1C8YA

Endo-beta-n-acetylglucosaminidase h, d130a mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFADEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
total genus 91
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c8yA00
2A3CA 1JFHA 5FL1A 4D6FA 1D7FA 2E8YA 3PZMA 3WUBA 2XWEA 3SCUA 4P7OA 1V3MA 4CN4A 3MMDA 2XVPA 3T0BA 1WCGA 4D6IA 1E56A 2WCGA 5GNXA 2ZX6A 1RP8A 2XWDA 1UD3A 3W6LA 2WHJA 3DYPA 4LX4A 3AS0A 3VMPA 1EHNA 1KXHA 2VMFA 3BXWA 1V6WA 2CCRA 3WY1A 3ZR6A 4D6CA 4CD8A 3DHPA 5HPOA 1PBGA 1OGBA 2WVTA 4NI3A 3AFBA 3POCA 2CNCA 4FLRA 3VDHA 4QLKA 3CUFA 2EBNA 3IJ9A 4MJ4A 4TTUA 1OGSA 1V03A 2VVSA 3VX1A 3VPLA 1TG7A 3WF1A 5JUVA 3I3DA 3PZOA 2D2OA 1HT6A 1JNEA 4HOZA 4UQCA 2XVKA 3FHQA 4QFUA 1HL8A 4KWUA 2JEQA 5EFFA 4NF7A 1C3FA 3E1F1 4P8WA 3SCTA 2WPGA 3F5LA 2UY4A 3MMWA 4PUEA 4YN5A 1A47A 2QF8A 2DSUA 1K9TA 3VTRA 3GNRA 1ZS2A 2G41A 4MNLA 3MANA 1CEOA 1GQLA 4F9JA 1BTCA 2OYMA 1IV8A 3A4AA 3FN9A 3TOPA 3W28A 1GPFA 1HNYA 3BAWA 2DSZA 1W1YA 5FIPA 2RGLA 1OT1A 1H11A 5A94A 1VFMA 3AIVA 1V3IA 3RCNA 5JIWA 2YA0A 4J3VA 2ZXDA 1KGXA 3F5JA 3HMCA 2GFTA 2FHBA 2ZUSA 4AIUA 1RH9A 3ARTA 2YDRA 1WDSA 2VT0A 5I79A 2VX4A 4OKDA 5A2BA 3NSMA 3RO8A 1KGWA 5CPTA 4JHZA 3AMCA 2VX5A 2BHYA 1V3JA 1W3LA 4M29A 1MW2A 2GJXB 1OD8A 5E9AA 2J47A 2J74A 3AMKA 1HP4A 2CHOA 5DF0A 1UZ1A 4BF7A 1E72M 2OSWA 3WN6A 4GPNA 4AZHA 1E9LA 3OGRA 4Z2LA 1H1NA 2NT1A 3FNDA 2WCSA 3TTSA 3ZJ8A 4YPJA 3PTQA 3D3AA 4KMQA 3GM8A 2WMFA 2OSXA 2YLLA 2ZUWA 2V3GA 1J10A 2BY0A 1UH2A 3DHUA 2QLYA 1SMAA 3K46A 1ISVA 3WD0A 4PMDA 4JFSA 4U5IA 3RM4A 1U2YA 2XVNA 3MSGA 4JCLA 2F61A 1FFQA 2CIPA 3WDIA 4XB3A 2VOTA 3IJ8A 1QI4A 1XSJA 3NCOA 1W9VA 1MW3A 1GHRA 1K9EA 2CERA 2JIWA 4LYPA 3VGHA 4AZGA 2O9RA 3EBVA 3N13A 5JBFA 2WVSA 1V0NA 5EFDA 3VD3A 1GOQA 2JF6A 3CHCA 4GINA 3SCOA 4OOUA 4JZ5A 2VZTA 2YA1A 2OSYA 4UNIA 2CHNA 1XH1A 4B16A 3K8MA 2BS9A 1GJWA 4HA3A 2E9BA 3KZSA 2PWDA 1WAWA 2ESCA 5HBFA 1OB0A 5I23A 3RDKA 5JBDA 1V0KA 3WD3A 3MUAA 2FH8A 2WMKA 3ZSSA 4W8AA 1V6XA 1MXDA 2YDSA 2Y8KA 3RM9A 2E8ZA 2W91A 1ZBVA 3WEOA 1JIBA 4J3SA 2ZE0A 3B9DA 5E6ZA 4AYSA 1EQPA 1KXTA 3CBWA 4QP0A 5BCAA 1E0WA 2YJQA 1V3KA 2CBJA 1W9BM 1PIFA 4HA1A 2A3EA 4GZJA 1W3HA 1UKQA 3PZTA 1I75A 3WL1A 4MB4A 1QBAA 4AEFA 4UOZA 1UWIA 3VIMA 4AZCA 2XUCA 4WIWA 2VR5A 3PTMA 3RMEA 4U31A 4MDPA 4UR9A 2XIIA 2WMIA 4UCFA 3MUIA 1B1YA 1QHZA 1TCMA 2WANA 2J7EA 2VTFA 4B9YA 4AY1A 4IPLA 2Y24A 4WF7A 1E71M 1H3GA 4C7FA 3AZSA 1EO5A 1QHPA 1YQ2A 1UQYA 4D72A 1MQPA 4GI9A 1GOMA 5JBEA 2DQXA 5D9NA 3VKKA 2UY5A 3PTKA 1VFOA 4D6JA 4Z2JA 1BPLB 3BMWA 1CTNA 5BRPA 3CHFA 5I3DA 4JFUA 6TAAA 3CUJA 1K6AA 4M82A 1D2KA 4PTVA 2D0FA 3AZTA 2WMJA 1BF2A 3DYMA 4AZBA 1ODUA 3NSNA 1NWRA 1OWQA 1DWAM 5LA0A 1C8QA 3T2OA 1X6NA 2WC4A 2GK1B 1CLVA 1B30A 4BQ5A 3W0KA 1E73M 2WHKA 4PUDA 4U2ZA 5BWFA 3SUSA 4BQ2A 1VEMA 2BHZA 5E70A 3VD5A 1DWHM 2XM2A 5A95A 2YIHA 5IFPA 3M07A 2WXDM 3T2QA 1NP0A 2PBOA 3WNOA 2ZWZA 1E6NA 3WSUA 3F5KA 4Q7NA 3ARQA 1XC6A 2VCCA 5HPCA 2GDUA 1JZ8A 2XM1A 4PTXA 4PSPA 3EMQA 3AHZA 1UKSA 3B9EA 1QI2A 2GK1A 3UG4A 2CETA 1J01A 1JI1A 2J25A 3LPOA 4Z2GA 3SCWA 1CXHA 1OGGA 5A6LA 2V3FA 3BH4A 1BSIA 4LQ1A 2WCAA 4UQDA 1E4NA 1BG9A 1ZJBA 2QMKA 4JKMA 1UR1A 3MUZ1 1GQKA 1WDRA 2XGIA 5AYIA 4AC1X 3GH7A 4UFIA 2V38A 3A4WA 1JDDA 1KB3A 2GJPA 3U57A 4A3HA 5ABFB 4XZWA 4HOXA 3VGDA 2ZX8A 2TAAA 2MANA 5BYWA 3PZVA 3KEHA 2YBUA 1WNOA 3TA9A 4AZ6A 3BLKA 3VINA 4CGTA 3OLEA 4UFKA 3VIJA 1NWUA 4DWSB 3W53A 3OZOA 5C71A 3QHNA 1SR0A 4V2XA 1E0XA 1ZL1A 4J28A 3N9KA 3EYPA 4JHOA 3IAQA 4PMQA 3G6MA 5A6JA 2DIEA 5FKYA 3W38A 2WM0A 1WZAA 3A3HA 2Y2WA 4AISA 1FP9A 1U30A 2W61A 3VIKA 2V3DA 1HJSA 1JI2A 1C91A 3AMGA 2OYLA 2C8NA 4OIFA 3OLIA 2VRKA 1EOMA 4IM4A 1GQIA 1ODZA 2JEPA 1NOUA 3WQWA 1X6LA 5EMYA 5CLWA 4ATWA 1GQJA 3VM7A 1EHAA 3T2PA 2PWEA 3KE0A 5F7UA 3RILA 3FY1A 3W26A 1HVXA 1FH7A 5EBAA 4UQEA 3U7VA 4JKLA 1CBGA 1CYGA 4FLQA 2WVVB 4TX8A 1JXJA 3CUHA 1G94A 3L4WA 3TTQA 1SFSA 3WEMA 1UWQA 2Y4SA 1W1PA 2C7FA 4F9DA 4ZEPA 1E6ZA 5A2AA 2JFEX 2UWFA 1CGYA 2BHUA 2NT0A 1J0JA 1PZ3A 2YL9A 5CPSA 2YL5A 1XH0A 4P7RA 1UOKA 3VGFA 1GONA 4EE9A 3OLGA 1XRVA 3CH9A 4WK9A 4B3KA 5I5RA 1QNRA 4W8LA 1JL8A 4PTWA 3SUTA 5AC4A 1I1WA 2F2HA 3GXIA 3VDAA 5A69A 1CECA 1PEZA 1G0CA 1X1NA 3GTNA 2A3BA 1E4LA 1VFFA 3WDJA 1V02E 1UKOA 1H0IA 3HU7A 2BXYA 1UD6A 2V5CA 1JAKA 3O2LA 5A6KA 1HVQA 4ZXOA 5IXEA 3T09A 1UR4A 1KQZA 2QMJA 3K8LA 2DT1A 2E9MA 3SEPA 1BGAA 4HTYA 4MADA 1LL6A 1UG6A 1UH3A 2WC7A 3CHDA 1VRXA 2DSKA 3WQVA 1B90A 4GI8A 3AJ7A 3OGSA 1BVNP 2EQDA 3EDKA 4GZEA 4J3XA 4AZ7A 4H41A 4MJ2A 4A4AA 1UD2A 5GNZA 1BYBA 3RM8A 4R5EA 1QI3A 3PZGA 5A8QA 3GH4A 2VI0A 1GZJA 4GO8A 1Q4NX 1P6WA 1B3XA 1J0YA 2EO7A 3CO4A 3WUFA 4L4PA 3NYDA 2DSVA 1WP6A 2D0HA 2VL4A 1G5AA 1XHGA 4PRWA 1R7AA 3CZ8A 2HVMA 1PZ2A 3VVGA 2VZUA 3WMSA 1Q6DA 5ABHA 5I6SA 2YBTA 1UWUA 1WKYA 3QR3A 4JIEA 1HJQA 3QHOA 3GZAA 3K4AA 3WIJA 1W1TA 3GNPA 4QDMA 4E8DA 3VD7A 4HPHA 2WK2A 1C7TA 1CXKA 1XH2A 3AS2A 1MYRA 4PSRA 3CTTA 1V08A 3WQ5A 1XD0A 1J11A 1ISZA 3WNLA 5ABEA 1H41A 2VRJA 1V6UA 1J12A 1KBKA 3PZIA 4WKFA 5IDIA 4EK7A 5ABFA 5D9MA 2BVYA 4CD6A 4U5KA 1GOIA 1EOKA 2GUYA 1MXGA 1WE5A 3NJ3A 4GKLA 2XVGA 1CPUA 4GQRA 