1C8YA

Endo-beta-n-acetylglucosaminidase h, d130a mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFADEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
total genus 91
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c8yA00
2CNCA 4OOUA 3WFLA 3VGEA 4MB4A 1FH8A 2GJXB 4AZ5A 1PX3A 4GINA 4CVUA 2W91A 3K8MA 3AIWA 2VR5A 4PCSA 4XZWA 3WDRA 1V03A 3BC9A 1LJYA 1DWFM 2FGZA 4OBSA 5IDIA 3MUAA 4AZ7A 4BS0A 4BF7A 2YL9A 2BS9A 4V2XA 2G3NA 5BRPA 1OD0A 3BSGA 5KZ6A 1HVXA 1E6XM 4UCFA 1QNRA 2IUZA 2J7BA 2VURA 4QCFA 3SCVA 1B0IA 1EA9C 3NSNA 3PZTA 2YJQA 4YPJA 2J7EA 1VJSA 1MW2A 2EEXA 3VMOA 4CD8A 1RH9A 4J3XA 5HNNA 5DT7A 3NJ3A 5IXEA 3MU7A 1B3YA 1BYDA 3UG3A 1K9EA 1C93A 3ARRA 3G6MA 4U3AA 1CXFA 2WKGA 3EDFA 3OA5A 1JD9A 4W7VA 1US2A 3M46A 5A2AA 4CGTA 1OT2A 1K9FA 2VRQA 1XH1A 1E3ZA 1AQ0A 1YQ2A 2Y8KA 1B1YA 1EOKA 2CXGA 2J79A 1U2YA 1G01A 1VBUA 2G3JA 3IJ9A 4AW7A 3RDKA 4PYSA 4HZ7A 3AHYA 3KWXA 4GZIA 4DUXA 2XSBA 4JAWA 3RMEA 1JZ4A 2VQUA 1M53A 4B3KA 3VDAA 4UQEA 1DWJM 1TR1A 1HNYA 2ZXAA 1G0CA 4JCLA 4MNKA 1JYNA 2BFGA 5CPTA 4BQ2A 3GXFA 1AQMA 4ZE4A 3L4WA 5AYBA 3WUEA 1CEOA 3HU7A 2YBTA 2CIPA 3B9EA 4JHZA 3WD0A 3EDKA 5C8BB 1FA2A 3WKZA 5D9OA 3WNKA 1U30A 2VVNA 3OBAA 3VDBA 2Z1KA 3CUFA 2VR4A 3VD3A 1I1WA 2OYMA 3ZSTA 1EDGA 4WSJA 3MV11 3DECA 1OGSA 2J25A 2XWDA 4IPLA 4D6EA 5LA1A 3PZIA 2EPLX 1J11A 1GW1A 2RGLA 1GZJA 2BXZA 3CUHA 4ZE5A 3EYPA 2YLAA 5M5DA 1UR9A 2BV9A 2E9MA 1UA3A 4PMNA 5AYIA 5FCZA 2OLHA 3WUGA 1WDRA 2VL4A 1H1NA 5CPQA 4H7VA 4D6GA 1VEPA 7CGTA 2O9TA 2VCBA 3KE0A 5E0CA 1XCWA 4JFSA 3AIQA 4KH2A 2WMFA 1J0KA 4NSBA 3IANA 1W9BM 2DSZA 4EK7A 5LA2A 1Q6EA 1VJZA 1GNXA 1Y7VA 2XIBA 3WD2A 2J77A 4HMCA 2WWDA 4PRWA 1O6IA 3MSDA 1XC6A 1UWIA 1ODUA 3VGGA 1OB0A 4UQAA 4D6HA 3VDHA 3GYCA 2GFTA 3RPMA 4F8XA 5JIWA 3WELA 2VZTA 4F9DA 3T0AA 2XVNA 2XFYA 1L0PA 1QNPA 3POCA 4AWEA 1UR1A 4HOWA 2J8GA 3G6LA 2XM1A 1ISYA 3TP4A 1GHRA 4PTWA 5EB8A 4X0NA 2CHOA 3O6AA 1QOXA 3L2MA 1TA3A 3CTTA 1FH9A 1V3LA 1ZL1A 1WZAA 3W53A 4FF5A 2A3HA 1NARA 2XHYA 3PZOA 3T0BA 3ARZA 1KGXA 5E09A 1V6VA 2WMHA 5D8WA 1FH7A 1H41A 1KB3A 5AC4A 3OIHA 2E9LA 3WDPP 4PSPA 1Q6FA 1UD5A 3K4AA 2PWDA 2ZUTA 1FOBA 2WVTA 3OZPA 1C7SA 4NI3A 2DQXA 3CBWA 1OD8A 2WXDM 2F8QA 1TUXA 2VCAA 3ECQA 4MDPA 2X8RA 1XGZA 1BAGA 2ZUWA 1TA3B 3AMLA 1UG6A 2Y8VA 4HU8A 4J3UA 4M80A 1W3HA 5GQBA 3OGSA 3ARWA 1H0GA 4AISA 2J7CA 1TVPA 5GPRA 1IV8A 3EDJA 5FIPA 5CG0A 4B9ZA 5IHSA 4M82A 2J7HA 2Z1SA 4J3VA 3VGBA 4HOZA 1JIBA 3K1DA 3GNRA 1JFHA 1J0HA 4TOQA 5BRQA 2GJPA 3I3DA 3ZJ6A 2DT2A 1CDGA 1MQPA 2AMGA 4H8UA 5I3DA 2DT3A 2B31A 3AMKA 3BGAA 3GDBA 2VT0A 2XVGA 3CPUA 4KRTA 2JF7A 3WF0A 3CHFA 2OSWA 1ZJBA 5CXPA 4P7QA 5D4YA 1NOWA 1BSIA 2ZOXA 4QLKA 4AC1X 3WMSA 4XB3A 1VFMA 3CUIA 2DDXA 4J7RA 1H4PA 2CHNA 2QV4A 1JL8A 4QLJA 2ZXDA 1BHGA 4ZXLA 1HT6A 4PMDA 3SCTA 3N17A 5BXTA 1H49A 3CHCA 4MNJA 3DC0A 1CXIA 4M8UA 3IK2A 3KEHA 2BVTA 2EBNA 3J7HA 1MQRA 2VTFA 6A3HA 4WKFA 3BSHA 1UOKA 1L8NA 1CGXA 4BQ3A 4QDMA 3BLPX 3DHPA 1G9HA 2D1ZA 1W2PA 3TA9A 4J3TA 1WO2A 1GOQA 3VU2A 4MB3A 3FHQA 1WAWA 4EAMA 3WIJA 2NW0A 1JI2A 1E6QM 4H04A 2E0PA 4D6DA 3CLWA 3O2LA 2GSJA 5I24A 3ZJKA 1HIZA 2FHFA 3MANA 3WD4A 3N18A 1CGTA 5DEZA 4UOJA 4M29A 1QW8A 3PZNA 2FHBA 1SR0A 5CGTA 1E5NA 1EHNA 4MNLA 4L4OA 3B9DA 3AICA 2BY0A 1OGBA 4JL2A 2G8ZA 1NP2A 2EPKX 3M07A 1UD4A 2QMJA 1E0VA 2ZUNA 3PZVA 2J75A 1B31A 3VUPA 3VMPA 4W8AA 5IFTA 3SUSA 1Q6CA 5A94A 2J47A 5E70A 5A8PA 4YHEA 2ZX5A 3ZSSA 3VD9A 1GOKA 3MV01 3POHA 5I23A 1E4MM 2FGLA 5D9NA 3PTQA 2OWWA 3TTSA 1WKYA 3GXDA 2WSKA 1E4IA 3CMJA 4CU8A 3AMGA 5A1AA 2E4TA 1M04A 3SCQA 3U7BA 3OGVA 4GKLA 2VNCA 3WQ4A 1AVAA 3MUY1 3T09A 1CGUA 1RP8A 3WDJA 3N12A 3A4XA 3VX1A 5AY7A 4PSRA 1V6YA 1E71M 1C92A 1GVYA 4Z2JA 4WJXA 1C91A 4GO8A 3VO0A 1US3A 4U2ZA 1UD2A 5E6YA 5GNXA 2HISA 3WQWA 3ARQA 4PCTA 3RILA 1KXHA 4MTVA 2JE8A 1ZU8A 4PTXA 1WPCA 2G41A 1MYRA 3QGVA 2DH3A 4R27A 4JFWA 2W63A 1CYGA 3OZOA 1UHVA 2XGBA 4V28A 5I77A 5BCAA 4UZSA 2VVSA 3QHNA 3WD3A 2XJ7A 5HDRA 1B90A 1V3MA 2WW5A 3UR7A 1J9YA 4L4PA 1JNDA 1E6ZA 1CGVA 1W2VA 3OLDA 1WE5A 4AD5A 1HJXA 4FK9A 5A8OA 4XV0A 5LYRA 2WCSA 2YBUA 1LF1A 3RO8A 4A3YA 1JDCA 3FAXA 1W9PA 6TAAA 1KXQA 1QI2A 4LGXA 3VMNA 3WH6A 1JNEA 2IXVA 1B2YA 2G3IA 1R8LA 2WHKA 3PZ9A 3VIGA 2ZE0A 1XD0A 5GNZA 1BQCA 3ZIZA 2YA0A 2J74A 3EMCA 2CKSA 2ZX9A 3FXYA 3WF4A 1W1VA 3AI0A 4ACZA 5A8MA 1E3XA 4W84A 1UH2A 3AOFA 5GNYA 4P8XA 3UESA 1UQZA 1ISZA 4UOZA 3GBDA 1B3XA 4P7RA 3AMDA 1LL7A 4PEEA 3RM4A 5I79A 1JD7A 2ZX6A 1C3FA 2XTKA 1EDQA 1R85A 1K9TA 4MAVA 3GZAA 3DHUA 3EDDA 3VGHA 2RGMA 1OINA 5ABEA 2WANA 1OWQA 4BQ5A 4AYSA 1KFWA 1OCQA 2FHCA 4IM4A 4QAWA 3WH9A 4CU7A 1JF5A 1LQ0A 1CGWA 1BYBA 1CIUA 2ZIDA 2WVSA 2XVPA 1OSEA 1DP0A 4GO9A 4ACZB 3WBEA 1WB0A 1GQLA 2YDQA 3NSXA 4YHGA 5BXPA 1QHZA 3AHVA 4OUEA 3AIEA 2JALA 4FLSA 2WVUA 5AC5A 4TVDA 3ZO9A 4P8UA 4TTGA 1QHOA 1PBGA 3PZMA 1KR0A 3EDEA 3SEPA 3BAIA 3NIYA 2JEPA 4Q7NA 4Z2GA 2WMIA 3F4VA 3W82A 2JIEA 4UFMA 3ZQ9A 1DWHM 2CYGA 4E8DA 3AJ7A 3CIVA 3RM9A 1AQHA 1TG7A 2DSKA 4HZ8A 2E3ZA 2XWEA 3L4XA 5EMYA 4CVWA 5ABHA 4AY1A 5ABGA 2D0HA 5D9MA 4UFKA 4F9JA 3WH8A 2IXUA 4AEEA 2BHZA 1BTCA 4OJYA 4PMQA 1PIGA 2WBGA 2DSWA 1UA7A 5DO8A 