5BRQA

Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea)
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
555
structure length
555
Chain Sequence
b'NPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDNGYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKEAASGKENLYRDFYIWKDMKPNGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYEMMHFWFEKGIDGFRLDVINVISKDQRFPDDDEGDGRRFYTDGPRVHEFLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNFHHLKADYPNGEKWALADFDFLKLKKILSEWQTEMNKGGGWNALFWCNHDQPRIVSRYGDDGKYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRILKEAGKPEAEIIEILKAKSRDNSRTPVQWNGEENAGFTAGTPWIPVPDNYKEINAEEALNDPDSIFYHYKKLNELRKEFDIITTGDYQLILEDDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIEGYDAKVLISNDTDLPESFKRFTVKPYQSIVYHLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycoside Hydrolase Family 13
publication title Bacillus licheniformis trehalose-6-phosphate hydrolase structures suggest keys to substrate specificity
pubmed doi rcsb
source organism Bacillus licheniformis atcc 14580 = dsm 13
molecule tags Hydrolase
total genus 209
structure length 555
sequence length 555
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.93: Alpha,alpha-phosphotrehalase.
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5brqA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5brqA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 5brqA02
2PI6A 1BTCA 3VGEA 5E0CA 1XRVA 2YLAA 2EADA 1CENA 5CGMA 2YBTA 3CZJA 3GYCA 1LG2A 3SUWA 2WMFA 1C8QA 5M03A 2FE0A 4DM2A 2IXUA 2W4XA 3PZUA 3TOPA 5ABHA 5JBEA 4LQ1A 3WH5A 2J74A 3SUSA 1FH8A 2X0HA 3N17A 4AISA 1VRXA 3ARQA 5I5RA 2B31A 1CXLA 2J79A 3A24A 2JF7A 5HDRA 4CD7A 1E71M 1FP9A 2XN1A 2GUYA 4C7GA 1MW0A 1ITXA 4YN5A 1W3HA 5BROA 3MI6A 1B3YA 4UOJA 1TUXA 1W9DM 2YIHA 1WNOA 3U7VA 3UETA 3MANA 1UG6A 3W28A 3BLKA 1Z32X 1XYFA 5BYWA 2Y8KA 2HISA 3L4UA 1R87A 3PBGA 3O6AA 4CD5A 5A6LA 4M8UA 4Z2KA 1ZJBA 1JZ5A 1NWUA 4IPNB 1EDGA 4L4OA 2WANA 3WH7A 1V0KA 3VTRA 3I3DA 3A23A 1UWIA 4GI8A 2YOCA 2WMKA 4P8XA 4WKHA 3BUIA 3LXAA 1VAHA 4JFUA 3VDAA 3HG4A 1I1WA 2VT0A 4XUYA 1HJWA 2XHYA 4XZWA 3BUQA 2WMHA 1GOKA 1ISXA 1TQTA 3WSUA 1UKTA 2BHUA 1W1YA 2YJQA 3EDEA 3MSDA 2A3CA 5KZ6A 3VIKA 4F66A 3EJQA 2XGIA 3UG5A 2DSKA 2GK1A 2VC9A 5FIPA 4PEEA 3K1DA 1GVIA 3WENA 1Y7VA 2EACA 1EHNA 1E15A 1H41A 3W6MA 4C7DA 1CGTA 2NSXA 2Y24A 3L4WA 1HVQA 4JFSA 3VMPA 3VPLA 5CPTA 2BS9A 2D0HA 2X0YA 4E8CA 1C3FA 3FHAA 1UD6A 1CXHA 4MNLA 4NXSA 3AIEA 1V0LA 5CSUA 1WDRA 4MTVA 3K46A 4JCLA 2WZEA 4IISA 2CEQA 2UY3A 3CTTA 2VX4A 1PEZA 4BF7A 5I23A 4PTWA 4W8AA 1UHVA 4UQBA 1NP2A 2F18A 1BAGA 3S5YA 4AC1X 5LA2A 2BY0A 3RM9A 1DWGM 3CO4A 1CLXA 2VCAA 4NRRA 1AQ0A 1QHZA 3MMWA 4B9YA 2CBVA 4PMQA 1X1NA 5A94A 4U5KA 4AZIA 1KWKA 1JI1A 1GQIA 5A6MA 4BZYA 3T08A 2FYVA 3NSXA 3LX9A 4D6FA 4AD1A 4QCFA 2EPOA 4PMDA 1BQCA 1R33A 3HMCA 1VENA 2DT2A 2VX7A 3IJ9A 2W63A 2O9TA 1PJ9A 5D9MA 3D5HA 2VO5A 1J12A 3IJ8A 2W92A 1K9EA 3M46A 1C8YA 4MDPA 3ZR5A 1J01A 1E70M 2BXYA 1JZ3A 2BHZA 1XCWA 1JYWA 8CGTA 1J9YA 1D3CA 3ZJ8A 4JHOA 2F1BA 4OGZA 4TVCA 2X05A 1J0ZA 3MKKA 4D72A 4HMDA 1CGUA 3VD7A 2JEPA 5HOSA 3OLEA 1ZBKA 1VB9A 2ZIDA 1HXJA 2WC3A 3UG3A 5CQ1A 1OGBA 1DWJM 4UCFA 3AHYA 2J7CA 4L4PA 3WN6A 3QHNA 2ZXDA 1KR0A 1S46A 2J75A 4W7UA 1SR0A 2EBNA 4J7RA 3W29A 3ALGA 1H0GA 3F5JA 2F7PA 4WK9A 1HXKA 2CPUA 1CGVA 2G3MA 4LX4A 3VSTA 3BVTA 3FW6A 2WVTA 4D71A 1KXVA 3MMDA 3ZSTA 1W91A 3PZIA 2V5DA 1ZJAA 2JFEX 3CUHA 1OGGA 2CCRA 3GXTA 1V3LA 3HG3A 1Q6FA 4D6DA 2WKLA 1CBGA 1E4LA 1K9DA 3SCTA 4NRSA 3EYPA 3S5ZA 3CUIA 1IT0A 3ARTA 3A5VA 3CMJA 4PTMA 1DWAM 3GM8A 3FN9A 3IJ7A 4H2CA 2WWDA 3NSNA 6A3HA 2WW5A 1VF8A 2Z1KA 2WHJA 4KRTA 4F79A 3AIQA 2DSWA 5A69A 1X6LA 2PC8A 3VNYA 1AQMA 2C8NA 3DX3A 2VCBA 3WQ5A 2W61A 2VZSA 1Q6DA 3AZSA 1KXHA 4KWUA 4EKJA 4C7FA 4N0RA 3MV11 3MUAA 3T0AA 2PB1A 1M7XA 3QOKA 1J0HA 2VURA 3ZMRA 4U2ZA 3MUY1 2PWEA 4B15A 1ISZA 1JI2A 3WIJA 2E0PA 2AAAA 2OW6A 3CHCA 3WQVA 3CHFA 4DM1A 1DP0A 2FDMA 1QWNA 3TTOA 2CERA 2Y4SA 1W3KA 1CXKA 3KZSA 1LL4A 5AC4A 1WPCA 4KGJA 3AQUA 3GNRA 1B90A 4MNMA 2GJPA 3FHQA 3OGVA 1H2JA 5GNZA 5JIWA 4GQRA 2YL5A 2F7RA 2YDRA 3M7SA 4BA0A 1JF5A 7A3HA 2BFGA 2XFFA 1ESWA 1KGXA 4IUGA 3O9NA 5AYBA 2J7DA 5A6AA 5M5DA 1E4MM 1WZAA 1DTUA 3WFLA 5E9AA 1JFXA 1B9ZA 1E73M 5BWFA 4JFVA 1UASA 3A6OA 2PWDA 3RCNA 4OJYA 2VX5A 3ARZA 3F5KA 5JIPA 3A22A 1C92A 2VNCA 2XN2A 4M81A 1UR2A 2WB5A 3BVVA 2W62A 3ZT5A 2WCGA 3PN8A 3AIUA 2CBUA 2G4FA 2GJRA 1GJWA 1TZ7A 4XB3A 1U33A 5ABFA 1CPUA 2CXGA 4HOWA 1ECEA 4H41A 1TCMA 4M29A 4BQ5A 2UY4A 2WBKA 3LPFA 3OBAA 3EMQA 3SUUA 5TD4A 5IHSA 1V6YA 1TQWA 1UR4A 3WUEA 3ZIZA 2J7EA 4MJ2A 4TXEA 1XSIA 3GXDA 2C7FA 1CXFA 1GQLA 4B3KA 2RGLA 2BVYA 3KLKA 2W67A 2D3NA 4EAMA 1M01A 4UFLA 1H4PA 3JUGA 4HMCA 3SCWA 1JDDA 4JCMA 4HOZA 1FP8A 3MUIA 4P8WA 1UR1A 2J7FA 3VOCA 1E6PA 2PWGA 4OIFA 3MU7A 1KXQA 3B9EA 1HTYA 2JEQA 1NWTA 3OB8A 3SEPA 2WHMA 2ZOXA 3GNOA 3CPUA 1HP5A 1VBRA 2BVDA 1Q4NX 2WVVB 1FH7A 1KB3A 3ZOAA 4AZ7A 2VL4A 5D9PA 1BVNP 1LF1A 1UH2A 3GXIA 4LPCA 3OLIA 2WWCA 3AISA 3CC1A 5I77A 1OIFA 3VDHA 3POHA 4AZ5A 1CYGA 3SUVA 3VO0A 1C90A 1HKIA 1D7FA 4M82A 2D22A 3NIYA 4NXKA 4W86A 4AZCA 5A8NA 1VFUA 3WH8A 1JYXA 2F7OA 2E8ZA 3T2OA 1XH2A 1A3HA 1H5VA 3WNKA 4A3YA 4U33A 1ZS2A 1V3HA 1FA2A 