1C8YA

Endo-beta-n-acetylglucosaminidase h, d130a mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFADEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
total genus 91
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c8yA00
2GJRA 4LQ1A 3BAYA 4EK7A 5E09A 3W4RA 4AIUA 4AZCB 3NDYA 1TR1A 2JIWA 5A6JA 2QV4A 4WSJA 1K9TA 1U33A 3QHMA 1US2A 4B16A 4WIWA 1HXJA 3OIHA 4J3XA 1FA2A 2ZX8A 3MV01 5HNNA 1OIMA 2QPSA 1F4AA 3BAWA 3WMSA 1C8XA 1E4LA 4Z2IA 1ECEA 3T2OA 1UYQA 5EFDA 4CU6A 5BWFA 4PTVA 1BVZA 4P7RA 5CGMA 1MFVA 1KXTA 2MANA 3AIEA 4BZYA 3VINA 5CZKA 5I3DA 4MADA 1QNPA 3SCPA 1E0WA 3ZIZA 3VVGA 3AICA 3EMQA 1G9HA 2ZWZA 1H3GA 1ZBKA 5A2CA 1W9DM 3WUEA 2BVTA 1CPUA 3WF0A 4HZ6A 4F9JA 2WLZA 3MMUA 3RJYA 1XV8A 1EXPA 2XYLA 2PWHA 3W6MA 4AWEA 2EEXA 1OGBA 1KGWA 1HNYA 1W2PA 5A6KA 1UKOA 1B3YA 1BF2A 2YOCA 1CWYA 2JF6A 2VZOA 3VMOA 2VNCA 3TTYA 3DECA 3HMCA 1UWRA 3WF3A 2YLAA 1NWRA 2BVDA 2X0HA 1PIGA 1CLVA 2AAAA 2WKLA 2CEQA 3KL0A 3U7VA 4P8UA 2J75A 3GBEA 3KEHA 4MPKA 4RE4A 5DFAA 1US3A 2QMJA 2WPGA 3VILA 2DT1A 4JL2A 4PN2A 3N9KA 1K9FA 1GOOA 4RE3A 1E6XM 3A3HA 1CXFA 3WQ8A 3TTSA 5DO8A 2XVLA 2XVPA 2EPLX 3VTRA 1W1YA 3I3DA 4BS0A 3L4TA 3EDJA 3MKKA 4JHOA 5M5DA 2D3LA 3PTMA 1NOUA 3EDKA 2VCCA 2X05A 1JG9A 4UFHA 1OGSA 1JXKA 5C70A 1EDQA 2XPKA 3TOPA 4D6CA 1NOWA 3FAWA 1VJSA 4HOWA 2EQDA 3WDIA 1H0IA 3PZOA 4AYSA 4V27A 1GORA 1NARA 2X1IA 1CXEA 2G3IA 1E15A 4CD5A 5ECUA 2EPMX 1Q6EA 2VVSA 6TAAA 5ABFA 2W67A 3W38A 5CPQA 5CGTA 5GNYA 3D3AA 3KL3A 3SCUA 1KXQA 1RPKA 1W3HA 3WMBA 3SUUA 3GH7A 2F61A 3UETA 3SCSA 2NSXA 3CIVA 5E70A 4AZBA 1QHOA 1H41A 1OM0A 1TA3B 2JFEX 2WHLA 3O9NA 4NI3A 3G6MA 3K4DA 2DT2A 1HP5A 3FXYA 1HL8A 4M82A 5A69A 4B9ZA 3N04A 5HDRA 1ZL1A 1NP0A 2UWFA 4AZIA 5A6AA 1BYDA 2FDMA 3WQ4A 2WVUA 3GXIA 3QHOA 3MU7A 2BFGA 4HMDA 2Y5EA 1NH6A 3AHYA 4M1RA 1UR2A 4P8XA 5GNXA 2BHYA 4KGLA 1JI1A 1GQIA 4Q22A 4P8VA 2VUYA 1H1NA 4JKLA 3AYSA 2OYMA 4FLRA 1E70M 1WZAA 2A3HA 3EMZA 5JBDA 5FOOA 4DUVA 2CITA 2J7FA 1MW3A 2W92A 1RP9A 3W26A 4YN5A 1CYGA 4PTXA 1JAKA 1W91A 3GDBA 2G3MA 3W81A 3WUBA 1TA3A 3PZMA 2V3FA 1BQCA 1UR8A 2Y24A 4P7OA 4WKFA 3NJ3A 3RM8A 3F5KA 2XWEA 1CTNA 3SCQA 3VNZA 2PWDA 1J0YA 1QVBA 2Y2WA 2X2YA 1BPLB 3SCWA 4TTGA 4GXPA 2CBJA 1KR1A 3EBVA 5M03A 3WNNA 4R5EA 1Q6DA 4QAWA 3VM7A 3VGBA 4D6JA 3OZPA 2ZUUA 3T2PA 3NSMA 3I3BA 1XH0A 1JNEA 3SIMA 1ZBCA 4H8VA 2E3ZA 2XFYA 2ZX7A 4H8HA 4FF5A 3MV11 3VU2A 1DWJM 2VZTA 4OIFA 2J7HA 3WDRA 1A47A 4JZ5A 3WDJA 2UY2A 4EAMA 3AZRA 4LYQA 3ALFA 1K6AA 1ISZA 3DHPA 4JFWA 1PX3A 3OG2A 1Q6CA 3VGFA 4J3TA 5A8QA 4EANA 1UH3A 1HF6A 1ZU8A 2YA2A 2JF7A 2J62A 4AW7A 3MUAA 2XSAA 4W7VA 3E1F1 3AIUA 3OB8A 1NP2A 2CYGA 4MJ4A 4LYRA 1CBGA 3KE0A 3S6TA 3HJEA 4NSBA 2WW5A 4UQCA 4MTVA 4UQAA 3U5YA 3PZ9A 3WH7A 3NDZA 4R27A 3SCTA 2BY0A 4FLQA 1GJUA 3WIJA 5I6SA 1NOFA 2RGLA 5BRQA 5CSUA 1UKTA 3ARVA 1JIBA 3GXFA 1V6UA 1PEZA 4M80A 3AZTA 1CZ1A 4DWSD 1M01A 4P7NA 5HOSA 1PBGA 2WMHA 1IT0A 1ISWA 1C91A 2J78A 3HU7A 5I78A 4W8AA 5FL0A 2OSYA 3AOFA 5GPRA 4KH2A 1EOKA 1BVNP 4MNLA 5E6YA 4UZSA 2WC4A 3CHDA 1E0VA 4GQRA 1EIBA 1FHLA 2ZX5A 2WB5A 3LMYA 2Y8KA 3VIKA 2ZXQA 2XVNA 2WMIB 1G0CA 4XX6A 1W3KA 2XM2A 2WM0A 1UR9A 4OBRA 1WZMA 2YBTA 5IHRA 4MNJA 3AS1A 1BGAA 3VIMA 4PCTA 1HJWA 1EDGA 1GJWA 4MDOA 4GZEA 3UR8A 4AZ7A 2J7DA 1XD1A 3AMKA 4PMUA 1JYVA 2WZIA 5LA1A 4OJYA 2DSWA 5A6BD 1W3JA 2CKRA 2XUCA 3U57A 4HOXA 1YQ2A 3VGEA 5CG0A 2VL4A 1TCMA 1VJZA 2FHFA 4UFLA 5A3HA 5IFPA 3WD0A 4AIEA 3CZKA 1JDCA 3W27A 4DWSA 2YBUA 4XV0A 1JAEA 1TZ7A 4B3LA 4CU8A 2XVGA 1PAMA 1QPKA 3VIGA 2G8ZA 3VDAA 4A3YA 1UWIA 1ISXA 4A4AA 3RCNA 2IUZA 4GI8A 4GZJA 2VX7A 4GI6A 5CSYA 4D6IA 2YL5A 2D2OA 4BQ5A 3VIHA 3WDHA 2PBGA 3UG3A 3A6OA 4E2OA 3WBEA 1DWHM 2VQTA 2JEPA 3FY1A 2HISA 2J4GA 3AJ7A 3QGVA 4P8WA 1XCWA 3OGSA 1B2YA 3L2LA 2PB1A 1V3MA 4Y7EA 3WNPA 1CXLA 5A2BA 2CHOA 1UH4A 3THDA 1LF1A 1J0HA 4LGXA 4LPCA 3AISA 3F5JA 4D1IA 3WD4A 4B3KA 2E9BA 2BV9A 1UA3A 1E6SM 2OSWA 1UWTA 2J7CA 1HKKA 1ZBVA 2E8YA 1HJVA 4UQEA 4H2CA 3AHXA 3WH9A 3L4UA 4NF7A 4ATWA 1MQRA 4FLSA 4OZOA 2CNCA 2WYSA 1QHZA 2D3NA 3CH9A 1H09A 2EXOA 1V0KA 3BLKA 4CU7A 2OWCA 3LPPA 1ITXA 1NQ6A 2VJXA 3PZTA 1V6XA 4UQ9A 4J3UA 5CXPA 9CGTA 1U2YA 3QHNA 4AY1A 5I0DA 1BYCA 3KL5A 4MB4A 3EMCA 1R86A 4NZCA 4U5IA 5C8BB 4PTMA 3VX1A 3VGHA 4AEFA 4PYSA 1SMDA 5M3WA 1UD6A 4CCDA 1QBBA 1V6YA 1KQYA 2OYKA 1J0ZA 2ZUVA 2XJ7A 4ZE4A 5I2UA 4ATLA 4CD7A 1E4NA 1W9BM 4DUWA 1JZ2A 1V3HA 3ECQA 3AZSA 4UFKA 1Q6FA 3NIYA 3MO4A 2WMJA 4GO9A 1E40A 3ZJKA 3UR7A 2VURA 1BFNA 4U3AA 4CVUA 1FP9A 5DMYA 3IJ8A 5LA0A 1XCXA 3WFLA 3A47A 2HVMA 2F2HA 2DDXA 2QHAA 3VGDA 4W93A 3APGA 5ABEA 1SMAA 3CMGA 1B3VA 1D2KA 1FH8A 3IAQA 4HPHA 5FCZA 5KZ6A 5F7UA 1PZ3A 3WSUA 5I24A 4IM4A 2F8QA 5IHSA 1HP4A 4AXNA 4W88A 1AQ0A 1WDRA 3W53A 2VQUA 1UR0A 4GO8A 2EPOA 1JGIA 1ESWA 1JZ5A 4W87A 4W5ZA 3IANA 3M6DA 4JKMA 5TD4A 4QCFA 1SFSA 5EFFA 1QNSA 4DM2A 1VIWA 4GINA 3JUGA 4TX6A 1W1TA 2PF0A 3WH6A 3GM8A 3K1DA 3WF4A 3LPOA 1LL4A 3VO0A 2OWWA 3CUGA 5DEZA 3DC0A 5HPOA 1JYWA 2GK1A 4PMYA 3WDQA 2GJXB 5D9PA 2PC8A 1JFHA 5I5RA 2ZX9A 3THCA 3ZR6A 2AOSA 3AI0A 3W37A 4HZ8A 3MSDA 5AY7A 4PMQA 4DUXA 2VVNA 4M56A 2GJPA 3T0AA 1UD3A 1E6NA 2DH3A 