4ZFMA

Structure of gan1d-e170q in complex with cellobiose-6-phosphate
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
474
structure length
459
Chain Sequence
HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNQQNIFISFGYRLGLHPPGVKDMKRYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVGTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative 6-phospho-beta-galactobiosidase
publication title To be published
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 184
structure length 459
sequence length 474
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4zfmA00
3TONA 1SR0A 5A6BA 3N13A 1UWUA 2E8YA 3A47A 1J10A 1GVIA 2DGAA 1W9UA 3LPPA 4HMCA 4GZJA 5CGTA 1VFMA 4ZE5A 2ZXBA 4GQQA 5FL1A 1WE5A 4U5KA 4QP0A 3CIVA 1H49A 3GNPA 4CD6A 1QI3A 1TCMA 1US2A 4NI3A 3QOKA 3UR7A 2OLHA 3GBDA 3AIWA 3WF0A 4WSJA 2VJXA 2CERA 2XWDA 2PWFA 2Y8KA 4HTYA 2DSVA 3O6AA 2GJRA 4DWSC 2IUZA 2CETA 1GOQA 1LQ0A 4TVDA 8CGTA 1UD5A 4QCFA 3WF4A 3VX1A 2JE8A 1W32A 3L4VA 1NWTA 2ZUMA 4BQ3A 4WLCA 1RP9A 3DHPA 2C8NA 3IJ9A 5D9MA 1QPKA 2JEPA 1LG2A 4PEEA 1B3YA 1OT1A 3VINA 1GJWA 1EH9A 2EBNA 1V08A 3OGSA 2HVMA 4N42A 5CPQA 1IZKA 3PTQA 1GORA 1KQZA 2GJPA 4TVUA 3WUBA 2EJ1A 3SCUA 5I77A 3AXXA 4XX6A 1UH2A 3WUEA 3RM9A 1TFVA 3EMQA 5AC5A 4U2ZA 3RILA 4J27A 1VEOA 1XHGA 1KGUA 1EOMA 4Q22A 1XRVA 3SCTA 3UG5A 3BMWA 4W8LA 4UNIA 2J25A 4AIEA 1SMAA 1UD6A 1XCWA 3CLWA 2CKRA 2TAAA 3IJ8A 4U31A 1AVAA 3BH4A 1E6RA 1XSJA 2XIBA 5A6LA 3FNDA 4CU6A 4Z2IA 1XD0A 1Q6GA 3WUFA 1OD8A 3S6TA 1J18A 1HN1A 3AS3A 3MMWA 4JZ5A 2BV9A 1MYRA 1Q6DA 1UR4A 2XWEA 1O7AA 2FGZA 4F66A 3GXMA 4AZ5A 1BYBA 3SUTA 4IPNB 1FH9A 2O92A 1CEOA 4XUYA 2EPMX 2WZEA 2WVTA 3FW6A 1M7XA 4U2YA 5GNZA 4WKHA 1BG9A 2E3ZA 3LMYA 5E0FA 3WDPP 1UKOA 1JF5A 3RPMA 3CBWA 3II1A 4HMEA 4MB1A 4CKQA 5C70A 2VRJA 4B3LA 3RM8A 5M5DA 1P6WA 3RJXA 1ISXA 3I3BA 4AISA 2WCGA 3SCSA 2BXYA 3AIBA 1KBKA 3VKKA 2ZOXA 1KXHA 2QV4A 1JIBA 5KZ6A 7CGTA 4CD8A 1EGZA 4MNMA 4D6JA 4AIOA 2BY0A 1BFNA 1UR2A 2WYSA 1OSEA 3RMEA 1UHVA 3MO4A 1V0KA 2Q8XA 3ZJ6A 2YLLA 1E9LA 1E0VA 3K4DA 1E56A 4Q7NA 1H5VA 3F5KA 3AXIA 1E6ZA 1HL9A 3CUGA 5AC4A 4BF7A 1TVPA 1PJ9A 4TXEA 5I0DA 3OB8A 4IUGA 1D3CA 4UFLA 3UR8A 1W1VA 5CPSA 5A2AA 1SFSA 4GPNA 1L0PA 1ZBCA 1LG1A 2ZX6A 1JZ2A 2WCAA 1JD7A 1QBBA 4L4OA 2WBGA 1PX8A 4W88A 1QHOA 4A4AA 1EO5A 3MUAA 4AEFA 3UETA 1H11A 4OOUA 4AC1X 1CLXA 2PF0A 2WVVB 3EMCA 4J3SA 4R5EA 2PB1A 3O9NA 3VIMA 1WZLA 1ZS2A 3PZMA 5A6SA 2YLAA 3WDRA 4M29A 1GQLA 4MAZA 5D9OA 3WNLA 1C90A 1PAMA 1J0KA 4Y7EA 1TVNA 5A1AA 2WWCA 1YHTA 3D5HA 2XYLA 4AZ7A 2AMGA 2WXDM 2ZX9A 2PWHA 3VGFA 3D3AA 1ZBVA 2EPOA 4C7GA 3VNZA 2XGBA 1K9EA 5E6YA 5A6AA 4MJ4A 3VPLA 2F8QA 2D24A 4J3XA 3WMBA 4PTMA 4H8VA 1VBUA 2Y2WA 4UFKA 1TE1A 4UQAA 1ISVA 3GNOA 2F2HA 1HX0A 1FH8A 5LA2A 1BTCA 1BYCA 4BZYA 4P8VA 1W9PA 2X8RA 3CH9A 2Y4SA 1K9DA 1VEMA 3AMGA 3M07A 4WKFA 8A3HA 3OBAA 2CYGA 1ZL1A 3WY1A 5TD4A 3AJ7A 2PI6A 4LQ1A 2D3LA 1V02E 3WF3A 1CLVA 1W2PA 2VTFA 4CCCA 4DUWA 4W7UA 1C8QA 5D4YA 1QHZA 2JF7A 4WK9A 4CUCA 4DWSA 3KL3A 3EDEA 4X9YA 4HOZA 2CHNA 4HA3A 4QAWA 3FXYA 4PMYA 1E6SM 2ZWZA 4GI8A 4YHEA 2YL9A 3VMOA 3FY1A 4TTUA 1U33A 2ZXDA 4W89A 2G41A 4ACZA 2YOCA 1V0NA 1E4NA 3MUIA 3T08A 4KGLA 3E1F1 1E40A 2GFTA 3LPFA 3ZIZA 3ARTA 2CESA 4MB4A 2OYMA 1C91A 2DSUA 2XG9A 3BAXA 4B3KA 4QLLA 2DDXA 4OBRA 5AYIA 2GDUA 3UG4A 1UR8A 5I5RA 1EOKA 1IT0A 1XYZA 2QPUA 4TX6A 2DSKA 1JYNA 3NCOA 3ZR6A 1K9TA 2BVDA 4CN4A 3QOMA 1K9FA 3N1AA 1W9DM 4JAWA 2G4FA 3WEOA 4W5ZA 2WMFA 2V5CA 2Z1SA 4AZBA 1FH7A 5ABFB 2VZTA 2YIHA 3FN9A 4TUFA 4Z2HA 1CYGA 2VCBA 4MTVA 3FHQA 3L4XA 4FK9A 1PPIA 1D7FA 1E0WA 4ZXOA 3CZGA 1UKTA 1YQ2A 1HXJA 3WDHA 4HOXA 5I2UA 2YDQA 3TTYA 1WDQA 5FD0A 3AIEA 2VR4A 3O2LA 5A6KA 2WZIA 1JZ4A 1CXFA 2W63A 4H04A 4W8AA 4FF5A 1HKJA 3PZTA 2XPKA 3MS8A 2DQXA 3SCVA 5GPRA 4V27A 2G3IA 1WZMA 3G6MA 1JDDA 4ZFMA 4P7OA 3FAXA 2E9LA 3S2CA 1G5AA 1OT2A 3SEPA 2ZWYA 1CTNA 3SCWA 5E9AA 2BHUA 2XVPA 5CSYA 4AZCA 4RL3A 2ZX8A 4AIUA 1XC6A 3W6LA 3WIJA 3TP4A 2IXUA 4P8XA 1NWSA 1G0CA 1QNRA 4DM2A 3W4RA 1C8YA 3GH5A 4GZIA 1UA7A 3AIUA 3CZLA 4AWEA 3QHNA 4FLOA 3GXIA 3BCDA 2GSJA 4JHOA 1X6NA 3OZPA 1WNOA 4PTVA 4QDMA 1G9HA 1X6LA 2J7EA 3BLPX 3VOCA 2YA1A 2W92A 2CBUA 2VI0A 1QI5A 2FHBA 4X0NA 4ML4A 1ISWA 2WKGA 3ARPA 3ZOAA 4B16A 1C93A 3W24A 1CECA 1V6XA 2DT3A 4D72A 2GK1A 2ZX5A 3WH7A 2GJXA 3BAJA 3WMSA 3N12A 2YL8A 4XV0A 2WHJA 1JAEA 2JEQA 3ARXA 4P7RA 2A3CA 1GHRA 1E6PA 2WLZA 5M03A 1JZ3A 5LA0A 3GH7A 1V02A 2A3AA 1MQPA 1HJQA 1TR1A 4EAMA 1NOWA 4AEEA 4LGXA 1WDRA 1I1WA 3VMNA 4E4PA 2ZUTA 4AY1A 3L4UA 1CGXA 1MFUA 3AZTA 1KXVA 4M24A 3WMCA 2XSAA 5JUVA 1OINA 3VIGA 4JCMA 4CGTA 3EMZA 3N9KA 2VMFA 3W0KA 4HPHA 1EA9C 1GCYA 2ZUNA 1GQIA 3ZT7A 4BA0A 4Z2JA 2WSKA 1D2KA 4RE4A 2O9OA 3AISA 3ARWA 2W62A 1AQ0A 3WNPA 3WL0A 2ZXQA 3VIOA 4UFHA 1GOKA 1WKYA 2PBOA 4DUXA 1QOXA 3L2LA 3K4AA 5EMYA 5HNNA 4C7DA 3ZT5A 2BNJA 4W86A 3WD2A 3WN6A 1LLOA 2D0HA 1VENA 2BXZA 5CSUA 1OD0A 3TTSA 3VNYA 2D0FA 4OKDA 1KXQA 3AIQA 5IXEA 4MNLA 4XZWA 2VUYA 3EDKA 1KR1A 5AYBA 4A3HA 4B9ZA 4D1JA 4U3AA 1AQHA 4KWUA 2BHZA 1EHNA 2CBJA 4WJXA 2DIEA 3W25A 3UCQA 5I3DA 2D22A 1NOFA 3RCNA 2VZUA 4H8UA 3N17A 4ZENA 1H1NA 1VIWA 5GQBA 3CTTA 2OWWA 3AYRA 1VJZA 3UERA 