2E6DA

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with fumarate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
312
structure length
312
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Structures of Trypanosoma cruzi dihydroorotate dehydrogenase complexed with substrates and products: atomic resolution insights into mechanisms of dihydroorotate oxidation and fumarate reduction
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
total genus 105
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2e6dA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2e6dA01
4CNOA 4RZ5A 5DCBA 4MYAA 3LTSA 3CB8A 1FWTA 1DJNA 3UWWA 5F2LA 1BWKA 4N4PA 5G2IA 1I2RA 1KFLA 3NQEA 3B04A 5K7JA 2ZBTA 1I45A 3M5XA 4NQ1A 3WJXA 4OGZA 4JIPA 1TYGA 4O15A 3HPZA 3HPSA 4N9CA 1H7RA 4JTEA 1N55A 1OABA 4FIQA 4LC8A 4GUFA 2VEIA 4IMEA 4X22A 5K4XA 3NQAA 3O6YX 3RMJA 2Z1BA 2E5BA 3DBPA 4WX2A 1XCFA 3TXVA 2H90A 3NO5A 4ZQCA 2CLHA 3G1XA 3LRLA 1W31A 5U7SA 3STGA 5BOOA 3GAYA 3P8JA 4R34A 3O05A 1YPIA 3LCHA 5F2GA 3NQ2A 3THAA 2V8ZA 4S1FA 3R8RA 3S6DA 3QPZA 3NL6A 2JK2A 3TQKA 1G4TA 4P2VA 5C6MA 1OFQA 3DENA 6ALDA 2Y62A 4K8HA 4ZMGA 3QMRA 4FX8A 4HSOA 4NNAA 1QNVA 5DXYA 1P4CA 1ZFJA 2RDUA 1X1ZA 4H3DA 3W1TA 3P8IA 4MVAA 3WJWA 2ALDA 1BEUA 3PSVA 4NJGA 2CZDA 4FIRA 1J2WA 1EX5A 3A22A 4FNTA 4JEQA 4MLRA 3W73A 5F1VA 2ISVA 4ZQNA 5AHNA 1F76A 3A23A 1W5PA 4OHQA 3P60A 2VEPA 3BGGA 2NXGA 5T26A 1MEIA 3USBA 3C0JA 5AN7A 4ICNA 5CZTA 3F1QA 2G96A 3S5ZA 4TMBA 1BWLA 3G3DA 3LXAA 5ABTA 1O95A 3FJ6A 4IPIA 1LRNA 3W76A 1XXXA 3QRHA 4UTTC 5A8GA 4MFDA 5HQEA 4JDBA 3W7NA 5C55A 1ALDA 2VC6A 2NV2A 1TTIA 1B9BA 3EX3A 3PUDA 4N6EA 2NWRA 4JS3A 5AHMA 1Z44A 3W1MA 1T99A 2H8ZA 2NWSA 3GYEA 3HBLA 2ABBA 3TKFA 4E38A 3W7QA 3UY8A 1L2UA 3LCWA 1AW2A 1WV2A 1I2OA 4JTHA 4N9DA 1DBTA 3NQ8A 3TNOA 3UZ5A 3ABQA 5LNUA 4HPXA 1GVFA 4NUWA 3ABOA 2QJHA 4WXYA 3WK3A 4IXHA 3MP4A 4IMFA 4FNRA 5EA9A 5D2YA 1K8ZA 1Z48A 3B0PA 5LNRA 5LNVA 1C9DA 4Q32A 1PHWA 3U8GA 1QPRA 3QEZA 3EXSA 4BF9A 4JICA 2Y7FA 1I8JA 2F7FA 3L67A 3UNDA 3KVJA 3W1RA 3IIXA 2A6NA 5DXXA 4CQ9A 4S2CA 3ZWTA 1P0KA 1SPQA 1S3HA 4Z1AA 1G67A 1ME7A 3C6CA 8TIMA 4MKNA 4N9EA 4K36A 4DEFA 4O18A 3EWXA 2FFCA 2R8WA 3DGRA 3LX9A 3FYOA 4JTIA 4JTTA 1TV7A 5DBTA 3GDMA 2ZZ1A 5DLCA 3UD6A 2CLKA 5F4XA 2OT1A 2QCFA 1HO4A 2JGQA 4JR5A 4UFHA 4TO8A 1HL2A 4KFNA 3WFAA 1FX6A 1TREA 4X9SA 3W88A 4NZJA 2GVJA 3UWUA 4R33A 3PS7A 1EB3A 2BSLA 3W85A 4ZQPA 2I9EA 2DJLA 5C54A 2XN2A 1IF2A 4HNNA 4YL2A 3ABSA 4FX6M 1ME9A 3S1UA 1RQEA 1FBAA 4WOQA 1SZFA 5BMXA 3G1FA 3S0CA 4CCCA 1OG0A 2G5WA 3Q37A 4GRSA 1Q6QA 1M5WA 4UCGA 3NDOA 5AYZA 2VOMA 4JTLA 1SO6A 1W54A 5EKYA 5I3JA 4IJBA 1ZY9A 3T40A 3BO9A 2DZPA 3CT7A 3GAKA 1RQBA 4PL1A 1D3GA 1WX0A 4GNJA 3DFSA 4M7TA 4Y96A 3E0IA 5LHFA 1OFOA 3DKLA 2WOQA 3KFTA 4EF8A 3P80A 4TIMA 1K02A 1MXSA 3SY5A 1QPNA 4E2BA 5AHIA 2C3ZA 5DCDA 3W2LA 5HWNA 5LGXA 4NNBA 3W84A 3KVKA 3G3MA 3W2UA 1I2NA 2E6AA 3MBDA 3TCEA 2UV8G 3FIGA 3GXTA 5G2HA 4UMCA 4GJ1A 2FB2A 1FUYA 3IVSA 5A5WA 1MEWA 3PUEA 1OFPA 2NLIA 4JIQA 3E9AA 3BW2A 4A22A 1W8SA 4JTJA 2Y6ZA 5D2WA 1FCUA 3QYQA 4LTSA 5FF7A 3BK0A 1H7XA 3MHFA 1IIHA 4O4VA 1GJPA 5CSSA 1H60A 1FCVA 4HSNA 1PCKA 5LSMA 4I9AA 4XTIA 2A7RA 2J24A 4XQ6A 3LHWA 1SSGA 3PG9A 3LBCA 1AL7A 2QCCA 3SJ3A 3OG3A 2Z0IA 4MLJA 4AWUA 3QFEA 1OFRA 3W1XA 2A85A 1YTDA 5LHEA 3WJSA 4KWVA 1KM6A 1GYLA 1P0NA 2QF7A 4WZHA 1W5QA 3BG9A 1JUBA 3SZ8A 4O54A 3EWUA 3TXZA 1WOBA 1YYAA 1SZEA 3TROA 5F2IA 1TPB1 4GUHA 4OV9A 2HTMA 5KZMA 3L66A 1CX9A 3JR2A 5KTLA 1XC4A 2ZA1A 4JYFA 1BTMA 3G24A 5I3IA 5DELA 3KRUA 3W2KA 5IBXA 3HGSA 4NJKA 3MO7A 3S42A 2WNQA 4HT3A 4DBEA 4LRTA 2V82A 4CNPA 1H1ZA 3G18A 3DAQA 3NA8A 4AF0B 1X7FA 4DBDA 1O94A 5I3GA 5CKSA 5HWJA 3RLVA 1YDOA 4LC6A 3EX1A 3SI9A 1XBZA 1QO2A 2A6LA 1F73A 3W7MA 4LOCA 5FF0A 1GOXA 1PL9A 4K6AA 2B7QA 2A0NA 3G22A 1JUEA 4UTJA 3NQVA 2PURA 4UTTA 1N8FA 3DFNA 4BI7A 1SO3A 1H51A 1VJIA 2YXGA 3C2VA 3DFOA 3OEXA 2ISSA 3FOKA 3G1HA 2DU2A 5CPOA 3PUOA 2YZRA 2NX9A 2C15A 2A5HA 1GVSA 3A9IA 1JCNA 1LP6A 2NV1A 3I7RA 1S5TA 4JX4A 4OT7A 4WY0B 2Y88A 4HHPA 3N73A 1LOLA 3CPRA 2GQAA 3KRSA 1FDYA 1PS9A 4J9JA 3W70A 1F05A 5L6UA 1DQWA 4OWGA 1H61A 4Y6GA 3BG3A 2FPYA 4POCA 3LI1A 3NQ7A 1LROA 4JDYA 1F74A 5EYWA 1MZHA 1Q6OA 4IQLA 3M5YA 1QMLA 5D30A 5K9XA 1LCOA 3UWYA 1LLZA 3QZEA 3KVMA 3TSDA 5C5YA 3B06A 5BW6A 5F4SA 2V9DA 4O0KA 3TSMA 3IGUA 4C1LA 1ME8A 3PBWA 2WQPA 1OX4B 1UASA 1Z42A 2NX3A 1XBXA 1WYIA 4AMAA 4GWEA 3M0ZA 3SECA 4X2RA 2C13A 4ORIA 3NQMA 4QAIA 4UFKA 5TIMA 3GK0A 3CC1A 4JY8A 2GOUA 5CZ0A 4ZVJA 2E77A 2C0AA 3H53A 1W37A 4AVFA 3UY7A 3BG5A 4IPJA 4LY8A 1F6KA 1D9EA 3MI2A 4IWWA 2VKZG 3O6DA 3PY2A 3UWZA 1VQTA 3A5FA 4ADTA 3NQCA 3EX4A 4PCFA 2ZA2A 5H91A 3AO0A 5CPNA 3GDLA 2GJLA 1RQHA 3TFXA 2JKEA 1V5XA 1YDNA 1KM4A 4OV4A 5FI8A 5KINA 4O17A 5G2WA 1OHLA 1OF6A 2TMDA 1K7XA 3KHJA 5U4NA 3EWYA 1NF7A 2FIQA 2OMAA 4GUJA 4LS1A 2E09A 3P5ZA 2RDTA 1KTCA 3HMJG 3UQNA 5DN1A 3TW6A 2JKAA 1VR6A 3RLUA 2FLIA 4AHOA 5HUPA 1SZNA 3W7OA 3MWAA 2GQ8A 3NQ6A 3W71A 1LM1A 3TMLA 4A21A 3QSTA 1TTPA 3WK2A 3PSWA 1A5SA 3DFQA 3DXIA 3O07A 4R53A 4PODA 2YW4A 4EOUA 3IVUA 4LT9A 1QAPA 3L0NA 3TC6A 3W86A 1WDWA 4EVZA 3BW3A 4NX5A 1JUKA 