5BRQA

Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea)
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
555
structure length
555
Chain Sequence
NPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDNGYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKEAASGKENLYRDFYIWKDMKPNGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYEMMHFWFEKGIDGFRLDVINVISKDQRFPDDDEGDGRRFYTDGPRVHEFLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNFHHLKADYPNGEKWALADFDFLKLKKILSEWQTEMNKGGGWNALFWCNHDQPRIVSRYGDDGKYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRILKEAGKPEAEIIEILKAKSRDNSRTPVQWNGEENAGFTAGTPWIPVPDNYKEINAEEALNDPDSIFYHYKKLNELRKEFDIITTGDYQLILEDDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIEGYDAKVLISNDTDLPESFKRFTVKPYQSIVYHLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycoside Hydrolase Family 13
publication title Bacillus licheniformis trehalose-6-phosphate hydrolase structures suggest keys to substrate specificity
pubmed doi rcsb
source organism Bacillus licheniformis atcc 14580 = dsm 13
molecule tags Hydrolase
total genus 209
structure length 555
sequence length 555
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.93: Alpha,alpha-phosphotrehalase.
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5brqA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5brqA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 5brqA02
3DC0A 4JFUA 4WLCA 1ESWA 1Q4NX 4ZE4A 3WNNA 2F8QA 4IISA 4GI8A 3VGEA 3ARSA 2J47A 1JDCA 3WUFA 3ZT5A 1KCLA 2D0FA 4FNRA 4H7VA 4HA3A 3W37A 1H0IA 2VQUA 2EO7A 3W24A 2WHMA 2WMGA 1Q6DA 2YL5A 1E40A 2XVLA 4M81A 3UG4A 5EBAA 3B9EA 2GFTA 3OGRA 1WE5A 4PMZA 1EO7A 3NCOA 4FNTA 2VCCA 3WKZA 2CITA 2WVUA 3AHVA 5E0CA 1JZ6A 2YA1A 5A8NA 1QX1A 1UR2A 3EBVA 1HWWA 5I23A 4JKLA 3WBEA 2F7RA 4HP5A 3BCFA 3BAJA 5M17A 1VRXA 2WBGA 3WDJA 3VPLA 2PBGA 2J7HA 1EHAA 1E9LA 3BUQA 1C8YA 4B15A 4WF7A 3IANA 3WEZA 4NXKA 3VUPA 3FNDA 1VBRA 4JKMA 1UH4A 1C93A 4WSKA 3CHEA 3WD2A 3KLKA 3OLEA 4JCLA 2XVGA 1GOOA 1C8QA 1JYNA 1NARA 1ODUA 3GXNA 1JXJA 1W3JA 3PZTA 4HMDA 2BXYA 5A6BA 4Q7NA 3T0DA 3AZTA 3MS8A 4XX6A 3WH7A 1OIMA 3VGFA 1UKSA 2JEPA 4BQ4A 1AQ0A 2F1BA 1OGGA 3GXMA 4PMQA 1U33A 2PB1A 3W0KA 2CKRA 3WUEA 5C70A 3DX2A 1CXIA 3DYMA 3VGBA 1E1EA 1Q6GA 2G4FA 4LYRA 5CPSA 3WBAA 1X6NA 1UWSA 2E9MA 4W7VA 4MJ2A 3SCOA 2VL4A 2YFNA 2BXZA 4H41A 2XSAA 5JBFA 1EH9A 1EOMA 3WQ5A 1V6UA 1VIWA 3TOPA 3N18A 2WW5A 1Z32X 3MI6A 1B3YA 4J3UA 1MXDA 4AZ5A 2GVYA 3RM4A 3BUDA 3A4WA 5JIPA 2J77A 3DHUA 1BTCA 2YLAA 5CG0A 3A22A 1V3HA 2FGLA 1HKJA 3W29A 2CBIA 3CUFA 3VSTA 3VSUA 1WZLA 4GPNA 2WMKA 3BUIA 1MW2A 4CU8A 3CMJA 4DO4A 2XHYA 4CCCA 3PN8A 3EMCA 1CEOA 3CTTA 1J0IA 1NH6A 3M7SA 4GZJA 3GXTA 3CBWA 4ZXLA 1HJQA 3W6MA 3CO4A 3JUGA 3D4YA 4X9YA 4J3XA 3WEMA 1PEZA 1GVYA 1ECEA 1WZAA 1W9BM 3VIFA 3CZ8A 4NRRA 3AHYA 2EABA 3CH9A 1FOBA 1NQ6A 5KZ6A 1PS3A 2FHFA 2XG9A 3MSGA 4CD5A 5HXMA 3VDBA 3UETA 1O7DC 1OT1A 3EDFA 5E6YA 7CGTA 1Q6CA 2YKKA 2CHOA 3U7BA 1Q6FA 4A3HA 1BVZA 2BFGA 3H55A 3CUIA 4JFSA 4TVCA 2G3NA 2VX5A 4FNUA 2D73A 3VGHA 3RJYA 2WZHA 1UKTA 2XVKA 3KEHA 2CERA 3T2PA 1B90A 3WUGA 1MQRA 4FLSA 2V5DA 3FHAA 2O9RA 1J0YA 4FNSA 3AS1A 2VMFA 5HBFA 2B31A 2J7FA 4B3KA 3UR7A 4LGXA 2FH6A 3VVGA 5DT7A 3CHFA 1LWJA 5CPQA 4J3WA 2F18A 4B16A 2VC9A 3GZAA 2JF6A 3DYOA 3CHDA 4ZENA 2VZVA 1NP0A 1JZ4A 1VJSA 3K1DA 3WY4A 5AY7A 4JFTA 3ALFA 3NUKA 1TCMA 2XFRA 4RL3A 4QFUA 2D1ZA 3SCSA 3RILA 4AD5A 5BRQA 2F7QA 2XUCA 1JI2A 3QHNA 5LA1A 1QHPA 5BXTA 1D7FA 4PCSA 1UWRA 2XM1A 4TVUA 4HZ6A 4AD0A 1JZ7A 2EJ1A 1ITCA 1W9UA 2W92A 1CXHA 4CGTA 4MTVA 3VIKA 1VFOA 1CECA 3KLLA 3AXHA 4M24A 5LYRA 2A3EA 3WL1A 1B30A 4UCFA 2DGAA 2O9OA 4QLKA 1WP6A 5I79A 1B1YA 2DIJA 4X0VA 3FN9A 5E6ZA 4QDMA 1GOWA 1W1PA 2UY4A 1TR1A 4FMVA 1EA9C 2FE0A 3APGA 4MB3A 3GNOA 1H0GA 3WNMA 3T0BA 1ISWA 4AD3A 3ZMRA 4ATWA 2ZUMA 3CZGA 3EJQA 2CESA 4Z2HA 3F5KA 3ALGA 3CPUA 4AMWA 1V3JA 3VIJA 4FK9A 4YHEA 2VX6A 4TX8A 2F1AA 2EPOA 2VVNA 2A3CA 4ACYA 1VFFA 3VIGA 3NDYA 1KBKA 3ZT6A 2YDRA 5A6JA 3A47A 2WMIA 1E3ZA 1BHGA 5FD0A 4J3SA 3T08A 3AIWA 2X8RA 2W66A 4P7NA 2WNWA 2D3LA 2EADA 4AD1A 1HNYA 4JAWA 2GUYA 3U57A 1H11A 4UR9A 1H3GA 4U2YA 5I77A 3AJ7A 1PZ3A 5CLTA 3VILA 5BXPA 9CGTA 3EDDA 3WDHA 3BC9A 1UR1A 2VRQA 4GZIA 4PTWA 4J27A 2BVDA 2Y4SA 2FDMA 3WQVA 1JXKA 3BVTA 1K9FA 1J12A 2XM2A 1XV8A 3VD9A 1GOIA 4QAWA 1MW0A 3W53A 1AQMA 3W38A 2DSVA 3MSDA 6TAAA 4Z2KA 4CU7A 2G3MA 4DO5A 2UY3A 3QGVA 1GORA 3WNLA 1I1WA 2F7OA 3AS0A 2V5CA 1QI4A 1NOUA 1QVBA 2YOCA 2BV9A 1E5JA 2DSKA 4EAMA 1HP5A 3ARTA 1JF5A 1ZJAA 4BZYA 2X2YA 3DHPA 2VZTA 1BYAA 2EEXA 4AEEA 2NW0A 1GVIA 3FHQA 4MB5A 1ZBVA 3AMDA 3GH4A 2CETA 2QF8A 1V3LA 4UQDA 1H5VA 3VU2A 1CXFA 4OOUA 4E2OA 4DM2A 1E6PA 2PC8A 3WIJA 1TQTA 5IFPA 2FGZA 4JHOA 1B3VA 1LG2A 3SCRA 1V6YA 1SYTA 3WD1A 3CLWA 1SR0A 4P8VA 3WH8A 1RH9A 2OYMA 1EO5A 3AYRA 5FKYA 3VMPA 4J3TA 4Z2GA 1VB9A 4YHGA 1QOXA 1EGZA 1HKKA 3VD5A 2BS9A 2J7EA 2WKLA 4DWSC 2XVNA 4CVUA 5M5DA 2OWWA 5HPOA 2YDQA 1KXVA 1JDDA 1V3KA 3NSNA 1KXHA 1JZ2A 1R7OA 4JFVA 2D3NA 4LQ1A 2ZE0A 2BHYA 3VX1A 1LWHA 3VM5A 3WEOA 2QLYA 4BCEA 4GKLA 4KRUA 3WQWA 2Y8VA 3WD4A 1UUQA 1HJUA 2PWGA 1RP8A 4P8WA 2QHAA 2WVVB 2J7CA 3QR3A 1E5NA 1ITXA 2ALWA 2X2IA 5E1QA 5A2CA 4V27A 3H54A 1UYQA 4PMXA 3D52A 2YL9A 