1GORA 1B3ZA 3BH4A 1OD8A 5E0FA 1HJQA 2YDQA 3QOMA 3ALFA 3UESA 2WVSA 3ARVA 1FFQA 1OINA 2VZOA 4PTVA 3AIVA 3H54A 3WDQA 3WQ8A 3DDGA 2G3JA 3VSVA 2WNWA 3ARWA 3WFZA 3SCQA 5FCZA 4TX6A 3WF3A 1E40A 4PSRA 3AJ7A 5DFAA 1J0YA 4H04A 3W25A 3BAIA 1V0MA 1XC6A 1GJUA 1E5NA 1BHGA 2UY2A 3WQ4A 4ATLA 4PUEA 4H8HA 4PMXA 4CD8A 5HPOA 4ACZB 3M6DA 3QGVA 4RL3A 3RM4A 2IGTA 4DO4A 3AFBA 1FOBA 3WUFA 5LA0A 1HL8A 2VQTA 2V3DA 4JAWA 1GOMA 1ITCA 4D6EA 1GOOA 3THDA 1KTCA 5A2AA 3VGFA 3PZOA 4AD5A 3HZ3A 1BLIA 5E1QA 3H55A 4P7LA 1KBBA 5ABEA 2FHCA 2DT1A 1T0OA 4QP0A 3H53A 3N9KA 1IZJA 4W89A 1W9PA 3U5YA 4MB1A 2CNCA 3WH6A 1W9VA 5JUVA 2GFTA 4CCDA 5BCAA 1EOKA 4ATDA 1JZ8A 5CZKA 2QLYA 3AMCA 3AMKA 1CDGA 3W6LA 4NSBA 4U2YA 5ABGA 1H49A 1SMAA 3NDYA 4HA3A 5IFTA 3BCFA 3EDDA 4PYSA 3TTQA 4OZOA 1V02E 2FH6A 1ODUA 4WLCA 3NCOA 3AYRA 1OSEA 3FXYA 2WSPA 2WBGA 4MNJA 5ECUA 2Y5EA 4OBSA 5D8WA 4CN1A 4D6HA 5CG0A 4IM4A 4NZJA 1XH0A 3VIJA 1CGYA 2NT1A 2YFNA 5LYRA 2CESA 2O92A 3UR8A 4GI6A 3WD3A 1UKQA 2W5FA 3VGGA 4N42A 1UH3A 4W8LA 2XWDA 1VEPA 1KFWA 1NWSA 1ISYA 3TV8A 1LG1A 1NP0A 1JDAA 1F4AA 2WC4A 4Z2LA 4QLJA 3T2PA 4CCEA 4WSKA 1J0IA 3WNLA 3WBEA 4TUFA 3J7HA 2VQUA 1GVYA 1V6UA 4GZJA 3RPMA 1MFUA 4KMQA 4PMUA 2G8ZA 4CD4A 5JBFA 3VMNA 3AYSA 1V03A 4JHZA 2XPKA 3N13A 2YDSA 2DDXA 4HTYA 3CUGA 1CLVA 3U5UA 2FHFA 1OT2A 2XVLA 3W81A 3BUPA 1G5AA 1J10A 5E6ZA 4CU8A 1KGWA 4UFHA 5BRQA 1QPKA 2VMFA 3LPGA 3B8SA 3F5LA 1JXKA 5KEZA 4CU6A 4GO9A 3PZNA 1QBAA 4UFJA 1YQ2A 3K8KA 1UZ4A 2DH3A 2DSUA 1V0NA 1TE1A 4HZ6A 1R7OA 4TVDA 5I0DA 3N11A 2E9LA 3GDBA 3L4TA 1WP6A 4ATWA 2V3GA 2OYMA 3DX4A 1IV8A 3CH9A 3MUZ1 2ZXBA 3LPOA 1E5JA 3WD0A 4MB4A 1JD7A 1FH9A 1PZ2A 4AYSA 4MADA 4BQ3A 4XZBA 2YA1A 1UUQA 1LQ0A 2VZUA 3RO8A 4W8BA 2XFYA 2VZVA 4M24A 1E6NA 5A6BA 3RMEA 2DIEA 1R8LA 5I3DA 5M3WA 1OB0A 3DX0A 3PZVA 2A3HA 5AY7A 3LXBA 1AQHA 3K4DA 5EB8A 2EPKX 2WMIB 4KRUA 4OUEA 1L8NA 4PN2A 2CHNA 1QNSA 1JNEA 1TR1A 1P6WA 2E9BA 1QVBA 1GQJA 3T09A 2BNJA 4S3JA 4B3LA 1V3JA 3LRKA 2D2OA 4J28A 9CGTA 8A3HA 2OYLA 1K9FA 2YA0A 5BRPA 3TA9A 4GKLA 5LA1A 3L4VA 2WM0A 2X2JA 2XSAA 1B2YA 3ZJ6A 1CXEA 3EDFA 3UG4A 4M80A 3GNPA 3QR3A 4M1RA 4D6JA 1NOFA 3DX2A 1QNRA 4GINA 3CZGA 4BQ4A 4HZ7A 2OSWA 3VIHA 3HG5A 2Q8XA 4UFMA 4D6GA 1MW1A 3CLWA 1PIFA 3IK2A 3OA5A 1E3ZA 1OBAA 4XX6A 5DT5A 1HVXA 3N18A 1HT6A 2BY2A 1MW3A 2V3FA 3EMZA 4PSPA 4V2XA 2J77A 2X2YA 1KBKA 5D8ZA 3AIWA 4DWSB 1QBBA 1ISWA 2BXZA 1ZB5A 1PBGA 1E55A 3WL0A 1EGZA 2CKRA 2F8QA 4M56A 3BAXA 4ZXOA 3G6LA 2J7BA 4JIEA 2NT0A 3KL3A 4IPLA 4Q22A 4D1IA 1H3GA 5DT7A 2ZUVA 1EIBA 5A6JA 3WMSA 1R34A 1B3XA 2OLHA 3U57A 2ZX6A 3VGBA 3AROA 5GQBA 3I3BA 1V3MA 3AXHA 3TP4A 4UOZA 3VINA 4YHGA 1WDQA 2QPSA 3DX1A 4KH2A 3BAJA 4FK9A 3EJTA 3AMGA 4P8UA 1WAWA 4UNIA 2DT3A 1DWHM 5CPQA 4NZCA 3TTYA 3NJ3A 4MB3A 3WEZA 2OWWA 5DMYA 2G41A 3AIBA 4PBGA 1JXJA 1EA9C 1RP9A 1W2VA 5A95A 4AD0A 1G94A 1UYQA 2YL9A 1CWYA 3WY1A 1GOWA 3PZQA 2GDUA 1CXIA 3OGSA 5CLWA 4AZHA 3ZT7A 3F4VA 3VM7A 1LWJA 3VX1A 2A3BA 1BYCA 4U5IA 1K9TA 2XFRA 3IANA 4MAVA 1C93A 3CUJA 3VVGA 1CGWA 1AVAA 1US2A 2RGMA 3PTMA 4DUVA 3RILA 3AS1A 2CETA 1HF6A 2XG9A 4AD3A 1QHOA 3EJUA 2DPEA 3BLPX 1G1YA 3BUBA 1HKJA 3SURA 1VFOA 1M04A 3EMCA 2QMKA 1UA3A 2ZICA 4PMVA 3L4XA 4CVUA 2OW7A 4PMNA 2W66A 3ZT6A 4AYGA 1JNDA 4E4PA 4MAZA 3WF0A 2BHYA 1LL7A 2ZX9A 4TVUA 4QFUA 1ZBCA 1PS3A 1UD4A 2UY5A 3D3AA 3D4YA 1JAEA 4AIUA 3OLDA 3ARPA 1H09A 3D50A 1HNYA 1UKPA 3CMGA 4UR9A 3ZQ9A 1TA3B 4F9DA 3N12A 1K6AA 1GPFA 5EMYA 3AXIA 1CNVA 2G3IA 1VEMA 2OWXA 4HMEA 1PZ3A 4BCEA 3L2LA 1CGXA 4AZBA 3NUKA 1WCGA 1UWQA 1JYVA 5CGTA 1BG9A 2XGBA 3CZSA 3TONA 1LWHA 1WDSA 1CIUA 1CECA 4ZFMA 1E56A 1N82A 3AHZA 4A3HA 2ZE0A 2XVGA 1UKOA 2F7QA 2ZUUA 2VR5A 3BSHA 1E72M 4WJXA 1G9HA 4FLOA 2F61A 1E0WA 1GNXA 2OYKA 1MYRA 5A8OA 4E2OA 1W3LA 3PZMA 1MXDA 4QLKA 1H11A 4S3KA 1B3VA 3OLGA 4UQEA 2D1ZA 1DWIM 3AZTA 1NOWA 2D0FA 2Y2WA 2W91A 1IZKA 2EO7A 4W7VA 4X9YA 2YL8A 1HJUA 4J3SA 4PMZA 4MB5A 1TMQA 1CTNA 1LL6A 1OIMA 2A3AA 3PTKA 1JF6A 3VDCA 1QNQA 4NI3A 1DWFM 3IAQA 4AD2A 4CN4A 2ZXQA 3WQ6A 4WF7A 1QWUA 2IXVA 3HG2A 3VSUA 1KQZA 2GJXA 5CSYA 3ARXA 5A6SA 2DSZA 2D73A 2Z1SA 1US3A 3VIPA 3VGHA 3VNZA 1TG7A 5M17A 3VIMA 2FH8A 1EO7A 1C7SA 3VD4A 2D24A 5ABFB 5DO8A 1B30A 1FHLA 3PZTA 1DEDA 2ZUNA 1UWSA 1BGAA 4YHEA 3A47A 1KWGA 4TX8A 3VDBA 4B16A 3FAWA 1OT1A 3CZ8A 2VX6A 2D20A 3VU2A 1UD3A 1D2KA 3N04A 4JKLA 1WB0A 3MMUA 3ZR6A 5BXTA 3LRLA 3KL0A 1QI5A 5A6BD 2EXOA 2XIBA 2QV4A 1WZMA 2FHBA 4U3AA 3AS3A 2WZIA 2DIJA 3WUBA 2GDVA 5HBFA 2F1AA 2EPMX 2GVYA 1U30A 4W7WA 2VZTA 4Z2HA 3LMYA 2YA2A 2X09A 4P7OA 4TOQA 3FY1A 1TQSA 3RJXA 4OOUA 1XSJA 3UCQA 1UA7A 2O9RA 5AYIA 4MJ4A 2E40A 4W87A 3VUPA 3CZLA 2EPLX 3VMOA 1V08A 1ZBWA 5HXMA 2GSJA 2YL6A 1F4HA 1O7DC 3OIHA 1QI0A 1QHPA 5BXSA 4FLQA 1B1YA 4W5ZA 1OGSA 4P7RA 1MVYA 1FHDA 3EDJA 3MO4A 3AXXA 1QW8A 1QI3A 1X6NA 1UR0A 1UD5A 3K4AA 4R5EA 4W85A 1JFHA 2FGZA 3BMWA 3HN3A 5HPCA 5GPRA 4OBRA 4J3UA 4ZE4A 3W82A 4FNRA 4BQ2A 2ZUWA 2VI0A 2ESCA 1L0PA 1HN1A 1PX4A 3BC9A 1W1TA 2VRJA 4HOXA 4Z2JA 4ML4A 1E4IA 1RH9A 4X0NA 2XYLA 3AOFA 2ZXAA 1MWOA 1V02A 1NH6A 4LGXA 1QI2A 2PBOA 3LRMA 2JALA 1JDCA 3GH5A 2F2HA 1V6XA 5D4YA 1OCQA 3GXFA 4CN6A 1W9BM 1XD0A 1CEOA 1BSIA 3B9DA 3GBEA 2DH2A 4HA4A 3CBWA 5DF0A 4AEFA 4Z2GA 4BS0A 4AXNA 2WKGA 4DUWA 4PUDA 1W1VA 4URIA 5IXEA 4UFKA 4D6CA 4AW7A 4OOZA 