2ACUA

Tyrosine-48 is the proton donor and histidine-110 directs substrate stereochemical selectivity in the reduction reaction of human aldose reductase: enzyme kinetics and the crystal structure of the y48h mutant enzyme
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVHQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title Tyrosine-48 is the proton donor and histidine-110 directs substrate stereochemical selectivity in the reduction reaction of human aldose reductase: enzyme kinetics and crystal structure of the Y48H mutant enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 102
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1994-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2acuA00
3MB9A 3V0SA 2J8TA 2HE8A 3R7MA 4PRTA 3COTA 2F38A 5C7HA 4G5DA 1HW6A 5JH2A 3FX4A 3V0TA 1K8CA 1US0A 4NKCA 3CV6A 3GHSA 3FJNA 1Q5MA 1VP5A 3LQLA 4EXAA 5DANA 3V36A 2WZMA 4XZMX 2P5NA 5LIYX 4FA3A 4PUUA 1PWLA 3CAQA 2NVCA 2ACRA 1ZGDA 2PDJA 1MRQA 3BURA 2ISFA 4WDUA 2IPFA 1T40A 3RX4A 3VXGA 2IPGA 4DBUA 3EB3A 1S1RA 3P2VA 2PDXA 3Q65A 4LAZA 1Z89A 5KETA 4GABA 3GUGA 4GQGA 5LIKX 1X97A 4JTRA 4YS1A 2DV0A 2PDGA 4H7CA 4XO6A 3LQGA 5JH1A 4EXBA 4ASTA 3LN3A 1J96A 1AZ1A 3R6IA 2PDNA 2PDQA 2FVLA 1C9WA 2PDIA 2PD5A 2PZNA 2CLPA 2PDBA 4WDWA 1GVEA 2F2KA 3UWEA 1LWIA 4WDXA 1QWKA 4L1WA 4JQ4A 2AGTA 3M0IA 3G5EA 4ZFCA 4JQ1A 3RX3A 4JTCA 4Q3MA 3GHTA 5HNUA 1A80A 1XF0A 4QXIA 1Z9AA 4PUWA 1FRBA 3ONCA 1IEIA 1YNPA 4QX4A 3BV7A 1QRQA 1EL3A 3ERPA 1XJBA 1PYFA 4WRHA 3V0UA 1RY0A 2C91A 1EKOA 2IQDA 3UYIA 4HMNA 1YNQA 3DOPA 4LB3A 5LIWX 3N2TA 1EXBA 2I17A 2PD9A 3D3FA 2PFHA 1AZ2A 4GIEA 4JIIX 2HE5A 4FALA 2VDGA 1M9HA 1EF3A 2FZ8A 4XZIA 1HQTA 4QR6A 4XAPA 4LB4A 2PDCA 4DBSA 2FZBA 5LIXX 4IJCA 3UP8A 3BUVA 3RX2A 2IPJA 1SM9A 4JQ3A 3BCJA 1R38A 3O3RA 4JTQA 4OTKA 3MC5A 2PEVA 2PDHA 3R58A 3DN5A 2FZ9A 4RPQA 3CV7A 3LEPA 4JQAA 5LIUX 5HNTA 4JIHA 3UFYA 3WBXA 2ACQA 3UZZA 3R8HA 4MHBA 3WBWA 4YVXA 2QXWA 1Z8AA 2IS7A 1Q13A 3M4HA 4GACA 4AUBA 4WDTA 3R43A 3LZ3A 3NTYA 3V35A 4XVEA 2HV5A 3R8GA 3GHUA 2IKJA 3LBOA 2INZA 4XZHA 4XO7A 3UZXA 1OG6A 4PRRA 1MZRA 1JEZA 3M64A 2PDMA 3UG8A 4YVVA 4ICCX 2PDKA 3O0KA 1X98A 4XK2A 2HEJA 4L1XA 2BGQA 3Q67A 4IGSA 1PWMA 3QKZA 3ONBA 1S1PA 1ZQ5A 4WEVX 4I5XA 2ACSA 2DUZA 1S2AA 1XGDA 1ZUAX 2BGSA 3WBYA 4JTDA 2NVDA 1UR3M 1IHIA 4GCAA 2HDJA 1AH3A 3F7JA 4JTAA 4R9OA 3S3GA 1AH4A 2IPWA 1AFSA 3H7RA 2R24A 4HBKA 1YE4A 3GHRA 2IKGA 4GA8A 2R9RA 3LENA 4XVDA 2PDLA 2HVOA 1T41A 1AH0A 1ZSXA 3CAVA 2A79A 4DBWA 2IQ0A 5AZ0A 2IKHA 4XZNX 3LNMA 3LD5A 3WCZA 2ACUA 4LBSA 3CASA 4LBRA 4XZLX 4YVPA 4WGHA 3G1RA 2PDWA 4YU1A 4FZIA 4QBXA 1ADSA 3H7UA 1RY8A 3T42A 2FZDA 2PDPA 1S2CA 4Q7BA 1X96A 3UZYA 4JQ2A 2PF8A 3LZ5A 4PR4A 2INEA 4LAUA 3H4GA 3CMFA 3R94A 4F40A 2FGBA 4IJRA 1LQAA 2WZTA 2BP1A 3C3UA 2IKIA 1RALA 5AZ1A 2PDFA 2DUXA 2HVNA 1MI3A 1VBJA 3UGRA 5HA7A 2PDYA 3KRBA 2I16A 4FAMA 3UZWA 1PZ1A 1PZ0A 3N6QA 4DZ5A 4PMJA 3WG6A 3B3DA 3LUTA 3U2CA 5M2FX 1YE6A 4GQ0A 4H8NA 2PDUA 3EB4A 1Z3NA 4JIRA 2ALRA 3EAUA
chains in the Genus database with same CATH superfamily
3W1RA 5L9FA 2J8TA 3C61A 2KAUC 1KM3A 2XH0A 4FSAA 1OYBA 4ALDA 3WH8A 3W1AA 3KHDA 4C7FA 2Y7FA 5HDRA 4MY8A 4H8HA 3NQMA 3FX4A 1PV8A 4QHRA 5HQMA 3OVRA 5G2HA 2P0IA 2C1HA 1RZMA 4TQTA 4HNNA 4PMOA 3WUBA 3LPGA 3LQLA 2RAGA 3HPAA 4YWIA 2E6DA 3V36A 4KESA 3PB2A 2E0PA 3GM8A 5CJNA 2XGBA 3MHUA 4MFDA 5DT5A 4C6NA 5JU6A 4DQWA 4QG9A 3CAQA 2NVCA 4J3XA 2GFTA 3BAWA 4PUMA 1U1UA 4E3VA 1FWRA 3C86A 4Z2LA 3R8RA 3G22A 5HQEA 5HJLA 3VXGA 4IUOA 3RN6A 3VM5A 1TV2A 3F2CA 3LV6A 4LALA 3G1FA 1W5NA 4IIDA 4F2BA 3BLLA 4LUTA 4GQGA 5LIKX 4ZE4A 3NVDA 1OYAA 2X8RA 3FYOA 3GE7A 4KCVA 3W53A 3NQDA 4PTNA 1I2OA 1UUOA 4KQNA 3LN3A 1MZHA 3WMCA 1XBZA 4Z0SA 2NUWA 2JK2A 4UIOA 3PS7A 2BXZA 2RUSA 1GJPA 1ZJBA 5F4WA 1KBKA 3UD6A 3CO8A 4C6IA 1BYCA 2AKMA 2QCNA 2DZBA 1F2JA 1IE7C 1LWIA 4IIHA 3NL2A 3GNDA 4GLEA 3B9DA 1XLEA 2G97A 1FWGC 3EWXA 2OO0A 3T08A 1ZU8A 4B16A 1BXNA 5D2YA 4CGTA 1UPPA 2R14A 2A7PA 1TCMA 4X61A 1BGAA 4HTBA 3DYMA 2WZIA 4QX4A 1H7XA 3DBPA 1WZLA 5A2BA 3GIQA 3NYDA 3URNA 5I2UA 2ZIDA 1QO5A 2XGZA 2FIQA 2PF0A 1OT1A 4GYFA 3TDFA 3M6DA 1ZJAA 3HV9A 1Z42A 2QVHA 4AY8A 3AYRA 4DUVA 4CU7A 1XX1A 3FAWA 4KWWA 3OP2A 2HE5A 4MM1A 1H7NA 3C4UA 1DWIM 3TZNA 2NUXA 4NZ5A 3HURA 4DVOA 1Q6RA 1XG4A 3EDEA 3S5ZA 4LB4A 1RA5A 4BI5A 5K9XA 1FWCC 1PDYA 1TWZA 1K4GA 2PDCA 1EP3A 4BZYA 2I1OA 1M1BA 1XYMA 2E8ZA 2JGQA 3UWQA 1XFBA 3HJZA 4L56A 3KCOA 2GVYA 1UWIA 4W87A 4JTQA 5CZJA 3IVTA 2PEVA 3PBGA 3S8HA 4JFUA 2CLIA 3F4VA 3WIJA 3FJ6A 4UTTA 2FZ9A 2PTDA 1PXGA 4DWSA 2AQVA 1OQFA 3QY8A 3CQKA 1M5WA 2E09A 3SBFA 2ACQA 2FGLA 5F4SA 3KBVA 3SUVA 2QQ6A 3S46A 4MHBA 4LQ1A 1G4TA 2GYIA 3UF9A 3WMLA 1BLIA 3M4HA 4QNEA 1TPH1 4GACA 2PPGA 3RM4A 5C2XA 1B1YA 3TR2A 3QV8A 3RO8A 3CXOA 1PX8A 3LRKA 3SCPA 2PA6A 4UTLA 3M5YA 4JGDA 5CSUA 1HJQA 5LXXA 1RH9A 4XZHA 1KKRA 4XO7A 4IUGA 2WPBA 4XTDA 3TMQA 4DAIA 2XH2A 1SJBA 1JI1A 1S5TA 2VGIA 2XINA 4GZJA 1VS1A 6XIAA 3DFYA 2OODA 3DFOA 2ADAA 4X2RA 3DHFA 4JYEA 3UY8A 3QKZA 1TSIA 1K7FA 1PUDA 2FHBA 1E0XA 1UR4A 2NXIA 2WMFA 4JTIA 1SO4A 3MS8A 4IIFA 1R2RA 2HTMA 3KE0A 3WL0A 1I4NA 1KFBA 7CGTA 4BF7A 4O1FA 4MPQA 1T99A 2OT0A 