1HF6A

Endoglucanase cel5a from bacillus agaradhaerens in the orthorhombic crystal form in complex with cellotriose
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct Experimental Observation of the Hydrogen-Bonding Network of a Glycosidase Along its Reaction Coordinate Revealed by Atomic Resolution Analyses of Endoglucanase Cel5A
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE B
total genus 119
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hf6A00
3WQ6A 4MAZA 1ZBVA 1KR0A 3KWXA 5HXMA 5ABEA 4MJ4A 3W6MA 4S3KA 5GQBA 3UCQA 2OSYA 1DP0A 4CU6A 3A6OA 3VD5A 2QPUA 2EJ1A 2G3MA 1E15A 1L8NA 2CBUA 2J78A 4AMCA 4HTYA 4Z2LA 2O9TA 1BYDA 2V3EA 1JNDA 3HJEA 4CN4A 1W3JA 2D3NA 1B3XA 3VIKA 3GDBA 3L4WA 5A8PA 1ZB5A 3WNOA 1QNQA 1M53A 4JKMA 3OZPA 4P7OA 1QBBA 1JFHA 5LA2A 1E71M 1JI2A 2VT0A 2WC3A 1KFWA 4QLJA 1KXTA 3W27A 2WCGA 2QV4A 4UOJA 2GVYA 2A3AA 1OSEA 4UQBA 2A3BA 4OUEA 4UQEA 1JD9A 2Y24A 1BYAA 2D1ZA 2X09A 4UFKA 1UR1A 5I77A 3ZR6A 3MV01 4MNLA 2BHYA 4QLLA 1NOWA 1ZS2A 4WKHA 3VO0A 1CXLA 3CHFA 3SCPA 2WMIA 4H04A 1JI1A 1E0WA 3UG5A 3AIEA 2D3LA 2WMFA 3SURA 5DO8A 3W6LA 2PBGA 1WDPA 1OCQA 1VEOA 1QNRA 1U2YA 2IXVA 2XVPA 4MB4A 1DWIM 4AD5A 3VIIA 4W7VA 3SCQA 1E4LA 2OYMA 4TX6A 4XV0A 2VZVA 3M6DA 3AIBA 5CZKA 1QHZA 2J4GA 5HPOA 3T0AA 1V6XA 1GPFA 2QMJA 1C7TA 2C0HA 2GJXB 2VQUA 2XSAA 1W91A 1CXHA 1VJSA 5BXTA 3GNPA 2J7EA 3A3HA 1WP6A 4D6DA 4PEEA 5A94A 3ARTA 1B3ZA 4TTUA 1CGXA 3SIMA 4D6HA 3DYPA 3WUBA 5A2AA 4H8HA 2VL4A 4U3AA 5I78A 1AMYA 1GZJA 2XTKA 2JF7A 1HNYA 2Y8KA 1LG1A 5IXEA 3ZQ9A 4XX6A 4HP5A 1ITXA 2Y2WA 4D6EA 5I2UA 2WZIA 5HOSA 1CTNA 3L2MA 4CCCA 5HBFA 4M80A 3KEHA 1XH2A 1HP5A 4AIUA 3W81A 4IPNB 1TA3A 2VRQA 3O9NA 3B9AA 2DSKA 2RGMA 4B3LA 1LF1A 3UR8A 3BAWA 1Q6FA 4EANA 1GJUA 1BFNA 4FLOA 1CGUA 4NRSA 3WFZA 1BG9A 1DWAM 3BC9A 4GO8A 2YL6A 1EIBA 3OGSA 3N11A 2E8ZA 1V02E 3IK2A 1UWSA 3OLDA 2OLHA 2DH2A 1C93A 1OM0A 2XJ7A 4W86A 4U2YA 4B16A 1HT6A 5E70A 4PTMA 3AHTA 1VENA 3AZSA 5D9NA 2V3DA 2XVKA 1FHDA 1UH2A 5BXRA 3SCSA 1TR1A 2RGLA 1EH9A 5ABFA 5JIPA 2WVVB 3OLGA 1E1FA 4PUDA 1BQCA 2VZSA 2WM0A 4JIEA 2E0PA 2C8NA 3NSXA 1VB9A 2HISA 5M17A 5CJ5A 2PC8A 1NWUA 3CIVA 2XFRA 1PIFA 3FAXA 1W1PA 1GVYA 2J47A 1KXHA 1V0NA 2FHBA 3CMGA 2FH8A 1H0IA 4A4AA 3SCRA 3SCTA 3VDHA 4GI8A 1C90A 1AVAA 3AROA 5IDIA 3WF0A 4F9JA 3WEOA 1AQ0A 4IPLA 3W37A 1HVXA 2XWEA 4M24A 4KRUA 4PMNA 4MDPA 4AIOA 2BVYA 3APGA 3WBAA 3AICA 2C7FA 4L4OA 1B0IA 2O9RA 1UD8A 2DH3A 3SUTA 4CKQA 4TTGA 2VMFA 3N12A 2X0HA 3ZM8A 1W1YA 5AYIA 1XCXA 1CIUA 4AEEA 2CCRA 3VD4A 4EE9A 4RE2A 1EDTA 2VZTA 5A69A 3ZJKA 4UZUA 5EB8A 3DYMA 1GCYA 1W32A 1X6NA 1AQMA 2Y5EA 2V3GA 4ATDA 4JKKA 5I24A 4DM2A 4HZ6A 5CPTA 1Q6EA 1US3A 3RJYA 1CECA 1ZBCA 4GIAA 3ZT7A 2IUZA 2ZX9A 1KGWA 2DPEA 4GQQA 5I3DA 2AMGA 2VX7A 1J01A 2O9OA 3KE0A 1D7FA 2JIWA 4CVUA 1JF6A 1WPCA 3CZLA 2WBGA 2WCAA 5IHRA 1Z32X 3D5HA 1QHOA 3N17A 4CD7A 1VBUA 1U33A 1J11A 1PBGA 1VBRA 4C7FA 2XVGA 3WY1A 1BHGA 3WSUA 1TMQA 1HKMA 2JF6A 2YA2A 4N42A 2DGAA 4YHGA 5FD0A 5CG0A 1LL6A 5BYWA 4PRWA 2AAAA 4OBRA 3GZAA 3PZVA 3AYSA 1C8XA 3SUWA 1B3WA 3VMPA 3L4VA 5AYBA 2X0YA 4AZCA 2V3FA 2WC4A 4HMCA 1EOMA 5IFPA 5JUVA 2XVLA 3PZQA 4Q7NA 2V38A 4ATWA 3AIVA 5A8MA 1V6YA 1JZ8A 2WVSA 5E09A 2BFGA 2D0FA 3UEQA 4ZEPA 3VIFA 3B8SA 1J18A 5M3WA 2PBOA 3AMKA 2JIEA 4J3VA 3G6LA 3VDCA 2VOTA 1BPLB 2F8QA 4UFLA 4ZE5A 1CGTA 2FHFA 3ALFA 2PWGA 4J3XA 4UZSA 4X0NA 4DM1A 3AS0A 3ZJ7A 3VKKA 5DEZA 3AJ7A 3ZIZA 3MU7A 3K8MA 3FHAA 1JDAA 1NP0A 3GNRA 1F4HA 2CITA 3GBEA 5E0CA 3MS8A 2GJPA 3VOCA 3WMCA 5CLTA 2E9BA 3RO8A 3AISA 3MV11 1GJWA 1UH3A 3QHMA 1H49A 5IFTA 3FNDA 3S2CA 3SCNA 2EXOA 3WF3A 4CD5A 1PX3A 1OGGA 4GINA 4XUYA 3VGDA 3TTSA 2J7HA 1KBKA 2X8RA 3CMJA 5D9PA 4D6CA 3EDDA 3O2LA 2W66A 1W9DM 2VRKA 1WZMA 3OB8A 3DECA 3EYPA 4HOZA 1E0XA 1ZL1A 1E6PA 4KMQA 2XVNA 2WXDM 1QI3A 4RE4A 4AZ7A 1C8YA 2J7BA 4KGJA 1G9HA 2OWXA 1UKTA 1FP9A 2EPOA 3NIYA 3DHUA 3UERA 3I3EA 3SUVA 1UA7A 3ECQA 4WLCA 4U33A 5I0DA 3WELA 1MXGA 3VD9A 3T2OA 1LL7A 1JNEA 4PMYA 1VF8A 3WH6A 1MFUA 1ZJAA 3S6TA 1ISYA 1E5JA 3UG4A 5D8WA 1CLVA 2G41A 3J7HA 4FMVA 4TXEA 1JFXA 1QPKA 2EPLX 1AQHA 4X9YA 4LQ1A 3DYOA 1QW9A 4XB3A 2YDQA 1HKKA 4Y7EA 1C8QA 1G94A 1ECEA 3VDBA 4GZIA 4H2CA 1UD3A 3PZ9A 3KL0A 2W4XA 3VILA 1TCMA 1E6RA 2OYLA 5CQ1A 3IJ9A 1NH6A 4BCEA 2WSKA 3CHDA 3CZGA 1ZJBA 2QPSA 4R27A 1JDCA 5GNYA 1B3VA 1R7AA 2PWDA 4LPCA 1FFQA 1ZBWA 1EDQA 3ARUA 4E8CA 2OYKA 1VJZA 1NOUA 4PMRA 3D3AA 3QOKA 5KZ6A 2J8GA 1J0JA 5DF0A 1MVYA 1I1WA 1GUVA 2EO7A 1UZ4A 4AISA 3L4ZA 1HF6A 2YDRA 4XZBA 4M8UA 4URIA 1UKSA 1QVBA 3AXHA 2WLZA 3EDKA 1Q6CA 4W87A 3WD3A 1EO7A 1B2YA 5M03A 1L0PA 4A3YA 2WVTA 4M29A 1HVQA 2WHKA 4GPNA 4D6GA 1Y7VA 1UWTA 1H41A 3A47A 2E40A 1HIZA 1CWYA 3THCA 4MNJA 1JZ6A 3K1DA 4H7VA 1BF2A 3WMSA 4PMXA 5AY7A 1E4NA 2MANA 3W24A 1R87A 1QBAA 3IAQA 4Z2JA 1VFMA 1BVZA 4TX8A 2Y8VA 3N1AA 4D71A 4CN1A 3AYRA 4NZCA 4HA3A 1K9DA 3N13A 1B30A 1KCLA 2J7FA 4NRRA 3VX1A 3L2LA 3K46A 4AYSA 2FDMA 1QI5A 2ZUSA 1EO5A 2VVNA 4JFUA 1O7AA 2EPKX 4GO9A 5JIWA 1V02A 3AIWA 3EMQA 3BLKA 1XHGA 2XSBA 1GOMA 2UWFA 2A3CA 3I3BA 4CN6A 2J79A 5HNNA 1J0HA 4CU7A 2QF8A 1W3HA 4P8WA 3WF1A 1JGIA 2E9LA 3M46A 4L4PA 3OLIA 1KGUA 2WAGA 