4WJEA

Crystal structure of trichomonas vaginalis triosephosphate isomerase v45a at 1.3 angstroms
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
250
Chain Sequence
RTFFVGGNWKANPKTVQEAEKLVEMLNGAKVEGNVEVVVAAPFAFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEAGFINIVNSNVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Crystal structure of Trichomonas vaginalis triosephosphate isomerase V45A at 1.3 Angstroms
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 86
structure length 250
sequence length 250
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wjeA00
1JCMP 4HSNA 3ATYA 3KRSA 1H7NA 1R47A 3I7SA 4K37A 4M6PA 1WBHA 3IIXA 1OYBA 7TIMA 4DO4A 1TPVA 1GG1A 1QPQA 3PG9A 4ZQCA 2JK2A 1DQWA 1VCVA 4UMCA 1SFLA 4KFPA 3PB0A 5K9DA 1AW2A 5LSMA 3ZS4A 1FDJA 4ICNA 2BWGA 4NJHA 4GUFA 2B0MA 3B8DA 1T8XA 4BI6A 1ZJIA 4UTLA 4MJMA 1DVJA 1EPXA 1DL3A 2H3DA 1XC4A 2A21A 3QMTA 3C56A 4WQ6A 5I3FA 4TO8A 1ALDA 2EF9A 3EXTA 1YTKA 5K7JA 5FF0A 4DO6A 2A7PA 4QJ1A 1LRNA 1J4EA 3FKRA 5DELA 3KRZA 5CSSA 1EP2A 4FEZA 3P8JA 4XUGA 5BMXA 4EVZA 3WK3A 1UB3A 3GR7A 4IJBA 2CLLA 3MHUA 2PC4A 3M6YA 4WJEA 3UPBA 4TMBA 3OVRA 3TR2A 1KV5A 4LVBA 3LCIA 1A5AA 2A5HA 2RDTA 3ZFHA 1V5XA 3U2OA 2ZZ5A 3NM3A 4O4VA 5CGQA 2V9DA 4FNPA 3R89A 3JRKA 1QNVA 4A21A 3L0GA 2QR6A 4TR9A 5LGXA 3KXQA 1SZEA 4LVDA 4MOZA 5CPMA 1XCFA 3C0JA 3WK0A 4N6EA 3HIJA 3W7PA 3VFLA 1RZMA 2CU0A 3B4UA 3IGXA 4NX0A 1LP6A 1XBZA 2QCGA 1UUOA 2YFOA 3G1SA 1SW3A 5EKYA 4O0ZA 3M0ZA 4FNTA 5C54A 5F2LA 5HR6A 4NJJA 3S0CA 3IRDA 3P62A 3I7RA 3UNDA 8TIMA 3PM6A 1W0MA 5HWNA 3H54A 3LDVA 3WJXA 1ZALA 3ATZA 4OV4A 1JUEA 4JTJA 3H55A 3L5MA 5MHBA 2Y70A 3EWYA 3TK7A 1I2NA 2TPSA 1VHCA 5G1YA 4AWTA 2CLHA 1KFJA 5AHLA 3TSDA 2CLIA 5AB3A 3VE7A 2LLEA 3HO8A 3WJWA 1HFBA 1EEPA 2A1YA 1XBXA 1H50A 5K9XA 3TFXA 2W6RA 4DPPA 4GUJA 1K8YA 1WQ5A 2QKFA 1GZGA 1H7OA 4Z1BA 2G5WA 3PBUA 3UZJA 1TTIA 1XBVA 4O0KA 2WO5A 1LTDA 1VS1A 4EWND 1ZNNA 3P82A 1TIMA 4UTHA 1YADA 3CWNA 3T4CA 1N8FA 1OYAA 3EKLA 4UR8A 1F76A 2QUTA 5FEZA 5F4SA 4EIVA 3NZ1A 6ALDA 1RPXA 2V82A 1FXQA 3GVGA 2YCEA 3MP5A 4R7JA 1LCOA 4YCPA 3BG9A 3EWWA 3C2OA 3IGUA 1ZHAA 3LCHA 3N2XA 3HG4A 3BG3A 1P0NA 3N14A 5TBOA 1JQVA 2C3ZA 1G69A 1X8FA 2OZ0A 3BPWA 2X1RA 1GVQA 4UTTA 1YXDA 4JGDA 1OK6A 4GUGA 1FWWA 4S2BA 4PC8A 4N02A 4CNNA 3D0CA 3I68A 5CPNA 4LNYA 1YPIA 4UTWC 4EF8A 3STGA 1KTBA 2WSRA 1TQJA 4WOQA 1LDCA 3CQ0A 4JS3A 3KHJA 4QNEA 2FPYA 3KX6A 2G97A 1BKSA 3W7GA 3S1XA 1W5QA 4UMBA 3TXZA 2A0NA 2XN2A 3C6CA 3P5ZA 4NXSA 4QAIA 5D2WA 1TMHA 4O54A 4DEFA 1TPB1 4UFKA 2Q3RA 4RZ5A 5D02A 2WPBA 3R5EA 5I3JA 4LOCA 2PRHA 4U28A 3K30A 3LHZA 4BWLC 3HPZA 3IIPA 4GE8A 2J88A 4JYDA 3P67A 5LZLA 4E38A 1W3IA 2NX9A 3MWAA 1K03A 2ISWA 4UNKA 1WA3A 3LLFA 1V7YA 4JTTA 4QISA 3U6WA 4QITA 3GYEA 2CZ5A 4JTSA 2E6FA 1L6YA 1D9EA 5HJLA 4L4MA 3O6YX 1KBJA 2I14A 2NV1A 3MHFA 1FXPA 2V0TA 1OJXA 3PBYA 4FIRA 1SQ7A 1FWTA 5HNRA 4HKPA 1O5KA 3FKKA 3RMJA 3W7DA 4NNBA 4JIQA 2FDSA 5DCBA 1VYPX 3DI0A 2J9XA 2WQPA 3LCLA 4BI5A 3EX3A 3R12A 1K3UA 5D38A 1UUMA 3NL2A 1EWEA 5GVJA 3BLIA 3W7LA 2O7SA 2E09A 5K9CA 2F7FA 3SY5A 5G2HA 4PTNA 1TO3A 3KRUA 1WOBA 4HIBA 3KFTA 2E6AA 5G4EA 2C15A 1LM1A 4PL1A 5D03A 3ABRA 3CEUA 3NZRA 4K6AA 1GVSA 5F4XA 2WSQA 1CI1A 3A22A 1PHQA 1FUYA 4IMGA 1HTIA 3LCXA 3M16A 1X6UA 3NM1A 1LBFA 4N4QA 5HR7A 5G2IA 5AHIA 4CCDA 1EX5A 2NUXA 3NQVA 5LNSA 1DOSA 3LXAA 2DZUA 3WK1A 4JTKA 2CLMA 1JUKA 1JULA 1VH7A 2E77A 4Y6GA 4JTHA 5EA9A 1NAL1 2X2GA 5DY2A 3DBPA 3KVMA 5EBUA 4AF0B 1EB3A 2PURA 2YYTA 4HHPA 4PH6A 3G1XA 3GKAA 3W7HA 4JTUA 3DH7A 5TIMA 2JGQA 5EMUA 1AL8A 1K8XA 3VKJA 3OG3A 3L0NA 3HGOA 4ZVJA 3IIOA 2C19A 2V2HA 3G8RA 4XBSA 3MHGA 3TSMA 3UQNA 1JCXA 3M5VA 4M6VA 4O50A 1L6SA 2DJLA 2X1TA 3O8AA 4UFJA 3TV8A 3F4WA 5EL1A 1TPWA 4JX4A 3KVKA 1G7VA 3LXBA 1QMLA 2A85A 5A8GA 1OVDA 2NZLA 3GB6A 3IVSA 4W9TA 5HUPA 1GTEA 1W8SA 3W86A 3W1XA 3MYOA 3FFSA 4LWWA 3G24A 4JDYA 4NQ1A 4K7YA 1U83A 4AF0A 4O57A 2ZZ3A 1ZAJA 2TSYA 2GPTA 5K3VA 1QOPA 3M47A 5DY3A 1GJPA 1VHNA 2C1HA 1KLZA 3S8HA 1T99A 3L5LA 1KFCA 2E5CA 3DFQA 1K7FA 2CZDA 1W31A 4BFAA 4AB4A 4OWGA 3IEBA 5BMWA 4XTIA 5LHEA 3M9YA 2Y7FA 3CPRA 1NFBA 5KZMA 4UFHA 4AHPA 2QUUA 2J24A 3C3NA 1A5CA 5K4ZA 3A5FA 3I65A 5FI8A 1S5TA 2J27A 3KAOA 1PCWA 4CCEA 1UCWA 1KM0A 1W5MA 3O15A 1XBYA 1ADOA 3G3MA 4OHQA 1A5SA 5CPOA 3SGUA 3WJYA 4NJKA 2GQ8A 3NQMA 3PUEA 1H1ZA 2QJGA 4NJGA 3S42A 1RQBA 5AC7A 2UV8G 3GNDA 1XI3A 3P84A 3W2KA 1A5BA 4Y96A 3W84A 3NQEA 3W07A 3EXSA 2DZSA 2JKEA 4Z0SA 5AHNA 5AC8A 2GJLA 3Q58A 2Y85A 1VR6A 1N55A 1HG3A 1JCLA 3FS2A 1YDVA 3E12A 4Z0JA 2P1FA 1VYSX 1LORA 1H60A 1TTQA 3QZEA 2VEKA 1JRCA 3I6RA 5G2WA 1W56A 4U4MA 4JX6A 3BLEA 1SZNA 5DXXA 2OJPA 4O16A 3GDRA 4LV9A 3STFA 1GVFA 5K4XA 2Y61A 4TIMA 3UWWA 1I8JA 3TE9A 3NR0A 2EPHA 1SZGA 2QDGA 3OIXA 2C18A 4I7UA 2QJIA 3MBFA 3LX9A 1EWDA 4RZ6A 4TU1A 5U7SA 1OX4A 1B3OA 3PSWA 4O17A 3NO5A 4X2RA 3B05A 1E51A 1TPEA 4JIPA 1LBMA 3FLUA 2HS8A 4HNUA 2J9YA 1R46A 1YTEA 3SJ3A 4AXKA 2XN0A 3S5OA 3F1QA 4PA8A 3NVTA 4LRTA 5FF2A 3W23A 3R13A 5AYXA 5HULA 2DZVA 4HNVA 2CLKA 3TMLA 1H7XA 1ME7A 3UWUA 1EUAA 1TSIA 4M7TA 3N19B 3C52A 3PAJA 5D30A 3VI2A 3PBVA 4TX9A 3QEZA 4AHQA 3NQ2A 3W7NA 4JNMA 3WJSA 5C6MA 3QW3A 