5BRQA

Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea)
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
555
structure length
555
Chain Sequence
NPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDNGYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKEAASGKENLYRDFYIWKDMKPNGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYEMMHFWFEKGIDGFRLDVINVISKDQRFPDDDEGDGRRFYTDGPRVHEFLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNFHHLKADYPNGEKWALADFDFLKLKKILSEWQTEMNKGGGWNALFWCNHDQPRIVSRYGDDGKYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRILKEAGKPEAEIIEILKAKSRDNSRTPVQWNGEENAGFTAGTPWIPVPDNYKEINAEEALNDPDSIFYHYKKLNELRKEFDIITTGDYQLILEDDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIEGYDAKVLISNDTDLPESFKRFTVKPYQSIVYHLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycoside Hydrolase Family 13
publication title Bacillus licheniformis trehalose-6-phosphate hydrolase structures suggest keys to substrate specificity
pubmed doi rcsb
source organism Bacillus licheniformis atcc 14580 = dsm 13
molecule tags Hydrolase
total genus 209
structure length 555
sequence length 555
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.93: Alpha,alpha-phosphotrehalase.
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5brqA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5brqA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 5brqA02
3ARVA 2WW5A 3CZEA 3ZR5A 5BXRA 1E6QM 3WD4A 3ECQA 4TUFA 1MYRA 4CKQA 1W1VA 1HNYA 1VBUA 1CWYA 1QI4A 3HG3A 1UR2A 1UA7A 1KR0A 3GXMA 1WKYA 1KQYA 4GZEA 3VIGA 2CHNA 2C8NA 3TTOA 4ZE5A 3NSNA 3BUPA 3CO4A 1D7FA 4JL1A 4QLKA 2YBTA 1XHGA 2D23A 3DYOA 3WQ8A 1G0CA 1ISZA 1F4AA 4TTGA 1UH3A 4WSJA 1BG4A 1QNRA 4UQBA 1OSEA 3AHZA 3RJYA 5BROA 2W5FA 3VIPA 3W24A 2WWCA 2X8RA 1K6AA 2VQTA 4AD0A 1JZ2A 3S5YA 5CJ5A 4X0VA 2EABA 3WUFA 4D6EA 2D0GA 2XN0A 1JAKA 1CGUA 1CXLA 2BV9A 4PUDA 2ZXDA 1QWNA 3WDHA 2YIHA 1UA3A 1FA2A 1C8XA 3VSUA 3GM8A 5GPRA 1B3XA 2FE0A 1GOKA 2G3NA 4ML4A 3SCSA 5I0DA 4ACYA 2WHMA 1TMQA 4D1IA 2PWFA 4JCLA 5C8BB 3ARQA 2WSPA 3W0KA 3D3AA 4OOZA 2EO7A 4QAWA 2IXVA 2FYVA 1W9DM 4M81A 1M53A 4Z2GA 1FP8A 1J0KA 4MB4A 2YFNA 4WIWA 3E1F1 3VGBA 3T08A 2Y5EA 3BSGA 5HXMA 4Z2IA 3VOCA 2CYGA 1LL7A 1WDQA 2G3IA 1HL9A 1UWIA 2WSKA 3ARWA 3GXNA 3LRMA 1JI2A 5BXSA 2QMJA 3SCTA 2RGLA 3K46A 5GNYA 2F7PA 1VF8A 1B3WA 1HIZA 4CGTA 4UCFA 2JE8A 4TXEA 2FHBA 3VSTA 3AYRA 4D6HA 4Z2LA 1BYBA 3WD1A 2WNWA 3KLLA 4BQ2A 1KXTA 1XSJA 3SCPA 2FHCA 1H11A 4P8WA 4AZHA 4UQ9A 4QLLA 3MSGA 3WY2A 3VDBA 3DECA 3LXCA 4ATDA 7TAAA 3AYSA 4CCEA 1W9UA 4URIA 1ISVA 2DT0A 4JHOA 4M1RA 2VL4A 1HKJA 1ZU8A 3EMCA 4E4PA 2ZUMA 3GXTA 2XJ7A 2J7CA 1OT2A 5I24A 3MMWA 1CBGA 1K9TA 1NWRA 3AIEA 1G01A 3QHMA 4X9YA 1UD6A 2A3CA 2Q8XA 2W4XA 4PMYA 1AMYA 5ABFA 2E9MA 3WD0A 2E40A 2J7BA 4HMDA 2F61A 5CLTA 4MJ4A 3AJ7A 1UR1A 4FNTA 3CZ8A 1TE1A 4QCEA 1LJYA 2ZUUA 1J10A 1Q6FA 3L4TA 3OG2A 1M01A 1HP4A 2PWEA 3VMPA 4UZSA 4BQ3A 1FH7A 2WVTA 2CESA 4AMCA 1PX3A 2DGAA 2VZOA 4XB3A 3SUTA 1UD2A 1Q6GA 1V6UA 4DO6A 2CBUA 1HWWA 2YDRA 3CUGA 3HJEA 4LYRA 2G3JA 5E09A 3A6OA 4ZXLA 3WMCA 5A8QA 1GJWA 1OB0A 1C7TA 3ZM8A 3WNNA 2HVMA 3BVVA 1WDPA 2D0FA 1W9PA 1C3FA 1E15A 2WKGA 4DM2A 4UFMA 2CKRA 3PN8A 1VAHA 1NQ6A 4BCEA 4LYPA 3FHQA 1J0YA 1VB9A 1J0ZA 3IK2A 3OGVA 4CD7A 1KTBA 3K8MA 3SUVA 3VD7A 2W63A 1JD7A 1VFOA 3W6MA 4AYSA 5AYBA 3TV8A 2XPKA 2QV4A 3DHUA 2XWEA 1CXHA 4U31A 2GK1A 3N04A 4MB5A 1CGXA 1BG9A 1EOKA 1L0PA 4NZFA 5E6ZA 4UOJA 3RMEA 3ALGA 1QI2A 2X2HA 4AD1A 3CTTA 1MQPA 2WMKA 1W1TA 1G1YA 1H2JA 3T2OA 1RPKA 3VKKA 7CGTA 4FNQA 4IPLA 3AHVA 2ZXQA 5A6SA 3MKKA 3WDIA 5F7UA 1EQPA 2PWDA 3CIVA 3NSMA 5CZKA 4H8VA 2WC3A 1CLXA 1BF2A 4F66A 2DT1A 2WMIB 2ZE0A 3L4UA 2ZICA 1DWGM 2ZUWA 1VBRA 4HPHA 4AZGA 3IJ8A 2OSXA 4OIFA 3H53A 5D8ZA 3A23A 3WH8A 1E6SM 1NOUA 1XYFA 1ZBKA 4U2YA 3WY3A 5I5RA 1JI1A 3W27A 2WLYA 1FH8A 1KTCA 3CZKA 4KRUA 1KCKA 4UFKA 1LQ0A 1TCMA 5D9MA 2WMHA 4U5KA 5DFAA 2VVSA 2XIIA 1XCXA 3WQ4A 2J79A 2YLAA 2X2YA 4NF7A 2E9BA 4B3KA 2CBIA 2ZX9A 4HOZA 1JIBA 1QNSA 2CITA 1WCGA 3WBEA 3O6AA 5CGMA 1MVYA 1R46A 2DSZA 3W82A 3KL0A 4LPCA 1XD0A 4GPNA 4P7QA 5I77A 1NARA 2XGBA 1E72M 2PB1A 1CPUA 2V3GA 4HOXA 3NDZA 1BGGA 1V6XA 3W25A 4FMVA 4W88A 4UFHA 3KZSA 4DO5A 2VMFA 3RPMA 3L2MA 2VRKA 1ZJBA 4YN5A 4UOQA 4GZJA 4NRSA 1QBBA 1KWKA 3WNLA 3NJ3A 1D3CA 4CN6A 3ZO9A 2PBOA 1ZJAA 1EHAA 3T0DA 4D72A 2XGIA 1X6LA 5HOSA 1E4LA 1EO5A 4JL2A 2ESCA 1QPKA 3GH4A 4A3HA 1UR4A 1H1NA 2WMFA 1UYQA 1ESWA 4MNJA 2PC8A 1GQLA 4FLQA 4HZ7A 2ZWZA 2XFRA 5CLWA 3UG3A 1Z32X 1XV8A 4DUXA 3PBGA 1W3HA 2XVNA 5ABHA 2BVTA 1BSIA 4QDMA 2WMIA 4V2XA 3ZJKA 3VM7A 4NI3A 4W5UA 2EPLX 1TQWA 5A8PA 1E0XA 1PX4A 1HP5A 3GNOA 2OWCA 2FH8A 4MTVA 4WKAA 3WNMA 4E8DA 3TOPA 4Q7NA 5BXPA 3B9AA 1E70M 5CPTA 5A6AA 1W3JA 5FKYA 2D3NA 3CMGA 2X2IA 1VRXA 3DDFA 5D9OA 1MFUA 1OWQA 3WD2A 2WC7A 1R86A 3T0BA 3CZSA 4UOZA 1H0IA 3ZSSA 2WMGA 2XHYA 4GXPA 3O9NA 3DHPA 3MANA 1OGGA 1JD9A 3RDKA 4CN1A 1DEDA 1C93A 1L8NA 3RM9A 1J18A 1QWUA 3OGRA 3AMLA 4NSBA 3AIRA 1DHKA 3QR3A 4P8UA 3S5ZA 3WUBA 1UD4A 2FGZA 1US3A 2CBVA 1SMDA 3NIYA 3GXPA 3GNRA 4D6JA 3WMBA 5IFTA 3CZNA 4TX8A 1UD3A 4CU6A 3WELA 1GOOA 1BQCA 1I75A 4FNUA 4WJXA 2DH2A 1CGVA 4B3LA 2WPGA 1HJWA 4J3WA 5LYRA 3VNYA 4AYGA 5I23A 1TQUA 3UERA 