3MUY1 3RM9A 3B9EA 1TFVA 1B9ZA 5LYRA 1GNXA 5HPCA 1OGBA 5I23A 3THDA 1RD6A 4H41A 4U31A 1JYXA 2WZHA 5D4YA 3VD3A 1HKJA 2D2OA 2BV9A 1GHSA 2WVUA 5ABFB 1QNPA 3AIQA 4J27A 3PTQA 1BLIA 1E70M 3AIRA 4HA4A 4UCFA 4LGXA 1DHKA 4GI9A 1WO2A 2J74A 3AI0A 1BVNP 3VGGA 4ML4A 1KQYA 4LXFA 2YA1A 1VAHA 1GOKA 3LPOA 1TG7A 5FCZA 2QMKA 1OD8A 2VX5A 4U3CA 1JXKA 1GONA 3SCVA 2UY2A 3ARXA 3VM5A 2UY4A 1UZ1A 2O92A 3T09A 2CBJA 1GOQA 1E40A 2ZWZA 4E4PA 2YDSA 1JAKA 1HP4A 1V3KA 4P7QA 4QDMA 5E6YA 4D6JA 1EQCA 1BGAA 2ZIDA 1UD6A 1LQ0A 4MAVA 1M04A 3TONA 1MQPA 3N18A 4GZJA 1PAMA 1PZ2A 1UR2A 2EEXA 4Z2HA 1CGWA 3VM7A 3K8LA 2CIPA 4MB5A 3II1A 4OZOA 3CPUA 2BY1A 1UYQA 3WNNA 5ABHA 3VIPA 3BLPX 1JZ4A 1SR0A 3WH5A 1ZBKA 2J62A 1GQIA 2J7DA 4K68A 4AW7A 4E2OA 1KBBA 1GHRA 4JCMA 1PJ9A 2YL5A 4V27A 1XD1A 4FLSA 2D0GA 1U30A 2J8FA 3A4XA 2YL9A 4H8UA 2W61A 4W88A 3QGVA 3W29A 4HPHA 1HJWA 1CXIA 2CBVA 5E9AA 1CXEA 5CXPA 3AMDA 4CD4A 3WDPP 3RM8A 2PWHA 4IISA 2ESCA 1WDRA 1WDSA 4D72A 1J0YA 4PMDA 1CEOA 1I1XA 4HOXA 1IZJA 3AIUA 2ZWYA 4RL3A 4W85A 1S46A 3FHQA 4P7RA 2CHNA 3OG2A 4FF5A 4FLRA 1D2KA 2Z1KA 1SYTA 3WDQA 3T2PA 2XWDA 2VZUA 3SCWA 2YKKA 4V2XA 2ZUWA 1UR9A 3NDZA 2JEQA 5A6LA 1CXKA 1VIWA 1QNOA 4UFHA 4PTVA 3U7VA 1XSJA 3ALGA 1FH9A 4V28A 2WB5A 5DMYA 3WFLA 3TP4A 2ZOXA 1KB3A 2B31A 4P7NA 1I75A 2BXZA 1H5VA 1CPUA 1UA3A 3AS2A 3EDJA 4HZ8A 2QLYA 3WBEA 4AWEA 1E6QM 4YHEA 1NWTA 1V6UA 2WCSA 4WIWA 2CKRA 3WD4A 1MW1A 3BGAA 4W8AA 2DT2A 3NSMA 4PMOA 2ZUNA 4CVWA 1W9XA 3EMZA 3ARPA 5I5RA 2BVDA 2PI6A 1KXVA 2WZEA 2WANA 4QCFA 2Z1SA 4D6IA 1E4MM 3U5UA 3RDKA 4CD8A 1JZ7A 2XPKA 5BCAA 2GSJA 3QHNA 3NDYA 4M81A 3EBVA 3TTYA 1H2JA 5BROA 1UKPA 4TVDA 3SCOA 3TTOA 1QHPA 5JBDA 1ISXA 2G3JA 3ZSTA 1G01A 3GNOA 1W9VA 2G8ZA 4QCEA 1V0KA 1UR0A 3WF2A 4PMQA 1UUQA 2DSZA 3AHYA 4OJYA 3OA5A 1C92A 3DHPA 4BZYA 3MUZ1 1V6VA 1HJVA 2FH6A 1XCWA 4JKLA 1MW0A 2WKLA 3PZNA 4OOZA 1QI0A 3CH9A 3CUJA 3WNMA 3OLEA 4JZ5A 4B9YA 3F5LA 4Z2KA 3WD0A 1E1EA 2VO5A 3FY1A 2VJXA 3VUPA 2UY3A 4Z2IA 3VDAA 3ARVA 4J7RA 1NWSA 5A2CA 3T0BA 2XM1A 4MNMA 2NT1A 5FL0A 3MO4A 3FXYA 2WMKA 3JUGA 5F7UA 3ARSA 4PMZA 4PYSA 1NOFA 4TVUA 3VMOA 4PUEA 5HDRA 4F79A 2GJXA 5A6AA 1HJQA 2CEQA 1ODUA 5C8BB 1E3XA 1JZ3A 1K9TA 1PX8A 1HL9A 3ZMRA 1JIBA 4W8BA 1Q6DA 3KZSA 3E1F1 1UKQA 4JHZA 5JBFA 1V3JA 4ZFMA 2F2HA 1GORA 3CO4A 1GQKA 2OSXA 4MTVA 4D1JA 1KWGA 2PWFA 1EXPA 3WH8A 3WL1A 3BCDA 1DTUA 1W9BM 1LWHA 3PHAA 5A6BD 2DT3A 1JXJA 4KH2A 1MQRA 1CZ1A 1WZAA 2J7CA 3BAKA 4W7WA 3RPMA 1M7XA 5BXPA 4UOQA 3VGEA 4JL1A 3WNKA 1BSIA 1B90A 2W5FA 3UESA 3WUGA 4IUGA 3VU2A 3DC0A 1UD4A 4X0VA 3GYCA 3IAPA 3PBGA 1XRVA 1UD2A 3HN3A 1KCKA 1NM9A 1IV8A 1W9PA 1ITCA 1JD7A 2G3NA 3A4WA 3ZJ8A 1VFFA 3EDFA 1XGZA 4PN2A 4W8LA 3VIHA 4NSBA 4DUVA 4WSJA 1CGYA 1RPKA 4ZXOA 4AIEA 1EGZA 1K9FA 4ACYA 5C71A 3VNYA 5CSYA 2J77A 3OGVA 4CGTA 3WD2A 5EBAA 4FLQA 3WD1A 4DWSD 3VD7A 1RP8A 4AD4A 1OBAA 1FOBA 3M7SA 3MMUA 4D1IA 2OWWA 2W67A 1J12A 5C70A 3T0DA 2WMHA 3VPLA 4MNKA 3GM8A 1HXJA 1KR1A 1GOWA 1TZ7A 4GQRA 1M01A 7CGTA 1TUXA 4W89A 1SMAA 1J9YA 2OWCA 2DT1A 1R85A 3CBWA 2BNJA 1E72M 4RE3A 1Q4NX 1V0MA 1OIFA 1KXQA 5A6KA 2WVVA 3WUFA 3MMDA 4W5ZA 2WK2A 4AY1A 4J3TA 2CKSA 1QW8A 3OGRA 1HJXA 3VX0A 1JAEA 3WL0A 2A3HA 5FOOA 2WC7A 3AZTA 4M82A 2TAAA 4AZHA 1EHAA 2CYGA 3M07A 2IXUA 4PSPA 3WNLA 1NWRA 2VC9A 2WMJA 1GW1A 1IZKA 3RCNA 3GH7A 1KQZA 3AMGA 4BQ5A 3A4AA 1V6WA 1HKIA 3QR3A 5EFDA 1UH4A 4UFIA 2YL8A 2WLYA 4LYRA 5A2BA 3IJ8A 4QFUA 3W38A 3SEPA 9CGTA 5IHSA 3NYDA 2WBKA 2XHYA 5D8ZA 3CUFA 2HVMA 1O6IA 4J3WA 2F61A 3ARRA 1HJUA 2CPUA 3WQ8A 2XGIA 4H8VA 1CYGA 3BMWA 4LX4A 1H1NA 4JHOA 4ZENA 3TOPA 2VX6A 1Q6GA 3PZIA 1TE1A 1DWGM 2WNWA 1OINA 4F8XA 2XFYA 4BS0A 1A47A 4QLKA 8A3HA 4QP0A 4PBGA 3GH5A 1WAWA 2JALA 5DT7A 5A3HA 4EK7A 4TVCA 3AQUA 3PTKA 3RIKA 2BVTA 2W92A 2WW5A 3VINA 2FHCA 2GUYA 4J28A 3OIHA 3BCFA 2VVSA 2X2YA 2G3IA 2E4TA 2O9PA 5E6ZA 3WUEA 4OIFA 3U7BA 4AC1X 3U5YA 3L4UA 1OWQA 4HA1A 2ZUMA 1G1YA 1LL4A 5A6MA 1C91A 1E5NA 3CGTA 1ODZA 4AZIA 3VIGA 4CCEA 3CUIA 1CENA 4LYQA 1DWFM 2XGBA 4EAMA 2BXYA 3ZT5A 4P7LA 2GK1B 1OGSA 3WMBA 2FGLA 1CLXA 4HMDA 4GZEA 4W7UA 3NJ3A 4MPKA 1WE5A 2PWEA 1BYCA 2VQTA 3MANA 1E0VA 2E9MA 4PCSA 2A3EA 2AOSA 1HN1A 1FFRA 2YIHA 3WDRA 3POHA 4MADA 1VEPA 1HX0A 2CHOA 1UWUA 1NARA 1PZ3A 2JFEX 3PTMA 2D24A 2DEPA 3FN9A 2VNCA 1H3GA 4C7DA 4M56A 4WK9A 4CCDA 3MUIA 1JF5A 1MW3A 3HU7A 5A95A 2WPGA 3ZJ6A 1W3LA 1MFVA 1J0IA 2NT0A 1B31A 4YN5A 4GKLA 3L4YA 3G6MA 4HU0A 1UQZA 2ZX5A 4UQAA 3W25A 3NCOA 1QI2A 1VFUA 5ABGA 2YJQA 4WF7A 3OBAA 3LPGA 4NI3A 1LG2A 4F9DA 2XG9A 1E9LA 3EMCA 5CPQA 5I6SA 1KGXA 4PMUA 3AXIA 2WYSA 3AOFA 1JL8A 2YLLA 4DWSC 3LPPA 3VGBA 2BS9A 3W82A 1ISZA 3CLWA 3AS3A 4JFWA 1MQQA 2ZUTA 4B9ZA 1R8LA 2XIIA 2VUYA 3GH4A 4P8VA 1JDDA 2Q8XA 1H0GA 5FKYA 3WDHA 2ZXQA 2ZE0A 4MB1A 3BSGA 1IT0A 3WF4A 3PZTA 4DUWA 2WHJA 1H09A 2CERA 1OB0A 1VFOA 1DWHM 5FIPA 4PTWA 2WHMA 1XH1A 1KWKA 1W1TA 2J7GA 3KL3A 5LA0A 2YA0A 2VI0A 3WIJA 4WKFA 4YPJA 2DSWA 4ATLA 2ZXBA 3MKKA 1W1VA 3TA9A 1B3YA 1F4AA 2GJRA 2WWCA 3AMLA 1JYVA 1OT2A 4UR9A 3F5KA 3CZJA 1J10A 3CHCA 1XYFA 1JYWA 5CPSA 3ARQA 4Z2GA 1UOKA 1CXFA 4R5EA 4E8DA 3WN6A 1FP8A 4AZBA 1UD5A 2VURA 2V5CA 2NSXA 3SUSA 1WNOA 4AD2A 4BA0A 3BH4A 