4PCTA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 161
structure length 438
sequence length 438
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4pctA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pctA01
3SUTA 1W1PA 2CKRA 4JKLA 5I3DA 1E5JA 2Z1KA 3WY3A 1I75A 3F4VA 2FH8A 2ZUWA 3NJ3A 4FK9A 3TP4A 1KCLA 3CZJA 2WK2A 4HZ8A 2WMGA 3GNRA 2A3EA 4KGLA 5FOOA 5A6KA 1GQKA 1GQJA 3WF2A 1ZJAA 3NDZA 3OGRA 1B90A 3T0DA 1E55A 3DX3A 4JL1A 4AD3A 3AISA 4HOXA 1R8LA 1TA3A 1V3JA 1D7FA 2CERA 4MB1A 3VGDA 3WENA 4DUVA 4TTGA 2VNCA 1KXHA 4YHGA 1BGAA 1U33A 5A8MA 1R34A 3BMVA 3WNMA 3N15A 3A24A 1QNPA 3VD9A 2EABA 4D6GA 1CXIA 2XN1A 3PZOA 1KXVA 1NWUA 2J47A 2XFRA 2BY3A 1HKMA 3AXIA 2E3ZA 3U5UA 1W9DM 2V5CA 4AW7A 2XGIA 2VRKA 4W7WA 2CPUA 5D9OA 3WBEA 3VIOA 1C90A 3DYMA 3N1AA 1HKJA 1FOBA 4B15A 3LPPA 1K9FA 2FGLA 3WH9A 4U2ZA 1MXGA 3L4VA 2WHJA 2WHMA 1KXTA 2J7CA 2ZUSA 3W6MA 3CZGA 4XZWA 3OG2A 2CETA 2YL6A 3F5LA 4AZGA 3O2LA 5BWFA 1J18A 2OWXA 1ODZA 2VZUA 1HT6A 1GPFA 3GXIA 3MKKA 4AXNA 4NX0A 1DWIM 4UNIA 2A3CA 3B9AA 3BAYA 4PTXA 1MYRA 3VMPA 1HF6A 3AS0A 3B9DA 2O9OA 4NXKA 4NSBA 4AMWA 4PYSA 5CJ5A 4OJYA 3WIJA 1VIWA 3HU7A 1KQZA 2YFOA 1W9XA 1B3WA 1ZL1A 3AMKA 2ZWZA 4C7GA 2J25A 1DWJM 2EBNA 3WUGA 7A3HA 2BNJA 1RD6A 1UZ1A 4HPGA 1UR1A 2YBTA 2XSBA 5BXPA 3NDYA 1H3GA 1JG9A 3U7VA 3VD5A 1HJQA 3EBVA 3PZNA 3QHMA 1AVAA 3NSMA 2IXVA 2WC7A 4BA0A 4HMEA 3UESA 4AY1A 4EK7A 3GH7A 5E1QA 3E1F1 6CGTA 2FGZA 2FHFA 3VGEA 1V0LA 1C93A 5EB8A 3A5VA 3AHXA 1E71M 7CGTA 4NXSA 1UOKA 1E0VA 3BSHA 4W8BA 2QMJA 2G3NA 1H11A 3WBAA 1VEPA 3A47A 3FNDA 2F7QA 3UETA 1ISWA 2ZUMA 3WQ6A 5A2CA 2WBKA 3GXMA 4MADA 4RE3A 2JIWA 1HL8A 2UY5A 5M5DA 3TTQA 1A47A 3PZIA 3ARQA 4JFSA 1FH7A 2XSAA 3A4WA 1BHGA 3MSGA 2DPEA 1WAWA 2WB5A 3AXXA 3ARVA 4F79A 3QGVA 5A8QA 1CDGA 1MW0A 4JL2A 2OW6A 3LPOA 4Z2KA 1J10A 3BCDA 2WCAA 2W62A 4AIOA 3VNYA 1NOWA 3WL1A 2O9PA 3RIKA 4LQ1A 4PTVA 2W4XA 5HPOA 2IGTA 2WCGA 2WM0A 3WF4A 1JZ4A 1E15A 3II1A 4GO8A 4FNRA 2EPNA 1G94A 3BCFA 2CHOA 2WHLA 3AZTA 1GVYA 3WQ5A 4M1RA 3VIMA 1EOKA 3AICA 2DQXA 1LL4A 1UWRA 3D4ZA 1ESWA 1H2JA 2CBUA 1PIGA 1UA3A 3RCNA 1BVNP 1P6WA 4PRWA 2WPGA 3GXTA 1E4MM 1UH3A 3BUDA 2A3HA 4QP0A 2YKKA 1CLXA 2X0HA 1XHGA 4IPLA 1M7XA 1H0IA 1LJYA 2BHYA 1KQYA 1OCQA 3ZT6A 1EA9C 3OBAA 5CPTA 3W29A 4X9YA 1HN1A 1NWSA 4CU7A 3NIYA 1TFVA 2X0YA 2J78A 3D3AA 1B3ZA 4Q7NA 2CHNA 2BVDA 4KRTA 3VU2A 5E0FA 3CPUA 4CU8A 4AZBA 4KH2A 3L4WA 4M56A 3CHCA 4GZJA 3SUWA 4JCMA 5TD4A 3BAJA 4LYPA 4ACZB 3IAQA 5A6SA 3W28A 4PUEA 1GVIA 3SUVA 2JFEX 1MW1A 2VZOA 3WD4A 2PB1A 1Q6DA 1W9UA 1C7SA 3PZQA 2X2HA 3BXWA 4U5IA 2ZE0A 1B30A 2PF0A 3BUPA 2WAGA 3SCOA 4E4PA 2JIEA 5DO8A 5BXRA 1CNVA 1JAKA 4AZ7A 5CSUA 1W9VA 2PWEA 3UG4A 1CTNA 4GQRA 1TQUA 1J0ZA 1QOXA 4TX6A 2YDSA 3SURA 4LPCA 1NP2A 3AMLA 3UERA 4TVCA 5JBFA 3LXBA 3BAIA 4V2XA 2O92A 4MNJA 3ARZA 1BVZA 4ZE4A 4E8DA 2NSXA 1L0PA 4XX6A 3ARUA 2FHCA 3N12A 3PZ9A 4DWSC 1XH1A 1Z32X 1R86A 3ARYA 1TZ7A 1V6VA 1LG1A 1JIBA 1SZNA 1R47A 2ZWYA 1GNXA 3FAXA 3WF1A 4GPNA 1V6YA 2QPSA 1BYAA 4LXFA 1V3MA 4W85A 3ARPA 2DH2A 3ZT5A 4TUFA 3MUIA 5I6SA 2WKGA 1O7AA 2EPLX 4FMVA 4NI3A 2YLLA 1M03A 3A22A 3WF0A 1CGVA 1ODUA 2Y24A 1GHRA 1IV8A 3WNKA 3VGHA 4KGJA 4AZCB 3EDFA 1J9YA 1KFWA 4UOZA 1CXHA 2E0PA 1SMAA 4UZSA 2D0GA 2VR5A 1DTUA 1HKKA 1CWYA 3VTRA 4ZE5A 3RMEA 1TUXA 3A6OA 2EAEA 3GDBA 3N11A 2DSUA 3B9EA 2VQTA 2AMGA 5HOSA 1V02A 1VF8A 1B1YA 2D22A 4M24A 4FF5A 1M04A 5A6JA 4DUXA 5ABFA 2BY0A 4JCLA 1ZS2A 1QI0A 1JFHA 3ARWA 2CXGA 3SCVA 1UG6A 2CIPA 4FNSA 1QHZA 3VGBA 4AWEA 1AQHA 1IZJA 1KCKA 3K4AA 1V3KA 5EBAA 3AS2A 1SYTA 1E73M 4UQEA 2J7DA 1EO5A 4AC1X 3WDQA 1QX1A 1O6IA 4FNTA 5CG0A 1WO2A 1NH6A 4CD7A 3WY4A 2J7FA 3AXHA 3PTKA 1EXPA 5M03A 3CZKA 1CECA 4AD0A 1W2VA 4YPJA 3MO4A 4NRRA 2WANA 2CESA 2DT2A 2D2OA 3CBWA 4HTYA 4QFUA 3WQ4A 4AISA 4MB3A 1UYQA 3WY1A 1UR2A 1E4IA 5I78A 1QBAA 4FLQA 2WMIB 1VEMA 4Y7EA 5I5RA 3WEZA 4BQ5A 1FH9A 4CN6A 2NT1A 3AIVA 3AQUA 3SCQA 4MAZA 2GJRA 4AMCA 3K8KA 3PTMA 1GQIA 3ZJ6A 4TVUA 3QOMA 3CUJA 1AQ0A 3AIBA 1WDRA 1JDCA 4EANA 4OUEA 3W27A 2GUYA 3TTYA 1EH9A 4RE4A 3WQ8A 2JF6A 1UKTA 3A21A 3A4XA 1E43A 1VBRA 4PMOA 1DWHM 5A6BD 4AZHA 1E0XA 1EQPA 2WW5A 3CZLA 2VL4A 4UFLA 1DWGM 1DWFM 3T0BA 4F9JA 3BC9A 2WKLA 2DDXA 2GJXA 3WH6A 4DWSB 1OT2A 4CN1A 4D6CA 3TONA 2XGBA 1UWTA 3GBDA 3AI0A 3ZOAA 3DYOA 2FDMA 1JZ8A 1CENA 1E1FA 3VIJA 1WNOA 3FXYA 3VSUA 3I3DA 2VCBA 5E9AA 3L4UA 3L4ZA 1QI4A 3GXPA 1E6ZA 1CGTA 3KLLA 3AHTA 1N82A 1H41A 4FLOA 4PMUA 1W32A 5E70A 3WUBA 1U2YA 3CUIA 2Y8KA 3UR7A 2ZX7A 3EDEA 4MB4A 5FCZA 1MQPA 3VINA 3BLPX 2A3BA 1CLVA 1TVNA 1AMYA 3VDCA 5M3WA 4AIEA 1UD4A 4UFKA 5I23A 3EJTA 2IXUA 3WD3A 1IZKA 4MNKA 2XWEA 3BAWA 4BQ2A 2F7PA 3VUPA 4D72A 1HVQA 1SFSA 1J11A 2VVSA 1U30A 4P7QA 1VJSA 4PSPA 1GUVA 3G6LA 3AYRA 4ZXLA 1HTYA 1CGUA 3DC0A 3SIMA 4FLRA 4TXEA 1NP0A 4BQ3A 3AS1A 1RP8A 1PBGA 3WFZA 5CLWA 2GK1B 4S3KA 1WZKA 3TTSA 1LF1A 1V6XA 4JHZA 1PIFA 5HDRA 1NARA 1JI2A 1QHOA 4JIEA 2OSYA 4U3CA 2HVMA 2VMFA 3CTTA 3VIFA 3HG3A 3CUGA 4QLLA 1FFRA 2BS9A 2XVNA 2F8QA 3BGAA 1SR0A 4GZEA 2OYLA 4L4PA 5D4YA 4MJ4A 3MU7A 1A3HA 5A8PA 4F8XA 1ITCA 1ZBKA 2W63A 2VQUA 1SMDA 3O9NA 4QCFA 5JUVA 