3BUIA 1GVIA 2VURA 2BY1A 2DT3A 1AQHA 3I3DA 3CZLA 1QI0A 2ZUVA 4W7WA 3SCVA 3VD9A 3QHNA 3DX4A 1Q6DA 4IPNB 1AQMA 1J9YA 3WN6A 1J0HA 3MV01 1H5VA 1IT0A 1WB0A 5LA2A 4OUEA 1S46A 4MNMA 3D51A 2F1AA 4Y7EA 2YKKA 3D5HA 3S6TA 1CDGA 2WZEA 4XX6A 1KFWA 2EPOA 4KMQA 3VD3A 1LL4A 1XSKA 4UZUA 1LL6A 3VDCA 2ZWYA 1U2YA 3KEHA 4QLJA 3UG4A 1NWTA 5A6KA 3CUHA 1GUVA 2J4GA 3VGHA 2Y2WA 1V0LA 2DT2A 5BXTA 1AVAA 2WZHA 1C91A 3CHDA 1R7OA 1OCQA 1VIWA 1PPIA 3BVXA 3PTMA 4AZ5A 3EJQA 2VZTA 3EMQA 2VCAA 3AHXA 1HJXA 2UY5A 1W1PA 4P8XA 1HKKA 2D0HA 3NSXA 3SCOA 3CLWA 3WL0A 5JIWA 4K68A 3BH4A 1HTYA 5A1AA 3M46A 4DWSD 4AZ6A 4MAVA 1J0JA 3WEOA 3CC1A 4ACZB 1XYZA 1JAEA 4AD4A 4S3JA 4U33A 2W66A 2VNCA 3MSDA 3BUDA 2O9RA 1OM0A 1FFQA 2YA2A 1W3LA 2CEQA 1G94A 2NT1A 1OBAA 4S3KA 4XZBA 2XVKA 3VIIA 3SCNA 2PI6A 2YL9A 2VZUA 4PTWA 2X1IA 1ITXA 3CUFA 2OWWA 1UQZA 3VU2A 3VGDA 2GJPA 1JGIA 1H4PA 1XD1A 4PMQA 3EDKA 3PHAA 3W38A 1BVZA 5E0CA 2XSAA 5M5DA 3KE0A 5HDRA 1CGTA 3SIMA 2VVNA 5CQ1A 1HJVA 5HPCA 3QHOA 3POHA 2DDXA 2YLLA 3AIQA 5ABFB 3N18A 2VZSA 3J7HA 2J75A 1CECA 2WVVB 4J3VA 1OGBA 4HU8A 1C8YA 4U3CA 3SCUA 2WMJA 3EDDA 2VR5A 4W87A 3GZAA 1E3ZA 2EEXA 2EQDA 1OT1A 2E8ZA 3JUGA 2F7RA 1V3HA 1B3ZA 5A6LA 3UR8A 1JZ3A 2J7GA 4ZENA 3EDEA 1X1NA 3HG5A 1JYXA 2CHOA 2OWXA 2WCAA 1VFMA 1GQJA 4PMZA 3ARZA 1NP2A 4D1JA 4W93A 3UESA 2VI0A 1V3KA 3AROA 3BCFA 3B8SA 4MDPA 2EPKX 1JL8A 4J3XA 1HN1A 2YBUA 4OBRA 1R33A 4OBSA 4UQEA 2B31A 4UFIA 1O7DC 4HA1A 4UTFA 2ZX6A 3WNPA 4GQQA 4AZBA 3IJ9A 3MUZ1 3BLBA 1NWSA 3M7SA 3VGFA 4ACZA 1BFNA 1H49A 4EAMA 1IV8A 2WXDM 3A4WA 4KRTA 3O2LA 3KWXA 4AEEA 1WPCA 4CD4A 5CGTA 1E6NA 2XN2A 4ZEPA 5A8OA 2J8FA 5E1QA 2GK1B 3AMKA 1CIUA 1EA9C 1QBAA 4RE4A 3KL3A 1G5AA 1E6PA 2JEQA 2QF8A 1QNPA 3K1DA 3II1A 2JIEA 4AC1X 1PBGA 1GORA 4DWSC 2EAEA 3MUY1 4UQAA 1TFVA 1E1FA 1VFUA 4EANA 2CNCA 3OLGA 4JFVA 1WE5A 3AI0A 1XH0A 4HU0A 4TX6A 5DMYA 4KH2A 1BVNP 2WVVA 2NSXA 5CXPA 5DT5A 4EKJA 3EDJA 5ECUA 1UWSA 5D9NA 4TTUA 3BMWA 4ZFMA 1BHGA 2ZUTA 2VC9A 5D9PA 4V28A 4DUVA 4FLRA 3WUEA 4QCFA 2VOTA 2WBGA 2E4TA 1SFSA 3ZR6A 8CGTA 3VGEA 3MV11 3D4YA 3AS3A 3MUIA 2XTKA 4HMEA 3L4XA 4JFSA 1CENA 1OIFA 2Y24A 3ARYA 1H09A 2OSWA 3VO0A 1TQTA 5A8MA 5DO8A 1GCYA 2HISA 3WDRA 2ZUSA 1B30A 1B1YA 4C7FA 3PZIA 1VENA 4WK9A 1CZ1A 3VIFA 2WM0A 3VIJA 3FY1A 2W91A 1JYWA 3KLKA 3A22A 1BPLB 4DWSB 3BVWA 1Q4NX 1V6YA 1CXEA 4TVCA 3AS2A 2DEPA 1CGYA 2VO5A 3BC9A 6CGTA 1UG6A 1YHTA 4P7LA 1OIMA 4N0RA 5CPQA 3G6MA 3WEMA 1KBBA 3K8LA 2FGLA 1HXKA 3L4ZA 1DWAM 3VD5A 4Z2JA 2UWFA 2J8GA 3BAYA 2YA1A 3EJTA 3IANA 3BVUA 2ZIDA 4CN4A 3RCNA 1UR9A 2ZOXA 1EDTA 1W9XA 1V3JA 3WNKA 1O7AA 3OBAA 3PZVA 1JXJA 3GH5A 4W85A 1SZNA 5IHSA 2X0YA 1MW1A 1PEZA 4FNRA 3ARTA 1KB3A 3BMVA 1VJZA 2QPSA 2QHAA 1ISYA 3NUKA 1BLIA 5GNZA 4GQRA 4ATWA 1KBKA 3GTNA 4CCCA 5JIPA 1UWRA 2VX4A 4ATLA 1C7SA 4J3UA 1R85A 1EO7A 3SCWA 4M56A 3AMGA 3VSVA 3ZQ9A 2D1ZA 5HPOA 2V3EA 4FF5A 4BQ5A 2WAGA 3CZGA 3THCA 2E9LA 1O6IA 1BGAA 4NXKA 3RIKA 4AIOA 4LXFA 1LWJA 1GNXA 5FD0A 1HJUA 1GOQA 4CD8A 4OKDA 1E43A 4PCTA 5D4YA 2VRQA 4NXSA 1E56A 3MUAA 5ABEA 2JEPA 4GO8A 2Y8VA 4D6CA 1VEOA 4XUYA 3EBVA 2X2JA 3SEPA 2V38A 4J3TA 1JZ5A 4W86A 4DO4A 1E55A 2X05A 3SUUA 5E6YA 1HJQA 3PZTA 1B9ZA 1TA3A 3T2QA 4AD5A 5E9AA 1OGSA 1GQIA 1B31A 4DWSA 2JALA 3OA5A 1KQZA 1PJ9A 2ALWA 3EYPA 4B9YA 2JF7A 3ZJ6A 2Z1KA 3ARRA 3WQ5A 3RO8A 2OSYA 3WF4A 2XFYA 2GJRA 3L2LA 1R47A 1JDCA 1KXVA 3AXXA 1HXJA 3D50A 3GNPA 1V6VA 1R34A 4MNLA 1R87A 2VCCA 4Q22A 2VTFA 3EJRA 3LX9A 3OLIA 1MQQA 3SUSA 2BXZA 4CU7A 2E3ZA 1NP0A 3SUWA 1ISXA 2A3EA 1SMAA 5M17A 3AXHA 2ZX8A 5EFDA 4JFTA 1P6WA 3ARXA 1H3GA 1MW2A 3AIVA 4AD3A 3TP4A 4W8LA 1E0VA 3OB8A 1X6NA 3VTRA 1VEMA 1LWHA 1NH6A 3GBDA 1EIBA 1EOMA 1QVBA 2VZVA 3LPGA 5A2BA 6TAAA 4MB1A 5CG0A 2F8QA 3ZT6A 4AMWA 4FNSA 2GDUA 4AISA 2WBKA 3VPLA 3ZJ8A 4J3SA 3HN3A 4HP5A 1QNOA 2YL5A 5KEZA 4CU8A 2OW6A 1E1EA 1V0KA 4MADA 1EH9A 2D22A 3CBWA 4W84A 8A3HA 5M3WA 5AYIA 3WQWA 2EXOA 2D20A 4L4OA 1DWFM 2VT0A 3WL1A 4GO9A 1ZBCA 2A3AA 3BVTA 3A4XA 5A95A 1UZ1A 1KXQA 3FW6A 4W5ZA 1UKSA 3WF2A 2JIWA 3VM5A 2J7EA 5A94A 2BHYA 4PTXA 3W26A 4AY1A 1ZBVA 4HA3A 4P8VA 4PBGA 1HVQA 1PAMA 3NYDA 1ZB5A 2VJXA 1QI3A 3AHYA 2QLYA 4PTMA 5I2UA 1WO2A 3NDYA 1CNVA 4P7NA 3WFZA 4UFJA 4A4AA 1E4MM 5BWFA 3TTSA 1V6WA 2BY2A 4PMDA 3AZRA 3CHCA 1NM9A 3WUGA 2XVPA 3FHAA 3ARPA 1KR1A 2J7DA 3AMDA 1GQKA 3F4VA 4YPJA 5I78A 1R75A 2Z1SA 1K9EA 1ZS2A 4LGXA 3BUQA 2OYMA 2WKLA 2X0HA 4Z2HA 9CGTA 1VEPA 2J47A 1MXGA 2J62A 4B15A 3UCQA 1CXKA 3WDQA 5IHRA 4WF7A 3VILA 3F5LA 5DT7A 1V02E 3ARUA 1V3MA 5AC5A 3AICA 2AMGA 4PYSA 3ALFA 2XSBA 3N9KA 1MQRA 1VJSA 2J25A 4JHZA 3AIWA 1FH9A 5A6MA 1I1WA 2BY0A 1XH1A 2YOCA 2DSUA 2YDQA 4CUCA 3WDPP 5AY7A 1M04A 2XG9A 3RJXA 2C0HA 3W37A 5FL1A 1EDGA 2XUCA 3LXAA 3W81A 4BF7A 4W7UA 3PZUA 3A5VA 2W61A 2XVGA 4GI9A 1E3XA 5BYWA 5ABGA 1GOMA 4DUWA 1ISWA 2CPUA 3QGVA 2W67A 1M03A 2ZUNA 3CUIA 3F5KA 3A3HA 3KL5A 1UHVA 3WSUA 2V5CA 1UKQA 3OIHA 1W3KA 3VIHA 5D8WA 2E0PA 4WKHA 2GDVA 3W29A 4GI8A 1KGWA 2EBNA 2GUYA 1CXFA 3ZT7A 1QI5A 3WY4A 1E6ZA 4AZCB 4OZOA 4PTVA 4U5IA 1HT6A 4RE3A 1KGXA 4NX0A 1LG1A 3ZIZA 4BQ4A 4OOUA 2EPNA 3RM4A 2C7FA 2BS9A 2Y8KA 3WH6A 2PF0A 1WZMA 3APGA 5A6JA 4X0NA 2CXGA 1J0IA 4HPGA 1JZ6A 1E71M 1E6RA 4M80A 4AWEA 3GDBA 3OLEA 4AMXA 1FP9A 3PZOA 4JAWA 3WKZA 4LX4A 3QOMA 2GJXB 5CSUA 3BAXA 1J11A 