4BQ3A 4JFTA 2XM2A 2WHLA 1G0CA 5CGMA 1RP9A 2E8YA 3GTNA 2PF0A 3FAWA 3W28A 5CSUA 2GFTA 1D3CA 3GXIA 5GPRA 3QOMA 1C7SA 2X1IA 1TVNA 1C3FA 2EQDA 5A6JA 1UR8A 1QOXA 4XZWA 1E6XM 3MMWA 3WH9A 5M5DA 2DSVA 1PPIA 4U5IA 4CD6A 1VEMA 4WJXA 2VR5A 4F66A 1H4PA 3AHXA 4OKDA 4U5KA 1V08A 3RJXA 2CNCA 3VNZA 4M1RA 4KWUA 3CZKA 3SCUA 1XD0A 3L4TA 3W26A 3IANA 4Q22A 1MWOA 4UOZA 1OIMA 1UR4A 1M03A 6CGTA 4EKJA 4GI6A 2D23A 2W63A 3W0KA 1WCGA 3IJ7A 3F5JA 2ZX8A 2BY2A 4HOWA 4WSKA 3ZOAA 1RH9A 4UNIA 1WKYA 2GDVA 3VGFA 1GQLA 2ZXDA 1OT1A 3RMEA 1MYRA 1E6ZA 3QHOA 1R86A 3AXXA 4BQ4A 1E4IA 2BHUA 4JAWA 3ARZA 1JG9A 1V03A 1EDGA 1GQJA 1UWQA 2EBNA 3N04A 3MUAA 2OSWA 3OZOA 5BWFA 1FH7A 3CUGA 5CGTA 4UQDA 2VCAA 4AD1A 1GOOA 4W84A 3ZR5A 5GNXA 5D9MA 3BAIA 1V0LA 1UWRA 2XFFA 1MXDA 3W4RA 1PEZA 1XH0A 4WKAA 5AC4A 1CGVA 4ACZB 5A8NA 2CBIA 3WQWA 3CUHA 4FK9A 1G5AA 3WDIA 4U2ZA 1JZ2A 2DSUA 1E6SM 2DIJA 4BQ2A 2EPMX 2VTFA 3ZO9A 2BY3A 4CU8A 2DIEA 2WMGA 2VRJA 4HU8A 4W93A 3BXWA 2ZUUA 2D20A 5EMYA 1EA9C 1DWJM 3FW6A 2WSPA 1JZ5A 1BG4A 4AZ5A 3SUUA 1X6LA 2G4FA 2GDUA 3BMVA 2XUCA 1FHLA 1W2VA 3AMCA 1CBGA 3AFBA 2CETA 5DFAA 4J3SA 5A6BA 4UFJA 3WQ4A 4MB3A 1EOKA 4DWSB 5BRQA 2W62A 4P8UA 3GXDA 1US2A 2Y4SA 1LWJA 2BY0A 1TA3B 4JFVA 4KGLA 4CUCA 2V5DA 3PZUA 4C7GA 1BAGA 2JEPA 1LLOA 3RM4A 1W3KA 1SMDA 2ZX6A 1TVPA 4JCLA 4AZGA 1XYZA 5A8OA 3O6AA 1ESWA 2W91A 1YQ2A 2VZOA 3GBDA 4ZXLA 2BHZA 1E3ZA 5LA1A 4AD3A 4MJ2A 1UG6A 2D22A 1LJYA 3T08A 3WQ5A 3I3DA 4DUXA 3K4AA 4GXPA 2UY5A 2VX4A 3AHZA 3VIOA 4OOUA 3WEMA 8CGTA 3VGHA 1NP2A 3UETA 1SFSA 3AZRA 3MSDA 1YHTA 4PMVA 3VIMA 1GOIA 3CTTA 7A3HA 4UQ9A 4LYPA 4UTFA 4UQCA 3KL5A 4IM4A 3WDJA 3ARWA 1V3MA 1CNVA 1HJSA 1OD0A 1XSIA 2EPNA 3WQVA 1ISWA 3WH7A 1E43A 1FH8A 2NW0A 7TAAA 5I79A 4AXNA 4B3KA 1UQYA 5D9OA 4S3JA 3ZSSA 3WNPA 4AD0A 3AS1A 3VMNA 4ACZA 3K8KA 3W53A 4AZ6A 3CZEA 3WENA 2YLAA 1V3HA 5TD4A 1BYBA 1V3LA 1UKOA 1WB0A 3RILA 2XIBA 5A1AA 2DQXA 2QHAA 1PX4A 3UG3A 1PIGA 5DT5A 4ZE4A 4D6FA 1BTCA 5JBEA 5CLWA 2FGZA 4N0RA 2ZX7A 4NF7A 4QAWA 4A3HA 1N82A 3K4DA 4JFSA 1XV8A 5GNZA 3LPFA 2CESA 1GVIA 3B9DA 3TTQA 3CZ8A 1EQPA 3WEZA 3AHVA 1J0KA 3F4VA 2CXGA 1A3HA 3GXMA 5A6SA 1K9EA 2VR4A 4PCTA 4DWSA 4HMEA 5BXSA 4PSRA 3NSNA 4UFMA 1CDGA 4BF7A 3LMYA 2YOCA 2D0HA 3NUKA 4HPGA 3N15A 4KRTA 1VRXA 2WMIB 1EHNA 4P8XA 1E56A 3EDEA 3PZOA 1R7OA 5A8QA 4HZ7A 2ZICA 1XSKA 2WWDA 1W2PA 3CHEA 2YBTA 3HMCA 1DEDA 1NQ6A 1K6AA 1W9UA 3BAJA 4B15A 1V3IA 1E73M 2WKGA 5BRPA 1QNSA 1E6NA 5AC5A 1E55A 1ZU8A 3L4XA 3BAYA 1H11A 5ECUA 2GK1A 3ZT6A 3VIJA 2J75A 1B1YA 1ISVA 4AZCB 2XYLA 2DDXA 3VTRA 4TUFA 3BSHA 3PN8A 3T2QA 3UR7A 1FA2A 3GXFA 1J0ZA 5EFFA 4PTXA 6A3HA 1MW2A 2X05A 2JE8A 3U57A 2DT0A 2VCCA 4W5UA 1X1NA 5FL1A 1XC6A 4JL2A 2ZUVA 1JYNA 1QI4A 3WKZA 2PB1A 3ARYA 2ZXAA 3PZGA 4J3UA 5E0FA 5KEZA 1HL8A 1BGGA 6TAAA 1UWIA 4TOQA 4MDOA 2J25A 2YBUA 2E3ZA 3MSGA 1P6WA 1UHVA 4OBSA 3VVGA 3POCA 1WZKA 3N9KA 3BAXA 3PZMA 1WDQA 2VCBA 4AEFA 1WZLA
chains in the Genus database with same CATH superfamily
4RJEA 2W0UA 1ZBVA 4BEQA 4A05A 2PAJA 4Q4PA 5HXMA 2XINA 4MJ4A 5GQBA 3MO7A 3B0VC 1O5RA 1N8WA 4CU6A 3KDOA 3G0XA 1OC6A 2QPUA 2EJ1A 3JR2A 3F03K 4AMCA 1OFAA 4Z2LA 1DIEA 4CN4A 1W3JA 4LYKA 4XAGA 2D3NA 2O7SA 1KV5A 2NSOA 1ZB5A 1ZJIA 1AL7A 4BFAA 1NDWA 1QNQA 3VOJA 1M53A 4JKMA 1XLEA 4MWAB 1K7FA 1JCNA 1O95A 3UZWA 1GG1A 1LOQA 1ZFJA 1K03A 2FGBA 1E9IA 1QASA 2B0MA 2QV4A 7PTDA 1GVOA 3DGRA 4QSFA 3TNBA 4OUEA 1BYAA 2EKGA 1UR1A 5I77A 3CL6A 1F07A 1NOWA 2ZRYA 4HCHA 4U28A 4DN1A 1YNQA 1VRDA 4E3VA 2WMIA 2QJMA 1JI1A 5CJMA 3UG5A 2D3LA 3EA1A 1UUOA 4AX7A 4LRSA 4DAIA 3L5LA 1RA0A 3L5MA 1OYAA 2IXVA 1DWIM 3DOPA 4PGLA 1XJBA 1VBGA 4XV0A 4NG3A 1VPXA 2R9RA 3Q67A 4Q8QA 1HO4A 5CZKA 2Z0IA 2IQ0A 4AVNA 1GPFA 2I56A 2QMJA 1C7TA 2VQUA 3QV9A 1QO5A 1CXHA 4YVPA 1POKA 3O63A 2PD9A 2EJAA 1F2JA 2VENA 4FP1A 4DYKA 3P82A 3T78A 4TTUA 3UT0A 4WRHA 4H83A 3CNYA 2GGIA 3LCGA 5G1YA 2NVDA 5A2AA 1RZMA 2HDJA 2FTWA 4AIBA 4GLEA 4U3AA 5I78A 1AMYA 1GZJA 2XTKA 2BZNA 3G1HA 4E6MA 1A5OC 1LG1A 4O4VA 1OJXA 3NQ7A 4Q4QA 4J2MA 2Y2WA 4D6EA 3G18A 5I2UA 2WZIA 3H6OA 5DXYA 2WJEA 3QR1A 1ONWA 4PTDA 5K4ZA 4IPNB 2DP3A 3KLKA 1ZP4A 1YLVA 1EYEA 2VRQA 1BWLA 2DSKA 5FESA 2RGMA 2A7NA 2OJPA 3LENA 5FSDC 3C61A 1TWWA 1EJUC 2XN2A 1Q6FA 1YDYA 5EMKA 4FLOA 3IS4A 4NRSA 1BG9A 5C55A 1W6TA 2Q8LA 5IBXA 3OGSA 1JPIA 3IK2A 4LUYA 1UWSA 2VFFA 2Q3OA 3MCOA 3MWCA 2DH2A 4PB5A 1C93A 3C2RA 4U2YA 5D2XA 1HT6A 3AHTA 3MQTA 1FHDA 5BXRA 3B4UA 3RXZA 4IPPA 4H3DA 3ZVHA 4DO4A 3DFSA 2AKZA 3DBNA 4IFRA 4LJ3A 2VZSA 1P7TA 2C8NA 2WOQA 3NSXA 2HISA 1WAUA 3T81A 3JZEA 4Q4MA 1DJIA 3H23A 3TOYA 3TU9A 2PC8A 1PIFA 1QK2A 4PUKA 1W1PA 5AN7A 3E0IA 3UY7A 1A3XA 1GVYA 2J47A 3MI6A 1W56A 2NQZA 4KF1A 1DJYA 1ADSA 1WUFA 2ZZ1A 4A4AA 3WJXA 3SCRA 5IDIA 3WEOA 3WK2A 1RQBA 2PLMA 4DJFC 4AIOA 2BVYA 1S2AA 4CNTA 3CIXA 1LRTA 3UPWA 1FDZA 1B0IA 3TSBA 3C2EA 1S39A 4G1NA 1QDSA 3SN1A 3HGSA 2TYSA 2YPIA 1W1YA 4ZGYA 5I7GA 4AEEA 3VD4A 2PP1A 5A69A 3IRDA 5GJPA 2HE8A 3DYMA 1W32A 3N25A 2CLOA 4ATDA 4QG8A 1G7UA 3LCLA 5I24A 2PEVA 4HZ6A 3ZS4A 1CECA 4GIAA 2RUSA 4Q3MA 3EWCA 2AMGA 4J5NA 2O9OA 3KE0A 4LY4A 3KAOA 1D7FA 2JIWA 1JF6A 3DFPA 4KEZA 2VEPA 1EC9A 3VXGA 2ON3A 4B5UA 2YCJA 1QHOA 1Y0EA 