4ZFMA

Structure of gan1d-e170q in complex with cellobiose-6-phosphate
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
474
structure length
459
Chain Sequence
b'HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNQQNIFISFGYRLGLHPPGVKDMKRYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVGTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative 6-phospho-beta-galactobiosidase
publication title To be published
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 184
structure length 459
sequence length 474
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4zfmA00
3GXDA 3EYPA 3AICA 2XVPA 5IHSA 4FF5A 2WXDM 3T08A 1WDQA 3UG3A 2PBOA 3W28A 2YKKA 2DSZA 1MW3A 5IHRA 1J0HA 1HKKA 1C8YA 1HN1A 1MW2A 2RGMA 4CD5A 3HJEA 1UD3A 2WYSA 1R85A 2CHNA 4H2CA 5FCZA 4KGJA 4UQBA 1B3WA 3VNZA 2ZUTA 1RP9A 2WM0A 4M29A 4J3UA 4W8AA 3WD2A 4CD6A 3ZR6A 3VIOA 1OBAA 3W26A 3NSXA 3AIBA 1QNRA 4P8XA 1RP8A 1OD0A 2J25A 1JFXA 2BVDA 1CENA 1AVAA 4W86A 1VFUA 3BAWA 3GH7A 1UKSA 1MW1A 3WL1A 5C70A 3POCA 1S46A 3GYCA 3WNOA 4AXNA 5ABEA 1ODUA 4PTMA 2CXGA 2J47A 2E8ZA 1DWHM 2VRJA 4D72A 1GJUA 2O92A 4UFHA 4M1RA 5JIWA 3MUY1 4JAWA 3ZR5A 4U33A 2E0PA 1C3FA 3N18A 1Q6GA 4JCMA 1JZ2A 1W3HA 2VR4A 3UG4A 1RH9A 2E3ZA 4HZ6A 3T2OA 1ZJAA 1UH2A 3CPUA 2DH3A 2X0HA 2OWXA 3RM8A 3SUWA 2ZX5A 5DF0A 4DUXA 3GM8A 2QLYA 1R87A 5JUVA 4U31A 1AQHA 1V6WA 3OZPA 1YQ2A 4XB3A 5A94A 3I3EA 1IV8A 4ZXLA 4CN1A 4D1IA 2YOCA 4P7LA 3AMGA 1NQ6A 4EAMA 2FGLA 4WSJA 2XPKA 3T0DA 2WHMA 4UQDA 1EO7A 1FOBA 1VB9A 1DWJM 5I2UA 1H1NA 2JF7A 3W37A 5CPTA 1E5NA 4F79A 4NZCA 3II1A 4JFUA 2YL8A 1J0IA 1US2A 3WFZA 3ARVA 2ZUVA 4MNMA 5BXRA 3CUIA 1UKPA 3SCOA 2DSKA 2V5DA 3CUHA 2VX6A 1KWGA 5BWFA 2CHOA 1GQJA 3AHZA 1XSKA 1UWTA 5IDIA 3NSNA 3VGGA 2CKSA 5A8QA 3BAJA 1V3HA 4JFWA 4KWUA 3HU7A 1ODZA 5FL0A 3BAYA 2PWHA 3J7HA 4XUYA 5BROA 1BSIA 4BF7A 4LYPA 3ARPA 3QOMA 2ZX9A 4D6IA 3PZUA 3RPMA 4M56A 3WNLA 1G01A 3VMPA 1H09A 3VIKA 4CCDA 1NWSA 1BVZA 1KFWA 1B3XA 3BSHA 2BS9A 4LYRA 3SCQA 2VURA 1KGWA 5FIPA 1FHLA 3BLKA 1ZBCA 1JI2A 2ZXBA 1H11A 1W9VA 1EIBA 1QI3A 2XGBA 1GOKA 1HNYA 3WH5A 1CGVA 1BVNP 1W3LA 3MSDA 1VEOA 4HU8A 1UQZA 1BYDA 3CMJA 1Q6FA 1CTNA 2WB5A 3T09A 3RJXA 3WSUA 4OBRA 3W81A 1JYWA 2O9OA 5M17A 4W84A 4MB3A 2JEQA 3SUVA 5A95A 1QVBA 1PAMA 1MWOA 5HPOA 3MU7A 1O6IA 3AOFA 2A3CA 3AXHA 3CHFA 2XG9A 4QP0A 5CGTA 1OINA 5IFPA 4JHZA 1CXIA 2DEPA 5A69A 4FMVA 5E09A 3WUFA 1W2VA 2QPUA 3WDPP 2YLLA 4D6EA 5DT7A 5A6JA 2XHYA 1NM9A 1E56A 3E1F1 1D7FA 1QBAA 4CN6A 4W89A 4V27A 5KEZA 4B3KA 2GJXA 4U2YA 1V02E 3PZNA 2XTKA 4PTXA 2EXOA 2VQUA 4RE2A 4IUGA 4CVUA 1XYFA 3UEQA 5DT5A 2D0FA 4B3LA 2NT0A 5ABGA 4D6GA 1BYCA 4FLRA 1E1FA 1PZ2A 1V0LA 1UR2A 1B90A 1LF1A 1LLOA 4UFLA 4H8VA 1UKOA 1BPLB 2EBNA 5M3WA 1FH8A 4V28A 2D0HA 1VBRA 3ZSTA 3EMQA 1UKQA 2E4TA 1PJ9A 2G41A 1QNQA 4WKFA 1BLIA 4WLCA 5I78A 4QLLA 3WH9A 1UQYA 4K68A 1LWHA 2OWCA 1B9ZA 1MFUA 2VVSA 1D2KA 1SYTA 3UESA 1NP2A 4MJ2A 4TVCA 2J8FA 4UZUA 4MB5A 1CGWA 1W3JA 4E8CA 2A3AA 2DT1A 3CUGA 1KB3A 1UR0A 4WIWA 3UERA 4CUCA 3AHYA 1KQZA 3VX1A 3AFBA 3N17A 3NIYA 3ARYA 1JZ6A 5JBDA 3WMCA 3VTRA 4OOUA 1IZKA 3AQUA 5DEZA 4GO9A 3W27A 4ATWA 5A8OA 3T0BA 4FLQA 4JZ5A 1GPFA 1MXDA 2J78A 3BAXA 4IM4A 3A6OA 1SR0A 3N9KA 3SCTA 2OSXA 3G6MA 1VFMA 1ISZA 1EDGA 3HN3A 3AIRA 5GQBA 3OGVA 4DUWA 3GBEA 2DQXA 5LA0A 1G5AA 4CCCA 5AYIA 1HT6A 2WAGA 3B9EA 3KL3A 2E8YA 2V38A 3VILA 3B8SA 1PPIA 2D3NA 2IXUA 2A3BA 3M07A 1IZJA 2VJXA 3WDIA 3CZLA 4PBGA 5IFTA 1GHSA 2WVVA 3N12A 4J3WA 1E6NA 5A6BD 1J0YA 1VBUA 8CGTA 3NSMA 1CEOA 3N04A 4GQRA 3WUGA 3AROA 4JL2A 2X8RA 3TA9A 1QPKA 1MW0A 5CGMA 4UOZA 2PBGA 1VEPA 4PCSA 2GJXB 1OWQA 2FHFA 5C8BB 3WIJA 1EXPA 1HKMA 5DMYA 2BVTA 2D1ZA 1E6ZA 2BXZA 2EEXA 4NF7A 3WH6A 2PWGA 4XZBA 2OSWA 1WCGA 5A8NA 3I3DA 2WMHA 4UR9A 5D9MA 2AMGA 2ZUWA 4NI3A 1XH1A 3MMDA 4DM2A 1Q6EA 3NCOA 2GFTA 4X9YA 2EPNA 2V3DA 4OOZA 3W25A 3TTSA 3BAIA 3ZT5A 3FNDA 2EPKX 3AISA 1A47A 4M80A 2W91A 4BQ3A 3CZ8A 3L2MA 4TUFA 5D8WA 3BMWA 4U3AA 1FFRA 1JAKA 3SUTA 4D71A 3BAKA 4KGLA 3VPLA 1W1VA 3WH8A 1OGSA 4TVUA 1JDDA 3FAWA 1I1WA 2PI6A 2Y8KA 1LG2A 2XVKA 1OIFA 4TVDA 5AC5A 3CGTA 1I75A 2QMJA 2VZVA 2YA2A 5CLWA 1NOUA 1B3YA 3ARQA 2JALA 3WENA 1EHNA 2IUZA 1VFOA 1DP0A 2DSVA 3VD7A 1PIFA 2WCGA 1ZBWA 1E4LA 4PMZA 2ZE0A 1UA3A 3WF0A 4Z2HA 1E3ZA 3CH9A 1KXVA 3POHA 5KZ6A 2GJRA 4ZENA 3OZOA 1M04A 1B2YA 3DYPA 2JE8A 1M01A 4XV0A 4GZJA 1TMQA 1G94A 1HJVA 4MJ4A 1DWFM 2DSWA 2XSBA 2UY3A 1JZ4A 1QNPA 2VZTA 2VC9A 2YA1A 3WF1A 6A3HA 3OLIA 2XFYA 3VU2A 1KQYA 3CUFA 2XFRA 1VEMA 4MDPA 5M5DA 3WEZA 3AYRA 3BCFA 4YPJA 5I0DA 4B9ZA 3EDFA 4UQEA 4OIFA 3SUUA 1H41A 1M7XA 3VOCA 3DYOA 1ISYA 1NH6A 2XVGA 2Y24A 4W85A 5LA2A 3UR7A 1K9TA 4JHOA 3N1AA 3RDKA 3ALGA 2BHUA 1E73M 3VDBA 1QI4A 4MB1A 1TA3B 4WJXA 1E55A 2J74A 2WCSA 3VGFA 5ECUA 1TVPA 1JG9A 2GUYA 1PX4A 2VUYA 1V3MA 2XM1A 4JFTA 3W29A 3F4VA 4UFMA 3TOPA 4MNJA 4AISA 1E72M 4OBSA 3QGVA 2YIHA 5E9AA 4CN4A 3VM7A 1HX0A 4HMCA 4LX4A 3AIUA 4YHGA 4IPNB 3WDJA 1KR1A 1W3KA 2O9TA 2YL9A 3OLGA 2G8ZA 1JFHA 4QCEA 3THCA 4PMQA 3CHDA 4W87A 1UWIA 2WSKA 2BV9A 2D20A 5CSUA 1CZ1A 1DTUA 1DWGM 2D2OA 2ZUMA 3CTTA 1G1YA 3FAXA 1QHPA 5BYWA 4BQ4A 4P7NA 3WH7A 5CSYA 3W24A 4W88A 3PZ9A 1BTCA 3L4ZA 