1XSIA 4ACZB 5BROA 5A1AA 1G1YA 1C3FA 5LA2A 4UQDA 1MVYA 1GHSA 1R85A 2A3AA 2D20A 3U5UA 1M53A 2NT0A 3M46A 1E71M 1BG9A 1WDSA 2O9TA 1M7XA 3F5LA 3PZQA 3VPLA 3ARXA 3RIKA 1HN1A 3IK2A 4TUFA 1KWKA 5FIPA 3QR3A 1V3IA 4JFTA 1FP8A 3N11A 5DT7A 3L4XA 1Z32X 1E3ZA 1X6LA 3GXDA 3UG5A 3NYDA 2ZXAA 2IXUA 3FHAA 1H2JA 5CQ1A 3M7SA 1BG4A 3FN9A 2PWFA 3N12A 3VM5A 3WH5A 1LQ0A 1QNOA 2XG9A 3WQVA 4UOJA 4Z2KA 3SEPA 3WH8A 3L4VA 4M24A 4UR9A 4PCSA 3G6LA 2CPUA 4PBGA 1J0JA 2XM1A 2XFRA 1VFUA 1RD6A 1KGUA 2RGMA 3ZMRA 2B31A 2GUYA 4AD4A 2YDSA 4DM1A 2J47A 2C8NA 4HTYA 3WNLA 4X0NA 3VD7A 5DT5A 2W4XA 4KRUA 2D1ZA 4GZIA 5BXSA 1OINA 1VF8A 1W9VA 1C93A 2XGIA 4C7GA 4PMNA 3II1A 3FAXA 3OGRA 3OZOA 1O7AA 1R7AA 3GNRA 3AHVA 3AFBA 1JL8A 3NSXA 3VD3A 2XSBA 4ML4A 3RILA 1BSIA 2J77A 2Y8VA 5JIPA 2GK1B 3AIBA 5JIWA 3ZJ7A 3GTNA 2O9OA 3WEMA 2V3EA 2WANA 3AIVA 4W8BA 5DF0A 1CGWA 5A8MA 1C92A 2FGZA 4W84A 8A3HA 1EO5A 1H4PA 1QI0A 3BCFA 1WZKA 2DGAA 1PX4A 4JFUA 5A8PA 1YHTA 1TG7A 3CZ8A 3BGAA 4ZXOA 1QNRA 1RH9A 1XH1A 2G3NA 4GIAA 4TXEA 4QCEA 2GDVA 5ABHA 4CCCA 1Y7VA 2W62A 3WMCA 4BF7A 1UZ1A 1ZS2A 5EMYA 2CESA 2YDQA 2CBIA 3T2QA 2G4FA 5D8ZA 4ZFMA 3BAIA 3TTQA 4W7WA 3AROA 1VAHA 1EH9A 4L4PA 3SURA 1PJ9A 2WHMA 3CTTA 3MUIA 4URIA 1B30A 5IFTA 3NUKA 4PMDA 4OUEA 1DWAM 3WNOA 2E40A 1CIUA 2BY1A 3A4WA 1IZJA 3W0KA 4HMCA 3WDPP 3B9DA 4JL1A 1MQPA 1DWFM 1CECA 2E9MA 1PZ2A 4MJ2A 1QNQA 3WBAA 3BH4A 4P7QA 4QLKA 4UTFA 4HMEA 3VDBA 1XC6A 2WWDA 3T0DA 4TVUA 1AVAA 2ZUWA 3WL0A 4M29A 4AZ6A 2DSKA 2BHZA 3WD1A 2BNJA 1E72M 4D6EA 1QOXA 3PZGA 1FH9A 2X8RA 3AHZA 3N18A 2PBOA 1GUVA 4W86A 1EHNA 1BAGA 2VZSA 1KBKA 2WMKA 3GH5A 2PWEA 1OGGA 4UCFA 1GOIA 1DTUA 2CBVA 2V5CA 2W91A 1W2VA 3VMNA 2W61A 4D6FA 4LX4A 1GONA 4BQ3A 2J79A 1J9YA 4CN6A 5ABGA 1V0LA 1R8LA 2EPKX 3CUJA 4HP5A 3CZJA 1E56A 3AMGA 3KWXA 1OB0A 1LWJA 1XD0A 7TAAA 1DP0A 4ZE5A 3RPMA 1W9UA 3MANA 3TP4A 4F79A 3VKKA 3ARSA 4FLOA 5EBAA 4L4OA 4Z2HA 1E6PA 2ZX6A 1VFFA 5GQBA 3M07A 4XUYA 2QF8A 3CUHA 1CXIA 2WK2A 1XYFA 4AZHA 4CD8A 1JDAA 2E4TA 1H0GA 3FNDA 4E8DA 3W29A 3ZT7A 4WK9A 1GOMA 2CHNA 3L2MA 3CUIA 1UKQA 3VIFA 1WDPA 3ARQA 1UWSA 3KZSA 1ZJBA 2WBGA 3VNYA 2YKKA 2X09A 3CUFA 4TOQA 5A6MA 4GI9A 1WPCA 1J11A 3VIJA 4XB3A 1IZKA 2WHJA 3L4WA 2A3BA 2J8GA 3RM4A 3EDFA 4PUDA 5FKYA 4OOZA 5A6LA 1SR0A 6A3HA 1CDGA 1B1YA 2BXZA 1W9XA 1OD0A 2CXGA 3VIPA 4WF7A 4N0RA 4C7FA 3AS3A 1OCQA 1HKMA 3RO8A 1UQYA 3DYPA 1C90A 2X0YA 4LYPA 3D5HA 4OOUA 1CGVA 3B9AA 1WP6A 4PSRA 1H49A 5BXPA 4ATDA 4PSPA 4CVWA 2YJQA 4PMVA 4H8UA 3WELA 3T09A 2BY2A 2BHUA 5CLTA 3W82A 1GOWA 1UKPA 2VZUA 4PTWA 1H11A 2YA1A 1FFQA 2J7BA 3B9EA 1LG2A 2ESCA 1UUQA 1N82A 3VDCA 1IV8A 1GVYA 1J01A 2VX5A 1TVNA 3K8KA 1DHKA 5GNZA 1W3LA 2VO5A 4QDMA 3GH4A 1E0XA 2WZHA 7A3HA 2W63A 1CEOA 5JUVA 3L4YA 4PRWA 3S2CA 3UG4A 4WKHA 1AMYA 4PMRA 3WD2A 3K4AA 1XSKA 1E55A 1RP8A 4KWUA 1B9ZA 1KWGA 4AD1A 2VR5A 3GNOA 1CGYA 1MXGA 2DQXA 3W25A 3AQUA 2V5DA 1B3XA 1CGTA 7CGTA 1R7OA 3OLDA 4Q7NA 1K9EA 2WCAA 1OSEA 4CN4A 4ZENA 1UR1A 2EJ1A 2WCSA 5BXTA 5D9OA 4F8XA 1JFXA 1GW1A 1GQJA 5HBFA 4C7DA 3TONA 5E0FA 4S3KA 4MAZA 2C0HA 2WC3A 3AYRA 3DYMA 3N15A 3VD9A 1VEOA 3AMDA 2J25A 1W1VA 2G3JA 3ZJ8A 1E9LA 4V28A 1KCLA 3AS2A 1HX0A 2DIEA 1HVXA 4ZXLA 3MMDA 1I1XA 3N17A 4BCEA 4ZEPA 1UG6A 2TAAA 3AIQA 1XH2A 3AXXA 4W89A 1WKYA 3ARWA 3ZJ6A 1EGZA 4D1JA 1VEMA 3RMEA 4AISA 2O9RA 1B31A 5D4YA 1GPFA 4U5KA 4WJXA 1UWQA 3AS0A 3VD5A 4QLJA 1ISVA 2O9PA 3VX0A 2D23A 1BGGA 1OD8A 1QI4A 3SUVA 4Z2JA 3ARYA 1KB3A 3O6AA 2VI0A 2WMGA 4H04A 1NWUA 1HT6A 2AMGA 3SCOA 3RDKA 5CJ5A 1V3LA 2ZUTA 2WSPA 3WFZA 1W9PA 2XVKA 2ZIDA 3CHEA 2BXYA 4CKQA 2YL9A 1V6VA 1DEDA 2WHKA 5BRPA 3W28A 4E8CA 2CIPA 1UD8A 2WMIA 2WSKA 3CPUA 4S3JA 1OBAA 4AD0A 2VCBA 3GNPA 1JNDA 2ZWYA 4A3HA 5JBEA 2QMKA 1EOMA 2GSJA 3PZIA 4V2XA 4YHGA 1MYRA 1JD7A 4CD4A 1JI2A 4W5UA 2UY5A 2DT3A 5FL1A 3BXWA 1GVIA 1G5AA 3PZUA 4NRSA 5A6SA 2WCGA 1VEPA 1ODZA 3T0BA 4TVDA 3SCRA 4YPJA 5D9NA 2E8ZA 2YLLA 1GCYA 4DWSC 2WAGA 1F4HA 2DIJA 2QPUA 1XGZA 2BVYA 2ZXDA 3A4XA 1L8NA 3U7BA 1NM9A 3BAKA 3ARZA 1UR4A 3WF2A 1LJYA 2CERA 4JCLA 4XZBA 4JHZA 2VOTA 4IPLA 2WMFA 1E6ZA 2XHYA 1K9DA 1GQLA 1KCKA 1WO2A 4AZGA 3AXIA 3BAXA 5CLWA 1JZ8A 1TE1A 1EQCA 2VZVA 1MW0A 4JFVA 3ARUA 3AIRA 3WUGA 4U31A 4TX8A 2VX6A 1NWTA 2UY3A 1HKIA 2WWCA 4P7LA 4D6GA 2D0HA 2A3EA 4AD3A 4B9YA 1TVPA 5E6ZA 5A6BA 4UZUA 1QW8A 2PWGA 5LYRA 1ODUA 3ZSSA 1KFWA 2DSVA 3K8MA 1MWOA 1E3XA 2FHBA 1G01A 3VUPA 4CCEA 4AIOA 1KBBA 2WKGA 1DWGM 4F9DA 4NRRA 3BMVA 1JXJA 2GVYA 1XSJA 1AQHA 2ZXBA 3ZT5A 1VB9A 3N1AA 1I1WA 1EHAA 2GJXA 3PTKA 4CD6A 1SYTA 1ZB5A 3MS8A 2VRKA 4MNKA 5BCAA 2E9LA 2Y4SA 4MAVA 3ZQ9A 2YL6A 1WE5A 4H41A 2J7GA 1V0MA 3BMWA 4PUEA 1E4IA 1ZBWA 4D72A 4ACZA 2BY3A 5AC4A 2A3CA 2O92A 2DSZA 4WSKA 1Q6GA 3CGTA 3PBGA 3PZNA 2W66A 1L0PA 4J7RA 4N42A 3TA9A 3MUY1 2YIHA 2WXDM 3GXMA 5E9AA 2ZOXA 2CETA 6CGTA 1PPIA 1HJQA 1MW1A 4M8UA 1WDQA 1C7SA 3L4ZA 4UQBA 2VX4A 5HXMA 2JALA 2DEPA 3N13A 3A4AA 2OSXA 1KGXA 4UNIA 4QFUA 1JYXA 1X1NA 2VRQA 3PHAA 3FHQA 4WLCA 2ZUNA 2V3DA 4D6HA 3BAJA 1GQKA 4B15A 1UQZA 2DT0A 2WVVB 4F66A 3AHTA 1GHRA 3PTQA 5I79A 2VT0A 1QI2A 1XHGA 2VR4A 3CHCA 2Z1SA 5A94A 4OBSA 3UEQA 4IUGA 3CO4A 1H5VA 1JF5A 