4ZFMA

Structure of gan1d-e170q in complex with cellobiose-6-phosphate
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
474
structure length
459
Chain Sequence
HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNQQNIFISFGYRLGLHPPGVKDMKRYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVGTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title To be published
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Putative 6-phospho-beta-galactobiosidase
total genus 184
structure length 459
sequence length 474
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4zfmA00
2WHMA 2WWCA 3VX1A 1E6QM 1JAKA 1WPCA 5GNXA 4YN5A 2XM2A 1JG9A 2DSVA 4BQ5A 2QV4A 3ARTA 2GK1A 1ISYA 3WH8A 1FFRA 4N0RA 5A1AA 1CGVA 3CBWA 4Y7EA 1C90A 1ISVA 1VRXA 4MAZA 1E0WA 4XZWA 1V0KA 5CLTA 4RE3A 4EE9A 3AIRA 3AMKA 1KR0A 2CBUA 1KXHA 1NOUA 2FGZA 1WZAA 1C7TA 2DSZA 3BAJA 2CNCA 5AYBA 2RGMA 4U2YA 2J78A 3CUIA 1PIFA 6TAAA 2VUYA 2VL4A 5A3HA 1GVYA 1W9UA 4CN1A 2AOSA 3POHA 1QW9A 2J74A 5BRQA 2QHAA 2G3IA 1PEZA 4ACZA 4JCLA 2VOTA 2X05A 1UD3A 1ZBWA 3WMCA 1GHSA 1MW1A 4URIA 4DWSA 1CZ1A 4Z2KA 4PTXA 4J3SA 4TTGA 4PSPA 1HN1A 1JF6A 4AIEA 2OLHA 7TAAA 2YOCA 2UY2A 4PN2A 3ZJKA 1PJ9A 4EK7A 1MW3A 3HJEA 4M1RA 3WDIA 3VTRA 2JF6A 1ISWA 4QLJA 3ZR6A 4Z2JA 3LPPA 2VZTA 4Z2GA 1IV8A 3VDAA 1GOOA 3CUHA 1KXQA 2J25A 5HOSA 3OLGA 2WHJA 3LPFA 3CHEA 3TOPA 5ABHA 1GOMA 1UHVA 2V3EA 2D0HA 3THDA 3VU2A 2DSWA 3CMJA 1TZ7A 2C8NA 4MB5A 4AZGA 1BQCA 1OWQA 1BPLB 1R87A 1HIZA 2WLYA 1J10A 2V38A 1KQZA 3T09A 3EDFA 2CXGA 1Y7VA 3K8KA 3AMGA 3W81A 4KMQA 2WVVA 3DYMA 4R27A 2DGAA 1UWSA 2UY5A 3CTTA 4W87A 5FD0A 4QLKA 3VDBA 4GXPA 3VMPA 3QHMA 1HKMA 1CGWA 2EPLX 2NW0A 3AIUA 1B2YA 2XIIA 3O6AA 1X6NA 4UFIA 2PWEA 5D9OA 4RE2A 3GBEA 4P7NA 3BLKA 1MQPA 1XCXA 3T2OA 3WMBA 2ZIDA 2GSJA 2O9RA 3IJ9A 2TAAA 3PHAA 4F8XA 1CXHA 1MQRA 1NOFA 4BQ4A 4HOWA 4NRSA 4H2CA 3AIBA 1L8NA 1H41A 4QCFA 3VDCA 4L4OA 3WBAA 8CGTA 3PTKA 2QPUA 2X2YA 1E4NA 1JNDA 1UH3A 5FOOA 1MVYA 1OM0A 3NSXA 3IAQA 3WNPA 3WSUA 2JIEA 1RP8A 4F9DA 2CBIA 2ZUUA 3AMDA 2Y8VA 4UQDA 3WN6A 2YL9A 1UWIA 3CGTA 3M07A 1F4HA 2VNCA 1WDPA 2WB5A 3W0KA 3CUGA 3AMLA 2FGLA 4W5ZA 2BNJA 4JAWA 2VQTA 1BG9A 2ZWZA 4JFSA 3WL0A 3F5JA 1E0VA 3RM8A 3BLPX 3TTOA 4FLOA 1E4IA 4XUYA 3VUPA 3WH9A 2WM0A 1QW8A 1QVBA 1OGGA 1TCMA 1W9VA 4C7FA 4AXNA 5CJ5A 1HJUA 3K8LA 2WLZA 2CBVA 3L4WA 4X9YA 1BGGA 3WEZA 3RM4A 3VVGA 5A6BA 4BQ2A 2E40A 3WQVA 1J0JA 2VVSA 5IHRA 1UWTA 4MPKA 1BG4A 2XVGA 3KE0A 2G3MA 4K68A 2XSAA 4QAWA 3G6MA 1H0GA 3VIIA 2VC9A 4W88A 4CD5A 3SCTA 2BFGA 4WF7A 1NM9A 4HZ7A 5CSUA 1EGZA 3CZEA 1Q4NX 4ATWA 4H8HA 3O9NA 2YDSA 3VIJA 2Y4SA 2EBNA 3UEQA 4NI3A 4HZ6A 2JEQA 3FNDA 5ABGA 2VR4A 4B3KA 3L4VA 2PWDA 1LQ0A 4AEEA 3RIKA 5HPOA 1HL8A 2J47A 3WL1A 2ZX8A 1B3ZA 5BRPA 4DM1A 2E9LA 1CGTA 2DT3A 2XFYA 4UQEA 3QR3A 3AS2A 5HDRA 1OCQA 5LA0A 1I1XA 4D6GA 5I78A 5JBEA 1JDAA 4CN4A 2OSXA 1JYXA 3FY1A 1BYDA 2VT0A 3GZAA 3WNNA 3MSGA 5M17A 1V02E 5I23A 3W29A 4CD7A 5I6SA 2ZXBA 1TA3A 1E56A 3POCA 3N15A 5A95A 1UKOA 2J7EA 4OUEA 4IM4A 5A8PA 3RILA 1VFOA 4KRUA 3L4XA 4PRWA 2PWHA 1JNEA 1WDRA 3MO4A 1BAGA 3W6MA 1E9LA 4PMXA 4PMQA 4BS0A 3CZJA 4GI8A 1V08A 3UCQA 5A8NA 4UNIA 1V6YA 4J3TA 3M46A 4P8WA 1TA3B 1Q6EA 4ATLA 1HJQA 3PZOA 4LYQA 1AQMA 3N9KA 1R85A 2XVPA 4CD8A 3KL0A 4JCMA 1VEPA 4TX8A 5GNYA 2JF7A 3WFZA 1EHNA 4IISA 3VGGA 1GOKA 3WD4A 3EDDA 4HA1A 1VFMA 4ZE4A 2J75A 3U7VA 3WNOA 5M5DA 1EO5A 1GOQA 2DEPA 2W61A 4PCTA 1GZJA 4W89A 4GPNA 1IT0A 4YHGA 3MUY1 1QI0A 1CTNA 1OGBA 2A3BA 1WO2A 4PTVA 4U2ZA 5A6KA 4MNKA 5CPSA 2YL6A 1VFUA 2XYLA 1ZJAA 2AAAA 1E1FA 4J7RA 5CGTA 1QI3A 1W2VA 4AIUA 4AMCA 3U5YA 2DPEA 2OSYA 1BYCA 1WP6A 1UWQA 1V3HA 3VIOA 3L4YA 4CVUA 5LA2A 4UQBA 4DWSC 1E6RA 1HVQA 4F9JA 1TUXA 2ZE0A 4J3WA 1CDGA 1YHTA 3VM7A 2YDQA 3GXFA 3VM5A 3KEHA 3DYPA 3J7HA 4ZFMA 1FH7A 1C3FA 2WK2A 3VPLA 3OZOA 1OINA 4S3JA 3RO8A 2EPOA 3EDEA 5HBFA 3BSHA 1JF5A 3AS3A 3AZRA 2BXZA 2WMIB 4P7OA 1DWHM 2PBOA 2QPSA 3NUKA 2J7DA 1NQ6A 2VI0A 1JZ2A 2WWDA 1UUQA 3WQ5A 4JL1A 5CG0A 1G94A 4V28A 4U31A 1MW0A 1A3HA 2VZSA 5DFAA 3WDHA 3BAKA 1Q6FA 1ITCA 5DT7A 4M56A 1SFSA 2OWXA 2BY0A 4AD5A 2V5DA 2WXDM 1JGIA 4D1IA 3TTSA 1WDSA 2BY2A 2ZUMA 3K4AA 2X09A 4H7VA 1DHKA 4W86A 4BZYA 4UTFA 4MDPA 1E3ZA 2W5FA 1NWTA 1UWRA 4LX4A 1DWGM 3KL5A 1CBGA 4MB1A 2FHBA 5I24A 3GBDA 3S2CA 4D6CA 1KGXA 1UH2A 4EANA 4E8DA 1UD4A 4OZOA 2OWCA 1HT6A 5D4YA 2OYLA 3ZR5A 1HKJA 4HTYA 2YA2A 3VD3A 3WF1A 1UR4A 4GIAA 3VIGA 4HMCA 1B3XA 3AS1A 2YIHA 5JBFA 1KR1A 1WAWA 3ARUA 2XVLA 3WUEA 2WVVB 1X1NA 2VQUA 5E6ZA 1FOBA 1W9DM 2ZUWA 2VRKA 4AZBA 1V3MA 3PZQA 1BGAA 2D1ZA 2ESCA 4H04A 2WSPA 4FMVA 1H09A 3MMDA 2RGLA 3OGVA 4CD6A 3N17A 1CXEA 1GOWA 1E0XA 2YL8A 4CCCA 1XYFA 2W63A 1YQ2A 4EAMA 1V03A 1DWIM 4RE4A 2XVNA 1TE1A 3L2MA 5F7UA 5HNNA 4PMYA 3WIJA 2PF0A 2EEXA 3ALGA 2GJRA 1E4LA 3AQUA 1QI2A 1EIBA 4P7QA 3MV01 4X0NA 4LGXA 4AZ6A 3ARWA 5HXMA 4AZ5A 1JFHA 1W3LA 3I3EA 2XGIA 4PYSA 5E9AA 4KWUA 1HP4A 5CLWA 5ECUA 1ZBCA 4DUVA 2J7FA 2ZICA 1G9HA 1BFNA 3W53A 5EFDA 2O9PA 2YA1A 2CCRA 1J9YA 3WF4A 3ZQ9A 1KXTA 4HOXA 1PIGA 4W8LA 3ZT5A 3AOFA 1CXFA 3GH7A 3B9AA 1RPKA 4DM2A 1I75A 1CXKA 1VB9A 3AXXA 4J28A 2WPGA 1LG2A 3CO4A 3HN3A 1TVNA 2A3EA 2A3AA 1BSIA 3VGHA 