5BRQA

Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea)
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
555
structure length
555
Chain Sequence
NPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDNGYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKEAASGKENLYRDFYIWKDMKPNGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYEMMHFWFEKGIDGFRLDVINVISKDQRFPDDDEGDGRRFYTDGPRVHEFLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNFHHLKADYPNGEKWALADFDFLKLKKILSEWQTEMNKGGGWNALFWCNHDQPRIVSRYGDDGKYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRILKEAGKPEAEIIEILKAKSRDNSRTPVQWNGEENAGFTAGTPWIPVPDNYKEINAEEALNDPDSIFYHYKKLNELRKEFDIITTGDYQLILEDDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIEGYDAKVLISNDTDLPESFKRFTVKPYQSIVYHLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Bacillus licheniformis trehalose-6-phosphate hydrolase structures suggest keys to substrate specificity
pubmed doi rcsb
source organism Bacillus licheniformis atcc 14580 = dsm 13
molecule tags Hydrolase
molecule keywords Glycoside Hydrolase Family 13
total genus 209
structure length 555
sequence length 555
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.93: Alpha,alpha-phosphotrehalase.
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5brqA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5brqA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 5brqA02
1QWNA 1ZJBA 3AZSA 1S46A 5D9PA 4M81A 2JIEA 1RP9A 3WH8A 4UQCA 2PF0A 1V6XA 4URIA 4W86A 1UYQA 2GJPA 3ALGA 5FCZA 3I3DA 3BSHA 4IUGA 2XN2A 4MNJA 5HBFA 2JIWA 3LPPA 3WEZA 3EDDA 5BYWA 4YN5A 3OZOA 2OSXA 1XC6A 4PN2A 4M29A 2OLHA 4DUWA 3WDHA 1WAWA 4NZCA 5EBAA 4FNSA 3WBAA 2WKLA 1TQTA 4UFLA 3W25A 2WKGA 3VMOA 3WY2A 2ZUMA 2VZOA 3GDBA 1DWJM 1VFFA 5DEZA 3PZMA 2JF6A 2CESA 1ZB5A 2JF7A 4JHZA 1LWHA 1FP8A 4PMNA 1VF8A 2CIPA 1VFMA 2VVNA 2VTFA 3WKZA 1GQKA 4CU6A 5A94A 1Y7VA 1CGTA 4PEEA 4NRSA 4MJ2A 3CZGA 1O7DC 4MAZA 1FHDA 4TX8A 3WEMA 1NWSA 5F7UA 4JCMA 3ZT6A 2CBVA 5JBDA 3FHQA 3WF4A 1KTBA 2BHZA 2O9PA 1JD9A 2X2HA 4WKFA 1E70M 2BVDA 3UETA 1CXEA 1TMQA 4JZ5A 4M8UA 1VFOA 1QI0A 3PTQA 2WLYA 1JZ4A 3BGAA 3MV11 2QHAA 1V02A 3O2LA 1E72M 3G6LA 1V6YA 4PMDA 3WQWA 1JF5A 1OB0A 2F8QA 3VX1A 2YL6A 3PZUA 1KXVA 2DH3A 1GOQA 4EAMA 1SFSA 5FL0A 1V0NA 2IXUA 1IV8A 1UHVA 1ZBVA 2XTKA 1D3CA 3D3AA 1J0YA 3QHNA 3AROA 5A6LA 1V03A 2ZE0A 3QOKA 1HWWA 4FLSA 4HZ7A 1U2YA 4V28A 2EABA 1C8XA 2OWWA 1CEOA 2CXGA 1G1YA 2XUCA 3NSXA 2BY2A 4IISA 3UR7A 3WY3A 2ZOXA 3DDGA 1V3IA 1V6VA 3OGVA 4MAVA 4PMUA 3SUVA 1GCYA 3UG5A 2ZXBA 5C71A 2VZUA 2DSKA 4WSKA 1WDPA 2FGLA 1TFVA 2J25A 1ZBKA 3ARPA 3KEHA 4P8UA 1W2PA 4AZGA 1SZNA 4CGTA 1TQUA 3DX4A 2WHLA 1W3KA 1E73M 4WJXA 3N12A 2DGAA 2WM0A 1CXIA 4BCEA 3AIUA 3TTOA 1JIBA 1QVBA 2D22A 3N04A 2G3MA 4GIAA 2YL9A 3PZQA 4CN4A 3GXDA 1QHZA 4HOXA 1GOMA 3WD1A 2F7OA 1H09A 2EBNA 3FY1A 3AXIA 4UQ9A 1UKTA 1ZL1A 1LLOA 1ITCA 4LGXA 1JDCA 2EPLX 5A6KA 1AMYA 3II1A 3LX9A 3UCQA 3ARSA 4B15A 5A6BA 3VILA 3CZJA 5CPQA 3HG3A 3OLDA 4W89A 3F5KA 3W53A 1M03A 4AZCB 2D0HA 1VBUA 1VEOA 1XCXA 1DWAM 5BXTA 4XX6A 3CPUA 3B9AA 3DX2A 5M03A 1TUXA 4TOQA 4Z2HA 4AY1A 4GO9A 2NT1A 4RE3A 3HJEA 1ZU8A 4AD3A 4C7GA 4CD4A 3WBEA 3SUSA 3AIQA 1SMDA 2XYLA 3W27A 5HPCA 1LJYA 4J27A 4JL2A 3ECQA 3CUIA 1JI2A 1HJUA 2DT2A 3VGDA 3WNMA 3VD5A 4MADA 2VC9A 3S5ZA 3DYMA 4R5EA 5D8WA 2WCSA 1NP0A 1NH6A 1XSIA 4U2ZA 1QNQA 3WY4A 3ARUA 3VGFA 3UEQA 3MUY1 4D6CA 3AJ7A 2E9LA 2BVYA 1LL7A 4EE9A 4B9ZA 3D4YA 1SMAA 5I3DA 3LRLA 2D0FA 5D9MA 5CQ1A 3U5YA 1VEMA 1W9UA 2VURA 3WDRA 3U7BA 4D6DA 2ZXAA 1UD8A 4D1JA 1H2JA 1QNRA 3WIJA 3DX1A 1JXJA 5IDIA 2O9OA 5BROA 3BH4A 2J7HA 1E43A 4PSRA 1ZJAA 3VDCA 3MUIA 4EKJA 1QBBA 2WVSA 3OGSA 4R27A 3WQVA 5A6AA 2WSPA 4P7NA 1VJZA 4GINA 2Y2WA 3AOFA 1JAEA 3IJ8A 4UFMA 1BLIA 2DT3A 2O92A 4JIEA 3ZSTA 1EGZA 3QR3A 4ATLA 1C92A 1WPCA 1QBAA 2WWDA 5DT5A 1EDTA 3JUGA 4B9YA 4HA3A 3VDAA 5D4YA 3RM4A 4AC1X 5BCAA 1N82A 4PRWA 2DPEA 3WH5A 4UOJA 3AHVA 1TE1A 1UR0A 4AW7A 1OIMA 2VCCA 1M04A 2W62A 2O9TA 3QHOA 4IPNB 1JDDA 1AVAA 1NWRA 1M7XA 3BAWA 4U2YA 4P8VA 4J3WA 2VRQA 4S3KA 4JFWA 2WMKA 2C0HA 3VIPA 2UY3A 5IHSA 1UZ4A 4L4OA 2D24A 1P6WA 4FNUA 3DYPA 1FH7A 1XYZA 3TTYA 3IGUA 4GZJA 5CLWA 4ACZA 2WC7A 5DT7A 4UQAA 1VIWA 4W7UA 3BUBA 3WFLA 1PX8A 3SURA 1OCQA 1X1NA 4TVUA 3N13A 3PZIA 1FOBA 5AC5A 1UR8A 3WD0A 2EADA 5FKYA 1AQMA 3T0DA 4W87A 3U5UA 1GNXA 3EJSA 3SCNA 1EIBA 3FHAA 4GQRA 4AD4A 4BS0A 4ZXOA 1JXKA 2YDQA 1F4HA 4J3UA 1E56A 3A47A 1W3HA 2OSYA 4P7LA 1CPUA 1W9XA 4PMZA 5A8MA 2X2IA 4JKLA 1PJ9A 4UQBA 2W5FA 2VT0A 4OIFA 2YA1A 4H2CA 3AHZA 2ZWZA 4PCTA 1QNPA 4TTUA 2J7DA 2QPSA 5AYIA 3T2PA 3EBVA 2CHOA 3K8KA 3VGEA 4NXKA 4FNTA 3OGRA 4KH2A 1ECEA 4DO5A 3N1AA 5C8BB 1HKIA 1UH4A 1QI2A 3K46A 4AMXA 2WXDM 4W7VA 2D1ZA 2E9MA 2DIEA 2F1BA 1JFHA 4W8LA 4PTMA 1E15A 1W9PA 1C8YA 4Q22A 1JZ3A 3SCTA 3RMEA 1H3GA 1Q6GA 2D3NA 1L8NA 3BSGA 3EMZA 1DWFM 1W3LA 1PEZA 2PBGA 1B0IA 3W4RA 1CGVA 4OKDA 3UG3A 1TR1A 3PZNA 4HMEA 3MMUA 2FH6A 1A3HA 2EAEA 2VX5A 1EHAA 3KZSA 4D6GA 4FF5A 1HVXA 1C7TA 3WQ5A 2CYGA 3VOCA 2A3AA 1OWQA 2PC8A 1KWKA 1JAKA 5M17A 3VD9A 4GI9A 1TA3B 1BG9A 1NARA 2JEPA 1MVYA 4U5KA 1UWTA 4RL3A 5I2UA 3BMWA 5LYRA 2J4GA 5I0DA 2EO7A 4B3LA 1OM0A 1HX0A 2QV4A 2WK2A 1B3WA 7A3HA 2DDXA 4Z2KA 3W24A 