMA 3TUUA 3RLGA 3HPAA 4YTRA 4E2BA 4PTMA 3DFSA 4HK6A 3W7PA 3VNJA 4U5IA 1ODUA 2WJEA 2REQA 1W5OA 5I23A 1UHVA 4NRSA 4GUHA 1VEOA 4Y9OA 4WLCA 3U2EA 1EIXA 3UG3A 3GXNA 2X0HA 3WX7A 4NY2A 3BOFA 4A2RA 4AY8A 4DI9A 2CZVA 3TLQA 1SFLA 1I0DA 5BXSA 5LIUX 1X7FA 4LY4A 5KEZA 4CQ9A 4TV6A 1MZRA 4ZXLA 3NOYA 3FA3A 1LTDA 3OLGA 3W85A 3NZ1A 2PGWA 5REQB 1NEYA 1IWBA 3U4FA 3ANYA 2DPEA 3G1VA 4HD5A 1NDWA 1K77A 1M01A 1XIFA 2BHUA 1O6IA 3APYA 3NGFA 4XBSA 1JDAA 4NJIA 4JNYA 1XX1A 2VJXA 1MW0A 3MHGA 3MBDA 2VEMA 4BA0A 3NTYA 4GX9A 4JIPA 4XD5A 1HFBA 2UY5A 3T44A 5KETA 3TP4A 5HWNA 4PR4A 2G5WA 5K7JA 2DUZA 1A0CA 2XWEA 3ONBA 1JEZA 3TAKA 1QAPA 5K2ZA 3NQCA 1DE5A 1XKJA 2BHYA 1A3XA 4KCTA 1YW1A 3BURA 3RO8A 1ISXA 2Y0FA 1S5WA 4UFHA 2DZXA 2PWHA 1Q2RA 3JZUA 4D6JA 3ME3A 4H7ZA 4O4VA 4AZCA 2DZSA 1KCXA 5FJRA 5ABHA 4HTYA 1J11A 3WMLA 3V0UA 4UOQA 5D2VA 2ZRVA 1HW6A 4EPDC 4XAFA 7ENLA 3H7UA 3ELFA 1XM3A 4P7RA 1A49A 3C3NA 4M29A 4K39A 5A6AA 3MY9A 5F2GA 5TQLA 3W1RA 4F2BA 2CZ5A 3TYZA 3MMUA 2YZRA 1J0HA 2H8XA 5DBTA 4LPCA 3ZQ9A 1O95A 4WD0A 3CQIA 4AIOA 4Z17A 1DKWA 1C93A 5A2AA 1CGWA 4MYXA 1KXVA 4HQVA 3NQMA 3LU2A 4RPQA 3CL8A 1D3HA 1XIGA 1T7LA 1EOKA 2WSRA 1D8CA 3WNPA 2JGQA 4LAKA 1Q7QA 2HK0A 1QBAA 4PMQA 1KGWA 4Q4MA 3APTA 1TFVA 4F2TA 3ABSA 3BGAA 1ADOA 1ECEA 1HP4A 3RLUA 4JQ2A 2I57A 3HFTA 3HV9A 3SFKA 1OCBA 1VYRA 1P6WA 3IVSA 3AHVA 1R3SA 3PULA 4TU1A 1YPFA 4TXEA 4AWEA 1TPFA 4JTRA 4B3LA 4R85A 4NZ1A 3VINA 1PHWA 2Y5EA 4W93A 1RPKA 1KV5A 3CHEA 1M03A 2PWUA 2A3AA 1E1FA 3H12A 2YXGA 4XQ6A 4IMDA 9XIAA 1DWGM 4TO8A 4Q8PA 1O66A 2YIHA 4RUBA 5FSDC 3VDCA 2F38A 1EDQA 5GNXA 3E96A 4RE4A 1XIEA 3GRIA 1W3KA 3B8SA 3I6TA 2PODA 3KOYA 4FNUA 3W84A 1S5NA 4S2BA 1V8EA 4XAZA 1J0IA 2JEPA 3ITVA 2FB3A 1UCWA 3A4XA 5MKGA 3PBUA 1Z48A 4GZIA 4CNOA 4RLIA 5A2BA 1UUOA 4EP8C 1TWDA 2ZX5A 4KFPA 5BOFA 2W27A 5K9XA 1Q6EA 5FF2A 4AG0A 3PJTA 2AL2B 3IRDA 3Q45A 1ADSA 5AC7A 4MNLA 4XIAA 1YX1A 1PYMA 4JDYA 1EUNA 2BVDA 3SECA 1Q13A 2OEMA 5MF5A 5CZTA 3DH7A 2POZA 4CD4A 1EEPA 4BHYA 2V69A 4UQCA 3AIUA 1CPUA 4PMDA 3UD6A 2PWFA 1R3QA 6XIMA 1O68A 4EXQA 1XLEA 2PDMA 2GSEA 1JCNA 2BGQA 2X7WA 4GPNA 4AVFA 3L12A 2OOFA 2X16A 3NM1A 3L4XA 4NILA 4QEEA 3A5FA 3EPOA 