4PCTA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-L-fucosidase
publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 161
structure length 438
sequence length 438
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4pctA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pctA01
3VNYA 1US3A 4D71A 3CUJA 2WZIA 3LX9A 1PJ9A 4HP5A 4W93A 3WF0A 4UFMA 1H0GA 1LJYA 3RJXA 1XSJA 1HWWA 2ZWYA 4NXKA 1OWQA 4PUDA 1CLXA 3JUGA 1E73M 3NCOA 3RM4A 5IHSA 1K6AA 5LA2A 1UWTA 2XVPA 3OG2A 4LXFA 1JXKA 2VRKA 3PZMA 3ARYA 3D51A 4D6DA 4RE3A 5A2BA 4K68A 1R8LA 1RD6A 3L4YA 1FH7A 2BFGA 4HA3A 4AZ7A 1XH0A 2XM2A 1G5AA 4XUYA 3WD0A 3WUGA 3SUVA 3QHOA 2EPMX 1PS3A 4JIEA 1KXHA 2YL5A 1W9BM 1V6VA 3WQVA 4OBSA 3IJ9A 1UWQA 3PZGA 3T2PA 3AHVA 4W89A 1JZ6A 2BS9A 3ZT7A 3W26A 2G3NA 1XH2A 1JGIA 4TOQA 5A6MA 1CXIA 1HN1A 2WVVB 9CGTA 2GSJA 3WY1A 1TG7A 3WMSA 4KRTA 1XYFA 3ZR5A 4UFHA 3CTTA 4TUFA 4OKDA 2XN2A 4Z2IA 2D0HA 4PCSA 1IZKA 3ZOAA 2RGLA 5E1QA 1WDPA 2XVNA 1A3HA 4H8UA 2QV4A 3NIYA 3W53A 1XC6A 3RMEA 2GK1A 2FYVA 4QCEA 2WC7A 1SYTA 1OSEA 5CXPA 4C7DA 4WLCA 1JZ5A 3VIJA 1T0OA 3UG5A 2YDSA 5IHRA 3O9NA 4PN2A 6CGTA 2J75A 2XTKA 1HXJA 3ZJ7A 1WDSA 1ODUA 1Z32X 2E40A 3BVUA 3WL1A 3DC0A 1BSIA 4W85A 2YIHA 3GH7A 4DUXA 1WO2A 2Y5EA 3U7BA 3L4WA 3OB8A 1C8XA 4UFLA 4JL2A 1PPIA 3BC9A 4FNTA 3HG4A 3PTMA 5CPQA 3A3HA 1W9PA 3VSUA 1EXPA 5E09A 3WD2A 3WIJA 3AIWA 4F9JA 1YQ2A 1OD0A 1MQQA 5CLTA 1Q6DA 3WKZA 4WIWA 1JZ3A 1R7AA 3LMYA 5F7UA 3THCA 4Y7EA 3PZNA 2J78A 1FP8A 4MJ4A 4GQQA 2GVYA 1E1EA 1SMAA 3SUUA 1FHLA 4PRWA 1TUXA 2D23A 4GI9A 2ZX9A 1G0CA 4H8VA 4X0NA 1W2VA 4EAMA 1ZJAA 3WDPP 5I6SA 4AY1A 2WC3A 1WKYA 2V5DA 4BQ5A 3SCNA 2WVVA 2WLZA 4EK7A 3PN8A 5A6LA 2WAGA 4AZ6A 4FLSA 2CCRA 3J7HA 4B16A 4GKLA 2ZUTA 4GXPA 3A4AA 1F4AA 3PZTA 5LA0A 1VEPA 4ZXLA 1E4NA 4EANA 4M56A 3O2LA 1DWGM 1LL4A 3AXXA 3W4RA 1TQTA 1NP0A 3B9EA 3N18A 4U3CA 4X0VA 2PF0A 3DECA 1H11A 3VPLA 4J3TA 3F5JA 3SCWA 3N1AA 5GQBA 4UZUA 1B3WA 1EDGA 2F7RA 3ARQA 4PMVA 1KGXA 4NZFA 2A3EA 1UD3A 1UYQA 5BXTA 2WMJA 4AD0A 3W6MA 1BQCA 4PMNA 1IT0A 1MFUA 4ATDA 2PWEA 4GZJA 4AIUA 2FGZA 1QPKA 3EDJA 3WNKA 1GORA 1W9XA 4AIEA 5DFAA 3WH7A 2QLYA 3M6DA 4MDPA 3NSMA 4TTGA 4AC1X 3WELA 2VURA 1W1VA 4D6CA 4W5UA 3BCDA 1JD9A 1UR9A 2J7EA 3K4DA 4EKJA 1B1YA 3PZVA 1LLOA 5D9PA 2E3ZA 2ZE0A 4QLKA 4MNLA 5I77A 3K8LA 3ARTA 3L2MA 2D24A 3QR3A 3AZSA 4F66A 2JF6A 2EQDA 3VIGA 4GZIA 3VU2A 1J12A 3TTYA 5HBFA 2VO5A 4J3UA 3CHEA 4D6JA 2WMGA 4QP0A 1EOMA 4HMDA 8CGTA 1Q6FA 1ZJBA 2FH8A 3AQUA 2E4TA 2DGAA 1BHGA 4JKLA 3N9KA 4N0RA 2G4FA 5EBAA 3A22A 4JFSA 4FLOA 4DM1A 1BLIA 3UESA 2ZXDA 4UFJA 4GIAA 4CU6A 4U31A 4Z2JA 2XFRA 2YDRA 1CEOA 1VJSA 2NW0A 2NSXA 4C7FA 3O6AA 4D1JA 1E6PA 2CETA 1FA2A 3EJUA 1DWFM 4JKKA 1TZ7A 1H49A 5EMYA 2D20A 5D4YA 4FK9A 3BUDA 2J25A 3WY2A 2D1ZA 1C7SA 1J0JA 1GUVA 1BTCA 4P8WA 3VIHA 1R34A 1MVYA 4ACZB 1QI2A 4HOXA 2Y2WA 2ZX6A 3GXMA 2VMFA 2J77A 4JFTA 4H8HA 3EDDA 3W38A 4MB1A 1DWIM 3PTQA 3VKKA 2B31A 4Q22A 3AHZA 4IPLA 3EBVA 1HKIA 2JIEA 4MAVA 3A6OA 4CVWA 5CG0A 3VD9A 5A6BD 3L4XA 3H55A 2BHUA 1VRXA 3FY1A 1QX1A 2WCGA 2VCAA 2WMIB 4XB3A 3WMBA 3WF3A 1CZ1A 5LYRA 1OT2A 1I1XA 1CNVA 2WC4A 1V03A 1GNXA 5D8WA 3GXPA 3WH8A 4ZE4A 2CPUA 1E1FA 4CN6A 2X0YA 5E0FA 2V3FA 4CVUA 3FHAA 2ZXBA 2ZWZA 5AC5A 2XSBA 1QOXA 2WHMA 1E5NA 3AS3A 1PX4A 1GJUA 1DWAM 1UD6A 3FW6A 1BGGA 2G3IA 5IFPA 1KCKA 4NRRA 3WUBA 3BAIA 1FFRA 1WAWA 3WNLA 1CGXA 4MNKA 1JZ2A 1YHTA 1XSKA 7TAAA 3OLDA 5A2AA 5C71A 3DYMA 3D50A 3MS8A 3L4UA 4MB5A 1DTUA 1WZAA 5A8QA 5BXSA 1E3ZA 1B90A 1FOBA 3CHDA 3K8MA 5A6BA 1MQPA 1CXEA 2E8YA 3WDRA 4W8LA 4A3YA 1TE1A 1GZJA 4U5IA 5A6AA 3LRKA 3T0DA 2XWEA 2WKGA 3F4VA 4ACZA 4YPJA 5I5RA 1JDDA 5AY7A 4PMRA 5BCAA 1F4HA 4QLJA 1VB9A 3K4AA 1QHOA 4OGZA 4AYSA 3LPFA 5HPOA 3NUKA 2OLHA 2WBKA 4JAWA 4P8UA 1W9DM 3EJQA 1C7TA 4WSKA 1HKKA 2WKLA 1HL9A 1VBRA 4UQ9A 1ISZA 3QOMA 1GOIA 2VC9A 3VIMA 2WMIA 3RIKA 3FAWA 3HG2A 2OSWA 2UY4A 1EDTA 1E72M 3CZGA 3DX2A 4F9DA 2CNCA 1U2YA 4UQEA 4PMQA 2GFTA 4XV0A 2F7QA 5BRQA 7A3HA 3SCUA 3AHXA 4RE4A 1E6RA 3TTOA 4D6GA 1CXFA 1W2PA 3KLKA 3K46A 1C93A 3ZJ8A 2G3JA 1VEOA 1SZNA 2J7HA 2YLLA 4UR9A 3F5LA 3WH6A 3CZ8A 4CGTA 3QGVA 4AIOA 1UWUA 2YFOA 4CD6A 2DSWA 2WZHA 2F18A 2DIJA 3II1A 1HXKA 1C8QA 1EH9A 1E6NA 3B8SA 4A3HA 1JI2A 1R86A 4FNRA 2J4GA 2X8RA 1E6XM 3MANA 1QNOA 1AMYA 2YKKA 4MJ2A 4FNPA 5BXPA 3AIEA 2ZX7A 3DDGA 3L4TA 2C8NA 1XD1A 1CLVA 1V6XA 4XZBA 3GBEA 4P7RA 3WDJA 2CERA 2DQXA 3WQ8A 2AAAA 3ARVA 2WW5A 3BLBA 2W4XA 5I2UA 1AQHA 3EMZA 4CD5A 3G6LA 4WF7A 2OYMA 4X9YA 2XGBA 4HU0A 1LL6A 2JIWA 1GOWA 2WWDA 3HG5A 3U5YA 1FHDA 6TAAA 2IGTA 2BV9A 3HU7A 3RM8A 4L4PA 4AD5A 1EHNA 2D22A 3TV8A 1WE5A 3GNPA 4UTFA 1V02E 3GXFA 2V5CA 2YOCA 2VX6A 2XVKA 3DYPA 3LRMA 4V28A 2GDVA 4D6HA 1WP6A 1XGZA 3UR7A 4JFUA 1DEDA 1R87A 2FHFA 4NX0A 3DHPA 1LQ0A 3EDEA 4LGXA 1SFSA 2X05A 1Q6CA 5HNNA 4Z2HA 1E5JA 1JYWA 3TONA 5CPSA 2Y8VA 1MW3A 1HIZA 3SCTA 2WCAA 2XGIA 3T0AA 3MUIA 1WZLA 1V3IA 1JYNA 1QI0A 3VX1A 2FHBA 3VIPA 3GTNA 5GNZA 3T0BA 1OD8A 3GNRA 2WVTA 2ZUSA 4GZEA 3W24A 4TXEA 3OGSA 1VFFA 5I79A 1OT1A 1LL7A 5A8NA 4W8AA 1KQZA 1UHVA 4MB3A 1KTCA 1V0MA 5A8MA 1UA3A 3N11A 2DH3A 1ZBWA 3A47A 4J3VA 1J0KA 