1HF6A

Endoglucanase cel5a from bacillus agaradhaerens in the orthorhombic crystal form in complex with cellotriose
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct Experimental Observation of the Hydrogen-Bonding Network of a Glycosidase Along its Reaction Coordinate Revealed by Atomic Resolution Analyses of Endoglucanase Cel5A
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE B
total genus 119
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hf6A00
2X1IA 3WEOA 1UH4A 4PUEA 1E3ZA 3GYCA 4MJ4A 4ML4A 2NT1A 2PF0A 1MFUA 4EE9A 6CGTA 4HTYA 3TTOA 3W4RA 2X8RA 1CGWA 1CTNA 3LMYA 3WDPP 1MW2A 3N9KA 3WEMA 1OB0A 2WANA 3ARVA 3BLKA 1OSEA 4B15A 4TXEA 4CCDA 1J11A 2PB1A 1BF2A 5A2CA 1LL6A 1W9BM 2WMFA 3MSDA 3GH7A 2ZUVA 2YOCA 3N1AA 1E0VA 1QI2A 1NWSA 4MAVA 3W0KA 3WDIA 2XHYA 1JZ4A 4WSJA 3RJXA 2DSVA 1OT1A 4F9DA 1KBKA 2VNCA 3AS0A 4HZ7A 2CYGA 2V5DA 3VDAA 3GXMA 4UFMA 3OA5A 4GI6A 3ZJ6A 4WLCA 4K68A 3GNRA 4MAZA 2YIHA 4CUCA 1JL8A 4PEEA 5A6BA 2XGBA 5D9NA 4KGJA 3BAJA 1XC6A 1E5JA 3OGVA 1PJ9A 4FLRA 2D23A 2BVDA 1CYGA 3BAIA 1CXEA 2OWWA 3WF3A 3EYPA 4JL1A 2RGMA 3TONA 1K6AA 1VJSA 3F4VA 2ZUTA 3WDJA 2J47A 2DIEA 3VMPA 4PMVA 4N0RA 1F4HA 5A8MA 2G3MA 2DH3A 3F5JA 5CLTA 5JUVA 2WSPA 2DEPA 3GXDA 3TP4A 4UQCA 4UFHA 3VIMA 3WH5A 2WVUA 4LYRA 1GVIA 3NCOA 1JDAA 2DSUA 1X6NA 1UD6A 1U2YA 4DM2A 1TVPA 3HU7A 4GKLA 1BFNA 1WZLA 3KZSA 2FHCA 1BYAA 5A1AA 3VGHA 2XFFA 4HU8A 2W67A 4W93A 2VI0A 3ZQ9A 1W2VA 3WQ4A 3RO8A 4UOQA 3POCA 4PMDA 4GO9A 4PRWA 3W25A 5CPSA 1CGVA 1ZJAA 4RE2A 3E1F1 2O92A 4NSBA 1PPIA 4MNLA 3AS2A 3WNKA 3NJ3A 2XG9A 2ZUMA 3OBAA 2GJXA 2ZUNA 4UQBA 2A3CA 3N18A 3D5HA 2YL6A 1GNXA 2DT1A 3ZR6A 4KRTA 3BXWA 4DM1A 4UFKA 4CN1A 1JI1A 4HZ6A 3VINA 1HJUA 2YL5A 3BH4A 1V6XA 4H2CA 2BY3A 3K8KA 2VZTA 1NOWA 3CZJA 3OLGA 1JXJA 3M07A 1V3LA 4MDOA 1WO2A 1WCGA 2XTKA 1Q6DA 2QPSA 4M81A 1DEDA 4M56A 1KXQA 3VO0A 1E6QM 4A3HA 1IZKA 4OKDA 3N12A 4TTUA 4DWSD 1UA7A 4UZSA 3VGBA 5I78A 3EBVA 1EGZA 2JF7A 1NWRA 5A3HA 3EDFA 1JZ3A 4AISA 3VMNA 3APGA 2Y24A 4Y7EA 1VFOA 2J62A 1BYCA 1RP8A 3KL3A 4WIWA 4LYQA 2FDMA 1GZJA 4PTMA 3T0AA 3WD2A 4D72A 2OYMA 3CHCA 3WF0A 2J75A 1F4AA 1JZ5A 3VIHA 1H0GA 2CNCA 3VGGA 1E9LA 3AHZA 1ODZA 1UA3A 4PCSA 4S3JA 4AZ6A 4Q22A 2QLYA 1G5AA 1MFVA 1V02A 3WD4A 3PZIA 1E6XM 1KXVA 1H41A 3FHAA 2YJQA 3MUAA 1L8NA 3O2LA 1QI3A 5I79A 1CGTA 1VENA 4HZ8A 5GNZA 3AMCA 3WY1A 3VUPA 1OCQA 4F79A 3O6AA 4QCFA 9CGTA 1UQYA 2NT0A 4V28A 1DTUA 2D24A 1HF6A 2QPUA 3RCNA 4H41A 1UWTA 4ZEPA 2D1ZA 5EFFA 1FH9A 2GVYA 1GOQA 4TX8A 3FXYA 4AZIA 3M46A 2VR5A 3WDQA 1V3HA 2ZX8A 7CGTA 3AIBA 3OLDA 3PN8A 1E55A 5A6KA 1C7TA 3ZT5A 3VM7A 1E71M 4AD2A 3VGEA 5IFTA 1GQIA 1CWYA 4RE3A 4CGTA 1DWFM 3RM8A 5CGTA 2E4TA 2WHLA 1E4MM 4MB1A 2Y8VA 3QR3A 3OZPA 2CKSA 3CUIA 2GK1A 4CU6A 3CPUA 1KB3A 1QHOA 3WL1A 4NF7A 4OIFA 1SFSA 4CN4A 1JD9A 1HL8A 2DIJA 1JZ7A 2BY2A 3SCWA 2XM1A 1XSJA 5KZ6A 4CVUA 1W1VA 2WPGA 1US2A 2WM0A 3TA9A 4D6FA 5M3WA 4AMCA 4Z2HA 2VT0A 1HJXA 2WHKA 1J9YA 4OZOA 5C71A 3B9DA 3NIYA 1A3HA 1HJVA 1E70M 4MNMA 1GUVA 3ZR5A 1MQPA 1L0PA 4W8LA 3WBAA 2WHJA 1SR0A 2QF8A 1C3FA 3K1DA 4P7RA 1BHGA 2JIWA 1E6SM 5CPQA 2WVSA 3SCSA 3W26A 4FLQA 2E9MA 1PIGA 2E9BA 4PTVA 2EPKX 4GI9A 3PTKA 4LYPA 2Z1KA 1NOFA 1JZ2A 1GHRA 1M53A 1UR4A 1JIBA 5A8QA 4XV0A 3U5UA 4UOZA 2BFGA 1WNOA 2ZWYA 1QOXA 3ARRA 3CGTA 1V0LA 1AQ0A 1EDQA 4XX6A 2WMIA 1ECEA 4TTGA 4S3KA 1B3VA 4AD1A 1O6IA 1KFWA 3VM5A 1ISZA 5BROA 3PTQA 5FL0A 1J0ZA 3WUBA 3ARSA 5BCAA 3ALFA 1H11A 3DC0A 3WUFA 1G0CA 1GQKA 4L4OA 3CTTA 5DT5A 1E1EA 1BSIA 1YHTA 3S2CA 3CHDA 3HMCA 3ZIZA 3OB8A 4W86A 2BHZA 3WN6A 4AD4A 1I1WA 3WMBA 1LLOA 1LJYA 3ARQA 1IZJA 1CXIA 4LGXA 3IK2A 2VX6A 4AWEA 5FKYA 5M17A 1V6VA 3RPMA 3FHQA 3QHOA 2VQTA 2IXUA 3WELA 5ABEA 4OJYA 3AIRA 1HJWA 1CNVA 4ZXOA 2C8NA 4MTVA 3PBGA 1PEZA 1DWGM 4ACZA 1UYQA 1BYBA 3WF2A 2HVMA 1CZ1A 4CCEA 4CKQA 1EQCA 3T2QA 1JDCA 5FD0A 3IJ9A 2BVYA 2JEPA 3THDA 2ZWZA 1U33A 1PX4A 1QW9A 1QW8A 4KRUA 3CUGA 4WF7A 1H0IA 3T2OA 4AZCB 2EO7A 1BVZA 1HP4A 1BG9A 2YL9A 2WMJA 4WKAA 2XPKA 3OGSA 4GZJA 4AD0A 1XV8A 2VUYA 2XVLA 2YA1A 4PMNA 5BXSA 2DGAA 4AW7A 1J18A 4GXPA 5CLWA 3HN3A 2EEXA 4PMOA 4B16A 3ARUA 1OD0A 2VTFA 5A94A 2BY0A 4UCFA 2DQXA 3AZRA 4UNIA 5I24A 1NM9A 5JIPA 1CXLA 2WB5A 2VZUA 4H7VA 3WMCA 2BHYA 1JYWA 1KBBA 4H04A 3NSNA 1Y7VA 1PZ3A 3CH9A 2WYSA 5C8BB 1Z32X 3A6OA 2WC3A 2J74A 4ZE4A 5FIPA 2WAGA 4AD5A 2DSZA 1QBAA 4PMZA 4ACZB 3MANA 2X0YA 1QVBA 3IJ7A 2ZX5A 4D6JA 2O9PA 4F66A 1KR1A 2D0HA 4AY1A 3CMJA 1WAWA 2ZXAA 1BGAA 2J79A 4AEFA 4HPHA 3BMWA 2NW0A 1J0HA 1C8XA 5A8PA 1UD5A 2ZUSA 1XGZA 1UD4A 4GO8A 4TVUA 1ZJBA 4P8VA 2W5FA 3SCVA 2D20A 1JF5A 1XCXA 1JAEA 2VVNA 3EDDA 3QOKA 1JFHA 1BVNP 4EANA 4U3AA 4PTWA 1V6WA 4HOZA 1D7FA 3ZT6A 1CGXA 2XGIA 2UY4A 1VFMA 2VRKA 2VCBA 1XHGA 3KWXA 3MMWA 2YKKA 4URIA 1SYTA 1TA3B 2VC9A 1Q6GA 1C8QA 5DEZA 3VIJA 1ISXA 1V3KA 4EAMA 2D0GA 3VILA 2AOSA 1GQLA 3NDYA 4RE4A 1MYRA 4AZ5A 3UEQA 5A8OA 4PMRA 2WZHA 1B3XA 1JDDA 4A3YA 1KCKA 3BSHA 2YA0A 2G8ZA 4PUDA 1EOMA 4QP0A 4U31A 3WD3A 1V02E 2VZSA 4ZFMA 4OOZA 4U5IA 1WZKA 1GPFA 3WFZA 1HKKA 5AC5A 4AZBA 1V0NA 2BV9A 2YDSA 3SUUA 2ZX7A 4AIOA 3NSMA 2ZUWA 2E0PA 5CPTA 2Q8XA 3WNPA 3MU7A 1O7AA 1XCWA 1MQRA 