4D72A 4NZCA 4FMVA 3DYPA 4PBGA 5A6MA 4UTFA 2J7DA 2QMKA 3AYRA 1QW9A 3N9KA 5FD0A 4W86A 1E1EA 1WZMA 4MADA 2J78A 1E6PA 4LX4A 2XUCA 4LYPA 1Q6DA 2WC4A 1KWGA 2WMIB 4D6FA 4J28A 4LXFA 1NH6A 1V6WA 3OLGA 5FOOA 1V02A 2YOCA 4PUEA 4DWSD 3MMWA 1J0ZA 4S3JA 1F4HA 3L4YA 1XSJA 2D2OA 2V3GA 5A6BD 4U3CA 1B3WA 4EE9A 1KQYA 1HJUA 3WMBA 3W28A 3ZT6A 3NYDA 1PPIA 5A6SA 3ZJ8A 2V3DA 3UG4A 5ABFA 2BHYA 4GI9A 2Y2WA 1QI5A 2V3EA 2WC3A 2YL8A 3K8KA 1H3GA 2WSPA 1BFNA 1CECA 3N04A 6CGTA 4UQ9A 3VTRA 4E2OA 2WZIA 2Y4SA 2QPUA 4W88A 3AXHA 4PMUA 1Q4NX 3MS8A 4HZ6A 3WNNA 1EOMA 1V0NA 4HPHA 4CD4A 1E6SM 3IAQA 1C8QA 1R7OA 3ALFA 2ZUVA 1KXVA 3ARXA 1J0YA 1OT1A 1UYQA 2ZX7A 5HXMA 1VFOA 1X1NA 3FW6A 3WDHA 3N13A 2WBKA 1E15A 1K9DA 1JZ2A 1UH4A 3VNYA 1JG9A 2BHUA 3AROA 3WN6A 2YL6A 4UQBA 1ESWA 4H2CA 4UQCA 3CZEA 3KL3A 3W0KA 2CITA 1VEOA 1EGZA 4CN4A 3IJ8A 4HTYA 5HPCA 2BXYA 5ABFB 2Y24A 3WEZA 2ZUUA 1W32A 1BGGA 4Z2KA 2O9OA 4CU6A 4C7DA 1GOOA 3SIMA 1QVBA 5FL0A 3MUIA 4B3LA 3UG5A 1BYCA 4MDOA 2WZHA 4HA3A 3WQVA 1NWRA 2BY2A 1KR1A 1CLXA 4B16A 1JFXA 2X2YA 1GORA 3S6TA 1E56A 1I75A 5A95A 1UZ4A 4DWSC 3T08A 2VX6A 4M56A 1W3JA 1V6UA 3BAJA 3WL1A 1S46A 1HL8A 1WZKA 1ISWA 4DUWA 1MW0A 2VX7A 2Y5EA 4BQ4A 1MXGA 3K46A 2YA2A 3OGRA 1PZ2A 4HP5A 4DWSA 5DFAA 4U5IA 2X0YA 2YKKA 1UWQA 3MKKA 4W5UA 1EDTA 1UR4A 3M7SA 1EHAA 4KGJA 4J3WA 2J8FA 4KGLA 4GIAA 2PWFA 3SURA 5E6ZA 3LPFA 2VZSA 3BLKA 3S2CA 4F66A 4PMRA 2DSVA 1W9UA 1FP9A 3LPOA 2WAGA 1V0KA 2F61A 3EMQA 4KRUA 3THDA 3QHMA 4XUYA 2UWFA 3T0DA 2CESA 1CENA 5A6AA 3CUJA 1FHDA 1C90A 4RE4A 4D1IA 4WLCA 4CCCA 4KWUA 1UD8A 3AS3A 4UFLA 2D3NA 1ZB5A 3GBEA 3QHOA 3AZSA 2BVDA 3BAYA 3AS0A 1NQ6A 2NT1A 5JUVA 1W3KA 3KL5A 2CERA 4FLQA 3W4RA 4DWSB 1JAEA 1GVIA 2W66A 5IHRA 2D0FA 2GK1A 2XFRA 4U31A 4ZFMA 4W5ZA 1V3HA 4M1RA 1E70M 3MUZ1 1C8XA 5A6KA 1UKOA 1H0IA 1TFVA 1JXJA 3F5KA 1XSIA 1CWYA 7TAAA 3U5YA 1VIWA 3SCWA 4CKQA 1GCYA 4BCEA 1QNSA 2WPGA 1W9DM 4PMYA 1KGUA 1J18A 3U5UA 4CUCA 1FP8A 2XVLA 2XG9A 3FY1A 1DTUA 3L4ZA 2VRKA 3NSMA 1UWUA 1JI1A 1I1XA 1HP4A 1QI4A 3WUBA 3FN9A 3SUTA 3A4AA 2A3AA 3CMGA 4EKJA 2JFEX 1SMAA 3WL0A 1XD1A 4UOQA 4DUVA 2GK1B 4GXPA 1HXJA 3PBGA 1HVQA 4AD0A 1R87A 2UY2A 4JKMA 1GJUA 1LWJA 2PBOA 1J01A 3GH5A 4JFUA 4WIWA 4CD7A 5HPOA 1GOMA 4Y7EA 3AMCA 3CZ8A 2W5FA 2EPNA 1HJVA 3VIFA 4A4AA 4HA1A 5CZKA 1MXDA 2DPEA 3I3EA 1MQQA 1DWGM 4NF7A 4WSKA 3CZJA 3U57A 2DT0A 3SCUA 1W3LA 4XZBA 4UR9A 3WNOA 3WY1A 4PMVA 1E72M 2VUYA 4PUDA 3W38A 5EBAA 1PIFA 3FHAA 3JUGA 2D20A 4AZBA 3LMYA 3ZJ7A 3SCNA 4UNIA 3ARTA 1O7AA 2VQTA 4A3HA 1TE1A 4P7LA 5IFPA 1HL9A 4FLOA 1JF6A 1CLVA 1X6LA 3MSGA 1QI3A 2NT0A 2WWCA 4K68A 4UFHA 5JBEA 5DMYA 1B30A 5CSUA 1VENA 2QHAA 4PTVA 3U7VA 4WF7A 1CXEA 3VM5A 3F5JA 1UR0A 1V3JA 2PF0A 1VRXA 1OIFA 3GXIA 4W7WA 4URIA 1MFVA 3VINA 4OOZA 4AIEA 2GVYA 3QOKA 1PAMA 3GH7A 1GQKA 2BNJA 2ZXBA 2V3FA 3SUWA 4AZCA 5M3WA 2X09A 3WDIA 2JIWA 2XM2A 1BGAA 4GZEA 1TVNA 1WZLA 3WNLA 2OSXA 2UY3A 1JYWA 3AISA 2JF6A 5CJ5A 3WDQA 2CBJA 2TAAA 3BCFA 5A8QA 1JZ6A 1MWOA 2WHLA 4PN2A 4TX6A 4F79A 3AHXA 2A3CA 4E4PA 2EJ1A 5A3HA 3L4UA 3PTMA 4ACYA 3ZR5A 1EQPA 1EH9A 1UH3A 1LL6A 5KEZA 1CPUA 1V6XA 1UWTA 3CUGA 1W1TA 5EFDA 3W81A 1TCMA 2WHMA 3SCOA 1GQJA 3VD5A 3SCPA 5ECUA 4WKAA 4V27A 4LQ1A 4AZCB 3WF3A 2FH8A 3FAWA 2VZUA 3LPGA 4W93A 3A3HA 1JYXA 1VB9A 3OLIA 3ALGA 4JHOA 2GDUA 1UZ1A 3ZM8A 5A2CA 2XYLA 5CLTA 1PX4A 3WQ6A 2WCGA 3PZQA 2UY5A 1XCXA 1NOUA 3TONA 5EFFA 4TVUA 3RIKA 2XIIA 4PMXA 1PJ9A 2OWCA 1Q6GA 1KQZA 1CXLA 4D6CA 4GPNA 2J7GA 3UETA 4QLLA 5BROA 4HA4A 4GZJA 4JL1A 4MAZA 4AD3A 2C7FA 1V3KA 3AIVA 2VO5A 3AXIA 2PC8A 4HPGA 4GQQA 1NP0A 1ECEA 1H11A 1WCGA 4Z2HA 3ZR6A 3EBVA 2NSXA 3ARSA 3VPLA 4HOXA 4D6JA 4JFTA 2E8ZA 1VAHA 1QPKA 1C8YA 2XFFA 5JBDA 3A6OA 1VEMA 3RJYA 1E4LA 1HJWA 4W7UA 3RCNA 2EXOA 1NOFA 1E5JA 4ZEPA 1HKIA 5I6SA 4B15A 3DYMA 3SCRA 4X9YA 3SUVA 3ZT7A 3VD7A 2OYLA 4QFUA 1JAKA 4PMOA 4JFVA 1CGYA 5CSYA 1OBAA 4J3SA 1ZBWA 3NCOA 3NDYA 4AIUA 1CNVA 1C7TA 1J10A 3APGA 1SMDA 2X0HA 2VRJA 4HMDA 1R86A 5JBFA 4H8HA 2ZUMA 2J62A 3W29A 3AZRA 1SYTA 4MNMA 1E4NA 1PEZA 3OB8A 1H5VA 1VFFA 2VX4A 2F2HA 3VDCA 2BY1A 1OGGA 2DEPA 1BVZA 1IZKA 2CBUA 2FDMA 3D3AA 2DH2A 1M7XA 2OWXA 3CZKA 1J0JA 3IJ7A 3ZT5A 4TTUA 3CZLA 5M03A 2OYKA 3QOMA 2ZWZA 1W1YA 3ARPA 1OIMA 2W4XA 3A47A 2ZXQA 1BVNP 4W87A 3WH5A 5BWFA 5C71A 2DGAA 3GH4A 1D7FA 1UQYA 2DT1A 3BMWA 2PWGA 4H8VA 2VI0A 2WMJA 1RD6A 4XX6A 4LPCA 1WDSA 2EPMX 2OSYA 2X1IA 1BPLB 2EO7A 1A3HA 1B3VA 3AHTA 1WP6A 2A3BA 3AIBA 3NUKA 1JYVA 3W26A 2WCAA 1UWSA 1JZ5A 1WNOA 2YLLA 1GONA 1ITCA 2CBVA 5A2BA 2VZVA 3WF1A 1XV8A 3HJEA 4GI6A 3WFZA 4BA0A 4JKKA 4MB5A 1JDAA 1QHPA 1A47A 3II1A 1H09A 1GPFA 3M6DA 1ODZA 3K4DA 4W8BA 4TX8A 1MVYA 3THCA 1E43A 1LG1A 1D3CA 4DM2A 3AXXA 1DEDA 1HN1A 3WQ5A 1QI0A 1ZBVA 3TOPA 3DYOA 1GOIA 4JIEA 1V0LA 4EANA 3GXMA 1JDDA 1G5AA 4TVCA 1G1YA 1PZ3A 4M81A 9CGTA 1E40A 3VKKA 3WQ8A 4CD5A 2O9PA 3ZMRA 2G3MA 2PI6A 1J12A 3B8SA 2D0GA 3N15A 1UUQA 5I2UA 5E0FA 3AHZA 3NDZA 1V3IA 3VIOA 4CCEA 1SFSA 4LYQA 2J4GA 1E6RA 5HOSA 3PZUA 2QLYA 2X05A 3L4VA 4MJ4A 2E40A 2BVYA 3MO4A 2G4FA 1JZ8A 4OKDA 4GI8A 4AZHA 1UD6A 3AS2A 1KBKA 2VJXA 4N0RA 2AOSA 3OG2A 4E8CA 1E55A 4W85A 1CTNA 4PMZA 