4ATLA 3EJPA 4CKQA 3BVTA 3QHNA 1QHPA 5M5DA 2DSUA 4W7VA 1N82A 4B15A 1VEMA 3W27A 1GHRA 3VD7A 3AIUA 1PEZA 1GOKA 4M80A 4GI8A 2JALA 1CGYA 4S3KA 2OSXA 4HPHA 1H1NA 3RCNA 3QHMA 5DEZA 3CH9A 1UD8A 1TQUA 1QNRA 4BQ4A 3AI0A 3HG3A 3W28A 3BUPA 1ISXA 1M04A 3GNOA 1KFWA 3AMCA 1P6WA 1ISWA 4PMDA 1EO7A 2CHNA 4IUGA 5DT7A 2VJXA 2OYLA 4GPNA 3CLWA 1QNQA 2XVLA 1DHKA 1XCWA 5CGTA 3W25A 4CU7A 2ESCA 1CXHA 3PZOA 1W9UA 5GPRA 4OZOA 3IAQA 4D72A 3SEPA 1KBBA 2AOSA 1HKJA 1ITXA 5I78A 4J3SA 2PBOA 4TTUA 2C7FA 1BYBA 1JNEA 4RL3A 2YJQA 1AQMA 4U2YA 3SCOA 1BYDA 4UQDA 1E43A 2YA1A 1JL8A 1J0HA 1C3FA 2D0GA 2YDQA 3VGGA 4BCEA 1S46A 1W3LA 4KWUA 5CGMA 4PMZA 3S5YA 1EQCA 3KEHA 1VENA 3WF2A 4L4OA 1JFHA 3AYSA 1KGWA 2W61A 3VGEA 4D6IA 1CXLA 2WM0A 4ZENA 3CHCA 1UH2A 1PX8A 1LF1A 3IJ8A 1OIFA 2OYKA 4J28A 2C0HA 1K9EA 4JHZA 3A4XA 2CBUA 1C90A 2VR5A 1VJZA 3MUY1 1D2KA 3OIHA 5CPTA 3WNMA 1SR0A 1Q4NX 1B0IA 2ZICA 3WF4A 1GONA 1WNOA 1RH9A 3CUIA 2ZOXA 5CSUA 1W3JA 2ZUNA 1NOFA 5JBDA 1BVNP 3BSGA 3VGDA 1QW9A 1TQWA 2RGMA 1HF6A 3BAYA 1LG1A 2O9OA 3VVGA 2WMKA 1W9VA 2QPSA 4E2OA 5HOSA 2QF8A 1X1NA 4GI6A 5FKYA 1PX3A 1UR4A 3FN9A 1HVXA 1FP9A 1CXKA 1E9LA 4V27A 2Y24A 1J0ZA 2DIEA 4TVUA 3WY4A 5EFFA 2G41A 1V08A 1KWGA 1V6YA 1J10A 2J7BA 3W37A 3GBDA 2BHYA 3LPOA 3UR8A 3D4ZA 2AMGA 2O9TA 2W66A 4P7NA 1QHZA 4J7RA 3MKKA 2WLYA 1EGZA 2WHKA 2JF7A 1EHAA 2OSYA 3WEOA 2D0FA 2XPKA 3UEQA 3TA9A 3VM5A 1NH6A 3LXBA 2QPUA 4OBRA 5BWFA 2PC8A 3KWXA 2BY3A 5TD4A 3SCVA 3OLEA 4UQBA 5HDRA 3S6TA 1QNSA 1UUQA 4CCDA 3VIIA 1NWSA 4WKAA 2VVSA 1B2YA 3WD3A 1MWOA 1JDCA 3K1DA 3BLKA 4NI3A 4B3KA 3A23A 2NT1A 3HJEA 3T2OA 3WDQA 1E15A 1UWIA 2MANA 1B3YA 3EDFA 3VINA 1HX0A 4KGJA 1HJXA 2DT3A 3WH5A 1VAHA 2ZUUA 3VD5A 4CD8A 1B31A 3VUPA 2QMKA 1LWJA 3L2LA 4H04A 4D1IA 4M29A 1H3GA 2XG9A 3ARPA 4FLQA 4R27A 2YBUA 1V3KA 3VDAA 2XVGA 3GXDA 4PTXA 3N04A 4NZCA 2EBNA 3MV01 1WDQA 3LRLA 1HJWA 2WSPA 1E71M 3KL0A 4IM4A 2X2IA 4KRUA 4CUCA 3SURA 4JFVA 2J74A 2VQUA 2PWHA 4E8DA 3UCQA 1H41A 1IZJA 3S2CA 1DWJM 4HMCA 1DP0A 1K9TA 1UASA 1VF8A 3BAKA 3AYRA 3ZSSA 1B3XA 3HZ3A 3CZJA 4QAWA 5AYIA 2DSKA 4AEEA 1OBAA 3MMDA 2ZX5A 3RJYA 3ZT5A 4A4AA 1ZS2A 4UZSA 4TX6A 2V3GA 2VI0A 4ZEPA 1GQIA 4F8XA 3IK2A 3VMNA 4E8CA 1OM0A 5BYWA 1JAEA 1CGWA 2CKRA 2TAAA 2YLAA 3A4WA 3PZUA 5DMYA 1HKMA 3FXYA 5C8BB 1EO5A 4M82A 2DH2A 3AMLA 4MPKA 3VO0A 2J8GA 5A6SA 3ZT6A 3I3DA 4H2CA 4AYGA 4PBGA 2J7GA 1Y7VA 1PZ3A 4NSBA 4W86A 2XHYA 3POHA 6A3HA 1QNPA 1NWTA 3FAXA 1XV8A 5D9MA 3POCA 4S3JA 3CZLA 2W91A 4M8UA 3MUZ1 3L4VA 3UETA 3AFBA 2XJ7A 2PB1A 3CZKA 3MO4A 3CO4A 5DF0A 1E70M 4HU8A 3AIQA 3E1F1 2D2OA 2EPOA 3OA5A 1NWRA 1E0XA 1B9ZA 3WD4A 3M07A 1LG2A 1UKPA 2CBJA 4BS0A 3UERA 4ATWA 4HZ7A 2VNCA 2W67A 2YL8A 3GM8A 2WSKA 1I75A 3ARRA 2EADA 1UQZA 5BROA 1UKQA 3ARSA 3GDBA 1GOOA 3BSHA 4WSJA 2VOTA 3WDIA 2GUYA 1E6QM 3KL3A 2IXVA 3WL0A 1ESWA 4H7VA 2VRJA 1JNDA 3OGRA 1UH4A 2VZVA 3OLGA 1W91A 4AMWA 3RM9A 1UD4A 1RP9A 3PZQA 3BUQA 4P7OA 3VNZA 3WNOA 3AJ7A 2YL9A 1DWHM 3PZIA 3VM7A 1GQKA 1ZBVA 1CBGA 3VSTA 3WD1A 3WQ6A 3WENA 3DDFA 3ZIZA 1H09A 4PYSA 3ZMRA 3OBAA 3CUGA 1R7OA 3EMCA 4TVDA 4WJXA 5M17A 3VDHA 1V02A 1MXGA 2OW7A 4Q7NA 4OOUA 1D7FA 4PMOA 2XFFA 2Y8KA 3I3EA 5HXMA 1B30A 4AZGA 3AIRA 3VD4A 1CGTA 4HZ8A 3IAPA 4W84A 2E9BA 1EQPA 1WCGA 1UKTA 3TTSA 3WDHA 1XYZA 4U33A 1FH8A 3DX3A 3BAJA 3M46A 3BLPX 2CITA 3QOKA 4JL1A 4AD2A 1W1TA 1JF6A 4D6FA 3WUEA 2BY0A 5A69A 3KE0A 1ODZA 3WQ4A 4CU8A 4AMCA 2F1AA 1UR1A 4P7QA 5JUVA 3ZSTA 3AS0A 1R47A 2WVSA 3WQ5A 1KCLA 5ABFB 1VFUA 1QBAA 3ZJ6A 4FLRA 5KEZA 1OGBA 3AZRA 1L0PA 5LA1A 1G94A 1M7XA 1BGAA 4P7LA 1M03A 1V6WA 3NDYA 3CPUA 1VFMA 4AD1A 1GHSA 1IV8A 4GO9A 3AIBA 7CGTA 3THDA 5M03A 1ISYA 1U30A 1E4LA 1V0NA 2OW6A 2QMJA 1W1PA 2XM1A 3RDKA 1NP2A 1TFVA 4DO4A 4W7UA 3T09A 1TCMA 3W29A 3PTKA 2G8ZA 4W5ZA 3SIMA 5HPCA 2W63A 3VILA 5FL1A 1VFOA 4KH2A 3WEZA 4LQ1A 4PTWA 1O6IA 4W7WA 2Z1SA 2Y4SA 5JBEA 4DO5A 1G9HA 3LXCA 3BAXA 2PWGA 3KL5A 1HP5A 2XSAA 4DM2A 1ECEA 1R33A 2JE8A 2BVDA 4LX4A 2UWFA 5A2CA 4BF7A 2GJXB 4ZXOA 2BY1A 3KLLA 3EDKA 3AS2A 2PBGA 3LXAA 2VX5A 1EIBA 1MQRA 1UG6A 2A3BA 4MNJA 5DT5A 1KXQA 2EPNA 1AVAA 2ZUVA 2X2JA 3GZAA 2XIIA 1B3ZA 1CIUA 2J7DA 1KGUA 4HOWA 2VCBA 3WBAA 1UD5A 1NWUA 1E40A 4PTMA 3AICA 3PBGA 4YHEA 3CV5A 2XIBA 2O9RA 3ALGA 4AZIA 2W5FA 4J3XA 3RO8A 3WMCA 5KZ6A 2YBTA 4AWEA 3MSDA 1A47A 2WBGA 3PHAA 1VBUA 4MNMA 4P8VA 4OOZA 2G3MA 4RE2A 4AD3A 2VZSA 5C70A 1CTNA 4IPNB 4FNSA 1UKSA 5ABFA 1JIBA 1GVIA 2ZIDA 4W87A 2CHOA 3RILA 2EJ1A 4HA4A 4FMVA 1H2JA 1V3MA 2PI6A 2EAEA 3DX4A 4WKFA 4XX6A 2OWXA 1JDAA 1KR0A 1E0WA 1GW1A 1OGSA 3F5KA 3S5ZA 4J27A 3CBWA 1UR0A 2DSZA 2OWCA 1JI1A 3H54A 3SUSA 2A3CA 1JD7A 1QW8A 5FL0A 3UG4A 3T08A 1BPLB 2VVNA 3GH5A 2FDMA 2WXDM 1QI3A 2Z1KA 2BXYA 4W8BA 2VUYA 4HZ6A 3VMOA 4BQ3A 2WZEA 1HJVA 4J3WA 1TQSA 2O92A 2F2HA 3CZSA 5IXEA 1UWRA 2GJXA 1UR2A 1XRVA 4TX8A 3CMGA 4GO8A 4ML4A 1UKOA 1V0KA 2BXZA 2VZTA 5I23A 1J9YA 2WMHA 3CIVA 3CUFA 2ZXQA 1NOUA 1BAGA 3IGUA 2VCCA 2PWDA 5CJ5A 1V3LA 1VIWA 1QVBA 1NQ6A 2WWCA 4PMUA 2VX4A 2WMFA 3APGA 2WB5A 4UFIA 5A95A 3SCQA 3VX0A 5CSYA 2WPGA 5A6JA 2XN1A 4AZCB 1HJQA 2GJPA 1NARA 1O7AA 4R5EA 2DDXA 3MUAA 1RPKA 2F7PA 4BA0A 5BXRA 1BG4A 