3ZJ7A 1UD3A 3MUZ1 4UZUA 1HP4A 3T2PA 3W0KA 3WQWA 1V3LA 4MDOA 5A8OA 1W3JA 2W67A 3AS3A 1OIMA 4OBRA 2QMKA 4KRUA 1V0NA 1D3CA 4CGTA 3ARTA 5IXEA 1JI1A 5GNXA 5C70A 3DHUA 4HA4A 3SCSA 5AC4A 2J7HA 4UFMA 2TAAA 1E6PA 4HMDA 4J3WA 4D6EA 4ACYA 3VVGA 2HISA 3CGTA 5BXTA 4PMRA 3ZSSA 3S5ZA 3RM4A 4Z2JA 1X6NA 3FN9A 3PHAA 4KMQA 3AMCA 1W9BM 3WH7A 2WLZA 1TQTA 3N13A 3AYSA 3ZQ9A 1HP5A 4AD4A 4GZIA 1XCXA 2YA0A 1GOWA 2XHYA 4AIUA 4BZYA 1KBKA 3WD2A 2GSJA 5BCAA 2UY4A 2QLYA 3EJQA 5AC5A 1BYDA 1B0IA 4JFVA 1E3XA 3DX1A 2O9TA 3AIUA 3RJYA 1W1TA 4PTWA 4DO5A 1VENA 1TMQA 2D23A 3RPMA 2YLAA 1KGWA 1C8YA 3W82A 2WVVA 1JDDA 3OLGA 2WZIA 1JZ6A 1JD7A 3BVWA 4PMDA 3ZJ8A 1C8XA 1MXDA 1FP9A 1WDSA 2VZTA 2EADA 3CO4A 2X2YA 4QDMA 1GCYA 3WMCA 5JBEA 2Q8XA 1ECEA 3A4AA 3SCWA 1VEOA 2XM2A 2J62A 3RDKA 3EDDA 1XV8A 2VTFA 2CYGA 1ZU8A 1S46A 5IDIA 3ZJKA 3WF3A 3BUIA 1TE1A 1CZ1A 2AAAA 2XM1A 5D8WA 1UKSA 1WP6A 1LWHA 2V5DA 1GOOA 4HOZA 3VIKA 3IGUA 1GOKA 5C71A 1NWRA 3WFLA 4D1IA 2EJ1A 1JXJA 2XTKA 2VURA 3ZR6A 2O9RA 2VZVA 3THDA 4B9ZA 2AOSA 1E0WA 3THCA 4U31A 4U3AA 3EMCA 3NYDA 4E8CA 3K46A 1G5AA 2W66A 3WL0A 2XVPA 3CLWA 1CGWA 2ZXQA 4MTVA 4AZIA 3VIPA 1BQCA 5JBDA 4JKKA 4KWUA 3IJ7A 2OLHA 4UR9A 3W26A 4V27A 1BTCA 1XD0A 5D9NA 4EAMA 4P8UA 1UD8A 2OWCA 5DFAA 4S3JA 4WKFA 1UKPA 1JYWA 3DHPA 2D20A 1ZB5A 1PS3A 3L2MA 2CBJA 1K9DA 3ZIZA 2JF7A 4PTMA 2VO5A 3TOPA 3IANA 4GINA 3I3EA 2QF8A 3DX2A 1BYCA 4UOQA 1RH9A 1US2A 2J8GA 1VFUA 4PMYA 1C92A 1E56A 4GQQA 5CLTA 4UTFA 1EGZA 4W8AA 1MWOA 3VSVA 3GTNA 3EYPA 1J0IA 4A4AA 2ZX5A 1HNYA 1WZMA 5M17A 4TX8A 3VIGA 3ARRA 4PN2A 4D6IA 2VRJA 1WCGA 3OLEA 3VX0A 5ABGA 3WNLA 3WEMA 3AIEA 3QOKA 4H8VA 3B8SA 1LQ0A 2W61A 1DP0A 1J0HA 4B3LA 3KEHA 4GI6A 2WC4A 4JKMA 2V3DA 3HG5A 1VFFA 3SUUA 3VNZA 4XZBA 4U33A 1B3YA 5CPSA 4C7FA 3W53A 3VILA 3J7HA 2GJPA 2XUCA 4PMZA 4WLCA 1D2KA 1JZ3A 1J0KA 1QI5A 2WCSA 4Q22A 1KGXA 2V3GA 4X0NA 3OGVA 3SCRA 1J0JA 1UUQA 3JUGA 3N9KA 4GKLA 3CUHA 2YA1A 2DT1A 2VOTA 3M46A 1XH2A 3S6TA 3BAXA 2J79A 1WKYA 3VM5A 2WMHA 3DX0A 2Z1SA 5CXPA 2G3JA 1QWUA 4J3XA 4W7UA 2VI0A 1XSIA 5F7UA 1CXFA 2DSKA 1GONA 3LXCA 4Z2IA 1MW2A 3EJPA 4HPHA 1GOIA 5E09A 1QNSA 1Q6EA 4GO9A 2ZICA 5JIWA 9CGTA 3L4XA 1H5VA 1GORA 4HP5A 1UA7A 3OB8A 4ZXOA 1E6RA 3CMJA 1GOMA 2JE8A 4JFUA 2FH6A 2OW7A 1E1EA 2ZX6A 2B31A 3O6AA 4OBSA 2X09A 4HA1A 1OBAA 1CXLA 1PAMA 2VRQA 1QWNA 4MNLA 5DMYA 2VX6A 1V6WA 5D9PA 3VDHA 4ATWA 1TG7A 2BVTA 2XIIA 3TV8A 2X8RA 2VT0A 2WSKA 5AY7A 3D4YA 3M07A 3POCA 3W6LA 3VMNA 2J77A 4MAVA 4ATDA 5IHRA 3WNPA 3BUQA 1EHAA 1WPCA 3U57A 4WK9A 3HJEA 3EDKA 2OSWA 2OSXA 3VGFA 2WYSA 2WVSA 4DWSA 1W3KA 3LX9A 1EDTA 3KZSA 5JIPA 5A1AA 1UKOA 3GZAA 2E9BA 4GI8A 1CIUA 5A6LA 5CSYA 4MB5A 4D6JA 3N18A 1OWQA 1E6NA 5CGTA 3BVXA 2ZX9A 3MMUA 4OOUA 1V0MA 3ZR5A 4P7OA 3GXDA 2XG9A 1E9LA 1JDAA 5CZKA 2YL9A 4W7VA 1G9HA 2D3LA 1QNOA 3VMOA 1WZLA 4B9YA 2WXDM 2GVYA 3ECQA 3GH4A 1BSIA 2DT3A 3EJSA 2VUYA 4HMCA 4H2CA 1HJUA 1MQQA 3GNOA 3LMYA 3D50A 1BGGA 2Y8VA 3A23A 1V02E 2QV4A 3N17A 1M53A 1VFMA 1PZ2A 5A94A 3AZRA 4V28A 1K9EA 5I77A 3MV11 1KB3A 4CVUA 3WN6A 1BG4A 2DSZA 1VFOA 4QCEA 1LWJA 3OZOA 4D6DA 1QNRA 1OB0A 1OT1A 3CUFA 1MVYA 4D71A 4Z2HA 1HX0A 2GDUA 3AFBA 2W92A 2E40A 2WLYA 4NZCA 2BVYA 2GK1A 2ZX8A 4DM2A 4PBGA 3PTQA 4AMXA 4P8WA 4AD2A 1RPKA 4CCDA 4J7RA 4YN5A 4QAWA 1JYVA 1UR4A 3WNNA 4F66A 4B3KA 1HL9A 4N42A 3T09A 4UFIA 3KL3A 3VIIA 1UR8A 5D9MA 5EFDA 3DDFA 5FD0A 4EKJA 1XCWA 4AZ6A 1NOUA 1LG2A 1E40A 3GYCA 1VRXA 2G3IA 3W37A 3D52A 2QHAA 5DT7A 2YL8A 3LRMA 2J74A 2ZUTA 2CNCA 2E9MA 3KWXA 1YHTA 1R87A 1DHKA 5GNZA 2J4GA 4LYRA 1R85A 1EDQA 2WSPA 3IJ9A 5E6ZA 2WMKA 2F7RA 2ZUUA 1V6UA 1I1XA 4W93A 4PMQA 4Z2GA 3VSTA 4AEFA 3PZUA 2ESCA 1L8NA 1OD8A 2WHKA 2ZXAA 2D0FA 1JZ7A 4OIFA 1EIBA 2X1IA 3CIVA 3W24A 3AIQA 4W84A 3KL0A 3MMWA 1KBBA 1JF6A 3OZPA 4M80A 3N04A 4HOWA 1B3VA 3QHOA 3FW6A 1V0KA 2PWFA 4UQAA 1XYFA 3WH8A 4FNUA 1C91A 2PWDA 3BLBA 4PCTA 2E8ZA 3MUY1 1E6SM 2ZUVA 5IFPA 1PPIA 1JAEA 3F5KA 2IUZA 2EEXA 2G8ZA 2PWHA 1DWAM 1XYZA 1QVBA 2XFFA 3NSXA 3OLDA 2NT0A 2XVLA 5ABEA 4WKHA 1CPUA 1E6XM 3WD0A 3EJUA 1E4LA 1Y7VA 5ABFB 1MQRA 5C8BB 1W2PA 2WZHA 4UQDA 1PEZA 3DECA 3CZNA 2BY1A 1JXKA 2XYLA 4U2YA 5I79A 3DYPA 4OZOA 5IHSA 4N0RA 3W4RA 1HJSA 3RILA 2F2HA 3WSUA 1M01A 2VX4A 2NW0A 4PCSA 1RP9A 2Y4SA 2BXZA 3OIHA 2CBIA 5EFFA 1C8QA 4AYGA 3BVUA 4MJ2A 4J3TA 4D6HA 2YA2A 4X0VA 2J75A 1O7DC 1CXEA 2XVGA 1JGIA 4Z2LA 1TR1A 1UWQA 2RGMA 1H49A 1QBBA 3EMQA 2WVTA 1GOQA 1CGXA 3MI6A 1UZ4A 3GNPA 2J7BA 1FP8A 3WY2A 3OGSA 3BAKA 3PZMA 3MS8A 2J8FA 4HZ7A 1OD0A 2ZIDA 1HVXA 6A3HA 4M81A 2VJXA 2WC3A 2RGLA 1HXJA 2VX7A 3BMWA 3DX4A 1DEDA 2FYVA 1UWIA 3VIHA 4IPNB 5BYWA 2E8YA 4MNMA 4NF7A 2PBGA 4UQCA 1F4HA 2PC8A 2G3MA 3CV5A 3VGGA 4FLSA 3VD4A 4URIA 2X05A 1BAGA 2EXOA 2GJXB 2EPKX 2G4FA 3S5YA 1UD6A 4BQ4A 1KXQA 1OGBA 5DEZA 2X2JA 4JFTA 2F7OA 3WDRA 1KTCA 1TVPA 3RM8A 3WMBA 3K8LA 4LX4A 3VOCA 1MFUA 1OGSA 5A6AA 2JEPA 2Y5EA 1PX4A 1PX3A 2XFYA 2VVNA 3AJ7A 3PZTA 3CZ8A 3FHAA 5FKYA 2EQDA 2YIHA 1V08A 2YJQA 4YHEA 3SCTA 2D3NA 2ALWA 2FE0A 4JAWA 2XIBA 3CMGA 1KR1A 1CGYA 1B9ZA 3EDJA 1LL7A 4CD6A 3FHQA 4P7LA 5D8ZA 4XB3A 4H8HA 2OWWA 4W88A 2W91A 5BROA 2E4TA 2CEQA 4CN4A 