4PCTA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 161
structure length 438
sequence length 438
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4pctA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pctA01
3AQUA 3K4DA 3RCNA 3WY1A 1ODUA 4DWSA 3SCSA 3JUGA 1X6LA 1PX8A 3AZSA 1EDGA 4UFMA 1JDCA 3RM8A 2XJ7A 2CBIA 1HF6A 3MKKA 2WVVB 4J3XA 4TTUA 1W3HA 4HPGA 2WHKA 1MQPA 2WVUA 1VJSA 3WUBA 5FL1A 5JBDA 4H8UA 5CGTA 2J7EA 1JG9A 2G3NA 3CPUA 7A3HA 2VR5A 3WY2A 1ODZA 1E4MM 3CHCA 3AISA 2PBOA 5LA1A 1P6WA 1UA3A 2WMKA 3OGVA 3WDHA 1GOWA 4PMOA 4A3HA 4BQ3A 2YFNA 5KZ6A 1TVPA 4GI6A 3WQ4A 4QDMA 4CU6A 2PC8A 4D6HA 3VUPA 5CPSA 2BHZA 1FFRA 3ZJ8A 1UZ4A 5CLWA 5BXRA 3VOCA 3W25A 2O9TA 3ALFA 4EANA 1TMQA 3IAPA 5E1QA 1FH8A 1GQIA 2A3CA 1W32A 5DO8A 4PMVA 2W61A 1UD3A 5I23A 3AZRA 2EBNA 3SIMA 1ZBWA 2VX6A 3RIKA 1CGTA 1BYAA 2Q8XA 3L4YA 3BAWA 2WB5A 4UOQA 1MW3A 3CLWA 4AMXA 1JZ7A 1E40A 3B9EA 1ZJAA 1GPFA 1WZLA 2G41A 1JGIA 2JIWA 4D6EA 3GNRA 1I1WA 2J47A 1MW1A 4MB3A 3T09A 1K6AA 5DMYA 1V03A 5BRPA 1VRXA 1PBGA 2A3HA 2ZXQA 1WPCA 4ZXLA 4AMWA 3OIHA 4WIWA 3EJTA 4M82A 3ZSTA 2BFGA 2J79A 3AIRA 2UY5A 4HA1A 3S5YA 3GXTA 3EDKA 1V6XA 4FNPA 4AIOA 1CNVA 1V0MA 2O92A 3THCA 3EMCA 2VC9A 3A23A 3BMVA 2E9MA 2C7FA 4UQCA 2YL8A 1VFFA 4MJ4A 2JEQA 3SCOA 4AY1A 3T0AA 3CZSA 3OGRA 1XRVA 5ABEA 2WMIA 2VMFA 4GIAA 2WLYA 3VM5A 2BS9A 5A6BD 4F9JA 5HOSA 5F7UA 4BA0A 4J28A 3FNDA 4MADA 4ATLA 4PMQA 1TQUA 1E3XA 1ZU8A 1YQ2A 1B3VA 3CZEA 3FN9A 2J8FA 1CXLA 2ZWZA 3BAYA 2W4XA 3LXBA 2IUZA 3NCOA 1N82A 3WD2A 4W7WA 1EIBA 4KMQA 2EPKX 3VO0A 3M07A 1CGXA 2O9RA 1A47A 2VZSA 2YFOA 1GJWA 4J27A 4CN6A 2DIJA 1WP6A 3L4WA 3N13A 4NZCA 1JDDA 3ECQA 1GUVA 1E55A 2YL6A 3AS2A 1CIUA 3GXFA 3U7BA 2PB1A 1KXHA 4CD4A 2WBGA 3WDQA 2ZICA 3WFLA 1W9BM 4BZYA 3NDZA 1NOFA 3WNMA 3AZTA 1R33A 4Z2KA 3DC0A 3WQWA 4PMUA 1HKMA 1KCKA 2V5DA 1HT6A 4H04A 2X05A 1SZNA 4PSRA 1V6WA 4M81A 1HKKA 3KZSA 1H3GA 2W91A 5HBFA 1UD2A 1R7OA 1PZ2A 3T0BA 1WCGA 1B1YA 1BSIA 4AYGA 4KGLA 3SCPA 3RPMA 1GQLA 2G3MA 2CCRA 2XPKA 2YKKA 3BVWA 1LLOA 1UR9A 4P7RA 3AFBA 3RM9A 1TQSA 1QI0A 1OGSA 3HG3A 1JYVA 1GONA 1H5VA 4PCSA 3IAQA 4F79A 3CMJA 1TQWA 3OLGA 5HDRA 3N12A 1H0IA 2QHAA 6CGTA 3DHUA 1ZB5A 3AIBA 2QMKA 4H7VA 1OIMA 3BC9A 1J11A 4U3AA 1HL8A 4EKJA 1G5AA 5GNZA 3EDDA 2X2YA 3A4AA 4TVDA 1EQPA 5A8MA 2EACA 4QLKA 1UKTA 1V0NA 4UQEA 3GH7A 3DX1A 3OBAA 1PEZA 2XWEA 4DO6A 5JBFA 3VGFA 1CGWA 3B9AA 2CETA 2ZE0A 3WQ5A 1KBKA 3PZ9A 3AIEA 2YDQA 4M1RA 4Z2LA 2J74A 3I3DA 3WBEA 1VENA 5E09A 4DWSD 2XN1A 1Q6GA 1BYBA 2OYLA 4MNMA 4S3KA 3CZLA 4LYQA 4ZE4A 2F1AA 2ZUNA 2DIEA 1ZS2A 3WD3A 3FHQA 1VFUA 3T2QA 1WO2A 1UWTA 1H09A 2XSBA 4IPLA 1JFHA 5ABFB 4GO9A 4FLQA 4B3LA 1XH0A 4HZ7A 2GJRA 3PTKA 3PN8A 3A24A 2D3NA 1U30A 1PS3A 3BVTA 2YJQA 3TP4A 1V02A 4UFKA 1HJQA 3T08A 1WAWA 1XH2A 4P7LA 1RD6A 4FLOA 1EDTA 2VZTA 4W87A 5C71A 2BY3A 3W24A 2E4TA 1E0XA 1RPKA 1CDGA 2BNJA 4D1IA 1J01A 5CSUA 2IGTA 1EH9A 2XVPA 3L2MA 4F66A 5I77A 5FIPA 3A4WA 3BVVA 4FF5A 4QP0A 4AD0A 4HTYA 2JE8A 4P8XA 3VMPA 2G8ZA 2OW6A 3U57A 4JZ5A 3VX0A 1QHZA 2XUCA 4J3VA 4CD6A 5A8QA 2F7RA 4UQAA 3DX2A 1UKOA 4WLCA 2V3EA 4EK7A 4BQ5A 4AD3A 4CUCA 4MDOA 2UY3A 4HU0A 1WZMA 2VJXA 3W4RA 3QHOA 3VDBA 3OZOA 1FOBA 3S6TA 8CGTA 1M04A 2EXOA 3WKZA 2D23A 2CBUA 1E4NA 1YHTA 4Q7NA 2O9PA 3WMBA 1QNQA 2XFRA 1XCXA 3NSXA 2HVMA 2WKGA 1UD8A 4Z2HA 1WZKA 1V6VA 4ATWA 4DWSC 3FAXA 2D1ZA 4TXEA 3VDCA 1PX3A 2BVYA 4NI3A 3GZAA 1WDRA 1E1EA 1W1VA 2WMGA 5DFAA 3LPFA 3AHZA 3WL0A 4BF7A 1V0LA 3GXPA 2XFFA 2D24A 1L0PA 4GI9A 3ARQA 3DX3A 4AZCB 4DUXA 3AMKA 1DWGM 5IXEA 2MANA 2EJ1A 2DSKA 5A2BA 1KQZA 2DSUA 4P8VA 3GYCA 4ML4A 4AZIA 1JF6A 2ZIDA 2J7HA 3BMWA 3WNOA 4K68A 3ZT7A 3PZVA 3HG2A 4P7NA 4A3YA 1OGGA 5A6LA 2CXGA 1OD8A 5AC4A 4LQ1A 1R47A 1CGVA 3L2LA 3LRKA 3A5VA 3KL0A 1B2YA 2FGLA 2CHOA 1FA2A 3EJSA 4AD2A 2WNWA 2CESA 1ECEA 1HIZA 4PTXA 2J78A 2YDRA 1HVQA 2J62A 1GQJA 1LG1A 1IZJA 1F4AA 4AZ6A 2Y24A 3K1DA 3W28A 3N18A 2PWDA 4M80A 2XIBA 3MMWA 3ARRA 1GVYA 2J7CA 3W53A 1UOKA 1H2JA 3GXIA 4YHEA 2NT1A 5I3DA 4X0VA 3GXDA 3RMEA 1JZ3A 2WC3A 5A6BA 1DWAM 2OWXA 5A6AA 3I3EA 1JXKA 1WZAA 2RGMA 4ZEPA 4AIUA 3WDJA 2BY2A 1QX1A 4QAWA 3WY4A 1JZ4A 1HJUA 2W92A 3ZJ6A 3AICA 4PMYA 2XYLA 2UY4A 1XHGA 3CIVA 4CCDA 4D71A 3VGEA 4PMZA 4TUFA 3KLKA 4J3SA 3ARUA 2VZOA 2X2HA 1GORA 4OGZA 4C7DA 1NOWA 3HN3A 4AC1X 3ARZA 4D1JA 1JF5A 1MFVA 1KTCA 3CC1A 3IJ8A 5GPRA 1XD1A 1HP5A 1UKPA 5CGMA 1V3IA 4OKDA 4PCTA 5M17A 1JDAA 2EADA 1AVAA 1J0IA 1O7DC 1OT1A 4GQRA 2E40A 5A6MA 4MB1A 5A6JA 1HWWA 4ATDA 1CENA 1E6RA 4XV0A 1UASA 2WYSA 1UR1A 4D6CA 4W7UA 1VF8A 3AI0A 3M7SA 5FD0A 4BCEA 3NSNA 5LA0A 1VFOA 1V08A 3UR8A 2JFEX 1B90A 1J10A 3QHMA 2VR4A 3AMGA 4JKKA 3VD7A 1BTCA 1PIGA 3UG3A 1KWGA 1RH9A 1W2VA 1R7AA 1EXPA 4IUGA 3SCRA 5AC5A 2W62A 3O2LA 2CNCA 4OUEA 2Y5EA 3PZUA 2TAAA 2ZWYA 1UWQA 4UQBA 4JFVA 1G01A 4FK9A 3CUFA 4PMDA 2WZHA 3VIJA 4ACYA 1KTBA 2D3LA 3ZJKA 5DF0A 3K8KA 1NP0A 4UQDA 2RGLA 4BQ2A 3CTTA 4FNTA 3PBGA 4EE9A 2QMJA 1UUQA 1FH7A 3PTQA 3LPGA 2F2HA 3A6OA 3WNPA 3ARWA 3ARXA 1XC6A 3WD0A 1CXHA 3L4ZA 2X8RA 4MB5A 4Z2IA 3VSTA 1UH3A 4E2OA 4AZCA 3N04A 1E73M 3N15A 1E5JA 4CCCA 4JIEA 5D9NA 4KGJA 5CQ1A 