1HF6A

Endoglucanase cel5a from bacillus agaradhaerens in the orthorhombic crystal form in complex with cellotriose
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE B
publication title Direct Experimental Observation of the Hydrogen-Bonding Network of a Glycosidase Along its Reaction Coordinate Revealed by Atomic Resolution Analyses of Endoglucanase Cel5A
pubmed doi rcsb
source organism Bacillus agaradhaerens
total genus 119
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hf6A00
4OOUA 5EMYA 1KXHA 4AD1A 4PTXA 2VCCA 4U5IA 2VTFA 2D1ZA 3WQVA 4E8CA 4AC1X 1GJWA 3NCOA 3BH4A 4CCCA 2NT0A 1EOMA 1O7AA 3MO4A 1B90A 3AIVA 3AHYA 3BGAA 3WBAA 3U57A 3ARTA 3CIVA 1BG9A 3AXIA 4JIEA 2ZWYA 1BG4A 3I3DA 5I79A 1MW2A 4W88A 1KR1A 4D6CA 1E73M 1E15A 5HDRA 3OG2A 5ABGA 2ZUUA 3WN6A 3KEHA 2E8YA 4C7GA 1QNPA 3O9NA 1V0LA 4LYPA 2Q8XA 3ZT7A 4AZ7A 2VT0A 3WF0A 3N12A 4JCLA 3N11A 1FH8A 1W2VA 4WLCA 1KFWA 1W9DM 3NSMA 1JZ5A 4F79A 1XV8A 4MNLA 4AD3A 2EPOA 1MFUA 5AY7A 3ARPA 4AY1A 1ISWA 1UA7A 1ZB5A 3A3HA 5AYIA 1J11A 2A3EA 2YDSA 2WMHA 1ZBVA 3KE0A 1XCXA 3K46A 1TVPA 5D9MA 1W1TA 4QLJA 2FDMA 4UNIA 2CEQA 1VJSA 1R87A 3RJXA 1PIFA 2C8NA 1E5JA 1JZ4A 4JKMA 1C8XA 4PMNA 2D0HA 4PMQA 3KL5A 3WDIA 4ZENA 1E0WA 4OBSA 1GW1A 2WCAA 3O6AA 1B30A 2JEPA 1BSIA 3AIWA 3ARUA 3WUGA 1H09A 2O9OA 1M03A 2BHZA 1Q6CA 5JBDA 3VPLA 3M07A 1VIWA 3CZEA 4HPHA 1UR4A 5KEZA 4MTVA 3ZJ7A 4J3WA 1C8YA 1E72M 2WANA 1GQLA 3PZGA 1NWTA 1FFRA 4GPNA 4XZWA 2F8QA 4S3KA 1IZKA 4GZJA 4H04A 4JHOA 4B3KA 1J0KA 5IFPA 3W0KA 4W84A 2DT0A 4GQRA 3LPFA 4KGLA 3POCA 3VX1A 3BLPX 3VIMA 2GJRA 3WD2A 3SURA 1V0KA 2YA0A 2J7HA 2G8ZA 4KWUA 2C7FA 4QAWA 1UH4A 5CQ1A 4IPNB 3EMCA 1EDTA 2JIWA 4AZCA 3PZTA 3IAQA 5ABFB 1JDDA 2VVNA 4WIWA 4H8VA 1JNEA 4XB3A 3WQ5A 2B31A 2G3MA 4AYSA 1F4AA 4CN1A 3GBDA 4BZYA 3KWXA 3EBVA 4EAMA 4L4OA 1IZJA 1CECA 4FF5A 4JFSA 4IISA 2AAAA 4PUEA 4MNJA 3B8SA 4ZE4A 2PBOA 4Q7NA 4D1JA 4PMOA 1WZKA 4Z2GA 1J01A 2ESCA 4GZIA 3PZ9A 3K1DA 3VDBA 4AZHA 2X0HA 1XSJA 1E4IA 7CGTA 2A3BA 2XUCA 2G3IA 4JFVA 3UEQA 4RE3A 4JFWA 3AMKA 2GJPA 1J0YA 4LYQA 2V5CA 2WCGA 4MDPA 3W27A 3ZJ6A 3GZAA 4CUCA 1HN1A 1J0HA 1U2YA 1WZMA 2DEPA 2DPEA 2QMJA 4TOQA 2J47A 2OWCA 3ZM8A 1PPIA 4GZEA 5BWFA 1OGBA 2G3JA 2PWGA 2PWHA 2UY3A 1WDRA 5JBEA 2YBTA 4ZXLA 2GSJA 2ZUVA 1TUXA 4MB3A 3EMQA 2YL8A 2D0FA 3OB8A 4W86A 5JBFA 3ZT5A 1E6NA 3MUAA 4Z2IA 1GUVA 2XVLA 4TTGA 4Z2KA 1XCWA 1UQYA 4P7OA 1LLOA 1UR1A 3DC0A 5I0DA 2MANA 2CPUA 1V3MA 3SCVA 1R85A 3WL1A 3THCA 3BLKA 3TTSA 4P7QA 3WNMA 1WNOA 4UQBA 4MAZA 1XD1A 2PB1A 4KGJA 2DSZA 2WVSA 3VVGA 3FAXA 1UD4A 3RCNA 1Q6EA 3N9KA 1HJWA 1EIBA 3L4WA 6TAAA 1RPKA 2J8FA 5M03A 3RM8A 1V3IA 1UHVA 4OBRA 1CGXA 3BMWA 1OGGA 4WKAA 1HVXA 1CLXA 2ZUNA 4M8UA 5A8NA 1SMAA 4XV0A 5A2AA 1PEZA 2VR5A 2YA2A 4B9ZA 4TX8A 4HOXA 2J7CA 3CLWA 4J3UA 1FA2A 1R86A 2X8RA 1E5NA 1L8NA 1WE5A 1I75A 2X09A 3AZSA 3A4XA 5D9OA 1JFXA 3VO0A 1W9UA 1GORA 5C71A 1EGZA 1D3CA 3BAIA 3K4DA 3TONA 1E43A 1E70M 1XD0A 2XFYA 1AQMA 4U5KA 3ZMRA 5A95A 1KWGA 2CITA 3F4VA 3WUEA 3GNOA 1XH1A 4W5ZA 3TA9A 4E8DA 2PWFA 1W9BM 1EXPA 1NOFA 5I3DA 1G01A 4BCEA 2JIEA 3GM8A 3VIIA 5A94A 5EBAA 3WNNA 2WWDA 5A1AA 2ZUTA 5A6JA 4HMCA 2A3HA 3M46A 1B3ZA 2G3NA 1CTNA 2V3EA 2VX5A 2FH8A 2WSKA 2BY1A 4F66A 5JIWA 1C7SA 3WQ4A 3NJ3A 1NOUA 2XHYA 1SMDA 2DT2A 3QHNA 1RP8A 4CN4A 1RH9A 1KXVA 2FHBA 4PYSA 4D6EA 5CPQA 5IHSA 5A2CA 1E4NA 1JD9A 4KRTA 2XFFA 3LMYA 4U33A 3SUUA 1UYQA 1MXGA 3VOCA 2X05A 3SCOA 2OYKA 3SCNA 4NI3A 3BCDA 3M7SA 2VRJA 4MNMA 4LGXA 1HXJA 4DWSD 4HA1A 1JYVA 2VCBA 3OLGA 1ODZA 2VZVA 2YIHA 2D3NA 4B15A 1ZU8A 4MNKA 1JI2A 4X0VA 1XH2A 2XPKA 3LPGA 3PTKA 2ZX6A 3FAWA 3ALGA 3PHAA 1GOQA 5C70A 1WB0A 3AS1A 3UG4A 3WBEA 1GOOA 4R27A 1HJSA 4C7FA 1JNDA 1MQRA 4AZ5A 4GI8A 1MFVA 2XVPA 3UR8A 4PBGA 2VQTA 1GNXA 2UY4A 3W53A 2OSXA 5A8MA 2WMKA 1PBGA 3ECQA 1UR9A 3CH9A 1WDQA 2YJQA 1KWKA 1C90A 2A3AA 3OA5A 4LXFA 1ESWA 3WFLA 1KQZA 9CGTA 4W89A 3PN8A 1PJ9A 5BCAA 1OWQA 1QHZA 1H5VA 1V6VA 4AD0A 5D8ZA 4GQQA 1JYXA 5A6BA 2W92A 3WH8A 4U3CA 1FHLA 3PTMA 2J78A 4AMCA 1US3A 1SFSA 2BY3A 3GBEA 4JFTA 2XVNA 2YOCA 4HMDA 2G4FA 1TR1A 4KMQA 3MV11 4V2XA 5HBFA 1R8LA 1V6WA 3ARQA 4PMZA 4WKFA 1AQHA 1BFNA 2ZE0A 1ZBWA 4UFLA 1JF5A 4GXPA 1HJXA 1V6YA 4UQDA 2E8ZA 4AIOA 4UQEA 1JYWA 1B3VA 2WVTA 2BY2A 4AZBA 3ARWA 4EANA 1DWJM 4EE9A 4HZ8A 5DFAA 2WSPA 1CDGA 3VIGA 1NP0A 5CLTA 2BVYA 4DWSA 4AZGA 1DWGM 1HP4A 1C93A 1PX3A 4AZCB 5C8BB 2RGLA 1MYRA 2D2OA 2YLAA 5DF0A 3WELA 1W2PA 2J7DA 4HPGA 1GOKA 1HKIA 1UKQA 2WVUA 1PX4A 1BYAA 2ZXAA 3CUJA 1B1YA 1UR2A 3VDCA 2DQXA 4X9YA 1OINA 1V02A 4W8BA 1JZ2A 1H41A 3PTQA 1UWRA 4AISA 3L4TA 3QR3A 2BVDA 1GQJA 2CBUA 3WF3A 2VJXA 1FFQA 5IFTA 5E9AA 4UFHA 3QHMA 1E3ZA 1QVBA 4M80A 1M7XA 4XZBA 3VINA 3CUGA 1V3JA 3D3AA 1VFFA 4IM4A 1V6XA 4PEEA 1WO2A 3QOMA 3WDQA 1BPLB 1MW3A 1CXIA 1EA9C 5EFDA 3W6LA 1QNOA 2WCSA 2ZX5A 4DWSC 1SR0A 2JEQA 5CLWA 1MW0A 5FOOA 3LPPA 3WSUA 2CIPA 1GOMA 3AJ7A 3MUIA 2WXDM 3A4WA 5FL1A 3ARSA 4A3HA 1CYGA 3JUGA 1J9YA 2WMFA 1GVIA 1VAHA 4HU0A 4OZOA 3RPMA 4CN6A 2WC4A 5JIPA 1CNVA 5LA1A 1R7AA 2VUYA 4JL2A 5I2UA 4GO9A 4HA3A 3GTNA 4OKDA 1WDPA 1BYDA 1XRVA 4RL3A 1ITXA 1UZ4A 1K6AA 1KCLA 4AXNA 1VEPA 3AHVA 1LL4A 