1HF6A

Endoglucanase cel5a from bacillus agaradhaerens in the orthorhombic crystal form in complex with cellotriose
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
b'SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE B
publication title Direct Experimental Observation of the Hydrogen-Bonding Network of a Glycosidase Along its Reaction Coordinate Revealed by Atomic Resolution Analyses of Endoglucanase Cel5A
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 119
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hf6A00
1JD9A 4FLQA 4H8HA 3L4ZA 1KCKA 1VBRA 1LL7A 3B9EA 3N15A 2VZUA 3PTQA 3PTMA 4LXFA 2E9BA 1KXHA 1TUXA 3LPOA 4IUGA 5I78A 1EOMA 2JFEX 3AOFA 5GNYA 2W63A 4W88A 3TP4A 1CPUA 3SCWA 1QI5A 1QNOA 1PAMA 2DT0A 4M81A 1QNPA 2VURA 4TTUA 1C3FA 3W28A 4Z2GA 1JYWA 3WMCA 3QOMA 1EXPA 3VGFA 1H0IA 2X1IA 4QCEA 2GJRA 2AOSA 2E0PA 3VPLA 2YA0A 1D3CA 1WZKA 3BXWA 3ARPA 2XTKA 4ACZB 2VVNA 4U5IA 3GH4A 5CLWA 4PCSA 4JL2A 2ZUTA 1GNXA 4MPKA 3ZSSA 2EBNA 4JCMA 4PMOA 4QLJA 2W92A 1BYCA 1OCQA 1HNYA 8A3HA 1EHNA 2O9OA 4CD5A 3GNRA 3SCTA 4J3TA 5AYIA 2CITA 1GQJA 1UR8A 1K9EA 3A4WA 3WMSA 2QPUA 1F4HA 1DWFM 4B3LA 4CCCA 1JAEA 3BLPX 3T09A 1OGBA 4L4OA 2WVSA 2NT0A 3BSHA 3CIVA 3WQ8A 5JUVA 4OBRA 1Q6CA 3SCNA 4MB5A 3WNKA 5KEZA 3DC0A 1G9HA 4A3YA 1EH9A 2DT2A 1TMQA 1UKTA 3MS8A 3WEZA 3CZKA 4UQ9A 1E72M 4GI9A 1XSKA 3OG2A 1LG1A 1OINA 3OBAA 1VEPA 1G1YA 1OB0A 1UD3A 3IAQA 2PWEA 2BFGA 1EA9C 1CLXA 1ZL1A 2XM2A 4OOUA 4DWSC 1E6SM 1EHAA 1E6PA 4PTMA 4XUYA 1W1VA 1R8LA 3AMCA 2WMIA 4PBGA 3NJ3A 1UWQA 4KRTA 1GQLA 2ZX5A 3DYOA 2YLLA 2JE8A 3ZJ7A 4UOZA 1DWGM 3WDPP 1HKIA 3AMLA 3FNDA 2FDMA 1UH2A 2UWFA 3WH7A 2XUCA 1YQ2A 1HJSA 4MNKA 2EJ1A 2VZVA 5D8WA 3QGVA 1Q4NX 3UR7A 1UQYA 4TX6A 4ATWA 4TOQA 1E6NA 4TVDA 3PHAA 4MJ2A 1E6QM 1LL6A 4NSBA 4J3UA 4J3VA 2OSYA 3APGA 2OSXA 5BYWA 5A6MA 2WKGA 2VRJA 3TONA 2D2OA 5A69A 3RIKA 1W3LA 4Z2LA 1R85A 2WBKA 2OWXA 4UFMA 4QLLA 3SCRA 3WMBA 2VCAA 4LQ1A 3K8KA 5GNZA 4IPLA 3WY1A 1NOWA 2X8RA 1ESWA 3OZOA 2E3ZA 5BRQA 1H3GA 4UFKA 3A47A 2WKLA 1VJZA 5A6AA 1QPKA 1E5NA 4HZ7A 3VGDA 4AEEA 3AIVA 4B9YA 4D6EA 2VTFA 3BAXA 1GOKA 4P8XA 4V2XA 4XZBA 4W7UA 1LF1A 4TVUA 1HF6A 1V02A 3CMGA 3VDAA 4V28A 5CGTA 4CCDA 3KL0A 3PZVA 3WQ4A 2GFTA 3FAWA 4KGLA 2DIEA 2J77A 3F5JA 2DSWA 3RO8A 2EPMX 3T0AA 1CTNA 3WNMA 1TFVA 2QMKA 5BCAA 4W93A 4H2CA 3WEMA 1W3KA 4PMYA 3T2PA 1GOIA 3W6LA 4AD4A 3KE0A 1JYNA 2E8ZA 3IK2A 2VX7A 2WYSA 3VIMA 2QHAA 4GZJA 4NRRA 1O7AA 1DTUA 3CUJA 4YN5A 1C7SA 3O2LA 1E40A 1PEZA 4QDMA 1UWUA 1J12A 1ISYA 3HMCA 1UD8A 2E9MA 2PC8A 1QI2A 1ZJAA 4HU8A 5ABEA 3BGAA 3VGEA 1GUVA 4ZXOA 1CENA 5LYRA 1E70M 2Y5EA 4RE3A 2WC3A 3S2CA 4D1JA 4OUEA 4EKJA 3EDFA 4P8VA 1LQ0A 1E55A 2W67A 4OZOA 3ARXA 2XSAA 2IXVA 4M82A 1BYDA 4MAVA 3MU7A 5EBAA 1E0XA 3NSXA 1C90A 1WKYA 4AZCB 1L0PA 1ITCA 4Z2JA 1ITXA 2CBVA 4MDPA 2YBUA 5CPSA 1E4NA 1B30A 1UR4A 1JFHA 2QPSA 3E1F1 4F66A 3OIHA 1HJWA 2ZWZA 1UD2A 5A8MA 4UFJA 4D71A 3WUEA 3EMCA 1H1NA 5F7UA 1TA3A 4D6DA 1WCGA 1JL8A 1J9YA 3VX1A 2G3JA 2VC9A 3SUUA 4CD6A 5AC5A 3QHMA 2ZWYA 1WZMA 2DT1A 4UFHA 3RM4A 2W91A 4D6FA 5I3DA 4HPGA 1BG9A 3ARZA 5CGMA 3PZ9A 3W29A 1EQCA 1WDQA 4MB3A 4Z2HA 2WPGA 4BF7A 4PTWA 1X1NA 4A3HA 4XZWA 2WZIA 3VUPA 5AYBA 2WSPA 1VRXA 2PF0A 4PMDA 4E8DA 1MW0A 3W27A 3PZIA 5I23A 1TR1A 5KZ6A 2QV4A 3I3BA 4CN1A 2QMJA 4F79A 1E9LA 3U5UA 1KGUA 1J01A 1VFOA 4U5KA 1Q6EA 3KEHA 3ALGA 4WLCA 5A1AA 4MNLA 1H0GA 1M03A 4RE4A 3MO4A 4QP0A 1JG9A 3ZMRA 2O92A 3WDQA 3ZJ6A 2CERA 5E6ZA 3S6TA 1CEOA 3ZO9A 2V3FA 1E0WA 1JZ6A 2XYLA 4PN2A 3UCQA 2WHLA 2XWEA 1FHLA 8CGTA 2VCCA 1O6IA 4J3SA 1UR9A 4Q7NA 2WLZA 1K9DA 2ZOXA 1KWKA 1HL9A 1W3JA 2YLAA 3FHQA 3QR3A 1CZ1A 4NF7A 3EDDA 2YL5A 4PMRA 4WKHA 2VL4A 1CXEA 1JI1A 1OIMA 1UKQA 1UKPA 1V03A 1KWGA 2VVSA 3WUBA 1E4MM 1I1XA 4BA0A 1VF8A 3VM5A 1W9VA 1VENA 1CDGA 3MV01 2JF6A 3CZEA 4DWSD 3WF1A 3W4RA 1QNQA 3N9KA 4W5ZA 2NT1A 3MMDA 2J7CA 3OGRA 1V3LA 1NWRA 5LA0A 9CGTA 4W85A 3WQWA 3ARVA 3UESA 1J0KA 3GBDA 2OYLA 2ZUUA 4PUDA 3SCPA 3L2MA 3N12A 4WSJA 1DHKA 2JIEA 2WAGA 2VZSA 1LLOA 3T2OA 1JNEA 1CYGA 2BS9A 3GYCA 5ABHA 3O6AA 5I79A 7CGTA 5IFTA 1FA2A 4PMNA 2WHJA 1GPFA 1ZB5A 3PZUA 4MNJA 2G8ZA 1FOBA 2G4FA 1LJYA 1BLIA 4GI6A 4GINA 2CBUA 3WKZA 1KGXA 3UG3A 2PWFA 2GJXA 2W4XA 1CGWA 1UD6A 3RDKA 3VILA 1H2JA 1NOUA 3VIHA 4J7RA 2A3HA 2ZUNA 1UWIA 3PBGA 2PI6A 3CHCA 1DP0A 2RGLA 1E6RA 5A95A 3ZR6A 3WH5A 1R7OA 4ZENA 3VNZA 4JKLA 3CH9A 2J62A 3K1DA 4WSKA 5A94A 5BXPA 4IPNB 2OWCA 2WMHA 1JZ7A 2WMJA 2ZX7A 2W62A 4LX4A 4Y7EA 4GZEA 1JZ8A 1Q6DA 4HA4A 1NM9A 1L8NA 3CO4A 4UNIA 5DEZA 2Z1KA 1FFRA 2Y8VA 3GTNA 1J0YA 1KFWA 3WDIA 3DECA 3I3DA 4F8XA 2D0GA 2E8YA 2QF8A 4AY1A 1AQMA 1NOFA 1BG4A 4OBSA 1GZJA 4UQCA 1GHRA 2EPNA 1UD5A 2Z1SA 3U5YA 1X6LA 3THCA 4JFSA 1IT0A 3VTRA 1JNDA 1KCLA 1UZ4A 3WD2A 4AIEA 5I5RA 2BY2A 1FH7A 5DMYA 2EPLX 1JYXA 3AHVA 5CPTA 4B16A 4GO8A 5GNXA 2X0YA 4UZSA 2WM0A 2OYKA 4P7RA 1V6XA 1NQ6A 2J7FA 1TVPA 1CGXA 3WFLA 4PTVA 1HP5A 5E9AA 1PPIA 3CZGA 1E5JA 1CXFA 3WUFA 1V0LA 1SFSA 1H41A 2D1ZA 2BVTA 1OGSA 4J28A 3ZQ9A 3CTTA 2EPKX 2PWGA 5E6YA 5BXSA 4PRWA 1BGAA 5IXEA 3GBEA 4MDOA 3VVGA 2VRKA 3DYMA 1JZ3A 3WBEA 1UOKA 4J27A 3WN6A 4GO9A 4JHOA 4X9YA 4DM1A 1XC6A 