4PCTA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-L-fucosidase
publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 161
structure length 438
sequence length 438
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4pctA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pctA01
1EGZA 1CZ1A 3GNPA 4OOZA 2G3NA 1EIBA 3W53A 2XVNA 1XSIA 3HMCA 3THCA 1UH4A 3LPOA 2A3CA 2GJXA 1W9DM 3MKKA 4ZFMA 2D1ZA 4AW7A 3WD2A 4Z2JA 3U7VA 5M5DA 2YDRA 4PTXA 3EDEA 3FAWA 1BYCA 2VR4A 2ZX6A 1VRXA 4J3SA 4AZGA 1E6ZA 3CHEA 2J74A 4CU7A 2OYKA 1UA3A 3BVWA 4DO4A 3WQWA 4PMVA 1UQYA 1K6AA 3VGHA 4C7FA 1ISYA 4W7WA 3ARTA 1UKTA 2XJ7A 3PZUA 5FKYA 4R5EA 4UFHA 1W3LA 2BXZA 1MW3A 2PBOA 4AD1A 4ZENA 3WF0A 2YLAA 1R33A 1H5VA 2O92A 2WVVA 1QI2A 2JF6A 4P7QA 2ZWYA 1R34A 4UZSA 4BA0A 4BF7A 1E40A 3W6MA 3II1A 3UESA 3AQUA 2WCGA 2BY1A 1OSEA 4UR9A 1BVZA 3TA9A 1M04A 1HJXA 4GINA 3VGGA 3WF4A 3QOKA 2XVGA 1C3FA 5I2UA 1FA2A 3A3HA 2XHYA 1F4AA 4AD3A 5AYIA 3MMUA 1US3A 2XGBA 4J27A 1UWQA 4TVDA 1OGBA 1TCMA 4CN4A 5CZKA 4CD8A 5DFAA 1KXTA 3CZLA 3WDQA 3RJYA 1W2PA 3MMDA 1UR9A 3BLBA 1QOXA 1BTCA 5BXSA 2DDXA 2Y4SA 2AOSA 4OZOA 3L4WA 1JAKA 1WE5A 1AQ0A 3RJXA 1MYRA 1E70M 5BRPA 1U2YA 1JI1A 3WQ6A 5I77A 1S46A 1HJSA 1TZ7A 4F9JA 4TXEA 3MV01 5DO8A 2ZUTA 4PMZA 3VIPA 5LA0A 1B3XA 1EO5A 4S3JA 3D50A 1UD3A 1U33A 1TQUA 4BQ3A 3PTKA 1SR0A 1KQYA 1E55A 3DDGA 2WCSA 1TQTA 3NYDA 4FNSA 4X0NA 4HP5A 1KXVA 3CZSA 3E1F1 3AMGA 4AZHA 4D6IA 5TD4A 1CGXA 2F7QA 2XVPA 3VGEA 4E2OA 2W63A 5IHSA 5E9AA 3ARPA 2O9OA 1H2JA 2ZUSA 1V0NA 4L4PA 4DWSB 4NI3A 4BZYA 4JL2A 4M8UA 1RH9A 3PZMA 3WH5A 4HOXA 3DX3A 1NQ6A 2E0PA 1GZJA 2G4FA 4CU8A 4MJ2A 4D71A 2YLLA 3AMLA 4XUYA 1CWYA 3N12A 5GPRA 3WNMA 4TVUA 2BY3A 4OBRA 1LWHA 3H54A 4FLOA 4LPCA 1FHLA 1XSKA 1X6LA 3DX0A 3EJQA 1JAEA 2G3JA 2CKRA 3VDAA 1JF5A 5GQBA 1W3JA 2YA2A 2D2OA 3UERA 4M81A 4FLSA 2DGAA 3CUHA 3WSUA 3L4UA 4JFSA 3WNNA 4UOJA 1JZ2A 4ZE4A 1K9TA 2OWXA 3SUVA 2WZEA 2D22A 1BVNP 3WY4A 1G01A 3K4AA 3U7BA 3CUJA 1E4LA 4PTWA 3TP4A 2UY4A 2XSAA 3WNLA 4B9ZA 2EO7A 2WYSA 4W7UA 4H7VA 4UOZA 1HKIA 4XV0A 1CGVA 2YDSA 3A22A 2QMJA 3VIHA 5I23A 2WCAA 4PMXA 2EPOA 1W3HA 1R85A 3CZNA 1XV8A 4PBGA 3AJ7A 4Z2HA 3BUIA 2OSYA 4JZ5A 1KGUA 3W38A 3WMBA 3WFLA 4KMQA 3DC0A 3CH9A 5E6ZA 4HMDA 1HJVA 1ZS2A 3UETA 1DWAM 2UY3A 1GVYA 2VCCA 2CBJA 3OBAA 2ZE0A 2J78A 4W87A 2VZVA 1H4PA 2AAAA 3ARRA 4K68A 5E0FA 1JYVA 1JZ8A 3CIVA 2J25A 1VFUA 2CBUA 1NM9A 4NXKA 1OWQA 1MQPA 3WD0A 3CUGA 1TA3B 3UG3A 5EFDA 4JKMA 2CIPA 3KEHA 4HZ7A 1R46A 4NXSA 1J9YA 3SCNA 5ABFB 1JNDA 2EPMX 1UD5A 4QLKA 2VCBA 4U3CA 1CBGA 1SFSA 4UFLA 3AMKA 1E43A 1W9BM 4WSJA 4A4AA 3IJ8A 1NWSA 1EXPA 3EJSA 4W5ZA 4UOQA 3AS3A 5CG0A 5IHRA 2BHUA 1UD4A 4D6JA 2ZUVA 4HA1A 2V5DA 4GQRA 1KBBA 4HPGA 3VILA 4P8VA 4NZJA 2WW5A 1V3HA 1ODUA 1PIGA 1GOWA 4AZCB 1ZJAA 3ZOAA 3W6LA 3W4RA 1OINA 1E6PA 5CSYA 4QCFA 5D9PA 1R8LA 2XGIA 1FFRA 1MFUA 2FDMA 3CPUA 4A3HA 3WEMA 1QHZA 3AYSA 4QAWA 2XWDA 5C71A 1NARA 1NOWA 2VL4A 2QLYA 2CITA 4XZWA 3BVVA 2BVDA 4UQ9A 3BGAA 2FHBA 2WK2A 4D6DA 4E8DA 5ABEA 2CBIA 1UR2A 2XM2A 1C93A 1GORA 3VDBA 3PZTA 4YHGA 5CJ5A 2Z1SA 5LA1A 2CERA 1E72M 1JYWA 1J0KA 3WN6A 2X2YA 1TA3A 4DO6A 3KL3A 3T2PA 1E3XA 5CLWA 4U5KA 5DF0A 5C70A 4A3YA 1PPIA 1NH6A 5ABFA 3WUEA 1ZBWA 2HVMA 1WZKA 5I5RA 1E6QM 1PZ3A 2X8RA 1FH7A 4AD5A 5A6KA 1R7OA 1JDAA 2D3LA 2VRJA 3VPLA 4MNJA 2PWGA 3BAIA 2VVNA 4FNUA 4GZJA 4S3KA 1UD2A 5F7UA 3EDDA 3H53A 2QPUA 4X9YA 1TVPA 3NCOA 1WAWA 4H2CA 1HIZA 4GI9A 3EMZA 3M6DA 4AZCA 3CO4A 2J7HA 3HG3A 4M82A 1PZ2A 4W86A 1AVAA 3BUQA 1KGWA 5EBAA 3WNPA 3BSHA 1NOFA 2WVTA 1OT1A 2YL9A 5BRQA 1DP0A 2YL6A 1J0ZA 4GO9A 1KGXA 1US2A 1SZNA 4PMOA 3S5ZA 2PWEA 1Q6FA 1C7SA 1G0CA 4JIEA 3THDA 3BCDA 4JFTA 4UQBA 4FK9A 5JIWA 4IPNB 3CLWA 4MDPA 3WY2A 1M01A 4RE3A 3ARQA 1UASA 4GIAA 2EABA 2BS9A 2J7FA 3BAYA 2D0GA 1ZBCA 1B0IA 2WNWA 2F1BA 1WB0A 2EPKX 2O9TA 1WDPA 2CCRA 3N04A 1DWJM 4P8XA 3ZJ6A 3SCQA 4TX8A 1HN1A 3AIRA 1V08A 1JZ7A 5D9OA 1GNXA 3DX4A 1D7FA 3IK2A 3AIUA 3MU7A 4ACZB 5BXTA 2DT0A 3TTQA 3CHCA 1KR0A 4LQ1A 3OLEA 3DYPA 2G41A 3WY1A 5A6JA 3PZQA 3VD9A 4P7OA 4D6CA 2RGMA 2X05A 1KXHA 4H04A 3RDKA 2DSUA 3FN9A 4HOZA 1W1VA 1GOKA 4FNQA 3KWXA 4HOWA 5DT5A 3HG4A 5A95A 1WO2A 1DWHM 2V38A 4D72A 3OA5A 2E40A 3A5VA 1V6UA 3EDJA 2WSPA 4QDMA 3VDCA 5EMYA 1FHDA 4MDOA 4CD6A 3VVGA 3AYRA 4EK7A 1JI2A 2BXYA 4TUFA 1H0IA 3OB8A 4P7LA 2A3BA 2YIHA 5FL0A 3MUZ1 4DM1A 4AEEA 2WPGA 2YDQA 1MXDA 1EQCA 3EJPA 3I3BA 2F61A 4UQCA 3VX0A 1B3WA 4QFUA 3GXPA 3WMCA 1UD8A 3PZGA 2D23A 1LLOA 2J8FA 1FOBA 2GFTA 3D4YA 1CXFA 1E4NA 1QW8A 2ZIDA 3AHZA 3F5KA 4CCEA 3AIBA 4YN5A 2NT0A 5E6YA 5A6BD 1W91A 5ABGA 3LRKA 4ACZA 3BLKA 4HZ6A 2ZUMA 5CPQA 1UD6A 2WBKA 1HTYA 3OLIA 1M03A 4C7DA 1G1YA 4UFKA 4WKFA 2VR5A 1E71M 2BY0A 3ARUA 4PMQA 1JGIA 4FLQA 1CNVA 2WHJA 4MADA 3IJ9A 2WM0A 1GJUA 5IXEA 3WD4A 2EPLX 1TMQA 2WMKA 2IUZA 1F4HA 4P7RA 4B16A 3HG2A 3NUKA 3OGRA 2Y24A 4W85A 1ZU8A 1N82A 3B9DA 2ZXQA 3BLPX 3GYCA 3WDIA 4KH2A 1V3JA 2PBGA 1J0JA 4PTMA 2W61A 1CGTA 1BGAA 1CEOA 2PB1A 2IGTA 4MB4A 2VI0A 1SMDA 2ZXDA 1HKMA 1RPKA 3N11A 3D3AA 2ZOXA 3GXIA 2DIEA 1DHKA 4UCFA 1B1YA 3VD5A 1I1WA 2DH2A 3W25A 1QI3A 1ISWA 3WNKA 1E1FA 3QR3A 