2EQDA 5I79A 3W38A 3FAWA 1QVBA 5I23A 4AD3A 1H4PA 3PZIA 1H41A 3UG3A 1HP5A 5DFAA 2DEPA 2VT0A 1R87A 4AD5A 1JZ7A 3WFLA 2JFEX 2WW5A 5CJ5A 2CITA 4LYQA 2CKSA 2WMJA 2NT0A 2DT2A 1B3WA 1H0GA 4ATWA 1CBGA 5CG0A 2BY3A 4M82A 1G01A 2VX7A 2X1IA 3NYDA 1SYTA 1H3GA 4LXFA 1JDCA 3GYCA 1ECEA 2J79A 2VVNA 2ZUVA 4W87A 5HPOA 4UQDA 1AMYA 1MWOA 2J7BA 3I3EA 1LWJA 2XVKA 2PC8A 1J11A 2EPLX 3WUGA 4UTFA 1V3JA 1B31A 1W9VA 4D6CA 4D6EA 3ECQA 3AXHA 3NDYA 4UCFA 3QHOA 3CZEA 3CO4A 3WF2A 2B31A 2NW0A 3VGGA 2XVLA 1JG9A 3CMGA 5CLWA 1W91A 5C71A 1JI1A 1HKIA 3HMCA 4JFUA 5BROA 3WFZA 3AHXA 3ZJKA 3WQVA 5A6JA 4LPCA 1TUXA 3L4YA 4AMCA 4CN1A 3AZSA 2EPKX 1JZ8A 3TA9A 4EK7A 2G8ZA 1RPKA 4OZOA 4TX8A 1QI2A 1O6IA 3CHFA 3SUVA 2VRKA 2ZUWA 4ZE4A 4EE9A 4OIFA 3HU7A 2WMKA 5DF0A 4Z2LA 4QLJA 1FHDA 3MUY1 1JDAA 3OLGA 4PSPA 3VDAA 1PZ2A 3L4TA 3NJ3A 2J74A 2VURA 1WO2A 5M17A 3CZKA 3NDZA 1J0ZA 5CQ1A 4BQ5A 3OLIA 1H0IA 2V3DA 5HBFA 2A3BA 3CZJA 4NF7A 3WDIA 3W28A 2WBKA 1GNXA 4PMNA 3VM5A 1BLIA 1IZJA 1E5NA 5HPCA 4BCEA 3DECA 1ESWA 1DWHM 2ZX7A 3VDHA 2E4TA 2XIIA 3VO0A 1TMQA 3L4ZA 3RM4A 5BXPA 3ZT6A 3M7SA 4J7RA 1CXLA 5AY7A 1AQMA 1W1PA 1JYXA 2A3HA 2ZUSA 4MAVA 3BSHA 4B9YA 1Q6CA 2J8FA 3BCFA 2BY1A 3GNRA 3MV01 4AXNA 1WB0A 4HA1A 4AD0A 4ACYA 3SUUA 4PUEA 2VOTA 2CEQA 2VCCA 6CGTA 1LL7A 1V3KA 4PN2A 2W5FA 3PN8A 3L4WA 1VAHA 1CNVA 3M6DA 4PRWA 2WKLA 1GQKA 3WNKA 2QLYA 4TOQA 4PCTA 5CGMA 7TAAA 2DH3A 1ISYA 1DWFM 5DT5A 5IFPA 2XFFA 3WD4A 2OWXA 3AIRA 2C7FA 4MJ2A 3QR3A 5E70A 1WP6A 3U5YA 3AIVA 4NSBA 3VILA 1Y7VA 4W5UA 3W53A 1CXKA 3MSGA 1WDSA 3VU2A 3WNOA 5CXPA 2W67A 4E8DA 3W29A 1R7AA 3APGA 3SCRA 3RO8A 1KBBA 2QHAA 4U33A 3SCNA 2ZICA 4YN5A 3PZUA 2WCSA 2J47A 3GXDA 4DWSD 3THCA 1QNSA 3T09A 4AYSA 1GQJA 2V3GA 4PMZA 1XSKA 1IV8A 5ABGA 4E2OA 4JL2A 3MSDA 1K6AA 1OIMA 4R27A 1UD8A 4PMDA 2JF6A 4FMVA 2WM0A 2OSWA 4CVUA 3AQUA 3M46A 1OM0A 4WSKA 2WMGA 1EHAA 4CCDA 2VX4A 1E6XM 2CCRA 1XH1A 3PTMA 3U57A 3SCOA 1V6YA 2CBVA 1LL4A 1TA3A 5HOSA 1KCLA 1UQZA 3IJ7A 3WQ6A 4CN6A 1E43A 4H41A 4J3WA 5BWFA 1E4MM 1RD6A 2CHOA 5IDIA 6TAAA 1CENA 2WPGA 2FDMA 2G3JA 3T0AA 2DT0A 1XYFA 1NARA 3W82A 1CGTA 4ZXLA 3WD1A 3IAPA 3I3DA 2WHMA 1B1YA 4HU8A 2ESCA 3OGRA 1V3IA 2X2YA 1JNDA 4WF7A 3AYSA 3WH8A 4NRSA 2X09A 4UQEA 4MDPA 4PCSA 3OG2A 4F9DA 3GH4A 1MXGA 4DWSB 2X0YA 1GUVA 4QCEA 4JKLA 1DWJM 4IM4A 5EFDA 3VGBA 2E0PA 3K46A 1R86A 4GZEA 2VX5A 1VBRA 2CBIA 3ZJ8A 4AZHA 4ACZB 1ZBKA 1H2JA 3PBGA 4W7WA 1NM9A 4HA4A 4ATDA 2PBGA 3GBEA 3DYPA 3CUHA 1MVYA 3WD0A 1EQPA 1JYWA 2O9TA 4AZGA 1HVQA 4MB5A 1KQYA 4UR9A 1XH0A 2UY3A 1LL6A 1VFOA 3ZO9A 1BSIA 5F7UA 1CZ1A 1E4LA 1OGSA 1XSIA 5ABHA 1B0IA 4P7NA 4FLQA 5CLTA 3WEZA 2J7HA 4IPLA 4NRRA 5IHRA 3CMJA 4L4PA 4KRUA 1OGGA 1QNQA 3AZRA 2NT1A 1C7TA 1N82A 4V28A 1KR0A 2VR5A 3VIKA 1JFHA 1PX4A 5JBDA 1FOBA 3K8MA 2O9RA 1C92A 3FHAA 1LWHA 2A3EA 4GINA 4GQRA 3AI0A 3KE0A 1JGIA 3J7HA 4E8CA 3SCQA 1QW8A 1WZAA 2OWCA 1OBAA 3EDFA 2CPUA 3BAWA 1E70M 4UOQA 1UZ4A 3BC9A 1QNPA 2JIWA 4MNJA 1NWRA 3MMUA 2W91A 4AZ6A 2DSWA 2AOSA 2J75A 1BPLB 5BXRA 2BFGA 4AZCB 4HZ8A 5JBEA 5A2BA 5JIPA 3B8SA 1G94A 1ODUA 2J7GA 4YPJA 3WELA 1UWIA 1M01A 3PZNA 4P7QA 2XVNA 1MXDA 5EFFA 1FP9A 4BQ4A 3U7VA 1PX3A 2VX6A 1UWTA 4MADA 4HZ6A 3VX0A 1UH3A 1DWGM 1WPCA 3ARQA 3CHEA 2WANA 2UWFA 3DHUA 1JXKA 5DT7A 4OBSA 3BXWA 3WNMA 2E9BA 1QHPA 4J3TA 6A3HA 1W3JA 4M56A 4UQBA 1KFWA 3AFBA 1GVYA 1CGWA 2GK1B 5I24A 1PIFA 1KB3A 1UR1A 4P8WA 1HT6A 1ISZA 4CD5A 2GJXB 3AHZA 1HJXA 3SIMA 5FOOA 3AMCA 3GM8A 3UEQA 1HF6A 3BMVA 1E6QM 3VDBA 2D3NA 3CHCA 3F4VA 5A6MA 1BHGA 3TOPA 1NH6A 1E73M 4UOJA 4MPKA 1BAGA 3W37A 4CU8A 4JIEA 1A3HA 5A8QA 3IANA 3DYMA 3AOFA 4MB3A 4X0VA 1BF2A 4CVWA 1EDTA 1XGZA 5LYRA 4H2CA 3A4XA 2YKKA 1QI4A 4PMRA 3WDJA 5BYWA 1W1TA 4H7VA 3VIPA 1JL8A 3ZMRA 9CGTA 1CDGA 2YJQA 4PTWA 2BHYA 1E3XA 3JUGA 1XCXA 4ATLA 2WMIA 2WHLA 3U7BA 1J0YA 1J9YA 2D1ZA 4JFSA 2X05A 1UYQA 1ODZA 4V2XA 3WNNA 3WL1A 2DPEA 5BCAA 4JKKA 1B3XA 4F8XA 4F79A 5C8BB 2D2OA 4W85A 3WQ4A 1GONA 2J8GA 1U2YA 1MQQA 3OZOA 5BXSA 4HZ7A 3A6OA 1TZ7A 1HKKA 3GXFA 4S3JA 3OA5A 1UWQA 2J77A 1DP0A 1R7OA 3WBEA 5FCZA 3WENA 2J7CA 4IISA 3TTQA 3U5UA 1ZB5A 3CHDA 3N11A 5KEZA 3KWXA 1E55A 1VF8A 1EDQA 1E3ZA 1W3KA 2OYKA 1CXHA 1GHSA 1ZJAA 3EYPA 3VGDA 3PZQA 4U5IA 3CZ8A 4D71A 2G3MA 3NSMA 1HIZA 2ZUUA 4TVCA 2ZE0A 5E0CA 1L8NA 4HU0A 3VGHA 3WBAA 1ZBWA 4W8BA 4Z2GA 2OSYA 1VFFA 2NSXA 1JAKA 1M03A 5I6SA 2YA0A 2XM2A 1BQCA 4RE3A 1Q6FA 3KL5A 2XUCA 4LYPA 1PIGA 4TTGA 3ALGA 1UR9A 4PSRA 2BS9A 1JI2A 4D6DA 2BY2A 4UZSA 4OJYA 1OCQA 4PMQA 2BVTA 3VD7A 1Q6EA 3CUIA 1J0HA 3WF1A 1JFXA 5A8OA 5A69A 3QHMA 2VRQA 3SUSA 1HP4A 1UA3A 1UOKA 3ARRA 4GXPA 1E6NA 1MW2A 3VVGA 2G3NA 1C8XA 1B3ZA 4D6HA 2MANA 1WDPA 2WC7A 3ARUA 3SUWA 2WVSA 3AS1A 4M81A 5BRQA 3WEMA 1W2VA 3OGVA 3IK2A 2QPSA 3ZR5A 4UFIA 3WKZA 2JALA 3T2PA 1NP2A 3ALFA 1UD3A 4KRTA 3K8KA 2GDVA 2VO5A 3BAIA 3MV11 2ZXAA 3VGEA 2E40A 5A94A 5A8MA 3AROA 3VIIA 3VIHA 1X1NA 5M3WA 1EDGA 2E9MA 1I1XA 2VZOA 3OIHA 1JNEA 2WVUA 1B90A 4S3KA 1GOOA 2XFYA 1KWGA 1V6WA 3VD9A 4K68A 1UH4A 1FFRA 2FHCA 2W61A 1UKPA 1E1FA 3QGVA 3NIYA 3W6MA 1BYDA 4CCEA 4EANA 3T2QA 3AHTA 1SMDA 1DWIM 4XB3A 1VRXA 3WH6A 4D6IA 3RIKA 2YL6A 1BVZA 1FP8A 1UG6A 2JIEA 3BGAA 4J3VA 2J78A 2Y24A 1M53A 2WZHA 