5BRQA

Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea)
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
555
structure length
555
Chain Sequence
NPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDNGYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKEAASGKENLYRDFYIWKDMKPNGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYEMMHFWFEKGIDGFRLDVINVISKDQRFPDDDEGDGRRFYTDGPRVHEFLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNFHHLKADYPNGEKWALADFDFLKLKKILSEWQTEMNKGGGWNALFWCNHDQPRIVSRYGDDGKYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRILKEAGKPEAEIIEILKAKSRDNSRTPVQWNGEENAGFTAGTPWIPVPDNYKEINAEEALNDPDSIFYHYKKLNELRKEFDIITTGDYQLILEDDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIEGYDAKVLISNDTDLPESFKRFTVKPYQSIVYHLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Bacillus licheniformis trehalose-6-phosphate hydrolase structures suggest keys to substrate specificity
pubmed doi rcsb
source organism Bacillus licheniformis atcc 14580 = dsm 13
molecule tags Hydrolase
molecule keywords Glycoside Hydrolase Family 13
total genus 209
structure length 555
sequence length 555
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.93: Alpha,alpha-phosphotrehalase.
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5brqA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5brqA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 5brqA02
1OT1A 2VR4A 4AWEA 4F9DA 4TTGA 5JIWA 1SYTA 2D23A 1WNOA 3JUGA 1CGYA 2VRKA 2PF0A 1J0IA 4HMCA 1WZMA 3WY1A 4W8LA 3BVVA 3CHFA 3NIYA 3QOMA 3WIJA 8CGTA 1UQYA 2BY2A 4HZ6A 3WQ6A 2YOCA 1ISVA 3OLGA 5F7UA 2XFYA 3ARRA 4MJ4A 3BLKA 5E9AA 1V02A 2D2OA 1C93A 5FCZA 1BVZA 2VQUA 5A2BA 5HPOA 5E70A 4FMVA 3ZOAA 1KGUA 3LX9A 2GK1B 4P8XA 2PWEA 3ZIZA 2EPNA 3MUIA 3WDJA 3ZM8A 1CBGA 3VM5A 1LG2A 1UR1A 1KR0A 3VIIA 3W27A 5A95A 3F5LA 1W9XA 1E6QM 1EQPA 3CUJA 1QI0A 4JKMA 1KCKA 1VJZA 6CGTA 4U5IA 1FA2A 4UNIA 3E1F1 1WP6A 4AMWA 1JD7A 1UD3A 1HKIA 1VBRA 4JFTA 3AROA 1WDSA 1CENA 1GOKA 4CCCA 1QI2A 3W26A 2VZUA 2WHLA 3RM8A 4UR9A 1TUXA 1I75A 2WMJA 3W6MA 1JXJA 3VIPA 2WMHA 1SFSA 3CO4A 2W67A 4MDPA 1D3CA 1UD2A 1V3LA 4GO8A 5A1AA 3A3HA 3DX3A 5A6BA 1KTBA 4W85A 2J7FA 3SCTA 4D6IA 4ZE4A 4UOZA 1NARA 3NJ3A 5EFFA 3VD7A 5CSUA 1OD8A 2QPSA 2VUYA 3SCWA 1HXKA 1OINA 3TTOA 4D71A 5TD4A 4BQ3A 5IDIA 5IFPA 4L4PA 1PPIA 2XVKA 1H11A 2X05A 1HVQA 1HIZA 2ZXAA 3VUPA 1E1FA 4WJXA 4DWSD 1NP2A 1Q4NX 2WAGA 2ZIDA 1MXDA 1XHGA 3PZNA 2DH2A 4NZJA 2MANA 1HJQA 3UG3A 3A5VA 3OLIA 3M6DA 2QMJA 4D6CA 1MW2A 1CGWA 1MQPA 4FLRA 3WQWA 2D20A 5GPRA 3WUEA 1KXVA 1JFHA 4JL2A 2V3GA 1O6IA 3PZOA 1H5VA 4BZYA 1E4LA 1TE1A 2ZUUA 1UKQA 4UFJA 3VX0A 1B1YA 1H0GA 3ZT6A 1C7SA 2E9LA 1HP4A 1W3HA 1PBGA 4FF5A 3A47A 1ITCA 1K6AA 5DO8A 3AZSA 3BVXA 6TAAA 4NXKA 5I24A 3FHQA 4CU8A 1DWGM 4S3JA 3THDA 1B2YA 3IK2A 1V6VA 5AYIA 1GHRA 3T2PA 1H49A 3MV11 2ZX9A 2XJ7A 5IHSA 2FGZA 4IM4A 2G8ZA 3WH5A 2V3DA 3K8LA 4IPLA 4JCLA 3ZSSA 3AJ7A 4DO5A 4W5UA 5GQBA 2FHCA 1W9PA 2BHZA 2CHNA 4EKJA 4J27A 1JI2A 2F7RA 4PSRA 4HU0A 5CLTA 1WZAA 2GVYA 3L4TA 2GJXA 1AQ0A 5ABFB 3CZJA 2W66A 5I79A 4UQ9A 5E6ZA 2FE0A 3TONA 3CUGA 1BQCA 4NZFA 2Y4SA 1E6SM 1ESWA 4B3KA 4D1IA 5I23A 1BGGA 2Y8KA 2VZSA 2XSBA 3HG4A 1EOKA 2BHYA 2EO7A 5D9PA 2FHFA 1HJXA 1OM0A 2W92A 4ZENA 3BXWA 1A47A 2CITA 2E3ZA 4AZCB 2OW7A 4D6FA 4XX6A 4JZ5A 2EBNA 5I2UA 5IFTA 3ARZA 3WDHA 3VIMA 4RE2A 4B9ZA 3FHAA 2EQDA 3MANA 1UR2A 2VQTA 4CKQA 1VRXA 4W89A 4AMCA 3PZUA 4MB5A 3OZOA 1FP8A 2D0HA 1DWHM 1JAEA 2VX7A 3RO8A 2GDVA 4D6DA 1UR9A 1M01A 3GXDA 3UESA 2Z1KA 3L2LA 3WQ8A 1V02E 1PZ3A 1ZBKA 2DEPA 2E8ZA 2D0FA 3RILA 1E0XA 2XUCA 5M03A 1KXQA 1CXKA 3DX2A 4LQ1A 4TTUA 3PZTA 1UA7A 1JZ6A 4J7RA 5E09A 5AY7A 4BA0A 4YPJA 3CHDA 1KTCA 2XVGA 1DWAM 1LL4A 3FAXA 1UR4A 1D7FA 1EH9A 3VM7A 2WMIA 1OBAA 3EDFA 3GNPA 4P8UA 4W8BA 4ZFMA 4UFKA 3MUZ1 1C8XA 3AS0A 1JZ3A 2OSXA 1OWQA 2RGMA 4AZBA 3EJUA 2PWHA 1MW3A 3ARTA 3L4YA 1QHZA 3B9AA 1XGZA 5A6BD 4GXPA 3VMPA 1LJYA 1B3VA 1EIBA 1IT0A 1HJWA 1QPKA 1E70M 1W1TA 2EPMX 1J0KA 1FP9A 1UKOA 4PTWA 3T2OA 1OCQA 3GXFA 4E8CA 4OUEA 3CMJA 2VURA 1W3LA 1U30A 5HBFA 2QLYA 2JE8A 2YA2A 2VX5A 4AISA 4MAVA 3VD3A 2DDXA 5M17A 4E4PA 3WF3A 1QBBA 3LXAA 4NZCA 4CU6A 2YFNA 1R86A 3BLPX 3RJYA 3CZEA 2G3IA 3ARSA 2VX4A 1GUVA 3BVWA 2WK2A 2FYVA 4EE9A 4P7LA 3WENA 3MKKA 3H54A 1H1NA 1BVNP 1ZBVA 4J3SA 1B3ZA 3TTQA 2UY4A 1LWHA 3VGEA 3D50A 2WANA 5BRPA 1V0MA 1GHSA 2DPEA 5GNYA 3HU7A 4M8UA 4XB3A 3W29A 4W7WA 4ACYA 3AFBA 3AYRA 9CGTA 1MFVA 2PI6A 5HPCA 3AXHA 1C3FA 1MFUA 4LX4A 5CLWA 2CNCA 3AIUA 2A3BA 4H7VA 1HNYA 3HG2A 4W8AA 4WKFA 1UH4A 5D4YA 1U33A 4J28A 2XM2A 4HPHA 1KGXA 3G6MA 2WNWA 4W88A 4K68A 5LA2A 3WF0A 3PTKA 1E55A 1G94A 1B3WA 2B31A 1X6NA 3PZGA 1ODZA 1G0CA 4IISA 1WDQA 1E56A 3G6LA 3K8MA 2W62A 4C7FA 2YLAA 1VFUA 1P6WA 1QHOA 3L4UA 4LXFA 3N04A 5FL0A 1UQZA 1UHVA 1MQQA 4Z2KA 4PMZA 5DMYA 4B9YA 1E1EA 1H2JA 3PN8A 1CWYA 3WD2A 1XV8A 1E6PA 1YQ2A 1CGTA 3EJRA 4CD8A 3VKKA 4V28A 3CUFA 3W53A 4BQ5A 2XHYA 2VI0A 2WSPA 4TVDA 3VD4A 1H41A 2X8RA 4P7RA 1E6XM 1HKJA 1HVXA 1KFWA 5CG0A 4AD4A 4UFLA 2J7GA 4OZOA 3CZLA 2WM0A 1UKSA 1GQJA 4Z2GA 1VENA 4BQ4A 1QNQA 3WNPA 2F2HA 4JIEA 3CTTA 1JFXA 3QHMA 5I5RA 2OLHA 3OG2A 4M1RA 3S5YA 5FOOA 3QHOA 2G3MA 4Z2JA 5LA1A 2WVUA 2CEQA 4D6HA 3A24A 