3J7HA 2J7EA 2WZIA 5FIPA 1E6SM 4P8UA 1G94A 1TE1A 3U5YA 2J4GA 4D1IA 4M1RA 1GOWA 4JCMA 3FY1A 4P7NA 1EHAA 4JL1A 4UOQA 1NQ6A 1QPKA 2E9LA 1UKOA 3G6MA 5I78A 3E1F1 2CNCA 2VOTA 1ISYA 1D7FA 1W3KA 2WK2A 1BQCA 3K8LA 2EPNA 4AIEA 1CXLA 1BAGA 2XSBA 2IXUA 4V28A 3IAPA 4OUEA 2EPLX 2W91A 3IJ9A 4A3YA 1H0IA 3ZR5A 1ODUA 3AICA 4F9JA 3RO8A 2IUZA 3NUKA 3VGDA 1GPFA 3SCSA 3L2LA 5IXEA 1V3HA 3NDZA 3BAXA 2W63A 1VENA 1UD5A 3AMLA 4U2YA 2VX7A 4QCFA 3AHTA 2E3ZA 3AQUA 3FW6A 2DIEA 1CXHA 1RP9A 1TZ7A 3SUVA 1H4PA 2O92A 3W38A 5CSYA 1VF8A 3T08A 4ACZB 2WC3A 1PX8A 2JF6A 5CPTA 3QHOA 4YHGA 4D6HA 2EPKX 2O9RA 3W26A 2Z1SA 4TTUA 3T2PA 3WEOA 4CGTA 3CMGA 4H41A 3WIJA 3IANA 5GNYA 4W7VA 4CKQA 3VMOA 1UWTA 2DSUA 3W6MA 4N0RA 4L4PA 3MS8A 3SCPA 2VI0A 3GH7A 2WBGA 4HA4A 4K68A 2GJXB 5I5RA 3AIQA 4CD4A 1DEDA 4LPCA 5A8PA 1L0PA 1MXDA 1JDAA 3MMDA 5D8WA 3DECA 2D23A 3FXYA 4UQCA 3RM9A 2ZUSA 2DSVA 2OYMA 3EDFA 1MW1A 3VDHA 3WEZA 1MQPA 3MU7A 3W82A 3UERA 4QFUA 2CETA 1NWUA 1E6PA 3AMCA 5CXPA 1FH7A 2XTKA 1WCGA 3OZOA 1WKYA 2DT1A 1S46A 3SCWA 2V3DA 4RE2A 1W3JA 1E6XM 1E3XA 3VD9A 1U33A 1JL8A 1XC6A 3L4ZA 3OZPA 3VGGA 1UKSA 4HMEA 4WSKA 3WENA 3U7VA 3PZNA 1LL6A 1NH6A 1XYZA 5I24A 1VRXA 1JD7A 4ZFMA 2BVTA 1NWSA 4H8HA 3OLEA 3RMEA 1K9DA 1FH9A 1UA3A 5I6SA 2Y5EA 3BAJA 1GQKA 3F5KA 2FGLA 3BAWA 3EYPA 3CZJA 5CPSA 1E6RA 3RILA 1KBBA 1K9EA 2J74A 3BSGA 1AVAA 2WBKA 2IXVA 2Z1KA 5HPOA 5AC5A 3AS3A 4FK9A 4GINA 1BGGA 4Q22A 2QV4A 3VNZA 2VZOA 5E6YA 5BXRA 1OT2A 3WQWA 1XH0A 3CZKA 2EBNA 1EHNA 4D6JA 3I3EA 4GO8A 5GNZA 4W87A 2QF8A 3GXFA 4AZIA 3U7BA 1PAMA 3L4VA 4CD5A 5HNNA 4Z2LA 1TMQA 1BYBA 1R7OA 1HJUA 2CXGA 3PZIA 5KZ6A 1G5AA 2V38A 3VKKA 1ZL1A 3CZGA 4N42A 4U3AA 4GI9A 4W8LA 4P8VA 2VZSA 3MV01 4J7RA 3SCTA 1OT1A 4H8UA 4AD5A 2XM2A 4U2ZA 2X1IA 1X6NA 3MANA 4W5UA 3AHZA 1N82A 3WMSA 2VZUA 4B9YA 4E2OA 4LX4A 3SCUA 1JZ7A 2XSAA 2D3LA 1UQZA 4UTFA 2WHLA 5GPRA 3VIFA 1UZ1A 4M82A 3SEPA 1JIBA 2BHUA 1LWJA 4QP0A 3ARRA 1A47A 1B0IA 4AIUA 1LG2A 1QNQA 1UG6A 2WHJA 3VU2A 3AMGA 2XIBA 3ZIZA 3GXDA 2X0YA 5A6LA 1KBKA 2EQDA 3B9AA 4DWSB 4QCEA 1HT6A 2WNWA 2J79A 3WY1A 3APGA 4H2CA 2WMIA 3PBGA 3LPOA 3WMBA 3WQ6A 1D2KA 5I77A 1CENA 1XYFA 4AEEA 3VGFA 3AISA 3PZOA 2XVKA 4J28A 4Y7EA 3UESA 1J0JA 5IHRA 3CTTA 3FNDA 4CD6A 4ACYA 2GJXA 4WK9A 3GNPA 3AIUA 2FGZA 1KQYA 3WDPP 3N1AA 4NSBA 4CVUA 3GNRA 2QMKA 4J3VA 4B16A 3FN9A 5CG0A 1CGWA 3DHPA 6CGTA 1NM9A 1UD2A 4J27A 5AC4A 2VVSA 2CHNA 1OIMA 2XWEA 2ZICA 4EK7A 2PWDA 3AS2A 4PMRA 4AZ6A 3CMJA 3CHCA 4JHZA 5E0FA 1JFHA 3WD0A 4S3JA 5HPCA 2UWFA 3U5UA 2FHCA 2J75A 3ZJ8A 2Y2WA 3WDRA 4D6GA 5JUVA 5A6MA 3THDA 5F7UA 1W32A 1W3HA 2GVYA 1XSIA 4MB4A 3VM7A 2EEXA 1YHTA 2BY0A 1JI1A 1QNRA 3TTQA 5GQBA 1E55A 3ZQ9A 3AMDA 2OWWA 4FLOA 3WKZA 4NRRA 2EPMX 4JKLA 1BLIA 4MADA 1HIZA 1E9LA 4XUYA 5M17A 1LJYA 3CHFA 2OSYA 2YDRA 1TG7A 4PUDA 4CU7A 3WDHA 4M29A 3WUBA 4FLQA 2VRQA 4JFUA 2V3FA 4HZ6A 5E6ZA 2DIJA 3WNLA 3VM5A 2PF0A 4UOJA 1DWHM 3OGSA 4TVDA 2UY2A 1MWOA 1LG1A 2PWEA 3RDKA 1K9FA 4OJYA 4UOZA 2PI6A 2PBGA 2CBVA 2E0PA 2J25A 4MB5A 1BVZA 4M56A 1DHKA 5D9NA 1EO7A 2A3CA 5HXMA 2W66A 3CHDA 3EDDA 1UKTA 3ZT6A 2V5DA 1ECEA 5TD4A 1QI2A 1JGIA 1ISZA 2QHAA 3POHA 4QLKA 2VX6A 1UOKA 2ZUWA 4YPJA 1QOXA 1W1YA 1W3LA 2O9TA 2WYSA 3BC9A 2RGMA 4UR9A 3BAYA 4UFJA 1MQQA 1C8QA 4BQ4A 1TCMA 2DSKA 1CZ1A 1NWRA 1FOBA 3VIOA 3T2OA 1C7TA 1DWFM 1ZJBA 4UFMA 4H7VA 5DT5A 2W5FA 5BXPA 2QLYA 2D24A 6A3HA 2BFGA 1FP8A 1CGVA 3ZOAA 2J77A 1E4LA 2Y4SA 2EXOA 1QHPA 2VMFA 2GK1A 3WH5A 3W4RA 4W93A 2CYGA 4YHEA 1E56A 1QBBA 2WHMA 2F2HA 2YL5A 1VEOA 5GNXA 5FKYA 4OOZA 4TXEA 3HMCA 4DUVA 4UCFA 2DDXA 2W62A 4ML4A 3TTYA 5D4YA 2CHOA 1GHRA 3VIJA 4CCDA 3K8MA 4XX6A 2VX4A 3WF2A 1JZ6A 4P8XA 1CXFA 5ECUA 1EDQA 2DSWA 3EDKA 3OGVA 1PZ3A 1GOIA 3ZR6A 1J0ZA 3WUFA 2DH2A 3NIYA 3AROA 3AZRA 3DYPA 1H3GA 2F61A 3AYRA 4LQ1A 4NZCA 1J12A 1EDGA 3CZLA 4W8AA 2ZXQA 1JYNA 2OLHA 1PZ2A 5BRPA 3VD7A 3OGRA 2VO5A 1E0XA 1A3HA 4PTWA 3MMUA 3WH9A 7TAAA 1CGTA 1LF1A 1TFVA 1OD8A 1EQCA 1U30A 2VQUA 5E0CA 3WNOA 3ARVA 2WKGA 2J7BA 2ZXDA 1KR0A 2OYLA 3WNKA 4TX6A 4PN2A 4PRWA 2VZTA 3IJ8A 2YKKA 3W24A 1I1WA 4P8WA 1E4MM 2XM1A 2DH3A 2VL4A 1KB3A 2C0HA 4D6DA 3WH7A 3SUWA 1EOKA 1LL7A 5A6AA 3T2QA 3O2LA 3W28A 2J62A 3A6OA 3AHXA 3TP4A 2GDUA 3T0BA 1QI3A 4GKLA 4Z2HA 1G9HA 3WFZA 3L4XA 1CXEA 1O6IA 3N17A 1JAKA 1VFMA 2GFTA 1IV8A 4WSJA 1GHSA 1LQ0A 3AIEA 4J3TA 1UWUA 2J7GA 1NP2A 5LA0A 3VUPA 2NW0A 1M53A 3T0AA 2ZUMA 1E1EA 3ARYA 4MJ4A 1ISVA 1Q4NX 1DTUA 4KH2A 4QLLA 3BSHA 2G41A 2BXYA 4JKKA 4UZSA 1XGZA 1CPUA 4IUGA 4DUWA 4TVUA 4DUXA 1UWSA 4PTVA 1JXJA 1BVNP 3ZJKA 1JZ3A 1ITCA 3VGHA 3EMZA 3CO4A 3VD5A 2VRKA 4P7LA 1JF6A 4HP5A 3A4AA 2WVVA 1UUQA 2AMGA 2CKSA 1M04A 4M24A 3CBWA 1VB9A 1UH3A 3OIHA 1KXTA 4ATLA 2EO7A 3KZSA 3WD4A 3WL0A 1WZLA 4JZ5A 3S6TA 4D6IA 1YQ2A 4AEFA 4W85A 1US2A 2YLLA 4CD8A 3T0DA 3VNYA 3WH6A 2XGIA 4ZXOA 2D22A 1NARA 3L2MA 4CU8A 3SCRA 2WZEA 2FHFA 3EDJA 1JG9A 1PIGA 1VFUA 1GQIA 1OBAA 1FHDA 4CVWA 2NT1A 2E9BA 3OLDA 4FLSA 1G1YA 2CCRA 4PSRA 3VTRA 5D9PA 1WDSA 5DMYA 5BXSA 3VMNA 1QBAA 4PSPA 1EQPA 2E40A 1V03A 3S2CA 1ISXA 3WF1A 1HL9A 4MB1A 1GZJA 3WMCA 3ARXA 2NSXA 3WF4A 5CGMA 3NSXA 5E70A 3GH5A 3UCQA 2ZWZA 2WMGA 3KL0A 1HKKA 5DO8A 3SCQA 2WPGA 