2GVYA 3VD7A 3JUGA 3WF3A 1AQ0A 2XGBA 1GW1A 3N12A 5JUVA 1GUVA 1UZ4A 1QHPA 1H0IA 1XSIA 4U3CA 1JDDA 1R8LA 1UKSA 2W66A 2HVMA 2XTKA 2WMGA 1EO7A 4AZIA 5KZ6A 4JHOA 3PBGA 4BQ3A 5E09A 2YL5A 3A47A 3K8MA 1AMYA 1DTUA 2DH2A 2FHCA 3QGVA 3ARVA 3VX0A 2GJXA 3VNYA 4JKKA 3AMCA 2GUYA 1EHAA 1ZU8A 1H4PA 2O9OA 4MNJA 1XC6A 2C7FA 4JKLA 3BAYA 1QBAA 1K9DA 1J0ZA 4W85A 3W24A 1KFWA 1ITXA 1ZS2A 4YHEA 3T2PA 1UD8A 1DWFM 1GHRA 5A94A 4TTUA 2VTFA 2VO5A 2UY3A 2Y2WA 1XH2A 4OJYA 5DMYA 3BH4A 4D6IA 4GINA 1JXKA 1H2JA 2J7HA 2VCAA 1NOWA 4UZSA 2XWEA 3T2QA 1WNOA 5AYIA 1GQLA 1WZLA 2DH3A 4CVWA 1B3WA 1B3YA 1W9BM 2W92A 3MUIA 1XD1A 4UFMA 4D72A 4KGJA 4KGLA 1PBGA 4W8AA 4HA4A 1P6WA 4GI9A 1U33A 5TD4A 1CECA 4L4PA 2XPKA 4HMDA 3GXIA 3WH6A 3OIHA 1V3LA 4PMOA 1NWSA 1XYZA 1E55A 2YLLA 4M24A 4TOQA 1AVAA 3ZJ8A 3ZMRA 2WZEA 1E6XM 2YDRA 3F4VA 1LWHA 5EBAA 2J7BA 1UYQA 1V6XA 5BROA 1LG1A 1UA7A 3MUAA 3PTMA 3TA9A 2XHYA 4MB4A 3NCOA 1VENA 4MTVA 3ARYA 5IDIA 5A8QA 2IUZA 4M29A 2UY4A 2WC3A 1Q6CA 3MUZ1 3B9EA 5D9PA 1GJWA 3D3AA 4LPCA 1NP0A 2WVSA 2OYKA 3VIPA 1JYNA 3MV11 4D6JA 3CLWA 3OZPA 3W37A 4WSKA 2G3NA 3CHFA 4R5EA 1WE5A 5CGMA 1JI2A 3U5UA 5I0DA 1HVXA 3TONA 3I3DA 2ZOXA 4D6FA 6CGTA 4WSJA 5CQ1A 5FL0A 3U7BA 5IHSA 1J0HA 5DT5A 3UR7A 4MJ4A 3AIVA 4FK9A 2XJ7A 3B8SA 1WZKA 3VD9A 1KGUA 5BXSA 2HISA 2D24A 1CWYA 2BY1A 2NT0A 3UR8A 4OBRA 2CKSA 4HA3A 1QI4A 1W91A 2WCGA 1FH9A 3ZSTA 3G6LA 3FXYA 1CLXA 3FN9A 3WY1A 3U57A 2DQXA 3PZTA 1EQCA 1H1NA 2E3ZA 4B9YA 2QLYA 3RJXA 2E9BA 2DSKA 3GDBA 1C8YA 3GTNA 1K9TA 4W7WA 3CMGA 2EQDA 3N18A 1EDQA 1ISXA 3ARXA 4E2OA 3E1F1 2QF8A 2WW5A 2W4XA 4PMDA 1E1EA 4ZXLA 2F61A 2CYGA 1W9XA 4GKLA 2WMIA 3EMCA 4XZBA 4CKQA 1HJVA 2BV9A 4QP0A 2YBUA 3CIVA 4WJXA 3EBVA 2WC4A 4LQ1A 4M80A 3OA5A 3ARPA 1GQJA 3GNOA 3SCPA 3CPUA 2DT1A 4PTWA 3MKKA 2MANA 2VURA 4UFHA 1K6AA 3WDJA 3W27A 3M6DA 4M82A 1US3A 4WK9A 4E8CA 3SCSA 5C70A 2Y5EA 3QHNA 3THCA 4ACYA 2W67A 2CHNA 3AHYA 3PN8A 1E6ZA 4PMZA 3EMQA 1M53A 4PUEA 2WMHA 1OT1A 1IZKA 2ZXQA 4NSBA 1UWUA 2WMFA 3CHCA 4MDOA 3MANA 1ZB5A 1FFQA 1B3VA 3N13A 3L4TA 5D8ZA 1WDQA 3AS0A 4H8UA 4EKJA 1M04A 2BHYA 1CGYA 1W9PA 1JL8A 3FAXA 3VD5A 1Q6GA 1FHLA 4TVDA 4QFUA 2JEPA 4P7LA 4QLLA 4XX6A 1PZ3A 3KL3A 2X0YA 4OOZA 2Z1KA 2WHLA 4ML4A 5FKYA 3NDZA 3O2LA 1KXVA 1CLVA 2E0PA 4QDMA 3DC0A 5A6SA 1GOIA 1I1WA 1UR2A 1UD6A 3WDPP 1MW2A 5A6JA 4AD1A 3ZJ7A 5LA1A 2VR5A 1E6NA 3FHQA 1MYRA 4OIFA 4PSRA 3KWXA 3WQ8A 2JE8A 1EDTA 5I77A 1MXGA 2CESA 1V6UA 4X0VA 1CEOA 1BF2A 1PZ2A 1EOMA 1GNXA 1QNRA 3N1AA 3PZMA 4PMUA 4HOZA 9CGTA 5A6AA 2BXYA 3NDYA 1DWAM 3RDKA 1C8XA 1GORA 2PC8A 2E8ZA 3GXMA 3APGA 3GXDA 3CHDA 3VGDA 1CPUA 3NIYA 3LPGA 4V27A 3WFLA 3T0DA 3ZJ6A 2BY3A 1OD8A 1XD0A 4XB3A 3WUFA 5M3WA 1KCLA 4GO8A 1VF8A 2CHOA 2WC7A 4MAVA 3PZIA 3CUFA 3I3BA 3LPOA 4AZCA 5GQBA 1SYTA 3PZVA 1FHDA 4WKFA 1CXIA 3AJ7A 1EDGA 1EH9A 2X0HA 2BHUA 3WH7A 2XVKA 3RJYA 2XSBA 2E8YA 1W2PA 2VVNA 2UWFA 5ABFB 1UD5A 2WMJA 3TTYA 5KEZA 1UKPA 3VOCA 4WKAA 3GNRA 2BVDA 3T0BA 1SMAA 4F79A 4CN6A 4M8UA 1JAEA 5IFPA 1E73M 4UFLA 2WHKA 5A8OA 1ZJBA 3A4AA 3VD4A 1M03A 1C8QA 3SCOA 3UETA 4AD3A 2GFTA 3W26A 4J3UA 3GH4A 2IXUA 1XCWA 4JFWA 2WKLA 4YPJA 1FA2A 4JZ5A 3WD2A 4AEFA 2ZX9A 3W28A 4UZUA 3NSMA 1CYGA 1BVNP 3ZO9A 4FLRA 2DSUA 3WNKA 4LXFA 4F66A 3K1DA 2ZUVA 2XFRA 4H8VA 5A2CA 1UOKA 3VGFA 4A3HA 3UG3A 4UFKA 5C8BB 1JYWA 5CSYA 1O7AA 2JFEX 1PX8A 3WENA 1LF1A 2G8ZA 1W1VA 3CZ8A 1VEMA 4GI6A 5CPQA 5FL1A 2J62A 3DHUA 3WUBA 1K9EA 3WD3A 1E43A 2JIWA 5ABFA 1JYVA 1CXLA 1QNSA 3AHTA 3AI0A 5CPTA 1CIUA 1HJWA 2FH6A 3ARZA 3BMWA 1E71M 3WEOA 4CU7A 3BCDA 3W82A 1HJXA 3AZTA 4HU0A 4W93A 3OG2A 2PBGA 4B9ZA 1KQYA 5M03A 2D3NA 3WELA 1OD0A 1TMQA 3FHAA 4PEEA 1G5AA 1H3GA 3DHPA 5CXPA 2WBKA 4MJ2A 3WD0A 4C7DA 4Q7NA 5GPRA 2OWWA 3CZKA 3B9DA 1XHGA 2WKGA 4P8XA 3BMVA 4PCSA 1KCKA 1JZ8A 1B90A 3WNMA 3SURA 4BF7A 4CCEA 4MADA 3DYOA 2D20A 3CH9A 1US2A 4GQRA 1E6SM 3ZT7A 3K4DA 1ZL1A 4S3KA 2VJXA 2XFFA 4WLCA 3WF2A 2VX6A 1TVPA 2GDVA 3ARSA 2V3FA 1V0LA 2WVUA 4NRRA 3IAPA 3VMOA 1M7XA 4Q22A 3VIFA 3WDQA 2J8GA 5BYWA 1QNPA 3ARRA 2D0FA 2DT2A 3LMYA 1UKQA 1E15A 3A4WA 2GJXB 3QOMA 1U2YA 3UESA 2NSXA 4PMVA 1B30A 3GM8A 1JZ5A 3MMUA 4B3LA 2WZHA 3WKZA 2YLAA 3D5HA 4IPNB 3PZGA 3MS8A 4A3YA 2EPMX 5A69A 2ZWYA 1LL6A 1UQYA 1JIBA 2O92A 4FF5A 3IJ8A 3BSGA 2J8FA 1WKYA 2BHZA 3ZIZA 4CU8A 3ALFA 3KZSA 4JKMA 5DEZA 3K46A 3OLIA 2YJQA 3W25A 3BCFA 1E4MM 3F5KA 1GQKA 5IXEA 1BHGA 2WNWA 4FLQA 3RCNA 5LYRA 2Y8KA 2O9TA 1AQHA 1W3HA 3AHZA 3NYDA 1BTCA 1XV8A 2WANA 4IPLA 1E40A 2XIBA 1UQZA 4Z2LA 3WNLA 1J12A 4B16A 5E0CA 4HP5A 4IUGA 1EXPA 2J7GA 2ZX5A 4OOUA 4UCFA 3VIMA 2J7CA 1TR1A 2YBTA 2ZX7A 3M7SA 1CENA 3EDKA 1K9FA 2BS9A 6A3HA 3BAIA 1CGUA 4LYRA 2PI6A 4D6HA 1B1YA 3MU7A 3BAWA 3WQ6A 2A3HA 3OB8A 1RD6A 1XSJA 1R86A 1WCGA 4P8UA 5DF0A 4D6DA 1QNQA 3VIHA 1VEOA 1DP0A 4CGTA 5GNZA 1N82A 4OKDA 3OGSA 5I5RA 4UOZA 2EJ1A 5A2BA 1D2KA 4J27A 1H5VA 3ZSSA 1MQQA 1QHZA 1E72M 4XV0A 1JI1A 2YA0A 4ACZB 3HMCA 2G41A 3VDHA 4ATDA 3IK2A 3CZLA 4AYSA 2DIJA 1W32A 1HKKA 3GH5A 2DT0A 2ZUNA 3SIMA 5C71A 4UOQA 3N11A 3WMSA 1PX3A 5BWFA 2BVTA 2J77A 3SCNA 2E4TA 2GK1B 1C92A 4UQ9A 1OBAA 2VZOA 1V3JA 3AYRA 1UG6A 2VZVA 4GZJA 1HKIA 4PUDA 1E3XA 4U5KA 1GQIA 1B31A 3QHOA 3OGRA 3TP4A 4MNLA 