5D9OA 4MTVA 3CMJA 4UOZA 3ZO9A 4QDMA 3SCRA 2WYSA 4Z2KA 3WQWA 4NXSA 3AROA 4DO6A 3D4YA 3AZTA 1E6ZA 1BYCA 3D3AA 1FFQA 2Q8XA 3VGFA 4FNUA 3MSGA 5A6KA 4JFWA 4KGLA 3GXNA 3ZQ9A 1WZMA 1KXVA 1UWSA 1PZ2A 4LPCA 1J01A 1ZU8A 3AS1A 4AMXA 4DWSC 3CGTA 1UR8A 1MFVA 2VR4A 4CD4A 3W81A 1GVYA 2WVUA 4UOJA 5GNYA 2JFEX 1JZ7A 5FCZA 2UY3A 2ZUMA 1ZB5A 3U7VA 1BVZA 2DT1A 1I1WA 2CYGA 3GH4A 3AMKA 2W92A 4OJYA 4UCFA 1AQ0A 1V0LA 5FD0A 1ITCA 2EEXA 3L4ZA 3DHUA 1ZBCA 3WBEA 5ECUA 4FF5A 2X0HA 5E9AA 2VQTA 1BG9A 4LYPA 3WUFA 1OIMA 1E55A 1US2A 2PWFA 2EACA 1E4IA 2GDUA 2ZX8A 4NRSA 2VZOA 1KQYA 2QHAA 4JKMA 3WFZA 1ZL1A 3WFLA 1WDRA 3EJRA 5A8PA 2W62A 3BCFA 1EOKA 2CIPA 3ARWA 1Q6EA 3AMDA 1D3CA 3ZJKA 1C8YA 2DT2A 4PSRA 3WEMA 1KTBA 1J11A 2JEPA 2CXGA 3DYOA 2GJRA 4DWSB 4F79A 4Z2GA 4GINA 4AZCA 1CENA 1V3JA 5FIPA 4UNIA 5CQ1A 5M3WA 4XZWA 2J7FA 3AMGA 4LYRA 1UD2A 2WK2A 4PMYA 3FNDA 2YA2A 5I3DA 1HTYA 1Q6GA 1HP4A 1W32A 1QWUA 4AD4A 4JZ5A 2XUCA 1H5VA 1JZ8A 4M1RA 1C92A 4ZE5A 5EFDA 5I24A 3D5HA 4Z2LA 3VGBA 1E4MM 1K9FA 2J47A 2UY5A 3B9AA 4DWSD 3AIVA 1W1YA 4N42A 1H4PA 3EJSA 1X6LA 3HN3A 1EA9C 2CESA 2IUZA 3N17A 4JCMA 2FHCA 2VT0A 3M7SA 2IXUA 4UFKA 2OWWA 1EDQA 3W82A 4UQAA 2CBIA 2VL4A 3BMVA 3BMWA 2DSVA 3GYCA 3TTQA 2A3AA 1HJUA 2EPLX 2V3DA 3BAWA 5A1AA 1UA7A 5I0DA 2DT0A 1QI5A 5IFTA 3BVVA 3WY3A 2A3HA 4AISA 4W88A 4HOZA 1XCXA 5AC4A 2V3EA 1V6UA 2FH6A 1ZBKA 4PUEA 2BY2A 1KXTA 3LPGA 1G1YA 1PIGA 3AOFA 1CGVA 3CZEA 2D73A 1OCQA 2CBVA 4ZFMA 2WCSA 2F8QA 4B3LA 2ZUWA 4YN5A 2NT0A 3NYDA 2V38A 4DWSA 2EABA 1HT6A 3DX0A 2WANA 2X1IA 2D3NA 4U5KA 4URIA 3SCSA 4C7GA 4YHGA 4D6EA 3BVWA 3IJ7A 3A24A 2WHLA 3G6MA 2F1BA 1K9DA 3OZOA 3BUIA 3ZM8A 4HMEA 3VMPA 1BFNA 4PMXA 2BHZA 1JAKA 3VSVA 2XYLA 3EMQA 3LPPA 1O7DC 4UOQA 1X6NA 2EXOA 4IISA 1KR1A 4P8XA 5JIWA 3CZNA 3KZSA 3T2QA 1QWNA 3AXHA 1L8NA 3VIFA 5GNXA 1TA3B 3EYPA 3NJ3A 4QCFA 3ARZA 3TP4A 1GPFA 1UZ1A 3NSXA 1FH9A 3VTRA 4CN4A 2J8FA 2ALWA 3OZPA 1CDGA 1TVNA 4DUWA 2EO7A 4MADA 4CD7A 3BGAA 1BYAA 1XSIA 2F7OA 3TOPA 2J62A 3SUTA 3VDCA 5E6YA 1WB0A 5JBFA 1GJWA 4FNQA 2J79A 3SCPA 3U57A 4AZHA 4B9YA 1U33A 1RP8A 5A94A 1W3KA 1GQJA 4EE9A 1CWYA 3H53A 3VD3A 2YA0A 4ACYA 5AYBA 5A8OA 3CHFA 4WK9A 2JEQA 1ISVA 3AHTA 4NZJA 1QI4A 1JXJA 1MYRA 1TQVA 1W3HA 3ALFA 5D9NA 5E70A 3SUWA 2J7CA 3BUBA 1PIFA 3WN6A 4AZ5A 3HMCA 1E56A 2YL6A 3K8KA 1WPCA 4BQ2A 1GCYA 1MW2A 4PCTA 5CZKA 2VZUA 3MV11 5BRPA 3WNNA 1JG9A 3ARUA 3I3BA 2CKSA 1HJSA 3A21A 5A3HA 2EPKX 1QBBA 3AHYA 4H41A 3VIKA 5DO8A 1LWHA 3VIOA 1JYVA 5FOOA 3CC1A 1GQLA 1M01A 2BVTA 2E9MA 1R85A 1OGGA 1HVQA 3D52A 1NM9A 3MI6A 2XWDA 5D8ZA 5ABHA 1B3VA 1UQYA 2X2HA 3OLIA 4CCCA 2XN0A 4AXNA 1JF5A 2ZXAA 3VDBA 1TR1A 1J0YA 3WSUA 4AZBA 4PSPA 3VOCA 4CN1A 4GQRA 1GOMA 1TA3A 4QFUA 1BF2A 2D3LA 1TVPA 4BZYA 1JFXA 1UOKA 2WNWA 4JCLA 1GOQA 4AW7A 2X09A 4AEFA 3EJTA 3DX1A 2HVMA 1OB0A 1XD0A 3B9DA 1XH1A 5E0CA 1NOWA 4MAZA 4U2ZA 1OINA 1V3HA 2CEQA 5ABGA 1R46A 2DPEA 4MB4A 4E4PA 4NF7A 1KWKA 1R75A 2YFNA 8A3HA 1CGUA 1CPUA 2DEPA 3MMWA 2BVYA 2VX7A 1MW1A 4U3AA 3BH4A 3BVXA 4HPGA 1MXDA 3PZ9A 3A5VA 3MMUA 3IANA 1KB3A 4MDOA 3VGHA 3AXIA 4JHOA 4B9ZA 4OIFA 3AISA 1H0IA 1WZKA 1JZ4A 4HA1A 4CCEA 2E8ZA 4DUVA 5EB8A 2XFYA 5IDIA 2BNJA 4M24A 1HNYA 1C91A 4OUEA 3N13A 3CUHA 1SMDA 4WKHA 4UQCA 3RPMA 3N12A 1G01A 4KMQA 3ARXA 1E0VA 4PEEA 4M81A 4V2XA 1E3XA 2X2YA 2O9PA 3BXWA 4QLLA 3MU7A 1UH3A 1UZ4A 4HTYA 3OGVA 1PAMA 2WHJA 1J18A 3N15A 3WNPA 2FE0A 1KBKA 2VTFA 3FHQA 5E6ZA 1E6SM 3NDZA 5CLWA 2VRQA 1JYXA 3NSNA 1HL8A 5JIPA 4TVCA 2HISA 3ZR6A 3UG3A 2GK1B 5ABEA 3GXTA 2F61A 3U5UA 4PTVA 4LYQA 2E0PA 3ECQA 1CYGA 1TMQA 2FGLA 1J0IA 1PBGA 1XHGA 3GXIA 3WF1A 1MW0A 1M53A 2E9LA 2UY2A 1CECA 3W0KA 3W6LA 3WH9A
chains in the Genus database with same CATH superfamily
3WQOA 3TW7A 2BZDA 2FVKA 1BMZA 3BW9B 1ET5A 1XHHA 2ZWYA 3B03A 1OFDA 1NEYA 4A66A 1KBIA 5EMJA 5HR7A 1Q9LA 5AVUB 1GZQA 5EEXA 1Y65A 1D5MB 1M1SA 1MNZA 3OVRA 5T1LB 1HAWA 3K0YA 2BNQD 4MDJA 2C3ZA 4LPTA 5C3TA 1NKOA 1KXHA 1W9BM 4PB0H 3F05A 2IPTL 3APYA 1WT5A 3IU3B 4F7CB 5ALCH 1DQVA 4RV8A 3ICJA 1I7ZA 4O1AA 2W9EH 3JWNG 1N2VA 3K2UH 5ESVA 4YEEA 3ABQA 3PJWA 1KBGH 3QRGH 4Z2IA 4TO8A 2EVJA 1A3HA 2QV4A 2R23A 5T3XE 5HATA 1D6VL 1GGYA 3QUZD 1R6VA 3HLKA 3RDTC 5GSVB 5FO7B 5F0MB 3ATBA 1HOCA 4UANA 1BSIA 1ECQA 1EERB 4H9UA 3GUFA 4UINL 1F8TH 1AI1H 3WHXB 3HE7C 3TIMA 3RZCA 4ORMA 3QA3B 5JPNB 4YSUA 2PYFA 5E09A 1YQ2A 5C0JB 5LHDA 1C1EL 1LHZA 1R7AA 2UY7A 4NCC2 5FEBA 1Y18B 3IFNL 3V0IA 3THCA 4NNAA 1JUBA 5I5IA 4LANA 4NU7A 3ZVHA 5IM7A 4C6EA 4GQGA 2P0IA 2G4EA 3ILPA 1NIAA 4UBDD 4HS8L 4XO6A 1AD4A 4XRCA 1DVXA 2IWKA 5MERA 1JRHL 5C07A 4BSVA 1YCSA 2MQGA 3UY7A 4FQLH 3J7HA 1XX1A 4KXDA 4GVGA 1VEPA 4GW1A 4NIYE 1X7QA 1YHPA 4MA3B 1GJIA 3DBXA 1RQBA 4FZIA 3A0OA 3MNVA 2QADB 3QO1B 1P0BA 3A9IA 3RVUC 4KTYA 3PG9A 4I5XA 3NJMA 3GVQA 1VYSX 1EEYA 3N1AA 4Q6XA 4UZUA 2WUCL 4KO5A 3ARQA 4L3FA 1UD3A 3UZWA 2WMJA 4R7JA 4O02A 4I5BB 2MPAH 1GORA 1W9XA 2R0ZH 3KPMA 4ODSL 4AC1X 3P4MA 4PGEB 2E7LC 4HIEA 4IKNA 4YLQT 1RV8A 2VXVL 1CLZH 3FOMA 4D3CH 4OV9A 2XWBB 3KWWA 2BOCB 3AZSA 3GZ3A 4XO8A 1BEYH 5HWJA 1RXOB 1XF4A 3JXAA 3BKYL 2JTDA 4HMDA 3V0SA 3D4GA 3QI9B 4OFPA 3TEZA 1MCNA 3KPQB 