4ACZA 2XGBA 3CPUA 1AMYA 1M01A 3VGBA 1OD0A 4PCSA 4LYRA 3AIBA 4ZEPA 1QI4A 2XG9A 1OGSA 3PZVA 2WMIB 3DHUA 2XIIA 2YL6A 3QGVA 3VMPA 3BAKA 4UFKA 4HU8A 4RE4A 1DWIM 1Y7VA 4BS0A 2WW5A 3K4AA 1SYTA 3FHAA 3SUTA 4CCEA 1Q6FA 2WMJA 1CBGA 1CIUA 3ZO9A 4F9DA 5A8OA 2QPSA 1X1NA 4BQ3A 1WAWA 3HJEA 3CZ8A 3UG3A 2W67A 2QPUA 3L4YA 2VURA 4UQAA 4J3XA 4BF7A 4PMVA 5IDIA 5FD0A 1BF2A 3GDBA 4W7UA 4CU6A 4A4AA 1QW9A 1MVYA 3W29A 3NDYA 4AD2A 3N15A 2Y8VA 4J3SA 4ZE5A 1HKJA 4BA0A 4IPLA 1JZ8A 2D0GA 2WZHA 4UQ9A 3WQ8A 1KGUA 2YA1A 4MPKA 3IK2A 1BTCA 2JE8A 1VBRA 2D20A 5FCZA 1V3LA 4BQ5A 4OIFA 3T09A 4JAWA 2WHKA 3HN3A 1DWAM 1K9TA 2DGAA 1Q6GA 2XFRA 1EH9A 1I1XA 3OBAA 1OB0A 4FMVA 3SUSA 2YDQA 1B2YA 1VJZA 2Y8KA 3II1A 2J8GA 2WLYA 3GYCA 2E9MA 3OLIA 4PTMA 3AOFA 3AFBA 3RM4A 1E6QM 2X2YA 3B9DA 1H1NA 3WDJA 3MSGA 2VCAA 1TA3B 3N13A 3VIKA 3AS0A 4HOWA 3WD1A 1HF6A 1CLVA 1ZJAA 5DT7A 1H2JA 2ZOXA 4NF7A 5LA2A 2ZX9A 3BMVA 2ZIDA 1E0VA 3W81A 4F8XA 2OSWA 1WPCA 1KGXA 2CERA 1OIFA 1V08A 1UKPA 1UH2A 1V0NA 5HOSA 3WEMA 5DEZA 3N04A 3CUHA 1J18A 2YBUA 2WC7A 5EB8A 2WWCA 1EO5A 3VDAA 3AZTA 1XSKA 1UR0A 2HVMA 3A47A 4AWEA 1HL8A 3K8KA 4YN5A 1UWIA 1B3WA 4CD7A 1VBUA 5LYRA 4C7DA 4V27A 1UD6A 1B3YA 3VGEA 1GCYA 2PC8A 1E71M 4PMUA 3NSNA 1VFOA 2BS9A 3IJ7A 2UY5A 2GK1B 2WAGA 2FH6A 5ABFA 4M81A 1OSEA 1E1FA 4E4PA 1FP9A 2VR4A 4HTYA 2ZX8A 4UFIA 3CGTA 5A6KA 1B3XA 4D72A 1V0MA 1P6WA 1ZBKA 1C91A 1AQ0A 1H49A 3G6LA 3SIMA 3PZUA 4AW7A 1V6UA 4GI6A 4PMDA 4MDOA 4DM1A 3WNPA 1G0CA 1QI5A 3CUFA 3L4UA 1CGUA 1KGWA 1GONA 1B9ZA 7A3HA 1J0IA 3MUY1 4KRUA 5CSUA 2WM0A 5A6BD 2VC9A 4PMYA 3HU7A 1W1VA 3ZSTA 4GIAA 1OM0A 1X6LA 2ZX7A 4X0NA 4ATWA 3CUIA 3MMWA 1HJQA 3NYDA 1GVYA 4WKHA 1W9VA 2YL9A 1H0GA 2Y24A 1E40A 1W1PA 1GJUA 2O9PA 4MAVA 3RJYA 4WJXA 3FHQA 3GXIA 4WF7A 2JFEX 3GXMA 2CBJA 4MJ2A 1NOWA 1BYCA 1JXKA 2WKLA 3I3BA 1WZAA 4PMXA 5FL0A 3TTOA 2E4TA 5AYBA 2GUYA 2JF7A 5ABHA 5ABEA 4ATDA 2W61A 3GH4A 1DP0A 5CZKA 5BROA 5BXTA 4D6FA 8A3HA 1HX0A 3MSDA 5I23A 4QDMA 4EKJA 1UD8A 4B3LA 2XJ7A 2XVGA 3VILA 3W37A 2WB5A 2AOSA 2CESA 4NRSA 5A69A 3ALFA 2BHYA 3EDEA 3RIKA 2TAAA 3M6DA 8CGTA 1UR8A 3BXWA 5EFFA 4P7RA 1TA3A 1B31A 1RD6A 3UETA 3AYSA 3QOKA 2ZXBA 1ZBCA 1CGYA 3AXHA 3UG5A 1KXQA 1HP5A 3W25A 1QNSA 3DYMA 2CKRA 1OCQA 1E6ZA 1QI0A 4AD4A 1ZS2A 3TOPA 3DYOA 2EJ1A 2XWDA 1C3FA 5BYWA 1V3KA 2WVVB 3N18A 2BNJA 1JDCA 2J7FA 3VD3A 3PZQA 3ZSSA 1CXKA 2OWXA 2BV9A 1H11A 1W91A 3VD4A 5CGTA 1CWYA 2CBIA 3ARZA 3MKKA 3AIRA 1HVQA 3F5JA 1CEOA 1HJVA 1Q6DA 2W4XA 5A6SA 3VIPA 5E09A 1F4HA 3PZMA 4HOZA 5BRQA 5CJ5A 4R5EA 5A8QA 2HISA 1W9XA 5A3HA 3BCFA 3CHEA 1WP6A 3WD3A 4W7WA 1QHOA 1IT0A 1BHGA 4TUFA 1QW8A 4DM2A 1UWQA 1TVNA 4HZ7A 3UR7A 1HKMA 2GDVA 3D5HA 1BGAA 4URIA 1V02E 2XYLA 4U31A 4BQ2A 3MUZ1 5M5DA 1XHGA 1Z32X 2VNCA 3KL3A 2DT3A 4UZUA 5M3WA 1W9PA 4Z2JA 1C92A 3F5LA 1HNYA 1VEMA 4PCTA 4FLRA 3AI0A 2JALA 3VIHA 2V3GA 2BXZA 1J10A 2WLZA 1JAEA 5A2BA 4D71A 1LWHA 1KCKA 3AXXA 3B9EA 4TVCA 1UD3A 3VX0A
chains in the Genus database with same CATH superfamily
3CQIA 1KXHA 3GFXA 2VCCA 4M7TA 5DXYA 4U5IA 2ZZ3A 2ZVRA 1FBAA 1ONRA 1LRTA 1EOMA 1CLKA 3ANUA 4YVPA 1IYXA 1TV2A 3C2RA 3LCLA 2OR2A 3WBAA 1IXQA 2OU4A 4JIEA 4NI8A 3OQEA 4FNUA 3P74A 3TYCA 4DYEA 1KR1A 4D6CA 1J8VA 2Y5JA 3OHIA 3SRKA 3UWEA 2OG9A 2ZUUA 1UOZA 4GVGA 3WFAA 2FZDA 4QJ5B 2OZTA 1QNPA 1V0LA 2PC4A 4LYPA 3STEA 2F9RA 4YCOA 1MXSA 2DUZA 3WF0A 3UWVA 4J1OA 1FH8A 1A5BA 3NPWA 3NSMA 1JZ5A 2XISA 4F79A 1MFUA 3QW3A 4REQB 4AY1A 4K39A 1ZB5A 4FNPA 3EXTA 1KCXA 1EUNA 2R24A 1HGWA 3TYDA 3I65A 4GXMA 3R13A 1K7FA 1KV5A 3N2MA 1NVMA 2CLEA 5CC6A 2FVLA 3CAKA 4QLJA 2CEQA 2OVLA 4KWOA 4TIMA 3FEMA 1E5JA 2Y85A 4N6EA 1C8VA 4PMNA 4PMQA 4ZENA 1TV7A 3O6AA 1FWCC 3KCOA 4O10A 3AIWA 3M9YA 1H09A 4E5TA 3VPLA 3BK0A 3NQFA 1O5KA 3C8FA 5KEZA 3S4TA 4DNHA 3A5FA 3FJ6A 1GQLA 3PZGA 1NWTA 4GPNA 4D8LA 3VOIA 1RD5A 3KRBA 4XZWA 5EPDA 3U48A 1IZKA 1W3TA 5IFPA 5CC3A 3HGSA 4R88A 1RK6A 1K6WA 5CPLA 4KEUA 3W1XA 4YU1A 3SURA 1TPDA 2YA0A 1OEPA 3MBDA 2G8ZA 1UH4A 3BJTA 3IAQA 3LNMA 3BWWA 4JIQA 3FVDA 1JDDA 4WIWA 1JNEA 1JCTA 3UJ2A 4DUOA 3DHDA 3RU8X 2QGHA 3QLLA 5DY2A 2OQHA 3M5ZA 1Y5VA 4L4OA 3RCMA 1XFCA 1CECA 4FF5A 3TQKA 3PJXA 3URQA 3GXPA 2AAAA 5D2XA 4MNJA 3B8SA 2VFGA 5C9ZA 4Z08A 5F1VA 2NUYA 2ESCA 3HZ3A 3K1DA 3GTHA 4C6CA 3OVPA 3DI0A 1IE7C 3UEQA 1LOLA 4WVXA 3ZR4A 2FMOA 1X38A 3MYPA 2PMQA 2V5CA 2G50A 1SR9A 3GZAA 4CUCA 1RCXB 1NDVA 5G4EA 3UYIA 1XQKA 4OVXA 4X60A 5K9XA 1J0HA 1U2YA 5LIYX 1XGEA 3IPWA 4XD3A 4GZEA 4R85A 1OGBA 2PWGA 4J2MA 2UY3A 1WDRA 5JBEA 3LZ3A 4Q8UA 2OODA 4CCZA 1JJKA 1TUXA 3H21A 4MB3A 1TZZA 4DIAA 1R3YA 4LBRA 1PDYA 3OB8A 4LVFA 1F6YA 1F73A 1E6NA 1QNVA 2FZBA 1TPUA 4L4LA 5FEZA 1SZNA 4TTGA 3MCOA 4XK2A 4Y2WA 2WOQA 2J9XA 3E5PA 4UIOA 4UC5A 3WL1A 3B8DA 3BLKA 1OFRA 4P7QA 1SGJA 1OF8A 1WNOA 3P5YA 1XD1A 1F9CA 2WVSA 4JDBA 1UD4A 1TWZA 1YPIA 3L4WA 6TAAA 2VYOA 4NX5A 2QXWA 1YPFA 3LTYA 4OBRA 3VNIA 1OGGA 4LCSA 4WKAA 1HVXA 5A8NA 1SMAA 5A2AA 6XIAA 4NZ4A 4B9ZA 4E2DA 2DVTA 4CNTA 4J3UA 1FA2A 1R86A 4C91A 2X8RA 1K8XA 1I75A 5D9OA 4PUJA 3KHJA 4GVFA 3KWSA 3DHFA 1W9UA 4ZR8A 4NAFA 3RR1A 3NG3A 1D3CA 4EXBA 3NOEA 3USZA 3TONA 4EP8C 2BTMA 1G7VA 1E70M 1AQMA 4MUZA 3ZMRA 1KWGA 3LHWA 5DY3A 