5BRQA

Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea)
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
555
structure length
555
Chain Sequence
NPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDNGYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKEAASGKENLYRDFYIWKDMKPNGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYEMMHFWFEKGIDGFRLDVINVISKDQRFPDDDEGDGRRFYTDGPRVHEFLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNFHHLKADYPNGEKWALADFDFLKLKKILSEWQTEMNKGGGWNALFWCNHDQPRIVSRYGDDGKYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRILKEAGKPEAEIIEILKAKSRDNSRTPVQWNGEENAGFTAGTPWIPVPDNYKEINAEEALNDPDSIFYHYKKLNELRKEFDIITTGDYQLILEDDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIEGYDAKVLISNDTDLPESFKRFTVKPYQSIVYHLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glycoside Hydrolase Family 13
publication title Bacillus licheniformis trehalose-6-phosphate hydrolase structures suggest keys to substrate specificity
pubmed doi rcsb
source organism Bacillus licheniformis atcc 14580 = dsm 13
total genus 209
structure length 555
sequence length 555
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.93: Alpha,alpha-phosphotrehalase.
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5brqA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5brqA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 5brqA02
2J77A 2YA0A 2AAAA 2XN0A 2DSKA 1CBGA 2HISA 3BH4A 3NDYA 1HKIA 3GH7A 4V2XA 3K4DA 1BGGA 3EDKA 4NXKA 5A94A 2DGAA 4GI8A 4OJYA 1HIZA 3GH4A 3N04A 4JCMA 1QX1A 1E6SM 3WL1A 4AIUA 3WQ8A 3BLPX 2JF7A 4AEFA 4HPGA 4NSBA 3T08A 1JI1A 1Q6CA 1H09A 3A4WA 3NSXA 4DUXA 3A23A 1UZ4A 1US3A 5FCZA 2XGIA 1W3KA 2J7GA 4EK7A 3VMPA 4IPLA 2VNCA 3W28A 1X6NA 3WUEA 1ISVA 4U33A 4FK9A 3THCA 1JDCA 5GNXA 3ZR5A 3OB8A 1GOMA 1JGIA 4D6HA 4BQ3A 5BWFA 1WPCA 4MB3A 3HZ3A 1UZ1A 3WUBA 4BCEA 3CUIA 3K8MA 5JIWA 4UFJA 3SCVA 3GXIA 3DDFA 4NZCA 1K9FA 1LLOA 3BAJA 3DYOA 1KXQA 3MKKA 1N82A 2NT0A 3LXAA 3GH5A 3PTQA 4KH2A 1W9VA 2WC7A 1ODUA 3RIKA 3W0KA 3LRLA 4M1RA 1J0IA 3GBEA 4XX6A 1U30A 1LWHA 2Q8XA 3N17A 2D20A 2X2YA 2WVUA 3ZR6A 1CWYA 1XYZA 1W3HA 3ARUA 4LGXA 2OWWA 1OM0A 3A5VA 2GVYA 4GIAA 2WSKA 1HF6A 1G01A 1B3XA 3BUBA 1W9PA 3GNRA 4P8WA 4PUDA 2BVDA 1EQPA 1E4LA 2J47A 4URIA 5LA2A 3CHFA 1WNOA 2D1ZA 5ECUA 3CMJA 1CXHA 3VUPA 2Y8VA 4WJXA 2J79A 2XFYA 3DX1A 4A4AA 2FGZA 2J8FA 3DX3A 3UG4A 4F66A 1QI2A 1B31A 3OZOA 4LXFA 3WH5A 1GHRA 1AVAA 3I3BA 2W62A 1BQCA 1FA2A 1UKQA 2WC4A 1V3MA 1B2YA 1UKPA 3EJTA 1V3LA 3I3DA 3NUKA 4TTGA 3WQ6A 3BLBA 2X09A 3W4RA 5DFAA 2IXVA 4OGZA 1SMDA 3MV11 4J27A 1E0XA 3BSHA 5AYIA 4GO9A 2D0GA 4JFWA 5D9PA 4UOQA 3SCOA 2QV4A 2G3MA 1NQ6A 1YHTA 1JZ3A 1F4AA 3ARZA 4MJ2A 1V03A 4MB1A 3W24A 3VO0A 5CXPA 4UQBA 2WPGA 5C8BB 2EADA 1TA3B 1UD3A 1C7SA 5CLWA 3BCFA 2WMIA 3AROA 3VGHA 3POHA 2WYSA 1US2A 3VX0A 1B3WA 3ZQ9A 3BC9A 3LRMA 5IXEA 2D3NA 4CD7A 3GXMA 2W63A 1UD5A 3L4XA 3KLLA 4U3AA 4AIEA 2DSZA 2DH2A 2IUZA 4DWSA 4AD1A 5ABEA 2D2OA 4HA1A 2OW6A 2A3BA 4MADA 1FFQA 2CIPA 4QCFA 4V27A 2YBTA 4QLLA 2DQXA 4MDOA 3WD0A 2OSXA 1C90A 4Q7NA 2EPMX 4BS0A 1V3KA 5IHRA 3GXNA 1TG7A 4FNSA 4GO8A 4YHEA 3VDBA 1E1EA 4S3KA 5EB8A 2Y4SA 1AQHA 2VZUA 2BHZA 2J7DA 2XHYA 2DPEA 1E3XA 4E8DA 1IT0A 3L4UA 4ZXLA 3AHTA 2YFOA 2OWCA 1UD4A 4W8LA 3VINA 2DSUA 3APGA 4PMNA 2J7EA 4L4OA 8CGTA 4P7QA 3U5YA 3RDKA 3WUGA 5A1AA 4ML4A 2DT1A 1NWSA 2YIHA 2CKSA 1CDGA 4AZ6A 3NYDA 2JEQA 2WNWA 3CZ8A 4P7RA 4ZE4A 3RJXA 3BXWA 4S3JA 3D5HA 2XGBA 2VOTA 2XTKA 3PZMA 5F7UA 4GINA 1UHVA 3FAWA 5E1QA 2O9RA 3THDA 1JAKA 4HA4A 4WLCA 5BCAA 2J4GA 3UR8A 2WANA 3WNPA 2XSBA 2ZUVA 3WL0A 2WCSA 4HA3A 3ZM8A 1H3GA 1JYWA 3CTTA 4D6DA 2W61A 1JNDA 1H2JA 4TOQA 3BAKA 4HOXA 1E0WA 1E72M 1QNPA 1CGYA 1BSIA 1KGXA 1XH2A 3BVXA 4H2CA 2F1BA 1PIGA 5D9MA 1VEOA 3T09A 5CQ1A 2WHJA 3AOFA 3BMVA 5BROA 1OBAA 2PB1A 4AMCA 1GJWA 4H8UA 1G9HA 5FD0A 1C92A 2WBGA 1F4HA 3AISA 3CUHA 4P7OA 1GOKA 3S6TA 2C8NA 2V3FA 1O7DC 3BVWA 3SUSA 3AXHA 2XG9A 3VVGA 3K4AA 3LX9A 1QBAA 3U7BA 4W84A 2D0HA 5E09A 3AIRA 3WQWA 5DMYA 3CZGA 1ECEA 5FKYA 4PTWA 1J10A 1HKKA 3WKZA 3O9NA 3VM5A 4TX6A 1A47A 3GNPA 1OIFA 4QDMA 3VM7A 1CGXA 1WB0A 4WIWA 1A3HA 2F7RA 3ZO9A 1B9ZA 1JG9A 1FOBA 2YLLA 2GK1B 2WWDA 2J74A 1JIBA 1D7FA 1E43A 2MANA 3QHMA 4ATLA 2V3GA 1G1YA 1GZJA 3KZSA 3NJ3A 1M04A 3M6DA 1TCMA 3N9KA 4W89A 4GZEA 3W29A 3FW6A 4JFTA 2ZOXA 3PZ9A 4WKHA 3QHNA 2GJXB 2BXZA 2FE0A 3OGVA 3DX4A 9CGTA 1DWIM 3DC0A 2ZUWA 4N42A 1KBKA 5I5RA 3NCOA 4D6EA 3AHYA 4LPCA 3S5ZA 2VCBA 1KXTA 2ALWA 3PZTA 1QNRA 2VZTA 4R5EA 1GOWA 1GCYA 3SUWA 1UH2A 1PX4A 1UG6A 4XV0A 5A8PA 1ODZA 5HBFA 2E9BA 1JI2A 4ATDA 3FY1A 4PSRA 4TUFA 2UY5A 2BY2A 1UOKA 3ZJ6A 3L2MA 4JCLA 4AC1X 4J3WA 3AS2A 2WHKA 3CZEA 3VX1A 5HOSA 2WZHA 5A8OA 3VD4A 1EIBA 3ALGA 1J11A 2YLAA 4P7LA 1W3LA 1VAHA 1FP9A 1MQPA 1V6XA 1PIFA 2CXGA 2VVSA 4CCDA 3KL3A 2YJQA 1DWAM 2BVYA 2FH8A 1HJWA 3WF1A 3L4ZA 3AHXA 2D23A 3VIMA 2YBUA 5E70A 1XSJA 3CMGA 3UG5A 1DWFM 1JFHA 1XC6A 3WDRA 3SCTA 1OT2A 3LMYA 3U7VA 2YL8A 1JAEA 3ARXA 1E4MM 3SCSA 2CPUA 4JAWA 3RCNA 1NOFA 1H4PA 4OOUA 7A3HA 1CXLA 4AZ5A 3EMCA 3BAXA 3TTOA 3GXPA 4W5UA 5M3WA 2ZIDA 4UFMA 3B9EA 1WKYA 4DO4A 2QMKA 3A6OA 2F61A 1W2VA 4FLOA 3BAWA 3OGRA 3BAYA 2QLYA 1VB9A 4AYGA 1WO2A 5M17A 2HVMA 4ZEPA 5ABFB 