3WD2A 3VSUA 2CETA 2CKRA 2Y8KA 5JIWA 4F79A 1E5NA 3T2QA 3LRMA 3D4ZA 3A5VA 4OZOA 5I24A 2D3LA 1OIFA 2RGLA 4HPHA 1KGUA 3VIHA 1CGXA 2ALWA 2WBGA 1R34A 5KEZA 5CZKA 3AS1A 5BXPA 3BLPX 1G01A 4E8DA 3VIOA 1W1TA 2NSXA 1CGYA 1CXHA 3OLEA 1WZLA 1KR0A 1XHGA 3WF3A 1GW1A 2J75A 1US3A 4H8HA 5HNNA 1OGGA 2ZUVA 1MQPA 3CUHA 3W28A 2WZEA 1XH2A 1CXFA 1TQVA 4HZ6A 2GUYA 2YL8A 3NUKA 5CSYA 4W84A 1F4AA 2WHJA 4W8BA 3T09A 3MSDA 3ZJ7A 1KBKA 1ZS2A 3E1F1 3PN8A 2VCBA 4DWSC 3THDA 1UA3A 4PMQA 1JYNA 3EDJA 4TUFA 5A8QA 1R86A 8CGTA 4HMDA 3AFBA 1W2VA 3L4WA 4ZEPA 1UD5A 1JL8A 3LRKA 3WQ6A 3IK2A 2PWHA 2WMIB 2WMHA 5GNZA 1ZBWA 4AYGA 5A6MA 5LA1A 2VOTA 4UNIA 2G3IA 3W82A 4CN6A 2W66A 1R33A 2V3GA 5I6SA 5AYBA 1XD0A 3TV8A 2VNCA 3HN3A 1H0GA 1ISVA 2EXOA 3OG2A 4K68A 3MUZ1 1ISXA 1B90A 4JAWA 3VDHA 1R7OA 1IT0A 3WUFA 1E0VA 3SCSA 4KMQA 1J10A 3CHFA 3QOMA 2OYLA 4CD7A 2WVVB 3KWXA 2J8FA 1ESWA 3PZVA 1UKQA 2ZXDA 4J28A 3L4TA 4CD6A 1L0PA 2XSBA 2NW0A 2EQDA 3VNYA 3U7VA 4AIUA 2X2JA 4KWUA 4B3KA 1OD0A 4H7VA 4DO4A 2XM1A 1E6ZA 3WEOA 4LYQA 3ZIZA 5JBEA 4QCEA 4JCLA 3WMSA 2Q8XA 2D73A 5E6YA 3LPGA 3BAKA 3IJ9A 2ZIDA 2XFFA 3LXAA 1EOMA 4ATDA 3CUJA 1BFNA 1UWIA 4H04A 1V3HA 4AXNA 1WZAA 1HKKA 1HTYA 1GHSA 5ABFB 5I77A 1V02E 1NWUA 1E3ZA 2XN1A 3EJQA 4CCDA 2XFYA 2WC3A 1GZJA 3A3HA 3OB8A 1O7AA 1EO7A 1MFVA 1WZKA 1DWHM 5CPSA 1SR0A 1TCMA 3OBAA 2QF8A 3QHMA 1XV8A 4W93A 4V27A 2EPKX 1M53A 4E8CA 1PZ3A 2VI0A 1HT6A 1TZ7A 3KE0A 4ML4A 2EPNA 1VJSA 4GZEA 3VDBA 1CWYA 4QDMA 4FLOA 2V5CA 5AC4A 2BFGA 1J0KA 1KR1A 2VQTA 4MTVA 3GXPA 3VINA 3A4WA 1J0HA 1FH9A 4JKKA 4JFUA 3AZTA 4W7WA 4IPLA 4FNRA 2W91A 4HA1A 3AIEA 1NOFA 2D20A 1EQCA 3LMYA 2ZUUA 3WF1A 3WMBA 1Q6DA 1LL6A 4MPKA 5C70A 2GJRA 2BVTA 1PS3A 1Q6CA 2AAAA 2VRKA 1J0ZA 1E1FA 4TVCA 4GI6A 3ARRA 3W29A 2TAAA 1M01A 2WVVA 3GTNA 4X0NA 4M56A 3UERA 4PTVA 3WSUA 4FMVA 5IFPA 5ABHA 1V6WA 3PZ9A 2AMGA 1OGSA 3MUAA 2F1AA 3ZSSA 1J18A 3G6MA 4CU8A 2V5DA 3OIHA 4U5IA 1R46A 1Q6FA 3L2MA 1RD6A 3CH9A 3D5HA 1TQSA 3WL0A 3AIWA 3DX0A 5CGTA 3WD4A 3FXYA 2YBUA 4DWSD 3BC9A 3APGA 3MI6A 2ZX6A 2V38A 1JFXA 4XV0A 3NSMA 2D0GA 2GDVA 1W1YA 5A3HA 3NDYA 5A2BA 3WF2A 5CXPA 2WPGA 1HNYA 4GZIA 3BLBA 2W4XA 4AD1A 3GH5A 4C7FA 2FE0A 1XYFA 2Y24A 4OJYA 5I79A 4LQ1A 3T0BA 2D2OA 3CZNA 2CKSA 2OW6A 1J0IA 2CEQA 2ZX5A 4LYPA 1BYAA 1UKPA 5CGMA 3AZRA 2G8ZA 3BAYA 1OT2A 2VCAA 2FHCA 3CZLA 5CLTA 1HJSA 1I1WA 1WB0A 1VB9A 1J11A 3VMPA 1QI4A 1E6PA 1C8QA 3MMWA 2YIHA 5I5RA 1UA7A 3CBWA 4W8AA 5CG0A 1Q4NX 2FHFA 2VQUA 2Y8VA 5E6ZA 1HF6A 1B30A 3LPOA 4PMXA 4XZWA 1QNSA 4L4PA 1CECA 4HP5A 4UFHA 1PX4A 1FFQA 1E9LA 3AXHA 3K1DA 3WNLA 5A69A 3U57A 2WBKA 4OGZA 1HL9A 4JL1A 4P8WA 4AD5A 1V3MA 3WNKA 2W67A 1UZ1A 1BPLB 3CZEA 2Z1SA 3BUPA 3MV01 1NQ6A 1WDQA 2CCRA 5I23A 2VZSA 5A6JA 1CDGA 3PHAA 3MKKA 3S5YA 4P7RA 4HA4A 6A3HA 2BY1A 1GPFA 2YFNA 1X6LA 1UD3A 4HU0A 4UOZA 4J3VA 4CD5A 1JZ2A 1K9EA 1UKSA 3T0AA 8A3HA 2G4FA 4TXEA 2WZIA 5ABEA 2EPMX 3WELA 5AY7A 1DEDA 5DO8A 1GVIA 1ISYA 2WMFA 7CGTA 1UR4A 1AQHA 1H11A 4QFUA 3SCPA 3B9EA 3GXFA 1EO5A 1SYTA 3L4VA 3VSTA 2WZHA 1V08A 1C3FA 1WCGA 4KRUA 1W3JA 5D9NA 3SCOA 3B9DA 3VD3A 1CBGA 1E40A 4BZYA 5JIPA 2J47A 1GQIA 5DMYA 3TOPA 2WMJA 3RDKA 1QW8A 4E4PA 3VMNA 2YKKA 2QPUA 1B3VA 1UOKA 1D7FA 4JKMA 4PYSA 2J7FA 3AI0A 1EXPA 2A3BA 3CHEA 5BRQA 1LF1A 2VR5A 1TQWA 3BXWA 3O9NA 2VX7A 4WKHA 1CIUA 1HXKA 3VIJA 3FAWA 3N15A 4KRTA 3L4XA 3ZM8A 4F9DA 4PSPA 2YLAA 3VIKA 4CU7A 2E40A 1ODUA 4BQ4A 2WANA 1MQRA 3WNNA 1MW1A 4AYSA 2BXZA 1R47A 3GXNA 4EANA 4PMRA 2WC4A 3AISA 1ISZA 4LX4A 3NDZA 5FL1A 4UR9A 2ESCA 3BCFA 6TAAA 2ZWYA 3W6LA 1KGWA 3VM5A 1MW2A 4GPNA 1DWIM 1G94A 1PIFA 1JNDA 3VD4A 2G3NA 2DT0A 2PWGA 2VL4A 2BHYA 4NSBA 4X0VA 3OZPA 4Z2JA 1XH1A 3ZR5A 2G3JA 2ZUWA 4H8UA 3VGBA 3S6TA 1H41A 1UWSA 3M7SA 3GM8A 3WUEA 3WMCA 3A23A 4CKQA 2XGIA 1UH3A 1UR1A 1YQ2A 2UY2A 3ARQA 1R8LA 1GQLA 2UY5A 3WDIA 1NOWA 4CCEA 1DP0A 1JDAA 3VVGA 3THCA 2J74A 3WENA 2E0PA 1GJUA 2YA0A 2PI6A 4OBRA 2CERA 3EYPA 4FNPA 1UQZA 4QLJA 1JZ6A 4QLLA 4GXPA 2F61A 3AMLA 1CENA 3FN9A 3T08A 4Z2LA 3UESA 3O6AA 3BAXA 4UTFA 3ZMRA 1KGXA 1JI1A 2J7CA 3ARYA 4DUXA 3DX3A 3WF0A 3AS0A 4NXSA 4DWSA 5E70A 2JE8A 3AMKA 2WAGA 3VM7A 3K8MA 1I75A 1MYRA 3N18A 1V3KA 5BRPA 3MS8A 1HP5A 2XVKA 3DHPA 2CBIA 4U3AA 3KLLA 4P7QA 1PPIA 1XGZA 2WVUA 4BA0A 2WVTA 4ZE4A 3GNRA 3EJUA 4ATWA 5EB8A 2X0HA 3IAPA 1R87A 4MNMA 3WUGA 1XD1A 4J7RA 1GQJA 3J7HA 1UD2A 3WH7A 1LG1A 2ZX8A 4UFIA 1W32A 3ZJKA 3A24A 1CLXA 3CHDA 2FGZA 3GXMA 4XUYA 2VR4A 4F9JA 2VUYA 2DT1A 2WW5A 3PZTA 3CC1A 1BAGA 3VGHA 1WO2A 3SCVA 1WDRA 3CTTA 4MNLA 2YJQA 3H55A 3BVUA 4PTWA 2QMJA 1GORA 2DSWA 3NYDA 1QWUA 1WKYA 2X1IA 3SIMA 3WL1A 4ACYA 3NIYA 5JBFA 1C93A 4DM1A 4ZE5A 1PIGA 3BVVA 2WCAA 5ABFA 3GNOA 1HJWA 4HOWA 2F2HA 4MB3A 4BQ2A 3L4UA 3VU2A 1GOWA 1R75A 3K4DA 5BXRA 3GNPA 3EDKA 4CVWA 4WF7A 1G5AA 1BGAA 1BYBA 1UWRA 2F7RA 1GOOA 4Y7EA 1IZKA 4WLCA 3TTQA 1EA9C 4AD0A 4CUCA 1WZMA 2OWXA 3M46A 2ZUTA 1V0MA 2CBUA 4PTXA 1VFUA 3ARWA 3WDPP 5GQBA 1XRVA 4UFJA 3BCDA 4NZJA 5M5DA 2IXVA 4YPJA 2E8ZA 3M6DA 1D2KA 3ARXA 3VIFA 3HG2A 3BAIA 3AMDA 1R85A 3GXTA 4NX0A 3FW6A 5CSUA 5FOOA 3CLWA 1CXKA 1CZ1A 4F66A 5CJ5A 2DQXA 4HOZA 1KFWA 2G41A 3HG4A 3UR8A 3KL0A 1V6UA 1NM9A 3GZAA 1W9VA 4DO6A 2JALA 3AQUA 3RJYA 3VKKA 3WH6A 1AQ0A 4N42A 3CZ8A 1UR9A 1KQYA 1QW9A 2YLLA 1BGGA 4UCFA 1HJQA 2DSUA 1QHPA 2YDSA 