1QBBA 4HPGA 2XG9A 5EMYA 1V02A 3L4UA 4MNMA 1TFVA 3L2LA 4U5IA 3TTQA 1FH8A 2XM1A 2NT1A 1W3JA 4UOJA 2VX4A 2F2HA 3GYCA 2YKKA 4AZ7A 3IJ7A 1J01A 2EXOA 1VBRA 3VGEA 3WUGA 2ZUTA 1G01A 1J0YA 1H11A 2WYSA 3T0AA 3EYPA 3ECQA 3CUJA 4UQCA 1CNVA 4DWSB 2CKRA 3AIQA 1X6LA 5E6YA 3BGAA 1U30A 4AD0A 5A2AA 1JZ6A 2WZIA 1Z32X 4TX6A 3SUSA 5AC5A 1R7AA 2V3GA 2WAGA 4W5UA 3EDJA 2XWDA 4PBGA 1W3KA 2WVTA 1VJZA 5BXPA 4HZ8A 3OLEA 2D2OA 4GO9A 4A4AA 2G3JA 4GZIA 4MB3A 5EB8A 4JHZA 1TG7A 3NJ3A 1HXJA 1ESWA 2B31A 2EPNA 4NF7A 4HPHA 1V3IA 3BAXA 4UR9A 4W84A 4H41A 1EOKA 1W1TA 3SUTA 3WF0A 3QOKA 1BYAA 4D71A 2CIPA 4PMNA 1G1YA 1KWKA 1W1YA 3VGBA 3AISA 4TVCA 1VIWA 1SR0A 1E5JA 2D3LA 2VZUA 4AWEA 1VBUA 2DDXA 4ZXOA 1UR0A 5JBDA 2CETA 5HPCA 3SCUA 3NSNA 4DUWA 2V3DA 1GONA 1MWOA 3WQWA 1BLIA 4AW7A 1ECEA 1J0KA 1PX4A 3W6LA 3OBAA 2CEQA 3MMWA 1KBBA 2FH8A 1NARA 1FP8A 1HP5A 5DO8A 3VO0A 3SEPA 2X8RA 1JZ7A 3ZT6A 4JFUA 4J3XA 1B9ZA 1E6PA 2WMKA 4TVUA 1JZ3A 2G4FA 3F5LA 4NZCA 4UQAA 1ODUA 1PPIA 4W8BA 8A3HA 3AIEA 1D3CA 2PWGA 3A4XA 5IFTA 1OIMA 4KRTA 7CGTA 1GCYA 3SUUA 1UR9A 4HU8A 1NWRA 1QI5A 3AXIA 4BA0A 3BXWA 1UD2A 4UFJA 4WIWA 2QMKA 5E70A 3W38A 1MXDA 4OBSA 1JZ4A 1HNYA 5BXRA 1R7OA 2FDMA 4PMRA 1HJSA 1UKTA 4P8VA 1EA9C 1ZBVA 4B15A 2WCAA 1C91A 3HU7A 5I79A 1J0IA 1XRVA 3AHXA 1B0IA 2D22A 2ZX6A 1XH0A 4JFVA 3AROA 4AD4A 4GQQA 3BC9A 1GJUA 1JXJA 3II1A 1V6WA 5AC4A 1C7SA 2VRJA 4AY1A 3ARQA 1OSEA 4D6EA 2EO7A 2Z1SA 3WD1A 2GDUA 4HMEA 4AZCB 1F4AA 1ODZA 2PWFA 1E70M 1IZJA 3SUVA 3VMNA 1XSKA 1FP9A 5ABEA 3AYSA 1EQPA 1JDCA 2BVYA 1E5NA 2AMGA 4CD4A 1XGZA 3PZNA 1VAHA 1MFVA 2GJPA 2ZXDA 4TXEA 5CZKA 4M81A 3GNPA 1CGXA 1KGWA 3N04A 1MFUA 1HX0A 3UG5A 5I3DA 4ZE5A 1BVZA 4JIEA 4CU6A 3AICA 1W1PA 3WEMA 1XH1A 1GPFA 3WH5A 3FW6A 2J4GA 3OLDA 2V5CA 1NP2A 3VINA 3AIWA 3PZUA 3PTQA 4KH2A 3AZSA 4RL3A 4DWSD 4LYPA 1M01A 1QHOA 2W91A 3PZ9A 4FLSA 1RP9A 2CBJA 1WB0A 3AFBA 4W7VA 3W4RA 3VILA 2ZXAA 1JD7A 1S46A 2OYMA 2WBGA 2F8QA 2JALA 1OIFA 4AD2A 2EPKX 1UA3A 4JFTA 3SCVA 1VFFA 1H49A 2W62A 2PB1A 5I2UA 4U33A 1ISZA 1OGSA 3MSDA 4U3AA 1HL9A 3A3HA 4J3VA 5A6MA 2A3CA 3S6TA 5D9MA 5A6BD 1G0CA 2QMJA 3EMZA 3VNZA 1D7FA 2XUCA 2CPUA 3VKKA 1J11A 1KBKA 2VCCA 1NWUA 3WDRA 1OT2A 4C7GA 4P7RA 3CZGA 5BXTA 1V0MA 1Q6DA 1ZBKA 5FCZA 4AZHA 3ZM8A 3SCQA 5JIWA 2OSWA 4DUXA 4QCEA 4Z2HA 1LL7A 2WSKA 2WCSA 5AY7A 2E9MA 2CITA 5FIPA 3RPMA 5D9NA 4CCDA 1PAMA 1V3KA 3AHVA 2VX7A 4ZEPA 2Q8XA 1J18A 1GVIA 1JD9A 1LWJA 4AISA 5JIPA 1UH4A 4BCEA 1UR8A 2X1IA 4PTMA 1C93A 4TUFA 1BYBA 2D0GA 2VMFA 1QPKA 1VJSA 2FHFA 3RM9A 3WBEA 1NH6A 2D23A 4D1JA 3L4ZA 3T08A 1L0PA 1A47A 2DIEA 3WQ4A 1WZMA 2C0HA 7A3HA 2VCBA 1O6IA 3UG4A 4Z2IA 1QOXA 2Y24A 2VRQA 4CUCA 4AIOA 3FAWA 1KWGA 1KB3A 1V0NA 4WKHA 4JL2A 1UZ1A 2IXVA 4E4PA 3ZOAA 3RMEA 1LL4A 5A8MA 1DWJM 2VX5A 1LJYA 3DECA 5EFFA 4AC1X 2CERA 3VIKA 3UERA 4GZEA 5E0FA 4ZENA 1V6VA 4W7UA 2J79A 3SCWA 1JFXA 3SCRA 1SMDA 2ZUSA 4V2XA 5D8WA 3AXHA 3IANA 1DEDA 1RH9A 1LLOA 5BCAA 3A6OA 1QNOA 1HF6A 4N42A 1OB0A 3SUWA 1UR1A 5A6LA
chains in the Genus database with same CATH superfamily
2WHMA 3TLLA 2WWCA 2TRSA 4GJJA 3I7QA 4TU1A 4YN5A 1JRCA 4BQ5A 2QV4A 2GK1A 3DBNA 3B8TA 1LORA 4HNNA 1FWHC 1FFRA 2JGQA 5DXYA 4Y7EA 1ISVA 4JTEA 3AIRA 5E1QA 4KWOA 3GYEA 2FGZA 4OU1A 5XIAA 1C7TA 5IRPA 3NXLA 5AYBA 1VJIA 4HD5A 2VL4A 1W9UA 4WGXA 2G3IA 4HN8A 1PEZA 1O68A 4NAFB 5FF3A 2HBVA 1SUXA 1GHSA 1A5BA 3TNOA 2PE4A 3DFPA 3RLGA 3EWUA 1XIHA 2CZDA 3P8IA 3TC7A 1DJHA 4ORIA 4ASTA 1ICPA 3CUZA 1MW3A 4M6PA 1TWZA 3DUGA 4XTDA 3WDIA 4XD5A 3PBWA 3LPPA 2RUSA 1MZRA 2XH2A 4RV3A 3BL3A 3HGJA 3TQKA 2ONEA 4JR5A 3PF3A 3STPA 3CHEA 1YDNA 2RH9A 1K7EA 2VGFA 3S1XA 3ES7A 2D0HA 3THDA 1SU5A 1SZEA 2DSWA 1W1A1 3L5LA 2C8NA 1BQCA 4Q33A 1BPLB 3T09A 2VWTA 5LGXA 2AMXA 3DBPA 3A5VA 3D46A 2PA6A 2QJIA 1JUBA 4JY8A 3UZ5A 3IV8A 2WVVA 3DYMA 3GR7A 4H6QA 1EBHA 3CTTA 3ABZA 2FZDA 3H7RA 2HV5A 5TF0A 5H8MA 3QHMA 4TV6A 2C0AA 3WLHA 1CGWA 1W1ZA 3KM8A 1XICA 1T5AA 3CAKA 4QG9A 5D9OA 2BDQA 3GBEA 3BLKA 1MQPA 1XCXA 7REQA 4IQJA 1CW2A 2J27A 5T9CE 3S47A 1P4CA 1EP1A 2J9XA 3MCMA 4UTHA 2A21A 4LUSB 2WZTA 3GC5A 1MQRA 1NOFA 2F84A 3G0SA 4H2CA 1H41A 3Q58A 8CGTA 3OG3A 3C5QA 3T8LA 1E4NA 1JNDA 1OM0A 1NJJA 4Q4MA 6ENLA 3NSXA 1RP8A 1I4NA 3CWNA 2CBIA 3BW4A 5G4HC 2ZKMX 2W3ZA 4F0HA 2PD5A 3EX6A 3EXRA 3SIZA 3M07A 4MFDA 1OJXA 4FXRA 1L9WA 4IIHA 2AL1A 2PAJA 4JX5A 4S1FA 3UWWA 2NXHA 4JAWA 2VQTA 4X61A 3WK2A 3W7EA 1E0VA 3R94A 4F0SA 4XTIA 1K6WA 3BLPX 3TTOA 4FLOA 4NKCA 1QW8A 3VDGA 1OGGA 3BLEA 1W9VA 1MNZA 3F7JA 2WLZA 4X9YA 2EKCA 2C1GA 1ONXA 3LK6A 3H2FA 4UTLA 4L9YA 3WEZA 1AG1O 3WQVA 5IHRA 1UWTA 3EB3A 3E9AA 5AHMA 2XVGA 1P7TA 4K68A 4BJHA 4EXQA 4WDWA 1VYRA 3G6MA 2PRHA 4QEEA 4YJ5A 3L5AA 3M1ZA 2VC9A 4W88A 4CD5A 1H5YA 2F2KA 3HZ3A 1NM9A 3GC4A 3FDKA 1KTNA 2V5KA 1ITUA 2Z29A 3WCZA 2INFA 4GWEA 4IFRA 4JIRA 1Q4NX 5LNWA 1I2OA 2FPYA 4E4UA 2EBNA 3JVAA 3HPAA 2QJHA 4ZFCA 1KM5A 2HEJA 1UIPA 2WSYA 4HZ6A 5DMNA 3KRUA 3K2GA 2PWDA 2FPTA 1LQ0A 3QFWA 4IP4A 4AEEA 4EP8C 2J47A 1ZJIA 3F4DA 1B3ZA 5HJYA 3I65A 3LXCA 4DM1A 3DI0A 2XFYA 3M0LA 1IIHA 3QR3A 3LMZA 1OCQA 4GY0A 5JBEA 2VT0A 1BD0A 3V0TA 1RXOB 1V02E 2R1LA 4CD7A 1EIXA 2VKZG 5CSRA 2X2GA 3ENLA 1VC4A 1IHIA 1TJ1A 3POCA 1XDMA 2E5BA 5A95A 