4O16A 3LX9A 1D2KA 1TWDA 2D0FA 4E2VA 4M1BA 4CD8A 4FEZA 2NQ9A 2ZYFA 4IMDA 3SUWA 1W2PA 4RCXA 1V02A 4H9ZA 1R85A 1NVMA 1D9EA 1P0NA 3OOQA 3TLLA 3IAPA 3EX6A 5AC6A 1I8JA 3EKGA 1YQ2A 5AZ0A 3GXPA 7PTDA 1ZJHA 1B30A 3AHXA 1R0MA 1PIGA 1UWAA 5B7ZA 3MUY1 4LBSA 3GDBA 1WKEA 2V5CA 1VHCA 2ZXAA 4NAFA 3GLCA 4DO7A 4R27A 4LVDA 4NJIA 4Y9PA 3L5AA 5TQLA 2G4FA 4FZIA 3MUAA 5K9DA 2GVGA 1KC7A 2CCRA 1PTAA 1ZL1A 4HHPA 3BANA 2FZDA 2RGLA 3ZZ1A 3VOHA 5D9OA 3NZGA 1F4HA 4M51A 1NH6A 1REQB 1FHUA 1SW7A 4QQUA 1UBPC 4AIEA 2DUXA 3E5BA 1EF2A 1V7YA 3RJYA 3WYZA 4DO4A 1Q6OA 3AIBA 2ZZ3A 4IFOA 3VAVA 1XSJA 2CZ5A 4AF0A 1UR1A 5H91A 1CTNA 1HL2A 3QMRA 3KFTA 3TMLA 3GYEA 3OO2A 2A4AA 1CGVA 4ZODA 3RCNA 2Z25A 1ZZMA 3PUEA 1CXHA 1RUSA 3FKKA 3TIMA 1ZBCA 3BLEA 1S2WA 3TYDA 3L21A 4AVNA 5C70A 3IK4A 3WUGA 1R30A 3WQ8A 5D2VA 3C2EA 2V5LA 2BV9A 1QUMA 4HVXA 5AYYA 1J18A 4P7NA 2R1NA 4DLFA 3PB0A 3EWWA 3GU1A 3CGTA 4WKHA 2PWHA 4MG4A 1L6FA 2Q3OA 1AK5A 3W74A 3KDOA 4Z17A 5F2IA 5LIYX 4PUUA 3UJFA 3L68A 3PPHA 3CV2A 4ZO8A 1WKYA 1MUWA 4DJEA 4IH3A 3AAMA 1JF6A 2QW5A 4M8UA 2WMIB 4O4VA 1XGEA 5AC5A 1LT7A 3TK7A 4C90A 2ON3A 3N2XA 1SJCA 1TPDA 3HA1A 3QN3A 1NWUA 2NUYA 3HTWA 4BA0A 1Q6EA 1E5JA 1TB3A 3M0YA 4GE8A 3IJ6A 2Z2BA 4MYAA 5C5YA 4JTRA 4NQ1A 4HPHA 4HHLA 3UWZA 3W0KA 6TIMA 1XRFA 3NM1A 3LHYA 3QHOA 4G7EA 3CUXA 4GGBA 1WQ5A 4ASTA 1A0DA 4GFIA 1W1IE 1ITUA 2H9AB 2ZA1A 1YYAA 4M56A 3DGBA 1MDRA 4OVXA 2GVEA 3P8IA 1KM4A 1YMYA 3M0VA 4PBFA 2R6OA 1F3EA 3ZYZA 2EQDA 5DMYA 4D6EA 4JQ4A 1W3NA 3WMBA 1XIGA 1OFAA 3K4WA 4JICA 3HB9A 4NHVA 1THFD 1W3JA 2XIJA 1BXBA 4KEVA 5FF2A 4PUWA 2W66A 3CQ0A 5B80A 5AN7A 5EMKA 4NT0A 1UPMB 4C6MA 1A5KC 4QE4A 1JZ6A 1RJQA 3MO4A 4MY1A 2IQDA 3LCGA 2B7NA 3CQJA 1DE5A 2DZAA 1HJSA 5LIWX 4US5D 4LTSA 3LTSA 1FVPA 3DFNA 2VENA 3D3FA 2CZEA 3LG3A 5AFDA 2YW3A 3W85A 4Q7NA 3UZJA 4A3RA 4AEEA 1EPXA 4DM1A 2PRMA 4DN1A 4RNFA 1Q65A 2BGNE 4CN1A 1R7AA 4HYWA 4GY7A 3SCUA 2PURA 3LCXA 3S2JA 2FZBA 4YTRA 2BFGA 4ZXLA 4IQLA 1D3HA 3WSUA 2QLYA 2QCEA 2DZWA 3ENLA 4Q4KA 3BOFA 4ZQNA 1AQMA 3FFSA 4FB7A 2C1GA 1Z48A 5JMUA 1QXLA 1XIIA 1S2UA 3O63A 5JQ9A 4AD3A 4CUCA 4ZOAA 3UG4A 4GFSA 2QV4A 4ATDA 3HG5A 3BC9A 4ZB0A 3TC6A 4C1KA 5G2WA 3CZLA 4YNGA 4OBTA 2VUNA 3DI1A 4HNOA 1E5NA 5D9PA 5T8GA 1JAKA 3QV7A 3KS6A 4Q33A 4X0VA 5CZKA 3D3AA 3Q58A 1K9FA 3O6CA 1FBAA 4IIBA 2INZA 3NG3A 1YDVA 3M0KA 1XD1A 1FY6A 1POJA 1TR9A 1JEZA 4AC1X 3K2GA 4W89A 2PGWA 3FIGA 3P74A 2JE8A 2PRHA 2J7EA 5C6MA 3WY1A 1VFUA 3O8AA 2J78A 5CPSA 4L80A 2R1LA 2VD9A 3HBLA 2BTMA 1I1XA 2CHOA 1ZQ5A 3B8UA 3BLFA 1TZ9A 3BWWA 1J2WA 3G1HA 3GUWA 4LU0A 1W17A 2CLKA 4JHZA 5A3HA 3L4TA 1UR3M 3PWIA 1Q85A 8XIAA 5M03A 3PJUA 1WA3A 1J0KA 1BRLB 3IPWA 3TJ4A 1EJRC 1XSIA 1Q63A 5EU9A 2ZUNA 3AALA 4EACA 1W1VA 4Q7IA 1ML1A 3CEPA 2WSRA 1LOQA 4AQLA 3NGJA 1JDFA 5I02A 2H9AA 3SN4A 5C7VA 5I3GA 2XJ7A 3EMCA 4EF8A 2Q3RA 2ZZ2A 3EWBX 3NQVA 3VIHA 4O17A 3QPYA 3IJ9A 3WBEA 1E51A 2DJXA 3IS4A 3S5NA 3H53A 3GKAA 4GC4A 4DUWA 1IEQA 2OWXA 1LRQA 1GJWA 3OB8A 1A50A 3OODA 4GUGA 4XG1A 4GVIA 3KTXA 4TX6A 3OIXA 2CNCA 4C1LA 2NX9A 4H9UA 1PDZA 1W37A 3O2LA 1S2CA 2C8NA 2W4XA 1IQ8A 3M44A 3WQVA 1EIBA 3DYPA 3ZJ8A 5I79A 2WZTA 2Y1HA 3H2CA 1XH0A 1K9TA 4KGJA 5H2ZA 3T7VA 5K4ZA 3TA9A 1WKDA 1J0ZA 2I16A 4FAMA 2HXUA 3FOKA 4PMQA 4MDPA 5AHLA 5EA9A 3FA4A 1E6ZA 1CGTA 4P5UA 1VFHA 3W7DA 2PDUA 2JKAA 1OBAA 3FSTA 3USZA 3LERA 4TO8A 3TC7A 2GWNA 4F0MA 1RLCL 1JZ3A 5TBOA 4J4KA 3LU2A 4P2VA 2W79A 5E0KA 2C13A 4ZO6A 4GQRA 3CL8A 4G6CA 1HF6A 2A7RA 3WH9A 2OZ8A 3CV6A 3KBJA 1XV8A 5BROA 1UC4A 3L0GA 2R1KA 3GX9A 1EJTC 3MMDA 1LDCA 3VZZA 4EAMA 3GWQA 2TPSA 3CZJA 1GOKA 3TVAA 4D6JA 4YYCA 5LHEA 1G69A 1UH4A 3EZ4A 2J6XA 5ECVA 3O06A 2W27A 1T40A 3E0LA 1DWJM 3R0UA 4LYPA 4ZVJA 1HG3A 3QF0A 4GHRA 1BWVA 3AROA 1K1DA 3O1NA 4A3YA 2OYKA 3SUUA 3L4WA 3JS3A 5JIWA 2PLMA 4LH8A 4G9PA 2YA0A 1W32A 1KCLA 3R4IA 5D03A 1IGWA 4CCDA 2X40A 2CW6A 2QDDA 4C6EA 3OGSA 5EKYA 2H90A 5CKSA 1JZ7A 3TNBA 1LLZA 3FDGA 2YR1A 1BF2A 2VOMA 2A85A 1ZALA 5FEWA 3VZYA 5BRPA 5AY7A 1L8PA 1X8CA 2J8GA 4QGCA 1B2YA 1IEWA 1QTWA 1GVRA 3EPNA 4U3AA 4O8AA 1W1PA 2FJUB 1KCKA 1BRLA 3TYAA 3N04A 5M3WA 2OKOA 3SUSA 2ZUVA 5HNUA 1W2VA 3GNRA 1E55A 2VJXA 2VFEA 2GOUA 2F61A 4H8UA 1VFOA 3EEZA 4U2YA 2DORA 3Q37A 1ALDA 2PTYA 4AISA 4YTSA 3NL5A 1EL3A 3VM7A 4G1NA 5CBBA 4K39A 4AWSA 1TMLA 2C91A 3R1ZA 1E0WA 3P93A 2DDXA 3W07A 4HMNA 4OUEA 1UZHA 3TFCA 1GVQA 3DOPA 2CC0A 4IQDA 1R7OA 3QZAA 5XIMA 2BHZA 4UNLA 1MDLA 1WXYA 1XBYA 1EDQA 3L4ZA 4OECA 4YWSA 3PPGA 4K1GA 4JTUA 2WW5A 1GVYA 4AD2A 2YX0A 2CLEA 3ZM8A 1EWDA 4PL1A 1AZ2A 3SJ3A 1EC7A 4C6DA 3H2AA 1UQYA 2CXGA 2AOSA 3QY6A 3CT7A 4RE3A 1TPB1 4C65A 4GNJA 2XYLA 1AODA 3G8RA 4CNTA 2CWNA 1L2QA 3VGDA 3VNJA 3P81A 3IIXA 2CLFA 3LDVA 3TQPA 2NV2A 1NFGA 5I07A 2UBPC 4WSHA 4S38A 1IWAA 3A23A 4E5TA 3HQPA 4Y2WA 1IZCA 2WZHA 4JQ3A 3N18A 5MKGB 1PEZA 3AIVA 3O3RA 1U5HA 1RJRA 5A69A 5AECA 3QW3A 3LGDA 5KZEA 1XLAA 2PB1A 3WF4A 4KKXA 1C8YA 4L5ZA 5HJXA 1XGZA 1EGMA 2YKKA 3P8JA 1OABA 2V8ZA 1EUNA 2DSZA 3PJWA 2ZUTA 1V0LA 1EX5A 4LGXA 1W9XA 5D05A 4YVXA 2VEFA 2BG5A 4KWOA 3CEUA 1XIDA 1Q6LA 5CLTA 2A3LA 3R43A 3N2OA 1ESWA 3RMEA 3TXZA 1KR1A 3R8GA 4A4AA 3W7PA 2ZE3A 1F3TA 1SPQA 1XRVA 2P8BA 1S3TC 1WDRA 4W86A 1JQXA 1SVDA 3PUGA 