2ZRVA 1CX9A 2R91A 1O94A 3UPWA 3E49A 3M1ZA 3UY7A 1G4PA 1Q6RA 3G22A 1PL9A 5AYYA 4A22A 3NA8A 1O5XA 1AW5A 4CQ9A 3PWAA 2B7NA 3C8FA 1VZWA 2WV8A 1KM6A 4YWIA 3GR8A 4ZQNA 1IXQA 4O8RA 3LHTA 2ZTKA 4FXRA 1H7WA 3TROA 5AN7A 5CZJA 3W2UA 3IVTA 5C55A 2ZQ0A 1TYGA 3O05A 2HTMA 1GWJA 1TV7A 1KFBA 4KFOA 1HL2A 1SU5A 1VGAA 1ZY9A 4BR1A 3L65A 1G6CA 1W5PA 3M5XA 5HWJA 4UMAA 3W2NA 2RKXA 3UD6A 5FEPA 1G4EA 4LC8A 3GIYA 3E0IA 5HQEA 5AOUA 2V5LA 3EEGA 2ZZ7A 1YYAA 3G1HA 1JJKA 3CB8A 3GAKA 3DFOA 3W22A 3MBDA 5LGZA 3IGSA 2Q8ZA 1FWRA 4FNRA 2WOQA 3W70A 4A2RA 4UTUA 2PE4A 1H63A 2YYUA 1KM4A 3DKJA 2DJXA 3QYQA 4LS0A 2ZRWA 2Y62A 3QMSA 1SW7A 3VE9A 1LLWA 3UWZA 3GDTA 1TPFA 4IMCA 4ZZ9A 4RXFA 2ZZ4A 3W85A 3Q2DA 1X1ZA 4G1KA 4M7SA 3QC3A 1AG1O 3NL6A 3BLFA 1F73A 4AHOA 3O16A 2WNQA 4GWEA 4FNSA 3HG2A 4UTWA 1IXOA 4CQ8A 4LUJA 2Y7GA 5DBTA 2NV2A 2IQTA 3DFSA 4RXGA 2ZTJA 1Q3NA 1FDZA 4P2VA 4GC4A 1RV8A 1P0KA 3P5YA 5DXYA 3WJZA 1I4NA 5AHEA 4QIUA 3S1VA 3TW6A 2VFDA 4XZ9A 1VCFA 5G4WA 5BRBA 2DU2A 4DPQA 3W74A 3L2IA 5LNWA 4WXZA 3R8RA 4BWLA 3N3MA 1GQNA 3TFCA 1TTJA 1LLZA 2AGKA 3MJYA 1GOXA 1VLIA 1KM1A 5J5DA 1JQXA 3IV3A 4IOTA 1TRIA 1Z41A 3ZWSA 1GG0A 1YLVA 2VXNA 3G0UA 4JD4A 5KTLA 1OHLA 1GEQA 3UXAA 5L6UA 3RFAA 1F7BA 3TU9A 4AWUA 3QW4B 3HPSA 4O19A 4MY1A 1I2RA 4ORIA 1W54A 2OMAA 4LW7A 4OGZA 1Z44A 3KOFA 5D32A 2A7NA 3G1DA 4O1CA 1LYXA 3LLDA 1J5TA 4MZYA 3E02A 3LI1A 1AK5A 5I3HA 3EX1A 4DXVA 1IXNA 1OX5A 1DHPA 4IPIA 1TREA 1H1YA 3CTLA 4O12A 1WDWA 4H6KA 3DFPA 2NXHA 3GKFA 1RQHA 3W2LA 3LTYA 3HBLA 3LOTA 1QPRA 1VJIA 4N9EA 5F4WA 1XXXA 4YCOA 2J6XA 3W1MA 2C0AA 1ICPA 4POCA 1I2OA 1DQXA 2H8XA 1IIHA 2GQ9A 5AC6A 1B9BA 3GDMA 5HWMA 1HO1A 3W7EA 4DBEA 4YXGA 4EOUA 1TRDA 5FESA 3O07A 3BW4A 4UR7A 5DLCA 4MFEA 1TJRA 3A23A 1QWGA 1KFEA 4ADTA 3TQVA 3LV5A 3HPXA 2QJHA 2DP3A 1BTMA 1TQXA 2FLIA 1AW1A 3NQ6A 4FX8A 4MLRA 2XN1A 3P61A 3W7RA 4NU7A 1W37A 5BOOA 4WY0B 3C4UA 1G4TA 1W3NA 3T40A 2GJNA 2NX1A 4HN4A 3NQ7A 4IUOA 1KM3A 4UNLA 2CZFA 1MO0A 4XKYB 1TPDA 1I2PA 1KLYA 4BF9A 1MZHA 1Q45A 3MUXA 2ZZ1A 5G5IA 5CG7A 3LTSA 2Y6ZA 3MP4A 1PHWA 2A6LA 1TCDA 3P7YA 3W7CA 2ATSA 2PRLA 4GUHA 1TTPA 2OX1A 3AJXA 3B03A 2A2IA 3MYPA 4IXHA 4WXYA 5CSRA 3QM3A 4LV4A 3LHUA 5EYWA 4MY9A 3W1NA 3Q94A 4XTDA 1Q6QA 1R2RA 4NXKA 2X1SA 4FNUA 3FA5A 2BXVA 3HMJG 1OFDA 4MYXA 4XKYA 3KVJA 3UWQA 4ZQMA 1VLWA 3DXIA 4M19A 4HT3A 3HF3A 5A5WA 1OX6A 5F1UA 2QCCA 1PS9A 3SR7A 3PS7A 1HUVA 2NXGA 3PULA 1TPH1 3NQAA 5CZSA 1D3GA 2V8ZA 4IX0A 3W72A 1I45A 4MKNA 3TW7A 3Q37A 4JDBA 2I9EA 4R33A 4JR5A 4FX7A 3W7JA 1M5WA 2CFFA 3DGRA 1XDMA 4NUWA 3TJLA 3PUOA 3EWUA 4N2YA 3W88A 5KINA 3T55A 3HB9A 3PC0A 1NSJA 3O6CA 2OT0A 4K8EA 2WJZA 3ELFA 3G3DA 3NYZA 1A53A 5DCDA 3ABOA 3W75A 3W6YA 4O28A 5EPDA 1GPWA 2C13A 4C1LA 1LROA 1LRTA 1RR2A 4QQ3A 1G67A 3PUDA 1WV2A 2QCNA 4ZQRA 3TAKA 3TAOA 1WYIA 4ML9A 4Y8FA 1KFKA 4N9CA 1DBTA 1O4UA 4H3DA 3DI1A 2H8ZA 1GVRA 2JBMA 4WZHA 3RU6A 4WD0A 1YPFA 4UC5A 1QCWA 3STEA 4I7VA 1QFEA 1P4CA 3NXFA 3TQ0A 3G1YA 1X1OA 4OQVA 3NL5A 6TIMA 1H7RA 5D04C 4QSHA 2V5BA 3W1TA 3W2JA 3B0UX 4QNWA 2G96A 2QCDB 4NX5A 1A50A 1UASA 4MFDA 4CNOA 4KWVA 5TQLA 4IX2A 2ZRZA 3EX4A 3B0VC 3A21A 3SI9A 3B04A 3KVLA 4IPJA 2OCZA 5F2IA 2D73A 2WNNA 3TXVA 4E0CA 4DF1A 1SO5A 1TPUA 4NNCA 3SFKA 2FQIA 5D2YA 3V75A 3LCFA 1N7KA 2E68A 2Z1BA 3ZWTA 1B4KA 2NX3A 3HQ1A 1GTHA 4R53A 1DORA 5I3GA 2DZTA 5E93A 3LBCA 3DENA 4RZ4A 2GVGA 2ZA1A 3NNTA 2JKAA 3MP3A 1OFBA 4NVTA 4Z1DA 4JXCA 3OBKA 2NXIA 2OT1A 4LS1A 2YX0A 1ZFJA 3OVQA 2B7OA 2ALDA 1DJNA 2I1OA 1FCUA 3GZ3A 1THFD 3GXPA 1YXYA 3NPVA 2CLEA 2HSAA 2P0OA 5CPLA 3STCA 4OBTA 3N2MA 1SO3A 3BW3A 3TSBA 1PCKA 3LGEA 3UXDA 3PVFA 4RK8A 3NAVA 5E1QA 2QCHA 3HGJA 4HNTA 3LV6A 2ZCGA 2F84A 3L66A 4AWSA 1IXPA 1OFAA 1EUNA 2CWNA 1M7PA 4K8HA 3GXTA 2XFWA 5DCEA 3EB2A 3TA6A 3FEMA 4O52A 3DFTA 4O18A 4MPQA 4DF0A 4TMCA 3NDOA 4UTKA 1FQ0A 4DQWA 4AVFA 3LRLA 1M6JA 2E5BA 3RLUA 1Q6OA 2ZA3A 3L9CA 4X22A 3OHIA 4JYEA 2BLEA 4C1KA 4RV8A 2A6NA 2DORA 2H6RA 1JCYA 3WFAA 1ZCOA 4ADSA 3LTPA 3O63A 3FIGA 5H2ZA 4DELA 4O13A 1F6KA 2VOMA 4UUIA 2BTMA 3LCGA 1PE1A 3S1UA 4LUIA 3SZ8A 3RNDA 3L0KA 5IBXC 4N6FA 2CLFA 2BSLA 3QRHA 3N9RA 1S5WA 3P60A 1QO5A 1SFJA 3QQ1A 5CZTA 4FB7A 3MW7A 3M43A 4FIQA 4A3UA 1WBJA 1F2JA 3NEVA 4M5PA 4JTLA 2E6DA 3LB0A 3L67A 3PG8A 2YPIA 1EIXA 3CEPA 4YL2A 3L21A 3S5ZA 3WK2A 2R94A 4NZFA 4EF9A 3L5AA 3G0SA 1JR1A 3QJAA 1TV5A 1G4SA 3W76A 1OFQA 3HG5A 2QAPA 4LS2A 3LM7A 2VEMA 3G8EA 4ALDA 3N9SA 2Z6IA 3EKZA 2BZNA 1XKYA 4OE7A 3NQCA 2TRSA 3P81A 4DO5A 2E6YA 5HUOA 3B06A 1ONRA 2Z0IA 3M41A 4UCGA 1SUXA 1H5YA 1YDNA 5FF4A 2NUYA 3TJXA 1YTDA 1S3HA 3CM4A 5FEXA 3W7QA 1KM2A 1YDOA 2RHGA 1B57A 3THAA 1K02A 4NNAA 4AAJA 4IXXA 1OFOA 4KWWA 1QOQA 4OV9A 1W3TA 3T7VA 1IF2A 2VFFA 4B5NA 3EXRA 2WSYA 3CT7A 4UIOA 5ABTA 3A9IA 5LNUA 1H7PA 3TDFA 2EGZA 2VEIA 2FPVA 3S1WA 3W7MA 4ZL1A 1MEIA 1JCJA 2JGYA 1DKWA 2DZXA 1MEHA 1UBSA 3GDKA 4Y90A 1GYNA 3OEXA 3IIVA 1XDLA 3DHFA 4X9SA 2E5DA 2TYSA 4UFMA 2GVLA 3UY8A 5LHFA 4IMDA 5FF3A 5CKSA 3BK0A 1OF6A 1TB3A 1FDYA 3ZR4A 5L9FA 3W1LA 3HG3A 3NQGA 1OFRA 5LNVA 4ADUA 1NF7A 2YSWA 1U5JA 1F6PA 4O15A 4GXMA 3SW6A 2QCEA 4GNJA 3LBMA 3PF3A 1EP3A 1FCQA 3NPXA 4OT7A 3IVUA 2RH9A 3W1PA 3CLMA 4PEKA 1FWNA 3RF9A 3MI3A 2B7PA 