2E6DA

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with fumarate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
312
structure length
312
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
publication title Structures of Trypanosoma cruzi dihydroorotate dehydrogenase complexed with substrates and products: atomic resolution insights into mechanisms of dihydroorotate oxidation and fumarate reduction
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 105
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2e6dA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2e6dA01
2QCEA 3FYOA 3TAKA 2XFWA 3UXDA 3NL5A 2J24A 4FNPA 5DY2A 4YCOA 1S5WA 3IIZA 3QF0A 1OYAA 3E9AA 1K7EA 3BLEA 1ZFJA 1GTEA 4AAJA 3W76A 4TMBA 2ZDRA 1OFRA 2D73A 5EPDA 3PR2A 4AVFA 4G1KA 1BKSA 1EWDA 2H8ZA 3THQA 2NX3A 2ZRWA 5AYYA 4Y96A 2WSYA 3RK8A 1WYIA 3GKFA 1EPXA 3W2NA 1SZGA 4M5PA 3S8HA 4TIMA 3P8IA 3N2MA 1KW1A 3I7SA 4FNRA 1M5WA 3LDVA 4FIRA 3W2MA 1H7PA 2CZ5A 2RKXA 5AYZA 1WQ5A 2DJLA 2J9ZA 1NFBA 5HWMA 5I3KA 3NQ8A 4JTUA 1KTBA 2ZZ4A 2CLIA 4MZ1A 1JCLA 3F1QA 3GDMA 4MIMA 3P82A 2E77A 4Z0SA 2GUUA 5LHFA 3NQ2A 1TJPA 4LVBA 4DPQA 3LB0A 4JTJA 1FDJA 1P0NA 3NQEA 4QM1A 4BK9A 3W72A 3L9CA 1F76A 1YDOA 2Y70A 3QM3A 2TRSA 4A22A 3N9SA 3TKFA 3WFAA 4JY9A 1G7VA 4NJJA 3P67A 4O1DA 1OX5A 5KZMA 4HN4A 2X1RA 4UIOA 3STFA 4QNEA 3BVJA 3DFTA 3W75A 3W7JA 3TROA 2NXIA 1A5CA 3SECA 3DKJA 1QPRA 3CQ0A 2A7PA 3EX2A 1NVMA 4MYAA 1OFPA 5F4WA 2GQ8A 3LLDA 3KRUA 1OK4A 2QAFA 3SJ3A 5AB3A 5IM51 2QJGA 2Y62A 3MYPA 4O1AA 4LVDA 1CW2A 1CI1A 4LOCA 5CZJA 4O12A 1OX6A 1FDZA 1GYLA 4HKPA 4JYEA 3VNDA 3IGSA 4TU1A 4TX9A 1E51A 3TDFA 4WUIA 2JK2A 4GBUA 1Z44A 3NM1A 3E0IA 2C19A 4QITA 5KSWA 1KBJA 4UTKA 3V75A 3HF3A 3W7IA 3IIPA 3W2UA 1VZWA 5BNKA 1X7FA 1QPOA 4HSOA 1PIIA 3NQAA 3P62A 3QPZA 4K7YA 4PCFA 1A50A 5AOUA 1UUOA 4ORMA 4MOZA 3L21A 2GJNA 2BZNA 3G1VA 4TR9A 4JX6A 4NX0A 3OVRA 1R2SA 2FB2A 1VYRA 1W31A 3E12A 3W7OA 1EWEA 3DAQA 1LRQA 3HB9A 5G2IA 4FB7A 1TTIA 1VCVA 4WOQA 3KRSA 1EIXA 1I8JA 3VKJA 1IXNA 3CPRA 2EAWA 3TNOA 3UWVA 2XN2A 4UTMA 1FXPA 1P4CA 3BLIA 2ABBA 1GJPA 3W2LA 1N7KA 2PRMA 2ZCGA 4AHQA 4OWGA 3STGA 2RDWA 4PL1A 3WJSA 1DQWA 1EA0A 5CZTA 3B0PA 3LERA 4FXRA 4O10A 4ICNA 2GQ9A 4O17A 2JGQA 3G1FA 1VPXA 5IBXC 2Y7EA 4LVFA 1HUVA 3TCEA 2YW3A 1IXPA 1I2OA 4LS0A 3SW6A 3CWNA 2HSAA 1M6JA 5D2TA 6ALDA 3VCRA 5C2XA 4RJEA 2E6DA 5BOOA 5CPOA 1MXSA 4AMAA 4DF0A 3DH7A 4NJGA 3EEGA 4IMDA 4DELA 3TMQA 2HMCA 4K8HA 2YYTA 3SI9A 2JKAA 5CSSA 4RXGA 3ABSA 3NPVA 4OU1A 3W1PA 3IRDA 4KWWA 1T99A 1VR6A 3PY2A 4K8EA 3GXPA 3UZJA 4L4MA 1JCYA 1LLZA 3IIXA 1W0MA 3IVUA 3S1UA 2Q8ZA 2NV1A 3A9IA 3IVSA 3A23A 2C0AA 1B4KA 3LCIA 2R91A 2VFGA 3WJYA 3LLFA 3KOFA 3QMRA 4FHAA 5HR7A 1SFLA 4CLMA 4XZ9A 3GVGA 4LRSA 4MJMA 3TSMA 3U2OA 2QUTA 2H8XA 2Z6JA 3PB2A 3L67A 4K6AA 2QCCA 3G3DA 3C2RA 2A7RA 2ZTKA 1ME9A 4Z1AA 2WNZA 1SUXA 2FJKA 1FWTA 3MUXA 3PS7A 2FB3A 3TXZA 2ATMA 3C6CA 3RFAA 1TB3A 2ZZ1A 3OVPA 1GEQA 5E93A 3EWXA 1L6WA 1PCWA 2QDHA 2Y89A 4GUJA 3W1TA 3LRKA 1XDLA 4UFLA 3FJ6A 8TIMA 3W7GA 1AK5A 3A5FA 3ELFA 1Z42A 1OYBA 5DCBA 3OBKA 4JNMA 1EUAA 4H4IA 1VCGA 4HNVA 3M6YA 5J5DA 3TV8A 5K4ZA 1TV5A 3O1NA 3BG5A 3KVLA 5I3JA 2P0OA 5HUPA 2B0MA 5K7JA 4CCEA 4JTTA 1AW2A 3IEBA 3N2XA 1QFEA 1TCDA 3MYOA 3M5VA 1NSJA 3N14A 1X1OA 3NQDA 3TSBA 3MP3A 1PE1A 3LHWA 2ZA2A 5D38A 1ZCOA 3F03K 1RZMA 1QR7A 1IIGA 1I2NA 3PBVA 3C4UA 2PRHA 3PAJA 2ZQ0A 4IPIA 5CPNA 3BV4A 4NT0A 1WDWA 4FEZA 4N4QA 3W7PA 3HGSA 4JICA 2AAMA 2J88A 1NAL1 3GDKA 3F4WA 4O4VA 3W7EA 3B0UX 4JD4A 3E49A 3LHUA 1FCQA 2TPSA 2BWGA 3KXQA 3MW7A 5K9XA 4XTDA 1WBHA 1VHNA 1GTHA 1WOBA 2EF9A 4UFMA 4WX2A 3CIWA 3NQ7A 2J6XA 3R5EA 4BWLC 2R14A 4UFIA 5I3IA 1KV5A 4K38A 1NF0A 2WSQA 5CG7A 2FFCA 4HNNA 1LRNA 3FIGA 1VYSX 3ATYA 4DXVA 5G1TA 4ADUA 4WOZA 1U83A 4MZYA 1GQNA 4GFSA 2CLKA 5K2ZA 4Z1DA 4JN6A 1LYXA 3P60A 3W1LA 4O15A 3S5NA 4LC8A 4N4PA 2DZPA 4OV4A 3FKRA 1PVNA 3IV3A 5FEZA 2QCLA 5G2WA 3DBPA 4RX0A 4LV4A 4HHPA 4JYDA 1Q3NA 5FF7A 2C16A 4CNOA 3STEA 3GLCA 2C14A 4JTIA 1GG1A 4JDBA 1JCNA 3LCLA 3R2GA 2ZZ3A 4PL2A 2WOQA 5H91A 3E96A 1ZJIA 4O53A 3BPWA 4FF7A 3TUUA 3DI0A 1TPC1 3I68A 3MI2A 4S2BA 4JTKA 1C8VA 4LUJA 4IMEA 4JIQA 4MY8A 4IUOA 3H54A 2QF7A 1LORA 1B57A 4CNNA 2A85A 1GT8A 4EWND 2G96A 2QJHA 3S0CA 1YADA 1KTNA 1FQ0A 2ZRUA 4N2YA 4UTTA 2YSWA 2VENA 1MEWA 1WX0A 3QQ0A 3L0KA 4KFOA 5D03A 3CTLA 3TW6A 3DKLA 3UWYA 4IWWA 5I3FA 1MEIA 5E0KA 5D2YA 2B4GA 4NX5A 1TIMA 2ATSA 5HULA 3C0JA 1SO3A 4X3ZA 1K02A 4LU0A 5AHIA 1YXDA 4DO6A 3LHZA 3L0NA 3DFPA 1W5PA 3VE7A 3KVKA 4KFPA 3B06A 4MLRA 4CQAA 3TQ0A 3WK3A 1HTIA 2XN0A 2J27A 3M9YA 5TBOA 3NZRA 3GDTA 1VGAA 3W73A 1SPQA 1H7XA 4JYFA 4Y9AA 1F73A 3W86A 4JGDA 3LHVA 1QMLA 3TIMA 3C56A 3S42A 4ONVA 4XWUA 5AHLA 3G3MA 4DO5A 1LLWA 5DCDA 4IOTA 1VS1A 3W7NA 5I3GA 5G2HA 1TYGA 4WD0A 5HQEA 3W1UA 2V9DA 1DOSA 1W37A 3LV5A 2VFDA 3G1YA 2E6FA 1QDSA 4YCPA 3PBWA 3G1AA 3W22A 1S5VA 3FA5A 1CX9A 4EF8A 4BFAA 3U8GA 4FNSA 3HQ1A 1TJRA 4FX8A 2JKEA 3CEUA 2GQAA 3PUDA 4PA8A 2CLOA 2Y6ZA 3M43A 4RR4A 4B5NA 5CPMA 4UTHA 2A2IA 2G95A 1YDNA 3O15A 4NJHA 4R33A 2VKZG 3AJXA 3MHGA 3JR2A 3PSVA 1SW3A 2HS6A 4PTNA 5HJLA 3TQVA 3LBCA 1JQXA 1OFEA 2A21A 2Z0IA 