2JKEA 4Y9MA 5ABEA 4V1YA 2ZKMX 3B9AA 4GKTA 3M64A 3LMZA 5LNVA 1ZS2A 1TVNA 4GO9A 1P43A 3TA6A 3ABZA 3E9AA 4DHGA 2BGQA 3T4CA 4KCWA 3NQAA 1MSSA 3BARA 1DJHA 2RJGA 3IJDA 5CAKA 2B4GA 4JAWA 4ML9A 5HMEA 5K2ZA 3SADA 3IGXA 4Z2JA 4GX9A 4KFNA 3AU2A 3AMLA 4FIQA 2XFWA 2YJQA 3DXIA 3ZR5A 2Y61A 1ICQA 3BE7A 3C3NA 2JF7A 1PX4A 1IIHA 4R5EA 2ZC1A 3WQ6A 2R24A 1OVDA 1OT2A 4QJ3B 2V5JA 3CTLA 3EBVA 2PWDA 3EGJA 3CPGA 1HKVA 1AUSL 3NQ6A 4GY1A 4H41A 4NRSA 4Z1BA 4EK7A 2J62A 3SUTA 5LZLA 3WCZA 2QKFA 4JN7A 2FQIA 4O18A 3QYQA 3ANVA 3HMJG 4QCFA 1FWJC 1DE6A 4BQ5A 1KTCA 1TKKA 3MUZ1 4WX2A 4GJ1A 4MYXA 2OQHA 4JHOA 1O5KA 5BU9A 2NSOA 4P7OA 2VMFA 2PDPA 3MA8A 4WSKA 1TZZA 3TKFA 2ZOXA 3LZ5A 3WF3A 1KFEA 1VRDA 4FIRA 3MDUA 3WQCA 4B92A 2INEA 3UR8A 4UQEA 4EPKA 4F40A 4LUSA 3SFKA 3IGHX 4US6A 4D8LA 4FMVA 3W88A 1FHLA 4MNLA 1OINA 1MI3A 4N02A 5M5DA 1MW0A 1QNRA 2HVMA 4MJMA 4CD7A 1GOMA 4AZCB 1JZ2A 1W6TA 4GK8A 2W91A 1XICA 2REQB 1UB3A 1EWEA 3L67A 1T7LA 3KDNA 4D6HA 3EX1A 1OCJA 1B4KA 3D0CA 4PTXA 3MBDA 1JRCA 3SCSA 4QS6A 2PBOA 1K8XA 2A3BA 2J25A 2WVVA 1P6BA 1KNWA 4GMEA 2W6RA 3S6OA 3IWPA 4PTMA 2B0MA 1QI3A 4WIWA 2VX7A 2OYLA 1FWAC 2XGIA 1O12A 1QHPA 1A5BA 1MW2A 3OZOA 4I5RA 3WDIA 1BYAA 4MWAA 4B9ZA 1ONEA 4BI7A 3MI2A 4YMZA 4GYPA 3C5QA 1EYWA 2V3EA 1PCWA 4UR7A 3T2QA 4PMYA 5JBFA 2AL2B 3CHFA 2XM2A 3ES7A 4H6EA 5F4XA 4B2DA 4DELA 4X22A 3TLQA 5KINA 3R0DA 2NT0A 1E1FA 1ELSA 5CPTA 4AZ5A 4E38A 3MI6A 4ML4A 2QS8A 1HN1A 2QAPA 1F05A 2Y85A 5C9RA 4MIMA 2VR4A 2FMOA 5KETA 4UFIA 1MYRA 5DMLA 2PC8A 4LAOA 4C6FA 4HCHA 2OELA 3AHZA 4Q8WA 5BRBA 3JVAA 2JALA 5CC6A 3MUCA 2XSBA 5XIAA 1JIBA 3MPGA 1AW5A 3L4XA 3G1XA 2J7FA 1LWJA 4WXYA 5LA2A 2PZ0A 5HMSA 4DZAA 1A5AA 1O5XA 4DIAA 1SFLA 4MTVA 4UNKA 2PGRA 3EOSA 3KLLA 4I7WA 3C2RA 4S39A 1XLKA 1NDZA 3L4YA 4HGXA 5U7SA 4DJFC 4BWLA 3UWEA 1QI2A 4LSBA 5IOBA 1GJUA 1MW3A 1A4LA 3JW7A 2O4MA 1UA3A 4S23A 3U9IA 3AS0A 4MGGA 1POKA 5EFDA 1I75A 5A6KA 5JBDA 4GWEA 5ABHA 1QU4A 5AC8A 4MWAE 3H55A 2VQUA 4QIUA 1GKPA 2VFHA 1WBJA 4NG3A 1TUXA 3TTEA 5C2GA 4CCZA 2R94A 3PBWA 4JL2A 4O1AA 3B9NA 2J7HA 2RKXA 4UR8A 3KRZA 3KP0A 1TCDA 1V79A 1QMLA 3WH5A 4REQB 2VGFA 4CQ8A 1GKRA 3VDBA 4XIAA 2NV9A 4WF7A 1VR6A 1H63A 2A1YA 1ISYA 1DQXA 1VC4A 4ZZ9A 2VL4A 1A5LC 4KW2A 4F0SA 5FJRA 3KVMA 4NNCA 1CCWB 1A0CA 4K8EA 4YTTA 3MO7A 4D9PA 3TSMA 1EF3A 3V1PA 4ZEPA 4XAPA 3M16A 4NX5A 4O54A 1E0UA 1C90A 2DSWA 1JPDX 1GQNA 1GQKA 1LJYA 4AG0A 4KGLA 2EKGA 3DH7A 1TO3A 1KBLA 1JPKA 1SM9A 2EPMX 1F74A 1G0CA 1GVOA 1E0TA 1OJXA 1E4LA 2REQA 1B3XA 3M7SA 4HU0A 4AHQA 1XYZA 1NJJA 2V38A 4HNLA 5LIUX 3DI0A 4NJGA 5K3VA 1DIKA 3MKCA 3PULA 3KOZA 2XIQA 3LYEA 2FVKA 2PRLA 4OUIA 3T07A 4A3HA 2X09A 4QDMA 3OPSA 2FHFA 3T09A 1B3YA 2H8XA 3UWVA 3DHUA 4I8DA 4FXFA 3T0TA 4XVEA 4XBJA 4CD4A 4M3PA 3QVQA 3ZR6A 4EANA 1KCZA 2ANUA 4RX0A 4IGNA 2YSWA 3IACA 9XIAA 7XIMA 2BY2A 3UZXA 4Q8VA 3M41A 1GOOA 3NSXA 2AL2A 5ECUA 1R3RA 3PTMA 4YVVA 4LYQA 1X98A 1H4PA 3UXIA 3NQEA 4Z2HA 3I10A 4D6FA 3B8VA 2DT1A 1W54A 4PCTA 3S9ZA 4UMAA 3V3WA 1Q7MA 4OT7A 4LBUA 2ZUWA 3ONBA 3PZGA 2WMKA 1CI1A 3U2ZA 1PJ9A 4I3GA 1Z32X 3LV5A 1KRBC 4AY7A 3P84A 1AA1B 2Q01A 2ZXQA 1IHIA 4Q8QA 1TMHA 1DQWA 2YDAA 3D6NA 4IGHA 3RLUA 3ZVHB 5D2XA 4QEEA 2PLJA 4OHQA 1H7OA 1ZTVA 2GQ8A 2IKGA 2KX9A 3VOIA 3UWUA 1TMQA 2HISA 3P60A 4S3FA 3NGFA 5LGXA 2IQ0A 4YPJA 2YLLA 3MMTA 3CUGA 4E4FA 1E73M 4HNTA 1UWQA 1IIGA 2ZVIA 4LBRA 4NZ3A 3U5YA 3HG3A 4S3BA 2OOGA 4RKAA 3REQB 1MEHA 4JFSA 1FX6A 5C0QA 2QCLA 4MOZA 1XUZA 3OGRA 3SGZA 5KZMA 2FH8A 3ITTA 1E4NA 1PZ2A 1D3CA 3N15A 1E9ZB 1IEVA 1UD8A 3SN0A 3L66A 5IDZA 5HXMA 1ADOA 3RLHA 4PH6A 4Q6JA 1QVBA 5AYIA 1CLVA 5CGQA 3UPBA 1YHTA 1AMYA 2HS6A 3W86A 3C3UA 1OYCA 3VUSA 2FDMA 3UW6A 3BQ6A 1GPWA 5HA7A 1E4IA 7REQB 1CEOA 2YBUA 3AXMA 2QNEA 4IG2B 4F66A 4AX7A 2FB3A 2VVSA 3UETA 1BG4A 3G1AA 3W70A 1O4UA 5FJUA 1ZLPA 2OSYA 1WPCA 2JF6A 1Z3NA 4JIPA 4M1RA 2EG8A 2V3GA 5LHFA 5LNWA 2UY4A 1XISA 5H8UA 4KEZA 3MW7A 5D8ZA 2G3NA 1YXYA 2YL9A 2PWGA 4KIEA 3S6TA 3B4YA 3AI0A 1YBQB 1V3KA 1OFDA 5CC3A 3RO6A 4GVHA 1UD5A 1UWUA 5A6BD 1UD4A 2J88A 1LM1A 3N1AA 4O1DA 1XLBA 1OF8A 1VP5A 4C1NB 2O56A 3WKZA 1M7PA 2POTA 3DKLA 3NQGA 1DHPA 3Q4DA 1S5NA 4K1WA 3W7EA 4JBRA 3IUDA 2PDJA 2GUYA 4FXJA 3DBNA 1H11A 2VKZG 4DJDC 1ZHAA 1LRTA 3LS9A 3WEOA 1JCLA 3ARRA 3MSDA 2QF8A 3WEZA 2QUMA 4XD4A 4HJFA 3BOLA 3FNDA 1XH1A 1XYCA 3P2VA 4W84A 3EA3A 3ZLGA 4ADSA 2XFRA 3WQOA 4ZQCA 4LV9A 4MF4A 2I56A 5FJPA 3KHJA 1AQHA 1HKWA 1ME9A 1KM0A 1FUYA 3C0LA 3U8GA 4B15A 3GH7A 1XG3A 1WKFA 3NOYA 2G3FA 4K38A 3R5EA 3OVGA 4L61A 1NOFA 3GDRA 1C8QA 3W2KA 3Q94A 4LXFA 1CYGA 8RUCA 1JNDA 3R6IA 2PDNA 1F8MA 3TYUA 3H12A 4OIFA 1GVEA 4CEXC 2HSAA 1NWSA 4UTUA 3VCCA 1QWKA 1W9VA 4P8UA 4ZE5A 4RDZA 3ZVHA 4KBXA 2X2YA 2WCGA 3WQ4A 3W7CA 4N9CA 4IHCA 2Z7GA 3E1F1 4NAEB 3ITLA 3EWDA 1K7EA 3U6WA 1XDJA 2E77A 2BMBA 3GXTA 3LSBA 3FGCA 3OLGA 1TV3A 5DXXA 4K8GA 1M03A 1G01A 3QW4B 1XLGA 2BY0A 1SFTA 1NOUA 4HMEA 3TX9A 3THUA 1WCGA 4HZ6A 3DCPA 5EMMA 1EJVC 4LB3A 4Y96A 5A95A 1EXBA 4GVFA 3WLIA 2WSQA 2I17A 4NZJA 3S1VA 1VH7A 2PFHA 3FKRA 4GIEA 3JZUA 1TPVA 3HQ1A 4B5WA 1H50A 3TJIA 1XRSA 1EA0A 5C9WA 2ZZ5A 1DTUA 5CBJA 2PP3A 1HTIA 3VIMA 1DJZA 1ZAIA 2C0AA 5A8OA 1Q8AA 2WLZA 3M0MA 4Q4QA 4GINA 2YDSA 2JIEA 2QEZA 1FCVA 