5FSDC 4I7UA 1W9BM 4QS5A 2NV9A 1AL7A 1AH4A 3R2GA 4ZGYA 1WYIA 4RZ4A 4O53A 4MLRA 1YW1A 2GSHA 4HMCA 5C7VA 3MY9A 4IMAA 2A3HA 2Z6JA 3SGGA 3M46A 1GVRA 4QEEA 1B3ZA 3G1SA 1XLLA 2G3NA 4O1BA 1CTNA 1DQWA 2PGFA 3PAOA 2F6KA 3B4YA 5JIWA 4O54A 3NFUA 3B06A 1SMDA 4YIWA 3SGUA 3NQDA 3QHNA 3EB2A 3ZYZA 4PYSA 1M6JA 1E4NA 4KRTA 1EJ7L 4PRTA 3WLHA 4GGHA 5BRBA 2VP8A 1MXGA 3VOCA 1UW9A 4EWND 5FSEC 4ZOAA 1W5NA 1IEQA 4Y8EA 2Y63A 2PTZA 1WUEA 3P67A 4JTIA 2OYKA 2QF7A 4NI3A 5AB3A 3M0LA 2OEMA 1X6UA 1LP6A 1JYVA 2VCBA 2WM1A 3UVAA 2VZVA 1ZU8A 4X0VA 4RX0A 3LPGA 1R6WA 1RJPA 1I2QA 3NZPA 3QH2A 1I4NA 1HKWA 4R7JA 3PHAA 4JNMA 3I7SA 3WBEA 2FTWA 1DJNA 2TRSA 4C7FA 1JNDA 3GWQA 4U4MA 1MFVA 4XG1A 4PBGA 1EJTC 2BVWA 3W53A 2RJHA 3C2VA 2C1HA 4ICNA 1VBJA 1WDQA 4A29A 5FESA 1KWKA 5DBTA 3THAA 1C90A 3CT7A 3LI1A 1KQZA 3F4CA 2NUWA 5F2LA 5G1TA 1QHZA 1DJZA 4IIFA 1PCKA 4AIBA 4ONVA 3KOYA 4GQQA 1THFD 4U3CA 1PKNA 1FHLA 3RF9A 5A8GA 3EA1A 3PG9A 3PBWA 1X8CA 3GBEA 1KW1A 4HMDA 4ZOBA 3H12A 5K9CA 1IWBA 2FQIA 4KMQA 6REQA 1R8LA 1V6WA 4WKFA 4QE1A 3KVMA 4WEVX 5C2GA 1NAL1 2PE4A 6ENLA 4J4KA 3UWQA 1JF5A 3AC0A 3V18A 2E8ZA 1HO1A 1B3VA 2OLSA 4JY9A 2OO0A 2BY2A 2WSYA 1RJQA 4DX3A 4EANA 2EJAA 4JTQA 2Z7GA 1UBSA 2PP3A 3W2KA 1YTKA 3QKEA 2QCEA 2ZRUA 5FJIA 1MYRA 2D2OA 2YLAA 3RX2A 4HPGA 5EMLA 2VD9A 1UKQA 2WVUA 2ZXAA 2GJLA 1XBVA 2V63A 4PBEA 3E5BA 5ECVA 1UWRA 2POZA 1NFGA 4XKMA 1GQJA 3WF3A 2RKXA 1AA1B 3GDMA 5IFTA 4JX6A 1BXNA 3QHMA 4LV9A 3VNMA 4XZBA 3VINA 1JR1A 3CUGA 1ZP3A 3N19B 3KCJA 4HHMA 5D09A 3QOMA 3WDQA 3LTPA 1BPLB 5EFDA 2OT1A 1QNOA 2WCSA 4H6RA 3JU2A 1K4HA 1SR0A 3VK5A 5CLWA 4LAMA 4E3TA 4PL2A 3WSUA 3TSDA 2CIPA 3AJ7A 4QBXA 3MUIA 1S2UA 3G5EA 3A4WA 3ARSA 3LTSA 2YSWA 5LIUX 3NQ7A 1J9YA 4H6QA 3UWWA 1BXCA 3UZXA 4OZOA 1Q8JA 1Q6OA 4L80A 1R7AA 4HYWA 2V67A 3W7OA 4OKDA 2FTYA 2ZRZA 3EKGA 4RL3A 1ITXA 4AXNA 1XRTA 2WQDA 4H6KA 3G1FA 3W02A 3NXFA 4EXQA 2PLKA 1LQ2A 1T8QA 1E9ZB 2YXOA 3EZ4A 2TSYA 3TOYA 5KTLA 4IG2A 5D33A 1BSLA 1EZWA 1DJYA 2INEA 5HJLA 1GOWA 4JCMA 2DVXA 1UC4A 3TSMA 4B4HA 1DL3A 5FF2A 5CKSA 1D7FA 5HWJA 2ZKMX 2PDPA 4XD6A 4AIEA 1RBAA 1BAGA 3T55A 4EOUA 1EX1A 2IXUA 4XBKA 5IBXA 3IAPA 1PDZA 2O7SA 4A3YA 1K8YA 4G56A 4O11A 4GUFA 4PB4A 3RN6A 4Q8NA 4B5TA 3GAYA 4FIRA 3VGDA 1GPFA 1Q65A 1HUVA 4M0XA 1EB3A 1V3HA 2BOFX 2W63A 3OVRA 1RBLA 4U2YA 3L9CA 4QCFA 2PDKA 3AQUA 2VR2A 3SUVA 1TZ7A 4I9JA 3PWGA 1H4PA 4WD0A 2WNZA 4ADTA 1JDFA 4HHPA 2CU0A 3W7MA 4D6HA 2OKTA 4AU0A 2O9RA 1W5MA 3W9ZA 3E38A 4L9ZA 4CGTA 5IBXC 3CMGA 5DCBA 3EKZA 4QISA 4S3BA 3VMOA 4HSOA 3WLOA 4MJMA 3WBXA 3W6MA 1EJSC 4L4PA 1GVEA 3SCPA 2GJXB 1DTNA 4WOQA 1T8XA 4PL1A 4LFYA 3FOKA 3UG8A 1DEDA 3WG6A 1L0PA 4Q4OA 3SN1A 2XGZA 4I9TA 1FWJC 3CC1A 4CEUC 3TK7A 4PUWA 2NLYA 1KTCA 4LRSA 3GDTA 2ZUSA 2IPFA 2Q01A 3C2EA 4H8NA 3IVUA 3VDHA 1ZAIA 3P8IA 2IKGA 2RUSA 3O3RA 3AYVA 2CFFA 4ZSTA 3NQAA 4MSSA 3OZOA 1TJ0A 4WGHA 3U2OA 1XLKA 5I07A 3UXKA 1E6XM 1E3XA 3EPOA 3A3WA 4ORIA 2VENA 5BOOA 3LGGA 2A0NA 1VRXA 4ZFMA 4UTKA 2BVTA 4S38A 3QMSA 1M1BA 1XXXA 1FH9A 2ASHA 3F5KA 1UR3M 4RR4A 3HFYA 1L6GA 3EYPA 3KTSA 1E6RA 1P6BA 3RILA 3THUA 3TCEA 1K9EA 1R38A 4MYXA 1Z89A 1Q3NA 4HSHA 3RGTA 4FK9A 2IW0A 2WJFA 5IOBA 2VD8A 1JPKA 2VZOA 1WOAA 3UCCA 5FEPA 5BXRA 1OT2A 4AVOA 3CZKA 2EBNA 3QSTA 2Z0IA 1EHNA 1FWWA 1K8CA 3U7BA 3MO7A 5HNNA 1FDZA 1BYBA 4G2DA 4LC8A 3T40A 1TR9A 3PZIA 5KZ6A 1PSCA 4U3AA 3W22A 2NX9A 3KM8A 4QQUA 3DH7A 3ZLGA 4H9TA 2LLEA 4W5UA 5TNVA 3PSVA 1AW2A 1XLEA 4B9YA 3SCUA 5AHLA 1PZ1A 1JZ7A 2XSAA 3LOTA 4X63A 4RLIA 5GPRA 3VIFA 1JIBA 3RX4A 3ARRA 4H3DA 1B0IA 2P10A 3HPZA 2QJIA 2ZC1A 2WHJA 2J66A 1WUFA 3ZIZA 3GXDA 1KBKA 3S46A 3UPBA 2GUUA 5FJPA 4QG9A 2EG7A 2Z27A 1TIWA 2J79A 3UNTA 4YYFA 5TAOA 3APGA 3DFYA 3WLSA 2AKMA 3PBGA 3LPOA 1D2KA 2ACRA 5I3FA 4Y7EA 1F05A 2HK1A 2ZTKA 4CD6A 4ACYA 3UWZA 1Q7QA 2NX1A 2FGZA 1V79A 3E9AA 1O60A 2EKGA 4CVUA 2QMKA 4WY0B 2PD9A 1WKDA 1CGWA 1RJRA 1FCQA 2PS2A 4RV8A 3P14A 3CMJA 3QQ1A 4JHZA 2RDTA 3A22A 3WD0A 3TU9A 4KESA 2PRHA 2R1KA 3U5UA 1MEWA 2I1OA 4DXXA 3CWNA 4D6GA 2ZQ0A 3OVGA 2A85A 1O4UA 5KINA 3IUHA 5F7UA 4C1NB 4FNRA 3GDKA 1RLCL 3VM7A 2IS7A 1H51A 1ALDA 3TTQA 2Q6ZA 1LZOA 3ITCA 1TWWA 3AMDA 5G5IA 5HMDA 2EPMX 3E2VA 5C55A 3LN3A 1HIZA 1OF6A 3JVAA 4WDTA 4KFOA 4YTSA 1AMKA 1OFEA 2PCQA 3R25A 1TPEA 1QATA 3WUBA 3GFZA 1TMLA 3OQ8A 5DLCA 5E6ZA 3WNLA 3OGSA 1O12A 4IJCA 3HBLA 4NYUA 2PWUA 1LG1A 3RK8A 2V0TA 2JGYA 3FIGA 4F0MA 3LCGA 5LHFA 3BGGA 2E0PA 4MB5A 1YYAA 3HMJG 1DHKA 2YR1A 3CXOA 5HXMA 2GDQA 2BOGX 3CHDA 1YDNA 1UP2A 1ECEA 4H9UA 1MDRA 4DJED 3B0XA 1Y5WA 2CZFA 1ISZA 1GTHA 4ZZ9A 2ISDA 4UBPC 3LRKA 2VX6A 1UOKA 2ZUWA 1W3LA 3TE9A 4QROA 2DIKA 2RGMA 4UFJA 3G0XA 1I9CB 1R9YA 2ZADA 1HKVA 1KM4A 1DWFM 2QUVA 1YBQB 2HRWA 4UFMA 3CMFA 4H7VA 5BXPA 4MZYA 2D24A 1QJWA 1FP8A 1WA3A 4CQCA 3ZOAA 2Q3RA 1EL3A 3TAKA 3W4RA 2XZ9A 5J5RA 1REQA 2YL5A 1O66A 1FWDC 2JK2A 4TXEA 4C6LA 2X16A 5D2YA 4GYFA 3PWAA 3R5EA 3VOHA 2CHOA 4FHAA 4UTTA 5CZJA 3K8MA 3CQHA 4LUSA 3DN5A 1JZ6A 1W5OA 1CXFA 5F2MA 5ECUA 3A13A 1V93A 1FWTA 4FOKA 1A0DA 2AKZA 3IVTA 2QJNA 3NIYA 1RZMA 3AZRA 1S5TA 3DYPA 2F61A 4LQ1A 1R47A 1ONEA 2FPTA 5EA9A 2VGBA 1J12A 1JCLA 2G97A 4W8AA 4MZ1A 3NPVA 4GD0A 2Y62A 3VD7A 3OGRA 3PJTA 