4R5EA 5D9OA 1ISXA 3VKKA 2FE0A 2W5FA 2XVGA 5BXSA 3CGTA 3NUKA 3AHVA 3AROA 3MV11 3BAIA 4D6DA 3MI6A 1J0JA 3W82A 3KLLA 3ARVA 3M46A 4U3CA 1MVYA 2WK2A 1UYQA 5HPOA 5ABFA 3VSUA 3AHXA 5GNYA 4V28A 1JZ6A 4U2ZA 4DUVA 1V0KA 3BVUA 3PZOA 3W6LA 3K46A 3QOMA 3TONA 1UZ1A 3CUGA 2G3JA 1CXKA 4GKLA 3BLPX 3NSMA 2A3EA 5EFDA 3HZ3A 1B3WA 4C7GA 2WC7A 1E71M 1EO7A 5AY7A 3T2OA 4PN2A 1L8NA 1JD9A 2XM2A 3VGHA 1J9YA 2VOTA 1JI1A 1U2YA 3VIMA 1JI2A 1MW2A 4JKMA 1CXFA 4JKLA 2CKRA 5BYWA 3MO4A 2PWGA 4PRWA 2J75A 2XHYA 1W3KA 5D8WA 2JIEA 2GJPA 3W37A 3AXXA 2DT3A 4M29A 2Z1SA 1WNOA 4HZ6A 4JL2A 5ABGA 2ZUVA 3VD5A 2VTFA 2PWHA 3N17A 5A69A 3ARSA 1MW0A 5JIPA 4AD4A 1DWJM 3A3HA 3OGSA 4X0NA 4CD7A 1MWOA 2XN0A 1UQYA 5BXTA 1TR1A 3ARPA 5D8ZA 1BG9A 5IHRA 4YHGA 2D20A 5ECUA 3TOPA 5A1AA 3K4AA 1GHSA 1BF2A 2VO5A 3VINA 1M7XA 5M5DA 4AIEA 4B9YA 1VIWA 2ALWA 1F4HA 4AZ7A 1HN1A 1QW9A 3THDA 3TTOA 2CEQA 1KWKA 5GQBA 2CBJA 3SCUA 1XYFA 3EJRA 5FL0A 1TQTA 3H55A 3CBWA 1XYZA 2VRQA 3CZ8A 4W5ZA 3WQVA 3F5JA 3EYPA 1UH2A 5CG0A 2J25A 3VDHA 1VJZA 2PWFA 2BXYA 1BGGA 3N1AA 4XZWA 5LA2A 1EO5A 3EDFA 3OLDA 3AS1A 2E3ZA 2VVSA 7TAAA 1NOUA 1RP8A 3BAKA 3VMOA 3WIJA 1E0WA 1Z32X 3GH5A 2F1BA 1AQMA 3BVXA 1HL9A 3BSHA 3TTSA 1C8XA 3AIUA 3O9NA 1LF1A 1VEOA 3A4XA 4W86A 3VIPA 3ZOAA 3W38A 2JF6A 4J3TA 4UFIA 1W9UA 3AS3A 3N11A 3AOFA 2OLHA 1E6ZA 2GJXB 3BGAA 4QCEA 1ISVA 3BXWA 3QR3A 1E15A 3U5UA 3L4UA 2WVVA 2FH8A 3SUWA 1OSEA 3SUTA 1EOKA 4D6IA 3SCNA 2V3GA 1W2PA 1E56A 4DUWA 4UFLA 4CVWA 4NZJA 2OYMA 3BLKA 3KE0A 1OB0A 2J77A 3B9DA 1XD0A 1ISYA 2J4GA 2NT0A 3WDIA 2WWCA 3S2CA 3CHFA 4LGXA 1TQVA 6TAAA 3H54A 4AYSA 2DGAA 1HJXA 1FP8A 1JYWA 1BAGA 2X1IA 1J0ZA 4W8BA 3BUDA 4QCFA 4EAMA 3NJ3A 5A94A 2WHMA 1BGAA 1BQCA 3W81A 3OA5A 2D0GA 2WCGA 4B3KA 1UD4A 3ZIZA 1W3JA 3DYPA 1BYCA 5A8OA 1E9LA 2XVKA 3EJQA 4FLSA 1DWFM 4CGTA 5FCZA 1UWUA 2W63A 2YOCA 1BHGA 1MXGA 1KGXA 3DECA 2ZXAA 1OIFA 3W0KA 4M8UA 3AIVA 1R8LA 3VPLA 3LXCA 1GVIA 2O9OA 1NWSA 1B0IA 3LXAA 2BXZA 1V3LA 4AZGA 2WANA 1ZBCA 4J7RA 3UERA 4XZBA 1JIBA 2GVYA 1G0CA 3D52A 5FOOA 1LL7A 3BLBA 3O6AA 2VX5A 1QBAA 4OBRA 4CU8A 1OWQA 5EMYA 5KEZA 3VTRA 3WD1A 1LJYA 1GOOA 3HU7A 2EPLX 3KL5A 1W3LA 2DT2A 2W67A 5TD4A 1QNOA 4AD1A 4GZJA 3IGUA 2VCBA 2JF7A 1J0KA 1W1TA 2FYVA 3G6MA 2PBGA 2YBUA 3BUQA 3SCQA 5HPCA 2F7QA 1HP4A 3I3BA 4KH2A 1XSIA 3WY3A 4CN1A 1C3FA 1E6SM 1FH9A 3MSGA 2DH3A 4W7VA 2DSWA 1W9PA 1B3YA 3NIYA 3F5KA 5CPTA 4B16A 4YN5A 1E6NA 3ALGA 1EQCA 1HKJA 1FFQA 4PMXA 5E6YA 2XG9A 2DQXA 4TVUA 1SYTA 3DYOA 3CUHA 2E9LA 5I2UA 5D4YA 4A4AA 4OIFA 3MS8A 3MUY1 4J3UA 5BRQA 2DSVA 1NWUA 1H49A 3VGDA 5IDIA 1BG4A 1TA3A 3AHTA 2YDSA 4JL1A 1O7AA 2FHCA 3G6LA 2XWDA 3UETA 3LMYA 2D2OA 2YL9A 3TTQA 4HA3A 3LRMA 1E3ZA 3CZJA 3BCFA 1K9FA 3WQ6A 2DPEA 2WSKA 1GOMA 2UWFA 3VIOA 3AIQA 3WF2A 3TV8A 4JFWA 5FKYA 1E1FA 3AIWA 3EMZA 1JAKA 1US2A 2V3FA 2GK1A 3FHAA 1E6QM 1D7FA 3S5ZA 3WF0A 1XV8A 4PEEA 3QGVA 4S3JA 3L4TA 4ZENA 1NWTA 1UWSA 2ZOXA 1JXJA 4N42A 1PAMA 1WDSA 5CLTA 1CGUA 3EJUA 1ZL1A 1U33A 3B8SA 2VUYA 3VGGA 4WJXA 4OOZA 3ZM8A 3FXYA 4AMCA 3AXHA 4MAZA 4TTGA 3WQ8A 1Q4NX 3VD9A 4BS0A 4Q22A 1C91A 1CLVA 4PUDA 1XH1A 3E1F1 1GCYA 4DO5A 1Q6FA 1QOXA 3ARYA 3EMQA 3ZT6A 4U31A 1CPUA 2DSZA 4AW7A 2DDXA 3MUAA 3NYDA 4NSBA 3MMUA 3PHAA 3WH8A 1JZ2A 1CTNA 1GOIA 5C70A 2CITA 4W93A 4KWUA 4HOZA 4HP5A 3IK2A 2FGZA 5D9PA 3PZIA 4X9YA 1NM9A 4W5UA 2BY1A 4HOXA 1KR1A 1R86A 2BHYA 3L4XA 4RL3A 3VNYA 2X0YA 1ZBKA 4W8LA 2IXUA 3CMGA 4DM1A 3LX9A 3CZNA 2JEPA 4B15A 1CWYA 3WFZA 3SEPA 4ZXOA 4OOUA 1JD7A 1QI5A 3RILA 1AQ0A 2WZIA 1M01A 1QHOA 5CPQA 1DP0A 1W91A 3DX4A 3LRLA 2QPSA 1CBGA 5A6KA 1Q6DA 5HXMA 2QV4A 4UR9A 2BVDA 4NX0A 5AYBA 6A3HA 2YIHA 3CUIA 3VILA 2XGBA 4AISA 4LPCA 4QLJA 1VEPA 1GZJA 2QF8A 4BQ4A 1C8YA 3EDEA 2J7GA 3BAXA 4H2CA 3ZR5A 4MNLA 5HNNA 1KR0A 4PTMA 2WZEA 1GHRA 3WNNA 4HZ8A 4TX6A 1HKIA 4FNRA 3OB8A 4P8UA 2B31A 2C8NA 5I79A 3N9KA 4MDPA 2WCSA 2OW7A 2UY2A 3TTYA 3FW6A 3HJEA 4HOWA 1ITCA 1EHNA 4PMNA 4CD8A 2GFTA 2EABA 2ZXBA 3UG4A 4NRSA 1R75A 3CV5A 3L4VA 4GQQA 1H1NA 4Z2JA 4LX4A 3SURA 2WCAA 5AYIA 2WSPA 4M24A 1AQHA 2AOSA 3CZKA 4UZSA 4YPJA 1TZ7A 1QWUA 4CD5A 2OYKA 3GXNA 1D3CA 1Q6CA 1VBUA 1XSKA 1UH4A 4HMEA 3VNZA 1EGZA 4PUEA 3CZGA 4GZIA 2JALA 4H41A 4E8DA 3VIIA 4E4PA 3BUPA 3WSUA 3APGA 5GNXA 1A3HA 1B30A 3H53A 3KEHA 1BVNP 4XB3A 1V6UA 1H11A 1CGYA 4UOJA 4HMDA 4U2YA 1QNRA 1B3ZA 1V6YA 2FDMA 1O6IA 4L4PA 4L4OA 1JYNA 1TG7A 3ZO9A 4ACZA 4IPNB 2D0FA 3WBAA 1GW1A 3MUIA 1M53A 2VZUA 3WDRA 3GH4A 2CIPA 4W88A 5EBAA 3A47A 1HJSA 3SUSA 3NDYA 2VNCA 3PZTA 2EPMX 1KFWA 1NH6A 1PIFA 3WL1A 2J7FA 4TVCA 3AMDA 1QPKA 2Y8KA 3VU2A 4FMVA 2DT1A 4PMRA 5I78A 3T0DA 2BVTA 4FNUA 1FHLA 1CXEA 1QHPA 3FAWA 5I0DA 4N0RA 5IFPA 1OT2A 1CZ1A 2VQTA 3WUFA 3PZGA 5I5RA 1IT0A 1R34A 1GNXA 1MFUA 3MV01 3PTMA 1I1XA 2XVNA 2PF0A 1E5NA 3M6DA 3WH9A 2OSXA 3GDBA 4P7QA 1DWIM 1KGUA 1ESWA 3WEZA 2WKLA 3WN6A 3SUUA 2WC4A 3EJPA 3GM8A 1WDQA 1Q6EA 2WVTA 4KRUA 3WF4A 1TA3B 1VB9A 4E8CA 1E72M 5BXPA 3GTNA 1ITXA 1CXIA 1SR0A 3BUIA 2VVNA 3CHEA 3OG2A 2CKSA 3UCQA 4PTWA 2CYGA 3IJ7A 3SCWA 4CCEA 2NW0A 1WDPA 2ESCA 4NZFA 1TE1A 2OSYA 3BUBA 1K9DA 2ZX9A 3W6MA 3VIGA 5DT5A 1PX4A 2WXDM 4MTVA 5ABHA 1XGZA 