4LYRA 3AS0A 3NSNA 1PX4A 1XD0A 2PWFA 3VM7A 1NWRA 3MS8A 4B9YA 4Q7NA 2DSZA 1FFQA 1OIFA 4M29A 3WQVA 5A2AA 4PMUA 3ZJ8A 1MVYA 5D9MA 3GBDA 3WQ4A 1W2VA 2WKGA 1DWFM 2GDVA 3UR8A 1VAHA 1EOKA 3K8MA 7TAAA 2ALWA 2JF7A 2FGLA 3PZIA 5JBEA 4L4OA 1W32A 1NP2A 3H55A 5D9NA 2OWWA 1UKPA 1WDQA 3ZM8A 2WANA 4H8UA 4W89A 5LA2A 1NWUA 4KGLA 3OGVA 1XH2A 1C8XA 4FNRA 2IXVA 2YL5A 1C7TA 1E6SM 2WHKA 3VUPA 3VIKA 2DEPA 2JIEA 4JHZA 3W26A 5A6BA 3WDJA 1K9DA 2UWFA 2VZTA 3ARXA 2VUYA 3WL0A 4QLJA 4CVUA 1W9VA 2V3DA 4B3LA 3BAXA 1TG7A 3UR7A 2E3ZA 2XM1A 1V02E 4F9DA 1UH3A 1QNPA 4NRRA 4AYSA 2DPEA 4P8UA 4DM2A 3WDPP 1I1XA 4UZUA 1UR4A 4XX6A 3W29A 1UR8A 3POCA 3SCUA 1BG9A 1CTNA 1EQPA 2VZSA 3GBEA 1UKSA 1UYQA 4JFWA 3ZT7A 4W8AA 5BXRA 3AXIA 2D3NA 1E0WA 1H3GA 1NOUA 1BPLB 4AIUA 1QWUA 3ZO9A 4DWSD 1TVNA 3GXTA 1U30A 1V02A 1OB0A 3SCSA 3EJRA 2WWDA 3CGTA 1JG9A 1MXGA 4LYPA 3CZKA 3L4VA 3AICA 3KL5A 2XSBA 2CPUA 2F7OA 2WAGA 1K9FA 1W1PA 1WDSA 3SCVA 1E5NA 1KQZA 1KR1A 1VEMA 4KGJA 3CMGA 4ZEPA 2C8NA 4PRWA 1R7AA 4P8WA 2VT0A 4HU8A 4UFJA 2J7BA 1TE1A 5FOOA 1YQ2A 3GNRA 3NSXA 4PMRA 4ACYA 4GXPA 2BVTA 1JYXA 3MO4A 2UY5A 2A3EA 1EHAA 3BMWA 2W5FA 3K4DA 1PAMA 2YA0A 3OIHA 1QNOA 2GDUA 3D52A 1CXEA 4BQ2A 3VIFA 5I3DA 1FH8A 3NIYA 4AIOA 3VIGA 1QVBA 2D0HA 1TQSA 1QNRA 4TOQA 4DUXA 1HKJA 1V3LA 1V3IA 4V2XA 4E8CA 1W9UA 1PS3A 5DMYA 3WBAA 3WENA 3IGUA 1B90A 2YKKA 1OM0A 2IXUA 2WC3A 6A3HA 4CD5A 4BQ4A 2JALA 1GJWA 1UR1A 4AZIA 4TTGA 1W3KA 3O9NA 2JE8A 4EANA 4J3TA 3WD3A 4YPJA 2J75A 1CYGA 3WF2A 1C92A 2XUCA 3WH6A 5AC5A 1ZB5A 1I75A 4PEEA 3VMOA 1JFHA 3ECQA 1HJUA 3WBEA 4UTFA 2Y2WA 4DWSA 1OCQA 2YJQA 2VRKA 1V6WA 2X0HA 3W28A 1HJQA 5EFFA 2DH3A 1H0GA 3BXWA 1UH2A 1H49A 1CXIA 1Q6DA 3VMNA 1GOQA 1ISZA 2Y8KA 1J0HA 3OLGA 3RILA 3GH7A 3W37A 3AIVA 2FGZA 2DQXA 1E3ZA 3BAWA 1R47A 1CENA 2XFFA 2J7GA 2CEQA 4JFUA 3VKKA 1HXKA 2OYMA 1BYBA 3SURA 3GNOA 3WL1A 2CETA 4CU6A 3L4YA 3FAXA 4TVCA 5KZ6A 1UUQA 3IANA 1UZ4A 2D73A 4NZFA 1LG2A 1XSJA 1ESWA 1JFXA 2NW0A 1HVXA 2ZX5A 3IAQA 1KBKA 3IJ7A 1TFVA 3A4XA 2X1IA 4UNIA 5A8MA 1V0KA 2FYVA 1V3MA 1W1TA 4WJXA 4R27A 1PX8A 2OSWA 2CHNA 1VEOA 3VSVA 3WEOA 3AXXA 2JIWA 1WPCA 4Z2KA 1E1EA 1SMAA 4TX6A 4D6EA 4UQEA 2J7CA 5HXMA 2GJPA 2F7PA 3EYPA 4URIA 4YHEA 1V6YA 3B9AA 3AMDA 1CPUA 2CHOA 2BNJA 5CXPA 2X2IA 1OD8A 2VO5A 3EDKA 1VIWA 2ZX9A 2WZHA 3CMJA 1K9EA 3TV8A 4MTVA 1MW1A 2ZUNA 4GQQA 3QGVA 1DWIM 3LPFA 1VFFA 3ZT5A 1FH9A 5A1AA 1PX3A 4PMNA 1V6VA 3T0AA 3BH4A 2D0FA 3KL0A 4EKJA 1Q6EA 4U3AA 1MQQA 1E0XA 1CXHA 5A8OA 3GXMA 5A6MA 5JUVA 2VTFA 1E4IA 3ZT6A 2CNCA 1WZLA 2WMFA 3BAJA 3DHUA 2WWCA 2EBNA 3ZIZA 4W88A 1HXJA 4F79A 3L4TA 3QHNA 3SUUA 2NSXA 1GUVA 2PF0A 3F5LA 3ZJ7A 3ZSTA 2VZOA 1B3VA 3HU7A 3LXCA 5A2CA 3AXHA 1AQMA 1QHPA 1VENA 1MW0A 3BUPA 3WDHA 1EO7A 4W5UA 1V03A 5HDRA 1HVQA 2E9MA 2XYLA 3PTQA 1WZAA 3SCRA 4WIWA 5HOSA 2VURA 2YBUA 5GNXA 3LXAA 1OGGA 3TTSA 1C8YA 5A2BA 2CXGA 2J4GA 4FNTA 2XN0A 1PIFA 1BF2A 4ATDA 1JZ6A 3AS2A 1NWTA 1BYDA 4HTYA 4JAWA 1B9ZA 3K1DA 4LX4A 2EPNA 2OWCA 1QNSA 3B9EA 4AMWA 5A8PA 2V3GA 1QPKA 2GVYA 2J77A 3PZVA 4Y7EA 3VGFA 4OBSA 3WH9A 3VGDA 5M17A 2WKLA 1UG6A 2VVSA 2J8GA 5E70A 3GZAA 5CGMA 1WDRA 4D6GA 3KE0A 1GOMA 4MNKA 1VFMA 1HP4A 4UQDA 4B3KA 3SCTA 4D1IA 3WUBA 3MMWA 2UY2A 1Q6GA 4D6HA 2JFEX 4RL3A 1JZ5A 3CHDA 6TAAA 1TR1A 4D1JA 3SCOA 4PSPA 1KWGA 5BWFA 1B30A 1QI5A 3ARSA 2Q8XA 3ZMRA 3K8KA 3ZQ9A 1JZ3A 3GTNA 1RP9A 3WELA 3EJTA 3S6TA 1SYTA 5DT7A 1G94A 2ZICA 3VTRA 3L4ZA 1H1NA 2JEPA 3B8SA 1R86A 3WDRA 1UHVA 3U5UA 2BHZA 2YBTA 1GQLA 1C8QA 2J7EA 3MANA 3AHYA 5M3WA 2EAEA 1XH0A 1BLIA 5D8WA 1JZ4A 2JEQA 4IPLA 3T0DA 1JXKA 3GXFA 5IFPA 3ALFA 5AYBA 1BAGA 2VX4A 2XIBA 2V5CA 1J10A 1UKOA 3W24A 3LXBA 3PHAA 1KWKA 1ITCA 2F2HA 1OBAA 4U2YA 1KB3A 4M56A 1GHRA 4H8VA 3DECA 3BCFA 1JDCA 1UQZA 1EA9C 3FY1A 1CECA 3PZOA 2FHCA 5A8QA 4WLCA 4F66A 1MW2A 1VBRA 3BSGA 4PUDA 1IV8A 1CIUA 4ZXOA 3KLLA 2E9LA 3WIJA 4CD4A 4J3XA 2WC7A 2XN1A 2MANA 3BVUA 1GOOA 2OSXA 8A3HA 2WMIB 4X0VA 1XCXA 1V0MA 4QP0A 2ZUUA 3RM4A 3VDHA 2WMJA 5IFTA 3GXDA 3WQ5A 1A47A 4MAVA 3F5JA 3A6OA 1GHSA 2XN2A 3J7HA 1GONA 4AD0A 4QLLA 1OT2A 2V3EA 3I3DA 2NT1A 2ZUWA 4JKLA 2E8YA 3ALGA 3L2LA 3S5YA 2VX5A 3ARVA 1GPFA 3BVTA 2ZX8A 5AC4A 3UG5A 2A3HA 1XC6A 3DHPA 2CYGA 3TOPA 1E0VA 2VJXA 3SUWA 6CGTA 4HMCA 2BVYA 1GOIA 1HJWA 4GO8A 4EE9A 5I6SA 2HISA 3SCWA 1DTUA 5CSUA 1UWUA 5A6SA 3FHQA 4GI8A 4AXNA 3IAPA 5FCZA 5D4YA 1X1NA 3TONA 1R75A 4M80A 3T2QA 1UWRA 5JIPA 1JF6A 5HNNA 4CN1A 3RCNA 4OUEA 3D5HA 5BXPA 1M53A 2YFNA 1BQCA 3EJUA 1JD7A 2Z1KA 3RIKA 2PWDA 3O6AA 2VQTA 1ODZA 2V3FA 1D3CA 2WMIA 4CN6A 1QWNA 2FHFA 1DEDA 3U57A 3WUGA 2EEXA 3W27A 1VB9A 3M07A 2XVKA 3L2MA 1E6NA 1UR0A 1W1YA 3HJEA 4J28A 1J11A 3I3EA 5CQ1A 3HG5A 3N17A 5HPCA 3FNDA 3VOCA 3BAKA 4BQ5A 3LPPA 5A3HA 4B15A 1AQHA 3QHOA 4AWEA 4AMCA 4CKQA 4UQAA 1B3YA 1R87A 4MPKA 3MUAA 4PMDA 3WQ8A 1CLVA 4OOUA 3KZSA 1RP8A 4MNMA 5GNYA 4HMEA 2WB5A 1EDQA 1ZJBA 3RMEA 2E8ZA 3VD3A 2WVSA 3A47A 3GM8A 1RD6A 4WKAA 5GNZA 3WH8A 1HNYA 1JYNA 1LL7A 1JXJA 1IT0A 4OIFA 3NDZA 1J0IA 4H41A 3CZEA 3N18A 1LG1A 2QV4A 4OGZA 4NZCA 1B3ZA 2YOCA 1CDGA 4MB5A 1CXLA 3T0BA 3VD7A 1GQIA 4P7NA 4DUVA 4MJ4A 2PWHA 1NP0A 1VF8A 4PSRA 3EMQA 4N42A 