2ZOXA 1AQHA 2VUYA 1G01A 2XGBA 1V0MA 3MO4A 2A3HA 3SUWA 2WVUA 3WH6A 4WSJA 3GNOA 1EDTA 2B31A 2JF7A 1MFVA 1ZBCA 3AQUA 1XD1A 5D9OA 1QW8A 1ZB5A 2WC3A 3UETA 5BXSA 4DUVA 5D4YA 3T0DA 5A3HA 1CGWA 4W88A 5I78A 1OSEA 2WLYA 1ESWA 3U5YA 3NDZA 1VJSA 3B9AA 3L2MA 5BXPA 1H2JA 1W3JA 2J78A 1E6RA 1OM0A 2XFFA 2OYKA 2QHAA 2W4XA 3WH9A 2RGMA 4CD4A 1BFNA 3WBEA 3MUY1 2YL8A 1XCXA 5C70A 1UH4A 2D24A 4KH2A 5M17A 4HA4A 2EEXA 3EMZA 2ZUNA 3OGVA 4HMDA 4D6HA 1EO7A 2NSXA 3LPGA 1R86A 4AWEA 2VX7A 2PB1A 5I77A 3CGTA 5AC5A 1FH9A 1YHTA 3KWXA 2G3MA 1J9YA 4WKHA 2XYLA 1Z32X 1JD9A 4AD2A 1E5NA 1W2VA 5CSUA 3N12A 3GXFA 1OIFA 3OLDA 5FCZA 1LF1A 2CKRA 4M81A 1K9DA 3WBAA 4PEEA 1E0VA 1JYXA 2VR4A 4EKJA 3WQ4A 2X0HA 1VF8A 1PX4A 1UR8A 2VQUA 1IZJA 2QV4A 5BROA 4HOWA 5EB8A 2JALA 1R85A 3LMYA 1UYQA 2CBVA 2FHFA 3ZJKA 2WSKA 2BXZA 3WD1A 2DT2A 1BG4A 1HKJA 4OOZA 2ZX9A 2OLHA 5GNYA 1UD5A 4TVCA 1E6PA 3GBDA 4TOQA 1TVPA 4BQ4A 4LXFA 1W3KA 1Q6FA 3DC0A 3N18A 3J7HA 1AVAA 3AROA 3ZR5A 3MS8A 1W2PA 1KFWA 3KL5A 5LA2A 1O6IA 8CGTA 1BGGA 1RD6A 4U2YA 3KL3A 5FD0A 2PC8A 2WKGA 3D5HA 5C8BB 2AMGA 1XCWA 3RJYA 3VMNA 3PHAA 4OZOA 5ECUA 2WKLA 1HJVA 2WZIA 3SCQA 4C7GA 5KZ6A 2PWFA 3VX0A 3CHEA 4N42A 4UQBA 4E8CA 3RJXA 1B9ZA 3W81A 1V6VA 3VNZA 1AMYA 3WDRA 3ALGA 3VDBA 2VJXA 1WZMA 1LG2A 3PZNA 4UFMA 4ZE4A 3VIOA 1B3VA 2WWDA 1FHLA 1HX0A 5CG0A 2WBGA 2GJXA 3F4VA 3EDDA 2G3JA 2YOCA 4MB1A 1WO2A 5IHSA 1LG1A 4X0VA 2CESA 3SIMA 3K4DA 4PMNA 4F66A 6CGTA 3K1DA 3WENA 2WZHA 2VX6A 3CMJA 1TA3A 3BCDA 1ZJAA 4ZENA 3PZUA 3IJ7A 3LPFA 3VOCA 2HISA 1HIZA 3GXDA 1CWYA 3VD4A 3AIBA 3AMDA 1JGIA 1ISWA 4ZXLA 1GVYA 2W62A 1KQYA 1UZ4A 3A47A 4NSBA 2CEQA 3SURA 9CGTA 2CPUA 1W1VA 4MB3A 1E6XM 3THDA 2BFGA 3AYRA 5CGMA 2D23A 1F4HA 1HKKA 2EJ1A 4OBRA 4B15A 1VBRA 4ACZA 3WFLA 1H0GA 3IANA 4NRRA 1VEOA 4Z2IA 3BAXA 3NIYA 4PMOA 5HNNA 2VC9A 4CCDA 1IZKA 5A8PA 2OWWA 1MW1A 2XJ7A 2W67A 2W5FA 1DWIM 2G4FA 1WZKA 3A4XA 4MNJA 1F4AA 1HN1A 4DM1A 2J4GA 2OWCA 4P7LA 3IK2A 2E3ZA 3SCPA 1KCKA 2EXOA 1KWKA 5FL0A 2X8RA 1RP9A 3VNYA 2ZXAA 2WNWA 3JUGA 3WUGA 4DUXA 2A3AA 1Q6GA 1VEPA 2XHYA 1EQCA 1PIGA 2DH3A 2FH6A 1V02A 1NWSA 2ZUUA 4NZCA 2F8QA 5A8NA 2J62A 4URIA 1DTUA 3WF3A 3L2LA 2UY3A 3ARZA 3DECA 4UFLA 2AAAA 1EH9A 3L4UA 4AD0A 4PTMA 2WMIB 1ISXA 4WLCA 5HDRA 5KEZA 3VGGA 4FLOA 3WDHA 3CZGA 3GH5A 4K68A 3WFZA 3W82A 4S3KA 2EPMX 1J0IA 1CXLA 3N1AA 3WF4A 1JAEA 2YDQA 2DDXA 3I3BA 3UERA 4R27A 4YHGA 1ZBWA 3AS1A 3AISA 2G3NA 4AW7A 3QOKA 1XSKA 2IXVA 2WHMA 3AXXA 1HXJA 1NARA 5ABGA 3VILA 4TVUA 2BV9A 2D0GA 3ARXA 4XX6A 1MFUA 2DT3A 4U33A 3HJEA 4U3AA 4CCCA 1EDQA 4D1JA 1LLOA 3VDCA 1PAMA 1KCLA 3THCA 4M24A 4X0NA 1JZ6A 1E1FA 4KRUA 5I24A 2PI6A 2VCBA 1CENA 1HL9A 1Q6CA 3CZKA 4H7VA 4FK9A 1G1YA 3BSGA 4PMZA 1AQMA 4J3TA 1C92A 2EPOA 1H5VA 1I1XA 1KR1A 4V28A 1PPIA 1XYZA 2PF0A 1RPKA 1DWJM 3W25A 2XFYA 2GVYA 5BRQA 1ZU8A 4BCEA 1TUXA 1BHGA 3S2CA 3ARWA 3QOMA 5E0CA 4E4PA 3BLPX 2GSJA 3MMUA 4UTFA 4RE4A 3VMOA 4WJXA 5BXRA 2ZX7A 1WPCA 4M1RA 2VO5A 3BC9A 2NW0A 3ZM8A 5AYBA 4JFWA 3VU2A 4QCFA 2XPKA 4P8VA 4W87A 5CXPA 2BY3A 1JXKA 2YLAA 3A6OA 3KL0A 2CBUA 1ITCA 1CZ1A 1M04A 1GOKA 1UR0A 1HKMA 5E6YA 4AXNA 8A3HA 2O92A 3AMLA 1MQRA 1QI5A 5D8ZA 2W66A 3ZQ9A 1CGTA 3WH7A 1GOWA 3T0AA 1BAGA 4OUEA 1SMDA 5AY7A 2VCAA 3UCQA 2AOSA 1TMQA 1NWTA 3L4YA 2YKKA 1W9XA 2VVNA 3AHXA 3TONA 3MSDA 5CZKA 4MTVA 3FAWA 3APGA 1QBBA 4ACZB 3MKKA 4W93A 4LPCA 1CLXA 1V6YA 1QNOA 1VB9A 4IISA 2IUZA 1XSIA 2FHCA 1WB0A 1E70M 1E15A 1NM9A 1FFRA 3WD4A 4KGJA 4CVUA 1BLIA 2UY2A 1EIBA 1WDPA 2BY2A 2O9OA 4CD7A 2Y5EA 2X1IA 1JDCA 1V0LA 2CXGA 4AD5A 2WZEA 1US2A 2QPSA 3I3EA 2D1ZA 1BYAA 3OBAA 1GHSA 1LL4A 4BZYA 2VNCA 5DT5A 3WUEA 4ZE5A 3VGBA 1L0PA 4HP5A 3AXHA 1CDGA 1M03A 2XVLA 1CIUA 5DMYA 1UQZA 2DGAA 1UA3A 3VIGA 4AD1A 1M7XA 4AZCB 2WAGA 3WDQA 1LJYA 4UQ9A 4CCEA 1CXFA 1B3YA 4P7NA 3GXMA 3VIHA 3ARRA 1W91A 3II1A 2G3IA 4M8UA 2WHLA 3VD9A 3N11A 1R8LA 4WSKA 5M3WA 4KRTA 1QNQA 4AD3A 3FW6A 3ZT6A 3CPUA 3FXYA 2FGLA 4LYQA 1J0KA 1ZBKA 4N0RA 5D8WA 1CGXA 4RL3A 5IFTA 1QHOA 1GORA 3ALFA 4OBSA 4GIAA 2WMHA 4W7VA 1QNSA 7CGTA 1NOWA 3ZO9A 2WLZA 3DYOA 4CD5A 4BS0A 4C7DA 3U7BA 3AIQA 1FHDA 1R87A 4W7WA 2WMGA 1W9DM 2CKSA 3M6DA 4DWSD 2V5DA 4KGLA 2D20A 3OIHA 2E40A 3SCVA 5TD4A 2ZUVA 2J7GA 4TXEA 4H04A 5DT7A 1C8XA 3WELA 4MAZA 2XSAA 1FOBA 2BNJA 2VQTA 2DSWA 4L4OA 3W37A 3SCSA 2FDMA 2QPUA 1JZ2A 3FAXA 3WQ8A 3W27A 4HZ8A 5GQBA 1G9HA 5BXTA 1UR2A 3WMCA 1J18A 1FA2A 4MPKA 1CGVA 3AICA 1J0HA 3BAIA 3N17A 4D6DA 1JD7A 3W4RA 3M46A 4UQAA 1JZ4A 3UESA 1KXQA 1VFUA 1D3CA 4GQQA 2GJRA 4M56A 4HPGA 1BVZA 3ARVA 1UD8A 1JYNA 4QLJA 2D3LA 2ZXQA 4UFJA 3CIVA 4E2OA 2ZIDA 4ZFMA 2ZUTA 3AZRA 3UG5A 1DEDA 5LA1A 4XUYA 3VGEA 3VIIA 1WDQA 3UR8A 2X05A 2Y8VA 1E6QM 2XFRA 1VIWA 1JZ3A 1VAHA 3CZLA 4RE3A 1EDGA 4PMYA 5A6BA 2XIBA 1UKPA 1H09A 2GDVA 2C0HA 3ARYA 1TR1A 4LYRA 3L4ZA 3QHMA 3WD2A 2D3NA 1DWGM 2WVVA 4PMUA 1FH8A 5I2UA 2Z1SA 3WNKA 4PCSA 2J77A 1GVIA 4W84A 4FF5A 4W5ZA 5LYRA 5A6SA 3UG3A 3AIWA 3VM5A 4LGXA 1JZ7A 2VRQA 3WDPP 4MNMA 4QCEA 3L4TA 2X0YA 4A3YA 1TE1A 3EDFA 2CITA 4W89A 3FHAA 3L4XA 4AD4A 1JYVA 1UWTA 4W5UA 1JG9A 3NDYA 4HMCA 4UZSA 3SUUA 4F79A 1B3ZA 4XV0A 4GZIA 1NP2A 4HU8A 4DWSC 1B31A 