4WJEA

Crystal structure of trichomonas vaginalis triosephosphate isomerase v45a at 1.3 angstroms
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
250
Chain Sequence
RTFFVGGNWKANPKTVQEAEKLVEMLNGAKVEGNVEVVVAAPFAFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEAGFINIVNSNVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Crystal structure of Trichomonas vaginalis triosephosphate isomerase V45A at 1.3 Angstroms
rcsb
source organism Trichomonas vaginalis
total genus 86
structure length 250
sequence length 250
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wjeA00
3S5ZA 2Y62A 4LUJA 2A5HA 4HNVA 3W74A 1O5KA 3LCLA 3G24A 4J9JA 3S6DA 5EA9A 3TR2A 3BARA 1R2SA 4UFJA 3QF0A 1XBVA 3NQGA 1U83A 1W5MA 1RQHA 1TQXA 2A7NA 3H53A 3VE9A 2JGQA 3LCIA 1W1ZA 4L4MA 5E1QA 2QAFA 1ZJIA 1Z44A 3W7QA 4CCCA 2P10A 1K7XA 4O1BA 3LHYA 2W6RA 3MI3A 2RDWA 4LUIA 5AHNA 2CZFA 1QOPA 2YYUA 4DBEA 3L65A 3GXNA 3ATYA 1E51A 3SJ3A 1GOXA 3W1RA 3ANYA 3GDTA 2V2HA 1JVNA 1THFD 4GBUA 3STEA 3E0IA 3LBCA 3HPXA 5K2ZA 3A9IA 1KBIA 1QAPA 4IXXA 3VFLA 3C56A 1VHCA 3EX2A 3I65A 2CLOA 3LERA 3NQ2A 4OV9A 4O1AA 1IGSA 3FFSA 3P81A 4MLJA 2OT0A 4N4QA 3IRDA 1FCBA 4LU0A 2EHHA 3NZRA 3RFAA 4XTIA 1SO4A 2ZZ1A 2CZDA 3QW3A 3MHGA 2PRLA 3NA8A 2YW3A 4MVAA 2ZRUA 3TC6A 4O13A 1YLVA 1D3GA 4QJ1A 4OBTA 5FF3A 1P0KA 2C13A 4UTUA 3R2GA 1B3OA 4QIUA 1YDNA 2FPTA 5EPDA 1W3NA 3TX9A 5DLCA 4DF0A 4I7UA 4Y96A 1XKYA 2CFFA 3G8RA 3B0PA 3R89A 2H3BA 1VR6A 1OK4A 3EXSA 4MLRA 1VYRA 2FDSA 5AB3A 3B04A 2ZRVA 3B03A 3S5OA 1I8JA 4O16A 1I2PA 4M6PA 2DU2A 4HNNA 2NXIA 3DFOA 4ORMA 1ZHAA 3S5NA 3W2LA 5C54A 1UUMA 1VC4A 4E38A 2VEPA 5G4EA 1ALDA 1KLZA 2CLEA 3FYPA 2DORA 4N2YA 5LNWA 4QSHA 2VFHA 3A5FA 1LORA 3TC7A 3R5EA 4Q4KA 3E49A 4KFOA 3TSDA 1LOQA 1GVQA 4NZJA 4R7JA 3NQAA 1IXNA 4XKYA 1F74A 2CLIA 1V7YA 1TPWA 5CGQA 3MBFA 3PY2A 3VKJA 5BOOA 5L6UA 4GUJA 2V2DA 3WK2A 5DN1A 3LCGA 5AN7A 1L2UA 3TA6A 1GVFA 2QCDB 2CW6A 2WQPA 1PHWA 4JTEA 1OFRA 1KV8A 3KFTA 5EL1A 1KTBA 3T44A 3IVTA 5CZJA 2O7QA 2G5WA 4DBDA 4UIOA 2E6YA 1KM2A 1WXJA 4S2CA 4GWEA 2P1FA 1PV8A 1BTMA 4Z0SA 3W75A 1PVNA 1GTHA 3M47A 3BK0A 1VQTA 2FIQA 5G1YA 4H3DA 1Q6OA 2JKEA 1L6WA 5C6MA 1ML1A 3C4UA 4MYXA 2YSWA 2H90A 1TTQA 1TQJA 1MSSA 3NG3A 3W23A 3UZ5A 3W1UA 4WD0A 4EOUA 3LRLA 3UPBA 1G6CA 2H8XA 1W3TA 3QQ1A 3CEPA 3CT7A 4MY9A 3TUUA 4K8EA 3MWAA 4UR7A 2DJXA 3O8AA 2A2IA 3W72A 1R46A 4IMDA 5HR6A 2J27A 2VFGA 3NL6A 3OVRA 3UY8A 3VNDA 3INPA 4AWUA 4KWWA 1RQBA 1KM4A 2E5BA 4LWWA 4N9CA 5C5YA 2QUTA 3MO7A 1XCFA 2NX9A 2C0AA 2NLIA 4JNMA 2YZRA 1XI3A 3DU0A 4WZHA 4AHPA 1VYPX 3UPWA 5F2LA 4UFKA 1SSDA 1NEYA 5LHEA 1TO3A 3BW4A 2YCEA 5D2XA 2WJZA 3H54A 3YPIA 4XTDA 3NYZA 4IX0A 5EMUA 3NQ8A 3GDMA 1WOBA 3IIZA 3W2KA 4EIVA 4YMZA 3A5VA 4UTJA 1SO6A 4XQ6A 1WV2A 3QM3A 2ZTKA 1KM0A 5KZEA 3I7RA 4C1LA 2GVLA 4CQ8A 2OX1A 3KRSA 3R13A 4O18A 1AK5A 3GVGA 3G3DA 3W7EA 3IIOA 4JTTA 4NNCA 3USBA 4ZQMA 1R2RA 3IGUA 3IVSA 1B4EA 2X1RA 2GVJA 1QR7A 5D02A 2I1OA 3PG8A 5E0KA 1T0OA 2NXGA 2Z6JA 3PBUA 3LXCA 5BRBA 3HO8A 3W2UA 4OV4A 2Y61A 5FI8A 3EX1A 3W1TA 1TPUA 3H55A 1I2QA 1M6JA 2YXGA 1C29A 4C1KA 1F6KA 4Z1CA 2Y7DA 5LGXA 3G1FA 3MYPA 1DJQA 3G1SA 5CSRA 4A21A 3ZFHA 1KA9F 5BMXA 5A5WA 5HNRA 2Y89A 4JTJA 4MY8A 2NX1A 4DPPA 2JBMA 5DBUA 3UY7A 3EX4A 2BZNA 3JR2A 1SZGA 3O63A 1SFJA 4LT9A 3NVTA 2RFGA 3NQCA 2E1DA 1WX0A 1IIGA 3GR7A 5D2WA 2VOMA 2Y88A 1QNVA 3LRKA 2YPIA 1AL7A 4DQWA 3EWYA 3A21A 1T8XA 2GJNA 4IUOA 1K8XA 4AVFA 4N4PA 5AC7A 3NQ6A 5D04C 3S1VA 3FIGA 4NJJA 3DI1A 3M5YA 3P8JA 2IQTA 3TXVA 1MEHA 2QDHA 3TMQA 1H50A 3WJXA 3M5VA 4NJGA 4O53A 4BR1A 2J9ZA 4AWSA 1H7PA 1A5AA 1QFEA 1QO2A 3L5LA 4JTHA 3OHIA 1TPB1 3NOEA 3B05A 4ALDA 3DFSA 4O57A 1W3IA 2NXHA 1KV5A 4FB7A 1F5ZA 4IMFA 3O16A 4ZMGA 1K3UA 1L9WA 4N02A 3C52A 4GXMA 3PB0A 1H61A 3UNDA 3BG5A 3CC1A 4TMCA 1NVMA 2X30A 4TIMA 2O7SA 3TSMA 1VH7A 1HL2A 5LSMA 3EWXA 5DXXA 4ORIA 5AHEA 2YR1A 3E96A 4UNLA 3M5XA 2Y7EA 4RX0A 4GRSA 1G4TA 3QYQA 1I45A 5H2ZA 1S5TA 1OX6A 2NWSA 3C2RA 3BW2A 2WOQA 4EWND 1ZFJA 3W7IA 3S1WA 3GZ3A 5DY2A 5AYZA 4ICNA 4UFMA 3KOFA 3BLFA 3CWOX 4Y8FA 1XL9A 3HG3A 4LC6A 4FF7A 3W1LA 1KFBA 3W2MA 4LVGA 4UFHA 4LW7A 3LRMA 2JKAA 2VFDA 1TTPA 2YW4A 4UNKA 3DFQA 4Q33A 4YWIA 4JX4A 3UXDA 3TCEA 4UTKA 3DFNA 3RU6A 2A21A 3W84A 4BF9A 3NPUA 5HMSA 1MEIA 3QMSA 4ONVA 4UUIA 1AW1A 3C2FA 3KHJA 2YGYA 4RZ4A 1WDWA 1A50A 3C8FA 3RNDA 3W9ZA 2VFFA 2XN0A 4HT3A 1JRCA 4OGZA 1VLIA 3PAJA 5D2VA 4ADTA 1OF8A 2WNQA 4MY1A 3BVJA 3SSJA 1A53A 2H3DA 5KZDA 3G1XA 3WJZA 1LZOA 2ZDRA 3LTYA 4DO6A 5D37A 1QPNA 4JXCA 3RK8A 3C0JA 1K03A 3W7RA 4JTLA 3KVJA 1W5QA 1K7EA 2C19A 4PEKA 1L6YA 4RK8A 4MFEA 5MHBA 5HQEA 1O95A 4MOZA 2H6RA 4JICA 5D03A 1TRIA 1IXQA 1KFLA 5D05A 6TIMA 3W07A 2E5CA 2VELA 2QCHA 3N73A 1X1ZA 1EUAA 1DOSA 2X1UA 2DZSA 4XKYB 5CZTA 1AW2A 1ZAIA 4GUHA 2J9XA 1Q3NA 1LOLA 3BLIA 3ZWTA 3FLUA 4BWLA 4GUFA 1EPXA 3W3OA 2DZVA 2ZA2A 3UWVA 2NWRA 2HTMA 4LVBA 1VYSX 4RZ5A 3O05A 3SGZA 2DZTA 2C16A 1XDMA 4CQ9A 2WV8A 1G7VA 3CHVA 3M0ZA 3QH2A 1WAUA 2WPBA 1QPOA 2F7FA 1FCVA 1H1ZA 4EF8A 2JKPA 2QJHA 4MZ1A 3EWBX 2QCMA 3TH6A 5D2TA 4BI6A 1KLYA 3GX9A 4DELA 4K6AA 3L5AA 1UJPA 2QCEA 4AWTA 3M41A 3QMRA 5K9XA 3WJSA 2R14A 3T7VA 2FB3A 4IMEA 3NQDA 3EKZA 