1V3MA 5DO8A 3ZM8A 2F61A 1HVXA 4PMVA 2W4XA 4D6FA 4GI9A 4P7LA 1B9ZA 4N0RA 5BXTA 1QW9A 1US3A 3GTNA 2XHYA 1Q4NX 1V3HA 1GW1A 1JXJA 4UFJA 1DHKA 3WH9A 2Y8VA 1RH9A 4URIA 1DWAM 1V6UA 4F9JA 3B9AA 1UD4A 2EEXA 4QLKA 1JYVA 2WAGA 4LYRA 1R8LA 1CPUA 3PZGA 4PYSA 2VQUA 3WQ8A 5IHSA 1LJYA 1R85A 2BVYA 3ARZA 4GO8A 1V3LA 4HP5A 1BYAA 1XD1A 4HOWA 2UY4A 1MQRA 2WSPA 4AD4A 1MW0A 3EBVA 2VVSA 3HN3A 2XJ7A 5D9NA 4QFUA 1WCGA 3LPOA 2OYLA 4W93A 2V5DA 3T2OA 3KEHA 1BVNP 4KMQA 1FHLA 5I78A 3A4WA 4NZCA 4W7VA 1HJUA 2CIPA 2VZSA 3N15A 2XM1A 2DSZA 4AZIA 2GUYA 4OUEA 1MW3A 2EXOA 5ECUA 3CPUA 1E72M 3CGTA 5A8NA 1M04A 1TG7A 2WVVA 1VJSA 3EDJA 1CIUA 3VM7A 1GZJA 1EXPA 3BSGA 3AS0A 1HKMA 3W27A 3ARSA 1PEZA 3T0BA 3LPGA 4B15A 4UQCA 2FH6A 1W3HA 3UESA 1VFUA 3IAQA 2HISA 4UQ9A 2YL5A 3NSNA 2QF8A 1J0IA 4MNKA 3WQ5A 2FHFA 4GKLA 1MFVA 5D8ZA 1E0XA 2WB5A 4KGJA 4JFWA 2YBUA 4JHZA 5CPTA 3ZSTA 2Z1KA 3VIJA 2YDSA 3AMKA 1ZU8A 4HMDA 3DYOA 2IXVA 2YDRA 3VDCA 1W3LA 4J28A 1E1EA 2VCAA 2PWEA 1UKSA 2RGMA 3F5LA 3KZSA 4CD4A 4UOZA 2CNCA 4EKJA 3GDBA 7A3HA 4GO9A 1I75A 2V3EA 3T0DA 2QMKA 4FLRA 3AHYA 4PMOA 3PHAA 2UY5A 5FL0A 1E15A 2YBTA 1RP8A 3AICA 3F5JA 3WD3A 1JF6A 3VUPA 5A2CA 1KGXA 3AMDA 3K1DA 5ABEA 5FKYA 1TA3B 1NP0A 3BLKA 2RGLA 1HL8A 4JFTA 1J12A 4M1RA 3B9DA 1F4AA 1U30A 4D1IA 4M80A 1E71M 2J62A 3VD3A 4WKAA 4C7FA 1UD2A 4JCLA 1V03A 1EO7A 1UKQA 2Y5EA 1HJVA 4JKMA 1A47A 2WK2A 3VTRA 4AD2A 1EQCA 2XTKA 1LF1A 3VD4A 3ARYA 4RE2A 4MDOA 1OB0A 5EBAA 2V38A 1HJSA 1ITXA 1JD9A 1CXIA 2DH2A 1CWYA 2WLYA 3B9EA 1MW1A 5LA1A 1UUQA 1UQYA 3CUJA 1F4HA 5E6ZA 3A4AA 2FGLA 1VEPA 2OSXA 3MMDA 3VMPA 3MU7A 2ZIDA 2J4GA 2VL4A 5IFTA 1GOMA 5EB8A 1CGYA 2XFRA 5ABFA 3POHA 3DC0A 2WC3A 1QNOA 1GJUA 3RJYA 1OIFA 4BS0A 3OLEA 1B3VA 1UZ1A 3RDKA 4DM1A 3EDDA 4UFMA 1S46A 3WQWA 1FA2A 3ARVA 3K8LA 3G6LA 5D9PA 3W81A 1H09A 3TTOA 2EPNA 2J7DA 5A3HA 4AD1A 1WAWA 3AS2A 1E4IA 2VQTA 2WMHA 4JL1A 3ZJ7A 1CGVA 4W84A 1G1YA 1W9BM 1CGUA 1QI0A 2GVYA 1KXTA 4GI6A 4WIWA 1W1YA 2D0GA 3MUZ1 1DEDA 4A3YA 1V0MA 3N04A 4UZUA 3VD5A 2XGIA 2O9PA 1ZJBA 3BAYA 2D23A 4GIAA 4DUVA 2AAAA 1B2YA 2WNWA 3WDQA 1UWSA 4CD7A 5JIWA 1HNYA 3L2MA 5E09A 3WH5A 2XSBA 3MKKA 1QBAA 4D6GA 1BG4A 2WWDA 3NUKA 3POCA 3PZ9A 3WSUA 4PMXA 2FH8A 4H8HA 1ITCA 3KL0A 5A8PA 5JBFA 1C7SA 1Z32X 2W66A 4PBGA 4YHGA 3GZAA 3N18A 2UY2A 4JFVA 2VZVA 4XZBA 2YA2A 1GOIA 2VNCA 1KCKA 5HXMA 3SURA 4HPGA 4CU7A 1XH2A 3VIFA 4PUDA 1UWRA 2PWGA 5D8WA 4KH2A 1HJWA 3A3HA 1KWKA 1BGGA 2D20A 3BAKA 3PZVA 3W26A 1KGWA 5DEZA 2X0HA 5A95A 3NSXA 2DT1A 1C3FA 1NOUA 1XV8A 1JZ6A 4PTXA 4M8UA 3ZSSA 2XVGA 3ZQ9A 4OOZA 4ZEPA 1VB9A 3PZOA 3AMLA 2WHKA 5DMYA 1NWUA 4BQ2A 4FLSA 1V0LA 1DTUA 1BGAA 5A6BD 2CXGA 3THDA 1NQ6A 1GPFA 1UR0A 5GNYA 3CUFA 3MANA 3PTKA 2V3FA 4J3UA 1PZ3A 4AW7A 1J0JA 1B30A 1V6VA 1FFQA 2J7FA 2WC4A 4P8UA 3AHVA 1OWQA 2EO7A 4LX4A 2DIJA 5FIPA 3HJEA 3OLDA 4PMUA 1JZ5A 2C0HA 1WZKA 2WMIB 2QMJA 2PWDA 5BRPA 3SCPA 5CZKA 1OGBA 2E8ZA 1W9XA 1GOWA 4U3CA 1EIBA 5GNXA 1PBGA 2VC9A 4Z2KA 5HDRA 1J01A 1CXEA 1E5JA
chains in the Genus database with same CATH superfamily
1D9EA 1OF8A 1SR0A 1NEYA 5A6BA 1Q66A 1UWUA 3LCFA 1J10A 5EYWA 2GWNA 3QW3A 1PZ1A 3LLFA 3W7EA 1P48A 1WE5A 2YPIA 3M0LA 4QP0A 1H49A 1FHUA 4MKNA 3E0LA 3LSBA 1Q8JA 1P7TB 4NI3A 1XCFA 3GBDA 2GUBA 4WSJA 4DWSC 2QDGA 5LNRA 2WJDA 3DXIA 3WF4A 2JE8A 1OX4A 3TU9A 2OOGA 2JEPA 4LAUA 3CV7A 5EGRA 1DXEA 1EH9A 1XQKA 4N9DA 1IZKA 1GORA 2ZRWA 3WX7A 4H9MA 2YDAA 4QHRA 2HV5A 5AC5A 2R91A 3LHVA 1UIPA 3HQNA 3ABZA 4PZVA 4KQNA 3GIQA 4Q22A 2WNNA 4TV6A 2OX1A 4FXSA 1H7WA 5FSDC 3M44A 3SQSA 2J25A 2HZGA 1UD6A 3H2MA 6REQB 3IJ8A 4KWWA 4ROQA 4LVGA 2FPYA 1ZFJA 2QUVA 5C7HA 1PUDA 3GC4A 2AQWA 5A6LA 4CU6A 1XD0A 1YPFA 1EJSC 1Q6GA 2P50A 1EL3A 1HN1A 4BEUA 2ZRZA 1XC4A 2YBVA 3W2MA 3FK4A 1UR4A 2XWEA 1O7AA 1R47A 4F0SA 3S2LA 3DHFA 5HR6A 4C6BA 1VCGA 1SJBA 4GA8A 3V1HA 3SUTA 4DB7A 1ML1A 3W7DA 4IWWA 2O92A 4XUYA 4GQGA 5HJXA 4LCSA 5G4WA 5FJJA 3OQEA 3QC0A 3M5VA 3EAUA 2PDCA 2RKXA 5LZLA 3B40A 1UKOA 4PL1A 1D7KA 3CBWA 3II1A 1KBLA 3BV7A 6PTDA 1RLDA 4O28A 1P4CA 3ZVHA 4XQ6A 3T55A 1RLCL 3RM8A 5M5DA 1ISXA 3PVFA 5HUOA 2PGFA 4BI6A 1FWEC 4YTQA 3ONBA 4UTTA 3AIBA 3VKKA 1OC5A 2QV4A 3KRBA 1JIBA 3C86A 4H6KA 2YFNA 1R2TA 4AIOA 1Q6OA 5A5WA 4ASTA 3E6EA 2I7GA 1UHVA 3MO4A 3BMXA 3MSRA 5H91A 2J24A 5HANA 1E56A 3SJ3A 3GIPA 1H5VA 1XRFA 1M9HA 2G3FA 3F4NA 1P6BA 4BF7A 1TVPA 3OB8A 2PDNA 3OZYA 4I8YA 1W1VA 1SFSA 2ZX6A 5DCDA 3B9NA 1S1RA 4O50A 5D2WA 4QEHA 2PDXA 5CJMA 1H11A 4R5EA 2WVVB 3WLHA 4UMBA 3PB0A 3RPTA 4MAZA 1ONRA 4WVXA 3WNLA 3R10A 2PURA 1TVNA 4HN4A 1TTIA 3ITYA 2DZPA 2NX9A 1TJ0A 5H6HA 3W84A 1SO5A 4EPKA 2XYLA 4AZ7A 1A5OC 2WXDM 3H70A 2PWHA 3EZ4A 2B7PA 4IGMA 3BGJA 4C7GA 3W7RA 1J8VA 1Z8AA 4MJ4A 4GRSA 1VBUA 1PS9A 3KOXA 2ATSA 1ISVA 3PFRA 3BW2A 4YTSA 3GNOA 1OK6A 1F3EA 1BYCA 4BZYA 1W9PA 5C9UA 2XH4A 4E38A 4LVFA 3OBAA 3A12A 2OXNA 1KM5A 4RDWA 1KKOA 9XIMA 1REQB 3B8TA 3BW4A 4LQ1A 1CLVA 1C8QA 4DNHA 3QR0A 2HS6A 3W01A 1GVQA 4LS2A 2RAGA 3KL3A 3QTGA 4GYPA 4NAEB 4QAWA 1ALDA 3RR4A 1PWMA 1YDVA 3WQPA 3VCCA 2YCLA 1QAPA 1XINA 4RKAA 3FY1A 3GVWA 1U33A 1GVRA 3A21A 4L61A 3O15A 3E1F1 4O11A 1A4LA 3B97A 1F61A 2HEJA 3LPFA 3VOJA 2CESA 4LAOA 2R1KA 4MB4A 1Z44A 2XG9A 4F0MA 2EG8A 