5CPTA 5ECUA 2ZUSA 3BAJA 1MWOA 1B3YA 3VIMA 2XPKA 3A4XA 3SUUA 1WDSA 3RILA 3CZSA 3D50A 5FIPA 1J0JA 1E6XM 3AXXA 3DECA 5BXSA 1RP8A 3ZT7A 2GSJA 3WQ4A 1QI5A 1DTUA 1J12A 2A3EA 4D6FA 5E0CA 1C90A 1MXDA 1KXQA 4D6IA 1ZBCA 3A22A 3A21A 2XM2A 1RH9A 4QP0A 2XN0A 1E6NA 3BVTA 1WE5A 2VJXA 3TTSA 1QPKA 3CUFA 1BVZA 3KLKA 1B3ZA 2YBTA 4C7DA 3RCNA 3TP4A 1QHOA 2DH2A 2X0YA 4GQQA 4UQEA 5D9OA 2GFTA 2W61A 1JGIA 4UZUA 2YA2A 2A3HA 5HPOA 3GYCA 4D6HA 4DWSB 5I78A 1Z32X 4JFVA 3GH7A 4ZFMA 1KTCA 1UUQA 4YHEA 2J62A 2VZTA 2D23A 1V3LA 3HZ3A 3MO4A 1JZ8A 1OT1A 4OOZA 4MB1A 4BQ3A 3L2LA 1FHLA 4M24A 4MNKA 5EFDA 4W5UA 3MU7A 1FH8A 3A4AA 3RM8A 3VD7A 2WWCA 1CNVA 3VSVA 1UKOA 2ZX9A 2OWCA 3GH4A 5A6BD 1BTCA 4QCFA 2X2YA 2J77A 2XG9A 1XCWA 3DDFA 3M07A 3ZR6A 5E09A 2E9BA 2EJ1A 2FH8A 1G0CA 1WNOA 4MB4A 2WSKA 3AHXA 1NWTA 4M82A 3WH9A 1BVNP 1JD7A 1RPKA 4UOQA 4A3YA 2XVNA 4MJ4A 5A8NA 3PZOA 1V3JA 4NRRA 5TD4A 3TONA 1T0OA 3BUQA 4BQ5A 2V3FA 2YOCA 1R7AA 1LWJA 3CGTA 1W9DM 2V3DA 2J8GA 1IZJA 1E1EA 2XWDA 1HKJA 2GDUA 3F5LA 1JYVA 1TG7A 4HU8A 3EJPA 1X6NA 4OUEA 2ZX7A 2DSVA 3K8LA 3DYOA 4RE4A 1MXGA 3UG4A 2VO5A 1KCKA 4NF7A 4KGLA 1J01A 3WFZA 3OLIA 3NSNA 4F8XA 2FDMA 1EH9A 4FK9A 4HTYA 4CD8A 2AOSA 3ZT5A 2OYKA 1PX3A 3BMVA 1BQCA 4W88A 2CPUA 1WP6A 2F7QA 2XVPA 3WDJA 1KXTA 1HL8A 1PAMA 3LXCA 1TA3A 3ZJ8A 4AD2A 4A3HA 5E0FA 2BY0A 2VRJA 3H54A 2J7BA 5DF0A 4BF7A 1JZ5A 1UD6A 5LA2A 3GBDA 1JNEA 2PWFA 4UFKA 5IXEA 3NJ3A 4D6JA 4AZHA 3I3EA 1JG9A 1DWGM 4NI3A 1E6SM 1G9HA 2QLYA 3EDFA 1GUVA 3BVWA 1W1VA 1EOKA 2DIJA 4WSJA 4MB5A 4AEFA 4N0RA 1HVQA 2CHNA 1ODZA 1MQQA 2X09A 1EHNA 4GI8A 2XVLA 1NOUA 3EMCA 2JEQA 3OLGA 5E1QA 1UG6A 2CITA 4DM2A 4TVDA 1BSIA 5EMYA 3FAXA 1FP9A 4J3XA 2WNWA 3ARZA 3HG5A 2BXYA 3CMGA 1E55A 4J3SA 2C7FA 4EK7A 1OINA 2WHMA 1CXLA 4OOUA 4AIOA 4FLQA 3PBGA 2FHBA 4H41A 2GJXA 1E4NA 3CZKA 2J7EA 2WYSA 1CGWA 2PB1A 3WDQA 4M1RA 1XSJA 1UWQA 1NP2A 3ARTA 2O9RA 2X05A 3ZO9A 4AZCA 4PBGA 3VX0A 2XHYA 3CO4A 5A2AA 4NZFA 1PZ2A 2XFRA 3W26A 3W37A 2OW7A 3RO8A 2Y4SA 1KB3A 3H53A 4ZXLA 1E6RA 5A1AA 2JFEX 1HIZA 3OA5A 2OYMA 3F5JA 4MDPA 3ZJ6A 4D6EA 2WHKA 4CVUA 2WCGA 3LPFA 5KZ6A 5ABGA 5GNYA 4U3CA 5LA0A 5EFFA 1U33A 1H4PA 3ZOAA 1JZ7A 2HISA 2VZVA 2XSAA 3VGGA 4HPGA 3WNOA 2W63A 1UASA 1E0WA 4M80A 3CHCA 3AIVA 1JYXA 3L4ZA 5BWFA 4GKLA 2C8NA 4ACZB 4FLRA 4CN1A 3FNDA 3L4YA 3LXBA 4PUEA 1OGBA 2WB5A 1QOXA 1B9ZA 1B2YA 4LYRA 1CTNA 2WMGA 5A6SA 3F4VA 2YL5A 3W81A 4TTGA 5DFAA 2E4TA 4AZ7A 3KL5A 1ISWA 4WIWA 1MFUA 3BUDA 1KXHA 9CGTA 1EQPA 1GJWA 1UQYA 1HKMA 1CYGA 1E4IA 3N17A 3AIRA 1XH0A 1E3XA 4GO8A 3T2OA 4CCCA 1UH2A 3W0KA 1K9TA 3W6MA 2UWFA 4AZ5A 5JUVA 5D8ZA 5GNXA 3MMDA 2Y5EA 1YHTA 4TX6A 4MDOA 3N9KA 4E2OA 4D72A 2J7GA 3IAQA 4QLKA 1HJXA 1KWGA 1H1NA 2F7PA 1GHRA 3WD3A 3A6OA 4UQDA 3ZQ9A 1BHGA 2XJ7A 1VENA 2YDRA 5HDRA 1K9FA 1GOIA 2VX6A 2J78A 1GOKA 2BHUA 4PMVA 2XIBA 5HOSA 2BS9A 1K6AA 4J3TA 4Q7NA 2ZXQA 2EACA 4AZBA 4YHGA 5A2CA 4U31A 4ZENA 4U33A 3TA9A 4X9YA 2BNJA 1UWUA 2VMFA 2RGMA 1B1YA 2F18A 2PWDA 4PMOA 4AISA 3W38A 2MANA 4PMYA 1W9BM 1W1PA 4XB3A 3DHUA 4A4AA 2QMKA 3MSGA 1VEPA 3S2CA 3AMCA 4P8XA 3SCUA 3EDEA 4FNQA 3VIIA 1HN1A 1I1XA 4JFTA 1W91A 2VX4A 1O6IA 4PUDA 4JFSA 3AICA 1UD4A 4Z2IA 4D1IA 2XIIA 4RE2A 3WN6A 3CUGA 1BYCA 1VRXA 5IFTA 2DEPA 2XWEA 2B31A 3GXIA 1H49A 1LG2A 1KQZA 3PZGA 5GPRA 2PBOA 3DC0A 3K4AA 4JHOA 1TVNA 4QAWA 2CNCA 4S3JA 3AYSA 1TVPA 3RIKA 3HU7A 4B16A 4Z2GA 2HVMA 5IHRA 3ARVA 1MW0A 1OSEA 2BV9A 2BY3A 2OSWA 1GONA 3POHA 2CBJA 2XGBA 4IM4A 5E9AA 3PTKA 3VNZA 3EMQA 3N11A 1XSKA 4LPCA 1VAHA 4W85A 4AMCA 3SUWA 2V3EA 1EDGA 1LL4A 1OBAA 1QX1A 1MW3A 4AZIA 1VBRA 3SCRA 4D71A 3MANA 3SCQA 3AS2A 1BG4A 1JF6A 3WNPA 1B31A 2GK1A 1E6QM 2A3CA 3QGVA 2YFOA 3AHYA 3POCA 5A8PA 3ALFA 2E8YA 4PCSA 3B8SA 4XZBA 1U30A 2FYVA 2DSZA 3VIGA 3BVXA 3WUBA 2ZUNA 4AEEA 1B3XA 5A8OA 4OBSA 2IGTA 3PTMA 1QNOA 1E0XA 2W92A 3VO0A 4DUVA 3D52A 1OD8A 2ZICA 1J9YA 4KGJA 5M3WA 1UR2A 3WY1A 1US2A 3SCWA 4HMCA 1E71M 1LQ0A 4AMWA 1QI3A 1FFRA 1H5VA 1ITXA 1PBGA 1GVYA 2E3ZA 1JYWA 1KBBA 1BYDA 2IUZA 4P7OA 3AMGA 2GJXB 2GK1B 4LXFA 1CLVA 3HMCA 3D51A 2WMIA 2J79A 5HXMA 1BF2A 1HXJA 1HJVA 1H0IA 5FD0A 1HP4A 1EDQA 4WK9A 2EEXA 4V2XA 2NT0A 4H8VA 2WLZA 1C91A 1E5JA 3EJRA 3AIBA 3BLKA 4WKAA 2PWEA 3VPLA 3CMJA 3IANA 3VTRA 5A95A 3NCOA 3KL3A 1V0LA 4UZSA 2UY4A 2VVSA 3CV5A 1DHKA 3SUTA 3EJTA 4W5ZA 3RPMA 2GVYA 3RJXA 4HZ8A 3RM9A 1K9DA 1E4MM 2X8RA 1CGUA 1A47A 1Q6EA 3CIVA 3WQ8A 1E4LA 1V0KA 4AWEA 3SEPA 3GBEA 3AHTA 6CGTA 1FA2A 3AYRA 2EPOA 7TAAA 3I3BA 1KCLA 2Z1KA 3BUIA 2XVGA 3IJ7A 3AS3A 4AIEA 4AZ6A 3VUPA 1C7SA
chains in the Genus database with same CATH superfamily