2A3HA 2G8ZA 1V03A 3WF0A 4FLOA 4QP0A 4W8BA 1PS3A 3U5YA 1W32A 4LQ1A 3OZOA 2CETA 3BAWA 2OLHA 2WZIA 3TTYA 1HKIA 3EJUA 1UOKA 1JG9A 4GIAA 4P7OA 3AQUA 1E9LA 1UWUA 2YL6A 2YA0A 1QHZA 4ZE4A 4D6FA 1TQVA 2F7OA 4R5EA 1QHPA 2ZX5A 4PEEA 4M29A 4RE2A 1OD0A 4D6GA 3EDFA 5E0FA 1GW1A 4JZ5A 1OINA 4PMUA 1UWQA 1HJSA 2V3FA 3GYCA 3VMOA 1E6XM 1K9FA 1XSIA 3IAPA 3WH5A 4HZ8A 3ZSTA 2WCSA 4DM1A 1CYGA 2CERA 3S2CA 3VIKA 2AAAA 3DC0A 2WHLA 3CPUA 1E4NA 4AXNA 4HMCA 3N12A 3N15A 5A8NA 3FAWA 2O9TA 1W9VA 4AZCA 1F4HA 1AQ0A 2BY3A 1Q6EA 3BGAA 3W6LA 4PMVA 1W9BM 1Q6CA 3CH9A 1M7XA 2G4FA 5FIPA 1US2A 1TUXA 4J27A 4AD2A 5M03A 4KGJA 3AMCA 4D6DA 4UNIA 1UZ4A 1U30A 3HMCA 1FHDA 3AISA 3I3BA 1CTNA 3THDA 4PMOA 1QX1A 2CIPA 1MW0A 3PZMA 2BHZA 4TVUA 1W2VA 1WNOA 3AZTA 5I6SA 2O92A 1RP8A 1MXDA 4MAZA 3QOKA 1GONA 5A69A 3D4ZA 1JXKA 3VNZA 3CUJA 5FOOA 2ZX7A 2GJXA 1GJUA 2VX6A 4A3YA 4JKMA 1WP6A 3VX1A 2VX5A 3BXWA 4U2ZA 3OLDA 3RILA 2E8YA 4U3AA 1N82A 3N1AA 3K8KA 5A6BD 4JFUA 4UQDA 1D2KA 4H7VA 4CVWA 1EXPA 5LA0A 3RM8A 1YQ2A 2W62A 1DP0A 3PZQA 3DX0A 1E5JA 3UG5A 4XV0A 5IFPA 1C8QA 2DQXA 2JFEX 4M24A 1JF5A 2IGTA 2MANA 2FDMA 1E40A 3WFLA 1ZL1A 1C92A 4J7RA 4EK7A 3POCA 3AOFA 3AIBA 3EJSA 1W1YA 2DSKA 1JYVA 1ECEA 1UR0A 1WDRA 1EHNA 3FNDA 1PZ3A 1R8LA 1DWJM 2XWDA 5E70A 3CHEA 2YL8A 4N42A 1B90A 3H54A 2XM2A 1HF6A 3G6LA 2D3LA 3D52A 2XYLA 3U7VA 6A3HA 3WEZA 4F9JA 3BAKA 4GINA 3GXDA 4HTYA 1J12A 1WZLA 1UWTA 3FXYA 3AIUA 3HU7A 4WKFA 1XH2A 5JBDA 3MMUA 2FH6A 3T0AA 4OJYA 2VR4A 1CGWA 4CD5A 5FCZA 1TA3B 1B3VA 3VIOA 4PSPA 3HZ3A 2IUZA 1BAGA 1RD6A 3WH9A 1XGZA 3L4YA 1CEOA 2BXYA 5AC4A 1JZ4A 3GXIA 1UQYA 1KXHA 3DYMA 1T0OA 2WCGA 2EACA 2YDSA 1QNQA 3BLKA 3A4AA 2J77A 3U57A 4CD6A 5EMYA 3B9DA 3MI6A 3B9EA 3LXBA 4M8UA 1JZ7A 1UD5A 1SR0A 2O9OA 3MS8A 5FL0A 2WANA 3HG4A 4H04A 4JKLA 4MB3A 4E2OA 5DEZA 4JFWA 3EMZA 2WK2A 2VQUA 1ITCA 4NZCA 1K9DA 3BAJA 2WYSA 3F5JA 4JIEA 2YFOA 1TVNA 1EQCA 1MW3A 1V0MA 4W8AA 4FLSA 3PZ9A 4MDOA 4Z2KA 1JFHA 1FFRA 4R27A 2NT0A 3W28A 3AS0A 1IZKA 2BHUA 3BCDA 4IUGA 4F79A 5A3HA 4HOWA 2V3DA 3U7BA 3TONA 4AEFA 4BZYA 1LLOA 1B2YA 1MWOA 3TA9A 3VIMA 3ZJ7A 1BYCA 1WZKA 3W53A 2BVYA 1ODUA 2Y4SA 2XFFA 3PTQA 3SCRA 1QHOA 5A2AA 4QFUA 2VUYA 1A3HA 3ZMRA 1FHLA 2WLZA 1E0WA 1GZJA 3AS1A 2GVYA 2PWHA 4FK9A 4YHEA 4B16A 1BYDA 1XC6A 1UASA 4PMNA 2BVDA 4V27A 4UR9A 4GKLA 3WY1A 2F18A 3CMJA 4GZIA 4XZWA 1JNEA 3N17A 1HVXA 3BAIA 4F9DA 1E5NA 1V08A 3WIJA 1TG7A 3VX0A 4PSRA 4UQCA 3ARSA 1E4IA 4ZXOA 2PBGA 2O9PA 1JFXA 4OGZA 3WH7A 3HG2A 1R7AA 1KWGA 3L4VA 1WAWA 2TAAA 3WBAA 5GNXA 2FHFA 1RH9A 1WZAA 3ZOAA 4D71A 1TZ7A 3BLPX 2D24A 4BA0A 1V3IA 3WF3A 1G9HA 1HL8A 4WSKA 4M82A 2DIEA 3VDHA 1OD8A 3A47A 3OZPA 3TTQA 3VVGA 1GOIA 1UUQA 1GPFA 1NOWA 4JCMA 1WDSA 5HBFA 1EDQA 1TVPA 3MMDA 1SYTA 3AHTA 1UKTA 3UEQA 2IXUA 4NRRA 2F1BA 4TVDA 2G41A 4H8HA 2XM1A 1I1XA 2WB5A 3CV5A 3LRLA 1U33A 2BNJA 5KZ6A 2EPMX 3AZSA 3K4AA 3LPFA 1MFVA 3PZGA 1V3LA 2VCBA 3VGGA 1GOWA 2G3MA 3DX3A 4AZIA 2F7QA 5EB8A 1UKPA 4LYQA 4PMRA 3SCQA 3DX2A 4GI6A 4KWUA 2JF6A 5BRPA 2RGMA 1DWHM 1V0NA 1QW8A 5GQBA 3LMYA 3A24A 1ODZA 4BS0A 2WWDA 3VUPA 1HKMA 3SURA 3H55A 2OW7A 1UH4A 1PIFA 4H8UA 1H0GA 1TQSA 1B0IA 1PZ2A 2J7FA 3LRKA 3IJ7A 3DYPA 4B9ZA 3IAQA 4W89A 2XVLA 5DF0A 5I79A 1A47A 1GVYA 2WVSA 1VFFA 3U5UA 3FAXA 3GXFA 2CKSA 4HZ6A 3UR7A 5LA1A 3CHFA 1KGUA 4PCSA 3VINA 4AIUA 3DX1A 1UD8A 2NW0A 3VDAA 4CVUA 3T09A 1JDAA 7A3HA 1EGZA 5I3DA 1W91A 4MNKA 2CCRA 4PMXA 2DPEA 5A2CA 2W92A 4HA4A 1QOXA 1BTCA 3EJPA 2DH3A 2UY4A 3WQ6A 1CXIA 1TR1A 3I3EA 3UETA 4J28A 1H41A 4H41A 2UY3A 3WD3A 4F8XA 1HX0A 4PRWA 1FOBA 4C7DA 2A3BA 3AXIA 5A6BA 2OYLA 3FN9A 4E8CA 2GFTA 2QPUA 1JNDA 2EJ1A 2DSVA 3BSHA 1XRVA 1UKOA 1UR8A 1DWIM 1XCWA 5BRQA 2X09A 1CLVA 2J78A 4MPKA 4PUEA 1LG2A 2D2OA 2V5DA 1JZ8A 5JUVA 3K4DA 5IDIA 2WHKA 5CSYA 2DIJA 3M07A 4UFLA 3VMNA 3N13A 1JDDA 5C71A 2WHJA 1IZJA 4P7RA 4MJ2A 2D73A 3LPOA 5JBFA 1V02A 4C7GA 3GBEA 3BUBA 3CZJA 2J74A 1J01A 2PWGA 3PZNA 5JBEA 3MO4A 2ZXAA 2AOSA 1DTUA 2VX7A 4NZJA 3WDJA 4YHGA 4TOQA 1W2PA 1C90A 2CBJA 1NOFA 4JKKA 1Y7VA 5C70A 3WF1A 4D6IA 3DDGA 4L4PA 4W7VA 1GHRA 2WC4A 2J7HA 3AFBA 4WLCA 5EFFA 3T2PA 4FNPA 1E73M 1RP9A 3WENA 3WQVA 2YJQA 1UH2A 5IXEA 3PTKA 1KCLA 3WMSA 3VD4A 2ZXBA 2F2HA 1PX8A 4AW7A 2OYKA 4KGLA 3M6DA 3N11A 1BYAA 5HNNA 2GSJA 4CCDA 1GHSA 2EADA 5TD4A 4IISA 2WVUA 1JYNA 2VRJA 1JF6A 2UY2A 4AIEA 5BCAA 4AZ7A 3MU7A 5EBAA 3ZT5A 1LF1A 1ZBWA 1NWUA 3WNOA 3CGTA 3LPPA 2XN1A 4EE9A 3W4RA 3L4WA 5CPSA 3A21A 4PN2A 2XIBA 3GH7A 3IGUA 3NCOA 2DSWA 2BFGA 2QMKA 1B3YA 1PIGA 4IM4A 4RL3A 3OGSA 1QW9A 4H2CA
chains in the Genus database with same CATH superfamily