3FFSA 2VEKA 3W7CA 1Q13A 4QLLA 2BOGX 1R9YA 3W76A 4J2PA 1UR8A 1IT0A 2NV9A 2GVJA 1JUKA 3WLMA 1K9TA 4JY9A 3QOMA 4K3ZA 5FEWA 1W9DM 4JAWA 2F9RA 2Z1SA 1MRQA 3I7RA 2HXUA 2ZRVA 1DQWA 3TQKA 1AJZA 3MJMA 1VRDA 1UKTA 1YQ2A 2YDQA 5FD0A 1SJDA 3AIEA 3O2LA 1TMHA 5K2ZA 4ORIA 1VH7A 2G3IA 4V27A 1O5XA 3G6MA 1JDDA 4ZFMA 4KEUA 4XZMX 2E9LA 3S2CA 4QXIA 1OT2A 5B7YA 1VBHA 3S6OA 2CLKA 3SCWA 2BHUA 4AZCA 2HE8A 2ZX8A 3BOLA 4AIUA 3W6LA 3WIJA 2FKPA 4G7EA 1TO3A 4P8XA 3HV9A 1G0CA 4DM2A 4IQJA 1AZ1A 3GH5A 4GZIA 3EX1A 6ALDA 2PLJA 4QRNA 4AWEA 3S8HA 1WOAA 3REQB 3PNZA 2OT0A 3OZPA 3SGGA 3UZJA 1WNOA 2J6XA 2ISDA 2CBUA 1QI5A 2FHBA 4X0NA 1ISWA 3WBWA 4AU0A 2OQLA 2Z1XA 2POTA 2PLMA 3ZOAA 5BNKA 2G50A 2V6AA 2VEGA 3ITCA 4GUFA 4BFAA 2DT3A 1ZUAX 2GK1A 2QUUA 1WXYA 3WH7A 2GJXA 4EXAA 5KINA 1KKRA 1XYBA 3R1ZA 2ACRA 3APYA 3N2TA 4XV0A 2WHJA 3FKRA 1JAEA 2JEQA 3ARXA 3BG9A 2VEFA 3H21A 1IZCA 1R2SA 3NZ1A 3USZA 2ZCGA 1E6PA 2WLZA 1QXLA 5I7GA 5CJNA 4FF7A 1AJ0A 4LEQA 1TR1A 1NF0A 3WJSA 3C2EA 4LGXA 1EA0A 3FEMA 3UJFA 5CPNA 2AMXA 2GOKA 2ZUTA 4AY1A 4XBJA 3OIXA 1JCXA 4FX8A 3M64A 1ADOA 3SIZA 2XSAA 3TZNA 2Z7KA 4IP5A 1XYMA 3VIGA 3B0XA 1BRLA 3W7QA 4NI8A 2WSKA 2IQTA 4J5NA 4A8RA 3WNPA 4IUOA 1W6TA 3VIOA 1XBZA 1SFTA 4AF0A 2VENA 1BVWA 2PBOA 3LSCA 4PBEA 4O1EA 1VP5A 4ICMA 4PC8A 1SM9A 1ENUA 4KW2A 4C7DA 4HPJA 3KTCA 3C2YA 2D0HA 4MY1A 2BXZA 5CSUA 2HTMA 1OD0A 5I09A 2YXOA 3ZWTA 2D0FA 1KXQA 1RHCA 3EDKA 2BHZA 4FS9A 1X39A 4WJXA 1SW7A 4X63A 3W25A 5I3DA 2VZUA 1UB3A 3N17A 2A6LA 4D8ZA 3L0NA 3E49A 2OWWA 3AYRA 3ORWA 1VJZA 4Y9NA 3RAOA 1QO5A 3FAWA 2A21A 1D8CA 4HMNA 3TYCA 8TIMA 1EWDA 2DZXA 2DEPA 2Q09A 4Q4QA 2VT0A 2QJNA 1R9ZA 1R87A 1JZ7A 5CJ5A 2CKSA 3B05A 2DT2A 5CG0A 4NZ4A 3OVPA 1R3RA 3DGBA 1SYTA 1G67A 1H3GA 3EB2A 2V8ZA 3LENA 3E0IA 1YKWA 3TQ0A 3GZ3A 2C18A 2VVNA 2QUTA 1AW1A 4JX4A 4UQDA 3I3EA 2XVKA 2PC8A 3WUGA 1ONXA 1W9VA 4D6EA 3AXHA 5MKGB 3NDYA 4UCFA 2ZZ7A 3CO4A 2DQWA 2XVLA 3NPVA 3ZLGA 5CLWA 4E0CA 1AW2A 3KBSA 3V0SA 4HK7A 3ZJKA 1WKEA 4FEZA 2EKGA 3L4YA 1DIKA 4QNEA 5CAKA 1CW2A 1YYAA 4EF9A 3LRLA 3TLLA 2H90A 3T44A 4EK7A 4HB7A 5HMFA 3S2NA 3KCOA 4TX8A 1IF2A 4ZO8A 3QZEA 5D02A 1QI2A 3KCJA 3LB0A 4HYVA 3H2CA 3FXGA 4JTTA 4P5UA 4ZE4A 4OIFA 5DF0A 4QLJA 3MUY1 4LC6A 1W3IA 2Y5JA 4IMGA 3NJ3A 4IFKA 2J74A 4E6MA 5M17A 4YJ5A 1OCNA 2XN1A 1J0ZA 2PPGA 1YPXA 1EJRC 2Y70A 4BHYA 1D8WA 3U2EA 3NQBA 2ASHA 1BLIA 1IZJA 5F2LA 3GTFA 4A21A 1ESWA 3F4DA 1DWHM 4Q32A 5GJMA 3VDHA 3CTLA 1A5MC 4LUTA 3CYVA 2E4TA 4F48A 1A3XA 1LOQA 3RM4A 4PFHA 4NKCA 1TELA 1K8YA 2LLEA 3O8AA 1CXLA 2A3HA 2E6FA 3WLPA 1EF3A 4O19A 3EOUA 3UBPC 5HATA 4B9YA 2REQB 1Q6CA 4OGZA 4AXNA 2BY1A 2QCDB 2NSOA 4ACYA 2FMOA 3SUUA 2CEQA 3BLOA 1V3KA 2C13A 3M6DA 1CNVA 2Z2BA 2WKLA 2NQHA 3WNKA 1G4SA 4PCTA 5EMUA 2CLFA 2E09A 3CS2A 3C2VA 1DWFM 4MLRA 2XFFA 3GKAA 3HFTA 3VILA 2BTMA 1CXKA 3GLCA 3P84A 4WGHA 2P8BA 4E8DA 1UOZA 3NURA 1XBYA 2J66A 3PS7A 3OBEA 1V93A 3FLUA 4J35A 3PZUA 1XS2A 2ZRXA 4HHPA 5C9WA 3RRXA 4ES4A 2QF7A 3OEXA 5AC7A 1RBAA 2G97A 4A8IA 1IV8A 1B5TA 3MSDA 1K6AA 5HNRA 4R27A 2YZ5A 1UD8A 1XUZA 3DEQA 2NVDA 2OSWA 3AQUA 2ODOA 1ZJIA 2WMGA 3F4WA 4GUIA 1XFBA 2VX4A 1E6XM 4JN8A 2CCRA 1S38A 3PTMA 1QTWA 2AQVA 2Z7GA 2CBVA 1TA3A 1UQZA 2CZEA 3RXZA 3ZLFA 2I1OA 4CN6A 4H41A 4J3WA 3DESA 1CENA 5AVHA 3R8GA 4DBWA 3ABXA 3N2BA 2RDTA 1CGTA 1UZDA 3C6CA 3QLDA 3YPIA 1YLVA 4ZXLA 3NGJA 3QJAA 3VNLA 3IAPA 3I3DA 2PDJA 2WHMA 3EWBX 3UY8A 1R9XA 4UCGA 2GSEA 3OG2A 2JK2A 3UWVA 1VD6A 3GH4A 4BKNA 1TREA 2X0YA 4IL2A 1ELSA 4QCEA 4GI4A 3HG2A 4JD4A 3G77A 2E0PA 3F2CA 1R86A 4UNLA 4AZHA 4FO4A 1ZBKA 1KLZA 4HNOA 3PBGA 1C29A 1J93A 2SFPA 4ATDA 2PBGA 5HAOA 3GBEA 3DYPA 4ZB5A 1IEXA 1MVYA 5K9DA 3VI2A 4GX9A 4GYFA 4PH6A 2NLIA 3FA5A 4B2DA 3TSBA 3B9OA 3RX4A 1VFOA 1BSIA 1R46A 2XIQA 1OGSA 4W4QA 2CWXA 1XSIA 5DELA 4P7NA 4LRTA 2F2KA 1KFEA 3LK6A 4IPLA 2Y88A 4BI7A 4L4PA 2NT1A 1S5MA 3TAKA 5A6TC 3IGHX 3TC6A 4PRRA 3EB4A 1C7TA 4GVGA 3H12A 4JDBA 3VIKA 1Z41A 4DJED 5DBTA 1PX4A 5JBDA 4GISA 3FHAA 1WBJA 3LCHA 4MWAD 3AI0A 3KE0A 3SCQA 1QW8A 3QPEA 3TCEA 4LY8A 4QSFA 2PDUA 3EDFA 4XAYA 2Q3OA 5DQPA 2JIWA 2CU0A 3LHUA 4M3PA 3PJWA 4B5TA 4HQVA 1P43A 4QG9A 2BFGA 3C2RA 1XLEA 1XFCA 1BTMA 2RFGA 6XIAA 4YPJA 1K70A 2DU2A 3PZNA 4OHQA 2XVNA 5AYZA 1MXDA 1OZQA 5K3VA 3CL7A 3VKJA 5IOBA 3CAKA 3WJZA 1UWTA 3E74A 3CHEA 1WPCA 4JOMA 2WANA 2UWFA 1KM1A 3DHUA 1JXKA 4GGHA 4WDWA 1GPWA 4J1OA 3BXWA 4HYRA 2PCQA 2ACQA 1A4MA 4M56A 3OHIA 3AFBA 5D33A 3TXVA 4MWAB 2FPTA 3BL3A 1PIFA 1KB3A 1QDSA 4GABA 1X1OA 1ISZA 4BWLA 1H1ZA 2AL1A 3WFAA 3AHZA 3AMCA 3GM8A 1CB2A 4BF9A 3BW3A 4IIDA 3BMVA 4JYDA 1E6QM 1FWAC 4EX4A 1TZ9A 2C1HA 5KTLA 2Y1HA 4B5VA 4PUWA 1BF6A 4JIEA 5A8QA 5K7JA 4L64A 1BF2A 1SO4A 4LUYA 4C6LA 3TE9A 3A4XA 2OU4A 1W1TA 4H7VA 3VIPA 1JL8A 3L23A 3P82A 2QKFA 4NJKA 4PTWA 1XCXA 3A9BA 3QLLA 2WMIA 4NAFA 3GS6A 2ZA1A 3U7BA 1UC4A 1UYQA 4V2XA 1FWGC 2ISFA 3WNNA 3CL6A 4KFPA 4CNSA 3KTSA 1B3XA 5FEXA 4F79A 2D2OA 1O1HA 4WXZA 1H7XA 4Y8FA 3W9ZA 1E9ZB 3STPA 3OZOA 5BXSA 5EY5A 1EUAA 3EX3A 1SZNA 1HKKA 3GXFA 3S9ZA 5CC7A 4GQBA 1XL9A 5DXYA 4JTJA 1T5AA 3FJNA 3V75A 2J7CA 3WENA 3N9SA 3TTQA 5KEZA 1QR7A 3LXAA 2Y61A 3TTEA 1QWKA 2YYTA 3VDGA 4XAPA 1EX5A 1P7TA 5F2MA 1KFLA 4K7VA 2V63A 4FZIA 2OYKA 