2ACUA

Tyrosine-48 is the proton donor and histidine-110 directs substrate stereochemical selectivity in the reduction reaction of human aldose reductase: enzyme kinetics and the crystal structure of the y48h mutant enzyme
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVHQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
publication title Tyrosine-48 is the proton donor and histidine-110 directs substrate stereochemical selectivity in the reduction reaction of human aldose reductase: enzyme kinetics and crystal structure of the Y48H mutant enzyme.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1994-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2acuA00
4Q3MA 1MI3A 2PDMA 3C3UA 1S1RA 1IHIA 2DV0A 1T41A 1MRQA 1Z9AA 3UZXA 2R24A 3D3FA 4LB3A 3BUVA 3WBWA 3UZZA 2IQ0A 3N6QA 3UGRA 4JQ4A 2PDQA 2QXWA 1Q5MA 4RPQA 1PWMA 3M64A 2VDGA 2J8TA 1ADSA 3R7MA 4XVDA 3S3GA 4JQAA 4DBWA 3N2TA 4ZFCA 2I17A 4GIEA 4PUWA 1GVEA 3R8GA 1T40A 5HNTA 3WG6A 3ERPA 2IKHA 3EB3A 3BV7A 3M0IA 4WDWA 2IPWA 4JTDA 3T42A 2PD5A 3ONCA 3R43A 1X96A 4WDUA 3UZWA 3Q67A 1XF0A 1PYFA 4WGHA 2FZDA 2PDFA 3LZ3A 3UFYA 4JTAA 3LQGA 3GHTA 2INEA 3UWEA 3BCJA 5AZ1A 3LEPA 4AUBA 5HNUA 1EXBA 1PZ1A 3V0SA 4QR6A 5AZ0A 1JEZA 3CAVA 3MC5A 4JTCA 4JQ1A 3UZYA 1AZ1A 2NVDA 1LWIA 3LQLA 1LQAA 1S1PA 4JIRA 4JIHA 4HBKA 4YS1A 4XVEA 2HDJA 3O0KA 1Z8AA 3CV7A 2PDXA 2P5NA 4LBSA 1XGDA 1MZRA 2PFHA 2FVLA 3RX3A 3LZ5A 4QBXA 2PDLA 4H7CA 2PZNA 2ACUA 1AFSA 4JIIX 3LBOA 4GA8A 5LIWX 2IKIA 1M9HA 3GHSA 5JH2A 1YE4A 4DBUA 4Q7BA 2HVNA 3ONBA 4JQ3A 4JQ2A 4QX4A 4R9OA 2R9RA 2ACSA 1YE6A 3DN5A 1J96A 4GCAA 3DOPA 4WEVX 3CAQA 2F38A 1C9WA 2IKJA 1HQTA 1PZ0A 3B3DA 1OG6A 3RX2A 3LENA 2ALRA 3LD5A 2HEJA 2DUZA 4L1XA 2PDUA 5LIKX 1AH4A 1Q13A 3R58A 2I16A 2IPGA 2ACQA 2PDYA 3UYIA 1VP5A 2C91A 2NVCA 2IPJA 3V36A 4GQ0A 5LIYX 4WRHA 2PDPA 4OTKA 2FGBA 2PDHA 4LAUA 4ASTA 4FALA 2CLPA 1K8CA 2PDNA 1X97A 3MB9A 2PEVA 1X98A 3BURA 2WZTA 4YVPA 4I5XA 5JH1A 2PDGA 1VBJA 2WZMA 3CASA 1RY8A 5KETA 5HA7A 3U2CA 1US0A 1AH3A 1YNQA 1S2AA 4XAPA 3R6IA 4XZMX 3EB4A 2ISFA 4YVXA 4LB4A 3GUGA 5DANA 3FJNA 4PRTA 3O3RA 3WBXA 3WCZA 2AGTA 4QXIA 1S2CA 2PDBA 4WDTA 1ZGDA 1EKOA 1Z3NA 2ACRA 4XZNX 1EL3A 3NTYA 5LIUX 2INZA 4WDXA 3Q65A 4PR4A 4XO7A 3VXGA 2PDWA 2FZBA 3WBYA 3QKZA 5M2FX 2HE8A 4YU1A 3V0TA 1XJBA 3EAUA 3H7UA 1UR3M 2PDKA 2PD9A 3LNMA 4GQGA 3V35A 4FZIA 4LAZA 2FZ9A 4JTRA 2PDIA 3P2VA 2F2KA 5C7HA 2DUXA 1IEIA 3KRBA 1R38A 3GHUA 4GABA 4EXBA 4F40A 2HE5A 4H8NA 4XZHA 2IQDA 4LBRA 1PWLA 1QWKA 2PDJA 3RX4A 2BGSA 1QRQA 4IJCA 5LIXX 4PUUA 1ZUAX 3LUTA 3R8HA 4JTQA 3COTA 3V0UA 3H7RA 1ZSXA 4IGSA 4YVVA 1RALA 4NKCA 4DBSA 2BGQA 2FZ8A 1YNPA 4EXAA 4XK2A 1Z89A 4MHBA 4G5DA 3CMFA 4IJRA 3R94A 2PDCA 3FX4A 4PMJA 4GACA 2PF8A 3GHRA 1ZQ5A 2IPFA 1AH0A 3G5EA 1EF3A 2IKGA 4DZ5A 4FA3A 2A79A 4FAMA 3G1RA 4L1WA 4XZLX 2HVOA 4XZIA 2BP1A 3LN3A 1A80A 1AZ2A 2IS7A 3UP8A 3UG8A 3CV6A 1FRBA 1SM9A 4ICCX 2HV5A 3M4HA 3H4GA 4XO6A 3F7JA 1RY0A 4PRRA 1HW6A 4HMNA
chains in the Genus database with same CATH superfamily
5HATA 3ENLA 2DZSA 3C3UA 3PG9A 3GH7A 4O1BA 4BF9A 4RXFA 1RBOB 2WJZA 2ZXQA 4O0KA 3E6EA 2YXOA 2WKGA 3CU2A 2I7GA 1QOXA 4WGXA 3OQEA 2FVKA 3MJYA 4O1DA 4IPPA 1P5BA 1JG9A 3NGFA 3NQMA 1SR9A 1Q5MA 1KBBA 4LW7A 4C6EA 2E5BA 5K4XA 1SFTA 2GWNA 3QTPA 3SGUA 1OBAA 1KLZA 5GNYA 4AZCB 1RPXA 1F74A 2PS2A 3NZPA 4PMUA 2REQA 2PP3A 1CTNA 3UWUA 3GG8A 3M7SA 4DRSA 3DFHA 3PULA 4XIMA 1Z44A 4C6MA 3R2GA 4OBTA 3DFYA 4D6HA 1IZJA 4WDUA 3UJRA 3KOXA 4PBFA 2EKGA 3KEHA 4HNVA 1G9HA 3OG3A 3GLCA 4O11A 3Q94A 3GHTA 3I4EA 3KE0A 2HK0A 1TELA 2INFA 3NQEA 4Y8EA 3MPGA 4JY9A 2BY1A 1L6WA 3EPNA 2GQ8A 2YR1A 2EO7A 3EKLA 5DBUA 5I0DA 5D32A 3B97A 3W26A 2HTMA 2C8NA 2WMGA 5IM51 4HYVA 4QLKA 4GUFA 4PMQA 5E5CA 2V38A 2W67A 2YB4A 4MM1A 1XLAA 3MMUA 4YS1A 1MEHA 4GUHA 4W9TA 3URBA 8XIMA 4K8HA 1JYNA 2YYUA 1UPPA 1XGDA 2VT0A 3D46A 3M5VA 1WKDA 4QNWA 2ZX6A 5CG0A 1GVFA 4UTHA 1XLJA 3GYCA 3GNOA 2DZPA 7ENLA 1NWTA 4A3RA 2NX1A 3TLLA 2QDGA 4R3UA 3UXDA 1F05A 1KXHA 1FWFC 2Z6IA 3TTYA 1K4GA 4JQ3A 4XD6A 1ELSA 3O6YX 2DVUA 4MJ2A 2W9MA 3B8IA 1KWKA 3PPGA 3CUHA 1CLKA 4EF8A 3DOPA 4HA1A 5M03A 1GOOA 6XIMA 4M8UA 4CD6A 1W1ZA 4LRTA 3M6DA 5HQLA 2VXNA 2QEZA 3UG3A 4N7QA 3VD4A 5M5DA 1ZTVA 5H2ZA 3DZ1A 1DQUA 4FXFA 4TX8A 5A8PA 1SFSA 1ZCCA 2VGGA 4LU0A 3LD5A 2X1UA 4MB3A 1UC5A 1UWTA 2WMHA 3C8FA 2DZTA 1FWNA 1I6NA 4GG9A 4L65A 1CX9A 3VGGA 2Y7DA 2W92A 3E38A 3HQOA 3T81A 3TVAA 1LOLA 4F0SA 1W9DM 4FO4A 1JQVA 5EKYA 2C1HA 2D1ZA 3OZMA 3PBGA 4E0CA 1JUBA 2EPLX 4M3PA 2ZXAA 1FBAA 4W8AA 3ARSA 2WK2A 2FKPA 3O16A 3QTGA 3GG7A 4IMEA 4IMFA 3TWAA 4Y9PA 5CC5A 2QCFA 2QJIA 1YXCA 2YFNA 4GQBA 5BRQA 1H61A 2OTDA 1A0DA 2YZ5A 3M1ZA 3W0KA 5G4EA 4C7GA 4I90A 2DZUA 2WANA 4NZ4A 4WK9A 2C7FA 5I03A 3GX9A 3G0UA 2ISFA 4ES4A 4E2OA 1EO7A 2F6XA 1GOWA 1R3SA 3CWOX 3ABXA 1OABA 2CLKA 3LPPA 2PGFA 2GPTA 4O53A 4FEZA 1W3IA 3PS7A 1EO5A 1K77A 5C55A 2J8FA 4XQ6A 4H9XA 3WCZA 2AGTA 4DYEA 3RRAA 7TIMA 2XVNA 3U5UA 1IIHA 2DU2A 3BAXA 4PFHA 1TCDA 1PX4A 1TRIA 1WKFA 4XTDA 3GG0A 1UOZA 2OGYA 1MFUA 4XZNX 1WKEA 5EPDA 4J1OA 3EXRA 4TVCA 2RKXA 3JR2A 4UZUA 1TX0A 4IFOA 3CV2A 3E2VA 3GFYA 4JTGA 4W5ZA 2VFEA 4UOQA 3IVUA 4H9ZA 1E9LA 