1E8WA 3P0YH 2WW5A 1NCDH 3C6LD 1F1DA 4MY9A 4NHCH 3VFCA 3WJSA 1VHCA 1LMKA 4CKVX 3P7YA 4OGYH 2QPXA 5E03A 4KXDA 4TLSA 4L1WA 4NZUH 4LLUB 3EGXA 3GXMA 2IWFA 4GZEA 1GCFA 4Q2ZB 3HOGA 1H3TA 4MGXA 1B4KA 4LLDB 3CQHA 5D02A 1QRKA 3QDJA 1GW6A 1F4YL 1JAKA 4ZSOA 4NUQA 3CV7A 1IT9L 3R4RA 5IWLC 1HYSC 1C8XA 4BJHA 4MHHI 1YNPA 1CT5A 2FCBA 5BV7B 4OOZA 2EO7A 3P3UA 2EEAA 4E9YA 4DQAA 2ICCA 4MB4A 5C97A 4ZGYA 3VGBA 3T08A 2YMTA 4PWHA 3R94A 1AI1L 4FZ8H 1EUUA 1H15B 1FY6A 4NN6C 5B7YA 2ZOLA 3SKJH 4IUOA 1K8XA 3ROLB 3GIVA 2J8TA 3HGJA 3J2PA 5DHXB 2HTKD 3EOAA 3WQDA 2RGLA 1XFPA 1IIIA 4WUKL 2F7PA 2HN7A 5AYQA 4JGMA 2I85A 5H94A 2LU3A 3ZTEA 1U8MA 3LRSA 3N3TA 1RK0A 1DOSA 3MSGA 3SDXB 4LCWA 4DBWA 3OJVC 3V0EA 2I17A 2WZMA 4URIA 4LASL 1JGVL 4ORMA 2PP3A 4OZGA 3GXTA 2XJ7A 2AQNA 2Y36H 3B8YA 4HMDA 4OZIB 5HGDA 1UWFA 3QJHB 4QQUA 5G1YA 5DC0A 4A2EA 4XXWA 1J10A 4REQB 4B0MB 3L4TA 5IHBA 1HSAB 3LZFL 1FWIC 5T9BG 3OVPA 2E7DA 3HQNA 3TEYA 5BOEA 5B22A 3UJJL 4WSGA 3HFML 5D1XD 3W07A 1P84K 4OD3L 4ODWB 4XOCA 4G8GE 1JULA 5AVNA 5C9WA 4ZXLA 4US6A 4AQ8C 1JCNA 2JTYA 2F8VA 5CHNA 5HHQA 4YXGA 2HVMA 3FJNA 3IRDA 4LB3A 2HZGA 3RX7A 1IGTA 3OG6B 1WG3A 5EBWB 3CH1B 3IJ6A 1SFHA 5C0DA 2WJ5A 4JTKA 3RPIB 4IRJD 2I9UA 1CGXA 3NTCL 4K55A 3H2OA 3ZRFC 5EA0L 4HIBA 1KYAA 2XWBB 1YLVA 1MCOL 5JPNC 3CX5J 4NIKB 3OHXA 1GOGA 5CJNA 2MOQA 3O0LA 4MNQA 3AHVA 2G30A 3PHQB 3E2SA 4AVOA 3GDMA 2FPTA 3M0VA 3QA3A 3IGAA 1OAKH 1CLXA 1T0MB 5E1HB 4EDXA 2HFEB 2FMNA 5ISZD 2BCKB 1KDJA 3UQNA 5AVWB 1Y0LB 4H1LA 3LN5A 1TIUA 1MO0A 4G9FB 1OG6A 3GSNH 3SJVE 2ACSA 5EU6D 2ZZ1A 5DJ8B 1RQ5A 1R5WB 1KD0A 1VFBB 4LBEA 1PLGL 4BZ1H 2P46B 2QKIA 2VIRA 4LHUA 3H7VA 3C6SB 1KCWA 2PDPA 4RUBA 1OAXH 1E4XI 5AHNA 2X38A 3PWJA 4NERA 4UT6L 3CDGB 1XD0A 3TVMC 1N2VA 1E72M 1AKJB 4YXKH 4Q8TA 1DQKA 2FJGA 3I2CH 1BGGA 3OL2A 1XR9A 3KPTA 3ATYA 2VRKA 2FLBT 3VNIA 5CGQA 2Y2TA 1KWKA 1MPAL 4FYRA 1IGIL 4H9XA 4XZLX 4HF5L 4RZ5A 3Q7JA 2N56A 3GBNH 2L04A 4WWKA 1LBMA 3GJFB 1XGRB 2DJLA 1A4KA 1TG8A 1ZHKB 2QHRH 2YRLA 1Z32X 1PYMA 2DYSB 1CLZL 4K1WA 5IROC 2BVTA 4HJFA 3ZJKA 3EO0A 4RH4A 1AQDA 1ONWA 2EPLX 1MFEL 4XBGA 3WNMA 1W72A 5DUMH 1AXIB 2GSMB 1QFUL 3IDGA 3C2YA 1OP3H 3ZSSA 1RHFA 5HJXA 3ABRA 2ZOKB 5IZ7A 4C54A 1Z6KA 3ONBA 4EN3D 4FR6A 4XNXH 1L8NA 1J18A 2ERJB 3CSYA 2PD9A 1S7XA 2FGZA 1DPMA 2X4NA 3QNYA 2ZUQB 1PZ1A 3SRFA 4DZ8A 2NDGA 5AW4B 2IQDA 3CZNA 1MQKL 1G7UA 4WX2A 1E5YA 1I75A 4DI9A 1E65A 4YS1A 5C7VA 3U9PH 3JTTA 1HJWA 1NKOA 3BKCL 4Q97A 3DMMC 4PRIB 2WWMD 3ES6B 3O45A 4FIQA 4XKMA 3QEQA 4DTGH 3P9LB 4Q6KA 5KZCB 1BXBA 1LO2H 4JO2H 3D3VB 4WZHA 4R7DA 2NXYD 4M7JL 1WB0A 3OAZH 4Q7DA 2BIHA 2ICEA 5DZJA 2CJTA 4U1HB 4YXLH 3Q44A 3S6TA 3B7UX 5D5ME 1S7VB 3K13A 1XSKA 1LL6A 4L5FH 3R8QA 1R5YA 3IS1X 2AK4E 3HB3D 3UG4A 3TEUA 5I28A 3DROA 4ZFGL 3B2VL 3L3OB 5CD5D 4FFYL 1C91A 2NXZB 3GIYA 4B5EA 4BD4A 3LZOA 4KIEA 1OANA 4P46A 3QORD 3TZNA 3BI9X 1FWWA 2PU0A 4PJ9B 3GC5A 4FMKA 3QDME 1I31A 2PUZA 3RP1A 1M65A 5JW4M 4G7EB 2VZ3A 3X14B 1MFBH 3AB0C 4JHBA 2X6VA 5EO0B 4FG6C 2LVCA 1G6RA 3LIZL 1FN4B 1OCRB 5LG1A 5MP6L 3ZKNC 2W0FB 2XH0A 1KJ2L 5IKCB 1SY6L 2VZUA 1XIJA 4E2BA 3UOAB 3GB6A 3AWNA 1H4PA 1JQVA 2HPMA 1JPTH 4EF3A 4O2EB 2R7EB 1BVZA 2DWSA 1TVBA 3GNDA 4PJGA 2J12B 2EDBA 5ABFB 2XETA 4XX1G 3LM7A 5C7ZA 5J11B 4AVIA 3ZKMD 4UM9B 4WNJA 3GZAA 1YMMA 1YAZA 1UIPA 5IVXB 3UR8A 1IKFL 4MZ8A 4L61A 3H23A 1TMCB 3VGAB 2ZC8A 4JO3L 3RK8A 3EDEA 1IJNA 1JPGA 5FO9B 3RB5A 2FJUB 2A7PA 5EOCJ 4W93A 3FCSB 5G2WA 5KVEH 1ZS8B 4FPSA 4WHDA 2OLSA 5ANME 4ZDHA 4K3HA 3USBA 3E9UA 5AENA 2XACC 1DXIA 3DEQA 4HGWB 3E6EA 4LEQA 4BWLC 1NFGA 4MWAC 3OA3A 3HURA 5ESAB 5MI0C 1B0WA 3BD3A 2AAVA 3B34A 4AC1X 3SO3C 3KDMB 1EHKB 4JLRA 1FE8L 3AI0A 1BYOA 3L65A 1V55B 3HMWH 4YTRA 4MAUH 5F9WC 5GVJA 5D9PA 4P05A 2WNGA 4MNGA 4MAYA 3MJ9L 1VYRA 4L05A 1RURL 4F7CB 1H09A 4HQQL 1CL7I 4QCIA 3ML9A 1R9FA 3P67A 1R5IB 4OV5B 3S2AA 2X2GA 2DEPA 5DD6A 2MCAA 1P4BL 3ECWA 3QCVL 1CLOL 4WOQA 2FGLA 4IS6A 2Z7KA 3LQZB 4Z0XB 3V5FA 5C55A 2CLEA 3GH5A 2VC7A 1FH5H 3NOIA 2WMPA 2VLJD 1IARB 4EI5A 3NFNA 4PG2A 4E6MA 4NJAH 4GQRA 3N4EA 3O2WH 4UTHA 1XBVA 4J3UA 4WFFD 1NPJA 1WS7A 5LHFA 2E77A 1XLEA 3LENA 3REWA 43C9B 3NQKA 3T3MF 1T1WA 3CPGA 1X97A 1ZGLM 1ZNNA 3UEZA 3W1NA 4IQEA 3L9RB 3AREA 2A9AA 2GUOA 2DB8A 4XVDA 3RQ3A 3ISYA 2K45A 2PTTA 3O3DB 1NMBH 5C08B 2X2JA 4TRPL 3FPXA 2OJ1A 2KMWA 2Z1VA 5JR1L 2F19L 5E9AA 4A6YA 3F62A 3RF9A 7FABL 2AMXA 2UYLA 3TN0A 1HKLL 5AZ2L 5T33L 1Z3GH 2O1AA 4N0UA 1UM4L 4TUJA 3N2TA 3VTMA 4L4VA 1ZHAA 4PI0A 3QQ3B 1LO0H 3SUSA 1UCWA 1P6AB 4Z0JA 4QAIA 2J21A 2C9AA 4E0RA 1CLYH 5CN1A 4HLEA 1PKMA 1L6GA 4MLJA 4WO4A 4ILSA 4JX0A 5C0AA 4ZB0A 2FR4A 1WAEA 2EKSB 2F8QA 3VI3E 1JN6A 4OQVA 5BU6A 4TSBH 1S3RA 3MI3A 4FAAB 2A1WL 2OR7A 2YXWA 1EH9A 4HWZB 3FMGL 3TYUA 1Z66A 5EEYA 5AYIA 4A8NA 2VT0A 3NQVA 1ZBCA 1QLRA 4JO1H 5B3JF 2JIWA 4EOWL 2J7EA 4U3SA 4JRXD 2NY3B 4P8VA 1W6WA 2C3VB 2VJXA 3KXFA 1V05A 3VXQB 1MF2L 3N1PC 1Z42A 8RUCA 2MOVA 2NXHA 3U1SH 4OZ4A 4OZFH 4X7TB 1VPYA 3S6OA 1UWXK 1SXBA 2R29H 2VXVL 1OY0A 1QOQA 3NFSL 1JUFB 2YAOA 1JZFA 2Y62A 4ZS6D 4PP2A 1HHJA 3S3JA 4LGXA 2WKLA 5FKAB 4R3UA 2QQNH 2C91A 5T1KA 1CXKA 3WDQA 4LB4A 4UILH 1W0YT 3QYMA 1MQ8A 1H6FA 3BWAA 3W2KA 3JWNC 3QIUC 1K5WA 3AICA 3L5XH 1MCWM 1N12A 2PTUA 4NZTH 4YDLC 2M2DA 3A3XA 3DHMA 1KIUB 1RUAL 4OJFL 1FZOB 1ZANH 2BP8A 2AZAA 5IK3B 5SWSE 3PWPE 1I82A 3BP4A 1YTDA 1MIMH 4GY1A 4F7KA 4RDWA 5FGBA 2YSSA 1GOMA 1DE5A 1KFAH 3ZS4A 4ZFOL 1NCUA 2Z34A 3KL5A 3OKOA 4X6CA 1A7OH 2NUTB 2AXGA 4JAMB 3B8VA 4LJ3A 1QZNA 5GJPA 4U1IB 2BVQA 3ZIZA 1M9SA 1A7QL 4G42B 4BJLA 2CA4A 4WOZA 4R97B 3MGTA 4OT1L 3ECBB 2BJMH 2H7WA 4AV4A 1RY7B 4OIAA 3BW9B 3QQDB 1FNGB 3BAXA 1YAIA 1J5TA 1EHLH 3JWDH 3KPPA 2CETA 1I0DA 4C5YA 4AOFA 1YXDA 2J9YA 1E9OA 3AQUA 1SYSB 1M7IB 1UUOA 2YL6A 2YA0A 4I5RA 1IAIH 4FQXB 5IJBC 1ZIAA 3GIZH 3A4FA 4H3DA 4QXVA 1YC8A 1UXSB 1MFAH 1GGTA 3IJEA 5F0PB 3UMTA 3R8RA 4BSVB 2OVLA 3RJQB 2NX5A 4F8TA 4DM1A 2CRMA 5MHSE 2Z31C 2AAAA 1SZFA 3VE7A 4YXHH 4QO1A 3NZQA 1K4CB 1W9VA 2JJTA 5B8CC 1E9YB 