4PCTA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 161
structure length 438
sequence length 438
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4pctA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pctA01
4B15A 4U33A 3WY1A 3BAYA 5E09A 4P7OA 1EGZA 3OIHA 3A3HA 3WNOA 3WBEA 2BHUA 4AZ6A 2FGLA 1GJUA 3N12A 1XGZA 4AD1A 1QI5A 1EQCA 4KRUA 5A6BA 1V6YA 2E9BA 1BPLB 2D3LA 1ISZA 4UFHA 1PZ2A 1OD0A 1V02E 3BUIA 9CGTA 1DWJM 2E4TA 3DX1A 5ABEA 4AD3A 1ISXA 1QW9A 1HF6A 2XVNA 4NZCA 4IPLA 2E8ZA 2QMJA 3PZVA 5I78A 1H3GA 2ALWA 2W92A 3QHMA 4W88A 3KEHA 3VO0A 5C8BB 3M6DA 4A3YA 1AVAA 3MANA 1IT0A 1FA2A 4CD4A 4ATWA 3CHDA 3T0DA 2VX7A 2BHYA 2Y2WA 4V2XA 4HOXA 3L4VA 3CH9A 1UD6A 1K9TA 3TV8A 1QBAA 1LL4A 5JBDA 3MU7A 3CZGA 4JFSA 5CSUA 5A6JA 5FL0A 3GDBA 3AIUA 1E0XA 4JZ5A 4RE3A 4L4OA 3SCQA 1EHNA 2EQDA 2Z1SA 3WDIA 1KCLA 2WMFA 2XYLA 4M29A 3UG5A 1VFUA 1UQZA 1SMDA 1U33A 3VUPA 5DT5A 1G0CA 6TAAA 2VZTA 2WHMA 1HIZA 1E56A 3VD3A 4GO9A 2CESA 4Z2HA 4AYGA 1FH7A 1VF8A 1UASA 3S5YA 3QGVA 4PMQA 2F1AA 5HOSA 2J75A 3HN3A 4MNMA 4TX8A 3IJ9A 2XTKA 2X0HA 1XH1A 4UQCA 3LPFA 1J01A 1CXLA 4NRSA 3HMCA 3SUUA 4GZIA 1QHPA 3A24A 3KL3A 1MYRA 3G6LA 4FNQA 2PWEA 4Y7EA 1QPKA 1XD1A 3DDFA 4CN4A 1BYAA 1TE1A 3VIKA 1V3JA 2WHJA 5IDIA 3VIMA 3VDHA 1AMYA 2DSKA 3SCPA 3MV11 4FLOA 4IUGA 3BVXA 4NSBA 1NOUA 1OT2A 2CETA 2QHAA 2X1IA 1G5AA 2Y8KA 2X2JA 1JD7A 2ZX5A 4V27A 1CXHA 1UKPA 3WY3A 2ZX9A 4MB5A 3TP4A 3L4ZA 1J0KA 3WH6A 3NDYA 3TTSA 2EPLX 1J10A 1HJWA 1JDCA 4QP0A 1WZAA 3HJEA 1KR0A 2CEQA 3IJ8A 4TTUA 4W89A 1QHOA 1OCQA 2PBOA 3BUPA 3RM9A 4UFLA 3G6MA 3W6LA 5M5DA 1GUVA 3M7SA 2PBGA 2CHOA 1GQJA 1H49A 3WQVA 4BS0A 5EFFA 3AXXA 3BAWA 2RGMA 4D1IA 3MMUA 2DH3A 3T09A 3AS1A 1K9EA 3AHVA 1JZ5A 1JI2A 3ALFA 2X09A 3NUKA 3TTQA 1UR8A 3N9KA 4Z2KA 2G41A 3LPGA 5BXRA 4MJ4A 5IFTA 3DX4A 3BVTA 2D73A 3WNMA 4QDMA 3GNPA 4QLLA 3VIGA 2XSBA 1TQTA 3GXMA 2DT3A 3AXIA 2XG9A 1UHVA 4BQ3A 4J3SA 3AOFA 3CUHA 5A6AA 1UG6A 4UFKA 1VENA 2YL9A 3WQWA 3GBEA 4WF7A 2ZX7A 4GQRA 7TAAA 4W7WA 2EBNA 2YL8A 2XVPA 5LA0A 2ZX8A 2VCBA 1GNXA 4UOQA 3FAXA 3CO4A 2XFFA 2WYSA 3PZ9A 5C71A 1XYFA 3CBWA 2WKGA 1E4MM 2UY3A 4JKLA 2VL4A 3A4XA 4MNKA 3VKKA 3WEOA 1GCYA 1V3KA 2AAAA 1W2VA 4JL2A 3L2MA 5I24A 2A3HA 3AMGA 3WD0A 1C7TA 4OGZA 3WUEA 4CUCA 1SYTA 2EXOA 3WDPP 3L4TA 3LRLA 5GPRA 1GOOA 2W91A 5FIPA 3BGAA 4HMEA 2YDQA 4ZXOA 3RIKA 1R47A 4KGJA 1JZ7A 3OG2A 4W5ZA 1CGTA 2YDRA 2WCGA 3MSDA 5E6YA 1L0PA 4M1RA 1JNDA 4ACZA 3WQ8A 1M01A 3FHAA 4M24A 1E72M 4FNTA 4FF5A 4HA4A 1AQ0A 3MO4A 1QNQA 1C3FA 4OOZA 3EBVA 2A3EA 1CECA 1H0GA 3WUBA 1WDSA 3WL1A 1DWGM 2C0HA 1BAGA 2VT0A 1B3WA 4AD0A 1Z32X 4GI8A 3UR8A 2G4FA 1TVNA 1X6NA 3CHFA 2GVYA 2ZUWA 1B1YA 2FH6A 3U5UA 2XM1A 4KGLA 5DFAA 5A6BD 3N04A 2ZUVA 2F8QA 1DWAM 1CWYA 1HX0A 2FGZA 1TQVA 3OBAA 2VQTA 2XPKA 5BRPA 1JNEA 1TQSA 2J62A 2VTFA 1B3XA 3QOMA 3GH4A 3WDRA 1TMQA 3WF3A 3ZR6A 2VC9A 5E1QA 1E70M 3VD4A 3T08A 2VX5A 3PHAA 2W5FA 5A8NA 2DPEA 3B9EA 5ABFB 4DM1A 5A3HA 2D0FA 4ATDA 3CGTA 4PTWA 3WDHA 1HKKA 2ZUTA 5I5RA 1KGWA 1W9VA 3WD4A 3LRKA 4X9YA 1B3VA 3ZSTA 1K9FA 1JL8A 1JFHA 5BXTA 1V0LA 4PSPA 4EK7A 1FHDA 2UY4A 3AIRA 4UFJA 1EDGA 1V3HA 2GDVA 2CCRA 4MADA 1J0IA 1UWSA 2DIJA 2Y5EA 3WENA 2HISA 1FHLA 5HNNA 3BSHA 1X6LA 1UWUA 2J8GA 3CUGA 1M7XA 6CGTA 3HG2A 5AY7A 8A3HA 1UR0A 3PZTA 1Y7VA 2YKKA 4HOWA 3MMDA 4U5IA 4WSJA 5C70A 1XYZA 2J8FA 7A3HA 2FHCA 3CLWA 3SUSA 3ARZA 1XSJA 4YHEA 2XFRA 1E6ZA 3A6OA 1BGAA 1MWOA 1EQPA 1KXTA 5CLWA 5E6ZA 2CBUA 2CITA 3VTRA 3WF4A 4TX6A 2GFTA 4F79A 4AMWA 1R75A 1FP9A 3W38A 1UYQA 4OIFA 5A69A 1CLVA 3DX0A 3AFBA 4PCTA 4CGTA 3WUFA 3VIHA 4BQ2A 1RPKA 4PN2A 1J0JA 4AIOA 4JKKA 1QNPA 2X8RA 3BCDA 3HU7A 3WUGA 1HKMA 2DSVA 3H53A 3A23A 1IZJA 4EE9A 6A3HA 4HPHA 3VGEA 2J7GA 1HJQA 4UTFA 3LXCA 1W3LA 3EYPA 3W82A 3MV01 3BAIA 4QLKA 2WWDA 4BZYA 4PBGA 3DHPA 1HJSA 3MMWA 1HL8A 1R7AA 4MTVA 3ZR5A 1E6XM 1EH9A 5A8QA 3ARSA 3F5KA 5A2BA 2J74A 3AYSA 1UR2A 3QR3A 2BXYA 5CPQA 1PIGA 3D4ZA 3SIMA 3BAKA 3CC1A 3JUGA 1C8QA 3ZM8A 2JALA 3I3DA 1UD8A 1KBBA 1HP5A 2J4GA 1ISVA 1QVBA 4H04A 1JG9A 1HJUA 2J78A 3VSVA 4QCFA 1C8YA 1GOMA 3S2CA 3WMSA 3AHXA 5FKYA 4U2YA 1E4NA 2PWHA 3DYPA 2NSXA 3SCWA 5EB8A 1V3IA 3FHQA 3OGSA 4R27A 2OYLA 4FNRA 1MW3A 1LF1A 2GDUA 3O2LA 4HMDA 3WNLA 4ZEPA 3ARPA 2X2IA 2WW5A 4PTVA 2XN2A 3AMKA 3AZRA 4TOQA 4BA0A 1GOQA 1GQIA 1H2JA 4HU0A 2ZE0A 3POCA 4TTGA 4FLQA 1KXQA 3A21A 1JDAA 4UQDA 1SR0A 3W29A 2OYKA 1B9ZA 1PX3A 5A8PA 1VBRA 2HVMA 2EEXA 4H8UA 3IANA 5IFPA 1O7AA 3ZJKA 5LA2A 3UERA 4PMRA 4OBSA 3L4WA 3NYDA 1MW2A 4PCSA 2GK1A 4W7VA 2DDXA 1TCMA 5CPSA 1W3JA 3BUDA 5I3DA 2WXDM 3VVGA 3EJUA 1ECEA 2FH8A 1HNYA 4KMQA 4DO4A 3AMCA 1E5JA 3N17A 3VPLA 1R86A 3WH7A 3UEQA 5DF0A 3FW6A 5HBFA 1PZ3A 4Q7NA 5FCZA 4UQ9A 2JIEA 2PWGA 4P8UA 4TVUA 5BRQA 4P7RA 1UR4A 2E9LA 1QX1A 1PS3A 3ZJ7A 2C7FA 3PTQA 1EXPA 1E3XA 4W93A 3CHEA 3AI0A 2D23A 4MNJA 4P8XA 3ZMRA 4DWSA 3THDA 3T0AA 4ZXLA 1NP0A 4QCEA 3NJ3A 5A6MA 3OZPA 3OB8A 3RJYA 1NQ6A 2GSJA 1C90A 1EDQA 1QI4A 1M03A 3WNKA 1DEDA 3VX0A 5A1AA 3BMVA 1VAHA 4GINA 1WAWA 3W53A 3SCVA 3VMNA 1BQCA 1E1FA 3RCNA 1V3LA 1BGGA 3GH7A 1E0WA 1C7SA 3TTOA 2C8NA 2XM2A 1MQQA 3AJ7A 1OM0A 2WHKA 3PZUA 