1UUOA 1CXHA 3QV8A 5C2CA 4UXDA 3W7OA 4D71A 3NSMA 1R5YA 2VWSA 4HU0A 3LHTA 3UCDA 1VFFA 2OT1A 2QJHA 4FOKA 1IGSA 4GMEA 1BQCA 4RE3A 1LM1A 3KL5A 5B80A 3GHUA 1PIGA 4FSAA 1EPVA 1W1IE 1UR9A 3R4IA 2QW5A 1L2QA 2BS9A 4XIMA 4V1XA 2BVTA 1Q6EA 1J0HA 4QX4A 1NELA 3VNMA 4ILSA 1HP4A 2WNZA 1UOKA 3ARRA 3T07A 1E6NA 3N6HA 3VVGA 3EPNA 1B3ZA 4D6HA 1TPFA 3FSUA 5FESA 4QEEA 3LMZA 1YDNA 4M81A 2PP3A 3S2MA 5BRQA 3N6JA 1Z3NA 3NZQA 1W1B1 2HMCA 3T2PA 4GLEA 1XIFA 4KRTA 3GY1A 5A94A 4YLWA 1Q65A 1DQXA 3M0KA 2EJAA 1F9CA 4XZLX 1CT5A 3NFUA 3P61A 2W9MA 1B90A 1NU5A 1GOOA 1LRTA 4NYUA 1KWGA 1V6WA 3VD9A 3UGVA 4DF2A 1FFRA 2BB0A 3QGVA 1ADDA 3TR2A 3UPMA 1BYDA 5U4NA 3CUZA 1EP3A 3KHDA 3LHWA 3R0KA 3T7VA 1U5VA 3T2QA 2WQDA 3JU2A 1DWIM 4XB3A 5FJOA 3SBFA 3DKLA 1BVZA 1UG6A 3F03K 1OFEA 1YMYA 2WZHA 1V3MA 4LAKA 2F61A 3LTPA 4DZAA 5BXTA 4MF4A 2BBFA 3T8QA 3M0VA 4KBXA 1DJNA 3TN4A 3NQ2A 4UBPC 3QSTA 3B9AA 3VCRA 2EEXA 4RXGA 4DQWA 5CC6A 3UZWA 2WAGA 3PZGA 3WQ8A 1RV8A 1VFTA 4JS3A 2DP3A 1ZQ5A 4OU1A 2GWGA 3IUIA 2V5KA 4HOWA 1O94A 3QTPA 1K1DA 3N19B 3S1WA 1T96A 4X61A 3E2RA 4M6VA 4E4FA 4ERAA 1KFJA 2OYLA 4W93A 3BQ6A 5JU6A 4LWWA 3FVMA 2XFWA 5HWJA 3M0HA 4H9UA 1HJUA 2CIPA 2PE4A 3V18A 1CX9A 1JPDX 2GUYA 4OUEA 1E72M 3CGTA 5A8NA 2WVVA 1TG7A 1GZJA 1Y65A 3AS0A 1HKMA 5I02A 4TR9A 1PEZA 1OQFA 1MUWA 3UJ2A 4UQCA 1PWLA 4ZR8A 3IIPA 1W3HA 2NWSA 1TB3A 3R25A 2YL5A 3NSNA 2QF8A 4HBKA 4Q33A 3WQ5A 3GHTA 2H3DA 1IE7C 4ECLA 5D8ZA 2F6KA 2YBUA 2I9EA 4OECA 1ONWA 3AMKA 1K4HA 4HMDA 4MZYA 2EF9A 3KW3A 3AYTA 4FI4A 3HPSA 3TN5A 1TPEA 4FXJA 1E1EA 4AQLA 1SU5A 3G0UA 5AHNA 5XIMA 2PWEA 2GQ8A 1PXGA 1UKSA 3R0UA 4OV9A 2V3EA 2AGTA 3T0DA 1DORA 4J4KA 5D2XA 2R24A 3PPHA 4CCZA 5EPDA 4K1GA 1IIHA 1KV8A 3F5JA 1F5ZA 1X38A 1TPWA 2RJHA 2ADAA 1HL8A 3B9DA 1F4AA 1TPVA 4M80A 3VD3A 4E3VA 4NAEA 4OFCA 1TQJA 3VZXA 1EO7A 1XLFA 3T9PA 4JKMA 3SECA 1DXIA 1Q85A 2G5WA 5AHMA 1LDCA 2XTKA 1LF1A 2W27A 1HJSA 4LBUA 5HA7A 2ZE3A 5CKSA 4UNKA 1FKWA 4KIRA 1I60A 1AD1A 2WLYA 3B9EA 4EVZA 3VKDA 2D73A 2RDXA 1F4HA 3NO3A 3QFEA 5FF7A 3HQ1A 2FGLA 1TZZA 2GGIA 3CIXA 3MU7A 4H83A 5FEZA 3RCYA 1XDMA 4Q8MA 4JYEA 4ZQNA 1BWLA 1GZGA 5IFTA 3F7JA 5EB8A 4FOJA 3POHA 1MUMA 3I4KA 1QNOA 5DRCA 1JPHA 5ABTA 1OIFA 2QDDA 3OLEA 1TTJA 4EF8A 4O53A 3MUXA 4UFMA 3G2GA 3LBCA 3KFTA 3FIGA 2ZA2A 4N9CA 2TYSA 3HPFA 1DVJA 3BO9A 4AD1A 3W23A 3EOEA 1RBLA 4JL1A 3RLUA 1F74A 3CQKA 1TV8A 1W1YA 1S2TA 3UYIA 2C79A 1N55A 1K02A 4UR8A 2Q71A 2Q3RA 2D23A 3QF0A 3UZZA 3K30A 4R33A 2AAAA 1W8GA 2WNWA 3WDQA 3REQA 3T78A 5JIWA 1TE6A 4TQTA 3L2MA 2XSBA 5CH9A 1QBAA 1Q2RA 5T91A 3HG5A 1RQBA 3QXBA 3FJLA 1SZFA 1GT8A 2FH8A 5LSMA 3CV6A 3GZAA 3B8IA 2UY2A 3UXAA 4PBFA 4YTRA 4ZOCA 1GOIA 1KCKA 3SURA 4CU7A 2QUMA 4PUDA 1UWRA 4KETA 2ZA3A 5D8WA 3RLGA 4L6OA 4HPXA 1QK2A 2J27A 4N2YA 1KWKA 4N6EA 2Z1BA 1BGGA 2ZRUA 3PZVA 4H8NA 4AC7C 5G2HA 1CB7B 3W26A 1F7BA 4Q4KA 2DT1A 3TNBA 1JZ6A 3NPXA 3TSMA 3B4UA 3EEGA 3GYEA 1GGOA 3IJ6A 3AMLA 5DBUA 1XF0A 2WHKA 1KO0A 4RE0A 3T1GA 5DMYA 2PTYA 2NQ5A 4BQ2A 3QN3A 1KM0A 3U4FA 3PANA 1ZCCA 1MEIA 1BGAA 5A6BD 2CXGA 4ONVA 3CUFA 2E6YA 3NPWA 1JUEA 4FIQA 1PZ3A 4MY8A 1J0JA 1O68A 1X96A 4UIOA 5J04A 1E51A 1FFQA 2WC4A 4P8UA 3AHVA 3HF3A 4JEJA 4HNTA 1SO3A 3BLDA 5FIPA 5LNUA 1JZ5A 2PS2A 4B5XA 5C9ZA 1TJPA 3PFMA 3GAKA 1I4NA 3SCPA 1VHNA 1GOWA 3ATZA 4U3CA 4DYJA 4GACA 1TV3A 4Z2KA 3V7PA 1J01A 1CXEA 1E5JA 3HB9A 1JQXA 3TONA 3PBVA 2E8YA 1SPQA 3NQFA 4DJFC 1RXOB 4IFRA 5FL1A 1ZLPA 4U5KA 3CEUA 3GNPA 4CD6A 3GC5A 3BV4A 3M0JA 4DAFA 1XLDA 5HR7A 1EXBA 2QT3A 3NNTA 1OCJA 4JICA 3WF0A 2QXWA 4QAIA 4HTYA 2DSVA 3O6AA 3ID7A 3H53A 4OQVA 4O0KA 1TX0A 8CGTA 4QCFA 3VX1A 2PC4A 3CXOA 3NQGA 4LNCA 1RP9A 4XZ9A 1H7RA 2PP1A 2C8NA 1QPKA 4AIBA 2J9XA 3HGJA 4PEEA 4M7SA 4M6UA 4XD4A 1GJWA 4F0LA 2HVMA 3IRSA 2GJPA 1UMLA 3WUBA 4XUGA 2QCGA 1LT8A 1TFVA 5MKGA 1EJXC 1EX1A 1VEOA 1KGUA 1EOMA 3NQMA 3LCIA 3O1NA 2BMBA 4UNIA 3PUOA 2DUXA 3MP5A 4W8LA 2FTWA 2Q8LA 3SGZA 3MT1A 1OG6A 2QYGA 2TAAA 2FMNA 2OX4A 1MZHA 4S1FA 3RFAA 1E6RA 2QULA 3T05A 1WKDA 3FNDA 3HO8A 4LUJA 1K77A 4Z2IA 3GTHA 3HG4A 1OD8A 3S6TA 4GH1A 3FEQA 3ZS4A 4JZ5A 1I2PA 3D47A 4GNKB 3UY7A 1Q6DA 1PKLA 1L2UA 4YWIA 1MI3A 2FGZA 2NUXA 1Q2SA 4GH3A 3CB3A 4N02A 3UG8A 1JEZA 3LGDA 1LBMA 2EPMX 5HWMA 5HMSA 2WZEA 2Z2UA 3FW6A 3FSTA 1OY0A 3CUXA 1H7OA 4R85A 4JTKA 4X2PA 5E0FA 3BUVA 3VXGA 3ITVA 4HMEA 4CKQA 8XIAA 3A64A 5C70A 3B0PA 5FAJA 3DFTA 3RJXA 4O14A 3I3BA 3L5LA 1AL8A 1ZJHA 5GVJA 1ZZMA 7CGTA 1JGMA 4MNMA 3L66A 3ZVHB 1W5QA 1FWSA 3R0DA 1MEHA 2PDMA 4DJDC 3H7RA 3LXBA 1BFNA 1UR2A 3QSRA 3RMEA 1XJBA 2REQA 4EPDC 1NDVA 1V0KA 2QCDA 3ZJ6A 1E9LA 2BXVA 3NTYA 4IXXA 1EP2A 2QPXA 3K4DA 1QWGA 1T99A 2IKGA 2VP8A 3SDOA 4HCDA 7ODCA 3F5KA 4Q4MA 3V4BA 3HGSA 5AC4A 4ICCX 3VOIA 1PJ9A 4XAZA 4TXEA 5CZJA 5FAGA 4IUGA 1D3CA 3UR8A 3H4WA 2VDGA 4L7ZA 2OEJA 2OJPA 3EWCA 1QBBA 3T42A 3NDOA 2WBGA 4NVTA 3MUAA 3WYZA 2QCFA 3IIXA 4OOUA 4AC1X 4GK8A 1UP0A 2A7RA 3VIMA 4UUIA 2HDJA 3N2XA 3UXLA 1N8IA 3KVKA 2JGQA 4M29A 4LB4A 5KITA 2ALRA 1GQLA 4RNFA 4IL0A 2EG6A 4H4IA 3N34A 4WOQA 3IJQA 2IPFA 1EZ2A 1QCWA 4DRSA 1QNVA 4HJFA 3TFCA 2GYIA 3USBA 1ZBVA 4RK8A 3VNZA 3QY7A 2XGBA 3BVJA 3LQLA 3TIMA 5G4EA 4GFSA 4M1BA 7PTDA 4J3XA 2Y7FA 2YCJA 2NUWA 3GIYA 5EU9A 