4PCTA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 161
structure length 438
sequence length 438
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4pctA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pctA01
1MQRA 1OGGA 4AZGA 1UYQA 5CPSA 4EE9A 5A8NA 3RM8A 5BCAA 3MS8A 4UQAA 4CN1A 1UR9A 1B1YA 1K9FA 2G8ZA 1OCQA 4V28A 4OZOA 1K9EA 4TUFA 4CD8A 1HJUA 4CU7A 1Q6EA 3L2LA 1FA2A 1XH0A 4OGZA 2HISA 4E8DA 4TVDA 2OW7A 1BSIA 4AYSA 3VO0A 1J0IA 1EDTA 1V0LA 3AMDA 3AISA 1GHSA 4PMNA 1PPIA 2E8YA 2X1IA 1O7AA 1VENA 4WKFA 4GI9A 1J12A 2WW5A 2ZUNA 1MW1A 3EJPA 4HU8A 1ISZA 4K68A 3WF4A 4UFKA 3AIEA 1TCMA 5E0FA 3D51A 2J8GA 6CGTA 2XFFA 1VEPA 2ZX9A 1TQWA 3CMGA 3SCQA 4AW7A 2XGIA 1J18A 2XFRA 1EO5A 2JIEA 1X6NA 1W9XA 1F4AA 1H09A 1UR4A 4NXKA 2WYSA 2Y8KA 2X0HA 1E6ZA 4CD7A 1G01A 4GI8A 4AD0A 5FIPA 4PMYA 1WZLA 1WP6A 3PZ9A 1C7TA 3W4RA 5M03A 1TUXA 1B3YA 1J10A 2J25A 3RO8A 5HPOA 4UQCA 1HJXA 3G6MA 3GBEA 3QOKA 3VIMA 1CYGA 1JFHA 5CGMA 1OIMA 3UG4A 5M5DA 4BA0A 2VZSA 4QLJA 4W86A 1HKJA 4DWSB 4CCEA 1OIFA 2J77A 1BPLB 1IZJA 3VGEA 2WHJA 2FYVA 1W3JA 4FMVA 2EABA 2BY3A 4AISA 4D6DA 4HMDA 4ZXLA 4UFHA 3OGVA 3U57A 4R5EA 2DSVA 3WF1A 3AXIA 3L4WA 1KXQA 1BTCA 3RPMA 5ABHA 2UY2A 3B9EA 1HVQA 4UNIA 4MNLA 4PMQA 1R7AA 2XSAA 5BYWA 3VDHA 1W1YA 1KTBA 2XJ7A 3AS3A 1RPKA 5EMYA 1H49A 1HKMA 5DF0A 4DUVA 2VX6A 3AFBA 4HOXA 2YA1A 5I0DA 1E6PA 1PX8A 4JFTA 2W4XA 3SCSA 1LF1A 1KR1A 2CETA 5I24A 3DX0A 1B31A 1CGWA 3AZTA 1US2A 4AIUA 4JHOA 1E70M 5HPCA 3K8MA 2WMHA 4YHEA 3WQ8A 3A21A 3RMEA 5GNZA 1M03A 1PAMA 4D6HA 1XV8A 2F8QA 2WMGA 4P8XA 1C90A 1QI3A 4F9JA 3A22A 3ARRA 3HU7A 1UZ1A 1ITCA 3S2CA 3H55A 3HG5A 5A69A 1VRXA 3OA5A 3POCA 4KMQA 1OWQA 5GNYA 2W91A 2WM0A 4QCEA 5E9AA 1ISVA 3WIJA 2Y4SA 1UD2A 2GK1B 3WH6A 2ZUVA 1E5NA 1JDAA 1UWIA 3LRKA 1VFUA 1RD6A 3SCUA 4P7NA 3BVXA 1YQ2A 1CXEA 1NOFA 3WEOA 1HL9A 2JALA 8CGTA 1E1EA 2YDSA 3PZGA 3WQWA 2HVMA 2V5DA 4U33A 2B31A 2WHMA 3EMCA 5ABGA 3W25A 1CENA 5IDIA 1M7XA 2WWDA 3M07A 1B30A 2DQXA 3WUBA 1EDGA 1E40A 2ZXQA 4AZ5A 4AEFA 2PBGA 3ARYA 3BAIA 3BUPA 3WMBA 1VFMA 1EO7A 2WPGA 3A4WA 3BMVA 3GTNA 2C8NA 5I2UA 3BH4A 3VM5A 4AZCB 4OUEA 1C93A 2XVPA 3DHUA 3BCDA 3AQUA 2ZICA 1W3LA 4HZ7A 4DM2A 3BGAA 3BVUA 3W6MA 5FL1A 3VD4A 3AMGA 5AC5A 7A3HA 3K8LA 1UOKA 1H41A 3CHDA 1DWJM 2CBVA 1W1VA 2QLYA 1WKYA 2DSWA 2DH3A 2PI6A 4F9DA 4P8WA 1E4IA 1UKOA 4AD2A 3NJ3A 2CBIA 5HOSA 3SUUA 1KB3A 1BF2A 4JFUA 1ISYA 3WD4A 2ZXDA 3TONA 4KWUA 4W7UA 2XM1A 3MUAA 2EADA 1GQKA 3VIHA 2W61A 2F7OA 2BVYA 4QAWA 1UKSA 2UY3A 2WMJA 2ZWYA 1JZ3A 3VSUA 3AROA 3HMCA 5JUVA 2D1ZA 2EBNA 2UY5A 4QCFA 3WNKA 1MFVA 1UH4A 3VD7A 1JXKA 3KEHA 4FNPA 1QHZA 2D0HA 7TAAA 2C0HA 4JAWA 4TOQA 5AY7A 1CIUA 5D8WA 2QPSA 2EAEA 4W7VA 3WD3A 3FAWA 3CZLA 1P6WA 5FCZA 3AZRA 3BVTA 1GQJA 2EJ1A 1K9DA 1Q6FA 2VR5A 3WDIA 3UESA 3WF3A 4C7GA 3WY1A 2OSWA 4BQ2A 1JYNA 1OB0A 1LL4A 3GNRA 1CGYA 4J3SA 4GZEA 2A3EA 1M04A 1GPFA 4A3YA 4NZFA 4OIFA 3AMCA 2VURA 3UG5A 1H11A 3U5UA 2F7RA 2YBUA 5BXRA 3OB8A 4N0RA 1WDPA 2VOTA 1VJZA 3VIPA 1W1TA 3WY2A 2CBUA 4U3CA 2V3GA 2CYGA 4WIWA 4UTFA 2XGBA 2QPUA 6A3HA 3N11A 1TQUA 3OLEA 3TV8A 3N18A 3ARSA 4D71A 1JZ6A 2NT0A 1SZNA 2W5FA 5D9OA 4HA1A 3MUY1 1TFVA 4HOZA 2OSYA 1GJWA 4JFSA 1JF6A 4RE2A 3WH7A 1Q6CA 3DDFA 3II1A 3OZOA 4EAMA 3OZPA 3WFLA 3BVWA 1PJ9A 1Y7VA 1JFXA 2X2JA 2F1AA 2NW0A 5A8PA 3J7HA 5HNNA 3SCRA 1UG6A 3ZSSA 5HDRA 4NXSA 1GZJA 3KL3A 4PMXA 1J9YA 1ZU8A 3N12A 3MSDA 2VVNA 3N04A 3AS2A 4ZE4A 3ZT7A 1ITXA 3ARXA 4FLOA 4WKAA 1ISXA 1L8NA 4AD5A 4TTUA 5IHRA 1DWGM 1HJVA 3BUQA 1E0XA 3UG3A 4A4AA 3KL0A 2XFYA 4AZ6A 2IXVA 3VMNA 5DFAA 4JL2A 1HIZA 2DSUA 4J3VA 4FNTA 2WANA 4DWSA 5DT5A 2OSXA 5M3WA 5IXEA 1KQZA 3FW6A 4NX0A 3W26A 1V0KA 4ZFMA 2FHCA 3ZSTA 3T0DA 4M1RA 4AZBA 5JBDA 4HMEA 3CLWA 2Z1KA 1SYTA 1B9ZA 4HP5A 2ZE0A 3S6TA 4ATDA 2OYLA 3KLLA 4AC1X 2CERA 2BY0A 1J01A 1JI2A 3EJUA 1OGSA 3CHCA 1MXDA 1IV8A 2WKLA 1B3VA 2WXDM 2G3MA 1CDGA 2ZOXA 1CTNA 1G0CA 2OYKA 1EOKA 4LXFA 1HL8A 5D4YA 2ZUWA 2QMJA 4JKKA 2X2IA 4KRTA 1MQQA 1WAWA 3VOCA 1BYBA 2V3EA 5LA0A 2OYMA 1E9LA 3WBAA 1CLXA 1PX3A 3SUSA 1JZ8A 3VD9A 2XVNA 3ALFA 1FH7A 4MB4A 2EPOA 2WCAA 3WFZA 1D2KA 2GJXB 3WH9A 4CUCA 3UERA 3JUGA 2AMGA 1NWTA 3AHZA 2D3LA 1KGXA 4JKLA 3ZR6A 3W37A 3VIJA 1XSJA 1CNVA 3WNOA 1JD9A 4MB3A 5TD4A 3BAWA 3NCOA 2GK1A 1G5AA 2J7GA 2X2HA 1TQSA 1QNPA 1GONA 5JIPA 3A4XA 3GYCA 2ZX5A 3EDJA 2J47A 5EFFA 3VSVA 1H0IA 2WSKA 4QDMA 1VFFA 2CIPA 2VMFA 4MTVA 3PZUA 3W38A 1E3XA 1ZL1A 2WLZA 3PZIA 3WUEA 3ZJKA 5CSUA 5A6BD 3W27A 3EDFA 4AD4A 3T0AA 4AYGA 1RH9A 1XD1A 4OOUA 2FHFA 1V6VA 5A6JA 1QPKA 3WUFA 1UKPA 5CQ1A 1JAKA 3OGRA 1TVPA 4WJXA 4D6FA 2GDVA 2ZXAA 2O92A 4JCMA 3DX3A 2D0GA 2YL6A 1AVAA 3ALGA 2V3FA 3CC1A 5EBAA 1EQCA 2WC7A 1QVBA 1O6IA 4AEEA 3LRMA 4NI3A 2DDXA 2VX7A 1QW8A 3BSHA 2XG9A 1RP9A 4UOJA 1I1XA 4XUYA 3WEZA 3PZNA 2JF7A 5E1QA 3WQ5A 4ACZA 2WK2A 4GQRA 1BVZA 1HP5A 4DUXA 2PWHA 4KRUA 2V5CA 2DH2A 3BMWA 4XZBA 4ACYA 2GFTA 5CSYA 4CVUA 4DO4A 4FLQA 1ZBCA 2OWCA 4W85A 1EDQA 4UZUA 3SUWA 1FP9A 2YL8A 1H1NA 3BLKA 3W82A 2F2HA 4F66A 2YDRA 1PIGA 2DEPA 3F4VA 1RP8A 2PWFA 2W66A 4W8BA 3BSGA 2X05A 4MAZA 2VNCA 4QLLA 1TQTA 2BY1A 4XX6A 4UFJA 1HN1A 1UH3A 