4PFMA 4JTIA 1WDDA 2FFIA 4K2SA 3ECQA 2OQLA 1M53A 3NQ6A 3EMCA 4KH2A 4AW7A 1GQLA 5A6TC 1UD6A 1V0NA 4W88A 4D1IA 3NIYA 2X1TA 2ZZ1A 3TVAA 2PMQA 4JXCA 3IANA 2NUWA 1TWWA 4H8NA 3EWUA 5CXPA 4Y6GA 1GQJA 3WQ4A 3ZSTA 3TJXA 1Z42A 3BLOA 3CAVA 4FO4A 2WW5A 2ZQ0A 3EDKA 3AZRA 2ZICA 1EC7A 3BCJA 3GC4A 4AXNA 3EWXA 3WD3A 3ICJA 3KVLA 2WWCA 4Y9PA 3TCEA 2G3MA 2R82A 3O8AA 2PPGA 3D3AA 2OZ8A 1U1UA 1GQNA 4XUGA 4R88A 4HZMA 3O7UA 3ZT5A 2QUUA 3B06A 2XJ7A 3CZGA 1GT8A 2P76A 1PJ9A 1MEWA 1X1OA 6TIMA 2EPLX 1DJIA 1FP8A 3E6EA 1JRCA 1OD0A 2HMCA 5CJMA 1K9TA 3L7RA 4WDWA 3SUUA 4DNHA 4H1ZA 4W86A 3W7KA 4A8NA 1JCTA 2BFGA 4NZFA 4LRSA 1M41A 8XIMA 4LXFA 3MMTA 2RGLA 5C9ZA 2GK1A 3STFA 4B3ZA 1EHAA 3B03A 3DC0A 4GC3A 7REQA 2C1IA 4DLMA 1JRBA 3G3DA 3ABXA 1OK6A 4DBEA 2A7NA 2BNJA 2ZUTA 1Q6DA 3VOGA 3SRHA 1OFAA 2WANA 4CD8A 3CEUA 2JIEA 4BY3A 4IGMA 2BXVA 2BBFA 4BWLA 1WKFA 1WDWA 4M51A 3EDDA 1OHLA 3LLXA 5D02A 1A5OC 5AC8A 4L6OA 1FHDA 3AAMA 2QW5A 5G2WA 4DVOA 4JIEA 2XGZA 1E15A 2EEXA 3E0IA 2XU2A 3M6YA 4FX8A 1V6TA 1PTDA 2C0AA 1O12A 1LG2A 3S2CA 4QGCA 2R1LA 3P61A 2ACRA 3SM0A 3HOJA 3UR2A 5F1UA 4B5VA 2VFFA 3EEGA 1TRIA 5B80A 2EGZA 3P80A 2AAAA 4NNAA 1ZTVA 4I5UA 2YB1A 3ZJ6A 4JOMA 5U7SA 4PUWA 3LENA 3N4AA 3LPOA 3NXLA 1OK4A 5AYXA 2HXTA 2I1OA 1H7XA 1ADDA 3BICA 3FJ4A 4K6AA 3AUOA 4HCDA 1M7JA 3THDA 2I5QA 5AY7A 5HJXA 1XRSA 4ZO9A 3WBXA 4AQLA 1XSKA 3QF0A 4DJDA 1WNOA 3A3HA 3ABZA 1VFMA 2DJLA 3T2OA 2FZMA 4X61A 1KBBA 4N9BA 3QHOA 4ZOCA 4XAYA 4GJJA 3MUAA 3VIOA 3CV7A 4QJ5B 4HNTA 1UH2A 5I02A 1WYIA 2IW0A 4O15A 1F74A 2PU0A 3OW1A 4W5UA 4DBSA 3KBSA 2BODX 1GGOA 1U33A 2OR2A 5HPCA 4F3HA 4BWLC 2ZE3A 1QWGA 4B5WA 1FWFC 3ES8A 1VFOA 2PLMA 3NPXA 2E5BA 1RJRA 4DO4A 1YDVA 3BC9A 2I17A 1J6PA 4DZHA 1R30A 4ATDA 3S5YA 1H7NA 4PUMA 3NQ2A 4C6CA 4R34A 4CGTA 1PIFA 1U2YA 4GVGA 4V15A 4X63A 4V1XA 2FHCA 3STEA 3TOPA 5C54A 3RJXA 2E6DA 2H9AA 4IPJA 1SQ7A 3M5YA 5HANA 1VBRA 4GUIA 3C2VA 2CZFA 2XPKA 1UR2A 5FEWA 4IZGA 3WQVA 3LZ3A 4F48A 4JTJA 1DJWA 1KTBA 3HG5A 2XISA 3A6OA 5LIKX 4QCFA 1Z6KA 1OCNA 4NZ3A 3IIPA 1QI2A 3WDRA 3WKZA 1AL7A 1GVIA 2D22A 2DZTA 2VC9A 2PDHA 4FLOA 1HL9A 5HULA 2GLKA 1TV3A 2XTKA 1QO2A 2B4GA 3UXKA 5AC6A 3ARTA 7XIMA 