1K9EA 3QHNA 4ZFMA 1KB3A 3UEQA 4M56A 3T2PA 3OLEA 4JHOA 1HVXA 2YA1A 2VT0A 3D5HA 4R27A 2CHNA 1KQYA 1GOKA 3FY1A 1QBBA 1V3JA 1C7SA 4WKHA 3AS0A 3VD3A 1BPLB 4FNSA 3VX1A 4FLRA 3WH6A 3IANA 1QI2A 2NSXA 1M03A 4V2XA 3RJXA 4AXNA 2YBTA 4AZ5A 5DEZA 2QLYA 3VIFA 2C0HA 1FHDA 4W84A 1UG6A 1HTYA 1VAHA 3A22A 1NARA 1G94A 1E4LA 1FP9A 5DT7A 1E6PA 4HMCA 1TCMA 5IFTA 4AWEA 3ZT5A 1E70M 1KCLA 3ZSSA 1KGWA 2WMFA 2YLLA 3DHPA 2ZX6A 5BROA 4NF7A 1J0YA 3IJ9A 1VBRA 2F7PA 4JFTA 5D9MA 1ZBVA 3K8LA 3VMNA 3AMLA 5CZKA 3F5LA 4UCFA 4AZBA 2WM0A 5C8BB 1US3A 1QI4A 1B3XA 2YLAA 4GXPA 4MJ2A 1KXVA 1OCQA 1UKQA 1BFNA 3AYSA 4OZOA 5E70A 2WHLA 2FHBA 3BAJA 3D4ZA 1QW8A 4D72A 4MNJA 4W8AA 1UD5A 4PSPA 1OBAA 2XFYA 2WHJA 1LWHA 4D6GA 4J3WA 1GJUA 1V3HA 1E4IA 2XSAA 4DO4A 3EBVA 2V38A 3QOKA 3WH7A 4B9ZA 2IXVA 3UG5A 1HXKA 4JAWA 2G4FA 2WPGA 2ZUWA 3GXMA 3RM4A 3U5YA 4UTFA 3WDPP 3WELA 2VZVA 5EFFA 4MB4A 4U5IA 2D73A 4WKFA 3WEOA 4U5KA 5I6SA 2YA2A 1J12A 1J18A 4MAVA 4RE3A 3RJYA 3MMDA 2VCCA 3WD4A 2VURA 3POHA 5A8PA 3BCDA 4P7OA 1EOMA 2EO7A 2V3DA 4LYPA 1W1PA 2EEXA 1I75A 4H8HA 3OLIA 1KBBA 1CEOA 2FHFA 1VEMA 3SCVA 3W26A 4GO8A 2WMHA 4DM2A 2V5CA 2WW5A 4U33A 1HXJA 3VGBA 4TX8A 1MQRA 5A2AA 4UFHA 3SCTA 5E9AA 3GBDA 1ISWA 4JHZA 5BWFA 1PZ3A 1UKSA 1E43A 5LYRA 3ZJ7A 5A3HA 4NRRA 1V02E 2A3AA 4NXKA 1EDQA 1UR0A 2F61A 2CBVA 1UQZA 2DEPA 2DT0A 2X0HA 4HU8A 1UD6A 1MXDA 3HG4A 4WSKA 2BY0A 2EPOA 1E0VA 2WMIB 3DDGA 3KWXA 3VIKA 1W9XA 1LL6A 1B9ZA 3WUGA 2G3IA 1QNSA 3EDJA 2ZUMA 8A3HA 2PI6A 1LL4A 1JFXA 1J0HA 1QNPA 3AYRA 2D0HA 2GK1B 1V3KA 3MUZ1 3U7VA 1LG2A 3A21A 1JAEA 1SMDA 4ACZB 1Y7VA 3AHYA 4V27A 2XGIA 3J7HA 2D22A 3WNLA 3SUVA 1DWHM 3VIHA 2F18A 2J7BA 1UWRA 3WH5A 2AMGA 1GQKA 3ZMRA 2E9BA 3UR7A 1HJWA 3VVGA 2FH6A 2Y8VA 1EA9C 4WSJA 4WKAA 1SFSA 3OZPA 1XSJA 4C7FA 1R85A 2ZX7A 4OBSA 3PZNA 1XCWA 3D4YA 2W66A 2EPNA 1ISZA 3VDAA 2ZXDA 2VRKA 3K8MA 2X09A 4QFUA 5CSYA 1OGBA 2WBKA 1HJVA 4OJYA 3WNKA 1C8QA 1KXTA 3ZQ9A 5I24A 4MNKA 3F4VA 4NXSA 1UR2A 4UFJA 2PWEA 1BYDA 2EQDA 3LPPA 4CN4A 1H4PA 1PPIA 3D50A 3CUJA 3RDKA 1C7TA 4WK9A 3AMCA 1UWIA 5E6ZA 3POCA 3TA9A 2XTKA 1JNDA 2GSJA 4GI8A 3WMSA 3AJ7A 1MQQA 1WB0A 4W89A 2ZX8A 3MSDA 3ARTA 2Y4SA 1T0OA 4FNQA 1JYXA 5BCAA 2ZUSA 3VD4A 7CGTA 1RP9A 1E6XM 4F8XA 4MPKA 1CYGA 4RE4A 3VSVA 2ZUTA 3PZQA 1SMAA 2YL5A 3WMCA 4Z2GA 2QPUA 2X2JA 1GOQA 4CVUA 1HNYA 3WEMA 1G1YA 1TFVA 1UR8A 5A95A 3PZMA 4D6JA 5JIWA 4WF7A 4LXFA 3ZR6A 4RE2A 4UNIA 4PBGA 2WMJA 2Z1KA 3II1A 1UHVA 2VRJA 3BH4A 4IM4A 1NWRA 2CERA 4KRTA 1D2KA 4QLLA 5A2CA 5JUVA 3RO8A 5E0FA 4P8WA 2WLZA 4DWSB 5IHSA 1K9TA 1W9DM 3CHDA 1JNEA 1X6NA 1IZKA 1W9VA 5CJ5A 3GBEA 1X1NA 1DHKA 2VCAA 3CO4A 3VM7A 1H41A 2HISA 1IV8A 4H8VA 4GPNA 3MU7A 1MYRA 4CU7A 1UA7A 1QWNA 2XVLA 4AEEA 2CPUA 1LQ0A 2BHUA 5CXPA 4ZE5A 1CLXA 2VQUA 3D3AA 2E0PA 1NP2A 2X2IA 4HA4A 1S46A 2E8ZA 4Y7EA 1OINA 4PYSA 1C93A 2A3BA 3HMCA 3AXIA 2J8GA 2VX4A 1OD0A 2VX7A 3GNOA 1UR4A 2DH2A 5A6SA 4UQ9A 1H0GA 4HPHA 4IISA 2YA0A 4JFUA 2Y2WA 2ZUUA 1LWJA 1CECA 5EB8A 4URIA 2XN2A 3MANA 2VL4A 1ZJBA 4JFSA 2OWWA 3DX0A 1QVBA 4LYRA 3W29A 3W27A 1VFMA 1EHAA 2WAGA 1KXQA 1QI3A 3KL3A 3DYMA 4W85A 2F7OA 1WE5A 3WENA 2WVSA 2OSWA 3LPOA 1DEDA 5A8NA 2F8QA 1HX0A 2OWCA 1AMYA 2GDVA 1BVZA 2GJXA 4GZEA 1C92A 3WF3A 1R87A 5M03A 5M3WA 3CH9A 1JL8A 9CGTA 4TOQA 5JBEA 3GNPA 4CKQA 3D51A 2E8YA 2WWDA 4F9DA 4XX6A 1DTUA 2XM1A 4UOZA 4AZHA 1TVNA 1B31A 1BLIA 2AAAA 2ZX5A 3DDFA 1OM0A 1WKYA 3BSGA 1G9HA 3HG5A 5E0CA 2XIIA 4AD5A 1PJ9A 2VI0A 4GINA 4XUYA 1W1YA 4JCLA 4PTVA 1JZ5A 4JCMA 2BV9A 1V3MA 1TUXA 4UZUA 1JZ8A 1C90A 2EAEA 4AEFA 4D6FA 2J7DA 3WUEA 1R46A 2GDUA 3UESA 2GUYA 3WF1A 1NQ6A
chains in the Genus database with same CATH superfamily
3K4DA 6FABH 5DJXB 4FULA 5BVPH 4PJAE 4NYLB 5I26A 3AAZB 3LKQB 4I3RL 4KK5C 1DIKA 3FJLA 3SY5A 5EBGA 3S0CA 4C4KO 3ZY7A 3VXSD 2VZ1A 3QPYA 1SJMA 3QXUA 4A2DA 5C08A 5A7BA 1M2VB 4JM2B 3ZZLA 4AZ8B 1SJBA 2F53A 1YRRA 2QVNA 1X5GA 3HMCA 3BV4A 2YMTA 3EO9H 3NL3A 1K70A 3ZQXA 1HEZB 3DI0A 1XISA 3E6FA 1XC4A 2PABA 3CT7A 1IEWA 1M7PA 4IX0A 2PPCA 2X4SA 5ITBH 4H19A 2XJ7A 4PI2A 1I85A 4UAOC 2OJZL 5T5FA 1ZNNA 3WJYA 4H1LH 1OX5A 1SOQA 3VFMB 4B5XA 2WVVB 3M45A 2DQTL 1CLCA 4P23C 2OSLA 2WLJA 1EP2A 4HPGA 4RXFA 4LVDA 2OL3L 2WHKA 4FG0A 2VABA 5B38B 4GH1A 3APCA 2WVUA 3WUBA 5FL1A 4XNZB 2JJWA 3NGJA 2NY0B 3QEQB 1T6MA 1QLEL 1WBXB 1HKWA 1C29A 3WFAA 1ADQL 2RIKA 1R3YA 1NC2D 4ZMWA 3NURA 4M3PA 4GC4A 1SFDA 3DCPA 3WY2A 5CGBA 1ODZA 2QDDA 2SODB 4EI5D 1S78D 3KS0H 3ENLA 3WTSA 3UFIA 3WK2A 4IGBD 3JWNC 4HJUA 4N8CH 2A38A 3VFCA 1P48A 3IS4A 5BRZB 5KZ6A 4DKEH 2BP5M 3GBNL 2Y85A 4GGHA 2J8OA 2YFNA 3NABL 4HJGA 4UQIM 4XI5C 2LR4A 5M7QA 1FYTD 3X17A 1G7UA 1WKDA 1WUEA 4GI6A 1XRSA 2PDKA 3F03K 1EVUA 1LK2A 4BEQA 5HR7A 3DUSA 4Z7UB 1PXGA 4I0PB 5IMOA 3GMLA 3DA0A 4OGXL 4UTAH 1NFBA 2R2CA 3ZJ8A 4EZMA 5ICZB 1RU9L 3MTWA 3FKKA 2YGPA 5CLWA 2VEFA 1JPGB 4N0YH 5AYUH 5BXRA 3EGXB 3IJ6A 2O9TA 1L9TA 3F7JA 4R97B 4Q89A 2ZF9A 3FQXB 2FBOJ 2P9RA 3NACL 5GGUB 1GQIA 4BQBA 4F1SA 2AGJL 1WFTA 3NSYA 4BM7A 1W32A 3EO1B 4LESA 2PNDA 2Z3FA 1GYMA 2HRWA 1G7IA 1HH9B 2KPWA 5DMJB 5TQ2H 3V9CA 3VJ6A 3AZRA 4JYEA 1DVUA 3HS8A 3HZVA 3SIMA 1MUJA 2A79A 4KDWA 