4ZFMA

Structure of gan1d-e170q in complex with cellobiose-6-phosphate
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
474
structure length
459
Chain Sequence
HLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNQQNIFISFGYRLGLHPPGVKDMKRYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEHNPPDGVGTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIANRYQLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSFTDLLWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative 6-phospho-beta-galactobiosidase
publication title To be published
rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 184
structure length 459
sequence length 474
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4zfmA00
5D9OA 1R85A 2V3GA 5A6SA 1JZ6A 2XFFA 5F7UA 2FGLA 3MSDA 4AYSA 3GXFA 1HJQA 2F2HA 1QNQA 1YQ2A 5E6YA 2CESA 1KBKA 3AQUA 4D71A 4MNJA 2ZE0A 2G41A 1A3HA 3CGTA 3LPOA 5IFTA 4UQAA 3AFBA 1E71M 2WWCA 1E0WA 3G6LA 2J7CA 4V28A 2GJXA 2BHYA 4HOZA 2ZWYA 2J8GA 3GBEA 5HOSA 4GO9A 3WQWA 4M80A 4F9DA 2GSJA 2X8RA 5D8ZA 5I3DA 1ESWA 3O6AA 2YDSA 4MDPA 2J79A 1GVYA 2E9MA 8CGTA 1IZJA 1EXPA 4UFIA 4C7FA 4N0RA 4UOZA 1H2JA 1XH2A 5FKYA 4CUCA 3CH9A 1WZLA 2WC7A 1FP8A 2DT1A 3RCNA 1GHSA 3ALGA 4B15A 5EFDA 3ZMRA 3GH5A 1FH7A 4CVUA 3ARVA 3DYOA 3WEOA 2ZWZA 2J4GA 2Z1KA 1TVNA 2XTKA 3HJEA 4UFHA 5D9MA 2XVGA 5HDRA 4PMDA 2J78A 3HN3A 2BNJA 4QLKA 1EQPA 4W87A 1TG7A 1UR0A 4DUWA 1V3LA 4WIWA 4E8DA 1OIFA 3N1AA 4D6GA 2CITA 3G6MA 2YA0A 5FCZA 3POCA 1LG2A 3VKKA 1ZJBA 2BV9A 3ARPA 1OIMA 3VX0A 4PMQA 4JHOA 3RMEA 3VGEA 4AIEA 3MUAA 1RP8A 1W1VA 3AIVA 4C7GA 1H11A 1C93A 2CKRA 2VQUA 5M5DA 3VIPA 3VIHA 1V0KA 1XCWA 1ODUA 4P7NA 4J3WA 3OIHA 5A8NA 1TCMA 3OGVA 3PTMA 3ALFA 4IPLA 3VIGA 4UTFA 1WZMA 2VNCA 3QOKA 5CJ5A 2ZUMA 3RJYA 3UERA 2BVDA 2CEQA 3EMCA 3T2QA 1BVZA 1MFUA 3SUVA 4AZGA 1GQKA 5CSUA 1GJUA 2XHYA 4U2YA 1VFMA 1X6LA 4OOZA 3CLWA 4W8BA 2XVNA 5C70A 2VC9A 2W66A 4OKDA 4URIA 2J7DA 4WKHA 3OZPA 1DWAM 4UZUA 1CIUA 4DWSD 4ZFMA 4E2OA 2BVTA 2CXGA 1GONA 5TD4A 2D3NA 4ATLA 1UA3A 4CD4A 1HJSA 5HXMA 2G4FA 4UOJA 1E1FA 1PAMA 1UR1A 1CGVA 1PX8A 1BF2A 4CU8A 3ZT5A 1MW1A 3VPLA 2UY3A 3CHEA 3NIYA 3LPGA 4KGLA 4GI8A 2PWHA 1UZ1A 5BRQA 3L4VA 1W9VA 3JUGA 2EO7A 4MNMA 3OBAA 2VVSA 2YKKA 1TFVA 3QGVA 1FHDA 2WVSA 4ATWA 4ZEPA 1V3HA 4MB3A 2VURA 2DT3A 1NOUA 3TTYA 4K68A 2W62A 1E3XA 1QHOA 4FLOA 1JD7A 4JL1A 2X0YA 2WZIA 1UR4A 1K9EA 3NUKA 3BH4A 1VRXA 1WB0A 2PC8A 2W91A 1HT6A 3ZT7A 5I23A 3B9DA 4ACZA 1NH6A 3GNRA 3VGHA 3U5UA 4H41A 4BA0A 3EMQA 2IXVA 1DTUA 3KL3A 2WCAA 3AHVA 3PZGA 4AMCA 1C92A 2JFEX 2WMIB 3AMLA 4RE3A 4TOQA 4XX6A 3IJ7A 4B3KA 1KFWA 4XZBA 3T2OA 4HOWA 3NDYA 5A2AA 1FHLA 1US3A 3GBDA 3SUWA 2DT0A 1M04A 3VGBA 4UQ9A 2WW5A 2VUYA 5A8MA 3UESA 3L4XA 1DWJM 5HPCA 4TVDA 2YL8A 3QHOA 3IJ8A 3T0AA 4E4PA 3PZTA 4TX8A 1FA2A 1PEZA 1CGTA 4M24A 3AHYA 4M81A 3L4UA 3FY1A 4Z2KA 3RO8A 3SIMA 2ZUTA 2GK1A 1EA9C 2YOCA 5BCAA 4WK9A 3VM5A 2J77A 3GNPA 3VD7A 4W84A 4UCFA 1K9DA 2BFGA 3I3DA 5CLWA 1V0LA 1TA3B 4H8UA 1CGXA 1J11A 1KB3A 3UETA 1GOMA 4DUVA 1WCGA 3W28A 1QOXA 5GNXA 3U7BA 1GQIA 5BXRA 5A1AA 4PMZA 1E6ZA 4P7LA 4R5EA 1LLOA 2YA2A 5JBEA 1QPKA 1E4NA 2GVYA 4ATDA 1M03A 4PSPA 4HMCA 3F5LA 5CXPA 5GNYA 5A6LA 1GOOA 3WH5A 1JGIA 3DYMA 3GM8A 3FNDA 1V0NA 1V3MA 3CO4A 3L4ZA 4AZ7A 3MANA 3HMCA 1NM9A 4J7RA 2A3EA 1GOQA 2QPSA 2HISA 2VZSA 2FHBA 1CXIA 3U57A 2QMKA 3CUIA 3WQ8A 4JKKA 3BAJA 4B3LA 3MMUA 1JXKA 2DSZA 3A47A 5I5RA 1KR1A 2ZXDA 5DFAA 1F4AA 1XYZA 3WNKA 1UKTA 3N04A 4W93A 3WDRA 5AY7A 5I24A 1D3CA 2X09A 4WKFA 1CZ1A 4CU6A 1UD8A 3WKZA 1FFQA 4U2ZA 4BQ3A 1V6WA 4P8VA 2GJPA 4F66A 3N12A 4ML4A 3WEMA 4CCDA 4HA1A 1E6PA 4LX4A 4JFTA 3SCRA 3NYDA 1HJVA 4P8WA 1LWJA 4HP5A 2UWFA 4TX6A 3W26A 1W9DM 1UYQA 3AIUA 1JFXA 4DWSB 2E0PA 3SCTA 5KZ6A 1EDGA 1C8XA 1EGZA 1MWOA 3SUSA 1FFRA 2O9OA 1H1NA 1CPUA 2PI6A 3D3AA 3BC9A 4M1RA 3UG3A 1D7FA 3EYPA 1XCXA 1CLVA 1DEDA 1E4LA 1NP2A 2W63A 1DWIM 4PEEA 4CD8A 3IAQA 1HIZA 1OWQA 1M01A 3CZGA 3ZO9A 2XGIA 5CLTA 3OLGA 1UKOA 3WNLA 3N9KA 1EDQA 1BVNP 2E9BA 4OBRA 2VMFA 1E4MM 2AMGA 4YN5A 3OB8A 1EHAA 4OUEA 3L2LA 4HZ6A 3WH8A 3GH4A 1E73M 2CERA 1UWIA 4CN6A 3W81A 1H4PA 1EOKA 3AMKA 1O6IA 3L2MA 2D2OA 1PPIA 3UCQA 3GXIA 5JIPA 2Y2WA 3SCVA 3K8MA 1AQHA 4CU7A 5A6KA 1ZBVA 2BVYA 1VBUA 3L4WA 3W24A 1E40A 1UHVA 4B9YA 3WNOA 3L4TA 1UQZA 3FAXA 1VBRA 2QPUA 1UD5A 3BMWA 3CPUA 3WDQA 5A2BA 3RIKA 1QNRA 4H2CA 3T09A 1HL8A 2VRQA 3ARUA 3WBEA 1V0MA 3TONA 2GJXB 1UH3A 1OCQA 3B8SA 3BAIA 4XB3A 1H5VA 1OB0A 2Y8KA 1AQ0A 3PTQA 3PZQA 4QCEA 3LPFA 4QDMA 4Z2GA 2WHMA 4UQDA 2FGZA 3UEQA 3WF3A 3F5KA 3VIKA 4AC1X 2ZUVA 4CKQA 3WDPP 1VEPA 1PIGA 1UKQA 3OGSA 1HXJA 4RL3A 2JF7A 3AISA 2OYKA 3DHUA 3LMYA 1Q6GA 3N11A 4Z2HA 3AIQA 4JFUA 4UQBA 1WO2A 2UY4A 2VCCA 3ARZA 2J74A 3VD5A 1EO7A 4V27A 1V6VA 1I1XA 1E6SM 2BY2A 2VRKA 4UNIA 1UR2A 3A4AA 5A6MA 3IJ9A 3EDDA 4MPKA 3NSXA 1KGXA 1PZ3A 4HA3A 2G3JA 5JBFA 1R87A 4NRRA 2Y5EA 5BWFA 4D6FA 4U31A 7CGTA 1VF8A 4GIAA 1N82A 5A3HA 3ZOAA 1KBBA 5E09A 5I79A 4XUYA 5IDIA 2XIIA 2CHOA 5CPTA 1GJWA 3M07A 1CXEA 3VDHA 2XM1A 1J18A 4PMUA 4L4PA 1C90A 3CTTA 2TAAA 2DSKA 1ITCA 1FH8A 5DEZA 2EBNA 4MB4A 3GXDA 3GH7A 5DT5A 1VEMA 1PJ9A 1B9ZA 4QLLA 1UD6A 2BXYA 2DGAA 5E0FA 2QMJA 2XVLA 4AD5A 