1O1ZA 4CD7A 1VBUA 4WY0F 1U33A 2WJDA 3PJWA 4JTCA 4C7FA 2C1HA 4KWVA 2QDGA 3WSUA 4QNEA 4FR6A 1TMQA 3TJIA 1GZGA 3BO9A 4N42A 3RR1A 5CG0A 1LL6A 1EF2A 2Y88A 4PRWA 2AAAA 4UMAA 4OBRA 1QATA 4J2PA 3MJMA 3W1NA 3I6TA 3VMPA 4Q8NA 1V7AA 4AB4A 3E5BA 2V3FA 4HMCA 4RKAA 3T4WA 1QOQA 4GVFA 3V7PA 2NQHA 2XH7A 1V6YA 2HBVA 5DANA 2PWUA 2BFGA 2OOFA 4HN4A 4ZEPA 4GQ0A 1US0A 3CL7A 2Y7FA 1V8EA 3P8IA 4NIRA 4F0SA 3VZZA 3WLSA 3BZGA 1G4PA 3AMKA 1QWKA 4O8RA 2JIEA 5JH1A 2FB2A 3G6LA 2VOTA 5LHFA 3HPAA 3V1HA 4RDVA 2FHFA 3ALFA 1R3TA 4J3XA 4UZSA 5FJOA 1V6TA 4K6AA 4GY0A 4IPJA 3VKKA 5DEZA 3RGTA 1W5OA 4XSLA 3FHAA 4LALA 1EX1A 1NP0A 3ITVA 2GJPA 3WMCA 3H55A 4MZYA 3B05A 3DBPA 3QHMA 3FNDA 3DFTA 1ZRQA 1PX3A 1IWPA 2Y5SA 3VGDA 2J7HA 4RPPA 4DYEA 2W66A 4KCTA 1W9DM 4GRSA 1E0XA 3BARA 4RE4A 4AZ7A 5EY5A 2C15A 1CB2A 2AAMA 4WVXA 2OWXA 1EC8A 1FP9A 4JTQA 1KFLA 1PO9A 2ONEA 2EPOA 3NIYA 3DHUA 2I14A 2R1KA 1AL8A 3BSMA 3NFUA 4WLCA 3TW7A 5I0DA 4LW7A 1V79A 4H01A 3WH6A 2ISSA 1ISYA 1E5JA 3UFYA 4QM1A 3UG4A 5D8WA 3JRKA 3QM3A 2OKOA 1AQHA 5F2GA 2HPIA 1OX6A 4HNNA 4MLRA 4XB3A 4QTGA 3H54A 4HNUA 2YDQA 1P48A 2OGJA 4O28A 1FVPA 3O15A 4Q8VA 1C8QA 4E2DA 3P93A 2A4AA 3GAKA 5MKGB 1CT5A 1PVNA 1A5MC 1PS9A 1TCMA 2TPSA 4O1CA 1X97A 1JPHA 5IOBA 2QPSA 1UP2A 2VFHA 4N02A 1ICPA 4PC8A 4UCGA 3LGEA 1B3VA 4ZMGA 2FYMA 4PUWA 5HULA 2GUUA 3TYDA 4HCDA 3S9YA 1I4NA 2B4GA 3ARUA 4E8CA 3TC6A 2W3ZA 3CQHA 3IVTA 3TNOA 2J8GA 5DF0A 1MVYA 5JVLA 2EO7A 4NKCA 1UZ4A 4N7QA 4UTKA 4M8UA 3W7RA 4JTDA 1QVBA 1WA3A 3EDKA 2J6VA 4UUIA 1Q6CA 3KHJA 1EO7A 1B2YA 2CLIA 2INZA 1L0PA 4A3YA 2WVTA 1P4CA 2PDFA 5D05A 4GPNA 4D6GA 3AC0A 2Y6ZA 1KFJA 4G56A 4Q33A 3A47A 1KO0A 3K1DA 4H7VA 4WSHA 3LCIA 2ZE3A 1E4NA 5AY7A 2MANA 1IEIA 1J96A 4Z2JA 5I3GA 5H2ZA 5JXQA 2Y8VA 3N1AA 3G0SA 1ZNNA 4KWWA 4HA3A 5GJNA 3R79A 1GKRA 3UWZA 3W70A 3L2LA 3K46A 4HPXA 3NR0A 2FDMA 3CB3A 2ZUSA 3OHIA 4JFUA 1O7AA 5JIWA 5H91A 4A8IA 3W7KA 3W6YA 3B8UA 1XHGA 2XSBA 2UWFA 3PNZA 2PU1A 4Q4RA 1YMYA 2QF8A 3K2GA 4O18A 3OIXA 2E9LA 4L4PA 1IZCA 3GR7A 1JVNA 3OEXA 2WAGA 4PH6A 1TFVA 3S83A 5LYRA 1OGBA 1HUVA 1R3RA 4OT7A 4Q4KA 1JYXA 2WZHA 5D4YA 3VD3A 4ICMA 2WVUA 5ABFB 1QNPA 3P14A 3K30A 1JCYA 2FZ9A 2X7WA 3TKFA 2J74A 3SY8A 2VDGA 2PZ0A 4ML4A 3VGGA 3SRHA 2Y1HA 3NEVA 1KM2A 1OD8A 5A5WA 3KP0A 4QJ3B 4IMEA 2CBJA 2V2CA 1BWVA 4BEUA 4INFA 5F1VA 4EXBA 4E4PA 1JUEA 1L6SA 3GU9A 1JCMP 1F73A 1HP4A 1V3KA 1EQCA 1H1YA 2C16A 1LQ0A 4R9XA 3TONA 4PBEA 1MQPA 1E1CA 3L23A 2Z6JA 3L0NA 4BJHA 4PB3A 3W73A 3M0LA 3NPXA 3VM7A 3K8LA 2P3ZA 3VIPA 5T8GA 1GVRA 2WSQA 2XN0A 5L6UA 2BGSA 1KBBA 2YL5A 3ES7A 4V27A 1XD1A 4LNYA 2CZEA 2V2HA 3A4XA 3KHDA 2W61A 5E5CA 1EWDA 3LLDA 3W29A 4HPHA 5E9AA 1CXEA 3AMDA 1WDSA 2QS8A 1CEOA 3OBEA 3NAVA 1IZJA 1OY0A 1YXCA 4G7FA 4U4MA 3LXBA 1D2KA 5DELA 3GE7A 2PSNA 2XWDA 2VZUA 3RYSA 4FXJA 2VGGA 1MEWA 3NL3A 2ZUWA 3LHWA 1IIHA 4Q8OA 4PTVA 3U7VA 1XSJA 1BSLA 3N2OA 3NZQA 4X2PA 5C5YA 4V28A 5DMYA 1IXOA 1VYSX 4ZQMA 2VGBA 1VLIA 4LC8A 1DJNA 4JGDA 4DF2A 1UA3A 4HZ8A 3WBEA 1ZUAX 3W9ZA 2F6XA 2XIQA 4O54A 2DT2A 3ABRA 2ZUNA 4CVWA 1W9XA 2Z7GA 4ADTA 1KXVA 3EXSA 4IT1A 1A0EA 3LV5A 3U5UA 1JZ7A 4WD0A 4LS0A 2XPKA 2ZZ5A 5BCAA 1YEYA 3NDYA 4M81A 1H2JA 2RJHA 1ISXA 2G3JA 1KBIA 1G01A 4H2HA 2G8ZA 4G7EB 5CC6A 1VS1A 3WF2A 3AHYA 3OA5A 1AH0A 4DF0A 4S3FA 4MYXA 3ONBA 1JPMA 1HJVA 1SZEA 1VGAA 1XIEA 2R14A 1QI0A 3CH9A 3CUJA 3R1ZA 3WNMA 3E74A 1E1EA 3FY1A 2UY3A 4PZVA 3TYZA 1YRRA 3SO7A 1TZZA 1GTEA 2B7PA 2XM1A 3T0BA 2NT1A 3MO4A 3JUGA 3VOGA 4PMZA 1POJA 3IIOA 4PUEA 2X2GA 5EU9A 4Y9MA 2GJXA 4MZ8A 2PWVA 1LT8A 4GE8A 3N6QA 3W1XA 3VC6A 4JIQA 2WSRA 1O5KA 3SY1A 5LNRA 3HV8A 1PX8A 3T05A 1X38A 1Q6DA 3KZSA 4Q6JA 2BGQA 1R6WA 3SFWA 4BWLC 2V68A 2UZ9A 1UZHA 3WL1A 3KCJA 3K1GA 5C9XA 1JXJA 1HL2A 3SDOA 5I3IA 3QSRA 3W22A 3KM8A 3O7UA 3B97A 3QLLA 1FWIC 1O1HA 1X6UA 4WJEA 3EXTA 4UC5A 2W5FA 3NQ2A 2ODOA 3VU2A 5CBIA 1UD4A 1ELSA 3PBGA 4UR7A 1P1XA 4YLWA 3FYOA 1KCKA 3PB0A 1NM9A 1IV8A 2IPJA 2VFIA 1ITCA 1JD7A 2BBFA 1VFFA 3EDFA 4PN2A 2VXNA 4NSBA 3SIZA 1PKYA 4EIVA 4ACYA 1RY8A 3VNYA 2QCNA 1B54A 1R0MA 1VYPX 4N9DA 4A3QA 4CGTA 3VD7A 1RP8A 4JTFA 4HNLA 5AC7A 5REQA 4D1IA 2OWWA 1K4GA 1TPDA 1PKLA 1LLWA 1PDYA 1AW5A 7CGTA 1M01A 4UTJA 1TUXA 3H2NA 5DBTA 1DIDA 2OR2A 1FWNA 2TMDA 1SMAA 2OWCA 5AB3A 1IF2A 2PLKA 4Q32A 3N4AA 5I06A 2GZXA 3A9IA 1TX0A 4RE3A 1E72M 4FZIA 1KXQA 2RAGA 3KTXA 3VZYA 2WVVA 1L6WA 3WUFA 1JDEA 2YYTA 3W7EA 4W5ZA 2WK2A 4B5NA 3FKKA 1I2QA 3RFAA 3GC5A 1HJXA 3OHMB 1JAEA 1SW0A 1O5XA 3UJRA 3S5YA 2A3HA 2WC7A 4AZHA 2AL1A 1JCTA 2IXUA 4US6A 2V2DA 1I8JA 3GH7A 3PK7A 3R6IA 3QZAA 5LKYA 5IDZA 4QFUA 9CGTA 3V0UA 3NYDA 2WBKA 4RNJA 3TYCA 3SW6A 1YX1A 1ZALA 4J3WA 4PUJA 1HJUA 3S42A 2CPUA 4TIMA 2XGIA 4H8VA 1TJRA 4QEHA 1H1NA 3QJAA 3LQLA 1Q6GA 1DWGM 2E1DA 5XINA 3UYIA 2OX1A 2G96A 5CZTA 1A47A 1YDOA 3HZ3A 8A3HA 4QP0A 1WAWA 1FWHC 1OF8A 3TXZA 3N9RA 3E2QA 1E9YB 4LANA 3P60A 5LIWX 4EK7A 3RRAA 2EAWA 2X1RA 3PTKA 2BVTA 2HS6A 2W92A 3VINA 2YZ5A 3OIHA 2ZA1A 2X2YA 4AF0A 4J1OA 4R7WA 1S5MA 3WUEA 1OX4A 3I68A 1VR6A 5MF5A 1OWQA 2AQWA 2R6OA 6XIAA 1C91A 4EXAA 4O12A 1EKOA 4K38A 3UWUA 1KKOA 2ZVRA 2BXYA 3ZT5A 4Q8MA 1MDRA 3GHSA 2FGLA 3IV8A 1CLXA 1E9ZB 4W7UA 4F0HA 1WE5A 