1V6VA 1AQHA 4NF7A 5JIWA 4HZ7A 1K9EA 3CZLA 4E8DA 1DWJM 3ZR6A 4F66A 1PAMA 2V3FA 3AMLA 4M56A 4B9YA 1H2JA 2Y5EA 5HDRA 4W84A 1OGSA 1EDTA 3LX9A 4MB1A 4LX4A 5E70A 2EPLX 1E15A 2V3GA 2X05A 4U3CA 3AHXA 3EJSA 4FNQA 3WF1A 3EDJA 4AZHA 1VFUA 3D51A 3O6AA 2XFFA 1CGUA 3AIVA 5FOOA 1LQ0A 4BQ2A 4M8UA 4D6HA 3GXDA 2F7PA 3EJUA 2WVSA 1KQZA 1XGZA 3ARWA 3WD0A 1WDPA 4PMYA 1OD0A 2FYVA 3MMDA 3EMQA 4D6GA 1UHVA 4AIUA 4L4OA 1UQZA 1PPIA 1R46A 4ACZB 4DUWA 3S5YA 2O9TA 5D9PA 2DT2A 4UQBA 3O2LA 5IHSA 2WVVA 4S3JA 4AW7A 1PX8A 4PYSA 4HPGA 2TAAA 3LXCA 3HG4A 1B3XA 3S6TA 4GQRA 2XIIA 2XGBA 2G8ZA 4R5EA 2D2OA 3DDFA 3OB8A 3IAPA 3VOCA 1J0HA 2AAAA 2V38A 5BXSA 4HA1A 1F4AA 2JALA 1EQCA 3WF4A 2RGLA 4PMUA 2VX4A 3HG2A 4E8CA 4PCTA 2ZXBA 1O7AA 1OD8A 1BVNP 1WCGA 4K68A 2BY0A 2ZXDA 3BMWA 1C90A 2X1IA 4PUEA 3SEPA 4GINA 1WDRA 4JIEA 1FFQA 2DH2A 4JKKA 3VGDA 5ABHA 1QHOA 1HL8A 3VD4A 3EYPA 3WDRA 4AWEA 3N04A 3OLGA 3DECA 3RDKA 4HOWA 5GNYA 3H53A 5IFTA 4UQCA 4AZCA 4EE9A 4AZ7A 4OZOA 4ACZA 3KE0A 4KMQA 2J7BA 4ZE5A 2VX7A 1E0XA 2W5FA 1CWYA 3K46A 4RE4A 2PWFA 3A5VA 3AHTA 4IM4A 2X2JA 2VNCA 3LRKA 3WY3A 3UEQA 2BVTA 4P7OA 1W3LA 2DEPA 1JGIA 1JL8A 4CU6A 3F5JA 3PTKA 5AYIA 3UG3A 3AS2A 2CKSA 3PZGA 4W7WA 2X09A 4AYSA 1E6NA 3UERA 2DIEA 3MANA 3UG5A 1E72M 2WPGA 5A69A 4MJ4A 3BUPA 2UWFA 2IXUA 2ZXAA 3AIBA 2GJRA 5AC5A 3T09A 1HVXA 2VRKA 1GUVA 3HG5A 4OBSA 2GJPA 3SCWA 2WCAA 1U30A 2GJXB 2WHKA 3SUTA 2PF0A 3WUBA 4PMVA 4AMXA 5AYBA 2IGTA 2W4XA 3ARUA 4UQAA 2FHBA 1JZ3A 3WQ6A 1TQWA 1W2VA 3WFLA 1UR0A 2RGMA 4MNMA 3BGAA 3TTYA 3EJTA 4AD2A 3MMWA 4TTGA 1Y7VA 3UESA 3FY1A 3MMUA 4H8UA 1QI2A 2J79A 1E4LA 1ZB5A 3GH5A 2JE8A 4D1IA 1JFXA 3AIRA 1ZBKA 4PSPA 2XN0A 1E73M 2D24A 3CZEA 4TTUA 5DEZA 3GXPA 3W81A 3AZSA 2OSXA 4XZBA 3IGUA 4U33A 1E6XM 1EIBA 2J74A 1ZL1A 3RPMA 3WMBA 3N12A 1GJWA 1QI5A 1E6SM 1JYVA 4DUXA 4HMEA 4C7FA 2GJXA 1E71M 1E4NA 2GSJA 3WL0A 4J3VA 3SIMA 1QNRA 4DWSD 1MVYA 1XHGA 4U5IA 1HL9A 1HIZA 1NWSA 1JD7A 2VT0A 2CYGA 3OGVA 4S3KA 1J9YA 1C91A 1UWTA 2WVTA 1CZ1A 1WZKA 2OYLA 4UFKA 3I3EA 2UY5A 3WDIA 4FLQA 1GHSA 2ESCA 1TQVA 4W88A 4PSRA 2NT0A 3QHMA 5CZKA 1TQUA 1BQCA 3CIVA 3AXIA 5A8QA 1FP8A 3HMCA 3BAYA 3ZT7A 2XSBA 1B3ZA 1E6RA 1KGXA 3U5UA 5E09A 2CHNA 3ZJKA 1MFVA 2YLLA 4W87A 4BA0A 3T2QA 5A6MA 4MNLA 3FAXA 3NYDA 2IXVA 2DPEA 1HVQA 3FW6A 1OGBA 5I2UA 3NSMA 4HU0A 1TUXA 4UQ9A 1ZBWA 2XFYA 1W1VA 1UR4A 3ARQA 1H4PA 4HOZA 1JG9A 1UD8A 3GBDA 4HA4A 1RD6A 3AXXA 5BCAA 2VURA 4UZSA 1GPFA 4AMCA 1UKQA 1W91A 3WNOA 1JAEA 1W9DM 3ZJ7A 4W5ZA 2OW7A 3K8MA 4AD4A 5I0DA 1IZKA 3RO8A 1JZ5A 3ECQA 3PTMA 3CMGA 5DF0A 2YIHA 3BCDA 4WSJA 1QWNA 4X0NA 2WC4A 3T0AA 1E43A 1CENA 4WKHA 3AICA 5GPRA 1M01A 3EDKA 1TG7A 3ARXA 1ODZA 2PWDA 4XV0A 2Y8KA 1UH2A 3RIKA 1B31A 4ZEPA 4MDOA 2ZUNA 5HNNA 2DSZA 2WMIB 1NWUA 2XPKA 3N9KA 3U7VA 3CUJA 1VAHA 3WDQA 2A3BA 4AZIA 3AIUA 1R34A 1R33A 2O92A 4NZCA 4OJYA 1HTYA 3KL0A 2CBUA 2J4GA 3ZOAA 3WQ8A 4QCEA 1IV8A 1G9HA 3QHOA 1JF6A 4OKDA 1E3XA 1E55A 5I3DA 4F9JA 4ATDA 2F2HA 4A3YA 1KB3A 2YJQA 1WPCA 3L2MA 2PWHA 2JF7A 1H49A 5CJ5A 3BMVA 1GONA 2V3DA 1M53A 2J62A 3VO0A 3VTRA 1OB0A 1D2KA 1G1YA 4HU8A 1W1YA 3CGTA 3MV11 8CGTA 4D6JA 3IJ8A 1PIFA 3CUGA 1KR0A 1S46A 1TA3A 1BSIA 5D8WA 1AMYA 3BXWA 3AMKA 5LA2A 3SCNA 1W2PA 2ZX6A 3N11A 3L4ZA 1OIFA 4OUEA 5GNZA 3MV01 2ZX7A 2E8ZA 2WCGA 3A24A 7TAAA 2C7FA 1UD2A 2QMKA 4OBRA 3WF0A 2OSWA 1E56A 3A3HA 1FH7A 2EAEA 2DT0A 3RMEA 4C7DA 2ZWYA 4D6EA 3S5ZA 2AMGA 1ISXA 3CHCA 4PBGA 2EXOA 3VMOA 5GNXA 1CGVA 2JIWA 1CNVA 2VR5A 2ZICA 1V3IA 3M07A 2EPKX 4AC1X 3VGGA 2J8FA 2WSKA 1V08A 6CGTA 3QOKA 5C8BB 3DDGA 1MW3A 2A3HA 1W1TA 2E3ZA 2BY1A 5IXEA 3W4RA 1KTBA 2G41A 2JEQA 4CD4A 2YA0A 1R8LA 2EACA 1ZS2A 3BVUA 1PX4A 3DX0A 3L2LA 1QPKA 4CCDA 3GM8A 4TOQA 1XC6A 2W63A 5C71A 1CGYA 2OSYA 3W26A 2XJ7A 1HJXA 5BRPA 4URIA 3VDCA 1GQIA 5A6KA 5CGTA 1ISZA 3WH9A 3WNKA 2WXDM 3TTSA 2Z1SA 4TVDA 1M7XA 1MQQA 2DH3A 1KCKA 1C7TA 1KWGA 2UY2A 5D9MA 8A3HA 2ZX9A 5ABEA 4D6FA 1JI1A 2PBOA 5KEZA 1I75A 1HJSA 1XD0A 2VJXA 4P8UA 1UH3A 4W8AA 2WZEA 3BLPX 2BY2A 1PX3A 2EQDA 3ARRA 3BVXA 4CN6A 3PZMA 3SCPA 3PZIA 1TFVA 4UTFA 4UFLA 3UCQA 3GXFA 5I6SA 4BS0A 3II1A 4P7QA 2VR4A 4JHZA 2CIPA 4ML4A 2NSXA 4AZBA 3HN3A 2WK2A 1FH9A 3ARPA 4CCEA 4W85A 3K4DA 1CYGA 3HG3A 1PJ9A 1GHRA 4DUVA 4PMDA 1XYZA 1NOFA 3W82A 4MADA 1UD4A 5A2AA 2WYSA 3J7HA 2X0YA 4UZUA 2W61A 2J7DA 3WMCA 1BAGA 1W3HA 4PTMA 1NM9A 3PZ9A 1VJZA 3OZPA 2W67A 1DP0A 4P7RA 4IPLA 3CC1A 2OWCA 3VD3A 1GW1A 4WIWA 2BVYA 2F61A 1CTNA 1VBUA 1LL7A 5D9OA 1SFSA 1W32A 4F8XA 5BWFA 1KFWA 1KTCA 5E9AA 4PTVA 3ZJ6A 1LG1A 1V6WA 7A3HA 3L4XA 3AMGA 1JD9A 4B9ZA 1EDGA 5A95A 4TUFA 4YN5A 1T0OA 1R87A 4Z2JA 3WSUA 5CGMA 2ZWZA 4W86A 3GNRA 1CXLA 1QW9A 5HOSA 6A3HA 1J10A 1V0LA 4NI3A 1UZ4A 3AMCA 3I3DA 3PZQA 3LPFA 4AZCB 1TE1A 4J28A 1DTUA 1UD3A 1BF2A 1VFMA 2MANA 5A8MA 4FLOA 1XSJA 1CGTA 1M03A 4MNJA 1R75A 3E1F1 1E70M 1RP9A 1B9ZA 2WMFA 3NJ3A 2HVMA 4EKJA 3HJEA 4KGJA 5BROA 1QBBA 1JAKA 1UZ1A 5IDIA 1JFHA 1LLOA 3WNPA 4AZ6A 3SCQA 4JZ5A 2CPUA 3MUY1 5A6BD 1BG4A 3ZIZA 1JYWA 1X6LA 3AI0A 5FCZA 1XH0A 1XSKA 1AVAA 1NOWA 3GH7A 1UG6A 4DM1A 5DO8A 2VOTA 3WDPP 3F4VA 2OLHA 1G0CA 3EJPA 1XRVA 4P7LA 1EDQA 1XSIA 3W27A 4OOZA 1EXPA 3BSGA 4C7GA 4CKQA 2WBKA 5LA0A 2VCBA 1DEDA 1W9VA 5F7UA 1HKIA 2VTFA 2ZOXA 3BLKA 3HZ3A 2C0HA 4OGZA 3WH6A 5I78A 3AISA 5A6AA 2WB5A 3PZUA 