2X1RA 3EB2A 3UZJA 4AEOA 1RVGA 4Z08A 3VI2A 3C2FA 2ZYFA 4AAJA 3LCGA 1JCJA 1XKYA 4IX0A 1VZWA 3W1LA 4FNSA 1VHCA 4DO5A 1G7UA 4NJHA 1GZGA 3HG5A 2EKCA 4XZ9A 1Q6RA 3GKAA 5D33A 4LNYA 1UCWA 4TMCA 3DU0A 2BWGA 4MFEA 1KV5A 4I7UA 3KOFA 2HSAA 1B3OA 4LS2A 2WNZA 1DQXA 3W6YA 1KBJA 2QCNA 1M7OA 3QQ1A 1EUNA 3W74A 4LVAA 1TPC1 3SIZA 1SUXA 3BW4A 2C18A 3TMQA 3UXDA 3GLCA 1FCBA 3AJXA 5D32A 2H6RA 2VFHA 3GDKA 3I6RA 3QW4B 4QISA 3OVPA 5K9DA 2NUXA 2BXVA 3P84A 1TRIA 2D73A 3UWQA 1OF8A 3NOEA 4NVTA 2RHGA 1X6UA 5F2MA 5IBXC 4K39A 5FEZA 2J9YA 3LCXA 4DPPA 3OHIA 1SU5A 4KFOA 2Y89A 2YGYA 4IMDA 1GVRA 3UXAA 1FWRA 3O6CA 3I68A 3S1VA 3W7JA 3C56A 5FEWA 4XBKA 3NPXA 4UNKA 3W9ZA 4LRSA 5EMUA 2R91A 3TU9A 4ZQMA 5E0KA 1G69A 1DV7A 4K7YA 4UC5A 4YXGA 4RX0A 2WSYA 3CTLA 3FLUA 1L9WA 3LHYA 3SGUA 1GEQA 3NPVA 3B0VC 2A2IA 4UTWA 3Q58A 1S5WA 2QEZA 1SW7A 1OFAA 1VLWA 5CGQA 3W22A 4ADUA 3LLDA 3VE9A 4DELA 1ZAJA 3IRDA 4GE8A 1W56A 4O0ZA 5CPLA 1H62A 4ADSA 1KLZA 1G6CA 1ZALA 4WOZA 1PIIA 3E49A 5D03A 3W07A 2B4GA 1TPFA 1KA9F 3E96A 4GUIA 1H7NA 2QUTA 1Q6LA 3W7EA 3FS2A 4MZYA 1A53A 3PB2A 4FNQA 4O11A 4Z1CA 2CZ5A 1VGAA 5KZDA 4JN6A 1UBSA 3C2OA 3B0UX 2QCDB 2NUWA 4LV9A 1JR1A 2Z6JA 3N19B 1IXPA 3PG8A 4M19A 2BZNA 4IOTA 3PBYA 2WNNA 1JQVA 1XM3A 3FKKA 3LXBA 3P61A 3CM4A 4AF0A 2NXHA 5KSWA 3GDTA 1KLYA 2V5LA 3GR7A 2ZZ5A 3VFLA 4HNTA 3W1AA 4NJIA 3EKLA 4K38A 3NQDA 1XBYA 4WUIA 3NZ1A 1NVMA 3M44A 2QCMA 4YCPA 2GVLA 2QUVA 2V2HA 3QC3A 4UTUA 3BLIA 1TJRA 2QUUA 3RK8A 2ZCGA 3PC0A 1XUZA 5I3KA 1VH7A 3V1PA 4ZZ9A 1LBFA 4FNUA 3HIJA 1LRTA 4EWND 3S9YA 4M6VA 3P81A 2ZRWA 2VFDA 1TPWA 5AC7A 3JRKA 4WY0A 3TDFA 1W1ZA 4O16A 3W7PA 1VC4A 1QDSA 1KM2A 1HG3A 1LTDA 4DPQA 2RDWA 3LRKA 1R46A 3NXFA 4AH7A 3IV3A 3HO8A 1R2SA 2X1SA 1L6SA 2WSRA 3NL3A 1XI3A 4RZ4A 1H63A 3F4WA 4CQAA 3HQ1A 3HGJA 4DF1A 1I2QA 4L4MA 2Y61A 3HOJA 3DHFA 1CW2A 3DKJA 1XDMA 4UR7A 2P1FA 1QWGA 2QAPA 1WOAA 2X16A 4IUOA 5AB3A 2Y7DA 2IQTA 3CU2A 1VCFA 2TYSA 1THFD 2B7PA 1KM5A 3DFPA 5D2TA 2W79A 3GNNA 3M7WA 3GX9A 4QIUA 3BLEA 3OA3A 4UFMA 1OYAA 1Q45A 4RLIA 1UUOA 4GUGA 5D05A 1OX4A 3KXQA 1SO5A 4WJEA 4O12A 1JVNA 2Q3OA 1OFEA 2OJPA 1VCVA 3R5EA 4PL2A 3G1AA 2DZUA 5EY5A 2QCLA 1TV5A 3MP3A 1NF0A 3FJLA 3N2XA 1W5NA 1O60A 1K3UA 1TJPA 5E93A 3G1VA 1RPXA 1BKSA 3VKJA 4XUGA 4E2DA 1VHNA 4PA8A 4O53A 3NL2A 2ZZ7A 3W7HA 2YR1A 3S1XA 1JJKA 4IX2A 3CWNA 3O63A 3GXNA 3MMTA 1WBHA 5IM51 4UFJA 3QSRA 4FNPA 4FB7A 1HUVA 4Z1DA 3W87A 2C1HA 2J9XA 3L2IA 1O4UA 4M6PA 1L6YA 4BK9A 3A21A 4C1KA 2QKFA 5DCEA 1C8VA 1ICPA 1TO3A 4UTKA 4FEZA 4CQ8A 2GUUA 2HS6A 4O10A 3TAKA 1QO5A 1YTEA 4QNWA 1M7PA 1X1OA 1GT8A 1CI1A 2QDGA 3CWOX 5G5IA 3RU6A 5D2XA 3W72A 4RXFA 5K4ZA 1W5OA 4NXKA 3QJAA 5CSRA 4IMCA 4JGDA 1GVOA 1TTQA 5G4WA 1I4NA 2YPIA 4UFIA 1R47A 4UMAA 2QCEA 2VFIA 4U28A 1OYBA 2A7PA 1A50A 3HG4A 3L5LA 4U4MA 1K7EA 2VFGA 1W3IA 1QOQA 1B4EA 3GVGA 4JTKA 1WAUA 4O1BA 4UTWC 4JTUA 4MZ8A 1GYNA 1RZMA 1XFBA 3U6WA 4KKXA 3NNTA 3EXRA 3O16A 4OQVA 4A2SA 3DZ1A 3HGRA 4Y90A 3C3NA 4JY9A 4CLMA 3N9RA 2QCHA 4RV8A 1JRBA 1QFEA 4A2RA 3INPA 3B4UA 1LOQA 1H7OA 1IXQA 1ICQA 5D38A 3N14A 2NXIA 1DVJA 2YFNA 3IIVA 4UTLA 2FPVA 4HIBA 1WXJA 3HF3A 4NU7A 2ZDRA 1Q3NA 3Q2DA 1VYRA 2WSQA 5TQLA 1DOSA 2R14A 4R7JA 3V75A 3DFTA 3L68A 5AFDA 3NPWA 4H6KA 1W3NA 4DXVA 1W0MA 3CEPA 4O8RA 4LUIA 3CIWA 5D09A 4MYXA 5LNWA 3OBKA 1VYSX 2FTPA 3SSJA 3G8EA 2B7NA 4O14A 1K7FA 3L5MA 1EUAA 1QOPA 2VEKA 1TPDA 3VNDA 1PV8A 1GTHA 1O5KA 3C52A 3RNDA 4BFAA 3HPXA 4E0CA 4O52A 3OVQA 3CIXA 2J27A 1FQ0A 1NEYA 1I2PA 3O15A 4A29A 1M6JA 1V7YA 1VS1A 1W3TA 1TPEA 3IIZA 2Y70A 3T44A 3C8FA 2DORA 3IIOA 2Y7GA 4Z0JA 1EP1A 3T78A 2BX7A 2E68A 3PM6A 5FF3A 1UJPA 2PRMA 2WKJA 4MZ1A 4ZQOA 3JS3A 4UNLA 3TA6A 3PBVA 1F6PA 5AHLA 4O1AA 3GIYA 4ALDA 3NQGA 1L6WA 2I1OA 4MY8A 4JX6A 4QITA 3OVRA 4RR4A 3QQ0A 1UUMA 4Z1BA 1TTJA 4CCEA 4IXXA 1KM0A 4JNMA 3BGJA 3OIXA 3NM3A 3SFKA 5HR7A 3WJZA 5BNKA 4NXSA 3W1UA 3BARA 5EBUA 2HS8A 4O1CA 1G7VA 1U83A 3BV4A 3O1NA 3ABRA 2QCDA 4RCXA 5TBOA 2GVGA 4GBUA 1QPOA 2YDAA 3W2MA 5DBUA 2EPHA 1R30A 3STEA 3QMTA 4Q33A 3P67A 4N2YA 1NAL1 2E5DA 3R12A 2DJXA 4JTSA 2B7OA 5LZLA 7TIMA 4WXZA 1JCXA 4AXKA 4XKYB 4WY0F 1TV8A 3S5NA 3LV6A 5MHBA 4DQWA 5HULA 3B03A 4O4WA 4JD4A 3LI0A 1EWEA 1B57A 4ORMA 1XL9A 5EPDA 2Q8ZA 3R89A 4Y9AA 5AYXA 4B5NA 1JULA 1QPQA 4N02A 5AYYA 2YCEA 2CLOA 2DZSA 1F5ZA 3GR8A 4M6QA 5F1UA 3PVFA 1FXQA 3W2NA 1FDJA 3TSBA 2X2GA 4RK8A 3QF0A 1XDLA 4XWUA 1ZJIA 3LM7A 3L0KA 2CZFA 3DI1A 3LLFA 3M41A 5E1QA 1VPXA 3STCA 1KV8A 3FYPA 2NX1A 1KFKA 1R2TA 4N6FA 2TPSA 3W7CA 2ZTKA 2GQ9A 4K7VA 2NUYA 3MI3A 3MI6A 1LOSA 3W75A 4OE7A 1GG0A 2TRSA 3TE9A 2V2CA 1FY6A 4UTHA 1SFJA 1YTKA 5HINA 1TRDA 3GZ3A 4UR8A 1ZNNA 5SWUA 5FEXA 4UMBA 2Y63A 4MIMA 1VCGA 2ATMA 3QM3A 4OU1A 3P5YA 1K03A 3QMSA 1SW3A 4QNEA 3MHGA 1KTBA 1TSIA 3T7VA 3PWAA 1WQ5A 2CZEA 4A3UA 4AB4A 2P0OA 3GB6A 4NX0A 4GFSA 2WV8A 3A24A 4BR1A 2AAMA 2TSYA 5LKYA 3MW7A 1H50A 4L4LA 5D37A 1X8FA 2E6YA 1XBVA 3ZWSA 4HN4A 2WJZA 3MYPA 3M9YA 4LVGA 3KVLA 2X1TA 4W9TA 3LBMA 3NEVA 4IMGA 1LDCA 4O19A 5G4EA 3NL5A 1YXCA 3C61A 1WA3A 1P1XA 2E1DA 3C2RA 3P74A 4GC4A 3LGEA 2J9ZA 1TPVA 4YWIA 4FO4A 2FDSA 1YPFA 1LBMA 3W1PA 2ZZ3A 1TB3A 2XN1A 3LV5A 3TFCA 3M6YA 3FEMA 4P61A 2OCZA 3NGJA 