1C8YA

Endo-beta-n-acetylglucosaminidase h, d130a mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
265
structure length
265
Chain Sequence
b'KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFADEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
total genus 91
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c8yA00
5D9OA 3EDDA 5HNNA 3VM7A 5A6JA 4UFHA 4AZCB 4P7RA 4PCTA 1V6VA 1B3ZA 4JFWA 1IT0A 1MFUA 2BS9A 1E43A 1IV8A 2O9PA 3W38A 1BGGA 2WSPA 3VX1A 4ZE4A 2ZUNA 1N82A 3AISA 4LPCA 3ARSA 2ZWYA 1MW0A 3AMCA 2XYLA 2JFEX 1BFNA 3WQ5A 3UEQA 1OIMA 3L4WA 2DH3A 3AQUA 3HU7A 2CYGA 4D6IA 2YJQA 4UQCA 4AEEA 5JIPA 1CBGA 1ISYA 5EBAA 4ZXLA 1VJZA 4W89A 1JFXA 2WZIA 4L4PA 3WH5A 4D1JA 1VFUA 1JG9A 4NSBA 5FOOA 1HT6A 4GZIA 1M03A 3U57A 2ZOXA 1F4HA 1DWFM 3PTMA 2WSKA 4X9YA 3RDKA 1EA9C 1KXTA 1WZKA 2CBVA 3CUIA 1VEOA 4ATLA 2BY2A 4W84A 2BHYA 1ODUA 2GJRA 5I3DA 2WW5A 2C7FA 3N04A 7TAAA 3AS2A 1H0IA 1CXFA 3CMJA 1E9LA 4IPNB 2GDUA 4IM4A 2YA0A 1UA7A 2XJ7A 3KE0A 3CTTA 3AS0A 5CLTA 4LQ1A 5A1AA 4AD1A 2DPEA 3ZJ7A 4DWSB 2E0PA 2ZICA 4IUGA 4GINA 3CPUA 3GNOA 4KGJA 4UR9A 3AMGA 3PBGA 3VIMA 1QI4A 1W2VA 1ZL1A 4XZBA 1JF5A 1HKJA 4AD5A 4UQ9A 4QCEA 1UQZA 3SCRA 1TR1A 2D1ZA 3WY1A 1JF6A 3ZR5A 4PMZA 1PIGA 2ESCA 1EXPA 2C8NA 3M07A 1Q6GA 1UWSA 2J7FA 4UZSA 1BSIA 5GNZA 1NP0A 1OB0A 1NH6A 4CCDA 3M46A 2WLYA 3WEMA 5IDIA 4AZCA 4WKHA 1J11A 3AHVA 2XVNA 3EMCA 4B9YA 3WBEA 1ZBVA 1R7AA 1C8YA 3WDJA 5CXPA 2O9OA 4PMQA 3VU2A 2GDVA 1GHSA 1CDGA 3WFLA 2X09A 3DYOA 3CHDA 2WCSA 1WDSA 5A2CA 2DDXA 2V3FA 1EIBA 3VD3A 4J3SA 3VDCA 4BQ5A 5C8BB 2HISA 3WDRA 1OT1A 5A6BA 3MANA 2WBGA 1K9EA 3L4VA 3AHXA 3L4XA 2W91A 4F8XA 1NOFA 2A3BA 4F66A 3BAXA 1M04A 3W26A 4HMCA 5A6LA 3VTRA 3WELA 1JDAA 4TUFA 4QLKA 2A3EA 2A3CA 1VF8A 4W7WA 4CVWA 4CCEA 1CGVA 5AYBA 3EDEA 1XSJA 2WCGA 3DYMA 4KWUA 1Q6FA 3OZPA 2ZX5A 3WNOA 4Z2LA 2CETA 1H11A 2FH6A 4AY1A 4BS0A 1QHOA 4WKFA 2XG9A 2CEQA 5JBFA 1EH9A 1OBAA 1H3GA 3T09A 4C7GA 1CGWA 3W81A 4OBRA 1FH8A 3OGRA 5A8NA 1BYDA 4RE4A 4GKLA 1ZBCA 3TP4A 3VIOA 3OGVA 4XB3A 3B9AA 1TCMA 4AD2A 4AXNA 4E4PA 1LL7A 3WFZA 1UD5A 2WCAA 3ALGA 2BVTA 5CG0A 2QV4A 3BC9A 3PZIA 2QF8A 1UD4A 1BVNP 3SUSA 2OSWA 5E9AA 2ZXAA 3UERA 3L4TA 3WDQA 3CMGA 4ATDA 1G5AA 5D9PA 4U5IA 1FP9A 4MNJA 4PMRA 4KH2A 1JXJA 1UWQA 3WD1A 1OCQA 4CU8A 3AS1A 3SCOA 5DT5A 4P8UA 3WQVA 4J27A 4QFUA 4CD4A 2VI0A 4MNMA 3BAJA 1WAWA 3WEZA 1V08A 4MDPA 1EDTA 1WKYA 3RIKA 3N9KA 4GI6A 3S6TA 1WDQA 2ZUVA 4AZGA 5CSYA 2D24A 3BAKA 2VQUA 3FW6A 2VCBA 5LA2A 1KWGA 5LA0A 4MJ2A 3SUVA 3L4UA 1ZJBA 2Y2WA 3UR7A 5C70A 3HMCA 2W62A 1NARA 1OGSA 3CLWA 1BTCA 4CVUA 2QMKA 1W9XA 2J79A 3WD0A 1NWUA 3AIQA 1JZ6A 3AXHA 2WLZA 2ZIDA 4UFMA 2WMIB 3OG2A 1V02E 3AZRA 1I75A 5ABHA 2VVNA 1JYVA 1FH9A 1DP0A 2WK2A 3GM8A 5A94A 1E4MM 1VJSA 4PTXA 1EOKA 2DEPA 3N12A 3GXFA 3MU7A 4QP0A 3PHAA 2CCRA 4DM2A 2VX4A 6CGTA 1WZAA 2XTKA 4Z2KA 2VVSA 4TVCA 4W85A 5I5RA 2OLHA 2CBUA 3VD9A 4UQAA 2E8YA 3BCDA 1EO7A 4MTVA 2QPSA 4Z2HA 2WC3A 1E6RA 3AIUA 2WKGA 1ZU8A 2J8GA 4U33A 4UFJA 4B3LA 1GCYA 4LYQA 3PZQA 3AROA 3W4RA 4ZENA 2ZXDA 2YA2A 3FHQA 4JCMA 3MUY1 4JL2A 4A3HA 4U3AA 2WWDA 2GVYA 3L2LA 2J8FA 2RGMA 2ZWZA 5EFFA 4AMCA 1OT2A 3N1AA 3PZOA 1HKKA 3KWXA 4JHOA 1UA3A 4WF7A 1QI0A 5EFDA 4A4AA 4MNLA 1GJWA 1TVPA 1G1YA 1R85A 4AD4A 5I78A 1J18A 2FDMA 1P6WA 1UWTA 5LA1A 1CGYA 1DWHM 3ARYA 4W86A 3WBAA 3ZJ8A 4XUYA 2J25A 4UNIA 1E71M 4AIEA 3AYRA 2X2YA 2OSXA 5E70A 1FFQA 4MAVA 1WB0A 4YHGA 4JKMA 1ITCA 4B16A 2VZTA 1QVBA 2VL4A 4XV0A 5I24A 4PTVA 5DF0A 3U7BA 2WXDM 3OLEA 1EGZA 4GXPA 1G94A 4PMVA 4JFSA 4ACZA 4YPJA 3BXWA 4F9DA 5FL0A 2BHUA 3WEOA 5A95A 2WMIA 6TAAA 2PWEA 3VVGA 2WAGA 2WVTA 1I1WA 3VD4A 2IXUA 3QHOA 1JZ7A 5D8ZA 1ZS2A 2HVMA 1NOUA 1XH1A 4GIAA 3LPFA 4AZ7A 1U30A 2VT0A 4UOZA 5KZ6A 1E1FA 3WF4A 2Z1SA 3AMDA 5A3HA 2VX5A 2UY2A 1CGTA 1AQ0A 7A3HA 3BSHA 1KGUA 2DSKA 3WUFA 3BCFA 4KGLA 3RMEA 1DTUA 3NYDA 4M81A 3RO8A 4MB1A 3WNPA 1Q4NX 4P7NA 3MMUA 1FOBA 1JZ4A 3O2LA 5EB8A 5IFPA 2XIBA 2NSXA 1V02A 3GDBA 1GHRA 3NSXA 2CXGA 4Y7EA 1HJUA 3LMYA 3WNKA 4W87A 1W9DM 2Y4SA 1JZ2A 4MPKA 1W3HA 1GOOA 3J7HA 1BHGA 2WVVB 4M8UA 2OYLA 1G9HA 3PTQA 1XH2A 1ZBKA 3NSMA 1UKPA 1WDRA 4D1IA 4WJXA 1RD6A 3POCA 2X05A 4DUVA 2V3EA 3W53A 3ALFA 2Y5EA 4WIWA 1UG6A 4KRTA 5A69A 3ARQA 2BXZA 2GFTA 4ATWA 2CIPA 3SCWA 1KB3A 4OUEA 4AZHA 4EANA 1MW1A 4X0NA 3DYPA 1J0KA 2XVKA 1LL6A 1JGIA 3SCSA 4WLCA 1KFWA 1AQHA 4CD5A 1XD0A 3VMOA 2DT0A 3WD3A 1MWOA 4V2XA 1QNRA 5KEZA 1CXLA 4FLRA 1EHAA 3MMWA 3SCUA 4AYSA 2ZUWA 3A47A 2G3JA 3CH9A 2JE8A 3VGGA 2FHFA 2WYSA 3M6DA 1AQMA 3DHPA 3BMVA 4CKQA 5IFTA 4PRWA 1KQZA 3NDZA 2W61A 5IXEA 4P7OA 2VCAA 2WHMA 1JYWA 1XRVA 1HJVA 3VGEA 5BXPA 1J0ZA 3B9EA 2FGLA 1V3IA 3L4ZA 4S3JA 3CZGA 3OLGA 4BA0A 3SCTA 2DT2A 2EPLX 2YBUA 1W9UA 1SMDA 3AMLA 5TD4A 1M7XA 3GNRA 5CPSA 2YKKA 3A4WA 4FLOA 2W92A 5F7UA 2EBNA 3AHZA 5E6YA 3WENA 2V3DA 3N17A 3GBEA 4J7RA 1NWSA 1D7FA 3GH5A 2OSYA 1AMYA 2CBJA 2CKSA 3WUEA 4E8CA 4LYPA 3WN6A 4AEFA 3WF0A 3U7VA 5JIWA 4BF7A 2J78A 5A2BA 4DM1A 5A8QA 4J3WA 4C7DA 1B9ZA 1KXQA 4IPLA 5A8MA 1PIFA 4AISA 2VCCA 3A3HA 1E6XM 1JAEA 4QCFA 2TAAA 3I3EA 1ZJAA 1QI2A 4GO8A 1V0KA 2G4FA 3W0KA 3ARTA 1WCGA 4IISA 1ISXA 