4JDBA 3H26A 2EIKB 5JXED 4POZD 2Y23A 4DETA 4Q6XA 4ZZ9A 4PRRA 4JY6B 4L4VB 1XFPA 1LEGA 3ATBA 5E00A 5C08B 4DZ5A 2JCCA 5C2GA 3MNVB 4FG0A 3UXIA 4M6OH 2D7MA 4MYAA 1V6XA 1P4UA 4W86A 1L3WA 3L3GB 1PDZA 2HPMA 3V4VL 2WINB 5FCZA 5E2TL 1TTAA 1ZV2A 5TGBB 1DJNA 2Y06H 2HT2C 1HFBA 4KIEA 3BSHA 4DHGA 4ORZC 1X8CA 3FCSB 3MNDA 2PDFA 1R3JB 3FF7A 2IH8A 3KAOA 3QV7A 2AZAA 3HE7D 4O58H 3TN0D 5B38B 1U5JA 3C0JA 4QDPA 4GP5B 3WEZA 4PJ8A 3VG0L 5DHEA 2P53A 2IH3A 4QTIL 4QROA 4LPYA 4IRSD 3UPAA 3AREC 4LNRA 2NLJA 5LN8A 2PP7A 1RUAL 2YUVA 4KEUA 4FQ2L 4LJ3A 4XXCA 4LARL 3L1OL 4UC5A 3ZDXB 3QDMD 2V69A 4WU5B 4ILDA 3SE4A 4NZCA 4PY8J 4FOJA 4DM2A 2YZ8A 3IJDA 3O6MH 3H4HA 2A77L 2WKLA 1TQTA 3E6HB 1EDHA 2MRYA 1K4HA 2PP8A 4UFLA 1FBIL 3UZVA 4AUUA 1GVRA 4JTIA 5GSVA 1NCDH 3VMOA 3WY2A 4HPNA 3AWEA 1OVDA 1I7RA 2IPWA 3LAFA 2AXGB 5GJTH 2XZ9A 4OTXH 3UTTD 1KULA 1RVFH 1IU1A 2EKGA 5DEZA 4GIOA 1FV1B 3QIUD 1W0WB 5F2FA 1ZB5A 1NKOA 4GRWE 2JF7A 4JHZA 1YNKL 3QORB 4NJAL 3SOBL 1LWHA 2OR8A 5EU4B 1FP8A 4TQEH 4XMKH 3B9NA 3KVJA 1L6ZA 1XS2A 3L9EA 4XBEL 3GEWB 4F1SA 5LKNA 4F7CA 2NNFA 3GJFA 4U6YA 2Z7GA 5D02A 1XZ0B 2VDRL 5FKPA 1PQZB 1VFMA 2QCLA 1JVKA 2VTFA 3CZFA 3MGTA 1SYVA 5TQ0H 2PCFA 2H9AA 2VVNA 5FJOA 2GSGB 4NQXB 2GB2A 1JCKA 2LFGA 3UO1L 5A94A 1Y7VA 2ESVB 1CGTA 3N3EA 4NQEA 5E7FA 1HYRC 4J3OF 4DN4L 3M0JA 2X4PB 4M5ZH 1KGCE 3WTYA 1G87A 4W4OA 1O7DC 4MAZA 1M7JA 3FB7B 4NWTL 2WWOA 3TA3D 4B97A 4JX5A 4MA1C 4QOKD 4R7OA 2Q8AL 5ILTH 1FHDA 4N4QA 4YZWA 1W72H 3WEMA 1WC7A 1UC4A 1W72A 1NBZB 2VLJB 3MBWB 5TE4L 3TPUA 2DY2A 3P4NA 3O6YX 3CL7A 2GCYA 1TO3A 4MJ6B 3E3HA 2NNRA 3LB0A 2V17L 2X2HA 2QS8A 1GK8A 4WKFA 3MR9A 3L9RB 1K8IA 2VLJD 3Q9PA 4K55A 1NBVH 3PGCA 1BLNB 3LV3B 4KNQA 1ICPA 1XL9A 4H40A 4R2GB 3RHWF 1CXEA 3O6CA 1TMQA 3JSSA 1UUSA 2FIKB 1ADQH 2UZPA 2HH0L 2ORBH 3BKJL 3Q7JA 4M8QB 3WIHA 4HISA 1E4WL 1MWAL 1Q9WB 5DRNA 4KJYA 1MNUL 3VXUB 1L0QA 1TPVA 5BJTB 3PTQA 1TR7A 3CFCH 4DH2A 2EH7L 2WLYA 1KCWA 4JQ3A 2BM3A 1FG9C 3D12B 3FTGB 1OXYA 1L9TA 1W2KT 4FI8A 3VXGA 2QHAA 3TBSB 4ZZKA 4PMDA 4UTMA 2JB5H 3SYAA 3WQWA 1OFBA 2XUWA 3QXDA 5AZEH 4L1HA 2YL6A 3PM6A 1FZJA 4QTIH 1KXVA 1ZS8B 3GSVA 4AWJC 1UP0A 3HJZA 3FSOA 1LDCA 3QNYB 4EAMA 5FL0A 3LS5H 3D2UD 4AL8C 4E8GA 4DKEH 25C8H 3VAVA 4AAJA 4XP9L 2VDNL 1ZALA 3QI9B 4E42B 1A2YA 1JXDA 4GY4A 5FUOL 4WTZG 1ZBVA 3GSQA 4R7DB 2VAAA 2XTKA 2QTEA 4AE0A 4A37A 1TJ2A 3D3AA 3WEBA 4M93C 2OULB 4ENED 4HHLA 1WGVA 3REVA 2ZE0A 3P4OA 4NO2A 4AITA 1JRHL 2IOMA 3F84A 4AENB 5JZ7D 3HC3L 4H26A 4KZEH 1I6NA 3UC0L 2YSSA 4M5YH 3QOKA 4B96A 3ZDZF 3SIKA 5LGHH 5GS1A 1C8XA 4Z8FH 4RGNC 2OWWA 2CXGA 4JJ5A 3QUXB 4HCHA 3W1PA 4CNOA 4QHNB 3GSXB 3QI9C 3NQIA 2XUCA 3W2JA 3DUUB 5LVEA 5KETA 3SD2A 3D30A 4QE1A 3H7RA 3UR7A 4KRPD 3EFFB 1ZDSA 2K8MA 4KQNA 4ABUA 4UUIA 5AENA 5CD5C 3TA4D 2ZOXA 4YLCA 2ZSWA 1XGUB 2MCPH 1V3IA 1P7HL 1D2PA 3OKKA 1T7LA 1XRSA 2JGQA 5GGUB 3RP1A 4PMUA 1UZ6F 1GKOA 4O11A 5JIHA 1LYXA 5D30A 3REQB 2MHAB 3TJEL 3IUHA 4X22A 4XNMA 3TU9A 4ENEC 1BWMA 5LJYH 1BSLA 2V5MA 2H6OA 2Y2TA 4PGZA 4MPQA 2AEOA 2D7OA 4S1QH 2DWDA 2APWA 3FO1A 1U8CB 1JV5B 3JV6A 3LBCA 3T4AB 4H8WH 1WDPA 5ICXA 1S2TA 4JYFA 1VBJA 1BBDH 4GFXA 3OYXA 3HNSH 1I1YB 2L04A 4L8SA 2DQIH 1W2PA 4U3HA 1DN0A 1EJFA 3B2UC 1A14H 5DJAA 5IP4A 4DGIH 3LHVA 1GGUA 1IBDA 4Z7OB 1U8HA 1LP9A 3DGGA 4CGTA 4LVOC 4KK5D 2A9AA 4LPTA 5ALCH 2P8PB 1TVBA 3QARA 3DX4A 3R7MA 5FF0A 5DJ6A 3INPA 1NCUA 2E7BA 5EBGA 1J9QA 1C5CH 1E73M 4C56B 3UACA 2VDLH 4XVUD 5KSUA 1YIXA 4BCEA 3SBRA 3P77A 4KCUA 3W0WA 5GRZA 3TWYA 5AG8A 4OU3A 4KKXA 3B3IB 2HXTA 6ALDA 5CEYB 4IOSA 2YD3A 5IVNA 2D22A 3BT2H 4L3FA 1NC2A 1XGYH 2A21A 3INUL 1B6DA 4HT3A 1J1XL 1TWZA 1BJ1J 5HGDB 1UM5H 2PDCA 5EUOF 3CBJB 5IVXA 2W9MA 1QHZA 5AVUB 3WD1A 1FFOA 2F7OA 4JY5L 3L68A 2EBNA 3FY1A 4IMLA 2XI9A 3AITA 4F8QA 2QXWA 2HROA 1AODA 4M03A 1HHJB 5MHBA 1FWSA 4LHUD 4F40A 3N91A 3WJLA 1ZCCA 5EBWA 5ITBL 3V5KB 3WKYA 4E9YA 4NNBA 2GVLA 3AU6A 3EOBB 3A9BA 4LSSL 2EPLX 1C5CL 3JBG7 4ZMAT 5LUMA 1BXUA 4XP9H 4P5KA 4P07A 3GWQA 4LCUA 4UCGA 3TROA 1Q65A 1Q94A 3UPMA 1ND0B 3DDMA 2XZZA 5IQNA 4IG2A 2CLKA 3SPVB 5CPQA 1O7SA 3HG3A 2YAOA 3EJJX 4DP2X 4LVEA 4U3SB 5DJ2A 1CMOA 1F5WA 2Y7OA 5T1MA 5DJZB 3WNJA 3W88A 2CU9A 2GUUA 1RUKH 3W39B 2DZVA 2P0OA 3DX8B 2FSEA 4A6YB 5IB2B 1D5ZA 5DJ8B 4ODBD 5D1XE 4P2RD 1QFPA 3ITCA 4BSVB 3HS0C 1DWAM 1A1NA 5IBUG 4X4ZA 3CPUA 5IF0B 5T1LB 4PY7A 2ATKB 5ITFA 5JOFA 4G6CA 4NOFA 1IJNA 1ZIAA 4JS7A 3RJQB 5C0RL 4Z2HA 2NT1A 1A0QL 4RE3A 4K7VA 3KRUA 3HJEA 1UOVA 3QR2A 4MXWL 1ZU8A 1S7WA 4Z7UA 4XTDA 4QSFA 1ZDQA 4G5ZH 4IBYA 4AF0B 4LP8A 3GJFH 1J8HD 1XG4A 3FCGA 4ABVA 3AIQA 3K6DA 3NCCB 4K8GA 3SUSA 5DA4A 3FT3A 3W27A 1TJHH 1LJYA 5GIRB 3DRQA 4JL2A 5F96H 3ECQA 1P7KA 3H9YA 3CUIA 4GUOA 1MUJA 1NEUA 3UTSA 4A1RA 5IMLB 1HJUA 3RPDA 3N2XA 2EH8H 2ZF8A 4F8LA 1EX5A 3KNBA 1FFNA 3U9UA 1CBVL 2NY3B 2W27A 3NEVA 4DXKA 5ABDE 4GFSA 5I15H 3W9EA 1TUFA 3NCYP 3NQKA 3VGDA 2HTLD 2YN3A 3Q6GH 4FXGA 3WNMA 1IXPA 5IROC 4BZ2A 2C3GA 3KDNA 4MADA 3S5ZA 2AI0L 2Q10A 4GRLD 5D8WA 2PN5A 1CVSC 2ATKA 4P46B 3GHEH 1M7OA 3WMQA 3LY0A 2G0KA 3O15A 5LNRA 1CU4H 2YEZB 4K9EH 3UEQA 1B4JH 2I60L 4YDNA 1FIGH 4DPRA 1IBBA 3AJ7A 3G5ZB 5KYXA 1INQA 4OD1L 3BH9A 2R2EA 4P46D 1LL7A 5JXAL 4EE9A 3VFSB 2NQ9A 3M7WA 3FL7A 4HD5A 4N1CA 1SMAA 4WI6A 3BOXA 3LRLA 4ODUA 3ZE0F 1YXDA 4DZHA 1UJ3C 3EH1A 1VEMA 2A0LC 4Z7NB 3C9NB 1W9UA 4O1BA 3U5YA 1IAKA 4IM8A 4Q6KA 1CLKA 1S7QA 3BLOA 4D6DA 1PU0A 1O12A 1PGRB 2ZXAA 3BZFA 4PJ7B 3H3PH 4XNYH 5EG6C 2OO6A 3OJGA 4D1JA 2VKXA 3MN8A 4FERA 5A2LH 3U9PH 1QNRA 1HL5A 1XBDA 2XISA 2X0UA 4Y5YA 5FSEC 3QFDA 1TUPA 4PRNB 2OMYA 3LKOB 4L3CB 2O9OA 3VD2A 4AG4H 1BREA 3M8OL 1E43A 3CN3A 4ABQA 4NQVB 1ZJAA 3TYGL 4Q6IB 3VDCA 1N7KA 3SGEI 2V9DA 3MUIA 4PRIE 3B2PA 4XC1L 1CDYA 1Z0NA 3ZR4A 3QJFA 1QBBA 1T5WB 3RLGA 5I5JA 3RI5K 4X5WB 4AH2B 2LAGB 3M5YA 4CNUA 3CN0A 1L9PA 4P2OC 1LQBC 4MBRA 4R27A 4JGJA 1OAXL 1SSGA 4MD4B 2OQHA 2WSPA 5A6AA 4M93B 5HI4D 1XGRB 4M5ZL 2PDKA 1I3GL 1K8IB 5I1JL 1LBMA 4TL4A 5EHFA 2CCLA 3T3PE 4PB5A 2CD0A 3OM3B 2EVIA 