3AI0A 2XVNA 2ZXDA 4AD5A 5BXTA 1V6VA 3AS3A 3M6DA 2E4TA 1WPCA 5IDIA 1KBKA 1A47A 1KXTA 1WAWA 4C7FA 5M5DA 2XM1A 3AXHA 3WBAA 1EOKA 3UEQA 4ZXLA 2VOTA 1ISXA 1GQKA 2C8NA 2WCAA 1MW3A 1MQQA 1GQIA 5M3WA 3ECQA 4E4PA 3FHAA 2CYGA 4CVWA 3HN3A 3OZPA 3ZIZA 1WNOA 2DDXA 3QHNA 3A4XA 3U7BA 1XCWA 4N42A 1C93A 5I2UA 5A3HA 3AIUA 3GNOA 1JF5A 3FXYA 3WQ6A 4PMUA 4M8UA 2J7HA 2CPUA 3CUHA 4BQ3A 2X09A 1ZS2A 5DT5A 1VAHA 3OLIA 3GM8A 1CGVA 3MV11 1GOOA 3G6LA 5DF0A 3VD5A 2G41A 1QNSA 3VIKA 3B9AA 2BY1A 3VIPA 4XB3A 1PIFA 4C7DA 1PX4A 4DWSA 1MVYA 4LPCA 4D72A 2WK2A 2FGZA 2AMGA 1JAKA 2VZTA 3ARRA 2V38A 4ML4A 5ABFA 1LWHA 1ECEA 3F5KA 4UFIA 2YL9A 1MXGA 4HA1A 1VEOA 4AZIA 2JEPA 2CBIA 4EAMA 3BH4A 1VFMA 1Y7VA 2BHZA 3AMDA 4HMDA 2DGAA 4YHEA 1B3XA 2EPOA 1JDAA 3SCVA 1HJQA 2CBJA 4TX8A 2DH3A 1TVNA 3WD3A 3VX0A 4JFVA 5JIPA 1HJVA 4CD4A 1MYRA 5JIWA 1XGZA 3AHTA 1E71M 5C8BB 2AAAA 4AZ7A 1MW2A 3SCSA 1JYVA 1NWUA 1H11A 1DWAM 3D5HA 1BGGA 3UERA 2BV9A 4DUVA 3OGVA 1EO7A 2V3EA 1ZBWA 2WHMA 2TAAA 3OLDA 3OB8A 1XSJA 5D9MA 2XWDA 1HX0A 3HJEA 1UKOA 4JIEA 4CVUA 4DUWA 2ZXAA 1V6WA 1HP4A 5IFPA 2A3AA 4B3KA 3VD4A 5A6JA 1KGWA 1EGZA 4UCFA 1JDDA 4XX6A 1H49A 1I1WA 4HOXA 1BPLB 2UY2A 2B31A 1AQHA 1KXQA 4JZ5A 1BF2A 2DSVA 2CHOA 1W9PA 2VR5A 5LA2A 1IZJA 2JEQA 5HBFA 2XVKA 4Z2IA 4JCLA 2WMIB 2ZUWA 3TTYA 3AHXA 1XD0A 2YL6A 1QI4A 4U33A 1FHDA 4MB1A 5FD0A 4WK9A 4AD2A 3PZNA 3AICA 1J0HA 2YDQA 1OD0A 1CLVA 5ABFB 1CXLA 1XH0A 3VM7A 2DSKA 4ATDA 2J4GA 4AD0A 1UD4A 1TE1A 4D6HA 1QHZA 1HVXA 3WF3A 4D1IA 1QOXA 1HJUA 2VCBA 4PMXA 1EIBA 3WIJA 2HISA 1GVIA 3ZJ8A 2QLYA 1VFFA 5EB8A 5CSYA 1DWIM 5CPQA 1KXVA 3WH8A 4CU6A 3FY1A 4PMQA 1VIWA 5A6LA 4P7NA 1HIZA 4N0RA 2XG9A 1HXJA 4KH2A 3IJ7A 3ZR5A 1SYTA 1R86A 1EDTA 3A3HA 1JF6A 3GH5A 3QHOA 5I0DA 3AIWA 2XJ7A 2ZX9A 3GXMA 1M01A 1JXJA 2GDUA 4AMCA 4OOZA 3VDBA 3AISA 3LMYA 1OT2A 5BWFA 1F4AA 1CECA 4MJ4A 3VU2A 3SURA 3AZSA 1PZ3A 1U30A 4U3AA 5IHSA 2D23A 5JBEA 2J7GA 1HT6A 4HTYA 2WB5A 4MAZA 2O9TA 2V5DA 1J10A 3WH9A 1X6NA 1CIUA 2D20A 4GI8A 1BTCA 2O9PA 1GVYA 3DHPA 2VX5A 2WVTA 3RM9A 4NI3A 3LPGA 2VQUA 7A3HA 1E4LA 2WWCA 3BAJA 1GHSA 4AC1X 2A3BA 1KBBA 3SUVA 2BY0A 1U33A 5A8NA 3BAKA 2HVMA 2BNJA 3U57A 2WMGA 5DT7A 1VJSA 2VX4A 4KGJA 3L4WA 3LPFA 1D7FA 5AY7A 4CKQA 5BRPA 1NP0A 1QW9A 1B90A 3KWXA 2ZE0A 5LA1A 3WNOA 1V02E 1CBGA 2ESCA 3KL3A 2WLYA 4GZIA 4H41A 1E43A 4F9DA 2D24A 3CUIA 1SMDA 3MUY1 1R7AA 1BFNA 1E6ZA 4WKFA 1OD8A 2OYMA 4CCEA 2YKKA 2D22A 1KR0A 2E40A 1OSEA 3EYPA 4PUEA 1UR2A 3CBWA 2FH6A 2BHUA 3NIYA 3OLEA 4ACYA 1XHGA 4AD1A 2YDSA 2G3IA 4U2ZA 1JGIA 4FLRA 1B3YA 1W32A 3N18A 1XYFA 4M56A 4R27A 1V0KA 1JD7A 4UOJA 1KR1A 3M7SA 3VIGA 2XIIA 4F9JA 3VOCA 4RE2A 4UOQA 3WFZA 1H4PA 1OM0A 3AJ7A 2WSKA 3F4VA 1GOWA 2W5FA 2BVYA 2XFYA 1AQ0A 1MFVA 5E0FA 1JDCA 1UG6A 3ARSA 4GQRA 4HU0A 4UFLA 1UYQA 1TA3B 2CIPA 3AMKA 2WMFA 5D4YA 3GH7A 5A8OA 3BAWA 3SUTA 3BC9A 4W5UA 3TTQA 3AZTA 1UUQA 3VIFA 5FCZA 1OWQA 1BAGA 3K8MA 1IZKA 4MNMA 1W3HA 2J7EA 4LGXA 2Y8KA 4HP5A 4WIWA 3BCFA 2JIWA 4GXPA 3FW6A 3TTOA 3VIIA 1HJXA 2G3MA 5HXMA 1JZ2A 2DSZA 2CCRA 2VZOA 4JKKA 2CKRA 1KQZA 3EDEA 3AMGA 4JAWA 4QCFA 2GDVA 4PSPA 3AXIA 3K4AA 3UG5A 4W86A 4S3JA 2DPEA 3CZ8A 2D0FA 3CMJA 1MW1A 4AZHA 3AS0A 1ISWA 1FH9A 3T0BA 1QBAA 2CKSA 5A6BD 3VGGA 4GKLA 2DQXA 4AZ5A 4ZE5A 3SUSA 1MWOA 4KWUA 3SEPA 4KRUA 2WZHA 4CD7A 1QW8A 2Y24A 2PWDA 4FLOA 1XV8A 3LPPA 3ZJKA 3WL0A 4QAWA 4HOWA 4HMCA 1VEMA 4W87A 1M04A 4ACZA 1GCYA 4AZBA 4PEEA 3PZGA 1UWRA 2WWDA 3W81A 3CZLA 4XV0A 3EMQA 1RD6A 2CXGA 3NCOA 2XSBA 2W66A 3WNLA 3NYDA 2IUZA 3VMPA 1XH1A 6TAAA 1HKKA 3WDRA 1QHOA 4JL1A 3TTSA 1BQCA 4U2YA 3PZOA 1VFUA 2UY5A 4PCTA 1W9DM 5M17A 5CZKA 1S46A 5CJ5A 3NSMA 3SUWA 1TG7A 4FMVA 1B2YA 1XD1A 4EK7A 2V3GA 5A6KA 3J7HA 2NSXA 3IANA 3VD9A 2J8FA 1QHPA 1ZBCA 5D9OA 5IHRA 4LYQA 3RPMA 3NSNA 4ZE4A 1C8QA 3WENA 2WBGA 4LYRA 3WELA 3EDKA 5CQ1A 2WC7A 2A3CA 4JHZA 3AS2A 3AROA 2YL8A 3MSGA 3THDA 5I24A 4WF7A 1W1PA 1H5VA 4R5EA 3T08A 4P8UA 1BSIA 3GXDA 3KL5A 3SCUA 4GQQA 4AYSA 2JALA 2A3EA 2F61A 5CXPA 4H7VA 1RH9A 3L4VA 3VGBA 5A2BA 2J8GA 3VO0A 1P6WA 3N13A 2XVPA 4BS0A 4P7QA 4DUXA 1IV8A 1UH3A 4AWEA 1FP9A 1M7XA 3I3EA 4YHGA 1MFUA 2XVLA 2GJXB 5TD4A 5A2CA 3RILA 4EANA 3F5LA 5M03A 4PSRA 2XGIA 3EDJA 4B15A 2O9RA 3VD7A 1W9BM 3CZJA 6A3HA 3NDYA 2VR4A 3AQUA 2FH8A 1XYZA 3GDBA 3VIJA 3MSDA 3VDHA 4CU8A 2WANA 3MUAA 3BMVA 1NP2A 1XH2A 3MMUA 2YBTA 1CGUA 3RMEA 3W6MA 2XVGA 4JKMA 1NH6A 2DEPA 1E3ZA 2PBGA 2WVUA 4BQ4A 4BQ2A 2BXYA 3AYRA 1PJ9A 2EXOA 3MKKA 2ZX8A 3WNPA 4UQBA 2GVYA 3MUZ1 3CHDA 4DM2A 3AYSA 1DWHM 1B31A 2C0HA 3MMWA 5FOOA 4V27A 1M53A 5A8PA 4QFUA 4OIFA 4AIOA 3VINA 1CGTA 4E8CA 4TTGA 3N11A 5HNNA 5A8QA 7TAAA 2VNCA 4JFTA 2NW0A 1UQZA 2BVDA 3W37A 3VMOA 4NZCA 2DIJA 3CUFA 4U3CA 1HKMA 2YDRA 4H8VA 1V3MA 1WZLA 2ZICA 4J3XA 4A4AA 4GPNA 1C91A 1NARA 2J78A 4JFUA 2BXZA 2YIHA 1OBAA 2YOCA 1B0IA 1J18A 2ZXQA 4RL3A 5E09A 1E0VA 1V0MA 3PZTA 3ZOAA 3ZT7A 5D8ZA 4JFWA 4W89A 5GPRA 3TOPA 2V5CA 1ZBKA 1J11A 1CWYA 3VD3A 4CUCA 1PZ2A 1HN1A 1SR0A 5E0CA 5ABGA 1B1YA 3BLKA 1AMYA 5FL1A 2X05A 1K6AA 1C8YA 1E6XM 4IM4A 1MXDA 1HVQA 4P7OA 4M24A 1UWSA 3GXFA 4W8LA 5BXRA 4GIAA 5BROA 5JBFA 2GJPA 1ZU8A 2ZUSA 3A6OA 1WDSA 3WNNA 1NWSA 2ZUVA 4HA3A 4TVCA 4AZGA 