4W8LA 1V0NA 1CLVA 3VSVA 3SUUA 4RE3A 4KGLA 4QLLA 1G5AA 2DQXA 2CBVA 1BG9A 2PI6A 2ZXQA 3WENA 5EFFA 1YHTA 4F9DA 2J25A 4W7UA 3N13A 3UR8A 4D1JA 1CGXA 3K8LA 3POCA 2NT1A 3LXAA 4AIEA 2J7GA 3U5YA 4PEEA 4MNKA 2CNCA 2CXGA 4UFHA 4IPNB 2GK1B 2XWDA 3GXIA 1EQPA 3A6OA 1R85A 1Q6EA 3AOFA 1C7SA 4NXSA 1WB0A 1WZMA 5CXPA 3SCTA 3VM7A 3BUBA 4H8VA 1JYXA 1KGUA 4EK7A 1DWGM 2E0PA 1KWKA 1R47A 1SMAA 4JCMA 4CN4A 2D23A 2VQTA 3DX3A 3N17A 5CPTA 5E0FA 4XZWA 4ATLA 4NSBA 4H8HA 3IJ7A 4GI9A 1QNSA 1C8XA 4D6CA 5FIPA 3WY2A 3SUVA 2WHJA 3ZSSA 3G6LA 1VEMA 3VIMA 1B0IA 1VEOA 4MB4A 1MW1A 2YL8A 1L0PA 3AQUA 4Y7EA 3AIEA 3DX1A 3LRMA 1CPUA 2E40A 3B8SA 4M82A 1OT2A 3CV5A 1E6ZA 5ABGA 3BLBA 3GTNA 2D20A 5BYWA 2GK1A 3GBEA 2ZUSA 4UOZA 4HOXA 4FF5A 3BH4A 3A4XA 1OCQA 1HF6A 1FHDA 3WFZA 4FNPA 1FFRA 4PTXA 4UNIA 5JUVA 3T2OA 4GQQA 1WNOA 1OBAA 1IT0A 1J11A 3WN6A 3VMNA 4AZGA 3AROA 2EPNA 5M03A 3AHZA 4V2XA 4MAZA 2CBJA 1GQLA 5M3WA 1EOKA 1H41A 4H04A 3VDHA 4GO9A 2E9BA 3B9DA 1UKPA 5DFAA 3FAWA 3B9AA 1MWOA 5EFDA 4EANA 5A94A 4H2CA 4UQEA 1JIBA 4MAVA 1DWFM 4OIFA 1MFUA 4PMOA 2O9PA 4GZEA 2XVPA 3A21A 4LYPA 5CSUA 3MU7A 2QMJA 1YQ2A 4D6IA 1K9TA 2J75A 1KXTA 3W28A 3THCA 3DX4A 1JNEA 1J0JA 5A1AA 2QPSA 1GQKA 4PMRA 4AY1A 2QV4A 3PZOA 2VRJA 5DT5A 4IUGA 3KL5A 1C92A 4E4PA 3WMSA 3WELA 1M04A 3N15A 2ZX8A 3SURA 2XIBA 3AS3A 5HPCA 1OM0A 1QBAA 3A23A 3S2CA 1QNOA 3NIYA 1PZ2A 1G94A 1F4HA 3LMYA 1VF8A 3TONA 1E6QM 1K6AA 2AOSA 3THDA 2DT1A 3PBGA 1OWQA 3ARZA 2WZIA 3D4ZA 1FP9A 4DWSB 4ZFMA 4CUCA 3BAXA 3EJRA 3VINA 1EHNA 3OIHA 4XUYA 3NDZA 3VIHA 4JFWA 1KQYA 5ABFB 1O6IA 3OG2A 1DWAM 1TZ7A 2YFOA 4MDPA 1HXJA 3VNZA 3VIPA 2YL6A 3CZKA 1UR9A 2GDVA 1FA2A 1TQSA 2JIEA 4BQ3A 1H09A 2A3AA 2D0GA 1TA3B 3M46A 4Z2LA 3OLDA 4WK9A 1XCXA 2G3JA 2DSUA 3VDAA 2VZUA 1QWUA 1SMDA 4NZJA 1V0KA 5TD4A 1KGWA 1CXKA 4M80A 4PMNA 1B3WA 5CSYA 5FL0A 3GDBA 1ISYA 1VEPA 3SUSA 3LPGA 3WH5A 4D72A 1V02E 1TVPA 5D4YA 1GOMA 4W89A 4UFJA 3IAQA 2Y2WA 4GXPA 2DDXA 4KH2A 4DWSA 1OINA 3AZRA 3PZNA 2QPUA 3EMZA 4U5KA 2FHCA 2JFEX 4PRWA 5GQBA 5ABFA 1V03A 4UOQA 1DWIM 1QNPA 1K9DA 5I24A 5CQ1A 3BVWA 4W8BA 5D8ZA 1DWHM 1E0WA 1W9XA 1GOKA 3VNYA 3SCUA 4M1RA 1H1NA 1V02A 1ZBCA 2J78A 3KZSA 2J8GA 4KRTA 1MQPA 2VO5A 1WAWA 3ARYA 1JNDA 2EPMX 5CLWA 5EB8A 2ZUTA 2BHUA 2YBUA 4N0RA 2VZOA 4CD6A 4U2ZA 1HT6A 1W9PA 2PWEA 3PTQA 1GCYA 1ZJBA 1NWTA 3NSXA 3N1AA 4MPKA 4PUDA 1HN1A 3OLIA 1UA7A 2DT3A 1E4MM 2VI0A 4W93A 3W25A 1P6WA 1WKYA 5DMYA 4AXNA 3D50A 4WKAA 2YDSA 5A6SA 2ZUUA 3TV8A 1IZJA 1HKMA 1FH8A 3HU7A 1GJUA 1MXGA 2XTKA 1BPLB 2CEQA 1QI3A 1J18A 2XN2A 3AFBA 4GIAA 3PZVA 2EBNA 3L4VA 4NX0A 1LF1A 3MUIA 3ZSTA 3O9NA 3LXBA 1HX0A 3QOMA 2YA2A 3W6LA 1R86A 1I1XA 2E8YA 5A2BA 3M6DA 2VUYA 1W3KA 1KBBA 2WANA 5ECUA 4GO8A 1B2YA 2BY3A 3LPOA 3WQ4A 1QI0A 1CIUA 3I3BA 4LXFA 3POHA 3L4UA 3CUHA 4V28A 3RM9A 1BGGA 3KL3A 1X1NA 5A3HA 1XH1A 5AC4A 1MYRA 4TXEA 3FXYA 3WY1A 2E9LA 3VIIA 1V3MA 3F5LA 3D5HA 1U2YA 3MUZ1 1D3CA 4F79A 4U3AA 1UD5A 3OBAA 1WDQA 1UKOA 1BLIA 4WKFA 3BVVA 5A6LA 4DO6A 2WMHA 3BSHA 1C3FA 3CZSA 2WHLA 1KR1A 4RE2A 1UASA 1J0ZA 1HJWA 2ZX5A 1BYDA 4Z2IA 5FL1A 1UD6A 4CD7A 4QP0A 2G3IA 2VZSA 1E0VA 1GNXA 1PBGA 4UFIA 1E1FA 1XYFA 1WDSA 3VX0A 3OA5A 1SZNA 3RCNA 5EMYA 4AEFA 3CZNA 1UQYA 4AISA 1RPKA 2WWDA 2WC7A 1LL4A 1CXEA 3BAWA 5JBDA 3ZM8A 2OW6A 4JL1A 2X2HA 4B3LA 3WF2A 3TA9A 1HJVA 4CVWA 2ZUWA 2FH8A 1JZ8A 4FLRA 3VKKA 4N42A 2IUZA 2WC3A 3ZJ8A 1XCWA 1LJYA 3A4AA 2DSWA 5IHRA 4W5UA 2XWEA 2OYKA 3D3AA 2Q8XA 1US3A 2BHZA 1CGWA 1UOKA 3EDEA 3LRLA 1GQJA 4L4PA 2ZUVA 2GDUA 2C8NA 2WAGA 3IK2A 1UWIA 1QW8A 1L8NA 4A4AA 4UFMA 1CDGA 3SUWA 1UR8A 1V6XA 2X0HA 2WLZA 1TMQA 3L4TA 1QNQA 1XD1A 3DYPA 4HPHA 1N82A 4YPJA 4QCFA 3MKKA 2WLYA 4HTYA 4D71A 1DHKA 1NWRA 3K4AA 3OZOA 3VD7A 3IJ9A 1FHLA 4NZFA 5A8PA 1TVNA 2YBTA 3RJXA 4D6DA 2D22A 2HISA 4NRSA 2WCSA 1GZJA 3ZQ9A 1XH2A 4AIOA 2CCRA 3WD3A 1BGAA 1UA3A 5JBEA 1KXQA 3G6MA 1ISVA 4JL2A 1BYBA 3BAKA 2BNJA 4P8XA 4J7RA 2VCAA 4TX6A 3VIOA 4BF7A 1UWQA 4BQ5A 4PN2A 3TTOA 5I5RA 2W62A 1E4IA 3SCVA 1BFNA 4GI6A 1JDAA 3TP4A 1VENA 5BXRA 1WO2A 1BYCA 1CBGA 1HP4A 1US2A 5A8OA 2E4TA 3GNPA 3MUAA 4Q22A 2WSPA 3LPPA 1V0MA 4UOJA 3L4WA 1NP2A 2WMJA 2ZIDA 3BAIA 2WKGA 3MO4A 1QHZA 2Z1KA 4LPCA 4U31A 2WM0A 3WF3A 1A3HA 1G01A 3RM8A 3PHAA 1R7AA 3KWXA 2Y24A 4XB3A 3GYCA 2XYLA 4R27A 1GOQA 1CLXA 1ZU8A 1PIGA 2OWXA 4WJXA 1J0KA 3L4YA 2XN1A 1UWUA 3AYSA 3OGSA 2D0HA 1J01A 3ZO9A 2W91A 4LYQA 4AYGA 2WWCA 3CZJA 3ZR5A 4CN1A 4ZXOA 4QLJA 1OSEA 5D9NA 1A47A 4CD8A 3K8KA 3TTQA 4M29A 4HZ8A 4HMCA 1HXKA 3AIQA 2VVSA 3ARVA 1LL6A 4KWUA 2XGIA 2V3EA
chains in the Genus database with same CATH superfamily