4AD0A 4UQCA 1GCYA 3VIIA 4BF7A 2WKLA 4PMOA 1HP5A 4UOQA 3NSMA 1ISVA 4YPJA 4NRSA 5ABGA 1BFNA 4RE4A 1ZS2A 4WSKA 3CZLA 1OBAA 3VD9A 1QBBA 1J0KA 2EXOA 3K1DA 4X0VA 5E70A 1W9UA 2V5CA 2DSWA 2FH6A 1EOMA 1HN1A 2QF8A 5M17A 3VIFA 4FK9A 1VIWA 5C8BB 1B90A 4H8VA 4BQ4A 1OD8A 1DWHM 2V3FA 3AXXA 5A95A 2G8ZA 3FN9A 2DIEA 4EAMA 2G3MA 1WKYA 2ZUNA 1E6XM 1RH9A 1BGAA 2E4TA 1C7TA 3BCFA 3AHZA 2OSXA 5I6SA 1YHTA 4CN1A 4LYRA 2GDVA 2ZUSA 2D0GA 4AD3A 4LXFA 1HKIA 5A6JA 3CMGA 1IT0A 3ZT6A 2CYGA 3RM9A 3WIJA 3ZQ9A 3TTOA 2CETA 3WF1A 1XSIA 2XFRA 4MNKA 3GXMA 4W88A 4UFKA 1HVQA 2WK2A 3EDJA 2YBTA 1MQPA 3O9NA 1UH2A 4MB1A 4WKAA 3VGDA 2FDMA 3WFLA 1RD6A 1SMAA 2IXUA 4P7QA 2ZX6A 1W3JA 4BS0A 4ZXLA 2YL6A 3M46A 2YIHA 1E6QM 2E3ZA 3MU7A 1OSEA 4RE2A 3WH6A 1G0CA 4U5IA 3S2CA 2B31A 1UZ4A 2RGMA 1UD3A 4PCTA 3THDA 4KGJA 2DT2A 4H8HA 4TUFA 3EBVA 1QW8A 4HOXA 3SUUA 2V3DA 1JIBA 4MAVA 1JG9A 1L8NA 7A3HA 3CUJA 3WENA 1V08A 4AIUA 4M56A 2GK1B 4AISA 1B1YA 4QFUA 4CVWA 5FD0A 1H09A 2JF6A 4AD1A 1WPCA 2VZTA 4GZJA 1XH1A 3D5HA 3NSNA 5A8QA 4D72A 2WBGA 3UR8A 2OWCA 4LYPA 1W3LA 1BG4A 1GOWA 4ZE5A 1BYCA 2JIEA 5A6AA 4AD2A 1ZBWA 4DWSC 2A3HA 2PB1A 1G1YA 3WH7A 4W5ZA 2VX4A 1HKJA 2MANA 3WD2A 2CNCA 4AWEA 1WZAA 2OYMA 4GINA 5DMYA 3VMNA 3VMPA 3UR7A 3PN8A 1NWSA 1HX0A 3QHMA 1JD9A 2EPNA 1EDTA 2YLLA 1JZ2A 4LQ1A 4PMRA 1QNSA 4QP0A 3GDBA 4JAWA 3OLEA 1V03A 1NARA 3SCQA 1KWKA 5I77A 2ZIDA 1NOWA 3SURA 1XSKA 3OLDA 2EEXA 4TTGA 3WD0A 2OYLA 4U5KA 4TVCA 3WL1A 1B3ZA 1UOKA 4GXPA 3CZEA 3LPPA 3WFZA 1NP0A 3EDFA 2X0HA 1K6AA 1SR0A 3F5JA 5DT7A 2WCSA 2NT1A 4WF7A 5BXSA 1CNVA 1CYGA 3POHA 3II1A 1MQRA 2BY0A 4PTXA 3WY1A 1LWHA 2VL4A 1JDDA 1WDPA 2J8FA 2YL5A 2W5FA 4YHEA 2GFTA 3WEZA 4JFVA 4Y7EA 2WSKA 2XIBA 1LL7A 3RILA 3CUHA 2WB5A 1CGWA 1H41A 4CN4A 2D23A 4UQEA 2X2YA 1BG9A 1VEOA 1W3KA 4S3KA 1PZ2A 6A3HA 4B16A 1JI1A 2QV4A 2VOTA 3TA9A 2Q8XA 2WSPA 3I3BA 1CLXA 1D2KA 1B31A 4X0NA 3WQ6A 4Q7NA 2XFYA 5E9AA 3AJ7A 3VTRA 5LA0A 2NT0A 1XC6A 3WELA 4UFJA 5CZKA 2E8YA 2IUZA 1UQYA 2W67A 1V3IA 4GQRA 1CDGA 1XD1A 3AXIA 2PWFA 4OBSA 3WBAA 1TUXA 2WM0A 1WNOA 1OGBA 3MKKA 1JAEA 1BHGA 1HKKA 3BGAA 2V38A 1QBAA 4H04A 3SCUA 1OGSA 2ZUWA 1R7OA 2BHZA 8A3HA 4JL2A 3VIJA 3ARQA 1XRVA 1HJUA 2A3CA 4J3SA 1V02E 1UKSA 3MV11 1LF1A 1XSJA 1G9HA 3ARTA 3BLPX 4HZ8A 3AZSA 1KR0A 3WQ5A 1UR9A 1CECA 3TTQA 4D6CA 1ODZA 2CBIA 1UG6A 3CUGA 4GO8A 4U33A 3AMDA 1KWGA 2YJQA 3I3EA 4AXNA 5IXEA 3OGRA 1B2YA 3ARSA 1VB9A 3ZJ8A 4J27A 5FIPA 1WP6A 2WWDA 3CBWA 4U3AA 4FLQA 1HJWA 3CZJA 1CEOA 3WF4A 1DWGM 3N18A 4PN2A 3VIOA 4W7VA 3O2LA 3WMSA 5ABHA 1ECEA 3ARRA 3BAWA 2WMIA 3AXHA 1E0XA 4U3CA 4ZENA 3FW6A 2XVKA 2CIPA 2J7GA 4HZ7A 1TVPA 2WVVA 3WQVA 4R27A 4ZXOA 3PZVA 5EBAA 2WBKA 5D4YA 2WVUA 7TAAA 2OSYA 1W9PA 4AZCA 3VIMA 3S6TA 4HPHA 3AIEA 4MDOA 1MQQA 4PMYA 3AIWA 5BXPA 1JFHA 2Z1SA 1GOIA 3W27A 1V6UA 3W6MA 1U2YA 1QI2A 3IK2A 2F8QA 1XV8A 2WC4A 3N17A 2VCAA 1E55A 1HKMA 2V3EA 1OT1A 2DDXA 1GUVA 3WMBA 3PZMA 1E4IA 4F8XA 3AROA 3SCWA 1MVYA 2WYSA 1JXJA 3W38A 3NCOA 3VD4A 1X6NA 3HU7A 1SMDA 4NSBA 1GPFA 2BS9A 3GTNA 1V6YA 1QI5A 1CGYA 1XYFA 4X9YA 1BSIA 2ZUUA 2EJ1A 4FMVA 2E9LA 3T2PA 1WDSA 2J7EA 3MUZ1 1CXFA 1E70M 4BCEA 4QLJA 3ZM8A 3WD1A 4IUGA 2WZHA 5ABFA 1QNPA 1RPKA 2PF0A 4JKLA 4J3XA 3L4YA 5CSYA 4D6IA 1VJSA 4AEFA 1QI4A 1XHGA 1J0IA 2WMGA 4L4OA 2VX5A 4V2XA 4D6EA 1AQMA 1ISYA 4KRTA 2WPGA 2VZOA 1CTNA 4J3UA 4MAZA 2EPKX 3UG5A 3AYRA 5CGMA 4JFSA 1BAGA 2ZX9A 3NDZA 1QVBA 1UWSA 2WMJA 2XWDA 1JNEA 4CD7A 5FL0A 3W0KA 1QI0A 4JCLA 1WE5A 2W4XA 1B3WA 2WAGA 4HTYA 5FOOA 1HL9A 3ZJKA 4LPCA 5BROA 1X1NA 1E6RA 1U30A 3T08A 2E40A 3M6DA 2VZVA 3J7HA 2XUCA 4GZIA 1QNOA 1Y7VA 2WLYA 1ITXA 3BAYA 1FP9A 4TVUA 1W3HA 3OLIA 3AHTA 3PZUA 1EQCA 1RP9A 2VT0A 1E1EA 2Y4SA 3ZSTA 3ARYA 1J0JA 2VZUA 1BYAA 3M7SA 3VILA 1MW2A 5GNZA 3VVGA 2DEPA 2G3IA 1GZJA 2YDQA 3DHPA 4KRUA 4MNLA 4HPGA 1C3FA 3PTKA 3AZRA 1CXLA 2J62A 3MS8A 1K9FA 1BYDA 4MJ4A 2NW0A 3TTSA 3KL0A 5GQBA 3CUFA 4D6HA 1ISZA 2ZX5A 4H7VA 4M8UA 4PUDA 1XD0A 2E8ZA 1JL8A 3BSHA 3VGFA 1CWYA 4BZYA 5JBDA 4LGXA 9CGTA 3WN6A 4GKLA 4D6DA 5E6ZA 2FH8A 4FLSA 2EPLX 2EPMX 1GQJA 1NWUA 3T0DA 3EDKA 4EKJA 2UY5A 1MW3A 5A94A 1SFSA 3W82A 4QAWA 1JNDA 5HBFA 2YA1A 4TTUA 4W5UA 4XZWA 1J0HA 1HJXA 4HMEA 4NF7A 4PUEA 3CHDA 4AZHA 1EIBA 3WD3A 4BQ2A 1JZ3A 1PX3A 1Q6DA 1ZU8A 2WC3A 2VR5A 3T0BA 1GHRA 1KQYA 3VINA 2A3BA 3AS2A 3WD4A 4PTWA 4NI3A 3SCSA 1HF6A 4W7UA 3N15A 2OLHA 3RDKA 3VOCA 5ECUA 5IHRA 1EO5A 4GZEA 4A3HA 4HA4A 4CCCA 3OG2A 3DECA 2WVTA 3A3HA 1MXDA 3AICA 2DSUA 1OT2A 2VQTA 3B9AA 1H0IA 1UD4A 1UUQA 5D9PA 1JZ8A 1NQ6A 3ZR6A 4AIOA 1H3GA 1JDCA 2V5DA 4W85A 1IZKA 3VO0A 4ACZB 5LA1A 1E3ZA 4EE9A 2EPOA 1G94A 2NSXA 2XSBA 1JYXA 3KZSA 2C0HA 2ZX8A 2DH2A 3MUIA 3KL5A 5BYWA 1M7XA 1ZB5A 2XG9A 2GDUA 4CGTA 4GI6A 2XM2A 1CXKA 4WLCA 3PZIA 1JF6A 4P7RA 4S3JA 2F61A 1O7AA 2ZICA 3VNYA 2WZEA 1JAKA 1JZ5A 1M53A 5CPQA 2PWDA 1E15A 1XH0A 3MUY1 3TOPA 4AEEA 3MMDA 4YHGA 2JE8A 5LA2A 3VX1A 3WQ4A 2O9PA 2XGBA 1ISXA 1US2A 3PZNA 3VD3A 2PBOA 2ESCA 4F9JA 2JIWA 1XGZA 4JZ5A 4P8XA 3VNZA 1SYTA 5JIWA 5AYBA 4TXEA 1MFVA 4D6JA 2D1ZA 3WF0A 5HPOA 3E1F1 3IAPA 5EFFA 1ZL1A 5DF0A 4JKMA 1IV8A 3K8KA 3W4RA 2J7BA 2WMKA 2AOSA 4JCMA 1WDQA 1W2PA 1EH9A 1OD0A 4XV0A 3BCDA 5M3WA 1F4HA 4GPNA 4KMQA 2JEPA 3THCA 