2VJXA 1UA3A 4BCEA 3U7VA 3VIOA 4D6GA 1E4IA 2XFRA 3UETA 2CESA 2WMKA 3K4DA 1UH4A 3AIBA 1UWTA 1G01A 4B9ZA 1V3HA 2RGMA 4K68A 1QBBA 3B8SA 3L4TA 4KMQA 1ZJBA 5A6BA 2FHBA 2BHYA 2WW5A 3ALFA 2OWWA 1BYBA 1W9UA 1D2KA 3FN9A 3RJXA 3UG4A 2XPKA 1GJWA 1K9FA 4AZCA 4ZEPA 1JI2A 3T2QA 1E1FA 5FL0A 3RCNA 1UR1A 1WO2A 2WCSA 4EE9A 1W1YA 3L4YA 2GSJA 2J74A 3BAIA 3M07A 1WZAA 5FKYA 3AZRA 1GOMA 2F8QA 3VKKA 1BYAA 1I75A 4FK9A 5I77A 1XSIA 1WDRA 5C70A 1WP6A 1JZ4A 3ARTA 2GK1A 1ZBVA 4PTXA 2CETA 1VBUA 1BHGA 3AIEA 3WL1A 4CU7A 3AHZA 3AHYA 5AC4A 2GUYA 5DO8A 4DWSB 4WKAA 1UA7A 1E3XA 1V0NA 3OA5A 2WXDM 2J47A 3WD0A 1PIGA 4S3KA 1EDGA 1E15A 2BY3A 1OIFA 1C92A 2ZX6A 1PX3A 3QOKA 4TXEA 1UHVA 4C7GA 2Y2WA 3VGHA 4UZUA 3L4UA 1CGYA 2VO5A 4PYSA 3AFBA 3D3AA 4W84A 3CLWA 3W24A 1J0JA 2VMFA 3CHFA 1QI0A 3L2LA 1QI3A 3AIRA 2WVVA 3PZMA 1PX8A 2XHYA 1Q6GA 2D3LA 3OGSA 1DEDA 4OKDA 3ARWA 1G5AA 2OSWA 4CN6A 1V6UA 1WB0A 2V3DA 4WJXA 5DFAA 2UY4A 1LWJA 1BVNP 1JZ5A 3JUGA 5I6SA 3WDJA 1U2YA 3ZT5A 1UR0A 1V3JA 5HPOA 5HPCA 4MB4A 3K8LA 3GZAA 4X0NA 4X0VA 1B3WA 3EMZA 3CHEA 5HDRA 1FFQA 1OGGA 4UQEA 2FHCA 3KZSA 3PTKA 1EQPA 3WD4A 2WZEA 3ARUA 3ZSTA 4W8AA 1QVBA 4HMEA 5A2AA 4YPJA 2VQTA 3GXIA 3ZT6A 3VNYA 1ODUA 1A3HA 3ARYA 1JXKA 2VI0A 3TA9A 3M46A 3II1A 3W53A 3ZM8A 2X0HA 2OLHA 1CXKA 2EQDA 4AD3A 1XRVA 2CHNA 4UQDA 1V3KA 4AW7A 3WUGA 1UZ1A 1RP8A 3BAYA 2XGBA 2GK1B 1KB3A 4ZFMA 3AS1A 1H09A 3SCQA 1CXHA 1HKJA 1FH8A 1US3A 3PN8A 4AISA 1WDPA 1Z32X 3WSUA 4MTVA 3W0KA 4CN4A 2ZUMA 1W91A 2UY3A 1N82A 1B3ZA 3PZQA 3SCOA 1CNVA 1J0ZA 1GONA 1TCMA 2D3NA 3DYPA 1OT1A 3W25A 3DHUA 1G94A 3G6MA 1W1TA 2X2YA 5EFFA 1JFXA 2VRQA 2WVVB 1V08A 1ISVA 3UR8A 4AIUA 3WD1A 3IJ9A 4AEFA 1EDQA 5JBDA 3W38A 5GQBA 1EO5A 4AXNA 6CGTA 1ISZA 2C7FA 4M80A 4IISA 1DWJM 4P8WA 1GJUA 4MADA 3GNPA 3BMWA 5CLTA 4E2OA 2PB1A 2JF7A 3OLGA 1KQYA 4J3WA 4PMVA 2WCGA 3A4AA 2EO7A 3MUIA 1W2PA 5E70A 2MANA 1J0IA 2DT3A 3N17A 2J7BA 2YJQA 4URIA 1K9TA 1B3VA 5CG0A 3IAPA 1GORA 4D6JA 3CUGA 2J79A 2Q8XA 2CNCA 3K46A 4W7VA 4BZYA 2DH2A 1V3IA 2D0HA 1R87A 4OJYA 4UTFA 3WF4A 4D6IA 1LG2A 2J75A 3WDHA 4ATLA 1ODZA 2E9LA 1GW1A 1C8XA 4L4PA 4NRSA 1HL8A 5FIPA 1PBGA 4AZ6A 1E73M 1CXIA 2WC4A 3EBVA 4U31A 1LL4A 5CSUA 1QNRA 3W82A 4QLKA 1MQRA 1VB9A 5EMYA 4TUFA 4P7LA 3FAXA 4H8UA 3N04A 3CGTA 4HOZA 3WQ5A 3CPUA 1NWTA 3NUKA 3WQVA 1C7TA 2F2HA 2G3NA 1B9ZA 2VUYA 4UR9A 3L4XA 1UKSA 1BVZA 4HZ6A 3AXXA 4Z2KA 1W9XA 4FLSA 5D9NA 1TZ7A 3ARQA 3RJYA 1GOQA 2WNWA 4W8BA 4BQ5A 3VDCA 2Y4SA 2DSUA 5D9PA 4PMZA 4M1RA 2W61A 3VMNA 1WE5A 2EEXA 1SMAA 2PBOA 1RP9A 1XCXA 2WHKA 2J7DA 2IXUA 2FHFA 2VX6A 2YA2A 3AIQA 5A6SA 2XIBA 3WH6A 3BSGA 3B9DA 1E1EA 4D6CA 2FGLA 4FF5A 2PWHA 2YA1A 1AVAA 4LYPA 3BCDA 5HOSA 5C71A 3IJ8A 3WF0A 3T0DA 1V6YA 3HU7A 2ZIDA 3MANA 2CEQA 4UQAA 4W7WA 4CD8A 1US2A 1RPKA 1E56A 1W2VA 3POCA 2VT0A 1JIBA 3N1AA 3WF2A 1MQPA 2ZXBA 1Q6FA 3POHA 4Q22A 4HPHA 2XFFA 5EFDA 2J25A 4M29A 3RM8A 3W26A 1FP8A 4HZ8A 4CGTA 5ECUA 1YHTA 3O9NA 3WEOA 3SIMA 4H04A 1G0CA 3NDZA
chains in the Genus database with same CATH superfamily
4HBKA 5I07A 1ZFJA 1KCKA 3HPSA 4G1KA 2P88A 2OO6A 1I2NA 4JICA 2W9MA 2HTMA 3PTMA 3KRZA 4QG8A 2E9BA 1TUXA 3S5ZA 4JN6A 5I78A 2OTDA 1GVOA 2W63A 4W88A 3TP4A 1CPUA 5AZ0A 5FJUA 1QNOA 4JTSA 4M81A 1POJA 2IW0A 1JYWA 3PY2A 3VFLA 2X1IA 3P0XA 2E0PA 3VPLA 1Y0EA 2YA0A 3E0LA 5DBUA 1D3CA 6REQA 3E12A 2AQWA 3FYPA 4PCSA 2ZUTA 1IWPA 2REQA 1WKFA 3HFYA 1BYCA 1EHNA 4CQ9A 4CD5A 3VKJA 4J3TA 4H9ZA 5AYIA 2CITA 1GQJA 3MJMA 3N2MA 4PC8A 3HOJA 4GC3A 3WMSA 2QPUA 2ZBTA 1TRIA 4CCCA 1JAEA 1YX1A 4R33A 3TJ4A 6ENLA 3H55A 1AD1A 5I00A 1EBGA 5JUVA 4LS0A 1EJSC 2H6RA 1PIIA 3UJSA 3O3RA 1TMQA 3CZKA 1H1YA 2PDJA 1IGWA 4UQ9A 1PE1A 3IGSA 3LNMA 1GOXA 4WY0B 3W6YA 3I10A 1UD3A 5F1UA 3EWUA 2BFGA 1CLXA 4DWSC 1VPXA 1E6PA 4XUYA 4QR6A 3MI2A 2WMIA 4LCQA 4WDUA 4H6KA 1UWQA 4YVXA 1SZFA 5C54A 4C6NA 2VWSA 1GQLA 3DYOA 2YLLA 4LVBA 4UOZA 5AHMA 5FA5A 4JTLA 3QYQA 4LAZA 1EJ7L 5GVJA 3NQDA 2FDMA 3ID7A 2UWFA 3WLRA 3VABA 5K7JA 3ABRA 4B2DD 3WH7A 1FTXA 4QITA 2XUCA 3HPFA 1DHPA 2VZVA 1Q4NX 2NQJA 4ZFCA 1UQYA 4DPQA 1GGOA 3R58A 2G50A 1FVPA 3VC5A 1VYPX 2C1HA 5AYXA 4NSBA 2ZADA 3KOXA 4J3UA 1CCWB 5KTLA 3G0XA 2RAGA 4LANA 5BZAA 1JCLA 5BYWA 3REQB 2WKGA 1FWNA 5A69A 3RIKA 1ENUA 1FWEC 1W3LA 2OT0A 4Z2LA 4O19A 2WBKA 3SCRA 4LQ1A 4AF0B 4IPLA 1H3GA 3E2SA 2WKLA 1K4GA 1QPKA 2Z26A 4AX7A 2I17A 4AEEA 3NQ7A 1XLDA 4LUIA 4D6EA 1FDJA 4WRHA 3BAXA 3OIXA 3P62A 3HG2A 2HNEA 2PA6A 5HNUA 1SSGA 4IGMA 2YW4A 3G1HA 1HF6A 3IVUA 1V02A 3VDAA 2R6OA 4KGLA 1JPDX 3DN5A 4GY0A 3T0AA 4D8AA 2A85A 2ZQ0A 4W93A 3ITTA 2DZPA 3JS3A 1PWMA 4HN4A 4PMYA 3T2PA 3UFYA 2RDUA 1GOIA 4AD4A 2E8ZA 2VX7A 3VOJA 4GZJA 5G4WA 3TYBA 5D03A 4NT0A 1XYLA 4BK9A 3CUJA 5KZDA 2BTMA 1R3SA 4IFKB 3O2LA 4QEHA 1PEZA 4LH8A 5G4EA 5HATA 5ABEA 1ZJAA 4KCWA 3VGEA 1YNYA 1RJQA 5BW6A 1CENA 1E70M 1T96A 2Y5EA 5J04A 1TPVA 3AUOA 1Q65A 4D1JA 2VHLA 3LHYA 4EKJA 2OZ0A 1LQ0A 4JEQA 1E55A 3W71A 3ARXA 2IXVA 2HBVA 4GYPA 4O1BA 3NQFA 3GG8A 5EBAA 3VCCA 4AZCB 2Y62A 4RZ5A 1SM9A 1L0PA 4MUPA 3E6EA 4H1ZA 1JUBA 4L61A 1NTHA 1IXNA 4KWVA 2G97A 2QDEA 1ALDA 2HXTA 1JFHA 1LT7A 3FEQA 1HJWA 5A8MA 3EMCA 1TV4A 1VBJA 1DOSA 1GEQA 3VUSA 1TA3A 4D6DA 1JQXA 1J9YA 