1ZB5A 1F4HA 1OGGA 1XCWA 5AY7A 1PZ3A 3W4RA 1V6XA 3EMCA 2WLYA 1I1XA 3U5UA 1FA2A 1H0GA 4BS0A 1V6UA 3NDYA 4CD7A 3TTYA 5EBAA 2W4XA 4CKQA 1J9YA 1EH9A 1JIBA 4P7RA 1LQ0A 1U33A 2ZUSA 2CBUA 4B15A 3RJYA 2X0YA 4A3HA 3AXIA 2ZUNA 1MFVA 3O6AA 2CERA 2F2HA 1GVYA 2ZOXA 4J3XA 3DHUA 5CQ1A 4LYQA 2VMFA 4JFVA 3L4XA 3PTKA 5FD0A 1M03A 2VX5A 3UR8A 3ZJ6A 1ISWA 5FL1A 1QHZA 4AYSA 1VF8A 2X1IA 1UR9A 6CGTA 4HTYA 2XUCA 1OB0A 1JD7A 1EOMA 3OLEA 4Q7NA 1BHGA 3PZTA 1E6XM 5HDRA 1UYQA 2J7BA 2BY0A 2ZX8A 4D6HA 4JFSA 1WKYA 1GQKA 4GPNA 1VRXA 2EPOA 4P8UA 5F7UA 2PC8A 3OGSA 3AIQA 4S3KA 1V08A 3MV11 3OIHA 3K8MA 2YBTA 5I79A 1JI1A 1UD2A 4PMXA 5TD4A 1TG7A 1FP8A 2WK2A 1EA9C 2V3GA 2CEQA 2WHJA 4E2OA 1WDSA 1DWIM 2DGAA 4U5KA 4WK9A 2UWFA 2VX7A 3PZQA 1AMYA 2Y8VA 3PZGA 1EQCA 2QHAA 3DYMA 3VNYA 3F5LA 3LPPA 3WQ4A 1V0KA 1PEZA 1LJYA 1B0IA 2VQTA 4GI9A 4ML4A 3HMCA 1CXFA 1UKTA 4MB4A 3AMDA 4OUEA 1UR8A 1V3KA 2VL4A 2WC3A 4N0RA 3WUBA 2VNCA 3L4WA 2WMJA 4UNIA 3WNNA 3LPGA 1KBKA 2DSUA 4WSKA 4UQ9A 3RMEA 3CUJA 1HIZA 3GBDA 4UFJA 1Y7VA 2GSJA 3SCUA 8A3HA 3WD1A 4AD5A 7TAAA 3ARSA 2ZWYA 1EQPA 1C7TA 1GOIA 3CZKA 1CGUA 1TUXA 3AHXA 5CZKA 1UWQA 4KRTA 4Y7EA 1BAGA 3ZSSA 3K4AA 2J7GA 4PMYA 1KCKA 2X09A 1HP5A 2VVNA 4AZGA 1C8XA 5CG0A 2CKRA 2ESCA 3WF4A 3FHQA 5HOSA 3W38A 1C8QA 4OJYA 4ZEPA 3G6LA 4ATDA 1TZ7A 5D9NA 3PBGA 4H41A 5EFDA 3OBAA 3MUIA 2FGZA 4AZ6A 3RIKA 3MUZ1 1WE5A 4BQ2A 2G3JA 1GVIA 1RD6A 3WKZA 1ZBKA 2VRQA 4BZYA 1BG9A 2WBGA 4AEEA 3ZQ9A 4GI8A 3PZVA 4CGTA 3IANA 1SFSA 4BCEA 3VX0A 2BY1A 3ARXA 1TCMA 4LXFA 4CD8A 3BC9A 1OM0A 3KE0A 3SCWA 1WZAA 2VR5A 1BGGA 4EK7A 1C7SA 2YDQA 3OLDA 3JUGA 4JKMA 2O9PA 3BGAA 4R5EA 1K6AA 3VGBA 3QHOA 1OSEA 1UD8A 4AY1A 4ZE4A 4AIOA 3WN6A 3S2CA 1J10A 1HXJA 2DH2A 4F9DA 1NP0A 4PSPA 5A3HA 5EMYA 5I3DA 3KZSA 4LPCA 3UCQA 4HA1A 2WZEA 2J7DA 4CU8A 1MQRA 1JXJA 2YL5A 4BQ5A 3ECQA 1E6RA 4Z2IA 1H3GA 2BY2A 3SIMA 4A3YA 5I24A 3AS2A 1JD9A 5IXEA 2JEPA 3MUAA 2WSPA 2CPUA 4S3JA 5CXPA 4QDMA 4GQQA 4YHEA 1V6YA 3AXXA 1EHAA 1J0JA 1WP6A 1E6PA 2G3NA 1XV8A 3QHMA 5A6KA 1ECEA 1W32A 3BSGA 1H5VA 3SCNA 3APGA 4EANA 1XD0A 3BLPX 3W6LA 4GZIA 1OT1A 1JXKA 1WZMA 2WVSA 2TAAA 1OT2A 5E6ZA 4W7WA 1W2PA 2D3LA 2E9BA 1JDCA 2VZOA 4PYSA 1R7OA 4UQCA 1CXLA 1NOFA 2VCCA 1B31A 1KXQA 1R7AA 3WD0A 3B9AA 2W5FA 1MXGA 1X1NA 1DWAM 3AIWA 4AZCB 3CZEA 1QBBA 3K8KA 1XSJA 3NYDA 3W6MA 3PN8A 1WZKA 4J7RA 1LL7A 3IAQA 4AEFA 7A3HA 3EBVA 1CXHA 3VIGA 2W62A 4JKKA 3L4VA 1PIGA 1MVYA 3PHAA 3AHVA 4DWSA 2W67A 1Q6CA 2NT1A 5GNZA 1BYBA 2PWFA 4V2XA 2FHCA 3VGEA 3RILA 1FHDA 3AS3A 1V0MA 3GXMA 3CMGA 3LPOA 1C93A 1BYAA 1DEDA 1N82A 2CITA 1K9DA 3FN9A 1TA3A 4J3SA 3VINA 4UCFA 5GNYA 4OKDA 3WDQA 1BGAA 2Z1KA 1HP4A 3EDDA 1E3XA 3OGRA 2J77A 1IT0A 3VKKA 2ZWZA 2CBIA 3D3AA 3MMUA 3AMLA 2EPMX 4TX8A 5HXMA 3AYSA 3M46A 1V3LA 4D1JA 2XWEA 5E70A 1EOKA 3LMYA 1XH2A 3AMKA 3GTNA 4L4PA 4CCEA 5GPRA 1CGTA 1JZ3A 2B31A 1HF6A 1JDAA 2J7FA 2DDXA 4M8UA 3SUSA 1DHKA 3GXFA 1HVQA 3OB8A 3BXWA 1GOQA 3WELA 4W8LA 2YA0A 4QLJA 2OSYA 3TTQA 1XGZA 4F66A 1R8LA 1XYZA 4J27A 3K4DA 4F8XA 3AZRA 4TX6A 4U3CA 4L4OA 3VD5A 3TP4A 2FDMA 1E70M 3SCSA 1WDRA 1GW1A 1B3VA 3CZGA 3AZTA 2JIWA 4PRWA 4B16A 1UWRA 5E0CA 3A3HA 1E15A 4KRUA 1HJWA 5CJ5A 5DO8A 4ZXOA 5CPQA 2PF0A 1KR0A 3K46A 4UFKA 3FHAA 1M53A 1QW8A 1HL9A 1F4AA 2VCBA 3SURA 3WQ6A 1HKJA 2W63A 3T2PA 3DC0A 3WQ8A 1TVNA 4PMRA 2VOTA 4B9YA 1ZL1A 3I3BA 2CESA 1J11A 4U2ZA 2OYLA 1MQQA 2ZUUA 1E4NA 3U57A 2QMKA 1CXEA 2AAAA 2WKLA 5HNNA 1P6WA 3KL5A 1UD5A 2WANA 4DWSB 4JCLA 3VUPA 4H8HA 1GQLA 3CHEA 4UOQA 3RM4A 3EDKA 1JGIA 5I23A 4UZSA 1ZU8A 4AIEA 1WO2A 1OCQA 5D9OA 1NWRA 2FH8A 1V02A 1X6LA 1QNSA 3T2QA 5BCAA 2XM2A 3ZMRA 2NSXA 4H8UA 2VTFA 5AC4A 1PX3A 2W61A 3W53A 3A4WA 1E0VA 1SMAA 1KGUA 3BMVA 3QHNA 4MNKA 1ZBVA 2WVUA 3KEHA 2YDRA 3D5HA 6TAAA 4WF7A 1LWJA 4CD4A 1UOKA 2F61A 5D9PA 1ITCA 1JNEA 1US3A 1VJZA 2XSAA 2VT0A 4Q22A 3VO0A 2WHKA 3A4AA 1RPKA 1CGXA 2CBVA 4QFUA 4MAZA 3NJ3A 1JYNA 1K9FA 3SEPA 5ABHA 1FH7A 3U7BA 3VIMA 2VZSA 3MV01 3AJ7A 7CGTA 1GZJA 1L8NA 4HOZA 1JL8A 1UZ4A 3VD9A 4AC1X 3PTMA 1XC6A 4YN5A 1J18A 3SCRA 3ARUA 3VGDA 3AS1A 1ZJBA 2UY2A 1CLXA 3CIVA 4ACZA 1JZ5A 5D4YA 1WNOA 1NOWA 3WD4A 5JBFA 1WAWA 2D24A 1MQPA 5BXSA 1TE1A 9CGTA 2BXYA 2F8QA 3WFLA 4AZBA 2HVMA 1E5JA 1W9BM 2D23A 2WZHA 3M7SA 1GQIA 2FH6A 4GZEA 4TOQA 5EB8A 1ZS2A 1UUQA 1C92A 3IJ9A 4HMDA 3ZOAA 4GINA 2EPLX 4BA0A 2GDUA 2Z1SA 3ZJ7A 1NWUA 1V6VA 4IPLA 4PMUA 1JF6A 1JYVA 5E6YA 2GVYA 4UOJA 2JF6A 1Q6DA 4PTVA 2DT0A 2PB1A 1H4PA 4NRRA 1H2JA 1E9LA 2D0GA 3N15A 4E8DA 4IISA 2J7HA 2V3EA 3VDCA 3WEOA 3DECA 2VRKA 4LQ1A 4QAWA 4ACYA 5D8ZA 1UR4A 3GH5A 1W1YA 3B9DA 1QNOA 2XJ7A 1UHVA 4GXPA 5FKYA 2DT2A 1FFQA 1UR1A 3N11A 2X2YA 5C71A 4Z2JA 3UG5A 2X05A 5ABFB 1H0IA 5CPSA 1E4IA 3EMZA 4TXEA 2YLAA 1E71M 1ISXA 2XFFA 2O9RA 4PCTA 5BXTA 3WDRA 2XGIA 1H49A 2GK1B 1V0NA 5BRPA 4HA4A 4C7GA 3ZT6A 2XIIA 3WD3A 3PZMA 1J01A 2C0HA 1B1YA 3AMCA 1XH0A 3L4UA 2ZX6A 1VFFA 3ZJKA 1SMDA 4AW7A 1GHRA 3NDZA 2OLHA 4M81A 1QW9A 1JZ8A 4TTUA 4M82A 1A3HA 4UTFA 1CXKA 3TONA 3VDAA 3L2LA 1KBBA 1YHTA 2YJQA 3W82A 1C90A 1E6SM 3ZM8A 4PMVA 4J3VA 3VD3A 2WCAA 4H7VA 2YBUA 3WNKA 3GZAA 5A1AA 4PUEA 5JIPA 2C7FA 1W9XA 3L4YA 2PWEA 1UWSA 4QCFA 3IJ7A 1E40A 4JL1A 1HJSA 3PZOA 2Y5EA 