2RJHA 3ZVVA 3MYOA 4OZHA 4WLCA 3BH8B 1MCPL 4JDVB 4LLWB 2WXMA 1I2NA 2NX3A 2AXWA 4C4KO 3NJMA 3E6FB 4HNOA 1PL3A 4Y9CA 3UG4A 3CNYA 4PMZA 3GZ3A 2GQ8A 1FORH 1UYWH 2UYLB 3DI1A 3QB7C 2FYYB 1QR1A 1KEMH 1PDZA 5IFJA 1AXSB 2R0KH 1UWXH 5DK0A 1RZ7L 1BJ1J 3RO6A 1EHAA 2QKSA 3GU1A 4ELMF 5GGTH 4GXUN 1I7TA 3GU2A 3UPRA 4B3VA 1OAQH 1N2VA 2C7UB 4UAOC 1L6FA 5FA3A 3L5XH 3WD2A 1NELA 3GINA 1PNCA 1U1UA 4Q7NA 2IKGA 2Q09A 4YHNA 4L4VB 3RYMA 1DYZA 1NBZB 2GL5A 5AVQB 1U33A 4O10A 1CXIA 3OHMB 2GGIA 4CQ9A 1BFVH 3KJ6H 1NGXA 1EH9A 2VSMB 2CUIA 4AQZA 5CJQH 1H8NA 4J3UA 4E38A 1QO3B 4E41A 5I5MA 2ATAA 1BTCA 3A22A 2NTFA 1NGQH 3LV3B 3DOSB 3DARA 4CVXA 1OALA 4GPNA 1EXUB 1NJ9A 2XWBB 2GWGA 2D4DA 4JTJA 1J0IA 5ESQA 1S7QA 1Q7QA 3G1VA 1BVNT 4NJGA 1V7NL 2OO0A 1OZQA 2RH0A 1WZAA 2QHRH 3CZ8A 3TYDA 4J8QA 2QCHA 3NAAH 2SEBA 3S2LA 1O7DC 1Q6CA 2GLKA 3WL9B 1BVZA 3QH3A 1XF4B 3H55A 2HFEA 4BFGA 3HI5L 1L6XA 5CAHA 5DSCB 1N67A 4FLSA 3FO0H 2DQUL 2OPCA 3U9PL 2BJML 1GZGA 3AQZA 3F85A 1LWJA 2PFHA 2LU7A 3ZGIA 4EN3D 4R3SB 3PY9A 2X9YA 3FUIA 3QV6A 3US0A 4PCSA 3DZ1A 3GW3A 2DZXA 1LBFA 4E0CA 3C0QA 3E5BA 1B30A 2X12A 4G43B 3S7GA 1BXAA 1XYMA 3H7RA 2J5LC 1TR1A 3P4LA 2WJEA 1LM1A 3WNMA 3NSYA 3K6DA 4I7UA 2C19A 3GKFA 1ZSXA 5FDYA 4TX8A 5E2VH 4A7QA 4Z3HA 1J1PH 5INCB 2YDRA 1ZE3H 1X9RA 3T08A 5JHLH 3OJMB 3K81A 1JNLH 4R0LC 4UR9A 2XVBA 2EC9U 1JVOA 1DOSA 2FIKA 5CLTA 9CGTA 3ECUA 4OECA 3KP1A 4JGJA 1R19A 1D5IL 3OC8A 5T33L 2KH2B 4IIGA 2HP4A 3BVTA 5BU9A 4BR1A 3TROA 2Y1AA 1QP1A 2TRHA 3DENA 3D08A 4H0GA 4FQXC 4DP8X 1T20A 2PRMA 2VELA 4DO5A 4AW4A 3NQ7A 2XINA 2PA6A 2GJJA 4QG6A 3GO1H 3GVWA 1OGAD 2QPXA 4XBSA 3W22A 1UBPC 3O8XA 4PB4A 1CZ8L 7REQB 4WEUD 3RVWC 2AXJA 1FNLA 3URAA 1BYAA 4QAIA 3GVGA 1AE6H 1E6PA 1UW9A 4DX3A 4OM0H 3JWDC 3TLQA 3ES6B 2HMCA 4LBEB 3WE6A 2CZDA 4GKNA 1IGTA 2OZ4H 3UXLA 4Z2GA 2QPEB 4KJWC 3P4MA 4OH2A 3VD5A 1HK6A 2FUQA 3LDVA 1ZLUH 4Y2OA 2HRLA 1OP5K 3W1RA 1YCSA 1I9JH 5F8RC 2JQAA 2VLKD 2V2TB 2UZIL 2AXGB 3UDWC 5DJZA 3LA4A 2CR0A 3PPCA 5E1QA 4HJ0D 1OGAE 1DBMH 1AQHA 1F4YL 5ABAA 3ZR6A 3VXTA 1IGSA 1KJ3L 1H2JA 2P52A 3SQRA 4AEIH 3HI1A 4K7PL 2XA8H 2JQZA 1AYRA 1EHXA 1WHPA 1NAMA 3AIVA 2R24A 3ARDA 1MWAA 3QJOA 1IBHA 4AX3A 1XEDA 2J7LA 3RVTD 5DZVA 3AWOA 2X4SA 2RAMA 1ECYA 3NCJH 2ZOWA 4LKCA 1FF5A 4MAUH 2V38A 3GVVA 3ZTNL 3QUZB 2VLKE 1W80A 4WZHA 2MOQA 2GABA 1QFPA 1XF1A 3IJYB 3CJPA 1DXIA 4K71B 4P2RA 3SDAD 3ORWA 3STZB 5IQ9A 4Z0BL 4AZCA 3CD4A 4GP8B 5DRWB 4RE4A 3GWQA 5SX5H 2CIKA 4WQ6A 4ODHL 2Y1VA 3UEQA 3TEUA 2I9TB 1ZANL 1KM0A 3GTVA 3HJZA 1JTTA 4WI9A 1ZUAX 5JQ6H 4ZMNA 1E72M 2G5UA 2EDDA 2IXUA 1CMOA 3SJVB 1HKLL 1GGYA 2GJPA 1RA5A 4JKNA 2WHKA 2BNQB 5EU7E 2J3SA 4JXCA 4UQAA 1WH0A 4HFUH 4K1GA 4NNXA 2FMNA 1KB5A 4WWKB 5ID1B 2BZCA 4HS6B 5DRXA 2R1MA 3MMWA 3GEFA 3LZNA 4OKVB 1QI2A 4J1OA 4JQ4A 4U1SA 3DO4A 1TWSA 2O6FA 1CI1A 4KROD 3FFDA 4XZBA 3D85D 2JGYA 3WZ0E 3IFLH 4BFOA 3VI3E 3DIDA 2IAMB 1XBDA 3KYKH 4DF9A 1A1MA 2X1PA 2QSVA 3Q5TA 4FQ2L 3PGDA 1E1CB 5E4EC 4I77L 1HL9A 1ZS8B 4Q6XA 1T1XA 1U92A 4LVHC 5C0IB 1V55B 2I57A 1CJYA 1UENA 4YWGL 3BPLB 1BQCA 4DGIL 2ISWA 5TDNA 3GSWB 1WFOA 3SRKA 3RPBA 2IH9A 2CHNA 4LPUA 1CFBA 4KOBA 4E68A 3NYDA 5E23A 1BV8A 4UTAH 5CP3A 2DPEA 1JPFA 4QS6A 2HX7A 1DUZA 2ITEA 2NUTB 4CNTA 4XNDA 3ULAB 3JWOL 4UB9A 1UD8A 1ETJA 2VXTL 1GAFL 1GPFA 1Y18A 1RCYA 1DDTA 1F3RB 3FCUB 1MLBA 4UNTA 3M0YA 3K5XA 4FQQB 5T3XH 5T1MB 2Z27A 3VD0A 2E6YA 4I89A 4EAEA 3QIUB 5F4WA 1E9ZB 2Y8KA 3W5NA 5BRBA 2ZCHL 3MLRL 1OY3B 5F1IB 4ZMZA 3IVTA 2WN3A 4X4YB 5HI5D 1DVFC 4FIQA 4KIRA 4Q52A 1JWSB 3OJDB 2FJGA 3V0VB 1JF6A 2WXRA 4XMPL 3T7VA 4IFKA 4RNRA 2QJJA 1GONA 1ZLWH 1PD1A 2XJKA 1P4LA 2HH0L 1V7ML 1HQRA 5BOZG 4EI6A 5EEUA 1RAMA 2HN7A 2NUXA 2JIXB 1N19A 4DXVA 1JRHI 1D5ZA 5L9DL 2R69H 3W00A 4N26A 1W54A 4M7KH 4NNCA 2ZWYA 3LV6A 2ZUYA 2OZTA 1UC5A 1RUKL 3MV9A 3NIDE 4G42A 4QRUB 1A4JB 1JJKA 2VR5A 3FXGA 1CL7H 3ISYA 4UOW0 3V4LA 4OLZH 4DOHB 2WO4A 6CGTA 5DZ9A 4X6CB 3DDGA 2V5YA 3KLSA 3R06B 1XB8A 4PPTA 3AAMA 3QXBA 3W4RA 3W2MA 3VACA 4DN3L 3T8XB 3GKWH 4YDZA 1CT8B 1JCLA 4PFHA 4Q8QA 4OFYA 1IEHA 4RMQA 1A3RL 3OQRA 3V4PH 5K9XA 3QDAA 4KMTH 1EEXA 1TFHA 3G1FA 1XD0A 3KOZA 4W9LC 1GXEA 1VFTA 5BQ7A 1ZA3B 4CN6A 3SCPA 4UTFA 4GIRA 4HIEA 2UV3A 1IKFH 3LY0A 5KSBB 1MSPA 4M5TA 2JVUA 2NNAB 4HYVA 2BW4A 1XW8A 3VYNA 4QKXB 4W85A 4U1LA 1JSYA 2CHWA 3FQXA 3O4OB 3WHE0 5KN5B 1WBZB 4UT9H 1G7JA 1N2RA 1DP0A 1OAZL 3CUPB 2VN6A 4FG6C 5DR5L 1N5YH 3WXVH 4NNYB 2IKHA 3EYFA 1ITBB 2PO6C 3EWWA 3CT2A 2AI0L 1YJDC 3B8DA 3VFPA 2NUWA 1HI6B 3QJUB 1R0AH 1LP9A 1TIMA 4LUJA 2NRDA 1P1ZA 5EO1A 2IADA 5HI3C 3LPFA 1BF2A 3RY6C 3GNML 3ITTA 4UTBA 3OMZA 2DY2A 4P2VA 4RAVB 3VUSA 3B43A 3LEVL 1LLOA 2QW5A 3WNPA 1BG4A 3EFFB 5AW3B 1OQOA 5DMMA 1XR8B 4OZHE 5K1VA 4K5LA 4LEOB 3GIVA 2D2GA 2IS7A 5CFHA 1EVUA 1XRVA 1EDQA 4OOZA 4PY8J 5JTWA 5DGRA 4NZRL 1BIHA 2A7NA 2Q6WA 1T80A 1DVQA 1GC1H 5A2LH 2C0HA 4HIJB 4XWGL 4HEPA 5F9WC 2CBVA 2IOIA 3C2EA 4JQIL 3U1PA 3KPRA 4WGWB 5D04C 4GABA 2DZSA 3AWGA 4YVNA 1Q65A 3PUCA 2XQYA 1H9DA 3S2MA 3DJSA 4HSQA 4EDXB 1R85A 3P0YH 1B4TA 3H70A 1TZIB 4M7LT 3HFTA 4UUJA 4AHPA 4O2CB 3T6QC 1P0BA 4CMMA 1KELH 4P9ML 2XU2A 1SMAA 2HK0A 3VKCA 1OXYA 1YY8B 1W0WB 2CRZA 1XLAA 3G5ZA 2CZEA 2EC9T 1AZNA 4UQ3B 5HHXH 1X7FA 3IRPX 1UTDA 1KGIA 3BWUC 2WHJA 3R11A 3H85A 2X9XA 3MJYA 1VEOA 4LSSH 3PHOB 1HH9A 4HQVA 1J93A 1L0PA 4R7DB 2B4CH 4A8IA 1XPGA 1IWBA 3FPYA 3DX1A 1CPUA 4LCQA 1YMYA 4I9TA 3VSQA 3KR3L 1A4BA 4S3AA 4MQ7B 3FT3A 2IV9A 3DSNB 3Q44A 1X39A 5FJRA 5EEXA 1A22B 2FB4H 4D3CH 1OBAA 3VMNA 1X9LA 4GQ0A 3STGA 2WNNA 1DQWA 4JZOB 1S9WB 1XBZA 5CLYA 4ROQA 4XOCA 1T0MB 3CMFA 1MFUA 3DI3B 1XYBA 4RUBA 4ZYKA 5CSUA 3GFYA 1LL1A 2J75A 3W28A 4PM1A 1Q9KB 4BIKA 5DT5A 4UTWC 1US0A 3BOXA 3SQOL 3GHEH 3TA3C 4CGUB 1BGXH 3VXSA 4H25A 1I9IH 1R24B 3KAOA 4FQXA 2BG5A 2YPLB 5D8JH 5EO9A 1G94A 1NSJA 4PG9B 2W81C 3H2CA 5DXYA 3GUFA 3ZPDA 3MUGB 4GACA 3K6FA 1OK8A 1ULVA 3O06A 1G9EA 3Q8EA 2X28A 3FSTA 1TZ7A 4HJ0C 5ID0B 4DERA 4PCPA 1KIQA 3UD6A 4GEJA 5KJ4A 3O2DA 3I6EA 3JR2A 4KXZI 