1ZALA 4BR1A 3T4CA 3LTSA 5BW6A 1DBTA 1B3OA 3ABOA 1MZHA 2QCDA 1O94A 4RZ6A 4Z08A 3DHDA 1I45A 3I6RA 4M7SA 1TSIA 1TPUA 5AHEA 2NXGA 2NXHA 5CZ0A 1GZGA 4N02A 1R2RA 1TRDA 2QUUA 1AW5A 2ZRZA 1VC4A 4LTSA 4IMGA 2I14A 1UASA 3ZFHA 3ZS4A 3EWYA 2V2CA 4UC5A 1QAPA 5SWUA 5EY5A 1MSSA 2G5WA 1EB3A 3PBUA 1BWKA 3LXCA 5I3HA 4ZMGA 1OFBA 4I9AA 4RXFA 3DENA 4O16A 3W1NA 4QNWA 4O4WA 2A0NA 2CLLA 1L9WA 4UTWA 5U7SA 5LNRA 4A2RA 2OT1A 3LXAA 4MLJA 4O0ZA 5L6UA 2Y88A 2VC6A 4AEOA 4JXCA 2VFFA 4MZ8A 4N6EA 1XXXA 3NG3A 1KLZA 3G1XA 3P80A 3OIXA 4NXSA 5TIMA 4M6QA 4X9SA 4Y90A 5D09A 4UMBA 4O52A 4UTWC 1QOPA 3WK2A 5G5IA 3LHYA 3D0CA 1EUNA 2O7SA 5AHNA 1TMHA 1F05A 3W70A 2VELA 3QZEA 1T96A 1Z41A 4IGHA 2EGZA 1T0OA 1TQJA 5F2LA 4D2JA 4NU7A 1EP2A 5D32A 4E2DA 1ZAIA 3QSRA 5AC8A 3PUOA 1N8FA 5FF2A 2NUXA 3MP4A 1A53A 2WJZA 3M5XA 1M7PA 1KM5A 1YTDA 3FFSA 5CSRA 4NNAA 1WA3A 1PCKA 2I1OA 3GAYA 1RQHA 1QO5A 5DLCA 1KM0A 5DXXA 5D02A 3W7CA 2R94A 3RF9A 3RLUA 1TO3A 3EB2A 2YW4A 1THFD 3EWUA 4IQLA 1QWGA 4UCGA 3C2VA 4X22A 3P84A 3G1SA 3I7QA 1G67A 2FPYA 2YFNA 4FNTA 4XBKA 2ZRYA 2UV8G 2WQPA 3CEPA 3O07A 4JTHA 1HFBA 1O5XA 1OK6A 3MBDA 3EWZA 4XKYA 2Y7FA 1HL2A 3TA6A 1XUUA 5DY3A 1W3NA 2IQTA 4A2SA 1LDCA 4AB4A 2RHGA 4ADTA 3G0UA 3S6DA 2J9XA 2Q3OA 4OV9A 2QCMA 2NX9A 1X1ZA 1AW1A 3B04A 4HNTA 1XDMA 3WK1A 1Q6QA 1SZFA 2Z6IA 3L5LA 4C1KA 5AYXA 3A24A 3N19B 1I2PA 2VXNA 3GDLA 3BARA 3TX9A 3HPXA 4FO4A 4JTSA 3TQKA 3O63A 1W3TA 3S5ZA 2YX0A 5KZDA 3H53A 1ZHAA 4UTLA 2CZDA 2DZWA 3QPYA 2W0UA 4UR8A 3C2FA 2VFHA 3DFOA 1P1XA 4IPJA 4ML9A 2X30A 3GXTA 4NNCA 5BMWA 1K03A 3GYEA 3YPIA 2Y61A 4OQVA 1H1YA 2TYSA 4RZ4A 4GE8A 4UFJA 5HINA 4M19A 1MO0A 4UR7A 3S5OA 4K37A 2NLIA 3SIZA 3DI1A 1OYCA 3ZWSA 3HGOA 3GNDA 2C6QA 1TPFA 5F1VA 1GVOA 4UXDA 2DZSA 4O57A 1FCBA 3MI3A 2TSYA 3DXIA 3EX4A 1XM3A 5LNWA 3IGUA 3M0ZA 1GVFA 1LROA 2EKCA 3SFKA 1RQEA 3TU9A 3LCHA 1SU5A 1TTPA 1T8XA 1W54A 5LNVA 3W3OA 3W1AA 1KTCA 1FCUA 2ZA1A 3LBMA 2V8ZA 2Z2UA 3KVJA 1DJQA 3L5AA 5A5WA 2Y85A 2QR6A 3M41A 5HR6A 5D37A 1TTQA 3W84A 1JCXA 1Q6LA 1UUMA 1AMKA 1H7RA 5G1YA 4P61A 2EHHA 4Q33A 3HOJA 4GUGA 4O18A 5F1UA 4M6PA 2A1YA 1SO6A 4JR5A 4HIBA 2X16A 3O06A 1VLWA 4TMCA 2QCHA 4O13A 4UNLA 1KM1A 2NWRA 3N9RA 4ADSA 4MUZA 5D30A 5HMSA 3BG3A 2ISSA 4M6VA 2NX1A 4MVAA 3W7KA 1YTKA 3EXRA 1G4PA 3UWQA 4AWTA 1KFKA 4MY9A 4EVZA 3LCXA 4JEQA 4JTLA 3LCWA 2CU0A 3L65A 4Z0JA 3NL6A 5LNSA 4UTIA 2QJIA 3TMLA 2NZLA 1H5YA 3KAOA 1YPFA 2Q8LA 1XI3A 3BW3A 2E68A 2DORA 3DU0A 3NQCA 1OJXA 3MWAA 1XC4A 4Q4KA 2V2HA 4BI7A 1G69A 1VLIA 5G4WA 3C2OA 1FXQA 1I2QA 3JRKA 3C8FA 1RV8A 3N3MA 5LKYA 2WNQA 4JTFA 3HMJG 1DKWA 2FIQA 4C1LA 5K9DA 4WXZA 1YXYA 1HG3A 3NEVA 2OCZA 3QW3A 4JDYA 1OFDA 5F4SA 1VYPX 4IJBA 3T40A 6TIMA 2DZUA 5J5RA 3WJWA 1FWWA 2FPTA 4DF1A 1WV2A 4O28A 3LTYA 4RCXA 3LXBA 2WPBA 5DN1A 3LCFA 2C13A 1XBYA 5CZSA 4DF2A 4O0KA 4AWUA 3UQNA 1GVSA 5KITA 4O11A 4DPPA 1K8ZA 4R34A 2E09A 1DJNA 3LOTA 2CWNA 3EKZA 1H51A 2ZRVA 3HPZA 3CIXA 3KFTA 4MYXA 2BLEA 3ZR4A 3LI0A 4JTEA 2E5CA 3W71A 1GVQA 1YLVA 2BTMA 5D2VA 1YTEA 3QJAA 1G7UA 4IXHA 3W7DA 1Y0EA 4BF9A 2B7PA 1SFJA 4NJKA 3NA8A 3Q58A 4O1BA 5DELA 2X2GA 3TR2A 1KM2A 3NOEA 2QCDB 4E0CA 1IF2A 3QEZA 3HIJA 1LTDA 4UTUA 5KINA 3L0GA 3QSTA 1G4TA 4YLWA 4I7VA 3JS3A 3EXSA 1TPH1 4K39A 1W5NA 3UZ5A 1JCMP 1KFLA 1K7XA 4RLIA 2CLMA 1KFBA 1PHWA 2ZZ5A 4O14A 2VFEA 4ZQRA 3OEXA 7TIMA 1FX6A 3NNTA 5D05A 1VHCA 2A4AA 1H61A 1FBAA 4GXMA 5LNUA 3PM6A 2X1TA 5FF3A 1YPIA 4N9BA 1K3UA 5CKSA 4FX7A 3NPWA 5T26A 1S5TA 5CPLA 2GVLA 3BLFA 1VCFA 5EL1A 3W2JA 5GVJA 3L66A 3HG5A 4ORIA 4E38A 4O54A 3GK0A 2CLHA 5C5YA 3HG3A 1S3HA 4PH6A 4U4MA 2CZEA 3S1VA 3U6WA 2F84A 1P0KA 3NQ6A 4UMCA 2I9EA 3T7VA 3NPXA 4QSHA 2FLIA 1BEUA 1R47A 3TC6A 5FEWA 1KFEA 3G1DA 4QAIA 1O5KA 4S2CA 1Q6OA 2YPIA 2VEMA 4CCDA 2W6RA 3FEMA 3PB0A 4A21A 3M7WA 3N73A 1X8FA 2WNNA 3FS2A 4R53A 3F4NA 2P10A 1UB3A 2QKFA 4PEKA 2YCEA 1FWSA 3ZWTA 1LCOA 4OHQA 3S1WA 3C52A 1TPEA 1IXOA 1FCVA 4CCCA 3AO0A 4UTTC 4HNUA 2QCFA 3GIYA 5E1QA 3P8JA 2PE4A 2Z1BA 3ABRA 3C61A 1KBIA 1W8SA 3S9YA 4MFEA 3EWBX 5EMUA 3PG8A 3R8RA 3R13A 4NVTA 3EX6A 2DU2A 5MHBA 1DV7A 4KWVA 2VFIA 3W87A 4XKYB 5LSMA 1JCJA 2NWSA 3NL2A 2C3ZA 3HG4A 3KX6A 2WV8A 3M1ZA 3TH6A 1ME8A 1MEHA 1HO1A 4OGZA 3P5YA 5FEPA 1FUYA 3M16A 4EIVA 1W5OA 3GKAA 2RFGA 5A8GA 1XKYA 3EX3A 3W88A 1J2WA 5FEXA 3Q2DA 2DZVA 3T78A 5HWNA 3CLMA 4LVAA 3NR0A 4WJEA 3GR7A 2W79A 4GUIA 4RK8A 4CQ9A 1O95A 1NEYA 5LHEA 3ABQA 2BSLA 5ABTA 2C1HA 2YFOA 1I2RA 3NYZA 3PULA 5C55A 4O1CA 1ZY9A 2V2DA 1WAUA 3NL3A 4LWWA 4AHOA 1KM4A 3O6CA 3W1QA 3PVFA 1C29A 3CWOX 4GWEA 3I7RA 3W7HA 4QIUA 4IX2A 2QDGA 3LTPA 1SW7A 3B8DA 3MI6A 3NQVA 1BWLA 4AH7A 2CLEA 3KRZA 1XCFA 3HGRA 1TTJA 1TV8A 1DORA 1A5BA 1K8XA 2ABAA 4DEFA 2BXVA 1ZAHA 1F2JA 3E02A 1ICQA 1AG1O 2CLFA 1H7WA 5U4NA 1OX4A 3G1HA 4AF0A 3SGZA 5HNRA 2X1SA 3QQ1A 4BI5A 4EOUA 2GVJA 3UPBA 1LZOA 3W1RA 2E6AA 2BX7A 1JVNA 1SR9A 4MKNA 3V1PA 1JUKA 3FOKA 3RMJA 5FESA 5HUOA 2YYUA 4NUWA 1RPXA 2WO5A 4HPJA 2ZBTA 1F5ZA 2PC4A 5BMXA 3DZ1A 2ZA3A 2Y7DA 5AC7A 4BI6A 1G6CA 1ML1A 3BGGA 4QJ1A 2XN1A 3L5MA 2P1FA 4MFDA 3Q94A 3VFLA 4WY0F 3USBA 4ZL1A 1OFQA 3B05A 3DGRA 3CC1A 1EEPA 4UFKA 2QEZA 2YXGA 5FF0A 5HWJA 4LRTA 4UFHA 1FDYA 2GOUA 1OFAA 2CZFA 