3KE0A 5I23A 2WCGA 4UFLA 1DWJM 2EACA 3FN9A 3ZJ7A 1QHPA 1W9UA 4UZSA 6TAAA 4C7DA 2F7QA 3HMCA 3FHQA 3MSGA 2O9PA 2IXUA 1OWQA 3KL0A 3LXBA 1EDGA 3LPOA 2XVNA 1FH7A 4ACZB 1RP8A 4J3UA 3BVVA 2VCCA 3AJ7A 4FMVA 1J0HA 2X2IA 1WE5A 3BMWA 5I77A 4K68A 5A6BA 1GPFA 1ZB5A 5BYWA 1WAWA 3WNNA 2BS9A 4D6GA 5AC4A 1M53A 3MI6A 5HPOA 3JUGA 1JZ5A 4W88A 4AD0A 3WEZA 3W81A 1GQIA 3VIIA 3OA5A 2GJRA 1W1VA 3ARTA 1BFNA 3W25A 3OLDA 4ZXOA 1HL8A 4W7VA 3D3AA 2VCAA 2WW5A 2IGTA 1W32A 2ZUSA 1BG9A 2XWDA 1R46A 4Z2GA 3ECQA 3WH8A 3N18A 1QVBA 3QOMA 1R33A 2PBGA 3PN8A 4M24A 5HXMA 3WY4A 5FOOA 1KWGA 4EKJA 1Q6EA 4M8UA 1TVPA 3CZJA 3E1F1 3GDBA 1EGZA 4PRWA 4WKFA 2X2JA 4WF7A 4UFHA 3A4XA 1TQWA 2WKLA 3AIEA 3HN3A 3VSUA 1R7AA 1QOXA 4J3XA 3RMEA 3AMKA 1H0GA 5E6YA 2G41A 2XSAA 3AMCA 3WD2A 5IHSA 1OINA 4JKKA 5HPCA 3O6AA 5A8NA 4OOZA 3MMUA 2DIEA 3PZGA 3PZVA 1XD0A 2V5DA 2ZWZA 3AIBA 2BHUA 4J3VA 1EQCA 1ISXA 2ZUUA 2VZVA 1JYXA 4Z2KA 3SCUA 5CG0A 4DO6A 3AQUA 2WM0A 5CJ5A 2EQDA 5DEZA 2WMHA 4KMQA 3VSTA 1R34A 2J75A 3CUGA 4UFKA 3LRKA 4E4PA 5EMYA 3WBAA 2QMJA 1DWHM 2CERA 4UR9A 1H41A 4R27A 1JZ6A 4OKDA 3K46A 4XUYA 4FLRA 2WCAA 3AXIA 4ZE5A 3SCQA 1S46A 4D71A 2XN1A 2VX5A 3ZOAA 4W5ZA 1VF8A 1U33A 2BY0A 1D2KA 4QLJA 4LYRA 1W91A 3J7HA 2VRKA 1GORA 1J0KA 4M29A 3A3HA 5CLTA 4Z2HA 4UNIA 3AS1A 1JF5A 1XSIA 2AMGA 1UQYA 4FF5A 3UR7A 1H11A 1CNVA 1HJVA 1K9EA 3ZT7A 4PBGA 2EPNA 3NIYA 3EDJA 5FIPA 5BXTA 1MW0A 1ESWA 2EEXA 1UWQA 1JZ4A 4FNTA 4AZGA 3VIHA 4FNRA 2J7FA 4CD8A 4XZBA 3S5YA 1BF2A 1O7AA 2CKRA 3SIMA 2JE8A 2D73A 1CENA 1ZBVA 5JBFA 5CSYA 2GK1A 4OZOA 1MQQA 1R85A 4LX4A 4PCSA 2A3AA 3O2LA 1C8QA 1V02A 3VGBA 2VZOA 1PBGA 3AMDA 4KRUA 2GJXA 1EA9C 3K8LA 2WHMA 4IISA 3MMDA 1E1FA 3GXTA 3LPGA 5I2UA 4MNMA 2BHYA 4U31A 4AD3A 1UWIA 1BVZA 3UETA 2ZX5A 3IJ7A 1ZU8A 1WZAA 2BVTA 4KRTA 1E6NA 4OUEA 1HP4A 1E4NA 1JNEA 1VBRA 4W7UA 3CC1A 1E70M 4RE3A 1WDQA 3CUJA 3ARSA 1W9DM 1C93A 3W37A 1CEOA 5CPTA 3K8KA 2W92A 5A2BA 4HZ8A 4AY1A 1EO7A 4AD2A 5JUVA 2XYLA 1DHKA 1I1WA 2ZUMA 2D22A 2DSWA 3PTKA 1JXKA 2VX6A 2VC9A 2W66A 2VMFA 3QHOA 4W86A 1UR0A 3QR3A 3AS0A 1CXKA 4GI9A 3CUFA 4B3KA 3LPFA 3U57A 1GHSA 1QPKA 1E4IA 4HP5A 5A6LA 3HG2A 1SYTA 3AIQA 4JZ5A 3VGFA 1E9LA 3WF3A 5KZ6A 1GOIA 3POCA 1LG1A 1V6WA 4IPNB 1Z32X 1NOUA 4UQAA 4AZIA 3WDHA 4QLKA 1VIWA 4W8BA 2ZE0A 3M07A 1EOKA 1JFXA 1UH4A 3VIKA 1J0ZA 5HNNA 1B3VA 5A95A 1KGWA 1E40A 4CD4A 3CIVA 4HU8A 1UQZA 1XCXA 3EJRA 4U3CA 3IJ8A 1H1NA 3EJUA 4GZIA 1HVQA 1J18A 2YA2A 3MUIA 5I78A 3TTYA 1UD6A 5AC5A 3AZSA 3VIGA 1H49A 2XFRA 4PUEA 5I0DA 1XGZA 2CHOA 1LL4A 3WQVA 5DT5A 5A8QA 4B16A 1K9DA 4AZBA 1E6QM 3VDHA 5E0CA 1GONA 2YOCA 2CITA 4NRSA 5ABFA 4H8HA 3VNYA 3PBGA 1EDTA 1KQYA 2YKKA 4PYSA 4FLQA 3T2QA 4DO5A 1QW9A 3GZAA 3WELA 3WD3A 3AFBA 4CU8A 1QBBA 1BHGA 3T0DA 2EO7A 5A6SA 3AS3A 3KEHA 4PMRA 1R7OA 4PEEA 4X0VA 4F9DA 1IZJA 3ARQA 3AHZA 2VR4A 3MO4A 3DECA 1E56A 4PCTA 1AMYA 3CV5A 1HNYA 3EJSA 4U5IA 3AHVA 2ZXBA 7CGTA 4MNKA 3T2PA 3CZKA 3HG5A 1H5VA 4JHZA 4DWSD 1GQJA 2X2HA 1OT1A 3BVUA 1JZ2A 3DX2A 1ZL1A 2NT1A 3A21A 2VJXA 1XRVA 2YL5A 1TQSA 4TVDA 1WZLA 3F5JA 1PZ2A 5BXRA 3PZQA 2XM2A 2FHBA 1ITXA 1OCQA 4BF7A 4CVUA 2J62A 4CN4A 3H53A 1UKOA 1DP0A 3W6LA 2ZX6A 4D1IA 2WWCA 2X8RA 1OSEA 4M81A 1R47A 4DM1A 3T2OA 4HZ7A 3IJ9A 4ZFMA 2XPKA 3EJPA 5GPRA 1IV8A 3MUZ1 3HG4A 2PWFA 1ZBWA 2X1IA 4PMYA 2GSJA 4JFSA 1O6IA 3VILA 1JD9A 4TXEA 1UKSA 2QPSA 4GQQA 4W87A 2WMJA 5C71A 4W85A 3L2LA 4CU6A 3IAQA 4JHOA 3ZIZA 4TVCA 2CHNA 4B15A 3WIJA 1QHZA 4H04A 3DYMA 4UQCA 2ZUNA 3FXYA 3VPLA 4ACYA 2YL9A 2YFNA 3WH9A 3EMZA 4QAWA 1TR1A 5A6KA 2ZICA 1GQLA 3GYCA 4QP0A 5CPQA 2D24A 3M46A 1E0VA 1V0KA 4C7GA 5M5DA 1CGWA 3GTNA 4D6CA 2G3NA 4F8XA 3HJEA 1VEMA 1UWRA 4YHGA 4F79A 4C7FA 4D1JA 4WSKA 4PMQA 1TQTA 1V3IA 2J78A 1UR8A 3EJQA 4PMZA 5A2AA 5ABHA 3B8SA 1PZ3A 3VIPA 2DDXA 1E6ZA 2A3HA 2VTFA 3ARVA 4CN6A 2ZX7A 4DM2A 1HTYA 3CGTA 1WP6A 1X6LA 3F5LA 1VFOA 1LL7A 1OIMA 2WKGA 2XIIA 4EAMA 2G4FA 2EAEA 3PHAA 2JALA 1W1YA 3DHPA 2FHFA 3CBWA 3OLIA 4MDPA 4AZCB 3L4VA 1GNXA 1HJSA 5M03A 4A3HA 2XWEA 2Z1KA 5CGTA 1E5NA 3VIFA 1J9YA 1RD6A 2WVTA 4NX0A 4UQDA 1BAGA 1MFVA 2YDQA 3CHEA 1AQ0A 1UYQA 3WENA 1I1XA 4E2OA 1VEPA 2V3DA 4RE2A 2Z1SA 2OYMA 5DO8A 3TA9A 2EABA 1UWSA 1PJ9A 4AD4A 3WQ5A 3EDEA 5BRQA 4PTVA 1K9TA 3VD7A 3BGAA 4CN1A 1DTUA 1YQ2A 4HMCA 4P8UA 1C91A 2A3CA 1TQUA 1ZJAA 2VT0A 4DWSB 1XYFA 4PMXA 1JXJA 1NP2A 1KBBA 2A3EA 3VTRA 5E0FA 2WLZA 1V3HA 4GQRA 3VDCA 3QOKA 3SCWA 3W82A 2FH6A 2TAAA 3SCNA 2XVGA 1NP0A 3MV01 4MAZA 3GNOA 1KR0A 2UY4A 2ZXDA 1HXKA 1UH3A 1K6AA 2EPKX 3NSNA 3OLEA 2WXDM 4BQ5A 3TTSA 3RM9A 2XIBA 3LPPA 1GQKA 2GDVA 4JL2A 2WAGA 1TA3A 4MNLA 1VBUA 4CD6A 2OSYA 4GKLA 4XB3A 1V3JA 1VFFA 2FHCA 4AW7A 5I6SA 3W38A 1CZ1A 3VDAA 1QWNA 5CSUA 1UASA 3AZRA 5GNYA 2VURA 2O92A 1FP8A 2J7CA 1VFUA 1LL6A 1HKMA 5ABGA 3I3EA 4JKMA 4HZ6A 4W7WA 2Y8KA 4PN2A 3VKKA 4FLSA 1CYGA 3SUTA 3OGSA 2X0YA 4PMOA 4P8VA 2BY3A 4JFVA 2CBIA 5EFFA 4J28A 1KCKA 4YN5A 3W26A 1UR1A 3AYRA 3FNDA 5EFDA 3SURA 2EXOA 3RM8A 3L4TA 3F5KA 1JDDA 3WFLA 4TVUA 2VVNA 2VX7A 4PTMA 1HVXA 1J01A 4BQ4A 1BG4A 1WZKA 2CEQA 3RJYA 3T0AA 3DHUA 2JF6A 4AISA 3D52A 2XVPA 3VGDA 4QCEA 5D8WA 3VMNA 1GUVA 2YDRA 1FHLA 1LF1A 4GPNA 4MNJA 3MS8A 5DT7A 1HX0A 2BY1A 1BPLB 2GJPA 1TMQA 2VRJA 5JBDA 1JF6A 4WSJA 2W67A 2E40A 3RPMA 1PEZA 4CGTA 5BRPA 1E6PA 3KL5A 2GUYA 1NH6A 