1HF6A

Endoglucanase cel5a from bacillus agaradhaerens in the orthorhombic crystal form in complex with cellotriose
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
b'SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE B
molecule tags Hydrolase
source organism Bacillus agaradhaerens
publication title Direct Experimental Observation of the Hydrogen-Bonding Network of a Glycosidase Along its Reaction Coordinate Revealed by Atomic Resolution Analyses of Endoglucanase Cel5A
pubmed doi rcsb
total genus 119
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hf6A00
1H4PA 1CGTA 4M8UA 3BMVA 1QBBA 1CPUA 1BFNA 5IHRA 2V3EA 1NOFA 1V3MA 2E0PA 1KWGA 1AQHA 3AIRA 3L4ZA 1MXDA 3ZT6A 1R85A 3UR8A 3ZT7A 3A4AA 2D0GA 2PF0A 4Q22A 2J7DA 1E0XA 3RPMA 1ZS2A 2VZOA 3ARRA 4GIAA 5CSUA 1E6QM 4PRWA 1KQZA 6A3HA 1VBRA 3ARZA 4PCSA 5A2AA 1V3LA 1OSEA 4P7QA 4AZ5A 1CDGA 2O9OA 1UR4A 4WKAA 2YOCA 1H3GA 1QI0A 2E8YA 1JF6A 5D4YA 1EH9A 4W84A 3GBEA 2XWDA 1OT1A 3CGTA 3WL0A 2J75A 2EPKX 4PSPA 1GOIA 2J7CA 1V3HA 3SCTA 3VO0A 3LMYA 4W7WA 5JBDA 2WC4A 3VGGA 1JZ5A 3ZJ7A 1H11A 4BQ5A 2GVYA 2ZWYA 1WDSA 3W28A 3NSXA 2F8QA 2BV9A 2XM2A 2Q8XA 3WNPA 2OWXA 2G8ZA 1CYGA 1KBKA 4CN1A 2VI0A 3IJ7A 1V02A 4P7RA 4GZIA 3T09A 1B3YA 4AYSA 5A6BD 3VGHA 2CESA 1QI2A 3CLWA 1WP6A 3VIHA 3DYMA 3L4YA 5FL1A 4QAWA 3VIOA 1Y7VA 3TTOA 2CCRA 2QMJA 2WM0A 2QF8A 3MV11 1UG6A 4GZJA 4W85A 4W8AA 3M6DA 5F7UA 4AY1A 1JNDA 4ACZA 4D6GA 5CSYA 2ZX6A 2XPKA 1IZJA 3K4DA 1D7FA 1HF6A 1C8QA 2ZOXA 5E6ZA 2CPUA 1E4LA 4S3JA 4PN2A 4KGLA 1E40A 3IAPA 1DTUA 2BY2A 4URIA 2Y5EA 1PAMA 5A6AA 3WMCA 1W9XA 3VDAA 3MV01 4C7FA 5E0FA 2OWCA 4KRUA 4HPGA 3U5UA 1ISVA 2OYKA 2XJ7A 1JNEA 2VNCA 1VEMA 4L4OA 1UD8A 1DWAM 4AC1X 1HJWA 3CMGA 1ZU8A 1W3LA 2QPUA 3SCWA 5HPOA 4W93A 4JFTA 1FOBA 4U3CA 4AIEA 1UWSA 1FH7A 3RJXA 8A3HA 2D2OA 2J8FA 3BGAA 2V3FA 3VD7A 4P8XA 4U31A 4UZSA 5M3WA 4KWUA 4GXPA 2NSXA 3AXHA 3WUEA 4UQEA 2FDMA 4HOWA 3BAIA 3PTQA 4K68A 3T08A 1H0IA 1HVXA 4P8VA 3IAQA 1JAEA 3CUFA 4DWSD 3EMCA 4LPCA 1PZ2A 2UWFA 2XGIA 2WMIA 1VJSA 1HP4A 2WVTA 3ZJ6A 4U3AA 3THCA 4AW7A 2JIEA 2XVLA 4F9JA 1B90A 3VUPA 3W81A 4Z2GA 5C8BB 1TCMA 1CGUA 2EBNA 4PTVA 5GNXA 3OBAA 2NW0A 3OB8A 4LYPA 1UH2A 1UKTA 1VRXA 4NI3A 3KE0A 3KZSA 3W25A 4A3HA 4AISA 1RH9A 5CJ5A 5CGMA 5I24A 2BHUA 3RJYA 1W9BM 1BAGA 3W26A 4XZBA 4CD7A 4TUFA 2ZX7A 1V0LA 3AHYA 1E1EA 3EYPA 1DWGM 3AQUA 1W9UA 3VMNA 1EO5A 5A94A 2VZVA 1AMYA 2YA1A 1I75A 2FHFA 1Q6EA 1CEOA 2VX7A 2WYSA 3BAKA 1R87A 4QLJA 4GINA 3SUVA 2PBGA 1RD6A 1QHPA 3AMDA 1GORA 4AD1A 2E40A 3WELA 5A8PA 2DSZA 1OD0A 1XYFA 4N0RA 4AZGA 1QVBA 3VM5A 3UESA 1E55A 3NIYA 5JUVA 4HMCA 1LLOA 3AHTA 3ARUA 1GOKA 4MAVA 3WQ8A 1H5VA 3AIUA 3GH5A 3L2MA 1UQYA 1E5JA 4HZ8A 2X0HA 1PX3A 1HJQA 2W5FA 1JXKA 2CBVA 4GPNA 2ZICA 3NSMA 2XFFA 3AZSA 1B2YA 2YA0A 1XC6A 2YDQA 4JL2A 2GJXA 3GDBA 1V6WA 3VGDA 2DT3A 3WDHA 2W91A 2C0HA 3UG5A 1WE5A 4B9ZA 1BLIA 4OJYA 2BVDA 3WSUA 2XHYA 1QNQA 3WN6A 3MSGA 1Q6FA 3WMSA 3PZGA 5BWFA 1K6AA 4DWSB 5BCAA 3T2OA 1SFSA 4JCLA 4KH2A 1J11A 1RP8A 5DT5A 2DH3A 1WZKA 2WMJA 3NSNA 4JZ5A 1M7XA 1VIWA 2VVNA 1UZ1A 3WBEA 4FLOA 2E9MA 5FOOA 3CZ8A 3KL5A 2DPEA 4JFWA 2ZXAA 3ZQ9A 4EKJA 3VDCA 1EOKA 2CBIA 2QMKA 3DECA 2ZUWA 5D8WA 1QNRA 4TX6A 1BG4A 2WMGA 1CGXA 1VENA 4IUGA 5M5DA 1ITCA 2DSWA 4QCEA 3BMWA 3ARPA 3WQ6A 1ITXA 3FW6A 4EE9A 4JKLA 2CKSA 4OBRA 4H2CA 2MANA 4ATLA 1NWUA 3SCSA 2A3BA 3W0KA 2XIIA 1DWIM 1E4MM 2GJPA 3TTSA 1V6VA 1V02E 3ALFA 5FL0A 3W53A 3WY1A 5AC5A 1OIMA 2ESCA 2DIJA 3K8MA 3T0AA 2VR5A 2CITA 3GNPA 2O9RA 2OYLA 2VL4A 4TTGA 1QI5A 1QOXA 1E6NA 3GH7A 3THDA 9CGTA 5ABFB 4P7OA 2J7BA 1UR2A 1W3JA 2DSVA 3SCUA 1HJUA 5D8ZA 1CZ1A 4D6DA 4D6IA 3SUSA 1ECEA 8CGTA 2Y2WA 1BF2A 1JD9A 1QPKA 1J01A 1JIBA 3ECQA 3PZNA 3M46A 1FP8A 1GONA 1BGAA 1C90A 2W61A 4DM2A 1CLXA 3TA9A 3VM7A 4PTMA 3VVGA 3WD0A 3AJ7A 4PMVA 2GK1B 2ZX9A 1KGUA 1V6YA 4AZ6A 3WDRA 3BAWA 2J74A 5KZ6A 2W67A 4NRRA 5M17A 5BRPA 4DUVA 3PZVA 1UKPA 3PZUA 4M82A 3W37A 1ZBVA 4PUDA 2W63A 1L0PA 2QHAA 1ZJAA 3MUY1 2QLYA 2XIBA 3N1AA 1L8NA 5AC4A 1J0YA 1K9EA 2CERA 3BCFA 3W27A 1U33A 1G01A 4AZHA 3VD4A 1JYVA 4ACYA 3AMLA 3BXWA 3A3HA 4XZWA 3EMQA 2A3CA 2WLYA 2Z1KA 4ATDA 1E9LA 1LL6A 4OIFA 1SMAA 1UWTA 1GW1A 2BXZA 2JIWA 1HX0A 1J0ZA 1YHTA 3AHVA 1GQJA 1E5NA 5D9OA 4ZENA 3WH5A 2X8RA 3ARYA 4V28A 3UERA 2OSYA 2WZHA 1W1YA 3WD2A 2XYLA 1UHVA 1UZ4A 2W4XA 4TX8A 3VD9A 5I6SA 2WBGA 1E4IA 2VCCA 2WLZA 4W87A 3MUAA 5GNYA 1VF8A 1PIGA 1LG1A 3PBGA 1EOMA 1C3FA 1D3CA 1B1YA 2XWEA 1EXPA 1XH2A 1TVNA 2DT2A 5A8NA 3OIHA 2CHNA 2DIEA 2VTFA 1BVNP 1C8YA 3O2LA 4W88A 3N11A 5ECUA 3L4WA 3SCPA 3PZ9A 2RGMA 4MAZA 4UOQA 1TA3A 4UCFA 3AS2A 1HT6A 3MMWA 4UZUA 4J3XA 1WNOA 2G41A 2XVGA 3WNOA 3MANA 1W1VA 1BSIA 3O9NA 1EDGA 3POCA 4HA4A 5JIWA 4CCDA 2D3NA 1E6SM 5IXEA 3AIVA 1GOMA 4CCEA 5C70A 4QLKA 3WEOA 2JEQA 2EXOA 2ZUSA 1PIFA 1DHKA 1GNXA 2XG9A 2D0FA 3I3BA 3SUTA 4PMUA 1KGXA 1OBAA 4HU0A 1C8XA 4PTXA 2G3JA 3T2QA 4JCMA 5I23A 1JGIA 1OGSA 3WF4A 1ZB5A 1C93A 2IXVA 7CGTA 1XRVA 3WF0A 1UR9A 2FH6A 3AIEA 4FLSA 2DT1A 4CU6A 4M80A 4CN4A 1XD1A 4BQ4A 4AEEA 2WNWA 3OLDA 1GJWA 5M03A 1VFFA 3PZIA 4TVUA 1PX8A 3AIBA 4J3WA 2GDVA 3FY1A 1KCKA 1P6WA 1OCQA 4MJ2A 1WDRA 1GHRA 2JEPA 3MUZ1 