2V81A 3SZ8A 1O60A 1SO4A 1J4EA 1F6PA 2FQIA 2ZZ6A 1Q45A 3MO7A 4FNQA 1RR2A 3GZ3A 4XBSA 4I7WA 4NQ1A 4POCA 1XBVA 1J5TA 1XFBA 1XBXA 2JBMA 4GRSA 3STCA 4MJZA 3O6YX 3GXNA 2X1UA 1JRBA 4JY8A 3W1MA 3FYPA 1GVRA 1XL9A 3BW4A 2ZZ2A 3OHIA 1VRDA 3TC7A 4FX6M 3LCGA 4OT7A 3VE9A 3M44A 1I4NA 2DJXA 5KTLA 1JQVA 1FWRA 1R30A 2AGKA 1KFCA 1EX5A 4HT3A 4OE7A 1SSDA 1JUEA 1H1ZA 5LGZA 4IXXA 4NXKA 2RDTA 4UTJA 5EA9A 5TQLA 1PL9A 3K30A 3L68A 1UCWA 2ZRXA 2ZFAA 1YDVA 3P7YA 3B0VC 1OABA 3C3NA 1RQBA 3NQFA 5DXYA 1SQ7A 3CT7A 3BG9A 3MMTA 5AHMA 3NDOA 2DZTA 2VEKA 3P61A 3NAVA 4O50A 3G24A 3LX9A 2Q3RA 3EWWA 3GX9A 3FKKA 4N6FA 2YDAA 5DBUA 4XTIA 1N55A 5F2MA 4WY0A 4UMAA 1TREA 5CGQA 3TK7A 3W23A 4GUHA 3M47A 5K9CA 2VOMA 3P81A 4NZFA 1DHPA 3TAOA 3W1XA 3VI2A 1LM1A 3TFCA 4FNUA 3T55A 4GNJA 1IIHA 1RVGA 1ZNNA 4L4LA 3CU2A 5C6MA 3GDRA 2GVGA 2VEIA 1UJPA 3PG9A 4WQ6A 3UXAA 3WJZA 3DFSA 1WBJA 1SZEA 3W7LA 4AXKA 1JR1A 2CW6A 5AN7A 1V7YA 3R89A 2Y63A 1GWJA 5KMYA 1D3HA 1YYAA 1LRTA 3W07A 4LUIA 1A5SA 1KFJA 3W83A 3DFQA 1WOAA 3QH2A 3QMTA 1KLYA 1KM3A 1HO4A 1XUZA 4LT9A 3T44A 2V30A 1H50A 4XQ6A 1OFOA 4N9DA 2ZTJA 1V5XA 5EBUA 1G4SA 1NF7A 1LOLA 1PV8A 5IBXA 1EP3A 3SR7A 1H60A 3PC0A 3UPWA 2FPVA 3W7QA 2WSRA 1TV7A 2A5HA 3P5ZA 4NJIA 3B03A 4CQ8A 4WXYA 1KA9F 1JUBA 3G8RA 4N9EA 3GAKA 5K3VA 1UBSA 1AL7A 4ZZ9A 1SSGA 4DO4A 4HSNA 1VQTA 3PF3A 4NNBA 3RNDA 2OZ0A 1B9BA 3NPUA 1R2TA 3W9ZA 4IX0A 3PWAA 2H3DA 1SW0A 2E5DA 2JKPA 4QISA 2QCGA 4XUGA 3MJYA 3HGJA 3NZ1A 4LS1A 4UNKA 4JX4A 3G8EA 1FY6A 2ZYFA 3RU6A 4KFNA 4Z1BA 3BW2A 3QW4B 4LC6A 5EYWA 1GPWA 1H7OA 4LW7A 4O19A 3HBLA 4ZQNA 2FTPA 1B4EA 3UD6A 2YR1A 3NO5A 1Q6RA 2A7NA 1YXCA 3B4UA 2E5BA 4W9TA 1JRCA 1ONRA 5AC6A 4CNPA 1K8YA 3QC3A 1L6SA 4GC4A 1GYNA 3TJLA 3UNDA 3MHUA 1ALDA 3INPA 3G0XA 2F7FA 4A29A 2NV2A 1KV8A 1WXJA 3BK0A 3P74A 4H6KA 1ZENA 2C18A 4YMZA 5L9FA 2OX1A 2ALDA 5D2WA 3I65A 1ZAJA 4AWSA 3BO9A 1TPDA 4JX5A 2H90A 4DBEA 3W2KA 1D9EA 2YZRA 1ICSA 5AHFA 5D2XA 4Z1CA 5KZEA 3KVMA 1FWNA 3LM7A 3DHFA 1OF8A 3TJXA 5DBTA 4S1FA 2NUWA 4YL2A 1LBFA 1ME7A 3QMSA 5F2IA 2A6LA 1G4EA 4GJ1A 4MY1A 4J9JA 4PODA 2DZXA 4GUFA 3WK0A 2B7QA 3EKLA 3FLUA 3O05A 4PC8A 2ISWA 3NM3A 1JJKA 1A5AA 3IIVA 3OA3A 4DQWA 2QAPA 1F6KA 2V5BA 5C54A 2RH9A 3L2IA 4Q32A 2WKJA 5F2GA 3TXVA 3LGEA 4LY8A 2B7OA 4PFMA 5FF4A 3CM4A 4H3DA 3LRLA 3A21A 4LV9A 2CFFA 4BWLA 3G18A 1K7FA 5AFDA 3S1XA 1DVJA 1L6YA 3G0SA 1TPVA 1OX4B 4P2VA 4AF0B 3UY7A 3NGJA 1Z48A 1W56A 2FDSA 1W1ZA 4WZHA 1TQXA 4JTGA 3FJLA 2JGYA 3HJZA 4ZQCA 1TPB1 2NUYA 2TMDA 5FI8A 3TE9A 4Y8FA 4IMCA 4UUIA 1QNVA 1W5QA 1U5JA 1L2UA 1JULA 4AHPA 1SO5A 1OVDA 2PRLA 3UYCA 4ZQPA 1QCWA 1R46A 4O8RA 3SY5A 2V82A 4ALDA 2RDUA 5H2ZA 1M7OA 3C2EA 2H3BA 2E1DA 3W74A 1VJIA 3SGUA 3Q37A 3M5YA 3HPSA 2B7NA 4RZ5A 4N9CA 1LOSA 2GJLA 4ZQOA 4E2BA 1DL3A 3A22A 1H62A 2A6NA 1QOQA 3KHJA 3N34A 3NVTA 1RD5A 3PSWA 1XBZA 2R8WA 2GPTA 2EPHA 4I7UA 4Y6GA 1PS9A 3S5YA 2J9YA 3W85A 3SSJA 5BRBA 3W7RA 1SZNA 3DFNA 4A3UA 3TSDA 3W7MA 3ATZA 1OG0A 1LBLA 3IVTA 3LV6A 3UY8A 2E6YA 5F4XA 3QFEA 1GOXA 3IIOA 1ICPA 2OT0A 2O7QA 3O16A 1C9DA 1OF6A 3O6DA 5DCEA 3LI1A 3GB6A 4QQ3A 3NQGA 2OJPA 1W5MA 3CHVA 4LVGA 4FIQA 4ZVJA 2PCQA 3UWZA 2KZHA 1DQXA 4YWIA 4LS2A 1KM6A 3G22A 4M7TA 3LRMA 1TPWA 4JS3A 1H63A 2VEPA 3WJXA 1LP6A 4EF9A 3LHTA 3QYQA 5K4XA 3MP5A 3NXFA 3W6YA 5EKYA 1W3IA 1QPNA 1EP1A 1X6UA 3R12A 4HPXA 3GNNA 1F7BA 4JIPA 4ZQMA 5G4EA 4K36A 3MBFA 2LLEA 3EXTA 2G97A 3HO8A 1P5BA 4NZJA 2H6RA 3OG3A 1LOQA 2YGYA 4WY0B 3HG2A 4YXGA 3NQMA 1O4UA 1PHQA 3QRHA 1LBMA 1F74A 1TRIA 3H55A 4RV8A 4DBDA 2Y7GA 3TW7A 3ANYA 3MHFA 1AL8A 3OVQA 3GR8A 1IXQA 3PUEA 4X2RA 3EX1A 4K7VA 2AQWA 4IMFA 1GG0A 1OHLA 3A5VA 5D04C 3UWWA 3O8AA 1VH7A 2DP3A 3UWUA 4OBTA 3IGXA 3PBYA 2V0TA 5D33A 3BGJA 2ZZ7A 4KKXA 5LZLA 5LGXA 2C15A 2V5LA 2QUVA 1QPQA 2HS8A 1QO2A 4LNYA 2PURA 4MPQA 1H7NA 1IGSA 2QCNA 1D3GA 4FXSA 4U28A 1ADOA 3TFXA 4TO8A 3RLVA 2ISVA 4R7JA 3THAA 3M5ZA 1BTMA 4RKAA 2HTMA 3CB8A 2OMAA
chains in the Genus database with same CATH superfamily
2QCEA 1VEOA 3GUGA 3ALGA 5DMLA 2J24A 4FNPA 2DT3A 4YCOA 3IIZA 1G9HA 4GPNA 1XIDA 2EPOA 2DW7A 4GKTA 1J5SA 1VIZA 3TZFA 4AAJA 5AECA 1M01A 1OCBA 2D73A 3BMXA 4AVFA 2YKKA 1E4IA 2OSXA 2H8ZA 3GXIA 4R27A 1ZJAA 4GY0A 3EA3A 5AYYA 3GD6A 2WSYA 3RK8A 3GKFA 4M5PA 3TLLA 4ZO7A 3EDDA 4TIMA 3P8IA 3EGJA 1KW1A 3LD5A 4ERGA 4FIRA 2YL6A 2CZ5A 4R7WA 3GM8A 3WEZA 3NQ8A 4JTUA 5CCZA 3L4ZA 2J6VA 1PTDA 1J18A 4MIMA 4KS0A 2XVKA 4GI8A 3SCUA 5BRPA 3A13A 2GUUA 1XR2A 2DPEA 3NQ2A 1AODA 4KEZA 2ZUUA 4B3ZA 4JTJA 1FDJA 3VABA 4MAZA 2OLSA 4QM1A 1XSIA 3BAKA 1GPFA 3L9CA 4F0HA 3R8HA 2CWXA 3N4EA 3TKFA 4HNOA 2VOTA 1G7VA 1J12A 4UB9A 2YZ5A 3P67A 2Q6ZA 1C8QA 5KZMA 3LQGA 4HN4A 4CEXC 1BYBA 4UIOA 1TMLA 4IP7A 4QNEA 8CGTA 3DFTA 3TROA 1FH9A 2YBTA 3FXGA 5F4WA 1HF6A 1OIMA 2ZC1A 2Q09A 3SJ3A 3WELA 2QJGA 4CEUC 4HZMA 2C71A 3UZZA 1NP2A 2AMXA 4LVDA 3E0FA 5C7VA 3LQLA 1V6XA 2OZ8A 4Q6XA 3R7MA 3BOLA 1MQQA 3DYPA 6TAAA 1FDZA 1GYLA 3PJXA 4MKVA 4JYEA 1CXHA 4PRWA 2FHBA 3LA4A 2IKGA 2JK2A 3NM1A 4GZIA 4QITA 1KBJA 3RLHA 3AXXA 3PPHA 1GQJA 1D7FA 2CPUA 3W7IA 1A3WA 2WSKA 1VZWA 5I6SA 3P62A 5D4YA 1UR1A 5AOUA 3KZSA 4MOZA 1BXBA 4DJED 2BZNA 4L9YA 2QS8A 1LWJA 1WO2A 3OVRA 1B3VA 4ZEPA 2FB2A 