1H1NA 1SZRA 2GVJA 1TG7A 1W5OA 5BW6A 1G67A 3BOFA 4OU1A 1M7OA 2GJPA 2QJMA 4J28A 1WOAA 3IJDA 1HGWA 1DXIA 4PTMA 2QKFA 4C90A 5FEPA 1WDPA 4AD3A 1DXEA 1ML1A 4PYSA 4CVWA 3GC5A 5H8PA 5LNVA 1DV7A 2QDDA 4EXBA 4F40A 1O5QA 3O6AA 3VZZA 2PDJA 3VAVA 4MGGA 2PB1A 3HGJA 3ARWA 4GQRA 1F3WA 3CHEA 2ZUNA 2KX9A 2HZGA 4TOQA 2PODA 1W3JA 1QFEA 3E5BA 4YTQA 3GNPA 4MG4A 3INPA 4JHOA 3S1XA 4EXAA 4QISA 2NT0A 4DN1A 3IGUA 5GVJA 2D2HA 4G5DA 5CG7A 2CBUA 1R7OA 1KQYA 1HL2A 1MWOA 5U4NA 4A29A 2CKSA 2WMJA 3VOCA 1E6ZA 2VD8A 1YTEA 1PO9A 2G50A 2E9BA 5FESA 4MWAC 1XFCA 1VPXA 2ZADA 1QNQA 2YCIX 3M5YA 4S2BA 4MY1A 3B03A 1ENUA 1BXCA 4WXZA 1PJ9A 3OQ8A 1YXYA 3GDKA 4N2YA 5CGTA 3UPBA 1ONWA 3CQIA 2C18A 3GQYA 4BF5A 3T09A 3ZR4A 1J8VA 1T0OA 3CV6A 1SM9A 1TE6A 3V3WA 3LTYA 4FNQA 3ZR5A 4GJJA 1R3WA 4Q7IA 1I0DA 1B2YA 4B2DD 3W25A 1GOKA 1VB9A 1WNOA 4DJEC 1OCQA 3FKRA 2ANUA 4Z2HA 1IHIA 3CQ0A 3AZRA 4BI7A 4GIRA 1N55A 3DFTA 3WBWA 1DJHA 3UZZA 4JNZA 5REQA 2I5GA 3VC5A 4PSPA 3VD5A 2DZVA 2QIIA 3IIPA 4RPQA 1MW3A 3TK7A 3WUBA 1CB7B 3IACA 5CC6A 4TIMA 1BSIA 3GSMA 4XVDA 3W85A 2CLMA 2YDRA 2Y5SA 1AQ0A 1ICPA 2XSXA 3U3HA 5L6UA 3GBEA 5HNTA 4N42A 1DHKA 3NDYA 1GYMA 1B3XA 1HN1A 3C61A 1JD7A 3UZWA 4I5RA 4P7LA 1F8MA 3TXZA 1LL4A 4P7RA 4HVXA 1J2BA 4L5ZA 2DQXA 1TR9A 1CXLA 1WO2A 5D2TA 4ZA0A 4DB7A 4I9AA 2QCLA 2J7CA 5JBDA 3W75A 4PTNA 1EXBA 3WEOA 4D6GA 4H01A 3NNTA 5KZEA 4GE8A 4XZBA 4QCFA 5ABFA 5FA5A 3H4WA 3H22A 4RV3A 3KOFA 4YMZA 4E38A 4UFKA 4LS2A 3F1QA 1JNEA 1LG1A 2FFIA 4XB3A 3KTXA 1KR1A 5TNVA 1W9BM 1VPYA 3BG5A 3PBMA 5FJPA 1GW1A 2CLIA 3LXBA 1W1PA 3LCHA 3REQA 5C8BB 3NYDA 4JCMA 1PE1A 1GQKA 3KZPA 2PTWA 1ZHAA 3LZ5A 3H55A 1RZMA 3N04A 1KFEA 2Q3RA 3T4WA 2UY4A 3B04A 3AYSA 3HGRA 1ITUA 1QHZA 2IKIA 3JZUA 3VIFA 4DUVA 2H90A 3B8WA 4NQ1A 3S1VA 1JF6A 4F2TA 2P3EA 3W29A 2CESA 3NGJA 4JNYA 3G1HA 1MZHA 3L4ZA 3SGZA 3WMCA 1E6SM 1E6PA 4UTMA 3PTKA 1XL9A 1LWHA 2RDXA 3CAQA 1C9WA 3AFBA 4KQNA 1FHLA 2CPUA 4WD0A 1SW7A 3MBFA 3VNMA 4NJHA 4W88A 3DFOA 1BWLA 3CB3A 1DYSA 3SUWA 2JKEA 3H24A 3EWZA 3ITGA 3SUVA 2QMJA 4NASA 4LSBA 1CXFA 4WZHA 4IQJA 8RUCA 1LBLA 3WELA 4AVOA 1PDYA 1E0VA 3DERA 4W4QA 1MUWA 4Y7EA 4QJ4B 1HKJA 1M41A 3MUY1 4KWVA 3NQ6A 4NU7A 1ITXA 4ENLA 1PKMA 3F4VA 3GNXA 2JGYA 1J10A 3BSHA 2QVNA 3GWQA 3KS5A 1K8CA 3VM5A 2WO5A 3BURA 3C0QA 2QUUA 3TP4A 5LKYA 4F8XA 3IGSA 2NWRA 5JH1A 5J8LA 1LRNA 2H3DA 1EP3A 1NJJA 3CASA 4MJZA 1D3CA 4WJEA 5HA7A 4FNTA 1KM3A 1EH9A 5CSRA 4C6IA 2HVMA 2PAJA 4I7WA 5BOEA 2B4GA 4I5UA 3TC7A 4ZTXA 3VDBA 1HT6A 4LX4A 1EJVC 1A5CA 2VFIA 2PZ0A 3W7NA 3BLEA 4YL2A 3KVJA 1E3XA 4F2UA 4OE7A 3UNTA 2VZSA 6TIMA 2R82A 4B2DA 4U2ZA 4FR6A 2B81A 1BXNA 4EE9A 4JZ5A 1SO3A 1T5AA 3E0WA 4QRNA 1AD4A 4NAFB 1KLYA 3LI0A 3SJNA 2DT2A 1DWJM 1L6YA 4ZR8A 3L9CA 3LA4A 4ZZ9A 3CNYA 4ACZA 4WDXA 1XLFA 3IS4A 4F79A 4O8AA 3C2EA 2FZBA 3WBYA 3WDJA 4V33A 4QIUA 1FWSA 1GQIA 3EWYA 3B0YA 1TZ9A 2BDQA 1DQWA 5TBOA 2O4QA 3CHDA 3M44A 4MDOA 7REQB 4B92A 3VILA 1KV5A 4K7YA 4F9JA 6REQB 4D6FA 3TYDA 1EFZA 1KR0A 4GVIA 1DKWA 2XGZA 4HPGA 3KBSA 1X6UA 1MUCA 2CU0A 2XWEA 4IJCA 3STCA 3MZ2A 4L4PA 4Y90A 2OLHA 3W2KA 3H6OA 3B8VA 2OEMA 5AKQA 2WHJA 3H7RA 1XP3A 4WSJA 3W7KA 5CXPA 4A6GA 3IARA 4O57A 4BQ3A 1OX5A 3LPFA 3DHPA 1PHWA 2VGIA 2FTPA 2DH3A 3CHVA 4B4FA 1DVJA 5JBFA 2B7QA 3CAKA 4H8HA 3WD0A 1E4MM 2A4AA 3R11A 1HL9A 3PB0A 2I14A 2XIIA 2HBXA 1Y5VA 1NWRA 4KCTA 1BQCA 1UH4A 5MHBA 3IIOA 1HP4A 4EK7A 4U5IA 3G3MA 4KPLA 1UR8A 1FKWA 2QS8A 1JCXA 1JNDA 5JUVA 4JN8A 2GUBA 4KRUA 3W1TA 4DVOA 2WMKA 1KNWA 4G2DA 4L6DA 3G18A 3DBPA 2WYSA 1ODZA 5A6SA 4QAWA 2PTDA 3TN3A 3H4GA 3AROA 4OIFA 4QQUA 2Z2BA 4O1AA 1KBIA 1KFBA 3UERA 3FY1A 4I7UA 5RUBA 3FYYA 4JTJA 3XINA 1OZQA 4AHOA 2Y8VA 1JCMP 1K8YA 1VZWA 5A8MA 1AG1O 1MRQA 1OD8A 4PE8A 1E5JA 4GWEA 5A6BA 3WDQA 3BUVA 4LS1A 2IQ0A 1VLIA 2OT1A 3VPLA 3A3HA 3VKDA 4RJEA 2X1IA 4M56A 1P7TA 1W9UA 2JFEX 3EWBX 2VDGA 4U4MA 3DFSA 1PEZA 5C9XA 3R7MA 4P7OA 3S3GA 3PTMA 3USZA 4P8UA 1KTBA 3GD6A 4AVNA 4X9YA 3GKFA 2CC0A 2WVVA 2WWCA 3FKKA 4JDBA 3W1LA 2ZRYA 1JAEA 1QMLA 3STFA 4WX2A 1TPWA 4BCEA 3SCTA 1MMFA 2FZDA 3TJLA 3LRMA 3EDDA 3ZVHA 3BZJA 1ZBVA 2WJFA 1XPYA 1XW8A 3I3EA 3U6WA 4IUGA 4O13A 3W1AA 3A6OA 4GKLA 4KGJA 5HNUA 2AAMA 1TQXA 3L21A 4I8YA 1PX3A 3SGGA 5FL1A 4US5D 3VM7A 3RIKA 1E9ZB 1AMKA 2DSUA 2ZTKA 4ZQMA 3TMQA 2P1FA 2HPIA 3NQ2A 4XISA 1W1VA 4JIHA 1EA9C 4HBKA 4LH8A 4XD3A 4WOZA 3BICA 3O0KA 4FI4A 4JTHA 5EFFA 4Z0SA 1J0IA 2PDXA 1I45A 4D1JA 4PUJA 1BFNA 2D3LA 1GJUA 1Y5XA 1TWSA 4UR8A 3MV11 1RJPA 3UBPC 1OFPA 3T0TA 5K4ZA 3UG4A 1ZBKA 4H7CA 4INFA 3DFPA 4GH1A 4CQDA 3VCCA 3W7QA 3VNIA 1GG1A 4HPJA 1Q66A 3WN6A 3DFQA 1PUDA 4W89A 3KVKA 3EDEA 3ONBA 4CD7A 3N2CA 1QDSA 5I23A 1RAKA 4PH6A 3UR2A 3QSRA 3EMCA 1C8QA 2G4FA 4TV5A 2PCEA 3JW7A 1BVZA 1ADOA 1I2NA 3PZMA 4RZBA 2X05A 4GCAA 3SZ8A 1ZY9A 2Y5JA 2I5IA 2Z28A 2F38A 2R8WA 2VQUA 4R7WA 4RDYA 1HQTA 1GT8A 3L5LA 3PJTA 3EDFA 3MKVA 2QCMA 1VJZA 4RR4A 5JBEA 2RFGA 2P0OA 3ZT5A 4PMNA 3GR4A 5A6MA 3E0VA 4Q8MA 2MANA 4XV0A 4QFUA 5GNZA 2Y8KA 2CBIA 4FLOA 3NL5A 2Z1BA 1Q13A 4J2PA 4S3AA 5AC7A 2WM0A 2FGZA 1REQB 5AY7A 4QTGA 3UYIA 1GQJA 3EPMA 1UMYA 4QNEA 2J25A 3FLUA 1I0BA 3F4DA 1JPMA 1PTAA 3L4XA 3B4YA 1GVRA 3PPCA 4PODA 3M0YA 1DQXA 4IP5A 2GL5A 3E96A 3MQTA 