1E6NA 2D24A 3K8LA 1UWUA 1V3KA 1W9XA 1B3VA 5CQ1A 1KGUA 3K4DA 1C91A 2C7FA 4UFLA 1VAHA 2J75A 3AS3A 1V6XA 4M82A 3BAXA 3TP4A 1HNYA 5I78A 1WZKA 2ZX7A 3FHAA 2VRJA 1KCKA 3NJ3A 3AZTA 3AS0A 1PX4A 4AZBA 1C8YA 4CD6A 1QHPA 2CPUA 3N13A 1W1YA 1J10A 2YL9A 4OOUA 3WDJA 1EHNA 5D9NA 3ZR5A 1ZJAA 1JDAA 1Q6CA 2A3AA 1E5JA 4Z2IA 5BRPA 4PMXA 1ZBKA 2HVMA 1ZBCA 3FXYA 1I75A 3CIVA 4CD5A 1UKPA 3PZ9A 4OZOA 3WDHA 4P7OA 5HNNA 2CBUA 4W8AA 3U5YA 2J7HA 3EMZA 4AZ6A 3APGA 1BYBA 4LYQA 3MV01 2VX7A 5FL1A 2WNWA 3VMOA 1JF5A 1E0VA 1CENA 1BTCA 3W37A 4FF5A 1HVXA 5I2UA 3CHCA 2WVVB 1GORA 1E56A 4IPNB 1B0IA 2YLAA 5LYRA 5AC4A 2D20A 2VI0A 3W6LA 4UR9A 3GZAA 1NWRA 3BMVA 1H0GA 1TMQA 5IHSA 2AAAA 4AZCB 2CBJA 1GQLA 1U33A 2GJRA 3FAWA 4C7DA 3WL0A 4PRWA 3WMCA 2QLYA 2BHUA 1V02A 5BXTA 3A4XA 3VDBA 2WCGA 4DUXA 2JALA 1CBGA 2FHFA 3QOMA 2OWWA 3RJXA 1R8LA 4W86A 1BLIA 1V3JA 1OGGA 2J47A 2Y8VA 4GQQA 3WH9A 4PCSA 4KWUA 3QR3A 5KEZA 4IM4A 2VR4A 4AZIA 4PSRA 4AD4A 2W92A 1A47A 4W8LA 3AOFA 4KH2A 1WDRA 4ZE4A 2J7FA 1JZ7A 1KQZA 3WNNA 3VUPA 5D8WA 5EB8A 1W2VA 4HMDA 2XVPA 2ZXBA 1LQ0A 3BAKA 4NZCA 5E0CA 1J12A 2GUYA 1L0PA 1VFUA 1QI3A 3GNOA 2X05A 4E8CA 1UWRA 5JUVA 2QHAA 4MADA 1TE1A 5CG0A 4EK7A 1VFFA 1PIFA 4MTVA 5ABFB 1LL6A 3KEHA 4CCEA 2RGLA 1E43A 3VGGA 4W7WA 3CZ8A 3PHAA 5CGTA 1MYRA 1J0ZA 2XYLA 1KCLA 2D0HA 2PBGA 3GYCA 3W53A 1VENA 5A6BA 1MW0A 1GNXA 1BPLB 5I0DA 4JIEA 3UG4A 2JEQA 1VJZA 5AYIA 2D0FA 3WUGA 3W29A 1P6WA 3A4WA 2WANA 4J28A 1B30A 2XPKA 3AYSA 2XWEA 2CHNA 2ZOXA 4FLRA 1BGGA 3A6OA 4PBGA 1UH4A 1C7SA 1JYWA 1R7AA 2BXZA 4B9ZA 4DM1A 3DC0A 1GW1A 3ZIZA 1CGUA 3AIRA 2PWGA 2YDRA 1TZ7A 3AS1A 3K4AA 4Z2LA 3ZJ7A 2VJXA 1H49A 3B9EA 4OIFA 2XJ7A 2PWEA 3BXWA 4Z2JA 3WF2A 2WLZA 3QHNA 4EANA 4F79A 2ZXQA 1FH9A 5GPRA 3BLKA 2DPEA 4QCFA 4JHZA 4PYSA 1GOKA 1CXHA 4OJYA 3WUBA 3VDAA 1KXHA 1KXQA 6TAAA 2Y24A 3ECQA 4BQ5A 3AI0A 1E9LA 1W1TA 4M29A 1C8QA 1FOBA 3FHQA 5M03A 2VVNA 5A8PA 4PMNA 3PBGA 2BY3A 3F4VA 3CZKA 4DM2A 1JZ4A 3RM4A 3SCPA 1UWTA 3U7VA 2WHKA 1PBGA 1TA3A 3RPMA 2VTFA 1E5NA 3ZJ6A 4MB5A 2WHLA 3CMJA 2VO5A 1DHKA 1VFOA 3KWXA 4UZSA 2CCRA 2ZXAA 1Q6FA 1E72M 3OA5A 4IISA 1J0YA 4WSJA 3MMWA 3WSUA 5EMYA 2D22A 1JYVA 4WJXA 1WAWA 1B3XA 2VCBA 3SCOA 2CBVA 5CPSA 4PTVA 1KXVA 2DSVA 3VM7A 5A69A 3ARXA 1KGWA 5A8OA 4J3TA 1R86A 4AZ5A 2YBUA 2WMHA 3RM8A 1JI2A 2C8NA 2D3LA 4AY1A 4JFWA 3IANA 1TR1A 1KXTA 3BSGA 4PTMA 3AIBA 2WXDM 1UA7A 1W32A 2OSWA 1NOFA 5IFPA 1UR8A 3ARWA 1UD2A 3WNPA 3WNMA 3SCNA 2WHJA 2OWXA 3WUFA 4GI9A 1QW9A 2WKGA 1DWFM 4Q22A 2WMFA 1HP4A 5AC5A 3WUEA 1J01A 1W91A 1B3YA 3ZSSA 2BY1A 4ACYA 4A3YA 1JYNA 1MXGA 1S46A 3EDEA 1Q4NX 4D1IA 4PMVA 1BQCA 1OM0A 3MO4A 3VU2A 3MSGA 1G01A 3AMGA 3AHXA 3PZOA 4P8UA 5ABEA 1LG1A 1K9TA 4A4AA 2XSAA 2DIJA 2X1IA 4AW7A 2G3NA 2VX6A 3KE0A 4MJ2A 5A2CA 1AMYA 3SEPA 1W9BM 4D1JA 4DWSA 4UFMA 3AMCA 1LJYA 1I1WA 6CGTA 2EQDA 3OZOA 3W25A 1DP0A 4HU8A 1LL4A 1UWQA 1GVIA 4N42A 2O92A 3SUTA 1ISWA 2O9TA 1G5AA 3CHFA 1W1PA 2J25A 2O9RA 5C71A 2UY2A 2CKSA 1NWTA 4J3VA 3K46A 2DQXA 2W61A 4HU0A 3DYPA 1AVAA 2FHCA 2DH3A 3WDIA 5A6BD 5DO8A 3VDCA 1J9YA 1Q6EA 1Z32X 1QHZA 1OINA 4W89A
chains in the Genus database with same CATH superfamily
1R85A 3T55A 1EBGA 5A6SA 1JZ6A 2Y61A 3M47A 2XFFA 4I5XA 5F7UA 2DUAA 2FGLA 4AYSA 1QNQA 1RY8A 1XC4A 3B8DA 1KBKA 5FF7A 3BJSA 2YGYA 4X63A 2ON3A 1N8IA 4O57A 2ZE0A 2VGGA 4AQLA 3NZPA 4AWUA 4DEFA 3LPOA 4ZZ9A 1LM1A 3B0VC 5F1UA 3DFSA 4NVTA 1E0WA 2J88A 2ZRZA 3QV9A 4L6DA 2BHYA 4HOZA 3CAVA 4WUIA 1GKPA 5CC5A 3WQWA 1L2QA 1ESWA 1AZ2A 3KVKA 2J79A 2V63A 5DY3A 3M43A 4UOZA 1XRFA 4ERIA 5G4WA 3YPIA 5D03A 4CUCA 3CH9A 4KCWA 2WO5A 2DT1A 1IWAA 3ALGA 3KCJA 4JPGA 4IZGA 3LGEA 1ZY9A 3TLQA 2Y5SA 3LHVA 4CVUA 4ICMA 7ODCA 4NX5A 2JGQA 1XWYA 3WEOA 2ZWZA 1FWRA 2CLLA 4XD4A 2J8TA 2XTKA 1I2RA 3CIXA 3CYVA 5CG7A 1ZHAA 4XBJA 4PMDA 3IVUA 2J78A 1UR0A 4WIWA 3FGCA 4E8DA 1XBVA 1AJ2A 2YA0A 4JHMA 2EAWA 4FIRA 2ZA2A 4HT3A 4DLMA 4XG1A 3VX0A 2PCQA 1IT8A 3MI6A 2HNHA 3VIHA 3NQFA 4YYFA 1HUVA 1XCWA 4MWAC 4NIRA 5AVHA 1GG1A 1KCXA 1Y5XA 3KFTA 4IPLA 1OCJA 1WZMA 2VNCA 3TWAA 1H62A 2ZUMA 1QT1A 2NQHA 1WV2A 1M9HA 4AZGA 1TRDA 4RPPA 1XG4A 5FF2A 1WDDA 1VFMA 2FMOA 4W8BA 4FNSA 4H7CA 8TIMA 5HULA 1WUEA 4UZUA 2XU2A 4NNBA 1R9YA 3C4UA 4S39A 4ATLA 4G1KA 1MSSA 5FI8A 4NZ4A 3DX5A 3CTLA 3TU9A 3RNDA 2PDHA 1MW1A 3L68A 3LPGA 1JEZA 2NVCA 4KGLA 1MDLA 5BRQA 3GY1A 3LGGA 4O18A 4QNEA 2CZDA 3RF9A 3QGVA 3GVGA 2P8BA 4WOQA 2VURA 5K9DA 4OHQA 4L6OA 2OOGA 3G77A 3GDRA 4K68A 1E3XA 4MPQA 1QHOA 1GVSA 4AFYA 3P5ZA 1VRXA 2PD9A 2PC8A 4JYDA 5KZDA 4AHQA 4K1GA 4Z1BA 3LV5A 2QVNA 3UXAA 5I23A 3B9DA 1NH6A 3GNRA 3VGHA 4A8NA 3U5UA 1AH0A 1PKNA 4BA0A 2IXVA 3KL3A 2QT3A 1JUKA 3AHVA 3PZGA 3NQAA 1A50A 3GVQA 4DXVA 2VUNA 5DMNA 1QOQA 4XX6A 4ZVJA 5LKYA 3IJ7A 4MIMA 4CNNA 1KFWA 4XZIA 4XZBA 4HHLA 1KLZA 1NFPA 1GT8A 1OFBA 2XZ7A 3VCCA 1Q5MA 1IEQA 3D3FA 4UQ9A 1A0CA 4KQNA 2CLMA 4YWSA 4E4PA 1Z41A 1AZ1A 1S5MA 1FA2A 4DB7A 3UWZA 3AHYA 1G67A 4DJFC 3KP0A 3L4UA 3FY1A 2YCLB 4J5NA 4K3ZA 2GK1A 2BGSA 1TPEA 5BCAA 4WK9A 3W83A 3VM5A 3GNPA 4MKNA 3U2CA 3WJZA 1MZRA 4W84A 1K8ZA 4OTKA 4FR1A 2CLKA 1PDYA 3SJ3A 4DELA 1UUMA 3UETA 4WQ6A 4H2HA 3C52A 2QCHA 2VC5A 1SZEA 3UPBA 2Y70A 4P7LA 2OGYA 2PP1A 3W70A 1LLOA 1IR1A 1QPKA 2BOFX 2GVYA 