2ZJSL 4P46B 3ABSA 4Z7VE 3SPVB 3QZOA 2G3JA 4XC1L 2VZUA 4M8VA 1BQLL 3TJIA 3V36A 4M80A 5CINL 3IAQA 1OINA 4KX9A 3HOJA 4BKNA 2BNUA 3RVTC 3UACA 5J1TC 3O8XD 1JGVL 5CUSH 2GTZA 4XO9A 1S2UA 3BVWA 2LLEA 5JYLA 5EPMA 5HNTA 3UDWA 4Y9FA 1VKXB 5IBXC 2J8GA 1G1OA 3ZMEA 2BHUA 2YBUA 4DP1X 1NCIA 3IIXA 3GHRA 2H1LM 2Q8BH 3QQWA 5HGGS 3LCLA 3ID7A 4KO7A 2WNGA 4CAGA 1BVOA 1GYWA 3L9BA 1TZGH 4N9EA 2QQLH 1I9EA 5SWZA 4ZFGH 1OFOA 4BV1A 3L4VA 1LF1A 4QUOA 1E27B 3LXBA 4RDQF 5IHWA 5B80A 4IKLA 2G2RB 5EBWB 1HCYA 4YHMH 4XBEL 1KBBA 5D4IA 1BXVA 3M1BB 2YN5A 4I8DA 2AV7B 4L3CB 5MHSE 5FEXA 4ONHA 3BUYA 5I6PA 4HK3N 1ZGLM 2QCGA 3IJEB 5JA8B 4RPPA 5F0JB 4GMTH 3CUHA 2J12B 1BGGA 1QWGA 3FUEA 3WIIH 2F9RA 2E9LA 4ERSL 1XBRA 5DCCA 4U3AA 3ARDD 1G6VK 4L80A 5BZWA 3G1RA 3QW9A 5F8QC 4PWFA 1IYXA 4U49A 5T3XE 4ES4A 3DNKA 2VZSA 1XYFA 3UBXB 3OA5A 3FU3A 4ZRGA 3OEXA 3PWPA 3VFMB 1A6AB 1D5MA 1ESOA 1B6UA 4PJFB 4UM9A 2XZ7A 3ZJ8A 1XCWA 1KDIA 5AD0B 1FFNB 3LRLA 4PS3A 2YEQA 3IDMA 1L5GB 3H9ZA 4P2RD 4UFMA 1J5HA 2F8XC 1TWWA 1IJNA 1GGBH 3GTHA 2AS5M 1DO5A 1EBAA 4KJPC 2R91A 3E2VA 1XO8A 4L23A 4JM4L 1HL5A 3SDYL 5I74B 1RAKA 4AGOA 3L45A 4S2CA 3MLXL 5GGSY 2NV2A 4APQB 1BYBA 4RNFA 1MLCB 4XC3L 1YUHB 3SKOA 2DWEB 1JPSL 4P3CH 2EDJA 3TTOA 4K7VA 2W62A 4IRSB 5IT2H 2ICWA 1WO2A 1ZVSB 1BYCA 2I60L 3WBWA 5CF3A 3LPPA 4CW1B 3TNNA 3L4WA 2EVFA 1TZ8A 2H26B 1LEKA 2REQA 1M3UA 2E27H 1K8DB 4ZW5A 3S36L 1Z69A 3IIVA 2XYLA 4PEKA 1CLXA 4QNPE 1G4SA 1YC7A 2OWXA 1M42A 2XWRA 2F6XA 2NSQA 4TQ8A 4QTFA 3T0WA 5B3NA 3LIZA 4HPOL 2H6PB 4MM1A 4OLXL 4U1IB 2F8QA 2QJHA 1LEIB 1NMCB 1J6PA 3TN6A 4U7KA 3C9NB 2JB5H 5DJYB 1KCLA 4IDJH 3QDGA 4Q9RL 2ARJB 2Y0FA 3W6YA 1X3DA 4NCC1 1NC2A 1TWZA 3LZLA 2HPMA 3VB8A 3CLEH 1MHPH 3FCPA 3EF7A 4XP5H 5AWNL 1OAKL 5I23A 1RMFH 1FCQA 3ETBF 4JZJB 1EAPA 4DEUA 3U4EA 1XF2A 3ROLA 2OMYB 1XFPA 2VFGA 1OCWL 1DVFA 3B7YA 3SBPA 1A3LL 2B5IB 1W0VB 2AHIA 3OWRA 5FGSA 4WSKA 1NJJA 5CKGA 1SOSA 4NENB 5EUOE 2XIDA 3AZTA 1R5IA 3RI5K 1OIMA 3GMPA 2JEPA 2ZOKB 3GSRA 4OD1L 2GTQA 3GI8L 5IB1A 4EUPG 3S37X 4FS9A 2NX5B 2BXZA 2XSAA 5F1OB 1MIEL 3FRPG 1B3YA 1HHKA 1NAKH 2ATSA 1OP4A 3MRRB 1U95B 1MCWW 3TBSA 3CUFA 3TVMB 1IF2A 3VSUA 1BMZA 1WZLA 1ZE3C 2BHFA 2P26A 1H5BB 5CJMA 1CEOA 2E7FA 4BBWA 3IU3A 3T6ZA 1J8HE 2HTLC 3DO7A 5MENE 4F57L 4XCEB 1XQLA 1MREL 3FT4B 4BZ2H 4IPIA 1RSCA 3PPEA 3B5TA 1PZCA 1RFDH 3MP3A 3N9RA 3TNMB 5J8OA 4DJEC 1IEBB 1SXBA 2CHOA 2AEIT 1X5FA 3UEZA 2CERA 2XFWA 2RA1A 4FNSA 2Z1VA 4X6DE 1FNGB 2J7FA 3S35L 3MV9D 3MYJA 3UR7A 2B08A 3RQ3A 1B3IA 4JW3A 2DQJL 1VBGA 1G6RB 1KJMA 3B7SA 2AEPH 4S1SL 4NZ3A 3OMAB 2H1XA 3NQCA 3ZTJH 1EP2A 2WKJA 5GGQH 1GKQA 3NZUA 2W92A 3WLTA 1AL8A 3MBFA 2ATPA 4OFYD 4Q6IB 2Y70A 5BO1L 5CJOH 3TPUA 2DGAA 5HA7A 5EBLB 4N8VA 3FRUB 3SBQA 3ROOA 3O3AA 3CSFA 2J6EL 3GSVB 1T03L 4Z78B 1FVPA 1RULL 4MB3A 3G5XB 4IBLT 3NA9L 2XIQA 2XWJB 4BHYA 3EJQA 3G3MA 2PO6A 4ZK8A 3NDYA 4AXWA 4I3RH 5E8OB 5EOCH 3P11H 3AIWA 2W66A 1B2WH 3ZIYA 2E7LC 4A55A 1RXLA 4JAWA 4Y9PA 1FJ1B 3U57A 3RY6A 4GAFB 3UR2A 1T2QL 1FXQA 2F08A 4LF1A 5J4MA 3FGCA 4L9ZA 1A64A 1JXKA 4RDBA 3V75A 2HRHA 2KZWA 1OAXH 4JG0H 4BZ1H 3RRQA 3W38A 2ZSWA 5IESL 1REQB 4CU7A 4EN3A 5FF6A 1OPGL 2WNXA 1FL5A 1QVBA 5CEZH 2VDKL 5E1HB 1H6EA 2H4EA 2VKWA 1UBSA 2ZCKL 4I87A 3TIDB 3BMXA 3BOVA 3ARTA 3KLHC 1DQUA 2X2YA 5G4HC 2EDOA 1F76A 5IVNA 4G6CA 5E2UH 1H5VA 4E9VA 5EU3B 3U36B 2FGZA 3NP4A 1DBAL 4FKEA 2I7OA 3L1OL 4P5RA 4WJ8A 3DUUB 2OYMA 4GKTA 2EDTA 5LNUA 1JCNA 1BAFL 5EHFA 4OI9A 4WTZG 2XVNA 2B3RA 4BDVA 4PUWA 5HPOA 3HE7B 4NNBA 3QPEA 1YW1A 1W0YT 3JRKA 2RUSA 2H6OA 3E9UA 1U8MA 2QTVA 4GKLA 2Y8VA 4GW1B 3QR3A 1EBPA 5GSVA 2BCKA 2ALWA 2Y7SA 4ENZA 2C1PB 3RDTC 1S9XB 1PGRB 3N85L 4NILA 3D52A 4J3ZA 1LP9E 1RZPA 5KVDL 3LQLA 3CZLA 4E8DA 1L6GA 4ZA0A 5D37A 1T0PB 3UVAA 1I1CA 1WA3A 5F9JA 4AUBA 3WG6A 3P54A 3WF1A 5LJYH 4OTXH 1OEPA 3O6AA 3DPBB 1NMAL 2BCMA 2WVSA 3L5IA 2DQGL 2X0VA 4V1DB 3MMDA 3Q05A 1F6YA 2Y07H 4U3SA 5T8GA 3EWXA 3FULA 3FBKA 5DQDH 2XZQL 1LT8A 3KWUA 4GQRA 3EX6A 2P8LB 2WIIA 3GHTA 2TRSA 2AAVA 4PBDA 2O1AA 4BFBD 1LO5B 4KITB 2ACSA 1OKEA 3UROR 4UTWA 3WF4A 4IJCA 1O7DE 3I9AA 4Z7NE 3CQPA 3TA3A 1VP5A 4ABVA 4E4UA 4NP4L 1ML1A 5TDPA 3FK3A 3OF6A 3KS6A 1AUSL 3VGDA 5ESVA 5ABHA 2WUBH 5DUPH 2YCJA 2ZXEB 3TX9A 3QMTA 1KIUB 4NT6A 5E8PA 2WJ5A 2IDFA 3EKCA 2VLKA 4QTIH 1TYEB 4FCAA 4QNEA 4RGMB 1MI3A 2IKJA 4NDMA 2BVTA 1CDYA 3VE0A 3ZE1F 4QRBA 3V1PA 3RU8L 3B0VC 4HIIB 2VLJB 1UXWB 4YXKL 4NLHA 4LF3A 2X3CA 5J6SA 3MRKA 2EIDA 3QCUL 5A69A 3VXSD 5F3BB 3W7MA 4FQXD 3VOFA 2YUVA 4TQTA 3FTUA 3RU6A 4TU1A 3PF2A 1U30A 1RZ8B 3IUIA 1N59A 3FQWA 2HVNA 3CFDB 3PWLA 1ND0B 1I1YA 3WQ6A 4YSAA 1WF5A 2NQCA 4LW7A 3WJSA 4XX5A 2DQFA 3P3UA 4KEUA 5EG6C 3RVWD 3RA7H 2LVEA 2JE8A 2NVAA 5GIRA 3AIRA 4YIQA 1E73M 5IBXA 3QFDB 2KQMA 2WTOA 2VC6A 1J4EA 1DDHB 3OJ2C 1EJTC 1AHWC 1JN6A 3EADA 3REQA 3KCJA 3GX9A 3DMMC 2A6IA 1QNRA 3CIQA 3WLQA 1FDYA 3FK4A 3VVWA 1ZDQA 4NKDB 4QR7A 3VXSE 2G97A 4GFXA 3JUZA 1GOHA 2DVXA 1C91A 1IAIM 2H32B 4WI5A 3ZWSA 4GXVL 2LU3A 3AXIA 2Q8AH 2GFBA 1NBQA 4C55A 2QCLA 1K2DA 1U93B 3BZGA 3BP7B 4CC0A 2XPYA 4MNLA 2OX5A 5IKCA 3L12A 4K2UH 1XGUB 4C60A 2DLIA 5F96L 3IDXL 4M6NH 3FVMA 1U58A 3EBGA 3GGWB 4R83A 4JM0A 3GZPA 3GBDA 2HDJA 3BQ6A 1W1IE 4BEQA 1UKQA 2F1EA 1YSOA 5SWZD 1TPH1 4R4FH 3WQGA 1E5CA 5DD5L 4HXAH 3TLLA 3PDOA 2YIHA 