1FY6A 1TX2A 1FXPA 4L65A 5FJTA 5PTDA 1K8YA 4RZBA 1B3OA 3MANA 2AOSA 3BK0A 2R1MA 1OCBA 4KPLA 4IIFA 1PZ3A 2D24A 2BX7A 2DEPA 1FWDC 3GTHA 5HA7A 4MSSA 1K02A 2Y63A 1DJXA 4C7DA 1JQVA 2E7FA 1FUYA 1QNVA 4M56A 2C79A 1H7WA 3MUIA 2HWGA 3M7WA 5CEWA 3BDKA 3SN4A 2R1PA 1J0IA 4J4KA 4PCFA 1RCOB 4HGXA 5FJJA 1UW9A 3C56A 5DY2A 3HTWA 3SGUA 3IVSA 1PZ1A 4WDXA 3TX9A 4EPDC 3NCOA 3S5NA 5ABGA 3LPGA 4R53A 4NYUA 1LG2A 4DB7A 2WYSA 3AOFA 1ZLPA 2XSXA 2BS9A 2B81A 4YYCA 4QG9A 1ISZA 4LNCA 3DZ1A 3AS3A 2F6KA 2ZUTA 1K8CA 5HUPA 3GH4A 2ZE0A 4XZMX 3NQBA 3DG6A 3UPMA 2YXGA 3GO2A 4ZO6A 3WLTA 4EPBC 2G0WA 4C65A 4REQA 1H09A 4XVDA 2VEFA 4UTIA 1OB0A 3H26A 1WX0A 2YCEA 2P1FA 1KWKA 3SGGA 4Q8TA 1TV7A 4NP7A 1W5QA 2DSWA 3M0XA 4ATLA 2ZXBA 3EWBX 3TA9A 2D2JA 5DMNA 1F4AA 2WWCA 2ISVA 4X9SA 1OT2A 3SAZA 3MSRA 3BW4A 1J2WA 2Z2UA 4IGMA 1WDWA 3F5KA 1J10A 1S5VA 1XYFA 1OF6A 1JYWA 1MZRA 3DFHA 5FJIA 1UOKA 1CXFA 1XQKA 1EIXA 4HU4A 3R4IA 3LCFA 4IMCA 4BA0A 3OQ8A 4JFTA 1P0NA 4KKXA 4AEOA 3GAYA 5CGMA 4LV4A 3GTNA 2FZDA 3THUA 5CSUA 1TJPA 2VDIA 3H53A 1TVNA 4NX0A 1AJZA 4ICNA 1C3FA 5A6JA 2YYUA 1UR8A 5DXXA 4XZWA 2PDUA 4AVOA 2VR5A 3FFSA 3NZGA 4MKVA 1V08A 2X7VA 2CNCA 2Z2AA 5C9ZA 3GTXA 3WBWA 3C2YA 1SFTA 1XKJA 2C14A 5E1QA 3HV9A 3SCUA 2VM8A 3UCCA 2GWNA 3MYOA 1P0EA 1MWOA 3LNPA 1OK4A 2WPBA 3M0KA 3G5EA 3WLJA 4EKJA 2W63A 3HPFA 3IIPA 4JN8A 5DRCA 2Q71A 1T7LA 4OUIA 4ZR8A 3F5JA 2BY2A 1RH9A 4UNIA 4E5TA 3WK0A 4C6KA 4KEUA 1ZGDA 2GDVA 3O6CA 2ZXDA 1OT1A 5BW6A 1R86A 3AXXA 3DU0A 4PFHA 3UU0A 2E6FA 1JG9A 1V03A 1YNPA 2PODA 4DZ5A 1FWFC 3VAVA 2Z29A 2XGZA 2OQLA 1FCBA 1PHQA 2OSWA 3ZVHB 3CHVA 3BGJA 1WXYA 4UTWC 3CUGA 5CGTA 4UXDA 3ZR5A 5D9MA 2CLHA 4ZL1A 3CYVA 1PEZA 4ACZB 1KTNA 4FK9A 4QS6A 3L67A 1FWSA 1UPPA 1FQ0A 3CU2A 2DIJA 4US5A 1TQXA 1XIIA 1T5AA 3STGA 2ZQ0A 1R2SA 4PB4A 4O14A 3UGVA 3R10A 4W93A 4HU8A 3ZWTA 4OQVA 2R82A 3LSBA 5EMYA 1XXXA 2EGZA 4I5XA 1JPDX 1BG4A 2VD9A 5HAOA 1MXSA 1IWAA 1CBGA 2NLIA 5DFAA 4S2CA 3KZPA 2B7OA 4ZB2A 3MA8A 4AG0A 4MB3A 1EOKA 2GQAA 4JOMA 1Z8AA 1LBLA 4CUCA 4MWAC 3PZUA 1XFCA 1RCXB 2VD8A 3DX5A 1LLOA 3RM4A 1W3KA 1SMDA 2MNRA 4MKSA 4DI8A 2IKIA 5HMFA 2FFCA 1XYZA 3O6AA 4EOUA 1ESWA 4PULA 4ZXLA 2ZRZA 4AD3A 2H9AB 2BTMA 3BOLA 2V67A 5AHFA 1XIHA 2ISWA 5HK4A 3AHZA 1A50A 1PSCA 4OOUA 4NZ4A 2AKMA 1F8MA 4ZZ9A 3IACA 1SFSA 3AZRA 3MSDA 5G1TA 4MHBA 2E09A 1RBAA 1QUMA 4PBFA 3WDJA 1V5XA 1TJ0A 3W72A 3E9AA 4JTHA 2EPNA 3ATYA 4FNUA 2IPFA 4B91A 4AXNA 3AS1A 3W1QA 3VMNA 1MI3A 3HM7A 4AHPA 3NVTA 3R12A 3GX9A 5AVHA 3W02A 2IKJA 1M5WA 4I9JA 5TD4A 1V3LA 3B8TA 2OOGA 2D2GA 2XIBA 4HSOA 1P43A 1RK5A 1PIGA 3TWAA 1BTCA 1T96A 4N0RA 5LNUA 1FX6A 4DJFD 3PTDA 3JZUA 2G50A 1WDDA 3QBUA 5GNZA 4JIPA 4GNVA 1LBMA 1OZMA 3LPFA 2I9EA 1GVIA 4KIEA 3CZ8A 3KVJA 3NL2A 1XDLA 3E0FA 4LCRA 2X0SA 3W1MA 3GXMA 4I6VA 4N9EA 4XTIA 3T1GA 1RJRA 4JX6A 5BXSA 4PSRA 2PDHA 4HYWA 3GTIA 4BF7A 2YOCA 2D0HA 4AY7A 4DAFA 3G1SA 3GKAA 1VRXA 1D8WA 1R7OA 1XSKA 1O60A 3CLMA 4I90A 3BVJA 3EA2A 3CHEA 3W1LA 1NQ6A 4GUFA 4B15A 1TKKA 1LP6A 2XN1A 1VPQA 1E73M 4TO8A 2YB1A 3W2UA 1E55A 3MKVA 4RE0A 2CXEA 5ECUA 4AWTA 2QCCA 3ZT6A 4D2JA 1KM4A 2J75A 1XLJA 1EBGA 4I6KA 4W9TA 2XYLA 3U2CA 4TUFA 2C18A 4RLIA 2V81A 3FVDA 5HATA 2Y62A 1TTPA 1MW2A 2X05A 3T42A 1WXZA 4W5UA 4X2RA 2ZUVA 1KFCA 2QJGA 4DXVA 2PB1A 3BTNA 4F0MA 1UWIA 1PIIA 4TOQA 2ZKMX 4MDOA 4M0XA 3G1XA 4O1BA 1FWWA 4OBTA 3VVGA 3D46A 1WZKA 2X30A 4OVXA 1BKSA 4O0QA 4MAZA 3GY1A 1L6YA 1VPYA 3H70A 6XIMA 4JQ3A 2OEKA 5ABTA 3W6MA 4S3KA 1NFPA 2PDQA 4C6IA 1MRAA 2PUZA 3VD5A 1UBSA 1U5HA 1XUUA 4CNOA 1R47A 1VFSA 1L8NA 1WBJA 2CBUA 2J78A 5JH2A 4FXRA 2O9TA 2GGEA 3MP5A 1UJPA 5IBXC 3UYCA 4GVIA 5B80A 2BLEA 4XD3A 4NUWA 1IE7C 1XLIA 5LA2A 3F4CA 3LSCA 1E71M 1JI2A 2WC3A 3XISA 3G1RA 1RJPA 4QLJA 1RQEA 3ERPA 4YS1A 2A3AA 4F2TA 1TVLA 2D1ZA 2X09A 3LCHA 3ZR6A 4QLLA 4DBSA 4XSMA 2YR1A 2OEJA 5HWMA 1ZS2A 4WKHA 3VO0A 4Z1AA 1FHVA 1H5YA 3SCPA 2ZTKA 3FEMA 4H04A 4L1XA 1R9ZA 1AW1A 3TYEA 1KFEA 2G5WA 3W6LA 2PBGA 3N73A 1WDPA 1OCQA 3HG5A 3MCMA 4A29A 1VEOA 4HA0A 1U2YA 2XVPA 4MB4A 3URAA 3FA3A 3Q45A 1YKWA 4XKYA 3TN5A 4GIYA 2DJXA 1FCVA 4NNCA 4ML9A 2DUXA 3M6DA 3QMSA 2Y5JA 4DJDC 1RBOB 1W3TA 3T4CA 5HPOA 3EWUA 4TX9A 1KCXA 3C2OA 2QR6A 3G22A 3G1DA 1VJSA 3GNPA 3ITCA 2J7EA 3A3HA 1WP6A 3B0XA 1ZPTA 3ARTA 1ONEA 5DRIA 4GYJA 3WUBA 1R46A 3D3FA 1TSIA 2X42A 3F2CA 5AC8A 1RVKA 4P5UA 2JF7A 1HNYA 4H6QA 5IXEA 3ZQ9A 5J04A 1SO3A 4WCJA 3HG3A 1CTNA 3L2MA 2RHGA 1TQJA 5HBFA 4S3GA 3B06A 1A5AA 3AWNA 3RNDA 4PL2A 5C9RA 3B9AA 4FX6M 4B3LA 3GU2A 3UR8A 5I02A 3QF0A 4EANA 3BL3A 1H1ZA 2VEKA 2J27A 1N7KA 2NUYA 3CB8A 4GO8A 1EIBA 1JUKA 1UP3A 3S8HA 3A13A 5BZAA 4H9TA 4K8EA 4W86A 4K37A 1UC5A 4NAEB 4B16A 4HJWA 3N3TA 4PTMA 3ZYZA 1VENA 3GG0A 1IGSA 3UCDA 1UH2A 2C1GA 3SCSA 4QDWA 1TR1A 1EH9A 4KW2A 3G1VA 1Q4WA 1QPRA 1K1DA 3OBKA 4JIHA 2OFJA 1H7RA 5F2IA 4JIEA 4LEFA 3NO3A 2Z7KA 3CL8A 3HIJA 1W1IE 3ABZA 2XFRA 3LI1A 3TK7A 2GQ3A 3VNKA 5TNVA 3O6YX 1RK6A 3TMQA 2FH8A 1RY0A 3B40A 1H0IA 4QEEA 1UB3A 1C90A 4F9JA 3AROA 3LG3A 2YCKX 4IPLA 3NURA 4B4HA 2XWEA 4PMNA 3ABXA 2Z4GA 3APGA 1YYAA 1KW1A 1HG3A 1FKWA 3GD6A 3PY2A 2DH3A 4CKQA 1D3HA 4UTTA 3W1AA 2X40A 3L2IA 1F6PA 2VMFA 4KQNA 3N12A 2X0HA 5AYIA 