4H2HA 4YS1A 3HMJG 2F2HA 4P8VA 3KOZA 4ICNA 3CH9A 4Z1CA 5G1YA 3M07A 4WKFA 1FQ0A 3WY1A 4JTIA 1TPB1 2ZZ4A 5TD4A 3UZYA 1V02E 1V7YA 1W2PA 3SM0A 4DUWA 4W7UA 2PRLA 1HW6A 4CUCA 1RQHA 4B5SA 3EDEA 3S47A 2R9RA 4HA3A 3FXYA 4AYGA 1E6SM 3M0MA 2VKZG 5CZSA 4NXSA 2ICSA 2ZWZA 2YFOA 4S23A 4TTUA 4YYCA 3TAOA 4Q8TA 4NQ1A 4H19A 1V0NA 1DYSA 3MUIA 4KGLA 3R5EA 5HQMA 4KF1A 4IMCA 2POZA 3GWQA 2OYMA 3H2FA 2ZZ6A 4GWEA 2X0SA 3EEZA 2IKIA 3TFXA 3U6WA 1GG1A 2BVWA 3QFWA 2VDHA 4FHAA 4Z17A 4TX6A 2DSKA 3A5VA 3NXLA 4CQDA 1F6PA 2G4FA 3WLNA 4IX0A 4W5ZA 2WMFA 4Q4PA 4LS1A 3C4UA 3KRUA 3A5FA 5ABFB 2VZTA 3W02A 4Z2HA 2VCBA 1TR9A 3EX2A 3PG8A 1OCBA 3N4EA 2WZMA 3G18A 4FK9A 2B7QA 1E0WA 2VGFA 1DQUA 4NUWA 5I2UA 1XRSA 1WDQA 1XYAA 5K9XA 2HBVA 4PR4A 5BZAA 1FWFC 3SRKA 4FF5A 1ZCOA 3PZTA 5EA9A 5FJIA 3SCVA 2C1IA 5GPRA 1WZMA 3QMRA 1RAKA 3IVTA 4P7OA 3R58A 2HK1A 2QUNA 4I9JA 2ZWYA 4HK5A 3VAVA 1Z6KA 2QCEA 1XC6A 3WJWA 4WGXA 3VZYA 4XKYB 1NDYA 2IXUA 1J2WA 3H23A 3S4TA 1GYLA 3W4RA 1UA7A 4KCVA 3SR7A 3N29A 3HM7A 3GXIA 1B57A 3HPZA 2FPVA 5G2IA 3OVRA 4L9YA 1X6NA 1G9HA 2J7EA 3ZFHA 1K8CA 4HNCA 3VOCA 2YA1A 2QDEA 2B0MA 2PFHA 1VFSA 5F4SA 2VI0A 1XBVA 4PUUA 1SJCA 4ML4A 4GJ1A 4YTTA 4IPPA 3ARPA 1O60A 1C93A 4DJEA 4ZOAA 4LJ3A 4JQ2A 3W24A 1CECA 1V6XA 2VWTA 1XBXA 4AHPA 4I6VA 4G8TA 4O57A 2Y62A 4O1BA 1J5TA 4B4FA 1UJQA 3U2CA 1PTGA 4XBKA 4XD6A 4P7RA 4E8GA 2V0TA 1PO9A 1A5BA 4M0XA 3E9AA 1XDJA 1V02A 2A3AA 5K4ZA 1NOWA 1LRNA 4J9JA 3N4AA 1E0TA 3BLFA 4Y9PA 1WDRA 4WJ8A 1TV7A 4RNJA 1FCQA 1BXNA 1CGXA 4A3QA 1K8XA 3WK0A 1OK4A 3OBKA 1EF2A 3B3DA 4C6FA 4L9XA 2E1WA 4AY7A 3WJYA 4GBDA 2DIKA 1OINA 4K36A 4QQUA 2X7WA 3FX4A 2Z24A 4CGTA 3EMZA 4S3CA 5XINA 4QG6A 4PTDA 4HPHA 1EA9C 3SRFA 1RY8A 2ZUNA 1H50A 3DN5A 5G5IA 4Z2JA 3ENLA 1D2KA 2ZKMX 3ARWA 2W62A 2HXTA 1IXQA 3GDMA 2ZXQA 5D2TA 5DCBA 4V33A 1WKYA 4A05A 3PJUA 5HMDA 2ABBA 3UD6A 5DLCA 1FWIC 3RLHA 4A3UA 4W86A 3WD2A 4RXFA 1TPC1 4LRSA 1ZSXA 3UQNA 4LTSA 2CWNA 3TTSA 3EXRA 4NXKA 3NO5A 2AKMA 3AIQA 5IXEA 4MNLA 4XZWA 4DXVA 5FJPA 4MGGA 2XZ7A 5AYBA 4D1JA 3B0YA 4MLJA 4KWUA 1AQHA 1EHNA 4GFIA 1AK5A 1VYPX 1QPRA 1EYEA 4U28A 3KP0A 4H8UA 9RUBA 1S3TC 2KZHA 3Q94A 1VIWA 1UP3A 2AQOA 2X42A 3CTTA 3UF9A 3LZ3A 4IFOA 2EQDA 4RDVA 5DMNA 1FBAA 4AD3A 3SRDA 3UG3A 2C19A 4IJCA 5DFAA 4KIEA 4OV4A 3DG6A 2FTYA 3CU2A 2DZBA 4AD5A 1IWAA 1XPYA 2JFEX 4UTIA 3KS6A 3NVTA 2WW5A 4ZOEA 3JW7A 2E5DA 4HNUA 1S5TA 3TX9A 1CLKA 1B3WA 1PKNA 3BOXA 4JX5A 1CBGA 2BY3A 4M82A 5SWUA 3VYLA 4NZ5A 5D03A 4O1FA 3NYDA 3IUHA 1YXDA 1ECEA 4REQB 1YTDA 4KEZA 2J79A 3MP4A 2D2JA 3V5CA 1AH4A 3V5FA 1J11A 2EPLX 3LM3A 3ECQA 2RH9A 3ZXWA 1S5WA 3CZEA 3F2BA 2GGEA 4ADUA 4EXQA 3WF2A 4LF1A 3W1RA 3LY0A 3UNDA 3BLIA 1JG9A 3KRZA 5M1TA 3HMCA 3WFZA 1S1PA 5AECA 6XIMA 4N4QA 5A6JA 2C15A 2GDQA 2TRSA 1EYWA 4CN1A 4NHVA 3TROA 4B92A 1JZ8A 1J4EA 3TA9A 3KOWA 2UBPC 5BWAA 3NL6A 1THFD 2OMAA 3CHFA 4JTLA 2E68A 4ADTA 2DY3A 3HJZA 3N3TA 4EE9A 4J3ZA 2XU2A 4PUMA 3OLGA 3VOFA 1Q4WA 3S5SA 4QNWA 3CZKA 3MMTA 2B7OA 3TV8A 3M0XA 1XIMA 2GL5A 3CHVA 1HKWA 3UT0A 3OLIA 1H0IA 5HBFA 3QQ0A 3G3DA 3W1TA 2E6AA 4H01A 3NAVA 3VM5A 2A2IA 4IFKB 3QYSA 4RNIA 1MUCA 2ZX7A 5LIWX 3UWQA 1TV2A 1YNPA 5BXPA 4JIIX 4MWAC 4J7RA 2PRHA 4K2SA 1KRBC 4G9PA 4MAVA 4Z42C 4QSHA 3THQA 3BANA 4LUTB 3NL3A 2J8FA 3MYPA 3T4CA 6CGTA 3PN8A 4TOQA 3H54A 5C7VA 3UVAA 3G1VA 1ISYA 5D2YA 3WD4A 2OWXA 3AIRA 2C7FA 3U8GA 5XIAA 5E70A 4YTUA 4TMBA 4BI5A 1KM3A 3W53A 2YB4A 3WNOA 4QE4A 3E0VA 1VYSX 4QJ3B 2DZWA 3BTNA 4JQ4A 1KBBA 4U33A 1M3UA 2V67A 4RPPA 3GXDA 3PJXA 4DWSD 1M1BA 4LBSA 1NVMA 1GQJA 2V3GA 2P53A 5ABGA 3BQ5A 4CLMA 4JL2A 5D04C 1OIMA 2J13A 5CG7A 2A3LA 3M46A 1OM0A 4JR5A 4ZMGA 3KOYA 3E96A 1RUSA 1LCOA 4BY3A 1RD5A 4A22A 4GVHA 3U57A 3C56A 3TMLA 3IJ7A 2PDFA 3WLTA 4K37A 4NNCA 3NZRA 5BWFA 2CHOA 5IDIA 2H3BA 4GJIA 1U1UA 2FJUB 4Y8EA 3FVDA 1QOPA 1XYFA 3S5ZA 4D8LA 3GR7A 5KZMA 4YVPA 1AFSA 2HVNA 4C6EA 4I9MA 1B1YA 3GVGA 4DY1A 1VPQA 3AYSA 3WH8A 3WBXA 2X09A 4MDPA 1WDDA 3DFQA 3GUGA 3RO6A 1MXGA 4DWSB 3DBPA 1GVEA 2GQ3A 1DWJM 3DBNA 7REQB 1KNWA 3FOKA 3VGBA 3AXMA 3URNA 2PCEA 3K46A 1TTPA 2VX5A 3APTA 4H7CA 1VBRA 1TV5A 3XISA 1H2JA 1IQ8A 5K4XA 4W7WA 3VA8A 4HA4A 3LTYA 1ZALA 2PDLA 2ALDA 3C8NA 1QFEA 1NAL1 2WO5A 3CUHA 1XISA 3UVIA 1EQPA 2O9TA 4MB5A 1TUFA 3TQVA 1XH0A 3PJTA 4HD5A 1VIZA 5IBXC 3CYJA 1FRBA 1TRIA 4RR4A 3P3BA 2GLKA 1J6PA 4R7OA 5CLTA 2HVOA 2GZXA 2J7HA 3WK1A 4B5NA 5IHRA 4LY4A 1XIBA 2HPMA 1QU4A 4L6DA 1QNQA 1GKQA 3IJDA 3ERPA 3CK5A 4AG0A 3SW6A 1JFHA 3GDTA 3B8WA 3K8MA 4KESA 4GQRA 4IJBA 1JGIA 4UC5A 2VFFA 2BGNE 4HSOA 2OWCA 2XISA 4JBRA 3BAWA 1HTIA 4HIBA 4UOQA 2WM1A 3DZ1A 4ERIA 1UZ4A 3QW4B 2PD5A 4AXKA 4MNJA 3PPGA 2W91A 5BXRA 1BPLB 3HGRA 4IMEA 5A2BA 5JIPA 3B8SA 1ODUA 4JN6A 2Y63A 5H8PA 2AKZA 1M01A 3WQOA 4KEVA 4P7QA 3K5XA 4P61A 1O5KA 1FDYA 4BQ4A 4M6PA 3DFYA 2HS8A 3Q45A 4D9PA 4MADA 3H22A 2Z2AA 3ARQA 2D2GA 3W85A 3DKJA 3QQWA 4OBSA 2FYMA 3BGGA 2E9BA 2DFAA 4O15A 6A3HA 3KX6A 1MO0A 4UTUA 1GVYA 2VOMA 3LNPA 2NVAA 5I24A 1KFBA 5ENLA 1UR1A 3L12A 1HT6A 5D09A 1DBTA 5FEPA 1HJXA 3SIMA 1M5WA 4D8AA 1F8MA 2QVNA 3FYPA 4BK9A 2X41A 3RGTA 2D3NA 1LQ2A 3F4VA 1R3VA 4N7QA 3W37A 4CU8A 4X0VA 4CVWA 4PUNA 3FA3A 1PV8A 1XGZA 4MPQA 5LYRA 2YKKA 1QI4A 1QW7A 1WA3A 