1Z9NA 4R7OA 3QNYA 5FA4B 4P5TD 4K6AA 2VQ4A 1IEQA 4YXKL 2XG4B 4MWFA 1XO8A 5D4YA 1T4WA 1FLRH 4I5UA 4P8WA 2TRSA 4ACZB 4LFHD 3JYCA 2B1HH 4H8HA 1T0MA 4MPQA 3W38A 4W6WB 4FR1A 5CHNB 1H62A 1KCXA 1NF0A 2WQDA 5GRUH 4E9WA 1A49A 4I18B 3FY1A 4CW1B 1AZUA 1S2TA 1BQLL 3UXLA 4H6EA 3FQUA 2X4OA 5ID0A 1KYDA 2CPUA 1WBYB 1IGSA 5E4IA 4FFVD 3FHAA 2ZXBA 4R96A 3DX6A 1JWUB 3H6OA 3UZYA 3NPVA 1KCKA 3VXUB 3HQNA 4KWWA 3QK0A 4A2GA 3N1MC 5EU6A 4TLTA 1A66A 2JTYA 2B1AL 1KM0A 4AYEC 1YPIA 3OLDA 4FE9A 4ZFOB 5IREA 4MA7H 1BVKB 1AOZA 1WZAA 3CHDA 3FO9B 3K8MA 5A6BA 4W9HC 4I1PA 5J6HB 3GBNH 4KFPA 3W7KA 4A3YA 3IJSA 3LRKA 2WKGA 1AR1B 2WXGA 4O2FA 3CUXA 2CRMA 4PMRA 4U05A 4AYSA 2TSAA 3MUUA 1SY6A 2NLJA 4NUGH 1W9DM 3DSFH 1XL4A 2VEFA 3A67L 2PW1B 1TLMA 3QOMA 4LAMA 1ML1A 3MBED 5BVJA 1UM6L 1FWBC 3JV4B 5LSMA 3KYKL 1E6RA 3TTOA 3U6RB 5FGRA 4XNDA 3B1UA 1CDBA 3L5XL 2FCBA 1V5XA 3C09C 4G11A 3NGFA 3R4DA 5ISZE 1U42A 5KVFL 4YZWA 2DSWA 4CL7A 3FQTB 2NXGA 1M57B 4JYDA 4JXCA 1B4TA 3TNMA 2CLVA 5KYWB 4ZFOL 1WDDA 2Y3AA 3WJLA 1ZJIA 3N9GL 1E4KC 3DDGA 4I3SL 1XW8A 3NZHL 3NAVA 2VMCA 4O58L 4Y2DA 1T1XB 1ILUA 5FGSA 1F61A 1ZTXH 1M7DB 1A9EA 1IT7A 4X9YA 3O4LB 1LL6A 2W95A 5KTLA 1CK0H 1KGJA 3D0LB 3NG5A 1DLHB 1EHNA 1KBJA 5C9WA 3N1PC 1Z89A 4ZQTA 1W6LA 4KKPA 5B8CA 3CQKA 2RQ8A 3TZVA 2QCFA 4KT2A 3GS4A 4LGXA 4BFGA 3EH5B 5HNNA 2DQHH 3TONA 1ACZA 1ZLUH 3L9CA 4A6YL 1SZEA 2Y8VA 1M7UA 4KY1L 1Y1DA 2PDCA 1ADQH 2VM9A 2YHGA 3JWNE 3SPJA 2RH0A 2H2PC 4NQDA 3AT0A 1K4HA 5D7JB 3P81A 1IM9B 4L48A 2JCCB 2ITCA 1ML0A 3PR2A 1AGEB 5ICXB 1BF5A 2EKCA 4JG1H 1N7KA 1B54A 4NN5B 5EORL 3N25A 2GT9A 1MZHA 2RDTA 1ZLSH 1UPMB 1DR9A 3B8WA 3PP3H 1BVOA 4WD0A 2EIDA 4DAFA 3VUAA 4Y4FA 2E7MA 5DXYA 3MCKB 5DTFB 3GO1L 1G84A 1T7LA 2VJXA 2F53D 2CG9X 2NUPA 2PP0A 4C1KA 3EYFA 3Q9QA 2CLPA 4HPYL 2MUCA 2HRGA 3VWKA 2GSIB 1MRFH 4IZGA 1UT2A 4D72A 4ABWA 2VIRA 1YE6A 3OKEB 1C3FA 1W3LA 2EIMB 5AAMC 5CGMA 1S9WB 5LBVA 2WQWA 1I60A 2HMCA 2YB4A 4JFXB 4F0KA 3WXVL 1QSEE 3UADA 1LF1A 1UZ8A 4Z3IA 5I03A 4HT1H 3RWHA 4LRNH 3D1MC 1J7VR 1VERA 2Y5JA 2EIJB 3PGDB 2F1EA 3CUIA 5M1TA 4EWND 4N2DA 3L5JA 2B08A 1AH0A 5DUBB 2AP2A 2EYSA 4A2MA 4NSKB 2RGMA 4ZQRA 3VVGA 3UGXA 3RL2B 4FQ1H 2Y2YA 5AOIA 4YE4H 4GI6A 4R84A 2ZZ3A 2DN7A 5AVWB 4WIQA 2E67A 2COVD 3FA3A 1XLKA 4TU1A 5GS0H 4PTTA 1S78D 3NEXA 2X7VA 4LSUH 1S38A 3C2OA 3TC9A 3O4LE 3LXBA 1KIQA 3CFBB 4OBRA 2PO6D 5CGBA 3OLEA 3KR3L 3QC0A 4DHGA 1MNSA 3K1DA 5AZ2L 2OA9A 2GJJA 4OZHB 4POYA 5CCZA 5K4XA 2KBGA 1C29A 3TT3H 1K5WA 5F71A 3QUMA 1MFNA 3RX3A 4M1BA 2ZUUA 2VGLM 2C16A 5HYQB 5AWNL 4YSPA 4NNPL 3G04B 3V5FA 1ZDQA 1DZBA 3MFFB 4XH2A 1XL6A 4XE0A 2O5NA 3SDYL 4NZCA 1GR7A 3G1FA 2VDIA 2JCCE 4JFVA 6ENLA 1DWJM 5I9QB 5E5MA 3C5ZC 1S7XA 4YFLF 4NO5B 4J3OD 3LH8A 1ZT4B 3HS0A 4IUOA 3RGVC 5SWUA 4LF2A 3GSWB 5J5RA 3PV6A 4TX6A 4AM0B 1JCVA 3FCTB 3TA3D 1RQEA 1DOSA 4ELMA 4G8EB 2J24A 3I9GL 4JUTA 1MAKA 4MDRA 2YLAA 5DMYA 4L4MA 4C1NA 1EO8H 4AYGA 3TO4B 4HLZH 2Y70A 1GY1A 5ICZA 1FH2A 5IHHA 1QUNA 2BSED 1JF1B 4PJCE 2NY4D 3BN9D 1Z66A 4MLIA 2FJFA 1PQZA 2AK1L 4YVPA 3AFBA 5FHBH 3P02A 2R1YA 3CHQA 3KD4A 5I75B 2D2OA 3UWEA 3O8XA 1G7HB 3VK5A 2E9IA 4BCYA 3GS6A 1CC3A 1CFBA 5HDWA 3BKML 1F11A 3RGHA 1E6QM 5JDSB 4HJ0D 4KRMB 1JNDA 2NUTB 4BUQA 1CICB 3QWRA 4XVTL 1WXJA 3GF8A 2X6CA 3AJ7A 4HGKC 4ENED 2VEMA 4UR7A 4BEQA 2OMVB 3RR1A 1BFVL 4AGMA 4F27A 2WJ5A 3U0HA 3DVNB 3M5ZA 5M17A 1DVSA 4GUPA 1GMIA 1P1ZA 1N0XL 3PM6A 3UFYA 1J6OA 2X6VA 4AZGA 2AEPL 4YNYA 4YL9A 3UDWC 3IAPA 3QFJB 2XPYA 4XTIA 4JREC 3EKLA 4K5LA 1A8JH 4KBPA 3JW7A 5FJIA 4O4WA 4IKIA 4OZHE 1T03H 3WQ4A 2CQVA 4QROA 4FQXD 4CQCA 1NCJA 3GLCA 1E65A 2QKSA 4HK6A 2VLLB 1HHHB 3ZJ6A 5D5MB 2QPXA 1EZVX 3KVJA 5BS0E 1G94A 2CCVA 3NDYA 2WZ5A 4P05A 3P0WA 4MAUH 3AADB 3FO1A 1EDHA 1UFUA 5IUCA 2Y4SA 3QQXA 4LX4A 4H5SA 2H1PL 3GX9A 4NZUH 5AVRB 3WAKA 5HYJE 4OJDH 2AXGB 3EDKA 2VX5A 3TJLA 2F8OA 2XNAB 1U95A 1UG9A 3FN0L 3ZZQA 1CLCA 4F33A 1CIUA 1KTDB 4LUSB 4OGXH 5BZZA 3FU3A 1RHHB 3PBGA 4YHEA 1TEFA 4XMPL 2J1YA 2JIXD 3C0LA 1YNTB 4LB8A 5E4OA 2Z65C 1ETZB 4XPBH 4RGMB 3XINA 5ABFA 2J88L 5CPMA 4DPCX 3OAYK 1PNDA 1JGUH 5BOPA 4QXUH 4R2GC 5TBOA 1N70A 3DAQA 4P2QA 4YS4A 1JCYA 4J27A 4G6KL 4OCXL 1EXGA 1UXSB 3T08A 1X7TA 1ONEA 3H7RA 4G7SB 5MEPA 1CL7L 5CIPA 1U6AL 1QPXA 3LCGA 3LG3A 1ECYA 4N0YL 1XRVA 1DQDL 3B7TA 4GO8A 4Y9FA 1N19A 2WQPA 1CW2A 4BK9A 4FJYA 5KYYA 1R3VA 3VFVA 3M0VA 4Y19E 2OG9A 1NQBA 2OJZH 4PMUA 2ZA2A 3LERA 1P1XA 3NFSL 1P2CB 1QLRB 3LENA 2A6IA 4Y2LA 1T2QL 3G5VA 3IVKA 4Y4KC 4UTKA 4M48L 3SKMA 3FB5A 4HNOA 2HKHH 4XPFL 3NDZE 3OIXA 3ZHNA 4KVNH 4JDTH 2FTWA 3TWAA 3UMTA 5FK9A 1M9WA 2R2EB 5E51A 4M1GH 1CU4H 4BFEA 3KBVA 4AJVA 4ZR8A 5F7LB 3W81A 4UAOB 3N6YA 5EC1B 5CCGE 1MFBH 3DUSA 1ZB5A 2ZUMA 4TM9A 4F8PA 2W92A 5CFAA 2BSRA 4EF8A 4E3TA 1NIBA 1OFRA 4UTAH 4LYPA 2ICEC 1W0WB 1IEHA 5A8PA 4RETB 3T3ME 1EOKA 1SFTA 1Q6EA 1RIUL 2GQAA 2WZPD 4N02A 2WJFA 4RIRB 4W4OC 1RUML 1MMFA 4U1NA 2PCPB 5JW5A 3KPRE 4KKRA 2MOQA 3FO2B 3HM7A 1M7JA 3U2JA 2OMXB 1HSAB 2R9HD 4LGSB 2H4EA 3RAJH 2Z4TA 5EBGA 4ZE5A 1AP2B 2ILLA 3BFQG 2VMDA 1K9FA 1EXBA 2QCDB 2WO3B 2KDYA 3AIVA 4ZO8A 4P46D 3R1GL 2CESA 2HRHA 3OWEA 4QR6A 2K0RA 3AU6A 2V5TA 3USBA 