4E8DA 1WO2A 3A4WA 4LXFA 1JZ2A 1NOUA 1O7AA 5FOOA 4AD4A 4CGTA 1BYDA 2CKSA 4LYPA 2VCCA 3RM8A 2WCAA 3W26A 1W1PA 4GXPA 3A4AA 4AWEA 1JD9A 1E3XA 4LYQA 2OWCA 3IAPA 3FNDA 4GO8A 1H1NA 1UR9A 5EFDA 2WZHA 5C70A 3W4RA 1KTBA 4GQQA 3WD1A 1J11A 5E70A 5FL0A 1BYBA 5IHRA 5F7UA 3POCA 1SZNA 1HX0A 2AMGA 1JAKA 4CUCA 2J62A 3UERA 3WKZA 3SCSA 2VVSA 2ZX8A 3LPPA 1EO5A 3AS0A 3ECQA 3T0BA 3DHUA 1J0JA 3I3EA 3G6MA 3VILA 1HJXA 2ZUTA 1MFVA 1ZBVA 3PZ9A 3NDZA 1Q6CA 3MS8A 3DECA 4W88A 4FNPA 6TAAA 4WKAA 4UTFA 1UQZA 3EJPA 3KLLA 1QNPA 3LXCA 1VFFA 3T2QA 4CU7A 2CITA 1PAMA 1GOQA 3HU7A 4V28A 5HNNA 1JL8A 2PWFA 3WELA 3WF2A 4PRWA 1DHKA 3DYMA 3VX0A 1UZ1A 2PF0A 4J3VA 5E6YA 2XM2A 4F9JA 4FMVA 1XCXA 3WMCA 4X0VA 1EQPA 3WEOA 3BVWA 4UQ9A 1V6VA 2DGAA 1W32A 2WK2A 3AIRA 1W3JA 1I1XA 1BPLB 3GZAA 4PMYA 3WF4A 1XYZA 2XVPA 4KGLA 2VR4A 5AC5A 4FNQA 4QAWA 1YHTA 1TFVA 3PHAA 3MV01 5A8PA 4UQDA 4MNKA 1B0IA 1RP8A 3D52A 1Q6GA 3GBDA 4AY1A 2ZUSA 1PX8A 4GI9A 4UFIA 2GK1B 4NZFA 2WMIA 2J8GA 2XUCA 4PMRA 4OKDA 4ZENA 1JZ6A 3VIFA 5IDIA 3HJEA 1WDPA 1KR1A 3FAXA 4P8VA 5EBAA 4F8XA 1W9UA 1EH9A 1UH4A 1E1EA 2OSXA 4DO6A 2WXDM 1E6RA 1KXTA 2WCSA 4J3WA 2XN0A 2QHAA 4HU0A 2J25A 2E4TA 4UQAA 5IFPA 1OD0A 3ARUA 2NW0A 3BAYA 3APGA 4AMXA 1E6QM 3OG2A 2DQXA 2J78A 3WBAA 2WC7A 1SFSA 1RD6A 2EJ1A 1UD2A 1NQ6A 3T0DA 2PWHA 3W27A 5FD0A 7CGTA 1QNOA 2CIPA 5CJ5A 2VOTA 3ARYA 2A3EA 3CHDA 4MDOA 3RDKA 4DWSA 3GXNA 1EHAA 4EANA 3ARRA 2J7HA 3CUFA 5BXRA 1R85A 3AICA 1B31A 3VGDA 3SCOA 1XV8A 1E6SM 3AHVA 1EDQA 1R46A 3CGTA 5C71A 4GPNA 3PTQA 3VIGA 2ZX5A 2JE8A 4W93A 4NX0A 2EEXA 4AIOA 2XWEA 2X1IA 1QW9A 4AMCA 3WNNA 1C8XA 4D6IA 1GCYA 1GHRA 4QLLA 3BAWA 4EK7A 4UZSA 2ZUMA 1A47A 1JZ4A 1J18A 4UQCA 1I75A 4GZEA 3VKKA 2QF8A 1HKMA 3VD3A 2OSYA 2J8FA 2V5CA 3CIVA 3M07A 2D0GA 2X2HA 3WY3A 2ALWA 2XTKA 1KGUA 1ISVA 4JL2A 1MW2A 3W38A 4JL1A 1E4NA 2E9MA 1E0VA 2EAEA 3CZEA 5FL1A 2UWFA 1E1FA 1H0IA 3AI0A 2WHKA 4JKMA 5A6KA 2J4GA 1E0XA 1VJZA 5A2CA 2EPNA 3U7BA 2WMGA 5E09A 2X8RA 4JKKA 1OM0A 3CHEA 3IGUA 3GXPA 1GQKA 1JIBA 2O9OA 1HP4A 1WZLA 3N15A 2PBGA 1VEOA 2CBJA 4QCEA 1GHSA 2CHOA 1QOXA 4R27A 5A2BA 3ZJ7A 3BCDA 1UD8A 3WL1A 3PZGA 4QDMA 1UWRA 2J47A 3WDJA 3SIMA 4AMWA 4V27A 1SYTA 5A8MA 2BY1A 3WF1A 3CV5A 4P7QA 4W84A 4J27A 3WNPA 4DUXA 1MQQA 1GONA 3A4XA 3KE0A 2XJ7A 1EQCA 3DC0A 4CKQA 1OWQA 2JIWA 3DYOA 3GXMA 5D9NA 4EE9A 4UOQA 3WMBA 2VVNA 1G01A 4FLRA 1B3WA 1MQRA 2DT0A 4TTUA 3BMVA 4FNUA 2AOSA 3A3HA 3OGRA 4WKFA 3II1A 3N1AA 3AZRA 1NWRA 3MSGA 3EDKA 4FNTA 1KQYA 2CBIA 2FGLA 2VJXA 3AHXA 3WDPP 3EJSA 2V38A 2QPUA 1R86A 2WLZA 1EXPA 4AIEA 1MXGA 3BAKA 3AMLA 3D4ZA 4JFTA 4ZE5A 5C8BB 1TQUA 1TA3A 2J7GA 3O2LA 4PTXA 1XHGA 3OZOA 1JYNA 4J3TA 5FKYA 5JBDA 4GZIA 3WEMA 5DEZA 3VD9A 4DO5A 2YFOA 4H8VA 1BG4A 2XVKA 3B9AA 3WDIA 1JZ7A 1HL9A 1TVPA 3ZM8A 3W53A 4RE3A 3S2CA 2JIEA 1XD1A 4FF5A 2WYSA 4LYRA 5I6SA 2EQDA 6CGTA 2DSVA 1XH1A 4YPJA 5A3HA 2TAAA 3VIIA 3ZO9A 4P7NA 4HZ8A 2VTFA 1C91A 5CLTA 3KL5A 3BVUA 3GH4A 1U2YA 1TQVA 1GOIA 1KCKA 2G3NA 4H8UA 1EDTA 3DHPA 1UWUA 2XM1A 4H7VA 5I78A 3DDFA 5I24A 4Q7NA 4HA1A 1PX3A 1VFMA 3VIOA 2O9PA 1E6ZA 1WKYA 3BGAA 3QHOA 3DYPA 1NM9A 3ARSA 2D23A 2DEPA 2XSBA 1R75A 2EABA 1UR8A 2CYGA 3SCVA 3SCPA 3KEHA 1RPKA 3ZSSA 4XV0A 3EBVA 4FLSA 4ACYA 4HPGA 2BY3A 3L4ZA 1KCLA 1PIGA 1HJSA 1HJVA 3WH9A 2XIIA 1BYAA 4ZEPA 2WHLA 3WY4A 4MPKA 4CVWA 1E43A 1V6WA 3W37A 4JFWA 2WMJA 4PCSA 2VRKA 3KWXA 1BF2A 2YLLA 3CZNA 3K8LA 5CPSA 1WE5A 2BV9A 1BVZA 4JZ5A 5EFFA 2Y8VA 2WLYA 4WSJA 2C0HA 4A4AA 2ZWYA 3GH7A 1R7AA 2D3LA 2GJXB 1SMDA 2WVVA 3BSGA 1G0CA 1PPIA 3D51A 1VIWA 1ZL1A 1UQYA 4PMOA 3AMDA 3WDRA 2WPGA 3VD5A 4U3CA 1JGIA 1E6XM 3QHMA 2VRQA 2JF6A 1GZJA 4NF7A 2X2IA 3THCA 2ZWZA 3NYDA 2E8YA 1MQPA 1O6IA 1LLOA 4ZXLA 3SUTA 4Z2IA 2HVMA 2YKKA 4RE2A 3CZKA 4CCCA 4TTGA 1HIZA 1Q6EA 3K8MA 3L2MA 1AMYA 1E9LA 1W9XA 4GIAA 4FNSA 1HKKA 4J3XA 3WD4A 3UEQA 4D1JA 3AHTA 3RJYA 1W2PA 4UZUA 1C7TA 2WSKA 3WQWA 5GNYA 2BVTA 1J0KA 4DWSC 1HWWA 2MANA 4W5UA 4AZCB 1EOMA 3SCUA 3EJRA 2QMJA 1FFRA 3S6TA 3BLBA 5A1AA 1JG9A 4HPHA 4Y7EA 3SCRA 1ZU8A 1UOKA 5D9OA 4AZ6A 1BGGA 2YBUA 3L4YA 4DWSD 3BUDA 5I2UA 3TTSA 1BFNA 4ACZA 3WNOA 4RE4A 3W0KA 1UKSA 3GTNA 3WNMA 1LJYA 1V3KA 1XSKA 3E1F1 4U31A 3OZPA 1GUVA 4AZGA 5CXPA 1TVNA 1CZ1A 4HP5A 3WDHA 5I79A 2E3ZA 2VUYA 5A8QA 2WAGA 1XGZA 3UR7A 4CD6A 4HU8A 3A21A 3SCNA 4AEEA 1GW1A 3WY2A 1VJSA 3BXWA 3RIKA 1VBUA 1M03A 3AS2A 4WIWA 1QI4A 3W24A 4PCTA 1UWTA 1NARA 5GNXA 1R47A 2XVNA 4B9ZA 1QX1A 2V3EA 1WZKA 3ZJKA 5BXPA 3WD2A 3VM5A 1M53A 1V3IA 2ZX7A 3WUGA 2IUZA 2WVUA 7TAAA 4K68A 3BVXA 1ODZA 3NSMA
chains in the Genus database with same CATH superfamily