5BYWA 3BARA 2QCHA 1SZEA 3ZMRA 5G4HC 3SGUA 1CDGA 3EA3A 4Z1AA 1E3XA 4AEOA 2R1MA 4S3FA 3ISIX 3KDOA 2D1ZA 4O1DA 4JFSA 4PE8A 2DPEA 2IS7A 4U10A 4IGSA 4ALDA 3ES8A 5BCAA 2JGYA 4JKKA 5C8BB 2CLEA 3NEVA 4W85A 4WXYA 2J8GA 2GGGA 1LLWA 1MQQA 1DJYA 2GPTA 1Y5XA 5AC6A 1BKHA 1S2AA 3BCJA 2PDYA 4HZ7A 2C3ZA 4AWSA 3A6OA 1TZ7A 2QAPA 1FUYA 2GJLA 3HBLA 3CT7A 1ZB5A 3CHDA 1JCNA 4C1KA 3M41A 1E55A 3CWHA 1B4EA 2QNEA 5LIUX 3G1RA 1UC5A 4C6NA 4UTWA 1PKYA 3EWDA 1I2NA 3EYPA 3PY2A 4IQEA 4U5IA 3QMTA 2G3MA 2I9UA 3XINA 1AODA 2NVCA 2OFJA 2ZE0A 4AHQA 4EWJA 3L2IA 1L8NA 3AYVA 3E2QA 4W8BA 1M03A 1RCXB 2YA0A 4X60A 4S2CA 2XUCA 4OUIA 2OLSA 1VFLA 3PB2A 4L1GA 2G0WA 1JI2A 2Z26A 3WG6A 1JDFA 4MM1A 4KCTA 1WYIA 3GKFA 3QPZA 3WF1A 1JFXA 3QHMA 1QPOA 2VRQA 2YW4A 2GVEA 3OO2A 4MZ1A 3ELFA 3QVQA 3N2OA 1WDPA 2WC7A 3MPGA 1WOBA 3SUWA 2OO6A 2WVSA 3AS1A 1AQFA 1W2VA 4MVAA 3OGVA 4RV8A 2QPSA 4UFIA 1HL2A 4KFOA 3WKZA 1GYNA 2YX0A 2JALA 1NP2A 2BX7A 3BG5A 1PL9A 3K8KA 1NDWA 1XIIA 2DVTA 3BAIA 4US5A 3MV11 3VGEA 4PL2A 1HFBA 4NYYA 5A8MA 4ERGA 1X1NA 3GU1A 5M3WA 1EDGA 3CO8A 1XRTA 3OIHA 4XZNX 4S3KA 2XFYA 4NJIA 4RX0A 3FDKA 3GTXA 3VNDA 1UKPA 3NIYA 1LORA 5DCEA 2ZFAA 3WLIA 3R8RA 3DG3A 2O0TA 4MYAA 4JQAA 4UTLA 3LHZA 3SN0A 2Z00A 1P6CA 2E7FA 2RJGA 1FP8A 3BGAA 4J3VA 2J78A 2Y24A 3ZM8A 4F0HA 3PM6A 5LXEA 4PMVA 4GI9A 1B9ZA 3NQAA 1US3A 3GTNA 1XLJA 2VC6A 1GW1A 1JUBA 1DHKA 3WH9A 2Y8VA 4ZL1A 1V6UA 1Y5WA 3BG3A 4DAIA 4QLKA 3O6CA 1WV2A 4XTDA 4I9AA 1CPUA 3U9IA 1JCYA 3G1YA 1FWNA 2A6NA 1R85A 1PB0A 1UASA 4L56A 4GG9A 3QZAA 3IGSA 3AUJA 4HP5A 4V15A 1BYAA 1XD1A 2UY4A 1H62A 3CAVA 3HN3A 2XJ7A 4QFUA 4DO6A 4O1CA 3LPOA 3STGA 5MHBA 1FHLA 2VGBA 5I78A 3P6LA 2E28A 1WBHA 2DZTA 5FA5A 3S1UA 3CWOX 1GTEA 4QE5A 3R2GA 1CIUA 1VHCA 1LBLA 2ISSA 2FVMA 3ARSA 3O6YX 4F2BA 1YTKA 1VFUA 3IAQA 5LNVA 3R12A 1JCLA 3UXIA 2ISWA 3BJTA 2FHFA 4KT2A 2WB5A 4H9XA 4C91A 4JHZA 5LKYA 3WQEA 3ZSTA 2Z1KA 3STFA 2YDSA 1ZU8A 4HSNA 2PGWA 4L1WA 1Q6RA 4Q8PA 5C0QA 1W3LA 1JRBA 1GVOA 1T6MA 4J28A 1G7VA 2Q02A 1VS1A 2XGZA 2X16A 4F0KA 1K03A 5JXQA 5CAHA 4CD4A 1I2QA 3ITXA 4UOZA 4EKJA 2VGGA 3GDBA 1I75A 2QCLA 4FLRA 4Y9AA 3TSDA 3AHYA 1U5JA 5FL0A 4MFDA 2YBTA 1FCBA 1RP8A 5DANA 1PCKA 3BURA 1A5LC 2NUYA 4GC4A 1R3QA 1RA5A 1Q7ZA 1A49A 1G6CA 2V68A 3IJIA 1A5UA 3TXZA 1ONEA 2V81A 4HKPA 4X2RA 1NP0A 3BLKA 4KEMA 5I07A 4E2DA 3UXKA 4CQ9A 1U30A 2J62A 4NJGA 3SADA 1ME9A 4WKAA 1GEQA 3W2LA 1DJGA 1X1ZA 1A47A 3W72A 4WSHA 2PD9A 1EQCA 2PDKA 4L5ZA 3R79A 1OB0A 5EBAA 1KV5A 1WX0A 3LI0A 2DH2A 1PSCA 1HQTA 3EKGA 5KZEA 3I68A 1JJKA 4GY7A 3F4CA 1M65A 1Y0EA 1A0CA 1VEPA 3GC2A 1F3WA 2OOFA 2FVLA 2QJMA 2FB3A 4QR6A 2PDWA 5JVLA 2ZRYA 3LGGA 5ABFA 4X22A 1GJUA 3RJYA 1UZ1A 3WQWA 5EMJA 1OHLA 3K8LA 3GNXA 3PK7A 3GK0A 3T4WA 1R3YA 1G4PA 2EPNA 4K39A 4ADSA 4FNSA 1WAWA 1VCFA 3EWXA 2GUUA 2WMHA 1N8FA 1CGVA 1PZ0A 4W84A 1ME8A 4M51A 1WQ5A 3ME3A 3W73A 2D0GA 1DEDA 3MTWA 3P0XA 4A3YA 1XIHA 1OABA 5TBOA 2XGIA 1K3UA 5JH2A 4NX5A 3BAYA 4XKYA 2XH7A 1B2YA 2QZRA 2Y8UA 3GHSA 3QBUA 5LHFA 1UWSA 3MKKA 3N4FA 4L80A 2F6UA 3POCA 4RZ4A 3EB3A 4PMXA 1ITCA 5A8PA 5JBFA 5T8GA 1Z32X 1HO1A 2W66A 4YHGA 4UTTC 3N18A 3SB0A 3Q4DA 2FZNA 5CPOA 3H55A 2EAWA 2GVGA 4JFVA 2VZVA 4GX8A 1E9YB 1QASA 5HXMA 3LERA 4HPGA 3UPWA 2BZNA 4PB5A 4YWSA 3VIFA 2V9DA 2P10A 3M5XA 1Z89A 4KH2A 1HJWA 3I65A 4IP7A 3BAKA 3P8IA 4RZBA 2WSQA 4PGLA 1KM4A 3A13A 2WV8A 1NOUA 2A5HA 2PTZA 3CASA 1O1ZA 2XVGA 3NOEA 5AHEA 1PDYA 3N14A 2QCNA 2INEA 3LBOA 3VKAA 2ZADA 4OOZA 1VB9A 1KC7A 4ZBCA 3L7RA 1DTUA 2JKEA 2YGYA 4QTGA 5CBIA 1NQ6A 1GPFA 2NV1A 3MANA 3PTKA 2V3FA 4J3UA 3C2OA 4ZQMA 3OTRA 4ZCWA 1A53A 1K4GA 3N9RA 4A2RA 3MHUA 4LX4A 2DIJA 3HJEA 3GDLA 3DERA 4ZVJA 1FWWA 1TJ2A 1N8WA 1SZGA 5J5RA 1K8ZA 3RX2A 5FF0A 5HQEA 5HDRA 3W87A 2P88A 1YX1A 1XM3A 1ZAHA 1CCWB 1IHIA 2ACUA 3M47A 3NL5A 1GVIA 5CSRA 2OLAA 4HMCA 4Q8NA 3L0KA 3W7HA 1VFMA 2ZXBA 3W7MA 1ECQA 3CIVA 3WJXA 2Y6ZA 2QGYA 1J79A 1US2A 3N2CA 3QOKA 3UR7A 4CEXC 3W3OA 4O17A 3Q58A 5FI8A 2E6DA 4O4WA 2VJXA 5HINA 4JIQA 2XWDA 2PWFA 2Y8KA 3DX5A 4GCAA 4GYPC 4L6HA 2IUZA 4LAMA 1GOQA 3W1MA 1LQ0A 2O7SA 3P93A 1UD5A 4TVDA 4A2SA 3CJPA 1T0OA 3L4VA 1NWTA 1U1JA 2ZUMA 4K6AA 4YXGA 4WLCA 2OQYA 3DHPA 2VM8A 1I6NA 2Z1VA 1OT1A 3M6YA 1AMKA 4REQA 3K1GA 3KP1A 5CPQA 1DE6A 3PTQA 4C6KA 1VLIA 4A8LA 2G37A 3QYQA 4TVUA 1C9WA 2EJ1A 4OVXA 1OX6A 4Z08A 3SCUA 5I77A 3AXXA 4E3TA 1OJXA 1RA0A 5CC5A 1RBOB 5HQLA 3LD5A 1XHGA 4JTEA 1IR1A 1QATA 4ZZ9A 4IOTA 4UB9A 5BU6A 1BXCA 2GGHA 3U2ZA 3UG5A 3BMWA 1BSLA 4AIEA 1SMAA 2ZVIA 1XCWA 3WLJA 2CKRA 2PTDA 3C2FA 2PLCA 3IV3A 1AVAA 3WMLA 3BH4A 1WUFA 1XSJA 3O06A 2XIBA 4QG8A 4C90A 4GCXA 4XG1A 1J18A 1S3HA 4PCPA 3W07A 2BV9A 5H1WA 4ZQOA 4F66A 3GXMA 4WZHA 1G69A 1BYBA 4MJZA 4H9ZA 3STEA 3RITA 2YZRA 4EPBC 2QJGA 3RMJA 3MA8A 4HZMA 1M7XA 4U2YA 3VCNA 5GNZA 4YIWA 1BG9A 1OX5A 2F84A 2E3ZA 3LMYA 1JF5A 1O66A 4MB1A 3NQDA 4I6KA 1LROA 3W7LA 3AXKA 3O7UA 4MUZA 4B3LA 3BPWA 4MZ8A 3MW7A 1P6WA 5HK4A 2WOQA 4GZ7A 3TK7A 4LUIA 3GR4A 1MDRA 3PWAA 1KBKA 2PSNA 1KXHA 2BOEX 1EGZA 1ITQA 4RUBA 1PE1A 2JKPA 1L6YA 2C14A 2WYSA 4JTAA 1H61A 4L4LA 4J2MA 2E67A 3EX4A 4Q7BA 3DI1A 1ITUA 2Y7DA 1KRCC 3C8FA 3W71A 3GUWA 4GY0A 5JH1A 4G2DA 3S5NA 4AAJA 3GTIA 1E6ZA 1HL9A 4IMAA 4AWTA 