2VX6A 1ZHNB 3RIKA 4AUJA 1O60A 2HG5B 5EU9A 1WV7T 1PZ5A 1N19A 4U4IA 3TYUA 3L4YA 3BAWA 4NKOA 3DPBB 1AE6L 1B0WA 1A9BA 1NLBH 2AGKA 4AMXA 2PMZA 2LLGA 4E9VA 3TEVA 3HBLA 1CLYL 1IBYA 2GVEA 3FQWA 1NLDL 3S1UA 4KRZA 2MFNA 3DUUA 4IRSB 1NSJA 3BIBX 1FNAA 1NIAA 1I2NA 1X98A 3G1SA 1AHWC 2YK1H 2PYEA 3DMMB 2ZG2A 2ITCB 1NKGA 2NNAB 2NY3D 1E5BA 2OJEA 3FU9A 4LL9A 4BXVA 4F91B 2OLSA 3HPXA 5JHMA 1PZUB 4XC1L 2CLRB 3GNRA 3P73B 4OCXL 4NC0B 3MOBL 3TVMA 4EE2A 3NQEA 4IBQA 5C0CD 3MB9A 2NVDA 1A5LC 3AYTA 5HGAB 2VABB 2DJUA 5DUPL 2ZXQA 2O30A 4LRIA 3KH3A 3XIMA 1WPCA 4PU2A 5F9DC 3L7EA 4B41A 7FABH 1EBHA 4UNTA 1YPFA 4P5MA 2OTPA 3L17A 5E99H 1GC1C 1KGCE 5H8MA 4PJ7E 4W9HC 1ZLUH 5H8UA 3SJ3A 1FYHB 1T0MA 2GQ9A 4KTYA 2E7LC 2NY7H 3AIRA 4LOCA 3NEVA 5JPMC 2QCDA 5I3HA 5BOEA 1QYGH 3GMNB 3JUZA 1HWHB 3LZFL 4KVNH 4NO0D 4NQXA 5GS1C 2ADIA 3IDXL 1XR2A 1OLZA 4HHWA 3CX5K 2W9LA 3USBA 1UP0A 3THCA 1G4PA 3IEBA 1TO3A 3GUTA 1NU5A 3N9RA 1JHLL 4FX6M 2C7FA 1W5OA 2BDQA 2JWYA 4BQ6A 4B53A 3M16A 3P3TA 2O7SA 2QR6A 1PFOA 1E4KC 4G7VH 3K71B 2JEQA 3TYDA 1J79A 4K2UH 3B1UA 1IEBB 3DIVA 3VRIB 2OR2A 3NSFA 4F8QA 4JHAH 3IDIB 3J27A 1KTNA 2ZAHA 3PWNA 4PTUA 5E2TL 1AC0A 3WQ5A 5ABEA 2VMFA 1VBHA 2NVCA 2WLYA 3VM5A 1XBXA 1YE6A 5A6BD 3ZKMD 2AK4D 4YDVB 2FFIA 1WA2X 3H7RA 1JNJA 3VVVA 3VD2A 5F2IA 5HA7A 1AH1A 3GPSA 1E5UI 3KOZA 3G6JA 4OFDA 1A5KC 3C0SA 3HPZA 3KBMA 1KF9B 2OQJA 1TJHL 4RGMC 2JB5L 2DYPD 2JJUA 3AUVA 3NFPB 4IEFB 4IXHA 4J2PA 3H21A 5E8PA 1MFCL 2DL2A 5GS3A 1JZFA 2CIKA 3AB0C 3AACA 5IBLD 2Z92B 1EL3A 3DIFA 3H2CA 5E9DE 3THAA 1PDYA 1JWMB 3NDYE 3F6LA 3AVEA 3TIEB 4W7WA 2XWBA 4JGNA 2I14A 1EIBA 2Y88A 4MNQE 4KMQA 4IIQC 2EPKX 3B2XA 3M07A 5FUOH 5SWZA 2P10A 4X9SA 5J12B 1A47A 3RJDA 4PJEF 4OTKA 5I3GA 1FG2A 2YFOA 3S37H 3C5JA 3ZZ1A 1S2AA 4NVTA 5MEOA 1V7AA 4R9XA 1R5IB 3S1GA 3H9YA 1NGZA 1R6WA 3CUPA 1QW7A 4Y6GA 4JR9H 4DLFA 3BDYL 1AKPA 4ROPA 3UYRH 3Q4DA 4DBDA 4O5LH 5JW5B 1LO4H 3UA3A 1HI6A 3O3UN 3HNSL 4F8NA 2PC4A 5HHOD 1UWYA 1E9QA 1MNUH 2P3EA 3OVQA 3ULAB 3MOAL 1T7XA 3HI6H 3M43A 3WDQA 3JTTB 1W9BM 1UZGA 3WFLA 1OTUC 2ZKXA 5DTFA 3X11A 1NOFA 3NDZA 1GVFA 1QSEE 3WNMA 4K2SA 4F15B 3E3QC 4PE8A 3KPRD 4Z2KA 4R85A 1P9MA 2A77H 1T0NB 3S34H 1SN5A 4JM0A 3T04D 3QFGA 4NZTH 1AD4A 4X7EC 3D4CA 4AQOA 3H22A 2FWUA 4NNYA 1K5NA 2ZAIA 2WXNA 3T07A 2CLVA 3HR6A 2V5TA 4HPNA 4ZW7A 2QDWA 3CWGA 3T9PA 1F9CA 5EIIG 1IBDA 1FWJC 3O9WC 4GYPA 4LSRL 2ATKA 1LEGA 3KZSA 3OOQA 2R83A 1H3GA 5TPWH 4M1GH 5HBFA 2OVLA 1WT5A 4FG6C 2PDHA 5GS2D 4NQQA 1KCSL 2FWOA 1RPQA 5LO7A 1WCGA 1TLKA 1WD9A 1X7QB 3E0WA 4IOSD 4HCHA 1W5NA 4DZ5A 1IVTA 3ANUA 3SCPA 1A6ZB 1GQLA 1ID2A 2BWGA 3MT1A 3PPGA 4RZ5A 4NN7B 4CSTA 3BVWA 3K72A 3MV7E 5L88L 4P7RA 3VKDA 4DX3A 4P2QD 5K1JA 1MHHA 2N0MA 3V5FA 4O02H 4PRID 3ISYA 2BXVA 3RM9A 4HS3B 4ACPA 2Z65C 4O9HL 4I89A 4KCTA 3QUYC 3KGSA 3T6XA 1JYVA 3CIXA 5I30L 3MRDA 1A9VA 4X63A 3I85A 4Y2LA 4K38A 1XO8A 1RUQH 1TQWA 5DC4B 3CNYA 2PFHA 2X4PB 4IRJB 4X6FB 3N12A 3PAZA 3MNDA 1H0IA 3ES8A 4IPJA 5A3IC 4XP9L 3A6BH 4IBVA 2CC0A 2QHAA 4AEHH 3WIAA 6CGTA 4DYKA 2H90A 1EMTL 3C6SB 3DHUA 3O6LH 1JHKH 2GUOB 2N7BA 2Z9TA 1KYFA 3QWOB 4JB9H 4NENA 2VERN 4RAVA 5A43C 5MERA 3MJ7B 5DSCB 5D2NB 4JX6A 4O4VA 3B0VC 4IMGA 1OCCB 5LIUX 3BC9A 1BEXA 2IDFA 4W81A 4LBUA 4XMZA 1FI8C 5KSBA 4Z7VB 3T3MB 1GC1H 3KPNB 3LJ3A 4N6RA 5FSEC 1AZNA 5GNZA 3WO8A 1R9YA 2HT4C 1Z5HA 2X2YA 3N9GL 3OF6D 4XBEL 4JO2H 5FYJU 3TEUA 3JU2A 3D2UA 4PJCB 1K8XA 1MY5A 1NGZB 1UKTA 3QZLA 3AWOA 5BW6A 1DIEA 2W6RA 4UMSA 1C8PA 3LGGA 2IALA 4ZMVA 3O15A 2ZZUT 3VFSB 5JQHC 4DO6A 5JBFA 3EYQD 1ADSA 3S47A 3V9EA 3V4UL 3VGFA 3MUJA 1P1ZB 1CGWA 1ZWIA 3BQUC 2C26A 5K9QG 3B9AA 3MRPA 4KOCA 2IAMC 2QKFA 3AITA 4PJFB 1SN2A 1WGOA 4H20H 4GQGA 4XCYA 4KQ0A 5M1TA 2J74A 4XAYA 1TENA 3BO8B 4JO1L 1TETL 3I3DA 1FAIH 3WBEA 5AB9A 1U8NB 2GDQA 4M51A 2XN1A 2OK0L 5I1CL 3HKFA 1Q6GA 2JJSC 2IKJA 1LE9A 3F6JA 2OYLA 4NASA 3RCMA 1MFDH 3C6LD 5HHOB 3QCVL 4Z1YA 2ZUNA 4E4FA 1DBJL 5IJVB 4F3FB 3D6GA 3PP3H 2MOQA 1KULA 1IZCA 4YU1A 3EBHA 3V6OE 4PUWA 4Q8BA 2H2SC 1A7NL 2V2XA 2VDLL 4N2IA 2IH8A 3N2XA 2NQCA 2E75C 3X1NA 4KKBC 1AR1B 4GMTH 4IPLA 2FL5B 2C9RA 4W1TA 1UCWA 4ZBCA 5DJ0B 5ABFB 1BM7A 2VQ4A 2BHFA 4CNTA 5IESH 2ICCA 3VCLB 2BW5A 3RNQB 4ZOAA 3BJTA 3VDGA 3TMLA 2JKTM 4HPOL 3SQBA 3UMTA 2OI9C 2PW2A 4DCQA 3A24A 1ND0A 5DCEA 1P7KB 2VMDA 2YJQA 3ZDXF 3EYUH 4BH8B 3PUOA 3CBRA 3MV8B 1WAWA 4QT5A 1MN4A 1NAMB 4NUJA 5J89A 2CLZB 1RD6A 4XD6A 5TDNA 1HZLA 1XIMA 4DN3H 4BWTA 1LMKA 3GO2A 4W87A 4ZQPA 4LSQH 3W24A 3ZO0A 1M05A 4Z76B 1E0XA 4L23A 5E8EB 3GMPB 3F7QA 1D9KB 1FVCB 3S46A 4Z8FL 1OF2A 1TTRA 2NXZD 1J8VA 3AXMA 4EIVA 5DJ6A 4AVJA 4V1YA 3FSOA 2XFWA 3U36A 1M9SA 1H5BB 4HZMA 3LCHA 1ZP4A 4PB9L 1NFAA 2QSQA 5JUEL 2LAAA 4NT6A 5KSVB 4LBAA 3F85A 4AQEA 3LS5H 2J9ZA 2V5BA 4ONVA 1RZIA 1P0BA 1CGSL 5FO8A 2Q8LA 3UAAA 3FRPG 4MMZC 5TDNB 4XMTA 1O66A 1P5BA 2ABAA 4QP0A 3EJYD 4HDIA 5DZJA 4AD0A 1R19A 2JE8A 5DFVD 1ICSA 4MX7A 2O4MA 3VMPA 3L9CA 4P8XA 1PU0A 5TH2B 1CICA 4QJ3B 2CLPA 5FB8A 3ABQA 3EEZA 4UM8A 1VLWA 4RZKA 3BURA 2OW6A 1V55B 3L6FB 3PF2A 2DZWA 1F5WA 3WBWA 4QXUH 2FO8A 1E67A 4HIEA 3GI8H 4J3VA 4WDIA 3Q1SL 4GKNA 4LNCA 4AWTA 1DIOA 3RX4A 