3KWSA 1YTDA 4IM4A 1UR3M 5A8PA 3RILA 1TX2A 4B5SA 2PWHA 3EWWA 1BAGA 3VAVA 5AHLA 4DEFA 1E9LA 4BS0A 4GI8A 1V08A 1XLJA 4J3TA 2Z6JA 2H6RA 4IGNA 3B0UX 3B3DA 4IHCA 1S2TA 1HJQA 1W0MA 1OX5A 3NPXA 5GJPA 2H9AB 3LZ5A 1R85A 4IL2A 5KZEA 2PC4A 4IJRA 3ZVHB 2ZZ3A 3QPZA 1VEPA 4XK2A 1Z9AA 5GNYA 3VGGA 2MUCA 2VFDA 1VFMA 7ENLA 4QAIA 3WNOA 1S2VA 5CGQA 3APTA 2W61A 5D09A 1AMKA 4PCTA 4R85A 4YHGA 2A3BA 1KTBA 3IJIA 4PTVA 3BG5A 3UZXA 3OVPA 3LUTA 4ZQRA 4MNKA 3OPSA 1HQTA 2QNEA 4BF9A 4DPQA 3OU8A 3GD6A 2ZDSA 3S1UA 2R6OA 4X2PA 5CGTA 3TJ4A 1C9WA 3U5YA 3CYJA 3CU2A 3SAZA 3THAA 1AZ1A 4H01A 4HK7A 1A0CA 1U5JA 5CJMA 3B8DA 3VIOA 1WXYA 4HZMA 1CB7B 4UQBA 4DWSC 4AB4A 9RUBA 1HVQA 1TUXA 4J3WA 3BJFA 1CDGA 3S1VA 4ZOEA 2YDQA 1HZYA 4AAJA 3MP3A 3G1VA 3J7HA 2H8ZA 1W3IA 4PUWA 1FH7A 1ZNNA 1C3FA 3LRKA 3NZRA 1MUMA 4INFA 2EPOA 5CG7A 2BX7A 4FIQA 1VLWA 3HA1A 3AS3A 4J1OA 1OK6A 3LB0A 4XD6A 2QPSA 5I3IA 3TV8A 4ZQNA 4LAKA 1PV8A 1L2QA 4JL1A 4C1KA 5HNTA 4V28A 1ZPTA 1A3HA 3MC5A 3RLVA 2QUNA 1F5ZA 4MJMA 4M56A 4S2CA 3ZS4A 5H6HA 3TOYA 2BY2A 1XBVA 1VZWA 4C6DA 7REQB 1J96A 2HZGA 1AH4A 4UTFA 2DUZA 3UYIA 1RUSA 1WOAA 2YXXA 3GS6A 1DWGM 3PTDA 2GJLA 2Q6ZA 1UH2A 4XD4A 4E8DA 2P0OA 5D4YA 2NQHA 1K8YA 2V5LA 3VD3A 3TH6A 3TNBA 4PUJA 1BXCA 3UCCA 1WAWA 5I00A 3WBXA 5EGRA 5D33A 4EX4A 2B0MA 4UTWA 3G1DA 2YFOA 2VQUA 2VRKA 2B7QA 1V3MA 1AW2A 3WJYA 2OU4A 4AH7A 4FMVA 2RGLA 3KTXA 3FDGA 5EKYA 1JPHA 4CCCA 3V0UA 4WSHA 3RX4A 1GWJA 1NY1A 4EAMA 3LHYA 3RO6A 4XAPA 1ML1A 4Y8FA 1X1ZA 2XVNA 4I6VA 3FOKA 1P7TB 2WPBA 3WIJA 3NQEA 2PF0A 2EEXA 3SN4A 3ALGA 2GJRA 3AQUA 1QI2A 4P7QA 4IIGA 1FXQA 5F2LA 1NDVA 2RJHA 4C91A 4A8NA 3ARWA 4AZ6A 4DJFA 3G8EA 2CLIA 3SRDA 3TZNA 3I3EA 2XGIA 2FGBA 1E9ZB 4QR6A 3QMSA 2GVLA 1K4GA 4B4HA 2J7FA 1GYLA 1OCJA 2PDXA 3W53A 5EFDA 3TFCA 4ZB2A 2O9PA 3N3MA 1EL3A 1PIGA 4ERIA 3QTPA 1TKKA 3T07A 4DJDC 3B9AA 1RPKA 3UBPC 4DM2A 1I75A 1CXKA 2Z26A 1L8PA 2WPGA 3BG3A 4GH1A 3T0TA 2V63A 3W70A 3KDNA 1H7RA 5C7HA 3SW6A 1TCDA 1XF0A 4PA8A 4RW5A 4KESA 2OKTA 4FNPA 4E38A 3MHGA 3RAOA 1GW1A 3N12A 4JIPA 1UZ4A 4UTUA 2FQIA 1UUMA 2BGSA 3MSYA 5CZ0A 2GQ3A 2ODOA 2XFWA 2DORA 3TYAA 3HURA 3VNKA 3EAUA 5E09A 4QIUA 1AMYA 1DTUA 2DH2A 1UC5A 2FTWA 3H7VA 3TZFA 3GTIA 1UPPA 3WQDA 3AMCA 2VEIA 4K8GA 3R4IA 3UY8A 1H4PA 3FFSA 2C7FA 4JKLA 4R88A 1SJBA 3BAYA 4DJEA 1E1CB 1J0ZA 1QDSA 3AUOA 3UZZA 1ZS2A 1F3WA 4DRSA 1GHRA 1F8MA 4TTUA 3AJXA 1XFCA 1KNWA 1RALA 1ZP3A 3BH4A 3FSTA 1H2JA 1JXKA 2IKHA 3SJNA 1NOWA 2BB0A 1GQLA 1SO3A 2VM8A 1B3WA 4ZTXA 1W9BM 3MUIA 2YCLB 4PRTA 1ZHAA 1TRIA 2O7SA 1PBGA 4W8AA 1ME7A 4HA4A 4O0KA 1PKNA 4L4PA 2C16A 3ITCA 2OTDA 1V3LA 2I9UA 1NWSA 1XYZA 1M5WA 4M24A 3T44A 4YVPA 4TOQA 2HNEA 1YE6A 5C2XA 3ZMRA 3OYXA 2WZEA 3EWBX 5FF4A 3QLDA 1LG1A 3TA9A 3HV9A 3PTMA 4GQGA 4GCAA 4XO7A 2Y70A 4M29A 4GVHA 1PSCA 1Q6CA 3B9EA 2Z00A 1GJWA 3KZPA 5I7GA 3CB8A 4HA0A 1CCWB 1UOZA 2Y7DA 3H2AA 1H7XA 3O0FA 3TE9A 4DXVA 3CHFA 3MUXA 4R5EA 3URQA 1F6YA 1JI2A 5I0DA 1EPVA 1HVXA 3M47A 2V5JA 2ZOXA 3MSRA 3WQEA 3U7BA 3P80A 4ZOCA 1F6KA 3ABSA 2GOKA 4NAEB 1LBFA 3MB9A 2HISA 4JDBA 3W9ZA 1CWYA 1YE4A 4NNCA 3JRKA 1WX0A 4UB9A 1PL9A 2CKSA 1NAL1 5I03A 3WY1A 3LRMA 1DOSA 3QZAA 3URAA 3N2TA 2H3BA 2I1OA 4B9YA 2QLYA 2E9BA 2Q71A 4KEZA 4IXHA 1KCXA 3GTNA 4W7WA 3N18A 1MSSA 3BGGA 2QF8A 2WW5A 3K30A 3WK0A 4PMDA 4YWIA 4WDXA 4D2JA 2PEVA 1MDRA 5IOBA 2RDTA 1GEQA 6REQA 5F4SA 2YBUA 3CIVA 3O05A 4JN6A 3EBVA 1YBQA 3OA3A 3OA5A 3WMLA 3GNOA 5AVNA 5FF2A 4Q8UA 4G7FA 1X7IA 2DT1A 4IF2A 3VYLA 4JN7A 3A22A 4Z42C 1YLVA 4M82A 4GNJA 5C70A 3GE7A 1PTGA 3CQJA 2W67A 4C5ZA 4PMZA 1EXBA 1MDLA 3AU6A 2RDWA 1ADOA 4JTAA 2WMHA 4PUEA 4NSBA 1UWUA 3EPOA 2CLEA 2WMFA 4MDOA 3C0SA 1A80A 1FFQA 3IK4A 3N13A 1K8CA 4YYFA 4EKJA 3W2JA 1JL8A 2I9EA 2DZBA 4HCDA 1CI1A 4QFUA 3RCYA 3E2SA 2VUNA 2VP8A 4XX6A 4PGLA 4OOZA 1F6PA 4ML4A 1PKMA 4FR6A 1O1HA 4IIFA 3IVUA 1CLVA 1U22A 3GU1A 3E0FA 3T78A 3GVRA 3W22A 1UR2A 4QG8A 1TTPA 2X1RA 3B06A 3ZJ7A 3G18A 2OMAA 3H23A 1OZMA 3LOTA 2F7FA 4WQ6A 3BW2A 3FHQA 4DLMA 1UUOA 1MXGA 3IGXA 1TV4A 1PB0A 5LIKX 1CEOA 3O6DA 1NDZA 3W1PA 1ECQA 4O1AA 5A6AA 1H51A 1PHWA 1PTDA 4QJ3B 1DWAM 5BOFA 3RDKA 4O14A 1H63A 4Q32A 1C8XA 1Y8BA 1ZALA 1GORA 4ZO9A 1EWEA 4R34A 4ZMGA 5EMMA 1Q2SA 5AHIA 3WFLA 3T0DA 1W1B1 2NUYA 2WO5A 3MY9A 3PANA 1OD8A 1S3HA 3FVMA 2B81A 4GO8A 3W1TA 1VF8A 2WKJA 3PFMA 2WC7A 1ZQ5A 3ITTA 2PDGA 4AZCA 3GIQA 3FJLA 1SSGA 1X39A 1XL9A 2WNQA 2BHUA 3ELFA 2XVKA 2VVNA 5ABFB 3KS6A 2QJJA 3TTYA 4QE1A 3BGJA 3U2OA 4LBSA 1MEIA 4HYRA 1R47A 1UKPA 2QEZA 3W2MA 3SJ3A 4MZ1A 2R9RA 4WY0B 1JAEA 4O18A 3PPHA 2WHKA 5A8OA 4GG9A 2P8BA 1GT8A 2YDAA 3KXQA 1Q7ZA 3WZ0E 3EWXA 3GHRA 3UETA 3IVSA 1M3UA 3O07A 4LCRA 1XCWA 2DZUA 4YPJA 3GDRA 2D69A 4QHRA 5CSSA 4US5D 1KKOA 1TSIA 3HGRA 2ISWA 1SW7A 3NR0A 2QQ6A 3FYPA 4PULA 1KV5A 3ZO9A 3QC0A 4Y9OA 3C4UA 2HSAA 4FLRA 3WNKA 1I2RA 1MXSA 2HDJA 2ZUVA 4ZA0A 3VGFA 4FOJA 2P5NA 4C6KA 4JTDA 3DERA 3N2CA 1PWLA 1XG4A 5K9XA 5FJJA 3EEZA 1O7AA 5B7ZA 1PX8A 4N9EA 2ZC8A 2ZZ5A 3H2EA 2PMQA 4GI6A 3CZ8A 3OZMA 2BZNA 3E6EA 1FUYA 1K9EA 4O19A 1J6PA 1JCTA 1E43A 2I14A 4YTRA 1SJAA 2P50A 1QNSA 3A24A 5CPTA 3UF9A 4O8RA 5MHBA 2GJNA 4IICA 3W82A 1HJXA 1TIMA 4HU0A 4W93A 2NX1A 5RUBA 3OG2A 3E0IA 2OZ0A 2NSOA 1BVWA 4WUIA 