1ZY9A 4R7WA 4ATWA 2CLEA 1FDZA 5BXTA 3BL3A 5JIPA 4JQAA 4PL1A 2OT1A 3GXTA 3TN5A 4NHVA 4LFYA 4EX4A 4YU1A 3FA5A 3DYPA 3TTQA 2PDXA 4R33A 5AYBA 4Q8NA 1AW2A 4HMNA 4Q7IA 3USZA 5G2HA 1EP2A 5IHSA 5J5RA 1K3UA 4GO9A 5H91A 3ZWTA 3LHVA 2GQ8A 2IPGA 4C6KA 3RK8A 5DELA 3N6HA 1QATA 3W2NA 5A3HA 1KV8A 1CGVA 3WLMA 2C1HA 6ENLA 3I10A 2QAPA 2O92A 2E9LA 5FAJA 2QGHA 3S1UA 1KFLA 2ZUMA 3HGSA 1XW8A 2YL5A 3B8UA 1B3OA 1CYGA 4MUPA 1RCXB 1Q85A 1X96A 1O60A 1S5MA 4MKSA 4NAFA 1SR9A 5FF0A 4H83A 3RX3A 3WY1A 5D9PA 5E70A 1V79A 3LD5A 4MVAA 4AD1A 4DM1A 3DYOA 1GORA 1K1DA 1IT0A 3EX4A 4A8LA 1E6SM 2VWTA 4C90A 1OABA 3PZNA 3LDVA 1ZJAA 1ONRA 4ZQRA 5AZ1A 3H23A 4F2UA 1DXFA 1XI3A 1DIDA 4J7RA 4B4FA 1I2NA 1UD2A 3DFTA 1EP3A 1OC5A 3GH7A 4J1OA 3WBEA 1RK5A 4M7TA 3ZJKA 1D9EA 4NRRA 1Z69A 1I2PA 1NFPA 2X1IA 4LX4A 1QOPA 4RZBA 4AH7A 2HBXA 3TYDA 3VD5A 5CAKA 1UZ1A 1E0UA 1YXYA 3SDOA 1PXGA 3W6MA 3AICA 3CT2A 4H01A 2GWGA 2Y8KA 1DP0A 4GBUA 2YA1A 5FEPA 4ZO7A 3VD9A 3NQDA 4IG2A 3AIBA 2O9PA 1P6BA 1UKTA 3S5OA 1F8IA 4LF1A 3U2OA 4H6EA 3AXMA 3WQ5A 1OCQA 3H70A 4Q8OA 3N29A 4KMQA 2QF7A 2PDIA 1ZUAX 4YHEA 1JUEA 1I8JA 5ECUA 7ODCA 3FX4A 4DBWA 3SN0A 4URIA 3FFSA 2X7VA 4AZ5A 1BKSA 3SBFA 1JDEA 2D2JA 3WJYA 3IEBA 2KAUC 5CZ0A 2GYIA 4D6DA 4M6UA 1XSJA 3CWOX 4ZQMA 4YVVA 1QTWA 1G9HA 3QC3A 3F7JA 3OVGA 3N3MA 5D8ZA 1JQVA 5EGRA 5I06A 1A80A 3W81A 4L1XA 1HJWA 3HJZA 3UPMA 3QQ1A 2D2OA 2JBMA 2NWSA 3FJLA 3BZJA 3QKEA 1E1EA 2A7RA 2EBNA 3AS1A 3BLFA 3ZR6A 1TVLA 5FJOA 2FB2A 1DJXA 4CCDA 3TIMA 2CZEA 4B91A 1HKWA 4PMXA 2YCEA 3VNMA 1CXLA 1LORA 2BP1A 2JKAA 4OE7A 4IF2A 2ALDA 2R94A 4GI6A 1QPOA 3WENA 4LNCA 2FDSA 2BXZA 3AJ7A 4IP7A 1C7TA 2FMOA 2UY3A 2A6NA 3VC6A 4KWVA 2V5CA 5BMXA 5DCEA 1HKJA 2A3CA 3GNPA 1UR1A 5TBOA 1PPIA 3E3HA 3BSHA 2QJIA 3V35A 4UQDA 3VA8A 4MLRA 4Y8EA 4C6DA 2OX4A 1JD7A 4FIRA 3NYZA 1K7FA 3SUSA 3N25A 3MP3A 2DZWA 1UMYA 1NOUA 5I00A 1E55A 1FCQA 1B0IA 4IM4A 4D6HA 1R7AA 1B31A 4PA8A 4GQQA 5AKQA 4UNIA 2VI0A 2P8BA 3VD7A 3W6LA 3NFUA 3T0TA 2VD9A 2ZCGA 1VFFA 1TCDA 5CC7A 1W0MA 1UKSA 1FUYA 4NX5A 4ZB2A 5FD0A 1BEUA 5A8MA 1R0MA 2H3BA 2G41A 2TAAA 3AS3A 4O17A 2G3JA 3KX6A 4F9JA 3GBEA 2PP3A 3CH9A 4FPSA 3BQ6A 1W1ZA 1HJXA 4JFUA 