1HF6A

Endoglucanase cel5a from bacillus agaradhaerens in the orthorhombic crystal form in complex with cellotriose
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE B
publication title Direct Experimental Observation of the Hydrogen-Bonding Network of a Glycosidase Along its Reaction Coordinate Revealed by Atomic Resolution Analyses of Endoglucanase Cel5A
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 119
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hf6A00
2WNWA 1GCYA 1PX4A 2G4FA 4M24A 4MPKA 4AWEA 1PZ2A 1JZ8A 4M82A 4AZGA 3S2CA 1OCQA 3TP4A 4H41A 1Q6DA 5AYBA 3UESA 3BMWA 5GNXA 3WUBA 3OLIA 1JZ4A 3AHVA 1TZ7A 3UR7A 3GZAA 1JF6A 1C93A 4UOZA 3SUTA 3B9DA 5JUVA 5CLWA 2PWEA 4UFMA 4P8VA 5FOOA 4PCTA 3SCPA 3NCOA 3SCVA 3TTQA 4W89A 1C90A 2XFYA 1V3HA 3L4VA 4MAVA 3ALFA 2O9OA 5I24A 4W5ZA 3U5YA 1HF6A 3BAJA 1GHRA 3EDFA 1E0VA 4UQ9A 2HISA 1G0CA 1Z32X 4K68A 4XX6A 4HP5A 4W87A 1O6IA 2XIIA 3PZNA 5ABFA 1W9PA 2HVMA 4JAWA 3QHOA 1XV8A 3SCWA 3VD3A 3WNLA 3QGVA 2D23A 4R27A 1ISVA 2EPMX 3AMKA 5C71A 4W5UA 4GIAA 5ABFB 1EOKA 3ARQA 5D4YA 1E73M 1Q4NX 1QNRA 3CH9A 1XD0A 1RPKA 2DH2A 5DMYA 4U2YA 3GXDA 5BWFA 1LF1A 1B3VA 3VIOA 1C3FA 1E15A 2E4TA 3RPMA 3WUGA 4J3WA 5HPOA 2YL8A 2EPNA 3N9KA 1JNEA 1EOMA 4X9YA 3VIHA 4WF7A 3AYRA 4KMQA 2J7FA 3MSDA 2WVUA 3ZM8A 2GDVA 3A4WA 2FHBA 1OBAA 4U5KA 1UD2A 4YPJA 2VVSA 3BLPX 2J77A 3PHAA 3GXIA 2CCRA 1J0ZA 3K4DA 4OZOA 1V3KA 2V3EA 3QOKA 3W38A 1EHNA 1WE5A 2VCBA 4HOWA 2GJXA 3CHFA 2WW5A 2Y24A 4LGXA 4QCFA 1J0KA 2V38A 3FW6A 1HVQA 5A3HA 1AQMA 1MW2A 2PWDA 2VRQA 3CUFA 2D20A 2VNCA 4V28A 4HZ7A 3MUZ1 4NF7A 4AY1A 2VX5A 1ISWA 2PBOA 2XVKA 1FOBA 2FGZA 2GJXB 1GQKA 3PTMA 1SMDA 1E0XA 3SCRA 3AZTA 3L4UA 3ZJ7A 1AQ0A 1IV8A 1AQHA 1XSIA 1TE1A 3WNPA 2E3ZA 1CECA 5A6JA 3WD4A 2J8GA 3FAWA 2WC7A 1GVYA 6A3HA 2GFTA 1J0JA 4AIOA 3DHUA 1V3LA 3WL1A 3W53A 2VMFA 4AZ7A 3VIPA 4B15A 2BXYA 1DWGM 4PMNA 3VVGA 3T0AA 5CG0A 2DPEA 3RIKA 2OYKA 1P6WA 2X0HA 2JIWA 3DECA 4CCCA 5AYIA 1E5JA 1LLOA 4PTWA 4X0NA 2WHKA 4E8CA 1K9FA 1I75A 2JALA 1BQCA 1JDDA 2XWEA 1JD9A 2G41A 3UG5A 4CUCA 3VIJA 1JL8A 4MB3A 1WP6A 2ZUWA 5BYWA 1OGGA 4P7QA 3K46A 2VQUA 3WQ5A 4P7LA 2CESA 1KWKA 4HOXA 1UKSA 3FAXA 1UH2A 2VZUA 2J62A 1YQ2A 3WF0A 3GYCA 1WAWA 2XWDA 1GPFA 1QHOA 3EDJA 4JL1A 3VIMA 4PSPA 5CSYA 2Y8VA 1TCMA 2A3BA 3N04A 1JGIA 3K4AA 4TVDA 9CGTA 1GOKA 4HA3A 1HT6A 3QHMA 4CKQA 2E8YA 1QVBA 4CN4A 5EFDA 3ZT7A 2WVVA 3OGRA 5GPRA 4PYSA 3WEMA 4AIEA 5IHSA 5HDRA 2DH3A 1I1WA 3VDBA 3N18A 5E0CA 1UZ1A 3FXYA 1GQIA 2ZIDA 4BS0A 2WZHA 4FK9A 1HJWA 1KB3A 5D9NA 4WJXA 4AZHA 3SUWA 3MU7A 4CU7A 6TAAA 1KCKA 5LA0A 3M07A 2FDMA 4Z2HA 3AIUA 2BVTA 2PF0A 2WBKA 3PTKA 4W88A 3AS2A 3T09A 3MS8A 2EPLX 2F61A 2D3NA 3T2QA 4JHOA 2YA1A 5M3WA 1DWFM 2DSVA 3W81A 1KQYA 3ALGA 1ZBWA 2VX4A 1H0IA 1E3XA 3O9NA 4J3XA 1NARA 4V2XA 1JYVA 3EMCA 5BRPA 4LYPA 3CHEA 1KBKA 1QNPA 2W63A 4ZE4A 3WQ6A 5DEZA 1HJXA 4YN5A 3RCNA 3WNOA 3ARSA 4XV0A 2JF6A 4ACZB 4ZXOA 1UR1A 4J3VA 3LMYA 4J3SA 2DQXA 2WKLA 6CGTA 1ZJAA 1W1PA 1UD4A 2GK1A 5A94A 3DYPA 5GNYA 4H7VA 4GZEA 1QI3A 4ZENA 4UQAA 3ARTA 4IISA 3VTRA 3F5JA 2VC9A 5BROA 2GK1B 3ARPA 4ZXLA 1NWUA 3AIQA 3ZT5A 4Q22A 3BSHA 5A8MA 2VZTA 5CPSA 4PMDA 1PX8A 1W32A 1W1TA 5FL1A 3A47A 3ARYA 1E1FA 1DHKA 3VGDA 1E71M 1F4AA 1KBBA 1UR2A 4HU8A 3UETA 1RP8A 4FF5A 4A3HA 2PI6A 1JAKA 1GW1A 2V5DA 3BMVA 3WMCA 3WD3A 5D8ZA 1TUXA 1NWSA 3RM9A 1R7AA 5M5DA 4QDMA 4Z2IA 3AROA 1W9BM 2F2HA 1HKKA 4QCEA 1LWJA 4UNIA 4GI8A 2WWCA 1UA7A 2BY2A 1UA3A 4J7RA 1TG7A 3WFZA 3ZT6A 1E6RA 3I3EA 1EGZA 3PZQA 5ABEA 3W4RA 3VIIA 2J7EA 1QOXA 4M29A 2X8RA 2XUCA 2J75A 1E43A 2ZE0A 4B16A 2DSUA 3EBVA 4WKHA 2D1ZA 1JYWA 4CCDA 3CMJA 4GPNA 3CHCA 3WH7A 1JXKA 1V02E 1X1NA 2JEQA 3N1AA 2VZSA 1PEZA 1EO7A 1FFQA 1HJSA 5E6YA 4ATLA 2XPKA 5JBEA 4QFUA 5EBAA 3II1A 2Y4SA 1R7OA 4MB5A 3RO8A 2ZX8A 3AHYA 1XRVA 1H09A 3MV01 3WUEA 3NSMA 5DT7A 1R86A 4UQEA 5JIPA 3BH4A 1K9DA 2WANA 4B3KA 3GBDA 4H04A 4ZE5A 2DT0A 5CPTA 1E1EA 3B9AA 2XHYA 1IZKA 4IM4A 2QF8A 2WLYA 1UWRA 3L4YA 4OOUA 2G3JA 4F9JA 2OSXA 4IPLA 1QPKA 4HA4A 1EDGA 1VBUA 4PMXA 4J27A 4BQ4A 4TX6A 3LPGA 1GUVA 4J3TA 4QLJA 1H0GA 3FN9A 4URIA 3GNOA 2CITA 1VIWA 1OT1A 1OWQA 4PUDA 1NQ6A 4AD4A 1KXHA 3MKKA 1W9DM 2WC4A 3OLEA 3NIYA 2OWWA 3WKZA 4OIFA 4D6IA 2ZICA 2QMJA 3OA5A 5C8BB 2J7BA 1CGUA 1QNOA 2VT0A 1U2YA 4HMEA 1ZB5A 1Y7VA 3A3HA 2WMJA 4AXNA 2W91A 2YL5A 4MJ4A 1MQQA 1Q6FA 5LA2A 1EDTA 2XGBA 3B8SA 2ZUUA 3AZRA 1UKOA 3A6OA 1ZBCA 1C8QA 5FIPA 2WSPA 2ZX5A 1GJUA 2CKSA 4GXPA 3CBWA 2BY0A 4IPNB 4W93A 4YHEA 1XCWA 2FH8A 4UQDA 4JKMA 1FHLA 3SURA 4MNKA 2DT3A 1EIBA 2IXVA 4WIWA 2JEPA 5E9AA 4ML4A 5CXPA 4D72A 5A2CA 1HVXA 3E1F1 5EMYA 4PSRA 2ESCA 2GDUA 3M46A 4AZCB 2RGMA 1JYNA 3W82A 1GOOA 4FLQA 1KGUA 3VGBA 3SIMA 1GOQA 2YDQA 3OGVA 4RE2A 1MVYA 5CPQA 2BXZA 4YHGA 4HTYA 4L4PA 4Q7NA 2DT1A 4ZFMA 2V3DA 1A47A 3WMSA 4CD8A 1VFUA 3U7VA 5HXMA 1GOWA 1K9EA 2XJ7A 2YIHA 1GZJA 1UR9A 3VNZA 3ARVA 3RILA 2WMGA 4E2OA 3SEPA 1LL4A 1QHPA 3RM4A 3J7HA 5A69A 4Z2GA 3WDIA 2O9RA 1W1VA 1WZMA 3PN8A 2YA0A 4P8WA 2XFFA 2YOCA 3RJYA 2WCAA 3AHXA 2ZX7A 2GVYA 3KEHA 1PJ9A 1UOKA 2Z1KA 4TOQA 4DUVA 4P7RA 4UZSA 2BHUA 1CXEA 1DWHM 3WL0A 5BXTA 5I5RA 4LQ1A 3AI0A 