3E02A 1HTIA 1SSDA 3G8RA 4X3ZA 3KRZA 1DJQA 5D04C 1FDZA 6TIMA 3DI0A 3PULA 1ZAIA 2ZQ0A 4IGHA 3FFSA 1AG1O 2QDHA 1ADOA 5DY3A 4AHPA 5HR6A 3LHTA 2PCQA 3EXTA 1LYXA 4NT0A 2QCGA 1YADA 2GJNA 4NNCA 3TX9A 3L9CA 4ML9A 3N3MA 2OT0A 2JBMA 3TV8A 1FCQA 3LHZA 1ICSA 5HMSA 1FWWA 4OBTA 2DZVA 1EEPA 1LBLA 3M1ZA 2E5CA 4JXCA 1NFBA 1KM1A 1H1YA 4AHQA 2JGYA 1ONRA 2V0TA 1IXOA 2PC4A 4RKAA 4YMZA 3W83A 1OFDA 2ZA3A 2H8XA 3M43A 4M5PA 1LRQA 4RJEA 2JKPA 3EWWA 3NYZA 3BPWA 1WBJA 1EP3A 1SW0A 3SGZA 1KFCA 1FWNA 4QQ3A 4D2JA 3N2MA 3UPWA 3UYCA 2CLIA 4FXSA 1IGSA 3B8DA 2CFFA 3TR2A 2BTMA 3PAJA 4MY1A 3LHUA 3S5OA 1YXDA 2EGZA 1PE1A 4PFMA 3EKZA 1OJXA 4ZL1A 1EWDA 1GWJA 3W2JA 1DL3A 2PE4A 1YXYA 1A5CA 1TQJA 1AW5A 3EEGA 3R13A 2FJKA 5K9CA 3CEUA 3U2OA 1KFEA 4GXMA 5EL1A 1D3HA 1S5VA 4UFLA 2Q8LA 4HNVA 2QJGA 3T55A 2O7QA 3D0CA 3NG3A 1T8XA 1OYCA 4LWWA 4LUJA 4RXGA 4UTMA 1TIMA 3W7IA 2ZZ2A 3UPBA 4K37A 5FESA 1FXPA 2FPTA 3UWVA 3TIMA 5CZSA 2G97A 2DZTA 2W0UA 1GG1A 3RFAA 5I3FA 3EWBX 4LVDA 2CLEA 2OZ0A 4PC8A 4AWSA 2Z2UA 2H3BA 3TK7A 1RR2A 4BI6A 3W23A 3K30A 4LVFA 4O57A 5D2VA 2ZZ6A 3L0GA 1LZOA 1TMHA 3O8AA 2OX1A 2PRHA 4BWLA 4DF0A 1TPH1 2VEMA 3MBFA 3SR7A 5BMWA 3EX2A 2E6DA 4WD0A 3THQA 2G95A 5F4WA 4CCDA 4UXDA 5BRBA 3LOTA 1KFBA 1PCWA 1H7PA 1IIGA 3A5VA 3G1SA 4PTNA 5I3HA 5CG7A 3WJYA 1NSJA 1RD5A 1F2JA 1EA0A 4LU0A 2VFFA 3I7QA 3LCFA 4Y8FA 3NQFA 4O28A 1KM3A 4N9BA 4HNUA 3S5YA 1KTNA 3TAOA 1VRDA 3F03K 3EX6A 3E12A 2A4AA 1E51A 3M5VA 1T0OA 5AHFA 4RZ6A 3NAVA 4MPQA 1C29A 2O7SA 1YLVA 2J6XA 3IGSA 3LHVA 4WQ6A 2FB3A 3P7YA 3S1WA 1AW1A 3G1YA 1JCMP 3M16A 4XKYA 2ZRYA 1VLIA 1MO0A 5LGZA 2A1YA 3TH6A 4TR9A 3PBUA 2ZRUA 4FHAA 3W1QA 4EIVA 2ZRVA 1UB3A 2V5BA 3M47A 3PR2A 2GPTA 3W1NA 3DH7A 3W7RA 2C16A 2RFGA 3M5ZA 1XUUA 3H54A 2ZTJA 2B0MA 3YPIA 1T96A 1OK4A 4N4QA 2E6FA 5D02A 4G1KA 4BI5A 4CNNA 3NM1A 2AGKA 4Q4KA 4XTDA 3TQVA 3N34A 3BVJA 4YLWA 3W7LA 3HJZA 3ZFHA 3N9SA 4Z0SA 3QPYA 2ZRZA 3GNDA 2ISWA 2P10A 3B05A 3T4CA 4LVBA 3W3OA 4JTGA 2NZLA 5FF2A 2HMCA 5AHEA 4YCOA 3ZS4A 5KITA 2VELA 2V30A 4LS0A 3C4UA 2CU0A 2VFEA 4DF2A 1AK5A 4JYEA 1K8YA 2F84A 3NVTA 2C14A 3H55A 1SFLA 3I7SA 1Z41A 4EF9A 1KFJA 5G1TA 4UIOA 2YYUA 4MJMA 5HWMA 2XN0A 5J5DA 4I7WA 4UUIA 3HG2A 1OK6A 3NZRA 3S8HA 3LTYA 4LV4A 1LLWA 4XBSA 3F4NA 3I65A 3WK1A 1J4EA 2YSWA 4ONVA 2R94A 1GVQA 3LDVA 1DKWA 3BLFA 1SO4A 4KFPA 3LCLA 3C2EA 4MOZA 2CLMA 3W7KA 3GXPA 5HUOA 4ZQRA 3VE7A 1JCYA 5H2ZA 2YW3A 1R2RA 2YX0A 4JX5A 4QM1A 3NPUA 1DHPA 3VCRA 2ZZ4A 2DZWA 3HGOA 2QR6A 5J5RA 2ABAA 3HG3A 3TJXA 2EAWA 3CLMA 1MSSA 1OX5A 3G1DA 3G0XA 1A5AA 3Q94A 4UTIA 2J88A 1Y0EA 1RV8A 5CZJA 5KMYA 1W5MA 1YDVA 1K8XA 3IIPA 3ANYA 4PH6A 3O06A 1ZCOA 3WK0A 2X30A 2WO5A 3LB0A 3MHUA 3TW7A 2Q3RA 3FKRA 3R2GA 2EF9A 2WPBA 1TQXA 5K3VA 5AOUA 3LTPA 4NZFA 2I14A 4TU1A 3KAOA 1ML1A 3G0SA 3MUXA 5AC8A 1EP2A 2ZFAA 2CLFA 2FQIA 4MUZA 4QJ1A 3TC7A 3W7GA 4M7SA 2PRLA 1DORA 1KW1A 1JQXA 3CQ0A 3G0UA 5DY2A 2C6QA 3FA5A 4TX9A 1ZENA 4JTFA 1QCWA 3IEBA 1H5YA 1G4SA 2LLEA 1SR9A 2KZHA 1OX6A 3QW3A 4DO6A 3L21A 5K2ZA 1TPUA 1IXNA 1QR7A 1SQ7A 3RF9A 4LW7A 1G4PA 2VENA 2W6RA 5HJLA 2EHHA 5HNRA 1GQNA 1J5TA 3ATZA 4QSHA 4HPJA 2XFWA 2RH9A 3IGXA 4K8EA 3CHVA 3ZR4A 1ZAHA 3W7DA 3SW6A 2QJIA 3L5AA 5FF4A 2RKXA 2A21A 1U5JA 1H7WA 4HKPA 2YFOA 5L9FA 1ZHAA 5C2XA 3NR0A 4MY9A 5FEPA 2CWNA 2AQWA 3DHDA 2X1UA 3LERA 1N7KA 3L65A 2QAFA 4BWLC 2Z6IA 1AMKA 1HFBA 1KBIA 3IVTA 2DP3A 2Y7EA 3PF3A 2C19A 4PEKA 4MJZA 3MJYA 1PHQA 2CLLA 1OVDA 1O5XA 5KZEA 1MEHA 1B4KA 3PB0A 3LCIA 1EPXA 1AL8A 1A5BA 5G1YA 4JYDA 2Y85A 5GVJA 2H3DA 3P62A 2V81A 1VYPX 1OFBA 4H4IA 4O50A 5LNSA 4FF7A 2YYTA 3MP5A 5CPMA 2ZRXA 4FX7A 1JCLA 3ELFA 1EIXA 3EWZA 3TUUA 2ATSA 3ATYA 1TCDA 2DZXA 1GTEA 3TJLA 1G4EA 1PVNA 2A7NA 4KWWA 4S2BA 3GDRA 3TQ0A 2VXNA 2CW6A 1FWSA 4NJJA 3STFA 2V2DA 3P82A 1GPWA 3GKFA 4FXRA 2BLEA 1P5BA 1F7BA 3QH2A 5AC6A 4O13A 3LRMA 3HB9A 3MYOA 1SZGA 4DO4A 3LXCA 3KX6A 4O1DA 4AWTA 4I7VA 1JRCA 1LORA 1HO1A
chains in the Genus database with same CATH superfamily
2WMKA 3AMDA 4HYVA 3WIJA 2YDRA 1IZCA 1GJUA 4DLFA 2ZVIA 3WH6A 4J40A 2BBFA 4E2OA 3K4DA 3M5XA 4NQ1A 2WVTA 2NQZA 1KQZA 4PUNA 4PMXA 4O15A 2RGLA 2WZTA 4GUFA 3ZJKA 3VKDA 5AVHA 4HPGA 3H7UA 4WDXA 3VZYA 1D8WA 3EYPA 5REQA 2PP0A 2INEA 3DHUA 2H90A 2UY2A 3G1XA 4Z1YA 5U7SA 2HBXA 3GAYA 4MUPA 5HK4A 4ES4A 1XLBA 2E8ZA 5E9AA 3NDYA 3S6DA 3QPZA 3AIRA 3ZT5A 2J66A 6ALDA 2QVNA 3GH4A 4MWAD 4FX8A 2VD8A 1QNVA 3UJFA 3L4YA 1QK2A 3RPTA 4GFIA 3W02A 3WJWA 4XUYA 4RDZA 1BEUA 1W9BM 4R5EA 2CZDA 5EFDA 3WQGA 1QWKA 1J2WA 3VZXA 5AHNA 2OLHA 1W5PA 2WMJA 1MEIA 3C0JA 2KAUC 4ICNA 4E6MA 2F8QA 1EC7A 1TX2A 3F1QA 2EG6A 1XG3A 4IIFA 3G3DA 4OOZA 2QIWA 3FJ6A 4IPIA 3VNJA 3W76A 2YCJA 4UTTC 4MFDA 2VC6A 2NV2A 4QQUA 1R3SA 1TTIA 1H1NA 2JIWA 1LT7A 1V3MA 4U3CA 2VO5A 2NWRA 4JS3A 3U4AA 3B9OA 3GDBA 4KH2A 4LAOA 1MWOA 5FCZA 2NWSA 3GYEA 4LAMA 3A3WA 1PIGA 1D8CA 2ABBA 3TKFA 2PZ0A 3N2CA 5C70A 3LCWA 4BF5A 2W91A 4JTHA 3OP2A 5HPOA 3LZ5A 3ABQA 3Q67A 1KBBA 1XLLA 4NP7A 2QJHA 3WK3A 2BY3A 1UROA 3KWXA 3SDOA 4EPKA 3T8LA 3HZ3A 4NSBA 3B0PA 4GXPA 4GY0A 4PBEA 2DIEA 1EDTA 3B8WA 5CC7A 1E3XA 1UWIA 3ZT6A 2PA6A 1PKMA 3QEZA 3H7VA 4TTGA 3SRKA 3PJUA 3W1RA 3GWQA 4RNIA 1K6WA 2WC3A 4HP5A 1OB0A 3N12A 