2ZIDA 3AIUA 3GNPA 3TTYA 2WZHA 5IHSA 4HA4A 3M6DA 2QV4A 3CZJA 2BVDA 4U31A 3HN3A 1GOMA 3AJ7A 3FHAA 3CHFA 4E8CA 4EANA 2PWDA 3VU2A 1E71M 3UEQA 4NRSA 2VR4A 4YPJA 3OG2A 1QNRA 5EB8A 1E3ZA 1FFQA 3VVGA 4Y7EA 2J7FA 2VC9A 2FH8A 3TTSA 1GQLA 1KCLA 3AMKA 3APGA 4MJ4A 2XN0A 3EDEA 1JZ2A 3W81A 1CXHA 2XVLA 4PTVA 8A3HA 3D3AA 3VDCA 1KBKA 2JF6A 3AMLA 5C8BB 2ZX8A 1M53A 4W87A 3VUPA 4MDOA 5D9NA 2BXZA 1GOOA 1KFWA 2YDQA 4S3JA 1FFRA 3L4VA 2CPUA 1QBAA 2FGLA 2OWWA 4PEEA 5ABEA 3IJ9A 4IUGA 1J0YA 2BHYA 4EKJA 1PEZA 2VJXA 4X0NA 3VNYA 2CKRA 3THDA 2GVYA 1JXJA 1L0PA 3BUIA 4UFIA 1JYWA 3L4YA 1C3FA 4TX8A 4HPGA 1CXIA 1PBGA 1Q6GA 1EGZA 3MKKA 4WLCA 3GXTA 4MADA 4ZENA 3WDQA 3FY1A 2X8RA 5A2CA 3UR7A 1JZ4A 4WSKA 3B8SA 1E4MM 3FXYA 3AYRA 5A6KA 1JNEA 3VX1A 3O9NA 4CU8A 3F5JA 5CG0A 3CZ8A 2WSPA 1HKKA 1SFSA 2QF8A 4CN6A 1MXGA 1DWAM 4URIA 3L4XA 2VZUA 3LPPA 3SCOA 3WBEA 1R85A 5ABFB 3SCVA 3ZMRA 3BXWA 1EXPA 4XB3A 1BYCA 3VIFA 3AHTA 5E6YA 3VGFA 4H2CA 4CD5A 5A2BA 4PMOA 5BRPA 1XGZA 1PX4A 2YBTA 1E5JA 3GH4A 4D72A 1UQZA 1X1NA 1BGAA 3VX0A 2D23A 5DEZA 1E6SM 1LQ0A 5E70A 2VQTA 5CLWA 1CXLA 2YFNA 3MV01 3VIOA 4X9YA 1NOUA 5CGTA 4UFMA 2PWEA 4FLSA 3U7BA 1W9PA 2V3DA 3BVVA 5I5RA 1C92A 4PN2A 3RILA 3NDYA 3QHOA 2AAAA 1JF5A 4ZEPA 1MFUA 4UR9A 2XN1A 3FNDA 4AMXA 3EJSA 3E1F1 1K6AA 1Z32X 2J7DA 1DWIM 3OBAA 4HPHA 3H53A 1E73M 3TTOA 1UD3A 1C8QA 3UR8A 1TA3B 2WB5A 1OM0A 4WKHA 3IAQA 3SCPA 4OOZA 2Y8VA 2VX4A 3CH9A 3GZAA 3T2OA 3VDAA 4PTMA 5CJ5A 3WUGA 3DDGA 4PSRA 3CZEA 1JYXA 1CECA 5A6MA 1BYDA 3WMCA 4B16A 3VSTA 4JCLA 1W91A 3N9KA 1W9UA 1R46A 3ZJ6A 1C8YA 3MANA 1OINA 3MU7A 3W29A 1DEDA 3WELA 1E4LA 2VRQA 4F8XA 4JKMA 4RL3A 1HT6A 2JEPA 3THCA 1EHAA 2ESCA 3VPLA 1NP2A 3CUJA 2IUZA 1H0GA 4B3KA 4CCCA 2QHAA 5I23A 3VIKA 3AHVA 2WVUA 2XYLA 3GXFA 3KE0A 2JEQA 5CXPA 2EO7A 1UWSA 4HZ6A 1WZKA 4PTWA 3ZT6A 3S5YA 3PN8A 4BQ3A 5GPRA 5DMYA 2YLLA 2XIBA 1KWGA 1UR0A 3LPGA 3PZVA 3WDRA 3PTMA 2J7CA 5BXTA 1VF8A 4AMWA 2CHOA 2PBOA 3N17A 1H5VA 1OT1A 4AIEA 4W7WA 3W24A 2D20A 3AYSA 1H4PA 2XVKA 1J0KA 1WZMA 1W9BM 2A3AA 1O7DC 2VI0A 3VM7A 2CNCA 1KXHA 3AIBA 1FP8A 3VGBA 3A3HA 4U5KA 2G3IA 3CZKA 2J75A 2EEXA 4DUWA 1JI1A 4AIOA 4H8HA 1QX1A 4UOZA 2BHUA 1GOKA 2D2OA 1YHTA 3NSNA 3DC0A 4KGJA 4MJ2A 1D3CA 1IZKA 4LYPA 1LWHA 4H8VA 1J0HA 5FL0A 3O6AA 4WF7A 3CO4A 3AICA 4FLRA 4MNMA 4MNJA 3MSGA 1QBBA 5A2AA 3L4ZA 1UD5A 3KZSA 1J11A 1JDCA 4L4PA 1E6QM 1QI5A 2G3NA 1V6XA 4J27A 4TTGA 1V3IA 1BHGA 3L4UA 4UFLA 3ECQA 2VCBA 4PCTA 4PMVA 3K1DA 3I3EA 2E8ZA 2WMIA 1A47A 1KTCA 1TR1A 5E6ZA 3TTQA 4AZCA 1TE1A 4JIEA 1V08A 2VCAA 3LXBA 5GQBA 7CGTA 1E6RA 1WDQA 2GJXA 3VMPA 2J79A 1VEOA 2PF0A 3S5ZA 4PBGA 4UQ9A 1EIBA 1GVYA 3VGGA 3WNPA 4L4OA 1BVNP 4E2OA 5A1AA 5CZKA 2G3JA 3EDDA 4YHGA 1QHPA 1W9VA 2G4FA 4Q22A 4PMZA 3MUZ1 3CHEA 3F5KA 5D8ZA 1HP4A 1UASA 3ARWA 5A6AA 1CGVA 2XVGA 2XSBA 4TX6A 3RCNA 4P7LA 1NM9A 5E0CA 1KGUA 3DX4A 2MANA 4HU0A 4W84A 2ZUSA 1HKIA 1UWTA 5IFTA 2ZX7A 4Z2HA 2IGTA 3GH7A 5D9PA 1V0NA 3IANA 3K46A 3BAXA 1CBGA 1BFNA 4LPCA 2ZX6A 1BAGA 1KWKA 2PB1A 2VRKA 3IGUA 3ARUA 1JIBA 4XV0A 3GNOA 2WC3A 2J7EA 3EJRA 3AS1A 4B9ZA 1QNOA 1GORA 2DT0A 5AYBA 1ZBWA 1UA3A 3WQ6A 1WO2A 3AXHA 1JNDA 1VBRA 3U5YA 1MWOA 2RGMA 1US3A 2GSJA 2VX5A 5JBEA 4DWSD 4AZHA 2J7HA 3RM4A 1HJWA 2XHYA 4H8UA 3WNMA 1XC6A 3L2MA 1NARA 1XYZA 4OBSA 1R87A 4UCFA 4HTYA 1B90A 1W3KA 4OBRA 4JFVA 5I3DA 4YN5A 4PSPA 1CPUA 2YIHA 4LQ1A 4IISA 3HZ3A 1I75A 1KCKA 2EQDA 3CZSA 3BCFA 4ZE5A 1AQMA 3OGSA 1CZ1A 1TZ7A 2VZVA 3ZJ8A 1WB0A 4PMRA 4MB5A 2NSXA 1JYVA 3AI0A 3RJXA 1KBBA 1WPCA 3KLKA 3NDZA 2GUYA 1B3ZA 2VCCA 3A4AA 2WNWA 1XH1A 2DT2A 3WEMA 3A23A 5I79A 1JZ7A 5C71A 3GBDA 2FHBA 2BFGA 2VO5A 3CUFA 1DWHM 3DECA 4DM1A 1R33A 2YL9A 3WY3A 1QI4A 4NF7A 1EOMA 2VUYA 4CD6A 2XN2A 1W32A 3AS0A 1FOBA 5HXMA 2XM2A 4D1IA 1T0OA 1MVYA 1ISWA 2WMIB 9CGTA 4Q7NA 3BLPX 3MI6A 4TVUA 5I6SA 3VIIA 5LYRA 1ZJAA 5CPQA 1GOWA 1QNSA 1MQPA 4E4PA 1GNXA 1CXKA 4JL1A 1X6LA 3QR3A 4CU6A 4OKDA 3ARVA 1ZJBA 2JIWA 2F7PA 2E9BA 5BRQA 4B3LA 1V3LA 1I1WA 1UKTA 4KGLA 1VIWA 2Z1SA 1JDDA 4UQEA 2EXOA 4GI6A 3CV5A 3W53A 1U2YA 4V27A 4UZSA 3AIWA 4P7RA 1QI2A 1OT2A 2PC8A 3GXPA 4PRWA 1UWRA 1XYFA 4B15A 4WK9A 3W28A 2VZTA 4W5UA 2FGZA 1ODUA 1PS3A 4GXPA 1UR2A 1E55A 1LL6A 1VBUA 4X0VA 2ZWZA 3RM9A 5BXSA 1TG7A 4W8LA 2F61A 3FN9A 1V02E 3AOFA 4PUDA 1UUQA 1FH8A 3UCQA 2E9LA 1VB9A 3EYPA 3ZO9A 1HTYA 4GQQA 3WY4A 2VVSA 4ACZB 4V2XA 3K8KA 4LYQA 2WVTA 1BQCA 4C7FA 4Z2GA 1UWUA 1V6YA 4BZYA 2BVTA 3G6LA 4LGXA 4U3AA 1J0ZA 3ZM8A 1JL8A 2YA0A 3T2PA 5A8OA 4NZJA 3ZQ9A 2BS9A 4B9YA 4M82A 4AXNA 2F1BA 1Q6DA 1G94A 2DIJA 1U30A 1E15A 2E3ZA 4GZIA 4CGTA 3BAKA 1NP0A 1R75A 3WQ4A 2X09A 1R8LA 4UQBA 4D6IA 1OBAA 1AQHA 3TP4A 4CD4A 2O9TA 2DT3A 1XCXA 3VINA 1HWWA 3WL1A 1UHVA 3F5LA 4MDPA 3SIMA 4F79A 1JGIA 4C7DA 2A3BA 3WN6A 2J78A 2D0FA 3WF2A 2CEQA 1LG1A 2XUCA 1NWUA 2YJQA 3WH5A 3WDHA 3BC9A 3SCNA 4J3TA 2D24A 4Z2JA 1V03A 1TMQA 3VD3A 5BWFA 4GKLA 1ECEA 3RJYA 2X0YA 4M8UA 4CCDA 4U2YA 2XWEA 3LXAA 1HF6A 4CN4A 1GOQA 3T09A 2XIIA 2XTKA 1R86A 1LWJA 2Y24A 3B9AA 3OIHA 4GZJA 4RE4A 3DX2A 5KEZA 1QOXA 2JFEX 2O9OA 3OLDA 4J3UA 1WNOA 2WAGA 1CLVA 2E0PA 3POHA 3PHAA 3D4ZA 4MNKA 1WZAA 3BAYA 3L4TA 