2HS8A 7REQA 3LY0A 3SRFA 3NO5A 1VAHA 2B31A 2IPJA 3UXAA 3BL3A 4IG2A 3P14A 3UZ5A 2WAGA 2Y24A 1XLCA 1JPMA 4BCEA 3QH2A 4RPQA 3GXDA 1I0BA 5HNTA 2BOFX 3UZZA 3P7YA 4ZB2A 4FPSA 1SJDA 1PIIA 2AGKA 4AW7A 2IS7A 3LGEA 1Q13A 1I2RA 4P7LA 4TXEA 1W1YA 4O1BA 3BLOA 3S2CA 3B04A 2WPGA 4MLRA 3OLEA 1QOQA 1ECQA 3L2IA 3LBOA 3ABQA 3IV8A 3EKZA 5D2TA 3MTWA 1HFBA 5CJ5A 5AC4A 1QPNA 4FX7A 2KZHA 1FXPA 3TC3A 4ZMGA 2NQZA 3M0HA 3MSRA 1V0KA 1NDVA 3F5LA 1IT8A 3WQGA 2D23A 3HQOA 1QK0A 4UTTC 1RCXB 1BYBA 3LCFA 4DWSC 3T05A 3GH4A 1RBOB 3UG3A 2WBKA 4HK5A 3WJZA 5GNXA 1UIOA 3PSWA 3BSHA 1AW2A 3WN6A 1UZDA 4GXPA 3NVTA 3LXCA 4CN6A 2PWFA 4NASA 4JZ5A 1GZGA 4KIRA 1CGYA 2QIIA 3NNTA 4KERA 3OHMB 2WC4A 3HQNA 1TQXA 4Z1YA 4AMCA 5IBXA 2CBJA 3C6CA 3GHRA 2TRSA 1DPMA 4YHGA 2I5IA 4XUGA 5FF3A 3GSMA 1FKWA 4XAFA 1IT7A 1XIJA 2TAAA 2FTWA 3ZT6A 4NZFA 2QGHA 4MB5A 3W84A 2F8QA 3ZS4A 1VCFA 1O94A 1FQ0A 4Q4OA 5PTDA 1IZKA 3TN5A 3A3HA 4YHEA 1JXKA 2PDWA 1ISXA 5I3HA 5I23A 1Y5XA 2X1RA 1V6XA 1XH2A 1KRAC 2AMXA 1I45A 3H7UA 3K8MA 4LCQA 4AH7A 5F2GA 2VFFA 3SRDA 1TPWA 1BTMA 1QNOA 3M47A 1N7KA 4NAEA 3VNYA 4GUJA 6REQB 1OY0A 5E09A 3K5XA 3UPMA 1DWHM 1R9YA 3LK6A 3WQEA 4J2PA 3B8WA 3BG5A 4TX9A 4H3DA 1M3UA 1ZRQA 3TTOA 5A6TC 1VFTA 1PYMA 2ASHA 1I2NA 4TV6A 2BVDA 3T1GA 4INFA 1X6UA 3VNDA 5M2FX 3AUJA 1JULA 5FEZA 1KFCA 1UP3A 2GUUA 5H1WA 1CGWA 1S39A 1TWWA 5D2WA 2PP0A 3QFWA 4JIRA 4L4PA 3ARXA 1C8VA 1XKJA 3IANA 5C54A 1J0YA 2PUZA 7TAAA 3LPFA 5ENLA 3IJIA 5EGRA 4DBDA 1V08A 5D4YA 2XIOA 4NI3A 7ODCA 1UBSA 1ZENA 4IZGA 3GTIA 3V0TA 3O9NA 3FJNA 1IXOA 1Q5MA 1B31A 4GX8A 3K8KA 3BMXA 3VMOA 3H24A 2Y89A 4ZOEA 4XSLA 4KEMA 4V33A 1ONWA 1UP0A 5JUVA 1XCXA 3NPXA 2J7GA 1OZMA 4R3UA 2INFA 1E9LA 3OG3A 1E6RA 3AMDA 3VC6A 1MFVA 3OU8A 3STFA 4A8LA 3RR4A 1H1NA 4RL3A 1MRAA 3F1QA 3OA3A 2W3ZA 1XM3A 1GYLA 3QMTA 1UQZA 2JBMA 1KXTA 2P3EA 3SCNA 1H0GA 4N7QA 4WR3A 3G3MA 5TAOA 4PEKA 1E0VA 2CESA 1XLIA 2P88A 2GJXB 2NWSA 4GZEA 3NYZA 2HRWA 1HL9A 1G4PA 2QDHA 5T26A 4W88A 5IHRA 4DJEC 4JR5A 5HBFA 1N2VA 3ABOA 4CQCA 3M07A 2CLPA 4IIGA 3F2BA 4WDWA 3UBPC 3WL1A 4WDXA 3ITGA 3HF3A 1O68A 3SN1A 4Q4RA 3A9BA 3NDZA 4ZFCA 2YYTA 4QDPA 3HIJA 2BHUA 3C56A 2W67A 1HXJA 3ME3A 3N4AA 4J1OA 3OW1A 2GSEA 1FXQA 1MO0A 1K8ZA 2GQAA 4L6OA 4WJEA 2PWEA 1YLVA 1P1MA 3BV7A 1PE1A 2IXVA 1VPYA 2VO5A 4JFWA 3A21A 3DHPA 2XVLA 5CGTA 3W75A 4NVTA 4P8VA 3TP4A 5FJIA 3DESA 1RXOB 1UG6A 1YNQA 4U3CA 2A3EA 1NARA 1LL7A 1QPOA 1QI5A 5G2IA 2NXGA 1HKMA 4NXKA 3PZIA 2ESCA 5A1AA 6REQA 3EX2A 5CC7A 3WH6A 1EEPA 1ITXA 1M9HA 1IXPA 3CB3A 2FTPA 2G95A 2DZTA 2AKZA 2ZZ6A 1HVQA 2A6NA 4GY0A 4S2BA 3DFPA 4EPBC 1QPKA 3ISIX 3BUVA 3QJAA 3QKEA 1RP8A 4E8GA 1DP0A 1K6AA 3UR7A 2QCCA 1J11A 2PODA 1A47A 1C9DA 1IXNA 1M53A 2JKPA 3DN5A 1S5VA 2RDXA 3UFYA 3MT1A 1EDTA 3SGUA 1GTHA 3URQA 3DFTA 3EDKA 1AW1A 1S38A 4DYKA 4UQCA 1DXIA 4FOKA 2WMJA 4AYGA 4AUBA 1G5AA 3EDFA 1RQEA 3RUBL 1MUMA 2FTYA 2WMGA 3PBYA 3RK8A 3ARYA 2HV5A 5M1TA 4ROQA 3WK1A 2IKJA 1BQCA 1GGOA 1H3GA 1UR0A 4IMGA 1RR2A 4F4RA 1XKYA 5TNVA 4H9MA 2Y8UA 3W2NA 1T96A 2Y88A 3WELA 3ZWTA 4GKLA 4Z0JA 1U1HA 2OVLA 3M0XA 4DUOA 4ICCX 4ZSTA 4BQ2A 5JVLA 2VUYA 1XLFA 3CHDA 2Y7GA 4RK8A 4NJKA 1XLHA 2QPUA 3P80A 2G96A 1S2AA 4XZWA 5I6SA 1QK2A 2XFFA 2QJIA 2YA2A 3WZ0E 5FL1A 4GCAA 5EPDA 3VC5A 1TUFA 3F7JA 3SCVA 3STPA 3S3GA 5KEZA 3XINA 3FXGA 4J9JA 3GY1A 2NVAA 4QFUA 4S3DA 3H7RA 3VGGA 3TH6A 1R87A 2GJXA 5DELA 1YE4A 2ZZ7A 2ISWA 4FOUA 3WK0A 1HGYA 1VPXA 4KH2A 3HPZA 4M6PA 1LOSA 1T41A 3MHFA 3E5PA 4C6OA 1ENUA 1ZSXA 1DOSA 1F07A 2WMHA 3BLDA 3N29A 3UCCA 3GVRA 6ENLA 4AYSA 4QG6A 1XBXA 5J5DA 1UR9A 2VM8A 4IP7A 3OIHA 3ZWSA 1PHWA 1XLJA 4MKNA 1GNXA 3U2OA 1TPC1 2X41A 4TUFA 1W8GA 1E1EA 1R3QA 3WJSA 3GYCA 3IGSA 5I7GA 3WNNA 3W7QA 4AC7C 2ZQ0A 1KQZA 3I6TA 4HP5A 4LAUA 5DY2A 3CAKA 2I7GA 2IKIA 3SGGA 3CUFA 3W76A 2DQXA 3PN8A 1Q6QA 5IM51 4FK9A 3MV11 3GTXA 2YDRA 3C2FA 5KZ6A 1R3VA 3NSNA 4WY0F 1BQGA 1Q4WA 4A2SA 4Q8PA 2QZRA 4US5A 5DF0A 2PTXA 4O52A 5EY5A 1HKKA 3AICA 3EXTA 3VU2A 3CBWA 2VQTA 4D6CA 1FWFC 1MWOA 1OGSA 5I3FA 2OEJA 4B9YA 1SZGA 3FA5A 2WSKA 2YPIA 3MUXA 4AAJA 4CKQA 2BLEA 5CSRA 2HPIA 5E6YA 5BW6A 4EVZA 2HE8A 3G0SA 2ZICA 2X16A 4M24A 1OX5A 1IZJA 3SAZA 4DBEA 1HO4A 3GTNA 2OYMA 2ZTJA 3GG7A 1CXLA 2G4JA 1K8CA 1KFWA 3W23A 4R9XA 4LW7A 3UGVA 4UUIA 1V6TA 1TJ0A 3ZT7A 5DN1A 1TPEA 1US2A 4MJZA 5CPMA 1OK6A 4ERIA 3S5SA 2EPNA 5A8QA 3PZMA 3RRAA 1E3ZA 1KW1A 4WGXA 1Q2SA 3BJFA 2ONEA 3AHTA 2J9YA 1V8EA 3RX4A 4GJJA 2XIBA 3BW3A 3ARVA 2X1SA 2YXOA 4L6DA 1XL9A 2E7FA 2WVSA 4L4LA 1CENA 1A5UA 2VELA 1OFBA 4RUBA 3SO7A 4HD5A 3ARSA 3WJYA 4BY3A 3GUGA 3T0DA 3AMKA 3FDKA 4K7VA 1VBGA 4YS1A 4EAYA 5A6LA 3FCPA 4IMAA 5CG0A 2FMNA 2YDQA 4ZFMA 3WD0A 1FHVA 3ZFHA 3C2VA 4UQBA 1P4CA 4F48A 2TSYA 1XIFA 4KWVA 3QHMA 5G4EA 2PDBA 4D71A 4NF7A 3W02A 3STGA 2Y62A 3N14A 1B5TA 3GU9A 3VE9A 1BF6A 2XM1A 1HNYA 2H8ZA 3WLHA 3XISA 3I4EA 1E4MM 4LCRA 4OOZA 1OZQA 1W5PA 1W9UA 2WZEA 1G7VA 5I3JA 3GHTA 3F4WA 3QLDA 2VC7A 5HNRA 4FI4A 3THCA 1GORA 2V6AA 5G1YA 2Z26A 4FLOA 3S0CA 3KL0A 1RK6A 3WDJA 3LRMA 2OLHA 1O5QA 4AZ7A 4IX0A 2OZ0A 1OF6A 1M68A 3W6YA 1V51A 1GYMA 3ES8A 1AJ0A 1LUCA 1XDMA 3VGEA 3HJEA 3OVPA 1B3ZA 3WNPA 1R2TA 3VD3A 3AS1A 3AHYA 1EPVA 2QR6A 1JR1A 4LF2A 2AQWA 4IPPA 5CBIA 1RVGA 