4TMBA 4GLEA 4RDZA 5HQEA 2YDRA 1RUSA 2D73A 2EJ1A 4L6DA 1EYEA 3G6MA 4OOUA 3N12A 3F4CA 2IXVA 3QPEA 3PZGA 2C19A 3EGJA 3GTXA 4BS0A 3AYSA 4AZIA 4QS6A 1MYRA 1JCYA 3DN5A 2JGYA 2J7EA 5HINA 3M47A 3A3XA 1QNRA 3CZLA 2OB3A 3H8AA 3SCRA 3NZRA 5A6BD 3W1TA 3PWGA 1XLIA 1CBGA 3R8HA 3JR2A 2GPTA 4LC6A 5H2ZA 4HYVA 1ZB5A 1F9CA 4IGSA 2D1ZA 5DY3A 4GY7A 1WP6A 1GVRA 4NX0A 1R2SA 4HNCA 3W22A 3M07A 4ZODA 5CLTA 4M1RA 3WDIA 1BWLA 2GDQA 3LXCA 4DUVA 1XIIA 5AHLA 1VEPA 1IT8A 1OX4A 1A5UA 3SURA 4HPGA 4K1WA 2VDHA 3VPLA 3W74A 3FJNA 4JNZA 4C7GA 4ZQOA 2IQDA 4L7ZA 4OJYA 1VJSA 1YE6A 1Q6LA 3EWYA 3WLLA 4JEQA 3KAOA 3UCQA 3VAVA 4J3WA 1YMYA 4RPPA 2WHMA 3RCYA 2ZZ4A 2GVJA 4LBRA 5HWJA 3WLTA 3RR4A 1H09A 3CL6A 3GHUA 5AHFA 5DMLA 4ACYA 5FACA 3T0DA 4XD6A 5FIPA 2RKXA 2EKCA 2XHYA 3H55A 1TPEA 1MDRA 3T08A 1C9WA 1P0KA 1BGGA 4O1CA 4Q8VA 4G8TA 1V3HA 4XSLA 2QJJA 3TYCA 3ZLHA 2E40A 3KUMA 4WDUA 1YTEA 3WEMA 1S5TA 2YBUA 5ABGA 3CZ8A 3UBPC 2J8FA 1HN1A 4DUXA 3TDFA 4TIMA 3XIMA 3C0JA 4DF0A 2R1PA 2ZYFA 3CASA 2WPGA 1ZCCA 4MKNA 4NIRA 1C8QA 2H8ZA 4ZR8A 1QNQA 1E73M 3GAKA 1IYXA 3ZLGA 1PX8A 3NQAA 3MT1A 1SZRA 1E72M 1PTAA 3WQCA 3OIHA 3PPCA 1TJ2A 3GXPA 4HA3A 4WK9A 3FVMA 5IBXA 5I3GA 3M46A 1HO4A 1OT2A 4ORIA 4XX6A 4HCHA 4I6VA 3NAVA 4KS0A 4Y9MA 3L0NA 4PN2A 4HU4A 3R58A 1X7IA 3CO4A 4AF0A 3THQA 1DPMA 4V2XA 1TV8A 1YDOA 4NAEB 1MFVA 4MNJA 2QGYA 4YLWA 5EPDA 1VZWA 4NUWA 2QCNA 2B0MA 3QYQA 3MQTA 4HYRA 1Q8JA 5I78A 4UMAA 2YOCA 4P7NA 3TSMA 1WO2A 4FSAA 4GGBA 4L80A 5CSYA 2B81A 3HIJA 1PO9A 1J6OA 2CLIA 3HPZA 4A3QA 5ABFB 4LEQA 3SADA 1H49A 1CTNA 4WOZA 3N2TA 2V2DA 1F8MA 5HOSA 4NJHA 3P3BA 1BPLB 4BK9A 3VD4A 2FIQA 1IR1A 3CM4A 3HF3A 4ALDA 3WMCA 1XC4A 4LNYA 2QCFA 5FESA 4S3CA 1V6UA 3F2BA 4H41A 3RCMA 4PUKA 4PMRA 1YBQB 4UTHA 5C6MA 4X0VA 4C6NA 1FWJC 4ML4A 5EFFA 1TPB1 1MXGA 3VIJA 3ZR5A 2Y4SA 4AYGA 2PWDA 3VYLA 3ARZA 4WY0B 1F3WA 3OZOA 1I4NA 1JZ4A 4QX4A 1XG3A 3FEQA 2ALRA 4ZZ9A 2Z25A 4LUSB 3BMXA 3GKAA 1V3JA 4V28A 4RNJA 2GOKA 2Z27A 2PI6A 1NJJA 3HQNA 4KRTA 5IBXC 2FPYA 3HGOA 3CPUA 4LUIA 4JYEA 3P60A 1UROA 3TROA 2Q3OA 4FXFA 4QLJA 1DEDA 3WLOA 3ZYZA 5IFPA 2E8ZA 3FHQA 2PURA 4J3UA 1RLCL 1J2BA 1RP9A 2WMFA 1IF2A 3WLPA 2NUYA 4J3ZA 