4Y5VC 2BGNE 3HNTH 4UTTA 4UQAA 4RE0A 3BMWA 3TTQA 3I6LE 2RKXA 1A80A 1VH7A 4KI5D 5DVOA 5F89A 5I0DA 5FW6A 3V2AR 1MI5E 1DDHA 4KZ0A 2WZMA 5DHVB 1S7WA 5B3JE 3OC8A 5E5UB 3BYYA 4HLEA 1H61A 4HKBA 1PCKA 1P4BH 4LS1A 3W9ZA 2D3NA 3L13A 4D6EA 3P0VH 2Y36L 2WLLA 3IJ7A 4D7PA 1F00I 4RZ4A 4AAJA 2VXTL 1MCWM 4UTBL 43CAA 3VSVA 1YY8B 3FQ1A 3MRJB 4JO2L 1UM4H 2Q8BH 3WLWD 4IISA 3GSOA 4V11A 4YLWA 4HULB 2NY1C 3R58A 5GNXA 4R26L 3IXAA 3DPBA 3U2CA 4M51A 1CI3M 4JZJB 1XPGA 1FH9A 1P5UB 2IXQB 4DJDC 1J5TA 1JRCA 2AJSL 1OZQA 3BSZL 3H9SB 2VGGA 4U3XA 2H6PB 4JN6A 3SPCA 2YD1A 2PF6A 1GQJA 3A5FA 2WQ8A 3V3WA 1A5BA 1E1CB 1PFOA 5CEZE 1TJIH 2UUDH 5D2NB 4BWUA 4LLVB 1VA9A 3LQZB 3R10A 3ALFA 1BD2E 1CBJA 3QEUB 5JHDE 2X4NA 4OF6A 1XLHA 5CZKA 1NUFA 3TW9A 1QWGA 3QAZB 3ARUA 1KCUL 3GVRA 5B4MD 4AWJC 1RCXB 1QBBA 3W0WA 4NBZB 3LS5L 1U4FA 1LWHA 4LUTB 4XT1C 3ILEA 4LRTA 3VFOA 5ABHA 2JMRA 1QFPA 3PBVA 4CCCA 4KESA 3D39E 1OF2B 4KVPA 1YEDA 2OO6A 3KWUA 4DQOH 4GQRA 3BH9B 1TA3A 4QFUA 2V7HB 3LCXA 2NQCA 5TDNB 3RFZA 2NVAA 3DARA 5D33A 3TQVA 1FWTA 3L3JB 3WBDA 2VR9A 3CDYA 3DGCR 4CSTA 3P69A 3GC2A 2QDVA 3NACL 1RSCA 3MXWH 2I85A 1O7SA 3PZ9A 4ZQNA 1NGQL 4JEQA 1VLXA 5F97E 5I1AA 3RX5A 2GBVA 3REVB 1GGUA 3TWCL 1Q9LB 2EC9T 1S6NA 4XWGH 4WQOA 1GZQB 4YR6A 5LB1A 1I82A 8XIAA 3MJMA 4S1DC 1H8SA 4MDJB 2OX1A 4E3VA 4FCAA 3T4YA 1XIBA 3N12A 3QJZA 3W11D 1RJPA 3QJRB 5KYNA 4X7EC 15C8L 4NN7B 4JE4B 3A6BL 4WHDA 1UZ4A 3TF7C 1I7ZB 1WXZA 1YEFL 4ONHA 3AZUA 3WQEA 2P5ED 3QEGH 5ESVB 4ZX6A 3PJTA 3QULA 2VM4A 4OLEA 4XO4A 2P88A 1F6AA 2QPEB 2R23B 4XMTA 3ZUNC 3URNA 5EULV 5FYKH 5CJ8A 1D9KC 3BLLA 1KJ2H 3WLKX 1HOCB 3SBPA 2V2DA 2E9LA 2UY2A 4LU0A 1GKRA 4EBQH 3KDNA 2JF1A 2F5AL 4A6YA 3RZCB 2VLJD 3FIGA 1ZPTA 3EW3B 3H9SE 3DIVA 1ZWIA 2PYFB 3BT2H 4HWZA 3PZMA 5DZAA 1DJXA 4NQUA 4A2HA 4OD3L 1E5YA 5C1MB 2UY7B 3TURA 5I26A 3T4AC 5IM7B 3SUVA 3KCJA 4JIEA 5JH2A 2NR6C 3ILPB 4AENA 5JHLH 1TPC1 5JR1L 4O1FA 4XRCB 5A6MA 3WLNA 3T77A 5MERB 5C07B 4BSVB 3F12A 1BMWA 2OV0A 2EP6A 2RGLA 4JG0H 3UW6A 2FTYA 4GW1B 1K2DA 1X7QB 2BSSA 2DLGA 2AMUA 3DBXB 2E47A 2R2CA 1MXSA 3MNVB 1KMGA 3PUDA 4K5PA 5AHEA 4A37A 2YDSA 1EEYB 1F90H 3ZW3A 2BNQA 2YIHA 4DUXA 2XFWA 2AXHA 4XZHA 3TN6A 2VXSL 4M7TA 5ENLA 3VU1A 2RDXA 2IEPA 3EUUA 2OX4A 3GZOA 4FNTA 1ZXQA 4O02B 1YBQA 4KXZH 3KPMB 3P4MB 4F2ME 3W2NA 4IBTA 4HIEB 3KMDA 4AJYV 5D9SA 3KP0A 3FOMB 4YZFF 3ARFC 2J78A 3KWWB 1PG7L 3V6OE 3V7PA 2FEEL 3ZZLA 3V0WL 3GIYA 4PRWA 4F2TA 5E99L 4G42A 1O6SA 1XF4B 5DO2D 2W38A 3O2VL 3QUZA 3DFPA 3P60A 5ADPL 4QG9A 3QNYB 2WAGA 5LNUA 1U58A 1A50A 4HDIA 1RULL 5T3XH 3DBNA 2FB4H 3OYZA 4MWFB 1NP0A 1TYRA 1FUNA 3ITXA 4EJ1C 3VPLA 3ISRA 3HOJA 4LAJH 1T0MB 4OJEH 3I84A 1KGXA 3MCLL 3T42A 4TUJA 2QNEA 4JY9A 3OZKA 5FSDC 3W6MA 1N3NA 4OIAA 3WNKA 3UXIA 5AYQA 4YQXL 1B1YA 4GNKB 4A38A 3WS3A 4Q97A 3TNNA 3FQUB 2X4OB 3TK7A 5ID0B 3DFQA 4MNLA 4XAGA 3K8LA 1TMHA 1FAIL 2QSTA 3KS5A 4R96B 3DX6B 5D1XD 1WX0A 4ONVA 5EWIH 3CXOA 1GHFH 3AQUA 5EU6B 1WA1X 1M41A 3LEVH 1GIGH 4FLOA 4OF5A 5J6GA 4WTZA 5MHSE 4W9GC 3HMWH 4RRPM 4QISA 4G2AA 1R3QA 5C07E 1E6PA 4KY2A 4LO9A 3CQPA 3MY9A 1KYOJ 1CDUA 4KTEH 1XM3A 3NABL 5FAGA 5B7MA 3WY2A 4Z0JA 4IS6A 3IJSB 1HS6A 1BTCA 1I85A 4O2FB 3EWYA 3GXMA 5LNVA 1YN6B 2ZC8A 1KJ3L 4D7BA 2JKEA 2NLJB 2BDNH 1N68A 1GJPA 3FT9A 5TGBA 5CG0A 2XACC 1I2QA 5K39A 2BHUA 3N14A 4XC1L 2DU2A 4QNPF 4FQ2H 4DGVL 5LYRA 4K9EL 4HAFA 3W39A 5BVJB 1IQ8A 1Z48A 3WH8A 4U6TA 4P5TA 4YSSA 3H42L 3HZKA 5SV4A 2DI9A 3AACA 5I6NA 4EI6A 3K2GA 5AN7A 1EK3A 3FW6A 4PW3A 1WOAA 2HROA 2FPVA 5EZPA 3NM3A 3WNLA 1L7IH 3E0IA 3QJQB 3TNMB 2CLVB 4BQ6A 1XSKA 1F18A 1R3RA 1B3JA 1N12A 5AYUH 2BWDA 1B4LA 5EDXA 1GS7A 4Y2DB 2QCCA 4CSZA 5B38A 3U9PL 1OP9A 5A6AA 1A9EB 2XWEA 3HPLA 1LYXA 4L9DA 4LIQE 1QHOA 1JNLL 4CDHA 5I73B 3QQNA 3DWTA 5B8CB 4XR8C 5FDWA 3PAOA 3TZVB 3RIKA 3WS6A 1EDTA 4H6KA 2E6PA 2J7LA 3LB6C 5F2MA 1J4EA 3IS0X 2NY2D 1UA6H 1YXCA 2A9AA 2WXOA 3KPLA 2AKRA 2G3JA 2W9DH 3UTSD 4NQDB 1XQKA 4PWEA 2DIJA 4K3ZA 1HXKA 2ITCB 4JTHA 3ABLB 2F8VA 4MVBD 1R86A 5DD6A 3AM8A 3VYOA 2FNBA 4BH8A 5M2FX 3U9WA 5EU6E 2GT9B 4H9XA 3NDOA 2E46A 3WKYA 5DK2A 3ARVA 2W4XA 4Y4FB 3MBEA 2XX0A 2O5ZL 1J8HE 1OK6A 2D03H 1GOWA 4DP5X 2JJSA 4DVRH 3RM8A 3HU7A 3T0VA 2NUPB 3EYFB 3VWKB 1ZUAX 1WP6A 2E5CA 2VIRB 4M6NL 3DVGA 4QE4A 4K3JL 4Z8FL 2Z7GA 3CX2A 3BIAX 3T0TA 3C08L 3NQVA 1WZLA 1AZVA 1EBAA 1XEUA 2J88A 2WVTA 1UZ8B 1VFFA 3RWHB 5K9CA 2ZCGA 1KQZA 3LEXA 1H50A 2NCEA 1UA3A 1E0UA 3A47A 2INZA 3NCMA 32C2A 2V9DA 2O6PA 1P6CA 1BCIA 3EJPA 4CKQA 3CNYA 4WY0A 1I45A 2EYSB 3SGJC 2OXHA 1LJMA 1J6PA 2Y7GA 4F3FA 3RX7A 1E4HA 2WOQA 5FIEA 4HEPG 3HBZA 4DY1A 5DEZA 1ET7A 1KC7A 3W28A 2DDQL 4EF3A 2CHNA 3CQHA 2A99A 5DD1L 5TE4L 2OYLA 2A83A 4PTTB 1TV5A 3OQ3B 1ENUA 4WI8A 1AYOA 3SCMD 1IJNA 5GPRA 1KIQB 5LNWA 4V33A 3MJGX 5I78A 1S3HA 3B6SA 5CGYD 1KC5L 3FT1A 2YA1A 1JL8A 2YDQA 2QDGA 4NPYA 2I27N 4KNTA 3NYZA 3VXSD 4C58B 3JWNH 2GSEA 3GFXA 2EDJA 5AD0A 3QUMB 5TNVA 3ZHLA 1MVUA 4QBXA 1OIFA 2OYKA 2ZZ7A 1T3FA 4XP5L 2CBUA 1DO6A 4XH2B 1CDJA 4DJED 4F7EA 4HNVA 2VDPH 2F53A 1LG1A 4MJ5A 2JNZA 4LGRB 4N26A 2QPSA 1N26A 4U4MA 5E5MB 5HOSA 5GGSY 1MUMA 1S7XB 2NQ3A 3HS0B 2G41A 5BZXA 5DELA 4HGXA 