1W17A 3NZGA 1S5WA 4JXCA 3UXAA 3FHAA 4PEEA 1HKVA 5FEZA 2IQTA 1QATA 2DP3A 1KM6A 4MJ2A 3XISA 3C8NA 3GG0A 3CL6A 3TW6A 1A53A 3LCLA 4KCUA 1TWWA 4P8XA 4I9TA 3BMVA 4WOQA 4WJ8A 1P5BA 3LG3A 3LM7A 1BRLB 3SGGA 1XBYA 1UJQA 4GQRA 2BTMA 5JQ9A 3K4DA 3SZ8A 3TCSA 1OVDA 3WF2A 2VX6A 2I17A 3DFYA 4MHBA 5FEXA 3IJLA 5DRCA 3UWZA 2WVUA 3E5BA 3TWAA 3W72A 3IAPA 1V77A 3VMOA 3S3GA 4LUTB 3RK8A 2J8GA 5BYWA 1QNPA 3SSZA 3A4WA 1J4EA 3B0YA 3NQBA 3UESA 3FKRA 1BWLA 1B30A 5CBIA 1JZ5A 1A5MC 2FJKA 1DXIA 2WZHA 2YLAA 5EPDA 3UJSA 4OGZA 2YZRA 4NIRA 3RMJA 4KBXA 4A3YA 5A69A 2ZWYA 4G8TA 1JIBA 1YNPA 3GFXA 2HROA 4H7ZA 1OADA 2E28A 4IJCA 4MWAC 3SB0A 3KOWA 4PFHA 3LV5A 3NO1A 2W0UA 3QYQA 4ZB5A 2VGIA 1RQBA 2Y8KA 3MCOA 5CEWA 3NYDA 3VOJA 4Q4OA 1UQZA 4LS2A 2WM1A 1J12A 5E0CA 4HP5A 4UCFA 4OOUA 4GGBA 5D2WA 4QE5A 1TJ0A 3OBEA 2J7CA 4ZZ9A 5C9WA 1G4SA 1MUWA 2OCZA 1AH3A 4HCHA 1G4TA 1P6BA 1OFOA 3SBFA 1CGUA 1W1IE 2PDBA 1PVNA 2FYMA 4V15A 4W9TA 6TIMA 2PI6A 5DBTA 1ZGDA 4ROQA 1B1YA 2ZC1A 1K4HA 2A3HA 3RXZA 3BCJA 9XIAA 1SW0A 1DJGA 1WCGA 1EJ7L 4IP5A 5DF0A 4D6DA 3BWWA 3VIHA 4F0KA 1BQGA 5HUOA 5I5RA 1JCNA 5HR7A 1H5VA 3R8RA 1SZNA 4XV0A 4IGMA 1JI1A 4ACZB 4R7JA 3VDHA 4DF2A 4GIYA 3RG6A 4QITA 3LHUA 1XIIA 2FJUB 4AYSA 3L0NA 4L6DA 2J6VA 1TELA 5I3GA 3N11A 5D37A 3T81A 1ADSA 4IMAA 2POZA 5BWFA 4ZQOA 1YPXA 2GK1B 2GQ9A 3L0GA 1V3JA 1UB3A 4GZJA 4DO7A 4WX2A 4PUDA 3ZZ1A 2DUXA 2EG8A 1E3XA 3QHOA 1M41A 3OGRA 3TP4A 4ERGA 1YRRA 3R6IA 2ZRUA 2NVCA 1OC7A 3GKAA 3L4UA 3NVDA 1XQLA 3L2LA 4U5IA 1FH8A 1B4KA 3NQFA 2EGZA 4RDVA 3DH7A 4UOJA 3EX2A 1I9CB 2F2HA 4AZ7A 5BNKA 1VBRA 2ZUTA 1C29A 2E25A 1H11A 4LBRA 3FYYA 3CUJA 5FAGA 3UWVA 2VDHA 1Q5MA 1XYCA 2IPGA 1X6LA 4IMEA 3S9IA 3H26A 4K2SA 5A2AA 3MYOA 3ID7A 2FZMA 1VCGA 4TX6A 3GU9A 4CNOA 1A5SA 3NM3A 2H8XA 5K9CA 1YDOA 4GE8A 4O8AA 4Z1BA 2PTWA 4JGDA 4HZ8A 3PR2A 1ONEA 4MB3A 3TMLA 2QAPA 3NJ3A 1RHCA 1A5UA 2ACSA 4AY7A 3RYSA 1EOKA 1DJYA 3QOKA 3UCDA 3ABQA 1JPKA 2D2HA 4NX0A 2IW0A 1W1YA 3WLOA 3HPZA 4TVCA 4E5TA 4AWEA 4Q8OA 3LTPA 7PTDA 3O15A 1UROA 4S3EA 3BOXA 2CETA 3SCUA 4LVBA 2C3ZA 3WQWA 4AW7A 1VQTA 3FA3A 4K8HA 2YR1A 3LSCA 3MMWA 3M0KA 2FH8A 2ZE3A 1FP8A 4HK5A 4AY8A 2V0TA 2X8RA 3CMFA 1JZ7A 1D8WA 4J3XA 5D38A 1A49A 4FA3A 4HSHA 2QCLA 4NZCA 4DNMA 1TMLA 1PPIA 1SO6A 1ZFJA 8A3HA 3S42A 3AIEA 4JQAA 3FJ4A 5CPLA 1UBSA 4B4FA 4GACA 1RV8A 7CGTA 2VFEA 1GCYA 2W79A 1BWVA 3SUUA 3R0DA 1UR9A 1KM4A 3AXIA 4BA0A 3BXWA 1RLCL 2I5IA 4UFJA 4JN8A 5E70A 3W38A 2VFHA 4ZSTA 1XYAA 1QO2A 1F7BA 5J5RA 4OQVA 5CC3A 2GPTA 2WCAA 2C13A 1FWFC 2X41A 5I79A 2ZTKA 3M9YA 5EMKA 3AHXA 4TMCA 1AL8A 1XH0A 4XAGA 1NF0A 4A21A 1Z48A 3BC9A 4Q4QA 4RV8A 1JXJA 2PWUA 4A22A 1OSEA 4D6EA 1TZ9A 2Z1SA 3QW3A 4CCZA 4AZCB 1VYPX 2Z1XA 3GTFA 2PWFA 4S39A 1IZJA 1XSKA 1FP9A 5ABEA 1F73A 5C5YA 4ML9A 4Y9PA 1EQPA 1JDCA 2BVYA 5CJNA 2AMGA 4ZQCA 1E51A 4CQ9A 2EPHA 3GDLA 4OT7A 1G69A 3L66A 3CV7A 4M81A 2Q3OA 3W2NA 1KGWA 3N04A 5KZDA 1MFUA 4AWTA 3KVJA 1IXQA 4LV9A 3ZVIA 3E2RA 5CC7A 5C9XA 4CU6A 1W1PA 1WUEA 4S3GA 2R8WA 4HJWA 4JQ3A 2HWGA 3M0HA 3OLDA 2FZBA 3AIWA 3PTQA 4DWSD 1GK8A 3COTA 1M01A 1GKRA 2FVMA 2C71A 2CBJA 3TAKA 4EWND 1XR2A 3AFBA 2QT3A 1UC4A 2ZXAA 1T41A 4RNFA 1GG0A 2FFCA 2FVLA 3I4EA 3MHUA 4AD2A 2EPKX 1YYAA 2DFAA 1H49A 2JK2A 2G3FA 5I2UA 3WLRA 2GLKA 4J3VA 3S6TA 5A6BD 1XIEA 3V16A 1OYAA 2VCCA 1AUSL 4JYEA 3S2JA 4V1XA 3MVIA 2J13A 2C91A 3HGSA 3WLQA 5FCZA 1RZMA 3B4UA 5KETA 4MGGA 3MW7A 4I8DA 4HHHA 3OYZA 2BMBA 3BV4A 4G2DA 5AY7A 3P2VA 2R91A 4AWSA 4S3CA 4XSMA 1L6FA 1RVKA 5D9NA 1Q45A 1V3KA 4CCDA 1RLDA 3W1XA 4N4PA 1XGEA 4PTNA 4BCEA 2HE5A 1BYBA 2D0GA 1OYCA 3C2EA 1K3UA 3WBEA 2CC0A 1AJZA 2QVHA 4X22A 1A47A 1ZAJA 1DIOA 3EXSA 4QS6A 1O6IA 2Y24A 4WRHA 4AIOA 2NZLA 3N2BA 2DU2A 1V0NA 2IXVA 3UNTA 3BK0A 1DJWA 3IGUA 4DN1A 4AC1X 3WX7A 3UJ2A 4AVFA 3I7RA 2J79A 3SCWA 4BR1A 1FY6A 3SCRA 3NOEA 3TN6A 4K39A 1LLOA 1KM1A 1QNOA 4G7EA 3E2QA 1KW1A 4LNCA 1IWBA 1RAKA 4XBKA 4RDZA 4PR4A 1V7AA 3VX1A 5HNRA 1GZGA 3E2VA 4K7YA 1E6QM 1WPCA 2BSLA 1JG9A 2REQA 4Q8WA 1RQEA 2OT0A 3ARTA 3DKLA 3WH8A 4K6AA 4N0RA 4DXXA 1E0WA 4ZO7A 1XLLA 2PGWA 4RJEA 4XZWA 2Y0FA 3T6CA 3W7OA 3RF9A 1S5NA 5DANA 5JVLA 3G8RA 4UC5A 5EL1A 8RUCA 1LBMA 3W84A 4LT9A 4PBFA 4XVDA 3IS4A 3CYVA 2RGMA 4Q8QA 3CUIA 2VUYA 5BU6A 1PCKA 5BRQA 4H7CA 3AO0A 3IEBA 4HVXA 3C8FA 2VOTA 2X05A 1UD3A 1SZRA 3V75A 3G3MA 4URIA 1FHVA 3GXPA 1CZ1A 4Z2KA 4BEQA 3GNDA 1REQA 2Z1BA 4TTGA 4PSPA 3IWPA 1HN1A 1JF6A 1ZCCA 2Y1HA 3MKVA 1PJ9A 3KCLA 1KFLA 3CT7A 1QFEA 3HJEA 4E2DA 3VTRA 2JF6A 1FCVA 4I7VA 4E0CA 2VZTA 2XH7A 1A4MA 3WJZA 4UTMA 1X8CA 1KXQA 2J25A 1R2RA 1WA3A 3AYTA 3OLGA 4JNMA 2WHJA 4F2TA 3TOPA 2X0SA 3CPRA 5E5CA 2PDWA 4REQB 1GOMA 2ZZ1A 4Q3MA 3KVLA 5DCDA 3I10A 2WJDA 4AZGA 2PD9A 4M51A 4PCPA 3PWAA 1J10A 2PDPA 3LCFA 2Z2BA 4M5PA 4DI9A 4KFOA 3VNIA 1DQXA 5DLCA 2ZRXA 4QE4A 1K7XA 2OX4A 4N9DA 1DV7A 4W87A 3CO8A 4YVXA 4GXPA 4M1BA 5M2FX 3W7KA 1KM2A 3M0VA 1HKMA 4FNRA 2NW0A 3AIUA 1B2YA 1XLMA 2BGNE 2PWEA 3UVIA 2CHRA 1SPQA 3TQ0A 1RQHA 4P7NA 4O1BA 1FHUA 2R1KA 3E74A 1I60A 3WMBA 4FX6M 1A5CA 3RGTA 2GSJA 3IJ9A 3P5ZA 2ZBTA 1ZP4A 2VEMA 2C18A 2OO0A 3VDCA 4Q4SA 4GMEA 2NWSA 1FWNA 4LAMA 2QPUA 3K1GA 4UMAA 3CAWA 3FCPA 5FJUA 2V68A 1MVYA 1HUVA 3LNPA 2JIEA 4F9DA 