3P82A 4FIRA 4X9SA 1R2TA 5AYYA 3OVPA 3UYCA 4GNJA 1LP6A 3S5YA 3W7PA 1OFOA 1P0NA 3EXRA 1QDSA 3KAOA 4UC5A 2QUVA 3HGSA 4ZQRA 2V81A 1D9EA 4GC4A 3R12A 2PE4A 2NV2A 3SY5A 1Q6QA 2A4AA 5HULA 4A22A 3B06A 2ABBA 2V0TA 4CQAA 3W1MA 3PS7A 3M43A 3NPWA 2Q3OA 2VFIA 1VJIA 4PTNA 5J5RA 3S42A 4FX8A 3NO5A 1AW5A 2PC4A 3GK0A 4LVAA 5KMYA 4YCPA 5HINA 3BPWA 4O4WA 3V1PA 2HS6A 4DF1A 3W1XA 3B4UA 3LHWA 1OX4A 4AHOA 1F7BA 1OVDA 1X1OA 4Z08A 4PODA 5KITA 3P60A 5TQLA 4CNPA 3KRZA 5I3HA 1SO5A 4UMAA 4AAJA 1TSIA 5AFDA 1FWTA 4JDBA 4FNQA 3G0SA 1TRDA 2ZA1A 2D73A 3LOTA 3LGEA 2QCFA 3TJXA 2PURA 5LHFA 1S3HA 2ZZ6A 3Q58A 3PB2A 1JCNA 1C9DA 3TSBA 2V82A 1W56A 1RVGA 4HIBA 4QNEA 1UBSA 3P74A 1FDYA 3O6YX 3NM1A 1Z48A 3NNTA 4NJIA 4A2SA 3MBDA 3LXBA 1I2OA 3ABSA 1IIHA 4AF0A 3W83A 5FF4A 4LY8A 3W1AA 4JTIA 2F84A 4M6QA 1W54A 4X2RA 1OFBA 1A5SA 3N2XA 4FNPA 5I3GA 1U5JA 5H91A 1J4EA 3W7GA 3F4WA 2VEMA 3DBPA 5CPOA 2JGYA 4JN6A 1TB3A 4GFSA 3DGRA 3QSRA 4LVFA 4ZVJA 5G2WA 3LCFA 5K3VA 4UTTA 1A5BA 3E02A 1F2JA 2GQ8A 3ZS4A 1F76A 1FCQA 3LBMA 1K8ZA 8TIMA 5I3FA 5AHLA 3W85A 1OYCA 4OU1A 1GTEA 1PIIA 5DXYA 4IGHA 4RLIA 3U6WA 2C14A 3RF9A 3BO9A 3L2IA 3PF3A 3N9SA 1EB3A 2RDTA 1DVJA 1CI1A 3M7WA 4XUGA 2ZRWA 4NX5A 1B9BA 4M7SA 4WX2A 4E2DA 4CNNA 3CEUA 4GJ1A 3BG3A 1JQXA 4G1KA 4FX7A 2A85A 2V5LA 4IPIA 2VXNA 5BMWA 4L4LA 5U7SA 4HHPA 4O15A 2OJPA 3LM7A 1TPEA 3FYOA 3GKFA 1SR9A 5KSWA 1IF2A 3HGJA 1C8VA 4FEZA 3GDLA 4QNWA 4YCOA 2Y6ZA 4JY8A 4K37A 5D30A 4UCGA 4NJKA 1EX5A 3PBWA 2W0UA 1H60A 1FWWA 1TTIA 4KFNA 1EP3A 1OK6A 4RJEA 1EA0A 1JULA 2B7NA 2YDAA 5LNSA 3LXAA 1I2NA 1RQEA 3FJ6A 1OJXA 2TMDA 2DP3A 3JRKA 1FDZA 2AAMA 3B8DA 2BWGA 1WQ5A 3A24A 5KZMA 5FEPA 3HBLA 3PULA 4NUWA 1F05A 3S1XA 1CX9A 2ISWA 3E12A 4IX2A 3TFCA 1QWGA 4FNRA 2A1YA 1HO1A 3P5ZA 4UTIA 1YXYA 1H51A 1KW1A 3CIWA 5T26A 2WNZA 3ELFA 2VEIA 1L6SA 1O60A 2Z1BA 3G1HA 3NPXA 1QMLA 4TR9A 2ISVA 1YTKA 4O11A 3TV8A 5F4XA 3B0UX 4FXRA 1Z42A 4NX0A 4TU1A 3LX9A 5FF0A 3A23A 1B4KA 3P84A 1IXPA 1XBYA 2ZZ2A 4K7YA 1XDLA 1YXDA 1XC4A 4WQ6A 4NNBA 3ABRA 2CLLA 5AC8A 3ATZA 1ZALA 4ZQCA 1OFPA 2ZZ5A 4NXSA 1Q6LA 3PUOA 1GG0A 3BG9A 2A7RA 4LOCA 2BX7A 4M6VA 3HIJA 2OT1A 4LV4A 1BWLA 3L0NA 5TIMA 3G0XA 1OX5A 4NVTA 5FEXA 2EPHA 3P62A 4WXYA 3F4NA 4RR4A 2RH9A 2E77A 2NX3A 3PG9A 5IBXC 4HSOA 5I3IA 4YL2A 4PCFA 3L67A 3BV4A 3Q94A 1SUXA 2ZRZA 2Y7FA 3NQEA 3LHZA 2NZLA 3UXAA 3O6CA 3I68A 1X8FA 3N3MA 1ADOA 3W22A 3MUXA 2I14A 1SSGA 1SW3A 1FWRA 3LCHA 3M16A 3N9RA 4CLMA 1LBFA 4NU7A 3MP3A 2QJGA 3NL5A 3N14A 2ZTJA 3WJYA 1VZWA 3F03K 3M9YA 4O12A 1RPXA 3PBVA 3O1NA 1I2RA 3MW7A 4QQ3A 1TV8A 1FDJA 2HS8A 4AXKA 2Z0IA 2E5DA 1H7XA 3TFXA 3PVFA 5D32A 2E6DA 3GYEA 3FS2A 1KM1A 5L9FA 2XN2A 4KWVA 3NQMA 2FLIA 2DZWA 3P7YA 1WYIA 3EWWA 4N9DA 2QJIA 1SFLA 3ABOA 3NQVA 5J5DA 3BGJA 5EYWA 3O06A 3HPZA 3L0GA 5CZ0A 1PCKA 1OFEA 1N55A 3LCXA 3W7NA 4WJEA 1HO4A 1OHLA 3G8EA 3TAKA 2RDUA 2ALDA 3SGUA 1H7NA 1QOQA 2ZYFA 4OQVA 2FB2A 1YPIA 6ALDA 4K39A 5AHFA 1ICSA 3LTPA 4IOTA 2XN1A 3UWYA 2G95A 1N7KA 4I7VA 2DZXA 2QCGA 3NGJA 2NUXA 4OT7A 2V8ZA 1H7OA 2QR6A 2VEKA 3W73A 1GYLA 4JIQA 5CG7A 3G1DA 2GUUA 4IXHA 2TSYA 4RCXA 5GVJA 1MEWA 4IMCA 1OX4B 4JTUA 5CSSA 3LTSA 3PSVA 1SU5A 4HPXA 5F2IA 3CLMA 3FKRA 4R53A 2XFWA 4LTSA 4UTWA 2R91A 3HG5A 3W76A 3W1QA 4BI5A 1JRBA 3W87A 4RV8A 2NUYA 3RMJA 2QUUA 3N19B 3M44A 1T96A 1W8SA 4YXGA 1PHQA 2Q3RA 1UUOA 4WY0A 1UCWA 2GQ9A 2ZQ0A 3NL3A 2Z6IA 4NT0A 2NV1A 4UTMA 1GVOA 5FF7A 4UFLA 1EUNA 5K7JA 2PRHA 4O19A 3TW6A 3HG4A 4AF0B 3GXTA 1TREA 1TMHA 3M1ZA 1EIXA 2OMAA 4O17A 3WJWA 1A5CA 5HJLA 1JUEA 4MYAA 1JCYA 2DZPA 2WKJA 5G1TA 5D33A 3PC0A 1TPVA 2EKCA 4R34A 1LBLA 2P0OA 2X1TA 3GR8A 2Y70A 3CIXA 3W7MA 4U28A 3NL2A 3C3NA 1LLZA 2C6QA 4UMCA 1LM1A 2ZBTA 1W5NA 1SZFA 3O15A 4WUIA 1XM3A 3DKLA 3SR7A 4XBKA 3TROA 2RKXA 4CCDA 5SWUA 4ADSA 3L21A 3STGA 1ZENA 4HSNA 3THAA 4QM1A 3N34A 1TPH1 4IQLA 4U4MA 1FWSA 1DQWA 1K8YA 1TPDA 4LV9A 1ZCOA 3GNDA 1OYBA 5EY5A 1S5VA 3EEGA 4M7TA 3LV5A 4O1DA 5G5IA 1YADA 3RLVA 2BLEA 3W70A 3LI1A 5G4WA 3WK1A 2ZZ4A 3CQ0A 4AEOA 1G4SA 2AQWA 4LS2A 1SW0A 5CZSA 3KVLA 5DCEA 5LGZA 4XWUA 1GQNA 3TU9A 3QPZA 1PCWA 4K38A 3P61A 1SO3A 2CU0A 2A6NA 4HKPA 1F73A 5F4SA 1FY6A 4H6KA 1EEPA 1KTCA 2TRSA 1DHPA 1Z41A 1NAL1 1N8FA 1ZNNA 2R8WA 2GPTA 3G1AA 3PWAA 3WK0A 4Y9AA 4FNTA 4AMAA 2PCQA 3S1UA 3WK3A 3LLFA 1WBJA 3TAOA 3MHFA 2OCZA 2WSYA 2X2GA 5TBOA 4B5NA 1J2WA 1MO0A 3LHTA 4K7VA 4JTFA 2FQIA 3W7LA 1AG1O 4IWWA 3W7CA 1KTNA 3GDRA 4MZYA 1H62A 5EBUA 2QDGA 4LNYA 3W7JA 3MP4A 4NQ1A 4WXZA 1UASA 3LV6A 2FTPA 1MZHA 1JQVA 2YX0A 1F6PA 2CLFA 3PBYA 1ME7A 1ME9A 2GQAA 3GNNA 2YFNA 2A0NA 1KFEA 4HPJA 4KKXA 4E2BA 3HPSA 1LROA 2YFOA 3GLCA 5K4XA 5D38A 1G4PA 4JTGA 1VPXA 4CNOA 1UB3A 3QQ0A 4KFPA 3MYOA 3HGOA 3W7HA 4CCEA 2FPYA 1JUBA 1G7UA 1QPRA 4IMGA 1TPC1 4WOZA 4HNTA 3QC3A 1WA3A 5K9CA 2GVGA 3UWWA 3NR0A 2ZRXA 2V2CA 1M7OA 3FKKA 3SI9A 3UZJA 3HMJG 3W1PA 3IIVA 3BLEA 3CPRA 3FEMA 1NF0A 3KVKA 1VGAA 3OVQA 4JD4A 3SECA 4DF2A 4O28A 4GUIA 1BWKA 4ZZ9A 1I4NA 4JTKA 4MKNA 1ZAHA 3RLUA 4FXSA 4N9EA 4O0KA 1M7PA 4JX5A 4O4VA 4PA8A 1XBXA 1FBAA 1GJPA 3GAYA 2G96A 4PL2A 3MI2A 1HTIA 2C15A 4JDYA 3P80A 5LNUA 2V5BA 1JJKA 3L0KA 3P8IA 2BTMA 2EAWA 1DORA 3L9CA 3ZWSA 2TPSA 3W86A 3MHUA 4D2JA 5F1VA 