3SUUA 5AC5A 1QOQA 1Q2SA 2ZWYA 1GTHA 2W91A 4HPGA 1DJQA 1P0NA 2NV9A 1YYAA 3PPFA 3MZ2A 4PULA 2ICSA 3A5FA 4EF9A 1XLMA 4PMDA 4MYXA 4UXDA 1NDZA 1JCNA 1RLDA 3W00A 3W7IA 1TR1A 4G56A 3L5MA 3SRKA 3N2OA 1H7RA 3KEHA 1YPIA 5A1AA 3M0LA 3MO4A 4NHVA 3TW9A 1O5QA 4QP0A 4I5RA 3EOUA 3UA4A 3GDKA 2CERA 5E6ZA 3HZ3A 3W1TA 2WJEA 3EX3A 1CEOA 4JTCA 1NVMA 3URQA 3BLDA 3V5CA 2CXEA 2XWEA 3NL3A 1W5OA 1TCDA 1A5SA 4J3SA 4C6QA 2WLZA 1C8VA 3MWCA 1UUOA 4XSMA 3UJ2A 1AMKA 1OIMA 4E5TA 3P8JA 3WUBA 3R0DA 2EG8A 1QPNA 4BA0A 4MWAE 3AYVA 1VYSX 2HQAA 1KTBA 4WHBA 4LF2A 4KEVA 3O7UA 4DWSD 3IGHX 3N9KA 3JR2A 4WXYA 2GGHA 4MGGA 1GKPA 2QJHA 3G1FA 4LALA 2GVGA 3UJEA 3E96A 4HMNA 1OFAA 1GYMA 3URNA 4W85A 4DF0A 3WQWA 4LUJA 3GBDA 5LNSA 4I6VA 4PUDA 3OU8A 2DZVA 1M65A 3GTHA 1UPPA 2VZSA 5I3FA 2WQDA 7CGTA 1LZOA 1SGJA 1GPFA 1XGEA 2ISFA 2NX1A 2WSYA 4EXAA 4MNJA 2E6AA 3LY0A 1FOBA 1XPYA 2GLKA 3WKZA 4JX5A 1BWVA 1VHNA 3TC7A 2ONEA 5CBBA 1UIOA 1O12A 2NV1A 3R8RA 3VIHA 3S5NA 2A3HA 3NAVA 5HR6A 1UIPA 1RQHA 3NGJA 1J4EA 4ZENA 7PTDA 4JKLA 1KBJA 3GR4A 4LTSA 4QBXA 4NX0A 3K1DA 4WSKA 4JY8A 4IPNB 4R7OA 5K9DA 3H12A 2W62A 4Y7EA 4O17A 3OHMB 2G96A 4PA8A 2PDLA 4IMFA 1MRQA 1FFRA 2RFGA 1J0YA 1KFWA 2R8WA 3I3DA 1F73A 1UB3A 1BG4A 1VR6A 4OBSA 3W07A 4ZBCA 1TR9A 4L9YA 2Z1SA 1TUFA 1X6LA 4JFSA 4JQ2A 3VTRA 1G7VA 2Z1XA 3UZZA 4AIEA 2A6LA 1Q7MA 2GL5A 3XINA 3RF9A 4B16A 1O1HA 2E28A 5GNXA 4BI5A 4UZSA 2OYKA 1NQ6A 4XTIA 4PTVA 5J5DA 3ZZ1A 4F0SA 4QJ5B 1PPIA 5EMMA 3M16A 4UR7A 2PDBA 1CXFA 4IPPA 4GBDA 3LMZA 1V0LA 1KFLA 3W2KA 2D1ZA 3H54A 4G7EA 4W9TA 3BZJA 3W2JA 5IXEA 2VRKA 3KCJA 4J27A 4GO9A 3LZ5A 1F6KA 4X9YA 4ONVA 2XVNA 2Z25A 3FXGA 2Y7FA 4UNLA 1WPCA 1A47A 1DJYA 4IMAA 2RKXA 2VFGA 4C7FA 2PP1A 2QUTA 2XM1A 4YLWA 3UWVA 4ZXLA 1EJXC 3FS2A 3ZLGA 2AL2B 1UUMA 1GQIA 4F40A 4DBDA 4JYEA 1QPRA 3ECQA 3EEZA 2CYGA 3T0CA 3OTRA 3HN3A 3OZPA 5K2ZA 2QGYA 3ZIZA 3PNUA 2EKCA 1PZ0A 1EB3A 1Y8BA 1Z3NA 1DJGA 2JKPA 4NAEB 4PCFA 3ATYA 5DY2A 1LUCA 3FXYA 3WQ6A 3TMQA 4IT1A 4YCOA 3ANUA 2CPUA 1EL3A 3GFYA 3MDWA 2W6RA 5D2TA 2X09A 3LV6A 5G2IA 2WNZA 1CGVA 3MV11 9RUBA 4L5ZA 3EOEA 5EPDA 1A5CA 3VIKA 4GVHA 3O15A 3W01A 4C7DA 1MVYA 4LPCA 5TIMA 4D72A 2FGZA 2V38A 5LIYX 1S5WA 5ABFA 4S23A 2YZRA 3QGAC 1ECEA 4UFIA 1F3EA 1MXGA 3ZLFA 4Q4PA 1VEOA 4TO8A 4AZIA 4PUUA 4YHEA 5IM51 2YXXA 1JDAA 4Q32A 1KLZA 2P0OA 4D9PA 2YCIX 5JIPA 4CD4A 2XZ7A 4L56A 1NEYA 1DIOA 3ZFHA 3UXIA 3N6QA 5C8BB 2DVXA 2AAAA 3FKRA 4MFDA 3T0TA 3F2BA 4L64A 1H11A 1DXIA 1NIUA 3WLMA 5EY5A 3UJRA 3LXCA 1EO7A 3PJUA 3OB8A 3E49A 3UXKA 1I6NA 3GFZA 3HJEA 3S2NA 1UKOA 4JIEA 5D37A 4CVUA 1OFDA 2ZXAA 1FWSA 4LNCA 1HP4A 1XRSA 2ZCGA 4P2VA 1KGWA 3KLLA 3FGCA 1U22A 1I1WA 1KXQA 4JZ5A 3LTPA 2PTZA 3W1MA 3IUIA 1W9PA 4ROPA 4F0RA 2YGYA 4JOMA 2G0WA 1S1PA 4JCLA 1XLKA 3TTYA 3GW3A 1FRBA 2DZWA 2OX4A 2QCFA 3B8WA 2V2DA 4Q8OA 1J0HA 1OD0A 4RX0A 3TYUA 1XH0A 4GKTA 3VM7A 2J4GA 4AD0A 4L9ZA 4CQAA 4ES4A 1HVXA 3RITA 3FVDA 4PMXA 1EIBA 2OZ8A 2R1PA 2C71A 4GNVA 1DWIM 5CPQA 1VIWA 1JVNA 1HIZA 4KPLA 1HXJA 4KH2A 3ZR5A 1SYTA 3THAA 1OC5A 1XI3A 1JF6A 1XIDA 1WYIA 3AIWA 2ZX9A 2IKGA 2P10A 4AMCA 1O5KA 4OOZA 5LZLA 1DORA 1Q6RA 2VFIA 1V4YA 4JTQA 3CQKA 1YDNA 3LMYA 4GIEA 3WLOA 4AWTA 5BWFA 4GE8A 2C6QA 4PH6A 3VU2A 4WR3A 2ZZ4A 3M4HA 2P50A 5HULA 3CWHA 1HKVA 3LD5A 2D23A 1FWIC 4HTYA 4MAZA 6ALDA 4TMBA 4IP7A 2Z24A 3FDKA 3OW1A 5DX7A 1J10A 3WH9A 4ZOBA 3IV3A 1SO3A 3UXDA 1WKDA 5CPMA 3LLFA 7A3HA 3WBYA 1KA9F 1YE4A 3VYLA 7ODCA 1TMLA 2FZMA 4OBTA 1KBBA 5KITA 1CLKA 1U33A 5A8NA 1U5VA 2QDHA 5FSDC 2HMCA 1UPMB 4UIOA 3L4WA 1D7FA 1MO0A 4AY7A 3KW3A 3IJLA 2YB1A 5CZ0A 3WNOA 2ESCA 3KL3A 4GZIA 4RDYA 4H41A 1A0CA 5EKYA 1E43A 4G2DA 2D24A 3LERA 3STGA 4Q8UA 1BFNA 4P5UA 5E93A 3TMLA 4WKFA 1GVQA 4IIFA 2E40A 1OSEA 3EYPA 1W8GA 2FH6A 3OLEA 1XHGA 2ABAA 3PP7A 4U2ZA 3NXFA 4Y2WA 3URAA 3T9PA 4O0QA 2ZA1A 4XG1A 4REQA 3TWAA 1KCXA 4KCVA 3KRUA 1XYFA 4PUMA 4R27A 4YNGA 2YCEA 4UOJA 4AYGA 2WSRA 4F9JA 2PE4A 4TR9A 3VOCA 1Y5WA 4Q8TA 1KFBA 4F2UA 3AJ7A 3TEVA 2A7RA 5H8MA 2XFYA 1AQ0A 3LGDA 1WQ5A 1JDCA 2WMFA 3SJNA 5D4YA 4YYFA 4ICCX 3LQLA 4KCTA 1UUQA 5FCZA 3W7JA 1XQKA 1UMYA 1TV5A 3W75A 2DV0A 1GEHA 2J7EA 3PK7A 1NF7A 2Y8KA 3QPEA 4WIWA 3BCFA 2NUWA 4XUGA 1JZ2A 1FHUA 1XF0A 3CV2A 3DERA 1KQZA 3BWWA 4DBEA 1F05A 1D3HA 3KBNA 5D02A 4QCFA 1DVJA 3SFWA 4ZL1A 3AXIA 1PWLA 3K4AA 3BL3A 4XSLA 2DPEA 2ZC1A 3CMJA 3W7CA 3AS0A 3BLIA 4GKLA 2Y7EA 4MY1A 4R53A 3NVTA 4AZ5A 1J6OA 4HNLA 3KP0A 1LORA 2WZHA 2V2CA 3K5XA 1XV8A 4GY7A 4QXIA 2OR2A 3LPPA 2NQ5A 5F2MA 3WL0A 4K7YA 4UTMA 4HOWA 1XW8A 8XIMA 1FWTA 1UWRA 2VFHA 2WWDA 3CAVA 3DKJA 3MWAA 4GI4A 1RD6A 2OEJA 1P1XA 3KTSA 2AL1A 1KRBC 2DZUA 2IUZA 3VK5A 4HIBA 2BBFA 1BWKA 1TIMA 3IARA 6TAAA 3WDRA 3CLMA 1EC8A 4PMJA 1BKSA 1H7XA 1VFUA 1KM0A 4K39A 3SUWA 2NUXA 4JTUA 1A5NC 3LQGA 4EP8C 2O0TA 3TDFA 3VI2A 2A0NA 5IHRA 1PDZA 3NSNA 4AB4A 4ZE4A 4ADUA 4ADTA 3SR7A 5CQ1A 2WC7A 3MSGA 1TPH1 3ZVHB 1KRMA 3T08A 4JQ1A 4P8UA 1BSIA 3GXDA 3KL5A 2W0UA 3KDOA 1EWDA 2A1YA 4O13A 2J8GA 3VO0A 1E9IA 1TJ1A 1KNWA 4A2RA 3M6YA 3S0CA 4DUXA 1IV8A 4WOZA 4MZ8A 1M7XA 1PL9A 5C0QA 3I3EA 5CZSA 4YHGA 5BU6A 1W1B1 4B4FA 4NZ4A 1MFUA 4WXZA 1PKMA 4ZTXA 2YCKX 2O9RA 3T7VA 1ONEA 3M0XA 4XBSA 3L9CA 3SECA 3MP3A 