1NH6A 3AOFA 2BVTA 3ZJ7A 4D6GA 4Z2HA 4JKKA 1KGUA 1UUQA 4TUFA 4P8XA 2IXUA 5E09A 2G8ZA 1DWFM 4PMRA 5CQ1A 1XV8A 4ACYA 4MNKA 3MV11 4CU7A 1PX3A 1US3A 2J8FA 4CN6A 4W7UA 4U3CA 1HJXA 2DH2A 4GO9A 4AMCA 4H8UA 3TTOA 3VUPA 1N82A 3W6MA 3LPPA 4XZBA 4UOJA 2WW5A 1B3WA 1OD0A 1E40A 1CNVA 3AYSA 4J3WA 1KXVA 1E43A 1CGUA 3BAJA 3GYCA 4AZ5A 1W32A 4OJYA 5FOOA 4H8VA 3PZQA 3VIPA 1E4IA 1QNPA 4B3LA 1QOXA 3UEQA 4ML4A 2OWXA 2Z1KA 4J7RA 2PBGA 2E9LA 3AHVA 4JL1A 3AI0A 2X2YA 4IUGA 3QGVA 2ZXBA 2J7BA 4HMEA 4AIEA 4Y7EA 1FP8A 2X09A 1NQ6A 3SCRA 1JYWA 4AZIA 4CU8A 2W63A 3U5UA 3UR7A 3OZPA 1PX8A 3TTYA 1E4MM 2V3EA 1UD4A 4PMXA 4UZUA 2O9TA 4JFVA 3NSXA 3CMGA 2XSBA 2VURA 1QI0A 3BAKA 3CUGA 3AIRA 4MDOA 7A3HA 1V3HA 4D1IA 2BY1A 3ARPA 3T08A 1EXPA 2WWCA 2O9PA 3ECQA 4DWSA 3CLWA 4AEEA 4JL2A 1GOOA 4F8XA 1LWHA 5M5DA 3ZJ6A 5A6BD 4MAVA 3G6LA 4BA0A 2W92A 4D71A 3PZ9A 1DP0A 1QW9A 4WKAA 4QAWA 2FGZA 4W8BA 4PBGA 1L8NA 3WEZA 2WB5A 1H49A 2VZOA 4D6EA 1UHVA 5CPQA 3RIKA 5HOSA 2VZVA 4P8UA 1MWOA 5CSYA 3N15A 4UFHA 3WF0A 4HZ6A 3W24A 1V3LA 2ZICA 4CKQA 1VJZA 5CJ5A 1E6SM 4FLSA 2YA2A 4BQ3A 5DO8A 4HZ7A 1LWJA 4GXPA 1EGZA 3OG2A 4AIOA 2DEPA 3NUKA 1GUVA 6A3HA 3AIUA 2DIJA 1OBAA 4B9ZA 4PMVA 4ATLA 1C8YA 2EPLX 1TZ7A 1XYFA 1VBUA 5CLTA 1J0ZA 3ZT5A 2XG9A 1TA3B 2VZSA 3VO0A 2BVDA 5A8OA 3PBGA 4J27A 4ATDA 3ZIZA 1E5JA 3WNNA 4PCTA 5A2CA 4EANA 3N04A 1GW1A 5A8MA 4Q22A 5IHRA 1OCQA 1XGZA 2E0PA 1M01A 1UWRA 4TTGA 3HN3A 1JF6A 3ARSA 3EMCA 1HKIA 1OINA 4TX6A 4J3UA 2CBIA 4UOQA 5CGTA 4YHEA 4DM2A 2ZUMA 1NOFA 3CZJA 2J7FA 1H4PA 2J8GA 2J7DA 3BAYA 3O6AA 1ISYA 3BMVA 5A6AA 2WBKA 4TVDA 3SUVA 4M80A 1QPKA 3WF2A 1LL7A 2PWHA 3RPMA 3WH8A 3MV01 5E0FA 5DEZA 2DPEA 1DHKA 3BSHA 1K9FA 5DFAA 1AQ0A 1HJUA 4EAMA 4RE2A 1UA7A 1W9PA 1E1EA 3K8KA 1JNDA 3WNPA 1HJWA 4HU0A 4P7QA 3AHYA 1S46A 1LQ0A 3ZMRA 3CZEA 3SCNA 1VENA 1UKTA 2J75A 1JF5A 3L4VA 3WMBA 2E4TA 4JFTA 4PN2A 1GCYA 3EDEA 1Y7VA 1PJ9A 4W86A 2YL6A 5M03A 1UR9A 1HF6A 3POHA 1HP5A 1WZLA 3AXIA 3WNMA 3MU7A 5HXMA 3AIEA 1E3XA 1Q6EA 2XTKA 2ZWYA 1E55A 1GNXA 2DT0A 3S6TA 3AHTA 5I0DA 3OB8A 1SYTA 3WKZA 1U33A 4GI6A 1BQCA 4H8HA 1UWSA 1R7OA 2EPNA 3AS3A 1MW0A 1M53A 1E3ZA 3ZT7A 3GBEA 2WYSA 1TVNA 2J7HA 5D9PA 3B8SA 1B0IA 4JAWA 3M7SA 1MVYA 2EPKX 3CUIA 1OIMA 1A3HA 4DUWA 3W29A 4W85A 1C93A 2Q8XA 2PWGA 1GJUA 1CXIA 1C90A 1BYCA 2CYGA 4H2CA 1KBBA 1O7AA 4X9YA 2D22A 1JZ5A 4Z2KA 1IT0A 1B2YA 2JE8A 2J79A 1JFXA 4CN1A 3BGAA 1JDAA 2JIEA 5A6MA 1TFVA 4NRSA 4S3JA 3TP4A 1ITXA 4JCMA 1KWGA 3ARUA 7TAAA 2WSPA 4CUCA 3GDBA 4CU6A 1ECEA 3WH5A 4IPNB 3PN8A 3ZOAA 5GPRA 4MB5A 1OT2A 3IAPA 1KR0A 3OA5A 1QVBA 3ZSTA 3WL0A 3O9NA 3VIFA 1BYDA 3BCFA 2J7CA 4FMVA 4CVWA 4PYSA 5A1AA 4QLLA 5JIPA 3EDJA 1CXEA 1EA9C 3WQ6A 1MQQA 1C7SA 4V27A 2ZX5A 1W9UA
chains in the Genus database with same CATH superfamily
2A3CA 2VEIA 1W17A 5FL1A 4D2JA 4BF5A 2JGYA 2E1DA 3HFTA 1Q2RA 3LI1A 2ZX6A 4EXAA 2BMBA 3W6LA 1H7XA 3AS0A 3VMPA 3MI6A 4KRZA 3WY1A 4D6CA 2J8TA 1XIMA 4CD8A 4HB7A 1F6KA 4K7VA 1OGBA 5AHLA 3FIGA 4FLRA 3TR2A 3VDHA 5FSDC 3EA3A 4LYKA 7TIMA 1V03A 3R8GA 2PZNA 2YW3A 1AW1A 4C65A 1HT6A 3W00A 4DJEA 4UQCA 1JQVA 4KWUA 2R24A 3MKCA 3C0LA 3HPZA 2PD9A 4P8WA 1PE1A 1A47A 3VTRA 3GNRA 4NAEB 2PS2A 3REQB 4K1GA 3SQSA 3TOPA 3W28A 1KFEA 2GUUA 1DE6A 2DSZA 1W1YA 2PGFA 4JD4A 4GBUA 4O50A 3RCNA 1X7FA 2YA0A 1VYSX 4O1DA 2ABBA 1KGXA 2ZRWA 2VFHA 4BFAA 4AIUA 3HG3A 1X1ZA 3OHMB 2OLAA 3RPDA 2VX4A 4IQJA 2F38A 3MB9A 2PU0A 8RUCA 2VX5A 2BHYA 4RX0A 1FTXA 1OD8A 3Q94A 2UV8G 3GLCA 1DXFA 1OCJA 5KINA 1Q6OA 2A0NA 1ZGDA 3T44A 2PA6A 5DF0A 3CIWA 1UZ1A 3IVSA 4AZHA 1E9LA 1G6CA 1AD1A 4Z2LA 3FNDA 1I2RA 2WCSA 3H8AA 3L0KA 3IK4A 3TTSA 3ZJ8A 1ZY9A 3PTQA 2F2KA 3D3AA 1P0DA 2PDNA 1H61A 4ZO8A 2OSXA 1QPQA 1M7OA 4US5A 1YDVA 4LCSA 1L6YA 1U2YA 2F61A 2Z26A 2G50A 1S5TA 1N8IA 1EP1A 3SN0A 1QI4A 1I45A 3LXAA 1MW3A 2A6LA 2CERA 4AZGA 2ABAA 2WVSA 4MFDA 2TODA 5EFDA 1EJTC 2B7QA 3VD3A 4LNYA 2TSYA 4A2SA 4WUIA 2YA1A 3OOQA 1PL9A 1XH1A 3K8MA 3E2RA 4LW7A 4CEXC 2E9BA 3ZLHA 2PLMA 1ZQ5A 1P5BA 1OB0A 1KFCA 5C2CA 1RUSA 5JBDA 1GT8A 1V0KA 2WNQA 3WD3A 1LUCB 2ZA2A 4XD5A 1OADA 3W71A 3GZ3A 1XIHA 4L61A 3MI2A 3RM9A 3GU2A 4XAPA 2ZE0A 3B9DA 3E3HA 4AYSA 1EQPA 3CBWA 2YYTA 3N3MA 4MUPA 2YJQA 4MLJA 3MYOA 5I3FA 1V3KA 3WJZA 2OMAA 4WD0A 1F6YA 1QWKA 3B0YA 2PFHA 3AALA 3W1LA 4GZJA 3N4FA 1UKQA 3O6CA 1B3OA 2G0WA 4GJIA 1QBAA 4KQNA 4AEFA 1UWIA 2IPJA 2ISWA 4EOUA 1JVNA 3SADA 2V2CA 4MDPA 3FA3A 4UCFA 1F76A 3TA6A 3PG8A 1B1YA 1SPQA 5JU6A 2ZRXA 1QHZA 4B5SA 3E12A 4HHLA 5C6MA 1BF6A 4Y9PA 1IZCA 1VFHA 4HT3A 5IRPA 1QHPA 4PA8A 1WKDA 4WY0A 4QIUA 2ZC8A 5JBEA 2C16A 4QJ5B 4J5NA 4IIFA 3VKKA 4DAIA 3NL3A 4AXKA 3TROA 5I3HA 3DI1A 3MVTA 2I9UA 1R0MA 1NF7A 3R0KA 6TAAA 1K6AA 6PTDA 3EWWA 3H54A 2WMJA 2W0UA 4GIYA 3L67A 4ZVJA 3L0GA 4CQAA 4EP8C 3KBMA 3V7PA 4K1WA 3NSNA 2WOQA 2FVLA 1C8QA 1B4KA 2WC4A 3N6HA 1B30A 4JYFA 2R1NA 5EU9A 4WOQA 2WSQA 1CT5A 2VR2A 1SQ7A 4A2RA 2BHZA 3LHYA 4LAZA 5DBTA 1DWHM 1V79A 2XM2A 5A95A 3BW3A 4O28A 3N6QA 1XLBA 1VBJA 1BKHA 1GG1A 4HPNA 1XYAA 1W1ZA 4MZYA 1E6NA 3WSUA 3GIPA 4X60A 3NQ7A 2VCCA 1A53A 3TYUA 2P8BA 2XM1A 3HG4A 2ZKMX 3EMQA 4PSPA 1QI2A 2GOKA 2CETA 1T41A 3AYTA 1JI1A 3TSBA 