4UZUA 1HKJA 3UR8A 3ZOAA 3K8LA 3HN3A 1HKKA 4OZOA 4B9YA 1UKTA 2VMFA 2WB5A 5CLWA 4HU0A 1XSKA 4ATWA 3WUFA 5A69A 5CGMA 4AZIA 4FLRA 3VVGA 1DHKA 4NRSA 4ZENA 2XSAA 1JZ7A 4IUGA 1KBBA 4C7FA 4C7GA 4IISA 1F4AA 2E9BA 1JZ3A 2WC7A 1HKMA 1QNQA 4N42A 1P6WA 2ZUSA 3KL0A 3ARYA 3UERA 3ARVA 3D5HA 3HMCA 5DF0A 1B9ZA 3EMZA 2V5CA 1E0WA 3O9NA 3AIUA 4JKLA 4P7OA 4KMQA 1NM9A 2WMKA 2XVKA 1ZS2A 5A8NA 4UQDA 1V08A 3W27A 1UR2A 2V5DA 5A6BA 3AFBA 1VBRA 3BAWA 3WD1A 5D8ZA 1ITXA 4MB1A 4MJ2A 1B3ZA 2WKLA 1MW3A 4UFIA 4NRRA 4AD4A 3MMDA 1K6AA 3SUUA 2ZX8A 1GHSA 2ZWYA 2VOTA 1KWKA 4RL3A 3WSUA 5JIPA 5A6JA 1V0MA 1J0IA 1HP5A 2WLYA 1OM0A 3VIIA 4D6IA 1CZ1A 1QBBA 2XPKA 1G94A 3VOCA 2V38A 4D71A 4LYRA 5LA0A 1MFUA 4AZ6A 3UCQA 1XH2A 3W24A 2XGIA 1VF8A 4RE3A 1BF2A 3FNDA 4ATDA 4AEFA 4S3KA 3TTQA 5BYWA 3SCSA 2QPSA 4W8LA 2EPOA 1TMQA 3CHDA 4CD6A 5CQ1A 1EO7A 1EXPA 5BXSA 1UD3A 2CETA 3WBAA 1LLOA 5HBFA 2Q8XA 1E9LA 5TD4A 5A6LA 4UFJA 3A4WA 2YA1A 3VIMA 4AD1A 3AYSA 3WNMA 2MANA 4HMEA 8CGTA 2D23A 1R7AA 1UWRA 5FKYA 2CPUA 4CN1A 1DWIM 3BXWA 4WK9A 4OIFA 1DWAM 1HF6A 2PWEA 4AZGA 1W9XA 1E1FA 1RP9A 2PWHA 2WK2A 4CCDA 4JCMA 3B9AA 2UY4A 4ML4A 3PN8A 2WHJA 1IZJA 3MMUA 3N1AA 1PX8A 1D2KA 4TUFA 2JEQA 3WH7A 2ZICA 7A3HA 1BYAA 2WYSA 5D9PA 3VGFA 3QR3A 3W6LA 1UKSA 2CKRA 5I0DA 3RJXA 2WLZA 4Z2IA 5I5RA 3CZGA 4P8WA 2A3EA 2EQDA 3AS1A 5E9AA 1U33A 3F5LA 4CN6A 2YL5A 3VX0A 3PZGA 2FH6A 1EIBA 2CCRA 3VM7A 1W1PA 4AXNA 1GOWA 3TTYA 5CPSA 3LPPA 4BZYA 5C70A 1XRVA 4TXEA 2GUYA 2WMGA 2WNWA 4P7NA 1M03A 1X6NA 1ZJAA 1KXTA 1E73M 1RPKA 1V02E 4U2YA 4DM1A 1GJWA 2DIEA 2BY3A 2E8YA 3VNZA 4PTMA 1HJSA 2VZOA 3GTNA 4MPKA 3VD4A 2C0HA 1QBAA 3VIHA 5BXRA 3TTOA 2WVVA 1W9VA 4U5KA 1HJQA 3AZTA 2WM0A 1BLIA 2W92A 3BAKA 2QF8A 1NWUA 1XYZA 1EO5A 1XYFA 4ATLA 2GJRA 3OLEA 1NWSA 1BG9A 3WENA 1WDPA 2DIJA 4Z2LA 2W62A 3T2OA 1M01A 4YN5A 3GM8A 5DT5A 4JZ5A 4P8VA 1LL4A 1XH0A 3PHAA 1ISVA 3ARUA 5FL1A 1MW1A 3GNPA 2GDVA 2YDSA 1NWTA 4QCEA 4M24A 5F7UA 1UR8A 3RM8A 1H2JA 3WMCA 3WF2A 2C8NA 1FFRA 2WVVB 3T2PA 3BH4A 1UKPA 3IAPA 4U33A 4IPNB 3W6MA 2AAAA 3L2LA 3VGDA 2VCCA 1Z32X 4AMCA 4ZXOA 3VIJA 1QNOA 1ZBCA 8A3HA 1EQCA 1LG2A 3WEOA 2D3LA 2VX5A 2PB1A 4J27A 3I3BA 1GQIA 4AIOA 2O9RA 1FFQA 1TZ7A 4WKHA 1BG4A 3VIPA 3UEQA 4RE2A 2W67A 3W37A 4QP0A 2O92A 3CGTA 3N11A 4R5EA 3GNOA 1JXKA 1HX0A 3BCDA 3E1F1 3VILA 1VFUA 2GJXA 2CBIA 1GUVA 3AIRA 1IT0A 2W61A 1CXKA 2PBGA 2YDRA 2D22A 3CH9A 1LWHA 4Q22A 5M17A 2HVMA 1KGWA 1KCKA 1ZBKA 3CO4A 1ISXA 1XHGA 1AMYA 2D24A 4X0VA 1CXHA 1N82A 1FHLA 3WNPA 1E0XA 2DSUA 3AQUA 1W91A 1KCLA 3PTKA 2CEQA 2VC9A 1CBGA 2J7FA 4D1JA 1YHTA 3BAXA 4GQRA 2WZEA 4H41A 1UKQA 1WDQA 3VIKA 4AD2A 3KZSA 1E6NA 4W89A 1JGIA 3BMVA 3CHEA 3L4TA 3WEMA 3W25A 2ESCA 2YIHA 5I78A 4OBRA 3T2QA
chains in the Genus database with same CATH superfamily
2CNCA 2VXNA 2V67A 2FIQA 2QJGA 3TQPA 1PX3A 3DG7A 2W91A 1GW9A 3K8MA 4XZWA 1S38A 2UV8G 4X63A 3BC9A 2V2CA 2FGZA 4BF7A 2YL9A 3BSGA 2ZFAA 3MMTA 1RCOB 3IUIA 2VURA 4JNYA 2J7BA 4QCFA 1KW1A 4AVNA 1BVWA 1B0IA 5XIMA 3PZTA 5REQB 3TCEA 3CLMA 1SW7A 1RH9A 4E2DA 3TXVA 4HZMA 4YNGA 5FEXA 2Q8ZA 4E2BA 1K9EA 3E9AA 2XZ9A 1CXFA 2WKGA 2PDHA 3EDFA 3W6YA 4LC8A 5HATA 2XIQA 5D2XA 4CQ8A 4W7VA 4AIBA 1OT2A 4IIHA 1VLWA 1E3ZA 4GNJA 1YQ2A 4I5UA 2Y8KA 4LTSA 2E09A 2J79A 1PWMA 3MZNA 4FS9A 3TC3A 2V30A 4B5TA 4JEQA 2PEVA 4XZHA 3KWXA 1QK2A 4DUXA 3W01A 2W79A 4QAIA 1JZ4A 1UP0A 2GOUA 4UQEA 4S3FA 1DWJM 4INFA 2CWNA 2Z2BA 1LYXA 3LHVA 3R8RA 3S2MA 1KBJA 2BFGA 1FWSA 1GTEA 3W73A 3NPWA 1K8ZA 3L4WA 4G7FA 4S38A 2V5KA 5CC3A 5I3GA 3C6CA 1JQVA 1YNYA 4NZJA 2IPFA 3BURA 1EA0A 1PE1A 3HU7A 4JHZA 5J5RA 3EDKA 5D9OA 3VE9A 5FESA 2VVNA 3OBAA 3V0SA 4LCQA 2INEA 4H9ZA 2Z1KA 1KBIA 1XKYA 3BV4A 1TRDA 3DECA 2J25A 2PDBA 2ZZ3A 4D6EA 1W6TA 5MKGB 1WA3A 5JMUA 1J11A 4GGBA 1S39A 1IT8A 2ISVA 2BGSA 4QQ3A 3WLRA 4OT7A 1UA3A 4PMNA 1FWFC 2Q71A 5AYXA 3V1HA 3Q2DA 3T78A 2WMFA 2DSZA 4G2DA 4EK7A 1VJZA 2P5NA 2YB1A 3RLHA 1GNXA 1Y7VA 2XIBA 4HMCA 5F4XA 2WWDA 5HQMA 3AAMA 1ODUA 1BQGA 3VDHA 1ECQA 3GHTA 6REQA 4F8XA 4TU1A 3HPFA 4XKYB 3TC7A 4JTUA 1L6WA 2BOGX 3LU2A 3POCA 4AWEA 4REQB 3DGBA 1JPKA 5CPOA 1JCJA 4QE5A 2F6UA 1XIIA 1ISYA 3TP4A 3L66A 3RGTA 1WYIA 2GGJA 1XWYA 2CHOA 4NXKA 3G77A 4FXFA 4I7VA 3L2MA 3TIMA 3WJYA 1E1CB 4CNNA 3DI1A 3CTTA 3W53A 1NARA 3GR8A 2XHYA 2QCCA 3PZOA 3T0BA 5E09A 1V6VA 1RBAA 4LJ3A 2VYOA 4AHQA 3HOJA 1S1PA 1KB3A 2X0SA 3LYEA 5AC4A 4A8IA 2EJAA 4DEFA 1PZ1A 3WLKX 3W2JA 3WDPP 4LW7A 1Q6FA 3MSYA 1UD5A 3N19B 2Z2UA 1OFQA 1P1MA 4AMAA 4HA0A 4UTKA 4AU0A 4A3QA 4IPPA 5FJTA 3W2KA 1Q63A 2WXDM 1TUXA 4LUSB 2EAWA 2X8RA 1XGZA 4FI4A 3AJXA 4RNFA 3IUHA 1DJQA 1A53A 4HU8A 3MCNA 4FR1A 4M80A 5HUOA 2NWRA 4I9JA 1FY6A 2Q3OA 3LTYA 3OGSA 4P61A 4AISA 1IV8A 3EDJA 5FIPA 5D02A 3B8TA 3LHTA 8RUCA 5BU6A 2Z1SA 4O0KA 1KTBA 2WKJA 3WG6A 5EY5A 3VGBA 1RK5A 4HOZA 2ZRYA 1UJQA 2ZRWA 2FMNA 1H7NA 1CDGA 1MQPA 5K9DA 3M5ZA 1NVMA 4HBKA 4WDTA 4TQTA 4XK2A 5AN7A 3T0CA 4UTTA 4Y96A 2AQVA 2OSWA 4ZQRA 1V77A 1G6CA 3HBLA 3N9RA 4MF4A 3B0VC 3G1AA 3CUIA 3ITVA 1U22A 4J7RA 3H2AA 1JPIA 4L4LA 3OIXA 1JL8A 1BXNA 3TYDA 1XRSA 4HNVA 1L9WA 4MNJA 1UC4A 1NFPA 3BG5A 3W22A 1UOKA 1L8NA 2YGYA 3O6YX 4BQ3A 1G9HA 