3PV6A 3D3VB 1BIIB 3DIVA 4AIZA 2EPHA 4UFMA 1BLIA 3T4WA 2XRAH 2HFFB 2AK1H 3ZSTA 3MO1A 3FTWA 1C92A 1WPCA 4F2MA 2P26A 3PNRB 2FJHA 4LKCA 4APXB 1EDTA 1JPSL 3GF8A 3VDAA 5E6IB 4B9YA 5EEZA 3M9YA 5D4YA 2G5RA 4BQ9A 4PRWA 3T6ZA 3BQ6A 2NYYC 1OTTC 1YMHA 3KG5A 4YHIA 5B1AB 5IESL 1TE1A 1EC9A 4AW7A 3R0DA 1NEYA 3B7YA 2CO7B 4JDVB 1KYOJ 2O9TA 4AWSA 3IDJB 3HNTH 1YNTF 4HSNA 1GZPB 4L61A 5AHNA 5AWNH 3VKBA 1TJHL 1AVAA 1I3UA 4MJJA 1NWRA 1Q3NA 2J2ZB 2EYRB 5KZEA 2FO4A 4N6RA 3PWLB 4N8CH 1OAJA 2J5WA 3DARA 4KWWA 4RNRB 5KYWB 2ZA2A 4LEOB 1XF2A 5L9DH 2VRQA 5A43C 5C0BA 2WMKA 3VIPA 4I87A 1UZ4A 2QHRH 4FFZL 4G6ML 2IPFA 2HNHA 2CUHA 2ZXEB 3SKNB 1N8WA 2AGTA 3AUJA 3BEWA 1P6WA 1FL3B 3NJGA 3Q8BA 3NA4A 1G4RA 3D25B 3DYPA 3MBXL 2HG0A 3PNWA 3MJ9H 4FNUA 4XE5B 4O57A 3SR7A 3MJYA 5EA9A 3IGUA 1ZV5A 1NJ9A 4MMXB 1PY0A 4F8PA 1CICA 2WC7A 1GYCA 1U21A 1VIWA 1ZWIA 1DVFC 2VH5L 3PGFL 4QHNA 1LROA 3B3DA 2P44B 2TRYA 5F0MB 3M47A 3RR1A 4HKBB 2PNDA 1PX8A 3NACL 1DUZA 3RX4A 4TVUA 2WZPD 1ANUA 2X1TA 3N13A 4NO0A 1A4JB 3AGWA 3UC0H 1AIFB 3C08H 3SQRA 3L7EB 4L8BA 3GINA 2YD5A 3ILEA 3PAVA 4OKVA 5HHXL 4NOBA 3GO1L 5IEKB 4XISA 2C3HA 3IS4A 1QJWA 4ZQRA 1X4YA 3F2CA 4UDUB 1BZQK 3T0DA 5D2TA 5LHFA 3SCNA 3EJSA 2ICWA 5DHVB 1W6LA 1WDWA 2BNRD 2DQUH 2W0KA 4KT2A 4OQ1A 4K8RC 4POYA 4HZMA 4XPHL 3UGRA 3NR0A 1MIMH 3ILDA 1IQDA 3MXWL 2MJWA 3BPLB 2JKWA 4EMZA 4WI0B 4P7LA 3RB7A 2XYBA 4WWNA 3IIZA 2A1WH 1CPUA 3WO4B 3WQOA 3OB0K 4HFUH 3IKCA 2FZNA 1NDWA 3KYNB 4MMZC 5A7BA 5IVOA 1KRMA 3QO0A 5IM7A 3V4PA 1Q66A 5GRJH 2OBGA 5EZIH 3QNFA 1NCBH 4JKLA 1JPEA 1A5KC 4TV5A 1E8ZA 1KTLA 3T42A 1JMXA 1OG6A 1J8RA 1Q9WA 2Z28A 3ULAB 2HKHL 4PJCB 1RXOB 1F2XK 4DYJA 4AYFB 4OIFA 2YA1A 3FT1A 4ICWA 2CLFA 4MCYB 2ZWZA 4PCTA 5HSFA 5AYIA 4XNMB 5FJRA 1XSOA 5ABAA 5B4MC 4XAFA 3MLYL 1A6VH 3IMSA 1TT6A 3K71B 4JS3A 1F3RB 3KZPA 1A65A 5IV2B 1KM0A 2G60L 2YPLE 4NJJA 4JBRA 3GMRB 3MRHB 1MAML 1CX9A 4F4RA 8XIMA 3IRZA 4KH2A 2W9LA 4N2IA 2IWGA 1G7QB 5BV7L 4M7JH 3SGJC 3HE6C 4MMZA 4PS4H 3QZEA 1BOGA 4LVGA 4UMBA 3OGCB 1A6WL 3RNKB 4KWOA 1JRHH 1ORQA 3WK1A 5GRXG 1O0VA 3ROOB 4E9VA 1XIJA 4XNXH 1GHFL 3SB3A 3GDMA 4XZNX 2GK2A 3PDDA 2IS7A 1A9BA 4ZA0A 4NAFA 4NZTL 4H2AA 4W9CC 2GJ6B 2CZVA 4W7VA 4E0CA 5K7JA 5F3HB 2D1ZA 1JV2A 2RFXA 3D7PA 3NFPA 3O6FA 5EZJA 1BJMA 1WG3A 3TIMA 3KPQA 1SY6L 3PWVA 4JFZH 4U7KA 1R3IL 2VLKE 3HAEB 4S10A 2RACA 1W9PA 4YQXH 1OK0A 3KCPB 4JR5A 2WAHA 1MCFA 2JKIS 3SY1A 3ES8A 5EO1A 4WDXA 2FTPA 1BP3B 4LEXH 5HD8C 1Q7MA 2REQB 4PC8A 4PFMA 1PZ5B 2A6JB 4G72B 2CUMA 1Q6GA 4JQ2A 2KQNA 4B4FA 1ICQA 3B43A 1U3NA 4MJID 4TMPA 4FXFA 3BSGA 5AHEA 2HJKB 4LVNC 3EUDA 3EHBB 1AS8A 1OGPA 3UP6A 1W3LA 4KDTA 2OX5A 4WGVB 3W4RA 3FU6A 1KV3A 2KKQA 3IS1X 4HHWA 4N2HA 4OKDA 3TXZA 1XR2A 3MHUA 4LCUB 4HMEA 4WO4C 5E03A 1ZFJA 5C7VA 1ETJA 5K9JH 4HYTB 2VX5A 4NZDA 4DGUA 3TH3T 4WD0A 2GJ6A 3QISA 4JY8A 3WQ5A 4JFZL 5DO2C 2GTWB 4QRPD 4GG8A 1AHWC 5INCA 2CHDA 3IPFA 4UV4H 1MUWA 4AVKA 2GSIA 2V7HA 4X98A 5IMKA 2IANB 1Y6NR 3W00A 3W23A 2X6BA 4H8QA 4GI9A 2WCPA 4JN2B 1TA3B 4TQTA 4AG0A 5AHIA 1DCEA 5JDSA 1IVTA 4P9HH 4QRPE 4R4BA 1R9FA 1NARA 1J48A 4JMXA 2DKMA 4QNPE 1HO4A 1NC4B 2IDTA 1H7RA 4KPLA 4U5KA 4JTTA 5EU9A 4QE5A 3BMWA 4UM9D 1V54B 1IAIM 3AU1B 3BP7B 2MQ3A 5KOMC 4B3LA 4OZIA 1OM0A 1LZOA 2D2HA 4FP8H 3LZ5A 4HIHB 2WK2A 4NQCD 4W9KC 3TT3L 3JWOC 2A2IA 1AD9B 5CZRA 5E8OA 3MLUH 2DDXA 4QQ3A 1KLGA 4HAGA 3WD2A 4M1GL 1AG1O 1OFEA 5D2YA 3QQXA 4JKWA 1JUFB 2VCOA 2CKRA 3BO9A 4C60A 3LIUA 1GYWA 3LQAH 4APQA 4AVJA 4ZMYA 3FIGA 2Y8KA 4BEUA 2J13A 5JIWA 4OF0A 3KLAA 1J8HE 3MUUA 2R69L 1FDLH 3T2QA 1QPOA 3D4ZA 3A5VA 5G5DB 4OZOA 5I24A 4GOAA 1BJ8A 1OIFA 1KG0B 4I90A 4PUJA 1DOSA 2RGLA 1LM1A 2BW5A 2OMYB 3DVGA 4L3CA 2VYOA 3GFYA 2CRZA 3ZMEA 3LEVL 5C9JA 1JFQH 4H6RA 2Z2AA 5CZKA 5KEZA 5DSCB 1E7VA 3AQZA 5T1MB 3AS1A 2DZTA 5BXPA 3CMOL 4JRXE 2M83A 3EYOA 1C08B 3OKNA 4NQ1A 3MFGB 3MJ7A 3O3BA 4J3OD 4D0DB 3KHDA 3XISA 4H1LA 3TYAA 4R5VA 1BM3H 4HIJA 4WI5A 2QAPA 3CNKA 3O3AB 3MHZA 5HNNA 1OGGA 2ZUVA 2Q3RA 3W28A 1E4JA 5CEWA 2WZEA 1XH2A 4AG4L 2V0AA 3LI1A 3KPQB 2GUYA 5D72H 4KTGA 3QUMA 2WSRA 2V2XB 1HKWA 3ES6A 3W9DA 5I7GA 4DNHA 5CSYA 1TJIL 1MFEL 4CVZA 4HN8A 4P4KA 3HFYA 1IGTA 1MG2C 5IZ7A 1PKYA 5C6MA 5KBLA 4R7VA 3T09A 1A6ZA 4PS3A 3ZL4L 4LS2A 4W8BA 4WW2B 2IXQB 2G0LA 3MSDA 1XR8A 4M02A 5EH1A 3SQBB 4N0UB 1FRGL 2IFFL 1ZS2A 4NDMA 1MEXL 5FGBA 1MJJA 1A8JH 2AJUL 4PJGF 5CEZD 2ICEC 2VCBA 1DQQB 1KJMB 2XN9B 3LOTA 3THDA 1A2YB 2Z7ZA 3I6KB 3KR3L 4J5VA 1ZD6A 2H2PC 3NIFB 4KUZL 2ARJQ 3WLRA 1K6QH 3NDZE 1Q45A 2OTDA 1S78C 2KLRA 4NJAH 4U1SA 2YAPA 1SMOA 3GPEA 4P2OB 3WLBB 5MENB 2FEEI 2PRMA 3EXRA 5HQMA 4MD5A 2JCCB 3L4WA 1JRCA 4QITA 1UD5A 1G9MH 2DV6A 3L5IA 2W0UA 2NNXA 3SE3C 1EXUA 4N0YH 3LRKA 3VFTB 3SDXE 3L12A 4K1WA 3F2LA 4N0UE 1A9EB 3IK2A 3WIHH 5IB3A 4JR9H 3F5WB 2VLRB 1A5CA 2BIQA 3Q3GA 4G9FA 3MLRH 3GUFA 1SEBB 3ID7A 2QQNH 3TYCA 5BS0A 1B3JA 1I1FB 1GKRA 1OK6A 4DOHB 4OLXL 1MDRA 3U6RA 4PCPA 3TS8A 1QG3A 2CDEA 3UF9A 2PTZA 4Z1DA 1IM3A 5D2LF 2HVJA 3VXSB 5D04C 1OSYA 1NC4A 4JUSA 1MJ7L 3FT0A 4R90H 2H2PD 2XH4A 5AYBA 2JKPA 4GXUN 2GTQA 2EE0A 1MEHA 4LOUC 4DPQA 1E28A 3C60C 3FTZA 3OZ9L 4OIAA 2N0KA 3LZFL 1ISVA 4K68A 4NKMA 2WO4A 1V8EA 1INEH 1OM3H 5I3HA 1Y5VA 3TBTB 4ZFOB 1P1VA 4G3YL 2Z8VC 1U8KB 3BZ5A 1OPGH 3HRZA 3NL6A 4Z3FA 1FG2A 1CICD 3NEEA 3G5XB 3QS2A 