1F3TA 2WV8A 5DY2A 3V5CA 4O50A 2AKMA 2QUUA 3U2ZA 1UWIA 1FWSA 2PRMA 4WEVX 2VNCA 2INEA 3AMLA 4W5ZA 4DWDA 4JFSA 5EBUA 3F5JA 3RM8A 1TPVA 3KHDA 1IEXA 2C1HA 4UNLA 2WM0A 2PDMA 3GVVA 4C7FA 4AXNA 1HJUA 3RUBL 5IBXA 2ACRA 1BGGA 3QGAC 3VVGA 5A6BA 4BQ2A 1P6CA 3KAOA 1A5AA 2E40A 1J0JA 1P48A 2VVSA 4LVAA 4HB7A 3GX9A 2G3MA 3LBMA 4FS9A 4EF8A 1H0GA 3N2XA 1IIGA 4PCFA 4ZR8A 5AC8A 2BFGA 5IBXC 5CSUA 4K38A 1EGZA 5LXEA 5C9UA 3MCNA 1R6WA 1PKLA 1WOBA 2Y4SA 4CNSA 3KOXA 3GIYA 4L64A 1UP0A 2JEQA 5ABGA 5HANA 2VR4A 1KC7A 3RIKA 3SI9A 3U4FA 1VD6A 3G77A 3MBDA 2I16A 2BOFX 1M9HA 3TN5A 1XLBA 2X1SA 4ZL1A 2V30A 3HPXA 4J5NA 3S9YA 4UQEA 1GOXA 5HDRA 4GIEA 1JDAA 1JYXA 2QV5A 2G4JA 4AVNA 3PBUA 1M7JA 3MSGA 5I23A 2XDFA 4G7EB 2ZZ7A 1TA3A 3N15A 5T91A 5KMYA 2J7EA 4CNPA 3HFYA 4OUEA 2HS6A 1VFOA 3SFKA 4KRUA 1J6OA 1JNEA 1WDRA 3N14A 4OV4A 1XC4A 3UR5A 3CZJA 3UCQA 4JEQA 5A8NA 4R33A 3TR9A 3PY2A 3S9ZA 1A5LC 1TA3B 4LY8A 1Q6EA 5FSDC 1IF2A 3PZOA 1AQMA 4JIHA 2XVPA 3EA3A 3DDMA 4ADUA 3W01A 3WLTA 3KP1A 4JCMA 2A6LA 4IISA 1IYXA 3WD4A 3UW6A 4GC4A 3EDDA 3V1PA 2HMCA 4LV4A 2ON3A 1EO5A 4TV5A 5AYZA 2Z2AA 1GZJA 4NQ1A 5MKGB 3VNDA 2O56A 1OGBA 4US6A 3UG8A 1LCOA 2PTXA 3LCHA 3GO2A 1OFDA 1W2VA 4AIUA 4AMCA 3NQ8A 2DPEA 3EB2A 3S5OA 2OXNA 4ICMA 4BK9A 2HE8A 3NQCA 1DHPA 1UWQA 3RR4A 1WXJA 4IGHA 4RR4A 2YW3A 4UTTC 3MI3A 4GXWA 1E6RA 3EZ4A 1EZ2A 4GJ1A 3ZYZA 3S6DA 4MZYA 3GXFA 3VM5A 1YEYA 2C6QA 4WR3A 4ZFMA 3OZOA 3PFRA 3GQYA 2Y63A 4LAZA 3PJUA 4GKTA 3H8AA 3SGUA 2NV1A 1AJ2A 3OVGA 1JF5A 3N4EA 1Q3NA 1DWHM 2PBOA 2J7DA 4MY1A 3GG1A 1EPXA 1S1PA 4NUWA 5CG0A 1EC7A 1MW0A 3F4NA 2VZSA 2A3LA 3QYSA 5CCZA 3BAKA 3KBVA 2EG7A 4Z08A 2V5DA 4HU4A 1LLZA 3TKFA 4GUHA 3RR1A 3HG2A 1Z6KA 2B7PA 3QV6A 5TAOA 4C6BA 3KBWA 3SRKA 1E3ZA 3GUWA 5HA7A 5EA9A 4LX4A 4O57A 1E9YB 2FHBA 2Q02A 3GBDA 4ZSUA 4ZCWA 1JQVA 3S2CA 4D6CA 3RRXA 3H24A 4DBSA 4OZOA 3BVJA 2OWCA 2QGHA 4HTYA 4CLMA 2RHGA 2PDHA 2YA2A 4HHMA 3WF1A 3BQ6A 4BI6A 3E38A 4GIAA 4S2BA 3NPWA 3T1GA 4Z0JA 4HMCA 4WVXA 1XPGA 3QY8A 2Y62A 1H7WA 2WVVB 1RCQA 1X1NA 1FOBA 2ZUWA 3I4KA 4JICA 4AZBA 1DXFA 1AK5A 1O5RA 3GVGA 3PZQA 1QK2A 2Y61A 2IQDA 3N6HA 3N6QA 4U10A 4Z1YA 1H09A 3MMDA 3TYEA 1Q6OA 3GTHA 1IEVA 1TV7A 3P14A 1CXEA 2FLIA 1F3EA 1YPFA 3VOHA 1XYFA 5H1WA 1IE7C 2W63A 1YQ2A 1KBJA 5BWAA 4GJIA 1FWWA 3C2RA 2QZRA 4PMYA 1N7KA 2NXGA 3DFTA 1RK6A 1EP2A 2Q8ZA 4HPXA 5DX7A 4LGXA 1H61A 1H7PA 5HXMA 3C3UA 1LRTA 1Q6RA 1Q8JA 1JFHA 1RVGA 3LY0A 1W3LA 4PYSA 1E1CA 5U7SA 1HP4A 5ECUA 1ZBCA 2FFIA 1WKDA 4S23A 2ZICA 1FDJA 1BFNA 4QJ4B 2GL5A 4H4IA 3RPTA 4JX4A 2PLMA 4KEUA 3UNDA 4EPEC 1QWKA 1VB9A 3CH0A 3A23A 1FCUA 2OEJA 3TIMA 3HN3A 3UXKA 4RNHA 2PCQA 1BSIA 4FXSA 2GVYA 1XYLA 1Q7MA 1EJRC 5JUVA 1GUVA 1XLAA 1J5TA 3Q65A 1KFCA 1XSIA 3M0YA 4U3CA 1R8LA 1UKSA 3WO8A 3PPCA 5KZ6A 4C6PA 4MLJA 1G7UA 4BQ3A 2ZA2A 2FHCA 3ARVA 1GTEA 2WSQA 3VX0A 1VPQA 4JKKA 4B5VA 1XKYA 3R8GA 3NPUA 2GUYA 2OZ3A 3UZJA 3L0KA 4IJBA 2IPJA 3MJMA 4XAZA 1GG1A 4AG0A 2Y7FA 5C2CA 1QBAA 4GK8A 5G1YA 1YPIA 3BUVA 3S1GA 2JKAA 1XCFA 4NYYA 3S5YA 3E12A 1KFWA 4YHEA 3DKJA 1HG3A 1Z89A 1VBJA 3LQGA 2UY3A 2RDUA 3U6WA 2OLAA 1XJBA 4OJYA 5DMYA 3HV8A 5CBJA 4UZSA 3ZXWA 1WNOA 1XWYA 5AYIA 4LUJA 4L1XA 4MG4A 1KCZA 3FVDA 3XINA 1JPDX 1TIWA 3W74A 4KGLA 3WLKX 5K4XA 3GAKA 4DZIA 3P67A 4GI9A 5TD4A 2CLLA 2QAFA 3HMJG 2XPKA 3LHWA 3WH6A 2VC5A 3UR2A 2RDXA 4QX4A 3A64A 1RSCA 3WJXA 4TO8A 1FWTA 1QRQA 1AVAA 3H22A 3ZJ8A 3T4WA 3F4VA 1JDFA 1IWPA 5EBAA 2J7BA 4JY9A 2ACUA 2XHYA 2VD8A 4Y9AA 3AAMA 3SECA 3BLDA 3ARYA 3GNXA 2Z4GA 2A85A 2IUZA 2WC3A 3EXTA 4LC6A 3DN5A 4L1WA 4LPCA 1NP0A 1POJA 2OYKA 3VIPA 4LU0A 4XAFA 4D6JA 3CLWA 3OZPA 3HIJA 2E77A 1ZZMA 2G3NA 3PPGA 1EKOA 4GXMA 4GFSA 1WE5A 3IIXA 1I2QA 4WDUA 3I3DA 4D6FA 6CGTA 1DE5A 1XLIA 4XZ9A 5IHSA 4GX9A 4FNQA 3AIVA 5KITA 3L12A 4E4FA 4PUUA 3VD9A 1KGUA 1LROA 2BY1A 1IR1A 5K4ZA 3IGHX 4HA3A 1IEQA 1W91A 2WCGA 3G6LA 3FXYA 4X9SA 1BKSA 3T55A 3GVQA 1D3HA 1EQCA 2BVWA 2Q3RA 3UA4A 1VH7A 3CL7A 1N8FA 2J8TA 3GDBA 1JCXA 3CMGA 2OGJA 3ARXA 1TVLA 3E1F1 4XO6A 3ISIX 1WYIA 5AECA 3EPNA 4TX9A 1PKYA 2P10A 4GHRA 4CQ8A 1EJSC 1R2TA 4GKLA 4ERAA 1HJVA 1YADA 4Q8MA 1IZCA 1VCVA 5LGZA 1P0EA 4WJXA 4HK6A 2WC4A 3HPSA 3G1YA 3SCPA 1VPYA 3CPUA 1TWSA 1GKQA 4PTWA 1FX6A 2PWVA 5E93A 2I57A 2MANA 2VURA 3EWCA 4AHOA 3TUUA 1LM1A 4MIMA 3M6DA 4IIBA 1JDEA 1UW9A 1ONWA 1US3A 4E8CA 3C52A 1XIGA 3QHNA 3GC2A 3THCA 5FI8A 1DXEA 1QO5A 1B5TA 1E6ZA 4S3AA 3IUDA 1MI3A 3B0XA 1KFEA 5BOOA 1B3OA 2PTDA 3USZA 2ZXQA 1M7PA 1ZB5A 2C19A 3MZNA 5D8ZA 1QUMA 2HXUA 4NT0A 4RXGA 2ZA3A 1M04A 1W9PA 3L23A 4GYFA 2XH0A 4TVDA 5AZ1A 4RPPA 1N8WA 4P7LA 1XIFA 1XLCA 1XS2A 1PZ3A 3KL3A 3MZ2A 2X0YA 4DYKA 3CL8A 2Z7KA 1HGYA 3O2LA 1Z69A 3RX3A 5A6SA 1C9DA 2CLPA 3F4CA 3RITA 3WDPP 5A6JA 3K4WA 3O1NA 4DHGA 2Y7EA 1NIUA 4LFYA 1K77A 4F3HA 1V5XA 4PSRA 3M0IA 4IQEA 1AODA 3G5EA 3HJZA 2JE8A 3W7QA 1EDTA 1QJWA 4GNKB 2CESA 3PJTA 3FS2A 4JYFA 1FWAC 3PZMA 1Z7AA 4PMUA 3VNLA 4ES4A 4XZLX 2NV9A 3NDYA 2PC8A 2E8ZA 3GXDA 2GSHA 3CHDA 3WLMA 1CPUA 1KFKA 3NIYA 4RNJA 3GDKA 3GXTA 2BY3A 1R3SA 3OP2A 1XD0A 5TNVA 2V82A 3PG9A 1KCLA 1K8XA 2CHOA 4PTDA 4GUJA 2XN1A 3PZIA 1OABA 5GQBA 2OZTA 3DG6A 3KP0A 3PZVA 1FHDA 1EDGA 1EH9A 4HBKA 5FA5A 1UMYA 3BLOA 2E8YA 1W2PA 1KFJA 