4A29A 3C2EA 3NOEA 1ZAHA 3NQDA 1ICSA 3CU2A 1SR9A 1ML1A 1WX0A 3GLCA 2B4GA 2R14A 4FX6M 1JUBA 3QH2A 3W1RA 2NWSA 5D37A 1Z48A 4GUIA 4I7WA 4RX0A 4MUZA 4LU0A 2ZRUA 1PV8A 2ABAA 3G1FA 3QFEA 3CHVA 2GVJA 2YW3A 2QEZA 2GUUA 4JX5A 2RDUA 4WOZA 4HPXA 4Q33A 1XUZA 1KV8A 4XBKA 1Y0EA 3GX9A 2H3BA 2QAFA 4IMEA 1VQTA 3DZ1A 2CLOA 1KA9F 4UTMA 3H53A 1WAUA 3HJZA 1LBLA 5KZDA 3HGSA 3DKLA 3DFNA 1GYLA 5C5YA 4P61A 3RLVA 3S5NA 3BV4A 3W73A 5D05A 3LRKA 3MO7A 3NL3A 3UWYA 1ME9A 3UYCA 1XUUA 1TJPA 2ZBTA 5LNRA 4O1BA 2NUWA 1XM3A 3M5ZA 2QF7A 3SGZA 3SECA 5BW6A 2VELA 5I3KA 4E2BA 2NWRA 4UXDA 3ANYA 1PIIA 4GRSA 4CLMA 5D2VA 3TH6A 4NT0A 3W87A 4JN6A 5AHFA 2EHHA 1W1ZA 3DU0A 4E2DA 2C16A 2C6QA 4N9BA 3NPWA 4LRSA 5D2TA 2VFHA 1F74A 4FXSA 5EY5A 2FJKA 3BO9A 1OABA 3W7IA 3BARA 3EWZA 1OYCA 3BW2A 5J5RA 2G95A 3IIZA 2X16A 2V2DA 2FFCA 3W7OA 3C2RA 1WXJA 4J9JA 3LERA 3PB2A 5KZEA 3T78A 2ISSA 2FIQA 2QCLA 3R2GA 2AQWA 5G1TA 3VCRA 1M7OA 4WY0F 1FX6A 1ZAIA 1PVNA 2FB3A 3ABSA 1DJQA 4AH7A 2Q8LA 5D33A 2CW6A 2ISVA 1QO2A 1JCNA 1J2WA 3TUUA 4HSOA 3UZ5A 3TQKA 5D09A 3AO0A 3TCEA 3P74A 3VNDA 1SSGA 1LRQA 1MXSA 4IQLA 4RLIA 2ZFAA 1ZENA 4UFLA 1K7EA 2Q3OA 1LOQA 1R2TA 1MEWA 3NQ8A 4GJ1A 1T0OA 2E1DA 1KW1A 1TPC1 3P8IA 4MZ8A 4ZQOA 1O95A 3A24A 4A2SA 4S1FA 4LTSA 3PY2A 3N73A 4K7VA 3T44A 4WY0A 4ONVA 3BVJA 1JRBA 2FTPA 4WX2A 1FY6A 1IGSA 3DHDA 1NVMA 3QPZA 3BG5A 3F4NA 4O10A 2ATMA 2DZWA 4ZMGA 2QUVA 1L2UA 3SSJA 2VFIA 4FF7A 3M44A 2H90A 1QPOA 1X7FA 1K7XA 4MLJA 3TNOA 1EP1A 4HNNA 4YMZA 1SPQA 3GDLA 3LI0A 2W79A 4PCFA 1MSSA 1KBIA 1C8VA 3TX9A 3B0PA 1RQEA 3QMRA 5K2ZA 3BGGA 4JTEA 2ZRYA 3QSTA 1VRDA 3GK0A 3EX2A 3W1AA 1NEYA 1VPXA 4QM1A 4CCCA 1G7UA 1UJPA 1FCVA 3CIWA 4FHAA 3G1AA 4GFSA 5I3IA 1RD5A 1OG0A 4X3ZA 2X1UA 1TV8A 2HMCA 5SWUA 1VCGA 4LC6A 1R30A 3MMTA 4KFNA 1DV7A 1BWLA 2VEPA 5FEWA 3RK8A 5KMYA 3JR2A 3JS3A 3ABQA 4RKAA 2ZZ2A 3C61A 4O53A 2YXGA 1RVGA 2V2CA 2J9ZA 1Z42A 4XWUA 2Z2UA 1I2QA 3FOKA 2GQAA 3G1VA 4JICA 3USBA 3C2VA 4I9AA 4N4PA 1FBAA 3S6DA 4D2JA 4CNPA 2ZDRA 1K8ZA 3A5VA 2VFEA 1KFLA 4UTTC 3NQFA 4LVGA 1BWKA 3W9ZA 3NGJA 3NPUA 5IBXA 3M5YA 3QQ0A 2YW4A 4ZQPA 2CZEA 2V81A 3PSVA 3GNNA 5H91A 1VC4A 3LCWA 3N34A 2V30A 2WKJA 4Z08A 5HINA 3O6DA 5AYZA 1O60A 3GXNA 3W2MA 3EX6A 1LOLA 4GBUA 2ZYFA 2HS6A 2R8WA 3GAYA 3S9YA 2JKPA 3W71A 4K39A 3UWVA 3W1UA 3THQA 4PL2A 5HMSA 3L68A 3CWOX 4LY8A 4R34A 1W5NA 2VKZG 1S5VA 2QCDA 3TC6A 3W83A 1EA0A 2BX7A 3TC7A 4WUIA 1OFPA 3QPYA 2ZA2A 1L6WA 1F5ZA 1H51A 1SO4A 3S5YA 5C2XA 5IM51 2Z6JA 4OU1A 3DAQA 5BNKA 2ZZ6A 2W0UA 4BK9A 3INPA 3W3OA 4IGHA 4JTGA 4BI7A 4L4LA 2KZHA 4NJIA 2ZRXA 1B4EA 1AL7A 3O1NA 1HO4A 1QPNA 2ABBA 3HOJA 4JTFA 4K36A 1LOSA 4RJEA 1QR7A 2YGYA 2Y7EA 3LRMA 5F1VA 5DBUA 2Y7DA 5LKYA 4AEOA 4MYAA 3W1QA 1CW2A 4M6QA 1L9WA 3MI2A 4DF2A 2VENA 3CIXA 3G18A 4NZJA 3LHWA 2O7QA 2DZPA 3E96A 1T96A 1OFEA 1P1XA 2Y63A 3TMQA 1AMKA 5T26A 1P5BA 1OX4B 2TMDA 3FJLA 3LHVA 4MY8A 1SZFA 2X30A 3LHYA 1BEUA 2Y89A 2YR1A 1OF8A 2QDHA 4LVFA 3O06A 5AFDA 1ME8A 3FYPA 3EWBX 2QCFA 3F03K 4O14A 4UTJA 1SO6A 3SIZA 2YZRA 4AMAA 4Z1AA 1QAPA 3V1PA 5AHMA 3I7QA 3QSRA 1C9DA 3FJ6A 4FO4A 4MJZA 1KTNA 4MVAA 4JYFA 2P10A 4N9DA 4JY8A 2WNZA 5D2XA 2EKCA 4JEQA 1XFBA 4UFIA 1VYRA 4Y9AA 1ICQA 5F2GA 4HPJA 4RCXA 1KM5A 4JY9A 1Q6LA 4LVAA 2PCQA 4RR4A 3LXCA 2RFGA 1XL9A 1OK4A 4O11A 4S2CA 3W7KA 1JVNA 4O1AA 3CC1A 1GVOA 4PFMA 4MIMA 5U4NA 1IIGA 1SW0A 2B7QA 5F2MA 2GOUA 3YPIA 4DBDA 4YLWA 4IMFA 1WOAA 2VFGA 4CQAA 4H4IA 2RDWA 1QDSA 2FPTA 5FF7A 4XQ6A 3PR2A 4UTIA 2VC6A 1H61A 5DN1A 3EWXA 3QF0A 5CZ0A 3MI6A 4MZ1A 4K38A 2FB2A 1FWSA 3NG3A 1GT8A 3OVPA 4ORMA 1F05A 3G0XA 1NF0A 4O1DA 2PRMA 1H62A 2Y88A 3TKFA 4O4WA 3HGRA 3FYOA 2C14A 5E0KA 4PODA 2YDAA 5KITA 1LZOA 3OA3A 3E9AA 2QCMA 2A4AA 4KKXA 4Q32A 4IWWA 2AAMA 1C29A 3PBWA 2YFNA 4JTIA 1D3HA 4Q4KA 3P80A 2EAWA 3U8GA 3TIMA 2NLIA 3BGJA 4Z1CA 3C2FA 2A7RA 1W5OA 1KTCA 5KSWA 1YXCA 1FCBA 1SSDA 4LT9A 3M7WA 4FNQA 1R2SA
chains in the Genus database with same CATH superfamily
1WUFA 3ITXA 2QPSA 4HSNA 3KRSA 4L56A 3IIXA 4IG2B 1OYBA 2VVSA 3WDRA 1PZ2A 4DO4A 1H2JA 3R0UA 5LSMA 3ARSA 3ZXWA 4JNZA 3VMOA 3BGAA 4ICNA 2B0MA 3B8DA 1E6XM 2HROA 4MJMA 1EPXA 1RD6A 4YS1A 3PK7A 5CQ1A 4PRTA 3QMTA 3C56A 1BXCA 1U2YA 5I3FA 2WMFA 1ALDA 1FH9A 3N18A 3DYOA 2A3LA 3K5XA 2PB1A 3MA8A 4U3AA 3A9BA 3WMLA 1E5JA 3UVIA 3EOUA 3CUFA 5BMXA 4EVZA 3GR7A 1J8VA 2X0SA 3M6YA 1BG4A 3UPBA 2QDEA 4MB3A 4ACYA 3CNYA 2NQZA 3TR2A 2VD8A 5ENLA 4G6CA 4AZCB 3MY9A 1TX0A 2UY4A 3U2OA 4O4VA 4YTUA 1DHKA 3ZJ7A 1QNVA 1F9CA 2QR6A 2WMGA 3KOZA 4TR9A 4ATWA 4N6EA 2ZICA 4QG6A 1UWUA 2CU0A 3GUWA 2QCGA 2BB0A 3G1SA 5EKYA 4O0ZA 2CBVA 3U7VA 5C54A 3BQ6A 4I90A 1QUMA 4Q4SA 5HR6A 4IHCA 3S0CA 1HJVA 2X40A 3IUDA 2WJDA 3CUJA 3RRAA 2QXWA 3KM8A 5HWNA 2Q02A 1TFVA 2HXTA 3H54A 1AH4A 1O12A 2IW0A 1HW6A 2Z25A 2QF8A 4H8HA 1PDZA 3AMLA 1VHCA 2X7VA 3ARZA 4F48A 3TSDA 4GJJA 3WJWA 1EEPA 1ADDA 3FGCA 4UZSA 5FA5A 4KQNA 4H9MA 1DTUA 1WQ5A 1GZGA 1H7OA 1EDGA 4H00A 4H41A 2OO6A 3POHA 1JCTA 1XBVA 5E6ZA 5CZKA 4ZB5A 1LTDA 1ZNNA 3EWDA 1TIMA 3P82A 1YADA 1EXBA 3ONCA 4EPKA 3SRFA 4UR8A 2C79A 3FNDA 5I7GA 5F4SA 4EIVA 3H23A 1RPXA 1CCWB 3TWAA 4JL1A 3F2CA 1X98A 1FWIC 2YCEA 3MP5A 1P48A 1ISXA 1ZS2A 4YCPA 3BG9A 1F6YA 4KBXA 