5BCAA 1V6XA 3UCQA 1QI4A 1XRVA 3CZGA 3LPGA 4NX0A 1TQWA 4JCLA 4W7VA 5CPSA 3PBGA 1ITXA 2YL8A 1GCYA 3VM5A 4DWSC 3W0KA 1XYFA 1E73M 4HZ8A 4AD2A 4FLRA 1G5AA 4CD7A 1XH1A 4U2ZA 3M7SA 5I24A 2WLZA 1VEPA 3G6LA 2E9BA 3PZNA 3AZTA 4TTUA 2OW7A 2ZXBA 2W91A 1CGWA 1UZ1A 1UKQA 1HX0A 2EXOA 1MFVA 2DIJA 7A3HA 2QF8A 2D20A 3AIWA 1IZJA 4ZE5A 5LYRA 1LWJA 2O9RA 4DO5A 1BYAA 1KCLA 4U5IA 3A21A 1JL8A 3WKZA 4PCTA 4M24A 1HT6A 3T2OA 2EQDA 3VIMA 3QHMA 3AHXA 5FL1A 3VX1A 5E1QA 2WSKA 2VX7A 3RM9A 4CVWA 1FP9A 3ARZA 1E15A 1OGSA 3VSUA 5ECUA 2E4TA 2WMGA 5AY7A 1O7AA 1FP8A 1QHOA 3VIOA 3DYMA 4EAMA 4IISA 3HN3A 5A6AA 3VMPA 2GSJA 1HP5A 1J12A 4GZIA 5IDIA 1VBUA 2X2HA 1DWGM 3N9KA 4MNLA 3ZR5A 4N0RA 3ARYA 4XB3A 1IZKA 1UWIA 4W8LA 4JKKA 2YA1A 3UG4A 4WKHA 4WSKA 1JDDA 3ZR6A 2XG9A 3AS1A 3NSMA 2VC9A 1CGYA 2BV9A 3RPMA 3OG2A 4FMVA 4KRTA 2XVLA 1BSIA 2G3IA 3NJ3A 3HZ3A 2X09A 2F18A 1JIBA 2YFOA 2VCAA 4AZBA 3BC9A 2XIIA 3AISA 1ZBKA 5E0CA 1HL8A 3WD1A 1O7DC 2PI6A 4MAZA 4RE2A 3SIMA 3WFZA 5CLTA 2VX6A 4WK9A 4Z2IA 4J3VA 2DT3A 3WY3A 1KTCA 3RO8A 1JD9A 4FNPA 3K8LA 1BFNA 3S2CA 3PTMA 3A4WA 4C7GA 3MSGA 4J3WA 3EMCA 3BUDA 1E6RA 1PJ9A 5I0DA 2W62A 2QHAA 5CGTA 3DYOA 1O6IA 3G6MA 2GK1B 1BG4A 1HKKA 5ABHA 4PUEA 3K46A 1YHTA 4JHOA 3D51A 4CCDA 2W92A 4MB1A 4M1RA 3WNOA 3AROA 3VNYA 1L8NA 4W8BA 2J62A 1QI0A 2VOTA 2DT2A 1XGZA 3VNZA 5EB8A 3A4AA 3KLKA 4U33A 1WP6A 4AIEA 1W9XA 2O9PA 3ZJKA 1KXQA 1LQ0A 2XPKA 4AC1X 3A23A 4OKDA 3SCPA 3VIJA 3EDFA 4E4PA 1B2YA 4W93A 1LL4A 1A3HA 3BUBA 1CGUA 1J18A 1P6WA 2FH6A 2W67A 4BCEA 3CTTA 3U5YA 9CGTA 3CBWA 1WCGA 2EADA 5FD0A 3CZJA 3POHA 2GJRA 3O2LA 4HA3A 3D4ZA 4AD4A 1BHGA 1WNOA 2D24A 1QBAA 4ZXLA 1TQVA 2C7FA 1VJZA 3VU2A 4JCMA 1UOKA 2W66A 4ML4A 3DDFA 4J7RA 3VIIA 3AFBA 4UFMA 1ISXA 1EOMA 3WF1A 3FXYA 1MWOA 2DSWA 2WHLA 4WF7A 3LX9A 1VJSA 3QOMA 1CXKA 4JL1A 2QPSA 1E6XM 1GVIA 1UWSA 5DEZA 3AI0A 1QBBA 3WH7A 1XD1A 2WC4A 5HPOA 1GQJA 2GK1A 3GH5A 3WEZA 2DSKA 1WZMA 3AHTA 1Q6CA 2QMKA 3OZPA 1VFOA 4IM4A 3T09A 1E56A 2F7RA 1E5JA 3MSDA 1G9HA 3CC1A 2B31A 2XFYA 2WHMA 4GKLA 2AMGA 4HPHA 1X6NA 1H09A 2ZWZA 3CV5A 3VINA 4JFVA 2WVUA 4AY1A 1HWWA 4Z2GA 3MV11 1AMYA 4V28A 3NDYA 3MI6A 4NF7A 4PMYA 4ATWA 4ATLA 4KWUA 4Z2LA 1V3KA 5A69A 2EJ1A 3L4XA 3AZRA 5E09A 4AZ6A 3N13A 1BGGA 1XCWA 3M46A 2FH8A 1Q4NX 1UA7A 2F1AA 1GQKA 4AZ5A 3SUSA 4HA4A 4GZEA 3BMVA 2VNCA 2WZIA 3CUIA 3RM8A 4LGXA 3GH4A 2ZX7A 3GXNA 4AYGA 2F8QA 1Z32X 4H8HA 5KEZA 3ARWA 7CGTA 3TTOA 2XWEA 2WLYA 2Y8VA 4PYSA 1XHGA 5C8BB 1KCKA 2XTKA 2ZXAA 1E9LA 1V0LA 3AHVA 4HU0A 3LMYA 1OD0A 2Y5EA 5I79A 2J7DA 1XYZA 5HBFA 3DX1A 1TUXA 1Y7VA 2BFGA 2C0HA 2XFRA 3DX2A 1KTBA 3EBVA 3FHAA 3CUFA 3CHFA 1OIMA 1HF6A 2G8ZA 1EHNA 4OJYA 1LJYA 2VZUA 3F4VA 3N15A 3WF3A 2TAAA 1UWTA 3VD4A 3UEQA 1W9PA 2CESA 5JBDA 1D2KA 1C90A 4F8XA 3OZOA 4U31A 4CGTA 3AIQA 2RGLA 3MUIA 3WMSA 2VMFA 3AZSA 4QCEA 1B31A 3LRLA 3AOFA 2VRQA 2OYLA 1ISVA 3OLDA 3A24A 4NSBA 4PTVA 5BYWA 1LF1A 2J47A 3VGBA 4FF5A 4CCCA 4MB3A 2BHYA 2BY2A 1J0YA 2DT1A 2CBVA 2DSVA 3CZ8A 3N1AA 4UFIA 4NRSA 4BS0A 2X2JA 2ESCA 5CPTA 3W81A 2GJXB 4GI6A 3MUY1 1LL6A 1H11A 2X0YA 4V27A 4LXFA 1EDTA 2OLHA 2WBGA 2FE0A 5FIPA 1PBGA 5BROA 3WUFA 3OGSA 3ZSSA 3BVXA 1C91A 4XZBA 3T08A 3LRMA 3AIEA 4KRUA 2EACA 3JUGA 1KFWA 2J79A 3AMCA 4PN2A 3SEPA 2CKSA 4CUCA 4AISA 2W4XA 4AMXA 4GPNA 1HL9A 1PEZA 3FW6A 3PN8A 1EDGA 5M03A 2GUYA 2OW6A 1J01A 4DUWA 3SUTA 4IUGA 1ZBVA 5A94A 1ECEA 4D6FA 2G3MA 5D8ZA 5A6LA 4J3UA 1ZL1A 3GDBA 1L0PA 1QNQA 1H41A 2WVVB 3VSTA 1JNEA 4LYQA 4RE4A 1WKYA 5JBFA 2WXDM 1T0OA 3VO0A 1GW1A 5A8NA 4AEFA 2VQUA 4AZ7A 1QX1A 1EH9A 4Q22A 2A3AA 3W82A 5I78A 1M7XA 4W84A 3PZ9A 8CGTA 1MQRA 1CLXA 3APGA 1QW9A 3TTYA 2WMHA 2PC8A 4PCSA 1E4MM
chains in the Genus database with same CATH superfamily
3DBXB 2A6JA 2Z7GA 1MF2H 3SY6A 5F7LB 1GKRA 5F9JB 2J88H 3UTOA 3M7FB 2B20A 3ATAA 4TQ8A 4IKJA 4WXYA 2AABH 4DEPC 2R91A 4LDOB 4WEBL 3S5NA 3OOQA 1DVXA 5E9DD 2OYKA 3B6SA 3WTVA 4WU5A 4YFEA 4A04A 3ARTA 4DP8X 1UKTA 3NIDF 3VWKC 3P0XA 5EPDA 2NY3D 4OIIH 3FUMA 3C60C 1R33A 5C09D 4FQQB 2JQXA 3ZDYF 2NW3B 1GZGA 1MI5B 1ADDA 1A64A 3SZKC 5E6RB 3DHFA 1P2CB 3QRGL 4OLEA 1FA2A 2VFIA 4DF2A 1F4AA 2G5BA 2YPLB 3TASA 3S0CA 3IKCA 1AFVH 4K9EH 2X4PA 1DZ0A 3VYOA 1BXVA 2DUAA 4MKMA 1JRBA 3WKML 3R1ZA 3WJMB 4YHOL 3L4WA 2GJNA 2XKSA 1ZTVA 4CAGA 1BXCA 3F85A 1S46A 4OKVB 2VDOH 4DKTA 2W1NA 4NBZB 2ROYA 1ITQA 4EQ3A 1D3GA 1DBJL 4U1HA 2UYLA 3C6LB 5T5FA 2IF7A 1KQYA 2G30A 4PIRF 4XKYB 5EMUA 1NEUA 1TQTA 1SM3L 4HKJB 4FNSA 1KXVA 3SPVA 4W9TA 5CU5A 4PUKA 4Q8UA 2I60H 3MTRA 2W63A 4X8XA 5DI8B 3V0EA 3D85D 1HILB 1MFBH 4QUOA 3RU8L 4LKCA 35C8L 9XIMA 5C9JB 4A39A 1URIA 1A3ZA 4GE8A 4OH2A 1CLOL 1I8KB 1CWYA 5DEGB 4H1LH 1JPIA 4ZQTA 3DV6A 1LWHA 4MF4A 5BOEA 1JCMP 3NOIA 5HDOA 3SE6A 1IGML 5JHBA 1ADQL 1UA6H 1MEXL 5C0DA 1DBBH 3WNNA 3FOKA 4UOJA 4FYSA 3Q37A 5F7AA 5IBLC 3EPOA 5IEHA 2V8LA 2ID5A 4Q2ZA 2VMEA 1IC5L 4UOZA 2BINA 5EH1A 4FP8L 3U6XS 2IKGA 1GOXA 4WOZA 1KIRB 1AODA 1I3RB 3RL1A 4BEQA 2QDGA 4MM1A 4XV0A 1ZLSL 4HW6A 3IMRA 3CL6A 2ZKYA 3H2PA 4IUOA 1W8GA 5B1KA 1E4KA 3UJTL 4FQXD 1NEZA 4M6QA 2WKJA 5FUCE 4C6NA 5EN2A 3WEXA 2NCMA 2HSAA 1XIWB 4PFEA 1JYVA 5JHAA 3S83A 5H8PA 1NM9A 