4G2DA 3SIMA 1J5SA 4JZ5A 1TV3A 4O18A 1CLKA 1E6PA 4BY3A 3DGRA 4HU0A 3CUGA 4C1NB 5CH9A 3FYOA 4YHEA 1R6WA 1TV7A 4QAWA 3T2OA 2ZZ1A 1XIHA 3M7SA 1M7XA 5DLCA 1PX4A 5F4XA 1LUCA 2JGQA 2PDYA 3CMGA 4FR6A 1HL9A 2WHJA 4NI8A 4KFNA 5I09A 3AUOA 1F9CA 1J0JA 3BDKA 3P2VA 1X39A 4QLLA 3FXYA 3PS7A 1EB3A 2BSLA 4PGLA 4ZQPA 2I9EA 1EJRC 2DJLA 3IUHA 4KRZA 4DNHA 4GZJA 4YL2A 3ABSA 4B92A 1FBAA 3C5QA 5BMXA 2DT3A 3UNTA 2QUNA 4A3YA 3Q37A 4NZCA 4GC3A 4OVXA 1M5WA 2GZXA 1PIFA 4IICA 4Y9NA 3F5JA 4JTLA 1SO6A 4PUWA 3BO9A 3ZXWA 1RQBA 3LSBA 2D24A 4F40A 1GUVA 4UZSA 1H49A 5FSDC 3H21A 1OFOA 2WAGA 3C0LA 4HU4A 2WOQA 4ATLA 4TIMA 2ANUA 2O92A 5A2AA 3KRBA 5DCDA 3LGDA 3F7JA 4TV6A 5LGXA 1WZMA 4AVOA 1F4AA 4LSBA 2J7HA 4HGXA 3BWWA 3TCEA 2UV8G 4PBGA 4H8VA 1TX0A 3GC2A 1XRFA 3DN5A 3IVSA 3I4EA 5A8PA 2NLIA 3LS9A 4ZA0A 1FHLA 5DQPA 1BVNP 4C7GA 3EOOA 2Y6ZA 5D2WA 1MVYA 1EXPA 3TEVA 4LTSA 5FF7A 1AJ2A 4O4VA 1V6VA 6ENLA 5LSMA 5E0FA 4XTIA 4FS9A 3CHEA 2A7RA 1TE6A 4GCAA 3OGVA 4GH1A 4DBUA 2CIPA 3QXBA 5E9XA 3DFHA 4TXEA 3N29A 2FH6A 2HROA 3WJSA 3N18A 4WVXA 1LF1A 4E4FA 3ARPA 2VZVA 4XKMA 5LHEA 1ZP4A 1KM6A 4WZHA 1W5QA 1ZP3A 4XK2A 1V3IA 3SZ8A 5CC6A 1LWIA 4JN8A 4O54A 4GQRA 3KS5A 1NH6A 1WCGA 3QKEA 1WOBA 1Z6KA 3EGJA 2Q02A 3TROA 2OLSA 2I57A 2X41A 2HTMA 3CUZA 2ZA1A 1CLXA 1Y8BA 3G24A 4Q6XA 2V3EA 1TJ1A 4PR4A 3KRUA 4X60A 3W2KA 1XGDA 5IBXA 3AQUA 2V82A 5TD4A 3G18A 3DAQA 1WUFA 4AF0B 2E3ZA 2X0SA 2W61A 3MQTA 1U1JA 3QOKA 4LC6A 1XBZA 2A6LA 3W7MA 3UPMA 2HDJA 5FF0A 3R0UA 3U9IA 4K6AA 1M53A 2A0NA 2EPLX 4UTJA 1J0ZA 3HQNA 3DFNA 3NZPA 4RNJA 1H51A 2YXGA 3FOKA 3G1HA 2XFRA 2C15A 1AD4A 4ZXOA 3O0FA 3VMOA 4P8UA 3OGRA 1O68A 3APYA 1S5TA 4BQ5A 4WY0B 3O3RA 3IJ7A 4JFVA 4HHPA 1EQPA 3T9PA 3CPRA 1GW9A 1M7JA 5FKYA 3KRSA 1T7LA 3BOLA 1JZ3A 4NI3A 3VKKA 3W70A 1F05A 4EAYA 1DQWA 4OWGA 4XZIA 1XRSA 3NQ7A 2J25A 4FF5A 3KCJA 1R9YA 1LL7A 3N17A 2OVLA 3M5YA 3BLDA 2A3EA 3UWYA 2D0FA 3KVMA 1XLFA 3B06A 5C5YA 3TSMA 1V93A 3GG7A 1CB2A 3PBWA 1IHIA 4DJDA 1UASA 4DJEA 2PGFA 4AMAA 1XBXA 1WYIA 1Z8AA 3M0ZA 2C13A 3T1GA 4QAIA 3CC1A 1BSIA 2UZ9A 1W37A 4IPJA 1NP2A 3O6DA 4FPSA 1E9ZB 4PCFA 5I77A 2ZA2A 5H91A 5CPNA 8RUCA 4CVWA 4US6A 5HAOA 1V5XA 1YDNA 4KETA 4OV4A 4J3ZA 4O17A 5A6AA 1OHLA 3MUY1 7REQB 1XH1A 1EO7A 3GH7A 2OMAA 4FLRA 2YA1A 4DWSB 1AODA 2JKAA 5HUPA 2EXOA 1SZNA 2IKHA 1GVIA 2GQ8A 3NQ6A 4LB3A 5HJXA 3W71A 4A21A 3QSTA 4B5SA 4H83A 1A4MA 5I7GA 4PODA 2OZTA 3GFXA 1JYWA 1T5AA 3IVUA 4HYWA 4JNYA 3B8VA 3T2QA 1QAPA 4H9YA 1YE4A 2FTYA 5IFPA 4EVZA 3WEOA 1SFTA 1TFVA 4L61A 4EAMA 4Z08A 1X6NA 3LCGA 4QHRA 2VURA 1XKYA 3W1LA 1R7AA 3OG2A 1HJVA 2NQJA 2ZVRA 4DO5A 3TN3A 1G7UA 4ZGYA 3HG5A 1MQPA 1EF3A 3GKAA 1Q7QA 1UCWA 4G9PA 3WH9A 2BB0A 2BWGA 1JGIA 1WKDA 4Q4PA 3KOFA 2HSAA 1A49A 3CV7A 2WNZA 3QQ1A 1EUNA 2PDXA 2C18A 4GVIA 3UXDA 4HSHA 5D32A 2H6RA 2IPJA 2VFHA 3QW4B 3E5PA 2NUXA 3UWQA 4NVTA 3SGGA 2RHGA 1LJYA 1H0GA 2MUCA 1X6UA 1P7TA 2REQB 4K39A 3GVWA 2HK0A 2Y89A 3SJNA 4ROPA 2CERA 4IMDA 1GVRA 1FWRA 3I68A 4V33A 3M0LA 5HMFA 3SCPA 3WF0A 4IG2A 1A0EA 5EMUA 4B3KA 3CV1A 3HJEA 1G69A 3HPAA 3PPGA 1XICA 3VIKA 1DIDA 1JXKA 4RX0A 3FLUA 4GABA 4RDYA 2QMJA 2ZUSA 2QEZA 1RJPA 2CZVA 1B90A 2XGBA 1RBOB 1ZTVA 1MW3A 4DELA 3SUWA 4GYKA 3S2MA 3QOMA 4CD5A 3IRDA 1JFHA 4OECA 3GBDA 1DWIM 3AYTA 2HZGA 4L64A 4WOZA 1PIIA 5D03A 2B4GA 1KA9F 2HWGA 2ADAA 2VZOA 2EBNA 1Q6LA 3CZJA 1K70A 3W7EA 3FS2A 4FNQA 4Z1CA 3ARUA 1EHNA 5ABFB 1MRQA 2NUWA 1A0CA 1JR1A 2Z6JA 3N19B 3XINA 3VD4A 4IOTA 5DMYA 4PCPA 3PBYA 3LPFA 4YTTA 3LXBA 3QHMA 3UG4A 3P61A 1ZLPA 2NXHA 1KBLA 5CZKA 1C8YA 3VFLA 3WDIA 5FAGA 2HPMA 4JAWA 2BASA 1XIIA 4KF1A 5DO8A 2NVDA 3DYPA 4HK6A 4JTQA 4L9YA 2GVLA 5LIXX 2QUVA 2V2HA 2WJEA 2Z7KA 4UTUA 3RK8A 2ZCGA 4D8LA 4ZZ9A 1M65A 4FNUA 1JZ5A 4KS0A 1XYMA 1LWJA 1LRTA 1HX0A 3S9YA 2FVLA 2GGIA 4V2XA 4M6VA 5F7UA 4IGNA 2VFDA 2WJDA 5AC7A 1W1ZA 4O16A 1QDSA 1E0XA 1C7TA 2BDQA 1AQFA 1V6TA 1LTDA 3KP0A 3DDMA 3FHAA 2XTKA 4LY4A 2EJAA 3PWGA 2WSRA 1H63A 1U33A 1KRBC 1US0A 2DIKA 4DF1A 3HGJA 1I2QA 1GOWA 3HOJA 1CW2A 2GVYA 2P1FA 1WOAA 1CIUA 2DZAA 2XH2A 1VCFA 1KM5A 3DFPA 3VNLA 5D2TA 2W79A 4L80A 3M7WA 4JQ3A 3BLEA 2UY4A 4RLIA 3CL7A 2XFYA 1UUOA 1S39A 4DM2A 2V5KA 1PEZA 4J28A 1XWYA 3KXQA 3NOYA 4WJEA 4O12A 3WL0A 3TTYA 2OJPA 4PTDA 2B81A 3LU2A 3VPLA 3E0LA 2DSWA 1IE7C 1MNSA 2W3ZA 5ENLA 3MP3A 1NF0A 3FJLA 2INFA 4V27A 4YYCA 1GVYA 2Z1VA 1TJPA 1QJWA 3G1VA 2YL9A 2OSXA 1RPXA 1UW9A 1BKSA 3VKJA 3OLGA 2DSKA 4XUGA 4KT2A 1VHNA 1A5MC 3NSXA 3C0SA 3O63A 3GXNA 1WBHA 1EYEA 4FNPA 4FB7A 2G4JA 1GNXA 3DEQA 3L2IA 4ZXLA 1L6YA 5JXQA 1FH7A 3B0XA 4H01A 1NOFA 4UTKA 4QEEA 2GUUA 3BMVA 3UXIA 1QVBA 2HS6A 4CKQA 3TAKA 3PK7A 2VRJA 3AS1A 5IXEA 1MW1A 1WKFA 1GT8A 1TMLA 3RU6A 4DZIA 5D2XA 3E2VA 4H9UA 4DJFD 5A8OA 3B3DA 4NXKA 9CGTA 3QJAA 3TLLA 3TN6A 5CSRA 4W8BA 2AL2B 1B30A 4D6HA 1HJXA 4FI4A 1XIMA 5G4WA 2YPIA 3K1GA 4UMAA 2QCEA 2VFIA 4YTQA 4LALA 3HQOA 1OYBA 3HG4A 1VFLA 4DAIA 1QI0A 1FWHC 4JTKA 1B4EA 4O1BA 3ZSTA 1WAUA 4AEFA 4J27A 1JZ7A 3U6WA 1JYVA 3WLQA 4A2SA 4HNOA 1ZBKA 2VX5A 4S3DA 2PWGA 2SFPA 1BXBA 1J79A 3B4UA 4GA8A 4J2PA 1IXQA 3FW6A 5D38A 2GFTA 1GGOA 2CKRA 3EDKA 3M0MA 3UR5A 3JU2A 3IIVA 3VOJA 2FPVA 3HF3A 2HPIA 2ZDRA 4O8AA 3USZA 4R7JA 4G6CA 