3MA8A 3KRBA 1EJVC 1GOOA 3JU2A 1IWBA 4AX6A 5L6UA 4MWAB 5I7GA 4J7RA 2QPSA 2HISA 1OK4A 2YB1A 1GG0A 1CXIA 5C6MA 1IXQA 4REQA 4MMWA 2QMKA 2W79A 3WQ8A 4B3LA 4PCNA 2DSZA 1TB3A 1H7RA 2QYGA 1YMYA 1KR1A 2WV8A 1SSGA 3OZMA 3PBYA 1JCMP 3VFCA 4W93A 2WOQA 5AY7A 2OZTA 5I24A 3DERA 4N9BA 2AQWA 1NJJA 4CU6A 1RXOB 5B7YA 2NXGA 3R5EA 4TX9A 1V6WA 3PBWA 1TIMA 2GJPA 3DH7A 4QEHA 4CCDA 4HA1A 3QRHA 3NYDA 4P8WA 4MHBA 5I03A 4IGMA 1POJA 3MB9A 3W26A 1LBLA 2ATMA 3UYIA 4HK7A 3V4BA 4DWSB 3SCTA 4PE8A 1YNQA 4PRRA 3QKZA 3SUSA 1FFRA 1CPUA 2PI6A 5G5IA 3BC9A 3UG3A 1D7FA 1E4LA 1XCXA 1DWIM 5DRCA 4CD8A 3IAQA 1OWQA 3L23A 3R12A 1M01A 3VKDA 3T0CA 2FB3A 1ZSXA 3WX7A 3N9KA 1BVNP 3GNXA 4OUEA 2BSLA 1O1HA 3GH4A 4I9MA 3PPFA 2CERA 1UWIA 4CN6A 3W81A 1W1ZA 4R7JA 4ZTYA 3BW3A 4L61A 3AMKA 1L6YA 1O6IA 2ISFA 3QXBA 1UPMB 3K8MA 1AQHA 4JYFA 1EJRC 1ZBVA 2BVYA 2V67A 2Q8ZA 1SZRA 2ACRA 2Z7KA 3WNOA 1Z8AA 4FI4A 3FJ4A 1H7PA 5EMKA 1OCNA 1QNRA 4O53A 3WCZA 4IMGA 1TPFA 3OA3A 3O07A 3B8SA 1H5VA 5LIWX 4XISA 1G69A 4HNOA 4IIBA 1QK2A 2C91A 3TNOA 3P80A 3G24A 3F5KA 2OMAA 4NJIA 3B8VA 1EJSC 3GC4A 4XTDA 2Z4GA 3S9ZA 3EPMA 1K6WA 4FF7A 3EZ4A 4E3TA 4IMCA 4QX4A 2QCFA 2L5HA 3TV8A 1BEUA 3BVJA 2J74A 3VD5A 2VFGA 3WO8A 4UNIA 3A4AA 5D02A 4GACA 3IJ9A 3I6EA 1KGXA 4WGXA 3ITCA 2G3JA 3EKLA 5JBFA 4E3VA 3ID7A 1AH3A 2Y5EA 2YW3A 1Q2RA 1YW1A 4AF0A 4U31A 4C6JA 1VF8A 4HPJA 3DBNA 2RDTA 1KBBA 3M9YA 4XUYA 4DHGA 1KM1A 3W7DA 2XIIA 5CPTA 3FJLA 3M07A 3AWOA 4B5SA 4EXQA 4WJEA 1J18A 3FDKA 3CL8A 3B9NA 4PMUA 3BW2A 3I7SA 3VYLA 3LHYA 1C90A 3W75A 4HQVA 3KBVA 3CTTA 4DQWA 3HPSA 2J27A 1ITCA 4GFSA 1F3TA 5DT5A 1PJ9A 1RR2A 3BOXA 1ONRA 6ALDA 5E0FA 3GAYA 2PRLA 2QMJA 1VH7A 1DXIA 5DX7A 3NQBA 3C86A 3S5NA 2HZGA 4PMOA 4IFKB 3EEGA 2OB3A 1RQEA 4YPJA 1ZS2A 3L0KA 3CZLA 2WNNA 1J0KA 3K1DA 4RE0A 1T0OA 3ANVA 3RITA 1UBPC 1SFLA 1V77A 1Q4WA 2QF8A 1TWZA 5LNRA 4EF9A 1VIWA 5H6HA 2FPVA 2YZ5A 1OD8A 4PODA 3AXXA 4QG9A 1PO9A 3GUWA 2NSOA 3W7JA 1V93A 2PMQA 3WLOA 1Q2SA 5K3VA 5DBTA 1I2PA 2E4TA 2PDWA 3WLRA 4LYRA 3VNLA 3OHIA 3E5BA 4IGNA 1IIHA 1EGMA 2P0OA 2CYGA 3JZUA 3RM9A 3WIJA 1F3XA 1JPDX 4DO4A 2CLPA 3PFRA 2XFRA 2F84A 3GXMA 3GTHA 2WK2A 3EDJA 5A5WA 3GX9A 2QW5A 2W27A 3TC3A 3PPHA 5HAOA 4F48A 5AKQA 1UP0A 3STCA 3K30A 4BS0A 2Y7DA 4GGBA 1E6QM 2E3ZA 2CC0A 4GRSA 1AK5A 3NQ6A 1OSEA 4RE2A 4K7YA 1G0CA 2B31A 2Z2UA 3LM3A 2IKHA 4KGJA 2DT2A 4H8HA 1IT7A 4MFDA 9XIAA 2Q6ZA 5J8LA 4OV9A 4Q8UA 3ELFA 7A3HA 4GLEA 1KBJA 1YKWA 4QFUA 4CVWA 3M64A 4RJEA 3CQJA 1H09A 4JDYA 3GLCA 4GZJA 4Q4SA 4RLIA 2GGEA 3NSNA 5A8QA 5ECVA 3B04A 3UR8A 3L5MA 1VPYA 2Y7FA 5CBJA 1W17A 2OO0A 4ZE5A 4TMBA 4D8LA 4GUIA 3G1XA 5A6AA 4MY1A 5REQA 3SQSA 1JR1A 4GISA 2QDEA 3KHJA 2QAFA 1G1YA 3WH7A 5C7VA 1HKJA 2I16A 2XH7A 1WZAA 3QZAA 2OYMA 4OVXA 3PFMA 4H9XA 1PKLA 1RD5A 3OVRA 4FX6M 1HX0A 2ACSA 3WZ0E 3Q45A 4C60A 1FWEC 4JQ3A 2V68A 4WY0B 1JPMA 5CAKA 3SCQA 2Y1HA 3Q58A 5KINA 1KWKA 5I77A 4ZB5A 4ALDA 3PBUA 1VLWA 3CT7A 3A64A 3RN6A 1XJBA 3QLLA 4HCDA 3TUUA 1UOKA 3GFZA 3TMQA 3MMTA 1AW2A 1E51A 1R3QA 1NP0A 3EDFA 4I6VA 1K6AA 1SR0A 4XZHA 1I4NA 3CWOX 3FJ6A 1CNVA 1CYGA 3II1A 3BURA 2ZC8A 3T07A 4MG4A 3GNNA 2YL5A 2W5FA 2GFTA 1HKWA 1T40A 1PYMA 3GW0A 4Y7EA 5HQLA 2XIBA 2GVGA 3NO1A 1YNYA 3XINA 1GTEA 4QBXA 1CGWA 3TR2A 3PC0A 3OEXA 1EKOA 4GHRA 4Q8MA 2WQPA 1JI1A 2VOTA 1YE4A 4DBUA 2Q8XA 3M0VA 4QNWA 1XP3A 3GDKA 4R7OA 4IGSA 1S39A 3N4EA 3WQ6A 3AJ7A 1S1RA 3WQOA 2VEFA 2P3ZA 4YL2A 4A8IA 5CZKA 4I7UA 2IUZA 3WQFA 1V3IA 1RV8A 2PU0A 2WM0A 1WNOA 4GX8A 4IH3A 3KOZA 1VPQA 3HF3A 1SUXA 1BHGA 3KDNA 7REQA 4E2VA 1QBAA 4US5A 2BHZA 4IMFA 4JL2A 3VIJA 5I3HA 1JQXA 3FA3A 1HJUA 2QJJA 4GI4A 1UASA 4CNOA 4JIPA 3UWUA 1XXXA 4GMEA 2RH9A 2PDQA 3E2VA 3V1HA 3CV1A 3JRKA 3AJXA 3BLPX 3AZSA 1FWJC 3WQ5A 1UR9A 3BPWA 3H55A 4R9XA 2YJQA 4HU3A 3WK3A 3ARSA 3ZJ8A 3S1VA 1S2TA 2WM1A 2WWDA 3CBWA 2PU1A 4FA3A 4FLQA 3GG0A 3CZJA 5G1MA 3VKBA 3WF4A 1DWGM 1PZ0A 5BOEA 3APTA 4PMJA 5ABHA 4M5PA 1ECEA 3MYPA 3AXHA 1JVNA 4AVFA 4ZENA 3FW6A 3SRHA 1P7TB 2DUZA 2CIPA 1FCVA 4ZCWA 3Q67A 1Q65A 3WQVA 4R27A 4ZXOA 2XH2A 3PZVA 2QEZA 4X9SA 2QPXA 3GC2A 3GHTA 2WVUA 3CB8A 4Q33A 2OSYA 1W9PA 7TAAA 5D2VA 5HMFA 4LS0A 4GQBA 3LX9A 2D2HA 4DYJA 1FWNA 1JFHA 1GOIA 3M4HA 1H7XA 4GKTA 1U2YA 1IEVA 1XV8A 1K7EA 2VCAA 3N17A 1WKDA 1X1OA 2V3EA 4KERA 3THUA 1ZJHA 4FOUA 2R1PA 1MVYA 3BUVA 1UPPA 3W38A 3HU7A 3UWVA 4NSBA 1A4LA 1MUMA 1OX5A 1CGYA 1XUUA 4HA0A 4BWLA 4GYPC 3E2RA 1XLFA 3UJFA 2A21A 4H19A 3HG5A 4FMVA 2NX1A 4LV4A 2Q09A 5C54A 1TELA 5EGRA 1RUSA 4V33A 4F3HA 1UJQA 4C1NA 3QPYA 1GYNA 5DRIA 1O68A 1MNSA 4UTTC 3UPWA 1QNPA 4I5RA 1RPKA 3O0FA 4EXBA 3O15A 5C2CA 4PUWA 3GRIA 4AEFA 1JDFA 4GBDA 3CV7A 3QR0A 2VX5A 4V2XA 4D6EA 3T0TA 3DC8A 2BZNA 4S3DA 3E12A 1CTNA 1P1MA 1LRTA 2EPKX 3AYRA 1O1ZA 5CGMA 3L9CA 3KBNA 2ZX9A 2FMNA 2VEGA 4HYVA 1Q3NA 2H3DA 1QVBA 3VI2A 4L1GA 4UC5A 5FL0A 4KF1A 2W4XA 4A22A 2NQ9A 5FACA 1ZP3A 4DJEA 4M51A 1X1NA 4O12A 1OY0A 3T08A 2E40A 3M6DA 3M5VA 4GZIA 4ZQNA 4A8RA 1W3HA 3PZUA 1OC5A 1E1EA 3LTSA 3T81A 4MOZA 1J79A 3VILA 1BYAA 3M7SA 5GNZA 2DORA 4ZFCA 1ML1A 2DEPA 2G3IA 1GZJA 3DHPA 1YADA 3AZRA 4E2BA 1CXLA 2J62A 3AO0A 1K9FA 1BYDA 1EC9A 3TVAA 1Y5WA 1DJHA 4IGHA 4IIGA 4ONVA 1UC5A 4S3CA 3DDMA 5IM51 2V30A 2VFEA 4IPIA 3R8GA 1OVDA 