2I24N 1RBLA 3ARGC 1OZMA 1LVEA 1E51A 4WY7H 4GA8A 3GSNB 4M3HA 3TF4A 2J1WA 5CJ8A 2QDVA 4OB5L 3U0TB 4M1GL 4R5XA 5DD6B 4UTCA 2NY0D 3PPGA 3WDQA 5KYXA 2XRAL 2UZXA 4IRZL 2R6OA 1CBJA 3QG7L 4GNKB 2IGFL 1SVBA 4OKDA 1ELSA 1E55A 1RUSA 1ADQL 1KFAL 5C0CB 5ERWA 3VNJA 4MY1A 1WBHA 2PTZA 3TA4D 1B5TA 4QM1A 1CTOA 3E0IA 3MRDA 3UQNA 4Y19E 1NCBL 3V0AC 2Y36L 5GGTA 4RSYA 4R8WH 2HMIC 2F7FA 3P8JA 3KRSA 1FVCA 1RVKA 4UM9D 2GSGB 1EBHA 1OX5A 4PR5A 3QGAC 4JK0D 4XNUH 2EXYD 3OKOA 3KW7A 5ANMB 5AVHA 1EBGA 1U5VA 4JE0A 3CYJA 2O61B 4CC4C 1YNLH 2WZMA 4C7DA 2VITA 3TXZA 3KDOA 4IICA 1OG0A 1QMLA 1JRHH 2YB4A 1ENUA 2ZAIA 2EAWA 1WXJA 1P5UC 5IDZA 1AGEB 4N22A 3SDCC 3VXMB 6REQB 1EJ7L 2DZAA 1DBBH 3I84A 1LO2H 1U83A 2BY1A 4QTHA 2VQ1A 5FKAB 3I02B 2ID5A 7XIMA 1ZS2A 1QPKA 2WQRA 4CCDA 1AD1A 4N2BA 5B38G 2Y85A 5HVWA 1D7KA 1KWGA 4Y9MA 4OFDA 3X1EA 5ABEA 4F2FA 3BKCL 2G37A 3CHPA 4K94H 2PDNA 4LCIH 4TVSa 5FDWB 5C08A 1GC1C 1MUMA 5FOBB 2EVIA 1MUJA 5DZJA 4KK9C 2W1NA 1N6UA 5DS8B 1WQVT 5T8IA 4AJWA 4PV8A 1L6WA 2A99A 2CAKA 1XFBA 4FMFA 3U1SL 5BPPA 4GG6F 3V52H 1JMXA 3I50L 3AU1A 2VDMH 4JX0A 4M93B 2OQJA 3W82A 4Z23A 2YAPA 1AP2A 1RHHA 2YBGA 4HUUA 3M0VA 4LVEA 1BFSA 3UABA 5I7GA 5H2ZA 2W67A 4DEFA 3N6JA 3QDGD 1GW1A 4Q4QA 5IHZB 2BVYA 4AYFB 1VBUA 3LKSB 2AQNA 1PG7W 3WFBH 1IGMH 2N1TE 1KTCA 5DVPA 2B4CC 3C12A 3WEXB 1DLFH 2J5WA 4FGMA 3TFKC 5EORH 1N18A 2A73A 1JPEA 2HJFB 4PIRF 5FGCB 2OEMA 4KAQH 1TSRA 5MEOB 3AMCA 5AB2A 2G9HB 4G7QB 1OP3H 5A8MA 3LZFL 3LTPA 3E2QA 1DVFD 3BFQG 1M7PA 4DI8A 1PDKA 2WMFA 3UBHA 4NWUL 4WVRA 4LHUB 3W56A 5EOTA 1EF3A 1QLFB 1UZ1A 3NFSL 4CNOA 5JHLA 3T8MA 4X63A 2NWSA 4KTEL 4DYEA 2R8SL 1MHCB 1TTUA 3HBPA 5C0GB 3A3WA 2VUKA 4P7LA 5CEZE 3USBA 2GGHA 2DUAA 1TVBA 1I8MA 5L7XH 3QDGE 5REQA 5F7UA 2VTFA 1UB6A 2FR4B 2C6QA 4G5AA 4DJEA 1B54A 3QNZB 1W72L 2Z8WC 3K72B 2FPYA 1BX2A 3CVHL 3X1FA 2V6AA 3KPNB 3LS4H 1BECA 3EAUA 2J7GA 1CE1H 4MNKA 4JZNB 3EFDH 3KVQA 3GHUA 4A22A 1IGIL 3D1MC 5D72H 5DJ8B 1HJBC 1PKQB 3CYVA 1R2RA 2MEJB 3DFTA 1KXVC 3VK5A 3EO9H 2KDYA 2ISVA 4PJXB 2XICA 4O16A 1IC1A 1TJXA 5HHPB 1R2TA 4W70A 3WY2A 1AZVA 2EE6A 2OZ4A 4Z3EA 1B0IA 4PFMA 1IM3B 3W9EB 1X1OA 3U25A 1MFEL 4JRWA 3DBXB 2PEVA 2GK1A 2BRRH 3K80A 4H8WL 4FNPA 5DCDA 1X44A 3QI9B 5FHBL 4PE8A 3QZWA 2PUZA 2NXZC 5C6WH 1JEZA 1G4MA 5A43C 3GVQA 1A1NA 4CCZA 2UY7B 5E94B 4PJIF 1GYCA 1JNHB 2OMXB 5GS2D 3MODL 4H2CA 2E7LA 4FHKA 3GG8A 5DCBA 2O9PA 1A1OA 3OKMB 2KYIA 2HV5A 5AUMA 4DIAA 1WWWX 3FSZA 2VRJA 4LO9A 2ICEB 4E4PA 4LCVA 3WELA 1EFZA 4KVCH 4FG6D 3VAVA 1FV1A 4NYYA 5HPCA 1JWUA 1Q8JA 4WGKA 2QFPA 3OVUB 4O4YL 2PO6D 5KZMA 1K6AA 4Y2DB 4JTSA 1TG8A 2Q3OA 3IFOB 4KZ0A 3SYAA 4EXBA 1R5YA 1E9PA 4XPGH 3UAFA 4HYWA 1TJIL 3HMWL 4XSMA 3OG2A 2FGWH 5HI3D 2PDJA 1BVKB 3K2IA 2Z4QA 1NDMB 3CCHA 4RLDA 1ZCCA 3COTA 3V35A 1WIOA 2ZTBA 5CEWA 2K7QA 4JYEA 1FN4A 3LKNA 4PBWD 4XPAL 3UXFA 1YRKA 3FB6A 1HFBA 1KNWA 4XN7A 2J6VA 3CZUB 3UAJC 4ZUUA 3U2SA 4PRPB 4KXZH 1NFIB 2GK0A 4KCVA 4C56B 2OB3A 2GEQA 2WINA 1MCCA 5CD5D 3B2MA 3IBOA 2XQBH 4Z7VA 1IWPA 1ZVHA 5AYYA 3JV4A 4UOQA 3EWCA 3UF9A 3IIOA 1CYXA 1ES0B 3F84A 4Z1CA 4M7ZC 2C71A 2WLIB 1G1CA 3NDYE 4QYOB 3RDTA 2WOYA 3G8RA 5LBVA 2VO5A 1MQPA 1W0MA 3IDNB 4WXYA 3F6JA 2K3TA 3WS6C 4N0RA 4CD6A 4JJOA 5EMJA 4R34A 3R10A 1AZRA 2HKAA 5DBUA 3DGCR 1RU9L 4O9HH 2P8CA 4LKXB 2YDSA 1BOGA 1S7UB 3HU7A 1MXGA 2XTKA 2VZ1A 2QVMA 2YD9A 3G18A 5FO8A 1Q7MA 3BZ4B 1VPOL 4LSUL 3PZVA 2VRAA 4OIIL 1HX0A 3CC5A 2ZFAA 1LNUA 2IQAB 3M6DA 1EZUA 2CDGA 3BZFA 3QUKA 1IBGH 2CUHA 3RBGA 5ECUA 1QEWB 5DUBA 4ODXB 5JPNC 1RZQA 5KTEH 2LHAA 1FNFA 2V9TA 3UZZA 5AC4A 3VWKC 2FPVA 2OJEA 1YRRA 3CDGA 3EKLA 3QZBA 4LGRB 4G7VH 4JY6A 1I3RB 1BLIA 4U1GC 4W6XB 3CZSA 1D2OA 3NCMA 4G6KH 1RJQA 2ADJB 4UTAA 4XAWH 5TQ2L 2MRYA 1TITA 3UG8A 4NERA 4AYBA 4Y9NA 2IPTL 1SZNA 4BFRA 3T78A 3W2LA 4LOUC 2ZZ2A 4Q33A 1S9YA 2FJHB 1BEYH 4MMYA 2K9UA 3PWUB 3RVUC 3WS3A 3TA3D 2BNRB 5H2BB 3A4AA 4S0SD 3A67H 3TBWA 4QAMB 4XIMA 4OZGA 2C8NA 1BZDA 3OF6D 1K72A 1X7IA 4JM2F 2G5BA 4OCXL 4ZMQA 2D7TL 1NUFA 3ESVF 1WDWA 4HPHA 3B9KB 1TLMA 3MV8B 3CFUA 1TWIA 2A4EA 3RRXA 5CU5A 4F5CE 2WCSA 1GZJA 2Y2TA 3VD1A 5EL1A 1Z5LA 2GI0A 4NZ5A 1IIIA 5T1DL 5ISZE 2JKSA 5KZCD 3WGVB 5DHVH 3VIOA 2E77A 3BEVB 4MCYB 1AHWA 2VB5A 5TF1L 2VN3A 3P80A 2QVTA 4OGQC 4HFWB 4OZ4B 3L6FA 3S6OA 1QSZA 3DIVA 1US2A 4NO5B 3SE8L 2M8XA 3DMMA 2MUCA 2WMJA 1VZHA 4M1CD 2F6KA 3SZKC 4NZ1A 4PJBF 3FTWA 1DQDL 2R69A 1EUAA 4JO1H 4XAPA 5AW7B 4ODVL 1SEBA 4WI8A 3L4YA 3KYNB 4LFHG 1GGCH 4NKOB 4NUJA 3UTZB 4RLIA 1G6CA 1NF7A 1A47A 5TE4L 2NY0C 3TTQA 4OW6A 1UM6L 1RZFH 3S8FB 1I8KB 2XGZA 1UACH 1JXGA 1UFGA 3PM6A 3U0PA 4GY7A 4OBTA 3B0XA 4LOVA 1SO6A 3ARBC 4MA7H 3DVGB 4ZQNA 1M68A 2FZNA 3L3JA 2QKIC 1BQHG 3ZVHB 3KPSE 4M5PA 1A4LA 3ARGA 1A0QH 4PGDB 1AGCB 4G83A 1Z66A 3V4PA 1RK6A 1CVRA 1LE9A 1BVLA 2ZZ6A 5HDWA 1RLWA 2B1AH 3FQNA 2EXYC 4JFYB 4JDYA 3I9GL 4A8NA 5BZDB 4JHMA 3WBEA 4HUXA 3LNMA 3PWVA 4FXGB 3BP6B 4TVPL 2Q76B 3VPLA 2W6RA 4XTDA 1CDUA 1QRNA 2Y1YA 3MA9L 4HEME 1MFBL 2DRUA 4LNVA 4XPTL 2LLGA 1FZOA 5FW6A 5KG9B 5CPOA 2XVGA 4Y1TA 4JANB 4PJHA 3QHZH 4X7CC 3BKML 5CZVL 1E42A 2IOOA 4YSDA 2PW1B 4UT9A 4Z3JA 1GGIL 1EOMA 1WFUA 3TOPA 5EUOA 1AHMA 4AWSA 1JGLH 2OOGA 4N2IA 3KUMA 3UZQB 2BODX 4RNHA 4CC4A 4GVIA 1O6VA 4CL7A 1QA9B 3OPZH 5D2YA 4KJPD 2ZA2A 1NH6A 1P5UA 3KOFA 5AHNA 4MMXC 3SDCA 