3VDAA 2F7PA 3NCOA 1E6SM 4PMOA 5FOOA 1G94A 3VM5A 2YBUA 1D7FA 1JYNA 2OW7A 3IK2A 2XFYA 5FD0A 1TA3A 3CV5A 4N0RA 1UA3A 1QHZA 2VCAA 3AHYA 2YLLA 1GVIA 3N11A 3EDEA 1LL7A 4UOZA 4AY1A 4M80A 4WSKA 1W3KA 4AD4A 1KXHA 5CLTA 1OT1A 3GXNA 5TD4A 3A4AA 1WP6A 1X1NA 1OINA 2PF0A 1LJYA 1B0IA 1HJXA 4L4PA 1C8XA 3MUY1 2J79A 3T0BA 4FLRA 2WVVA 3MKKA 4P8VA 1DWHM 4J7RA 1CIUA 2BY0A 3HG3A 2CXGA 1SMAA 4LYQA 1WO2A 5HPCA 4WIWA 1FP8A 3WD3A 4P7LA 3K4DA 3WEMA 4CVWA 3N1AA 2WVUA 1LWHA 1V6WA 2XN0A 3GXFA 3D5HA 3KLLA 3ARQA 3H55A 1JYXA 1DP0A 3W81A 4H41A 2V3EA 1TR1A 1ZB5A 3S5ZA 2YLAA 3VOCA 1BTCA 3W4RA 2IUZA 4AIUA 3SUVA 3SUTA 3WH5A 2Q8XA 3ARVA 1EOMA 1VRXA 4OUEA 4JFWA 3WBAA 1JD9A 2G3NA 5E70A 1U2YA 4LGXA 1S46A 2DEPA 3IGUA 1TVPA 2Y24A 5JBFA 5I77A 2F61A 4HTYA 4AMXA 1JZ6A 4D6JA 2XSAA 5CPTA 3S6TA 1IZKA 2FDMA 4ML4A 1OIMA 3SUWA 4XV0A 4D6EA 4U5KA 3L2LA 2VRKA 3VGBA 1IV8A 1JF5A 3J7HA 3N13A 4IM4A 4AZBA 1UD3A 2YJQA 5CJ5A 3CZSA 3WL0A 1Q6FA 4RE2A 4YPJA 3EJSA 5D4YA 2VCCA 3TTYA 3RMEA 3W37A 1KB3A 2YFNA 3VIOA 3BUBA 2BVYA 1JZ8A 1ZL1A 5D9OA 2WVSA 3AIEA 5D9PA 4GI6A 2NW0A 5HDRA 4JHZA 2DIEA 1VBUA 4AWEA 5CXPA 4ZFMA 2X0YA 4DM2A 2XIIA 4XZBA 4A4AA 1R46A 3WNPA 4CKQA 3ZSSA 4PMZA 5ABFA 1HL9A 1QNSA 1VJZA 2WC3A 4NX0A 2XWEA 1JI1A 4W84A 5E0FA 1LL6A 4ZENA 2IGTA 3BAXA 1J12A 1TG7A 1XCWA 2O9PA 4OOUA 1BYBA 2VZVA 1KWGA 2X2HA 1HKJA 4OKDA 1HXJA 2WSPA 1VEPA 3E1F1 3HZ3A 3II1A 1RD6A 4OZOA 3PZIA 2BXZA 1GOKA 2ZUNA 4W8BA 2PWFA 4NZJA 1BLIA 3VU2A 4HU8A 2FHBA 3WF2A 3BSGA 1VFMA 1YHTA 4ZE4A 1OGBA 1H4PA 4AMCA 4U3CA 4DO5A 5A8MA 3VDCA 1EIBA 4AZCA 4W87A 2YDSA 1BYDA 3D52A 1KGUA 4J3UA 2WB5A 2TAAA 2CIPA 2E9MA 1LG2A 4PRWA 2ZOXA 1JXJA 3ZIZA 2FE0A 3LRMA 3LXAA 4PUDA 3ZT6A 1V6UA 3AZSA 3AROA 4W7UA 3TA9A 1W1VA 4URIA 2VVSA 5IXEA 1R7OA 4LYPA 1CYGA 2O9OA 3NSMA 4ACZB 3WY4A 3PTKA 1WZLA 1UD4A 2VNCA 1B31A 4WK9A 4ATLA 3VGFA 1R8LA 4FK9A 4HMCA 4FNPA 1NWSA 1E15A 3GM8A 2WBKA 4GPNA 5M03A 2EJ1A 4D6IA 1WE5A 3IJ7A 3AS3A 2W62A 2WWCA 3LMYA 4S3KA 3TOPA 4R5EA 1Q6DA 3AZTA 4M81A 3BVWA 4F66A 1XSIA 4PMUA 3BLKA 4DWSC 1ODZA 2WMHA 3F5JA 2XN1A 2QPSA 3BC9A 2D0GA 1ZJAA 4JAWA 5M3WA 3CUFA 3W25A 1W3HA 1LQ0A 1QOXA 1JZ3A 1EO5A 5I23A 3POHA 2UWFA 2VX4A 3ARXA 1CDGA 2PWDA 3KL0A 1HN1A 2V3DA 2J7DA 3VIIA 3W26A 2GJRA 3B9AA 3I3BA 4W86A 1UWIA 3LX9A 3WDJA 2D2OA 4CU7A 5A8OA 4M56A 4Q22A 2D0HA 2G3MA 2VZUA 3M46A 4N42A 1CNVA 1VFOA 1VEMA 4W85A 4D6HA 4J28A 1CXFA 2VR5A 1GORA 3QOKA 2BV9A 3CIVA 4NF7A 1ESWA 4DWSD 5JIWA 3UETA 3OLIA 4E4PA 4NZFA 3VSUA 1VFFA 4YHGA 3CZEA 2BFGA 3EJRA 4MB4A 4C7FA 1V6XA 2DSUA 1CGWA 4GKLA 2XUCA 4Z2JA 1HVQA 2WPGA 2WK2A 2UY5A 3BUQA 1ISYA 1JIBA 3AS2A 4OJYA 1XH2A 4J27A 3AHTA 1MFUA 2XVKA 2VURA 2O9RA 2QMKA 4HPGA 3NSNA 5AC5A 4PUEA 5GNYA 2J7EA 3LPPA 4Z2LA 1MQRA 4MDOA 2CERA 1HP4A 3WEZA 4JFUA 4AISA 2CBJA 1ZBCA 3RDKA 2CYGA 3CPUA 1E40A 3AYRA 4TUFA 1UOKA 1D3CA 4F8XA 1UD5A 4GZEA 2BHZA 5IHRA 2D1ZA 3F5LA 2OLHA 3EMCA 5DO8A 1UKOA 1J9YA 2JF6A 1JFXA 5I2UA 1GZJA 1LG1A 2GJXB 4B3LA 1UR1A 2J7BA 2GK1B 1Q4NX 1PIFA 5D8WA 3BVUA 2F7QA 2JEPA 4AC1X 4XB3A 4D6FA 1E5NA 1H41A 3SCNA 5IHSA 3VD9A 3MUZ1 3WIJA 3AMLA 2EABA 1TFVA 3U7BA 2AOSA 3EMQA 3EDJA 3VNZA 2W67A 1J0HA 4JL1A 5D9MA 4J3VA 3ZT7A 4CN6A 2BS9A 3U5YA 1M04A 3WFZA 1E1EA 2WBGA 2ZUMA 3MUAA 1JGIA 3T2PA 2DQXA 3WSUA 4AZHA 4ACYA 1EDTA 5CQ1A 4DO6A 3VDBA 2OSXA 2YBTA 3D51A 3ECQA 2E0PA 1NWUA 2WANA 3L4YA 3AS0A 1NOFA 3H54A 2WLYA 1WKYA 5FL1A 1MXGA 1GQLA 2ZUUA 2V5CA 1NWRA 1FH9A 3U57A 1V03A 7CGTA 4BQ5A 2WMGA 3A22A 2WLZA 2ZX6A 1OBAA 3GNOA 1P6WA 3WKZA 3RM8A 1N82A 3EMZA 2EO7A 3IAQA 1FFQA 4PEEA 1CGUA 1OD8A 1UWRA 3WF0A 1GONA 3GBDA 2XHYA 2B31A 5BROA 2OWCA 3KLKA 3GXDA 5JUVA 1C91A 4KWUA 2DSWA 3BVVA 3WFLA 4MNLA 4D72A 2VRQA 3GTNA 1B3ZA 3AISA 3B9DA 4A3HA 2JIWA 4DUXA 3ARUA 4WKAA 3FXYA 3PZOA 4WJXA 4IISA 3VIPA 4BQ4A 2J77A 1PX8A 1F4AA 5A6LA 1QW8A 2D3NA 1HXKA 4JCLA 2CPUA 4AZIA 1O7DC 1H0IA 1E71M 2GUYA 5GNXA 2WZIA 4BF7A 5CG0A 3KL5A 4TVCA 5EMYA 2A3BA 3W28A 3GXTA 3UESA 3O9NA 2DH2A 4AW7A 5E0CA 2XVLA 4MJ2A 4UCFA 4CD6A 1KQYA 5F7UA 2YFOA 3ARTA 4H7VA 1XV8A 5BXPA 4CN1A 4B16A 4Z2GA 2YA2A 3EDDA 4PTMA 4UZSA 2CBIA 4AXNA 1RP8A 5EBAA 4HA1A 2MANA 3HG4A 3AQUA 1WPCA 1JF6A 4U31A 3OLGA 3VM7A 1TQWA 2A3CA 4AZ7A 2BNJA 1HT6A 5M17A 1UA7A 4M8UA 4D1JA 4EKJA 3FN9A 3GXIA 3WF1A 1WDQA 1UWTA 1WZMA 2EPNA 3CZJA 3K1DA 3WNNA 1US3A 5D9NA 4S3JA 3BLPX 4KH2A 4MPKA 4P8WA 4NXSA 2D24A 3KWXA 4EAMA 1CGXA 1CPUA 4QAWA 4D71A 3W6MA 1V0KA 4CCCA 1OWQA 1E6RA 2E3ZA 2WNWA 2D22A 3RPMA 1A3HA 4B3KA 4GZJA 3UR7A 2O9TA 3FNDA 2FHFA 1YQ2A 2ZXBA 5BWFA 1QNRA 3GZAA 1CBGA 3RILA 4UQEA 4IPNB 3NIYA 5ECUA 2E40A 3ZOAA 4NI3A 1OB0A 1R34A 1PJ9A 4J3XA 3EDFA 2YOCA 3CUIA 3VMOA 2X05A 1M53A 3K8KA 1KTBA 2VO5A 1GOIA 3VGDA 1WCGA 1BHGA 3WELA 3DYMA 1ISWA 2YIHA 2F7OA 1VEOA 4UFMA 4FLSA 2XGBA 5DMYA 3WQ6A 2CNCA 1W2PA 1HWWA 2ZXAA 5HPOA 3FY1A 3VSTA 4GI9A 1JYVA 4TVDA 3WQ5A 1LWJA 5I0DA 2XGIA 4F9DA 2VZOA 1EO7A 1OSEA 1W9XA 1HVXA 1OIFA 3CHCA 1V08A 4MB3A 3DC0A 3PZGA 1I1XA 4DWSB 1JZ4A 4JCMA 1UR9A 2WMKA 1UZ4A 4D6GA 1E6NA 5CZKA 2FYVA 3A47A 2PB1A 3D3AA 4WLCA 4UNIA 5I79A 1TZ7A 5EFDA 4HA3A 4HOZA 4D6DA 2XJ7A 1GHSA 4MDPA 1JAEA 3D4YA 3AIWA 4UOJA 