4D8AA 5A8QA 4QRRB 2F7RA 5LXXA 1RSYA 5JPNC 1UKOA 4LRIC 4NQSB 3LHWA 4EK7A 4B9FA 4FJ6A 2NYZA 3G1HA 4N2BA 4O2CA 3ABGA 4APQC 1VESA 3P4LA 1T89C 4MDOA 3CDZB 2UY3A 2R2BB 5KSAB 4KK9D 1CQKA 1LTXA 1I1FA 4PV8A 5FB8B 3MRCA 2PTZA 2IBBA 2VJXA 3SBQA 1MEWA 4NAEA 3QHOA 1QWHA 1YUHA 3C75A 1IARB 3MRBA 3QCVH 2WBJA 1K4DA 3QC0A 2WY3B 2YUXA 4ETQA 3WTXA 4GKTA 5FS5A 2AMXA 1MY7A 5E2VL 2D23A 4A35A 4ZGYA 5FEBA 2EAWA 4Q7NA 2EO9A 1F3XA 4GYKA 5I1KL 3NQFA 3WMBA 1H0DA 1V8HA 1OHZA 4JRXA 3V6OC 1JGMA 2APBA 4XUGA 1TLMA 2DQUH 2W94A 3UPAA 5IW6B 5JQ6L 2R2HB 3N2OA 4FXSA 5PCYA 4GRSA 2XIQA 4Z2HA 2CM6A 3C6LC 1FZJA 1TWDA 2CDGB 3S8FB 3V5KB 1DVFD 5JTWA 4ATWA 3X13B 2G4JA 5CEYA 5KYYA 4TR9A 4DWSC 2VWEC 3ILQC 3MV8A 4LBEA 3AXLB 3GZ3A 4NIYE 4OZHB 4BK5C 4JFFD 1WCQA 1PX3A 3GSVA 1O5XA 2QSTA 3V18A 1CDUA 4MA8L 2FZDA 1MWAL 4NWTH 3WTUA 3TBWB 3CAKA 3X13A 1Q9KB 5DFAA 2Q8BH 4UQ2B 3LPFA 3ZZSA 1A5FH 3AHZA 3L5MA 5I5IA 5HHVH 3QWRD 3DNKA 1T1XA 1TV5A 1IKNC 3K6IA 4J5NA 2CR6A 3WL0A 2HXUA 4QIUA 3C8NA 4NUGL 4NWUL 2CJ3A 3CVDA 2Q87A 1PKYA 3ARQA 5KJ7E 3R0KA 4G6MH 5DJDB 4DUXA 1DWGM 2HTLC 4YDKH 2MANA 3U0PB 2Q6ZA 3F2DA 3E9UA 3QYMA 1NGPH 4AYDC 4NYYA 5HNTA 1ZKAA 3KYMB 3PU7A 3TX4A 1KQZA 3N29A 4UTBL 3P0YH 4M0XA 2QVHA 1QRNB 4F7MA 3ESPA 2FX9L 4Q74A 3UROR 6REQA 1AR1C 4M48H 4HQQL 1JF6A 1HQRB 4UOW0 2YAMA 2HVBA 2YMOA 3CFJA 3KNBB 3EFOA 2ICWB 4XPAH 4PN6A 1B3OA 3IUIA 2DQFB 3ASNB 4TKWA 3WNOA 1FWAC 4K68A 4NY2A 5HGGS 1IAIH 1W8GA 2BRRH 4P7NA 3MV7B 5GRXG 1MVUB 4J1UA 3MRPB 1TTUA 4G1NA 3HHSA 4KKXA 4WUIA 3L1GA 2CD0A 3WFDL 1U0QA 3MP4A 4LQ1A 3RAOA 2OFQA 3BLDA 1CGVA 3RU8L 4MZ8A 1S7XA 2C9SA 3LRKA 4UTIA 4L4TA 1NMCB 1GKEA 3R11A 1B2YA 1I8LA 3CFCL 1AZZC 5E4IA 3W83A 3G5WA 2AEWA 4WUUD 4AD2A 2WNWA 1XLFA 2CESA 1J9RA 1EFZA 2MQGA 2P5EE 5EUKA 4JTAA 1WCBA 4JJ5B 4BRJA 2YDRA 3PR2A 2J62A 5HHOA 4KHXL 3SOBH 3CPRA 4IFKA 3ECVA 3VB9A 1OHLA 1F4AA 1CD9B 3TR2A 2G5RA 1E2VA 1MWAB 3Q6GL 4R3SB 4PEKA 3KJ6H 1G9MH 4M80A 5MKGB 1B4JL 4YL9A 1P5UC 1NDGB 1ZA3A 3OQ3B 1XB6A 3ARRA 1KXQE 4XXDB 5MERB 4BGDA 2DWDA 1E2WA 2Y5TB 3TM6A 1QOPA 3L9YA 4LAJH 4MQTB 1OF0A 1XIFA 4HS6A 4OHQA 2OCJA 1HXYA 1YO4A 4MCMA 4B4HA 2HFTA 4GVGA 4D8PB 4CQAA 2NT1A 4S1FA 1F41A 5AYZA 4EZLA 4Y1AE 4X0VA 1JZ3A 3RMEA 4AEOA 2FBJH 3B9KD 3GW0A 1JHTA 4KRPB 5GGSY 3ABOA 1LO4L 3I3EA 1WBZA 4KRMB 2Y36L 4M1DH 1ONXA 1MCJA 4E9TA 5JW5A 1RJZB 4AF0A 1K2DA 4OTXH 2QGEA 4P2QA 4XZMX 4UMCA 1LD9B 2Q6WB 2CU0A 2BY2A 4ZOCA 4AM0B 5LNGA 3PBYA 2R0LL 3ET9F 3LN4A 3ZHNA 1T66D 4O2FA 5JZ7C 3DO7B 1TV3A 4OFCA 4ONHA 2J73A 3R8GA 3LHPL 4IOSA 4KXBA 4XI5D 3B7UX 1T3FB 4JAMA 2W92A 2XYLA 4AENA 3INPA 3NIFE 1BD0A 2UY4A 5IB5B 5IVZA 1GOGA 3WEXA 4RFNC 3A4DA 1M7OA 3CU7A 3DHMA 1FO0H 1N64L 2JQMA 4P2OC 3CCHB 3HURA 2YPKA 2ZBTA 1S7SB 2NXGA 2GSGB 1U91A 5D9SA 3VGEA 3MYOA 4TUFA 5KAQG 1JPIA 3RPIB 4HUWA 2X2HA 4HWZA 2FO1A 1GORA 4I48A 3ZKXC 4OGZA 3GIZL 5E1HB 5ELIA 4AC1X 5J04A 3HE6D 2EEBA 4M7ZB 4OCSH 3K5XA 4D1JA 4P5TA 3B7RL 1MRFL 3II3A 3IJ8A 2PUZA 1E9PB 2WQVA 4E3VA 2OEKA 2Z4GA 5HDOA 4GYBA 5LDSA 3C6LB 1NMAH 1Z2KA 1UXSB 3CCHA 5E2TH 2JKXA 4F0KA 2IFGA 3EBGA 3FIGA 5M17A 3ZXWA 4R0LC 1C5BL 3ZXAC 3GS4A 4Q6XA 1KT2B 2YZ8A 4K2UL 4WUKL 3Q37A 2WBJC 5IJKA 3EOTH 3AG4B 3UJFA 4N2NA 1T1YB 3EXTA 5F8QC 1KPRB 1NFDB 4L4TE 2EECA 3CHOA 4N2AA 1ZLEA 4JZNB 4PTTB 4TRPL 4U1JA 2EO1A 5FHAH 5A6MA 5JOFA 4IG2B 1NBYB 4Q9RH 2XWJB 4ZSOA 3T0XA 4L0ZA 2NRDA 2WLIA 1DVTA 5FYJL 2VM3A 5SWZD 3BG5A 3W1AA 1YG9A 1F11A 1N0XH 2PRHA 4FQ2L 1M6UA 5LBSH 2WYSA 1VF8A 3AI0A 2IG2L 3BDKA 2ADJA 4Z7VA 1FN4B 4GO6B 3I75A 4FXJA 1LT7A 3WJWA 3VFRB 4NAFB 3TWCL 3MCMA 2PYED 1FY6A 4BCXA 1ECZA 2UXVA 5EIIA 5E99L 1B90A 1IBHA 1UYWH 3GNMH 1DOSA 1RJQA 2VR4A 7FABL 3JV0A 3H56A 2ZYIA 4L8SB 3DI2B 4MA7L 1KWGA 1POJA 4K39A 3ELQA 1R7AA 4PODA 3BZFB 2EG7A 3MOBH 1TU2B 4YIQA 1SQMA 2AK4A 2WV3A 4XC1H 1J8HB 3JT0A 3RX8A 3F05A 4GJTB 3UACA 2X9WA 5IGXH 2YPVA 1DVQA 1P5VA 2ARJB 5D1ZD 3T44A 1P2CB 1H6FA 2Y5EA 3ZTNL 5EFIB 4JFHE 3GX9A 4GG9A 4YZFF 5FJIA 2TAAA 2E9WA 2AQPA 3D9AH 3JWNE 1E9YB 4MWAA 5DN1A 4LLVA 1ZJHA 3TNBA 2XTSA 3HC4H 4N2GA 4JNYA 5CCZA 2XG4A 4B5SA 4RFOH 3VXRB 2Q3ZA 5DS8A 2VDLB 1ZHLB 1E8XA 1PL3A 2CR0A 3DPBA 3QCTH 4QYAA 1YN7A 2O7QA 3Q5YA 1DUZB 2ANUA 4ENEC 3N4EA 4WFHD 4X9HA 5DVLA 1AGFB 1DQUA 1EC7A 3BI9X 1FDYA 3UZEA 4A2SA 4AQ1B 4PD4J 4AL8C 1BVKB 1U8IA 2JLLA 4R4NC 3U9PH 3K8KA 5E2UL 4YHYC 1TVBA 3UGEA 2RGLA 1TJMA 4Q8OA 2V33A 1RUMH 3CTTA 4FNTA 4RNFA 1T8QA 3IK4A 4LLWB 1MFBH 5HVWA 4L65A 1FL5B 3GJFA 3HKZA 3C60A 2A2QT 4OCRH 1FH7A 4NKCA 1AAJA 2IJ0C 3TJHC 1KC5L 4X6BB 3FCUB 1D2OA 5AHEA 1RJYB 3ARXA 1XLIA 4MB5A 1P6CA 3EOLA 2KDGA 1AI1H 1EA0A 3L21A 2AEOA 4E2OA 4GUFA 1MCOL 4MJZA 4FAMA 3S1WA 3N04A 2TSAA 3QC5X 3HAEB 4O52A 4LCWB 5ITFA 4NM8H 4LVGA 4Q9RL 3N15A 4UU9B 1ZLVK 1E5JA 4JIEA 5E8EA 4CCCA 4KGJA 4LP4A 4ODXA 5CQ1A 1L9OA 1ZS8B 2FEEL 3KMDA 1D5BB 4TNVK 2GVLA 3E8UL 4LOUD 2EDOA 3HZKA 5JXAH 2W5FA 3IACA 5LNVA 4GKZA 1LM1A 1K4HA 3UXAA 1MFBL 3OKLB 1OTTD 4QT5B 5JIDA 1F6YA 4RW3A 3BAIA 3Q44A 4F2MA 3IDYC 3M44A 2PPDA 4UT6L 4Q8NA 2HSIA 3MI6A 4LSVL 1J0JA 5JIIA 4PR4A 1YJDH 2QADC 3QZWB 3CVHH 1FYTE 1VF5C 4K94H 5CWSB 3QZAA 3IBEA 4MQ7A 1FZMA 4DAIA 4FLHA 