2VX6A 1NP2A 4M81A 4GO9A 4QLKA 2WAGA 4WK9A 1J0HA 5AC4A 1WDRA 1DWJM 3T0DA 1EQPA 1W3KA 2ZXBA 1XD1A 1GHSA 3AXIA 2XTKA 5A2AA 3WIJA 4MB4A 1IT0A 1M03A 3F5LA 1SMAA 1S46A 1W9VA 1A3HA 4PMUA 4D6FA 5FL0A 3ARXA 4EAMA 1B3WA 4AMCA 1W1YA 1X6NA 4P7NA 2ZXDA 3K8LA 5CSUA 1E55A 3U7BA 3VX1A 5A6KA 1MW1A 1HKJA 1UWUA 1XH2A 4JHZA 1UQZA 5TD4A 1D2KA 4J3UA 3CMGA 1TFVA 1Q6GA 1WZLA 1JZ3A 1RH9A 3ZJKA 5DT5A 2EBNA 4UCFA 2YBUA 1VBRA 3VDAA 1D7FA 5IDIA 4MNJA 4BZYA 2UY5A 1QW9A 2PWHA 5JBDA 1V03A 1US2A 1HNYA 1W9UA 4AD5A 5BCAA 2A3AA 2D24A 4U3CA 2VRJA 1UG6A 3HMCA 4S3KA 3F4VA 3AJ7A 1GNXA 5HPCA 1EHAA 1MYRA 2WMIA 1US3A 3M6DA 3N17A 4TTUA 1CXFA 3CZEA 1C8XA 4AZBA 3WH6A 2J25A 1DWAM 3ECQA 1G9HA 1V6WA 2GSJA 2QPUA 4XUYA 1BFNA 4CVUA 3D3AA 4N42A 3CGTA 2XGIA 5F7UA 3RJXA 1D3CA 2EPOA 1BHGA 2WMIB 2W66A 2CEQA 3VOCA 1H1NA 1UD3A 1K6AA 3RM8A 3A4AA 4NSBA 3WFLA 4AZIA 2WHJA 1C92A 3MO4A 1JFHA 1W9XA 5IXEA 5EB8A 2ZOXA 4JFVA 1H5VA 3WH5A 2BFGA 4UFLA 2NT0A 4U5IA 5D9MA 2WVSA 4CCEA 5GQBA 2V5CA 3HU7A 3POHA 3WELA 2YL9A 3G6MA 3AHTA 3VUPA 1B2YA 1MFUA 1OINA 2VURA 1HL9A 3CTTA 5A8NA 1J18A 1XSKA 2BY3A 3WF4A 5A1AA 4LX4A 2CETA 2Z1SA 1CTNA 1W3LA 2WLZA 5EFFA 1B3YA 4GINA 1QI2A 1E56A 1FHDA 4AW7A 1B0IA 2XVPA 3NDZA 2MANA 4JIEA 1MQRA 1OGSA 1E6NA 1JNDA 3BAWA 3KWXA 4U31A 1CGTA 1B1YA 4Z2JA 1Q6EA 1OIMA 3GH4A 3TTYA 3WNKA 1E6PA 4S3JA 3NJ3A 3TOPA 1XGZA 1VRXA 1BVZA 1MXGA 3AXXA 4TTGA 5D8WA 4LXFA 1NOFA 1HP4A 8A3HA 1VFFA 5E09A 4XB3A 1VFOA 3CZGA 1E4IA 4RE4A 1HJUA 5A8OA 1H3GA 2DSKA 5CGMA 1OSEA 2WCGA 3TA9A 1JF5A 4PTVA 3RMEA 2PC8A 1E4NA 3W25A 4LYQA 1UH4A 1BYDA 1KR1A 4TVCA 2WVTA 2NT1A 1J0YA 3AIEA 1V3MA 1UWIA 4Z2LA 3AMLA 2UY2A 1KWGA 4AD0A 1V0MA 1CZ1A 4PMZA 3CIVA 3AICA 1C8YA 1V6XA 4PMOA 3VD9A 3A4XA 4ACZA 5ECUA 3CUJA 2CBIA 3TTSA 3POCA 3WQVA 2O9TA 2BV9A 2J8FA 5C70A 1HIZA 1VEMA 3WMBA 2XYLA 3W26A 2WSKA 4NZCA 2WKGA 5ABGA 1QI5A 4UZUA 3NUKA 4UOJA 1CGYA 5E6ZA 1ISYA 5A6MA 1XSJA 3MMUA 4JFSA 2CXGA 3T2OA 3ZR5A 1HJQA 1KFWA 3AS3A 3WSUA 4H2CA 1L0PA 2G3IA 3FY1A 1UYQA 2XM2A 1SYTA 1R87A 2WZIA 5DO8A 2DIEA 3IAPA 2W4XA 2DEPA 1V02A 3K8MA 2ZX9A 4D6GA 3AQUA 4MAZA 3LPFA 3ZJ8A 2XSAA 1CGXA 4QP0A 2Y8KA 4JKLA 1E72M 2PWFA 4PTXA 3N13A 4H8UA 2TAAA 2PBGA 3W29A 2J47A 3MUIA 3EDDA 1ZL1A 5E70A 1WDQA 2WMHA 2W92A 1OT2A 2G8ZA 4Z2KA 3VGEA 1NWTA 2WWDA 1ITCA 2VO5A 5FD0A 1NOUA 4WSKA 2WHLA 4ATDA 3BCDA 4KGLA 4MTVA 3BC9A 4PUEA 5FKYA 3N12A 3QR3A 3FHAA 3KL5A 4KRUA 3SCQA 4P8UA 5AY7A 3W0KA 3DHPA 3KL0A 3ZOAA 5BRQA 1BGGA 3CUIA 3AIBA 3THCA 2VZOA 3PZ9A 3S6TA 1CYGA 1EDQA 3APGA 5D9OA 1LWHA 4PMVA 3VIFA 1CXKA 1CGWA 1JIBA 3HJEA 2CHNA 1JZ2A 3ZIZA 1AVAA 1WDSA 4HOZA 3PZUA 4NI3A 2CKRA 3BCFA 4AEEA 3ARWA 3OIHA 1JI2A 1MXDA 3CZ8A 1RP9A 2A3HA 2YLAA 4UFHA 1G5AA 1LL7A 2YL6A 4GO8A 1TVPA 2DDXA 4N0RA 2JIEA 1UHVA 4ACYA 5E0FA 3WDQA 1B9ZA 5A8QA 3PZMA 1JZ7A 2NSXA 1EO5A 1WZAA 2DSZA 3THDA 5IHRA 1CWYA 2EQDA 2VTFA 3FNDA 1E6XM 3GH5A 3WQWA 5LYRA 4AYSA 4EANA 1V08A 1HKIA 3CLWA 1OGBA 1VEOA 4P8XA 7A3HA 1KXVA 1BVNP 1VEPA 5BXPA 3VNYA 5A8PA 1EXPA 3WQ4A 2XSBA 4TUFA 1UH3A 1UKTA 1CIUA 2J79A 1J10A 1LJYA 2FHCA 1UKQA 4BQ3A 2W67A 4EKJA 2YDSA 5A6AA 2A3EA 1KGXA 4D6JA 4QLLA 2UY4A 1BYAA 3CZKA 3MUAA 2VJXA 2CIPA 3HN3A 4DWSC 1HKMA 3M7SA 3VDHA 2VQTA 2DGAA 2G3MA 1J0IA 2YA2A 3AMDA 5BXRA 1UUQA 3G6LA 4W8LA 4CU8A 1ZJBA 3CO4A 1HN1A 2BVDA 1PBGA 4WKAA 3SCTA 2DSWA 1QNSA 5CGTA 5M17A 3CZJA 1BF2A 5A2BA 1GORA 2CBVA 1XHGA 2G3NA 5I79A 4AC1X 1JD7A 3ARZA 4PCSA 1N82A 3VMNA 5I77A 3OGSA 4HZ6A 2VZVA 2IXUA 3CHDA 1JG9A 4R5EA 1XH0A 3D5HA 3AS1A 3OLGA 5A6BA 2O92A 1ITXA 3AIVA 2AMGA 3FHQA 5IFTA 4FMVA 4AZCA 4BA0A 2F8QA 3VD4A 4UQBA 4BF7A 4W85A 2BVYA 1QBBA 3U57A 4OUEA 3O6AA 2D0FA 3VGGA 5JIWA 2CPUA 1W2PA 2YJQA 2WM0A 2J7GA 1R85A 1J01A 4UFJA 7TAAA 4DUXA 1CXIA 3WF3A 3ZJ6A 1WZKA 2J7HA 3ZSSA 2B31A 2EPKX 1DP0A 2VI0A 3AIRA 3L4XA 4D6EA 4JFTA 1UQYA 1V3JA 3QOMA 1FA2A 4PBGA 1M01A 5I6SA 2EXOA 4CGTA 4LPCA 4DUWA 3VO0A 4F9DA 2V3FA 4M1RA 4XZBA 1YHTA 3GXMA 4TVUA 3WNMA 2O9PA 2IUZA 1MWOA 5HBFA 2BY1A 2VUYA 1E40A 2X05A 1TVNA 2XM1A 3UERA 2DT2A 4MADA 4KRTA 3ZSTA 4HPGA 3WEZA 1W3JA 2D3LA 4AISA 7CGTA 4DWSA 1BSIA 1ZU8A 3W27A 4JL2A 3PZOA 3WD2A 4BQ5A 2QMKA 3K1DA 4MDPA 3AZSA 2VR4A 2WC3A 2NW0A 3L4ZA 2FGLA 4WLCA 1C91A 1CXHA 2WCSA 1Q6CA 1UWQA 1CEOA 1J11A 4DWSB 3DYOA 4QAWA 2X0YA 4A4AA 3IJ9A 4JFUA 1LL6A 4OKDA 1VFMA 5I23A 4UR9A 4AZ5A 2WB5A 4WKFA 1R8LA 1PAMA 1G01A 4P7OA 4CVWA 4PMQA 3T08A 3WH9A 2W61A 1M53A 1JFXA 4GZIA 3ARUA 1EA9C 2UWFA 3EDKA 1PZ3A 5I2UA 1E6ZA 4UTFA 2YDRA 5AC5A 3K8KA 2BNJA 3NSXA 1EH9A 1UWTA 3ZMRA 1MQPA 1ZS2A 4CD4A 3OZPA 3L4TA 3SUUA 2XIBA 1H11A 4L4OA 3BAXA 3CPUA 5I3DA 1ISZA 2XVLA 4FLSA 3SUSA 2DIJA 4D1IA 3MANA 4C7GA 1B3XA 3IJ8A 4GI6A 1UR4A 2OWCA 3N11A 5DF0A 3WBAA 3VKKA 2D2OA 2Y2WA 3ZQ9A 2GJPA 2ZUNA 3PZVA 4UFKA 3AHZA 1M7XA 1WKYA 2ZWZA 1J9YA 3TTOA 1G1YA 1UKPA 2FHFA 3AFBA 3W6MA 2RGLA 1ECEA 1XYFA 4GKLA 1B31A 1BPLB 4FLRA 3NDYA 2EEXA 2WHMA 1E70M 1UD6A 2WPGA 2XG9A 2D22A 3VM5A 4JCMA 3UG3A 3WD1A 3IK2A 3PZIA 4PTMA 2CBUA 1OM0A 1CXLA 3KZSA 4DM2A 3PTQA 4C7FA 3NYDA 4E8DA 2OWXA 1IZJA 4IUGA 3AOFA 3CZLA 1VB9A 3WDRA 2GUYA 1FH9A 1QBAA 1V0LA 2X2YA 2CERA 1JXJA 1W3HA 1GJWA 4W84A 1XCXA 1RD6A 4D1JA 2BHYA 3AYSA 