3IACA 2VO5A 5DMMA 3R58A 4RNFA 4ZTYA 4ZQNA 4PTWA 5HUPA 3MMUA 1CGTA 1LF1A 5H6HA 3PY2A 3CJPA 5HMFA 1FKXA 3ARVA 4E38A 3FKKA 2J27A 3C0JA 4O4VA 4PN2A 1R5YA 2OZ3A 3W24A 1WX0A 3OPSA 4UTTC 2WV8A 1HO4A 3SGZA 1JCNA 2VL4A 5BOFA 1EEPA 5CEWA 2C0HA 4GCAA 5PTDA 3CEPA 5ABTA 3WH7A 3SUWA 1CX9A 3I4KA 2J62A 1D7KA 3TP4A 2GDUA 3K30A 3ABSA 4J3ZA 4GKLA 5C9UA 3V7PA 3L4XA 1QR7A 4I5RA 3N17A 1BTMA 4GH3A 3WLJA 4PE8A 2GLKA 3AIEA 3NZGA 4Z1DA 1OFDA 1KFEA 3WK0A 5AECA 4LF1A 2UBPC 2G41A 1H61A 4DBDA 4DUWA 2XIQA 1J2WA 2ZZ2A 5HNUA 1UWSA 4PTVA 3B9NA 3CWHA 3EMZA 5H91A 1XPYA 1JF6A 1ZQ5A 1PKYA 4GISA 1M04A 5JMUA 4M24A 1B4EA 3EPMA 5D32A 1KXTA 2GPTA 3LLDA 5D2TA 3WD4A 3WL0A 4DF1A 4JZ5A 5FJUA 1YQ2A 2GQ9A 1IXPA 1KLYA 2NQ9A 1QW7A 4CD8A 3VNYA 3WH6A 3UJEA 2W27A 3P8JA 4CU8A 3SCRA 3IIPA 4DZHA 2PD5A 4IOTA 4AEOA 3EDJA 2DU2A 4HPNA 4OHQA 3T6CA 2QYGA 4RZBA 2P5NA 2P8BA 1OBAA 4PSRA 2XZ7A 3I4EA 3VMNA 1V03A 5J04A 3S2CA 2Z1BA 1Z48A 3BURA 1YTEA 3MW7A 4YVXA 3UPMA 1SJBA 2O4QA 3WMCA 3ARXA 5CGMA 1KM1A 3UCQA 4Q4RA 1T0OA 3BW2A 5MHBA 5HINA 4K36A 3SCQA 2B7NA 4ACZA 1AMYA 3TH6A 3HTWA 1EP1A 2VGGA 3PUOA 2MUCA 3VGBA 4Q7IA 4JTKA 3SFKA 1F6KA 1RQBA 3AIBA 4ZEPA 1OGSA 1TPVA 1WKFA 2WMIB 3VMPA 2GUBA 4UFKA 2OGYA 4KEVA 1P1MA 1DWIM 5I09A 1W37A 1Y0EA 4G7EA 1SYTA 4CCEA 1Q6FA 2WMJA 3ZO9A 1CIUA 3MKCA 4K1GA 5A8OA 1DQUA 2RFGA 4BQ3A 5AHIA 4YVVA 2W67A 3W71A 4J3XA 2OX4A 1XIFA 2X30A 4MG4A 1BF2A 4W7UA 1Q6LA 4A4AA 3G8RA 3NDYA 1RQEA 4GIEA 1K7XA 2Y8VA 4ZE5A 5XIAA 2OB3A 1XUZA 1QPRA 4KKXA 1P6CA 4PA8A 4QJ3B 3V35A 3VKJA 4PRRA 3PC0A 2WHKA 1NU5A 4LVBA 3HN3A 1M7PA 3EB3A 3GKAA 2PPGA 1ZPTA 2FFCA 1B2YA 3P93A 2L5HA 4LBSA 3II1A 2WLYA 4AWTA 2ABBA 1NDYA 3LBMA 5F4XA 3AFBA 1SUXA 1IF2A 2IKIA 3WK3A 1DXFA 4PB3A 3GHUA 2DW6A 3N13A 5C9WA 1X1OA 1ZJAA 5DT7A 2WKJA 2Z7KA 5DXXA 3AJXA 4E3VA 3BMVA 4F0LA 1N8FA 3M0HA 5D2WA 5HA7A 1E0VA 3W81A 5D03A 2QPXA 1UKPA 3O05A 1LBMA 2ATSA 5AHFA 3L0KA 2HNEA 4H7CA 2YBUA 2QJGA 5EB8A 1QFEA 4FXSA 3A47A 4AWEA 2W79A 3I6TA 1UWIA 1B3WA 1VBUA 1EJXC 2QZRA 2G4JA 4V27A 1UD6A 4OWGA 3CM4A 4G9PA 4YTQA 4XVDA 1GKRA 1LDCA 3NSNA 2BS9A 4FXFA 1W3IA 1TJ1A 2GK1B 3E6EA 2FH6A 4UUIA 3L5MA 1EA0A 3G77A 1XLMA 2DZUA 4DPQA 4UFIA 3CGTA 2OTDA 4MHBA 1B3XA 1QT1A 3R8GA 5LZLA 3G6LA 3H6OA 1V6UA 4O17A 4GI6A 4PMDA 4MDOA 1Q6RA 3QFEA 1SW0A 3W1MA 3UXLA 2JBMA 1HFBA 1F8IA 2QUTA 1DORA 1QI5A 3L4UA 3DC8A 1OADA 3ZLHA 1PHQA 3TC3A 5CSUA 3BE7A 3GNXA 1SJDA 2C6QA 4IIDA 4NT0A 5BMWA 4PMYA 2A5HA 3N25A 4GIAA 2PLMA 4PB5A 2I56A 3EX1A 4X0NA 3CHVA 4GXWA 3RHGA 3CEUA 1KA9F 1W9VA 2YL9A 3REQA 3TROA 1E40A 1GJUA 3PF3A 4JS3A 2B7OA 4AX7A 4MAVA 5REQB 3FHQA 2CBJA 4Q8OA 2GZXA 3GSMA 3H7RA 2V5LA 2FZ8A 1BYCA 3ERPA 3NL6A 5FL0A 1YXCA 3QFWA 4O1CA 2E4TA 5AYBA 5ABHA 2E1WA 1EF3A 3LU2A 5CZKA 5BROA 1TMHA 1AL8A 4EKJA 4Q33A 3VILA 4C60A 3W7GA 3ITGA 1PKMA 1B5TA 1PWMA 2E6AA 1F74A 4NRSA 2XU2A 1JPMA 3ALFA 2BHYA 3EDEA 3M6DA 8CGTA 1ZUAX 4UB9A 3BXWA 4MWAB 3RUBL 4YMZA 4H1ZA 5EFFA 1TA3A 3DX5A 4DY1A 4CNOA 3S0CA 1UP0A 3EB4A 3PPFA 1KXQA 3ABXA 3P82A 1DXEA 4HMNA 1E6ZA 3EOUA 1Q2RA 2XIMA 3N2CA 2VEIA 1L6SA 2PDFA 3LSBA 3H7VA 3ZSSA 2BV9A 3ARZA 3F5JA 1CEOA 1AD4A 2CWXA 2W4XA 3AYTA 3W6YA 3W74A 5K9DA 1E1CA 2QDHA 1ZJIA 3VIPA 1XRSA 1F4HA 3PZMA 4HOZA 4LUYA 5BRQA 2QKFA 5CJ5A 3OO2A 2CHRA 4MZ8A 3VNJA 1WP6A 3VYLA 4IX0A 4A3RA 1XLJA 5AHMA 4GWEA 2X1SA 2GDVA 3UBPC 3BV7A 1BGAA 4U31A 3VA8A 1Z32X 1IXOA 3KL3A 2DT3A 4B5VA 3N2OA 4Z2JA 2C15A 1DJWA 1R3SA 3IJQA 2HJPA 3SSZA 3S2NA 2BXZA 4F0SA 2QCDA 1JAEA 1XBXA 1KCKA 1LUCA 4J40A 4TVCA 3GYEA 5EMYA 1I2RA 3AALA 4IMGA 5I3GA 3NCOA 4NAEB 4OFCA 1FWRA 3GTXA 2NT0A 3NYZA 5LNUA 1ZLPA 3AIVA 3AHYA 3ARTA 4H9ZA 1S1RA 3A4JA 4O1DA 3G1RA 3AAMA 3H55A 4W88A 1E73M 4A2RA 3OG2A 5ABGA 4FNTA 3PNUA 4HNOA 8XIMA 1H7RA 3E0VA 3QQWA 5FI8A 3FYYA 4C7GA 3O9NA 1I45A 2Q8XA 5DMLA 4JCLA 3N11A 4FS9A 4TV6A 1KFWA 3SQMA 1W9DM 2QDDA 1A3XA 1XV8A 4AD3A 3VNKA 2EPOA 1WXJA 1O5XA 5EGRA 5AY7A 3FXGA 3KUMA 1O94A 3NQ8A 2IPJA 2PDGA 3KVKA 4OUIA 1RUSA 2VHLA 3T1GA 5AYIA 1J11A 2A3EA 1RCOB 1IQ8A 1TRDA 2FZNA 3TYZA 4H2HA 1XCXA 3W2MA 2FDMA 1S5WA 3PBUA 3TC7A 1R87A 1PIFA 4HA0A 1TIMA 1B54A 2C8NA 4JKMA 3SB0A 2I9UA 4GX8A 2WCAA 4LVGA 3BOLA 5G4HC 3ARUA 3KDOA 3QLDA 7REQB 1M03A 1WXYA 1UR4A 2E6FA 3S1XA 2UZ9A 3LHVA 1F7BA 4IF2A 2WANA 1FFRA 2HS8A 1GZ1A 4DZAA 2QQ6A 3GS6A 4UR7A 1Q4WA 5GVJA 3HB9A 4B3KA 3LPFA 3URBA 3POCA 2NVCA 3BLPX 3VIMA 3L0GA 1DPMA 8TIMA 1R3QA 3OVQA 3M44A 2J7HA 1OJXA 1FX6A 4LB4A 4KWUA 2C7FA 1XKYA 1EDTA 2VEGA 5G2HA 3PZTA 1K77A 2PURA 1GJPA 3WBYA 5ABFB 4AWUA 3WQ5A 5HWMA 2B31A 5KMYA 3TYBA 4AYSA 2FJUB 5F2GA 4PBFA 3GBDA 3N73A 1JRBA 1F6PA 4O52A 4QM1A 5KZMA 1AD1A 3EBVA 3S2LA 3DFOA 2H90A 3ES8A 4LBUA 3N6QA 4Q7NA 4I3GA 3KBJA 4Z2GA 1J01A 4NXSA 3PZ9A 4JYFA 2CLIA 2X0HA 1H60A 4OGZA 1UB3A 3F4DA 2A3BA 1TYGA 3W1RA 2Y89A 3AMKA 3PPHA 1J0YA 3N4EA 4LYQA 2WCGA 3OODA 3MHFA 1E0UA 3N3TA 4W4QA 3W3OA 1HN1A 4AF0B 4GQBA 4EIVA 3S1GA 2J47A 3ZM8A 4REQA 1R3VA 1M3UA 1XQLA 7XIMA 3LM7A 3BG3A 4ZXLA 2GSJA 1T40A 2A4AA 3WLNA 2JGQA 3TNBA 3BJSA 4HCLA 9XIMA 4DBEA 1XIMA 3V5FA 2D0FA 4W86A 3D47A 3LDVA 5JBFA 1U5JA 5EMUA 2I57A 2OGJA 1I2OA 4K6AA 2BZNA 1YEYA 4P7OA 1LLOA 1UR1A 4GZ7A 1JPIA 1MSSA 2Z4GA 4M19A 