2DT3A 2C8NA 3AHTA 1LL6A 4J3TA 4ACZB 2E9MA 5BXPA 3W0KA 2ZXQA 5A6LA 4RE3A 3AS0A 3GDBA 1JNDA 1UA7A 3ARZA 5I77A 2WW5A 1GOOA 3VIFA 3VMOA 4Z2LA 2ZX7A 2XIBA 1G0CA 1GONA 4HMEA 1QI5A 3AZSA 3GNOA 3AIVA 4AZ5A 2UY4A 4CU6A 4MADA 4A4AA 3L4TA 2Q8XA 4HZ7A 3VMNA 5A6AA 4AZCA 4W7UA 3WF3A 4XZWA 4MNLA 2J7EA 2JIEA 1WPCA 1ISVA 3M6DA 1GUVA 2WMFA 1J12A 4P7QA 2WBKA 1HKIA 4W8BA 1KGXA 2D22A 4J28A 4GO8A 4HPGA 4AD0A 1W1PA 4CVWA 4MAVA 2XWDA 4WKHA 3O9NA 3MS8A 5M03A 4Z2GA 4P7OA 4FLSA 2WMKA 4C7DA 1G9HA 4PSRA 2YDSA 2CBJA 2MANA 1UH3A 1E6QM 4R27A 1XHGA 3GNPA 3WY1A 2E40A 1Z32X 2WHLA 3BCDA 3GNRA 3OA5A 3IK2A 5BRQA 4DWSD 4PUDA 2V3FA 1W1TA 1BG4A 2CCRA 3VDHA 3N13A 4WKAA 4H04A 1LG1A 2QF8A 3ARWA 5LA1A 4AD3A 1D3CA 3ARTA 3WDHA 1W9UA 5FOOA 1U2YA 3A47A 2WVTA 4URIA 5GNXA 1E1EA 4PMDA 2CYGA 4W7VA 2J62A 3K1DA 1WB0A 1HJXA 2WMIA 3MMWA 2GDVA 2WWDA 3WBAA 2J4GA 4DWSC 2OYMA 4MPKA 1U30A 1E0WA 1HJQA 5A8MA 1HJUA 4P8VA 4JIEA 1VIWA 2QV4A 4HU0A 4RL3A 1GCYA 1JF5A 1W9DM 2J79A 4FK9A 2V5CA 1ESWA 3CBWA 3S6TA 1NWTA 4PMNA 3WF2A 1QI0A 3VGHA 3F5KA 1V03A 5HBFA 3MKKA 5EFFA 1CNVA 2W92A 1WZLA 1ITXA 2VX4A 3DHPA 4EKJA 3K8LA 3AI0A 1UH4A 1KXTA 3WEMA 1K9EA 1AQMA 4E4PA 3BH4A 4PTWA 4PEEA 2WLZA 3VIIA 1UWUA 3WNPA 3QR3A 4NSBA 1CBGA 2YL6A 4AD1A 1O7AA 5E0FA 1JZ7A 2GJPA 2WKGA 4D6DA 2VZUA 5A2AA 5A2CA 5I5RA 2EQDA 3GXIA 3WUEA 4N42A 4PMOA 2VO5A 3TTOA 4OZOA 1L0PA 1EO5A 3ZT7A 3A4XA 2BVYA 3VIPA 4D6FA 5A8PA 1B30A 1VAHA 2CIPA 4KMQA 1BFNA 1LL4A 2G3MA 3WQ5A 1CWYA 3ZIZA 1JYXA 1FH9A 3NUKA 2A3HA 3VIJA 2WMGA 1GJWA 4C7FA 4NRSA 1FP9A 2OYKA 4AD2A 3WQVA 1VENA 1MYRA 1TFVA 4HOXA 1JAEA 4DUVA 3ALFA 3QOKA 2ZICA 2A3EA 3KWXA 1EDQA 4ZFMA 3T0AA 3WBEA 2FHBA 2JFEX 4XX6A 1XRVA 2WZIA 4AMCA 4CU7A 3MANA 4FLOA 1KWKA 2XYLA 3RO8A 2WPGA 3O2LA 3CHCA 2WNWA 5AYBA 1C91A 2BNJA 4HOWA 1UG6A 3CO4A 2J7CA 4Z2KA 1B3ZA 3CLWA 1W91A 1CECA 2BFGA 1KXHA 3CZJA 1CIUA 4AD4A 4LGXA 4TTGA 4MDOA 4RE4A 3IJ8A 3RCNA 3AIEA 4U5IA 1NARA 1E0XA 2ZXAA 2WMIB 1XCXA 1R86A 4AZ7A 2EO7A 4HP5A 1GORA 1XD1A 2CNCA 4X0VA 3VM5A 4AIUA 1PX8A 1UD6A 5A6MA 3ZO9A 4M24A 5HPCA 2WC4A 1HVXA 3FXYA 2J8GA 1VJSA 5DFAA 5A2BA 3FW6A 2PWDA 2NW0A 2E9LA 1CGYA 5LYRA 1KCLA 2DIJA 4UQAA 4X0NA 2QPSA 4W5UA 1EDTA 1GOMA 2CETA 4GI6A 1CLVA 3UETA 4AWEA 3ZJ8A 1OD8A 3GH4A 1QHOA 3U7VA 5CLTA 4EE9A 2BHZA 1J0KA 4HA3A 4HZ8A 3PTQA 1Q4NX 4MTVA 4UFIA 2HISA 2ZXDA 3MO4A 2EJ1A 1HL8A 2UY5A 3EDJA 2G4FA 1QOXA 4KH2A 3VVGA 1BQCA 1WDPA 4W93A 3F5JA 2RGLA 4QLKA 1W9PA 1E4MM 2XVNA 2J75A 2W66A 1E43A 2WC7A 3RM9A 5A6BA 4P8WA 1UD4A 3WNMA 1XSIA 4GIAA 2Y2WA 4DM1A 1V3IA 1CYGA 2G3IA 2XVLA 3FY1A 1CPUA 2BY3A 2DIEA 3WQWA 4AZIA 2Y4SA 3VIHA 4GKLA 1EGZA 5JBEA 4W5ZA 3SCVA 1BF2A 4ZE5A 1QI2A 2BHYA 3VD4A 3KL0A 1CDGA 1AQ0A 1J0ZA 1TR1A 5ABFA 4JKLA 4D6JA 4PN2A 3U5YA 2WWCA 3PZIA 5I6SA 5A6SA 2WVVB 1X6NA 1UZ1A 2DPEA 2GK1A 2VCAA 3WMBA 4F9JA 4HPHA 2ZIDA 4ATLA 2VI0A 1PBGA 3THDA 1GNXA 3MSGA 1GOWA 3ARRA 3IAPA 3WMSA 3LPFA 4AZHA 1OGBA 1OIMA 3SCPA 2IXVA 4D6CA 3OG2A 3EDEA 1V3JA 2AOSA 2OWWA 3WL0A
chains in the Genus database with same CATH superfamily
3GXDA 4RX0A 1DQWA 1YXCA 2J6VA 3AYTA 3VKJA 2GDQA 4RW3A 3ATYA 1H7RA 3TKFA 2YYUA 3UPMA 2PBOA 1U5VA 4HNNA 1W1A1 2DSZA 5IHRA 1J6PA 1J0HA 1HKKA 5LNSA 4HPNA 3VYLA 2RGMA 5XIAA 2A5HA 1RA0A 2V9DA 3GVVA 5GJNA 1XLEA 4H2CA 1A3WA 5FCZA 3K4WA 4YWSA 5I03A 1R3VA 2QNEA 3IVUA 4KCUA 3OQ8A 2ZUTA 3IIZA 2WJZA 3C2YA 4M29A 3ZR6A 3NSXA 1QNRA 4P8XA 1OD0A 1A49A 4DJEA 4O53A 1AVAA 3GIYA 5PTDA 3MSYA 2CLEA 1KTNA 1JPIA 2IPFA 1OFOA 3GYCA 1QW7A 4IIDA 1EWEA 2P5NA 1ODUA 4PTMA 4BHYA 4WOZA 2E8ZA 4TV6A 1RBAA 3T7VA 1GJUA 3K13A 2OKOA 3DI0A 3ZR5A 1OF8A 1C3FA 1DTNA 3KCOA 4FOUA 1SO4A 4MOZA 2QCGA 4ZODA 3EPMA 5HMFA 1ZJAA 3CPUA 1XIDA 1OY0A 4DUXA 2QLYA 4HPJA 1FWAC 5JUVA 1YQ2A 3KTSA 4XB3A 1US0A 3ABXA 3GDRA 4CN1A 2YCKX 2YOCA 1NQ6A 3N25A 5FSDC 2FGLA 3UR2A 9XIAA 1MSSA 1IEIA 2P0IA 1DJQA 1OQFA 1FOBA 1DWJM 1H1NA 5DXYA 1GK8A 3AWNA 3P82A 2H6RA 4MNMA 3TU9A 5BXRA 3SCOA 3ITTA 2VX6A 4DAFA 3S5NA 2Z27A 1UWTA 3UFYA 2CKSA 4JNMA 3CQKA 1IIGA 5AHIA 3BAJA 3HU7A 1ODZA 5FL0A 4L5ZA 1BSIA 2D69A 1ZJIA 2VEMA 3QOMA 4D6IA 4ROQA 4M56A 4EWJA 3VIKA 3NGFA 1PYFA 5T9CE 3EKZA 1TJ0A 1F5ZA 4FXRA 3SQMA 3L5LA 3OJGA 4RK8A 1KGWA 2GWGA 1FHLA 3TLQA 5HQLA 5FJRA 2RAGA 3SSZA 2FZNA 4AB4A 3GR8A 4N6FA 1RK5A 1GKPA 3WK1A 1VEOA 5HWNA 1NFBA 3EPOA 1U22A 5D2TA 1QVBA 5C6MA 3VUSA 3G22A 3MHUA 3CXOA 3AOFA 8RUCA 2A3CA 1H50A 5EMLA 1K8XA 3SN4A 1FUYA 1OINA 3GG0A 1MXSA 1G67A 1XINA 1GKRA 2QPUA 2Z29A 4AH7A 1TVLA 5DT7A 5A6JA 3PY2A 1F3TA 4MG4A 1D7FA 2G4JA 4CN6A 3P81A 3B8VA 1V02E 2EXOA 3KDOA 3ZR4A 2XIOA 1H7XA 4CVUA 5DT5A 2HDJA 2GUBA 2Y7DA 4B3LA 1SFJA 2XH7A 2NT0A 5ABGA 4D6GA 1BYCA 1E1FA 1V0LA 1B90A 4IG2A 3TN3A 1EJ7L 3N3MA 1YIXA 4K7YA 1UJPA 4UFLA 1BPLB 5DBUA 2EBNA 4V28A 3PNZA 1UP0A 4S3FA 4ZBCA 3UY7A 2PDLA 3EMQA 1O4UA 1UKQA 3AXKA 2G41A 4WKFA 3AUJA 1KFBA 4WLCA 5I78A 1W5OA 4QLLA 3WH9A 1UQYA 2FB3A 3HQNA 3OG3A 1MFUA 3LTSA 1W3TA 4JTUA 4O8RA 4CQCA 4PGLA 4NHVA 3TC3A 1JCYA 1I45A 3UESA 2V69A 4JTIA 3NNTA 4TVCA 9XIMA 3M5VA 3NVDA 1W3JA 2GGGA 4LRTA 2YYTA 4E8CA 3DUGA 1MUMA 3IIOA 4Q8OA 2BODX 3KFTA 4C6FA 1KB3A 4O0ZA 1UR0A 3ITCA 3OA3A 4WIWA 3UERA 2Z7GA 5HULA 2IPGA 3G18A 3NIYA 1JZ6A 4U4MA 