2XYLA 4LYRA 1QW8A 3KZSA 2QPUA 3D51A 2ZWZA 1V3IA 4BCEA 4GKLA 1CLXA 1PX4A 1UWSA 2BVTA 3K4AA 3MSDA 1KXTA 2YDQA 4UCFA 4JKKA 2JIWA 4QLLA 3U7VA 1EDGA 1DWJM 1QNSA 2E4TA 5EMYA 4BS0A 4DUVA 2XTKA 4NRSA 3WQVA 3OLDA 2V5DA 2WLYA 3NDZA 2C8NA 1EA9C 1HN1A 4WSKA 3WL0A 1QNRA 2JEPA 3WF1A 4L4OA 2D1ZA 2WXDM 1UOKA 3BMWA 4DM2A 1RP8A 1VEMA 2XWEA 3HMCA 1J18A 1BG4A 2IGTA 3AMDA 3NSMA 6A3HA 4WF7A 3DX1A 4OIFA 1QOXA 3N1AA 2J8FA 3LXBA 3W38A 3GXIA 3F4VA 1Y7VA 1TCMA 1FFRA 1GZJA 2VT0A 1N82A 2PWGA 1K9DA 3VIKA 3VGFA 1ODUA 3F5KA 2J25A 3AXXA 3DDFA 3VILA 2X1IA 2DT3A 1JYNA 3B9DA 4N0RA 5A6SA 3TV8A 1V6YA 4AMXA 1UD5A 1JIBA 1RH9A 1LG1A 1E71M 4P8VA 3QGVA 3AHYA 3SCVA 4NRRA 3T2QA 2W63A 1UG6A 1JZ8A 1JXKA 3AHTA 3AHVA 1Q6GA 2IXUA 1OGBA 1NOFA 1UZ4A 3H53A 1US3A 1TQUA 3WMCA 1HJVA 3OGRA 2DH3A 1AVAA 2VCBA 3VDCA 5CZKA 4AEFA 2BHUA 1V03A 1EO7A 1GJWA 3AISA 1G5AA 5A6AA 2BY0A 3MUAA 5BWFA 3K4DA 3S5ZA 4R27A 1L8NA 1UH3A 2ZX5A 3RPMA 3EBVA 1PAMA 1UD4A 4UZUA 2PB1A 1HWWA 5LYRA 4TOQA 3LPOA 3DECA 1W9VA 2EABA 2G3JA 3WMSA 2BVYA 2XN2A 4J3VA 4TX6A 1M53A 2EPKX 3IGUA 1TVPA 3ZJ8A 2UY5A 3CMGA 1UASA 2YL5A 1E43A 1ZJBA 2W61A 4PMOA 1Z32X 1MQRA 1EHNA 2WZEA 1QHPA 4NF7A 3QHNA 3GZAA 2JF7A 4DWSC 2BXYA 3FW6A 1NH6A 2VL4A 5DT7A 3WEMA 3WMBA 1V0KA 2VR5A 1V6WA 3BUBA 1JF6A 1TQTA 2GDUA 4TXEA 2CETA 2UY3A 2OWCA 4BF7A 2VNCA 2FHBA 4TVUA 2VC9A 3LPPA 3WUFA 2ZUWA 3M07A 3ARQA 1C8QA 2YBUA 2J74A 4WK9A 3UCQA 5M3WA 4AEEA 3CUIA 4EAMA 1UWRA 3WEOA 1D2KA 3AIQA 1ECEA 1UA3A 2WZIA 1KXHA 4FLOA 2PBGA 4W7UA 4HZ7A 1B3YA 4NSBA 1C7TA 3GH4A 4KGLA 1WPCA 1HXJA 2Q8XA 1I1XA 4OOUA 2XIIA 4U5KA 3AIEA 2OYKA 1TVNA 2HISA 3ZSTA 2VJXA 4DWSA 1CIUA 2CERA 1O7DC 3GNRA 1XH2A 2CYGA 4PN2A 1JYXA 3WH7A 4MB4A 3L4VA 3OLEA 1JZ7A 3W28A 4AD3A 3VNZA 3CHCA 5AYBA 1E5JA 2QV4A 3NDYA 5A2CA 5FD0A 5DEZA 4UQEA 4PMYA 4V27A 1E5NA 4ACZA 5A2AA 5EB8A 1EDQA 3SUVA 1CXFA 3AS3A 3UG5A 1V6UA 2FH8A 2J79A 1JZ2A 4IPNB 4PMQA 3DHUA 2DT0A 1CXLA 4AD0A 3VMNA 5BYWA 1PX8A 2WC7A 2X0HA 1VBUA 1XCWA 3LRKA 2DGAA 3SURA 1WZKA 3J7HA 1B3XA 3ARXA 4JCMA 3GTNA 1GORA 4P7QA 1Q6DA 2EADA 1TR1A 3W24A 4ML4A 4V2XA 1WDPA 4NXSA 2WVTA 5CGTA 3D4YA 3B8SA 4R5EA 4GINA 3AS2A 4MNKA 1CGUA 1JD9A 5GNZA 4UFIA 2ZICA 2QMKA 2WHMA 4MADA 4ACZB 4JHZA 5DFAA 2E9MA 3BMVA 2YA1A 4CVWA 1K9TA 5CXPA 3N11A 4GO9A 1CGXA 4PBGA 1VAHA 1E4MM 3O6AA 1H4PA 1W3JA 1BGAA 3VGBA 3EJTA 3MUY1 2WZHA 3CZSA 2V3FA 1UKPA 4PUEA 3DHPA 2FH6A 5CPQA 3WFZA 2AMGA 3PZ9A 3ZMRA 1FHLA 2YL9A 4DWSB 1NQ6A 3CUHA 2YDRA 2EEXA 1V08A 3SUTA 3VSUA 3VGHA 3MS8A 1WE5A 5JIPA 4EANA 1TFVA 1KCLA 3VSTA 3A21A 1OIMA 3AIBA 3WNNA 5HXMA 3VDHA 3EJSA 3AIWA 3W82A 2A3EA 1B30A 3BVTA 1QI4A 1IZKA 2CCRA 4W7VA 1BYBA 3WFLA 1SR0A 3ZO9A 5AC4A 1EOMA 3U57A 1JL8A 4AXNA 4M24A 1E6RA 3GH7A 1LL7A 5BXRA 4CN4A 4WSJA 4M29A 1EO5A 4HZ8A 1H0IA 3ARUA 2NSXA 3WQ5A 1IV8A 3II1A 3KLKA 1NM9A 2DSUA 3OZPA 2J78A 1SMAA 2J47A 1BLIA 4UOJA 4UFMA 4AZ7A 1RD6A 3CV5A 3GBEA 1KWKA 1M03A 1J12A 1GW1A 4H41A 3LMYA 2JEQA 3VGGA 2XGBA 1XSKA 3SCOA 1V3JA 1EDTA 2ZX6A 4AIOA 1BFNA 2ZWYA 4ZXOA 3U5YA 2XN0A 3NYDA 3ARVA 2DT1A 4OBRA 5CQ1A 4U3CA 2CBIA 1QNPA 1BTCA 3CIVA 4UFHA 3WF2A 3EDEA 2VO5A 4AYSA 3BCDA 4Z2IA 4QP0A 5IHRA 2VMFA 5EFDA 4PCSA 1JNEA 2BFGA 2PC8A 3W4RA 4GZJA 4RE3A 2QF8A 3RDKA 2Z1SA 3EMCA 1ZBWA 3PZQA 4M81A 4NX0A 1US2A 1OSEA 1OT2A 1TQWA 2DIEA 2YKKA 2J8GA 1J0HA 1CPUA 3W81A 1EXPA 2YFOA 1G9HA 3AXIA 1SZNA 3KWXA 5E0FA 2QHAA 3SCPA 4JHOA 5JBFA 3ARYA 4M56A 1UD8A 3WEZA 1J01A 5C8BB 5IXEA 4J3WA 1MW0A 3KLLA 2D0GA 3HJEA 1J0ZA 7TAAA 3AI0A 2W91A 1GJUA 5ECUA 4FNUA 1V0LA 2NT1A 1GQLA 1QWNA 1NWRA 2GJPA 1BHGA 4MB1A 3SUSA 1CZ1A 1HJUA 4PYSA 2PBOA 4MJ2A 3T0BA 2WVVB 2WCAA 3RMEA 2J7HA 2J7BA 3BGAA 4TUFA 3OB8A 5GNXA 1E15A 4DO6A 1XRVA 4A4AA 1W2VA 3BAXA 1W9DM 3I3BA 1M7XA 1HP5A 1XH0A 2WVSA 4MNMA 1Q6FA 3EDKA 5A94A 5E6YA 2DSKA 2G4FA 2VTFA 1G01A 3MI6A 1ZL1A 3SCQA 2XN1A 1RP9A 1W3KA 3DX0A 4B16A 4LYPA 2DIJA 2X2IA 3DX4A 4PMNA 3WKZA 5JUVA 4C7GA 1W1PA 1QW9A 1QNOA 5A8QA 1QI3A 5HDRA 2XM1A 4WIWA 1JF5A 3A6OA 1J9YA 3GH5A 2OW6A 3LRMA 3WH8A 1FHDA 4FLQA 1V3KA 4JFVA 4A3HA 4YHGA 4GI9A 3W6LA 1GVIA 4DO4A 3VVGA 1B90A 1GOQA 2WWCA 1C8YA 1PJ9A 1ZS2A 1CEOA 4LYQA 4Y7EA 1GOWA 1S46A 1NOUA 2X0YA 3A23A 2XG9A 4N42A 1VFOA 2VZVA 2D3LA 3AMGA 1KWGA 4MNLA 3VD9A 2UWFA 4HA1A 4OOZA 1HTYA 1EGZA 2YBTA 1B0IA 1HL8A 3EJQA 1CXEA 1BSIA 7CGTA 1VF8A 4ZE5A 1OGGA 2CESA 1W1YA 1R47A 3WBEA 2PWFA 1KB3A 2OSYA 3PBGA 2AOSA 1XH1A 3AMKA 3OGSA 3VDBA 3ZR6A 3A4AA 1VEPA 2ZE0A 4RE4A 1FH9A 1JI1A 3BH4A 3ZT7A 2GJRA 1UYQA 1HL9A 3GXNA 1W9UA 3PZVA 3AIRA 1ITXA 4FNTA 4AZ6A 1JYVA 2EACA 4PMRA 2PWDA 4GI6A 3ECQA 1JDAA 1R7AA 2F61A 1LWJA 5LA0A 2ZUNA 4FNSA 3IJ7A 2DSWA 3TTSA 5M5DA 3T08A 3CGTA 2JIEA 4CD7A 5ABFA 2VVSA 3IJ8A 5FL1A 1PIFA 2V5CA 4AYGA 3S6TA 1TA3A 4GPNA 3WH6A 3WN6A 2VVNA 2D24A 1V0NA 2DSZA 2GUYA 4F66A 2Y24A 2EPLX 3MMUA 2ALWA 4HTYA 1QVBA 3PZMA 3FN9A 4QCFA 4MPKA 2J7DA 1L0PA 1TQVA 1EQCA 1CYGA 1E6NA 4GQRA 3OGVA 3BAKA 2CBVA 3LRLA 2CKSA 3VO0A 2CBJA 5FKYA 2C0HA 3ZJKA 3ZJ7A 4D6JA 1PX3A 4F8XA 3QR3A 5CPSA 1OD0A 3F5JA 3RJXA 4MTVA 3TA9A 3ALGA 3BAJA 4KMQA 4FNQA 3WDPP 3T09A 3N17A 1WDRA 3KL3A 3K46A 3TOPA 5A8NA 3K1DA 3IJ9A 3MV01 4U2YA 1NOWA 3KE0A 1W9BM 4PMVA 5E0CA 3RIKA 2WWDA 1DEDA 2X2YA 1WAWA 2XVNA 3WBAA 3SCSA 2XGIA 2EXOA 2YLLA 4YHEA 2W5FA 2X2JA 2J7EA 4HOZA 4HPGA 2JFEX 