1Q8MA 1X8CA 2FZMA 3QUXB 4O2EA 2EKSB 4ANKA 1DN2A 4PJIA 1RIUH 4E9LA 5M03A 2C14A 2ADIB 5DA4A 1NY1A 1W0VB 1AA1B 3P2VA 3I6EA 3FCSA 4YDJA 1JUEA 1EJUC 2NLJB 1ORQA 2XZZA 3NQ6A 5HYJA 1ITXA 1R5VB 3HB9A 3DJSA 5BROA 4M7JH 2CKBH 5I1JH 3H85A 4X4ZA 4F4RA 3GX9A 1QSVA 1NDTA 4WUUD 2FRGP 4RDQG 1P1MA 2MNRA 1ZCCA 3APMA 2ZZ6A 1HQRA 4G82A 4Y88A 1HYSC 3HG0A 1TIMA 4YDIH 2DI7A 2BO0A 5EORL 1PYFA 3VXUB 1HJWA 3BO8A 2ZJSL 1RXOB 1CG9B 2K7PA 3E38A 1GGCL 1M7PA 4I48A 3CHVA 2OP4L 4MNGA 4O12A 3KZ8A 2DTSA 5KN5B 3COOA 2B1HL 2IEPA 4MAUL 1WWBX 3D30A 4MX7A 5IJVB 5LXXA 1SFHA 1FWBC 4ZAKD 5FCUL 4MLSA 1WIUA 3F12A 1WBJA 5DZAA 3N9SA 3F03K 2GGGA 4A66A 4PE8A 3M0MA 4U1GC 4UNLA 3WL9B 4UT7H 2BFVL 5L4JA 5F4XA 1KULA 1JGLL 5IT2H 3K7UA 2CIKA 4HQVA 3CO4A 1CLXA 4B9YA 3HPJB 2CBVA 3CUPA 5F6HI 1JI1A 4DYEA 1T1XB 3QCVL 1SW7A 4Z08A 4PMDA 3HHRB 4KZDL 5BNKA 4TF4A 5D7HA 1AOHA 5CHNA 4MASA 3CBJB 1R0MA 3TLQA 4WFGD 2K78A 4L56A 4IGBA 5D5MA 1E70M 2X4NA 2XXCB 1JZ3A 1NF7A 1XQKA 2I7SA 1RH8A 3ZHDA 3T42A 2J9XA 3KBHE 4X98A 2QV5A 4O4WA 4DP0X 4D72A 5GJTL 2RFXB 1VLXA 2WTRA 2WLKA 4UNKA 4EIZC 4WOZA 5CWSA 3TCLB 2NUTB 1NCIA 4S3EA 3LQGA 4K8RC 4GQPH 1B3JA 4F7TA 5C0BA 5D6DA 4OB5L 4OY9A 3W87A 5K9JL 1CD8A 2HX8A 4LAKA 2H0FA 5D1XD 4R8WL 3QWOB 3QWNA 3FGCB 4M6VA 5D4JA 5B8CB 3H42H 3D0VB 5DJ2A 4BQBA 3A5VA 2EPHA 1IAKA 3C5XA 4LDEB 3CH0A 2MNJB 5FF4A 5FGCE 2AJUH 3E6HA 3DO3A 4ZVJA 4GQGA 2AQSA 4WU5A 3T4YA 2VCBA 4P46B 4JIPA 4RZKA 4JFDA 3W39B 2FEEL 3MV11 4N4QA 2HLAB 2QIIA 2W38A 3JT0A 1S1PA 4I18B 4NN5B 1RFDL 3ESMA 1CT8B 3VXOB 3Q7JA 2PYED 2NY0C 1FO0A 1EF2A 3GNRA 3L9CA 5T5NF 3CN3A 2DZAA 2INFA 2IDQA 1ZXKA 5D2YA 4N25A 1YLVA 5KVDE 2J7DA 1RK1B 4Y5XC 1TMHA 4JFVA 5CZJA 1WV2A 3A22A 2HE8A 4TO8A 3RAJL 4F9PA 3QNXB 4HH8A 4FG6C 4EF3A 4PQXA 1WA0X 1MCOL 1FZMB 1QP1A 4PJGB 3T1FB 2DYPD 3W2KA 2XZQH 2CA3A 5K9DA 5DSCA 4A37A 1I2NA 3GXDA 3CPGA 3JTBA 4PJEA 2OZ3A 4OAWB 3GTVA 4EAMA 2J6VA 4DIXA 3VQLA 3SCWA 4CQBA 3QPQD 4OFVA 2GHZA 3D9AL 12E8L 2J12B 2ZCZA 1FZOB 2WHMA 2X7LB 1CF8L 4F8NA 2ZYFA 3GNOA 3LBOA 3IMTA 3O4LE 3P3YA 1Q9KB 3L12A 4XO4A 1DN0A 3OZKA 5C0CE 3Q65A 1R3KA 3H7LA 3P2TA 4GXMA 5CD5D 3EHBB 1ET8A 3P82A 5M94B 4QIUA 4HKJA 2OOFA 5TDOA 4IMDA 3R18A 4PM1A 3B9KD 1C08B 1KXQE 5LB1A 2VFFA 5IOPA 1XMWA 1L3NA 2OKMA 5IHUH 4JK0D 2E6JA 5DRZB 1KD0A 4IBQA 3RAOA 4MUPA 4PTVA 3KVLA 4WXZA 3BUVA 2P8LB 4S10A 3SCQA 1LL1A 2A1WL 1RKRA 3VG0H 4J4PD 3GZQA 1BD2D 1OC5A 3WUFA 1IGJB 3UNDA 3MRGA 1GOOA 5FCSH 1L6XA 4BEIA 2WSYA 3PWNB 1G6RB 4X83A 5AD0A 4S0SD 1RJYA 1SY6L 3U6XS 1T3FB 3U0PA 4OIBA 2GFTA 3WJMB 3E0WA 4MRBA 1O0VA 1OAZH 5GS0H 4KAQL 3KW7A 5GZNC 5CZXC 2GAZB 4G1MA 3A6CH 5IFTA 4UXDA 3WNIA 4G1EA 5A6IA 2YUZA 2WBGA 2PCPB 4KO7A 4WV1B 2IJ0C 4IBYA 4D6HA 2E9JA 1XH0A 3RLSA 4C8XA 2WUCH 2UVEA 3LKQA 2GVEA 3NH7H 2OQHA 4L9YA 3VFVA 3ULVL 3ULVE 1A7QL 5GVJA 3WXVH 1J0IA 2HVKA 1VZWA 4RKAA 4MS6A 4GZJA 5AALA 4HEPG 1DVFD 1AODA 3VMNA 4D0BA 3U5UA 1R3YA 4YVNA 1KV5A 3D25B 4QKXB 5KEZA 3L7FB 1IGMH 2CKBA 3QEUA 4E9QA 4CCZA 3V3WA 4X6EA 1W1A1 1XFBA 3RTQC 1KIRB 5C8JA 3UWQA 1XQLA 1PNCA 1XBZA 4XMPL 4BXSV 5FYJL 5FYJE 3KP0A 3AG2B 4K3JH 2O6CA 2IPTL 2GJNA 3LS4L 3DURB 4L4MA 3GGWB 5IWLC 1HFBA 2PPFA 3ULUF 2VZUA 4HHHA 5C97A 3IACA 5CGQA 1IC4L 3OM3B 5EBWA 3PDDA 2YOAA 4R4NC 5T3XL 5T3XE 3MJ7B 2D7OA 3ATYA 4QHUB 1L8NA 4Q4KA 5CP3H 1CDCA 3WQEA 3KNBB 1KZQA 2DQFB 5IF0B 3U2JA 5E8OA 2DWXA 1G7IB 2QCCA 3SOBL 3LKOB 2ACQA 5F9WB 2Y63A 3HQ1A 5EZOH 3L67A 4GINA 1S2VA 2N7AA 4D9RD 3ZLFA 4NGHH 1WBZB 1BGXH 2FVKA 4X6DA 4HNVA 4WJ8A 3LZRA 4B3EA 1W8OA 8FABB 1RZQA 4NZ5A 3L6FB 3GJEB 2G5WA 4BIKA 4KNQA 1DUYB 3HLAB 4HWZA 2HTKC 4Q9CA 4G1NA 1XCQA 1V27A 3WFEH 4OIIH 4X8GA 1NKRA 2FBJH 5FESA 4K2SA 4OZGF 4LAOA 5CEZL 1MIMH 2Z8SA 1TJRA 3RU6A 5CEZE 4P2RB 1TTGA 2PTWA 3DFOA 1EV2E 2XNAA 3CU2A 3AMGA 2A7NA 1WAWA 4I9WD 1DO5A 5LNSA 4PI2A 5CD3B 2ICWJ 3UWZA 3QO1B 2Z7ZA 3AZUA 1H61A 2BLFA 5D7LE 4G8TA 1IBHA 2DM4A 4DN1A 4PW3A 1CWYA 1MFDH 3CFDA 3HOJA 5I03A 2ADGB 2RJGA 1T1WB 4PRHE 2PNDA 3NP4A 6XIMA 1IKNC 1ZHKB 3C6LC 1IE5A 3VX1A 5I8OL 2W1NA 1XEUA 4O19A 1OL0A 3FUHA 1N7ML 3UWEA 1F90L 1ZHAA 1WH0A 1YNPA 4AQ8A 2X4TA 4H19A 1TZIA 4KDTA 4LWWA 3SGEI 4HIXL 4O51A 3ZQXA 4E4PA 4IRJD 3WF0A 4MMYB 2WBJC 3EXRA 4LRNH 4QFUA 1D9KD 1L3WA 3Q3GB 2D9QB 4CADB 3QG7H 3OLDA 4A67A 5I2IA 4PP1C 2F08A 3MV9E 3AXLB 4YNYA 2PF6A 2W9DH 5AFAA 4P3CH 3BZDA 1HAUA 1WCGA 4HJGA 3CNYA 4WNJA 4RGMC 2VOMA 3FA5A 2BW5A 3RQ3A 4E6MA 1YYML 3VI3E 4S3AA 1MYRA 2APSA 4QLKA 1XCTA 1DVJA 1U8LA 2YD6A 1SN5A 3QQ4B 2EECA 2Z2UA 1B0RA 3FMGL 3SPCA 3MWAA 2A3AA 2DN7A 3IXAA 1MLCB 4NI3A 5BZWA 3RCYA 5BS0D 2I56A 4UQIM 3MA9L 4FERA 4JX6A 1W16A 3W5NA 4P4KC 1S3RA 2IOIA 1QLEH 4GXVL 4IW4C 3NQKA 5GRVL 2VL5B 3RLHA 4LF3A 4X7DC 1KJ2L 5AVUB 5IQLA 3RUBL 4MJ5A 5F7NC 5JIMA 1LTXA 2QV4A 3I50L 3QEQA 3BP5B 3KJ6H 1TITA 4P5MB 1XGTB 1TCRB 3ZYOA 5JORB 4U6VH 1V7ML 4LSRH 3RU8H 1A9BA 2VZTA 2PD5A 2Y0FA 4WI2A 2AL2B 4ELME 4BELD 3UIZA 4P7RA 1A6WH 1TPH1 3WU1A 1GR7A 3AXXA 3BG3A 4I6VA 4IK7A 3PDOA 2FGZA 1XG3A 4EXBA 5ACZB 4RDBA 4FNRA 2ZUWA 1DL3A 2FX7L 3ATDA 3WLRA 5C08B 4IRSA 3TH2T 3R8GA 4HJ1A 1NH6A 3DOPA 2BNRA 2Q3XA 2YPKB 4LUTB 4IQJA 2ZAIA 4X5PA 1MI5B 5AWNH 3FQUA 4AXNA 5IV2A 4JPVH 2VLJB 4Z1PA 3UWYA 4R90H 5D96B 4O02L 5PAZA 1XGRB 5EBUA 3KW8A 3NFSL 4PRPE 2QQQA 4HKZB 2CDGB 2A9MH 3KBPA 3A4AA 1I9IH 2I7OA 2QNEA 3MGTA 4BHUI 5EBMB 1QEXA 1HO4A 5FYKH 3LJ3A 1PD6A 4A2EA 4PV1C 4Z76A 1P84K 2HSIA 3LU2A 2UX7A 3V0VA 2BNQD 4ZFQA 4ES9A 4PJ6A 3G6MA 4ADIA 4YUEH 2XETA 4NT6B 4HULB 3C4UA 1E5UI 5C0AB 1S7SB 4DWHA 3UTTA 4XMUA 3BZFB 1XGEA 1YPZE 3X17A 2VC2L 3D12B 1LO2L 4OF3A 1LOLA 4WO4A 3PABB 4GRMB 2J9YA 1ID5I 1JZDC 3QWRA 4U1LA 1N6VA 5FM8A 2JH2A 5ISZD 1IAOA 4Z0BH 3B9OA 1J9CT 3QXAA 4YU1A 4BCXA 2ZXEB 1T7YA 5F1NA 5DJ0B 3P3BA 1BPLB 5AZ1A 1MH5A 4WEMB 1PKYA 2VRAA 3B9NA 3VRJA 1U8JB 3WIHH 1K4DA 2VXQL 4AY1A 1BECA 1UXWB 3LN4B 4DAFA 4B9KC 3LQZB 3BUTA 2WXDM 3MXWH 1YAIA 2QHAA 4ZW8A 2IPJA 3IWVA 1HHIA 4Y5YB 4JKPH 3PGCA 3BJFA 3T0DA 1II4E 5KVFH 4FULA 3VE0A 5BOEA 3IDJA 3ANVA 