4GXPA 3GUWA 3KRSA 5D2WA 4BI7A 3A23A 2ACUA 5LYRA 3SGUA 3R0DA 3LBMA 2FVMA 4O1AA 4GYKA 1ME8A 2NQHA 2YX0A 3C2FA 4BI5A 3GE7A 4X3ZA 1M1BA 3TFCA 3AXHA 4WKFA 1N8WA 3PAJA 1X6UA 1EPVA 3LEPA 3G2GA 3ZFHA 3MCNA 4NZCA 4NJJA 2FZ8A 2WJDA 4MWAC 3HG3A 3M6DA 2GUUA 5BOEA 1H3GA 4U10A 4AX6A 3I3EA 3DZ1A 1G4PA 3E2QA 2VGIA 2E9MA 3UWQA 2RH9A 2DH2A 4GY0A 4JFVA 3AALA 3MO7A 1V4YA 1F61A 4AEEA 3PBMA 4MY1A 2ZTJA 1O94A 4OOZA 1PZ2A 4IIGA 1HGYA 2ISSA 3O6AA 3TW7A 2D23A 1SZFA 3O16A 1E3XA 1UIPA 1EC9A 3AU6A 4JTKA 2XSBA 1MW1A 2O0TA 2VVSA 5D8WA 4IP4A 3RM8A 3NXFA 3AHXA 3GVWA 4KIEA 3AOFA 3S1VA 2HZGA 2CEQA 2YDSA 1KWKA 3TQVA 4YL2A 4U28A 3L5MA 5F4XA 4D6CA 4HHPA 3W3OA 4KWSA 1SW7A 4S39A 3RN6A 3M0LA 2J74A 4RZ4A 1JPHA 3G3MA 4Q8WA 4LAMA 3CLMA 5CBIA 1UR3M 2GJPA 3RLVA 3A64A 5K4ZA 2VENA 3AJXA 1D2KA 2Z4GA 1N8IA 1GTHA 1P1XA 1TIWA 4KFOA 3BV4A 1F6KA 1UQZA 5H8MA 3MA8A 3B8IA 1VLIA 2VZSA 5EA9A 3N4FA 4C1KA 4CD5A 3DCPA 1ISZA 4W9TA 3WLNA 5C9UA 1EP1A 3L4TA 1UJQA 3IGHX 2Q02A 4GRSA 4YTUA 4K7VA 2A3HA 3PG8A 3ONCA 1JF5A 3MDUA 3TZNA 2D3LA 4F66A 3DHUA 1TKKA 2GQ3A 1UP2A 4H9ZA 1SFJA 2WNWA 3SSZA 3MP5A 4C1LA 3VOFA 4DZAA 4AEFA 3W1QA 1G69A 1M9HA 1O7AA 1OX4B 1VQTA 3CZJA 3VGHA 5EFDA 1GYNA 3QV6A 3KDNA 3GTFA 3ZM8A 5CG0A 2EG6A 3FAWA 3R43A 1J18A 1UWQA 1T8XA 5E6YA 3U8GA 1QMLA 4GI4A 3AIEA 1OGGA 3COTA 2O9OA 1Q6CA 3FSUA 1P6CA 4IL2A 4GQRA 1ZQ5A 1FWWA 2PTYA 4AIBA 5A69A 1ZS2A 4S38A 2DIKA 1Q7MA 2FZ9A 1YYAA 1IR2A 4G9PA 3M64A 3QC0A 1ALDA 1TR9A 2X42A 1VPYA 3PR2A 4KIRA 4JIIX 4X2PA 2WK2A 2J8GA 1IGSA 2VRJA 3AIVA 3AHYA 1NAL1 4F79A 3ARPA 1QPQA 1H60A 3T9PA 1GHSA 1PTGA 3C56A 3S1GA 2ZZ7A 3NCOA 2X0YA 2ZKMX 3UCCA 2I14A 1J0YA 3CB8A 2YA2A 1NF0A 1PS9A 5CBBA 5C0QA 3KW3A 3GXDA 4RKAA 4W7UA 4L61A 1Z32X 3RCNA 2ACSA 2YXOA 3H2CA 5LA2A 5BWAA 3SY5A 2PLCA 1UOKA 2Q8LA 3SY1A 3PUOA 1SFSA 3TH6A 3W01A 4P61A 3W29A 3WDPP 2EF9A 5DMYA 2OYMA 4NJGA 1SO4A 3KCOA 1BG4A 3GHRA 3TNOA 3ARWA 3PBGA 2Q8ZA 1E43A 4GUJA 4FR6A 2EAWA 1A5AA 2NV1A 2IKIA 2RGMA 1GG1A 1HJQA 3AYTA 1ZFJA 5RUBA 1LWJA 2PFHA 2WMGA 3W76A 3LNMA 4EWJA 1TCMA 5T26A 4J2MA 2Z1BA 3D0CA 5GJNA 4PBGA 1RBLA 4U33A 1NVMA 4W8BA 1ML1A 1IXPA 1NOWA 4Y90A 3RG6A 2J6XA 3DUGA 3JUGA 5D03A 