2J25A 4R33A 4Z2GA 4WGHA 3UW6A 3N73A 3KLKA 3GU9A 3NPWA 1S2AA 1I8JA 3BH4A 1BSIA 4NILA 4LQ1A 4GY7A 3QY8A 1MEWA 2WCAA 3UY7A 2QDDA 4UQDA 3UXKA 3P8JA 1X8CA 4BHYA 4H00A 4ZSTA 1IXPA 1WA3A 2CZFA 2SFPA 3UY8A 3MUZ1 1O5QA 1IYXA 2XGIA 1N8WA 1FWIC 2DZSA 1FWBC 3GH7A 3NEVA 2V2HA 3EWXA 1IXNA 4XZWA 3SRDA 3VGDA 1XDMA 2TAAA 3KEHA 2YBUA 1UWAA 3LCIA 3BLKA 5HMDA 4NX0A 4DWSB 2GOUA 3IPWA 4V2XA 2P5NA 1ZL1A 4JNZA 4IFKA 4R34A 2Z6IA 1KM4A 3IAQA 3OHIA 3XINA 5K9XA 4A35A 2P8CA 3W38A 2R14A 2WM0A 4L56A 2QIWA 3RNDA 2Y2WA 3THAA 4GMEA 4QDPA 1A5KC 1C91A 1XRSA 2Z28A 3AMGA 3W86A 3E2SA 3GU1A 4OIFA 2PPGA 2V30A 1V8EA 3RX2A 2QJJA 2V5BA 2VC7A 1YE6A 5AZ0A 4ATWA 3XIMA 5G5IA 1GQJA 2ACUA 3R11A 2PDXA 2Z1BA 3T2PA 3LLFA 1R3SA 4DLFA 4TX9A 3FY1A 4P2VA 3QV9A 1FH7A 1Y5WA 4Y9AA 3T78A 1TX2A 4JKLA 4A22A 1JXJA 1H7WA 3CUHA 4L6DA 3DU0A 4MG4A 4H7CA 3RR4A 2C7FA 1E6ZA 4ZQMA 2GGJA 4GX8A 5CZTA 2NT0A 3BCJA 4JXCA 4KW2A 1EX5A 1V7YA 1RQHA 4D8ZA 4E8GA 3BICA 2XN2A 2G3FA 2POTA 4GUFA 5J5DA 5E1QA 2F2HA 3VDAA 4DJED 2H90A 1CECA 3CAWA 1PEZA 1EC7A 3KOWA 1X1NA 2GYIA 1ZZMA 1PHWA 2A4AA 3WJSA 1VFFA 4JTLA 1SZGA 1UKOA 1H0IA 4MJZA 2BXYA 1JAKA 4LAKA 1HVQA 4WZHA 4ZXOA 5IXEA 5GJPA 4CLMA 1TV2A 1KQZA 2QCDA 2FJUB 2TRSA 3K8LA 1BGAA 4YWIA 1FQ0A 4MADA 1IE7C 4AHPA 1G4SA 1SO4A 1UG6A 3CHDA 3WQVA 1ZRQA 4GI8A 1UBSA 3AJ7A 3P5ZA 1W31A 4GZEA 3IIZA 1FWAC 4K8HA 1W5MA 5XIAA 4A4AA 1ZSXA 3QVQA 1K8XA 4R5EA 2NQZA 5A8QA 1ADOA 1GZJA 1D8CA 4GO8A 1Q4NX 1H5YA 1P6WA 3BLIA 1XRFA 1J0YA 3EWYA 2DSVA 1SM9A 2VL4A 4Z17A 4Y90A 2XGZA 2YZ5A 2XISA 3VVGA 1TCDA 2XH2A 2HQAA 1GG0A 1UWUA 3QR3A 5BMXA 3GZAA 4E4FA 1EJUC 3GNPA 3GUGA 4E8DA 3VD7A 1YW1A 2WK2A 4F0RA 1E0TA 2WZMA 1MYRA 4HNCA 2BWGA 3N2TA 3MZNA 1HKWA 3UZYA 3WQ5A 1ISZA 3NGFA 5ABEA 3DCPA 2IMRA 2HXTA 2VP8A 4XIMA 1VP5A 1KBKA 5IDIA 4EK7A 1ONRA 4CD6A 4U5KA 4I90A 2B81A 4QISA 1MXGA 3TYAA 3MCNA 4I5UA 1ME7A 4FX8A 1IEXA 5KSWA 3RLUA 4DNHA 2YXOA 3B9NA 4NU7A 2XGBA 1V0MA 1Q8AA 3UU0A 3H4GA 2PGRA 2JKAA 3GS6A 4DJDC 2E6AA 2YGYA 5D9OA 2OCZA 3QKZA 3BW2A 4DUVA 1CGWA 4W88A 2X41A 1ESWA 1RK5A 2E28A 3S1GA 3U5YA 1OVDA 2D73A 2WQPA 3EXSA 1ZJIA 2XFFA 3DIPA 4KCUA 2ZADA 3UPWA 1ZALA 1BFNA 3DI0A 4JBRA 3WMLA 3FCPA 3WBEA 4UC5A 2P3EA 1AW5A 4DF1A 1H7PA 3DOPA 2V6AA 3KBJA 3EMZA 3OGVA 1B9BA 3TIMA 4D6HA 1M68A 3JRKA 1S39A 4O1BA 4AWEA 5I77A 5J04A 3CGTA 5AC5A 3KP0A 1FH9A 1Q63A 4HU4A 1GZ1A 4ENLA 1E5NA 5CSUA 3N12A 3QLDA 3VE9A 5C7HA 3UWQA 1K9DA 4REQA 3VZYA 1K8YA 2VR4A 5D32A 2DFAA 1VH7A 2VQUA 1UR8A 1VBGA 2E67A 4DRSA 5EB8A 5HWJA 3ZJKA 4UNKA 2WSKA 2BXZA 2Y70A 4OQVA 2UZ9A 3URAA 2ZX9A 3CO8A 5LIUX 5GNYA 1UD5A 4TOQA 5BNKA 3CIXA 3S47A 5AECA 4LXFA 2VGBA 2YXXA 3MKVA 3QRHA 2QCMA 3A5VA 3AROA 3MS8A 2V8ZA 2X7WA 4Y9MA 5LA2A 1EKOA 4NG3A 1DJIA 4U2YA 3APYA 4YVVA 2PC8A 4RK8A 5J8LA 5C8BB 3H22A 3IACA 3RJYA 5HNRA 1ZCCA 1GPWA 2WZIA 3JU2A 4GACA 5KZ6A 3JS3A 2PWFA 3VX0A 2IKHA 3W81A 2JKPA 3VNZA 1YKWA 1Z6KA 2E25A 4F0HA 3VDBA 2QZRA 3PZNA 4AVNA 4MWAB 1FHLA 1EP3A 3OVPA 2WBGA 4MY9A 2GJXA 4E4UA 3EDDA 2QF7A 1JGMA 1WO2A 1O12A 4GGHA 4GJ1A 4F66A 3K4DA 4O54A 3KTCA 3GVRA 5CEWA 2C13A 3BCDA 1ZJAA 1HGYA 3HO8A 1HIZA 3M41A 4DQWA 3GXDA 1Q85A 4JIRA 1ONEA 4F2TA 3PUOA 4FOJA 4IP7A 1L6FA 3M9YA 1IQ8A 3CYJA 4GCAA 4ZXLA 1YPXA 4GNKB 3LGDA 1XUUA 3VDGA 3O7UA 4YYCA 2JQXA 3SURA 1FHVA 2FQIA 1A5BA 1HFBA 3THDA 3MP5A 4XO7A 2YX0A 1F4HA 2IQ0A 4DJFD 4B15A 3R89A 3MUXA 3LNPA 3WFLA 3IANA 2FMOA 4Z2IA 3UZZA 1KCXA 2VWSA 4N6EA 5HNNA 2NXGA 3PWAA 4XKMA 1F74A 4CCDA 5A8PA 4GJJA 1MW1A 1YRRA 3T7VA 1DWIM 2G4FA 2OWCA 3T81A 4FNUA 3SCPA 3LB0A 4LUJA 4Y8FA 3TWBA 5FL0A 2X8RA 1RP9A 1XIJA 3WUGA 2WNWA 1Q66A 1R2TA 3TAOA 2YZRA 2XHYA 3DFPA 1E1CB 1NWSA 2J62A 3BZGA 3D3FA 1DTUA 1X39A 4C60A 4JTAA 1E9ZB 4UFLA 1EH9A 3L4UA 4AD0A 2X40A 4MKNA 3OBEA 3LZ5A 4UWMA 4WLCA 3MHUA 1DIKA 3UWYA 4FX7A 3CB8A 4JN7A 3M44A 1CXLA 3C5QA 3WF4A 1RVKA 5KZDA 3NL5A 4Q3MA 3I3BA 4HHMA 3UERA 2Z1WA 1GVEA 4LU0A 3GG0A 4US5D 3BZJA 1XISA 4ZGYA 2V63A 4YL2A 2WHMA 4LB4A 1JRBA 3G24A 4QQ3A 1L8PA 4XX6A 4HYVA 3QY6A 4RDZA 3L66A 4XD6A 5HUOA 3QW4B 2INZA 2CLLA 4M24A 3W1UA 4ZOCA 4E2BA 4KRUA 4JTDA 4YU1A 3RX3A 3E96A 4H7VA 1XYMA 4HN8A 1IXQA 1G1YA 3S5SA 4PMZA 4N4QA 4J3TA 1H5VA 1I1XA 3GD6A 3B4UA 2ZC1A 4QG9A 3QC0A 1OX4B 3QFWA 3TX9A 1M1BA 2PF0A 1DWJM 1OK4A 1K6WA 2XFYA 2GVYA 3HTWA 5BRQA 3W7RA 2B0MA 4DY1A 3BLPX 3LXCA 4I9MA 4I5XA 2VO5A 1TB3A 2NW0A 5CCZA 4N02A 3ZM8A 2PTXA 4ZQRA 3CH0A 5AYBA 4QCFA 2XPKA 4P8VA 1PKYA 3KL0A 2E6YA 3VNIA 1M04A 4PGLA 4H9XA 3SGZA 2C71A 2O92A 2W79A 8A3HA 4JEQA 1MQRA 1QI5A 5D8ZA 4IIEA 1F73A 1BAGA 1V51A 3C2YA 3UCQA 4ERIA 2PRHA 3PB2A 4HHHA 2XZ7A 3AHXA 3TONA 3UA3A 4MTVA 3FAWA 1FCUA 3APGA 1QBBA 3LBCA 4ACZB 4W93A 3F7JA 3H2NA 3B3DA 1QNOA 2IUZA 3W02A 2ZZ1A 3M4HA 1E15A 1KNWA 4QG6A 3WD4A 4KGJA 5EMMA 1EIBA 1SO5A 5E9XA 4CD7A 2O9OA 4Q4KA 2Y5EA 1A50A 1W1IE 4LAUA 1JDCA 3RITA 1BTMA 4UTMA 2WZEA 1US2A 2QPSA 1XGEA 2HBVA 2GVEA 4NXSA 3BQ6A 4QJ3B 4DN1A 2F9RA 4ZE5A 4EPBC 3VUSA 3WFAA 3RK8A 2GWGA 5DMYA 4AD1A 1PIIA 4DJEC 3NOYA 4AZCB 3GR8A 3LV6A 4FIQA 3GXMA 5KZEA 2V0TA 3VIHA 5D2VA 3C56A 1K4GA 3II1A 3IWPA 3VD9A 4LF1A 1FWTA 4CEUC 4WSKA 1TPWA 3CPUA 3FXYA 4C6OA 3L68A 