4PGEA 3CLFL 4NP7A 1M6OB 1MNUL 1FDLH 3CN2A 1KA9F 1OQFA 2FLRT 2BASA 4AK2A 4KKXA 4YXLL 4ZUWB 3VAEA 1J8HA 3W7QA 5MENA 2AJSH 3CEPA 3NTCH 2EVJA 5EZOH 2V5DA 5DY2A 3QLDA 1LQSR 4FXKB 5LAXB 3P9MA 3PHQB 3VVGA 3GMLB 3NFNA 1OVDA 1XI3A 2OSLA 4NQSA 3HM7A 5C0AA 2KZ1B 4PJ7E 3WY4A 2IKIA 5E6RB 4JFTA 4ODWB 3PFRA 4A2EA 3C52A 1YEFL 3NT0A 5FIEA 1H7WA 5BRQA 4U0RB 4X6DA 5LA1A 4N28A 4MD4B 1JZ7A 1BWWA 1EPVA 4DFIA 5E1AA 1CXHA 1P48A 3FU7B 1EWHA 3T4YB 4B9IA 1Z6KA 2ZNWA 4AH2A 1M1SA 3QS2A 2NQHA 5C08D 1ACCA 5IP4A 1W3TA 3TH3T 1Z5YD 4M03A 1XIEA 5K33A 5GJNA 2FE0A 4G1NA 3AUVA 4TMBA 2ZDSA 3MFFA 4LIQL 1NUNB 1S78C 3CHQA 5CP7B 3P60A 4KJYB 5GGUB 1LO4L 2HX9A 1NCCH 2G60H 3NCWA 5F0PB 3MQIA 4O58L 3MDJA 3IN0A 3GMRA 2PPEA 4Q6JA 3EJJX 4L7ZA 5F7YC 1G43A 1Z8AA 4PTWA 2A9NL 5D1QC 3CK0H 1IL1A 1N9PA 2WO3B 3ZO0A 4Q2ZA 4NAMA 2W8CA 3QRFM 3ABOA 4MKMA 2GJZA 1NGYA 1HQ4B 5C08E 2BP0B 2I1OA 1QVOB 3SW6A 1AS8A 1QYGH 4FIRA 2QGEA 3FKRA 2WWKO 5E2WH 3BCJA 1QNZH 1FRGH 4JUSA 4KVNH 3EGSB 2O5ZL 1GVIA 4FJZA 2KZBA 3RUGF 5JHDB 5EC1B 3BLOA 3J8F7 2LVCA 4U1KB 1RH9A 5JXAL 3J27A 5EIIB 2Y3NA 5C9JB 1OFRA 1LOQA 4DZ8B 2HTLD 1P7QA 1E6JL 1IFHH 2J7EA 3UU0A 2IBGA 5M5DA 1S3KH 1GZQA 2YB1A 1KXVA 4YEFA 3UMNA 2MHAA 4N1EA 2DTSA 1EL3A 1R30A 1O66A 1EX0A 5KS9B 3P0XA 4DJED 3VX1A 2X0WA 1L2UA 4KRUA 5I16A 2CLRB 1HJUA 2I5GA 5IGXL 4B4HA 4QIUA 1R5VA 2HRWA 3RI5F 4HJFA 1DZBA 2W9LA 4XP9H 5U7SA 1V6VA 2O30A 4ZX6A 3LRGA 3WUWA 3QXDA 2V3FA 1IGYB 2NY3B 2EPLX 1TDQA 5FA5A 5CCGE 4BXVA 1E5UI 1JF1A 2P44B 3CQJA 2IMNA 5IG7B 2YK1H 1J8VA 3L3DB 3GXDA 5FYLL 1UROA 1F42A 2CLZA 5L0QC 3STCA 4HGWA 4HWEL 4Z8FH 1XS2A 4AIUA 1I31A 4WNQA 1Z7AA 1R46A 1QBMH 5I1AB 1WC7B 4WEBH 3H9HA 3IM1A 3V18A 1EJOH 5CBJA 2X4TA 5EYWA 3REWA 3L2NA 4P5SA 1LM8V 4NY2A 3RWDA 1A0EA 1BVNP 3MAWA 4BRJA 2W94A 2X1IA 5CD5C 3HC3L 1FFQA 1JV2B 3M0JA 1SYVB 2YKLH 3N04A 3W2DL 3V7PA 5GS0H 1RVGA 3Q2LA 5I71C 3SCMC 2R9HC 3WJZA 1LK2B 4G56A 2VAAB 2VDQH 1WT5C 3ESNA 1XAKA 4RGNE 1Z9OA 2V5TA 4JPKL 3BKJL 4NJIA 4MJ4A 4I3GA 3B97A 4GUHA 2AK1L 2GVJA 2J4WH 5I17B 3IVKA 3HC4H 4E5XB 3UAJA 1GUVA 1WCBA 3SCWA 1S38A 4PMVA 2XYBA 2EUWA 5EY5A 3B4NA 1K5NA 2K6YA 4LV9A 3E8VA 2RGMA 1KTRL 3U2CA 2PDMA 3KLHD 5E2TL 1CX9A 3UJIH 1GGTA 5LKYA 4JRXB 2YZRA 1UFUA 5CSBA 1KKOA 4ZZ9A 1QFWL 3L9CA 5DEZA 4WUUA 4YS4A 3WS6A 3MDUA 1IXNA 1RJYA 3QFWA 4DP5X 5JQ9A 4D9PA 3O6KH 4GLEA 4D9RD 2ZRVA 3MBEC 4UTTC 1HSBA 5HVFB 4ZGYA 2UWEF 2Z91B 1UCBL 1FO0H 5AHIA 2XU9A 5K1JA 3MC0A 4K36A 2J8OA 4R0LA 5HDQH 5AOJA 3QXTA 3VXUB 4PJ9C 4F8OA 4Z7UF 1T4KB 1FP8A 1OC5A 3RDTD 4GYBA 4M6QA 3EGXB 1E6RA 4G9DA 1SR9A 1AGBB 43C9B 4RR4A 5JPNA 1TETL 4ODBD 4JJ5B 4A8RA 3LKPA 3D48R 12E8L 2VZ3A 4MKTA 5CJNA 2CGZA 3VWKA 2XFYA 3ILQC 5IQ7H 2O4EA 4YDLB 2CKBL 4X7FC 3WNOA 2ZP0T 4HCRH 2DQTL 3MDWA 1MUCA 3L7FA 1OANA 4D9RE 5CH9A 1FVEB 4LAQH 3RL2B 3H22A 1A14H 4Q14A 3UBXI 4K94C 3FOLA 5ICYA 3RIKA 4PRDB 4L6HA 4OV5B 5EZLB 3MJ6A 4GW5A 3V6OC 1RVFH 4JRYA 3FCTA 4M62H 1VYRA 5I09A 2Q86A 1R34A 1Q7ZA 2VXSH 4MLIA 4WHTB 4H8QA 3WQ8A 3LN9A 1XR2A 3P2VA 4UB0H 1CDIA 1XCTA 5KW9L 4M1CC 2UZYA 1XLGA 5MHSD 1C08B 2EVHA 2A1WL 3EX4A 4YHYC 2P5PA 2J62A 1TNNA 2PD5A 2NXYC 4XAKD 4HU8A 1TTBA 4D6JA 4K23H 4Z7OB 4AK1A 2H8XA 2X4RB 4MXVF 4WWID 1QSVA 4WGXA 4Q4MA 4ZMTA 3RKPA 5IY5B 2VC2L 1DE4B 3HN8A 3CAKA 3L4ZA 4H1ZA 5T3XD 5TH2A 1FIGH 4WW2C 3IXTA 3G08A 4M4RA 4Y19A 1XL6A 2TRYA 2AQSA 4KPHH 4JQ3A 1PV8A 2WYTA 1ZHLA 1DQML 2EXOA 4Z7QF 1MY5A 1C9SA 4X4KA 4YNYB 3UTQB 2E68A 4ADJA 1P0DA 2WSKA 1RUML 1TV5A 1RIUH 1VGKB 2MQ3A 3C09C 3MNZB 3VFGH 4KZEL 3BVUA 3O6MH 2DYPB 4OZFB 3LTVA 4XAKE 3R43A 1DSFL 1TZ9A 3R13A 2ENJA 2WSQA 1KULA 2XJ7A 1ZTXL 3M0IA 2KT6A 4TLKA 3APNA 4QE5A 1KCKA 4UIMA 4LUTA 4BZ2A 3JV6A 2ZX9A 5D96B 2OL3L 1U3JA 2VEKA 3DMMD 4ZMLA 4C6JA 4R9HA 2HWZH 4P3WA 2YZ5A 2HUEA 3ARBA 4P2AA 3FN0L 4MSWB 2GSHA 3ARRA 2RFGA 1TFVA 4OZGE 1NOAA 3OR6A 1A7NH 4JFFE 2QKIA 4O28A 3VJ6A 2VR4A 2KZKA 3U7WH 2P8BA 1E8YA 2WK2A 4ORGB 3RG6A 1MJUH 2Y7EA 4O13A 4KO9A 4MADA 1ZT1A 2R1YB 2WQWA 1OD9A 1WFJA 2AGKA 4GG8A 1ME9A 3MROA 2B20A 2BFVL 1F0LA 1PKMA 3SBRA 3FTXA 4P7RA 3EZJB 4IPLA 1CLYL 3UC0L 3BSZL 4PJAE 5D9OA 4OFVA 1SM9A 2R1XB 3NSCA 3L4XA 3ARGD 4LRNH 4BQ9A 2VUOA 1D9KC 3HNTL 3BIKB 6A3HA 3VTAA 2X6VA 3B6SA 1M3JA 5ANHA 4KRMB 3DX8B 2NX1A 2FLIA 3UH8A 1QRND 3QQ9C 5BV7B 2QR0B 1R5WB 4FOUA 1P4BH 3R1ZA 1FQ9C 4DGUA 3ONBA 5IMMB 1OCCB 2F7IA 5I8EB 4HC1H 1CFMA 3AAZA 2EIMB 2H9GB 3DHJA 3QQ0A 1I7RB 4MMXA 1PZDA 5AAPA 1DXEA 5HYEA 3CZFA 5HGDA 2WBKA 5LA0A 5EN2B 3U7AA 4HH9B 1HKIA 2HMID 4FP1A 2DV6A 4UDTA 4WV1B 5E1IA 2WB5A 2WQPA 1HCVA 1BG9A 3N91A 4TUOB 2FATL 3EYVA 5BOOA 2F54B 2BERA 1CGXA 4TUJB 1RURH 1A5OC 3FS2A 2VFIA 5CSZB 1N3NA 2O72A 3JQOB 3QCTL 4GJTB 3C6CA 5GS1C 3VFUB 3W7EA 4MA1C 4UTJA 3SDCD 1QRNE 4EK7A 3DIFB 1PCWA 5C8JA 1F02I 2ENSA 2Y25A 4O1FA 3VFNA 3FC8A 5E0FA 3K4ZA 2YPVH 3VXPA 5JW3H 3F2LA 5AW8B 2R7EA 4PJHE 1A9VA 1LBLA 4UNUA 1ZAJA 4GBDA 2J8UF 2NZ9C 4WDTA 3O41A 2Y7MA 1JVKA 3GLEA 1J8HD 1E8ZA 3R18A 5MEND 1VPYA 4RFNB 4C6CA 1EGVA 5D2VA 1PZ5A 1F4WL 4KK9D 2INFA 4S3GA 1HZHH 3PE9A 3UO1H 5C0AD 2VGIA 2EPNA 5EWIL 5F1NB 1MFDL 4QO1B 5FXCH 2IQ9L 1UVQB 2R8WA 3D4CA 1YTEA 3HLAA 3MRMB 1H3PH 3FAWA 4XD6A 2V6HA 1Q9LA 4ALAL 4NUWA 2IQ0A 1EP3A 3CU7A 3T07A 4X3ZA 3SB0A 1M2OA 4N9GA 5DC2A 2QPSA 3GRWH 1C92A 4NKCA 5D1QA 1W37A 5ITBL 4EXAA 