3R0DA 5JBDA 3G1RA 4OOUA 3EGJA 2QJGA 3SY1A 4LC8A 3LB0A 1PKMA 3AQUA 4DNHA 3H4WA 4JZ5A 4DO5A 4F3HA 5AC6A 2J78A 4GYJA 4IM4A 5D37A 4UTHA 3N9KA 4AVNA 1DJWA 1TPB1 3HN3A 4EVZA 3AIRA 1D3GA 3W2NA 4DUWA 4E3VA 5KZMA 1A5BA 3TK7A 1LQ2A 1TPFA 4NASA 5I3IA 2V38A 2P3ZA 1N8FA 2D3NA 3M07A 3R12A 5G2IA 4XZLX 3FKRA 4XD4A 5IFTA 3NL6A 1M41A 4YMZA 3N4FA 6XIAA 4OQVA 4GI4A 3KCLA 1POJA 2VEIA 1OK6A 4DQWA 1JEZA 1QPOA 7REQB 1SFTA 3L23A 5FEXA 3L0KA 4JL2A 4BEQA 1MI3A 2PU0A 3TA9A 5CGMA 1YDNA 3N34A 2PLCA 2PBGA 5C9ZA 4PCSA 3GHUA 1MUCA 5AN7A 1KCZA 2VDHA 1BRLB 3AUOA 4GUGA 1VPYA 5BOEA 3N6HA 4KEVA 4YL2A 2PWGA 4FXSA 4XZBA 1C9WA 4UR9A 2WMHA 4JQ2A 3C8FA 3QMSA 3E38A 3KHJA 3NCOA 4Y90A 2V3DA 2B7PA 3BAIA 4CQDA 3UP8A 4M80A 2W91A 4BQ3A 2P76A 5D8WA 4U3AA 1FFRA 5DY2A 1XBZA 4M6VA 1XYMA 1OGSA 3ZLGA 3M0KA 3SFWA 1OFQA 3OIXA 3FAWA 1TTQA 1WKFA 4TVDA 2WSQA 1MEIA 3GC4A 3FSTA 3A5VA 4NJGA 4XAGA 5CLWA 5HR6A 3SECA 1NOUA 3WENA 3ICJA 1UPMB 4LTSA 3STPA 1VFOA 4JX4A 4J35A 4K1WA 1E9ZB 1Z8AA 3CH9A 1LBFA 1KXVA 2A6NA 4Z1DA 2F84A 2H3BA 3M0JA 2MNRA 3W75A 2YCIX 4REQB 5IOBA 3EAUA 2XSBA 3INPA 4JTRA 5C0QA 3FYYA 4J5NA 1RA5A 4JICA 3OLIA 4CQBA 1KQYA 3Q45A 3HFTA 3FKKA 4MDPA 3DFHA 2NQ9A 3BCFA 4B9ZA 2YDAA 1X7IA 4OIFA 3SUUA 1M7XA 1X39A 5LA2A 3UR7A 4Z42C 1PSCA 3RDKA 2BHUA 4US5A 5EU9A 1TPVA 3RF9A 3THQA 1AFSA 3KLKA 3LQLA 4WJXA 1U5JA 3E0FA 1XG3A 3SY5A 2A85A 2WCSA 3VGFA 3F4DA 2ON3A 1JG9A 2GUYA 2VUYA 5FF7A 2XM1A 4JFTA 2BSLA 4DEFA 2QCLA 4S23A 4UFMA 1SO3A 2VGBA 1BWVA 3QGVA 4LAZA 1VBHA 1RBLA 2YIHA 3G1YA 1EP1A 4AHOA 3VM7A 4HMCA 4H6QA 3HGOA 2YL9A 2C19A 1JFHA 3KW3A 2O55A 1P6CA 4W87A 2A7PA 2WSKA 2BV9A 7ENLA 1YYAA 3P5YA 4OGZA 1DWGM 3G0XA 1EP3A 3UPWA 2NQLA 4WD0A 2PRLA 3TMQA 5BYWA 1A5NC 4P7NA 3NO1A 1Y5VA 5CPNA 3OBEA 1O95A 5DELA 3PZ9A 3L4ZA 3LRLA 2Y62A 1TPEA 1MMFA 1PZ3A 3QM3A 3EXSA 3D47A 1FA2A 3UD6A 1XFCA 4NJIA 1KFJA 3NDYA 3LDVA 3KOYA 1M3UA 3TTYA 5EBAA 4QSHA 4CKQA 4QJ4B 2ZA1A 1K8YA 5BMXA 2BWGA 5I06A 3CL8A 3W1TA 4R3UA 1Z69A 1RVKA 1LQ0A 1L6GA 1HKVA 1TWWA 2CBUA 1FVPA 4FNUA 4YVVA 3RJYA 3O6AA 5J04A 2F2HA 1GVYA 1WXJA 1XUZA 1OJXA 4EX4A 4MSSA 4JFVA 4L1WA 3L4XA 3LXCA 1FDYA 1W54A 2J6XA 5CSRA 3LHVA 5FD0A 3TCEA 1M03A 4R34A 3ZJ6A 3NL5A 1W8GA 2PGEA 1XDJA 3GFYA 2PDWA 4FR1A 3WK0A 4GFSA 1VKFA 4JY9A 5CPLA 1M7JA 1WKYA 1BXBA 2EPOA 3IJ6A 1OADA 3WQCA 2PC8A 2PWUA 1Y8BA 4HSNA 1XLLA 3BG3A 1ZHAA 4QJ1A 4JYEA 2YBTA 3FJLA 5I79A 5F2LA 3FLUA 2XIMA 2NZLA 5C5YA 1KC7A 5E9XA 1ITUA 3H21A 4UCGA 1K7XA 1TJ2A 1EA9C 1TV3A 4E2OA 4U5KA 4HIBA 2VX7A 3B05A 4HT3A 4ZGYA 1RV8A 1AMYA 2QHAA 3S5YA 4DO6A 1KFKA 4RXFA 1M68A 2GUUA 1LJYA 3Q4DA 3KDNA 3LOTA 3HMCA 3B03A 1UKTA 2HV5A 3AMDA 1A0EA 3P14A 4A8NA 5I7GA 4OUEA 2VL4A 2WC3A 3MCMA 2QCMA 4KCWA 1KBKA 1SJCA 3PUDA 4HD5A 1WV2A 4ZCWA 4MUPA 4UIOA 8A3HA 5TF0A 3WD1A 4WR3A 4AD5A 7TAAA 2REQB 4GE8A 3NGJA 1CGUA 1KLZA 3SDOA 4RR4A 1YTEA 4MZ8A 4QHRA 1VHNA 3AHXA 4PC8A 5CZKA 5K9DA 4Y7EA 5CBBA 3M0IA 1NFPA 3K4AA 3QH2A 2J7GA 4PMYA 3GKFA 3GHTA 3NQEA 2TYSA 2VVNA 4AX6A 1DJZA 1C8XA 1AW1A 3V7PA 2QYGA 4N9DA 4QM1A 2ESCA 4AWSA 3FHQA 1AW2A 1F76A 4JBRA 4GC3A 4QE5A 2V5LA 4AZ6A 4E4FA 1AMKA 2GJNA 4BQ2A 1XYAA 1RD6A 3PBMA 2VRQA 2NQJA 4BZYA 3LCWA 4GI8A 4CGTA 1QCWA 4CQ9A 1SFSA 1H60A 4BCEA 3VX0A 3E02A 3ZLHA 4LXFA 3N2OA 4BF9A 1OM0A 4GIEA 4AFYA 1Q4WA 4EIVA 1WZAA 5EY5A 1BGGA 2OT0A 1UP3A 2VDIA 2PTYA 1XLFA 4R5EA 1K6AA 4GUJA 3QHOA 1UD8A 4AY1A 4AIOA 3WN6A 2OQYA 4KF1A 3IK4A 1NP0A 4EPBC 2R1NA 3MUXA 3P84A 4BEUA 1VZWA 2GVGA 1OG6A 3V5FA 5G4HC 4LCQA 5LNUA 2PRHA 1MQRA 1JXJA 1XLIA 3GG7A 1QPNA 4Z2IA 1JPKA 3SIMA 5I24A 3AAMA 5AYZA 2JEPA 3UYIA 1OHLA 3ITYA 3EZ4A 1ME8A 3PBWA 2ZRZA 4GQQA 1V6YA 3G8EA 3MA8A 3V3WA 4AF0A 2X2GA 4KFOA 2G3NA 1XV8A 3CIWA 3QHMA 4ICMA 4G8TA 5HA7A 5AOUA 1XD0A 3CQ0A 2PDNA 4UTLA 4G6CA 3GIPA 4KESA 3TFCA 3C4UA 3LGEA 3O6CA 2WVSA 1QOQA 1PUDA 3P0XA 2QV5A 2WZTA 1CXLA 5CJNA 1F6YA 4L61A 2W5FA 4Q4RA 4AZCB 3PJUA 1LL7A 3IAQA 4AEFA 3ZLFA 3EBVA 1ADOA 5FJOA 3L4VA 2F6UA 3QRHA 3S5OA 1CLKA 4HVXA 2FHCA 4F2UA 3RILA 3AS3A 3GW0A 1BKSA 3CMGA 4HNCA 2ABBA 3G1AA 1BYAA 2CITA 1JDEA 2IPJA 2TMDA 1SUXA 3FN9A 2DIKA 3VINA 1XC4A 2Q01A 4LVGA 3APYA 3VK5A 4O19A 2C3ZA 4GABA 1G4EA 4LAOA 4XK2A 1F2JA 3VCNA 3LV5A 3MMUA 1HO1A 5HXMA 1Q85A 4D1JA 1EOKA 4S3EA 3T0TA 3LSCA 4GMEA 3AMKA 3GTNA 2IKIA 1GTHA 4JTDA 4YTRA 1EPXA 3GW3A 5E1QA 3SUSA 1DHKA 3BXWA 3QYQA 2OSYA 4Y8FA 3SGUA 4NX0A 4JIRA 3K4DA 2F38A 1MEHA 4I7WA 4IJBA 4M6QA 4A3RA 1QMLA 1GKQA 1DQUA 2Z28A 3VC6A 1B54A 4KIEA 4PRWA 3U9IA 1GVEA 4GNVA 4YTTA 5E0CA 1ME9A 4ZXOA 4XWUA 2PF0A 4XIMA 3CYJA 4AY8A 2QJHA 5HR7A 4UFKA 5KSWA 2V2HA 1C9DA 1F4AA 2VCBA 3SURA 1HKJA 2AQOA 1TVNA 3W1LA 4ZL1A 4OV4A 4O28A 2DZSA 2INFA 3Q37A 3MHFA 1KV8A 2PSNA 3U57A 2AAAA 2WKLA 3HA1A 1I9CB 3B9OA 1NVMA 2ZFAA 5T9BG 2WANA 1S2TA 2YSWA 4X63A 4HJWA 3A21A 4Y6GA 3CHEA 4UOQA 3UVIA 1R9YA 4R33A 3QZ6A 3RM4A 2P0OA 3EDKA 1JGIA 4B92A 3H53A 1ZU8A 4Q8VA 4R7JA 4AIEA 1WO2A 1NWRA 4DPQA 1XICA 3SR7A 3T2QA 4NAFB 1XI3A 2XM2A 3C2FA 4OT7A 4QEHA 2VTFA 4Y9NA 1EJUC 3KWSA 1EX5A 2ATMA 1NTHA 5C54A 1ZBVA 4NZJA 3ES7A 1KBJA 3D5HA 3DGRA 1MRQA 1KBIA 1UOKA 2F61A 4BR1A 5D9PA 1ITCA 3LSBA 2QQ6A 3G3DA 3FV9A 2B7QA 1CGXA 4JGDA 1D8CA 4PCFA 2VZSA 3MV01 1U83A 3GLCA 2E09A 