2B7QA 3W6YA 1S5WA 1ICQA 1KFCA 3QRHA 2VENA 4I9AA 3OEXA 1RD5A 4FIQA 1T99A 2J6XA 4LRSA 4YLWA 4ML9A 2Y85A 1PE1A 3PR2A 1BKSA 3HG2A 2WSRA 2ZFAA 3W7KA 1KFJA 4JEQA 3V75A 2A6LA 1VCVA 4GUGA 2ZCGA 2X16A 1Q45A 1XUUA 2CZ5A 5DBTA 5F1UA 3EX3A 2I9EA 4K8HA 1FUYA 4JY9A 3TMLA 4XZ9A 3NXFA 2G97A 3MJYA 3PUEA 1MXSA 3TJLA 1O4UA 5HWMA 3C2EA 3GAKA 4LS0A 4NNAA 5CPNA 1OABA 1NSJA 4ZQNA 1GVRA 2FJKA 5AHMA 3TIMA 5KTLA 4UTHA 1P4CA 1P1XA 2E6AA 3GDKA 1YTDA 4RXFA 4DO4A 1ME8A 4AH7A 4MFDA 3BGGA 3IGSA 3UQNA 1XBZA 4FNSA 3W2NA 4PL1A 1NF7A 3IEBA 2EGZA 4W9TA 1RR2A 5HR7A 1VS1A 2EF9A 3LLDA 1XFBA 3W71A 3LHUA 4M19A 4EVZA 3EKLA 1LDCA 5HWJA 1ZAJA 4PC8A 3FJLA 2LLEA 3QW4B 3HGRA 3NQ7A 1RV8A 3FA5A 1OFDA 4UTWC 1O94A 1V5XA 2UV8G 3AO0A 4DO5A 1DBTA 2H8ZA 4TO8A 4X22A 2ISSA 4LS1A 3MMTA 4OE7A 5IM51 3PSWA 4N6FA 1TCDA 1YTEA 3NPVA 4JIPA 2QCNA 3G1YA 4HNUA 4UXDA 1HUVA 4O1CA 5KINA 2FPVA 4O54A 4QAIA 4FHAA 4WY0B 1R47A 3P5YA 3AJXA 1R30A 3HQ1A 3OA3A 3U2OA 4FX6M 3NEVA 1AL8A 4PFMA 1DKWA 3CM4A 1SZNA 1DJNA 1AMKA 2QKFA 2TYSA 1Q6RA 4DXVA 1LYXA 5C2XA 3IIPA 1DL3A 3O07A 1WBHA 2B7PA 3O6DA 3CB8A 4MJMA 4OHQA 2QCLA 2CLMA 4Z1AA 3L66A 1LBMA 3L68A 3NM3A 3F1QA 3SZ8A 2J24A 2ATSA 1H7WA 3NDOA 4IJBA 5HUOA 5G2IA 3PUDA 3TK7A 3KRUA 1BEUA 1LRTA 2CLKA 4QITA 2QCCA 5ABTA 2V30A 2ZZ3A 3C2VA 3IGXA 2ABAA 1XXXA 4JX6A 3S0CA 2AGKA 1W31A 3DHFA 1JCXA 3QEZA 1K02A 2W79A 1QPQA 3U8GA 4JYDA 3SFKA 1HFBA 4NZFA 3G0UA 4O8RA 5D09A 5LZLA 5DCBA 2HSAA 2Q8ZA 1YDOA 3LHVA 4O52A 1GG1A 3QSTA 1XUZA 2ZA3A 4XBSA 3TW7A 1TJPA 4A3UA 2CWNA 3KX6A 4S2BA 2RHGA 4ZQPA 1B57A 4N9BA 1X6UA 2FFCA 3KVMA 5C55A 4IPJA 2GJLA 5BW6A 1W37A 2Q8LA 3TQKA 1Y0EA 1X7FA 3UWZA 1EWEA 1M5WA 3GXPA 3CU2A 4BWLC 3PM6A 1FXPA 4M5PA 4O50A 3T40A 3HF3A 3W88A 2VKZG 4WY0F 5LNRA 1J5TA 1SW7A 3M5ZA 3QMTA 5FEWA 1SZEA 4E0CA 4H4IA 2GOUA 3TXZA 1LOSA 5A8GA 1VCFA 5I3JA 2A7PA 2E68A 1K7FA 1LRNA 1FWNA 2OZ0A 2YYTA 4X3ZA 3NQFA 5FESA 1OFAA 3IV3A 2DJLA 3EXTA 4P2VA 3NZ1A 2C1HA 1TYGA 3TDFA 1OFQA 1FXQA 3TKFA 3R8RA 4JS3A 1OYAA 4Z1DA 2E6FA 3L5MA 5E93A 1G67A 4A29A 5AHIA 4BK9A 4JR5A 4JTSA 3FOKA 1FCUA 1EP2A 1D3HA 3LI0A 1YYAA 1YXCA 5CPMA 5F2MA 1CW2A 3M6YA 4MPQA 1ZY9A 3S8HA 4ADUA 2VC6A 3GKAA 1P5BA 2CLHA 1OG0A 4UFIA 4BI7A 3OBKA 1GT8A 2CZEA 1QO5A 1W5PA 1KM6A 1W0MA 2BXVA 3LB0A 3DAQA 4RXGA 1H5YA 4ZQOA 3T78A 3QJAA 2ATMA 2C3ZA 3I7QA 3DI0A 3Q37A 1O5XA 2VFEA 5FF2A 3C61A 3B0VC 5AYXA 1KBJA 2B7OA 3EWUA 7TIMA 4TMBA 3TNOA 1QCWA 1H7RA 3Q2DA 4RKAA 2DZUA 1GVSA 1G4EA 2KZHA 1KM3A 2J9YA 3UWQA 4BFAA 4Z1BA 1H1YA 2B0MA 5I3KA 3VCRA 1RZMA 3EX6A 4WOQA 1TIMA 2QCDA 4JGDA 3QZEA 2WNNA 2PRMA 1JCMP 2QF7A 4MIMA 1KFKA 3A22A 3ABQA 4I7WA 1KM5A 1GPWA 4MZ8A 4LC8A 4EF9A 4NXKA 5LKYA 1TV5A 2Y63A 3IIXA 4O0ZA 3TE9A 1YPFA 5LNVA 3P67A 2JK2A 4FNUA 4O10A 1GYNA 3G1VA 2QEZA 1VRDA 2WO5A 3OG3A 3SIZA 1SPQA 5DY3A 3K30A 3CTLA 5D2YA 2ZRYA 2WSQA 1TJRA 5DCDA 2X1SA 3S9YA 3NAVA 4A2RA 4S1FA 5K4ZA 3C2OA 1GZGA 4JYFA 5CKSA 1DV7A 1YDVA 5F2GA 4TX9A 3STFA 4O14A 1LCOA 5HUPA 5HWNA 1JCLA 2ZZ7A 3GB6A 1PS9A 2E09A 5DELA 3QPYA 5BNKA 5U4NA 3EB2A 2B4GA 1DQXA 3DHDA 4K36A 1VHNA 4UTTC 3UD6A 1JR1A 3JS3A 2BSLA 2V9DA 3GIYA 4P61A 2C18A 3E9AA 4RZ6A 3LCWA 5CPLA 1EWDA 2R94A 2Y7GA 1JCJA 1OF6A 3T55A 4Z0JA 3I7SA 1VLWA 3IVUA 3LDVA 1WOAA 4Q32A 1PL9A 3DKJA 3BW3A 1VCGA 3HJZA 3DZ1A 2QAPA 1TTJA 4UR8A 3N2MA 3QFEA 4LVDA 3W2JA 4UMBA 3W7DA 5K9DA 4PH6A 3T4CA 1EP1A 5AOUA 1IXOA 4MJZA 3DENA 5G2HA 2Z2UA 4FO4A 1LRQA 3DFPA 4OWGA 3SW6A 3C6CA 1FQ0A 1LLWA 3G18A 1GEQA 4UTLA 3TQVA 4Y90A 5IBXA 3W1NA 3G3MA 1W5OA 1ICPA 2J88A 5AC6A 3DH7A 3W7OA 5F4WA 1TPFA 4DPQA 3MP5A 4GE8A 4MUZA 2NUWA 4AHQA 1SQ7A 4JYEA 3THQA 3DXIA 3VE7A 3HOJA 1HG3A 3KXQA 4NJHA 3TQ0A 4Y6GA 1G69A 3G22A 1JUKA 3HB9A 3CWNA 1TV7A 4LRTA 1H63A 4AB4A 1LTDA 4ZL1A 3DFTA 1GWJA 3I6RA 3MI6A 1ONRA 3WFAA 5FEZA 4POCA 4QISA 3STCA 3OIXA 4DEFA 4R33A 3EWZA 1NFBA 4N6EA 1FX6A 4HN4A 3UWUA 5EKYA 3D0CA 3VI2A 2HMCA 3ZR4A
chains in the Genus database with same CATH superfamily
3S5ZA 2A5HA 3W74A 3LCLA 4J9JA 1UR9A 3B9DA 3TR2A 3BARA 3QF0A 2NVDA 1AH4A 5JIPA 1U83A 1SJDA 4DLFA 2MNRA 3ZJKA 1RQHA 2PWFA 3H53A 3PTDA 2EEXA 1W1ZA 4HTYA 3KZPA 4DRSA 4MADA 4UZSA 3PUGA 3W7QA 1UWRA 3LHYA 4LUTB 2NT0A 2RDWA 2YYUA 4DBEA 3SJ3A 2FJUB 1GOXA 3W1RA 4AC1X 4Z2KA 4ZOAA 3K5XA 1JVNA 4GBUA 3STEA 7XIMA 5H8MA 4D6EA 4IXXA 3VFLA 3C56A 3VOJA 3EX2A 5M03A 1KCZA 3POHA 3NQ2A 4O1AA 1IGSA 2YB4A 3G5EA 2V38A 5GPRA 1QTWA 2OT0A 2D23A 1FCBA 1P6BA 3U57A 5M2FX 4F0SA 3NZRA 1YHTA 3PZNA 2CZDA 4BS0A 3LYEA 3QW3A 2ZDSA 3MSDA 1WDSA 2ZRUA 3IS4A 2MANA 1E6PA 2Z25A 4HA1A 3H4XA 4PMYA 3N17A 5FF3A 2OZ8A 4M1RA 1B3OA 4QIUA 5FJIA 5EPDA 4FI4A 2O4QA 4LQ1A 1K4GA 4MLRA 3ZJ6A 1VYRA 2FDSA 3PFMA 4UOZA 2I16A 2NXIA 2VYOA 4QE4A 5C54A 1UUMA 1VC4A 2Z1KA 1KLZA 2CLEA 3FYPA 1Q6GA 2VFHA 2EG8A 1YE6A 1Q66A 4US5D 3V5FA 1PYFA 3E49A 1XLBA 3TSDA 3TN5A 2E4TA 2VZTA 4H8UA 1GVQA 2EKGA 4DJFC 2D2GA 3W25A 5IOBA 1AH3A 3PJUA 3NQAA 2G0WA 4AU0A 2ZOXA 4LUSA 3WK2A 4PRWA 3VDHA 3Q67A 2ZWYA 3L4ZA 3KHDA 4MM1A 4JTEA 3CV7A 5EL1A 1KTBA 4WDUA 3WLLA 1JDEA 4AD2A 1BXNA 2O7QA 4UIOA 1QW8A 1KM2A 3ITVA 4S2CA 2XIOA 1EOMA 4Z0SA 3H4GA 1GTHA 5I23A 4IZGA 5BU6A 2YL9A 1XIMA 2P0IA 2EG7A 3C4UA 3GH7A 1TVNA 5D8WA 7REQB 1DJZA 