2J6WA 3PV6B 5GJSL 2XIQA 1AHWA 3KLDA 3U7YL 5I02A 1SBBA 4UOW0 4ELMB 2DRUA 3UEQA 5JXQA 3EXRA 1KM2A 3QV8A 3HHSA 4QXWA 4Y9PA 5BWFA 2D2JA 4YTUA 5IDZA 4JR9L 4C1NB 3UP1A 1IE4A 4Z1BA 5ICZB 1OC7A 4WI6A 1QUNB 2FJFB 1PQZB 1E15A 3QXTA 3QUML 2LR4A 1W72A 3GKFA 2R1YB 3SBFA 4TQEL 1F9CA 5G1YA 3WU1A 3O8XB 2B8OT 3RPBA 3UYRL 3L5WA 4O1EA 3D08A 5HJXA 1HZHH 4IM4A 4CUCA 5BZAA 1F11B 3OMNB 4Y8FA 3TLLA 1K9TA 2VMJA 2P76A 4QAWA 2PO6A 4DAGL 3T44A 4AEEA 4RLIA 2Y7NA 3ULUC 1Q65A 2YK1H 5I15L 2GC4C 5AW0B 4BE5A 4YAQA 4LF3A 4U1LB 2O5YH 4GUPB 1P1ZB 4MPKA 2K6ZA 4FA8A 4Q8PA 2HKFH 3I50L 2IDTA 4YNYB 1TELA 2Q7AA 2HDJA 1DSFL 3ATAA 4UTBA 1IKNC 2WXFA 1Q7QA 4S38A 1VPYA 5FOBA 1RHFA 4M1DL 3WD4A 3VG9B 1WD8A 2CBJA 3UERA 4ICWA 4Z95L 9XIAA 1I0BA 5BO1L 1NDVA 1B2WH 3BSZA 1TTRA 2N1TE 2YL8A 3TA3A 2QUTA 5H2BA 3WIIH 2FIQA 4KUZH 1QDSA 2PPFA 2R0WL 3FO1B 3HGSA 2CZFA 4OSUH 2PLMA 4IPIA 3BTNA 3GIPA 5EOQH 3FRPA 2CO3A 4EACA 2BSEA 3WNOA 4H5SB 3ARDD 3V0HA 5F44A 3PWGA 4OU3A 3EMCA 2GZXA 4R7LA 3VDHA 2Y07H 1U95B 4OCRH 1BWLA 4WO4C 4OI9A 3DGGA 1ACYH 2JKNA 4EIUA 3SGEI 1HOEA 4QJ3B 1G6RA 4F33B 1CGTA 4AKOA 3TTSA 2P8LA 4YDKH 2WSRA 3NJXA 5SWQA 5D5MF 2CITA 4E41E 4P4KC 4AD2A 1AR2A 1Y07A 5A69A 1KOAA 3HFFA 2IMRA 5HUPA 4FOMA 3OODA 5CINL 3BPCA 4OFIA 3T0EE 1AMXA 2CZEA 1CR9L 3B2XA 5BMFL 5ABFB 4Q6JA 5GS1C 4IQLA 1DSWA 1A5CA 1M03A 4YX2H 4M4RA 2FBJH 4P2QB 1TFVA 5DSCA 1D5RA 2DLEA 1XPYA 4GY1A 5HPCA 2GYIA 2B15A 1P0NA 3FSOA 4PTWA 2Z1SA 5MEPB 3LXCA 2PWGA 3N1GC 5CIPB 1S8DA 3SKOA 3GSMA 3W3BA 5ELIA 1EIBA 1SOQA 4FR6A 1UG6A 1KXQA 5KYYB 3VFVB 2E6AA 3GZAA 1YNTF 3TH2T 2XIIA 3FTUA 4FQXA 3QAQA 1IVLA 4HOWA 1OQFA 2A6IB 5K59F 3G5VB 3IVKB 2ACSA 3QPXL 5T5FL 3SKMB 3FB5B 4AZIA 3NAAH 5DS8A 1VLWA 3RKDC 4ZFFB 2CK0L 4WENB 3L5IA 1A5KC 1DQUA 3AG2B 4RE2A 2KS0A 1CTNA 5FK9B 2ZIDA 3I75A 4LSTH 3TSMA 4DF1A 3DX4A 3X14A 3OAUL 1P84J 1D5BA 1ELSA 3ZDYB 3DUSB 3L48A 3E96A 4JZOA 2BSRB 1NBYA 3EA2A 4GXWA 3O6LL 3VCCA 4LVOB 1HJVA 5JA8B 2ATSA 4RESB 2NWRA 5IXEA 2JIXA 1I3RA 1TTIA 4I1NB 3SDDC 5IMKA 1UB5A 4YVUA 5IUSA 2AS5M 4G82A 2VCCA 4LVHC 1ADOA 4WY7H 3NCCB 4LASL 1RPKA 4U1NB 1MIEH 5JW5B 3PAVA 4A8LA 5I8EA 5IJCC 3NXFA 4HU2A 2DQTL 4DVBA 2XIOA 4BRJA 2AQOA 4AY8A 4UTWA 4QLWA 3UNTA 4D9RE 4PJ6A 2R59A 2MMXA 2Z34A 4KGLA 4JANA 5I7GA 2F54D 5GRZA 4PUBH 4XXCA 1D7BA 5DUML 1WCQA 4C6FA 2XV3A 1OEPA 4NIKB 7FABL 1LK3H 2UY3A 2CYGA 3GHRA 2ZCLL 3VFTA 4N2GA 5F89B 1R3IL 5DT1H 5ECUA 1IGCH 4FF5A 4L80A 1NMAH 1YTKA 1PCSA 1J5OL 1DDHB 2VC2H 2QHAA 3WFZA 1S7WB 4WUUE 3R11A 4I3GA 4HKBB 4R33A 3H2AA 1RUPH 1WZ1H 5AB0A 2EF9A 4ZO7A 1NF7A 4WRHA 4FDWA 1BVWA 1QSZA 2WLLB 2V0TA 4XZWA 4Z3JA 1J48A 1V10A 2YA2A 43CAB 4HAKA 4AD4A 4AVJA 3GSOB 4J3OF 1FZJA 3RUGA 2HBXA 5FEPA 1T1WA 4L3CB 5I0VA 2CR3A 3VGBA 3STPA 1XDJA 3CV1A 3IXAB 3DPBB 2W3ZA 4MZ8A 3H2QA 2G9HA 2VDMH 1DJSA 2IKHA 1L9NA 1RZKL 5IB2A 3CMFA 3GSXA 3TMLA 4OGQC 1I0DA 1IX2A 2HYMA 3V5OA 4XMKH 3SZ6A 4KJWD 4QI3A 5F7DA 4RAHA 4AOFA 2WZPA 3BVVA 2EXYD 5AG9A 1G1KA 2EC9U 1S7TA 4XMXA 4Q0XH 3AOFA 4JTFA 4N2HA 4N2YA 2X4NB 3LLFA 5IFHH 2X3AA 4UTMA 3MJ9H 3W0WB 1OAUL 1SXAA 4OIIH 4P46A 4OLXH 2QULA 3VFOB 3A24A 1R4XA 2F1BA 5DEFA 4ZTPL 5D1QC 4HT3A 3GG7A 3SDAD 1O7DC 1YEDB 5KJRL 3GAYA 4MKSA 1FXQA 3EJYC 4A8IA 4IRZH 1TA3B 1T66C 4PS7A 3RFZB 3STGA 9PCYA 2HXUA 1UZ1A 4FABL 2QQNH 3RXZA 3EYQD 5GS0C 2J20A 3U6XA 4DJMA 4AUUA 1FFOA 2I57A 2IG2L 4UTUA 3QSKB 5A2KH 3FBKA 1P53A 2PETA 2J79A 3B9KD 2X6BA 2WSYA 3QJHA 5C86A 3HFTA 4MMXC 5I1JL 3VFWA 5I1AB 3Q13A 5MP6H 3AQXA 5EB9A 4YHZL 4YR6B 5BVPL 2QBWA 1BTMA 5AW7B 2YL6A 3BOVA 1BFTA 4E2VA 2OYPA 4BQ2A 4D94A 3TSBA 2TRYA 3H3KA 5F8RC 3T4YB 1SM3H 4Y2OA 4W4QA 4I9JA 1FDYA 4YZFE 4H41A 3S83A 5EEWA 1TQCC 3NFPA 4ONHB 4YDLB 1EAJA 1TR1A 3H9YA 3GMNA 3QULB 2NY6D 3NPZB 1PU0A 1GOMA 1F6AB 4GIRA 1MJ8L 1D5ZA 1HJCA 1LTDA 4AH7A 1N4XH 2ZDSA 4LCIH 3KRBA 5A40E 3B9DA 4U2ZA 1V3HA 1G4EA 3T6XA 4C6PA 4EOWL 2N7BA 2RGSA 4WTZG 3AQDA 3QHFH 1DE6A 3W7EA 3GINA 5CEZH 4A6YB 1W3TA 2BC4A 5CSSA 3IANA 1ZWIB 4XODA 2A7RA 4JHOA 4HWZB 4GSUA 4PBEA 1A5UA 5K3VA 3SAZA 4L6OA 4DUVA 4J2QA 3ESVF 2IVFC 2QVNA 4ZTXA 4BWLA 4ADUA 4BDVA 4WV1C 2X2YA 4AIZA 4AENB 4DVOA 3T77B 4M7LH 3DO7A 2PTZA 3F12B 4O51A 2P43B 4B53A 2OMNA 3B34A 3SOBL 4DNMA 5G5DA 3LLXA 1K2DB 3UG3A 2BSSB 2WKOA 3ZYZA 3OOQA 2IPFA 1A7RL 5KVEL 1M53A 4JJHA 5FF7A 5I1GL 1ID5I 4KTDH 4ROQA 3TU9A 2BNQB 2HLFC 3LX9A 3MNMA 3L23A 1AGFA 4H13C 3TM6A 5AB9A 2AJZA 5IHSA 1RZIA 1GXEA 2PTDA 1ZSDA 5I1LA 1YBQB 1Z8AA 2XVPA 1PZSA 5C0IA 1JPIA 2NY5H 1AY1H 4X8GA 5D9SB 4A67A 2P5EA 4MCZA 2WD0A 4K4KA 3QZ6A 4QNPE 3APNA 3C9NA 1OTUD 4G42B 3QDMD 5KVFE 1OYBA 3B0XA 1O6SB 3VXUE 4LKCA 1E4XH 1PY9A 3VCNA 3QUZB 1HZLA 4D9LH 2PTWA 2GGJA 3QUKA 4GG9A 3RUGF 4HJ1A 1U58B 4HDIB 2VLKD 5K5YA 3P0YH 3BRGC 2VLJA 3PBMA 3NZUA 1OSEA 1AZRA 4Z23A 5DZLA 5G55A 3NNTA 4LSQH 4HUXA 3PP4H 4K07A 4Z7AA 4LSDA 4AYDC 1FWAC 1P4LA 4I9WE 4CCZA 3DTUB 2HRWA 3CUPA 4TUJB 3TH4T 2FZNA 1CTMA 3A3HA 3ZHKA 3MI2A 2JB5L 2QKFA 3R06A 3VRJA 4S3BA 4WDXA 3WS3B 3TNNB 3O3UN 1W8GA 1UT1A 2DZBA 4MJ4A 4U0RC 4ZMXA 4IIGA 1L6PA 3S3DB 2ZX9A 4HFUL 5E7BA 1ICPA 1Z9AA 2VWTA 4YCOA 4UMGA 2WJZA 1AODA 5D1ZI 2NSMA 2WLZA 5DEJA 3ZTCC 5DA0B 2AJXH 