5FIPA 2DT2A 2OYMA 1ZB5A 2OWXA 5D9OA 3HG3A 2AAAA 2F7PA 3ZJ6A 4JFSA 3WNMA 2ZUVA 1LQ0A 3BUQA 3WY4A 3ZR5A 3FY1A 4URIA 1J0YA 2O9OA 3D4ZA 2XFFA 3SIMA 1OIFA 1XSIA 1ZJAA 4XZWA 1YHTA 3T0DA 2A3HA 3ALFA 1E0VA 1CXIA 4HMDA 4P7NA 4H8VA 3WDQA 4KRTA 3BAIA 3GYCA 1I1WA 1VB9A 3NUKA 1JYWA 2ZX7A 1MW1A 3CPUA 2J75A 4W86A 2D73A 3VTRA 1PEZA 5CGMA 1ISXA 2VRQA 5E1QA 4XZBA 3OIHA 4B15A 3DYPA 1W91A 2WC4A 4S3KA 3BAYA 3LXCA 2ZUSA 1FFQA 4UZSA 4U33A 3MU7A 4DUWA 1PIGA 2BS9A 3VIOA 3CHEA 4CUCA 1GOOA 5JBEA 4DUXA 3UG4A 1T0OA 1BF2A 4FLSA 1CNVA 4FNRA 2F7QA 1WO2A 5JBDA 3CH9A 4QCEA 1H09A 3ZQ9A 3HN3A 4M82A 2G41A 1GPFA 5A69A 2BNJA 3WD0A 4KRUA 4AC1X 1MVYA 3VD5A 2WKGA 5D9NA 5A3HA 3ARWA 3SUWA 1ZBCA 2XSAA 1F4HA 4C7DA 3LPFA 5BROA 3IANA 3WNLA 3POCA 1KQZA 4AD5A 3A4XA 1XCXA 4XUYA 4RL3A 3MMDA 2OSWA 1UH2A 4Z2LA 1G1YA 4ATWA 2WW5A 1OGSA 3UR8A 3EJPA 2CXGA 1OB0A 3BSGA 3W37A 3VMOA 3B9EA 3D5HA 4JFUA 1Q6CA 3AMCA 2A3AA 1KR1A 3WDIA 1A3HA 1V3MA 1GOIA 3GXMA 1E0WA 3WUGA 1QX1A 2D22A 4U3AA 2GK1A 4X0VA 3O9NA 2NT0A 1E3ZA 4BQ2A 3AIVA 1R8LA 3WDRA 1HX0A 1UWIA 4JAWA 3A4WA 3A22A 4PTMA 2ZXQA 3N13A 3AICA 2Y5EA 4AZGA 2CHOA 1PS3A 4AZHA 1HF6A 2WSKA 4AZ5A 4OBSA 1DWIM 1R34A 4QLJA 4TVCA 4WLCA 5D8WA 2XIBA 1M04A 2WCGA 3PTMA 4F79A 1V6XA 1J10A 4YN5A 1KGWA 4UQAA 1TG7A 1TMQA 3EMZA 3ZT5A 1GQKA 2VCCA 4GZEA 3BCFA 2F1AA 2J4GA 5I3DA 4WKHA 1XC6A 3AYSA 3T0AA 5A6KA 4CD4A 1BYAA 3TP4A 4HOWA 1BYCA 1VJSA 4PUDA 1VFFA 1E72M 4CCDA 2BY3A 2E8YA 8A3HA 4JFWA 3GXTA 5BCAA 3MSGA 3PZIA 1JZ4A 3PTQA 1W1VA 2A3CA 1C91A 4CD6A 2WMGA 3PHAA 2BY1A 1XD0A 5ABHA 3BLBA 3DC0A 2RGLA 3SUUA 3U7BA 1SMDA 3BUIA 3IAQA 3RM4A 1GONA 1QWUA 1AQHA 5CJ5A 3CZKA 2O9RA 3WD4A 3VGDA 4PTXA 1JDDA 1NWUA 4QDMA 3WL1A 1J11A 4KH2A 3KL0A 3LPGA 4UQDA 5A6LA 3APGA 1IZJA 3AZRA 2JALA 3VPLA 3W0KA 5I77A 1C90A 4B3LA 1QI5A 2TAAA 3MO4A 1B31A 2IXVA 2ZXDA 4W93A 1WB0A 2J77A 3GNOA 3NSXA 2EPOA 2WBGA 1UUQA 2Y8VA 3RM9A 5D8ZA 2CIPA 2ZXBA 2WVVA 1EHAA 1PZ2A 4PMXA 5I6SA 4LGXA 5BXSA 4A3YA 3WD1A 3N12A 4W87A 4W84A 4CCEA 3SCUA 1DHKA 2G3NA 3AMLA 1FH8A 4D6GA 1JNDA 3SCRA 2CKRA 2O92A 1LF1A 1E4NA 5ABEA 1JGIA 1BPLB 1UR0A 2V38A 4E2OA 3MMWA 2OYLA 3AHXA 3BUDA 3W25A 2EAEA 2VX6A 4CVUA 5I78A 3OA5A 4GI8A 3WY2A 4KGJA 4F9JA 1W32A 5BXPA 4HOXA 2YA0A 3TTYA 3RCNA 2GFTA 2ZOXA 2J62A 1VFMA 4E8DA 3SCNA 5A6MA 2FGLA 3BAWA 1ZU8A 4QFUA 2F1BA 1QBAA 1R33A 3M46A 4TX8A 1GQIA 1C92A 1XD1A 2O9TA 3UEQA 3DYOA 4Q22A 4M80A 1R46A 3WNKA 3WY3A 2CBUA 1VIWA 3GM8A 2DSVA 1E6ZA 2ZUMA 4AZIA 5C70A 1K9FA 3AQUA 3EDJA 3GXPA 1HKKA 3POHA 4FK9A 5KZ6A 2OWWA 3VINA 1AMYA 3BC9A 1HJSA 2GSJA 1X1NA 1NP0A 2X09A 1UZ1A 2WHJA 2C7FA 1O7AA 3VOCA 2E9BA 5A8OA 2ZUTA 4D1JA 5BRQA 3H55A 3VDAA 5KEZA 2WHKA 4H8HA 5CSYA 3WELA 1AQMA 1LLOA 2J7CA 2YL6A 2NW0A 5A6JA 3WSUA 4AY1A 1DP0A 4AIUA 4IUGA 4GIAA 2BVDA 2WKLA 3L4XA 5HNNA 3BSHA 2WMIB 4ATLA 1KBKA 2XWDA 1X6LA 3UR7A 1JAKA 3I3DA 4OKDA 3VIHA 3EDDA 3HG5A 4ATDA 3D3AA 1ISZA 1MYRA 3L2MA 4D6EA 1R85A 5HOSA 3VNYA 5C71A 5BXTA 3GDBA 2WMKA 1F4AA 3N18A 3VIJA 4MAZA 4PSPA 1BYDA 3WD3A 4CGTA 4GZIA 1JDCA 2WYSA 2VZTA 2F7OA 3FNDA 4P8WA 2O9PA 4JKLA 2BV9A 1R7OA 1V3HA 4UTFA 3THCA 3NCOA 2VRJA 4HU8A 1UKTA 3UERA 3NSNA 1E4IA 1H3GA 4J3XA 1CTNA 3WH9A 2F8QA 2UY2A 2FDMA 3CC1A 2XPKA 4PTVA 4AD1A 3DYMA 2WB5A 1R87A 3EMQA 3I3EA 3WNOA 1TQSA 4H2CA 1XYFA 1ISWA 4X0NA 4FNPA 4AW7A 1CGVA 5I0DA 1TA3B 4Z2HA 4XV0A 1DTUA 1ISYA 1LL6A 1CECA 2HVMA 3AHZA 2BXZA 4CN1A 3AS1A 1E73M 3HZ3A 1WCGA 3M7SA 1JG9A 2W4XA 1W2PA 1CXHA 1B9ZA 1R75A 4ZXLA 2YL8A 3D52A 3ARPA 4CU7A 3L4ZA 2Y2WA 1UWTA 2YJQA 1GCYA 2DQXA 1XSJA 3EYPA 3QOKA 3KEHA 4QAWA 4JL1A 2WMFA 2WPGA 7A3HA 4W5ZA 5A8PA 2WBKA 4U2ZA 2VCAA 2F18A 1DWFM 1K9EA 5ABGA 1E9LA 1CDGA 5A8MA 2XVLA 3N9KA 1BG9A 3VU2A 1GNXA 4QLKA 1J0JA 4J3UA 4OJYA 1GVYA 2X2HA 3S2CA 5D9MA 3DDGA 1HKMA 1E40A 4HP5A 3WF4A 2WCSA 1WZLA 3L4WA 1NWSA 3BVUA 4P7OA 3FAWA 3WQ4A 3VX1A 3UETA 4PMDA 3U5UA 1BAGA 4HA3A 1UD6A 4CD5A 3AZTA 4PMUA 1RPKA 4PRWA 1VEOA 1TZ7A 2ESCA 3O2LA 2JF6A 4Q7NA 3BUPA 3K8KA 2V3EA 4AZCA 4LPCA 3CZNA 3CZ8A 4GQQA 1GOMA 5DF0A 3VIGA 1U2YA 3KL5A 4HA4A 2D3NA 2IUZA 3FXYA 4MB3A 5CPTA 4DM1A 3IAPA 1CLVA 1FOBA 4MDOA 1MXGA 1UR8A 2VOTA 4UQBA 4ZEPA 4OGZA 1E3XA 3AOFA 2ZX8A 4UOQA 3N15A 1KQYA 1KBBA 4WKAA 5EBAA 5DT5A 3GBDA 4PEEA 2GJXB 4MNJA 4H8UA 2VZOA 2YIHA 4U31A 4J3TA 2WLZA 4AD2A 4NI3A 4EK7A 4UQCA 4D72A 2CPUA 3CZGA 4HMEA 3WUBA 3CLWA 3CBWA 1UWUA 2EJ1A 4KWUA 1WKYA 1HT6A 2YDSA 1XYZA 1UWQA 1JZ5A 2E40A 1Q6EA 2WC3A 4CN6A 2XFRA 3VIFA 2E0PA 1FH7A 3OBAA 3SEPA 3VSVA 4PCTA 4X9YA 1NWTA 2XVPA 4AIEA 5AC5A 1MWOA 4H04A
chains in the Genus database with same CATH superfamily