1XYFA 2PBOA 2CERA 4B9ZA 4TX6A 3EDKA 1BYBA 4PMUA 1XSKA 1JIBA 2QLYA 3DHUA 2YLLA 4HPHA 4M56A 1V3HA 3THDA 4D6EA 3OBAA 3VNYA 1XGZA 1CXEA 3VX0A 1PX4A 3L4YA 3VDAA 2W5FA 2ZUTA 1C8XA 1G0CA 2FHCA 3RJXA 5FL1A 2C0HA 2UY3A 3D5HA 3UG4A 1GVIA 2J74A 3AIEA 1GQLA 2D0GA 1W1YA 3UG3A 5GNYA 3MV01 3BAIA 2NW0A 4MB5A 1FHDA 1QHZA 2WVSA 1EQCA 2WPGA 4EKJA 4XX6A 4HA3A 2E4TA 1EDQA 3ZT6A 4AZIA 1LJYA 1E4IA 1E3XA 1MQQA 3KL3A 8A3HA 4JFTA 5ABFB 1VENA 1UR9A 1FHLA 4J28A 1MXGA 2Q8XA 3ECQA 3RCNA 4N42A 2NT0A 5M5DA 3AYSA 4W8AA 1E4NA 3LPPA 5CGMA 5FCZA 1Y7VA 1R8LA 2IUZA 3FXYA 5BXSA 3WNLA 2G3IA 3WIJA 2DSVA 4CD6A 2E9BA 3FN9A 3AOFA 3VUPA 4YN5A 1QI3A 4PTWA 3O6AA 1C93A 1W9VA 3TTYA 1HKIA 3K4AA 4R5EA 4AIUA 5GQBA 2WNWA 4NF7A 1E0VA 3MS8A 1V0NA 3AIBA 4MB4A 5IHRA 4MJ4A 3BH4A 1V6WA 1HP4A 4P8XA 3KL0A 2QMJA 1UUQA 3VGHA 3BLKA 2JF7A 1YQ2A 3IANA 3SUWA 3JUGA 4J3VA 1NQ6A 3CHFA 4HMDA 1UZ1A 2WKLA 2AMGA 5CSUA 5BWFA 2ZX7A 2W63A 4ML4A 4PSRA 1PPIA 4DWSA 3AJ7A 4D72A 5I77A 1QW9A 3OA5A 1H41A 3WUGA 2A3HA 2ZXQA 1HN1A 3U5YA 4UFKA 4FLQA 5BCAA 1FFRA 2PB1A 2BVDA 4BQ2A 1RPKA 2EJ1A 3AMKA 1HJWA 3VIKA 4Q7NA 1MW2A 5E0CA 4GI9A 2XFRA 3TONA 4PCSA 3W6LA 1PEZA 3MSGA 4FF5A 3SUUA 3WH6A 1E3ZA 1US3A 3WF1A 1KR1A 4WK9A 1UWIA 2CBIA 1NM9A 4AC1X 2OWWA 2X0YA 1C90A 1GOMA 2O9RA 2DSWA 4URIA 5HPOA 2F8QA 1E0XA 3SCNA 1E0WA 3F5JA 1GPFA 1KBKA 1O7AA 5ABFA 5BYWA 4MADA 4W7VA 4Z2IA 5ABEA 1JDCA 1HX0A 4H8VA 2E40A 2Z1KA 5AC4A 3AICA 4JKLA 4D71A 1UR2A 1PBGA 1CXIA 3WUBA 1CEOA 3CZKA 3EYPA 1LF1A 3UCQA 5ABGA 9CGTA 2J7GA 3OZOA 1DWAM 3ZOAA 5FIPA 4TTUA 4BQ3A 5JBDA 4PN2A 3VM5A 3VGDA 3W37A 4CD8A 1UR4A 3WH7A 7CGTA 4H8UA 2D20A 1W1TA 2VUYA 3CO4A 3FAWA 1JI2A 2VQTA 5BRPA 1V03A 2FH8A 1GOKA 4ZEPA 5A8OA 2G3MA 2YOCA 1DEDA 3T2OA 1QNSA 3EDFA 3THCA 4BCEA 1KBBA 1BYAA 3WL0A 5CGTA 1LLOA 1ZB5A 3FAXA 5BRQA 3AS3A 1OINA 1OD8A 4NRRA 3SCQA 4PMNA 3K1DA 4AZ6A 5BXRA 1NWTA 1L8NA 5ECUA 1R7OA 1QNQA 3CUHA 2O92A 3QHNA 1FP8A 3A6OA 3OLIA 1UKOA 2XWEA 3VIHA 1ZBWA 4H8HA 3EMQA 3KEHA 2OYKA 3VIJA 3PZ9A 1UKSA 1HJSA 5GPRA 5DT7A 2VTFA 5A6MA 1JAKA 2VMFA 5D9MA 4OKDA 3NJ3A 1HJXA 1V6XA 3ZM8A 1MXDA 1MFVA 3K8MA 1TG7A 1CENA 1KCKA 1UZ4A 4OOUA 2YL8A 1CPUA 3UESA 3GNPA 4M29A 1H2JA 2XSAA 3WF3A 1DHKA 3POHA 1JNEA 5AY7A 1F4AA 2BXYA 1C7SA 2CESA 1MVYA 1NOWA 1CGXA 1VBUA 2ZE0A 2ZX6A 3UG5A 3ZQ9A 1GNXA 5A6SA 4PMDA 1OSEA 2VRQA 3AXIA 3WQ8A 1GOQA 4JAWA 3GXDA 4OJYA 2JEPA 1J9YA 2J77A 4Z2JA 2W66A 1BG9A 3WL1A 4U5KA 5GNXA 4AZBA 1C3FA 3ZSSA 4UTFA 4U2ZA 4U31A 2XGBA 5FKYA 3VIPA 1BPLB 1GONA 3WD2A 1J0HA 1K6AA 4JFUA 2GSJA 2Y24A 1SFSA 4DUXA 3RPMA 4WSJA 4EAMA 3SIMA 3CUJA 1VFOA 4D6FA 4TXEA 4F79A 3IK2A 1X1NA 1HXJA 1SR0A 4YHEA 3VDHA 4ZE5A 4BQ4A 3CHCA 5CLWA 1W3LA 1EOMA 3IJ8A 1CLXA 1C92A 4AIOA 3N18A 4S3KA 1GOIA 2WC4A 1GW1A 3IAPA 2E3ZA 4MDOA 4P7LA 5CZKA 1B2YA 2GJXB 1UR8A 3GXIA 3PN8A 3KL5A 3ZSTA 3K8LA 4LX4A 2YDQA 3NSNA 3EBVA 1RP8A 3B9DA 3ZIZA 2WHKA 5DFAA 1V3MA 2GJPA 2WBKA 1VBRA 3LPOA 1JFHA 2XVGA 2WHJA 2XFYA 3WMSA 1E40A 4OZOA 1ISVA 4H2CA 4HOXA 5JUVA 5M3WA 3AHTA 4NI3A 1PAMA 1E6NA 4M1RA 4PTMA 3FHAA 2DT3A 3W24A 4PSPA 5HBFA 4HU8A 2G3NA 3RJYA 2YL6A 2E9MA 4CD7A 1HNYA 1Q6CA 4JIEA 3T0BA 5BROA 5D4YA 3VINA 4D6CA 2J7EA 1XYZA 1GQJA 1A47A 4HPGA 2WMHA 3WNNA 3GH7A 2WVUA 2CNCA 4UQDA 3WSUA 3GYCA 1K9TA 2VC9A 4LGXA 1E1EA 1UWRA 2DIJA 2FGZA 3GXMA 1JZ3A 2PF0A 1VIWA 5EMYA 1UH2A 4PUEA 3RM9A 1XHGA 5HOSA 3ZT5A 3FY1A 4ZXOA 4V27A 1CTNA 4ACYA 4DUWA 4MAZA 1JNDA 1PX3A 1OGBA 4GO9A 4H41A 1UKTA 4KRUA 4QDMA 3OB8A 3WF2A 2D3NA 3B8SA 3I3BA 4UOJA 1I1XA 5CPQA 2WMGA 1E4LA 2EEXA 4PMXA 3MUZ1 3W29A 2XM1A 3QR3A 1TMQA 1E6QM 4CU6A 1W2PA 1QHPA 2PI6A 5I79A 4Q22A 4PUDA 4HZ8A 1E15A 3A4XA 2D0HA 1C8QA 4D6DA 5A2AA 1B0IA 1XD1A 3CGTA 4GPNA 1CWYA 2IXVA 4MB3A 3WDPP 2XVLA 1G01A 4TTGA 3TOPA 3MV11 1TA3B 3WMCA 1KXVA 4X0VA 3VO0A 1WZLA 3QHMA 3K4DA 3VGFA 3VD5A 3BAYA 4CN4A 2DIEA 1VFFA 4AZ5A 3UETA 1W1VA 2CITA 2VZUA 1HVQA 3W27A 1M53A 3MMDA 1VEMA 4KMQA 4P8WA 1MW3A 1E6SM 3BGAA 3GTNA 1FA2A 1UR1A 1CNVA 3VNZA 2WVVA 3RILA 1GOWA 2F2HA 2EPNA 3PZMA 1UQYA 2XGIA 4RE3A 4RL3A 1MQPA 2J47A 1U2YA 3PZNA 1DWJM 2YL5A 2WMKA 3G6MA 1MQRA 1FH7A 4BZYA 3WDIA 1AVAA 2JIEA 3MKKA 2V5DA 3ARRA 2EXOA 4FMVA 1H09A 1WZMA 4ZFMA 5AYIA 4UQBA 2Y8VA 1HKMA 1XCWA 3CBWA 2UY4A 3EDJA 3TTQA 4U2YA 4CCCA 3DC0A 2ZX8A 1KWKA 1O6IA 2J7DA 1W91A 1ECEA 4AW7A 1J0JA 2J7HA 2WHLA 3WQ6A 3T08A 3PZUA 3E1F1 3FNDA 3F5KA 1D3CA 1J12A 4EK7A 3N11A 1B90A 1V3JA 2J75A 2UWFA 2XFFA 3IJ7A 1LWHA 3TA9A 4FK9A 2X0HA 2VOTA 1HP5A 3QGVA 3OIHA 3ZMRA 3N13A 1GQIA 5LYRA 3CZEA 4M24A 6A3HA 2VJXA 4TX8A 1CLVA 4QLLA 1B30A 4B15A 4CU7A 3OLDA 1EO5A 3MO4A 1E72M 2VRKA 4LYRA 1GVYA 1OD0A 3CHEA 4D6HA 1BAGA 4DWSC 5HDRA 1NP2A 2YBTA 1LQ0A 1HF6A 4CN1A 1TA3A 3QOKA 3ZJKA 3WDHA 1ITXA 1KGWA 3IAQA 1LG2A 1B3XA 4AWEA 4WSKA 3PZGA 3AIVA 4P8VA 2D0FA 3NIYA 1PZ2A 2WZHA 4W7UA 5A6AA 3ZR6A 5CPTA 4U3CA 1HL8A 3RM4A 3RM8A 5I0DA 3QOMA 2ZUUA 1WPCA 3L2MA 2YL9A 1QBBA 4PBGA 1EHNA 4AD3A 1CYGA 4UCFA 1UHVA 1B31A 2DGAA 4H7VA 3NDYA 1PZ3A 4CN6A 1RH9A 1BGAA 4HOZA 4OOZA 2VZVA 4C7FA 3EMZA 1KQYA 5FD0A 1E6ZA 1GZJA 3W82A 1US2A 3SURA 2VR4A 4N0RA 1LWJA 1XV8A 3K46A 1GUVA 4WKAA 1UD6A 3N15A 1R86A 1W32A 2D23A 5D8WA 