3X12B 1MHEB 5EOCJ 3C60C 3SKMB 1OX4A 4H1LG 4NVTA 3TJLA 1HXMB 5IB5B 4DQWA 1S7XB 3ZDZF 4RZ4A 2C0AA 5D93C 1NDVA 2OQHA 2JXMA 4RMRA 1TSHA 5BVJA 4CUCA 3TFKD 5BRZB 4K8RH 1Q0XL 3MCYA 3K0WA 4XUYA 2VDRL 4QLRA 3GC4A 1R3TA 5C0AE 1DWAM 3ENLA 4MDPA 2VOMA 1U91A 2FJUB 4JHBA 2EH8H 1J5OL 4ZFFA 3MGAA 3OLDA 1RK1A 2ZTKA 2CU0A 3J07A 1G9MH 2VDPB 4BINA 3IRCA 1TTRA 1RUAL 3DRQA 5DZLA 2A9BA 2YPKB 5ALCH 4AKPA 1B3WA 3S34H 5PAZA 3HPSA 4RGNC 5IB4B 4LC8A 3SO3C 1FWTA 2QPUA 5GQBA 4FOMA 4HLZH 3O0RH 2OXHA 4TN9A 3D30A 2CMRL 5L4IA 4B5EA 1W9XA 2HLAA 4XQ6A 4M6AA 2GJ6E 5KVGH 2EPMX 4R26L 5CLWA 4BCZA 1OGTA 3PV6A 3QJFB 3STLB 3L65A 2C3GA 3N1AA 3THAA 1P7QD 1XXXA 1HN1A 1E4MM 5DMYA 3RL1B 4FABL 3IDIA 3G6DL 1B4KA 3C5ZC 5I02A 3DN5A 1KMGA 1F58H 5XIMA 1FLTX 3GYEA 3MCMA 5CN2A 1EDYA 1RCXB 4NRZB 1SYSB 4BFIA 2ZYSA 3E6HB 4FKKA 2ASHA 4HSAC 2WZTA 5CPMA 3W11C 3R4DA 5KETA 4NZUL 4G6ML 2A38A 4HNTA 3VIIA 4IG2B 3MUZ1 2NXZD 1RIVL 2C9XA 1MN4A 3WLSA 1EXBA 3HEIB 3SCMA 4C83B 1Q13A 1GNXA 2YAHA 2OI9B 3O3EA 4UFIA 3DERA 1KYUA 1WDSA 3GD6A 4KUCD 1WT5A 4ZAKC 1YN6B 1LL4A 1CXEA 4JL1A 3MA8A 3TA9A 1QJWA 2BWDA 5F3HA 5T1LA 1IRAY 4F4RA 3BDKA 2Q8XA 1US3A 2DI7A 1GMIA 4WU5B 2OLAA 4LLYB 4XNQA 4MA8L 4F27A 1QW8A 2NCMA 5ITFA 1TX2A 4I18C 4LDOB 3RCYA 4MIMA 1ID5I 4WY0B 3IGKA 1Q63A 5JW4R 1D3GA 3KBJA 4YPJA 1FCBA 3W0WD 3MSPA 2NZIA 3ITVA 3N2CA 2BGQA 5BOJA 4DJMA 3IJSA 4WHCA 3ME0A 3HRZB 3D09A 1FNHA 2J1YA 3IAGC 4LNYA 2Y5TB 4HHAB 4LTSA 1B4LA 5D6DC 5I5RA 2P10A 3UAJD 4WHYH 1EJSC 5LXGH 3MBEA 4G8AC 4F5CA 3HR6A 3MUAA 4YHIB 3UPAA 4UTTA 1AO7B 5K59F 1CGSL 5IMKA 4BQCA 3U6RB 4Q58C 2WKGA 2NY2C 4U31A 5C1MB 3K6SB 5ISZA 4F1SA 1R7AA 2Y24A 2VGBA 5I1KH 3QK0A 3U9UB 3HZMA 3BQ5A 4PJ9A 1XLEA 1UP2A 4JDBA 3MLYL 1KYDA 2QJIA 2W91A 1JHTA 1CG9A 3ELAT 1JHLL 4JDEA 1Z9LA 4WUUD 1Q2SA 5HJXA 4NNAA 4UAHA 1Q1PA 3LEXA 4KHXH 3W0WE 4R7OA 4GH3A 2B77A 1LP6A 3HLKA 4HMCA 1S7RB 1THCA 1RZIA 3MRNA 1LL6A 4KWUA 2XV6B 2GUOB 35C8H 5TK2A 3LENA 4JPVL 3QVAA 4GI8A 3D3FA 4EE2A 1DSYA 4JHUA 4FNRA 1P6FA 1HDMA 2A7RA 3D18B 1EJWC 5LBGA 1Q6DA 3NIGF 4HIPA 3P93A 1TVHB 1K3UA 3C3NA 1FWSA 3S4SG 4G8FB 4XNXH 4Y8AA 2WVUA 3MTWA 3D25A 3Q7JA 5AN7A 2R2HB 1R3WA 3QO0A 2DQMA 5D1XE 1PTAA 4OGYH 4GQ9H 3V6OA 1PQZB 1VRXA 4PGCB 2A0LC 4JREB 3VWKD 4U4IA 1RQHA 1DVUA 4L1WA 5CC5A 1INDL 3KPSA 2J57A 4WF7A 3IANA 1YECH 4WUUE 2X7LA 1C1EH 1T41A 5FK9A 2XKSA 3NJIA 3KLKA 2P5EA 3UWWA 5CHNA 4HULB 4YDIH 1AW2A 4AKQA 4UMSA 1FRBA 2PB1A 1E1EA 4LOUD 3M7FB 4HU4A 4MJ2A 4HEMA 5FUCC 3KVJA 4H41A 1A02N 3RVUD 3ZDYE 4P5MA 3SY8A 2QHLA 4JRYD 4KKPA 1XDJA 5ENWB 3RM4A 1VDGA 3TYGL 5JIPA 4WW2A 4Y4KB 2LAGB 3ZBMA 2XPGA 3I6GA 2X0UA 2ZOLB 4DO4A 1EUTA 2PDHA 2XZAL 3BG3A 4NJ9H 1BREA 1ED3B 5IVXF 3CTTA 1P1MA 2CE6A 2OTWA 2OT0A 4D8ZA 4O53A 4G8GB 3GXTA 3GSXB 4ZXLA 2X2GA 3F12A 1TNMA 1KTLA 3UAAA 2FL5A 1YEDB 1W9BM 3NL5A 3DURB 5DJXB 1KENL 3AHYA 4F0HA 15C8H 4CQCA 2YGNA 4I48A 4QBXA 1Y5VA 3UTTA 4IOIA 1PYWB 5ETUA 4NJAH 4FFYL 1EPFA 3LNFA 4DKAA 4FQLH 2XG4A 2AJXL 1QCWA 4XZLX 5AC6A 2IWFA 3WIHL 2YBVA 4PTUA 4Y19D 1JXFA 1F3WA 5DRCA 3I75A 3FHAA 3U6XA 1YPZB 1MIML 2Z8VC 1JPST 5EC2B 4JRYE 1Q4WA 2YMOA 3U46A 3X3FL 1P2CB 1VBJA 3CHDA 2WXNA 4GAAA 4S2BA 1HC1A 3LS5L 3REVA 3R89A 4RL3A 4QI3A 4AD5A 2R2BA 2CW6A 3WK1A 2XZCL 4UU9A 3ONCA 1MCWM 4XZMX 3OW1A 3EWBX 4Y16B 4NUGL 3CVBA 4PJ7A 3RNKA 2O9OA 1F6AB 4ZQPA 4WK0B 1U8PB 1O6SA 2Q7YA 3USZA 1UXMA 1CO1A 3ARBD 3T3PB 1SFJA 1PAZA 4HKXA 1F45A 3U4KA 2BSSA 4P61A 1GJIA 4ATWA 2ZUMA 1O0VA 2JQMA 3ALGA 2GGJA 4DAFA 2A3CA 3LDBC 4PC8A 3HBQA 1O68A 3MSRA 3CFIC 4QF1A 2FAUA 3QRGH 3US1A 4RRPA 1D9KA 4HK5A 3WJWA 4DQAA 1T7ZA 3BPOB 2VJ8A 2ZTJA 3VILA 5BXPA 2FKPA 2GIXA 1YEGL 2VRQA 4GZIA 4XP6H 4R7JA 5F4XA 3OWEA 5I76B 1HOCA 3ABQA 1XV8A 1U8OA 1BYNA 4Z2KA 4NZDA 3MKGA 4FZEH 3QIWB 3GSQB 1YE6A 1SJHA 3EH1A 1A5MC 1TO3A 4PY7A 3FN3A 1LDPH 1JK8B 4F3FB 2WKOA 2C1HA 2DSKA 2WO5A 5CLXA 1HP5A 4X5RA 2EYTB 3Q43A 4YDVB 2PKDA 3S88L 4NM4H 2WLMA 3IMSA 4D2JA 4ZUVA 3T05A 4DM2A 3N41B 1TLKA 1KGYE 4LLDB 3VOGA 3HBGA 5GS1A 3PJNA 1WK0A 4YHGA 1WXZA 2A3LA 4NSKA 2IANB 1G7MA 2IW0A 2WN2A 2YXMA 1IGJB 1KCRH 5AL0A 2ZRYA 2Z6FA 2VDLL 1X98A 3LBOA 5C2BL 3WXWL 1RSYA 3CDFA 4BCEA 3RR4A 2W79A 5IM7A 4NJJA 2PWGA 5IOKA 3IEBA 2ZWKA 2X2IA 4F7TA 1YPXA 4OZIE 4FI6A 2X7WA 2QQQA 3GNDA 4PMXA 5CEZD 3A13A 5KVGE 3L5AA 4H6KA 1UPMB 4F66A 1I82A 1YMHB 3AGVA 1VADB 3OG6B 1LWRA 4QXUH 3DSFH 2OFJA 3MLTA 2IF7A 3LCGA 3VFRA 1LQ0A 2AJUH 4MAYC 1YYLH 3EJUA 4ANXA 3IRSA 1PJWA 3OHXB 4S2SB 1OD7A 4UTMA 4QOKB 3T2NH 4HK0A 2XIIA 5CM1A 4TKWA 2UXFA 1LBMA 1H51A 1TJ0A 4O14A 5I1EL 2A6JA 1G9NL 2ZXBA 4G7SB 5IUCA 3C60A 4IS6A 4Y4FD 5ICXA 2ZD0A 4Q6KA 2BMBA 5DYOB 1S78D 3HS0B 1U4FA 4C8XA 5IFTA 1DFBH 5JH1A 2WJDA 2W27A 4CBZA 1E0XA 2NQLA 2AJVL 3HF3A 2VXNA 3NQMA 3WLJA 1W3LA 4C57C 3F5JA 2O4MA 3UG3A 1GVFA 4NQCA 4W7WA 3L3HB 2A6LA 5D1QD 3O45B 4PULA 2AVGA 4JS7A 4YDKH 3NGJA 3R8RA 4APXA 4L61A 1KCZA 4XI5D 1HILA 1XG3A 4ZB0A 3GS0A 4HYRA 5FLUA 4RISL 1W2VA 3D8MA 1UR0A 4M6UA 1M65A 1S1RA 2BNQE 4JKWA 5CZ0A 2WQUA 1ZBKA 1SZRA 1NGPH 3GR4A 1FUNA 1A5FH 3RE0A 1CDCA 4XK2A 1S9KC 3M8OL 4ZSUA 1USQA 1NIUA 5MERA 5JOEA 3GSOB 1UM4L 1KCSH 4DUXA 4PJGB 5D9SA 3QEHB 4QRFA 4AIBA 5D1QE 4IOSD 1G7LB 5IHLB 3C5ZA 4RMWA 4RZ6A 2DDQH 3MJMA 3QPXH 2AEOA 1CZ1A 4CJ0A 3MJ9H 2PLTA 1BZQK 4PSRA 2NT0A 1BF5A 4XKYA 3QFJB 3U9WA