2A3AA 3AU6A 2BXYA 4FNPA 4O1FA 1TV7A 3W07A 2POZA 2X0HA 4TQTA 3WUGA 3C0LA 5KETA 1DJYA 2YKKA 3H2MA 4GGBA 2OXNA 3K13A 1A47A 3HG5A 1WPCA 3LLFA 4UTLA 4UQDA 3TU9A 1SGJA 5FL0A 2VUYA 5IHRA 2G96A 2VDIA 4X22A 5EMLA 2CWNA 5BU9A 4E8CA 4PRTA 1FCVA 4IIBA 3N4EA 3PN8A 3BH4A 1OHLA 1UA3A 3BGAA 3M0MA 2XH2A 5AHLA 1ESWA 3NUKA 3USBA 2ZUMA 1LQ0A 1ZLPA 5C9ZA 4KCVA 1OGBA 4YTSA 3WLLA 4S38A 1XIBA 4LC8A 3BE7A 4EPKA 3BW2A 5M17A 2GGGA 1A5MC 5LIUX 3QPEA 3WNMA 2E68A 2A5HA 1TB3A 4HPXA 2WNQA 3PFMA 3CUGA 2WMFA 4GCXA 3KTSA 2AL2A 4JEJA 4RW5A 1X8CA 3FA4A 1Q6RA 1KKRA 4HK6A 1NIUA 2ZBTA 3K4WA 3SRKA 3AS3A 1SJAA 2D73A 4DBDA 4JTRA 2OJPA 4MB1A 2V2CA 2Z2UA 2ZDSA 3CMGA 3R8RA 3KRBA 3QHOA 5K9DA 3C2VA 4NAEA 3BG9A 2A6LA 2BV9A 3QQ1A 1WKYA 3AIVA 3FJ4A 3W2MA 5C7VA 4B5WA 3L0NA 1NDYA 2BGSA 2UY5A 4UTIA 1ZUAX 4ZTYA 1AW1A 2B7PA 4DWDA 3DAQA 1R87A 2BASA 3TE9A 4X3ZA 4OOZA 2YW4A 3SCWA 1DWGM 1XCWA 1AA1B 2GDVA 3STGA 2WVUA 5D2YA 1E5NA 2CZVA 2G5WA 2NQ9A 2C0AA 4JL2A 3QMSA 2NSOA 1TJ0A 4ZB5A 2EG7A 3QV7A 3RO8A 2PSNA 2JK2A 3LMYA 1FHUA 4PCPA 4WKFA 4TUFA 2IPFA 2YL8A 3SECA 3R0UA 3SCQA 1WQ5A 3AMCA 3CC1A 4KT2A 2F84A 1X38A 1L2UA 5MF5A 1Q6LA 1CNVA 2WAGA 5D33A 4V15A 1D7KA 1D8WA 2RJHA 2J66A 1OFRA 3K8MA 1GZGA 1AJ2A 1LLOA 1PIGA 4O28A 1JYXA 2NX9A 3ITOA 2XGBA 2XSAA 1GONA 1HKVA 2QV5A 4PCSA 4IX2A 1FRBA 2Y63A 1ZBCA 1RSCA 4IGHA 1TTIA 5A5WA 1H7NA 2NQ5A 3MUCA 3B8TA 1C7TA 4MLRA 4NHVA 5IBXC 3WX7A 3O0FA 5AHFA 1F76A 3RUBL 1H63A 2O92A 1SZNA 3WLHA 3OHIA 2QIWA 4LPCA 4LV9A 3D3FA 1TREA 1E72M 3AZTA 2QDHA 2EEXA 3SCRA 3OLGA 3W7MA 4DI9A 3UXKA 3WF3A 2Y8UA 1FHVA 3EX1A 3SY1A 4JPGA 3POCA 4NP7A 1L8PA 2VD9A 3WQWA 3TAOA 2FVMA 3B0XA 1RQHA 2TRSA 4FX8A 5JXQA 3WG6A 2VI0A 1UJPA 5LNRA 1LQ2A 4HP5A 3N25A 4JTDA 3NQFA 5HJLA 3VX0A 2B7NA 3Q45A 4A2RA 1MSSA 4REQA 3W22A 3S46A 3MTWA 1HKKA 1QU4A 4X2PA 1OX4B 4M51A 3F2BA 1VCFA 3TR9A 3VNYA 1A4MA 4S3BA 5F1UA 3I10A 2XM2A 3TYEA 4GD0A 4QDPA 4MJ4A 3M41A 1OCBA 4BQ2A 3OA3A 1NARA 4QR6A 1K9FA 4GNJA 2X41A 1U1UA 2Z1SA 3L0KA 3MC5A 2PURA 1VBGA 2WCGA 1D9EA 4K37A 3C4UA 1XIFA 3XISA 5DO8A 5EMYA 3GO2A 5CC3A 3WH9A 4DXKA 1VFHA 1XLMA 2J7DA 2HJPA 3SR7A 4YNGA 1LG2A 2YCKX 5G1MA 2VO5A 3EA3A 2BMBA 4CCDA 3THUA 4X0VA 2QF8A 4JHMA 2YL5A 2J74A 1R3VA 3MCOA 4GUIA 2ZTJA 1AW2A 3HN3A 3QC3A 2X7VA 1XR2A 2VMFA 1OQFA 4GA8A 1M9HA 2X16A 3GHSA 3W70A 2HVNA 4PCTA 2J4GA 4LS0A 3A5VA 3N17A 4ZXLA 3ABSA 1VYSX 3BDKA 3H53A 2L5HA 1GPWA 1O95A 1GK8A 4R33A 3OZYA 3WSUA 3TW9A 3GH4A 1IEXA 1WYIA 5HWMA 1UWUA 3RLVA 3FA3A 1XM3A 4CKQA 2F6KA 4AIBA 3CLWA 3B3DA 1U1HA 2VFGA 4ADTA 5BOFA 3KCOA 2YOCA 2EG6A 1GCYA 2PWFA 3NR0A 4ZE4A 1FH8A 3MUXA 4GI8A 8A3HA 2J13A 1XBYA 3M07A 3QW3A 1FWJC 1OGGA 2PDUA 4DXVA 4YYCA 1H3GA 2V9DA 5G2WA 1Q65A 3H70A 2ZUUA 3DC8A 4ZCWA 1QW9A 3A64A 3SFWA 1ISXA 3L7RA 3LYEA 3QGAC 2C91A 2A3BA 5TQLA 3L5MA 2JIEA 2QQ6A 2A3CA 3KHDA 3KFTA 2CXGA 2W63A 1XLEA 1E6QM 2GGIA 1KXVA 1KBLA 1CXIA 1XCXA 4CCCA 1VHCA 3CJPA 3KBJA 3DC0A 4J3ZA 2X0YA 2IQTA 4WXYA 5AHIA 3CWNA 4LNYA 3T0BA 2J7BA 1ONRA 4Z2IA 2WZIA 4Q4QA 4WLCA 1YNQA 1AL7A 1S2AA 1VKFA 3S42A 1U5HA 1GZJA 1UBSA 2ZKMX 3DENA 3NEHA 3EKZA 2RDTA 4NUWA 3MUAA 4XKMA 1HP5A 4H6KA 2A85A 1XFBA 3GH5A 3RLHA 2ZIDA 1S46A 2Z00A 3I7SA 4H9YA 1OINA 2VCCA 4GXWA 4MIMA 4MKVA 1NELA 4GI4A 3AZSA 1HVQA 3PZVA 3NTYA 3DG6A 2D2GA 3WZ0E 4UTTA 3QR0A 5LA2A 3SCOA 2Z27A 1TPVA 2EJ1A 2J88A 2GQ3A 3P8IA 2PDWA 1IYXA 3AMDA 1JULA 3B06A 2OYKA 2YBVA 3A47A 4H9MA 2D2JA 3WNPA 4AY8A 3F4CA 4ERAA 1QI4A 3W83A 2D0FA 1EQPA 4Z1DA 2FH8A 2Z26A 3HFTA 2XIJA 1O1ZA 3PSWA 4LVFA 1V3HA 3P2VA 2QZRA 4ZXOA 1D3GA 1V0KA 3WH7A 1XCFA 3GKAA 2ESCA 5DFAA 3ICJA 3OBAA 2IQDA 3TMLA 4F0RA 1P43A 3FFSA 3LUTA 5EMKA 4MNLA 3TN5A 4MYXA 3KLKA 2X1TA 1GUVA 4NKCA 1HZYA 2WNWA 3QW4B 3VDGA 3WNKA 4XZ9A 2GSEA 3UWZA 3NEVA 1QW7A 2QJJA 1AMYA 2VEPA 4FP1A 1OF6A 3NSMA 2EXOA 3B9OA 2YA2A 3FEMA 3WYZA 3GNDA 1QPKA 3M0KA 4K3ZA 2RUSA 5CPQA 4EAMA 3QGKC 3H2CA 1SFJA 3SSJA 1EZWA 4DUOA 3H2NA 2DSKA 2XVPA 3FV9A 5D05A 3N2MA 2QUNA 3LN3A 1QO5A 4ZOEA 3FK4A 3NQCA 5I3FA 1XRSA 1E3ZA 3M4HA 1YRRA 3E2QA 2CFFA 3W7OA 4O18A 4LJ3A 4XO6A 1MDRA 4FIQA 2O4MA 1V03A 1XIDA 2PCQA 3MO7A 3FCPA 1Y5WA 3TYAA 1I2QA 3B40A 4D71A 3LV6A 4ZQRA 1X1ZA 3M0LA 1KTCA 3N6QA 4GUJA 4JQ4A 2VNCA 1K9DA 4A22A 5IXEA 1O94A 3K30A 3ISIX 2J8TA 3NL2A 3NWRA 3S5ZA 9XIAA 2RHGA 1A50A 7TAAA 4YJ5A 3N2TA 4NJGA 3G1DA 4DBEA 3C2FA 2WKJA 2OODA 1UKSA 3EB3A 2QJNA 3D0CA 4KIEA 4LVDA 4PTDA 1OYBA 1QOPA 2NT1A 1Z6KA 2ISDA 4Q33A 1WAWA 3E9AA 1UZHA 4ATDA 4WGHA 2Q8XA 1PKNA 4LALA 4JTAA 4R7OA 1Z69A 4ZVJA 1ONEA 2E40A 1LTDA 4YCPA 3LEPA 3ARUA 1KRBC 4Q4OA 3UWWA 1H49A 5F4WA 4JQ1A 3FS2A 3T2QA 4EKJA 2RGLA 3S1GA 2ZC1A 3S2CA 4JL1A 2PLCA 4G9PA 4HTYA 1TRDA 5PTDA 1JI1A 1UUMA 2Z2AA 3QKEA 1WUEA 4XVEA 1J5SA 5BMWA 3GFZA 1GNXA 2VX6A 5HQMA 3UQNA 4ZBCA 2UBPC 2FJKA 4N02A 5HWJA 3BLPX 2VOMA 2XWDA 4CN6A 3G8RA 3IJ9A 2YLLA 2QT3A 5LXXA 4H41A 3OO2A 2Z4GA 3TC6A 3VGBA 1LORA 2AAAA 3AYVA 4MB5A 3N1AA 4HA0A 5EMUA 3FSUA 2QR6A 4IF2A 1V6XA 3BGGA 4YLWA 3RAOA 2VQTA 1UR9A 3HZ3A 3LOTA 1UUQA 2NVAA 1KO0A 1MQRA 3CL6A 2OLSA 4FHAA 1UH2A 2PI6A 3RX2A 3WBAA 3HFYA 4HPHA 4FXJA 1KB3A 2CEQA 5FAGA 2NZLA 5HBFA 1IR1A 2BNJA 1F6YA 5KMYA 1J79A 3MDUA 4UIOA 2P76A 2GGEA 2G97A 3HURA 4TO8A 4HOZA 