3VGFA 4R88A 4LGXA 2QJGA 3WN6A 4GKLA 3CB3A 3MHGA 5LZLA 3P62A 4GUJA 5B80A 3HA1A 1YPXA 3N2OA 6XIMA 1ICPA 1A5NC 4IIHA 3FFSA 4NG3A 1RZMA 3T0DA 4O0ZA 1EWDA 4KCTA 6XIAA 4JTLA 2UY5A 1MW3A 5HJYA 3W82A 4HZMA 5HBFA 1JNDA 3NG3A 4TTUA 5FJIA 3MWAA 4XZWA 4HMEA 3QBUA 3D6NA 4AZHA 4ZODA 1MEHA 3WD3A 4BQ2A 4B5WA 3PUDA 3THQA 1UP2A 3TN5A 1TJPA 3WK0A 3T0BA 4TO8A 5C9XA 1GHRA 3VINA 4DX3A 4F2BA 3AS2A 3WD4A 4PTWA 3N73A 2BASA 3F4CA 3KS6A 5HMSA 4GZEA 5FJUA 4HA4A 1C9WA 3DECA 1J93A 2WVTA 1XDJA 2DSUA 3M44A 3VABA 4YU1A 4TIMA 5LIKX 2I5GA 4X22A 1UD4A 3TJLA 3DEQA 1DJIA 4GIEA 3W84A 2ZRWA 5G1TA 4E4UA 3FYPA 3G1VA 1XI3A 2EPOA 1I0DA 2OKOA 5HJXA 2C0HA 3WLJA 1PSCA 1HQTA 2I7GA 5BYWA 1JCJA 4MWAD 3ABRA 3LYEA 1VC4A 2A6NA 5AB3A 3TIMA 1W0MA 3DI1A 3PZIA 1R3YA 3CC1A 4S3JA 2F61A 1US0A 1KFKA 3K4WA 4HYWA 3VNYA 1NDYA 4LUTB 2E6FA 1JAKA 3W1PA 2PWDA 1JGMA 5EMJA 3MUY1 4NKCA 4I7WA 3L65A 1TPB1 2FQIA 1ISXA 1RVGA 3VD3A 3A3XA 2Y6ZA 1EC8A 4JZ5A 4P8XA 4TXEA 4UXDA 4JNMA 3GG8A 2D1ZA 3WF0A 4MKSA 1G4SA 2QCNA 5EFFA 3MCNA 1ZL1A 5DF0A 4JKMA 1PCWA 4Q6JA 5KTLA 4IL2A 1H7NA 3PUOA 2AOSA 4IFRA 3MVTA 1FHVA 3OP2A 1F4HA 1DIKA 1E6NA 1ICSA 2D24A 1V3KA 2G5WA 1J96A 4HD5A 1KGUA 1BD0A 4UFLA 1T8QA 3MYOA 1VAHA 4QG6A 3UVIA 3BAXA 3TP4A 1HNYA 1A5MC 2ZX7A 3FHAA 4UBPC 2X7VA 3AS0A 1PX4A 4AZBA 2VC6A 2CWXA 1EFZA 3N13A 1J10A 4ZQOA 4OOUA 4GQGA 3WDJA 3TQ0A 4O11A 1Q6CA 3LHUA 4LUYA 1ZBKA 2W6RA 1I75A 2OX1A 5HNNA 5HANA 4W8AA 4PGLA 3APGA 2C19A 5TIMA 4ROQA 2OOFA 5XINA 2B7PA 4V1XA 3I6TA 4K8EA 1FCQA 4IF2A 1KBIA 3GFXA 4XIAA 3ITGA 1JCTA 1PHQA 3CHCA 4B4FA 2OTDA 1E56A 4GVIA 5BOFA 2VI0A 1FWDC 5LNVA 2AGTA 2GGHA 1H0GA 2AAAA 4WVXA 4AZCB 4ML9A 2CBJA 3F2CA 3H6OA 1GWJA 3FAWA 1A3XA 2QLYA 2D2GA 3N4FA 3W1NA 5D04C 2BHUA 2Y7EA 3S6DA 3L2IA 2WCGA 1OEPA 2QCDB 1OABA 2OT0A 1F6PA 2OWWA 2P50A 2DUXA 2NVAA 1V3JA 1EPVA 2J47A 4M6QA 2Y8VA 1ZTVA 5I3JA 4FXFA 4PSRA 1PE1A 4L7ZA 4FX7A 4PB4A 4KH2A 3KOWA 3LCHA 4IPJA 2WSQA 2X2GA 2BMBA 3LHTA 2J7FA 2KZHA 3L21A 3WNNA 4UTWA 4GNVA 5LGXA 5D8WA 5EB8A 1EBHA 3E5PA 1LQ0A 2F6KA 3MWCA 5HWJA 2PFHA 2XN1A 3GNOA 3O05A 3IACA 2HBXA 5JUVA 4MADA 6ENLA 1TE1A 4J35A 3S2JA 3WQCA 1RBOB 2NV9A 3TCSA 3L0GA 1GGOA 1E43A 3SAZA 3VGGA 3HBLA 1NEYA 5D38A 1Z3NA 4LVDA 4AHPA 1KCLA 2D0HA 3W53A 4JXCA 4IPPA 1QUMA 3CM4A 5A6BA 2HDJA 1GNXA 5I0DA 1KM0A 1KM4A 4TMCA 1VJZA 2D0FA 2ABBA 3W29A 3BTNA 3A4WA 2WANA 2H3BA 1FCUA 2XPKA 1RQBA 5CC7A 2EG7A 5F2MA 1BGGA 4PBEA 3UCCA 2R6OA 4UB9A 2C71A 3MI3A 4FPSA 5G1YA 4YNGA 3FX4A 2E25A 4FOJA 2NWRA 3UJRA 3BXWA 3S5ZA 2WLZA 4EANA 2TPSA 3NPVA 4PYSA 4BJHA 5BZAA 1FWGC 4OJYA 2YCLA 3UA3A 5KMYA 4O54A 3KOXA 5M03A 2VVNA 5D05A 1FKXA 4DM2A 1X8CA 2HS8A 1UBSA 4KT2A 3RM4A 3QPEA 4GVGA 3SGGA 4B5XA 1PBGA 1XLDA 1A5KC 3ZJ6A 5JH2A 3CMJA 1Z42A 3H70A 2CCRA 3MMWA 5EMYA 2D22A 2FB2A 1WAWA 2C1HA 3NL2A 2G96A 4Q8WA 3AAMA 1R2TA 4NAFA 4JTAA 1R86A 2WJFA 4GNKB 3UY8A 4XZNX 4EPBC 1EB3A 5DCDA 4DZ5A 5AHLA 4JFWA 1SPQA 1VYPX 4PTMA 1ZP4A 1W32A 2FLIA 1NOFA 2RKXA 1UD2A 3RYSA 3OBKA 2WHJA 4Y8EA 1JUBA 4GI9A 1V51A 5SWUA 1D3HA 1KV5A 1W31A 5JQ9A 3WUEA 2JQXA 3FV9A 3GE7A 1B3YA 3QYSA 4D2JA 3KXQA 2XIJA 1DXFA 4RDWA 3P3BA 2Z1BA 2ZA1A 1S2AA 1S46A 4IJBA 3MT1A 3UJ2A 1BQCA 3MO4A 1O5RA 1DJQA 1G01A 3AMGA 1DJGA 1LG1A 1K9TA 3TWBA 3UZJA 1ICQA 1QWGA 3ZLFA 3GXPA 3IWPA 2E68A 1X97A 1IGSA 4I7VA 2CLHA 4DWSA 4HHHA 4EACA 4QDPA 3U9IA 1TX0A 1LJYA 1HKVA 5E1QA 1WKEA 3OZOA 3N6JA 4QGCA 4N42A 2A7RA 4GC4A 1ISWA 1NTHA 1EZWA 1W1PA 3UZYA 2J25A 4JR5A 4TU1A 4HU0A 1ITQA 3DYPA 5CPOA 2FHCA 3UP8A 4GJJA 5DO8A 3GDTA 3URAA 3UJSA 3MY9A 1QHZA 5D9OA 3PJWA 2OEMA 3UG8A 4XSLA 2JGYA 1A5LC 3QMRA 2RAGA 5C7HA 4GD0A 1HJQA 2F2HA 5E6YA 5CGQA 4LWWA 1NSJA 5DXXA 1I2NA 1Y65A 2Z27A 4D71A 1VJIA 1TJ2A 4Q4QA 2G41A 4H3DA 5IFTA 3AFBA 1E71M 2WWCA 1ECQA 1X6UA 1Q6QA 4CNSA 2YDAA 5HQMA 4PZVA 3B8TA 2ZWYA 3WK1A 4R7WA 5HOSA 4GO9A 4PR4A 2VD8A 4DJFA 4RNIA 4AIBA 2PWVA 3GR7A 4F9DA 5I3IA 5D8ZA 2YDSA 1T99A 2E9MA 8CGTA 1XYBA 2VEMA 3W7CA 4M3PA 5CZTA 4L6HA 3IGXA 4DZHA 2WC7A 3CQKA 5BU6A 2ISSA 4LVBA 3EWCA 3K1GA 4X3ZA 4B15A 2INZA 5EFDA 3ZMRA 1FH7A 1OFQA 4YCPA 3IGSA 4Q4OA 4B91A 3HJEA 5D9MA 2XVGA 1BXCA 4XTIA 5I06A 3UQNA 4DNMA 1VHCA 4NJKA 1FCBA 2DFAA 2BNJA 4W87A 4DUWA 5J04A 1OFDA 1WKFA 1LUCB 4D6GA 1PV8A 4S38A 1WX0A 3G6MA 3QEZA 3VKKA 2BV9A 2TODA 3ARPA 5D09A 2BG5A 3GVWA 4PMQA 1OYCA 3OG3A 4B92A 2PUZA 4UTKA 2GPTA 2PLMA 2VQUA 3CAWA 4B3ZA 4J3WA 3W7IA 4UWMA 3OIHA 1B4EA 1TCMA 3PTMA 3OU8A 3CL6A 1BQGA 2BOGX 3NEVA 1O5XA 4H7ZA 3G22A 2O0TA 1PXGA 2BVDA 1DBTA 3V0UA 4KWVA 1VBJA 3T2QA 1GQKA 1GJUA 3S0CA 2XHYA 4F40A 4KEVA 4O16A 5HK4A 2GQ3A 1XLMA 5C70A 5CAHA 1XIBA 1VP5A 4URIA 3WBYA 2KX9A 2R8WA 3GNDA 1A4MA 1DWAM 2P5NA 3UVAA 4E2OA 2BVTA 2O56A 3SJNA 3H2MA 1UJPA 4CD4A 1HJSA 3O1NA 1L6FA 2G4FA 2ONEA 4S23A 1PTAA 4UOJA 3MUXA 1UR1A 1RAKA 1CGVA 2I9UA 1PX8A 3VOFA 1FWHC 2PDXA 3VDGA 4KETA 2RHGA 3N3TA 3NIYA 3KRZA 4GI8A 3V75A 3L4VA 1KRCC 4AWTA 4FR6A 4QJ5B 1XF0A 1M1BA 2YKKA 1FHDA 3R2GA 2QZRA 4MB3A 2DT3A 1D9EA 2RJGA 3N9RA 2W62A 1K9EA 1FWCC 3BH4A 1WB0A 2W91A 2R1MA 1HT6A 4ACZA 2V5LA 3G0UA 1WQ5A 4PUNA 3ORWA 4QEEA 4H6QA 3AMLA 3E49A 1UC4A 2QQ6A 4IXXA 5KSWA 4B3KA 4DJDD 2BP1A 1FHLA 1US3A 2DT0A 3E0IA 3WJSA 1LOLA 2WW5A 4LUIA 5A8MA 3UESA 1DWJM 