2EO7A 4CN1A 2VCAA 4IISA 1X6NA 2D0GA 4J3WA 1QBAA 4HZ7A 3AMCA 3EDEA 3B8SA 4Z2LA 3VOCA 1W32A 4JCMA 3HN3A 3SUWA 3UERA 3MUZ1 3VDHA 3VD4A 4AC1X 2UY4A 1JYNA 1VRXA 5CPSA 4BQ4A 1XYZA 3LPGA 2CKSA 4PMOA 3ZM8A 2DPEA 2XGBA 1UH2A 3WF1A 1HVQA 5I77A 3MMWA 4WKAA 1I75A 1QW9A 2YL8A 4BQ2A 2Z1KA 2FH6A 4HA3A 2ZICA 3CHFA 4MDPA 1JZ7A 1QHPA 1HL9A 2GFTA 3WQWA 3OBAA 1W1PA 4XZWA 2XIBA 3CZGA 4MB3A 3I3EA 1UA7A 5D9MA 5A2AA 3VGGA 4TVCA 2FGLA 1CXKA 1ZJAA 1FFRA 5A8NA 1KQZA 3CBWA 1V03A 3DYOA 1C8QA 5A95A 1E4MM 2JEQA 1PX8A 1EA9C 4D71A 4AD5A 3WY1A 4CUCA 1CLXA 4RE2A 3NCOA 4J28A 3ALGA 4FMVA 1EDTA 3WD3A 3PN8A 1JF6A 1E73M 1BHGA 1LLOA 2J7EA 4EE9A 1FH7A 1HJSA 2ZUSA 3WN6A 3BSGA 1MQQA 3AMLA 1VFOA 4AEEA 4UFJA 1V02A 4U2ZA 1HJUA 2WVTA 1GOKA 1C7TA 5EB8A 2ZE0A 1ISYA 2JIEA 1WB0A 2J8FA 3WUFA 1B0IA 1HIZA 3VIIA 4JKKA 2CCRA 4J3SA 2ZUMA 5BYWA 2FH8A 4OKDA 4UOQA 3GZAA 4X9YA 4HA1A 3WNMA 3VIOA 4JIEA 1E5NA 3CMJA 4UOZA 4GPNA 3VMPA 1AQMA 4W7UA 2W5FA 1KXHA 1E1FA 3OA5A 2YA0A 3RJXA 3EYPA 1QI3A 3WQ6A 2Q8XA 1LG1A 2OWXA 4QP0A 3J7HA 3GBDA 4KRTA 1UD4A 1UZ4A 2WBKA 4E4PA 1TFVA 1UKSA 3ZOAA 3RM9A 5KEZA 4KGJA 1VBUA 1UHVA 4W8LA 3K8LA 3LPFA 2WNWA 2GDUA 2QLYA 1BTCA 1V6WA 3QOKA 1MXDA 5IDIA 2CBUA 1MW2A 1J10A 2WLYA 4U3CA 1WZLA 1O6IA 2EBNA 5M17A 1E1EA 1PIFA 3ARTA 4HU0A 4M81A 4W85A 1E43A 5IXEA 2E0PA 4IPNB 4AZ5A 5A8OA 4U33A 1KR0A 5FD0A 4DWSB 3SUSA 4X0VA 1OIFA 1UD5A 3WENA 1M04A 4QLLA 5CPTA 1VBRA 1UOKA 1CENA 3W24A 2DSUA 1V0NA 3CLWA 1V08A 5BXRA 1EQPA 2WVVA 3WQ5A 2VMFA 2WZEA 1CXHA 1D3CA 2J74A 1GNXA 4U2YA 1J18A 1UWUA 1S46A 4TTUA 2VTFA 4UFIA 4HPGA 5E0CA 4MB5A 4H7VA 3WEZA 2D24A 2XFFA 1BYBA 3ZT6A 3BLPX 1A3HA 4BA0A 3IJ9A 4RL3A 4GQQA 3GYCA 3ZO9A 5JBFA 1M03A 3PZVA 1JDDA 2G41A 3OLGA 3SCVA 1NWSA 4HU8A 1DWIM 3O2LA 3AXHA 3IAPA 1V02E 1GOQA 3F4VA 1OT1A 3WKZA 2XIIA 3FW6A 5AYIA 2D0FA 4CGTA 1TMQA 4LXFA 3NSNA 3IJ7A 3TTOA 8CGTA 1LL6A 1TUXA 3CZLA 4JAWA 1C8YA 5ABFB 1JZ6A 3SCNA 4UFMA 5HPCA 2OYLA 1OWQA 1EO7A 1WAWA 3CZEA 1LL7A 4EKJA 3OGVA 4ACYA 4AD2A 2D22A 1E5JA 4D6DA 3WNKA 3WEOA 1WCGA 3MSGA 2XWDA 4YHEA 3SUTA 2JE8A 1Q4NX 4J3VA 4HA4A 2C7FA 1GZJA 3UCQA 3ARPA 1FHDA 3DHUA 5AC5A 3OLIA 3POCA 1MFUA 3POHA 1WNOA 4MB1A 1ITCA 1HJXA 2VC9A 1B3WA 3ZSTA 1G94A 1E6QM 1JD9A 4HOZA 3T08A 3BCDA 2YDRA 4K68A 2OLHA 1BLIA 2VRJA 2XTKA 3WL1A 4FK9A 1D7FA 3OLEA 4GKLA 1OT2A 2WC7A 4AZCA 2V38A 1CNVA 3AIWA 3BSHA 4Z2GA 2PI6A 1LWHA 1FOBA 1UD2A 4MNMA 1JZ3A 3ARRA 3ZR5A 3QOMA 1P6WA 1HKJA 3BC9A 1E6RA 1B3ZA 3W6LA 4PMXA 5I23A 2WVSA 3K46A 3EDDA 4JFSA 1KXVA 1BYAA 1B90A 2FHCA 2BS9A 3UESA 1QI5A 1VENA 1J0KA 2IXVA 2EPNA 1JZ4A 1V3JA 1J12A 5C71A 4AMCA 4PEEA 2V3GA 2NT1A 1CGUA 1CGXA 1J0IA 1VFMA 4PMZA 1U30A 4KMQA 1R87A 5D8WA 1XRVA 4J27A 1V3KA 2DH2A 5AYBA 2NW0A
chains in the Genus database with same CATH superfamily
4Q7IA 4Y90A 3M64A 3KW3A 3W4RA 3NDYA 2CLHA 3A3XA 2FVMA 2NQ9A 4WSJA 4L1GA 4Y9PA 3VK5A 2C1GA 1HUVA 3HG3A 4WR3A 3QHMA 3UWYA 1HXJA 3T42A 2ZX8A 2A2IA 1F4AA 3MCOA 3OODA 1VYRA 3WMSA 2QJHA 3I4EA 3KVKA 1XYAA 1XXXA 5BZAA 4CU6A 2MANA 1KXTA 3BJSA 1GK8A 1MZRA 3VINA 1QNPA 3VVGA 2ZZ4A 2J27A 3R10A 1G9HA 3SRHA 1YPIA 3LDVA 1W9DM 5C5YA 2ZZ3A 1JCTA 3WUEA 1CPUA 4C6PA 2B7OA 3NPWA 4F9JA 3JRKA 3O16A 3RRXA 3EAUA 1K7EA 1GQNA 3LRLA 1CX9A 4HPNA 4F40A 2EEXA 4XAPA 4RZ6A 2A21A 1DE6A 1BF2A 1CWYA 2JF6A 3VMOA 1PKYA 2FMOA 2VNCA 1S2AA 3A13A 3HMCA 4HNOA 2BVDA 3GKFA 1PTGA 1CLVA 2HZGA 3U7VA 1QWGA 3KL0A 5DANA 3R0KA 3GBEA 3I68A 4ECLA 2B4GA 2QMJA 2OFJA 4R9OA 4FNTA 2BG5A 1OZQA 1SO6A 1R5YA 2VFIA 3TTSA 4WRHA 1EWDA 2R1KA 3APYA 2F6UA 2EPLX 1UROA 2C71A 3GU2A 4BS0A 3RG6A 1AW2A 3TAKA 4JHOA 4Z1AA 4I5UA 3SY8A 2D3LA 1FCBA 3PTMA 4Q4RA 3CT7A 3E0LA 1OGSA 3E2VA 1EDQA 4GJ1A 1NOWA 1I60A 4IP5A 4QJ3B 3VABA 3FIGA 1NARA 2X1IA 4ZSUA 3B8IA 4XBKA 1P43A 1B54A 4CD5A 6TAAA 5CPQA 3BLOA 4U4MA 4AB4A 3NQ8A 3D3AA 5BOFA 3KL3A 1KRBC 4RDZA 3S8HA 1LM1A 3SCUA 3HGSA 4ENLA 1FWHC 3WMBA 3FJ6A 3GH7A 3PPCA 3D0CA 3W1PA 2NSXA 4AZBA 1OM0A 4MWAE 2J8TA 4NI3A 3RR4A 2DT2A 3GRIA 3H23A 1NP0A 2OZ8A 2UWFA 4AZIA 1BYDA 4M51A 1PL9A 3WQ4A 3GXIA 3QHOA 2BFGA 4M1RA 4P8XA 3C6CA 2Q8LA 4KGLA 4H9UA 2HBXA 1I4NA 4E3VA 3JS3A 3AYSA 4HU4A 1E70M 1WZAA 3IIOA 5JBDA 2ZE3A 2CITA 1TPUA 1DXEA 4X22A 1JAKA 1GZGA 1GEQA 5HWMA 3E02A 2DORA 4GX9A 1WOAA 4N9CA 3VNZA 4XSLA 4JGDA 2PWDA 1A5MC 1SO5A 2QCHA 1IQ8A 1KR1A 4G56A 4QS5A 5FEXA 1Q6DA 4D6JA 4IT1A 3RHGA 3T2PA 3WQPA 2HXTA 5DRCA 5U7SA 3SIMA 1JNEA 5IBXC 3U2EA 2QF7A 2E3ZA 3TN4A 1XW8A 2PDQA 1XM3A 4QSHA 3PS7A 3DHDA 4JY9A 2V30A 4Q4MA 3W1MA 3NNTA 4QSFA 3T6CA 2YR1A 3AZRA 4LYQA 3C56A 5H8UA 4S2CA 3BLIA 4DAFA 3VGFA 5A8QA 1OY0A 1ZU8A 1UJQA 2J62A 4AW7A 1QWKA 1O94A 3ES8A 4W7VA 2XZ9A 1ZALA 3OB8A 1NP2A 3HJEA 2XZ7A 1ME9A 1XLAA 4CQ9A 4A8IA 4FNRA 1J4EA 4INFA 1K8CA 1KM2A 4AX7A 3RCMA 5CSUA 1JIBA 2QXWA 1J79A 3AZTA 4I8DA 5HOSA 1W1IE 1AH4A 1XLKA 1IT0A 1C91A 1G4EA 1XBZA 1H7NA 3R1ZA 3BG9A 1Q2SA 5GPRA 4KH2A 5KSWA 1TSIA 3MBDA 4F2TA 3GUWA 1TZZA 1ZZMA 1EC9A 1OCBA 2HBVA 2ZX5A 3V18A 5SWUA 2WB5A 3TYDA 3KS6A 2VM8A 1ELSA 3VIKA 2XVNA 4D8LA 1PE1A 3LOTA 1G0CA 4WX2A 2J9YA 3ZWTA 4NI8A 1L6FA 3LI0A 3P80A 4Q8QA 3TCSA 3FA3A 1F6PA 2Z6JA 4PTNA 3AS1A 4I8YA 1C8VA 3FOKA 