4LNRB 4E3TA 2APTA 5MEOB 1RU9L 3DROA 3CLMA 1S2TA 1Z9MA 3RGHA 1SFSA 4BCXA 4Q8PA 3FHEA 1J8HE 1AW5A 1CTMA 4D6JA 1ZMYA 3KP1A 4NZJA 3P74A 5GRUH 2E28A 5B7MA 2K9UA 2DI8A 4R33A 3RFAA 2H45A 5AVVB 3CC5B 1I8IA 3GB7A 4L4TB 1J8HA 4MD4B 5GVJA 2FDMA 5JW5B 3GWQA 2RFXB 5TH2A 2OCZA 3FCTB 3SSZA 4DXKA 2H8PA 1PBYA 1FVEB 4M48L 1FFNB 1YNLH 4QEHA 3E6FA 1LILA 4GHRA 1FL6B 1L9MA 1TQCB 3QC5X 4JGMA 4EUPB 4ERGA 4HUXB 1P4BH 2P88A 1U8HA 3T2PA 4TQTA 4L9LA 3KHJA 5GGRY 5LDSA 1E6QM 3AWGA 3QCVL 4AD5A 1Q9LB 1OK0A 2FZ9A 4XPAH 2W27A 3FTZA 5GGRB 3C5ZC 2D03H 1IBGH 4AMKL 5AAMC 3CO4A 4M82A 2E9GA 3KW3A 2X3AA 2Z31D 3BG3A 3MHFA 1MH5B 4WGWB 4FCHA 4WEEA 1G9NH 3S5ZA 2I27N 1FXPA 3VXRA 4RR4A 5T8IA 1OM9A 2IH3B 2OMVB 1FL3A 4WJ5B 1IFRA 3OKYA 1F4YL 1MCBA 1ORSB 4P49A 3WQEA 1W8SA 5A7EA 4FX6M 1B0IA 2WNWA 3ZVHA 4KITB 1U8LB 1S78D 3EXJA 3CQPA 3SCQA 1INEH 2BNUA 3QXAA 4GYJA 3DVGA 1XGUA 2ITDA 1BDYA 3OLEA 2J44A 1NBVH 3FS2A 1OAZH 2RGMA 3GC3A 4L5FE 2Y7EA 1W1B1 1TZ9A 4HOWA 1U8JA 3A6BL 1DVTA 3RVXD 2V38A 3OA5A 4QDMA 4CC0A 1FF5A 5HR7A 1DQXA 3V5KA 4BSWA 2AGTA 3KOFA 3OPSA 3NK4A 4AEOA 5L4IA 2Z8SA 2NCEA 2J8FA 4W4QA 3MRRB 3R8RA 4M8RA 1P0KA 5SX4H 5AOIA 4IGMA 3TFXA 2E9WA 2HJKB 3TTEA 3TR9A 2BC4B 4QX4A 4QXGL 3MA8A 1UC6A 1G1YA 4NM4L 2X89D 2AANA 1VLXA 4KROD 1OIOA 2FIKA 3NFNB 3DO7A 8FABA 1M2VB 2GJZA 4QXUL 5I19H 4Z7OB 4DGUA 1E5BA 5FOBB 2BS8A 2R59A 1KXVC 1SMDA 1J5SA 3HKZA 4MAUH 3E49A 5J1SC 1T7VA 2HG5A 1QI3A 4E9TA 2CR0A 4I5BA 3DLQR 1RPQA 3CFEB 4AM0Q 1ZHKB 3GBDA 1E8XA 2J5WA 1W2VA 1E9QA 4LSRH 4LFHD 1ET8A 1EIXA 1E9ZB 2DZVA 2CK2A 3CE1A 1SVDA 5D9NA 2GTZA 4JHBA 3N3TA 5DZ9A 4TSCH 3LHTA 2BSLA 1PB0A 3VIKA 4YSDA 4QJ5B 5KVEE 3TL5A 3S2LA 1E9PB 2PPDA 3UNDA 1TG7A 2E3ZA 2F54B 4I8DA 4DQAA 4TMCA 5GIRB 3TR2A 4YWSA 2ALDA 4F0HA 4P46D 1LEIB 3CSBA 3IMWA 2OEJA 1K7FA 4NPYA 5CZXC 3TXZA 5DU7A 2QTVA 4JFWA 4M1BA 4XPHH 3TX4A 4JHAH 2WD0A 2YMXH 2XU9A 2YAPA 4FXJA 1UM6L 3NJXA 1JCTA 5FYJL 4XHJD 3EYOB 3BLIA 4P5MB 2G9KA 1KQZA 3CMGA 3AFLA 5DUJA 2DBLH 4KAQL 4UFJA 1FGNL 3NRPA 3I6KA 5DRNA 2G5RA 2H3BA 2Q8LA 2CLLA 3RX8A 3W2UA 1Y1UA 2NQ5A 3CPRA 2YXWA 2IMRA 5IB1A 3R94A 5HJYA 5BRZA 4LEXH 3N55A 3F6JA 2V81A 2J4WH 5KSBF 4X6EB 1BZ9A 5CNHA 5L4JA 1VFAA 5JVLA 3RVTD 1JK8A 3HPLA 1HK6A 3QI9A 2Q0ZX 1WFOA 1GJWA 3KG5A 4FABL 4IBYA 4EZJA 3PLYA 3CH1B 4HJGB 3B8IA 4XZNX 1OB1A 2XUCA 3D9AL 5HMDA 1I75A 4KQ4H 4PEEA 4TL4A 3W28A 5E08L 3JZUA 4C56B 1H6FA 1YQVH 1I2NA 3G0SA 3QWQB 5DT1H 5EF1A 4KKRA 3OZMA 1OAXH 3P40A 3WL1A 3FAXA 3QUYA 4XNXH 3F12A 3I10A 1A9EA 4YDLC 3A4XA 3QR2A 3BP5B 4V1YA 1P0DA 4JTDA 1NCJA 3G5YB 1AH0A 3K81A 4H6QA 2KDYA 1PV8A 4URIA 1TQJA 2BMKA 4LVEA 3PXLA 4XI5D 5HNUA 3VE7A 5FYJD 3UAJD 4X4ME 5C9ZA 4ONFL 2YD9A 1QTPA 1H5BB 4MCMA 2ZONA 3BURA 2DZEA 4FAMA 2BWQA 4X4KA 4U4IA 3ZT6A 1GIGH 4ZPVB 1WS7A 2WWCA 4AWUA 2X4UA 5DC0A 2CZDA 3FC8A 5T1LD 5DMLA 1MRFH 3W86A 1EC8A 2EIJB 5A2CA 3CDGB 3AXHA 4GH3A 1ZSDB 1TXKA 2XYLA 3SCRA 2VURA 1U1HA 3BSZA 1L2UA 3UGEA 2DDQL 4DJMA 4I5UA 3DN5A 2Y1YA 4WR3A 4Q33A 4LCIH 4A2FA 4ACPA 3GBNL 4B9GA 4M43L 3QWOA 5EBLB 1B3IA 5AVUB 1GHFH 2Z6FA 1CW2A 3H3KA 3C56A 3IGSA 2EDXA 4MWAE 2I1OA 4Y2LA 2DPKA 5ADPH 3CHDA 3B34A 4D1JA 3E3HA 3VKBA 5HPMB 3JWNC 2IALB 2Q8XA 5IREA 2J1WA 5IHUL 1I7UA 1SHMA 4HPOL 4MWAA 2DLFH 2F53B 4ZOAA 1Y07A 2X1QA 2WLIA 1ID5I 4XNUH 1E4JA 4JM2D 5ECGA 2C9PA 2VX4A 5DRZB 4LE8A 5IIEB 2IOMA 4UTAA 2BM3A 4WNSA 5FA5A 2BVQA 1YPZB 4LBUA 4WHTB 1RK7A 1NUDA 3KTXA 4LSPH 4P4KA 3FY1A 2BNQD 2CGRL 5D71H 5A2LH 2C1IA 2X9ZA 4F66A 4JTIA 1RZFH 4CMHB 1IV8A 1Z9LA 1BXXA 4G59C 1EC7A 1RIUH 4HS3B 2B16A 1KB5B 3SDCA 3MOAH 3VFOB 1R9YA 1ZLVH 5T33L 5IFTA 1HHHB 3FJTA 1ZLUK 2HLFD 1GYCA 2LAAA 2NY7H 2PDNA 1XBDA 3I9GL 5DZLA 3BLOA 4S2BA 2CCVA 2PTYA 4LEBA 4HWBH 5EN3A 3ANVA 3GHBH 1NCGA 1ICSA 4PR4A 4O00A 4AY8A 3SUWA 3VI3F 1O6SB 1I2OA 1DKWA 3AY4C 4LANA 1GEQA 1UWUA 5G1YA 3JWDH 1FQ0A 3EYFA 4L3CB 4BFAA 2K70A 2FJHB 1PKMA 4PUUA 4Y5YB 4MMXA 4GEJA 3NZGA 5LAXB 3UGUA 2QCDB 1RUMH 2EEFA 2VQTA 4HF5L 3OJDA 4OIAA 4JY9A 5FHAH 5LUMA 1QWNA 3F58H 1TPVA 4JHMA 4DVOA 5I1CH 5LKNA 3MLRL 4UQ3B 3IE9A 5E9DB 4PJ9D 4F1SA 1IAIH 1JZJA 1DFBH 1NCAL 3L5AA 3ULVF 3WAJA 4R0LA 1HHJA 3C0QA 5IBTL 2NY3B 1NUNB 4HOMA 1R87A 3ETSA 2BLEA 5C09B 3FU8A 4B9KC 4K07A 2YUXA 4MMYA 2E8ZA 2AK4D 3A47A 3DSFH 3QG6B 4WSHA 3N2BA 2X4RA 3QI9C 2AXGA 1U3JA 4UINH 2BOEX 2ZKHH 4MS8C 4MJ4A 2DQHH 4OD3H 5KTEH 5M95B 1OX4A 1XRVA 4IJRA 1MHPH 4MA1B 4C6IA 4GRMA 3UTZA 1TQWA 4R26L 2D2HA 5F4WA 5HJ3B 1TTPA 5I5MA 4LSVL 1KMGA 1B0WA 1NAL1 4HG4J 1NWPA 5F70A 2KX9A 1A7QL 1FZKB 4GAYB 3RZCD 4U1LA 1W15A 4HH8A 1XAKA 4N8CL 1R3LB 2XQ0A 1YEEL 2F5AH 2N7SA 1GYVA 5IHHA 2EKCA 1O66A 2WYHA 2DL2A 3EYQC 2Q02A 3HQ1A 1JV2A 1Y0LB 3L3HB 3MLTB 3BTNA 4Y4HD 4G6MH 3D85B 4GZIA 5IDIA 4F1ZA 2VJ0A 5DFTA 1NWOA 3RPKA 4ZUWA 4I6KA 4XB3A 1N4XL 3FU7B 2C3VB 2NZIA 5HGBA 4WSKA 3MLYL 4KKNA 3OG2A 1L9PA 4IIQA 5G5DB 4IRZH 1AQKH 2FTWA 4CKVX 4DLMA 2YBRB 4XWOD 4KRZA 2Y06H 4DF1A 4O4VA 3TJHD 3UWVA 1ZLEA 4ZBJA 2WJFA 4GMEA 5LXXA 1T5AA 3RIAK 1AR1C 1QD0A 5H35A 1BXUA 4ALAH 5CM1A 2G4EA 2CLEA 3DYOA 4C6BA 4PH8A 3D7PA 4N0UE 1Q6OA 2BW4A 1E2WA 1VA9A 3CWHA 4RPQA 2QNEA 1L8NA 4GUIA 3RCMA 3FQTB 3EB2A 1QAPA 1RJPA 