3BUVA 2XFYA 1E6XM 3IJQA 4WD0A 4NP7A 4QGCA 5CJMA 4BEUA 1E9IA 1W3TA 5BXPA 3CEPA 4KEZA 4CCZA 1HJVA 1K70A 1UIPA 5E0FA 3SRHA 3TUUA 2W62A 1UR3M 4K8EA 3MWAA 1EH9A 3RG6A 4UR7A 7PTDA 1FHUA 3SN1A 1R46A 1E4LA 2AL2B 4IMDA 2YCLA 2G3NA 3NL6A 3AYRA 3UA4A 4I9MA 4CUCA 2E5BA 2FFIA 4J3SA 4QS6A 4N9CA 5C5YA 3MO7A 2VURA 4GY1A 3UU0A 4JNMA 1V6TA 4L64A 3ZT7A 4GK8A 1VYPX 4H6QA 1NEYA 4HZ7A 2QV4A 2YCEA 5HNUA 4IX0A 1WOBA 3W2KA 1MW1A 2VDIA 5KZEA 1KM0A 3AZTA 4KRUA 4AWEA 3DG3A 2B81A 5DMNA 4D6CA 4W4QA 3RM4A 4H01A 1K1DA 3IIOA 4ZQMA 3IVSA 1QR7A 4XZBA 2EJ1A 3Q65A 1T0OA 1H0GA 2XFRA 1FWCC 4Q4PA 4GCXA 3WLKX 4AIEA 3W2UA 4JFUA 3EX1A 1ISXA 3LUTA 5LXXA 1Q6FA 3AICA 1MWOA 5CJNA 3AHTA 4JTDA 1KRMA 1DJQA 3IJDA 4BQ5A 1R3VA 4A21A 5BMXA 1KA9F 4H2HA 3TC3A 1HKIA 1J6PA 4JTJA 2NX1A 3VUSA 4DPPA 1LL6A 3UY7A 5H8PA 4H6RA 5C0QA 3NQCA 1WX0A 3MPGA 1EDTA 5HXMA 3GR7A 3W4RA 4W8BA 2XIIA 1AUSL 4IPNB 5HJYA 1QNVA 1NM9A 1TA3A 1S5MA 3EWYA 4IUOA 2GJNA 3N6JA 2XUCA 4N4PA 3U5UA 2GQ3A 5EFFA 3S1VA 4W88A 2VWSA 2ALRA 3TXVA 1MEHA 4B15A 2OQHA 1O1HA 3M5VA 4NJGA 1JFHA 1PSCA 5AC5A 1MUWA 1UKPA 2VDGA 1H7PA 4AWSA 1A5AA 1V02E 2GYIA 4JZ5A 4JTHA 4GI4A 2G3MA 3DFSA 4O57A 3VKDA 1W3IA 2NXHA 4FB7A 1F5ZA 4IMFA 1W8GA 1CWYA 3UR8A 4DZHA 3Q4DA 1A4MA 1L9WA 3FDGA 2RGMA 3C52A 1DE5A 3PB0A 4DWSB 3LLXA 3TVAA 3BG5A 3TYEA 3UVIA 4TIMA 3TSMA 1HL2A 5LSMA 4O8AA 3M5XA 2Y7EA 1ODZA 4KPLA 4QQUA 3QYQA 5H2ZA 1S5TA 3HTWA 2MUCA 3SRFA 2KX9A 3GZ3A 5AYZA 4JQ1A 2NSOA 3VO0A 3A4AA 3CPUA 4Y8FA 3HG3A 4BA0A 3WZ0E 1C93A 1KFBA 3QN3A 2BY2A 4C6JA 3GTFA 1ZSXA 3WEOA 1N2VA 2ZVRA 4Q33A 4ERAA 3TCEA 1D7KA 2PBGA 4M1BA 4U10A 1MEIA 4ONVA 3IJ9A 4YIWA 1R5YA 3C2FA 4RZ4A 1WDWA 1A50A 3RXZA 3RNDA 1CBGA 3BVJA 4RDYA 3GM8A 1EDQA 4Q3MA 5DRCA 3G1XA 3B9OA 4DO6A 3CHCA 4PUEA 1YNQA 1K03A 1CXLA 4JTLA 2HROA 2ACUA 1W5QA 4GPNA 3S3GA 5DMYA 1OCBA 3C0QA 3I10A 5MHBA 1J10A 3LPOA 5D03A 1TRIA 1KFLA 1ESWA 3BV7A 3H2AA 2E5CA 2VELA 3N73A 3B9AA 1KGUA 4XKYB 1AW2A 2PSNA 4GUHA 5AYBA 2J9XA 1LOLA 3ZWTA 2BS9A 2FVKA 1MQRA 4BWLA 4B2DA 3CB3A 4MGGA 4L5ZA 3QY6A 4KIRA 3UWVA 3AIUA 4B5UA 3CAWA 3UJEA 4TXEA 1XDMA 3AMDA 4CQ9A 2EPNA 2Y8VA 2PEVA 3M0ZA 3RDKA 2F2HA 1QPOA 4IQEA 1H1ZA 1ZRQA 2Z28A 4YVPA 4DAIA 1RCOB 4XUYA 2WSPA 1KGWA 2D2OA 1C9WA 3QV9A 4E6MA 2QCMA 4DJDC 5E9XA 3WNKA 4HOZA 1TMQA 1UJPA 5GJPA 2DFAA 1OBAA 3PZMA 3TR9A 4X9SA 3EKZA 3DCPA 3LPGA 5AYYA 4HBKA 5CC7A 1TR9A 4INFA 1LP6A 3W7PA 3EXRA 1QDSA 1O12A 2UY3A 5BU9A 4GC4A 4ECLA 3R12A 2PE4A 2VVNA 3NXLA 2NV2A 2A4AA 3KRBA 4DBSA 1S2AA 4WKHA 3B06A 2V5DA 2XM1A 2V5KA 4PTNA 4PMJA 3NO5A 2PC4A 4LVAA 4ATDA 1IZCA 4B5TA 2O9TA 3V1PA 3P0WA 2HS6A 3QHMA 3LHWA 1OX4A 1F7BA 2P76A 3BCFA 2VC9A 3LU2A 5KITA 4KIEA 3RRAA 4CNPA 2ZX7A 4GG9A 1XW8A 5E6YA 3P2VA 1IEWA 1TSIA 1WDPA 4NL1A 4JDBA 3G0SA 3QY7A 1LL4A 1ZB5A 3WEZA 2D73A 2GSHA 3LGEA 3MANA 3CH9A 5ABEA 5LHFA 4GQQA 4FP1A 3PB2A 5EFDA 1C9DA 3QHOA 2XSXA 1UR0A 3TSBA 4MNMA 1E4IA 1XCWA 3O6YX 3ALGA 3NM1A 4XAGA 4F79A 3EZ4A 3HPFA 1VB9A 1EZ2A 3CO4A 5C9RA 3UR7A 5HBFA 3W83A 3T0TA 2EJAA 3EPNA 4V2XA 1CGUA 1DIOA 3DBPA 1N8IA 5CPOA 2O9PA 3ITYA 3CL6A 1OC7A 2D24A 2QPXA 5G2WA 3SUWA 1IGWA 1A5BA 3ZS4A 1B31A 3HMCA 5AHLA 4G6CA 4NZ4A 1H5VA 3UCDA 1GTEA 2YCIX 3U3HA 4D6JA 9XIMA 3HQOA 1E1CB 2OTDA 3BO9A 2PU0A 3L2IA 1EB3A 5DMMA 3O0FA 1YEYA 1CI1A 1M03A 1TX0A 4XUGA 2PP0A 3LENA 5BROA 5FJTA 2Q8XA 3CZJA 1DTNA 4XX6A 4CNNA 1GK8A 1NWSA 3RO8A 4G1KA 4FX7A 2J7BA 4PSRA 4C6OA 2VZOA 1B0IA 2D2HA 4QP0A 1E5NA 1UBPC 2GWGA 2DPEA 3WQEA 1SR0A 4Q8VA 1SMAA 1ZJAA 1TPEA 3GKFA 1H2JA 1IF2A 3EA2A 4YCOA 3ABXA 3T0BA 4JY8A 5D30A 1K8CA 4AIBA 4NJKA 2PWEA 1TTIA 4KFNA 4RJEA 3S9ZA 4MB3A 4GMEA 4NG3A 3NIYA 5LNSA 4JFSA 4HTBA 3CV1A 1RQEA 2TMDA 3QGAC 3JRKA 4P5UA 1FDZA 3MKKA 1UC5A 1QWKA 3C5QA 1KRBC 5TD4A 1TELA 5HA7A 6ENLA 5A6JA 1IEIA 5JXQA 3NZQA 4IX2A 2OWCA 3EA3A 1HO1A 4AYSA 5HNTA 3CIWA 5BWFA 1QI0A 2CITA 4AZIA 4GXWA 4ZODA 2VEIA 1UR2A 5B80A 4D6FA 3G1HA 1UOKA 1Z9AA 1CYGA 1YTKA 3FEQA 2Z7GA 3TV8A 2Q71A 2YDQA 4NX0A 1XFCA 3HFTA 2PDKA 3A23A 4MJ4A 3OGVA 1V6WA 4MB1A 1UWUA 4E8DA 4G56A 1OSEA 1ZALA 4ZQCA 1CEOA 1Q6LA 3VIKA 1XYZA 3PJTA 1ZZMA 3BG9A 1FRBA 2BX7A 2HVNA 4M6VA 3HIJA 1E6RA 3VIOA 1OCQA 4B90A 2YB1A 4KWUA 1HP5A 4IPPA 4L65A 3F4NA 4RR4A 3SB0A 5IBXC 4PCFA 4N42A 2XJ7A 2X7WA 2ZRZA 4ZTYA 3NQEA 1EYWA 4J5NA 3GO2A 3O6CA 1CLVA 1EDGA 1HZYA 3N3MA 3KZSA 3MUXA 2I14A 3N9RA 1SW3A 1FWRA 1LBFA 2DEPA 2P3ZA 1HKMA 1XYLA 3NL5A 3N14A 3HV9A 4ZFMA 3CUIA 1WZMA 2UZ9A 1AJ0A 3M9YA 1HKKA 2J66A 2VP8A 3NSXA 3MW7A 2XTKA 3T0DA 3WQ8A 2X0YA 4WRHA 3TFXA 1Q6EA 1Y8BA 5D32A 1XDJA 3D47A 2WMGA 3OJGA 1KM1A 4S3KA 4PZVA 5L9FA 3RGTA 1WYIA 1UH4A 4N9DA 4KESA 5EYWA 3M07A 1DXEA 2PU1A 1LJYA 3HPZA 4IL2A 5LIUX 5CZ0A 1T6MA 3AS0A 1Q4NX 1GJUA 1CXHA 2ISFA 2P8BA 3GXMA 3TAKA 4IJCA 2ALDA 2Z1VA 2XINA 2J7EA 3GFZA 1QOQA 4HJWA 3BE7A 4PFHA 3IANA 4IOTA 3VM7A 3H2CA 2G95A 3B8UA 1FWBC 2DZXA 3NGJA 1PKYA 1LUCA 2DT1A 4OT7A 2QR6A 2GSJA 5CG7A 2GUUA 4Z2IA 3W29A 4QE1A 3QOKA 4HQVA 5GVJA 1FWFC 4DWSC 2Y5SA 3LTSA 1V93A 1ISWA 4LTSA 1XRFA 3SUVA 2E25A 3AIQA 4X60A 1XPYA 1I75A 4HNLA 9RUBA 3ARTA 4BI5A 1K9DA 3W87A 3SCNA 4GKTA 1XRVA 3RMJA 1MQPA 2XHYA 3T2OA 3N19B 1PHQA 1UUOA 1M04A 4CN4A 1XYBA 2GQ9A 2Z6IA 4XB3A 4UFLA 