3I6RA 4BY3A 4AZ7A 3H22A 3BZGA 4JHMA 5LA1A 2ABAA 1W3JA 3U57A 5CG0A 3UT0A 4A8NA 1JR1A 3UWVA 5IFPA 3DKLA 3CZKA 3EWXA 1AH0A 3EWDA 1X98A 4L1XA 2IPWA 2YBUA 5MF5A 1JAEA 3FJNA 1FHUA 1FQ0A 1YADA 3UPWA 1I2RA 5KETA 1UWIA 1ADDA 4KS0A 1NFBA 3GX9A 4TU1A 4O1DA 4RXFA 1TB3A 4LUIA 2VX7A 1EF3A 2J13A 4GGBA 2D2OA 3V5OA 3VIHA 1U1HA 4XD4A 3CV2A 3TYBA 4QG6A 4C91A 4LS2A 2AQOA 1DWHM 4Z0SA 2VQTA 4JD4A 3FY1A 2HISA 1OFAA 4D8ZA 1I0DA 3AJ7A 3KBVA 3E12A 4NJGA 3QGVA 1V7YA 1XCWA 4ROQA 4Y7EA 3WNPA 3EX3A 5J04A 2CHOA 4NX5A 3U8GA 1DJWA 1W8SA 3UFYA 4LGXA 3AISA 2JQXA 5ABTA 2HTMA 3WD4A 4B3KA 2E9BA 4GQBA 2OSWA 2TMDA 4LVGA 3HURA 3WLOA 3M0VA 1HKKA 4NZ5A 4QX4A 3PP7A 1EUAA 1HJVA 3GSMA 4JTCA 1E0UA 3CL8A 3BL3A 4KFOA 3L4UA 1RCOB 2QCFA 3GG1A 3G8EA 4IFOA 4MZ8A 4OZOA 2XH7A 4J40A 4KEZA 1QHZA 2PDPA 4CU7A 4L64A 4EXQA 2GQ9A 2C91A 1RA5A 1V6XA 4E3TA 3L68A 2PFHA 3UA4A 2A7PA 4TMBA 3E9AA 2BASA 1MUWA 3ABOA 1SU5A 4PTMA 1LBLA 3LHZA 1SMDA 3LLDA 2OYKA 1J0ZA 2CLPA 2ZUVA 4MWAA 1RBLA 4DJEA 1AH3A 4DUWA 4XZIA 3ECQA 3AZSA 3NURA 4UFKA 1Q6FA 1WYIA 3MO4A 3ICJA 2R1LA 1LOSA 4QS6A 1M6JA 3NM3A 1FWEC 2FB2A 4S3GA 3SJ3A 4O1AA 1NQKA 1VRDA 3WFLA 2HVMA 3GHTA 2DDXA 3BLDA 3OPSA 2D73A 2PLMA 1D2KA 1JCJA 5FCZA 5F7UA 2F8QA 3H2FA 5LIUX 1L6SA 4AXNA 4LUYA 4YTQA 4W88A 3V5FA 3UG8A 2DZWA 4HZMA 1CLKA 1S2UA 2NWSA 5TD4A 2EHHA 4RV3A 3C8FA 2PF0A 4AUBA 2V68A 1HGWA 3K1DA 4TX9A 1THFD 2GLKA 3VO0A 3UWEA 4R7WA 5HPOA 3DC0A 3MKCA 4C6LA 2PUZA 1KCXA 4PMYA 2GJXB 1JFHA 2ZX9A 1PDYA 3AI0A 1ML1A 5HQMA 3W37A 2NVCA 3MSDA 5AY7A 2VVNA 2BGQA 3ONBA 3W84A 1B57A 4IICA 1XSIA 2WM1A 3JZEA 1W3TA 4NU7A 3GD6A 1MZHA 1XIJA 1C3FA 1F74A 3GDMA 1MVYA 2R91A 5B7ZA 2D20A 2NT0A 5DQPA 1E71M 1TRIA 4HYVA 4L4LA 4OWGA 2E28A 4WDUA 4TUFA 1UASA 3QMTA 2RKXA 4JTEA 3L4XA 2VD9A 4OE7A 1KFCA 1H2JA 1NDVA 1BG4A 3FN9A 1SSGA 4GGHA 1FRBA 3G1YA 4F0KA 4M24A 4PCSA 5BRBA 4JYEA 2XM1A 2XFRA 2R94A 1GG0A 1P6BA 1D7KA 4JQ4A 2YDSA 3G77A 1CI1A 3VKCA 4A6GA 3CQJA 2VDGA 4HTYA 3WNLA 4DJFA 4XTIA 5LGXA 2J6XA 4WUIA 5DT5A 2QQ6A 3NPXA 4O1FA 2D1ZA 1K7XA 3QV9A 3W01A 1C93A 2XGIA 4Z42C 3OJGA 4I9MA 3ZLFA 4O4VA 1A0CA 3OYXA 3OGRA 3GNRA 2E1DA 4PC8A 1JL8A 1JPDX 3NL5A 4OVXA 1SVDA 4C6CA 4LV4A 3VD3A 2J77A 2GGIA 3AIBA 3IIVA 1P0BA 3M5VA 3W9ZA 2V3EA 4UMBA 5G4HC 4W8BA 1LOLA 1CGWA 2FGZA 3MI2A 4W84A 8A3HA 2J9XA 2VFEA 1XRSA 3WLHA 2VEGA 4FSAA 3MP5A 4K1WA 1RH9A 1YTDA 2G3NA 4US6A 3VZXA 4C65A 4UB9A 3B9OA 4XKMA 5FJIA 4QCEA 4Q8TA 5HK4A 4NJHA 5ABHA 3GVVA 4BF7A 3GVWA 2P8CA 2YDQA 1F9CA 2KAUC 2CBIA 5DCEA 1VFTA 2IPGA 2XSXA 2PDCA 3AROA 1VAHA 3K2GA 4IWWA 1P1XA 3RU6A 1P0KA 1V8EA 3SURA 1XLMA 1B30A 1DJHA 3G1SA 4PMDA 2X1UA 1XG4A 5LZLA 4GIRA 1DOSA 1TJ0A 2BY1A 1IZJA 2Y1HA 1LCOA 4XAFA 3QPZA 1MQPA 2E9MA 4JEQA 4FX6M 3ZVIA 3Q37A 2QULA 4QLKA 1LRTA 3R0UA 1TJRA 4TVUA 1AVAA 2ZUWA 1EJTC 2GWGA 3QFEA 2DSKA 4GCAA 4QJ5B 2BNJA 1E72M 2X8RA 3AHZA 3H2EA 3B97A 4JTKA 1EHNA 3P2VA 2WMKA 3MCMA 2QW5A 1OGGA 1QPQA 4F2BA 2HCVA 5B80A 4ZTYA 3MYPA 4LRTA 2V5CA 2Z1XA 2W61A 3STEA 4LX4A 1J9YA 1REQA 5EPDA 7ODCA 1E9ZB 5EMKA 4M7SA 2G95A 3O15A 4N4PA 9RUBA 3W1UA 4GYPC 1RD5A 4YL2A 4F79A 3VKKA 4L4OA 4Z2HA 1R3RA 3NQEA 4X60A 1XYCA 2O7QA 3NQGA 4XUYA 1PSCA 3WLNA 1LTDA 1GVFA 1CXIA 1SO3A 4ZQRA 3QM3A 1T8QA 3U4FA 4UTJA 1JQVA 2DIKA 1P0EA 4XAZA 5D02A 3L2MA 4C6EA 4JIIX 1WDPA 3KZSA 3VNYA 3IIPA 2YKKA 5EMJA 1ONRA 1IEWA 1XLDA 4GI9A 1WPCA 5AYXA 2FPTA 5J5DA 5BWAA 2REQB 3UZWA 1TX2A 3R13A 3TMQA 3KBWA 2WHJA 3L4WA 5XIAA 3CXOA 3RM4A 3P5YA 3EDFA 1HQTA 3BLFA 4IMGA 3ITOA 4GY0A 1F05A 4HGXA 3HG4A 3AU2A 1ZP3A 3TU9A 3BW2A 3WCZA 4AF0B 2VP8A 4JTFA 3KDOA 2X0YA 4IG2A 4JTQA 1H49A 4Y9AA 3DI0A 4B5SA 2BY2A 2BHUA 3E38A 3TJIA 2B7NA 2YCJA 3MY9A 3LMZA 3EWZA 4QROA 1XIBA 4RZBA 2QIWA 2ON3A 4AIBA 3GLCA 3C2OA 2VX5A 3L0KA 1W3LA 4QDMA 3E0FA 3W76A 3DFSA 3FLUA 4O57A 1O5RA 5K3VA 1E55A 5HMFA 2VKZG 3VC5A 3GNOA 1CGYA 1MXGA 3ABSA 1RR2A 2FDSA 2V5DA 1B3XA 1QK2A 6ENLA 1HO4A 1K9EA 3CHVA 4LWWA 4AHOA 4ZENA 1J6OA 1UR1A 1EFZA 3TR2A 2WCSA 3R11A 4FF7A 1VCGA 1GQJA 3QVQA 4H7ZA 3TONA 4XBSA 5E0FA 4S3BA 1Q45A 1POKA 3VI2A 3WLQA 1E9LA 3TV8A 1EPVA 4NNCA 1W5MA 1QRQA 1KCLA 4X2RA 5D2YA 3TNOA 2PLCA 4WEVX 5KZEA 1O12A 4BCEA 3UWWA 2HNEA 2TAAA 3AIQA 3S47A 1A80A 3AXXA 3HA1A 1PB0A 1VEMA 4AISA 1B31A 4QISA 5D4YA 3KVLA 4S23A 4WJXA 3THUA 1UWQA 3VD5A 2O9PA 1FY6A 3ARYA 3O6AA 2WMGA 3CM4A 1GW9A 1XLIA 3M0YA 1LQ2A 3R5EA 2AMGA 2Q6ZA 3SCOA 2SFPA 3QEZA 1V3LA 3WQDA 2ZIDA 3KX6A 4HPXA 3M44A 4FIQA 1EJUC 1OEPA 3W28A 4E8CA 1LUCA 1PKLA 2MNRA 2WSKA 5FI8A 4AD0A 1TPEA 3TYAA 3LD5A 3UXDA 1EEPA 1WDWA 4CD4A 3FX4A 2X7WA 3OP2A 3VKAA 4NIRA 5FL1A 3BXWA 1GVIA 3NOYA 2WCGA 3UQNA 4TVDA 3EX1A 3FYPA 4L9YA 5D9NA 4KERA 3MC5A 3NVDA 2E8ZA 3ANVA 4LC8A 2DIJA 2QPUA 3ID7A 2ZBTA 2ZXDA 3O8AA 3PBWA 3IWPA 2EKGA 2VDIA 1IYXA 1KM6A 4ZO9A 2CERA 3T1GA 1F6KA 2JK2A 4L61A 1KW1A 3LG3A 4AZGA 3AXIA 1EP3A 1M1BA 2VZVA 1TWIA 4JFVA 4FB7A 3W7QA 3AIRA 3WUGA 5I03A 4U31A 4TX8A 2J9ZA 1GJPA 2GVLA 3KDNA 4POCA 4QG8A 4P7LA 4I5RA 3S2MA 3VXGA 4D6GA 3M47A 1TVPA 4MSSA 3LSBA 5CEWA 5E6ZA 3QY7A 3FVMA 1DJQA 3NDOA 3ZSSA 2PDJA 2PP0A 1IEVA 4IIEA 4Z17A 4PE8A 1E3XA 4B5NA 2YXOA 2YDAA 2ZADA 3QYSA 1LP6A 4HN8A 