4PBFA 3E12A 3W7OA 1XICA 3MQTA 1T40A 1LRQA 2FVMA 1H41A 4FB7A 1NTHA 4WOQA 3VKJA 1UD8A 1IXNA 3CPRA 4PMQA 1TUFA 3UWVA 4UTMA 2RDXA 3QBUA 3W2LA 2XJ7A 1XPYA 4AHQA 4H04A 2QVNA 3ZJKA 3NURA 3VX0A 1EA0A 1EEXA 2OGYA 4FXRA 4O10A 4ICNA 1VFMA 2GQ9A 4O17A 4W89A 2OYLA 2IPFA 1OGSA 3KW3A 1VPXA 2Y7EA 1HUVA 4XZMX 1Y8BA 4LS0A 3SW6A 3B4YA 5D2TA 1IQ8A 3OVGA 4EXAA 4DF0A 3DH7A 2E9LA 3EPOA 3CASA 2IKIA 2WHMA 3TMQA 4IT1A 2CBJA 3LZ5A 4U3CA 3LBOA 3GU2A 2JALA 3NPVA 4OU1A 3GY1A 3ERPA 4K8EA 3G5EA 1JCYA 1W0MA 3IIXA 1K1DA 4U2ZA 3IVSA 2VWSA 2PWHA 3A23A 2O92A 1WDDA 2C0AA 4WEVX 2DFAA 3BH4A 2VFGA 2WJDA 2JIEA 1XIIA 2R6OA 5KETA 2D2OA 1XIEA 1XS2A 4FHAA 3GZAA 2R1LA 1UBPC 1TX0A 4QE1A 4E2VA 3AWOA 2H8XA 3PB2A 4W86A 2BY3A 3L4WA 3E2SA 4DYJA 1IZJA 5AC4A 1LQ2A 3QLDA 3MUXA 2FB3A 3C6CA 4X63A 2ZZ1A 3NO3A 1EZ2A 5E93A 1PKNA 1L6WA 1PCWA 1M68A 1XDLA 3NCOA 3TYAA 4D6IA 4LAOA 1VCGA 4I6KA 2D0GA 1TV5A 2EG6A 2P0OA 4UBPC 4EPKA 3NZQA 2FVLA 2D23A 4L61A 4CCEA 4JTTA 1AW2A 3N2XA 1QFEA 1TCDA 3SURA 5ABHA 3WEOA 1XD0A 3TSBA 3MP3A 2OOFA 4DUOA 1GONA 3LHWA 2VTFA 2JFEX 1VFHA 3H22A 4ILSA 1PKMA 5ABFB 4BKNA 1M41A 3PBVA 4F0KA 3C4UA 2PDYA 4IPIA 5CPNA 1OIFA 2CKRA 5H6HA 3KBMA 4V33A 1FHLA 3B8VA 2IS7A 2IKJA 3GDKA 3QC0A 3B0UX 3E49A 3LHUA 1XH0A 4PYSA 1DJGA 5BU6A 3KXQA 1V02E 4AD4A 3ARVA 3RCYA 1HZYA 4WX2A 1V6VA 4JTQA 2F6XA 4XAPA 5I3IA 1V0LA 4K38A 2GVEA 3UGRA 3T9PA 1W9DM 2FFCA 3FIGA 3ATYA 4DXVA 5G1TA 4ADUA 3P0WA 4WOZA 1GCYA 2J77A 4MZYA 1E6QM 4GFSA 2ZUTA 4JN6A 3H2CA 1LYXA 3VDGA 2J75A 3W24A 1LJYA 4LC8A 1PTAA 4N4PA 1F3EA 3CV6A 4CN4A 4XSMA 2QW5A 1UWUA 3STPA 1FKWA 3VGHA 2QCLA 3DBPA 5A6SA 4DBSA 3W02A 4QQUA 5FF7A 2C16A 4Q8QA 4CNOA 4AVNA 1KXTA 3FDGA 3MMWA 3CUFA 3GLCA 3LCLA 5DRIA 2ZZ3A 3GU9A 2WOQA 1W1A1 4LBRA 5H91A 3E96A 3W37A 4MWAD 1QI5A 3BPWA 1RCXB 4XZLX 2ZX5A 3JUGA 3DI0A 1M04A 4BEUA 1TPC1 3QHOA 3MI2A 1A80A 4J35A 2VMFA 4IM4A 4LUJA 2XZ7A 4IHCA 4IMEA 1JAEA 4UR9A 4Y7EA 2QF7A 2OWCA 3A6OA 3ITYA 1KTNA 1EGMA 3AYVA 2DSKA 4DXKA 1SR0A 4P8UA 3IUIA 2VENA 3WH7A 3QQ0A 3TW6A 3ARZA 2WCSA 4JOMA 5I3FA 3E6EA 3VUSA 5HULA 3U2CA 4X3ZA 3T0AA 2W4XA 3N12A 5AHIA 1YXDA 3LHZA 1W5PA 2PDIA 3SUSA 1PX8A 3B06A 4MLRA 4Z2HA 3MUY1 1K4HA 4HK6A 4GVIA 3KCOA 4CQAA 1E6XM 4ERAA 5TBOA 4AZCA 4PB3A 2XM2A 5IRPA 1SVDA 4Y9AA 4LYRA 1F3TA 1DJZA 2WLYA 3GSMA 5T91A 3TIMA 3LS9A 2XWEA 3C56A 3G3MA 3VOCA 4IOTA 3WLPA 1VS1A 3T1GA 4A8IA 5A6MA 3W1UA 1DOSA 1M3UA 4XD6A 3LV5A 1E3ZA 1W8GA 3V4BA 3KZPA 2ZXDA 4PR4A 4BFAA 2X40A 1YPXA 4QS5A 3M64A 1KWGA 2QV5A 1NDVA 3GVVA 3UZWA 2DQWA 4MTVA 1GK8A 4PA8A 2CLOA 2IUZA 1MWOA 2VCCA 4KGLA 4R33A 3MHGA 1MW0A 3JR2A 2HS6A 1E6ZA 4Q6JA 1CLVA 3AHYA 4M1RA 1J0IA 3WLRA 3CS2A 2Z0IA 3T4CA 2WKGA 3VIGA 4GKLA 2V3EA 3TYUA 3TTOA 4Z08A 1I45A 3NVDA 4AQLA 5C9UA 4J3ZA 3BAWA 1RP9A 3F5LA 3UXLA 3MKVA 2GJPA 2BOEX 4LTSA 2I14A 1UASA 3BAYA 3ZS4A 4AUBA 1AQ0A 3S2NA 4LCQA 1QAPA 4H9ZA 5CSYA 1DHKA 5I3HA 4GYFA 4ZMGA 1AH0A 1OFBA 4I9AA 1WP6A 3DENA 4O16A 4DWSB 2A0NA 2CLLA 4WLCA 2D3NA 4UTWA 1IEQA 3P14A 3VO0A 2C8NA 3NSNA 1RK6A 2Y88A 4DYKA 4AEOA 2Z7KA 4N6EA 1JYNA 3QPEA 4Q22A 2J66A 3OIXA 5TIMA 1FH8A 4MNJA 3CZJA 2WQDA 2E25A 4O52A 1QOPA 4URIA 3VIFA 4OOZA 5G5IA 3V3WA 5LIXX 3W27A 3GH7A 1YRRA 2VHLA 4NILA 3IACA 5E6ZA 3WUBA 1T96A 2BY0A 3OTRA 3CPUA 2GVYA 4M1BA 1TQJA 4J3SA 5M3WA 2E4TA 4REQB 5D32A 4E2DA 2HE5A 1ZAIA 3QSRA 2BHUA 2EKGA 1VENA 3U5UA 3B97A 1YTDA 4KRTA 4JFTA 5I02A 1DJXA 5M1TA 4S3CA 5H8MA 3B9EA 3KUMA 2R94A 7ODCA 2Z1WA 3EB2A 4LB3A 3EWUA 2FKPA 1VFUA 4M6UA 1U5VA 4HHLA 2P53A 3I7QA 2FPYA 2YFNA 3L23A 2UV8G 1B54A 3O07A 2DIKA 1O5XA 1KRCC 1EDQA 3DEQA 3N9KA 4XVEA 1UP0A 1TZZA 4G7EA 1W3NA 1LDCA 3SCVA 2RHGA 4GI6A 2XPKA 4LNCA 3XISA 4OV9A 4AIUA 1ZBCA 2NX9A 1JPDX 5C9WA 1AW1A 1XDMA 3GUWA 1ITCA 2EO7A 2YCIX 5LA2A 4YVXA 3N19B 5AVNA 5RUBA 3HPXA 1RVKA 3UJSA 3CUGA 3O63A 3ID7A 3UGVA 2W0UA 4DNMA 2G50A 4IPJA 4ML9A 1RP8A 1Q8JA 4GIRA 2TYSA 3U57A 3CT2A 4X9YA 3S5OA 1W1YA 4K37A 2NLIA 3BDKA 4HPGA 1US0A 1OYCA 2YCLB 1CNVA 4F0LA 2C6QA 3M0HA 5F1VA 1GVOA 1BFNA 2BMBA 2DZSA 4ERIA 1FCBA 3MI3A 3VOIA 5JVLA 3IGUA 5E09A 1GVFA 2EKCA 3SFKA 4DN1A 3MMDA 1TTPA 1FWFC 1HW6A 4Z1YA 4DZAA 2GDVA 1F8MA 1KTCA 3QQWA 1FCUA 1UPMB 4GGBA 2FYMA 3ZO9A 1O5RA 4QJ3B 2GGJA 1JZ6A 5I3DA 3I3BA 4PBGA 5CBBA 2XIMA 1TTQA 2QDDA 1XQLA 5CPSA 3W38A 5G1YA 3C0LA 1FFQA 1FA2A 4O18A 1CXFA 1TZ7A 4M6PA 2A1YA 1A5LC 1P7TA 1K9DA 2X16A 1TX2A 1IE7C 2YOCA 4WDUA 2QCHA 3S4TA 2NWRA 2XH2A 1J9YA 2F6UA 3SRDA 1H09A 2NX1A 3EDEA 4M56A 3WQEA 1ISVA 2QULA 3EXRA 4J3TA 2VGFA 4F4RA 5AKQA 3OA5A 1FWAC 4MY9A 2NLYA 3LCXA 2PDFA 3K8MA 4YS1A 2PD5A 3B8UA 4UOQA 2DIEA 1ESWA 3KAOA 3BW3A 2E68A 2EJAA 3DU0A 4Q4KA 1XC4A 4LSBA 1BHGA 1FXQA 3LY0A 3C8FA 3N3MA 1BF6A 2WNQA 1RHCA 1E3XA 4GQRA 4ZOAA 4OJYA 1V77A 1KXVA 1LG2A 5F4SA 4M81A 1VYPX 3VMNA 9RUBA 3AZSA 4LGXA 3JVAA 2YCKX 2FPTA 4AG0A 1WV2A 5DN1A 2C13A 5CZSA 2DUAA 4LCSA 4DF2A 4M51A 4AWUA 5KITA 5CGTA 4O1FA 2E09A 4GVHA 3LOTA 1JZ8A 4DI8A 5IDIA 4IL2A 1H51A 3HPZA 1K8CA 2GJXB 3KFTA 2OQHA 2PLMA 2BTMA 5D2VA 1YTEA 2R1NA 5GQBA 1F07A 2OO0A 1G7UA 5REQB 1Y0EA 1N8WA 4BF9A 2B7PA 3BUVA 2GDQA 1XG4A 4CUCA 3TR2A 2RGLA 4NY2A 2QCDB 3IJLA 3QEZA 5T9CE 2PGRA 2XG9A 3PNZA 3QSTA 1G4TA 3KOWA 2CC0A 