4C6IA 2G3NA 2CPUA 2RDWA 1FWNA 1MUCA 1EA9C 4IICA 1F6PA 1MFUA 3PNZA 4GIEA 5TIMA 1QPKA 2Y63A 1A3WA 1EX1A 2WMKA 3NYDA 3I7RA 4QG8A 3Q67A 4AXKA 3OG3A 3VZYA 4JTAA 3B9NA 1RZMA 2ZDSA 4KETA 2I7GA 4DLFA 2PSNA 3B0YA 2BY0A 1TTJA 3KCJA 4CUCA 2FMNA 4GIYA 4G56A 2JQXA 1GOQA 1MVYA 2QUTA 4W8AA 3W07A 2KZHA 2HE5A 4KFNA 3LGEA 1UC4A 4QS5A 2NV2A 4RNFA 2F84A 3NSNA 3P74A 4NZJA 3PB0A 5GNYA 4P5UA 4BKNA 9XIMA 3S9YA 2G96A 3KOFA 3KTXA 1CXFA 2BLEA 1AW5A 2W61A 1VBHA 4DXVA 1E0VA 1Q4WA 1IZJA 4LV9A 3K1GA 4HJWA 3CUFA 3QLLA 4O0KA 3UWWA 2NQ9A 2VGBA 3UWVA 2V30A 3G8EA 1XIMA 1EDTA 3UW6A 1Q6FA 2V67A 5TF0A 4HPHA 4FB7A 3EXSA 4MWAD 4EPKA 2PC4A 4I90A 4IT1A 3WLIA 4CNTA 2YL6A 3M0KA 4R5EA 2QCMA 4GYPC 1GUVA 4CCEA 4GWEA 2BVWA 3KM8A 1FWIC 4F9DA 2ZA1A 4L6HA 2FVLA 2X40A 3T8LA 1OB0A 1H0IA 4RX0A 2FYMA 3P67A 3E5PA 1FWAC 3W82A 2WSPA 4JX5A 3FXYA 3I7SA 1S2WA 1ONXA 1TWZA 3FA4A 1OYAA 3E2RA 2ANUA 3GBDA 2PCQA 4HZ8A 2V6AA 3PS7A 3PVFA 1IEIA 4QDWA 2NVCA 2ZADA 2G8ZA 4DZ5A 3LMYA 1GVEA 3VUPA 3T8QA 5HDRA 2CLFA 3ITTA 2R14A 3B97A 4Q3MA 3CL7A 4FEZA 1F3EA 1FXPA 2BOEX 3B0UX 2UV8G 3B8TA 3QQWA 4RNIA 5LIWX 6PTDA 4N9DA 1SM9A 3A3WA 2QR6A 4O53A 5E5CA 3KRUA 3MSRA 2H6RA 4OHQA 1PKNA 2ASHA 4AFYA 3GHSA 4M7SA 4WJ8A 3QR3A 1L6WA 1XDJA 1M04A 3B9OA 5A6MA 4KRZA 3S47A 3O2LA 1R6WA 3RMJA 4IGNA 4L1WA 1OM0A 1RVKA 1TRDA 3MZ2A 1R7OA 3GNOA 3NQFA 1R2RA 3GIQA 3N3TA 2NSOA 5CSUA 2HPIA 4U2ZA 2WLYA 1NY1A 1BF6A 4X60A 3R0KA 3TAOA 1CCWB 1M5WA 4L56A 2OLSA 1V6WA 4DN1A 4UTMA 3O6CA 4ICMA 5GPRA 3SRKA 2P53A 3OBAA 1OGBA 1AW1A 1RD6A 3PUEA 4XZIA 3RITA 2ZFAA 3QMTA 3PF3A 3REQA 1VFHA 2BVYA 5CSSA 4LUTB 4UQAA 4NI8A 1TA3B 4MJ2A 4RW5A 3GY1A 4GI9A 4P8WA 3F5KA 2VP8A 2Q01A 1TJPA 3TTYA 4GE8A 3TONA 1AZ1A 1V7YA 1FFQA 1WE5A 1ZHAA 3KL5A 4LANA 1P0DA 3EOOA 2B7QA 1RQHA 1FHVA 4HT3A 4NZ4A 1NELA 4EPBC 3VNDA 4I5RA 1ZAJA 4C6QA 1BGAA 4XZBA 3W7OA 4ADSA 4PMJA 5DMMA 1EF3A 4HN4A 1WDPA 3PFRA 2HK1A 3K4DA 2YDAA 4ERAA 1ITCA 5LNWA 3U5UA 4IFKB 3EB4A 3VMNA 1Q63A 2W9MA 4K36A 4G1KA 3N19B 1IXNA 4JFSA 1H62A 3AI0A 1TSIA 1GVOA 2BS9A 3BSMA 4D2JA 3QKZA 1E9YB 1JZ7A 3ARRA 3C0LA 3VM5A 2W92A 4UCGA 1RY8A 3GM8A 2WKLA 1BWVA 2Q8XA 3GQYA 3W27A 1XLDA 2PD9A 5DEZA 1AL8A 