3S1XA 1K6WA 3VU2A 3S1WA 1V7YA 2B7QA 3SQLA 2R1PA 2VEIA 4FXJA 3FHQA 5BOFA 3DKLA 4JHMA 1R47A 5C54A 4EACA 5GVJA 1X98A 3O2LA 4RZ6A 1QATA 4KF1A 2FYMA 4IP7A 1EP3A 5DEZA 4ZOBA 4I9TA 4M29A 1EHNA 4MNLA 4L4OA 3B9DA 4JL2A 3M07A 2QMJA 1E0VA 1Q7ZA 1ONEA 1D3GA 5D03A 3VMPA 2Z6IA 3OZMA 1B54A 3DHDA 3QR0A 4AAJA 1VJIA 2QCMA 4JX6A 5K9XA 5IFTA 2VGBA 2FLIA 2DZWA 2PGFA 1Z8AA 3N2CA 4Y6GA 4IFOA 1GG0A 3VD9A 5I23A 1HO1A 3KS5A 4X2RA 3QZ6A 4QEEA 3WK2A 3QZEA 4C6CA 3QJAA 3GXDA 3KBVA 3CU2A 3REQA 5A1AA 5FSEC 4GKLA 3WQ4A 3MUY1 3U4AA 3W1RA 3WDJA 3N12A 2HXTA 2DW6A 1QNVA 4FR6A 4H2HA 2HSAA 1R46A 2C16A 4MKSA 1C92A 4Z2JA 4WJXA 2XINA 4X22A 1LOSA 4B3ZA 1VFSA 4O17A 1UD2A 2HISA 3ARQA 5TF0A 1GKPA 4LUIA 2YFOA 4GYFA 5F4SA 4WUIA 4LSBA 1WPCA 2G41A 1DJNA 1MYRA 3S3GA 4C1LA 2GGHA 4UXDA 1YTEA 3V0TA 4MJZA 3LA4A 2CU0A 3OZOA 2XGBA 4V28A 5I77A 2XU2A 4PH6A 4Q33A 4N02A 1OFDA 4LS1A 3K1GA 4KBXA 4L4PA 3QPEA 4NJKA 1OX6A 1BTMA 4NVTA 5KZDA 3M0VA 5IBXA 5LYRA 2YBUA 1Q45A 4AUBA 4O12A 3FAXA 1W9PA 5EMJA 6TAAA 1QI2A 1EZ2A 3XISA 1JNEA 1RCXB 2IXVA 1R8LA 3VIGA 2ZE0A 5GNZA 4C6FA 2DW7A 3EKGA 5K9CA 1FWNA 2PDNA 2CKSA 4LYKA 3BG3A 3F2DA 3WF4A 1A0EA 1OADA 4XQ6A 3TYZA 4ACZA 4IFKB 2Z0IA 1SQ7A 1TJ1A 4EXBA 3AWNA 1DQXA 4D2JA 1B3XA 4PEEA 1ZP3A 1MNZA 2ZX6A 3A5FA 1RQHA 3GXPA 1R85A 2FFIA 3EDDA 3CV1A 1F3EA 1SUXA 3BQ6A 2ZRUA 1AQFA 5ABEA 1V7AA 2VENA 5DQPA 1OC6A 1XP3A 4IM4A 4CU7A 4XAZA 1CIUA 4ZGYA 4LS2A 1DP0A 5D04C 1WB0A 3M6YA 3F4WA 1GQLA 4YHGA 3KRBA 4WXYA 3AHVA 1M7PA 4EPEC 3AIEA 3IIOA 4IQJA 3PBWA 2Y62A 4P8UA 1XQLA 3PZMA 4FP1A 1PTDA 1A49A 3GRIA 3GDTA 4GY1A 4M51A 1JUBA 1G4EA 2ATMA 2WMIA 3F4VA 3ZLHA 4U10A 2JIEA 3S5SA 3ZQ9A 4A2RA 3N2MA 3GDMA 1TWSA 1TPC1 1AQHA 3NOEA 4Z0SA 2XWEA 5ABHA 2Z1WA 4B4FA 1LUCA 1U1HA 4F9JA 4HN4A 3I10A 3WH8A 1I2OA 4AEEA 2GVGA 2QAFA 4NHVA 5DO8A 3NZQA 4D72A 3DYPA 4PBGA 2BGQA 2VEFA 3LOTA 1ZAJA 3TN6A 4O15A 3B0YA 1RR2A 4ZOCA 3RNDA 1F8IA 4ZBCA 1HW6A 1Q6DA 4Y9MA 1KWGA 1O5XA 4LXFA 4IOTA 1EGMA 4HYWA 5EU9A 1V02A 1O5KA 1NF0A 3MMWA 3L4YA 2V3GA 5A6BD 2PGEA 3KXQA 4LAMA 2HE8A 4US5D 1IXPA 1DXFA 3TSDA 2OLAA 2WM1A 2AL2A 1GGOA 4O13A 3EGJA 1XGDA 2WSPA 4Q6JA 1IWAA 4KCWA 4AEOA 4C6IA 2DVUA 5FJJA 4H19A 6CGTA 4FEZA 2WZIA 1QOPA 4UTJA 3AU2A 4D8AA 5KZEA 3RR1A 2GQ9A 2V9DA 2PDWA 4PMUA 1HGYA 1R7OA 3P7YA 3QZAA 3ARXA 1VYSX 2PLCA 3BOFA 2E68A 3IJ6A 5C55A 3WDHA 1XBXA 2WOQA 3W1PA 3LSBA 3A24A 2BHUA 3CASA 2V63A 2DZPA 3EWYA 1ESWA 4IQEA 3VAVA 1A0CA 1UCWA 3THAA 2HWGA 3WEZA 5JVLA 4QSFA 4PMJA 3OO2A 4C7DA 1IR1A 1GOOA 3SIMA 1TSIA 1QVBA 4EWJA 3Q4DA 2IW0A 3HZ3A 5LSMA 2PDKA 4MDOA 1FXPA 1NWRA 2BY2A 5BU9A 3GYEA 1E56A 3BLEA 3LLFA 4DWSC 3WCZA 3ZLGA 2NZLA 3BAJA 4BHYA 3WL1A 1UW9A 1HL8A 1ISWA 4Q7IA 2Y5EA 2XIMA 3LCLA 4BQ4A 1EJWC 2J8TA 1ONRA 2XN0A 4DWSA 5M2FX 2YKKA 1AK5A 1UR4A 1DOSA 3DEQA 3ZVHB 3SURA 3IIXA 2CLMA 2ZZ4A 3GG1A 4H1ZA 3LENA 4JIRA 3OEXA 1V0KA 3EMQA 3E38A 3QHMA 2UWFA 4AVOA 3M0MA 2V6AA 4NY2A 1QOQA 3AYVA 4RE4A 4OHQA 4M6PA 4KWUA 3L21A 4W9TA 1AH3A 3P6LA 4ZZ9A 2V5JA 1GJPA 4HHLA 4KEMA 3UBPC 3LHUA 2NT1A 3LN3A 5AOUA 1JRBA 1SFTA 1ADDA 3NEHA 1TJRA 2J6VA 1RXOB 2B4GA 5DCDA 1V3HA 3H7UA 4C1NA 1E70M 4K36A 5A6KA 3OG3A 3PY2A 1H0IA 4ZVJA 3WBXA 4S2CA 2G3FA 5LHFA 4NYUA 3SRFA 2YPIA 4YL2A 5SWUA 3SECA 2XG9A 1DTUA 1B3OA 2VRKA 3NSMA 4MSSA 2PU0A 5C9RA 3A13A 3WUBA 1IEQA 5U4NA 1POKA 2A3AA 3CMGA 3TMQA 2YCLA 3E0VA 3WL0A 4I6KA 3W85A 5JH2A 2YCJA 4GXPA 5TAOA 4AD0A 3FSTA 5JH1A 4XZNX 1H7RA 1T99A 3C2RA 4HIBA 4Y7EA 3AMCA 3PPFA 2Z1VA 2XIOA 2F9RA 2PLKA 1PHQA 2DY3A 2EPNA 1MRQA 5TBOA 4A4AA 2R1MA 7ODCA 1MXDA 1XLJA 2FB3A 3WJSA 1J79A 2DPEA 4NF7A 3U57A 4MY1A 3P74A 3CZJA 1JRCA 4Z1DA 4GMEA 5EA9A 3MA8A 4UR9A 2WJFA 3WY1A 3BSMA 2FVMA 3W38A 4PUDA 3HM7A 5EBAA 3R94A 3DBNA 3LLDA 3LMYA 2E6AA 3ZJ7A 1TTPA 3GVVA 2V69A 4P7LA 1HL9A 1X6LA 4XO6A 3EPNA 2WWCA 2NWSA 4M3PA 3CMFA 4RZBA 4WY0B 5CSUA 1GZGA 1W3NA 4MKVA 1CXEA 3VM5A 9XIMA 1PHWA 4ZOAA 4HK6A 2DUAA 3TN5A 3IGSA 4JDYA 1MFVA 2C1IA 3VINA 2X1TA 2DU2A 3GH7A 1GQKA 1JEZA 1R2TA 2V3FA 4AZCA 2GSHA 2X09A 3EPOA 3DOPA 1BGAA 4GZEA 3KHJA 2UY3A 4GJJA 1JR1A 3N73A 1H63A 3L5LA 3GDRA 3F4NA 2QJIA 2TAAA 4A29A 1MWOA 3COTA 4LWWA 4ZB2A 2QDEA 3UXKA 2HROA 2A3CA 5A5WA 1SZFA 1RQBA 4GYPC 3G1FA 4QTGA 4QNWA 4E38A 4IWWA 3GB6A 3PTMA 4LVFA 3L12A 3ZR5A 4BY3A 3R2GA 4ML9A 1UH3A 3CPGA 1WV2A 1LL6A 4IFKA 5GJMA 3CNYA 3LUTA 1V6XA 1UWTA 3CUGA 3BLOA 5D2TA 5LIUX 3SCPA 4GFIA 2VD9A 3VFCA 1NSJA 2FH8A 3FAWA 3A3HA 1JYXA 1VB9A 3E2QA 2GDUA 5H8UA 2XYLA 5CLTA 5AKQA 3DH7A 1RA5A 4Z17A 3W02A 3TONA 4TVUA 2R1NA 2Q09A 3LY0A 2XIIA 4A22A 4HNUA 2PD5A 5DRCA 2YR1A 2HVNA 3GG8A 1TWIA 1FDZA 5H6HA 5DANA 2ZZ1A 1AODA 4HA4A 4RUBA 4ZMGA 4GQQA 1FTXA 2QIWA 1P6CA 2WO5A 1ECEA 3WFAA 3A3WA 1JPMA 4Z2HA 4LS0A 3FFSA 5CBIA 3UPMA 4FF7A 3RU8X 3W7NA 2E8ZA 1VAHA 1QPKA 1C8YA 1K8XA 2XFFA 3A6OA 1OZMA 3KZPA 4IX2A 3RCNA 1CLKA 1HKIA 2QCFA 6ALDA 2F6XA 5HANA 3BW3A 3DYMA 3UXDA 3ZT7A 1UR3M 1KCZA 4QFUA 3BK0A 2NVDA 1D8WA 1JAKA 5CSYA 1OBAA 3NCOA 4AIUA 2GGGA 4KKXA 2Z00A 1DXIA 1C7TA 4S3EA 3VKCA 1R86A 3EPMA 1SO4A 2OEJA 2ZUMA 3UFYA 1E0UA 5L9FA 4N4PA 5H8MA 1SYTA 1E51A 2MUCA 4H6QA 5FACA 3QY6A 1KFJA 1E4NA 2VM8A 1PEZA 2FPVA 