4CD5A 1J0ZA 2BY1A 1E43A 4MB1A 3W0KA 2ZWZA 3OLEA 2ZWYA 5CGMA 1JDDA 2JF7A 1NP2A 3PZNA 4UFIA 4CVUA 4C7DA 4YN5A 3M07A 3WH9A 1GPFA 2F7RA 4KRTA 1ZBKA 4K68A 5JBEA 3CTTA 3SURA 2F18A 3VILA 4HZ7A 1E9LA 4QLJA 2AMGA 4JFTA 3W27A 3VGGA 2V3FA 2DT0A 3SCTA 1E6QM 2DT2A 4HZ6A 5KEZA 1I75A 1XHGA 1CXEA 3AIBA 1HKIA 5GQBA 3SEPA 3ZT5A 2RGLA 5E9AA 1AQHA 1HTYA 4EANA 3T2OA 4UQAA 4CCDA 3F4VA 3K4AA 3K46A 3VD7A 5CGTA 3CMGA 1KFWA 1PBGA 2WHLA 1G01A 4B9YA 1BF2A 1ZU8A 4CD8A 4PMYA 4MAZA 4NXKA 3N18A 1J18A 1MW0A 3O6AA 3K8LA 4M82A 3RM4A 2J7FA 5LYRA 2ZXDA 2PC8A 4E8DA 3VNYA 1AQMA 1J11A 1BFNA 1ZS2A 4LQ1A 2CKRA 2XVGA 3CZLA 1UH2A 3BXWA 1V6VA 1UUQA 3WD1A 3EJPA 4P7NA 1VJSA 2J7HA 2VX6A 4GXPA 1R85A 3I3EA 2IXUA 4BCEA 5ABHA 3PZQA 2D20A 1GHRA 3AIQA 2GJPA 5HXMA 8CGTA 4WKFA 3FAWA 1XRVA 1W32A 2WSKA 2WVTA 2G3IA 3A4WA 1E55A 1W1TA 2EPKX 3ZJ8A 1H1NA 5ABGA 1V02A 3UG4A 1TUXA 2VRJA 1ITCA 1Q6EA 4X0NA 3APGA 2WCAA 3SCUA 4PYSA 4LX4A 1QWUA 5A2CA 4V28A 4XX6A 1JZ2A 2JEQA 3DYOA 3WY2A 5D8ZA 4AZ5A 2VMFA 2WMIA 2ZUSA 3SCRA 2WCSA 2EAEA 1NOWA 4AD5A 1L8NA 1NWTA 3MUIA 1E4LA 5BXSA 2WZHA 5AC4A 1W9PA 1GOWA 2XIBA 2NT1A 3VMPA 3MI6A 1BYCA 4PMVA 1ZBVA 5CSYA 2JE8A 3ARRA 3LPOA 1R33A 3AXHA 4P7QA 3OLDA 4QFUA 2EADA 3W24A 1A47A 3WD2A 1H11A 2QPUA 4PMDA 1US2A 2WMJA 5JIPA 5A94A 1B30A 2WC7A 2OSYA 3EDKA 4WKHA 3WMCA 3BAJA 1LLOA 4Z2IA 5I6SA 3VINA 3WH8A 2VI0A 4TXEA 2V5DA 1GJWA 1WDPA 5DT7A 1W9DM 1U30A 1XSKA 4JIEA 1E0VA 3GXPA 1D2KA 2OSWA 2VUYA 4HP5A 2VR4A 2QLYA 3ZJ6A 1CTNA 2OW6A 2YL5A 3WMBA 2UY2A 3N15A 1KR1A 4RE4A 4AIEA 1UD2A 4AEFA 4CD7A 1XCXA 2ZXQA 1PX4A 4W8LA 1G9HA 2F2HA 2EPOA 4GO8A 5A6KA 2PI6A 2OYMA 3VGHA 3SCSA 3VD5A 1MXDA 4LPCA 4UQBA 2W4XA 1DWFM 3BH4A 1B90A 4DUWA 2YA0A 2XWDA 2A3AA 3AMDA 5DEZA 4MAVA 5AYBA 1NARA 2YA1A 1QI0A 2V3GA 1XC6A 4X0VA 1V0NA 4DUVA 3PN8A 3DHUA 1UH4A 3EJQA 1DTUA 4PTXA 4U3AA 2J25A 1F4HA 1R87A 1BG4A 1H09A 3LXBA 2JFEX 1FFRA 5BCAA 1KQZA 1B2YA 2WC4A 1CLXA 2J7CA 4C7GA 1RH9A 1RP9A 5BYWA 3BMWA 3WN6A 1UKSA 1QNOA 2GJXA 2DT1A 2NT0A 1KCKA 2VQUA 1PEZA 1XH0A 4PSRA 4UR9A 3ZO9A 3CZKA 2CKSA 1ODUA 1UH3A 2BY2A 3ARWA 2Y8VA 3NDZA 3OZOA 3NSXA 3GH5A 1B3YA 1UKTA 1ZBWA 1EHAA 4E8CA 1BSIA 2WM0A 1KBKA 2WMIB 2WZEA 4LYRA 4JHOA 2WVVB 1K6AA 1CXKA 3RO8A 2VJXA 3DDGA 1WNOA 4AZGA 2IXVA 2QF8A 1MW1A 3OGRA 1O6IA 3BCFA 3UG3A 5A95A 3ZQ9A 2CBVA 1DHKA 1UKQA 4W5UA 2VZSA 1PPIA 1JXKA 1BVNP 1CEOA 3IAPA 3CMJA 3OGVA 4LXFA 2WKLA 4CU8A 1E3ZA 1E73M 2BVDA 1UWQA 1TA3B 5GNZA 2DSZA 4CCEA 1EOKA 1Q6GA 2BY3A 2BVTA 1GVYA 4H8HA 5AYIA 1OGGA 1UZ1A 2E8YA 3VIFA 2VOTA 2Y4SA 3MSGA 3CUJA 2CHNA 3VX1A 1SFSA 3EJTA 4JFVA 2J47A 4RL3A 3QHOA 4F9JA 1CZ1A 3GNRA 1V3MA 1T0OA 1JAKA 1E6PA 1FH8A 4JKMA 1GQKA 5A6SA 1OGSA 2EPMX 3SCOA 2W61A 2O92A 3U7VA 5A2AA 1KGXA 1MVYA 1CGVA 1KWKA 4U2ZA 1H5VA 3CZ8A 5LA1A 1QI3A 1W1YA 3A5VA 3THCA 3T2QA 2ZICA 1ITXA 2X2YA 3KZSA 1PAMA 1QI2A 1BG9A 4UZUA 3KE0A 2G3JA 4PMXA 1QBBA 2F1BA 1JYWA 1J0YA 1HJVA 4W8AA 1QWNA 4E2OA 4D6CA 2W66A 1MFVA 3DECA 1WDRA 1ZJBA 1VB9A 1FOBA 1W9BM 1WB0A 4OBRA 1DWIM 1SZNA 3ALGA 3AICA 1C93A 1V0MA 4XUYA 1EA9C 3AIVA 2QV4A 3WDQA 4GQQA 2YL6A 1CENA 3UCQA 1G1YA 1UQYA 3MS8A 3RJXA 3DX3A 4HZ8A 4H2CA 1BVZA 3CZNA 3GYCA 1XD0A 3TONA 1C92A 2EACA 3QHNA 4B9ZA 1MQPA 2V38A 2Z1KA 3PTMA 1CGYA 3VIJA 4XZWA 1WZKA 3HG5A 4ZE5A 3L4XA 4AD2A 3BLBA 2G8ZA 1W9UA 5KZ6A 4J3WA 3DX2A 3K8MA 1W91A 3PZMA 4AZCB 3ARYA 1NM9A 4FNSA 4AYSA 3B8SA 1KTCA 1K9DA 1VIWA 4AEEA 2ZIDA 4FMVA 1NH6A 3L4UA 4PMNA 1KXVA 1TQUA 2DGAA 1W1PA 3WQ4A 3AHZA 3PBGA 2VVNA 1Q6CA 4CU6A 2ESCA 1I1WA 3D50A 3OA5A 4J3TA 4FNUA 1E4IA 1GW1A 4NRRA 4GIAA 2OWXA 4H8VA 2W63A 1CXIA 2WAGA 2OWWA
chains in the Genus database with same CATH superfamily
1EJWC 4B15A 1PU0A 4U33A 3QPQD 5HJXA 5JH1A 3STBA 3WY1A 3C2YA 5E09A 2DLTA 4P7OA 3FSWA 1EGZA 4AX7A 3OIHA 2X9XA 3TH6A 2FB4H 1ZHNA 5FO8B 1I7TB 4ZD3L 4QRQB 3KMDA 3DJTA 3THUA 1XGQA 3L3IA 3ERPA 5D2XA 2EDWA 1U6AL 1A80A 1T04B 3HPLA 4LGPB 2G9HB 4QDGA 2BP3A 3GMMA 4QPEA 3L3OA 3QC3A 3M5XA 4B4HA 1BZ7A 4MM1A 3MGOA 5BV7L 1OO2A 3EJYC 3L5WA 1ZVNA 4LYKA 1JK8A 1OD0A 1D6VH 3WNIA 4FHAA 1E8WA 5HHQA 3N1QC 4GRLB 4ZTOH 4PBVC 1OY0A 1MWAB 4FI7A 4D2JA 1M7UA 5CSRA 3VFGH 4AD3A 5CGBA 2QQ6A 3MNDA 5CEYA 2N01B 4GAJH 4O02B 1MHHB 4YFLF 2ZE3A 4IPLA 3AWOA 4ZTEA 3UA4A 1FZOB 3PZVA 4JVUA 4KJWC 3ARDA 2AGTA 2VEGA 5I78A 2XX0A 3QHMA 1DXEA 4FOKA 3EEGA 4W88A 3TK7A 4UM9A 3M6DA 1SO6A 3UZXA 4QNWA 1AVAA 4YWIA 4A3YA 5C8BB 4F1SA 2AK4E 3MANA 3WEBA 3OGCA 4S39A 1OVZA 5FYJD 4FXGB 3S35H 4TQEH 2R8WA 5TDPB 1DVXA 1MHEA 4W9DC 3FMGH 4RE0A 1DANU 4M6MH 3T0DA 3O11B 4UT7L 2Y25A 3NJNA 2BHYA 2V5YA 5ACMA 4HJ0D 2Z4TA 4UT6L 2WV3A 1XLMA 1ZOXA 2AKRA 3DGBA 32C2B 4O2FA 1UD6A 4JPGA 1K9TA 2JCWA 5L4IA 5L88L 2EDRA 4ZPVA 2DWEA 1RLDA 5GRVL 4F3FA 4DNLA 1TQBC 2VN7A 3KLQA 3QQ9D 5JBDA 1NC2B 1TKWA 4JFSA 5DTFB 3IIZA 1A0DA 3M43A 4KF1A 4H01A 4R97C 3RVTC 2Z64C 1A64A 5FO7B 1BXBA 5A6JA 3KVPA 4XC1H 1MI5A 1VKFA 3AIUA 4PWGA 5KVMC 2QCNA 4RE3A 1UGKA 1BXXA 1XGPA 1P0NA 3UTSA 2OX4A 3O7UA 2EQDA 2GABA 2WBJD 5CEZE 5F89B 5HGAA 2BTMA 1OB1A 1PBYA 2X4TA 1KCLA 4LSVH 2WMFA 3INPA 1RIUL 2QQLH 3TBYB 2UV8G 1FNHA 4M29A 5EZOL 3UG5A 4N7QA 3EHBC 1HOCB 3SPGA 