4XUYA 3PZOA 2PWHA 1CXFA 3SIMA 1JZ7A 1XH1A 7A3HA 1E73M 1C7TA 3VGFA 3VU2A 1JZ3A 4M24A 1UYQA 1JFXA 1FA2A 3UETA 5A3HA 1LWJA 3IJ9A 4PMXA 5A6KA 3RIKA 1VBUA 1QBAA 1UD2A 2E4TA 2XGBA 5ABHA 3WUBA 1W91A 3DC0A 1ZBKA 1W1PA 2ZX8A 1J0IA 2FGZA 4WLCA 5DEZA 4P8UA 3F5LA 4E8DA 1KBBA 4J3VA 4UQAA 1KXQA 3TP4A 4BCEA 2TAAA 1GVIA 4MB5A 2WANA 4Y7EA 3VD5A 5HBFA 5GQBA 1US2A 2YA2A 1F4AA 2WMHA 3T0DA 4QP0A 3ZR6A 3MMDA 3TOPA 4WF7A 5A2CA 4FLQA 4UFKA 4N42A 3VGEA 4E4PA 3EMZA 2YBTA 3BSGA 3CUJA 5CLTA 2ZUNA 1MW2A 2VUYA 3B9DA 3DHUA 3LPGA 1FHLA 3I3EA 1ISWA 2JE8A 1MW0A 3D5HA 1XV8A 3PTMA 4AIOA 3ARSA 1H49A 2BHZA 1UD4A 3T2PA 3JUGA 1TR1A 2D3LA 1JF5A 3OGVA 2VQUA 1X1NA 2DQXA 4ZE5A 1U2YA 1IT0A 5HPCA 1QW9A 1EO7A 3GH4A 5DMYA 2PI6A 3GXMA 1ISXA 1KCLA 3F4VA 1O6IA 1GHSA 3ZJ8A 1CGYA 2EPMX 2WSKA 1JYWA 4H41A 1HNYA 3SUUA 4H8VA 2YIHA 2XFYA 2G4FA 2UY4A 4GZEA 4PBGA 2Y8VA 4MTVA 2EPOA 3I3DA 1JYNA 4QCFA 4AIUA 3OA5A 1E3XA 4PMZA 2BNJA 1UA7A 4PMNA 3RMEA 2GJXB 2HISA 3N17A 3FHAA 3AIQA 4M29A 2ZE0A 1B30A 4AXNA 3QR3A 4GI6A 1E4NA 3A4XA 3G6LA 3SCRA 4HA1A 3BAXA 1MW3A 1XH0A 2A3AA 3W4RA 1A47A 3WD1A 2GDUA 2WCGA 4V2XA 4CD8A 4MDPA 3K1DA 1W3KA 4X0NA 4JFSA 4HPHA 4F66A 1JYXA 2XTKA 4ML4A 5I2UA 3PN8A 4PMDA 2OYMA 3VIIA 3N04A 2CEQA 1NARA 3WH7A 2WAGA 3FHQA 2D1ZA 3BC9A 1JDDA 5A69A 4AZBA 3ZMRA 1IZKA 2J4GA 2UY2A 3G6MA 3OLEA 1UKSA 2XVNA 1HKMA 1E6PA 3UG4A 2UY3A 1W2VA 1B9ZA 3M07A 3UCQA 2J78A 1MQPA 5A8QA 2IUZA 1UD5A 1HKJA 1TA3B 4OKDA 1E0WA 1LG2A 3AXXA 5JBEA 4B16A 2FHCA 2ZX5A 1HN1A 2G3MA 3APGA 3BAYA 2J7GA 3BLPX 3FAWA 3GXDA 1WZMA 5A2BA 3WH6A 3EDFA 4LQ1A 3AS0A 3VD3A 3GBDA 1G1YA 5DF0A 2QV4A 3N15A 1DEDA 2JALA 3DYOA 3WH9A 1H1NA 4UFIA 3EDDA 4A3YA 1NWTA 3U57A 3RCNA 4UFMA 1J18A 5IDIA 5BXRA 4CU7A 2OSXA 4C7GA 3W6LA 3PTKA 2WW5A 3OGRA 1E56A 5AYBA 1GUVA 3RDKA 4P7LA 4X9YA 2V5CA 3B9EA 1CLVA 2EJ1A 4GKLA 4CKQA 1O7AA 4B3KA 1S46A 2E8ZA 5TD4A 3AXIA 3VDBA 4H8HA 3W6MA 2CBJA 4UQCA 5I77A 4HP5A 4V27A 5EMYA 1HJXA 3CZGA 1CENA 1RPKA 5I3DA 1WCGA 2C7FA 3WL1A 3DYPA 3IANA 2W62A 1LWHA 1DWFM 4FK9A 2Y8KA 3RM4A 3IK2A 3UG3A 1UWUA 3VIPA 1H0GA 2D22A 1CXLA 2CETA 1X6NA 2CNCA 5DT7A 3WH8A 4W7VA 4U5KA 1JZ8A 1G5AA 4H7VA 3AZRA 1V3JA 1GOWA 1EIBA 4WSJA 2D24A 1UD6A 4P7NA 4DUWA 4CVWA 2XVPA 3AZTA 1UWIA 1ZBWA 3GM8A 5AYIA 1QNSA 3K8LA 2GK1A 3QGVA 1OINA 4B3LA 5I0DA 1GPFA 1E43A 4J3SA 1HJVA 5HDRA 4Z2IA 3WEMA 3WQ4A 5C71A 1XD0A 1SR0A 4PYSA 1NP2A 4D71A 3VMOA 2IXUA 2GSJA 3CHEA 1GOOA 1JDAA 1MXGA 4AD5A 1V6XA 2BY0A 5BYWA 3ZR5A 1UOKA 4U33A 5A8OA 3WDJA 1QW8A 3L4XA 4RE2A 1KQYA 2Z1SA 4UFLA 1GQLA 1C7SA 3OLIA 1HL9A 4PMRA 4TTUA 5ABFA 4AZIA 1B3WA 4OUEA 3WQWA 2WVVB 1XCWA 1OD8A 1J0KA 4WJXA 4YN5A 1J0HA 1E15A 3SCOA 1LL4A 4GO8A 1LQ0A 3AI0A 1FH9A 3PHAA 3O6AA 1XHGA 4WK9A 1HJSA 4PMYA 3LPFA 4D6HA 4PEEA 4PSRA 1U30A 2GUYA 2F61A 4QDMA 3BLKA 1M04A 3CPUA 3ZM8A 3RM9A 4H8UA 3BH4A 3MUIA 3WBAA 1NWSA 1WPCA 3BAJA 1UR0A 3KL0A 3LPPA 4PCTA 1QI3A 2VRJA 3D3AA 3WF2A 2PB1A 3ZOAA 2E3ZA 4J28A 4D1IA 3ZIZA 4Z2KA 2VOTA 4CGTA 1QNPA 2XSAA 4ZE4A 4GQRA 4C7DA 4CUCA 4E8CA 3ARXA 4GI9A 3LPOA 5CXPA 4AD2A 1FFQA 5BROA 3WQVA 3CTTA 3ALGA 2J7EA 1OGGA 4DWSA 4ZXOA 4NRSA 1TMQA 3KWXA 1XGZA 3VGBA 3ARQA 6TAAA 3N18A 4Z2LA 2D20A 3AS1A 1V0MA 2WZEA 2PWDA 1DWHM 4CD6A 1VJZA 1ZBCA 1NM9A 1OGBA 2EEXA 2BS9A 3QOKA 3WENA 5EBAA 2XM1A 3NYDA 3WEZA 1MFUA 3QHNA 5HXMA 3AICA 1HXJA 1IV8A 3KL3A 1Q4NX 1VEPA 1VB9A 1M01A 1UR1A 1B0IA 3WMBA 1Q6DA 1Q6CA 2XSBA 3CH9A 5HOSA 4F8XA 1J9YA 2V3GA 1W2PA 1KFWA 5D9MA 3AFBA 2BHYA 3CHDA 2BFGA 2EO7A 2AOSA 1PX4A 3F5JA 3FXYA 3U5YA 5A6BA 3KEHA 3GNOA 4FLRA 3B9AA 4JHOA 2HVMA 1KGWA 3EDKA 2VQTA 3RM8A 1EDTA 3SURA 3VPLA 5LA1A 5I78A 2J79A 3OLGA 5EFDA 1XSIA 5E70A 1H41A 4PMQA 4XV0A 2VX6A 1F4HA 3E1F1 4WSKA 1HVQA 1EGZA 3VKKA 2CKRA 4YHEA 4L4PA 2VO5A 1C92A 1VEOA 3NJ3A 4IISA 1RP9A 4DM1A 2WMFA 4XB3A 2JF6A 3PZQA 4ZFMA 4AWEA 2X1IA 4JFUA 1R7OA 4B9YA 3ARWA 4MDOA 2J47A 2VZTA 2XVKA 5A6JA 2BXYA 4U5IA 2W66A 4MADA 1W32A 3EDJA 4RE4A 1OB0A 3FAXA 3SCVA 4UOZA 4BA0A 2WZIA 2YDSA 5FD0A 5LA2A 2WMIB 3AHZA 4J27A 4GQQA 3F5KA 3WUGA 2VRQA 1V08A 5E09A 2X0YA 4W5UA 2BY3A 1MFVA 3EBVA 1B3VA 5FKYA 3BSHA 2O9TA 2DSKA 2WCSA 1UD3A 4HZ7A 2CHOA 1R86A 5AY7A 3VMPA 3CO4A 4CU8A 3PZMA 3WNNA 4Q7NA 3GXFA 3S6TA 3UEQA 4WKFA 1TUXA 1BYCA 2VJXA 1OWQA 3AMGA 1KXVA 2ZUVA 4JIEA 1XSJA 5CPTA 3WDIA 4AMCA 1B3ZA 1PPIA 2WK2A 4XX6A 1G94A 4AZCA 1WZLA 5CG0A 3WF1A 2WSPA 3CMJA 2VX4A 2A3EA 2X05A 2VCAA 3CZKA 1H09A 1JXJA 4X0VA 4MB1A 5CGTA 1E71M 1GOQA 1VFMA 3MS8A 1EHAA 4NZCA 1BYBA 2VX5A 3WD3A 4JKKA 5A6SA 2YBUA 1E6ZA 4CD4A 4MPKA 4D6JA 1M53A 2XFRA 1PJ9A 5CQ1A 1QI4A 2CIPA 5A6MA 3ZSTA 4BQ2A 4AD4A 3WNKA 4DWSC 4MNLA 1BQCA 5E6YA 2YL6A 3VOCA 4Z2HA 3RO8A 1GVYA 1XYZA 1OM0A 1HP5A 2J8GA 4ACZB 2WB5A 2WHKA 3OGSA 1NH6A 3MO4A 3VIGA 3ZO9A 5CPQA 2W92A 4JAWA 1OT2A 4UFHA 4P8WA 3W29A 3SCNA 3VIKA 1NOUA 3WIJA 1FHDA 2WVSA 2G3NA 6CGTA 3MKKA 4HU8A 3VILA 4OOZA 5FIPA 2FHBA 4PMOA 1V0KA 3K46A 1WDPA 2D0HA 1C91A 1PZ3A 3WD4A 1UKQA 3OZOA 2NT0A 2PWFA 1I1WA 1R8LA 4HTYA 3MMUA 1E6XM 2ZUUA 1EA9C 2D23A 2OLHA 3S2CA 1TG7A 1BPLB 4HA3A 4M1RA 1WO2A 1V3IA 4TOQA 3CHFA 3CUIA 3AMKA 3OG2A 1JG9A 4TXEA 3QOMA 4M56A 2J25A 1MQRA 4MNKA 3VX1A 3QHOA 4KRTA 3VIMA 4R27A 4JL1A 