3W0KA 1QWUA 2Q8XA 1MW3A 3SUTA 2E9MA 2EPMX 1C8XA 1CXFA 4FF5A 3RDKA 1WCGA 2CHNA 1EQPA 1D7FA 4D6EA 2WKGA 2WHKA 3A5VA 4OJYA 1C7SA 2O9RA 1CEOA 1LG2A 1V6WA 1KXVA 2WZIA 1VJSA 1FH9A 3KWXA 2DSKA 1SMAA 3FHQA 3NSXA 2WVVB 1GVIA 1E6XM 5D9MA 2ALWA 4N42A 5FOOA 1ZB5A 3TA9A 5DO8A 3SUVA 3RIKA 4PUEA 3PZQA 4DO5A 1M01A 3VDBA 1XRVA 3GXMA 3DYMA 2CKSA 4KH2A 1HNYA 2FH6A 1E72M 1QNQA 3SEPA 2YL5A 5JIWA 1QW9A 3ARPA 1HJSA 4M81A 3BAJA 1E0WA 3D50A 1TA3A 3W6LA 1EA9C 4HA3A 5I77A 3B9DA 2OLHA 3LRLA 1HXJA 1DP0A 3VGHA 4BS0A 4D1JA 1SR0A 1EHNA 4UQDA 1MYRA 4M80A 4JHZA 1NH6A 3CZNA 1OSEA 3D5HA 4MB1A 1KXTA 1FHDA 3CGTA 2WBKA 3MV11 1GUVA 1ZBVA 1UD4A 4W8AA 3WD0A 3EJQA 2BHZA 3N1AA 2BXYA 1HXKA 4ATWA 1LLOA 3KL5A 3WMSA 4J7RA 3WSUA 1XSKA 3AHYA 4QLKA 3LPFA 2JE8A 2FE0A 3EMZA 4PCSA 4M29A 2Y5EA 5GNXA 1V3JA 3NIYA 2BY2A 4D6JA 1BLIA 2ZUUA 3A24A 1CGTA 2DT1A 2CESA 5AYIA 2RGLA 3WDPP 2J7BA 4GO8A 2AOSA 3U7VA 1NOWA 4NZCA 1W2VA 3D52A 3IJ7A 2DPEA 2VL4A 1GHRA 2EACA 1BG9A 3LX9A 1ZBKA 2WVSA 3MMDA 1OGBA 3M46A 4W89A 1EH9A 1V3MA 2WMKA 4PMUA 2W67A 1VEMA 1R47A 3GDBA 4W93A 1BYAA 4QP0A 3MUIA 1HJQA 3HG3A 2WMFA 3WL0A 1DTUA 4UOQA 3T08A 3MO4A 4D6GA 3DYPA 4PYSA 1MW0A 2QMKA 4M56A 4RE3A 3AHXA 4S3KA 5A6BA 3ZIZA 3WQVA 1J0JA 3PZOA 2D3NA 4R27A 4AZIA 1N82A 5AC4A 1GQIA 4IPNB 3WF0A 4EK7A 1UWQA 1E56A 4J3WA 3QGVA 1SMDA 1BG4A 1W9DM 4ZXOA 3IAPA 2VQUA 4GO9A 1E6NA 5A94A 3QOMA 3IK2A 1C91A 1LJYA 1PZ2A 1PZ3A 2EPLX 1Q4NX 4W88A 4NRRA 3CIVA 3CUIA 3CUHA 5A8MA 4MAVA 1NWRA 2VT0A 3SURA 4FNQA 2PWGA 4ML4A 4LX4A 4H7VA 3WKZA 2G41A 1E43A 3GH5A 2V38A 5BXPA 3K4DA 4FNUA 4U5IA 1ESWA 1HX0A 4HMCA 1ODZA 1UR8A 3DYOA 1OD8A 4GINA 2GJPA 4D6CA 1VAHA 4Z2IA 2CXGA 1CGUA 3VILA 3NSMA 3EJTA 3VNZA 1W3HA 2VZOA 2DSZA 4XZWA 5C70A 1W2PA 2UWFA 1JD7A 3VTRA 4HOWA 4AD3A 3PTKA 3HG2A 2IXUA 3LMYA 1NQ6A 3DX1A 3I3BA 3GM8A 2EPKX 1V3HA 1W1PA 5KZ6A 2BNJA 2F18A 4M24A 2WWCA 3AIVA 2W63A 3ARTA 4GPNA 4FNSA 1UKQA 4CKQA 1H2JA 2TAAA 3WDJA 1E1FA 1UR1A 4P7QA 1AQ0A 3QHNA 2CCRA 3CTTA 5M17A 3AIQA 2D22A 3A6OA 3EBVA 1V02A 5JBFA 3ZR5A 4JZ5A 2J74A 4QFUA 5CPTA 2J8FA 4J28A 2WC4A 3UETA 1DWFM 2DGAA 5A95A 3A47A 2XWDA 2WLYA 4P8VA 2WHLA 4A3HA 5F7UA 3IJ8A 5A8QA 3BUBA 2NT1A 3MMUA 2EPNA 4NSBA 2WCSA 3WNNA 4J3XA 1IT0A 3GXIA 3CMJA 3D4YA 4GIAA 3HG4A 1UQYA 2OWXA 3PTQA 1XD0A 1XH2A 3WH8A 5FKYA 1G1YA 2E4TA 2BV9A 3T2QA 1XSIA 3CZGA 1A3HA 1FHLA 1OD0A 1QI0A 3HJEA 4DWSC 5ECUA 3DHPA 5A6LA 3PBGA 3H54A 1VFOA 3ZJ7A 1JZ5A 1F4HA 2UY4A 3LPOA 3T0BA 2YFOA 4LYRA 1GCYA 1WDSA 1S46A 2A3HA 3NUKA 3ARQA 3MMWA 4PTXA 4DO6A 1MW2A 4U2ZA 2W62A 3AIRA 1K9TA 4PMDA 1V3KA 2J62A 4AZ7A 1B2YA 5CLTA 1R7OA 2WZEA 6TAAA 5I78A 3WD1A 2WVVA 2C7FA 4BQ4A 4ATLA 2ZUMA 4H04A 4WSJA 1TVNA 2D73A 2WCGA 1AMYA 3CUGA 5LA2A 2VRJA 1BGGA 5A3HA 1WDRA 1H3GA 4IPLA 2F7QA 3PZTA 3EMQA 3TOPA 1DHKA 3BUDA 1XCWA 1E4NA 1V6UA 4H41A 3VMOA 4W5ZA 3SCWA 4BQ5A 4P8UA 3BLBA 2GJRA 3K4AA 5HBFA 1CWYA 3CBWA 1UZ4A 5DT7A 3M7SA 5LA1A 1UA7A 2O9PA 4AWEA 3ZT5A 3VD5A 1HVXA 4FNRA 4BCEA 1B3XA 3N15A 2OW6A 2YKKA 3O2LA 4P7OA 1E0VA 1KR0A 3WENA 2CBJA 3WNLA 3VKKA 4FK9A 3VIGA 2YLAA 4AMCA 4MPKA 3GXDA 3EDKA 3I3DA 1LL7A 4Z2LA 5BROA 2X2YA 2ZUTA 2VTFA 1U33A 3CPUA 1XHGA 1V0MA 3AZSA 2CITA 2A3CA 3OLGA 5FD0A 3OLIA 2FDMA 1G9HA 1GW1A 4HZ8A 1TQVA 4AY1A 1NWSA 1B0IA 2J4GA 3QHMA 1JG9A 4CVWA 5EFDA 3NYDA 4TVCA 2ZXBA 2GDUA 1QHOA 4IM4A 1ZS2A 3ARZA 2YOCA 3LXCA 1KQYA 2W92A 1CGXA 5ABFA 1UH2A 1UD6A 4BF7A 1JAEA 3VGDA 1R34A 5A6SA 2WBGA 3FAXA 1KGWA 3ZOAA 4TXEA 3GXNA 2YA2A 4JFWA 1PIFA 4Z2KA 1WE5A 1GOIA 4AD1A 1GJUA 5E09A 3AXXA 1QWNA 1UD8A 1B3WA 3PZMA 3WD2A 3SCTA 2Y2WA 5IFPA 2XPKA 3N13A 2E40A 2DIEA
chains in the Genus database with same CATH superfamily
1SFJA 4AIZB 3OAZK 1VPQA 4BFRA 1URLA 2VLJD 3GC4A 2OFJA 3SN4A 4PLJC 5BZWA 1UYQA 5CPSA 4EE9A 2LAAA 1FZMA 1HNGA 1NDZA 3M0VA 4NNBA 5AALA 4K07A 1ZAIA 3O3AA 5A8NA 1OFAA 1NL0L 5INCA 3K6SA 3TAOA 3RM8A 3STZA 4YDZA 5BCAA 1I8JA 3QEUA 1MREH 2CXEA 3GDKA 2XTJC 2UY7A 4U1SA 5EUOE 5B38A 1WZ1H 4ZMLA 1KRAC 1TQXA 3MS8A 3R7MA 3V4BA 4RZCA 4AQEA 1K9FA 3KR3H 1NEZB 1OCQA 3NRFA 5IJKA 2J8OA 5IJCC 5EOTB 1DVTA 4V28A 4JREC 4PJEE 5I0WA 1VQTA 2OCJA 2A79A 3G77A 1A4AA 1ZE3C 1IVTA 3P2VA 1BA9A 4JQ1A 4JDYA 3QP3A 2Q20A 1YNTA 4HCRH 1Q6EA 3BD3A 2P50A 2CQVA 3L2LA 3QQ9D 1P4BH 4PI0A 4OGZA 4LS0A 5B39G 3GHTA 4NG3A 4TVDA 2ZYRA 4DX3A 4MAUH 2NR6C 4FQHA 1YRKA 4MAUL 1PZAA 3PNZA 3FFCE 1HAUA 2IFFL 2QQLL 4QX4A 2EO9A 5HNTA 5EBWA 1YY9C 4GH3A 4OFDA 3CEPA 1PPIA 2YCEA 3CFKB 3OGOE 1P4CA 2DOCA 3VRLE 5CEXB 2V7HA 1E4KC 3ML8A 2PRLA 2E8YA 2BOCB 4U7MA 3QZOA 1KPUA 2FIRT 2MNJB 3TWYA 1AR1B 2A4ZA 3MO7A 3DSFH 4WWNA 5FA3A 4G7YH 3H4XA 1YX1A 2LFGA 1DBJH 5FGCB 3EJPA 3T77B 3ELFA 4HU8A 3JTSB 4Q4QA 3LQZA 2OBGA 3WF4A 2O1AA 3B6SB 3F5WB 5E0FA 4RFEA 2J55A 3D51A 5FM8A 1R3WA 5AW9B 3QC0A 4G5DA 1VKFA 1NEPA 3BP6B 4JQIH 4QWWC 3RQ3A 3O6MH 2GGGA 3QEQB 3JR2A 3MO1B 3PC0A 1K72A 1VEPA 1VGEL 2I16A 1HKFA 3CMGA 4ASTA 3DH7A 4DKFH 3SCQA 4BY3A 2WJ7A 5K9DA 4QTFA 3BUTA 1J18A 5IGXH 3GR4A 1F4WL 5MP6L 1X5MA 4W6XB 4LSPL 1W9XA 4FFYH 5EUOF 4HU4A 1OB1B 4KK5C 1J9RA 4NXKA 4IRJD 4FERA 1KZYA 4XOBA 1Z5YD 4YNYB 3CBRA 1TR7A 3L3IA 1ZNNA 2WYSA 2DMGA 1YDPA 