1CEOA 3UESA 2PBGA 3UCQA 5AC4A 3VNYA 3VVGA 1WB0A 1GCYA 2FHBA 4PCTA 4CU8A 4W5UA 2BXYA 5A2BA 1BPLB 5I77A 5EB8A 2VRJA 1E6ZA 3NSXA 1MQQA 3RJYA 2O9TA 4J28A 2PWEA 3SEPA 2DT0A 3PZQA 3SUVA 1ZL1A 3VX0A 4D6CA 2YDRA 5IHRA 3LPGA 4F9JA 5BRQA 2X05A 2AMGA 3UETA 3AFBA 3VTRA 1DWJM 3IANA 1UH3A 4W89A 4R27A 2YBUA 2GJRA 1NWTA 1M7XA 4V2XA 4KWUA 2VOTA 1WZMA 3ARYA 4JHOA 2XVPA 4E8CA 1EO5A 1CGUA 1FOBA 4X9YA 2PWFA 1KGXA 1W3LA 5BRPA 4OBRA 2WZIA 1H1NA 4J27A 4P7OA 3CZGA 4U2ZA 1HX0A 2VJXA 3MO4A 2J77A 3AYSA 2YA2A 4P8XA 2C7FA 1VEMA 1XH0A 5A6SA 3LPOA 5D4YA 5HXMA 1JYXA 1WP6A 2EPOA 3OLEA 1QHZA 4GINA 2D3LA 1XSIA 4BQ4A 3AHVA 2DT3A 2ZX9A 3W37A 3VIOA 2EPMX 1ZBWA 1B9ZA 1VFUA 5BXRA 3W38A 2FGLA 3M6DA 2XYLA 4AZHA 4PMQA 5E6YA 1AMYA 1B1YA 1C8YA 1CXHA 3ZJ8A 1S46A 3MMUA 2XUCA 1W1YA 4UTFA 2OWXA 1CIUA 1OGGA 1V03A 4DWSA 4JL2A 1UWQA 1WDQA 2XSBA 4FF5A 2Y2WA 2ZIDA 2VZOA 1UKTA 2GDVA 2E8YA 3W24A 1H5VA 1KCLA 3VPLA 2E8ZA 1E1FA 3I3EA 4MPKA 1B31A 4LXFA 2GJXB 4BQ3A 3AIVA 3AICA 4TVCA 2V3EA 3KL5A 5A2AA 4AZ7A 2XFYA 1XYZA 2D3NA 1W91A 1TVNA 1UQZA 1E0WA 1XRVA 3VIKA 3T08A 3N13A 5E0FA 1TE1A 3BCDA 3VX1A 1BQCA 1UKSA 3SCTA 1B2YA 2Y5EA 3K4DA 2W92A 2QV4A 1LQ0A 2Y8KA 4WKHA 2JEQA 3SUWA 3ZO9A 1KWGA 3NDZA 3AXHA 1VJZA 2PBOA 1UUQA 4DWSC 1JAKA 4JZ5A 3W6LA 5AYBA 3MKKA 1ISVA 4NRRA 1OIMA 4DUVA 4HMCA 2ZE0A 3W6MA 1VF8A 4Q7NA 4JFSA 2XSAA 3WH8A 5D9MA 2J25A 4X0VA 1WDPA 2XIBA 1FH8A 1R85A 5C70A 1E4NA 1QBBA 4GQQA 5A6LA 1MXDA 1E40A 1HXJA 2VL4A 3SCOA 2B31A 3EMQA 5DT7A 2J7BA 4U5KA 3AMLA 1KXHA 4W7UA 1J0IA 3WQ5A 3G6LA 3AISA 1VBUA 1UH2A 1CBGA 4A4AA 1UWIA 4M8UA 2Z1SA 3W27A 4HPGA 1W9UA 4P7QA 2JIEA 1TMQA 1B90A 1YQ2A 4ATWA 4C7GA 5IDIA 3W53A 3B8SA 2W66A 1UKOA 1EO7A 1FH7A 3BGAA 1C7SA 4PN2A 5D9OA 7TAAA 2V3DA 1NARA 2J7HA 3RIKA 1G01A 1Q6FA 2J4GA 4TVDA 1WKYA 2YLAA 1CXFA 1EHAA 1AQHA 4H8HA 4D6IA 5I5RA 3THCA 1FP9A 1QNPA 2ZX6A 3KE0A 3K4AA 1ZS2A 3ARTA 3WUGA 1EDTA 4HA4A 3UR8A 3L4YA 1G9HA 1QNQA 4B3KA 2PWHA 1OD8A 4CD7A 2MANA 3ARXA 4IM4A 3WNOA 3PZ9A 1DWIM 1KQZA 3SURA 4HA3A 4D6HA 1IT0A 3TTSA 3AMDA 1E15A 3J7HA 3AYRA 1G94A 1V6UA 3BMVA 2BXZA 4TUFA 1E6NA 2G41A 4J3UA 1KXTA 3EMZA 1CPUA 2J8FA 4QFUA 2WWDA 1ISWA 1CGYA 3PZNA 4JHZA 3D3AA 3U7VA 2WMGA 1ZU8A 1EXPA 1OGSA 5JBEA 1Q4NX 1ESWA 1W1TA 4JKKA 4BF7A 4AZCA 1FHLA 4AXNA 2WVVA 1HKJA 3VKKA 4W5ZA 1EHNA 4MDPA 3GDBA 5CSUA 1W3JA 1VIWA 4FLSA 2W62A 1JXKA 2FH6A 2IXVA 4J3SA 1X6LA 2WC4A 4WJXA 3CUFA 1GOMA 1W3HA 2D2OA 5D8WA 4KGLA 3WQWA 2D22A 1J0KA 1WE5A 4CD5A 1K9FA 3AQUA 5HPOA 4HA1A 5JIWA 2WKLA 4ZXLA 3EDJA 5GPRA 4F8XA 2CBUA 4JFUA 3DYPA 3OGRA 4M80A 5HBFA 4MNKA 2O9OA 1FFRA 3G6MA 3GM8A 3SCQA 1CDGA 3VDCA 2VX5A 5CZKA 5CJ5A 3EDKA 3TTYA 1XH2A 3WH7A 2WMIB 1TA3A 2WWCA 3SCPA 2F8QA 2GK1B 4J3VA 3IJ8A 4JKMA 3MUIA 2WHMA 5AYIA 3AI0A 1JYVA 1BAGA 1TUXA 3OIHA 5BXPA 4XZWA 5A8NA 3N04A 2UY2A 1FP8A 1JI2A 4QAWA 2J7DA 5IHSA 1OIFA 1PZ2A 1E72M 2EBNA 2QMKA 5HPCA 3RMEA 1XH1A 1E0XA 1VRXA 2A3EA 3A4XA 1JNDA 1UWSA 3MMDA 1CXKA 2VR4A 1SMAA 2A3AA 4IISA 4J3XA 4E4PA 4LPCA 3NUKA 1M04A 1QI5A 2GJPA 4W85A 4MNJA 3WDHA 1JYNA 5GNXA 2WVTA 3I3DA 4U2YA 4JAWA 3VNZA 4FLOA 4QLKA 4Z2IA 1MW1A 4FMVA 3GXFA 2DT2A 3T09A 3L2LA 2JE8A 3AS1A 1HKMA 3VIIA 4PBGA 3PZVA 1LWHA 2DSWA 3GZAA 4FK9A 5F7UA 1DWHM 1ZBVA 1E5NA 1OT2A 4XZBA 1W2PA 3CIVA 4GIAA 1SMDA 1MXGA 3AMKA 3FNDA 3WNLA 5ABFA 1V0KA 1GQJA 4ATLA 2IUZA 1GJUA 1W3KA 1VEPA 4U33A 4TOQA 1IV8A 3CZLA 1US3A 4W8BA 5HOSA 4CD8A 1UR1A 4GZEA 4JCLA 1LF1A 4YPJA 1W9PA 4UQAA 4XUYA 3FAXA 1WZAA 1D2KA 4W84A 2G3IA 3U7BA 3PZTA 3UERA 5IXEA 1E6RA 4MB5A 3RM4A 4EK7A 2OSXA 3L4WA 1EA9C 4MADA 1CENA 3OZOA 4DUWA 4LX4A 3WNNA 1GVYA 5I23A 1ZB5A 5FL1A 4QLJA 2VO5A 2JF6A 2V3FA 3W82A 2WCGA 3LPPA 1WPCA 5EBAA 1EH9A 3AHYA 4GPNA 2VRQA 3VD5A 1MVYA 2PC8A 1K9TA 1RD6A 4M82A 3SCUA 4NRSA 1PX8A 5A69A 4W88A 2HISA 3AROA 3F5KA 3VD4A 1AQMA 4UQ9A 4PMYA 4UFJA 2V3GA 2XVNA 4YHEA 1K9EA 2CITA 3WD0A 4D1JA 1BTCA 4M24A 2VQUA 4B9ZA 5I0DA 3DHUA 4C7FA 5A6JA 4DUXA 2CIPA 4J3WA 2J7GA 3GNOA 2BY1A 1UWUA 2F61A 4W8AA 3CZ8A 4M1RA 1R8LA 2CHOA 2JALA 2V38A 3OLIA 5LYRA 3FN9A 1EOKA 1JNEA 4BS0A 2XFRA 1FA2A 2CERA 3MSGA 2OLHA 5HDRA 3UG5A 3CMGA 3T0DA 3RDKA 5E0CA 4BQ5A 4YN5A 1WDSA 3A4WA 4MJ2A 1J10A 2OSWA 4AIUA 5A6MA 3WIJA 1J01A 3VGFA 2CEQA 1MW3A 4UOJA 3KL0A 2O9RA 5DO8A 5GNYA 1R7OA 1R86A 2WNWA 3VIFA 1ZBCA 3WSUA 3BSGA 2VX4A 2WSKA 2FGZA 1Q6EA 3WNMA 2ZXDA 4PSPA 3GNPA 3II1A 4Z2JA 3POHA 1OINA 2GDUA 2WBKA 4AEEA 1QHPA 4N42A 2GSJA 3L4TA 1QNSA 1KQYA 4MB4A 2BNJA 3BCFA 1HN1A 1GJWA 2G4FA 1C90A 1ZBKA 4CD6A 1K9DA 2VCAA 3DECA 2PWDA 4E8DA 1V3MA 1W9DM 4M29A 3CUHA 2VURA 3VD7A 2XM2A 2ZXBA 3AHXA 5BYWA 3NYDA 4V27A 3MV01 4H8UA 1UZ4A 2E9LA 3A4AA 5E6ZA 2WLZA 1NOUA 2YL8A 2J78A 2CETA 2WXDM 3TTQA 4W7WA 2ZOXA 4E2OA 5KEZA 1LG2A 3VIPA 3N11A 1EDGA 4D6GA 1JZ6A 3L4VA 1CLVA 3ARPA 3GH4A 1Q6CA 4PMXA 1H4PA 8A3HA 3PZMA 2C0HA 3GXIA 1U30A 2X2YA 3BAYA 2OYKA 2WVVB 4QLLA 2QHAA 2UWFA 4P7LA 3LPFA 3AXXA 2EJ1A 5M03A 2GFTA 4CVWA 1J0JA 4P8WA 3WBEA 4W7VA 1RH9A 3CUJA 2EXOA 4HU0A 1E43A 1VFFA 1B3WA 3ZOAA 2ZXQA 4DWSB 4B3LA 3RM9A 2CBJA 1UR9A 1JD7A 3BLPX 3CHEA 1P6WA 3CO4A 5GQBA 1V0MA 4NI3A 4GZIA 3DYOA 1M03A 3WF4A 3U5YA 3AIEA 3WH6A 4UFLA 3AIUA 2YDQA 3VU2A 