2V69A 2VR4A 4RE0A 2V2HA 1IIGA 1XYZA 3PBYA 4C1NA 3HTWA 3VIJA 4CU8A 2ZZ6A 2RDTA 5C7HA 4DBSA 1RZMA 1CGUA 4B92A 3LNPA 3R2GA 2XVGA 3TW6A 2OQYA 3I65A 2PBGA 1EX5A 4JHMA 5C5YA 5EMUA 4HSHA 3GX9A 3SGUA 3O6DA 2C0HA 1FWJC 3GHUA 4OIFA 3R13A 3ONBA 5FF4A 4E8CA 3N11A 1TZ9A 4JFTA 2NW0A 3TH6A 2BVDA 3VMOA 3M0MA 1WX0A 3NTYA 4NKCA 3TC6A 1RALA 1KBIA 3BE7A 5FEZA 4UMBA 4A4AA 4GPNA 2RDWA 4JFUA 2YIHA 1YXDA 3BURA 4DAFA 4HK6A 1OBAA 2YOCA 1B0IA 3BLOA 1QT1A 1XYCA 4NASA 3E0FA 1R2SA 3QSRA 1E0VA 2WM1A 3W72A 4GX9A 3PZTA 3ITXA 3ZT7A 1V51A 1GWJA 2D2JA 1E1CA 1AZ1A 4Z1DA 1IR2A 5MKGA 3W1LA 3CL7A 3V0TA 1XBYA 5ABTA 5HINA 1EP3A 4L9XA 3H22A 4IP4A 2X05A 3BMXA 3VKCA 1E6XM 4IM4A 1K7XA 3HV8A 4M24A 1KKOA 4W8LA 1XISA 4WCJA 5JBFA 2GJPA 4WZHA 3CNYA 2ZUSA 3WLQA 3WNNA 1C29A 2GSEA 5F2LA 1R9ZA 1LBMA 3UNTA 1QXLA 4M51A 2C14A 2C1GA 2QS8A 3MJYA 4GFSA 1G01A 1EJRC 3QXBA 3HG4A 1TV2A 3P2VA 4EWND 3L4TA 1CB2A 1ZJBA 5HUOA 4XISA 4MY9A 2BHYA 3VNDA 3ALFA 2HZGA 1OCNA 3R11A 1W9UA 4FEZA 3GC2A 1D2KA 3RJXA 4GBUA 3UG4A 1K9FA 3G1SA 2WJFA 3PWGA 5FL0A 5XIAA 4TV6A 1UR1A 2C16A 4O8AA 3R6IA 3ZLHA 3S47A 2GSJA 1WZAA 3CASA 3WLTA 1GOMA 1BYAA 1I75A 2CW6A 3P61A 1XSIA 1WDRA 3K4WA 1WP6A 4H9YA 3THQA 1JZ4A 5EGRA 2GK1A 4KEZA 1BHGA 4CU7A 1MEIA 1B4EA 3AHYA 4DWSB 4WKAA 1UA7A 1E3XA 2PLJA 1WXJA 1V6TA 2E25A 4IQJA 3PSVA 2V82A 3HQOA 3H4GA 4C7GA 2Y2WA 4ZB2A 3VGHA 2E09A 4AWUA 4K36A 3B8IA 2VO5A 1W8SA 4W84A 1G67A 3H2CA 3W24A 4YVPA 2FKPA 2OVLA 4JYFA 2XHYA 4DJFD 3QW3A 2BGQA 3H21A 3OGSA 1RD5A 2TYSA 4DZHA 3KRSA 1G5AA 1M41A 3W7PA 3VKBA 5DFAA 3EWBX 4MWAA 5DRCA 1ZALA 2VC5A 4X22A 2Y5JA 4GYPC 1XJBA 4QE5A 5CC5A 2F6UA 3NWRA 4N4QA 2QJJA 5I6SA 1JUKA 4GFIA 3WDJA 1U2YA 3DZ1A 4JTTA 5HWJA 3GZAA 4X0NA 4CQDA 3EMZA 3CHEA 2PZNA 3QZAA 4UQEA 3E02A 3KZSA 3PTKA 1H60A 3QY7A 1EQPA 3P6LA 1K8ZA 2WZEA 1SVDA 3MBDA 1QVBA 4GNJA 3B05A 2YDAA 1ZHAA 2VQTA 4LB4A 3RCMA 3ARYA 3M46A 3II1A 3U2CA 3QC3A 3B04A 2OLHA 3OVPA 2HDJA 2CHNA 4I5XA 4UQDA 3TK7A 3WUGA 1RP8A 2C15A 4DWDA 2A79A 4ZFMA 2Y70A 2VEKA 1ZJIA 1LM1A 5C9ZA 1TKKA 2YB4A 4WUIA 1WDPA 5DRIA 1IHIA 3OPSA 1ELSA 4CN4A 3U4FA 4B4HA 2ZUMA 1W1ZA 2PFHA 1ONRA 3SCOA 3STEA 4QG9A 1VJIA 1TV8A 1CNVA 4HJWA 1A53A 3DYPA 3W25A 4HHMA 3N9RA 1WKEA 2VRQA 4OFCA 2PPGA 1ISVA 1J5TA 3WD1A 1DXEA 4JX4A 3W38A 3KRBA 4M0XA 4I8DA 4XK2A 2AGTA 4IMDA 3H7VA 1R3YA 3N34A 2OX1A 3GNPA 2O56A 1CX9A 2ZYFA 3OLGA 3M0ZA 5HAOA 3WJSA 1F3TA 3V16A 3B8DA 4PMVA 1XBXA 1AUSL 2EO7A 3Q65A 3QTPA 2XU2A 1W2PA 5E70A 4B2DA 2IS7A 2J7BA 2YJQA 4DPPA 2HSAA 4D6JA 3NQ8A 2Q6ZA 4KFNA 1THFD 4MVAA 3CIWA 1SO5A 3W7MA 3VAVA 4UTFA 3DBNA 4HYRA 4AMAA 3NYZA 4ATLA 1RK6A 5IRPA 1GW9A 4DJDA 1NAL1 4PB5A 3UJFA 3ENLA 2QULA 1HL8A 3UYIA 3HG3A 4AZ6A 4KF1A 2WC4A 3EBVA 3V4BA 3VZXA 1ZTVA 1TPFA 4E4FA 1MQRA 2Q71A 5DCBA 3WK0A 4ZQMA 1LOLA 4IFOA 1UC5A 4HOZA 2QPXA 4I7WA 3WQVA 2Q8ZA 2YW3A 3TVAA 2G3NA 1B9ZA 1W54A 1KD0A 3EOSA 4YWIA 3W7KA 4ZZ9A 2VFEA 1UBPC 4F0LA 1PDYA 2C19A 2NQLA 2OGJA 2B0MA 1R2RA 4W8BA 4IJBA 1V5XA 4PMZA 4O0KA 3ERPA 1YKWA 1P1MA 2PBOA 1XINA 1RP9A 4NUWA 4F2TA 1AW5A 2VX6A 5A6SA 1H7PA 1VS1A 4XD4A 1E1EA 4D6CA 2FGLA 4JTHA 3F1QA 4FF5A 3QC0A 3C8NA 1YEYA 4NVTA 1WDDA 2XSXA 1KFCA 3BCDA 3ZYZA 3W1AA 2ZIDA 5FAGA 4K1GA 4JNYA 4B5NA 4CD8A 1Z69A 1TV3A 1W2VA 2VFDA 2VT0A 2PMQA 3N1AA 1M7OA 1M5WA 1MQPA 2ZXBA 1K8YA 1EUAA 1EYWA 1QASA 4ZSTA 1DYSA 1X96A 3W26A 3QV8A 3WBXA 4C6MA 5ECUA 2H8XA 4YIWA 5LGZA 4MZ1A 4XZIA 3TYDA 4WY0A 4S39A 1QNVA 5LNVA 4DO6A 5E0KA 1W5PA 3TZNA 1YLVA 1KO0A 4ZQRA 2PDNA 3N15A 1ZPTA 3SGGA 7XIMA 2OZ3A 1SJAA 3QYSA 3SADA 5G1TA 2PD9A 1KXHA 3LPOA 4IUGA 1EOMA 4FIRA 5FACA 1XIEA 3LA4A 2X1RA 3UW6A 4O4VA 5I3HA 2VURA 1DQWA 1C3FA 3W28A 3EGJA 4Z2GA 3PWAA 2VDHA 3O16A 4WVXA 3GDMA 1H0IA 2AOSA 4E2DA 1OFOA 1L6YA 4GLEA 4ICMA 2P8CA 3AJXA 5CLWA 1LDCA 5AB3A 5T26A 5AECA 1V93A 4PMOA 2E1DA 2DJXA 1DPMA 8A3HA 2Q01A 3TJIA 4UUIA 3REQA 3GNRA 3CT7A 4PUKA 5K4XA 3N25A 4H9XA 2QW5A 2VDGA 3G1RA 1FWCC 5DBTA 2DVTA 3HGSA 3PANA 3Q45A 4RV3A 3GY1A 2WVSA 5C2XA 5HNRA 3WQPA 1Q6CA 4MB5A 3WNKA 5HQMA 1RR2A 4NNCA 3D3FA 1EH9A 2DT2A 1UKTA 3WEZA 2DJLA 1FHVA 4GI9A 1LG1A 1OINA 3OBAA 3L2IA 1RVGA 3IAQA 3O07A 4IPIA 1EA9C 5FSEC 1W1VA 1K8XA 1R8LA 3AMCA 3N2TA 1NFGA 3ORWA 3K1GA 3GHTA 2JE8A 1BRLB 4QGCA 1DWGM 3WDPP 1ZENA 3A21A 4NYUA 1QU4A 3C52A 4KFOA 1UH2A 2E1WA 2GVEA 2R14A 2XN1A 1YQ2A 1HJSA 2EJ1A 5D8WA 3QGVA 4LRSA 4CNNA 2VD8A 3E0IA 1KM2A 4TX6A 1EKOA 1US0A 2EGZA 1E6QM 4NL1A 4GVFA 3M43A 3PM6A 3L21A 4Z1CA 3APGA 2OSXA 2FQIA 3CWOX 3KBSA 1S2UA 5A6MA 2PDIA 3TONA 1OEPA 3OO2A 1R5YA 3WK3A 2ATSA 1R85A 3ICJA 4DZ5A 2FB3A 2X30A 4UFMA 3WMBA 2VCAA 5GNZA 3K8KA 2QJGA 3LLDA 3T6CA 4H01A 1VH7A 2QR6A 4QJ1A 1U83A 2X8RA 1MUWA 1J96A 3ITLA 3A47A 1VJZA 9XIMA 1X7IA 3KOZA 1E5NA 4HZ7A 2V5JA 4B9YA 5LNUA 5D32A 3IPWA 4DO5A 3L12A 4XZBA 4XKYB 3QY8A 1PO9A 1A5KC 3KDNA 4NIRA 4UTWA 4YJ5A 4TVUA 3CMGA 3JU2A 2PGEA 3KL0A 3PZVA 1E9ZB 2POZA 2GFTA 3FAWA 2DIEA 2J77A 4IG2A 1GVEA 3F5JA 3RO8A 5AHNA 1CTNA 4C91A 3ATZA 4PFMA 1WOAA 3RHGA 3B8VA 5BCAA 4H2CA 3KVLA 1YNQA 5CAHA 2Z7KA 4M6QA 2J9XA 1ZY9A 3KE0A 1JYNA 3WJXA 2DP3A 2QHAA 3LHWA 1GVRA 1FWGC 1QK0A 1BVWA 2Z6JA 4KRZA 3LRLA 4LW7A 4FAMA 3M0IA 1UZDA 1EA0A 3N9SA 3DI0A 2DZBA 4OUEA 