3W3OA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-053
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-053
rcsb
source organism Trypanosoma cruzi
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w3oA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w3oA01
1I2NA 3GNNA 2YSWA 3UWUA 2E1DA 3LX9A 3TA6A 2AQWA 2KZHA 3M47A 1XBXA 1JUBA 1A5SA 2ZRXA 3ELFA 4C1LA 3V75A 2CZFA 3LV6A 3QEZA 1W8SA 2V5LA 2FJKA 3RLUA 1X1ZA 1N55A 1SO3A 2X1UA 3NVTA 3NQ8A 3W7IA 1DOSA 4FNRA 1WDWA 2Y7DA 4IJBA 3BG3A 1TTJA 5D32A 2E6DA 1KV5A 2VC6A 2ABAA 3O05A 3S5NA 3OEXA 4LV4A 3OIXA 4FIRA 2C14A 3HG2A 1G7VA 2V8ZA 3NZRA 1LOQA 2ZFAA 1WA3A 2DU2A 3OBKA 1OX4B 2X2GA 3DHFA 4NZFA 2EF9A 2JGYA 1M6JA 1JCJA 3LCGA 4GUFA 2QCGA 3ZWSA 3PBWA 4AF0B 1PIIA 2TYSA 2B7QA 2QCLA 4O18A 3LI0A 1I4NA 1YTEA 4QAIA 4QSHA 3VCRA 1WOAA 1T96A 4H4IA 3H53A 4N9DA 3S5ZA 4UTJA 4BFAA 4NX5A 1RD5A 1BWLA 1ML1A 2ZZ6A 2FFCA 3G8RA 4GXMA 1KM5A 2OT1A 4LVFA 4O57A 4N6EA 3C0JA 1TPWA 2VFHA 4JXCA 4EOUA 3LDVA 5IBXC 3W84A 2Y63A 2TSYA 4M5PA 1O5KA 1TV5A 3LXAA 4WY0B 3S8HA 3GKFA 1LROA 3RNDA 1AW2A 4LC8A 3GXNA 5EKYA 4O50A 4FEZA 3HQ1A 2XN0A 5D37A 3TQKA 1FXPA 3W87A 2OX1A 4M6QA 4CQ9A 3NQ6A 1SQ7A 4RLIA 3KHJA 3STGA 3TXVA 2A2IA 3HG5A 1EWEA 3TK7A 1PVNA 1Z44A 1EUAA 4ZQNA 2V82A 3BGGA 2DP3A 3CPRA 3GAKA 3JR2A 2J24A 3W1MA 1Q6QA 4LS1A 5FEXA 2F84A 2PRMA 1EEPA 5D2TA 1TSIA 1IXNA 4X22A 4WY0F 3TC6A 3S9YA 5CZ0A 3RU6A 4JDBA 5H91A 3FS2A 4CQ8A 3TAKA 1KLYA 1ZHAA 4UTLA 3G18A 4IPIA 4CNPA 3HGSA 3IGSA 1CW2A 1H7OA 4IX2A 2FB2A 4TMBA 2J88A 4PH6A 5AC6A 1ZALA 3FJ6A 2DZUA 3FA5A 3EEGA 3C2FA 2NLIA 1RVGA 1AK5A 1PHWA 3B05A 3W7EA 3MI2A 2H6RA 5GVJA 4ZMGA 5DCBA 3VFLA 1Q3NA 1KV8A 1K3UA 1FWWA 1TPVA 3R12A 3G1FA 1R47A 2E6FA 1W5NA 3W86A 3NQ2A 1X6UA 3N73A 2VFFA 4NJGA 1GYLA 5K2ZA 2FQIA 1W5QA 5IM51 2XN1A 4A2SA 3QC3A 3U2OA 3IIZA 1FCVA 1DQWA 4CCCA 3P7YA 1WAUA 5D04C 5BMXA 1O95A 2E68A 4MJZA 3W7RA 4OHQA 2H3BA 2QUVA 2E5DA 1S5TA 3DFOA 2G5WA 3C52A 1JVNA 3NGJA 1P4CA 2V9DA 4XWUA 1OFDA 5BOOA 2VELA 2WNNA 1W5PA 3UYCA 4I7VA 3M7WA 4PCFA 4NX0A 3L67A 3S6DA 2RH9A 1I2QA 2UV8G 4M6PA 2V30A 1KM2A 2A21A 3EKZA 4O15A 4RR4A 1YPIA 1FX6A 2TMDA 2C15A 3EX1A 1OFPA 1PV8A 3EWXA 4Y96A 