4GW1B 4KNTA 4O2FB 4F8QA 2VR4A 2EZ0C 4JX0A 5TDNB 3C6EA 2V68A 3EYQD 1M41A 4J2MA 2YD9A 3UTSA 1OCOB 2AJUL 4F5CA 1TZZA 3GK0A 2G0LA 2Z0UA 4JZNB 2QZRA 3KWUA 5AW5B 3UROR 3UZEA 1RZ8B 5AD0A 4XP4L 4YSRA 1WNOA 3GM0A 5C0DA 1X4XA 1IC7H 4ACPA 3ZVIA 3K2MC 1CGYA 2VRKA 2PF0A 1W72L 4HMCA 2XDFA 2DLEA 5A2IH 3QOMA 1UM4L 3WIJA 4PJ5E 5FUOL 4AHQA 4RV3A 2NY6B 1BYPA 1OL0A 2B1AH 2BY2A 2BIPA 3OKDA 4ZMXA 2YOCA 1ZA6A 5HD8C 5L4JA 1LBFA 1AKJA 1EV2E 4NG3A 4LCYB 3MI3A 2AXFA 4ETQB 4F91B 1OY3B 3OLGA 4ZTOL 1N6UA 3ZJAA 4JNXA 3SRFA 5BVPH 4XNQA 3BW2A 5FDWB 4PJEB 3CXHK 3B9NA 2AJZA 4I9AA 5I03A 5LNWA 1WBZA 5HGAB 2XTJC 5E9AA 4LW7A 3NJVA 2RJHA 3FQNB 1U8OB 3PABA 4LDLB 3M7FB 4TKWA 3NIFF 1PO9A 5EV7A 5FCZA 5E08L 2VQUA 5A2BA 1FKXA 1MH5A 1GY2A 3NWRA 4LAJH 4FMVA 4X9HA 4XVOA 3E2QA 3GIVB 3MJMA 3W7KA 3LX9A 1MZYA 2HJFB 2GK1B 3QQ4A 1HAWA 4R7DA 5DVLA 2PWEA 1ZHKA 1XIDA 3PBUA 5U4NA 1Q72L 1XS2A 3ZIZA 3WDJA 3SGJA 2H8ZA 3ZM8A 1IEBA 1ACYL 2JI2A 3ULSA 4X9IA 3C6LA 2XBZA 2YBRB 2VDOB 1UUOA 4UYQA 2E6FA 4MY9A 4BUHA 5LIWX 3E0VA 1BWWA 5J56B 1NPNA 2X40A 3I6GA 1KR0A 1YYAA 3VIIA 1S8DA 3N1MC 2WJFA 3DO7A 5A95A 2ZTJA 3B9KD 1W9XA 4PJXF 5CU9A 3FKKA 4WIQA 3PHOB 5CAYB 12E8L 3V0UA 1KIPB 3H9SA 3KGTA 4H5SB 5E5LA 5E8EB 3X1NA 4MZYA 4HKJA 3RPTA 3WJZA 3N43F 1EXUB 1NIEA 5CSBA 3PFRA 5LKNA 2R1WA 35C8H 3MHFA 1TO4A 4QRPB 1AXSA 2EDQA 4PLJC 3R4DA 3EGSB 1X1ZA 4Y9OA 1R6VA 3E1F1 4HIQA 1WP6A 1TWSA 1SSDA 1R3IL 1YNTA 1BCIA 2D7TH 4YSOA 1XEUA 4QHUA 3U0HA 1PY4A 4AMWA 5EOQH 5FW7A 3GTXA 4FIQA 4WUIA 2ZWKA 1MIEL 3FH5A 3QUYD 1XO8A 1OAZH 1WQVT 5KVFL 4O8RA 4DBSA 4AXKA 4N6RB 1Z9PA 4LNRA 3OHIA 3H7RA 3O3AB 5EU4B 5FGCB 4GVFA 2CH8A 3V0SA 3UZYA 4KUZH 1MUMA 1WDSA 3OHXB 1PZAA 3BD3A 3W72A 3D09A 1QSVA 2J5LB 4ICWA 4AJYV 5IWLA 4V1XA 3FUHA 5LXVA 1PKMA 3S9YA 4S1SL 3WFHB 4QXIA 3D2UB 4Z8FH 5D96C 4Q4SA 5MKGB 1W0MA 4P9HC 1S3RA 4ZNEE 2MTAA 3VIPA 1WA0X 4XI5C 1QLEL 3K6FA 1TZ8A 5J1SC 2AJVL 1VADA 3IE9A 3L08A 3Q5TA 3GHTA 2EYTA 3D0VB 3FT9A 1T22A 1D3CA 5EO9A 4LFHG 4QAIA 3WFHA 5HINA 3DSNB 2F08A 2O5XH 4JX6A 2PTZA 3DX6B 4X6CB 3TJIA 4OV9A 3VFSB 4YXGA 1OP3H 3LEVL 5AVNA 2P44B 4N0CC 4G70B 1M6JA 1R3KA 3SBPA 4NZ8A 2J7FA 3NABH 3B0YA 4ZE4A 4UOZA 2CGZA 3PWVB 4IBSA 1OZUA 4UF7C 2B15A 1W8EA 3IT8D 3OR6A 3GF8A 1FVEA 4FP1A 2AJSH 1GOHA 5L0QB 2SEBA 2Y3AA 3RGVA 3UTZA 4UT7H 4EOWH 4L6DA 4NYYA 5IDIA 3ZQXA 4GJ1A 3TQKA 5HPMB 3TH4T 5AHNA 5J7CC 4OJFL 3GR8A 1H11A 1A4BA 1HVQA 2E6PA 1HIZA 4FKKA 4Y4HD 4JG1H 5BRZD 2ADIB 2CZEA 1EP2A 2OMUA 5AAMC 1RUKL 4LARH 1KIPA 2ZIDA 3H9SB 4HSQA 1IEAA 3WKYA 3AM8A 3S5SA 4RESB 1SFLA 2QV2A 2HVNA 3UWWA 5EMJA 1NAML 2B59A 2GK0A 2DH2A 3NRPA 1T21A 3BLDA 4PBEA 1AAJA 3C87A 2QMJA 5F2IA 1DQLL 3NYZA 1YJDH 4FLRA 5F4SA 1X3DA 1F6KA 8FABB 4CL7A 1UWEL 3L17A 4NZDA 3FFCE 4RGND 3SGJC 1IVTA 1OM3L 1YE4A 2PCEA 4NQCE 3GUTA 2W60B 5D6CA 3T71A 4BFFA 4O1BA 3SDOA 3L13A 1MDAA 1RZKC 1V55B 1YEHH 4JL2A 5E0QA 1AQKH 2V3GA 2XZCH 2ZWLT 1O9WA 3JV6A 5IQNA 3VXOA 3MBDA 1PLCA 1TO3A 4XAYA 2HVBA 1O6IA 3ZRCC 3BLIA 1KYDA 1TE1A 3FULA 4CVZB 1UKQA 1QO3A 3ES6B 3P4OB 4PRTA 5EC2B 3SGGA 2JB5H 1GSKA 3O9WC 3DBPA 1HP4A 1W3TA 3ZKMC 4X2RA 4E42B 2H9AA 1FWIC 4E9YA 1AKJB 1JVOA 1K6AA 35C8L 5D5MA 1MI3A 3R6IA 2XTJD 4OF3A 3OKDB 5D1XD 1OE3A 4Y5XC 3IJSB 4GWEA 1KF9B 4UINL 5I24A 2H0FA 1LEKA 3RTQC 4QNWA 5A5WA 5JQ9A 1KIRB 5FF7A 2XN9D 3MP3A 3ERXA 2J6WA 1OCJA 3VVVA 1DWGM 4S3JA 3O16A 1SJCA 2QHLA 5I2IA 4YIWA 3CVHH 4DKDC 1JVKA 5DURD 2Z1XA 1V6VA 3UJ2A 4P3DB 1TPXC 4U1GC 1GHRA 4N9GA 1A02N 2R82A 1QSEE 5CKAA 2BGNE 4LS0A 1KYUA 5IG7B 4X99A 2XJ7A 2N7SA 3E12A 4EP8C 1KDJA 3MC5A 3R11A 3IM1A 3ABSA 1CR9H 1Q1JH 4DP7X 5C07A 2INFA 4R4BA 2Z2AA 4DKTA 3MDUA 1REIA 1JV5A 2OQYA 3DJSA 4GRWF 5A3ID 5T5NF 4Z77A 1UT1A 4MMYB 4IPLA 2JCCB 2OLSA 5MP6H 5TF0A 3AJ7A 1XX9C 3T3MB 4DO5A 4KHXL 2KDGA 4LMQE 3WGVB 1P7TB 3EAUA 4A2EA 5K7JA 4PJ5B 2FHCA 3BW9A 4PTUA 5BZAA 3EH5B 3HMWH 4FP8L 3RE0A 3HZMB 3RRXA 5JXAH 4C6CA 2ZZ1A 3QI9D 1SEBB 1NTHA 3EX1A 1JZJA 2A0LD 1S9WA 5FA5A 1NEYA 5CN3A 1F2XK 3IIVA 4FQQA 3TBTB 3E6FB 3SBQA 4KTYA 5T3XD 3RZCB 5MERA 3ASOB 3M5VA 3SJVD 4EVNB 2G3XA 3TVMB 3IJQA 3CVHB 3CZJA 1X5YA 2NY7H 2LFGA 4QRBA 2W66A 5I79A 1DUZB 3UZXA 1YEHL 3EXLA 3V4UL 5E6ZA 3WG6A 4JPVL 3MU3A 3EOTL 4NZRL 2VXTH 2NZ1A 5C0IB 1IKFL 3QUXD 1ND0A 3STLB 1LZOA 1E6OL 2ZOKA 4CQCA 3ISRA 5KJ4A 5C07E 1NC4D 3B7YA 1E6SM 5IBTL 3UYOD 4B9CA 3QG7L 4WWNA 3FN0H 4X6BA 5EFIB 5JHAA 4ZX4A 1OAUL 2FJHB 5BV7L 3FYOA 3FT3B 3KDMB 1M7DA 3ZYJA 2G97A 4KO7A 3LCIA 3CQ0A 3O6LH 4KESA 2XA3A 1TZGL 2ID5A 3GSXB 3ZWSA 1I1FB 1AH3A 4GFIA 4G9DA 2NY3D 1JJKA 2Z1PA 4H13C 1ZKAA 4XX5A 5D9PA 4FSAA 5D7IE 4ZMOA 1ZTXL 3Q13A 3J27A 5AAWC 5DS8B 2E3ZA 2XISA 4HWBL 2LLLA 5LDUA 4XX6A 4EPBC 1F8TL 4NQCA 5CD3A 1DHPA 4L6OA 3TOYA 1Q7ZA 2DVUA 5K1NA 4MMZC 5D1QA 5IFTA 4KKAD 1A25A 4Q6KA 5D2LB 3TBYA 4IMLB 1BVOA 3EX4A 3NQ7A 3PPHA 1HWHB 2Q20A 3MANA 4MAYA 2VQTA 4CKQA 1SYSA 1VRXA 4P5TB 4W89A 4C47A 3ZKMD 1AC0A 4I0CC 2QDEA 1N2RA 1FP8A 2N3JA 2Y1VA 1JAEA 3JTTA 5AFAA 2CCVA 1DWHM 3OZOA 3RO8A 1KD0A 4AIBA 4C1LA 2HJLB 3VNKA 4M7TA 4D6DA 4OFIA 1MWAH 5J3HC 5C7XL 1PYWA 4MQ7B 1AH0A 1J8KA 1UWGL 2QR6A 2NQDA 1Q13A 1S7QB 4U6XB 1OC7A 1OCRB 4H83A 1M4KA 1KB5B 5DMNA 3HR6A 7REQA 3CL6A 3FU0A 3QY7A 2X2UA 3RAOA 1T3FA 1ACYH 3JT0A 3PPEA 4MGGA 2GITB 3G5YB 5JA8B 2DEPA 3DSFL 2E8ZA 3NSDA 5BXFB 3FQXB 4P2AA 5IJKC 3LV3A 4L0YA 1N4XL 1ZJHA 1Z5HA 1UACH 1TEFA 5GS1C 1J5OH 1ECZA 2ENQA 7FABL 2AJVH 1F3TA 1U95A 1KXQA 3WKNA 4LQ1A 1QR4A 3ITTA 3ZUNC 5AOUA 3T0CA 3NSJA 2YMTA 2IKIA 2H47C 3TA4D 1UA7A 4U1KA 1JZ6A 4J7RA 5DDHB 3OXRA 1MAMH 4AQAB 2L5HA 5FSEC 3HI5H 2OX5B 3MODH 3CZFB 2DQWA 2R14A 3GC3A 3QYCA 3BH8B 3BDYH 4RRPM 1EEZB 1VCVA 1CFBA 4UQ3A 4L1TA 1UC4A 1EUNA 1GGYA 1GPOH 5C6PB 5L6YH 5E93A 5FACA 4J3OF 3QEHA 5JOFB 3V1PA 1C08A 1IZCA 1KPRB 2DVTA 4L4LA 3CLFH 4OLXH 4M7LH 5ABDE 3VWKB 1YPFA 3KP0A 1AI1L 2JVUA 3FDWA 1XM3A 4YIQB 3TO2B 2V7NA 5I1HH 4XKYA 2Y06L 4LLAA 4AGMA 1C8XA 3QQ0A 2K3HA 3H21A 4KKZA 2XSXA 3BKCL 3TCXA 4OI7A 1OWQA 2RGMA 1P7HL 3KZPA 5DEGB 4P5TC 3CQKA 