3W7IA 1TWWA 4IIDA 3LM3A 2Y89A 1Q6FA 1YPFA 4JS3A 4HTBA 4NX5A 2DFAA 4FLQA 3UY7A 2P8CA 1K3UA 3PBYA 5AHMA 2FMNA 4GBDA 4HA4A 1TJRA 4DJDD 5DMYA 3MWCA 5FF7A 1W3NA 2CYGA 1UR1A 3WJXA 3K8LA 3M16A 1M3UA 3LY0A 4NZ5A 4NZ3A 5EYWA 1H41A 1HVXA 2V2DA 3UR7A 2WKLA 3CK5A 1YLVA 2V81A 7REQA 2JEPA 1AD1A 1JQXA 1PBGA 3KCLA 1Y7VA 1S2WA 1QR7A 3IJ7A 1AH3A 6REQA 4XAPA 1HFBA 4JICA 2WLYA 2X0SA 3RITA 5CZJA 3EX6A 3QRHA 3LGDA 1V3MA 4IQDA 1FWCC 3KOYA 4PMZA 1DBTA 3QJAA 2OZ8A 3SY5A 3N14A 3PFRA 6CGTA 3NO3A 2FLIA 1TUXA 1KM2A 4TX6A 3MA8A 1EIXA 1UR4A 1WX0A 3TLQA 4NY2A 3GXTA 3UVAA 5A2CA 3LS9A 3W73A 3RG6A 5AHEA 4C6PA 4OUIA 4IQEA 4K8EA 3A12A 3H26A 1SSGA 2A0NA 1XRVA 3A4XA 1W3HA 1WBJA 3IJQA 1FDZA 1OFAA 2F6UA 1PV8A 1P4CA 1E9IA 5A94A 2PDKA 3TTOA 2HS8A 3VE9A 1IGWA 4M7TA 3LU2A 2FZ9A 3QC0A 4IP4A 1TMQA 3BANA 3EOSA 1U5VA 3WL1A 1RVKA 3B8DA 2JIWA 3PZTA 2O7QA 2E67A 1H5VA 1W31A 3GE7A 3FHAA 4POCA 5LIXX 4PUUA 1EHAA 1UP2A 5CPTA 2GK1B 1GVYA 1E6XM 3PZNA 3CZJA 3V0UA 2JF6A 2Y70A 1V3LA 5DX7A 5A3HA 2V6AA 3BSGA 1P1XA 2AL1A 3AMKA 1VIZA 3F4WA 2OWCA 3M0XA 1V3KA 1RK5A 4AHPA 5HNRA 1TWIA 1F4AA 1QHPA 5B7ZA 1S5WA 1F07A 1AODA 1TPDA 3WQ4A 4DZ5A 4FA3A 1G0CA 4C6FA 4V27A 3VUSA 1JZ2A 5CBIA 4QSHA 1BKSA 1KRAC 4XZLX 3EOOA 2HVOA 1R5YA 1QI2A 4U33A 3RM4A 3ZT6A 1O1HA 4DO4A 1GG0A 5HMSA 3WK2A 2VX4A 1MEIA 3SURA 1W0MA 2BB0A 1P0NA 2ATSA 1WAUA 4MTVA 3P3BA 3A21A 2Q02A 5HJXA 2CITA 1QPOA 3VA8A 4BEQA 5DF0A 2G3MA 4UR9A 1K02A 5D30A 1S5VA 1MQQA 3GVGA 3T4CA 4L4MA 1QBAA 4PUKA 2PDQA 3H2OA 1XKJA 3OGSA 4OECA 5G4WA 4LXFA 3GVWA 4K7VA 3C2OA 3TFXA 5CPOA 4M1RA 1Y65A 3CV1A 1QK2A 4X60A 1EGVA 1LM1A 3K8KA 4EWND 1JL8A 3HF3A 1HXJA 2PD5A 1I8JA 4DJDA 2YA0A 4A2SA 1B5TA 4Q6JA 1UKTA 1W2VA 1PSCA 1J5TA 4FS9A 4J5NA 3AICA 3TW6A 3CPUA 1TIMA 3CQKA 5XINA 3IGHX 4Q8WA 3WDRA 3S9IA 1FOBA 1JEZA 2BOFX 3VFCA 3TQ0A 2CERA 3CTTA 5I6SA 4N4QA 3IIXA 4XKYB 1LUCA 1AZ1A 1PZ2A 3CZGA 2CNCA 1EIBA 3SI9A 5SWUA 4PMXA 4YIWA 4PB4A 3ZZ1A 3MCMA 4L6HA 1JDDA 3G0XA 4Z1AA 3O07A 1B3YA 2PBOA 4TMBA 3SAZA 2XIOA 3GC2A 1R3RA 4FK9A 4CNNA 2YB1A 3ZO9A 1REQA 3RJXA 4CD8A 3F5LA 4KBXA 4W84A 3EB2A 5EB8A 2F8QA 2VEIA 2YA1A 2DIJA 1JCTA 4UTKA 1OWQA 2CZEA 1XDJA 1LZOA 3NQAA 3V7PA 1EDGA 4UQ9A 1Q6DA 2O9PA 1EUAA 3DYOA 2NXGA 4AW7A 2J47A 3JRKA 4H8VA 3RMJA 1E73M 3DI1A 3A13A 3V16A 1JDCA 1VIWA 3IUHA 3S6TA 3FGCA 4BEUA 2QUVA 1XKYA 3GXIA 3KX6A 3PY2A 1GVQA 4XD4A 4EF9A 5DXYA 3B9EA 3MKCA 4Z1YA 5A2AA 1EPXA 4CLMA 4AEFA 2ISWA 2OGJA 3ARVA 5CKSA 5D4YA 3CPRA 3AIBA 3N12A 1LWJA 3HA1A 3LMZA 3IV8A 3HJZA 4Z1CA 3CH9A 3CEPA 3LBCA 1OFDA 3PP7A 1ZJHA 4XBJA 4LEQA 1PTDA 4EIVA 5D2VA 3W27A 1XIGA 4O19A 3CYJA 3NPVA 3PPFA 1YX1A 1RLCL 3SY8A 1GJWA 3JZEA 4HZ6A 1AQFA 1UYQA 4AZGA 4FX6M 2YZRA 4LOCA 2Z24A 2CLHA 3KZSA 4J35A 4H4IA 2Y62A 3WF2A 3G1VA 1PZ3A 4WY0A 4NZFA 1NOFA 3PPHA 3VOJA 3PG8A 1CBGA 4C1KA 1XYZA 4CN4A 2CLLA 4JFWA 5BXTA 4DY1A 1DOSA 5DQPA 3GU9A 3UPMA 3M9YA 4AD4A 3QR1A 3R6IA 3O05A 3AMLA 3CIWA 3BAYA 3CT2A 1MEWA 3HTWA 2CLOA 2ZC8A 5E1QA 1ITQA 3AYRA 4BFAA 2HNEA 4PBGA 3PNZA 3IAQA 2WZEA 3L4YA 1F3XA 2A7PA 2WB5A 3SN0A 3LI1A 4U31A 4XBKA 4L6OA 3P0XA 3ZJKA 5CJMA 1NY1A 3E2SA 1FQ0A 4PMYA 2KZHA 1VYRA 3GIYA 4JYEA 4ECLA 2J27A 5A1AA 3CQJA 3VIGA 4JTKA 1UKOA 2ZZ1A 1EKOA 4RCXA 4WF7A 1C8XA 1K8XA 3CWHA 5E9AA 2ZA3A 3ANVA 1QW8A 4HK7A 2OYMA 5BRBA 3T0CA 4I7VA 5KZMA 4BA0A 1U5JA 3TAKA 3VMNA 3IJ8A 5I77A 1G69A 5D9NA 1DORA 1XSKA 3QKZA 2V0TA 2WQPA 4YWIA 1DHPA 1XJBA 1WA3A 3AC0A 3H7UA 4GYJA 3QBUA 3FNDA 4W85A 3LNMA 2FIQA 1IWAA 3SEPA 3O6DA 4IGMA 1B1YA 3W1NA 2A2IA 4M24A 3MSDA 1ZL1A 4JX4A 2DUXA 2E4TA 1U30A 5FD0A 1XLDA 1R9XA 1Q45A 3P60A 4HZ7A 2W91A 1SW0A 3S5NA 4LC6A 1TMHA 4JN6A 4MUPA 2WCAA 2I9EA 2OZ3A 1LF1A 4GO9A 3BPWA 3PUEA 4MYAA 1JZ4A 2Z7GA 5DT5A 4A3UA 4HU3A 4DBSA 1NDVA 2ZRUA 2BBFA 1L6FA 3HQ1A 4B5UA 1O60A 2V3EA 5AC5A 1B9BA 3L2IA 2VVNA 2UWFA 3VGHA 3A3WA 4JGDA 1OD0A 2W66A 3E0FA 3TQVA 1GVSA 2V3DA 4KERA 3T78A 1B57A 4DM2A 1Q63A 1W9VA 1CENA 4LT9A 4I9TA 4GLEA 4UTWA 1CXEA 1ITCA 2OOGA 1FUYA 3CIXA 1W1A1 4HOWA 4LUIA 5D9PA 1C93A 1LBMA 3I7RA 1QPNA 1AK5A 4O17A 5KZDA 1VRXA 1XX1A 4FF7A 4OHQA 5E6YA 4AXKA 5A6TC 1KQZA 1IWPA 1OX4A 4LVGA 2QUTA 5FIPA 4AMAA 2G41A 4UFLA 3DEQA 1BG4A 3QZ6A 3WF1A 2ZRWA 2V30A 4S39A 4XBSA 1A49A 1HJWA 3IK4A 4M6VA 1CGYA 5J5RA 4FNUA 4O8RA 4XSMA 1FWRA 1SMDA 1LLWA 1NWUA 3QYSA 2PDMA 3FXYA 4ZQPA 5G2IA 4KS0A 5FI8A 1SQ7A 3ITVA 4GUGA 3ZVHB 3JU2A 4AWUA 3KOWA 1UWSA 4JDYA 5D2WA 3M0VA 4UFIA 3RJYA 2RGMA 1RXOB 3BJTA 4W7VA 3WFZA 4GVFA 4KMQA 1H5YA 4JQAA 4DBWA 3CXOA 3NPWA 4GIEA 2Q01A 1K7XA 3QFEA 2EPHA 2A3LA 2IPWA 2BHZA 2QHAA 1K03A 2PTYA 1VEMA 3NQDA 2AMXA 4JX6A 1Q6QA 1XF0A 3BC9A 1CLVA 3UU0A 5F2GA 2Y24A 3ARYA 3LLXA 3UFYA 2ZX9A 1V79A 3AQUA 3LG3A 3CZEA 2C0HA 3OODA 3OZPA 2J6VA 3GYEA 1MW0A 4JKKA 2OWWA 1V6TA 5FEZA 1QI5A 4D8AA 2XTKA 3S5YA 3DHDA 3ABOA 3SCVA 2QYGA 4QE4A 1QBBA 4Y9NA 2NSXA 4DO6A 1DJNA 1TJPA 3LHVA 1JGMA 5BROA 3EDJA 4Z2GA 4L7ZA 3U7BA 4GYPA 1GKPA 2E6DA 4NJJA 3HPAA 2Y7EA 3B9AA 1V3IA 4Q4RA 4AB4A 1LDCA 3B0UX 4F2BA 2C79A 4ZEPA 3H2EA 2OZTA 3BAIA 5T26A 2PC8A 2XVKA 2FQIA 4EANA 2VEFA 4AD2A 1OYAA 3DKJA 5AFDA 5BWFA 2VURA 5BXSA 1XG3A 5AB3A 3VO0A 3BCFA 1Q6OA 1GHRA 1XINA 2OQYA 1FWHC 2DORA 2V63A 3NXLA 4ZMGA 3TKFA 3TNOA 