1YTKA 3STCA 3AJXA 1NF0A 3O15A 4K38A 4ZZ9A 4ONVA 4QITA 1F6KA 3W2MA 1QPRA 2WNQA 3U8GA 2ZRVA 3LLFA 3W70A 5AOUA 3PUOA 4O0ZA 4IOTA 2QCDB 3PM6A 4KFOA 5IBXA 3HBLA 4KKXA 4BI6A 1TV7A 2NXGA 4ADTA 2QCFA 2VFEA 3LHTA 3W83A 3EX6A 3EX4A 1FCQA 6ALDA 2A6NA 3A24A 1DJQA 3TKFA 1W37A 2NUYA 2ZYFA 3GDTA 5I3GA 5DXXA 1SO4A 1TJPA 1ICQA 5LNSA 1UCWA 3W7DA 3P82A 4FX7A 1GG0A 3PWAA 3GDKA 2GOUA 3HJZA 3IV3A 2RDUA 2YCEA 3F1QA 3QH2A 3T40A 2JBMA 1W54A 4W9TA 1WBJA 3ZFHA 4IMCA 2CLLA 3TJXA 3R13A 2V2DA 4OE7A 1KTNA 4NXSA 2JGQA 2OZ0A 4UC5A 3L68A 1YLVA 4OU1A 1L6YA 1EUNA 4GJ1A 4MYAA 1JRCA 3PG9A 4NNCA 2E6YA 2QKFA 3L5MA 3OVPA 3DZ1A 2AAMA 4FNPA 4XBKA 4BWLC 5AC7A 4DO5A 3NL2A 4RZ4A 2G96A 1NVMA 1T8XA 1C29A 3TJLA 1PCKA 3DENA 4POCA 1H7NA 4XQ6A 5A8GA 5D05A 2QAPA 3O6CA 3SSJA 5K9CA 5KZMA 4HKPA 1KM6A 4N9EA 1IXOA 5HULA 3EXSA 3HF3A 3Q58A 1A5CA 4O54A 1OG0A 3G1DA 3I7SA 3LV5A 1R2TA 4I7UA 5HQEA 4GUIA 3BLIA 3NM3A 5DY2A 1KTCA 3M1ZA 4JTIA 4ALDA 3NQAA 2DORA 3BGJA 5F2IA 3S1XA 1OX6A 4UMAA 1FWNA 3EWBX 3P80A 1OFAA 5D2YA 1OK4A 2V0TA 2NWRA 3W2LA 2ZZ1A 3KAOA 2CZDA 2C0AA 3GAYA 2NUWA 3O1NA 4O1CA 4JTFA 5D2WA 1DL3A 1W1ZA 2BTMA 1MO0A 4UFHA 4XUGA 1GT8A 5CPNA 4JX6A 3W9ZA 1RR2A 4UTKA 4K39A 4O19A 4YLWA 5F4XA 1K8XA 1I2PA 4LOCA 3W85A 3G24A 1BEUA 3CEUA 2TRSA 1JRBA 5T26A 2GQAA 5DCDA 4IPJA 4UXDA 3L0NA 2CWNA 1H7RA 1KM1A 3NL3A 4E2DA 4NJHA 3CM4A 5AB3A 4N4QA 4IX0A 4IMDA 3KRUA 1RQHA 4O13A 4NQ1A 1FCBA 3GLCA 2NX9A 2Z6IA 4MLRA 1NF7A 2QR6A 4NNAA 3K30A 4QM1A 1SO6A 4R33A 2NWSA 3B03A 3NL5A 3NQGA 4XBSA 2CLHA 1DBTA 1QR7A 2OCZA 2VEIA 1LZOA 2X16A 2FPVA 3NO5A 3GDLA 3PBUA 4KWWA 5K4ZA 1TPH1 2DZPA 4N02A 4QIUA 2V5BA 1A5AA 3EX2A 1EP3A 1S5VA 3QF0A 4RKAA 2CU0A 3STFA 1H60A 4AMAA 2P10A 1G4EA 4X2RA 4UFLA 1MSSA 1YDOA 3G3DA 1U5JA 1X7FA 4LW7A 2NX1A 1XBZA 1TB3A 3OHIA 5H2ZA 1O5XA 3LXCA 4Z1DA 3TUUA 1ZAJA 5LNVA 3MO7A 3LRMA 4E38A 3IIOA 4LWWA 2O7QA 2FPTA 4UFKA 4LUJA 4A29A 1VCGA 1B4KA 4QNWA 4Z08A 1FWSA 4OWGA 3W6YA 3KVJA 3TW7A 4IMGA 2CLFA 2V2CA 3C8FA 3TFXA 1XC4A 4XKYA 2ZA3A 2YX0A 1F7BA 3UWQA 4NJJA 3NR0A 1TTIA 3BO9A 5HJLA 3R2GA 5LHEA 1YDVA 3NQEA 1OF6A 4S2CA 4P61A 2BZNA 1HL2A 2Y61A 3TW6A 5BW6A 4EVZA 4N4PA 4O0KA 3LCFA 3KRZA 4I9AA 4XTDA 3S1UA 1DVJA 