4P2VA 3LHZA 4AC1X 4YN5A 1J18A 4RKAA 3VGDA 1W6TA 2V5JA 1ZJBA 2UY2A 2G3FA 1CLXA 4S3GA 1OFRA 2VGFA 3Q65A 1WAWA 3KTXA 1MQPA 4WOQA 1TE1A 2BXYA 4AZBA 2VR2A 3SRDA 4GNJA 3CIXA 4IXXA 4A2RA 3FX4A 2FH6A 4BWLC 1VCVA 5XIMA 4TOQA 2GSEA 3MWCA 3B0VC 1ZS2A 1UUQA 3JS3A 1TMHA 3IJ9A 2X1SA 3I7SA 4BA0A 3C2EA 2FFIA 1VYSX 4Y96A 3HPSA 4HNVA 1NWUA 1V6VA 1JF6A 4GQ0A 1JYVA 3E74A 4XZMX 4FZIA 5E6YA 5CG7A 2QS8A 4A2SA 2DT0A 1K8ZA 1H2JA 1E9LA 3W7LA 2NVDA 2A6LA 1WOAA 2D0GA 2ZQ0A 3N15A 2J7HA 2V3EA 4IISA 4LRSA 4E8DA 3TC7A 3WEOA 4ACYA 3E49A 5FSEC 1UR4A 3GH5A 4ADTA 3VAVA 3V75A 3PG9A 3NEHA 4K2SA 5FKYA 1UR1A 3N11A 1A53A 3RGTA 4Z2JA 2GJLA 5CPSA 1ITQA 2POTA 4TXEA 3ABOA 4EXAA 1ISXA 1JULA 2XFFA 1Q5MA 1DIKA 1FDJA 1V0NA 3W7OA 4C7GA 5K3VA 1J01A 4JX6A 2Y1HA 1NU5A 1K3UA 3WQOA 3ZJKA 4FNTA 5G2WA 3EWBX 3TYZA 5RUBA 2G37A 5HMEA 4KEUA 4M81A 1JZ8A 4TTUA 2I5IA 2OEKA 3GO2A 4O52A 4F2BA 3L2LA 3ZYZA 1VPXA 4WGHA 3M7WA 1C90A 3GAKA 3NM3A 4PB5A 1V6TA 4O10A 4H7VA 3GZAA 1KO0A 4A22A 1P5BA 1TQXA 4O12A 1UWSA 5D03A 3GXPA 3IJ7A 1E40A 2V8ZA 4KBXA 3PZOA 1UPPA 1LL6A 2FTYA 1EJSC 3W0KA 5BXPA 4I5UA 4DJFD 1SR9A 5F2MA 3B97A 2PCQA 4GXWA 1ZY9A 5I77A 4ERIA 3WBXA 3KAOA 4HMEA 3I10A 4XD5A 1GEHA 4CU6A 4MADA 4A4AA 3FVDA 4HZ7A 3VMNA 5DRIA 3MPGA 3M1ZA 4HU3A 3D0CA 2WMFA 1XPYA 3E6EA 1PO9A 2WBKA 4QIUA 4W8BA 1IGSA 3IEBA 2Y5JA 1W1PA 4ONVA 2XWDA 3OVQA 4WKHA 4B5TA 3O9NA 2PD5A 3G24A 1KCXA 4FLSA 4NXSA 3SY8A 4ORMA 4C7DA 1XM3A 4O1DA 1UMLA 3QFWA 1UH3A 1VYRA 3OVGA 4HNOA 1DIEA 3QF0A 4GUIA 2BVWA 3EEGA 2GOKA 3GNRA 3HG2A 4GRSA 1FWCC 4GUHA 3RN6A 2V3FA 3CL7A 1W1TA 2NLIA 1BG4A 2CCRA 4F48A 3N13A 1IWAA 3CB3A 3QV6A 1LG1A 3ARWA 5LA1A 1JUEA 4AD3A 2CLFA 1E1CA 4HNLA 4CCZA 3HF3A 5EBUA 5FOOA 4JDBA 1I2RA 1U2YA 4URIA 2X7WA 1E1EA 1XQKA 2PS2A 1U5HA 3FYOA 1HJXA 2V2CA 3E12A 4GYPC 3TNBA 1U30A 1E0WA 4O54A 4IP7A 2QV4A 3LA4A 4RL3A 4BI5A 4YU1A 5AVNA 1F61A 2I56A 4FK9A 3USZA 1QI0A 3EA2A 4N02A 5HBFA 2RDTA 1SU5A 3MKKA 5EFFA 2OZ8A 4A8RA 3FJ4A 4NJKA 1WZLA 1ITXA 3TWBA 2C1IA 4INFA 1UH4A 4KKXA 3A23A 1K9EA 4B4HA 2F7FA 3RCYA 3W1RA 2FB2A 1T6MA 3I7QA 2WLZA 4RV3A 2FJUB 3WNPA 4JTGA 5EA9A 2WKJA 4AD1A 3F03K 3OHMB 5ECVA 1MZRA 2GJPA 4TR9A 5A2AA 6XIMA 1PZ1A 5A2CA 2EQDA 4PMOA 3LERA 1I4NA 3TTOA 4L80A 3LHYA 1K02A 2VFHA 1L0PA 2VWSA 1O68A 3ZT7A 1YE4A 1D8WA 1J79A 1B30A 2DZPA 1VAHA 2CIPA 4ZSTA 4GK8A 1ADSA 1JYXA 3QPZA 3L66A 3R13A 1EJTC 1XIJA 1QXLA 4OVXA 2WMGA 3AC0A 4C7FA 4PE8A 2OYKA 4I9AA 3WQVA 1TFVA 3GTFA 4DUVA 3ATZA 1XGEA 3DZ1A 3NXLA 3WBEA 1ALDA 2JFEX 4C6LA 4IXHA 4AMCA 4CU7A 1IWPA 3RO8A 3O2LA 4K39A 3CHCA 1JCTA 5KITA 3H2FA 2BNJA 4JTEA 4ZB5A 1CECA 2BFGA 4TTGA 1WA3A 2B81A 5HJLA 1NARA 4RDVA 4KWOA 3HMJG 2BP1A 4IG2B 3PSWA 1R86A 2H3DA 4Q4OA 1GORA 1TX2A 1IIHA 1PX8A 2UV8G 2WC4A 2J8GA 2E9LA 3ZFHA 1LLWA 4UQAA 4NL1A 4GYKA 4X0NA 2CETA 1CLVA 4M0XA 4HN8A 3GH4A 1I2PA 1UUMA 2E77A 3N3TA 3TLLA 1J0KA 4HZ8A 1TJPA 4MTVA 4Y2WA 2EJ1A 1Q6RA 1QOXA 3VVGA 3GX9A 1WDPA 7TIMA 3PBUA 4W93A 3F5JA 3UWYA 1W9PA 1Q63A 1SGJA 1MUWA 1N2VA 1TE6A 2XVNA 2J75A 4P8WA 1UD4A 4GIAA 3PUGA 3QKZA 2BTMA 3T42A 3WQWA 2CFFA 2WSRA 4W5ZA 3SCVA 3MP5A 3KP1A 3GNXA 1WOBA 2VUNA 4LBUA 1J0ZA 4ZQOA 5ABFA 2ADAA 1TPWA 2PAJA 1I60A 2GK1A 1JRCA 2ZVRA 3VKCA 3TAKA 4QITA 1WXZA 2Z7KA 1AD4A 1DPMA 1GOWA 1YXDA 2QCEA 2NWRA 1OGBA 4ZOBA 3SCPA 2QIIA 2IXVA 4D6CA 3OG2A 3EDEA 2EKCA 2OWWA 3JZUA 5AHMA 2Y61A 3TQVA 2I5GA 5AHEA 2QZRA 2XVPA 2WXDM 4FOJA 4BY3A 4TO8A 4UR8A 3W28A 1VQTA 1MW3A 1R2TA 3PS7A 1Q6QA 1YDVA 4UTTC 1HN1A 4WJEA 2WYSA 1R85A 2CHNA 1G4TA 1W37A 4O4VA 2NQ5A 1KW1A 4KGJA 1IF2A 3WG6A 4MWAE 3NQ6A 1B3WA 2CLOA 4FR6A 3DXIA 1H7NA 4J3UA 3WD2A 1KRAC 1OBAA 2GGJA 4V1YA 4KPLA 1J6OA 1RP8A 1XIEA 2J25A 1JFXA 2IPWA 2YW3A 3UU0A 4I5RA 2BVDA 5LIYX 2FDSA 2ZRYA 2PUZA 3IGSA 3XISA 1VFUA 3VZYA 1UKSA 1MW1A 4WSHA 2FMNA 1SZGA 3QEZA 3R7MA 1I0DA 5K9XA 2P3EA 1QO5A 2YGYA 5DXXA 2PDKA 4AXNA 5CZTA 2J47A 1VFHA 3B4YA 4F0RA 2VRJA 1R0MA 4D72A 1H7PA 4UFHA 2G97A 4L64A 3OOQA 1WDWA 3S1GA 5FAGA 3MUY1 4BJHA 1BVWA 3W01A 1XDLA 1Q6GA 2VR4A 3FYPA 5BOOA 1RH9A 2G95A 4IGHA 1THFD 3A3XA 4FALA 5KZDA 3KOXA 3W74A 2X0HA 2OWXA 3RM8A 5I07A 2VEPA 3NXFA 2KAUC 4GGBA 3GVWA 3GM8A 5AZ1A 1R87A 2Z0IA 4U31A 2CU0A 3OZPA 2BGSA 2INEA 2DZWA 3OP2A 4Z1BA 3W88A 3I4KA 1IV8A 1YNPA 3M0HA 3P74A 4MJZA 2HK0A 3KBWA 2RHGA 3GNNA 2WHMA 4UQDA 3LZ5A 1T5AA 2O56A 3TN5A 1FHVA 1P0EA 3IGXA 1W5PA 5CPTA 4A05A 4F79A 4GCXA 3BZGA 2RJGA 2YL8A 4HA0A 4E8GA 3ARVA 2ZUVA 3OO2A 1UKPA 5DX7A 2DSKA 1KWGA 5BWFA 1WKEA 4N9BA 3V18A 3W1UA 5A8QA 3M16A 3I4EA 3SW6A 2XU2A 4KWUA 3S1XA 1FWFC 4V15A 3BAYA 4O17A 4LYPA 1XW8A 2QGHA 3QVQA 3ARPA 4DYEA 2ISWA 3NQFA 1VLWA 3PZUA 3NURA 4PH6A 3WNLA 2E1WA 1RJQA 4CCDA 2ICSA 3PANA 5EMKA 4KWVA 2WV8A 5LXXA 4UNLA 3QZAA 3C86A 3VKBA 2VURA 3N2MA 4LNYA 1Y0EA 1FWIC 1ZBCA 3W1MA 1H11A 1W9VA 4HCLA 3Q2DA 1RZMA 1W0MA 2DV0A 1HNYA 2D2JA 4WY0F 6PTDA 1NSJA 1BVNP 1W3LA 3LD5A 1QDSA 4D8AA 4HU8A 3A5FA 5LNRA 2GVJA 2OPJA 1LORA 4GVGA 3WSUA 2O9OA 5M17A 3KVMA 4W84A 3O05A 4DJFC 3VNDA 1MWOA 5HPOA 4YWIA 1FWJC 2I9UA 1FWGC 3S9ZA 3GU2A 1XP3A 4QP0A 2XG9A 2OEJA 4TV5A 2RKXA 4GH1A 4RW5A 5E09A 4WZHA 5K2ZA 1W2VA 3TUUA 1IXQA 3WDPP 1LYXA 2FZ9A 2YLLA 1XKJA 7REQA 1NM9A 3NZGA 4B3KA 4U2YA 4H6EA 