3PM6A 3CLWA 5EU9A 1LWIA 1A5LC 2HVOA 3LPFA 3RRXA 1B90A 3GDBA 5FKYA 1L2QA 2DQXA 3VIHA 1DYSA 3XINA 2A21A 5E9XA 3CC1A 2DU2A 2YGYA 2ZX7A 3FYOA 4AB4A 3QGAC 1L9WA 3BLKA 3UJEA 2PTXA 4HK5A 3VILA 4JCMA 3TC7A 2BVTA 3KBJA 1XCXA 2OZTA 4CQAA 1R9YA 2FQIA 1TO3A 4UUIA 1FXQA 1JIBA 1VJIA 1ZBCA 2VT0A 5AVNA 3L9CA 1L0PA 4ZO6A 2ZDRA 3THAA 3ZO9A 4EF9A 3WEZA 4B4HA 4Z1YA 2TRSA 5GJPA 4JN8A 4GOAA 4GXMA 3MS8A 3S4TA 3NZQA 1UWTA 4HU8A 4HOWA 1V7AA 1CEOA 1KKRA 3UY8A 3ZOAA 2XSAA 1JUBA 3QN3A 4ZQPA 1GJWA 2GGHA 3QFWA 1Z8AA 3AIRA 4UMBA 5CSRA 3L65A 4TR9A 3QHMA 3QY6A 1JVNA 4KCWA 1ENUA 4R3UA 4JTDA 2QCDA 4JTUA 3VKCA 3TV8A 4AVOA 2GJLA 3KHJA 1BSIA 3DHDA 1H7OA 4RZ6A 4C6BA 4KCVA 3SUVA 4MB4A 5KINA 2F6UA 4YTSA 1B3XA 3JRKA 2OSWA 1JNDA 2UBPC 3CYJA 5XINA 3T4WA 2NW0A 3FW6A 1IIHA 1FH7A 3P6LA 3C61A 1VP5A 6TAAA 2QJMA 3V1PA 1K9FA 2GL5A 4B9ZA 4IPPA 2IQTA 1L8NA 1LBLA 4CVUA 4DPQA 3LHZA 1QU4A 3B8WA 3K30A 3VKDA 1XYCA 2R6OA 8XIAA 4KWUA 5C7HA 2NVAA 3WUGA 4D1JA 2E6AA 1KCKA 3EKGA 1XH0A 3SCVA 1A47A 3R0UA 3R79A 3M0IA 2WQPA 3QVQA 4JTHA 4ZTXA 1H1NA 1PZ3A 3K4WA 2J79A 4KERA 4AMAA 4Q4RA 1UH3A 2F7FA 3O3RA 4K37A 4IQDA 3LCXA 1E6PA 4F8XA 3QR0A 4A22A 2OFJA 3TKFA 1ELSA 3MZNA 3NQ8A 5I24A 1IEQA 1FBAA 2E7FA 3VGEA 3QV9A 5A5WA 2VZVA 5BNKA 2J8TA 3E1F1 3MV11 1SMAA 4KEMA 2J7CA 4FOUA 1YXCA 3BJFA 3QSTA 3WUFA 1BXCA 1B57A 4FXSA 4DI8A 1LYXA 5LHFA 1LG1A 2VFEA 2V8ZA 4N02A 1TPUA 1EUAA 4J3SA 4YWIA 1W56A 3PJXA 5HK4A 4PB4A 1TPC1 1CX9A 2D69A 5A94A 1E6QM 3ARXA 2QPXA 5A6LA 1JPKA 3NO5A 1LCOA 3W7DA 4DYKA 4G7FA 2QPUA 2ZUSA 4GQBA 4L9XA 3UR7A 2SFPA 1IIGA 1OGSA 1JCJA 2IS7A 4CQBA 4D8AA 2OEKA 3GD6A 4NG3A 3UU0A 2V3EA 3ZZ1A 4DZIA 1LOLA 3DOPA 4D71A 3DGRA 4K68A 4M82A 2Q3RA 4M80A 1EDGA 3RMEA 2RFGA 4M5PA 1RPXA 4DF2A 2CXEA 3N34A 3LOTA 2J7HA 3BE7A 1LDCA 1H51A 3HBLA 3W1UA 3A13A 4H6RA 3TMQA 5CCZA 2RDXA 5A8GA 1RSCA 3BG5A 4JFTA 3AQUA 2DSKA 2ZXQA 1MWOA 3P14A 2P0IA 5G1TA 2TSYA 2CNCA 1CIUA 3JU2A 1PBGA 4NU7A 1ZU8A 1FCUA 2CYGA 1XLHA 4B90A 5I3JA 2R9RA 4HA1A 3LCFA 5GQBA 4MZYA 1OY0A 4ACZB 3UERA 1A0DA 3FGCA 1W3JA 1PE1A 2PDFA 1JDCA 2XN1A 1E3ZA 3DECA 1EC8A 4JNMA 1W2PA 1T40A 4E2VA 1TELA 3M5VA 4Q4QA 2Q71A 1KWGA 3M0XA 3CHCA 4YCPA 