1X7IA 3KRSA 2WJEA 2VZVA 4XZIA 1KXHA 1MMFA 3RNDA 1Y7VA 4QR6A 1XQKA 1UJQA 3DX5A 2AAAA 3W6LA 2HJPA 3THDA 2VZUA 2BVTA 4X63A 4XD5A 4IJCA 4A22A 4J3WA 2YL6A 3NQBA 4ZQMA 3UVAA 3UWYA 4E2OA 2EXOA 5JIPA 2ZRXA 4IFKB 4FLQA 4E6MA 4ROPA 2NV1A 1QOXA 3GVQA 5HWNA 3USBA 5HMFA 3WNKA 2FFIA 2QDGA 2GDVA 4B3KA 5J8LA 3CV7A 1LL6A 3GZ3A 4YLWA 5AVHA 3PC0A 3IUIA 1OD8A 1A5CA 1DKWA 3IIOA 3IV3A 1M7XA 2NXHA 4JNYA 3FA3A 4UFHA 1EC9A 1MQRA 4GI8A 4HHMA 1KM5A 2WKJA 1Q7QA 1RSCA 3WJXA 4MUPA 4L9YA 3W81A 4IPIA 3VKJA 4A8NA 1ZCOA 3WEMA 4HTYA 2QPSA 1TTIA 2CWXA 1PKYA 4TMCA 4JFTA 2GGHA 4BQ3A 1OG6A 4YCOA 4XD3A 3IJLA 4A21A 3L2MA 3QV6A 1NOWA 2PDMA 4H04A 3UG8A 3O0KA 3VDGA 5IFPA 2D22A 4O50A 1OFOA 2FH6A 2J66A 3Q67A 4PODA 1UKSA 1V4YA 2GL5A 3VTRA 3CHCA 2YCJA 3H4WA 2J79A 1C7TA 4TOQA 5AYZA 3VI2A 4J2MA 5D09A 2OT1A 2Z24A 4L9ZA 2DUZA 2VCBA 4DZIA 3T2PA 3DG3A 4Z2GA 2NVDA 4UXDA 2F6UA 3VD4A 1BVWA 3W1XA 2ZRZA 1LF1A 1UZ1A 3LHTA 3S1GA 1SFSA 1AFSA 2PCEA 4OV4A 4ADTA 3OYXA 4AWEA 2XN2A 4FS9A 1JNEA 1PHQA 1W31A 4F0HA 4S3EA 3CAVA 5DCEA 3TXVA 2ZX5A 2F7FA 3MCOA 3LLFA 4J3TA 2VGBA 2W62A 4Y8EA 3UJRA 1BSIA 2J74A 5FOOA 3QRHA 2ZWZA 1TJRA 2QUNA 2ZZ4A 3CLMA 4N9EA 2B7QA 1J0IA 3PANA 2RDTA 1O1HA 4H4IA 1UIPA 1BSLA 5LA1A 3GDTA 3C0QA 4NYYA 1X96A 4PCSA 2XZ9A 4MFEA 1CXFA 1MFUA 2FPTA 5FF0A 3KVLA 1RALA 1SZEA 1WUFA 2J6VA 3IVSA 2I9EA 3GR7A 1XIBA 3NXFA 2DZPA 4W8LA 2EPLX 1M04A 3DC8A 3TTQA 2PBGA 2V82A 4MNJA 5FESA 2NQHA 1GTEA 9CGTA 5K7JA 3BLKA 1WNOA 1V0NA 5D37A 5DCDA 1UC5A 1ECEA 3PPCA 1VJSA 4MMWA 4NP7A 4WD0A 5B7YA 2G37A 4O1CA 3BGAA 1ITCA 1RHCA 5T9CE 4Q4SA 4D6IA 3RRXA 1XLLA 2QUUA 2ALRA 2V2DA 2J9XA 1EH9A 3A3XA 4O0KA 2DW7A 2VD8A 3CZGA 4JFVA 5CPOA 2OX1A 1KBBA 1QW8A 1B54A 4PRTA 3W2UA 5HWMA 1HW6A 1Q6CA 2Z29A 3GNPA 3WK3A 4IFKA 1US0A 3ARTA 4JDYA 3VPLA 3SY1A 1HKJA 3QTGA 3O6YX 2QJNA 2WC7A 3LNPA 1YPFA 3GFZA 3B8TA 1XYBA 2C16A 1UYQA 3WLMA 4O53A 3U5UA 1WYIA 3SSZA 1X6NA 1ZGDA 1PSCA 4K2SA 1EQCA 3LMYA 4O0QA 4LY4A 4DBUA 1BTCA 2Y70A 3W2JA 2CHNA 3K1DA 4RJEA 4ZTXA 4PUKA 4AZHA 1CNVA 1OC5A 3RCYA 1M7JA 4U5IA 5KSWA 1DL3A 4K7YA 4MWAC 3IGUA 4H9TA 1OC7A 1EX1A 4P8XA 4GYPC 2PLCA 1FTXA 1BG9A 1E9IA 3G1YA 3HFTA 4GUIA 5LXEA 4V15A 3QSTA 4F2TA 1AZ1A 1EJXC 1UKPA 4B5VA 2OTDA 3NOEA 5AB3A 3N12A 2F2KA 3POHA 4O19A 2XSAA 3IK2A 1NEYA 3BLPX 7A3HA 1KFJA 3MZNA 1JL8A 3THAA 5BYWA 2YB1A 1QO2A 4ZR8A 5ABTA 4NNBA 1XF0A 3VNLA 1FDYA 1ZP3A 3E0WA 3RPTA 1G7UA 2VX4A 2OCZA 4JN6A 4HOWA 4NY2A 5FJJA 1BGGA 4DX3A 5KZDA 4HU3A 3QPZA 1XJBA 1Y65A 2O9PA 5BOFA 3V0UA 5BXTA 3PTQA 2BS9A 1O6IA 3CYJA 1CGUA 3TN3A 4D8AA 3VIFA 6PTDA 3BV4A 5GPRA 4LEQA 1VFSA 4BWLC 5FAJA 3H4XA 2G3JA 2RFGA 4ERAA 2QJMA 4N0RA 3ZLHA 2Z2AA 1AJZA 4ORIA 4F9JA 3TJLA 2WK2A 1IT0A 5SWUA 3VIOA 5D04C 3G2GA 4JTSA 4HB7A 1F9CA 4UFKA 3A64A 5BCAA 3TQVA 3AZTA 4KWUA 1JUKA 2VP8A 3Q2DA 4GG9A 4PL2A 3M7WA 4P61A 5D9NA 4FR1A 4R85A 3V5OA 4H2HA 5LIXX 1EC8A 4HK6A 4TVCA 3H70A 4Z2KA 1N55A 3ABSA 3RX2A 2QUVA 3MHGA 1XSKA 1YPIA 2P10A 1QWGA 3G77A 1JYXA 3B0XA 3OQ8A 4GXMA 1VFFA 2DU2A 2P76A 4GO8A 1P0DA 1OD0A 3WENA 3AXXA 5CZSA 1NF0A 3MANA 3AIUA 3ABRA 4J27A 2FPVA 1TTPA 1DV7A 3GK0A 2ZTKA 3WBWA 3U4AA 1VB9A 4GXWA 2E28A 3DERA 1MEIA 1XCWA 3VD9A 2GPTA 3CL7A 3N2CA 4CNPA 4O14A 3H21A 4AZIA 3UR2A 4UTKA 3KCJA 5DLCA 2PTWA 5LGZA 1JCXA 4GI6A 1XRTA 3N3MA 3VIPA 2WO5A 3B05A 1L6SA 2CZFA 3WNMA 4QSHA 3ZSSA 2NQ5A 2W9MA 3T81A 4C6JA 3IJ7A 2DZUA 3NSMA 1PAMA 5CH9A 2BVYA 3WF0A 3H2OA 1J8VA 4FHAA 2X0SA 4UOJA 2YL5A 4DWDA 2DJLA 1W5QA 3SECA 2XVPA 1T8XA 1I60A 4IGSA 3PVFA 3DG6A 1DJYA 1CB7B 2CYGA 2DFAA 5FJTA 1JYVA 4IP5A 4MKSA 3KEHA 2DEPA 2XU2A 1V02E 5FIPA 5GNYA 4LEFA 1E1CB 2CZVA 2QHAA 4C91A 1HJXA 1SZRA 4CVUA 1AH4A 5LKYA 1TJ2A 2C3ZA 1H09A 4ZCWA 4C6LA 2YFOA 2YGYA 4H6KA 4XVDA 1UHVA 1GW1A 4LVBA 1XC6A 3GDKA 4JKLA 1AH0A 4J40A 4E4UA 1R8LA 3QV9A 3H6OA 4XKYB 4B5SA 2E25A 5K9CA 5T9BG 3N25A 3WX7A 4HSOA 3WJWA 1R9XA 1GPFA 4QITA 3GBDA 3UQNA 1CWYA 3CMJA 4WGHA 1R46A 4C6CA 5A6AA 5EFFA 3MWAA 1XPYA 2V30A 5HPOA 4J3ZA 2GLKA 1EZWA 2VEKA 3ICJA 5FD0A 3UU0A 4Y9OA 1Q6GA 2F6KA 1CDGA 3G1DA 4AU0A 4HCLA 1FFQA 2O92A 1WDDA 3SIZA 3BMVA 4C6BA 5AZ1A 3TN6A 2OEKA 2ZRVA 4ENLA 3TUUA 3BQ5A 2GDUA 2D73A 1VBJA 3ITYA 3G8EA 3PF3A 3QEZA 3TOYA 1PZ0A 3N6QA 2VWTA 1Q2RA 4R53A 4A35A 2BZNA 3A4WA 1YE6A 4KETA 3I7SA 2ABBA 4FXRA 1FP9A 4CQAA 3VMPA 3N6JA 2YLAA 4XX6A 3W28A 5DXYA 2VC9A 1UUMA 3ZJ7A 3FVDA 3DHDA 3LXBA 3NQFA 3L2LA 4GD0A 2X2GA 3MB9A 4ZXOA 5DEZA 4DO5A 1XIHA 1LL4A 4X9SA 4XSMA 3OBKA 3E38A 1C29A 3NQ8A 3PAOA 4DXVA 3W1QA 1IF2A 1ISVA 2D2OA 1RQHA 4N4QA 4J28A 3AFBA 1LROA 4X3ZA 3VINA 1ODZA 1XS2A 3QQ1A 3KBSA 2WZMA 1UZ4A 2P5NA 1PWLA 4AD5A 3UVIA 3EA2A 5FF4A 1Q8JA 3WFAA 1B3VA 4ZENA 1V0MA 2HK0A 1LCOA 3QMSA 3M5VA 1REQA 4I9JA 1X1OA 3BXWA 4XZ9A 1TJ1A 2UV8G 1AD4A 4DEFA 1T5AA 1K77A 1SW0A 4PUNA 3MP5A 4V1XA 1VLWA 3YPIA 3GC5A 1E9YB 5CPLA 1OG0A 3GZAA 3NUKA 3WLRA 2ISVA 1TE1A 2DGAA 4O15A 3SSJA 3OYZA 2VEGA 1DQUA 5G1TA 2Y6ZA 2YA1A 3DDMA 3DAQA 3DC0A 4LYRA 2RJHA 1GQIA 3N9SA 2E6YA 5JH1A 3QOMA 2GUBA 2Z4GA 1EFZA 1L0PA 4WY0B 1S2TA 3VE7A 1P0KA 1X1ZA 3GH5A 3MMUA 3ITCA 3RU6A 4S3AA 3VX0A 2FVLA 2PDIA 2DZXA 4IFRA 4IOTA 4WOQA 2Y7EA 4KEUA 2WJFA 4EE9A 1QPRA 2VX5A 2BOEX 2Z00A 1E1CA 1LTDA 2RGMA 1WAUA 4R88A 