1XCXA 1TPC1 3FSUA 4EE9A 4GY7A 2BVWA 3WJWA 2DY3A 5LSMA 3IVUA 5EB8A 1GCYA 1AQMA 2Y5EA 2V3GA 4WJ8A 3SN0A 1XBXA 4DJEA 3LUTA 4DNMA 1US3A 4YCOA 1DE6A 2PCEA 1ZBCA 3PVFA 3P80A 3CUXA 4GXMA 4HQVA 3ZT7A 2ZX9A 3AXMA 4WR3A 5I3DA 4MZ1A 1J01A 1ZAJA 3P5ZA 3WLOA 1H50A 1ZSXA 5IHRA 4MWAA 5EMUA 4IX0A 2UV8G 5CAHA 1S5NA 1M68A 4TR9A 2PDBA 1J11A 1PBGA 1VBRA 1HO1A 3ANUA 3WQFA 1S1PA 3G0UA 4C1KA 3M43A 5K9DA 2HTMA 4IGSA 2L5HA 1HKMA 2JF6A 2O0TA 2YA2A 3B0UX 2DGAA 1B4EA 3UXKA 4BI7A 3P0XA 8TIMA 4CQCA 1LRQA 3AYSA 3PZVA 3QFWA 1B3WA 4L4LA 3L4VA 2O55A 2ZVIA 3BOXA 4AZCA 4QXIA 2WC4A 4GUIA 1Q2SA 1EOMA 4JQ4A 4QE1A 3TN6A 3PZQA 4Q7NA 1SW7A 1AUSL 2QYGA 1TWDA 5AHMA 1JZ8A 3QLDA 5E09A 2I57A 2FMNA 3T9PA 2QV5A 1B4KA 2F38A 4BR1A 3UW6A 4XZIA 1GVSA 4Y9AA 1J18A 4R9OA 3NQDA 3BGGA 3M64A 4L1WA 1I2OA 4NJIA 3LHVA 4J3VA 3VDCA 4LY8A 4H8NA 5XIAA 2W27A 4ZE5A 2QCFA 1CGTA 1U1UA 4KRZA 3CWOX 2GGGA 4A22A 1UMYA 4UB9A 3CH0A 4XO7A 1AQFA 4QJ1A 3TUUA 3GBEA 3MS8A 3MBFA 3VOCA 3RO8A 2E9BA 3MV11 3DESA 3RO6A 3QYSA 3L7RA 3S2CA 1AK5A 2EXOA 3G24A 3RN6A 4GINA 2A7RA 1KBKA 4HK6A 5D9PA 1W37A 1D9EA 3EDDA 3OG3A 1YIXA 3OB8A 4HOZA 1Z6KA 3AYVA 4ILSA 1E6PA 2XVNA 3FIGA 4CLMA 1OG0A 3QQWA 4UBPC 3URBA 1UKTA 1XYBA 3M5YA 2PDLA 3CC1A 5KETA 3U2OA 3UR5A 2ZZ7A 1BWKA 4U33A 5U4NA 2D73A 3T2OA 1TPB1 3QVQA 1XLLA 3TQKA 3S6TA 4DY1A 1CLVA 3KX6A 5CG7A 1FWGC 1QPKA 4IH3A 3DYOA 3UJ2A 4NY2A 1S2TA 3W7PA 1HKKA 4NASA 4Y7EA 1SR9A 3N29A 4XD4A 1G94A 1ECEA 1TPUA 2QCEA 4Q7BA 2B7QA 3UJFA 3GHUA 4X22A 3EPOA 4C6QA 3TR2A 4MWAD 1FDYA 3KL0A 2W4XA 4E4FA 1ITQA 5EBUA 2PP3A 4JPGA 1QTWA 4Z1YA 2AQOA 4GGBA 3CHDA 1VHNA 2HV5A 1H7PA 2ZZ6A 3TQPA 1T6MA 3BW3A 4GUHA 4DZIA 3N9SA 1BRLA 1EDQA 1DE5A 1AJ2A 1VJZA 2PMQA 1O4UA 4M5PA 3QOKA 1I0DA 3JVAA 1J0JA 4K7VA 2W9MA 4AISA 3L4ZA 1XQLA 1UKSA 5I3FA 2WLZA 3R5EA 4JY9A 2FPTA 3WD3A 1UZDA 4GGHA 1YDVA 2WHKA 3W7QA 3T07A 1Y7VA 3BLDA 1VJIA 1H41A 2E40A 3ANVA 1JZ6A 1YBQA 2PZNA 2VOMA 1BF2A 5D2WA 1GWJA 4YIWA 5I03A 1OFOA 1LBFA 1VFMA 2GVJA 2O7QA 4NZCA 1B30A 1KCLA 1RVGA 4AYSA 1QI5A 3EEGA 3EWWA 1EO5A 1F9CA 2VVNA 2ZZ2A 4A35A 3CUZA 5C2XA 3AIWA 2DZVA 3EMQA 4FX8A 3MHFA 1Q63A 2A3CA 2J79A 5HNNA 1J0HA 3DGBA 4OV4A 1W3HA 3P7YA 3WF1A 1JGIA 3OLIA 4S3CA 1ZCCA 3FK4A 1EP3A 1KGUA 3NM3A 9XIMA 5HPCA 1GNXA 4TV6A 3H8AA 3THDA 1RD6A 4H41A 4U31A 4KCVA 1HKJA 2D2OA 2Y7EA 1SZRA 2DU2A 3AIQA 4J27A 4V1YA 1L6GA 3AIRA 1SO4A 4HA4A 5I00A 1DHKA 4GI9A 4P2VA 3CS2A 4FB7A 3BPWA 1GOKA 3LPOA 4U3CA 4C1NA 4A8RA 2ACQA 1YNYA 3GZ3A 4LAKA 5C2CA 4MY8A 3SCVA 2UY2A 3UGRA 2UY4A 3T09A 1JDFA 1GOQA 1E40A 1EA0A 4LF2A 1B57A 1JAKA 4HTBA 5E6YA 5AHEA 4AU0A 1J6PA 2FB3A 1BGAA 1HQTA 3NQ8A 3GWQA 4Z1DA 1JCLA 4ZTYA 3RHGA 1FWAC 1PAMA 1PZ2A 1UR2A 3M6YA 4EP8C 1CGWA 4XBJA 1HKVA 4OZOA 2BY1A 1KM0A 3WNNA 3TQVA 3GXPA 4I7UA 2NWRA 1SR0A 3WH5A 3E5PA 1GPWA 1GQIA 4O16A 4AW7A 4DWDA 4EAYA 4JNMA 1QO2A 3W7IA 1QR7A 4C6OA 5DX7A 5TIMA 1A5BA 3GNNA 4PUNA 1SFJA 2NVCA 2CBVA 4WHBA 4I9AA 4CD4A 3WDPP 2PWHA 4QAIA 3PFRA 1WDRA 2VDHA 1PKNA 4PMDA 3W7HA 1EC7A 3DHDA 3ICJA 2ZWYA 4RL3A 1UROA 1DXFA 1IEVA 4P7RA 2CHNA 3OG2A 3V0SA 4QBXA 3WDQA 3SCWA 4ZQOA 2YKKA 2JQXA 4O53A 2GOUA 1UR9A 3S1VA 2NV9A 3MSYA 1VIWA 1QNOA 4GQBA 3W1TA 5EYWA 3Q58A 3FA4A 3WFLA 4DNHA 3SJ3A 1BF6A 5FEZA 4O50A 1KB3A 2WQPA 4LF1A 2B31A 4P7NA 2BXZA 1UMLA 4I3GA 2QLYA 2YFOA 4AWEA 3TZNA 4YHEA 2WCSA 2CKRA 1MW1A 1RBLA 3NSMA 3V1PA 2Z1VA 3TCEA 7REQB 2BVDA 2PI6A 1AH3A 4MF4A 2ZFAA 1T41A 3RLVA 2WZEA 4QCFA 2Z1SA 2E6DA 3H7VA 4D6IA 3I7QA 4N2YA 4CD8A 1TPEA 4Y8FA 3NO5A 3MMTA 3EBVA 3TTYA 3WJZA 3AWOA 5BROA 4TVDA 3SCOA 2WJFA 3MY9A 4JTSA 5JBDA 3EX3A 2Q01A 4G1KA 2OEMA 3RITA 1V0KA 4P61A 2GVEA 5D2YA 1UUQA 2DSZA 1C92A 2GDQA 4YU1A 1S2UA 3DHPA 1RLDA 3R89A 1IGWA 3V5OA 4OOZA 3KBJA 3VOFA 4N6FA 4ROQA 1Z9AA 1GK8A 4JZ5A 3H4XA 3TN3A 2VO5A 2VKZG 2QF7A 3UNDA 3ARVA 3PR2A 2NLYA 4MNMA 3WQOA 5F7UA 1JUBA 2CLFA 3KS5A 1NSJA 5HDRA 3BLLA 3DG7A 3TWBA 1HJQA 2CEQA 3ITLA 4PODA 4YVVA 1E3XA 1IEXA 1RAKA 1IWBA 3KTSA 4LAUA 4XIAA 1K9TA 3QZ6A 3OQEA 3ZMRA 1JIBA 4H9ZA 2QUUA 4IICA 5JBFA 4MPQA 3W3OA 3C0QA 3PS7A 4GCXA 3GG1A 3R8RA 3DHFA 3CO4A 3HMJG 3S2JA 5M1TA 2C1IA 3WH8A 2QAPA 3MVIA 2BOFX 4WDWA 4JY8A 4KH2A 2J7CA 5EL1A 5K3VA 4WEVX 3VKJA 1E0TA 2PF8A 4Z1BA 4W7WA 2HNHA 3VGEA 3CXOA 1R3YA 4ALDA 4EWND 1DHPA 3UESA 1XW8A 4O13A 2H3BA 3DFNA 2TODA 1Z89A 5FF4A 1UP0A 2CLPA 3IAPA 3RLUA 3V0TA 1XRVA 4KS0A 5D04C 2CWNA 2XZ9A 3RPDA 4HNCA 3R7MA 3A4WA 3ZJ8A 2VC7A 1XYLA 1DYSA 1CGYA 1RPKA 1NFBA 1TPVA 3OW1A 2O4MA 3L21A 3EB2A 3OGVA 4E2VA 3PBYA 4Y6GA 3BV7A 5EBAA 4CNSA 4XG1A 3UVIA 3SSJA 2W67A 3ITGA 3T0DA 4XAYA 4XAZA 1M6JA 1RHCA 2WMHA 1GOWA 3QKZA 4C1LA 4RNHA 4GQRA 4L80A 1DIKA 4PE8A 3QFEA 1KFBA 4W89A 3MUCA 2Y89A 4GVHA 5AHIA 3FDKA 3FCPA 5I3HA 3CBWA 3EWZA 5I3JA 2BASA 4HT3A 1TJ1A 1V0MA 5A6KA 4LSBA 1P0BA 2G95A 2ZRUA 3FEQA 1KRBC 4Y9PA 5L9FA 3IUHA 3M41A 4M82A 2TAAA 1EHAA 3M07A 1AH4A 5E0KA 3GNDA 1I2RA 3N19B 3IJLA 3WNLA 2FJUB 4KESA 1GW1A 1IZKA 4MFEA 3VA8A 3AMGA 4F0RA 3P84A 3A4AA 1V6WA 3C6CA 4UFIA 3M5ZA 4M51A 1ZCOA 4LYRA 1EJ7L 3IJ8A 4MVAA 2OT1A 1W54A 1Q8AA 3W1RA 4NJGA 4DXXA 1O6IA 3PSVA 3UXLA 1VCGA 1VFHA 3DKLA 3LHZA 1CYGA 3BMWA 4JHOA 3DKJA 3TOPA 1TE1A 3HB9A 2WNWA 1OINA 