1L8NA 5I78A 1JDAA 1CDGA 4D6DA 1H49A 3SCOA 1ISXA 3GNRA 1LG1A 3VILA 1CBGA 2YKKA 3VD5A 4FLOA 3SCUA 3VX0A 3WEOA 1GOIA 4AIUA 4RE3A 2BS9A 3T2PA 4TXEA 4AZ6A 1XH1A 1G94A 1QW8A 4HMDA 4W8AA 1XC6A 3BLKA 1PX3A 4MB1A 1LG2A 1BYBA 3WH8A 1LQ0A 4GQRA 4MDOA 3DYMA 4HA1A 2PWGA 4PMYA 5DFAA 2CHOA 2V3GA 1JZ6A 3QHNA 1BTCA 2ZUTA 3WF1A 1V3IA 3B9EA 1BGAA 3KE0A 5CJ5A 1E9LA 1W2VA 1MW0A 1KGWA 1JI1A 2VOTA 1JZ5A 3WDHA 4GZJA 4V27A 3SCSA 4GQQA 5CQ1A 4HPHA 2WMKA 2JF7A 3AIWA 4PN2A 3VIKA 3GDBA 4OBRA 3VU2A 4XZWA 2A3CA 2QV4A 3EMZA 4M8UA 4CU6A 4NRRA 3ARRA 3BSGA 2OSWA 1GOMA 1NP0A 2ZUSA 1FP8A 2ZXQA 2CNCA 5IFPA 2GJRA 4PMRA 3SCNA 4BQ2A 3PZGA 1QHZA 1UWSA 4MNLA 3W6LA 3WN6A 3GBEA 3VD7A 1EQCA 3MMWA 4UOQA 1E4LA 3BXWA 3GTNA 2YLLA 3MV11 3EYPA 2W62A 1UR0A 3MUY1 4D71A 2JE8A 3BAYA 2AOSA 3VMOA 2WVVB 2QHAA 4U33A 1X6LA 5A6BD 3EDEA 4MNMA 2J78A 4BCEA 1MFVA 2J4GA 3O2LA 1VENA 1KXTA 2FH6A 1UZ4A 5BXSA 2WZEA 4PRWA 1V0NA 1W91A 2ZXAA 5CLTA 4RL3A 1PIFA 1B30A 1DWIM 1UD5A 2XVNA 1JDCA 1U33A 1UR8A 4U3AA 4J28A 1E3ZA 4WSJA 4CN1A 3SUVA 2BHZA 2VCCA 3L2MA 3UR8A 4B3LA 1CNVA 3GH7A 3WUFA 1NM9A 3JUGA 3L4WA 3L2LA 4X0VA 2ZX6A 1HX0A 1H41A 3AMCA 1CPUA 4C7DA 1QI4A 4A3YA 2D0HA 1SFSA 2OSYA 3VDCA 4NRSA 3AISA 3BGAA 4F66A 1U30A 1CLVA 4B9YA 4HZ8A 1CENA 2E40A 2ZUVA 4W7VA 1DEDA 1ESWA 4M80A 5HOSA 1E4MM 3T0BA 3KL3A 4CD6A 2Y5EA 3TONA 2WK2A 4DWSD 1J12A 2VR5A 1O7AA 4H8HA 3UEQA 2XVGA 4AD2A 5A6SA 4JZ5A 5I0DA 1OIFA 3NSNA 3ZO9A 4AEFA 1TA3A 2J7CA 2ZUMA 2YBTA 1GQJA 3VMPA 4W86A 5HNNA 3I3BA 1VAHA 1ZBKA 1NH6A 1MW3A 3WDPP 3OZOA 3WF2A 4F79A 2X09A 3LPOA 1C7TA 4U2ZA 4ZEPA 1TA3B 1VJSA 4H8VA 3IJ7A 3MSGA 3UCQA 4Y7EA 1B3ZA 1FH8A 1FH7A 2W5FA 2Q8XA 4LYRA 3U5UA 1E0WA 3LPPA 4OBSA 4W7WA 8CGTA 1GQLA 2E9LA 2VRKA 1E6QM 1NWRA 1HJVA 2ZWYA 4OJYA 1I1XA 1VJZA 1KQZA 1QI0A 2E8ZA 1JAEA 2OYLA 1OD0A 4M56A 1NOWA 1OD8A 1GVIA 1C7SA 3OB8A 1BAGA 3VGFA 4HMCA 4W8BA 5GNZA 4TX8A 3WENA 3N15A 1V6VA 2CYGA 5JBFA 1H2JA 2E9BA 4CD5A 4KGJA 1F4HA 1FP9A 2VVNA 2XFRA 3WBEA 4CD7A 3PZTA 5LA1A 2E0PA 5A6LA 1WO2A 4JFWA 1SR0A 2X1IA 1E5NA 2PB1A 1PIGA 2OYMA 5CZKA 1WCGA 3RDKA 2E9MA 4GI9A 3AS0A 2UY3A 1AMYA 1KR0A 2OLHA 1K9TA 2VCAA 1ODZA 1KXQA 3OLDA 4KWUA 3WD0A 2J74A 2AAAA 3IANA 3I3DA 1HL8A 1HP5A 3VINA 3UG4A 2CBJA 3BAKA 2QPSA 3WQ8A 3WDJA 1M04A 3W37A 1TR1A 1JYXA 1CLXA 1GONA 4KH2A 3DC0A 3MMDA 3VM7A 2WYSA 2C8NA 1TMQA 1UD8A 1H4PA 1E6SM 1KCLA 2VL4A 1VF8A 2WBGA 4OOZA 2EO7A 1B90A 1V6YA 1DTUA 3GM8A 4D6HA 5KEZA 1WPCA 1CGVA 4UQCA 1V0KA 1ZBVA 3ZR6A 5M03A 1HXJA 4CN6A 1BG4A 1WDPA 4D6CA 1ODUA 3BAIA 3GNPA 2JFEX 3PBGA 3VIGA 3OG2A 4AD1A 2EJ1A 4EE9A 3EMQA 4DM1A 4F8XA 3CUHA 4AD3A 1BG9A 3CUGA 1WNOA 3VPLA 1BYCA 4E4PA 5KZ6A 1FFRA 5ABHA 4HU0A 4MJ2A 2QLYA 2J7DA 2VX7A 2C7FA 3VGHA 1WB0A 2WMFA 1OB0A 4EK7A 3F5KA 3W24A 5D9PA 2D0GA 4ATWA 3AMGA 4PEEA 4B9ZA 1PPIA 3WY1A 3OBAA 4W7UA 3W28A 1QNQA 4JKKA 5A95A 3WNNA 1BLIA 3GXFA 1V6UA 4UFIA 3AXHA 4JCLA 2WXDM 5FCZA 2C0HA 1XYZA 3IAQA
chains in the Genus database with same CATH superfamily
4MIMA 1LM1A 5AVNA 2G4FA 4M24A 4PC8A 4GBUA 4AWEA 1JZ8A 4H41A 3BMWA 4O52A 3JU2A 4E6MA 1KM1A 3JR2A 1JZ4A 3PR2A 4X63A 2PFHA 3BWWA 2NQ5A 2J9ZA 2DZBA 1JF6A 2G3FA 1MEIA 4PL1A 4LAKA 1QO2A 1TB3A 5JUVA 3IRDA 5CLWA 2PWEA 1MMFA 3DGRA 1QDSA 3TTQA 2ZRZA 1GZ1A 2XFYA 1V3HA 3S5ZA 3R79A 3ZVIA 5C9RA 2PF8A 2O9OA 4O1AA 1RY0A 4JN7A 4EPBC 3BAJA 1GHRA 5AZ1A 1T7LA 4NAFA 1GGOA 2B81A 5M2FX 4GX9A 1J2WA 4I9TA 3CXOA 1FQ0A 4JAWA 2PGWA 1PTDA 3KOXA 3PFRA 3CAVA 1VFHA 2IPFA 4TMBA 4QM1A 3CH0A 5EMLA 3A5FA 1O95A 2YZ5A 3ARQA 1PKNA 1E73M 1Q4NX 1QNRA 3QC3A 5DMYA 1W54A 5L9FA 4C6FA 1NDWA 3WUGA 2YL8A 2EPNA 3GC2A 4O13A 2J66A 3PY2A 2G0WA 1E1CB 3LBOA 1XYLA 4DJDA 4KMQA 2PDYA 2J7FA 3TC7A 3HF3A 2J9YA 4IJCA 4WDXA 1RQHA 2OFJA 1EZ2A 3K4DA 3KOWA 1J0ZA 4OZOA 3QOKA 3IIZA 3W38A 1O5RA 4JY9A 3GVGA 1UBSA 2B7QA 3G0UA 2GJXA 1I2OA 5A8GA 2Y24A 4PUUA 3CL7A 5HANA 1HVQA 3BLLA 6XIAA 1AQMA 4QIUA 3CUFA 3MJMA 4NF7A 3GRIA 1ISWA 3GAKA 2GJXB 3TSMA 2VELA 2HE5A 3WLQA 4AC7C 1R3RA 4KCVA 2H6RA 1FWJC 1AQHA 1XSIA 4BI5A 1AW5A 5DBUA 1SSGA 3AYTA 4XIMA 4RZ5A 4O8RA 3UFYA 4XVDA 6A3HA 2GFTA 1AD1A 4AIOA 1V3LA 1ITQA 4NZFA 3W53A 4K8GA 1UB3A 2X42A 3I7SA 4O1EA 4JQAA 4PUNA 5TQLA 3VIPA 2QCMA 4B15A 3EPMA 4H1ZA 4JIPA 4HBKA 4JTEA 1T5AA 4IPIA 1YIXA 2J88A 3A9IA 5CG0A 2DPEA 3RIKA 1P6WA 2AQWA 2X0HA 3L23A 2TMDA 4H6EA 2X40A 2JIWA 5JH2A 4PTWA 5B7ZA 1LRTA 4E8CA 1K9FA 1X1OA 4QJ5B 1XP3A 2XH0A 4G7EA 3H54A 1SW7A 1TJPA 3LCXA 3IEBA 2G41A 4CUCA 2NX9A 3DOPA 3UVAA 3NPXA 2Y7EA 1WP6A 4AMAA 4E3VA 1OGGA 3K46A 4P7LA 1KWKA 4HOXA 1JRCA 3FAXA 1RQEA 2X2GA 3NQ7A 4Q7IA 4YTQA 3I10A 4PCFA 3U48A 1GT8A 3GTXA 3QLDA 3UXDA 4GA8A 2PDUA 1I2PA 1HKWA 2BODX 1JCJA 1GPFA 5DLCA 3NQVA 3QEZA 4P61A 4NYYA 4PSPA 2Y8VA 1TCMA 2VGGA 1GOKA 4HA3A 3NQMA 4CN4A 1ZP4A 3OGRA 5GPRA 2DZAA 4GGBA 4PYSA 3U6WA 1UPMB 2DW7A 2WSRA 5FF2A 4DZ5A 1XX1A 3L65A 5E0CA 2V5LA 4LRTA 4GY1A 2WZHA 2PDNA 2FB2A 4AZHA 4B2DA 3SUWA 3G2GA 2YDAA 4Z2HA 5HQMA 1P0DA 3KRSA 2PF0A 4DI9A 1LQ2A 4AVOA 4GIYA 4PRTA 1D3HA 2CW6A 4MGGA 3MS8A 1QXLA 2F61A 4J1OA 4ZSUA 3T2QA 2XIQA 4Y9AA 1KQYA 3C2FA 3WQGA 4C6CA 1HGWA 1ONRA 1H0IA 1Z8AA 5JMUA 1TX0A 3P3BA 3PC0A 1JYVA 3K30A 3GDMA 2INFA 2RDTA 