3BOLA 1ZHAA 3LMYA 4XVEA 3LCHA 1NIUA 2JIEA 1GGOA 3BG3A 4WR3A 1D8WA 1S38A 5TAOA 4FXFA 2FZ9A 8CGTA 2PA6A 1BGGA 3WQCA 3BPWA 3WQFA 3BV7A 4D71A 2HVMA 1Q13A 4GUGA 2Z7GA 4V33A 4DYKA 1GYMA 4F4RA 3AAMA 3I68A 3T0TA 1E15A 3LBOA 3PZUA 4PRRA 4UTWC 4EF8A 3QC0A 3ALFA 4DJED 1KTBA 4L6DA 3M46A 4GH1A 4DJDC 1NM9A 5BWFA 1K9DA 3IJ8A 1V0KA 1C7SA 1U22A 3W7GA 1OZMA 4UMBA 1ADSA 3P5ZA 4E4PA 4O54A 4JFTA 3ZJKA 3FEQA 5I3JA 4JPGA 2OX4A 1BQGA 2PRHA 3TN4A 3EPOA 5HPCA 1BYDA 3LHZA 2G3FA 4AQLA 4E5TA 1S2UA 4JYDA 1ZSXA 2Q8XA 1W3IA 3SAZA 3E3HA 3OLIA 3ORWA 1V7YA 2VZSA 1OCNA 1P43A 1KD0A 3VGEA 5HJLA 2AL2A 4NZ3A 1Q7QA 5HJXA 3O6YX 1KBJA 4B3KA 4GMEA 2E67A 1JIBA 3AU6A 4M82A 1UIPA 4PTMA 4FIRA 5HNRA 4ACZB 2ESCA 3W0KA 5DX7A 1YNYA 3FKKA 3W7DA 1UWIA 2DGAA 3PWIA 5BRPA 3KCOA 3CUZA 4NSBA 4B92A 5D38A 1W9DM 2FH6A 5K9CA 5BCAA 2F7FA 2FHCA 4CD5A 4IISA 4Y9NA 5G2HA 4TX6A 2VX7A 3VD9A 2XSBA 1J96A 1RH9A 4GCAA 3TOYA 1O6IA 1GNXA 2I5QA 2ZWZA 3NOYA 1CI1A 2H9AA 3FJNA 1PHQA 4N4QA 1X6UA 1LBFA 4QE1A 3WLNA 2GUYA 1EX5A 1EA9C 5LNSA 3LXAA 2PWDA 2QULA 4S23A 3VOJA 3ZSSA 2CLMA 1JUKA 1Z9AA 2YKKA 3DBPA 4DJFA 3U48A 2IKGA 4PH6A 3LUTA 5FD0A 5TIMA 3VDGA 3LS9A 4C6OA 4GISA 3N4EA 1JPKA 3L4XA 3G8RA 4HK5A 4D6JA 2PDNA 1JCXA 1A5MC 3M5VA 4M6VA 3VTRA 4O50A 1L6SA 2X1TA 5CG0A 1TPWA 2DVTA 4JX4A 3KVKA 1G7VA 3VZZA 1QMLA 5A8GA 2NZLA 3GB6A 1JD7A 2OYLA 3WH9A 1W8SA 3MYOA 2WVVB 3JZEA 4LWWA 5BROA 4JDYA 4B5TA 3HMCA 1U83A 1ITQA 3CV2A 1ZAJA 1FH7A 2WMIB 1TZZA 4F2TA 4C1NA 4DZIA 1LF1A 1KRBC 4UR9A 3L5LA 1R0MA 2WZTA 2NV9A 4M51A 4R9OA 4XO6A 1A0EA 4B3ZA 5LHEA 3M9YA 2Y7FA 2EG8A 1V79A 3WNOA 5DMYA 4AHPA 2J24A 2W66A 5FI8A 3RN6A 4HD5A 3SUTA 4BQ5A 1GOMA 1UCWA 4WRHA 4KCUA 2PWHA 3CZJA 1XBYA 3SGUA 4NJKA 1XHGA 5H8UA 1H1ZA 3S42A 4BHYA 2E9MA 1XISA 3GNDA 1E1CB 4MADA 3W84A 3W07A 3A4XA 3EXSA 4S3EA 3JUGA 7ODCA 4Z0SA 5AC8A 1VR6A 3T07A 5ABFB 3E12A 4Z0JA 1QBBA 1VYSX 3QZEA 1US3A 4EPDC 4O0QA 4IGSA 4JX6A 3R25A 3WD2A 5DXXA 1EYWA 3BAKA 2ZUNA 1CXEA 5HMEA 3O0FA 3MUZ1 3VIHA 4MKVA 3MUAA 4HTBA 4LV9A 4Q8UA 1GVFA 3BURA 2Y61A 1C91A 3KP0A 3OU8A 3TE9A 2EPHA 3OIXA 3WQWA 1QHPA 3DYMA 2PWVA 1EWDA 4XISA 4LCRA 3PZOA 4YTRA 5AC5A 2I5GA 2PWFA 1F4HA 2EG7A 2HS8A 4GK8A 4HNUA 2UWFA 1YTEA 1AQFA 4AXKA 1QNQA 2XN0A 3S5OA 1WB0A 4C6NA 2HXUA 2Z24A 3NVTA 4LRTA 4GVIA 2XSAA 4ROQA 2OZ8A 5FF2A 4C7FA 4LF2A 5EU9A 4J40A 5HULA 2FZ8A 3HQOA 1U5HA 2PGFA 5JBDA 2CLKA 1H7XA 1ME7A 1V3JA 5DMNA 3WEZA 4NYYA 4Y9OA 4YPJA 3C52A 1XRSA 5TD4A 3VI2A 4U31A 5TNVA 1X6LA 3P2VA 4X0VA 4AHQA 2V5CA 3PFRA 3QW3A 1CX9A 5I79A 2WBGA 2R91A 5CH9A 1TVLA 3M1ZA 4MNLA 1JGMA 3PTQA 1Q6RA 2QV4A 1X38A 4G2DA 3EA1A 3C8FA 4X61A 4HCLA 4RW3A 5A95A 4FXRA 2BGQA 1XCXA 3F5LA 4K68A 2BOGX 3W2UA 1ZCCA 5C55A 1TYGA 3TTSA 1HL2A 1VGAA 5IDZA 1ZY9A 3L65A 1G6CA 1TVNA 4ICCX 5HWJA 2DZBA 3U9IA 2VGFA 3W2NA 2D2JA 1G4EA 1PB0A 2OKOA 3E0IA 5HQEA 1WKEA 5LA2A 1BXBA 1WDPA 5C9RA 3G1HA 2MANA 4HK6A 3ZLFA 1W3LA 1TIWA 3W22A 3N4FA 4Z2IA 3IGSA 2BODX 1MUCA 3W70A 2PE4A 3BJFA 1SR0A 5GQBA 1TG7A 4FOJA 4IMCA 4IG2A 4S3JA 4RXFA 1Q4WA 3THCA 3W85A 3Q2DA 4M7SA 1RLCL 3QC3A 1AG1O 2C8NA 4EPBC 4AHOA 1IZCA 2F8QA 2WNQA 1AODA 3S46A 4LUJA 4DNHA 2NV2A 2XJ7A 3WSUA 1KXTA 3VD3A 5FSEC 4P2VA 1WPCA 3WJZA 1RCOB 4S39A 3GXFA 4FA3A 4I5XA 3HTWA 4GZIA 3T42A 4XZ9A 5LYRA 3WLKX 2OWWA 5LNWA 4QJ5B 4JCLA 1GQNA 1BVZA 3WN6A 4M81A 2BY0A 1LLZA 2G41A 3MJYA 1GOXA 5HJYA 3HURA 5PTDA 1GQIA 2G4JA 4J3WA 4GXPA 2VXNA 3QQWA 3G0UA 1UOZA 4AZCA 1OGGA 2QS8A 1GEQA 2ZDSA 2D24A 3OLGA 1KXVA 3RFAA 1F7BA 4JIHA 1C8YA 1Z69A 3QW4B 3HPSA 4O19A 2F2HA 1I2RA 5JVLA 1J12A 3VFCA 3GNOA 1B3WA 1Z44A 3G1DA 1LYXA 4P8WA 3S6TA 1HVQA 3M0XA 4QG9A 4C6KA 4O12A 4JAWA 1WDWA 2CHRA 4H6KA 1IHIA 3LTYA 3N25A 2PDLA 1VJIA 2DT2A 1XXXA 4YCOA 2J6XA 3RXZA 2OYKA 1RJPA 3PJXA 1AFSA 1W1B1 2AAAA 4PUNA 1IIHA 2DUXA 2GQ9A 5HWMA 5FESA 3O07A 1RK5A 3CZGA 1J93A 2WZMA 4HPNA 1TJRA 2J62A 5CJNA 3HPXA 3B0YA 3T9PA 1BTMA 1XRTA 2CERA 4FX8A 3APYA 4LF1A 3W7RA 3KBWA 2VMFA 2BGSA 3C4UA 4IIBA 1R7AA 2GJNA 3TYUA 2BNJA 1DYSA 3GVVA 3W4RA 1DPMA 1VJZA 4F79A 4UNLA 2CZFA 1MO0A 3W81A 4MG4A 2X2YA 3WH7A 2ZZ1A 5G5IA 3R7MA 1V3MA 1POJA 5CG7A 3B9NA 1VF8A 3MP4A 3I6TA 2A6LA 5B7YA 4GY0A 1O1ZA 3P7YA 1GUVA 2PRLA 1TTPA 2BXYA 4J3ZA 3AJXA 3B03A 2A2IA 5C0QA 3H2EA 3N13A 3QM3A 4LV4A 3E0LA 3SCUA 3W1NA 2FZBA 3Q94A 4XTDA 1R2RA 3VMPA 2ACSA 4JFSA 4IP4A 1MW3A 2OEJA 1MQPA 4FNUA 4NI3A 4LAZA 4CU8A 3L4WA 2QT3A 4V1YA 3RM9A 4DRSA 4FS9A 1YRRA 4MSSA 2V8ZA 3EZ4A 2F6KA 6XIMA 3UFYA 3TLQA 5CC5A 3QZAA 3BLPX 4JFWA 5CBBA 4CN6A 3ITOA 1BF6A 4NUWA 1PJ9A 1LLOA 3NYDA 3EAUA 3CT2A 1W2VA 3IJ9A 3ITLA 3PC0A 1NSJA 1R8LA 4L1GA 4NP7A 4D8LA 2WJZA 3ELFA 1XYZA 1FRBA 3G3DA 1A53A 4PRWA 4O28A 4ACZA 3URAA 1RR2A 3AS2A 4QQ3A 3MUY1 4J3TA 4B5WA 3PUDA 1WV2A 4ILSA 3L2LA 2Y1HA 3TAOA 4Y8FA 4PMRA 3T2OA 1DBTA 1GVRA 3NWRA 1E6SM 2PAJA 3RU6A 1NELA 4I7VA 2BMBA 1E1EA 1QFEA 1CIUA 1MRQA 3G1YA 9XIAA 4OQVA 1E4NA 1ZBCA 4H7VA 3OG2A 3B40A 2G96A 4IIHA 1A50A 1JAKA 3V7PA 4C6EA 4MFDA 1DWIM 2J79A 1XGDA 1EZ2A 3EOSA 2WM1A 3B04A 4FR1A 1GW9A 1PYFA 1A5LC 2OCZA 1QXLA 4UZUA 4FOUA 1FTXA 5CSYA 3AYVA 4QSFA 3SFKA 4R3UA 4RNIA 4UOQA 5I02A 1O66A 3ZWTA 2NX3A 1X6NA 2E25A 3HQ1A 1GQLA 5M17A 3BCDA 3UP8A 3R8GA 1HJSA 