1O60A 5D02A 3PAJA 2Y7GA 3BG9A 4DXVA 1WXJA 1C9DA 4ZL1A 4YCOA 1BWKA 3QMTA 3B0UX 1KFBA 3P67A 3PULA 2ZZ2A 1S3HA 3C2EA 4DF1A 5FI8A 1ZJIA 4BWLA 5FEWA 2RFGA 2X1SA 5BNKA 5HWJA 3CHVA 4Q33A 3I6RA 2Z2UA 3HMJG 4O17A 3DHDA 4B5NA 4LU0A 3MMTA 3NEVA 4JYDA 3KVLA 2G95A 2RKXA 3NYZA 4MZYA 5LZLA 4OV4A 5CZJA 5CPLA 1GOXA 1SU5A 4MFDA 4JY8A 2NUXA 2QEZA 1AL8A 1TPDA 3TH6A 3W23A 4EWND 3UXDA 2DZWA 5DN1A 1FDJA 3NDOA 4YXGA 1VYPX 4UTMA 1IGSA 1F05A 4YMZA 4UTHA 3G1XA 3IEBA 3A5VA 2PE4A 4D2JA 4GRSA 3L21A 4E0CA 2R14A 3LHVA 3V1PA 1JCNA 1YDNA 1WV2A 3B0VC 1RQBA 2C3ZA 4MZ1A 1K7XA 2WO5A 4JTTA 3TU9A 2ZQ0A 4LS2A 3NQMA 4EF9A 3A5FA 3M5ZA 2C6QA 3O07A 1OX4A 3GXPA 3S42A 3EWZA 1UB3A 3W1AA 1GVSA 3LHZA 4L4LA 4MY8A 4AF0A 3PB0A 3LCXA 1EX5A 2GJNA 4PL1A 4RK8A 3A22A 3T78A 1PE1A 2Q8LA 3B04A 4AWSA 4BI7A 1JUEA 4GE8A 1WX0A 4JNMA 2YYTA 3MUXA 4JTSA 3A23A 1NEYA 2JKAA 4JIQA 5HR7A 5G2IA 4JTLA 3VI2A 1G7UA 2CLOA 3G8EA 1SW7A 2QDHA 4R53A 4S1FA 3SZ8A 3WK0A 4A3UA 4TIMA 1O4UA 4UTUA 3E9AA 5AHMA 1YYAA 2QDGA 4S2BA 4WY0A 1KFEA 1W5MA 1XXXA 4NXKA 2DZXA 4GFSA 1XUZA 2X1RA 2GVGA 3NPXA 2ZZ3A 2BSLA 3T4CA 4MY1A 4NVTA 1GEQA 1TYGA 3MJYA 2QCEA 4JYEA 2WOQA 3FYOA 4LRSA 1VLWA 4HN4A 2LLEA 1M7PA 3LHUA 2YW4A 1B4EA 3C56A 2J9ZA 2HTMA 4KWVA 3INPA 2WPBA 5I3JA 3DKJA 4JN6A 3TXZA 4OV9A 5HUPA 1LBLA 2VEKA 4A22A 1M5WA 3W2JA 4AHQA 1JQXA 2CLMA 2X1TA 3ZS4A 5EYWA 3G1VA 4MFEA 4GWEA 1QNVA 1RV8A 3GDMA 3SECA 4FO4A 2ALDA 1R30A 2OT0A 2ZRZA 3G0SA 1N7KA 3ABRA 3T7VA 4GC4A 4JR5A 1BKSA 2PURA 3LBCA 1IIHA 2GVJA 1SR9A 1THFD 1QFEA 3RLVA 2Z1BA 1WBHA 5EY5A 3I68A 2DJLA 4RJEA 3QMSA 5E1QA 1OFBA 1UBSA 5KZDA 3PR2A 3O8AA 2WQPA 2A7NA 4LV9A 2XN2A 1XI3A 1ZENA 4LC6A 3P61A 1L6SA 3F4NA 1AG1O 3DFPA 3PC0A 4ADUA 5U4NA 1TQJA 1MEIA 1VPXA 3G1YA 1K8YA 4PODA 1K7EA 4HIBA 1OFEA 4JDYA 3LTYA 3M16A 3ANYA 3W7PA 3L66A 1DKWA 3TV8A 1LLWA 3O6YX 4WUIA 5LGXA 3CTLA 3CQ0A 2D73A 4LS0A 4RX0A 3LRLA 2XFWA 1LDCA 3P8IA 4JTKA 3PVFA 3UQNA 3WJZA 3JS3A 5DY3A 5FF0A 1JCLA 1YPFA 8TIMA 2DZTA 5G1TA 2VEMA 5MHBA 3ATYA 1W0MA 3QW4B 3BW2A 1LRQA 3W1TA 3FJLA 5LKYA 4ZQOA 1A5BA 1GPWA 4CCDA 1DV7A 4FX8A 3LCWA 4QNEA 3D0CA 3S0CA 4HT3A 1FDYA 4IMEA 3KX6A 3MWAA 1DJNA 4EIVA 3CWOX 3P74A 5K3VA 3G1SA 2AGKA 