1PJ9A 1HJVA 2QPUA 1CXKA 3LPFA 3LPGA 2CKSA 2V3FA 1R46A 4PMVA 3AHYA 5IFTA 3S2CA 3NUKA 3HMCA 3RO8A 4LYQA 1EDGA 3BSGA 3M7SA 4D6FA 2CBVA 1PZ3A 5DF0A 4ACZA 1TA3B 3OA5A 4CD4A 1ZBVA 2BFGA 3TTOA 4FNQA 1W3LA 1QI3A 2FHBA 2W5FA 5DT5A 4IUGA 5A95A 1ZBWA 3CH9A 1OIFA 4DUWA 4J28A 3LRKA 1R7OA 1HWWA 5HXMA 4ZENA 4QLKA 3MV01 2DIJA 1JF5A 2YFNA 2DH3A 4BS0A 3MMDA 3W81A 2OYMA 1HJXA 3DDGA 4HU0A 3L2LA 1V3HA 3CZSA 1CBGA 3SCNA 2D0HA 1ISXA 4U5KA 3RJXA 1UQZA 2XN2A 5FL0A 3GXFA 3NCOA 1HJWA 3WMSA 6TAAA 3K8MA 3CC1A 1GZJA 3HN3A 1H1NA 4H7VA 2EO7A 1OM0A 4H41A 3APGA 4JZ5A 1ZBCA 3IJ8A 1UH4A 3U5YA 3U7BA 2J7GA 2XVKA 1H0GA 3K4DA 4OOZA 3PZGA 1E5NA 4XUYA 1X1NA 4NRSA 4UFJA 5BRQA 4BCEA 4HU8A 5E6YA 1QI2A 1NQ6A 4WKAA 1J01A 3LXAA 3T2OA 2XPKA 5CQ1A 3WUEA 1GJWA 4EE9A 2OYKA 3WQVA 2BXYA 4UQBA 4HA3A 1ZJBA 2E9LA 4ZFMA 4AZCA 3SCPA 4AZ5A 1OGGA 4RL3A 4WIWA 1IT0A 1XH0A 1NWTA 1R75A 4TVDA 1UH2A 2YDQA 5BXSA 3T2QA 1FHLA 2XN0A 2WVVB 3IK2A 4A3HA 4AEEA 4CD8A 1ITXA 1XC6A 3AZSA 4NZJA 3WDHA 1BYBA 4L4OA 1J12A 1R33A 4HZ6A 4XV0A 1KR0A 2D73A 5HPCA 3OLIA 4WF7A 1W91A 1JL8A 3GBEA 2BV9A 2MANA 1VBUA 2ZUNA 2YL5A 1LLOA 1JNEA 1C7TA 1C3FA 3EMZA 2YDRA 4GIAA 4PMNA 4WJXA 4RE2A 1WDPA 1VB9A 5LYRA 4A3YA 1W1YA 4W5ZA 4MPKA 4UQ9A 1JFXA 4UFHA 1UD5A 2DT0A 2VCAA 3VD3A 3VM7A 3MSDA 3VX1A 3KE0A 1V03A 5A3HA 3MUAA 4CCCA 2PI6A 4IISA 3AIWA 4BF7A 3ZSTA 1EOMA 3G6MA 1G01A 3SUSA 8CGTA 4GI9A 2WMIA 4WSKA 4PSRA 1QPKA 1FH8A 3W25A 2EACA 1VAHA 4K68A 1CEOA 4NZFA 1E4NA 1UD2A 3UEQA 3ZT7A 3L4YA 4AD1A 3ALFA 1ISZA 3LRLA 4FNPA 2VCCA 3AOFA 4QLJA 1FA2A 2CITA 1QW8A 3KLKA 4AYSA 1KTBA 2YBUA 1Q6GA 2UWFA 2WMJA 3WDIA 3VKKA 4CCEA 1EHNA 4W86A 4DWSD 1W1VA 3RM9A 3ZM8A 3TA9A 3M6DA 3UG3A 3UG5A 5BRPA 2G41A 5EMYA 1TQSA 1TCMA 1XD1A 3AHZA 4TOQA 2DGAA 2VX5A 3IAPA 3HZ3A 2WWCA 2J7EA 4ML4A 3WDPP 1LL6A 4E2OA 3MANA 3H55A 1JZ5A 4J27A 5I2UA 4W8LA 1UHVA 4LGXA 3ZMRA 2VZSA 4ATLA 1JZ2A 2F1BA 4DO6A 2DEPA 5CPQA 3K1DA 4R5EA 3T0AA 2A3AA 2WBGA 1CYGA 3GXNA 1XRVA 1ISVA 1FFQA 1F4AA 1T0OA 1E72M 3GM8A 4OGZA 1Q6FA 2WMFA 1B3XA 1UR9A 2C8NA 4W5UA 4UCFA 2WNWA 5GPRA 3BUBA 5A69A 1H4PA 5A2AA 4D1JA 1BG9A 4W89A 1K6AA 4JFWA 2ZOXA 3SEPA 3CHDA 3BVVA 4P8VA 1W3HA 5ECUA 2PBOA 3VDBA 2XWDA 4P7RA 5ABHA 4DM1A 3UCQA 5HBFA 1QHPA 4CVWA 4GXPA 3D5HA 4IM4A 3D51A 4MDPA 2V3EA 1FHDA 1WE5A 2WZEA 3VDAA 2GDVA 1KWKA 4DO4A 1BPLB 2D24A 1GHSA 3HG4A 1B2YA 2WVUA 5GQBA 1XSJA 5FL1A 1G0CA 1BFNA 5A8NA 3WEOA 3ZO9A 1YQ2A 2BHUA 1WB0A 5KEZA 3CHEA 3AMDA 3WELA 1HIZA 1X6LA 4JHOA 3WKZA 4OKDA 5FIPA 1K9TA 4CU6A 3SCUA 3POHA 3H54A 5E0CA 4M8UA 4ZEPA 1EQCA 3PN8A 5LA0A 3QR3A 4R27A 2VC9A 4WSJA 2X2IA 5I24A 1GW1A 1V3IA 3AROA 4C7DA 1E70M 2Y2WA 2F61A 3ARXA 2BHZA 3PBGA 1QW9A 1E3ZA 3AMGA 2YOCA 1JYXA 1UWSA 2V38A 4P8XA 2C7FA 4PMXA 1PX8A 1UR0A 2D1ZA 2ZXBA 5KZ6A 3VD7A 1VJZA 4PEEA 4J3SA 1HXKA 1MFVA 5AYBA 3WH5A 4CKQA 1EO7A 1OSEA 2F1AA 3FAWA 4M82A 1XSKA 1QNQA 3EJRA 1JYNA 4B16A 4PUDA 5LA1A 3QHNA 5AYIA 1NM9A 1BLIA 1MW3A 2EPOA 5LA2A 5A6BA 4J3UA 3VPLA 5A6MA 1HKIA 4CD5A 2PWGA 2C0HA 3CHFA 1UQYA 1ISYA 2JALA 3ALGA 1WDQA 2ZXDA 1AQMA 1BF2A 2CCRA 2EPMX 4AD5A 4F9DA 1G1YA 3WD1A 3W38A 2DSWA 7TAAA 5I0DA 3AHVA 4TTUA 1UASA 3CZEA 4J3VA 3WNOA 1W9PA 2XJ7A 2DIEA 3BVTA 3FY1A 3GH5A 3BLKA 3L4TA 1TQVA 5HNNA 1OINA 1E6QM 3AIRA 1KGUA 1TQWA 5A2BA 3T08A 1JNDA 3UR8A 2UY3A 1UKQA 1J0YA 4CUCA 2F18A 1Q4NX 3H53A 2VR4A 3BH4A 5CGMA 2WWDA 1R7AA 1UWUA 2DSVA 1XGZA 4UOJA 1WZAA 3WUFA 3HG2A 2UY2A 4W87A 1I1WA 2GFTA 1H09A 3WDJA 3A3HA 3KL5A 1US3A 1KWGA 1GQLA 3ARSA 3NSNA 1GJUA 1Q6CA 4H04A 1NOFA 2BY2A 4M29A 8A3HA 1B31A 3PZVA 3F5JA 3I3BA 1JD9A 4P7NA 4H8UA 5GNYA 2JEQA 3VO0A
chains in the Genus database with same CATH superfamily
3F65A 1OK6A 4U1NA 2PLKA 1A3QA 4DF0A 4GMSL 4PJBE 2H9AA 2WMGA 4GXVH 3S2MA 2A3EA 4IIQA 2XKNA 3W2UA 3T0DA 4L4LA 1TZIB 1RZGA 2J1YA 2A38A 2WO4A 1EGVA 1W0VA 4NQCA 3J8F7 2K45A 1IM9D 2OMBA 3ZN6A 1KCZA 1VLXA 1CFSA 2ATPA 1QNPA 1SVCP 5AD0A 3G8RA 3OKMB 1OEPA 4L3EA 4G6JL 1HKMA 5EIQA 1GC1H 2H90A 5E8EB 4ACTA 2NCMA 4Y7OC 4M3HA 4PUJA 2AQRA 4Q32A 3GUFA 2VSMB 4WHYG 3EWZA 3FOLB 4Z7WE 1EEPA 2YAQA 1DVZA 3Q2WA 3W6MA 3FQWA 3P7YA 4N2FA 1VFLA 2OWXA 4IRZL 2ZPKL 1JNJA 5BOJA 5DYOB 2NW2B 2O9OA 3MP4A 1UIPA 4PB9H 4HWUA 3MA9H 1BF6A 4ZTEA 4DGVL 4GNVA 5DQ9B 4AF0A 2PCQA 3MY9A 2OI9B 3I9IA 5D5ME 5AL8A 5K39B 1CDBA 3T2NL 3GR8A 4AENB 3HJ0A 4C47A 2P76A 2IOIA 1BXNA 3VI4B 1GGIH 5BXPA 1UTDA 3EBVA 4DBSA 1QFWL 2CKBA 2F68X 4O0QA 1BX2B 5FUOH 1DXIA 3E02A 3A3XA 3THAA 1O6SA 3V4PA 1E71M 3QARA 4N87A 4PJGB 5TTRA 4R88A 3QDGE 1YEEH 1JZDC 1P4LB 4WV1C 5A2LH 4PJAE 5EU3A 1T2JA 2JIWA 2UY5A 3SBQA 3V18A 1OWWA 4MQ7B 4JFSA 3TU6A 4PI0A 1A25A 3O2WL 2WB5A 1WAWA 2OZNA 1BMWA 3L7EB 1PDKA 4JTRA 3QCVL 3MRRB 1FPTH 1WCQA 4KY1H 3S8GB 1NOWA 5HJ3B 5T26A 2EXWD 2J1ZA 3BZDA 1JUKA 4P46C 1P0BA 3KYKL 5C0FB 3QRFM 4DGUA 2XN9B 4Z5RA 4XMKH 2D7PA 4KEUA 4BKNA 1BAFH 1PV8A 3P77A 2CR0A 5IREA 4A7QA 3VXRB 2BVOB 3BD4A 2WBJD 3N2MA 1TE6A 5C0CD 4FTVE 5MP6H 4UTTC 4HDIB 3SKJL 2XZQL 1N26A 1FN4A 4NERA 3SUWA 4LEBA 3HI6L 2DZSA 2UXTA 3AU0A 5CPMA 4NAFA 4S1SH 4OTKA 1GVIA 2Q2EB 3AREC 4ZJ9A 1IAMA 1D6VL 2PC4A 2JIEA 3EPOA 3NIGB 1N19A 1TRIA 2NNFA 1KMGA 