1XD0A 2EPKX 5E93A 4HPHA 3DCPA 3DENA 4AIOA 3WBXA 1S5MA 1XLMA 1OFBA 4HGXA 4QS6A 4PTXA 3OVQA 2AOSA 3CS2A 3KTXA 1OY0A 4NZ1A 1W1TA 2VHLA 3IJ6A 1DJNA 1YXYA 1KNWA 2CLEA 4Q22A 5CPLA 1Q66A 3KWXA 3BCJA 1MUMA 1SO3A 1YEYA 3BW3A 3TSBA 1PCKA 4D6EA 3LGEA 4ZOAA 1QJWA 3PVFA 4PULA 1CB7B 3LV6A 5FJPA 2XINA 3KBVA 3O0KA 1UR1A 2OEKA 2F84A 3KUMA 4AWSA 3VUPA 2ZE0A 4KESA 4ZO7A 4PYSA 1SJCA 3LA4A 4O52A 3APTA 4MPQA 3WNLA 4BEQA 2HPIA 4ZBCA 1VP5A 4DQWA 4GHRA 3UYIA 1SVDA 3RLUA 1Q8JA 1Q6OA 1E1CA 2GSHA 3N12A 2PDBA 1DXEA 4JTDA 4RV8A 2A6NA 2AQOA 2ZVIA 2H6RA 4HA4A 1Q7ZA 3HV8A 3SQLA 4DELA 3GY1A 5ABFA 4K8GA 1F6KA 2XWDA 4JFVA 2BTMA 2YBVA 4HTYA 4OFCA 3VM5A 1K70A 1Q5MA 4LUIA 4FF5A 2EJAA 5CC3A 2DVUA 3SZ8A 5IBXC 3H2NA 1JPMA 3CYJA 3QRHA 3N9RA 1ZBVA 1S5WA 2I57A 1SFJA 3WBYA 5CZTA 4TOQA 4FIQA 2V67A 4A3UA 1MVYA 3WQOA 1BXNA 2PZ0A 1QHZA 3VNIA 4ZE5A 3VKKA 4JTLA 1KKRA 5EB8A 2E6DA 1JPIA 3H21A 4QBXA 1Q6FA 3WK2A 1IYXA 1NDZA 1JR1A 4XX6A 2QAPA 3BCFA 4LS2A 4NRRA 4AYGA 1PTDA 3SCPA 3LZ5A 1JD9A 2AKZA 4H7CA 1WAWA 3COTA 3OTRA 2CKSA 3ARVA 4DO5A 4U2YA 3F4CA 1TKKA 1DIDA 5HUOA 3FY1A 3B06A 1W1PA 4GQBA 3M41A 4CD8A 3GRIA 1SUXA 5FF4A 1XR2A 4NG3A 4I9MA 3UZWA 3TTQA 4Q4PA 3N29A 2RHGA 3CZKA 4W88A 4NNAA 1H49A 1AQ0A 2JEQA 1QOQA 1VFSA 1IF2A 2VZVA 3EXRA 2ZVRA 2J7EA 1V0LA 3FHQA 5LNUA 2V5JA 1XG3A 2VEIA 4J2PA 2RGLA 1MEIA 2JGYA 1JZ8A 4GO9A 4BZYA 4AW7A 1IT7A 3WNNA 1H0GA 4LFYA 3B9EA 2GVLA 4GO8A 3EPNA 4RUBA 3UY8A 5LHFA 4IMDA 4FK9A 1YNPA 5CKSA 1FDYA 5M2FX 3HG3A 4L5ZA 3NQGA 4NKCA 3B3DA 1NF7A 2PC8A 2YSWA 2VD9A 1KWKA 3QHMA 4Q6XA 3T0AA 4XSLA 3LBMA 3PZNA 5ABGA 4B5UA 4S3GA 3NPXA 1IEVA 3IVUA 3NSMA 3CLMA 5I07A 3MI3A 1P0DA 3WNKA 3WUFA 3NOEA 3FN9A 2QJNA 5BOEA 3URNA 1UP3A 2DSKA 3NQDA 4X9YA 2QVHA 1SR9A 1B1YA 2B4GA 4FX6M 3K1GA 3SUVA 2Z1XA 4E2OA 3SUWA 4RX0A 4PTVA 3QFEA 3GBDA 2A3BA 2QEZA 4D6FA 2GUUA 3RM8A 1CLKA 3A3WA 1E0UA 1IWAA 2H3BA 4IMEA 4MHBA 3DZ1A 4MGGA 3H53A 4IQDA 1UKQA 5KZDA 1V7AA 3RR4A 1P1MA 4LH8A 3DKLA 1HF6A 3GC5A 1GYLA 4P61A 3RLVA 3S5NA 3W73A 4HBKA 1R9ZA 1CWYA 1TJPA 2ZBTA 2PDMA 4O1BA 5LNRA 2NUWA 2NSXA 3OLDA 3M5ZA 4PUKA 5BW6A 3T81A 2VELA 5I3KA 2NWRA 2GDVA 4AD5A 2DDXA 3ANYA 4GRSA 4YNGA 3U7BA 1XLHA 3GG7A 4ZCWA 4JHZA 3DU0A 4E2DA 4N9BA 3O3RA 4LRSA 1IGWA 4AWEA 5C2GA 5EY5A 2FJKA 3BO9A 1LG2A 3W7IA 3EWZA 5J5RA 3E5BA 3TC3A 3IIZA 1OCJA 2X16A 5A6AA 1IWBA 1RSCA 4J9JA 4C6MA 4UQBA 3LERA 5KZEA 4URIA 2ISSA 3T78A 3VOCA 3R2GA 2J7HA 1H0IA 2FB3A 3ABSA 1OG6A 1PKNA 4DM2A 4AH7A 1IEQA 3AHXA 1UKOA 2DT0A 4KEVA 3U5YA 4HSOA 3DBNA 4LSBA 3CUXA 1LRQA 1S2CA 1SFTA 4HOXA 3PZ9A 2ZFAA 4UFLA 4MKSA 3MTWA 3IUHA 4ZQOA 1O95A 3EWCA 1PZ3A 1QPKA 4FP1A 2JIWA 3CHEA 2J25A 4LTSA 2ZADA 1LL6A 4UCFA 1DEDA 3CLWA 4W5ZA 3N6HA 4F2BA 2NVCA 1HX0A 1YBQB 4GIRA 1E0VA 1NVMA 3QPZA 1PX3A 4B90A 2ATMA 2DZWA 4ZMGA 4FALA 3ARYA 1EJXC 4ZFMA 1X7FA 1GPFA 1B0IA 1ENUA 4KT2A 1Z32X 4NHVA 4MMWA 4Z17A 4RDZA 3QMRA 5K2ZA 4P8VA 4JTEA 1PWLA 3AXHA 3H2AA 3UESA 2D2GA 3QSTA 2BVTA 2W62A 1J0KA 2Z26A 3W1AA 1HXJA 4CCCA 1JF6A 1DWJM 2VNCA 3ZT6A 1FCVA 1JYVA 1XLKA 4GFSA 5IHSA 4HJWA 4WVXA 2PWEA 1LQAA 1R5YA 2WHMA 4DB7A 2DVXA 2X1UA 4ENLA 2HMCA 1E9YB 4GY7A 5SWUA 4PMZA 3SCWA 3AS3A 1XGEA 4YYCA 1BWLA 3FK4A 3L4YA 1UD4A 1ISYA 3C86A 4RKAA 5DMLA 4BCEA 3SQSA 1V8EA 1OWQA 2CETA 1I2QA 3WLRA 3S2MA 2OO0A 4OECA 1HKMA 4QLJA 4ICMA 4S3FA 1FBAA 2BHYA 3WEMA 4I8YA 4MDOA 4LYRA 3A5VA 2D0FA 2VFEA 4G9PA 3NPUA 3M5YA 3RPMA 3LPFA 2YW4A 4ZQPA 1QNOA 2CZEA 2V81A 4IL2A 3GNNA 1LWIA 1OC5A 1VKFA 4XD3A 3TTOA 1C93A 2VUYA 3N34A 5LIWX 2WKJA 4XKMA 5HINA 3H70A 5AYZA 1O60A 4GBUA 4PUWA 2VI0A 2R24A 3DOPA 5EGRA 3GAYA 2PDUA 4KETA 1B54A 4L6HA 4P7RA 1QASA 3WLLA 5HMSA 5A2BA 1K4GA 5I6SA 5IHRA 1MI3A 3A13A 3THUA 1EA0A 3TC7A 3ZSTA 2OR2A 4WUIA 3N1AA 3LGDA 1OFPA 3GWQA 1L6WA 1SO4A 4LAOA 1AQMA 2HEJA 2Z6JA 4OU1A 2ZZ6A 1CT5A 2YCIX 2W0UA 4AMCA 3WQPA 4NY2A 1UA3A 2PDKA 4KRZA 1XH0A 4BI7A 4L4LA 1S5NA 1BFNA 2KZHA 4NJIA 1JGIA 4A8IA 3ES8A 5I3DA 3O1NA 2Z29A 4CVUA 5BXSA 1QPNA 1E6NA 1F4AA 3MCOA 4GCXA 5ABHA 4RJEA 3W00A 2OOGA 4Q4QA 5F1VA 2Y7DA 4XBJA 4NAFB 3TYDA 1CW2A 4DF2A 2VENA 3CIXA 4GA8A 2XFFA 1DIOA 3CK5A 2XUCA 3UERA 1T96A 1QK2A 1EHAA 1EOMA 1P1XA 2Y63A 5C9UA 3R1ZA 3FSTA 5AYBA 2QGHA 3KOYA 3AYSA 2C71A 3FJLA 1SZFA 2X30A 1BEUA 5JMUA 3O06A 5AFDA 1MXDA 4Y7EA 3P6LA 2DIEA 1RP8A 2YZRA 1HVXA 4YN5A 3SIZA 4BEUA 2PDPA 4AEEA 1AUSL 3I7QA 3QSRA 4G7FA 4LYQA 1MUWA 4LBRA 4MJZA 3VAVA 2XGIA 4MVAA 2GVYA 4DJFC 2WNZA 2EKCA 4JEQA 3WD0A 1VYRA 3B8UA 1KM5A 3QR0A 2IKJA 1OM0A 1CGXA 3PJTA 3CB3A 3WDJA 4GI9A 4Y2WA 3PPHA 3CC1A 2F2KA 2F38A 4PFMA 3STPA 3GBEA 4GY1A 4OUEA 4YLWA 3WY1A 4H4IA 1QDSA 2OB3A 3IJ7A 4XQ6A 2PI6A 3PR2A 5C7HA 1QHOA 2QIWA 3LPPA 1XYBA 1FWSA 1FWDC 3NG3A 4JQ1A 3DC8A 2EEXA 4HOZA 1F05A 2FVLA 1NF0A 4O1DA 2G3JA 4TTUA 5CBJA 4S3KA 4NI8A 1J6OA 3VD5A 5E0KA 3ZR6A 4PODA 5KITA 2Z1VA 1LZOA 3CBWA 4IIFA 1V02E 4Q32A 4MNMA 2AAMA 2Z7KA 1D3HA 4OBRA 2XH2A 3WF3A 1DJGA 3P80A 5A6JA 3BSHA 3CAKA 2O0TA 1J5SA 2A7RA 4C5YA 5BRQA 1FCBA 5I03A 2E3ZA 4LT9A 1R3VA 4IQEA 1R2SA 2E1WA 3H6OA 3S5SA 3I3BA 1H7NA 1R47A 1K9TA 2PDWA 2OSXA 7TIMA 2E0PA 3GO2A 5GNZA 1TPVA 1GG1A 1JI2A 3PB0A 1AW2A 1WDSA 5FAJA 4NIRA 3ZS4A 1ZJIA 4UTLA 1K8CA 3H2MA 1DVJA 2GWGA 