1J0KA 3B06A 5EBUA 1A4MA 4IICA 1KLYA 4F2UA 4PEKA 3ALFA 3EA2A 3P67A 4TU1A 4CD5A 1EPVA 1YXCA 1DL3A 4O0KA 4IFRA 1H62A 2WMGA 1W9DM 1EJ7L 1FDYA 1EF2A 3BMXA 1KFBA 1TPEA 2Y63A 4FA3A 2E40A 4JQ2A 4DNMA 2ZUVA 1X38A 3O06A 3TSMA 5FJRA 3FYPA 1QUMA 1C8XA 4MAZA 5CKSA 5D30A 1ML1A 2VQTA 1TQXA 2FDMA 2QPUA 4DPPA 3W27A 2C0AA 5GQBA 1K02A 3B4YA 4PODA 2W6RA 1UR2A 3M16A 3WMCA 3N2CA 1H63A 1KTNA 3H2AA 1CGVA 1GEQA 3W74A 3K1GA 1J0HA 1YNYA 3LU2A 1JD7A 1XBXA 1JCNA 4IFKB 2H3BA 4UQAA 4N4PA 1KXQA 3MJMA 3U6WA 3TXZA 1VFUA 2QCEA 2GJRA 2X0SA 5LNRA 1FWNA 3UP8A 3B8DA 1RY0A 3DFOA 4QLJA 3O6DA 2D3LA 4UFJA 4MOZA 3CIVA 4E2OA 3AZRA 4LUTB 3HQOA 2DVTA 4XUYA 3VGEA 4QHRA 1OX6A 1V93A 1XX1A 3WLPA 1WDQA 3UR8A 2PTDA 3R1ZA 1T6MA 2QJIA 1VAHA 2REQB 5DMNA 3CZLA 3P93A 4L65A 3O1NA 3W2UA 8XIAA 1RD5A 4FHAA 3VC5A 1GZGA 5HINA 2E5DA 1IIGA 4IHCA 2C0HA 4RUBA 3L4ZA 1FH8A 1MNSA 4QX4A 3S83A 4CNNA 1DVJA 1QOQA 3WNKA 4H1ZA 2J77A 1UPMB 4FF5A 4A8IA 4W5ZA 4H9VA 4GD0A 3UG3A 3VM5A 2D69A 1VR6A 1XR2A 4WCJA 3IVTA 4C5YA 2CITA 3FHAA 4MJMA 3O6YX 4AD4A 1UWTA 1NP2A 3SRHA 4DWSC 1B31A 3VZZA 2HE8A 2XINA 1NELA 4DJFA 4FNPA 4X2PA 2A1YA 3ABQA 3H4XA 2V69A 1I6NA 1U5JA 4P8XA 2G8ZA 5FESA 1SO3A 4GH1A 4OU1A 1IGWA 4MNKA 1FVPA 2GVGA 4R9XA 3SW6A 3TZNA 1PX3A 1US3A 5SWUA 3DGBA 1L6GA 5DCEA 4GO9A 4AMCA 4H9TA 3LPPA 3NFUA 4XTIA 1EWDA 3RPTA 1E40A 1CNVA 4J3WA 4XKYA 1R9YA 1VQTA 3CWHA 3QSRA 2AKZA 9RUBA 3DFHA 4B90A 3PZQA 1TPH1 3VOFA 2CLEA 1T8QA 4GABA 4GXMA 2GZXA 1M5WA 4HIBA 5TF0A 4ML4A 2IQTA 3JZUA 2Z1KA 4LS2A 3AHVA 2Y6ZA 4ADUA 4LVFA 2J7BA 3GHSA 3QTGA 4AIEA 1QNVA 2YCKX 1U1HA 4CU8A 2W63A 1VBHA 3LN3A 2R82A 3O8AA 2BG5A 3AUOA 1UD4A 4RZ4A 1LROA 4Q8UA 2XSBA 1JCYA 3W7GA 3BAKA 4JNMA 2R1MA 4RNHA 3BLFA 3GVVA 2OR2A 1AL7A 2QUVA 2C1IA 2BY1A 3QMTA 3CUZA 4P61A 1EXPA 4NNBA 4PL2A 3V0SA 4AEEA 4K2SA 2NX9A 1HO4A 2ISFA 4JL2A 3DESA 4BA0A 4WKAA 4PRRA 4W8BA 1L8NA 3WEZA 4WOZA 3WLSA 2VZOA 2CFFA 4D6EA 3L5LA 2J9YA 1UHVA 3QF0A 1TJPA 5DXYA 1FY6A 5HOSA 3VZXA 2VZVA 1IEVA 4P8UA 1MWOA 3W24A 2ZICA 3GO2A 1VJZA 1FWEC 3G1AA 4FLSA 4BQ3A 3PSVA 3OG2A 4AIOA 3GXPA 2JGQA 1GUVA 2YXGA 4I9JA 3MQTA 3MJYA 2P0OA 3NQ6A 3P8IA 3H21A 2EPLX 3IRDA 1TZ7A 1E9IA 4DXVA 5CLTA 3LUTA 4B5TA 1J0ZA 2XG9A 2E7FA 2VZSA 5A8OA 1YDYA 3OEXA 1DJGA 3R0UA 4EANA 1GW1A 5A8MA 2E0PA 1M01A 4B4FA 1DIOA 3IIVA 4ASTA 2CBIA 4C6DA 2VC6A 3GAYA 4K38A 5CGTA 4ROPA 3CZJA 2J7FA 3M0MA 4TIMA 5A6AA 5ECVA 3NQEA 3ERPA 1D3GA 1LRNA 4XKYB 3SUVA 1KA9F 3VK5A 4M80A 1PS9A 3ITTA 3WF2A 2NUXA 3E5BA 3RPMA 3SY8A 2PDIA 1W5PA 1UIOA 3CEPA 5DEZA 5I09A 2VEPA 4HCDA 1EUAA 2RDXA 1O5RA 1HJUA 4EAMA 4RE2A 3JW7A 2QULA 3TNBA 3Q45A 3AAMA 1IF2A 4H3DA 1XYLA 3R4IA 3WNPA 4DVOA 4E0CA 5DXXA 2Z2BA 1LQ0A 3ZMRA 3N9SA 3EWZA 1UKTA 5LNVA 2J75A 1JF5A 4YMZA 3O63A 1D7KA 3EDEA 4GE8A 3UGRA 1JDFA 3R8RA 4AWTA 1HF6A 1EB3A 2HBXA 1B54A 4I6KA 3MU7A 3PFRA 1E55A 3CUXA 2BOGX 4LV9A 1W3TA 3OIXA 2KZHA 3OB8A 1SYTA 3CB3A 1U33A 1BQCA 1M7PA 3N29A 4H8HA 1Q3NA 1A0CA 1MW0A 3V5OA 1J2BA 5D9PA 1EBGA 2PAJA 4YJ5A 1OIMA 1A3HA 3SJNA 3OPSA 3MSYA 1K3UA 1C93A 1SU5A 4GXWA 1GJUA 4JS3A 1SJCA 2VYOA 4Q8NA 3WBYA 1V6TA 3SY5A 2HNHA 1BYCA 2CYGA 4HGXA 1PKNA 2Q6ZA 4X9YA 1PWLA 1XLFA 2JE8A 3N2OA 1RAKA 4KESA 5LIXX 3BGAA 4XBSA 1WBJA 3MCOA 5A6MA 3M7WA 3ARUA 1O68A 7TAAA 3GDBA 4LAMA 2XFWA 5K4XA 4IPNB 4TQTA 5CPLA 4MB5A 2J9ZA 1OY0A 1TWSA 4IX0A 3RCMA 4R53A 1KR0A 1QVBA 3ZSTA 3VXGA 1LLWA 3O9NA 3VIFA 1M41A 3KVLA 2EF9A 4ONVA 4YTRA 3GHTA 4PYSA 5JIPA 3EDJA 1LUCA 3UA4A 1PSCA 1A5CA 1MQQA 4UMAA 2E1WA 1VPQA 1ADSA 1MZHA 3W85A 4UXDA 2XWEA 5TNVA 1FXPA 3HQPA 4U10A 3T0BA 1TVLA 3GC2A 3OA3A 4EWJA 1E56A 2WCGA 3W07A 5D09A 1DJZA 2XWDA 3CPGA 3CXOA 3SAZA 3IVUA 2VMFA 3M5ZA 4GLEA 1V6WA 4O0QA 3FGCA 5HR7A 4HK7A 3DHPA 4GY1A 2CZ5A 3VKCA 2HVNA 3B97A 4NI3A 1GVSA 3POCA 1YDOA 2XDFA 4QLKA 3N2XA 5AFDA 2QT3A 3ELFA 4J40A 4MJ4A 1F3WA 1OGSA 3H7RA 3WF1A 4MYXA 1FX6A 3PZOA 1W1A1 1JNEA 3LGEA 3O07A 1L6WA 3A5FA 3PBWA 4DJFC 4INFA 5I3KA 5EFFA 4LFYA 4KCWA 4JTGA 4HJFA 2UY4A 4YN5A 4PUEA 1KTCA 5TAOA 1OC7A 2GPTA 3EGJA 2AGKA 3W2NA 1Q7ZA 1BWKA 2OYMA 3CAVA 3KBSA 1LZOA 3GDTA 4Q32A 4O15A 3RGTA 1GPFA 4HSNA 3BAWA 1FHUA 1EEPA 4XZMX 1BD0A 1X8FA 2OQYA 1V3IA 4LNCA 4DLMA 5JIWA 3D47A 4K36A 1YPFA 2FHBA 2Z2UA 2ZUSA 3BG5A 3VNMA 2V5JA 2BXVA 2J9XA 4OT7A 1US0A 2YDRA 1WDSA 3C2OA 3MMTA 1PYMA 4Q6XA 3RLGA 4NHVA 5CPTA 4BJHA 5IM51 1FWGC 3T9PA 4JHZA 4C90A 4JY8A 2J74A 2V68A 1HP4A 2EG8A 4M6QA 3QH2A 4GUIA 1TYGA 4MMWA 2CW6A 1Z41A 2ALRA 1H1NA 2NT1A 3LERA 3PUEA 4QSHA 3NZPA 3G1HA 4YPJA 1ZLPA 2YLLA 2V3GA 4BKNA 1J10A 2QLYA 3K46A 1ISVA 4XZIA 3DFYA 4JFSA 3DGRA 3GKFA 4U5IA 1LM1A 3H4WA 4JCLA 3LRMA 2NLYA 3QXBA 3CTLA 4XD3A 2CLKA 2DZUA 3SFKA 2QDHA 1K9EA 1UW9A 3N13A 1V0NA 1GOQA 4D9PA 2VZTA 4P5UA 1Q6QA 4JYEA 2R6OA 2CHNA 1I0DA 2BS9A 5LIKX 1GJWA 1PXGA 4AAJA 2CHRA 4C6CA 2PWDA 1R3YA 3PNUA 2GGIA 5CC7A 1IR1A 2ESCA 5HBFA 3UYIA 3RDKA 3NQBA 3O15A 3MUAA 2FH8A 2WMKA 2XH7A 2E5BA 4W8AA 4BI6A 1MXDA 2E8ZA 1ZBVA 3AXMA 1PTAA 1JIBA 5AYYA 5E6ZA 3GTIA 1A0EA 5FF4A 3G5EA 1J96A 2OZ0A 2H9AA 5AHMA 4PH6A 3S2LA 1UJPA 1IHIA 2F6XA 1ONWA 2HTMA 2ODOA 4ZOAA 1TWWA 3CT2A 4QE5A 5EGRA 4MB4A 2PDCA 1PTGA 1WUFA 3OBKA 4PC8A 