1R3LB 4TX6A 3EW3B 3I10A 4CVZA 4EIUA 3GTHA 3KXFA 2Z6JA 3E0IA 4E8DA 3FTWA 2VQ1B 5AAMC 1Z32X 2C5DC 4W9EC 1DBMH 1SZNA 4XX1E 2REQB 4XXWC 3W3OA 1RL1A 4X4ZA 5ICYA 5I26A 2CLMA 2CRMA 5AUMA 2A9MH 2GITA 2X30A 5I6SA 4X4XA 2Y7QB 3LQZA 3EWCA 3TC9A 2AQWA 4W68A 1H0DB 4U05A 3STLB 3LN9A 3IT8D 3RMEA 3NJGA 1CICD 4XZHA 5IVZA 4JPIB 4HG4K 3PM6A 1BJMA 3WEBA 3PUUA 1ED3A 1KBGL 3PC0A 5TK2A 2EINB 4OCYH 3VGBA 3RY4A 1KCKA 1IBFA 3GLCA 3AS2A 4ISVB 3JWOH 1Q1PA 5CD5D 4AC1X 1EAOA 4TUOA 3R8BB 2FL5B 4GHRA 2HKHL 1RK7A 3HRZB 2O4QA 3WLTA 4YL2A 3V0VB 5C7HA 3FT9A 1SO6A 2V67A 5AHMA 2YD6A 4PJFE 3WCYA 5E2WL 2I7GA 2P8PA 2Y7MA 3LKPA 4XPFL 2WLKA 2XJKA 1J5CA 2ZKXA 2H41A 4UQ2B 3QUKA 3CXDH 5JXED 2LLGA 3F7VB 1DZBA 1FXPA 1YMYA 4JJHA 1R5YA 4J6RH 5E9DA 4NN6B 3KPPB 2XBDA 4HT1L 5BZWB 4LASL 4JQIA 1A1NA 4LK4A 4WQ6A 4KKBD 3S1GA 4W4NA 4YUEL 2FMNA 1T7XA 3UAJC 3LTYA 3JW7A 4OZFB 3RWGA 4O2CB 4L4TA 1A0QL 3QAZB 4GG6A 1XLGA 2CW6A 3KLLA 1VIZA 2YAHA 3WUBA 4QTFA 4XNQA 4YXHL 4R7OA 1JNLL 3NL5A 4G56A 4HZ1A 4JG1H 1CLVA 3EYQD 3Q7JA 1UD4A 4UFKA 3TURA 2EHHA 5J1AA 3KVKA 4EI6B 4P57B 5DJXB 4RW3A 1KM2A 3QUMB 1XDTT 1AFVL 1SW0A 4ZAKA 2Y69B 1WAAE 2NW3B 4NZDA 4Q8UA 3CUZA 1QRNB 1SZFA 1OLZA 1ZHLA 1FDYA 4CGUB 3BAEH 4RESB 1OAXH 1R6VA 2IH1B 2DBJA 1MZHA 5JLZA 5D71L 4AL8C 4C56E 4XBJA 1J6OA 3OKNB 3MUZ1 4E9WA 2EC9T 4OJFL 2CSPA 2QTVA 2YD4A 1CQYA 2J3SA 5HYJA 1KJMA 2ZTBA 5GJTH 43CAA 1Q4WA 2QMKA 1THCA 1SR9A 1N4XH 2AEQH 5GNXA 1UJQA 5AC4A 1ZT1B 1TXKA 5J0BA 2Y7GA 1BBJA 1CDIA 3B2PA 2VD9A 3O0KA 4NYLA 3Q13A 1MELA 3N13A 1OG0A 3WN5C 3GPSA 4NG3A 5SWZA 3OJDB 4HISA 4IMFA 1EPVA 1CD1A 2J5LC 2AKRA 5BVJA 1BYDA 5JW5B 4GUIA 2CLEA 2WTRB 3LQMA 2H5UA 4YDJA 3FCGA 3UJIH 2DLFH 1Q9KA 5IMOB 1QNZL 3BXNB 3OR6B 5I1CL 4JPVL 3C2AL 5J1TC 4PMDA 1C8XA 1JUEA 4MA7L 3MROA 3CO4A 5J89A 2HG0A 4LCWB 3P54A 4K73A 1N9PA 3RDKA 4HQVA 5IDIA 4DGWC 4KRPD 5D2YA 4FX6M 1FV1B 1WFTA 2XM1A 2QXWA 2K78A 1A66A 4U6XA 5IW1A 3MW7A 3HIJA 4E42A 4ZOEA 4LCQA 1A6UH 1NSNL 2I9LB 5C71A 1NGXB 3ZE1E 5CMAA 1JXJA 4Z8FL 2D69A 4DGYH 2AL2B 1AQKL 3F83A 3MBFA 1DSWA 3K46A 5KVDE 1CGWA 2AZUA 3ZRCC 4LKXA 4G80A 3UROR 3ESOA 2QF7A 1DJQA 3O6DA 5DHXB 4EF9A 1KRBC 3CSYA 3DRTA 3BEVA 4WVRA 5TGBA 2I27N 1N55A 4AW4A 2ENQA 3MDUA 4HIEA 1UKPA 1HK6A 3SJVE 4MZ3A 5AKQA 4OLUH 1XGTB 1ETB1 5C0BB 2VITA 4UOQA 3IFPA 2XWJA 3QDMD 2ERJC 1ZP4A 3NAVA 2OMWA 1QAPA 2C3VA 2I9TA 2SODB 4JN1H 3LN3A 1XGRB 4YIQB 3AIEA 5DUML 5IHZB 1J0HA 1DYZA 3HLAB 3FTGA 5CPSA 2XUCA 1UJPA 1F45A 3P9LA 5JIQA 4JN2A 2EH8H 3UWZA 3NIFB 2Z4GA 4O8AA 3PXJA 3L4CA 3LK6A 3D1MC 1G43A 1PLCA 2ENJA 4NQVB 1AQDA 2A3LA 3O4LB 3C2VA 1KTLB 2RCSL 4HXAL 4K55A 3MV8A 4QHUB 5L0QC 3NABL 1AI1H 1ADOA 5AYXA 5AWNH 3FYPA 3NXFA 3CFEA 1GOMA 5CFAA 3O6LL 4PGEB 5I74C 1ZSDA 2GI0A 5IUSA 3MCYA 1J5IA 4LGPB 1CXLA 5IRPA 3JZYA 2GOUA 4WR3A 4A63A 3VDHA 2XFWA 2P42B 3CIQA 4Q6IA 2VDQH 3RFZA 1H60A 1TWSA 3MC5A 3VKCA 1Z5LA 1TX2A 4NQTA 1XGEA 1PY0A 3JV4B 3GKFA 1EDTA 1J9RA 4NZTH 5AW2B 1UKOA 3O3BB 3FTZA 1UJ3C 3UVAA 4GBXB 3OR7A 4JO5A 1OWQA 4BJLA 3EOYG 4DJED 1C08B 1ACXA 4P7OA 5KS9A 1F8TH 1I7RA 3MRHA 2K8QA 4FSAA 2JKSA 5IJKC 4XTRC 1YNTA 1CFNB 1ZLVH 4OGYL 1BGGA 4I77L 3ASWA 1YZZA 3N17A 3AZRA 3UAFA 2P80D 4MXWL 5LNWA 3FT4B 4JY4B 1D7CA 1KEML 5LGZA 2ARJQ 1V05A 2W92A 2Z0BA 5ABAA 2DTML 2HX8A 4JFEB 1OYAA 3G1HA 4TOYH 3ZRFC 2R0KL 5J9PA 2ZJSL 1NGQH 4GVFA 3H2PA 1UR8A 5DCBA 3UBXI 5SWSD 1YYLL 4EKJA 3UDWA 2MNUA 1E5UI 1L2UA 1NOUA 2VDOH 5E1GA 1U4FA 3OKMA 4R4BB 1HW6A 2OT1A 5K4XA 1R87A 2Z93B 1DHKA 2ZSWB 3NFNB 4PRHB 3MOQA 1PTGA 2MKWA 2W59A 5E8EA 4W93A 2Z34A 1JXGA 4PJ7F 5D32A 3DIPA 5H8DA 5HVFB 4DVOA 3MRFB 3MBWB 4Z0SA 3BQUB 4DEWA 4GA8A 4NP7A 3GDTA 4X5LA 3CAWA 4Y88A 3N04A 1O5KA 4UU9B 3LH8A 3WS6A 4RGNC 5D2LF 3EOUA 3KUMA 3Q05A 3ETBJ 3MRPB 2O5ZL 4NS0A 3A67H 5DYOA 4WKHA 3L5IA 5C8BB 1PDZA 5I79A 2FPVA 4AQLA 3RL2B 4AENA 3RGVB 1EUUA 3U9PH 3GG0A 4UNLA 4OZGB 3L9RB 3QIWD 3VI4A 1KJ2L 2J9YA 4LIQE 1ICPA 3GU2A 4GABA 4JRYB 3H7BB 1BX2A 2TSBA 3QUYD 4Y5XB 2PP0A 4BA8A 4MCYB 2JFCA 3FJNA 3EX6A 1CGXA 4UIKL 5ANME 4S1DD 3GNPA 5T91A 4BFIB 3MS8A 1ORSA 3QUZD 5DELA 3LLFA 4LSVH 2BGNE 1LK3L 1DVYA 1YNPA 1WA3A 5DJCB 3HKZA 1P4LA 4AT6A 4B90A 3CQJA 1AG0A 2GJ6E 4DTGH 5JTWA 3VG9C 4RCXA 4FLSA 4ICNA 2VMEA 2J6VA 1E7VA 4MQ7A 3E5PA 3HR5B 1W0MA 3WIHA 3L7EA 3X11A 4JAMA 2F7OA 3KJ4C 3MRRA 2RUSA 1TO5A 2EIJB 1RH8A 5HJ3A 4QG6A 1A5NC 4NIYE 4IGNA 3TSBA 3S6CA 3DXAB 5EKYA 4LE8A 5C0FA 1OP5H 2YBRA 3NO3A 2YJQA 5DVNA 5F96L 4G8IB 3U4FA 1W8EA 4OE7A 2XN9A 1H6TA 2LR4A 1BVKB 2B9AA 2PWVA 1CGYA 4HWBA 4WXYA 5E5RB 1LL7A 4ZQCA 2B16A 3N2TA 4HX1B 4H8HA 3S7GA 2BVOA 2XICA 4A6GA 1K4GA 4D8OA 3TYFB 2NR6D 1G6RH 4HDIA 5D33A 2I07B 1RQ5A 3OBEA 5CEZL 4ZXBC 4AQ1C 1E5CA 3VVWA 5CKSA 2TRHA 5F7NC 2FQDA 2R56L 1LO2L 3SD2A 2YN5A 5KVGH 5A95A 1UUSA 4MASA 1LRQA 2YZ5A 3BDKA 1Z0NA 3SE8L 1R3LA 4OBTA 4WZ9A 1MJ7L 2P5WB 4MY8A 4L1GA 1IC7L 4KX8A 4P05A 3WMSA 4DN3L 5EU6E 5G2IA 3U5YA 3U2SB 4WWKD 3D18B 4HCGA 2J7GA 2XVKA 2REQA 5GS1C 2IKIA 1WEJL 1QI2A 2OMXA 1KCSL 2YOAA 4DP8X 5KJ4A 4YXKH 1YEGL 3T6QC 2ZXCA 2O55A 4HSAC 3DG3A 4LS1A 2ZWNA 1T7LA 4HA3A 5DZVA 1H0DA 4ODSH 4Y19D 3STLA 3WMQA 3QSKB 1XB6A 2X89D 2WLHA 