1HINL 4NUPA 4GS7C 3U30B 2NZ9D 3OJDB 1N59B 3SKMA 2VGBA 3ZE0B 4L8CB 4GKSB 5BOZG 1OZMA 1QX1A 3EWZA 3B43A 4M48H 2GEEA 3AZTA 5AL0A 3FSZA 1SBSH 3VB9A 4NKOA 3M0MA 2WQPA 2N59A 3QZLA 5EU3B 3VNZA 2Z1PA 4EPKA 2CH8A 2BZDA 1XBXA 3DKJA 4W9GC 1IGJB 3MP3A 1TO3A 2MNRA 4H7VA 2DWYA 2Q86B 4LLUA 1WZ1L 2EH7H 4QT5B 2WLHA 3MCNA 4Q2ZA 1ZTVA 3G08B 3VJ6A 1MY7A 2HEJA 3TU9A 4OLZL 4H8WL 1DBBL 1NDMB 3TH3T 4LLDA 4KKNA 1TJ1A 4EXKA 2XYLA 1J9QA 2JB5H 1I9CB 5DLMH 2HRPH 1GHFL 4PBXA 2N7SA 4HCRH 3PRZA 5L9DL 3TBWB 4HTYA 4ORGB 3P4OB 3AQDA 1GYWA 2DKMA 3EG9B 2CUAA 1YJDC 1FDJA 5BVJA 2BFVH 3MRKA 3V52H 1CEOA 1AL8A 4YC2B 1D5IL 4NAEB 4L23A 4DAGL 1YDPB 1H15A 2GYSA 3D5OF 1NELA 3ROLA 1HI6B 4DEWA 4A21A 2VQUA 1RLCL 4XD3A 3MRBB 1EQCA 5FWQA 1GYMA 1ED3B 3PF3A 3MUJA 3WLWD 4IUGA 1ZAHA 4A1RA 5JUEL 1NQBA 3KLAB 4DJDD 2Z1BA 3I9GL 4X4XA 3SDXA 5I03A 3COTA 2DI8A 5KG9B 2Q3RA 3TL5A 2CKNA 2P7TB 1E5ZA 4ZXBD 2BP5M 4OZIA 5BJTA 3RLUA 5I75C 3QJHA 4WHTB 4BZ2A 3O9WD 4ZXOA 1A4AA 1HSAA 2XINA 1KIRA 1EJVC 3QJOA 3WLRA 4YE4H 5C9XA 3TQ0A 1K6QL 1J1XL 2WXPA 1TQXA 1FWTA 4ODWA 3RL2B 3Q8EA 2VDNB 1GOIA 5HWNA 4QWWC 3H2FA 2IXUA 3RWGB 4HH9B 2PTWA 2BPBA 3WFHB 1I1XA 4DBEA 3K2IA 1IM9B 1I8KB 2R0LH 1A9BA 1BGXH 1P5VA 2D2HA 2AQ1A 1FSKC 3APDA 3CH1A 3DX3A 4AZIA 1NC2B 1NICA 3RPIA 4X4KA 3M1CA 1Q7QA 3IRSA 1AR1C 2ADAA 2MJWA 2XWBA 4PJAF 2AK1L 3MZGB 3ZR4A 1CIDA 3T8QA 4OUOA 2Z6JA 1TTPA 1OTUC 4P2QD 3PHQA 4RK8A 3V6OA 3CHFA 3ABOA 1GKOA 1GVOA 2X1SA 1IVLA 3K91A 3B4NA 1T0MA 7A3HA 1L3NA 4G5DA 1YY9C 1J9TA 2HFEA 1OTTD 2BCKA 2W92A 3W1RA 3LCXA 2FZ8A 5AUMB 5C9RA 3GI8H 2E59A 4M5ZH 4J28A 2NR6D 4PRWA 4NC2B 4G9FA 2I07B 3FN9A 1FLRL 5DJ8A 4HIHB 2GFTA 1EZUA 3KZPA 2UVFA 5TE6H 4QTFA 2DSVA 5AYZA 3TBSB 4JMNA 3VXSD 1UR8A 2DMGA 3C6SA 4I2XE 2VXUH 3A4JA 2BSBA 1MCBA 3UL4A 3W7LA 3CDGA 3EGXB 4KO9A 1AKJA 5HATA 3PZNA 3WO4C 1BQRA 1INQB 1MZZA 4Y9CA 3TX9A 2VX7A 1KCUH 1JUKA 1X3DA 4KMLB 3R0NA 4ODSH 5IB5A 3NGJA 1VBGA 4RDQF 2NDFA 1GHRA 3AU6A 3VDGA 3GJFA 1LILA 3WMSA 4RWYL 2NVDA 1WAAF 1ZHKA 1YRRA 5KVFL 3WQCA 4GXWA 1HGWA 3VVVA 5SWZB 5K59F 4PGLA 2CDEB 5LO7A 2HPIA 2V17H 3CQQA 2GCYB 3UZVB 5DN1A 3NCCB 3NCWA 4FKEA 3LPPA 1M68A 1FRGH 4GSRA 3O2DL 1G9NC 2PZ0A 4GNKB 4LSUL 1PIGA 4PIBA 3MACL 1M7OA 2ZOLB 5ALBL 2UWEB 4Z7QE 1I2NA 1XIWA 2CJUL 3P3SA 2HN7B 3TYEA 1KA9F 1KQYA 1U8MB 3TTOA 1D7FA 3O6LL 3JVGA 3UYPB 5E9DE 4QLKA 3FCUB 4J3OH 2YPVA 3CNYA 2VEGA 1QNRA 4N28A 2QNEA 1IGCH 3FF8A 1ADSA 4BF5A 3ES6A 1PBYA 1JZ2A 3QLLA 4OZGB 2VDOL 2PYED 3P9LA 3L5LA 4RZ4A 3D3VA 3F4WA 3H7BB 4ZNEE 1YRKA 3CYJA 3C2AL 3HTWA 1UA3A 4ML4A 3TA4D 4U1HA 1TJMA 3RVUC 1S7VA 5HHXH 3UIZA 3S8WA 1TDQA 5CN2A 2YCJA 4FADA 3L3OA 2ENQA 1J88A 2IAAC 1LL7A 3UFYA 3ABKB 3QZPA 4RMUA 1UWIA 4TV3A 4PJ9A 4Z7VB 3MLSL 1BWVA 3QRLA 5CHNB 4G7EA 3X14A 4UTBA 1ZZMA 3BVDB 4PFHA 3IWPA 3PNUA 5EO0A 5F8QC 1IGTB 4K3JH 1O94A 3HZKA 4D6HA 2VJ8A 4KDTC 4ZMWA 4BQ2A 1UJPA 1XSJA 4RZCB 4UR7A 1NCNA 1UM6H 3FK4A 5IKCA 1XDMA 2DT0A 4HJJL 5LNDA 1TIWA 1DJZA 2AJXL 2BIIA 4O2EA 2R7EA 5I24A 4KK8D 2DYPA 3U0TA 4DYEA 4NC1E 3OHXB 4JHUA 3E12A 5ABFA 4MNQB 4HHWA 4HYVA 4UM9A 4ONGH 2X1PA 2PWVA 4PJHE 1M01A 5IVXA 1WDDA 3QV9A 4H1LB 3DI2B 4UNKA 3DUGA 3CAWA 5I73B 1HWWA 4X6DE 3QQNA 2AZUA 3FCSA 1CDIA 2VITA 5DJ2A 4XP6H 5LUMA 1C3FA 3LTPA 4R8WH 3JZ7A 4HGWA 5LNRA 3PWJB 4HYWA 1C5CL 2DQ6A 1ESOA 4PJXA 4NQUA 4AF0A 4TOYH 3IWVA 3OKEA 4JPWH 4Z7NF 1XR9B 3HFTA 2QCLA 1IAKB 3MX0A 4ONOA 3W70A 4DP1X 2XQYG 3OGOE 3ZDXF 2P8PB 3OD3A 3HNVL 3KDMA 1TITA 2J24A 3H0TA 4AKQA 4W9EC 5JVLA 4FQQA 1A1OA 7CGTA 4IPLA 2OR2A 1BWLA 3EFDL 1G7PB 3L4UA 3R2GA 2YXXA 1A6TA 4IIQB 3RGHA 3NZPA 4ZMZA 1W72B 4F7CA 5LZLA 4YGAB 3IDGB 1V5JA 5J7CC 5C54A 1R5IA 3DFPA 3CZKA 3KHJA 4OV5A 1DDTA 1TZGH 2ESVB 5EZJB 3B7YA 2NQCA 2PABA 2YLAA 5AHEA 1HHHB 1Z3RA 2X12A 3W83A 1JIBA 4GG6E 2CO7B 5I3GA 3WJLA 4GSDL 2FQIA 4LPCA 4P7QA 1NDTA 2EXWC 1CUOA 3QUHA 4HOXA 2ATKA 4G72B 3W25A 4L48A 4OJDH 2ADFL 4DF0A 1A14L 1KKRA 3WTSA 3DHJA 5D4HA 5KTEL 5LGJB 3IRPX 4CN6A 2PBOA 2FTWA 4D72A 4AL8L 1QASA 3AALA 5BO1H 4QAMB 3R5EA 2GGIA 1I8IB 4LCUB 4R7DB 1UYQA 3UYRL 2H3BA 3GZQA 2J88A 5HY9A 43C9A 2BZ7A 1OTSD 2NVAA 4US5D 3L9RA 4V2XA 2EDTA 2VQ1B 1HP5A 2HPOA 4JZNB 5CBEB 4Q4KA 3DROB 3ILQD 5C08A 3CMGA 4GUJA 2VDHA 2WC7A 3ZZLA 2WLIB 2JCCF 2EECA 1I4FA 2NQZA 2IPGA 3I7QA 3P69A 3PANA 3RDKA 2FZMA 1IIGA 3RM9A 4HVBA 1QWUA 4NGHH 3O0KA 3UVIA 2OU4A 3VWKB 1F6AB 1SMDA 2VLRA 4TLUA 2XN9D 3QQ3A 1R3TA 2C4FT 3B3IA 2CAKA 1QPOA 3S5NA 1OP5K 1BPVA 2VURA 2X1XR 4ZTPH 1EAQA 4BRJA 2H0PA 1QZ1A 3EJJX 2QQ6A 2EKSA 2QGCA 1T99A 5LNWA 1TFHA 2L7JA 4PJGB 4KQ0A 4HWZA 3FDWA 1CBVL 1GGIL 1ACCA 4HNVA 2P5WE 3P0VL 2V5SA 1ZKAA 2V9RA 2P0IA 3G2GA 1SJMA 4QLJA 2C3VA 1K02A 3VXQA 1AVAA 4HK5A 3P73B 3UU0A 1JUFA 2BVOB 4AZ5A 2HAZA 3AUJA 3T78A 4WTXA 3LSOB 2PODA 3M0JA 5FKAA 1L6ZA 4ZDHB 5J0BA 4FQJH 1X5YA 4K39A 1FXQA 1TWZA 2X3CA 2OX1A 1YECH 4DY1A 5D7KD 5FOJA 2YB1A 3XISA 2O9RA 3ICJA 1OQFA 4ZUTB 2WIMA 4OAWB 2J5LB 3P02A 1OVDA 3NACL 1KIUA 1FZOA 5EDXA 3MZTA 5IK3A 3QDGE 3C2OA 4EIGB 2FVKA 3THML 3W23A 4Y9NA 3VFLA 2QR0A 2OL3H 5KYYB 5I00A 5D2WA 1CF8H 4FABH 3F04A 5EH1A 1E3FA 3J7HA 3NZRA 5C09E 4UF7C 1C8YA 1S2CA 3CEUA 4O57A 2NUTA 4W87A 2FECI 5LVEA 1KNOB 3P77B 4GAYB 2TMDA 4A7GF 1H7XA 3CXOA 1NSNL 2FT7A 1RV8A 1EIXA 2MSPA 4Y2NA 3VFPB 4TVPH 4G42A 3DO7A 3OKLB 5A2JH 1KLZA 