2Y62A 3T4CA 5HPCA 3QHOA 2A7PA 4TX8A 5FEXA 5KITA 1K8CA 4M24A 4GQ0A 3N6QA 3RO8A 2ZUTA 3VNDA 4KCVA 4H01A 1ADSA 3N3MA 3NQGA 3TROA 3W86A 3VE9A 1X1ZA 4UCFA 1K9DA 2BFGA 3I3DA 3N4AA 4ZQMA 5LNSA 2XISA 1V0LA 4WJ8A 3RRAA 1TA3B 4GUHA 1J11A 3OBEA 4DXKA 1GOMA 4DUVA 1EJUC 1S38A 3U7BA 1P5BA 1SO4A 4JNZA 1E6ZA 4HTBA 4MKVA 4EWJA 1XISA 5JBEA 4IQDA 4UIOA 4HMCA 3EWUA 3SY1A 2YCJA 2DQWA 3NZ1A 3BDKA 4LSBA 4JTDA 3WH5A 3T78A 3FNDA 3H54A 3L4ZA 4AZ7A 3MANA 1OFOA 2VZSA 2BB0A 4HYRA 3IRSA 3UPMA 1OADA 3TCEA 4LYKA 2PGFA 1TZ9A 2FVLA 1A80A 4RDZA 1TKKA 3A47A 1FQ0A 3P8JA 2Z28A 4H8NA 1XYZA 2Y85A 2VM8A 2GGJA 4WKFA 4Q8PA 4KWOA 4LEFA 5TBOA 3SBFA 1UD8A 3BV7A 4WDXA 1R3VA 3WKZA 1IEXA 3FK4A 2R14A 4BQ3A 3M1ZA 4F66A 4HBKA 2PDMA 4JNYA 3WEMA 2QF7A 1X7IA 4H6RA 2YXGA 2HE8A 1E6PA 3IV3A 2NXIA 1PDZA 1UB3A 4HK6A 2HK0A 4A3QA 4KBXA 1SR9A 1G7UA 3R0UA 2UWFA 4GCAA 4TX6A 3U4FA 4XBKA 4RK8A 4XZMX 3AIUA 4F0SA 1XLCA 2E0PA 1HO4A 1JPHA 3WJYA 1EGZA 1P0KA 3IGHX 3G18A 3R58A 4IP4A 2O9OA 3S1WA 3D3AA 4M1RA 5I3FA 2PDPA 5CKSA 1DQUA 4PEEA 3FA5A 1KFBA 2VR2A 3U2EA 4J2PA 5HA7A 3CZGA 5CLTA 1UKOA 4OBRA 1EDQA 4NXKA 1E4MM 4QITA 1A0EA 4YN5A 2F6XA 1EHAA 3L2LA 1J2BA 4B5TA 3WH8A 2PAJA 4DRSA 3A22A 2YSWA 2QV5A 1EOKA 4XBSA 3C3NA 3L2MA 2WPBA 5JIPA 3GXIA 4R34A 1HG3A 4DI8A 2Y2WA 1A3WA 1X98A 2JKAA 3ITVA 3ITXA 5LXEA 4K1WA 1RJQA 5A6KA 3L4WA 1UHVA 4B9YA 1ENUA 2YBVA 1TQXA 1A5UA 4UTLA 1N2VA 2FPYA 1VBRA 3O0KA 2QPUA 3BMWA 3CPUA 3RIKA 4H2CA 3BQ6A 4MSSA 3E6EA 1V0MA 3TONA 2GJXB 4Y9OA 1M3UA 4HSOA 1ZQ5A 4XB3A 3PTQA 5C0QA 1V6TA 3LPFA 4MGGA 4Z2GA 2WHMA 1W5MA 3UEQA 2ZZ4A 4A29A 2O4QA 2FZDA 4IWWA 3WF3A 3T44A 3VIKA 4E2DA 2ZE3A 4DYEA 3W1QA 4CKQA 2GJLA 3QGKC 3OGSA 4LJ3A 4V1YA 2JF7A 3NPUA 3W2LA 1M68A 5D30A 3W1XA 4IQEA 3LMYA 3IIPA 3AIQA 4UQBA 3NZQA 4NAEB 3W7OA 5BMXA 2HK1A 1EP1A 7TIMA 1EO7A 3H8AA 4V27A 2NUWA 6REQA 3HV9A 2E5DA 4DBWA 1J6PA 2NX9A 3NA8A 3RX2A 1W1B1 4KEZA 4HA3A 8RUCA 4R9OA 1XIFA 3R25A 3RXZA 3CU2A 5BWFA 2PRMA 4R33A 4LRTA 3UFYA 1TYGA 4GIAA 3ZOAA 1P6BA 3FLUA 4JTIA 1FDJA 4MVAA 1GJWA 1CXEA 1XQLA 4JX4A 3QJAA 1RJRA 1JDEA 2CWNA 3KTSA 3OQEA 4Z1DA 4WDWA 3WLPA 4YYCA 1KV8A 1FH8A 3L5LA 2VDGA 4MB4A 2VEIA 2ZVIA 1OC7A 4H6KA 4BFAA 4QLLA 1JJKA 1ME7A 1Z7AA 4IIDA 2TMDA 4Z1CA 4AD0A 3B0PA 4OGZA 1XFBA 1L6WA 2PDJA 1GCYA 1R9ZA 2NUYA 5E93A 3H2FA 1HP5A 1HTIA 1ISVA 3B05A 4JX6A 3THAA 5ABGA 4RE4A 3VD9A 1QBBA 2EXOA 3LHZA 2GWGA 4X0VA 4JIRA 3ICJA 3GAKA 4EVZA 3S42A 4BR1A 2FH6A 1HN1A 3LUTA 2EG8A 4D8ZA 4LAZA 4ASTA 3LV6A 4FK9A 5HWMA 1B90A 3QKEA 4G9PA 4H8VA 1ONXA 2CHRA 3V0TA 3ZWSA 1DWHM 2V3FA 4ECLA 3PANA 5DCBA 4IP5A 4C90A 2DIEA 2DW7A 4ZO6A 3BZJA 1XG3A 3NEHA 1QCWA 3NO5A 4EAYA 3AHZA 2OSXA 5I6SA 4CN1A 1KKOA 3H2NA 2GDVA 2ZUSA 3UGVA 3XISA 1HKIA 4Q4RA 3D47A 5C9WA 3HB9A 3CMGA 1IT0A 3ZT6A 4AVNA 4QQ3A 3DG3A 1Q7QA 3TTOA 2CETA 2I14A 1HVQA 2YBTA 4C6IA 3QSTA 1B5TA 3DHDA 3KVLA 2EKCA 4H00A 2CLEA 1W56A 1MQPA 1UH2A 3VOGA 1NDWA 2YW4A 3VGDA 3FDGA 3WFLA 1RD6A 4P7QA 2ZX6A 3M46A 2YIHA 3GG7A 1SJDA 1YDOA 5FJJA 1DHPA 5CC3A 3C2FA 4JTFA 1XCFA 5AHMA 3S2CA 3S47A 4E8GA 3MBFA 2RGMA 1WOBA 1UD3A 2ZYFA 4PCTA 1KRAC 3THDA 1QMLA 3I7QA 4D8AA 5HMDA 1OG0A 3EBVA 4TUFA 4HOXA 3A3WA 1EX1A 3E0FA 1KKRA 3UD6A 4POCA 4DF2A 3CUJA 3IIOA 1V08A 2JBMA 3QMSA 1AJZA 4AISA 4MY9A 2ZRYA 1WPCA 4IHCA 3PWAA 2Z25A 2WBGA 1R3SA 3BGJA 3NVDA 4LYPA 1BG4A 1GOWA 1W5PA 3TYAA 3E0VA 1LTDA 2POTA 4L56A 4JEJA 3GTXA 4AD2A 1DL3A 3PG9A 1SO3A 2CNCA 3GIQA 2PP3A 4GINA 1KFCA 3VMNA 2YZRA 4GYPA 4HVXA 1TE6A 2J6XA 1NWSA 3RUBL 3UU0A 1Q7MA 1I0BA 3DENA 1D8WA 3G0SA 3S9IA 4XVDA 4UTUA 3GKAA 1FDZA 1H60A 1LORA 2PDBA 3BLEA 4JAWA 1NARA 1P0DA 1NOWA 2PEVA 1XSKA 4TVCA 4U5KA 3WL1A 3BLOA 3BZGA 3OPSA 1XQKA 4UTMA 4M7TA 4GXPA 4QQUA 2KAUC 3CZEA 2PZ0A 3WFZA 1L8PA 3E02A 5DT7A 4LU0A 4N9DA 2WCSA 1XS2A 3TA6A 5BXSA 5HWNA 1PIIA 3POHA 3BO9A 4GUFA 4Q4KA 1TPH1 2VL4A 1QWKA 2J8FA 2VEKA 4YHEA 3KCOA 1KBLA 3QR1A 1W1A1 3WEZA 3N2MA 4LUTA 3UR5A 1GOXA 5JXQA 4G7EB 3STEA 2EHHA 5H8UA 2VP8A 3S4TA 2WB5A 3HJZA 3ENLA 4O17A 4RV8A 1M6JA 1V8EA 4B2DA 3AYVA 3CMFA 1VEOA 1W3KA 1J6OA 4S3KA 2CLFA 1SFJA 1UP3A 1B3OA 1EEXA 2QV4A 2WJDA 4O1CA 4QJ1A 1CLXA 1XUZA 3G1AA 4Q7NA 3VTRA 2OQLA 4GYKA 1XC6A 3WELA 1F8MA 4UFJA 3SRKA 1UQYA 2W3ZA 3B03A 4GQRA 2YXXA 4A3UA 3VZXA 1XD1A 4A3RA 2PWFA 1TUXA 3MKKA 3KZPA 1G7VA 1OFPA 3ERPA 1XIEA 2V38A 1A5SA 3H2EA 1R30A 1OGSA 1UMLA 4GWEA 3NQMA 4I9TA 4I90A 3KWSA 4C1LA 3ARQA 5RUBA 1ZJIA 3TH6A 3TX9A 4LY4A 1UKSA 1BVWA 1E9ZB 4LNCA 1XSJA 3HFYA 4HZ8A 1GVOA 4P61A 1E9YB 1XRSA 4L4LA 3CAQA 1ODZA 1UG6A 4FEZA 3P61A 1VB9A 4J27A 3ANYA 1HJWA 2WQDA 1CEOA 3UT0A 4PN2A 3IIVA 2PTWA 3O2LA 3WMSA 2WMIA 2Z6IA 4E5TA 3IJQA 1E0XA 2JKPA 3UNDA 2XVKA 5H8PA 3TW9A 2ALDA 4ZB2A 3GHUA 4F2UA 1FWFC 2NZLA 4OBTA 4JIQA 2QUTA 3PNUA 5EPDA 4AZCA 2ANUA 5LNUA 4NYUA 3JVAA 1DVJA 1NAL1 2QCDA 2F8QA 3IK2A 1E55A 2H8XA 2E1WA 1GUVA 2QUNA 3L0NA 4E4FA 3RLVA 3FVDA 5AHEA 3CL7A 3GVVA 3AROA 1Q6RA 3QM3A 2WYSA 1YTKA 4U4MA 2OODA 4GABA 3KLLA 1JXJA 3VD4A 1SMDA 4ORIA 1D3GA 1C29A 5HMEA 5DQPA 4GVFA 4Q7IA 4UR7A 1V6YA 1QI5A 1XYFA 3W1AA 1VHNA 2Q01A 3CEUA 3CQHA 3W23A 4EOUA 4MF4A 1KTCA 2EJ1A 4FXRA 4QRNA 4PL1A 3TYCA 1IF2A 2HQAA 3G1HA 4JX5A 1PTDA 4JDBA 4Y6GA 1WA3A 5CZSA 2BTMA 3P60A 5EKYA 4QLJA 