3G1AA 5FF4A 4P2VA 2GQ8A 4E2BA 2NZLA 3G22A 3THQA 3NZ1A 4QJ1A 5L9FA 3MHGA 3Q94A 1HO1A 3RMJA 1BTMA 5LNUA 1TPUA 4LY8A 4DBEA 2VFGA 5FEPA 4C1KA 4JY9A 3W07A 3KVKA 3NG3A 4UCGA 4RZ6A 4NJIA 1OF8A 3S1WA 1N8FA 2ZDRA 3L5AA 2ATMA 3QQ0A 3P8JA 2ZZ7A 5KTLA 2G97A 1IXPA 3DFTA 4YWIA 3WK2A 3HGRA 3HPXA 1W31A 2GPTA 3MI3A 1GTHA 4DELA 3O6DA 4UMCA 4TX9A 1GTEA 2A7PA 5G1YA 4YCPA 2QCNA 1JCXA 2A5HA 2GJLA 1KFCA 3IIVA 5HMSA 3TSBA 2QCDA 3WK3A 3W7JA 2H8XA 3FFSA 1FQ0A 3QJAA 1D9EA 3KVMA 2QCMA 1SFLA 1AW1A 1VYSX 1ZAHA 5DBTA 3LERA 3TMLA 3PSWA 3DFQA 5C55A 4MYXA 4M19A 4K7VA 3FIGA 3WJSA 4XZ9A 1OFOA 2RDWA 4O4VA 3UWVA 1VHCA 1UUMA 4UR8A 5D2XA 3PS7A 3E02A 3FYPA 2YFOA 1HTIA 3L5LA 4FF7A 3M5YA 3W1UA 4MUZA 1EPXA 2BWGA 2O7SA 4ZQPA 5CSRA 4NUWA 4FNUA 1HFBA 3DU0A 3UWWA 4U28A 3BLFA 1A50A 3W1NA 4QISA 4GUHA 4R7JA 3DAQA 1W3TA 1D3HA 4JIPA 4MZ8A 3DH7A 3PY2A 3G0XA 3MI6A 3R5EA 1ICSA 3N2XA 2I1OA 1GJPA 1YXYA 3MYPA 1QCWA 2NV2A 1OYAA 3LGEA 3BV4A 1QPOA 3TFCA 2ZA2A 5I3KA 3NQ7A 4JTHA 1GYNA 4WXZA 4TR9A 3W7OA 3NM1A 2QCHA 5D38A 3W1QA 2QUTA 3W7KA 3LXBA 3O06A 3Q2DA 1LYXA 2YW3A 4O1AA 1VRDA 3N34A 1H63A 1VR6A 4JTEA 3HPZA 4NT0A 2PRLA 2J9XA 5LGZA 1SZNA 1K7FA 4IQLA 5G4EA 1YTDA 2ZRUA 2C13A 2J6XA 3FKKA 3FOKA 3L9CA 3EXTA 2ISSA 3G0UA 1B3OA 3N19B 4WXYA 2VFDA 4O28A 4ORMA 5CGQA 4JTGA 1YXDA 3MP4A 3P62A 3BK0A 2QJGA 3HIJA 5HR6A 4FIQA 5D30A 3M9YA 1TPB1 3CT7A 3W2UA 3LRKA 3GKAA 3TMQA 2YZRA 3NPWA 2OJPA 1B57A 1H7XA 4BK9A 1XM3A 2RDTA 4HHPA 2Z6JA 4WD0A 2YFNA 2BXVA 4Z0SA 1KW1A 3GYEA 1WOBA 4QQ3A 4MY9A 3N9RA 3IGUA 1I2RA 3EB2A 3QMRA 3BPWA 3H54A 4LVGA 4ADSA 3W7HA 3QM3A 3P84A 2VKZG 1GZGA 3C61A 1W3NA 3MYOA 4UIOA 5FF7A 1F73A 3FEMA 3TSDA 2VFIA 6TIMA 3VE9A 4MVAA 4WOZA 5AYXA 1OABA 4LNYA 1L2UA 5BMWA 4IUOA 4LT9A 3NQVA 2F7FA 5F1UA 4JX5A 1OVDA 1QOQA 3SY5A 1K02A 4UUIA 4GUJA 4RV8A 4O4WA 1SSDA 1H7PA 1JJKA 1SZGA 1QO5A 4LVBA 4IXHA 4DF2A 2P0OA 3TX9A 1EA0A 4UTWC 1JUKA 2NXHA 4MOZA 1J2WA 1H50A 1WYIA 5C6MA 1U83A 1KA9F 2B0MA 4Z1BA 2PC4A 1VZWA 4RXFA 3C2VA 3F03K 4ZQCA 3I7QA 1LOSA 2VOMA 3DFSA 1PHQA 2Y62A 1Q6OA 1ZFJA 3IIPA 5TQLA 2A6LA 3LCHA 2V81A 4H6KA 4AAJA 1F74A 2FDSA 3IIXA 2RHGA 3UZJA 4JS3A 1EB3A 1M7OA 5I3FA 1H5YA 4FHAA 1H61A 2FIQA 2V2HA 3A9IA 