1VAHA 5DO8A 4EANA 5D9PA 1LF1A 2JF7A 1CXIA 5EFFA 2YJQA 1CXEA 1V3KA 3AYSA 4ZEPA 1TVPA 1M03A 2DT0A 4KGJA 2ZWZA 4ZXLA 2YLAA 3CZJA 3HJEA 5KEZA 4W8LA 4IM4A 4R5EA 3WDQA 3II1A 1R7AA 3CUGA 1XSKA 3IJ8A 3ZT5A 1OIFA 4AD3A 3FN9A 3A6OA 3L4TA 1W1TA 4JFVA 2CBUA 4S3KA 1TE1A 1CWYA 1ZL1A 3ARVA 4J3UA 3WDPP 1UR8A 5I79A 1ESWA 1BYAA 3CIVA 1WZAA 3A47A 2E9BA 3VX0A 4HOXA 3B8SA 3HU7A 2A3HA 4UTFA 1TFVA 4MNMA 2WHJA 2V3DA 3PZTA 4GI8A 5ABGA 5JBFA 1VFOA 4OZOA 3TTYA 2CYGA 1MYRA 1VFUA 1ISYA 1AQMA 4J3TA 1Z32X 1LL7A 2B31A 1CXHA 1KR0A 3W82A 3WFLA 2DSUA 4H04A 2DDXA 3TTQA 3VNZA 4AEFA 4IPNB 4UR9A 1HKIA 1H2JA 4WKHA 2Y4SA 1JDCA 3QHMA 4NF7A 1HKKA 4RE3A 4OBSA 4W89A 1W9PA 3GXIA 5IFPA 2WCAA 3AYRA 1HL8A 1W9VA 1JAKA 3VINA 2BVYA 2J7HA 4W5ZA 2ZUTA 1UWQA 3VTRA 3EDEA 2O92A 1JZ4A 1TZ7A 1CBGA 3OZPA 3AROA 3RILA 1K9FA 1A3HA 5D9NA 1JZ6A 2XUCA 4RL3A 2YDRA 3FNDA 2WKLA 2RGLA 4AZ7A 2VRKA 1LJYA 4W8BA 1ZJBA 2DGAA 1ODZA 4QLLA 4MJ4A 2WKGA 1AVAA 1V6UA 1EDQA 3L4VA 1BVZA 1MVYA 1UA3A 3K8KA 1CTNA 2V5DA 1BHGA 1K9DA 3GNRA 1DP0A 3HN3A 2J7FA 1NP0A 3U7BA 2UY5A 3AHXA 2WPGA 4UQ9A 4CN6A 1E1FA 4TVDA 2ZXDA 3L2LA 4E2OA 1PEZA 4D6FA 4GO9A 4CVUA 1G9HA 3W38A 4U2YA 2EQDA 5I5RA 5IHSA 1KXHA 2Y24A 2YL8A 1J10A 3K4AA 2WMKA 2V38A 4LXFA 2AAAA 1JI1A 5GPRA 1UH3A 1CECA 3GTNA 3GYCA 3WNLA 1BYDA 2FH8A 2PWEA 1CGVA 3T0BA 3MSDA 1V0NA 2NT1A 3TONA 4CCCA 4HOZA 2O9PA 1X6LA 1CGWA 3A4WA 2J77A 2PWGA 2WC3A 4FMVA 5A6LA 2GFTA 3NDZA 4LYRA 3SEPA 1BTCA 1WB0A 5A1AA 1G0CA 4MB3A 1UQZA 1UKOA 3WNMA 1YQ2A 2X2YA 4UNIA 3VIFA 1WDQA 7TAAA 1UUQA 2F2HA 3AOFA 1KR1A 4JKMA 4HMDA 1KWKA 1ISZA 2VT0A 3CZLA 4EK7A 2WWDA 4D6CA 3CUHA 4YPJA 4AD0A 2WC7A 1JI2A 2YL9A 4IPLA 1KXTA 3UR7A 4F9DA 2BY1A 1MW1A 1FFRA 4BS0A 4UFJA 1GZJA 3AISA 2ZIDA 5FCZA 4EAMA 3J7HA 4UQBA 1CIUA 3VNYA 4CD5A 1US3A 4ATWA 3DHPA 2VC9A 1NOWA 1EQCA 4U2ZA 1MQQA 1J12A 3VIJA 3WKZA 4W7UA 2VZUA 2J62A 2ZXBA 2YL5A 4D6EA 4F79A 4HZ6A 4AZCB 5JIPA 1V03A 1E0VA 2VZSA 3L4UA 2CXGA 4LGXA 1PBGA 1CNVA 3CZEA 2WHMA 5DFAA 1JD7A 2VCBA 3GZAA 2FGLA 2PBOA 2YLLA 4LX4A 2VVSA 2EPNA 5CZKA 3AS3A 1W9DM 3CBWA 4YHGA 4BF7A 3N12A 3CHCA 1XCXA 2YKKA 3SUWA 3N13A 1Q6GA 2DEPA 1WKYA 5CLWA 4LYQA 3VDHA 1MWOA 1WAWA 4OOUA 1I1XA 2X09A 3MU7A 1FH8A 1BGGA 4BQ3A 2QPSA 1DWJM 2E9LA 1E6RA 1CXKA 1NWRA 4FF5A 4D1JA 2AMGA 4PUEA 4QFUA 1JL8A 5LYRA 2OSWA 2GJRA 1N82A 2ZXQA 5E0CA 3N9KA 2BVTA 3BCDA 2WWCA 4W86A 5LA0A 1GQKA 2WVVA 5EB8A 5BRQA 5BXTA 2PC8A 4PTWA 4Z2JA 5E9AA 4JHZA 4NSBA 2WVUA 1AQ0A 3POHA 4UQDA 2JFEX 1JFHA 1GCYA 1J0JA 3NDYA 1E3ZA 2ZUMA 5IFTA 2VMFA 4KMQA 5HNNA 3W24A 1ODUA 1QHZA 3ARTA 2EPLX 4A4AA 4BZYA 4DUXA 1B3XA 1GQIA 1UWRA 1K9TA 1SMDA 1E72M 3AMCA 1SYTA 1QHOA 5BXSA 1B31A 2DH2A 3ZSSA 4MB4A 4D72A 1JZ2A 1UH4A 3U7VA 5ABEA 3AIWA 1BG9A 3ZJKA 3WFZA 1D2KA 4M81A 1E70M 1HIZA 2G3IA 1EHNA 1FP9A 5A8MA 2OWWA 1EQPA 3WF3A 3WQ5A 1GJUA 2WBKA 2WXDM 1W3HA 4TVCA 4MNJA 5A95A 2VR4A 1QNOA 2VURA 4J7RA 3NUKA 4WIWA 2C8NA 3WUFA 3NCOA 4B15A 5CPSA 3HMCA 1KB3A 1NQ6A 4HMEA 3M7SA 2WHLA 5BXPA 4UOJA 5GNZA 3SCQA
chains in the Genus database with same CATH superfamily
1H4PA 4M8UA 2FPVA 4NASA 2GOUA 1R6WA 4UTHA 5IHRA 2V3EA 3QTGA 1E0UA 1G4PA 1P7TB 1NOFA 1FXPA 1ZLPA 3K1GA 3L67A 1MRAA 3ZT6A 2KZHA 3ZT7A 2Z1WA 2J7DA 1ZS2A 3HG3A 3I7QA 4JIRA 4GIAA 4O18A 3BURA 1DJHA 1VBRA 1VYPX 2GGIA 4M5PA 1OSEA 1S5TA 1UR4A 4LF2A 4HD5A 4O54A 3NPVA 2E8YA 3WLQA 1H7RA 1NF0A 4LU0A 3GZ3A 5D4YA 1FWSA 3CV7A 3RPDA 3WL0A 3QFWA 1Z44A 1OFBA 2J7CA 3M5VA 1V3HA 3SCTA 4GBDA 1A4MA 3E0IA 3VGGA 1OFAA 1I0BA 2VDIA 3OO2A 3WK2A 2DORA 2ZWYA 1WDSA 3W28A 2VD9A 3T6CA 2VGBA 2GVGA 1EX1A 5D04C 3FIGA 3TYZA 3DC8A 2OWXA 2WJEA 2G8ZA 1RCXB 1KBKA 3PJUA 4CN1A 1V02A 4P7RA 3OBEA 4GZIA 3T09A 2XGZA 1EXBA 3QMTA 3IK4A 1A3XA 5E93A 3CLWA 1WP6A 3VIHA 4K1WA 4QAWA 3VIOA 1Y7VA 4Y9OA 3DERA 5KSWA 3MV11 3TSDA 1KV5A 1Z8AA 3HQNA 3DHDA 4ACZA 4IGMA 2XPKA 1IZJA 1H7XA 5H1WA 1D7FA 4LCSA 1HF6A 3P60A 3DHFA 1ICSA 5I3GA 3RLGA 2ZOXA 2YCLB 1E40A 1IIGA 3T78A 1EF2A 3IAPA 3FYOA 4NZ1A 1W1A1 1YE6A 3WMCA 4ZOAA 4Z1DA 3MV01 4DZAA 4O17A 1JUEA 3RXZA 3V5FA 2OWCA 2IQ0A 1ISVA 2OYKA 1EJTC 1DJWA 3W7NA 1JNEA 3WZ0E 4PRRA 2QJNA 2YB4A 3OVPA 3TU9A 1HJWA 1F3TA 2PEVA 4QJ5B 1ICPA 5BZAA 4YTTA 4W93A 1MRQA 2QR6A 3N4EA 3TZFA 3WO8A 3MI6A 4U3CA 4AIEA 3RJXA 3I7RA 8A3HA 1M7OA 2VFHA 4MZ8A 4QJ4B 2QCFA 3MZ2A 2GVJA 1FWDC 1XIGA 2PDLA 1TKKA 2Y5JA 3WUEA 2V69A 4UQEA 1A5CA 3BAIA 4EF9A 3LGEA 3PTQA 1ZSXA 5FA5A 3VKAA 1XBYA 2HSAA 2W9MA 2ZZ3A 1JAEA 2XH4A 1FXQA 3E0FA 3T1GA 1CW2A 1HP4A 4MY9A 4U3AA 3THCA 2A5HA 1B90A 1TCMA 1CGUA 2EBNA 3GUGA 1KCZA 3C56A 2ISFA 1VRXA 5GVJA 2IKHA 3M0MA 5CJ5A 1SO5A 2J9YA 4JQ2A 5DMMA 2BHUA 1BAGA 1FWFC 1GYMA 2QUMA 4TUFA 2ZX7A 3AHYA 3I6TA 2G50A 3QLDA 3GTHA 1V8EA 4UR7A 4H4IA 1B4KA 2VX7A 3BAKA 3RYSA 1R87A 4QLJA 3HGOA 3B8TA 1VFLA 1ALDA 1RD6A 1F8IA 4LCRA 4JTRA 1F7BA 4TV6A 1FRBA 3WELA 5A8PA 3F4CA 1XYFA 4NXSA 4KEMA 1IXPA 4WVXA 5G2WA 1R3SA 1P0DA 3ARUA 2IW0A 5LHEA 2OEKA 4DXKA 1PX3A 4MLRA 4ES4A 1JXKA 2QVNA 3F2CA 1XLKA 4WHBA 3IVSA 3U2OA 4R33A 3VGDA 3WK3A 3GR4A 4W9TA 1R47A 2PDPA 5FAGA 4ADTA 1VIZA 1K02A 2BVWA 3ITOA 1OEPA 2X1TA 1B3OA 3GHUA 5BWFA 4O1AA 5BCAA 3T2OA 5HWMA 1R46A 5DT5A 4GOAA 3LCXA 2A21A 4H9TA 1VIWA 2GWGA 2VVNA 