1UBSA 1LBFA 3NO1A 1DWGM 3BMVA 5REQB 1ZQ5A 3ZT5A 4I7WA 1VB9A 1EC8A 2YGYA 1SYTA 2TSYA 1ZB5A 2DJLA 3H2NA 2R14A 5E0KA 4JTTA 2GGEA 2Y4SA 3PTDA 3EWWA 4MAVA 3ZQ9A 4XVEA 4JQ2A 1X1ZA 3ERPA 1WE5A 5AZ1A 3BMWA 3HQ1A 4ZOBA 3MMTA 3RU8X 1S39A 3M0MA 4DPQA 2DSZA 4WSKA 4MY9A 1LLWA 2I57A 2FQIA 4YIWA 4TR9A 3BVJA 4L9XA 3IRSA 4EOUA 3E0VA 3HPSA 4LVDA 3QN3A 4CQDA 1WDQA 1DIOA 4QITA 1KM0A 2P3EA 3FHQA 1REQB 4QNWA 1EJXC 4YMZA 2HPIA 2DZUA 2B81A 2DT0A 1DKWA 3E2RA 5FA5A 4QRNA 4F66A 3N2CA 4KW2A 5I79A 4YWIA 5AHMA 3F1QA 1QK0A 2RDXA 5DXYA 2VGIA 2Z1SA 3UEQA 2WOQA 1S1PA 1JF5A 4UIOA 2EO7A 5CPMA 1KTNA 4IISA 2V69A 2D0GA 4J3WA 1L2UA 2BSLA 3HG2A 3B8SA 3SW6A 3HN3A 1A5NC 2UY4A 3U48A 1JYNA 1VRXA 3UF9A 3W70A 4BQ4A 1XYZA 2CKSA 2XFWA 1U1UA 1E9IA 1YE6A 2DPEA 1Y0EA 4Q4KA 4A21A 4BI7A 3RO6A 1S38A 1XFCA 1QW9A 4JYDA 4NILA 5CC5A 2ZICA 1JZ7A 3GHSA 2XIBA 1C29A 3UCCA 3P3BA 3I3EA 4QDWA 3GNXA 2FIQA 2X1SA 5EMUA 4CLMA 3CBWA 3F4DA 4MGGA 3MA8A 1TMHA 5A95A 4FR1A 1EA9C 2VWTA 4AD5A 2OO6A 4F0MA 4FNPA 3NCOA 3N6JA 3NVTA 3PN8A 1FCVA 4EE9A 1LLOA 3VDGA 1FH7A 2ZUSA 1FWDC 1W1B1 5K2ZA 4UFJA 1V02A 3L5AA 2NZLA 3L67A 2JIEA 3RLHA 2ODOA 4XD3A 1QU4A 2I9EA 2VEKA 3LZ5A 3GZAA 4HA1A 3VIOA 2Q01A 4JIEA 3EOUA 3CMJA 4HNVA 3BGJA 2ATMA 1VFSA 4W7UA 4JTJA 5LGZA 3OW1A 3MDWA 2PZ0A 4XD6A 3GBDA 4DY1A 3H24A 4KRTA 1MNZA 4U28A 2WBKA 4E4PA 1EKOA 1S2VA 3PJWA 3N9RA 2PE4A 4GQ0A 5CC6A 3T05A 3HB9A 3K8LA 3LPFA 2WNWA 2GDUA 2HV5A 2XIQA 1V6WA 4FHAA 1A5UA 3N6QA 3BPWA 4EP8C 1M68A 2YB1A 1SFJA 4HU0A 4M81A 2HWGA 2R6OA 4AZ5A 4O50A 4GXMA 1KR0A 1JUEA 4Z1CA 3L23A 5AB3A 3PB0A 4Q8MA 1UD5A 3HGOA 3WENA 1XYBA 3GDLA 4QLLA 1PKMA 5CPTA 4B5WA 4B90A 1FWSA 2DSUA 2O7SA 3Q67A 2PTYA 1V08A 2WVVA 1D3CA 1GNXA 3DFNA 1UWUA 3QC3A 5G5IA 4UFIA 5E0CA 5DY2A 3GC4A 1NFPA 2XFFA 3WJSA 4LVFA 3BLPX 1A3HA 4BA0A 3IJ9A 8RUCA 3G1FA 2V2DA 3K13A 5CJMA 3TTEA 4C6DA 3TR9A 1TPVA 3ZO9A 3PY2A 2G41A 2GWNA 3U2OA 1GOXA 1Y65A 4M5PA 4PB4A 2A7RA 1A5BA 2GOUA 5JXQA 1FWRA 2C14A 3NGJA 5F2MA 2Y0FA 3BE7A 3IAPA 3IUHA 2ZDRA 1GOQA 3F4VA 2HRWA 3SQMA 3WKZA 3S1XA 1SR9A 3LLFA 3S5ZA 1Q4WA 2E09A 1Z89A 2DZAA 4LXFA 5DX7A 2C3ZA 1XBVA 1TUXA 3CZLA 1C8YA 1HG3A 3KCLA 3THAA 3SCNA 3GY1A 3N2OA 3W1RA 4EAYA 3O6CA 4IX0A 1XX1A 2JBMA 4UFMA 1IR1A 2QJMA 2A0NA 4TMCA 2CLIA 3FSTA 4XVDA 4J5NA 2P53A 2YYTA 4OTKA 5AHFA 4YHEA 3SN4A 1EJ7L 3P60A 3C2RA 1VP5A 1WKEA 4NKCA 2C7FA 2PURA 1DV7A 5AC5A 3POCA 4EVZA 2BGNE 1S5WA 2F38A 3BOLA 4FO4A 3H70A 3PK7A 4F3HA 2Z00A 1B3WA 4US5D 4AHQA 1JD9A 1EZWA 4HOZA 3TZNA 3BCDA 3CLMA 2OLHA 4JTUA 1TPFA 1D7FA 4IIFA 4O12A 4DF1A 5DLCA 4Z2GA 5LHFA 3N2XA 1B3ZA 4PMXA 2OEJA 2VGGA 5I23A 4JFSA 3K46A 1R3VA 4ADUA 3HMJG 3PUEA 4V15A 1OFOA 1QI5A 1J0KA 2EPNA 4AFYA 2Z29A 4HCHA 3N73A 4YTTA 3R2GA 5MKGB 4GFIA 3G1RA 4O0QA 1J0IA 1DJGA 3IGSA 1X6UA 4KMQA 3PSWA 2DH2A 2OQLA 4L56A 1OQFA 2GJRA 4AWUA 4LT9A 3BAYA 1J93A 1OABA 2F7FA 1FHVA 4AIUA 5AYYA 3W2JA 4QE5A 3P84A 2QV4A 2Z7KA 5DMNA 2G96A 1U33A 1DJYA 2PDMA 3GHUA 4WIWA 3OIHA 4J3XA 2X42A 1FA2A 4PZVA 4XD5A 2PRHA 2QZRA 4Z2IA 1EF2A 3P61A 1ECEA 1UYQA 3IV8A 2C1IA 3C2YA 4TV5A 4PTVA 4MWAD 1MFVA 2ZFAA 4BZYA 2Z0IA 3HPFA 3LU2A 5H1WA 1IGWA 1E0WA 3AICA 3EMQA 4PRTA 2FMNA 3VFLA 1S2TA 2CWNA 4JS3A 2ZWZA 4PRRA 1ZBKA 5A2CA 3CNYA 3I7QA 1TPDA 1IF2A 3E6EA 3SAZA 4HK7A 1QDSA 2XH4A 3WF0A 4HZ6A 1OZMA 2WLZA 3F7JA 2V0TA 1XV8A 4KIEA 2X1RA 4AWEA 5K7JA 1OGBA 1HNYA 1W2PA 3OA3A 4XAGA 4S3DA 5DELA 4MF4A 3TTYA 1UWRA 1XFBA 2YLAA 1NWRA 1PIGA 2AAAA 2NUWA 2CEQA 5TAOA 4ZSTA 3BMXA 1AFSA 2QNEA 4P8UA 2I14A 3I6EA 4KCWA 4RE4A 1UPMB 2QR6A 4JL2A 3N9KA 2FKPA 1GOOA 4X2PA 4RE3A 1B4EA 4UMCA 2VHLA 2CFFA 4JY8A 3WX7A 3WQ8A 5DO8A 6ALDA 2XVPA 1W1YA 3QW3A 1M7JA 2Z28A 1C9WA 5M5DA 2X05A 1LZOA 2QCCA 2Y7DA 3EKGA 5HNUA 5C70A 3MP3A 3GK0A 3CAVA 3IIZA 1XI3A 1L6YA 5I00A 3STFA 2TODA 3FAWA 4NZ3A 1RJRA 3T4CA 2EQDA 1FVPA 4AYSA 1S5NA 3A64A 3IJIA 1GORA 1CXEA 2QVHA 4CQAA 2PP1A 1E15A 5ECUA 2EPMX 1Q6EA 3HQPA 1ME8A 3URAA 2Y88A 3W38A 4PUMA 2CLMA 4LALA 4DI8A 1T0OA 3AJXA 5GNYA 3RK8A 2V5BA 1OHLA 1RPKA 3BANA 1W3HA 2D2JA 1ZAHA 3SUUA 1I2OA 2AGKA 4EPKA 2F61A 5J8LA 1P48A 1Q7MA 4ZB0A 1OC7A 3F2DA 3PUGA 3VKDA 4XO6A 1H41A 4AX6A 1HP5A 3FXYA 3P8IA 2OJPA 4J35A 4M82A 4B9ZA 1ZL1A 2WJEA 2WNQA 2PDNA 2FDMA 2HEJA 2WVUA 3GR8A 3RLVA 3LXBA 2Y5EA 7PTDA 3WK1A 4XZNX 2BHYA 1JI1A 3QZAA 4PMJA 1BRLA 1PWMA 1WKFA 2A3HA 4UR8A 3EMZA 3R7MA 1EA0A 2HK0A 2J7FA 4NX0A 2W92A 3VNMA 1CYGA 3GDBA 3H6OA 3MWCA 2G3MA 1TA3A 2V3FA 4P7OA 1XIEA 3NJ3A 1ICSA 3VC6A 2XWEA 3EXTA 1TJ1A 4GH3A 4CNSA 1KLYA 3SCQA 5KZMA 5BNKA 2PGFA 1QVBA 4AEOA 3SCWA 3KRZA 4WD0A 1KKOA 2CBJA 2Y61A 3VGBA 5C2GA 3DFQA 2NLIA 3S9ZA 3I65A 4UNLA 3NSMA 5G1YA 4NZFA 3I3BA 2XFYA 1XC4A 2P10A 4FI4A 4GHRA 4W4QA 1A47A 2UY2A 4EAMA 2NXGA 4JFWA 2H3BA 3EB4A 4J3TA 3M43A 1HF6A 2I5GA 3S1VA 2JF7A 4FA3A 3E1F1 2RDUA 2CYGA 1CBGA 2WW5A 4MTVA 4UQAA 3PZ9A 4JQ1A 4RR4A 3L21A 3FGCA 2HE8A 4R27A 3PB2A 2ZA3A 4FLQA 4L5ZA 3WIJA 5I6SA 4XKYB 1NOFA 5BRQA 1DBTA 1E9YB 3ARVA 3BQ5A 4RE0A 3D47A 3GXFA 2BVWA 1TKKA 1CZ1A 3HIJA 5I06A 2Y85A 1A4MA 3GAKA 1I2NA 2HS8A 1R3WA 1O5QA 2EKCA 1IWBA 1ME7A 3SSZA 4ICCX 4LYKA 2R1NA 3AOFA 1LT7A 1Z41A 4MNLA 3KHJA 4QG9A 4GQRA 