3EA1A 3G5EA 4E4PA 5T91A 3MKKA 5TF0A 3ALGA 3SRHA 1KLZA 3CC1A 1W5OA 3DIPA 5EMJA 3E49A 3W00A 3W7KA 1G4SA 3MJYA 4IPLA 3TNOA 2WXDM 3ONCA 4PRWA 4PZVA 1KGUA 2PSNA 1NSJA 4XKYA 1QRQA 1Q7ZA 1JYNA 3B03A 4Z1AA 2YCLB 2WMIA 4BKNA 1V93A 1PYFA 3S1UA 4PTWA 3RM8A 4RE4A 5F1VA 1CXIA 3II1A 5CLWA 3TCSA 4A29A 2YBTA 1QAPA 3B0PA 1FKXA 4HPNA 3T4WA 1DEDA 5EL1A 2YZ5A 4IXHA 4EF9A 2R82A 2F2HA 4AZGA 3ATZA 1U22A 3P61A 3CYVA 1RQBA 3VCRA 2VRKA 4GI9A 3LXAA 5IHSA 4Q4PA 3QC0A 3W1PA 5LSMA 2V67A 3B40A 4UTWA 1NELA 4I90A 4JS3A 3GR8A 4WOZA 2Z6JA 3DFSA 3O07A 4HSHA 3SW6A 4GJIA 3UPWA 5C8BB 3CPRA 3R58A 3AWNA 1LQ0A 2I14A 3L4VA 2J7CA 1YDYA 5LNSA 1TA3B 4PUDA 4MJ4A 1VPQA 4H2CA 5GJPA 3IARA 3GD6A 4HA0A 3C52A 1T8QA 3PZVA 8A3HA 3BW2A 3L9CA 3FYPA 4UWMA 5A6BA 1R86A 2DPEA 2VT0A 3HU7A 1HKIA 2VZOA 3GG8A 3VZXA 3BSGA 3WQPA 2Y2WA 3OA5A 2P0OA 1EUAA 3T0CA 3F4CA 3FHAA 1BHGA 4O28A 5HATA 3VKDA 2V68A 1OB0A 4W4QA 3VNZA 5CC5A 2DIJA 3MDWA 1ISWA 2QPXA 1LQ2A 4MNMA 3H22A 3KZPA 1X39A 3QHNA 1QW7A 2EJ1A 1KV5A 2E68A 2FLIA 4X60A 2OWWA 4WEVX 3PZQA 4ZQOA 1XGDA 3E2QA 1BWKA 2BGSA 3CB8A 4JTDA 4AIBA 3KOXA 3RDKA 1IEXA 3WUFA 1NP0A 2FDSA 2FPYA 4R9OA 4AHOA 5I03A 3TV8A 4BEQA 4WY0A 4AWUA 1EIXA 1K3UA 4JDBA 2X1TA 2HVOA 1E6QM 3QSRA 3E6EA 3JU2A 4DBWA 3ZOAA 1UD3A 2XZ7A 1S5MA 3TYCA 4AXNA 1BFNA 4GUHA 4MPKA 1UMLA 3JRKA 2FB2A 3LTYA 5FL0A 3BZGA 4AEOA 4QM1A 1GZ1A 3S83A 1KV8A 4DM2A 1UW9A 3GXMA 3WH7A 3VABA 3T0AA 1RY8A 1EOKA 3D5HA 3OZPA 2CXEA 1MXSA 3SURA 3UZYA 2OGYA 2PGEA 3UJSA 5IBXC 2A3CA 2J7BA 4PMXA 3QR0A 2YCLA 3H4GA 1DIEA 3W2LA 3PJXA 1FWDC 3CWHA 3GVWA 4WKFA 3Q45A 4UFLA 4IICA 4QDWA 4NI8A 4OV9A 1J01A 4M19A 3BAYA 3KP1A 1DORA 1W3IA 2ZE0A 1PZ1A 3BVJA 4LUTB 3MWCA 1XYFA 3GRIA 4YCPA 2VR5A 3WG6A 3BSMA 3NJ3A 2QCMA 4XB3A 1S46A 3MQTA 1XR2A 4AZBA 4ZGYA 5C9UA 1OGGA 4MB4A 1HIZA 4Y90A 4RW5A 4LS1A 4JKKA 3A13A 1HX0A 1D7KA 3R7MA 2C6QA 2WHJA 3W7JA 3C0JA 3U0HA 5C7HA 4G5DA 2IQTA 1OIMA 2GGIA 5DX7A 2NWRA 3KWSA 2XDFA 3VCNA 4PGLA 3BMWA 1M41A 4H01A 1B0IA 3URAA 1BWLA 5CXPA 1HP4A 2GZXA 4OGZA 4PC8A 3MV01 4NZ4A 3UCQA 4Z08A 2WM0A 1VRXA 4EOUA 1J79A 1J0JA 2VC6A 1RD6A 3BK0A 1MRQA 4U5KA 1EXPA 4GBUA 2ZBTA 1FWSA 4DUXA 2WV8A 3WNOA 3RMJA 4PSRA 2GVLA 1LBFA 2OMAA 3LPOA 1W56A 5A2CA 1GQLA 7TIMA 4A8RA 3N13A 1MNZA 1X97A 4AB4A 2D0HA 2EBNA 4WK9A 2VR2A 4ICMA 1NTHA 4JYDA 1UWTA 3GTHA 1Z7AA 1TPFA 3BH4A 4H7CA 1JFXA 3WLTA 5CZ0A 2VRQA 2WQPA 5HUPA 1F6YA 1FDZA 1U33A 1VCGA 4GQQA 3B0YA 1E70M 2PZNA 1SMDA 1Q66A 2PC4A 3IUHA 3BW4A 5C55A 1JUEA 1V3MA 4UQAA 3MVIA 1SR9A 1WOBA 2QCDB 2ZRWA 4JIQA 5E6ZA 1JCTA 3K8LA 1AL7A 3SQMA 3W83A 2TMDA 3FSUA 3RX3A 1OADA 3H7VA 3M5ZA 2CBVA 4W85A 3P3BA 1PX3A 1KM1A 3GAKA 4U33A 2GGGA 4QXIA 2ZA2A 4HPXA 3RITA 2PP1A 3BO9A 1VGAA 3S47A 1HZYA 4RNJA 1MVYA 2V5KA 1UROA 4DY1A 4Y7EA 1RLDA 1EKOA 5AHFA 2V2CA 3M43A 5EBUA 4RE0A 1SYTA 1ZBKA 2WJDA 2P53A 5CEWA 1ZJIA 1HGWA 3NO1A 5G4HC 2PTZA 5D30A 2VTFA 4CU8A 3BOXA 5C71A 3ECQA 3QZ6A 4LVAA 3MP3A 5F2MA 2PCQA 1W91A 4UTIA 1XLDA 1PVNA 1HQTA 1D8CA 2HK1A 4ONVA 3VDAA 4CVWA 3U48A 3VNMA 4DBSA 2YXXA 1P6CA 4IQEA 1EHNA 2CLHA 3L65A 4RZ5A 3LBCA 1RCQA 3BCJA 3RU8X 3QGAC 1R38A 3EWZA 1W3TA 4GUFA 1IR1A 1XD0A 2PU1A 1GQJA 1H49A 2D3LA 4HYVA 1VBHA 2UY3A 4IPJA 4M80A 3MU7A 4XKMA 3DFQA 3U3HA 2WVTA 1M6JA 1OFPA 4TIMA 1Z69A 4XV0A 3B97A 3E96A 3NTYA 4HU4A 3V35A 3WQ5A 2J24A 5GJNA 4NAFB 1V5XA 4W7UA 2O7SA 4QEHA 3PTDA 5AHIA 4B5NA 3PG8A 4IMFA 4UR9A 2CERA 5MHBA 4PFMA 4JHMA 4PULA 1F61A 2ZRUA 3B8SA 3W1MA 1VJZA 3DG7A 1OFQA 3MJMA 1XLMA 2VNCA 2EHHA 1BYDA 3EOUA 5HAOA 2E67A 4AZ6A 4MAVA 1L9WA 3HGSA 4HIBA 1ZBVA 2EO7A 3VOFA 3PM6A 4L65A 4AF0B 4Q8UA 3OTRA 5MKGA 1U30A 3LI1A 3GFXA 1RK5A 3ALFA 1ONRA 2D20A 2ZXDA 3CWNA 4FNSA 3ZMRA 3SRKA 4DO6A 4YIWA 3KM8A 5LYRA 2WANA 4AVFA 4MZ8A 2JFEX 2GJPA 2D3NA 4C6PA 4BFAA 2NSXA 3AUOA 1R3SA 1LLWA 3PWGA 3MMWA 1GZJA 4Q8NA 4S3CA 3LRLA 4M82A 3UY7A 3CASA 3JZEA 5HK4A 4DPQA 1YRRA 2QCDA 2W92A 3AIEA 2JGYA 3CJPA 3GW3A 4HA1A 1A5OC 2CBIA 5FAGA 2XISA 4M7TA 4L4OA 1QBAA 3LPPA 3B0VC 4FNUA 2QF7A 1RA0A 1NQ6A 4NU7A 4Q8OA 3WD4A 1KXVA 4PTDA 2V63A 3M9YA 2E5CA 3TWBA 1J5SA 5FJOA 4PCNA 1QCWA 3TU9A 3NL6A 3VOJA 3N9RA 3S9IA 1N8FA 3KRBA 3F2DA 4GOAA 3VX1A 3RIKA 4R34A 3EXSA 2Q6ZA 1C93A 4PMJA 1RJPA 2G50A 1JD9A 2XWEA 4XBKA 4HZMA 2VZTA 4GQ0A 2WNZA 4DNHA 4G7EB 2GWGA 5HPCA 4AIUA 5HQLA 1WXJA 3BJTA 3FVMA 3G1VA 4O8RA 4Z1DA 3O6DA 4PEEA 4YTQA 4LRSA 3ID7A 2QT3A 3F5JA 1ZBWA 2ISSA 4J7RA 1DVJA 1JCYA 2ABAA 1WV2A 4F0LA 1FFRA 4L7ZA 4RZBA 3W7HA 4EXAA 5D38A 3N9KA 3T6CA 2VZSA 3MBFA 3MUIA 3MZ2A 2HXTA 2ACRA 4QROA 4I7UA 1ITQA 4UB9A 4Y8FA 1W1TA 4WDUA 1QR7A 3MSYA 1K4HA 3TQKA 4HZ7A 1XXXA 3W38A 4IL2A 3EMQA 4N4PA 3UWWA 4F0KA 4H9VA 1EGZA 1WDWA 3PZTA 2IPGA 2ZUSA 2QJHA 3I3EA 3I6RA 1OC6A 2XFYA 3VNKA 3TROA 3VNIA 1M7OA 2PDXA 1HP5A 3R11A 3ZSTA 2DUAA 3VIGA 3MY9A 1YW1A 3A22A 3PNZA 1EYEA 2HQAA 4WCJA 1RBAA 2H3DA 4AZCA 3AXHA 2WLYA 1H7RA 5A6JA 2YZRA 4GVGA 4GZ7A 1OIFA 2X30A 4B5XA 3MSGA 4CD6A 5AYXA 3LQGA 1SMAA 1TRIA 1DJXA 1ZCCA 2VHLA 3W73A 1C9WA 3N4EA 2G5WA 3N4FA 3AZSA 1TIWA 3KBWA 2Q8LA 5CQ1A 4LUJA 1NWRA 5DRIA 1YNYA 1KWGA 2CFFA 3NL3A 1S2VA 4J35A 1FH9A 2WWCA 4TMBA 1WBHA 1EP2A 4K8HA 3UCDA 1Z9AA 2VGGA 5DY3A 1J4EA 1WAWA 1F5ZA 4HNUA 4KF1A 5FACA 1C91A 2GJNA 