2OQLA 1WB0A 1RALA 3NPWA 4H6KA 1W3NA 3H2AA 2A3BA 3CIWA 4MYXA 5LNWA 1VYSX 3TQPA 3QFWA 4O14A 1K7FA 4GO8A 3CAKA 2BY1A 1EUAA 2G3NA 3TONA 1O5KA 3C52A 4ZODA 1KD0A 1FWAC 3CIXA 4DWSD 1S2WA 4ACZA 3PZNA 1V4YA 3DYMA 4NASA 3S9ZA 1M6JA 1PWMA 2PCEA 2XVPA 1VS1A 4AY7A 3KM8A 1W3TA 3IIZA 2Y70A 4UB9A 3WENA 2PEVA 2QZRA 1D7FA 3GHUA 2Y7GA 4RUBA 3ZSSA 1ZPTA 2BX7A 4UQ9A 3UF9A 3PM6A 2PRMA 3JS3A 5JBEA 3KLLA 2P3ZA 4UNLA 1UC4A 1MUMA 3H4GA 5HQLA 5GJNA 1Q6GA 1KWKA 4ALDA 3NQGA 1L6WA 4MY8A 4AU0A 2HNEA 4S3CA 4F9DA 1AA1B 3FDKA 2QV4A 3OVRA 3QQ0A 1UUMA 2XIQA 2VDGA 4CCEA 4D6DA 1KM0A 3H22A 1EX1A 5HR7A 4J3XA 5EMYA 2DFAA 3PTQA 1YDYA 4O1CA 3BC9A 4GVGA 1U83A 3BV4A 3O1NA 2GVGA 1R30A 4Q33A 3VGFA 2WB5A 3E0VA 1E73M 1DJGA 1NAL1 2WCAA 3WFLA 3BAXA 1WE5A 7TIMA 4WXZA 1JCXA 4AXKA 2D2HA 4AIBA 3EOLA 2J4GA 4LYQA 1BLIA 4O4WA 4UOQA 3AOFA 2WZIA 4MKVA 3KZPA 3LI0A 3FXGA 4E5TA 4PEEA 1B57A 4DB7A 2XGZA 5C9UA 3CZKA 4N02A 4PMYA 3HTWA 5F1UA 3AAMA 4MTVA 3MDUA 3UCCA 2P3EA 2PZNA 1H4PA 2NV9A 4C6JA 1QNPA 3VOFA 3OIHA 1PBGA 3QF0A 1XDLA 4PULA 4PSPA 2VX7A 2VCCA 3SUSA 3DI1A 1Q13A 1WPCA 3D5HA 2NX1A 3E2QA 1TVLA 3W7CA 2ZTKA 2CNCA 4L4PA 3W29A 4OE7A 3TE9A 3VU2A 1SFJA 4N7QA 3SAZA 4XAPA 3V36A 3VKAA 3U0HA 2QJMA 5FEXA 4GIEA 2QPXA 2Y63A 4MIMA 4AZGA 3BTNA 1RD6A 2CBJA 3P5YA 3QMSA 1MMFA 4RNHA 3UEQA 2F9RA 3AZTA 1SW3A 4MHBA 4XZMX 3T7VA 1TA3B 4YWSA 1WQ5A 1EQCA 4Q22A 3FEQA 2IKIA 1MI3A 4AB4A 2P0OA 1CXKA 3GB6A 3LZ3A 5CAKA 4Q7BA 4DBSA 3NZQA 3AMGA 4BR1A 2TSYA 5LKYA 1H50A 2EJ1A 4IQJA 3CQHA 4PFHA 2WK2A 2ZKMX 5ABGA 3WUBA 4W9TA 4FALA 3I10A 3NEVA 9XIAA 4Q4SA 3NL5A 2CBUA 1W9UA 1P1XA 2E25A 3LGEA 3KL3A 4I3GA 1PAMA 1E0TA 1NDVA 3THCA 3WLMA 3W1PA 4PTMA 1KRAC 2XN1A 1DWHM 3U7VA 3VGEA 4B90A 3TZNA 1UZ4A 2FZ9A 4G7FA 1M3UA 4MAZA 1XGEA 3AYVA 1SSDA 4X3ZA 3AHXA 1DJQA 5D04C 3GHSA 3GTHA 4C6NA 4JIIX 3KOYA 1B31A 5AZ0A 1RJQA 1XSIA 3V5OA 2W27A 3PULA 1XH0A 3VMNA 2ZQ0A 4IGHA 1W1A1 3PBMA 1XIFA 3N2BA 3EXTA 1LYXA 1YADA 2XU2A 2GJNA 1B2YA 1Y5XA 3L9CA 2Z28A 3OGSA 2H9AB 3OU8A 1YNYA 2OT0A 3N3MA 4JOMA 4JTRA 3WEMA 3KTCA 1V0KA 2QQ6A 3LHZA 1ICSA 4J35A 5HMSA 5ABEA 1ISWA 2DZVA 2PLCA 1OBAA 3MSDA 4BQ3A 3GIQA 4AHQA 4IJRA 1EOMA 3WNOA 1ONRA 2PU0A 4XAYA 1CGTA 5LA1A 2PC4A 4YMZA 3M0VA 4HNCA 5IFTA 3T0AA 4PMVA 3EWWA 1IYXA 1SW0A 4IIHA 2EPOA 2AMXA 1KFCA 4W86A 3OPSA 5JIWA 2X8RA 2CBVA 1RP9A 4FXSA 3CAQA 3B8DA 1V0LA 3TR2A 4ZOAA 4QCEA 4MY1A 3EA3A 2DV0A 1PE1A 4QBXA 2WSPA 1OJXA 2VUYA 2OLAA 3QY6A 1VBUA 4ZL1A 3W2JA 1KXVA 4H9ZA 4QDWA 3AU2A 1KCLA 3R13A 2VR2A 2VWTA 1IV8A 1BGAA 3T55A 2YCLB 1UR0A 4HHHA 1WDRA 1OYCA 3EA1A 3BOXA 4A3HA 1TIMA 1S2VA 3ME3A 5DEZA 1SJCA 1A5OC 3WQ5A 1KXTA 3T42A 3GY1A 4V28A 4PB3A 1XCWA 3VOGA 1EDGA 3K13A 2G3FA 2Z2UA 2H3BA 1CGYA 1W9XA 4O57A 4DY1A 1LZOA 3CMJA 2ESCA 3CYJA 4Q7NA 4DF0A 3H2OA 5C0QA 3SR7A 3QVQA 1F4HA 3EX2A 4WD0A 3THQA 4UXDA 3AXMA 5BRBA 1KFBA 3GNOA 3A5VA 1IIGA 1IEXA 2Y1HA 4RE4A 4ZB5A 3WCZA 3SN4A 5HQMA 4AZ5A 2GK1B 1GKRA 4LU0A 1GORA 1ZBCA 4RDWA 4F0LA 4Y8FA 4ENLA 2VX4A 4HNUA 3S5YA 1S2AA 1KTNA 4LCQA 3KE0A 3LY0A 1NP0A 3KZSA 1RLDA 2FZMA 1XLMA 4RZ6A 5I00A 3BL3A 4ZO7A 3NAVA 3R10A 1RCXB 1CYGA 2J6XA 2FB3A 4AWEA 1UP3A 3F2BA 3S1WA 4XKYA 1RA0A 1QPKA 3GQYA 3IUDA 1E5JA 4H7VA 5LGZA 3E0WA 3OODA 3ICJA 2XG9A 2E7FA 3LUTA 3B40A 4FHAA 5C71A 2OO0A 4BKNA 2QW5A 1V7AA 7REQA 1NOWA 4IZGA 2QS8A 1T96A 3FSTA 1P6BA 1T40A 5D02A 3WN6A 3TQVA 3N34A 3WFZA 1ZBVA 3W7LA 2VX6A 2RJGA 3ZFHA 3TYAA 1RCQA 3EDEA 3GNDA 4US5D 4LVBA 1E9IA 5FF2A 3CXOA 3N6QA 3ZS4A 1VJSA 4LS0A 3N25A 2CU0A 2VFEA 1ESWA 2G37A 1VIZA 3L2LA 2G41A 1Z41A 4EF9A 3VDGA 5J5DA 1XSKA 5JU6A 4LV4A 3I65A 3LM3A 2PODA 3LDVA 3GXPA 1JD7A 5H2ZA 4ASTA 4W89A 1R2RA 2VWSA 2YX0A 1PUDA 1K8CA 2ZZ4A 1JF6A 3LQLA 2PDGA 4XISA 4CU7A 3O6AA 3TJXA 3W37A 1JXJA 4JCMA 3WLRA 3G1DA 1B5TA 2HK1A 1ISXA 4UTIA 4LF2A 4JQ4A 1Q66A 3BCJA 4M1BA 1YDVA 2DVXA 2PF0A 1XDJA 2REQA 4UOJA 1JI1A 3V18A 4OFCA 2V5DA 2VEGA 1TQXA 1ML1A 5BROA 3WLLA 3TC7A 4PCTA 3CQ0A 2NT0A 3FA5A 5H6HA 4CN6A 4NRSA 3IEBA 1AJZA 1C90A 1TUFA 4NZ4A 1SR9A 4QJ4B 5DFAA 2VC9A 1JDEA 3HV9A 4DUWA 1QR7A 2E4TA 1JZ8A 4LW7A 3MV11 2VENA 2W6RA 2EHHA 4OIFA 4DWDA 3RMEA 1J5TA 3K4AA 1W17A 1TMQA 5B80A 1QASA 4KWUA 1ZAHA 1CPUA 3A3HA 2RKXA 3WD0A 4JEJA 1UD5A 2VDIA 3UJSA 1L0PA 2ZX6A 1U5JA 2P0IA 3N9KA 1EHAA 5A8NA 4HKPA 8A3HA 1UP2A 4ML4A 4D72A 5L9FA 3W81A 5C2XA 3NR0A 2Z1WA 1JPDX 1U1HA 2CWNA 4X61A 1U1UA 3LERA 4ATDA 1MNZA 3EMCA 3FNDA 1B3WA 4GH3A 1KBIA 4A8LA 3SRFA 4PEKA 2AQVA 2OWXA 3PZMA 5I07A 5KZEA 3T05A 4L65A 3GTFA 3PAOA 3W53A 2H3DA 3MS8A 4DBWA 2I5IA 2XPKA 1OFBA 3L2MA 2ACUA 2VOTA 3GVQA 4JNZA 5HMEA 4N0RA 2YYTA 2ZRXA 1QI4A 3LG3A 1Q2RA 3S2LA 2DZXA 3STPA 4C6IA 3N6HA 4JIRA 1G4EA 4IT1A 1U5VA 4TV5A 3WQFA 2A7NA 4KCUA 4KWWA 4EX4A 3TQ0A 3W00A 1FWSA 1KC7A 1TKKA 1HF6A 2OU4A 4PTWA 1P5BA 1ENUA 3QH2A 4O13A 3LRMA 1DJZA 1V03A 3NXLA 1SZGA 4DO4A 2XIIA 3KX6A 4O1DA 4AWTA 1OC6A 3S1UA 1LORA 1CT5A 4H1ZA 4CNOA 3LTSA 2PMQA 2Z2AA 3CNYA 3UWWA 1FHDA 2UY3A 1BRLB 5F2LA 2NQ5A 5G2IA 1I2RA 3WDRA 3GU9A 5K7JA 1SJBA 4QRNA 3HPZA 7XIMA 1N55A 4K68A 4FIQA 3LSCA 4LC8A 3KL0A 4IMEA 2FJUB 4IFKA 3MUZ1 1QW7A 2Z1BA 4S3KA 1VPYA 4MB5A 2Z24A 1BGGA 3ZLHA 2WLYA 2CLHA 2QDDA 3Q4DA 1W31A 4TVDA 4CNSA 