1AMKA 2YDAA 1TQXA 3GDRA 2CZEA 2A1YA 4K37A 1T99A 4NNBA 2B7OA 3H55A 4GUGA 1MZHA 3KRSA 5G2WA 3LM7A 3CIWA 1S5WA 2C19A 3HGOA 5CPOA 1P1XA 4PFMA 2Z0IA 3DI0A 1KM4A 3IGXA 1LBFA 4YL2A 3SGUA 2WSRA 5G4WA 5AHNA 3STEA 3TCEA 4Y6GA 3O16A 1IIGA 1W56A 4X9SA 3RF9A 2Y89A 4FX6M 3I7RA 4ZQRA 3PSVA 4OT7A 5KITA 3A21A 4WZHA 2YGYA 3U6WA 2W6RA 3BARA 4LTSA 4Z1AA 4FNTA 1LCOA 1QDSA 2ZZ5A 1ZAIA 3PB2A 4FB7A 3LCLA 2B7PA 2WSYA 4WQ6A 4UFMA 3QYQA 4JYFA 3E12A 4O12A 3JRKA 5G2HA 4CLMA 1OX5A 4RZ5A 3M0ZA 4OQVA 5DXYA 3N3MA 1VHNA 1VCVA 3WJXA 1XKYA 3P5YA 3GIYA 4RCXA 1OK6A 3CLMA 2W79A 4Z1CA 1FY6A 3YPIA 1XCFA 3EWYA 4AXKA 1IF2A 3BW4A 2GUUA 2EKCA 3PBVA 5AN7A 3LOTA 4TO8A 1SUXA 3MBDA 3DKLA 4IXXA 4JEQA 4O8RA 3SR7A 1JCYA 3TAOA 1NAL1 5CSSA 2FB3A 1F76A 1GG1A 3G1HA 3P81A 3LTPA 1VH7A 1E51A 4GBUA 4R34A 5EPDA 3QPZA 2R8WA 5G5IA 3PUDA 2DZSA 1YXCA 4UR7A 3B4UA 5F1VA 1YADA 3GB6A 3B06A 2YXGA 2QJHA 4DO4A 1OYCA 1UASA 3L65A 3S1VA 3TQ0A 4UNLA 3NPUA 4ZVJA 2Y7EA 2J9YA 5AHIA 3O63A 3TNOA 1SZFA 1LOLA 1VJIA 2NXIA 2Y6ZA 3WJWA 5CG7A 1TTPA 5EA9A 4DBDA 4O14A 4CNOA 3W7MA 1C8VA 4MLJA 4UTWA 4OGZA 1O94A 3OVQA 1MEHA 4NJKA 1LORA 3MHFA 4UFJA 1SZEA 2QJIA 2ZRYA 1FUYA 1OFQA 3Q37A 2Y85A 4NZJA 4LUIA 1GWJA 2WV8A 5FEZA 1T0OA 2EGZA 3W1PA 3NAVA 1X8FA 3R8RA 5C5YA 3VKJA 2ZTKA 1F5ZA 3UWYA 5AYZA 3MP3A 2H90A 4LVAA 1ADOA 4K36A 5K9XA 3UZ5A 4HNVA 4HSNA 1JQVA 4K8EA 3BVJA 3M5VA 3L0KA 3GXTA 3EWWA 1LP6A 2HMCA 1CX9A 3CU2A 1TV8A 1JULA 2Y70A 4AH7A 4PC8A 3C3NA 2PRHA 5AHLA 2ZCGA 2CZ5A 4DPPA 1HO4A 1MEWA 3L2IA 4NU7A 2E6AA 1F6PA 5AHFA 5AC8A 4WJEA 1VC4A 5LSMA 1KBJA 5D03A 1OHLA 1TMHA 5CZTA 4PTNA 1EIXA 1TIMA 4ORIA 1KLZA 4FNQA 1WQ5A 1B9BA 5DLCA 3TC7A 1IXQA 3IVSA 1W3IA 1TPC1 1DORA 5FESA 3DXIA 3GX9A 5HUOA 1FWTA 1QAPA 3HG4A 2VEPA 3TQVA 4DQWA 5D09A 4BR1A 5I3IA 2P1FA 1TCDA 3UPBA 3S5OA 5FF2A 1SW3A 1Y0EA 4A2RA 3SW6A 5FF3A 3IVTA 4BF9A 3W7LA 1A53A 5AHEA 1TTQA 2FLIA 5K4XA 1FCUA 3LTSA 5CPMA 3AO0A 4N6FA 3E49A 2E77A 4FXSA 4AEOA 2Q8ZA 3CEPA 1GVRA 1DQXA 3P5ZA 5E0KA 4CQAA 2DJXA 3QW3A 1MXSA 2ABBA 2QAFA 4HNNA 3QRHA 4O16A 1ICPA 4LRTA 4WOQA 3NOEA 3KOFA 3CIXA 2C16A 3PF3A 1D3GA 3TIMA 2EAWA 1SW0A 4AWUA 3GR8A 2ZRWA 5U7SA 4Y9AA 4AHOA 3N9SA 3M43A 1Z42A 1JR1A 