3EPMA 3ECBA 3QPXH 2P8MB 3BW9A 3QQDA 2BS8A 4UQEA 4E3VA 2B31A 1FNGA 1BD2E 3QDAA 4E41E 3U2IA 4ACZA 4PBFA 1FH2A 3I6LE 3UPAA 1M56B 4ZEPA 5C0BB 5LBSA 4B5XA 4W1TA 5FB8B 2WMPB 1SYSA 4M5TA 1JHKL 3NFNB 4FQXA 2E7MA 4NN6B 3IDMB 4X7FC 1UXSA 1PBGA 4DWSC 3GNML 3LOWA 3GRIA 3U36B 3WEBA 2LLGA 1NTDA 3ZN6A 3REWB 4NUJB 1UB3A 5HYEA 4BSVA 3QPYA 3EDJA 5DMIL 1SLVA 3WSQH 3EYFB 4HSOA 4LEBA 4BKLB 4PCKA 1K4CA 3HE6D 3N6HA 1FZJB 2DBLL 2PTTB 5A16A 4PL1A 1N59A 5E6SB 1RH8A 3ZHKA 1A7RH 4KI1A 2IPWA 4XMPH 1FIGL 4GKSA 1MHPH 2UYLB 3MUUA 6CGTA 2WQDA 1OIMA 4X5LA 1WK0A 2G50A 4Z7OE 2BGNE 1T6MA 2AJUL 4DGVL 1SEQH 3DXAB 4MKNA 2J9ZA 5F7HA 4Z2JA 2EDFA 4UB0H 5JOPD 1IGJA 2ZP0T 3V6BR 2AL1A 4ZRGA 1TPH1 1GKQA 5IHSA 2X0YA 4BK4A 1LM8V 1PEZA 4FNRA 4QT5A 2PMQA 1FWNA 1Z89A 4ZMTA 3VD1A 4YTTA 1NC4D 4WO4B 3G08A 3E5PA 4PTTB 4ATLA 1WH0A 4KK5D 1VZWA 3QEGL 5HPOA 1MZYA 2ZKXA 3DUSB 4XMKL 1LE5B 4C1NA 1ZGLB 1A3QA 2WCPA 3FSOA 3KBSA 1GOQA 5CLYA 5D4YA 4XVJL 3HG1E 4YHKL 1TR7A 1GY2A 2B4CH 2Z6FA 1IM3D 3P4OA 4FOMA 1UADC 3FQ1A 4LAZA 3EG9A 3PZTA 1DSWA 2YS4A 4OZ4B 4YO0B 4QROA 1L9NA 3U4KA 4B9YA 1BEXA 3V0WL 3ARRA 5FA3A 4JOMA 3PLYA 4MTMA 2XFYA 4KCTA 4A7SA 4UTWA 4EWND 1LDSA 5T1KB 3EYUH 2X9XA 1HI6A 3MRCA 2XV0A 3BWAB 4PR4A 5IUSA 1ISXA 3MRBA 2ZX8A 4JFTA 1GR7A 2ZKHL 5GRUL 2OMBA 3OB8A 4N26A 3KLAA 3FNKA 1DN2A 2DQIH 1AGFA 3JTBA 3ZT6A 5DK2A 1OQOA 1AG6A 3BO8A 4O4YH 4X80H 1AJ0A 2E27H 1O0VA 2R24A 4ES9A 5KG9A 2EXOA 4HC1L 1PVHA 4N2EA 3VABA 1WX0A 4XI5C 2Q7NA 4MM1A 3TVMB 3GUFA 3GDTA 5DURB 5CWSB 2SEBB 3HPXA 4FZEH 1SMOA 4IBTA 4X9BA 3MBEA 3B0UX 4WIQA 4PTMA 3IK4A 4WHTA 2KLTA 5DZOA 1NEPA 4PUUA 4ONFL 2V5KA 1N68A 3UNTA 3AZRA 4AUJA 2P5ED 5KYNA 3PB0A 5F2GA 1N10A 3MO1B 1ZS2A 4H1LH 2J47A 2D8KA 4TO8A 1T22A 3FFCD 5C3TA 2XQBH 5BU9A 3RWGA 2X44D 4JFFE 4HH9A 1V02E 3ARUA 3WFHA 1IM9A 3N9KA 3KPPB 1I8KA 3LZLA 2L7UA 1FH9A 2COVD 1E9OB 4YFDB 3B1UA 3BUYA 4IRSD 4LLYB 1PLAA 1P4IH 3A5VA 1N7KA 3M88A 3T4AB 4DQOL 4LRSA 5EZPA 2XSXA 2NX5B 5F2LA 2H41A 3FLUA 2I5GA 2F1EA 4XSMA 3MJ6A 1RIUL 4QO1B 3L4CA 4WVXA 2EBNA 3NQFA 4QE4A 4PJIE 3TURA 1H1YA 2EDYA 3R0UA 4XTRC 4OLXL 5F97E 4O15A 1TSHA 3VQLA 4GVFA 4FQCL 5DFVC 5AUMA 4L8DA 2BS9A 3PHSA 3BWSA 5IESL 5G55A 1LWRA 1UC5A 3APGA 3E2RA 2QJNA 3AGWA 4JRYE 1W72H 1J0IA 1SFLA 3G1FA 2I07A 2J1KA 1MCFA 3GDBA 3II3A 2Z4TA 3OLEA 3NH7H 1QMLA 3TV3L 4GHRA 4HIHA 4ATTA 4HFWA 1ILUA 3TBSA 4QY8B 1PS3A 5BUPA 3IGXA 3W7MA 1XTLA 2OTUB 4K23H 3LS4L 3VJ6B 1QRNA 1DQVA 3UGEA 2V3FA 1INQA 3CSBA 2CXEA 4IGBC 3BJFA 4XB8A 2ALDA 3Q67A 2EDEA 3QR0A 2XZQH 2ROYA 3K6SB 2Y69B 1J9SA 1KLUB 4KI5C 3N15A 3L81A 3JXAA 2VP8A 1FYTE 1BQ5A 2BY3A 4K94C 2EHHA 3C56A 4JEQA 5SWZA 2CDEA 4XNDA 4GVGA 4MA3A 2GCYA 4WGHA 4KERA 5M03A 4AD2A 3UZVA 3D25B 5BVJB 3MRKB 4DZIA 1G1OA 1MW0A 3VU1A 1W2VA 4WWID 1FGVL 5BW6A 4D9PA 2UWEA 3BXWA 1UOVA 4O52A 3RILA 4RMTA 5JXQA 5K9DA 2W3ZA 3JWOC 4UQDA 4EZLA 1A5LC 4HUXA 1ERNA 4GYFA 1KFLA 1G7JA 3MREA 4ZX6A 1KMGA 4V1DD 4HWBH 4KI5F 1G6RH 3HLAB 4J3OD 3UYPA 1C92A 4X4XB 1JYVA 1XGUB 5I1GH 3ID7A 1CU4H 2DICA 4KU1A 3C8KB 3MTRA 3H7BA 1HKWA 3G0SA 4M6OL 1IC4H 3SQSA 3LI0A 1R9ZA 5BJTB 3E74A 1PG7X 4P5RA 2NNAB 1CTOA 4XP5L 1KRAC 1AE6L 1KIRB 1URIA 3WIHA 3P8JA 1XGZA 4TQ8A 1V10A 3VFTB 5F1OB 2V2CA 3MI6A 4IKNA 3HG4A 4Z7VA 4XBSA 3N0PB 5H4YA 1AYRA 3BRGC 1A9BB 1PW3A 3T6CA 1XIIA 1P5VB 4TMPA 2WN2A 2R1YA 3ZJ7A 1AIZA 4RZCA 4M0XA 3TYCA 1TZOA 2ADIB 4DYJA 2GL5A 4QOKA 3MN8A 3QGAC 4J6RL 4XXCA 4F33B 4QRUB 1GZJA 1LROA 2Y7SA 1XEUA 4UR9A 4EPBC 5D7LD 1PO9A 3D46A 2D9QB 1ZMYA 5D7JD 1OE3A 5IB3B 4RDZA 1TG7A 4UQCA 4FULA 1HE7A 4XMVA 1ANUA 4KCVA 3SN4A 2J5WA 2O9PA 3L4VA 2R27A 4TX9A 3WBAA 3D39E 1WZAA 2Y0FA 4RSVA 3RRAA 5F1IB 4DIAA 3BGFC 4ML9A 5C2BH 1YEWA 1UZGA 1ONEA 3TCTA 1RZKL 1DO6A 4Y0GA 2X6MA 2JJWA 5K9QI 4WWPA 4QS5A 1POJA 2EPMX 3ZVHB 3MUGB 2NY2C 1N0LA 4XPGH 4IIZA 2B1AH 1GSKA 1MEXL 1UBPC 2NQ3A 3CFIC 5HYJB 1IAKA 4RA0C 4BS0A 3DX8B 1OEPA 4S23A 4G2AA 2VM3A 4PWKA 5HUPA 3H55A 5IB5B 4Q8MA 1UH4A 2P8PA 1T1YA 3SPGA 1PZ5B 1KXQE 1PZ2A 2QELA 2IWGA 1YNLL 4PJ7E 5AW1B 2H8ZA 4PVNA 5I79A 1DLHA 4E36A 2NNRA 5H6HA 1OVZA 2K0RA 3P4LA 4Z78B 1VPXA 2IANE 4JZJC 1MUWA 4NRXB 4PCSA 2J8UE 2NW0A 4CVUA 1G7PA 5HJ3A 4IL2A 3DFNA 3C5ZD 4P4KB 4TYUA 2FQDA 4Y5XC 3APNA 2CWXA 1D5MB 4IIQA 5D1QE 1H7PA 3K2KA 5T1DL 1YDVA 2H26A 3AXIA 4M43H 4IHCA 4DJFC 5T3ZL 3L3HB 1TV2A 1J5DA 3G1YA 1JZHA 2ESVA 5EZJA 1HHHA 4A6YH 3K2GA 1XINA 4JM2D 4TUUA 5DDHA 1XIWB 5F9OL 2CO7A 5CEZD 5I1JH 2WTOA 1G9MC 2XV6B 2ZT9C 3CT7A 2WHJA 4MJ2A 5JBFA 3SR7A 2J74A 4UTUA 5D6CA 2VJ0A 3KH3A 3TKFA 1SPDA 5LGJA 1IKOP 1C90A 5F7AA 4F0SA 4L4PA 4P8QA 1KN2L 1I8IA 3QIUB 4LCUA 3NO5A 5L8JB 4KNTA 1I2QA 4MDIB 3CJPA 3THAA 4H13C 4KGLA 4YS4A 3ITOA 4CCDA 5A7BA 5E4OA 1TV5A 2VRJA 2R14A 1Z9AA 1CICC 1WD9A 2VQ1A 2A9DA 3MLWL 3MU7A 3VXME 3NCEB 2DVUA 4JZNA 5CBEA 4FNLH 4P5TC 4EXBA 2YQ2A 3F4NA 2WLIA 1IXQA 1V93A 1ZLVH 4OKVB 4K8RC 3OM3B 1MFCL 2CWNA 1XEDA 1W1B1 4PL2A 3O6FC 4R2GC 3B03A 3ARBC 4HKZB 2CA3A 1FWFC 1U3HD 2YDAA 5DS2A 3UJEA 3VWKA 1F6AA 4ZODA 3SBWA 2PD5A 1TRIA 3HZKB 4MY8A 2CO6B 5JDJA 1W5OA 1CYWA 4JL1A 2LHAA 2YBTA 2YJLA 1H5BC 1LRTA 2GBUA 3G6JF 3TBTB 4ROQA 4KOCA 5D03A 3CZUB 2E5BA 3S5YA 4CBPA 2DYPB 3U0TB 2XBDA 2BV9A 1F3RB 4YLBA 1YEHL 3MUXA 2YIHA 3HR5A 2RA1A 5J9PA 4DOHB 1RD5A 5ICYB 5D7SL 4UOW0 3GTVA 2EVFA 4LZKA 5T1MA 4Z2GA 