1OGGA 5I6SA 1BLIA 2W67A 1XC6A 4P7QA 3SCVA 1BVZA 1ISWA 4GQQA 2DSZA 2CHNA 1GORA 1ODZA 2YDSA 5E09A 2BHZA 1B3WA 4J3UA 2XWDA 3ARXA 2JALA 3A4AA 3ZT7A 1V3LA 5E0FA 1KXHA 1TZ7A 3ARWA 3F5LA 3GBDA 1UD8A 3MSDA 1VB9A 2J7BA 2F61A 4GQRA 4UZUA 1CZ1A 3T0DA 2YA1A 3K8KA 3VDBA 3WQ4A 3WH9A 3AZTA 1CECA 4QLJA 4HTYA 1JD7A 4W5ZA 4UFIA 2ZUSA 1JXKA 1VRXA 2JIWA 3VKKA 2YLAA 2XUCA 2YIHA 4OIFA 1KCLA 3F4VA 4GZJA 1V3KA 2XSBA 3GH4A 3CUGA 3GZAA 3ARPA 1JZ8A 4EE9A 2JF6A 2VZSA 4M80A 1J0YA 1H49A 3T0AA 4B3KA 3PZTA 4D6JA 2E9LA 2EQDA 4M82A 2YDRA 4A3YA 4UOQA 1HIZA 2VURA 2GUYA 1QPKA 4JCLA 4MNKA 4K68A 4W8LA 1BF2A 3VIGA 4PEEA 3VMPA 1UD3A 4LXFA 3SEPA 1Z32X 3SUTA 1M01A 2VR5A 1JD9A 4JZ5A 2Y8KA 5I2UA 1UYQA 1WDPA 3VD7A 1PJ9A 3ZO9A 5HXMA 1TUXA 2GK1B 1E55A 2WC7A 3S2CA 3AFBA 4HU0A 1TE1A 4ACZB 3D3AA 1ISZA 4OBSA 1HVXA 4AD0A 1E70M 2JEQA 3BSGA 3M7SA 2MANA 2BNJA 2VNCA 4TOQA 2DQXA 3PZVA 4FLSA 3CZJA 3T2QA 2VX6A 1LL4A 2BVYA 3APGA 3VPLA 3WKZA 4E8DA 2XPKA 1GJUA 5C71A 1DWGM 1H4PA 4PYSA 4UFLA 1UH4A 1R87A 3NUKA 4HZ6A 4HA1A 2QPUA 2ZUMA 1UKQA 5HPCA 2D3LA 4HA4A 4QAWA 2X1IA 3I3DA 2O9TA 2BY3A 5M17A 2BY1A 1UOKA 1E5JA 1KGXA 1QI5A 1V6UA 2V38A 1B1YA 1V0MA 2G41A 5IHSA 4RE2A 3AIRA 3II1A 4R27A 1OM0A 3T2PA 1DWIM 2UY5A 3BAWA 1XSIA 3AHYA 3MUAA 5DMYA 1QW8A 1A3HA 1HL9A 2PWHA 1K9DA 3WD4A 1XH0A 1JL8A 2EO7A 3KZSA 4HMEA 2D22A 1LG1A 3AIWA 2W4XA 1SMAA 1H1NA 1W3KA 3W6MA 3W25A 2OWXA 2XIIA 5DEZA 1W9PA 2CKRA 4W93A 1OWQA 4NZCA 1QOXA 1SYTA 1EQPA 1TFVA 3AXXA 3NCOA 2DH2A 1EDGA 2ZXBA 3G6LA 2WMFA 4E2OA 4D6GA 1E6PA 3WMBA 1QNOA 5AC5A 1Q6EA 2VZOA 1X6NA 3ARUA 4CUCA 5DO8A 4H04A 1VAHA 3BLPX 1WO2A 2GK1A 2PBGA 3AZSA 3UR8A 4Z2GA 1RP9A 1JI1A 1L0PA 2PWGA 4J3TA 4TVUA 2RGLA 2XVPA 4GI8A 3TTOA 1QNPA 4V28A 1KR0A 8CGTA 1B3YA 1CGUA 1V6YA 5A6BD 1UR0A 1B3VA 1H0GA 2ZX9A 3IJ9A 5CJ5A 1S46A 1YHTA 3MUIA 4W88A 2EPMX 4CGTA 2B31A 2PC8A 1PX8A 2WM0A 1WE5A 3O9NA 2WANA 1GQKA 5D9NA 2V3GA 3VIIA 2QHAA 2XM2A 3VILA 3OGSA 1J0IA 2A3AA 1X6LA 4HOWA 3DECA 1VEPA 1IZKA 3PTKA 4W8BA 3VMNA 4F9JA 2X8RA 1CXHA 2OYMA 3CIVA 1JDDA 2OWCA 2J62A 2VO5A 1W1PA 4W5UA 1D2KA 1IZJA 2DT1A 4J3XA 2EPOA 4JFVA 2NT1A 3WH8A 4DWSD 1C7TA 2PWFA 1C91A 1H5VA 2XHYA 2G8ZA 2WB5A 2VX7A 3TTSA 2WMJA 3ARZA 1UD2A 1J01A 2AAAA 5E6ZA 1UH3A 3WQWA 4XZWA 1E56A 1J10A 2J4GA 5I23A 2V5CA 2WZEA 4HP5A 1CIUA 3HJEA 1WNOA 4JL1A 1BQCA 4NRSA 5A6KA 1CXKA 1XCXA 2CPUA 2FHBA 3ARVA 1VFMA 4HZ7A 3VGBA 3VIFA 1Q6DA 5JBEA 1MYRA 2D2OA 5A8PA 1BG4A 3U5UA 1JYXA 1K9FA 4TVDA 5M03A 1V0LA 2BFGA 1W3JA 1ESWA 1UWUA 2J7CA 2VRJA 3LPGA 3HN3A 4L4OA 2BV9A 3BMWA 4JHZA 2DSUA 1OIFA 2E8ZA 4PMYA 1BYCA 3CZLA 4GZEA 4PMOA 2PWDA 3CUFA 3SCPA 1TVNA 1QBAA 3ZJ6A 1U33A 2AOSA 5CQ1A 4UQEA 2CHOA 1JYNA 1JZ5A 2WWCA 1NWRA 1W9BM 2BY0A 3W28A 3WNMA 1WP6A 5BXTA 2GJXA 1E5NA 3CZ8A 1E73M 4JKKA 1HJQA 3AI0A 2EPKX 3VOCA
chains in the Genus database with same CATH superfamily
2FJUB 3VM7A 4OU1A 2WZMA 3E02A 1XKJA 1IT0A 4NZFA 1P1XA 2WQDA 3BJSA 3M5ZA 2O9PA 3IARA 2WSPA 4AVOA 5EA9A 1XISA 2ZUNA 1N82A 4Z1DA 2ZWYA 1MW0A 3FOKA 2JFEX 3WQ5A 4X22A 1H7XA 2DH3A 2VD8A 2CYGA 4UQCA 4EX4A 5EBAA 2V69A 2V2HA 5DANA 1DIOA 2PCEA 2BG5A 4D1JA 4QG8A 3PSWA 5FOOA 1VP5A 4GZIA 1M03A 3S5YA 5JXQA 3W72A 4OUIA 1OX4A 3O6YX 1NU5A 3CUIA 5I7GA 3DKJA 1VEOA 4YS1A 3KCJA 1VCFA 3BL3A 2V2CA 1XYBA 2V8ZA 5F1VA 3ANYA 2WZTA 2Y70A 2C7FA 3CUXA 1O5RA 1EF2A 3OVQA 1PS9A 1EP2A 1J6PA 4IMDA 1A80A 4YVXA 4S3EA 1RQHA 1XP3A 1OX5A 1R0MA 3CTTA 3KBWA 4LQ1A 3L23A 1UWAA 1D8CA 3S5OA 4AD1A 2DPEA 4DWSB 4QJ5B 1SM9A 3CPUA 3GNOA 4KGJA 4UR9A 1EC7A 3PBGA 3T44A 4L4MA 3N6HA 1QI4A 1IIGA 1R3YA 4JX6A 1SZEA 3CPRA 4UQ9A 4QCEA 5TQLA 1ZALA 3NXFA 2FFCA 1DVJA 4C1KA 3GLCA 2VWTA 2B0MA 3EKGA 3RFAA 2ESCA 3M07A 3QV6A 1SGJA 4ERIA 4ASTA 1DPMA 5IDIA 2AQVA 3G5EA 1J11A 4QE1A 3S46A 4B9YA 3EMCA 3EA3A 4BEQA 6REQB 3P6LA 3UCCA 3BLOA 1XLFA 2O9OA 4PMQA 3VU2A 4K2SA 2VFHA 1GHSA 2W6RA 5JMUA 1KD0A 2XN0A 3CHDA 3TX9A 4PCNA 4CNNA 2V3FA 4MY1A 2Y7GA 3NZ1A 2KX9A 4GYJA 3VDCA 4RNJA 2HEJA 4BQ5A 3C2OA 3FKRA 1OABA 3CV1A 1K9EA 3L4XA 4MJMA 1KFCA 3NR0A 2CU0A 5FEZA 2DFAA 2CLPA 2QCMA 3P74A 5HQMA 1JDAA 1IXPA 1W8GA 1A5OC 1VF8A 1P5BA 2QCFA 4UNLA 3CMFA 4KWUA 3U2ZA 3PUGA 1F73A 3WNOA 3G2GA 1NDWA 1WA3A 3LHWA 1QHOA 1XIEA 4WKFA 1K4GA 1W0MA 5JBFA 4PTDA 2EKCA 2NSOA 3GVRA 3BLIA 3VZXA 1VHCA 4C6FA 1CGWA 3UPWA 5A8NA 2Y0FA 4GKLA 3VIOA 3NQCA 3W7JA 4XB3A 2HRWA 1M68A 4R7WA 4Z1CA 3ES7A 3HPSA 4RDZA 4DNMA 3WLRA 1S39A 1W8SA 4O0QA 1TJ2A 2QV4A 3R0UA 3PZIA 2NXHA 4ZQNA 3KFTA 1WKFA 3HTWA 2Z28A 4FOKA 4QNWA 5D9PA 4NHVA 4J9JA 3OG3A 3V75A 1UWQA 3W2LA 1DXEA 2VEKA 4QDPA 4QHRA 3CEPA 2RDXA 3UXAA 4CU8A 3AS1A 1PWMA 4IIDA 1XLGA 4CNSA 4QFUA 2BBFA 1WAWA 1YXDA 3RIKA 1FWAC 3PY2A 4ZQCA 5CSYA 5AC8A 2QQ6A 3M41A 3DOPA 5LA2A 6PTDA 3DG3A 3K5XA 4MJ2A 3N4EA 5FF7A 4INFA 1NARA 2ZZ6A 4NZ5A 5DXXA 3HGSA 4I5RA 1D3GA 1AMKA 1QFEA 4LRSA 2WLZA 4MWAD 3VFCA 1V02E 1I75A 2NXGA 2QVHA 3BJTA 3W1AA 4L65A 2VVNA 1Q45A 2Q71A 3UJ2A 1DP0A 2CLHA 5A94A 3IIZA 3W9ZA 3GB6A 3RX2A 3GXFA 1X6UA 3LBCA 2XTKA 3P82A 3WX7A 2VVSA 2OGJA 4W85A 2OLHA 1Z48A 4GABA 2E8YA 3GIYA 3IIOA 5JH2A 1VLWA 3DDMA 1ZFJA 4BI6A 3EWZA 4NJHA 4Z2HA 4UFJA 4LYQA 3N19B 2ALDA 4AY7A 3AROA 3W4RA 