4NNAA 4H19A 3PNZA 4C6CA 5DANA 4EKJA 4E4UA 1EOKA 3BLDA 2C0AA 1CGXA 2NUXA 4O1CA 4O19A 1AFSA 2D2GA 1ITCA 4Q8WA 2AGKA 1O4UA 4ENLA 3V36A 3FW6A 4DY1A 3FV9A 4OBRA 3T8LA 1UROA 3UCCA 4LWWA 4XAGA 1NWUA 2DZXA 3NL2A 3W0KA 3GG1A 1E4MM 1OABA 3THAA 3TTSA 1EUAA 4Z17A 3WY1A 1OIMA 2ESCA 2DIJA 4PCNA 4XD6A 1K3UA 2XDFA 3MSYA 4Z1CA 2CITA 3RCYA 3GXNA 2VL4A 4E3VA 2YSWA 1QOXA 3GXTA 1E6NA 4LUSB 2R1PA 1DJQA 2GQ3A 4RR4A 3THDA 9CGTA 4P7OA 3UGVA 4UTWA 1ZNNA 3BW4A 1HJUA 3KTSA 5D8ZA 2B7OA 4D6DA 2ZVIA 4GNVA 1VKFA 5CZJA 5K4ZA 3VYLA 3LQLA 1ECEA 2XH2A 2Y2WA 1TTPA 5BOOA 3PBWA 1A0EA 3MBDA 1GONA 3TN6A 1YBQA 3G1HA 2Q3OA 3ANVA 1CLXA 4AF0A 3W2MA 4AVFA 3PPHA 5CSSA 4PMVA 5HK4A 1MEHA 4LOCA 2O55A 3BAWA 3BVJA 4C6JA 5M17A 4M82A 2IQDA 2FYMA 1NTHA 4NQ1A 3N1AA 1L8NA 1FHVA 1GTHA 1DIOA 4H9VA 1J96A 4JIHA 3NYZA 1U33A 3VOIA 2VGGA 4ACYA 4LBSA 1HTIA 4LEQA 3A3HA 3U9IA 3EMQA 4ATDA 3W22A 3NGJA 2E25A 3G5EA 4XBKA 3R0UA 1UWTA 2BXZA 3U2EA 1BXBA 1E5NA 1UIOA 4IFKA 3QGKC 3SJ3A 4V28A 2PRHA 4GYPA 1TWDA 2OSYA 3B0XA 3EKLA 1W1YA 3WD2A 1VBJA 2XYLA 1UZ4A 3NPWA 3KOFA 1E4IA 3TN3A 2WLZA 2FB2A 4AVNA 2YPIA 3CQ0A 4M19A 4DX3A 2ACRA 1WYIA 5GNYA 3T55A 4GWEA 3M6YA 2ZA3A 3NPUA 3OQ8A 3T0CA 3N4FA 3C0SA 3BE7A 1C3FA 2E6YA 2P0OA 3S5OA 3FJ4A 2HVOA 1TVNA 5G1TA 4LUJA 3LHVA 3QQ1A 2DIEA 2VTFA 4D8AA 2IMRA 2X2GA 1BVNP 1C8YA 3GAYA 4W88A 3L4WA 3BOFA 4L9XA 3A21A 1EEPA 2QCDB 5FSEC 4BKNA 1FWJC 3A5FA 2WM1A 2PTYA 1KFCA 4DZHA 4K7YA 3MANA 1EDGA 4S23A 5JIWA 3NAVA 4CCDA 5IXEA 3T9PA 1GOMA 2BODX 4X2PA 1LOQA 4QLKA 1XDMA 2XG9A 3I3BA 3SUTA 2ASHA 2G3JA 1FVPA 3NQ7A 1JGIA 1OGSA 4JD4A 3WF4A 4RNHA 4HA0A 2IXVA 2NUWA 1UR9A 3VNLA 2CC0A 3IRDA 4H9ZA 2J24A 1UP2A 3OLDA 4IMAA 3M1ZA 3QC3A 3IIXA 4YVVA 1X8CA 2EKGA 3IWPA 2DVTA 4M6PA 4Q4OA 3SO7A 1OX4A 1KCKA 3OIXA 4QE5A 2Y62A 3MUZ1 4ZFCA 4QDWA 3ITLA 3WYZA 1U22A 1CXFA 2PDUA 1RCQA 3MHFA 1XYBA 3NXFA 4O8RA 3VU2A 4M24A 2HK0A 4WDXA 1JFXA 1FA2A 3WK0A 8XIAA 1LWJA 2I9UA 3H22A 4I6KA 1QBAA 1TPWA 2ZA1A 1ONWA 3KVMA 2E4TA 1U83A 3QEZA 4CQDA 5PTDA 3DC0A 3OBKA 2ZX8A 5C55A 1R3YA 2AQWA 1R9YA 1YTDA 4E8DA 1KBBA 1W3NA 2VP8A 4LC6A 2TAAA 1GVIA 3TP4A 1XIIA 4B5XA 3QVQA 2WANA 4Y7EA 1IWPA 3ZVIA 4ZTXA 1US2A 2YA2A 4C6NA 1F4AA 4QP0A 3B06A 4JTCA 3R89A 3TOPA 3BJTA 3O3RA 5A2CA 3EMZA 2ZUNA 4YCPA 1Q2SA 3QV9A 1NDVA 3MJMA 2YB1A 2REQB 3DFNA 3PTMA 4AIOA 2BHZA 4GKTA 4FO4A 1UD4A 1Z9AA 2OG9A 1TTQA 2QUVA 2D3LA 2VFEA 1TMHA 2VOMA 3D0CA 1GKQA 4O57A 4IWWA 2TODA 1A5OC 2DQXA 4IPJA 1EF3A 3QF0A 4PTDA 3OVRA 5HPCA 3VI2A 1EP2A 4FA3A 1QW9A 4C1KA 1EO7A 3TKFA 2AQVA 5K4XA 2PI6A 1ISXA 1O6IA 1GHSA 4R7JA 1CGYA 4FNUA 2EPMX 2WSKA 4H41A 1ZUAX 3B0YA 2YIHA 4FIQA 1Z7AA 3PBVA 3RR4A 1XLJA 3MZNA 4NXKA 1YX1A 1JYNA 4QCFA 4BF9A 3L66A 1AL8A 2HE8A 4AIUA 3OA5A 4PMZA 1UA7A 8TIMA 2GJXB 1XLHA 4O1FA 2HISA 3FHAA 4RXFA 1M3UA 3VOFA 3RR1A 2ZE0A 4YTRA 2OT1A 1E4NA 9RUBA 3MWAA 4HA1A 4NAEB 1WAUA 3BAXA 3TH6A 1XH0A 3RU6A 3W4RA 4DBUA 3WD1A 2GDUA 1Z3NA 4FXSA 4HNUA 1W3KA 1DJGA 4ZO6A 4F66A 1TWIA 1V4YA 4MY1A 3UFYA 2HPMA 2J88A 2WAGA 1F6PA 3BC9A 4AZBA 1XIFA 4R9OA 1IZKA 4FNPA 2UY2A 1V6TA 2DW6A 1E6PA 2BGQA 2NQZA 2RDXA 1OZMA 3KTXA 4KCVA 3UCQA 3KS6A 4LUSA 1MQPA 5A8QA 5K2ZA 4ZOCA 3TIMA 1MUWA 1S5NA 1S2UA 3C61A 3VKBA 2WNNA 2ZX5A 3BLPX 2ALDA 3W7IA 1R38A 4JDYA 3EDFA 3AS0A 3VD3A 4YTQA 4B4FA 4XG1A 3TE9A 2ACSA 4FOKA 3DGRA 1OFOA 1TQXA 5LNSA 3ORWA 1ZTVA 3IVUA 4R53A 4A3YA 2P3EA 3SQMA 3RCNA 1BWLA 3KDOA 1YDYA 1J18A 5IDIA 4RZ4A 4C7GA 4I7UA 2OMAA 4QE1A 3E5BA 2PLKA 3OGRA 3H4XA 1J2WA 1HO4A 4NG3A 3RDKA 4QS6A 4X9YA 4MYAA 3B9EA 2QDEA 4FB7A 2EJ1A 5KETA 1TE6A 4CKQA 3W1MA 4B3KA 2E8ZA 2OEJA 4DNHA 3AXIA 2F38A 4H8HA 3CT2A 2CBJA 5I77A 4HP5A 4IFKB 1PL9A 3S0CA 2E77A 1NFBA 1CLKA 5CPMA 1SJDA 3WL1A 1THFD 3DYPA 2DUAA 4IUOA 3W00A 4WUIA 4H8NA 5D38A 3UG3A 1DJNA 4H9UA 2EJAA 4O14A 3ABSA 3GTXA 4L64A 1QR7A 3C0QA 1JCLA 4CNSA 1JZ8A 3RPTA 3NQFA 4WSJA 4P7NA 3CUZA 2XVPA 2G0WA 4RXGA 4D9PA 3LXAA 3STPA 4KIEA 3U2ZA 1OINA 3TJXA 1GPFA 5HDRA 3WEMA 5C71A 1AK5A 1SR0A 4PYSA 2NV9A 1L6YA 1T99A 4HK6A 4D71A 1JDAA 3HV8A 1TPEA 4QAIA 1B54A 5GJPA 5A8OA 3WDJA 2ZFAA 2DVXA 3GNNA 4MLJA 2ADAA 4HU4A 3NPXA 1GQLA 4NZFA 1XCWA 4WJXA 1J0KA 4Q8PA 3WBXA 5LZLA 1E15A 1LL4A 4KESA 4GO8A 5I07A 1LQ0A 1FWCC 3O6AA 1XHGA 3KAOA 3U0HA 3FVDA 2YCKX 3LPFA 4YWIA 4IFRA 3SN0A 4BI5A 1IHIA 3RM9A 2B7QA 1M68A 4F40A 4UTLA 3JW7A 4HBKA 4Q8QA 2VRJA 3ITVA 5D2TA 3ZIZA 3G1AA 1UZHA 4E5TA 2VOTA 1X96A 1GVQA 1L9WA 2R1LA 4GQRA 4ZSUA 5H2ZA 4WY0B 3T4WA 4A21A 3R11A 1LWIA 1KRCC 5CXPA 3ALGA 4DWSA 3A64A 2AL2A 2YGYA 5HAOA 3I4EA 4IMCA 1XGZA 3MKCA 3WLMA 1RY0A 2PWDA 2H9AB 1UBPC 5EBAA 4NP7A 1MFUA 4YWSA 5HXMA 4AWSA 3DGBA 1VEPA 1VB9A 3MP4A 3TCEA 4KCWA 2AMXA 2GPTA 5EU9A 1W2PA 1E51A 1MZRA 2ZRYA 5C54A 4TIMA 5HATA 2BHYA 4DPQA 2BFGA 3LMZA 2EO7A 4QISA 2FZMA 3GNOA 4FLRA 4HJFA 2WKJA 4DJEC 1EJRC 1V93A 3LHYA 4JHOA 1F07A 3E2SA 1KGWA 1R2RA 3SURA 3BO9A 4GJ1A 4WX2A 4UR8A 3DFYA 1EUNA 1PDZA 3M0HA 2BOGX 4KPLA 1F4HA 1TX2A 3E1F1 5CH9A 1QCWA 4LAMA 1EGZA 2QJHA 3VKDA 2VO5A 3C6CA 3NJ3A 1WUFA 1RP9A 2JBMA 4XB3A 3BICA 3IIZA 1BRLA 2X1IA 1NELA 1GG1A 3M0LA 2A79A 3S2JA 4ZCWA 2J47A 2XVKA 2BXYA 3V18A 3DBPA 4U5IA 4EVZA 3TWAA 2QCMA 4HTBA 3A12A 4XISA 4RE4A 3W7GA 