3VIMA 1XPGA 2Y61A 4WIWA 3RMEA 3BV4A 1MUCA 2XIIA 4O0ZA 5C9RA 4UMCA 2DZWA 1E0UA 3IGUA 1YIXA 5D04C 1TCMA 4KETA 2J7EA 1A3WA 3CQ0A 4LBRA 1E71M 1H3GA 3OVGA 4C7FA 4DXKA 1EO5A 1YQ2A 4ML9A 3P74A 1MQPA 2W27A 5D9NA 2UY5A 3WLJA 3EEGA 3M0VA 4NAEA 4FZIA 4Z2JA 4NAFB 4LANA 1Z89A 5D05A 1CTNA 3M0IA 2PTZA 5AKQA 4X9SA 4JFUA 4IP5A 1KKOA 2I57A 2A21A 3AZTA 1HZYA 1JEZA 4ICNA 3M5XA 3M0JA 1H7OA 3U48A 3W83A 4AWSA 3ABSA 1BF2A 4AZBA 3VOHA 1UMLA 1P0NA 1SVDA 4O10A 1NWRA 2AQWA 4OHQA 1KRCC 1XBVA 1OQFA 1DWAM 5LA0A 1X6NA 4GYPA 7XIMA 2VM8A 4BQ5A 3T4WA 3UT0A 1HL2A 1G67A 1TPB1 4NI8A 1QPOA 1E73M 4MUZA 4PUDA 4U2ZA 5BWFA 4GUHA 1G4EA 5LGZA 3E0VA 1UUMA 3W7OA 3W7LA 4I7UA 1F3XA 2WXDM 2EKCA 1Q2SA 1NP0A 3WNOA 4MM1A 2ZWZA 3DHDA 3HGRA 3F5KA 1XC6A 4UNLA 4XZ9A 2FTWA 3WK0A 1S5NA 2YYUA 5T9BG 2V82A 4F40A 3SCWA 4M7TA 2X16A 3ATZA 3XISA 2G37A 3SSJA 4YCOA 2QMKA 3S1XA 2QVHA 1UR1A 1GQKA 3F4NA 4AC1X 5LIWX 3LI0A 3GKAA 5E93A 5I3IA 4A3HA 5ABFB 3E0LA 4ORMA 4OV4A 2MANA 1WNOA 4IMEA 4MWAD 4XBKA 4CGTA 2ANUA 2PGEA 3H26A 3R43A 3W53A 3ICJA 3KHDA 3OZOA 3KTXA 4RPQA 5C71A 2OEKA 1SR0A 1TELA 1E0XA 2TMDA 1Z44A 2PP3A 1AODA 3EYPA 3G6MA 2DIEA 5FKYA 3B8UA 2DZXA 4HNUA 4UTLA 3CL6A 3B8TA 1P0KA 3B0VC 4LVDA 2O7QA 1MMFA 1P1MA 3D46A 2HWGA 1PTDA 4IM4A 2XN0A 2E77A 1NOUA 1M7JA 1X6LA 4GFSA 3UJ2A 1S5WA 1MO0A 5CLWA 2GUBA 3VM7A 3G0XA 3GYEA 1EC9A 1HVXA 5EBAA 3TH6A 3U7VA 1GVFA 2JKEA 3RRXA 3VABA 4FLQA 4PUKA 1OFEA 4UIOA 2WVVB 1Q45A 3CJPA 3L4WA 1SFSA 2I16A 4GC3A 3WEMA 3NM1A 4QROA 2Y4SA 1XFCA 1W1PA 2YPIA 4HK5A 3P60A 3BJSA 1PV8A 2JFEX 4IX2A 1R30A 1E1CA 4E3VA 3DG7A 1J0JA 2YL9A 5CPSA 5DMLA 2YL5A 2FGBA 3IUIA 1UOKA 1VHNA 3A23A 2A79A 1GONA 2FVKA 3A9IA 4WK9A 3UZ5A 4B3KA 1QNRA 5I5RA 3QMSA 4W8LA 1WXZA 2V9DA 3WLHA 3GXIA 3QPZA 4WGXA 4F2BA 5C0QA 1SW0A 2FZNA 4MPQA 1UCWA 4DZIA 5EMUA 6REQA 1LCOA 4GYFA 4B92A 3HU7A 3GRIA 3O2LA 5A6KA 1ZHAA 2HSAA 2PTWA 3T09A 1UR4A 3W7QA 5F2IA 2E9MA 4DB7A 3SEPA 1G4PA 3SECA 5FEXA 3FKKA 3KVMA 1LL6A 1IT7A 6TIMA 2DSKA 3TE9A 3NOEA 3PJUA 3DH7A 4B4HA 5LKYA 4JQ4A 2QIIA 3N6JA 2XSXA 4H41A 4MJ2A 5GNZA 4F0SA 1BYBA 4AFYA 2OO0A 3S8HA 3ES7A 1QI3A 4IQLA 3STEA 3P2VA 4KF1A 1QAPA 3NVTA 4HU3A 1TREA 3NYDA 3KOXA 2D0HA 4PRWA 3W1PA 3F4WA 3PWIA 1PZ2A 2GSEA 3OYZA 2YBTA 1J2WA 3ES8A 4RDWA 1HJQA 3GDLA 3WIJA 4DF2A 1GK8A 1A3XA 4HPHA 1C7TA 3AS2A 3HPSA 3MI3A 4GYJA 3CTTA 1XD0A 1J11A 3WNLA 1WX0A 5G2WA 4YXGA 1S2UA 3DKLA 3H53A 2BVYA 2J6XA 1H50A 2DV0A 1EOKA 1AA1B 3AU6A 2GUYA 1WE5A 1AG1O 4GKLA 1LYXA 1DJWA 2YCEA 4GQRA 1OZQA 3MDUA 2A3HA 2WVUA 3VA8A 1JJKA 4JTRA 4XQ6A 2B31A 2C1GA 3R58A 1AJZA 4IPJA 4XVDA 2Z1XA 3LK6A 4LBUA 1QW8A 2WC3A 3UETA 5BXSA 3LBMA 3PBMA 3P81A 5D4YA 3T0DA 3CPRA 5A3HA 5DQPA 1OSEA 4KKXA 3IGHX 4KERA 2QUUA 4CQDA 5BXPA 4IP4A 1PWMA 3GE7A 1BWVA 1OM0A 3A4JA 2OYKA 2QHAA 2ZFAA 4GUJA 2GQAA 3W7CA 3U2OA 2B7NA 3TC7A 1OX5A 2WNZA 3TYZA 2D24A 5M17A 4Z1YA 4HA4A 1QTWA 1X1OA 3W7EA 1YTDA 5DN1A 2ZUNA 3KBWA 3OYXA 4HMDA 5HR6A 2NSXA 3GG1A 1ICQA 2PDPA 2VELA 4ZB5A 1R86A 4MFEA 4M5PA 2VX7A 2GSHA 1WDWA 4UTKA 3VNKA 1YHTA 2YCLA 3KP1A 2G4JA 3UJFA 1Z32X 1JD9A 5G4WA 2OO6A 3W73A 1OIFA 1EEXA 2CKRA 1XGDA 4Q8PA 1E0VA 2ON3A 1LOQA 3WQ4A 2X0HA 2J24A 3MHFA 2QV4A 5BROA 1R85A 1H51A 3LHWA 1GYLA 3BG9A 1CB2A 4K8GA 4FF7A 3WK2A 4GYPC 4TVCA 5F1VA 1TVPA 4JY9A 1WBHA 4EIVA 1PUDA 1AVAA 3ZR5A 3KL5A 1O6IA 1TV3A 8CGTA 3LLDA 1VJIA 3DERA 5FD0A 1ZUAX 3DFTA 2WKGA 1J4EA 3FVMA 2EHHA 2AMGA 1K8CA 3PHAA 3QMRA 2G95A 4Q8WA 2AKMA 5REQB 4C7GA 3TYBA 3QQ1A 2Y7FA 3CHEA 3GK0A 3P0XA 2PP1A 5EA9A 3V0UA 4UQBA 4E8CA 2CZEA 1RJRA 2OB3A 1B9ZA 3DEQA 1AMYA 4L1GA 1H7NA 2VJXA 4HNOA 3S5NA 2PP0A 1RALA 1B3VA 3CAQA 1HX0A 2OT1A 4JHMA 3F4VA 3EPMA 2YOCA 4O12A 1F61A 1TJ1A 1EJVC 5IHSA 4YVXA 3BLEA 1LG1A 5FEZA 2BOFX 5DBUA 4WJEA 2YFOA 2VX6A 1RQEA 1LTDA 1DJQA 4MWAC 3PVFA 4HPJA 3EX3A 3LPFA 1CI1A 5MKGA 2WV8A 1K77A 3NO1A 2Z24A 5LXEA 4WEVX 2VEFA 5E5CA 3PSWA 1GVYA 4HJWA 4CNUA 1TRDA 2B7OA 2CEQA 6XIAA 4ZB0A 3AWNA 4EF8A 1W1VA 3RMJA 1M65A 2BFGA 1SUXA 3T1GA 3HQ1A 3LLXA 2D23A 3E0WA 4OWGA 1HKKA 3S1UA 3CNYA 1VBRA 4ACZA 1H0GA 4NRRA 1VEOA 4UR7A 4CNOA 4WHBA 3PR2A 2QW5A 1YLVA 5EY5A 1YMYA 1DXIA 1R3QA 2HK0A 3C52A 1MEIA 2OWWA 4ICMA 2XJ7A 3DFNA 2W67A 4JQ3A 1WZKA 4MNJA 1WAUA 2QGHA 3PPHA 2J4GA 1HO1A 2PD5A 3A21A 5CC6A 1KCKA 2OOGA 1TV7A 1QW7A 5KZMA 2OPJA 1Y5VA 3FLUA 3LHVA 4PFMA 3QLLA 1HTIA 4FR6A 3RO6A 1EQCA 3I65A 4I7VA 2FH6A 5FF3A 2ZUUA 1O4UA 3PJTA 3ANUA 1ZTVA 3CWOX 4IIHA 1A4LA 4ZBCA 3L2LA 3WF3A 3HA1A 4QQUA 3ARZA 3DECA 1UZHA 3W7KA 5A6TC 3TDFA 4PTMA 4WQ6A 1QDSA 4FLOA 3WDHA 3E2QA 2WSRA 4K68A 5REQA 4S3KA 4Y8EA 3N1AA 3TQ0A 4HPXA 2YDQA 2ZDRA 5C2XA 4IGMA 3AS1A 4AW7A 1FWDC 4YS1A 2IXVA 3OO2A 3RF9A 2QCDB 2D2GA 1TUFA 2EGZA 5ABGA 3VILA 1ENUA 4W9TA 4TVUA 2ZYFA 2R1PA 2Z1VA 2D0GA 3ARXA 1MFUA 1WKFA 3HJEA 3W23A 4U3AA 4D1JA 3VDCA 1KCLA 2V81A 3THCA 4B2DA 1P43A 2AGTA 4X0NA 1JZ6A 3OODA 5IBXC 2GVLA 5I24A 2OXNA 2VCBA 3CZKA 2X42A 1T96A 5JH1A 4GVFA 3BSGA 3V35A 5CBIA 5G4EA 2R8WA 3AO0A 3EX1A 1RJQA 3C0QA 1D9EA 3P5YA 1ZU8A 4BCEA 3RLVA 4A6GA 1GQNA 1TV5A 2GSJA 2OEJA 4UTFA 4RE4A 3VMOA 1P1XA 3I68A 1NDZA 3I6RA 5BXRA 3MW7A 4FX6M 3ZVIA 4FS9A 4L1WA 1CLKA 3EOSA 