3GS6A 2A21A 2AMGA 2YCLB 4UB9A 1PAMA 1WDDA 2J74A 3B9OA 3WNPA 3WDQA 4Q7NA 1C8QA 1CXLA 2A7PA 4QJ1A 2PP0A 5D8WA 5CSSA 1EP2A 1FWAC 3OJGA 3UCCA 4Z42C 2NT1A 3MHUA 2P3ZA 3RCNA 2PC4A 2CEQA 1S2WA 3PPCA 3OVRA 4YHGA 1KV5A 4NAEB 2YIHA 2D0GA 3E0WA 1E5NA 1A5AA 1V6TA 1NFGA 2RDTA 3ZFHA 1E72M 2Z4GA 2ZZ5A 2PFHA 5CGQA 2I17A 4GKLA 3R89A 3KW3A 1MFUA 2FJUB 1SZEA 3VM7A 1XLAA 3WD3A 5E09A 3C0JA 3RHGA 3HIJA 3W7PA 4H1ZA 1M04A 1V6VA 3CZ8A 3IGXA 4NX0A 1XBZA 1UUOA 1ISZA 2NSOA 4DBSA 4EACA 3IRDA 3I7RA 3UNDA 8TIMA 2DFAA 1FA2A 4DY1A 2OPJA 3HN3A 3H55A 3L5MA 4PUJA 3EWYA 3TK7A 5DFAA 4WSKA 3PUGA 4UQAA 5G1YA 4AWTA 1UR8A 2CLIA 2VUNA 3DG6A 1W1IE 2O9OA 4Q8TA 3HO8A 3CASA 2A1YA 3TFXA 2W6RA 4DPPA 4XG1A 3MB9A 2QKFA 1R9XA 2HBVA 2G5WA 3PBUA 4O0KA 2IQ0A 2WO5A 4EWND 1VS1A 1OC6A 3T4CA 3EKLA 2DIJA 1KGWA 4R7OA 1Z6KA 2QGYA 1F76A 2QUTA 4D8ZA 2V82A 2RGMA 1PXGA 2VZTA 1VBUA 1FXQA 4PUDA 4XAZA 3GVGA 4H2HA 4AYSA 4R7JA 4JIIX 1FHUA 4Z2LA 1LCOA 2KX9A 3ECQA 4Y9MA 3IJQA 2V5KA 4Y8EA 4QGCA 3N14A 3TQPA 2JFEX 3UNTA 5TBOA 1JQVA 1G69A 5AECA 2XIOA 5HMFA 5B80A 1J0JA 1Q2RA 5DMMA 5A2AA 3GM8A 1YXDA 1FWWA 2J77A 4GPNA 4N02A 1TJ0A 4H7ZA 1W1VA 1YPIA 3KP1A 3M0YA 3EOOA 2WSRA 1TQJA 1LDCA 4GABA 3KHJA 4JHMA 1KO0A 1DJZA 1UR3M 2G97A 5CSUA 1BKSA 1FFRA 3TXZA 2A0NA 4HA3A 3C6CA 3DN5A 1PUDA 4NXSA 3FYYA 2OQYA 1TMHA 2J75A 4DEFA 4HCDA 1XH2A 2Q3RA 2XTKA 5D02A 3T8LA 4C6DA 2J8TA 4Q4RA 3K30A 3HPZA 4GE8A 4IFKB 1IEWA 4LEQA 1AVAA 2J88A 3AICA 4AY8A 3TTEA 1RJQA 3AHYA 2ISWA 3LLFA 3U6WA 1HNYA 4QITA 3GYEA 4JTSA 2YCJA 2E6FA 1L6YA 2ZIDA 4KWOA 4L4MA 3RCYA 2QDDA 4NZ5A 5JU6A 2ZE3A 1OSEA 1NH6A 2V0TA 1OJXA 4WDUA 5A6TC 1OZQA 4F0SA 1SQ7A 2DEPA 5EBAA 1O5KA 4H9YA 4JIQA 4B2DA 2FDSA 5DCBA 1YBQA 3EX3A 2FH8A 3VNLA 1GCYA 3TVAA 3NL2A 2OSWA 5GVJA 1T8QA 1VBJA 4QTGA 1WOBA 7PTDA 1DIKA 1A4MA 5LA1A 5D03A 3CEUA 4ZO9A 1GVSA 3AXKA 1Q8AA 2O4QA 3VOGA 1R3TA 2Y8KA 4IMGA 3LCXA 1L2QA 3M16A 5G2IA 4LYPA 5AHIA 3CQKA 4AZBA 1DOSA 1TMQA 3WK1A 1HJQA 1S39A 1JULA 1VH7A 4GYPA 5EA9A 5DY2A 4AF0B 5C71A 2A3CA 3N2OA 4E8DA 3W7HA 2HRWA 2JGQA 1C3FA 3WLPA 4MNKA 5EMUA 5CAHA 2DW7A 3WFZA 4AEFA 3IIOA 5I0DA 2YOCA 4DJDD 1RK6A 1UUQA 3MSRA 3TV8A 3MUCA 2WMJA 5HK4A 3LXBA 1OVDA 1JDAA 2GJPA 3W1XA 3FFSA 4MM1A 3TONA 2BASA 2E9LA 1HGWA 4NQ1A 4K7YA 1VIWA 1ZP4A 4O57A 2TSYA 1QOPA 3M47A 2R6OA 1KR1A 3SADA 2E5CA 4CEUC 3T6CA 4LX4A 3O9NA 2V3FA 1V08A 3HPFA 1GVIA 1P0BA 2HBXA 5CC7A 4AB4A 3NSNA 4OWGA 4C6CA 3IEBA 3VIIA 4HHMA 3CPRA 2C1IA 1NFBA 3PHAA 4UFHA 1SJBA 3C3NA 1A5CA 3TP4A 3A5FA 3AS1A 3CH9A 3KAOA 3UJFA 2DSUA 2CZVA 3GZAA 1ADOA 3G3MA 5XIMA 3GIQA 4UQCA 3GTIA 2IPGA 3PUEA 4NJGA 1RQBA 4HMCA 3MT1A 3P84A 3BC9A 1Y5VA 1REQB 4HMEA 3AMGA 1CB2A 1SZRA 2GGGA 3WQGA 2Y85A 2VZOA 3CMGA 1YDVA 4MAVA 2DZAA 5TF0A 1TTQA 2VEKA 3QKZA 3VZXA 3I6RA 4WKAA 4U4MA 1Q4NX 4YVVA 4NAFA 4IM4A 1EJUC 4GQQA 1CLVA 3STFA 1Q6CA 3AQUA 5JQ9A 1I8JA 4QCEA 5A6BA 1V3KA 3RU8X 3RX2A 1L6GA 1K4HA 4GVGA 2WC3A 2C18A 4I7UA 1A3WA 2V6AA 1R3WA 4G7EB 2PSNA 4TU1A 5U7SA 3MDWA 1B3OA 1TX2A 3A4AA 2DIKA 3B05A 1LBMA 2WLYA 2OQLA 1E70M 4PR4A 1JFHA 4J3SA 2WCGA 3SJ3A 3F1QA 2ASHA 1HIZA 1UKTA 1EC9A 4AD4A 3M07A 3R13A 4TV6A 2ZUWA 3F7JA 2DZVA 1C90A 3UWUA 4HP5A 4IPPA 4C91A 2ZXQA 3N19B 1VFFA 3PAJA 5D30A 3Q67A 3QEZA 2W27A 3W7NA 2OSYA 3GW3A 3NZGA 3UPWA 2Z1WA 3U3HA 1XQLA 5IOBA 2O55A 3G22A 2XVLA 4A22A 3K8KA 3PWAA 2W9MA 2WV8A 1UJQA 1LQ2A 4YWIA 4BJHA 4Z2JA 3LHTA 1H7WA 3IRSA 5AN7A 4A3YA 3WEOA 1E40A 4ERGA 2ZQ0A 4LNCA 4AD2A 3W25A 1TV7A 2VX5A 4KFOA 1SU5A 4XK2A 5KZ6A 4LXFA 4BR1A 1W5PA 4H9VA 3FA4A 1PZ1A 2YLLA 3ME3A 3CMFA 5FEPA 5AOUA 3EEGA 3IJIA 5HQLA 5M5DA 3OYXA 1WKDA 2ZZ7A 3UWEA 1YYAA 5DT5A 3WMBA 3AHVA 3VINA 1M01A 3CB8A 3DFOA 3GAKA 4C65A 1UOKA 1ONXA 2J7GA 4M24A 1FWRA 2CESA 2WOQA 4YVXA 4A2RA 2YYUA 3DKJA 4LS0A 1SW7A 1XLLA 1LLWA 2BY1A 3UWZA 2E8YA 4IJCA 3SY8A 4H8UA 3BL3A 4HN8A 5DT7A 1ZU8A 4V1XA 3CO4A 3R43A 4UOZA 4GX9A 1F73A 1EJ7L 4N42A 2O9PA 3GR4A 4RL3A 4FNSA 3HG2A 2WVTA 3Q65A 4CQ8A 3MSDA 2IQTA 1J2BA 1EJSC 4QLLA 4YVPA 3T09A 4DIAA 2ZTJA 3C3UA 1XP3A 4J5NA 1M53A 4C90A 3AIVA 4A3QA 1MRAA 4IQJA 1P0KA 2ZC1A 5MKGB 5AHEA 4QIUA 3ZMRA 1VCFA 2PLMA 2DU2A 3DDMA 3L2IA 2XGZA 3AIRA 4G56A 3V1HA 1ZBKA 3R8RA 3AIUA 2HE8A 4GI6A 1PTAA 1E55A 1A0CA 2V3EA 1W3HA 3IV3A 2SFPA 4EXQA 4AZGA 1TRIA 1Z41A 3ZWSA 2OEMA 4AX6A 4LAUA 1E9IA 3UXAA 5HATA 3UGVA 5GPRA 4QQUA 4HU8A 2D3LA 4MY1A 3TEVA 1PSCA 4Q4OA 2PUZA 2Y8VA 1W54A 4H83A 5D32A 2A7NA 2XVKA 3LLDA 1J5TA 3OZMA 4MZYA 3E02A 5FJJA 4PCSA 3LI1A 1AK5A 3SIMA 4DXVA 1GZJA 1YX1A 1DHPA 4H9ZA 4D8AA 3S2LA 1M68A 3DFPA 1RQHA 5AKQA 3LEPA 1EO5A 5IDIA 5F4WA 1YKWA 3UR2A 2C0AA 1ICPA 3VDBA 4NRSA 3U2ZA 1DQXA 1B9BA 3GDMA 1EQCA 2VRKA 1HO1A 3BOXA 3L12A 4EOUA 3NZQA 5I77A 1TRDA 2J66A 1KFEA 4ADTA 3LV5A 2QJHA 3E2QA 3PANA 2UBPC 4DLMA 1TQXA 3NQ6A 4MLRA 2OODA 5A69A 5I2UA 4GIYA 4Q3MA 3WBEA 3K4DA 1KGXA 1W3NA 5FL1A 2VDGA 4HN4A 4GNKB 1UPPA 3NQ7A 3KDNA 1R3SA 3CQJA 1NY1A 2VURA 3IPWA 3E38A 4LALA 1I2PA 3C5QA 1Q45A 4G1NA 3HFTA 4DI9A 1E4LA 1ECQA 1W9UA 1Z89A 1B2YA 3KBMA 2PMQA 3P0XA 2POZA 2ATSA 2E4TA 4PCNA 2FZDA 4IXHA 3RX3A 4RDYA 4WXYA 3KTCA 3R8HA 3WF2A 5EYWA 2IQDA 2WCSA 1Q6QA 2X1SA 2BXVA 3HMJG 3MJMA 3H26A 1OFDA 4KWSA 4MYXA 5CXPA 4XKYA 