4IMGA 3LLDA 4DYEA 4GX9A 4NKCA 4D8LA 3S8HA 1EWEA 5E09A 2X0YA 2ON3A 3V5CA 2A6LA 1H61A 3QM3A 3W7EA 4F48A 4QNEA 2O9TA 3UZYA 2HXTA 1M7JA 3VZZA 5AY7A 3VMPA 3PZMA 2GSEA 3GXFA 4WKFA 3G22A 1SQ7A 5JVLA 1R2TA 2JK2A 2ZUVA 4JIEA 4AMCA 2WK2A 3HMJG 3UQNA 1QTWA 3BW3A 1S2CA 5I03A 4Y9MA 4NX0A 1Z48A 3GWQA 2FMNA 4GX8A 3GVQA 2OX4A 1H09A 5EL1A 3EB3A 2KX9A 4M6UA 1DBTA 4MB1A 5CGTA 1E71M 2VC6A 1VFMA 1QU4A 1IT8A 4FNSA 5CPLA 4IMFA 1VRDA 4V1XA 4HNCA 5EPDA 3ZSTA 2I56A 4AD4A 4BQ2A 3K4WA 5HJYA 1SFLA 4DWSC 2PTDA 5HNTA 3VOCA 4EXQA 3XISA 1F76A 1A50A 4ACZB 3HM7A 2OO0A 3OZMA 2AL1A 5CPQA 2W92A 3UVIA 4DJDC 1PTDA 3C8FA 3SBFA 3SIZA 3W29A 5TAOA 1TO3A 2PGFA 3GTIA 4NL1A 4MZYA 3WIJA 4C6LA 1A5LC 2QUTA 3VILA 4OOZA 3H2AA 2FHBA 3UJRA 1MDLA 1VR6A 2PS2A 1T96A 1PZ3A 3WD4A 1XQKA 2NT0A 3T05A 5CC5A 4HTYA 1E6XM 3AJXA 4UTTC 1EA9C 2OLHA 4M1RA 2NUYA 4XKMA 1V3IA 4TOQA 3MI2A 1JG9A 3U8GA 3IARA 4TXEA 4A35A 4AYGA 2J25A 3PUDA 3W74A 4MNKA 4HK5A 4KRTA 1KCXA 1PUDA 3SSJA 3FSUA 4EANA 1VD6A 4I7VA 4LS0A 1Y5WA 4GE8A 1LRTA 1ZZMA 2YJQA 3HTWA 5I06A 1TVPA 3HPAA 4LF1A 4PB3A 3MBFA 4UTMA 3ABOA 1XFBA 4W8LA 3FDKA 2EKCA 3II1A 1GVRA 4I9AA 2E09A 1K6WA 3PY2A 3LG3A 3LTPA 3K30A 3BSMA 4KCTA 4LALA 5CC6A 3HPFA 1O94A 2CBUA 1TE1A 3P6LA 4RJEA 2B81A 4A3UA 4K6AA 1CWYA 1ZL1A 3ARVA 4K39A 1QXLA 3NFUA 1ESWA 1BYAA 2PGEA 3CIVA 2AQOA 5KTLA 2CU0A 2YDAA 2FIQA 4IJCA 4A6GA 5I3KA 3V0SA 2WHJA 3B05A 3WLPA 4GI8A 5ABGA 2PGRA 4OZOA 3TTYA 3KFTA 1AQMA 4J3TA 2B31A 1CXHA 2DSUA 4H04A 2DDXA 3TTQA 5IBXC 4C91A 1DQUA 1VFHA 4G7EB 1WQ5A 4WKHA 2Y4SA 4NF7A 5LNRA 1JCTA 4GUHA 4OBSA 7REQB 3STCA 2VEGA 2PP3A 1XIMA 1JAKA 3S2LA 3VINA 2BOFX 4W5ZA 2ZUTA 4JN6A 4OV9A 3VTRA 2XN1A 1X6UA 1TZ7A 3OZPA 4P5UA 3RILA 4XAFA 4UMBA 4IMDA 1B4EA 3UG8A 1G4SA 1LJYA 3EXTA 1J4EA 3KRSA 1B5TA 3L4VA 1BVZA 1MVYA 3K8KA 3GYEA 5HWJA 3HN3A 4EACA 4GISA 4CN6A 5TNVA 4E2OA 4CVUA 1D8WA 1G9HA 2Y5SA 1G4EA 3H4GA 2EQDA 5I5RA 3K4AA 1W1ZA 2ZTKA 5C7HA 2AAAA 3MHUA 4AVOA 3C5QA 4BJHA 3MSDA 4U28A 1V0NA 2NT1A 5K9CA 3TONA 1HL2A 2O9PA 2FB3A 3A4WA 2QS8A 3LTSA 4EPEC 2PWGA 3P8JA 3FX4A 2GFTA 3GKAA 1YLVA 5A1AA 4MB3A 5K3VA 4QS5A 3B97A 4UNIA 1K7XA 3VIFA 1WDQA 4O4WA 1VLIA 1KWKA 2J13A 1IEXA 3COTA 3MKVA 4LS2A 2MUCA 4MWAE 4IPLA 3UR7A 2IS7A 2OGJA 2Z00A 4US6A 1RD5A 1GZJA 1H62A 2QDHA 2ZIDA 4RV8A 5FCZA 4EAMA 3L12A 4ROQA 3GNDA 2V68A 1Q6QA 4CD5A 1US3A 3VNMA 4XWUA 4H7CA 2G4JA 3BG9A 2ATMA 3VIJA 3UXAA 5ECVA 2PCEA 3KXQA 3TYDA 4P2VA 4NZ4A 1AD1A 4IGNA 1NEYA 3G1SA 1S5MA 3TQ0A 2HNEA 1QO2A 1AW2A 3SZ8A 2CXGA 3CAWA 3STEA 4DQWA 5C2XA 4DBWA 3CZEA 1VYRA 5DFAA 1YEYA 2QGHA 4ZA0A 3IV8A 1FTXA 4XO7A 4C60A 1UMLA 4IJRA 2PF8A 5DN1A 5HNUA 3AS3A 3CBWA 5HUOA 2PDNA 1FQ0A 3BARA 4ILSA 1Q6GA 2PU1A 3CH0A 8RUCA 3UY8A 2NVCA 1C29A 2RFGA 2X09A 3MU7A 2ZADA 4IX0A 1UP0A 1CXKA 1NWRA 5I09A 4PUEA 4XZLX 3Q65A 3H2EA 7ENLA 3DI0A 4I9TA 3DDMA 4LY8A 3BCDA 3SDOA 5F2GA 4H6RA 5AHFA 2HE5A 2PC8A 4Z1YA 4Z2JA 3VKCA 3PP7A 4S3GA 2BOEX 2JFEX 2P88A 4J9JA 5IFTA 2VMFA 4Z0SA 4N02A 4A4AA 1IEVA 2EPLX 1F6KA 2GWNA 2HJPA 1GQIA 1UWRA 1K9TA 2TRSA 2Z27A 1SYTA 1JPKA 5BXSA 3ZSSA 2R1NA 3UR2A 1UH4A 3OVGA 2G95A 3ABQA 3ZJKA 1KM5A 1N8WA 1HIZA 5C9XA 1KTCA 3QZAA 3VXGA 3WQ5A 3GC5A 3B03A 2WXDM 3BZGA 3O1NA 1W3HA 4TVCA 1CX9A 3DFHA 4FNQA 1O5KA 2PDIA 2VR4A 3CQIA 4WEVX 3H8AA 3LENA 3WUFA 3L68A 1JEZA 3N25A 5DY2A 1Q85A 4I9JA 1DE6A 5CPSA 3PB0A 2R8WA 1NQ6A 3LXBA 3BV4A 3M7SA 3ZVHA 1REQA 4OVXA 3SCQA 4HNLA 1CGTA 1KKRA 3BMVA 3O15A 3W2NA 4JTIA 3SECA 4UB9A 3EPMA 1RVGA 2E0PA 1KWGA 3N3MA 3KRZA 2J9XA 4B5UA 3IACA 1FY6A 1MXDA 3C52A 4V1YA 3A4AA 2VFDA 2D0GA 3VOHA 3A3WA 3L21A 3SGZA 1E0XA 1S2TA 1OC5A 4YLWA 5REQA 4JNMA 1J6OA 3AO0A 1E6QM 1KQZA 5FESA 3ARZA 4AHPA 2Q02A 2HBVA 4B90A 5A2AA 4AFYA 1V3LA 2P8CA 3NURA 2DUXA 4GGHA 4P7QA 1CDGA 4EXAA 3F7JA 1H3GA 4FPSA 4WDTA 1PV8A 1R3TA 4AWTA 3EB2A 3E96A 1Q8JA 3EA2A 5AHNA 4AY8A 1EH9A 3WJZA 4S3EA 3GBEA 1OT1A 3CGTA 1Q2RA 4AX6A 4DJED 4GUGA 1F3XA 1GOIA 1X98A 2YXGA 2OTDA 3W2JA 3UCDA 2X1SA 1P0KA 5JQ9A 2WC4A 1JZ5A 1H11A 4OV4A 4LVAA 3M64A 4CQAA 1RZMA 2UV8G 2CFFA 1HGWA 3P82A 2F8QA 2BV9A 4N4PA 2Q09A 1ZJHA 3UNTA 4DJFA 1OVDA 3I7SA 3L5LA 1JUKA 4IIEA 1B3YA 4AYSA 4H6QA 2XISA 1EKOA 4DJDD 2CESA 1QI2A 1J5SA 2VFGA 5T9CE 3L4YA 2FJKA 4GYFA 3PK7A 1ZGDA 3EOOA 3TN4A 4GZJA 3CJPA 5F7UA 1EJ7L 4AY1A 3S1WA 1GVFA 5CSYA 2ZX6A 3OEXA 1XYLA 5H8UA 2VEMA 1TYGA 1B9BA 1C8QA 4Q8NA 2PDHA 3KCJA 4O10A 4PN2A 3OP2A 1SW3A 3BV7A 2BY2A 4URIA 4J4KA 1PAMA 4MPQA 4C6MA 4MWAC 3VDAA 2HV5A 2A85A 2GUBA 1Q7ZA 5FJRA 3U6WA 1GOXA 4L4OA 5CGQA 4MYXA 3SCWA 5HPOA 4JFTA 3P7YA 1FOBA 4S39A 5T8GA 2PUZA 3QV8A 4LAKA 4ZL1A 1JDFA 2D2OA 2J8FA 3BGAA 1LUCB 3EA1A 1Y5VA 3FEQA 2V3FA 5M3WA 3QYSA 4GXPA 1S1RA 2NSXA 3EWDA 1ZJIA 4HOWA 4JTHA 1YTEA 3GVGA 2DP3A 1HVXA 3IAQA 4DWSD 2AGTA 1PZ2A 2XGIA 2WMIA 2ZQ0A 3PWIA 3UWUA 1VCVA 4GFSA 4H6KA 3VUPA 4Z2GA 5C8BB 1K4GA 2BGSA 5GNXA 4LYPA 3KE0A 4A3HA 1SZFA 1RH9A 2DJXA 5EMLA 4IF2A 3W7LA 3EGJA 2OO6A 5HANA 3UWZA 4XIMA 4GG9A 2ZTJA 3EYPA 3N2TA 3O0FA 1TV4A 5A94A 2QULA 1ZAHA 3OVQA 1Q6EA 1CEOA 5L6UA 4GINA 3UXIA 4WY0F 3WLTA 1SZNA 3AMDA 1A0CA 3KX6A 2DSZA 3PS7A 4GUJA 4LTSA 3VM5A 5JUVA 4C5YA 1YDNA 2HZGA 3MWCA 3MHGA 3BLIA 3QBUA 3MT1A 4AU0A 3L2MA 1ZHAA 