4HIJA 1QJWA 1OSYA 2VEPA 1H0DA 3P73A 1F18A 2BVOA 4AUYA 3V0DA 4Z3FA 1TZHB 2Z31B 1MCNA 5EBUA 2VITB 3ESVF 3LSOA 4ERIA 1JI2A 5DJ2B 1IGYB 1YPXA 2O5YH 3K46A 5GNYA 2B77A 1D3HA 4LCIH 1VF8A 3F8UB 2DQEH 1HIZA 4QDGA 3BKJL 1X38A 3AYRA 4E42B 4S1FA 4PJXB 5EORL 1I9IL 4AF0B 1IGMH 2NYYD 4ZUTA 1I3GH 1TNNA 3OKEB 4OAWA 3QH2A 3MX0B 1XFBA 1YEFL 7TAAA 2XDFA 3AYSA 4K7VA 5J13C 4JDVA 5C0CB 2NZIA 3R0KA 2IKJA 1T6WA 1T1ZB 2NLIA 2C3WA 5DUPL 4QG9A 3I75B 5KYYA 4PMYA 3H0TB 4Q52A 4FQQB 1A1OB 3TBVB 3W7OA 3GTXA 1Q6FA 4YK4B 1KNOA 3P77A 4GAYA 3WKNA 1A6TB 3UPRB 3B2UD 3UIYA 2C4XA 4TVPD 3SUTA 12E8L 2C13A 5BO0D 3VFPA 2A0LD 3OKLA 1IC7H 2W9EH 4Q6IC 4XH2A 3TMLA 1ZLSL 5IWLA 3MBXH 4HGMA 3B9KC 2CQVA 2P8MA 4I9JA 4GQ9H 4KVNL 4LYPA 4X2PA 1ECYA 1JD7A 1PFOA 5IT2H 2ATKB 4OCLC 1BWKA 2FBJL 4AC4A 5CMAB 5C0BA 3KAAA 5FB8A 4MB5A 1E5CA 4JTJA 2IMMA 3REQB 5BMWA 3SDCC 4XVSL 4ANXA 3FUHA 2CO4A 3K2UH 3IDMA 5EU5B 2FATH 3ALGA 4LSPH 1MDLA 3FKRA 3SGGA 3U36A 5SX5H 4Q8UA 5HVHC 3O3AA 5HY9B 4NUJA 4RDQG 1KGJA 3RY5A 5F7UA 1J93A 3QDJD 4FFVD 4X7SH 3ZUCA 3EYFA 4BKLA 4Z1YA 4TQHA 5I6NA 5E4IA 4FQ2H 2X10A 3GMPB 5J3HD 3A23A 1FZJA 3UZEC 1CK0H 2DKUA 1FH8A 1KTCA 4NBZB 4B5ZA 3P30H 4ZFFB 1I4FB 2UXVA 5BV7H 5I1CL 3T0EB 2PCPB 3OKMB 5H2ZA 4HOZA 1TPWA 4UU9B 4PRDA 4HN8A 2DI7A 3DXAA 3WBEA 2C19A 1FJ1B 3MLYL 2VLRB 3W82A 4HN4A 2VLKE 3OGCA 1XAUA 3B3IB 5FYKH 2AMUA 3LMJH 4DP7X 1XL6A 3ZXWA 1T66D 5EZIH 1Q72H 4DCQB 5AG8A 3TAKA 3V3WA 3T8MA 2R69L 3GO1L 2VWEE 4LTSA 5HMEA 2FK9A 1QNZH 4AQ8A 4PTTA 2YEZB 2O4EA 4FXLA 4KRPD 4LCWD 1BKSA 3QSRA 2QFRA 3F85A 3DUSA 1LE5A 2JKSA 4G7FA 2Y07L 1C5DB 1ZGLA 4FP8L 4DUXA 3Q2VA 2AJSL 2ODOA 1FSKB 1FWCC 3ZWSA 1ZUAX 3VK5A 4W5UA 2NY0B 3ENEA 3AZUA 1N2RB 4N0YL 2XH2A 4LDLB 4X6EB 2G5UA 4MS8C 4DN3H 3NJLA 3KTCA 3O2VL 4KK9C 4BZ2H 3MOAH 4YO0A 2Q8BH 1OARH 3RUGB 2P3YA 3LH2H 4GXPA 5AVZB 5EWIH 3MANA 2R4SL 2ZNWA 1NGZB 2P44B 2AABL 5DVKA 2J4WL 4OJEH 1MFDL 5J5DA 2AQRA 4YWIA 2OTDA 3IB4A 3NA4A 3OZ9H 1UD3A 2ED8A 1BAWA 2CUIA 4ICNA 5HI3C 5BZDA 2WPGA 5ACZA 4AY8A 1U2CA 1KEMH 2BY1A 1IT8A 4Q33A 2VSMB 3BZ5A 2RALA 4H83A 1DUYB 2Q8AH 5DD1H 2FIQA 4PB9H 2QR0B 4FG0A 1OFBA 4FX7A 4W9ZA 5LA2A 1G7MB 4Q9QH 3UTTE 4D8AA 2CD0A 4MNMA 3WLJA 3RY6C 3D51A 2DV0A 3TVMA 1CDGA 5CWSA 2SEBA 3Q3GB 1U3ZA 3JUZA 3ULVC 4X22A 2MTAA 3DO7B 1XL9A 2WXNA 1VH7A 3MO1A 2UY5A 4ZZKA 1EX5A 2J72A 4XNQB 2DDQH 1N8FA 3A5FA 3SDDD 5IROA 2VR3A 4HYRA 4Q8QA 4ACZB 3JVFC 1L0QA 2ODIA 3GVRA 3V4UH 1TJHL 5E95B 2IPTL 4RISH 3S2JA 3WKMH 3MV9E 1KJVB 4KZDL 1YPFA 2DF3A 2EUXA 3RHWK 3VIIA 2WJDA 4AI7A 4KV5E 3CUFA 2ZG1A 3V1HA 3UA4A 2XKUA 4S3GA 4HBCH 2V68A 4LLYA 1HIML 3T44A 1D6VL 3T4AA 5JIQA 5HPCA 3ULVF 4N86A 3ZWTA 2HLFD 1F5WA 3ABSA 4N2YA 4K9JA 4D7BA 3R58A 3KP0A 4J3VA 4I7VA 4D9RD 4NN5B 4EIVA 1Q9LB 4WWKD 1JPHA 3MRDB 3DMMA 5I6KA 3GJFH 4UB9A 5AVHA 5A16B 5M2FX 4DF1A 2TPSA 2J66A 4CQ9A 4Y5YC 4PULA 1YNKL 4UT7L 3DSFH 1EBAA 4PJDE 3HUJF 3HMXL 3WS3B 1KTNA 4ZO6A 3PG9A 3TX4A 4UFIA 5FUOL 4UTFA 4NLHA 3ZKQD 2IKGA 5CH9A 5KBLA 4G3YH 1E1CA 4RGOL 4QY8A 1NCCL 4C90A 1X6UA 3BN9C 4JRXE 1A53A 2C3ZA 2ZCKL 4M6NL 1PKQE 3ZL4H 2K78A 1J9RA 3KL3A 2OTUA 5AB2A 1GAFL 5T5NF 4C5ZA 3TZVC 4Q58C 1YZZA 1MWAL 3QVAA 1IU1A 1R2RA 5DMYA 4NQED 2NSXA 3K6SA 4C1NB 1B4RA 3DVIA 4MFEA 2FQGA 1Y07A 4JTCA 1KLUA 3FS2A 5DRCA 1NKRA 1DBTA 2BLFA 1MI5E 2CLOA 4N5UA 4OM0H 2CLPA 1LDPH 1CZ1A 3VIJA 3FY1A 2W91A 3D25A 4KJPC 5AW3B 2IFFL 1DXEA 2GSIB 5FA3B 1WXJA 5LIXX 4N0RA 2H3NB 2ABAA 3WLPA 1W80A 5DMGC 4ABQA 1Y5WA 2GPZA 5FKPB 3ZDXB 3MRCB 3S7GA 5L2KE 1UR9A 3PUCA 3PPGA 2GQAA 3UTPE 4F15B 1BCIA 4BEIA 4UTBH 4ES4A 4MX7A 3M5YA 1OYCA 5FXCH 1AGFB 2V0AA 3HLAA 1KBKA 4GSXA 4N1CA 5DK2B 1CW2A 4KY2A 3EZJB 4HBQA 1C29A 3BO8B 1XGUA 1KCSL 1Z9OA 1T2QL 3BRDA 4ZJ9A 4C8XA 3THCA 1F76A 4U0QB 5A2KH 2IDCA 3C8KA 4MWAA 4MMZC 3LHPH 5ABEA 2VRQA 4NXSA 3MBEB 1RIVL 3LRGA 1F2JA 3VXRA 4GRWF 3D34A 5J06A 2NNAA 1JZ5A 1S6NA 4N9BA 2YD2A 3MSPA 3TPUB 3B0YA 4P2VA 1YMMD 3LQGA 3ALWA 1GT8A 5FHAH 1GXEA 3M7WA 2V2HA 3VFTA 3L0GA 3S6DA 1FHNA 1JCVA 1T22B 2FBRA 5IQ7H 3RDTC 5BMFL 4JQ1A 2A3EA 2OSLB 1SMAA 5KMYA 4GI4A 1U8IB 1QTYT 1OPGH 3HNSH 3P5ZA 2PETA 2RDXA 3BUYB 4QXGL 2ADIA 3WXWL 1V27A 1QNOA 2DLEA 3AUWB 4F33A 4QRUA 2P88A 2WAQA 3DGRA 1A7PH 5C0EB 5FUCC 2D20A 2V5MA 4AYFB 3B8IA 1UZ1A 1Q0EA 4K5NA 4R0LC 5FM5O 5I9QB 5F0MB 3QY6A 2DVTA 2DM2A 1BFVL 5IB3A 3KEDA 1ZB5A 3AHYA 5I2UA 4JY6A 4LAQL 1FFTB 5KYXB 4OF6A 5MEND 1XT5A 4NWUH 5E9XA 2W94A 4RIRB 4L8DB 3VA6A 4YPJA 4MAYD 5F1IA 1P1VA 4XN1A 1NPUA 4WDIA 2ATAA 3FH7A 3N1MC 1YE4A 5D4JA 3RKPA 5DT7A 5AW8B 3OB0K 2WLNA 4HFWB 5KSBE 3CVHL 3ZDYB 4Z08A 1AZUA 5IBUG 3B2XA 3P80A 3ZVHA 4L6DA 3MUGA 1MREL 5CKSA 4DKFL 3QISA 2VC2B 1X5JA 3L3GB 1W0VB 1DTNA 3UTOA 1QRNB 3HS9A 1UGNA 5HYJA 4PPTA 2W61A 3VCLB 2DJMA 3DX8A 4F2BA 1SZEA 2CNYA 5AC7A 4HKXB 4AVHA 5KBKA 3IUDA 1PZ5A 4MRCA 4Q4SA 3KVPA 3F5KA 1YEEL 3GLDA 3T7VA 3GU2A 1UKQA 3AFLA 3OG4B 2MPAL 4WKHA 1YEIL 4DPAX 3ZKSD 5IFHH 3WY4A 4Z78A 4S0HA 2J88H 4I0PD 4NRXA 1T41A 3U4EA 1KCRL 3SSGA 5A2FA 3KWTA 4MA3B 3ABMB 4P4KA 1D5MA 4NJJA 4CCZA 5FM5M 3V4PB 1YN6B 3FCPA 1OAYL 1QEWB 4HPGA 1WOBA 1E6RA 2XBZA 1IC5H 3L3HA 2ZTJA 3E3QC 1WYJA 5HHVL 4D3CH 4QP0A 3TN0D 2P53A 1QBML 4LMQI 5BOFA 3BAWA 4CQ8A 2ZKWA 3EJUA 1MG3C 4HUXB 1X98A 2Y5JA 1G7JB 3MREB 3P4NB 5G2IA 5E0FA 4B53A 5F4SA 1UP3A 4QRPE 1A4CA 