4JFTA 4CD4A 2XWDA 1GOOA 1EIBA 5M5DA 3U57A 1B0IA 4JIEA 4BZYA 2F2HA 3WFLA 2CBVA 2PWGA 3ALGA 3FY1A 1A47A 1QNRA 3WQVA 3KEHA 3SCNA 1HIZA 4ZE5A 1W9VA 4AD3A 2V5CA 1W9XA 1TR1A 3TOPA 3CBWA 4OOUA 4D6EA 1TCMA 1UG6A 4J7RA 2WBGA 1XD0A 3SIMA 4WK9A 2CBIA 2W4XA 1DP0A 1R7AA 4BQ2A 2DDXA 2A3BA 1NP0A 2Y4SA 1B30A 3AIWA 3W81A 4AYSA 1KR0A 1FFQA 3ZMRA 5CG0A 5AY7A 1XD1A 3ECQA 3BC9A 4P8UA 2X09A 4W87A 1GOKA 1HKIA 3MS8A 1BG4A 3L4ZA 5D8ZA 1OBAA 4OBSA 4L4PA 1KGUA 3ZJKA 5I2UA 2CXGA 1KWKA 2OYLA 3L4UA 3W28A 1NQ6A 2ZUUA 5BXTA 2OSYA 1OWQA 1PX3A 3B9EA 1E4IA 2EPLX 3GH5A 2WCAA 1GOIA 5E09A 4HP5A 3L4XA 4PTXA 5ABGA 4HOWA 2BHUA 3AOFA 1JZ8A 4HOXA 2WLYA 1GHSA 1B3YA 2CCRA 1NH6A 2VCCA 1UKQA 3WKZA 4ATDA 3IAQA 1KGWA 3BAXA 1GW1A 3SCRA 3SUTA 2WK2A 3WQ6A 4Z2KA 5ECUA 4OUEA 5FOOA 3EDEA 4J3TA 1VB9A 2TAAA 3DHPA 2E40A 4D71A 5A6AA 1UD3A 3FAWA 4CU7A 1E6PA 2EPNA 1PIFA 1LWJA 1UD8A 3PZOA 1BLIA 2NSXA 1WDRA 1C91A 3MUZ1 4U3CA 1NP2A 2J7CA 1GONA 4JCMA 4JFWA 1RPKA 1TZ7A 2DPEA 4EKJA 1I1XA 3GBEA 1R87A 1UR0A 5EMYA 3ZSSA 3VD9A 2WW5A 2J7FA 2ESCA 2CPUA 5ABFB 5DFAA 4WSKA 2A3HA 5JBDA 3QHNA 3K8LA 4BCEA 2GUYA 1JGIA 1W1PA 4TX6A 5A95A 2YLLA 1FHDA 4WKFA 1UKPA 4BA0A 1M01A 3WQ8A 1UR2A 3WD1A 2WMKA 4CN6A 5A6BD 1XSKA 5E9AA 3I3BA 3VDHA 1CECA 2DSKA 3AXIA 4Z2GA 1UHVA 3AS3A 3ZM8A 6A3HA 4D1IA 3MUY1 2VX7A 2XJ7A 4LQ1A 4RL3A 3K46A 3PTMA 3WENA 5CSYA 4GI8A 1JF6A 4YHGA 1QI4A 3ARWA 5LA2A 2WCSA 4JKLA 1B3ZA 2PI6A 4PMUA 2CESA 4X0NA 1HP5A 2XVGA 1V3JA 5FCZA 3A47A 2W63A 3WUEA 3BAWA 3OG2A 2DH2A 2UY3A 3GTNA 2XWEA 3B9AA 1V08A 3WF1A 3CHFA 5D9PA 7A3HA 3N15A 3QOMA 1QI0A 2W91A 4IUGA 1H3GA 1RP9A 1VAHA 3UG4A 3QHMA 5ABHA 1H2JA 1E4LA 2XVKA 5CGMA 1CLXA 1J0YA 3UR7A 4GQRA 4HMEA 3ZJ7A 4UQDA 1E73M 1C92A 3WDRA 1MWOA 4PYSA 5HNNA 4UR9A 2OWCA 1LL4A 1UR8A 1ITCA 1EQPA 3VOCA 1X1NA 1QNOA 1XYFA 4IPNB 3DYMA 1E56A 3AJ7A 2BS9A 5EFDA 2G3NA 3AZTA 1ITXA 4MB3A 1C93A 2G3JA 3RILA 1V3IA 4AZGA 4C7DA 4JFVA 1PAMA 1J12A 4QCEA 4IPLA 2RGLA 3PHAA 2J7EA 3ARZA 3S6TA 4HMDA 5I3DA 1DWAM 3FW6A 3O9NA 3L2MA 1NWUA 3ZSTA 5CXPA 3K8MA 2CKRA 1H49A 4D6DA 1DHKA 4ACYA 1LG1A 2FHFA 2VVSA 3VMOA 1JG9A 1OM0A 1ISYA 3EMCA 3CLWA 3SUSA 5IFPA 4AC1X 1G1YA 3WH9A 5DF0A 1HVXA 1N82A 1HJSA 1GOWA 5JBFA 1W32A 4P7NA 1OGBA 3HJEA 4QDMA 1VBRA 1HNYA 3A3HA 3AIQA 1BYDA 5CQ1A 4Z2LA 2VZVA 1TG7A 2E3ZA 3QGVA 3VGDA 5LA0A 1QPKA 3VDBA 1MW0A 3PZUA 3M7SA 1UZ1A 4ZENA 4AIEA 1ODUA 2X0HA 4NZCA 1TFVA 2VMFA 2XIIA 3WL0A 1HJQA 3ZT7A 1BGGA 3N17A 3JUGA 1UOKA 4B9YA 5I6SA 8CGTA 5E70A 2YBTA 1V6YA 3VIGA 4KH2A 1GORA 4UZUA 3T0BA 2WKGA 2FH8A 1HVQA 3AZSA 3F5LA 1H09A 1D3CA 4XB3A 1JFXA 3CZKA 4R5EA 5BWFA 3VD3A 1AVAA 3IAPA 1VEOA 5LA1A 1UD2A 2W61A 3GBDA 3MV11 2JFEX 3UG3A 5DMYA 4KMQA 1E3XA 2AAAA 2D0FA 4UQEA 2QMJA 2UY5A 3BAKA 3W29A 2ZICA 5TD4A 2EQDA 4PSRA 3CZEA 3AHTA 3WMSA 3WEZA 1PBGA 2J8GA 2WZEA 2BVTA 3AMGA 3T2PA 6TAAA 1HL9A 4UFIA 3PZGA 2WC7A 1I75A 1HT6A 4H8VA 1UWRA 2CHNA 1LL7A 2WMHA 4CCCA
chains in the Genus database with same CATH superfamily
3WEOA 8TIMA 3B8WA 1MFUA 4EE9A 4GACA 3W4RA 1CGWA 1H63A 1TRDA 3KFTA 4RW5A 3LMYA 1SZEA 4GX9A 4QG9A 3N9KA 3WEMA 1TV2A 2HVOA 2ZRYA 3V35A 4CCDA 4TXEA 4M0XA 3E38A 1ZJIA 2PB1A 5A2CA 2X1SA 1LL6A 1W9BM 2WMFA 4XZHA 1F9CA 3U2CA 5I07A 4GKTA 3FFSA 3CQIA 1QI2A 1Z7AA 1WKDA 1RD5A 1F05A 3HPXA 1IEQA 1R2SA 1FX6A 4BI5A 1OT1A 4IP5A 3BLOA 4HZ7A 2Y62A 2NWRA 2PPGA 4KEZA 2P76A 3GXMA 3TQKA 1GYNA 4UFMA 4GI6A 4PB3A 1B5TA 1Z69A 1LDCA 4NU7A 1JL8A 2CZ5A 5E5CA 4PEEA 2HROA 4FXFA 2HEJA 4JN7A 3NAVA 4PUJA 4A8IA 3QW4B 1XC6A 5AN7A 1E5JA 3OGVA 2QCCA 3WLIA 4PCNA 1CXEA 2VFDA 4LUSB 2FZBA 4DXKA 4LAKA 3TA6A 3F4VA 3WDJA 4IL0A 2DIEA 4GVHA 3UGVA 4B5WA 2ADAA 3GD6A 3L5MA 4LAOA 4LUIA 1F8MA 1SFLA 2DH3A 3LERA 5CLTA 3KW3A 2WSPA 2ZRXA 4MLJA 4UFHA 3QGKC 3W7QA 5DXXA 3B8TA 4GRSA 1X6NA 4QQUA 1DIOA 1U2YA 2GGEA 4GKLA 3C52A 1ZNNA 3KZSA 3BLEA 3MSRA 5LNWA 3HGRA 1F6YA 2E6AA 4JN8A 2VI0A 1W2VA 2ZE3A 3OZYA 3P7YA 3PBYA 5AYZA 3CUZA 1RJQA 3P61A 4O54A 3OOQA 1ZJAA 4RE2A 1ZALA 2YDAA 4NSBA 3H7RA 2A79A 2B7PA 1IWBA 3OBAA 2ZQ0A 3BV4A 4YCPA 2A3CA 3GNXA 3APTA 4ZGYA 2DT1A 3ZR6A 1KNWA 4OBTA 3VOJA 4N9BA 2VXNA 1IE7C 2AAMA 1NOWA 3QLDA 3L5LA 2TPSA 1XIDA 4MDOA 4KIEA 5C54A 3A5VA 3N29A 3LY0A 4JICA 3LZ3A 3D47A 1IZKA 4UTWC 2FIQA 4H8NA 4TTUA 4IMDA 5I78A 3EBVA 2JF7A 3KHDA 5HUOA 1QAPA 2Y24A 5AVHA 4OGZA 2OQLA 2JGYA 1RP8A 4A22A 3KL3A 4JEQA 3S1GA 3NZ1A 2FDMA 3SN0A 3ATZA 3WQDA 3WF0A 1X7IA 4BK9A 4AVFA 4EOUA 2Y7EA 1NFGA 2CNCA 3O05A 3AHZA 4PCSA 5MHBA 1KTCA 1LTDA 2YBVA 5FJOA 4AZ6A 1BTMA 4Q22A 1G5AA 1V02A 3PZIA 5AB3A 5I3FA 3SGGA 4Z17A 3MP3A 3MUCA 3DBPA 3ABQA 2Z1XA 1QI3A 4I5UA 2C1IA 3LMZA 4MUZA 5I79A 1CGTA 1SVDA 1VENA 5GNZA 3O15A 3VUPA 1OCQA 4F79A 1QK0A 4QG8A 1M3UA 1ME8A 1UQYA 4RX0A 4V28A 1Q7ZA 4MFEA 4IGNA 1WBHA 1WYIA 3SO7A 1JDFA 3F4NA 4C6OA 2AQWA 2SFPA 4H41A 3CPRA 4ZEPA 2D1ZA 5EGRA 2DVXA 3GK0A 1GOQA 1LBLA 2A2IA 4AZIA 5HWNA 1V3HA 4AB4A 5A6KA 1OCNA 3VM7A 3LTYA 3TCEA 2ZZ6A 3NGJA 3UG8A 4CGTA 5CGTA 4Z1BA 1H7NA 1LZOA 4X63A 3NO3A 1NFPA 4YVXA 4CU6A 4IMGA 3WL1A 4NF7A 4TMBA 1W1IE 1JZ7A 3EWYA 1XSJA 5KZ6A 1MEWA 1XIGA 4LOCA 4F0MA 2VT0A 4M51A 3DKLA 5HMEA 1J9YA 2OR2A 2WNNA 1GPWA 1OK6A 1A3HA 2EGZA 1MQPA 3TWBA 5LIUX 