4UFJA 1FHDA 2PPGA 1UIPA 2R9RA 4A8IA 1FWGC 1XLLA 4GVGA 5EBUA 3WEZA 5AYYA 4F0KA 3S5SA 1G7VA 1NF7A 3MMWA 3MHFA 4HQVA 1EX1A 1JPDX 1BXBA 1W1YA 1H09A 1SJBA 3L66A 4HHLA 3MZNA 2E6FA 3VZXA 4AY7A 3FSTA 1W54A 4CQ8A 4BF7A 2DUZA 1KM1A 4L1XA 3DFNA 4D6DA 2VX5A 5LIKX 2V5CA 2ABAA 1TUFA 3WQCA 4AZBA 3CHCA 3P84A 4IPLA 3BOXA 1UP0A 1YTKA 1CB2A 2E9MA 3IUIA 3DG3A 4HU4A 4EPDC 2BZNA 4FALA 5A8OA 1X39A 2PLJA 3VDCA 2OKTA 1AJ0A 1K9EA 2CBJA 3HPFA 3WDIA 3VTRA 1OM0A 4C5ZA 3D6NA 3I6RA 1EJWC 6ALDA 2BVDA 1KRCC 3W00A 4IL2A 3NPUA 4FLRA 3TYBA 3VZYA 4DF0A 2YDSA 2BG5A 5IOBA 3HG2A 1K4HA 4O4VA 2ZCGA 3OGRA 2E8YA 1DIDA 3WY1A 1J9YA 4Q8VA 2PWEA 4RDWA 3T8LA 3T9PA 3VOGA 3N3TA 3GAKA 4ILSA 5E6ZA 3QMRA 1S5TA 2G95A 1JRBA 4DEFA 2QGYA 4TMCA 4BQ4A 1G7UA 4UMBA 3W7JA 4UTFA 4B91A 3F5JA 1RP8A 5I3HA 3RPMA 2VWSA 5ABEA 1KWGA 2WOQA 3UY8A 3EDKA 3Q65A 2DZBA 1B9ZA 3VC6A 2CBVA 3P8JA 3VXGA 1TMLA 1GPFA 4PBEA 4QEHA 1W5MA 1PB0A 3HPZA 3ZJ7A 1IEVA 1BKHA 4D6EA 3NL3A 3V35A 1W5NA 3L68A 4L64A 5JIWA 2PDIA 2WCSA 2WSPA 3RPTA 2TMDA 2WJEA 3AHYA 4WHBA 1NP0A 3TDFA 3ZR6A 1IEIA 2C15A 4OFCA 4J9JA 3AALA 5D37A 4ZOBA 1XUZA 5HR7A 3WF0A 2VHLA 3HIJA 3HMJG 4LYKA 2B31A 1CYGA 2VYOA 4NVTA 3W1UA 3NQVA 1LJYA 1QPRA 5CSSA 1LOQA 1C3FA 1LLZA 4ZSUA 4B5VA 2DY3A 4LCQA 3G1SA 1ZSXA 3VE7A 1LRTA 3AWNA 1XH0A 4B3KA 4XUGA 2J75A 3GDRA 4ADUA 4Q4SA 3T7VA 4MB4A 1UHVA 1JDFA 4L4LA 2BLEA 2PDCA 5H8UA 1VJIA 4AYGA 1LROA 3SRHA 3G5EA 2X40A 4MY8A 3S2NA 1BGGA 5AECA 3WEMA 1V3JA 2DT3A 3WLIA 1PIIA 3CYVA 4S3FA 1JD9A 1V5XA 3ALFA 3TJIA 3SUSA 2NXHA 5AYIA 4DELA 1F8IA 4NT0A 1FWDC 1QK0A 3SDOA 1KXTA 4EP8C 4ICCX 4PUNA 1OJXA 2PGRA 4DLMA 2Y4SA 1HJXA 1A5OC 1R30A 4UNIA 2WVSA 3EOUA 3XIMA 4PRRA 1HW6A 4HMNA 2VFFA 1RH9A 2ZRZA 1VFUA 2ZYFA 3MMTA 5G1YA 3WQFA 4REQB 5K9CA 3LCWA 4A8RA 1SR0A 4JIPA 3S1WA 1FCBA 9CGTA 2TAAA 4DXXA 5H6HA 1G4PA 2VFDA 1G1YA 3HM7A 3M64A 1ME8A 3GTNA 3ARXA 4B5SA 3SUUA 4R9XA 4J3WA 5D2XA 4E5TA 2ZZ5A 1QPQA 1F3EA 3W7HA 4QDWA 4XAZA 5E0FA 1A5UA 1UQYA 2O55A 3QHNA 1BG9A 1WZKA 4RE3A 3KBNA 1H1ZA 4QG8A 5F4XA 4G6CA 1GQLA 4H6EA 3W38A 2ATMA 2E6AA 4IG2A 2QMKA 2CW6A 5A95A 3ARTA 1TWDA 3WLMA 3SRDA 1XWYA 2YDQA 3E49A 4UTTC 1WOBA 1UROA 1YQ2A 1XLGA 2PC4A 5DRIA 4PTWA 4NILA 1O4UA 3T40A 5AC8A 2FHCA 4IZGA 3PZGA 2WHKA 2QJHA 1JPKA 4L9XA 4NIRA 4NG3A 4O10A 4DNHA 2FGLA 4AISA 4AEOA 5DN1A 4PSRA 4XD5A 4AIUA 2HPMA 4B5TA 1TTPA 1DJQA 3VNDA 1IZKA 1XQLA 4BQ5A 1VBHA 4C7FA 4LBSA 1JIBA 2FVLA 3RX3A 5CPSA 3TTSA 3C0SA 1EWEA 4DHGA 4GQQA 4NF7A 4NNAA 3LBOA 3ZLGA 5LIWX 3N9KA 1SYTA 3PNUA 3WQOA 3CUIA 1BQGA 2TODA 4AZ7A 2HXTA 3LPGA 3LXAA 3LHUA 1FWBC 3UETA 3GNNA 4W7UA 3W3OA 5TD4A 2ACSA 1Q4WA 4WEVX 3ZXWA 1UZ4A 4A4AA 2AQWA 5HMDA 4CNPA 1M5WA 2QGHA 2GJNA 3CH0A 5A69A 5D03A 2WXDM 1EZ2A 3WF4A 3W72A 3EA2A 3LENA 1B0IA 1AVAA 4DYJA 2YIHA 3W53A 1R9YA 4GI6A 6PTDA 3SN1A 4C5YA 3HPXA 1FVPA 3G1XA 3R58A 4PMDA 2NW0A 3W82A 4IXHA 2V69A 4C6OA 3KVLA 2TPSA 4R5EA 3WD1A 3I6TA 4FX7A 5C0QA 5U7SA 1CGTA 1SO6A 3WNLA 3AHXA 5D9OA 1UWRA 2GUYA 3WH6A 4WRHA 1O6IA 2A1YA 3MW7A 2GOUA 4QSFA 1KCLA 1XH1A 3BV4A 4EX4A 1X97A 1QJWA 4GJ1A 1FP9A 3VOHA 3THAA 3U5YA 1R3QA 4P61A 3FDKA 4NI3A 2F9RA 4M19A 3II1A 3H54A 1OG0A 4LYQA 4B3LA 1US0A 5CGQA 2Q8LA 1FY6A 3PJUA 4G8TA 1E9YB 5HPCA 3B0PA 2OCZA 1XBVA 5CH9A 3GTXA 3P93A 4KFOA 3MWAA 5HXMA 1JCLA 2V8ZA 2YLAA 2GK1A 4V1YA 3KUMA 2V5LA 4X63A 2YCLA 1J93A 3MSYA 4L80A 1PTGA 2XH0A 1G94A 2PF0A 3P6LA 5KTLA 4W8BA 1V4YA 4OWGA 4LFYA 3N2OA 2PU0A 1LP6A 1WUFA 3WJSA 4FOUA 1US2A 3IEBA 2WHMA 3N15A 4C6DA 4XO7A 1XPGA 1FH7A 1XLKA 2J7FA 1KD0A 1W5QA 4RZ5A 3N18A 4KRTA 4JR5A 4LAZA 2PTZA 2E09A 1E4NA 2OO6A 4MNKA 2F2KA 4URIA 5C7HA 1ZNNA 2VJXA 3CO8A 4MZ1A 1GHSA 2V5JA 3ZIZA 4P2VA 4TR9A 1BGAA 2WSYA 3CTLA 4K2SA 4XZHA 3SQLA 1TPC1 4X61A 2PU1A 2Y5EA 3T8QA 4UQEA 1BF2A 1V02E 4JD4A 1O5KA 4C6QA 4CU8A 4ICNA 1A5AA 4YVVA 1R85A 1CXKA 2Y2WA 1VF8A 4PMRA 3T2OA 1TPFA 2YL6A 5EMMA 4BWLA 1YNPA 4ZQNA 1Z89A 4X2RA 3GK0A 3ITTA 1BSLA 2ZWZA 1VFTA 2AMGA 3NCOA 4R85A 3HQPA 1EEPA 3H12A 5EMJA 3R94A 4HT3A 4YN5A 1X6NA 3S6OA 3O1NA 2PF8A 3ITXA 2NQZA 4JTSA 4P7QA 1EF3A 1VGAA 1M68A 2PBGA 3SCSA 3WENA 2E7FA 3G1RA 3HG3A 2E9LA 5CLWA 1UPMB 4IPIA 2DW7A 4HSOA 3WQ8A 3YPIA 3P74A 1HG3A 3ZVIA 3L12A 2B7OA 4OUEA 3T1GA 2VCBA 2C1IA 2FB3A 4TXEA 3BLLA 2HV5A 1MYRA 3G22A 1ICQA 2GQ9A 3TTQA 5DRCA 5KEZA 1AJZA 4IUOA 3UF9A 1RY0A 1GJPA 4HN4A 4UWMA 2W62A 1JZ8A 1EYWA 1P0DA 2ZZ6A 3U2OA 4XKYA 3P5ZA 1L9WA 2Z1KA 2C16A 3UZXA 2WPBA 4KWOA 4LCRA 2VELA 4PFMA 3R4IA 3FYOA 4AQLA 2WC7A 2WHLA 5I02A 4G7EB 4KIRA 2DVXA 4GISA 2EHHA 2NLYA 3EGJA 1P6WA 3PR2A 1V0MA 3UNDA 4CCEA 1YPXA 2I17A 4H3DA 5A6BD 2QNEA 2WZHA 4PUWA 4S3JA 1W1TA 3WQPA 1KCZA 3SCNA 3GXPA 3BSMA 3SCPA 1EBHA 1KBJA 4GOAA 3W02A 1PYFA 4X9SA 1QI0A 1OCNA 3ORWA 3LZ3A 2FTYA 1GYNA 1E15A 1FWAC 1Z32X 1E0WA 2VC6A 4TTGA 4J3UA 3BCJA 3BMWA 4Z1BA 2ZX8A 4OZOA 3AJXA 3WH8A 3MO4A 3TX9A 2D2OA 5LYRA 5LA0A 2YX0A 3RCNA 3W7PA 4MMWA 3PVFA 1NF0A 2I57A 2OVLA 4B4HA 1H11A 3MV01 2P8BA 3KDNA 1MXDA 4JCLA 1O66A 3BG3A 3ZOAA 3UT0A 4GYFA 4KWUA 3EWDA 1OB0A 1TPEA 2BOEX 3BVJA 3BZGA 1MZRA 1F6PA 3N19B 2XFFA 1R8LA 4UXDA 3ZJ6A 4Q6XA 4AVFA 4DZHA 3E0LA 2ZE3A 1I9CB 3IGXA 3OYXA 1OT1A 3TYZA 4Q7BA 1KFCA 3WJZA 4JQ2A 3KOZA 1NVMA 4QX4A 1IV8A 