1G01A 3UXKA 5K7JA 2WCSA 4P7OA 3S6TA 3TYDA 1Q6DA 1AZ2A 2GK1A 1JGIA 4NZCA 1ZPTA 1MFVA 1WKDA 4Q7IA 1ISZA 2A3EA 5DEZA 1A5CA 4R9OA 3S2JA 4CD6A 4F40A 4MYAA 3GFXA 1K77A 5G1TA 1TPVA 3E0VA 1LBLA 3W7MA 3GR8A 3WBYA 3OB8A 4FMVA 4IJRA 3KWXA 3TP4A 5A2BA 4GX9A 1Q85A 3NL2A 2IPFA 4S3FA 1LLZA 5CCZA 1VBUA 1E0XA 3O15A 2VWTA 4S3JA 1P48A 1XM3A 3OODA 4XBKA 3STGA 2CBJA 2YA1A 4NY2A 2BGQA 3N34A 4ICMA 3GU1A 2OXNA 4LV9A 4KCWA 1IT8A 3QR0A 5G5IA 5I3DA 1YADA 5C9UA 2BLEA 3W70A 2QMJA 3RLHA 1DXFA 3IARA 3TCSA 1KXVA 3TTSA 2AQWA 4XD3A 5TF0A 4S3GA 4XWUA 3QPZA 1PCWA 5HPCA 3F5LA 5F4SA 3PK7A 1AZ1A 2BHUA 2R8WA 2E8ZA 4HMEA 3A12A 5CAKA 2GPTA 3UYIA 2PCQA 3NDZA 3TAOA 5A3HA 3MHFA 5HDRA 5TBOA 4B5NA 1TJ2A 1J2WA 4MKSA 2OOGA 1VFHA 3SY8A 1KTNA 2GGHA 4K1GA 4I6VA 4B16A 4WXZA 3PANA 1MZHA 1XPGA 1JQVA 1F6PA 1P1MA 3GNNA 1NARA 3KE0A 1JXJA 3HPSA 2YFOA 3UNTA 4HVXA 4G5DA 1AFSA 3CZ8A 1UB3A 3QQ0A 5REQB 1REQB 2OYMA 3UESA 3MYOA 3RU8X 3HA1A 4CCEA 2FPYA 3RJYA 1FVPA 2DUXA 1QPRA 4X0NA 4PEEA 3WLPA 4KS0A 2J8GA 1KFWA 3VZXA 3MSRA 3IUHA 2W9MA 2VZSA 5A95A 2V2CA 3SI9A 3UZJA 1EX1A 3WQ6A 3HMJG 3DOPA 3CPRA 3FEMA 2QQ6A 1NF0A 3PFRA 1US2A 4ERGA 2ON3A 3N15A 5ABGA 1EYEA 2E9LA 1FTXA 3OYXA 3IJIA 2I17A 3ES7A 3W82A 1GZJA 1M7PA 4GYJA 4O4VA 4PA8A 3N18A 4J3VA 3MI2A 1HTIA 1HGWA 4C7GA 3A6OA 5LNUA 3FXGA 1YE4A 3RJXA 3WELA 1OCNA 3ZWSA 1X7IA 2TPSA 2XH2A 1BXCA 5FSDC 4PMQA 3W6YA 3FA4A 4F0LA 4HP5A 3MJMA 4L9YA 4PB3A 2VENA 4IGSA 2FTYA 5CC3A 1T99A 4ACZA 3OZOA 4ML9A 2EPOA 4WVXA 1Q8JA 4EXQA 1NJJA 3V75A 2A6LA 2FZDA 1VCVA 1XWYA 5CPQA 3TYCA 5M5DA 1V03A 2FKPA 1Q7MA 4AZGA 2FH6A 3DFYA 5DBTA 3EX3A 2CETA 3BSGA 4M8UA 5C7HA 2G97A 1MXSA 3VOFA 3S2MA 1AD1A 3GAKA 4MNJA 3BCDA 4NNAA 5CPNA 4LSBA 4P8VA 3EOEA 3TIMA 2BODX 2FHCA 2E6AA 5FKYA 2VD9A 4D71A 3BGGA 1GOMA 4Y9MA 2ASHA 1RCQA 1XBZA 3WBWA 3UQNA 1Q2RA 4PMOA 3IEBA 2EGZA 4W9TA 2EF9A 5TAOA 2VX6A 3SBFA 3LHUA 4M19A 1W2VA 3EKLA 3ITCA 4LANA 1LDCA 5HWJA 4LNCA 1ZAJA 3QW4B 3HGRA 1M65A 4UTWC 4ZOBA 3ZVHB 1GOIA 5A6MA 1BGGA 1LT8A 4LS1A 2JE8A 3MMTA 5IM51 3QLDA 3WENA 3B8SA 4GI9A 3NPVA 2QCNA 3G1YA 4GBDA 3QZ6A 4C6CA 2WLYA 3L4XA 1TWSA 5C2CA 5KINA 1UJQA 1UQZA 4RDWA 3P5YA 4DJDA 3M0MA 1DWIM 3U2OA 4Q8MA 3VGHA 3H26A 3OA5A 4PFMA 1FOBA 5AZ0A 1AMKA 4ZTXA 2VUYA 2TYSA 1NOFA 3O07A 2W91A 1WBHA 4ZFCA 3HFYA 3TQPA 1HJXA 1P7TA 1A5KC 2CLMA 2W3ZA 4CGTA 1LBMA 4H7ZA 4HPHA 3L68A 2PA6A 1XIHA 4YPJA 4GYFA 3WIJA 3NDOA 4OOUA 1XIBA 1OADA 4LUTA 3TK7A 3SFWA 4QITA 4ZE5A 4Y9PA 5I00A 4RW3A 2ZZ3A 1XXXA 3R0DA 3ES8A 1F3XA 2W79A 2BMBA 4NYYA 3P3BA 3QSTA 1DWHM 4RE2A 1TJPA 4S2BA 4JKLA 5HK4A 3C0LA 4DHGA 5C55A 4B91A 1W37A 2VQUA 3TQKA 3UWZA 3TTQA 1EWEA 4XZHA 1OGBA 5LA1A 2INFA 2JIWA 3HF3A 3BGAA 1KD0A 1SW7A 1QU4A 1RBAA 1EGVA 2GOUA 4XZIA 4JFWA 2YDRA 5EBAA 5A8GA 1UOZA 2NQJA 3SIMA 1LRNA 4RE3A 1SYTA 4X3ZA 3NQFA 3IV3A 3EEZA 4P2VA 2C1HA 3TDFA 1OFQA 3R8RA 3QLLA 3CL8A 4Z1DA 2BBFA 3OBAA 1XIFA 3AIEA 3EMCA 3VGBA 4GINA 3MCMA 2V5CA 3AU6A 1FCUA 2VRQA 2W67A 1D3HA 2GUBA 5D8ZA 1VEPA 5JH1A 3M4HA 1CW2A 1PO9A 1ZY9A 3QR1A 3UGVA 3GKAA 1P5BA 1W3LA 3T08A 3WQVA 4UFIA 2NQ9A 1QO5A 3IPWA 1W5PA 1JCTA 1W0MA 4ML4A 3LB0A 3DAQA 4RXGA 2QPUA 2AMXA 3T78A 3GHRA 1N8WA 2ATMA 3I7QA 3Q37A 3OLIA 1O5XA 3W00A 2VZUA 3C61A 4AD3A 2B7OA 3TNOA 1ZS2A 4XZNX 3Q2DA 5KEZA 4RKAA 2J79A 1GVSA 2PTXA 1ZTVA 5A2CA 4BFAA 3H2OA 4Z1BA 2GDVA 4O0QA 5I3KA 1CXIA 2BOEX 2BVTA 4W5UA 5HMDA 3OLDA 4WOQA 3WD2A 3QZEA 4HMCA 2QF7A 4MIMA 1QI3A 2QUMA 2WM1A 3GC4A 3WSUA 1KM5A 2DUAA 3R10A 1TV5A 2YA0A 4O0ZA 3U2EA 1UKOA 4QROA 1TUXA 2QEZA 1BGAA 4QBXA 2VC5A 7REQA 5K4ZA 5G1MA 1QBAA 2XISA 3BL3A 2Y5EA 1CGWA 3WF3A 4JYFA 3GBEA 1OB0A 1MXGA 3STFA 3GTXA 4LAMA 4EX4A 3VYLA 1KCLA 2E09A 4ZB5A 4D8ZA 5BNKA 5U4NA 4JCLA 4QX4A 3RIKA 2DSVA 2AL2A 3FJ4A 3VFCA 3T42A 3CK5A 4UTTC 1VHNA 2FZ8A 5XINA 1JR1A 4P61A 2BSLA 3EDEA 3NCOA 4WJ8A 2VVSA 2Y7GA 3VDBA 3T55A 1VLWA 3IVUA 1PL9A 3HJZA 1VCGA 3WD4A 3H7RA 4X0VA 2G4JA 3QFEA 3W2JA 4P7NA 1V6UA 1HVXA 2A3CA 3LA4A 3RPTA 1BXBA 5AOUA 3U48A 4HOWA 2F61A 3DENA 4WCJA 1RHCA 3VCNA 2BHZA 1B9ZA 2Z2UA 3R11A 1LRQA 3TONA 2FHBA 4HCHA 2R82A 4MJ2A 4F0MA 1LLWA 2PDWA 5IBXA 3W7OA 2YXXA 5F4WA 2X7VA 5I06A 4DPQA 1PAMA 4I6KA 3MP5A 8A3HA 2DH2A 4AHQA 4QSFA 3T07A 2ZUVA 4KWSA 1GOWA 1JZ7A 3HOJA 3KXQA 4NJHA 3TQ0A 2HVOA 3MTWA 1L6FA 2D0FA 4LRTA 1H63A 4ZL1A 1EJUC 1LTDA 3AS3A 4KEUA 3I6RA 4LBUA 3I4KA 2FGZA 3MI6A 1O1ZA 4QE5A 3DBNA 2ICSA 2HPMA 4ILSA 4QISA 3STCA 1NFBA 1SMDA 4YHGA 5XIAA 3D0CA 5JVLA 3E3HA 4YYCA 3AZRA 2Y62A 3OGSA 1GPFA 4HNVA 3G24A 3S6DA 1TZZA 5EA9A 4ZXLA 4J7RA 1UR1A 4UFJA 1XBVA 3NQGA 1W5MA 1PIGA 1WDDA 2DVXA 4DJEC 4QTGA 2A7NA 3MDUA 3SRDA 3W6MA 4A8IA 3LCIA 4YN5A 1V3MA 2W63A 3U4FA 4CKQA 1Z44A 4OOZA 1K7XA 2YCLB 4E8CA 3LSBA 3GHTA 4I9JA 3VM5A 5FAGA 2VJXA 4MWAA 1QOPA 5JUVA 4B9ZA 3H23A 3ATYA 3BMWA 4KT2A 3VIMA 3GDTA 3ZR5A 3BAIA 2DSUA 1DJHA 1W9VA 3EPOA 1IZJA 3LSCA 4DWSA 3E0IA 2FMOA 3VZYA 3A9IA 3APGA 3W81A 1V8EA 5E6ZA 1XLIA 1PDZA 2GVEA 1EPVA 2WAGA 3FFSA 1JFXA 1WE5A 5JMUA 5IXEA 4N4QA 4NKCA 4Z2GA 2XZ7A 4CEXC 2YL8A 3U9IA 3QV7A 4BF5A 4IGMA 4C6BA 1WP6A 1UKSA 4GIEA 3A47A 1O5QA 3MHGA 4R7WA 1C8QA 3R0UA 3B9EA 4XSLA 3RX4A 4LH8A 6XIAA 1B3WA 3KEHA 1P0KA 3CV6A 3VIHA 4J1OA 2Q09A 2C13A 