2ZZ4A 4YTQA 4IX2A 2PGEA 1PXGA 2BGNE 1T0OA 1LUCA 2ZWZA 5EFFA 1TELA 3MZ2A 3VCRA 2A5HA 3Q4DA 4WOQA 4O1AA 4CNUA 4QE4A 1QI0A 5ECVA 4A4AA 3N6JA 4LUYA 1MSSA 1G1YA 4AD4A 1ELSA 2FDMA 3QC3A 4A8NA 3H7RA 2R1MA 4LALA 5E5CA 3OYZA 2QZRA 3CIWA 2X2YA 2XIOA 4REQB 3UYCA 3SJNA 1RQBA 3OHMB 4B2DD 3BG5A 2WXDM 3NA8A 2VEMA 4MHBA 1G94A 2QIWA 4MWAE 1W54A 1F76A 5CPNA 1Z41A 1BQGA 5D32A 3PBWA 4J4KA 5SWUA 1Y8BA 2HJPA 1QUMA 2WAGA 2WVTA 1TO3A 3MYPA 1I1WA 4L6OA 3LG3A 4ES4A 1KFEA 3EX6A 4F0HA 2ALRA 1M7JA 1B4EA 1TTPA 2HVNA 2HVMA 1NOUA 1XH1A 4AZ7A 4GXWA 2J27A 2F2KA 1T40A 1E1FA 4JGDA 4ZVJA 5ENLA 1CGTA 1AQ0A 1OZQA 4H83A 8RUCA 4RNFA 1KGUA 5I3KA 3BCFA 3NYDA 2A6NA 3L67A 3EPMA 4C5YA 1PCWA 3C0JA 3UBPC 3CAKA 5EB8A 4I8YA 2CXGA 3TMLA 1HJUA 2AGTA 3LMYA 2ZTKA 4MPKA 4NL1A 3R4IA 1GOOA 3J7HA 4PGLA 1EGVA 3LCIA 1THFD 1V4YA 1XIMA 2PPGA 3TJXA 1UKPA 2QJGA 3TZNA 3HPFA 4D1IA 2WM1A 3MSYA 4HPXA 1I6NA 1WBJA 2WOQA 2QGYA 2C15A 3ALFA 3BGGA 4QISA 5KZMA 2OGYA 3CL8A 1HUVA 4WIWA 4GRSA 3SI9A 2GFTA 4KEZA 5KETA 2RFGA 2Z1WA 1O12A 4PCPA 1IT7A 4JQ1A 3MO7A 3CB8A 3T1GA 1MUWA 3WD3A 2BODX 4I8DA 5HULA 4HU3A 2QKFA 1EHAA 1IQ8A 2ZUWA 2VM8A 3GC4A 3LRMA 2EF9A 4G1KA 4KEUA 2G3JA 3OW1A 4S23A 1G4SA 3A22A 4Q8TA 3HQ1A 4GJ1A 5IFTA 4HTBA 5IXEA 4RW3A 2WHMA 5HJYA 4WRHA 3VGEA 5H8MA 5BXPA 1RLDA 1RCQA 2FGLA 4I6KA 3MHUA 4DF0A 1EJSC 2I56A 3NXLA 3CZGA 4NKCA 4O0KA 3OLGA 2J8TA 4DF2A 1TJ0A 5XIAA 4ICMA 3WJWA 3FEMA 2QCDB 1QPOA 2YKKA 4YWIA 3ORWA 5HAOA 3N17A 4YTSA 3QXBA 4IJCA 3GBEA 1NWSA 1D7FA 3LM7A 2C71A 4QSFA 3UPMA 2A2IA 1KCXA 5CC7A 4E5TA 1OC6A 4FP1A 3T9PA 5JIWA 5A8QA 4K37A 4J3WA 4PZVA 3RUBL 1B9ZA 2V81A 3P60A 1A5CA 2XIQA 3W2NA 4EPBC 2HXTA 2VCCA 3CAVA 3VFLA 4QCFA 4ICNA 2XDFA 3C61A 1XIDA 3R12A 3RK8A 1DJNA 3GVWA 4XKMA 2G4FA 3R1ZA 3D46A 3QGAC 4XBJA 4IISA 1ISXA 3EWYA 4ILSA 1WUFA 3DHUA 1YBQB 2QAFA 4M56A 1V3HA 5FF3A 3P61A 3OBAA 3IUIA 3VX0A 5AFDA 3CUZA 3L4YA 2ZUTA 3V0TA 2UV8G 2G50A 1GVSA 3NPUA 5D04C 2FHCA 4F0LA 5FL1A 3D6NA 3M43A 3FJ4A 3N2TA 2C0AA 3DG6A 2YYTA 1M9HA 5C2XA 3KXQA 1C9DA 1W1YA 5GNYA 3N2CA 1N55A 3W7IA 2BTMA 3MV01 4PFMA 5F4XA 1FHDA 5F4SA 1RCOB 2HCVA 1ZAHA 2WVSA 3HJZA 1EQCA 4ZB5A 4DXVA 3PK7A 4E4FA 1MZRA 5HNUA 1P0EA 2X1TA 2A7PA 5DLCA 2QCDA 3QZAA 1TV8A 1FHLA 4J28A 1O5KA 3W02A 1TZ9A 1LDCA 4N42A 1K70A 5M5DA 4GYFA 4GE8A 4FIQA 3DN5A 3AU6A 3WNLA 5EMMA 3NGJA 3PUEA 2OPJA 2DSVA 1IIHA 1L6SA 2E9BA 3FN9A 1LOSA 2PZ0A 2O55A 4Q8WA 3NO1A 5CPMA 3O6AA 3TTYA 3TC7A 4LW7A 3K4AA 4R5EA 4AIUA 1S1PA 3B8VA 2WNWA 1V6TA 4B3ZA 3O0FA 3KCLA 1HP4A 1WUEA 3EX1A 2GGEA 3IACA 1UUQA 3BLKA 4XO7A 2W27A 1YQ2A 5D38A 1XIBA 3ANVA 1XBVA 1UZ1A 1Z7AA 3OQEA 4QG6A 2W63A 1YBQA 3UXKA 3V5CA 4BI7A 1JULA 4PBFA 3OP2A 3IV3A 3HG4A 3U5YA 1JDFA 1HJWA 3B3DA 3QEZA 4HQVA 4A29A 4E3TA 2PDLA 1GYNA 1W1IE 2Z24A 4GVIA 3P8IA 3W6LA 2CLKA 1PEZA 4H9VA 2INZA 3SUUA 3WH6A 5TF0A 1KR1A 4WK9A 3G8EA 1UWIA 2CBIA 1NM9A 5G5IA 3GO2A 2FFIA 2O9RA 5FJUA 4EXQA 5K4ZA 2J6XA 3F5JA 3HG3A 4DZAA 1GPFA 1KBKA 1O7AA 3AC0A 2H6RA 1TPWA 5BYWA 4MADA 1HX0A 2PGFA 1XQLA 1IXQA 1A3WA 3SGUA 3S1WA 1X7FA 3EYPA 5IRPA 3UCQA 4DO7A 3IJDA 4HJWA 1YNYA 4BQ3A 4XAGA 3VM5A 3OVPA 3E0FA 3YPIA 4ZTXA 3WH7A 7CGTA 4H8UA 4GNVA 1W1TA 4CQBA 1GOKA 4ZEPA 2E5BA 4LVFA 3EDFA 3THCA 4BCEA 3SM0A 3F4CA 2V5KA 1HQTA 3H4WA 4Q6JA 4V33A 4DJEA 3FAXA 5BRQA 4A35A 3AS3A 3VNLA 1OINA 2X40A 1OD8A 4PB5A 4PMNA 2DUAA 4I5UA 2Z26A 2AKZA 5BXRA 3H21A 4RPQA 1R7OA 1QNQA 4N9BA 2KZHA 3N73A 3ABXA 5CAKA 1FP8A 3D0CA 3TC3A 1UKOA 5HNTA 2OX4A 5CEWA 3FJLA 1JPMA 3LTSA 3FGCB 5DT7A 3B4UA 3SY5A 3KW3A 1XIHA 1JAKA 4NAFA 1UUOA 3NJ3A 4Y9NA 1RBAA 3ABOA 4H1ZA 3B8TA 3ZM8A 1MXDA 1MFVA 4OOUA 4R9XA 2UZ9A 1PCKA 2YB1A 1DXIA 4GCAA 2CESA 4LBUA 1QRQA 2ZE0A 2ZX6A 1LYXA 1BD0A 1OFEA 3ZQ9A 2O4QA 5A6SA 1OSEA 2CZ5A 3TSMA 3C2RA 5GVJA 4OJYA 4HMNA 3NQEA 2ACRA 4QS5A 1FBAA 4Z2JA 1BG9A 2CLMA 3L7RA 1KM5A 4H9UA 3LK6A 4IHCA 1BPLB 3ZYZA 4GI4A 2PWVA 2IMRA 2Y24A 1PUDA 3RR4A 3ATZA 3CUJA 3QY6A 3RLUA 2CLLA 5H6HA 2PDPA 3VDHA 4BQ4A 4UTMA 3AXKA 3GVQA 3PPFA 4GXMA 1CLXA 2VDGA 3UJRA 5CBBA 1B3OA 8TIMA 1M3UA 2NLIA 3RF9A 1XBZA 2Q01A 4DI8A 3GXIA 4NXSA 4U10A 1QK0A 3B9DA 4FHAA 4GQBA 1MUCA 4RUBA 4ECLA 2WHKA 2WBKA 1JFHA 2EHHA 3FGCA 4H19A 3GXPA 3WMSA 3S5SA 1E40A 2ZVRA 3V5FA 6ENLA 4F4RA 3AHTA 2VC6A 4NI3A 3UXIA 4ZQPA 1RD5A 1CB7B 1TV4A 3IS4A 3ITYA 4O1CA 4HU8A 3CPGA 1Q13A 4YCOA 4XAPA 1EXBA 4JIEA 1Q6CA 3T0BA 5CBJA 2R94A 5KINA 2HNHA 4GVFA 4D6CA 1DJYA 3IRSA 2J7EA 4IGNA 1XYZA 3BOXA 1AUSL 4K1WA 4KETA 1A47A 1QT1A 5C6MA 4JYEA 2HWGA 1KLZA 4PUMA 1FXPA 4HPGA 2ISDA 4JTGA 3UYIA 3NURA 3PUOA 1K9TA 2PGRA 5D2XA 3W86A 1UWRA 2DIJA 1JZ3A 5B7ZA 1BSLA 2VYOA 1UH2A 4PUEA 3RM9A 1XHGA 5HOSA 3FY1A 4K8HA 5AB3A 1CTNA 4DUWA 2F6UA 3LLXA 4IL0A 1OGBA 4TV5A 1FCQA 4KRUA 3TSBA 3OB8A 3MJYA 2D3NA 4QGCA 1BVWA 3FA5A 3W29A 1T5AA 2ISWA 2Q6ZA 4O1BA 4MZ1A 3DXIA 1POKA 5I79A 1YE6A 2CC0A 3HOJA 4D8LA 5C9RA 3ICJA 3A4XA 1C8QA 2P8BA 1US0A 4A21A 3EB2A 3SW6A 5A2AA 4V1YA 3CGTA 1CWYA 4MB3A 4TTGA 3MV11 4X0VA 3QHMA 3VD5A 4R9OA 3HF3A 2GJLA 3UU0A 4AZ5A 4GHRA 5AYZA 1U22A 4KMQA 4P8WA 5E9XA 3BGAA 3H2OA 3NGFA 4KQNA 1FA2A 1W17A 4S3AA 4GISA 4QX4A 2F2HA 2EPNA 1PE1A 1TPDA 2XGIA 1JEZA 4RL3A 