1I2QA 3J27A 4K2SA 5IFJB 4AB4A 2VDMH 4FG2A 2GHZA 4AHQA 1B3JA 3BPNB 3OMAB 1KR0A 3PBMA 4U6YB 3TXVA 3K6FA 4XNZC 5E8NB 2B15A 1JNEA 5D7KD 3M0HA 2QVNA 3EYUL 4AAJA 2VLRD 4W5ZA 1RALA 1GYCA 2FL5A 2DT0A 4U1GB 5I17A 3HRZA 4Z0BH 3TOYA 4YDZA 3MUAA 1D7BA 1VC4A 4OU3A 3V0VA 2Y1YA 4X7DC 3WFAA 1Z9OA 4JFYB 2EACA 4ONFH 4EUPA 3BVJA 3UEQA 3ZT7A 1GVRA 2H26A 4BRVA 4FQIH 1TKKA 1MCWW 4JFDD 1A14L 3AOFA 4AYSA 1KTBA 1GG0A 5AFDA 4YSSA 4DWSD 3IF1A 4N7QA 2VXUH 5ECJE 3KPPA 1HXMA 5BZWA 3T8XA 2WTPA 5FAGA 2GBAA 1Y5VA 3HC3H 4PJ8C 1T7YA 4MMYB 2O6CA 3V95A 5I2UA 1KLUB 4OZFA 3BI9X 4AQOA 5DJYB 4O2CA 1MZYA 5FO8A 4ES8A 4DLMA 4M9PA 3G5ZB 1B3XA 1OP3K 4K3EH 4RRPG 4K2UL 4PWIA 3B2XA 4IKNA 3FA4A 1NCDL 2VXVL 1PKMA 5FO9A 4GQ9H 2PBOA 3VZZA 2QKIB 5H8PA 3K6IA 3B06A 4C4KO 4EI6A 1HILB 3F6JA 5EYWA 5DJXA 1X5IA 3OG6B 2GVLA 4U6VH 5JW4R 1NL0L 4O52A 4P2OC 1I31A 3RL1A 2NW3A 3M64A 1MJUL 2N3JA 1A7BA 1NIEA 4J39A 3GXUB 3QZPA 2HT2D 5A40E 2APSA 1TJ2A 2H2PD 2X6MA 5JMUA 4E2BA 4WSJA 2X2IA 1BREA 2IH1A 1OPGL 3OKNA 2CZDA 1X1ZA 4I3RH 1ACYH 2BNRB 1K8DB 3EOSA 3P02A 4PBDA 5FPIA 4HU4A 4ZTPH 3LIZH 2F1AA 4KW2A 4L05A 3EJRA 1UP3A 4WDTA 4PUKA 2KI6A 1ZT1A 1MW3A 5A6BA 2I7OA 1ISYA 3DIFA 3EB4A 3WL9B 3WNOA 1T4KB 2LW3A 2KERA 4XCFL 1CLYL 3OJDA 5FF3A 1JNDA 3LYEA 2CHDA 3SPHA 3Q45A 2F18A 4AWJC 3QQWA 3QFGA 1Z48A 2E6FA 3MZNA 1S8DB 1H09A 1CU4L 3LVEA 4ORGB 4P07A 2GEEA 3BXNA 2BY2A 3GR7A 5BOPA 2ZCKL 4OTXH 5I3DA 1E5JA 1F41A 4L1SA 1KCBA 2WW8A 3WY3A 4LCWA 4KO7A 1G1OA 3MWCA 4KROB 1BXBA 1E50A 2QW5A 1S2WA 1YECL 4R97B 1XZ0B 1FV1A 1R4XA 2DV6A 4LU0A 4JTFA 2J7LA 4FADA 1G0XA 2I9LA 5T3XD 1NGXA 3BG5A 5CJXC 4P2QD 2DYPB 1LLWA 4GRWF 1Q13A 2AL2A 2MNRA 3O8XB 4MB1A 4JREC 3MKVA 2Y6SC 3QMSA 1RSCA 4XOEA 3NZPA 3I9AA 2XT1B 4JLRB 4NP4L 1R3IH 1PYMA 3HFFA 2P9RA 3V75A 5A3IC 1IZCA 1R3JB 5D9OA 2XU2A 1DVFC 3EBGA 2IADB 2QEJA 4ZMPA 1XGTA 5C0BA 1K9FA 4Q14A 2QDWA 5EC1B 1MXGA 3QUXA 1UWEL 2E6QA 4XIAA 3LCWA 4XZWA 1DLHB 4X4YA 1XGRA 3QIBD 4Y1TA 4A2EA 5IHZA 3HLAA 2V2XA 3BAYA 1MYRA 3W39B 5CJNA 3TZVC 5D7SH 4UB0L 1EJSC 1MVFA 1E6OH 1JGLL 1WJ3A 3WIJA 3HU7A 5CEYB 2O30A 2HTMA 1ZL1A 5I8KH 3QY7A 4WI4A 1UR1A 3S34H 2BVPB 1H3GA 3QZAA 4I8YA 4NQVA 3U7VA 2WQ8A 3O4LA 3U6RB 1YNQA 4TSBH 1KTLA 3RR1A 1RAMA 3UESA 4QHUA 5E1QA 3G5WA 5ADOH 1P6AB 5GGRB 4V1YA 2N59A 4ZO9A 1TQXA 3KS0J 3ECBA 1UOKA 3IDXL 2NYYD 3QG6B 4PGEA 3ZLHA 4TTDC 3SKOB 1NLBH 2YPLB 1ULVA 4RE3A 3CCHA 1ASQA 4H0HB 3QPQC 2LLEA 1ITQA 4JFOA 4IG2B 2E5DA 3ESMA 1H8NA 1DFXA 1TKWB 5A8QA 1HSAA 4MYXA 3RMJA 3N42F 4MNQB 4N8UA 4HIJB 1D5ZB 3OAZH 5HHOD 3O3BA 3US0A 5JOPE 4UTWA 2WM0A 2DWSA 4LSQL 1YNKH 4GO8A 1ZXKA 2R2HB 1C08A 3L0KA 3AZTA 3GFUA 2CBUA 1PIGA 1E4MM 5JDSB 4ORZC 3DG7A 1CFNA 5F7DB 1VYRA 1S2VA 3P30L 1G84A 1GYLA 3L3GB 1CDYA 1QT1A 2DQTH 4LCSA 3B4YA 3FT4A 2OX5A 2XXGA 4Q9QL 3P0VH 5D8JL 5DFWH 5M1TA 4WCYH 3TWYA 3NZ1A 2FYMA 5A6SA 3SPGA 1C7SA 2EG7A 2ZE0A 4XCEB 2HLFD 3MLTA 5DO8A 3O2DH 5D1XC 4OFPA 1NMCB 1FNFA 4XNDA 2Z31C 3LXBA 4XN1A 4R4BA 4OZHE 2NWSA 3TDFA 2Z93A 2ZSWA 4PRHA 3NFNA 3NZGA 3F04A 3CFUA 4NLAA 6PAZA 3GYEA 2PDLA 4DOHB 2OG9A 3MRFA 3KS6A 3MBWA 1TVLA 4M3KB 1N8WA 2XYCA 1BKSA 4P3DB 4PGBA 1GVEA 5I71C 2RB8A 3HEIB 1FYTB 4DEPB 3GQYA 3TJIA 3WNKA 4IBQA 1KFWA 2P53A 3P3BA 5CAKA 4GS7C 3PPFA 1VZWA 3MRPA 1WT5C 2G0WA 4UYPA 1ZTMA 3B8VA 1GAFH 1O0VA 3I6GB 3SCVA 1QHZA 2ENPA 1EJWC 1IZJA 3FDWA 5DMIL 2JELH 4PJHF 5I19L 1EO5A 4ZMXA 4OZGA 3L9RA 3AXHA 4DY1A 2HNEA 4HEPA 1CCZA 5CN1A 4QITA 3SO5A 3ITOA 3F7QA 3W1ZA 5RUBA 3FRUB 4JRYA 3H7BA 5F7AA 3L1EA 5FX3A 4U4IA 5D1QE 3Q1EA 1YO4A 4Y5XA 2XTSA 1J5TA 4MCYA 4G7QB 1MAMH 4BFIA 3IE4A 4L23A 1O68A 2OAAA 4LF1A 1J4EA 2V5SA 1AR2A 2AXJA 2ZAHA 5FEBA 1YEWA 1GQIA 4A2SA 6PCYA 3H7UA 3IVKB 1HG3A 5CBBA 5DUPH 2C34A 2L5HA 5CLZA 5DEGB 2V5JA 3QZNA 3MRCA 3DK0A 3HR5A 4LLDB 1KDJA 3QIUC 1XGYL 2P1FA 1Q6OA 3STEA 2FLIA 4R90L 3FKKA 2NY0D 2VCBA 3O9WD 3QG7L 4GXUM 1WG3A 1N82A 4RAVB 1A0CA 4N6EA 5C9JA 3TFXA 1ZAGA 4I3SH 1T83A 4L9XA 4G8IA 2A4AA 4RPPA 2UZXA 1BVKA 4F8LA 1LEKB 4C57C 3VUPA 3ZDZE 3SQOL 4HX1A 4TQHA 1U30A 2X4PB 4JFFA 4E36A 3MV7E 4GRMA 2EVGA 3ATFA 1QUMA 4BQ3A 3ABGA 2OKMA 3E6EA 3TYFA 3MZ2A 2GSEA 3A4FA 2I07A 5KANI 2X3BA 4X63A 4JHZA 1MFCL 3QI9D 4R5XA 3CUGA 1COBA 5G2WA 1LO4H 2XVNA 4DJFC 1ZBKA 3D87B 4NKOB 2XPZA 1IGIL 2XZZA 1TTQA 4APQD 1RUML 3UJJH 4ELME 3NJVA 1W3JA 4WRLA 5DGQA 5L9DL 4DB7A 2P5WA 3MYPA 2XG4A 2QPDB 5ESAB 3TN0D 2YRPA 1ZAJA 1YEFL 5HI3D 3U2SA 1OGAD 4N9EA 4Y96A 3ZSSA 1AE6L 4M7ZC 5JIDA 4P5TD 3ARDD 3RY6A 5E6IA 4YGVB 3MRDB 4D9RE 1NEPA 2QSCH 3GFXA 1HHGA 3R4DA 4WI7A 1BZQK 1ACCA 1NCBH 5J56B 5FEPA 5SX5H 3QRBA 5IFJA 5C1MB 3DROB 1I2PA 4X7SL 3LKQB 5AVWB 4U6YA 2VFIA 2OELA 5E8NA 3WMCA 3IUDA 3W2KA 4G6KL 4O02B 4X22A 1Z44A 2Y72A 1VEOA 2XM2A 2VTFA 4HGKC 5TNVA 3ITGA 1CZ1A 3RGBA 3W0WD 2ZZ7A 1G7HA 3SO3C 1PSKH 4EJ1C 4B9ZA 3TROA 4JFYA 3M9YA 2CK0H 4LARH 4PS4L 5F7FA 4KAQH 3LEYL 4A8LA 3F7YB 1KB5H 4FGMA 1G7JA 4C5YA 4R96A 4I0CC 5DD3L 2QQLH 5DT1H 4KK5C 3NTYA 3HS8A 2BZ7A 3BVNB 2ZXWB 5GZOD 2OQJB 5CPNA 3RB5A 3BPOB 2ESVE 1S7QA 3U0HA 4KQNA 4HC1A 1G9NH 4LRIA 1K8XA 1M6OB 1SY6L 3QSRA 5DJYA 4JIRA 4N26A 4DQOL 1S4IA 5IJDC 1NCAH 1NFDB 2Y0SA 1TV7A 