2ACUA

Tyrosine-48 is the proton donor and histidine-110 directs substrate stereochemical selectivity in the reduction reaction of human aldose reductase: enzyme kinetics and the crystal structure of the y48h mutant enzyme
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
b'ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVHQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title Tyrosine-48 is the proton donor and histidine-110 directs substrate stereochemical selectivity in the reduction reaction of human aldose reductase: enzyme kinetics and crystal structure of the Y48H mutant enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 102
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1994-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2acuA00
3GHRA 2IPGA 4YU1A 2PDBA 3GUGA 2FZBA 2HV5A 5JH1A 1HQTA 2IKJA 3UZYA 4JTRA 4JIRA 4PMJA 3NTYA 3B3DA 3BCJA 4GACA 4WEVX 2R9RA 4QBXA 1AZ2A 4LB4A 1X98A 3O3RA 4HMNA 2BP1A 1YE4A 2WZMA 3UFYA 1XJBA 3N2TA 2R24A 3UGRA 3UZZA 1JEZA 3WG6A 1OG6A 3RX3A 4XZHA 5M2FX 2FZ8A 1Z89A 1MRQA 4ICCX 3FX4A 3LBOA 4GABA 3WBXA 2PDUA 4WDUA 2F38A 4XAPA 4WDTA 4XZIA 1ZQ5A 4LBSA 2NVDA 3LD5A 2ACSA 2ISFA 2PDQA 2FGBA 3C3UA 3EB3A 3CAQA 4JTDA 2I16A 3V0UA 4L1WA 1T41A 2HVNA 5HNTA 4PRTA 2HEJA 5DANA 3R8HA 1QRQA 4DZ5A 2PDJA 3LENA 3CMFA 3G1RA 2P5NA 2PDNA 4QX4A 1S1PA 1EF3A 3WBWA 4XVEA 2PDWA 1YE6A 3COTA 3T42A 3RX2A 4XO7A 4FZIA 1X97A 1PZ1A 4DBUA 3BV7A 1ZGDA 5JH2A 2DV0A 1HW6A 1A80A 1X96A 2IKIA 3RX4A 2PDHA 2IQDA 4L1XA 2FVLA 1M9HA 4LAUA 1LWIA 1Z8AA 2PDMA 1FRBA 2IS7A 5LIXX 1ZSXA 1Q13A 5AZ0A 2HVOA 3H7UA 3R8GA 4FA3A 3H4GA 1S2CA 4IJCA 3QKZA 4XZLX 1EL3A 1MI3A 2A79A 1K8CA 1PWMA 2I17A 1YNQA 4PR4A 5LIKX 1GVEA 4JQ4A 2ACRA 3BURA 3V35A 4DBSA 1US0A 2PF8A 4XZNX 4FALA 4EXBA 5C7HA 2FZDA 1AH4A 4IJRA 2PDGA 3MB9A 5KETA 4WDWA 1XF0A 4H7CA 3D3FA 2C91A 3M0IA 4YVXA 4NKCA 3WCZA 2J8TA 3LEPA 4G5DA 3LZ3A 4I5XA 2PDIA 1XGDA 2PZNA 1ZUAX 3CASA 3U2CA 2INZA 3MC5A 2PDFA 1AZ1A 2IQ0A 3R43A 2INEA 4ASTA 3GHUA 2CLPA 1QWKA 2PDXA 4AUBA 2PFHA 2NVCA 5HA7A 3EB4A 4DBWA 2AGTA 4YS1A 1Z3NA 2ACUA 2IKGA 4MHBA 2FZ9A 1EXBA 1Z9AA 4XVDA 1C9WA 3UZXA 2PD5A 2DUXA 5HNUA 4H8NA 2BGQA 1S2AA 3LN3A 3R58A 2PDLA 2PEVA 4ZFCA 2IPJA 1AFSA 2WZTA 2HE8A 3FJNA 3VXGA 4JQAA 4JQ1A 5LIWX 1PYFA 4LB3A 3UYIA 1T40A 4GA8A 2HE5A 3Q65A 4JQ3A 1LQAA 1S1RA 2PDKA 2ALRA 3LQLA 3P2VA 1YNPA 3V0TA 1EKOA 1VBJA 2VDGA 4LAZA 1PWLA 3CV7A 2IPWA 4Q7BA 4WRHA 3GHSA 3UWEA 3DN5A 4PUUA 4EXAA 4YVPA 4R9OA 3BUVA 1AH3A 4JIHA 3Q67A 3DOPA 4GQGA 3M64A 3H7RA 1RALA 1J96A 3R7MA 3UP8A 2PD9A 3EAUA 4XO6A 5LIUX 4GQ0A 1MZRA 4XZMX 3R6IA 4JTAA 3G5EA 3F7JA 4WGHA 1IEIA 4Q3MA 4QR6A 4F40A 2BGSA 3M4HA 3S3GA 1RY8A 1IHIA 4GIEA 1SM9A 4WDXA 2F2KA 1UR3M 3ERPA 3R94A 3LNMA 3ONBA 4FAMA 3LQGA 4JIIX 1R38A 4JTQA 2IPFA 5LIYX 2IKHA 3LZ5A 3O0KA 2PDPA 3GHTA 2PDCA 4JQ2A 3N6QA 4QXIA 4PUWA 1Q5MA 4YVVA 2DUZA 3KRBA 3UG8A 2QXWA 5AZ1A 1AH0A 3ONCA 4RPQA 4JTCA 3UZWA 2HDJA 4HBKA 1PZ0A 3V36A 1ADSA 3CV6A 4GCAA 4LBRA 4OTKA 1VP5A 2ACQA 4XK2A 4IGSA 3V0SA 1RY0A 2PDYA 3WBYA 3CAVA 3LUTA 4PRRA
chains in the Genus database with same CATH superfamily
3PZQA 1KR1A 3LGGA 1UKOA 3L68A 2G50A 1VFTA 3A23A 3FK4A 5A8NA 1W1A1 2QJJA 4LVGA 4C6NA 3LV5A 4O10A 2WQDA 4YLWA 1TA3A 2Y61A 3DI1A 4ZQRA 3ORWA 3TJ4A 1KWGA 3VIIA 4Z08A 1B57A 1RZMA 3RXZA 5HUOA 1IIGA 4H9ZA 4GRSA 4WEVX 4A8LA 3GVGA 2PP0A 4QBXA 4UOJA 5GNZA 3LOTA 1W91A 3GWQA 2WW5A 2NLIA 3QR0A 3KHDA 3ZT7A 3P61A 4CEXC 3SSJA 3NO5A 3OZYA 5M2FX 2FZ8A 4LGXA 4AZHA 4DLMA 3EXTA 4JTFA 3GNNA 4IPNB 3VC5A 3OTRA 1OY0A 4IFKB 5A95A 4LJ3A 3E9AA 4L4PA 1V0NA 1J5TA 2JBMA 3CEUA 4QJ3B 3N04A 3TQ0A 5JVLA 1ZQ5A 1EIXA 5FCZA 1CTNA 1V0KA 1Y0EA 3LD5A 2NVDA 3OOQA 1DJNA 1VHNA 4I6VA 5I3KA 1UA3A 1JDFA 1EJVC 1UWUA 1I2NA 4W88A 4RZ6A 5E9XA 3MW7A 3L5MA 4HD5A 4A3YA 9CGTA 1OF8A 4JTDA 1CXHA 4IT1A 2OVLA 1XPYA 3UXAA 4Q4RA 4DJFA 3GNRA 2HVNA 4OHQA 1QXLA 4IXXA 4ZVJA 3U57A 3II1A 4UMCA 1I4NA 1XWYA 4DM1A 5DBUA 5IFPA 2E5CA 2J7DA 2FGZA 1KKRA 6ENLA 2PTDA 4RCXA 2XIMA 4AZCA 1F4HA 1RLDA 4LALA 3S6DA 4NZ4A 3VDAA 3CUGA 1Z44A 4UMAA 5CQ1A 1XIBA 2X2YA 4UTTC 1X7IA 1MDRA 2OWXA 3MI6A 4JFWA 2OYLA 3L5LA 3LCXA 4G2DA 1JFXA 1AODA 3PZ9A 3P6LA 4RE4A 3W0KA 4HU8A 4MPKA 2VX7A 2Z25A 2Y5SA 3T6CA 4PSPA 2CU0A 3FSTA 4NYYA 4NU7A 3ZSSA 4LEQA 1GG0A 1TCDA 4HMCA 3ZQ9A 3N9SA 5DBTA 3ICJA 4M29A 3L4YA 4WHBA 1PEZA 2QJNA 1FXPA 1ZHAA 4O1AA 4J2PA 4EF9A 2YL5A 4QS6A 5AZ0A 4IH3A 1LRTA 2BB0A 3R8GA 3O6AA 5T9BG 3AWOA 2EF9A 1X6UA 1JCLA 2VZUA 3CJPA 3QGKC 1QCWA 4P61A 1UWQA 1U2YA 3CT7A 4WKFA 1US0A 3GXFA 3NDOA 4U28A 1LBMA 4UTUA 3IJLA 3FVDA 3GM8A 1IGSA 2QUUA 9RUBA 3UJFA 3ABRA 3TTOA 3SO7A 4E4PA 2DZTA 4J27A 3NL3A 2CKSA 4TMBA 1TE1A 1KBKA 2QV5A 4AD5A 1WBJA 2GUYA 3MMUA 2CYGA 1WV2A 4NI8A 3KFTA 2F84A 2YPIA 4W84A 5GPRA 2D1ZA 1KBJA 1QFEA 5H2ZA 4ZO6A 1QNPA 2VWTA 4XV0A 2O92A 3GIQA 4N2YA 1FWRA 2I14A 3I7SA 3QV6A 3ZR4A 3BC9A 3NEVA 3FFSA 1N2VA 4RZBA 3S1UA 3MDUA 2POZA 1HJWA 3RRAA 2WPGA 1EJXC 3BG3A 3EOSA 1XSJA 3RN6A 3G1YA 1L2UA 1VS1A 5IM51 3GFZA 3MUIA 4DJDD 5CJ5A 3TNOA 2X1SA 4HNCA 1X6NA 2WCAA 4HMDA 1O5QA 4MB3A 3IAPA 1US2A 3R58A 2VGGA 2P10A 3W4RA 3A12A 3PULA 4JX6A 4KFOA 4N0RA 4W7UA 3URQA 1W9UA 