5HPOA 5LGXA 1EFQA 1NKRA 4X6CF 5DUMH 2YO3A 2XC8A 3QG6B 3U7WH 4ZUSB 3HC4L 4ZJ9A 1ES0B 4V28A 2VKZG 4E68A 4OLZL 2VYRE 4UNVA 1JZ6A 3RWEB 2G4GA 4W70A 1Q72L 3FU8A 1V0KA 5HGAA 4HKXB 2ZOTA 1RJRA 2A6KB 2V67A 1MCWM 2G9KA 5IMKA 3DI3B 2VN5A 3RQ3A 3W3BA 1VYRA 5ENLA 3LGEA 3G6JB 3K80A 5TE6L 1E0UA 3GSWB 1S7VA 1CDIA 3BLPX 4FQCH 4TV3A 2HBVA 3QV7A 3BJSA 4NAEB 2E1DA 2HK0A 3KWTA 3MDWA 3PBUA 1JGEA 1U8CA 2EDWA 4MA7H 4XHJD 5ABZA 1NAKL 5GXBB 1B3WA 2IFFH 4XKYB 1T4WA 4CEXC 5AY7A 1HHGB 2H32B 1ADQA 1E4HA 5AW3B 2BW4A 5I0XA 1L5GB 4E9SA 4FQHB 3KWSA 3NQCA 3QIWD 3KGRA 4GAYA 4KKPA 1J9YA 3FTYA 1OE1A 4HCRH 1AOHA 2QFRA 2ZG1A 4J23A 3GEFA 3T0CA 1CFQA 1R5WA 4GRWH 3VAVA 1MCRA 1IVLA 2X4RA 1F3TA 2LLEA 3MO4A 4RZ4A 5BYWA 4N25A 1X1OA 1MREH 3DX9A 2V68A 3IV3A 1JNNH 2VP8A 3VJ6B 3WQFA 4RX0A 1MFEL 2BNRB 2OO0A 1P6FA 5CJBA 3TYFA 5DD5H 3VFPB 4MDIB 3GDRA 2JIEA 2GJPA 2OZ3A 4H8PA 4EVNB 3FO1A 3KJ6L 3LEXA 4WV1C 4GG6F 3CWOX 3QVQA 1OC7A 4H6EA 3VNMA 3WS6A 2ENJA 2XTJC 4PFEA 5I0VA 4DWHA 1H5BA 3DXAE 1JN6A 3AM8C 1YSOA 2VTFA 4BK8A 3CFNA 4HGWA 2IANA 3SPIA 1OQFA 1XF2A 1MRFH 5A16B 3WIHL 3TVMB 1DJZA 4LHUB 3N17A 4ERAA 5A69A 2RR3A 2CQVA 4JR5A 5JIPA 4OQVA 2MCAA 4M8RA 3JWOL 4BE5A 3O63A 4XP4L 3OGSA 2XLLA 2Y7GA 4YMZA 4JO3H 3IGXA 1TYJA 2VDQB 3BZDA 4WKXA 5MEPB 3OR6B 5FW8A 3ULUC 3T6CA 5IHRA 2BRRL 3HG1E 5E0KA 2CZEA 4PRBA 1WDDA 5ECUA 5I18L 3O3EA 1MNSA 3G6JE 2ZZ6A 1BF2A 4LKCA 4K7FB 4M48L 1T99A 5M5DA 3QIWA 2VQ1B 3QIUD 4B9YA 1YPZF 1W37A 4KKLC 5DJZA 4KROD 5IQ7H 3IETB 3THDA 4FJZA 1TXKA 1X7QA 2YUWA 4EDWL 2PWUA 1AFVL 3BWWA 1KWKA 5TQLA 3IV8A 3GFXA 1QMLA 2K3HA 3VWJB 4C5ZA 2Y07L 5IB3B 2Q76B 3SGDH 3BH8A 1N8WA 5CG7A 4JRYA 2AXFB 4BBWA 5FL0A 3WQPA 2Z25A 1TWZA 2B4CL 2FMNA 3QIBC 1DQMH 3ZL1A 1XYZA 2I07A 3V5HA 3OTRA 1EGJH 5CUSL 3KPQA 3KCLA 2E6YA 3C9NA 2XIJA 2DTSA 3G08A 4POUB 4QY8A 3V8OA 1QTWA 3ITTA 1SLXA 3NESA 1CZ8L 2PR4H 1GPWA 1VRDA 3V5CA 1CT5A 3NIFB 4ZR8A 3V0HA 2C3HA 3DO4A 3BSZA 1FWIC 1ZHKB 3IF1B 4WI5A 2DZAA 3NTYA 1B4JH 3SBWC 2H9AA 3N1AA 4YTRA 1NCGA 4R8WL 5B3NA 1EO5A 1P4BH 2BNUB 2NZIA 3EDFA 3OXRA 4MNQD 5DZNA 4GG6A 2E3ZA 1AGFA 4ZSOE 2OZ8A 7TAAA 1KCRL 2VVSA 3BHBB 4C6EA 2QHRH 3W1NA 4WFED 4XMPH 4F15C 1E0WA 1R5VA 2CSPA 4L4JA 2OLDA 2OMUB 2VSCA 4KO6A 2F1BA 4M8VA 3WE1A 1J5SA 3PBVA 2W38A 5EU7C 8RUCA 4F7EA 2TODA 4LMQI 1UB3A 1BIIB 3AIUA 3O9NA 4Y4KA 1X7SA 3I6EA 3A4XA 3VIPA 3ZOAA 5T3ZH 1XIJA 2JV6A 2HG0A 1ONQB 1QG3A 3D87B 1E2ZA 5E2VH 5JHDA 6PTDA 2B1HH 3CSFA 4AGLA 5HQEA 4UFIA 3AS3A 1DJNA 1XLEA 1GYVA 1H3TA 2B1AL 3I6LE 4NI6A 1W72L 3ZK0A 1MEXL 4ESKA 1E6ZA 1QK0A 3AREB 2GUOA 2E5DA 4LNYA 5I66A 3DJ9A 4S1QL 1T0PB 3SKJL 1ISVA 3QDME 4I5RA 3BK0A 3WQGA 4PJIB 2G5BB 1II4E 2BSRB 3HBQA 3U48A 2IAAC 4JEGB 2Q8AL 1QPPA 2ACUA 3UR8A 4LLYB 2FX9H 4FSAA 3MSYA 2XOTA 1MUWA 5K9OA 1PKMA 3OJVC 1OSEA 3QB7C 2CHRA 4BWWA 3DFNA 1EOKA 4D6IA 4BHUI 3S88L 2K6YA 4H8WC 3VNKA 5BNXD 3P5YA 2WSYA 4Z2GA 2X2UA 4O0KA 1AZUA 3L5AA 1E8YA 6XIAA 4IMAA 3IDGA 1AD9B 1SDDA 5SWSE 4UFLA 3WN5C 4B5EA 2VLLB 2M8XA 5K59F 2VFHA 2WP3O 1E5CA 1XG3A 4YGAB 1BEUA 3GY1A 3SDDB 5SV4A 2DWSA 3LKQA 3TYZA 4M8QB 4OLXH 5KN5A 3WDIA 3BVJA 1RIUH 4XMXA 2K4AA 2NY4D 4ZTOL 3AWNA 2XJLA 2MNWA 3OMAB 4IMFA 4JNMA 2N7AA 3CHFA 4LTSA 1EEZB 4M02A 4HWEH 1EJUC 1H50A 6TAAA 4M43H 4XVOA 1AGBA 4FL4B 2DGAA 2MJWA 2MTAA 1FJ1B 1BQLH 1CD1A 1KG0A 4KC3B 3RGVB 4CGUB 5IVXB 4FOJA 5LIKX 5E9XA 4CC4C 2YW3A 2VB5A 5J6GA 1JPHA 4M03A 3V52H 2D7TL 4A2LA 2WNZA 5D1QC 4JANA 3MDUA 1J0ZA 5JQ6H 4W8BA 4NKMA 3F00A 1UCTA 4LLWA 3QSTA 5ALCH 1LJMA 3OX8A 5JPMB 4NQDB 4KO7A 2P48B 4P07A 1ZALA 4PLJD 3BPLC 4S1RH 4YNYA 1QFWL 1IEIA 1XF3B 1PAZA 3UBHA 2WHMA 3UZQA 1EAPA 1WYJA 4KXDA 2D0GA 4CJ0A 1XQKA 4B3KA 1F86A 4US6A 4X61A 4HLZG 2BBFA 3LB0A 5J6SA 1KCBA 2CCVA 3BARA 4QEGA 8FABB 2OBGA 1LEKA 12E8H 4WU7A 3LLDA 4WRLA 4TO8A 1JTOA 3EJQA 4FLSA 4GMTL 3RWFB 3F04A 4CGTA 3GSRB 2A6IB 2KZBA 4PD4K 3KXFB 2VDLH 1EP3A 5F9AC 5AVTB 1FUYA 2YCKX 4N8VG 3FFDB 4HH8A 2L3BA 4ODBD 3T1FA 1IGYA 5TK4A 1MSPA 3CSGA 12E8L 1U22A 4CNUA 1MXGA 5HWJA 3DECA 3ULUF 1J8HA 3QQNA 3NO1A 2MQ3A 2HRHA 3FO2B 3CT2A 4M8UA 4QKTA 3WTWA 3VPLA 5L2KD 3SE3C 5C0ND 1GVIA 2G5WA 1AZ2A 2OX1A 1B0IA 1DE5A 4NUPA 2BXZA 1V3LA 2WLLA 5D7EA 4S1RL 5C0JA 2DF3A 4WU5A 5T1LB 1EJVC 4PJ7A 4JO1H 2FB4L 3VH8A 3INUL 2WANA 1WT5C 1BZ7A 4CEUC 4Q8WA 3HOGA 3MOQA 2I24N 4L3EE 2OT1A 3B06A 2GVYA 4L3EA 3OWRA 4LB3A 2XZQL 3MLUL 4QXIA 1G0CA 3V52L 4O15A 2E3VA 3T0EC 3K2MC 1UROA 5FOOA 4C54A 1ASQA 1GIGL 4PB9H 3EGXA 3QP3A 2P4AB 5GZOC 5ID1A 2XTJE 1HK6A 1QAWA 3O6AA 2YD4A 1QBAA 4TTDC 1K7EA 1I9RH 4YS1A 3PWNB 1Q9OB 3R19A 4PTUB 1BQUA 4D0DB 3SQSA 5HQLA 4FFWC 3QORB 2ZCKL 2K1MA 5DEFA 4DT2A 5KEZA 4OD2A 4O1CA 3WD1A 4XMWA 3Q05A 2APFA 4ZTOH 1NCDH 4WI2A 4YPGB 3EADA 4G70B 2ZRWA 4XXCA 5JDSA 5KBKA 2E68A 2EPLX 4JLRB 4NZ5A 1W3LA 3T0VA 1K8YA 2DT2A 4L4LA 4X60A 2B59A 2BNRE 4UM9D 3S35L 1VYSX 4AYFB 2BG5A 1QNOA 4AD1A 4M4RB 2Q86B 2MKWA 3K6OA 3W88A 4W9LC 2HDJA 3EZ8A 2YAPA 1BBDH 4JNZA 4HPOH 2CMRH 4JYFA 5IV2B 4IRZH 3G6MA 2J88A 3S96B 4BZ2L 1A0QH 3PS7A 4O1AA 4PR5B 1F07A 4QG6A 4WQOA 4QY8B 2DZVA 1SLVA 4PRDA 2BODX 2W88A 5LHDA 2Q3RA 4X99B 1HP4A 4Q6JA 4Q8QA 4R0LB 3EEGA 1IIKA 