4G42A 2Y8KA 25C8H 2X0HA 3BGGA 2NY6B 4CD7A 3TU6A 2DWXA 3W1ZA 5AG9A 2A6IA 4Q9RH 4WW1A 1T5AA 4O1DA 5CPLA 2R0ZL 4KV5E 4CVXB 4AD0A 1D5BB 1K4GA 3PCYA 3L9RA 1X7SA 4M61B 4NQSB 1TV3A 4M6QA 4AY8A 3ZGHA 3SDAD 2RDTA 4FQ2L 1ZVSA 1DQVA 4WDWA 2QTEA 4OCRL 2G0LA 2K70A 1LEKB 3BSZA 3BE1H 3O9WD 3ET9F 5CS7A 3U2SB 4A2HA 1QRNE 4ZFZB 1Z66A 1U8MB 2V63A 1AP2B 1FNHA 3G6MA 4KHXL 3D05A 4HJGA 1JFHA 3S48A 1OCBA 2J2ZB 1WXZA 1NGWA 2V2WB 2D2CC 3JV0A 3QFWA 5DS2A 3WK3A 3PYCA 2ZOKB 4OI9A 2GJJA 5I76A 1VFBA 3M8OH 2NX9A 1QKZH 3RWGB 4QRSB 3NIFE 3ZTJH 2L0DA 3PJUA 4BA0A 2CZ5A 1NDYA 1HKJA 1T7VA 2HN7B 5AW5B 4KZDH 3B34A 3L1GA 5IHUL 1O1ZA 1F3RB 4DW2H 3UACA 2J71A 3KJ4B 2WZPD 2RHEA 2YN5A 3S6CA 2WHJA 1S9KC 1KBGH 3N25A 4WUKH 3U46B 3E2RA 3TK7A 4ABUA 1OE2A 4WNSA 4ZQTA 4HMDA 1KJMB 2XH4A 1CFTB 2NPLX 3LCFA 4WY0A 4KIEA 4DXXA 5F7WC 3NVTA 4KHTH 1P4LB 2ZCLL 2BX7A 2DSVA 1ORSA 1BGXL 4XXCA 4JS7A 1AUSL 3P3SA 2NCEA 4LY8A 4DZAA 1KXQA 1KEML 5IUCA 4KRPB 5ANMB 3HMJG 4HW6A 2HJKB 4PRIA 4PRPA 1EK3A 3CVHL 2A7RA 4EOUA 4YQXL 1H3WM 1RJLB 4PMFA 4WI0B 3KYNB 4QOKD 4R7DB 4X42A 3F2LA 2GGJA 3KBPA 5BYWA 1E6JL 3GRIA 1IGCH 3HGSA 2F53E 3A3WA 4RDYA 3AYTA 3MGOB 2V9RA 3ZGIA 2VXUH 3ATAA 4NRYB 1OSYA 4DH2A 1BBDL 2HVJA 1YYML 1RPKA 5EMYA 1H49A 1HKMA 1BBDH 2IMRA 3FQTB 4NQSA 4M1DL 2JCWA 2X4OA 5ICXA 5FEWA 3AFBA 1G6VK 4N2BA 4HOXA 1KBWA 1SEQH 2IBBA 4HIHB 3M4HA 1RH8A 5DCCA 2FX7H 5DJCB 1DDTA 5DK3A 3S46A 4ENZA 1T03H 5JW3H 4F7EB 4JKWA 3BAEL 1XBYA 2ZKXA 4GACA 5CBEA 2CETA 5KBLA 1NDGB 1B31A 3IJLA 4PGLA 4ZUVB 3FJ4A 1I8IA 1SF3A 5F4XA 3FFDB 4AIUA 3SJVB 5BNKA 4NNPH 3OKOB 5CJXA 1E70M 3REQA 3WLJA 1ZVNA 2H32H 5HPCA 2WMHA 1WFOA 3WQ8A 3MVIA 1JZFA 3OG4B 4P59L 3WYRA 4PRTA 3DGGB 5JNYB 1FORH 4NN7B 4F7PA 2ZCGA 1PYWA 1CT8A 2HX7A 3CHQA 3O6LH 4D6HA 1JHTB 3PWLA 1QSVA 3LKRB 2CIIA 2YQ3A 1QI3A 3TN0D 3V4UL 1JUKA 2FCBA 4F9JA 4TULL 3A22A 1OABA 2C3HA 3ARRA 4LVFA 3RRQA 1ITCA 3H55A 3HG5A 1VRXA 3POCA 1GT8A 2EC9T 3IKKA 4I5RA 4A8LA 1NCBH 1CL7H 3D3VA 2W91A 4JKNA 4MA8H 4QHNB 1D7CA 4K5MA 2AK4B 4D0BA 5DMKB 4H19A 3DJZA 4F0HA 4BK5A 5T26A 1KT2A 4PBVC 3HF3A 5E9AA 5D7IF 2FEDD 3DX6A 3EGSB 1IGMH 1ISVA 1TELA 5G5IA 3G6AA 4XNMB 3EJJX 4LOEA 1E5NA 4HNUA 4KKRA 5EZPA 1C5DB 2GQHA 4JVWA 2HJPA 1VFUA 2ICWI 5EZLA 2BHFA 5IQNA 3HPJA 1ZV2A 4P7NA 2UWEE 3HLAA 1GC1C 4AX7A 4OTXH 4JPIA 1DBAL 2WUCL 2WO3B 3WEOA 3ARGB 1ZFJA 4O0QA 2ZRXA 1HL9A 2FBJL 4WO4A 5D55A 2VGIA 4CQAA 2QSTA 5JH1A 1E1EA 1DN0A 1JPFB 1ME9A 1P2CB 4PV8A 4XCNA 4U6VL 2CBOA 4L05A 5D1QB 4JD4A 3EMCA 3HPLA 3PGFH 1S2EA 4P9MH 5DYOA 4RW3A 2G5BA 3UYIA 1AXTL 5D2NB 3U79A 4IDJL 2OZ8A 3K6IA 2XZ7A 4AGOA 5A2FA 3BYTA 5CBEB 5D5ME 5J4MA 3MYZA 3M07A 1B30A 1UROA 2G5UA 4AY0A 3OJVC 1VADA 3R79A 1N5YL 2WLIB 2JXMA 3QIWD 1XAKA 3N41B 5D2LB 3G08B 3ARYA 2PBGA 4AZ5A 3HPFA 2ANUA 4AQ8C 2CA3A 4WWID 1TWSA 2VDQH 5HHMD 2V4LA 1EJ6A 1VFMA 3ATFA 3SN6N 2WPGA 5C8JA 3A4WA 3LCLA 4F7PB 4GGBA 3FV9A 2ISSA 4AZCB 4EMZA 4QE5A 4OUEA 1CF1A 4GXUM 4Z0XA 4R34A 1SBSH 4FLHA 2WXKA 4XXCC 4Y4HD 5DTFB 1DBBL 2JKSA 2HKAA 1RA0A 3C5QA 3Q2DA 4GYFA 1GAFL 1GPOH 4QHLA 1GGBH 2Z8WC 3WFEH 2IDFA 4KBXA 2IXQB 2YPLE 3AABA 4FTVB 3GSNB 2EVFA 5E95B 4U1NB 3RVTD 2CUAA 3NJFA 1BFTA 4ES8A 3MP5A 4UTJA 4PWEA 4TLUA 5KBMA 3VQLA 2I5GA 1JRHI 2PEVA 4MMWA 3DETC 3C4UA 3TR2A 4MNQB 3FFOA 5CIPH 5D1ZA 4OZ4B 4IGHA 3QDJE 3BSZH 3TDFA 4G7VL 3MLUH 3VG0L 1U5JA 1UOKA 2OG9A 5JHDA 3GTXA 2DIAA 2VM9A 4O5LL 1H41A 4ELKA 1AHKA 5ESQA 3TO4A 2O72A 3AUOA 2FT8A 4LDEB 2Z0IA 1QBMH 5I1DB 1MNZA 5D2YA 1X5XA 5HHPA 5EY5A 7REQB 3BOXA 1A9BB 2A38A 2YUVA 4ZFGL 3S5LG 2ILLA 1C16A 4WRHA 4RQQB 4BUGA 5IG7A 2DH3A 1VACA 3MODL 4JRFA 3NM1A 3UG8A 1P4IL 4F9DA 4NYUA 2WQDA 1DXFA 4LVBA 2X3BA 1E4IA 1UKOA 1W17A 3NJ3A 1JE6A 3GSUA 2SEBB 4ELMF 5MEPB 4LOVA 2HPIA 1BF2A 1QA9B 1AE6L 1AD9A 4IKKA 5DC9B 3VRJB 4B41A 1XQLA 3JV4B 1BX2A 1EJRC 3WD4A 3DJRA 4WV1C 1YY8B 3CH1A 1CG9B 4RV8A 3R5EA 4W7UA 2Z35A 2GI0A 3R0NA 4Y4KA 1VPOL 2XM1A 3MUAA 1IAKB 1KPVA 1MRCL 1YNQA 4LH8A 3ZY7A 4UNKA 3W72A 4GW1B 1GQKA 3MRLB 4RIRA 3RHWF 3ILPB 3W00A 2CA4A 3FONB 1TJIL 4FG6D 4MCYA 4P9HL 3EX1A 1E6OL 2Y3AA 3FQNB 4QE1A 1JZ3A 2YBRA 4FL4C 4YHNA 2XOTA 5H8PA 5JUVA 3LKNB 2D1ZA 4ERAA 3RYMA 1I8MB 3MX0B 4Q9CA 2UY5A 3CPRA 1MFVA 3UNDA 4WENB 1HSBA 1UH4A 1OW0C 4IDLA 5DUJA 1JXKA 3VD7A 1T83A 4APQD 3HZKB 4OQTL 5GJTH 1X5JA 1I4FB 2KLTA 3GBNH 4A39A 1I8KA 3HRZB 1QFWM 3FUNA 4I77L 4IS6A 1IEXA 4LANA 4F4RA 1RJYB 1AR1D 4X7FC 1BWVA 4K9EC 1P4LA 4M7KL 1SGJA 1Z3GL 2X4PA 2TRSA 5LKNA 5KVGE 3ZE0F 3AGVA 5KYYB 4MYXA 1EIXA 1RZ8A 2EAEA 3DTDA 3DX8A 5KSBE 4W7VA 3CZLA 4XNMA 1EJFA 2BSSB 5DEFA 4IRSA 5EEWA 1U3JA 3SAZA 1EVTC 3G9AB 1AAJA 3QXAA 3UYCA 4N2CA 1FL6A 2Y0SA 3ZO0A 1PE1A 1DVQA 4LNYA 4N28A 2ACUA 1AODA 1TZIA 1EZ2A 3ETBJ 2BP0A 2WTPA 3UESA 3WF3A 1YJDH 2DJLA 4N2NA 2O4MA 1QUPA 4I9AA 2OL3L 4GQ0A 4MJHA 2ZVIA 4Q8BA 3UFIA 4UV4L 1OB0A 2YZ5A 1MFCL 3GSXA 2EE3A 1CGYA 2Y1VA 4E0CA 4NENB 4ADSA 1IJNA 5EUOB 1O7DE 5TGBA 1AIFB 1KDIA 5D1ZI 4D9LL 4OIFA 7PTDA 4HHMA 1QO3B 3CSYB 4U6YA 4GSQA 4LLYA 3UG5A 5E7FA 2JVUA 1PQZA 3KG5A 5TE6H 4ZUVA 4F2MA 1W2KT 1KEGL 4JY5H 1GZ1A 3U5UA 2GJNA 5DHVH 2YBUA 1IGIH 3ZRSA 4IPIA 2YK1H 4FA7B 1XH3A 3KPMA 