1TJHL 1MEXH 1XB8A 1K8YA 2C18A 4DJDA 3CFCL 2XG5B 2QKIA 5AC6A 4PMZA 5I18L 4LNVA 3IDIB 1LO5B 4NM4H 5LQBH 2ZOLA 2EKCA 3PG9A 1HILA 4UV7H 4LKCB 3QFJE 3UG8A 1RJQA 5J04A 4LB4A 5C08D 1F6PA 3STGA 4QBXA 3RZCC 4FYQA 1FTXA 1LK2B 3UA4A 2V5BA 1GONA 5DRNB 4FQ2H 9CGTA 2ABAA 5F7HA 4HP5A 1E65A 4ZXOA 1MI5E 2FECI 4JDEA 3KZPA 3SIZA 5CHNA 4O9HH 6TIMA 4H3DA 2G5UA 2X09A 4ZMOA 4IRJB 2D31B 1W3TA 2BNRA 1Q1JL 2X8RA 2EDNA 2FEDC 3VMNA 1KFBA 5FJIA 3H4WA 1XLMA 1J96A 2WVSA 1BM7A 4ONGL 4MA1B 2E47A 3FGCA 2WQDA 1T4KA 3TEWA 4OHQA 4NNBA 4KX7A 3TJLA 3TVMB 4JOMA 4G6AD 3LQLA 4TSCH 5IESL 3UYIA 1J5HA 3W7IA 1WA0X 4PREA 1S8DA 3DGDA 2VUYA 3LMYA 2V5RA 4ORGA 1HHHB 1HSBB 5DU7A 2K6WA 4LC8A 1URIA 4DHLA 5I77A 1EHLL 4LOCA 2ZAGA 2NSOA 1OB0A 3M1ZA 5I75B 4PRPD 3GHBH 1XZ0A 5I03A 4F24A 4Q8VA 2F74B 3PTQA 4XMWA 1JPFA 4X6FB 1DQJB 3T09A 4HJSA 4QG9A 4CC0A 3WAJA 2K0RA 2VOMA 1HGWA 1E51A 2OKTA 3DDFA 5FD0A 1WHPA 4JXCA 4PULA 3Q6GH 3WQFA 1XBYA 1MUCA 5HD8D 4OCSH 2OXGB 3ZWTA 4JLRA 3B7SA 3TC7A 4XB7A 2IKJA 3EYSH 1EXHA 4Q4RA 5D1ZI 1B57A 3EKLA 3UZQB 1XGUA 2EDRA 1L8NA 1R3JA 5IMLB 1VFBB 4OIFA 1EEXA 4N5ED 1EBHA 2GTQA 3DFSA 3N6HA 3BMXA 4F7TB 1KTRL 2HKFL 5IB5A 4DP2X 2R0ZH 3WHE0 2WSQA 2ZUVA 1JPGB 5ILTL 5IFPA 2IANE 5JR1L 3WTTA 3NEXA 2ADGA 3W39A 3TYCA 4PJ5B 1A6AB 1QYGL 3EJUA 1EJUC 3SQBA 5CU5A 1QBML 3SHSA 3N9GL 1ZHKB 2YKLH 5CEYA 3DYPA 4Y1AD 3UXIA 1T5KA 1MSPA 1AGFB 2BVPA 3TASA 1TOXA 5LCVL 1TWDA 3U6RA 1TR1A 1VCBC 2R4RL 4OIIH 1H49A 1SSGA 4W6XB 4FA3A 1UZ4A 3LCGA 4AH2B 3ORJA 5EMLA 4UTBH 1LDSA 3BJLA 2JKLA 2IQAB 1Z5YD 3ALWA 3QG6A 4M81A 4TNGA 1S9WB 3LNEA 2C4FU 3SKOA 1EEUA 2YPLA 1DEDA 3M8OH 3FN0L 4IPNB 1S3KL 3D30A 4YHYC 3HC0B 4AEHH 1AO7A 2OZTA 3E3QC 3MRMB 1UB5B 4BFRA 4MFHA 1KOAA 1TKWA 2BH0A 1HIML 3B5TA 5DEZA 1H3PH 4XOBA 4HIJA 1D5ZA 2JEPA 4IRSD 1NSJA 2G2RB 2NSMA 2R2HA 4REQB 1GTHA 3GMQB 2W9DL 3KP1A 4KZDL 2Z26A 2A2IA 1U4EA 3M7FB 1TETH 5F7DA 4N4PA 3O3DA 4I18C 3BKJH 1IGTA 5LO7A 4MDIB 5HJYA 1L9QA 4LEQA 1U6AL 1V4YA 4LLVB 4ODTL 4K8GA 3KZ8A 3I9GL 4P5RA 1MFEH 5BUGA 3HMCA 4QRBA 5KSAD 4PCFA 2CNYA 1U8JB 3MRLB 3DC8A 1IYXA 1PFOA 2BZDA 3CIXA 2G60L 1NCWL 1UM5L 2WKOA 3LRKA 4JICA 1YPZF 4XCEA 1LEGB 4ZENA 1V6TA 1L3WA 2WNXA 3T0TA 3W2NA 3BGFB 2CMRL 2YUXA 1V3HA 5K69A 2P45B 3S1WA 4W9FC 1RA5A 2YUZA 2VMJA 1WUEA 2ZRUA 5CIPH 5EA9A 3CPRA 1JJUA 3OAUL 3KBFA 3HHMA 2P47B 5CJOL 1T3FB 3G1XA 4QXTB 1MDTA 1BQ5A 4M6QA 3CHPA 4QAIA 3SKMB 2C3HA 3MQIA 1XFBA 4P3DA 4X6CB 1QBLH 4QOKE 4O4YL 1F3EA 3EKZA 3T3PB 2KZ1B 2QVTA 2R8SL 2HP4A 2Z4TA 5IGXH 2EDLA 2V37A 3WKYA 3P60A 2LTQB 4X99B 4GJIA 2EDEA 1IM3D 3LNHA 2DS4A 5D93C 4EPDC 4JM2F 4UI2A 1ZCOA 1J12A 1R33A 2Q3AA 1U3YA 2G4GA 3CASA 3I6GA 3WFBL 1XEDA 2CWXA 3CSGA 3SDCC 3U25A 3JS3A 2W0UA 4D9QD 2QCEA 1JFXA 2E6AA 2ZA1A 1LP9A 3FRUA 4X7CC 5T1DH 4OCXH 4YYFA 1RURH 4KKLC 2N01B 4L29B 2BS8A 1FH8A 3USZA 2Z8VC 3DJSA 1ZGLM 3AWGA 3QWQB 1YUKB 3V55A 3G5YB 3OVGA 1UA6L 1J8HB 4LP4A 4AD1A 3TQVA 3W7QA 2RJGA 2VCCA 3HNSL 4P49A 4DEFA 4DPRA 4UTIA 2Q02A 2X4TB 5DEGA 1KB9J 3ZM8A 1GPWA 3P93A 1N7KA 4N3UA 4KKZA 4HIBA 4LLDA 3HBGA 1XAUA 4TLSA 1TCMA 5EEZA 2WJEA 3QWRD 3MANA 4ATLA 2QPXA 3H2FA 3B43A 3X14B 1CYGA 2HX7A 3LIUA 4MOZA 3SOBL 4RAVA 1FSKC 3B03A 1UR9A 4G71B 2V9RA 3JZUA 1FHUA 1GMEA 5A69A 3ETSA 1H4PA 5A2AA 4F37K 1BG9A 1W3HA 4FXGB 3VDBA 2ISFA 2FATL 2FLMA 1QTSA 2WZEA 5HQEA 2X4PA 1OFDA 4IW4C 2Z0UA 5DD0H 2YXXA 3CDCA 2HT3D 1B2YA 4W9DC 3BK0A 4OI7A 3VNKA 5F9DC 3EFOB 2UZIH 2YD7A 3WFCH 3AMDA 3K6SB 1NDZA 5E2TL 1KYAA 4K7YA 1JRBA 1K9TA 2UWEB 3EOTH 3ZDXB 5L4MA 5HYEA 5DR5H 3D3FA 1JWUA 5IG7B 4NKOA 4UV4H 3ARBA 5FF6B 4HYTB 2W0PA 5JA9A 1UR0A 3H0TB 3V4VB 4J3SA 3V52H 3S3JA 4DNLA 4X0KB 3OKYA 3BJ91 1IGFL 5ESAA 1AR1D 4KIEA 5LA1A 3QHNA 4XMLH 2YWYA 4J3UA 3R12A 1JPKA 4KBPA 3OMZA 1X5AA 1DBBL 4I0PD 2HV5A 4AQAB 1TIMA 1S7UB 3OAWA 4NLHA 3UQNA 3XINA 5XIMA 4MXQD 3CFBB 2YD3A 4U1LB 3MRDA 5ESVB 5HNNA 5EUOF 1TQWA 4H6EA 2OJZH 1J0YA 4DVBB 3C60C 4I9AA 3F7RA 3FHEA 3SSGA 1UWAA 3DBSA 1FE8H 4XP1L 2F53B 3K71A 3WE6A 1KWGA 8A3HA 4NI8A 1B31A 1J88A 3L1GA 2E5EA 1FDJA 1A4MA 2V30A 4O02A 2QT3A 3DHMA 3G0UA 2VLJB 3W1XA 4YWSA 3QEQD 3O6KL 1UOWA 4R7NA 1B0GB 1WFNA 3AGVA 1OTTD 5FB8B 1BFVH 5J6SA 3D39E 1T1WB 1KCUL 4YHGA 2V5MA 3MRBA 3F7YA 3KDNA 3I84A 1L4IA 3GVQA 1SPQA 5HVWA 2XC8A 3KWWB 1W9DM 4EPKA 4JM2C 3BVNA 3CIAA 4FQCH 2VRKA 4HCRH 2PMQA 2CPUA 5I6PA 1GSMA 3N1AA 4US5A 1L9MA 2H7WA 4A2GA 1AYOA 4M1DH 4WAFA 4KPLA 1UGKA 1M6OA 1MRFH 2NWRA 2J72A 3FMGH 2VUNA 1WRFA 4BKLA 4GVGA 3O2LA 4HCHA 4RDVA 3KBMA 1NFDA 1ZTXH 2QCHA 1UWXK 1T1XB 2Q8AL 2WXLA 4PGDB 4AL8H 4NX0A 3HOJA 1OCCB 3IIZA 5BS0D 4O13A 1IFGA 2ZYRA 3FFCE 3KCWA 4IP5A 3DV4A 1VIWA 3IDIA 1LO5A 1KQZA 4GACA 3EXJA 1FCGA 1MFDL 3P84A 4V2BA 4QQ3A 4L4VE 1BQUA 1CL7I 1N70A 1LK2A 1NICA 3CX5K 2LFGA 4E9RA 3ZFHA 5DLMH 4Y5VB 3QO1A 5DRNA 1FNAA 2G2NA 2H3DA 3MA7A 2WZ5A 4NUWA 3BDYL 1E7UA 1UWGH 5DMNA 1VEPA 5CJQL 3WHE1 5CCKH 3T0EC 4IRJA 4DF9A 3L3IB 2D31A 4FABH 1MRDL 5DS1A 4XPTL 2Z27A 1H7WA 3GK8L 3KPSD 2Y07H 2XSAA 3SD5A 3O41B 1JNHB 4J4PA 1GW6A 4MJIB 1BW8A 1B4JH 3IJSB 1K5WA 4UAHA 4LCIL 12E8L 4G6FD 4Q8BA 3D85A 4AIOA 1XIGA 5HPOA 1H7NA 1JZ4A 1W5OA 3FBKA 3TVMA 4XC1H 