4ZE4A 2W63A 5FJIA 2BGSA 3RCNA 3WNOA 1ZJIA 3HQPA 2JF6A 3UZXA 4HGXA 1RUSA 4J3VA 4WDTA 3TN3A 2DQXA 4RXFA 4RUBA 5D32A 2GK1A 2Z00A 3BZGA 5A94A 1ADDA 1XYMA 3KCJA 3ELFA 4DBDA 3GDTA 1S38A 1FWBC 3GIPA 1DIKA 1QW7A 3L0NA 4ICCX 3TNBA 2GK1B 4N4PA 1SO4A 1NWUA 1XRFA 3WLLA 3BGJA 3STGA 3R2GA 3ZT5A 5ECVA 3BSHA 5A8MA 4PMDA 1A5BA 3G1SA 3NEVA 1W1TA 4L5ZA 4HA0A 3Q2DA 4DJFD 1DHKA 2A7NA 3E5PA 1E71M 5D38A 3KP0A 1KBBA 1UR2A 4HVXA 3HPXA 1P5BA 3S2MA 3VKJA 3GHUA 3EX2A 3BQ5A 4N02A 2FYMA 1TRIA 4GJJA 3WMCA 1Q5MA 1TUXA 1NWSA 4Z2IA 2G97A 1LLWA 1W9BM 2F2HA 2I7GA 4ZL1A 1HKKA 2FTPA 1XIDA 3W1TA 1P0NA 3UU0A 1LRQA 2NXGA 4UNIA 2P1FA 1UA3A 3GY1A 3I3EA 4OBTA 1M7PA 3W4RA 3QXBA 3C0JA 3JW7A 2J7EA 2X8RA 2XUCA 2J75A 1E43A 2ZE0A 4QX4A 5DQPA 4GYJA 4N9CA 2D1ZA 1JYWA 1FDZA 3BE7A 3CHCA 1ITUA 2JEQA 4AWTA 3UJEA 3O16A 1S5MA 4DO5A 5LNSA 4ATLA 1WX0A 1H5YA 4KFOA 2RDUA 2E5DA 2ZZ3A 3L9CA 4IQEA 4MB5A 1BRLA 8XIMA 1VHNA 1ZTVA 3NGJA 3GFYA 1J4EA 2ACUA 3WUEA 1C8VA 3G1DA 2IQ0A 3V5CA 5DT7A 1R86A 3BH4A 4B5VA 1VPYA 2HMCA 2WANA 3V35A 4H04A 2I1OA 4I5XA 2PAJA 1O94A 2HXUA 1BF6A 4KEZA 4REQA 1BRLB 4IM4A 3L4YA 4OV4A 4YNGA 4HA4A 1EDGA 4G7FA 4J27A 3NA8A 3C0QA 1GUVA 3CQKA 1EC8A 3F1QA 1OYCA 4REQB 3W7CA 1OWQA 2GYIA 2IPJA 3GR8A 1KXHA 3EX6A 1FDJA 2OT1A 3WKZA 5BOOA 3E96A 3M4HA 4IP7A 2AL2A 4PUMA 1FY6A 2I16A 2ZICA 2B7OA 2QMJA 2NXIA 3OA5A 5C8BB 3KHDA 2BDQA 2C15A 4HMEA 1TJ1A 2R14A 4HK5A 3E0WA 2YL5A 4KEUA 3TUUA 3C5QA 5LA2A 4M5PA 4IQDA 3W75A 4HYRA 3AZRA 1YPFA 1UKOA 1FCQA 2AL2B 1ZBCA 4AH7A 3NQ8A 1TTIA 4AFYA 3CBWA 3CC1A 1R5YA 4W93A 4YHEA 1UC4A 3LHTA 4UQDA 1FXPA 3UXIA 4HHHA 4B5UA 1XBXA 4UTTA 4ML4A 3OHMB 4IX2A 4D72A 4ZQPA 4UCGA 1AW2A 4KPLA 3E1F1 3RGTA 3SSJA 1R3VA 3WQFA 4PTNA 2Q8ZA 1JYNA 4FLQA 3VGBA 3KBMA 1GOQA 4GLEA 3OGVA 4RE2A 2YW4A 5LZLA 5XIAA 4YHGA 1VLWA 3RPDA 4HTYA 3VOHA 4L4PA 2R24A 1CCWB 2V5KA 2V3DA 3WJXA 4NAEA 3WMSA 4KCWA 1VFUA 2XH7A 3G8RA 5HXMA 1FWCC 1PDYA 2YIHA 8RUCA 4E2OA 1LL4A 5A69A 1HTIA 4Q4RA 4Z2GA 3WDIA 5FA5A 2YOCA 4NAEB 1JPMA 3NZQA 4AWUA 3KEHA 1P7TA 3DFTA 1PJ9A 1QPRA 2GVGA 1LBMA 3WL0A 5BXTA 1UR3M 3W3OA 2Z2BA 4GO9A 2VFHA 2PDMA 1LTDA 5AC4A 4GH1A 3LLDA 4Y9OA 3D6NA 1EQPA 1P7TB 1W3KA 2ZXBA 1GHSA 4JIQA 4IMEA 3L5AA 3AXIA 5A2AA 2SFPA 4HNOA 3C0SA 4LV4A 3V1PA 1IT0A 2A7RA 4R7WA 3ITGA 3ARXA 3SDOA 4EAMA 4AMCA 3TKFA 3LYEA 2PCEA 1GEHA 1GVEA 1E55A 3U7BA 3MT1A 1D8WA 3VX1A 3R8GA 2RFGA 4A22A 5A6KA 2ANUA 4QQ3A 3LY0A 5DANA 4PB4A 5FSEC 3Q45A 4MWAD 1FWDC 4AF0A 3MKVA 3QFWA 1OC5A 3ABRA 1RH9A 2QQ6A 2PDIA 2EBNA 3TJLA 4FA3A 3QH2A 3VDAA 4XUGA 2PDCA 2BGNE 1TJ0A 2PWHA 1KRCC 1V03A 2WSYA 1US2A 2RH9A 2J13A 2GVLA 1I9CB 2A6LA 1HZYA 3HMCA 3KFTA 4S3KA 3G1RA 5I3GA 1GNXA 3N17A 3KBVA 4AZBA 1UCWA 2J25A 1O12A 3ECQA 4GC3A 4AHQA 1G9HA 2AMXA 2QPUA 4CVUA 1UUMA 3MMTA 3CGTA 1RY8A 3CPRA 5F7UA 4ILSA 4ADSA 1BHGA 1O5QA 3EPNA 2CEQA 4Q8TA 4C6JA 1H1NA 1TSIA 4WOZA 4NSBA 3WFLA 4AZIA 2WHJA 2C14A 4YMZA 1YPXA 4GQ0A 3W23A 1P0EA 3SRFA 5EB8A 4IIEA 3WH5A 2BFGA 1SJDA 4J5NA 2WVSA 4DB7A 3OEXA 3FS2A 5TBOA 3EX1A 2V5CA 4CNPA 3G6MA 1FRBA 1KLYA 5HMDA 4R88A 2VURA 1HL9A 4L65A 1EEXA 4FXSA 2JGQA 5G2HA 3W7EA 2IKJA 3LS9A 2PTDA 1B3YA 1QI2A 3H4WA 3Q4DA 1IR2A 4IIHA 3FJ6A 1FWAC 2MANA 3NDZA 3LM7A 5H8UA 4YYCA 1OGSA 3SO7A 1TVLA 1RA0A 3C8NA 1JNDA 3TEVA 3S3GA 3OBKA 1EF3A 3SGZA 1GWJA 1GK8A 1SW3A 4K39A 2EG7A 4XKMA 3HB9A 3NJ3A 1AD4A 3TOPA 1VRXA 1BVZA 2QPXA 1MEWA 1THFD 1UC5A 1HP4A 3H2FA 3F2CA 4MKNA 5E09A 4XB3A 2B7PA 3A3WA 1WBJA 1YBQA 3F4WA 4NZ5A 1E4IA 2FB3A 4RNIA 4ZSTA 1ONEA 1HJUA 4GRSA 5A8OA 1H3GA 2WQDA 5CGMA 3OW1A 1ZSXA 4C6QA 1OSEA 3TA9A 1E4NA 3LZ3A 2Y63A 3GR4A 1BYDA 3HURA 5D05A 2Y89A 3OIXA 3AMLA 2GQ9A 1V6XA 1XDLA 2XH2A 4ACZA 4KETA 4RE0A 2QULA 3FSTA 3PG9A 4AEOA 2G50A 3L2IA 2OX1A 2O9TA 2BV9A 4ICNA 5I02A 5C70A 5K9DA 3TYBA 3A13A 1EX1A 3P74A 3W26A 3TC6A 2HE8A 5ABGA 2R9RA 3NUKA 5E6ZA 1ISYA 3NGFA 1B9BA 1X7FA 3MMUA 3EXSA 2CXGA 3T2OA 5CC3A 3HIJA 7REQB 3P81A 4PBEA 4UBPC 3PTDA 3QYSA 4GZ7A 4K8EA 5HMFA 1WXJA 4QTGA 2Q6ZA 2WQPA 2QGHA 1B3OA 3GTIA 1R87A 4GK8A 3N6HA 3LG3A 2W4XA 1V02A 1MNSA 3G3DA 1TRDA 3HGSA 4FEZA 1TV7A 4QP0A 4PCPA 2PDPA 5CBBA 3JZEA 1UOZA 3ES7A 3TJXA 1FCUA 1WQ5A 4H8UA 3ABZA 1VRDA 1XDMA 2J47A 2VDGA 4PE8A 3GIQA 3QVQA 3EDDA 3IIPA 1V51A 5E70A 2PTYA 2W92A 2G8ZA 3VGEA 4ASTA 5FD0A 5HJYA 4WSKA 4G9PA 3B97A 4KGLA 4MTVA 3Q94A 4W4QA 4PUEA 2AL1A 4ZQNA 4US5D 1BXBA 2VFDA 5BRQA 3THCA 1SZNA 2FGBA 2HV5A 5CPMA 2VZOA 3PZ9A 3VZYA 3S6TA 4Z1BA 2CLOA 3WQDA 3FVDA 4PMVA 1CXKA 1CGWA 1ONWA 4B91A 3ZIZA 1WDSA 3IPWA 4AEEA 3ARWA 1MXDA 1RP9A 3GVRA 1Z89A 2YLAA 5DCDA 4O8AA 2GPTA 2YW3A 3RR1A 4GO8A 2YL6A 4GGHA 2PLKA 4N0RA 2JIEA 1U5JA 4Q4KA 1R30A 4UTTC 4FAMA 5A8QA 1JZ7A 1EO5A 1TPDA 5IHRA 1CWYA 3NQDA 2QCDA 2EQDA 2GQ8A 3FNDA 2DZVA 4R34A 4JTCA 1NDVA 3K4WA 2GWNA 4K8HA 4I6KA 1KXVA 1VEPA 1XDJA 1A5OC 4K2SA 1FWTA 3DU0A 5KTLA 2YXGA 3QYQA 1UKTA 1CIUA 3GG7A 1LJYA 1X97A 1UKQA 4BQ3A 2W67A 4ORIA 4EKJA 3BARA 1S5WA 2A3EA 2BTMA 3MWCA 3G1YA 3RNDA 2Y7DA 4Z0SA 1LP6A 3T42A 3URBA 3M7SA 3VDHA 1VFSA 4M6UA 5LKYA 4ZODA 1PHWA 3AAMA 3KCLA 4WKAA 1DXEA 3LNPA 1W0MA 2FKPA 1GORA 5I79A 4QQUA 4PCSA 3ZXWA 3W1LA 4HZ6A 3CHDA 3O0KA 1BKHA 1XH0A 5BWAA 3D5HA 3AS1A 3OLGA 