1XGZA 1TJIH 3TA3A 1WHPA 2O9PA 3HVNA 4N0UA 4O2EA 2NNXA 4ZB0A 1A6WL 1X9QA 3S3JA 1A3HA 4KRPD 4MJID 3FB5B 4JFQB 2WOYA 3FT9A 1PVNA 9CGTA 1WCBA 1EXUA 4ELME 5SWZA 1UPPA 3D4ZA 4AD4A 3W07A 3LYEA 5D7KD 2W66A 4J7RA 3NPZB 1Q7QA 1EOMA 3FXYA 3C2VA 4LHQB 1RHHA 1IT9L 4OTXL 4MWAC 3GMMB 5C0BE 5IJBC 1AG6A 1FZOA 1FPTL 3UJ2A 4I90A 1RZ8A 2WP3T 1B4KA 1JJUA 4V28A 1WFJA 1BBDH 1TRIA 1Q2RA 3MSRA 3DENA 4NQSA 5E09A 3EGXA 4LDLB 3N4FA 5BOFA 4L3AA 2Y7SA 4DF9A 4OJAA 4AQAA 4P4KC 1L5GB 3O9WA 3BZEA 4DCQB 1DBKH 4IKIA 4ZFQA 4FKHA 4MFDA 2WZIA 5CC5A 2VUOA 2DI9A 5GGUB 3GH4A 2HKHL 2YJLA 4MA7H 3DFQA 5JTWA 4WZHA 1M6UA 1FVPA 3GSNB 3SDCC 4HU0A 5KVFH 4OJYA 2ISVA 1H7RA 2DZPA 3VXNA 2P44B 5LHDA 3F5WB 3RDTA 2Z31B 1KENL 2A0NA 3LA4A 4G1MA 5HMEA 3V36A 3N3MA 2QAPA 1J1PL 3BGMA 1LF1A 4CNUA 3V4VH 3I6GB 4QXTB 3LDBB 4ZQNA 3KVQA 1BQLL 1T4KB 4AGQA 2DJMA 4XCCL 3R8QA 3SY1A 3FCUB 1A4MA 5EIVA 3KVDD 2GLKA 2NQ9A 1XGPB 3NJNA 2FJKA 4MMXC 3NQ8A 2MIZA 4NQVA 3STFA 4KRUA 2WPBA 3WS3A 1KFWA 2ZF8A 2YCLA 3MSYA 2Y85A 1J01A 2EG8A 4OUIA 2AZUA 4Z0JA 4WKZA 1ZK5A 4R0LC 4ZTXA 3GIVB 4RE4A 5J3HD 2WXDM 2RDXA 1WBXB 5J13B 1EH9A 3MPGA 4NAEA 4PULA 4OQTL 1XSOA 1CZ1A 3T44A 2G3NA 4NASA 4OFDA 1KTJA 1VD6A 4AW7A 1DVFC 1E4XI 1BAFL 2VR4A 3RZWA 4KX7A 4AK1A 1W56A 5C07E 4Q8MA 3MC5A 3W1UA 3Q7JA 1MI5D 5HHMD 5FECB 5I6XB 4W7WA 3KJ6H 5LBGA 5INCB 1DL7L 5FKYA 3NSCA 1YVLA 3MRQA 3ZDZF 1J05B 4KROB 1IEXA 3IDYC 4ZOBA 2XDHA 5AECA 5C07A 2YPLD 5CCGE 4LPTA 1YDPA 4P5KB 4MFEA 4FX7A 3TA9A 3ULUF 3MRHB 1GOFA 2Y07L 5B7ZA 3ASNB 4FFYL 4NNYA 1DBAH 3QH3A 2OT0A 4UTLA 4L1SA 3FB6B 4NKOB 1OGBA 3CG8A 3CFUA 3NURA 3U9WA 1G6CA 3EWZA 4LH8A 4KIEA 2HVJB 1KULA 3LH8A 1UMLA 1PQZA 4H8QA 3UBPC 2CMRH 3Q8BA 2ZRZA 4BFIA 2WQWA 2Y4SA 2VJ8A 5C0AD 5IB2B 3CWNA 3K72B 4QRPD 4Y8DC 4I8YA 3FYIB 1UWXK 4PJ7B 5AHLA 4ZFGH 4IIQC 3FOMA 4U0QB 1BF5A 4GC3A 1M9HA 2XV0A 4Z5RB 3O0FA 2ZUTA 3NYKA 1EO5A 3GDLA 5DZPA 3H2QA 4HWUA 4HSCX 3ISIX 1T03H 2V7HA 2O6PA 4XP6L 5F93C 3N50A 4QKTA 3BT2L 2DM2A 2LGNA 4NZ4A 3NMEA 3FTXA 4LEOA 4P46B 3VFNB 3DX9A 3W72A 5E9AA 5E2UL 4Z0XA 4XMPL 1ODAA 2HUHA 43CAA 4INFA 2VXUL 3H6AA 4OZGB 3PHQA 5EKYA 5JW4N 4PBVC 3LKRA 2P0IA 2PABA 1IEAB 5EZOL 3N12A 3TESA 5GPRA 3W87A 2QVKA 3L6FB 2XZ9A 1FNEB 4O17A 4AWJC 3DX0A 1X9LA 4E9WA 3FQRB 1RPXA 2NXYD 3D1MC 4DJDA 4M02A 2DLTA 3Q6GL 2XCMC 3NQAA 3BUVA 2QJJA 2VEIA 5DJ0A 2X0SA 5F89A 3C86A 3RP1A 1MLBA 3UZYA 2EO7A 2HX9A 2WYSA 1RZPA 2GT9A 4W7UA 5G4OA 5BV7C 1YDNA 1KPVB 2GQHA 2XACC 1U3HA 5AHNA 5FYKE 1H15B 4OQ1A 1L9NA 4UNUA 1XIWD 2G5WA 1OV8A 3X12B 4DSYA 1S5IH 3VI4B 3V0VA 3Q4DA 3GSUA 3P11L 4KK5C 5E0FA 2NR6D 4JHWL 3O9WC 5HD8D 2ZXEB 2PO6D 1IJNA 4TPRL 3TIDB 2CIPA 3SCNA 4NXSA 1F2QA 2ATSA 4HIBA 3KS6A 1BQKA 3U7WH 1XKYA 4KVCH 4F33A 1IQDA 3MB9A 3T71A 4AB4A 2YGNA 4KOBA 3DWTA 4KKXA 1S9VA 1MEWA 1V3HA 3CK5A 4AW4A 1XLAA 2B77A 2WUBL 1X5YA 3DRQB 1YNTB 3P3BA 1TTUA 4GRSA 4PWIA 3SODB 5CKSA 1Q6RA 3TNOA 2OG9A 2KZKA 2VXVL 1YW1A 4YSEA 2BGQA 1KBGL 1GS7A 2WK2A 2NSOA 4JO8A 4PP2B 1B57A 1EP3A 2C4FU 5I8EB 5J57B 3LKNA 3WN6A 3FB8B 3CV2A 3L16A 3WLSA 5ABFA 3WUEA 3DX6B 3CHSA 5I5RA 2X8RA 1TO4A 3HZKB 5JLZA 1AGCB 5L6YL 4GY4A 3EGDB 4MNJA 3BJLA 3BPOB 4FTVB 3U1SH 2OGYA 4Y19E 1JRHI 1KM3A 3NWRA 2VDOB 4G8IB 4AZCA 3STGA 2PCQA 3FTGA 3MLWL 2V5LA 1IUZA 5JXAH 4AYFA 1NKRA 3X13B 5FEPA 4AXWA 3M0JA 1VHPA 4TX9A 3LMJL 5JO5A 1KJVA 5D7EA 4ORMA 3UJEA 7PCYA 1ZBCA 2Y3AA 3O6FA 1XQ4A 3ZTJH 4HGWA 4GT7A 3AIRA 4Q8VA 4ZMWA 1GNXA 3I85A 2BO0A 5CBEB 5JHLL 5ETUB 1QVOA 4LHUA 3WHXA 2DT0A 1IKNA 3HB3C 3UROR 1H7WA 3O6YX 4KCTA 3C9NB 3ABZA 4HHHA 1DJNA 4NL1A 1S7TA 2NNAB 1I8AA 3US9A 1RK0B 2VHLA 1PD1A 5DELA 5CGQA 1WO2A 4I3RL 3ABRA 2GBVA 3NZ8B 4WW2A 5FLVA 4H2HA 1T1WB 3EWYA 4Y9GA 2UZXB 2OMZA 4XN4A 1BQHA 3H23A 3VX0A 4XO6A 4KUZL 1B3WA 1XIIA 2A6NA 4GACA 1I1YB 4P4RB 2BNQB 3D4YA 4ONGL 4JQAA 1NAMH 2ZIDA 2AEQH 2WQRA 4NJ9L 2C14A 4BV1A 4AVIA 3ESUF 2WBKA 1XIEA 4ASTA 1M3UA 4XNYL 3DJSA 3ITLA 4B16A 1E4HA 5DQJA 3WUWG 1C5BH 4QRQB 3WDIA 4E5TA 3EOUA 2P24A 2OMUA 3Q8FA 5LNRA 4WY0A 4U1SA 1UM4L 2YK1L 2L8AA 4JQIL 3BLFA 3GXIA 5IFHL 3OVUB 1PTGA 1B1YA 2QSVA 3LB6D 2B59A 3SYAA 2DAVA 1PX4A 3DPDA 2IQ9L 1X7TA 1ETZA 1IEQA 2B3IA 3KPNB 3FUJA 1ZT4A 3RUBL 4JICA 3WV0A 3TBSB 4JTHA 1F00I 4KGLA 4BRVA 5I1IH 1C8XA 3FNKA 3V0UA 4DJDC 2DEPA 3M1OA 4PJ9B 1AL8A 3KAAA 2DWTA 1ZPUA 3UBXB 2OZTA 3LIZH 2FIQA 4NRRA 3BD5A 3NL2A 4FXKC 4I9MA 5CCKH 4UZUA 1KSRA 4DKEL 4PJAE 4BKTC 4C65A 1XR9B 5DEFA 4MS6A 1MIEL 2R27A 3G04B 3ZO9A 1PSCA 2CZVA 5I17B 1E5YA 3AUWB 4C4BA 1JE6A 3QPKA 4E41E 3SPIA 3OU8A 3QMSA 1WDSA 4KGJA 3URNA 3C60A 2A2IA 3ILPA 3SE8H 2G75B 4G6JH 1IM9D 2PDJA 4E41A 1WD8A 2EILB 2MQ0A 3KDMB 3CZFB 3IWUA 1AFSA 2WYZA 2W5PA 3GSWA 4S1RH 1OALA 3WBDA 4BQ2A 1U8MB 4TUOA 3K7UA 2V7NA 2OP4L 1JGVH 4L3FA 3RZCB 4V2XA 3CH8A 1UBPC 3WBAA 1W1IE 3IGUA 4XGZB 4GBXD 4MD0A 2IBBA 4YHML 2W80C 1ACYL 4AH7A 2NTSP 3WF2A 3G1AA 1CU4L 1NDGB 4Y4HB 1T1ZB 4MVBC 3FFOA 4LLDA 4Q4QA 1DQJB 1BZEA 4DWSA 2KL6A 2YJQA 1AGFA 5DDHB 1KLFA 2EZ0C 1H49A 3IIZA 1ISZA 3EO1B 4RQQA 5K9KB 1ZCOA 3DHMA 1IC4H 1JGDB 3FO9A 1WXZA 1Z3GL 3BAWA 4FN0A 5CJXA 2CEQA 4FERA 3VKKA 3CFJA 3S5LA 4G8FA 1EP2A 3OG3A 2D73A 4HUCA 1FNGA 