4GH3A 1DFBH 1UWRA 2A7NA 4XE5B 3LHTA 4C6MA 5JXQA 2Y7DA 2YKKA 1UM4L 4ZK8A 3A4JA 3L7RA 2O5YH 1IL1B 4UUJB 3QHTC 3TBCA 1HSBA 2XH0A 2FQEA 1SLUA 3LD8B 1VGEL 2CHNA 4X2PA 1WVZA 5CU9A 1TZ8A 4LSTH 2VN3A 4KH2A 5C9RA 4BHUI 3BAJA 1XX9C 1WS8A 5CF3A 1YEJH 4C54A 3GZPA 1XAKA 4X6FA 1MW1A 1DQJA 4QXWA 3WD4A 2X2HA 3BXWA 1G4TA 2NY1C 4J23A 4U5IA 1Z2KA 2PF0A 3SCOA 1MCJA 4PJCB 1CNVA 1AKJB 3VXSE 2OODA 1IIHA 3EZ8A 2GWGA 4GQRA 4Z7NB 3ZE0F 4WKZB 3DMMB 4BZ2H 3BAIA 4LFHG 5EV7A 4XOCA 3L3OC 1JR1A 2IIJA 5JYLA 2N0KA 1FFOB 3MBXL 1FDZA 4F15B 3PZ9A 3AZUA 3UZQA 1LMKA 1JIBA 5IMLA 1NCNA 2HWZH 1RFDH 5KOMC 3ARPA 2B14A 1FCUA 4F7TA 2WKGA 1BZDA 1IT9L 4XAWH 4OZ4B 3HFML 4S0SD 3GNNA 1T22A 5IBXC 4S3EA 3GI8L 1JPGA 3HNVH 1ZPUA 4KI1A 5CR1A 1B9BA 3C5ZC 3RCYA 2AMGA 4ZMAT 1ZJHA 4PPTA 1M04A 1R24A 1T0PB 3M41A 4WJ5B 4PWKA 5D7IE 4BFFA 1ZWIB 2CIPA 2ITEA 3N9SA 3HQNA 1ETZB 4KZEL 3HUJE 1P2CB 5IB1A 2J7DA 3MCG1 3GWJA 1AGFA 2O6FA 1EXPA 5K7JA 3S36H 3VZYA 3WFEH 4JFHD 4DW2L 1NCCH 5F44A 4QFUA 4Z3GA 3WCZA 4BQ5A 4K0OA 4F92B 4NRXB 3U36B 1TZIA 5HDBB 4UMBA 4MAZA 4QJ3B 5G4HC 2HVJB 1JPHA 5DEFB 5HQLA 4AMKH 2PTYA 2IQAA 3WLRA 1WDRA 1S9WA 4Z7UF 3G6JF 5DEJA 4NAEB 3FONB 3HC0A 3BLFA 5AVVB 1MH5B 1B4EA 4X98B 3BC9A 4HV8B 3MRMA 1UB5A 2ZTJA 5CGYC 1MOEA 3DYOA 2FDMA 4Z78B 4BZ1H 1S9XB 5E1HB 3KLAB 3ILQC 1JGVH 3L4ZA 5FYJL 2G2RA 4Z7QF 3FOLA 4REQA 3EDEA 5D03A 4LV9A 1YMHB 1MQPA 2C9UA 1TVNA 3BHBB 3VGAC 4TKWA 4GD0A 3BAWA 2F7PA 4MJ6B 2NY2B 2AEOA 4AKQA 2ZBTA 4HJWA 2NW2A 2HWGA 4Z1DA 2APFA 1YW1A 2QVFB 1OF6A 3G6LA 3DI3B 5DQ9A 4HS8H 1I9CB 2R69A 4MDIA 3HA1A 2A99A 4OF7A 1RP8A 4WWOA 2ETWA 2FYYB 3T1GA 4LLVA 3TEXA 5K39A 4BQ6A 5EZIL 2XV2A 3IBEA 5FDWB 4N1CA 3NN8B 2OSYA 2HVMA 4W70A 4W4OA 1YA5A 1DSYA 3O05A 3WMLA 2MOQA 4FI8A 1A64A 2RKXA 4JBSA 1SMDA 3O9NA 1LEGA 5JUVA 2VD8A 5I1AB 2N1KA 1HP4A 3WQWA 1V3LA 4PJGA 3ITVA 3ZTNL 3BIKB 1OIMA 4U3XA 1H7RA 1BEYL 5JMOC 3SSZA 3VTTA 1M3IA 1CR9L 3LQAL 3B83A 2QR0B 3MSYA 1JI1A 5C70A 3DFHA 5IWLC 3ONCA 3KGUA 5AW3B 3UF9A 4QXTA 1W9BM 3WH7A 3HIZA 4EI5B 2OL3L 1FNGB 4YHOL 4X6CA 5FYLE 2DVTA 3KGSA 1GOWA 4AIUA 3P4MB 3HR6A 1X97A 3TT1L 1XPYA 2P88A 3HQOA 4MLSA 4IS6B 4LANA 3U9IA 4XKYB 5T3XH 4MHHG 4MWAB 2CJUL 5KVEH 1LO0L 1P4BL 3VXRA 2RTTA 4RMQA 2Q8XA 2AANA 1OSYA 3W7GA 3FYEB 3BKYH 4JO1H 2IS7A 4R7JA 1T5WB 5FHAL 3OOQA 2Y1AA 4PLJC 1GOOA 3IGUA 3UBGA 2HCZX 3NOEA 3CLEH 3L21A 5DBUA 2VXSL 4U31A 1UXWB 4L29A 2HFFB 3NYDA 4E8CA 3G5YA 4MJZA 3ZXAC 4JRXB 1J8HA 2P5PA 4HSCX 3C6EA 4YFLI 4BFGA 5AKSA 1J9CT 3BJTA 2WLIB 2MQGA 1DQUA 5LDSA 1WWAX 2X4TA 4P8UA 1UD8A 4BFBD 5KYXB 2ZWKA 3LN5B 2ZG3A 5DD1H 3S2JA 4Q4OA 2VQ1A 5F1IB 3NACL 3ZIZA 4G9FE 3QDJD 5FYKU 4X50A 5B7FA 4OFYD 2ZZ6A 4PLKD 2H6UA 2R1MA 4LVHC 3X14A 1U93B 3RVUC 4PRTA 4AVJA 3VIGA 1XLLA 2VSDA 2Y7QA 4H8PA 2ZE3A 1W6WA 1V79A 3P40A 2ZUQC 5I30L 2UVFA 2M83A 1VFFA 4M6MH 4FXGA 3VG0H 1AXIB 2PDIA 4C7FA 3LNFA 2P5EE 4JPIA 1AXTH 5EOCJ 4WLCA 2LE9A 2DW5A 1EZVY 3WG6A 2BRRL 3W5MA 4FP1A 1YMMB 4NO0D 2W6RA 1EHXA 1IBBA 3RIFF 2VR8A 3EFOA 4QNPF 4ISVA 3FCBA 2V5LA 2HYMA 2NSQA 4KK9C 5DXXA 4F2UA 2E74C 2FIRT 1RI8A 4ZMYA 1A8ZA 2P8CA 5F7UA 4PJIB 1SO5A 1MW2A 4HPHA 1GOIA 5EL1A 1W1A1 2FBJH 1M7DB 1BQRA 2HJLB 5IG7A 1DPMA 3PAOA 1I85A 4YVXA 5AYUL 3PS6A 4L8SB 1OBAA 1CDUA 2EDTA 4X9SA 4UQ2A 4KKXA 1BBDH 4J3BA 3V4VA 3I6LD 3F7VA 1MIEH 4X0KA 1C5CL 4BWLC 2ZRZA 2CCWA 3MNDA 3P81A 8XIAA 3EDKA 3W7DA 1CD8A 3NJHA 4AQAA 4JZNB 4P2RD 4QR6A 3CFBA 3FOMB 4LB3A 1QFWI 3CL6A 2ZX9A 5JUEH 4XTRD 4DVBA 1XIMA 4AZUA 3EGSB 3AWNA 2QL1A 5HI5D 3FQ1A 4L1LA 1H8OA 3GNOA 1YE6A 2F53A 5GJSL 3N1PC 5HDQH 3V6OC 3IFLL 2H47C 2KZKA 4P57A 5C0JB 2ORBL 2E68A 4EZKA 3QUMA 5DCEA 2Y62A 3MSPA 5CZVL 2YD5A 3CFQA 3T55A 4AD2A 1SHWA 4GIEA 1AY1L 3W00A 1B0GA 4F66A 5A2IH 5CP3A 4JS3A 2F54B 2OK0H 3D07A 1QRNA 3T4CA 5JYMA 5FB8A 3UO1L 2R8WA 2Y9RT 2HE5A 1P1ZB 4Q8NA 2H0JA 5F4SA 2X9YA 1P1VA 2BIQA 1XEUA 1XIIA 3VXUE 1ME8A 4KI5F 1T1WA 2DBLH 1E40A 5K4ZA 1QK2A 1SYVB 3EOLA 3NVDA 1GZGA 3WLIA 3GZOA 4GIRA 2ZUTA 3EOEA 3IV3A 4XPHH 3QRGL 4QRQB 4H01A 3LEXB 2YD1A 3RA7H 1EEZB 4RZ4A 2ZKHH 1KFLA 1DANU 1EIBA 2HJFB 3B4NA 4NUGH 3OZPA 1MFBH 2RD0A 1V0KA 1XYFA 5AQ0A 4Z18A 1C91A 3BLBA 5LGXA 3I6EA 1G9ML 5TE7L 3NL3A 1T1XA 4GKNB 1VADB 1MWAB 2VYRE 5JW5A 5A2FA 2WTRA 4JQVC 4HJGB 4XO5A 4E9LA 1E4LA 3Q01A 4QRPD 4QHMB 3LHUA 3OVRA 5IMOA 4Y9AA 1GOHA 4QRRD 4IJRA 3OR6A 1JXKA 5DO2C 4ML9A 2F9BT 3W4RA 1P53A 3ERXA 1TJGH 3G04B 4NKDB 3GBMH 4NQDB 4MJ2A 3GE7A 1ONWA 1GRWA 1W8NA 1ZP3A 1CXEA 1OLLA 2IGFH 4OI8A 3KP0A 1XF3B 4G6ML 3EMQA 4Y5VA 5BOZG 1EP3A 1JPSH 1XQ4A 2VE6B 1SEQL 4RDWA 3B9VA 6A3HA 1EGJH 1VKFA 4KWWA 1A4JB 4XIMA 3BMWA 3OYXA 3ATDA 1MPAL 3L3IA 3CFTA 5T5NG 2NXYB 4UTMA 2EPKX 1JNHA 2XKUA 4NT6B 1KXQA 3HBZA 2IQDA 3IJSA 4ILSA 2GIMA 3RG1C 3R13A 4HHPA 4JFTA 1PLGH 2AK4B 2WXPA 8RUCA 2BX7A 3BQ5A 5B8CB 5FA5A 1FHNA 2WQWA 2BIPA 2HFGL 2AEIT 3VOCA 1DQKA 4JUTA 3GB6A 4TR9A 1DQXA 3S46A 2A7PA 5CUSL 4PODA 4HHGA 4YIQA 3ZUNC 1K72A 2J6EA 3UWVA 4G3YH 1IL1A 1RK0B 4UUJA 1F3TA 2B1AL 1OTSC 4CN4A 2WCPA 3ZHFA 3TE9A 1XFCA 4ZXBD 1GJPA 4A21A 2XQYG 4L1XA 3NUKA 1R9YA 5E8DH 2YK1H 1ZT7B 1CFQB 4CD4A 1LEIB 3V0JA 4I9TA 5TE6H 3TTOA 1F8MA 5LHEA 