3IUIA 1GZGA 3P2VA 3SM0A 4GA8A 3B97A 4DBDA 2P76A 4LAKA 3RRXA 3R13A 3IGUA 2OELA 3BOLA 4J3XA 1R5YA 1Z44A 3L4YA 5CSYA 4KEUA 1VJSA 1J0IA 3H4GA 3DU0A 2WMGA 1AQMA 4KRTA 2D73A 1O5KA 2VZOA 1VQTA 5AC7A 4HCLA 4ZO7A 5GJNA 3QZEA 4RNHA 1MXSA 1BAGA 3AXKA 5D2TA 5C5YA 1S3TC 1YBQA 2X16A 3HOJA 1UWSA 2WMJA 4GJ1A 3QW4B 3V35A 3WLLA 3RX4A 1WE5A 3VNJA 4HPNA 1F07A 3KTCA 4JN8A 4QSFA 4HTYA 2VXNA 2FZMA 1F9CA 2O7SA 3HQOA 1O95A 3SIZA 3J7HA 1QNOA 1QPRA 1Y7VA 4DO6A 1ITXA 4PUMA 4TVUA 3AHTA 3UZWA 3C2EA 4Y90A 1RP9A 2VT0A 3M0JA 1AD1A 3DHFA 3TTEA 3ZVHB 2VZUA 3QVQA 2VFFA 3RX3A 3VVGA 2PDCA 4PFMA 4ZSTA 4MFEA 3QYQA 2YDQA 5CZJA 1RA0A 2V2DA 4M19A 4AMAA 2NW0A 3U8GA 4MUZA 5GQBA 2GVEA 2HBVA 1ISZA 4JIHA 2E8ZA 3DN5A 4NHVA 2GOKA 4F0HA 3BSHA 3CV6A 3PS7A 4BZYA 4EP8C 3E0LA 3LSCA 4D6DA 5HUPA 2PTXA 4XD3A 4FLSA 1QXLA 2BVWA 2NLIA 4DPQA 5AZ0A 1XLGA 4X61A 4YVVA 4O13A 3MBDA 1NWUA 2FKPA 3EDKA 1HZYA 1SFSA 3UBPC 3W7GA 3LD5A 2VELA 1HJXA 1M65A 1VYRA 3A12A 3H53A 1EIBA 1JZ3A 1RBLA 1PX3A 2H9AA 4XVEA 1Q6DA 1ZU8A 1ZAJA 2FYMA 4DI9A 3UNTA 5H91A 3TAKA 4NI3A 2OLHA 3RCYA 5EYWA 3CPGA 3NQ7A 3S83A 3GYEA 1PWLA 3OQ8A 2UZ9A 3A3HA 3DXIA 3AICA 3MC5A 4Y9PA 4ICCX 3UXKA 1SSDA 5FSDC 1OC6A 5K4ZA 4LVGA 3P0WA 1UUQA 5D9PA 1JZ8A 3ZR6A 4K36A 2VFIA 1H3GA 3R94A 1JDCA 4FO4A 2V5DA 3VE7A 4W85A 1ZAIA 3WBWA 5LA1A 1C9DA 2WNQA 4WY0F 3WMLA 4YTTA 4Q8TA 1AMKA 4O4WA 2ATSA 3UW6A 1JCXA 1M7XA 1ZGDA 3BLDA 4DZAA 2XG9A 3T40A 5K2ZA 4GI6A 5LGZA 1IE7C 1BXNA 1ONWA 4P7RA 1XBXA 2GDQA 2IPGA 3KAOA 2PLJA 1LZOA 4DY1A 2FVKA 3W87A 1W1IE 4ZBCA 1XIJA 4BF9A 2G3FA 2DZVA 3P7YA 3TOPA 3ZFHA 1XLIA 3VX1A 3PNZA 4EF8A 3RHGA 3PZNA 2ZRXA 3G8RA 2ESCA 4F9JA 2JIWA 3EXRA 3OIXA 3W2MA 3F2DA 1AG1O 4UCGA 1GPWA 5JIWA 1F6YA 2B4GA 1H7WA 5BMWA 1CB2A 5GJPA 2I9EA 5HPOA 3IRDA 3ONCA 2ZZ6A 5EA9A 5FJTA 2GGIA 3V5OA 3K8KA 3EOEA 3QFEA 4XZLX 2WMKA 4JCMA 3HGSA 1WDQA 3TLLA 1BXBA 3IEBA 1J5TA 4Y2WA 1F2JA 3BCDA 1SJCA 3EA2A 2JEPA 3W7KA 3HGRA 3FVMA 3K8LA 1UWUA 1W9XA 1B3VA 1BKSA 1NY1A 2DZBA 3PK7A 5EU9A 3A13A 5H1WA 1C91A 2C7FA 4JS3A 3ZZ1A 2B0MA 1NIUA 3AS3A 4M82A 2C79A 1UOZA 5I78A 3FCPA 3BL3A 2QVHA 3AZTA 4XD5A 1C8YA 1QHPA 4C6PA 4REQB 3RO6A 1W1YA 2OVLA 1ZJAA 2IQTA 1GZ1A 2A3AA 3H23A 4XKYB 4Z2IA 1LUCA 3FJNA 2HVMA 1ZBCA 2QKFA 3DFPA 4P7OA 1M7PA 2CBUA 3TOYA 2D69A 4C6QA 4AZ6A 1BYBA 3IJLA 2ZZ2A 2VX7A 5JMUA 5FL1A 1DYSA 2WNWA 2RDWA 2GVJA 4OUIA 3VMOA 2GUUA 1E0VA 1CENA 3W37A 4K37A 3SR7A 1HVXA 5CCZA 2AMXA 2WVVB 4IPNB 5AC4A 4L1WA 3BMVA 3LS9A 4MYXA 3CNYA 3EXSA 1F7BA 4C7DA 3SGZA 3E2QA 3VDBA 3A4XA 1P0NA 2V5KA 4JTKA 1TPUA 4UMCA 2JALA 4L65A 2J9YA 4H6EA 1CBGA 4N7QA 1BLIA 1N7KA 3WH9A 4K8GA 4PCSA 4KWUA 1Q6OA 2VR4A 4IM4A 2QJIA 3RLHA 5E0KA 4R3UA 2W92A 1GYLA 4GYJA 3E96A 2SFPA 1KM5A 4HPXA 5AHIA 1QO2A 3MP3A 2OEKA 2HWGA 1BRLA 5XIAA 2XVPA 2ZXBA 2HCVA 3UA4A 4NZCA 5E0CA 2GUYA 1L0PA 1VFUA 5FJPA 2X05A 4E8CA 3LTPA 1VFFA 1W5OA 1MMFA 1S5WA 1XGEA 2CU0A 5ABFB 1VCGA 3KEHA 3GTFA 1S5VA 1TMHA 3GDLA 3G3MA 3CZ8A 3BMXA 2W0UA 4I9JA 2DVXA 1S2UA 3QSRA 3GYCA 3MZNA 3RFAA 3REQA 2Q3RA 5KZEA 2ZADA 4IP7A 1W3NA 7PTDA 3PB0A 5G2IA 4KESA 3A6OA 1CB7B 1R7AA 3DC0A 4HSHA 2PWGA 3CLMA 4HNLA 3K4AA 3ZJ7A 2VJXA 1FKWA 1H49A 2QCMA 1WXZA 5F1VA 3WF2A 3TQVA 4PTNA 3LTYA 3BLKA 3M0LA 2DPEA 3GB6A 1REQA 4JHZA 3R7MA 3KX6A 4BI6A 3W00A 1CXHA 1V4YA 4K8HA 4TR9A 1V5XA 2DIKA 2X1RA 5M1TA 4AF0B 1FOBA 2QDDA 3FHQA 2TSYA 3FXGA 3VNIA 4JTHA 3F4VA 4RXFA 1JZ4A 3SCPA 2Q8LA 3LNMA 1TPC1 3H22A 3HPFA 3T8QA 1UWTA 1S2WA 1XBZA 1TA3A 3RPMA 3S3GA 1E5NA 1DE5A 4C6FA 4UMAA 3OA5A 4IISA 1J0YA 4WSJA 4QJ3B 2GJNA 3AALA 3O6CA 4Q8NA 3NYZA 2ZA3A 1LRQA 5CPSA 2PDGA 2LLEA 2YFNA 4PTVA 2DSVA 3B4UA 5HINA 3ARXA 2IQDA 2WMHA 1JI2A 2C8NA 5AVNA 1AQFA 1N8FA 2INEA 2OQYA 3KOYA 3OYXA 1EP2A 1KXTA 1PHWA 3BSGA 5K9CA 3VKJA 5G2WA 4WSHA 5IFPA 1OFAA 3WNPA 3WNMA 4ADTA 2HE5A 4RZ6A 3BE7A 3VC6A 1I2OA 5AC5A 3B8WA 5F2LA 2IKJA 1TTPA 4KW2A 3ZSSA 3DFNA 4O1AA 2BY1A 4JTSA 1G4PA 4ACYA 3LU2A 2VD9A 1JYNA 3LN3A 4D1IA 2V2CA 3K13A 3GU9A 3S5SA 4LALA 1LP6A 2DJLA 1OFEA 4XAYA 5ABEA 1RLCL 3NGFA 4E0CA 3W7QA 2DIJA 2BDQA 2ZZ3A 1ZCCA 4DAFA 3F1QA 4FS9A 5AC6A 2G3NA 2QULA 3R79A 3KE0A 4MJ2A 2B7NA 2CZEA 1U1HA 1X8FA 4S3EA 1U1JA 4UFMA 2XIMA 3AMCA 1EIXA 4X60A 3RGTA 1K8YA 3OZYA 3EGJA 3GU2A 1UWQA 3ZS4A 3SUTA 2X1SA 4J1OA 2XN2A 4WEVX 1G5AA 1FX6A 1W8SA 4PB5A 1F3EA 2O9RA 5C71A 2UY2A 4LOCA 1NWTA 4S1FA 2W61A 1YNPA 1LQ2A 1AVAA 1LRNA 3M7WA 5LIUX 1J9YA 3V18A 1Z32X 1BWKA 1TO3A 4W89A 5FJOA 3EA1A 3PVFA 3QFWA 3MSDA 1UCWA 3CJPA 3EB2A 3QLDA 4NZFA 4NNCA 4QXIA 4B5UA 2CESA 1RSCA 3KLKA 3TZNA 5D2YA 1OX4A 3LGDA 1CI1A 3CGTA 3PUEA 5I00A 1IXPA 3PPCA 3H24A 1R2RA 3LRKA 3NOYA 1RLDA 2J7CA 4X2PA 3LNPA 4MLRA 2GJXA 1Y8BA 2J8GA 3M0MA 3M41A 1RK6A 3LHWA 2YXOA 3QY7A 2X8RA 5I3DA 3O6AA 1GVYA 3DG7A 1T8XA 1QU4A 4ENLA 1EXPA 5T9BG 4N0RA 2Y0FA 4L4MA 4CQCA 2ACUA 3N2CA 3G3DA 1XINA 1SM9A 1XH2A 5FKYA 5IBXC 2C6QA 4IQLA 1FP8A 1GHSA 1ZPTA 4NAEA 4ZQPA 1ADDA 3ZR4A 3LCFA 4NZJA 5CH9A 1IXOA 4N9EA 4G8TA 2AKMA 3V7PA 3DYOA 1W5NA 4L9ZA 4JQ4A 2X1UA 2Z1KA 1TVNA 2YB4A 4UFHA 4LY8A 3ES8A 1POKA 1EL3A 4G56A 4TV6A 2AAMA 3CWNA 3HN3A 4QLKA 3VKCA 2F38A 2XINA 1TG7A 4BWLC 1V3LA 2AKZA 1OIFA 3N1AA 2CITA 3URBA 2OZ3A 3WYZA 7ENLA 5FCZA 4PRTA 1LG2A 1EJ7L 4H9TA 1OIMA 6TIMA 