3Q2WA 3NSDA 4LCRA 4QF1B 2VE6A 2GITB 5A16B 2P5EE 1NPUA 4HCRA 1WPCA 3VFPB 4YVVA 2IANE 2HFEB 2P5WD 3WN5B 1XRSA 1O9ZA 2HH0H 1FWDC 2BNJA 3CUPB 2VO5A 1GGOA 2WBJD 1MW1A 3XINA 2P5EA 3ZT5A 3ZVVA 3QQDB 2EH8L 1GGUA 3LBOA 4ZMPA 2BFVH 4KRPB 4MJIB 4FP1A 2XICA 1V8HA 5E00B 1P0NA 4WDIB 4P5TC 4XG1A 1E6JL 1YTEA 5E6UB 4HLZH 5DZOA 5FO8B 4KW2A 4TQIA 2N1TE 4PRBB 1EO7A 3TU6A 1AGBB 5HDRA 5DYOB 3MRDB 1TU2A 1PHWA 2OTWB 4QIRA 2PGRA 5I3FA 1W0VA 3MDUA 3ZRSA 4JGNA 5DJAB 1UWEH 3AZUA 1QWHA 4WW2C 3M0XA 2ZXWB 4N85A 5SWSE 1S7WB 2VVSA 1TIUA 1UENA 2J8GA 3QV9A 1NICA 5E70A 4NENA 3U30B 1GOMA 4ANWA 5ENLA 2V5BA 3H3BC 1G7QB 4RL3A 5CU9A 5SWSA 4FQJL 5D1ZI 1TJMA 3OQ3B 2YS4A 1KWGA 5BWFA 3I6LD 2LQRA 4YSRA 3EJTA 3RWFB 4NJHA 2CKBL 3SDXB 1R5YA 1MJ8L 4UT6H 1CDUA 2PXYC 1DCEA 3CV6A 5E4AA 2EDRA 4DAGH 1EWEA 3HPXA 3CQJA 3RJQB 3ZYZA 3CT7A 1XBXA 2J7EA 2ZA3A 3NZRA 1CFTA 2WXKA 2H3DA 3GXFA 4I9TA 1WF5A 5INDA 2Y2TA 4QHNB 1UKOA 2YDAA 4XIMA 1E42A 1OBAA 2DQIH 4M56A 1M7UA 3O8AA 1IILE 5HDBF 2H41A 1RZJL 3GSQB 3MWAA 3PZOA 1OM3L 3BSGA 2OA9A 5DMKA 2BVOB 5H8UA 4MNHA 5T3ZL 4CD4A 4B2DA 5F7EH 1ID2A 2IPWA 2PS2A 2OSXA 4JB9L 2ZCHL 1TZZA 3RM4A 4ZNEE 4GCAA 3PGDA 5DUPL 3OPZL 1IU1A 1FHNA 4FQLL 5IQMA 3ZUNC 4X4XA 3OAZH 3I3DA 2QHLA 4BRJA 2NT1A 1HGWA 2FZDA 3MTWA 4YOKA 1IGYB 5C0ND 4AIXA 4ZNEA 4JTFA 3V1PA 3BVTA 2ZX8A 3FH5A 2XY2A 4XMUA 2AAVA 5E6IA 3VFVB 3RWGB 2CDGA 1A5OC 2NY4D 1A4CA 4XTRC 5J4MA 1CDIA 2NMSA 1FWBC 1I7RA 1SN2A 1DTUA 3RKDC 3LCYA 4QXVA 1FFOB 3BVNB 3SPHA 5TDOA 3O4LE 1TZAA 1XF3A 2ZQ0A 1CCZA 5ISZD 4ELKA 1Q9OA 1J5DA 4Q32A 3O6AA 2DD8L 2P5NA 1D5XA 2WMIA 1VLWA 4ORGB 5KINA 2CNZA 2DIAA 2NV2A 2EEXA 5D2VA 4GRWE 3O4LA 4Z1CA 3LKQA 2JKLA 4WHBA 4FQ1L 4LOUC 4DQOH 1UR0A 4XTDA 1T7ZA 5HHMB 1QT1A 1REIA 4XVTL 1OADA 1F6YA 3N17A 4HBCL 3VOCA 1MFAH 1HXMA 1A6AB 3IDIA 4HZLA 3RL2B 2H1XA 1F02I 2ZOOA 2FZ3A 3GM8A 3O2VH 3I75B 1MAKA 3RYSA 1UATA 3AB0C 5EZLB 4YBLB 2CPCA 3ROOB 3W11C 3VOJA 3P9LB 2BIPA 3O6DA 4BSJA 3NVTA 2Q01A 1A21A 1UVQA 1U8CA 4B7LA 4UIMB 1I7TA 1T1XA 4I2XE 1P69B 4DRSA 4HFUL 4G3YL 4DWSC 5F96L 3W0KA 5C0AB 1LBLA 4CD7A 1CL7L 1XH1A 1LO2L 5T3ZD 4QRPB 3PZNA 3M5ZA 1CGWA 1QPRA 2BP5M 4J6RH 4LLQB 2Z26A 5KG9A 1IZJA 4I2XA 4PJFE 1BYAA 3TK7A 4YGVA 1KCLA 5LDUA 4U5IA 3G6JB 4XCFL 3ECWA 5CJXC 1J5OH 1XR8A 3B2DC 4YXLL 1ZNNA 1QSEA 3N85H 4GGHA 5JZ7D 2X4TA 1F3RB 2ZCLL 4PJFA 3G1SA 1DEEA 2APFA 1EMTH 3KS5A 1FL5A 2BNRD 3VH8G 3SGEH 4RDYA 3NZQA 4Z3FA 1QNIA 1UGKA 4JEQA 1VPQA 4B4FA 4UBDC 3GSNL 2YB4A 3UG4A 4PWGA 4PJIF 3AS1A 4GP8B 2VC9A 2HTKC 4DVRH 2X40A 4O4YL 4AZBA 4BDVB 3S3CB 1DBTA 1AKJB 2LU4A 3A0OA 1N5AA 2NXYB 3HNSL 4GMSH 3HQOA 2HVNA 1AIFA 4JHUA 2BSRB 4NQCE 2XX1A 1G4MA 1JD9A 2F68X 3WCZA 2OCCB 1HH6A 3FO0L 4C7GA 3EMCA 5KSUA 4O1AA 4KMTL 3QFDA 1BZOA 1IC7L 3SKJH 3QJHB 4HJUA 5J6HB 1KXQE 2QEZA 4KJQD 1QFEA 4NQCA 2DEWX 4ZO7A 5EGRA 1Y18B 3V0IA 2UX6A 1PG7H 4Z7UB 1CFSB 1OP9A 1W9XA 3B03A 1SFLA 1KXQA 3CCHA 3A23A 4J23A 2FFIA 3KTCA 2CCWA 1JGMA 1C08B 3CTTA 4U6XA 2QDHA 3TW9A 1VR6A 1BHGA 2NY6D 5D93C 5E24E 2PO6B 1NCTA 4ZW3A 4DZBA 3ZO0A 3AFBA 2E47A 1WAEA 1QA9A 4L23A 4BXVA 1CXKA 4G5DA 4G7EB 1M1XA 3BZ5A 3LIUA 4EF9A 1TYEB 2VSDA 3EOLA 4EXQA 2FL5B 5LIKX 3CV5A 4BKNA 4IBTA 3TA4D 5KETA 2WNKA 1FG2A 1ZLPA 1JNHB 3WLHA 2FK9A 1G4SA 4CNPA 4XO9A 2E27H 3MRMA 3THML 3SUSA 4S1SH 4ECLA 1RUAH 2IFFH 4XP4H 3E0WA 4H8HA 3VXRE 3ANYA 1JZIA 4W4OA 4ETQA 3UMNA 3WIHH 5JOPE 5B1AB 1ZAIA 3T7VA 3U9UA 2NZ9D 2XWRA 2DB8A 1SFJA 3R0DA 1LP9F 3SRFA 4N9OB 3SDOA 1LJYA 3UTTD 3MRFA 4BFNA 1QFOA 1WWAX 5I73B 1MZYA 4H8WC 1U91A 5AVQB 1YMHA 3EYUL 3T55A 1QLRA 1B31A 3AOFA 5E6IC 4X5LA 5TFSH 4BH8B 2BHYA 2GSGB 1QPQA 3ECBA 4OM1L 2AHIA 4RGOL 2HDJA 3E9UA 4HIJB 3TJEH 1C12B 1W5NA 5HVHB 3TSDA 4YYFA 4CQ8A 1FWGC 4AQLA 5I15H 3UBHA 4CJ1A 1WRFA 3BOXA 2X4SA 4ZMGA 5ICYB 3KBEA 4D9RE 3ZJAA 1ZD6A 1EJ8A 4LCCB 1CGSL 5F7KC 4K3JL 1ZCRA 3WFEL 3FUEA 1RSCA 4K2SA 1GGBL 3FKKA 2LLEA 4M3PA 3EZJB 2FLIA 1OWWA 4LLVA 2NX5A 1A1NA 3L23A 4MX7B 3JWNE 3VO0A 1NCOA 1A3WA 4Q22A 3N25A 4ZMQA 4QHMA 2E76C 4YIQA 4ZQKA 1OC6A 3W7NA 3NAAH 1D9KA 1IEIA 1W9DM 4A29A 4FHKA 2D1ZA 3U7VA 4L5ZA 2ZZ5A 4BJHA 3TWCH 4JY6A 4HNCA 2VUKA 4YAQB 1E6ZA 4EZKA 1RUQH 5CD5C 4O4WA 1SLVA 2B9AA 4ADUA 4DO4A 3ZLHA 2EYSB 2MHAB 5ADOL 3VGHA 2R9HD 3ESOA 4HSNA 3CU1A 2NY1C 3PZUA 4C5YA 3L3OB 4FGMA 1GPOL 4R84A 3HPSA 3FO2A 4RNJA 2FX9H 4P7QA 4BA0A 4LAZA 4L4VD 3W6MA 5AZ2L 2F2KA 1RUPH 2E6QA 3I02B 2BJML 3SYCA 1L6PA 4PLOB 4HUWA 1MF2L 4QRRA 1CC3A 2J88L 2XGBA 4Q3MA 3BEWB 5JIIA 3K5SA 3CZLA 2AABL 3WDQA 3GUTA 2L3BA 3WFHA 1OCRB 4OZOA 4EXBA 4K7VA 5BMXA 4UTWC 3K6DA 1Q6LA 2E75C 4HHGA 1MSPA 4OIIL 2FIRT 4LQFH 3WLBB 1L7IL 4WSGA 1M7PA 3R0NA 2ADGB 4TXEA 1NFKA 3PF3A 1Q63A 3WG6A 4PMZA 4IPIA 4QRSB 3FT3A 3OQEA 3U2EA 2YD5A 3AY4A 4H2AA 4OZIE 1F11A 5EBWA 5FESA 2WCSA 3QIWC 2KQNA 2VISA 4LT9A 2I32A 1AFVL 4K9EL 4E2OA 1FH2A 2YLHA 3KLQA 3PV7A 2N3JA 1GG0A 5BO1H 5BRZE 4OZIA 1V54B 1N8FA 4KKBD 4XAFA 1KLGA 4CQAA 1GW6A 2X53A 3QO1B 4J1UB 4CU8A 4GAFB 5KYWA 4J40A 3O6LL 4TF4A 1A5LC 2G4GA 4H6KA 2Y25A 5T1MB 2IG2H 2HA1A 5ABAA 2VDOL 3CDFA 4P59H 4AJ0A 3KRBA 4PJGB 1QLFB 1IM9B 3UERA 1KCUH 4K8EA 4JY5H 3IDNA 2XVBA 2VLLB 1P7TB 2OWXA 3SUVA 