4A3YA 4BA0A 3ZMRA 2UY3A 2UY2A 1L0PA 5IFTA 4FNPA 4AD5A 3ARYA 4UQEA 1FFRA 1MXDA 2BV9A 2E0PA 3WD1A 3AMLA 1TQVA 3RO8A 4LYQA 4IUGA 2OW7A 4HMDA 3TTQA 1VFMA 3UG3A 3NSMA 3UCQA 4F9JA 1CGTA 5A6AA 3WUFA 3WDQA 3WMBA 1V6UA 3WMSA 3MANA 3F4VA 1G5AA 1CLXA 5A6BD 1NWRA 1QNSA 4Z2JA 3WNOA 1XSKA 1BYCA 2ZX8A 2B31A 1R87A 3M7SA 1JZ8A 1C8XA 4M80A 2CNCA 3WNKA 1TZ7A 3GXFA 2JIWA 2XFFA 2UWFA 5I24A 1HN1A 4LYPA 1J0JA 1H0IA 3OG2A 3RM4A 3CZSA 1UKTA 5A69A 4H41A 1E71M 5D4YA 4JIEA 1KFWA 2CETA 1KCLA 4AMWA 4WKAA 3UESA 2YL6A 1JZ7A 3K1DA 2C0HA 1E55A 3WDIA 2GFTA 1UA7A 4ATWA 3AMGA 1EH9A 2Y5EA 1PPIA 4PTXA 1XHGA 1W9BM 2ZXQA 3A4AA 3SCRA 3VD9A 1PS3A 3AI0A 2PWDA 3CZNA 4NF7A 2V5CA 2WSPA 5GQBA 4W93A 1QI3A 1C8YA 1WDRA 3WBEA 1U2YA 2J7HA 3GXDA 1I75A 1EDQA 5FL1A 3WSUA 3TP4A 3GBDA 1CXEA 3IK2A 5IFPA 1P6WA 1FH8A 1M03A 5I3DA 3WF2A 4AYSA 1UD2A 4P7NA 1SFSA 1V02E 3ZJ8A 2E9MA 3OBAA 3VU2A 3WNMA 2BXYA 3AICA 4P8XA 4M56A 1HJQA 1SMAA 4MAVA 3BUDA 1KWKA 5LA1A 1MW3A 2DSVA 3W27A 1MYRA 5BXSA 1CECA 1DEDA 4J3SA 3BUIA 4B9ZA 1JDAA 1XV8A 3N13A 1VRXA 3CO4A 3AIWA 4B3LA 4RE4A 4J3TA 3BLKA 2XVLA 3DDGA 1BYDA 4HMEA 5LA0A 2FDMA 4BZYA 4EE9A 1B0IA 3VD3A 3L4YA 1OD0A 1UWTA 3WMCA 4UCFA 6CGTA 1E15A 1E73M 2G3JA 2BFGA 2V3EA 2WVVB 2DT0A 5CPSA 1BGAA 5LYRA 1Y7VA 1KQZA 2PBOA 4U5KA 2CBUA 4AZCA 4D72A 4UZUA 2VO5A 4AEEA 1V08A 1TE1A 2XM1A 4GXPA 1CXFA 4U2ZA 2EPOA 1JD7A 2X05A 2F7PA 4CVWA 2VRQA 3CHCA 2ESCA 1ISYA 1HWWA 4FNQA 1GOOA 1CGVA 3KLKA 4AZHA 3CZLA 1QHOA 3OZPA 1CTNA 5CZKA 2DIJA 5E9AA 4UOZA 2OLHA 3WF4A 2E8YA 2VZSA 1R86A 4AXNA 1Q6FA 2QPUA 2CBVA 1PX8A 3W6MA 4B9YA 4HTYA 4XZWA 4HPHA 3II1A 3T0BA 2F8QA 3BAIA 3FHAA 1E3ZA 4FNUA 3PZNA 2WMGA 2OYLA 2WZEA 3D50A 4DWSC 3VNZA 2G3IA 4KGLA 1R8LA 3PZIA 5A2CA 4AWEA 1QI4A 1EOMA 1UA3A 3H55A 1B3YA 3WNLA 2PF0A 1M01A 1XH0A 1UR4A 3ALFA 3CPUA 4ZENA 3PZUA 1B3ZA 2G8ZA 3OIHA 1TVNA 1EO5A 4CU7A 1NOWA 4JL1A 3WY2A 4CKQA 1GOQA 1MQRA 1CGUA 1HP5A 3VGGA 4H8VA 3ZT6A 2VX4A 5A6JA 4X0NA 4ACZA 3A24A 1CXIA 3U5UA 1ZJBA 3G6MA 4W8AA 1E6RA 3D4ZA 2QHAA 3VIJA 5A3HA 4MPKA 1MXGA 4CUCA 2FGLA 1SZNA 5D9OA 1EHAA 2Y2WA 2WMFA 1M7XA 4KWUA 5D9NA 4J7RA 1UD8A 3G6LA 7TAAA 4DUVA 4AMXA 1V0LA 3WY3A 1X1NA 3CLWA 4LQ1A 3VOCA 1BYAA 2PC8A 3TV8A 2E3ZA 1PAMA 5FL0A 3WDJA 4BQ2A 2BNJA 4CCEA 2WK2A 4D6FA 2DT3A 3WDPP 2QF8A 4PMDA 3QGVA 1ZS2A 1NM9A 4EANA 1B30A 3A47A 1WDSA 1KR1A 5D8ZA 1IZKA 1Q4NX 5IDIA 1BLIA 5TD4A 1OGBA 2PWGA 1GVYA 3UERA 2C7FA 3EYPA 1OD8A 2ZWYA 1KXVA 2DEPA 2CYGA 3L4WA 1Q6GA 3W53A 1OGGA 3FAXA 1G0CA 5I79A 1LJYA 2ZUTA 1WCGA 1JL8A 2D3LA 1KTBA 1QWUA 4X9YA 2JIEA 3D4YA 3VIOA 3MMWA 3B9DA 2F7OA 3EDDA 3MU7A 4GI6A 4M82A 1C7TA 1VENA 4NI3A 1QNOA 4MB4A 1TFVA 3ARPA 4DUWA 4V28A 4L4PA 1E5JA 1W2PA 1MFUA 1V0MA 2VL4A 2XN2A 2Y24A 3WH6A 3BCDA 3DYPA 3A22A 3WEOA 1HJUA 1B90A 1J12A 3AYSA 2OWXA 3CHDA 1XD1A 3NDZA 2JFEX 4TTUA 5CGMA 3WQ4A 1KGUA 4QFUA 3PTMA 2VUYA 5A6MA 4UQ9A 4Q22A 2PI6A 1AQMA 1ITCA 1VJSA 1QW8A 1OB0A 1GVIA 2O9OA 4HOZA 2CESA 1EHNA 1R75A 3BUQA 4PMVA 3WN6A 1E6XM 4KGJA 1RH9A 2WBKA 4MTVA 3KWXA 2E8ZA 5JBEA 4UFIA 2W4XA 1GW1A 5GNZA 1C3FA 3ARWA 2F2HA 4MB5A 5EBAA 1HXJA 2F1AA 1NARA 4Z2LA 2XUCA 2W91A 3UEQA 1L8NA 2EBNA 1J0YA 1UWUA 2YDSA 3BUPA 3MSDA 1ISZA 1UR9A 1DWGM 4CD5A 2VQUA 3WH7A 1NWTA 3LXCA 1PX3A 5HDRA 2VI0A 1UR2A 1QI5A 4TX8A 1KB3A 1SR0A 3WEMA 5BXPA 2WZIA 4IM4A 3EMQA 1FH9A 2EPLX 3AXXA 1LG2A 2W5FA 2J7BA 3S2CA 1G94A 3N15A 2WMIB 1CLVA 3EBVA 3BVTA 2OYKA 3D51A 1JYNA 1FHDA 3IANA 3B9AA 1XCWA 3ARRA 4UTFA 3ZT5A 3IGUA 4HU0A 2VQTA 5DF0A 2CCRA 3SUVA 4D6JA 3VSVA 5A8MA 4WK9A 1KTCA 4NXSA 1RP9A 1ISWA 1ZBCA 1W3JA 3WFZA 2VR5A 2WC3A 2DH3A 1V6YA 2FYVA 3VMOA 3TOPA 5C70A 3EDFA 8A3HA 4PSPA 1VJZA 3AIUA 3MUAA 3N12A 3TONA 1BVNP 1HJXA 2NW0A 2AOSA 1V0NA 2WVVA 3IAPA 1UUQA 2YA1A 3DX0A 2RGLA 4NZJA 4GZJA 1CPUA 1HL9A 1W1TA 1B1YA 3OLGA 2F18A 4HOWA 3N1AA 2WB5A 4CCCA 3N11A 3ZSTA 3AZTA 3RILA 4OBSA 1RPKA 4U2YA 1TUXA 4AZ7A 1GJUA 3MUY1 3SEPA 3WF0A 1V6VA 2V38A 1QNQA 3ZJKA 2PWEA 2O9TA 3SUUA 2WHLA 1KXHA 4D6IA 2GDUA 2X0HA 5E6ZA 1WZMA 3ZSSA 5JIPA 3GM8A 1LWJA 2PWHA 4Y7EA 3CH9A 4MJ4A 1ZBKA 1HT6A 4JFUA 4UOJA 1W9XA 1W1PA 1MVYA 4JKLA 4NZFA 2XJ7A 3PZOA 2NSXA 3HG3A 4OIFA 1MW2A 1MWOA 1LQ0A 4RL3A 2E9LA 1JYVA 4H7VA 2ZX9A 4Z2IA 1XH1A 2J25A 1NWUA 2EJ1A 2OSWA 2RGMA 1BTCA 3WD4A 2CBJA 6A3HA 2WMKA 4NRRA 3AIVA 3SCPA 3HU7A 4OBRA 2DT2A 1OGSA 4YPJA 1EXPA 5AYBA 3H54A 1WDPA 2WVSA 1CIUA 1BYBA 2E4TA 1Q6DA 4PMUA 3BSGA 3VD5A 2XVKA 5AY7A 2JEPA 2J8GA 4N0RA 1D3CA 4E8CA 2ZXAA 1QI0A 4AIOA 1T0OA 2WLYA 2D0FA 3VGEA 3WY1A 1MW1A 5KEZA 1HKJA
chains in the Genus database with same CATH superfamily