3VXGA 5I03A 1GHRA 1EC8A 2OQLA 3L5AA 1FY6A 1TWDA 2C0AA 1FWTA 1SZRA 1A5CA 2VM8A 1W3JA 2AKZA 1ISYA 4KWUA 3QPYA 3PTMA 1W31A 3TYBA 3B9NA 3GYEA 3CHCA 2IPWA 1ODUA 1E3XA 4HHLA 5KINA 3G0SA 5FEWA 1YPIA 3DN5A 1UCWA 2O0TA 1ENUA 2FYMA 3M47A 1UIOA 1F7BA 3UWWA 2PTYA 2WMGA 4HHPA 4HNOA 4YL2A 4ZQNA 4IISA 1UJPA 1BYBA 2FGLA 4O1BA 5T8GA 3L4TA 3M64A 2DQXA 2XH0A 3UU0A 2X1IA 3ZJKA 1W56A 4GXMA 3U2OA 4OE7A 1XYCA 5LNWA 4J2MA 1BHGA 3A22A 1FWIC 1KLZA 4XZMX 1GK8A 1QHPA 1TZ7A 4JTAA 3F7JA 6REQA 4JHMA 3L12A 5C9RA 3NO3A 4CCDA 2QMKA 1XQKA 2B7NA 2V63A 1RVKA 1BFNA 2REQA 2XGZA 3SCPA 3GXTA 4BA0A 4QSFA 1QU4A 5GJNA 4AHPA 1KFCA 2BHZA 2B0MA 4G56A 4JTQA 3W71A 4MNLA 2J62A 3TSBA 3TKFA 2Q71A 4I90A 4PFHA 4XIAA 2VFFA 4UZSA 4AX6A 4UR7A 4RV8A 1W3NA 1QBAA 3KL5A 3UG8A 4AHQA 3ZM8A 3THDA 3TSDA 4DZHA 3UWVA 1VZWA 3VO0A 3OGSA 2J66A 3W7NA 3HPZA 5HR7A 1KKOA 1R3QA 2WMIA 2PRLA 3P74A 3O6DA 1HL8A 3KHJA 1GOWA 1GW1A 1JUKA 2JGQA 1MUMA 4P7RA 5J8LA 1UOZA 5I02A 3N34A 2CBUA 2W61A 3W76A 4O54A 3T1GA 4BQ3A 1G4SA 4PTXA 4UFIA 4NI3A 1NH6A 4MB4A 2HV5A 2ZUUA 4HU0A 5LSMA 1OX4A 4E3TA 2IKJA 4GY1A 1TWIA 2Y7GA 4PMJA 1O60A 3OYXA 3UWUA 1ZJHA 2NSOA 4IMDA 2DORA 4CNNA 2ZKMX 1C29A 3L21A 1XLLA 3S1WA 3MJYA 1UA7A 4CCEA 3LHWA 4X2PA 1B9ZA 2V9DA 4IG2B 3VIJA 5IDIA 1EIBA 3S5YA 5CPMA 1BXCA 4TMCA 3PZTA 2BASA 4FR1A 1F07A 3NEHA 5CZJA 4LOCA 1J4EA 3DH7A 2XWEA 3CMJA 4PBGA 3AUOA 2OJPA 1WUEA 4MVAA 4WY0F 3OGRA 1HN1A 1FP8A 2Z27A 4AZ5A 1YIXA 4NILA 3U4AA 4GXWA 4BF7A 2CZFA 3WLPA 3WQEA 3W7OA 2O4QA 3JZUA 3GG7A 4FNPA 3EBVA 4UNKA 1R9YA 1T41A 4GY0A 4PUMA 4LAOA 1ITUA 5LZLA 3MZNA 1W1VA 3OBEA 5CPQA 5DANA 3BVJA 1Q6FA 2GQAA 3GVVA 3NQ2A 3HF3A 3KBJA 2WPBA 3BW4A 1EF3A 4JYDA 3W00A 2PGEA 1A0EA 1WOBA 3VVGA 4Y8EA 5I77A 4MADA 3B40A 3TW7A 3KOWA 1T8QA 3U9IA 2V5DA 1K70A 2WANA 3GC2A 1GVIA 4LU0A 4GWEA 2PDHA 3W23A 4MYAA 4MJ2A 2UY4A 2YFNA 5REQB 2Y8UA 1QT1A 4A3RA 5HJYA 4LAUA 4I9MA 3UNTA 4UTWC 3T2QA 1E5NA 4S3GA 1LF1A 1MEWA 2IS7A 3PNUA 1LTDA 5HATA 2HJPA 3DHDA 5ENLA 4B5UA 3PZGA 4IQJA 1GOXA 3BLIA 4O57A 1BRLA 2E9BA 4X9SA 2BSLA 2OQYA 3H2CA 4D9PA 4MKNA 2G5WA 2E1WA 3M5YA 4WF7A 1YNQA 1S39A 2EAWA 5HWNA 1LCOA 2GL5A 2DW7A 4XD3A 1KXHA 4FI4A 3BOFA 3W1PA 2RDTA 4HSHA 1AH4A 2OFJA 3WEOA 3MUZ1 4MWAD 3QPZA 3WUGA 1XF0A 2GK1B 1XICA 2ZFAA 4DY1A 2XYLA 3UPMA 2EJAA 4S3KA 1KCKA 3R1ZA 1V3IA 5M5DA 4ZQMA 2J8TA 2JF7A 1XLIA 1R9XA 4ZBCA 4ZCWA 3ZWTA 1GVFA 3L4UA 4UFHA 3FDGA 1TREA 3VNIA 3QM3A 3GBEA 5CGQA 2D22A 2NUYA 2YZRA 4K7YA 4QLLA 1JRBA 1EJRC 1LWJA 1BAGA 4KGLA 3CU2A 2EPOA 4ASTA 3ITLA 5F1VA 2IW0A 4Y9OA 3S9ZA 2ZXBA 3O63A 2UWFA 1WO2A 3KRSA 5CAKA 3LLXA 2PCEA 3OZOA 3AYRA 1G4EA 1V3KA 5JQ9A 1V6TA 3AHYA 1DIDA 3S47A 4IP7A 1E70M 1DJQA 1Y65A 5BU9A 4CVUA 2BVYA 2DP3A 4C6CA 3G1AA 3LBCA 5GNYA 4NQ1A 1S2AA 3B9EA 1NP0A 3GVRA 2VCBA 4UCFA 2ZX7A 2G4FA 3I4KA 3TOYA 1D3HA 5BXSA 1ICQA 4JQ3A 4E3VA 3WNMA 1QNVA 2ZRZA 1SO5A 4IP5A 1E72M 4LVAA 2YB4A 2DUAA 3PBGA 1OFQA 2I9EA 3WDIA 1D8WA 4AFYA 3WQVA 2OWCA 1VB9A 1PIIA 1W1ZA 2E8YA 3AHTA 3PR2A 2ZQ0A 1A47A 2JKPA 5CLWA 1EGZA 1XIJA 1UC4A 1UR2A 3WDPP 2YZ5A 3Q67A 3SGZA 1ZENA 4ZODA 2A3AA 2CWXA 3GFYA 5DEZA 4IFKA 2QMJA 3LTSA 4JHZA 1DQWA 4IPIA 2OZ3A 3VINA 1TIMA 2DDXA 4XISA 1ZALA 2I9UA 3S1XA 4XKYB 3L67A 3RR1A 2E8ZA 2ZX5A 4G1NA 1L6WA 3G2GA 3QMSA 1IHIA 1EJSC 1W3LA 2FTYA 1KA9F 3AIUA 1F9CA 2W66A 2OZTA 3B0UX 4AD4A 5HWMA 1FWJC 1XP3A 1YDOA 4H7VA 2JIWA 4E6MA 4W87A 3DDMA 3PS7A 5KZMA 3THQA 4UTFA 2OPJA 4CQDA 2OEJA 4NZ5A 1B0IA 2Y63A 4TUFA 3R8RA 3IJ7A 3QMRA 1X6LA 2WM1A 3T0DA 1NWSA 3UZWA 1SVDA 4AHOA 2RH9A 2Z7GA 1Q45A 4HA1A 1N7KA 3W88A 1UBPC 2V3DA 5AYZA 5LNUA 2QCCA 1DWHM 3VD4A 3V0SA 1DJYA 3EGJA 3LMYA 1QPNA 3QRHA 3F4DA 1KFBA 1YPXA 1DJXA 3UXDA 4V2XA 1RBLA 4ZXOA 4XB3A 5AC8A 1O95A 4H9UA 3ITCA 2PWVA 1CDGA 4BI5A 1B3VA 4O8AA 3HG5A 2BMBA 3E6EA 2XUCA 1OFBA 6XIMA 3V1HA 1M53A 1RP8A 2GGJA 4X3ZA 2QCNA 1F6PA 5H1WA 5T9CE 4D6DA 1ME9A 1N8IA 4WX2A 4WUIA 3NQAA 5DX7A 2QEZA 4KWWA 2PTXA 4QSHA 2OO0A 2XG9A 3WDJA 2NUXA 1CGXA 3AIRA 2HISA 3MKVA 1TSIA 1UD2A 1GKRA 2VZOA 3B3DA 1YXCA 4GVGA 3BCJA 3M0XA 5EMJA 4XUYA 2PLJA 5XIAA 1KTNA 3MMWA 5BWFA 1CI1A 3FAWA 3H26A 3IIXA 3MI2A 3OA3A 1XRSA 4UBPC 3DBPA 1GQIA 2WZMA 2XSBA 4PULA 2BGNE 3UFYA 3GDKA 4ZB5A 3PF3A 4K8HA 1JRCA 4C6OA 4PYSA 3UGRA 1JR1A 4MY1A 3M44A 1W2PA 3OW1A 4GLEA 4AB4A 1Z89A 1MEIA 2G4JA 3WD0A 1K6AA 4JFSA 4HZMA 3AFBA 4XAPA 4XZ9A 3SAZA 5ABGA 4Q33A 1Z41A 3FKKA 3M0ZA 4LXFA 4ILSA 3OLGA 3H54A 2DW6A 2J24A 2W91A 2DJLA 1C92A 2D73A 1EJWC 4QM1A 1MDLA 4LPCA 3MVTA 4WIWA 3AIQA 3KTSA 3K5XA 1TPWA 4UQDA 5F4SA 3KS6A 4MYXA 2ISWA 1QRQA 3LENA 1OZMA 4N7QA 2WC7A 3E3HA 2WWDA 3O1NA 4PB5A 1EQPA 1LUCB 4GH3A 1T96A 2X16A 3TP4A 5KZEA 4GX9A 3K4WA 2YYUA 5A1AA 5CXPA 3B9OA 4Q4OA 2EXOA 3SJNA 5GJMA 3NQDA 2QPXA 1MXGA 2JKAA 4MMWA 1B4KA 4H9YA 2IQDA 3AXXA 1P43A 5B7ZA 3OLDA 3PJXA 1EJTC 4JCLA 3W1LA 4FX8A 1OK6A 2V69A 4B9ZA 1G6CA 2GJLA 2ZBTA 1XYZA 4TQTA 4D72A 4QEHA 1LQ0A 1XQLA 4XAFA 1ZSXA 6XIAA 4NHVA 1NWRA 3ES8A 2GSEA 4O0KA 4XD5A 5TAOA 1OHLA 1BGAA 2AMGA 3KVLA 4Y9MA 2YR1A 4LUIA 3M0VA 1WKFA 2A79A 1GYLA 3H12A 4CUCA 3BURA 3GTFA 3HMCA 3I7QA 1SJAA 1O68A 1TV4A 1R8LA 1PTDA 2PPGA 1BQGA 3E0FA 2XZ9A 4HIBA 1I1WA 2ZZ1A 4DJEA 1S46A 2C19A 1GYMA 2J6XA 3ABOA 3SCNA 1Q63A 