1CX9A 4GI4A 2OB3A 1H5VA 3GKFA 2DEPA 1BVZA 1IZKA 2GQAA 5FI8A 2OEKA 4WDXA 2VFGA 1X96A 5FJPA 1RBLA 1M3UA 2QIIA 3CC1A 5M03A 3CZLA 1XIBA 3MPGA 2C13A 4W87A 5DMMA 3UYIA 1EKOA 1QTWA 1WAUA 2DGAA 3GH4A 1D7FA 3NFUA 1UQYA 3WQCA 3UNDA 2DIKA 2HS8A 3WJZA 4Z1AA 4JTHA 1BPLB 2IPWA 2A3BA 1OFOA 1T8QA 1UMYA 2H9AB 3W1XA 2EG6A 2YLLA 3P80A 1CCWB 2CBVA 4PUKA 5A2BA 5LNUA 5CC7A 3A4JA 4LB4A 3CT7A 1GG1A 1DIKA 1OYCA 1JDAA 4Z1CA 4BF9A 1H09A 3KP0A 3M6DA 3K4DA 2GPTA 3R25A 1MVYA 3MP3A 3OW1A 3NQMA 5L6UA 2F6KA 1M7JA 3VABA 3W1AA 1QI0A 3G1YA 1GOIA 2TPSA 3CQIA 4JTSA 4AVFA 2OX4A 4AHPA 3UPBA 1EGVA 4CNTA 3Q67A 1YRRA 2C1GA 1KM3A 3VKKA 2QQ6A 4CD5A 4LUTB 2CZVA 1SW3A 5XIAA 2X41A 2QUTA 4ADUA 2REQB 1Y0EA 3ZMRA 2PI6A 1J12A 3MCMA 5E0FA 5FJUA 3AHZA 1K70A 1V3IA 3QXBA 4K1WA 4HN8A 5HQEA 2J4GA 3QPZA 3LK6A 4M19A 3PZUA 1GQNA 2DJXA 2E40A 3MO4A 1EX5A 5TQLA 4M7TA 4AF0A 4JIHA 3G1DA 4N0RA 4ZL1A 4DLFA 3GFZA 1E55A 4W85A 4PMZA 3QW3A 4K1GA 5D32A 1KO0A 3P0XA 3SN1A 2GOKA 4J5NA 4B9YA 1AH4A 4L7ZA 1DIOA 4HU0A 2QNEA 3CWNA 1X7IA 2A6LA 1TTIA 1XYAA 2NSOA 1JZ7A 3NQBA 3EXRA 1F4AA 1BD0A 1REQA 1A5UA 1UUMA 2X42A 4N42A 2ZUSA 3OBKA 3ARYA 1K7EA 4S3GA 2IQDA 2VR2A 3ARVA 1R9XA 3HMCA 5CSRA 1XJBA 2RKXA 4QJ5B 4C6PA 1PL9A 1XLIA 3BJFA 3AIUA 1OC7A 4JKLA 4P7OA 4RXFA 1NM9A 3I68A 3T7VA 2ACSA 3TJ4A 4RKAA 2GL5A 3MDUA 1VBRA 3WD1A 3E6EA 1ITXA 4AQLA 3IGUA 2PP0A 3ITXA 4MJ2A 2WKLA 4IH3A 3HGOA 3GG7A 1K6AA 2G4JA 4R3UA 1RLCL 2Q3RA 1GHSA 2Z25A 4S23A 2VOTA 1KWKA 4IUOA 1ME7A 3QY8A 1J0IA 3W1NA 2IPGA 2ZA2A 3KBSA 1QBBA 2R24A 2V38A 4D71A 5LA0A 3LI1A 3UCQA 1QPNA 3FNDA 5BYWA 3SCSA 1TMQA 3CHDA 2CLHA 3T1GA 1EXPA 5BXSA 4L9XA 4IP4A 4JQ2A 2CETA 2PWVA 1R2RA 1E9LA 4H6RA 3LZ5A 5A6LA 9XIAA 2X30A 4PL2A 5AFDA 4JTIA 1Z89A 1V6TA 2YA1A 3R43A 4FNSA 2QF7A 4Q8MA 4IMEA 2D23A 3CV6A 1UWRA 4LVAA 2DZUA 2OTDA 3BXWA 4WK9A 4JY9A 4PA8A 2PWEA 5H91A 3TW9A 1E9YB 4ML4A 4IXXA 4ERGA 1P7TB 4N6FA 7A3HA 3TAKA 3QF0A 1NFBA 4OECA 2WYSA 3QV6A 5D9PA 3CT2A 3W6LA 1UKSA 4OUIA 5I0DA 3ZS4A 1S3TC 3QC3A 1TR9A 4H83A 3O63A 3LTSA 3CL7A 4CN6A 3VX0A 3KTSA 3G0UA 2FH6A 2PODA 4OE7A 4HCHA 3DU0A 3SW6A 2Y70A 2OPJA 2BVWA 3C3NA 3LPPA 3T44A 2WMGA 2X2GA 2Y5JA 4P7NA 4K7YA 2X1UA 1J2BA 1X6NA 3H23A 3ITLA 3LBOA 3NXLA 1W1ZA 4Q4MA 4Y9NA 3E0LA 2DIEA 2BY3A 2PDLA 4PTMA 3GHUA 3GTNA 4HJFA 4RE0A 4I3GA 4MPKA 4X60A 1QBAA 2B0MA 2QUNA 2WVVA 1W9VA 4U5KA 4ZQMA 2C71A 4WOZA 3KDNA 2QPXA 3W1QA 4H7CA 1NWUA 4MLJA 2HK1A 1ZUAX 3T07A 1QPQA 2AL1A 1WDPA 4NAEB 4XVDA 4GYJA 4DJED 1F3TA 4ROPA 2HNHA 2R1LA 3JU2A 4FHAA 1M01A 5D37A 4YN5A 1RUSA 1HKVA 3PG9A 5DT5A 4JZ5A 3P93A 4GIRA 1A5LC 1LL4A 4PBEA 1S2CA 5FL1A 1G69A 2V2DA 1L6YA 2D73A 5I7GA 1TREA 1UR8A 3RM8A 3WF2A 2C8NA 1W5PA 1YNQA 1A3WA 4WCJA 4U33A 1UBSA 4E8GA 5CJMA 4IPNB 3W6MA 1F5ZA 2PDJA 2AAAA 2W0UA 3VGDA 4IGNA 2VCCA 1Z32X 3W86A 4ZXOA 3VIJA 4Z42C 1ZBCA 4Y8FA 1XX1A 1GQIA 4HTBA 1FFQA 1I2RA 3VIPA 2W67A 3R6IA 1KFKA 3W37A 4QP0A 3WX7A 1W37A 3P2VA 3LCFA 5FA5A 3S1UA 1TYGA 1LBLA 5DLCA 3WZ0E 2GJXA 2CBIA 2HXUA 4JTRA 1HKWA 1CXKA 2PBGA 2YDRA 1LWHA 1F8MA 3QLDA 2HVMA 1KGWA 4JR5A 3KVKA 3RO6A 2DQWA 4DZAA 1XHGA 1EFZA 2D24A 5G4HC 4L9YA 3WNPA 3UQNA 4GK8A 3PTKA 1CBGA 2J7FA 4O18A 3NWRA 3BAXA 2WZEA 4H41A 3CAKA 4LV4A 4AWTA 4LNCA 3M0ZA 3BMVA 1PKNA 2ESCA 4MZ8A 7TIMA 2X1RA 5I78A 4L1GA 2RJHA 3EKLA 4OOUA 3WFLA 3VOIA 3KLKA 1HUVA 2P3ZA 5FEPA 2VEMA 2YB4A 4GINA 1OQFA 2VELA 2DUXA 5C5YA 4ERIA 4UTWC 1B4EA 4M6UA 4KRZA 3WDRA 3WYZA 4MWAC 3GAKA 4OBSA 3MUAA 1OYBA 3SO7A 1O4UA 3CAVA 2G3NA 1A5CA 1DJWA 4O8AA 3KLLA 5C9ZA 4C91A 3U0HA 1HVXA 4UCFA 1Y5WA 3C61A 2HTMA 3U2ZA 3NSNA 4YPJA 2YJQA 7XIMA 3QY7A 5BOOA 3RHGA 1MW2A 2GUBA 4M6QA 3S83A 3IIPA 4PB4A 1ZJIA 4IPIA 5KITA 4J3XA 4WY0F 3KUMA 3MU7A 1B3YA 4DF1A 1BYDA 3ARRA 3CL8A 3G6MA 2ACRA 2Y88A 1KM4A 3LQGA 1US2A 3M46A 5A2AA 5AVHA 4CGTA 4WJEA 4YWIA 5HINA 4L1WA 3EX1A 5EMMA 3QKZA 4RPQA 1B1YA 1EOKA 3NPUA 1GPWA 1N7KA 2WNZA 4O4WA 3UXLA 1K1DA 4FNUA 5F2MA 4IP5A 4GZIA 1MXSA 3CHVA 3AALA 4XD3A 1M53A 3G22A 3ITCA 4B3KA 4K8EA 1HNYA 2ZXAA 1G0CA 3UPWA 4BQ2A 1ZSXA 4CNUA 3VKAA 1DHPA 3ATYA 3PPGA 1JCNA 5AYBA 1GOXA 1CEOA 1R3RA 4XAFA 3WD0A 5C8BB 2CLPA 1FA2A 3WNKA 4XD4A 2G50A 3CUFA 2VR4A 1EDGA 4ADTA 3T8LA 4M6VA 5LA1A 3PZIA 1GW1A 1QWGA 2PFHA 3Q45A 3UJRA 5GJNA 3H6OA 1CB2A 2PDQA 4YIWA 1GEHA 4DO6A 3A22A 4EIVA 1EXBA 3VNDA 1WDRA 3V4BA 1IE7C 1H1NA 3T81A 7CGTA 2O9TA 2VCBA 1Q13A 2OMAA 1XCWA 3AIQA 3C56A 4KH2A 3RITA 4O54A 1TPEA 1YTDA 3IANA 4NSBA 2E6FA 5DX7A 1AL8A 3GSMA 4NX0A 4FNPA 5HUPA 3WD2A 2J77A 1SM9A 3JW7A 1XC6A 3VGGA 1J8VA 3GYCA 3EEGA 3HB9A 4GACA 4YCOA 2OFJA 2VZTA 1L0PA 3QFWA 1QNPA 1UR1A 4NKCA 3VKBA 1PDYA 4XIAA 1NDYA 1E9IA 1GHRA 4PTWA 4ZA0A 1IEXA 4X0NA 2V5LA 3IJQA 4MOZA 2J9ZA 3M16A 4ALDA 3H2FA 2QCNA 1TA3A 4C6BA 5CZSA 3U2OA 3P5ZA 1FH9A 3EOSA 1V3LA 4UMAA 4O14A 4WDUA 4HJWA 3MI2A 4FF5A 5LKYA 1GYMA 3FX4A 4AWSA 1IIGA 5DBUA 5D8WA 3A21A 1ICSA 1YDVA 1V4YA 7PTDA 3L5AA 1O5QA 1SFJA 3W72A 1IZCA 4XISA 2ISDA 5LGXA 1FOBA 1GYLA 1VBJA 1C7SA 3C52A 4AFYA 1DE6A 3CBWA 4I5XA 2NLIA 2VCAA 1W5QA 2QT3A 1JCTA 2R1KA 2PRMA 3WO8A 3DBPA 3G5EA 2WQDA 4JYFA 4MFDA 4RPPA 4ZR8A 5GQBA 1PIIA 1PB0A 1P7TA 3ARWA 1H0GA 1TVPA 4G7EB 