1RUKH 1ZGLM 1FH9A 3MSGA 3NJXA 5MI0C 4DVBB 5K1NA 4GXVH 4H1LA 3U0PA 1HCFX 4N2YA 2DH3A 3HRZA 1SZFA 1DANU 4N5ED 2GUUA 5HINA 4FKHA 3O41A 2DSWA 2F54D 2WBXA 2XGZA 1B3YA 3LCLA 2B1AH 4X99A 1H51A 25C8L 1KB9K 1SXAA 5BV7L 2ALRA 3QG6A 2FZBA 2EH7L 1USZA 4DPCX 3F5KA 4GIEA 4YN5A 4APQB 3L3KA 5EULV 1G1KA 4A2FA 4EMZA 4MWAE 1PHWA 1RAMA 3OGCB 1E6NA 3ALGA 2HV5A 4U05A 4Y4KB 1HKJA 1FFQA 5I6OA 1H6TA 4XNQA 1RMFL 1J9SA 3CQIA 4Z95H 2LQRA 3TO4C 2JKEA 1XBVA 1U21A 3OR6A 2I7OA 3QUXC 3EFFB 1F58H 4O58L 4XMPL 3BQ6A 3CUHA 2IVFC 3MPCA 4JO5A 4P3CH 3ZMNA 1WVZA 5D4YA 2IQ9H 5JW3H 2RHGA 4A4AA 4EPKA 4RESB 4U0RC 4OIFA 2RGSA 1U8JB 2ZUXA 3UAJD 3D3VB 5EU6A 3AWEA 1UGKA 1I7TA 1RXLA 3EAKA 2DP3A 4ZQKA 1K7FA 5CKAA 5BRQA 3U0TB 5C6WH 2Q7YA 5IT2L 4JKPL 3VNLA 2A77L 4NFBA 3TEYA 5BU9A 4E2VA 1DVYA 2FLMA 1BM3L 5HMDA 2YDSA 4LSBA 1O7AA 1ZT4A 2YRZA 3CFIC 1AGEA 2OAAA 3G24A 4PUUA 3MOAH 3V5HB 5C9JB 3GG7A 3LMYA 3QQ4A 2YR3A 3QC3A 1EBPA 1MCFA 2YL9A 3VFPA 1L9WA 4TLUA 3C2EA 1JHKL 3N1QC 4NN6C 5AOJA 3LNGA 4OB5H 3A6BL 2QPEB 4BJLA 2R2BA 5KSAA 3BCFA 3CDZA 3WQ6A 1FG9C 4Y16C 2HLFC 4GSRA 5FC9A 2ADFL 5JHDD 2BIMA 3QG7H 4TQEL 2MIZA 3H6AA 3VIOA 4KKCC 5CJMA 2BRQA 1R3VA 1MELA 3TO4B 4L4VE 4X4MA 1A8JH 3AIQA 3IUDA 4LUSA 3EXRA 2EZ0C 1FZMB 1BAWA 1E1FA 2COVD 3ISRA 2VHLA 4Y9OA 3AIWA 2IPUG 2V3FA 1GHFL 3OB0K 3L0KA 3FHAA 2IPKB 3NPZB 4OFKA 1N7ML 5I1EH 1TPVA 3NA9L 3S5ZA 2YXOA 1X7TA 4GMSH 1DUYB 3GXUB 4AQLA 4A2EA 5D72L 1KZQA 3VXSB 5D37A 1Q7QA 1XV8A 4UTLA 3QGVA 3BOLA 3KM8A 1FFPB 1NBZA 4ZENA 1CU4L 3Q8FA 2ZOXA 2OMTA 5AVVB 5LGHL 4LT9A 1P1MA 1I8KB 3HBGA 5EGRA 3EYQC 3WKPA 4DVBA 4HPYL 1F2QA 2L0DA 3I50H 3T0EB 5IFJA 2JQXA 3MJ9A 1CGUA 5CLTA 1P1VA 1ZL1A 3IT8D 3A67H 4Y5VB 5G2NA 2PU1A 5DQ9B 3C2YA 1X4YA 4XN1A 3ZBMA 4UT9A 4LEOB 4R7NB 4IDJH 3B8SA 3QXBA 3RVTD 2C19A 4U1MB 3VGGA 3LQAL 4RIRB 1FC1A 5ACLA 4ZFOL 1NIDA 2E77A 1MJ7L 2ZYSA 5HYQA 4MAZA 5KITA 5XINA 3UPRB 3Q2CA 2PU0A 1MFEH 4YSOA 4TTGA 1F3EA 1DJGA 1WXZA 3WQ8A 1OP5K 1RLWA 4LGRB 2QSCL 1JNNL 3W1TA 2PR9A 4TVSa 5LGYA 1RZPA 2DKUA 4DP0X 3IXAA 3IDXH 3OTTA 1F4WH 3VD9A 4BS0A 4D9PA 4DTGH 1T6BX 4ZXBD 4N8VB 1GCYA 1L7TH 4Q6IA 5IHUH 4PUDA 3UF9A 4HK6A 1R3JB 5JHLA 2P42B 1X5ZA 5FAAA 1MCHA 4U31A 2X10A 1CPUA 4NOBA 3W39A 4K7PX 3UYRL 4CVZA 1OSZA 1AUSL 1D8CA 4X42A 2DDXA 3SY1A 1AQDB 4XTRC 2A4AA 3APYA 4I7WA 3WKNA 1AQFA 5E9NA 3ARGD 2P5ED 4TULH 3PHAA 3UZJA 4E38A 4MYPA 4DI8A 3R5EA 2BSCA 1U92B 2CDFB 2EKSB 5ETUA 2VL5B 5ICXA 1CBVH 1I2RA 2DB8A 1CTNA 3GSXB 4P5TB 3CDYA 5J5RA 1ZK5A 2V7HB 2IEPA 1QSEB 2CITA 3PPHA 2PCFA 3LH9A 3QPQC 4J4PC 4BUGA 3DXAA 4HK0A 4M7LH 1VZHA 4DJEA 3MX0B 2BSSA 5FF6A 1A3RH 4RSVA 4E9LA 1ZA6A 2VXQA 1NUNB 4X9YA 1MDAA 1UMYA 4IICA 5C07B 5DD0H 1S7RB 5L7XL 1TJHH 1IGIH 4HC1H 4JPVL 2DIKA 3EAUA 2QF7A 4YWGH 3L23A 5DLCA 1JMZA 1AO7D 4FXTA 4PGCB 3O9WD 3VAEA 1XIDA 1KR1A 4JJHA 4PCKA 2DQEL 4K94L 1D7CA 1R86A 4JG5A 1JF1B 1ZVHA 1F11B 4FFVC 4PS4L 4GISA 4EAYA 3L3OC 3L9BA 3QXDA 3VNYA 1O7VA 1CI3M 2A6IA 1ZBKA 5FAGA 3ZFHA 3SRFA 3M0ZA 4UT6H 2YD2A 2XWJA 3WMQA 5C8JA 5FLVA 3R8BB 1RZJL 4WU7B 3I2CH 4G7VL 3IBOA 1K2DB 3U2SB 2R9HD 4B15A 3RLVA 3WFZA 3TFBA 3UCCA 3G5ZA 1KCWA 3STGA 4W9KC 2P50A 3VFGH 1M42A 2P8MB 4XVJL 2WOBA 3F8UB 1JHLH 2W0FA 3RILA 5C0GA 5AFAA 4JQAA 1M01A 2R9RA 4ATTA 4HNOA 4MXQD 5CR8A 4N0YL 3PAYA 5AYUL 1QRQA 5BJTB 5CPQA 5G4HC 1U8OB 1OZUA 3E6HA 1I1YA 3VFUB 2CK0H 1JRHI 3OAZK 3C6LA 4JVPA 4YDJB 3M9YA 4QQUA 1CBGA 5A6KA 4WWOA 4OF6A 4WCYL 5DYFA 4A2GA 4EQ3A 3LENA 4NG3A 5LZLA 1OWWA 1FIGL 2AK1L 2P5WB 1I1RA 4Z7IA 2X4UB 4LRNL 1X39A 4ANUA 2BVDA 3LZ3A 4PCNA 1QFEA 1KC5H 2ZKWA 4E41E 2HJLA 2GGJA 5D1QE 2VISA 4L64A 1MRCL 2V6HA 1FWHC 3GKZA 3BIAX 2FZ3B 3IFNH 1E30A 4HEME 1GY2A 1AGBB 2WXOA 3N50A 1ZT1B 4Z7VE 2YBRA 2GSGA 3DKHA 3T3ME 5G2HA 2XGBA 3RLUA 4XRCB 1WISA 4IGBB 1GZJA 2GAZA 2QF8A 5I5MA 1C8YA 2DQEH 3EDEA 5EO9A 3KBFA 3HPAA 3BAXA 5DS8B 4L6DA 4U1HA 1LQAA 1UP2A 3VRJA 4MNLA 4XIMA 4P5KA 4JTKA 2XWTA 3W1QA 5HHNA 4L5ZA 5H4ZA 1KR0A 3TC3A 3UABA 3VGAC 1CDHA 3WBDA 4TPRH 3ZE2E 4B50A 3SHSA 4ZFGH 1KKRA 4QYOA 1I3UA 4PH6A 4ZA0A 2R1MA 4A2HA 1IC5L 2WMPB 2WCSA 5AW4B 1OP9A 2WQ8A 3EJZD 4KV5F 5K9OB 2HVJA 1T22A 4KDVA 1WTGT 3KCWA 1SDAB 2VERA 3HJEA 2XSXA 3ONBA 1EHNA 2XT1B 3BKJH 2BSRA 3OG6B 4H0IA 3O6KH 2NUPA 5TQ2L 3WJJA 5I1GH 4PMNA 2BNRD 4U3HA 4L1DA 1PZBA 2PYFB 3QUZB 4OKVA 2PXYC 4L4MA 3RUGF 4XNYL 2EABA 2VWSA 4KX9A 1HO1A 4FZ8H 2R8WA 3MKVA 1U5JA 3WLTA 3L4VA 1P7QB 4PJGE 3SYCA 5I16A 3FDWA 3H2FA 4N3TA 3H2MA 3MR9A 2B0SL 5ESVB 3GSQB 2WSPA 4FQ2H 4W9FC 3NAVA 1IKFL 4M24A 5EIVA 1NFKA 3DETD 3K1KC 4UZSA 2YPLB 2FATH 3P0VL 4YPJA 4KI5D 3CMFA 1G7MB 1DQDH 1OQXA 1BQGA 4KW2A 3FF7A 4CD5A 3B8UA 2H9GA 3FA5A 3GR7A 1FVDB 3GXNA 4NPYB 1Q6CA 5KSBB 1RQBA 3W22A 2J8HA 5I16B 5K9DA 1DR9A 4APQD 4MD0B 3VE0B 4Z7WE 5CCKH 3C12A 5IJDC 2V2DA 4HMEA 4M00A 5D1ZA 1YAIA 3VNZA 1GZHC 3QMTA 1S9YA 5L9DL 4QX4A 1NMAL 2CIIA 2I27N 4X4KA 1MLBB 2F58H 1T20B 3ELFA 2KZ1B 3PGDB 2HYMA 4I88A 4LLQB 1NL0L 3MRKA 1WEJH 5TAOA 3NJNA 2FJHB 4E5XA 4E4PA 4E8DA 3C86A 4POZC 3U8GA 5ANHA 5GS1B 1B30A 1ZY9A 3QDMA 1BVNP 2WOYA 4TVPD 3RA7H 3PL6A 4LARL 2ZF8A 4KI5F 2FGWL 3UBXG 1V6UA 2JVUA 4J9JA 3NQ6A 3PREA 5D1XE 