3WKZA 3AIQA 3MT1A 3P8JA 1W8GA 5F2GA 4NAEB 3NQ2A 1BPLB 3UG5A 3THAA 4S1FA 2BOEX 3R8RA 4JQAA 1FWGC 4AIEA 3W4RA 5C6MA 4P2VA 1OFQA 3DENA 3L12A 4B16A 3T4WA 4HSOA 4NNAA 1WDPA 1ZFJA 2RDUA 1X1ZA 4H3DA 4YYFA 4M51A 1XPGA 3P8IA 2ZXBA 1UIOA 4W84A 1DQUA 4NJGA 4QFUA 4FIRA 1EX5A 4FNTA 4JEQA 4MLRA 2PTDA 4ZQNA 1XLEA 4OHQA 3BAYA 4CU6A 3P0XA 3USBA 2W62A 5AN7A 3GG8A 4S38A 3GFYA 1PPIA 2F61A 2G96A 4MNKA 1I0BA 3IJIA 3E74A 3LXAA 1O95A 1R38A 4D1JA 2PD5A 3EPMA 1ALDA 3EX3A 1XLKA 3EEZA 3GXDA 3PUDA 3DHPA 3C86A 3SFWA 1XLAA 3W1MA 1XH2A 1US2A 2PU1A 4NILA 3TC3A 4G56A 2GSJA 1WV2A 1I2OA 4IIEA 1UMYA 4N9DA 1DBTA 5FD0A 3UZ5A 2XJ7A 5G4HC 4HPXA 2G8ZA 1RSCA 1PZ0A 5CGTA 6REQA 1S2UA 1XGZA 1EKOA 1J93A 4GIYA 3PUGA 4IMFA 4FNRA 1I75A 5EA9A 5D2YA 1K8ZA 3PHAA 1C9DA 3CUXA 3U8GA 2ACRA 4GKTA 2C1IA 2F7FA 4XZBA 1PZ3A 2G3IA 3WY1A 1M1BA 3UBPC 5EBAA 4L5ZA 4CQ9A 2ISDA 1P0KA 1ITXA 1GHRA 1JCTA 1S3HA 4Z1AA 2PWHA 3C6CA 3A64A 4MKNA 1O1ZA 4K36A 1YW1A 1R3VA 2FFCA 4PB4A 2ZDSA 3THUA 3KTSA 1CWYA 3LX9A 2HE5A 4AZ7A 4JTIA 4MWAC 1G1YA 4JTTA 1F8IA 3GD6A 4XVDA 3GDMA 1VJZA 2CLKA 1NQ6A 5A6KA 5HJYA 3AZSA 3KW3A 4JR5A 4XO7A 3OHMB 5E5CA 2XIBA 4UFHA 1HL2A 4KWSA 1Q5MA 4NZJA 1C93A 2GVJA 2QHAA 5CAHA 3NSNA 4HZ6A 3W85A 1LWHA 2CCRA 5C54A 5M2FX 5IOBA 4FX6M 4XZWA 3CZ8A 5A6SA 4PBFA 1W1VA 3G1FA 1XC6A 3S0CA 4CCCA 2QUMA 3IS4A 4IJBA 4QEHA 3REQA 3GAKA 1L6GA 4PL1A 1WX0A 3WH8A 4AC7C 5EMLA 4IFRA 2JQXA 3DKLA 3BH4A 1MXSA 1A5NC 1QPNA 5AHIA 2C3ZA 2TAAA 5HWNA 4FLQA 2WYSA 4NNBA 3WBEA 1LQ2A 3G3MA 3W2UA 1I2NA 4GQBA 2E6AA 3GXTA 5G2HA 1O5RA 1BHGA 2FB2A 2FHCA 1TELA 4YHGA 3LPPA 1IZKA 3MWCA 1J0HA 3DC8A 1UD6A 4A22A 1FHVA 1W8SA 1FCUA 3POCA 5E70A 3NSMA 1I0DA 1REQA 3DFYA 1H60A 1AH4A 1FCVA 2JEQA 2V69A 1CENA 2E67A 4XQ6A 3LHWA 2VD9A 3QHOA 4TTUA 1A0DA 1M68A 2WKLA 3OG3A 3OQEA 4B5VA 4MLJA 5MKGB 1OFRA 3W1XA 2A85A 1JUBA 3S6TA 3TZFA 3ZLFA 5A8QA 2J47A 1SZEA 1QATA 5GNYA 1BVZA 1K1DA 4OV9A 5KZMA 1QOXA 4LUSB 4E4PA 1L6FA 4JYFA 1BTMA 1IEQA 5C9RA 4PMOA 1M03A 2BVWA 1UZDA 3TYEA 4PUEA 3F4DA 2X2YA 1Q63A 2YL8A 3S2CA 4NJKA 2QXWA 3CPUA 3QLLA 4F79A 2BY0A 4QDMA 1I6NA 4CNPA 4AQLA 3ID7A 4EXBA 5M17A 3URAA 1X7FA 1WZLA 3RITA 3B9NA 1O94A 5I3GA 3RLVA 3G6LA 3JZEA 1IEVA 3V0UA 4IISA 1QO2A 4WKHA 1GOXA 1PL9A 4AX7A 3ERPA 4OTKA 2PSNA 4ZR8A 1JUEA 4WDTA 1P43A 3TP4A 3UJ2A 1SO3A 3C2VA 1PSCA 3DFOA 3PUOA 2YZRA 3JUGA 1KGUA 1JCNA 4CNUA 1LP6A 3I7RA 3FDGA 2C79A 2Y88A 3V5CA 1Y5WA 1EC8A 2E1WA 5BRQA 2OEJA 3N73A 1MQRA 3C0QA 3RGTA 2A3AA 1R3WA 1V6XA 3S6OA 4B2DA 2H9AA 1H61A 5GNXA 3LI1A 2CXEA 4JDYA 1F74A 1MZHA 2E9MA 1Q6OA 4IQLA 1XINA 3VIPA 4BF7A 1O1HA 3T81A 2X05A 1WDDA 1L8PA 3FAXA 3TSDA 3NUKA 4P7OA 3WQWA 2OODA 5F4SA 4C6LA 4C1LA 1XYAA 4GWEA 4M0XA 4GXWA 4X2RA 3ZR5A 4ORIA 3MKVA 1PX8A 1ZZMA 1JGMA 2GOUA 2E77A 8XIAA 2C0AA 4LBRA 4AVFA 1D9EA 4IWWA 1YIXA 3BLPX 3UWZA 2FGZA 1HT6A 4JFTA 4ADTA 1ODZA 4DI8A 2DW7A 2YCLA 5CLTA 2GJLA 1RQHA 2J79A 2QJJA 4QP0A 3KTXA 5G2WA 3KHJA 1K7XA 4XIMA 3EWYA 1J01A 2FIQA 3P5ZA 2RDTA 1KTCA 1UH4A 3UQNA 4AHOA 3RLUA 2FLIA 4NIRA 3UR2A 3WLOA 3SRDA 4C6QA 3TMLA 1LM1A 1GKPA 2DSVA 1L2QA 1ITCA 2DUAA 1HW6A 1J96A 2YW4A 3CH9A 3EKGA 2WCSA 4Z2JA 4NX5A 3EB2A 3UZJA 4AEOA 1RVGA 2OSYA 3M64A 1AH0A 1V3LA 2PDKA 2ZYFA 1JCJA 1VZWA 3H24A 1YMYA 1GZGA 2EKCA 2Z2BA 2OXNA 3ZO9A 3MU7A 4MFEA 3VM5A 1ZCCA 1B3OA 1ECQA 4HN8A 5GJPA 1KBJA 5A6JA 3OBEA 3W74A 1GOMA 1NJJA 3GM8A 1SUXA 3DG3A 4XD6A 3WD4A 4F48A 1FCBA 3AJXA 2HVMA 3AZRA 1YQ2A 2QV5A 3GDKA 4QISA 5JH1A 3XIMA 3MANA 4YU1A 3BMXA 3M46A 2BXVA 3P84A 2BVDA 3WBXA 4H7CA 4QX4A 1E6ZA 4J2MA 4U2ZA 5FEZA 2J9YA 3OHIA 4AZCA 3O6CA 1DWJM 2GWGA 1RK5A 3C56A 4S3GA 1M01A 1XIDA 5FEWA 1NARA 3NPXA 4UNKA 5HANA 1EFZA 4CD6A 4V15A 3TU9A 5CPQA 5E0KA 3LPOA 4D8AA 6CGTA 4I9MA 3V7PA 1XD1A 3GXMA 3CTLA 3BUVA 1GEQA 2B31A 3TJ4A 3B0VC 2A2IA 1S46A 3Q58A 4C6DA 1S5WA 1TR9A 3ARXA 4IJCA 1K9EA 2PTWA 3W22A 2L5HA 3VE9A 1E70M 2ZUMA 1E4IA 1BVWA 1UKPA 1W56A 4NAFB 1W6TA 2GVEA 5CPLA 5TF0A 4IGMA 1UR9A 1KLZA 1G6CA 2R1MA 2FHBA 4FOJA 3W07A 2DH3A 3UVIA 1IEIA 1H7NA 3VC5A 1B3ZA 1AFSA 1FFQA 2CZ5A 5EMKA 1VGAA 1V3KA 2VI0A 7A3HA 4YIWA 2QCDB 2X7WA 3BANA 2NQ9A 4Y7EA 4LV9A 1XYFA 4LUTA 1UWQA 3WD3A 4M19A 5JVLA 3ITVA 2R1KA 2WNNA 1XM3A 5CBJA 1D7KA 1PB0A 3H2FA 1DP0A 3CM4A 4QS5A 3ZR6A 5KSWA 4HB7A 2ZZ5A 1FWFC 2WLZA 2WSKA 4R9XA 3A4XA 4K38A 4WUIA 1IWAA 7TAAA 5D8ZA 1NVMA 3M44A 2NSOA 4UNIA 1XLCA 1MW2A 3N4AA 4GPNA 4MWAB 2QUUA 3PC0A 3E0FA 5I3KA 1VH7A 5EGRA 5GQBA 1KGXA 3VDHA 1EPVA 2UY5A 1YX1A 4C6OA 2VT0A 2YJQA 1QBBA 4I5UA 3TDFA 1BAGA 4BCEA 5A1AA 2RDWA 3LRKA 1R46A 2BXZA 3NXFA 3IV3A 1S5NA 2XH0A 1DJXA 3C3UA 3HQ1A 3SADA 4DI9A 2VGGA 3FGCA 3II1A 3DKJA 1QWGA 2QAPA 2X16A 4IUOA 1BXCA 4QTGA 4V1XA 2E9BA 3CU2A 5LA0A 1WXZA 3WQ4A 3GNNA 4KRTA 3OA3A 1OYAA 1Q45A 1MW0A 3CYVA 2FZ8A 5D05A 1POJA 1OX4A 4XZLX 1SO5A 2OG9A 2Q3OA 5IRPA 4AISA 5I3DA 3R5EA 4PL2A 2RDXA 2DZUA 2FVKA 3LPGA 1W5NA 3FVMA 5XINA 3ARTA 5AC4A 5FJRA 5C9XA 3T09A 1G5AA 1CGUA 1VFSA 1JAKA 4PA8A 4O53A 3V0SA 4JKLA 3S1XA 2X0YA 4IX2A 2WANA 3QBUA 2PB1A 4UFJA 3QSRA 1HUVA 7ENLA 7ODCA 1BG4A 1FWEC 1NOUA 5I0DA 2WWDA 4J7RA 1OCJA 4OBRA 1ICPA 4CQ8A 4I6VA 3WLJA 1SR0A 1PYFA 3N15A 3GHTA 4YNGA 1V0MA 4DZHA 4GVHA 1QO5A 4GI8A 