1XCFA 3THCA 1F61A 2ATMA 2PB1A 4Q4PA 2VFIA 3VVGA 1RCQA 1PS9A 3CO8A 2VC5A 1Q6EA 5F2IA 1Z7AA 1T99A 1V3IA 1EGMA 3CUZA 3L5LA 4US5A 3DENA 1CGXA 2VC7A 3QRHA 3H2FA 3HQPA 1TV3A 2ZUNA 3M4HA 4M8UA 5G4WA 4XV0A 2WSQA 3G0UA 1PEZA 3MI6A 4UTLA 4B5NA 3HPSA 2ZVIA 3VUSA 1MEIA 7TIMA 4TX8A 1DJGA 1UUOA 4HOXA 2J7CA 4GHRA 2ZFAA 1N8WA 2X09A 3A4XA 4N7QA 5EU9A 4Y9AA 5JH2A 3UXAA 2YCKX 4KBXA 1EC9A 3VZZA 3CAQA 5LSMA 1E43A 2PLCA 2CITA 4AAJA 3WUEA 5AHEA 2CZEA 3W84A 4RXFA 4W5ZA 1DBTA 2PWFA 4AWSA 1EXPA 3SBFA 3UWUA 3KBVA 1VBGA 3VIIA 5A94A 3LCIA 3EWUA 4GACA 2WWDA 5LIXX 3WO8A 5A6JA 4JIRA 4A3QA 3WQEA 3Q65A 1M41A 3EWCA 2HE5A 4CNUA 1F3XA 2RDWA 2FH8A 2WSKA 2BY1A 4XZMX 1C7SA 3TJ4A 5D02A 2PEVA 4GG9A 4X22A 3HG4A 4JBRA 2FHBA 1KXVA 4PEKA 4D6EA 3WQOA 1H7XA 1JD9A 3L12A 1AZ2A 2VWSA 3KTCA 2QS8A 1UYQA 2X05A 4H01A 4P5UA 3VE9A 1OX4A 2X0SA 1ELSA 3MC5A 1BXBA 1HZYA 5SWUA 2VGFA 4LU0A 4B5XA 4EF9A 3QY7A 4OT7A 4LGXA 1HXJA 3TFXA 1J96A 1XICA 1XG4A 4XTDA 1ODZA 3DFPA 3ONBA 3S1WA 4MNKA 1NFBA 4YS1A 1XH2A 2XPKA 3PG8A 3UZWA 1VJIA 1YE6A 3P0WA 5HANA 4F0HA 1XLGA 4ECLA 1GOQA 5C70A 4HNTA 1GOOA 1KD0A 1PWLA 4XWUA 1R30A 3QGAC 2I17A 1MQRA 2E5DA 3UR8A 1M65A 1GNXA 2X2GA 2UY4A 3IRDA 4GCXA 4B92A 5A8MA 2WMKA 4B91A 3CH9A 1VCFA 2FB2A 3RFAA 4IMDA 2A3AA 4DBUA 1W0MA 2DZPA 5BNKA 2A6LA 1V6VA 3N6HA 4OBTA 1JYXA 5A6BA 2ZRXA 4IFRA 2W92A 4JTAA 3WH8A 3ES7A 4XZ9A 1Q85A 2O0TA 2CZDA 3QBUA 1SFSA 2BY3A 3GXTA 4ZBCA 2E6DA 4JFTA 2HBXA 2XVNA 2NQ5A 1LTDA 4G8TA 1MZHA 2G4FA 3LCHA 4ZO6A 4HJWA 4OU1A 1AFSA 4V2XA 2RJGA 3ARQA 4S3FA 2JKAA 1AQHA 4IIGA 3VZYA 3JZUA 4F48A 2ZE0A 1ZBWA 4NQ1A 3GDLA 1A0CA 3C0QA 3MUXA 3NURA 1P0NA 3R10A 1JCMP 4Y9NA 1HJXA 1V6YA 1XLAA 4AIOA 1YXYA 3N2TA 3NQVA 2C79A 4R7OA 4LCRA 2WVTA 2FLIA 4AZBA 1RLDA 2PU0A 5DFAA 4AUBA 3WK1A 2HMCA 3E96A 1BKSA 3ICJA 1V6TA 3NM1A 3W70A 3MCNA 2RGLA 5DF0A 3IIVA 1KBLA 3NTYA 3FGCA 3L68A 1S3HA 4LALA 4D8ZA 3IV8A 2D73A 2XIOA 3N14A 1PX4A 3FLUA 1VHNA 3CUJA 5C6MA 1V77A 1F2JA 3LQLA 3BANA 2DQXA 1H63A 1PV8A 4X9YA 3WX7A 3JW7A 1UUMA 1O5QA 3L4TA 4QSFA 2YB4A 4S23A 2VJXA 1VIZA 5E9AA 5A6TC 1E3ZA 1A5SA 4M80A 1M7XA 1AH0A 3D3AA 1TRIA 2HK0A 3PK7A 1EA9C 1XISA 4YWSA 3W6LA 4LAUA 2ZX5A 4GKTA 3R43A 3MSRA 1JCXA 2DJLA 2ACUA 1MW0A 3MJMA 3LPPA 1DIEA 3IWPA 5JH1A 3ATYA 3T8LA 3C0SA 4WR3A 3G1HA 5HJXA 1V7YA 5HQEA 3JUGA 3UP8A 5C5YA 1QWGA 3RPMA 1IEIA 4CN6A 2QDEA 1SM9A 5BMXA 4LJ3A 3CB3A 5LA1A 2QVNA 4JL2A 4QXIA 1SVDA 1BYDA 3EGJA 1UZ4A 2VFFA 1BD0A 1KCLA 1FRBA 1VEPA 2V5KA 1GEHA 3O16A 4S1FA 2WZIA 4GQ0A 1E6SM 2R91A 3NNTA 1MUCA 1G94A 1TE1A 3U5YA 3W7NA 2Y7DA 4PCPA 2P1FA 3MVTA 4P7NA 1NQ6A 2E9LA 3U4AA 4ZB5A 5I78A 4IGHA 2CNCA 2VOTA 3CH0A 1PIIA 3BICA 1RHCA 3B8IA 4IMEA 3LXCA 4HU3A 3H2NA 1IGSA 4V28A 4I6VA 2WPBA 3LB0A 4IJRA 1Q5MA 1P7TA 1H0IA 1XBYA 3G3MA 3I7QA 3AICA 5I03A 1AG1O 2IUZA 4N4QA 4B2DD 1A3WA 1ZTVA 3C2YA 3L2LA 5IXEA 5CGQA 3NDZA 4ZQPA 1UD5A 3ENLA 4PODA 4NZJA 1E9IA 4MFDA 2VX7A 1A5OC 3AHTA 2E3ZA 1CXHA 2GGIA 5C0QA 2O92A 3BV4A 4FOUA 2J88A 2JF6A 3EWDA 4OECA 3GTFA 2VEMA 3QC0A 3QHOA 3H4XA 1J2BA 3W26A 4TTUA 4HJFA 3B04A 4Z1BA 1LCOA 5J8LA 3T0CA 4DO6A 1IR1A 2XN0A 3ZFHA 4ZFCA 2ODOA 3EWWA 4MF4A 4W7VA 3IGHX 1Z44A 3W7DA 4DNMA 5BU6A 5B7ZA 2DZAA 3U3HA 4DBSA 1EXBA 3L0NA 5E5CA 3VFLA 4EX4A 3MS8A 2VI0A 1QU4A 4XKYA 1NY1A 4UTWA 5I5RA 3QN3A 5A8PA 3W86A 2QCHA 2A7RA 5D8WA 5CCZA 4NJJA 1XS2A 2B7PA 4QX4A 3OZYA 2BGSA 2Y0FA 4RW5A 3KBNA 2HSAA 4WUIA 2V5BA 4BKNA 3MZ2A 4GUHA 2TPSA 2CETA 4C6QA 1YPXA 3M5VA 1J93A 5CXPA 3W1LA 2DT1A 3SCWA 4RE2A 2GGEA 1QOQA 4WJ8A 3VD9A 2J9ZA 3VGGA 1XC6A 2ALDA 3L4ZA 3OZPA 1TUFA 4WSKA 3WENA 3U7VA 5AC6A 1HQTA 3YPIA 5HNTA 5I3HA 2B81A 3HQOA 4IPJA 3AWOA 4UTWC 5DBUA 4ZQOA 3O15A 4BR1A 3BAJA 4C1KA 2VELA 3W7RA 5DN1A 3HPFA 4O1EA 4DXKA 5CPSA 1X96A 1S2WA 1IGWA 1NEYA 3CPGA 2J74A 4O14A 3WBWA 4O18A 2Z1KA 5HPOA 4IHCA 1XLIA 1VHCA 2OZ0A 5AC5A 1RBOB 4GINA 3RLUA 1PB0A 2FGBA 3KDNA 1MO0A 2GQAA 4V15A 4HK5A 3H24A 4PGLA 4JXCA 1GYLA 3H26A 4LS1A 1XH0A 2QUNA 3I3EA 4W87A 2JKPA 5LKYA 3LG3A 1NDWA 1R7OA 4M7SA 1G5AA 5EKYA 2V38A 3VKKA 2BBFA 4N42A 1ZSXA 1ZZMA 4DLMA 4WY0F 2DFAA 1KKOA 4GUGA 4C6KA 3M0YA 2NXIA 1OT1A 3CV7A 4XZHA 4AD5A 3MANA 3AHZA 1N82A 6REQB 4F3HA 2VZUA 1LORA 1LYXA 3GAKA 2C16A 1DOSA 1NQKA 3SEPA 4H4IA 4JN6A 1W8GA 1TPB1 4QP0A 1A47A 1EC8A 3B3DA 4AIUA 4YLWA 1LG2A 1QNQA 3VU2A 4EPEC 1ADDA 3RG6A 1YX1A 5CG7A 1RVGA 3GVQA 1H1ZA 2WNWA 4F4RA 4UTJA 3S5YA 1O5RA 3SJ3A 3MKVA 5K3VA 4JX4A 1D9EA 2E1DA 3WMBA 3CQJA 4FR6A 5I77A 4JNZA 2YW4A 3VGFA 3C4UA 3UESA 1FCUA 2GJXA 3Q94A 3S9IA 1VD6A 4HHHA 3WDPP 1QRQA 1GYNA 3FSTA 3BARA 3FN9A 2YYUA 4FF7A 2DP3A 2ZA2A 2VKZG 1XLBA 3DHPA 3S42A 1RSCA 1UD2A 2VVSA 2CHNA 3DG7A 2XWEA 2ZICA 4NY2A 2ON3A 4JX5A 4LWWA 3LRMA 3O6DA 3UR2A 4Y9PA 3UF9A 1T6MA 2XN2A 5HPCA 2UWFA 3HURA 3HV8A 1KFBA 2NX3A 1QDSA 4IQDA 1W32A 2GVYA 3E2RA 1EIXA 3EWZA 4Z17A 2BY0A 1QNRA 3R7MA 1W8SA 2FZ9A 5GQBA 3M5YA 2FPVA 3VZXA 3HG5A 4JKLA 1BLIA 3GFYA 3CAWA 3CK5A 2PDUA 4FI4A 1E9LA 4XUYA 5M17A 3RRXA 2OSYA 2YDRA 5CBJA 4NHVA 4CU7A 3WDHA 1OYCA 3D46A 1YE4A 1G4SA 3C56A 2VRQA 3VM5A 4A22A 2PF0A 4TU1A 4UOJA 2UY2A 3W83A 4V1XA 1ZFJA 2PWEA 2Z25A 5FF3A 1K9FA 2PI6A 2CBVA 5H1WA 3GHTA 4M56A 4PUMA 5D9NA 2A3CA 