1MQPA 3PZNA 4WR3A 2A4AA 1FH7A 2JIEA 3RXZA 2EXOA 2E5CA 4EP8C 4ZFMA 3A12A 4F0RA 1LOLA 3CBWA 2UY4A 3TTQA 4C6DA 1KWKA 4LCRA 1ECEA 1QNVA 3VABA 1F6PA 4IQEA 1FCVA 1XUZA 3WQ6A 3ONBA 1JGMA 3T08A 1KM3A 3E1F1 3FNDA 1EEXA 1KFLA 3P62A 1J12A 3DESA 4NJJA 2OQLA 5KTLA 1QO5A 1B90A 2UWFA 3H26A 2XFFA 3PG9A 3NYZA 4IXXA 3LSBA 3V1PA 1ICPA 1EJXC 3LRKA 3QGVA 3SRDA 4FXSA 5AC6A 2VKZG 4DBDA 3W74A 5D30A 4M24A 6A3HA 3M1ZA 5HUOA 4S3GA 4TX8A 1UB3A 1VRDA 4DELA 1A4LA 3SN1A 5C9WA 3WG6A 1B30A 1PTGA 1GZ1A 1RA0A 3GU9A 2H3BA 3TCSA 2I5QA 1E72M 2VRKA 2V5LA 4WVXA 3VKCA 2A0NA 2QF7A 4KIRA 1NP2A 3PPGA 2W0UA 1XYMA 3O15A 4CN1A 4L1GA 3B9OA 3WDHA 3TWAA 1NAL1 4M7TA 1LG2A 1B3XA 4AWEA 1R3RA 1PIIA 3PZGA 1EC8A 4Q8OA 1Y5XA 3W07A 3AIVA 2X42A 4YIWA 2WPBA 2I5GA 3NIYA 4Y6GA 4A2RA 3HGJA 4C6NA 4U3CA 3U2CA 3L2MA 2ZTJA 2RUSA 1EHNA 1CYGA 3O6CA 3O06A 1ML1A 4KRZA 3P14A 4H7VA 3NDYA 4PRTA 4MKNA 3CNYA 4CN6A 4L9XA 1SJBA 4OOZA 2VZVA 3NVTA 3EMZA 3FKKA 5AECA 2O0TA 4DXXA 1R38A 5C7VA 4K7VA 3W82A 1US2A 3SURA 2Y88A 4N0RA 4AVFA 4BJHA 2ZCGA 5LIUX 1J5SA 1GUVA 3T4WA 1W32A 1OGGA 4P7QA 3SCVA 1BVZA 1ISWA 5EL1A 3STGA 1H7PA 4GQQA 4H4IA 1GORA 1ODZA 2HE5A 4YWSA 4F2TA 1B3WA 2XWDA 3CK5A 3ARXA 3ZT7A 1TMHA 3ARWA 3ABZA 3KX6A 1KTNA 3TQ0A 2F61A 4IMCA 4XIAA 3L0NA 4UZUA 1CZ1A 1EJVC 1XUUA 2B7OA 3K8KA 3DGBA 3VDBA 3E3HA 3WQ4A 3TTEA 4HTYA 2FTPA 4W5ZA 2ZUSA 3VKKA 2VELA 3GS6A 4F48A 2FZDA 2YIHA 3F4VA 4B5UA 1T96A 1L9WA 1V3KA 4ADSA 4B5VA 2YBVA 1I9CB 2ZE3A 1O1HA 2A21A 3CUGA 2JF6A 1VFSA 4M80A 1FQ0A 3PZTA 1OG6A 4M82A 2CZFA 2YDRA 4UOQA 5GJMA 3A24A 4AEOA 5G1TA 4IL2A 4MNKA 4NVTA 4CNPA 4K68A 2G97A 3WK0A 3GC5A 3EOLA 3OVGA 4R7OA 2DZXA 1UD3A 3LBMA 1Z32X 2Y8KA 4WOZA 3S1GA 1QK2A 3W3OA 4ADTA 4LJ3A 5BOFA 1M7OA 5BZAA 3WFAA 3S2CA 3S3GA 3ZVIA 3MJMA 4JXCA 1ISZA 4OBSA 1XRTA 1TWIA 3UA3A 1XI3A 4AD0A 2JEQA 3BSGA 4Q6XA 2MANA 1CLKA 1OF6A 2DQXA 4FLSA 3T2QA 1LL4A 3KTSA 3VPLA 3WKZA 3L5MA 5LXEA 2XPKA 5IBXC 1H4PA 2FLIA 4PYSA 1UH4A 2E67A 5CC6A 3TSDA 2ZKMX 3ID7A 4HA1A 2ZUMA 4HA4A 1VGAA 4AWSA 2O9TA 1R5YA 3Q67A 3IUHA 2BY1A 3ITLA 4NJIA 1UOKA 2PTDA 3F2DA 5DELA 1V0MA 4AHPA 2CFFA 5IHSA 3HPZA 3QPEA 1OM0A 3TYUA 1NY1A 4HCDA 3O16A 1DWIM 1DQWA 1QR7A 1XSIA 3AHYA 1GVOA 2QCGA 2ACUA 1SJDA 1QW8A 2VEPA 1XH0A 4RDWA 1SO5A 4E0CA 2D22A 1LG1A 3AIWA 4NIRA 2W4XA 1XF0A 1K02A 4JTTA 1W3KA 3W6MA 3WLQA 3E12A 3QQ1A 3NQGA 1K8CA 4W93A 3BW3A 4XK2A 4NAEB 1SYTA 3TW6A 1TFVA 1X97A 3NCOA 1QATA 5HINA 2JGQA 2WMFA 2VOMA 3E0WA 1LBMA 5DMMA 1AW5A 4CUCA 5DO8A 3FSUA 1VAHA 1XG4A 1N8WA 3BO9A 1E9ZB 3BW2A 3NEHA 2RGLA 4FNPA 1I60A 3E96A 2XFWA 1X38A 3TTOA 3S1XA 3FLUA 2WJFA 2X16A 4V28A 1AODA 4GNKB 3IJ9A 2DZWA 3E2QA 1JCJA 3KRZA 3NAVA 4J40A 4PUWA 1W5PA 1PX8A 1WE5A 3PG8A 2Q09A 3O9NA 1GQKA 3W1QA 5D9NA 3VIIA 3OGSA 1J0IA 5FEPA 5HMSA 5G4EA 2FIQA 3DECA 2Y6ZA 1FX6A 1O94A 5REQB 4W8BA 4OV4A 1F3XA 1CXHA 3VOGA 3RN6A 2J62A 3WLLA 4W5UA 4ORMA 2DT1A 2PTZA 1R3SA 3S8HA 4P2VA 2V9DA 3KOYA 4PR4A 4DWSD 3LCHA 4E2BA 3P2VA 3TTSA 3MDUA 2GQ8A 4AWTA 1J10A 4HN8A 5BRBA 3QPZA 4HP5A 1BQCA 3VNJA 2ZZ2A 3KRBA 1XCXA 3IEBA 4QS6A 5I3HA 2DVXA 1RJQA 1OADA 2PE4A 3ARVA 4HZ7A 4BI5A 2E6FA 3VIFA 2PDWA 4JY8A 5JBEA 4NAEA 3U5UA 1JYXA 2E7FA 2VRJA 2X7VA 4JDBA 3JRKA 5FAJA 3ITXA 4RZ4A 5T9BG 3CZLA 4PMOA 4PA8A 2Z1VA 4IOTA 3CUFA 1LQAA 1QBAA 7REQB 5LXXA 1TV3A 2AOSA 4H6RA 3GUGA 3VKBA 5CQ1A 4UQEA 4HYVA 1VYRA 4TX9A 1LLZA 2ZRWA 1SZGA 1TIMA 1PV8A 4KFPA 3M0HA 4XVDA 3HZ3A 4S2BA 4DJFC 3W28A 3WNMA 2YXXA 4MLJA 3R0KA 3NL3A 3AI0A 2IKGA 3PJUA 1SW0A 1GTHA 4L80A 3TNBA 4GY7A 4P7RA 1XJBA 1V6VA 4UC5A 1B3ZA 4JFWA 3S83A 4KEMA 2PD9A 4YNGA 3MA8A 4XIMA 3MKCA 5K4XA 4PEKA 5REQA 2HS6A 3I4KA 4ZE4A 4JN7A 3T0TA 2Z29A 3C0LA 3AQUA 4HHLA 2NXIA 5MF5A 1YLVA 1QO2A 1EX1A 2IQDA 4D6IA 2YJQA 2C1IA 2WJEA 4AEEA 1ISYA 2Y85A 1YYAA 3F4NA 1AW2A 1DORA 4HSHA 2JQXA 3VDGA 1JUKA 1M6JA 4NSBA 1I2NA 3NQ6A 2J13A 3U57A 2GSEA 1DWFM 4X9YA 3RDKA 2CBVA 5LIYX 1CB2A 2Z1XA 4ATLA 3WQEA 4MFEA 4AC7C 1MEIA 1JUEA 5I3DA 4G5DA 1RBOB 4YJ5A 2O56A 3N04A 1GYLA 3KCOA 3AS2A 2QDGA 1OYAA 4IM4A 1LCOA 1FWRA 2YA0A 4K8GA 3KS5A 3B8UA 1IEXA 5CLTA 1RQEA 1YPXA 3ZJ7A 4ZL1A 2PU0A 4JTDA 3VIMA 3VCCA 7REQA 1I45A 3CV2A 1FTXA 4AD5A 4KWVA 4J5NA 1TPB1 2OU4A 4I9MA 1TCDA 4XZ9A 5LNWA 1TKKA 1UCWA 2OZTA 1FWTA 1AQFA 2C8NA 4RNIA 2P0OA 1ZUAX 1Q6GA 2ZYFA 2J7FA 4QXIA 2P3ZA 1J6OA 3M46A 1QOQA 3WEMA 3UVIA 2RDTA 5HWMA 3SQLA 1W5NA 3WBEA 1ZBVA 2VWSA 3QGKC 1VLIA 1KKRA 4L9ZA 3WFLA 4FXJA 2RDWA 3UQNA 3M0KA 1Z6KA 1WDSA 4C90A 2KAUC 1G7UA 1S5TA 5C8BB 1O66A 2HISA 2PDQA 4UTHA 4RZ6A 1FWNA 4F66A 3U8GA 4DZ5A 4HMCA 4B90A 1H7RA 2AMXA 2Y89A 3VTRA 3WELA 4TUFA 2NLYA 4V1XA 4W7WA 1EC9A 4MYXA 3WZ0E 3IJLA 3DENA 3DFPA 4UTWA 4JR5A 4CCEA 2IKIA 4O53A 3SO7A 3IWPA 3GDKA 3OZPA 1Y65A 4Z2LA 3M0IA 4CLMA 2ZZ3A 1IE7C 4ALDA 2PLJA 1WOBA 2XG9A 4ZTYA 5HA7A 3T09A 1N2VA 3PF3A 1E0TA 4RE4A 1XLMA 5EKYA 3OGVA 1H62A 1ICSA 4D2JA 4AXNA 3QMRA 4ZOEA 3FA3A 2WCAA 1N8FA 4AG0A 1UASA 3BC9A 1WXZA 1A5NC 2XH0A 1BVNP 5K7JA 4B5XA 2ZXAA 1JDEA 3RO6A 3L4TA 3WDQA 3CMGA 4ZQOA 4ATDA 5C54A 1G5AA 3PBYA 4WJEA 3B0PA 4LBSA 4PMRA 4DPPA 1JXJA 2PSNA 2JKPA 1GZGA 3CO8A 1WAUA 3GIPA 4CD4A 2VI0A 4MNMA 3BAJA 3E5PA 3WEZA 3K2GA 4LV9A 