3PZNA 2XTKA 4AWTA 4RE2A 1BRLA 2ZTKA 5REQB 4DZIA 3EKGA 1XYFA 3UEQA 3E2RA 3FVMA 4IGSA 3RPDA 3H4GA 1XLGA 4FLRA 2ASHA 1PZ2A 5TQLA 4YCPA 4LUSA 4DBUA 3UXLA 3MTWA 1J4EA 1Q2RA 5HWMA 2OX1A 1FH8A 2D0HA 1IXPA 1XYLA 2E4TA 1S5NA 3E5PA 3KOWA 1QNQA 3D46A 2Z24A 1GQNA 2FVMA 4G1KA 4MPQA 1IT7A 1LWHA 2OWCA 1B9ZA 3BLFA 3P8JA 1M7PA 3PNUA 2ZKMX 3C2RA 4EXQA 4JS3A 1U1UA 3ZVIA 1CGWA 2A3AA 1AL7A 3TYCA 4NT0A 4RE0A 3G5EA 3AFBA 3N17A 3T4WA 3UYCA 1QASA 1TTJA 3CMFA 4XVEA 3ARYA 3V0UA 3NVTA 3SZ8A 1IZKA 1MXDA 5CEWA 3MDUA 5I02A 4MF4A 4REQA 3G6MA 1ISZA 5U4NA 3NPVA 2QDHA 5AHLA 4HHHA 1RBOB 4JNZA 5SWUA 4E2DA 3F4NA 3B9EA 3KL3A 1PPIA 1K4GA 2A3BA 3M5XA 3WDIA 3CZLA 3MY9A 4PBGA 5L6UA 1GHSA 3BV7A 4J3WA 4LBSA 1E6NA 3DCPA 4IPPA 3WJYA 4ZQNA 3DESA 4YIWA 4DHGA 4DJDD 1GWJA 3N04A 4GQRA 3MP3A 1PB0A 4UOZA 3TVAA 2GJXB 4A3QA 2FHFA 3CV6A 5HQMA 2D1ZA 3UJRA 2BXZA 5KINA 3WH6A 1WCGA 3NQ8A 5A8NA 4IQDA 2ALDA 2AMGA 1XISA 4NI3A 1I6NA 1Q6EA 3W23A 2GFTA 2PPGA 3W25A 3LCFA 2I14A 2EPKX 3AISA 4US5D 1A47A 3CV1A 3SI9A 3CZ8A 5H2ZA 3W3OA 3CPRA 1JAKA 5JMUA 5K7JA 4D71A 1E9IA 3BAKA 3M41A 3MKCA 3DERA 1P0DA 3BDKA 3WO8A 4LH8A 2VP8A 4H9ZA 1DXIA 4TVUA 2IMRA 1I1WA 1H7OA 2Y8KA 3S47A 3C56A 2XVKA 1OIFA 3GRIA 1PTAA 3MBDA 2PTZA 4NKCA 1NEYA 2QMJA 2VZVA 1W31A 5C9XA 2JKEA 1DQXA 2H8ZA 3LXBA 3UJSA 1B3YA 3IRDA 3C8NA 3RLVA 3K5XA 1OX5A 3CEPA 3GIQA 4K38A 4K7VA 1DP0A 3VD7A 3WLNA 1JCMP 5HMDA 2WCGA 1OG0A 3QV8A 1E4LA 3H7UA 4XKYA 4IQJA 3ITOA 2QF7A 3WF0A 1E3ZA 4H7CA 1FWNA 3S4TA 2BZNA 4WQ6A 4GZJA 4Q4SA 5F4XA 2F6XA 2V2DA 1DWFM 2DSWA 2UY3A 2VZTA 6A3HA 1XIMA 3VKDA 5IDZA 1VLIA 3W7MA 3WEZA 2MUCA 4DJEC 2C18A 4GXMA 3DYOA 4QSFA 4D8LA 4FXFA 3W1PA 4NYYA 3LM3A 4RDYA 4CQ8A 5FJTA 4K6AA 1IEWA 2A79A 3ALGA 2CWNA 1XRSA 3VDBA 2C0AA 2Y5SA 4E0CA 1XUUA 1TIWA 1E55A 4Q8UA 5ECUA 3BL3A 1TCDA 1TRDA 3PFMA 3W29A 4C6BA 2J9ZA 3F4VA 3TOPA 5GVJA 3DBPA 1PCKA 4AISA 3KBMA 1Z89A 5KZEA 3B8IA 5JH2A 3NQMA 1LDCA 4LX4A 3AIUA 4MZYA 1A5KC 2G5WA 3SAZA 3W7JA 2O9TA 3OLGA 4PMQA 4DBDA 5KETA 4IP4A 1UWIA 1CZ1A 5AECA 3VNKA 2D2OA 4O8AA 3FAXA 1QHPA 2P8CA 1FQ0A 1PTDA 1DE6A 4IMDA 2ZZ6A 2WZMA 3W24A 4W88A 2QXWA 1OGGA 5EPDA 1XCWA 2DJLA 2Y6ZA 3TH6A 4H4IA 2DZTA 3R11A 3NZPA 2XISA 4RCXA 3U5UA 2F9RA 4EPKA 1V6UA 3TEVA 1XL9A 1SJAA 3Q67A 3NPUA 2W4XA 4N2YA 3QC3A 4FO4A 3DN5A 4YVXA 1JIBA 3G8RA 1I8JA 1TB3A 4PODA 4DXVA 1U33A 1K03A 1VRDA 3WCZA 2G96A 2A7RA 3KP0A 3LV6A 4G7FA 3U4FA 3SRKA 3LI0A 3DHUA 1S5TA 2VMFA 1ONWA 1ME7A 3MUCA 2QCFA 3KHDA 3UR8A 3MVTA 3SSJA 2X1IA 1UR9A 3M6YA 3NO3A 2NXGA 1EOMA 1R38A 3UR5A 1SZFA 1RK6A 4C6QA 4Q7NA 2Y8UA 4LCSA 2BY0A 4D6HA 4R7WA 4UUIA 4QNWA 1S2WA 5F7UA 4O1AA 4MFDA 3AIQA 3GD6A 1JPHA 1Q6OA 2GL5A 1XIHA 3L12A 3OIHA 3KCJA 4FNSA 5LSMA 4PMXA 1UD2A 4DX3A 5TD4A 3SGZA 4B90A 2QUMA 1ZAJA 2WK2A 2CEQA 4ALDA 3CQJA 2UWFA 4S2BA 4C1LA 4J2PA 3F5LA 2OB3A 4PA8A 3WQ4A 1V0KA 4MY1A 3EXRA 2VQTA 1FWDC 4ML4A 1CXFA 3MKVA 4AYGA 4J3ZA 1V3KA 3WZ0E 3V1HA 2VNCA 2VGGA 1Z3NA 3LPGA 5HJYA 5CZJA 1HIZA 4I6VA 5CAKA 3F4CA 1DJHA 2ZWYA 1EQPA 3GYEA 1EZWA 3VNMA 1HZYA 2PU1A 4LT9A 2ISVA 2HK1A 4ADUA 1UWQA 3R0KA 4LS2A 4KRTA 1GTEA 1ICSA 4BKNA 2B7NA 4R9XA 2VELA 4JTAA 4MWAC 3LGDA 5CG0A 1W5MA 2CKRA 3W38A 4OJYA 1Q2SA 3G6LA 3RXZA 1TZ7A 3PBGA 3MUIA 2QR6A 2FGZA 2B7OA 1WE5A 4L6HA 1GVIA 3WKZA 1ZBKA 2A7NA 3PB2A 4DXKA 3CWHA 2R1KA 5DCEA 3IANA 4JYFA 3ARXA 3H8AA 4CD8A 4PL1A 3KE0A 4GVFA 3OBKA 3A22A 1UOZA 4C5ZA 5HNRA 1C7SA 2YDQA 3PF3A 4JKMA 3DFYA 3EX3A 2GQAA 1PZ0A 1OSEA 1O5KA 4QQ3A 4RPQA 4ZE4A 1XBVA 1SO5A 2X7VA 1QK0A 1GEQA 2ZA2A 1GVSA 1XIFA 5A3HA 1A4LA 3T55A 3F1QA 3VXGA 3S1WA 4LPCA 1XBYA 4HA1A 3QLDA 3VABA 1DIDA 4CU8A 2ISDA 1YX1A 2QUTA 1E6RA 4JTHA 3EWWA 4G9PA 3U6WA 3EOSA 2B4GA 4XZ9A 3MUAA 2WSPA 3LY0A 1OZMA 2CPUA 4S3JA 5CXPA 4S3BA 4K8EA 1F8MA 4XBKA 4JEJA 4JTFA 3FJNA 2AKZA 2PGWA 5A6KA 3DFTA 1H5VA 3SCNA 3APGA 5DMMA 4EANA 4MZ1A 3UY8A 1ZP3A 3CV7A 3TJIA 4JX5A 2F2KA 3GDLA 4LVDA 1L6WA 3DENA 3EOUA 1V93A 3OHIA 2E9BA 3NQAA 4LC6A 4PYSA 4UQCA 3V5CA 1R7AA 3UJ2A 3AIWA 2VDGA 1QBBA 4LS1A 1WZKA 1K8CA 3XIMA 1F9CA 3VIGA 3QQ1A 2NT1A 3M0VA 5DCBA 4GC4A 2I1OA 3O7UA 4WJ8A 3LPOA 1C93A 2PTWA 4DYJA 3E2QA 1X7FA 1K9DA 1TA3A 3THAA 4UCFA 3KVKA 3B4UA 3WDQA 1BGAA 3T07A 1KFEA 2Z1KA 3N9RA 1HP4A 2V63A 1FWEC 1KM4A 3VC5A 1R9XA 3OGRA 2J77A 1NJJA 3VKKA 2EAWA 1ONEA 4PUWA 2P10A 1HUVA 1H62A 3AYSA 1V3LA 3SJ3A 4LUYA 2XWEA 4PBFA 5E70A 1I2NA 3NG3A 1E1CB 1XH2A 1WBJA 1CGTA 3VE7A 3RO6A 3TW7A 2YW4A 3DFPA 4M8UA 3OB8A 1GOQA 3FK4A 1IEXA 4F66A 1R8LA 4TX6A 4U3CA 1OCBA 3VD5A 3TP4A 1SZRA 2E6FA 1PWMA 2FDMA 2OTDA 3SCSA 5FA5A 3S83A 4IFRA 5CBJA 2PP1A 3NDOA 3IIXA 2A3LA 3PBYA 1UWRA 1O1HA 1XS2A 3RX3A 5I3JA 2J8TA 1E15A 3UXDA 4KRUA 3N19B 3ABSA 4L6OA 3QQ0A 5CJ5A 1IYXA 1TX0A 2ZC8A 3TYUA 3K46A 1M53A 3FHAA 1HL9A 4NVTA 4LY4A 3WLJA 4JQ4A 3B0PA 1NDYA 2W63A 3DC0A 3WQ8A 1DVJA 1XLHA 1TIMA 2CESA 1J11A 4U2ZA 1GT8A 3GK0A 4DIAA 2QUVA 2ZUUA 3HQ1A 3A9BA 5FI8A 1WQ5A 3TN6A 1IR2A 5A5WA 2QMKA 1EFZA 1SSGA 4I3GA 4OFCA 1EC8A 3CJPA 3TR9A 4M5PA 4RV8A 3QTGA 5HNNA 3C52A 3KL5A 1BD0A 1XWYA 4DWSB 3QXBA 4N9EA 3VUPA 1W8SA 2IKHA 1A0DA 1OFDA 3T05A 4B5NA 4UZSA 4O13A 5G5IA 4A8LA 1OCQA 1XFBA 3NWRA 1V02A 4KEZA 1QNSA 1MZHA 1ONRA 4GBDA 2NSXA 3ZMRA 3MYOA 3RPTA 2W61A 