4J2XA 3NTCH 2PCPA 4RV8A 3DSNB 4E9SA 3TP4A 2I60L 2QDVA 1P53A 1P5VA 1MFBL 2PD5A 5IESL 3OXSB 1R9ZA 2E68A 3CIQA 3MFFA 4GBXB 4O2CA 4EOWH 3PJLA 2EIBA 2IMMA 2R23B 1W3HA 4Z7QB 3F1QA 1WGVA 2CWNA 2BRRH 3W38A 3LZPA 1WTGT 3KWWA 3PABA 3ZIMA 4KEVA 2PCFB 2J78A 2XNAB 1J79A 2PGFA 3G5ZB 2I9UA 3ZVIA 4CW1B 3ARRA 1TT6A 1VYRA 1UA6L 3B7TA 1DBBL 2QR0A 1SO4A 5IVNA 4DP4X 3OKOA 3RUGB 3UF9A 1R46A 4QCIB 4N2KA 3NQ7A 4K3ZA 2AJXH 4JR9H 4W4OC 4TTDD 4JKWA 3D0AA 1J4EA 1GJIA 4NJGA 4RE0A 3EGSB 1N18A 5KN5B 3ZWSA 1ZJAA 3WTXA 3BN9C 4MWFA 4ZSOB 4GQBA 2J55A 2XPGB 1FJ1A 4N90E 1NOWA 5FA4B 4UANA 2P5WB 2V2DA 5DRCA 4E42A 4ZQCA 5D55A 1IBHA 2WBJB 4CA4A 3H42H 4KDWA 2LE9A 3WLPA 4YHGA 3TJIA 2CERA 3CQQA 4FTVD 1GSKA 1H3UA 5AW5B 1IT8A 1JHTB 4V2CB 2REQB 2P8MA 2CA3A 3B3IA 3VFTB 5G2HA 1MNNA 3BANA 5GRUL 4GKTA 3C8HA 4QWWC 1XC4A 1B9BA 3T5WA 4MA3B 1BOYA 3QW9A 5EU7C 5B3NA 3N29A 4AC7C 5TE6H 2WTRB 4HNTA 2VDIA 4EPDC 5LGJB 5I3IA 1US2A 4NJIA 1TV8A 1X5XA 4XNZC 5JIWA 2JK2A 3D8MA 2WYIA 3APMA 5J1TC 1P4BL 3MMEB 2OSLB 2XFGB 3VRLF 4JRYE 4PI0A 4HIEA 4P8XA 5I0VA 1D9KC 4ISVA 1VZGA 4X5XB 4KK8C 4NCDA 4E9LA 4IKNA 4CMMB 3MP4A 1KIUA 4XPAL 4RCAA 4DIXA 5CR1A 1AO7D 3VDGA 2D03L 4JRYA 4Q0XH 3S8HA 4GAAA 5GGQH 4XRCB 2WXQA 4I7VA 1KYUA 2NNRA 3BIKB 4DVBA 2X41A 2O5NA 1G9NL 4EIGB 3NIFE 3VGAB 1CICA 1IEBA 1MCDA 3QUMH 3F64A 3KPMA 1EEXA 3DBPA 3E9TA 1QFUH 2YIHA 5FL0A 3MUZ1 1TCRA 5I3GA 4L1GA 3NTYA 1INEL 5MEPB 3ZZSA 4KTDH 1PKOA 4WO4D 4PLKC 3AUJA 1CXFA 2AQWA 3ZIYA 1ZA3B 2XWTA 1D5IH 4ACZA 1LMKA 4JBSA 3G3MA 1NBVL 4QT5B 3TLRA 1OAZL 3SOBH 4YHZH 3DDMA 4K5OA 2WM0A 3MJWA 2HX7A 1YEYA 2ZXQA 5ELIA 4Q52A 1XMWA 4XC1H 4KPLA 3ELQA 3FUNA 3OVPA 2OZ4A 2VGFA 3ZGHA 3V5OA 1BGAA 4GYFA 3RLGA 1SY6A 2UVFA 4NN5B 2N0MA 1M7IA 2NY4B 1TYRA 3KD4A 1KV5A 2QJMA 3AS0A 4GQ9H 3O45B 3PV6A 3LTYA 2IBZY 2DQEL 3UR8A 4S1FA 5ISZB 3K8MA 1Z2KA 4TU1A 3EOBA 2OWWA 3NCEB 2HS6A 3ZM8A 1AS6A 1BVKB 5C1MB 4OZHF 4N0YH 1UXSA 1XH2A 2EUWA 1E6SM 5K9JL 3KHOA 1Z5LA 4G1EA 5I19L 5HAOA 2N59A 3N2XA 4JZNA 3K2IA 1XX1A 4CVUA 1MVUB 2CKBB 2VN6A 3WQOA 3EUDA 2K6ZA 4MAUL 2DPEA 4ZO9A 3HZVA 3RVWC 1RURH 1DVFA 4PJHF 5JXED 1NOUA 3VRJA 4LSRL 5EIIB 3SCSA 2K0RA 4XMLL 4DFHA 3CGTA 3LBCA 2NLYA 2J6WA 2A5HA 5KAQG 3AICA 3FQUA 1YEGH 3K1GA 2YXGA 4TSCL 1S7SA 1ZEAH 5I8OH 1SZRA 5DRWB 5HGHA 3HMJG 1JYXA 3T6ZA 3LERA 3K4DA 1PAMA 4AAJA 1NMCC 4EI6A 3KHDA 3D0VB 2I69A 3CX2A 5I3DA 4U6VH 3VIGA 3HZMB 1QVBA 5TE4H 4K2UH 1LDCA 4JHAL 3PUOA 2YMXL 2ED7A 1X1ZA 5C7VA 3P4LA 3URQA 5I0ZA 3O9NA 4EANA 2OLAA 2VC2B 2BNRB 5I1DA 4LS1A 2UZYB 2YD8A 1HGYA 1MG2C 1OCOB 1F3DJ 3ECQA 3EO0A 3U0PB 4KZDH 3SB0A 2GTWB 1YX1A 1T6WA 1JXFA 3WQGA 3SQSA 1T04B 3SGGA 3OLGA 4LEXL 4P2OB 1R3JB 2J4WL 1VHCA 5E8OB 2DQXA 5HR6A 5AVHA 2Y69B 5CZ0A 1HXKA 4P3DB 1QQDA 1O1HA 3GVRA 3HIZA 1CMOA 1PCSA 3ITYA 2WXJA 3G6AB 2CWRA 7XIMA 1V0KA 3HAEB 5C9RA 5DJ8A 5SWZE 2Y6ZA 4KQ4L 3WLQA 2OL3H 1SMAA 3QUKB 5HXMA 1F3DH 1XG4A 1FC1A 2B1AH 3B9AA 4U1JB 1AQDB 5EUKB 1NTDA 1K9EA 1YQVL 3TYBA 4LVHB 1NC4A 3T0AA 5DT1L 4ZRGA 1UG9A 3PWJB 1CXHA 3UJIH 1OAXL 1P7KB 2XBZA 3BAJA 1OAQL 1HXJA 4XNXL 3EX1A 1GUVA 1QCWA 2NY6B 1XLJA 2PF0A 1P0EA 3QRBA 3ZSTA 4PR5B 4O2FA 3TBWA 4YXHH 4I9JA 5MI0B 2C18A 3ET9F 1QAWA 2P8CA 2UWEF 5SV4A 4GBUA 3NPSC 4QO1A 5GNXA 1KZQA 1KTLB 3LZFH 5EY5A 4FG6C 4XNMB 1AY1H 1CICC 2EPNA 3IJEB 1QPKA 2J77A 2JXMB 5TF0A 5HI4C 4IMKA 4ATTA 4IX2A 2EDYA 2CHDA 4QRUA 4IIZA 1IKFH 1TPXC 4B3KA 1XXDC 3WIAA 3CNYA 1Z48A 4UNKA 3UNTA 1MRFL 1FFPB 2EYTB 4FCAA 1HSAB 1E30A 3SCOA 3FDWA 3ONBA 1NPJA 3U0TB 3JVAA 4ZTYA 1Q85A 1ANUA 3DUSB 3V9FA 4FRWA 2GOUA 4QJ4B 2IWEA 4GW5A 2QPEB 4LCIL 1TTCA 1U4EA 4WHYG 3UTTB 1LRQA 4PREA 1TCDA 2PNDA 1BIHA 3RVVD 2IPKB 5DHVA 1NKGA 3EKLA 2F2HA 4F24A 1EDHA 2X0VA 1GHRA 3LGGA 1TNMA 3DETD 4PY7B 3DECA 1YO4A 4ZUUA 3EG9A 2H0EA 4UTTC 4QHKJ 1E1CB 2HMID 2FHCA 1YY8B 1MW2A 4DBDA 1GVFA 4OZFB 4QGTA 3U4KA 1CIUA 2C1PB 5IVZA 4FQPA 4RWHA 2J2ZB 4IGBB 4J3XA 1T8XA 1LXMA 3A3WA 2C9SA 1HE8A 1TEYA 8A3HA 1LO4H 5J12C 1UEYA 2DLFL 2I07A 4MJ6B 1UB3A 4XNUL 3SOTA 4ES8A 4XNAA 2ZUWA 1KJMA 3ALGA 3VOGA 1KIQA 4R7VA 1OD7A 4UUJB 4J4PD 1YHPA 2B5IC 2OTUB 1RMFH 5C3IA 3OW1A 4WX2A 3UVAA 1VCVA 4MZRA 5D96B 5D71L 1YE4A 3SCWA 4X9HA 1SEBB 2YYUA 1RZFL 1UB6A 2A38A 2XFXB 3SDDA 2GBUA 1X44A 4AH2B 3KYKH 1RIUL 2UZPA 3MOAL 4QY8A 5EU6D 4BBWA 4MVAA 4EZMA 3W27A 3ENLA 1HZHH 1QO2A 4XPFL 2NY7L 3IU3B 3TT3L 3PWPD 1P0BA 2PDCA 1LK2B 5JW4R 4HWBL 1CI1A 1IEVA 4AWEA 4AMCA 4FQIH 1P5BA 1E27B 1F05A 3OSVA 4KZ0A 4L9XA 2WB5A 3JZYA 1SSGA 4DQWA 1R6VA 3T9PA 1M56B 4GG9A 2Z7ZA 3NABH 4L4VB 4KK9C 1JXJA 3F7VA 3JWDL 4ZPTA 2INFA 3OP2A 1BX2B 1OHLA 1JZDC 4MCYA 1A5NC 2GDQA 2QGDA 4R96A 3BV7A 5JQ9A 1RUML 4CVZA 3CZGA 5FHAL 3I50L 4H4IA 5CMAA 3TH2T 1UC4A 1DUZA 2H0JA 3KLDA 4D3CH 1SOSA 1IAIL 1E73M 2VC6A 1DFBL 4Z7WB 2E5CA 3G6LA 2A0LD 4OT7A 4NNXA 2W91A 2Z0UA 2ACRA 2IOOA 3TNMA 4LPYA 1Q9KB 5REQB 5E4OA 1XINA 1LWJA 3PM6A 4GW1A 3FUFA 3CN4A 3DSFL 2EQDA 4HX1A 2WJEA 5KZDA 1MZHA 2GB2A 2ZKHL 2ATKB 4JO3H 2DQHL 1O7AA 4OD3L 3F7YA 3DYMA 1SU5A 5KTEL 4IISA 4R4FH 2DWDB 3M7WA 1ZHNB 3WHE0 4ABQA 1XF2A 1EHXA 4LL9A 3GJFH 2FVLA 5I3HA 3JV4A 1AKJD 4Z7AA 3CSGA 4LUYA 4KCVA 1CGYA 1A65A 2YSTA 