4CQDA 2FPTA 1BKHA 4CVWA 3W0KA 4IUGA 5I0DA 1W3NA 5DLCA 3F4DA 4Y96A 1XKYA 2CFFA 3G8RA 3B0PA 1QASA 2DT2A 3C3UA 1OK4A 3GHSA 5AB3A 3GC5A 1I8JA 3M64A 4O16A 5IFTA 1CTNA 2DU2A 3DFOA 1KGXA 5BZAA 4BF7A 1QBBA 1P6WA 2PLMA 3ZLGA 2G8ZA 4CQCA 1PYMA 3AHXA 3SN4A 3A5FA 1IV8A 4B3KA 1C7TA 3TC7A 4Q4KA 3KCLA 3SAZA 2XWDA 1LOQA 4L7ZA 4R7JA 3LZ5A 3URAA 1IXNA 4XKYA 1F74A 2OU4A 3AUJA 1TWDA 4IISA 5CGQA 1UHVA 2VX5A 2WVSA 4A8NA 3TYBA 4B5XA 5BOOA 5L6UA 2V2DA 1LWIA 3DN5A 4MMWA 1VD6A 3LCGA 5AN7A 1LT7A 3TA6A 3LD5A 2CW6A 3N6HA 1PHWA 5CZJA 1W1A1 3TW9A 3H7VA 4AEFA 2E6YA 1WXJA 4GWEA 1PV8A 2DSZA 4L1GA 4LFYA 3M0KA 1VQTA 3ZXWA 3QHNA 2FIQA 4L56A 4WJXA 5G1YA 1Q6OA 1XLEA 3E2RA 5C6MA 4AISA 1KKRA 3VMOA 2H90A 1TTQA 1TQJA 2ZUTA 3W23A 3EDJA 4B92A 3VGDA 4EOUA 3F2CA 3EOUA 4MY9A 3WQ4A 4I5RA 5BXTA 1TCMA 1UPPA 2DJXA 3O8AA 2OQYA 2A2IA 3W72A 4F0KA 2PDHA 1I0DA 5HR6A 3TJ4A 3OVRA 2OSWA 3UY8A 3VNDA 3E2VA 4KWWA 4MF4A 1R86A 2QUTA 2C0AA 2FMNA 3SY1A 2IQDA 4UQ9A 1CXKA 2UY5A 5LHEA 2CNCA 3BW4A 5D2XA 4HYRA 1OZQA 4PTDA 4AZCB 3H54A 1EBGA 3NQ8A 3N3TA 3GDMA 4FSAA 2ACRA 4EIVA 4YMZA 3QM3A 2GVLA 2O9OA 4CQ8A 2OX1A 3IJ6A 2DT0A 3R13A 1AK5A 4BZYA 3GVGA 1UC4A 3G1RA 3G3DA 3ZLHA 4B2DD 3SURA 1GOOA 1R2RA 3IGUA 2GVJA 2IKJA 1X39A 2CERA 3IUDA 1HKWA 5D02A 2J8TA 1O66A 1VFFA 3QQWA 2QJMA 4OECA 4MAVA 4D6HA 3LXCA 5BRBA 3HO8A 4OV4A 2Y61A 1E0TA 2OELA 3K1GA 1TPUA 1M6JA 4YU1A 3TLQA 4C1KA 2Y7DA 3SN0A 4FAMA 3FV9A 3EPMA 3MYPA 2YXOA 4G7FA 5A5WA 4RV3A 4MY8A 3NTYA 1S39A 3O63A 3MUY1 1R3RA 4PTXA 2WW5A 3S83A 2H9AB 2DGAA 1US0A 3NVTA 1U22A 2WMIA 1A3XA 3FAWA 1EXBA 1IIGA 1LLOA 2O9RA 1XIGA 4WDWA 5D2WA 1E1CA 2VOMA 5FSEC 2Y88A 3LRKA 3MSYA 5CLWA 3EYPA 1AL7A 1W6TA 1VAHA 4Z17A 4XIMA 3NQ6A 3T8QA 2VOTA 4NJJA 3TYZA 3R43A 3KL0A 3WLMA 1Z89A 5LIWX 1H50A 2DVUA 2R1NA 2YL5A 5HAOA 1AMYA 4JN8A 3K1DA 1QFEA 2VQTA 4QG9A 3OHIA 4GQRA 4ALDA 2WHMA 2ZE0A 4DI9A 1F4HA 3SQLA 3GNXA 3O16A 3PZVA 1E43A 3UA3A 4LX4A 3H2EA 3LK6A 1BYBA 2WVTA 4B4HA 5AVHA 3CC1A 1NVMA 3AZSA 2O7SA 1AD4A 3R1ZA 2YR1A 3E96A 4UNLA 4OUIA 3K8MA 4L4PA 4J2MA 3WQGA 2NQHA 2NWSA 1TG7A 3BW2A 4EWND 3W7IA 3S1WA 5DY2A 3EBVA 1DQUA 1RJPA 3OW1A 4UFMA 3SO7A 1KQZA 1DJGA 1IR1A 1KQYA 4FF7A 3W1LA 3W2MA 4UFHA 3LRMA 1CB2A 2VFDA 1ZP4A 4H9UA 3E6EA 3DFQA 1I1XA 1QXLA 2PDLA 4AZ5A 4BHYA 3QOMA 1EIBA 2PWUA 4BF9A 3NPUA 5HMSA 3QY8A 1VFTA 1PX8A 4RUBA 3G6MA 4PSPA 2VX7A 4HT3A 4DM1A 4ROQA 4OGZA 3PAJA 3SSJA 4GYPA 2E0PA 1XGDA 4H04A 4CEUC 1FHVA 3UR2A 1O68A 3KBNA 2OWWA 1LZOA 5A6TC 3DEQA 1QPNA 1K9FA 3C0JA 3W7RA 1HKVA 1K7EA 2XIQA 1V4YA 3JVAA 1O95A 2ZX6A 3GFYA 5A8PA 2UY2A 1J0IA 1ONXA 1WZLA 4PCNA 1JIBA 6TIMA 3W07A 2QCHA 3EB4A 1ZAIA 3BLIA 2BVDA 3B0YA 4GUFA 1UH3A 1EQPA 1YBQA 4K1WA 1UPMB 1PPIA 2ZA2A 2NWRA 2HTMA 3CBWA 4LEFA 3RRXA 3UJSA 3KM8A 5I7GA 1WUFA 1NIUA 2OG9A 5CH9A 1R9YA 3CHVA 1Q7ZA 3WNNA 4M51A 3ONBA 1X96A 4MZ1A 3EWBX 1K6WA 3ID7A 2QXWA 3KBWA 4BQ3A 5D2TA 4AVNA 1W9PA 1KLYA 3GX9A 3NDYA 4FS9A 4CD4A 3ARXA 1K9TA 1PZ0A 4AWTA 4GZEA 2HZGA 4F48A 1GW9A 2FB3A 4IMEA 5AC8A 4Q22A 3UYCA 4GNJA 3KAOA 2OODA 4GOAA 4M0XA 4UQBA 4A8RA 2AQOA 5HULA 4KH2A 4CQAA 1OIFA 3M43A 2OGYA 1S1RA 4TX8A 2Q3OA 1F8MA 3S42A 4FX8A 3WX7A 4YCPA 2XG9A 3ZIZA 4RNIA 4DF1A 1PBGA 1TWIA 3EWDA 3KBJA 5H8UA 4JIEA 4PODA 2PAJA 3BXWA 2SFPA 1HXJA 3P60A 3KRZA 4QJ3B 4MAZA 1BRLB 2HJPA 4UMAA 1A47A 5JQ9A 1W32A 2ZA1A 2BXYA 1X98A 4L6OA 1B5TA 3QPEA 3R94A 4G9PA 2YL6A 3UJ2A 2PDIA 4GVHA 1U33A 4HYVA 3URQA 4H41A 2V82A 1W56A 4QNEA 3L4YA 1UBSA 1XLJA 1FDYA 4X63A 1W2PA 1I2OA 3CJPA 4OFCA 2X1IA 3KS5A 2WYSA 5FF4A 1BAGA 5CBIA 3PZIA 5A1AA 2F84A 3PN8A 1W54A 1UA7A 1U5JA 3W38A 1Y5VA 4JNYA 1CGXA 3W7GA 5JBDA 1P0EA 1TB3A 4GFSA 2FZMA 1GVEA 4ZVJA 3D46A 1J0KA 4H9ZA 4UTTA 3EKGA 1F2JA 4JBRA 1FCQA 4QLKA 3CIVA 5A6BA 1OYCA 3CUXA 3RM8A 5DXYA 4WSJA 4RLIA 2A3BA 2PDJA 5A6KA 4MWAE 4GH3A 2C14A 2I56A 3PF3A 3AISA 2RDTA 3SCOA 3UR5A 3T0CA 2WC4A 2WCAA 1ZCCA 3OLGA 4NX5A 1B9BA 3AI0A 4WX2A 5FAJA 3VDCA 4DJFD 3BG3A 1WO2A 2OYKA 2V3GA 3VD4A 1XIEA 2WJEA 5BMWA 4HHPA 3OIHA 4ZOEA 3AS1A 4IP7A 1C8VA 1LUCB 1GVYA 1QHOA 3FGCB 4D6GA 3BH4A 3SCUA 3WLTA 4H9YA 1M41A 3BLPX 3PBWA 1DHKA 3LMZA 4PULA 4GCAA 2GGIA 1FWWA 2VCAA 1OK6A 3V5CA 2E7FA 4GY7A 4AD4A 1JULA 2DT3A 2YDAA 3V4BA 4AZ6A 1I2NA 4IIDA 4GC3A 1QJWA 1WNOA 1E4MM 2WMHA 1R8LA 1WQ5A 3IACA 1F05A 5EU9A 1QI4A 3E12A 5KZ6A 3TFCA 3ZSTA 6REQA 2A1YA 4UTIA 4LXFA 1IT0A 1H51A 1KW1A 7ENLA 4J4KA 4JCMA 5E9AA 2VD8A 1VKFA 5T26A 2IKGA 4JTRA 2WNZA 1O60A 2Z1BA 3NPXA 2VGGA 2ISVA 3W53A 5F4XA 3B0UX 4DJEA 4FXRA 1BVNP 1KCXA 1REQA 1Z42A 4Z2JA 2GJRA 1B4KA 3HPAA 3P84A 1IXPA 4A35A 2ZZ2A 2YCJA 3A13A 1UMLA 4EXBA 3XINA 1EBHA 4B4FA 1XC4A 3PPHA 4WQ6A 1UMYA 4NNBA 3ABRA 4AX6A 2E8YA 4IF2A 4Q8QA 1OFPA 2ZZ5A 3W6LA 4XV0A 3G0XA 1OX5A 4NVTA 3QKZA 1PX3A 5FEXA 3UWEA 3P62A 1GJWA 3XISA 1J12A 1JG9A 1V0MA 1F9CA 1B2YA 2E77A 2NX3A 3KLLA 4YL2A 4Z2HA 4BY3A 3L67A 1HL9A 4Q8TA 1SUXA 1XD1A 3KBSA 3E1F1 1V02A 3V3WA 4DUOA 3CAVA 1LWJA 3I68A 4NHVA 4PMRA 1X8FA 1ADOA 1AQFA 2PDNA 4PB4A 1OM0A 4J3XA 4CLMA 2WKLA 4R7OA 4NU7A 3OBEA 3NQBA 2QJGA 4J35A 1JYWA 3AFBA 1JEZA 5M3WA 4XD6A 2ONEA 4N7QA 3F03K 1K9EA 1RPXA 3DESA 3KDOA 3MSGA 1I2RA 3O1NA 4QQ3A 2HS8A 1H7XA 1BYDA 3WUGA 3UZYA 4MG4A 3GXDA 