3ITGA 3H12A 3U2EA 3UWQA 3NTYA 3DXIA 4RV3A 2DUAA 5A5WA 3BANA 1OX6A 2QCCA 4OBSA 3FXYA 3WIJA 3PS7A 1HUVA 1RALA 3PULA 1TPH1 3NQAA 3KLKA 1I45A 4MKNA 6CGTA 1BKHA 2WZEA 3Q37A 1A5KC 2PU0A 6REQB 4IFKA 4R33A 5IRPA 2CHNA 4XZWA 5A6LA 4U2ZA 4B3LA 3OGSA 1A49A 1JDDA 2EPLX 4N2YA 3RUBL 4U10A 4R85A 1H4PA 3F5KA 2BY3A 1ONEA 4K8EA 3JU2A 5DCDA 4C6QA 3QOKA 2HWGA 1GPWA 3UR5A 3SCNA 3QHOA 2UY3A 3UETA 3KBSA 1G67A 3WF4A 3AUJA 1R86A 4ZQRA 3GDBA 2BHUA 5KEZA 3VOIA 4ML9A 1M41A 1KFKA 4MWAE 3AIQA 1L8PA 1O4UA 4IH3A 3L23A 2JBMA 1CGTA 1Q7MA 4ZXOA 2ANUA 1FWJC 4UC5A 3NQBA 1UMLA 5HXMA 1J18A 3LLXA 3DYPA 1Q6EA 1H7RA 4A4AA 5D04C 3AYTA 2V5BA 4QSHA 3W1TA 3W2JA 1RPKA 2QCDB 4NX5A 1HL9A 1X7IA 3SGGA 3TYEA 1NOFA 2CXEA 3ZQ9A 4IX2A 4E2VA 3EX4A 1XLJA 4XZNX 4W4QA 3A21A 2OGYA 3ARQA 3KCLA 1QOXA 2NVDA 2WNWA 3J7HA 4LPCA 1UZHA 2YXOA 3LQGA 3UA4A 3V75A 3LCFA 1OD0A 1TWWA 1V3IA 3VGHA 5FJOA 4R53A 2X8RA 4W7UA 2DZTA 2P76A 4W5UA 3NNTA 3QFWA 1DE5A 4NVTA 2DY3A 4JXCA 1PZ0A 1ZFJA 3MV01 5CJMA 2ALDA 2PP1A 4JTAA 3CL7A 2I1OA 1FCUA 4REQB 4UBPC 1THFD 3GXPA 3NPVA 3CWHA 4FSAA 1G94A 4HNOA 2HSAA 5AY7A 1K6AA 1X1NA 4WLCA 4OBTA 3N2MA 1PIGA 4EXBA 3F4VA 1BRLB 2QCHA 2OLAA 3B8IA 3HGJA 7CGTA 1F3EA 1O68A 1KFWA 3L66A 4IIGA 1EUNA 3AZSA 4K8HA 3GXTA 2XFWA 2OTDA 1P7TB 2ZC8A 4K1WA 1AJ2A 3NDOA 4WSJA 3MSYA 2GFTA 1IV8A 1FQ0A 4AIUA 3LRLA 1M6JA 1KQYA 2E5BA 2ZA3A 1V02A 2YL6A 5JH1A 3DHUA 1V93A 3PZTA 4ES4A 2BLEA 2D0HA 3M7SA 3BJSA 4Q6JA 4EANA 2L5HA 4CN1A 1C9WA 2DORA 3WFAA 1ZCOA 4ADSA 1T7LA 2D22A 2IXUA 5C7VA 1UH4A 3SCOA 3B9DA 3UT0A 4P8XA 3TYZA 1UD2A 3NUKA 3W38A 4N6FA 1EEXA 2CLFA 2WSKA 3N9KA 2J6VA 1UWAA 5H8MA 1CBGA 3MW7A 2ADAA 4B9YA 3M43A 4PBFA 2BOEX 2WMKA 4G7EA 2TODA 2NLYA 2J78A 4RE4A 1VB9A 3L67A 4LB3A 4I5UA 1GQJA 4ZO8A 1WXZA 4M8UA 3S5ZA 3CQIA 3UXIA 4I6KA 3G0SA 3QJAA 1NQ6A 1OFQA 3HG5A 4QDWA 3ZR5A 3IJLA 4HOWA 3ITCA 2Z6IA 1XKYA 4JHOA 4ATDA 3NQCA 2TRSA 2W91A 3P3BA 5C70A 2GLKA 2Z0IA 3AYRA 4UCGA 3ZYZA 2D1ZA 3TJXA 4A8LA 4X2PA 2CBIA 3QZ6A 1GKRA 1P6CA 1UR0A 1ZGDA 3W37A 4FPSA 1K02A 4CN4A 1YQ2A 4CD6A 4B5NA 1ZJHA 1X96A 1R3YA 3CT7A 1WE5A 3M64A 4UIOA 4OZOA 3WLSA 1H7PA 3CXOA 1CGUA 2DZXA 3PZQA 4C6IA 4HQVA 4EKJA 1EX1A 4Y90A 4KIRA 4P7OA 4A6GA 3IIVA 3WH8A 4GKTA 4X9SA 1IR1A 1EO7A 3K13A 1SM9A 1G9HA 3M0IA 1UC4A 2REQB 1OF6A 3UG4A 5L9FA 1HZYA 5LNVA 1NTHA 3AZTA 5FCZA 3WBWA 2I5IA 2GK1B 1U5JA 1F6PA 4GXMA 2QCEA 4GNJA 3RLGA 3PF3A 3E2VA 1EP3A 1ZBWA 2RH9A 3RF9A 4PEKA 1FWNA 4A29A 3AXMA 3WUGA 1GOKA 3C2EA 1VFHA 1ZAHA 1ICSA 3RLHA 3CU2A 4C7DA 2INEA 3GLCA 4TXEA 4L7ZA 1JUBA 1OQFA 2WK2A 1W8GA 3TJ4A 2NWSA 4J28A 2VZUA 1SMDA 1OCQA 4J4KA 5CEWA 2VVNA 4GBDA 4LU0A 1YW1A 2ABAA 3G1FA 1UKSA 2YW3A 1HN1A 1J6PA 3G6LA 5E0FA 5BZAA 4Q33A 4HMNA 4WCJA 3WLIA 1C7TA 4WGXA 1Y0EA 5MKGA 2AGTA 5KETA 4ZOEA 3KL0A 1LBLA 1UWSA 3VO0A 2WKGA 3B8WA 3EBVA 2VYOA 1N2VA 5C5YA 1B31A 3GHRA 4RNFA 1TCMA 2YB4A 4AU0A 1TWZA 1OINA 3MO7A 1M65A 3UWYA 1ME9A 1XUUA 5HNTA 3UZZA 2ACRA 1XM3A 3BTNA 1D2KA 3OIHA 3SGZA 4F8XA 4E2BA 1VPQA 2VWSA 1PIIA 4CLMA 4HSHA 4UTFA 1KCLA 2EHHA 1BD0A 2C16A 3QGKC 5A6MA 3D46A 3GNXA 3GVQA 1EFZA 5D2TA 3QGAC 2VFHA 1F74A 4HNCA 1OABA 3T2PA 2C7FA 2OWCA 4GIEA 2QJJA 3GTNA 4TVDA 3W7OA 3PB2A 3GVWA 2FIQA 2ZXBA 4XZIA 1FX6A 3SURA 1PVNA 4XAFA 1DJQA 3PJUA 2Q8LA 5D33A 5B7ZA 2ISVA 1QO2A 3TUUA 3VA8A 1MW1A 2WM0A 3VKCA 3T8QA 1SSGA 3NFUA 1MXSA 3C0SA 1W6TA 3CQHA 4XD5A 2XHYA 3R6IA 4MWAB 1LOQA 3GH5A 4DWSD 4L65A 1KW1A 3PNZA 3NDYA 3N73A 4K7VA 1TZ9A 4WIWA 2OZTA 1JPDX 4PSRA 1JZ6A 3GTFA 2IXVA 1E0TA 1V3HA 1WDQA 3P0WA 2ZX6A 3CHCA 4P8UA 1YDYA 2JF6A 3QV9A 4O10A 2G3IA 3SSJA 4AVOA 4OTKA 3QR1A 3B8VA 4MLJA 1LL4A 5IFPA 3TNOA 1EP1A 4OIFA 3CUIA 2W79A 4PCFA 3VUSA 3HZ3A 3TX9A 1F3XA 1RQEA 1RY0A 1JPHA 2CCRA 4EE9A 1EZWA 2ZRYA 2YLAA 3ERPA 2EPMX 5J8LA 1JYNA 3GK0A 4H6RA 2FHBA 1V77A 2Y5SA 4FHAA 1RD5A 3TOPA 1J11A 1OG0A 1XSKA 5FJTA 4GIAA 4DVOA 1X8CA 1VCGA 1R30A 4KFNA 2J47A 3EMQA 3WQEA 2ZX5A 3JR2A 1HGYA 2ZZ2A 1UZ1A 4QFUA 4QLKA 1Q6DA 3VGDA 1MW0A 1XIBA 3OYZA 2Z2UA 2YL8A 3BE7A 3DUGA 3G1VA 3GH4A 1CEOA 3C2VA 4N4PA 3XINA 3FW6A 3MV11 2ZDRA 3BLDA 4LVGA 4IP5A 1BWKA 1LL7A 2PU1A 1F61A 3FDGA 1LQ0A 3K4WA 1VC4A 5T8GA 4KCWA 4Z08A 3GXNA 2CKRA 4TV5A 3WELA 1LOLA 2ZYFA 3EB3A 2R8WA 3S9YA 3W71A 3W1UA 3THQA 3EB4A 4UQ9A 4AY1A 3DECA 3GW0A 4W8LA 4AG0A 1EC8A 3WMSA 4LY8A 2R9RA 4R34A 2OFJA 1W5NA 2VKZG 1S5VA 1XIEA 7REQA 2QCDA 3TC6A 3VYLA 2BX7A 3VABA 4GINA 1KRCC 1CPUA 1WO2A 3HV9A 1BAGA 1E6QM 2XVGA 1H51A 1Y8BA 3CUGA 4F40A 1EPVA 4KWUA 3DAQA 3N3TA 1WKYA 3QN3A 3W3OA 4IGHA 2INZA 2PODA 4JQAA 3UZXA 1QI2A 3PPGA 3T05A 2ZRXA 4FXJA 4IIEA 2WHKA 4U5KA 1LOSA 4WKFA 3KE0A 3SB0A 1E6RA 2Y7EA 2XIQA 5LKYA 2ODOA 4KS0A 3SO7A 1FH8A 2Z2AA 3DFHA 3AHTA 1XYMA 2O7QA 1S1PA 2DZPA 3A47A 3E96A 4W86A 1A5OC 1AMKA 1JYXA 4TTGA 4YJ5A 1P5BA 3LNPA 1GJUA 3N2CA 1OX4B 3LHVA 1CXKA 3V4BA 2XH4A 3POCA 3LYEA 1ME8A 4P7NA 3FYPA 3O2LA 4WSHA 5D4YA 1WZKA 4XD4A 1BRLA 3VDAA 2WVUA 4FO4A 1KWGA 3U0HA 1G5AA 4GYPC 4JYFA 5FKYA 4N9DA 2O9RA 4JY8A 5D2XA 1NDWA 1P7TA 1PX8A 1H5VA 4Y9AA 1ICQA 5F2GA 3ITVA 4HPJA 3BQ5A 3E74A 2DW6A 4JEJA 3LXCA 4W7WA 1HP4A 3GTXA 3W7KA 1JVNA 1NWSA 5LIYX 3ZVHB 1XC6A 5U4NA 1IIGA 1SW0A 3YPIA 2GOUA 2PDYA 3VIGA 1BYAA 2Z28A 3WQ4A 