2QGYA 1JDCA 2G3MA 3CAWA 3WYZA 3HBLA 2CITA 2VO5A 1XGDA 4XUGA 4DRSA 2ZX6A 4RJEA 4JHOA 2W67A 4M7SA 4HK7A 3QTGA 1CX9A 1D9EA 1CXKA 1LQ2A 1LRNA 7ODCA 1VPYA 5C9ZA 1E6ZA 4EANA 1OX5A 4TTGA 1XBXA 2HZGA 3GIYA 4LYPA 3F5KA 2PWDA 2XSXA 1V51A 5CH9A 4RDWA 1XRFA 1K9DA 1ONRA 4HYVA 3CUIA 2XTKA 2F6XA 2ATSA 2OEMA 1UB3A 1W37A 2YA2A 2A7PA 5D9PA 2Y5EA 4FS9A 5G1YA 3AU2A 3BK0A 3IGSA 1OCQA 3GNDA 4Y96A 4A8IA 9XIAA 4R3UA 4DYJA 4ZFCA 2F6UA 2IPJA 1YTKA 3W7JA 4ALDA 2EKGA 2GQ3A 4NASA 3O05A 2WAGA 3R79A 3SUUA 7A3HA 3TSMA 3VIKA 4JTUA 1ZBWA 1PO9A 3PTQA 3BLLA 1E0VA 2WCGA 3PTDA 1PWLA 3IARA 3VOIA 2HNHA 1GOOA 4QG9A 5A5WA 1TV3A 3KM8A 4IG2A 3HA1A 1YHTA 5D38A 4UFMA 3WX7A 4YVPA 4IMAA 4CQ8A 1R47A 2Z7KA 1VYRA 3IS4A 3PJUA 3W6LA 4OV4A 4K7VA 4BQ4A 3NA8A 4W93A 1TPFA 3FA4A 5FD0A 4CU7A 2WMJA 4F48A 2MNRA 2ZZ4A 1MZRA 3U48A 5I78A 1EEPA 4IPLA 4M24A 3R6IA 4P8XA 4WGHA 4WXYA 2X1UA 1L2QA 3S3GA 5G5IA 5EA9A 4FNUA 2HPMA 4JICA 3GNXA 4W85A 1VIWA 1UR3M 4QP0A 3LHUA 1EZWA 1RP9A 1NFGA 1P6CA 2VDIA 4OU1A 3M9YA 3AS3A 3VU2A 1XISA 2QJHA 2YBVA 1MUWA 5RUBA 4AYGA 3WK1A 5CG7A 5HWJA 4JKLA 2PA6A 1HNYA 3FY1A 4RZ5A 2Z26A 3GY1A 2W6RA 3WQ6A 2FPTA 3SCWA 4IX2A 1JZ2A 4PEEA 2A3EA 3AI0A 3IWPA 3CLMA 4Y2WA 2GGIA 1XG3A 1SFLA 1KLYA 3EA1A 4B3KA 1E9LA 5C2CA 2OQHA 3QGAC 7XIMA 3NSMA 1L8NA 4O13A 5TD4A 1OEPA 5J5DA 1XCXA 3NQ6A 1FUYA 4C91A 4O16A 3CB8A 4M8UA 2XZ7A 1KNWA 3LHYA 5CCZA 2XU2A 3KX6A 3W6YA 3W84A 3KVJA 1EF2A 2Q8LA 1H61A 3VE7A 1XM3A 1XIHA 4ZXLA 3B0VC 3VKCA 4R34A 3QYQA 1XBYA 1M7XA 4LB4A 1X98A 2GK1A 5IFTA 3DFQA 1CWYA 3OHIA 3N15A 3PB2A 1BF6A 4KBXA 3SQMA 2XVNA 3QW3A 4H9XA 1Y5VA 1ZLPA 1OG0A 3BLOA 3F1QA 1PVNA 3WFZA 5DCDA 3FVMA 4LAMA 2F8QA 4ICCX 4EPKA 4L56A 2B81A 2AGKA 2X0YA 3LBOA 4RPPA 1V7AA 4AH7A 3EA3A 4BCEA 1NFBA 4NJHA 4HHHA 3QFWA 5E0KA 4W4QA 5MKGB 4R7JA 4WJ8A 4O4WA 5E5CA 2ZC8A 3F4VA 3GYCA 4DYEA 1FCVA 2QPSA 3UCDA 3G1DA 4NJJA 4HNUA 3ARXA 4I9JA 3B0PA 5KITA 5CSSA 4M51A 1XUUA 2V30A 3GG0A 1KGXA 3VIHA 2D69A 3UW6A 3H4WA 1OFPA 3VDHA 4QFUA 2JGYA 3WBWA 4NY2A 2QJGA 4WJEA 4W89A 4FZIA 3VOJA 3ME3A 2VQTA 4RKAA 5EPDA 3H24A 3ITXA 1GORA 3W9ZA 4U2YA 1BD0A 4C1KA 4H2CA 1CT5A 4LS1A 4G9PA 1RQEA 2H9AA 2FQIA 4UIOA 3BICA 2W79A 1SW3A 1XSIA 5CSYA 4E2OA 3PK7A 1W8SA 1EEXA 4ZZ9A 1LL7A 3DG3A 3FS2A 3N2OA 1M9HA 2FTWA 1C90A 5BOEA 1TTQA 4QQ3A 2CWNA 2RJHA 3CTLA 4CCZA 3ZMRA 3OHMB 3ARTA 2HVOA 1EGVA 4AISA 3P14A 4NP7A 4MY8A 4RE0A 3GXNA 4AZ6A 4FA3A 3VC6A 3SUSA 1XIMA 4C7FA 3VGDA 4UQBA 1AQMA 1XKYA 1K8CA 3P5YA 3RFAA 3GR8A 3ZFHA 3W26A 4ML9A 1J0IA 3C2EA 4NF7A 1JIBA 1H7RA 4P7LA 4XKYA 1BXBA 4KKXA 1RXOB 4WDWA 4DUVA 3RF9A 1MO0A 2WSRA 5TNVA 4ZQPA 3JRKA 3LGEA 2O7QA 4E4FA 1YRRA 4WOZA 2XVPA 1Q7MA 1JZ3A 5HMDA 2EBNA 4O15A 1EPXA 2XM1A 1H7PA 5CZKA 4AQLA 2A3CA 3WBAA 3B8SA 3KP1A 2GDVA 2CLOA 1O5KA 5KSWA 4IL2A 3VKJA 3T40A 4BZYA 4MJMA 1UKTA 3W38A 1PUDA 2C7FA 4D8LA 4D1IA 4C6DA 4IIHA 3RLGA 1UUMA 2OMAA 4MG4A 3SR7A 3ZOAA 1D2KA 5D32A 3BARA 2IKGA 3N3TA 3HQPA 4HPGA 5AHEA 1RK6A 3A24A 2VX4A 3WLNA 1XLKA 3VKDA 1PKNA 3NQFA 3WLTA 1GWJA 1H09A 1LLZA 5EU9A 1TFVA 1A5SA 2HVMA 3POCA 4JNYA 3ID7A 3Q37A 1U83A 5K9DA 2PDLA 1EH9A 3VX0A 1LJYA 4L7ZA 1PYFA 2FH6A 3UR7A 4AZGA 3LM3A 3Q65A 3T4WA 5I3JA 5I3DA 3UXLA 2Z24A 4XSLA 1JPDX 4AEEA 4S23A 4F9DA 1H0GA 4EX4A 3K4DA 5G4HC 4JCMA 4GQQA 3CEPA 1KC7A 3W3OA 3IVUA 4U4MA 3G0UA 3QSTA 4ZENA 1KGUA 3LCIA 3TA6A 3BJFA 3AUJA 5D2YA 1CGVA 1XBVA 1U5VA 3MCOA 3WQ8A 1HO4A 3DOPA 4ATWA 2H8XA 1OIMA 4LC8A 2A4AA 3EDDA 3MJMA 4DF0A 3TC3A 3W53A 2PD9A 1QPQA 3GB6A 3A4AA 2ZVIA 1GHSA 2ZTKA 3E1F1 2INFA 1IT0A 3EWDA 1ONEA 4WVXA 1YBQB 1HKMA 1IEIA 1Q4NX 3I3EA 1CIUA 1K8ZA 3A3XA 3PBMA 3VNMA 4XD6A 2C79A 3G3MA 2CBVA 3WQ5A 4AWSA 2V3GA 2E6FA 2D2JA 3LQGA 4JIIX 5HJLA 3EKZA 1Q6GA 1EO7A 2OLHA 1LUCA 5U4NA 5G2IA 3AWNA 4JQ2A 3N6QA 4QXIA 2C1GA 3QN3A 4PUWA 3FIGA 3THAA 3NXFA 1XD0A 5FEXA 2HDJA 5CPOA 3WFLA 4HCDA 4OKDA 1HVQA 2E6AA 4BEUA 1K7XA 4B2DA 1JUBA 4I7VA 1RY0A 4HHMA 4AVNA 3WD4A 3BG9A 4QROA 4KCUA 1G9HA 3TV8A 1EOKA 3E2SA 1A0CA 4B5XA 4OOUA 2YX0A 4ZMGA 4ATLA 4AAJA 3T0BA 4IXHA 2XJ7A 1VF8A 3SEPA 2Y89A 1JPKA 4QCFA 4W8LA 1W9XA 4W7WA 1YDYA 3HG2A 2POTA 4DI9A 1G5AA 3O7UA 3KL0A 1XS2A 5D8ZA 3HGRA 4BEQA 2I56A 5EMYA 3HPFA 3D3AA 4LS0A 1MFVA 2WVVB 3QQ0A 3P67A 4MKVA 3NTYA 1TWZA 4UC5A 3QZAA 4MSSA 7TAAA 1M6JA 2FDSA 1GNXA 3IJQA 1JZ5A 5DMNA 1WZLA 2A21A 1DWIM 3A5VA 1DJZA 3UPBA 4MTVA 4FXSA 3MS8A 3O06A 1XJBA 1RCQA 7CGTA 1QO2A 2BS9A 1XCFA 3ITTA 3UXIA 5F7UA 4Q4PA 3M0KA 1LBLA 4OECA 3GTNA 1LORA 3C2YA 3C2VA 1V3HA 1CB2A 2A7RA 1VHCA 2Y2WA 3IJ9A 3AHVA 3QC3A 1XLFA 5LA2A 5CBIA 1AJ2A 3EPOA 2QW5A 4KT2A 1TPB1 2R8WA 1E1EA 2EPKX 4K8EA 4L1GA 4DLFA 1R3SA 5D05A 2ABAA 4UTKA 1TVPA 3TYAA 1POJA 3WF0A 4F8XA 2C13A 1H11A 4ACZB 1QW7A 1VFUA 2ZA2A 1XL9A 1ECEA 1NP2A 4DJED 1KRCC 3PPFA 3H2OA 2DZSA 2XN1A 4E0CA 3EWUA 4OUEA 2JF6A 3RPMA 4JNMA 2PBOA 4JKKA 4C5YA 3CPRA 2BZNA 1UP3A 4H6KA 1F3XA 1MNSA 3VTRA 1KCLA 1XLEA 3POHA 1K77A 3M0LA 1LYXA 3A9IA 3ITOA 2P88A 1VAHA 3GTHA 1GZJA 5AYXA 1OZQA 1I2RA 4DO4A 4LUJA 1L8PA 2FLIA 4JEQA 1TG7A 2J7GA 4GE8A 1W1TA 3N73A 3RU8X 2GVLA 3LPOA 3PG9A 1XLGA 4HNVA 5FJOA 3CK5A 5AKQA 4MB1A 3H7UA 3WH9A 4JAWA 4CN6A 2B4GA 2Z1WA 5CGTA 1UD5A 3A9BA 1GW9A 2QT3A 4O17A 1BVNP 1E4IA 4IUOA 3ISIX 3DERA 