3ZFHA 2AMGA 3FHQA 3MI6A 4H6RA 3A22A 4AZCA 4HHPA 1QJWA 1TPEA 4ORMA 1UP0A 3R7MA 4UWMA 4DLFA 4D8ZA 3JRKA 1IIGA 2J7GA 1R85A 4HPJA 3BG3A 5F1VA 4DUXA 3F03K 3LI1A 1EJTC 3ZJ6A 4XAZA 1ZLPA 2EPKX 1XKYA 3H55A 3S1WA 3G3MA 3EWWA 2VEIA 1FA2A 1M01A 1JDEA 5I6SA 2DVXA 2EXOA 5FF3A 1W3NA 2DUZA 4DZHA 4DUWA 3N25A 2QIIA 1TJ2A 4M1RA 1YHTA 1V7YA 2R8WA 2IUZA 1MWOA 2BY1A 1E40A 1KFJA 3R0KA 4Z1CA 2FTYA 2XM1A 3AWNA 1VFLA 2JQXA 4MADA 4GQGA 3ZSTA 2D3LA 4AISA 7CGTA 4DWSA 1Q2SA 3W27A 3VE9A 4A3UA 4NI8A 4GFSA 3S42A 3K1DA 4ZB2A 2NW0A 4Y9NA 3UWUA 2BOGX 3RITA 3C52A 1Q6CA 1BSLA 1GOXA 4DWSB 3CV6A 3DH7A 3DYOA 3GXNA 3M47A 3C61A 3BJTA 3KRUA 5HJLA 2GGJA 1YTDA 1LL6A 2DZWA 4DJFA 4YTTA 1VFMA 2FFIA 3C4UA 3WYZA 4AZ5A 4WKFA 2YX0A 1G01A 4P7OA 4CVWA 3B4YA 3TFXA 1JCTA 1M53A 3XISA 4DO6A 1XIFA 3ANYA 3ARUA 4EWND 7ENLA 2H3DA 2PGEA 1E6ZA 1RK5A 3QY8A 3GK0A 3I6EA 3NSXA 4E2DA 2VD8A 2VGIA 2FQIA 4DEFA 2YYUA 3SUUA 1H11A 1J93A 1U1UA 3DFSA 4H9VA 4Y6GA 3FDGA 4L6OA 1Q66A 3O6DA 2ZYFA 4GI6A 4YTRA 1TQXA 5JQ9A 3VKDA 3N11A 2YCLA 4UFKA 3AHZA 1SUXA 3DFHA 1G1YA 1ZRQA 2ZRVA 3R89A 4DBEA 1L6WA 1EBGA 1NF0A 3TZNA 1RQBA 3EX3A 3NDYA 2H8ZA 1VCGA 4IG2A 2YCLB 2WHMA 1EF2A 4B5TA 3GDKA 3M16A 1VBGA 4JCMA 3UG3A 1EYWA 3IK2A 4CQ8A 1J8VA 1ICSA 4XZNX 2R1LA 3GHTA 1S2AA 2OGYA 4C7FA 2VDIA 3TYAA 1KBIA 2H90A 2GUYA 3RHGA 3L0KA 3DCPA 2NZLA 2CERA 1JXJA 1F73A 1W3HA 3FA3A 4JTQA 2VFEA 5CH9A 1AQFA 1AK5A 3HZ3A 5LIXX 4D1JA 3AYSA 1TUFA 4ZQRA 4EXAA 1JDAA 3TLLA 2VEFA 1VKFA 1V7AA 1XLIA 1H49A 5EL1A 3IACA 1NY1A 2ZRWA 3USZA 3CWHA 7PTDA 1TJRA 4FLOA 3SCUA 3BQ6A 1XBZA 4RE3A 1YNQA 2ACQA 3T2PA 4AZ6A 4LB4A 2FTWA 3BLKA 1LG2A 3O3RA 3EEGA 4EPEC 3M64A 4GQRA 1GEQA 3DYMA 5IRPA 3QHNA 1BTCA 1N55A 2ZUTA 1BWLA 4GYPA 4Q4PA 3KE0A 4FOUA 1DV7A 4DIAA 1KGWA 1JZ5A 4H4IA 3QLLA 4IIGA 4V27A 3CYJA 3FGCB 2JK2A 2VFIA 3AIWA 2F6XA 3L5LA 4PN2A 3VIKA 4F2UA 2A3CA 3IARA 2CLMA 3HQNA 1F6YA 4FX8A 4HKPA 3BLIA 3FFSA 5IFPA 4PMRA 3T0CA 3PZGA 3P61A 4GD0A 5M1TA 3NR0A 1ZNNA 1W6TA 3MMWA 4UOQA 3BXWA 4X9SA 2POTA 2W62A 4M1BA 2QEZA 2PODA 3OBEA 2QHAA 4WJ8A 3TIMA 3A12A 1ZAJA 3SY8A 2FH6A 3T6CA 5BXSA 4AVNA 1V0NA 1H7RA 1EJVC 1PTGA 2ZXAA 3SR7A 1PIFA 3LXBA 3TK7A 3H2MA 1DWIM 1UD5A 3PB2A 2XVNA 1U33A 4CLMA 4U3AA 2AQOA 1E3ZA 4JTAA 3SUVA 2VCCA 1H60A 1MXSA 4Y96A 4B3LA 1S1PA 3QKZA 3TXVA 3WUFA 4X0VA 4F0SA 3L2LA 2W79A 1IF2A 5I3IA 5MKGA 3AMCA 4C7DA 1P1XA 2D0HA 1AJ0A 3GD6A 2XINA 1XI3A 3T81A 3BGAA 1LLZA 4JQ1A 1U30A 2OG9A 4HZ8A 4GFIA 3PWGA 1P43A 5MKGB 2E1DA 2HJPA 3B8VA 4E4UA 2CLPA 3KL3A 4HCHA 3ID7A 4C1NA 2WK2A 1IGSA 2ZZ6A 1QUMA 3MBFA 4C6IA 3UEQA 4AD2A 5A6SA 5FEZA 4PODA 3ZO9A 1FKWA 4WEVX 4KCUA 2ZUMA 4D8LA 1W5PA 5G4WA 5CG7A 1CI1A 1I2NA 5AHEA 1SFLA 3UR2A 4MWAB 3LPOA 1C7TA 4U2ZA 1VJSA 5KZEA 3TN4A 3IJ7A 4LCSA 3E38A 4RZ4A 3PBVA 2EPHA 1O5KA 1SJAA 1B3ZA 2V8ZA 4OBSA 1YXDA 1GQLA 3M41A 4IZGA 1E6QM 4UTJA 4MSSA 2XN1A 2E8ZA 1JAEA 3INPA 2OX4A 2WJFA 2D2GA 4HSNA 3HV8A 3G22A 3ES8A 1XQLA 1C7SA 1HG3A 2CXEA 3OB8A 3BG5A 4DZIA 2TODA 2BWGA 1RVGA 3VZXA 5GNZA 1POKA 4TX8A 5D09A 5KMYA 3S1VA 4QISA 2OZ3A 3GHRA 4YU1A 4HNVA 2OZ0A 5JBFA 2E9BA 4JDYA 1R9YA 2VVNA 2Z6JA 2ZZ7A 4JFWA 3V36A 4KIEA 2PB1A 3W2NA 1EA0A 2E9MA 1XRTA 1QAPA 3R8HA 3UJRA 4OWGA 4EPDC 1H51A 1KR0A 2VCAA 4V33A 3P0WA 4GUFA 3WD0A 2OPJA 5C54A 4GUGA 2FIQA 4BK9A 1OFBA 4FNRA 3REQA 2X41A 4LUJA 5LHEA 3R0DA 1JYXA 4WOQA 4A3QA 3RR4A 2P5NA 3WQPA 3MMDA 2VXNA 2MNRA 4L6HA 3STEA 2XFWA 3WK0A 2VD9A 1E6SM 1KCLA 2WBGA 4HNUA 2DP3A 2R91A 4D6HA 5KEZA 1MDLA 1SZGA 3EA2A 1WPCA 1CGVA 4UQCA 1UJQA 1PKLA 2W3ZA 5M03A 2DW6A 4L4LA 4B3ZA 4LRSA 4N2YA 4C6KA 2C1HA 3BAIA 1ZAIA 5C6MA 1KRAC 3PBGA 4BI7A 3KCOA 2V63A 3WLIA 2J24A 4M3PA 4W9TA 1YW1A 2VC5A 3EMQA 4LNCA 3TW9A 4DM1A 4F8XA 3CUHA 1BG9A 1QR7A 5C5YA 4DJFC 3VPLA 1BYCA 3TZFA 2QLYA 2VX7A 3VGHA 1OB0A 1MRAA 4EK7A 1F05A 3B03A 1EB3A 2D69A 2D0GA 3PAOA 3AMGA 4PEEA 3WY1A 3OBAA 4DHGA 4XWUA 3W28A 3ITCA 4J2PA 4K6AA 1V6TA 2OZTA 2OEJA 3SGGA 1RXOB 4JTSA 4U4MA 4UFIA 1FDYA 3ITVA 4JCLA 4I9AA 3IAQA 3UGRA 2A2IA 2PGRA 3PM6A 3N6QA 4DRSA 2QKFA 1H7PA 3HBLA 3NZGA 4AB4A 3ITTA 1PZ2A 3UXKA 1I0DA 1OCQA 1R2TA 4NZ3A 1Q6DA 1EL3A 3D3FA 4ADTA 2JBMA 4CNUA 1L6YA 3AHVA 3UWEA 3GZAA 5AHIA 5LNWA 4LUSA 2QZRA 4JYDA 1C93A 4KBXA 1KBLA 3SY1A 2R6OA 5FOOA 1VCVA 4PCTA 2AGTA 3NWRA 3SCVA 2Z1XA 2A85A 2E6YA 3DENA 3BLDA 3ALFA 1M65A 1E0VA 1J2BA 1J5SA 4HP5A 4W87A 2XIIA 5ABFA 5BOEA 4PL2A 3P93A 1XV8A 1W17A 4NU7A 3VD3A 3QGVA 1A50A 2PZ0A 1ISVA 1JPKA 4W5UA 3W2MA 5ABFB 1EOKA 3GFXA 1RPKA 1XQKA 3L7RA 4U2YA 3GXDA 3IUIA 1JPDX 3PUGA 4ROQA 6TIMA 5BMWA 2YCIX 3VIOA 1TV5A 1C3FA 2E4TA 4J3WA 1E9IA 2OLSA 2V2CA 3EOLA 3N9KA 3TQVA 4LUTB 3I4EA 3WJWA 3CWOX 2FPTA 4LNYA 3AYRA 4PULA 1LT7A 1YLVA 1WXYA 3N73A 1XINA 1LYXA 4U5KA 3B05A 3DG3A 5DX7A 3MSYA 4LVAA 1H7WA 3BLPX 3LD5A 2CCRA 3MBDA 1EHNA 1WE5A 3W87A 4GYPC 4FIRA 2E68A 1Z3NA 2GL5A 4HOWA 2BX7A 1G6CA 3CHFA 4OQVA 1T96A 4TR9A 4MVAA 4LEFA 3AC0A 2YPIA 1MW2A 2PWDA 2VNCA 3SIZA 5MHBA 4ENLA 2FGZA 2PDHA 3PTMA 1IEQA 1E0XA 3SCRA 3AZTA 1OFAA 3U2ZA 3ZJ7A 1DE5A 1TE1A 3WNPA 2E3ZA 3NL5A 1DTNA 2HVNA 3E49A 3EA1A 3B40A 2RKXA 1R47A 3MZNA 3HFYA 1J0JA 3DHUA 4BR1A 4Z42C 3WL1A 4WCJA 3CQ0A 5G5IA 2VMFA 1X8FA 1NF7A 2BXYA 