5FD0A 1AQKH 4Z7UB 5DS8A 4XH2A 3QG6B 2A3EA 1J2WA 1DIDA 3QPXL 5K59E 3O41A 3N2TA 1B31A 1FYHB 1DJHA 2X1TA 2EIKB 3QN3A 3CVDA 4FHBD 2C3ZA 4MCYA 3RURA 2FPVA 1F3XA 1QUMA 4AMCA 4XMZA 3U9UB 1JZ4A 1EJWC 3ZMNA 2PABA 4Y2DB 2E7FA 1Z9SB 2XTJE 2VMDA 4R7XA 3QGKC 4LUJA 3UTQB 2ALWA 3MJGX 1LE5A 3SO7A 1YN7B 2WQVA 5HP5A 4P9HH 4RX0A 2VW7A 3JWDH 1P0NA 3AI0A 2BHFA 3GTFA 2ETWA 4X2RA 1ZTVA 4AEIL 2B9AA 2F8XC 4HAFA 5D4QA 4HBKA 1UWRA 3O63A 2A1YA 5I6OA 3CV5A 4D8OA 3H12A 1DE5A 3MU3A 4HWBL 1MNZA 1N2VA 4ETQB 5G4OA 4WI0A 5GS2D 4Y4KC 4L0ZA 1ID2A 3IIVA 3A3HA 3B8DA 2ZPKL 4BE5A 2R82A 5DD5L 3AZRA 2I5YL 4G72B 4YHIB 4AW4A 1UM6H 3ULUD 3EJSA 3WKQA 3VW3L 3SQBB 4ECNA 2IWGA 3GMOB 3TNMB 2P5EA 1F42A 3TWAA 3TO2B 1WBXB 1JTOA 2ATAA 2RR3A 4GBDA 4GBXB 3PSVA 4ZX3A 4XXDA 3B9AA 1QU4A 4YHOH 2V0TA 3MT1A 3QZAA 1HL9A 3IFPA 4MA8H 1ROWA 1X5YA 4Y19B 2ADJB 1JK9B 3CM4A 1VJIA 2WIIA 4N6RB 4DP9X 4I7WA 4LSTH 4TOYH 5EO0A 2OXGB 4IOFC 1CDYA 3KPTA 2V2WB 4G9FB 1DVTA 4DZ8A 3ABSA 4PP2A 4G3YL 5D1ZC 5J3HC 3L2IA 1WKYA 1IQ8A 3DYPA 1H5BB 3QFJD 4HEPA 2WLIA 4RFNC 4M6OL 2WWKO 1GS6X 1BWMA 4HJJL 5LGZA 3LUTA 3LGEA 5FHAH 5EU7E 3FFDB 3BV4A 4JFWA 2YLLA 1I3RB 5CC5A 5HNTA 2JCCB 3I02A 2O0TA 4ELDA 1OW0A 4B9FA 3QUMB 3OAZK 2ZWYA 1R7AA 2EDNA 4ES8A 1UQYA 3SE8L 1FNGA 3PWPA 2XINA 4FZEL 5CCKL 3GIPA 1MIEH 2JF6A 3B5TA 4D0CA 4HWUA 3RWIA 4PG9A 2W0FB 3K8MA 3VI4A 1E8XA 3L3OA 3L0NA 2OZ0A 3JVGC 1BBDL 3PXHA 3QDMD 1BFTA 2CRMA 2ESVE 1NMCC 4DGVH 2BWQA 3RUGA 3Q2LA 3LIZL 5DEGB 1EJVC 1KFAL 4MNQB 3EYSL 2K70A 5LGJA 2JNZA 4ZFOB 3CFCL 3BLBA 4Y7EA 2MQ0A 1OF6A 3L8QA 4X5QA 2EICA 1AGFB 1S7QB 1QXLA 2EXSA 3QYCA 1WC7A 3T2NL 3SDXE 3B2VL 3C2AH 4X99A 4IEFA 4NFBA 1CI5A 1OQFA 1TTAA 1K8YA 3WY2A 4Y1TA 3RIKA 5H91A 5L2JA 1UQSA 5F1SA 5JW3L 3M43A 3H9HA 4DW2L 5FV1L 1E0TA 3S36X 3NOYA 1A25A 4GKZB 1KIQA 1F11B 4E68A 4FQJH 3GB7B 3BW2A 5INDA 2WQSA 2ATSA 1U1JA 3OD3A 4GYFA 4XCYB 3N29A 2GSGA 1PVNA 5MP6L 1XIBA 3WH5A 4L8SC 5EFIA 3N40F 4LCUA 4LSUH 2O5NA 5HDRA 2UXTA 3IPFA 1EAPB 3MI6A 1CE1L 4WENB 2YIHA 5AHLA 3OKOA 3GHEH 2Z64C 3AAZB 3HUJA 1MKFA 4NUGH 2AQQA 3OKNB 5DQJB 4N0UA 5IVZB 1IILE 4PJFB 4GO6B 5DJAA 2YOCA 1KRAC 1U5VA 1M7IB 4GW4A 2C6QA 4DZBA 3OA3A 3RL2A 1MQ8A 1HZYA 3LD8B 4JQ1A 3VWJA 1W1YA 3VXPB 3S0CA 3EDEA 1N8OE 3ZYIA 1AZ1A 1JRBA 3OG3A 5HY9B 1I8IB 2PPGA 5BO1H 3WGUB 4ZAKC 1TYEB 1EHNA 2E9GA 4GUFA 3UYPB 4E3TA 5FXCH 3S37H 2OEKA 2ZOLB 4XB7A 4ZSOE 1H1YA 2N3JA 3FUKA 4MNLA 4NXSA 5DBTA 5I8CB 1AOZA 2WQWA 2HCVA 4JFYB 3U9IA 1U2CA 3MGAA 5HHMB 4UQBA 1TPEA 1BAGA 4WNSA 4Q74A 4JE4B 5LA2A 1A1MB 3QZNA 5F4SA 3WIHA 1PSKL 4U1JA 2YBVA 3EBAA 4KZEH 2DQWA 3GRWA 5C55A 4LRIA 2IPUK 1FFOA 2XQ0A 3K6SB 3VNLA 1BQCA 4AEHL 4R4BA 2ZDSA 2FB3A 2MUCA 2FDBP 2VDRB 1PJ9A 1JPTH 3JV6B 1GK8A 2QADB 4PJ9A 4XI5D 2OTWB 5DFVD 5FA4A 1PD0A 2AJXL 4GKTA 4NIKB 2IALB 5E0QA 3XINA 2H0JA 4GB9A 3T3PB 1MJ7H 1TV8A 1LO0H 3LN5B 2WC3A 2HUEA 5CQ1A 4WFHE 6XIAA 2J7CA 1EEXA 2GWNA 4PJCA 2RD0A 1YEGH 4NO2A 4NEHB 4IU2B 4I0KA 3TFCA 5D1XC 5E0KA 2J8OA 4CNOA 1CGVA 4JHAH 2B08A 1WFTA 3BKJH 3MMDA 3QSKB 3QJQB 5DQDL 4KDVA 3DKJA 2NQJA 5JXEA 4KKXA 2GC7C 1RZGB 2XWBB 4DF9A 3GXTA 2IPFA 1V3LA 1Q6FA 3HE7C 3NZHL 4J4KA 3R0NA 2KAUC 2OK0L 2G30A 4I2XE 1JUBA 1K8DA 2WW5A 4HPYL 4KOBA 3AIQA 3FQWA 4FTVB 2PC8A 4X4XB 4AV5A 3VXME 3CFKA 4FNLH 3NTCH 1K5NA 3NCJH 5IHZB 4XZHA 1AJ7H 3ONBA 5F7MC 1MHCA 4N0RA 1XIGA 1R4XA 3GSOA 1DHPA 4JRXD 1XIMA 1T80A 2X28A 4BQ8A 2GUBA 1L4IA 1O94A 1S9YB 4ZFZB 1DEEA 4LVFA 2CRYA 2QHRL 3UAEA 1L2QA 2GJPA 2RALA 2PPCA 1WKFA 4HPOL 1SYVB 2H7WA 3IGAA 2RUSA 4JTHA 1ESWA 1U8OB 3BXNB 3C87A 3PLYA 3DROA 2YQ3A 3IGHX 3R06A 1PZ1A 2X4RA 1ZK5A 4YZWA 3ZXWA 4W9KC 4F9LC 1NBZA 4XB3A 4A3UA 1XGYL 1K5WA 3TF4A 1FCBA 2CXGA 4HOWA 1ECEA 4BQ5A 2NTSP 1OM3H 1W17A 5ICZA 5KJ4A 1V6YA 1TQWA 3C8NA 3VD2A 3F7YB 2HKFL 3QPQC 1KV8A 3ZO0A 3HI5L 3QAZB 2F54B 3ZWSA 2N1KA 3KLKA 2QSCH 1S2EA 3ONCA 3BV7A 2NUXA 3W22A 5KSAD 4QROA 2WJFA 3RIFK 3C0QA 4DGYL 4GYJA 3BWUF 1UM4H 1MCKA 2OMZA 3UOAB 3FB8B 3PCYA 2OCFD 2JEQA 2D03H 1PZ5B 5EC1B 4UAOB 2DLIA 2VYOA 1NEZG 1IGTA 2WTOA 2DQIL 5CD5C 3VFTB 2ZFAA 5D4IA 1BQGA 1SQ2N 3AISA 4YXKL 1XXDC 4L1GA 2EDFA 3B9KC 3POHA 1CYGA 1HKIA 1D7FA 3LHUA 5EIIG 3V8OA 5FKPB 3DV4B 3F2CA 1A3RH 3IFOB 4WHDA 3QP3A 4EUPG 4QHMA 4QXTB 1GORA 3L9RA 1KM6A 3IGXA 5E0FA 3QQ3B 1U83A 4NZTH 5DRNA 3DDGA 1RZ7L 1U93A 4PJBB 1BEYH 1ZGLB 4TV5A 4OQTL 3T4CA 3MA7B 3TE9A 3UJEA 3LVTA 4PMFA 5I66B 1C5BH 4K3EH 5ABEA 1V7YA 4H8WC 2FHCA 3FUNA 3EWUA 5FI8A 1EP1A 1HFUA 4WKZB 3UTZA 3DSFL 3U5YA 4JEJA 5JHDA 2RA1A 5DT1H 3UACA 1XX9C 4MDIA 1FIEA 1O5PA 2B7OA 4JB9H 3ORJA 1XGDA 2OSLB 3NCOA 5DD1H 4Z7NB 2PYEA 4DOHE 1ZTMA 5LXGH 3RGTA 2YFNA 1LD9A 3PAJA 4H9YA 3WD3A 5KG9A 2W5FA 4W8LA 4R26H 3BZ5A 1DVFC 2X9YA 5T3ZH 1JPFB 4B0MM 1JRCA 3MUCA 2CWNA 2VQ1B 2VDIA 4NO0B 4RCAA 5CZVH 4C56A 2Y6TE 1MWAL 4JTFA 3UC2A 1OT2A 2DYPA 1DVSA 3P0YH 1ODAA 1SFLA 1JXKA 4M43H 2VWTA 3C75A 3WBYA 3WK0A 4Z77B 3H7BA 3P67A 4CVZB 1T03H 4LSVL 4POZC 3CFIC 3SODB 2PR9A 3WD0A 3TNOA 2OODA 4FZIA 3PHOA 2G5BB 1IQWL 4UIOA 3K6NA 4BH7A 2AW2A 3F7VA 3R19A 4S38A 3WTWA 2NY5H 2WJ5A 4L8BB 2OL3B 2AK4D 1RK5A 2Q7NA 4DP4X 1GQJA 3CIXA 2V81A 3EA1A 3VXNA 3GDKA 4ODXA 4JZNA 3U3HA 1H3PL 3ULSB 4JLRB 1Z9PA 5J6GA 2YCJA 5C1MB 4ENZA 1LM8V 2MH4A 3DX2A 3UA3A 2Z7GA 2AGKA 3ARFB 2IPKA 3VIHA 1ZEAH 1A7OH 2NY1B 1ND0B 