2Y89A 3VU2A 2ADAA 2HNEA 3DHFA 1BVWA 3P3BA 5CXPA 1ZFJA 4JEJA 2YLAA 5FF7A 4JIIX 1ITCA 4L9ZA 1GOKA 1K7XA 1HKMA 3CV2A 7ENLA 2FPYA 1G7VA 5E6YA 4AXNA 2BB0A 4YNGA 1CGTA 4JIHA 3MHGA 1GOWA 4H9ZA 1KO0A 5T9CE 1PO9A 4BI5A 3CL8A 2AOSA 1NWTA 3L4YA 1SGJA 1I9CB 1RBLA 5CZKA 3ATYA 1MXSA 1CLXA 1KBJA 3DN5A 4HQVA 2X1RA 3WQPA 3NXFA 4TO8A 1AD4A 2ZZ4A 3KS6A 1BLIA 3IJQA 2YDAA 1WDPA 3ID7A 3Q58A 5H8PA 3CU2A 4IUOA 5DY2A 1TZ9A 4I8DA 2VNCA 5DT5A 4C6KA 3I7QA 1L0PA 3AXHA 4G7EB 3MBDA 4I3GA 1EA0A 3HQNA 2XVLA 1O5KA 2DGAA 3MZ2A 4LUIA 3C86A 1XLAA 1LJYA 3SZ8A 2QCGA 4TMBA 4C6IA 2WHLA 4D8LA 4H6RA 5M3WA 4AD3A 2IKIA 3I10A 3RAOA 5D8WA 1ZBKA 4N0RA 1XLIA 1QHOA 4JDYA 4OBSA 1QU4A 3WLQA 1QNSA 7CGTA 3E74A 2G5WA 2V5KA 1NOWA 1S2VA 3W1RA 3TYDA 3ZXWA 2WLZA 3HF3A 3DYOA 3USZA 4BS0A 1O94A 3AIQA 4R9OA 4GZ7A 4JTFA 3SJ3A 3NL6A 2V5DA 4KGLA 3LHUA 1ZCOA 1Z69A 3IIXA 1YADA 5DANA 2CLOA 4LOCA 3W87A 1E9YB 5DT7A 4O14A 1F9CA 2XSAA 4XG1A 3RRAA 1TR9A 3IJ6A 1JZ2A 1EIXA 3FAXA 5F4XA 3WQ8A 1HW6A 4F48A 1G9HA 5FSEC 5BXTA 2L5HA 4AH7A 1J18A 4V33A 1IWBA 4MWAA 3F03K 3INPA 5AHNA 4D6DA 3N17A 1RLDA 3G2GA 1UOZA 1BSLA 1Q5MA 4DI8A 3UESA 4ZOBA 5EL1A 1D3CA 4BWLC 4XUGA 4M56A 3NL2A 5D38A 4BF9A 3UJRA 3QV7A 1C9DA 1UD8A 3G3MA 3E49A 2WJFA 3V36A 1S3HA 2ZIDA 4ZFMA 2ZUTA 2PRLA 4XVEA 1R46A 3UG5A 2ASHA 5FJIA 5KETA 2X05A 2XFRA 1MDRA 1VKFA 1EDGA 4PMYA 4FO4A 1WDDA 3KS5A 1J6OA 3M6YA 1UKPA 3MYPA 3U8GA 4M0XA 2POZA 3ARYA 1TR1A 2Z00A 2NX1A 1UB3A 3WD2A 1DWGM 5I2UA 1EUNA 3F4DA 4HTBA 3IIPA 3WLRA 5ENLA 4I9TA 1CCWB 4XZHA 4NJGA 3AIWA 4LGXA 4FAMA 2VRQA 1GTHA 1OFBA 4JTIA 4QCEA 3L4TA 4BEQA 4A3YA 1TE1A 3GY1A 3EDFA 3VOGA 4W89A 5BU6A 2QCLA 3EKGA 3L4XA 4W5UA 1JG9A 4HMCA 1BRLB 2FMNA 3K5XA 3HZ3A 4GOAA 4HU8A 2OELA 3G8RA 4Q8OA 3ZJ7A 3PPFA 4TUFA 4NZ1A 3PM6A 3SY1A 4QS5A 5E09A 1DWFM 3R6IA 4PMRA 5CQ1A 3KVJA 4AMAA 2R1KA 4ACYA 3STGA 4CU7A 1R9ZA 3BVJA 4WR3A 4U3CA 3R10A 1D8WA 3S0CA 3UXDA 1RCQA 1XDJA 1ALDA 1N82A 3W6MA 1RJPA 3BL3A 1F7BA 3AYSA 4GCXA 2G97A 2P0IA 4MY1A 3DUGA 1OEPA 2VEGA 3WQOA 1W32A 4OJYA 3VIPA 4IJCA 5AVHA 4E3TA 5I3GA 5FA5A 2PBGA 3DKJA 2E9LA 1XBYA 4XAFA 5I3JA 3AI0A 3TV8A 2X2YA 4GC4A 4NX5A 2ZXBA 1VCGA 3BE7A 1XCFA 3NAVA 4Y7EA 5HWNA 2X09A 3T0CA 3S9ZA 1KM3A 3SCRA 1MDLA 5K9CA 1KM1A 1AUSL 3TTYA 3PANA 4PMXA 4IPPA 2CLHA 5EMKA 2QR6A 4Q4QA 3T6CA 3S3GA 1QI0A 3WO8A 2Y62A 4I8YA 3PJXA 3P0WA 1V3HA 4K39A 1TJ2A 1W3NA 1XKJA 4R3UA 2WWCA 3ECQA 4F0LA 4DWSA 4GKTA 4CQ8A 5M5DA 2QCHA 3ZJ6A 3M0KA 3G6LA 1DP0A 3KDNA 4QAWA 4A3RA 4F3HA 2ZZ7A 2ZVIA 3TJLA 2ACRA 2VGGA 1W56A 4PBEA 3IEBA 1XIBA 1T8XA 3OQEA 2EG7A 3ABXA 3P62A 4FNRA 4HYWA 2TYSA 4DO4A 4LC8A 1WXJA 4UFHA 4HZ6A 4S3AA 5CJ5A 4XTDA 1O1ZA 1A5SA 4AIBA 1E6SM 1MEHA 1GKQA 3CLMA 4HZ7A 1LWJA 4GXPA 3H2CA 3B0PA 1YTEA 2QUNA 1EX1A 3ONBA 6A3HA 3AIUA 4XZNX 2F6UA 2VFGA 2FIQA 3N9RA 2QAPA 2H9AB 1XYFA 3U2CA 2Q8ZA 4HZMA 2ZA1A 1VD6A 3TMQA 1TA3B 3VO0A 2BVDA 4J27A 5BU9A 3ZIZA 2XIOA 1JPKA 3V75A 1E5JA 5A2CA 3N04A 4MKSA 3A3WA 5IHRA 4S3EA 4TTGA 1JF6A 3EMCA 1HKIA 4IXXA 4GISA 2X2GA 3EB3A 4NUWA 4J3UA 3UFYA 4UBPC 2FFCA 4DM2A 3E6EA 1QPRA 4GY0A 2J8GA 3BAYA 2IKGA 2YB1A 4A8LA 1Q65A 2DP3A 5B7ZA 4QG8A 5G1YA 2Q3OA 3IUHA 3NQ2A 2ZA3A 4S23A 3RCYA 4AVOA 2PWHA 3WH8A 1EBHA 4J35A 5E0FA 3W3OA 3W7PA 4FXJA 2YBVA 1DHKA 5DFAA 4QE4A 4NAFA 3QZ6A 1WQ5A 1ECQA 3S5YA 1W9PA 3VCNA 3NQGA 1NAL1 4HU0A 4L9YA 5HJYA 4OTKA 1AH4A 4P7QA 3GR7A 2HJPA 1F3EA 3SCNA 3KLLA 1VENA 4OVXA 5C54A 1GKPA 1DYSA 4LCRA 4NJKA 2OFJA 2CLMA 3C8NA 1UP2A 3WMBA 5JVLA 4W86A 1FWWA 5HMFA 3HGJA 5M03A 3H70A 4G8TA 3BG3A 3HFYA 4O1FA 3POHA 1WZLA 3AXIA 2CWNA 2Z29A 1HG3A 3OP2A 3TWAA 3AIEA 5HAOA 1A49A 1E3XA 3HMJG 3F1QA 2OOFA 3V1HA 4XZLX 4GI6A 4RPPA 1R7OA 2EPNA 3W1XA 4O1CA 1TMLA 1C9WA 1E3ZA 2C3ZA 2BZNA 5FF0A 4Q4PA 4DZ5A 1TVNA 1YXYA 4AG0A 3S46A 4PL1A 4G1NA 4JGDA 1MVYA 1A0DA 1UJQA 1W0MA 3W29A 4W85A 2R94A 1CXIA 1DXEA 4KBXA 3ITCA 1C90A 5MKGB 1FDZA 4EPEC 1KBLA 4H2CA 1OC5A 3GDKA 4IIGA 4Z2KA 1IT0A 5LNSA 3QKEA 2NV2A 1ICPA 4U28A 3N2BA 1U5VA 3C4UA 1TFVA 1W1B1 1TQJA 1G4TA 3TP4A 5CH9A 4RR4A 5H91A 1FWJC 2FZ8A 4FXRA 1PKLA 5BOOA 1ECEA 1UPPA 5CPNA 1SSGA 5LHFA 3FJ4A 4Z1BA 3PN8A 1F07A 1OT2A 1SR9A 7REQA 3DDMA 3WL0A 1MNZA 1BYDA 3MPGA 1SZRA 2J7CA 4FMVA 4CVWA 1LOLA 5AOUA 2Q02A 4QLLA 1P0EA 1CXEA 1EA9C 4I9AA 4IPIA 3EZ4A 3OVRA 1JFHA 4N9DA 3PZMA 5C2GA 3WUBA 3SCUA 4P7OA 1V3MA 4CN4A 5PTDA 1E51A 2AL1A 1X7IA 2XVPA 1WCGA 4V1XA 4NJIA 3F4CA 2VDHA 1RP8A 3RG6A 2PTYA 5I02A 4IMDA 3DYPA 3C2VA 3BXWA 2NUYA 3ZR6A 5C55A 1XS2A 3H12A 3U4FA 4IMFA 3Q67A 1PBGA 1TJ0A 1EYWA 3TJXA 3AFBA 1DIEA 4ZCWA 4MHBA 3CUFA 3WBXA 1M6JA 2RKXA 1VGAA 2GWNA 3CAKA 3VOJA 1TG7A 5JUVA 3I3DA 3VE7A 2D2OA 2DQWA 2XVKA 3O05A 4NF7A 3TCEA 3E1F1 3W9ZA 3F5LA 1IEWA 4DYJA 1SW3A 1A5MC 3ITGA 2G41A 4HYRA 4MNLA 2J13A 3MANA 2OGJA 3KRSA 1XPYA 1GQLA 1BTCA 3GIQA 3GW0A 1K8ZA 3HGOA 4KFPA 3TVAA 1ADDA 1W8GA 4QR6A 5FIPA 4C1LA 2RGLA 4REQB 1OT1A 3HBLA 1H11A 1VFMA 4LB3A 3U3HA 6REQB 4B2DD 4IWWA 2ZXDA 1AFSA 1O60A 2C14A 3F5JA 3HMCA 2GFTA 4AF0B 1ITUA 2FTYA 2V5LA 1RH9A 5LIYX 3W7DA 4OKDA 3OJGA 5A2BA 1CX9A 3NSMA 4KCVA 3RO8A 1BXCA 3U2EA 1W3LA 3UNTA 2GJXB 3FSTA 5E9AA 3EWBX 1NIUA 3AMKA 4HNTA 2CHOA 