1XLKA 3GIYA 4QE1A 1JIBA 4GY0A 3H7RA 5TIMA 3K1DA 3GNRA 1JFHA 4TX9A 4TOQA 1I60A 3ZJ6A 3GTXA 1FWRA 3GDLA 4H8UA 3G8EA 3B0XA 2BB0A 3HURA 3TTEA 2JF7A 4KFPA 4PE8A 1ZJBA 4D9PA 5CXPA 1VCVA 4H9XA 3MHUA 1M6JA 1BSLA 3SB0A 3KCOA 1KD0A 2HRWA 4XBKA 3WLMA 3WMSA 3O8AA 3NOYA 4LY4A 2JKAA 2AGTA 4C5ZA 4U28A 2QV4A 2ZXDA 3MP5A 1BHGA 3G24A 4ZXLA 3C8FA 2EHHA 2PGRA 3WMLA 4PMDA 3SCTA 4BI5A 5BXTA 1H49A 4O16A 3GD6A 4GABA 1S5WA 4K2SA 3OODA 4RNJA 4RZ4A 3DC0A 1CXIA 3C86A 4FXSA 2EBNA 3SIZA 4GA8A 3W00A 3SY8A 6A3HA 3LGEA 3AUOA 2ZZ6A 3BSHA 1CGXA 1XR2A 3DHPA 2D1ZA 2GUUA 1O1ZA 4J3TA 1WO2A 2WSYA 3ABSA 2A21A 3FDGA 4GZ7A 1XBVA 3A9BA 1JI2A 4H04A 2E1DA 3WQOA 3MTWA 3SY5A 4D6DA 3BJTA 5I3FA 5I24A 3MANA 1AJZA 1IEWA 1Q2SA 2PLMA 1CGTA 3U3HA 3PZNA 2E6DA 2BY0A 1OGBA 1FDYA 2G8ZA 1X1ZA 2VD8A 3B8VA 1UD4A 3TMLA 5I3HA 3PZVA 8XIMA 3DIPA 3VYLA 4RR4A 3PSWA 5CC6A 4LEQA 1XLCA 1FRBA 3O1NA 2ALRA 3GVWA 1HZYA 4GNKB 3W7KA 4YHEA 2BG5A 1F3WA 1FCVA 2Z1BA 1F07A 5LIKX 1E4MM 2FGLA 5D9NA 2FZNA 3PB2A 2OWWA 5BW6A 3TTSA 1AZ2A 1XINA 2WSKA 1E4IA 3PFRA 3WLQA 5HULA 2FZ8A 2E4TA 4GFSA 1Z6KA 3UP8A 3IWPA 4OFCA 3KAOA 1CGUA 2QULA 3L0NA 3A4XA 3ZYZA 4I6VA 4FA3A 1OX4A 3UWUA 3R1ZA 3LXAA 1PO9A 2I16A 3CWOX 1HG3A 4ZB5A 1YBQA 1R38A 4NIRA 1OK6A 1A5MC 3VO0A 1US3A 5E6YA 3DFPA 3WQWA 3T8QA 4PCTA 3LB0A 4LRSA 4MTVA 1PKYA 1ZU8A 1G7VA 4PTXA 3DFNA 3E0IA 3WLLA 4E6MA 2EG8A 2OELA 4JFWA 1CYGA 1EPVA 1HO4A 1UJPA 3M0YA 4PFMA 5BCAA 4UZSA 4MHBA 4K39A 1V3MA 3NGJA 4YS1A 1MSSA 1JJKA 2CZEA 4I9MA 4KT2A 4JICA 1JNDA 1K8CA 4GE8A 1WE5A 4XV0A 1Z69A 4F0SA 1TWDA 4Q8VA 5K4ZA 1JDCA 4JX4A 3C2VA 1XM3A 3W23A 3VMNA 4PTNA 3EWUA 1XD0A 1BQCA 1JVNA 3E02A 4BI6A 3IIZA 3E3HA 2J74A 3H4WA 3EMCA 5CZJA 3RMJA 1EEPA 5A8MA 3AOFA 3E12A 2VP8A 4PCFA 3UESA 3GE7A 4UOZA 3GBDA 4MY9A 2Y7FA 1QJWA 4JQ4A 3T05A 5CBBA 3VUSA 1YMYA 1P0KA 3B03A 1EB3A 5LNSA 1JD7A 3STGA 1C3FA 4B91A 4ZSUA 1I4NA 3WBWA 1AZ1A 3DHUA 5C9UA 3PAOA 3G8RA 1OINA 1OWQA 1KFWA 4XBJA 2FHCA 2EF9A 3IJLA 3TUUA 3W7DA 1JF5A 1BYBA 4JNMA 3IEBA 2WVSA 2ZZ5A 2P53A 4ICCX 3VC5A 1F74A 3R13A 3BW4A 1I2PA 2JALA 3MY9A 1DJZA 1Q5MA 5AC5A 3ZO9A 4XAPA 4IXHA 3VZZA 1QHOA 1KR0A 3LGDA 4Q7NA 1UASA 3KP1A 2F7FA 3Q94A 2FGBA 1UP2A 2CYGA 4O50A 4E8DA 1VHNA 5CC5A 2Y1HA 5HWNA 3ANUA 4DLMA 3UZXA 3FJ4A 2B7NA 5EMYA 4CVWA 5G1YA 1UZDA 3DXIA 2QS8A 3H7VA 2V2HA 4UFKA 4LRTA 2IXUA 4PMQA 2WBGA 3U2EA 3CQJA 4NZCA 4FMVA 5A6MA 2QMKA 4RK8A 4GUIA 3SN4A 1THFD 3I6TA 3O15A 4FX6M 2RFGA 1F6YA 5BZAA 1VIZA 1KLYA 2IKGA 4BJHA 4MADA 1HGWA 3GVQA 1RPXA 3PNUA 3MI3A 1NH6A 3W7IA 5FOOA 3LXCA 4FO4A 4DWSD 1ZNNA 4YYCA 3P0WA 4U3CA 2OT1A 1KQYA 3WMBA 3W28A 3NTYA 2NUXA 3ZJ8A 5A6SA 1BRLA 2WJZA 2YXOA 2F38A 3DAQA 2E5DA 1Z42A 2WC3A 4KIEA 5F2IA 3K8KA 2PA6A 2Z4GA 5AHEA 1H3GA 1FWJC 1CECA 5I3JA 3N04A 4UR8A 4E2OA 4W88A 4DQWA 3AXHA 3M1ZA 2PDIA 4C1KA 5C2XA 3MS8A 1SSGA 4LUJA 3WNNA 4V1XA 4D8ZA 5F4WA 3TFXA 2ZUVA 1KXVA 5G4EA 3NZGA 1J0YA 2FJUB 1OT1A 3ELFA 1XUZA 3VCRA 3N13A 1K9DA 1JZ2A 2QAPA 1MDRA 3VE7A 4UQCA 5FF2A 1TZ9A 2JBMA 2PDCA 3W0KA 2CITA 4CN4A 4HTYA 3LXBA 3O05A 1LRTA 5ABFB 2Y24A 3NQEA 2ZUUA 4Z2KA 1Z9AA 4CU6A 1RCQA 1R9YA 2OCZA 3MUIA 1L6FA 3UG5A 1AFSA 5CH9A 4H7ZA 1CLXA 3ES7A 4JGDA 4PRRA 4KFNA 4H9TA 1JFXA 4IGHA 3BE7A 3TXZA 3EWBX 3S6TA 4BWLA 4WGHA 2ZE3A 3MJMA 4V15A 1W3JA 1V6UA 2CHRA 1I8JA 1S46A 5AZ0A 3ZFHA 4DUWA 1MW0A 4B90A 3ID7A 1W0MA 2B7PA 4YXGA 1XF0A 2AKZA 4W5UA 2QUVA 1EHAA 4KGJA 2J8FA 3R8GA 1H7WA 4KGLA 4GIAA 1RQEA 2IKHA 5GJPA 3LPFA 5EMKA 5T91A 3RFAA 1G4TA 3H22A 3LPOA 4KRUA 5CSSA 3W1LA 3AC0A 2RUSA 1QR7A 2CESA 4K8HA 3EX4A 1XDJA 4GUJA 2Y89A 1B5TA 1XBYA 3CUJA 1W17A 3TN4A 4D1IA 1L8PA 5CPNA 1Q8AA 3BLDA 3SM0A 3GBEA 4K3ZA 3LGGA 3O16A 4F2TA 3AS0A 4YMZA 5JUVA 3A3XA 3ZLFA 3KL5A 2CERA 2Y7DA 1T41A 4QSHA 5PTDA 4IMAA 3C0LA 4HGXA 3PP7A 2XFRA 4ZFMA 3W7QA 1U1UA 4J2PA 2ZC1A 4M1RA 3NPVA 3EEZA 5I07A 2QXWA 4XAGA 1C8XA 4DJFC 4Y2WA 1UKOA 5CKSA 3WK3A 3F5KA 2NQZA 4Y8EA 4HSHA 3G2GA 2O4MA 4CKQA 1DJXA 2UZ9A 4BCEA 4EF9A 2LLEA 4L6HA 1H62A 2CLOA 2WPGA 2VGFA 1VHCA 1KM5A 2R9RA 3FY1A 3GIQA 1J6OA 3L4ZA 1UWUA 1JI1A 5IM51 3VFLA 2J66A 4IJRA 2H8XA 1H60A 3GTIA 1HP4A 2ZVIA 1QI4A 3FN9A 3CTLA 3A4AA 1QPOA 3NVDA 1TPVA 2E77A 1XD1A 3UWQA 3F03K 3OQEA 2GK1B 2C15A 1HXJA 1FWGC 3UG8A 1HVQA 2UY2A 2OG9A 1GJUA 1LWJA 2PBOA 4JFUA 4WIWA 4CD7A 1IIHA 3BANA 1F73A 3SGGA 1U5JA 3DENA 3TWAA 1TTJA 6TIMA 4DBWA 1HJVA 3S9IA 1XXXA 3VIFA 3RLUA 4XZ9A 5CZKA 3QSRA 4OV9A 1KRMA 1DWGM 3FJ6A 1W3LA 3S5ZA 3WNOA 2NQJA 4PMVA 4RW3A 2QGHA 3HTWA 3KTCA 1L6GA 2D20A 3ZWSA 4F0HA 4GX9A 2Z29A 1WQ5A 3B97A 2NUWA 3IJIA 4ZODA 3BOXA 2A4AA 3L65A 3W2NA 4EAYA 3ANVA 4HD5A 4PTVA 2VFIA 4DVOA 4WF7A 3F5JA 3UWVA 4Q8PA 5K2ZA 2OZ3A 1VRXA 1OIFA 5A8GA 1I2NA 4GGHA 3OOQA 1RZMA 3UWEA 3H26A 1YX1A 2A85A 4AIEA 2PAJA 2GVYA 4LVBA 3QOKA 5I02A 3R0UA 2BNJA 4WSHA 4GXMA 2ZXBA 3SUWA 4L9ZA 2JIWA 4RJEA 2XM2A 2YCKX 1I9CB 1TVNA 1WZLA 2OSXA 4IG2A 2POZA 3AISA 4BF5A 3S9YA 3WDQA 2CBJA 1JZ6A 5K3VA 4PN2A 4F79A 1TPDA 3ITGA 4OVXA 3N9SA 1GVOA 5A3HA 3L4UA 3QR1A 3TYCA 3QLLA 2HDJA 1YIXA 2H3BA 1CPUA 2E6YA 4DIAA 1VKFA 5I3KA 2WHMA 4C65A 4L56A 4C6NA 3VD5A 3ERPA 4IF2A 4NU7A 5ECUA 3TYEA 3B0UX 2R6OA 2XH7A 4E3VA 