1UQZA 3UMNA 4F7MB 5T26A 2EIJB 1CK0L 3QP3A 2VDLH 3SBFA 2V7NA 4FP8H 4R2GC 4GAGH 1QO2A 3NURA 5AZ2L 5BS0A 4KFNA 2E47A 3NJGA 4M61A 2EG7A 3J2PA 5J8OA 3G5VB 1B6UA 4UDUB 3H6OA 4P99A 5T5FA 3DX5A 2QXWA 2IH1B 2MOGA 4LRIC 1YPZA 4ZAKC 1QRNA 4NZUH 4QHNA 2DM4A 4AYGA 2C19A 1YY9D 3V0WL 4XO3A 1YEYA 5GS1C 5DHYB 3S5YA 3SGUA 4PMQA 4EN3A 5IB1A 1ZK9A 2F1AA 2X5PA 5B3NA 1KD0A 4Q6JA 5E1AA 3NQ7A 3ULVC 3PABB 1S78C 2FYYB 2VLKB 2XV0A 4TX8A 5HJ3A 3L3DB 3NPVA 1FG9C 3UGVA 3QQ4B 2NQ9A 1AG1O 2XFXB 4W9LC 4BFGA 1XLLA 1TZIB 1BZEA 1FSKB 4JFFB 3UXIA 2UXFA 5DLML 3GO1L 2VIRB 3O4OC 2ZQKA 4L18A 4LLQA 1MFNA 2CLVA 1CXLA 1RZPA 5SWZB 4EIBA 4UM8B 1QO5A 1U1UA 3SUUA 4OZ4A 1D5IH 4G56A 2QCMA 4DCQA 3OOQA 4GZIA 4LAUA 5CCZA 1FZKA 1X98A 1KC5L 3FDWA 4AY7A 2PWEA 4UWMA 3E6FB 3ZTNH 5KSBE 4L37B 4OF0A 1QPKA 2IH8A 4EZKA 2QNEA 2VXVH 4CN4A 1TE1A 3TYZA 1FQ0A 1YEWA 2K45A 1FA4A 4MLRA 3QK0A 2LGNA 4DZBA 5AVZB 4P2VA 2YRPA 1C8PA 4TNWF 4JE4B 5CFHA 1CT8A 4G1EB 2GC7C 3Q94A 2I7OA 1RCXB 1TIMA 2R56L 2R14A 2HJLB 3N3TA 4AMAA 3M6YA 4J4PA 3WLBA 4AJWA 1I7ZA 3GXUB 3W2KA 5AL0A 1ZSXA 1XM3A 3OBEA 3BVXA 4OVXA 1I8AA 1OT2A 3OKEB 3O2DL 1OL0A 2X2JA 4V27A 3WTWA 4NNYB 3MZNA 1E4KC 1X38A 4TVPL 1YZZA 1UKPA 3BOVA 3BP7B 5FO9A 2ZX9A 3HAEG 3ILQC 3NCJL 3TROA 3ARDC 4OCSL 1J0KA 1XYLA 2R24A 4JD4A 5FK9B 3GB7B 2DQIH 3TTSA 2FB4L 2EPLX 2V8LA 5CILL 1HJWA 4H25A 3E5PA 4KWVA 3OKDB 1RZKL 2F84A 4APQA 2OTDA 4E41A 3QDGE 4ZTOL 2HYMA 5ESQA 2OL3H 1KR0A 4GYJA 3MLVH 2F6KA 1OLZA 4W89A 3RPBA 1ED3A 3ZHFA 4RDZA 4KKLD 3IARA 4A7SA 1NCWH 2R0ZH 3G6MA 4B5SA 4RNRB 4NOBA 5C0CE 5HR7A 5E2VH 1QCWA 1J8HA 1KXQE 2XQBL 3HI1B 3DGGA 4DGWC 3TF7C 5DRNA 1OG0A 5AW9B 2CHOA 1H49A 2C91A 2P88A 5D7IE 3HJZA 1WSST 3I10A 5T3ZL 5EFFA 4GISA 3PWNA 4MQSB 3SDYL 4CJ0A 1FWHC 2REQB 4Z7WE 2UZPA 3BAWA 4AENA 4F2ME 1OCRB 4YZFF 4D1IA 1T1XA 2H1PL 2ZZ6A 1BM3H 3T09A 4NWTH 3BP4A 3QEGH 3AS1A 4L4TA 1BZ8A 1IGIL 3DK0A 4ZOAA 2PABA 1K9EA 2H26B 1RJZA 2PDJA 3ALFA 4LQFL 1GC1L 3EHBB 4XOCA 4A6YB 3L1OL 1Z3NA 2O0TA 4JIHA 2W0LA 3HN5A 3H4GA 3LPGA 4MWAD 5KUKA 1OTTC 5D72H 4QHMA 4B5VA 1MCIA 3P77B 4GMSH 1IIHA 2P3EA 1S9WA 3BVTA 4DSYA 3KWSA 2VC2B 2D73A 3WNMA 4AQAA 3S88H 4RRPG 5D2VA 3GSNL 3SE9H 1REQA 5XIMA 3W7MA 2CJTA 1R3KA 3GSWA 2X70B 4X7DC 2DT3A 4EDWH 2AXWA 3HVNA 1QLEL 1R5VB 3RJDA 3AXIA 1JTOA 2DQJH 4U7KA 5E6RB 3CFJB 4E5TA 5LVEA 4EX4A 2J7LA 3IRSA 3H1ZA 1ADSA 2XG9A 4J1OA 4KRPB 5DVKA 3VQ2C 5I73B 3AB0C 4LHJB 2RBLA 4W68A 4QRSA 2O4MA 4O15A 3S1WA 5F2GA 1WUZA 1UG6A 1IJ9A 1VENA 1HEZB 3BT2L 4ELMA 4FN0A 5TH2B 1AE6H 2AXGB 3KXFA 4RFEB 4CKVX 3NPWA 4B2DA 3CUXA 1DSFH 3HG0A 3O06A 2J88L 1AGBA 1XF5B 5E03A 4LASH 3GBEA 1NFPA 3NQKA 4WF7A 1I0BA 4IDLA 4UV7L 5DC9B 4OD3H 4GQRA 2JJVA 5TPWL 3IVUA 3QVQA 1P69B 1K77A 4IIFA 2C9AA 3MRCA 2EBNA 5BZWB 5ABZA 2G97A 2JKIS 4N8PA 2YL8A 4EZLA 3RAJL 1MCOL 1VDGA 2EXSA 2ZX8A 3QA3A 5PTDA 4HAGA 4UOQA 1NMCC 3FAXA 3CYVA 3CO4A 1F2QA 4X0KB 3DKJA 2WYSA 3S1VA 4LCQA 3U2ZA 4N2GA 1E4MM 4ZZKA 3MKGA 5C6TH 2VL4A 3NIFF 4KRPD 3UYRH 4ELKA 3WEOA 4LEFA 4NN5C 5HY9B 2VN4A 2QDEA 2TRSA 4CNNA 2OXHB 1T0NB 3NH7H 1H0DB 5I6XC 4ETYA 1A4LA 2PTWA 4TQEL 3QCTL 4A7UA 1XEUA 3NJXA 4YEFA 3TN0C 3KW8A 3L2MA 2YD7A 1H8SA 4FHKA 4M62L 3T4AB 5I24A 2A3HA 3GVWA 2QCDB 5LBGA 3WD0A 1R5WB 4GRLD 2YPVH 4HXAH 4KNSA 3WUEA 4EDXA 2BP0B 3WGUB 1M1XA 2EXOA 4MWAB 2A38A 3WDPP 5BXFA 3S6DA 1GAFL 1ME8A 3O07A 1UCBL 1DVFC 3KVKA 2TSAA 2FT6A 2YDQA 4MDJB 2CA3A 2A74B 4QWWC 3RIKA 2APSA 2FEDC 4KGJA 4TULH 1JZ7A 2NY2D 2R69L 5I8EB 4FF9A 2XZ9A 4MCYB 3CCHB 3P84A 4FTVD 2YDRA 1AIFB 3DPBA 1OF8A 4TUKL 2WCGA 4GFSA 4MA7H 4ZW8A 1BM7A 4PI2A 4D9QD 5FYKE 3VFPA 3REQB 3MFFA 4Q4RA 2X4PB 3LCFA 1M01A 3V4UH 3FHAA 4ODSH 4M24A 1QRND 1R3LB 1DIDA 2BRRL 3OSVA 4JTUA 1W54A 5F21B 3WHE0 1M1SA 1QNQA 4OOZA 3EBVA 5IVXE 4OJFH 2A3EA 1GTHA 1CECA 1HIMH 3CPLA 4DGYL 2QVNA 4Z3JA 4KQNA 4XAWH 4LY8A 3NOIA 4F3HA 1W6WA 3LBMA 1AR2A 4GW1A 3U82B 4ZQKA 3NQCA 3HNTH 3OHXB 2CW6A 3IIPA 3FJ4A 4BKTC 3UW6A 5M2FX 2CLMA 1QD0A 3Q1EA 4DPRA 2X7LA 3C09B 4H26A 1X6NA 3L9RB 4JZJC 3UAEA 5DN1A 4U28A 2HPIA 1FORH 5MHSE 3RWCA 3M44A 5EN2B 4MD4A 2JI2A 3PNUA 4MSWB 4R8WL 4KX9A 1KIRA 1JGDA 1CI3M 1B1YA 3RYSA 3ABKB 3HQOA 1JGEA 3SN0A 4L8BA 5B3SB 4CADA 5J6HB 1YJDH 3UBXI 4H1LG 1Q9OA 3NZ8B 4PJAE 4YO0B 3KBJA 2AQ1A 2YD6A 4IS6A 5ANHA 2ZKYA 2FJGA 4KKAD 1DWAM 3MV8A 3QPYA 2MQ0A 5I8OH 1CWYA 1XR2A 1JMXA 1HX0A 3BUYB 3VWJD 3URBA 4KJQD 3KHDA 3IPBA 5HQEA 1ETZB 4P46B 2KZ1B 3B7UX 3IN2A 3O81A 2J62A 3NXLA 1T4WA 2WLIA 4L3AA 3U36B 4JFOB 3FOKA 4DEUA 1C1EL 2XXCB 3QOMA 4DK3A 5GS1A 3GH4A 3RZWA 3WDRA 4GA8A 3TU9A 3B9KB 3B06A 3BEWA 1F3JA 3TT3H 3ZDYE 2YWYA 1KV3A 1FWCC 2F54D 1E70M 3S2JA 3F7QA 3VD4A 4DOHE 4GMEA 2DY3A 4WWKB 1ZALA 3MRFB 1XCQA 3DMMD 2G75A 4IHBA 4F1ZA 4BZ1H 4UB0H 1XIJA 1ZENA 3GG1A 2Z24A 2KMWA 3PHAA 1BWWA 3NL2A 3IVSA 1N2VA 4DXVA 2NR6C 3MLYH 5F4WA 4W9CC 5C0GA 1TJRA 1D5ZA 1KBPA 3T4CA 5BOZG 4DLMA 2BC4B 1NGYA 3FKUS 1UZGA 2GQ3A 1UQSA 2YRBA 3LQZB 5TQLA 1RU9L 2CK0L 2XI9A 5U4NA 1G7JA 3S34H 1KYFA 1HXYA 5ABFB 3F7LA 3GWQA 2BSBA 4DP7X 4P2RB 4BI5A 1JJKA 1F4XH 4JKWA 3P11L 4PTWA 5DJ0B 2CDFB 3OJ2C 2WOYA 4W9HC 2XWBA 1P1VA 4WJ5B 3L3JA 4QHLB 3BQ5A 1C8VA 