4K39A 2CLMA 4O14A 1IT0A 2VFEA 4PUEA 3OEXA 4HYWA 1B90A 1FX6A 5XIAA 1WNOA 3DYMA 4AIEA 1FBAA 4GXMA 3PM6A 2X1TA 3VUPA 1VFLA 4LX4A 3GXDA 3BLLA 2VUYA 2QJJA 4ZO6A 4J1OA 5CPLA 3QLLA 4LALA 4O54A 1VEPA 1UIOA 1WDPA 8XIMA 3S1VA 4HMNA 1HVXA 4W7WA 4A3RA 2VQUA 3EDJA 2I9EA 4KERA 3NPXA 4R9XA 4GGHA 4L64A 3Q65A 5FEWA 3G1DA 4QROA 1O5KA 5FJTA 3BAIA 4QXIA 3FS2A 2VZUA 3RN6A 1KBKA 3QOKA 1LCOA 3K1GA 3S1WA 3H8AA 1FCVA 3OQEA 4HNUA 2HPIA 3B8WA 1C7TA 2Z1BA 4LF1A 4RPQA 4MFEA 4ZFCA 3R8RA 3OLDA 2D20A 3APGA 1ZTVA 3AROA 1E1FA 1AMYA 3ORWA 4KWVA 1L2QA 1PTGA 3EAUA 3W87A 5LSMA 1YMYA 4MUPA 2NWSA 3MDUA 4PMZA 1OSEA 4QX4A 1D3CA 3KX6A 5GNZA 2WV8A 4L6OA 4B5WA 5I03A 2VGGA 3P5YA 5FEPA 4ZODA 3WD1A 2WYSA 2FDMA 1YKWA 2RFGA 4QCEA 1HXJA 1XKYA 2PDJA 1UKPA 1E55A 1E1CB 1CLKA 2OG9A 1KCXA 2VR2A 3OIHA 2OODA 1FTXA 4WJEA 4GUIA 1LL6A 1O95A 3AMKA 3IK4A 4H7VA 4PMDA 1CIUA 5LHEA 1BG9A 3E0VA 1CGVA 4JQ3A 4LF2A 1GOMA 1ZY9A 4LWWA 1KM4A 3KE0A 3CWOX 4GWEA 3I7RA 3W7HA 3ES7A 2QDGA 2GGHA 1BWLA 1Q63A 4AH7A 2WHKA 2VC5A 2A3HA 1QU4A 1O12A 1ICQA 4W4QA 2OX4A 2CLFA 4L6HA 3T05A 4LY4A 5A6TC 2FH6A 3QQ1A 2BX7A 4PTDA 1FWDC 4C6FA 3USZA 3V1PA 1QHOA 5HNUA 3FOKA 4HHMA 3HU7A 3AU6A 1CZ1A 3M0LA 2EQDA 1TZ9A 5HXMA 2ZBTA 3WD3A 4TVUA 4UNIA 3KWSA 4JQ2A 5HMEA 5I00A 5DMNA 3DZ1A 5AC7A 2CBUA 1ML1A 1EC8A 2XN1A 2VI0A 1G1YA 4HPHA 1QHPA 4NAFB 4WY0F 4ZL1A 2NQ9A 2Q71A 1PJ9A 3CC1A 4UFKA 5FL1A 1EF2A 1WDQA 4LRTA 1A5KC 3H4XA 1Z6KA 1OFAA 3FDKA 2VR5A 1OGBA 1J4EA 1DQUA 3GZ3A 2PDPA 4PE8A 4P7QA 5DEZA 1QBBA 3FGCB 5F7UA 4H00A 3V5OA 3FYPA 4S3FA 4FX6M 2DJXA 5KTLA 1FWRA 4K1GA 4HT3A 4QDPA 1H1ZA 2A3EA 4L56A 5LGZA 4NXKA 2RDTA 4W8BA 3MUZ1 4PUKA 3DHUA 3L68A 1UCWA 2ZRXA 3FCPA 4NYYA 1YDVA 3VOFA 4DAFA 4ENLA 2XUCA 1C3FA 3HV9A 4LAUA 3NQFA 5DXYA 3BG9A 3NDOA 3P61A 3SQSA 4O50A 5FACA 3TTEA 4DHGA 3EWWA 3GX9A 4XTIA 1N55A 5F2MA 5CAKA 4UMAA 3SY8A 2A79A 4NZFA 1R85A 3OHMB 3CUIA 1XYAA 3WG6A 3T0TA 3TFCA 1DJIA 4FNUA 3R8GA 1QNQA 1IIHA 4PTWA 1UR2A 1OT2A 3F2DA 2VEIA 5FAJA 4WQ6A 4DIAA 2AQOA 1WBJA 3CUHA 3WH5A 3RU8X 1NWRA 4BF5A 1UZ4A 1JDCA 1LLOA 2XZ9A 1NIUA 5EGRA 2XH0A 4KIEA 1D3HA 1LRTA 3WD4A 3K4AA 5LXEA 1BRLB 1A5SA 3QMTA 4MWAE 4LT9A 2PTYA 4XQ6A 1V7AA 1OFOA 1DWIM 2QNEA 2ZTJA 5C2CA 2O4MA 5LIUX 5MF5A 3N2OA 1LOLA 1EP3A 2V63A 3R0DA 3SR7A 1B31A 4S3JA 1TV7A 2A5HA 3IJ9A 1DE6A 3V0TA 1KA9F 2AOSA 2HXTA 1IR2A 3G8RA 5FJPA 4HZ8A 5CC5A 3H23A 1SSGA 1CXLA 4LANA 3T2PA 1NOFA 4JFWA 1UH3A 3OJGA 5I77A 3AICA 4L7ZA 3KTXA 1B9BA 4IX0A 2PB1A 3PWAA 2H3DA 1ZLPA 5D8WA 4DJDD 3BSMA 3LM3A 1RA0A 2D2GA 3NZ1A 2ASHA 2YA1A 3D5HA 3I4KA 1K9FA 3BW2A 4US5D 2CERA 4GH3A 3SCPA 1H7OA 2OTDA 1FWEC 1ITQA 4DLFA 2A7NA 2P0IA 2J7FA 1O5QA 4TX8A 3L4UA 4W9TA 2D24A 4CNPA 1PZ3A 2X41A 2QPUA 1Q7MA 3MHUA 1ALDA 4PCNA 3T81A 3SDOA 3G0XA 3UCDA 3UG4A 2NV2A 1KV8A 1WXJA 5I07A 4J3WA 3AHZA 1B2YA 2YB1A 1A5UA 1RCQA 2C18A 5L9FA 4B16A 1HVQA 1KNWA 1TUXA 2D22A 1PZ0A 3WBYA 4RNFA 4IJCA 1YE4A 3AC0A 4GINA 3V16A 3BO9A 3PTDA 2VC9A 1V3MA 4DBEA 2YZRA 4H8VA 4Q4RA 3EOEA 4Z1CA 5D2XA 2AL1A 4JKKA 5KZEA 4BJHA 1FWNA 1OF8A 4OOUA 4F66A 1UWRA 3UA3A 3M6DA 3ARRA 1WZKA 4EAMA 3WQ8A 4FAMA 2BBFA 1GQIA 4I9MA 2NV9A 2HBXA 4PODA 3AHXA 3FLUA 4AYSA 3N13A 2ISWA 1JJKA 3IIVA 3WQCA 2WC7A 4W88A 1TVLA 2CIPA 3L2IA 3B0XA 2V69A 3CL7A 2NT1A 4V1XA 3IJQA 4HYRA 2B7OA 3WD2A 1T5AA 4H8UA 4CVUA 3IGHX 5AFDA 4PTMA 1DVJA 4AF0B 3NGJA 3AU2A 4GA8A 4U10A 1HP4A 2AGTA 4WZHA 4JIRA 2PU0A 4B4FA 2WZEA 3VDAA 2TODA 3ZLGA 1E15A 4P7NA 1W1VA 3D3AA 3WX7A 5FI8A 2GFTA 3RDKA 3WQ5A 1W5QA 1U5JA 6ENLA 4AHPA 1OVDA 1HL8A 2PRLA 3JW7A 3HV8A 4UQAA 4ZQPA 4IUGA 5C2GA 4CNUA 5G4HC 1OQFA 2V82A 4ALDA 5H2ZA 1WKFA 2RJHA 4GJJA 3PNUA 3CQHA 2DZBA 2E1DA 9XIAA 3W74A 2BV9A 3K8LA 4AC7C 1E0TA 1F3WA 2GJLA 4QEHA 4WDTA 3LYEA 2A6NA 3WBAA 1W9PA 1D8WA 3N34A 2R9RA 3PTKA 2V3GA 4JFUA 3E74A 4I7UA 3ISIX 1PS9A 3S5YA 2J9YA 3PJWA 3TN4A 3DFNA 4A3UA 1VJZA 4MSSA 1OG0A 3LV6A 1W17A 5F4XA 1GOXA 3IIOA 2OT0A 4JHMA 4JQ4A 4B5VA 2O7QA 1NOUA 3LI1A 1XIBA 1IV8A 3W26A 4PZVA 5I5RA 2FTWA 2PCQA 3UWZA 2QHAA 4Y2WA 2Y0FA 3AIVA 3G22A 2PA6A 1H2JA 2J74A 4M7TA 1TPWA 2UY5A 3BLKA 3E1F1 3W6YA 1NWUA 1X6UA 3XINA 3GNNA 4LBSA 3RR1A 3ARWA 1O7AA 2PWEA 2XVNA 5G4EA 4K36A 3WLHA 7PTDA 1P5BA 4IMAA 2ZUNA 3DC8A 3EOLA 1AQMA 1MW3A 4IFKB 4BA0A 1W3JA 1WZMA 3QRHA 1TRIA 1R3TA 2J8GA 4RV8A 4D6CA 3M7SA 3WEMA 1ISYA 2POZA 3GR8A 3OVQA 4CD5A 1IXQA 3PUEA 4IMFA 3MPGA 3DGBA 3UWWA 2I5GA 3VC5A 3TONA 3IGXA 2VX7A 3SRKA 4J27A 2V0TA 4AEFA 4DWDA 2OR2A 3FA3A 5ABFA 2C15A 1E72M 4XO7A 2BG5A 2PURA 5LIYX 2BGNE 2DZAA 2VZOA 2IXVA 4FXSA 4TO8A 1BYDA 4XZWA 4H9TA 2E28A 1EQCA 3IK2A 3QKEA 1ITXA 3M0KA 3CB8A 1C7SA 3ZJ6A 2ZDSA 1RY8A 2ANUA 4TXEA 3FYOA 5LA0A 4F2UA 3NL5A 5H8UA 3GBEA 4MNKA 3HPFA 5DY2A 3RGTA 3ZOAA 1IHIA 1K7EA 3EZ4A 1ZFJA 2QGHA 1Q2SA 4S3BA 4JTDA 2ZDRA 1OFRA 5EPDA 3S83A 3WNNA 1W3HA 3WL0A 3THQA 2NX3A 1ZBKA 2V68A 1V6YA 5HJXA 2NQZA 3VD9A 5FL0A 4GHRA 2ZX9A 2GGEA 3AIUA 2DDXA 4GD0A 4PULA 3N2MA 4X0NA 3WDPP 1H7PA 2OZ3A 1CGXA 5HWMA 5I3KA 4HU8A 1D2KA 2YB4A 1L6GA 4P8XA 3RAOA 4MZ1A 4QG9A 5DF0A 1X97A 3ARPA 3ZQ9A 4I6VA 5LHFA 4PUMA 3CQJA 1H1NA 2EPMX 3QY7A 4KF1A 4UCFA 3AHVA 3LB0A 3LMZA 5AZ0A 2ZX6A 4ZB5A 3UP8A 1SMDA 4MWAC 4GX9A 1XPGA 1QVBA 