4UNKA 1SPQA 4O1BA 3ABSA 1PCWA 5KINA 1TO3A 5TBOA 1PL9A 3ABOA 2E5BA 3UPWA 2QUUA 4JGDA 5EMUA 1XL9A 1GVOA 1H7WA 2A85A 3GNDA 5F2LA 3SJ3A 1L9WA 1OYBA 3LLDA 3EXRA 3QSTA 1UUOA 3EX3A 1ME8A 1XUUA 1Q6RA 3MP5A 4H3DA 1XDLA 1TPFA 2B7NA 1LM1A 4PEKA 1G67A 4IWWA 1VGAA 4MIMA 1RQEA 1OJXA 3OVRA 3W7CA 3BLEA 1LTDA 1QPNA 2YYUA 2CLIA 3W73A 1R2RA 2ZTJA 4JTUA 5C54A 4WX2A 4HNUA 2CLEA 1KFJA 3P60A 2ZA1A 4TMCA 3W74A 1R2SA 3NA8A 4OBTA 4FXRA 2ZZ4A 4M6VA 1H62A 1QPQA 3QZEA 1J5TA 1W5OA 2J27A 2Q3OA 2DZVA 1SSGA 1R46A 4GNJA 4N9BA 2ISVA 5D2VA 5F4WA 2WJZA 3TSMA 4PL2A 4CCEA 1H1YA 1Z41A 4O10A 5CZSA 1TREA 3UXAA 4UFIA 5KZEA 1CI1A 3CB8A 2ZBTA 2FPYA 4L4MA 1LLZA 5LNRA 1RZMA 4KFNA 3KXQA 3GZ3A 4K7YA 3RK8A 1DHPA 3MHUA 1HG3A 5C2XA 2EPHA 3PUEA 1FBAA 4UTIA 3T44A 1HUVA 1I2OA 3QFEA 1AL7A 3EKLA 3HPSA 5I3HA 3HGJA 5ABTA 2H8ZA 1TRDA 2GQ9A 1TJRA 1ME9A 2E5CA 4K8HA 3CWNA 5EL1A 1RPXA 4U4MA 1XDMA 5TIMA 4DO6A 4O53A 3QQ1A 3VE7A 4KFPA 3T55A 4UTTC 1AW5A 4BI5A 4ML9A 2HS6A 3GVGA 2R94A 5E93A 3W75A 3GR7A 4AB4A 4IGHA 1ONRA 3C6CA 2QF7A 4LVDA 3WK1A 1I8JA 4K6AA 3GK0A 3TR2A 1VLIA 5HWMA 5AYYA 4RXGA 4UMBA 3BG5A 5BRBA 1Q6LA 2WNZA 3VNDA 5KMYA 3UD6A 3NQDA 4XTIA 2JKEA 3LBMA 4CNNA 5KSWA 4HNTA 3QPYA 2X30A 1P0NA 5L6UA 1K8ZA 1VCFA 1ZCOA 1G4TA 3UWZA 3E0IA 1FWRA 2OMAA 3SFKA 4HPXA 1OFRA 3M41A 5LNWA 2A4AA 1X1OA 2CW6A 5EBUA 1Z48A 2NV1A 3W7QA 5DELA 3UNDA 1Q45A 1VYRA 1I45A 3C2RA 4J9JA 1XFBA 3BW3A 3M5XA 5J5RA 3F4WA 3LI1A 1V5XA 1FDZA 1KFLA 5HINA 2ATSA 3G3MA 3B0PA 4N2YA 3CC1A 1QO2A 2A0NA 3LCIA 3W88A 3OG3A 3R89A 1ZY9A 4AVFA 3WJYA 2EHHA 4AHPA 2QCCA 3HB9A 3LHWA 1L6WA 3NQCA 4AWTA 4DPQA 3DI1A 2Q3RA 3TDFA 1EP1A 3DBPA 3M6YA 3THAA 1SFJA 1LRTA 1VS1A 2I14A 3DGRA 3HO8A 5AFDA 3W1RA 3LHYA 3ZR4A 3QSRA 1EWDA 3ZWTA 5HWNA 3E96A 3IRDA 3NL6A 3SGZA 3MBFA 3UY7A 3C2OA 3ABQA 3KFTA 5F2MA 3N2MA 4I7WA 1KBIA 3W1LA 5LHFA 1V7YA 3W2NA 2HSAA 5F4SA 3NXFA 4JD4A 2NX3A 2VXNA 4O11A 4N9CA 1G4PA 2B4GA 4ICNA 1ME7A 5K7JA 2PCQA 3TE9A 3B8DA 2W0UA 4TU1A 3W22A 3W3OA 1F2JA 4HSOA 4O1DA 3W7GA 1VQTA 3W1XA 3FLUA 2C18A 3W7NA 5J5DA 2ISWA 1H1ZA 4EF8A 1GVQA 4MKNA 4JX4A 5K9DA 4Y90A 5DCEA 3FKRA 4MPQA 1XBVA 1ZNNA 1G6CA 1KFKA 2Y7FA 5A5WA 2JKPA 2E09A 1XBYA 3W76A 2R91A 1K03A 