4WFED 4Z7OF 3W74A 4LK4A 5I06A 1IEAA 4H0GA 4TNWK 1W5NA 3EH4B 1W9VA 5F7DB 1A6TB 1YEJL 4GG8A 4W4NA 1Q0YH 3WCYA 1PIIA 4AZ7A 4LSRL 2X1SA 4PSPA 3H9HB 2VGBA 4O4YL 2XKNA 1EDGA 5FYJE 2X6CA 2DQUL 5EIIA 4LV4A 4MADA 3ME0A 5C55A 5FHAH 2FKPA 3E49A 3JWNH 3MLTB 4JTFA 4G8GA 3S3CB 1A1MA 3P3TA 3LZFH 3MRLB 3QZWA 4HSNA 3WENA 2OT1A 5G2IA 1XLJA 1FHLA 3CHPA 2O26U 1HH9A 2Z35A 4YFDB 2HISA 3P2VA 3BP5B 5JW5A 2R1YA 4YLCA 4HU3A 5LGZA 1OTSD 3OHIA 5KITA 2APVA 3EWBX 1KPVA 3CUGA 5E5UB 5DHVB 2GAZB 1IGMH 1N59A 4OCRL 5KYNA 3ITOA 2I60L 1NBQA 5CIPB 1TV7A 1GG0A 2WLKA 2DMBA 2X89D 4YIWA 3JTSB 4TKWA 4YBLB 5FKAB 1KUMA 3IMRA 5TK2A 2NY6B 2YLKA 2YKKA 1K7XA 1PD6A 3PUDA 4A8NA 4J3ZA 4MJ6B 1F7BA 2P5PA 3KCPA 4JFQB 4U5IA 2AL1A 1XYZA 3P02A 4QS6A 5D7IB 2GFBA 2FHCA 4XNQB 2Q8AH 5HI5C 3SUSA 3RWGA 3FA5A 3FFSA 2D4DA 4K3ZA 2NNFA 5A43C 1EEZA 1T5XB 3U46A 5FV2A 2RFXB 4P2QB 1OADA 2QSCL 1BGAA 1JGLH 4OFIA 4AEIL 1B6DA 1FSKC 1YMMA 2Z8RA 5C0ND 4IPPA 3HI6L 1LT7A 3IWVA 4GYPC 1GKQA 2CBUA 5AC7A 2QQQA 4J8RA 3JWNC 3RVUD 4ZTPH 4P59L 3UR8A 3VKDA 3WF4A 5DRWB 3DLQR 3P62A 1JV5B 2Q09A 3QF0A 4N02A 3P8IA 1LP9B 2MCPH 3OKYA 1SDYA 2VXQH 4F7CB 3FQRA 5JDJA 3RZCA 2IPJA 4RLDA 5G2WA 1HHGA 3P2BA 2H3KA 4ETQB 3MPGA 4F79A 3R0KA 2C3VA 3K4ZA 2HTMA 1WIUA 3OHMB 3UYRL 1FP9A 3W38A 3NN8B 3B5HA 3MYOA 2HLAA 4EVNB 1RR2A 1CLVA 1G6VK 3AFBA 4S38A 4PCTA 4CGTA 1Q65A 2J8UA 2MCMA 5IWLA 1SOQA 2IG2L 1SFDA 1QDSA 1VLWA 4PJFF 4BQ2A 1MY5A 2VN3A 1J0JA 5D1ZB 2I07A 4KXBA 3PHOB 1BAFH 3BCDA 4NQED 4AIOA 3WTVA 1QNPA 1SZRA 3P8JA 3EH1A 3FF7A 3WUGA 1IBYA 4IMFA 1CBVL 3G08A 1F58L 2W9DL 4K7PY 4KXZI 4MVBC 3A23A 3LKSA 4ONFL 3UTTA 1SZEA 4M0XA 2YRLA 1U5VA 3QYNA 1L0XA 4HPHA 1LE5B 2GZXA 1AP2A 3Q1SL 4NPYA 3G22A 3VGEA 5FIEA 3RDTA 1WKFA 2J7GA 3PL6B 1MRQA 3KPOB 5E51A 5FS5A 4OUUA 3BH9B 4HBCH 4PREB 5CZVH 5I26A 4RDBA 2V5SA 4BFRA 1OYBA 1XLEA 2X41A 3EYPA 1YPZE 2K78A 3B3BA 4X9BA 5KYXB 3NRFA 2WWDA 4BZYA 5DXYA 4RMBA 1XRSA 2X3BA 1TKKA 3RHGA 2W94A 4BR1A 3QZOA 4HSAC 4ZUVB 3ITYA 1HL8A 4UIMA 5IVOA 2DQTH 4P07A 4DP1X 1DXFA 2MJWA 5EUOA 1Q6LA 5AW6B 1Q66A 4AKPA 3OAZK 3MRDA 3GGWA 2IBZY 1EH9A 4ZSOB 5HSFA 2DZPA 4PJ5A 1V7AA 1XG3A 3DEQA 2JB5H 2R29A 1GZGA 3ARSA 4UQIM 3F5KA 2YXOA 1GGYA 2NSQA 2J74A 3DURA 4EUPG 2R1PA 3D39E 2CQVA 1QRQA 4OCMC 2ITCA 1ONQB 4ORZC 5D7LA 4NILA 5ITBH 4RGOH 5CPQA 2BCKB 1OOAA 1DYZA 1PIGA 3C5SB 4G8GD 1U36A 4P9MH 5IHZB 1K3UA 2WP3T 2NXYB 3GEFA 3F6JA 3QUHA 3K6SB 1A5NC 3VRJA 1EP1A 1H3WM 1S9XB 2CG9X 1KG0B 4ZMNA 1GZPB 1ZT4A 4ZO8A 3NZPA 4X2PA 1HCVA 4LSTH 4OIAA 4ZX4A 5IQOA 1VGEL 2ADJB 2G5RA 3GRWL 4UAOC 5DWUL 4FPSA 4Z7QF 3I3DA 1P5BA 2ZZ3A 1BQRA 3WLWC 3S1GA 1BWKA 3EJZD 3UYPA 1KFJA 2A9MH 4Z1PA 1G67A 2J4GA 1ISVA 1PWLA 4H04A 3DOIA 3OWEA 4QRTB 3TSMA 1E6OH 2F54B 1HJUA 4O4WA 4HTBA 4Z7AA 2J78A 4JKPH 3TC3A 4H8QA 2FIKA 3WE6B 3AACA 3B7YA 3D34A 5T1MA 3TFKC 1PZDA 1PKYA 5D05A 4I3RH 1UM6L 4UTLA 2IQAA 2OI9B 4RFOL 1I45A 3G04A 2VKWA 3V7AE 1NVMA 3UAJC 1INEH 4ESKA 5CHNA 1GOMA 2ACRA 4NJIA 3WMSA 1I85C 2ZD0A 1V7NL 5LHFA 3QZMA 3AHXA 3QPKA 3B4NA 5GSVA 3MUGA 1NCBH 5FKYA 4A68A 1E4NA 3SRHA 3UNDA 4EIGB 3SFWA 3FU3A 3VWJB 5EB8A 2LLGA 3RLUA 1NGPL 3SJNA 4ERIA 1BXUA 1TWDA 3L1OH 4QHUB 1E1CA 4H4NA 5C07D 1MW3A 3CDCA 2OL3L 4OGAD 5AKRA 3MO1B 2C4FT 3TJ4A 2MNJB 2NY5C 2WW5A 4PTVA 4EMZA 5CGYC 2N1KA 1E90A 4RQQB 3H0TB 4NP9A 1MDLA 3IJYB 1Z7JA 3IJ6A 4GXFA 3EYOA 3KM2A 5KVFE 1EEYA 3BOXA 1OK4A 4H40A 5ABDE 2AFNA 2BW5A 3HMXH 4TTGA 1Y1DA 2A77H 1JE6A 1C08A 3DVGB 4CVXA 3UWZA 3QWRD 4KV5F 2I57A 2CJUL 4K3EL 2BIIA 1P7TB 2V0TA 3CIWA 4FXJA 2OYKA 2YD3A 2CNZA 5E7BA 2A85A 3N2OA 4GWEA 5IEHB 1MCJA 2X1TA 4GG6F 4G7EA 3QFDB 1D9KA 5JOPD 4HSCX 5FUOL 3OB0K 4HKBA 5KYWB 1VBRA 4PRHB 3MODL 5A7EA 2HVMA 2VP8A 3TO4A 2ZVIA 4PJ8D 5IFPA 4PS4L 1IU1A 3PP4L 5DLCA 1BFSA 4LLDA 2P48B 5CILH 5D1QA 4PMRA 1LM8V 1NAMH 3L4WA 4OBSA 2VGIA 2VLJA 4Z76A 1MW2A 4YXHH 3I2CH 5I18H 1XRFA 1G7QA 3MCOA 4IJCA 4NNAA 5EU4B 2YGYA 4KKLC 5DK0B 1RJRA 1RV6X 1W3JA 2SFPA 1CVSC 1EJTC 4DZAA 2J71A 4JHAL 4OCWH 3QFJD 4NFBA 3CL7A 3VOIA 4RIRB 5GGRY 1YRRA 2E59A 3K7UA 2XWJB 3WLHA 1QSVA 4XVEA 1ECEA 3N34A 1VP5A 4X80H 1M9SA 1S7VB 1HNYA 2VDRB 4KMQA 4DO4A 4YHYC 1E51A 1E5JA 1GS7A 2MHAB 4APXB 3KDMA 3N17A 4DI8A 2ZF9A 5HDBF 2GSMB 1OW0A 5F7MC 2J44A 1CFBA 5H37H 5LNSA 1FWDC 1PZ3A 4Q7NA 1JGUH 5EOCL 3WKPA 4XKYB 3F7YB 2JIEA 4P8UA 4FQ2L 2BOCB 4Y5XB 2X6MA 4Q8OA 2XCMC 4NO3A 4PCKA 3NXFA 2AEWA 4W6XB 3BQ6A 1PKMA 2E9LA 3ZJ7A 4DKFH 5F9OH 2BSTB 4QD2E 4LHUB 3CAFA 2OMZA 4IMEA 4IT1A 3RFAA 2YEVB 3AADB 3V79C 1RV8A 2VXSL 1E42A 3JW7A 3P4OA 4AVNA 5K9QG 1KPUB 3TZVD 5DUPL 1HAWA 3GSNH 3A4FA 3SE9L 1YEDB 3D0CA 4IBSA 3KS5A 4HHAA 3THDA 3RWIB 1LNUB 3T0AA 4ZXLA 2NX5D 4QXWA 4P5MA 2BPBA 3IWUA 3WD5L 3MRIB 3GHEH 5I19L 1Z42A 4FHJA 3UOAB 1A6WH 3HC0B 3NJ3A 2OXGA 3OB8A 1E5BA 2EEFA 4UTWC 4GRWE 3DXAA 2NY1C 2CLPA 3MUUA 4C5ZA 3ARBA 3DTUB 2OCCB 3HG1D 1VAHA 4G7QB 3EB2A 3BLEA 5IIEB 3ARBB 5EZIH 3UTPD 4CW1B 4OLYH 4LNRA 4DP0X 2FJFB 1BQCA 3TC7A 3WUWA 4FGMA 1IZCA 4HEMA 2NLIA 3U0WL 3LEVL 4F2MB 1E0WA 3GH7A 3VNKA 3TTEA 2MFNA 4GW4B 1DR9A 3LNMA 2OR9H 3BKYH 3JSSA 4P49A 2VGGA 1N8ZA 4YGAB 3RL1A 4YXHL 4XPAH 2QPDB 3ROLA 3UTSD 2VSCA 