4HZ8A 4NAEA 5D2YA 3H2MA 4DBEA 3DFSA 1LCOA 5AYXA 3FSTA 5CG7A 3TVAA 5E9XA 1RSCA 3BUVA 1N8FA 2XFFA 6TIMA 3AZSA 1PB0A 2YDQA 2GJXA 4TMCA 4PUJA 3WDHA 2DT3A 3CL7A 2HS8A 4KQNA 2C0HA 4JIIX 3S1GA 5LNUA 1WE5A 4B9ZA 1DORA 4ADSA 4OJYA 2XHYA 5CAHA 3GB6A 1DOSA 1FWRA 2C15A 3WN6A 4EX4A 1S2WA 1SFSA 1J11A 5EMKA 3HV9A 1UIPA 3NSNA 2X1RA 4JZ5A 1M7XA 2OJPA 4FXFA 3WBEA 1XLBA 4UXDA 2CBIA 3W70A 1QNRA 2QCNA 4TX6A 2WMGA 4HN8A 5M5DA 3GK0A 2GQAA 2AKMA 3GU9A 4ZSTA 3ARPA 3GY1A 1WUEA 3KOWA 1C9DA 3M0XA 2OOGA 4KBXA 3LRKA 4ATLA 3CLMA 2CZEA 2XIIA 1M5WA 2ISWA 1DWIM 5LIYX 2GJPA 3CIXA 4HYWA 4S3AA 4G5DA 3DESA 4K8GA 2D2HA 1TJ1A 1V6VA 3ALFA 3W53A 4L4MA 3BQ6A 2F84A 2FLIA 5F4XA 2VR5A 4V33A 1OFQA 4XZNX 1T40A 2ABAA 3KBJA 4F0HA 1A5KC 3EZ4A 4I8YA 5LIKX 2XH7A 3GG8A 3DU0A 3GH7A 4JICA 4TR9A 5ABFB 1W3JA 4LVBA 4MY8A 4EPDC 3N2XA 1O1ZA 2V0TA 3ID7A 1CZ1A 4C6FA 1XXXA 2ZRXA 2CWXA 2I16A 3PUEA 4D6IA 5LIXX 3W3OA 3TROA 1UJPA 4IIBA 3DX5A 1QPKA 3M46A 1Q13A 4HK7A 4S38A 3MTWA 2RAGA 4DBDA 3TA9A 3VM7A 4LT9A 1LM1A 2GK1B 4F0KA 1KGUA 4AZ6A 2NXHA 2OCZA 4XZHA 1A4LA 3L0NA 4ZO8A 5BRPA 3HA1A 2P76A 1ZBVA 1FWGC 5AVNA 2W63A 1ZJAA 3B0PA 2QLYA 2XIBA 2F7FA 5AC4A 5CC3A 1J0YA 3I65A 4A05A 1IE7C 2CERA 2HTMA 4QG6A 1VGAA 3VD4A 4LCQA 2RUSA 3O6CA 1F74A 3EWZA 4XZWA 2A3CA 1NDZA 4OIFA 1ZPTA 2OKOA 1NDYA 2A0NA 3VNKA 3KUMA 1W5NA 5AZ0A 1HX0A 1A53A 1GQJA 1JJKA 4IP5A 4YU1A 1XDJA 4FX7A 1AJ0A 3UERA 3M7WA 3IJIA 1EPVA 4DJEA 4G1KA 5DY3A 2WBGA 4KFPA 2Q01A 1XISA 4XTIA 5HQMA 4HCHA 4YVXA 1GK8A 4EXBA 1H7OA 1PIGA 3U3HA 2PZ0A 1LG1A 3PBGA 5LXXA 3DUGA 1MSSA 4NHVA 1D3CA 4DWDA 3WQDA 4OUIA 4GHRA 4ZB0A 2EAWA 5A8NA 4DXVA 4QG9A 5DMLA 2PRMA 3O2LA 1EC9A 1SW0A 3N11A 1HKWA 3SCPA 3PZ9A 4MAZA 4LV4A 1ONXA 2QDGA 1WBHA 1PTAA 4QROA 3H23A 3AS2A 1HT6A 3WX7A 3N34A 3CB3A 2HRWA 4J3XA 4UZUA 1FWEC 1FWNA 1K4HA 3O9NA 1BKSA 3TLQA 2Q8LA 1K7EA 3QPEA 1E6SM 3UGRA 1NU5A 2I17A 7TIMA 1NIUA 4HN4A 3BMXA 1PIFA 1OF8A 2D0FA 2YZ5A 3S9ZA 4PMUA 4HU0A 3OQEA 4PTXA 4AQLA 4JCMA 3A5VA 3GVWA 1ZB5A 5BW6A 2XIMA 7CGTA 1X8FA 3AIEA 2CLFA 4FLSA 4DPPA 4CU6A 1JPIA 4M80A 4RNJA 4CN4A 3EEZA 2WNWA 4PCPA 5BU9A 3DH7A 1VFFA 2D73A 3ZS4A 1FWHC 3FY1A 1GPWA 4K3ZA 3B40A 3ZLHA 1EP3A 5C2GA 3M5YA 4MJ2A 4Y6GA 4QRNA 3N73A 4PR4A 1GHRA 2JEPA 4HCDA 3PZOA 2PWHA 3R2GA 2J6VA 3KRBA 3EPNA 1QPRA 2X30A 3IGXA 1TIMA 1HG3A 2VXNA 3VGFA 3S47A 4C1NA 5CBBA 1O5XA 5IDZA 5A3HA 4HSOA 5A6KA 4DZ5A 4JNYA 4C6PA 4Y9NA 3C2VA 4FI4A 2JKEA 1UD2A 1XL9A 3MQTA 1OZQA 4US5A 3WUBA 1EPXA 1W91A 1W1PA 3QV6A 2PDYA 3UU0A 2FGZA 4WLCA 2HCVA 1OFPA 1KM6A 4J3VA 1KXQA 1TJ2A 2QCDA 4MB5A 4GC4A 1FDJA 2WMHA 2H3BA 3ZR6A 4LFYA 3BGGA 5IBXA 1AODA 2Q6ZA 3NA8A 4KT2A 4UFKA 4N42A 4E4PA 2YBTA 5BWAA 4EF8A 1V79A 3LPGA 1O5QA 4UTJA 1TV2A 3GTFA 1XI3A 3O6YX 4K1GA 2CLMA 1L6SA 1JPDX 1X39A 4QEEA 3V0UA 5BU6A 3T2PA 1RK6A 3L5AA 3JUGA 4KEVA 3K2GA 3W2LA 4B5TA 4B5VA 5AECA 2WSYA 4S3CA 2VQUA 4RDYA 4AXKA 1U2YA 2INFA 3LHZA 1KRMA 1QPOA 3QY8A 1LBLA 3M0JA 1JYWA 3ANUA 1HNYA 5XIMA 3WLSA 3T44A 4JGDA 2G4FA 4JNZA 3A23A 5AYZA 2UY4A 4Z42C 2Y8VA 3WLKX 4NX5A 2EPOA 1XRFA 3R8HA 3I3DA 3MSRA 4UNLA 3ATZA 4PTNA 4AMAA 2BNJA 4L1GA 4L65A 3EKZA 2Q3RA 3RMEA 5BOEA 3Q37A 4IZGA 1XDLA 1Q7MA 2PDXA 4TX9A 4NJHA 3TQKA 3G2GA 3G6LA 3SCRA 2NLIA 3UA3A 2ZVRA 4UMCA 1MW3A 2A3AA 5D09A 1A47A 4WDWA 1TB3A 2WCGA 4V2XA 4CD8A 1VFSA 4MDPA 4HSNA 5TBOA 4C6KA 3EKGA 1JYXA 2XTKA 4AF0B 4Y96A 4PMDA 2OYMA 2E28A 3UD6A 2ZZ7A 3N04A 4H9MA 2CEQA 1NARA 3UXLA 3WH7A 3RX2A 5BMXA 2I1OA 5A69A 4QR6A 4MJZA 4Y2WA 2J4GA 3QZ6A 1YADA 4HHMA 1EYWA 4ORMA 1KBJA 4DJDA 2Y7EA 3C2RA 2Y7GA 4HMNA 3LA4A 2P3ZA 4DJFD 1V7YA 1Y0EA 2UY3A 4QEHA 1B9ZA 5F1UA 3M07A 1MUMA 7PTDA 3F2DA 3L0GA 1PIIA 4LRSA 2VC7A 1HKJA 3DXIA 2QYGA 4OKDA 2HVNA 2PA6A 2VELA 4EWJA 1LG2A 3AXXA 5JBEA 2FHCA 2X16A 1HN1A 5KZMA 5EGRA 2J7GA 1XICA 3FAWA 3GXDA 2OEMA 5A2BA 3KOZA 1MNSA 4LQ1A 3KM8A 2YCIX 1DEDA 3E0VA 4UFIA 1TIWA 1NWTA 2Z7KA 5KMYA 2R14A 1U5VA 4AEOA 3LERA 1L2UA 1DHPA 3W2UA 2AKZA 3B4YA 3TMLA 3H12A 2NXGA 1E56A 2JGYA 3PANA 5AYBA 4P7LA 1QPQA 2V5CA 2CLEA 1CLVA 4J35A 1YIXA 5FF3A 3TW9A 3ABZA 1O7AA 1SO4A 2ISSA 3UY7A 5TD4A 4JTGA 4UMAA 2INEA 2I5GA 2ZKMX 1ADDA 4PL2A 1S5WA 2QCEA 2C7FA 3OODA 1YPFA 4EOUA 2W62A 4E8GA 2HWGA 4J3ZA 2O7SA 3ONBA 4YS1A 4FK9A 2Y8KA 4PBFA 4BI7A 1AJZA 1F6YA 3VIPA 2D22A 3IRSA 2CETA 1X6NA 4DHGA 3LOTA 4OT7A 1IYXA 3H2CA 2CNCA 5DT7A 3NM1A 4U5KA 3M41A 1G5AA 1XFCA 2NX9A 3CYVA 4JYDA 3ZZ1A 4Y90A 2V82A 1UD6A 2QUNA 3LRLA 4RZBA 2FZBA 1OCBA 3W1UA 1OFDA 4M7TA 3K8LA 1O68A 1W0MA 1XD0A 2WSQA 3NZGA 3OG3A 1NP2A 2NX3A 4LSBA 2GSJA 3CHEA 1K8CA 2DJLA 3L4XA 3CB8A 4WGHA 4NZJA 5HMEA 1LROA 5BNKA 4RCXA 2LLEA 1HO1A 2BSLA 3OLIA 3G3MA 3LNPA 3PJTA 2OZ8A 3PVFA 1B3WA 4OUEA 1E9ZB 3H6OA 3AI0A 4WK9A 4G6CA 3N6JA 1XGEA 3LQGA 3O07A 4CLMA 3QGAC 4CNUA 4D6HA 4PSRA 2GUYA 2F61A 2R9RA 1DIDA 4GUFA 3WQOA 4C6OA 4UTUA 1TCDA 4UBPC 3EA3A 3WBAA 1AH0A 2IQTA 3LPPA 5F4WA 4PCTA 1FWTA 1QI3A 3O63A 4XAZA 3E38A 4J28A 3E0LA 3APYA 5EKYA 3W7OA 1H1YA 1V77A 3SM0A 3U4FA 4E8CA 5KZDA 3EAUA 3ARXA 4O0KA 3BANA 2QF7A 1LQ2A 3W1NA 3LPOA 3UZ5A 5C0QA 1FFQA 3WQVA 4K37A 3CTTA 3TFXA 1AD4A 4KKXA 1TMQA 3VGBA 3N18A 4Z2LA 2D20A 1V0MA 1DWHM 4CD6A 1VJZA 1OGBA 2QIIA 1A5UA 3WENA 4AC7C 