3MLZL 2O5NA 1G6RH 2XWBB 3NDYE 5INDB 3ZHDA 3R10A 4NXKA 1MZRA 1J5IA 3DJZA 4P5SA 3OO2A 2BZCA 3M8OL 2DUZA 3SGJC 1G4MA 1Q6CA 4BFIA 3I6SA 5HYJB 4IBWA 1K6WA 4YHZH 3C08H 1G7IB 1UB6A 2BINA 1W1B1 3W28A 2H8PB 4Y4HA 1IC5L 4JM2F 4FK9A 1HW6A 3RWCA 3V6FA 1AI1L 2WO2B 3S2AA 1IO4C 1JZFA 4MB3A 1A4LA 3G1VA 3WUBA 3OD3A 4ZUUB 3QZWB 5JTWA 5F96L 5JA9A 3V8OA 4EEEA 2ICEB 2BWDA 2NT0A 4U7MA 4KH2A 4M7JH 5JIHA 4F92B 1AHMA 4XX6A 3LDVA 1GGOA 1N5AB 5D6CB 2WYTA 4X5PA 2INEA 1OSPL 5H35A 2CBMA 1U83A 5AW1B 1B3XA 5LGHH 2BVDA 3WS3B 2D1ZA 3VXNB 2ZWNA 1M6OB 1SNRA 3DX1A 1N5YH 5C0AD 4MGGA 3NFUA 4S2SB 2PP8A 4XPHH 4BY3A 1I8IB 1DJYA 1XLCA 1UKPA 5K3VA 1BWLA 2BH0A 5DFAA 5B8CA 1R5IA 4UOQA 1TKKA 1KCVL 5LB1A 2GBUA 2DYPD 1G7HB 1C7SA 4AM0B 4EKXA 3H6AA 5AW9B 5SWUA 4LHUA 4KWSA 2D3NA 2REQB 4IPIA 2ITCB 2PCEA 4BHYA 5H1WA 3P1VA 4QSFA 2YBTA 3LQZA 3PHOB 5AWNL 3SI9A 4F1SA 1DVTA 5IHRA 2VFGA 4PVNA 1VPOH 5FKAB 4FXJA 4U1LB 1NBZB 2ZADA 2I85A 4J40A 4HNLA 5F7FA 4JHAH 3ZYOA 1AO7B 3SDAD 3TBWA 4Z5RA 4I5XA 1A1MB 4PJXB 1GYAA 1CT8B 1JHKL 3KPLB 3BRFA 2QCLA 4CNIB 2W9DH 3MKCA 3MFGB 3FLUA 2VE6A 4KF1A 3NYDA 3LQMA 3JV4B 5DRZA 3U25A 4WI9A 1NFIA 1OL0A 4GINA 4N2EA 3RPBA 1N55A 5FKPA 1F8TH 2R0WL 1GVEA 2X30A 3O6LL 1ED3B 3K81A 4K1GA 3X14A 1H2JA 1RK6A 2J4WL 1XFBA 4GT0A 1XRSA 3MROA 4M3HA 3GG8A 3WTVA 3EYFB 1IJNA 5EU3A 4AMCA 3NACL 4RDYA 4WWNA 2ROYA 4JO4H 1FTXA 3QMSA 5J3HC 3MYOA 3Q44A 2XWBA 5INDA 3KAAA 1FUYA 1XF3B 3GEFA 1OCOB 4JTFA 1EAPB 4OM1H 4HPNA 4NG3A 3T8VA 3NCFB 1X7TA 2AXWA 2R0ZL 4TX6A 3IU4L 1EJTC 1G7IA 1WFUA 2H32H 2H8PA 5DVNA 2DQWA 3QAQA 4K94H 4IHBA 1EEUA 1K02A 1EBPA 2D31B 3QZWA 2ZOLB 5IUCA 1I6NA 3S5ZA 1WKDA 3VNJA 4K8RH 3S88L 1B4JL 1RUQL 1GOWA 1BLNB 1PX4A 3UGUA 2HRWA 3XISA 1ODZA 2K9UA 4XHQA 1N5AA 5D6CA 4LNYA 4I5BB 5JLZA 3BX7C 1ZXQA 5IZ7A 4HWZB 1IIGA 5AVZB 5I1AB 3RB7A 2ZA2A 2J1KA 1EIBA 3WS3A 3US9A 2Y7GA 3IWVA 3VXNA 2XG5A 4F7EB 1M6OA 4JRLA 4QRRA 4WSGA 2OG9A 3MRLA 3NPUA 4S2SA 5E8NB 2ZKHL 5E1HB 4JUSA 5C86A 1DQWA 2WSQA 1CXLA 2NX1A 1H7OA 3NQIA 3NJNA 2X0SA 1OP4A 4BUHA 3K71B 2YUVA 2F9BT 3E0VA 3IM1A 5M17A 5D1XD 4XCYA 1SM3H 2YPVH 1B2WL 1G7HA 3WYZA 4ZB5A 5TE6H 1Z66A 1DBAL 4AM0A 4PJ8C 3MSYA 2PW2B 5FGBA 4CQDA 4DX3A 2BZDA 2GVEA 2VXQA 3EOLA 4OLXH 2REQA 2ITCA 5AZ1A 3THMH 4J3UA 5D2LE 4ZQCA 4Y6GA 3MHZA 3PHOA 1RIHL 2P76A 5A6BA 1HEJC 4YEFA 2IBZY 1P7BA 5FKAA 1XICA 4P2RB 4IKLA 2E75C 3WEZA 4LPYA 2GGGA 3CIWA 1IGTB 4UUIA 3WQGA 5AHFA 1BFNA 3OSVA 2WW5A 2UWEF 1AO7A 1KJMB 1A1MA 2PAJA 4A37A 2OLSA 4D8AA 3G9AB 1V7NH 1CT8A 3KPLA 4Y1AB 5LN4A 5KBMA 4UV7L 4CNIA 3DOSA 3Q7JA 4LLMB 3ITXA 3E1F1 4WKFA 1SDDB 5TNVA 3EG9B 3HN3A 3PDDA 4J3XA 3G1SA 3JV4A 2INZA 2XSAA 2XNAB 3IRZA 2O6PA 2V9TA 1XBXA 2CSPA 3NABH 1ED3A 3CSYB 4BFFA 4JM2B 4W4NA 1O7VA 2Z6JA 3IMTA 1FWXA 5DJXB 4FERA 4XMXA 3CAFA 4KJPC 2PW1A 4UU9B 4F40A 2HE8A 3ULAB 3K46A 2IQAB 4ZE5A 4XBMA 1WDDA 2Q8BL 3LZFL 5EEYA 3RTQC 2BW5A 4R4BB 5CJXC 3HFTA 1IGFL 2Z1WA 3QDGD 5CLTA 3AABA 3O6CA 1H11A 4CADB 5C2GA 1HJVA 3EGDA 2XRAH 1ESWA 4KK9D 2XV2A 2Y85A 3RVTD 1S3RA 4NQED 2J7FA 3LV6A 3VNIA 2V30A 3VNDA 2YGYA 1OGTB 2FTAA 4IF2A 4XPFL 2VC2H 3GRWH 3VOGA 3V0WL 1F90H 4WI5A 1T7ZA 3V0JA 3GU9A 1ADQA 1H6FA 1L9PA 4JTHA 1HOCA 4R33A 3HR6A 2E9GA 2NY3D 3LLXA 4K8RL 2MKWA 1BLNA 2IFFL 1JNLL 4ZXBB 5DVKA 3KVLA 3CC1A 3PREA 2DYRB 3CUJA 3FSVA 1YPFA 4I5BA 1TZOA 5IWLA 4HWZA 3FQ2A 5I1AA 1JRCA 5KVEE 1KFKA 3SPHA 2QBWA 1QTWA 4NQQA 3LM7A 3EYUH 3HNSH 2Y72A 3BICA 4OLYL 3LVEA 2F5AL 1EEXA 2ATPB 3KCWA 1V6WA 2FTWA 2IPUG 5E8NA 4FX7A 3S9IA 5EOCJ 2ZE0A 4YXKH 3M07A 4HF5H 1I3GH 3VIKA 4U1HB 1J8RA 4Y88A 3GVWA 1VGKB 3I6TA 4W1TA 5JYLA 1QUMA 4Q8MA 3JTBA 1JZDC 3EJRA 5DGQA 2KQMA 2BPBA 4ONVA 1HVQA 3TBSA 1I60A 1UD6A 3VIGA 5GJMA 2PPCA 5H91A 2GVLA 4B16A 3ILEA 4XE0A 2Z91B 1MQKH 4KY1H 1YBQB 3PBGA 4EBQL 4JG1H 4HCHA 4JDVB 4Y1TA 4AVKA 4NI8A 3WD3A 3D06A 2X6CA 3B7UX 1QBBA 4CNUA 3OJDB 4OLXL 3KEHA 1IZJA 1V55B 5T1KA 3QLLA 4IDJH 4K23H 4GO6B 1VYPX 3LS5L 4P2RA 5HQLA 4XC3L 2BIMA 2PPEA 1IGTA 1OT1A 3LZNA 2WZPA 8XIMA 4TVDA 4X7EC 4OUOA 4Q6IC 4JR9H 1KJMA 4DEPC 4IS6A 2J62A 1WFOA 1WEJL 5H6HA 3N3MA 1KCUH 1V7NL 4Y1AA 3NPZB 4XC1L 1HE8A 5BNKA 4LLMA 5EUKA 3RWEA 4GISA 3DSFH 4JQIA 1SDDA 2XPYA 2NY5H 1XC4A 5HI5D 4DTGH 2XNAA 4LCVA 4PODA 2PODA 2QV2A 1JD9A 5T1DL 1FJ1A 2ZQ0A 2WZTA 5CZ0A 3CSYA 3QUKB 1FGNL 5I1CH 3AY4A 2XQYG 4JM2A 3RWFB 3ZIZA 4WO4D 5E03A 1TWWA 3W1QA 4EI5B 2HLEB 2IPTH 5DJXA 5BV7B 1IX2A 1PKQB 3WIIL 4ACYA 4UU9A 3SDDB 2B1AH 4AUUA 3G5ZB 1FV1B 5JW4M 1P1MA 3PABB 3Q67A 3DVGA 3GTNA 4PWFA 4GAAA 1F6LL 3O6YX 1GKOA 3BLEA 4PP2B 5HSFA 1KN2H 3FCSB 4R4BA 1NPNA 3RAJL 1BFOB 4CN6A 1UACL 4JX5A 4DM2A 4BWLC 3OKEB 4CADA 5L9DH 1M2OA 2XRAL 2BGSA 4MDJB 2C34A 1KFEA 3NA8A 4ZFFB 5C6PB 2FQDA 2GQ8A 1OGTA 4W4OA 1DHPA 4BCYA 5GS1C 4I0CC 2QUTA 1VEPA 4DOHB 3PG9A 5D7LB 1KELH 1S2AA 4FEMA 5F6IC 3AGWA 5FEZA 4IHCA 3EDEA 3BGAA 5HYQB 4LAUA 3K3QA 4LSRH 4Q32A 3RGVB 1JXJA 5CBAB 3VTRA 1L6SA 2WJ7A 1JRBA 5DSCA 1EP3A 1DFBH 4GOSA 3QCUL 3NXLA 4B3EA 4N2BA 2QSVA 3CFDB 4WFHE 4RK8A 1TA3A 4MNLA 4GKLA 3PJNA 3H4FA 1FZKB 4L1GA 1CZ1A 3VXSE 1KLZA 1S2EA 4WVXA 2ATPA 4FNLH 2QIIA 3X1EA 4MMZB 4XNAA 1WYIA 4U1HA 3MBXH 1VGKA 4NYYA 3DROB 4POCA 5C3LD 1MI3A 1RUAL 1JEZA 4YHMH 3K6DA 2UWEB 4PE8A 1IGIH 3FPXA 3LD8B 4IOIB 1MNSA 1NCWH 4MMWA 1DVFC 2VVNA 2R29A 4PV9B 3CHXA 2Z91A 5J6HB 2QPXA 1YO4A 4PJ5E 1YBQA 3VGDA 4JDVA 3RHGA 4FAAB 4YSAA 3ZDWA 3VVWA 2MEJB 4I0KA 2GJPA 1QRND 4L56A 4GIOA 1JF6A 4MFEA 5D7KD 5GS0C 3ENLA 3QPQD 2DIAA 3UACA 1SHXA 4AD5A 1HCFX 4IDJL 2BV9A 5TH2A 2YBGA 4PBVC 2VDNL 1IU1A 3NEEA 1NMAH 4W9GC 4LKCB 5I66B 3GSWA 3N40F 1R2RA 2MSPA 2O5YL 3RVWC 2QJMA 4LVHC 3I6KB 4NAFA 1USZA 1P43A 1CLXA 2KZKA 3WNOA 4AC7C 3JZUA 1QAWA 3CAVA 1O6VA 3S5OA 3Q1SH 5JH1A 1WFTA 3RF9A 2GGIA 3FDWA 3TFCA 4F58H 2DI8A 1JUKA 1F3RB 4ODTH 1IFHH 5CBIA 1YEFL 4A05A 5C0BE 3B6SB 3BQUA 1KM6A 1F3WA 3I68A 3SCRA 3VD9A 1PS3A 4G7EA 1SLXA 1I2OA 3QTPA 3QUKA 4C6IA 3GXDA 4CQBA 1V8EA 4DJEC 3RWFA 4EI5A 4AT6B 2YB4A 4JPWH 4UTTA 3WNMA 3SDDA 2XZ9A 4M56A 1FV1A 3QR2A 2XPGA 