3UEQA 3MUXA 1IXOA 4P5UA 2OT1A 1E56A 2RFGA 3FV9A 1W1B1 1J11A 4GVIA 4UQCA 4YHGA 1H60A 2HXTA 3PZVA 1GOMA 1T99A 5AYIA 1MMFA 3EXRA 1FWEC 3MDWA 5C9UA 3VUSA 3R43A 2V2HA 4AY8A 3QLLA 3ANYA 2VNCA 2INEA 4NZ1A 4FX7A 3SCTA 4YN5A 4US6A 4AWTA 4LVDA 2OLAA 3T81A 4GH1A 3H6OA 3VIFA 3VMOA 3NOYA 4FXRA 1NSJA 1HG3A 3ZT5A 2CZ5A 1R3VA 3LBMA 4KERA 4MHBA 2FZ9A 2UY5A 3L4ZA 4FNQA 2ALDA 2JFEX 3RUBL 1KRMA 2DUXA 2DJXA 3GS6A 4H83A 1SO6A 5D30A 4ONVA 3STPA 3QF0A 1RJRA 3WUBA 1AFSA 3WK3A 4IQDA 3T9PA 3OEXA 2OZ8A 2XHYA 3NO1A 4W8BA 4UUIA 3U7BA 4G1KA 1G69A 2HE5A 3S2CA 4KRUA 1HTIA 4W8AA 2DT1A 1CPUA 2GGGA 3CB3A 1ZJAA 3VDGA 3WUFA 1OVDA 1A4LA 1YNPA 3VOFA 3V0TA 1EKOA 4LAZA 1TR9A 1Y5WA 5KZ6A 1BLIA 5T91A 5KEZA 4PUDA 1WKYA 3CLWA 5B7YA 1KBIA 3NQEA 4MDOA 4MWAB 1CXFA 5GJPA 5DXYA 4NXKA 2HTMA 5D9MA 4W9TA 4PUEA 1XW8A 3DBNA 1CLKA 4JXCA 4A3QA 4ZO7A 4NAEB 4EACA 3ITYA 2NW0A 3MKKA 2Y6ZA 3AAMA 4N6FA 4XO6A 1JCTA 4Q8QA 1BG4A 1JAEA 5J04A 3EEGA 3G1SA 3BG5A 3SGGA 3NQGA 3W7QA 4HPHA 1JXKA 4GZJA 4L64A 3W7PA 1QAPA 2VOTA 2DU2A 2HK0A 3AQUA 3ARQA 3JVAA 2IPFA 2IKHA 1J10A 4WXZA 1AUSL 3GHTA 2PDCA 3AALA 3TYEA 1GVQA 2WSQA 1AQHA 2H3DA 3UJSA 4C5ZA 1KR0A 3UETA 4C6EA 2HPIA 2ZXDA 1VFFA 1XDMA 1Q8JA 4CD8A 2YBTA 1AJ0A 4C6FA 4LSBA 3CV6A 3QYSA 5DMMA 3SFKA 1RCXB 4H04A 1QR7A 1ZCOA 4UR8A 4DNHA 2ZCGA 4D6EA 5C2XA 3W02A 1HIZA 3N6HA 1H0IA 3SCUA 4GPNA 3BMWA 1FWNA 5D2XA 4QGCA 1QOXA 4X60A 4O1CA 3HO8A 1K6WA 4IHCA 3O07A 4IWWA 1PZ3A 4F79A 3UZJA 4MLJA 4M6PA 3W37A 2VFDA 2OSWA 1IYXA 1CZ1A 1FWAC 1THFD 4GK8A 4CGTA 5BMWA 4LYQA 2C1HA 4KCWA 4A8RA 1Z42A 3VDBA 4EIVA 4N9EA 5JH1A 1SZGA 4GI9A 1HQTA 4L61A 4MM1A 2DIEA 4GIRA 3NPXA 1P0DA 4DAIA 4QDMA 4MJZA 2Q01A 2V5BA 3ZJ6A 1UWRA 2ZC1A 2ZX8A 4EAMA 4F66A 2W62A 2XFWA 4GZ7A 2Z1KA 1PCWA 2Z28A 2BP1A 3TTSA 3C86A 1R7AA 1TA3B 1QOQA 5HMSA 4J40A 1S3HA 5FAJA 4S1FA 4XTDA 1E6QM 1TPC1 2XVGA 3GU9A 1ISXA 1AA1B 4DNMA 3D5HA 2RDWA 1K9TA 3MMDA 4UTJA 4DI8A 3A64A 3SUTA 5AVNA 2YXXA 3S42A 1BWLA 2ZUSA 1NELA 4WDTA 2WKJA 2NT1A 3QKEA 2Q6ZA 2ATMA 2XISA 1KM5A 2PZ0A 3I6RA 4RNHA 2Z6JA 1KD0A 4YTTA 4ICMA 2G3FA 3WENA 3DENA 2YYTA 3OA5A 5D09A 3NWRA 4NX0A 1XIEA 1VLWA 3ZYZA 4DBEA 2P5NA 3W1AA 2ZXQA 3QOMA 4LCSA 3D6NA 3TYDA 2P53A 3CZKA 1FFQA 4YTQA 4RDVA 1PDZA 3SBFA 1IR1A 2V6AA 3O0FA 1PCKA 4JR5A 4DBUA 1QNSA 1ZGDA 2OSXA 3E0IA 3GUWA 5EBAA 4U31A 2H6RA 3B9DA 1Q6QA 1EO5A 1NTHA 3K8KA 3FEMA 1FFRA 3MY9A 2AQWA 4U33A 1SFJA 4AZCB 1TV5A 2ZRXA 4Z2GA 1XYMA 4TX6A 4FOKA 1E9YB 2WXDM 3B03A 1WXJA 4LH8A 1OGGA 1Q7ZA 5FL1A 4H00A 3P5ZA 3GQYA 2PDMA 3ZLHA 2R14A 3HQNA 3MUCA 1C91A 3JR2A 4GKTA 1CEOA 1YQ2A 4BKNA 4HCLA 1BEUA 1QI2A 3ALFA 4ROQA 2DZAA 2BOGX 3IK4A 3DG7A 4ICNA 5DT7A 3KE0A 2OODA 3MV11 2OWWA 2Y0FA 4ZQCA 4UNLA 3GD6A 1WDRA 4H2HA 4L5ZA 4RLIA 2ZA3A 2VEGA 4EXBA 3NPVA 3IACA 1QJWA 1S2UA 3UERA 4J28A 1B3XA 4IP4A 5F4XA 5K4XA 2GWNA 4O0QA 3MA8A 1FWDC 3L0NA 3WCZA 1VBGA 3ABSA 4DF2A 2AAAA 4CKQA 4J9JA 2HXUA 3EDFA 3CL7A 2PBGA 4ZB2A 2PDIA 4LUYA 4YTRA 2PZNA 1MFUA 3MC5A 2OKTA 2PDFA 1JZ7A 4DJDA 4PMZA 4A3HA 5ABEA 2G8ZA 3RMJA 4TVCA 2QDDA 1I75A 1OFOA 3W1XA 4M81A 4BY3A 4AUBA 2YBUA 5KZDA 4DBWA 3LGDA 2ZA1A 4QNEA 5EMMA 4YS1A 4PCNA 3OVPA 1UD3A 5JMUA 1P1XA 1HKJA 4L6DA 1OD8A 1ZFJA 3DKLA 4J7RA 1WNOA 3N2MA 1O5XA 4LRTA 1NDZA 3IGXA 5HK4A 4OIFA 3PANA 1DTUA 5CJNA 3RCMA 1E6XM 3CIXA 4FPSA 5L9FA 1CNVA 1BG9A 4DXXA 3A3HA 4HA4A 4E8GA 3ABXA 2OZ0A 1J6OA 1SJDA 5F4WA 5DMYA 2X09A 1BKHA 3R4IA 3WD2A 2VTFA 3GZAA 3RDKA 1G0CA 2PAJA 3QR1A 5I3IA 2F2HA 4XAZA 1FOBA 7ENLA 4R7WA 1H5VA 4KWSA 2Z0IA 2WVVA 2G3NA 1S1RA 2PDKA 3AMLA 1HJXA 2WJDA 4PMDA 5GVJA 2WWCA 2OYKA 1VBJA 5CKSA 1BTMA 2WKGA 5DF0A 3UNDA 2HROA 3TN5A 3M7WA 4QISA 4X0VA 4GYJA 4KMQA 1G4PA 5D9OA 3LSBA 2P1FA 3BAYA 5DFAA 2GWGA 4ZO9A 3CUFA 1GGOA 2MANA 2PWHA 3CPGA 3C2RA 2PB1A 5BOOA 4E2BA 2YIHA 4US5D 5A3HA 2GJNA 2QS8A 1MW3A 4OQVA 4IMCA 1EHNA 1MWOA 2X41A 3MV01 3KEHA 3BSGA 5F2IA 2A5HA 4GQ0A 3GO2A 3PVFA 3AXIA 5HMEA 1A0DA 4LUSB 3TR2A 1DIKA 3LX9A 4PEKA 2F2KA 2CBJA 3CC1A 1QI0A 4GIYA 4ACZA 3NZGA 4WGXA 3APGA 4S2BA 1KM0A 3EWBX 3P0XA 4AWEA 5GNXA 2JEPA 5HAOA 3VD5A 1TUXA 3IIPA 1EYEA 1DHPA 1NOWA 4KEVA 4RNJA 4Q6JA 1ZAHA 2DUZA 4NG3A 2WVSA 1AH0A 1U5HA 3ENLA 4BHYA 1JYVA 1VENA 3UJEA 3PBWA 1NVMA 4L4LA 3VGHA 3LYEA 1TRDA 3UA3A 3JS3A 1J2WA 3GX9A 1XR2A 4J3TA 1RJQA 3PG8A 1LZOA 1KQYA 5CC7A 1RUSA 4HB7A 1W54A 1LOQA 2X8RA 3G22A 4IPPA 4JTHA 2WMIB 2WO5A 2Z2AA 3DCPA 3LXBA 1LG1A 1OFRA 3HV8A 1KWKA 1R3WA 3UWYA 4GUHA 4WJXA 5H8UA 5I2UA 3KOZA 1UZDA 1WXZA 4AXKA 2BXYA 5DMLA 5BRBA 1S5WA 4J3WA 1KQZA 1HKWA 1MUCA 5HQEA 4MF4A 4GYPC 3N9KA 3I10A 4R33A 4D71A 4RV3A 3WF2A 4JEJA 4BQ2A 1GJWA 4FNSA 3QQ1A 2NV9A 4EPDC 4HMEA 4RE2A 2NVAA 3V5CA 3EWCA 1YXYA 4O1DA 4Z1BA 1YADA 4C6LA 4Q8MA 4Y9NA 4X0NA 2Q3RA 5A8MA 4C1NA 3KAOA 2AL2B 3E0VA 1J01A 4B16A 4DELA 5CC3A 3LLFA 3R10A 3VA8A 1YLVA 1SZNA 1F3WA 1UWIA 1KV5A 1KGWA 3CL6A 5JBFA 2R1NA 4QNWA 3UG3A 3WNOA 5PTDA 3R89A 1E4LA 2XIOA 3RR4A 2XVKA 3FJ4A 4UCGA 2XVLA 1WQ5A 5IBXA 2XGIA 3RRXA 1JFHA 3UWZA 4CD6A 1FWHC 3T08A 1UUQA 1UKPA 3WJZA 2VR2A 2J7BA 3WF4A 3G1RA 5FF7A 1UJQA 1WCGA 3TAOA 5MF5A 5HQMA 3MU7A 4K3ZA 4Z2LA 4GUIA 4Q32A 2GGEA 3D46A 4Y7EA 2J25A 2RUSA 3WF3A 1P0KA 1R86A 1I2QA 3EMZA 4Z2HA 5LXXA 4K36A 2PTWA 5TBOA 2H8ZA 