1GGBH 1B4RA 1RCOB 5JH2A 1QNRA 4PW4A 1QXLA 1OTSD 3EJYC 3GMRA 1C5CH 2F68X 2YKLL 1X5JA 4I0PD 4YDMA 1V5JA 1B3ZA 1T8XA 4DP6X 3TA6A 5CSZB 2OP4H 2XIOA 2E46A 4PP1C 2BS8A 1OFEA 1S7XB 4GQPH 4Y7MA 1SO4A 3NQIA 4HZLA 3GRWH 4L4PA 1OSZB 2QPDB 1TG7A 3W02A 2DMHA 5ISZD 5LBGA 3TPKA 4ZD3H 1GW1A 5D4JA 2P88A 1PJWA 2VZUA 3MUIA 2V2CA 2AVFA 3WDRA 4NNAA 1KO0A 9PCYA 1X5HA 2GJJA 2C1OB 1KZYA 3C2AH 3GFUA 4K3DL 1YYAA 1U8PA 3PWPD 1C16A 2VDML 2ACQA 3QTPA 1XR8A 5TTRA 2EDKA 5ICYA 1WTLA 3NDYA 3PZTA 3BWAB 4IFKB 4XG1A 3MI2A 4FFZA 3GU1A 4DBSA 3NG5A 2PE4A 1VLIA 1FE8H 4ODTL 1YHPA 2X9XA 1IYXA 2X0WA 3PUGA 2PMQA 1JWUB 1MF2L 1SLUA 4Z0BL 2J7FA 3G1RA 5DR5L 5J13C 3AMDA 1OZMA 1QPKA 3C5SB 2RFXA 1G7QB 4MA1C 3T71A 5DJ8B 3LK6A 2J6WA 5FKAB 3BGMA 3NSDA 2DT1A 1DBKL 1PKQA 3V0GA 3T0DA 5I78A 5L6UA 5AHFA 3QQDA 5D7JC 2VR3A 3MJ8A 3VFWA 2X7LB 1ORQB 3FN0L 5DRNA 3BTNA 3CV7A 4BK9A 4HNTA 3NJJA 4UQ3B 1KXVC 2WBJB 4P3CL 5L2KB 3T42A 5IFPA 1OT2A 1S39A 1CZ1A 1MVFA 2VQTA 5C7XH 2EYTA 3WUFA 1SUXA 4YJ5A 3TCLB 3DX9B 5CAYB 3F5WB 1RZFH 5C0AD 1A4KB 1R34A 3QPXH 3V3WA 2IPGA 4S11A 1BWVA 1HW6A 1O75A 1KIQA 3NIGE 2PF0A 3LGDA 1LILA 2ORBH 3M6DA 4Y9EA 4HZ1A 4OCMC 3TQVA 2XWBB 3MLRH 3WH9A 4TQIA 2Y63A 4GYJA 2FWLB 2H3NA 2EDFA 1L5GA 2CK2A 2OSXA 3QEHA 5I1HL 2OG9A 4P7QA 1PWMA 2Y7NA 1QSFD 1HC1A 1KGUA 3HZVB 3SBRA 4XKYA 5AB1A 3VOJA 3CIQA 1OGTB 4HIIA 3IJIA 1A21A 1AKJB 1E8ZA 1NSNL 3NFPA 1U93B 3WEZA 3SJVD 4A2MA 1HQ4A 4JRXE 2YGVA 2IANE 4OM1H 3MFFA 5B3JF 5I1JH 5MEQA 2YYUA 4GVIA 1RIHH 2LTQB 2HCZX 2GGGA 3Q13A 5CBEA 3W85A 3SYOA 5I1LA 1GZQB 5F6IC 2EVIA 5ICXB 4LP5A 4XOBA 2VLJD 2Z4QA 4KZCA 1RK6A 3HIZA 3UJJH 3QNZA 4WI9A 1RBOB 2RDTA 3THQA 1OXYA 4PGZA 2GOKA 1T6WA 2CUIA 3DRTA 1CXIA 3Q2NA 4MQXC 5IFHH 4NWUH 2KS0A 3HUJF 4LSPH 2VVNA 3S35H 4CDHA 3CHEA 4XN4A 3ZE2F 3ZVHA 2VE6B 3FU7B 2V30A 4PTWA 2CYGA 3O4LE 4IKKA 4LQFL 1PCXA 1QSED 4MKMA 1DPMA 5GGSA 2XX1A 1QEXA 3SCWA 1ZZMA 5L8LB 1TMLA 2DQJL 2R9HC 2NW0A 3MC5A 1WDPA 2ESCA 2MCMA 4ECNA 1NAL1 2VLMD 1TE1A 2OSYA 3QK0A 1O6TA 1K9DA 4NQXB 4R7WA 1UJQA 2JK5B 5HYQB 4HXBH 4KUCD 3VD1A 3O2DH 1ZHBA 2Z7GA 3TT1L 2L5HA 3JYCA 4GA8A 5DT5A 3HE6B 4C6NA 5AAMC 4MTVA 4TQHA 1XGZA 3W5NA 1TPXB 2QKIB 3WJMB 3O81A 4LOUC 5IW1B 3QHNA 2ZUQB 1VYPX 4JGUA 1HUVA 5D6DA 3MV9B 5IIEB 1A25A 3NYZA 3AGWA 3CIWA 1KJVB 3T2PA 1P0DA 3MJYA 4F3FA 4JHOA 1HVXA 1WAEA 3ZL4H 4F8TA 4J35A 4R27A 3STCA 2L7UA 3MRFA 3NR0A 1BXUA 1GOKA 5KJRL 1INEH 4H9XA 1QBBA 1UVQB 4YTSA 5DK3A 3CX2A 3BE1H 4GSDL 3LY6A 3REQA 3S3GA 1XDTT 3RPIA 3VD3A 4AXWB 3N1MC 4BRVA 1VD6A 3LEPA 1KCUL 1PYWB 1BPLB 4JREC 4KUCF 4AE1A 5BW7A 1ZPTA 3T3PE 3VX1A 1EIXA 4Q7IA 1TVBB 2XY1A 4YFEA 1FYTA 3ZVVA 4GLEA 2F53B 2D03H 5C86A 3FA3A 4N28A 1KYDA 4Z1AA 1U9KA 2WHVA 1TSRA 5AWNL 2Y0FA 1R3HB 3FA4A 3TW7A 5AW2B 1VCBC 3QA3B 2GY5A 4MNHA 3DMMC 4OCYL 4UINH 1M65A 4H6RA 2H8PB 4EUPA 4W84A 1EO8L 4G43B 3MU3A 2ENYA 5HGHA 3BEWB 2Y7QB 2CNYA 5K59E 3WMLA 1N8ZB 4L9LA 1OVDA 3PL6B 4RKAA 3DX6B 4R2GD 3ZT5A 4E4UA 1E70M 1S1PA 2YLLA 4QNPF 4TF4A 5K9JH 3FQRB 3UJTH 5J56B 4PJ5E 5D2NA 5FGBA 4UTBA 5JUEH 2IF7A 1LDSA 3I9IA 1FSKB 1I1AD 4KVPA 3S3JA 2ZXEB 2HE5A 3TXAA 5C9KA 3FC8A 4JY5H 4DBWA 2XDFA 2XFXA 3Q9QA 5C0JB 1ZANL 1VZWA 1PVHA 3MVIA 4M19A 3HQPA 2P8MA 3K8LA 3VMNA 4PJ9D 3RZCD 2X0SA 4NO3B 2CLEA 3Q94A 1U8KB 4LCIL 2Y6ZA 5FWQA 2N1TE 2NCMA 3T1FB 3BP6A 4Q0XH 4GY7A 3L2NA 3SGKA 4Z7NE 3DGCR 5BV7B 3QIUB 3S2JA 3SSZA 2JCCE 2YEQA 4FTVE 4ZMXA 4PRPB 3H9SD 4MJ2A 3ZDXE 5CPLA 4ODVH 4B7IA 1KXVA 1Y1UA 4NKDB 4YX2H 1FLRL 1JZGA 1UKQA 2DJSA 3OKOA 1PS9A 3EB2A 3P4NB 5HMEA 3RITA 2WHLA 2FHBA 3BAJA 2JF1A 1XLMA 4DK3A 2AEQL 4WOZA 1KCUH 5F4SA 3SKJH 4FFVD 1KFKA 2UV3A 5AG8A 4DJFD 4JM2C 1DE4B 1SHXA 3OKMB 4PSPA 2UXFA 2WZ5A 5CN1A 1OBAA 5GS1A 4QQ3A 2VDKB 3DZ1A 4P3WA 2N56A 3VXUD 1U8NA 4A8IA 2F7IA 3ZL4L 1EYWA 1FAIL 3E6FB 1V3HA 3TTQA 3SGEI 5EMJA 4B97A 1E4IA 1ETB1 4CNIA 3BVNB 4LGPB 2V38A 5C09B 4JQIA 3EBVA 1ITBB 4KU1A 5HHNB 1XZ0A 3VE9A 4P23B 4WHBA 5K39A 3VQMA 4AGNA 5E8DH 4ZYKB 2J6VA 1MEHA 4QHKI 1JPFB 3EYFB 2NXYB 1HXKA 2DQMA 4DSYA 1OG6A 4JAWA 3PXHA 5F0PB 1K8DA 3WJZA 1QLEB 4IIBA 4GRMB 3FRUA 3P6LA 3V2AR 4GBXC 4WHYG 3B3IB 5IEKB 3TZVD 5SWUA 4G71B 4U3XA 5E0QA 5F9JB 4NSKA 2ZONA 2ENQA 1TZGL 4V33A 5CIPB 5C8JB 4QTGA 2ZCHH 5FW7A 2NY2B 4OT1H 1F3DJ 5D1XB 1ZCRA 4PV9A 4L9LC 4MXWL 3C8FA 5HJ3A 3L0GA 2BJMH 2Y6SC 5D4HA 3QYNA 4HJJH 3KPTA 5C0BD 2F0CA 2D73A 3MZTA 3DVNB 3QORC 4J3OF 2VDPB 3IN0A 3QXTA 4J3BA 5EZLA 5IG7B 4F24A 1AG6A 3KDMA 3VG0L 1AXTL 4XNXL 1EFXB 1RFDL 1WH0A 3QIBB 2P5WA 3WEOA 4U5KA 1LK3L 5IFAL 3TTEA 2HSAA 4P5RA 2VLKA 4RE3A 1E4XH 2AJZB 5EZPA 4DF2A 4BFGA 2Y07H 4LVOC 4XP9H 1BRLA 5DCBA 3QO0A 4JFPA 2NLJB 1FH5H 2C71A 1OAUH 3KZ8A 4KF1A 15C8H 4PJHB 3POHA 4G7EA 5A8PA 3BCDA 3KX6A 4P7OA 2EO7A 1RVGA 4PS3A 3BH9B 2TPSA 4LYPA 4BFKA 1XX1A 1D7DA 2F5BL 3KHQA 3GUGA 3OLIA 4DVRL 3S5OA 2FHFA 4OLYL 1MPAH 2J6EL 5I6KA 4W86A 2V5CA 1BQSA 1FCQA 1BQRA 5L88H 1IT7A 2IPTL 1SJDA 1HXJA 3QEHB 3VGBA 4WFGD 3BUVA 1MQRA 1A9BB 5IUCA 5KVDH 3THML 5GVJA 4UFHA 5LQBH 2X3CA 3F1QA 4OCWH 3SADA 3GBDA 2WLNA 2HG5A 1QFPA 2R8SL 2E67A 4FP8L 2XWCA 1IJ9A 4UIKL 5HWNA 1UKSA 1QD0A 3OF6A 3JWDL 1H8NA 1WUFA 4ZFFB 9RUBA