1W54A 2A2IA 1WKEA 1XIHA 3OLIA 4FNTA 3TOYA 2A7RA 1PX4A 1TZZA 2YW4A 1YXCA 4QE4A 3PZQA 4J4KA 4YYFA 1XCXA 1NOUA 3FKRA 4L64A 3BLLA 2X7WA 4FXRA 3PAJA 4FPSA 5AHNA 4PMXA 1PJ9A 3K30A 2PDMA 4CQBA 2OWCA 1LDCA 4LU0A 1KQZA 2XH2A 4GJ1A 1NJJA 4MY8A 1QASA 3GDKA 3GNXA 4MUZA 5HNUA 2P0IA 4XAYA 4MAZA 1UP3A 2C7FA 4ASTA 4HPGA 4DZIA 1KKRA 3TA6A 3THUA 1H50A 3MUXA 3NL6A 3EBVA 3VPLA 4HOXA 1JDFA 3ORWA 5JBDA 3UY8A 3T55A 3RJYA 1HJWA 3UA3A 1R3VA 2FZMA 4W7UA 4ADSA 1NOFA 1E5JA 4ZEPA 5I6SA 3BL3A 1EUAA 4X9YA 1AUSL 2P8CA 3BARA 4PMOA 4JFVA 1CGYA 2HPIA 2NQ5A 2PRHA 4R7WA 2ADAA 1RD5A 2P8BA 2ZA1A 4IIEA 3DKJA 1CNVA 1J10A 4R7OA 3APGA 3SSJA 2VRJA 4HMDA 2JKPA 5HR7A 3R7MA 2R82A 3UGVA 4H8HA 2J62A 1T5AA 5EL1A 1TE6A 1F76A 2V81A 3OB8A 4L6DA 1JCYA 4BK9A 2VGGA 1BWLA 3P8IA 4P5UA 2CBUA 3APYA 1V5XA 2DH2A 1XW8A 4LOCA 3CZKA 3HV9A 4GUGA 4TTUA 3S4TA 2OYKA 3QOMA 5BMXA 3ARPA 1JDEA 1OFEA 2I14A 1OIMA 2W4XA 3A47A 3WH5A 5BWFA 3F4CA 6PTDA 1B9BA 3W7GA 2DT1A 4C5YA 2ZZ7A 1NU5A 3H12A 1PDZA 4AHOA 2FJKA 2VI0A 2WMJA 1KRBC 1RD6A 2BBFA 2VFEA 4MYXA 3TU9A 1MZRA 2X1IA 1A3HA 3NQ8A 1S2VA 4JN6A 4WDWA 1JYVA 3AUJA 4QXIA 1H51A 4RZ5A 1WNOA 3NQ2A 3L7RA 3WF1A 4I7UA 4GI6A 2FZDA 3AXKA 4MGGA 5D05A 4MB5A 1QHPA 3QFEA 1GPFA 4RX0A 1SW0A 3H4XA 3THCA 3EKZA 3HG5A 1E43A 1N8FA 1ZLPA 1MI3A 1ZBVA 1MRAA 4X2PA 4GC4A 3GXTA 5KTLA 4EANA 3GXMA 3I65A 3CWHA 5LNVA 1G1YA 1T7LA 1PZ3A 4QM1A 3RYSA 4YTQA 3SY1A 3FYYA 1LM1A 3MYPA 4XWUA 4JPGA 2QCDB 4XG1A 3N15A 2D0GA 5EYWA 2BDQA 1PCKA 2ZYFA 3NDZA 1KA9F 3VIOA 2Z2AA 3KDOA 1Q6OA 5K7JA 3L4VA 3W1TA 2PTXA 3D6NA 4GI8A 4NAFB 1UD6A 3AS2A 4DJDA 3XINA 2AOSA 3OG2A 1ZENA 2VGIA 4IICA 1CTNA 4UZUA 4WXZA 3GY1A 1RVKA 4YCPA 2VUNA 1J96A 3ZOAA 3K8LA 1YDYA 1HKKA 2YZRA 1F7BA 1XLAA 4DPQA 3QQ0A 2WB5A 3XIMA 5CLWA 1ZQ5A 2CW6A 5CGMA 3O7UA 3VVGA 4KPLA 5CJNA 1ZCCA 1KCXA 2XSAA 5BNKA 4C7FA 3MSRA 4NT0A 1QNQA 2CLLA 3W1UA 1U5VA 1AMKA 1S2AA 2AGKA 5AHIA 3W7HA 4IMGA 4RNHA 3O9NA 3RRXA 3DHFA 3CL6A 2XVKA 4G8TA 2GQ3A 1V08A 3LRMA 1UR2A 2V5DA 1QW7A 1W3TA 4CQDA 2F2KA 5A6BA 4YVXA 5J5DA 3BAWA 5E1QA 2X16A 4X9SA 1B3ZA 1MW3A 4US5A 4QG8A 4AD4A 1SJCA 4DZ5A 2A5HA 3SZ8A 1TPB1 3SUUA 4CQ9A 3S9ZA 2ZX8A 4TV6A 4B92A 4F0KA 2EPHA 3BVJA 3WSUA 1XIGA 1ZPTA 4BR1A 2D2HA 3P62A 3QGKC 4KCTA 2RAGA 3QTGA 2WLYA 3VIIA 1EJXC 2XPKA 3VOCA 2ZA3A 4A3UA 3CEUA 2NQ9A 1M68A 5KZMA 1JCXA 2CLEA 4IQDA 1VF8A 3NQ7A 1Q6RA 4RE3A 1BF2A 4WR3A 4ATDA 4PUJA 4AEFA 4S3KA 3LHZA 3H2NA 3M5VA 1BWKA 2C1HA 1UD3A 3LHWA 3HGJA 3S1GA 4GISA 3A4WA 4ORMA 4UTTC 1R6WA 4WEVX 3S5OA 7ENLA 3VIMA 3WJWA 3AYSA 1YLVA 1LROA 4HMEA 4GC3A 2XZ7A 8CGTA 1XC4A 5EMUA 1XGEA 4IIGA 3N6QA 1XIJA 1LOQA 4CN1A 4LT9A 5HK4A 3SDOA 4DYEA 2XN2A 3RCMA 1W9XA 1RP9A 2WK2A 4CCDA 4JCMA 5G2IA 3PN8A 2BODX 5TNVA 3N1AA 3S8HA 3F2CA 2EG7A 1D2KA 4MUPA 3SJNA 2QDGA 4DAFA 4CLMA 1PUDA 3JZEA 2Y6ZA 2CKRA 1IGSA 3RJXA 4IT1A 2AKMA 5E9AA 3IUDA 4XVEA 1TCDA 5AZ1A 4O8RA 4LANA 3TZFA 1GOWA 1KNWA 1T96A 2PDPA 2OQYA 4AXKA 2GUYA 3NVTA 3TN3A 4IFRA 3G3MA 4Z1YA 2FB2A 1KFLA 1RPKA 1V02E 2ISWA 3GU1A 4U2YA 4DM1A 4NJGA 1GJWA 3HMJG 2G96A 2E8YA 4JYEA 1HJSA 3A12A 2VZOA 1Y5XA 3TTOA 1OCNA 4P2VA 4JIPA 4M0XA 4XBSA 3T9PA 1AJ2A 2WM0A 3BAKA 3CAWA 3SR7A 1JGMA 1EO5A 4H4IA 2GJRA 3OLEA 4IL0A 3DERA 1BG9A 2QR6A 1XQKA 3NQVA 4GY7A 4Z2LA 2F84A 1D3HA 3N4EA 4H3DA 3T2OA 1FWBC 3RCYA 1R3SA 4C6KA 4P8VA 3TDFA 5DXYA 3F2BA 3EXSA 2VFHA 3PHAA 2NUYA 2GDVA 2YDSA 5D2WA 3CYJA 5LHEA 2PDGA 1NWTA 3IARA 1DQWA 4M24A 2HZGA 5F7UA 1J2WA 5D09A 2BP1A 1TPH1 3CIXA 2DJLA 2G97A 1UKPA 2WNQA 3QQ1A 3O0KA 3FGCA 4S2BA 4O10A 4MWAD 4EXQA 1QNOA 8A3HA 1LG2A 1UIOA 3WEOA 4FX8A 3QM3A 4KCUA 3S2JA 2VX5A 3MHFA 1ML1A 2PB1A 3CJPA 3TX9A 1Y65A 1TZ7A 1BG4A 6XIMA 4ZTXA 2O92A 3LI0A 3VILA 2XSXA 4HCDA 5IBXC 2ISSA 1JCLA 1IT0A 4OGZA 2I1OA 2W61A 2D22A 2Y7EA 3KVJA 4HKPA 1DJHA 2GVEA 3VCCA 3NEVA 2ZKMX 3NL3A 1OG6A 1FHLA 3HG3A 4RLIA 2VC9A 1D7KA 4GQRA 1AG1O 1WDQA 3W1MA 5REQA 3ANYA 1ITUA 3CHEA 2GVJA 3APTA 3QPYA 1IGWA 3B8UA 4TIMA 3SFWA 3TV8A 1ADOA 1Z3NA 1FCQA 3OYXA 4PB3A 1MO0A 4FX7A 4DXVA 3G1RA 4MB4A 3VGEA 2G95A 1FH8A 2J13A 4ZQNA 1QRQA 3K2GA 2VC7A 1IXOA 3KBJA 4JTDA 3RU6A 1S2WA 2VR5A 4PCSA 4XZMX 4DPPA 1W5MA 1V03A 1DWFM 5IDIA 1KM2A 1EWEA 4AZ7A 3GVRA 4YTSA 3LCHA 2BS9A 2OOGA 3R58A 5BRPA 1OD0A 4NUWA 5KZ6A 2GQ8A 4K7VA 1TV7A 1QNRA 3SCVA 3GW0A 1LT8A 2DZVA 5HAOA 1VJSA 3ABXA 3M0LA 1GTHA 2EEXA 5C7VA 5G1TA 3VOJA 4CD8A 2A6NA 2PCEA 1R9ZA 3B4UA 4YJ5A 2R91A 5DT7A 1RAKA 5IXEA 2Y5SA 3MT1A 2ZZ2A 2W27A 3UG3A 1C93A 2YCEA 3NQCA 4ZB0A 4QHRA 3H21A 3NURA 2L5HA 1TJ2A 1MNSA 4NNAA 1LOLA 3OA5A 5LNRA 3AYTA 1H1ZA 1P0EA 1Y8BA 4QX4A 4NX5A 1XH1A 3BICA 2PTYA 2PRLA 1P6BA 4AH7A 1OVDA 5G1MA 2G3JA 4DBSA 6ENLA 4DNHA 4J40A 5HR6A 4PL1A 5MKGA 3C5QA 2ICSA 3QV8A 4RXGA 4LUYA 2ACQA 5D33A 3RMEA 2FTYA 2FKPA 3G1HA 1BKSA 3VDAA 2R8WA 4LAUA 3SRKA 2PWUA 4JCLA 2D2GA 4MNKA 1JYNA 3SRDA 1S5VA 3VI2A 1A0DA 3GXFA 4WX2A 1AQMA 3VKDA 3UNTA 4C6MA 3WUEA 1LCOA 3UU0A 1W8GA 3TVAA 2CIPA 3B9EA 3L2IA 3WKZA 1UPMB 1U30A 4QG9A 3UXAA 3VDBA 4LALA 4B5UA 4UTUA 1VRDA 4WSJA 1ZHAA 3MV11 3EA2A 5IOBA 1S5MA 1OGSA 5HMDA 4IPLA 4XKYA 3P81A 1H1YA 3BLIA 2BXZA 4EPDC 4GG9A 1KFCA 4REQA 1OG0A 1TTQA 2P1FA 3EYPA 