1CECA 1JDAA 2BTMA 5AALA 4PP2A 5T5FH 5TDNB 3WKML 2YKLH 1BFOA 4EE9A 4QGYA 2CE6A 5E6ID 1FWWA 1AY1L 4Y16C 2V3EA 4MDJA 4ANKA 4KKXA 3LCWA 4ZFFA 3LD5A 2XWJB 1V08A 1C5BL 5KVFL 1P7TB 3OKMB 2XVBA 2C3XA 1S6NA 3QHZH 3DBPA 1EJWC 5D7LA 1LVEA 2R39A 4HIPA 3MSRA 4GAJL 4NO0B 1VCAA 3F7KA 5DRXB 2VLLB 5HYQA 4WFFD 4AX3A 1Q0EA 4WJEA 1PX8A 1SOSA 3RGVA 1IR1A 4DYKA 5CBAA 5IVOA 5L2KB 2YPLA 5D1ZC 3SDXB 5JA8B 5ECJE 1RK0B 3VNZA 3IARA 5CN2A 3ZBMA 4TL5A 3CFDA 2NY4D 3M0VA 2R1WB 1ICQA 3BGFC 2HUHA 4K8HA 1FZKA 1JOIA 4X5WB 2DEYX 5IB4A 2E7CA 3HBLA 4K3EL 3CLFH 3ITLA 4ACZA 2ID5A 4MPKA 4MMZA 5I30H 1NCCL 2AL2B 2Y2WA 3GDMA 2QLVB 3DROA 1RL1A 4FA7B 2UWEA 4PWHA 1YXDA 5FL0A 2JB5H 4DP6X 4IOIA 1KA9F 4QCIB 1HE7A 3S36L 2R14A 4PV9A 1FZJB 4KKAD 2J13A 1HS6A 2H0EA 2EG7A 3F85A 3BPLB 3NESA 3QMTA 2WJDA 1JPGB 4I0PA 3OPZH 2GC4C 4E3VA 4LCQA 5I66A 4GG6B 3G24A 4UUJB 1OAUH 2Z29A 3PPEA 4JRYA 3SYOA 4N5EC 3T0EC 4MXVF 3I6KA 1N64L 1UEYA 1J2BA 2AMXA 3QIUC 4OR1A 2KKQA 5EU6A 3R94A 4JFFB 3T4AC 1TMHA 3KBPA 1NEYA 3GZKA 3HE7B 3Q1SL 3S37H 3C2OA 3RR4A 1W1ZA 4MSWB 1NUFA 3G6JB 2FATL 2E8ZA 3DARA 2Y23A 4IPPA 4TV3A 2HWGA 1JGMA 3DENA 3EYQC 4I8DA 4HPXA 2IOOA 3N3TA 2ZRVA 3MSDA 1OAQL 1ZE3C 2GJ6B 2VQUA 2VI0A 3K4WA 2Q7NA 4AT6A 4P3WA 3FQRB 3R43A 1E50A 3EMQA 4OTXH 5F7LB 3ABZA 2F6AA 2FIKB 1J8SA 1X7IA 4IIGA 2OPJA 2VN5A 2RCSH 4CNOA 5LJYH 2OK0H 2CO6B 3OAZH 5C09E 2NWSA 3GG7A 5HP5A 1MUCA 3ESOA 2RDUA 4WWPA 1IGMH 3MBEC 2BNQB 5GJSH 3LDBC 2YA1A 4MCNA 5IB3B 2FT6A 5EC1A 4LVDA 2XWJA 5B4MC 3FQYA 4JQ3A 3K74B 3SBWC 5XINA 1P7TA 2R1XA 5F7EL 5PCYA 4JAMB 3OKMA 2J44A 4NKDA 3IGSA 1SY6H 2YXGA 3SUUA 4NO0A 3W9EB 1SMOA 2VLLA 5FUOH 4GIEA 5CN1A 5C0RH 1LWJA 4NT0A 2ISSA 4Y2DB 4JKLA 5L2KA 4R3UA 3SDXA 4Q9QH 1YN7A 3F05A 3KWVA 4E9WA 5CEYB 1RK0A 5CCZA 1TYRA 1XH1A 1DSYA 5H37H 3UYPB 2R1WA 4X3ZA 4P9HH 1NIBA 5CF3A 2ZXCA 1CIUA 4I3SH 1PL9A 1GGYA 4KH9A 1W5NA 1L9TA 5I8CB 4K3HA 3RR1A 2EIDA 4RISL 1CBGA 4KK5D 1INEL 3K4DA 1FG2B 2OT0A 1RZJC 4GCXA 2WQSA 3IF1B 2OR9H 1TPH1 3R12A 5M7QA 5I8OH 3FMGL 3W7DA 4B5EA 4LIQL 1FO0B 3K5XA 4QXVA 5IHWA 3A23A 4IJBA 3QV6A 4XTRD 3NURA 2VNCA 1D2OA 3A3XA 2IMMA 4MSSA 1JDCA 3QJFB 4I9WE 2WKOF 4PYHA 1JCKA 3ISRA 3GK8H 3CDCA 3D0VB 1ZVNA 2YCIX 1N82A 3IMVA 5HNUA 4HLZG 4N2HA 1R3SA 4J2PA 4GG6A 4UUJA 5JUEH 3S3DB 1HL5A 2MCPH 3ZMNA 2GVYA 3M7OA 3QQ4B 2XZQL 4NN7C 4V1YA 4JFFA 5ECUA 2YO3A 1VZGA 4EIGB 3HE7A 4BUQA 4N86A 1P1VA 5GS2H 1XBZA 4MSWA 4XO6A 5CZVH 1HFUA 1BQRA 1W6LA 1LBFA 4AQ1B 4NUMA 1BD2E 3IDXL 4DXVA 3H7UA 1UKQA 2EIMB 1NGXA 1V3LA 4TSCH 3W4RA 3DTDA 1IRAY 1AHWB 2UYLB 3MV11 4ALAL 1K8XA 2GJ6A 1A5OC 4JFWA 3BWSA 2ZXEB 3HE6C 4NJAH 3FQRA 1WFIA 2CA4A 1U1JA 1IXOA 4DK3A 1TU2B 1P48A 5G2WA 2ITEA 4L4VD 4N8VG 2A6DB 2X7WA 2FIKA 4CD7A 1FCCA 4P2VA 2KPNA 4AIEA 1PZAA 1A4KA 4WGHA 2IUZA 2YD2A 1F5WA 5EULV 2IDUA 5HHVH 1T80A 1UOWA 2FNWA 2CO6A 3M0YA 4H2HA 1HJCA 4GO8A 4KX8A 3J8F7 1JZJA 5EB8A 3FRUA 5IB3A 3G5WA 3DX7A 2XHYA 2DPEA 1G7LB 5E2UL 1ROCA 2CLFA 4B90A 1SJHB 4JAMA 2C4FT 1KLGB 1F3JB 3M0LA 5A1AA 3V4BA 3MRMA 4X60A 2L7JA 3TJLA 4PULA 2WNWA 3W9EA 4RDQG 3RITA 2DZEA 5K9KB 4A68A 4Y2DA 1KTLB 2XN9D 1X9RA 4WEBL 1NIAA 3ZVVA 1V05A 3UR8A 5CEYA 4JO5A 3QVAA 3E5PA 1EIXA 4DGVH 4DGYL 3C0SA 3UYPA 2ZNXA 4U6HB 1CGYA 1MUWA 4WHBA 2GG1A 3LXUX 4P9HL 1KGXA 2DZAA 2GTZB 2WSRA 2ZPKL 3LGDA 1D2PA 2FMNA 5I8CA 4DN4H 1LCOA 4LSVL 5I1EH 1C92A 2O26U 1GY1A 1V4YA 5IY5B 5I1JH 1KV5A 3LA4A 5JPMC 1GOKA 3HNTH 4U7SA 4DVBB 1FG2A 1A0DA 2RHEA 2QKFA 3IF1A 3U7BA 2EUZA 2XTJE 3BJTA 4BEUA 2Z26A 5DMYA 3RPTA 3TEUA 2A9AA 1FO0A 3WQPA 1QNIA 4A3QA 4NQVB 3R06B 4M43L 1OIFA 3WGVB 4ZSTA 5D2NB 1HKVA 1CGXA 5DMMA 4ZMPA 4UT9A 3ZO9A 3L1OH 3PLYA 4XAWH 5JHDD 3NP4A 2VYOA 9CGTA 3SECA 3ZR4A 3DC0A 2OTUB 4MMXC 2Q86B 4LPXA 1I3VA 2NSMA 3D0VA 4XPAH 5CINH 3PJUA 3VFSB 2G0LA 2DB8A 2D9CA 4WU7B 3QV7A 3KRBA 3FY1A 3LQAL 3WTYA 4G3YH 4U1GB 2E7LC 1FC2D 3B8IA 3NYKA 3SGUA 3EH2A 3SW6A 1OM3H 3UDWC 3KL3A 2YJQA 2GITB 1GC1L 3VIMA 1CR9L 2AXJA 4S3DA 4TPRH 3HUJE 3SCTA 3M0IA 4AQ1A 3COOA 1OGAB 1E4MM 3KR3L 4HB7A 2AZUA 3ILQD 2PCPB 4XP1H 1F2JA 1AHWA 2UYLA 4HPJA 1TTJA 3N0PB 3T3PF 4DO4A 1DLFH 2RALA 4RV3A 4Y8AA 1JBJA 3OGRA 2X1WL 4TUOB 2DJLA 1YYLL 1RZ7H 2GLKA 3GD1C 3SDCC 3ZJ7A 2YUZA 3OZLA 2Z24A 4LGPB 3E96A 3FHQA 2NVAA 5DBUA 3WZ0E 2O6FA 2EIBA 3CMFA 3S1XA 3ML9A 4F8OA 5DZVA 2ZYFA 3AU2A 3PGDB 1ZY9A 4QS6A 4DKEH 1RXLA 5LZLA 4APQC 1JPFB 1NCUA 4Y8DC 4WHYG 3QSRA 3VIIA 1TEFA 3OA5A 4CNTA 1W1VA 2F5BH 3EZ8A 1G7LA 1HL8A 3QJTB 3V9CA 1P0SE 3UGVA 4AZ8B 3WH8A 3KLSA 3N18A 2I9LA 1SJHA 3V0DA 2PBGA 4DPPA 2ATKB 2HJFB 1MEXH 1KWGA 1TTUA 1KLGA 1WYJA 1OCRB 4FEZA 4LU0A 5AAWA 3TH3T 2X2JA 4WF7A 5DEJA 2NCMA 5EA0H 4C60A 4FI7A 2LHAA 5K9KA 4JGMA 1KTLA 3KDNA 4QLRA 1XD0A 3B7YA 4TUJB 3KGUA 4BM7A 2NY6D 3PL6C 3VXRB 2A9DA 4DGVL 3NQEA 3QDJD 3ZZ1A 1MEIA 1QP1A 4PU2A 2GTZA 3KTXA 3PR2A 4E4PA 4ZI8A 3SJNA 4WI0B 4K3ZA 1UM4H 3HC3H 3P0GB 3FH5A 4N02A 3UY7A 5H94B 4DVBA 4Z2HA 4Q9RL 3ME0B 3CBKB 2AMGA 1XRFA 2YXVA 4FTVE 4WR3A 1P5UC 2EDOA 1FL5B 4NQVA 3R06A 3BLIA 3BPOB 4AGLA 3ZPDA 2OMZA 4OLVL 4OLUL 2XWXA 5T3XD 2JJSC 1R85A 3MV9E 2Q6WA 4L3EE 1EA9C 2FIRT 1SJEB 2L7QA 2OTUA 4NT6A 43C9B 3CU1A 4YXGA 3RNDA 4XPAL 5DWPA 2BVTA 2B1HL 4J1UB 3VFSA 4WU7A 1VBRA 2XACC 3GC4A 5TAOA 1KCBA 4NKIH 1XI3A 3NO1A 4HZ8A 4GE8A 4FQHB 4X2UA 3SE9H 3RU8L 1UR0A 3IRDA 