4WJKB 4K7PL 2QR0B 4K8RC 3S9DB 4B9IA 4LHUA 4WY7H 2OLDA 2HCZX 2R0KH 1FNLA 4LPYA 4N0RA 4JQVA 1UA3A 5F7FA 1LO3H 4NQVA 5DMKB 3KW3A 1PG7X 4PJDB 4XKYA 2Q1EA 3CFQA 1B9KA 4E0RA 2YPVL 3BW2A 1CFNA 4DTGL 1GVIA 2YLLA 3NQ6A 1MIMH 2HSAA 4HIJA 4F33A 1V10A 5DD0H 5C7ZA 3EXJA 1XIGA 2J27A 4N9DA 2BG5A 4AY1A 4Q56A 3EHBD 3V1PA 4YNYA 3QIWA 4NM8H 4M6QA 4AD4A 3NZSA 3T07A 4DVBB 4TS6A 5LXVA 2RUSA 1GC1H 3CBRA 4O54A 3OVRA 5CSZA 4QM1A 1L9QA 1NGZB 4XVDA 2Q3AA 3M0MA 4KVCL 2YB1A 1K7EA 2IJ0C 2P28B 1OINA 3WK0A 1CIDA 3TBTB 2KBGA 5AB3A 1KMGA 2BVQA 1B0IA 3O63A 2ZSWB 1C8XA 2NY3B 2J79A 3ELFA 5CAKA 5JHDE 1GKOA 4FLRA 2R4SL 3VFRA 4P8VA 3B8TA 5IOBA 4EIVA 1CIUA 2BY0A 4XP4H 5DC2A 1N4XH 5CJBA 2CXGA 4HDIB 4P23C 1KJ2L 4UMSA 2Y1YA 1WO2A 5KJ7E 4AHOA 3V4UL 1RCQA 1FP8A 3I75A 3UTZB 4P7LA 1UT9A 3WEMA 4FQ1L 2A6DA 3TIMA 5IEHA 3DFQA 1QQDB 3NPZB 3IDXL 2XN0A 1M4KA 1ZXKA 3N1PC 4LESA 1A6VH 2VR2A 3B9OA 1I1AC 3IBEA 2KT6A 3IU4H 3KLLA 3ARQA 3FJTA 4FD0A 3WL9A 4Q9CA 3CH1A 1UZDA 1KLUB 1MREL 1HZKA 3F7KA 4I85A 4K9EL 5DJZA 3CMOL 1JYXA 1K4GA 4KNTA 3VD0A 1TR1A 2PTXA 1EC7A 4P2QE 1ZB5A 1LRNA 5F7KC 3VXRD 3W3BA 5F6IB 4LLAA 4CSSA 4AVFA 5B3JF 1M7DA 3GMNB 4UAOB 4P4KA 3WFHB 3OKOA 2ENSA 3QEQB 1M5WA 3PM6A 3W29A 1O9WA 1IQWH 4JCWA 3MXVH 5E8OA 1EOMA 2AV7A 3MA9L 5GS2D 4AIZA 4AQ8A 2OXNA 4GKTA 4OUEA 4E3VA 1A5MC 3HLAA 3EJJX 2V2XA 4YE0A 2DUAA 4GT7A 1L6WA 3WBAA 4PWJA 4X6DE 3EJYD 5E70A 4OFYD 1EJRC 2W3ZA 4GH1A 4O02H 3PWPA 1TVPA 5ACZA 1OALA 2ZT9C 3KS0H 3R0MA 3PWGA 4R34A 3ZJAA 4LLYA 4Y2WA 3KAAA 3KWTA 4G1MA 2IQAB 4AMXA 3GKFA 5DMLA 5DO2D 3VWJC 4CNSA 1WEJH 2P8LA 4OJAA 3US1A 4HAKA 1OIMA 1QWKA 2ZWNA 3MT1A 5E4EB 1DJXA 5TJWK 4UQ2B 4FABL 4YFEA 4U5KA 3KWWB 2GSGA 4JAMA 3L2LA 1MI5E 2PPAA 2VRKA 4AE1A 4XWGL 5FA5A 1FFNA 2E4FA 2K7PA 4IIGA 4NT0A 3IS0X 1IV8A 5F7EH 3DKHA 2DTSA 3DV4A 3KPPA 4OJDH 1YLVA 4IM4A 2W1NA 1I8LA 3EW3B 3UGUA 2V5LA 1S5VA 3DPDA 2XA3A 4ZFOB 2EGZA 1JCNA 2PTTB 3IGXA 1I2RA 2IEPA 1LOQA 4HFWB 5E00B 3OX8B 1OFPA 4Y19D 4O8AA 1NPUA 1JWUB 1Q6FA 3W7CA 4A2SA 2H8XA 3NIGB 5ANMA 3RTLA 1H3XA 3EJSA 4LSVL 5IT2L 4LCWB 2F68X 3GSVA 5LO7A 2Q0ZX 1AW5A 3ZIMA 1T4KB 1W1A1 4CA4A 1UXSB 4LP4A 5FUOH 1A5KC 1O6SA 4JDEB 5KVEE 2ZNXA 5IVNA 2FFCA 3W37A 3DG6A 2FPVA 2I14A 1QR4A 1IIGA 6PCYA 5AZ2H 3FC8A 3W39A 3MBXL 4LAQH 2BVYA 1JZ8A 1ZL1A 4XMZA 1MRCL 5DCEA 2V7HA 3ET9F 3S8GB 2GTZB 1XB6A 2I1OA 5C0CB 2EDBA 1BQUA 5D9PA 2WBJB 5INDB 2D8KA 4P9HL 4ZUVA 2NW0A 3HC3L 5D93C 2DPKA 3BQUB 3T0EB 5IFJA 3ES7A 4G9FB 2WV8A 4Z7WB 1N18A 1BVLB 1OK8A 2H0FA 3OM3B 1IGWA 1Q8AA 2X0YA 4Q6IC 3Q06A 3NZ1A 1ACCA 1PCKA 3ITTA 4XAYA 4DM2A 2GBUA 5B7ZA 2Y7GA 4ZOEA 4JFZH 3ZDYB 3NQ8A 3F7RA 4XZBA 1TG8A 5DI8A 3KPOA 1TZGL 3GJEB 4XO8A 4PLNC 1VJZA 1I8KA 4PIBA 2WC3A 4DJFC 4NX0A 1DUYA 2BO0A 1W15A 3VFNA 3TN6A 4JRYA 4PRBA 2HZGA 1XDJA 4XN7A 4MMXA 2BNQB 3RY6A 3PHOA 5E0FA 3W7HA 4Y4FD 5D1ZA 3PGDA 1DVJA 4TQ8A 2E3VA 3EX6A 2IGTA 3BAXA 3BUTA 4F5CE 1TG7A 5TFSL 1UOWA 1DFBL 1YEFL 1ORQB 4XIMA 1BYBA 4N86A 3IUIA 4OKDA 4P5TC 4JBRA 3IIXA 2QVKA 4KX7A 4NCC1 1YE4A 3NOYA 3VA8A 3TOYA 2C3VB 3TYDA 3FSUA 1AD9A 3PPFA 3WLIA 2OZTA 1USQA 1SBSL 3CDFA 3PJTA 1QLFA 3VXMD 3MBWA 2ZP0T 3APFA 3RZCB 1GOKA 2ZZ7A 1JWMA 2X10A 2HTKD 3GC3A 5JPMB 3ITCA 1VPOH 5KZCB 2C1OA 2KERA 4NZJA 1BIIA 3MLXH 1KTLA 5CN1A 4E9SA 4CQCA 3S97C 3C0LA 4J8RB 4K15A 2QGEA 4E41E 1EXUA 2V6AA 3BSGA 5AVHA 3WF2A 5IR1B 3RUGA 1M3JA 4WGVB 3N85H 4KZEL 2QKIA 4IQJA 4DJDC 1QG3A 4WEBL 4Z7NE 2H3DA 4KVPA 3VFSB 1AGDB 2G96A 3FGCA 3U46B 4WKZB 1ZS8A 3SBPA 3WLWD 5JQHC 4AZCA 1EKOA 3NJMA 4AWSA 1L9PA 1A0QH 5IREA 2YDSA 1P4BL 4K3HA 2J73A 5EV7A 1G7LB 2KI6A 1BYDA 3N41F 4Q2ZB 5D7IA 3STZB 2WJZA 4D9PA 2SODB 2AL2B 1BQHB 3GMPA 3QIUC 1ESOA 1A8ZA 3FUIA 2XN9A 1MJ8L 3SGEH 4EBQH 2CIPA 2E9MA 3CWNA 4DJDD 3RL2B 1V5JA 3QFJE 2H2SD 4A6GA 5JQIB 2HFFA 1IF2A 1OCCB 4BZ2L 1XLFA 4UBPC 2PCFB 1YAIA 3N40F 4ZUUA 4Y4HA 3WS6C 1ZAIA 2ZOXA 3VC6A 3ZIZA 4FEZA 2FE0A 1TNMA 1UB6B 4EUPB 4RISL 4PUDA 4AWTA 2IV8A 5JPNC 4O17A 3NFNB 1QSEE 2XA8L 1OFEA 5DHVA 3ZT6A 4MFEA 1FWXA 1KPVB 3FTSA 4ACPA 4DJFD 1U3YA 1E9IA 4FZIA 2FZMA 1C5DB 4H6KA 3QI9B 3LD5A 25C8L 1R7OA 3BP5A 1EGJL 4LYPA 4Q6KA 3LCXA 1F58H 2EDYA 2VWEC 4BRVA 4XR8C 1J2BA 1FWWA 2CLHA 1L9TA 3KJ6H 4ACZB 3WY4A 3BK0A 2XDHA 4XN2A 3OAWA 3MLTA 3ZGHA 1IEQA 2PGRA 3QEHB 2I60H 2RIKA 3TEVA 4ICMA 3MLZH 2V30A 1PKQA 4J2XA 1PHQA 2DL9A 2XKNB 4MNQB 2HROA 2R8SH 4LARH 5CCHE 5MI0B 3AWGA 5SX4I 43C9B 1HC1A 1ZFJA 2N0KA 4LU0A 1P0DA 1NWSA 4AYMC 2OCZA 4RPQA 1ASQA 2GJJA 3IEAA 4C59B 1IAIH 2VDOB 4JVPA 1RJYB 1FYTD 1E5AA 4AMKH 1WWBX 1YIXA 3FQYA 4GPNA 4JFDD 5M03A 4G72B 1EFXD 1T20B 3RWJA 1WE5A 2V9DA 4NZDA 2O6DA 5GS2H 1ID5I 1O4UA 1I9JH 3K13A 4MD0A 5EA9A 3JV0A 3AS3A 4P2RA 3QV7A 2AJZB 2W62A 1E67A 4EI5B 3C8DA 3GINA 2Z7ZA 4G9DB 4JZNA 4KI5D 5CZRA 3TOPA 1YUKB 5K7JA 3AZTA 4NDMA 5GGUA 3WEXB 4CJ1A 2O6CA 3Q67A 2Y1AA 4E42B 1DXIA 2VELA 2BSRB 5GJSH 3F04A 2BOBB 4DPBX 4J5VA 3LCIA 5JDSB 4M5ZH 2X16A 3CSFA 3GMOA 3WKQA 4YXLL 3RA7H 1R1CA 1SUJA 4JAWA 5F8QC 2XIMA 1S5TA 3CUFA 2X0UA 3EGXA 3BPNB 4F8TA 4LEBA 1QOXA 1YTEA 3MYJA 3GSUB 1W37A 1RERA 5BRZB 3M0VA 5I23A 1JCLA 5DWUH 3POHA 2UWFA 3BEWB 3ARXA 1CDGA 2PWDA 3JUYA 