4IJRA 4GVHA 1YNYA 3OZYA 3TVAA 2WOQA 4IGHA 4A8RA 1TWIA 4X22A 3DECA 4NXKA 4WZHA 4NXSA 1W5MA 3L5MA 3VOGA 3QR1A 4EOUA 4JNZA 2HDJA 1QWGA 4O17A 1WXZA 1YNPA 1H7NA 1K02A 4Q33A 3W22A 4YWSA 3VIJA 4DY1A 3EOUA 1FUYA 7TIMA 1O68A 3F4NA 2CESA 4FZIA 2VZUA 3S6OA 5LGZA 3KM8A 3AYVA 4HK7A 1XLFA 4L7ZA 5KSWA 3SJ3A 3GYCA 1EC7A 3F7JA 4JL1A 5T91A 1S1RA 1TPFA 3VIMA 4ZO6A 5CSYA 1JGIA 3VNIA 1OX5A 4MWAC 9CGTA 8TIMA 1NTHA 1R9ZA 3QHMA 3K5XA 2PDJA 2E8YA 1QVBA 5EFDA 2WVVA 4FB7A 2ON3A 4ZOEA 2PSNA 5IHSA 3UGVA 1AH4A 1I1WA 3PUOA 1US0A 4G1KA 3OVPA 3FXYA 2QDGA 2ZIDA 2ODOA 4A21A 1HJWA 2OKTA 4CU7A 3RU8X 1KCKA 2NQZA 1E9YB 5LA0A 3S5YA 2FDMA 3AIUA 1ZUAX 9XIMA 3PTKA 4W88A 3AS2A 1DWFM 3VKAA 3G1HA 2QUTA 2HZGA 4TMCA 3S83A 4PA8A 1A5LC 5K2ZA 4Q4QA 3FSUA 2QNEA 4J3XA 1NARA 1U83A 4V2XA 3VNDA 2IQDA 4KEVA 1TTQA 5BRPA 4LYPA 3CHEA 1KBKA 1QNPA 2WNNA 5DEZA 4YN5A 1M68A 3ARSA 4O12A 3KTXA 1KM2A 4BF5A 1F74A 4ZXOA 1UBPC 3P6LA 1KFCA 3RLVA 1L8PA 3DFQA 4O19A 3LV6A 3UJSA 3QN3A 5HR7A 3GZ3A 3SFWA 4QE1A 1TTJA 2P50A 5GNYA 5EMMA 4GZEA 3ARTA 3MPGA 3UCDA 3VTRA 3F5JA 2VC9A 1PO9A 4B5NA 1A4MA 2ZZ1A 2OO6A 1OK4A 1DJNA 1ICPA 5FSDC 3P2VA 4RW3A 2FVLA 4V1XA 3NQFA 1NDZA 1RBOB 2WV8A 1QK0A 3LTYA 4Q22A 2CZDA 3CPGA 1OJXA 4Q8VA 1YDYA 5E5CA 1ME8A 5FL1A 4HU4A 1T41A 3ARYA 1BXNA 2QCEA 3VGDA 3MHFA 1Q85A 4QITA 5DMLA 1F4AA 3EB3A 3RK8A 1F8IA 1K3UA 1RCOB 1R3TA 2YCEA 3C2RA 1RP8A 5CC5A 1TCDA 2GOKA 4FF5A 3LRKA 1OADA 2D2JA 2G4JA 2OELA 1JGMA 2V5DA 3BMVA 3WD3A 5D8ZA 3RM9A 5M5DA 4DJDD 3AROA 3WLOA 4IIDA 3AO0A 2XU2A 1UA7A 4Z0JA 3RUBL 1E6RA 4N9BA 4GNKB 1ME9A 1EGZA 3PZQA 1WAUA 5AC7A 4XZMX 5TF0A 3FKKA 2DSUA 5FJPA 4LC8A 2ISVA 4CCDA 3CMJA 4GPNA 3TR2A 1ENUA 3VKBA 3VKCA 1X1NA 3T1GA 2R1KA 2Y62A 2VUNA 3W7LA 5J8LA 3OP2A 3PBUA 1FFQA 4J3ZA 3PULA 4O10A 5FJJA 3IV3A 1OHLA 5JBEA 5EBAA 4O54A 4AYGA 3QMSA 1R7OA 4S39A 5AHNA 2ZX8A 3AHYA 1XRVA 3KOFA 3S46A 3HPFA 2V2DA 4LS1A 3CNYA 4R3UA 4UQEA 3VE7A 1TV8A 4MY1A 2PZNA 5AN7A 3FJLA 3B0PA 2GJNA 1IZKA 4KWOA 2WLYA 2G3JA 3GSMA 4IPLA 1TO3A 4IQLA 1DJGA 4XVEA 4PMXA 5HK4A 4TX6A 1YE4A 3LPGA 2AAMA 1H0GA 1Y0EA 2CITA 1OT1A 3EZ4A 3QKEA 1NQ6A 1JRBA 3VNMA 5F2MA 3NIYA 4DELA 4QRNA 4OIFA 4D6IA 2OGJA 2H8XA 4B5WA 2ACSA 3IWPA 3R43A 2CZEA 5T9BG 1CGUA 1XGEA 1K6WA 1OYBA 1J6PA 3A3HA 4MJ4A 1MQQA 1EDTA 3B8SA 4Q4SA 3FK4A 2ZTKA 3A6OA 5FESA 3CJPA 3UZ5A 4EF8A 1LRNA 3IUDA 4LYKA 3HPAA 5FIPA 3TH6A 2CKSA 3IGXA 4GXPA 1XBVA 2BY0A 1EJRC 2O7QA 2ZA3A 2HSAA 3O05A 3AXKA 1F07A 3OA3A 3QV8A 3RCMA 1XR2A 4LAOA 5CXPA 1PDZA 6REQA 4UIOA 3W72A 4PSRA 1W8GA 5H1WA 4H01A 5HINA 3TQ0A 3IGSA 3QQWA 2YDQA 3SY5A 1EYEA 1PTAA 5ENLA 2BXZA 3ABOA 4B2DD 4ZFMA 4CD8A 1OABA 1K9EA 3VNZA 4DNHA 4JTHA 3SEPA 3RM4A 3KVMA 2HNEA 3VCCA 3TYZA 1W1VA 3I6RA 2IW0A 3PN8A 4WXYA 5J5RA 2YA0A 4OV9A 4I8DA 2Q3RA 2XFFA 3RJYA 3H24A 2OB3A 2WCAA 2GVYA 1XIHA 4L9YA 2PPGA 4UTUA 3UP8A 1T40A 1IQ8A 2BHUA 1CXEA 5I5RA 2OEKA 4TV6A 1L2QA 1NP2A 1RBLA 3W7KA 4JDBA 5AHLA 2V9DA 3E74A 3NVDA 4WK9A 1F5ZA 1MI3A 2Q09A 1DWJM 3DX5A 1ZCOA 1CLKA 3H26A 2BOEX 4FNPA 5AECA 1OC6A 3M0LA 1S46A 4D6FA 5FL0A 2HS8A 4GCAA 1GVQA 1W1YA 1X6NA 3EKLA 3S4TA 4MOZA 4QJ4B 2ZRXA 3CWNA 4GOAA 4Q8QA 1XIGA 1UWUA 1O60A 4JHZA 4XSMA 3KRZA 1RAKA 1UQZA 4JNYA 4LCQA 4E4FA 1A49A 1D2KA 3I68A 5HMEA 4J3UA 5PTDA 3CEPA 3V18A 4K7YA 1JZ3A 3VOJA 3ZJKA 3Q58A 5ABTA 3A23A 3GTHA 4GUJA 5IDIA 4TO8A 1C9DA 1PWMA 1S5TA 4JTJA 2D24A 4U3CA 2VRJA 4GNVA 1UG6A 4YYFA 3F4VA 3AJ7A 5K4ZA 1EHAA 1US3A 5AHMA 1CXFA 3CZEA 4BY3A 1P0BA 3W76A 3WH6A 1L9WA 3B8IA 3BG9A 3DAQA 3IVUA 1BFNA 3USBA 1F3EA 3D3AA 5DCEA 1V8EA 1K8CA 1EP1A 4G8TA 4N42A 4IJBA 2F7FA 3DHDA 2RAGA 2DZSA 2W66A 1KFLA 2DU2A 2P8CA 1UD3A 1K6AA 3A4AA 1FWGC 3HQ1A 4ZQCA 5K9XA 1C92A 4H8NA 4HT3A 6ALDA 3HG2A 4XTDA 3ICJA 3XINA 2ZOXA 1H7OA 4GISA 1QCWA 4KQNA 2CLFA 4BEUA 3HU7A 3NNTA 3WELA 4ZA0A 3U8GA 5AB3A 3LK6A 1B2YA 2QCGA 3FEQA 2HXTA 3WK2A 2P0OA 3CTTA 3KBNA 1RA5A 5A8NA 1XSKA 4JEQA 1IZCA 1OG6A 3CAWA 1S2TA 5AOUA 5A1AA 2CETA 2Z1SA 3BGGA 2RDWA 1WKDA 2A21A 3FYOA 3MC5A 4TV5A 3RAOA 4FIQA 1QK2A 3W9ZA 1ALDA 1E56A 3CQJA 1QMLA 3S2LA 2GZXA 4LJ3A 2PRLA 3F4CA 4JIEA 1RJRA 4GABA 1MQRA 4BKNA 2XZ7A 5F4XA 3LCGA 4R33A 2HEJA 1D3GA 2TPSA 4Z2JA 2J6VA 3UCCA 4F0RA 1W37A 2BVWA 3DBPA 5CSRA 4S3JA 4DAFA 2FZ8A 1XGZA 1MXGA 1SU5A 3N2TA 1NOFA 3BW4A 4K1WA 3B0VC 4RE4A 1P48A 1QASA 2E6FA 3QC0A 2IMRA 1JF5A 2CZ5A 5G1TA 3ATZA 5BZAA 4B4HA 3B8TA 4XG1A 3W25A 3LSCA 1UH4A 4TVCA 2WVTA 1J0YA 1V3MA 1UWIA 4S3CA 2UY2A 1P1MA 4AD0A 1CZ1A 1PL9A 4X60A 3A4XA 4M0XA 3LGEA 4F4RA 5ECUA 3H7UA 2QCHA 3TLQA 2GQ3A 4KKXA 2PD5A 4LAUA 3NEHA 3UWQA 1VEMA 4A2RA 4C6PA 5D2YA 4UZUA 5AYYA 1Q3NA 1IXQA 1F9CA 4HSHA 3CT7A 1GPWA 1KFWA 1YXYA 1GTEA 5HUOA 2FDSA 5DXYA 1H1YA 1L0PA 3FY1A 2XIMA 4H9MA 1XFCA 2DVTA 4C6EA 1SYTA 2D73A 4Q8PA 3C3NA 3NTYA 3NPUA 2PDBA 3DUGA 4KIRA 2DEPA 4JQ2A 2ZX9A 2CWXA 2XN0A 2Y7FA 5KETA 3ZJ8A 4F3HA 3W7GA 2AQVA 1NEYA 2XSAA 4XD5A 2Y8KA 3A64A 3LENA 3QM3A 2X7VA 2PWFA 4PTXA 1M3UA 1M1BA 4US6A 2BBFA 3LXCA 1AODA 4KERA 5KZDA 5FF0A 1AJ2A 3NL3A 1OT2A 3CM4A 4I8YA 2WWDA 3W83A 2VO5A 3S47A 3TW6A 1DXIA 3MI2A 3LN3A 3FX4A 3W02A 1XYAA 3QR3A 4DQWA 4P8UA 3APTA 5AY7A 3W0KA 2OVLA 3DHPA 3KL0A 3W1QA 3ZOAA 1JQVA 3E3HA 