1A5AA 1F61A 1TPH1 3NYDA 5C6MA 3CO8A 3KL3A 3DG7A 1NAL1 4HPXA 1UR1A 1B0IA 1OK6A 1JQXA 1Q6CA 2XSBA 1JCMP 5HOSA 4F8XA 2FMOA 2EG7A 3M5XA 5DMNA 4IQDA 4PCFA 3CHDA 4G9PA 4L6OA 3L9CA 4ZOBA 1LORA 1LZOA 1ME9A 2P10A 3HQ1A 4DVOA 5DELA 3B9AA 4PODA 2PPGA 3RM8A 5DXXA 5J8LA 3GVVA 5EFDA 1V5XA 4PMQA 3DI1A 4WSKA 4WJ8A 2DV0A 5H91A 2HQAA 1HVQA 3EPOA 3GLCA 3VKKA 4YHEA 2P5NA 4RX0A 2A7PA 4CEXC 4E2BA 1H1ZA 3PZQA 1MDRA 4ZFMA 5IM51 2V2DA 1R7OA 4B9YA 2E5DA 3ARWA 3D3FA 2PDGA 3H24A 4GY7A 2W66A 3R10A 3EDJA 4C1LA 1OB0A 3FAXA 3C3NA 1ZAJA 1FUYA 3NVDA 2YDSA 3A22A 2Z1XA 3AHZA 4V15A 3L23A 4GQQA 3F5KA 3WUGA 4W5UA 1MFVA 3EBVA 5I3HA 3SY8A 1HKVA 3CTLA 1PKYA 1B57A 5I3JA 2JKAA 1EGMA 3WLHA 3CO4A 3ABXA 4CU8A 1OFRA 3E74A 3WNNA 2Q8ZA 3S6TA 3UEQA 6ALDA 2ATSA 4PFMA 2OQYA 3EOUA 4JX4A 3K5XA 1BYCA 3NQGA 1OWQA 3P5ZA 3WDIA 1B3ZA 1PPIA 1EGVA 3TJLA 4NYUA 5AHIA 4AZCA 4H9XA 1K70A 4PA8A 4QE4A 3WF1A 3E3HA 2VX4A 1W3TA 1IXQA 2W79A 5FJJA 1SFJA 1AZ2A 4GJIA 4G7EA 1E1CA 1KBIA 4K36A 2OOFA 1ML1A 1W54A 4PB4A 3SRDA 2FTYA 3HOJA 1GZ1A 3O06A 3WD3A 5A6SA 2YBUA 3M5ZA 2XU2A 3S5NA 1PJ9A 3GXPA 1QI4A 5FACA 1SZRA 2HMCA 1XJBA 1RQHA 3C8NA 1BQCA 5E6YA 1H5YA 3RO8A 5C9WA 2W6RA 1LP6A 1HP5A 5HQEA 2WHKA 4KEZA 4EIVA 3HG2A 1NH6A 3MO4A 3ZO9A 4JAWA 2PLMA 1KM2A 3SB0A 1A5NC 3VIKA 1NOUA 1S5VA 2JGQA 1L6WA 1WBJA 3FA4A 4XSMA 4L1WA 5FIPA 3B8WA 3SGGA 4DNMA 1R3WA 1LLWA 2PWFA 1QO5A 3S2CA 3F1QA 1TG7A 3L2IA 4HA3A 1NVMA 1WO2A 3CUIA 3OG2A 4XK2A 5LKYA 1RJQA 3QQ0A 4M56A 4ZBCA 3B8DA 2HEJA 1XBVA 2P1FA 1K1DA 1E9IA 1XBXA 3EWCA 4MWAA 4OU1A 2GGJA 3VIMA 4R27A 3GS6A 4XD4A 3GC2A 1VAHA 1ZP3A 4X9SA 4WOQA 1TZZA 1LF1A 3TTEA 1GEHA 3GUWA 1I45A 2WJDA 1CXIA 5EFFA 1KLYA 4RZ6A 3AAMA 1RK5A 3KBNA 3PPFA 2YLAA 3CZJA 1P4CA 4R5EA 3WDQA 1R7AA 2XIQA 3AU2A 3LYEA 4Q4MA 4IHCA 1OIFA 4FX6M 4S3KA 2VUNA 4CQ8A 2J8TA 2PLCA 3ITXA 5I02A 4JHMA 3WDPP 4LBRA 3EXRA 1UR8A 2QXWA 2Q71A 3LY0A 3A47A 2E9BA 1DVJA 1XKYA 3VX0A 1UWAA 3B8SA 3HU7A 2V3DA 1VFOA 2CYGA 1ONRA 1MYRA 1VFUA 1ISYA 4CQCA 3GFXA 1KR0A 3BCJA 1NF7A 3OU8A 4AEFA 3ICJA 2C3ZA 1H2JA 4X61A 3WLRA 5CKSA 4KETA 1XYMA 1HGYA 2WCAA 3AYRA 1OHLA 2NQ5A 2HS6A 2BVYA 3KLKA 2J7HA 4MGGA 3E2QA 4AB4A 1JCNA 4O16A 3EDEA 4XO6A 1WXJA 3TAKA 2QCHA 1JZ4A 1CBGA 3RG6A 4RL3A 1NY1A 3C0LA 4JIQA 4W8BA 1Z41A 1ZJBA 4LC8A 3IIPA 1RUSA 1EDQA 2FDSA 4I9MA 5J5DA 4HT3A 2J9ZA 1UA3A 4FSAA 1A80A 1CTNA 3A3XA 3GNRA 3U7BA 4O4VA 4UQ9A 6REQB 4TVDA 5A8GA 3L2LA 4JPGA 5B80A 1PEZA 3KVLA 4KCUA 2PODA 1SPQA 4MFDA 3MC5A 5I3IA 4DI8A 1BRLB 1KXHA 4KWWA 1AH4A 2HROA 3CAQA 2V38A 1P43A 2EHHA 4JQ1A 3NQ8A 1JI1A 3GTNA 3KOYA 3T07A 3NZPA 3WNLA 3TNBA 3H21A 2PWEA 3T0BA 2DZWA 3UPBA 3C2EA 4CCCA 3PG9A 4RNFA 1PWMA 4FMVA 5A6LA 4S2CA 3T40A 3P61A 4MF4A 1WB0A 1G0CA 3W7DA 4UTKA 3WNMA 5E1QA 1YQ2A 3MW7A 2X2YA 3N19B 2B0MA 1KR1A 3VE7A 4JKMA 1OCNA 4HMDA 1ISZA 2VT0A 4D6CA 2V8ZA 2WC7A 1GG0A 1SJAA 4F9DA 2NQLA 3HGJA 1MW1A 4YTSA 3MI3A 1AW1A 3J7HA 3E49A 4UQBA 3DKJA 4RPQA 3N3TA 4IIHA 4ATWA 1NOWA 1EQCA 4U2ZA 3ATYA 1S1PA 1MQQA 1POKA 4ZOEA 1XQLA 4JDBA 4FOUA 2J62A 1ZP4A 1WKDA 3MPGA 1XP3A 1QASA 4RZ5A 3FFSA 5JIPA 4O11A 1E0VA 4WY0A 2VZSA 2RKXA 3IVTA 4H7ZA 3MO7A 1PBGA 4KRZA 1IF2A 3KTCA 3FK4A 4HQVA 1RR2A 3GZAA 1QDSA 3BJFA 4B2DA 1XUUA 3UJEA 4UUIA 5CZKA 1V7AA 4POCA 2OLAA 4ZO9A 2QJGA 4C65A 3SRKA 4O28A 1JPHA 3DN5A 4XZ9A 4GVIA 2DEPA 1WKYA 2CZVA 4JN7A 4NYYA 3URAA 3LHUA 1MWOA 1WAWA 1W5QA 3QSRA 4FR1A 4MZ1A 1KFKA 3NQVA 4HNTA 2PE4A 3IPWA 4HU3A 4BQ3A 3IJLA 3I10A 5F1VA 4QFUA 1JL8A 5LYRA 2OSWA 2GJRA 1N82A 3FKKA 1PCKA 2ZXQA 5E0CA 2BVTA 3N4AA 3QKEA 3TQVA 1HFBA 2FVKA 4W86A 5LA0A 3DENA 3BDKA 5E5CA 3BK0A 4AY7A 3TV8A 1A3WA 2WVUA 3ZWTA 4UQDA 1JFHA 1GCYA 4LS1A 3NDYA 2ZUMA 5HNNA 1LT7A 1ODUA 4DUXA 1B3XA 1K8ZA 3S6DA 3SJNA 1AL7A 4OTKA 2DH2A 2ONEA 5FEWA 4MB4A 4I8DA 4U10A 3W7PA 2O56A 3NOEA 2OZ3A 3I6EA 3WFZA 5TF0A 1E70M 1EHNA 2YXXA 1EP1A 2DUZA 5A8MA 3RO6A 4HCLA 1Q7QA 3N9SA 2A4AA 2WO5A 4NILA 5A95A 3TYEA 2E67A 2E5CA 1QNOA 1R9XA 3QH2A 1R5YA 4REQA 3OJGA 3LLFA 2H9AA 3HGSA 2C8NA 2OKTA 2PTWA 2ZDSA 3NCOA 3SY5A 3HMCA 2PDBA 1YDVA 1KB3A 1BXCA 3MVTA 2J6XA 2WHLA 4NNCA 4IOTA 5BXPA 2AL2B 4UOJA 4LUIA 4HSHA 1I2PA 3W76A 3STFA 5HMDA 4GBUA 1V3MA 3Q58A 1AQHA 3MB9A 3TJ4A 3AIRA 1G69A 1R85A 3UR8A 3TYUA 4UTIA 1EBHA 2OFJA 4Q22A 1R3VA 2Z1VA 2CXEA 3USZA 4KWOA 4HHPA 4JTQA 3BL3A 3ARRA 3HG5A 1IXNA 1BQGA 5CSUA 4LAUA 1UW9A 4ZVJA 4AZ5A 6XIMA 2YOCA 3IJ6A 1ENUA 1WXYA 1W5MA 2A1YA 3ITCA 1R2SA 2PD5A 4DF1A 4W84A 2C71A 2XWDA 3TCSA 3VCCA 3QMRA 4PSPA 2XN0A 4JYFA 3VO0A 3QXBA 4W7WA 5JBDA 1RY8A 4AX7A 2W0UA 5LSMA 3USBA 3NDOA 4MWAB 4BQ5A 2GVYA 3P5YA 1VHCA 3CQHA 2XM2A 2Q8XA 4MWAD 3PJWA 3S2MA 2WJZA 3TW6A 1CYGA 2VI0A 3O7UA 2GYIA 1AH3A 2YYUA 3A24A 2Y7FA 4ML9A 4KFNA 1TPC1 5EYWA 3TXZA 2BASA 3WJXA 4J40A 4PL1A 2GUUA 3DYMA 5FL1A 4ZTYA 2V81A 4GACA 3TTOA 2CCRA 2GQ8A 4NVTA 3VK5A 5AHLA 4OGZA 1UG6A 4W8AA 1F05A 4PUNA 4C5ZA 4RDZA 1JNDA 4D6GA 1FKWA 1DJIA 2TSYA 2X7VA 3JR2A 5CZ0A 1E4LA 3ES7A 1DTUA 2WJFA 2PZNA 2Y5EA 2UBPC 3FGCA 3LB0A 5HMFA 3NO3A 1NQKA 4HNOA 4Q8OA 2C18A 5E0FA 2RDTA 2ZZ6A 1P6CA 4HPGA 5M1TA 3U5UA 1GYLA 2XJ7A 1YNYA 2VNCA 1VEMA 5FEPA 2I14A 5LIWX 1DWAM 4AC1X 4AHQA 4C6EA 1ZU8A 4UTTA 1T7LA 4GVFA 1TTIA 1FH7A 