2K3TA 2UXGA 3EB2A 3BH8A 5SX4H 4PSPA 1N2RB 1GGOA 4EUPH 3PPEA 4J4PA 1HNGA 4GAGL 4OUUB 1RZKL 3T55A 5E24E 3O6KH 1NF0A 1G0DA 2GL5A 3MCLH 1TSHA 3IF1A 3B3BA 4RMSA 3FYPA 3U9PH 3FB7A 2M2DA 3LNGA 4L64A 3I3BA 2IKGA 4AZ8A 2HFTA 5F4WA 4NKCA 4M8QA 2C9SA 1CDBA 1UJ3B 2AQPA 3JTTA 5IB4A 2AK1L 1C29A 3Q06A 3WSQL 4IJCA 2QQLH 3S83A 1BJ1J 4PJAA 4W68A 1CS6A 5D7SL 2Y06H 1XAUA 4NAQA 2AEWA 3FTYA 3MV7B 3MRJA 4JN1L 3TO4B 1NDYA 5KJRH 3TA4D 4XP5H 3UPMA 3EYOA 4G6CA 4LLYB 4NAFB 3VM7A 1LWJA 2X6AA 4F1ZA 4MOZA 4O8RA 4G11A 4PD4K 1UR3M 4B6ZA 3UPRB 3V0TA 3ABLB 1I7ZA 2FWLB 2WGNB 3HKZA 1RY7B 3AS1A 4NJ9L 1DVFA 2IPWA 4IRJC 3PAZA 32C2B 3QZEA 2J55A 1AZZC 5HWNA 1D9KC 5CEYA 1FO0H 3L4XA 1RZ8A 2OW7A 1UWXK 4L4LA 1OM9A 2F74A 4AYGA 4QX4A 1T21A 2WCPA 4ZT1A 4XKMA 1YEJL 1PLBA 1F3RB 4UWMA 4UR9A 2CLMA 1GVOA 5GGSA 4YTQA 3C60A 2FWOB 1F58L 4HUNB 1W3NA 2XWTB 1CNVA 1RK6A 2OWXA 1ZENA 1CGXA 4YEFA 4LVAA 4HJFA 2V9UA 2XGBA 4OLVL 5GGTL 1I0BA 3KPOA 1PXGA 1BZOA 3HC0A 2CMRH 4ESKA 4K5MA 4JO2H 2PDBA 2DS4A 3AZTA 3SIKA 2NZIA 1OIMA 2GOUA 3RRXA 2W0PA 4GIPD 3NZQA 2IXVA 4O9HL 4PW9A 3SHSA 3W83A 1WTLA 1TG7A 3MMEA 1KBVA 3Q8EA 3AQDA 3ZQWA 4RIRA 1A9EB 4HMNA 1P53A 1X8FA 4X0KB 1GIGL 3BPCA 3SE3A 3F1QA 1UD3A 3AVEA 2GGHA 3ZZQA 3LRLA 3SDAD 1BVKA 3NJIA 3CBRA 4QHNB 3Q8AA 4ISVB 1O1HA 1KCXA 2F1AA 3S5OA 4ZI8A 3SZKC 1P9MC 1G7VA 4CJ0A 3E9UA 1MG3C 3ARGA 4GS7C 3TZNA 2CDEB 3C12A 5BXSA 4W5ZA 2GJ6E 5E9DE 2A9BA 2ADFL 1VZHA 1B4LA 2QZRA 4XUGA 2CCVA 4IIBA 1ZA6B 3LNIA 1OX4B 1YJDC 5SWSE 3JUZA 5SWQB 1E4IA 2BW4A 3FCGA 2Z2BA 1ZALA 2E47A 1H63A 1A64A 5IB5B 1V6XA 4AC7C 3T6WA 1OCQA 1BIIA 3MREA 1HWHB 4MD0A 4YL2A 2GKIA 3CXFA 1BCIA 3B37A 2CBTA 3A4WA 2AQ1A 4A2FA 2BP1A 2JBMA 1R3HB 2EC9U 3GBNL 4JIRA 1YCSA 4G5DA 4JG9A 2JGQA 5DX7A 3DGGA 1QO2A 5BVJB 1N8ZB 3U4BL 5TDNB 4AH2A 3MZTA 3WGVB 1OF8A 1JHKL 4GQZA 3MTWA 2ZC8A 3GHRA 3CB3A 2NY4D 3GXUB 2YD2A 1BVLB 2FMOA 1EKOA 4QXVA 5TQ0H 2ZUTA 3MO7A 1MDAA 5DJXB 1WDDA 3MSRA 4PUJA 2GQHA 2K1MA 2XBZA 1OABA 2W8CA 4UC5A 1L9SA 2V2XA 3TAKA 4LDCA 2EYTA 1DHKA 1UZ1A 1IM9D 2W9LA 1P5BA 1VIZA 2EKGA 4JRWA 5ICXB 4LCWD 1V6VA 4K8GA 4PFMA 3QISA 4FQPA 1CLYL 3D3VD 4G43B 2V2HA 3O8XA 2VC7A 4RPPA 4PG2A 3D52A 2CNZA 3GK0A 3MBEC 1PX8A 4GI9A 2ENPA 1FFTB 4H1ZA 6PAZA 3RZCD 1PCKA 2HLFD 3QUHA 4X4KA 4X5WB 4C6LA 2WJEA 4I0PB 4LLQB 4UM9D 3RWHA 1E6RA 2XV2A 2Z0IA 4H0LC 2RCSL 1O5DT 1KJ3L 2JIXD 4Z78A 5DJDB 3SB0A 2CO6A 1PIIA 4QDGA 5HVWA 3U2CA 1BKSA 1FNEB 3FQNA 2G0LA 3QXVA 2P8PA 4GG6E 1SLUA 5T1LA 3ASWA 5IB2A 4XC3L 4M3JA 2VCOA 2DBJA 2BMKB 1QNOA 1IFRA 2HA1A 4AQZA 1BZ8A 3S1GA 5FO8A 4R7NB 5FV2A 4FQHB 1MNSA 4X80L 2BVPA 3HPFA 3SRKA 3OKMA 4TLUA 3KRZA 4GD0A 1NEZA 1C8XA 1QSEE 2FJHA 4QHKI 4C6MA 4ADGA 2IG2L 2X89D 2E5EA 5EIIA 5AFDA 1I3GL 4FSAA 5AKVA 2IQAA 4EUPA 4R7JA 2EAEA 4JPKH 4NQSA 3KS5A 4Z42C 2VERA 1EJ6A 5A2CA 4DQOL 4TPRL 1AGDA 2WLHA 3VFLA 3IGUA 2QTVA 2HZGA 35C8H 1IC7L 4CNTA 2P48B 2FB2A 3S5SA 1NLDH 2Z8VC 3P11L 4R3SA 2BNQA 4P7QA 3F84A 4HT1L 4M6NH 2YQ2A 4MMXC 3KE0A 1R5IB 3DC0A 2JIWA 4XBGB 3ULUC 4OF8A 3FT3B 1FYTA 3TEZA 1VRDA 5D9SA 5F7DB 1FPTH 2PP0A 4AGNA 2JKLA 3OGCB 3EXJA 4MVAA 3HE7D 2XIDA 1HQ4A 3GDMA 4Q97A 4QAIA 2NSOA 5LCVL 1QNIA 5ISZA 2DQEL 4XNZC 1E50A 2IADA 2R0ZH 1EEPA 4GZIA 4NQDD 4JGDA 1ZV9A 2QQKH 2IMMA 4EXQA 2WQRA 1XH1A 5A3HA 2E6AA 3VIIA 1GEHA 5CBBA 3SIZA 1MAJA 5CZTA 4JFQA 1VKFA 3BI9X 2ODOA 1E5CA 3OC8A 5DMLA 1RCXB 2G3NA 4H7VA 4HU3A 3EEGA 4WUIA 5KVDL 1IBGL 2AJ3A 2RQ8A 1EHXA 4LLWA 2AXWA 2P1YA 3LZ3A 5GJSL 3QFEA 2VDKB 1P7KA 2RJMA 3GTTA 4MA3B 4U6TA 1KCLA 4LESA 3W2LA 4G6FD 2H26A 3E9TA 3WH9A 2XIIA 5KYUA 2Z25A 1S9WA 4OH2A 5KJ7E 4YDKL 4G7YH 3N0PB 4EAEA 3PREA 4IIZA 4LAJH 4Q33A 4FP8H 4XPAH 2Q8AL 2KQMA 3QHMA 5AYTA 3SN0A 2D31B 4NF7A 4K8EA 2JFCA 1X5HA 2OZNA 4GAFB 4H6RA 4JIQA 5AZ0A 3HKFA 3DPDA 1PG7L 9RUBA 3G5XB 1HESA 1TU2B 3GINA 4D1JA 4M19A 3IU3A 3BRDA 3BARA 3RDTD 1Y65A 3DOSB 2O56A 3UBXG 5AC8A 2OEMA 3K1GA 3HNSH 5IGXH 4HG4J 3RZWA 1UOVA 2DWEA 4UUJB 4DKFL 2ZXGA 2YBUA 5F89B 5MEND 3TTSA 1WWCA 4Z7WA 2E09A 4KNSA 2X1PA 1LJYA 2VISA 3TQVA 1GUVA 1TO3A 2Z1BA 4JNXA 5I79A 1HGWA 4I9TA 5C0FA 4L9DA 3H2PA 3TASA 5H1WA 2QGBA 1PDYA 3QNYB 1DYZA 4JTSA 3R5EA 4AC4A 4XK2A 4QQ3A 1F18A 7XIMA 3UFYA 4PH8A 3KOFA 1FFNA 1VFAA 4K5PA 3T81A 4B9ZA 1QMLA 3ITOA 4XNUL 1NIBA 3MNZA 4UT6L 3GHSA 4GT7A 4CSPA 2ZNWA 1ROCA 5K1JA 1I3VA 3ERPA 1VACA 1YMHA 3EBHA 4QR6A 1ZAHA 1PFOA 2VFEA 1JF1B 5BOPA 2BSSA 3PZUA 5JQIB 4OR1A 3TAOA 2J74A 5HSFA 4GGBA 1FSKB 1JWUA 2BOCB 1CZ8L 1F8TL 2ZQ0A 2JF7A 3WJSA 4XPTL 3QQNA 3U4EB 5HHOD 1DQML 3GSNH 2V7NB 1AH1A 1U6AL 4M7ZC 5CBIA 1AIFB 5F8QC 3PWUA 2J57A 5D2VA 1KN2H 3R7RA 3WIAA 3O6AA 1R3TA 4WJG3 1KPRA 4AQAB 2PF8A 2CLIA 1SDYA 3H2WA 1JZ5A 1NWUA 4IPNB 2R56H 1THAA 3U7AA 1ETB1 4Y5XA 2ACSA 2DMBA 3A23A 3RE0A 4N8VG 3V6FB 1UWIA 4NO5B 1A3XA 5FB8B 2CE6A 4KQ4H 3KVMA 4UMSA 2XN9A 4G8GE 3MUGA 4P49A 2WMHA 5KZ6A 3VIKA 1GVIA 3QORB 3KRUA 1T04A 1X5JA 4N4YB 4BCZA 1N12A 4YVVA 3NPUA 1OGAE 3QXWA 2YAFA 3DN5A 3OZ9H 2QR0A 2ICWB 1OAKH 5CPOA 1TTCA 3ULVF 4POZD 1A5UA 3VFUB 3G1SA 3PGDA 2WZEA 4S1RH 3EYUL 3QDMA 3SQOH 1EFQA 5JPMC 4R53A 3QJHA 5TF1H 4EN2A 3WHXA 3NFNB 4TLTA 2E77A 2VDHA 2GBVA 2XXGA 3OR6B 3BP4A 3MMWA 1N67A 1X1NA 2P8MA 4GMEA 2XISA 1J05A 1W6WA 4TQEL 1MAKA 1V7NL 1UPPA 1G7LB 3L3JB 1XWVA 1KPVA 2NZLA 3TBYA 4XI5C 4ZNEE 2G9KA 5DFVC 4PYGA 