3KS5A 3CAQA 5A5WA 2AKZA 1C3FA 4Q8VA 5J5RA 5CPQA 3BOFA 2FJUB 2QYGA 2A1YA 3BW4A 2POZA 2XH4A 1M5WA 2E9MA 4AAJA 1F3TA 2HNHA 3AALA 4BF9A 4ROPA 4GI9A 4ADUA 3GKAA 4LYPA 3BV7A 3H4WA 3IARA 3RG6A 1F76A 1GHRA 1M53A 3GDMA 5A8QA 1R3YA 3RX4A 3AJXA 3HPZA 4XV0A 4XZ9A 3U5UA 4UOZA 3G1XA 1JCYA 3K1GA 1YW1A 3ARRA 1Q2SA 3CGTA 3OVQA 2XGZA 2H90A 2XINA 4S3KA 4S3CA 3VYLA 3AU2A 3VM5A 5I03A 1R47A 4BY3A 4TV5A 2ODOA 4ERGA 3TR9A 3ALFA 4ZOBA 3H53A 2OG9A 3DC0A 2QR6A 3HV8A 1GQKA 4L4OA 4WOZA 1RQBA 4UB9A 4B2DD 1BSIA 3CHDA 3HMCA 3KWSA 3OB8A 3WN6A 1WXJA 1EEPA 4AD4A 1I1WA 4H4IA 3R89A 4H9VA 1W1A1 1CXIA 5FSDC 3W1XA 1U1HA 1EJWC 3IK2A 3O0FA 4B5VA 1V6VA 4DLMA 2ALDA 4HGXA 3WELA 2W9MA 1TWDA 4MTVA 3CB8A 3PBGA 1DWGM 1FY6A 4JD4A 3JVAA 5LIYX 5FD0A 3W1UA 2BVYA 3UWWA 2JEPA 2ZWZA 3EWZA 2NLIA 3DFNA 1RXOB 3DFSA 2YL9A 1TPVA 3MMTA 1FWFC 3HZ3A 3TX9A 1R3TA 3C56A 1GVQA 3W7OA 1XV8A 1W31A 2XDFA 4H9MA 2GPTA 2YA1A 4PMNA 5CLWA 1EYEA 1TWZA 2BY0A 5FEWA 2DQXA 3GYEA 3MCNA 5JIPA 4GVFA 2WB5A 4NYYA 3CIWA 2PP3A 3W7LA 3TLLA 1M41A 3G0XA 3NM3A 1PZ3A 1RK6A 2Z1BA 4XBJA 2WC3A 5BW6A 2VEFA 2ZKMX 3ZVHB 3CTLA 4EVZA 1OABA 1KBIA 1PHWA 4GIRA 1XBXA 4J2PA 4JTRA 1QVBA 4D6JA 2G50A 2V68A 3B03A 1MDRA 5DCBA 3I6TA 2ZXAA 2C1HA 1QPQA 4YTTA 2YZRA 5A8PA 3BE7A 1XGZA 1ZJBA 1JFHA 1BVNP 3I4KA 1WKEA 4PTWA 2HWGA 4PGLA 1V6WA 1XBVA 4HOZA 7TIMA 1D7FA 2XGIA 2VRKA 2VCBA 1RALA 1WV2A 2PDYA 3E5BA 1UCWA 4URIA 2R9RA 1QT1A 4AY7A 1SYTA 4ILSA 5DEZA 1W5QA 1V3KA 3BANA 3WLHA 3NL6A 4RPPA 1A5NC 5HNUA 3S9YA 5A8OA 2FB2A 3UW6A 1VRDA 2HSAA 2G8ZA 3WD3A 3VKCA 5DCEA 1K7FA 4POCA 4OOZA 1ZSXA 3LHYA 3M64A 3T4CA 3A3XA 3CLMA 1HKKA 1IXPA 5AC5A 1AJ0A 2YDSA 4DHGA 3SUUA 1XUUA 2NWSA 4AIOA 5K4XA 2NSOA 4O14A 3NA8A 3WNPA 1XCWA 4I8DA 1MQRA 5AC4A 2RDWA 4M5PA 3SW6A 1Y0EA 2CC0A 4AF0A 4K36A 3WZ0E 3R6IA 4GVIA 2FHBA 1RJPA 3R94A 4IUOA 2A5HA 2CLKA 4PBEA 4F2BA 1Q3NA 3GWQA 1TTQA 1QOQA 3RJYA 1ECQA 3FA5A 4XIMA 3SEPA 5K4ZA 2DT0A 3PZQA 1ZL1A 2ZZ3A 1IEVA 1F2JA 3DH7A 3UETA 4AC7C 3EAUA 1DWJM 1NWTA 2QGYA 4KWUA 4IQLA 3TC3A 3MI6A 4WR3A 3O6CA 1KFCA 1XJBA 3JZUA 1D3HA 2PWFA 3TN5A 4J2MA 1W3LA 5BRPA 4Y9AA 1X97A 2PEVA 4J27A 4ICCX 2C15A 2OOGA 3FJ4A 4XAFA 5XINA 3LA4A 4P8XA 1IR1A 1FWAC 5A6SA 1JRCA 3LPOA 5D4YA 2EPOA 3OLEA 4LVBA 1TPWA 4BQ4A 1AW1A 2VEKA 2G96A 3U3HA 4H7CA 2EPMX 3KUMA 1B9ZA 1J96A 1EKOA 3QW3A 2FGLA 1B4EA 3M6DA 3UJRA 1O66A 4J40A 3KVLA 4XISA 5E6YA 4A05A 4MYAA 4Q8OA 3NG3A 1UC5A 1VPQA 3IV8A 3MHGA 1Z42A 2OWXA 1CIUA 1BWLA 5F2LA 4IZGA 4Q3MA 1V03A 2ZA2A 5K7JA 1UWQA 5B80A 1WDQA 1KRAC 2XSBA 3OHIA 3CXOA 5IBXA 3R0UA 3P3BA 3W24A 2BGQA 2TSYA 1H5VA 2FPVA 1P43A 4MPKA 3P93A 1W5OA 4LXFA 2ISWA 4BQ3A 3PM6A 2ISSA 4PRTA 2PDJA 2Y7GA 4A35A 1E0WA 1EUAA 1XRVA 2DW6A 1PWLA 4UTIA 5HK4A 5C6MA 1TE1A 3BCDA 1BQCA 2GVJA 3KDNA 3DGBA 3SY5A 1UKSA 4NJIA 3HQOA 2IPGA 2V2HA 1AG1O 1GW9A 3UPBA 4JYEA 2PTXA 1IHIA 2G37A 1VJZA 4LS1A 4YL2A 2BOEX 4FAMA 4IIDA 5AYBA 3MKKA 1RQHA 4MZYA 1OIMA 5BU9A 3SY1A 4NVTA 1ENUA 4OTKA 2VC5A 1MXDA 1E0TA 1B3OA 2VFEA 2B31A 5DT7A 4U5KA 4RKAA 3AMLA 2Z26A 4DJDC 4L1WA 1Q6RA 3EB3A 1VBUA 2DZWA 3DI1A 2Z1SA 4RV8A 3P81A 4GFSA 2OMAA 1GKRA 3EX4A 1B90A 1A5LC 4C7GA 3C0QA 1UKOA 1RVKA 4TR9A 4IGSA 3ABOA 3BGAA 2W79A 4PN2A 4F0RA 2ZC8A 1NARA 2J7HA 3RIKA 2YLAA 3KZPA 1CXFA 4DZHA 1AQHA 5BWAA 4MFDA 4D6IA 4NXSA 3H54A 1QNPA 1DKWA 3K4AA 5J5DA 2PCQA 4DRSA 1ZS2A 3WUGA 3BG5A 2QDEA 1G9HA 3V0SA 2G97A 4B3KA 2ZCGA 5HWMA 3ARXA 4IM4A 3WBWA 1DWIM 4ZR8A 4D6HA 1IT0A 3TTSA 1SO4A 4S39A 3BMVA 1XIBA 2I7GA 2G41A 4J3UA 2RJHA 2J8FA 3HQPA 1ZU8A 1EXPA 5DXYA 1W1B1 1F3WA 4BF7A 5E93A 3JW7A 1FHLA 2WVVA 3W2LA 3UP8A 4GGHA 1VIWA 1K77A 1KM3A 4LW7A 2FH6A 4RE0A 4NJHA 1DJQA 3DENA 1W3HA 1I2RA 1O5RA 4PUNA 3IIZA 4ZQNA 4RK8A 1J0KA 2DY3A 3ABSA 3M43A 2QVNA 3MDWA 1QATA 4E8GA 5HQEA 1HKVA 3W1AA 2PRMA 3L2IA 1K9FA 3TN3A 4FIQA 4G1NA 4MNKA 3WJSA 1FFRA 3G6MA 3T7VA 1IEIA 1DXEA 5CJ5A 1XIFA 2P10A 1D3GA 2WWCA 5IM51 2F8QA 2I56A 3VZXA 3W86A 2TODA 1EEXA 1I2PA 2WHMA 3C8NA 3OIHA 3IIPA 4B91A 5BXPA 2FDSA 3EKGA 1QWKA 1FP8A 2HBVA 3N2XA 1PZ2A 4IP4A 1E72M 2Q8ZA 1ZLPA 3RMEA 3LXBA 5CCZA 5T91A 2CU0A 1E0XA 1VRXA 1NDVA 4KETA 1I9CB 3MMDA 2A3AA 4MY1A 3GHRA 1TQXA 1G4PA 4IISA 4NNBA 4HQVA 1L2UA 3ES7A 4LPCA 4IOTA 3WDHA 3PB0A 3I3DA 5BMXA 4JAWA 3KBNA 3BLDA 3FJ6A 4JNMA 1BVWA 1MW1A 5CSSA 1XUZA 2JE8A 1EJ7L 2DSWA 3O16A 4KESA 4ALDA 3LXCA 5D38A 2NQ9A 1E5NA 4PFMA 2IS7A 3E74A 3V0UA 4XZBA 1W2PA 4MPQA 1U83A 1MXGA 3AMKA 4LV9A 2QJHA 2FQIA 5ABFA 1GTEA 1GJUA 2VENA 2OPJA 1IV8A 1US3A 4UBPC 3LTSA 1NELA 2A85A 5XIMA 5HOSA 4QITA 1YDYA 1NSJA 1W9PA 3W72A 2R91A 3FAXA 1D2KA 3UERA 5IXEA 1E6RA 4DAIA 3RM4A 1P4CA 1X8FA 1F3EA 4IP7A 3AYTA 3ZVHA 1UP3A 2Q71A 3G1SA 1H5YA 3FS2A 4DBUA 4QLJA 4HPJA 4JNYA 2HMCA 2JF6A 4I3GA 1V7AA 2WCGA 4QAIA 3ZS4A 1EH9A 4GXWA 3D0CA 3VD5A 1TPH1 3GVGA 3ORWA 2D69A 3IIOA 3E02A 3UJSA 3AROA 3GE7A 1Q6LA 3ANYA 2QDDA 4PMYA 3WD0A 4IF2A 3S42A 5I0DA 3DHUA 2XU2A 4C7FA 4DUXA 2CIPA 3MVIA 1Q45A 3E12A 1IXQA 4GHRA 1UWUA 3QFEA 5CC6A 2F61A 2J9YA 3CZ8A 1R8LA 2JALA 4M1RA 2AGKA 5D2TA 3FN9A 1JNEA 2XFRA 3IUDA 1MRQA 1MZRA 1FA2A 4FNRA 1OFDA 2R82A 1UWAA 4X22A 3FK4A 5HDRA 3UG5A 3QSTA 1N8IA 5C9RA 1WDSA 3A4WA 3WLOA 2DZUA 4MJ2A 