4QNWA 2QDGA 1NELA 3UGRA 5M5DA 2RJHA 2OQYA 3W72A 1YBQA 1W5OA 5BWFA 4U5KA 1E6SM 1DWGM 4R3UA 3MO4A 1TTQA 1I4NA 1NDYA 1D2KA 4U10A 3UZXA 3L5LA 3ORWA 4FR1A 3CBWA 2G0WA 1QOQA 3GVGA 4HD5A 3MMDA 4MZ8A 1RZMA 3P0WA 4GNKB 4Q8TA 1IZJA 2WMIA 1GVEA 3AICA 4OQVA 4Y90A 4CLMA 3N9RA 2QCHA 2OEKA 4A2RA 1LOQA 2VC5A 4Q8WA 4KQNA 1DVJA 4HIBA 1GCYA 2OGYA 2Z29A 3PFMA 1VPQA 1VYRA 2GGHA 1XLHA 3VD9A 2R14A 2Z26A 3URBA 4XD3A 5AFDA 1CDGA 3OBKA 2FTPA 3RRXA 4EACA 3WUEA 1OCQA 3PANA 2VEKA 1PV8A 1EH9A 1ISZA 1FTXA 4BFAA 3MZNA 2WMHA 1TVNA 2Y4SA 5HNNA 1NEYA 3FY1A 4PRRA 3O15A 2GGEA 4WKFA 1V7YA 4LX4A 5FJUA 2HVNA 3DECA 5FJOA 2RAGA 2OO6A 4AD0A 1W3KA 2FKPA 2DORA 3MSGA 1C7SA 3RDKA 1XYBA 3A4AA 4HVXA 1QHZA 4A6GA 1Y5VA 1TWSA 3MSYA 5FF3A 2WKJA 2Y8KA 2HE8A 2WM0A 3MKKA 4TVCA 1JYXA 1TE1A 1A4LA 3TA6A 3BSGA 1F6PA 3QGVA 4GQ0A 5JUVA 2I1OA 4DJFC 2OTDA 1C8XA 4QITA 1UD4A 4PTXA 3WX7A 2CHOA 3NM3A 5EBUA 1W3HA 4RCXA 5C8BB 5TBOA 3FYYA 1R7OA 4KIRA 1QPOA 1E1CB 2BGNE 4LEFA 3A4WA 3GNXA 4PMQA 4JKMA 1UUQA 3SO7A 5FJPA 4N2YA 3R12A 2Z1SA 5LXEA 4JTSA 2B7OA 4GI9A 2ZICA 3UFYA 3P3BA 2VMFA 1FH9A 3S5NA 3LV6A 3E5BA 1UR8A 5HULA 4J3VA 3QY7A 4JD4A 1J18A 2FZDA 5DF0A 1KR0A 2I5QA 3R94A 2E9LA 1EWEA 3ES7A 3AALA 5HNTA 4KIEA 1YRRA 3DX5A 4S39A 2DZSA 4F66A 4M6QA 5HA7A 1RH9A 1FXQA 1X97A 3TSBA 1BQCA 1JDDA 1UOZA 1EO5A 4XWUA 4E4UA 1KXHA 3UYIA 2JEPA 4XSMA 5A6BD 1W3JA 3M41A 1LL6A 4B15A 1R2TA 3I3BA 3L4WA 2WHKA 3OLEA 4N6FA 4W87A 1X98A 3KEHA 4K7VA 4HBKA 3MI3A 3W75A 5H8UA 1GG0A 2TRSA 2OGJA 1FY6A 4WJ8A 1CXLA 4Q8OA 4UTHA 1Q2SA 4DWSC 1V02E 4UR8A 1GOOA 1HVQA 5SWUA 4CD7A 3TTSA 4UMBA 2YBUA 2VZUA 2ATMA 3QM3A 3LMZA 1EJUC 3LK6A 5CPTA 2AKZA 1E72M 3RM4A 3MHGA 2BFGA 3EOSA 4GY1A 3PWAA 3AS0A 1FWBC 4GFSA 5ECUA 4AEEA 2WHLA 3A24A 2BGQA 4L4LA 1X8FA 3HFTA 1E71M 3CB3A 1UR4A 2WJZA 4L1WA 1VFFA 2X1TA 4IMGA 1LDCA 4O19A 2NQLA 4QJ5B 1YXCA 3R0DA 3C61A 2E1DA 3AXIA 4MNLA 2FMNA 1YPFA 3JW7A 3NO3A 3WBWA 3EPOA 3M0XA 1SVDA 3M6YA 4P61A 3NGJA 1UKTA 3RCYA 1HTIA 3CZLA 4LAKA 3AWOA 4P8VA 3IK4A 3KRZA 5BZAA 1FDZA 3ZVHA 1F3WA 1EGZA 3GIPA 3RLGA 2D0GA 1AG1O 2QDHA 5DY3A 4K1GA 5FIPA 4AHPA 5HR6A 4NHVA 4OJYA 1DJHA 1EJXC 3FA4A 4NT0A 2QCGA 8XIMA 1XX1A 2VHLA 2O4MA 2OFJA 6XIMA 3GFZA 4OBTA 5AECA 4D8ZA 1EJ7L 1GOQA 1LBLA 1FP8A 3H70A 1T6MA 4JXCA 3W38A 1NFBA 4HQVA 1H1YA 2OKOA 1IXOA 2WBKA 5T9BG 4RKAA 1XW8A 1OFDA 4M5PA 4M24A 2ZOXA 1LRQA 2J8TA 5XIAA 3VUPA 1FWNA 1E6XM 3VCCA 4QQ3A 3A4JA 4LAZA 2A3CA 2CFFA 2BTMA 2OKTA 2WZHA 5I6SA 3W26A 3ZT7A 1BWVA 4PFMA 3EKZA 1FKWA 1GWJA 2CC0A 1DL3A 3DCPA 3WQEA 1A5CA 1AW5A 3EBVA 4GD0A 3ITOA 3U2OA 1WO2A 2AGTA 1KFEA 1J8VA 3V35A 1D3HA 2Q8LA 4TX6A 1VFOA 2O7QA 3D0CA 2ZE0A 2G50A 4A4AA 3W7IA 4F0RA 5CEWA 5JQ9A 1Q4WA 2BHZA 2FPTA 1WXYA 4CNTA 2G97A 2X7VA 2DZTA 3RX2A 3NO1A 3APTA 1NFGA 4LVDA 2CLEA 3WD1A 3TK7A 2PTZA 1E9LA 3K30A 4L6OA 4P7LA 1DJYA 1EGMA 3O8AA 2OX1A 2PRHA 3KDOA 1O12A 1S3TC 1TPH1 2BMBA 5AY7A 5BMWA 3P93A 2YBTA 4QLKA 2E6DA 2J7BA 2G95A 1J0YA 5F4WA 1GQIA 4P7NA 3WNNA 1SJAA 4F0HA 2ZXDA 2ZE3A 3B0YA 1H7PA 5CG7A 4JFSA 3CQKA 1DXIA 4DZAA 1GQJA 2VFFA 1E0VA 3WLIA 5REQB 3EX6A 3E12A 3UZWA 2A4AA 1E51A 1TUXA 1YNQA 1HKIA 3O9NA 3OLIA 4MPQA 1KGWA 5E6YA 1XYCA 1YLVA 3IGSA 4C6CA 4GYPC 1PKNA 1TR1A 4R7OA 2ZRYA 3QC0A 1VLIA 3IARA 3RN6A 2YLAA 2P8CA 3I3EA 3AMKA 3KL5A 3GNPA 1V3JA 1ONWA 2V5BA 3PR2A 2GPTA 4JPGA 4HYRA 5HNUA 1RBLA 3QYSA 3W7RA 2RFGA 1OT1A 3M5ZA 3A13A 2B0MA 6A3HA 1KB3A 1PDZA 1J0IA 1ZB5A 4N4QA 2E6FA 1V6WA 1EOKA 4J5NA 4Y9OA 2YKKA 3HJZA 3TW9A 3N9SA 2ZRZA 3VIHA 2ISWA 2P10A 2ZC8A 4F4RA 3H2MA 3TLQA 4YCOA 2VZSA 3PP7A 5KITA 2VELA 2V30A 2X0HA 3C4UA 1EYWA 1XKJA 1AK5A 4JYEA 3AU6A 3I7SA 1SFLA 2ZUTA 3UZZA 2R9RA 5G1TA 2YYUA 1PZ2A 2Y8UA 3WMCA 5HWMA 2DDXA 4I7WA 3AC0A 1UBPC 3F4NA 3WK1A 4ONVA 5A6LA 1DKWA 3N1AA 3BLFA 4AUBA 3LCLA 5XIMA 3C2EA 4HHLA 1XYLA 3UXKA 2ZXAA 3FK4A 3T6CA 3VD5A 3L4XA 1HGWA 3NPUA 3VCRA 4KGLA 3C8NA 3HGOA 4WK9A 3M0YA 1OX5A 3G0XA 3SQMA 1A5AA 3Q94A 4MAVA 1JFXA 1RV8A 5CZJA 4W88A 5KMYA 2XUCA 3O06A 1ZCOA 2VGIA 4H7ZA 2XVLA 3CUIA 4K1WA 2X30A 2FZBA 2OWWA 3QPEA 2Q3RA 3V16A 3KOXA 3R2GA 2DH2A 4HZ8A 2BOFX 3LTPA 4NZFA 3KAOA 4M6UA 3B9AA 3MUXA 1N82A 3CT2A 4QCFA 2CLFA 4A35A 1CCWB 1E6NA 4DYEA 3HPFA 3UERA 2PDJA 2C6QA 4TX9A 1F8MA 1XHGA 3KP1A 4MG4A 1JIBA 2R1NA 3AHTA 2LLEA 2KZHA 3UGVA 1OX6A 3QW3A 4LFYA 1LUCB 1WNOA 3U3HA 3AHVA 1CZ1A 2BV9A 4W7WA 4XBJA 5HNRA 1EDQA 4NAFA 3IGXA 3OZMA 4K8EA 3RJYA 3CHVA 3LMYA 3ZR4A 2RGMA 3W7DA 4U31A 3RXZA 2G4FA 2R1LA 3Q45A 3TTQA 2F6XA 3WELA 4C5ZA 4DO7A 1QNSA 1C8QA 2AQWA 2X1UA 2HJPA 4ZFMA 3FJ4A 1AMKA 1HFBA 2Y7EA 3PF3A 1GPFA 3MJYA 1OVDA 1O5XA 5FJTA 3GC5A 3PB0A 1EPXA 3LCIA 1A5BA 4PMNA 3POHA 1ODUA 5G1YA 5GVJA 3FHQA 2GDQA 1G01A 2YOCA 3P62A 3WMLA 3QR3A 1V8EA 4H2HA 3MP5A 5CPMA 4FX7A 4QE4A 4MWAA 3ELFA 4MB1A 2ATSA 1TCDA 3LGGA 3TJLA 4R7WA 1PVNA 4C7FA 4WIWA 1LG1A 1XP3A 4FK9A 2CW6A 3CO4A 4PUUA 4NJJA 2V2DA 3KBVA 3P82A 4FXRA 3WNMA 3EWDA 5KEZA 3U57A 3CUHA 4IGSA 1UYQA 3ALGA 4WKAA 3EPNA 3PZVA 1LL4A 4MYAA 3CB8A 4BQ4A 3IRSA 2WVSA 1Q6CA 2VJXA 4GOAA 1BWKA 3T0CA 2W4XA 3D46A 3B04A 2XSXA 4WGHA 1ZJBA 3BCDA 3AXXA 4OOUA 1I45A 5I2UA 4JIPA 3N4FA 2J7GA 3WSUA 3HPSA 3TWAA 4N9CA 4W85A 2IW0A 1Q7MA 4JTEA 1E56A 