5A6BD 2Z4GA 3T0TA 1A80A 2R94A 3SY1A 3FGCB 5HINA 1XBZA 3FSUA 1Q4WA 2VUNA 5AB3A 5K7JA 3G6LA 1NF0A 4J1OA 4YPJA 2ESCA 4Z2JA 2CKRA 3AS1A 1ZBCA 1WAWA 2E6YA 5C6MA 4IL0A 3MBDA 3SURA 3WNNA 2HCVA 1FRBA 1VBRA 1E1CB 3IRDA 3TQKA 4S3AA 1GT8A 3QV8A 1VKFA 3NSNA 3IEBA 3VIPA 5A94A 3K2GA 1P6WA 4WSJA 4WSHA 1KBLA 4O28A 1MI3A 2TSYA 3OB8A 4LANA 4C65A 2WHLA 1OB0A 2VHLA 1GVEA 5LIKX 4B4HA 5FOOA 4Z2IA 3EDEA 1VH7A 3WJSA 2YOCA 3RNDA 8A3HA 3GRIA 4LV9A 4IF2A 1MW0A 1BRLB 3S0CA 2WCSA 2Z2BA 5I79A 3T2OA 1TWWA 4XD4A 5C2GA 2DY3A 2EHHA 3TJXA 1VEOA 2C91A 4C6MA 3IJ6A 1M41A 1PYMA 1X8FA 1QNRA 2ABBA 1H51A 3OPSA 4BS0A 1E9IA 2XH2A 4XIMA 3L2LA 1GVRA 3SY5A 3WJXA 3AMKA 3WDHA 1M65A 1POKA 4LYKA 4HU4A 5I07A 4H8HA 4GZEA 1GEHA 3W70A 3EPNA 1AZ1A 5CJMA 2YFOA 5I0DA 3A47A 1XLAA 2G97A 1ZL1A 4B15A 3M16A 5FF4A 1VYPX 2PFHA 2NVCA 2PTZA 3KLLA 1S5TA 4TV6A 4N4QA 3PP7A 2WJFA 4GZIA 3ZR6A 3AJXA 4KS0A 4LCRA 5BRPA 1NQKA 1VR6A 4DZIA 2Y70A 1RR2A 1FWGC 1FXQA 1U1HA 3WD3A 1WXYA 2GJPA 4GFIA 1M1BA 4XBKA 1V6XA 3ZWSA 3UR8A 2ZZ7A 3R0DA 1OINA 3PJWA 3AOFA 3VCNA 3CAKA 4JPGA 4DUWA 3V16A 4DWSA 3F4CA 3L0KA 2RDXA 1LRQA 1TV8A 1SPQA 3P2VA 5FAGA 1RPXA 3A6OA 4GG9A 2W92A 5HXMA 1S2TA 3CV7A 1MYRA 3S5SA 3G3DA 1Q6EA 4MNMA 3H8AA 1IGWA 3KCJA 3GAYA 1XDJA 3CZJA 4HSOA 2E4TA 2ZADA 1H41A 4R85A 3L9CA 2NQ9A 4ENLA 3RIKA 3SRFA 3AU6A 4PMXA 1ECQA 4HQVA 1WA3A 4L9ZA 3W72A 1VPXA 3TYZA 2ANUA 3BXWA 1RALA 3HMJG 3N13A 3GTIA 1ITXA 2FVKA 2HS8A 2DVXA 1V79A 1ZPTA 1UMYA 3U5UA 4QJ1A 2G37A 5M1TA 4NAFB 4O0ZA 3BCFA 3W01A 4Q3MA 1ADDA 4QR6A 4PTDA 3VMPA 4F40A 1E9ZB 1RY8A 3MHGA 4GIEA 2ZDRA 4LX4A 4UQAA 4B3LA 4QS5A 5IDZA 5I6SA 4V28A 4FLOA 4LVBA 1P0BA 4FAMA 4M3PA 2HBVA 2VGFA 3M5ZA 2XWDA 4MGGA 4C6BA 4GQRA 2YSWA 5F1UA 3BH4A 4CVWA 3ES7A 2OR2A 3QC0A 1GKQA 2ZYFA 4DO6A 3C0LA 3TOPA 2QXWA 3CZGA 4WLCA 4H9MA 2DSVA 5FJJA 1ADSA 3S5OA 3FHAA 2EPMX 4OT7A 2PS2A 1KRBC 3CHEA 1GZ1A 1A5AA 5DRCA 2E28A 4PL1A 4BWLA 4UNIA 4GCXA 4HNTA 1W3TA 1AW5A 1F5ZA 3P62A 3WLQA 3NL6A 2LLEA 1E3ZA 4UWMA 3V5OA 3OGVA 4DM2A 3LDVA 1ZBKA 4UOZA 1DEDA 1JZ8A 1VJZA 5DN1A 1TV2A 4V1YA 3UZYA 2DT0A 1DP0A 4I8YA 5AOUA 4JYEA 2QUMA 4RR4A 4X63A 3HGJA 1RD5A 4LCQA 3GVQA 3TCSA 3M6YA 2WZIA 1LOSA 5G4WA 4OUIA 2PI6A 1TRIA 1KM3A 1YE4A 3VKKA 8XIAA 2BNJA 3E2QA 3DZ1A 1QASA 1HO1A 3U6WA 5G1TA 1UH4A 4K1GA 1AL8A 5IBXC 4QDPA 3GZ3A 4LFYA 2OGYA 3VGFA 2ZUVA 1XX1A 1GVOA 1EP1A 3WLJA 5FSDC 1S5VA 4H1ZA 4AZIA 1CGWA 3VGGA 1YDNA 1X1ZA 2DSKA 4EK7A 3MQTA 2VEFA 3PUEA 2ZVRA 5HNTA 3TA9A 2J74A 2QULA 4TXEA 4AZBA 3GIPA 3U7VA 3CZ8A 1K3UA 4NZFA 3SM0A 1TV7A 5I3FA 2W27A 1N82A 2BXZA 2B31A 1YE6A 1DVJA 2YB1A 3GXDA 1PX8A 3I7RA 3DKJA 1E0XA 1UR4A 4PBFA 2CIPA 5JH2A 3FN9A 1DXIA 1QOPA 1VJIA 4MWAC 1PL9A 4QG6A 3SRKA 4CU8A 2V5KA 3SQLA 3WQPA 3CQIA 2WHJA 3C4UA 4L1XA 5H91A 3I3DA 3NDYA 3ITVA 4AIEA 3UGVA 3MHFA 2DZBA 5E93A 3V1PA 4DX3A 4LVFA 4PMUA 1MQRA 5FF0A 3CUHA 3FYPA 3GR4A 1OGBA 4BFAA 4UFLA 1NU5A 1SO3A 2DZPA 1S2CA 3QMTA 2A3HA 3EOUA 3UVIA 1R9ZA 1BVWA 1TQJA 2A85A 4OOZA 1NQ6A 4O8RA 4NT0A 4JQ4A 4RW5A 3L23A 4DO5A 3HPAA 2PF8A 2WLYA 2PLCA 4LUSA 3GE7A 4G6CA 5C7HA 4JBRA 3H4XA 2DH2A 3MB9A 4O50A 4HNLA 1CYGA 4ZSUA 4C6PA 1TTIA 3VGBA 4CQCA 3W22A 3D3FA 1JDAA 2PP1A 4ERGA 5HULA 4LAKA 1JF6A 4ES4A 3LRLA 4DQWA 1BPLB 4X2RA 2NWSA 3QEZA 4C6JA 4QCEA 3U2CA 1W9DM 2QIWA 3NQCA 4CQBA 4AVOA 2FZMA 2BVWA 2OSYA 3EWYA 3LTYA 4NJIA 3LHZA 1KTCA 3WL0A 3NYDA 1ICPA 1EX5A 1BQCA 1UH3A 5E6YA 3NDZA 4WD0A 5HA7A 1YX1A 4Q8OA 3NNTA 2FHCA 2O9TA 1SZEA 2UBPC 4LT9A 1B9BA 3M0YA 1U33A 3K8MA 1AG1O 1O94A 5U7SA 3MCNA 1TMLA 3TFCA 1WUFA 5LXEA 5LGZA 3BJSA 3Q4DA 1I0BA 3FYYA 3CWHA 3WMSA 3WY1A 4QG8A 4V1XA 4XBJA 3BLDA 2OOFA 3N1AA 1LLOA 1V4YA 2BXVA 1JYWA 1UBSA 2EKCA 1LQAA 1XLMA 3EZ4A 2W3ZA 2R1LA 2D2OA 3BW3A 1EX1A 1UROA 1XLJA 9XIMA 5C5YA 4H3DA 4KIRA 1XCWA 5EMUA 4AWUA 2Q02A 1UWSA 1N55A 3AMCA 1YNYA 1Z69A 3S46A 2ZRWA 1T5AA 3GVWA 3GDMA 3OYZA 2AL2A 2G3IA 1EFZA 3NUKA 4AC1X 1P6BA 1E1FA 3SFWA 2DFAA 1ZS2A 1IEVA 1XDLA 4INFA 2R6OA 3BGGA 4G7FA 3AROA 1S2VA 1V93A 4ERIA 4AYSA 4GJJA 2XIQA 4N4PA 4HCHA 3VPLA 3CZEA 4JX5A 3IAQA 2ZUNA 2G41A 4DJFC 4XG1A 4LUTB 1UIPA 1R85A 2D2GA 2R82A 1JPMA 1H2JA 2WOQA 3RJYA 3VD9A 3QFEA 2YGYA 4S3FA 3BW2A 3NQ7A 5SWUA 3NVTA 4R9XA 2GOUA 2PDPA 1Q6CA 1JL8A 2QF7A 3BGAA 3STEA 4BWLC 5AC4A 4QQUA 1T0OA 2TMDA 2GJRA 3RAOA 4DEFA 4HBKA 2BTMA 3FGCA 3W1UA 2MUCA 2ACQA 1S5MA 3DYPA 2YDAA 2QVHA 2ONEA 4MUZA 4U5KA 2EG7A 2O9PA 2OELA 5A2AA 1EP2A 4CD5A 3HGSA 3P7YA 3VYLA 4REQA 4CD4A 4JTKA 2PGRA 1EQCA 5M17A 4HSNA 3LUTA 3GAKA 2E5DA 1HVXA 1M5WA 5CGMA 5BCAA 1LG2A 1GOQA 1E1CA 1TJPA 2NZLA 3VM7A 4TV5A 5EY5A 2PRHA 2Q3OA 1UR8A 4K38A 4YYFA 1QI5A 1EXPA 2AKMA 1EJUC 2ZUWA 3ATZA 4O18A 1QNQA 4GD0A 2ZICA 2V5CA 1WBHA 3HURA 1FWCC 2ZE3A 7REQB 1H7OA 4LY4A 4Y90A 4EP8C 1NAL1 3DYMA 1AZ2A 2J8FA 2P3ZA 3C0SA 5BYWA 5HPCA 2C15A 2BY0A 1DTNA 5A8OA 3O6YX 1A5KC 4R5EA 3NCOA 4HNNA 4GYKA 3UZZA 3KRUA 2PODA 2QUNA 2O4MA 1TJ2A 2PLKA 1V6WA 1GONA 4WY0B 3WJWA 5LNVA 1IV8A 1PHWA 3E74A 3JUGA 4WDUA 1LL4A 4LTSA 4N02A 4XZIA 3H53A 3UPWA 1JUEA 1PX3A 1W5QA 1OX6A 2VC6A 2V3EA 3WK2A 2A2IA 5IHRA 2PWGA 4W5UA 4IUGA 4RNIA 2GVJA 1JYXA 4AVFA 2J7HA 3GTXA 3CXOA 3KWSA 4JN6A 3STGA 3H70A 3ZLGA 3LMZA 2HEJA 2WC4A 1M3UA 4DZ5A 3PFMA 3QLDA 3I6TA 