4QHKI 3CHFA 4CA4A 1KBVA 2WVVB 3GJEA 3UO8B 5AYZA 3CIXA 3FB5A 1IEBA 3PZVA 3V5HA 2ETWA 1UKQA 5GGSB 3CHXA 1ZRQA 1GGBL 3S8WA 1R3LB 3L4TA 4GXWA 3DAQA 3W83A 1Q0YH 2DEXX 5TF1L 1MFMA 1BXXA 2H3NB 2Y36H 4PWKA 1GC1H 1P6BA 2V0TA 2X1XR 4NC1E 3VFMA 1FGVH 3VNYA 1PSKH 4AIUA 2X2JA 2RMNA 3KYMB 1G6RH 4FXTA 2B1OA 4B3KA 5DS2A 4OIIL 3PBWA 4FFVC 3LGDA 1A5AA 3S47A 4FFYA 5KITA 2CJSA 2ACQA 4GKTA 3BG9A 3EOLA 3U83A 4LIQH 3G1YA 4R9OA 4OLWH 3LXUX 1HHHA 2OQYA 4LYQA 3R5EA 4XP4H 4DP9X 1GZ1A 4N4PA 3ZJAA 4K0OA 5GGSY 4G80A 4DPBX 4M1DL 2VR2A 1K03A 1JUKA 4JCLA 3HB3B 5JPMA 3SDXB 4ELMA 5IEHB 4KCVA 3V5KA 1RJZA 2A1YA 5DQJB 4JW3A 1KPUA 3GKWH 4YVNA 3MUHL 3HCVB 3N0AA 3FS2A 3WN5C 2Y72A 4Y1AB 4Z1BA 5KYUA 5E99L 2I25N 3H9ZA 4O1CA 1VPYA 2ISVA 4LCVA 4Z7IA 2JF1A 1FL5B 4JO2H 3LXAA 2ZCZA 5I6LA 2ATPA 1EOMA 4MFEA 1CLYL 5T5FL 3W22A 1BFNA 1FWRA 4GD0A 1F6LL 4HLJA 2M2DA 4QXGL 3GLZA 5C0AA 4Y1AD 3TTEA 1J2BA 3MNWA 3JV0A 1T1YB 3PGCB 3E38A 4Y8FA 4ZNCD 5HJLA 1WEJH 4LCWD 4ZNEA 3GMPB 5B38A 2BIMA 1KBWA 4FHAA 1G0DA 4QRBA 1TQCC 2GITA 4UT9L 3W1ZA 1SVBA 3Q48A 5DZVA 3B7RL 2UVEA 2OTWB 5F72S 1TZIA 5I8CB 2Z29A 1QBLL 1E27A 4HNTA 4UTAL 2K4AA 5C3IA 2MCAA 4S0TD 3UIYA 1IEXA 1O7AA 3TNNA 1FF5A 1DWHM 1Q6OA 3U2JA 4WNQA 5CPSA 4WDIA 4Z1YA 3NZHL 5IROD 4QCIB 1IKNC 5F0LB 1J9SA 1YQVH 2J4WH 5LGYA 4ZX3A 5ID1B 1O1ZA 1WFUA 2OGYA 3K6FA 2NY7H 3TO4B 4MCZA 2NY3C 1AW2A 3IPWA 2FNBA 4W93A 4NU7A 2QCMA 5E2WL 2LABA 2NLIA 2VITA 4HIXL 4R3SB 5JLZB 2FVKA 3OW1A 3U2IA 1TZ7A 1ED3B 1QRND 3MV8D 4ML4A 1D9EA 3IXAB 2NX5D 3H1ZA 5CJ8A 1WXJA 3S3PA 1OHQA 4UIMB 1KR1A 2VQTA 4G7VH 4TUKL 2GUOA 4ZT1A 3IGSA 3A4WA 2JNZA 4WXYA 1RSFA 2GVJA 3EEGA 5DS8B 3WMPA 5IQ9A 5IT2H 4DYEA 1SYSA 1BQSA 2HT4C 4IYKA 4IPLA 2XV3A 3D34A 1EEZA 2C9SA 1AJ0A 4HA1A 3VI3A 3NQ2A 1K7EA 4OH2A 1F11A 1F8TL 3LMYA 3UZQB 5HYJE 2GPZA 2ZUUA 1IBGH 3SDDD 3VQ2C 5KSBF 1KKOA 1LOSA 1PKMA 1PO9A 3PL6D 4IMAA 4AY7A 1S9YB 3RVTD 5DX7A 2IADA 3U4EB 3K91A 4DN3H 3VYPA 15C8H 1IWAA 2HK0A 2GYIA 5BZWB 3UCDA 5T8IA 1Q6CA 2QGEA 1J0ZA 4GRWB 4R5XA 1E1FA 1SFJA 3ARRA 4GI6A 1ADQA 1P1ZA 4IK6A 3SKJL 4F3FA 1AKPA 1GJPA 4YJ5A 5H2ZA 3D46A 1T4KB 4XOCA 1J1PL 2ZPKL 1SM3H 1I60A 1VP5A 3LEPA 3TVAA 3WSUA 4FMVA 5IFPA 2DEYX 2JXMA 1H1ZA 1X4ZA 2F7FA 1WT5A 3VNDA 3PZ9A 1CB4A 4OCYL 1E6NA 4JGMA 5IT2L 1A49A 2FYMA 3X1BA 3QN3A 4M4RA 3DFSA 1ONQA 1CFQA 4H8WL 3PGDA 3MUAA 2F1AA 1RK7A 2A74B 2AJVL 3MRDA 3P81A 3ML8A 2Y63A 3G6MA 1Y18B 4NQDD 4CU8A 2V5DA 5G5IA 1R46A 3GZKA 3KYAA 4M6ML 2E5EA 1TEGA 4EUPG 1CFNA 4N2KA 3WKPA 3CH9A 3KPTA 1CLOH 5HDQL 3WL0A 3I6GB 5C0CB 5T1DH 3RUGB 3W57A 2NNAA 3TEYA 4MKSA 3TO2B 5FF7A 2ZD0A 5CM1A 3APGA 4FADA 3MI6A 1W37A 4DWSD 4WY0B 4BFNA 1F90L 5F44A 1VESA 2WXRA 4GYPA 1M7DA 1IAOA 3L23A 3PAOA 1XZ0A 2RAGA 3KM8A 4XTIA 4RIRA 3WF2A 1OAXH 2JKTM 3BZGA 5E5RB 1MHHB 2WPGA 1VYSX 2V9QA 4IKKA 1X5JA 4WY7L 1WKEA 2WQXA 5EFIA 3BLBA 3DOIA 4CW1A 4BWLC 2Y7SA 2Z7UA 4EF9A 2ICWB 3CQIA 4KZDH 3UTSB 1JZIA 2P47B 5C08E 1L3NA 5KSAD 3NCYS 5DD1H 4UM9A 1QPPA 1FVDA 4LQ1A 4TYUA 1CLCA 3OJDA 3TBWA 5I79A 2RKXA 2Q3AA 1OCCB 2K6YA 4GH1A 2OW6A 5E7BA 2O93L 1VFSA 2Q5BA 1U22A 3ORWA 4L37A 1KFGA 2FNWA 2ODHA 4PVBA 1H3WM 4K94H 2EUWA 3T44A 4LYPA 4N2LA 5IK3B 1PFCA 4P0DA 4N86A 4TQHA 4GG8B 1UM5L 5INCB 3QIWD 1JZHA 2PUQT 4P2RA 4ZAKA 5LN4A 3H7VA 3VUSA 2ZONA 1C08A 2UY6A 1IUZA 3RTQD 4DZ8A 3BAYA 2G8ZA 1OWRM 1OT2A 4GMTL 2OKOA 3EOEA 1F3EA 2FWOB 1SPDA 2PF6A 4N25A 3C5SB 4XPTH 3TVMB 4ONGL 4JTSA 1UUNA 2HTMA 5K9KA 3U7YL 1C12B 4IOFC 1YDOA 3LBMA 1ZT1B 4FSAA 3S46A 3UTSE 3NJJA 5C6PB 4IS6B 4NKDB 2MKWA 2V5SA 1QI4A 2N1KA 3HI1B 1E6PA 3R10A 5ALCL 3CSFA 5CC7A 2DLIA 2YIHA 3BFOA 5ALBH 4EN3B 3CBWA 1IJ9A 2W59A 2MTAA 3RAJL 1VR6A 3KVQA 4QAIA 4GGHA 2Y8VA 4XVTH 1NLBL 3I6LD 3L7EA 3P11L 4L8BB 3IGLA 1B30A 4DQOL 1WAAA 3QMRA 4B9CA 3LPOA 4PMXA 1SOXA 2XZCH 4HIIB 1CECA 1PMYA 1JUFA 5FW7A 3PF3A 3TFXA 5HULA 5MP6L 4US5D 1FFQA 2VFDA 4MNGB 5KS9A 2OFQA 1JK9A 3HUJE 1E9LA 4HJIA 4TOYL 1A9BB 4IEFA 3TEXA 3IGFA 3U57A 4HS3A 1AA1B 4JN6A 2YO3A 3WN5B 1N5AA 2C3ZA 1V3MA 4K3GA 2N4IA 1OOWA 3CZEA 3ATFA 3PV6B 1W3NA 2E9WA 2IANA 1DLFL 1CN4A 2CHWA 2YGNA 5K2ZA 3EO9H 3IS0X 4DBWA 3I7SA 1XF3A 3MX0B 4EUPH 2X4OA 5ADPH 4K3HA 2Y62A 5DELA 2CCRA 2KI6A 1EAPA 3KPSE 5I23A 2VZSA 1RH8A 2N7BA 5FFGA 1R6WA 3MZNA 1FNSL 4FQLH 3VXRB 1TTCA 3FFCB 3QQ4B 5IR1B 1CDGA 2JJTC 1G9NL 2PWVA 4KAQH 1NFKA 1AZ2A 3EOTH 3QUZD 4P7RA 1IIHA 2X7VA 4J3BA 5F97E 2OX5B 1KBJA 2HBXA 4HA4A 1I9JH 4F7EA 3JZEA 5E6IC 5BW7C 3HS8A 5JQIB 1GPFA 5BS0D 3RFAA 4KFZC 3V1HA 4HU0A 2ZKXA 3N1FC 3QCUH 4PJFE 3EKGA 5AAMC 1JZ2A 1ZY9A 3K0YA 3ITTA 3QYSA 4Y16D 3W2KA 4LKXA 5D72L 1D5IH 4TXEA 1G6RL 5B39B 3WELA 5K9OB 5HD8D 4UYPA 1HINL 3EGXB 2JQAA 3FRPA 3E7JA 1ISYA 1ZAHA 4JXCA 3NVTA 5GHWL 5EEYA 1MDTA 1K2DA 2W60B 7CGTA 4LCQA 1UR4A 4UMCA 2Z0UA 1C5DA 1FWIC 5KBMA 3BGJA 5HVFB 4C83A 3FT9A 2QIIA 3I02A 1FRGH 2IFFH 4RMQA 1XBXA 4U4IA 3UCRA 1SYTA 3L4VA 1NGQH 3H0TA 5I00A 4GXMA 1C3FA 3QHZH 4UBPC 3WQDA 2RD0A 4XNZB 4HBCL 4KRUA 3ARBA 4OZHE 1W3JA 5GGRB 2YCLB 5D9NA 3H2PA 5GGVH 2PXYC 3D6GA 4MMXC 3MRIA 1UXLA 2APXA 1CBGA 1U9KA 4XC3H 4LUSA 3X1EA 5JIPA 2DS4A 1DJQA 1CDHA 2CR3A 3O4OC 3V8CA 4YBHA 2HTLC 1N0LA 3TOPA 2R1LA 5D7KE 1SXNA 1ID5I 1QLEL 1XX9C 4RFOL 4V1DB 1G69A 4R7DA 5GVJA 5L9FA 3RDKA 1QW8A 4MSWB 4NM8H 5F1IA 4QEEA 2YKKA 3DFOA 4E4PA 1MSPA 1RZKH 1FDZA 