3GHTA 4YDKH 4XWUA 3S9ZA 1Z32X 4S0TD 3WDHA 4MKNA 1MCJA 3GHSA 1J0ZA 1DE6A 1F58H 3BIKB 1K2DB 3VWJA 2IDTA 1ZPUA 5DDHB 1LO2H 4UINL 1I2QA 4LBUA 1XCQB 1H1NA 3EJUA 3WK2A 4ZVJA 3TO4B 2YA2A 5AC5A 3WJLA 4PUEA 1UYWH 3QQ9C 4YVNA 1OX5A 4L1WA 2GKIA 4TUOA 1BQ5A 4TMCA 4NRSA 1IBFA 3PAJA 4DJFD 2IQDA 2VEKA 2DOCA 1ME9A 2OOFA 3EBAA 3NQKA 1QRKA 3J27A 4HSQA 4Z18A 3Q48A 3INUL 2VDMB 3B9NA 4Q8WA 2WBJA 5K69A 3TDFA 4F9DA 4N87A 3PGDA 4K7VA 3D6GA 3G7TA 2PLTA 4OIIL 3LZPA 4YDVB 2F74B 1H5VA 2OQJB 1RJQA 3S4SG 2J5LB 3PXLA 1XRVA 5KSAC 2QSCL 2YL5A 1TQSA 2Z7GA 1MCRA 4M1GL 1GGCH 4AZ8A 1E28A 3H53A 2ATKA 3QF0A 1MEXL 4N68A 5E1AA 4Y4HB 1WZ1L 3H23A 3PAOA 4TNEA 4Y9AA 1T22A 4XO3A 3S35H 4QYOA 1ZBWA 5I0WA 3VRLF 4JFSA 3VILA 1JTOA 2PYFB 4BCXA 2QPSA 3VDGA 4W87A 1YDVA 5C71A 3G3MA 4JHOA 3KWSA 1QFWM 4QXGH 4R97B 4AFYA 5IJCC 2ENSA 2ZUNA 2WKOA 4O14A 3C8FA 3O07A 2ZC1A 5KOMC 1E0VA 1NKGA 1L3WA 3QEHB 5IVXE 4WSKA 5GRXG 1ZDSA 6XIAA 3QUZB 1BKSA 1J5HA 4F2BA 2PD5A 3GSQA 2GYSA 4C6LA 4EAMA 3PHAA 1GGBH 1EYEA 4XO4A 2WWMC 4HJJH 1FL5A 1OAYH 2POZA 1Z69A 3U0HA 5B8CB 5B7MA 1AGEB 2HTLD 3VG0H 4FR6A 3JV6B 5M03A 5ACMA 4HAKA 4DEFA 4F3HA 3II2A 3P2BA 4TQEL 1D3HA 3L7FB 1F6AB 1CFTB 2BG5A 1H60A 2XCMC 3NO5A 1J86A 3NZUA 4ZA0A 4LHUB 1ITUA 43C9A 3GVQA 2FO8A 5D7HA 2EILB 2NDFA 2WLZA 5FM5M 2KL6A 1KFLA 5LAXB 4MHHI 4FFZL 4NUQA 3FTXA 2OR2A 4NKIL 4NENB 3LHPL 3CT2A 4XGZA 3TROA 1NCBL 1TWIA 3WFCH 1FH2A 1V3JA 3W1NA 5FYKU 2BIIA 1Q72H 2EDLA 4TV5A 4KXDA 1N0XH 1RQBA 4MKTA 4X7SH 5J6SA 2YSWA 4PJBE 4HNNA 5GS0H 4B27A 1JPKA 3EAKA 3VOIA 3X12A 3PBMA 4XZHA 3SUTA 3BIKA 4HU2A 1K2DA 1FL3B 1SJDA 5DDHA 3A67L 3AYRA 3SURA 1K8IB 2HLFC 1XGUB 3TO4A 1CICC 3ARED 4XD4A 3FQTA 1Z9MA 1KJVA 1CB4A 5AZEH 2JTDA 3D52A 4JIRA 1S38A 5LIWX 2OZ4A 2VJ8A 4LB3A 2P8BA 1HX0A 3O63A 4PG9B 5JBDA 3ZTDC 2E40A 1LE9B 4KFZC 3KWUA 3U1PA 4I89A 4YK4B 4LARL 4PFMA 1FN4B 4GMSH 1Z9AA 5F7AA 2H3BA 4WDXA 1RJRA 3RO8A 4YDVA 2F74A 4GS7C 3ANUA 2OQJA 3X3FL 4F0RA 2CFFA 1G43A 4ZFOL 1A0QH 5LBSH 1KKOA 1V6UA 2B16A 2BXVA 1NIDA 4FX8A 4D9LH 1PZUB 1HQRA 5FI8A 1XIIA 1R87A 1JGLH 4M80A 2XFFA 3PHSA 4X8XA 4L4TE 3OG2A 1DJWA 1KFAH 4P46A 1PYWB 3VXTB 4M48L 1N8ZB 3OKLB 5D05A 3O2DH 1W72L 2E27H 1KLYA 3DVIA 3MNVB 1NL0L 4BUGA 2PYFA 4HT1L 4P5MB 3BSZH 5GQBA 4IKNA 3S2MA 3FTSA 3BE7A 1D6EB 4G8GE 4NBZB 2UY6B 3OSKA 3GMRB 5JLZB 3FF8A 1M03A 3MHUA 5DD0H 5FWRA 1YVLA 4P7NA 3IFPB 1FIGH 4F7MA 2QFPA 1RZQA 1HJQA 3TQVA 4PN6A 4AMAA 3L5XL 1MW3A 2XG5B 3GJFK 1XV8A 3ZTNL 2GPZA 5BJTB 3QEHA 3NWRA 4QRRB 4TLSA 3CO4A 1GOHA 1E4XI 2WLLA 4PP1D 3QUZA 3MRLB 4J3TA 4BYHA 3EKCA 4HG4J 4LSQL 3AAZB 1YNPA 4XAGA 3UZEC 4Q4QA 3WMCA 4J39A 2GWNA 2X7VA 4X6DF 1GGBL 2G3JA 1BIIB 4NCDA 2PBOA 4U5KA 2BP0B 1AGEA 4D72A 3JV6A 1G4RA 3VG0L 1KPVB 2WXRA 3NSCA 1KM4A 3C6EA 3W5MA 4GLEA 2PXYB 1TQCB 3C6LD 3O6KH 4XPBL 3L7FA 1F6AA 1CFTA 3G77A 4QEGA 4XCYB 2X05A 3HM7A 3VW3L 1AC0A 3SGKC 4OCXL 4OLWH 3T8QA 4ADGA 3OM3B 2H1PH 4Z08A 4XZWA 3M45A 2CLKA 2HSIA 3C5XA 1NC4D 5LAXA 2OYLA 2WZEA 1CDIA 1J8HE 3V8CA 4NENA 3ABLB 1GMIA 3V95A 1B3YA 1QSFB 2IQ0A 3GNXA 2CCWA 3HLAB 4RGNB 5AVSB 4JL1A 4KKQA 2XXGA 5A6JA 3SE4C 3WBYA 3UAJA 4Z8FH 4EVZA 3QNFA 4DPQA 3DOSB 4X4ZA 1M7XA 4WRLA 1JWSA 4EZMA 1FL3A 4C6CA 3VFWA 4X4ME 3OBEA 1BYAA 1K8IA 4A3RA 1XGUA 5I3HA 2A7NA 5IROC 4GK8A 1Q38A 1BQHB 3F7YB 3BH9B 4N85A 3O9WC 4JRFA 1VA9A 5AOKA 1Q0YH 2ZWYA 1IKNC 2CKBL 4LCWD 4PG9A 5GISL 2PW1B 1LE9A 2AQQA 5HNRA 1J5CA 1FN4A 2A9MH 4JFHE 1MVUB 3N1PC 1G6RL 2F8VA 2NYYC 1RQEA 3MV8E 3E8VA 3EGDB 3Q5TA 5EBMB 1A0QL 5E9DB 3PU7A 4WTZG 1RVGA 2B4CH 3WJMA 4S1DD 4YHZL 3WTUA 3C08L 2XYCA 3N6YA 4OF3A 1U41A 4RGMC 3V9FA 1PYWA 3TQPA 2AEPH 3VXTA 1A50A 1N8ZA 3OKLA 3EEZA 3CQQA 2XXFA 5REQA 3MNVA 3FA4A 5E8EB 1T6MA 1HOCB 4CMHC 3MB9A 4P5MA 5KSUB 4M7JL 3Q8AA 2VGFA 2R2CA 1D6EA 5TQ0H 5DXWA 1WV2A 1BEYH 1CZ8H 2UY6A 3GMRA 3GVGA 3KXFD 4C90A 5I06A 1FCBA 1UWFA 1O68A 1B6DA 3IFPA 4LDLB 1CQYA 5LGHL 3E7JA 2PTXA 3N15A 3EBVA 2RQ8A 2WYHA 1L6YA 1FHDA 3GNNA 3HRZC 3NIGF 1DJGA 4XB8A 4JYFA 3WXVH 3OWRA 3NZPA 3H4GA 5BJTA 2CCRA 4PTDA 4Q89A 4ZMWA 1ISWA 1N5YL 3W7RA 3H9SE 2NY0C 3IPBA 1NZRA 3LKQB 5K1VA 3AAZA 4XPHL 3MUAA 3BL3A 1JV2B 3U8GA 1BIIA 2BP0A 4Z0JA 1HL9A 1DL3A 4IOFC 1KPVA 3TN0C 3TBSB 4UIKH 2XJLA 2PXYA 1QG3A 3ULVH 4YN3A 3ZE2E 3MUY1 5EPMB 1GAFH 1D5MB 2PC4A 4IRZH 4J3OG 2PWEA 1ETJA 1XLAA 4XP6H 3GG0A 5JIPA 4DZBB 4Y7EA 2QHLA 3D3VD 4HJTA 5T1KB 4D2NA 2PPGA 2V5MA 5CD5C 4W9IC 1E67A 5FYKH 1JYVA 1VPOL 2ZZ7A 4L1DA 2EJ1A 3JW7A 1QSFA 1DO6A 4OBRA 5BS0E 1OF6A 3HLAA 4JHAL 4PM1A 4LSDA 1PAZA 3VFGH 5JMUA 2XVKA 4IS6B 2F6XA 3OTTA 5SX5K 2FZ3A 1AL8A 4M7SA 3FFCD 5EUKB 3RWEB 2W9DL 1R3WA 4WJ8A 1MW1A 5BOEA 1XQ4A 3HB3D 3CV1A 1OCWH 4P3DB 3GH7A 2E7HA 5A94A 5HY9B 4HC1A 1HIZA 3N04A 4OD3H 1F8TL 3VYPA 1TCRB 4OLZH 1ZLEA 1FJ1B 4HJ0C 1BQHA 1A6PA 3F7YA 3BH9A 5GNXA 3NOYA 3SDYH 2XFWA 4KOBA 3GXIA 3DVGB 1Q9KB 5ABAA 3IFLH 4NNYB 4JO4L 5TFSH 3PPGA 3NQ7A 1R6VA 1MOEA 4C4UA 1MVUA 3WNIA 3RIKA 1MWAH 3LRLA 4MZ8A 3MOQA 1XMWA 4L4MA 2P10A 2XLLA 1W3HA 4NIYE 4OM1L 5EBMA 3KHOA 4EACA 2V5LA 5E9DA 4HKZA 1ZA6A 4V1DD 2VLKD 3KHQA 4P8WA 4PUDA 3UTSE 5JOEA 4XOAA 3KVMA 3L17A 1G0DA 2YK1H 2F08A 3MC5A 2VQ1B 4ZMAT 1RY8A 3TJ4A 4A4AA 1CJYA 4K94L 4PJ9C 3R13A 1R3IH 4CLMA 4HQQH 3OTRA 3G0SA 5E8EA 4X6DB 4WEVX 5DQJA 5T1LD 5GZOD 1B2YA 1GIGH 2NV9A 5KSUA 2X09A 