1KRCC 4P8VA 4DY1A 2WNQA 2XSAA 4LEQA 4M82A 5FJRA 1UC4A 1BYDA 1K7EA 2HROA 2E6DA 1E0XA 3GG7A 1VP5A 1WKYA 3TAOA 4L1WA 4Z2JA 1ITXA 2PP0A 4MDPA 2PDQA 3WQFA 3VZZA 3N4EA 1B30A 3S5OA 1LQAA 4JN8A 4A22A 2LLEA 3STPA 3ABSA 3GUWA 4PBFA 1I4NA 1U1HA 3G24A 4F0HA 4D71A 3WUEA 4B5WA 5JU6A 4Y6GA 1WCGA 4H6QA 1EBHA 4PBEA 3VX1A 2G3JA 2VC9A 4CD6A 1LP6A 3BJSA 3ABOA 4RUBA 2O7QA 3RM4A 3EOOA 2IKHA 4H6RA 1W1A1 2ZZ5A 1BG9A 1XBZA 3ARZA 3PZ9A 3UVIA 4PTNA 1REQA 4MB3A 3HQNA 3UCDA 3PULA 2QJIA 4M1BA 4BF7A 2NWRA 2QDGA 5B7YA 4Q7IA 5AYBA 2VD9A 4E8DA 2DQWA 3GAKA 4QEEA 4IGNA 5K3VA 3CPGA 4CN1A 2QMJA 2JKAA 3U5UA 1KGUA 1J01A 1VFOA 3ALGA 4WLCA 3KS6A 2DUAA 1H0GA 1M03A 3S5YA 4RE4A 2OPJA 2R1KA 2O92A 1LLWA 3WDQA 3ZJ6A 4WDXA 3HURA 1QOPA 3ZO9A 2V3FA 1ZCCA 1JZ6A 3JZEA 3C56A 1OFEA 4I9TA 2QCDB 2OOGA 2YCLA 3DCPA 1I2OA 4OGZA 2J24A 1DQXA 1TJ2A 8CGTA 1O6IA 1UR9A 3NFUA 1EEPA 2ZOXA 1KWKA 3KOYA 1W3JA 3AU6A 3W23A 1UP0A 4NF7A 4D8LA 2X40A 4WKHA 2VL4A 1JI1A 4HNOA 1UKPA 1V03A 3TSMA 2VVSA 2VELA 1VFSA 4NG3A 1I1XA 2QGHA 3U3HA 1VF8A 1W9VA 1WXZA 1VENA 3ISIX 3HPZA 3XISA 3U4AA 4D2JA 3MV01 2JF6A 3CL8A 3M9YA 3W4RA 1QNQA 5I7GA 2NT1A 3MMDA 2J7CA 4KERA 5IDZA 3OGRA 4A3UA 2BASA 3BGJA 4LB3A 4Q3MA 5EU9A 3TYAA 2O4MA 4JIIX 4XD5A 3ARVA 4GVGA 1J0KA 3NVDA 5C9UA 1R9YA 2OYLA 1X1OA 4H9MA 1N2VA 1OZMA 4BY3A 1W1IE 3L2MA 4WSJA 2JIEA 4Z17A 2WAGA 1LLOA 1JNEA 3R0UA 3O6AA 2XIOA 4PMNA 4IGSA 1AL7A 3LI1A 4Q6JA 4US6A 2P76A 3CQJA 2G8ZA 2PF8A 2INFA 4F3HA 2G4FA 3EA2A 4GI6A 1IF2A 4JBRA 5LIUX 2PWFA 2GJXA 1RJPA 3DC8A 3LZ3A 4FXJA 3RDKA 2X2GA 3SBFA 1TPWA 1XFCA 3KBMA 1PCKA 2ZUNA 1VLWA 4RNJA 4FIQA 1UWIA 3GC4A 3PBGA 2PI6A 2RGLA 1E6RA 2B4GA 1F2JA 1R7OA 3VNZA 4K7VA 4ZO9A 1UW9A 3TQVA 5BXPA 3T81A 2WMHA 1JZ7A 2WMJA 3W3OA 4MLRA 5BU9A 4WSHA 4RW5A 4HA4A 4Z1AA 3BO9A 4B5VA 3WDIA 3O05A 1JEZA 2KZHA 3DECA 1QWGA 4F8XA 2E8YA 1PYFA 6XIMA 1GZJA 3BSMA 1P4CA 4UQCA 1GHRA 2EPNA 1Z8AA 2PTDA 1R47A 2XDFA 2ZA2A 1UZ4A 2BY2A 1Q2RA 3N3MA 3U0HA 5DMYA 4RZ4A 2EPLX 1MXSA 4A2SA 2WM0A 2OLSA 3W84A 2H3DA 1V6XA 1TVPA 3FVMA 3V1PA 4K8HA 3WFLA 1T5AA 2AKZA 5FI8A 1EJTC 1LQ2A 1IEWA 1E5JA 1S2AA 1H63A 4GH1A 2GPTA 1H41A 4Z1BA 1TQXA 2BVTA 3QR1A 2Q3RA 4LYKA 3LM7A 1KM3A 3IRDA 2NWSA 1BGAA 4J2PA 1LRTA 4C6DA 1JZ3A 3WBEA 1UOKA 2TSYA 3WN6A 4LEFA 1KKRA 1N8WA 4US5A 2ZXDA 1EGMA 3G1AA 1V6VA 1YIXA 3AS3A 1IQ8A 2YXOA 1AA1B 2VOMA 3E38A 5IDIA 1KBKA 3IIZA 1DJXA 4ROQA 4E2BA 1WAWA 5M5DA 2PDWA 1EOKA 3UEQA 5FEPA 5HK4A 2WCAA 3V75A 3TYCA 1GPWA 5M3WA 1OVDA 2ZZ1A 3FHAA 4ORIA 1L6WA 1OFRA 3LSBA 3OBKA 1NY1A 2JBMA 1J5SA 3U7BA 1XCWA 3QV9A 1C93A 5A3HA 4DLMA 3GNOA 1RCXB 5M2FX 4PMUA 4C6IA 4M8UA 3FSUA 3CUHA 2BGSA 3R1ZA 2DIKA 3NGFA 4N9BA 4Y8EA 1ZS2A 3FK4A 2ALDA 5RUBA 4AHPA 2I7GA 1Z9AA 3A13A 4HVXA 4XVDA 4ZO6A 5DF0A 3VD5A 1A80A 1QNSA 1QPOA 4JXCA 4KIEA 2BY1A 4EWJA 3AXMA 1PIFA 2J27A 2WK2A 1EPXA 3C2EA 2AMGA 1JAKA 3ARRA 2BB0A 2ANUA 1LWHA 1UZHA 4ZQPA 1I2PA 4E2VA 1IT8A 1F3XA 4HA1A 4HGXA 1J2BA 2CBIA 4ASTA 3BH4A 2BGNE 3BCJA 6REQB 3O8AA 1B3XA 3SCVA 1HJQA 5AYYA 1TVNA 3KVKA 3SRHA 2REQB 4JFVA 1HJVA 3BJTA 3AHTA 4S1FA 4PE8A 1E71M 2VP8A 1QJWA 4YYCA 3EKLA 5DMNA 4QISA 1DWAM 3EA3A 1BGGA 4JTAA 3UERA 2BV9A 1ONWA 3OGVA 1OFBA 1Y5XA 1PUDA 1XSJA 1C9DA 4Z1YA 3SSJA 4EF8A 1HX0A 2ZTJA 1PSCA 1F76A 4DUWA 3EB3A 4DJEA 1BEUA 3U2ZA 3UD6A 1VRDA 3DH7A 3T1GA 1EGZA 4LRTA 2B81A 4XX6A 1Q8AA 4HOXA 3PJTA 2UY2A 2WV8A 4JIQA 2DSVA 2CHOA 4LOCA 1D7KA 2VR5A 2BP1A 5HBFA 4EXBA 4E6MA 3NO3A 1LBFA 2WMIB 1GKRA 3AHXA 3CB3A 1QI4A 5FD0A 4WK9A 3HGRA 4IHCA 2FVLA 2JKEA 1ZLPA 4H83A 1XIMA 1FWHC 3GTIA 1X98A 2YDQA 3CC1A 1CLVA 3LX9A 3SI9A 2GUBA 5CBIA 1UD4A 2X0SA 3VFCA 1QOXA 2HISA 3OHIA 1GVIA 1KM1A 2BDQA 5CSYA 4NZ1A 3VNJA 4WGXA 3FY1A 1NSJA 3FSTA 5CC6A 3HMJG 3L67A 4MWAC 3KBVA 3GDRA 1EDTA 3A3HA 3DESA 3GH5A 3QHOA 2PUZA 3GQYA 3WLIA 3GXMA 3NQVA 1JXJA 3IIVA 3LCGA 3GRIA 3RUBL 2EG6A 3AISA 4PUWA 3GHRA 3W74A 1SW0A 3UXAA 4ZGYA 2R82A 1H62A 3RR1A 3BVJA 3DFHA 1KM5A 2XINA 1PZ3A 2Y7DA 1SZGA 3AC0A 1RJRA 1U30A 2IPWA 3U2OA 5JBEA 2J7GA 3N2XA 2V5DA 1UP2A 3E3HA 1W5NA 4TQTA 3I7RA 4K1WA 2D20A 3IIPA 4KEMA 2O9PA 2R1LA 3KUMA 1A5UA 2VX5A 4NI3A 3ES8A 3LPGA 4B3ZA 2WWCA 5J8LA 1GHSA 4XZMX 3R94A 3G3DA 4X9SA 2HS8A 4AC1X 1JPHA 4K6AA 3KVMA 2BY0A 2E7FA 2HPIA 3FLUA 1XYBA 2BNJA 3FJ6A 1X97A 1VJSA 3LEPA 3QBUA 4BEQA 1NP0A 3MVIA 1OC7A 1K4HA 5T91A 3C3NA 3G0UA 2QZRA 5GJNA 2QUMA 3TE9A 1B3OA 1IEIA 3MUY1 1R7AA 4XO7A 4MKVA 1RY8A 4XAYA 4LAOA 4CCEA 2YKKA 2D22A 1KR0A 4KETA 4GUGA 4H2HA 2PRMA 5FEWA 2BHUA 4FX6M 5G1YA 2V30A 3PBWA 4GUIA 3W1RA 3RNDA 4Q4MA 1ICPA 2F6KA 4FLRA 3GC5A 2DU2A 1W32A 1S3TC 3W02A 3N18A 3MO7A 4K3ZA 3AALA 2J9YA 2NQHA 3TN5A 4ADSA 4I7VA 3BLFA 2QCLA 2Z2BA 1IIHA 3HB9A 1H4PA 3OVQA 3UPWA 4Y9PA 2WSKA 3EX2A 2W5FA 4RXFA 2NX9A 1MFVA 1DV7A 1J2WA 4UFLA 3UQNA 1TA3B 3OOQA 3GH7A 2A2IA 3BAWA 3BC9A 1ZJHA 5XINA 3TTQA 3AZTA 3VIFA 1OWQA 4ZOCA 1F6YA 3LXBA 1ZGDA 4K8GA 4JS3A 2JIWA 3FW6A 3MT1A 1TJRA 2G3MA 1NDWA 4B5UA 1J8VA 2CCRA 4HKPA 3LLXA 2PGRA 4AUBA 1Y65A 1VBGA 4PSPA 3KCLA 5HR7A 4W86A 2CZVA 2X1SA 3QMTA 1TIWA 4G1NA 4O1CA 1AZ2A 4UTJA 3T0BA 2CKSA 4CQCA 3LG3A 5AVNA 2X7VA 1QAPA 1LTDA 4S3EA 1MWOA 3NEHA 3G0SA 2IPGA 3BG9A 4L65A 2Y24A 2Y8UA 3T07A 2PWDA 