5IM51 4LV9A 1EDQA 3PP7A 3AJXA 4ZZ9A 2I56A 1R38A 1K8ZA 4WHBA 1IE7C 5GJPA 1JIBA 2CHNA 1AVAA 1JUBA 4NI3A 2CKRA 2YCJA 2KX9A 3OIHA 2PS2A 1I2RA 3N19B 1JEZA 4HIBA 4PB5A 3LV5A 1TVPA 3MVTA 4DPPA 1HFBA 4ACYA 4S3GA 3HA1A 3MCNA 3P7YA 3L66A 2DSZA 3LCHA 3EOOA 3B4UA 1G4TA 2VTFA 3TCEA 3M5ZA 4NASA 3WQWA 2PDWA 4AYSA 4EP8C 1V08A 1HKIA 5EKYA 4KF1A 1VEOA 4NL1A 4DBUA 5BXPA 4A8NA 1EXPA 3WQ4A 1KW1A 3MYPA 1A0CA 4EACA 4TUFA 4NG3A 2QYGA 3EEZA 2PP1A 4GKTA 1PZ0A 3LEPA 5FAGA 1FWIC 2OJPA 4XZIA 1EFZA 4QLLA 3L21A 2UY4A 1EGVA 4D9PA 5CJMA 3MUAA 1OG0A 1UMLA 3HN3A 4MLJA 4ZOAA 3NO5A 4IMAA 2DGAA 3E5BA 2G3MA 1J0IA 3HGOA 1UUQA 3R8RA 2Q01A 1TWDA 1HN1A 3MP5A 2BVDA 2ZDSA 2DSWA 4HHLA 4Q7BA 3S9ZA 5A2BA 2OT0A 4G2DA 2CBVA 2G3NA 1XUZA 4LY8A 1UMYA 3QR0A 4H2HA 3S9YA 3OGSA 4OT7A 4R5EA 3LX9A 5E0KA 5A6BA 1ITXA 1EJWC 4MZYA 5K3VA 4UQBA 4LVDA 2OTDA 3W6YA 5T8GA 1GW9A 3VGGA 5F4WA 2CPUA 1W2PA 3SBFA 1KV8A 4UFJA 4UTKA 2J7HA 2JKAA 3MJYA 2V82A 3K2GA 4H6KA 4JFTA 3SSZA 1UQYA 1T8QA 2RHGA 3QF0A 3QOMA 5EBUA 2HROA 1I0BA 2DVUA 4LPCA 2A7PA 3VO0A 1FWNA 1NSJA 2G37A 5C9XA 4LAMA 3KVLA 2R94A 2PGFA 1TVNA 4WY0A 4WUIA 4C60A 2DT2A 3AWOA 3KLLA 1BD0A 4KRTA 2KZHA 1W3JA 4EXQA 2WO5A 3SM0A 2CHRA 3BURA 1R0MA 4JL2A 2X1SA 3UR5A 4NUWA 4WY0B 5LNRA 3T07A 4MDPA 2VR4A 2FGLA 2VOMA 4WLCA 4DJEA 1C91A 1CXHA 3MHUA 1H63A 3WG6A 3KDNA 4TIMA 3S8HA 4RJEA 1SW0A 4X61A 1OCJA 4NAFB 1OK6A 3A9BA 3W86A 2E25A 5I23A 2WB5A 4IIBA 4JY8A 4L1XA 2HNHA 3GVVA 3T08A 4O53A 3QY7A 4X2RA 3ZYZA 2UBPC 1PZ3A 1DJWA 4UTFA 5AC5A 1EH9A 5C7VA 4NJHA 1F3XA 3CL6A 3KTSA 4JN6A 4UTWA 3OZPA 4YL2A 4DXKA 2E1WA 3BAXA 4CNNA 2QCFA 1ISZA 4WDUA 4O1FA 4ZTYA 4AHOA 4FX6M 3U4FA 4C7GA 1B3XA 1TIMA 1H61A 4JD4A 3ONCA 2OWCA 3CASA 3WBAA 2D2OA 2JKEA 3PZVA 4PFHA 3TTOA 1UKPA 2FHFA 3LGGA 2BLEA 4Q8WA 4QNEA 2RGLA 4K38A 3KBSA 1XYFA 4M6PA 5JH1A 2V0TA 2PU0A 2BXVA 1VP5A 1UD6A 2XG9A 2QJJA 2BG5A 4K36A 2QJHA 5HWMA 3P62A 3W7NA 2P3EA 3MA8A 4DM2A 3P14A 2C79A 4LEQA 1IZJA 1K7FA 5D2TA 3AOFA 2QS8A 3CZLA 3B0UX 4H6QA 1VB9A 5C55A 1NJJA 1QBAA 5E9XA 4MYXA 1RJQA 4BWLC 1F7BA 1NFBA 4DO7A 2RDXA 1OFQA 1L8NA 3DC8A 4L1WA 1W31A 4Y9PA 4D6DA 3SCOA 1ISXA 3TNOA 3M0IA 4IH3A 3TAKA 1LG1A 3RFAA 5GJMA 3EGJA 4E3TA 4JTIA 1DQXA 2ZZ4A 4J40A 3IIXA 5DBTA 5AZ0A 5I3HA 4AX7A 4NT0A 1QW8A 2FZMA 4HMDA 1DHPA 4DZAA 3UQNA 4S2BA 1W1ZA 1H50A 4BEQA 1BYBA 1OZQA 1OEPA 2XGZA 1DORA 3H8AA 4HA1A 2CHOA 4NNCA 3WF1A 4UB9A 1G4PA 3PPGA 3CQIA 3W2LA 1OF6A 5CJ5A 1WKFA 2QJGA 4G7EB 5CZJA 1L6FA 1LOQA 3WDHA 4GZJA 3SCSA 4HJFA 1V5XA 5CQ1A 4JS3A 4HPHA 4OBRA 2WZMA 3CQHA 2Y85A 4NRRA 3UJFA 2OSWA 1GOMA 1NP0A 1FP8A 2ZXQA 2B4GA 4PB3A 2CNCA 2GJRA 3U9IA 2Y6ZA 1RSCA 1EQCA 3SJNA 3MV11 2OXNA 1DIOA 4LALA 4XO7A 4RDVA 1UR0A 3STPA 3VMOA 3LQLA 2QVHA 4HNLA 1G7UA 2HRWA 3EDEA 3R1ZA 1U5VA 4MNMA 2J78A 4BCEA 2XH4A 3M1ZA 3O2LA 1VENA 5L6UA 5HNRA 1YRRA 1AL8A 1DQWA 3G1AA 3W71A 4PRWA 1FX6A 1W91A 3G5EA 1GTHA 4LVGA 4RL3A 1B30A 1R3QA 4LBRA 4PFMA 3FA5A 1UR8A 2BHZA 3L2MA 5EMJA 2PLMA 3UR8A 3T40A 3SI9A 5C9UA 5LXXA 4Y9MA 3JUGA 3L4WA 5J5DA 4O1CA 1CPUA 5EMUA 1QI4A 2PU1A 1N8WA 1OX4A 4A3YA 4QJ1A 1Z41A 3GAYA 1SFSA 4N9EA 1CLVA 3B06A 2EAWA 4ZOBA 2WJEA 5I07A 3M43A 3ENLA 3TW7A 4LFYA 1DEDA 1XM3A 1ESWA 2CZFA 5BMXA 1UPPA 4IF2A 2QGYA 4IPJA 5REQA 3DG6A 4CD6A 3TYUA 2Y5EA 4GVFA 4DWSD 4R7JA 1SO3A 1J12A 4H8HA 5I3JA 3B0XA 4JZ5A 2O56A 4XAYA 4WDWA 4AEFA 1MEHA 2X7WA 4DPQA 3QV9A 3PWIA 5REQB 3VMPA 2AKZA 3I3BA 1F6KA 4JGDA 1VAHA 2NLIA 3WDPP 1D7KA 3KS5A 1Q7ZA 3SN4A 1FTXA 3WF2A 4S3FA 3QW3A 4B92A 4H8VA 2GQAA 3V0UA 1YMYA 2W5FA 3KBWA 4LVFA 4HSOA 3STCA 1SFTA 3TWBA 4GY0A 1UZHA 1JCMP 3NYZA 3BANA 3T05A 1NWRA 1HJVA 4OJYA 1KQZA 2R1PA 3PB0A 3IJQA 3TV8A 3S5SA 3TWAA 1NOWA 3KOZA 4XAFA 3FIGA 1OD8A 2VGBA 3EA3A 2NSOA 3IIOA 4HMCA 3MP4A 3E2VA 3NVTA 4QSFA 4W8BA 3W1PA 3WENA 3U4AA 3N15A 4O0QA 1BWVA 4TX9A 4DN1A 1N8IA 4YTUA 1FWSA 4UC5A 4CD5A 1A5SA 5D30A 3M0YA 1AJZA 4DNMA 1T99A 2E0PA 1QATA 1KD0A 1ECQA 1SR0A 1Q4WA 1PIGA 3NQ6A 5CZKA 5CGQA 1AZ2A 3AS0A 1KLZA 2UY3A 3B04A 1AMYA 2ZKMX 4F0HA 5TIMA 3WLMA 4F2BA 2AAAA 1ZQ5A 4MZ8A 1HL8A 4WVXA 3VINA 1LROA 3UG4A 2CBJA 3BAKA 3BUVA 3WQ8A 1M04A 1L2UA 3GG1A 2B7NA 1GONA 2QDHA 1LT8A 4I7WA 3DC0A 2C8NA 2CZVA 2RJGA 1HO1A 1VF8A 2VL4A 3G0SA 1K8YA 1B90A 1V6YA 3QPZA 4WR3A 3WK1A 2VKZG 3GM8A 1K7EA 2E6DA 2QV5A 3EB4A 1ZBVA 4J9JA 5MF5A 3ZR6A 4UNKA 1QTWA 4OE7A 2FPYA 1WDPA 3GC5A 4G6CA 4DBSA 5LXEA 4IT1A 1XIBA 3LRMA 1TZZA 1GVFA 2PP0A 1A5KC 1PSCA 1R6WA 2PRHA 1R3WA 4EE9A 1X8CA 1GJPA 5TAOA 3KX6A 4AD3A 3CUGA 1WNOA 4E4PA 3GWQA 1FFRA 5ABHA 3LBCA 2J7DA 2C7FA 3KS6A 2DFAA 1SQ7A 3R10A 3L67A 4JIRA 4B9ZA 1DOSA 4GVGA 4Z1AA 4WRHA 5A95A 3TFCA 3WNNA 4DJDC 1BLIA 3H2EA 3ITXA 3IUHA 1V6UA 1JPIA 2F9RA 4DVOA 2WXDM 5E93A 1XYZA 1E0TA 1T0OA 1MRQA 2EGZA 4UMCA 1GCYA 4MPKA 4M82A 3S1UA 1VD6A 2YGYA 4C6OA 3QTPA 1XLMA 1PS9A 3OLIA 5JU6A 3UR7A 3TTEA 4FI4A 3WLKX 3BVJA 2HPIA 2GOUA 4UFMA 5FEWA 2GUBA 2PRMA 5H8PA 2GSHA 3JVAA 3SCPA 3NCOA 2Y88A 4W89A 1ONXA 2GUUA 4MAVA 5I24A 3W7IA 1VR6A 4W5ZA 3U5YA 1HF6A 3SW6A 3TN5A 3EDFA 3BOFA 4UQ9A 5CBJA 4O1DA 4XX6A 3WQEA 3LA4A 3GKAA 1W9PA 4LWWA 2HVMA 2R82A 2QJMA 2VYOA 1EEPA 4RR4A 3TOYA 4MUZA 4R27A 3DFPA 3URAA 3PWAA 2EPMX 4JHMA 3QZAA 