3N9KA 3NG3A 4O10A 4RXGA 4GI6A 4AZGA 3E2RA 5DQPA 2D24A 2YW3A 1C8VA 1G4EA 2VQUA 2VEFA 2X1RA 4HK5A 9XIAA 1R3QA 3NM3A 1KFBA 5C70A 3KBJA 3HMCA 1OGSA 5T8GA 4X2PA 1BTCA 4CVUA 3HM7A 2Y61A 1H63A 2QMKA 1FDYA 2J79A 3WD0A 1NWUA 4PC8A 3BVJA 1EJ7L 4UFMA 4HD5A 1S5MA 3LTPA 5ABHA 5CZ0A 4Q32A 1FH9A 1XRFA 4ZQMA 2JK2A 1VJSA 3QKZA 1EOKA 4JPGA 4Q4SA 4HIBA 3HV8A 1ZHAA 4G56A 6CGTA 4Z2KA 1F3WA 5C9ZA 4EACA 3U4FA 3R58A 4LAUA 4NZJA 2DV0A 3VD9A 1MRQA 4XUGA 2Y63A 3BCDA 3VNMA 1VHNA 1F05A 4XAFA 4UUIA 4D8AA 3EZ4A 2WC3A 1E6RA 1A3XA 2I17A 1ZU8A 3AIUA 4U33A 4K39A 1XIGA 2PDGA 4B5SA 4U4MA 2BGSA 1C9WA 3FHQA 4JCMA 3TE9A 4JL2A 4XBSA 2PRHA 3BLFA 2J8FA 4DPQA 1OT2A 3N1AA 2NVAA 1GW9A 3PZOA 1LLWA 3EWWA 4X3ZA 3CQ0A 1HKKA 3EWXA 4JHOA 3W7MA 3W7DA 1TVPA 1R85A 5I78A 1J18A 3OZYA 1CGYA 1DWHM 1WXJA 1MRAA 4S2CA 4W86A 3VUSA 3WBAA 1TMLA 1H7NA 1ONXA 2NUYA 3M9YA 1XM3A 3AYRA 3ZFHA 5E70A 2E25A 1F3EA 3E0VA 1A4MA 1ONRA 4O13A 1DKWA 1QVBA 3VCNA 4Q8VA 5I24A 4PTVA 3B4YA 2Y7DA 3U7BA 3UZWA 2NX3A 4JFSA 2DUZA 2QULA 4O16A 3LI0A 3QN3A 3CS2A 5FL0A 5A95A 2YCJA 4LTSA 3VVGA 2ON3A 5HR7A 3TLQA 3LZ5A 1KLYA 1TWDA 5G2HA 2IXUA 4CEUC 3GR8A 5D8ZA 3BMXA 1NEYA 4GIAA 1P0DA 4UOZA 4DHGA 3E0IA 3ITGA 3LI1A 4MIMA 2XH2A 3AMDA 1KO0A 3MQTA 5FF4A 4OHQA 2E77A 3W1UA 1YNQA 4E8GA 2EKGA 5GJNA 3KAOA 1DTUA 2P0IA 1OCNA 3EEGA 2BZNA 3MP5A 3PC0A 2XIBA 2GVJA 4LNCA 3PNZA 3NSXA 2EGZA 4Y7EA 2HBVA 2A1YA 5H2ZA 5DN1A 4K38A 4JQAA 3P93A 3MTWA 1K03A 3UP8A 3CH0A 5A6TC 1BHGA 2WVVB 4M8UA 1G9HA 1S2UA 1XH2A 1ZBKA 1F8IA 3NSMA 1WDRA 4FPSA 1RD6A 4O4WA 3POCA 3L2IA 1AH4A 2XGZA 9RUBA 3S2LA 2GZXA 2VC7A 2BXZA 1DHPA 3TN6A 4ATWA 5A8GA 1K7XA 2CIPA 2PWUA 2XSXA 4JD4A 4OUEA 3WQDA 4AZHA 1MW1A 2ZC1A 3GE7A 4X0NA 4G6CA 1A53A 2XVKA 1P7TB 3PSVA 4WLCA 4JTJA 5AYXA 1S3TC 1XXXA 3N9SA 2PA6A 3VMOA 4IP4A 1QNRA 5A5WA 3CYVA 5KEZA 1CXLA 3P5ZA 3OU8A 2PP1A 2Q8LA 3M0LA 3NOEA 3SFWA 4LEFA 3R7MA 2REQB 1S3HA 2JE8A 3AWOA 3M6DA 3DHPA 4PODA 3BMVA 4PRWA 4FXFA 1H1YA 3NDZA 2W61A 3EX2A 3WLTA 4DIAA 3UNTA 1K4HA 1HJVA 1TPC1 1J0ZA 3B9EA 3CT7A 1V3IA 3MUXA 2FZNA 4S3JA 2ZA1A 3HBLA 3SCTA 2H8ZA 4ZCWA 2DT2A 5KZEA 2EPLX 2NUXA 5EMLA 3AMLA 3PUDA 5TD4A 3TDFA 5FAGA 3WLPA 4FR1A 4HNTA 4FSAA 4DJED 2WNNA 2EBNA 2IPWA 5RUBA 5E6YA 3WENA 1SQ7A 2NQ9A 3VYLA 2OG9A 1KFKA 5JVLA 1AMYA 4JX5A 1FHVA 2CBJA 2ZRVA 5BWAA 4QJ1A 3WUEA 1E1CA 4E8CA 4YMZA 2R91A 4BF7A 5A2BA 4C7DA 5DMLA 3R0DA 4AISA 3A3HA 1E6XM 4C1LA 3I3EA 3H2CA 1ZJAA 4A3RA 3O7UA 4GO8A 5AKQA 4Q8PA 5AHNA 1ZSXA 4AMAA 1XYFA 4K36A 2PBOA 3EDKA 4CQCA 1JIBA 2QLYA 3ZWSA 4HPHA 2BP1A 2ZRZA 3LZ3A 4D6EA 5LNSA 1PDYA 4UCGA 3GXNA 1CXEA 3LB0A 1PWLA 1PX4A 1V7YA 3VDAA 2DVUA 1Q6QA 4AH7A 3ERPA 1ZPTA 3S0CA 4G7EB 3MW7A 3I6EA 2QT3A 5DX7A 3D5HA 2REQA 3G0SA 3R13A 4YTTA 4UTWC 3MPGA 5K3VA 2D0GA 4M7SA 1E51A 4ORIA 5F2MA 2NW0A 2ATMA 3B8IA 4EPDC 2A6LA 3PWIA 1A5LC 4MZ8A 5AYYA 1H61A 3KP1A 1EDQA 1Z69A 4AZIA 1LJYA 1MQQA 2IKJA 2H9AB 2FPVA 2C3ZA 3P8JA 1HTIA 1PKYA 3RCNA 3CC1A 4R33A 3FCPA 4UR7A 1AH3A 3AYSA 3GY1A 4C6KA 3VAVA 3HPAA 1R8LA 2GGIA 3TYZA 2CHRA 3WIJA 4AVNA 3CQKA 1T7LA 1V51A 4QQ3A 4UMAA 3AOFA 4E2DA 4ZODA 4PTWA 1WOAA 1C93A 2RDUA 2WJZA 4EF9A 4NF7A 4H6KA 1V0NA 3MVIA 5IHRA 1XYLA 2P3EA 4P8XA 2QMJA 4I3GA 2RAGA 2YCIX 5I03A 1Q85A 4WY0B 3TUUA 2WKLA 2AMGA 4DBWA 2X30A 1RLCL 3CEUA 2EAWA 1NDZA 1DQUA 1D3HA 1QW9A 3OA5A 4MF4A 2B7QA 1JCTA 3U48A 2ZXQA 4UFKA 2PB1A 1E9IA 4G7EA 2GSHA 1LP6A 1L2QA 2HPMA 5E0CA 3TONA 4PCSA 1DJIA 2YXGA 3WF1A 3WLKX 3KWSA 2X0YA 1ZCOA 3WQGA 1A0CA 1C90A 3C3UA 5D03A 1GOMA 5M1TA 3TYBA 2DSWA 1IXNA 4O12A 4ZGYA 4DJDA 4JTSA 2DZBA 2F8QA 4RV8A 2NWRA 2H9AA 3VOIA 4MZYA 4AAJA 1SFJA 4W7VA 4Z2IA 5ABEA 1JDCA 4H8VA 1VFLA 3D3FA 3AICA 4R7JA 3ITTA 4D71A 1UR2A 1PBGA 1VIZA 3UNDA 1CEOA 4GD0A 1IHIA 1LF1A 5ABGA 9CGTA 1OFBA 2J7GA 3OZOA 3ZOAA 1DJWA 2FVMA 4R34A 3PNUA 5DMNA 3W37A 1EKOA 2E1WA 4PUJA 3ATYA 1UR4A 4NNAA 3A13A 3M16A 3A9IA 4XZNX 2FPYA 1JCLA 1POJA 2WSQA 1GK8A 1DEDA 1QNSA 4HNCA 3M5VA 3V4BA 1BYAA 3DFHA 1KW1A 2Z2UA 5CGTA 1ZB5A 5EGRA 1IWPA 1YKWA 3K1DA 4J3ZA 1FWJC 1FUYA 3NPXA 4TQTA 5ECUA 4MFDA 3ABRA 2PGWA 1IGSA 1FWEC 2P88A 3A6OA 2XWEA 2PAJA 1CW2A 4AHOA 4B5WA 3LCFA 3RYSA 5KITA 3LHUA 1QASA 3TC6A 1Q8AA 2VMFA 5D9MA 1EPVA 2Q8ZA 2X41A 1OY0A 1ADOA 1QWKA 2CLOA 4RKAA 1CPUA 3UESA 3GNPA 4M29A 1IT8A 1AJ0A 3WQFA 1F4AA 3NQ8A 1RUSA 1MVYA 1RJPA 1SO4A 1CGXA 4DB7A 3PTDA 3B8DA 3MVTA 1GNXA 2YXOA 5DXYA 3WQ8A 2QUTA 3L0KA 2OZ0A 4GH1A 1XR2A 3G1FA 1J9YA 1XGDA 3OVRA 2C79A 2J77A 5CZJA 3FYPA 4WDTA 1KV5A 4U5KA 2NV9A 1C3FA 5K2ZA 3I7QA 5AHIA 3ZSSA 4U31A 2XGBA 2VGBA 3IGSA 3WD2A 1EJUC 4JFUA 5K9DA 1M65A 3RPMA 3LUTA 2YGYA 1VFOA 1KCZA 3NO5A 4D6FA 3A4JA 3GKAA 4F79A 3IK2A 1K1DA 1SR0A 4YHEA 5CLWA 4UR8A 3UJEA 1EOMA 4PL2A 2IQTA 4AIOA 3IAPA 4MDOA 4P7LA 1B2YA 4GFSA 4LAZA 4GQ0A 4GBUA 1ZP3A 4Y96A 1HGYA 1S5WA 3PS7A 4EWND 2XFYA 5DBTA 3VXGA 2D2HA 4JTIA 1DBTA 3Q2DA 3LGEA 1G4TA 1X8FA 3TN5A 2YFOA 5JUVA 5M3WA 5E0KA 1PAMA 3NTYA 3EKLA 4C6EA 1IR1A 3NPWA 2G3NA 1H60A 2E9MA 5BROA 3CQJA 1ONEA 2FYMA 3VNDA 1VFTA 1W3NA 3GYEA 1CI1A 3VINA 1IGWA 3KVMA 1OX4B 2A3LA 3I10A 5G2WA 2WMHA 3IJIA 4UQDA 2CNCA 4FX6M 3PJTA 2VC9A 3B0UX 4MOZA 4LGXA 5G2IA 2YZ5A 4PMJA 1E1EA 