1UQSA 4DZIA 1U3YA 1QFPA 3W27A 3QRLA 5GISH 2H0FA 3BQVA 1B4EA 4PS4H 5GZOC 2NQ5A 2DLIA 1DLHA 4EDXB 1LO3L 1BXUA 4X9IA 2JBMA 1FH5H 2CXKA 1U93A 4TS6A 3FYOA 5FCUH 4GG6E 3PSVA 2DWSA 5H2ZA 2LU4A 2AABL 1ML0A 2QPUA 2BNQD 2OMUA 3BP6A 4L9LA 4WFGE 2XGBA 3N11A 4TPRH 2WYTA 6A3HA 1U58B 4P2QE 3TXVA 5KZEA 2PLMA 3AUJA 1SOXA 3BT2H 1LOLA 3ARSA 5L7XH 3PWPD 4P23C 2EIZA 5D9OA 4HA1A 3WX7A 3LI1A 4I1RA 3MUY1 4NO3A 2ITCB 2N0KA 1D5IL 1Z5HA 2CLRA 5AVZB 3RLSA 1U9KA 4XBPA 4LVHC 2FZDA 4GG9A 3PL6C 2BLFA 3IU3B 3AGWA 4G7VH 3WLWC 2J88H 4NPYB 1CB7B 5LNVA 1GJWA 1RKRA 4CRPA 1RUAL 4Q8MA 4NKIL 5H2BB 4AJWA 4KK8D 4NQQA 5IBUB 4DERA 3O0KA 5AVRB 3O0RH 1KLYA 3UP6A 4RE2A 2W65B 3DDFA 3II1A 4UTBL 3CHPA 2V67A 1FNGB 1YEJL 3U3HA 3L68A 3OZOA 3VNJA 1SLXA 2BW5A 3U25A 1I7ZA 5IF0A 3Q48A 3EB2A 3NQMA 4C60A 3V5DB 3QIBD 5TDNB 3WFLA 3BVWA 4RISL 4F58L 1L9SA 3N73A 1MJ7L 5AL0A 3T65B 4DXKA 1JPKA 2N1KA 3E6FA 3K7UA 2PNDA 2TPSA 4YCPA 2ADGA 1A0QL 4Y5YC 2K6YA 2X2JA 3U0TB 3V0EA 3RTQD 1KENL 2KZKA 3J7HA 4N9DA 2P1YA 1J5OL 3IWUA 1E0TA 4PY7B 2EEBA 4R9XA 5HNNA 2P0IA 4HIJB 2ZWLT 1CDIA 4JFXA 2AQQA 1ZGLP 4LKCA 4PJXE 5DJYA 5JDSA 2OR8A 3OX8B 4PRHD 3K2GA 3TN5A 2QDWA 4DWHA 3OVPA 3WLRA 4ZE4A 4TNGA 4PJIA 5CWSB 4FLOA 4IGBA 4XHQA 4WKAA 2Y6SC 3DSNA 2XICA 1DVYA 1I85C 4AD5A 4X6CA 2X4NA 1DJWA 4FG2A 4AGMA 3ATDA 1DWGM 5IHRA 4L5FL 4AV0A 4W70A 2IMNA 4XNBA 3VAEA 3UG3A 4Y8AA 4L3EA 2BRRL 3QXDB 4NZTL 3U46A 4K0OA 1I8MA 1OOAA 5TQ0H 1OSPL 2EDHA 2HXTA 5KINA 4FFZA 1L0XA 3RIAF 2NY6C 4J3VA 3VWJC 1D9KA 2WV8A 3MSRA 3PAZA 1XZ0B 1P7TB 1EXBA 2ZNXA 5ICUA 4FA3A 4DWSA 4HHAB 5MHBA 3IGFA 5M3WA 5AYTA 1KQZA 2G30A 1X5ZA 4PREA 2GAZB 1V0KA 2VDIA 4ZFMA 3DG6A 4OIIH 3Q3GA 2ORBL 3CPGA 4XX5A 4NQEA 4Z1BA 2B2XL 2NTFB 3TZVA 1IE4A 1LT8A 4YNGA 3RK8A 1MWAB 2FRGP 3CLWA 4DKEL 1ONWA 2PLCA 3L3KB 3WLHA 1R3VA 2VDML 2IH3B 4HP5A 5D7SL 5I07A 2CPCA 4JM2A 2ZE0A 4ATDA 1L0YA 3UWZA 4C4BA 4B9CA 4M19A 3RWJA 3V0DA 1OGSA 4NN6C 1GYUA 3O16A 1PG7H 3N29A 1U92B 2GVGA 3PP3H 2WXDM 3KYOA 3KP0A 3CK0H 4C6LA 3CFEB 2Y88A 1CTNA 5EWIH 1TTBA 4NAMA 2HRPH 2XV2A 1WISA 3CXOA 2K4WA 1DQWA 3LHUA 2YJLA 3DGDA 4GYPA 5D4YA 4LUJA 5F2FA 4E9TA 1JPIA 2Y70A 3EAUA 3BH8B 5I1AB 2X2IA 2CBQA 3MU3A 3R0UA 4DKFL 3QWRA 2OSLB 2NY0B 1XF2B 1WAWA 3AUWB 1HZHL 3G5XB 3HE6C 5HGHB 2VLJA 3HS9A 3GKWH 3NQCA 4E2BA 4E6MA 3UTTE 5E9XA 4Z7WF 1E9LA 3RGVC 2H1LM 4YHOL 1I3GH 5D8JH 6XIMA 5LGXA 1Z3NA 3CDZA 1S5HA 3QUKA 1NU5A 1CL7I 1QSEB 3AWEA 4ZX6A 1X4XA 3P3TA 2F9BT 5T9CE 4YTTA 2X89D 4KUZL 2EH7L 2JCCA 2VLMD 4JO3H 1H0DB 1SLWA 1T3FB 3QHFH 4B0MB 1NFGA 1QWKA 3DCPA 1MRFH 1O12A 1ZEAH 1AZCA 3ID7A 1T20B 1R4XA 2UBPC 3C2EA 5DD3L 4IGNA 2GJXB 3GNNA 4QXTA 1CDCA 4S2BA 4MA3A 1KJ2A 2NY4B 4NKQB 5M95B 2ROXA 1MIML 4X6DA 1TJGH 4KDTA 4KKZA 3KRSA 4BM7A 1KGXA 5FYKD 5BMWA 1VYSX 2E09A 3VIJA 1XSJA 5GS0D 2B4CL 2AV7A 4NDMB 1E5UI 1KG0A 4GKTA 4OGAD 1OE3A 4OM1L 3MWCA 4AX3A 4GUOA 3BAWA 2DQFB 5DLCA 3S3PA 3VE7A 2P5PA 1G5AA 1ANUA 1GQNA 1Q45A 5IMLB 1I9IH 4XZ4A 2P5WE 3OJGA 1QNPA 2I07A 1JPST 5JIPA 4X7SH 5GRUL 1GONA 3QUGA 4EVNA 2DW7A 1EEZA 1U4EA 4OIBA 3EWBX 1OADA 5IW1A 1FWAC 5CSSA 2V5BA 3QRFM 4OCYH 1H0IA 4LSRH 1NCGA 5EU5B 3RJOA 1QLFB 4G71B 1U1HA 1VHCA 3LZPA 3MV7B 4NFBA 4L1WA 1TX0A 3ABSA 5EOCH 2VMFA 3VC6A 4MTVA 4C4KO 3W38A 4UM9A 1WWAX 1E3XA 2VXQH 5D2NE 5CWSA 1SXNA 3PZIA 3P2DA 4OJDH 2QUVA 4IX0A 1Y6KR 5CSUA 2OMWB 2P7TA 1JP5A 3ESPA 5FO8B 2C15A 3MACH 3RLHA 1OP4A 3UOAB 4Q89A 4QHLB 1MCWW 4HCFA 1AGDA 3RI5K 4F7CB 1RH9A 3ABQA 4S1QH 1PKYA 4RFOH 1V6VA 1KLGB 5D2LE 4S1QL 3QW3A 1YNLL 2JKJA 4N86A 3QMTA 1EEXA 1X7IA 4OLXL 5CQ1A 3INOA 5ELIA 1OVDA 3U2EA 4QEHA 3WFCL 4WI8A 1M9HA 5JHMA 1TE6A 3SDXF 3CN3A 2ZXAA 1T7LA 1XKYA 2IAMC 3L65A 4JCMA 1ECQA 2AERT 1WITA 2H32A 4MJIE 3RUGF 4J5VA 4I85A 4XP5H 1UCWA 1AVAA 1AW1A 2BSED 2XT1B 3VVVA 3T0TA 5I9QB 1KA9F 4L65A 5BW7A 3B8WA 5E8PA 2L4OA 3O2WL 1CWVA 1XR2A 3GDMA 2GSIA 4JYEA 2WZ0A 2OXGB 5AZ2H 1P0NA 2PDGA 3QY6A 4WUIA 2FUQA 4PCFA 5CILH 2VX7A 1EMTH 3DSFL 5F88B 3FTZA 3RF9A 5E7BA 3PZNA 4F33B 4QKTA 2AMUA 3GUTB 1PZCA 4AM0A 3C0SA 5DA4A 4QRRA 5JLZA 4EXPX 4IRJB 4PP1D 4IQEA 4TMPA 3CD4A 2PWHA 2YD1A 4DUXA 4KERA 5HMFA 5HDBE 2NTSP 4Z7IA 5JW5A 1E8ZA 2K8MA 4AJVA 2V5CA 1N64L 2ZF8A 3SODB 4KRUA 3V35A 2FO8A 1MCQA 2DH2A 3KYNA 4ZOCA 4ACYA 3O41A 4KQ4L 1J8VA 3ARDB 4L8DA 4BZ1L 4HIIA 4XPBL 1OK4A 2APVA 3MJWA 3D39A 3N42B 2DLGA 4PS3A 4Y0GA 1LYQA 3X3FL 4ALAL 1TKKA 3CN0A 3G2GA 1ZBCA 3T8QA 4K8RC 4W85A 4DJFA 4L1LA 3E96A 1WICA 2O30A 4C6CA 2YWYA 3BLKA 1DJNA 5HULA 4HS8H 4F66A 3G8EA 3LHWA 4H7CA 1IM9B 1O0VA 4M7JH 5ITBH 4Q32A 2DEPA 2EH7H 4JG1H 4JO3L 2VH5L 4MJIA 2JKXA 1XF4B 1D5MB 5FKPA 3TT3H 1CF8L 5AVWB 4FQXC 1MREL 3LKQA 3BSGA 1ZRQA 2X1RA 1ZA3A 4DNMA 2MCMA 4B90A 1DJXA 1KFBA 1R5VA 2NXZC 3FOLB 3L1EA 1S2AA 4XX6A 4AVOA 4UUJA 1IWBA 5DQJB 5DZLA 1JXDA 5IQ7H 3TN4A 5H4ZA 5KJRL 1T2XA 1XT5A 4GAYB 1A49A 1I60A 2XN9E 3ULVF 3GNPA 3TTYA 4Z3JA 4UMBA 5F7BA 1T1WB 3OR7B 1IXOA 4NJHA 4FZEL 2VDLL 5E1AA 1ND0A 4HA4A 4O4WA 2QV4A 2HEJA 5E6RB 2I24N 5H94B 1FSKB 2KT6A 3MLTA 2X1OA 3BPOB 1OAKH 1A1OA 1J8KA 3IBEA 3WD5H 2IPWA 4KXZH 2BBFA 2IKHA 1FNEB 2DQDL 3HN3A 3BN9C 3R0MA 4IOFD 1FWTA 1GOMA 1SMOA 2VXVL 