1HNFA 1ETA1 3FU8A 3I2CL 3V5KA 2IQDA 4UR8A 1BOGA 3VXTA 1DJIA 3ZJ8A 4G6KH 2F1BA 3IMSA 3CN1A 3TFBA 2F53A 3MKKA 4MA7H 4V33A 4X6CB 3AQZA 5BZZA 1JTPA 1ZBKA 1HXJA 3GMPB 3SN4A 2RAMA 2Y6SD 1JDEA 3TCEA 3E8UH 1ZWIA 2VXTL 5TFSL 4JY4B 2DZPA 1ADSA 1S46A 2EBNA 1ML1A 1AD0B 4XP1L 4AM0Q 1LDSA 4D71A 1IWPA 4MZRA 2WLLB 5FAAA 3LV3A 5JDSA 1R0AL 2ROYA 5C9ZA 5B39G 2INZA 5DJ6A 5GZNA 3CWHA 3HG3A 5GGUA 4WDIA 2WKLA 1E4LA 2JB6B 3FFCA 4R84A 4JPIA 3MLWH 1PYWB 2ZOKA 5I1HH 5GS1C 1SPQA 2Q7YB 1QLRA 4LW7A 5JDJA 4F37F 4NZ1A 3RTLA 4NS0A 4H8PA 4P2YA 1Q6DA 3OAZH 1LBLA 4EKJA 1MPAH 3T40A 4NRYB 1KTRL 3MHUA 1SGKA 3G6JE 4LS2A 3MUAA 3KVKA 2P5NA 3RO6A 3T0AA 1T6MA 1LT8A 3EFOA 1W0WA 1MJJA 2AJZA 3VTAA 4KQNA 3ES6A 2W88A 4LHQB 1S8DB 2IPUG 4HD9A 1X9UA 1ZCOA 4M9PA 1JOIA 1R3IH 3KEDA 4MNMA 2JI3A 1O68A 1WS8A 2OEJA 1GG1A 3NESA 3RTQA 3MC0A 4KC3B 4Y16B 5AYBA 1CT5A 1P43A 1DTUA 2CNYA 1P0EA 5IVXB 4JG1H 2IQ0A 1Z3GH 1LEIA 4UM8A 3KWSA 4YWIA 1MCPL 1WSST 5IWLA 3FTGA 1O4UA 5FAJA 1AJZA 5J13B 1OQXA 3L5IA 1DZ0A 3PJLA 3KBNA 4M29A 3PP3K 5B22A 2Z7KA 1J9QA 2X88A 3NPSC 1YXCA 5F3BA 2DF3A 5KSAC 3WUEA 2ZE3A 3S3GA 2EIZB 3QH3A 2AHIA 1CXFA 4CQDA 5SWUA 3HFML 2OB3A 2FX8L 3FF8A 5IW3A 4O2FA 4PW4A 3SO3B 5D1QB 4HMCA 1LP9A 1N18A 3QSTA 2NY7H 3R43A 5A5WA 1P4CA 2C7UA 2IOMA 1Y18A 1DV7A 1BXUA 3KYMA 4DFIA 3CPUA 2FYMA 3VI3F 3BH9A 1FH7A 1KB3A 4Y9PA 1GZ1A 3IJ6A 2Z35A 3KX6A 3TA6A 4LPCA 2WWCA 3PS7A 1ZIBA 1GY1A 4U0QB 1FCCA 4HBCH 1KB5B 1IM3A 4TN9A 1QKZH 3WNKA 4UOW1 4KI1A 3EWZA 3WJLC 2DZXA 1QFWH 5I1IH 4O1AA 2BRRL 2Z8RA 1KYUA 3KGSA 4AYEC 2XUWA 3BZEA 3E0LA 1H0DB 3VSVA 3LHAA 4QG8A 4XBEH 1NBVL 1XC6A 4JN2A 2R0WL 1E67A 2FO4A 2FJGA 3N9GH 3M6DA 3AFBA 3QDGB 3V5HB 4MQ7A 1SEBB 1IEAB 3EWYA 4EVNB 3PZOA 1IKNA 4ZX4A 3C6LA 5CIPB 4RISH 5KZEA 4ELMF 4F2EA 3W7HA 4MB1A 4HFWB 2A73A 1EANA 5BCAA 4S1QL 3VACA 3E1ZA 1URIA 2PC4A 5DUJA 5ABGA 1WF5A 4XVSL 2VDPH 1NCOA 1I8MB 4MNJA 4E36A 3KTCA 4ZO7A 2WBJA 5IJBC 4AYMC 4NQCB 4B7IA 3EH4B 3EYFB 1NC2B 4F20A 3BZ4A 1OLLA 3SM0A 5FDWA 5ANHA 1LO3L 3I85A 4RFOH 4M9OA 5EA9A 1ISYA 1OFOA 1DQJA 4GKOA 2WJDA 3CWNA 1Q1JH 4NM8H 5KUMA 1MEHA 1WBYB 5IJKC 3HQNA 2GVLA 1FN4A 2VR9A 1N59B 5T1KB 4TULH 2R27A 1L7IL 4JTCA 4LEXL 2XVLA 4S3DA 2LGNA 3GWQA 1Z5LB 1MFMA 2AITA 4DBUA 4BFIA 5CMAB 4X8CA 4NYLA 3ANUA 3TU6A 4GUPB 3GSNA 3V52L 3TBTB 3BT2H 4PB9L 4ECLA 4L9LB 5DS1A 4Z5RB 2PDJA 4H0IA 4NSKA 4I77H 4J3OF 3QS2A 3LSOA 4XNAA 3ZXAC 4Q4EA 2V9QA 4V2CB 3INUL 1PNDA 2AEPH 2ATMA 2EH7L 1JD7A 2XJLA 5FF6B 3SYOA 1UUQA 4P4KA 3N2XA 2ZWNA 3CFMA 3G6DH 3GRWH 3W1ZA 1B4TA 5I75C 3K4DA 4K2UH 4H4IA 1YPZF 3GLCA 1MFAH 2C1PA 5KUKA 3MBED 2YGNA 1DE4A 3O11B 4OCRH 2NQLA 4N1EA 4B3LA 5A2JH 3IDIB 9CGTA 3NIGE 3O4LD 3DHFA 1EL3A 2F2KA 2J1ZA 5CC3A 3UG4A 5C0CD 1PCSA 3GKWL 3QJZA 1OG0A 4HZ7A 4PCNA 4Q7IA 3A5FA 3IK2A 3OA5A 1E3ZA 5DT5A 3GKZA 4YSUA 2AQNA 1WICA 5F97E 2PMQA 1UFGA 1A6AB 2AJVL 3LZFL 3K4ZA 3N55A 1E55A 1VA9A 1EGZA 3KPSA 4KETA 3ZGIA 1KIPA 3BAXA 5LNWA 3G6LA 2PU0A 3ZYJA 1FVCA 4MD5A 3DG7A 4UUIA 1PJWA 3UZYA 4Q9QH 1EIBA 3Q6FB 5CGYD 2BP8A 1BMGA 4XISA 4XPFH 4YHGA 1KB9J 2AP2A 1ZGDA 3UBXA 4ZMGA 4R97C 1IBZA 4OHQA 1I1FA 3EJTA 5IOKA 3O45A 4UNIA 4QEEA 1LWIA 5SX4I 2BS71 1TO5A 4YPGB 3R8QA 1C5DA 4HX1A 1JRHL 5IBXC 4ZTEA 2F6KA 2C9VA 4G6JL 4OT1H 4HS6A 4QOKE 5K59F 1XINA 5J8LA 1BA9A 3D2UD 3D06A 3LRHA 3KDMB 4XN4A 1XF3B 5TF0A 3LN3A 1U58B 1FV1B 4XAKE 1BYCA 5HGDA 1U8IB 4K71C 2YUXA 1BQHG 2ZRZA 1IFHL 3F01A 2R39A 2CETA 1T66D 3V0FA 1HKJA 5I18H 3QKEA 4L18A 2DWYA 4ALAL 3ULVD 5BV7H 2XA8L 1AXSA 3VFNB 2D4DA 1DPMA 3D50A 1FWJC 1SJEB 4B92A 3W57A 4KPHL 3G5WA 3UGUA 4LBSA 4K7PX 1PZ3A 3CQPA 2V17L 1AXIB 3NUKA 1FIGL 3EG9A 4IIGA 4ZFMA 1WXYA 2Y61A 1BOYA 3WCZA 3T07A 4CNIA 3SJVB 2PYFB 3WXWH 5BNXD 2VLKE 4JDTH 1ET7A 5FYJD 1S5IL 3BOVA 1R5WA 3SDCB 2VGBA 2D2GA 2Z1WA 2D1ZA 1TPXB 4FQQA 1LL6A 2IBZY 4IU3B 1S9VA 4EBQH 1N26A 4N8VA 2WY3B 3BE1H 2CHRA 1EZ2A 5DRXB 5MEPB 1QR1B 1FWHC 2D73A 5T3XD 1BQSA 1HCVA 4X9HA 1NGXA 5BZAA 1B30A 3PWLA 4FOUA 3A47A 2PGWA 3SDAC 3FZUD 1KBLA 3QDJA 4AL8C 3NJNA 2XZAH 4X7FC 2BK8A 1P7TB 2GHWB 3CO8A 1S2TA 4KH9A 1KELH 4EI5D 1S5HA 3QMTA 4GAAA 3JWNE 2YA2A 4BK8A 5CN1A 5CLYA 4OOUA 3FEQA 5HMEA 4XIAA 3M1OA 3RX8A 3B8UA 3E3QE 1I9RH 3FA4A 4PTUB 2HFGL 4UWQB 2OAAA 4DGIL 5KVGE 4JQXC 3H4GA 4DTGL 1DOSA 3SSZA 1NCAH 1ZT4B 3F5WA 4XNBA 3BMWA 4CSTA 3NQBA 3V0WH 4ZE4A 3FSWA 5CEZD 1DQQA 4AYFB 1L0PA 2COQA 3D39B 2VRJA 3MY9A 2XYLA 4NDMB 4CC1A 3KPRB 5D7IE 4DVBB 1K4HA 3GRBA 3MTXA 4LUSA 2VFDA 4HK7A 2DZTA 5DWUL 3LEXA 2J8UB 5D71H 1ML0A 4PRHD 5HYSB 3QXDB 2PDPA 3HF3A 1R30A 4Y9EA 2PXYB 5FEWA 2WUBH 4Y4KA 4APQB 3W26A 1G9MC 3UZEC 3VFRB 2DM7A 2FR4B 2R7EA 5DD3H 3H2OA 4UYPA 1EEZB 5DUPH 4XTIA 2NY4C 1G7MB 3DK2A 5F7UA 5B39A 1KFEA 2CQVA 4P4RA 1EFXA 3SDXF 3QZ6A 3CYJA 3THQA 3BWUC 1J5CA 1YYCA 4K1GA 3MV9D 1IGCL 1MFVA 2VW6A 4FNPA 1QDSA 5ANMB 4XPHL 3WLBB 4NQEE 4LNCA 5D1ZA 1WYJA 3WELA 3PPGA 4RA3A 3WK3A 2PF0A 3FK3A 1UBSA 2HK1A 3LTPA 1LROA 1D5XB 5EUKA 5ILTH 4I4WB 4GSXA 3BVWA 3OPZH 4KOCA 1W32A 3ZRFC 2DW6A 2X9ZA 4C6IA 4XSMA 2VN3A 3RZCC 4KGLA 4PBEA 3BKYL 1XX1A 1JVOA 4QAWA 2HLFC 5HYQA 1TFVA 4Y5VC 1KOAA 4HJ0D 4MNKA 1CLZH 1Q6GA 5I7GA 5G5DA 3C08L 4OKDA 4DZIA 5IDIA 2HWZH 4Y90A 1ZY9A 2QVFB 5AVSB 2WWKT 1NCGA 3BPNB 1T8XA 1UZ8A 3ASOB 4YDVA 3LM3A 3HM7A 1X39A 1OD0A 2PD9A 1AD9B 2DTML 3AY4C 