3WK1A 3IUHA 3OHIA 1UH4A 1XLFA 3GC5A 5C9XA 3VVGA 5LXXA 3FYYA 3ENLA 2GSHA 3U48A 1DJGA 2Y89A 4O11A 3I65A 5EMMA 3U2ZA 5CGTA 2I9EA 1A5CA 3R94A 4D6IA 5FF7A 3TW9A 4PC8A 4WSJA 5F2IA 1LL6A 1MMFA 1DQUA 3GNNA 1RQBA 3BLLA 1ISVA 4RDVA 1LWHA 2CWXA 1YNQA 1PV8A 1SYTA 4EAYA 2E9BA 2ADAA 3AMLA 1G94A 4DWDA 3ALGA 4HPXA 2Z1KA 3EKLA 1XPGA 2H90A 3WF3A 4ORMA 1BLIA 1FWCC 1T8QA 3M16A 1YQ2A 1J9YA 1OINA 4YS1A 1GW9A 3ITCA 4JHZA 4U2YA 4MUZA 3BSGA 4Q32A 3MUXA 3T0AA 3M0MA 1JYWA 1OF8A 2D2GA 4IIBA 2GUYA 2E67A 1IHIA 1KXQA 4YN5A 1ISYA 3KVKA 3VGDA 2AQVA 4IISA 1UA3A 1XP3A 5HATA 4A3RA 3SZ8A 3DG6A 3TQKA 3QFEA 3GZ3A 3PZ9A 1NWRA 3RM4A 1XL9A 1XBYA 2OOGA 3NEVA 3J7HA 3W24A 3EA3A 5M3WA 1EGMA 3GNXA 3GIYA 1ZLPA 1B5TA 3U6WA 3QZ6A 3WUEA 5D37A 4LJ3A 4C1NA 2YKKA 4JS3A 5A6SA 3QH2A 4V1YA 1U5JA 3ZWSA 3BTNA 1D3GA 1AMKA 4O13A 3TEVA 4JY8A 3AWOA 1T6MA 3NL5A 4AAJA 3ZVHB 4CU6A 3CMGA 2XIJA 3QW3A 3LTSA 2HDJA 1BQGA 4UZUA 3AUJA 3L0KA 2QHAA 4A3UA 3UXIA 4AEOA 4C65A 3URAA 4AVNA 4UQEA 1LBMA 1XUZA 4LS2A 2BGNE 4ZB5A 4MNMA 1YLVA 4D6EA 5XIMA 2ZZ5A 4TV5A 2J24A 1LUCA 1KLZA 4Q6JA 2WZIA 5E1QA 4HSOA 1LP6A 1KA9F 1XGDA 2Y5JA 1M7OA 3WDHA 3N9KA 3W2KA 2FH8A 3MUIA 5CPQA 1XG4A 3SR7A 3WL0A 4ONVA 3PNUA 1QNVA 4RCXA 5FA5A 5BXPA 3V0SA 3VMOA 1G67A 4BJHA 3R1ZA 4RE2A 5AC5A 4BQ5A 2O9RA 3SFWA 1V93A 2D0FA 3WQ8A 1B9ZA 4S1FA 1NWUA 4IP5A 4AMCA 1MRQA 5B7ZA 2EQDA 3JS3A 3SCQA 1KRAC 2GDVA 3H2MA 3E38A 1EZ2A 5TNVA 1XYAA 3LK6A 1NP0A 5IOBA 4GQ0A 3P8IA 4C6JA 4MNKA 1E70M 3LUTA 4F40A 3WMBA 3QOKA 2PRMA 2KX9A 3LCWA 1G5AA 1KRCC 1ZCOA 3LQLA 4AYSA 1XFCA 2FKPA 1C7SA 2PZNA 1FKWA 4TQTA 5C2CA 4Z2JA 3W38A 5CLWA 1TX2A 4X0NA 2Y61A 1SPQA 1UBSA 3RHGA 3GFXA 1W3IA 3NURA 3IUIA 4DX3A 1WA3A 3IJDA 1ECQA 1VBGA 3GDKA 3SRFA 3B8DA 1FDJA 3H6OA 4JTFA 4BF9A 2INZA 4Z1AA 2WC7A 3BLDA 3F2CA 1JF6A 4TVUA 3CZKA 4GG9A 1SZGA 1W5NA 2YJQA 4DYJA 3TE9A 1K9DA 2X2YA 5C2GA 1HVQA 4K7YA 4ICCX 3ZVIA 1QI3A 2VQUA 4GKLA 3GG1A 2WCAA 1CXKA 1OJXA 4AZ6A 3ITGA 1UWIA 4ZSTA 3BJSA 2DVTA 4LB4A 2E25A 3NZGA 4WKHA 2AQWA 1TREA 1W2VA 2J88A 4J9JA 3RX4A 5AHNA 3N15A 2V5KA 2PBOA 3BGGA 3UZWA 5BWFA 1PIIA 3LYEA 3A9BA 3LHWA 1GTEA 3DC8A 3DIPA 2YB4A 5AOUA 1YRRA 4UTUA 3KFTA 4YYCA <