4MADA 1EQPA 3ERPA 2OEMA 3NAVA 4ZO9A 3T0BA 2QVNA 1GOXA 3MYOA 2QJGA 1RY0A 4AD0A 1TTJA 4CNNA 1S3HA 5G4WA 4KRUA 1NY1A 3TR9A 4PB5A 2CLMA 4NNAA 3SCOA 3N2TA 4HKPA 4K37A 5D02A 4RR4A 1CPUA 3UERA 3B9EA 2WCSA 3IJQA 3BDKA 3SDOA 1QOPA 4JIIX 2IXUA 2VI0A 4EX4A 2VRJA 2C71A 2QCFA 3ZLFA 4FP1A 3ARQA 4UBPC 1VIWA 3CL6A 5I78A 2DIEA 4L1GA 3TTYA 1W3KA 1O1ZA 1AVAA 2QDEA 1XWYA 4TU1A 1JXJA 1HJWA 1DJGA 4UOZA 2CITA 3DENA 3SI9A 2SFPA 1SJAA 3LCIA 1HUVA 3AQUA 1IYXA 4EXQA 3KL5A 1TR1A 2AMGA 1OCBA 3B8IA 1YTEA 3GKFA 3AZRA 2E8YA 2ZX9A 5CPQA 3EYPA 4OTKA 2DT0A 3MC5A 1F8IA 3G6MA 2DVTA 3LEPA 1OFEA 4FNQA 2ZA3A 1B3OA 2XVGA 4JL1A 1G9HA 1TX0A 2QXWA 3WQWA 1KFLA 4DJFD 4HQVA 5HR6A 4HNCA 2XIIA 3QZEA 4WDTA 8CGTA 1GEHA 4UTFA 4GCXA 3MI3A 1WXZA 2WB5A 3E02A 3RYSA 3WBAA 1SGJA 3L12A 4REQA 3B4UA 1FP8A 3CZKA 4DAFA 1YX1A 2X1UA 1F4AA 2Y4SA 3NDOA 4K3ZA 2DT2A 2BY1A 2GGJA 3QR1A 4RDWA 1WUEA 1A49A 4NSBA 4LAMA 1SFJA 2R1MA 3VOGA 4JN8A 3TEVA 3M1ZA 2HNEA 4FXSA 3UR5A 1UR2A 3P0WA 1E6SM 4ICNA 5EMUA 3RAOA 3RXZA 4ILSA 1EJ7L 2HDJA 1DHKA 1LZOA 4FF5A 2GQ9A 4HPJA 4EWND 3NO3A 4ECLA 5D8WA 3AISA 4HBKA 5A6SA 5GNZA 4JTKA 3G6LA 3HG2A 1G4EA 2YB4A 2XN0A 1VFLA 3UA3A 1W1B1 5AKQA 2DZVA 2BODX 3G24A 4I6VA 5H8PA 3RR1A 2WM1A 2Z1KA 4IXXA 3HMCA 3OGVA 2FYMA 3VFLA 3AYTA 4Q32A 4H1ZA 4XZLX 1EOMA 2C79A 3VILA 1C92A 2BOGX 1U5JA 1JYWA 2CKSA 1JAEA 1CLKA 4CCEA 3W7NA 2B7OA 1DIOA 3R2GA 3CPUA 4W7VA 3UJ2A 2Z1BA 4R7WA 4Q7BA 4QJ4B 1F7BA 3MCMA 2LLEA 4UTMA 3K4DA 1LQAA 2CPUA 4IJRA 1J12A 5BOEA 3OLIA 3AXKA 2PDFA 4AHPA 3O6AA 3NZQA 3LM3A 1J9YA 1YIXA 1EB3A 5ABGA 2ICSA 2OOFA 1KA9F 4UCFA 4C5ZA 1JDCA 4D72A 1XP3A 1RPXA 3CO4A 3CLWA 3GU2A 1M01A 3QLLA 1J2BA 4H8NA 1XC4A 4O1EA 2ALDA 3HFYA 2BHYA 4E0CA 3QM3A 4LS2A 1LRNA 5D9MA 2C14A 1LBLA 2WSYA 2D24A 4LJ3A 3KAOA 4LX4A 3EAUA 1Y8BA 5BWAA 1YDNA 4KPLA 4HT3A 1QHZA 2P8CA 4HN8A 1U1JA 2F38A 1YKWA 4QQ3A 3L5LA 3PAJA 1V3JA 4IMEA 4XWUA 2GVJA 3EPMA 4JY8A 3GHSA 1KBIA 1K03A 1Q6DA 4FX8A 4CNOA 3REQA 4AD4A 1UUQA 1A3HA 3VUPA 4FR6A 1SO3A 2I57A 3GNNA 3R0KA 2OR2A 2IUZA 4QJ5B 3FYYA 2Z28A 3PFRA 2Q8ZA 5BMWA 2OO6A 1RBLA 4HMCA 2GQ3A 4FO4A 7ENLA 2HWGA 2OKTA 1F3WA 4HU8A 1NDYA 1E6XM 2CIPA 2I5QA 1Z89A 4YXGA 4JX6A 4GABA 4CN4A 3EDDA 4HA4A 1QHOA 3C2YA 3W1LA 1GHRA 1L8NA 2PS2A 1VEPA 2X42A 1F76A 3AYSA 2PE4A 4PMDA 3CUJA 3NZ1A 2WNNA 4XAGA 3VVGA 3EDJA 4LAKA 4XTIA 4PSPA 2OQYA 4R7JA 1KRCC 3I3BA 2IMRA 3KW3A 3QBUA 4TV5A 3BG9A 1DJWA 2PDQA 3U7BA 4LFYA 4RV8A 2PD5A 5XINA 1YBQA 1UH3A 4LOCA 1YXDA 3A5FA 3E2SA 4RDYA 2OLSA 4GIRA 4CD5A 4LC8A 3LM7A 4Q3MA 2D2JA 3W82A 4C1NA 3FJLA 3RFAA 1I2PA 3NPUA 3TN4A 1FRBA 1IEIA 4B3LA 4NIRA 3GC2A 5JBEA 4OU1A 3PPFA 1XHGA 1QPQA 1WZMA 3EOOA 1UOZA 3HGRA 3GDLA 3IRDA 4AY1A 3FW6A 4UOQA 1PTGA 3UYIA 1QDSA 2NX3A 3W71A 1C3FA 1UWRA 3BTNA 4HYRA 2HZGA 3WLNA 4DYJA 1KXQA 5KTLA 4PUJA 1KB3A 4IT1A 1R2SA 4DYEA 2PD9A 2HMCA 4GPNA 3IIPA 4HA3A 4DJDD 4QCEA 4PCPA 3E2RA 3EXRA 3E2VA 2FZ8A 3HGOA 1NQKA 4PFHA 3CZ8A 1TVLA 3PBUA 2DZSA 1AMKA 3AIQA 2DW6A 1GT8A 1ADDA 4HN4A 3R89A 5AHMA 4V2XA 2F9RA 4Z1CA 1RPKA 1R3WA 3N34A 3PTKA 1MUCA 3WQFA 2D2GA 2H6RA 3WLQA 4M29A 3NR0A 3CK5A 5GVJA 4EIVA 3WLJA 1V6UA 3DFHA 2BXVA 4QAIA 4JIHA 1ZAHA 1WDSA 3ZT5A 3R8HA 4XIMA 1VYRA 1TVPA 3WD3A 3FJ4A 2BNJA 2FVMA 4WXZA 3A4XA 4AEFA 2VFDA 4LF1A 1TG7A 3P6LA 3GHUA 1LG1A 6TAAA 1GG1A 3EX3A 3I65A 4FLRA 5I5RA 3B06A 3T44A 1JFHA 1PKMA 4D8ZA 1DWAM 2ODOA 4XISA 1CBGA 2X1IA 2DY3A 2VEMA 1N82A 3NPWA 1UA7A 3D47A 3KLKA 4C7DA 3RJXA 2HEJA 2OPJA 1QATA 4L1XA 3S4TA 1TFVA 4KCUA 4LUSB 1XQLA 4AFYA 3GIYA 3GIPA 3H2MA 1X6LA 3CS2A 4F0RA 4HMDA 5HULA 4CQBA 2GOKA 4G1KA 5I77A 2YCEA 3WDHA 4DRSA 4AIOA 5G1MA 1ZUAX 4G8TA 3ZQ9A 2OXNA 3S2NA 4UMBA 1TQJA 5I3DA 4ZOBA 1W3HA 4MAZA 3PFMA 4XAYA 3WF1A 5DCBA 2IPWA 3A9IA 3PY2A 4PMZA 5DBTA 1MW1A 2WVVB 1FCUA 3W01A 4R33A 1O95A 4JTHA 4F9DA 1CXEA 5F2LA 4QP0A 1U2YA 3AJXA 4CCCA 4GZIA 4HZ8A 2A79A 5FSEC 4KS0A 4J3UA 3ARZA 3L23A 4HOXA 2OSXA 3GG1A 5HMDA 3PNUA 3NURA 3H23A 1DJQA 3EWYA 1IXQA 3CV1A 3U4FA 4MWAB 4YVPA 3F5KA 4Q4MA 1A4MA 4MVAA 4GNKB 4DF1A 3CQHA 3A4AA 1PZ3A 4ZOCA 9XIMA 1TJPA 4ZO7A 4YU1A 4UQDA 4QBXA 3KBNA 3VD7A 4DZHA 1UR8A 1TV5A 2VXNA 3PZNA 2A21A 5HUOA 2PGFA 3TFXA 4M7SA 1PCKA 5I00A 3SM0A 3VIKA 2E9LA 1D3GA 1F6PA 3BAKA 4S3KA 2VFIA 2HCVA 5LNRA 5AOUA 4AMAA 1FH7A 1YADA 1EDGA 1WZKA 2YCIX 4GNVA 3KBMA 3U2EA 3BZJA 1H62A 4DZ5A 5CG7A 3L4UA 2Z27A 1UOKA 3K46A 2Z6IA 3LUTA 5A2AA 2XUCA 1Y0EA 2HROA 1LYXA 4DWSD 2J8FA 3GG0A 2O7QA 4ZL1A 1UH2A 1JF5A 3I3DA 3DKJA 4L9XA 4UNIA 4H8VA 4UC5A 3CUIA 5DMNA 4MJ2A 4C60A 1W8SA 1RCOB 1JD7A 3EEGA 1ZPTA 2AQOA 3V0SA 4PMVA 4Q22A 2VURA 3COTA 5FEXA 4UTHA 1E6PA 3CIXA 4D6GA 1NFPA 4NKCA 2YL8A 1E56A 2WWDA 2VYOA 2Q02A 4LY8A 1GW9A 2BWGA 2XTKA 3L0KA 2E4TA 3NCOA 3VK5A 3BAJA 5HR7A 1QFEA 4XZMX 4PB3A 3QC3A 1HO1A 1QI0A 5E9XA 2ZDSA 3QY7A 4FA3A 1GK8A 1LP6A 4QAWA 3WDPP 3BURA 2O0TA 3IJ8A 3UXDA 1X1NA 1OFRA 1F73A 2QCHA 1VHNA 3ANUA 3UXKA 4UTJA 1AJ2A 3BAXA 3ARWA 2QMKA 1JJKA 2ZX8A 3W72A 3Q65A 4GH1A 1UKQA 3W7OA 3OHIA 2H3BA 1XYAA 3UA4A 3POCA 3ITOA 1JVNA 1K9DA 2J75A 1AQFA 3BJSA 5GJMA 2G3MA 3UJEA 2Y8VA 2Q71A 2NZLA 3AO0A 1SO5A 4IM4A 1J96A 3VO0A 3BPWA 3TZFA 3SCQA 4UQ9A 1JZ8A 2FZMA 3CZEA 3KTCA 4Q8TA 2PAJA 4S1FA 1A5MC 3WFLA 3DGRA 