2FB2A 4NUWA 3JZEA 1IQ8A 2PDNA 4CN4A 3GDTA 1S1PA 2VFHA 4S3CA 1G7VA 3MWAA 1LOLA 2DZXA 4GUGA 2HBXA 4XO7A 1J0JA 4M0XA 5A6AA 5DO8A 1D3GA 3BV7A 1ICSA 1F2JA 2DV0A 2NLYA 2TAAA 3KLKA 4IQLA 3FOKA 1CXLA 1RH9A 3FA5A 1QWGA 3BCDA 2AOSA 5D04C 1GTHA 3GR7A 1XYBA 2CLKA 3ELFA 1RSCA 1BWKA 3EXSA 6CGTA 1UWTA 3W86A 3QXBA 2OU4A 5AYBA 1JI1A 4L9XA 3SQSA 3NGJA 5LHFA 4I7WA 4B92A 4P8VA 2QCEA 4X22A 2X7VA 1UZ1A 3NPUA 2ZZ2A 3RLUA 4EAYA 2E09A 2QCMA 2GJXB 3CIWA 3T8QA 2H9AB 1LT8A 2QCLA 3OQ8A 3AIEA 1C8QA 2ISSA 5F2GA 1Q2SA 1DE6A 3NIYA 2VMFA 4CNOA 1VIZA 1H63A 1ONWA 3KL3A 3M07A 4XZLX 3P3BA 1C7TA 3RM8A 2OCZA 1PWMA 2ACRA 3O16A 2HS6A 1BYDA 4F2BA 3N14A 3QHOA 2OKOA 1HP4A 4NAFA 5D9NA 4OV9A 4B90A 4B5WA 4DWSD 3OLIA 2A7NA 4PMQA 5A6KA 2W0UA 1B1YA 1H1NA 1H62A 3HFTA 3AIWA 3S6TA 1WDDA 1GEQA 1F05A 4HZ7A 2YXOA 4HTYA 4FR6A 4PMNA 5C7VA 3FW6A 4HGXA 4D6IA 4GX8A 5LHEA 1ZUAX 2J7CA 4H01A 2OOGA 4QE4A 1A5BA 1DQXA 3WMLA 1EDTA 5EFFA 3VNDA 3OQEA 1KTBA 1JNEA 2D23A 4OZOA 3G8EA 4IFOA 4M1RA 1W17A 1K7EA 2O55A 3GDRA 1V6VA 4ZA0A 3P84A 1IWBA 4D8ZA 1PIFA 3STCA 4J3ZA 5C54A 3VCCA 4MNKA 1L6SA 4RNFA 1XG4A 3HZ3A 3HG4A 1UKSA 1L9WA 1E71M 1YPFA 2CXGA 2I7GA 4KEMA 4RX0A 4YCPA 1C9WA 3M46A 3MP3A 4U3CA 1IEWA 3UT0A 4H8NA 5HPOA 1JD7A 1XV8A 3TIMA 4G7EB 1TB3A 1WPCA 1J8VA 4KWVA 1FHLA 4LB3A 1NF7A 2C71A 3TXZA 3URNA 3CQ0A 1XLBA 4L6HA 1E5JA 1VRDA 1D8CA 1O6IA 1IZJA 1YYAA 2PCQA 3LCLA 3K1DA 2VFIA 3U4FA 3THUA 4S2CA 4GO9A 1BWVA 3W2JA 2BV9A 3RCNA 1Y5XA 4POCA 3NQ8A 2X1RA 3DUGA 3MCMA 3E12A 4F4RA 3BUVA 2ZRUA 3R12A 3B8TA 1D3CA 4F0MA 1Z48A 5IOBA 3TXVA 1MW1A 1ALDA 4ECLA 5ABHA 1JDEA 1W5OA 1P0NA 2G3JA 3AIVA 3F4NA 4KCVA 4WZHA 4XBSA 3K8LA 5LGXA 3G5EA 3E0WA 2VUYA 3H7VA 3M1ZA 1WZKA 1VRXA 2QCGA 1L6FA 3W29A 2NQZA 1BF2A 1QUMA 3M43A 4XX6A 2ZIDA 1HKIA 3KBVA 3C8NA 1V3LA 1HJSA 4C6QA 1HKVA 4GQBA 2FPYA 1NDWA 3W1TA 1NWTA 4I5RA 4FLSA 3DHPA 4M5PA 3FLUA 4HN4A 3ALGA 5DY3A 3TYUA 1LP6A 2WMFA 5I06A 3IGHX 3RLHA 2WBGA 4F0HA 3V36A 4DBDA 1ZRQA 3PM6A 1DHKA 3UD6A 3W82A 1S2WA 3C2FA 3H22A 1JPIA 4LEFA 4DF1A 4ERAA 1OYBA 2DZUA 5A2BA 2WC3A 2QCDB 2PDYA 2J4GA 1TJ1A 3WEZA 1XLCA 3OVGA 3CAVA 3WH5A 3QV9A 2GLKA 1E0UA 2BOEX 5G2HA 3VFCA 3VZYA 2J8GA 3OBKA 4PRRA 4EOUA 1OK4A 1SZFA 1V6YA 3BZJA 3W1MA 1EC9A 3MUY1 1G7UA 3MBFA 4EVZA 2V5LA 2ZUTA 5CPLA 3TFXA 3GXPA 4HZ8A 1I9CB 4O11A 3T55A 3MO7A 3AISA 3PJTA 1J9YA 1GOKA 2VT0A 2V38A 3TMLA 4HN8A 4UXDA 1TYGA 4RXFA 3NR0A 5AHNA 4U10A 1ZJIA 3P93A 4GACA 2Y85A 2CBIA 2PF0A 4GNKB 3VOCA 5A6TC 1RQBA 2NXHA 2GUBA 3VD3A 2OEKA 2J75A 4AXNA 2DT3A 4JTTA 3ZJ8A 3AZSA 2CLIA 1TVLA 1LBFA 1MRQA 3AXMA 2JEQA 3AS2A 2J13A 1XC4A 4Q8PA 4GABA 4K1WA 1GZGA 1KW1A 2F38A 5BW6A 4LS2A 3I68A 3PZMA 3PN8A 4JTIA 1K02A 5DRIA 4HPNA 2CC0A 3NFUA 3KS5A 4JIEA 4J5NA 3FAXA 3H23A 4PTNA 4U5IA 4PODA 3ARSA 4PB3A 1XH1A 2NQ5A 5A6LA 3QW4B 5IXEA 4ACYA 1MNZA 4IGHA 2QJMA 3C2OA 2Q8XA 2ZOXA 3KTXA 3LS9A 3OBAA 4F9JA 2QDEA 2PDWA 3COTA 2P3EA 3DECA 2ON3A 2UZ9A 1K7FA 4MFDA 3WEMA 1VFMA 2JQXA 1XHGA 4J4KA 4IFRA 3BV4A 1I0DA 4MPQA 4OJYA 3CNYA 3C61A 5BOFA 1KM1A 2VRJA 4GGHA 1G1YA 1C3FA 4PUNA 3BL3A 1B3WA 3W1QA 1UHVA 1OC7A 1TQXA 3KBWA 3AZRA 1DOSA 2I1OA 4IGMA 4Q4MA 1HUVA 2FVLA 3F2CA 4FK9A 2YJQA 2A3LA 3M0HA 1W32A 3N4AA 3ANVA 3C56A 1TPDA 2E3ZA 2J78A 4UTMA 1A49A 5BNKA 1GPWA 3U5YA 3VNYA 1OCNA 2Y88A 1W9VA 5GQBA 3PBUA 1ONXA 1V02E 2WSYA 2VJXA 4WSKA 1RQHA 3A4XA 3DHFA 4KFPA 4RL3A 2OYMA 3E02A 1V6UA 1QPOA 3VILA 1ZP4A 3DFPA 1V0MA 1R87A 4N9BA 2WSKA 4L80A 3QV7A 2ZRVA 3I3BA 4LUTA 4JFVA 2VI0A 2E68A 3GSMA 3HTWA 1LDCA 3T7VA 2QHAA 3W07A 2RAGA 1G01A 5I5RA 1JQXA 2JK2A 1XSKA 2YDQA 1PS9A 4DWDA 3O6CA 2FTPA 3CASA 4URIA 2A3BA 1A5OC 1L0PA 1R0MA 4CEUC 1C8VA 1EA9C 3IJIA 1WOAA 4DUXA 1UPMB 3S1GA 3DFNA 1X39A 3RM4A 3N9RA 1B90A 1V3MA 3TCEA 1ZP3A 2DH3A 2WNNA 3WQWA 1XLDA 1PKMA 1BSIA 3N19B 2GZXA 3UWQA 1B54A 3SI9A 4CNUA 3AXKA 2BGQA 1FX6A 2PLMA 3L4WA 4PMRA 1JZ6A 3W7KA 2WMHA 4WKHA 3BAKA 2WZEA 5E0CA 2RJGA 1SSDA 2WZTA 3WH6A 3SIMA 4NIRA 2YW4A 1O1HA 3MVIA 1FH8A 4Z1DA 1YMYA 7REQA 1VPQA 2QPUA 4GMEA 3M41A 1HJVA 1E43A 2J77A 5D4YA 1HZYA 8TIMA 1TCMA 3IRSA 4S3EA 1GJPA 3UWEA 1V02A 1ZAIA 4UTWA 2VC7A 1FDJA 3ZR5A 5FJPA 3QQWA 6TIMA 2YCIX 1K8YA 2FZNA 2UY3A 1VJSA 2OLSA 2FJKA 4WY0A 3OVQA 4KGJA 1JQVA 3GK0A 3CHFA 3UG5A 1KXVA 3NZ1A 3UP8A 3VUPA 5JU6A 1PZ2A 4JX4A 3TN4A 3ARVA 5K4ZA 3MKCA 4KW2A 3R25A 1RA0A 1HT6A 3N2XA 1TPVA 4AF0B 3P0WA 3WLSA 1KBBA 1X1NA 1PIGA 2OTDA 4QIUA 4UTHA 3PTKA 2WYSA 2YXGA 1TX0A 4AD1A 3Q94A 1K1DA 1I2PA 2QIIA 4ROPA 1B4EA 1HGWA 3LNMA 3N12A 3R11A 3V7PA 1K4GA 1PB0A 1SJCA 2GVEA 3PUGA 1R30A 3O2LA 4JN7A 3SCQA 3XINA 2NQLA 5K9XA 3LERA 4M19A 1ZU8A 2GUUA 4JTCA 1PTGA 2R1PA 2Z29A 3CZLA 1PZ0A 4GCAA 4JN8A 3CL8A 2A6LA 1J12A 3BAWA 1HFBA 1SMAA 4XK2A 5A6SA 4KQNA 1FKXA 5DQPA 1GQLA 3VIMA 4HA0A 1KFKA 2ZXAA 1DIOA 3LCFA 1IF2A 3WBYA 8XIMA 4CCCA 5AC5A 4AMCA 1KM2A 1QHOA 3B0XA 4KEUA 2J9XA 2GJXA 1OD0A 4TX8A 1NDYA 3QY7A 2GQ8A 4HKPA 3L7RA 3OZMA 1F4AA 3C6CA 4MZYA 1Z7AA 3DGBA 4Z42C 3SN1A 2BY1A 3R0KA 4IMEA 4JZ5A 4Q4KA 3QHMA 3T8LA 4H19A 2RHGA 1LM1A 5EFDA 2ZX9A 2UV8G 4Y9AA 3EPMA 3ARUA 4Q4SA 1TE6A 4UFKA 2VZSA 1CB7B 1V03A 4YMZA 1IT8A 5G1MA 4PA8A 4DJEC 2G95A 5CG0A 2GVGA 2EJ1A 5HBFA 4JTEA 3W81A 2QAFA 3GKFA 1I60A 3LCHA 3WG6A 