3VOJA 4WHBA 4AIEA 1W1VA 3AIVA 1H11A 1LROA 1C93A 2CKRA 3H2AA 2XIQA 2V5JA 3VIPA 5D33A 4JY8A 4UUIA 4DPPA 1ODUA 3NXFA 2NX3A 1WBJA 4Y96A 2OLAA 5A8NA 1TTIA 4GH1A 1W37A 3OGVA 2X42A 3ALFA 2G4JA 4ZB0A 7XIMA 2ADAA 3QOKA 4QE5A 5CJ5A 3NM3A 2PDIA 1IZCA 4HB7A 3N25A 4INFA 1TRIA 1C8VA 4E38A 1BVZA 1MFUA 3SUVA 5HUOA 4M6VA 4U2YA 4XSMA 1UZHA 2VC9A 2W66A 5CJMA 3QQ1A 2J7DA 3OZPA 3SB0A 2OU4A 1GONA 3W88A 3OYZA 4JGDA 5TD4A 2WSRA 2D3NA 5HXMA 3B0YA 1B57A 1E1FA 1PAMA 4XQ6A 3ZT5A 3TJIA 2PZNA 2UY3A 4H9VA 2XH4A 1PWMA 1LLZA 1UZ1A 3KP1A 1W9VA 3JUGA 3WQDA 3EAUA 4MNMA 3BG3A 3N29A 4ATWA 1R6WA 4ZEPA 1V3HA 3CPRA 1JRCA 4FLOA 1JD7A 4JL1A 4ZTXA 1XM3A 3NM1A 3NUKA 4MM1A 5J5RA 3QV8A 2HVOA 2XGZA 4LBUA 2XSXA 4GE8A 4H41A 3EMQA 3U4AA 1DTUA 4GJIA 2WCAA 4AMCA 2JFEX 4YTUA 3DGRA 2C14A 4LB4A 2BODX 1EYEA 3KRUA 3TC6A 1LT8A 1FXPA 2QJHA 5CZ0A 1FBAA 1ZCOA 2ABAA 3E3HA 1Q66A 3T2OA 3R10A 4R85A 3D0CA 2V0TA 5A2AA 3SUWA 2DP3A 3PBMA 2VUYA 3L4XA 4TVDA 4C6NA 4XKMA 3IJ8A 2C16A 4A35A 4ILSA 2QDGA 3T0AA 4GXMA 1VPXA 3PZTA 3WLMA 1PEZA 5CSSA 3GS6A 4DJDC 3PAJA 3VC5A 4M81A 4WR3A 3IJDA 4Z2KA 3SIMA 3ABQA 4WZHA 3GTIA 4XK2A 2P53A 1KC7A 2J66A 1EA9C 2YOCA 2OCZA 3L12A 2G97A 3SFKA 3L5AA 3PWIA 4E6MA 4X2RA 2VFDA 1XYMA 1TZZA 2FDSA 3UZXA 3WQGA 1Z6KA 1XLLA 4H8UA 2GWNA 4C65A 1KB3A 1WCGA 3SECA 1FWIC 1QOXA 1XW8A 5GNXA 1GQIA 2QIIA 2WJEA 2I17A 5A1AA 4PMZA 5EMLA 4RZBA 2VGBA 3MO7A 3N6HA 3MKVA 1QO5A 3VKAA 3FKKA 5CXPA 1EJXC 3C8FA 4IL0A 5BOOA 3N2TA 1JGIA 3DYMA 9XIMA 2WKJA 4HCHA 1V0NA 2ZC1A 3CO4A 2QJNA 5T91A 4LFYA 3UWQA 4DWDA 1UMYA 4F0MA 2X40A 2C13A 3CUIA 4JKKA 3BAJA 3MMUA 3ITYA 4EPDC 4IMAA 5I5RA 1N55A 2ZXDA 5DFAA 1F4AA 2V8ZA 3N04A 3B06A 1D3CA 1HFBA 4A6GA 1CZ1A 4AEOA 5I3GA 5H2ZA 1YXDA 3GG1A 4P8VA 3M5YA 3N12A 4ML4A 3LQGA 4XZ9A 3W1TA 4G7EA 4UR8A 4LX4A 3S5YA 3SCRA 1HJVA 2A4AA 3WLQA 3TW7A 4HP5A 3AYTA 4K2SA 4LH8A 2ODOA 1PKYA 1VFLA 1QW7A 1JFXA 3ME3A 3MP4A 5KZ6A 4LVFA 1E1CB 1C8XA 1MWOA 3RPDA 3UWYA 1UWAA 3EA3A 1H1NA 3IS4A 3EYPA 3RLUA 1DEDA 1NP2A 4DNHA 2W9MA 2ZTKA 4O14A 1WAUA 2DVUA 2E9BA 2RJHA 2VMFA 2AMGA 4XO6A 2ALRA 2PGWA 4HJFA 3OB8A 3O3RA 4DUOA 1E73M 2UBPC 2OKTA 4BKNA 2GYIA 3R0KA 1LDCA 1PPIA 3UCQA 4A2RA 4N02A 3SCVA 2A6LA 3E38A 4CU7A 3FIGA 1VBUA 1V79A 4LBSA 2XIOA 4NILA 3HGJA 3M0HA 1UD5A 3QY6A 1RHCA 3U3HA 2VRQA 3PJXA 3ARUA 2AL2A 4F0KA 2POZA 1UH3A 8XIMA 1JCYA 4QJ4B 1OCQA 3BAIA 4DLFA 2Y8KA 1OB0A 3FOKA 3HPXA 3PZQA 1Q45A 4QDMA 5TNVA 1FWBC 4UQDA 2Z00A 4DO5A 1E0UA 4AC1X 3M5XA 2ZUVA 1VEPA 1PIGA 3KW3A 1HXJA 3TYUA 2OYKA 3AISA 3MVIA 3B40A 2UY4A 2VCCA 1SQ7A 1K4HA 3ARZA 5CBIA 3SQMA 3CUZA 1V6VA 1I1XA 2VRKA 4Q6XA 1A53A 3TSBA 4MWAE 5KZMA 4F0LA 5A6TC 1BWVA 2FIQA 3STPA 4XIMA 3KDOA 1A49A 1FWAC 2RDUA 1U83A 3P74A 4D6FA 3S1XA 4PULA 3EOOA 5DBUA 3E0WA 1N82A 3T9PA 5A3HA 3DESA 3LCIA 4Z0JA 3VAVA 1V7AA 3VDHA 1PCKA 5TF0A 1XIIA 4IG2B 3SN4A 4L4PA 1A5BA 1FUYA 1ELSA 2TAAA 2DSKA 3DOPA 1I60A 2EBNA 5F4SA 3GXDA 3GH7A 1B9ZA 1UZDA 4B4HA 5FF0A 5D37A 1UD6A 2BXYA 2CLIA 2DGAA 1T7LA 3S2MA 3PP7A 3PPGA 2R9RA 4YLWA 4UQCA 4JTRA 4BF7A 2WKLA 1QRQA 4GNJA 2DW6A 3SADA 4PCPA 4UOQA 3GQYA 3W2JA 5H8MA 4F2TA 4KS0A 2PTDA 3C2VA 4I3GA 4LAOA 2PC4A 5E70A 1W9UA 2V9DA 3VA8A 2DSWA 3PR2A 3BG9A 4CNPA 4JTGA 2VEPA 4ZOEA 5M17A 3AWNA 5C8BB 4BQ4A 3IVTA 4OFCA 3TEVA 1CCWB 2G8ZA 1H1ZA 2FTWA 3ZYZA 4EAMA 1DORA 1LOSA 4L1XA 4Q8OA 2G3MA 1ME8A 4MUPA 5L9FA 2IMRA 1RH9A 4NP7A 1C7TA 3BCFA 1M7OA 1YHTA 5AFDA 3LCGA 4AD3A 3V36A 5A6JA 3B0UX 3DKLA 1I6NA 3ZQ9A 3WF1A 1YXYA 4MNKA 3TFCA 3ZVHA 4W88A 1DJXA 4W9TA 4LC8A 5FA5A 4W4QA 4WKAA 3C3UA 1M5WA 4MB1A 3HV8A 2Z6JA 3P81A 4UMBA 1IXNA 1SMAA 3GDMA 4C6MA 9RUBA 4YTRA 2YL6A 4S2CA 4GX9A 3MU7A 4U5IA 3NURA 4CQDA 3ABXA 3I10A 1KFEA 3EX2A 4AUBA 1JPIA 3SUUA 1WDWA 2GOUA 2Q02A 3C2YA 3AXMA 1JG9A 1L8NA 4C91A 1TMLA 3KHDA 4M56A 3QH2A 1RCXB 2JF6A 4NX0A 2VZTA 3F4NA 3TYBA 2DU2A 3RLGA 3KVMA 1XH1A 3DI0A 3D5HA 5C55A 4D72A 1VD6A 2DJXA 5BNKA 2E5BA 2OWCA 3FEQA 3S5OA 1O12A 3I68A 3P6LA 1KW1A 4S3GA 2R1KA 1FDYA 2OPJA 5JVLA 3NQEA 4DWSC 2A3HA 2UV8G 2VX4A 1T6MA 4AWEA 5DMYA 2X1TA 3NPXA 1VRDA 4XWUA 4ZQRA 3VMPA 1MRQA 3PN8A 4WGHA 1MEIA 3CK5A 2HXTA 5EY5A 3PBVA 1JD9A 1EDTA 1OZMA 3OVQA 1JZ2A 4LQ1A 1QNSA 5E5CA 4Z1AA 2ZIDA 2BGQA 4YIWA 4FX8A 2EEXA 3QMTA 3V16A 3ANUA 4DF1A 3PTDA 3P67A 2Y8UA 1CX9A 4C6EA 1VCVA 3TJ4A 4Y8FA 5FF3A 3F5JA 3W1LA 1LOQA 2P88A 2C0AA 2NT1A 3C56A 4WF7A 1MQRA 2BY0A 3WY1A 1LWHA 1JDDA 3LXCA 5J5DA 4JFVA 1CLKA 2WSKA 4KEMA 3RILA 2PODA 3O06A 3CUHA 1UUOA 1KTBA 3NQDA 4CN4A 4N6EA 2D23A 2X2YA 2V69A 1PZ2A 4JY9A 1YX1A 6A3HA 1OFRA 4DF0A 2CZFA 1GYMA 1D2KA 4N4PA 1JUEA 4X0NA 3R11A 2XFYA 2MUCA 2HS6A 5CC6A 5LA0A 2CLOA 5BU9A 2NT0A 4FNRA 3NXLA 2DZWA 3EWXA 5AECA 2VOMA 2W67A 3A4JA 4OBSA 4CEUC 3WG6A 1JAEA 1AODA 4HMNA 1HKKA 2GQ8A 2R24A 3ATZA 4OWGA 4H04A 4NAFB 3SCUA 5C9ZA 2ZUWA 1W54A 2Q71A 1R7OA 3U2ZA 1XRVA 2GSEA 2A3CA 3MCMA 4QE4A 4DVOA 1V02E 4GC3A 3L66A 3ARTA 1HGYA 1KR0A 1SGJA 3N2XA 3D46A 3TTQA 3SFWA 2CBIA 4U33A 2OX4A 3AMDA 4XKYA 3I3EA 2Q3OA 3LCWA 3OGRA 3IJIA 3EX1A 4KFPA 2V2HA 4GUGA 2Z1VA 4C6OA 4U3AA 2OT1A 1QNVA 3VIOA 4HU4A 1TQJA 3BAWA 1RBAA 2NVDA 2V6AA 1TVPA 2WVVA 3HQ1A 4FNQA 4B5NA 1IWPA 5D4YA 4CQ8A 3HQNA 3VIMA 2I56A 3S6TA 1RPXA 1XGDA 3AIEA 1MQQA 4PMYA 3VZZA