2IXVA 1JCMP 5DSCB 2EDNA 1QWGA 5TQ0L 5HGHB 1NQ6A 4UDUB 4PBEA 2K4WA 4CC4A 3VO0A 5CXPA 3R25A 1KBWA 1FNAA 3QUXD 1TA3B 2BO0A 3S98A 4X5QA 4U4MA 3GXMA 2NYKA 4AD1A 5DY3A 3FYPA 4S3GA 3LKQA 4JVUA 4N2OA 4LQFH 3T65B 4AUYA 1JV2A 4KDTA 3WS6A 2BASA 4U1IB 4OLEA 4QXTB 1E51A 1BV8A 4WY7H 2OWCA 4ZNEA 3APGA 1LEIB 4PMNA 5EOCH 1SM3L 2YPVL 5EPMA 3U5YA 1EGJA 1D5MA 1CDUA 5TE6L 4YHYB 2P5WB 2EDEA 4XAKE 1KACB 5T1JA 1OV8A 2BOFX 4NC0B 4S3JA 3D5HA 4DZBA 1P0NA 4P61A 4K9EH 3GW0A 3THML 3L3KA 3V6ZB 3IDGB 2J4GA 3RWGB 5FUZH 5D93B 3GMQB 4JRWA 5TH2B 4ZQTA 5FYKL 2HPMA 4BZ1H 1FFOA 3RVUD 4YBQC 3NJXA 3GSWB 3UBPC 1NBYB 2HFFB 5E5MB 2XQ0A 3QKEA 4P2QD 4KCTA 3GIZH 5KS9F 4NAFB 5IFHH 2HFEB 3ORWA 1M57B 3S42A 1VGEH 4EI0A 2DMCA 2VLRE 4ES4A 3MX0B 3H9YA 2VEGA 3HZYB 4UI2A 3E5BA 4P7OA 4P3DA 3BP7B 3BO9A 5HY9A 4L8DB 3NPSC 3DFSA 4CVZB 4NJJA 3BQUB 2CZNA 4JTRA 1EJXC 3WQWA 3B0YA 4Y9NA 5DEGB 4G7EB 4PTWA 1TCRA 5CZRA 3D3FA 2WUBH 3NABL 1SW7A 3F83A 1X7FA 1YNYA 2IDFA 4M1CD 4YHKH 3NFSH 3CVDA 1KC7A 2ATMA 4GYJA 4ZSUA 1E43A 2W8CA 3N9KA 4PRIE 1ILUA 2ZOXA 4YS1A 1TEYA 2W0FA 4U6VH 3DX4A 2CNYA 3LMZA 2XPGB 7PTDA 1DVZA 1Q9KA 4HZAA 4NNYA 2VCBA 3D85B 2CO7B 4ZW7A 1U2HA 3UL4A 1UG6A 4PRTA 3M5ZA 4ATDA 1JDFA 4Y19D 2A1WH 3T1GA 5L7XH 5DUPH 3B3DA 2BY2A 2R59A 4AC1X 4J3WA 2WNKA 1YY9D 3MTRA 3EHBD 1A5LC 3NIGB 3PWNB 3NQAA 1FP9A 2VQ1A 3LNGA 1U8IB 5LGZA 5L2JA 1QABA 2VC2L 3GRWL 2B9BA 1F90L 1OK0A 3JWOH 4U05A 4GXFA 5E56A 3FU7B 1FFPB 3LKPB 4X6DA 2CPUA 5DJ0B 2FCBA 2OZNA 3IUIA 3B7SA 4OE7A 1BRLA 4TNVF 3F7QA 2YPLB 1HYSC 2DQMA 1MCHA 3ILPB 1JVNA 5HGHA 3MRHB 2R8SH 4UDUA 4XOCA 4E5XA 5IFJA 1VB9A 2ZZUT 1TJHH 2J72A 3M7WA 1R17A 4NZDA 2EDDA 1INDH 2QEJA 1WKEA 5C6TH 2DQCH 1NMCC 5FW6A 3EYUL 3HNSL 3HFFA 3DETD 5IB4B 3MDWA 2VSDA 4ACZB 4XBPB 2ALRA 2BOBB 2DM4A 3QXTA 1OAKH 5F2IA 4AYBA 2Z4TA 4R0LB 5EMLA 1GPFA 4YXKL 2OP4H 4HF5L 1I3GL 3T3MF 1H7NA 3T65A 2FQGA 2VFFA 3TVAA 1MJUH 2H3KA 3BG3A 4U1IA 1OFBA 4O2FA 4QXTA 1O94A 2FEDC 2QGEA 3BEVB 1EXGA 1M3UA 4LPUA 2E6AA 1LEIA 1WVZA 5F6HJ 3G5EA 1MQKL 5G4HC 4KY1L 4M8UA 1KENH 1EGZA 4JG1L 2P5WA 2C71A 1C5DA 2WXKA 4I0PB 3TEXA 2E59A 1JTTA 3EXLA 1QOXA 5FJJA 4UMAA 5E6YA 5EWIH 1FLRH 1M7UA 4PRPE 5FYLE 5HPCA 3V6ZA 3K2UH 4JGJA 4HSHA 3IDGA 4KKBD 4PUUA 4F57H 2ZWZA 3RWGA 4QQUA 2C4FU 3GMQA 4AXKA 4K23L 5CG0A 1CU4H 2Y6TE 1NBYA 4HBCH 4MNGE 2Q76A 2HFFA 5E5MA 3MLXH 4JRYB 5DO2C 1A7QH 2HFEA 4AJWA 3NL5A 2SODB 1U8LB 4JR9L 4K3JH 4L2YA 3Q01A 5EU6B 1KCUL 2PPFA 1TZZA 3OEXA 3VVVA 3MX0A 1FH5H 3HZYA 3HN5A 3DSFL 5C0CD 3J7HA 43CAB 1YMME 2NY5L 4MLIA 2I9UA 3BP7A 3C52A 5CPOA 4L8DA 4DTGL 4FF5A 4CVZA 1K9EA 3QG6B 5B7FA 5DEGA 3K4ZA 3HA0A 3ELQA 5I1CL 2Z0BA 4PJIE 1E4JA 2QJIA 1IJ9A 2FJGB 3F65A 2IPTL 3MA7A 2VXNA 3PNZA 4ZTPH 5D72H 2B1AL 3N2XA 3LPGA 1S5WA 3IMRA 5JQ6H 3A6BH 3D85A 2W38A 3LCYA 2CO7A 2Z1XA 1KN2L 5C08D 3LN9A 5L9DL 2LQRA 3K8KA 3GIQA 4QRNA 4XXCC 4MD0B 5HWJA 4Z1AA 1QRQA 3ID7A 5EC1B 1JXKA 3QCTH 3PWNA 4A1RA 4RZKA 2R1XB 1U8IA 2OXNA 3NK3A 4GH7B 2X10A 1T83A 3LCLA 4NKDB 4XTDA 3FU7A 1MDLA 1KELL 4NILA 1FFPA 5C55A 1LWRA 4G5DA 3LKPA 5DJ0A 1HXMB 4IXHA 35C8H 4DGIH 1I8LA 3Q9PA 5I82A 4LSRL 3CIVA 4FO4A 2KUTA 1THAA 1YN7B 3ILPA 5HATA 3MRHA 1DFBL 1F3DJ 3DSNB 4IGBC 5HJ3B 4NM4H 1KQYA 2A38A 5IBUG 4GX8A 3CHPA 1YUHA 4NZ5A 2DQCL 5B1AB 3W2LA 2BDNH 5G5IA 4BD4A 4FL4C 2WAHA 4H0IA 2NSQA 5IBXA 4XBPA 3TEZA 2BOBA 5I8EB 4FNLL 4GBXA 3AHZA 3HB9A 3VH8A 3SBQA 3RZWA 5KZMA 4R0LA 1I85C 2BSCA 1GWJA 4FC3E 3KG5A 1KM0A 4R2GB 3MBXL 4HIXH 3ANYA 3LKSB 4DWSD 5KS9B 1UCWA 4YHML 4GP5B 1IGIL 3K6NA 5DZLA 3TA3D 3ZL1A 5EORH 4UTWC 1NCWL 4AQLA 4G6AC 5B22A 2XM2A 2IAMD 3BEVA 4A6YB 2RBLA 2ANUA 3W6LA 1ZGLP 1MSPA 5DBTA 4GUGA 2YCJA 2G60H 1UROA 5HANA 2ESVB 3EJPA 1IV8A 5KMYA 1FLRL 5DD6A 4B4FA 4U4IA 3N29A 2E5DA 2HXUA 1NMAL 1DKWA 4Q4IA 5HVHC 3RLGA 4FALA 3MLXL 1AOHA 3B9VA 1TIUA 2A74B 3G1FA 3D05A 2H7WA 4PH8A 1WC7B 4R4ND 1E1CB 1U8LA 1LQAA 2EVHA 4K3JL 4QAWA 4QD2E 4FFYH 2D24A 4R9OA 1U5VA 4MCYB 4Z3GA 5F4SA 1CGWA 2G30A 2C9UA 1QPPA 43CAA 3WQOA 3H6OA 2VTFA 4F58L 3EOBA 4ODTL 1IFHL 3SE3C 2O4QA 4NRXB 3RHWF 4BJHA 3QG6A 1U95B 1NGXB 3QJZA 3JWNG 4AZCB 2EKJA 3L4VA 3FYYA 3EB3A 1LRQA 3VIFA 1D7BA 3BKJH 2FJGA 4PGEB 1UYQA 2MPAH 4JTAA 4JPWL 5E94B 2C18A 1X97A 3CS2A 3T55A 3CFBB 3UFYA 1HU8A 4Y8FA 1A4KB 2E25A 5T5FL 2VC6A 4UT6A 3W82A 2YKLL 4F7CA 2WXIA 4A2HA 4NPKA 3MV01 4MAZA 5I73B 1OVDA 2EPKX 3MA9H 4MD0A 2NXZD 3FRUB 3V6OA 3DX7B 4FQXC 1AH3A 1VBUA 3G5YA 4WK2B 1TV3A 1T4WA 3DFNA 3H4XA 2DL2A 2VURA 3TXZA 2RDXA 1LL6A 3MRMB 5IOPA 3QHZL 1P4BH 4W7WA 3F7VB 4JHWH 4JNMA 1HXMA 1I7UA 1XIWD 4YGAB 1F4YH 1J9QA 3BFOA 2CZDA 4J28A 3W23A 4CC1A 3RNQA 4EF8A 4UTAH 1HXYA 5E5RB 3KCPB 2OGJA 3T4YA 3DSNA 4IMAA 5HJ3A 2MCAA 2WW8A 1K7FA 2ZVIA 4GRWH 4Q4PA 1G4PA 4GPNA 3I7QA 1JNNH 2BDNL 4DEUA 4EJ1C 5C0NC 4F80A 3RPMA 3GZOA 3TH4T 2BMBA 2Y7QA 3CLFL 5I8EA 1MDRA 5ECGA 4AH2A 5I30L 4M8VA 3ULSB 1XP3A 2H1XA 3LKSA 2W0UA 5KS9A 5C2BH 4F9JA 2LLGA 2V2TA 4M6MH 4C56D 2DW6A 2JB5L 5ADPH 4WEMB 5LNUA 4A6YA 3ZKND 3NQ2A 2EZ0D 4K07A 1FBAA 4N9CA 3HLKA 3BVDB 3CZSA 4YHIB 1HHKB 4UTLA 5TDPB 1DQKA 2CETA 2ESVA 4JKPH 1IL1B 3KRSA 3CVBA 4WHCA 3OPZL 3WDIA 2G5UA 1GZGA 4PTXA 2H3XC 4L3AA 5D1XB 3NYZA 5IB2B 4ODSH 2AABH 2PWDA 3ULUD 1C8YA 4F2EA 1J93A 1NGYA 5IHHA 1GYUA 1OAUL 3U9WA 3OHIA 1OYBA 5IFPA 2A74A 3WF2A 4OB5H 3HHMA 