5FO7B 3QQ4B 2W94A 3SZ6A 2CO1A 3BDBA 4GNKB 3L48A 3NRQA 4PJBF 4WKZA 3DMMA 3L2LA 2PDFA 3HBLA 4UIOA 4Q0XH 4Y16D 4TVSa 1WISA 1A4LA 3V1HA 1AZ2A 2PDYA 4K9EH 4XT1C 4CDGC 3IGAB 3BWSA 1XR8B 4M1GL 1FBAA 3JV4A 3CNYA 5C0ND 2IFFL 4KFMA 5L2KE 4JFQB 4GBXA 3KPRD 1ZJBA 4OZ4A 3UJSA 2WQRA 3S9DB 4UT9H 3IJYB 3C2FA 1ET7A 2QADC 3MJ9H 1H5YA 4WJ5A 4KI5C 2KYIA 3ES7A 4WHTB 1ZWIA 3ZUCA 1JL8A 2MANA 3VRJB 3ALPA 1LLOA 2YRLA 3B0UX 4C6QA 4GIAA 4ZFQA 3VRLE 2FB4L 4A3YA 1KIPB 3CPGA 4GVHA 3S88L 4O18A 4MPKA 4JY4A 4F3HA 5ALBL 4JFEA 2C6QA 3NVTA 4XZIA 1W72B 5KVDL 1F76A 3S37H 3CFJB 4NRXA 3U36A 4NZFA 5A2KH 2HVJA 1F1AA 5F7EH 3PL6C 2XZCL 1Z42A 5I6OA 2FQFA 4NAEA 4HIIB 2IBZX 3PE9A 4GC3A 1GQNA 1MH5A 1J5OH 4PJ8D 2PDCA 4HV8A 3B8IA 3OF6D 1MG3C 2OOGA 3EAKA 1DLFH 1EUAA 1KM5A 4C91A 2HH0H 4MS6A 4JTUA 2NY6B 4Z78A 3BQUA 1CLZH 4NM8L 1S9XA 3KLAA 2YPVL 3WJZA 4PJDB 1U22A 1XRVA 4K9JA 4WY0F 1W5QA 3WU1A 4UU9A 1A65A 1YMHA 4IGBC 3L16A 3TA3C 2JQAA 4NRZB 3SEPA 4P8VA 3PJNA 4LF3B 5HBFA 1RAKA 4MJ6A 4DAIA 4AGNA 1IVLA 2B0SL 3SYQA 5BV7H 2MIZA 3HF3A 3C5QA 3VA6A 4P2OD 3SFWA 2IAMB 4DO4A 4QRFA 2FYYA 1G0CA 1BFNA 2WP3T 3RL2A 2Q3RA 4XVUC 1WB0A 3RGVA 3CHEA 4PJXE 3QV9A 3N6QA 5FDWA 1FDLL 3NN8A 3BO9A 4JS7A 5FIPA 1A5BA 1H1ZA 2ZCHL 3PDOB 2FD6L 4NQEB 2VN7A 1E9ZB 1V3IA 3KW7A 4QTHB 4IQEA 1E3ZA 5I1AA 4DZAA 1E9QB 5DJCA 4GRWH 3BIKA 2AJXH 3LQAC 2QR0A 2CLRB 1X96A 4PUDA 2A0LC 3ABLB 2CLVB 5A6MA 1KBJA 1AD9B 2QHRL 1BF2A 2X0SA 4LDOB 3WLQA 4ZPVB 2Z25A 2C1HA 4A37A 4L1WA 5AHLA 1XO8A 4IPPA 5F7MC 2DP3A 4JTSA 4WFGE 4JDZB 2ICWJ 3DXAA 4IS6A 3A3HA 3KDOA 4E41B 2XZAL 2AITA 5JHBA 4MWAA 5TIMA 4H8UA 4O54A 4LAKA 1UB6B 4C6EA 1ZE3H 2FH8A 5I9QB 4OFCA 5AW4B 2GG1A 5BU6A 2PRLA 1JVKA 3MXVH 3U7WH 3F7LA 5FUCE 3T6XA 1UP2A 3NDZA 3ZW3A 5F9WB 4CSZA 3S8WA 4LCVA 3IGLA 1NGWB 2OCCB 3ZQXA 1XSOA 1TVHB 4KWOA 2H3XC 1KENH 3GTXA 3WGVB 1UXWA 2HUEA 5I1IL 2HFFA 4AJYV 4JRXA 1DVUA 6XIAA 5C0QA 1CLOH 2NX5D 5A3ID 2A73B 3MN8A 2AABH 5FJTA 1XLFA 3D06A 3R1ZA 3NL6A 5KYXA 3RG6A 2Y1ZA 2G75B 1I8LC 5F1IA 3DYMA 4AYDC 3D18A 4LHUG 4KKNA 2FX9H 4XK2A 4P23C 3NURA 3HE6C 3CX2A 4JG5A 5BWFA 3STZB 2HSAA 3TZVD 2VR3A 4IMKC 4NCDA 1SF3A 5BO0D 2PPGA 3THQA 4XWOC 1ZY9A 3VMPA 5JZ7C 4ERSH 3W9DB 4ZO7A 4HGWB 2JLPA 2ZRWA 3MQTA 1NBYB 1DXEA 4OJYA 3CFNA 3EA3A 1M7IB 2BLEA 1ZXQA 5I6KA 2F1EA 1YMMA 4WFHE 5I0ZA 1KYOK 2J25A 5J8LA 4LIQL 3SBRA 2BNJA 3WTXA 2W9MA 4K8EA 2QCFA 1QEWB 1RJYB 3PWPD 1RUAH 1JVLA 2HRPL 5AW0B 4L4MA 4BA0A 4PJIA 5IEHB 3AHXA 2AKMA 4TTDD 2AHIA 3I2CH 2HJLA 3VRIB 1D9KB 4LVBA 4YWIA 2OPCA 2GTWB 3ESNA 4L8SA 1CI1A 4B0MM 5TPWH 2WBKA 2WBXA 1HL8A 3NIDE 2I16A 4F0HA 2XNAB 2WSDA 1PZ1A 1FH7A 3O16A 2DPEA 4YDVB 3GBNH 4HSHA 3I02B 1DVXA 3WFDH 3QWOB 4DZBB 5KSVB 3VNYA 4JZNA 3PG2A 4LQ1A 4MMYA 5HNRA 3FOMA 2VR9A 4GQPH 1KLUA 2EPNA 2WHLA 2EUWA 4YU1A 1QNIA 3WQ5A 2XWBB 3JTTB 3EGSA 4IIBA 4PRWA 3G5ZA 2J8UE 3GHEL 3HI5H 3SCMB 4BUQA 3KDMB 4WHYH 3NJXA 3V5CA 3N85H 1NWSA 3TNNB 1TMCB 3DWTA 2F58H 2ED9A 1A1MB 3NZQA 4WWID 3GJFB 4FDWA 4PGCB 4Y4HB 5E5MB 4UNVA 2DZAA 5KZDA 4R0LC 1NLDH 1USQA 3C9NB 4RV3A 2VZ3A 3VKJA 3GRIA 2PB1A 3M0VA 4Q33A 4YSDA 3VXPB 1HHIB 1P1ZA 4MPQA 2CLPA 4ZUUB 1F13A 5I1HL 1VHNA 3LY6A 1VR6A 4HUKB 2Q7AA 5HWNA 2O92A 3UGEA 5HGDB 1I6NA 2J4WL 1K8DA 4N90E 5DZAA 4LS2A 3RVXC 3T78A 3ZE1F 2N0MA 1C5BL 1EBGA 1KC7A 4LLAA 1TZ7A 3TJ4A 3UXAA 4AEIL 2VN4A 2HJFA 1NCIA 1E6JL 2DH2A 4M6UA 4NI3A 4JN8A 1KIQB 3WL9A 1W8SA 5FEXA 1F11B 4OV9A 2JLLA 5I5IA 1CXHA 3HQ1A 1G9MC 1GR7A 4OLVH 3N11A 1VADA 1MWAA 1MQKL 4NBXB 4DKAA 8TIMA 5D7JC 4HJGA 2DLTA 4QHMA 3C2YA 4L2YA 4R7LA 1EVTC 1YAZA 4FP8H 3RAOA 5IQNA 1LXMA 5IKCB 5CG0A 4AHPA 3B9NA 4NQDA 4ECNA 3CZKA 3P6LA 3SY0B 4AH7A 3E38A 3TNBA 3QE5A 5HMEA 2D2OA 2EVHA 1XF3A 1FG2B 5AW1B 4DIXA 2VE6A 4N20A 1U1UA 1KGIA 2DYPA 3N3MA 2QQKH 3UJEA 3O8XA 4K7PL 1EF3A 3QOMA 3CUJA 3NH7L 3CLMA 2HT4C 1OCZB 1A4JA 4MAYB 3TTYA 1EH9A 5J7CC 4PMOA 2EZ0C 1F6AB 3QIUD 3PBUA 2XTJE 2WKLA 1EP2A 1GGCL 4NT6A 1Q0XH 4FAAB 3S0CA 5DMKB 4DNHA 3RFRA 4DAGH 1U36A 3EFFB 1XL4A 5B8CA 1FWFC 3II2A 3VSUA 1RSYA 2IADA 4UTAA 3R0NA 1E6ZA 4L5ZA 1F1DA 5EC1A 3TWBA 1H41A 1FWXA 4HG4J 5DJ8B 1DBKH 4F8NA 3MR9B 1DLHA 1EC7A 1ZEAH 4HK7A 1OB1B 2V9TA 3E0WA 1UPMB 4UNKA 3MP3A 4EIZC 3HV9A 5MF5A 4LAUA 1RK0A 1REIA 1VJSA 4JO3L 4OD3L 3FCTB 4IQLA 4N2OA 1WZKA 4DJFD 3L68A 1ZT7A 3M5XA 5HI4D 2YW3A 1LEIA 1JE6A 1LQ2A 5AVXB 3KLSA 3V36A 2FLBT 3MU7A 5FO7A 4BIKA 3QQ4A 1KFAL 5GGRA 5LVEA 5MEPB 3QHFL 1C1EH 3MJ7B 4MD4B 4HCLA 4M7KH 1AZNA 1SW7A 3GFYA 4HKXB 5E8PB 4XXDB 4H7ZA 1GKOA 2VDKL 3OW1A 1LRTA 4FI7A 5GGSY 4LT7A 3CK0L 1PKQE 4HMDA 4XBEH 4ORIA 2FTPA 4ACYA 4IG2A 3VVGA 2JGYA 2HSIA 3RTLA 3FN9A 3IGAA 3QKEA 1XR8A 3NA4A 5IM7B 4MNQA 2HXAA 3NZRA 2IDFA 1ZLUH 4BZYA 3EB2A 2GSJA 3CH1B 2N4IA 1B0IA 4RRPM 4IMGA 2F6UA 4Q52A 3AB0C 2DJXA 4N8VG 3Q1SL 1XIWB 5D1ZD 4IOSA 1PZ5B 1DQDH 5GRJH 1VENA 4TMPA 5JDSA 3OLGA 2WZIA 5DMMA 3DTDA 3DBNA 3TJHC 5FXCH 4WHTA 1ZANH 1EBPA 3L3GA 1FXQA 2V9UA 2QGBA 3LZ5A 5ICUA 5F1NB 4H9XA 1ONQB 3DNKA 4ZCWA 5C7XL 1PYFA 1NANI 3RUGF 4YDMA 1OAKH 3BPLC 4J12A 1VA9A 1INQB 1W72A 4ZZFA 4ZL1A 2DMCA 5DY3A 4M5ZL 3ZR4A 4PV8B 3MCKB 2W66A 2XVPA 5EF3A 2GUBA 2ONEA 5KSBF 1IM9B