1OSEA 1R3YA 4KIEA 1HJQA 4LC6A 3BLPX 3ARYA 1A53A 3AYSA 2GSJA 1ODZA 3KVKA 4YTSA 3BPWA 2J27A 3OP2A 3FX4A 1H50A 3GU2A 2PDUA 1GVYA 5EGRA 4B5SA 1IXQA 4Z1AA 1Q8AA 3IUDA 3UY8A 3WNPA 1RBOB 5D2VA 3I4EA 4H6EA 4O52A 2WSPA 3USBA 4AG0A 3HB9A 2VFEA 3PZIA 3DFYA 3R5EA 1I1XA 5HR6A 3IK2A 4B5VA 1N8WA 3CMFA 3M7SA 1WDPA 2EGZA 3TUUA 3WUEA 1Z32X 2OXNA 5A2CA 4G7EA 3RX2A 3WMBA 1RD6A 1PZ1A 3SN4A 3WLIA 1R2SA 3WLHA 3B8IA 3B8DA 3M6DA 3BAIA 2V0TA 3QBUA 2P0OA 3SGUA 3LPFA 1ZBVA 2W9MA 1NM9A 4UFJA 2VP8A 1ZJBA 2EG6A 5A6JA 1VGAA 3KXQA 1WB0A 1V8EA 3PZUA 2CZEA 3N18A 3LXAA 3RPDA 3VI2A 1EPVA 3M5VA 4PMVA 3NYZA 2V8ZA 3CV1A 4YHEA 3CUZA 4I3GA 3OU8A 3EWWA 4Q8WA 4UTIA 4K6AA 1YTDA 3WLOA 4EWND 4K68A 4XWUA 3IPWA 1R3TA 2WB5A 1TVNA 4M6QA 1E6NA 4CD7A 4BJHA 1OT1A 1AW2A 2XPKA 2J9ZA 5EKYA 4EWJA 3LI1A 1CW2A 1F74A 1U22A 1DXEA 2WVUA 3APTA 4S39A 4M80A 3W7DA 4RXGA 3WDQA 1MEHA 1V77A 4KCTA 3TWAA 3EX4A 4DBSA 5C70A 3SIZA 3JU2A 4IJBA 4B3ZA 5DXXA 5G2WA 4ZR8A 3L0GA 5LYRA 2BX7A 1E0WA 1X8CA 3WH7A 1UQYA 1JCMP 1FWBC 4RW3A 4PZVA 2PUZA 1F76A 3FHQA 3MTWA 3CH0A 4NKCA 5H8MA 5EL1A 3AYTA 4U2ZA 1CCWB 5HDRA 1ITQA 4I5XA 1B3OA 3MP4A 5LA1A 2Z1SA 2CLHA 4NRSA 3I6EA 1LLWA 3T2PA 1TJ0A 3ABQA 2X1TA 2ZZ3A 3MI3A 3DFSA 2X40A 2XINA 1FBAA 1TMQA 2NUWA 3LA4A 2VKZG 5LNRA 4KPLA 3PUOA 2AGTA 3PWIA 3TK7A 3V3WA 3SN0A 2QCDA 3EKGA 1SQ7A 2ODOA 1DWGM 3WNKA 4FX6M 1Z9AA 1X38A 2VX5A 3QSRA 1MXSA 3BTNA 2CESA 2FB3A 4J35A 2CERA 4O12A 4GNVA 1WZMA 4IIDA 5D37A 5DLCA 3AJ7A 1PJ9A 4N9CA 1NOUA 4US5A 2DQWA 3VM5A 4IGNA 1XGZA 5EBUA 1UMLA 4YWSA 3UJRA 2O9RA 3G1FA 5CEWA 1AVAA 2Z2UA 4O14A 2P76A 2HWGA 4ZEPA 4E2VA 2YA0A 3H2EA 2C18A 2PWUA 1OADA 1SYTA 1QATA 4PTWA 3LRMA 2WV8A 1C9DA 2XN0A 4D8AA 5A8PA 1QW8A 3UQNA 2WJEA 5E09A 4GOAA 4HPJA 1US3A 4QTGA 3H7RA 2VC9A 3WL1A 2F6KA 5FESA 5FJIA 3DG6A 3WK0A 5I7GA 4W5ZA 3T4CA 3SCSA 1EC7A 1EGMA 4MY9A 3MP5A 3GG8A 2XFYA 1DV7A 1Y8BA 2Y7FA 5I3GA 5DY2A 3GFXA 1R2RA 4XZWA 4HZ6A 1KXTA 2E25A 3R94A 1WDQA 2FH8A 2YLAA 1UD6A 3N29A 3P82A 4A29A 1XUZA 4QAWA 3UR5A 4W86A 5FIPA 1GTEA 2YLLA 5HOSA 2FVMA 2P50A 3T05A 1JAKA 6ALDA 5AHIA 3KVMA 1KXQA 1WDWA 1UP2A 2C16A 1S5NA 4MZ8A 4R88A 3ATYA 1J6PA 3TJLA 4OTKA 3F5LA 5DT5A 4LF2A 1J0ZA 3UA4A 3GDBA 3CMGA 1QO5A 2J88A 2FDMA 4GYFA 3S2JA 3W7EA 4OBTA 5E70A 4UMBA 1OYAA 1PKYA 1E0TA 4FO4A 1FDZA 3EEZA 3AIBA 3GC5A 4HJFA 3HN3A 1J0KA 1I45A 3U2ZA 1SGJA 1A3WA 1WP6A 4E4UA 3MZ2A 5BWAA 2TRSA 5EB8A 1ME7A 2FMOA 4PSRA 3RO6A 2NX3A 2J79A 1EUAA 3G24A 5LA0A 1F6YA 1SSGA 2P8CA 2NV1A 1D7FA 4KFNA 3LSCA 3H2AA 2CFFA 4YWIA 5E1QA 4GIAA 3QHNA 3TJIA 3CQHA 4L4MA 1JEZA 1PAMA 2VCCA 4MDPA 5CSRA 5C55A 3MT1A 2PGFA 2D20A 2F7FA 2KX9A 3GG1A 4BF5A 1W1PA 3S5ZA 2V81A 4A05A 1RLCL 3GDLA 4PGLA 1TJRA 5KMYA 3W24A 4ZGYA 2VZTA 2XM2A 1ISZA 5M03A 1EBHA 2H90A 2Y62A 5D2WA 2V68A 4FF5A 4ZTYA 2FGBA 3FJLA 3C3UA 3BOXA 1ISWA 2QLYA 3OZPA 1UD4A 1WDSA 1EBGA 2BHYA 2W63A 3OO2A 4NNCA 4C1NB 1YTEA 4HK6A 1JPHA 4GC3A 5A6BA 2D3LA 1L6GA 3L4VA 1HL9A 1KO0A 3O15A 1PXGA 2CHRA 4YYCA 3MUAA 3R8HA 4J3XA 1R6WA 4UQEA 4LV4A 2VGIA 4QX4A 1E6SM 1JD9A 3SRHA 4HYRA 3W2LA 1FP9A 2DZWA 1VD6A 3UESA 4HOWA 1X97A 2VEPA 5EMLA 2CZVA 2JALA 1BVZA 1XKJA 4C1LA 3N3MA 1SFTA 1P0EA 1B31A 4GFSA 3WQCA 3SUWA 3ZO9A 1HJUA 4DJFD 1OBAA 3T0CA 3V5FA 3TROA 1SR0A 3KP0A 3AMDA 4Q8NA 2YW3A 4PMYA 1WKDA 3WD1A 3W7LA 1E4NA 2XGBA 3N11A 5HNNA 1FHDA 3PY2A 3IANA 3WDRA 4AD0A 1LWIA 1SFSA 4GISA 4PUJA 1RJPA 2WJZA 2XSAA 4Y8FA 1QPKA 5AECA 1VYSX 4GINA 3GH7A 1JGMA 2R91A 4NXSA 1TZZA 4I7UA 4S3DA 4FNRA 3GLCA 1GPFA 2VFGA 3QKZA 4LYRA 1EL3A 2AMXA 2NWRA 2I17A 4PR4A 2O9OA 4AF0A 4ZOCA 3DESA 1GJUA 6PTDA 2HNEA 1OWQA 3EB2A 3RILA 3LV6A 3IGUA 1TMHA 3F03K 1QW9A 1ADOA 1T6MA 2YCLB 1B3YA 5AN7A 2VC5A 4V15A 4DB7A 4KWOA 1EP3A 2C6QA 3DU0A 3EYPA 4UZUA 4ORMA 4FNTA 2VRKA 2NV2A 4KH2A 3PUDA 3UXKA 3NURA 1ZZMA 2VENA 2DVTA 3UCQA 4N6EA 5D2TA 1NY1A 2INZA 3CIVA 3G8RA 4DXKA 2IQ0A 1SR9A 5CBJA 4GGBA 4UOQA 2B7OA 4FB7A 3CUJA 5MHBA 4E8DA 3EA2A 2E40A 4P2VA 5K3VA 1SU5A 3QY8A 1QWKA 3BDKA 1E6PA 3RPTA 3TONA 1QDSA 3VNJA 3HJEA 4LW7A 1JG9A 1XYLA 3VZXA 3T44A 4XVDA 3UG4A 1XINA 4MB5A 1JCXA 2V3FA 1XYFA 4PN2A 1VFHA 1WYIA 3ZXWA 3AXHA 2DSUA 5A8GA 1UR0A 1CXEA 2AQVA 3AHZA 4GA8A 4ML4A 5HANA 3WKZA 3SY8A 2ALRA 3LQLA 4D6HA 1K8XA 3L4XA 1VBUA 3REQB 1VQTA 4H4IA 2WBKA 4WCJA 3U0HA 1ESWA 1W3KA 3VE9A 2FJUB 1DE5A 4PUUA 2CLLA 4DWSB 1H49A 4OGZA 3ARRA 4Y9PA 3W27A 3WLKX 4EXAA 2YCKX 2QDGA 4QDWA 5CLTA 4R9OA 1PDYA 4P7QA 1FWFC 4PCTA 1AH3A 3H2NA 5M3WA 4WOQA 2HRWA 2H3BA 2QVNA 1XI3A 4NVTA 3UVAA 1S3TC 1W8GA 1H7XA 2ZTJA 1P1MA 3EKLA 4I8DA 1DYSA 4G8TA 3T0AA 4QHRA 2D24A 4NZJA 2ADAA 4Y6GA 4WQ6A 1MZHA 3I65A 1WZAA 1Q65A 3ECQA 4MAVA 5FJTA 3B8UA 2XFRA 4TX9A 3MYPA 1R7OA 3PNZA 1R38A 3NSXA 4P7OA 3BAJA 3SJ3A 3RG6A 3TQVA 5T26A 2FFIA 4Q8VA 3B8WA 2E5BA 4EXQA 4C90A 4HK5A 4GVFA 1E40A 3FA3A 3TYCA 4DIAA 3B97A 3GKAA 3G1HA 3OG2A 3VOHA 4MNJA 4RPQA 4YIWA 3DGRA 1EB3A 1NWUA 2Q09A 3GNOA 2VDHA 4IQEA 3TC7A 1VP5A 1OFAA 5DELA 1DKWA 4BI6A 1PBGA 3W25A 1BTCA 3CH9A 3IIVA 3WLLA 4BI7A 3S9IA 3E38A 3ZS4A 2PU1A 2I5QA 3H21A 1UH2A 2L5HA 2ASHA 4K37A 4D6CA 4PE8A 2BOFX 4JS3A 2QUVA 3KW3A 1P4CA 1GCYA 3LNPA 2PDBA 2RKXA 2FZBA 5HUPA 3BMXA 1W2VA 3DFTA 3GNPA 2CNCA 2TPSA 1P5BA 4HPXA 1RVGA 3PFRA 4JTRA 