4NP7A 4IG2B 3S2MA 2E28A 2NV2A 4Z0JA 2QULA 1UKTA 5TD4A 8XIAA 3NOYA 3POHA 4YPJA 3XISA 2D2JA 1QOXA 3N2BA 1W1YA 4NZ3A 4MY1A 4UR9A 3N9SA 3BAYA 1L6YA 2DSKA 1ME9A 3VCNA 4ERGA 1FOBA 3WJYA 3T2OA 3WQPA 3MCMA 2XDFA 5DT5A 3E02A 6A3HA 2BFGA 1CGVA 1XGDA 2C91A 3E49A 1PTDA 3STGA 2BMBA 4W93A 4YHEA 1EBGA 4N6FA 4NJKA 1VEOA 5FKYA 1VKFA 5K7JA 4IGSA 2EKCA 3TTYA 4DJDD 3ITYA 3VIJA 2VX4A 3GW3A 4JHMA 2WQPA 1TO3A 3BQ6A 4JICA 4B90A 1J0ZA 3WUFA 4KCTA 2DH2A 2FB3A 5IDZA 4AYGA 3M0MA 1IWPA 5HATA 3AU6A 4QRNA 2VOMA 4NZCA 1TJRA 3UA4A 1EDGA 4MY8A 2ZXQA 1DIDA 2OLHA 1PZ2A 1XUUA 3PVFA 3IGUA 1A3HA 1TFVA 1EQCA 3QV8A 5E0CA 3WNOA 3G2GA 3O6YX 2PP1A 1KR0A 1Y8BA 3M0VA 3WNKA 4C6FA 2ADAA 3C0LA 3DG6A 4C1NA 3TAOA 3IJ8A 5KZDA 1I1WA 4P8WA 1P0DA 1KKRA 4CLMA 4ZOEA 2CZVA 4O1AA 3W1PA 1B9BA 1ONWA 5A6AA 3O2LA 3A6OA 3B97A 3FYPA 1V8EA 1QI3A 3PJUA 4CQBA 4IIBA 4Z2HA 3S5SA 2GQ3A 4L65A 1G9HA 3INPA 2XIJA 1CXEA 1VFMA 1ZENA 4DI8A 1KM5A 1UWUA 5TQLA 5LA0A 3VUPA 2NW0A 2NSOA 4BEQA 3M1ZA 3OP2A 1E1EA 3ARYA 4MJ4A 1ISVA 1QUMA 1KTNA 1Q4NX 5K4XA 3TN5A 3BSHA 4FPSA 4UZSA 4TVUA 4DJDA 5DCDA 4BI5A 2PF8A 3KAOA 1UP3A 1ITCA 1I6NA 3FJLA 5CPOA 4HP5A 3A4AA 4XAZA 3UD6A 2ONEA 2AMGA 2CKSA 4KWSA 3WLIA 1FDYA 3S9ZA 2AQOA 3KZSA 3GUGA 1GZGA 1QCWA 3S6TA 1ZRQA 3A24A 3ANYA 1US2A 2YLLA 3T0DA 1A53A 2XGIA 4B4FA 5G2IA 5I3KA 3MP3A 3S2JA 3MDUA 3L2MA 1CB2A 3T4CA 1VFUA 4CNNA 1FWSA 1GQIA 3IIOA 2D2GA 4F2TA 3GD6A 2CCRA 1LRQA 4DJDC 1YDOA 1QBAA 2E40A 1CI1A 3VDGA 1ICSA 1ISXA 3KVJA 4WRHA 3W00A 3WF1A 3WF4A 2PDCA 5E70A 1P43A 1PTGA 2RDUA 1U1UA 2WMGA 1XF0A 4L9YA 5DO8A 2V9DA 3GRIA 2GGGA 3H2OA 1SZEA 3B0YA 3PZVA 1UZHA 4JIPA 2R8WA 1H62A 3QGVA 4LUTA 1KBJA 3BAKA 1F5ZA 4MKVA 1I0BA 4N2YA 2YCEA 3C86A 1LBLA 5I06A 5CZTA 4WDXA 2GL5A 1CBGA 4S39A 2QPSA 3MB9A 2C1GA 5HWNA 3U9IA 1HTIA 4WJEA 3C2OA 3WLLA 1EX5A 2VURA 1W1IE 4UQAA 2PDWA 1X7IA 2OZ8A 1TSIA 4BF7A 2HTMA 5FD0A 4X2RA 2Y7GA 1QW9A 1MVYA 5JQ9A 3N15A 3O7UA 1IXNA 2R1PA 4XZNX 2I16A 3WQ8A 3NDOA 1KGUA 2YW3A 3IK2A 1BTCA 2JE8A 3BW4A 1M7JA 4LVDA 3OIXA 1TE6A 1V3LA 3GIQA 3T09A 4A8IA 2Z1XA 1DWAM 3ZWSA 1TWIA 4GJ1A 1I1XA 1OB0A 1N8IA 3SUSA 1VJZA 1XIEA 2J8GA 4GJIA 3BJFA 3GYCA 2P8CA 3CLMA 3OLIA 4PTMA 4A8RA 1VFTA 3KCLA 1XR2A 3RM4A 3EA2A 4RUBA 4JD4A 4LVAA 3IVSA 4TMCA 3VIKA 4MMWA 4NZFA 2GGHA 3AS0A 2Y7EA 4C1LA 1CLVA 1H2JA 1JVNA 3XINA 2ZX9A 4HNNA 1BEUA 1K03A 3I7RA 4JTRA 3LMZA 3LV5A 1KGXA 1V0NA 5HOSA 4DAIA 3WEMA 3N04A 2WWCA 1EO5A 4G1KA 3VDAA 3URNA 2WO5A 2HVMA 1UR0A 1HL8A 3K8KA 3KVLA 3PPGA 3F2CA 3KOXA 1GPWA 1B3YA 2PC8A 2AQWA 1E71M 3H53A 4NKCA 1VFOA 2EG6A 2WAGA 2G5WA 3HQNA 3PNZA 4I9AA 2H9AB 3LUTA 1REQB 4E4PA 1FP9A 1L2UA 3A64A 4HTYA 5FAGA 3GVVA 4JTFA 1UBPC 2E7FA 3LD5A 2J8TA 1V0MA 1P6WA 1ZBKA 4IZGA 4G7FA 4LRTA 3SIMA 4LUSB 4HYRA 3VCCA 5H8PA 2ZZ7A 1VPXA 3AO0A 5AFDA 3HF3A 1G0CA 1ZJHA 3CUFA 3O1NA 1KGWA 1YXDA 4KS0A 4NU7A 4F2UA 7A3HA 4DELA 3MUY1 4DO7A 2H3DA 2QUUA 5RUBA 1R46A 1N2VA 3HU7A 1EFZA 1W1VA 3ZSTA 1OM0A 3QF0A 3S5NA 2ZX7A 1VYPX 2PGWA 1ZCCA 3FKRA 6XIMA 3CUIA 1HJQA 3NYDA 1N7KA 2Y24A 1R3RA 4U10A 3EWXA 3SI9A 2O9PA 1G7UA 3GXIA 3GXMA 4KETA 3WYZA 1NOWA 4GK8A 3I3BA 4PTDA 4PMXA 2R1MA 2QNEA 3TTOA 2GUYA 2JF7A 5ABEA 4ATDA 3GH4A 5EMJA 4MKSA 4D6FA 5CSRA 8A3HA 1LLWA 3OZMA 1HX0A 5I23A 6TIMA 5TF0A 1UD8A 4MM1A 3W37A 2XVGA 1CW2A 3NVTA 1XLDA 5I3IA 2CESA 4H7ZA 1GTEA 2TAAA 1QTWA 4PFMA 4BF9A 4LV4A 4UMCA 4K8GA 4P7RA 6PTDA 3ZLFA 1B31A 3WZ0E 2NQZA 4EPKA 3T44A 4KW2A 3MPGA 1QNSA 5F4SA 2G95A 3IEBA 2EHHA 1QI0A 4AD4A 1ZS2A 3TOPA 3DYOA 1L6FA 3M6YA 3P5ZA 4YJ5A 1C3FA 5BYWA 1V3KA 4E2VA 1K02A 3N18A 3PB0A 1JDCA 2YX0A 2HV5A 2J7FA 4UXDA 1YMYA 3PZQA 3IGSA 2OWXA 2WJDA 2PDLA 3A9BA 3TR2A 3VD4A 1CWYA 3N2XA 5HUOA 3AIRA 3ITTA 1HJVA 3DERA 5A6SA 1Q66A 4MJZA 5E09A 3CWOX 2ZDRA 1OC5A 1S5MA 3H4GA 3SZ8A 4R5EA 2HISA 1W9XA 5A3HA 3BCFA 2JKEA 3WQGA 1QHOA 3PM6A 4TUFA 2WSRA 2CLKA 1QW8A 4HZ7A 1TVNA 3UR7A 1HKMA 3D5HA 4URIA 1V02E 1T96A 2XYLA 5M5DA 2INZA 3NR0A 2VNCA 4NVTA 5M3WA 5A5WA 1HNYA 4FLRA 3AI0A 4IPPA 4I9MA 3VKAA 2ZYFA 1OFQA 5T26A 4GBDA 1EYWA 2G96A 3LHZA 3V5OA 1ONXA 1D3HA 2QVHA 2X7WA 1W3NA 4DVOA 3P62A 4HYVA 3AXXA 4DYKA 2REQA 3B9EA 4HK6A 1IEWA 1UD3A 4ACZB 4AD1A 3ZVIA 4PTXA 1J5TA 1VRDA 3RO6A 1XYMA 1W1B1 1FY6A 3WQVA 2ZA3A 4AC1X 4XIMA 3BH4A 3USBA 3OBKA 3MO4A 4E4UA 2J9YA 3CQKA 2AL2B 1WBHA 1TTJA 3CIVA 1BG9A 2QCFA 3AXIA 5REQA 2ZWYA 4RDVA 3RAOA 3WK2A 4Q4SA 3S83A 3B0VC 2OELA 2C0AA 4Q8QA 5U4NA 1L2QA 3UR5A 4XAPA 2Y61A 3CL8A 1WBJA 1SO3A 2FVMA 4H6EA 4JN7A 4CNSA 5B7YA 3ZT7A 4AZ7A 3NL5A 1S38A 2DZXA 3N12A 4C6OA 3L5AA 4M1BA 3G8EA 4RXGA 2HDJA 3PP7A 3ARPA 2WZTA 1ISWA 4JQAA 3T81A 3S1UA 3O06A 4OV4A 4YXGA 3W7EA 3EX3A 3QPYA 2BODX 4R3UA 1FDJA 2YDSA 1XI3A 4LUIA 2P0OA 1TVPA 5D9MA 1W1TA 5LIKX 1HG3A 1DV7A 4Y96A 3UJRA 4P2VA 1VJSA 1TZ9A 3RJXA 4AHQA 4XSMA 3G1VA 1OQFA 4Q6XA 1I0DA 1C8XA 1A50A 1VYRA 3LBOA 1E0WA 4OBSA 3U6WA 4Q6JA 1PTAA 4GNKB 1R2SA 1UPMB 4Q4MA 2O9OA 2VFEA 3SAZA 1Q6CA 2B7QA 3M07A 1IEXA 1PL9A 3CZEA 1GVSA 4WCJA 2PDYA 3ZJ7A 4J3WA 4RCXA 1C8YA 2XFWA 1E72M 2DZBA 1XDLA 4JQ1A 5C2CA 3TMLA 4LEQA 2BWGA 3MQTA 3PB2A 2F8QA 4JHOA 4GZJA 4H04A 2R1LA 3P61A 1J0KA 4JYEA 4LB3A 4W84A 3VX1A 4HU4A 3WD2A 2FYMA 1NDZA 1V0KA 3GQYA 