3N18A 2FHFA 4E4PA 3W72A 7CGTA 2WVVB 2Y70A 1W3KA 2QT3A 4JY9A 4ZOEA 5C8BB 3EMZA 4NJJA 3W00A 4O1DA 5A6BA 1YNYA 1MNZA 5FAGA 1NWTA 1A5OC 3VNMA 3LPFA 4ROPA 3W7JA 3ZXWA 2PU1A 1A5CA 3CPGA 3VXGA 5C7HA 1U33A 3EX2A 3F4CA 2GQ8A 3DIPA 3KRUA 4H2CA 3UT0A 2PMQA 3GHSA 1QJWA 2O9OA 2Y62A 2FVKA 3MYPA 4O1AA 1EDTA 5A8NA 4YTQA 5CZJA 1VBHA 1E1EA 3TJ4A 1W32A 2PEVA 3OB8A 1TG7A 4YVVA 3VNDA 3L2LA 3IGSA 3REQB 3N4FA 3MZNA 4KEUA 3MU7A 3C5QA 5EU9A 2MANA 3IIPA 3W2UA 1KCLA 5BNKA 1X7FA 4E3VA 4FSAA 4HSOA 4IIHA 2E9BA 2I17A 1KB3A 1PIIA 2PWVA 1W3LA 4K7YA 1AD1A 1UUOA 2CEQA 2WMJA 4PUDA 1R2SA 2WJFA 3THDA 7REQB 1UMYA 1EWEA 4XAGA 1BGGA 4XISA 4CD4A 5G2IA 2V67A 3UJ2A 1Y65A 5HAOA 3KRSA 2EJ1A 2VVNA 1MMFA 4EPDC 1P4CA 1KFWA 3CH0A 1WCGA 2OVLA 4C6QA 1N7KA 1JDDA 3PZ9A 3WJSA 3VA8A 3UW6A 3B0PA 2EG7A 3GR4A 3E2QA 2DH3A 3G1FA 3UVAA 2WK2A 2YW3A 1I2OA 1E9ZB 3UNTA 3BLOA 3VINA 2OXNA 4MGGA 6ALDA 5C2XA 5BOOA 5CPOA 1MI3A 1XYFA 4IMDA 2HMCA 3SI9A 2GQ3A 2WJEA 4GYPC 4FK9A 3QOMA 3RIKA 3ZT7A 3WL1A 1FWJC 4L4MA 4DWSA 2Q8ZA 4X60A 2FJUB 2EPNA 3LCIA 2ZOXA 2PCEA 3B9DA 2Z24A 3MTWA 3WJYA 3KOFA 3SEPA 3QMRA 4XX6A 1J2BA 1EPVA 3GVGA 3PN8A 4LRSA 2Z6JA 3O0KA 3F2CA 1OCNA 1ME9A 3ONCA 1BQGA 1SUXA 4RDWA 3OGVA 2FJKA 4H9XA 2ATMA 4KBXA 5CPQA 3OO2A 1TB3A 1VBGA 3S2JA 1GEQA 4MAVA 3BAXA 5G1MA 3EWXA 2XHYA 4REQA 1F8IA 4UFLA 3FJ6A 3A5FA 1QNRA 1OEPA 3MCOA 2ZXAA 1V51A 5D9OA 3OBKA 1EUAA 4H4IA 4HA3A 2XTKA 3BG5A 3TP4A 5I3JA 1JF5A 4KCWA 5K7JA 3C0QA 3R6IA 1Q5MA 3PZOA 1KQZA 3MYOA 3M5VA 1NSJA 3OBEA 4MKSA 4QG8A 2ZA2A 5D38A 1YX1A 3GS6A 4YPJA 3RX2A 1UKQA 1RJRA 2XGBA 3PAJA 4IG2B 3RG6A 1ISXA 3WNOA 1OADA 1XRVA 1WAWA 1WDRA 4I8DA 3W7PA 4JICA 2AAMA 1P43A 1V0NA 3WNKA 2OKTA 4FLSA 4IGSA 4O4VA 3WDJA 4WJ8A 4JCLA 4D6FA 3PHAA 2BWGA 1ZUAX 1HX0A 1EHNA 1X6LA 1X7IA 4A35A 2VRKA 3MW7A 4XTDA 3AIEA 3B9OA 1IWPA 4PB5A 3RPDA 4BQ3A 4RV3A 2YCJA 1GTHA 1OCQA 4UFMA 4GZEA 3NQ7A 3VKBA 2J6XA 4IFOA 4RE3A 2OLAA 4W5ZA 4DJFA 2J7BA 1SFTA 5A8QA 4JQAA 4FZIA 4PCTA 2WSQA 4HN8A 4HNNA 1VBRA 3T8LA 2WHJA 4XZNX 2CHRA 2WWDA 2PLKA 5CC3A 4AZ7A 4NRRA 3W1LA 3KL5A 3APTA 3CQIA 5A2CA 4JIEA 2YCLA 2NQJA 2FZNA 1PVNA 2VT0A 4IPPA 4KEVA 3WQWA 1GW1A 3QHMA 4RX0A 4IPLA 1CB2A 4P7OA 1A5NC 3MA8A 2C14A 3M0YA 4JTIA 4W84A 1JCNA 3VZXA 2IXUA 3G6MA 4FPSA 3EWDA 2GSJA 2PTZA 4MG4A 4C5YA 1PDYA 2ISFA 1TJ1A 4AIOA 1UKOA 4MY8A 3WNPA 2XIQA 2QJNA 2E1WA 1B57A 1OM0A 2A85A 4EWND 2G96A 3SCRA 3R94A 1FQ0A 2ZRUA 1Q7QA 4WKHA 4C91A 4UTTA 3CZKA 3K4DA 5IFTA 3N11A 4KFOA 1XCXA 1WUFA 3LPPA 4TTGA 4YU1A 2GL5A 4H9UA 1S38A 5I0DA 3WQVA 3L0NA 1NDYA 3VE7A 3KOXA 3CWHA 1UZHA 1BG4A 3WK3A 1HTIA 3CNYA 2J27A 1J0JA 3NZRA 1UC4A 3GDTA 3WLMA 3W73A 4GBDA 1H7XA 5A95A 1S2TA 3GC4A 4KWSA 5CC6A 3UERA 4XWUA 1UP3A 5EBAA 4DO5A 4ATWA 1LLWA 3ARUA 4NSBA 5DCDA 3WQOA 3OP2A 3W7NA 2ZADA 5I3GA 1EF3A 1R38A 2V9DA 2ZICA 1R3YA 1JZ4A 4Q4OA 1S5VA 3FA5A 4EAYA 3SN4A 4AW7A 4FNSA 5HNNA 5ABEA 1GUVA 4OECA 4JHZA 4L1XA 1UR4A 4K2SA 2Y6ZA 2HJPA 4RR4A 5CPMA 4UTHA 2G95A 3E5PA 3O15A 2OGJA 1BVZA 2GJXA 2VKZG 3E0WA 3PSVA 1SW3A 4F0SA 1U30A 3GVRA 5HJLA 1V8EA 3IJIA 5REQA 3TQVA 3UFYA 1JQXA 1JI1A 1NARA 2Y5EA 3LTSA 1U5HA 5BW6A 1B30A 1MZHA 2QCDA 1O94A 4RZ6A 1TPUA 3B9AA 4BS0A 1GZGA 2OPJA 2J7CA 4CQBA 1EXBA 5D8ZA 1AW5A 1RK5A 3FAXA 4DZIA 3Q67A 1DXFA 1TVPA 4HSHA 3K4WA 1TV3A 2OSWA 1XH2A 3PBUA 5AYIA 2G41A 3LXCA 1AD4A 4JIIX 2R82A 3WQ6A 1A4LA 1Q6DA 1NDZA 4O4WA 3PZTA 2GLKA 1L9WA 4XIMA 5LNRA 2R24A 2OT1A 1A4MA 2X7WA 3LXAA 1LQAA 1X6NA 2D1ZA 4MLJA 3EOUA 2HQAA 3C86A 2VC6A 5IFPA 1XXXA 3P80A 5HA7A 4X9SA 4JTAA 2NSOA 5PTDA 2G3IA 3D0CA 3AUJA 3PFRA 3ZVHB 4ICMA 2KX9A 2O7SA 5AZ1A 5AHNA 3SN0A 1E0VA 1F05A 3W70A 1ZJHA 4R9OA 3QZEA 4CQCA 1Z41A 4NU7A 3FSUA 1UQYA 1ZL1A 4LEFA 3H2MA 5AC8A 3PUOA 1N8FA 3MP4A 1A53A 5A8MA 3RX4A 5CSRA 4NNAA 3M0JA 1PCKA 1BD0A 3GAYA 5DLCA 4E4UA 3W7CA 3RF9A 4GVFA 1FHVA 3NZPA 3RLUA 1TO3A 1TR1A 2YW4A 1DXIA 1GKPA 1F3XA 3PZMA 3G1SA 4FNTA 2ZRYA 3UR8A 3OZPA 2WQPA 3CEPA 1HFBA 3HA1A 1HL2A 1XUUA 3QZ6A 4H7CA 3WH9A 4A2SA 3A4WA 2PWGA 1XRFA 2A3CA 2QCMA 1E1CA 4NYUA 4ZO9A 4B5TA 3WK1A 3UG8A 2Z6IA 5AYXA 3CUXA 4PRRA 1PX3A 3TX9A 3BARA 3NIYA 4JTSA 3B9NA 4UQDA 2CLPA 3FAWA 3TQKA 2XU2A 1R7OA 2YX0A 5BWAA 5KZDA 4UTLA 1UD6A 3QPYA 4CGTA 5JH1A 3LLXA 4UR8A 4JEJA 2Z00A 3S9ZA 2W5FA 1WE5A 2NVAA 1KKOA 2Y61A 1CT5A 5HINA 4C6MA 3C8NA 4M19A 4MB1A 2WMIB 1DIKA 2OQLA 3DI1A 3IARA 3NTYA 1YEYA 2WZTA 4H83A 1UH4A 4H41A 1PBGA 5I78A 4I9TA 1E56A 3EX4A 3VAVA 2ESCA 3M0ZA 1ZGDA 4BEQA 1KRMA 2BVYA 3TU9A 2OOGA 3EB3A 1SU5A 1PWLA 3W3OA 2J13A 3W1AA 4KPLA 4R5EA 4D6DA 2V8ZA 3N2BA 1MRAA 4NAFA 1WUEA 3L5AA 4DM2A 4JPGA 5A5WA 1SYTA 2QR6A 1LQ0A 3CL6A 1UQZA 2QIIA 5HR6A 3W84A 1JCXA 5B7YA 3SIMA 4U5IA 1VFFA 4CD6A 1J0HA 1QOXA 1LWHA 6CGTA 3SCOA 1H11A 1XGDA 5F1UA 4AFYA 5EMMA 1QT1A 5B7ZA 4B92A 4NL1A 4JR5A 4HIBA 3O06A 3FGCA 4TMCA 4ZENA 1JNDA 3GVQA 4MUZA 1QW7A 1TR9A 3PPCA 3GG7A 4RL3A 1JZ5A 1MXDA 3THUA 1YTKA 3VC6A 1S46A 2PD9A 3BQ5A 3UJRA 4GXPA 4JEQA 4J3XA 3W4RA 5FSEC 1JYXA 4B2DD 3NL6A 5LNSA 3TEVA 2BXZA 5FSDC 4M80A 4HJWA 1FWCC 4H1ZA 4WRHA 3GC2A 2HV5A 1H5YA 2DSVA 2O55A 1YPFA 3QV6A 2HK0A 3G2GA 4MMWA 2DORA 1OJXA 1G69A 4DM1A 5LKYA 1Q13A 5HJYA 2FIQA 5GPRA 4C1LA 5K9DA 4WXZA 1CLXA 