1J4EA 1J01A 2C6QA 4TU1A 5RUBA 2IPFA 2OZ3A 1NEYA 4INFA 3WSUA 3BSGA 1A3WA 1WBJA 2WSKA 2FGZA 3W74A 2ZXDA 1W5PA 1CLKA 3BMXA 3II1A 4Z2JA 1OINA 3BLIA 2YSWA 4EWND 1GQNA 3TYBA 4N42A 2GSJA 4FX6M 5AHLA 1GJWA 4CQAA 2VCAA 3VCNA 4I8YA 3UJEA 2GWGA 4DVOA 1V3MA 3GRIA 3VD7A 3H12A 2FPYA 3MB9A 3BJTA 3MW7A 1VQTA 3GXNA 5BYWA 2Z1WA 2X2GA 2FVKA 1UZ4A 4B4HA 2G5WA 1JCJA 1IYXA 3HTWA 5C7VA 1JQVA 3S2JA 3TTQA 3U4AA 3NGFA 1XG3A 5HWJA 1J6PA 1WKFA 2P53A 4O0KA 4IIHA 3ARPA 4ZQPA 4IFRA 3N73A 1WUFA 2PDKA 4YVVA 1ICPA 3GXIA 6REQA 5L6UA 4HHPA 3S0CA 2OYKA 1VD6A 3BZJA 3G0UA 3PFRA 4M6QA 3NNTA 3LI0A 1M7OA 4P7LA 3LPFA 2WNZA 1OK4A 3UWQA 3CL7A 4GCXA 3LNPA 2I17A 3RK8A 2XFWA 3CUJA 1E43A 1VFFA 1B3WA 3QH2A 4DWSB 1TB3A 1LYXA 2EKGA 1DJYA 3BLPX 2X1TA 4D8AA 3DYOA 2I57A 1M03A 1WDWA 1SU5A 3AIEA 3WH6A 1M65A 4JN6A 3AIUA 5CBJA 2DV0A 4LAMA 1KA9F 4UTKA 3FGCB 5D33A 1B0IA 4JIEA 4HK7A 1XG4A 1EBHA 3B0XA 3FY1A 3WQVA 3OVGA 4PB5A 3SCNA 4Y9PA 1CI1A 2V5CA 1O95A 2P3EA 1SPQA 3A64A 2AGTA 5HMSA 4IIEA 4Q8TA 2A7RA 3NZRA 2VELA 5DRCA 1Q8JA 2J88A 4S3EA 1ZAJA 1XLLA 4UTMA 4YTRA 1IR2A 3R11A 4AYSA 2Y4SA 3W81A 2C3ZA 3D46A 3BJSA 3ZMRA 1YNYA 5C0QA 2IQTA 4N4QA 1XD1A 5I3KA 1VLIA 3PSVA 3BLFA 4P8UA 1Z41A 1GOKA 1HKIA 5G1TA 1OBAA 3W22A 1YNQA 3P82A 3NL2A 1BKSA 3ZJKA 3VNJA 3VZZA 3E3HA 1LP6A 1YE4A 5BXTA 1OWQA 3AUJA 3HA1A 1MRAA 1A3XA 4BKNA 5AC7A 3GX9A 2QDGA 3G1YA 3W6YA 2WCAA 1GOIA 3TW9A 3GFZA 2B0MA 1TRIA 3RN6A 3RU8X 3W71A 5E09A 3L4XA 3QMRA 5ABGA 4HOWA 1SW7A 3AU6A 4HOXA 3GB6A 1GHSA 1B3YA 4CQBA 3W73A 3F4WA 3G1FA 1KGWA 4RDYA 3CIXA 4IMCA 3SCRA 4AWTA 1KM0A 2V0TA 3B3DA 4Q4RA 1TUFA 5KZEA 2HQAA 4CEUC 1VB9A 2TAAA 3DHPA 2E40A 1XF0A 5FF0A 3OQEA 3FAWA 5FAJA 3EXTA 1EJSC 4L65A 3WQCA 1A5CA 4O1DA 1PIFA 3EOOA 1BLIA 1DOSA 5EYWA 1HKWA 1WDRA 1ITQA 1C91A 3SY8A 1L8PA 1OADA 4U3CA 4UMCA 3UNTA 1GONA 4ZO8A 1K6WA 3NPUA 3I7QA 3DIPA 1JJKA 4G6CA 4S3DA 3UXIA 1OG0A 4PRRA 3VFCA 2NUWA 3T0TA 3SJ3A 4F0HA 1PSCA 5EMYA 3ZSSA 3KLKA 3RX3A 2J7FA 1JQXA 2ESCA 3M0LA 5ABFB 5DFAA 4WSKA 2A3HA 5JBDA 2GUYA 4YWIA 3KX6A 3CJPA 3TYEA 3WQ8A 1QK2A 1MO0A 3WD1A 1H7OA 1EP2A 1ZGDA 4LQ1A 3XIMA 1XPYA 3K46A 3UCDA 4HNOA 1TTJA 3RR1A 3MBDA 4YHGA 1QI4A 1LUCB 3GTFA 4JKLA 2WV8A 2CLLA 1B3ZA 2JBMA 1HP5A 1V3JA 3U0HA 3H26A 4LF2A 3BAWA 4FX8A 4I7UA 2DH2A 2CXEA 2XWEA 4KPLA 3CHFA 4FB7A 4HJWA 3QOMA 1QI0A 3VA8A 3WK0A 1RP9A 1VAHA 3W1LA 1H2JA 5CGMA 4GQRA 4UQDA 1E73M 5TF0A 4A8NA 1RSCA 2FKPA 4PYSA 2ATSA 2NVDA 3LLDA 3IV3A 1O5XA 4X3ZA 1XYFA 3EXRA 5FJUA 1FWIC 1IIGA 3N19B 3AJ7A 4Y96A 1KC7A 1ONRA 4MB3A 1DXFA 2Z25A 4DBDA 2E28A 4C7DA 1FQ0A 2CZFA 4QCEA 3Q94A 5IOBA 3WBXA 1GG1A 4EWJA 5I3DA 1ZJHA 1H49A 3I7RA 4ACYA 8XIAA 2VVSA 2PTZA 3LGEA 3SUSA 3UF9A 3WH9A 3DFYA 2GQAA 3QKEA 3MCMA 2FVMA 2RFGA 3V3WA 1GOWA 5JBFA 1BXNA 2HTMA 3HJEA 1TTPA 4QDMA 3BG9A 3A3HA 4E2BA 3W9ZA 5CQ1A 1EXBA 5CAKA 4GY0A 4HB7A 3CWHA 3CNYA 3VDBA 3PZUA 2AL2A 2DZSA 1A0EA 4ZENA 2VWTA 5F2IA 3EWCA 2Z29A 3REQB 1UOZA 1K7XA 1EYWA 1RLCL 3N17A 1PZ0A 3L21A 1A49A 1IZCA 1EJVC 5G5IA 9XIMA 4AUBA 2CLHA 1GORA 4UZUA 4WCJA 4JX6A 1TQJA 1H09A 3IGHX 3DC8A 2HDJA 1A5SA 4R5EA 5BWFA 3H4XA 3FIGA 4MM1A 1Z3NA 1AVAA 3VD3A 1RV8A 3IAPA 4G7FA 3S5ZA 5E1QA 3MV11 3T1GA 4S2CA 1CCWB 3UG3A 4QHRA 5AZ1A 2D0FA 4DYKA 5TD4A 4JQAA 1GWJA 1GGOA 3PANA 3QC3A 3EPNA 3CPGA 4GZ7A 3L7RA 3QMSA 1LOSA 1E1CB 4QDPA 6TAAA 5B7ZA 1XM3A 4LALA 1HGYA 4IG2B 4ORIA 1EF2A 3CU2A 2O4MA 2V5LA 4JTUA 3OIXA 3A9IA 1PKMA 4S3AA 2F6KA 2V2DA 1C9WA 3A22A 2WOQA 1ONEA 3E0IA 1XIMA 4CCZA 3ANUA 3QPZA 3WLLA 2B7QA 2WMHA 2QPXA 3PBMA 2G95A 1JCNA 1UH4A 3GIPA 4PUEA 3GYCA 3JU2A 1LM1A 4MJ4A 4BEQA 2NT1A 3UVIA 4ZFCA 6CGTA 2XH7A 3TFCA 4GH3A 3EPOA 1I60A 1OB0A 1XLGA 3KRUA 1OFOA 3PBWA 1VCFA 3C0SA 3QPEA 3WLRA 3GH7A 3R5EA 2YOCA 1E0VA 3ONCA 1NWSA 4MAVA 1AZ2A 4WHBA 2DSVA 2QULA 1UC4A 3EPMA 3H7VA 2P1FA 1KBKA 4MYXA 2VNCA 4QRNA 3TKFA 2CYGA 5CSRA 3E0LA 1PIIA 2V5DA 3ZXWA 3N25A 2ZDSA 4WLCA 5G2IA 4K68A 4MAZA 2QCDB 4FXSA 3EWXA 4PH6A 2PSNA 4FPSA 1VCGA 2D23A 1T8XA 1YXDA 3NM1A 3AO0A 3EYPA 1SR9A 3NQFA 4RXGA 5HAOA 3DU0A 5LHFA 2PDUA 3E0VA 4JYFA 2J47A 3KCLA 4PMVA 2QJJA 2R1NA 2G3MA 2O4QA 3AYVA 3SQSA 3U2ZA 1H7XA 5AVNA 1Q8AA 4LU0A 3IGXA 4B2DA 2DEPA 1YKWA 5H1WA 4UQCA 3VIMA 2WVUA 4GISA 3I4EA 1JDAA 2DSUA 4GQBA 1XLDA 4DM2A 3TJIA 1TVPA 4GI4A 1KFLA 1BFNA 1T99A 2NXIA 1WZLA 3GDTA 1W37A 4O28A 3ABZA 5A1AA 3VGHA 5FEXA 3PB2A 5HNRA 3OU8A 1VHNA 4BWLC 3TJXA 4QEHA 5F1UA 1JEZA 4UOQA 3TZNA 2CLMA 3POCA 4PMDA 4GO9A 1G69A 5CPSA 1BWVA 4HPXA 3BUVA 1R3RA 5AZ0A 3GG7A 3U8GA 3IK4A 4O16A 3AS2A 3NJ3A 2XG9A 5D2XA 1O1HA 4UQBA 3D5HA 2YL6A 1VKFA 3S5NA 1GNXA 4ZVJA 4DM1A 2YCLA 2NVCA 4H1ZA 4GQ0A 2HBXA 1YMYA 1V6XA 1EJXC 4H2CA 2I1OA 3OLGA 3M7WA 3M07A 4V1YA 1DXIA 2QPSA 1DEDA 3U9IA 1KXQA 1E6QM 4OKDA 4DWDA 3A5FA 1ITUA 1UA7A 4Z0JA 2YYTA 3G1VA 2RHGA 3EDFA 2EG6A 3KOXA 3G0SA 3VMNA 4CQDA 4Y7EA 5T9CE 1PKNA 4QE1A 4LAUA 1VFOA 4NT0A 1MNZA 2P0IA 4WIWA 4O4WA 5A6TC 5J8LA 3P0WA 3T0AA 4D72A 2OYMA 3LYEA 5KETA 1BRLA 2YXOA 3GU9A 2WM1A 4DBSA 1SM9A 5DBTA 1UJQA 1H0GA 4LVDA 3VGGA 1ODZA 1UA3A 4O13A 4OT7A 1FXQA 4DF2A 2H6RA 4JPGA 3WK1A 3MP4A 3FLUA 4XKMA 4YTUA 4ZO9A 2O0TA 1KXVA 2ALRA 1G4EA 1H41A 1P0DA 1XYBA 4HZ8A 3LGDA 4JTLA 