1PPIA 3M47A 1POJA 1KW1A 5AYZA 1I2PA 4EACA 2GJXB 3ARRA 1O5RA 2CHNA 3IPWA 5F2LA 1HO1A 3OLDA 3W74A 3U2ZA 3ITCA 3G6MA 1TSIA 2VZUA 3DKLA 4XTIA 3T6CA 3K1GA 1TPB1 3KBMA 4XG1A 3LCGA 4W86A 2HCVA 2EF9A 1FFQA 3QSTA 1I4NA 3DBNA 3KL3A 3MDWA 4ERIA 2Z25A 3UWYA 4C6CA 3VKJA 4DNMA 3W1RA 1KA9F 4BHYA 1CGXA 1SSDA 5DXXA 3WDPP 4Q8PA 2UY3A 2CETA 5BRPA 1VP5A 4GQ0A 5J04A 3NOYA 2ZFAA 4DUWA 1E56A 5LIYX 3W7EA 2PP0A 1H0GA 4MY9A 2HK1A 1E4LA 4OGZA 3W81A 4ASTA 2VEMA 1W17A 1W32A 3CEUA 3GDLA 4HCLA 1J2WA 1EC8A 1XSIA 3PBVA 2ODOA 3P61A 2DGAA 2WZTA 1HX0A 3N3MA 4GVHA 4DJFA 4J3SA 2PDGA 3K4AA 4F3HA 3AAMA 2PGEA 4IT1A 2WZMA 2CHRA 5H91A 1RD5A 4QGCA 1J0HA 3RRXA 3AXMA 5DBTA 2BY0A 4E4PA 4AZIA 2GVGA 1JI2A 1QATA 1GOMA 2EGZA 3MMDA 4RK8A 2IMRA 4YVXA 1X1NA 5DANA 2H6RA 1BF6A 4DJDC 2E1WA 1XGZA 2XU2A 3KRUA 5HJYA 1Q6EA 1XRFA 5HUPA 2ZVIA 3ARPA 3OTRA 1J0YA 3DUGA 1IIGA 1ZGDA 2X09A 2CZ5A 4NSBA 2BVWA 1QTWA 2BSLA 4G1NA 5F2MA 2NQLA 1BTCA 3UZJA 2DQWA 3UR8A 1OIFA 4GY1A 3RN6A 1QUMA 1DL3A 4GHRA 3SQMA 4AZ6A 2Z7KA 1MW2A 1QASA 2YFOA 3NXFA 5CC7A 1XYCA 4GX9A 1BHGA 2ZA1A 3OVGA 3ZQ9A 4DWSB 1NTHA 5M2FX 3LGGA 4HIBA 1LBFA 1KC7A 4S3KA 4DX3A 5CSYA 3VNJA 3UCDA 3T07A 4FF5A 1KGWA 1O12A 2PD9A 2VZOA 4Y96A 2YYTA 1YDNA 4XIAA 3HOJA 5B80A 1W9XA 1I2OA 1IXQA 1W37A 3BQ5A 1C8VA 1U1JA 3LERA 1T96A 1HF6A 1ONXA 3GTHA 1IEQA 1XLCA 3P0WA 3WBEA 3PJXA 3P62A 4GIYA 3OZOA 4JBRA 3HB9A 4IH3A 1EGZA 3LSCA 1QVBA 3DU0A 4E4FA 4J4KA 3VD7A 4N4PA 1XRTA 3FVMA 3ZSSA 5I3KA 1GOXA 1NAL1 1RALA 2EQDA 5IDIA 4FOKA 2I9UA 2J6XA 3NZQA 3PUDA 1MUMA 4MHBA 2WVTA 3W1QA 4IJRA 1TWZA 4HNUA 5CCZA 5JMUA 2X2GA 3RNDA 1AH0A 4BR1A 1GVOA 3LHTA 1J18A 1T6MA 2IKGA 3W76A 1E51A 4V28A 3E74A 5TF0A 1NFBA 2W61A 1OK4A 3KS6A 4HPNA 4MFEA 4MOZA 4D8LA 3UZ5A 3GVVA 3I65A 1FKXA 2ICSA 1Q7MA 1UR0A 1OZMA 3TOPA 3RU6A 2DSZA 3Q58A 3TJ4A 2BVTA 2P88A 2DIEA 1OSEA 2VENA 2A7RA 4ATLA 3QQWA 1IEWA 3LPOA 1XDMA 3OEXA 3E1F1 4ONVA 1MXGA 4PUMA 3NQGA 2WMIB 3S4TA 3HG4A 1I60A 3VABA 1J11A 3GR7A 4KESA 4N0RA 3MYOA 1EC9A 4PTXA 1W8GA 1VJSA 3RO6A 1G4EA 2QCCA 2ZUSA 1NFGA 2HRWA 4FR1A 4WOQA 1LUCB 2OZ0A 1T40A 1UD5A 4MNJA 1UP3A 1V77A 4WDWA 1N8WA 2GVLA 4JKLA 1YBQA 5I7GA 4OBRA 3NZ1A 3NO5A 1JUKA 3URQA 3K4DA 4EVZA 2XSBA 1B3OA 1XLHA 4P8WA 4QEEA 1VYPX 2VM8A 2OO0A 1CPUA 3Q2DA 4U10A 1NWSA 3UWEA 1PZ1A 3RF9A 3ALGA 3EX3A 2QCEA 3KTCA 4KRZA 1J0KA 4GNVA 3W7DA 1MNZA 1OCJA 4K6AA 1BRLB 3FGCB 4X0NA 2V5BA 3MU7A 5FSDC 5C6MA 4UZSA 4JIRA 4IISA 2PGWA 1BYCA 5J5DA 4PC8A 4PGLA 1M6JA 3WLRA 3CLMA 2QDEA 4OJYA 3C52A 3GTIA 4RNIA 2XUCA 4O16A 4U3AA 4WUIA 1K70A 3SIMA 7CGTA 4US6A 4C1NB 4JNMA 2H8XA 4QS5A 3UXIA 3VOIA 4GNKB 4ERGA 4Q32A 4WIWA 1VC4A 4EAYA 3ZLFA 2EG8A 2X1RA 2W0UA 1QAPA 2FMOA 2BWGA 4H8UA 1NOUA 4AIEA 1UC4A 4DPPA 4EXQA 4BS0A 1W8SA 4GZ7A 3WL0A 3S9YA 2BS9A 3BLOA 3OYZA 5CPLA 1C9DA 1XD0A 3VNZA 4HSHA 4GXPA 3FVDA 1V7AA 5HNNA 3WK3A 3L2LA 1P0KA 1KFWA 4MADA 1RUSA 5TIMA 1M7PA 2G0WA 1OEPA 3TN6A 3GAYA 3CUJA 4UMAA 4UTWC 1UOKA 1FXPA 4NI8A 3G0SA 4PB3A 4GRSA 4OKDA 4XAFA 4WY0B 3TCEA 2XIQA 1XD1A 1KM0A 2VP8A 1XBZA 3NVTA 1W1B1 3WQ5A 4J2MA 1OX6A 4QLJA 3NSXA 3O2LA 4D6IA 3OLIA 4Q4MA 4F0LA 3UGVA 1Z48A 1IGSA 1VCVA 3RCMA 3LDVA 1EWDA 4G56A 4HCDA 3W71A 5A2BA 3T55A 5LZLA 2FH6A 3HV8A 5C9UA 1JRCA 1A3WA 1IWBA 1FDYA 4AZ5A 4I5XA 3WK0A 3GW0A 4A35A 4I3GA 4NL1A 5EGRA 3R1ZA 1PAMA 5C9RA 1I75A 1O7AA 3GDBA 4XZMX 1MW1A 1OFQA 4ZB2A 4PRWA 2ABBA 1H0IA 2BVYA 1B31A 1JXKA 4GC3A 3DI0A 3I3DA 2BOGX 1UW9A 4H9TA 2VR2A 1E43A 3A4AA 3VMOA 4NNCA 3ZJ8A 3LXCA 3WMSA 5G5IA 1S2CA 2ZICA 1D2KA 2HS6A 4J3TA 3QH2A 3W4RA 1PKLA 4HK5A 2P3ZA 1F6KA 2NQJA 2XN0A 1JZ5A 4C91A 3KCJA 4Z2KA 1XS2A 1ZAJA 1B90A 4LGXA 2I56A 1YIXA 2ACRA 3N2BA 3CQHA 4S3GA 2INZA 3BXWA 5KZ6A 1N8IA 1E6RA 3WLJA 2GOKA 3GXMA 1UBPC 1UG6A 3H4XA 3EAUA 2FJUB 2DIKA 1SJCA 1UR3M 2VFHA 1NOWA 4GQGA 3U7VA 2WJDA 4GYPC 2AQVA 1CWYA 1Q7ZA 3DXIA 4IL0A 4K38A 4LF1A 3VIHA 1WE5A 3ZS4A 4O4WA 2PLMA 5FJTA 3IJIA 4HMEA 1R2RA 4JTUA 4H8NA 1HTIA 1HKIA 1QRQA 1YMYA 3GUWA 4F4RA 3QN3A 3OG2A 1OY0A 3TZFA 5H1WA 1AQMA 1Q8AA 4DPQA 4GFSA 3NYZA 3V1HA 1SPQA 4QITA 1GEQA 3PBWA 3PK7A 2J9ZA 1QCWA 3U4FA 2A3HA 4GY7A 3CMFA 3VFLA 3TC3A 2A6NA 5CAHA 2X2YA 6A3HA 3AUJA 1OC6A 2IW0A 5I07A 2VZVA 4KETA 4Q4PA 1VEPA 2OEJA 3G8EA 2EPOA 5HINA 1PL9A 1JCYA 1FWEC 5CEWA 4JIEA 2OSYA 2XISA 2WW5A 3ZFHA 5AC6A 4JKMA 1ICSA 1AZ2A 3AS2A 5CJNA 1N7KA 4V2XA 1JVNA 3H2AA 1DJIA 4RNJA 5IRPA 3KM8A 1FFRA 4RUBA 5FCZA 1SO5A 1RLDA 1MI3A 3TYUA 2XZ7A 1H7PA 2X1SA 4RV8A 4EPBC 1TA3A 1XH2A 3FJLA 3WQ6A 3TSBA 2ZZ3A 3UXAA 4LB3A 3EEGA 4QE5A 2PTXA 5LXEA 2O9RA 1F7BA 2ZUVA 1DXFA 1KGUA 3BLKA 4ZB0A 1ME9A 2D23A 3PJWA 1IXPA 2GDUA 1UWQA 3TV8A 1UCWA 1WBHA 2BHUA 1AUSL 3AU2A 4DUXA 3R8GA 2R1MA 1VPQA 5CZSA 3BV7A 3M0IA 3NFUA 3R0DA 1UASA 3ONCA 5HULA 1H7WA 1UD4A 3B05A 3VGEA 3Q67A 1Z42A 2BHYA 1CECA 3S6DA 2FZMA 4LYPA 2HQAA 4AH7A 3LCLA 3S2MA 5F1VA 1ADDA 1VRDA 2ZZ4A 3VK5A 5BOOA 1JZ7A 1XICA 4WR3A 5D09A 5I06A 4KEZA 1RK6A 3BAKA 4PB5A 1FH9A 1N82A 3CAVA 5CQ1A 4NYUA 3U57A 1E70M 4E2BA 3GZ3A 4HNLA 3MHUA 3UCCA 2OR2A 1IE7C 3SRFA 2QUMA 5AOUA 5T91A 4MZ8A 1ZP4A 3G1FA 5G4HC 5CBBA 2QCDB 2ZUTA 5AVNA 3ZMRA 1QI3A 1J6OA 1Q2RA 4E4UA 3KBWA 3BTNA 3VNLA 4HN8A 3G1AA 2Z1WA 1E6NA 4WVXA 2NLIA 3QR3A 