3L3IB 3TO2A 4FG0A 3AJ7A 1L9RA 1IMHC 1R9ZA 3CHFA 1FBIL 1XEDA 1E28A 4V2CB 1DIKA 1M3IA 4W4OA 1P43A 3G18A 4E8CA 2DBLL 5DFVD 4CVXA 4JFYB 4LCCA 3BP7A 2E7BA 1V7AA 2FZ8A 2QGYA 4EANA 4MY1A 3VU2A 2DZBA 4B4FA 4QOKA 1SXBA 5LB1A 4GEIA 1XGPB 1JZGA 3MV9E 1FYTA 1BJ1H 3LZFL 3GS4A 3QB7C 4JRWA 4YPJA 3V0WH 3OG2A 2H9AA 4NT0A 3QH3A 1NMBL 5D05A 1L9WA 4DEFA 4Y7EA 4XAPA 1I1YB 4MDJB 5C6PB 5FW6A 4JO2L 4PWKA 2B77A 4LLDB 4Z3GA 2QW5A 1A6WL 1UT1A 3LEVH 5BOZG 3T78A 2NLJB 1AW5A 5JIDA 4DCQB 4GY0A 4O0KA 4MJ4A 3APGA 3CO8A 3VJ6A 1PCSA 3W81A 3D46A 1CXHA 3V7PA 8A3HA 3D3AA 3TN0A 3ZL4H 1TYRA 2HFGH 4LCUB 3MYOA 3I6RA 2JF6A 5C8BB 1M53A 4BE5A 3EOSA 2K3HA 4JANB 4BH7A 4KW2A 3QZNA 2OT0A 5CZJA 1A5MC 4C1KA 4OF6A 4LVEA 4NO3B 4JTRA 3HBGA 5FO9A 5EUKB 4P3DB 3CQQA 2CALA 4ZXBA 4MHHI 3QDGE 1P0KA 4QOKE 1VPOH 4LVOC 5IJBC 3CFIC 3WKNA 3GFZA 2OWWA 4PEEA 3ZTNH 2CDGB 4Y2OB 4BDVB 1MHPL 1N2RA 1VBGA 1BQLL 3IJ9A 5ABEA 4MJ5A 1UB3A 2P9RA 3M5ZA 4O2EB 1J0YA 5HHQB 1S3KL 4YEFA 2VGFA 4QDPA 1PEZA 2B0SL 3THDA 4YZFE 1L0PA 4ZGYA 4PBWD 4WKZB 3BEVB 3NQVA 4UFIA 4XP6L 2NY1D 2RAGA 2YAOA 2OMZB 1AFVL 3QPKA 1EANA 4GVFA 3RKPA 1XGTA 4IOIA 2D9QB 3W75A 5ABHA 5E99H 3D25A 1CFSB 4Z7UE 1NAKL 1UXLA 1EGZA 4XMXA 3TYGL 1SO4A 5CAKA 3SPVB 2QTVA 4WLCA 4BZ2A 4MADA 3WDQA 1PF3A 4O5LH 4I3SH 3FU6A 2ISDA 4ESKA 5A2CA 5AN7A 4CW1A 1J05A 5GJNA 2BS71 5BMFH 4TO8A 5JNYA 3EOUA 5GGVY 3GD6A 3Q9PA 4DPQA 4GAGL 3B8SA 5HHOE 3FMGH 5BMFL 2XWJB 5CAHA 2F58L 5CZVH 3BWUF 4LHUD 1BD0A 4AVNA 2DLEA 3K2KA 4JKPL 4WW2F 1QPOA 3IS1X 1IGWA 5CG0A 2ZTJA 1GGIL 1UZ8B 1VHPA 2WSPA 1JK8A 2GT9B 3QEGL 1HKKA 4QE4A 4HNNA 1MXGA 4MWAE 2VDPH 2O5ZL 3L4XA 4W9ZA 2VMJA 3RVXC 3SCMC 1WKFA 4AF0B 2OXNA 2BOGX 3FBQA 5BRZA 2XGZA 3R18A 4KKLC 3R2GA 4GXVH 5EGRA 5F0MB 1X98A 3WBEA 4ISVA 1R85A 2YQGA 5SWSE 4AWJC 2GG1A 3QI9A 4V1DE 1PV8A 3BP5A 2WXIA 2PWVA 2VN7A 4WU5A 3TCTA 1QU4A 2VDNB 4HS3A 3BXWA 1EXPA 4OB5H 3K0YA 4CNPA 1IC4L 4GCXA 5E6YA 4W9HC 3TO4D 2ERJB 3ALPA 1IBBA 3FOMA 3MLWL 3VGFA 1SVCP 3G0UA 5F3HA 4PMOA 3RVUC 5BRPA 1ETZB 1XGZA 1P1XA 4H1LB 1KM2A 1UQZA 2CW6A 3VFGL 5KS9A 1W3IA 1EA0A 1I3UA 4PRNB 1FL5B 3QYNA 4NAEB 1TTPA 1DQXA 3GJFH 1LQ0A 1H5BB 3F62A 4EI5D 1Q13A 3BARA 4QRRB 4L4LA 1EB3A 3S6DA 3NSDA 2O6FA 3IXAB 4N0CD 4FXTA 5CGTA 4C83A 4UFMA 2YPIA 2GGHA 5E1HB 1W9PA 4GW1A 1RXLA 1P7HL 3U6RB 3LMZA 4YVUA 4KFZC 3K6OA 2EDEA 4Y16D 5E8EB 5AUMB 4CADA 1XICA 5BRZE 4ZEPA 5I3FA 4FQLL 3K5XA 4O18A 4AMXA 3EJSA 3QFJB 5J6HA 3GMMA 1LRTA 1OEZW 3LKPB 1J48A 5HR6A 4KKBC 2PO6B 2Z1WA 1DUZB 4LPUA 5ETUB 1AW2A 1T96A 1AY1L 4PJFE 2B1HL 4XD3A 3H53A 4MVBC 1VFAB 1ZENA 1E73M 1YEJH 4LFHG 1AG6A 1R5IA 4MRBA 1C8QA 3P69A 4S11A 1SFSA 1TV7A 1XIDA 4RK8A 1Q5MA 1X38A 3IUHA 4O4YH 5I5IA 1A1NB 3SDCB 4K4KA 4YSEA 5C0NC 2WB5A 1OM0A 4JX6A 4EVZA 1GPWA 2CO7B 5KSUA 1T89C 1KYOK 1XLFA 4QDMA 4PRDB 1F8TH 3F12B 1CE6A 5CLXA 4E9YA 3CH9A 3GZAA 3BO8B 1UMLA 3G7TA 4A2RA 4B92A 3HCVA 1CK0L 2Z3FA 2PDFA 3RIFF 3DDGA 3T44A 4X7EC 1F45A 3WJSA 5FIEA 3RB7A 2REQA 2VEGA 5ITFB 5TQ2H 1JPDX 4OZGF 4RRPG 1WIPA 1W91A 4WCYH 3X13A 4TKWA 2AHIA 4LS1A 4XBMA 1SJAA 4GABA 1OINA 3MU7A 5LNSA 2XN9A 3BZJA 1MCNA 2A1WH 4AHQA 2O5YL 2BMKB 4EXBA 2J6EA 1XRTA 2YCJA 4S10A 4UCGA 2QL1A 3RPBA 4C7FA 4J2MA 1A5SA 3HFML 2ZF9A 1KFKA 4HPYL 4RVBA 1TPXB 1VGKA 1W72A 5E8NA 3U1SH 1ZAJA 4HIXH 2B4GA 3ULUL 5MERA 2RALA 1T0NA 2IH1A 3SE8L 1NP2A 1EQWA 2IUZA 3CUJA 5DBTA 3W85A 4ZTXA 1G9MH 2R2BA 1MJUH 1HJCA 4JJHA 2GB2A 3VNLA 3EH3B 4JY6A 1T1ZA 1ZHNB 4L37B 3GFYA 3GZ3A 2BOBB 5EMLA 3GG7A 3NEEA 4Y4FB 1BPVA 2X3CA 2X4SB 3BXNA 3WBXA 1FVDA 2JEQA 3KE0A 4DXVA 3IGKA 1G7MB 3M5VA 3SDDC 1G7HB 3QO1B 1BVOA 3DO7B 4LIQH 1NF0A 4MA1C 3KPQB 4LVAA 4AGNA 4GZ7A 5BU9A 1PW3A 3U82B 4DCQA 3EFFA 4FQIL 2EVJA 3VG9C 2AANA 1KTLA 4GSDL 4KMTH 4YXLL 1I1AA 3PN8A 2QCFA 4DJDC 2PTUA 5KYUA 4UC5A 2C13A 1XBVA 2QLVB 4TN9A 1WX0A 1OOWA 2GI7A 1H15B 4KEZA 4A7TA 3FKUS 3RDTA 4D8OA 1ZTXL 2NY5L 3V4VH 2ZZ3A 4O8RA 5FJJA 3DJTA 1FGNH 3PTMA 2OMXA 1TFPA 2J7CA 2Z1XA 5BXTA 2GK0A 4DGVH 3L7EA 4U1HA 5B1JA 2PBOA 1LEGA 2GQAA 2P88A 4KO7A 1SHMA 3MCLL 4XCEA 3MI3A 3P8JA 4LEQA 4X8JB 1F2QA 1T04B 5CIPB 3RZWA 3ZE2E 3UWYA 1WWWX 3W24A 2QELA 3MAWA 3X1FA 1E4WL 2N59A 5CJXC 3AYSA 3HC3H 3FT3B 3R89A 3RU8X 2XVKA 5C9WA 1LBMA 5LGZA 5KW9H 5J0BA 2VLRD 4KAQH 3RWCB 3NZ1A 5E2VL 2X9WA 3QUYD 4POZD 3GBNL 4CNUA 3TFXA 5IT2L 2HK0A 4C55A 3L5WA 5F3BA 5IB4A 4YWGH 2CNCA 2D2GA 2WNZA 2W27A 3REVB 2J4WH 2WOBA 3CQIA 3UC0H 3A3HA 4IBTA 5K3VA 4AEIH 2D03H 3LHVA 5F89B 2IF7A 1NIUA 1EBPA 3L9BA 3WFHB 4Z0BL 4KRZA 1ZT1B 3DXAD 2CJSA 3Q6FB 4ONGH 1JI1A 3DTXA 4AIOA 2PC4A 3HJZA 1I3RA 2GJ6A 5EB9A 1YY8A 3X1EA 2CLKA 4RR4A 2BHUA 3WNIA 5D1QC 1YHTA 3D0LB 1DQJA 1NFIA 1TZGL 2C9RA 2X7LB 3M1CA 1IZKA 4MJ2A 5AW8B 4E0RA 4R90L 5E8EA 1IJ9A 4Y90A 2ZYHA 2EDWA 5JOFB 1QPRA 2AGKA 1HKLH 2VN5A 2BIIA 1G43A 1Z3GH 4L4VA 4PMEA 1LDCA 4GY7A 5HGAB 3HUJE 3LKPA 4DGYH 2QKIC 3TH4T 1U3NA 1BVNT 1QQDB 3A4DA 4NZUL 3R25A 1BAFH 1TCRA 3H7BB 1OANA 5CGYD 1S7UA 3AXMA 3FS2A 3VFOB 3FCUB 1QBBA 5DVLA 2F38A 2WTRA 1ZTXH 1HH6A 2NY5H 3KPOB 3L3GA 3V4VL 4DGIL 5CBAB 3L4ZA 3GDRA 3RLVA 1FCQA 2AJYH 1D9EA 1K3IA 4JTEA 1ZPTA 2OMXB 2P44B 4WFED 4NBXB 5IEKB 4YFLI 