4QCFA 2AQOA 6REQB 4MJMA 2D24A 2Y5JA 3LHTA 1GEQA 1XLEA 1DQUA 4FNSA 3RITA 5CKSA 3WCZA 5CEWA 4Q8WA 4DYJA 2KZHA 4JTIA 3MKVA 1TV5A 2V6AA 3WDQA 3HO8A 2ZX8A 7CGTA 3AIBA 3OLDA 3PN8A 1E55A 1C7TA 1E71M 4CEXC 4DN1A 1QPNA 3VGEA 4L9XA 2EF9A 4O19A 1TYGA 4JQ1A 3FEMA 3RM8A 7ODCA 4YIWA 3S6OA 3BOLA 2I5IA 3QR3A 3CPUA 5G4WA 2QCHA 4OIFA 1SFSA 2DIJA 3P80A 4Y9OA 4CNSA 3E0WA 4IX0A 4CVUA 3BQ6A 3IJIA 1US2A 4UTUA 4DJEC 3TA9A 2JKAA 1W8SA 4D6FA 1OX6A 4XD3A 1Q7MA 4OZOA 3W7DA 1GZGA 2FTWA 3B9DA 4XAZA 3TYDA 2V5BA 1AUSL 2NQHA 1LRNA 4W8LA 3WBAA 1SR0A 4WDUA 2JIWA 2ZVIA 3B97A 2WVSA 3GU1A 4O15A 3TMQA 2Q6ZA 1YE6A 2VEMA 1PIGA 3DG6A 2E9BA 3NZGA 4NZ3A 4JTTA 4IFKA 5K9XA 3HG5A 5EMMA 3PTKA 3EX3A 3PAJA 5I09A 1E9YB 1PTAA 1WNOA 4MWAE 3UVAA 1ME7A 4AU0A 1V0LA 1K4HA 4NJJA 4WDWA 4R7WA 2WMIA 3HB9A 2VD8A 1ECEA 5DY3A 1CT5A 3N6JA 3N2TA 1M9HA 1O6IA 3P84A 5LXXA 5BROA 3PTQA 1YRRA 2DUZA 2A7PA 3WUBA 3ARSA 5BCAA 5LGXA 1Q13A 1NDWA 2BLEA 1KLZA 5DT5A 4G2DA 1NU5A 2YB4A 1T5AA 1DHPA 4R3UA 3LN3A 3M0ZA 4W86A 2BHZA 4QIUA 1YBQB 3TNBA 3ARQA 3GVVA 1QR7A 3I6RA 3T9PA 2ABAA 4J4KA 2VX6A 3R7MA 1XYAA 4TQTA 4C6EA 5LNUA 5M17A 2GVLA 5CG7A 4JTGA 3QHOA 1TCDA 1OC5A 2IXUA 4ZL1A 4JEJA 4OJYA 1HJWA 1MMFA 1EBGA 2FJKA 2XH2A 3MPGA 5FF4A 1XQKA 2C8NA 4ZXOA 1PEZA 2ASHA 2FLIA 4ZOCA 1BYBA 3WF2A 3T2QA 1XLHA 4IMAA 1QWGA 1FCVA 4QNWA 1PX4A 4PUWA 3PF3A 3AXKA 2F9RA 2YCEA 3CUGA 4WF7A 4AZCB 5GJPA 3GDRA 1P0BA 4C1NA 1PTDA 2ZFAA 2WMJA 1PHQA 4O0QA 4WKAA 2XPKA 4DAFA 2Z28A 1LRQA 1K7EA 2X0SA 2XVLA 3DFQA 5BXSA 1OQFA 4GXPA 1GVEA 5C5YA 3B4UA 3R1ZA 1BQGA 1S5TA 3STCA 2INZA 4UCFA 5I24A 1NM9A 1CXLA 4JTFA 1C29A 1ZUAX 4H7VA 1HFBA 2BHYA 4ZQRA 3WMCA 2ZADA 3G22A 1JYWA 1KBBA 3IWPA 3CH9A 1HUVA 1DE5A 5C8BB 1Z32X 2J74A 4GUHA 4ZE4A 2WAGA 1X38A 2VFHA 1BXCA 3JZEA 3RLUA 1R30A 2JKPA 5HUPA 4F3HA 4ACZB 3MANA 1L9WA 4F66A 3HG4A 3T42A 4AY1A 3W7PA 3EA1A 1WAWA 1BGAA 4DJFD 2UBPC 2NW0A 3CQ0A 1TX2A 1E9ZB 7REQB 1UD5A 4GO8A 3R25A 5D04C 3I7SA 2NQZA 2D20A 1JAEA 3QOKA 1P0NA 1WXZA 4LSBA 1VFMA 3GTHA 1RCQA 4N9EA 2E1WA 4M7SA 2YKKA 1O60A 2VFFA 3W1RA 2ACQA 3EB4A 1BKHA 2VC9A 1VC4A 5HULA 1C8QA 3UZYA 1ZCCA 1UUOA 1L6YA 2Z6JA 3PWGA 4E2DA 3SFWA 4XZNX 5DN1A 2HXUA 1WQ5A 3C2OA 1F61A 3UEQA 3EWDA 2WZHA 1JDDA 2YCIX 1CX9A 3VKDA 1W56A 4A3YA 3R8GA 3BSHA 2Z4GA 3BCJA 3HPAA 3WG6A 3LCIA 3H2FA 5HJYA 3TYZA 3GY1A 5BMWA 1MSSA 1TWIA 3DUGA 4AZBA 4Q7BA 1KRMA 3G1AA 4XK2A 3IACA 1OFPA 3KBVA 3UESA 4GJ1A 3NEHA 1GOXA 4B5XA 1RY8A 4YU1A 4BHYA 4PCTA 3P74A 4KERA 2BXYA 1BPLB 1POKA 4AHOA 2DUAA 5EB8A 3M0JA 2VRJA 5JXQA 3NSXA 3QFWA 1MQQA 2XISA 4DZIA 4QROA 4B5SA 3PWIA 4Q6XA 3VX0A 4D6CA 6XIAA 5BRQA 1S3TC 4O18A 3IPWA 4MWAB 2MNRA 2UZ9A 4K8EA 1NQKA 3EKLA 4L6DA 2ACRA 2OT1A 4LBSA 5CPLA 2VOTA 3RRXA 4JIRA 5TNVA 1WZMA 2CLPA 4JHOA 2Y89A 2XVPA 4E8CA 5C2GA 1ML1A 1CGUA 1FOBA 1KGXA 4OBRA 2WZIA 3B40A 2OX1A 4P7OA 1B4KA 1Y8BA 4NZ4A 4U2ZA 2NX3A 3N6HA 1G4SA 3RO6A 3G3MA 3R0KA 2J77A 4IT1A 2YA2A 2C7FA 1VEMA 1AD1A 1JYXA 3OO2A 4GINA 2D3LA 4J35A 4UC5A 4E4FA 2EHHA 4O1CA 4YYFA 5BXRA 3H2NA 1OC7A 4Q4OA 1AMYA 2JK2A 5EMUA 4JGDA 1C8YA 3B0VC 4B3ZA 3PP7A 3ZJ8A 3MMUA 1S39A 3MUXA 5D37A 2XUCA 1W1YA 1K4GA 4FXRA 1OGGA 4DWSA 4JL2A 1PCWA 4PL1A 4FF5A 1W8GA 2Y2WA 3AWOA 3OEXA 4N9DA 3UWZA 2E8ZA 3I3EA 3UXAA 4DQWA 1KM1A 4LUTA 2GJXB 5TBOA 3AIVA 3PUDA 2V3EA 4HK5A 5A2AA 5ABTA 2D3NA 1UBPC 4H6QA 3LHVA 4C91A 3QLLA 3UNDA 3S6DA 3TCSA 4RNJA 4M3PA 1B2YA 2HVNA 2W92A 2QV4A 3G2GA 3LCHA 4JTKA 1ZENA 4AVOA 1K3UA 5G4EA 1MUMA 3W02A 3V7PA 4JS3A 4NL1A 4WKHA 5CC3A 3ZO9A 1L6WA 1KTNA 3UXDA 3TQPA 2PBOA 1UUQA 4UXDA 2J13A 4IIGA 3W6LA 2FFIA 3R43A 4FS9A 3K13A 4IPJA 4ES4A 2O7QA 3W6MA 1VF8A 4Q7NA 3TYAA 2XSAA 1OJXA 5D9MA 1TV3A 2PURA 3WJWA 2OO0A 1WDPA 3LRLA 2ZRWA 1FH8A 1R85A 3UQNA 1QBBA 5A6LA 1O4UA 3ZWSA 1HXJA 2RKXA 3W7IA 4RZ4A 1P1MA 2J7BA 4WX2A 1OX5A 3UZ5A 1KXHA 3MP5A 4UCGA 3G6LA 4LBUA 4GVGA 2QIIA 1UP2A 4A4AA 4LUYA 4FNPA 4HPGA 4GY1A 3QGAC 3KRSA 4DJFA 5LXEA 3CAWA 2GZXA 2W66A 2I14A 4L6OA 1EO7A 1P7TA 4XIAA 3EX1A 5FJRA 4XWUA 1FH7A 3CWOX 3VFLA 4DX3A 1C7SA 2REQB 1H60A 1G01A 4AWSA 1NAL1 3GHUA 3NVTA 3THCA 3MDUA 1FP9A 3KE0A 3DDMA 1QW7A 1OEPA 2H9AA 2IQ0A 5D2YA 3L4YA 3REQA 1QNQA 4IG2A 2PWHA 1OD8A 4CD7A 4DF0A 4UNLA 4LS0A 4S2BA 3PZ9A 3SURA 1KQZA 3UR5A 3J7HA 3AYRA 2BXZA 1SZNA 3EMZA 1CPUA 2PZNA 3U7VA 2WMGA 4K7VA 4JKKA 1UROA 4AZCA 3QY6A 4GE8A 9RUBA 4AXNA 2ISDA 3VKKA 1EHNA 4WXZA 3GDBA 4CQ9A 4FLSA 4N7QA 3N14A 1F6PA 1P7TB 1Y5VA 1X6LA 2WC4A 4WJXA 3HURA 3CUFA 2B7NA 5CC7A 2D2OA 5IBXC 4IXHA 1WE5A 2CWNA 1DJGA 2ZBTA 3AQUA 4PMJA 3T78A 2FZ8A 1P0EA 1LOQA 2NVAA 3TH6A 3W7RA 2INEA 1TWWA 3OGRA 3H22A 4M80A 4J1OA 5HBFA 2WSYA 1LCOA 4EPEC 2V67A 2ZZ1A 5CZ0A 3GM8A 1OYAA 4GYPA 3TTYA 3GHSA 3WH7A 2WMIB 1A0DA 1XINA 1TA3A 2QCMA 5DMMA 4JTJA 2P3ZA 4JKMA 3MUIA 3AI0A 4PB4A 3IJLA 1QO2A 4Y8FA 3MY9A 2DVTA 1HZYA 4QSHA 1FWEC 3GUWA 3QYSA 3FXGA 3G8RA 5AECA 2J7DA 4QS6A 1OIFA 3EX6A 4JTSA 1F3XA 3NPWA 4KBXA 2A3EA 1G4TA 1UWSA 1SMAA 3GVQA 4CNOA 3HFTA 4E4PA 3MZNA 3NUKA 1GG0A 3F1QA 4W85A 1ZQ5A 1UP0A 4OU1A 3Q2DA 5C9UA 2WVTA 1LRTA 3TYCA 3VNZA 4JDBA 4XD6A 4Z2IA 2WZMA 2XIOA 4FMVA 3GXFA 3L2LA 3AS1A 4XQ6A 1HKMA 3PZVA 3KBWA 1TKKA 1DJIA 5HANA 5F7UA 4C5YA 5EKYA 