1E0VA 1EIBA 3KWSA 1FHLA 4KESA 3IV3A 3H7RA 4HYWA 3ISIX 2OOGA 4GNVA 1VYPX 2DZVA 4DBSA 2JGYA 2I5QA 3S5NA 1W3KA 2XM2A 1VS1A 3LENA 1ZHAA 4LW7A 2YBTA 5IHRA 4MNJA 5C7VA 1BGAA 4Q7BA 1X8FA 3CEUA 2ISWA 4BI6A 4GCXA 2HQAA 3KRUA 4MDOA 4RW3A 4HN4A 4O1EA 4PMUA 1JYVA 3CK5A 4CNOA 1XJBA 3KXQA 2DSWA 2XUCA 4S2BA 1TZ9A 4XSMA 1FXPA 1QUMA 4AH7A 1VJZA 2FHFA 1P5BA 5A3HA 1TX0A 3M0JA 3XINA 1F7BA 2PTDA 4MPQA 5C2CA 5C9WA 4DO5A 3QH2A 1TRDA 1JDCA 4PUNA 3SRFA 1PYMA 1I45A 1TZ7A 2XDFA 4CU8A 2XVGA 1QPKA 2P5NA 3IVSA 2DZBA 4O18A 1ISXA 3RCNA 3C2VA 3G0SA 1JDEA 1J8VA 4GZJA 3TA6A 5CSYA 4D6IA 3CQHA 3K30A 3OVPA 4OGZA 4BQ5A 5C55A 3UG3A 3CPGA 1GYLA 3A6OA 4E2OA 4GJIA 3R94A 5CSRA 3V75A 3VNJA 3ZS4A 4O17A 5C0QA 8TIMA 3OGSA 4ORMA 2PB1A 1XLEA 1V3MA 4US5A 4MJMA 4MIMA 5A2BA 4FS9A 1UH4A 3WJYA 3THDA 1J0HA 4LPCA 3TNBA 2EPHA 1VYSX 1P0DA 4LAUA 3QF0A 1J2WA 1S1RA 4FOJA 3UBPC 2P8BA 4JNYA 3AHXA 4WOQA 3GG0A 4ATWA 4FLSA 1TWDA 2NQJA 2EXOA 1V0KA 1IXQA 3LPPA 3PZTA 1NQ6A 2VJXA 2YSWA 3BDKA 4DJDA 2ZC1A 3DHFA 4J3UA 3LX9A 9CGTA 3A24A 4HB7A 3QY8A 4MY8A 1WBHA 3M9YA 3B0VC 3EMCA 1R86A 4NZCA 1XQLA 2V6AA 1F2JA 2DZTA 2OMAA 4JTLA 3RX3A 4WJ8A 1O4UA 4I90A 3KCOA 5M3WA 3IIXA 5CBIA 4IL0A 1QBBA 2BP1A 1KRCC 4CCDA 2YPIA 4WCJA 4XUGA 4YWSA 2ALDA 1OC6A 3QJAA 5I2UA 2W0UA 4ATLA 2PDGA 2Y6ZA 4Q8UA 3VOGA 3W88A 4GIYA 1E4NA 3CIWA 8XIMA 2EG8A 3NIYA 1O1HA 5K9CA 6XIMA 4GO9A 4IGNA 4DRSA 5GJNA 1T8XA 3QMRA 1E40A 4Q8VA 5EYWA 1RY0A 1H7PA 2VURA 1BFNA 3HFYA 4EACA 1FP9A 7REQA 1XGDA 1XCXA 2QHAA 3VGDA 2BWGA 1GPWA 5ABEA 1SMAA 3CMGA 1OFBA 2Q71A 4HPHA 4JIHA 4B3ZA 3BARA 5I24A 1UR3M 1AQ0A 1YPXA 3K5XA 1WDRA 2VQUA 3TWAA 1GVQA 4GO8A 3VE9A 1JZ5A 4W87A 3B0PA 2E1WA 4W5ZA 3IANA 3M6DA 4JKMA 4QCFA 1JUBA 3H53A 2QDGA 4HYRA 4WY0F 4DM2A 1VIWA 1AJZA 2W79A 4TX6A 4HSOA 1WDDA 3GM8A 3H55A 4DI9A 5I3FA 3RLUA 3LZ3A 3WF4A 4C1NB 3GNDA 2OWWA 3S83A 3CUGA 2VFHA 4IIDA 4XK2A 2IQTA 3UWUA 2OT1A 1RUSA 5I5RA 4YS1A 5C9RA 2AOSA 2RFGA 4UXDA 4HNUA 5HR6A 4IJRA 2HVNA 4PMQA 2DFAA 3IK4A 3R79A 1XIMA 2GJPA 3IGHX 2NQ5A 3AYTA 2BLEA 1PZ0A 2DH3A 2BDQA 2L5HA 2F9RA 5BROA 5A1AA 1BVWA 3HO8A 1R85A 3W7MA 5I3KA 1IGSA 2QUTA 3QFWA 4F0SA 1WDSA 4F2UA 2POTA 4PUJA 3F5LA 5LNUA 3I6TA 3VPLA 3WLJA 3RIKA 1KWKA 1SW0A 3QR3A 5FIPA 4OT7A 5U4NA 3S2NA 4UTWC 3CYJA 5DT7A 2VC6A 1E3ZA 1XGEA 1X6LA 3LBMA 3GXDA 1BKHA 3NYDA 2ZXAA 2QDEA 5CQ1A 1WXJA 1MEHA 3N12A 3VM5A 1O5XA 3WH5A 3C86A 3WQVA 2XG9A 3N19B 4UOJA 3WH8A 4DF0A 4IUOA 1YBQA 3G6LA 1VGAA 1PWLA 1VFUA 4J9JA 2OPJA 4JN8A 4AD4A 5M2FX 4IMFA 1RV8A 2CZVA 3KM8A 4AXKA 4GZIA 2OG9A 1OINA 1VF8A 1W1ZA 3UJSA 3TOYA 1BWLA 4C7GA 3LGDA 1XLLA 2YZ5A 1O7AA 1R7AA 3OZOA 3AHVA 4RCXA 3NSXA 3TH6A 2BGSA 1YDVA 4WY0B 4ML4A 3RILA 1BSIA 2Y8VA 5HWJA 2GK1B 5JIWA 3ZJ7A 3Q2DA 3WEMA 5LHEA 3JR2A 4PL2A 3GS6A 4Y9MA 3M4HA 1H63A 1IIGA 3CU2A 4Z1DA 3BCFA 1WZKA 1EJRC 1RLCL 2NVAA 1TR9A 1TG7A 4ZXOA 1F73A 5LXEA 2Y70A 3SGUA 4TXEA 1Y7VA 3GU9A 3OYZA 1XINA 1M7OA 1UZ1A 4JQAA 1ZS2A 5F4XA 3U0HA 3HFTA 3T2QA 1O1ZA 4ZFMA 4C6OA 3TTQA 4W7WA 2VC5A 4KCVA 2ISVA 3SQLA 1ZFJA 4ALDA 2WHMA 1LYXA 3MUIA 4URIA 3NUKA 4GZ7A 3WLIA 3NM1A 3WNOA 4GYKA 1SJAA 1CIUA 1GYNA 3WJXA 3B9DA 3NZQA 2WNZA 4IPPA 4XG1A 3SI9A 2FPVA 1PXGA 3IJLA 1A5CA 1DWFM 4E6MA 3NQBA 4GVGA 1MEWA 5FJPA 1QNQA 3NZ1A 3WBAA 2GGGA 4IJCA 2NQZA 2W6RA 4HNCA 3VDBA 2WWDA 3GVRA 3T0DA 5D38A 4M29A 4PCPA 4I9TA 5KZDA 3WD1A 3T0TA 4C6MA 1D8CA 1NTHA 1GUVA 4W86A 2VZSA 4BJHA 1W17A 3GH5A 3CWOX 3RLGA 3LCGA 5FF7A 1GOIA 3QTGA 3CV6A 3LXAA 2W91A 4HPJA 2WO5A 4DO6A 3L2IA 4H9YA 3OHIA 4BQ3A 4CN6A 1RVGA 5ABGA 1V0LA 1R8LA 2EPKX 4DYJA 1E56A 2XINA 3AMGA 1OB0A 1SSDA 4NZJA 4S3AA 4EWJA 1LWJA 4M1BA 1SZRA 4H3DA 1AL8A 3ARSA 2Z1WA 3H4GA 4FLOA 3TW6A 1E6PA 3MWAA 3THQA 4MM1A 1VZWA 5A8GA 1Q13A 4IP4A 4O16A 2QF8A 1TJPA 2YXXA 3L0GA 1JPKA 3FDGA 1RCQA 3D6NA 2FLIA 1JDAA 4IGSA 4G6CA 4WOZA 3M5ZA 3TQ0A 1ZJBA 5LIYX 3ZR4A 3LGGA 2C15A 2X09A 3CUFA 4S3EA 1FCQA 3W85A 1J11A 4WXYA 1PV8A 5HNTA 3L66A 2INZA 1KTCA 2A3BA 3H4WA 1M65A 2J8GA 1F07A 5I02A 2H8ZA 4PUDA 3TROA 1SR0A 1W5NA 4IFKB 1CDGA 1B1YA 2R1PA 1G7UA 3BV7A 2CXGA 3L5MA 3VIPA 4WF7A 1XLGA 4C7FA 1OCQA 3A12A 1XIGA 2CC0A 1R2SA 4GUHA 4IF2A 4REQB 1W5OA 1CGVA 3B9AA 3S9IA 3IGXA 3GHRA 4ZQPA 4ATDA 2F6XA 4PSPA 4CVWA 2YJQA 4PMVA 4H8UA 1R0MA 4LY8A 5MHBA 5K4ZA 2GVJA 2YA1A 5D37A 3CEPA 2J7BA 1YIXA 3B9EA 3IJQA 1LG2A 1UUQA 1N82A 3GTXA 2PLKA 3OQ8A 3VDCA 5FF0A 3UD6A 1FDJA 1J01A 1XYMA 5G2WA 2GUUA 4C1KA 3WZ0E 3U2CA 7A3HA 3O07A 5JUVA 3G22A 4WKHA 1AMYA 3QV8A 1IEQA 5F2IA 4KEUA 5EBUA 5HA7A 1KWGA 1B9ZA 3O7UA 4P61A 1IXOA 4AD1A 2UZ9A 2V9DA 1KBIA 1ZCOA 3EB3A 4HSNA 3UY7A 4MJZA 1XS2A 1W5QA 7CGTA 4L9ZA 4QEHA 4OBTA 1T5AA 4OV9A 1ONWA 3AAMA 2X41A 1NIUA 3VE7A 2HS6A 1TTJA 2C16A 1EZ2A 1UUOA 3KRBA 4NAFB 4Q4PA 4GH1A 4QBXA 4DN1A 1Q65A 4RNJA 3UU0A 5D9OA 1JFXA 3CC1A 2QAFA 3MP4A 4C7DA 5H6HA 4MAZA 1N55A 4O19A 3N15A 3VD9A 1VEOA 4DO7A 3AMDA 1OFEA 1Y5XA 3A9IA 1B5TA 5CPLA 4V28A 3GVQA 3RXZA 3AS2A 1K8XA 1HVXA 3CPRA 2PWUA 2PF8A 4ZEPA 3LBOA 3EWUA 4Q6JA 1O68A 1XP3A 1PTAA 4H83A 3CL7A 1GPFA 4JBRA 5D04C 3V0TA 1CCWB 3ZLGA 1EJVC 4LAOA 2Z24A 4GG9A 1R30A 1ISVA 1V5XA 4J1OA 2D23A 4XWUA 1OD8A 1QI4A 4H9VA 4DX3A 