1T0PB 3W2DL 2ALAA 1QI5A 4GQ9H 3U4AA 4LUSA 5AZ1A 3GRWL 2X44D 1BMWA 5LIWX 3E2QA 4I9XA 4M1CC 5F1NA 3U0WL 3GJFA 4I3RH 4OJFL 4PW9A 3UTZB 5CD5D 5FB8B 3PY9A 4LPYA 3D0AA 3YPIA 5IMOA 4AE1A 5DO2C 2ISWA 2V9QA 5B7ZA 1YEHL 2WMIA 2GJ6E 1QRNB 5LCVL 1KTCA 1MCSA 4KI1A 5A2LH 3US9A 3ANUA 3QRHA 2J57A 7ODCA 5HHME 5IVZA 5B21A 1ZA6A 3UMNA 1O68A 2C1OB 1GGBL 4JZJC 5I73B 3GGWB 3IVKA 4KXDA 2QKFA 1KJ2H 1KM4A 3EYSL 1E6RA 1OCWL 4NQ1A 3RHGA 2ZKYA 2WTOA 1Q66A 4YMPA 3S2NA 4XN5A 4KUZH 2GJXA 3LV3A 1U5HA 4IMFA 2IH9A 1T0NB 5K1VA 1SVZA 2V17H 3S5ZA 3TZVC 4H6RA 3P62A 5JYMA 5EIIB 4X4YB 1EIBA 3DERA 3OIXA 1BJ1J 2BIOA 4ENED 1HFUA 3GK0A 4KT2A 3S1WA 4ZUTB 4LLDA 5F7FA 1IAII 4IGMA 2JCCE 3SRFA 5DVPA 5D72H 2OELA 4JFOB 4XR8C 4L4OA 4LU5L 4JG0L 3K1GA 1HSAA 1O9WA 4P5RA 2YSWA 4Q4EA 1NBZB 4CNOA 3VWJA 1CI1A 3PABA 4MNGE 4OCMC 1FSKC 5ID1B 3LD8B 1IFHH 3EDDA 4Y96A 1RULH 4DGIH 5EC2B 4RPPA 4KITB 3E1ZA 3ANVA 4LGRB 3B7SA 3L3GB 3VFVA 1NGXB 3HURA 1WAAE 3LK6A 1EEYA 1XAUA 3CK0L 3MUZ1 3CQJA 2AQ1A 1RHCA 3CHEA 4U1JA 3WN5A 1H3VA 3DXIA 1MF2H 4XKYA 3CFMA 3MC5A 5A6AA 4JM2D 4I0CC 4TX6A 3BLDA 5HMEA 4NZRH 3N12A 3L8QA 4AB4A 4XD6A 4NLHA 3X1NA 1T04A 5CIPA 5GGRA 3WJWA 1KGUA 1NPUA 4XCEB 1ME7A 3BL3A 4ZQCA 1YUHB 3MLTB 4AITA 5C0IA 2OJEA 4GRLB 4XBGA 4FE9A 2KZBA 2ZX7A 4E9VA 4ORZC 2I5IA 1R9XA 3A64A 4LU0A 2IGTA 4JM2B 1RVFH 5F9OH 3JYBA 2IH3A 4DFHA 3K46A 2X88A 5E94A 4FX8A 2WKOF 3LH9A 4R5VA 3QTGA 2A5UA 1B4LA 1HGYA 4ZTEA 1WFTA 3WOVA 3LS5H 1LM1A 1IQ8A 1CU4L 3ULVD 4BGDA 4QS5A 2QADB 3FYPA 4KH9A 3EW3B 1PTGA 1DEEA 2AEPL 4RDBA 3D25B 2EXSA 1C5BL 1QACA 3L1FA 5C0EA 3GNOA 1J96A 4Y4FC 3O7UA 2PO6D 5C54A 4ANKA 4FFZH 1ZVYA 2N01B 4BFFA 1FG9C 4PR5B 4GAJH 4K1WA 3ARDC 3U7WH 5ENWB 2B7OA 4FXKB 1MI5A 2CLLA 5C0BB 1OAUH 3GHRA 1SY6A 3NABH 2FR4A 2AXHA 4ABWA 5ID1A 3AS1A 4JGJA 4XVOA 4GYKA 3UY7A 2FLRT 4C59B 3QK0A 1E5ZA 2FSEA 4YHMH 4ONVA 3MLZL 3GQYA 1WO2A 3BUVA 1SRDA 4GUCA 1US3A 2VX5A 3APYA 3LLFA 1JERA 2IV8A 2LW3A 2A9MH 4KMTL 4YXLH 4EWND 1QJWA 4X0KA 4TXVB 2VEMA 4F0SA 2FTWA 2H2PC 1HJWA 5M1TA 2X41A 3U1PA 2AK4D 1EF3A 3DMMA 5AKRA 3L2MA 1XC6A 3BZGA 3UXAA 4BELD 3V5OA 4ZMNA 4LLUB 1X5YA 4WCJA 1RK7A 4QIRA 5C08A 5BXPA 4L4TA 1CUOA 3CVHH 4MKSA 3DOSA 1UM5H 4YDJB 4A2SA 5BZAA 1B90A 5D7IA 4DP2X 4GKSA 3JS3A 5B1AB 2I9LB 3ZIMA 4LV4A 4Z76B 4UM8A 4KWSA 5DJ2A 3O9WA 5HNUA 1CPUA 4NNXB 2B0MA 3HNTH 2PGEA 4L0PB 2BERA 2JB5H 5T1DH 5CN1A 5C0GB 4XK2A 3QLDA 1I1AC 1OWWA 3HMXL 4DJDA 2EIDA 3A5FA 1TKWA 3QQNA 4GOSA 5DD6A 3FOLA 1Q9WA 2BNQA 3FH7A 2W0FB 2QSQA 4WGVB 1FG2A 2H6UA 4KX7A 3CZSA 3MRFA 3PUOA 4AU0A 4DZ5A 4ZE5A 4IWWA 1AQMA 4NM8L 1XXFC 3AM8C 1AQKL 1AP2A 3B43A 4KO9A 5J12C 5KVDL 4MMXB 3STEA 2EECA 3TEVA 4X9HA 1LRNA 1A1MA 1WB0A 1OAYH 3H9ZA 4PMRA 1J86A 5I8CB 1FWRA 4M4RA 2P52A 3VH8A 2Z26A 2V8MA 2IQ9H 2NSXA 3ZZQA 5JA8B 2Y3NA 1HKVA 1OGAE 3RJXA 1KBBA 4K2SA 3KBMA 4QI3A 3TX9A 4QP0A 1N5AA 4NHUB 3ALXA 3NOIA 1TWZA 1ZLSH 3IJYB 3PABB 3S97C 4AXWB 5SX4I 2BWGA 1NBZA 2GUYA 5HGAA 4DQWA 3SQLA 4Y9EA 1CICC 3G04A 3P3RA 3N40P 2PGWA 4HK3N 4WRLA 3P74A 3WLKX 3O15A 3NMEA 1XH1A 4F3HA 3L9YA 1HINH 1MLBA 3PBYA 1ORSB 1JZ7A 3GU9A 2VM3A 3OHXB 1ROWA 4GG8B 4P46D 3MXVL 4NZ8A 3UYPA 4F2EA 5J9PA 1CLKA 1A6ZB 4DBUA 2FNBA 1Y6MR 4L23A 3W2LA 2AJZA 3BVDB 3TV3L 3ZDZE 4GKZA 3LEYL 1BM3H 2YL9A 3H2EA 3PB0A 3IVUA 4C6PA 1JSYA 2XXMB 1QI4A 3NCFB 1EOMA 3NL2A 3BJFA 4NF7A 2VUYA 3W02A 3FTWA 1JPSH 4X6DB 4Y4KC 3GLZA 2XIJA 1FI8C 3NGFA 4HGXA 3AU2A 5J6GA 4UDTB 4U3HA 4WV1A 4RGMC 5G2IA 1DDHB 1RUMH 5HHVH 3LIZL 4YIQA 1C12B 2XM2A 4LEXL 4R33A 4Z7OE 3WTVA 2WMIB 1LDSA 1G7PB 4AVJA 4M3JA 4F27A 4F7MA 5KS9F 1IE5A 4Q7NA 2NW2A 1FG2B 3QULB 1I7UB 4IMKA 3UIZA 3RWFB 2C1IA 2MIZA 2XZCH 4ZNCD 2EKGA 2ZBTA 5F0LB 3W6YA 4RMTA 4NAEA 2Y7LA 4G6FB 2XTLA 2IKJA 4ODVL 1PCXA 2A77L 1EZUA 3GZOA 4G6KH 1XL9A 3VIIA 5JR1L 5F7HA 4FMFA 5HI3D 4KX8A 3B8VA 4QHUA 3EG9B 1MCHA 2ZSWB 4RMSA 5D33A 1GNXA 1CXKA 3S3SA 3P14A 4ZMGA 3WKPA 4XNYH 2KQNA 2ZCZA 3MKCA 2PKDA 2PTVA 2VCOA 3TBSA 4AM0Q 5LBSL 1VLIA 3PGDB 5IBLD 3P82A 4JTSA 5E5CA 2QCDB 5E6UB 1JN6A 5BRQA 3R6IA 2UZIH 2XX0A 3LD8C 3EA2A 1OQOA 3LPWA 1NZRA 3MA7A 4KGLA 3UYRL 5FF3A 1J2BA 5T3XD 4PJDB 4IFOA 2R0WH 1VKXA 2OEMA 1GY2A 1ZSXA 4G8TA 5C92A 2XNAB 2VR6A 2B0SH 3FFCD 1YNPA 1NBVH 1VD6A 5LIXX 5IFHH 2E67A 1WIUA 3ANYA 2BP8B 3AIWA 3CXFA 1G7QA 3ZUCA 4EOWL 1WUFA 4GAYA 2X4RA 1YTDA 4YSSA 5FWRA 3OJDA 5T1MA 5FUZL 3ABXA 1UWRA 3PULA 2ZOTA 1IKOP 1DANU 5GIRB 1PD6A 2NZLA 3DOSB 3NCYP 3MTXA 3HQ1A 1AGFB 4QR7A 3NCXA 4HXAL 2H6RA 2WZ6A 4KFOA 1ZIAA 4NZ5A 1ZVHA 1E55A 1J9CT 3RR1A 5DJ2B 1WFMA 1BZ9B 1TXKA 1N0LA 4OV5B 4FABH 1LL6A 2C16A 1B4RA 3DUUA 1SDAB 3P1VA 3MDJA 2PODA 1YBQA 2EG6A 4NL1A 3W7PA 1GRWA 1TJ1A 4R85A 3RM9A 4P5MA 4IYKA 4W6YB 3L21A 3S1GA 4JQ4A 3PHSA 4PBEA 2L8AA 4HKZB 2J21A 4W8LA 3T0ED 3VD1A 4LF3B 5GZOA 2P5WD 4GRSA 4JXCA 4DYKA 4PJ9A 4XVDA 1V02E 3AOFA 1FZJA 4PUDA 4IRSD 4LSTL 1YPZF 2EILB 4NQXB 5ERWB 3I75A 4DAGL 5FWQA 3UCQA 4DJFD 1JUFA 3EYPA 4XXDB 3ASWA 1A7OL 1HTYA 2MNWA 2YXVA 3LBOA 4F0KA 3HV9A 3OX8A 2DWDB 5T5NG 1YMYA 4NM4L 4FIQA 2NW3B 4YVXA 4A2LA 3ZWSA 1INEH 1J1PL 3OAWA 5I74B 1QPQA 4PCNA 3FLUA 3IJYA 4ACZB 3PL6B 2WVTA 3FS9A 3O2VL 4K55A 