3GQYA 4QQUA 1E0VA 1SMAA 1KGUA 5DBTA 1BXNA 3AXMA 4PL2A 3TV8A 2WVUA 6TAAA 1JNEA 1Q7ZA 3CO8A 3QGKC 3A4AA 3NL3A 3TSBA 1S2VA 2CBVA 1TR9A 4GISA 4L1GA 1J5TA 3NJ3A 4HHPA 4ICNA 3SEPA 5ABHA 3GG8A 3AJ7A 5H8MA 1GZJA 2FGBA 3OPSA 3B06A 3N4EA 3FA3A 3ARUA 3AS1A 3DG3A 3HGRA 4O0KA 4NNCA 5LHFA 1P1MA 1UR3M 1JZ5A 4UTWC 2GWNA 1WNOA 1NOWA 3W1XA 4Q8QA 1SW7A 4DWDA 4WHBA 2X1UA 9CGTA 3CLMA 1E5JA 4ZTYA 1AK5A 2WZHA 3QPEA 4LVFA 1GQIA 3W70A 4XAPA 1UCWA 1GOXA 1WYIA 3FA4A 4GACA 4DF0A 5LGZA 4GINA 2EPLX 3M0YA 4G1NA 4ROPA 4JIQA 4PZVA 3ZS4A 4DRSA 4NRRA 1OYAA 4GX8A 4KQNA 1YNQA 3EOLA 5JU6A 3DG7A 3UA4A 1FWBC 1W1YA 3M9YA 3B9DA 5AB3A 1KRBC 4HJFA 3W7RA 1UHVA 4GXPA 3G77A 3KBVA 3VNJA 2X2YA 5C71A 3DAQA 5ABFB 3EMZA 3OYZA 5HNTA 2YLAA 1E71M 1H49A 2GK1B 4MKNA 3ZT6A 5AC7A 2XIIA 3WD3A 3PZMA 1I2OA 2C0HA 4AX7A 3AMCA 3L5AA 2PDMA 1DE5A 1VFFA 2C6QA 1SMDA 3LS9A 4PR4A 3NDZA 3GB6A 1UIOA 2UZ9A 2E28A 4NU7A 4LY8A 4M82A 3C0QA 1G6CA 2GGIA 2ANUA 1T7LA 1HO4A 2QUUA 4KEMA 3VDAA 1KBBA 1JCLA 3BOXA 3W82A 4CLMA 2DUXA 2XGZA 1E6SM 4O50A 2J9YA 4MLRA 4WRHA 5F4WA 3R0UA 3NZQA 1B9BA 4GX9A 3MMTA 5IBXC 4OE7A 4IMFA 3W7DA 1XIIA 3L4YA 1IWBA 4QCFA 4US6A 3MCNA 1HJSA 4FIRA 3M0ZA 4LVAA 1BWKA 1JCXA 1P0KA 1FWSA 2ZXQA 2XN0A 3QQWA 5A6LA 4RE3A 2J9XA 3IACA 1UA7A 3ARZA 4PTDA 3VIFA 4Z2LA 3HPAA 4W9TA 1G0CA 2YBVA 3AZSA 4YVPA 5AYXA 2HS8A 4C90A 1JPMA 1MDRA 1FCUA 3N2TA 4QDWA 3WF3A 4V33A 3QLLA 2O7QA 1V51A 4MJMA 1B4EA 2JIEA 3I68A 1DBTA 1J12A 3BV4A 2X1TA 4QR6A 1HGWA 2VFIA 2BOGX 4GO8A 4HPGA 1X6UA 4MAVA 3MS8A 5M2FX 4P7OA 4IPJA 2WMKA 2PDGA 3KZPA 4PSRA 3O06A 2YDSA 2Z6JA 2MANA 3OTRA 4GOAA 4R27A 4TMCA 1TPH1 4N4QA 3G0UA 3GNPA 3WY1A 5LNVA 2WHLA 3BCDA 1PDZA 4WDTA 2P88A 4DWSD 5H6HA 3WLOA 2PDJA 1FKXA 3W7QA 4WKAA 5G4WA 3NQ2A 3T40A 4H04A 2QF8A 2ZRUA 4N6EA 1AQFA 1Q13A 1I0BA 3ARTA 1W9UA 4LUIA 3MI3A 2IQTA 1H61A 3PM6A 5D30A 2WVTA 2Q02A 2OR2A 1X8CA 2J62A 1HFBA 1WB0A 3MMWA 3CT7A 2WWDA 3PC0A 4H9YA 2OYMA 4MPKA 4ZOAA 3TQPA 3G1SA 1HJUA 4P8VA 3EB2A 1AJZA 4HU0A 3NEVA 3H2EA 1JF5A 1R3SA 2X0SA 2J79A 1UC4A 2PEVA 2DZAA 3KVLA 1ESWA 1PWLA 4PMNA 1WKDA 3WF2A 3K1GA 3VGHA 2ZZ2A 1V03A 4TU1A 2QW5A 2W92A 3DHPA 4JQ1A 3AI0A 1GVOA 4UTJA 3WEMA 1UBPC 3CK5A 4RDZA 3L5MA 4KIRA 1W5NA 1Z42A 5FF3A 2AL2B 1AJ2A 4FPSA 2ISFA 3IWPA 4RZ4A 2FLIA 4NSBA 3ABZA 3R43A 4DI8A 2YL6A 3IRSA 1A5CA 2EG6A 3GTXA 1YLVA 1SZEA 2G50A 5I5RA 3LHUA 3GXIA 4HBKA 4N42A 1Q8AA 1QU4A 4UB9A 3TSMA 5HMSA 3S2MA 5DANA 4GYPA 1EO5A 3U8GA 3CWOX 4D6FA 4KMQA 1LL4A 2Q6ZA 4ZR8A 1CWYA 3ZIZA 3GC2A 1NFGA 3NQDA 1FH9A 4W4QA 1Y5XA 2A3HA 4Y8EA 1GJWA 3C0SA 3GDTA 3URQA 3LHWA 1MYRA 4B4FA 3QJAA 3ALFA 2D73A 4GHRA 2A3EA 3V36A 1ZCOA 1KLYA 1EDQA 1ZENA 4ZFMA 3UNTA 4AIBA 2FHBA 2RJHA 4ZQPA 4NJJA 2WZIA 5ABTA 2PTDA 3EX1A 4FLOA 1I2QA 1RSCA 3VA8A 3LK6A 3UZ5A 1C91A 1UG6A 5JH1A 2J7CA 1L6FA 4RNFA 1B3ZA 3CLWA 3NQCA 4LGXA 4MDOA 3B40A 3DBNA 3RX4A 3NZRA 1VP5A 2Y63A 5D38A 5G2HA 2WMIB 4LUSB 3OQEA 4AZ7A 4XSMA 4C6OA 4UMAA 3LCHA 2EO7A 4WX2A 1R2SA 3VOJA 1SJDA 1ZRQA 2VFEA 2CNCA 3G1XA 3GKAA 1OK4A 3CT2A 1RXOB 3ZO9A 3C3UA 4M24A 4C6CA 3KBSA 3FXYA 3JW7A 4QX4A 5DFAA 5A2BA 4UMBA 2PWDA 4GVIA 2NW0A 3SN0A 5FF2A 4QE1A 2DW6A 5ENLA 3LM7A 3MT1A 1QPRA 1T40A 3E2SA 5GJMA 3H2NA 3PWGA 4Q8NA 4X9SA 3PTQA 1QO2A 1Q4NX 4UFIA 4NG3A 1S1RA 2HISA 1MNSA 2OCZA 4MIMA 3ENLA 5CCZA 3W1NA 4C6MA 3P67A 3TA6A 2EJAA 4RZ6A 2W66A 1E43A 3ANVA 1Y5WA 1H63A 4DF2A 4DJDA 2FTPA 2KX9A 4J1OA 2BY3A 3KTCA 2DIEA 4WY0A 3U4AA 3Q58A 1FWWA 4YLWA 5D04C 1T8QA 1EJRC 5D33A 4AC7C 5JBEA 4MLJA 1BF2A 1XF0A 1QI2A 3QKEA 2KZHA 3VD4A 1CDGA 2E5CA 3UGRA 3USBA 4GVHA 4JPGA 4FNPA 4JKLA 4QJ3B 1OCNA 5A6SA 3IUHA 3T44A 3AALA 1UZ1A 1REQA 2DPEA 3WMBA 3CUXA 3ZVHA 1AH0A 4F9JA 4NI8A 1GYLA 2DZBA 3BE7A 3RFAA 4JQAA 2VI0A 3THDA 1DJNA 1YTKA 3FA5A 4UTMA 1AZ1A 3ARRA 4AZHA 1OIMA 1WUFA 3FGCA 1TZZA 3L7RA 1W17A 2YXGA 3WL0A 2DJXA 3BANA 3RRXA 3EYPA 2Y7FA 3AICA 3SJNA 4IF2A 4LF1A 1WDQA 2PC4A 3UG3A 3DI1A 4H01A 4H8NA 3NQBA 2YKKA 4DY1A 3ZWTA 3EPNA 4Q33A 1MW2A 2QUNA 1UD3A 1S39A 1XLJA 1AD1A 2Z1WA 4UQBA 4CEUC 3DFNA 2YB1A 1SQ7A 1XRFA 2DUAA 4W8AA 4PEKA 3VIOA 4DXXA 3P6LA 4B5XA 1KKOA 4R85A 3F2DA 4LJ3A 1MO0A 1Y65A 2BMBA 4W86A 3BAWA 3WL1A 5C70A 1GPWA 2ZBTA 4UXDA 4HHMA 1PL9A 3POCA 5CC7A 1S46A 2SFPA 2OGYA 1T41A 3WNOA 3HPZA 2HZGA 2WJDA 5AC8A 1DWHM 4IOTA 4NX5A 5T26A 1Q65A 1M9HA 1W1B1 3GZ3A 4FXJA 4XKYB 2XFWA 1YMYA 4MVAA 4JAWA 3STEA 4HN4A 4U33A 5BRBA 2E0PA 4UTTA 5H1WA 1RY0A 3PG8A 1LOQA 1W3HA 3UG4A 3UWWA 3BG5A 2JKPA 1XLBA 4LAKA 2DH3A 2TODA 3SUWA 2ZX5A 1EYWA 5FESA 1VD6A 4AHQA 4L9ZA 4YYCA 1AQHA 3EB3A 3I3EA 5H91A 1A5LC 1O1ZA 2DW7A 4D1IA 4IPIA 4P7LA 3AMGA 5D2YA 4EAMA 3LEPA 5MF5A 4WSJA 2XPKA 3T0DA 4XQ6A 1EO7A 1VB9A 5REQA 3I6RA 2JF7A 4H9TA 3W37A 3PPFA 1E5NA 2XN2A 3JU2A 1PS9A 2JBMA 1J0IA 3REQB 3WFZA 3CUIA 2DVXA 1T99A 3CUHA 1GQJA 3AHZA 5IDIA 2PP3A 2A4AA 3NSNA 1V7AA 3VNIA 3VGGA 4K8HA 1V3HA 4JFWA 4EAYA 4JXCA 3NOEA 2NXHA 1RLCL 2WM1A 4FS9A 2PWHA 3J7HA 1ZP4A 4XUYA 5BROA 3ID7A 2GGEA 1VJIA 3MYPA 3KOFA 1WXYA 3VMPA 1H09A 4XZHA 2E1DA 1NWSA 3U2ZA 3HPFA 1P7TA 1B3XA 1GGOA 2BS9A 2DU2A 3SCQA 3TCSA 4H7ZA 1QK2A 3UJFA 3GUGA 2Y7EA 2GQ9A 4S3DA 4XD6A 5LKYA 2HE5A 3EOOA 1EIBA 1ZALA 2QCCA 1XCFA 4E5TA 3HBLA 2CLMA 3IV8A 