2E6DA 4GJIA 3FS2A 3DGBA 5ECUA 5JBFA 3NQMA 2PB1A 2FLIA 2QV5A 4NZ5A 3EWWA 3WMLA 2QJIA 5DO8A 5HOSA 4O1EA 3BGJA 3EB3A 1Q2SA 3OLEA 3QV8A 1PCKA 1OFEA 3LCXA 1KR0A 2BHYA 3UJFA 1OHLA 4U33A 2Z24A 2WC7A 1HIZA 2WMFA 1YPIA 6ALDA 5AHFA 1ICSA 3UWYA 4I7VA 1ZBWA 8RUCA 2VMFA 2VEKA 2BV9A 2J78A 1HVQA 4JIQA 3G1DA 3D5HA 1T40A 4ZCWA 1W91A 2RDXA 4RCXA 4WDTA 2X05A 2HV5A 4AXNA 1WB0A 3U4AA 3PSVA 1SU5A 3TEVA 1DWGM 2XFWA 1ZLPA 2XZ9A 3ZVHA 4IFKB 3W1QA 2FTWA 3PNUA 4UQDA 3IAPA 4ENLA 4Q8OA 4RV8A 2NUYA 2VL4A 4J27A 3MUZ1 1CXFA 1S46A 3O7UA 1E3XA 3M44A 3THDA 3ARYA 3NSNA 1LQ2A 1UCWA 3GUWA 4A3YA 4IGNA 3P6LA 1YIXA 4F8XA 3AMKA 3PJXA 1VEMA 1XLCA 2HRWA 2PRHA 3KL5A 4DBWA 3EDKA 4S3EA 2V3EA 3VKKA 3FNDA 1TREA 4QLJA 3SUUA 2OMAA 3WJWA 4Q8PA 2JFEX 5ECVA 1I60A 2G4FA 4R34A 3CIXA 5CQ1A 3C3NA 3CTTA 1SJAA 1LM1A 2ZBTA 1ISVA 3MC5A 1SZFA 1F6YA 1PDYA 3HJEA 4HSNA 1DJWA 3VOHA 1TPH1 3KTCA 2RJHA 1TPDA 4F9DA 3WQPA 3TZFA 4GXPA 3GW3A 1S5VA 2DQXA 3APYA 4O1DA 4Y9NA 1QW9A 4ES4A 4M24A 3ME3A 5G4WA 1XLKA 4G8TA 1BQGA 1TE1A 4ZB0A 5CZSA 2YZ5A 3KVLA 3VGFA 4FPSA 2C71A 5LGZA 1EJ7L 1GQNA 5AVNA 1UD3A 2E67A 4XISA 2CKRA 1F61A 4DAFA 2PLCA 4B3LA 2VI0A 3SSZA 4H6KA 1KTCA 4EK7A 3BOFA 1A0DA 1DHPA 1N8FA 1ZNNA 4Q6XA 3G1AA 3PWAA 4FNTA 4GKLA 2EPLX 2QJNA 4EE9A 4RNJA 4LYPA 2OCZA 4RW5A 3GDBA 3LM3A 4DJDD 3WF1A 3DYOA 1MO0A 3EAUA 3U0HA 3RN6A 1P0BA 2OR2A 2PDXA 2FQIA 3W7LA 2E1WA 4IWWA 4DIAA 1PKMA 4PRRA 4PMVA 4DNMA 2Z00A 1H62A 1OCJA 2EBNA 4WSKA 3W7JA 4NQ1A 3GD6A 3AROA 3AWNA 4HHMA 1JI2A 2YX0A 1FFQA 1XSIA 3PBYA 1W1PA 3WL0A 1JDCA 1W17A 2A0NA 4HPJA 1ODUA 4E2BA 3GLCA 1DP0A 1XQKA 4C6DA 3WN6A 3GY1A 4KFPA 1P7TB 1FWHC 4WKFA 5LIXX 2ZXAA 3WQFA 3L4UA 4C65A 1DYSA 2DUZA 2HDJA 4KWOA 5A69A 2GVGA 5LIYX 1SZRA 3GNPA 4IFOA 1E71M 3KVKA 1VGAA 3OVQA 4NSBA 4ZO6A 2Z1SA 4GUIA 1BWKA 2PWVA 2E28A 1XLHA 1I4NA 4ZZ9A 4JTKA 1ZAHA 2J7GA 5JU6A 1BLIA 2ZADA 1SM9A 4CN6A 4N9EA 1XIJA 4KCUA 4JDYA 1N82A 3WY1A 4G7EB 1YNYA 1NP0A 3L0KA 3ZO9A 2EAWA 2VGFA 4WHBA 3BMVA 5F1VA 1J11A 2B7QA 3N29A 1HT6A 1KB3A 1AODA 3QRHA 3GW0A 1UQYA 4QEEA 1AQ0A 1A49A 3AXMA 3M0YA 2OX4A 1RD5A 4GH1A 1XF0A 2J6XA 5EMKA 1YRRA 1V77A 4TTGA 3V7PA 2YDSA 2D69A 4GUGA 1TV2A 4DYJA 2P53A 3IRSA 3WDPP 2X41A 1XUUA 2WZIA 5E0CA 3NUKA 4GI6A 2VTFA 2ZIDA 5F1UA 1C8YA 1YNPA 1FUYA 1HKJA 4JY9A 3TMLA 4GACA 3N12A 1BWVA 3MJYA 3PUEA 1O4UA 2NLYA 3DC8A 4LS0A 4V1XA 1TE6A 1NSJA 4NYUA 5CC5A 4S3BA 4URIA 2FJKA 5AHMA 1Q5MA 4U5IA 1RJRA 2VC7A 4DUVA 2CPUA 3LQLA 2IW0A 1AJ2A 3GH4A 2AGTA 2V3FA 4H2CA 2WB5A 4JQ4A 5EMJA 2OVLA 2PUZA 3W2NA 4QLLA 4PL1A 1NF7A 3N9KA 3M0IA 1JDAA 2XH4A 1M7XA 1VS1A 1JDDA 3ITOA 1XFBA 3W71A 4C91A 1XISA 3VNKA 1PZ3A 2L5HA 1MW3A 3MVTA 2LLEA 3D3AA 1OFDA 4S38A 4PBGA 4D72A 1O94A 4JPGA 1DBTA 1TMLA 4X22A 3BLKA 3GVQA 2ZUWA 2PODA 1YTEA 4Y2WA 4HNUA 4WSHA 4LGXA 1IR2A 3KOZA 1BSLA 1HUVA 3ITTA 2EPKX 1KBKA 1R47A 4L1WA 3AJXA 3HQ1A 4IICA 5J04A 1NDWA 1WKFA 3NEHA 3CM4A 4JIHA 1GKQA 1Q6RA 5AKQA 4UOJA 3IIPA 1DL3A 1CDGA 1RCXB 3O6DA 3CB8A 5JIWA 4OHQA 1RBOB 1WUEA 3RMEA 3WFZA 1XLFA 1H7WA 2OOFA 4KETA 3CMJA 3VOIA 2C0HA 3KRUA 1LRTA 4B5SA 2WJFA 5ABTA 1TWZA 3TZNA 3IGXA 2ABAA 1C8XA 2AKZA 4J28A 1FWGC 2D3LA 3LGDA 3QEZA 2VCCA 1QPQA 3U8GA 2HXUA 4GQ0A 4HN8A 1HFBA 1XQLA 3G0UA 5D09A 1WZKA 5DCBA 1XG3A 1YDOA 2Q8ZA 3LHVA 4O52A 1ZJBA 1XUZA 1ZBVA 3TW7A 2D1ZA 1PEZA 4ZQPA 1VFMA 1B57A 2FFCA 3KVMA 1IWPA 4FZIA 3PZUA 3UZXA 3J7HA 1M5WA 1TJ0A 2CKSA 1G94A 3CU2A 2PDQA 3CUFA 5BOFA 4IIEA 4Q4QA 3M5ZA 3QMTA 3ZR6A 1BG9A 1XH0A 4DVOA 4H4IA 2XSAA 1KBLA 1LOSA 4H8NA 2AKMA 4D9PA 3XIMA 1NOUA 2I5GA 5C9ZA 3OZYA 1UP0A 4JHOA 2Y4SA 1FWNA 3B40A 5I6SA 5ABFB 2DJLA 2QW5A 3NZ1A 1TYGA 2QMKA 3CT2A 3BLOA 4HA4A 1OYAA 1X1NA 1MYRA 1SFSA 4BK9A 1NFGA 2EXOA 5CPMA 4PR4A 4DO7A 3W01A 1VIWA 3S8HA 4HCDA 3RCYA 2VC6A 1OG0A 3OBKA 3STPA 4AFYA 1NWTA 3NO1A 1VEOA 1H5YA 4RNFA 3QJAA 1RP9A 5T8GA 2C3ZA 1E6QM 2J7FA 4WR3A 1DJXA 3EOLA 4D8LA 3N6QA 2VFEA 1HQTA 5AC4A 4XD5A 5DFAA 4LBSA 1QCWA 1H7RA 4DWSD 1PXGA 3ERPA 2J9YA 3EGJA 4MWAB 2P50A 3KOWA 1JZ8A 1BFNA 3M0HA 2WNNA 1JCMP 4G1NA 1KFKA 2FZBA 2XWEA 1J93A 1GPWA 4P8WA 3MA8A 3S1GA 2CZVA 3WQCA 4QDPA 2CXEA 5A6LA 3FYYA 4O10A 4AX7A 1GYNA 2WO5A 3MQTA 3SIZA 1SPQA 3K30A 1E9LA 4LAOA 5D2YA 2WSQA 4ATLA 5DCDA 2X1SA 3NAVA 3C2OA 1YDVA 4RDVA 5F2GA 4TX9A 3PWGA 4CD8A 1GNXA 1LCOA 3POCA 4LAUA 5HUPA 5A94A 2INZA 2PCEA 2XIMA 1MFUA 3EB2A 2B4GA 1DQXA 1U30A 1JAKA 1WDRA 5I2UA 1F3WA 3GH5A 3GTIA 2V9DA 3F5KA 4R27A 3LCWA 1EWDA 1JCJA 1EHNA 3ANUA 3FA3A 4Z0JA 3UEQA 1WOAA 1R3WA 1W9XA 2Y1HA 4RNHA 5JH2A 3N2MA 4UMBA 5K9DA 1E0VA 1ZP3A 3VXGA 4PH6A 4AZCA 1R9ZA 2ZICA 4MJZA 2Z1WA 5G2HA 3MS8A 3C2YA 4HHLA 4PUNA 4E3VA 3DFPA 3ARSA 3SW6A 3C6CA 4PTVA 3VNZA 3G18A 3AIRA 3TQVA 4R3UA 1TV3A 3G3MA 1W5OA 3CGTA 5JBEA 4W7WA 5AECA 1CT5A 5BOEA 1TPFA 3B9NA 1F3TA 3RCMA 1PKLA 4MUZA 1OINA 2NUWA 1NELA 4CNUA 1HL8A 4IQDA 1CLXA 4JYEA 3QC0A 4W93A 3WD0A 3D6NA 4J3ZA 3ONCA 2ACSA 1GVIA 1G69A 3G22A 4L9ZA 1JUKA 2GLKA 1UZDA 4Y7EA 4AB4A 4GO9A 1CNVA 1GWJA 3OZMA 2WJDA 1ONRA 1MDLA 3IUIA 3B97A 2H9AA 4N6EA 4UNIA 4HN4A 2WLZA 3FK4A 3VI2A 2HMCA 3WNOA 4LUJA 2R1LA 2QT3A 1O5KA 4ZOCA 1R2SA 3C86A 3ECQA 3BJFA 2OYLA 1RAKA 3PTQA 3U7BA 5C7VA 1C3FA 2IQ0A 3CUGA 1FWAC 5HMFA 1XH1A 1TQXA 