3L0GA 3GG8A 3A3XA 1Y8BA 4KFNA 5I0DA 2I17A 1Z9AA 3HGOA 4UFLA 1LUCA 5A2AA 1ZBCA 1KFCA 4Q4OA 3BE7A 1JD7A 5KMYA 4DZ5A 3T81A 2GVLA 3JR2A 3PP7A 1PX8A 1QHOA 1O4UA 1EO5A 3TYDA 1CLXA 4J3SA 1VFHA 3O9NA 3UWWA 1WZLA 3EOOA 3TWAA 5A6SA 2YLAA 3URQA 3V36A 3WDRA 1LP6A 2DZVA 1C90A 4Y7EA 3LCGA 3VC6A 2WWCA 1NIUA 1YHTA 3D5HA 2AMGA 2OTDA 3HURA 3DFPA 2ZX9A 3VGFA 3IVSA 3O05A 2P0OA 2EPOA 1SW0A 1K9EA 5E6YA 5A6AA 2ZC8A 3VPLA 2F8QA 2ZC1A 1M7PA 3LRMA 4R9OA 1EJUC 3H26A 3C3UA 1YIXA 4PTMA 3WMBA 3MI3A 2Y2WA 4UFKA 4UQAA 4CNOA 1FH8A 1XIJA 5LA2A 3SI9A 3QY6A 4LH8A 3LU2A 4IMDA 2Y4SA 1PDZA 1VEMA 1K7XA 4RDYA 3R94A 1ZL1A 1QRQA 1TTQA 3IARA 4IQLA 4MIMA 5CSSA 2PU0A 3AJ7A 3VFLA 4IPIA 2D3LA 1J2BA 2QR6A 2VTFA 4CCCA 1QHZA 3V3WA 2Z25A 4C5ZA 4WK9A 2BGSA 3CM4A 3WLRA 2Y85A 4DWSA 3W2NA 4YCOA 4DF1A 1FHVA 7REQA 2FB2A 3URBA 5D32A 4GI8A 4HSHA 4Q4RA 2ZXDA 4W89A 2G41A 4L9ZA 5D37A 4R7WA 1Q63A 1UR3M 4CNUA 2YOCA 4YMZA 3TDFA 4GC3A 3T08A 1E40A 3MO7A 4H1ZA 3ARTA 4LFYA 6TIMA 1P0EA 1XG4A 3BAXA 3CQIA 1NSJA 4OBRA 5AYIA 5I5RA 1XYZA 3NZGA 3LCLA 2PZNA 3ZR6A 1HUVA 5C54A 1T7LA 1K9FA 3N1AA 1TPUA 3CPRA 2V5CA 4AZBA 1ZENA 1FH7A 2VGIA 1OF6A 4NNBA 1CYGA 3WLKX 3L68A 4TIMA 3L4XA 5T26A 2P5NA 3PG9A 3RU8X 4F2UA 1PPIA 3CZGA 1HXJA 3WDHA 1SJAA 4ZGYA 3TTYA 1W0MA 5HJLA 1AUSL 1TJRA 2WZIA 1DJQA 3PUEA 4FNQA 1CXFA 1YE6A 1KTCA 1ICSA 4H04A 4W8AA 1HKJA 3CIWA 3MS8A 3V1PA 1H5YA 2OGYA 2IMRA 3URAA 4QS6A 3FAXA 3IACA 3DI0A 4NZJA 1CTNA 5E9AA 2XVPA 4RL3A 3IGUA 2J6VA 2DW6A 1UP2A 1YNQA 4GY1A 3TP4A 4AY8A 2L5HA 1S5VA 3SFWA 1QNRA 4L1XA 3G1DA 3SY5A 3QHNA 4FLOA 3BCDA 3MP3A 1E0UA 3MDWA 2J9YA 4F4RA 4QDMA 2YXGA 3W7IA 2V2HA 3P5ZA 2V69A 1T8XA 4G1KA 3BJFA 1VZWA 3UZ5A 5IDZA 1J5SA 5EMMA 2E77A 2ZX5A 3I6TA 3RRAA 4QJ1A 4WUIA 1PCWA 3GDKA 7ENLA 3EOSA 3WMSA 3LLDA 3SRHA 1RALA 2YL8A 2OZTA 3KVLA 4S3GA 4G1NA 4FX6M 1EJTC 1YXYA 3N73A 3C3NA 2XH2A 2P8CA 4ZODA 1FWTA 1ICQA 1GHRA 5M03A 1JZ3A 5LA0A 5DXXA 3GH7A 2HPIA 3OOQA 3IIVA 4EAMA 2ABAA 1Z69A 5JQ9A 4C6DA 4IGHA 5BU9A 4JTUA 4E4PA 1W1ZA 2O56A 4MSSA 3L4UA 1MFUA 3DOPA 2JQXA 3AZTA 5D05A 1TPH1 2OCZA 1KXVA 4M24A 5JUVA 4JCMA 4EIVA 3RN6A 4A3RA 1GQIA 3ZT7A 2BASA 4BA0A 4C6JA 4JTDA 3CL8A 3ES7A 3AWOA 3HA1A 3WL0A 5BOOA 5J8LA 2CLMA 5G2WA 4DBDA 1QOXA 3L2LA 3NR0A 3TYEA 4AX6A 4O13A 3GVQA 5EMYA 5HNNA 1TWIA 3WZ0E 1XQLA 4CNNA 4Q7IA 4DHGA 3ZT5A 2BNJA 2XIOA 3WN6A 1VR6A 1YE4A 3GG1A 3W1QA 1RQEA 1L8PA 3VNYA 3TJ4A 4LNYA 5CEWA 4KCUA 1KRMA 1PHWA 1KR1A 4A3HA 3GR8A 4B9ZA 4U3AA 3ITOA 4HHHA 2CBJA 2PODA 1LTDA 3UCQA 2D22A 2FLIA 3RCNA 5CBJA 4MJMA 1H1NA 1OFPA 3G8EA 2QCCA 5GQBA 3ZZ1A 3UR2A 2XIJA 4O8AA 1HGYA 3P7YA 3EXTA 1WXJA 2XN2A 1KCZA 4IGNA 4HNVA 1XP3A 3G1FA 3W38A 1QVBA 2H9AB 1OVDA 1H41A 1AZ2A 3MWCA 5HJYA 3WQDA 3G22A 4A35A 4ZTYA 1QO2A 2OELA 1XKJA 3B0VC 4IJRA 3HPAA 1SFLA 3OJGA 2WMJA 3CQ0A 1DJZA 2NT0A 2GGJA 1ZP4A 4I7VA 4FB7A 4OE7A 1G01A 1UBPC 4DPQA 2VX7A 3PNUA 4Z1YA 1W3NA 3L67A 1B9BA 4LXFA 1JDCA 3VE7A 2WZTA 3KXQA 1D3HA 2PF8A 4IPJA 1YEYA 2O4MA 2ZUVA 4W87A 5HPOA 1AMYA 1MWOA 1LWJA 5DMLA 4UTFA 2FZ8A 1V3JA 4D6CA 3RHGA 3MBDA 1YDOA 3QHOA 3LCWA 1TWZA 2NW0A 3OW1A 1OFDA 4FXFA 3IRDA 4S3BA 1W91A 3M0IA 2HE5A 1JI1A 1SFJA 1RJQA 5BROA 3TLQA 4R88A 3IK4A 3WQVA 4LPCA 3IIZA 4CQ8A 1ZPTA 1F3TA 4JIHA 4M7TA 2RDUA 2J9ZA 3KLLA 1UCWA 3AZSA 4QE1A 1NF7A 4BEQA 3MYOA 3OG3A 2OGJA 4B5WA 3AO0A 1TVLA 4OZOA 3SUVA 1MNSA 1KW1A 1IT7A 3MBFA 4I8DA 2ZUWA 3PAOA 4QJ4B 1EPXA 3HU7A 2WMKA 4YNGA 1KM2A 4Z2LA 4DUOA 1FHDA 4R9XA 3EX6A 3P62A 4UR7A 2B7NA 1PZ2A 4QITA 3S9YA 2VURA 1WO2A 1F8IA 1WAUA 4S3EA 3CV1A 3G1HA 1JCMP 5CQ1A 2V3DA 3WCZA 2QDHA 2A3BA 3U0HA 3CZJA 4IIHA 4NF7A 3W28A 2CC0A 2WBKA 3NL2A 1GNXA 1DOSA 2HQAA 2PEVA 5HPCA 4BCEA 2Z6JA 3GXTA 4GXMA 1AW5A 1R3WA 4JX6A 3DENA 5AZ0A 4C1NB 4DYEA 3PTDA 4HU3A 2BDQA 3VO0A 3KVMA 2ISVA 3ZT6A 3M7SA 5AY7A 4PODA 1AQMA 1W1PA 1JYXA 1AH0A 4HNNA 1DPMA 4H6QA 2ZZ3A 3PPCA 1IEQA 1U83A 5DY2A 3EKZA 3M16A 1WB0A 4HA1A 3TOYA 4AD0A 2TPSA 2VUNA 2INFA 2W5FA 3L4WA 4BWLC 5I00A 1GQKA 2QLYA 2R1LA 2PDIA 5CGMA 3TW9A 1YW1A 3ANVA 5DT5A 5IFPA 2CLPA 3QY8A 4MJ2A 4DJFD 3NGFA 1WP6A 3AIVA 1Y7VA 3S0CA 4W5UA 5BRBA 3DCPA 3MSGA 1WDSA 3VU2A 2W67A 3LOTA 2O7QA 1R7AA 5AHIA 2ANUA 3SCRA 1XIGA 4IMFA 3RO8A 3MC5A 2QHAA 2WCSA 3LCXA 2J47A 2WSRA 4AYSA 3FS2A 2I5QA 5C2GA 4PMZA 1XSKA 3DIPA 2WNQA 4S3DA 3ITGA 3ABSA 4PMDA 5DMMA 4GJJA 3U2OA 2JF6A 4FMVA 2Z6IA 1HO4A 1Q7MA 4XZIA 2BODX 4I5XA 4YYFA 2HK0A 4ZTXA 3SCOA 1V6YA 1XGDA 5HOSA 1KCLA 1W56A 3WQ6A 1M68A 5HULA 1E43A 3UP8A 3DU0A 4IP4A 1X8FA 2WPGA 4NG3A 2G3JA 2PGRA 4GUHA 2DT0A 5DY3A 3GD6A 3W82A 1KBJA 3W75A 3WD1A 4C5YA 4GVFA 3P5YA 4GQ0A 4JGDA 2NQZA 2ESCA 3OGRA 1V3IA 2X2YA 1JNDA 4Z0SA 4NRSA 4CQAA 4UQEA 1ADSA 4E2BA 1IT8A 3O3RA 2HROA 3DGRA 3MCMA 1GUVA 2AAMA 1MNZA 1OYCA 1F05A 4IM4A 2XSXA 1IXPA 4C6PA 4GZEA 1PHQA 3W70A 4DI9A 3ZJ8A 2A1YA 3R43A 4ACZB 3RPDA 3LX9A 4I5UA 1HG3A 1NM9A 1PTDA 3M0YA 3BK0A 3BJSA 3WD0A 1JYWA 4AZGA 1HVQA 1V7AA 1KQYA 3B4YA 1FVPA 3PPFA 3FKKA 5C5YA 1TX2A 2P3ZA 2V2DA 4KCWA 5F7UA 1CZ1A 1E4LA 1PKMA 2C71A 4PTNA 2PUZA 2ZQ0A 1X7FA 4NU7A 3W86A 2GQ9A 4EXBA 3S2JA 4CNPA 4RDZA 3OQ8A 4DJDD 4HHMA 1N82A 3EA1A 1I2OA 3M5ZA 1EC7A 4O10A 3KAOA 2A3EA 2OODA 1AH3A 3H2AA 3J7HA 3PUDA 1WZAA 1DE5A 3SY1A