3B4UA 4QBXA 3PANA 4D6CA 4E3TA 1OADA 2PZNA 3W6MA 1H1YA 4S3CA 1E1EA 1SZGA 4XUYA 2ZX7A 3L2MA 3WQGA 4DQWA 4R7JA 2ZXBA 1UZ1A 3C0JA 3PWAA 2XFRA 4KEUA 2WNNA 2ZXDA 5K3VA 3TUUA 1HKMA 4YYFA 3L67A 3VIOA 2NUWA 5T8GA 4BJHA 1IF2A 1Y8BA 1TTJA 1PZ0A 3TEVA 3B9DA 3ATYA 4AC7C 4YTRA 4UFMA 5HMEA 3OPSA 2C14A 1RHCA 1U33A 1VBRA 3MJMA 1J6PA 3M43A 1X8FA 5HQEA 1TPUA 4LY8A 1O68A 3DGBA 2HEJA 2XDFA 5CAKA 4C7DA 4TTUA 4RNHA 1JCNA 5T9BG 1XISA 3MI2A 3SB0A 2PDYA 1RA0A 1UJQA 3UG5A 3OGVA 1EXPA 4ALDA 4GY0A 2QW5A 2IPJA 1F61A 1UD8A 2OOFA 1S2VA 2H9AA 3MUZ1 4B15A 1GEHA 5AVHA 2PDHA 4I6VA 3F4NA 1YPIA 5G1TA 1DIOA 2ZVRA 2PEVA 4A8LA 3B0VC 4YVPA 1JZ6A 2OQHA 2Q6ZA 4CU7A 1RY8A 4AXNA 2CXEA 1UWIA 1EUNA 3AIUA 1V8EA 3H2FA 3L0GA 4GX8A 4S1FA 4CNSA 3CGTA 3NIYA 1ZBWA 2VEGA 4S3EA 2ISSA 4LV4A 3SCUA 1A5BA 2QAPA 3DCPA 3LM7A 4M6UA 3MP5A 4MWAB 4FB7A 5C9WA 6TAAA 4CCZA 2GJLA 1OIMA 1KGXA 1T7LA 4H1ZA 1KV8A 4JFUA 3WBXA 1WCGA 3QGVA 3A9BA 5BNKA 1BYAA 4RZ6A 4PCFA 2JF7A 3PTDA 1YXDA 3F03K 4HMDA 3RYSA 1Z3NA 2UZ9A 3LGEA 1H60A 3W1XA 4YPJA 4XWUA 2CHOA 2OKOA 4DIAA 2GVEA 3UA3A 2I1OA 2HROA 4IHCA 3VIJA 4KFNA 2ZQ0A 5LNSA 4WJ8A 1HJQA 4HB7A 1DJGA 4BZYA 1L8NA 3P7YA 1BYBA 4MVAA 1OYCA 3V0TA 3HQNA 4GFIA 2DZXA 4JTEA 2R91A 3QOMA 2XM1A 2C71A 3MI3A 2BXZA 1XIMA 3THCA 4O0ZA 4M29A 1ZJAA 4I6KA 3EWCA 4H7VA 1A0CA 3APYA 3H8AA 4GABA 3QY6A 2VC5A 3OIXA 2V3FA 3QF0A 3N6JA 1PWLA 4N6FA 2VVSA 3S9ZA 1TZZA 2GSJA 4AWSA 3KXQA 5HPOA 1HNYA 2ZE0A 4OBSA 4B9ZA 4IGSA 4A8NA 3RDKA 5F7UA 2J9YA 4Q8QA 3KLLA 2OEKA 5M1TA 4XK2A 4G7EA 4DZIA 1GKRA 4B9YA 3PC0A 2VUNA 2DW6A 3U48A 3U4AA 3SJ3A 3I3BA 1VBUA 2FHFA 4HNNA 4DWSD 1JPIA 1OFEA 4LTSA 1ZS2A 2OMAA 2A79A 1VS1A 4AEEA 4GH3A 1SMAA 6ENLA 1R2SA 4XZIA 3WD2A 2BP1A 1X1OA 1XLBA 4ML9A 3QEZA 5FF4A 2W27A 4M6QA 4Y6GA 4H7ZA 4WSHA 2R1KA 4KCWA 3W86A 4UTJA 4JTTA 4AC1X 4OT7A 2V82A 1QXLA 3KWXA 4RL3A 2DZAA 1CXHA 4QM1A 3NSNA 4XAGA 4MPQA 1YEYA 1JCJA 3OU8A 1YDVA 1B3VA 1KXQA 3W01A 3WMLA 1Q3NA 5MKGB 3KRZA 2PWHA 4PEKA 4D2JA 4IG2B 2VRJA 2QXWA 3APTA 4HU0A 4MAZA 1H4PA 4Q8TA 1EDTA 3VIPA 3MVIA 5EL1A 1W3LA 3A3XA 3MY9A 4DO5A 1OGSA 4IPNB 2HMCA 1RQBA 4O50A 1GVEA 3PZIA 3ERPA 1SVDA 3R79A 2R1PA 4GBUA 4LAMA 3ZM8A 4E6MA 3NG3A 3ZT7A 1HUVA 1A3HA 3NVDA 3VMPA 5BMXA 1ZP3A 4PUEA 1CLXA 4LY4A 4H2CA 3STEA 3VKAA 4IIGA 1VAHA 2GJXA 4IX0A 3AIRA 4L9YA 4NX0A 3RR4A 2VC7A 4AUBA 2RDUA 3DG7A 4EWJA 3V0SA 2PWUA 4PZVA 1V6UA 1AQHA 1NQKA 4E8GA 1FX6A 1I2RA 3URNA 3QY7A 2EAWA 4FXSA 4F9DA 1TIWA 2AKZA 1W1IE 4IMAA 1IXNA 4QE1A 3W84A 3VINA 4R34A 2HDJA 4C60A 3GDMA 1FP8A 1Z8AA 3QZAA 4ZFMA 1JYWA 1KRMA 3VKCA 2EPKX 3QPZA 2XH4A 3KVMA 1C92A 1TFVA 5HR6A 1C91A 3W88A 4QAIA 3PZUA 3BQ6A 1WDRA 5CZ0A 2MNRA 3QOKA 2WSKA 4JIIX 3GB6A 8TIMA 3D3AA 3TYCA 1V51A 4DBUA 3SFKA 2R94A 3ZWSA 1DIKA 3TR2A 3G3DA 3GTFA 4IMDA 3AXIA 4BWLC 1G5AA 3SN4A 5DLCA 4RNFA 2V5KA 3EPOA 2YCJA 3UW6A 2ADAA 1J96A 4RX0A 3URAA 3QLDA 3QM3A 1F4HA 4W5UA 1SO4A 2FFCA 2G8ZA 3CMJA 2EPMX 1FDJA 1EJRC 3ZWTA 5A8NA 2XN1A 1H7XA 1JXJA 1P6BA 5CPMA 5FJIA 4FSAA 3LNPA 4XAYA 3BOLA 2I5QA 3F5KA 4HA3A 2OWXA 5FOOA 4ZODA 2Z1VA 4U28A 4Y9OA 2PRLA 3GR8A 2NVCA 1A5NC 3TJXA 1XSJA 1E4IA 2AGKA 2VZTA 2PDPA 3DHFA 4QG9A 2YCLB 4DWSA 3H21A 1CIUA 4HJWA 3WLTA 2GWGA 3C5QA 4LUJA 1X98A 1QWGA 4PCNA 1TO3A 2QJGA 3IJLA 4C6KA 1UB3A 1DJWA 2GDQA 2UY2A 3SADA 4J27A 2PLKA 3AHVA 4LEFA 3O06A 5D8WA 1Q7QA 3RXZA 3AS1A 2GGJA 1TJ1A 3AIQA 1XYMA 4O1EA 3BAJA 3V1PA 2VX7A 3WD4A 1A4LA 1QNVA 4QHRA 3P67A 2HNHA 5DCEA 4JN7A 1A5LC 1EX5A 5C2GA 4N9EA 1CDGA 3E0IA 4RE0A 4M81A 5E9XA 5DMNA 1E1CB 1KBKA 5DMMA 4B16A 3ES7A 3OBEA 1H7RA 2BGNE 2POTA 2QCNA 3RFAA 3WO8A 3MI6A 1NDZA 4A3QA 2J24A 4HHHA 1XHGA 1K6WA 2E8ZA 4KF1A 3WH5A 4CNOA 5DY3A 4HOXA 5CBJA 1XBXA 4QCEA 3BK0A 3EOEA 3KAOA 4ZL1A 3SQSA 4BK9A 4ZOCA 1ECQA 3PHAA 1IR2A 2A21A 3G24A 2IXUA 4PMOA 2OG9A 3AMGA 5D02A 3LK6A 2EBNA 1R38A 3QXBA 2ZDRA 5BXPA 3TQKA 2HE5A 2OPJA 4LBRA 4D9PA 3W6YA 4JEQA 4Y8FA 3LTSA 4IFKB 1TCMA 4UFHA 4BI6A 1PDZA 2VC9A 3COTA 3ELFA 3C56A 1KCXA 1K6AA 1CGWA 2WMIA 5XIMA 1Y0EA 1EBGA 2FZNA 3LHZA 4CD5A 2X7WA 2Q3OA 5TAOA 4C6JA 2FZ8A 4W93A 3GY1A 4FOJA 1DJXA 1PX8A 3LSBA 4E3VA 5JQ9A 1IZCA 1EF2A 3J7HA 2HSAA 5JVLA 1MFVA 2Y88A 1Q8JA 4XX6A 1F2JA 4AG0A 4V1XA 1XYAA 2O9TA 2Q09A 3IANA 2ASHA 1VCGA 4JAWA 2C3ZA 1WZLA 3EXTA 3FAWA 2BTMA 4H19A 3LHYA 3D5HA 1XGEA 1JFHA 3W7GA 1IT0A 3M5XA 1W9PA 1R47A 5HOSA 1ZJBA 2X8RA 5HUOA 5A6LA 4RKAA 2G3IA 3UP8A 2ZWYA 2YXGA 4UQCA 5ECVA 3MVTA 1W2PA 3MSGA 4HNOA 3OW1A 2CZFA 3PZ9A 2GGHA 3WJWA 5E0KA 3N9SA 2QAFA 3F7JA 1WDSA 4HYWA 1RR2A 4MDPA 4GYKA 4WJXA 1RCOB 3IAPA 1XYFA 2E28A 1BRLA 1PVNA 1G01A 1MQPA 3LCFA 4H6QA 3UPWA 2OX1A 3UVIA 4DJFC 5AYXA 2PRHA 1OK6A 2YSWA 3BO9A 4D1IA 3DIPA 3N2XA 4GKTA 5EFDA 4AY1A 3R13A 1XI3A 1UIOA 1ALDA 4U5KA 4YTTA 3DGRA 4C1NA 2X30A 1V6YA 2VGBA 2NV1A 1S5NA 2FHBA 3WLSA 1EJXC 4HMCA 1NFPA 1KM6A 1WXZA 4J3XA 2D22A 2YPIA 4L1GA 2UV8G 2FPYA 1DWFM 1X96A 3NZRA 4N9BA 2VOTA 1C8YA 3O7UA 4US5A 2WWDA 3IJ6A 4NZJA 3NAVA 2JEQA 4C6LA 1M65A 5H8MA 5CJ5A 1B54A 1KFLA 4PUDA 3BLFA 1C29A 3FEQA 1VLWA 1BWVA 5I3IA 1GOIA 3M6YA 3SUTA 4MF4A 2JE8A 4OOUA 4CQAA 4CQBA 4AZCA 2ZRXA 2TSYA 1NU5A 3OLEA 4ROQA 4R88A 5C2XA 3C86A 1TV3A 4DZAA 1LWIA 1LQAA 3PUGA 3VD3A 3NOEA 4QLLA 1SW3A 