1PS9A 1G4SA 1NFBA 2A7RA 5DBUA 3SIZA 1KTBA 3NQFA 2VENA 3W71A 5CKSA 4Y8FA 3W72A 4M7TA 1GQNA 3PBYA 3RFAA 1P0KA 4M7SA 3IVUA 1QMLA 2JK2A 1UJPA 3S5YA 2WKJA 4O52A 1QOPA 1KM3A 1ALDA 1LRNA 4PA8A 1G69A 4XKYB 2C1HA 1H51A 3M44A 2BX7A 1EP2A 4ZQMA 3ATZA 1SO5A 3W2KA 3LB0A 1KM0A 2CFFA 3I65A 3L0GA 7TIMA 2YPIA 4UTTA 5SWUA 3HOJA 1GVFA 4Q4KA 4DF0A 1J4EA 3C4UA 4HPJA 3SI9A 5D33A 1TPEA 4JICA 1NSJA 2IQTA 3MW7A 3NPVA 4A21A 2H3DA 1QWGA 5F2GA 2HS8A 3EWUA 4IMFA 1FXQA 1LBMA 3HG3A 2I9EA 4FNSA 3USBA 1P5BA 3DFNA 3PG8A 3NNTA 3WFAA 4X3ZA 2GVLA 4Z0JA 4MJMA 4Q32A 1JCMP 2CLKA 4DEFA 4G1KA 2Y88A 4JTJA 3TROA 3UY8A 2WSQA 2BLEA 3OA3A 2YR1A 3N14A 5HNRA 2FTPA 1TRIA 2TPSA
chains in the Genus database with same CATH superfamily
1I2NA 3GNNA 4IP7A 2E1DA 5FJUA 8A3HA 2ZRXA 1E3XA 2CZFA 5EB8A 3GVQA 1N55A 2DSZA 3W7IA 3NQ8A 2AOSA 4XAGA 4L9YA 1TMQA 3O05A 3S5NA 4LUYA 4Q4MA 3OIXA 3VMOA 2C14A 2AMXA 3HG2A 1G7VA 3NZRA 2W3ZA 2ZFAA 2DU2A 3OBKA 2X2GA 3DHFA 1BRLB 1ZLPA 4DYKA 4HOWA 1CXKA 1M6JA 1JCJA 2QCGA 3ZWSA 1PIIA 4B4HA 3LI0A 1I4NA 1ZCCA 1TWIA 3LN3A 1WO2A 4N9DA 1RD5A 1US2A 2OT1A 3UT0A 4EOUA 2BVWA 1RXOB 1JDFA 1JAEA 3I3EA 3PPFA 3WF1A 1TV5A 3VOGA 4DUOA 3ES7A 4WY0B 1EIBA 1PDYA 3RNDA 1AW2A 3WDIA 2WCSA 4LC8A 7REQB 3U7VA 2OLHA 4IISA 4O50A 1LLOA 3BAXA 4Y9MA 3TQKA 3GR4A 1FXPA 2OX1A 4MAZA 4YTRA 3KHJA 3TXVA 2A3CA 3PZOA 3R11A 3APYA 1EWEA 2EKGA 1UHVA 2UWFA 3IK4A 2E28A 1TE6A 1EUAA 2PI6A 4MNLA 2DP3A 1QNPA 7ENLA 3JR2A 3VOHA 3NDZA 2ICSA 4LS1A 5FEXA 1O6IA 1S2WA 1AQMA 1UPMB 1EEPA 5D2TA 1SGJA 5I3DA 4N42A 5HANA 1J0KA 1TIWA 4JDBA 4HJWA 3ABXA 1ZHAA 3G18A 4IPIA 4CNPA 1CW2A 5REQB 1V3HA 1YNQA 4FAMA 2FB2A 2J88A 1KBBA 5IRPA 1ZALA 4PSRA 1E1EA 1ZGDA 3Q65A 4UQ9A 3BLOA 3R12A 2BFGA 1O68A 5FD0A 3ZVIA 3CZLA 2VFFA 5LIYX 1ZBKA 2PDFA 1W5QA 4A2SA 2BGNE 1FCVA 4CCCA 1PTAA 5BMXA 1O95A 4NRRA 4WLCA 3ARRA 5DANA 3EGJA 3C52A 4DXKA 3NGJA 5HK4A 1P4CA 1IWPA 2V9DA 3MZ2A 1QATA 4DNHA 3M7WA 3QR1A 1QBAA 2EO7A 4ZXLA 4W85A 3WLPA 1DWJM 2X05A 1LQAA 3BZGA 4O15A 1E15A 1FX6A 3ONBA 3WUEA 1PV8A 4NY2A 4Y96A 1NIUA 3PUGA 3STCA 4UR9A 2OWWA 4J27A 2CBUA 1MW0A 1ZL1A 3NFUA 1F6KA 1LL4A 3H22A 4GI8A 2QVHA 2Z4GA 3GNOA 2R1PA 3WKZA 4NZ5A 4QCFA 1FHLA 1S1PA 