2UV8G 2XFWA 3USBA 3KZPA 3ZJKA 3E2QA 3L0KA 3CT2A 4QAWA 4HMCA 2QNEA 3QN3A 4ACZA 1GCYA 3NNTA 4PEEA 3B97A 1JPKA 4HN8A 2GWNA 1HGYA 3L23A 2NUYA 2CXGA 1U1JA 3NCOA 2VEFA 2XSBA 3GNXA 1TRDA 1XH1A 4I6KA 1QHOA 4JL1A 2JGYA 4U2YA 4DJFA 3PZOA 3PPCA 3R5EA 5AHIA 1TG7A 2INZA 3BW2A 1XD1A 2QCGA 3P14A 4DZAA 4EK7A 3UBPC 1XLAA 3RFAA 4HSOA 4JIHA 3IANA 3VD9A 2J8FA 1QHPA 5D9OA 1FXQA 4ORMA 9XIAA 3PPGA 3RPMA 4S3AA 2I5IA 4HU4A 1YTEA 4DF2A 1H61A 3BLEA 3WELA 3RX2A 2A3CA 3OJGA 3AS2A 3NL6A 1F07A 3O1NA 4EVZA 4AQLA 3BLLA 4R5EA 1DIEA 1VYRA 1KCZA 4GQQA 2JALA 3N6HA 1RH9A 3VGBA 4UC5A 2NLIA 3N13A 2XVPA 1QWKA 2P1FA 2QAFA 4LBUA 3S42A 4AWEA 4RCXA 4HNTA 3W86A 4MWAD 3GFXA 2XGZA 5A2CA 3V36A 3RILA 5HJYA 5G2WA 3BG5A 5M03A 1JCTA 2PGWA 1NJJA 4GIRA 3BV4A 2OLAA 2I5QA 5CJNA 3P8IA 3C0SA 4J35A 3GDBA 3MSDA 3KXQA 3C0QA 3MTWA 3VDHA 3DBPA 3MP4A 3N3TA 2WKJA 3A9IA 3W2MA 4EOUA 3O0KA 1NP2A 1L2UA 2YBTA 3T44A 5AC7A 4CCZA 4LC6A 3QPZA 2ZA3A 1NH6A 2DEPA 4BQ4A 2BXYA 1PJ9A 4O16A 5JH2A 4H9TA 4K8EA 5IBXC 2Z2AA 3B0XA 3E2RA 2GVYA 3FIGA 3MUZ1 3CHDA 1YDYA 4DM2A 3AYSA 5CZJA 5FOOA 4HPJA 1M53A 6XIAA 5A8PA 4QFUA 4E4UA 3VINA 5C9XA 2QVNA 4LAMA 5AC6A 4IQDA 1Q3NA 4EPBC 2FMOA 3Q4DA 7TAAA 2VNCA 3LOTA 2OELA 1UQZA 4NJHA 3T78A 4NZCA 3EPMA 3CUFA 2YDRA 4H8VA 1V3MA 1WZLA 1XIGA 2C3ZA 2PSNA 3HGJA 5LKYA 3LCLA 2BSLA 2J78A 3SY1A 1PKYA 2CLHA 4LUSA 1M6JA 1L6GA 2IPJA 1X1ZA 3FJLA 4RL3A 4WGHA 1Q4WA 5D8ZA 1FQ0A 4OHQA 3STFA 2OB3A 4W89A 1TX0A 2F7FA 1P7TA 1ZBKA 1JCJA 4G7EB 5I03A 3TQKA 2PLKA 1SR0A 3XIMA 3G2GA 1B1YA 5I3JA 3BLKA 5FL1A 3EWXA 1MXDA 1HVQA 4P7OA 3VKDA 5BROA 1ZU8A 1BTMA 2X1TA 3A6OA 1H50A 1OY0A 1WDSA 1X39A 4AZGA 5CAKA 2H3BA 3VIOA 4JTRA 2OODA 4GA8A 4A8LA 4D6GA 4XTDA 2XFRA 1FDYA 1Q7ZA 2QCMA 2GWGA 5EMKA 4HSNA 3GO2A 4C6OA 2Y7GA 3AIBA 2Y61A 4Q4RA 4JEJA 2RGMA 4N6FA 4DJDD 2QUVA 2PLMA 1L8PA 1XLIA 3B8SA 4XWUA 1R6WA 3PBVA 4DUOA 3TFXA 1WA3A 4KMQA 3UWWA 3UP8A 4WX2A 1NFBA 5DMMA 1EIXA 3FN9A 3WFAA 1GJWA 4ZEPA 1JI2A 1M7PA 5AHEA 1WO2A 3QV7A 4EE9A 3L4YA 4PZVA 1C9WA 3M07A 3BQ6A 3FJ4A 3AZRA 3QMRA 5B80A 1OG0A 5G4HC 1K1DA 4IH3A 4UTWC 3DFOA 4X2RA 4FXFA 3RN6A 3RLGA 1ZAIA 4R88A 3WLJA 3FCPA 3UCCA 4TX9A 3EKGA 4N4PA 4A8NA 2JQXA 4PB3A 2Q8LA 2J6VA 1PIGA 3CQIA 1EDGA 4O50A 3C0LA 1E15A 4B5XA 1AJZA 2V0TA 1OIFA 2ZX6A 1VLIA 1PX3A 5LGXA 3QOKA 2C1IA 5D04C 1UHVA 5D09A 3C2VA 3IK4A 3PJWA 5H1WA 3EWWA 4C5ZA 3ZS4A 4UZUA 2FTWA 2OU4A 1VC4A 4PYSA 3AFBA 3GB6A 2NLYA 3D3AA 3RG6A 3CLWA 3BDKA 3CHFA 2WSQA 3L2LA 3AIRA 4GHRA 1O95A 1PX8A 4A35A 2D3LA 3ZVIA 5CPLA 1DEDA 2PC4A 3HQPA 1AODA 4DQWA 3TN3A 2I57A 4CN6A 1ZRQA 3T4WA 1WB0A 3MDUA 2UY4A 3G18A 3UZXA 4LT9A 3CJPA 1G69A 3EPOA 4R3UA 2PDHA 3LHZA 3DFPA 1A49A 2PU0A 4MB4A 3K8LA 1X8CA 1S5NA 1IT7A 1W17A 2ZRWA 3NZGA 4ZB0A 1O1ZA 3MY9A 1I60A 1O5RA 4DXXA 1YW1A 1TB3A 3H8AA 1YPXA 4K2SA 1XC4A 2UZ9A 4HMEA 4XZHA 3UZJA 5A2AA 4YPJA 3A3XA 1RK5A 3FGCB 3VNYA 4UR8A 2WO5A 3TA9A 3CM4A 3ZM8A 4W4QA 2EQDA 3WG6A 4AW7A 3NQMA 1UZ1A 3RU6A 2XGBA 2YSWA 3RPDA 1M7JA 1KB3A 3AS1A 3GVWA 2F9RA 4NILA 5DCDA 1F8MA 3HQ1A 5G2HA 2G37A 1W91A 1O66A 1LBLA 4PR4A 1N82A 3KCOA 4PCPA 4S3GA 1I2QA 2BOFX 1J0ZA 1GONA 3GNDA 4PCNA 5EYWA 1TCMA 2D3NA 1OT1A 1G94A 3G6MA 3TN6A 3IJ9A 4AEFA 3PJXA 3FX4A 1OK4A 3VNMA 1GJUA 1DJIA 1EC9A 2EJAA 4NJJA 3SQMA 3DGRA 3NM1A 5CLTA 2VGGA 1S3HA 2JF7A 1P0KA 3W1UA 1F5ZA 3TFCA 1PV8A 5BWAA 4L80A 4RKAA 2V5LA 4URIA 1K9TA 1B3VA 1AL8A 2QXWA 1XPGA 3CUGA 2I9UA 4QJ3B 2GJLA 3K46A 3LHVA 5E1QA 4M19A 2X16A 1A5BA 3D6NA 2E9LA 1C8XA 3HV9A 1YTDA 1O94A 3CV7A 1TWZA 3L68A 3O0FA 1XQLA 1DE6A 4QLKA 1VB9A 3DKLA 2DORA 4A3QA 3SN0A 1TZZA 4MF4A 4S38A 4TUFA 1UOZA 3K30A 3CUXA 2G3FA 3BGGA 2PTXA 3C0JA 3CPUA 3MC5A 3BARA 3NUKA 5FESA 2A4AA 2CLMA 2WPBA 2F2HA 3WYZA 1H5YA 1VFHA 3JW7A 3L4XA 1UKSA 1N8IA 4Y9NA 1ME7A 4Z2KA 4FLSA 1W9XA 1S39A 2D2HA 5D9NA 4ZVJA 3ARQA 3QRHA 1GOQA 2WNWA 4BQ5A 4O11A 1JR1A 2DSUA 4GOAA 5EMJA 1GG0A 2NX3A 4ALDA 1OF8A 1WE5A 2EEXA 1XLFA 3TLQA 4RR4A 3DFYA 3VOFA 2J7DA 1EJWC 1WAUA 4AH7A 2YA2A 4UTIA 3ZWTA 3B9DA 1S1RA 4REQB 4EIVA 5BMXA 2FGBA 2PWHA 2YA1A 1AVAA 4FHAA 3LTYA 1R3QA 3NPWA 5C71A 3IJ8A 2O7SA 4BWLA 4DZIA 1V6YA 2FZBA 2GUUA 2E68A 2CEQA 4GCXA 3SDOA 3DIPA 4UQAA 4BF9A 3A64A 4HTBA 1ME8A 4L7ZA 1RPKA 4CLMA 3G3MA 3UGRA 1JIBA 3PB0A 4MIMA 2EF9A 4ILSA 2A21A 3KVJA 2B7PA 3TXVA 1TVLA 1Q6FA 3S6DA 3W7RA 4XZ9A 4M29A 5LNWA 4C6KA 4XKMA 1FP8A 3GW0A 1OCBA 2E6FA 4FXRA 3CQHA 3O9NA 3WEOA 1E9YB 3G1VA 1G0CA 3ANVA 4M7SA 1VBRA 2YXGA 3B9EA 1HGWA 4C1LA 4HCLA 3BK0A 3CXOA 2VZUA 3MCNA 4HPNA 4J2MA 4LXFA 3C8FA 3H26A 3H2MA 3HPXA 1BRLA 4KS0A 2JFEX 1S2CA 3AOFA 5GNYA 3RPTA 2V5KA 1JCMP 1WXYA 1O4UA 1QNPA 5D33A 4TTUA 2ZVRA 1TJPA 1WDWA 1HO1A 3QOMA 1EXPA 4QCEA 3B06A 2GJRA 3PUDA 1JPMA 1WZKA 2P53A 3ARPA 4U5IA 3A24A 3GH4A 4XD3A 4R9OA 1GNXA 3I68A 3RYSA 5F2GA 4QLJA 4IMEA 1OCQA 3FDGA 2QQ6A 2O9OA 3O06A 4DRSA 2A6NA 3P5ZA 1K9EA 3A4WA 1T8XA 1BKHA 4B3LA 1IYXA 2GYIA 3BLPX 4CEXC 3WQEA 1OGBA 4L4OA 4X61A 4EPKA 3EXTA 3OODA 3FOKA 1R3RA 4ZR8A 4AY8A 3W2NA 3WQ8A 4OBRA 4PFHA 4XQ6A 2FIQA 3SCNA 3ME3A 5KEZA 3DC0A 2PWVA 4A3YA 3MS8A 3CO8A 4XKYA 1E72M 1EJVC 1XSKA 3OG2A 1GVFA 4ZA0A 3WK1A 1NF0A 1VEPA 1OB0A 2PWEA 1OX4B 4OOUA 2XM2A 4OECA 1EHAA 1XM3A 4MY8A 