1EVTC 3W70A 3GXUB 1LQ2A 2YZ1A 1ZSHA 4L1DA 2ERJB 1MCSA 4FXKA 1NY1A 3WIIH 5E0CA 4KKLC 4P5RA 1E9IA 2F5AL 3M5YA 4LBEA 2R0WL 1BFNA 4P57A 2W6RA 3G6MA 1SJEA 4G6ML 3U4FA 5D7IF 1DXIA 3H6JA 3NSYA 3NJVA 2Y6TE 3Q8EA 1HCZA 3MBDA 4HKBA 1ZAJA 3PXHA 4HU4A 7REQB 1IBZA 1NMAL 4MAYD 2CIIB 3CAKA 1AQKL 4IMKC 2PSNA 2Y06L 4NFBA 4TULH 4E4PA 4P2QD 4RSVA 4JN2B 2AV1B 1XLHA 3NCCB 3QZAA 4HA3A 1WNOA 1Q8JA 1A4BA 3RNDA 4ALAL 1U42A 5FYKU 2VAAA 5LWYH 1K4DA 4HDIB 3E8UL 5JH1A 4F48A 1MKFA 4LLMB 3QIBA 1UWSA 2XZ7A 1BZ7A 1QBBA 5EL1A 4WI2A 4RIRA 3TIMA 4U4MA 2GUOB 2VUNA 1TJIL 4UT9A 4HHLA 2XFYA 2WHMA 3LHZA 3D4GA 5C9XA 1QRNB 3MGTB 4JYEA 2EKSB 1J2WA 1QK2A 5C92A 3BW4A 1XFBA 1Y5VA 3SW6A 3FUHA 2IPTH 3CHOA 4NHCH 4HA4A 4C1NB 2VEMA 5TPWH 5CC6A 2ZX7A 3FT1A 1CZ8H 4JKPH 3TJ4A 4Y89A 3MRKB 1E9LA 2GGJA 3NQFA 1G1KA 3QFJA 3CHFA 4L05A 1O94A 4J2PA 4OR1A 3MODH 1G7MA 3EWBX 3KRZA 2VMFA 1Q3NA 2FYMA 5H8DA 4YZFE 4NSBA 2J47A 3CBRA 2JKRM 4ZZKA 3PBMA 3HBGA 1DBKL 3OR6B 4P5TA 3SDDC 1ULVA 5JIDA 4H1LB 2QV5A 3GUGA 5CPTA 4MA7L 5JA8B 3BP6A 4V27A 5FJPA 3FEQA 2EYRB 3QG7H 3ZL1A 4QR7A 2G2RB 3CWGA 2QVMA 3LRMA 2J1ZA 3X11B 4AGMA 1V79A 5KVFL 4JDZA 5DJDB 4QISA 1TKWA 3LGDA 2UZ9A 2AXHA 1XBVA 1E65A 3ZE1B 2QHRL 2V5TA 1AO7B 2F5BH 3PN8A 1YEDB 1ZBVA 4UIOA 1BMZA 3A64A 1FTXA 1RL1A 3TYEA 1EBPA 1PD6A 4QDWA 5IF0A 1WFTA 2C1OB 3HE6C 4Q74A 4AZ7A 4ORZC 3GY1A 1XHHA 2PR9A 2NQDA 1UH4A 5CN1A 3MKKA 5DJ6A 4BCZA 3OMNB 2W0KA 4Z2JA 4GSUA 2ZCKH 4J8RB 4WO4B 2PXYA 3MX0A 4OZ4B 4KHXH 5SWQA 4CU7A 5F3BA 3WQWA 3GRBA 2JKXA 3ULUC 2VM9A 4U4BA 3AWFA 5IKCB 2A83B 1MW3A 1WIOA 2NY2C 4N8UA 3GLCA 3FKRA 5D4HA 5IM51 1FIEA 4QHUB 2BY1A 3KAOA 5KAQF 3N91A 4K7FB 5AW3B 1R1CA 3MA7A 4JRXD 3QA3A 1UWQA 4KJYA 2FT7A 4H0LC 1A3LH 2C91A 3RJYA 3NCMA 4G42B 3U2SB 1PLGH 1FWJC 5IROA 5JOFA 1BM3H 3QQ9D 2ZUQB 4GLRI 3KJ6L 3W3BA 5F2MA 5HVGB 2OQLA 1TMHA 4OGQC 5BRPA 3LZRA 3PFQA 1M6JA 4BI6A 3BMXA 1A6PA 5DJXB 1Y0EA 4PBWD 1A8JH 1NDTA 4OB5H 2PTVA 5ECJE 2AJ3B 3ILQC 4F8OA 4QTGA 1U8PA 4Y9PA 1DBAL 1HCYA 4BFOA 3N2TA 5KTLA 4F7CA 1FORH 4Z78B 5K39B 5L6UA 4AYID 2CMRL 5E8EB 1JGLH 3NA8A 4TLUA 5CSBA 4NX5A 1WC7A 2X2GA 4ZFGL 3S4SA 3FZUC 1ZGLB 2PPGA 1I9JH 1OF0A 1D7BA 3H54A 1NGPH 1CE1H 4GWEA 1HHKA 5GQBA 4NO5B 2O5ZH 5D32A 2H4EA 3I6EA 1T03L 3O63A 2E86A 1FUNA 2YRLA 3NEOA 3P0YH 4MQ7A 2BERA 4FI8A 2AQSA 5RUBA 5JNYA 3K4AA 4XP5H 4LU5H 4JM0A 4WTZA 5IMMA 2DN7A 3KS0J 1Q13A 3QIBC 1B9KA 3BCJA 3VXUB 4DWDA 3A22A 3SBQA 2B9BA 3WTWA 4G9FE 3LCXA 2G95A 1XGEA 1RZGB 4L61A 1YYCA 1F3XA 1NMBH 3C09B 1XV8A 3BWZA 4B5EA 2Z4QB 2GGIA 1HHIB 4OV9A 1VCBC 3SPCA 2CBJA 5DS8A 4G9FA 3GZOA 2OXHB 3N6HA 5BVPH 1TRDA 3HF3A 2XWBB 3LQAL 3D39A 4Z3GA 1TA3B 5FK9A 4S0HA 2BP1A 5IVXE 2AZAA 4NT6A 5L2KE 4QLKA 4E5XB 4YSUA 3AW5A 3DJTA 3SB3A 4N5ED 1DJWA 3KS0H 2B4CL 4MKTA 1EFXD 5CP3H 2EVFA 5IVXA 4AV4A 2XZQH 5L2KA 4C6QA 1UUSA 3ZRFC 5K1NA 2ADIA 3C2AH 3UYPB 1Z3NA 2HZHA 1S5IL 1RUSA 1BQUA 2MNUA 2CITA 3BVVA 3GMRB 3IDXH 1JCVA 5J89A 4O53A 4RAHA 3QEQD 3P77B 1HSBA 4MZ8A 1OQFA 2PCEA 5CJ5A 2ZOLB 4L4LA 2KBGA 3U7WL 5CLWA 4KVCL 4BZ2H 1NH6A 1A5FL 4I89A 3MRPA 3H6OA 5HI5D 1IXPA 4C6FA 5D1QB 2PRMA 4FNUA 4S3KA 1XBYA 4N2AA 2PUQT 3IJHB 4ZMLA 3HNTH 4DUOA 4GI9A 1WSST 2Z6JA 5CILH 4JTRA 3F7KA 3IK4A 1EPXA 3KMDA 3VD0A 3OXRB 3W9DA 5FB8B 2QELA 2CRYA 2DKSA 3CEUA 2C1HA 1BKHA 1IE7C 5J6GA 4AF0B 2IADB 1P6FA 3ABQA 2CRIA 3MJ9A 2XV2A 3RTQA 3GIYA 4J3OD 4YS1A 2V5RA 3NOEA 4GG6F 2K6WA 2EE3A 4BKLA 5BUPA 1F97A 2R0LH 2FJUB 4LQ1A 1JJKA 5I8KL 1XLEA 3I9AA 3W5NA 3FONA 3TURA 4D6CA 5JXAL 3NAVA 2JJTA 1C9WA 5AOJA 4LUTB 3T3PB 2A9DA 5L7XH 1DLHB 4LO9A 4BSVB 2WXRA 4NIYE 2WQ8A 2QZRA 3UGXA 4BKSC 4APXB 4IPJA 3TZNA 1CB4A 3AYRA 2LTQB 2E59A 3D69B 2E7CA 2A3BA 2R6OA 2CZ5A 5EUOF 4FULA 3WLOA 3IJYA 4TV3A 3BO8B 2Z9TA 4LF3B 4WFFE 1QPNA 1HHGB 5L4FA 4NOBA 4CCEA 5IROC 1G7IA 4IU3A 1REQA 4HZ6A 1L9WA 4UFKA 4KKCC 1TWWA 2BY0A 2DMCA 1SXBA 1W0YT 4ANVA 5C7HA 1UTDA 3G22A 1TTIA 2XH2A 4D0DA 3EH3B 2VC2L 3RIFF 1RERA 1X39A 1CYWA 4RFNB 2ZZ7A 4PTMA 2ZZ6A 1LD9A 2W61A 2VI0A 3IVSA 4MDJB 5HGAA 1SVZA 4N2NA 3WNKA 1T5KA 1NAML 3E9AA 4X99B 4GYPA 1IVTA 2AEQL 5ESAB 4N3UA 3P0WA 1DWFM 1UFGA 4UAOC 4JJ5A 3D3VD 4DESA 2PLMA 5EU6B 2IIJA 3DXAB 2FX7H 5MERB 5FGBA 2IDTA 4EDXA 4KFNA 3NIDE 5FF7A 2DW6A 1C5BL 3GMLA 1YY9C 1WDWA 1KIPB 4H0GA 3PWPB 4JXCA 3M17A 3MVIA 3KVLA 4L0PB 4BK8A 3WL0A 4NN7B 4FAAB 1CTOA 3ZDYE 2XM1A 1FO0H 2YKLH 2WXOA 2XETA 3NXLA 3ZE0B 2YAOA 4IOSD 2JB6B 3FPYA 4F92B 1UKSA 5SX5K 3H85A 3O0RH 3MLXH 2DZWA 1JG9A 3D33A 3QQ4B 4MKNA 1X6UA 3KL5A 1QSEE 3ZHDA 1NSNH 1A7OH 3BQ5A 4PRWA 4XH2A 2OMWB 4N22A 5I1IL 4JTQA 2FTPA 5FOOA 1YQ2A 4OV5B 4XBEH 1FWXA 4OLWH 3BPCB 3LIZL 5DBTA 2W5FA 5J1AB 4F2TA 4XC3H 3HLAA 1KNWA 5DGQA 3PJXA 3T0XA 3T0TA 2DY2A 5F9WC 5CCKL 2I5IA 1FZJB 4DUXA 3EJZD 2W0PA 4HIIA 3QT2A 1NGWB 1EXHA 4RH4A 5GZNA 3ID7A 1B90A 4ADJA 5HHXH 1PU0A 3KJ4B 2INEA 1R3KA 4R2GC 3P84A 5I74C 1AZUA 2WO2B 2Y8UA 2H6UA 3WD3A 4UTWA 3BT0A 2C6QA 1FWAC 3FULA 3S9IA 4P2OD 4NO0B 1RY0A 4LKXB 3S1VA 3VMOA 3KGRA 3TXVA 3SE8L 4G6JL 4FOKA 5LXVA 2WNZA 2HYMA 4LL4A 1NDYA 1Q38A 1ZT1A 2XINA 3VMNA 5C08B 4JANA 4B95C 1CR9H 1OC5A 2JCCB 3WLTA 1JQVA 3GH7A 3ZU8A 3LSCA 3AREB 2DW5A 5HTSA