4XIAA 4Q6JA 4BF7A 1E72M 1PDYA 3OGRA 4H2HA 5DRCA 3I4EA 1VFSA 4J2MA 3VKAA 4KMQA 3GM8A 4IOTA 2WMFA 3P82A 3PULA 2H3DA 2ZUWA 4AY7A 3SN1A 3DHUA 3WD0A 3L0NA 4PMDA 3T8QA 1EXBA 4H4IA 2NLIA 4RDYA 3A9BA 1FFQA 5JQ9A 4M6PA 4XB3A 4HCLA 1GHRA 2JIWA 3VGHA 2PLJA 3EBVA 5GVJA 3HB9A 2HXUA 2JF6A 3C3UA 3CHCA 4GINA 3URBA 4OOUA 1VPYA 4JZ5A 3ZYZA 3VOIA 3ZVHB 2OSYA 1VCVA 4UNIA 3NGJA 3R13A 5D2WA 1FCBA 2IKJA 5HANA 4IFOA 1TWZA 3PAJA 5LXXA 3V0TA 3MY9A 3UR2A 3GHRA 5H1WA 3SQMA 3LV5A 1YXDA 3PWGA 2Y8KA 4G1KA 1OG6A 1ZNNA 1W5OA 3V5CA 3WEOA 4J3SA 1A5NC 4HMNA 3ITXA 1KXTA 4QP0A 3A24A 5BCAA 2HZGA 4YTSA 1FBAA 1TE6A 2CBJA 3DAQA 1PIFA 4HA1A 1S2WA 2A3EA 3GFZA 1JCJA 3LQGA 4F0MA 1W3HA 3UWUA 2OZ3A 1KBIA 4IIDA 3QY7A 1I75A 3LX9A 3VKJA 3IJIA 1KD0A 1ZAHA 3V3WA 1B4EA 1NY1A 3VI2A 1VC4A 2VR5A 1KC7A 4U31A 4UR9A 4IGHA 2W3ZA 1AJ0A 1AZ1A 3CT7A 3L5AA 4AY1A 4IPLA 3GIYA 1LQAA 4WF7A 4IIBA 4NZ5A 3BGGA 3DENA 2O0TA 4D72A 4GI9A 3L5MA 3ZFHA 2DQXA 4KWWA 3PTKA 2V2DA 1XG4A 3SM0A 5CPMA 5DELA 4D6JA 3GG8A 1NDWA 3LCGA 3GXNA 2Y7DA 2FTPA 2OQHA 3BMWA 4QNEA 5AC6A 5FF2A 5BRPA 2QGYA 3CHFA 1QWGA 4PZVA 5DCDA 1ZAJA 3PUGA 2FYMA 1OG0A 1NDVA 2OTDA 4PTVA 3TQKA 4ZFCA 3B40A 1QO2A 1JRCA 3D0CA 1ONXA 1ODUA 1QK0A 2EJAA 2QV5A 1S1PA 3FDKA 3T2OA 5LGXA 1JPIA 3KRUA 2VEKA 2Y1HA 4NYUA 4C1NA 3W0KA 1GVRA 2WHKA 3MCMA 3FXGA 4XAYA 4K7YA 5E70A 2CLFA 2ZRVA 3SR7A 3M07A 4C6QA 2VFIA 4HNVA 4B5UA 4KT2A 3BJFA 2PBOA 3QSTA 2Y7EA 4MYAA 1HGWA 3VYLA 5HPCA 2GDUA 1JPDX 1JZ8A 1NSJA 2VXNA 4Y9NA 3UG4A 2BGSA 3A13A 3H2EA 3IGSA 3MUCA 4M19A 3WLLA 1TWDA 1MRAA 3DFSA 2QCNA 4EAYA 1CXHA 4JR5A 1LLZA 2GGEA 2V3FA 4MWAE 2DZVA 2XZ9A 1QT1A 4LTSA 1E4NA 2P50A 2QJGA 3CV6A 1R3RA 2C1HA 4TV6A 1TMHA 1WDRA 2HK1A 2PDJA 2X1SA 4UFIA 3ZS4A 2V38A 4O1EA 1KB3A 3U57A 2H8ZA 4DF0A 4EWND 1P7TA 2VENA 1T0OA 2WPBA 2ZX8A 4MVAA 3H7UA 2DW6A 3TA9A 4AZ6A 1NFBA 3VINA 4UFKA 1R38A 3VIJA 2OZTA 2O55A 4NZ3A 2O56A 4DO5A 4J28A 1BRLA 4LF2A 3LM7A 4AB4A 3UGVA 3N9KA 3W7NA 4PMQA 2VC5A 5A6JA 1KM6A 1W54A 3SBFA 3TW6A 3WLIA 1WZAA 3CQKA 1FP9A 2W61A 2ZRZA 3B9OA 1HJSA 5AHEA 1JI2A 3QYQA 2WJZA 3WLKX 2C8NA 4DUOA 3W2KA 4C6EA 3W7JA 3W2LA 5L9FA 3BSMA 5LZLA 4R88A 4UCGA 1EJRC 2P1FA 1ODZA 1CW2A 3HG2A 5U7SA 3E0IA 5DCBA 5EMYA 3UR5A 3LOTA 2P3ZA 5BRBA 2VDGA 4JX5A 3TJIA 1GW9A 1EHAA 1O5XA 2PWEA 2BOEX 3FVDA 1EC8A 3JZEA 3E38A 3KE0A 3RILA 3W26A 2ISVA 3LMZA 4FR1A 4MLRA 2BSLA 4LC6A 3H23A 1G94A 3AUJA 1UWQA 3LA4A 4ZEPA 3MWAA 4C6PA 5D2XA 2UWFA 3FYYA 1JPHA 1HKVA 1YPIA 4UTJA 2QNEA 3VGFA 3WJXA 4EE9A 4GHRA 4PTWA 3SUTA 1XQKA 4RNIA 4QJ4B 4L4MA 3EWUA 3KUMA 3GTNA 1E4LA 5M2FX 4JYDA 3WDJA 5HA7A 3NM3A 4RDVA 1VFTA 2V5CA 1YNPA 3UPBA 4OE7A 1ZJHA 3S42A 4X61A 4PCPA 2QMJA 4MZ1A 3FFSA 3P80A 4L64A 1TKKA 3G1XA 4PUWA 1R2SA 3W1NA 1B90A 3UF9A 4AQLA 4WSHA 4XAGA 2EQDA 3BANA 4AC7C 3EDKA 1Q4WA 1TX0A 4J3XA 4AZ7A 3EOUA 5FEPA 3F2CA 3R25A 4XK2A 4DZAA 1UD2A 3LSBA 4FOKA 4ORIA 3RM8A 2NQLA 3F2BA 3GH4A 2C18A 2VI0A 3FV9A 4ZSUA 1G7UA 5AYXA 4L4PA 3RU6A 1G5AA 3EB2A 1R7AA 3W7HA 4FIRA 3CZ8A 4OFCA 2HVMA 2EG6A 3OTRA 1XLGA 4AHQA 2HS6A 4XAZA 3S5ZA 2Q8LA 5I6SA 3QHOA 4JIEA 4QDMA 2WKJA 5CZSA 3LCWA 1P0BA 2WJEA 2Z4GA 4IL2A 2J66A 1NFGA 1RBOB 3GUWA 2VRJA 4QRNA 3C2EA 3PF3A 5FJOA 3PZIA 3G1RA 5D9MA 5ABFA 3FDGA 4LUTA 4R7WA 1TWIA 1RCOB 3NJ3A 3CC1A 3VCRA 4AHOA 1KM0A 3HV9A 4O17A 4KWSA 4ZO9A 1LP6A 3L7RA 3TU9A 3NYZA 3WH6A 3ZWTA 4WSJA 3ANVA 1EDTA 1U83A 1PKMA 1MFVA 1ZBCA 3AQUA 4XSLA 3MSRA 4Y2WA 1ZB5A 4H83A 2NXIA 1GGOA 4BWLA 2WLYA 5B80A 3TZFA 1VJSA 3BARA 3C2FA 4GVIA 3NPVA 3L2MA 2HRWA 2I7GA 2J78A 3T4CA 2NXHA 1XLHA 2W4XA 1TV4A 3N4EA 2DUAA 3MUY1 3TC6A 1PZ0A 2YL8A 1XCXA 4M6UA 1QFEA 4IMGA 4UTWC 2ZZ3A 3NURA 3EX6A 4G7EA 1NQKA 4DX3A 1EO7A 4O8AA 1KRBC 2PLKA 3UD6A 1DPMA 3DBPA 4M3PA 2PB1A 3QQ0A 1GTEA 1RZMA 4BEUA 5HK4A 3KWXA 4ROQA 4WKHA 3PB0A 4JTKA 3G3DA 1W2VA 1FDJA 3GXFA 5FCZA 4M81A 1XI3A 4Y6GA 1JCTA 1OFOA 4EKJA 3NQFA 2VD8A 1XLLA 1TIWA 1IZJA 3R2GA 3WQFA 2FHFA 3TFXA 3TQPA 3WD1A 3G0UA 2C79A 1BG4A 3BURA 1HKJA 3VFLA 2OLHA 3LM3A 4JIPA 2D2JA 4KCTA 3W7MA 5H2ZA 4BQ4A 2DUXA 5AHFA 3BK0A 1W3KA 3ZLFA 4QBXA 3J7HA 4Z1CA 1KFWA 9XIAA 1XYBA 5BOEA 1BGGA 3BUVA 3QFEA 3D5HA 3OZMA 4O4VA 1GYNA 2OODA 4WVXA 3P61A 1VFLA 2I5IA 4FSAA 3VMNA 4OZOA 5ECUA 2WKLA 1HJVA 3K2GA 2Z7GA 1J5SA 7REQB 4GX9A 3THQA 3G22A 3P6LA 3ITVA 4N42A 3W75A 3BWWA 3TQVA 4KEUA 3RJXA 1PCWA 6ALDA 1V6VA 4JDBA 3TN3A 1J79A 1LORA 1LG2A 4UFMA 1LBMA 4FNTA 5CG0A 1R3VA 3SSZA 3N3TA 3UG8A 4PB5A 4WDXA 2O4MA 4X0VA 2CESA 4Q4MA 3SIMA 4PMNA 2QUMA 3K1DA 2BODX 2PURA 2WZHA 1OK6A 1KV5A 5HQEA 3PZUA 1QJWA 3VOCA 4GVGA 2FZMA 3R94A 1EGVA 2HEJA 1SJBA 1KM5A 4LUYA 1QMLA 1CWYA 3VD4A 3W1TA 1XYCA 2GL5A 3AIBA 3HGSA 3P84A 1BXBA 1OABA 2O7SA 4H9UA 1JGIA 2W62A 5T8GA 1N8FA 3A47A 2GQ9A 2GGGA 3TSDA 1XJBA 2OVLA 3P14A 1RA0A 1E6XM 3TN6A 1DQXA 3EX2A 2HCVA 4J3ZA 3MVIA 5CGMA 3KHJA 2RDTA 1S1RA 3SGGA 4IGSA 4O53A 5AHIA 3AC0A 4CQ9A 2EJ1A 4OBRA 3TK7A 2QDGA 1XLJA 3APTA 3LQLA 2I5GA 2P88A 3SI9A 4ILSA 4KPLA 2VC9A 2R9RA 4GGBA 1AH3A 1H1YA 1LOSA 4LSBA 3USBA 4PUMA 3L9CA 1F4AA 4P7LA 3LD5A 4NP7A 2ATSA 3KOYA 3W1AA 1KWKA 3RHGA 1XLDA 3VNYA 4EF9A 3R5EA 3ZLGA 4DUXA 1YYAA 1GOXA 3IARA 1XXXA 3Q4DA