4PTMA 3BQ5A 1XLEA 1EX1A 3L7RA 3IVSA 3TIMA 2ZX5A 2QT3A 5D05A 1TTJA 3ZJ7A 4EXQA 1HKIA 3CK5A 4I9AA 8TIMA 3W7EA 2XH0A 2ZRXA 3AYTA 5F4WA 1D8WA 3K2GA 2PDMA 4C1NB 1T0OA 2I16A 4O8RA 3UR7A 1HO4A 1UJQA 3S2MA 2P8BA 4V15A 4PRTA 2PWUA 3PHAA 3GG1A 4MJ2A 3BUVA 4J3VA 3EWDA 3KLKA 4M3PA 3L0NA 2HE8A 5DY3A 1MMFA 5KINA 3QM3A 3MMTA 4CNSA 5JQ9A 5CPNA 3EA1A 4M6UA 2OWXA 3S5SA 2WQPA 1OC6A 4BEUA 3EB4A 4V1YA 2YR1A 4R34A 1YBQB 3UA3A 1ESWA 3OZOA 2WNNA 5H8PA 2VM8A 3TTEA 3H2FA 4BJHA 4GNKB 4LC8A 5HA7A 5KMYA 3AIVA 4Y9AA 2OKTA 2VTFA 1K7FA 1GOKA 4P8XA 1RA0A 1LF1A 1M1BA 4WJ8A 3LS9A 3RO6A 4NI8A 3COTA 3S46A 4V28A 5CGTA 2QEZA 4CCDA 4HT3A 3WQ4A 5AVHA 2FPTA 4RW3A 2QYGA 2DSWA 4KW2A 3PUEA 4RZBA 1TFVA 2ODOA 3FFSA 1K6WA 2INEA 4XIAA 1YTKA 2V6AA 2EHHA 3W6LA 5HQEA 3NO5A 4GJJA 4Q8PA 3VIMA 3DOPA 1O7AA 3H23A 1T6MA 3LCFA 4YN5A 3H2OA 3MP5A 3B03A 3NZPA 2P0IA 1C7SA 3EWZA 1TWDA 3EPNA 1E40A 1ISYA 1UD8A 2E9MA 1LOSA 2PC8A 3HMCA 1W37A 4HU8A 4O1DA 3BGAA 1GUVA 3VKAA 4ZXOA 5LYRA 3BW3A 1J79A 4IL2A 1NELA 2ZRYA 4K38A 1N8FA 3S1VA 2E67A 2WC3A 4H4IA 1N7KA 2Z28A 4FI4A 4G5DA 1VZWA 3EDFA 3QF0A 2FVMA 5CPOA 2JGQA 4OZOA 4MAVA 1T41A 4PUNA 3VNIA 1C90A 3H2NA 1ITCA 3GE7A 1EXBA 2YBUA 2CHRA 1ECQA 4GXMA 5CPSA 1PKLA 4PTDA 2QJMA 4GJ1A 2OFJA 2QPSA 3E1F1 2QCHA 4H9UA 3FYOA 4UFJA 1H1NA 5F7UA 4IMGA 4MPQA 1Q6OA 3BOXA 1JL8A 3H7UA 1PKNA 3TX9A 2DT1A 3QR0A 4QSFA 4D6FA 4C6BA 1RBOB 4A8IA 2ZTKA 1EQCA 1WDQA 3NDOA 3B9NA 4Z2HA 1XP3A 4XIMA 4QAIA 4PTWA 1X1NA 2ATMA 3NZ1A 2WZIA 4US5D 3LCHA 3RK8A 5FJOA 2WSPA 3QGKC 1VRXA 1R0MA 2PF0A 3W27A 3PZIA 3UXLA 4IX2A 3F2DA 3I3BA 4QJ4B 2B7OA 4U5KA 3LCIA 1Q6EA 5TNVA 2TMDA 1K8CA 3BANA 4L1GA 1TWWA 1JG9A 3ZMRA 5L9FA 4DLFA 1TQJA 3W70A 4XAPA 1X6UA 4O57A 4J4KA 7REQB 4MWAB 2XYLA 1VGAA 2WHLA 4F48A 1FHLA 2VCCA 4Q7NA 1AW1A 3V35A 1HL9A 5FF3A 3NQBA 4DNHA 3FHQA 3QR3A 4HA0A 2GOKA 3EDDA 1CXEA 1TWIA 4AHQA 3ITYA 5LHEA 1KWGA 4JN7A 4Q8WA 3L5LA 1E4MM 3P80A 3I4KA 1CDGA 3BJFA 3CZEA 4XD6A 2BLEA 4GX8A 2J8TA 2F38A 1D9EA 5CC3A 3NQAA 1NWRA 3T40A 1DKWA 5LA0A 5D2WA 1QDSA 4C65A 4FNRA 3UESA 3KOWA 3OQEA 4HHHA 3N12A 4YCPA 1AJ2A 3GLCA 3T2OA 4A29A 2BS9A 5ABHA 1AG1O 4O1AA 2H9AA 1TMHA 1ZB5A 3O6CA 3N2CA 3B0PA 4AC7C 3PFRA 3M0KA 1P48A 1BLIA 3GR8A 2ACRA 4GINA 2CBUA 1KGXA 1PS9A 2BXVA 1IXQA 4EPDC 3GD6A 2SFPA 4H3DA 2FPYA 3A23A 1XYAA 1NOUA 4J7RA 2VYOA 1O60A 3CHCA 4DJED 4GYKA 4HZMA 5T9CE 3EB2A 5A95A 3ZR6A 4G8TA 4HK5A 4O0ZA 4WEVX 3CH9A 2HBXA 5A94A 2OWCA 4O4WA 3SAZA 1P0DA 5HWMA 2PAJA 3MVTA 4GZEA 1JZ8A 5IOBA 4ERIA 1WUEA 1L8NA 3CO4A 4UNIA 4DJFC 2ON3A 1W0MA 4HHLA 3DUGA 2OT1A 3CMFA 1AQMA 3A3WA 1NOFA 5DELA 3W22A 1RAKA 4DB7A 1QO2A 1UD5A 4PRRA 1EFZA 1QPQA 1IT0A 1JNDA 3WD2A 5I5RA 3IVTA 2O4QA 2CLFA 3DHDA 1FH7A 3L0GA 3JZUA 1JYXA 3AHVA 5HJLA 2PDYA 4LS1A 4LVFA 3N14A 4HQVA 2X0YA 4QM1A 5C2CA 4P7RA 3NXLA 1CGXA 3LGGA 4UMAA 3T4CA 1BSLA 1ZSXA 3NM3A 1HP5A 3SJ3A 2HPMA 3CZGA 2Z1BA 3KTXA 2MNRA 1FWBC 3WUFA 1LT8A 1SFSA 3E74A 4IJRA 4GACA 1F8IA 1T40A 1TSIA 3CTTA 2EPKX 1FWWA 2PWGA 5E6YA 1GYLA 3C2RA 3VVGA 2C79A 5F4XA 3KM8A 3L5AA 5HQLA 4FO4A 1JCXA 4DM1A 5C55A 1XC6A 3AI0A 4HB7A 3TQPA 2QIWA 3BG3A 2ZRUA 3M6DA 2E4TA 4ZQCA 1QMLA 5AC8A 2XH2A 2PRHA 4IIBA 2ZC8A 3AXHA 4L6DA 5FF7A 2VOTA 3GR7A 1GQKA 1MW3A 1MQQA 3GKAA 1TPB1 4QE1A 3OVGA 1XUZA 4E4PA 3H6OA 4JR5A 1A5OC 3H4XA 1MNSA 2I14A 3NQGA 4Q8VA 3QHNA 3M44A 1SZRA 1K77A 1PCWA 4HNVA 4WQ6A 5I2UA 1L2QA 3AIUA 4RNHA 1FY6A 1JF5A 4QS5A 2EG7A 3KFTA 1AH0A 2CLEA 2J7HA 3UPMA 2FFIA 4GMEA 1TPEA 1BXBA 1Q63A 2PDCA 4RK8A 5DT5A 1FCVA 3QQ1A 3V18A 3G6LA 4G6CA 3V7PA 1NU5A 2G41A 3B9AA 4X63A 4GQ0A 4YTUA 1XDLA 1FUYA 2VZTA 1E0TA 2FB2A 3WZ0E 3PR2A 5FEXA 3FA4A 3WLLA 3M5XA 2VGFA 4EAMA 2OQLA 4Y8FA 3T55A 1VFMA 1RHCA 1Y7VA 3GVVA 1JJKA 4HMDA 4H8NA 1UROA 2DGAA 2EPOA 4HD5A 3WLNA 2DH3A 3WD3A 4C6PA 1QATA 3MYPA 1MYRA 4G9PA 4JTIA 4C6FA 4AVOA 5LIXX 4AZ7A 3GZ3A 2NVDA 3QFEA 3SCSA 3DG3A 1EGVA 1JYVA 1NWUA 1U5HA 4LSBA 3FYYA 2V3EA 1EZ2A 2TAAA 2WHMA 3OLDA 1VCFA 5D9MA 4S3BA 4J40A 3C5QA 4QRNA 3TJXA 1W5QA 3KHJA 1V6WA 3C2FA 2A3AA 1Q66A 3VD4A 3SFKA 3QKEA 5A6JA 1ZNNA 1JDDA 4IFRA 4JQ4A 1H49A 4QE4A 2B31A 1AQHA 2VUNA 2P3EA 1S5MA 2OMAA 3M5YA 3CU2A 1IZJA 2JEQA 2XVKA 3O6YX 1FDZA 3E2VA 3AWOA 1XD0A 2YL6A 2TODA 3W9ZA 4MB1A 3N4FA 4AD2A 2OEKA 5D30A 3PZNA 3USZA 5AN7A 5DQPA 2VR2A 2Z4GA 4DXVA 2PDGA 4ATDA 1TE1A 3WF3A 1G4EA 4U28A 3DGBA 3TQ0A 2V63A 3ZJ8A 3W85A 2QLYA 4WDTA 2DZTA 5FF0A 4XAZA 1VFFA 5EB8A 4LAUA 1W3IA 1A0DA 3UWUA 1D3GA 4CU6A 1Q6QA 1PTDA 3HGOA 4PMQA 5A6LA 3IJ7A 2OGYA 3BTNA 1S2TA 3HO8A 5DLCA 4HK7A 5CCZA 4POCA 2HV5A 3P7YA 5I0DA 3HM7A 1M01A 2GDUA 4FP1A 4QIUA 3DG6A 2VXNA 3VDBA 5D38A 5LSMA 2HE5A 4AAJA 1VQTA 4E8GA 2RHGA 2DUXA 1LYXA 4S2BA 4O53A 4CQBA 5D2XA 1F4AA 1CECA 3UY7A 4MJ4A 4E0CA 3PF3A 3GYEA 3M5VA 3KWSA 1XLBA 1W5MA 4S3DA 3MSYA 5MF5A 3KAOA 2O9TA 4XO6A 5T9BG 3KBWA 2BMBA 1AW2A 2ACQA 4C6CA 1R38A 1CIUA 1X6NA 4GI8A 1OJXA 1GVYA 3FKKA 5K9XA 2PGFA 2PEVA 2VQUA 1F61A 5EMLA 1XIBA 1E4LA 1XICA 2DVUA 3T8QA 2A3BA 4OUIA 4IG2B 2OEMA 4FNSA 2J13A 3BAKA 2HVMA 3U57A 8XIAA 2FJKA 4DHGA 4KGJA 5BRPA 5AY7A 3LPFA 1GVSA 4E38A 4YXGA 4QSHA 1DIKA 3BZGA 1QW9A 1B90A 1OF6A 3UZWA 4H19A 3KWXA 3W1NA 2ZE0A 5LA1A 1CBGA 1JGMA 1NFPA