2FGZA 3GXMA 3BLDA 3EWDA 4L5ZA 4O52A 2QDEA 4ZXOA 4V27A 4ACYA 4MAZA 3NZQA 1SSGA 2F7FA 2QV5A 2QUMA 3OIXA 3VA8A 5CPQA 1ECQA 2EEXA 4PMXA 3MUZ1 3URBA 1E6QM 2VFFA 4CU6A 3E2SA 4GUJA 4OTKA 1U5VA 3MYOA 5MKGB 4LV4A 3CV6A 4XZLX 2D0HA 1P0BA 1S2TA 5MHBA 4I5XA 1S38A 3TYDA 2FB3A 2PDJA 3DHDA 1XD1A 5CAHA 4GPNA 1X98A 2IXVA 3CLMA 3WDPP 1G01A 2WO5A 3LY0A 3VO0A 3DH7A 1S2AA 1WZLA 3T8QA 3RU8X 3QBUA 4L4LA 4UMCA 4G7FA 5D05A 1XLJA 3KOWA 4CN4A 2PLKA 3H24A 5HJXA 4OVXA 2QXWA 2CITA 3I68A 1KRBC 5EMJA 1M53A 2OOFA 1VEMA 3GNDA 1MW3A 2ACQA 4HNNA 2B7NA 3GTNA 1UR1A 5J5DA 3PZMA 4A6GA 1KC7A 2P50A 4H9YA 4DYJA 4B92A 4KWWA 4Q8NA 5AVNA 3G6MA 3VKDA 4BZYA 1I0BA 3WDIA 3SSJA 1AVAA 3H12A 3MKKA 4KERA 1WZMA 1HFBA 1U1UA 2Y8VA 1HKMA 1XCWA 3EDJA 4HCHA 4WXZA 1DIEA 2HK0A 4XZHA 5BMWA 2J7HA 4QR6A 3M64A 4M6QA 1D3CA 5T91A 4EK7A 1IF2A 4UTKA 4LSBA 2J75A 3IUDA 3NQAA 4DN1A 2NUWA 3KP0A 7ENLA 2DW6A 2PODA 3ZMRA 3AALA 3CZEA 5MKGA 3WLHA 1QTWA 5TBOA 4B15A 3OLDA 3MO4A 3P3BA 1ICQA 3IIPA 1GVYA 3CHEA 1UPPA 3MCOA 4DYEA 4N9DA 4B2DA 4IIEA 1LQ0A 3NVDA 3OBKA 3STEA 3DX5A 3BTNA 4HT3A 4RX0A 2QDHA 2R1LA 3OA3A 4RDYA 3TXZA 4WSKA 1LORA 1F6YA 1LRTA 2DUXA 1VJIA 3GDLA 4HBKA 4W7UA 1HL8A 3TXVA 4LRTA 3V5OA 2X1SA 4HPNA 4JHMA 4EVZA 4N6EA 5BU9A 3M6YA 4POCA 1ZRQA 4DLFA 3GTXA 4DJDC 4WCJA 5LGXA 3SN0A 1YDOA 1BGAA 3GD6A 5M2FX 3G1RA 4LYKA 2B7PA 3WBXA 4WD0A 1E6ZA 2ATSA 4ROPA 5C2GA 4Y2WA 4HZMA 1R3VA 3G1YA 3UR2A 1EB3A 4M0XA 4WKAA 5D8WA 5I6SA 1FWHC 2CHNA 1QCWA 4YLWA 4W4QA 2GVLA 1X96A 2PMQA 2JALA 3A4AA 3NOYA 5E0FA 1KXHA 1Y5VA 3TZFA 4OT7A 3GBDA 3MSDA 1VB9A 1Z3NA 2PDIA 1XBYA 1FWWA 3T0DA 3BARA 1NFGA 3C2YA 3JS3A 3WH9A 1JD7A 1UP0A 4H2HA 4IG2B 1YE4A 3G3DA 4O19A 2C16A 4F0MA 2JIWA 5K9CA 1B4KA 4OIFA 2WJDA 4MKSA 1DOSA 1LUCB 3N2XA 3TV8A 2XSBA 3ARPA 3SN4A 1JZ8A 4KPLA 3TW9A 1JCNA 2FTYA 3W7QA 1H49A 3BDKA 5B7YA 5HWJA 1KBJA 5XINA 3B97A 4A3YA 2ONEA 1AL7A 4TIMA 5I3JA 3EXTA 1HIZA 2VURA 5BMXA 3NQFA 1YPFA 3B8WA 3EXRA 4S39A 3VIGA 3WQCA 3VMPA 3UJFA 3SEPA 4AB4A 3SUTA 1JD9A 4JZ5A 5D09A 3B0XA 5I2UA 1UYQA 3VD7A 3BV7A 1XYCA 2XH7A 5HXMA 1TUXA 1N7KA 2WC7A 3C2FA 4HU0A 3LHVA 1TJPA 1PZ1A 1TPH1 3EXSA 2GQ3A 2BNJA 2DZSA 2VNCA 3BANA 3PVFA 2HV5A 4GC3A 2BVYA 2Z6IA 4NJKA 5E93A 1QJWA 1XWYA 4KCVA 3GX9A 4UFLA 1R87A 2OXNA 1AG1O 3NUKA 3N3MA 2NZLA 2QPUA 5HPCA 1U5JA 4IT1A 1GKQA 3DBPA 1VBGA 2X1IA 5M17A 2V5JA 2OQHA 3QPYA 3LCXA 2PTYA 2G41A 3WLNA 4RE2A 4R27A 4IG2A 4Q8QA 3V7PA 4FNRA 1GPWA 1XLDA 1IWAA 3BAWA 3VOFA 4QG9A 4KW2A 3GFZA 4N02A 3EPOA 1SO6A 2V6AA 3FYYA 3W2KA 1K9DA 3WD4A 1JL8A 1R9XA 1LM1A 3N25A 5LHFA 1SMAA 4BKNA 2VGGA 3UZ5A 4LANA 2OWXA 2XIIA 5FF2A 5DEZA 1OWQA 4NZCA 3OJGA 1QOXA 5FJIA 2HVOA 3Q45A 4GUIA 2ZXBA 4G9PA 4E2OA 2CXEA 2Z0IA 1P0NA 3DI1A 1PKLA 3WMBA 2ZRYA 3KVLA 1Q6EA 3LHTA 4IGMA 4LBRA 2QW5A 4H04A 4IJBA 3R2GA 1WO2A 2PBGA 4Z2GA 1RP9A 5F2GA 3IGUA 3HQPA 5L6UA 3W76A 5EPDA 3AAMA 2D73A 4KFNA 4GI8A 1IEQA 1QNPA 2TPSA 2RJHA 1KR0A 8CGTA 1B3YA 1MUMA 5CJ5A 1S46A 1YHTA 4CGTA 3Q58A 1YIXA 5F1UA 5PTDA 4B5TA 3QYQA 1UZDA 3QSRA 2CWXA 2QHAA 2R82A 3B03A 3VILA 5C55A 1QW7A 1BKHA 4GVHA 1X8CA 1IZKA 3PTKA 3VMNA 4F9JA 3I6RA 3DFNA 3KLKA 3UZZA 2C13A 4KBXA 1JDDA 2OWCA 4JFVA 2HBXA 4UB9A 3WH8A 1C7TA 3W7OA 1RCXB 3MWCA 3QV9A 3V36A 4GNJA 3Q37A 2WMJA 3KBNA 3ZVHB 2FKPA 3O8AA 1H51A 4XZWA 5I23A 3HIJA 2WZEA 3HJEA 3HGRA 3W71A 4MWAC 2E09A 2ZZ7A 3DGRA 1VFMA 3AO0A 3CB3A 3VGBA 3NZPA 2OCZA 4NX0A 3UF9A 5M03A 1A0DA 5G1MA 1ESWA 2ZZ1A 3LPGA 4J35A 1EGMA 4ZSUA 1RK5A 2BV9A 3BMWA 3ZWTA 3T55A 3W1LA 4PMYA 4XWUA 4AIBA 1L8PA 2Y62A 5HJLA 3WLOA 4H7ZA 1GVRA 1GOXA 1MI3A 1S2VA 2SFPA 2YPIA 4OECA 4YXGA 1SPQA 1TVNA 4NI8A 1ZAJA 1TPUA 4JTAA 4QSHA 1L6GA 3GZ3A 3SADA 3LSCA 1A0EA 4JX4A 4S3DA 2WWCA 4PL1A 2BY0A 2GL5A 3ITVA 2GJXA 3IGXA 1OFOA 2PTWA 3O0KA 5CC5A 2AGKA 5D9OA 3EDDA 5HNNA 5A6JA 4Z0JA 1S2CA 4PCTA 1DJGA 1KM0A 2BS9A 4NU7A 5AOUA 2OT1A 3N9RA 3E2VA 3W38A 1BGGA 3MI2A 5AHMA 3VX1A 2AL1A 4YVVA 3AISA 1EJTC 2XYLA 3W1XA 8XIMA 4QRNA 3N6QA 1BFNA 1O1ZA 3EWCA 3UEQA 3L4WA 3DG7A 3V1HA 3W7LA 2R1NA 3HU7A 4Z1AA 5JIPA 2YYUA 4PUUA 4ZXLA 5LIXX 1JFXA 3SGZA 3B06A 5FSEC 1VFUA 3W7NA 1J2BA 3ZVHA 1EP3A 3C52A 3BWWA 3UR5A 1F4HA 1PB0A 2WSKA 1WZKA 3SSZA 1L2UA 4W84A 2BHYA 1ODUA 3ABSA 3GRIA 2C1GA 3EX3A 1J96A 4JTFA 3V0SA 1FY6A 4HB7A 4Q4RA 1H0IA 1VQTA 4MM1A 4LVAA 1E9LA 2GDUA 4US5D 2FZMA 1R9ZA 4X2RA 1UA7A 2XJ7A 3KE0A 2X0SA 4M6VA 2QIIA 3FS2A 1BXBA 3P84A 1A5SA 1AJ2A 3O63A 2OEKA 1YNPA 1ME9A 2ZICA 4IUGA 4GINA 3N29A 1OFDA 4ZSTA 4FA3A 3V16A 1HKJA 1UQZA 3H23A 1TR1A 2D1ZA 3WY1A 4BK9A 1JF6A 2FB2A 1PIGA 1Q5MA 4HHPA 5TNVA 1MMFA 1UWSA 1SW7A 1J2WA 5GNZA 1AZ1A 1OB0A 2AAMA 1NH6A 1D7KA 2OEJA 1V8EA 3TLLA 2XVNA 1O95A 1XLIA 3S1VA 2PDFA 4L9YA 1A5KC 1R7AA 3TR9A 4C6PA 3WJXA 2ODOA 4HYRA 1CDGA 1TRDA 1EF3A 1FDZA 2X09A 3DYOA 2QCHA 1OK6A 3OO2A 2ASHA 2PRLA 3BG9A 4EIVA 1EIBA 4C91A 4JIQA 3VD3A 3XINA 1XQKA 3MANA 5CKSA 1DQXA 2W91A 2FVKA 1W31A 3AYTA 5FI8A 2PF8A 3LERA 3B04A 5A6LA 3REQA 1F9CA 4YTRA 1IWBA 2L5HA 3L68A 4QLKA 4CVWA 1W3IA 4LVBA 2F6XA 3RMJA 4A8IA 1KM1A 5AYBA 1XSJA 2WCGA 5I07A 3H7UA 3QMSA 3LYEA 2ZX5A 3WK3A 3UPBA 2CETA 1RXOB 2FH6A 4AY1A 1DE5A 3MDWA 3HQOA 3IK4A 2CEQA 1EH9A 1OBAA 