1P48A 1DE5A 3S2LA 4BEQA 1UR9A 3Q65A 5AYIA 5FCZA 2OLHA 1T6MA 2VL4A 2JKEA 1VR6A 3JZUA 5E0CA 2VC5A 4JFSA 1J0KA 4GJIA 1E1CA 4O53A 1W9BM 4GYKA 2PZNA 5LA2A 3UJSA 1Q6EA 4DBDA 2NLYA 4JTEA 1EC8A 2ISFA 4HMNA 4FOUA 4ROQA 4H9MA 3C4UA 3MSDA 4E2VA 4UQAA 4D6HA 2GFTA 1B4KA 1OEPA 2DP3A 4Z0JA 5JIWA 4F4RA 4F9DA 2XVNA 2XFYA 1LRQA 4JD4A 3G3DA 1XLBA 4HOWA 3PWIA 2J8GA 4LBRA 1ITQA 1AA1B 2XM1A 1V51A 4JIQA 1FHUA 2QV5A 1A5NC 2KAUC 3H55A 4LUSA 2QEZA 1A5OC 3DZ1A 1I0BA 1QOXA 5DRIA 3GW3A 2ANUA 3U2CA 2YDAA 5CG7A 2PE4A 5M1TA 4UUIA 1XICA 1ZL1A 1WDWA 3PPHA 3V18A 2A3HA 3S2NA 3TR9A 1H41A 3VNKA 4A35A 3MZ2A 4HNOA 1PZ0A 6REQB 1K77A 4PSPA 3CEPA 2NXGA 3HPXA 3VK5A 5AC8A 2HK0A 1R0MA 1TRIA 3A5VA 2WVTA 3KX6A 5HNRA 4US6A 4EF8A 1N2VA 3HGSA 4X61A 3BWWA 2BSLA 3CH0A 4GBDA 1XRFA 4NJIA 2DQXA 2Y7GA 1LBFA 1A3XA 3PJXA 3GFYA 4JX5A 2CZFA 3T40A 2TSYA 4LB3A 2FTWA 4L80A 4B4HA 1FWEC 1BAGA 2ZUWA 1H7OA 3AU6A 5E0KA 3IVSA 3QKEA 2Y8VA 2WSQA 4J3UA 1W3HA 1GEQA 2HCVA 1RHCA 1F05A 5BRBA 2J7CA 5CG0A 4NYYA 2QDDA 4M82A 1TMHA 5XINA 4HT3A 4XSMA 2HJPA 1P0NA 1T0OA 4IGMA 2BMBA 4A05A 1O94A 1J0HA 5BRQA 1FCBA 3I3DA 1F6KA 2DT2A 3EWDA 1EEXA 5I3DA 2B31A 3AMKA 5ABTA 4JOMA 3BGAA 2VT0A 2XVGA 3CPUA 1S5NA 4FIRA 1Z41A 3CHFA 2ZDRA 3AO0A 3QTPA 1BSIA 2ZOXA 4F40A 4QLKA 4FOJA 1VFMA 3S5YA 4GUFA 2CHNA 3C0JA 3HFTA 4QLJA 5T26A 1HT6A 1QPRA 2ABAA 4YWSA 3N17A 5EKYA 3MVIA 1X8CA 3CHCA 1Q8JA 3BV7A 3KBWA 5CPMA 1VCFA 3J7HA 1M5WA 3M47A 4F48A 4A8NA 3QRHA 3IS4A 1M41A 4WKFA 4AG0A 1VH7A 3KVMA 4QDMA 3BLPX 4DWDA 4TR9A 1S2TA 2CZ5A 1GOQA 2BOFX 3H2CA 3NO3A 1WAWA 4EAMA 1WUEA 2VDHA 2NW0A 3G1SA 4RV3A 1HQTA 1E6QM 3LNMA 4H01A 3GK0A 3FYOA 2GSJA 3GG0A 1ZCOA 3N18A 1K8YA 4DAIA 4UOJA 1QW8A 1XLMA 2C3ZA 1SR0A 4ENLA 1RV8A 3FEQA 4JQAA 1FXQA 1T8XA 3AICA 2WV8A 2QKFA 5JQ9A 1NP2A 4XZLX 4MVAA 3HF3A 2J75A 1IWBA 3MO7A 3VUPA 1OF6A 3CUZA 4EVZA 5ECVA 1Q6CA 3IJDA 3D0CA 1E0TA 5A8PA 1S3HA 1GOKA 3POHA 1IXQA 3OZYA 2CZDA 3PTQA 2ZRZA 5DCEA 2OGJA 2PMQA 3IPWA 1WKYA 1PXGA 3CMJA 1ZY9A 3AMGA 2FPYA 3SCQA 3U7BA 2Z1XA 3UZ5A 3N4AA 1OJXA 2W6RA 4XSLA 1TIWA 2Z28A 3VX1A 1BWVA 5RUBA 1SZRA 3U9IA 4GH3A 5AY7A 3M44A 1V6YA 1DBTA 1E71M 1GVYA 1Q7MA 5H8PA 2PP3A 3IACA 3H8AA 4GO8A 2QUMA 4HPXA 3NYZA 3I6RA 1XYBA 3FS2A 3KBMA 2EKCA 3EX3A 1TV2A 4UNKA 3GTHA 4R27A 4Q8TA 2ACUA 1TMLA 3REQB 1F9CA 3H70A 1KV5A 3WD3A 2XJ7A 3QH2A 5HDRA 1B90A 2WW5A 3UR7A 2FZ9A 1EP1A 3TC6A 1E6ZA 1I0DA 3OLDA 1HJXA 4FK9A 4YLWA 5KETA 5A8OA 2QJJA 2WCSA 4A3YA 1QDSA 1KXQA 2PD9A 4LGXA 3WH6A 1NDZA 4I7WA 1NELA 2G3IA 3PSVA 4FSAA 1MEIA 4ZO9A 3ZIZA 2YA0A 3KOXA 2ZX9A 5I09A 4DJEA 4O1FA 3VOGA 3C2EA 3AI0A 2Y8UA 1AW5A 1R3TA 1VLIA 3ZWTA 3ZXWA 4AWUA 1UC5A 3UCCA 4XD6A 3ABQA 1EJ7L 1R3YA 3HFYA 1KBLA 3SADA 4R33A 1EP2A 1ISZA 4QJ3B 2J88A 3G0SA 3MBFA 3AMDA 1LL7A 1XIEA 4UMBA 2VKZG 1ZRQA 1IXNA 4HNLA 1EDQA 3FIGA 4PFHA 1K9TA 3GZAA 3VGHA 4EPBC 4UTHA 3W75A 4MIMA 2RGMA 2IS7A 5FAJA 2WANA 4BQ5A 3K5XA 4HNCA 3SJ3A 3IK4A 1OCQA 3F4DA 3H24A 1SZNA 3ATZA 4IIFA 4UWMA 3VA8A 3F1QA 3WH9A 3EA3A 3ZVIA 4G56A 2ZIDA 4PEKA 2XVPA 3L23A 4ACZB 3UY7A 4K8GA 2YDQA 3NSXA 3W7CA 3CXOA 3H2EA 1QHZA 4OUEA 4IQLA 4IIDA 4FLSA 3RLVA 4F0LA 4TVDA 4C6QA 1YE6A 4TTGA 1PBGA 1VPQA 4DUOA 1HTIA 3EDEA 4HHPA 3SEPA 3SFKA 2V0TA 1OZQA 3EWWA 1OCJA 3S6OA 3W82A 4UFMA 1PVNA 4ORIA 4LVDA 4IL2A 4KESA 1G4SA 1T40A 1SO6A 4CEUC 3UJ2A 2DSKA 4HZ8A 4R85A 1F6PA 3L4XA 2VDGA 2YFNA 4AX7A 5ABGA 2POTA 4NNBA 5D9MA 3GC2A 4HSOA 3QGAC 4OJYA 1QK0A 1PIGA 5B7ZA 1O12A 2DSWA 1C9WA 4UTFA 5FJRA 3BUVA 1QW9A 1J4EA 5FD0A 3UXIA 3JVAA 3RAOA 2J78A 4LYPA 2WC4A 2PSNA 2WMIB 2OU4A 4J28A 3P5YA 3OLGA 1TUFA 4PUEA 2IKJA 1J0ZA 1F4HA 3KTXA 1XSJA 3KW3A 4B5VA 4UNLA 4EE9A 1HJUA 3TZNA 1XYLA 4ZQCA 2RDTA 2TMDA 1LUCB 1GVSA 5CEWA 3PUDA 3UG4A 4HHHA 4A3RA 4GI9A 1CW2A 3VZXA 2YL8A 2VEPA 3K13A 1BFNA 5DMLA 2IPJA 3H2OA 1NY1A 3VTRA 1YKWA 2BWGA 2Y4SA 3HJZA 1SJDA 6XIAA 1Q4NX 2AQOA 2OJPA 3IGHX 4FIQA 3EWCA 3KBNA 3V5FA 3N2BA 1H61A 4GVIA 4CD4A 1JULA 1E6SM 4JXCA 1CI1A 3ALFA 2WSRA 1S2UA 3GS6A 1OFAA 2ZX7A 3PJUA 2ZBTA 1VFOA 1X1NA 3GNDA 4B2DD 3FW6A 1YDNA 2WBKA 3H54A 3GZ3A 1UH4A 3KS6A 1JG9A 3AROA 1XFCA 1EZWA 3L67A 1O1HA 4HK5A 3NL2A 3O07A 4FNRA 4H2CA 1J6PA 1Z44A 1EGZA 2J6XA 2BXYA 1EPXA 3GX9A 3URNA 2AL2B 3KWSA 4J9JA 8TIMA 3GLCA 5C2CA 3ZVHA 3EB2A 5FL0A 3GR4A 1GKQA 1P0DA 3FXGA 2WZHA 1XDLA 9RUBA 4DJFD 4B16A 2NXHA 2X2YA 1UOZA 1GORA 1I75A 5A95A 1WOAA 4RDZA 2OGYA 1UZ4A 1VP5A 3C2OA 3T08A 2VX6A 1EC9A 2E5CA 3I7SA 3K46A 2YA2A 4QGCA 1FDJA 3MUCA 3OGRA 4HP5A 3LSCA 3EOUA 2X0YA 1WKFA 2PTWA 1TV3A 3TE9A 4AB4A 3MKKA 4NZFA 3M7SA 4G9PA 4J3WA 1MEHA 2C79A 3PC0A 5E6ZA 4ZTYA 3UZWA 3QYQA 4GWEA 2E28A 3T42A 5FF4A 3BLKA 4F66A 3STEA 4PMRA 1OF8A 3M9YA 2HS6A 2ZDSA 4K38A 1S5TA 2WAGA 3THDA 4OWGA 2NQLA 4XUYA 3T0DA 1CENA 1NDVA 1FHDA 1C90A 3LHYA 4WLCA 1VPYA 4E4FA 1UD8A 3UD6A 3AS3A 4UFLA 5MF5A 4JQ1A 3LBCA 3QHOA 4RDWA 2BVDA 4TO8A 1YADA 2A3LA 4GQGA 2I5IA 1W3KA 2PZ0A 4DWSB 2I9EA 3S47A 1JAEA 1FWDC 1GVIA 4PULA 3LRLA 4MWAE 5IHRA 1R2SA 1AH0A 3M7WA 4U31A 1AW2A 1DIDA 3TLQA 4LAOA 3INPA 4HNNA 4O1AA 3B0PA 1VD6A 2IQTA 4LBSA 4F2BA 3PJWA 1JXJA 5AC7A 7TAAA 3AXMA 3U5YA 3SCWA 3QQWA 1GCYA 1GZ1A 2Q6ZA 1QNSA