3KRBA 1GOKA 3WH5A 1SZNA 1CGVA 2B0MA 4MY8A 4C6EA 3JZEA 3MSDA 3WLQA 1BYDA 3RLUA 3WLTA 3M44A 3T81A 4KCTA 4ZFCA 3W81A 3VOIA 4MB3A 4Q7IA 2C1GA 1PAMA 5D02A 3MU7A 2VD9A 3V5OA 1DJYA 3W22A 4ZSUA 2Z25A 2R1MA 3AXHA 4FX7A 2E5BA 1FCQA 1VIZA 3CHFA 5IFPA 1CXIA 2DEPA 2PGFA 1H7WA 4GY1A 2X40A 3N9SA 4FMVA 4H9VA 2OO6A 4GQBA 2ACRA 2V67A 4TMBA 2XHYA 2ATSA 5BOFA 3E1F1 4W89A 4V27A 4AU0A 5JVLA 5KEZA 1V79A 2HMCA 2QAPA 2GJXA 4IGMA 1FXPA 4OTKA 2HXTA 4Q8MA 3QGAC 2RDXA 3H26A 3WQDA 2YX0A 7PTDA 3GFZA 3BGJA 4CNOA 2VWTA 3W9ZA 1LLOA 1RUSA 2R82A 2NVAA 4H8VA 4XAFA 5M3WA 1S1PA 1AODA 1TTPA 3OU8A 2X30A 2H90A 4FEZA 1VBRA 3IV3A 3ZSTA 1SFLA 4UTIA 1PJ9A 2PCEA 3R8HA 3P8IA 4K68A 4Q32A 1TREA 3ERPA 2NX3A 1XGDA 2HBXA 4J40A 1DOSA 4PRTA 2VVSA 4MJ2A 1HGYA 1ZFJA 3L65A 4UZUA 3WLSA 4MB5A 2ZDRA 3SIZA 2OMAA 4ZZ9A 2DT1A 2IW0A 3R5EA 5EKYA 4NQ1A 4B5VA 3MI2A 1JUBA 4JQ3A 3WMCA 3UWZA 4PCPA 4HHLA 1LM1A 5DEZA 4GO9A 2Y70A 3W27A 3WFAA 2Z6IA 3GG1A 5A8OA 2PDCA 2OXNA 4WXZA 3FEMA 3A6OA 2LLEA 2OKTA 1SR0A 3TIMA 1VFMA 1FCBA 4XUGA 5GQBA 3LBCA 2DQXA 4LNCA 5AYIA 1HT6A 2BLEA 1LRQA 4ZQRA 3UXKA 2HQAA 3VILA 4H19A 1IZJA 1A4MA 2VJXA 4X2RA 3GFXA 5HK4A 2IKJA 3M5YA 3N12A 1FY6A 2Z2UA 1XQLA 5A6BD 1J0YA 3QC0A 3H23A 3FOKA 4NNAA 2X8RA 4M7SA 4L9XA 3MB9A 1VEPA 1OWQA 5C8BB 3WIJA 1O60A 3IJLA 1EXPA 3QV9A 1HKMA 4ECLA 2WSYA 5DMYA 3I6EA 2BVTA 3UA3A 4WDXA 2OSWA 1V77A 5LNWA 2EF9A 4LFYA 4Q4KA 3I3DA 5D9MA 2Z2AA 3TYBA 1XH1A 2QJJA 4DM2A 4OOZA 3GU1A 2RDWA 3LXAA 3HURA 3L2MA 3O6DA 1OZQA 4TUFA 1TWDA 1F07A 4L1XA 3T78A 1LLZA 4E3TA 2ZZ4A 4KGLA 3VPLA 1W1VA 3WH8A 3GUWA 3SQSA 1JDDA 3W1AA 3H2MA 2PI6A 1W3IA 1J5SA 1W3NA 5BNKA 5F2IA 3S5SA 2PDQA 4HPXA 4MKVA 1X1OA 3NM1A 3R8RA 2PF8A 4J9JA 2DSVA 1PIFA 1GG0A 3M5ZA 3N2BA 4PMZA 3C0JA 2ZE0A 2Z1VA 2FPVA 4H83A 3OZOA 1B2YA 3DYPA 1CW2A 2JE8A 2QGYA 4XV0A 2O0TA 1TWIA 1G94A 4H9XA 4H3DA 3LTPA 1QNPA 2E68A 4CNNA 4NZ1A 2YA1A 3WF1A 2HNHA 3VU2A 3CUFA 2XFRA 1G69A 3WQPA 5M5DA 5LGXA 2IQ0A 3AYRA 4YPJA 5I0DA 5GJPA 1H41A 5C2XA 3VOCA 1ISYA 1NH6A 5G1MA 4JTKA 2E7FA 2Y24A 1EL3A 4W85A 4G5DA 1K9TA 4JHOA 5DQPA 5FF4A 3UWEA 3N1AA 3WBYA 4MKSA 2A2IA 1E73M 1P43A 2XZ7A 2PWVA 4MB1A 1TA3B 3A12A 4HYWA 3W73A 3FJ6A 3PAJA 4PMJA 1F7BA 2RFGA 1KM2A 1TVPA 3TQKA 5KTLA 1PCWA 4GCAA 1V3MA 1IEVA 3B0XA 1RQEA 3HIJA 4PB4A 3RUBL 1E72M 1ADDA 3A4JA 2PA6A 1V8EA 5E9AA 4CN4A 3G0SA 2OODA 3CH0A 3WDJA 1KR1A 4XZNX 3CAWA 2AAMA 2G8ZA 4S3CA 3CPGA 3CHDA 3COTA 2GOUA 3H12A 2D20A 1DTUA 1XYCA 2ZUMA 3CTTA 1XIBA 1TRIA 4LW7A 4QXIA 3WYZA 2QCDA 3WH7A 4LAMA 1TJRA 4LAUA 5CSYA 4HB7A 2FFCA 3IJDA 1BTCA 1GZGA 4PFHA 4IUOA 3WLRA 4XO7A 5AY7A 4OHQA 4JEQA 3HG4A 5BW6A 2OO0A 3W4RA 3DHFA 3VCCA 3EMCA 2WLYA 1I1XA 4AAJA 1H0GA 1DKWA 1EGMA 2BDQA 4CD7A 3U0HA 1J9YA 2PURA 4L6DA 4ZA0A 5I09A 2HPMA 2OZ0A 3AWOA 5LHEA 1NDZA 2X0YA 4A3HA 3AXIA 1W56A 2CERA 3W86A 2YCJA 3DFOA 2VYOA 1AJ0A 2J88A 4J3XA 3UJEA 3CS2A 3BZJA 3ONBA 1P0NA 3UCDA 4OBTA 2OG9A 3PTKA 2VX5A 4DUOA 1ISWA 1T96A 3BOLA 4AYSA 6CGTA 2BBFA 4GQGA 1OB0A 2ZYFA 1F8IA 3RITA 1H1ZA 3FDKA 3PZTA 1UYQA 1LUCA 3BJSA 2ZX8A 4P5UA 3HOJA 9RUBA 4JFSA 2WNNA 3CAQA 1GQKA 2YZRA 2AGTA 4FF7A 2CXEA 1ENUA 1G7VA 3S1VA 3K8MA 2FPTA 1R9ZA 1JI1A 3LCGA 1TG7A 5LIUX 1N8IA 4WK9A 4GY7A 4UBPC 5CZ0A 2OQLA 2NXIA 1EQCA 2XDFA 3VNYA 3WLKX 4LEFA 3WLHA 1B0IA 4JTCA 2CZEA 4Z0JA 2Z1BA 4A21A 4NJHA 2IQDA 4MB4A 4ORIA 1R2RA 3GR7A 1MEWA 2I16A 1UR8A 1P1XA 4N0RA 3WUBA 5EL1A 3L4WA 3C61A 2CZ5A 1BEUA 4UNIA 3VFLA 1OFBA 2DSUA 4WSKA 2YZ5A 3CUJA 4UFJA 2PFHA 3SCUA 4EF8A 1J93A 3WLIA 3RR1A 3OEXA 3WK2A 3U48A 1GOIA 1Q8JA 1FRBA 4RNHA 3GNDA 1C29A 2WPBA 1OEPA 3ZSSA 2PDFA 1KCKA 4EWND 1R3RA 2GSHA 3P2VA 5MKGA 3GDKA 1B5TA 3WF4A 1EX1A 5HOSA 1C8QA 2J27A 1AG1O 3URBA 4GJIA 5D9NA 5EFDA 3GXNA 5KMYA 3P80A 1R30A 5AYYA 3RIKA 3MUZ1 1RCQA 2G3JA 2QEZA 2PD9A 2A0NA 2WJFA 3IVTA 2WBGA 4FNQA 4AEEA 2Q3RA 3IS4A 3PZVA 5K9CA 4RLIA 3H70A 1A5OC 2NSOA 2BY1A 3DOPA 2HTMA 4S1FA 5DMNA 4V1XA 2W6RA 4UTUA 4GZ7A 4Y9MA 3V35A 8TIMA 4EK7A 2Y7GA 4O11A 3JUGA 3VGBA 3W2MA 4IIBA 2E6YA 3DX5A 3S2CA 1J10A 1YBQA 5CKSA 4O4WA 3OW1A 1O66A 4F9DA 4PSPA 5EMYA 1EKOA 2AL1A 4MWAA 3R4IA 4D9PA 5I3DA 3KZSA 3MCOA 1ZJHA 3LYEA 3WLPA 2WZEA 2RUSA 2J7DA 2R91A 4BQ5A 1RALA 3ECQA 2HNEA 3MZNA 1H3GA 2FPYA 3V16A 2ZC1A 1JD9A 5IXEA 2HWGA 4PUKA 3LI1A 1FWHC 4QDMA 3W07A 2W3ZA 4YHEA 2CLKA 3AXXA 1EHAA 3H54A 1J0JA 3ME3A 1OYBA 3KOZA 4LV9A 1W32A 3BLPX 4GZIA 3E96A 5E93A 4MM1A 5HQEA 3SADA 1IEQA 4W7WA 4L4LA 1WBHA 3BJTA 3KUMA 3BLIA 1NOFA 4DI9A 2VCCA 1B31A 1KXQA 3B9AA 1MXGA 5IM51 1BKHA 3EWYA 3QY7A 3CZEA 1XSJA 1PYMA 2C13A 1JR1A 7A3HA 1CXHA 3QBUA 2QPXA 1MVYA 4DWSA 1JPDX 1Q6CA 2W67A 1S5WA 5GNZA 1XR2A 4V2XA 3VGEA 4RNIA 3BG9A 4DN1A 1FHDA 1V0MA 3GXMA 4ASTA 3EWXA 5CBIA 4NXKA 3T6CA 3L9CA 3W84A 1N82A 2ISSA 4S39A 4HZMA 3LCLA 5DCDA 3MQTA 4DELA 3R89A 5GNYA 4OKDA 3NR0A 5CPOA 3MZ2A 3TSDA 3P62A 3BK0A 4Q6JA 3EDDA 1E3XA 3PJWA 1XLAA 2CWXA 1K7EA 1YDOA 4Y9AA 3D3AA 4O14A 1UW9A 3AMLA 4TX8A 4QG8A 2VFFA 3GTIA 4XAZA 3R2GA 3H4XA 3LMYA 1JZ3A 3IUDA 2B31A 2DZUA 4ZO8A 1FXQA 1JDAA 2J7FA 3LBOA 4PB3A 2DDXA 4S38A 4Y9PA 2G0WA 4XTIA 2PTXA 5A8GA 1HVQA 2PLJA 2YA0A 4C6KA 2C71A 1XYZA 1UROA 4F8XA 4L4OA 1S38A 3R25A 1E70M 1WDRA 5B7ZA 4LCRA 3S6OA 1B3VA 3AZTA