1WC7A 3DX6B 1TTBA 1E1CA 1KF9B 3PULA 3NEVA 4EN3D 3CEPA 2IH8A 4MCYA 4BXSV 1MCWW 4IEFA 2CM6A 1G67A 3S37L 3F4CA 4RE4A 3UG8A 3KTCA 1AZBA 1DUYA 1EZ2A 4RQQB 3DDGA 4PTUB 4WWKC 2FDMA 2AI0H 1AZVA 2NLYA 2NY1D 4NRXA 1UWTA 1U95A 3V6BR 1YMYA 2QCCA 3QZWG 2W9LA 3VGAB 4AZCA 1RV8A 2XH2A 1N12A 1KBPA 4NCC2 3MREB 4X83A 4PGEA 3CCHB 1M6JA 2WLIA 2WD0A 3CHCA 2MPAL 4OTXL 2X7LB 3BD4A 5E94A 4MWAE 1CGVA 4GSQA 3CFBA 4PY8I 1R86A 2HPIA 1Q6FA 4AXNA 1BZ9A 2RCSL 2GK2A 3LKOB 3ZZLA 1ERNA 5DZPA 2OK0L 2X6VA 3T8XB 2ZDRA 3WN5C 3B7TA 3CFTA 4ABWA 1AZCA 3H55A 4IGSA 1IGML 4O0KA 5GJSL 3GSMA 3OIHA 3DHFA 2TSYA 1M56B 1TZHB 4CKQA 1ZLUH 1B0GB 5DMLA 2I9LB 4O00A 1VKXB 5HHMD 1FVPA 2JJVA 1DJQA 1I8UA 1OIOA 1AG6A 2QDVA 1CXIA 4Q58C 1E6RA 3WJXA 4QY8A 3NBNA 1SY6L 3F7VA 4JYEA 5FUOL 4IGMA 5C0RL 1FSKC 3RY6C 2Y2TA 1AR1C 2PSNA 4LQ1A 2EDQA 3WLJA 3GW3A 4Q9QL 3ZIMA 4CCEA 4UTAL 1JZEA 4TSBH 3KCPA 3VKBA 3WLTA 1ORQA 1G69A 1R5VB 3RKDC 2C7FA 2NY3B 2Z7KA 1ES0B 3EGXB 4I3SL 2RDTA 1O4UA 1IEVA 3FK3A 2X0UA 4JX4A 1UP2A 2OTWA 1ZENA 4K71C 2D3LA 3C2AH 2JWYA 4ONFH 3ULSA 1F76A 3BP5B 4DUWA 4XWGH 5EYWA 2OR9L 5I8OL 3QPXH 4JB9H 2VLME 2FPTA 3C8KA 5JO5A 4ISVA 2QZ5A 3U48A 2XTJC 1KGUA 2OMZB 3EPMA 4BFJA 4YHIA 1HHKA 5TDPA 4HOZA 2CESA 3L21A 2Q6WB 4HHAB 4LRIC 1EP1A 1W56A 1HWHB 3KOYA 1IL1A 1LYXA 5K9CA 4MYWB 3M0MA 2QVMA 4KK8D 1C3FA 1TV5A 4NT6B 4A8IA 3GK8L 5DRCA 5D1XA 1HXJA 5FSDC 1L9MA 4PUJA 3S1WA 5IB2A 3DX8B 1L8NA 4QRSA 4O54A 2JKTM 3DPBA 1WA1X 3CXHK 4N5UA 5JUEL 1GS8A 1UR2A 4V2CB 3QFJD 2MCPL 3DX6A 4MZ3A 3R6IA 5E7FA 1XH3A 4ZX5A 3B9KD 3SAZA 1UJ3C 1ET5A 3IGUA 2V5KA 5DF0A 1SFHA 1C9SA 5HDBF 1AK5A 4O2EB 5CZVL 3WFZA 5G1YA 5FEWA 4MJIE 4RQQA 2NR6D 2FYVA 4PTUA 3RLVA 5FEPA 2WWNA 5IRPA 3N42F 2ZC8A 3VWJB 2CZVA 1AYOA 3SYPA 4TSCL 5DU7A 4KO5A 3IRPX 3P3YA 1B1YA 3LRHA 3ZRCC 4JN1H 3MREA 3GXUB 3NJHA 2ED6A 4CCCA 3CCHA 1RPKA 4KNSA 4NJAL 1TPWA 2AJZB 2W6RA 1BFTA 1GJUA 4FOUA 2EVIA 2X7LA 2V38A 4YLBA 3BT2H 3U9IA 1RHCA 1RSFA 3GM8A 4EXQA 2AK4B 2WBJB 3I74A 3LKOA 4YC2C 4CBPA 5HHVL 1H3TA 1NQBA 4X6FA 3T8XA 1XIDA 3NDOA 2YZ5A 5G4WA 3GBNH 4W9ZA 1HH9B 2CBJA 4H9VA 3NJMA 4F2UA 4W9JC 1BYBA 1TZHA 1B0GA 5D37A 3H2OA 1E28B 3QS3A 1VKXA 2KS0A 4RJEA 1HNGA 2J8GA 4ICNA 2APTA 5E1AB 4POZD 3EYVB 1SJVA 5AD0B 1DDTA 2YA0A 4I7UA 3Q05A 5DFVC 2D9QB 4O18A 1T22B 4G8TA 3AC0A 4IIHA 4QYOB 2R2HB 5C92A 1JZGA 4IRJB 3A3WA 4M9PA 3MKGA 4G80A 4Y4KC 4LEOB 3X2QB 4IJRA 2V2CA 3T2LA 1M7JA 1W3KA 3PWPE 3R58A 3QIBB 2BZ7A 4I88A 1R5VA 4LLQA 1UP0A 1ES0A 3THCA 3EGXA 4Y9CA 3R11A 1EZLA 4QWWC 1AD1A 4DN4L 1BAWA 5JIWA 5KAQG 3V16A 5I1EL 2XINA 4AW4A 3QA3B 1LLOA 3MKKA 1JPEA 5FHBH 5I1JL 3HNTL 2OTDA 3BP5A 1XGQB 1ZP3A 4RMWA 1PDKA 2XWCA 3MCG1 3GINA 3MUJA 3GSQB 4PD4J 5IW6B 3ARUA 3WLMA 5CLXA 4B95C 2DD8H 3BUBA 1W9PA 2R8WA 2PDMA 1DE5A 1YUKB 2J47A 3CHFA 2VDOB 1CXHA 4FG2A 3L1OL 4XAWL 5IQ9A 2Z31C 4HHAA 3QB7C 2DM3A 4Z0SA 4FIRA 1AVAA 4L3CA 4D3CH 5CINL 3I3DA 2A0LC 4YQXH 1O0VA 3DX8A 3CU7A 5J8LA 4YYFA 3ET9F 1L6PA 2OB3A 5E8OB 1SUXA 1A2YA 3S0CA 3CN1A 1G4EA 4LS2A 3WIHH 1DBJH 3PK7A 2Y2YA 2Q10A 2JIXB 3W24A 4G3YL 2YS4A 4PI2A 2WPGA 4XGZB 1IBDA 2IH1B 1Q9OA 1Z7AA 2PO6B 1R0AH 3VGHA 5G1MA 2WYSA 1G7PA 1OM3L 3NJJA 4IYKA 5EEUA 4E4FA 3BW4A 1LQSR 4W70A 4O2EA 1F11B 1MAJA 3WHXB 2GIYA 3M64A 1KBIA 1X98A 4TPRL 3HHRB 2FWOB 3X12B 3GYEA 4FNSA 2HKHH 2RQEA 3V1HA 1RZIB 4JFDD 4TSAH 4XP1L 3KYAA 4XKMA 2R27A 1IT0A 1DLFL 1U6AH 4ZXLA 3NN8B 5D33A 4GQ0A 3FQTB 1KJVB 4HKBB 4WGKA 3MO1B 2AJZA 5L6YH 2J7EA 1RZ7L 3R19A 8CGTA 3A5FA 3UZXA 3WUGA 1CLCA 1J6PA 4FI4A 4KT2A 3KCJA 4YL2A 2JEQA 3BT2L 3L16A 5DRWB 3LHVA 1YAZA 2C9RA 3A9BA 4RZ4A 3N91A 1UOLA 3QZNA 3PQYB 2Q3ZA 2AK4A 5AAPA 1T40A 5F7UA 3WE1A 4MJJA 3UWEA 4DKEL 2PF6A 3AW5A 1H1YA 4C59B 1HH9A 3ZM8A 3B7RL 3D8MA 4QE4A 4P2YA 1JNDA 2ZG2A 1OO2A 4KXZH 2IBBA 4WW1B 2F5BL 3RX4A 5D9MA 3NH7H 1HQRB 5C54A 5BU9A 3BXNA 5D5MF 3EOEA 2Y0SA 2IIJA 3G1YA 5EA9A 1N7KA 3N6HA 4TQHA 2AVGA 5DFWH 4P46B 2B2XH 3EYVA 2LAGB 4ZD3H 5ESVB 5AD0A 4P57A 3P6LA 5EA0L 1EQWA 4LUIA 2R2HA 3FIGA 1K3ZA 4LALA 4IRJA 3AM8C 1M71A 1I3UA 3TZNA 3ITOA 5FKYA 5LO7A 1IHIA 4LEOA 1UUNA 3DCPA 2LU3A 3QIBA 1BF8A 1IF2A 3APCA 4YSRA 4W9HC 2J74A 4PY7B 1XIGA 2X1UA 2EIEA 1B0RB 3KZSA 5A2FA 2N0MA 4F7MB 4RZCA 3V2AR 4H20H 1DWIM 5E9NA 3L3JB 1HZHH 2G2NA 3H2AA 1CW2A 1UM4L 3QA3A 2NQ9A 1TLKA 3HC3L 3WO4B 1ICTA 4OGAD 2QDEA 4FYRA 2GGEA 2WLLB 1XGQA 1QACA 2EH7H 1JI2A 1JPSH 4GY4A 5IW6A 2Z34A 3S1UA 2UY5A 4TVPE 3S0PA 5A7EA 3AS2A 3FYEB 4FF9A 4HIQA 3UA3A 2VVSA 5CLZA 4QGTA 4N2DA 3WO3B 3UPAA 5E70A 3OAZK 3CMGA 4J4PC 3DNKA 2NNAB 2GJZB 2CLLA 5HI3D 4U6TA 4M02A 3ROLB 1WK0A 1RD5A 1EWHA 3T3PB 2PCYA 4C8XA 5T3ZH 5E8OA 4H1LH 5EDSA 3EZ4A 3B2UC 1ZGDA 1QRNA 2N7BA 4F93B 3SRHA 1P0BA 3CVHH 4PRRA 2OM5A 1DBJL 3OQRA 2JIXA 3WUWB 3SE9L 2IH1A 2PO6A 1DJNA 3WG6A 1QHPA 3OC8A 2GJJA 2GC7C 2I32A 2X1SA 4FFTA 2JSFA 4KK6D 4UBDC 5B3SB 4XI5C 2NQ5A 2V9UA 5F1IA 2VSMB 4YDKL 4Y0GA 1F11A 3W1UA 3ARDD 3WHXA 3HJ0A 4GIPD 3PP4H 2FWOA 1IT8A 5BO1H 4C6BA 3QWQB 1ZB5A 2A6IA 1JWSB 1F58L 3PAVA 1JZ5A 1RZIA 3PUOA 2BWIA 2C3VA 3VFWB 5E1IA 1LO2L 2BX5A 4RDWA 4NN5C 4DERA 3MJ8B 3GQYA 4B92A 5EEXA 2IGTA 3NN8A 1UYWL 1Q6QA 4HKBA 3MO1A 3RVXD 3TESA 3WSQH 3B8DA 1WFNA 2YBVA 4UFHA 2HWZH 5F2MA 5DRWA 3RMEA 4QHKJ 3PQYA 3RUGF 3AMCA 3KJ4C 5GGQH 1A5SA 2W5PA 3O6AA 4QNPF 5HHOD 5EF1A 4FXRA