1ME9A 4A21A 1XBYA 3R0KA 4FOUA 2XFYA 4ZO8A 4BS0A 3LRLA 3KVMA 4LBRA 4Z17A 4GIEA 3C3NA 2OELA 5A3HA 2OZ8A 4IOTA 1TWZA 3VFCA 3G8EA 3EOSA 4UMBA 4L7ZA 2GUYA 4J28A 3GTFA 3BCFA 2VVSA 4O0ZA 4H00A 2E4TA 2O9PA 3UVAA 3LHUA 3ZLFA 2Z25A 4IF2A 1PTAA 5A6TC 2RDWA 2ZUMA 1NTHA 3M0MA 3TYAA 5A6MA 5G4HC 5C54A 3HQ1A 3CGTA 1ODZA 4AZIA 4M7TA 3GVQA 4BKNA 3FJLA 1DWFM 4EAMA 1SM9A 3PUDA 2VQTA 4ADSA 4FO4A 4M6PA 4PCSA 5F1UA 1SZNA 2A3EA 1FFRA 2E1WA 4EPKA 1EGMA 1Q7ZA 3E2SA 4MADA 4ZCWA 1UWUA 1XIDA 3FS2A 2ALDA 3PTMA 2V63A 1MUCA 1XWYA 2PTDA 5D02A 2VNCA 3TA6A 3CK5A 3IJ6A 3TSDA 4CCDA 4LUTA 1OG6A 1MW3A 3CAWA 2XH0A 1F74A 3ZJ6A 3WX7A 1MZHA 4YN5A 3EB4A 4GKLA 1RUSA 4HU0A 4R7OA 3E02A 2ZX5A 1OX5A 3W25A 1ENUA 2IMRA 3KCOA 3OBAA 2PGEA 2HPMA 3BLOA 4KFOA 3EMCA 5I6SA 3AXIA 3D6NA 2YLLA 3LPPA 4Y8EA 3VCCA 3ID7A 2FKPA 5CZSA 2GQ9A 3CLWA 4JFWA 2DZPA 1GTHA 4WOZA 1SJBA 4P8VA 4WX2A 1IT0A 5DBUA 1OCNA 3WF4A 3GQYA 4MLJA 2HBXA 4M7SA 4AMAA 1VFOA 2XFWA 1I9CB 2J9YA 4H7ZA 1PDZA 1T8XA 3W7DA 3UZ5A 2WHMA 2YBVA 4C6EA 1W1TA 3LTYA 4Q6XA 1XDJA 3EWDA 4HN8A 1PV8A 3OJGA 3UBPC 3MI2A 2V8ZA 3MKKA 1W1VA 4E0CA 1B3YA 4DHGA 1OX4B 4JEQA 3UJSA 1DTNA 3AMLA 1QPNA 4M6UA 1VKFA 1EEXA 4HK7A 3NL6A 4UR9A 3CHCA 5EPDA 3DENA 5CPSA 1WKFA 3ARQA 1KBJA 3KRSA 2DZUA 4AZBA 2QCLA 1UD5A 2VURA 4I5UA 3TH6A 4AD2A 4BQ3A 3SB0A 3M0ZA 4UTWA 3QQ0A 1P0DA 3QMTA 5H6HA 2IPGA 1VBHA 1ZQ5A 2OX4A 4MJMA 2GFTA 2H90A 3MVTA 3WJYA 3U3HA 4X61A 1FRBA 2X1TA 3QSTA 1DORA 2POZA 2F6UA 4WOQA 1LROA 4C6DA 4CD6A 4LUTB 2INFA 3GSMA 1GQNA 3AHXA 2A79A 4M1RA 2QUMA 3S3GA 3R13A 3CZKA 3BW2A 3L4TA 3W26A 1C9DA 5F2MA 4XKMA 3U0HA 2PE4A 4UNKA 4PMJA 1UR4A 2ZZ4A 6CGTA 2OCZA 1Z41A 1NIUA 4ZQNA 4AHQA 3A4JA 2GQ8A 3W0KA 1P0KA 3IJ7A 1TRDA 1JRCA 1YPIA 4HHPA 4HOWA 4AUBA 4DELA 1FBAA 3M1ZA 1GQLA 1F3WA 4FALA 2DVUA 3WLQA 3ARZA 1FDJA 4YYFA 5LIUX 3N04A 1VIZA 5CCZA 3MUAA 3SECA 8XIMA 2ZA3A 3H2MA 2D2HA 3TYBA 3H12A 1V0LA 4IGHA 2XFFA 4PL1A 1MXDA 3GLCA 3E0VA 3FYPA 1XH0A 1WKEA 5BOEA 5A8NA 3B8WA 3WQWA 1G5AA 3C3UA 4GJJA 3REQA 4O1AA 3TV8A 3S9ZA 1BXCA 3BJTA 1E6SM 1Q65A 1EJRC 2EPMX 4UNLA 1V93A 2QDDA 1O66A 1JCJA 5HWJA 3VCRA 4CQ9A 2Q8ZA 2D20A 5LIXX 2WSPA 3SUUA 5CBBA 1GJPA 3AYTA 1FHLA 5D03A 3Q37A 3AFBA 4GVGA 4J3SA 1PYMA 5A6BA 4UFJA 3WQ4A 4JQAA 4POCA 4DWSB 4P8UA 3GXDA 4C5ZA 3A21A 2BY0A 4KGLA 3NQEA 1O5QA 1W3IA 1XPGA 4AC7C 2ZX6A 3GFXA 1TVPA 4GISA 2PDGA 3TJ4A 5D38A 3VABA 5D33A 2W91A 1YQ2A 2QDHA 2VZOA 3GBDA 2BHZA 1E3ZA 5LA1A 4JTTA 1BD0A 4MJ2A 3O3RA 2C91A 2Y61A 3MI3A 2D22A 3I3DA 2CZDA 2HZGA 4LUSA 1F05A 4K36A 4GXPA 3OA3A 1LRNA 2UY5A 5HMSA 3A5VA 1WXJA 8CGTA 1Z48A 4EVZA 3HURA 1K8XA 3D47A 4UTLA 1NP2A 5CKSA 3KOYA 2HVNA 3LHTA 3XINA 5DN1A 2DW6A 3EXRA 4PMVA 3VIMA 4UQ9A 4LYPA 4HB7A 4UTFA 4UQCA 3KL5A 1PKMA 3PG9A 4IL0A 3ARWA 4N9CA 1ISWA 3WH7A 1E43A 1FH8A 3QW4B 1XS2A 2BSLA 4PRTA 4S3JA 3WNPA 2DFAA 3ONCA 3QGKC 3OYZA 1TPH1 4GOAA 3U8GA 4FNSA 3K8KA 3VI2A 2E5DA 3W53A 3CZEA 1V3HA 3DC8A 1WB0A 4LOCA 3RILA 1S3HA 1EJSC 2HMCA 1TV3A 1PX4A 1EFZA 4ZE4A 3U6WA 5K7JA 4FA3A 2XH4A 4L5ZA 2FGZA 1YDNA 3B4YA 3EEZA 2ZX7A 4NF7A 5G2HA 4PUMA 1XV8A 1N55A 4YTUA 2QVNA 2PRLA 1GEQA 2IQDA 2JBMA 3MHUA 3GR4A 3H22A 1R38A 4Q7IA 3F4NA 5DMMA 3EOUA 3TTQA 3TJXA 2CXGA 3G2GA 2DZAA 4GNKB 5A6SA 1K9EA 3BG3A 3OYXA 1J93A 4HMEA 1EP2A 4UFMA 3C0JA 1J8VA 3MP3A 1OFPA 2WZTA 3H7RA 1VZWA 3KW3A 3EDEA 3UZJA 3STCA 2RDUA 5LGXA 2ZC1A 5A8QA 4HZ7A 2WWDA 1ZENA 1NAL1 4CNNA 3HMCA 3M9YA 3RAOA 3G1YA 3N3MA 3HGRA 2OKTA 4DO7A 3LU2A 4RCXA 3PG8A 3M0JA 5EA9A 3AUOA 1O12A 3LBMA 3AXKA 3BSHA 4ROPA 4AVFA 3GXFA 4YTTA 3A3WA 3S1WA 1J0ZA 2R1LA 4A2RA 5I3KA 6A3HA 5BU9A 2JE8A 3PB2A 4XIMA 1OHLA 2RKXA 4HPNA 5C6MA 3WYZA 1RALA 3VE9A 1HGYA 3T55A 1JJKA 4S3BA 3PZGA 4J3UA 3EWYA 1BGGA 6TAAA 1VQTA 3KRUA 1XLMA 3HG2A 4JICA 1W1A1 2QCDA 2E3ZA 4MY1A 1VHCA 1RPXA 4X63A 3POCA 3CAQA 3N9KA 3ZZ1A 2WNQA 2CC0A 4FXFA 3PZMA 2VCBA 1WZLA 3LTSA 1J2BA 3HQPA 1I2PA 3B8DA 2A21A 7REQA 1UJQA 1G67A 3AALA 3UCQA 4X3ZA 4NAFA 3MTWA 1W31A 3R0DA 1Y5WA 1LWIA 3W7LA 2AMXA 1G7VA 1E15A 4YVXA 2OPJA 2XU2A 4QQ3A 1JNDA 3HJEA 3VIKA 3GDBA 4I7WA 5A8PA 4D8AA 1IEQA 2DZXA 5EKYA 3PNUA 4QHRA 3GUGA 3SBFA 4N4QA 5E93A 1XC4A 1JFHA 4C6MA 3UZXA 1K70A 3UXIA 3B9NA 3IPWA 3W7NA 1KM1A 1Z44A 2GVYA 1T40A 3KUMA 2A3BA 1M7PA 4UQEA 1JD9A 2Y24A 2YW4A 2ZRXA 4HJFA 4ERIA 4UTMA 4UFKA 3WQPA 2VHLA 3WBYA 1WV2A 1L2UA 3B3DA 3E6EA 5REQB 3USZA 4RZ5A 4LBUA 1OEPA 4GUGA 1OFRA 4O19A 3DERA 3HF3A 5GVJA 3CHFA 3LRMA 4MWAE 3I7SA 2PGFA 5LNWA 3AIEA 4CEUC 2WMFA 3SURA 1BQGA 2QUVA 3PBVA 4GUJA 5DO8A 3OODA 4IP5A 1YXYA 1V51A 4LH8A 5HQLA 3PPHA 3G1AA 1QNRA 1GKQA 7ENLA 4AD5A 1U1HA 3SCQA 1KTCA 2OYMA 4TX6A 5AYZA 4AY8A 3PBWA 2VGFA 2QIWA 5FAJA 2VZVA 3N2XA 2RFGA 2CZ5A 3AIBA 2PDMA 1W5PA 4JTUA 4L9ZA 5AYYA 3QRHA 3NQAA 5H8MA 3T0AA 3VYLA 2XSAA 3FGCB 3VDGA 4DQWA 4PEEA 5A94A 3CV7A 3SIMA 2C0AA 2IQTA 4IL2A 3DYPA 1YADA 3QV6A 3UA3A 2FZNA 3T40A 4DUOA 1VBJA 4H8HA 1GVQA 5FF0A 1Q8JA 3C52A 2Y8KA 4XX6A 4DBEA 1XRFA 5HOSA 1T8QA 4MUZA 4CCCA 2P0IA 2J24A 4M80A 4EWJA 1HP5A 1TZ9A 1XLFA 1OC7A 4MG4A 3U2EA 5BU6A 3WBXA 1Q7MA 4I8YA 3R11A 2VWSA 2V6AA 5EGRA 3W71A 3TIMA 1GJUA 1UR3M 2CLLA 1CGUA 2F84A 3QPYA 4L1GA 4JEJA 5CC7A 3M4HA 2CZVA 5FACA 