2G97A 5KEZA 3GR8A 4LF1A 4FI4A 1GVFA 2BG5A 1PUDA 3N29A 3GNRA 3M5ZA 4DYJA 1YIXA 4PL2A 4CN6A 2X7WA 1E73M 2J66A 2ZQ0A 3VD4A 1M03A 1C8QA 3ITGA 2B4GA 3SCOA 4JTTA 3WLLA 3MYPA 4ECLA 2MNRA 4AD3A 2ZTJA 3W26A 4S3DA 3TJLA 3F2DA 2A4AA 2DJLA 3ICJA 4PB5A 2DZWA 2OG9A 4Y9NA 4GVFA 1FA2A 1VP5A 1R3TA 3C6CA 3TYUA 4DB7A 4WOZA 3UXIA 2V81A 3QKZA 4AEFA 3PB2A 2ZX9A 3W28A 3LM3A 1BVNP 1DVJA 3NURA 4MF4A 2DSUA 4IH3A 1T0OA 3PUGA 1EZWA 2XFRA 3IVTA 4QSFA 3V5OA 4ORMA 4ZB0A 4A3HA 7XIMA 1KLZA 3BQ5A 3P0XA 3EA2A 3RN6A 3BE7A 4UFKA 1TPEA 3KUMA 5HMFA 1U5HA 5CSYA 2JFEX 4BI5A 3U0HA 3DU0A 2Z28A 4F2BA 3QZ6A 5FL1A 3PNUA 1IT7A 4DAFA 3PB0A 4K37A 3FJ6A 4LVGA 3GNNA 3LI1A 1IQ8A 3AI0A 5REQA 1E71M 3P3BA 4IFKB 3W2KA 3EB4A 2H9AA 3NNTA 3QM3A 4O52A 2PBGA 4EAYA 4R9XA 3CAVA 1J5SA 1TMQA 3O7UA 4ICCX 1RY0A 2QCCA 3DHPA 1VFTA 5CBBA 1EX5A 2CLKA 4FZIA 4NZFA 3B9DA 3W3OA 1EGVA 2WKGA 4PCSA 2HBXA 3FJNA 1IEIA 4NJGA 4MADA 3HM7A 4DZHA 1E6SM 3ZT7A 3KTSA 4S3KA 2FKPA 1KBLA 3VKAA 4WLCA 2A7NA 1OFPA 3MP5A 4BHYA 5AC6A 1NDYA 5I06A 1POKA 4AEOA 3B97A 4HSOA 4Q22A 3VIFA 3WDQA 4O11A 3S2LA 1E15A 3LXAA 4N02A 1Q66A 1TTIA 1EA0A 4NJKA 3OO2A 4OTKA 3B8WA 4FO4A 4B3LA 3NZ1A 3TWBA 4C6IA 2DVTA 3PZGA 4GFIA 4UR7A 1NDWA 3NQ2A 2EPMX 3QKEA 4AYGA 3ERPA 2TYSA 2O92A 4FF5A 3IJ8A 4I3GA 4GQ0A 1F07A 3LCGA 1XKJA 3OJGA 4JIIX 4CU8A 3ALFA 4JKMA 2YJQA 3N2OA 2PLJA 3W25A 1M65A 4E3TA 5BW6A 4LC8A 2AL2B 4D8LA 2WNWA 2VEKA 1LOQA 5LYRA 2J6XA 2O9TA 5T9BG 3EOSA 1W3HA 3DFNA 3AHZA 1XV8A 2WANA 2ZRZA 1SFJA 4HIBA 4G5DA 3WNLA 2QYGA 2ZX5A 4IUGA 2J7GA 3AWNA 3VIMA 1FWIC 1S2UA 5F2GA 2ZX7A 1CENA 1K9FA 4PC8A 1ZAHA 3UGVA 1TO3A 2AL2A 3P93A 3BAIA 2VR2A 4L4MA 3V3WA 3T9PA 3K13A 3T40A 3MU7A 3OB8A 2P3ZA 2QDGA 2YGYA 3UD6A 1R86A 3LGEA 3TSBA 3GW0A 4O53A 3PUOA 4P8UA 3QEZA 1QNQA 4XZHA 2FMOA 3LLXA 1Z41A 3I6EA 2D73A 3OGSA 3JR2A 2C79A 2XIQA 3OBKA 4MYXA 3CV1A 4JBRA 3H2NA 4NJIA 1EJUC 2G41A 2WQDA 2OEMA 3TYCA 1FDYA 1W32A 4ZO8A 2PP1A 1SQ7A 2VYOA 3SIMA 4UOQA 4H6RA 3WMSA 2BVTA 3SCNA 3KRSA 1TX0A 2VZOA 4AVOA 3AYRA 1UG6A 1THFD 2VZVA 3ITVA 1HKIA 1FCBA 3P82A 1SJDA 4U5KA 3BJTA 3ZLGA 1RD5A 2QUTA 3QH2A 4P61A 1QBBA 1UP3A 1FWRA 4Z1DA 3NEHA 1RY8A 2Z25A 2XG9A 1V02A 3NO3A 4LUSA 3TYZA 1QOPA 2ATSA 2XM1A 3B0VC 5D04C 2TPSA 1W5QA 1W37A 1TB3A 1A0DA 1PTAA 4MFEA 4QNEA 1H1YA 3VGEA 3WUGA 5I3FA 2WYSA 4NZJA 1DJQA 3EYPA 4LAOA 2ICSA 1B54A 4JDYA 4UQCA 1AFSA 1E9IA 3BGAA 1RPXA 3A5FA 1Z32X 1R7AA 2V3GA 2WAGA 3THUA 1ITQA 4W5UA 1LUCB 3OODA 1P0KA 3A4JA 4OE7A 3HO8A 3EEGA 4JHZA 1DE6A 1TG7A 1ESWA 2B31A 1GVSA 2EPNA 3R1ZA 4NF7A 2QDHA 1V3IA 4UR9A 4W84A 3SUTA 4D71A 1BYAA 4C6OA 4C6NA 5BZAA 3QSRA 3APYA 3VGBA 1EB3A 4HNTA 4IIEA 1TQJA 2NX9A 5JBDA 3V4BA 3DHFA 4B2DA 3OQ8A 4S3FA 4YYCA 4A8IA 1BLIA 5H91A 2D2GA 3NQGA 1ECEA 3NQ7A 4R7OA 3W6LA 2CEQA 4V33A 1KBBA 4I9AA 4NY2A 1OQFA 4AC7C 1ELSA 1HP5A 5DO8A 3VO0A 4R9OA 1K03A 1N8IA 4WY0F 4F0RA 4JFUA 1DJIA 3OIXA 1E6PA 2VDGA 4TVUA 3TC3A 2AQVA 2G4FA 2VC7A 3LBOA 1YKWA 1GZ1A 4W8BA 1D3CA 4C60A 3A4XA 1LLWA 1D8CA 2GWNA 1OIMA 5EY5A 1LOLA 2PU0A 1YXYA 3IIPA 4H00A 4I9JA 1EUAA 1NWRA 5JMUA 1QI5A 2YBVA 4DNHA 2ATMA 4H6KA 1NFPA 5CPOA 5DXXA 1DIEA 2PPGA 1JZ4A 4FR1A 1IGSA 1HJSA 1ZCOA 1EA9C 4B15A 3LHTA 3CEUA 3RLUA 3M0ZA 1B0IA 3H54A 2ZX6A 3AROA 3BSMA 4AD4A 4GQQA 1GJUA 3W02A 1IGWA 3CK5A 1C7SA 4F2UA 5D30A 3ARQA 3GVWA 2BWGA 3W76A 2NQ5A 4FXFA 1U5VA 3EOUA 3IUHA 2F6XA 1F4AA 4RLIA 2UV8G 1FXPA 4WGHA 3H53A 4JTQA 5D2TA 2XN2A 1UWAA 5C0QA 4LYKA 1QTWA 1E5NA 3NAVA 3R11A 1ZLPA 1XGZA 1VAHA 5D02A 3DFSA 5EMLA 3BZJA 4TXEA 4QRNA 1QOQA 1HX0A 1BVZA 2VC6A 1XH1A 1GPFA 4XVEA 4QS5A 2J4GA 2V5CA 3VINA 4XUGA 2BXVA 2BLEA 3AZSA 1ZY9A 4LYPA 1TV8A 2NWRA 4F40A 4O13A 1GVRA 1RP9A 4HKPA 4B5WA 3MVTA 3VILA 2VFGA 2F8QA 5FEPA 3UZWA 3H4XA 4JFTA 3KHJA 3VE9A 1VLIA 3TLQA 2PB1A 2P76A 4LRSA 4U4MA 3WJWA 4U3AA 1HL9A 3M44A 5G1TA 2SFPA 2E5DA 2PSNA 4RE0A 4X2RA 5FJPA 1D7FA 3AXKA 2CPUA 3WQOA 1J11A 2ZRYA 4HHPA 1K02A 1NWUA 4MSSA 2QCFA 3WDRA 2OR2A 2WOQA 4JTUA 3CZGA 3TK7A 1XYBA 4IG2B 3OTRA 1ZBKA 4LTSA 3UPMA 4AZHA 3W23A 2PP3A 3T0CA 3VABA 2QXWA 4CQDA 5DCBA 1FWJC 3G1HA 3RU8X 4J2MA 1KD0A 3NVTA 1LL7A 2WCSA 2CITA 5FIPA 4C65A 3OVQA 1EEPA 1PAMA 3R10A 1J2WA 2Q8XA 1J18A 4CQBA 2R94A 4JTFA 4AISA 1UH4A 1UR8A 2X1IA 1TPC1 2VMFA 1VJSA 5FESA 4D1JA 3L4ZA 3CV6A 3T08A 1W3NA 3SN0A 2E09A 4QQ3A 4GUGA 1RJQA 1XIDA 2P88A 4A2RA 4HPNA 2C0HA 2HCVA 2VCBA 3WLJA 4H9VA 4L9XA 2VRQA 4ZODA 2WNNA 3KVMA 3CUXA 3EKLA 4WKHA 3A3WA 1UZ1A 3UXLA 4V1YA 2CZFA 3ZOAA 3GU2A 3R5EA 5EFFA 3G1FA 2CERA 3VIKA 3UERA 4GZEA 4ZENA 1X1OA 4PUKA 5C2GA 1OX4A 4GY1A 4V2XA 2V2DA 4NZ5A 5D8WA 3FV9A 3IANA 1DEDA 1RH9A 1L6SA 4LVDA 5BCAA 2O55A 7TIMA 3BDKA 3SUWA 5A6LA 2PGRA 3UWEA 1YTKA 4JS3A 5I07A 1AD1A 2X7VA 2PDNA 1E0TA 5GNXA 1XUUA 2XM2A 3REQB 5FEWA 3DXIA 1NFGA 4NL1A 5FF0A 3UPWA 3CTLA 1A3WA 2E68A 4UTKA 5A1AA 4RZ4A 1CGVA 3CBWA 1VRXA 4MAZA 2KZHA 2ZZ2A 3UU0A 1V0KA 5CLTA 4RE3A 4EE9A 3AMKA 1KR0A 3HG5A 1KXHA 3CB3A 1NOUA 2XZ7A 2CNCA 1NF7A 2ALRA 4QSHA 3P84A 8TIMA 4U2YA 4PB3A 6TAAA 5A3HA 3UT0A 1GVYA 4H83A 4CN1A 3POHA 1QW9A 2J74A 4DJDD 2QHAA 1OF8A 2TODA 2TSYA 1GVEA 1GEHA 2YCJA 4HGXA 1MW1A 3DGBA 4DWSA 4J3SA 2ISFA 4AIEA 7TAAA 1QW7A 2YOCA 1B4EA 2UY2A 3NOYA 3GIPA 4C6FA 