2UYLA 2XXFA 4UBDC 5EU3A 2IPFA 2Q3OA 1MW3A 4NJKA 3UWUA 3ARTA 1G1CA 3KM2A 3N40F 4HPYL 4QYOB 3LKNA 1BP3B 4LCCB 1AC6A 2ATSA 4A7QA 4JFOB 3EWXA 2CKBB 2DZPA 1NIBA 1KM1A 5I6NA 1KZYA 1BEYH 5D4IA 2JKPA 1M2OA 1PZ0A 3TESA 5DJ2B 5JA9A 1HJWA 1B0RA 2RGSA 4JZOB 4S1QH 1E70M 4MASA 4AEHH 2EPMX 4JPKL 3T05A 4XMPL 3ETSA 3VG0H 4Q8NA 2IBGA 3GI9L 3U7AA 1CDJA 3VD2A 2NVCA 3QW3A 2LU3A 1F6FB 3WLOA 4G59C 4AK2A 4P5KA 4KUCD 1V7NH 3GMQB 4E8CA 5F6HI 5DK2B 2C1GA 3CMJA 1DN0A 2XPGB 4L4VB 2PDMA 2VURA 1LL1A 3SFWA 4PJIA 2QLYA 4WNQB 1JNLH 2YA2A 3GSWB 5F89B 1IBGH 3VD3A 3ISWA 3PWUB 2FFCA 5T3XL 3KVLA 2E27H 1X5GA 3UX9B 4ZFCA 2FO8A 1QBBA 4U6YB 2ESVE 3B3DA 4NP4L 2DN7A 2YFNA 4FQXB 5DHVB 4PJ8C 3NH7H 3P9WB 1DQTA 4LE8A 4U49A 3LEXA 1XLKA 3D6NA 3RJYA 2PURA 4AG0A 1HO4A 5IBUG 4DH2A 4AW4A 1EUTA 2DQCL 4X42A 1WD8A 1S3KL 1T7VA 4R2GB 1QLRA 3NGFA 1FFTB 4BA8A 1ADWA 5HPMA 2UXVA 1YO4A 4H4IA 4P7LA 3KXFB 1I3RB 3BIKA 3SZ6A 3ULVH 3H54A 5ITBH 1ELSA 1VBJA 4YXKH 1ZALA 3VRJB 4QR6A 3BWUC 2R1PA 5GSVA 2PYFA 1TITA 4ISVB 1F3DH 4J3SA 4NN6B 1X44A 2IPJA 5G4EA 2YCEA 3MLUH 1Y18B 4O2EB 5DEJA 4BSVB 2X1SA 3KPPB 1T5XB 2XWZA 4R84A 5DJZB 3U9UB 3DG3A 3S3JA 1X9LA 1HHIB 3MV9B 1BOYA 4A2FA 5B8CB 4LLVA 1G6RB 4LCSA 4M8UA 4XB3A 1SJHA 4M4PA 3WJLC 1VPQA 3E38A 1MFEL 2WUCL 2YXVA 4PWJA 4LQFL 4TSBL 5GRJH 2F8VA 2PS2A 3AFBA 5E5CA 3MJ8B 5TE7H 3IMRA 3HS0A 3PBMA 2C1PA 4FAMA 5DJAB 2WCPA 1P6BA 2HVKA 4Z0SA 1KM5A 1L6SA 4EF9A 4UYPA 4XC1L 3N5AA 3QNZB 1W3NA 1MFUA 4LB4A 3P0YL 4QGYA 4X3ZA 5HWJA 5JH1A 2DLFH 2A3BA 3AUVA 4OIBA 5ANMA 1JGUH 2X6CA 3HRPA 5B1BB 2XUWA 5HBBA 3S3DB 3Q43A 4ISVA 2BZDA 2AV7B 3G0XA 1HNYA 3BXNA 3HG2A 4LCUB 3MSRA 5E9XA 4X5PA 1AGFB 2EG6A 3GMRB 1RH8A 2V2WA 4G5DA 2Y2YA 5JNYB 3G6MA 4JO2L 1HHHA 2QPFA 3GBLA 4JFDE 2B7NA 2VKXA 5DI8A 3FB8B 4MJHA 4WI0A 2OZ0A 1XL4A 4Y9AA 1LO2H 4L5FL 4HFWA 2BWIA 2QFPA 1OFPA 5SWZB 1W5OA 5EMMA 1RQEA 4N0YH 1X6NA 3PL6B 1MEIA 3LDBB 4FFVD 1Z9MA 3PZGA 3QZWB 2C9XA 2JJTA 4GIRA 3BD5A 4Z42C 3HFML 1JBJA 3G6LA 3K2IA 5KZMA 1DANU 4F80A 2FTAA 4NS0A 2DQFB 1RUMH 1EO8H 1E6JH 3PWUA 4ZOAA 5DRZB 1UM6L 2YLAA 4L6HA 3UOAB 3VYNA 4IBYA 3GRWH 1QHOA 5BV7H 4AENB 1OGPA 3A6CH 4GKNB 1DN0B 1KY6A 5EU6E 1PZDA 2JK5A 4HG4K 1SYVB 1UQZA 2NW3B 2QADB 2I27N 4Z2KA 25C8H 4P5KB 4JK0D 1NGXB 4Q32A 3BP7A 5T33H 5EIIG 2JIXD 1CWYA 3GMLB 2HPTA 1YQ2A 2NXYD 1ORSA 1UURA 4K4KA 2Y72A 3M0YA 2ATKA 4IIHA 3EJRA 3MJWA 4V11A 2NV1A 2Y0SA 4QXVA 3AUOA 4ZS6C 5GJSL 1QVOB 4N2HA 2BSEA 2GJ6A 4GBXD 2COQA 5CPLA 4BQ5A 1WKDA 3DUSA 3EYVB 1BJ1J 4NHCL 5MI0C 4TVDA 2O6PA 2WBJD 3BSZH 1UOVA 3JVAA 2C7UA 1HKJA 4MUZA 3SKJL 5F9WC 5MEQB 2A3TA 1IU1A 1WGVA 1T7XA 2O5ZH 1Z1WA 3ZVVA 1ETZB 2HCVA 2QJNA 4IP4A 4XOCA 4UFLA 5GVJA 2V0TA 4YHMH 4X4YB 4YYFA 2PDIA 3DO3A 3F7QA 4IGBA 4KJWC 3BT2H 1VENA 2G9HB 2NR6A 3WQDA 4S38A 2IKGA 2H3NA 3QJXA 4YSPA 3RWDA 5I0WA 1PLBA 3MGTA 5IFAL 1UWGH 1QNQA 3RGTA 4ALAC 1SJBA 3HTWA 4FO4A 1SDDB 2X1PA 2ZCHL 1JFXA 5J6GB 1PSKL 4NO3A 1F61A 1NJJA 1ZUAX 1DEEB 5DY2A 1FYTE 1YEIH 3MCOA 5D32A 3LEYH 3QG6B 3LS5L 4UM9A 3QHMA 3HG1B 4XXDB 1MFDL 2P8LB 3BH8A 2KHAA 3WIHH 4EXPX 3HBLA 2VUNA 4GKSB 4WCYH 4EZLA 3IU4L 4YWGH 1HTIA 2X16A 3TPUA 4TL5A 3PS7A 5HR7A 4D6HA 4R97C 1AA1B 3DH7A 1D8CA 3L23A 2AXGB 4WW1A 4XD4A 4A68A 4KRPB 3M0HA 2FJUB 5SWSB 2FUTA 5MEOA 4H8PA 4A6YH 1IM9A 1BFOB 3OKYA 1SW3A 3SOTA 4IPJA 2HT3D 1W5QA 4PMRA 2HRWA 4LU5H 2FWUA 1UWSA 3T0EE 4G43B 3CAFA 3G5YA 4I0PD 2QVMA 4GYJA 5KZDA 4DP5X 3MCLL 3URQA 5CJXA 3MKVA 1C5CL 2VFHA 3WXVH 2GAZA 1F00I 4LUTA 5IB5B 3GG7A 4PJEE 4MQ7A 2F53B 2CDEA 2NY4D 3Q1SL 3WG7B 4JIHA 3LBOA 3MBEB 4ERSL 1PFOA 2JIXB 4IOFC 3GG1A 4NZRH 1JVNA 4DGIH 4BHYA 2GT9A 5AW8B 3FC8A 4YDKH 2E4TA 1AS6A 2EUXA 3GZPA 1EBAA 1NSJA 2Y3NA 4MAYB 2PP3A 1BQHB 3DKJA 3BUTA 4G9FB 3ZDZE 1W15A 1RZGA 2LV4A 4KHTH 1RK6A 5FJJA 2WOQA 4FG6D 2QCLA 4BUQA 5JORB 1QU4A 4NQCB 5CD3B 4O10A 4I5UA 3SJVE 5I1AB 2R9HC 1XCQB 2A9MH 4GX9A 2JEPA 2NY5C 3B5TA 4N90D 1V5XA 1Q9LB 4U6TA 4EI6A 2DZWA 4P2RB 2RIKA 4AVHA 1DQVA 3GTIA 5E8NB 3NFNA 4JYDA 5FXCH 5IW1A 4Q52A 5GGVY 5B38B 4DM2A 1X97A 3TIEB 3MCNA 4JDEB 4ZAKD 5BZXA 1W1A1 1VEMA 4BY3A 2HWZL 2XWEA 4TQPA 1J18A 5F1KC 1G0DA 1YN6A 3Q9PA 4OQTH 1BD0A 1BG4A 3AMDA 4H7CA 3TQPA 2HPMA 4GLRI 2FIKA 4WF7A 2RCSL 3DX1A 4MWAC 4OLYL 2EIKB 4H1LA 4NVTA 1ONQA 2FLMA 4DGVH 2IWFA 3MCMA 1YY9D 4H40A 2R4RL 1QOXA 3LXBA 4NC0B 4Q7DA 1WCBB 5BO1H 5L2KB 3EGDB 3F4VA 3QUXA 2HXUA 4NM8H 1I1AD 1FFRA 5CCKL 1GZJA 4C55A 2PDXA 2PWGA 5EUOB 3N0PB 4G6FD 3N42F 1K9DA 3IIOA 5F2MA 1DVFD 3HBPA 1ZA3A 1ODUA 5T1KD 3UZQB 2H26B 5C0AA 4A6YB 3X14B 3F5KA 2CDFB 1DJHA 3AXXA 2Q3XA 3DDFA 5ICYB 2J88A 4US5A 1DYZA 3HZMA 1SVBA 5ID0B 3QAZC 3L5LA 1RSCA 2NLJB 4HCRL 1Y5WA 2VSDA 1YYML 3LV5A 3TZFA 3WLRA 1DQDH 1JWMA 1Q66A 3IMTA 2OSLA 4MOZA 5DX7A 1PCXA 1WIOA 3Q2CA 5CHNB 4G9FE 4XE5B 3W1TA 1UD5A 1U3HD 5F71A 3LQZB 3DFTA 4JEQA 5LZLA 3MZGB 4HB7A 1RH9A 3CU2A 5FCUH 1INEH 4M6NL 4L2LA 5IFJA 1MCNA 1X39A 3ZLHA 2IBZY 2D8KA 3UWVA 1FNGB 4P8VA 1CW2A 3AHYA 3FGCA 3CFKA 3UAJC 3FSAA 3SY1A 4R4ND 5FOBA 2MOGA 1ZQ5A 3QLLA 1NLBH 1YXCA 1JXKA 2AEQL 4PRPD 3EOBB 1BM7A 3QJFA 2FB2A 4UQIM 1QWKA 3G6JE 4F0MA 5HQEA 1AYOA 4D9RE 2JLPA 4YOKA 1F74A 4MSWB 2BNRE 3STGA 3TFKC 3DGGA 5DZ9A 3WMCA 4LHUG 2FO4A 3M1BA 1E8WA 4BQCA 1XBRA 3PRZA 1F3WA 1IEXA 3BO8A 1A6AB 4NO0B 2VCBA 3FJ4A 4YBQD 3CFEA 2BIIA 5GJNA 