4LU5H 1S7RB 4U49A 2FZ8A 4DVOA 2OMUA 2ATMA 1WHOA 1S9YB 4WU5B 4WUKL 2J7DA 2XFWA 3GTTA 3UEZA 3UJFA 4UTJA 2OJZH 3W57A 1EHLL 3LX9A 4OCLC 1JZJA 1N2RB 2FTAA 3DOSB 2D2OA 4M56A 2D0HA 2G3MA 3GRWA 4KVNL 1H7PA 4FFZA 4GAYB 3VUSA 1XYAA 2UY7A 5CG7A 3LKPB 1VFOA 1XJBA 1XF4B 2WUBL 3WTTA 2FJGB 5GZOA 4ZFGH 1GORA 1ADWA 1FV1B 4YO0A 2QPXA 3HMXA 3CIVA 1HHHB 4HHPA 2NUYA 4FEMA 1GEHA 5FJUA 5AVUB 1ESWA 1YPXA 4TUOA 4DWSD 2CDEB 2VWTA 4L8BB 1FL6A 1I3RA 2IAMD 2Y5QA 1DN2A 3DK2A 4L2LA 2OYPA 1JGDB 4CNIB 5BV7H 3C3NA 5I3HA 3PG8A 3STCA 4AHQA 4YHGA 4DGYH 4BFBD 2JIXB 4HK3J 2BVOB 1T5WA 3RWCB 1D5MA 4C5YA 2FR4A 4OLWH 3RY4A 3X14A 5T1JA 3S9IA 1E9PA 1SR9A 4JG5A 3REWA 3EJRA 3LBOA 2R1MA 5KBNC 4X6CF 1BFTA 2DSUA 1X7IA 4EE2A 5I5MA 2B7DT 3KPRA 3FVMA 3BN3B 2ZAIA 4U10A 3OKKB 5DK2B 4B3EA 1L5GA 3M1OA 3BUQA 3ES6B 4NU7A 5C0QA 3HEIB 4F9LC 4O14A 3QDME 1ISYA 3TN0B 3MRQA 1KELL 2V9UA 4N90E 1JP5A 5D1XA 3AS2A 4AYBA 3GBLA 1FZJB 4OJYA 4LAMA 4NWUL 3HRZB 5JW4R 1VYSX 2IWFA 3AHTA 3QUXC 1P7HL 1EZ2A 4QBXA 3QR1A 3W1XA 1WT5A 4BFJA 1JVKA 2JTDA 4CMHC 3OYZA 4HMNA 2O9RA 2QMKA 2GUOA 3NSNA 3QZNA 5AVYB 4L3CB 1OAUL 3MFFB 3FBQA 4MUPA 4XC3H 5GNYA 1Z0NA 4Z1BA 5L0QB 3LPPA 1I9RL 4Q9RH 1H6TA 4I3SL 4X42A 2H5UA 4AKOA 4FIQA 4MDOA 3TQ0A 2XG5B 2NXIA 4IJRA 4E8GA 3QULA 8FABA 5FA3B 1RK1B 2ATKA 4I87A 4FCAA 1FC2D 3RRQA 3RDKA 1NUGA 4PLKD 1E40A 3WFCL 1LHZA 3MLUH 3S3BB 3EG9A 4EDXB 1BDYA 2CMRL 1U41A 2OTPA 1KCXA 4MWAA 3GSNA 5FAAA 5I1GL 1TJ2A 3H4XA 4KK8D 4F8XA 2ODHA 2R1LA 1C16A 2PLTA 4GZEA 4I7UA 1JCXA 2V2HA 3G0SA 4DP9X 5BV7B 1CICC 5BVPH 2OLHA 4LF1A 3Q01A 3MDWA 4WTZA 3S6TA 3DSNA 3K6DA 5DO8A 4E9LA 3W7JA 2OZ0A 1BIHA 2Y36L 3L9BA 3HOGA 1VPYA 5I1DB 1J9YA 4JIRA 2HX8A 4XCEA 4ELKB 5IJCC 5HVHC 3TIDB 3JYBA 2VWSA 3EX3A 1HL5A 1VLXA 1XB8A 5FYKU 2VM9A 3CC5A 4P3CH 4LVOB 4RX4A 4AG4L 1O5QA 3CVCA 4HUKB 4PJBB 1E9OA 4PJFB 3BVUA 3OGOE 5D2LA 1DTNA 2F7QA 4PPTA 4TRPL 1LZOA 4I7VA 2Z1BA 5C7HA 5I02A 1AW2A 2MCPL 4F24A 3MRKB 1OGAB 5DLLA 3PWIA 3QDMB 1EA0A 3RFRA 2CNYA 1XH3B 1XLHA 2PP1A 3MLSH 4JDZA 4IRZL 4XB3A 3ZVVA 2B9AA 2CC0A 3QWOA 4F37F 1NIEA 1W31A 3LNEA 1P7BA 1P7KA 3C5JB 4R4ND 2EABA 4KZDL 1L9SA 3U7BA 1AGBB 3QY6A 1XDTT 1DE6A 3TYGL 4J3OF 4QYOB 4JNMA 3QDMD 1J0HA 5BQ7A 5D9MA 4GYBA 1HEZA 5E2TH 5LBVA 2W07A 1P4BH 2BDQA 3APYA 1ZEAL 4OLEA 4GNJA 1DYSA 3ARGA 4RDVA 2Y3NA 3ZXAC 4LAKA 5I1EL 1OAUH 5FB8A 1SOXA 1Y0LA 3DRTB 1UUOA 4ANWA 4D8AA 4GMTL 3B8IA 3T2PA 2DQXA 4RA0C 1AKJB 4PJHE 4ACYA 3GSWB 1FRBA 4ICCX 4AZHA 4RGND 4TSBL 1K1DA 5ACLA 2FO4A 4BEQA 1TTQA 3UD6A 2WLLB 1YEJH 3EX2A 3P77A 1X5ZA 1YMHB 1RVFL 1AL7A 5F8RC 5EA0L 4LS0A 4QOKE 1CTMA 1K5NB 2VAAB 4FTVA 3CS2A 3QI9C 3V2AR 4PJEA 4WHTA 3UWEA 2HJFB 1AA1B 3D51A 4OLXH 3FX4A 4DEPB 4XSMA 3VXRE 5XINA 4E9RA 4AGOA 1SYVB 5L2KB 2BSEA 3GSOB 4UILL 4AENB 4HULB 1CICD 4LLVA 4X63A 1HNGA 4JFPA 2DWDB 2ZYHA 3BHBA 3IETB 4MQ7B 4X8JB 2CKBA 2X53A 4OM0H 3MWCA 2PDYA 2V5CA 2ZUUA 3PU7A 3HI1A 1TJIH 1OP3H 2V0AA 3Q3GA 4F9PA 4GC4A 4UOW0 4OY9A 4OCSH 4NQDD 2GG1A 5DJDA 3QPQC 3UTTD 2GLKA 3B8YA 3PWLB 4IIQA 4IU3A 4TMPA 6PAZA 2I5YL 4HH9B 4NYLB 5D93B 3EB3A 7CGTA 3IDNA 5ESQB 3MP5A 2B59A 1XIWC 3QIBD 1EJXC 2YCJA 3QC0A 4BQ5A 2WLZA 3OVPA 2F54E 3NNTA 4XBKA 1NQBA 1U2HA 1WFUA 3W3OA 4U1GC 4U4MA 4TO8A 2EO7A 3IAQA 4ZUSB 1CGUA 2WXPA 1AD0B 4U6TA 1FO0B 3C9NB 4KQ0A 4K8RH 5EORH 4I18C 5E08H 2A1WL 2XHYA 4PMJA 1CDCA 1UOZA 4NNYA 3ZTJH 3DTXB 1NCIA 4HUXA 3OKEA 1G5GA 4KWUA 4B5NA 5I6KA 2DSWA 3BGFB 3BVVA 2FZDA 1DQQB 1UWGL 4FXLA 2BP8A 3ULSA 3EEZA 4MNLA 4D72A 1S7XB 1S7TB 1AXSB 1TJGH 2V8ZA 4WZ9A 2EG8A 3QWQB 3VNDA 3MRBB 3C5XA 1PLBA 3SSZA 4LSPH 2EIKB 3OHXC 4PG9B 4F2EA 1Q6QA 3ULVL 4WKAA 3ZYOA 3PZOA 1NCUA 1ZVSB 3MZTA 5AKQA 4YCPA 3EFOB 1NAL1 3N1FC 2AGJL 5AL8A 4O00A 4LPVA 2Y69B 3QHZH 4B95C 1GCFA 2FX7L 1K6WA 2BASA 3BJFA 1HXKA 3EPMA 4JO1H 4JCLA 4XPHH 3BCJA 4K36A 3SE3C 3P3YA 3O2VH 1KY7A 1DO5A 1Z3GH 3D0LA 3PV6B 1H0IA 1KN2L 5I15H 5SWZA 4IOIB 1E6JL 3ISRA 5FACA 4XWGH 1EXHA 3GNNA 3GS4A 4JFYA 2H45A 1F61A 3HQ1A 5BRZD 1JDEA 1BQ5A 1TZIA 1ZA3B 3QW4B 5HMFA 3W02A 4P5RA 7TIMA 3L3GA 3E8UH 1BOGA 4N9EA 2FYYA 1R3IH 3EFOA 3KM1A 3VYPA 5IMMA 1CBVH 1OC5A 2J72A 1RJQA 3GXTA 2CO7A 1F0LA 4R2GB 3VJ6A 4IQHA 3F01A 5EO9B 4MJ2A 2WD0A 1VRSA 4PG9A 4UCFA 1EJOL 4Y16A 4CD6A 3G1AA 1FVDA 4PS8A 1PUDA 5KYYB 2XY1A 2DZTA 1N10A 1S7TA 2YFOA 4LVGA 3G5VA 5D7LE 3N44B 5HVGB 3KRUA 4K1WA 4H7VA 1DQQA 3P4MA 2MQCA 5BNKA 4Q33A 2DBJA 1IC5L 3SKNA 3VXSB 4GXWA 4XAPA 5D30A 3MTRA 4HUXB 5CN3A 1WYIA 3IVTA 3F65A 2YA2A 4LAQL 1IQDB 4ZTYA 4ORMA 4B16A 3EDDA 3HB3B 8PAZA 2BSSA 4UZSA 1MZRA 2ZUYA 1ZV9A 3UTTE 1DBKL 3V4PH 5EBAA 1FO0A 4HA1A 3MREA 4DN3L 4LSSL 3EXSA 4F92B 3N1MC 4ADJA 3MV7D 2ZSVA 4NC1E 5IV2A 3VTAA 4HCRA 4G6JL 1FWFC 3AQUA 2Y72A 2X4QB 2H3XC 5DJ2A 2IF7A 3VM7A 1NBCA 1UWGH 1XZ0A 2EIZA 3TJIA 2D03L 4KI1A 4Y16B 3NCYS 2OLAA 1TKWB 2IGFL 5BZDA 3FN9A 3L6FB 3GXIA 3HC3H 5KVEH 5BOOA 4F3FB 5CBAA 1WDQA 1WZMA 2CO7B 4ZPVB 5K1NA 3D9AL 1XL9A 2F53E 1M9WA 5IJDC 4RKAA 2IDFA 3DO3A 5D9NA 3CU1A 5I1HH 2CLKA 4A3QA 4YAQA 1MLBA 1A9VA 1F1AA 4P8WA 3NDZE 3ESVF 2CKBB 2D7MA 2CE6A 2FNBA 3KWXA 3TJLA 4PRDB 4GXMA 4IOIA 4FXGA 1RZMA 3L65A 3NGJA 3LVEA 4L56A 3V5FA 