1OZMA 2A6NA 3UY7A 3MZ2A 4E2BA 4HQVA 3T78A 3CH9A 4CEXC 1XD0A 3C6CA 3NPWA 1TE6A 3M0VA 3GIYA 5DRCA 4EWJA 3Q37A 5BWFA 1LF1A 1B3VA 2C71A 3RPMA 5HAOA 5HPOA 1JNEA 1VYSX 2JKPA 3BW2A 1EOMA 4FNSA 3W73A 2PTZA 1XKJA 3DERA 3CYVA 3TU9A 3A4WA 2FHBA 1OBAA 5GVJA 3KUMA 4YPJA 2VVSA 2J77A 3PHAA 4GI4A 1V3KA 2V3EA 3W7RA 3I4KA 4AAJA 4U10A 1Q63A 1W56A 2VCBA 2WW5A 4E8GA 4A35A 2ZA2A 1J0KA 3OHIA 5I06A 2O0TA 3FW6A 5A3HA 3H6OA 3VCRA 3SAZA 1P6BA 4AF0B 4YVXA 3UZWA 5HQLA 4AY1A 2VX5A 1SMDA 1HO4A 4NJGA 2IPGA 4JPGA 2PDLA 3TSBA 4QBXA 3UJ2A 3A5VA 4PUJA 3QTGA 1FWHC 1YPIA 3QQ0A 2J8GA 3RYSA 3FAWA 1GVYA 3C0LA 2OCZA 1SVDA 1BEUA 1S3HA 3N2XA 3CLMA 4AZ7A 1RLCL 4QG9A 3LZ5A 3VABA 4ZO7A 2ZVRA 3EKGA 1REQA 2OYKA 1KBJA 5B7YA 3N2OA 2DZUA 2E5BA 3SQLA 1VBHA 1XF0A 1E5JA 4RLIA 1LLOA 4JN8A 1NFGA 1QRQA 2NUWA 2WHKA 3W7PA 4Q8UA 1I75A 1REQB 3TR9A 2JALA 1BQCA 1JDDA 4NJJA 4I90A 5F2GA 2XWEA 1JD9A 3L12A 4QAIA 3UG5A 4DX3A 1IEWA 1JL8A 4MB3A 1A5MC 2ZUWA 3QGKC 3CK5A 2VFFA 3WQ5A 4ZCWA 1TKKA 3DG7A 3GTFA 3WF0A 1WAWA 4GYKA 1QHOA 3EDJA 1PYFA 1RK6A 1CB7B 4GWEA 3V5OA 2ACRA 4AUBA 4CQBA 3ZR4A 3K4AA 4TVDA 1DIDA 3TYEA 3D0CA 2GWGA 3HGJA 4DXXA 3ZT7A 1OQFA 3QSRA 3NQ2A 4AIEA 3NPVA 1Y8BA 2TYSA 4LANA 1WDWA 3RX2A 3VDBA 3N18A 3NZ1A 4BS0A 1LQAA 1KB3A 1XYBA 3MKCA 3CS2A 5D9NA 3M0ZA 3MU7A 2Q3OA 6TAAA 1H1ZA 1LUCA 3M07A 4JXCA 2I5GA 1YBQB 2WBKA 3PJWA 1JR1A 1XLLA 3M7WA 3T09A 2EPLX 1PIIA 2D3NA 4JHOA 3KTCA 2DSVA 1EC9A 1XBYA 2ZE3A 5DXXA 4YLWA 3EWXA 2CLLA 3ALGA 1LUCB 3WQOA 1E3XA 2P53A 1XIIA 1KFEA 1ZAHA 2ZZ5A 1WDDA 4ZQMA 4F0KA 1HJXA 3G8EA 3UPBA 1QU4A 3APYA 4C5YA 3BSMA 4G56A 4ACZB 1ZZMA 3QRHA 1UR1A 3OOQA 3P82A 1M6JA 2FMOA 4RDWA 1XL9A 4J3SA 4PUKA 6CGTA 1ZJAA 1TREA 2QR6A 3TE9A 4HPXA 5EU9A 3DYPA 5G4EA 2PP3A 3GU2A 3QV7A 4ZENA 1Z9AA 3NURA 4UQAA 5BROA 4QE4A 1J6OA 3ARPA 1GQNA 4ZXLA 1M41A 4EX4A 1DJHA 2VZTA 5CPSA 4E5TA 3W2UA 1M9HA 1PX8A 1ZCCA 1EGMA 3G77A 2I5QA 2ALDA 3T8QA 4GXWA 2QUVA 1RCQA 2GVJA 3UWYA 3ZLGA 1PWLA 4O14A 2YXXA 1MUWA 2P88A 3PNUA 3HPSA 3UETA 2ZC1A 3CB8A 4A3HA 1JAKA 1XLJA 1DKWA 4IMCA 1I8JA 1MUCA 1R7AA 4QDMA 1F76A 4LUIA 3BDKA 1SO5A 3GE7A 4LT9A 2WWCA 3TAOA 3PBYA 1W3IA 1DJYA 3HO8A 3CIWA 3WFZA 3ZT6A 3WBYA 3VIIA 1QOXA 1UP2A 4B16A 2C6QA 1YKWA 1XWYA 4ZO9A 2P76A 3HJZA 3LNMA 4FNUA 3N9RA 3AUJA 3WH7A 1JXKA 1V02E 2VWTA 3N1AA 3IJLA 2VZSA 1EO7A 1FCVA 3GO2A 2XPKA 4DYKA 2YSWA 3GX9A 3M0HA 3W2KA 4XO6A 3II1A 2PUZA 2Y4SA 3V0TA 3RO8A 2W27A 4K7VA 1X7IA 3KWSA 1H09A 1W5QA 3NSMA 4INFA 1T8XA 2QUUA 4MG4A 5JIPA 4B4FA 5D2WA 3GBDA 3KLKA 1BKSA 4ZE5A 4HN4A 5CZTA 2QCDB 4R53A 2PDXA 5CPTA 1E1EA 3LHVA 2QF8A 1UWRA 4OOUA 4F9JA 1WBHA 1S5VA 2OSXA 1TPB1 1QPKA 1NDYA 4YIWA 4R7OA 1BTMA 4BQ4A 3GQYA 3M6YA 4QLJA 3FN9A 4URIA 4I7UA 2E6AA 3OVGA 1JJKA 4IOTA 4AD4A 3N4AA 3S1XA 3MKKA 1W9DM 4KFNA 4Y8EA 4FALA 4QE5A 4H9XA 4U28A 1A5CA 5I7GA 4GHRA 1QNOA 1U2YA 1R3YA 1Y7VA 4AQLA 4D8AA 1Q6FA 2XGBA 4H3DA 3IVSA 3ABQA 2ZUUA 2WPBA 3ABXA 1C8QA 1JVNA 2ZX5A 1DBTA 1GJUA 4NILA 4ZGYA 3TYCA 4IPNB 3DESA 2FH8A 4QHRA 1I4NA 1KRMA 1JUKA 1Y5WA 1K1DA 1GG0A 4WIWA 2IXVA 1YYAA 4F2TA 2QCNA 4FO4A 2JEPA 4GJ1A 3WX7A 2BOFX 3W84A 4DAIA 2C18A 5EMYA 2ESCA 2GDUA 5G4HC 2AKMA 3W1MA 4AZCB 2RGMA 1XLCA 7ODCA 3W82A 1GOOA 3SIMA 3QZEA 1MVYA 3W7OA 3R11A 4L56A 3FYYA 1ZJHA 2DT1A 4FOJA 4GXMA 5H91A 4JX6A 1K77A 4ZB5A 1GZJA 5DELA 1UR9A 3TXZA 1VIZA 3RILA 2WMGA 4GH3A 4YJ5A 1QHPA 5C2CA 3J7HA 3PAJA 2O9RA 4N7QA 1WZMA 4IFRA 3AHXA 1UIOA 1XLEA 1UOKA 2Z1KA 3KOYA 3H23A 2VX6A 4JQ3A 4M81A 3NOEA 4BI6A 1XGDA 1E1CA 2WAGA 1J0HA 4S1FA 2HVOA 2D2HA 4RZBA 3T0DA 3IRSA 1XD1A 3WIJA 1VC4A 1OC7A 1M03A 3F5LA 5CBIA 1B5TA 1GVSA 3GDRA 1W9VA 2H3BA 2POZA 3OQEA 4P7NA 2ZXDA 3K8LA 1R9XA 1AG1O 2XDFA 3UY8A 1QT1A 2QIWA 1JCNA 5LIYX 4R9OA 4GYFA 3QGAC 1XIJA 2RUSA 1Z44A 1XH2A 2FZDA 3CMGA 1WZLA 1Q6GA 3B8UA 2PLJA 4XKYA 1TPUA 2ONEA 1X38A 1KRBC 4IQJA 1AH0A 2YFNA 3F4DA 3NQCA 3ISIX 6XIMA 1VBRA 1D7FA 4MNJA 4BZYA 4LY4A 5JBDA 4MY9A 2FLIA 1BXCA 1HNYA 1W9UA 5FJUA 3UBPC 2ADAA 3VNKA 4XKYB 3C2OA 3UXAA 5HPCA 1EZWA 2WMIA 1MYRA 1A53A 2Y7GA 1C8XA 3BZJA 3H70A 1MNZA 3H7VA 3SRHA 1YE6A 5CC6A 3EWZA 5H8MA 1LZOA 3RJXA 3O15A 1D3CA 2EPOA 2WMIB 4UTLA 4OUIA 3RM8A 2EKGA 1VBJA 2OLAA 1RVKA 4IG2B 1JFHA 3U0HA 5IXEA 2C16A 2EJAA 4JFVA 1H5VA 4YTSA 3MI3A 4UFLA 4UMBA 2NT0A 5LNUA 4U5IA 1O1HA 3EKZA 3BICA 3POHA 1MFUA 2P10A 1VFTA 4GC4A 3BV4A 1J18A 2BY3A 3WJSA 2DV0A 2Z25A 4LX4A 1RALA 5C9ZA 1V79A 3P8IA 2O55A 1W3LA 5EFFA 3VFCA 1B4EA 1FHDA 2XVPA 3U2OA 4NQ1A 2ZZ2A 4IPPA 4ECLA 3QBUA 2ISFA 3TQKA 4XD3A 3LTSA 3BAWA 1ZP3A 4U31A 1CGTA 1B1YA 1ML1A 4L9ZA 1OIMA 3TTYA 2FPVA 2CLEA 3AXXA 4TTGA 3TCSA 4LXFA 2NUYA 3WLJA 3RLGA 8A3HA 3FA4A 3W7MA 1RD5A 1VFOA 3CZGA 3OYXA 1F6PA 3LI0A 1S2VA 1O5XA 5G2IA 2DSKA 4FS9A 2WCGA 3O06A 4DUOA 2DIKA 3RMEA 4LYQA 5HR6A 4Z2LA 4H00A 1KWGA 1V0MA 2HS6A 2GGEA 3GLCA 2QCLA 1U1JA 4PMOA 1CT5A 3GU1A 1TQJA 2CBIA 4Q6XA 3NFUA 1HIZA 2XYLA 3EXTA 1W1IE 2WSKA 2WKGA 4BF9A 2V69A 3EWUA 1YDVA 4UOJA 1CGYA 3LCFA 5HULA 3ABSA 4GY7A 4DBWA 3V1HA 1JQXA 3ZR5A 4A2SA 1BVWA 4H7ZA 2FZBA 4NVTA 2G3IA 4Z17A 2V2HA 4XBKA 1EJUC 5DO8A 1A3XA 3R13A 3H4GA 2PE4A 3MSRA 3BCJA 4D6GA 3AQUA 3LPFA 4CQAA 1EX5A 1IT8A 4AU0A 1TX2A 3LOTA 1CGXA 1EP2A