1K70A 2VWSA 4O0KA 3TN3A 4LS0A 5F1VA 3C3UA 4I6KA 2GSEA 4HU3A 2JGQA 4B91A 3G3MA 4QJ4B 5I3JA 5EA9A 2WSPA 1SJDA 3WFZA 3CB3A 5AVNA 2JKPA 5F1UA 3CHEA 4BF5A 3E49A 3BLLA 3ANUA 4LJ3A 1HL2A 2WHKA 3DDMA 4IPJA 5BRPA 3PF3A 2ALRA 1YTEA 3OTRA 3REQB 3GNPA 2ZWYA 5JBEA 3OOQA 1EOMA 1YXYA 2GSJA 3LNPA 4ZO8A 1VPYA 3QV6A 1EBGA 1NAL1 3LA4A 1OFRA 2XU2A 3I10A 2UY5A 4JTAA 4GK8A 4PB3A 3C3NA 1G5AA 4M6VA 2OX1A 1J2BA 4KT2A 1VEPA 3T0BA 3SCRA 2HK1A 1XPYA 1LOQA 3E0WA 4DWSC 1LT8A 3QC0A 3NR0A 4F0RA 2XIJA 4XISA 3ARZA 1LJYA 2QKFA 4L6OA 4XZBA 1L6WA 4JHZA 4JTRA 4IPLA 4O53A 2GDQA 1AQFA 5C9ZA 4HTBA 2WMFA 3W83A 2XHYA 3EPOA 3FS2A 3P62A 3BAXA 1JZ8A 2I17A 2ZA2A 1TE1A 1MW0A 1EJSC 1UMYA 1VFLA 1OYBA 4DUOA 2UY3A 4IQLA 2WWCA 3BOXA 3HOJA 3QRHA 1BQGA 1US0A 3PBYA 3NZRA 4B9YA 2BOFX 3GC2A 1HKWA 4UZUA 1QW8A 2PWGA 2VDHA 7XIMA 1ODUA 2P1FA 3W7CA 1DQXA 2PLJA 4PA8A 3FJ4A 2FTPA 1OCNA 3W87A 3S0CA 1W31A 2PDUA 1FWAC 1XIHA 4ZFCA 1KBBA 2WKGA 1VCVA 1GT8A 3IJ6A 4JX4A 1CB2A 3MKVA 1XSJA 4A2RA 1AQHA 2ZXBA 1I1WA 4FX8A 3CUZA 5I7GA 3PTKA 4QQ3A 3GDRA 2VRKA 4MNKA 3TKFA 5BCAA 2WQDA 3ITTA 2CXEA 4CNTA 2J7GA 3TCEA 3LSCA 4YCOA 4OUIA 1KO0A 5AC4A 3BICA 1Z3NA 1Q6GA 1JPHA 4XAYA 3KBNA 2YCLB 4HIBA 4J7RA 4N42A 4DELA 3KBJA 4Q33A 2PU0A 2WXDM 1G67A 4FPSA 3C61A 3GXMA 3HQNA 3GR4A 1HJQA 5FEWA 3HV9A 1VLIA 1TIMA 1YBQB 1KGXA 2V2CA 4UNIA 1S5MA 2IKGA 2VRQA 3LHYA 1C9DA 3PHAA 4NP7A 3SSJA 3C2FA 2V3DA 3EX4A 4ZQMA 3BAJA 5XINA 4AQLA 5D32A 3TLQA 3WQCA 4B15A 1UQZA 1OFQA 3FA4A 1R9ZA 2PDBA 3FEMA 4GISA 1FWCC 3UWZA 4QR6A 3H2OA 1XWYA 3LYEA 1QI2A 1XHGA 1J5SA 3CT2A 3QTPA 3CHCA 2E68A 4OBSA 3B8DA 1QPOA 1OCJA 3CO4A 2OO0A 4CN1A 1OVDA 2PAJA 1X6NA 4HZ7A 1WUFA 3AMCA 3MZ2A 4WY0A 1UMLA 4JCMA 3SUWA 2DY3A 4H1ZA 2ZTKA 2I7GA 2FZMA 2OX4A 3GDTA 1JUKA 3ZXWA 4O1BA 3ZM8A 4JTDA 2XGBA 3IRDA 1X96A 3UPBA 4G7FA 3LHVA 4R33A 4IHCA 5I77A 3GTIA 2VGBA 3DG6A 2YL8A 2G5WA 2FH6A 1RHCA 1QHPA 1HL9A 2GFTA 1A5LC 3WQWA 2FZ8A 2E6YA 5A2AA 4Q8NA 4TVCA 1GKPA 2ISDA 1CXKA 1DL3A 5CZ0A 1FFRA 5A8NA 4CNUA 3DYOA 1KRMA 1PUDA 1E4MM 2JEQA 1QASA 4MOZA 5C2XA 2FJKA 4D71A 2ZKMX 4CUCA 1CLXA 3QY6A 4FMVA 1EDTA 1E73M 3GIPA 3WN6A 1VJIA 3L9CA 4TV6A 3I7SA 4AEEA 1DJXA 4U2ZA 1K4HA 1NSJA 3UPMA 1GOKA 1C7TA 4R88A 3KOFA 1BF6A 3GU1A 2J8FA 1HIZA 3BO9A 4E38A 4JX6A 2CCRA 1TV3A 4HJWA 4XIMA 1AUSL 1P1MA 1JPMA 1TREA 1XIIA 1W6TA 1J96A 3CO8A 4LAZA 3L65A 4DZAA 4UOZA 3VMPA 2ZZ7A 2W5FA 4GQGA 1MUMA 1E1FA 1JCMP 3V0UA 3TXVA 3WQ6A 1R9YA 1LG1A 3BJFA 1FWIC 4ICNA 3GIYA 3SZ8A 2OWXA 4GUJA 1UZ4A 1BKSA 1TFVA 3ZOAA 4JXCA 1XLJA 3K1GA 3BQ6A 4E8GA 9XIAA 4ZQCA 1UHVA 2CLFA 1QR7A 5CG7A 2QLYA 3DCPA 4ZL1A 1MXDA 3TC7A 1O60A 2F84A 1QOPA 2CBUA 1WZLA 1O6IA 5M17A 2EBNA 1PIFA 3DGBA 3HPAA 4H19A 4NVTA 5A8OA 4K36A 4U33A 5FD0A 2AKZA 4DWSB 4X0VA 2VENA 3BUVA 4JQ3A 3LN3A 1VBRA 5L9FA 1ZAIA 4RPPA 4ZO6A 1M7PA 1EQPA 1Y5VA 2VMFA 2WZEA 5A6TC 2J74A 2A7NA 1EX5A 3DBNA 1J18A 1S46A 4HPGA 4MB5A 5D05A 4DYEA 4O0ZA 3ZLHA 4LCRA 4N4QA 4RL3A 3LM7A 1BXBA 2PDWA 1M03A 4N02A 3OLGA 1P0NA 4O52A 3SCVA 1NWSA 1YNYA 4HU8A 3W7DA 3KCJA 4O15A 2ZDSA 3HJZA 4J4KA 1DWIM 3SADA 2DUZA 4PB5A 2VEMA 3DXIA 4AHPA 3W2UA 3AXHA 1V02E 3NOEA 4FALA 1RALA 3DKJA 4QIUA 5CC7A 3ATYA 2DU2A 4G8TA 2OU4A 3FW6A 1I0BA 5AYIA 2D0FA 1HTIA 3VCNA 4DF2A 2G97A 2ISSA 5IBXA 1JZ6A 3KS5A 1OWQA 1EO7A 5LNVA 4S39A 4EKJA 1OK4A 3PNUA 2YZRA 4D6DA 3LCLA 3R4IA 3CIXA 4B2DA 3MSGA 2CLEA 2GQ8A 2JE8A 1A5SA 1I2PA 5IDZA 1GZJA 4R7JA 4H8NA 3OLIA 2GSHA 1MFUA 4ZCWA 1ITCA 4LUJA 1G94A 4GIEA 1E6QM 1V6TA 3F4NA 4N2YA 3DAQA 3U6WA 3B3DA 2YDRA 2YFOA 4K68A 5ECVA 3EEZA 3WL1A 4HK6A 4JTIA 1JPIA 5FSEC 2BOGX 3TYZA 4GKLA 2WC7A 4RZ4A 1YLVA 2V38A 1LWHA 3N29A 3TJ4A 1KM4A 4PBEA 3HV8A 3G1DA 1L2QA 4UTMA 1P6WA 4K6AA 5AHIA 2ACSA 4MZ1A 2O0TA 1HFBA 1KXVA 1ZJIA 2FHCA 3G1HA 1JZ4A 3G1XA 4PR4A 3S1UA 3NPUA 1V3JA 5C71A 7REQB 5LSMA 2DQWA 2OGYA 2ZRZA 1I2QA 1CGUA 4UTTC 2RDTA 4NQ1A 3RGTA 5T9BG 1XRVA 3CAQA 1D3HA 5AYBA 3TQVA 3W1XA 1OG6A 1KM5A 5E09A 4AZCB 2JIWA 4N9BA 3F03K 1S5TA 1BRLB 4G1NA 4NNAA 5A6JA 1K9TA 2PPGA 1T99A 4H7CA 1US2A 4B16A 3TXZA 3L5LA 3SY1A 1OIMA 2QPSA 2EJAA 3O3RA 1VPQA 3LTPA 1X38A 3R12A 3BAWA 5BMXA 1C8XA 1E4LA 1SJBA 2VEPA 1L6GA 5HNRA 4B4FA 3UGRA 5EFDA 3HZ3A 3WYZA 5BWFA 1LLZA 5CGMA 2R82A 1VC4A 5CZKA 5I3DA 4MADA 2HNHA 2FJUB 3H8AA 1TV8A 3SCPA 5HMEA 3DU0A 3URBA 4HJFA 1E0TA 3T40A 4GBUA 2PS2A 1P7TA 2QJIA 3LCIA 3MYOA 1ZP4A 2X16A 5HJXA 3ZVHB 3R25A 5G1TA 4JDBA 2A4AA 2XYLA 2XISA 4JIQA 4UTLA 1BTMA 3W6MA 1ONXA 1KGWA 2QCDB 1F61A 5A6KA 1UKOA 1RA0A 5G4EA 2YOCA 4Z08A 3S4TA 4YTRA 3DECA 3V4BA 5AHNA 5H2ZA 5DY3A 2WKLA 4L80A 1I6NA 1QOQA 2RH9A 2J75A 1GVRA 1OYAA 1F3EA 4IIBA 3TDFA 3KEHA 4MPKA 3ZFHA 4IXXA 5DFAA 1US3A 3VILA 1YDNA 2DT1A 1EYWA 4PN2A 1K9FA 4WZHA 3A3HA 1CXFA 3NL2A 1K7FA 1YNQA 3A9BA 4C6IA 2CLKA 4WXZA 3V16A 4XBJA 4M6QA 1NOUA 2VCCA 4UTTA 8XIAA 1JG9A 1K1DA 2OKOA 3UXIA 3P7YA 2XPKA 4YNGA 3TOPA 4D6CA 1T40A 2DVUA 4BWLA 4NAEB 4HOWA 1EGMA 3QQWA 3PZOA 1KBJA 1JCLA 1QW7A 2EAWA 4UNKA 3W7PA 5J5RA 4IGMA 1ZAJA 2G3IA 4HHHA 3H4XA 5ABFA 3R43A 1YE4A 3BJTA 4JN6A 5CGTA 4E2DA 4LCSA 3M7WA 1SFTA 4AWTA 3ZVHA 1GWJA 1O66A 3B8VA 3WJZA 3CIVA 5E70A 1QHOA 1TA3B 3O9NA 2JFEX 