1L2UA 3AC0A 4DI9A 1PPIA 5F1UA 2OZ3A 4QRNA 3KOFA 3PG9A 4Z2IA 3K1GA 5A6MA 2XIMA 4JCLA 3VIJA 2AGTA 3FLUA 3OG2A 4OE7A 2J27A 4GIYA 1T6MA 1JGIA 1A80A 4LPCA 3N11A 1KM6A 4PUEA 3URBA 1Q4NX 1SW3A 4A8IA 1TV4A 4JOMA 3FXYA 3ORWA 4GRSA 2PMQA 4ZSUA 1PTDA 3AOFA 4I9AA 3O15A 4YL2A 2W5FA 3SQSA 5HOSA 4GBDA 4JYFA 3EPOA 4QISA 2E40A 3APGA 2C19A 2C18A 1TZ7A 2HBXA 3AMGA 2YYUA 2E6AA 3ITXA 4WKAA 3H2FA 3OLDA 1W9PA 3FY1A 2WC3A 3WK2A 2ATSA 4PBEA 4MY9A 4ACYA 4D6DA 2DH2A 2WNQA 2J4GA 1TELA 2E5BA 2VFGA 5I06A 3AXIA 4H9XA 3VDCA 2BY3A 4FNPA 1OWQA 4NZCA 3APTA 3QGKC 3O0FA 4FALA 3W22A 2XVKA 2EJAA 4LNYA 3IVUA 1N8WA 2R8WA 4QE1A 3UYCA 6CGTA 5CSYA 3VKBA 4NX0A 1QI4A 1SSGA 1SR0A 4KMQA 1TWSA 4RLIA 2DP3A 3W29A 1UD2A 4B3ZA 1B3WA 1OEPA 4H83A 4KFOA 1KLYA 1DWGM 1XIMA 5BWFA 2Z1WA 3B9OA 4JQAA 2CHRA 3P5YA 3KX6A 3E3HA 1WX0A 4OBRA 4DJED 3QR3A 4RXGA 4ES4A 4X9YA 4S3GA 1O7AA 2VCCA 2Z1XA 2G3IA 3LHVA 3VGBA 4MKVA 3UEQA 3DUGA 4X0NA 3V5FA 4NILA 2ZUMA 1E72M 5CPNA 4H6QA 2NW0A 4B4HA 4UTWC 3CTTA 4IIEA 5U4NA 3QYSA 5BMXA 4PE8A 3W3OA 4JTEA 3V16A 2E9BA 4PRRA 2VVNA 3A5VA 4JEJA 1MZRA 3K13A 1EGVA 3S42A 1NU5A 2PDKA 4XK2A 3IAQA 1WO2A 1CECA 5CCZA 1A53A 3WNLA 3L7RA 4MSSA 3NIYA 4J5NA 1IR2A 3T9PA 1X7FA 1A3XA 4BEUA 4O13A 2PLKA 3VIIA 2WQDA 4JTFA 4I5XA 2ACSA 2JEQA 5A8PA 3W6MA 5REQB 1KR0A 1VQTA 3TE9A 3CMGA 3ATYA 2FGZA 1HJVA 3RPMA 2UY5A 2CU0A 1VZWA 1XW8A 4HSNA 4D1JA 1B4EA 1E3XA 1C7SA 5FF7A 1Z44A 5K4XA 3OBAA 2R9RA 2DSKA 5TD4A 2BDQA 2PDLA 5D33A 3J7HA 1OM0A 3UG5A 3VD5A 3RG6A 2BSLA 2O55A 1YTKA 3M0LA 3GDMA 2XSXA 3M0ZA 3LD5A 5HINA 1KTNA 4R7OA 1G1YA 3N2BA 3BGGA 1VF8A 1UD6A 4N6EA 3R79A 2NQJA 5EB8A 1VJIA 3T8QA 2D69A 3B8DA 4C6QA 1P0BA 1ADSA 3T42A 3LGGA 4UFJA 1OK4A 4B4FA 1H51A 2UWFA 1SUXA 4JQ2A 2PF8A 5JXQA 4ORMA 4PR4A 2R91A 3A47A 2V0TA 4N6FA 2QGYA 1DJNA 2J47A 3ARUA 2P3ZA 1VYSX 4BR1A 4EPDC 4RNHA 1AL8A 3F4DA 4F2UA 1K9EA 1MQPA 3IIZA 4BS0A 4IGMA 3GQYA 3UGRA 3LHZA 1SSDA 2OQLA 5AVNA 1LORA 5EBAA 2VCAA 5BOOA 3I7RA 3B3DA 1H1YA 4PYSA 4OWGA 3U2CA 1FHDA 4M6QA 2C15A 3M6YA 1KO0A 3W1UA 5FI8A 2ZXBA 4CQ9A 4B5UA 1NFBA 3NXLA 1QASA 3T2OA 3PZ9A 1OX6A 1KWKA 1M65A 1KTBA 3CT2A 4BI6A 2WVUA 5KMYA 3PBVA 5ABFB 2VEPA 1EBGA 3FEQA 1NAL1 4M0XA 4WJ8A 2QJJA 1PL9A 3ARPA 3TAKA 2CBUA 3KUMA 1DBTA 4B90A 3IIVA 1EO5A 1KKOA 4RXFA 1J93A 3GNXA 3LOTA 1KD0A 1BEUA 1CGXA 1CLXA 4L6HA 1H61A 1XPGA 1DYSA 1V6YA 3AS2A 5DANA 2E5DA 2WCAA 1SZNA 4KCTA 4LT9A 1DXEA 5DO8A 5GQBA 1CIUA 2QV5A 2J9ZA 4ATLA 2BBFA 3NZRA 2B81A 3MP4A 5F7UA 3TJXA 1O60A 1H60A 5DBUA 1GVIA 4O57A 2V9DA 3FGCB 4QTGA 4ATWA 3G1SA 1CB2A 1Y5VA 1IGSA 1V3LA 3DU0A 1DXFA 1AQ0A 3PSVA 4GIAA 3LTPA 1VEMA 1W3LA 4URIA 4LAZA 1QBBA 1PO9A 1EEXA 3BAIA 2A0NA 1VBRA 3P82A 2DT3A 4JD4A 3GFYA 2BXYA 3TWAA 2E6FA 1K7XA 1PKLA 5FSDC 2F6XA 3H2NA 4NZ1A 2XH4A 3KCLA 2PDGA 2DQWA 3R10A 2AAMA 5AYBA 3STCA 2PWVA 3L5MA 1KBJA 1D8WA 2I9UA 4NJHA 4FNTA 4TTUA 4HK7A 3NEVA 1P7TB 5REQA 5MF5A 4MDOA 3D46A 2YW4A 3NM3A 5A8MA 2W63A 1F3XA 3HOJA 4O4WA 3ABXA 1SZFA 3M0IA 1YDOA 5H6HA 4OOUA 3SY5A 2A3AA 3QPEA 1T0OA 4IWWA 3RPDA 1XCFA 1MQQA 3M46A 2J77A 1ZAJA 1DTNA 1SQ7A 2ZRYA 4DF2A 4Y9AA 1RVKA 4S3JA 4C7GA 4I8YA 5J04A 2WBGA 2OG9A 1K8YA 4A6GA 2RH9A 3BICA 3TSBA 4EWJA 4GYJA 1Y5WA 1I1WA 1G67A 1R47A 1J5TA 2RDUA 1CW2A 1JUBA 3SR7A 2BB0A 5E0FA 3VA8A 4H6RA 1BKSA 3LCHA 3EKLA 2OGJA 3JR2A 2XN1A 2Q09A 3IEBA 4G7FA 1NP2A 4I7VA 3VDHA 1W5MA 4FLSA 4J3SA 1TX2A 2OZTA 1A0EA 5EMLA 3TOPA 4HHHA 1E71M 2ZDRA 2MANA 1KCXA 3NQ2A 4N2YA 4I5UA 3S5OA 2GGEA 1RP9A 4BHYA 1GYNA 1UCWA 4CNSA 2UZ9A 1DWFM 1FWTA 1FH8A 5BXPA 2PDHA 1UKTA 3ZO9A 1RD5A 1UP2A 4W5ZA 8XIMA 2F84A 3I68A 1VIZA 3SY8A 1V77A 3WBXA 1NF7A 4IMCA 4TTGA 5ABFA 3GS6A 1W1A1 2EG7A 4WZHA 2OU4A 2EEXA 2P1FA 4QNWA 2PU0A 1JDEA 1JPIA 3KRUA 3T8LA 1GVFA 1H5VA 1DIDA 1QT1A 2AL1A 1AG1O 3LI0A 3HV8A 3EOLA 3MVTA 3TYZA 2YOCA 4PMNA 3NA8A 3ZJ6A 3ZIZA 1KRMA 4LS0A 4RPPA 4BQ4A 3LCWA 3VOCA 2JQXA 2JEPA 3H2EA 3MCNA 3GC4A 1KGXA 3WFZA 2HPMA 2WNWA 5A5WA 5E9AA 4BK9A 1E6NA 1ICSA 2YFNA 5I24A 3CAWA 4IQJA 5HJYA 1WZAA 4LUIA 3HPXA 5AHEA 3VYLA 2ZUUA 1OSEA 2QCGA 3O7UA 4D2JA 4WSJA 4DNMA 4WJXA 5DRCA 2OJPA 4H00A 4J3VA 2QULA 4TR9A 3EX4A 3TONA 1AH3A 4H19A 1XIEA 4MZYA 1ME8A 4LUYA 2Y0FA 4UCGA 4LRTA 3FS2A 2X7VA 3LENA 4ZA0A 3M5XA 2GK1B 3C0SA 1WOAA 3DEQA 2EPHA 3PUDA 1LT8A 1VD6A 2ZX6A 1P7TA 4HJWA 3W9ZA 4Z42C 3LNMA 2VX6A 4K6AA 1JCNA 2ZADA 4F3HA 4YYFA 1P0EA 3R13A 2EF9A 3AIRA 4KRZA 2V3FA 2DSUA 3W7LA 2YIHA 2VDHA 3S2LA 4U28A 3OQEA 3QQWA 3TSDA 4H7VA 2DSVA 2YBVA 3KTSA 2YXGA 4MZ1A 4UZUA 1P5BA 3S1XA 1Z41A 2G8ZA 2QYGA 2ZX7A 3SFWA 3PUOA 5EYWA 1LLOA 4HNVA 3SJNA 4DXKA 1GOWA 2OSWA 2Y8KA 1U5VA 3R94A 2BP1A 2C0HA 1UASA 1HL8A 2VC5A 4C6KA 1B57A 1GVSA 3VMNA 2HVNA 1EJSC 3W27A 3V7PA 3W1TA 2J13A 1WDQA 1G6CA 2PDYA 5M17A 2GSJA 4TVUA 1EO7A 2A6LA 4MLJA 5FEPA 3V75A 3LA4A 2CLLA 1GHSA 1JCJA 1CXKA 1FWBC 3GNOA 1OHLA 1TE6A 3OZYA 1TRDA 1OCQA 1UKOA 3RGTA 2Z1SA 4JIEA 1H7WA 1I9CB 3EB4A 3DECA 4ACZB 3NQ7A 2DIKA 1GEQA 4K68A 3GTFA 3W7MA 3TW9A 1SO6A 4NJJA 1OGBA 5IRPA 3HZ3A 3MYPA 2NLYA 5CGMA 3OEXA 4UZSA 3FEMA 3THQA 4KWSA 5JH2A 1X38A 1W1ZA 3CWOX 4RNIA 2ZFAA 4Y9NA 3NDYA 2MUCA 4YN5A 4KRTA 5AHNA 1NDWA 1SU5A 1K70A 2Z1VA 4XAZA 3EOEA 4ZQRA 1WP6A 5E93A 4ZQPA 3FN9A 1ODUA 3UT0A