5J6GB 1JV5A 2CCRA 4N3TA 2HJKA 4HBQA 2BWQA 4KI5F 5D4QA 2INFA 1NCCH 1KSRA 5CJQH 2FZMA 4C54A 1UJ3C 4PP1C 4IS6B 3CXDH 1H11A 1MRQA 1XF1A 4M6QA 1YY9C 4K1WA 1XZ0A 4OLYL 4LBAA 3D69A 5TGBB 4PMNA 2FX8L 4AIUA 5K39B 2A1WH 2BNQE 1TQBC 1MFDH 3V7AG 3WH7A 2QLYA 1OW0A 4BFOA 4PY8I 3W39B 5FF4A 1TPB1 2VUNA 5GJPA 3TSDA 4IG2A 3ZE2F 5I77A 1OYAA 4P5TB 3MLTA 3HZKB 5D70L 1ITUA 3RPIA 4GZIA 3FA4A 4EI6B 4I48A 4MCMA 3LCIA 2WMGA 1BHGA 2R2HA 4FC3E 4JGUA 3Q8CA 4IJBA 4DM1A 3UESA 2PCQA 2XSXA 3L0NA 3O3RA 4APXA 1BM3L 3GM0A 1UXMA 1DWFM 4PJBA 2YKLH 3H4FA 3U0WH 2OL3L 5CO1A 2B77A 2BIHA 3E7JA 2B9AA 3HPLB 4C65A 5F9OL 3ORJA 2CCLA 1FKXA 2B7QA 3A4JA 2ESVD 1QT1A 3PANA 2N7SA 3VKKA 4MJID 3BISA 5IJBC 1NFKA 2DBJA 4MAVA 5E6RB 3M43A 5D1XA 3TZNA 3U1PA 5TFSH 5FDWB 2YRPA 4I6VA 2GAZA 2R1LA 2F9BT 4S2BA 4UC5A 3H4GA 5G2NA 2HQAA 4CN6A 1IILE 3KPLB 2AKRB 1WA3A 4WW2A 4XCFL 4QF1A 4Z17A 2EEDA 2VFEA 4KXZI 3PGFL 3ULAB 5JXAH 3ZIMA 3VB9A 3L54A 4OM1L 1JXGA 3SIZA 3WTTA 4FF7A 5DD6B 3EZ4A 4HBKA 3S0PA 4BH8B 5DUJA 3GMRA 1NSNL 1N64H 3ZLGA 4HBCH 4F57L 2B16A 2IOIA 5K9OA 2ZZ4A 2N7AA 5I6OA 4ZUTA 2WB7A 4OT1H 4G72B 3OMZA 3F00A 4JN1L 1OTTD 3MBEB 3QYNA 3W2JA 3PY9A 2Z35A 4P3DA 5B7ZA 1VB9A 2IQ9H 5BXFA 1SDAB 3BGJA 4NWUH 1C08A 2HK0A 5F96H 5MEOA 3DVGB 1KRMA 3NQ7A 5J12B 4HCLA 1WAAA 1HGWA 1OCJA 2RJGA 2XJKA 2Z2BA 3BG3A 1X5ZA 4URTB 4OFCA 3CZ8A 1EZLA 3RAOA 4CD6A 3R7MA 4OBTA 4MTMA 3FHEA 1UURA 4J40A 32C2B 5I1CL 1W31A 4WY0B 4FLHA 3TJIA 3IWUA 5L2JA 2OXHB 2AZUA 2P1FA 2I17A 2XLLA 4UNTA 1OF0A 4F3FB 3L4TA 2C8NA 1PIIA 1VF5C 1NDTA 4UTLA 4PIBA 2DQXA 3X1FA 6XIAA 1AGBA 3L0GA 3EMZA 4J3OG 3PJXA 4LIQH 4QRPD 1GA2A 2P3ZA 4UWQB 4XVSL 2A83B 5D2VA 1XTLA 5AVQB 3UTSA 3PHQA 2BBFA 1JE6A 1JPHA 3NEOA 3KUMA 3GSUA 5T5FA 3F1QA 3WL9A 2HPIA 3B6SB 5EZOH 1XF5A 1XLCA 3FRPG 5IR1A 4GLEA 5LAPA 4NPYB 1JYNA 5G2HA 4DGYH 5AD0B 4N2CA 1OD8A 1MVUB 3RLUA 1T3FB 3ASNB 5ABZA 1KTCA 3QGKC 1ZBWA 1J0KA 4F7EB 4BI6A 1KKOA 4GKSA 2F53B 5DR5L 4B15A 4MJ5B 1T99A 3IIOA 2R4SH 4DUOA 2FGWL 2FFIA 1TQUA 4QD2E 4Z6AT 5AW2B 3VWJC 3BUPA 4L8BA 2YJLA 3AT8A 1AHWB 2DQCL 2ZQKA 2YAEA 4F0SA 3QUXC 2XVLA 2OCZA 5D1ZC 5CC3A 1SOXA 4OD1H 4H4NA 1F3WA 3HHSB 5FJJA 3RZWA 5CZVL 3QFJE 4TNWF 5BOOA 4NO3A 1A21A 2D0GA 5DD3L 2P53A 5J9PA 5HMSA 3S35L 3HF3A 3JWOH 1S3KL 2WM0A 2XBTA 4BA8A 1K9EA 2VUOA 2F58L 4LMQE 2Y7EA 5D5ME 3L5WB 2ZICA 2VFFA 5F70A 2GQ8A 5C7HA 1S5MA 2JVUA 1HF6A 3BAYA 2KHAA 2FQIA 5FJRA 3F5WA 2ZNXA 3SCMA 2DM3A 3WN5C 4ELMF 3QFWA 2PO6B 2NVCA 1E9LA 3BWAA 4AEHH 5BNKA 3GMPA 2D2HA 4J9JA 3L66A 5JU6A 3V7AE 3AALA 3QZPA 4J7RA 2E86A 4KXCA 4YAQB 4G7RB 4LF3B 4QG8A 3VXSA 3P11H 2EDQA 4RCAA 4XP9L 2DJ4A 5D4JA 3QUGA 3W02A 2CLKA 3S6TA 4MYAA 1MCCA 4WKAA 3EPNA 5EKYA 4DJEA 2XQBL 1GC1L 1JPST 1W72L 2C9PA 3EDFA 1YIXA 3UP8A 5FOBB 3WH5A 4GXVH 3BE1H 3D18A 3SB0A 1T21A 2QQLH 5BW7A 3ATFA 4LRIC 1QFUH 1V3KA 1RKRA 4PTXA 5GGSA 1CE1H 4KUCD 3GEWB 3B06A 3TA3B 3I65A 1JHKH 2VQUA 5H2BB 2PWHA 4RVBA 5IZ7A 2YPVH 1DJGA 3UZEC 2XT1B 3UGUA 3C5SA 3U0TA 2F53E 5INCA 2ZG1A 3KTCA 4XMLL 3FRPB 2LU7A 1AGDA 1W5PA 4A4AA 3IU4H 1JHTA 2NY4B 2V3GA 3RX8A 4IIHA 3F4WA 2BZNA 3ZXAC 3S5SA 1Y8BA 1OWWA 3A4WA 4OGAC 1DIEA 1QEXA 3VO0A 5A6SA 4ZX5A 2OCCB 3DGGB 1VESA 2A1YA 4MQXD 3RVXD 1G6RB 1NBVH 5BW6A 3JTBA 1WAAF 2P8LB 3MUZ1 1RD5A 1FNSH 4BCZA 5SWQB 3EH3B 4HPXA 1ME8A 3S9IA 1TWSA 3ROOA 5ECVA 2LQRA 1WUEA 3MZTA 3BPCB 1MLCA 2PXYD 2DYSB 4BF9A 4QRUA 1HHGA 4DKEH 1MDTA 4M4RB 3CUZA 2AZAA 3UAJD 3WLJA 5DSCB 4N6EA 2VWEE 2YD0A 3UTQA 1U1UA 3SGDI 3EH2A 2AQRA 3BUQA 2QJGA 1X9QA 4O15A 4YWGL 1GOXA 1S8DB 3SKOB 1UCBL 4FFWC 5IM51 2ZSWA 1SU5A 3DU0A 1V02A 3LVEA 2VH5L 3G08A 3W74A 1G6RL 4FQXB 4XBMA 3NM1A 1A0EA 4K3DL 1GPWA 4G7YH 4HZ8A 3T1WA 2E9BA 1IE7C 3HPZA 2KMWA 3I9AA 2CZNA 3UWYA 4DBWA 1CF8H 3LV3A 2YD8A 1XGPA 3DXAD 2JQXA 2CZDA 1KN4H 5DS8B 4RAVA 4KEMA 4LDOB 1DIKA 3WXWH 3V9EA 1UR1A 3ZSTA 3AS0A 1R47A 3BVNA 5I30H 1X9UA 3I75B 4FLRA 1I9EA 1EV2E 3BLFA 5AYXA 1L0PA 1BGAA 4JPGA 2OX5A 4AD1A 3ARDA 3TLQA 3FU9A 3X14B 1TCMA 4XMZA 4KZCA 4QYOA 1D5BB 5FUOL 1TSIA 4JZOB 3WEZA 1NBYB 2E5BA 1IBBA 1AD9A 2UWFA 3D07A 5EFIA 1W1ZA 2JIXB 1YNPA 2V2WA 1I3RB 3GGWA 3UA3A 3DA0A 5IMKB 3ETBF 1UB5B 1DQQA 4LP5A 3IF1A 1TMLA 1KGUA 3MCOA 3WE6A 4U7SA 1E40A 1UUOA 3AICA 3RA7H 2P8PA 2WLHA 2A74C 3EOAA 1NUGA 4PB9H 1RA0A 2YRLA 5IESL 2OKMA 3H21A 4J3XA 1DQML 5I8EB 1DBBH 5CM1A 1EVUA 2PA6A 3PHAA 4HHWA 1OV8A 4DVBB 3I6RA 5K33A 1GVIA 1PY0A 1K4GA 3ZDYF 3GXUB 5E6ID 4JANB 2AQ2A 5JMOC 4E5TA 1E0WA 1GW1A 1OGSA 2E27H 5I1KH 4L4TD 3OJ2C 4MDIA 1X5GA 4A2DA 1J1PH 4LNCA 1QI3A 2OTPA 5D2NE 4W8BA 2CKBH 4M8RA 3VFTB 5CCKL 1VS1A 3ZVHB 1ZS8A 5AVTB 3LRHA 4GBXC 4A7QA 4MF4A 3VW3H 1NCAL 4ICNA 4Z7QB 3MUGA 1ED3A 3SCQA 1SHSA 4IP5A 3RUBL 4M1CC 3QXAA 5F4XA 6PAZA 3ZO9A 5C2XA 4X5XA 3B40A 4O8RA 3KOFA 1FZJB 3RUGB 4NLAA 1T1WB 5I8KL 1RUSA 4TSBH 3VTAA 2X2UA 4EIGB 4UV4H 1E6OL 2QJDA 3O0LA 1UWSA 2G9HB 1SUJA 1D5IH 3DKJA 1NLDL 1QXLA 4KJQD 4N2NA 5IBTL 5IB2B 3GSXB 4XMUA 4LVDA 1LMKA 5GNYA 2JFEX 3C8HA 2YD2A 4JNXA 1SYVA 4UCFA 1GYLA 2BGQA 4KCTA 1NGYA 3L4ZA 5F7DB 2OQHA 3RU8L 1VZWA 1YEKL 1S7TB 4KROC 1H7PA 1OTSD 4IGBD 1D3CA 3EB3A 1MAJA 3BMXA 3QE5A 4XAWL 4F79A 1T1ZA 2F54A 