4KW2A 3MI3A 1SFSA 3JVGA 2ARJQ 4FQXD 4FFVD 1Q9OB 4XAZA 1MCSA 5BW7C 4AX6A 5EA0H 5F7YC 4F2ME 1EHAA 2V5MA 1FNSH 1TJGL 1A49A 3VGDA 2FT6A 2G60H 4LBAA 4AQEB 1A6TB 1K2DA 1UWXH 3EPNA 1QFWM 4H8WH 1VH7A 4W93A 2QJDA 5DRCA 1H8LA 3BAWA 3TBBA 1TQCC 1K8XA 1J18A 1NCBL 1ED3B 4XPBH 4HPXA 5F2LA 4F48A 2QF8A 2AEQH 2VR8A 3IDXH 2VDNB 2V5CA 2GGEA 2X2HA 3AU1B 4PRIB 1MW2A 5DVNA 1E4NA 2AV1B 2E9MA 3PXJA 5CAYB 4FP1A 1DVZA 1W72L 1CCWB 3C8FA 3QARA 2WHKA 2J4GA 1E9QA 5EEZA 1RBOB 3CXDL 2Q7AA 5BJTA 1JIBA 5D2WA 1HP4A 1DQLL 4PRPD 1HUVA 4WJKB 5E5MB 3QQ9D 4QCEA 3V0EA 1C8PA 5A2BA 2XG4A 4FQ2L 3BW4A 3EFDL 3FYIB 2J47A 5E5CA 1FCQA 1ENUA 4JXCA 3LSCA 4J3OD 3WYZA 3QC6X 3DYOA 1ZLPA 4L8SA 1KEMH 1TV5A 3BMVA 5CJ8A 4XODA 2DQHL 4GQ0A 1D3HA 4HCDA 5AYYA 4WUUA 4KRPD 4ZZ9A 2X4QA 1IXPA 3BO9A 1I31A 5JXAH 3OX8B 1CD1A 3WEAA 2YFOA 4H88L 1SFDA 5E2JA 5HANA 3GMMB 1UCBH 1KTJA 5HDQL 1KIUB 4IGSA 4HNCA 1MRCL 3CE1A 2OFQA 3ZHFA 5JPNB 3H3PL 1J5HA 3G5VB 3RGVB 1ZT1A 1LRNA 3DHPA 1JCJA 4U1IA 1VFMA 2O9PA 3LCLA 2NW3B 3SCMB 2VEKA 1A6ZA 1KFKA 4ZAKA 3QHOA 2MHAA 4OTXL 5D2LE 4CVXB 1C9WA 1WFIA 5ERWA 1B4JH 1O5RA 2ZKHH 2I07A 4NZ4A 3HNVH 1HJSA 5EBGA 4WFEE 3VFSB 3NAVA 4A6YL 3I6RA 2WMJA 2H6PB 4U1MA 3A6BL 4JZ5A 1SJAA 3BK0A 4NP4H 4WSJA 1E8ZA 5IR1B 4E2BA 2JKNA 4MLJA 5EKYA 3D51A 4YFDB 1UWGL 4Z7OB 1F4WL 4U0RC 5I5IA 3SUTA 4HK3N 2HVMA 1RZKC 3MRLB 5HTSA 3H2FA 3QHFH 1NPNA 3RDTC 3PS6A 2P50A 4JY5L 3TA3D 4HNLA 5T5NG 4XX1E 2HTMA 1HDMA 4GY1A 3DUUA 4NWTH 2P0OA 2UZXA 1XBYA 2B5IB 2WSKA 3APFA 5AECA 4WNQA 3HPLA 4QE1A 3F7LA 5IM7B 3KYNB 4UILL 4PCPA 1J8KA 3IFNL 1JG9A 4PJ5E 3B3IA 2XDFA 2XTJD 4Q4IA 4HGKC 1ZPTA 3V4VH 3PHQA 4GEIA 3AO0A 3BPLB 3SE6A 2YEZA 5D1XA 1XQ4A 3PWJB 4HP5A 4ODHL 1F8IA 1M2VB 3MRMA 4CD6A 1S3KH 2CHWA 3DJZA 3MA8A 1M03A 2A83A 5L2KE 2IFFL 3EZ8A 3ARDB 3HE7A 5T5FL 2FLMA 4YYFA 4OJFH 2B15A 4XRCB 5KYXA 2DICA 5EU6B 4CBZA 4FXSA 3T05A 1N9PA 4NQDA 2BC4B 3FU7A 2DQGH 1E4HA 3UNTA 3TOPA 2BVEA 1E2VA 2R8SH 4H6EA 5J11C 2ISSA 1QBMH 5E8DH 3DXAE 3KUMA 3NK3A 5HINA 1FFPA 1E2WA 3FS9A 4FOMA 1SXAA 4E9VA 2CA4A 1UB6A 3MANA 2E7BA 3GG7A 1BQHA 5DLMH 5BYWA 2HISA 2DZVA 4HCHA 3PBGA 3S3SA 4TRPH 2FATL 2VABA 5ACMA 3GVGA 5DZJA 1QNZH 4P8XA 2FX9L 4F9LA 3O05A 2VEPA 3LB0A 4G42B 2ERJB 3QQXA 1KLUB 4D9LL 5GJNA 1UKTA 3QW3A 3HZVB 2R69A 1ZAGA 3UG5A 4MKSA 3K1DA 2I9LA 3NJMA 4GW5B 4Q6IC 1A5SA 5HMFA 3PTDA 5EMKA 1AE6L 2YPLD 4KK5D 3NQ2A 5AW6B 4F2FA 3WEXB 4YSQA 1LM1A 3NYZA 5JR1H 1I1AB 3SDDD 5DCCA 2OJ1A 3LHYA 5C54A 3QZLA 1AW1A 4B9JA 4GUGA 1DWGM 3WO4B 5IJDC 3TMLA 2XZCH 4LAMA 3VAEA 2QPFA 4MYXA 1VS1A 4JO1H 3B9KA 3RB7A 1YJDH 1KYFA 2EPOA 5C0RL 1Q72H 2ESVD 3V0HA 3ISYA 4Y9BA 2YWYA 3U46A 3CJPA 3IJ8A 2WMPA 1SO5A 4L5FL 4PJXE 2PO6D 1K9EA 4L5FE 1Y5WA 1QRQA 4PZVA 4P5SA 1N70A 2ATPA 4NG3A 1SJCA 4Y4HD 4JHOA 2Y6SC 1BD2A 4OGZA 2V7HA 2WKJA 4NI8A 4TVCA 4HYRA 2BB0A 1KCRL 3FSAA 4RLDA 5IMLB 3O15A 2DLTA 4M7LH 1VB9A 3ISIX 1A0QH 5HVGB 5HHVH 2HVBA 1NFDE 2AAMA 1ADQL 2HX9A 2OTUA 2RHEA 4AKQA 1RHHA 2NDGA 2J75A 1OGPA 3R8HA 4ZS7L 3S35H 3OTTA 3L95B 3F5JA 4JS7A 3O6FB 1R9FA 4YAQB 5I1CH 4TLSA 2YS4A 3KD4A 2FBOJ 4PV9A 1SDAB 3ZL2A 4YXGA 5AAPA 5LQBL 3W76A 1CBGA 3GUTA 4CW1A 5HHOA 2Y1HA 4JTKA 3GPEA 5I9QB 4RMTA 3MAWA 3IJ7A 2YXXA 5HATA 3MYZA 1M9HA 4CBPA 3Q8FA 3P4MB 3DX3A 4O16A 4KWUA 4GMSH 1EBHA 5IKCB 2J5LC 1O12A 2P88A 3NJJA 2B16A 4CC0A 2WPBA 1WCBA 2PB1A 3DNKA 1F3DJ 2P5WE 5E6RB 2OW6A 5ADOH 5HHPA 3ZHNA 1CJYA 1HL5A 3FCTA 4I7UA 1MLBB 5F1IA 3R1GL 3E74A 4AF0B 3M17B 1IU1A 5J89A 5EN2B 2X9WA 1TZHB 3D18B 4R7DA 2VJ8A 2Z24A 1JFXA 1UASA 4LVNB 3ARZA 5FW7A 2OMBA 4AAJA 1SOSA 4IOSD 1T2QL 1HSBB 3H2QA 4KEMA 1B2WH 4LHUB 4H41A 1VGKA 2P9RA 5KZDA 2AQ3A 2B1AL 4ZUTA 3SUUA 3BGJA 4PPTA 3SKNA 2K8QA 2OJZL 2O5YH 2OZ4A 3NQGA 1GAFL 4C1LA 2C7FA 1B54A 4AMAA 1U8CA 1IAMA 2GSIB 5CAKA 4M5YH 4LZKA 2VLRB 4B96A 4DVOA 2NQDA 4JCMA 4P5TD 3TEVA 4PY7B 1LUCB 1A5MC 4NC0B 4MWAB 4KWWA 4FXKC 5J06A 1V79A 1Q4NX 1FAIH 3FUIA 3BPWA 3GLEA 4TMPA 4YIQA 2YCEA 2FECL 5T9BG 4W86A 4K8RH 4I5XA 1NQBA 1GPWA 3UJTL 1A3HA 1H5VA 4GYPC 4XMLH 4IRZL 1DO6A 5GS2H 1NINA 3LHVA 3V6ZA 5C9UA 2YCKX 5AHIA 3QYNA 4JICA 4WFHD 2Y69B 5INCB 3QLDA 2CALA 3LBMA 3FYEB 4M62H 2J3SA 1FWTA 2EE2A 3ULUH 2HK0A 1D5BB 1JGDA 4PSRA 4H04A 1CFSA 1J0YA 2RGSA 5CEXB 4H8HA 4O52A 2PFHA 4PEKA 2X4OA 4PI0A 1FVEA 3FQ1A 2J21A 3TEYA 3L23A 3MCKB 4NPYA 2VN6A 5DI8B 1GKPA 3V4VA 1QFWI 2IAMB 3HC4H 1J86A 1FG2A 4JTLA 2EDMA 1LYQA 3AT9A 2OMWB 4LBEB 2IANE 4AXWA 1EOKA 1AHWC 5I26A 2YXGA 4FA3A 5REQB 3ETBJ 4IRJA 2VGLM 3CFQA 4O58H 4HB7A 3U6RB 1D9KA 4H0GA 3VXMD 1AI1H 2OPCA 2A77H 1EGMA 5ECUA 5K9OB 4NZJA 3ALXA 1S7TA 1YEIL 1NIUA 1UG9A 4JTJA 3OXRA 3VGAB 1ONWA 2ATKB 2X4PB 1I7UB 2VUNA 4GT0A 1KFWA 4QRPE 1J1PL 4IQEA 2E68A 4WSKA 5CSRA 2DORA 1AD4A 1MCLA 4JTDA 4KMQA 4A21A 4HSAC 6REQB 1U8KA 4JHZA 5F96L 3WLMA 1LRTA 1UBPC 3FH7A 4M6UA 2BVOB 1YEEH 1JCTA 4ZX5A 4QD2E 5G2NA 3JVFC 3QZWB 1NDWA 1T6WA 5BRQA 5BS0A 3DFTA 4HEME 2J44A 4PB5A 3IKCB 5D1ZI 4GO9A 4L6DA 2VH5H 3KJ4C 4ZMZA 3G1VA 3PL6D 4PFHA 1TE1A 1CFTB 4HZ6A 1RJZB 3FSUA 3ECBA 3WLSA 3GDBA 1WP6A 3CK0H 3H6AA 4N5UA 3DO7A 3M7FB 1E5JA 4XWGH 4KXBA 3VKJA 1DJGA 4UTHA 4XZ4A 3T0EE 3KPQB 4BXVA 1E6NA 2DIEA 1R8LA 2LTQC 4LAZA 3HVDA 4L3EE 2EPKX 1DBBH 1OCWH 2VDOL 5CG7A 3WN5C 4WSGA 1TR9A 1O5KA 3W9DA 1UT2A 1IARB 3ZJ6A 1CXEA 4PBVC 1P9MA 5DJCB 2X6MA