4W4QA 2ZZ5A 3LOTA 1ZBVA 5CBBA 2YPIA 1OT2A 1P1XA 4GIAA 3O07A 1TVLA 4HKPA 3FNDA 3KCJA 3UYIA 4LB3A 4NAEA 4DO5A 5D03A 1R38A 4HN4A 1W3KA 5IDZA 4QE5A 5FEPA 4ZBCA 2A6NA 3GKFA 3KS6A 3XINA 1VPXA 2OO6A 2NQJA 4YPJA 1HTIA 4H01A 3EA3A 4DYEA 1A5OC 4QDWA 2FMOA 1G6CA 2G3IA 2ACSA 3EWUA 3PZTA 1XLIA 1U1UA 4PTDA 4AIBA 1Z9AA 2HS8A 4EK7A 2OODA 1JPHA 2BX7A 4DUWA 2VC6A 4KCWA 1GVYA 3L12A 2WQDA 2JKEA 2VO5A 5D02A 5C9ZA 3MKCA 5XIAA 2INFA 3UU0A 2VDIA 3VKJA 3AHYA 5K3VA 1F74A 1B54A 2PWUA 2VRQA 5I06A 1MVYA 2PC8A 1DJNA 1TV4A 4P2VA 4W88A 3F5KA 3VD4A 1AQMA 4EXQA 4IICA 4E3TA 1BTCA 2VQUA 1QJWA 5H6HA 5A6JA 3P8IA 2J7GA 3B05A 3HGSA 3IEBA 2PMQA 1XYLA 1ZPTA 4QTGA 1I0BA 1EOKA 4BS0A 1DJHA 4JIQA 2OEJA 2OLHA 3TXZA 3RLVA 5AHNA 4QISA 3KOYA 2OSWA 5A6MA 2CEQA 4I5RA 2OCZA 3VDGA 3KL0A 4UTTA 4OV9A 5DO8A 5GNYA 1R7OA 3E5PA 4M6UA 4Y90A 3QM3A 3P14A 1Q6EA 3CAVA 3WNMA 3N2BA 4PSPA 4BEUA 4XO7A 1K8CA 3P8JA 2WBKA 3HG3A 4AEEA 4G7EB 4E38A 4LNCA 1KQYA 4IHCA 4REQA 2G4FA 4CD6A 2FZNA 1TO3A 3VZYA 2VURA 2F6XA 3AHXA 4LWWA 1V79A 3MV01 3M41A 2BP1A 3O63A 3MWAA 2EG7A 4HD5A 1R2RA 2J78A 3FYOA 2WXDM 2PUZA 2DZPA 4E2OA 5KEZA 3KRZA 4H9YA 1W5MA 1P0KA 3N11A 1EDGA 1DORA 1JZ6A 2HRWA 4JX4A 1EUNA 1H4PA 3KOFA 1XLAA 2CHRA 3PZMA 2C0HA 4X2PA 1TIMA 1NTHA 3USBA 3B8VA 4O8AA 3ITCA 1KCZA 1U30A 2X2YA 4O12A 1I2OA 3BAYA 3FJLA 3UYCA 3KTXA 2VWSA 4HNCA 3LDVA 3AXXA 1FRBA 4O53A 3WBEA 5M1TA 1VP5A 4ZB0A 3ZOAA 1S3HA 3L67A 4HU4A 3RM9A 2CBJA 1JPKA 1MNSA 1IEWA 2GQ8A 2PDXA 4PULA 1U22A 2DJLA 3CHEA 3BOXA 1EIXA 4FHAA 4HNTA 4NI3A 1V6TA 3KM8A 3S1UA 3WF4A 4ZA0A 1DJXA 3SADA 2Z7GA 3G1HA 4O50A 3OG3A 3RCYA 4JFTA 3LG3A 2R14A 2XWDA 1GOOA 1SW0A 3GG0A 3U57A 1XP3A 3OTRA 4M7TA 2CBVA 1TV7A 2OKTA 3ALGA 3KTSA 5GJNA 4ZQOA 3M5YA 1Z89A 3GNNA 5CJNA 1VHCA 3TOPA 4OOUA 3F03K 4E4UA 1TTIA 4RZ6A 1TCMA 1U1JA 1SSGA 3W87A 2WBGA 1S2AA 3SIMA 5HR7A 3HG2A 3NVDA 1VFSA 4B4FA 3DFTA 3VOHA 3NOEA 1R7AA 1EP1A 2DZBA 1ZZMA 3W7NA 1FFQA 3LZ5A 3U48A 2X09A 2XIMA 4W87A 2C91A 4GWEA 3MS8A 1BG4A 3L4ZA 5D8ZA 1CB2A 3M0YA 1UBSA 4L4PA 1QASA 5I2UA 1KWKA 5MKGA 2OYLA 3QQ0A 4AQLA 1PX3A 3QZEA 3GH5A 4R9OA 3TEVA 3W7MA 4PTXA 4UMBA 2YW3A 1GT8A 4A8LA 1MEHA 2CCRA 1NH6A 2CZVA 3BAXA 2WK2A 4Z2KA 1Q63A 4HPNA 2WSRA 5ECUA 3TFXA 4OUEA 2PLMA 5FOOA 4GC3A 1PXGA 3NQ2A 5KZDA 1HO4A 5REQB 1LBFA 1EC7A 3KOWA 1UD3A 4CU7A 2EPNA 2Z6IA 1LWJA 1UD8A 1OFQA 2NSXA 1VIZA 3ABXA 3C86A 4KCUA 3VI2A 1UW9A 1BWKA 1RPKA 1TZ7A 4QJ4B 1UZDA 1UR0A 1YEYA 1H7RA 3K8LA 3QHNA 3O6YX 1KM6A 4WKFA 1UKPA 4RLIA 1M01A 1UR2A 2WMKA 3I3BA 4XTDA 4OFCA 2DSKA 3AXIA 4Z2GA 1XDLA 3ZM8A 5DMLA 4C6NA 4HSOA 4D9PA 3HMJG 4A3UA 3QRHA 3WENA 3ARWA 5LA2A 4ASTA 4AFYA 2WSQA 4Q4SA 4PMUA 2XVGA 3OG2A 2OZ0A 4PCPA 5T26A 3B9AA 1BXBA 1V08A 3SQMA 3WF1A 3RR4A 1PDYA 7A3HA 3N15A 2W91A 2BZNA 2NV1A 3VNIA 3CYVA 4Q8PA 3QHMA 4X9SA 3IIVA 5ABHA 2BSLA 2A6LA 5DANA 1C92A 4XZIA 1MWOA 3A23A 3V5FA 2B4GA 3RHGA 1UR8A 1ITCA 2YCJA 5B7YA 2ONEA 2Y6ZA 3WLPA 1EPVA 4MVAA 4GJIA 4US6A 3SRDA 3P6LA 3B4YA 3N2OA 1QO5A 4HK6A 2G3JA 2ZRZA 3CL8A 1V3IA 4HYWA 4JFVA 3ZLFA 3DFPA 3EX2A 3S3GA 3S5YA 3ARZA 4YTSA 4HNUA 3STEA 1I8JA 2HJPA 5CXPA 3G5EA 3K8MA 3GR8A 4D6DA 1DHKA 1SO5A 4C6JA 1LG1A 2FHFA 2HV5A 2Z2UA 1FWBC 4LS2A 2YFOA 1JG9A 3CLWA 4YWSA 1Q65A 2VGGA 3GW0A 1N82A 2Y88A 5REQA 3TV8A 1Y5WA 1XL9A 2HK0A 4N02A 4NZ5A 5F4WA 4P7NA 1VBRA 1HNYA 3AIQA 1BYDA 3VCCA 1GVOA 2PLKA 3GS6A 4GUJA 3BK0A 3BSMA 4PTNA 1O5QA 3QTGA 4AIEA 3KHJA 2OGYA 2R24A 3N34A 5M2FX 2GJNA 1AQFA 4NZCA 5TAOA 2XIIA 3KP0A 5FEZA 4I9MA 5AOUA 4DLFA 3SRKA 4MZ8A 1D7KA 2BODX 1AODA 5I6SA 3C61A 4QEEA 1X7FA 4KCVA 4R53A 1V6YA 3CK5A 3O3RA 1ELSA 3RUBL 3N6QA 1EC8A 5BOOA 2FH8A 5DMNA 3AZSA 3MI2A 4XB3A 3CZKA 3LSBA 3G1DA 2CW6A 1XRTA 2ZYFA 4BF5A 3NQGA 1VEOA 2DZTA 5LA1A 3NPXA 1UD2A 2W61A 1FHUA 5G4HC 1O5KA 1E9IA 4JTCA 3TSMA 1E3XA 4JTEA 2AAAA 4UQEA 4DY1A 3W29A 1XIEA 4PSRA 2OLSA 4N9CA 3TN4A 3L0GA 3WMSA 1PBGA 4IIFA 4OUIA 3AMGA 4MKSA 4Z1DA 4UFIA 3W7GA 5I02A 4D8ZA 3ELFA 4FZIA 2O56A 3UD6A 1I75A 3BVJA 2YW4A 4RNHA 2ZVRA 3IUIA 4WGHA 3WMLA 2X1IA 4G8TA 3HPSA 5EBUA 1Q6OA 1VLWA 8RUCA 4ML4A 1SSDA 1PZ1A 3T81A 1DIEA 2YYUA 3WDPP 1MW2A 2BMBA 3CL6A 2J27A 2DFAA 3ME3A 2WANA 4Z08A 3BLKA 4B15A 1W0MA 3BW2A 5DRIA 4AVNA 2HZGA 4FXJA 1TPEA 3TVAA 3MTWA 5LIKX 1CB7B 3WDIA 3O1NA 4JTAA 4QS5A 3KRBA 4WSJA 3AWNA 4XVEA 3RJXA 1PS9A 4F9DA 4H83A 4F48A 2X16A 3F4DA 3OA3A 2BWGA 3VDAA 5EA9A 3OA5A 3GNRA 4IQEA 4GG9A 1XXXA 3TJLA 2ZZ7A 1W1ZA 4HSNA 4P61A 4KGJA 1W6TA 1A0CA 3BAJA 2YZ5A 1TPC1 4GYFA 3B0UX 2C14A 1ICQA 1NDZA 4FLRA 2BVDA 3WF3A 1EL3A 4MHBA 3TONA 1K6AA 1VJSA 2FPTA 3K5XA 3VMPA 2Q01A 3C5QA 3LEPA 1F4HA 2QEZA 3QY8A 2R1KA 5A8MA 4IQJA 2FZDA 2J8TA 2I5QA 2ON3A 3HIJA 3N4EA 2ISFA 3PJTA 3F5JA 1GZ1A 3RU6A 4TIMA 2A4AA 5JUVA 1DJZA 5AHFA 3TP4A 5PTDA 2VM8A 4WSHA 1GVIA 1EP3A 3HU7A 1S5NA 1A80A 2FHCA 1FWWA 2XFFA 2QCFA 4QJ1A 4HU8A 3E2SA 4W93A 2YGYA 3S5OA 2OGJA 3WQ4A 5FACA 1Z48A 2PTDA 3LI1A 3ITLA 3RO8A 2GSHA 1JCMP 3U2OA 3CT2A 3W2UA 2F84A 4US5D 4AEOA 1CGVA 2QCEA 3UXKA 1MDLA 4QR6A 2E6YA 4L1GA 2Q09A 3WQEA 4MNLA 3WNKA 4YMZA 3E2QA 3K30A 2NXGA 2GJXA 1SO6A 2GSEA 3N18A 3GNDA 1RA5A 1PV8A 4O1AA 4RW3A 1S1RA 3BXWA 1XFCA 3R2GA 4CN1A 3R13A 2RDUA 1JI1A 