4GPVA 4NAQA 3VW3H 1OAKH 3W6MA 1V0KA 4X2RA 3EOAA 1YMYA 1VFHA 3TCLA 3RJQB 1RVGA 4LB3A 5LB1A 4A8RA 5FEZA 1EUNA 4AJYV 3GDMA 3G77A 1ZVSA 2VW6A 1OWQA 2ICCA 3HFML 3SY1A 3W1NA 1DFBH 1U95B 5HMDA 5IEKA 4IM8A 1J6PA 5K9DA 1YMHA 1UFGA 1A3HA 3OP2A 2M83A 3QUMA 3MJYA 1W0VA 3C6EA 2OMNA 3PE9A 35C8L 2ZXCA 3WHXB 3ZLQC 1FUYA 1IBHA 4G5AA 4BINA 2PDPA 2BSCA 1KJMB 4FNLL 2BWIA 1BFVH 3NGBB 1O75A 3SYCA 4KRNA 1XAKA 1GQNA 1S39A 1FYTB 4AGNA 1G69A 1KN4H 1L4IA 4K9JA 1A65A 3H7BB 3HMXL 1Y0LB 1BZ7B 1CF1A 1AI1H 4AMKL 1RCOB 3LEXA 3BZDA 3L3OB 4K7PH 2E40A 3ZZLA 3ARGB 3EPNA 3DBXB 5EHFA 5C07E 1FVCB 1EZVX 2OI9C 2Y6TE 4ZMXA 1OB0A 1R3JA 2MH4A 3C9NA 1S3KH 3EDFA 2X05A 2R59A 4ZW6A 4EZJA 5CGYD 4Z7QE 1BKHA 1UATA 1VZWA 2A4CA 2GYSA 1GY1A 1P7KB 3C5JA 4GMTH 3LXUX 3MDUA 4ENEC 2R0LL 3E2QA 1WTLA 5G2NA 5B7EA 1AZ2A 3MACL 1SQ2N 1XH3A 4IRJD 4AVKA 5F72S 1DQDH 1Y18A 2PW2B 3O6LL 1A1OA 4E2VA 3N0AA 3Q48A 5HJBA 5I74B 4AWJC 5JXAL 1E9OB 2XTSA 4PJFA 2ZXAA 5D2LB 1FIGL 1Q6RA 3HG1A 3C4UA 3BLLA 3SY5A 5I18L 3SR7A 2G3XA 2XX1A 1VHNA 1QABA 4N8UA 4GJ1A 4RK8A 4N4QA 1IBFA 1U93A 4CEXC 1PD1A 4XCEB 1EV2E 2EVIA 3IETA 2AXFB 4UU9B 4FA7B 5CZSA 1LWJA 3B56A 3DROA 3WQFA 1H9VA 3J27A 2J9XA 1JFQL 1QR1A 4JDVB 4CRPA 1EMTH 4G8IA 4TSAL 1KN4L 3TA3C 3UROR 2HS8A 4MMWA 4F9DA 3BAEH 2NDFA 4PTUB 3B1UA 4P2AA 2VZOA 3UP1A 3QXBA 4PJEB 1C16B 4WHTB 1LUCB 2IMRA 1OSEA 2R9HC 4U6VL 1OIFA 2CZ5A 2VAAA 4FTVB 2DQCH 2ZCKL 2Y06H 2IPTL 1CF8H 2OA9A 3MNWB 2B1AL 3EG9B 3U0HA 4M6OL 1O7VA 3TCSA 5G55A 4AD1A 1CK0H 2IAMB 4EP8C 4NQSB 3AXLB 4DF1A 3JS3A 1JZ4A 2WLLA 3PNWB 4YWGH 4H6QA 4C58B 5ECVA 1RK1A 2ATKB 3CMOH 3T0XA 2E86A 3WV0A 1E6NA 2MPVA 5CZKA 3LS9A 4NN6B 1AKJA 5L0QC 1JRCA 4IPIA 5IFHH 4P2QD 3VXSD 2AZAA 4IIQC 2P76A 4K5OA 4YVUA 2BH0A 4NQCE 2HUEA 5CP3A 1FAIL 3WFEL 4AOFA 1QWHA 4L3CA 1OZTG 2NQCA 2OMYB 4NQSA 4INFA 2GUOB 3ABQA 1RULH 4UINL 4CSZA 2GSEA 2XQBH 3L95A 2DRUA 3D4YA 3LTVA 4QYOA 3SKJH 4BKSC 5EZIL 2J66A 4UT9L 4O1DA 4JM2D 3LNGA 1NCAL 3B7RL 1A7BA 5DS8A 3W88A 1AKPA 2OAAA 2E75C 3W0KA 4YYFA 2G2PA 3MRQB 1TPC1 4YS1A 3OLEA 1Z7AA 1FC1A 2EDJA 2C79A 1QLRA 1MFCH 4HSQA 3IEBA 4MZ1A 5CGMA 1JDDA 2JF7A 2AXFA 3PZNA 3VCCA 3WS3A 5LKYA 1WGVA 4KDTA 4YN5A 3M07A 3WH9A 2HT3C 4YSDA 2R23A 4K68A 1TMHA 1G87A 2DV6A 3HG1B 3RIAF 1LOSA 3LN9A 2PO6D 1B3OA 4QQUA 3KH4A 2WGXA 3NIDE 2LFGA 3TASA 3UPAA 3VG9B 3CC5B 3BKYL 3FFCE 2ZYIA 4LBAA 4N22A 5D5MF 3SJVD 1R3WA 1SQMA 1T5WB 1E9LA 2V4LA 4QLJA 3K30A 3QUXA 3I9GL 1SSDA 4RV3A 1FE8L 3VGGA 2V3FA 4B5ZA 3SCTA 2CZFA 3HIJA 3ZDXF 1M65A 3MHFA 4TUOB 4CGUB 2K4WA 3H42L 5KEZA 2AABL 3BSZA 2L7QA 3HBQA 1KYAA 4N25A 1CGSL 1E6JH 3JWNG 3M86A 3NA4A 5C08A 1NCJA 4MYWB 5I1HL 3PJWA 3NSDA 4Z1DA 2CALA 4F7TB 1F4YL 1IGTA 2I26N 1KIQB 3LKPA 5C0CD 1R2SA 3UCDA 1TELA 5E9AA 2P5WE 2QQLL 4AQLA 1NDMA 4Z9KB 1V7MH 4HS6A 5C0DB 3SY8A 2YAHA 3FSVA 4TM9A 4C57C 4U0RB 1FXQA 1N2RA 3R1ZA 3VFWB 1K4DB 5AENA 2GEQA 3SZ6A 1NAKH 1HCZA 3HHSB 3CQ0A 1YO4A 5HGDB 1F8TH 3JT0A 2VEFA 5TIMA 2IFFH 2H41A 2XG5A 2DYPB 3TW6A 5TDOA 1EWEA 1KJMA 4ZO6A 4HZ1A 2I9EA 2WN3A 2X1WL 3ISIX 3PF2A 1KFWA 1S8DA 3BPOC 4EAYA 3NCBB 1HKVA 4GYPA 4MY1A 2DMCA 3GKZA 1J93A 3EO1B 3GIYA 1F45A 4X83A 3ELQA 1V8EA 4MAZA 3FV9A 3L0KA 4NXKA 2E9GA 5KVDE 4XCNA 1DIKA 3W7QA 4O53A 4B9KC 4J35A 2Y22A 3OZ9L 2ZXDA 5D1XB 3ZHNA 3AALA 4NS0A 3EOAB 4KC3B 2OR2A 4CMHB 4H1ZA 4JPKL 4WUUB 1AQMA 1JGVH 1T66D 1Z9SB 5T1KB 3WTSA 2YCKX 5L4FA 2DL2A 2DQGL 5FOBA 3VOHA 1L5GB 3QUXD 4NZUL 4YHZL 1BAFL 2IXQA 3UJSA 1ZS2A 2MSPA 2OSLB 2X42A 1I3VA 1WEJL 4Y8AA 1RZJH 3DSFH 4C6NA 1NCCH 2NNRA 1RJYA 2JQZA 3CZLA 2FR4B 4ICNA 4XT1C 2ZCGA 2VDKH 3UJTH 5FHBH 4FKKA 3VD2A 5IRPA 1GJIA 1XC4A 2V8MA 4TSBH 4LIQE 2K70A 2P1YA 3L6FA 3O45A 2C0HA 4L8SA 2FVLA 4P7NA 1K8YA 4R7LA 3W1RA 3OMNB 1HHHA 5I1IH 1HZYA 3CDGA 3VOGA 1JNNL 3QBTB 2D20A 2GKIA 4NHUA 3RKDD 4X5WA 5IV2B 1HHJA 3NFPB 1GYCA 1ETB1 4NKDB 3SDDA 1IL1B 4U6VH 2VFHA 3CQHA 3HW7A 3W00A 1K03A 3QI9A 1C5DA 3HUJA 2BSSB 1NLBH 2EC9T 2XZAL 3EGDA 5I75C 1NINA 1QOQA 2G3IA 3HFMH 4TSAH 3BIAX 4DBSA 1AS7A 3E0IA 4GAAA 3DETC 3VXSA 3EYUH 3NFNA 5ABGA 1IT7A 3L81A 3UG4A 1MEXH 4EUPA 4NI8A 3SRDA 3B43A 2WCAA 4PFEA 2BVEA 2RJMA 4KKNA 4YHLL 5I6PA 5A40E 4JO2H 2DQGH 1YTDA 4PULA 3SCUA 1VGAA 4HC1H 4H9ZA 1XL4A 3GSUA 1XAUA 1UM5L 4ODVL 4GBDA 4XHJC 5CP7A 2JEQA 3RO6A 1XCFA 5CBIA 2FLMA 3KYNB 4LL4A 4GXUM 4TRPH 3W7NA 5HWJA 1BQHA 4JQIH 2IPKA 3CHQA 5FJOA 3D25B 2GOUA 4LO9A 4AZ5A 2BOBA 1G7LA 4UTHA 5FF6B 4RRPA 5ICXA 4NDMB 2NY3D 1TNNA 2VHLA 4AD5A 3SM0A 2VMCA 3DTDA 1NWTA 3BH8A 4JZNB 4AL8L 3QW3A 5AHEA 1UM6H 1QA9B 2VLJD 3HC4H 5E8NA 1W9PA 3PB2A 4H8PA 1NEZB 3HE6B 3CM4A 1RHCA 1TV3A 3K2UH 3L2IA 3IJIA 3MI6A 1EQWA 5IR1A 1BYCA 4G5DA 4ERGA 5F9JB 1AC0A 1ZBVA 1BA9A 4WRHA 5CSYA 5ISZB 1VH7A 4V11A 1US0A 2QVMA 1HG3A 1R33A 2R15A 4EXPX 2CHWA 1B4JH 4LT9A 1NFKA 4P7QA 3STLB 3LCLA 4ANVA 1YKWA 3LSCA 3D30A 1A47A 1NCBL 2IGLA 4GRMA 3TESA 2KZBA 3U6RB 1H11A 4PMDA 4BFNA 4MNQA 1ZANH 1PKQB 1WH0A 4L80A 3HURA 1TLKA 1US2A 3EWUA 4YNGA 3QEHA 3ZIYA 5LGXA 1N64H 3AQYA 1I60A 2GCYA 1JXDA 2E1WA 4HUVA 2F58L 2AC0A 5LDSA 4KRZA 3M1BB 4KO6A 5HYJD 2PW1A 4X7FC 3ZE2B 2BGNE 2UBPC 4WSHA 2HFTA 2OGYA 3JWOL 4ZGYA 4Z2IA