1K2DB 1UWXH 3B5GA 2WQPA 3EX3A 2H32H 2IPUG 2NW2A 5CZKA 4N8CH 2UZIH 3B04A 1A1MA 3ZDXB 1AHMA 1ZV5A 2OEMA 5D7JA 3V6OA 1JCTA 1XCTB 3CFCH 4GYKA 3FIGA 1G5AA 5C97A 2HZHA 2GDQA 3P82A 2AGKA 3MUAA 5BWFA 2DQHH 1AXIB 5TTRA 1FRGH 4XD5A 4OECA 4HNVA 4NGHL 3CL7A 3QT2A 1L8NA 2UZ9A 3O6CA 3KRSA 1UH3A 5EOCH 3U7WH 5LUMA 3Q8EA 3GMOB 4BV1A 3L3JA 4AZ8A 3NZHH 2O93L 1FE8H 2XLLA 4RWYL 3KPSA 3H3KA 2HK0A 4R3SA 4DFIA 1DBKH 3N3EA 1XF5B 4WUUD 5IUCA 4Y2NA 5J1TC 5LYRA 3BX7C 4GRMB 1YE6A 1FC1A 5F7AA 4GUPA 4KJPC 5C2GA 2XWJB 4OM0L 1JUKA 1Q63A 4Z7QF 2ITEA 4FQHB 4L3CA 5AYQA 5E2JA 2DF3A 3VJ6A 5CEZD 1PD6A 3CEUA 3M0LA 4PRDA 2DL2A 2D2GA 5KG9B 5I1IL 1OWRM 2EABA 2DEWX 3RHWF 3TA3A 3BUYB 2BVYA 3BLOA 2XN2A 4J3VA 1PDYA 4QEEA 1NGPL 2Y5SA 4WQOA 2JJVA 2O30A 1GC1H 2HRPH 2ADIA 1NGZB 1EHXA 4KFOA 1UPMB 4AU0A 1E9ZB 1NUFA 4GSQA 1XINA 2FO4B 2M1KA 1IAIH 2UY5A 3ZJ8A 1IM3A 3LKRB 1KO0A 1UASA 2CZNA 3ILDA 3PCYA 1ZJBA 4UTWA 2KLTA 4GVGA 1PYMA 5TBOA 3CDGB 3NAAL 4KZCA 4XO5A 1ZPUA 3QJFB 4QAMB 1KM4A 3P8JA 5KVFH 3MYJA 3MV8D 1MQRA 5KINA 4IMFA 3F4WA 1EHNA 1YEFL 1UT9A 2O4EA 5HJXA 2ZWNA 3EHBC 5T8GA 2WZEA 1I1YB 1QHPA 3BDXA 4C58B 4WFFD 3QHNA 1AO7D 3O0RH 3GZAA 5AVQB 3FGCB 3STEA 3R12A 3RBGA 3P9LA 2BXYA 4EPSA 1DIOA 2PTTA 3H23A 2VL4A 1ZHNB 4GO6B 4BQBA 2X3AA 1AR2A 2H5UA 3C5ZA 4YE4L 3WEMA 4FXGA 4X61A 2VR5A 3UPBA 1G4PA 4P9HH 5I8EB 4ZSOB 1JF1A 1DQIA 1RZ7H 4LV4A 2A0LC 1YEDB 1IM3B 1SLWA 1LO0L 2H0EA 3I85A 3ESMA 3LKRA 2NV2A 5HUOA 5I1EL 4IMKA 4IS6B 3K74B 2WXOA 2GDUA 1AGBA 5I16A 4DP9X 3ITOA 2CETA 3NPVA 2FGWH 4GW5A 1S7SA 3EFDL 3IDXH 2VNCA 3QDGB 4TVUA 1FCUA 2VC9A 2WM1A 3WUFA 4Z0BH 3S2AA 3LQAL 3M07A 1MNUH 2YJLA 3EO9L 5F9JB 1Z3RA 3BICA 1YEYA 4EZMA 4PRDB 1DLHB 1WF5A 4XZ4A 1W0WA 2VE6B 3GTVA 1WUZA 2VC5A 1M1SA 1KLGB 1U8QB 5EU6B 4HWEL 4LLWB 3FBQA 1QKZH 1E4KA 1PFCA 4Q4IA 2HFGL 2N56A 5HDBB 5M3WA 2ZC8A 4TV5A 5K69A 5TQ0H 2VAAB 4JPGA 4LNRB 3VYLA 3KPRA 1KBGH 3WEOA 1F05A 3BV4A 3AIQA 2Q8LA 3WBXA 1I45A 1NCIA 2VB5A 2XTLA 3J8F7 3UWZA 3B97A 3ZXWA 1P1XA 7XIMA 3GGWB 4HYVA 4WZ9A 5K33A 3E80A 1AMXA 5BVJA 5C2BH 4UNLA 5BPPA 4EQ2A 2XWTA 3GSVA 4N5UA 4UIOA 1AR1D 3GJEA 3VI3F 4DBWA 1LVEA 3AREC 4JMXA 3T6WA 3V6ZB 2Q8XA 3V35A 1Q0XL 2CK0H 5BMFL 1I1XA 2MH4A 2QCDA 2X7VA 2PA6A 2XIIA 2IMMA 3T3PB 1SN2A 3B4UA 3EF7A 4O5LH 1M7IB 3DV6A 2OYKA 1TVNA 4ENED 1W72H 2BGSA 3OXSB 2CERA 3GNRA 5DGRA 4YQXH 4QX4A 4LFYA 4DUOA 4Z7UA 2B1AL 4UMGA 5JORA 2NX1A 3UFYA 1SGJA 1N12A 3I6GB 1JUFA 2HT2C 3C5ZD 3OLEA 3SCMC 3SKOA 4C6NA 4GAYA 3CHCA 2GVEA 3CIXA 2VUOA 2CUAA 4JM4H 4K7PH 3PLYA 4K55A 1RZGB 4NQDA 2NY6D 4K5PA 5EZJA 4ANWA 4EIZC 3NDYA 2JKNA 3R2GA 1OAKH 4OFYA 3PXHA 2I5YL 5G1TA 5FD0A 2DV0A 1RLDA 5I1GL 4PMYA 4PUBH 4Q6YA 4OGAC 3C3NA 5JUEL 4QOKB 3L3HA 5A2AA 4H6EA 3W56A 1B6UA 2F53A 1WEJH 5DK3A 1RJYA 5IK3B 3VI3B 1KFLA 2OXHB 5TNVA 4NUPA 1A21A 1XZ0A 3OPZL 5HWNA 1FWGC 2J79A 2YAHA 1JZ2A 1PKQB 4ZBJA 4JTUA 2X87A 3ARED 1ZPTA 4PMQA 4P46C 4UAHA 1UGNA 1K6WA 2DT0A 4PJEA 5ALBL 3VNMA 1YNQA 2XU2A 3O6MH 4ZW6A 1OFBA 2X0HA 2DGAA 5IHWA 1VA9A 4I77H 1ZA6B 4IRJD 4QHPA 1FX6A 3DUHA 3H6JA 4JCMA 3DVFA 4MNQE 4NAQA 1GORA 4PRBB 1JHKL 4YXHL 4M62H 2EADA 4K3DH 4W4OC 3PU7A 4PGDB 1GT8A 3CV7A 4LNCA 3W24A 5ID0A 2AQSA 2DQHL 2HLAB 3TPUB 1HDMA 2A6DB 2ATMA 1TQCB 1R5WB 2WVTA 3ARFD 5I74C 3R8RA 2F9RA 3U7WL 1OLLA 4B96A 1R3JA 3NJLA 3N4EA 3E2HB 2PCFB 3D4YA 1C9SA 3B8SA 3UJSA 4XXDA 1K3IA 2VC7A 2VW4A 1L9OA 3AS2A 3CSYA 4MNKA 1JSYA 1P5UA 3M88A 4U1IB 5GNZA 1NAMB 3E3QC 4IIGA 2VXQA 3EGDA 3G2GA 2ZICA 1VFAA 1F6LL 1ZXKA 4Z5RA 5FLVA 1TB3A 3I02B 1CLKA 1EERB 2P3EA 3BT2L 1A2YB 1BZ7A 3EYOB 3WTYA 1AH1A 4S2CA 4C6LA 4P2QD 1URZA 1P5VB 1JMXA 1YN6B 4P99A 1DKWA 4HQQL 4JDEA 4X6DE 5AW6B 1WS7A 2PDUA 1XBXA 4HH9A 4PBGA 3DBSA 3O3BA 4WFED 3O6AA 1B4LA 3VXMA 1H4PA 3S1WA 1W3JA 2ROXA 4P2RA 2ZP0T 5DFVC 5JW5A 1VKFA 2AQWA 4K0OA 3DUSB 3EYVA 1LLWA 1SJDA 2V3FA 2ZOOA 2VDML 4Z8FL 4R7WA 2GJ6B 2WUBH 4DPRA 3VW3L 3VFRA 3W5NA 1XKYA 2VW6A 2QQLL 3ZMRA 4NQUA 3RURA 4F15B 2YPLE 3CUHA 3OJDB 3WYRA 2ZE3A 1BV8A 2EEXA 2JJSA 1V08A 3VSUA 1XBDA 2R4SH 2QCNA 3F7VB 1KGJA 4Q97A 3VGHA 4BZ1H 1O7SA 3GSUB 2MFNA 3UIZA 1TR9A 2JV6A 5EZIH 5KN5B 3S1VA 5CC7A 1J1OH 1A6PA 3TS8A 1BMZA 5C7ZA 4KW2A 1XRTA 1OANA 2R0KL 5D7JD 1JPEA 2VJ8A 3O3DB 1Q9OB 5KMYA 3MFGB 4OQTA 1MRFL 5IB5A 3BJ91 1NFKA 4KROD 3V6FA 2CLOA 5T5FA 2QJGA 2Y36H 2MQGA 3TBWB 5BO1L 5BS0E 5CZVH 2EP6A 4I3RL 3ZS4A 3TJHC 4RPPA 1BOGA 3JZUA 1MJ8L 4HBQA 3GJFK 5CO1A 2NDGA 4GG6F 1B30A 1ZSDB 1QI4A 3BVTA 2CJTA 4XMPH 4Z7VA 4P3WA 3S9DB 5ABZA 2IFFL 3QGAC 2X30A 3MHUA 2ZKYA 2IDCA 1IQWL 4F40A 7PAZA 3U57A 3MX0B 3BXNB 3WK1A 1JL8A 5REQB 1M9SA 2VENA 2YMXH 4LVFA 1Z7AA 4FOUA 4PRRA 1GZ1A 1TVHB 1P84J 4MXWL 1LLZA 4XXWA 1EBGA 4M29A 3Q2WA 1YECH 4HLEA 1A53A 4HZ8A 2Z31C 3RPBA 1DQWA 1IV8A 5KYYB 3U0TB 2H90A 4M6OH 4FC3E 5T1JA 4QJ5B 1PZ1A 3SKNB 5FB8A 3UU0A 1NM9A 4NUGL 3LCLA 5IMLB 4HXBL 2J78A 4WXYA 5AVUB 4J4PD 4ELME 4I6KA 1USQA 1I9IL 4UOJA 3B40A 3OBEA 1T5WB 4OLUH 2GSIA 1UCBL 1EP1A 2CK0L 5BMFH 2NSQA 3CLMA 3H7BA 1JXDA 1M03A 4JN1L 5C0AD 1J12A 2E76C 2UY7A 2YXWA 4ZJ9A 5CJQH 3BRGC 3W1MA 2XV2A 5EN3A 5MEQA 3P3BA 4O54A 2JEQA 3VGGA 2XGBA 3QRFM 1F02I 1YEGL 1MAML 2CJUH 2IPTH 2W65B 5CGYD 3QEGL 4PY7A 2ZX6A 4UT6A 3AZUA 3UTTB 2AEOA 2QZQA 1A6TA 4HF5L 5EPMA 3RAJL 2X4QB 1T1YB 1UC5A 2FLIA 2YCKX 3DX5A 3R94A 3NYDA 2PC4A 