2XRAH 3T3PE 1CDYA 1I7ZA 3F4CA 2LGNA 2P76A 3FO0L 2GGGA 4U7SA 2R0WL 1VPQA 3G3LA 2VDLL 3TXAA 5C0AD 4FA6A 3GRGA 1DCLA 3R7MA 3S2CA 5J6HA 3QIUA 2WHLA 4AXNA 3N12A 3VI4F 1U1JA 4RAVB 4MDIA 2R8SL 3US9A 4RNJA 4NO0A 1TZ9A 3GTHA 1Q6CA 2YN5A 2ZUXA 1US2A 5AOIA 3RR4A 4LPWA 5AOKA 3SECA 1J6PA 4MHBA 3PZMA 1A6WH 4YHZL 3OO2A 4MAZA 4LAMA 4C83B 1A3LL 4OKVA 2YMXL 1LO4H 3U46B 3OLDA 2E8YA 1XLLA 4HKZA 2DD8L 4Z7WE 5A6BD 1EPFA 1JE6A 2EDLA 5EUOE 5BPPA 5FFLA 1D2KA 3BLEA 2NY5L 1FGNH 3RM8A 4GMSL 3LYRA 4KOBA 4O50A 2PDLA 4LW7A 2CO6A 4X5WB 2R1YB 4LAJH 1AOZA 4EK7A 3AOFA 3SFWA 4GUOA 3SJNA 4QOKB 5L9FA 3TBTA 3EF4A 2R1WA 1U93B 2C9VA 3N9GL 1BAFL 3QUKB 4N22A 3GWQA 2B2XL 3VTTA 3OG3A 4PM1A 4AMAA 3RFRA 4HIIA 1H8LA 5C2UB 5ICYA 2FH6A 4AX6A 5G1MA 1A65A 4WEBH 1FTXA 5HNTA 1JZ4A 3EWBX 3QQXA 5I18H 3A4AA 1N5YL 3U57A 3B9DA 3NG5A 5CJMA 3ARGD 1YBQB 3O6MH 1TZHA 2Z31A 5GZOC 4E2OA 1MSPA 1BFOA 1MCPH 4NZCA 1WBXB 1K9DA 3GM0A 1IGYA 3H4HA 4X50A 4W8AA 3PZ9A 1FFRA 1XBDA 1W17A 1N0LB 1GS7A 1IEVA 1LLOA 4E42A 2YPLB 4HCIA 4EBQH 4TTDC 4CGUB 1KELL 4C4UA 4EDWH 3CVCA 1UC6A 1FHLA 5C0CA 3MHGA 4CC1A 1T1YB 1T1ZA 2P8CA 5DVMA 5HULA 3S9DB 2W5PA 2BVDA 3QNXB 3I75A 1Q90A 1DLHB 5HHPB 2R91A 4FJZA 4DK3A 5KVMC 1MJ7H 4Y8AA 3CU2A 3TBVA 1KYOK 3TC7A 2PGRA 3CQFA 2QR6A 4OGZA 1VERA 4LALA 5HJ3B 1GC1C 3TA3D 3JV4B 1YDYA 3ZYOA 2R1PA 4Y2DC 3UPRA 2OKOA 4H2HA 1NBVL 2H26B 3PWAA 1UWGL 4UTKA 1WDSA 3G3DA 5T9CE 1ZOXA 2VFGA 2A9CA 4YSRA 3MVIA 4TVDA 5IV2B 4H19A 2PYEE 1HL5A 5TPWL 5DDHB 2VEKA 5C3LD 2BNJA 4H2AA 2PTYA 1PHQA 4L1DA 5DHVB 2PCXA 2WGXA 1EXUB 2R0KH 2HLEB 3SCQA 5CMAA 2RGMA 5D6CB 1V0NA 4FAMA 3QIWB 1PAZA 3TGXA 1JRHH 5DJXB 3KVJA 5JXEA 3REQA 1TVDA 5EU5A 1PIFA 3L12A 1QTWA 1OWWA 3CIQA 4B9ZA 4H40A 1SJAA 1SXSA 3CN0A 2BZCA 4U1LA 2Z0BA 4C6JA 3IF1B 2VXSL 1W91A 1RPQA 2DZBA 3F6JA 1RJPA 3GMPA 1CXIA 2EF9A 3RBGA 1P0KA 3EWUA 2LFEA 1NA8A 3L48A 1KCVL 3DENA 4ZFFA 3LSCA 4XPTH 4I3RH 3T0EA 2PCPA 3U2EA 3X12B 4X9HA 3OKMA 3AG1B 3LDVA 1UKOA 4UU9A 2KDGA 1Q0YL 4ZW8A 3RCYA 4OW6A 1LT8A 4O02B 2A77L 1FJ1A 3GHEL 2IKHA 1BVOA 5C71A 4PJAA 3RGTA 1BLNB 5J12B 3M0YA 3SW6A 4PQXA 3SKUD 1DQQA 1GZHC 5GGQL 1D2PA 4DCQA 2ZXAA 2E5EA 4TOQA 1A5NC 2CBJA 1DLFL 2QT6A 3S2MA 3S3PA 1T0NB 2YW4A 4W7VA 3IS0X 2YEZA 3AFBA 4ESKA 2BW4A 2MUCA 2Z1XA 5CF3A 1EJSC 1MUCA 4JYFA 5CZXC 7PTDA 5CC6A 3HR5B 3T42A 5LGHH 1TYEB 1C5DA 4YNGA 5J9PB 5FAAA 2GSJA 2QZRA 5FJTA 2B4GA 1TTQA 4IIDA 4PJBF 4AZ7A 5T1MB 1N2RA 3PYCA 2F53E 5KANI 4HIJB 3FUDA 5HBBA 4LIQH 1JCKA 4X6EA 2XIBA 4HNTA 1H0DB 4XBJA 3RUGA 3C8NA 4IM4A 1KIQB 4RL3A 1KRCC 3TT1H 1NGZA 1DQDH 4U6XB 3VCRA 3DG6A 4KITB 4NM4L 1XHHA 2VDNH 4KO6A 1TMHA 4P5UA 1A3ZA 4HB7A 4ZE5A 3BUPA 1A7NL 2WWNA 3DO3A 2F8IA 1UH3A 2H2PC 2Z7WA 3KPQB 3W24A 4JDVB 1HH6B 1DUYA 4IG2A 1BREA 2XN0A 3COOA 1DVUA 3SOTA 1GZQB 5D55A 2Z8VC 4TULL 1TYRA 3JBG7 1G7MA 5GPRA 2C3HA 3H1ZA 4JCLA 1D7CA 1A50A 1E2WA 3SGUA 3QHZH 4BCZA 4Q9BA 2BIMA 3Q3GA 1W9DM 4JPVH 1FP8A 4CSPA 2YFNA 4R6UA 4IGBB 3UJTL 4KZ0A 1PCXA 3VE0A 3V8CA 4PS7A 4PBVC 3WUWG 3VOCA 2RGSA 3PL6D 1HL9A 4JFDA 3GXNA 4XH2B 1PB0A 2JELH 2QMJA 4XNQA 3SO5A 1AOHA 4AGNA 1VYSX 4NUGH 1BFSA 3KLHD 2CE6A 3MV8E 1TTAA 2WB1A 2EDWA 4ZYKB 4LSVH 2FHCA 1KJVA 4M1CD 4DVRH 2JKXA 5M95B 3NIGE 4QRSB 4KFPA 1FNEB 3NBNA 1AKJD 2XIQA 3QCTL 1AC0A 4D0CA 2B5IC 3Q1SL 4HJEA 1CBGA 4ZMOA 3NL3A 3U6WA 4YVPA 4YQXH 3O3AB 1P7TA 4IIEA 4M6MH 3DV4A 3AJ7A 4G83A 1DSFL 3LCFA 4K8HA 4Q0XL 4MGGA 4MBOA 3W2UA 1Q9LA 4NP4H 2PFHA 5AYYA 3MRDA 3P2VA 4WHCA 1FWSA 5KVGE 2CLMA 1VRSA 1FWEC 1EZSA 4IHBA 3ZHDA 4ENZA 4IKIA 1WFTA 3Q2LA 3WMCA 3WNNA 2YCLA 4B41A 3WS3A 4PRDB 2P48B 3W02A 2ZOTA 4HUCA 4QHLA 3W56A 4KHTL 1Q6OA 2FEEL 4BCEA 3AG4B 2INFA 3FJLA 3OGCB 5IHUH 4QG6A 1GJPA 1OADA 1ICQA 1MIEL 2CGRH 3N04A 4JQ2A 2HKAA 4O53A 4RGNE 1Q5MA 2XTJE 4NZ5A 4EIUA 5CUSL 3K5XA 2DOCA 4O14A 1KACB 3VXGA 1C1EH 3KPRB 3Q2WA 4XAFA 4PRID 2D7OA 4AEIH 4GIRA 2FECL 2YR3A 3TJHC 5KZCD 1URZA 4GX9A 2VH5H 4KDTA 3D3VD 3YPIA 2HT4C 4NG3A 3GBML 4MZRA 3GHBH 3NIFF 3WQPA 4Q4EA 1KBGL 4PUJA 5D71L 4N90E 4ZA0A 5JPNB 2VVSA 2PDCA 2X2YA 5SV4A 3WIHH 4NF7A 2GSIA 3LTYA 1QACA 5LNEA 2K7PA 2H3NA 2NXZD 1MHEB 2ZPKL 3SE8H 1R46A 4LBUA 1IBHA 5FKPA 4HIXL 4PJ9D 4HEMA 1WCBB 2ZUYA 1RZIA 2V3GA 1N70A 1TV7A 4Y9MA 4JM4H 5HD8D 4E2DA 4FMVA 2HPTA 4BQ6A 5BZDB 5ACZB 2J6WA 1Q38A 3BGFB 3NOEA 3F84A 3FUEA 4KO5A 4ZTOL 1BTMA 4LP8A 1JPSL 2WYHA 2YGOA 5IFAL 1OSPH 3B4UA 1EGJL 1KTLB 2UV3A 2PC8A 1ADQA 4JTEA 2GC4C 3PBGA 4QDMA 4UANA 4M4PA 2PKDA 3TOPA 3HPAA 2X2IA 5D9OA 3SQLA 3TPUA 3MYZA 1GVEA 1J1OH 3WX7A 5DVOA 3CV6A 1NDZA 2VKWA 1N0XH 4RV3A 4ICCX 1YY8A 3S5ZA 2CBVA 2WSQA 3GNRA 1E90A 4L9XA 2FSEA 2YPIA 3UWYA 1U4EA 2AQQA 2OSLA 4MPQA 1U8IA 1LLWA 3NA8A 5LNGA 2PCYA 1WSST 1WBYB 2VR8A 1QFWL 5MEPB 1QI0A 3IFNL 1QR4A 3ORWA 4YDVB 1UWAA 4ZSTA 4KWOA 1H5VA 1M6OB 1MCJA 1QFEA 1ZTXE 3ULUC 5C0EA 4UM8B 2QUNA 4AYFA 4RWHA 3N06B 3D5HA 3BQUD 2JCCA 3VNJA 3EOTL 2CPCA 3DVNA 2H9AB 3VYPA 4NKQB 1SXCA 3DMMB 3WLOA 2ZQ0A 1QP1A 4JD4A 5KYXA 4FI6A 4D2JA 1DVXA 1DIKA 3BSZL 4RIRA 5F0LB 5HGAA 4HXAH 3L7FB 1YQVH 5BUGA 3DJ9A 5KJ4A 1T6VN 5HHOA 4YCPA 3ZDZE 4EVZA 4C6MA 4MJMA 1T8QA 3WIIH 3VW3H 1NAKL 4C56E 5GRYA 5TK4A 1E1CB 3CSTA 5GHWH 1JAEA 1D9KD 1KM6A 3U7WH 3DPDA 2FZBA 2YA2A 3ULUF 4P5TB 4GLRH 5E2JA 3KJ6L 3L3GA 5B7FA 2EDMA 2YK1L 3VGDA 1E4HA 1JGIA 1W0VA 2GJPA 5KW9L