4CQAA 4YU1A 1MNSA 2RDWA 2FPTA 2P0IA 2VC6A 3EWXA 4R27A 3QGVA 3VGFA 2VC9A 1FWHC 3GVRA 3WLMA 3OVPA 4ORMA 1PKYA 3B97A 2EJ1A 4DXXA 1FVPA 1H11A 1TE1A 2Y88A 3TKFA 3HGRA 2C14A 3TA9A 1DIEA 3PTDA 2ZX9A 3L4VA 6TAAA 4TVUA 3PBWA 4GFIA 4JZ5A 3LK6A 3U8GA 3TIMA 1OIFA 3BGJA 3C2FA 4QRNA 1KTCA 1WZMA 5KSWA 1SSDA 3QPEA 5E6YA 1M03A 3RAOA 4N0RA 3CV7A 3ATYA 1JNDA 4Q7BA 3I7SA 4K37A 4M6PA 1WBHA 4HA1A 2ICSA 3OGVA 4HJFA 1V6XA 4AC1X 1VCVA 4UMCA 4E4FA 2GUBA 1FDJA 2BWGA 1Q65A 4NJHA 3S47A 4GUFA 3R4IA 3WENA 2CBJA 2ZKMX 3WDHA 3MKKA 3URQA 4ERAA 3CZEA 1DL3A 2H3DA 2W4XA 4WQ6A 4X0NA 4TO8A 1FHDA 2EF9A 4RNJA 1YTKA 4ZB2A 5K7JA 4DJFD 4DO6A 2ZOXA 1J4EA 3FKRA 5DELA 1ITXA 4P5UA 2O9TA 3P8JA 4XUGA 2W92A 1E56A 3FHAA 3WK3A 4IJBA 3BAYA 2AL1A 2CLLA 4WJEA 1RBAA 2G8ZA 4W8AA 3EKGA 4LVBA 3LCIA 5HPOA 4BQ2A 2Y24A 4MAZA 3NM3A 1ODZA 1TUXA 4Z1YA 3JRKA 4A21A 3L0GA 3VX1A 3KXQA 5LGXA 1WP6A 4LVDA 1EL3A 3H2OA 1V6UA 3WK0A 3DG7A 3BAWA 3VFLA 1RZMA 3B4UA 3SCRA 2TAAA 3R0KA 2YFOA 1SW3A 1Y5XA 3BMXA 2GK1A 4FNTA 2QUNA 2WJFA 4L80A 2VCAA 4PUEA 4FOKA 5F2LA 4NJJA 4ASTA 3DX5A 5D9PA 1RXOB 3O7UA 2IKIA 1JYWA 3PM6A 1W0MA 3NURA 4G5DA 1ZALA 3WJXA 1JUEA 4JTJA 3SFWA 5MHBA 1I2NA 2TPSA 5A3HA 2CLHA 1KFJA 5AHLA 4AZHA 3SCSA 1EH9A 1Z3NA 2LLEA 1L6FA 3BAXA 5K9XA 1XBXA 1H50A 2I16A 5A1AA 4K1GA 2W63A 3C8NA 4QDPA 4IMAA 2QUMA 1FOBA 4Z1BA 1RCQA 1U33A 3UZJA 1F3WA 1W91A 5I06A 4KGLA 4IPNB 4PMXA 3CWNA 2PD5A 1VPYA 1OYAA 3A3HA 1JNEA 2ACQA 3WL0A 3FA3A 3NZ1A 4C6LA 4LBSA 4IT1A 4GJIA 4LJ3A 3W24A 2ZX8A 1YE6A 4S38A 2CWXA 4PFHA 2CXGA 3IGUA 5A94A 3HG4A 1P0NA 4US5A 4PB4A 4DZHA 1EJTC 3H4XA 2C3ZA 1X8FA 4ZEPA 1IR2A 2QPXA 4A8RA 2X1RA 4JGDA 1OK6A 4PC8A 1CXHA 4CNNA 1XICA 4WHBA 5CPNA 2V38A 4LNYA 3N17A 2PTDA 4WOQA 3VXGA 3CQ0A 3OGRA 4JS3A 1UZDA 1XIIA 3KX6A 5BWAA 3S1XA 1W5QA 2POTA 3TNBA 4DYJA 3C0LA 5D2WA 2VR4A 1TPB1 4UFKA 2WPBA 4LOCA 2P88A 3QYSA 3P67A 1XLGA 4E38A 3G77A 5T91A 1K03A 4UNKA 1WA3A 3KBJA 4MWAA 4XO7A 4Q8VA 4JTTA 4TX8A 4RE0A 4RE3A 4OVXA 1ZL1A 3VIFA 1XLCA 2CBUA 1XKJA 2NV1A 3PZIA 1V6YA 1FXPA 4WK9A 4GQ0A 3RMJA 4NNBA 3BLKA 5DEZA 1VJSA 1UD5A 3VX0A 2OLSA 1FHVA 3DI0A 2J9XA 1UUMA 4QR6A 1QNPA 1EWEA 1XYAA 2P50A 3BLIA 3W7LA 2O7SA 2E09A 2X09A 1C8XA 4CNSA 3HA1A 3SY5A 3VILA 4PTNA 1TO3A 2YB1A 2V3DA 4HIBA 4GQRA 3KFTA 5G4EA 1VFLA 4XZBA 3BH4A 4PL1A 1H41A 3N6QA 4U5IA 2PDIA 3N2BA 5F4XA 3A22A 1FUYA 1UPMB 3NM1A 1J10A 1XCWA 4NZCA 2EPOA 1XYLA 3BDKA 2DZUA 3WYZA 1TA3B 4JTKA 3IARA 2E77A 4Y6GA 1BSIA 1MXGA 4ECLA 9RUBA 1NAL1 2X2GA 3KVMA 1EB3A 3D3FA 4IGMA 3IAQA 4W85A 3MKCA 4JTUA 1ZB5A 1AL8A 2FTYA 3VKJA 3OG3A 3L0NA 4ZVJA 2PGEA 2C19A 4HK7A 4XBSA 2PDCA 3MHGA 3UVAA 4UFJA 2G50A 3DGBA 3M0JA 1UZ4A 4KRTA 3AIWA 3CJPA 4S3AA 2A85A 3IVSA 1GKQA 1PKMA 2XH0A 5HUPA 2BBFA 5CC6A 4FLSA 2Y8UA 2VC5A 3UR7A 2ZZ3A 3BICA 3JW7A 4I6VA 3ID7A 1S2TA 1VHNA 5GNYA 1KB3A 3IUIA 1EBHA 3GC4A 4PCPA 2QLYA 3VZYA 2CZDA 3PWGA 1W31A 4Y9PA 4MF4A 4XAGA 1MDRA 1ZZMA 1DWGM 4XTIA 3MWCA 1W1YA 3S9IA 4DHGA 5KZMA 2R1LA 4HNLA 2QUUA 2XGBA 4HB7A 4ZFCA 3CZLA 5K4ZA 3I65A 2WVVA 2J27A 5EMKA 3WF0A 4CCEA 1KM0A 1PYMA 2WMIA 3OZOA 5M1TA 2OQHA 3WJYA 5BXRA 2GQ8A 2J8FA 5FACA 1U1UA 4Q7IA 3W2KA 1A5BA 3NQEA 1HP5A 2FDMA 3CHFA 2DZSA 5FOOA 2JKEA 1R7OA 3PP7A 2I56A 4JTQA 4ZTYA 3UG5A 3Q58A 3E5PA 1BTCA 1KC7A 1N55A 1HG3A 1JCLA 3K46A 1P6BA 4HYVA 1JRCA 3N11A 3LENA 1KXQA 4LAKA 3C2YA 1QW7A 3BLEA 1SZNA 3WD1A 2WSPA 3KOXA 4AZIA 4O16A 3GDRA 4E3TA 2XG9A 3TR9A 1KRAC 3GHTA 5K4XA 3UWWA 3GU2A 4CD4A 3VDCA 4YYFA 3EOLA 1PO9A 4H2CA 3D47A 4YWSA 3OZPA 3SUSA 3LX9A 1F8MA 4J2MA 4RZ6A 3V18A 1OX4A 3PSWA 3FX4A 4O17A 3NO5A 3KLLA 1E51A 1TPEA 4DJEA 3BOFA 3KS5A 3ZT7A 2J9YA 1IWPA 2PP3A 3B9AA 2Q6ZA 4PA8A 2ON3A 2OWXA 3AUOA 5JUVA 3SY1A 4LGXA 3NIYA 4YTQA 3VC5A 1E4MM 2WXDM 1GK8A 4E3VA 1GZ1A 3TMLA 2PF8A 1VBHA 2PCEA 1EUAA 1KR0A 2XVPA 4M7TA 3MDUA 1Z7AA 3LM3A 4TX9A 5EFFA 5C6MA 1QI3A 2ZRVA 1O94A 4FAMA 2GZXA 1AMYA 3ZVHA 3E49A 3I4EA 3UY7A 2Y4SA 2JE8A 1PL9A 1FWCC 3UF9A 5AYYA 2ZUMA 4MUPA 1AW5A 3TJIA 5DRIA 1T41A 1KM6A 3GR8A 4ZQNA 1IXQA 2WC4A 2DV0A 4XVDA 4O8RA 3JZUA 2ZTKA 3TROA 5CZJA 1QK0A 3APGA 1HKKA 4QXIA 3O05A 1GWJA 1RJRA 5A8MA 2HK0A 2YDRA 3M5XA 3U2CA 4UMAA 2P5NA 3GU9A 4L61A 4P7LA 2RKXA 3UD6A 1VEOA 4LC8A 5FJUA 2EPNA 2Y5EA 4DZ5A 3II1A 2B31A 4PMVA 1GW1A 1LUCB 1JAEA 4FNRA 2QVNA 2VR2A 1HKJA 4PMNA 5A6KA 3QYQA 3QMSA 3VE9A 4PE8A 4H8NA 5CJ5A 1TPFA 4LCSA 4RW5A 4TUFA 4DWDA 2X0HA 1PDYA 1X1ZA 3NL6A 1V0NA 3BLFA 1K6WA 1BYCA 4GWEA 4BKNA 2PDJA 4Q4MA 1IXOA 5C2CA 4Q8QA 1UHVA 2Y7GA 2ZUVA 1XIDA 4RXGA 4H9UA 1AQHA 2GVEA 4GC4A 3TW6A 1CGYA 4DZAA 5G4WA 5BRBA 4DPQA 4QE4A 1XS2A 3S4TA 4KEMA 1I0DA 2B81A 4BWLA 3N3MA 4DWSC 3GU1A 1XLFA 2AGKA 3MU7A 3I10A 4IOTA 4XAYA 4GZEA 5HBFA 1Y5WA 1UKPA 1EJVC 1R87A 5L6UA 3VNZA 3TU9A 4AWUA 5REQB 4YTSA 1EIBA 1J0YA 1T5AA 2PWUA 2OMAA 1YMYA 4B4HA 2BVDA 1OD8A 3DIPA 1IT0A 1PWMA 4O1CA 1VBGA 8XIMA 5I3HA 2VRJA 3KCJA 1OX5A 1KBKA 1TREA 4FR6A 3AJ7A 2WYSA 2G3MA 1NFPA 2NXHA 3UCQA 3HBLA 3LOTA 1EXPA 2OU4A 1QPRA 1G01A 4N9EA 2VEFA 2XIJA 5A2CA 3W1MA 2BG5A 4W93A 5GJPA 2Q09A 1I2OA 5AC6A 3R58A 5JBFA 1AD4A 1L0PA 1VBRA 1VIZA 3W7EA 4DBEA 2VGBA 4YXGA 2KAUC 1W2PA 3REQB 1XRFA 3I3DA 3RJYA 1I75A 4UR7A 4YIWA 2VOTA 5DLCA 4WDWA