3SQLA 5HDRA 1JI2A 5K4XA 4UQBA 1XIEA 1SGJA 2E5BA 3DBPA 4FP1A 6PTDA 5A2BA 5BXRA 1TWZA 4WX2A 1XCFA 2DT2A 1EJWC 3TXVA 5A8MA 1XV8A 3GTNA 4IFOA 5BOOA 3H2NA 3RYSA 1ZGDA 3HV8A 4ZSTA 3O05A 1YPIA 1TWDA 3CV2A 3PN8A 3LBOA 2PP3A 1OM0A 3NL6A 3TYDA 3URNA 4F0KA 2GJRA 1EA9C 2JK2A 3TQKA 3L4TA 1G4TA 3U5YA 5BXSA 2Y62A 3WQOA 1HKWA 2DVUA 4AVNA 2ISFA 3W1TA 4FSAA 2DUZA 3AIUA 2ALDA 3VXGA 3PSVA 3A22A 3GXFA 4C91A 4QG8A 2I16A 2DZBA 5F1VA 2I56A 1XQKA 4C6FA 4PZVA 3A23A 3IK2A 3P60A 4JBRA 2XVNA 1BTCA 5CZTA 3GUWA 4MF4A 1BWLA 3W24A 2C71A 3VA8A 3PTKA 5ABTA 4GX9A 3SUTA 1LRNA 2XSBA 5A8GA 3EMQA 4HA0A 5HQEA 2C7FA 1B9BA 1E55A 3CQIA 3ZIZA 1JZ6A 4QE5A 4N6EA 1HNYA 3WNKA 4Z2LA 5AHMA 1Z44A 2PWFA 3HBLA 1VAHA 2XZ7A 3PNUA 4TX8A 4E38A 3W7QA 1L2UA 2ACSA 3BJSA 3TVAA 2P53A 2GYIA 3TNOA 5LNUA 3RJXA 2DSZA 3BJTA 1GVFA 4DUVA 2WC7A 1JZ2A 1E9YB 4WXYA 4IXHA 1QNOA 4PMJA 3CHCA 3ZOAA 5LNVA 1VEMA 1JG9A 4D71A 1QPRA 3A12A 4W7VA 5HXMA 4JICA 2Y7FA 1I8JA 5CSUA 3PPCA 3EOEA 5EMJA 3ZWTA 4Z17A 4M1RA 4MM1A 2FFIA 1SPQA 3S47A 2BNJA 1DIKA 1X8CA 8TIMA 2Q8XA 2QIIA 3SSZA 1L8NA 4HCHA 1RVKA 4A3QA 4KPLA 1PTDA 2R8WA 3VM7A 8CGTA 3E38A 1EF2A 4DVOA 3IJ9A 4L9XA 1XR2A 4H9TA 4YN5A 5DBTA 1GOIA 1W9PA 3UD6A 2PDWA 1RXOB 2QCFA 1HO4A 3W01A 2OQHA 4AZHA 3P14A 2XIMA 4TO8A 3WFAA 2WNWA 1FX6A 1TREA 4X9SA 2VCAA 4R33A 1A3WA 3QLDA 1QI5A 2Q71A 4EPDC 3M07A 3RO6A 4H9VA 1IF2A 1XG4A 2R1PA 1F6YA 4E3TA 1SZFA 2VR5A 3L4ZA 3R1ZA 1W1IE 2G5WA 2BXYA 2PDUA 4GRSA 4B4HA 1VRXA 1G0CA 4B5UA 3NDOA 4G7EA 1W54A 5EKYA 1Q85A 5I3JA 1ZY9A 2Y24A 2DZPA 3QR1A 1D3GA 2POTA 4GNJA 3DFSA 4GY7A 4M7TA 4Y96A 3IAPA 5BXTA 1BYAA 3KFTA 4EF8A 2FDMA 1K02A 3UP8A 3W2LA 1FWJC 3W84A 4EPBC 2P50A 3KVKA 4E8DA 3WZ0E 4O0QA 1P7TB 2DT1A 3MBDA 3FIGA 4CD8A 2WVUA 5JBDA 4UMCA 4GJ1A 1FUYA 1MEWA 3PUEA 1OFPA 1FVPA 4JIQA 1U22A 1ZL1A 3C2YA 3U2ZA 3E9AA 1EEXA 4ZOCA 4IP5A 3ONCA 1B9ZA 4JTJA 3VOCA 2XVGA 2VEFA 1H7XA 4YVVA 3MHFA 1IIHA 1MXGA 3NEHA 1KRMA 1PCKA 1GQLA 4I9AA 1QK0A 4AG0A 1NFPA 3WF3A 1UD3A 3EOUA 3PTMA 1BFNA 3S4TA 1UJQA 5I79A 1AL7A 2XYLA 4XG1A 2Z0IA 4WF7A 4JTAA 4LNCA 4AWUA 3VABA 1XF0A 4AD2A 3R0KA 2NSXA 1WZKA 2J7DA 1P0NA 1GYLA 3BG9A 1JEZA 2BOGX 4IP4A 2VR4A 5DT7A 2P5NA 5F2IA 1TPB1 4ECLA 5BCAA 1OINA 3L66A 6TAAA 1CX9A 5KTLA 1XC4A 2EO7A 4Q8UA 5I3IA 2WVVB 5DELA 4HA1A 3RM8A 4EXAA 1QU4A 3M4HA 3H23A 3MO7A 3S42A 1BQGA 4DBEA 4LCRA 1H1ZA 4C6EA 5AC5A 1S1PA 3AFBA 1JPMA 4DBDA 5I24A 5CSYA 4ZE5A 1YDOA 3EX1A 4XD4A 1FWIC 4LOCA 5BYWA 1DE5A 3PJTA 4IP7A 1SMAA 4PB5A 4Q4RA 5A6TC 2R82A 1E0WA 3NQVA 5PTDA 1N8FA 2BVTA 1VJIA 3B97A 3OEXA 1E6QM 3LA4A 2A5HA 1E4MM 3A9IA 3NDZA 2EPKX 2PDFA 4M56A 5GPRA 4OT7A 4WSKA 3KBNA 3SCUA 3VO0A 3J7HA 2DSUA 2ZX9A 2PI6A 3FSUA 3CAWA 1JNDA 4QJ3B 1RY8A 2OSWA 2GQAA 1CXIA 2IPFA 1MUWA 1K6AA 3OZOA 2F6UA 1P6CA 2VVNA 5J8LA 2DQXA 3BG3A 3VDCA 5KETA 4POCA 1E6RA 4CQCA 4DX3A 4GBDA 2D1ZA 1CXEA 4OUIA 4UR9A 1OZQA 4QROA 5D30A 1QMLA 5K9XA 5CG0A 1LCOA 4UWMA 4ATWA 3GS6A 2VC7A 2Q09A 4QS6A 4XSLA 3WBYA 2V9DA 4O0KA 1UA3A 3IGUA 4GZ7A 2WW5A 5M3WA 3QV8A 5A69A 2WMGA 4REQB 3SECA 3NQMA 4PUMA 3ECQA 5TIMA 1XJBA 3GK0A 4YVXA 3KCOA 1P48A 3VKBA 4HCDA 4HU3A 1EBHA 4JY8A 4GIRA 1RLCL 1DIOA 5CZ0A 4E8CA 4I9JA 3UY7A 4LY8A 1F6KA 4EXQA 5FA5A 2VKZG 3PY2A 4ZFCA 2ZADA 4RL3A 3NQCA 3VGBA 3TFXA 2HXUA 2JKEA 4A8IA 1KM4A 4AY8A 1DXFA 5JIPA 1KQYA 1AQ0A 3AIWA 5U4NA 3VIIA 2PC8A 2ZUVA 1ZSXA 3SBFA 2GOKA 2E09A 1HL8A 1MDLA 3HMJG 4C1NA 5DN1A 1VR6A 3R8HA 3WQCA 1CBGA 2EG7A 1JPIA 2D2JA 3MWAA 1UD8A 4H8NA 1N8IA 3PSWA 1EL3A 3GW3A 3DFQA 3DXIA 3O07A 2YDSA 4OZOA 1A80A 4EOUA 4LT9A 4C6BA 3TC6A 3W86A 1WDWA 3ANVA 3BW3A 4DHGA 3TOYA 3QZAA 1X6LA 4HHMA 3C2FA 4AAJA 1F07A 4IM4A 4IX0A 1QI3A 1VHCA 4M8UA 1Y7VA 1NDWA 3UU0A 4XZ9A 1Q6RA 5D33A 4LNYA 4UOZA 5DX7A 3BSHA 4TMCA 4K2SA 4DJDD 1KV5A 4I7UA 4DJED 3ITXA 1E5NA 3HN3A 2Z7GA 1TV2A 1DQXA 4PMZA 2QCNA 1QI2A 1RBAA 4LVAA 3SIZA 2BG5A 3EDJA 1ZU8A 1XIGA 1NIUA 1O7AA 1W2VA 3AXHA 3PZOA 3OVPA 1JF5A 4U5IA 2VRQA 1TRIA 1OF8A 3NOEA 1UKQA 2OZ8A 2NQHA 2J78A 3UG8A 4HJFA 2DW6A 3VX0A 4KFOA 2YGYA 2F2KA 2EG8A 3MCNA 4L6HA 3W7JA 1CGWA 2EKGA 3NTYA 4GQGA 4XBKA 4EWJA 3WLNA 3W9ZA 1CLVA 4PSRA 4ZQMA 1DJWA 4K7YA 4UC5A 4YXGA 4YVPA 2IPWA 2BY2A 5MF5A 4ACZB 2WSYA 1Q6EA 3LHYA 1NTHA 1HP5A 4RZBA 1XLGA 3MA8A 2OEMA 1SW7A 1OFAA 2HISA 3WNLA 4JQ2A 1VLWA 4ADUA 3F5KA 3LLDA 3ZM8A 1QT1A 3IACA 4Y2WA 1PKYA 4Q8QA 2GSEA 4Q8PA 4GYJA 5I78A 3T8QA 3UW6A 5CJ5A 4O0ZA 4ZSUA 5AYIA 4WDWA 1ZALA 1RK6A 1OC7A 5T9CE 3ARYA 3E96A 3OW1A 2QUTA 3NGFA 1J10A 1RCOB 4O11A 1A53A 4FOKA 2V3FA 3UR8A 1RY0A 2O4QA 1UBSA 3VNZA 3GE7A 4R27A 3RCMA 3PG8A 3SCQA 2BZNA 3FKKA 4HU8A 1AMYA 4H04A 3WLHA 4AF0A 1V02A 3UCDA 3GDTA 3WNPA 5FL0A 5GNZA 4B3ZA 3E1F1 4Q8VA 1XFCA 3NJ3A 4HNTA 3W1AA 4NJIA 3NQDA 2Y8VA 3ONBA 4KBXA 3F5LA 3QTPA 3WLPA 3NZ1A 3R79A 2QCMA 3WH7A 1MDRA 2D23A 1UPPA 1TJRA 1NM9A 4P8XA 2IQDA 1LBFA 1UMLA 5AYBA 3HIJA 2ZIDA 4DM1A 4HOZA 2ZRWA 1TPWA 4H6EA 3JRKA 4WY0A 4BZYA 5IHSA 1HG3A 1UH2A 4DJFA 4DPQA 1B1YA 4AH7A 1NWUA 3H12A 3IWPA 4MSSA 3HO8A 2X1SA 2O9RA 1TZ9A 4JN7A 1AJ0A 3NL3A 1WDQA 3GHRA 3N4EA 3V5FA 5IDZA 2Q6ZA 4L4MA 2Y61A 1JAEA 3DHFA 2BS9A 3MUIA 4UR7A 1E3ZA 4DLMA 3T2PA 2XSAA 2C8NA 5AB3A 2NT1A 1V6UA 2IQTA 1PJ9A 2TYSA