5ICUA 4KKXA 1F76A 1PTAA 3HVNA 4P46B 3LNGA 5DEFB 5D03A 2E09A 4NZRL 4IDJH 4ECNA 4ZT1A 1M56B 4ERAA 2GVJA 1KKRA 1JZ8A 4JX5A 2B39A 2ZKYA 4GX9A 2ALDA 1H4PA 4Z78A 2WWKT 4Y5XC 2NLYA 4TOYL 2IXUA 1FFOB 2NPLX 4ZS6C 3CEPA 3T07A 2ZRYA 2DSVA 4BV1A 4M6MH 3QJHB 4WWOA 4LCYA 1DLFH 3ELQA 2J1WA 2DT0A 2A3HA 4W88A 2CLMA 1H8LA 1ZHKA 2OBGA 4M6OH 1ZCOA 1OP4A 3ZE2B 2IPTH 4NQSA 3S0CA 2ZUWA 2ZJSH 4Y2OB 3OWRA 3QY7A 1KV7A 3DRQA 2DQIL 5EO9A 3C0SA 4U10A 3NFPB 5DS1A 4H4IA 4MXQD 2EE9A 2OL3A 3GMNB 1DJHA 1U3YA 3TBSA 4MKVA 3BKJH 2WP3T 1ZEAL 1D5ZB 5EMLA 1Z0NA 3E3HA 2HNHA 3QO0A 2J3SA 1I8UA 1AH4A 3PU7A 1TPUA 3QQDA 3C75A 3UJJH 3MUHL 2I9LA 2AL2A 3W2UA 2J62A 1ME9A 5JBFA 5IQOA 5TH2A 2BC4B 1KJMA 3N50A 4Y9OA 4H0IA 3CN0A 4DPAX 2UZIL 3PV7A 2HP4A 3PFMA 4DSYA 4XN9A 3IFNH 2P0OA 1LOQA 1W3HA 4Z7OB 1X7FA 1CLOH 3SDAA 3NJNA 2X9ZA 3FUKA 5TQ0L 3DO3A 1I9CB 2CKSA 4MUPA 1OC5A 4KKCC 4BDVB 2ZAGA 4G3YL 5JMRA 1HL5A 2FL5A 2H32A 2F74A 2JCWA 4AIZB 1M01A 4D8AA 2ZTJA 4JTLA 1SF5A 1EEUA 1NM9A 5KINA 3QG6A 3DO7B 4P23C 2XN0A 5DFVD 4O51B 4ZMGA 5CCJA 5G5DB 3M0MA 1IGFH 2GHWB 3B9KA 1YLVA 4CN1A 4ETYA 3MVSA 2D3LA 1YYAA 2GY7B 5TE7H 1GOQA 4FKEA 4KI5E 2WUCH 5E0CA 1NOWA 1NFDA 3OZLA 1PZBA 4HK7A 3DJSA 3GMOA 1JN6A 5L7XH 1X1ZA 4H8WL 5DJ8A 2VX7A 4NM8L 2BG5A 1AGFB 5HDBF 1KBVA 2AJZB 3MYOA 1RZIB 1ZSDB 2J6EA 5GGUA 5I1LB 3M41A 4MDOA 2ZTKA 5C0IB 1A9VA 4AXWA 1FP5A 3L5HA 3CX5K 3VC5A 2P5EB 4MCZB 2BNJA 3MOBL 3JVFC 3V52H 1ORQA 1U8JA 3MCYA 4B9JA 3C9NB 4EP8C 5FYKU 3BKYH 3QJUB 2XWRA 4P04A 3V75A 3LKRA 4LKCB 2A5UA 5HMEA 3V5CA 2XH0A 3EZ8A 5HDLA 3WNJA 3G1YA 3QUKB 4NCDA 1CUOA 2DTMH 2XZQL 3FDKA 5C09D 4KKBC 2F61A 2VLJB 1EJOL 1QD0A 4LVNB 2ZZ2A 4HUXB 5I3GA 4HJUA 4EPEC 3BDBA 1ADWA 1P4LB 4IT1A 3NCBB 4W93A 5E4AA 2ZG2A 5E8PA 3CUPB 1LJYA 2EVFA 1XSJA 4NXKA 1M71A 4H0GA 3TGXA 1TXKA 3UYOD 3QZOA 4PL1A 4IP7A 1NGZA 1K6AA 1IVTA 1UWTA 3ZTDC 5FAAA 1GW0A 3R06B 4O4YH 3VRJB 1OQXA 3CN4A 2NXYD 1KLZA 5AOZA 4FEZA 4Q8MA 4L65A 3LJ3A 1JR1A 2GK0A 4QEGA 3NPXA 2DD8H 4LUIA 1ZTMA 2G3NA 5C97A 2GOUA 1QMUA 1JV5B 2IDFA 2HJKB 5TJWK 3K2KA 1P0EA 3W53A 4AHQA 4HXAL 4V1DD 4N4YB 4PC8A 2B7PA 3O9NA 5B3SB 2PMZA 3VH8A 1WO2A 1XZ0B 2VAJA 3L4WA 4P2VA 1GL4B 2PS2A 1FWCC 3D69B 3QDMA 3RGBA 3BP5A 1UM6H 4IICA 3LKNA 1BW8A 2ERJB 3IIPA 3L5XH 3QV6A 3IMWA 4UYQA 4HIHA 1A3WA 1TV3A 2P5PA 4IG2B 3MLTB 4NQDE 1KM3A 5KVFH 3RPIB 2VLKA 5IFAH 1EJUC 2R82A 4IJTA 2WWMC 2EUWA 4I48B 2Y7SA 5GS3A 3P4NA 2R2HB 2AEQL 3ALWA 4APXB 3GNNA 3BP7A 1T4KA 1DWGM 3TDFA 4PJ8D 4PJBB 4KIEA 2Y7OA 1UBSA 3WQDA 3CHPA 5H8UA 4MM1A 2PF0A 3DECA 4HQQL 3DGBA 1RLBA 3R6IA 3QUYC 4AVOA 3JUZA 3SCWA 5BQ7A 1SSGA 3QQ1A 4HNLA 1T8XA 2HJFA 1JTTA 1HKFA 4B92A 2BVOA 4NP4H 4I88A 1KCVL 5BPPA 5D1XB 1OCRB 1T89A 2D2GA 3KWVA 2GAZB 1Q45A 4XC3H 1DJZA 1CD0A 5KW9L 3PZVA 1G9ML 3FVDA 3QR3A 5F6IB 4WW2B 2NW3A 4QF1B 3L7EA 1VKXA 1ICQA 3CHEA 3B8TA 4HWEL 3O06A 4GAJL 5HWMA 4X4MA 1E5UI 1TSHA 2I69A 2ZXDA 1ZLEA 3GMRB 1VJSA 4FNLH 5K9OB 1E4XI 2X16A 4UOW1 4ZUTB 1OFOA 2YXOA 1TTFA 2D1ZA 3RX2A 3WLPA 1R34A 3GO1H 1NFDF 5AHFA 2Z35B 4P3DB 2J77A 3ZZSA 5BXFB 1BFSA 3WEBA 2B31A 3EO9H 1Q3NA 1HKIA 1C08B 2F6UA 3RWJA 1CYXA 4XZLX 3Q7JA 5MEOB 1FCVA 4KHXH 1W8NA 1OT2A 1QRQA 9RUBA 4UMSA 2NY3C 3CU1A 2QGEA 2JKPA 4BELD 4GJIA 1Z1WA 1XYMA 2ZWZA 3PABA 5AHNA 3IE9A 1X96A 1H8NA 1GJUA 2NY0C 1UD6A 2WUBH 4W9LC 3F2LA 1KLYA 4WWKD 3C56A 3TCLA 1IFHH 4MNKA 5DMMA 1X6UA 3FTZA 4Y8EA 2XIMA 2ZG3A 4YBLC 4IRJC 1MCBA 3IDJA 5L2JB 1TVLA 2ESVA 2AQNA 4GP8B 5JIKA 4MJIA 2D7TL 3PUUA 5BOFA 1WUFA 1B90A 2X3BA 4D2NA 1WUZA 2PKDA 4ANXA 2DZTA 5GRXG 1AGBB 4PRTA 1OP5K 2NY2B 4ELME 4XP6L 4ABVA 2OLHA 2H3KA 2XKUA 3MSPA 3UTSB 3KR3H 1YKWA 3PHQB 3GSUB 4AEIH 5AZ2H 3WL9B 2B20A 1V77A 1XF5B 5E9DD 4QSFA 2MCMA 1ZVYA 5IR1B 5FUCE 3K46A 1E6JL 1TJ2A 3SKJL 4AVHA 3G1HA 4DKFL 3FEQA 1VEOA 2GL5A 1QK0A 3COTA 4WY0F 4DI8A 2UXVA 4MZRA 3O9WC 3II1A 5DS2A 2Z1PA 4P9HL 4JQXC 1QNOA 2GC7C 4GKSB 3QR2A 4F15C 1D7KA 3S3CB 3WMLA 4LWWA 4Z7IA 3IVTA 3T8LA 5CZRA 4CD5A 1CGSL 2XGBA 3TN4A 3GNXA 4L8BB 3EXLA 3MAWA 3HIJA 3U5YA 1I2NA 4RMWA 4OZIA 3H3BC 1XDMA 3GB7A 1CLYL 3C12A 4PJXA 5CZ0A 3WLRA 1F2XK 5I16A 4DP1X 3OAZK 4R7XA 5TF1H 1Z9SA 2FHFA 4OF0A 1MQ8A 1EHLH 4NO3B 5F8QC 2GSGA 3MPCA 3PPEA 5J9PB 3MOQA 1LE9A 1IEWA 2XIJA 3DI3B 1RZPA 3X1GA 2MNRA 4FJZA 1WAAE 5LNSA 2J6XA 5HR6A 4ZXBC 3Q6GL 3K0WA 1V0MA 3NDYE 4QRPA 5F1OB 3KBEA 3QXBA 4LP8A 1N82A 3HUJA 1CCZA 2P46B 3F5WB 1PEZA 3GFUA 3SCMB 2Y7MA 3CH9A 3BWAB 4L1TA 3MGAA 3UYPA 3AI0A 4BQ4A 4POZC 3GMPB 5B7YA 4PMDA 4DZAA 2J5LB 3EOOA 2KYIA 4R97C 2XWTA 4QTFA 4GPNA 1QNQA 2DQJL 3P5YA 1ETJA 4TNEA 3VXSB 2Z31C 3FMGL 4OZOA 4OFYD 1KBBA 3KPSD 4JMXA 2AEPH 1U3HD 2F7FA 4ZZFA 4GY0A 4BFJA 4JTRA 1YYLL 1TV2A 3VGGA 4KV5F 3KEHA 2V9RA 2C9XA 5DZNA 5H8PA 1IQWL 2QQQA 3VFNA 2YGNA 3CHCA 3D18B 1T21B 3W87A 4LU5L 1JCMP 1ES0A 1RUKL 1WNOA 3R0NA 5GGSB 2ZOXA 1W17A 2B0SL 3URQA 2CLFA 4HIJA 4P2QE 5EOTA 3BSGA 3SJVD 5C0RL 3ONBA 3MXVH 2QCNA 1A25A 2JJUA 3AUWB 4R83A 5HQEA 3R43A 1UR4A 3C5SB 1NCIA 1FNHA 1N6VA 3U0TB 3WY4A 5INCB 2J7BA 1AGDB 3GK8L 4NC1E 2ZZUT 2VDRL 1QHZA 4B90A 4FQCL 3CEUA 3QP3A 2NDGA 4Z77A 1DFBH 2ZVIA 1KBPA 3QQ9D 1KT2A 3TN0D 5TD4A 2EXSA 4W9JC 4QWWD 2V2HA