1L2UA 5F88A 1KKRA 3ARFC 1R24A 2QPUA 5A2JH 1D6VH 2BP8B 5MEQA 2IEPA 5GJTL 3LS9A 3PUGA 1PEWA 1B0GA 4GQZA 3A9IA 1XPYA 3CHEA 5GJSH 3KHQA 1LP9F 3QJHB 4Z7OF 1UGKA 3NP4A 3V0IA 5C0BB 3TYFA 1MUMA 3QRBA 1KPVA 3T6VA 3JWNH 3EO1B 2QSQA 4OM0L 2VX7A 2XQBH 3CVHL 4HVXA 2DDQL 3VIJA 1JPFA 1AZ1A 4S3AA 1H5BB 2Z31A 3N15A 4PJBE 4KRTA 1K6QL 4MLIA 1H7NA 3UIZA 4H25B 2VDHA 3E0LA 3ITLA 1KN4H 2VXVL 3GMQA 5GGRY 1U3ZA 2YLAA 1MLCB 4PTNA 4YDJA 3RDTA 4OSUH 1ODUA 3ZY7A 4INFA 3UVAA 1LEIB 4QRUB 3FTUA 3LEXA 2DI9A 4HIBA 12E8H 1MW1A 4AYSA 2BXZA 4EDXB 4L4JA 4JG0H 3GXNA 5HPMB 2W81C 1NIEA 3CXHK 2A5HA 3VH8A 3Q6FB 2HRPL 3FKRA 3GIPA 3NYZA 2WC4A 3TLQA 1WBZA 2KPNA 3ARFA 5LBVA 3NIGF 3T0VA 5IG7A 1QBMH 2IBBA 2YD1A 2YXWA 3QZOA 4B0MM 4RPPA 4XOBA 4IOTA 5FF4A 5TK4A 4UR9A 4DUOA 4MM1A 4TNGA 4RSVA 4BGLA 1JWMA 2QDWA 1JSYA 3BYTA 1I7UB 1Y6KR 1KGWA 1KPUB 1UXWA 3BEVA 4EXKA 1NTHA 1BQLH 2VXSL 1A4AA 5DD5H 2QUVA 3GTIA 5GISL 2H1PL 3KLQA 1PKQB 1K77A 3LENA 3TT3H 4GRLC 1NAKL 3SYQA 4Q8TA 4MMXA 1KIUA 4N2CA 2XKUA 1E4XH 4XK2A 4WUKH 4ZPVB 4O5LL 1RK0A 3UD6A 1IKFL 4LCCB 4UQIM 5D32A 1VDGA 5AOUA 2F74B 5C0JB 4DJDA 3FQYA 2RJMA 3WTXA 1KLFA 2G3ZA 5CZTA 4Z2JA 5BZAA 1XH1A 5JUEL 5EBMB 3TF7C 4H8UA 4HT1L 3STZA 2AJXH 4MZ2A 3GEFA 4DAFA 2VZ1A 3M41A 3KPLB 5HY9B 4XWGL 4HNOA 4PJCF 3WEXA 2JIXD 3IMBA 1AJ7L 5F2LA 2PDYA 4H0GA 2QCFA 4ONFH 4F3HA 4F91B 3WMCA 4BJLA 1IEHA 4DX3A 3WJMA 2NQLA 5J8LA 2FUQA 3E2HB 1YE6A 4C6JA 1QSED 2CO7A 4JDVA 3EOBA 1GQLA 4P3CH 4NT6A 3WQFA 4FA3A 1DP0A 3FRUA 4LCIH 5D1XB 2JV6A 4HKZA 5AAMA 3TM6A 2IJ0C 3WENA 1T6BX 4Q74A 4OGQC 4Q4IA 1GJUA 7ENLA 1J5OL 4R7LA 2NV2A 5BW7A 4OBRA 1LMIA 3I2CH 3OHXB 1XPGA 3TJPA 3S4SG 1SHWA 3T65A 3NQDA 1KTDA 2CH8A 4Z0BH 3V75A 3DO3A 2HKHH 2F61A 5TGBA 4M1DH 3MTWA 3W9ZA 5DY3A 3FN9A 3O6AA 2QKSA 3TL5A 5TPWH 4K7FB 3ZMRA 4ZO8A 4X9SA 4BI6A 1V7NH 3SB0A 3N4AA 1JI1A 1AXTL 1LO3L 1V05A 4OCMC 1XFCA 2O7QA 4LLQB 1DE4A 4E41D 5C07A 3O0RL 1IX2A 3RIFK 5CJNA 3GSWA 3GI8H 4LLMA 3DX3A 3FYPA 3WIAA 3AS0A 4X83A 3QF0A 2O4EA 3CX5K 4XVSL 3M17B 4G8AC 5JW4R 5BOJA 3K8MA 4Y5YB 1I75A 1AXIB 1V3KA 2FR4A 1GHFH 3BYYA 1FWCC 4XCEB 4YDLB 4PTTB 2WUCL 3SCTA 4NQVA 5ICZB 2FEJA 2WUBL 4G83A 5BMXA 2XVKA 3DHPA 3IWVA 3KLLA 2FVMA 4WI8A 2CMRL 3YPIA 4QRPA 2DV0A 1PPIA 1JJUA 1XGZA 4I0CC 3M1BA 2AVFA 1IQDB 3VOFA 4PBXA 3P62A 2XFXB 3MBEC 3GTVA 3OBKA 2VXQA 2XIDA 4YHZH 4IX0A 5GRUH 1XGRA 4TIMA 1KENL 3OKMA 1BYNA 3OZ9H 4TL5A 1YLVA 5EB8A 4NIKB 4K8EA 1OTUC 4GW1A 4MNQE 5E5UB 1R87A 5T1DL 1IZCA 2FVLA 2Z25A 4CMHC 5DMLA 1PZCA 1TITA 1PKQA 3Q2VA 4J7RA 1WUZA 2P7TA 4TLSA 4Q8QA 2R2EB 3V0UA 1P7QA 1KPRB 2J72A 5EZPA 1TIWA 3C2VA 2Q7YA 3AG3B 2XWJA 2Y6ZA 1FDYA 4JM2F 4HLZH 4Y8EA 1LOQA 3WH7A 4HK3N 3QB7C 1UWAA 3QZWA 1ZCOA 4H3DA 3NSJA 3MRJA 4J4KA 4FZ8L 2DWYA 2B4CC 4UFIA 1X44A 4LUTB 3FCSA 3THAA 4NBYB 2PPFA 4R97C 1TFHA 5AHLA 3KCLA 4KVCH 3A24A 3QQWA 1CK0L 4AX6A 1CLXA 3VD1A 3DPDA 3E0WA 4UT6H 4XUYA 1RMFH 1ED3A 3ECVA 3EOAB 4AQEB 3OKLA 4XE0A 2WW5A 4JPIB 3F7VA 1DLFH 1ZA6A 4MWFA 1KFAL 4UAHA 4J4PC 4X6BA 3SGDI 2P0IA 1EA0A 2E25A 1J5OH 3RN6A 4FHKA 1NUGA 2YGPA 4XP1H 1OP3H 5FA3A 3SCVA 5DRXB 4M6QA 1S7TB 1TYEB 1WDRA 3CTTA 4EZLA 3CFTA 4MZ3A 4M48L 3VFRB 2Q87A 5JW3H 1IGYB 3H55A 5EZLB 5KSBE 1TO4A 1B54A 3T3PF 4BSVA 3HFTA 5H94A 2F58L 1M6JA 3DROA 3TN3A 5DRZA 3DGGB 1L8PA 2NOYA 3US0A 2VISB 2BJML 1QYGL 1GORA 5JW4Q 2DSWA 2HAZA 5IM7B 4Y9PA 3NGBB 4FMFA 2YGQA 2AJYL 4MBOA 2WB1A 3QR0A 1RIUH 2EXSA 4G8GD 4KJQC 1FNEB 1NGPH 4X6FB 4XMZA 4IGMA 4ZODA 3V6OC 3GZQA 2HLFC 4G9FD 3VZZA 3WE6A 5FOJA 1RUML 1X97A 2GITB 1RHHB 1C93A 3HV8A 4OV4A 4DM1A 2ZG2A 2C18A 4G7QB 4ZE5A 4PJAF 4IIEA 4E6MA 1XB8A 2V7NA 4G3YH 3OKYA 5F1OB 4DRSA 2F2HA 3QYNA 3L4UA 5XINA 3H2CA 2F7IA 1UZDA 2Q8LA 1MHCB 2GTZB 1OCBA 1WT5C 4Q56A 1RJLB 1K4DA 2ESVA 3O81A 3ZTDC 4DJFA 3PG9A 4MD0B 1JCLA 4JRWA 4N8PA 1HWHB 1BXVA 3GMNA 2F7RA 1O5XA 4L4OA 4G1MA 4ZMPA 2NV1A 4QS5A 4UU9A 1XIEA 2P1YA 5KVMC 4XKYB 1M71A 5JHLH 1EA9C 2GAZA 1TLMA 4K37A 2VN5A 4A2EA 1K8DA 4YFDB 4U0QB 5ERWB 5F7FA 1N5YL 1UZGA 4YVPA 3QM3A 3S2AA 1YMYA 2AEPH 1I31A 4BHUI 3EXSA 2ACUA 3B2VH 4J1OA 2EIZB 3V2AR 1SYSB 4RW3A 1QFWI 2G75B 5GQBA 4ODTH 4XNZC 1VCFA 3QG6B 3W74A 1NTDA 1N4XL 1SU5A 3U9IA 1AP2A 1XLCA 2E8ZA 2EDHA 1CFVH 2C19A 3FUMA 4TOYH 3OQ3B 3A3YB 4HS8H 4HFWA 3VIFA 3BAIA 1BVLA 1YNLH 4OFDA 4PJIE 4TLTA 5H37A 5GS0L 1VGKA 4OR1A 4AMKH 2JELH 2G4EA 2E7LC 2GEEA 3V0FA 1WFTA 3UGXA 4MNHA 2C13A 3BRDA 4JZNB 4JRFA 3PFQA 4MWAC 4G70B 1WDAA 2Q3XA 3CLWA 4X0KA 3W01A 5M94B 3ILQC 1ORQB 3N41B 4PYGA 1D7KA 3VAEA 3UJTL 5IVZA 1TTRA 2O30A 2DQXA 1KFWA 4N0CC 1J86A 3B2VL 5A2FA 1CFTA 1Z9AA 2QUUA 3UR8A 1KFAH 1WZ1H 3H9HA 3OR6B 2YAHA 4FXLA 1BQHG 5DR5L 4Q58C 1J6PA 2R15A 1GGTA 1U8QB 2AKRA 2J12B 3BQUB 2OJPA 3LH8A 5IJVA 3GZAA 3OHXC 3PQYE 2JALA 3AQUA 3M4HA 4XWOC 4KK9D 2VP8A 1O9WA 1E9YB 3IVTA 3MCKB 2VUKA 1UR9A 3STPA 3CMOH 3ZDXE 3PTDA 1X9UA 5GJNA 1FORH 1QW9A 4X6DB 5CU9A 5GS1B 2N59A 3NEOA 5FV1L 4YHYC 2EUZA 1IM3B 1HKLL 1Q0XL 2YD9A 4UCFA 1HJQA 4TNVF 2QGBA 1P5BA 1PLGL 2DSUA 4BRVA 4KKBD 4MMWA 3GHEL 1OAKL 3W1XA 1DSWA 3U9PL 3FS9A 3S88L 4Y7OC 1B3YA 1N68A 2DVUA 2NY6D 2YPVA 4KY1H 1EJUC 2FZ8A 4IU3B 5KTEH 1S78D 4P9MH 4PCYA 4UINH 1FXPA 1WDSA 1NDGB 3CZSA 4RCXA 1KYOK 1U8IB 2LU7A 5FHAL 1OF6A 1J5CA 1J0JA 3DECA 3AXXA 1I1RA 4NVTA 2JJUA 2NR6D 3BWSA 3PWJA 5BXSA 2XWBA 