1ZBWA 1XYBA 3SCNA 5J5RA 2DZUA 2INZA 1T41A 1TELA 5BOFA 3OBAA 3LTYA 4UQEA 3CMJA 4RCXA 1POJA 4EWJA 1T7LA 2JEQA 4HTBA 4JCMA 4O0KA 4DPPA 5GJNA 1NFGA 2E0PA 3EKZA 2J47A 2ZRVA 1ZS2A 3CO8A 3LGDA 2OFJA 1XX1A 3O9NA 4MYXA 3ZR4A 3LI0A 2E5CA 3EDFA 3W7DA 5JQ9A 4V27A 3AYTA 1XYMA 1EXPA 5DELA 3CZ8A 1BRLA 1FWIC 1E6SM 1RD6A 3O2LA 4I7VA 3EXSA 4MJ4A 2CBIA 4LEQA 1KFLA 2ZZ5A 1HQTA 4ZQRA 1UG6A 1EOKA 2WCAA 3EDKA 3NNTA 3KTCA 1VHCA 4GY1A 4WGHA 3E2VA 3MWCA 4HTYA 4KRUA 3AUOA 3L4TA 5CJNA 1IWAA 1VEMA 3WQ4A 1JFHA 1JZ3A 1P6WA 2W3ZA 3K46A 4FX7A 2C0HA 2PODA 1TWIA 4R3UA 3W2JA 5GVJA 4E38A 2ON3A 3GFXA 1J0KA 1V3LA 2CLHA 4L65A 1P6BA 3HG3A 2OWWA 1OT1A 1PIGA 1S3HA 1GOQA 1EFZA 2F84A 2OELA 3FHAA 2EPKX 3IUHA 5GJPA 2Z28A 5CAHA 1XLBA 1KBLA 4DNHA 1BEUA 1R47A 1MDLA 2JF6A 5FOOA 4TVCA 1Q6OA 2X05A 3TYBA 2VEMA 2W6RA 3FEMA 3PB0A 4HCLA 2WHLA 4YTRA 1EC7A 1X8FA 3Q4DA 1B3ZA 1O1ZA 3F4NA 1BGAA 5C9RA 4K8GA 2YCEA 3ARTA 3NUKA 3ZWTA 4QDWA 1TV4A 4EPEC 2HZGA 3F7JA 2VR4A 2FH8A 1TPEA 1S1RA 4DZHA 1H5VA 2P3ZA 2PWFA 2QCFA 3G6LA 4S3EA 1E9IA 1H49A 1KBIA 3S9YA 4J4KA 5HANA 5EMUA 3H2OA 3R13A 2ZIDA 3EX6A 2EG8A 4XSLA 1DV7A 3VIKA 3DX5A 2VFIA 4XKYB 3IWPA 1BKHA 2C3ZA 4JN7A 3LENA 1LL7A 1HO1A 4GISA 4G5DA 1E9YB 1W5OA 3ZSSA 1LL4A 3EX3A 1LF1A 1J2WA 4D1IA 3T78A 2DZVA 4HMCA 3KDNA 3ECQA 4AD2A 4PMXA 4ZCWA 4RK8A 1H0IA 1TMQA 4DBWA 3ABQA 2BSLA 5A6LA 3CUJA 5ABTA 2YFOA 1I2RA 3KBSA 2BY1A 3NYZA 5C55A 4TTUA 3VGFA 4LUTB 1WAUA 3NL3A 3II1A 1CWYA 1KGXA 5E9XA 1GOIA 3MI6A 3NQVA 3GFZA 3D3FA 3KRZA 1XCFA 3HGRA 2DV0A 4DEFA 2JF7A 1UOKA 2BXVA 2YBUA 4PMUA 4QBXA 1H7WA 4AF0A 3SGZA 5HNRA 1HGYA 3FW6A 4BI5A 3LNPA 4EOUA 3UPBA 4AD0A 3IAQA 1JVNA 5DQPA 4QEEA 3RMJA 5AYBA 1NJJA 2YYUA 1LUCB 4NUWA 1SGJA 2ZA3A 2V5CA 2Y7DA 3H2NA 3L7RA 3R11A 1G6CA 3BGGA 4QJ1A 2P1FA 2XM1A 1I1WA 3GFYA 2WAGA 3MV01 3SUWA 1EYWA 3USBA 1OFQA 1P0DA 1Z32X 3B05A 1QK0A 1SMAA 1EEPA 1FWBC 3QVQA 1HIZA 2YXGA 3R10A 4NASA 5FF0A 4UFHA 1FDYA 2GOUA 3WF2A 3U2ZA 3SZ8A 1ZB5A 2PBGA 2XINA 3MO7A 4FNQA 1I75A 4XBSA 4NQ1A 3V5FA 3SBFA 3H26A 4JQ1A 3QR3A 1XFBA 3STCA 3M07A 4MJZA 3UR7A 4JY8A 1UMLA 1VRDA 3W0KA 2IPWA 3PZIA 3WDIA 3M44A 1I4NA 1KFCA 4OE7A 3MKCA 1FRBA 1EOMA 2WMFA 4IXXA 4QLJA 4ASTA 4GXWA 5EA9A 1J0YA 1PL9A 3T0BA 1GQLA 2XH4A 1D8CA 3GE7A 1Y7VA 1QTWA 1DWFM 2WMKA 1RQBA 4GNKB 1SQ7A 4KESA 2UY4A 1MQRA 5AHMA 3DG3A 3AS3A 2VJXA 3MVTA 2G3JA 3W6MA 4GG9A 3W25A 4BHYA 3CHEA 3G24A 4DZ5A 2D0FA 1QWKA 3FKKA 3GNRA 3H2AA 1EO7A 4EPBC 4IFKA 3SQLA 3W23A 4GUHA 2GYIA 2VOMA 3P81A 2VX6A 4Z17A 3TAOA 3H7RA 3W1XA 2E8YA 1LM1A 3T55A 3SY1A 4B5XA 3VIHA 1EJTC 2OWXA 3KL0A 4MADA 1UJPA 3PG9A 1XV8A 5TD4A 2R1MA 3WKZA 3W7LA 4AXKA 1C8YA 1J96A 4QCFA 1ITUA 1QBAA 2JQXA 1V7YA 4NZ4A 2PUZA 3R89A 1TA3B 3VNKA 3MSDA 3CYJA 1V79A 3W07A 1DJHA 4ES4A 3DFQA 1WOAA 4IICA 1KLYA 1KM3A 1HO4A 1V3HA 1VB9A 3M46A 4ROQA 4QAWA 1QNSA 3MSRA 4HQVA 1V5XA 5LIKX 3UVIA 4B15A 5EB8A 1NF7A 3GW0A 5IBXA 1BXNA 3O3RA 1H60A 2BASA 3BMWA 3W7QA 4NJIA 1OB0A 2QV4A 1KRAC 3GAKA 1DWHM 4DO4A 1SJCA 1VQTA 1JAKA 4WVXA 2OZ0A 3PAOA 1HNYA 1R2TA 2V3FA 4PMVA 5E5CA 1SW0A 4QISA 4XUGA 3IV8A 4WIWA 1O68A 3GNOA 4AD3A 4JX4A 1FY6A 2ZYFA 1ECEA 4DO7A 4LC6A 5EYWA 1UC5A 3N1AA 4LW7A 4O19A 2F61A 4GMEA 4FLQA 1B4EA 2P50A 2R1KA 3NO5A 5T8GA 1Q6RA 1YXCA 1FWHC 1LT7A 3B4UA 4I9JA 4I5RA 2YA0A 3D46A 3SB0A 5AC6A 2BVWA 2BOGX 3QC3A 1L6SA 4GC4A 5CPTA 1RH9A 2WVVA 4Q8UA 3PWIA 2BHZA 2J8TA 4L1GA 3BK0A 3BZJA 4AC1X 3AQUA 4YMZA 3PFMA 5EMJA 1TE1A 3PJUA 3PZVA 5IHRA 4TUFA 1BWVA 5D2WA 3NFUA 1GOKA 3RX3A 1ZAJA 3EEZA 3NYDA 1I60A 4JX5A 3KBJA 6PTDA 5AHFA 3KVMA 4E2OA 3UCCA 3DHFA 2QUMA 4NF7A 5DBTA 2PP1A 3AZRA 5BXTA 1ME7A 2QMKA 1W9XA 1SJAA 4GJ1A 4BZYA 4GUFA 1E6PA 3WK0A 3H70A 1WKEA 1TCMA 3HZ3A 3REQA 3OA3A 4G1NA 1XWYA 2G0WA 1B5TA 1A0EA 5F2GA 1R5YA 4DJEA 5FF4A 4H3DA 1N82A 3LRLA 3A21A 2OEMA 4LQ1A 4H9MA 2CFFA 4BWLA 3G18A 2J8FA 4MHBA 3S1XA 3UWEA 3SRFA 4OUIA 7REQA 1HKIA 4HNCA 3FJLA 1OC7A 2PDLA 4UZSA 1TPB1 1HJQA 4N42A 3TE9A 4Y8FA 3EOOA 4UUIA 1JDFA 3ZR5A 1JULA 3DG6A 1GQKA 2E67A 3UXIA 1DIDA 4H8NA 2ZXBA 3T6CA 1DXEA 2BP1A 1IZKA 4O8RA 3VIPA 2VC7A 3P3BA 2P88A 3MDWA 4C6OA 3RO6A 4IZGA 2H3BA 1I9CB 3OU8A 4N9CA 4AZ5A 2MUCA 4E2BA 1DL3A 1Z8AA 3UEQA 3KHJA 4IFRA 1S1PA 1E4LA 3WLIA 3EA2A 3W85A 2QDEA 4C5ZA 4AD5A 3FN9A 1MW1A 4IH3A 3VMOA 4X2PA 2Z27A 5A8OA 3QFEA 1ICPA 3KOZA 3O16A 3ENLA 3GB6A 3TWBA 1W5MA 3WF1A 1NWSA 3CHVA 4NZ3A 3N3TA 3PTMA 4ZVJA 2QQ6A 3CAQA 2KZHA 4ACZB 3KBNA 4HZ6A 1EH9A 1R9ZA 4JS3A 4ZE5A 3WJXA 1NQ6A 4EF9A 3VCNA 3LHTA 3ITLA 3HQOA 3MP5A 5EKYA 2MNRA 2PGFA 4HPXA 2J7GA 4C90A 3MY9A 2VYOA 1JF6A 3K1DA 4ZQMA 1H3GA 4JFVA 2G97A 4F2BA 3KHDA 4AYGA 1H4PA 2YGYA 1TIWA 9CGTA 1PHQA 1LBMA 4DBDA 2P76A 3ANYA 1AL8A 3OODA 2WMHA 3EX1A 5JBEA 3O8AA 4XVDA 1VH7A 3UWUA 1X38A 3PWGA 2XWDA 1SM9A 3VTRA 5D33A 5LZLA 2B31A 2YDSA 4IISA 1W9UA 5GJMA 4PTXA 2V5LA 2VD8A 2PBOA 4GQBA 4ZXOA 2QUVA 4IG2A 3LZ3A 2PDHA 1PPIA 2Q8XA 3TTSA 5HNTA 1TWZA 3WQPA 4EANA 1W6TA 4V28A 4MPQA 1H7NA 1IGSA 1D3GA 3TFXA 2I56A 3RLVA 3UZXA 3TZNA 4F40A 3WF3A 2ISVA 1BTMA 4GZ7A 3VGGA 1XYZA 1GKQA 2HTMA 3GHTA 1ZPTA 3QV9A 2C1GA 3VDBA 3OW1A 3CTTA 1MW2A 3TAKA 2HNEA 2WWCA 1OZMA 3F5KA 3UXDA 3AIBA 2BGSA 3S2MA 1OD0A 1E4NA 1S5WA 3I3DA 3QF0A 