2YEZA 2ATKB 1AE6H 5B3JF 2VC6A 2HFGH 2QLVB 1HC1A 2NY2C 4K8RH 4DEPB 3IGAB 1KPVA 1W54A 4GEJA 4UFHA 5DHYB 1OPGH 1XB3A 3I9IA 4WEBH 5T3XH 1YTDA 3RX2A 3ABMB 2CHDA 3GNDA 5IT2H 1CF1A 5D05A 3LZFH 4AENA 3OZMA 4FALA 5F89A 2VMFA 3LRHA 5IHRA 1H3VA 1MIMH 1N3NA 5MEPB 2EDRA 4PJIB 4AVJA 2PC8A 2ZVRA 4RE3A 5H37G 2GSGA 1CDCA 1PIIA 5AVZB 3SJ3A 2ORBL 2YX0A 4GVIA 2DOCA 1TZIB 4YHYC 2R1LA 3CHPA 3KR3H 1RUQH 3PZQA 4LT9A 3IGXA 4LBUA 2W95A 1OSEA 2IPUK 3O41B 2OTWA 3JV5A 4GPVA 4IRJC 1OT2A 4IIQA 3GNNA 4DCQA 2DIEA 4MZ3A 2W0PA 5C9JB 5SWZA 2J8GA 2HA1A 1LDSA 4MFEA 2YFOA 1G9HA 2ZSWB 3CSPA 3QZNA 4GQ9H 5EOTA 3ZTJH 1XF0A 4NJHA 1KENL 1MCBA 5DSCB 4TUKL 1QASA 5FEPA 3N41F 4DZHA 3S4SB 2X4OA 3ARYA 3D39D 4M56A 3TM6A 1EFXA 2OP4H 1NOLA 4IRZL 4WUUE 3NQVA 1TU2A 5FHAL 2UYLB 2EVGA 1N59A 3AY4A 3RRAA 3HF3A 5IXEA 4WCJA 5C0CB 2Y6TE 3P77A 4GG8B 5EH1A 3UP8A 4IX0A 4AQLA 4TVPE 3EH4B 5INDB 5KJRL 3FMGH 5F72S 3RVUD 3G3DA 1JZIA 3HURA 1L6FA 3TC3A 3HJEA 4FZ8L 1J0ZA 1DQQA 3VD1A 1MJ7H 1ROCA 3JW7A 2OLAA 3QUMB 5D2TA 3KGSA 4QTHB 1KPRA 2A9BA 1H6FA 2BS8A 3KBEA 4LLQB 3VC5A 5K39B 3ARGD 1WRFA 2W91A 1GJUA 3IGAA 1QW7A 3EBIA 3VFCA 3U0WH 3KPMB 1RIVL 3CFJA 3N85L 3B3IA 5C0BA 4XWUA 1RU9H 1NLBL 3EGXB 1NLDL 4JGUA 1JQXA 1F97A 1SDYA 4Q6JA 1IGWA 3GU2A 2VDHA 2Q9OA 4HZAA 1J8HA 1GZQA 1NCTA 3HRZC 3IVSA 4XZHA 3SUSA 5CBIA 3I6RA 1E9OB 3HZKA 1W6WA 3KBFA 1IGFH 3CN1A 4ZXBD 3T0BA 2NY0C 2WVVB 3TKFA 3PANA 4P0DA 1NM4A 3O9WD 4O00A 1DFBL 1HO1A 4X7EC 3U30B 1V10A 2HPIA 3N9GL 5D6DA 2IAMA 1NCWL 1LP9B 3D25B 4F8LA 4OZGA 1VPOL 4AV0A 3AJXA 5FF6B 2QUTA 2ZC1A 3PL6C 5D03A 2HT2D 1PTDA 1REQB 3N2MA 1M7XA 1HP5A 4Z7UE 2OZ4L 3RVWC 1EF3A 2ZD0A 3GVQA 4A7VA 3LS5H 1JRBA 2WVSA 4C56A 3KR3L 1MRCH 3K71B 4L65A 4RW3A 4AVKA 3EJYD 5CEZE 4J9JA 4QQUA 4X2PA 1WBYB 5JW4R 1DQUA 3FJNA 4LRIA 4L4VA 5K9DA 2YW3A 5HHOA 5HK4A 3OPZH 4MAYC 1CLOH 3B06A 5DK2A 3ZZSA 1HZHH 3GLAA 4HJJH 3BKJL 4IMLA 2XC8A 4GG6E 3V0GA 3AG2B 3DX0A 1NUGA 1D8WA 2IPWA 3D3FA 4N3TA 4PMNA 1YEEL 3E0WA 4XP9H 1PLGL 2FB4L 3KXFE 3KRBA 4JFXB 3IJEA 3MVSA 4L8DA 2VM8A 3EEZA 2NQ9A 1AJ0A 1B0RB 4JO5A 1QNOA 5DS8A 3BP6A 5A8QA 2VM9A 4XB8A 2WXQA 2QGCA 4S39A 2DQJL 2IV9A 4MWAA 4JQ1A 2DBJA 1Q9KA 1W72B 4JY6B 4YLCA 4RZKA 1OSPL 5HHQA 5JZ7C 4KUCF 1H7RA 3GO2A 3LGDA 3LHWA 1RZJH 4HUVB 2Y1YA 4FLQA 1MJ7L 4NQVA 5DEGA 5H8MA 1Q9OA 3MREB 2QKFA 2CRZA 2OKOA 4FG0A 1G7MB 3NQGA 3O3RA 3O4LD 1DVFC 4DO4A 1UUSA 1ZLDA 5KN5A 4WFGD 4B91A 1GOQA 4XN7A 1PJ9A 1WFTA 1F58L 1MRDL 5AECA 2OJ1A 4LYQA 1RXOB 2ARWA 2Q7YA 5LCVH 3RX5A 4PB3A 1IAII 2B14A 4LSRH 3QYNA 4LRNL 3FH8A 3FO0L 1NOUA 3A23A 1RZMA 3T65A 1Y0LA 2ARJQ 5EC1A 4M5YH 4Q9QL 2EYSA 2NXGA 6ENLA 2XG9A 5CMAA 3S7GA 4KWSA 1CLZL 4N42A 1P7KA 3FOKA 4KI5E 3CUPB 5DY3A 3BL3A 1X9QA 4PRAB 1ET5A 5EWIL 4A39A 1EHLH 1S7VB 4IF2A 4NCDA 4ONVA 4YVXA 3F5WA 4OOZA 1NEZB 5B39A 3VXMB 1WVZA 3GSNA 4N2KA 1B0IA 2XKSA 4I9WE 2YBTA 3FEMA 4PCNA 3WFDH 4HH9B 4JAWA 3NA8A 4NQSB 3PREA 1S2CA 1N67A 4P2RE 3LMJL 7CGTA 5BW6A 2Y1AA 3IDNA 4AYID 5JHDA 1A7BA 1EGVA 2AW2A 3BRFA 5JPNA 1TNNA 3H2PA 4A8RA 3DV4B 3C2AH 1TFHA 3M0ZA 4GGBA 1YXYA 3QDME 2BCKA 1E65A 4QRSB 3STFA 2OSYA 2H6PA 3B37A 1G9NH 1RUPH 2XPYA 3S48A 1OF0A 1XH3B 3VXPB 1A7QL 3MHZA 5GJPA 3OGSA 2PE4A 1YN7A 3CH1A 4P2CG 1AFSA 2Y06H 3FSTA 3BWZA 4Z7UF 2I9LB 1R5WA 2V0AA 2XZZA 4G6KL 4GAAA 5EIQA 3SGKC 4RE4A 3HMJG 3EB3A 5EUOE 3AUJA 5G55A 2VXNA 4OZFH 1YEGH 3D05A 3BH4A 3ATEA 4U6VL 3T8MA 3ETBJ 4BH8B 1X5LA 2YD8A 2X1QA 1C12B 3KBPA 3CSFA 4UTBL 4MNGA 1J48A 1NC2A 1VCBC 3V0VA 1MCCA 4I5RA 4K8HA 5FUCE 1INEL 2FJKA 2XOTA 3JWDH 2NX5D 3DBXB 2HT3C 2DRUA 1QO3B 3ES6A 2P49B 3GJFH 3KM1A 3MRQA 3O9WA 3IRPX 1V05A 1A7OH 1J8RA 4PM1A 5EU7E 3RWHA 3GYEA 3PJUA 1KBWA 1E42A 2NNRA 3GDTA 5LA0A 1LWJA 2ZOLB 3GSXA 1P4CA 3KJ6H 1KNWA 1RV6X 3PAOA 4FNSA 1M7DB 4CSTA 5CGBA 3IJ7A 4Y1AE 4AQ1C 2WY3B 5IFHH 1RALA 1GRWA 2G4JA 2GWGA 1TT6A 5E95B 2RAMA 1DVFA 2AXJA 2X10A 3T08A 3ZXAC 5ALCL 4JPIB 1ZT4A 4HISA 3EBHA 2JIEA 4FXSA 1XBYA 1DUZA 2QAPA 2XIJA 5D2YA 1K03A 1EJWC 1DR9A 4EVNA 3IJ8A 5FL1A 4YN3A 1PIFA 5HI4D 1A3RL 1R9ZA 3E6FA 1NIFA 4J3OG 1NFIB 4FQLH 5D9SB 3N2BA 3RWCB 5IF0B 4XNUL 1XWVA 1I9EA 3D7PA 4Y2DA 3TBCA 2VVNA 4FFZL 1D7BA 1XIJA 4NZ3A 2D24A 3RL1B 2BP0A 4QO1B 1V5JA 2X88A 4F66A 3BW9B 1HCFX 1Z8AA 2B2XL 4WJEA 2ALWA 3O63A 3ZFHA 3U36A 4Q8PA 1P7TA 4N3UA 2R0WL 4A1RA 4JIQA 1OTUD 1AQDB 1D6VL 1TTRA 1JHKH 4MDJB 4XZUB 3OHMB 3OKNA 5J5EA 3PJLA 1ED3B 2GIYA 3ONBA 3DRTA 1FVEB 2PMZA 1L0PA 4KRMB 1CYGA 3PWVA 2VDKL 4GQRA 4Z78B 1OP5K 4N0UA 1Q7MA 4OT1L 5SWZD 1F58H 3BAKA 3TFKD 3LRLA 2WLIA 3GSOA 1L9MA 3IDIA 5IEKA 4HKZB 1IIHA 1NDZA 2CKSA 4OTKA 1Z9AA 4F8TA 3BKML 1R3KB 4LSRL 4FTVE 1NCGA 1G7LB 2CBJA 5LN4A 4EN3D 3ICJA 2WBJC 2YPLD 1OX4B 3B8VA 3ZJ7A 3ALXA 3IRCA 4RDQF 1NLDH 3W1UA 2ZG1A 4E41A 4MFDA 4HK3N 1PX3A 3FT2A 4F2MB 4UI2A 4ZW5A 43CAA 1OD0A 3F5JA 4G6AD 3UPCA 4NJAH 5T33L 3ALGA 3FB7A 2Z2UA 4UZGA 3M5YA 5IP4A 2CLRA 2DY3A 3P3UA 4ZPVA 3QMRA 1CT8A 1NIAA 1WDRA 3BAEH 2QADD 4ODTL 3N17A 3K46A 4GSXA 1XICA 3IK4A 2HX9A 2EIJB 3QPKA 4LBAA 4ES8A 3K1DA 5D5MB 3TH3T 3DXIA 3QQ1A 3GU1A 4U2YA 1NOWA 2I9UA 4JJ5B 43CAB 1W9BM 3A4DA 1LBMA 1ZHLB 1MFAH 2OU4A 5E0CA 2JXMA 1UCWA 3SQOL 3RIKA 4XMTA 2A73B 3MMEB 1I7UA 4IRZH 2XVNA 4WQ6A 3SCSA 3OHXA 4N0UE 4PWIA 3L81A 3SDDA 3GSQA 3HUJB 5A6IA 5KAQF 4Q8QA 3W2JA 4H7ZA 2HYMA 1R3IH 