2XYLA 1U83A 1WDQA 1EDQA 1PHQA 4KFPA 2G4JA 3PZOA 4AWEA 4IM4A 4S2CA 3AO0A 1VR6A 3CPGA 4U3CA 3CIVA 3KRSA 1NSJA 1VFSA 2BX7A 2W5FA 5D9MA 4HU8A 1AFSA 1KM5A 5EY5A 2E1DA 2WV8A 5JH2A 1XIEA 1PS9A 3AISA 3QFWA 4NRRA 4R9OA 4UOZA 4O1CA 3QY8A 2QF7A 2FYMA 1TKKA 5IFTA 1YE6A 1V0NA 3E5PA 3TOYA 4DM1A 3WDHA 5I00A 2IKJA 2JGQA 1Z7AA 4TVDA 1CT5A 1EJ7L 1R3TA 4ZQOA 3W2UA 1S5MA 1NEYA 4RDVA 1J0JA 4Z17A 5C54A 3WUEA 4LAOA 2DJXA 3OVRA 3KW3A 3GIPA 1YNYA 2FB2A 4ZENA 3O9NA 5A6JA 2ALRA 4TVUA 4GPNA 1GORA 3ZSTA 3AXHA 3W87A 3V18A 3ANUA 5CPNA 3LLDA 5K9XA 4IICA 2JKAA 3RLGA 3KWSA 3LV5A 1BVNP 3VIIA 2FPTA 5FSEC 4MSSA 3VUPA 1EB3A 5EA9A 3WLNA 4IOTA 2Z1XA 1WV2A 3BJFA 4AD0A 4CUCA 2NXIA 3FJ6A 4O52A 4UCFA 2BY3A 1QNOA 3ITLA 3GZAA 4M1BA 1DEDA 1B30A 3MB9A 4EOUA 2Y7GA 3NQ7A 1M7JA 2Z29A 4AF0B 1VBJA 1JAKA 5D8ZA 1B4EA 2VRQA 4C6NA 4CQCA 2XIMA 1MDLA 2Y85A 3EWWA 3LBMA 4AD5A 1DP0A 3H23A 3B8UA 4E8DA 2WPGA 1CGUA 3TWBA 3L4TA 4ZQCA 3T0DA 3CBWA 4GMEA 1SFLA 3R5EA 4MLJA 3IIVA 5E70A 4DLFA 7A3HA 3TCSA 4LB4A 3JVAA 2YGYA 1TR1A 8CGTA 4A05A 2XHYA 3O3RA 4F66A 2J79A 3CL7A 4PULA 4YCOA 1JDAA 3GVRA 3UJ2A 4NNBA 2CIPA 1QNSA 1SU5A 1BVWA 2RJGA 3W2LA 1ZCOA 2E77A 3CZLA 3AYTA 4IP7A 4O0QA 4LUSB 3V75A 1CCWB 4RE2A 1YDOA 3G77A 2VDHA 3AIWA 1UD6A 4DF1A 3N13A 3IVTA 4GI9A 2W6RA 1D7FA 2V3GA 4PR4A 5LA1A 4NRSA 4Q4KA 1DPMA 3U0HA 2ZA2A 4I9JA 3IIZA 3DH7A 1ISWA 2E0PA 3QV9A 4MUZA 2VRKA 4FLSA 4AIOA 3B9NA 8XIAA 2DP3A 3EWUA 3TN4A 4FZIA 3ARZA 1EOKA 4UQAA 2ON3A 2V5DA 3CM4A 3R25A 1S39A 1D8CA 4WKHA 4JY8A 3S8HA 1P1MA 1A53A 4GZJA 3BLIA 3GHUA 4LANA 3TSDA 3P14A 2HBVA 1GYLA 4UQBA 3NQ8A 3PWIA 1QWKA 3NO1A 4DAIA 4MWAD 3APGA 3I6EA 3ABQA 4CEXC 4KW2A 3W23A 2C1GA 2IXVA 5HWNA 4JTQA 1OFBA 3S2JA 2Q71A 1EJSC 1L6SA 5LHEA 1UKQA 4LQ1A 2E3ZA 3T2PA 2BGQA 2YDAA 4FXRA 4JTLA 4LF2A 4A3YA 3FW6A 5FJJA 4N9DA 2E5CA 3VKKA 2NX3A 4QROA 2VEKA 1W3KA 4AHQA 3LB0A 4QDMA 3HMCA 5E0CA 4NXSA 4PMVA 3NM1A 2CLEA 4OV4A 2PWVA 1UZDA 3HV9A 1ZQ5A 4I8DA 4DJED 3HO8A 5K2ZA 4AZHA 4UMCA 3PSVA 1OF8A 4JOMA 2NWSA 2DVTA 1A0EA 1QOQA 3STPA 4HHPA 3K46A 3CZKA 1PCKA 2C19A 3WNOA 5JIPA 1VFMA 4HNCA 1F73A 4ADSA 2DPEA 4LBUA 3A9IA 1Q2SA 3IRSA 1E71M 2IS7A 3M0ZA 1BLIA 5F2IA 1EJTC 3WK1A 1UH3A 3UESA 1EGMA 1R7AA 3V5OA 3IK2A 2TYSA 3MP4A 4UC5A 4WSKA 3M0JA 2J9XA 4LUTB 1ZU8A 4H83A 1O5XA 1JJKA 4AWTA 1YBQB 4UB9A 4FMVA 2PMQA 2DV0A 1T41A 3TA6A 3RLUA 1Z9AA 1DE6A 2R24A 5CZKA 4O14A 4HSNA 4CNUA 3PZQA 3WKZA 4GO8A 4PA8A 1HIZA 3LRKA 3UR5A 3CHFA 4G7FA 2E6YA 2OX4A 3U2EA 3G6LA 2QCDA 4ZO9A 3GIQA 4RDZA 1ZJIA 2F61A 4W7WA 4AU0A 4GIAA 3VDHA 3RPDA 2H8ZA 1JPHA 3UA4A 4CEUC 4Z2JA 1V6WA 4GZEA 4LVBA 3UXLA 4CU6A 5ABHA 1NP2A 3GDTA 2XIBA 3TH6A 4JFTA 1RV8A 3IUDA 3VKBA 4GINA 5JU6A 1HO4A 2PDFA 3NM3A 1E0XA 3FIGA 2OSWA 3LQGA 4CGTA 3ME3A 4M82A 4ICMA 3PAOA 3BGJA 2D69A 5BCAA 5HANA 3EEZA 4H00A 4P8XA 3AXXA 1KKOA 3GXDA 4QJ3B 1FTXA 4JTCA 3RR1A 3KHJA 3N73A 1JUEA 2OLAA 3D47A 5A8GA 3TZNA 2QPXA 3CUFA 3DYPA 1IT8A 3LQLA 2XVGA 1TYGA 1TV2A 1S1PA 4DO7A 2GLKA 5I3DA 4IMCA 1VFOA 3VCNA 4DI8A 1P48A 1FCQA 4Q8NA 3M5ZA 3CT7A 4W87A 1RQEA 3CV7A 3OB8A 2P5NA 3ECQA 2REQB 1M53A 3POHA 2GFTA 1CEOA 2QCHA 1T8XA 1K9TA 3UEQA 3RMEA 4QP0A 3Q4DA 1YKWA 1R0MA 4HJFA 4IXXA 2XJ7A 1U22A 4AAJA 4MZYA 3MANA 4H6RA 4A21A 5L9FA 1C7SA 1D3HA 3GU1A 3NZGA 3MHGA 3VCRA 3OA5A 1LRQA 4XZWA 1XC4A 4LYRA 3WLQA 5LGZA 2OQLA 1WDDA 1B3WA 3G1YA 3GFXA 4JTFA 1EEXA 4B5XA 1JF5A 4TU1A 4MWAA 3VGFA 4P7NA 1S2UA 1TE1A 2BODX 3OHMB 1GW9A 1V08A 1ZB5A 1W56A 5BZAA 4IPJA 4LAKA 2IPGA 2D0HA 2ACQA 5EU9A 1F3TA 3HJEA 2PA6A 2O0TA 1VEOA 1OT2A 2XINA 3AIEA 4LCSA 2FGBA 4LAUA 4LVAA 4DJEA 2DSVA 1Q6GA 2NV9A 4IJBA 3TIMA 1FWTA 4HGXA 1L0PA 4M6PA 4N9CA 2OELA 2RDWA 2QPSA 4QG6A 4K1GA 3UJSA 4J40A 1TV4A 3U2CA 1RJQA 3VU2A 3VX1A 2ZZ2A 3OVQA 4YWSA 4PN2A 1EC7A 3EKGA 1VD6A 4UCGA 3CB8A 2QVHA 2Y61A 4QJ1A 4E2DA 2DUAA 2Y7FA 1WB0A 1VH7A 2ZX5A 1CGVA 3U8GA 2PP1A 4IFRA 2NV2A 3GM8A 4QXIA 1LL7A 5CSUA 1WZAA 2V2HA 4WDTA 2J78A 2IUZA 4H2HA 2VGFA 3VIMA 3AXKA 2CZDA 1FXQA 5FF0A 2XFWA 3IVSA 1SZFA 4UTUA 4FPSA 3VD9A 2WNZA 4AFYA 1EL3A 3TW7A 3EMZA 1ZENA 3CL8A 1TVNA 3GU2A 3OIHA 3UJFA 1X7IA 2WSQA 1BD0A 3TFCA 1TPH1 2KAUC 2C13A 4YU1A 3MS8A 1HJUA 2YCEA 5B7YA 2WBGA 1EHNA 4L9ZA 4QS6A 1IT7A 2OT0A 4PL2A 1LOSA 3ITYA 4IIHA 1FA2A 2Z0IA 1V0LA 1XIJA 1TZ7A 4D72A 4WKAA 2XPKA 1RA5A 3ES8A 4NXKA 4NAFA 3IV3A 4Y2WA 3PB2A 1A5SA 2XFYA 1PIFA 1G4TA 5GPRA 3RX4A 3NJ3A 3EZ4A 4Y9AA 4P5UA 3UWQA 2FPVA 1AL8A 4K36A 2XN2A 5LSMA 1T99A 1XYBA 2WM1A 4F48A 5MKGA 3VVGA 3NURA 5FEWA 1RCXB 1TV8A 1OVDA 1SZEA 4HZ8A 2O9OA 3A24A 2AQOA 2O56A 3PWGA 1E40A 2J7EA 4PMJA 4OQVA 1EP1A 2WC3A 4NZCA 3I7QA 3ABZA 2DZWA 4NZ1A 5KITA 1TA3B 4UR7A 3NA8A 4NJKA 9RUBA 4GC4A 3I68A 2Y0FA 3UCQA 5XIAA 1E0UA 2Y6ZA 3S2LA 5FF3A 1MRAA 3WLOA 4BI5A 1A80A 1JGIA 3K2GA 4GXMA 3MSRA 1ISYA 4Q22A 3A4JA 1UA7A 1BWKA 4ROPA 1DIEA 1VQTA 1XV8A 1ZPTA 2W79A 1TQJA 3GXFA 4D8ZA 5AN7A 3EXSA 3DYMA 3TXVA 1R86A 1N2VA 4Q3MA 3S5OA 3WLPA 3EA1A 1W5PA 2OU4A 2AOSA 3EMQA 3L4WA 4O15A 2PRMA 4HHMA 4MKNA 4MNMA 4K8GA 3ATZA 2BY2A 1TJ2A 3M7WA 3N4AA 4QQ3A 5I79A 2QPUA 1F5ZA 3QMTA 3M46A 4WCJA 3MUIA 1R46A 4K68A 4A3HA 1PWMA 1DWIM 1EJUC 2P53A 3NL6A 3S47A 3UJEA 3EBVA 1PCWA 1I1XA 3T05A 1K1DA 5CGMA 3GC4A 3QYQA