1QI4A 3E9AA 3BLEA 1GTEA 3TVAA 3W76A 4TMBA 3PR2A 3N6HA 2P8BA 3CXOA 1TWDA 1XYLA 5AC5A 1YBQB 4RE4A 4Y96A 3WLJA 1BYCA 1WYIA 4RW5A 2FZ8A 1EPXA 3W2NA 4IIDA 4E6MA 3I7SA 4C1NB 4FNRA 1UR9A 1M5WA 3LDVA 4DLMA 3W2MA 1WQ5A 2DJLA 1NFBA 4NAEB 4Q4PA 1KTBA 3WY1A 2CLIA 5LXXA 1JCLA 4HZ7A 2E77A 1CCWB 1X98A 1PAMA 2OB3A 1AQHA 1WKDA 2WC4A 3FX4A 1GVIA 3ITVA 3I4EA 4LVBA 4DPQA 1V0KA 2Y5JA 4PBEA 4KGJA 3CBWA 4A3HA 3RMEA 3AIQA 2TRSA 1JYWA 3N9SA 1TWWA 3OZMA 3WFAA 4OBSA 2ZWZA 3BWWA 3BQ6A 3GH5A 4D1JA 1OX5A 1JYVA 3ZM8A 3CZGA 2CNCA 2X1RA 1DYSA 1Q6CA 2XIJA 3W75A 1K6AA 2ZUMA 4AXNA 2NXIA 1FP9A 3BLDA 3SECA 3DKJA 1QPRA 3CQ0A 4MYAA 1OFPA 4AEEA 3TOPA 3LLDA 1OK4A 3T0CA 3EWCA 3E5BA 5AB3A 2AL2B 1CW2A 4U33A 3TLQA 1PKYA 4WK9A 3PP7A 1XD1A 4NI3A 5IXEA 1XGEA 3DCPA 3VX1A 4TU1A 1E51A 4F79A 4WUIA 2INFA 1Z44A 1ADDA 3NEHA 3E0IA 5KSWA 4UTKA 5I09A 1OCJA 3V75A 3HF3A 1DWJM 1XINA 1QPOA 3CAWA 4D8ZA 2YLAA 2DSUA 3QPZA 4PCFA 1A50A 1CECA 3ARXA 3W81A 2GJNA 4JX6A 4NX0A 4G2DA 4WKAA 4GC3A 2A3BA 1VFTA 3BXWA 3LSBA 1JD9A 1Z3NA 3HB9A 1TTIA 1VCVA 3XIMA 1I8JA 2PF0A 2EAWA 3TNOA 3MCNA 5FJUA 1FXPA 5CGMA 3OZOA 2ABBA 2DVUA 4OWGA 2UZ9A 2RDWA 3BJFA 4PL1A 4GO9A 1DQWA 1UYQA 3WUFA 5HK4A 4IQJA 2PGWA 3DHPA 5D9NA 3RJYA 2PPGA 4ZB0A 4LUSB 1A47A 2WZIA 2HSAA 3VU2A 4TOQA 4RJEA 2E6DA 1EYEA 1MXSA 1HJVA 4NJGA 3EEGA 3UETA 3KL3A 1XSJA 3AWNA 4EKJA 1UWAA 1EGVA 2YYTA 3RHGA 2JKAA 5CSSA 4RXGA 4QGCA 1PYFA 4KWWA 1S2CA 1T99A 1UR8A 2WZMA 3PY2A 2XVPA 3HM7A 3S1UA 3IVUA 2NV1A 1WB0A 1B4KA 3C2YA 4QJ4B 2YJQA 2PGEA 1ZBVA 4I5XA 1AJ0A 1OWQA 4MJMA 4LYQA 4D71A 3OGRA 3L67A 5A69A 2X1IA 3URAA 3C2RA 6XIMA 3VM7A 2ZTKA 2RAGA 4Z1AA 3R43A 2D3LA 3PS7A 3ZVHA 3RFAA 1CENA 1NU5A 4BF7A 3OVPA 1B3YA 1M1BA 3ANUA 1A3HA 2QDHA 3W1TA 3LRKA 4B90A 1B0IA 8TIMA 2NSXA 3WD0A 3IS4A 5C9XA 3W7GA 1Z42A 1I6NA 3VCCA 1R86A 2EPLX 3O6AA 1EHAA 3KLLA 3M6YA 3HPAA 3KS5A 3TV8A 4S23A 5K4ZA 3O1NA 1T6MA 3SUVA 2YDRA 2GJRA 2Z1KA 4ML4A 4TX6A 4XZIA 1WZLA 3H4GA 5MKGB 1GOOA 2Y8VA 3O7UA 1X1OA 3COTA 3NQBA 2PSNA 3DG7A 3IJ7A 4R88A 3GYCA 1ZCOA 4J7RA 4G8TA 1KCKA 3CAKA 4RDVA 1QR7A 1I2NA 3BL3A 2ZQ0A 4TV6A 5FCZA 2G3FA 4GJIA 2ZWYA 1Q6FA 3BV4A 3LN3A 1WDWA 1UR0A 4N4QA 3HGSA 4RW3A 4Q8OA 3VVGA 1P0EA 3F4WA 5J8LA 3PUGA 3UJEA 1FWGC 4JD4A 5HPOA 3CYVA 2TPSA 1BF2A 4LH8A 5ABGA 4WSKA 4A8LA 2WM0A 1WBHA 4X61A 3CV1A 3U4FA 1QNPA 3QV8A 3FV9A 1K9TA 4F9DA 3UXKA 2QMJA 4I8YA 5A6JA 3VK5A 2R14A 1KV5A 3AMDA 1NF0A 3TN5A 5CG7A 3NSMA 1U83A 4O0QA 4W8AA 4Z1DA 1XRTA 4D6EA 2WMIA 3N15A 3OYZA 3L12A 4O15A 1OZQA 3S5NA 3WDQA 3EBVA 1B3WA 3LPGA 3FKRA 3MVIA 5FEZA 3VGEA 3N29A 1ONXA 2YLLA 4HHPA 1NELA 1Q3NA 1ZJBA 3S3GA 4OZOA 2YIHA 2HVOA 3S47A 5JMUA 4EXQA 4PL2A 3TJIA 2GK1A 1XHGA 1ZJIA 3QFWA 3VD7A 4ICCX 3L4YA 4O53A 4FF7A 4GYKA 4A6GA 4B5SA 3I68A 4S2BA 1J93A 4JTKA 3WLTA 1QI2A 4IUOA 3AMCA 1A5MC 2PF8A 7TAAA 4INFA 2ZXQA 4CNNA 1GT8A 3TYZA 2QJHA 3S0CA 1YADA 4PCSA 3ZLHA 2CBVA 4HBKA 3A9BA 1MEWA 4KQNA 3KP1A 5HQMA 3CTLA 4IWWA 3ZZ1A 8XIAA 1MEIA 2B4GA 1K02A 4LJ3A 4DO6A 3DFPA 3THCA 4WGXA 4KFPA 1TVNA 3OZYA 1EJVC 3WLNA 4M24A 3TQ0A 1IEIA 1ZCCA 3N6JA 2XN0A 3BANA 2J62A 1VGAA 4RNHA 4DAIA 2XDFA 1EQPA 2Y4SA 3LHVA 4AX7A 3S6OA 4PUJA 3BLPX 3A3HA 1N2VA 4ATLA 2JIWA 5AHLA 5IDZA 1G94A 3ZIZA 1K9EA 1TYGA 1PO9A 4WD0A 5HQEA 1S5NA 1HKKA 2UBPC 2VFDA 3G1YA 1UD4A 3N4AA 2E6FA 4C60A 3G1AA 4F9JA 1JXKA 3TN6A 2JKEA 4GIAA 4H01A 4AY8A 3CEUA 2HK1A 2GQAA 1EJRC 4H2HA 3GIQA 3PUDA 3A4JA 3M43A 1RY0A 4B5NA 2AKMA 3U5YA 5CLTA 1YDNA 1XH1A 2NQLA 1CGWA 1XFCA 1WPCA 1EJUC 1QRQA 5CZKA 3WMSA 4CN1A 3KBWA 1PX4A 2ALRA 4RE2A 3J7HA 4UTFA 1OFEA 1ZALA 1TFVA 4BR1A 4Q7BA 5HOSA 1DE5A 1UZDA 1K6WA 2AAAA 1B3OA 3ABOA 3DHDA 2CITA 2J79A 1KR0A 1ODZA 5AHEA 1T8QA 2NXHA 3I6TA 1R2RA 1MDRA 1TRDA 3WQFA 2QUUA 2ZRZA 3GDBA 4NZ5A 3U3HA 4IMGA 3O0FA 2HISA 3EWYA 2V2CA 1LWIA 2QF8A 5SWUA 5EY5A 2PWDA 1MSSA 2G5WA 3FHQA 1EB3A 3K8KA 2RGMA 4FALA 3GBDA 4RXFA 2B81A 4QNWA 4CNTA 5M17A 1TV2A 3SGGA 1M7XA 2Z4GA 1EGZA 1W91A 5L6UA 2YBVA 2X2YA 2VFFA 4RUBA 3N2TA 1RBOB 5ENLA 3KM8A 1E0UA 4PRTA 4ZFMA 4Y90A 2VURA 5D09A 4UMBA 3WNLA 2WSPA 3LHYA 1W2VA 3L4VA 1X39A 2PDCA 1TMHA 3WIJA 4CD8A 3H24A 4MDPA 1T0OA 5F2LA 3LNMA 3WBXA 1L6FA 4QS6A 4GIYA 2IPGA 5FF2A 2NUXA 5CQ1A 3B8TA 3M5XA 1M7PA 1KM5A 3P2VA 1S39A 3FFSA 3M4HA 1QO5A 1EA9C 2HNHA 4FR6A 1THFD 1QWGA 3DECA 4F48A 4X22A 3P84A 4GZJA 1G67A 4PMYA 3VNLA 4JTHA 4WDXA 4Z42C 1ZP4A 1OK6A 4XKYA 3EWZA 2Y7FA 3TA6A 1AFSA 2VZSA 3RILA 5LA1A 3QR0A 2IQTA 4OBRA 2ZUVA 4PUUA 1UWTA 1JG9A 3AISA 3G0UA 3KDOA 2J9XA 2Q3OA 1BLIA 4FS9A 4NZCA 1XLHA 2Y5SA 5JUVA 5BROA 4RZBA 4HNTA 1ZZMA 1Q6QA 2ZVIA 1SZFA 1XDJA 2BFGA 3L5LA 4C1KA 2GSEA 3A24A 4LCRA 4J3VA 2VXNA 3PPFA 1RXOB 3W28A 2P3EA 3WBEA 4ZE4A 4FO4A 4LUTA 4CU7A 2OEJA 3KBVA 4ECLA 1J01A 1BSLA 2CZDA 1MUMA 2YL8A 4HHHA 1R3SA 3QYSA 3DFOA 1P1XA 2X30A 3GXTA 1F9CA 4HGXA 2XIOA 1K03A 4Y8EA 1JGMA 1FP8A 4U5KA 1H1YA 1US2A 4PUWA 4UFJA 2PDBA 3BSGA 4UR7A 1R3QA 2WZHA 4LAKA 3QY8A 3ZWSA 1ADSA 3HGOA 5JXQA 4WSJA 3GNDA 3URQA 1TPFA 2JEPA 3SCQA 2WCGA 4IPNB 1CTNA 1ONEA 4UXDA 2X09A 4A05A 2PDXA 3DXIA 1XM3A 4HNLA 3UBPC 1LUCA 4FLOA 1LROA 1RCOB 1QASA 3MKKA 1T8XA 3VD3A 1G0CA 3B0YA 4HMEA 3PZQA 2ADAA 3FY1A 2ZA1A 2Z2UA 3UF9A 1DJQA