4QCFA 2BP1A 3M0XA 3VE9A 1X38A 2XSBA 1XSJA 5E1QA 4LB3A 2QAFA 2FZ9A 4OIFA 2HBXA 1WXYA 1J96A 2BXZA 2W6RA 3MI3A 1TIWA 4LUIA 1UROA 2CZFA 3PPGA 4HU4A 5E5CA 1OGGA 2BGSA 2Y0FA 4E5TA 3L65A 5CBBA 2O56A 1E51A 1RA5A 3ANYA 2V2HA 5CPTA 2QYGA 4GLEA 2PWGA 3HPXA 5K2ZA 4DLMA 3L2LA 1KBIA 3DERA 1QAPA 1FH8A 2FVMA 3I65A 2CLOA 3UFYA 3WH5A 3LERA 3RR1A 4OV9A 4YTUA 3FY1A 4MLJA 4E4UA 3IRDA 1UD4A 3GYCA 1Y65A 4NI3A 4DXKA 3KL3A 5IDIA 3THUA 3RFAA 4XTIA 1SO4A 2PRLA 3NA8A 3CQKA 3KCJA 3FVDA 4O13A 1D3GA 3IJ8A 4LAKA 4FALA 4OBTA 2DV0A 4UTUA 3R2GA 1YDNA 1YPXA 3TX9A 4HCLA 4DF0A 3ICJA 2BVWA 1WCGA 4EACA 5E70A 2YBTA 3VZZA 2H3BA 1V08A 5I02A 4HA3A 4IH3A 1HGYA 1XS2A 3B04A 1D8WA 2WBKA 1I2PA 2WMIB 4M6PA 2PP1A 4ORMA 4ZXOA 5EB8A 1ZHAA 2VCBA 1JDFA 5HANA 2VEPA 4CN1A 4J3UA 3WLQA 4MB5A 1HW6A 4N2YA 5LNWA 4EAYA 4L80A 3ZSSA 1E0UA 5FCZA 4KFOA 1UKQA 2DW7A 5ABHA 2OGJA 2PZ0A 3E2SA 5CJ5A 5BRPA 4GQGA 2YCKX 1XP3A 1JD7A 1TPWA 3DG6A 1EO5A 3MBFA 3PY2A 3TTYA 3VKJA 4GUJA 4NAFB 1DIDA 4FLRA 5DN1A 1GVFA 4YJ5A 3LN3A 3H2FA 4X9YA 3ZVIA 3KFTA 3IVTA 5CSYA 3S2NA 3VOCA 3ARZA 1BVZA 1R3YA 3M47A 2C91A 2OEMA 3GUGA 1L6WA 3H24A 4MYXA 5BXSA 1ZBCA 3NG3A 4AD5A 3UZ5A 4AY7A 3LRLA 2H8XA 3QQ1A 1FP8A 3CT7A 4JFVA 3EA1A 3S2CA 1OC6A 4UCFA 1UD5A 4Q7NA 2J27A 1R85A 9XIAA 1UH2A 1GW1A 3VK5A 4RE4A 1KM4A 4BEQA 4HNCA 1XCFA 1ZUAX 2NX9A 1V0KA 2NLIA 2YBUA 2FHFA 2YZRA 3DU0A 3VD9A 4AHPA 1K6AA 1TO3A 2INEA 4EP8C 1R3TA 1J01A 1UD2A 2WJZA 4YYFA 1GCYA 5EMUA 1JZ3A 1BRLA 4W87A 3IIZA 1C90A 4Z42C 1DE6A 2EO7A 1KRCC 4LALA 4XQ6A 3OU8A 1AJZA 1KBBA 3N2CA 3KRSA 2WCGA 4MUPA 2PZNA 2WWDA 3W7EA 5DT5A 4DBUA 1B4EA 2X1RA 3W27A 1QNRA 7A3HA 1WKEA 2I1OA 5FOOA 2Y24A 2J75A 2VX4A 1D3CA 2VHLA 3W1TA 6TAAA 2OLSA 2YXGA 1F6KA 1YMYA 4Z1CA 5LGXA 3G1FA 1YBQB 1EC7A 1QK2A 4PUJA 4LB4A 3OG2A 1HJSA 1FWDC 3ZFHA 5A6SA 2QJJA 2Y89A 3V0UA 1P6CA 2DDXA 3EX4A 3MMUA 2BZNA 4HJFA 4S3AA 1VF8A 4QHRA 1E6ZA 2POTA 1I1WA 5DMLA 2PDCA 2YIHA 4WEVX 4OKDA 2E1DA 3GRIA 4NRRA 1RVKA 2QS8A 3CLWA 1QI5A 1W3KA 4XSMA 3UCQA 4DQWA 2Q01A 2QIWA 1OD8A 5A8OA 1JZ2A 4AVFA 5PTDA 1E6NA 1LG2A 3FIGA 2D3NA 1UD8A 3DI1A 1XCXA 3M5YA 1AH0A 3VVGA 3FHAA 5FIPA 3P8JA 2Z26A 3BSHA 4JEJA 2QDHA 4IIBA 4JQAA 4FOUA 1EC9A 4O53A 4XAZA 2J9ZA 5D9MA 4GABA 1QO2A 3L5LA 3KTSA 1TPB1 3NOEA 3B05A 4MWAC 4ZSTA 3FGCA 1OIMA 3KWSA 3G2GA 4KCVA 1RUSA 4YTSA 1K3UA 4N02A 1S2UA 3HQPA 1H61A 4PTWA 3VNIA 2X30A 1VH7A 3EWXA 5DXXA 4ZO8A 3CPGA 4GRSA 1G4TA 1I45A 4C5YA 1R9XA 1EF3A 4IQJA 3UPMA 1AVAA 1JYVA 1HNYA 3V18A 1ZFJA 1XYMA 1M1BA 3V35A 3NGFA 5CSUA 3PPFA 3BLFA 1LF1A 3VMPA 1XL9A 3OGRA 3TOPA 4MHBA 2JKAA 2YW4A 4UNKA 1C91A 4DYKA 4YWIA 4UTKA 1HJWA 3VD3A 4DI8A 3RU6A 1GYMA 1BPLB 1R38A 5A6BD 3QMSA 4UUIA 2WVVB 1E55A 1P43A 1AW1A 3KHJA 2YGYA 3GHUA 1POKA 4W7UA 4LUYA 1DIKA 2ODOA 3FSUA 3C8FA 3W9ZA 2VFFA 2XN0A 4HA0A 1JRCA 1VLIA 2WVUA 5D2VA 4ADTA 1OF8A 1MQQA 3T81A 1VBJA 1FH9A 3CH0A 2ZXQA 5KZDA 3WJZA 2ZDRA 5D37A 2FGBA 5A8QA 4JXCA 3FW6A 3MUCA 1M01A 4H7VA 3K8LA 4F2TA 2C19A 3GTNA 2VGBA 4XAPA 5HQEA 1QT1A 2H6RA 4JICA 1IXQA 1UR8A 2PBOA 1X1ZA 3AIWA 2Y8UA 3FLUA 3GS6A 3N04A 4GVFA 1J0ZA 1UA3A 4GZIA 3R8GA 4U3AA 1EPXA 3GIPA 4V15A 4LVBA 1VYSX 4RZ5A 3SGZA 2DZTA 2C16A 4IIHA 3LY0A 3T1GA 2HQAA 2WV8A 4XVDA 1G7VA 2WPBA 4PTMA 2F7FA 1FCVA 2HNEA 4K2SA 2JKPA 5CEWA 1QPKA 1ZU8A 3AHYA 6CGTA 3TH6A 1JPDX 2CC0A 4FF5A 4ZEPA 4BI6A 3TN3A 4K6AA 3GXFA 3M0LA 4ZO7A 2QCEA 3N2TA 1Y5XA 3M41A 1PZ2A 3WJSA 2XIBA 2VGIA 4DJED 3P82A 3QFWA 6REQB 1R2TA 3OVPA 4LPCA 3O3RA 3HU7A 4UC5A 4OZOA 1H09A 2OPJA 5FL0A 1XR2A 3B8IA 4GGBA 3SY5A 1Q6QA 3TWBA 1T7LA 4A22A 4C6MA 1PWLA 4GNKB 2V0TA 3K13A 3W1MA 2QHAA 3NPWA 1G9HA 1VJIA 2PGRA 4DYEA 1W9BM 3QGKC 1AW5A 3WQOA 1R6WA 3BPWA 2XM2A 4U5KA 2XVGA 6XIMA 2PDGA 4AHOA 2DH3A 1OVDA 1X1OA 2Y5JA 3KLKA 4OBSA 1NU5A 2QUNA 4U3CA 5BRQA 5TQLA 3SADA 3RAOA 4AAJA 4IFKA 4M29A 5AFDA 3G6LA 3G77A 4FNQA 1TRDA 3LOTA 2G3JA 3DYMA 2QCFA 2BDQA 2DIKA 2PURA 3NSMA 5I79A 1E73M 1S3HA 5F7UA 3Q58A 2IPJA 2ZUMA 1JCNA 4FOJA 3I3BA 1RVGA 2G3FA 3P74A 4PMDA 3NNTA 3ARRA 4ICCX 3ABSA 2BY1A 1OGSA 3RO6A 4S3CA 2VRJA 2IXVA 1RP8A 4XKMA 4P7LA 1OFBA 3N2XA 4FNPA 1XYAA 3WLNA 1J4EA 3F4WA 4GISA 4A3QA 5CC6A 2GJPA 3PBGA 3AXXA 3DGRA 3CZGA 3LCFA 3DFHA 2J74A 4P7RA 2GQ8A 1F76A 5I3FA 3W85A 2OZTA 1UD6A 5GJNA 1B54A 4YNGA 3U6WA 3RF9A 1EJSC 5J8LA 2WHLA 1DJYA 3OP2A 2NVCA 2J47A 2ZRWA 4E2DA 2BY3A 4L61A 2WMKA 4REQB 3CEUA 3UG5A 1RPKA 1MW2A 2V69A 1CPUA 3N4FA 2QGYA 4DN1A 2V5LA 2VXNA 5FL1A 1L6GA 5U7SA 3VIIA 3LMYA 3QGVA 2OJPA 3FYOA 5KSWA 2GSEA 4AD0A 1GQJA 3R0KA 4FEZA 3GDLA 4QNWA 1RH9A 2Y6ZA 4K37A 3TNBA 3PNZA 3PBMA 3KCOA 1EX5A 1UWSA 1E72M 4ROPA 4LAZA 4PUUA 1EA0A 4B3ZA 3LXAA 2WMJA 2X09A 1V51A 2DP3A 3BAXA 2AAMA 3B8DA 4H19A 4E2OA 3NOYA 2GUYA 5FEPA 4EXAA 3R6IA 4NUWA 3S1XA 1CX9A 3ITXA 2Q02A 1QWGA 2PDMA 4FNRA 1Q13A 3P5ZA 4DXXA 4QG8A 4MSSA 2G50A 1QMLA 1S2TA 3MT1A 4O11A 3EWCA 1E40A 4TU1A 1IZKA 4W85A 1CENA 4BKNA 5FF0A 2VDHA 3WNLA 4KW2A 1M53A 4N0RA 2CLLA 4H8VA 3DC0A 4GYPC 2NVAA 3GC2A 2NT1A 1VPQA 1GG0A 5A8NA 3AALA 3BCJA 2OT1A 4LV4A 1IEQA 4UOQA 4UTFA 1GQLA 2EPHA 3UW6A 3QKEA 1CLKA 1QVBA 3CNYA 3WD1A 1XLMA 1G0CA 3MDWA 4C90A 5I3IA 4RDZA 4MNKA 3BV4A 1JYXA 1TWWA 3Q94A 4G7EA 2Y2WA 4F2BA 2Y7FA