2OELA 5K7JA 2XIMA 2PDLA 4M1RA 1TR9A 4EWJA 3A9BA 1ISWA 3ZR6A 4QBXA 4Z2JA 1R3VA 4Z2GA 2INZA 2DZVA 4H9ZA 2AGTA 1IV8A 5AFDA 4POCA 3VDAA 3CUHA 5HOSA 4K36A 3DG7A 4S38A 4DELA 2VGGA 3QQWA 3WLNA 1UBPC 1UHVA 4IT1A 1TMHA 3P74A 3VU2A 1EJTC 2WNZA 3UA3A 2XH4A 1TZ7A 4EF9A 1GYNA 3HF3A 1OWQA 1Q13A 1R87A 2WLYA 2V38A 3LHVA 4HQVA 3EDFA 1Q2RA 4UIOA 3TN3A 3W81A 1MUCA 4KMQA 4DJFC 2VDIA 3RCMA 2YW4A 4R27A 2DGAA 1XX1A 3VKDA 5FD0A 3CQIA 3VDBA 3C56A 4HJFA 4JTCA 1DIDA 3NTYA 1ZAIA 3T2OA 4Q8NA 3BJSA 3W87A 2PZNA 2ZIDA 4PUMA 3PHAA 4BQ4A 2HVNA 4HOWA 4NRSA 1FQ0A 1WBJA 4K1WA 1L8NA 3NA8A 4L4OA 3M0XA 2E1WA 1TJPA 1UH3A 5FOOA 3IAQA 3WSUA 1I8JA 1JPMA 5HINA 3AMDA 4H9MA 1SM9A 3WN6A 1YW1A 4XZNX 3CGTA 3O3RA 2NLYA 3P60A 1F4HA 1LT8A 3FX4A 1WDPA 5AHNA 3VA8A 4I90A 4IX2A 2WB5A 2OPJA 2FGLA 3KTCA 2YCIX 2DVUA 2HTMA 1BG9A 2ZWZA 6XIMA 4FPSA 3VOFA 4REQA 4A3QA 3T4CA 3IRDA 4GA8A 2G37A 1KTCA 2DZPA 1E4IA 3VUPA 4Z0SA 3GAYA 1QVBA 4DJED 1PDZA 3IACA 1TCMA 2UZ9A 3AUJA 1L6GA 1DKWA 4YIWA 1K8ZA 5FACA 1FTXA 5KINA 3W00A 3BOFA 4C1NA 1EJWC 1NFBA 1QU4A 1BG4A 3KE0A 1QPRA 1D3GA 3BV7A 2QKFA 4IFOA 1G4EA 1W5PA 3TTEA 1Q7QA 2IKGA 4DJFD 1FWGC 3W86A 4LUYA 4DUOA 3EOEA 5H8UA 3O9NA 2YDSA 1VKFA 3QV7A 3NPVA 3QR1A 3U3HA 4GNVA 4JX6A 5DMLA 2X30A 1O5XA 3FNDA 1XLDA 1KFBA 4B3KA 3PSVA 4GYPA 1HL8A 2NQLA 3WL1A 3Q4DA 2ZX8A 2F38A 2YYTA 2GSEA 3R2GA 1XLFA 1UZDA 3W85A 3AS2A 1Y0EA 4GBDA 5I78A 1P1XA 3UWQA 2OSXA 4LWWA 3FY1A 1BYDA 5M17A 2PU1A 3W29A 5I6SA 4ZGYA 2ZXBA 4WDTA 2OOFA 4EVZA 1W5NA 1CB2A 4BF5A 3A13A 4U28A 3LD5A 3UWYA 1IWAA 1LOSA 3QXBA 5AHFA 2H3DA 4E8GA 4PRWA 3MO4A 4QM1A 1MMFA 3W6MA 1F05A 1O5QA 3EWDA 3ANYA 4PMXA 1QMLA 3WQPA 3E0WA 1UASA 3GG8A 1V6YA 3G0XA 5SWUA 4ATLA 3QR0A 4L1GA 1PCWA 4CD8A 3NWRA 4BEUA 1R5YA 3VZZA 3KVKA 3WFZA 2YZ5A 4DZ5A 4ZE4A 1LZOA 3O06A 4HYWA 3U7VA 2E7FA 5M5DA 1GOQA 4BWLA 3N4AA 2DEPA 2D2JA 4LNYA 4GPNA 1IT0A 3DOPA 4L6HA 4YS1A 1QI0A 1CTNA 1AW1A 4U2ZA 5A6KA 5CPSA 2YL6A 4LUIA 1GPWA 1ZJAA 2AAAA 1E1FA 1JCMP 1I45A 2YSWA 1F76A 2XIOA 1J93A 3TEVA 4MM1A 1V3HA 3N19B 3L4YA 4CVUA 3FGCB 5LNUA 5LA2A 1VFSA 1WDDA 4FNSA 4F9JA 1WQ5A 1A3XA 3VM7A 1IEWA 2OT1A 3M4HA 3DYPA 2PDJA 3HB9A 3VPLA 3TSMA 3S1WA 1L6YA 1W31A 2V67A 4DY1A 3DIPA 3DC8A 3E0LA 4S3JA 3E02A 3QPYA 5HBFA 5H2ZA 2XIJA 3BSHA 3AZRA 2BXZA 1NQ6A 1FKWA 2VI0A 2WWDA 1UUQA 4C5YA 1HFBA 3PWIA 3VUSA 3ATYA 1G94A 1S2CA 4HCLA 2QCGA 4C6EA 1TV5A 3STEA 2ASHA 2HRWA 3QBUA 3WDHA 1AW5A 3HQ1A 4EOUA 4KETA 1I2PA 5DT7A 1SFSA 2OWXA 2BY0A 4AD5A 3L9CA 1MRQA 1LBLA 1JGIA 4D1IA 1WDSA 5FJOA 4Z1AA 2X09A 4B5UA 3UJRA 1UMLA 3D47A 1DHKA 4PEKA 4BZYA 2Z6IA 1UJPA 1NWTA 3W71A 3BANA 4IGSA 4KCVA 3RX2A 3M5VA 3S5SA 1KGXA 2R82A 2XZ9A 2PGEA 3FA5A 3B9OA 3M16A 1L6WA 3TW9A 2OYLA 4NAFA 1HKJA 3LENA 3G2GA 3QLLA 4PB4A 1B3XA 3AS1A 2YIHA 5JBFA 1KR1A 4ZOAA 3DEQA 3HOJA 2XVLA 2FIQA 4PBEA 3WUEA 2PGFA 2QVNA 3KDOA 1W9DM 1O66A 3EOOA 3S5NA 4DVOA 1BGAA 2D1ZA 4WXYA 4E6MA 2WSPA 4ADTA 3Q2DA 3KRZA 3CAQA 3ZFHA 1AL7A 3N17A 4ICNA 5DQPA 4M7SA 1DWIM 3LGGA 4NNBA 1G67A 5LNSA 1OY0A 1JCYA 3H2MA 4RE4A 1TE1A 3L2MA 5F7UA 4G1NA 3CC1A 1HO4A 1E4LA 1R0MA 1EIBA 4O54A 4Y9MA 2H90A 4AZ5A 4WXZA 2ABAA 1I0BA 4ZQMA 4KWUA 4JTHA 3PUEA 5K9DA 3RU6A 3VCCA 4DUVA 2QCMA 3Q94A 1G9HA 4JNZA 1DPMA 3U8GA 2CW6A 4XWUA 1J9YA 3WF4A 1KXTA 2RJGA 4HOXA 1QPNA 3PUDA 3ZT5A 1WV2A 1CXFA 1W6TA 1TPH1 3AXXA 2X40A 1XRSA 3CO4A 1TVNA 5KSWA 1XRTA 3JUGA 3WF3A 3FLUA 1AQ0A 4HU3A 2XGBA 1K1DA 2PDCA 1SR9A 1QHPA 3H12A 4QDWA 2FPVA 2W66A 2HVMA 3ONBA 3PBGA 1G6CA 2YL5A 3A47A 3LLFA 3ZLFA 3QGVA 5G1MA 3UY7A 2VENA 3VNYA 4B91A 4K1GA 2R14A 4I7UA 2NUWA 3QY6A 3GDMA 4Q8PA 2O9OA 3FXGA 1XC6A 2GGJA 2GWGA 4MNJA 2E6DA 1SO4A 4NG3A 5HATA 5HK4A 2E6FA 1MEHA 3T2PA 1ITXA 1UD8A 1DWFM 4MPQA 5DMMA 4PMJA 8XIMA 2VO5A 1XH2A 3F1QA 1R3WA 4GINA 1R46A 2HQAA 2J7HA 2AQOA 2VCAA 3T2QA 4JYDA 3VC6A 3GFZA 1OHLA 3RFAA 2W92A 1XD1A 4YCOA 4ILSA 4KGJA 3I68A 2VXNA 2PDQA 1T96A 3PBVA 3LGDA 3BICA 1OCNA 4MKVA 1U33A 2O7QA 1CECA 3PS7A 3LA4A 8XIAA 4FSAA 4HMDA 1DJXA 3GXIA 3OIHA 3MI6A 1VCFA 4UTWC 1SZFA 1JR1A 1Z44A 4FEZA 5JXQA 1J79A 4NXSA 2E67A 1LWHA 2V6AA 3C2VA 4JNYA 5BROA 1UA7A 3MUAA 5LXXA 3UQNA 3AC0A 4LSBA 4MB4A 1Q4WA 4MTVA 1VENA 2Y7GA 5IDIA 5A8QA 2UY4A 3NG3A 2I56A 5D9PA 3AYVA 2WVSA 3EWZA 3MV11 4GVIA 1JCJA 3W37A 1ZSXA 2QGYA 3SRFA 1AH0A 3NGJA 1FRBA 4KWSA 3V35A 4WSJA 5CQ1A 3LV6A 9XIMA 4MJ4A 2NQJA 4FK9A 3B8SA 3SFWA 3ZWTA 1VHNA 4CEXC 1QI4A 3ZSTA 1FH9A 5CPNA 1CLXA 1KRBC 3FN9A 3U57A 2DQXA 1OF6A 3SDOA 3I6TA 3O6YX 4A8RA 1G7VA 1XQKA 1H1NA 3REQA 2DSKA 1TPWA 1C8YA 4L7ZA 1K9TA 2NVDA 1XINA 2EQDA 3W7GA 1EDQA 2CLMA 1ISXA 4E2OA 3A9IA 2W4XA 2GVEA 2F61A 2CYGA 1W9XA 2WMIA 4PRRA 5BOEA 3WG6A 1T40A 2BV9A 4QP0A 1M6JA 1O4UA 4XZMX 1F8IA 3SY5A 1QXLA 3MDUA 1GQJA 4G9PA 4HHLA 4C1LA 2YFNA 5L6UA 3WDJA 1OK4A 4XSLA 2Y5EA 4JHMA 4OVXA 4UCGA 4ACYA 3PN8A 3TX9A 2E6YA 3EMQA 2IPFA 3VFLA 3KX6A 1IZKA 5HWMA 4HNCA 1UZHA 4BWLC 3UJEA 1WDQA 4H8NA 4H8UA 2OQHA 4OWGA 2BHYA 1CGYA 3TVAA 1T99A 4FOKA 4H2HA 3PC0A 4RPQA 4IXXA 4A3UA 2JEPA 3U4AA 4F48A 1LDCA 2GQAA 3I6RA 3SSJA 3P7YA 1LRQA 2HK1A 5FJRA 3NDZA 1M1BA 3QJAA 4QDMA 3DC0A 1FBAA 4RK8A 2IMRA 3DHDA 3TSDA 4ALDA 5LA1A 1H1ZA 3INPA 4JQ4A 3ES8A 1MYRA 4OIFA 5B7YA 3KWXA 3UFYA 2ALDA