4S3FA 4C7GA 3W81A 4J2PA 4OBRA 1FH8A 3OGRA 3T4CA 1BYDA 3A5VA 1ZBCA 4UTIA 2P1FA 4H9MA 3LHYA 4E4PA 2HS8A 2Z1BA 1IZCA 1CT5A 1Q65A 3M0XA 3ALGA 1O60A 1H7WA 3GVGA 5EMKA 4BHYA 4R3UA 4TMBA 1UD4A 2A7RA 2E6YA 3SUSA 2OSWA 3FFSA 3G77A 3UERA 1TREA 4LY4A 4NAFB 1R9YA 3S47A 4KH2A 2YB4A 3G3MA 7PTDA 1K8YA 3SRHA 1OHLA 2YCKX 5LKYA 1PZ0A 3ZZ1A 1M41A 5DT5A 2ADAA 4P8UA 4LY8A 2Y1HA 4ZBCA 4JOMA 4MDPA 1WKYA 3WO8A 3GDRA 2DU2A 2QAPA 1F3TA 4O1FA 1OC7A 1QPQA 4GJIA 4A3QA 3BAKA 3FW6A 2VCBA 3MT1A 1K7EA 5TAOA 3RPDA 4WX2A 3SUVA 2IKHA 3L4UA 3QTPA 3UR7A 4LS1A 4PRRA 3UCDA 2W62A 4ONVA 3SAZA 3CLWA 4JYFA 3R8GA 3DFSA 2VXNA 1JCYA 4XSLA 2NQJA 4K7YA 4ZR8A 2WMIB 1I2RA 3AZRA 4NQ1A 4WDWA 3AWNA 4RK8A 1JYVA 2WK2A 3GM8A 4AWUA 4JN6A 4HNVA 4PTXA 2DEPA 3N12A 3G1AA 3MU7A 4QP0A 4AUBA 1OK4A 3QV8A 2VX4A 4TVCA 3KS6A 2BASA 3IVUA 3EAUA 4Q8MA 2XN2A 3RG6A 4O17A 4JNYA 1EO7A 3L5AA 1BRLB 4LS0A 2MUCA 4MTVA 3CWNA 4B3LA 4DAFA 1T8XA 2WKJA 3PZQA 2A7NA 3LM3A 4ZENA 3N3TA 3GFXA 3EEZA 1RY8A 2WWDA 2GVYA 1U5HA 2XH4A 1LBLA 1T6MA 3H22A 1F8MA 3WK1A 3KWXA 4GUGA 1UBPC 1UA3A 1LT8A 1TTQA 2W9MA 4WF7A 5EFDA 4IQDA 1PVNA 3WQPA 1O68A 4QITA 1P6WA 1UWTA 1W1ZA 3CTLA 1XX1A 3ARYA 4FX7A 3ZJ8A 4XUYA 2R1PA 2J25A 1F07A 3EWBX 1E71M 4UNIA 4AIEA 1YTDA 4QTGA 3HO8A 1FFQA 4MAVA 1WB0A 3RHGA 3HG2A 3QR0A 4IQLA 2WNZA 3E0LA 3U2OA 2VZTA 2VL4A 4LNYA 2FZ8A 5DF0A 1TPFA 3OLEA 1EGZA 4GXPA 4PMVA 3HQNA 5IBXA 4ACZA 4YPJA 1MXSA 1ITUA 5AVHA 3TQKA 1XLKA 3BXWA 5JU6A 3WLSA 1DYSA 1NIUA 1P48A 3G18A 3WEOA 2WMIA 1EJWC 3H2AA 2PWEA 3VD4A 2GVGA 2Q02A 2PLMA 4L1XA 1VYPX 2OMAA 3QHOA 1JZ7A 1ZS2A 3E49A 4RXFA 3APTA 3LPFA 3RLVA 3LNMA 1U30A 1KBLA 4Q4OA 5KZ6A 1V5XA 1UP2A 3SECA 4UWMA 2OODA 2X1UA 1YDVA 5A3HA 4NYUA 2UY2A 4O1DA 1TWZA 1UC5A 1YX1A 4LUIA 7A3HA 1BRLA 1I2OA 3BSHA 2DJXA 3WJZA 2DSKA 2C19A 1UMYA 4M81A 3THQA 1Q4NX 2YX0A 4O4VA 3W7CA 2VHLA 1FOBA 1JZ4A 4YCPA 2NSXA 2E6AA 4O1EA 3I7RA 2CZVA 1SFTA 2XIJA 4LVGA 1JZ2A 2V67A 1W3HA 4H8NA 4GLEA 2OYLA 3MBDA 3PTQA 5FSDC 4LEQA 2J24A 4B4FA 4HNUA 2UBPC 2V3EA 2Z2BA 3W53A 2Y5EA 1IEWA 1UG6A 2EJAA 4KRTA 5A69A 4UTTA 2Y5SA 2GGHA 3W85A 1KB3A 4EANA 3EA1A 1RR2A 4AHQA 1FCUA 1W3TA 1K8XA 1J0KA 3L5LA 4FXRA 3SCSA 3CYJA 2ICSA 1KFWA 4GYPC 4CD5A 3UY8A 1XD0A 3LXAA 2QR6A 4V2XA 3GG1A 5AN7A 2EG6A 4F0KA 3T0CA 3W01A 3SCUA 1XKYA 4AYSA 3A47A 5EYWA 4QBXA 3F4WA 3CH9A 3VGGA 4JIHA 4ERAA 1QOPA 2FHFA 2WYSA 4HK6A 3RGTA 5CZTA 4CKQA 1ZY9A 1KQZA 1UZHA 2HE8A 4P7OA 1JYWA 1HGWA 1XRVA 3BSMA 4OFCA 3U6WA 3W1TA 3L4ZA 3GDTA 1G6CA 4O0ZA 1EUAA 4ZQRA 1W9UA 4N4PA 4Q33A 3WLJA 3GNRA 5DBUA 2YFNA 2ZFAA 2GOKA 4WZHA 3VOHA 3A4WA 2F6KA 1EZ2A 2E6DA 2W92A 5F7UA 3QZEA 5EU9A 4I9TA 5LGZA 3VOJA 3FJNA 1R6WA 3GH5A 1TJ1A 2GDQA 1NF7A 3XIMA 2CKSA 4BY3A 1F5ZA 3WN6A 1XLAA 2BGQA 4ML9A 3BW4A 3WF0A 2C18A 3U7VA 1EBGA 1JAEA 1G7VA 1Z44A 2FVLA 4GUFA 3THAA 2OELA 1AD1A 1V0KA 3W0KA 3OEXA 3ARTA 5T9CE 4DX3A 3K30A 4TX6A 1BYBA 3A21A 4ICCX 4PMUA 4DI9A 3C6CA 4N9EA 2ZRUA 3ZLFA 1F6KA 4GVGA 2QVNA 3LMZA 4DJFA 5BNKA 4Q7BA 1EYEA 3QQ0A 3SIZA 3THDA 1AL8A 1HO1A 1LOQA 3VI2A 1XGZA 2JKEA 1PL9A 2NQZA 3F7JA 1PO9A 1XICA 1D8WA 4MYAA 3DFOA 2OQYA 4LC6A 2C0HA 2UY3A 5LNRA 3Q94A 1J93A 3N2OA 1AZ2A 4ZOAA 3ANUA 4O57A 4KT2A 2FMOA 2PUZA 2DIKA 4MB5A 3QM3A 3IIVA 2Q3RA 2WPGA 1FDJA 1UJPA 4HA3A 4XX6A 4DBSA 3ZLGA 1E3XA 5AHEA 2TODA 8A3HA 1RV8A 1XIIA 2OTDA 9XIMA 5ABFB 1VENA 1UR9A 1PKMA 4N6FA 1DXFA 3IPWA 4D8ZA 2NT0A 2B4GA 1E4NA 3LPPA 5IM51 3DZ1A 3C2VA 3FXYA 3CHVA 2G3IA 1TSIA 4S1FA 2QJJA 1U1HA 5FJOA 4KWSA 3EOSA 1QI3A 4FALA 3R8HA 3INPA 1HKIA 4JS3A 1KA9F 4IX0A 5AC7A 2HSAA 3UT0A 3OODA 1E0UA 3V35A 1BF6A 1E0VA 3MS8A 3AIBA 3U2EA 4MJ4A 3BH4A 3LXCA 3KL0A 2F9RA 1ZQ5A 2JF7A 3U4AA 3IANA 3SUWA 1UR3M 5BU6A 2FZBA 3B0YA 4J3VA 3S2NA 1NQ6A 4HMDA 1I0DA 2E68A 5BWFA 2ZX7A 4R88A 1PPIA 2QUNA 7ODCA 4DWSA 3AJ7A 1TJRA 5I77A 4IH3A 2E28A 3C8NA 3SFKA 1H41A 3B0VC 2W79A 5BCAA 1FCBA 1FFRA 2WSRA 1ADDA 2BVDA 2XIMA 1RPKA 4BQ2A 3TQPA 3BGJA 4M6UA 1TV7A 1TX0A 4WUIA 4Q7NA 4GIRA 3SY1A 4EWJA 1V77A 1XLLA 3CU2A 4FF5A 4N4QA 1E3ZA 1US3A 2V68A 4PE8A 1DJQA 3R89A 4GKTA 4WGHA 2OOGA 2VENA 3N4AA 4URIA 5HPOA 1E0XA 1E0WA 6REQA 3CL7A 4ZO9A 5ABFA 3GR4A 3S5NA 2H8XA 1O5XA 4MKVA 2OX1A 2Z1KA 5AC4A 4ZA0A 3T78A 4FX8A 1VCVA 3CZKA 1UPMB 4JTEA 5H1WA 5FIPA 4TTUA 2VC5A 1R2SA 5JBDA 4PN2A 1XIFA 3VGDA 3K1GA 4CD8A 3GQYA 4ROQA 3GSMA 5DRCA 4AF0B 1FRBA 3CO4A 4YU1A 2Y7EA 1ITQA 3FAWA 1JI2A 5BRPA 3STCA 4FNSA 4NNCA 2XU2A 5A8OA 2G3MA 2YOCA 3TJLA 1GG0A 1SO3A 3R94A 3T2OA 2GQAA 1KBBA 3WJYA 3WL0A 4MJZA 5D37A 4HSOA 1LLOA 3H7VA 5KSWA 4K1GA 4JNZA 3W75A 4NRRA 4QEEA 2PFHA 4BWLA 2QNEA 2TRSA 4BFAA 2HROA 1NWTA 3CUHA 4Q3MA 2O92A 4V15A 1WV2A 3GAYA 4QIUA 3QHNA 2IPGA 4WY0F 3OLIA 3LTYA 4EF8A 3VIHA 3UXLA 5F2IA 3ME3A 4H8HA 3UGVA 1AH0A 2OYKA 3VIJA 3PBVA 1MO0A 4BF5A 1TZZA 3LCGA 4IXHA 5GPRA 5A6MA 1B9BA 3BZGA 2P10A 4L64A 4OKDA 4KEVA 1HJXA 4YTUA 1UZ4A 1KCKA 4YL2A 1SR9A 3PPHA 3H55A 1R46A 4E3VA 3ZXWA 1JJKA 3WF3A 3POHA 3NPVA 2BXYA 3LQLA 1V79A 5AY7A 4EOUA 4MVAA 1VBUA 1IYXA 3UG5A 4L61A 4PMDA 1Q8JA 1GOQA 3BUVA 1OCBA 1VYSX 2V5BA 3LXBA 3CWHA 3GVVA 2W66A 5HWNA 3WL1A 4UTFA 1GJPA 3VNKA 2IW0A 1FKWA 4AF0A 4DRSA 4C1NB 5FKYA 4ZO7A 1GONA