1OZQA 4HZ6A 4IMEA 4GNVA 4QJ5B 4L64A 3BH4A 1IXNA 2BY3A 3K8KA 2DZXA 3MBFA 3CZJA 4MWAC 1XBZA 1JCTA 1JXJA 1V3LA 3R8HA 4KKXA 1ZP4A 4M81A 3DCPA 3GAKA 3OODA 2Y5SA 3QPYA 1GYMA 4M56A 2P5NA 4CLMA 3VO0A 2E7FA 3AXMA 2GGJA 3ITXA 2BXVA 1DYSA 1RPXA 3N12A 4EPBC 4DWSD 3HQ1A 2QKFA 3NR0A 3VGBA 1KW1A 4NILA 4EAYA 1EGZA 5DLCA 5A3HA 4XSLA 1H62A 1R9ZA 1F73A 2NUYA 5JH1A 2PDFA 4I6VA 4K1GA 2H3DA 2GLKA 2J62A 1J93A 1GVRA 4LUTB 1SQ7A 3AUOA 5FESA 4FSAA 4PTMA 3CHCA 2J75A 1F4AA 3SFKA 1JZ5A 3VIHA 3Q58A 1GVSA 2UV8G 2NX9A 4JX5A 4S3JA 4AF0B 3H24A 3A21A 2QLYA 3UJ2A 1MFVA 3WD4A 1E6XM 4GUGA 1VYSX 5AKQA 3FHAA 2YJQA 4M6PA 3MUAA 1TX0A 3MCOA 1X96A 5CAHA 3WY1A 5F4XA 3O6AA 9CGTA 2CLIA 3QV8A 2AL2B 5G1YA 3PR2A 5AYYA 3PWAA 2QPUA 2PLJA 3DI0A 4NZJA 2B81A 3N4FA 1N8FA 4UTJA 4ZQMA 4LT9A 2AL1A 1FH9A 1TJ1A 1WXYA 3ITVA 4Y2WA 7PTDA 1SGJA 1YLVA 2P50A 2QJMA 4ICMA 4AD2A 4G1KA 1TMHA 2R6OA 3FOKA 1DWFM 4OQVA 2E4TA 4GUIA 2WHLA 1E4MM 4MB1A 3V16A 5FI8A 5CPNA 4HBKA 2ZZ4A 3SJNA 3W84A 1W3TA 2CKSA 3CUIA 2DP3A 4FNQA 4NHVA 3VKBA 4CN4A 2XM1A 5HNTA 2WM0A 2QZRA 4O4VA 2CZDA 2VC7A 1KKOA 4AMCA 5LIWX 2HE8A 4Z2HA 1HJXA 3C0LA 2WHKA 2WJEA 4BI6A 1S38A 5C71A 3WQPA 3C3UA 1Q5MA 1HJVA 4MNMA 1GUVA 1EWDA 3TJ4A 5CJMA 2VEPA 2WHJA 2QF8A 4P7RA 1TPB1 1XQLA 4IIBA 4I9AA 3W26A 3DGRA 3LB0A 1XKJA 5AC6A 2GDQA 4C90A 3LHUA 4PTVA 4ZO7A 1KFBA 3EB2A 4MY8A 2EPKX 2V82A 2Z1KA 2NQLA 1NOFA 1JZ2A 5HMFA 1JIBA 2BFGA 1SJAA 2ZWYA 1QOXA 5CZTA 4XX6A 1A5UA 4DBEA 2NUXA 4YLWA 2RAGA 3LBOA 1B3VA 1XC4A 2CLOA 2IQDA 4WUIA 4UTTC 4FOUA 2NV9A 1KFWA 1ISZA 5H2ZA 3DEQA 5FL0A 3UBPC 2OQHA 3JR2A 1J0ZA 4NY2A 3D3FA 1A4MA 2OKOA 1H11A 3LRKA 4K39A 5C7HA 1DJWA 1OCBA 1RBLA 3UZZA 3WO8A 2PGEA 3M0KA 4G56A 1J6OA 3IRDA 4P5UA 3S2CA 5F2MA 3I6EA 1NF0A 3SGUA 1LBMA 2X41A 1XRFA 1LLOA 1LJYA 1P6BA 1KFEA 1IZJA 1QCWA 3STPA 5HJLA 2BGNE 1RLDA 4AWEA 4L1XA 3FHQA 1VH7A 2PE4A 2VQTA 3MC5A 2OVLA 5GVJA 5ABEA 3AIRA 1CNVA 3DZ1A 5BU6A 4X2RA 1QUMA 1UYQA 3W7KA 1XIJA 2HVMA 4CCEA 4CKQA 3OHMB 3UZXA 3IJ9A 4A8RA 3THDA 1TPFA 3VNKA 1QW9A 2PTWA 3TSDA 1VFTA 3DBNA 1H0IA 3T2OA 5LSMA 2EO7A 1BVZA 1KBLA 1HP4A 1BG9A 3L9CA 2XIQA 3M0VA 1ZTVA 3OGSA 3QJAA 3GIYA 4GZJA 1VGAA 4ZMGA 2QDHA 5LNRA 3WLSA 4D8LA 4YS1A 4AW7A 1J18A 2PRHA 3HN3A 2EEXA 3UWUA 3S2MA 3VC6A 3WJYA 5A94A 3AZRA 4UR8A 1K8YA 2VZUA 3U4FA 4GNKB 4H04A 3NSNA 3V18A 2QUMA 3TK7A 2WYSA 4UMAA 4F2TA 4AD5A 4WRHA 3QZAA 4A3RA 4GA8A 4JYDA 2X0YA 3IJ7A 3KLLA 2O9PA 4DPPA 5T9BG 1AJZA 4S38A 2R8WA 1QTWA 3GO2A 2J79A 5HINA 4HPHA 4XKYA 1J0HA 1KKRA 3GFXA 2VKZG 2ZUSA 4XD4A 5ENLA 1UD4A 3W7EA 1F07A 4Z1AA 4TVUA 4P8VA 2W5FA 3S1VA 2PDQA 1JF5A 1XCXA 5IRPA 1G7UA 3EDDA 1YDOA 2QAFA 1JCXA 4QX4A 1I4NA 5EU9A 7ENLA 1CGXA 1XHGA 3MMWA 3W1MA 4DB7A 1ALDA 1Q6GA 4O17A 3VIJA 4EAMA 2D0GA 4QJ3B 3VILA 1GQLA 3NDYA 2V5JA 4RE4A 4EXAA 1K03A 1K8XA 1B3XA 3LLFA 3W1NA 3TAOA 1AA1B 3S46A 4HN8A 4PUDA 4QP0A 3TC7A 4GBDA 2WPBA 4N6FA 4ZFMA 1SFTA 1OC6A 4U5IA 1XGEA 1DPMA 2G4JA 2QAPA 3UWYA 1V0NA 3H55A 5LHEA 3NSMA 3N4AA 2E0PA 2FMNA 2D2GA 2Q8XA 3MU7A 1CEOA 2PBGA 4H9TA 3UCQA 2ATMA 3HGJA 1XDMA 1X1ZA 4CU8A 4W5UA 1V8EA 5A2BA 5I77A 4KFPA 3STFA 1A5KC 4KS0A 2BB0A 4J28A 4F4RA 1G7VA 3SDOA 2YDRA 4F9JA 1EPXA 4LUSA 5DELA 2E67A 2L5HA 2PAJA 3AFBA 1N8WA 2OQYA 4C6LA 3IANA 3NQ8A 2YBUA 3TXVA 2GJRA 4JNZA 4V2XA 5U4NA 2PU0A 3Q65A 1DQWA 3RPDA 4C6DA 3ARYA 1JRBA 5G2HA 3GC4A 4ECLA 4K38A 1VFLA 1H1NA 4RNFA 3PS7A 1HX0A 2VJXA 3MO4A 3AYSA 4JDYA 3HV9A 1XH0A 2EG8A 1WP6A 1XSIA 4LF1A 3E6EA 2DT3A 2GOUA 2VUNA 3P2VA 1VFUA 3W38A 1PVNA 3TN6A 1K8ZA 1V5XA 2XYLA 4AZHA 1X8CA 4PMQA 4EP8C 4OHQA 3NXFA 4PBFA 4GOAA 4H19A 1KM2A 3S4TA 2RDXA 1AZ1A 4FNTA 1XX1A 3CMFA 2XZ7A 4ZOAA 3GDLA 1KCLA 1WUEA 1X1OA 2A7NA 1W5NA 1TWSA 1OFBA 2I5GA 4H6EA 3HOJA 1AMKA 1XIIA 3MHUA 1BD0A 3AICA 4GJJA 3BPWA 3VNLA 4AZ7A 2NXHA 2XFYA 1R9XA 1XYZA 1W91A 3CM4A 1UQZA 3VIKA 4WQ6A 5E0FA 3VX1A 1TE6A 2WJDA 3SCTA 3QQ1A 2Y5EA 2YCKX 3OW1A 2OXNA 3LBMA 1G67A 2EPHA 2Y8KA 3SGZA 2JEQA 3KOZA 1S2WA 3AXHA 1SJCA 2IKGA 4JZ5A 4Q8UA 4L56A 4DUVA 4JFSA 3WH8A 1C9DA 2YX0A 4A2RA 2XIBA 4LRTA 5C70A 2XN2A 3WLTA 2VL4A 2ZA1A 3SCOA 3EMQA 3LHZA 3VOIA 5MKGB 1SZFA 2WJFA 3PC0A 1NIUA 1EGMA 1TZZA 3AISA 3NQBA 2PLCA 2RUSA 1UWIA 4M8UA 3VKAA 3W27A 1VS1A 3MA8A 1POJA 1TMQA 2JIEA 4PZVA 1YQ2A 5BOFA 4ATWA 5K9DA 2PWVA 4UTWA 3B8SA 4CNPA 5EL1A 1VBHA 4GCAA 3FDKA 3QBUA 4C6IA 5J04A 4MZ1A 7TAAA 1Q6FA 2J4GA 3QKZA 3TNOA 3MHFA 4O1EA 2PGFA 2V81A 4IL2A 1EGVA 4H8HA 5AHMA 3GQYA 1OVDA 1UMYA 1IXOA 4IH3A 2ZX6A 4EXBA 2X40A 2DW7A 4PUKA 4Z0SA 4H3DA 4HA4A 3UR8A 1KTBA 4D2JA 2BOFX 5F2GA 4E5TA 5K2ZA 3GTIA 4BR1A 3DKJA 2HK1A 2MANA 3NQVA 1S5VA 3WNOA 3RF9A 1QRQA 3CHVA 3W7JA 4C6BA 3EGJA 3R12A 3AMDA 1G94A 1E6NA 5U7SA 4QFUA 2WWDA 1FTXA 3D3AA 4WD0A 1OGSA 2G3FA 4C6FA 5JBEA 4AG0A 3EA2A 4JY9A 2FFCA 4KEVA 1FWNA 3BO9A 3I10A 4HCHA 5CSUA 1GTHA 4F2UA 2IXVA 4DJED 4J3SA 2XSXA 3OZMA 1DIDA 3GUGA 4L4MA 4KGLA 2VYOA 3RCMA 3IGUA 3WQWA 3L5AA 5DY2A 4U28A 3UY7A 4CD5A 1OYBA 1PUDA 3ZZ1A 3PVFA 4LBRA 4FEZA 2X1RA 4MY9A 4E2VA 5HPOA 2QJIA 4HA1A 4XZMX 4ZXLA 3NFUA 3EDJA 1WOBA 4F8XA 3IVTA 3P60A 7XIMA 2E5CA 5KTLA 1XCFA 3DYPA 3E96A 4C1LA 3UCCA 3BQ5A 3C2EA 2O9OA 3SQLA 1YTEA 3SCQA 4QQ3A 3VDCA 2VX5A 5CZKA