1XG3A 1Y5XA 2E8ZA 4HYRA 2OLHA 1IHIA 1HFBA 3TW6A 2X1SA 3P81A 1OM0A 3N2MA 4AAJA 1DKWA 5E70A 3GFZA 2ZRVA 3GDRA 4IMGA 3MPGA 3RCMA 4HZMA 4DZAA 2I1OA 2WVVB 3OLGA 3VCNA 3H7UA 2ATSA 1E1FA 3TLLA 1BQCA 2WM0A 1A5SA 2YFNA 3O0FA 2V5BA 1S2VA 3PWIA 4HIBA 4IIEA 4AQLA 3HPSA 2IS7A 3WQDA 4LV9A 3CIVA 2PDWA 4WZHA 3NQFA 1GW9A 1V0NA 3WLHA 2OVLA 2QEZA 3CMGA 4Y9OA 1AFSA 2ZC8A 3VDHA 3SCTA 4GI8A 4RW3A 3WF0A 4LAZA 4EX4A 1AQ0A 5J8LA 1HVXA 2A5HA 1MMFA 2G37A 4KRUA 1ICSA 3TAOA 4A6GA 1DXEA 4JTIA 3AICA 2C7FA 3UNTA 2O9RA 4C1NB 1H60A 3BMXA 2ATMA 3ZM8A 2NUWA 3CPGA 1ADDA 2CCRA 5G4WA 1F7BA 4RE2A 1EDTA 3KBNA 3NVDA 2VZTA 4PTNA 4UZUA 1X6NA 1IT8A 2KZHA 4GYFA 4DM2A 3B8VA 1A5CA 4LCSA 3GW0A 3MW7A 3RG6A 1S38A 2PDNA 2IUZA 2XZ7A 1KGWA 2DPEA 2Z1XA 1ONRA 3UF9A 2AL2A 2YW3A 3WLNA 2BDQA 1F8IA 1WPCA 2QUNA 3CWHA 2WCAA 2A1YA 1PXGA 1TWSA 1EEPA 3N17A 2VC6A 3ITTA 4E3TA 4JHMA 4JBRA 2E25A 3WY1A 1AA1B 3BG5A 2AL2B 4RR4A 4GABA 3M0VA 3Q4DA 1NFGA 4QGCA 2I5QA 2QXWA 3CAKA 3LLXA 1ICQA 1TR9A 5HJYA 5AZ1A 1NU5A 2HCVA 4GYKA 1C8XA 3SUWA 2C71A 5AYBA 2E68A 1DJZA 5I07A 2E5BA 3WLKX 5IFPA 3ENLA 3F2DA 4UTUA 2V38A 1RXOB 4ATWA 3LD5A 3AIVA 3REQB 1DQUA 2WVSA 3H2EA 2Q02A 3UEQA 1IQ8A 2YCIX 3VIFA 1VLWA 1S5TA 4AHOA 1JRBA 4JIRA 1KC7A 1S2WA 2P5NA 3O0KA 1A3WA 3GIQA 3NO1A 1BPLB 2F8QA 3NL5A 2NQJA 4UFLA 1Q6QA 4FAMA 2PWGA 4DM1A 3AS0A 2FVKA 3DFQA 1ZAIA 3ZJ7A 3N6JA 3ZIZA 4MJZA 1JDAA 3GNRA 1F4HA 2CITA 4RW5A 2P0OA 3AISA 1GJWA 3S5SA 1H49A 3SCNA 2FTYA 3LI0A 3WF3A 4CD5A 4LUJA 5JQ9A 2CU0A 4XUYA 1NDZA 1PB0A 2ICSA 2OZ3A 3FSTA 8XIAA 1JEZA 1W5MA 4US5D 3O2LA 1M65A 1EXBA 2VRKA 1WZMA 3DECA 3EYPA 2GUBA 2IKHA 1QI3A 3P8JA 3AJXA 3PPCA 2I16A 1C8YA 4A8NA 2Z1BA 4C90A 4KGJA 1H61A 1G9HA 3BUVA 3W7CA 5LIKX 3CT7A 4NL1A 4A3UA 3BCJA 3W88A 3IIVA 3HJZA 3UERA 4LVDA 2Y7GA 3I3EA 5AOUA 1UA7A 3A3XA 4LBSA 3OVRA 4WGHA 3SRFA 1H7OA 3WELA 2GYIA 3VD9A 3FOKA 3TW9A 2GGHA 2ZRWA 1VF8A 1ZJAA 2PDCA 1NY1A 2G41A 3J7HA 4FMVA 2NV2A 1JFXA 5HNRA 4GACA 4PA8A 5F4XA 3FKRA 4DBDA 2RDXA 3L65A 3INPA 4C6LA 4L4MA 3V3WA 4DF1A 4IP7A 1GZ1A 5FJUA 1SZFA 4H2CA 1U5JA 5HNTA 2ZCGA 2PPGA 1E6RA 2OYLA 1L6FA 4XKYB 2WSKA 3W86A 4RXFA 1ZJBA 4J3ZA 4R27A 1JDCA 1OC5A 5GNYA 4D8ZA 1SVDA 3NXLA 1TV5A 3PPFA 3EGJA 2PWDA 3KBVA 4LPCA 4GJIA 1FFQA 3UXAA 3W7GA 1U83A 1ZBWA 2WV8A 3NZ1A 3GDTA 3F2BA 2OYKA 1NOUA 1X98A 1XL9A 1W8GA 4F48A 4QG6A 4RV3A 1I1WA 3ZR4A 1HF6A 2YDRA 1YE4A 1HZYA 3AXHA 3OO2A 5D2VA 3DH7A 4W87A 3CWNA 5M03A 3DDMA 3S5ZA 4M29A 3S0CA 1HVQA 2PLCA 3HA1A 1UWTA 3OZMA 2NX3A 1J5SA 3NEHA 1HIZA 1OVDA 4AWSA 3MDUA 2I9UA 4QE5A 1KM6A 1NF0A 1QBAA 3IAQA 1BVZA 1GYLA 4D71A 2HXTA 3PUEA 3AYRA 1K9DA 4KT2A 4NRRA 4AXKA 2ASHA 4H9VA 2WNNA 4HCLA 3O05A 3LM7A 4CN6A 4CU7A 1RQHA 3RU6A 1ZHAA 1PHWA 4HK5A 4F2BA 3KXQA 3S4TA 3B9EA 4K39A 2QCMA 3N2CA 3U4AA 2BV9A 1GHSA 1M3UA 5HJLA 3URQA 3TFXA 3DI0A 2V30A 3LXCA 1KRAC 2Y0FA 1HW6A 3VZXA 3PSWA 3AI0A 1F5ZA 3GUWA 1BVNP 2F7FA 5T91A 4LXFA 4RNFA 2ABBA 4FR1A 1S1RA 4G2DA 1TG7A 1LCOA 5FCZA 5KSWA 3STFA 4L6OA 4IXXA 1F3TA 1EUNA 1CCWB 1DVJA 1W3NA 3LXAA 4WY0B 3UWWA 4O1EA 2P8BA 1BXNA 1GONA 3ARXA 1ITUA 3VM5A 1UZ1A 2O92A 1NEYA 4K1GA 3CQKA 2ZWZA 1GEHA 5D2TA 3TEVA 1KTBA 2YDSA 4KERA 3KVLA 1A5UA 2PTZA 1R3SA 2ACSA 1LTDA 1EZ2A 2ZIDA 1UD6A 4WY0A 1J79A 1SJCA 1YXDA 4V1XA 1M04A 3EKGA 3PBUA 2EEXA 4Q8PA 1X7FA 2PU0A 4B5TA 4GBDA 4MB5A 3II1A 3CPUA 1UYQA 3ABQA 4IX2A 3BLPX 3BJSA 1JZ4A 4HU3A 1SJDA 1K7XA 2J7DA 4K68A 4HHMA 3ME3A 3B03A 3E3HA 2DJLA 4JCMA 2GVGA 1XIGA 4FLSA 4XZNX 1TMHA 4YJ5A 3W2MA 3KVKA 4H8UA 3H4WA 1Q85A 3S1XA 2WQDA 1HJWA 5FI8A 3S2NA 1TRIA 3SADA 1XLCA 2ESCA 4D72A 3BG9A 2A85A 3OP2A 3PJUA 4JXCA 2E77A 4XK2A 4GH1A 4LVFA 5ENLA 3F7JA 2PGWA 4W85A 1S46A 1W8SA 4FLRA 4FF5A 5FEWA 4BWLA 5CSRA 3NWRA 3FV9A 2X1UA 3H2FA 3THAA 3NDZA 2JEQA 5A6LA 2CHRA 4UFHA 3C4UA 5LXXA 2NQ5A 3P2VA 3ALGA 3TP4A 4DBUA 2CLEA 2ZOXA 4NAFB 1F76A 1H5VA 2P53A 2OO6A 4W4QA 4E38A 1A5NC 4GBUA 1EGVA 3NGJA 3P5YA 5HR7A 2ISDA 1CI1A 4PMOA 5I5RA 3SY5A 3TXVA 3CAVA 2PDKA 3G3MA 3ATZA 3QYQA 1E4MM 3RDKA 2QJIA 2Z26A 4RZ6A 2GSJA 2I7GA 1V77A 3L0GA 3MB9A 3LS9A 1UKPA 3TTOA 3ISIX 3ZSTA 2XH2A 3M0YA 1WOBA 3QV8A 4QCEA 1PUDA 4NYYA 4PMQA 4IHCA 3RUBL 4KWSA 3DI1A 4NT0A 1A4LA 4BZYA 1V6VA 2VUNA 2FH6A 2P8CA 4DXKA 1XCWA 4JKLA 5E9XA 3DCPA 1MDLA 3PUOA 3PZNA 4C91A 3EOEA 2YGYA 4QX4A 3SQSA 4L6DA 4Z2KA 2QNEA 4Z2IA 5FEPA 3IGSA 3JW7A 1NWSA 3QN3A 3SJNA 1S2CA 1UBPC 2OMAA 1HTIA 4MGGA 4IIBA 3VMOA 4QIUA 5LNVA 4F79A 5K2ZA 4ERGA 2FJKA 3SSZA 4HYVA 1M1BA 3S1UA 4A8LA 1ODUA 5C8BB 4K1WA 4DI9A 3TJLA 3VKBA 4XAPA 4M19A 1GVEA 3EKZA 5RUBA 1EJXC 3QTPA 1UKQA 4JHZA 3L12A 2Y70A 3GDLA 2Z2BA 2F2HA 1GORA 4DJED 2QAFA 1GQKA 1PYFA 4MTVA 4D1JA 1KWGA 3WLRA 1H7NA 2PWFA 3A23A 6PTDA 1UASA 1LWHA 3M0IA 2DT3A 5CJNA 3SGZA 1HGWA 1WZAA 3BAKA 2A6NA 3KDNA 1FWBC 2EKCA 3SRDA 1M7XA 1VP5A 4LUIA 5FSEC 4ASTA 3NYZA 1H51A 1XBZA 1XR2A 1BSIA 2HVOA 3WUGA 3WZ0E 4IUGA 2E6AA 4GA8A 1TO3A 2R24A 4IFOA 1DIOA 1UD2A 3HN3A 4XO6A 5U7SA 1W9PA 4K7YA 4R33A 3NTYA 1P5BA 3UWYA 4KEVA 1XGZA 4QITA 3VIHA 4DUVA 4WSJA 1LOSA 4AIEA 1EGZA 1ZJHA 5GJMA 4DEFA 2J77A 4OECA 4OFCA 3WD2A 3S1GA 4FLQA 4DWSD 1XFBA 4DO6A 5BOOA 5HR6A 1OBAA 1J12A 5C70A 1TYGA 4GK8A 3P61A 2IKGA 1WOAA