1KM3A 5BOEA 1GOXA 2J6VA 4XD5A 4G1NA 4ZOCA 5LHEA 4QAWA 5CQ1A 4X9SA 5CPMA 4ADUA 4IPNB 3EMCA 2JIWA 4AZCA 1KTBA 4AX6A 1GKQA 5CJNA 5C2XA 2VVNA 4H8VA 3LCXA 4HNLA 4CN1A 1OX5A 3UGRA 4NAEA 4DZIA 3APYA 4BZYA 1KM2A 1XRFA 4M6UA 3KWXA 3SRDA 2CXEA 1ZALA 4PUEA 3ABOA 1UPPA 4ZE4A 2PZ0A 1ADSA 4JEJA 3WJSA 3UPWA 2BB0A 4IX2A 4PH6A 1WZKA 2O56A 4GZIA 4FAMA 4KFPA 1XSJA 4B3ZA 1DXIA 3TW7A 3WLPA 1M5WA 4IQLA 1K70A 2YFOA 4JFVA 4GRSA 4RE3A 3A12A 4JFWA 4D9PA 4NUWA 4MDPA 2GSEA 4DLFA 3GDRA 4O1FA 1WZMA 5MKGB 2DEPA 3REQB 2DPEA 2GQ8A 1YADA 4TOQA 5DRIA 1PPIA 4A05A 2PU1A 5BWFA 2ZZ6A 4U28A 2YBTA 4Y9MA 3SFWA 5FF0A 2ZUVA 3EMQA 2YL8A 3ZVHB 4Z1AA 1KM6A 1UZDA 1FWAC 4GVHA 3ZT5A 4Z2IA 1GUVA 1VFSA 1ZP4A 1UQYA 5I0DA 3DC0A 1EZ2A 1V3MA 3SCVA 3WNMA 1XC4A 2J24A 4HPJA 3IJ6A 2DSZA 3O6CA 2OO6A 4PMJA 3N9KA 3M5XA 1EIBA 3KXQA 1OABA 4GNJA 1RPKA 1BF6A 5M03A 1KFKA 3Q37A 4H9YA 2QJMA 4GYKA 4S3DA 1UHVA 3IJIA 3SN0A 3S3GA 2Q71A 2R14A 4AB4A 3ITLA 1IT8A 1CLXA 2OEJA 2VR5A 1KCZA 2YA2A 3CLWA 3GW0A 1E5NA 3WMLA 1AJZA 3W07A 3AZSA 1W54A 1A5NC 1JFXA 1XM3A 3VO0A 3L67A 5L6UA 4Z1CA 2QEZA 2HVOA 4GBUA 4NYYA 5C71A 1EGZA 3GKFA 1M7OA 3K4DA 4TMBA 1PUDA 3LNPA 4PC8A 1XD0A 2XFYA 4U5KA 1EYEA 5A95A 4L4MA 3GNOA 1TTQA 4E8DA 3MYOA 2HXUA 2OOGA 3QZEA 2PZNA 2ZTJA 1NOFA 3W2UA 5I3DA 2X1RA 1G01A 4BI7A 2JIEA 3T05A 1UWAA 4GIYA 3WNNA 3UCDA 5AOUA 1D8CA 1LUCB 3FDKA 4IIHA 2E67A 1JUKA 2C19A 3DKJA 3P3BA 2VX5A 3TJLA 3N4FA 3M41A 3TJXA 4F66A 3HO8A 1PHWA 1WQ5A 1QPNA 4HCHA 4KT2A 5EY5A 2XHYA 4ZA0A 4NL1A 1V4YA 1RQHA 2PDNA 4HK7A 2E5BA 1W31A 5U7SA 2DQWA 2OX1A 3DI1A 5I7GA 2DZWA 2YCLA 2RAGA 1RP8A 3GU9A 4CN4A 2Z2AA 3G18A 5IHSA 4LOCA 2XFFA 4U33A 3SUUA 3I6RA 3TZNA 3ZZ1A 2C13A 3MSYA 3W2LA 3SCNA 3EAUA 3BCDA 1JUEA 2IQTA 2VRJA 3K1GA 5HNRA 2VDGA 4MNMA 5HR7A 4DWSD 3OLGA 3R11A 2YIHA 3CYVA 4DPPA 1JI2A 3V4BA 5BU9A 1TCDA 3R8HA 3KX6A 2PP0A 3P84A 3PTKA 2ZX6A 1DJIA 1PKLA 3FAWA 5LXXA 3DAQA 1YRRA 1WB0A 3AS1A 4R27A 3VE7A 5JVLA 1EGVA 4AZ5A 3FX4A 4GI8A 2XVPA 4G6CA 3CV1A 4IMFA 2OSXA 4S3CA 3PJWA 4J9JA 1GWJA 1A5UA 3VKBA 1PBGA 3ECQA 4C90A 1UR9A 4EACA 4PR4A 2YJQA 2VC6A 3CPRA 3OA5A 4LXFA 3NQBA 3WFLA 1FHVA 1VFHA 4W89A 3W1AA 3HOJA 1OWQA 3W72A 4XISA 2EG8A 4AD0A 3DOPA 2X40A 2GVGA 4KCUA 1EP3A 4O13A 2QCGA 1PYFA 3M43A 1AK5A 3GG7A 4RNJA 4AMCA 1US3A 1OC6A 4EVZA 2YOCA 1TR1A 5B80A 5HBFA 4PMZA 3BLEA 3CNYA 4UMAA 5AHNA 4XBSA 2IQDA 3Q58A 3KLKA 3TXZA 1TPH1 4JN8A 4LNYA 3P0XA 4UQEA 1W5PA 1DWJM 1FWBC 4HZ8A 2WSPA 3VIGA 1NP0A 4DWSA 4C6DA 1DWGM 2EGZA 1M9HA 4LC6A 3TN6A 3WELA 1VBHA 2J7DA 1GOKA 2ZE3A 4EPBC 3FFSA 2P50A 1YDYA 3IUIA 3W7LA 2OOFA 1Z3NA 2NQLA 1SW3A 2NZLA 5AYZA 1V02A 4W8BA 1H41A 3PTQA 4AISA 4GY0A 4L56A 2V81A 4K2SA 2ZDSA 7PTDA 3KS6A 2DZTA 3APTA 4JTSA 2YZRA 3LX9A 1QVBA 2PGEA 4AFYA 3W1TA 1H7PA 1V3JA 4IM4A 1UROA 3LBCA 3PUDA 4O0KA 5FA5A 4IQJA 5LIWX 3GIYA 3R0UA 1X8FA 1MW3A 1I60A 3OU8A 4DWSC 3L65A 3TUUA 2P76A 3D3FA 4LF2A 4ZCWA 3VI2A 3CUXA 3CIXA 3I68A 3U8GA 2WXDM 4ALDA 3W88A 3OTRA 4A3HA 1CYGA 3W1NA 3BZJA 1GVIA 4MOZA 2C71A 2A79A 7ENLA 4MKNA 3M7WA 5JIPA 1ME8A 1SQ7A 1ZY9A 3DUGA 1LWIA 4HA3A 1WDPA 3TW6A 1VYSX 4FNSA 1KV8A 2X1UA 1Y65A 3J7HA 2J7EA 5FIPA 1KRBC 1TTPA 1XYLA 3F03K 3EA3A 4M6PA 3W7CA 2J4GA 1JCYA 5CJMA 1XLHA 4D1IA 4M1RA 2V69A 3KZPA 4ZQCA 3FY1A 4UOQA 4JL1A 1QPKA 1UKOA 3ITOA 3G6MA 5CZ0A 3WJZA 2IMRA 1PVNA 3DFTA 4YTUA 1W3KA 2WK2A 4JPGA 2EPNA 3S5ZA 1CXLA 3LM3A 5CPNA 3RPTA 4O4WA 1PO9A 1OCJA 4GLEA 3PANA 4OUEA 2EPLX 4JTEA 5H8MA 2W91A 3NPXA 3IJ9A 3AU2A 3EXSA 3RO8A 2VM8A 4FR1A 3NUKA 3A21A 5HQLA 5FEXA 3SO7A 3H70A 3HIJA 4ERAA 2GWGA 3BAXA 3GO2A 3AMLA 3TZFA 1ME7A 1W1A1 2DUAA 4LNCA 2V5JA 2DIEA 3PBMA 1RP9A 1IEVA 3W38A 3LLXA 1TQXA 1IT7A 1PX8A 3QGKC 2A21A 1OG0A 3XIMA 3UJSA 3T7VA 3QTPA 3KOWA 2EPHA 1OX6A 3NL2A 2EPKX 5HQMA 2Z1SA 3RNDA 3WEOA 1VPYA 1JEZA 4UTUA 2Z1WA 3CQ0A 1EWEA 3WIJA 3WCZA 1TPFA 3IANA 5GNYA 4CKQA 3M0XA 1OY0A 1K1DA 3BQ5A 3H7UA 2AAMA 1TV5A 1UWTA 4QDPA 5AZ0A 4XUGA 4ZL1A 4HA4A 4K68A 4JTHA 1A5MC 2PFHA 4C6PA 3ABQA 1DJXA 4CD4A 4LPCA 3WLKX 3KTXA 4HD5A 3DECA 3IK4A 4XBJA 2DSVA 3EDFA 1UC5A 1P0EA 1UCWA 3WEZA 1MQPA 2QIWA 1VLWA 1U1JA 4WGXA 3W82A 1ML1A 3KLLA 1D3GA 4QFUA 3OG3A 1NWUA 4DQWA 2VEPA 1OX4B 1E6PA 3R4IA 2NWSA 5D38A 5FJTA 1TJPA 3NXLA 1WCGA 2QV5A 1SZRA 5HK4A 1S46A 3BLLA 3TWBA 3DFQA 1V7AA 4Z42C 2W3ZA 3BLIA 1U33A 1UKSA 5XIMA 1UJPA 3PZNA 5I24A 2WZMA 4WDUA 1NWSA 3E12A 4H8HA 4HQVA 2X42A 3RMEA 2QAPA 1K9DA 1UA3A 1Z69A 5I6SA 2Y5EA 3UNDA 4IFKA 5EL1A 3BAWA 4RDZA 5CBBA 5H8UA 4DJFD 1A4MA 3BSGA 1AVAA 5K4ZA 4Q22A 3VNZA 1BGGA 1B4KA 2PSNA 2FJKA 4J35A 3SECA 1BWKA 3DKLA 4RZ6A 3W1QA 3WQWA 1M68A 4DBWA 4D6JA 3MA8A 3EEGA 1NF0A 4GO8A 2QF8A 3GXFA 3L4VA 4CD5A 4H83A 1TMQA 5I3JA 1HJUA 2CXGA 3CZGA 4L9XA 4L6HA 4W8LA 2AGTA 2PAJA 5J5DA 3HQ1A 2VZSA 3VNLA 5CH9A 1OCBA 1WXZA 1GGOA 3WMSA 1MUMA 4DF2A 4LX4A 4Q4KA 3CV6A 1UQZA 3V0UA 4UTFA 3FYOA 3UXDA 2X41A 2BHUA 3UZJA 2Q8ZA 4YL2A 1UG6A 3AMGA 2INFA 2XIBA 4AVFA 4QE5A 2X0YA 5AVNA 2EQDA 3B9AA 4QCEA 3STFA 1HT6A 3RYSA 2P3EA 1DQXA 3U2ZA 3W7IA 4H2CA 1RVKA 3K13A 5H2ZA 3FGCB 1W5QA 4M6VA 1SJAA 4L64A 4J28A 1J0JA 3FNDA 1NIUA 1Q6QA 4WK9A 3GNPA 3PPCA 5K2ZA 3AIUA 2GOUA 3N9RA 2ANUA 5HMSA 3N1AA 3KHDA 4J3VA