3E3QE 1BF6A 4JTRA 3O3EB 5DJZA 1MQ8A 3LHPH 4P5MB 1QNIA 5KANI 2ZCKH 4NEHB 1RAKA 3IYLW 4PS7A 4LAQH 2A3EA 1HCZA 1C90A 1NGXA 4IL2A 3RZCD 4OLEA 5BJTA 4EI5A 1SLXA 1T04A 1A5FL 3UAJD 4CQCA 3MCLH 1OCWL 1DQLH 1OD9A 3DGDA 5IK3A 3AO0A 4KX9A 3PUUA 1RH9A 4GKOA 3QUKB 4KRLB 4NO5B 4QP0A 1ONWA 1Z7AA 1L6PA 2XN0A 4HQQH 4U6XA 1MCIA 2BC4A 1OG0A 5HWNA 1RPXA 1T5XB 4J6IA 4W70A 2GGHA 5H35A 2ICWJ 3HHMA 2NWRA 4ZMTA 2ZADA 1I8LA 1ZE3H 1B5TA 3KLKA 3GAYA 5AYYA 3RCNA 1MCLA 2ITDB 3E2HC 4R8WL 3HW7A 1ZCRA 4QXVA 4XN2A 5HQEA 4PJGE 4QTFA 1A25A 2AMUA 4F2UA 1T0NB 1J8VA 1DQUA 4GQQA 3QQ0A 2KT6A 2IO5A 1T3FA 2O55A 1NCHA 4Y2OB 2WBJC 4IQEA 3S8HA 1E8XA 2NX5A 3DSFL 2Y07L 3ZLQC 3GDRA 1R3SA 2BSSA 1EL3A 1EHLL 1P48A 5CG7A 5KVGH 1KT2A 3UNTA 2W61A 2YA2A 4D6HA 5HPOA 3FT2B 4DWSB 4H2HA 4IWWA 3IMVA 4DJEA 3U2ZA 3FB7A 2PCPB 1QEWB 3SDAB 1MHEB 2DTMH 4ODXB 2E28A 3OC5A 4ONOA 4UXDA 3CFKA 1T1XA 3DFTA 3QYCA 4BFRA 3RAJH 2WSQA 5FCSH 5DRIA 1VGAA 2D23A 2CBOA 5CJOH 4D8PA 4R9HA 1EZWA 4DN1A 1JZ8A 4MB1A 4BQ3A 4ZDHB 2O7SA 4M24A 5EFDA 4IDJL 5G1YA 4NGHH 4KJWC 4RISH 4OU1A 1TKWB 3NACH 3M1OA 4ZUWB 3A4AA 2H32H 3DTXB 4DP0X 2WWCA 2GY7B 3KOFA 1UKOA 1RY7B 4HSQA 1G7UA 4XNXL 2BO0A 6ENLA 3GH4A 4RV8A 1ZNNA 1RZGA 1JHKH 3FFDB 3ZTNL 4L8CB 3ULVC 2Q7YB 1E2VA 3NGBC 5HJXA 3WLLA 5F7DB 1PYWB 4QHLB 5AB1A 4LIQL 3MJWA 2J6XA 3ESPA 5HDWA 2J77A 4LV9A 2VMEA 4C59B 2XG9A 2XACC 4NQCA 1SO6A 4N0FB 1P0DA 4L23A 2E9BA 2NTSP 2EJ1A 2FH8A 4OSUL 1G0CA 1E6OH 4MB4A 2I5YL 1SW0A 3DEQA 4QG9A 4G56A 4WV1A 3AHXA 1A3LL 1NWTA 3QWRA 3WK3A 4U6HB 1FP5A 4WW2F 1BVNP 4CL7A 3MRNB 3WH9A 1TJMA 1HZYA 4P5TA 3TJHD 4LCSA 2F54B 3V35A 4HCFA 4XMUA 2UZXA 3BT2L 5AOJA 3IFNL 1TJ0A 3WBWA 3VFPA 5AOKA 3PR2A 2R4RL 1QR4A 1BTMA 2VQ1A 1EQWA 4NRRA 5D70L 4S0HA 1AMKA 1RZJC 3H56A 3EF7A 1T0OA 2MPVA 4JREB 4NN5B 4O51B 2LU3A 4D0DA 4BQ5A 3FYOA 1WWAX 4OZ4B 2CJ3A 25C8L 4WCYL 2J8GA 2AV1A 2GJ6D 5E95B 3QGAC 1P9MC 1AY1H 4LLUA 5B22A 2OOFA 2XSXA 3F5LA 4XCYA 4IIFA 5EOCH 2WOQA 5AVRB 1L6YA 3R79A 1VADB 2H6RA 4N0FA 2A7PA 2A6IA 1KCKA 2VO5A 4NF7A 3IDJA 4NKIH 1AGEA 2FMOA 3Q2LA 4ZTPH 5DXXA 3WFZA 3ULVL 5DVLA 2JKNA 3ARFB 5CEXA 2AKMA 5DFWH 1SZRA 1T21B 2BWIA 2WBJB 3MAWA 5KN5B 2FDMA 3L3DA 3MGOB 5HMSA 2FEDD 5KANG 1L6GA 5DHXB 4DO7A 5GRVL 5I6XC 3KW8A 2P88A 2XDFA 4K6AA 2FGWL 1KFCA 2WQSA 3LTYA 2VSMB 5IV2A 1N6QL 4FIRA 2E1WA 2NX5B 4G2AA 3BMVA 1VGEL 1MXSA 2XNAB 1BQCA 1MMFA 3E0GA 1KTRL 3TPUB 1E2WA 4PJEA 1GYLA 2CZEA 4NJIA 2OTPA 3GB7B 1VBGA 2UWEA 2XG5B 2QCDB 3GVRA 4RW5A 1IF2A 5JNYB 1LP9B 3QCTL 4RH4A 1TB3A 1UQSB 3DUUA 4RVBA 1PAMA 1UIOA 3QJFB 1Q9LA 5BS0B 2FDSA 4NZ4A 4AD2A 4B7LA 2C4XA 35C8L 3UYOD 1H5BA 2Z31B 4WO0A 1U3HD 1HH9A 5DJDA 1LE9B 2EUXA 3H54A 2VRJA 1J88A 4XD6A 4XO3A 4BF7A 1B0RB 3MLVH 1EEYA 1A5BA 5AOZA 1JNEA 3OX8B 1Z3NA 4UFKA 5D09A 1IFHH 7PTDA 1ADOA 3VFLA 3UTOA 1DJYA 5DD0H 3L08A 5KVFL 2IALB 2CZDA 4D6JA 2JLLA 5IOBA 3OD3A 4UUJA 1VPOH 2PPCA 3LS5L 2I85A 2VDOB 3NSFA 4M1CC 4PUBL 3I3EA 4XBEH 2REQA 5H6HA 2OOGA 1S5WA 1CZ8H 5I0XA 3Q6GL 3GUWA 2P5WB 4WX2A 3EDFA 5D8JH 2YW4A 1NOAA 4KESA 4ADUA 3KAAA 2BIOA 4X8CA 3G1AA 2BMKB 4XPAL 1EOKA 4Q7IA 2EC9U 1E6OL 1XBRA 1QFUL 2V2TB 1SN2A 4X8JA 3LM3A 2VSDA 4B5SA 1YEFH 4PG2C 4AEFA 4AX3A 5JHLA 3AWOA 1JWMB 2CHNA 1IC1A 1LK3H 3ASOB 4P4KD 4X2UA 3SE8H 1ODZA 3SPGA 2X09A 1HZHL 4O2FB 4RDQG 3BESR 5T33H 4F7PA 1WXYA 3V5CA 2GY5A 1O6SB 5E1QA 2CITA 5E6UB 2V6AA 3VW3H 1M6OA 1OGTA 3NFNB 3VVVA 2B7NA 4TVDA 3JW7A 1MNNA 3PP4L 1OL0A 5IVXE 4X4ME 5I1IH 1XG3A 3D25A 4B5WA 2N7SA 4RLIA 2G37A 4M62L 3ATAA 2E6FA 1BVKA 2RIKA 4W4NA 1F5ZA 5MERB 1RK1B 1PTAA 2XCMC 3RIFF 5FESA 3GGWA 5FX3A 4YHKL 4PB0H 2JB6A 4QRRE 3VNLA 3FN0H 3QFGA 5ICZA 5FCUL 3DX9B 2Y06L 4HWEL 4L0YA 1GGCL 2J7EA 3CZKA 1FQ9C 3FNKA 4EQ3A 1XLLA 3IM1A 2WYSA 1RUQL 2O6DA 3FQTB 5I0YA 4MJMA 2PB1A 1H63A 2INZA 4NASA 4AIBA 1KRBC 3V4UH 3VJ6B 2RALA 4ZPTB 3H85A 1XSJA 4X4YB 4NNXA 4M1RA 3UTPE 1JPDX 5DBTA 3L7FA 3I6EA 4K2UH 1A1MB 3NEHA 1HS6A 4NL1A 3CXFA 4X6CE 2E09A 4GSDL 4ALAH 5CC5A 1RUAH 4DCQA 1W8OA 3AALA 3NPWA 4Q4OA 1MHPH 4WWKD 5HHOD 1Z9LA 4K3ZA 3W3OA 5C0AD 1LBLA 4O50A 3WLHA 3MX0A 3KBMA 1W0VB 1S7RB 2WO2B 3PPHA 2UWEB 2YPIA 1UC5A 1ZHAA 2Y4SA 3QPEA 1NCDL 2NY1B 3H2WA 1FI8C 2CIIB 3OQRA 4CBZA 5A1AA 1P1ZB 3U7YH 5DUPL 1T0MA 1S2VA 3FDGA 3OA3A 3OA5A 5GGRA 4IIGA 3CN2A 1AZVA 1OAUH 4PLNC 2DKSA 1YAZA 5HHOA 3F5JA 3N3MA 2X4NB 2NY4C 3BLLA 3MGTB 4BK8A 4FG2A 5FM4A 5IFJA 4D6EA 3SDCB 4LUSB 1RLBA 4Z7VB 2XBZA 5FYJU 3GMOA 3R7RA 1KM4A 4I85A 2P24B 3W3BA 3LNEA 4JN7A 1FYTE 5KZ6A 3QUMH 4QO1A 4YVUA 2G95A 5ABGA 5GNYA 4U3CA 3HC0B 3DFQA 5LDSA 1U33A 1H4PA 3ZOAA 1IBHA 4K9EL 5F7LB 1YEIL 1AZZC 2VZVA 3I9AA 3VGGA 2PZ0A 2XSAA 3LSBA 4AU0A 3HS0B 2ROXA 3WNOA 2W63A 4XPFH 1MVFA 4XVJH 1D3GA 1QPNA 2C1OA 2HLAA 5TF0A 2Z6FA 3NOYA 2XFXA 1YEJH 3TX9A 3V4VH 3TYEA 3TZVB 1SEQL 4UTKA 4GKLA 1U58A 2GEQA 1CICB 4XHJD 4NPYB 1GJIA 5CILH 1B4EA 2JQXA 3FNDA 2A4CA 4Z0SA 3C2YA 4YSDA 3SM0A 2R4RH 1BZ9A 2GFBA 1SVDA 1XXXA 1LDSA 4PBVC 5D1XD 1O5QA 1CTNA 2J1WA 3QEUB 2FWOA 5L6YH 1FAIL 1IM9B 4F9LA 3MYJA 2WMGA 2YL5A 3IV3A 4WEVX 5TIMA 2HWZL 4YOKA 5FYLD 4AZ7A 1I1CA 1YEDA 3X3FL 4Q9QL 3VU1A 3M8OH 2AP2A 4Q9QH 4IFKA 4MXWH 2FB2A 4LSPH 3W1LA 3DOPA 1QMLA 9CGTA 4HUCA 1UCTA 3UJFA 4U1KB 2P46B 4BFKA 1Z6JT 5BU6A 5LNWA 5C9ZA 3CHOA 1JGDB 4GO8A 5EF1A 2DUAA 1X4XA 1NSNL 4FFWD 2HEJA 4EWJA