4JIRA 5HJXA 3CYVA 3W75A 1NIUA 3QY6A 4EPBC 1I8JA 2DIJA 4EF8A 5BMXA 2WMKA 3ARWA 4ZOAA 3C8FA 5AC6A 3F2DA 3T07A 4FEZA 2AAMA 4IMGA 4MJ4A 3RGTA 4DVOA 4B5TA 2YDRA 4XQ6A 2DVUA 4OBRA 1T7LA 4XZHA 3MMTA 4F0LA 3UCCA 4F2UA 2Y7EA 5HNRA 4TVUA 3DHUA 1CGTA 4PUKA 2GQ9A 5C71A 1UZ4A 3TH6A 1UD8A 3B9AA 4LBSA 3A5FA 1Q6OA 1KM4A 3CUXA 3W73A 2I16A 4H6RA 4KRTA 2B7QA 3EWXA 2JE8A 4CU6A 2OX4A 4YTUA 1XIFA 2JKEA 2VD8A 3W7MA 3PZOA 4IIEA 4IIGA 2NQHA 2EPNA 1X7FA 2Z1BA 1BXNA 4H7ZA 3UZ5A 1DJGA 4AY1A 1SMDA 4GC4A 2PE4A 2VCAA 1TO3A 4J3SA 4ZOEA 5REQA 3PZNA 2J7EA 1EA0A 4DN1A 4A35A 3CWNA 4IIFA 1M01A 1UR1A 3KZPA 4Z1YA 3WJYA 2RDUA 4D6GA 4DXVA 3W83A 1SO4A 4M1BA 3A4JA 2CCRA 4JTLA 1J93A 1DWJM 4B91A 2BVTA 1UASA 3S1VA 1F61A 4D6JA 4JTJA 2BFGA 2E6DA 2BY3A 3VZZA 1JCJA 4PTMA 1O12A 2DIKA 1AL7A 4FHAA 2ZZ5A 5D03A 3MHUA 1EOMA 4J3VA 3BJTA 1TKKA 3PWGA 3DX5A 4QLJA 1J2BA 3WQOA 1IXPA 1ZTVA 2QKFA 3URAA 1JYNA 1TZ9A 3TE9A 5ABTA 3V35A 4P8UA 5FL0A 2J47A 3NXLA 4XZNX 4JL2A 2Z6IA 4RZ4A 3RJXA 3TQPA 2FKPA 4QEEA 5KETA 5AFDA 3HG3A 3PSWA 2F61A 1B30A 3PB0A 5CZSA 2QUTA 4GXPA 1QNOA 3INPA 2XIJA 3KRZA 1U1JA 4B5NA 2ISDA 1A5LC 1H4PA 4G5DA 5I3HA 2GDQA 3URBA 3WLMA 1PV8A 4Z0JA 1YXDA 3UY7A 1DJIA 3AYVA 3BOLA 3W2MA 3KBSA 2FIQA 4E2DA 1TIWA 2DPEA 1VBHA 3Q58A 4UB9A 1XYAA 3PBVA 3EX6A 1J18A 3ZLFA 2PC4A 3K13A 3SSZA 3ZT6A 2NT0A 1U5JA 5FI8A 2ACUA 4H9VA 5H6HA 4E8CA 5FJRA 1X1OA 3IVSA 1TUFA 2D0HA 5I23A 2WHKA 3EDJA 2QV4A 2WM0A 3UZXA 2PP3A 3WH8A 5IRPA 3LB0A 2PSNA 3K1GA 3M0JA 1UOKA 3R13A 4MOZA 4NJGA 3TW6A 3TTQA 3LN3A 2PURA 2X42A 1EZ2A 3BAXA 1O66A 1GUVA 5AHFA 3SRDA 2HE8A 3NAVA 2ZE0A 1IEQA 4PH6A 5LIWX 2EQDA 3OIHA 3TZFA 1GKPA 3F4WA 3SCVA 1R3RA 4HT3A 3PWAA 1MSSA 1XIIA 2XH7A 4ADTA 3MSDA 4O4VA 2C14A 4Q7NA 3EOLA 1U30A 2VDGA 3THCA 1HGYA 4GY7A 1ZNNA 5G4EA 2ZDSA 1A4MA 4B4FA 2WQPA 3BGJA 1JF5A 3Q2DA 3FEQA 4WK9A 3R2GA 3W1NA 1MW2A 1K4HA 4HA3A 3XISA 4LF1A 1KCXA 1J96A 3TAKA 4JFTA 2VZVA 3GW0A 4EKJA 3EAUA 1RV8A 3NZPA 1WE5A 1C8YA 2Q8ZA 4MIMA 4HU3A 1H1YA 3IJ8A 4QRNA 1RBAA 2VR5A 3P81A 4JDBA 4CQAA 3CT2A 4W7VA 4HTBA 2BGSA 4NZ3A 5JUVA 4GVHA 2V82A 4QLKA 2BWGA 4A2RA 3CTTA 5CPSA 1PX4A 4WDXA 3FJ6A 1FCQA 3U3HA 1O4UA 3ONBA 4CNPA 1FDYA 3BQ6A 1P7TB 3C3NA 1AJZA 3LZ5A 3NGFA 4QJ5B 2ZUMA 4JYFA 3S2LA 3VAVA 2P8BA 1XPGA 4XAGA 2VD9A 2PMQA 3A13A 4JDYA 4L65A 3N4FA 3APYA 4K39A 1AQ0A 4IMFA 1XXXA 1GQKA 3CO4A 4CLMA 2VEIA 1O1ZA 2BG5A 1JZ4A 4U3AA 1AQFA 1U1UA 1VFSA 3LHTA 4K8GA 3BSMA 3LPGA 3QGVA 4H41A 2CEQA 2PWEA 3KCLA 5DCEA 3IUHA 3CQJA 1GVSA 4MLRA 3WQFA 3GH4A 5FA5A 3S6OA 8RUCA 3GHRA 2IPGA 4YU1A 1FHVA 4O19A 3BLKA 3GUGA 2BHUA 5L6UA 3FXGA 1J79A 4ZB0A 2NQJA 2ICSA 4REQB 4KETA 3ABZA 3KBMA 2Z1VA 3DIPA 3ZIZA 2I5GA 2NXIA 3DC8A 1REQB 3JW7A 2AL1A 1RPKA 1JXJA 1N8FA 2G0WA 1K03A 1W3HA 1EHAA 5FSEC 1FCUA 1VFLA 2GSHA 4O1FA 3G0XA 1OCJA 2YCLA 3O3RA 4HMNA 2VEKA 5EMKA 4D2JA 2Y8VA 1H1ZA 1EJ7L 2X05A 4CN1A 1B5TA 2R24A 3U8GA 3C52A 3FCPA 3O9NA 3RX3A 4O1EA 3NOEA 1VCVA 4C60A 4DJDC 4UQ9A 2C1IA 1KV8A 3PPHA 1UP0A 2X2GA 3P60A 4PCPA 3W28A 1G94A 1ML1A 2XIIA 1UW9A 4FIRA 3A21A 5BXRA 3S2MA 3NM1A 3CGTA 4L1WA 4I9AA 5F2MA 5D02A 4IIBA 3W87A 3IV3A 5FKYA 2ISVA 3S8HA 3EMQA 2VEMA 4Q4QA 2QDHA 2QGHA 2VOMA 2QYGA 1M7OA 1W5MA 4S38A 3F2BA 1H3GA 1GQJA 3BSHA 4FOJA 3T42A 1UUOA 1KB3A 5LKYA 5IHSA 5BZAA 2UY2A 4D1JA 1ZCCA 4PB4A 3AZTA 3RM9A 5FJUA 3LCGA 2GYIA 2R1MA 1VCGA 4A8NA 1IXNA 2DSWA 2JIEA 5I24A 4NYUA 4ZOBA 3REQA 4MKSA 3ITGA 5FF3A 2A1YA 1BSLA 2X30A 5CC6A 1Z8AA 3BQ5A 3IJDA 3LHVA 3KOFA 3HQ1A 2CXEA 4ZFMA 3TTYA 3MSYA 1Q13A 3LM7A 4FIQA 5JIPA 4NNBA 1CLXA 4FMVA 4GHRA 4IJCA 1IEXA 2VXNA 2VRQA 3EX2A 3M5XA 2EO7A 5FEPA 4J3UA 4BQ5A 1UYQA 4IZGA 3WO8A 2EPLX 4MUPA 3S9YA 3PC0A 1GG1A 4FALA 4GKLA 3WIJA 3CV2A 2PDGA 1ME8A 3UR2A 2IQTA 4H7CA 6TAAA 1M03A 3M0IA 1DXFA 1JVNA 2W4XA 3G77A 4FF7A 3SZ8A 2WK2A 4JY8A 1V3JA 3MSRA 1IWAA 4IOTA 4XSMA 4RUBA 1E6RA 4M6UA 1EDQA 2WNWA 3RYSA 1FHUA 3GHUA 3RLVA 4A2SA 1JNDA 2CLEA 2FPVA 1M7PA 3GU1A 1UKQA 2BODX 1AK5A 3HQOA 2PDXA 1HP5A 3CO8A 3VDCA 1PTAA 5ABFB 5CBBA 1ITCA 4OFCA 3QZ6A 3OODA 3KBNA 4AIUA 4KESA 3HJZA 1TPEA 3STFA 1HKKA 4XKMA 2QCFA 1XH0A 1UPPA 3HGOA 3RCYA 3EOEA 4GUFA 3DEQA 3UBPC 4YCOA 4NL1A 1W5NA 2E9LA 3L65A 2V67A 4DHGA 1TPH1 3W2KA 3ZVHB 4DYKA 3R0UA 1E73M 3GC4A 1R5YA 4BR1A 4CNSA 2E1DA 1GYNA 1E51A 1EYWA 4KF1A 3KOYA 1BKSA 4WRHA 3GHSA 4R27A 1XH2A 1PKLA 5E6ZA 4ZE4A 3O8AA 4XAYA 4V27A 1DJWA 4ZE5A 3AHXA 4CNTA 1J5SA 1HL2A 4EPEC 1E15A 1OC6A 2AQOA 1B3ZA 3VCRA 4C7DA 3MANA 5FACA 3IVTA 1SJBA 3NQBA 2E0PA 4GUJA 4UTLA 3WLRA 3BMVA 4ZTXA 5D33A 1WX0A 1QK0A 2Y1HA 4Q8TA 3CBWA 2DZVA 5JBEA 3TU9A 2KAUC 2FHFA 2V2DA 2GDUA 5CZTA 4RDZA 4OWGA 3NG3A 3PPCA 5LIYX 1XD1A 2DGAA 4YNGA 1UZHA 3GXIA 4Q7IA 3WF1A 2BLEA 5AC7A 4C6IA 1UG6A 3MPGA 4YVVA 3TZNA 3BLFA 3KRBA 2GGHA 3HPXA 3VOGA 1W9PA 1KFLA 2WNQA 3ONCA 2PU0A 1A3HA 4A6GA 3HFYA 1I2OA 4M82A 4AZ7A 2C3ZA 1AD1A 5CPNA 3DC0A 1PE1A 4JFUA 4MFEA 4AW7A 1QK2A 4JKMA 2QR6A 4CQ9A 2Y7DA 3K46A 3W7GA 3L2IA 2EPHA 2YCJA 4Z2KA 1VEMA 3VNLA 3W2UA 3RMEA 3WFAA 4A22A 1V7YA 3TW9A 1A3XA 1OFEA 3M0MA 1I6NA 4AIBA 5CAHA 2VX6A 1R2TA 1W9BM 2Z1XA 2EG8A 3VFLA 1FCBA 2FFCA 3W7HA 4A21A 4N9DA 4OVXA 3WSUA 1E4MM 3PPGA 1TTJA 3TMQA 4Z1CA 3BZGA 1QBBA 4Q22A 4LNCA 5KTLA 1CLVA 2C8NA