3L54A 2BIQA 3KPSE 2IDSA 2ZUYA 1GKEA 1DANT 1TSHA 2BPBA 3CFNA 5CP3A 5EN2B 1RUPL 3IDIB 2HV5A 4JBRA 2W6RA 5EOQL 2R9HD 4YHEA 4QRRD 4NL1A 5I1LA 3ISIX 3UJEA 5E2TH 3L9BA 3FQWB 4MAUH 2DT2A 4KVPA 5DT1H 1IAOB 5DXWA 2OYMA 2AQQA 3D3VE 1HL4A 2YPKB 4GLRH 4U1NB 5CLXA 5TDOA 2PTDA 2F7PA 4ZFZB 3W7GA 1FO0H 3LH8A 4TVPD 3NXLA 1RXLA 3QDJB 5EORH 3VWKD 5BQ7A 3N40P 1F6AB 2CLHA 3P0YH 4KDVA 3C09B 3CYVA 4JHMA 3BUQA 1ZLSH 1KN2L 3WY4A 5I1CH 3FY1A 4MYXA 1O5PA 4BCZA 1JCKA 3RL1A 2EDWA 3U0PA 3MNVB 3P54A 1AD1A 1DJNA 4F0KA 4AL8H 2EXYD 1J0YA 3EIFA 5E5MA 2O9OA 3SIMA 5AOKA 1NFIA 3HC3H 5MHSD 4PJGF 4PRNB 3DVNB 4JHBA 1ZDQA 1B2WL 4LO9A 4OV5A 5ESVB 2FJFA 1ID5I 3IMSA 3T0DA 1XLGA 4XZWA 4KROC 4DP4X 2SEBB 4MMXC 4WFHD 4HMDA 4JPIA 5FAAA 1E0VA 4JTCA 3DVGB 4P7NA 1EZUA 2C1OA 1VACB 2O0TA 2WHVA 4KRTA 4C91A 5B1JA 1GVRA 3WQEA 3CPGA 4G9PA 5C9WA 2P53A 2OV0A 4HCDA 2JKLA 3TWAA 1JWUB 3CQJA 3VFPB 1MH5B 5D70L 5TFSH 5F8QC 1XXFC 1FL3B 4BWTA 3RXZA 5E2UL 4MF4A 1P4BH 5ACLA 5J5RA 1JZDC 1PEZA 5CGMA 3FRUA 2D9CA 4JVUA 5AHEA 1BFTA 2BVEA 4PJ8A 4WEUD 1EC9A 3S88L 2INZA 4XZBA 4CNNA 3DYPA 2BP8B 5ES4B 2DMHA 4Y2WA 1W91A 1HYSC 1T0MA 4XP4H 2EH8H 3VXQB 4XPFH 2X4SA 3FA5A 5FYJU 4NBZB 1HH9A 2ZUSA 3GR4A 4PJ8D 3UACA 1KTNA 4X5XA 5E2VL 4UZSA 3TWCL 1CT8B 2OG9A 3F7YB 1N6VA 5DURB 3FB7B 2I17A 4DUWA 5KW9H 3CHEA 5GGSB 5LAXA 4O1DA 4M3JA 2ANUA 4LU5L 1GOOA 3WO4B 2DZUA 1INQB 5F88B 5ENWB 4DUXA 1C29A 1BF2A 1D5IH 1YVLA 4NRZB 3UYRL 3BZDA 1HILB 5TDNA 1J5IA 1OX4A 3QYQA 2WZPD 5ACMA 3KRZA 3WJSA 4BEUA 3GT6A 2Y70A 1WHOA 3Q0HA 5KYWB 2J1KA 4IU3A 2G41A 4OLVL 1RFDH 1FNGA 1SY6A 1SHSA 2QHRH 5IMOA 2BNJA 2VEFA 5A69A 2R23B 4RAUA 4Z78A 3NP3A 3Q48A 1A3LL 2GHWB 2ZA2A 4AC1X 4BZ1A 5SX4I 2OMZA 3QPZA 3ROLA 3RU8X 1MIML 2X1XR 5IROC 4C6JA 1ROWA 1JGEB 4H88L 4TUJA 1MEXL 2C9PA 5HP5A 4HSAC 3NDYE 1R0AH 5BOFA 4QRPA 2I9TA 4LEEA 4AGQA 1FL6B 4Y89A 5DJDB 3U36B 3V55A 1R30A 4B9FA 2JJSC 3GHPA 1EXUA 3NURA 2Q10A 3T4CA 3UVAA 2HS8A 5A2LH 1EQWA 3WUWA 1KQZA 4R7OA 3RZCD 3OKOB 4FMKA 5F7LB 2HLEB 1KIQA 1R3VA 3A4XA 1P4LB 4AD5A 2Y5QA 1TJ2A 2H26A 5C0AB 2EYSB 2JKJA 2KZHA 2OTDA 2OSWA 3OBKA 3PR2A 2Z8VC 1JN6B 3EJPA 2ZNWA 2CXGA 4Z0XA 2OEKA 3IPBA 3VMOA 3B9EA 1Q45A 1Q6CA 4W9LC 4CNTA 1Q38A 2FTYA 4QKTA 3ULSB 3WDIA 2OEJA 1NCDH 4KV5F 3U4KA 4NNXA 3VXUB 2CRYA 3WLWC 3GLCA 1GOIA 5IBXA 3HHSA 3MNDA 3KBMA 1BFVL 1QX1A 4X0VA 4DY1A 2GK1A 4RRPG 4NFBA 3O9NA 1E3ZA 2DQTL 4BQ2A 1S9VB 3CFDA 5D2NE 1U6AL 3AIVA 4F58L 4NJJA 4DNHA 3VFWB 2XZAH 3LSBA 4XP1L 4UNVA 1NC4B 1TVBA 4LLUA 4TULL 5DCBA 4XCEA 2CMRH 4PTMA 2YRPA 3N13A 1WBZB 2Y5EA 4LSPH 4M7KL 2CHOA 5K93A 3G22A 4IDLA 3BN9C 4QG9A 2FTPA 4NNBA 4X8JB 1S2EA 4MNGB 3T3MF 4LCYA 3MSYA 1K7EA 2VH5H 1OP3K 3W2LA 1JTPA 4Y9EA 3MRKA 2HMIC 1V7NL 3T3PF 1SVDA 2BOEX 1XLDA 5LNSA 5DC4B 4IYKA 3MC0A 1NMAL 4XN8A 4G9FA 2HTLC 3ZHNA 2PDFA 5G4HC 4YS1A 2APFA 3W22A 3WYZA 5FA4B 1JCJA 1J10A 4V1DA 4ZUWA 3CH1B 4UWQB 2OODA 2VDPL 1AUSL 4HHMA 2DIBA 1TMQA 5C09D 1QR1B 3VXPA 1TG7A 1GQKA 2R1YB 2Z1WA 2R6OA 1DXIA 3BCFA 5IBLD 4GZEA 2W0KA 4KAQH 4UV4H 4R6UA 5DXYA 4QTIH 1FV1A 3GEWB 3IS4A 4FX6M 5L4IA 2AEIT 1NCUA 3H6AA 4YNYB 5JPNB 1O5XA 1W31A 2CC0A 3AYSA 3UXAA 1KTLB 3QO1A 1I4FB 5KBNC 4HGWB 4PBVC 2V5MA 1VFHA 1RZFH 3O2WL 3IXTA 4F2ME 1R5VA 4CD4A 1KIUA 2A9NL 4AX7A 3O2DA 2DM4A 4DFHA 5I15L 2HT4C 1JTTA 2WLMA 2Q76A 3HZKB 5HYJE 5KZCD 3DXAB 4Q2ZB 1MHEA 1H9DA 4JXCA 4HS8L 1LD9B 3P4MA 4ZDHB 4Y4FA 2XNAB 1JQVA 2AAMA 2GIXA 1E72M 4N2MA 3B34A 3T65B 1XGPB 5GJMA 4JFWA 3F00A 5EL1A 5GGQL 1IC1A 3SE4C 5BCAA 3MSGA 2RKXA 1EX1A 3PZIA 2K0RA 4DF0A 1A1NA 4H9YA 5IB3A 3CFQA 4R33A 1NPUA 3NIFE 1RY0A 4QRPE 1EJXC 3TIMA 2A6NA 3THDA 4JW3A 2J9XA 2WMGA 3VH8A 1C8VA 2A6KA 2H3NB 2P5PA 3RWDB 4RDZA 4HK0A 3LEPA 5I30H 4JVWA 3SUUA 1FCGA 2P1YA 3HI6L 1SMDA 2VDLB 4OCYL 4HN8A 2A0NA 4I18A 2PO6C 4Z1PA 3ZJ6A 3GBMH 4P9MH 2MSPA 3W07A 2IQAA 3CCHB 4IXXA 1TJ1A 3BURA 1PZSA 1Z89A 1EFXB 1W72A 1NANI 1SF3A 3ESOA 3PP3K 4N85A 2X4OB 5CUSH 3RM4A 4FYTA 4I1RA 4QG6A 3DIDA 3X1FA 2XH2A 4Y0GA 1AQHA 3MYPA 2Y25A 4Z1CA 3RUGE 5T3ZD 3KW8A 3ROOA 1AGEB 3HNTH 2NCEA 3OR7A 5FX3A 3BO9A 1E8YA 3BP4B 1JHLH 2M26A 2YMXL 1QFWH 1Y6NR 3B2MA 5FS5A 3SY6A 4EIUA 3Q4DA 3D69B 4QDMA 2ICEA 3CQFA 3TURA 4Y4KB 1S2WA 4ECLA 3V0TA 4IIQC 9RUBA 5D2NA 4LCWE 3KL0A 3LPGA 4KOCA 4QF1A 1TSRA 1WXYA 3MJ9L 2P7TA 2CO7B 3QQNA 4ZX3A 2JALA 1OGTB 3QIWD 5I77A 2IALA 1LT8A 1RFDL 2QHRL 3G5ZB 4G71B 1D5MA 4IMKC 3MZ2A 1A22B 2QVTA 3HMXH 2DWYA 3NEHA 4CQDA 1JCVA 1MFDH 1A7PL 2WV3A 3SRHA 2FX8L 1JUEA 1IQDB 3R0NA 1FE8L 3DTXB 2F1EA 4JGJA 5EZOL 1G6RL 4V2CB 5DC2A 4Q9CA 3QNXB 2I25N 1DIEA 3O0KA 1N7ML 1PY9A 2EKJA 3P8IA 1UGKA 3UAFA 4NI8A 2FT6A 1T0NB 1CZ8H 2OL3B 3NSXA 4Y4KC 2FD6L 2WBGA 5GZOA 1CC3A 4WENB 1T1YA 2Y8VA 1FL5A 1V7MH 2XWBA 4WTWA 1F90H 5E99H 5FGSA 2FX9L 4RZCB 4IKIA 2GJ6E 2YHGA 1UR3M 3QORB 3BVJA 5D2WA 5HNRA 2ZXBA 2WVVA 3GKWH 1B4TA 2AEWA 5HI5D 3CDYA 1U5VA 1VIZA 1USZA 1X7QA 2BDNH 3H4HA 4PMXA 5E6IA 3VA8A 5BXSA 3WD1A 2AITA 4UT9A 3S5LA 4QISA 1OCWH 2PDYA 1J8HB 1GZQB 3QIBC 4KX9A 4ZPTA 4ANXA 2XG4A 4L1HA 3U30C 4JGNA 2EIDA 1FH8A 4L0ZA 1U8MB 3CC5B 1JNDA 2HVKB 1CDYA 1ZT1A 1ZT7A 1OAQH 3HZVB 3PGCA 3PFQA 3HS0B 5IKCA 1MKFA 4MD0B 4YDKL 4LLQA 2DU2A 4Q4MA 4LU0A 4O0ZA 5KVGL 1E4NA 3ET9F 1JV2A 3TGXA 1RZJC 4AQ8C 5B8CA 1TDQA 4HJTA 3BUDA 2C3VB 3FO1B 3D18B 3O8AA 4I7VA 3UZWA 3FFCB