3G6MA 3K4DA 4PEKA 3STCA 5A69A 4GNJA 1OFDA 4YVXA 2UBPC 5A6AA 4NXSA 1T7LA 3MU7A 1NH6A 3AHYA 3COTA 2IW0A 1GQIA 4MLJA 3S5YA 2V63A 4Q22A 2V81A 4JKLA 2QUUA 3P5ZA 5GJMA 3DFOA 3GFZA 1D9EA 4S38A 4DLFA 4DUVA 2XN1A 2GQ3A 3W26A 2OQYA 4PTXA 4ADTA 3WUBA 2C19A 3PZMA 1BQCA 1UR8A 2BMBA 2Y24A 1Q7ZA 3PM6A 2BODX 3LM3A 2NXIA 1KM1A 1Q6QA 1J0YA 3W1TA 2Y2WA 3QXBA 1BPLB 1MSSA 1I8JA 3T7VA 3KLKA 2WSQA 4GXPA 3LTYA 3EBVA 1F3XA 5M03A 3WNNA 3VM7A 1DTNA 4C6QA 3LK6A 2A6NA 2VEFA 1L9WA 3OZPA 4EF9A 2A79A 2Z6IA 3PC0A 1XH0A 1ZBCA 1H50A 3PUDA 1SW7A 5EGRA 1GKRA 4OIFA 4K1GA 5I3GA 1FWGC 3W1QA 3WDRA 1YEYA 4H6KA 3O1NA 4B5VA 5M1TA 3ALFA 1K6AA 4XZHA 4EXBA 3OG2A 1Q6CA 3W2LA 1W56A 3KP0A 1SZFA 4YJ5A 3PWGA 5BU9A 2Q02A 5LNSA 3O06A 5LNWA 3LTSA 2XSAA 1NJJA 3AIUA 2PD5A 1JCYA 4LYRA 3S6TA 4ERAA 4DPPA 4Y9OA 3U5YA 2Z4GA 3WH7A 3NDZA 4QE1A 3SCTA 1GKQA 4DWDA 3UR2A 2C18A 1IHIA 3LS9A 2E5BA 3LCWA 1D3GA 1UKTA 3QW4B 4IJBA 2ZA1A 1V6UA 1PEZA 4DWSD 1M01A 1PBGA 4O1CA 3PAOA 3UW6A 3SQSA 3HM7A 3W2KA 1ISWA 4KEVA 4AVNA 3LBCA 3MQTA 3PULA 2GPTA 3HU7A 3WK3A 5I78A 5E9XA 1N8WA 4W8AA 3E0IA 4O11A 3L0NA 3VCRA 2WC4A 5AYZA 3CHDA 1JJKA 4JR5A 2ZRVA 4PULA 5AHEA 3LCHA 4BF9A 5H91A 3LMYA 4S1FA 4IQEA 2ZXQA 3USBA 2WMIB 3USZA 1A4LA 4XX6A 3D3FA 4ZOAA 1WZMA 2QUVA 2H8XA 4LUSA 5HAOA 4JNZA 1P6CA 4GUGA 4PCTA 1AD4A 1HJWA 2NXHA 1XKYA 2DUAA 3W7KA 4GZEA 3AMKA 3BK0A 3C5QA 2WZIA 1RQHA 1JCNA 4NL1A 1ITQA 4DXKA 5A6BD 2NX3A 3V3WA 2QUMA 2VL4A 1TCMA 4UFLA 4K8HA 3ZWSA 5BW6A 3ELFA 2QCNA 2XIMA 4AIEA 2QJJA 1LRQA 5EU9A 4P2VA 3EXRA 3PG8A 1PVNA 3W27A 1PZ1A 2VEIA 4DWSA 4XV0A 4RW5A 2A6LA 4AY8A 4D9PA 4B3LA 1PAMA 1GYMA 2AAMA 2IPJA 4A3YA 3FDKA 1S2WA 5CSSA 2PCQA 4HSHA 3W7NA 2IUZA 4GI6A 4I5XA 1MO0A 3LNMA 3V1HA 4GC4A 4LTSA 2IMRA 2RAGA 2PP3A 3WBEA 5FEZA 2ACQA 2WZMA 1K4GA 4I9AA 4NYUA 2X1TA 4A3QA 4AAJA 1S3TC 4FNUA 2NUYA 4JX5A 4P8WA 3T44A 4FXRA 3L2LA 3OU8A 2A5HA 3UYCA 5AOUA 1CXLA 3GUGA 2CWXA 5K9XA 3GAYA 5PTDA 2BZNA 3F4WA 1LF1A 3KOZA 1UBPC 3F5JA 4D1IA 4DEFA 2C79A 3GE7A 1A3XA 1OJXA 2BV9A 2WZTA 4HT3A 1E6SM 3W1LA 3V5CA 3FXGA 3EOSA 4KWWA 1UWTA 4XTDA 1KM3A 1ZBVA 2E8YA 2HPMA 4UQEA 3IGUA 4NUWA 3CWNA 2YW3A 4YCPA 1H09A 3BLKA 2NQHA 2OWCA 1UP3A 1XBXA 1ITXA 1FDYA 4UQ9A 3DH7A 3CB8A 5CXPA 1N8FA 3E2QA 4AU0A 1U2YA 3QHNA 4AY1A 4RKAA 3KL5A 4MB4A 4X61A 1YXCA 4J2PA 3FJLA 4Q8PA 3VX1A 1FKWA 3QYQA 3M6YA 5CAHA 1UD6A 4RNFA 5I3IA 1KQYA 1M9HA 3W7GA 2CZDA 2HVOA 3MHFA 1EXBA 3N4AA 3IJDA 5HANA 5C9UA 4A3UA 2PGRA 1V3HA 1Q7QA 3IEBA 3PR2A 2WMJA 3MCNA 3M0LA 1JRCA 4IMEA 5JH2A 3ZJKA 2B7QA 1UP2A 3UR7A 4U3AA 4AG0A 4CVUA 3M0KA 1ZSXA 5FESA 2NX9A 1W8GA 5CCZA 4NJIA 3A47A 2INFA 2F2HA 4UWMA 5AHLA 2E67A 3APGA 3KTCA 1YPFA 1B3VA 5HUOA 1GG1A 3PNZA 3ATZA 3IAQA 3RFAA 4J3ZA 1RY8A 3WSUA 5IHSA 1HP4A 2CLLA 2CZ5A 4REQA 1TCDA 2H90A 5CBJA 3P6LA 1VIZA 3MVIA 1BD0A 1JGIA 1ESWA 1KLZA 4LBUA 2E6AA 1TPC1 1W1A1 4LBRA 4GINA 3JUGA 1TV2A 2E6FA 1U22A 4RNIA 1IT8A 5D2VA 1IXPA 3LPOA 1LL4A 3OBKA 4K37A 4HHLA 4WJEA 3T4WA 5KTLA 3TMLA 5DEZA 4R34A 3WDQA 3A23A 1EL3A 3THCA 3ZR6A 3QSTA 2VUNA 4UR7A 1XBYA 3IACA 4M56A 4IMDA 3TX9A 1MI3A 3T0AA 1AODA 4ACZB 2XN0A 1G1YA 5LA2A 3Q4DA 5HMSA 1U5VA 2A3AA 5HQEA 3H7UA 3M46A 4K8EA 3UNDA 3F2BA 1LROA 1BG9A 2O9TA 3SBFA 3HGJA 2A1YA 4L6HA 2EG6A 3ARXA 1HN1A 1K77A 2AQWA 1V3IA 5FAJA 4JFTA 2TRSA 3N11A 2R24A 4NNBA 1WV2A 3UG5A 3GIQA 3VNLA 1XCFA 1GEHA 2BXVA 2IXUA 3FHAA 5AZ0A 1LQ0A 1QNOA 3SEPA 3VA8A 1EYEA 3L4VA 3NQFA 3UJRA 3UZ5A 2ZZ2A 2CPUA 3GW3A 4PBGA 1J0JA 1RD6A 2GUYA 3S5SA 1DIEA 2P50A 2C8NA 4DQWA 3QLDA 3MO7A 1PDZA 4GYPA 4UMAA 4X0NA 4IFKA 2FTWA 5HATA 2W4XA 3UZYA 3Q94A 2DVTA 5BXSA 1W9VA 2DV0A 1OYCA 2P0OA 1JQXA 5EL1A 3II1A 4Z1BA 5FF4A 5FJUA 4ZA0A 3ZYZA 3RUBL 3AFBA 2XSBA 3TQPA 2HROA 4QQUA 4GI4A 4KBXA 5IM51 1C92A 1KV8A 3OHMB 4U10A 1M5WA 1EO5A 2GJLA 3F2CA 3W3OA 4A22A 4YTUA 1H4PA 1QI0A 2DGAA 1PX4A 5A8PA 1RPXA 3DESA 4GMEA 5C6MA 5CAKA 4QJ1A 3S1WA 2OR2A 4GIAA 3UZZA 1FDZA 2GDVA 4CCCA 3WMCA 5EMYA 1NDYA 3AXMA 1ECQA 3LERA 5EMMA 2DUXA 2OQHA 5D8ZA 3BAIA 5G1MA 4FXFA 4QGCA 1EH9A 3CTTA 4WHBA 4GX8A 5IFTA 2EGZA 2PEVA 3RR1A 1JGMA 1DWAM 4OUEA 4ZGYA 4JTGA 2ACUA 3A4WA 1TTPA 5FJOA 3W0KA 4O8AA 4HMCA 4ILSA 2VGFA 3C0QA 3U4AA 3FGCB 4JICA 1CECA 3RITA 4MJ2A 2DZXA 4GXWA 3WBXA 2WKJA 1KFLA 4UTFA 4HMEA 3ITGA 3NFUA 4WSHA 3G1VA 3WL0A 4AZ6A 2P88A 5DXXA 3PZGA 1FH9A 2NV1A 2FVLA 4LF2A 2PWEA 3REQA 4UCFA 1F76A 2FZ9A 1DTUA 3K4WA 6REQB 3UY8A 1W2VA 3VMNA 3NL3A 1GONA 1QATA 4FP1A 3RX4A 3UNTA 3RCYA 2ASHA 4A8LA 4HP5A 2PRLA 3MT1A 1MXSA 3MHGA 1XD0A 3GYEA 1ONEA 1DP0A 2MUCA 4ZE5A 3RPMA 3TYUA 1OF6A 3LUTA 5CJNA 2GJNA 4MY1A 2X2GA 2W27A 4LAKA 1VFFA 5GQBA 1EJWC 4NT0A 4DJDD 2WK2A 3B0YA 3TN5A 1XYFA 1UC4A 2E4TA 2ZRYA 4E8DA 3G2GA 2CHNA 1SGJA 4DBUA 1UKQA 4RDWA 3VIFA 2AL1A 4IQDA 3ARQA 1UWSA 5D09A 5T26A 1VLWA 2ZRXA 3LB0A 1R2RA 3T78A 4TOQA 3SFKA 4IL2A 2UV8G 1F8MA 3EA1A 3W07A 2ADAA 4OOZA 5A6LA 3JU2A 1OC5A 1LDCA 4LF1A 1GTEA 2BXZA 4O4WA 5GJPA 1W9XA 1G4TA 3TWBA 4ASTA 2PSNA 3VKBA 3FFSA 4LB4A 4N0RA 5AC8A 5I3HA 1UQYA 1C90A 2O4MA 1FX6A 1H7OA 3SGZA 4OOUA 4BI5A 1WP6A 4OV4A 2WSRA 5BXPA 1UPPA 2RHGA 3N34A 3OZMA 2OOFA 3T09A 5CLTA 1OK6A 9XIMA 3WK2A 1UKPA 5LNRA