3R79A 1X7IA 3NZRA 3VD7A 2NLYA 4U31A 4UZSA 3F4NA 2FDMA 2REQA 4K68A 3T08A 3R12A 4HPJA 3D6NA 1TTJA 4P8VA 1G67A 3CUFA 2FTPA 3BLOA 3EMCA 1GW9A 2UWFA 3N2MA 3GKFA 4ICMA 1EC7A 1DJXA 2JIEA 4AW7A 4F9JA 1J79A 1GVOA 4ROPA 4PTVA 1JPMA 3OBAA 3KP0A 5HR7A 4IG2A 3ZR4A 4NI3A 2C19A 1BWVA 1LQAA 4ECLA 5CGMA 5I24A 3RJYA 3W26A 1MXSA 4XZBA 4MM1A 4LANA 3HF3A 3ITGA 1DWGM 1W9UA 4NJJA 2Z1BA 2VZVA 1AMYA 2YA1A 4DYJA 2WYSA 3ONCA 2PBGA 3T0TA 1QHPA 1TWZA 1BWKA 4N9BA 4JXCA 1TQJA 4AD1A 2E40A 3H2NA 5DBTA 4N0RA 4TQTA 4JTTA 3HQOA 3UESA 1GJPA 4HMCA 3AHTA 4E6MA 3C0JA 3E2VA 3NWRA 1GOKA 4MAVA 1H5VA 3GH5A 1UQYA 3QLLA 2VFIA 1E5JA 1SZGA 1HJQA 3W01A 4Q32A 1YMYA 2CBVA 4GPNA 2ZICA 3H7VA 3NSMA 1B2YA 4M6QA 1XC6A 2VEKA 3G0XA 4JL2A 2CLLA 4RNIA 2Y88A 4GIEA 2V67A 2C91A 2W91A 4JIPA 4C6BA 3UG5A 1GVSA 3WSUA 4GNJA 2EPHA 1OCJA 3B8IA 3V3WA 1Q6FA 1K6AA 2OR2A 4YJ5A 4KH2A 4B92A 2XZ7A 3P93A 4L61A 4QJ1A 2DH3A 2WMJA 4I7WA 4JYEA 1UZ1A 3O16A 4FLOA 1EJWC 1QOQA 5FOOA 1JRCA 5AOUA 2DPEA 4JFWA 3N2BA 3ZQ9A 4QQ3A 4R34A 4Y8FA 2QMKA 5D8WA 2ZUWA 6PTDA 2VEPA 1VENA 4IUGA 4LVFA 3RLHA 4B2DD 4PGLA 4IIFA 3TDFA 3P0WA 3WQEA 2DSWA 4QCEA 3W83A 3QMSA 4RW3A 1ITXA 4JKLA 2V5LA 3SCSA 4MMWA 3PM6A 1R9ZA 6XIAA 4XUGA 4GJJA 1UJQA 3B3DA 1OX6A 5FL0A 5AC5A 2Z24A 1QATA 2YXOA 1HZYA 3K8MA 3T0AA 3OYZA 3EWXA 1IR2A 2GJNA 2NV1A 2Z29A 2A7NA 2O9RA 4S2BA 3QR1A 2GVEA 2OYLA 4TTGA 2Z6JA 1ELSA 2E6FA 2J7BA 1UR2A 2Z0IA 3ZWSA 3A13A 3WFAA 1IEIA 1QWGA 4PMJA 3Q2DA 1RCOB 4GYKA 3PZNA 1C90A 4DM2A 4PTMA 3CMFA 1XIHA 3AJ7A 1IXOA 2ZX9A 3B8UA 4IH3A 3TUUA 4PC8A 1YE4A 4DO4A 4F0LA 5JH2A 5KZ6A 2W67A 3R25A 1F73A 1UKPA 1KTBA 3W37A 3UJSA 4PUDA 3HO8A 1W5PA 3K13A 2QHAA 3UVAA 2JKPA 1XLIA 2HNHA 2PGWA 4Q4RA 3LV5A 1RLDA 4YL2A 3W27A 1G01A 2OPJA 4O0QA 3AMLA 3BXWA 4ZODA 3UF9A 3W85A 3QW4B 2WLYA 1WV2A 2ZBTA 2WPBA 1LL6A 3VCNA 1SMAA 2FGBA 1D3HA 8XIMA 5FEXA 5EBUA 1J0ZA 1FDYA 1YHTA 3AHVA 5JU6A 2VEIA 2QV5A 3ZXWA 2X8RA 1A49A 1MEWA 2O4MA 1Q6OA 2WZHA 5U7SA 1UHVA 3ES8A 2W4XA 3VD9A 2VCCA 3HGRA 4W87A 2C16A 5AVHA 4J2MA 1SU5A 4X3ZA 3GFYA 1IZCA 1SO6A 3EOSA 5FJIA 3VOGA 3UXKA 3TW7A 4W4QA 1ITUA 1B1YA 2G97A 1S39A 2H3DA 1XH2A 4FR6A 1FWIC 3W07A 3LI1A 4IPIA 2V6AA 2DT2A 2XSXA 2CHNA 4R7OA 4F0SA 2XH0A 3EWYA 5ECUA 3UA4A 4NZ5A 2PDMA 3Q94A 5CPNA 4UOQA 3I68A 3OZYA 1XINA 1TA3A 4UCFA 5CJMA 2QQ6A 1XLCA 4F4RA 2VYOA 2DIKA 3S5SA 1PZ0A 2XVGA 4YNGA 3WNOA 4IJBA 1OQFA 3H70A 1WKFA 4AIBA 3AIVA 3L0KA 2DQWA 5CBIA 4L6DA 5C70A 2QGYA 1OADA 3WEOA 2JEQA 3VZYA 2ZUSA 1MI3A 1KGXA 2Z4GA 2OQLA 1C8XA 1JDEA 3T2QA 5I23A 4LJ3A 1C93A 5D2XA 1XRVA 4YTUA 1POJA 5KZEA 2FH6A 2RDUA 2DT1A 3IGSA 3O0KA 1XD1A 4BQ4A 4AEEA 5AC7A 1GJWA 2EG8A 5M03A 4KS0A 3UNDA 3PZIA 1PX8A 3RF9A 1N7KA 5CSRA 4FIRA 4O1EA 3LTYA 3P80A 3MCOA 4MHBA 4IQEA 2AAMA 1XLFA 3U48A 3UW6A 4XUYA 3D47A 2GQ9A 2P50A 1UMYA 3SIMA 1XH1A 7A3HA 3B9OA 1E73M 1C7TA 2OELA 1JZ3A 1UYQA 3IJ9A 3PF3A 4A22A 4PMXA 4JN8A 1VBUA 4S3FA 1I4NA 3NEHA 1BXNA 1RJPA 4GYPC 2WOQA 1ZBKA 2NXIA 5DEZA 3F5LA 4DRSA 4UQAA 4BCEA 4LB4A 3EX3A 5G2IA 4JTEA 1CI1A 3OA3A 4M3PA 3YPIA 2PFHA 5FF4A 4WXYA 2BZNA 2BBFA 3T0DA 2HXUA 3CL6A 4AH7A 5F4SA 3G24A 1KM0A 1XBZA 3PAOA 4Q33A 5DQPA 4FLQA 3RAOA 2D69A 3CUJA 5CLTA 4IQJA 1SO3A 2VUYA 3UJFA 3B9DA 4ZQNA 3WLLA 3DHUA 4WCJA 4GD0A 1XUZA 4LUTB 1FHLA 4CNTA 3I3EA 1ISWA 1MW0A 3D5HA 3R58A 1TX0A 1L8PA 3ARSA 1H49A 1XIJA 1XKJA 3H55A 4NY2A 1JF5A 2QCCA 1X1NA 3SN1A 2PCQA 1AA1B 1KLZA 1I6NA 3ABRA 1I0DA 4N6EA 3GFZA 1IT0A 3QN3A 1XPYA 3GH4A 5FF2A 3Q67A 5DMYA 2F9RA 1KCLA 3F4VA 2ZCGA 3ZJ8A 1QNVA 1QMLA 3GU2A 2PAJA 3QY6A 5AHMA 3LDVA 4GZEA 4DLFA 3UWVA 3W72A 1P0NA 1E3XA 3JZUA 5C9RA 3GHRA 4PMNA 2YCLA 2QDDA 4O13A 4AAJA 2CW6A 3W1TA 2R1KA 1B30A 4AXNA 4OBTA 4HB7A 2OB3A 1JR1A 3A4XA 2BB0A 3WQGA 3TYAA 1JULA 3RLVA 1EJUC 3XIMA 2VKZG 2VM8A 3K1DA 3NQAA 4X0NA 4QQUA 3W1LA 4ML4A 5I2UA 3PN8A 3VIIA 4GNKB 5FJPA 1EC8A 1FCUA 1YPIA 3WLJA 3FHQA 3AXKA 4YYCA 2ICSA 3NO1A 1UKSA 2I7GA 2XVNA 1EZWA 4XBJA 2I5IA 3UG4A 4G56A 3GIPA 1YDOA 1W2VA 4WZHA 2J78A 1VPQA 4BY3A 2IUZA 4C6QA 4DZIA 1O95A 2FPYA 1UD5A 3BZJA 4JQ3A 1TA3B 3P14A 2DZBA 1E0WA 1TZ9A 3L7RA 3N2OA 3BAYA 3ELFA 2JQXA 3WH6A 4MVAA 3QZEA 3VA8A 2R6OA 3GBDA 1G1YA 4QM1A 5DF0A 2QV4A 1GTEA 2JALA 3DYOA 1H1NA 1P1XA 1U5HA 2ZZ1A 4UFMA 5CJNA 4D2JA 2H8ZA 2OSXA 4LRTA 1LOLA 5G4EA 3W6LA 3P3BA 1P6BA 3PAJA 3PNUA 2E68A 4MJMA 4ALDA 5FAJA 1NFGA 1DTNA 3H2FA 3G1DA 1M65A 4AUBA 2I57A 1P48A 1VPYA 1JCXA 3W87A 3VDBA 3AU6A 3W6MA 3H7UA 1CENA 1RPKA 1WOBA 4ZB2A 2OX1A 4UWMA 3IANA 4Q4KA 2WZTA 3GDLA 4PH6A 3MCMA 5AN7A 1RBLA 2R24A 2CLIA 4IMEA 3E9AA 1H0GA 4HHLA 1CXLA 4HJWA 4B91A 2ODOA 3PBMA 1YNPA 2E7FA 2D2JA 2E6DA 2J66A 4CCZA 2XFWA 4GMEA 3HIJA 3N2CA 4Z0JA 1V3JA 4RUBA 1TRDA 5DBUA 1EIBA 1L6GA 1QJWA 2QKFA 3AZTA 1ZBWA 4E38A 1UR3M 1QWKA 5AYIA 3WQCA 3VOJA 5I0DA 2GK1A 3QGVA 4B3LA 1E43A 4J3SA 4N4QA 5HULA 2Z25A 1PO9A 4QNWA 3W7QA 3V75A 2IXUA 1GOOA 1MXGA 4AD5A 2RH9A 1V6XA 4GY0A 4EPBC 2BY0A 3RX4A 1UC4A 3SGUA 4RE2A 1KQYA 2Z1SA 1O1HA 2OQHA 2HDJA 1OG6A 5DCEA 4ADUA 4UFLA 1C7SA 1TREA 2QJIA 1I2NA 3WQWA 2WVVB 1L6FA 1OD8A 2ZRUA 1J6PA 4FOJA 4GIYA 3SCOA 1YW1A 2FZDA 4MUPA 1QRQA 3JRKA 3PHAA 2BGNE 3TK7A 4IG2B 5BOFA 5AKQA 2Y70A 5MF5A 4S3BA 4QITA 1PTGA 3G0SA