5K93A 1BQCA 4Z2GA 3QO1A 1YEGH 2YC1B 4KI5E 4BZYA 3C2AL 4LGXA 4U3AA 2WTRB 2H0PA 4N2FA 5AKTA 5FHAH 3T2PA 3D06A 1XIFA 2ZA1A 4GW4A 4BUHA 4LCUA 1YQVH 4JGDA 2NVDA 1EX0A 2P45B 2RUSA 1AZBA 2ZSVA 3TC7A 1FDLL 3FT2A 2OX5A 2F1BA 3M0LA 2WZAA 2E46A 1A6ZA 4NNYB 1A5UA 5J9PB 2E3ZA 3EGDA 5AVYB 4GZIA 3LEVL 4NCC2 5IB2B 3TC9A 1XYLA 2VELA 4RXGA 3J8F7 1R75A 7FABL 4XBSA 3HBLA 2OJPA 2Q76A 5IEHA 4GG6A 2XRAH 4D6IA 1AXIB 4I4WA 4WI7A 2VXQL 2CSPA 5JPMA 4LK4A 3VFNB 4EAYA 3QWNA 1M4KA 4WDXA 1TVLA 4Q56A 3TPUA 3DVGA 3NRQA 4K9JA 3VACA 5EF1A 5JQ9A 3MNDA 2YRZA 3MRNA 2DT3A 2OZNA 5CJBA 3NACL 5DD0L 2VXSL 2VDPL 1FGNL 3N1MC 2ZXGA 3MV8D 2HMIC 1AD1A 2NWRA 4BUQA 4CSZA 3BEVA 4XOEA 1BXCA 1W31A 3VINA 4PGDB 2G9KA 3QCUH 2YXMA 5HDLA 3MBXH 3C8HA 3GLEA 1MRAA 3BW3A 3SIMA 1CE6B 3FO9B 4O51B 3F58L 4HIEB 2A3BA 3O3DA 2J78A 4KZCA 4L56A 1NC2D 4Y2WA 1CC3A 3WF2A 1K03A 4I8YA 5AZEH 4HEPA 3QUMH 4HLZH 1KBVA 3TWBA 1Z9PA 1IBFA 3TJEH 1XH3B 2AI0L 3KPMB 4JM2F 1E90A 1GW0A 1Q2RA 1YUKB 5MEQB 3WH5A 2VDLH 4E0RB 3WDHA 3SGJC 1OC6A 3QXTA 3FOKA 1USZA 2OMBA 3Q2CA 4HJ0D 1FRGH 3GMNB 1OVZA 2OGJA 5BWFA 3KS0J 1RJQA 1X5GA 4P9HC 4GKLA 5LDSA 2IQAB 4W4OC 1JWSA 5C3IA 5CCHE 1A4LA 3V75A 5EU7E 3I4EA 2A1WL 4B3ZA 3PS6A 2NQZA 2X0YA 4Q7DA 4M8UA 4U1MA 4KF1A 2OPCA 4U2YA 4IHCA 4XZHA 1HOCB 4I48B 4OKVA 1AA1B 1I8IB 4Y16B 5D7HA 3CVCA 2NUPA 1J7VR 3Q05A 2R9RA 3CFBA 1GOQA 3W1TA 2X4SA 4JR5A 2YUXA 1P5VB 4N2LA 3QIUD 1K4DA 2GJ6D 4NIYE 4J3ZA 4LAJH 3RZCB 5JO5B 4W68A 5F1NB 4PJ7B 3HUJF 2O9OA 4O1BA 3LIUA 3AY2A 1XYAA 1UM6H 3PHAA 2WAGA 3BKJL 3FQTA 3L13A 1E6JH 3POHA 3O2DL 4JE0A 3UROR 5HVWA 2ZG2A 4K7FB 2G50A 1N2RB 1O7VA 5HWJA 2IALB 3TQKA 2BDNL 2XCMC 3IE9A 1SVDA 4X4ME 2HJLA 3BLFA 4B0MM 4JDVB 5F3FA 2EPMX 4NZUH 4HT1L 4B9IA 3RBGA 3CLFH 4X6DF 3S34H 4FF5A 2LQRA 1WCGA 1HE7A 1D7FA 1MG3C 3A67L 1GVOA 1HHKB 1IHIA 4XKMA 3RA7H 4PJEA 2Q09A 3GMPA 5GGQL 2O9RA 3ITYA 1CEOA 5GGQH 4NJAL 4LRIC 3QI9C 4RIRB 3P4MA 4BQBA 4QG8A 3W9EA 1GYWA 1KXVA 1RHHA 43C9A 2HRLA 5I0ZA 4C58B 2JKNA 4NWUL 3MRQA 3SQOL 5C9RA 3N9GH 4P5UA 4MJ6B 2E1DA 2OEJA 4PJAA 3PWPE 1C5CH 2DSKA 4L4MA 3TFKD 1V7ML 3OVQA 3FHQA 4TULH 2YD3A 3HZVB 1Y0EA 1O4UA 3GLAA 4EBQH 1HHJA 2WVVB 1GVIA 3WE6B 1E6XM 5D7KE 4ZPVA 3UJSA 5HJLA 1FFOA 1ZB5A 1CFNA 2DZVA 2HNEA 3F03K 1GYMA 4U1KB 3EH2A 3G1SA 3B2VH 3RIKA 1MEWA 3WL9B 3BQUD 1F6LL 5LHEA 3UJTL 1E5AA 3QEZA 3W88A 5EOQL 5B1KA 3NDOA 1I1FA 3VDBA 25C8L 4L8SC 4IRSB 3F6JA 1YEIH 3DYMA 3BLOA 2F2KA 1D5XB 4LNRA 2CKSA 4LCWA 3ARED 1J88A 2P5WB 2Y36H 4I3GA 2ENJA 4B96A 3P9LB 2QVMA 2HVJB 3UPRA 1HJSA 4NT6A 3K0WA 4U6HB 1R3KA 3W6LA 4N5EC 4JDVA 1WAAF 1Z3RA 3QQDB 3MNWA 4QNPE 2OLHA 2WJFA 3T55A 3W7QA 4PRNA 3QEGH 3VGHA 3ZDYF 4BS0A 2PTTA 1FY6A 5CH9A 3VXMB 4ZQNA 3ORWA 1AD0A 1A7RL 1EHNA 3K2UL 2VD8A 3D87B 1OYCA 2Z7UA 1RCQA 3C5ZA 5HVHB 2R24A 3RX5A 3CZNA 1OAJA 3MBWA 4JHUA 2FNWA 2RR3A 4ZXBC 3QGKC 3LM7A 4XZUA 2Q6ZA 1KXTA 3JWNH 1FHDA 4UIOA 3H9HB 3IFLH 3IJ6A 2QVNA 2WBKA 3CGTA 4DLFA 3KS0H 2GTWA 3DIPA 3C6LA 1R1CA 2YXWA 2DZWA 1T7XA 1R9YA 2CU0A 3WD0A 5HGDA 5T33L 3HFMH 1WD9A 2EDRA 1MN4A 5CMAA 2BHZA 5B80A 2BXYA 1RURH 2CH8A 1BEYH 2ZOLA 3QDGA 1JNLH 1W8OA 4PMJA 5I6NA 5D8JL 5HGBA 1DBBH 3V5FA 3DK0A 4OCSH 4PJ5E 4TPRL 1AKJA 1EXGA 4LCWE 5DD1L 3M1BB 3SKOA 1PDZA 2P3EA 2SODB 4XUGA 4LUSB 1EAJA 3MR9B 5DGRA 1CIDA 3LA4A 1DZBA 2LE9A 1R3JA 5E24E 1M2VB 1LD9B 4TQPA 4HUVA 3WSUA 3TNMB 3DX7B 5HYSG 1OYBA 3W70A 3Q3GB 1PGRB 2EDYA 4XAFA 3UPWA 3B9KB 4LV9A 2XG5A 2F84A 4UT7L 3N4AA 4QLKA 5C07B 3UR5A 2FE0A 1VACB 4JQ2A 2QT6A 1RZ7L 3GBMH 3MRIA 3EMZA 3E3QC 1TITA 1VFSA 4JRXB 3PQYE 4X5LA 4A6YA 3C8DA 4RFNC 3NIYA 2FVNA 5D2VA 3G6JE 3D6GA 2PDIA 1BLIA 4LHQB 1CGTA 2PW1A 4IXHA 4DP6X 1R2RA 1KGCD 2X70B 4M5TA 4E41B 2J9YA 2EXYC 1K5NA 2A4CA 3H85A 5GRXG 2OP4L 1FL3A 2GQ9A 1VFTA 2RGLA 5KVFE 3WDPP 3I84A 2DY3A 4IU3A 3MHZA 5GXBB 2XXFA 5JPNB 3T05A 2JQZA 4HISA 1JUEA 2AOSA 3U7VA 4XMTA 3D9AL 4AYFA 2CG9X 5AHIA 1OTSD 2AITA 5FACA 1VBJA 3KXFA 1GGYA 4L1TA 1W2VA 1IEBB 2HRWA 2WYIA 1NMCC 3S98A 1RL1A 1QR1A 1LQAA 2AQVA 4L29B 3FULA 3B9NA 3I7QA 2VWEE 2WVSA 4TQEH 2QCLA 3MMDA 3CSFA 1RCXB 2QJGA 5TE7H 1FH2A 3DPDA 3TM6A 3WAKA 4PMUA 3SBWA 3D2UA 2W67A 3GYEA 4LF1A 3ILDA 4TV5A 5EPMA 1U6AH 1A3ZA 3Q2NA 3GDBA 5KN5A 4I18B 2XH7A 3MHUA 3A6CL 3G3LA 4WIQA 1QSEA 1NLBH 1G1KA 1G9NH 1V5JA 1TDQA 2NLIA 4JY9A 5KBNC 5KZMA 4MSWB 4IMGA 3RUGE 1Q85A 2BZDA 2DIBA 4LLMA 5KYYA 1P6CA 3MLYH 4ONHA 4YO0B 1Q72H 3NK4A 5TTRA 4PYSA 5AL8A 4HEPG 4ZVJA 2XKUA 2HX8A 4S3KA 5D7LB 2XQBL 4WJ8A 5A6BA 4IHOA 4P23B 4Q8UA 2CMRL 4TYUA 4NQDA 3NSYA 5EZLB 2CZVA 1XQ4A 4I5BA 4AYDC 5H37H 3PZOA 4KK9C 1MHEA 2D3NA 4F1ZA 3UBXI 4C56D 4K2UH 1SFHA 2ZD0A 4HHWA 2K78A 2AV7B 5HP5A 1GQIA 1ZTMA 4HK0B 1TQBB 3H3KA 1JNHA 3QJFB 4FP8H 1CICA 5F97E 2APWA 3KGTA 1Y1UA 3GIZH 3N4FA 4JIRA 2B59A 2MH4A 5H8UA 1IF2A 1JQXA 5DURB 2VLKA 4UTBH 3RRAA 4Q2ZB 1Z0NA 5AW0B 5C0EB 1KPRB 2NWSA 1XB8A 1P5UB 2FJFA 4ZW5A 2HWGA 3IN0A 1E6NA 2XQYG 4S2SA 4D2NA 4TLSA 1AGCA 2E25A 3TLLA 2INFA 3U2ZA 4N8VG 1F6AA 4KVNL 4O2FB 1C91A 3AWOA 4NPYA 4JFED 4PCPA 4XH2B 1ILSA 1YMMB 5LCVH 4XPBH 1A5KC 1PTDA 2DTSA 4J3OD 3AM8A 5EV7A 5H8MA 5I8EB 3TA3D 3ULSA 3DFPA 1QNIA 3CIVA 3B9KC