3DYPA 3ZJ7A 3NO1A 4DZIA 4KKXA 5LXXA 1UROA 3RG6A 4GH1A 4LUTA 1ZBCA 3OZMA 5C7HA 6ALDA 1DJQA 3PAOA 3TKFA 3AOFA 3GDTA 3WBAA 4P8UA 3VNYA 2OSYA 4KCTA 1SO4A 3VIIA 1UCWA 2ESCA 4H9TA 1O1HA 5CPSA 3PWAA 2CHRA 1KKRA 4BS0A 3I10A 1TZZA 4CUCA 1GVEA 4J5NA 1WDSA 4W9TA 3AHXA 3EPNA 3ZFHA 4IMCA 1XIEA 4A8NA 4LYRA 4OE7A 4IGSA 2WZIA 3EB4A 4WVXA 2G50A 1EF3A 1DYSA 2WMHA 5BXPA 2E6YA 1Q65A 4DNMA 1QVBA 1YW1A 3RUBL 4DO5A 5HNNA 4L9XA 3P2VA 1NVMA 1DPMA 3DENA 3MDUA 1XLJA 1JGIA 3WQPA 3TZNA 3HF3A 4O54A 1M3UA 5C9WA 3QC0A 1R2TA 2GGGA 3IUHA 3BLIA 4GUIA 5HBFA 5A2AA 3FHQA 5DY2A 1FRBA 3BGJA 2J47A 4UMAA 1FWNA 3SURA 4W5ZA 3UYIA 3P80A 5D2YA 3VUPA 3IUDA 2NWRA 3M0MA 3WBYA 3ZXWA 3WMCA 3WFLA 1PZ0A 3KAOA 3GDBA 2C0AA 1ITUA 3GAYA 4MG4A 1VPYA 3O1NA 4O1CA 3JZUA 2BTMA 1KCXA 1E6NA 4JX6A 1RR2A 4WGHA 4UTKA 2AL1A 1E40A 2J74A 3ECQA 1JI1A 2OZ3A 3A3HA 3IAQA 3U9IA 1BEUA 2IXUA 2TRSA 2OSXA 5J04A 1XYLA 1XIJA 4L1GA 4PCPA 1H7RA 2GLKA 3NL3A 3UR5A 3VKCA 1XLIA 4R9OA 4N4QA 1V6XA 4A05A 1J6PA 4IMDA 3UF9A 3KRUA 4L65A 4O13A 1JD7A 4NQ1A 4H7VA 2NX9A 4A8IA 4TV5A 4O0QA 4MLRA 1NF7A 4AZ6A 2QR6A 1VF8A 4QM1A 1XH1A 3F4VA 3ZT7A 2NWSA 3B03A 5HMEA 4FXFA 2OCZA 1LZOA 2X16A 3NTYA 1KQZA 3PBUA 4KS0A 4KWWA 1TPH1 2AL2B 2DZPA 1F07A 4R7WA 3UBPC 4N02A 4QIUA 3EX2A 1EP3A 2WJEA 4RKAA 2VGIA 3RCMA 1YQ2A 2P10A 4UFLA 4AU0A 1U5JA 1GK8A 1X7FA 3RILA 1TB3A 2BBFA 2VDGA 1O5XA 2A3HA 2GJRA 1E55A 3VC5A 3RDKA 3MO7A 2DIEA 3RM9A 2WZEA 3DG6A 3WEZA 4AZCA 1QK0A 2O7QA 4JHZA 4ZO8A 1CPUA 4CD6A 4W8LA 5A8OA 3KVJA 2YCKX 4LB3A 2YDRA 3C8FA 3VZXA 4TVUA 3PZVA 4C6EA 5HPCA 1OQFA 2DSUA 4M24A 4GINA 3UWQA 1TTIA 1B54A 4QDWA 1YDVA 1HKJA 4S2CA 3GC2A 3EA3A 3TW6A 4Q6XA 4H6EA 4EVZA 1QTWA 2FH8A 2FHFA 3GTNA 1OT1A 3E5PA 4BF7A 1WXJA 1C9DA 4ZL1A 3B0UX 1CB2A 4L1XA 2GVYA 4QX4A 2DVUA 2A3BA 1Q63A 4BWLA 3IJDA 1DJHA 5HMDA 3C0SA 4FI4A 2X1SA 6TAAA 4CN6A 3I6RA 1XLEA 3BAJA 4LU0A 2RKXA 4X0NA 2AQOA 5LZLA 2HE5A 3KCLA 3AYRA 3LG3A 2XJ7A 4LY4A 1NDVA 3TH6A 3VVGA 3W23A 3UXDA 4YXGA 3WLLA 3AROA 2YCLB 1IGSA 1FH9A 4GYPC 3CV6A 3KBNA 4UTHA 3G1XA 1FVPA 3H2AA 2TODA 2Y1HA 1XYMA 3WQDA 3LPFA 3KUMA 4GACA 3Q45A 4EF9A 3A5FA 4AIOA 1OX4A 3W1AA 3T0DA 1V93A 1XQKA 4MY8A 4L80A 3LCXA 3G5EA 4RK8A 4LAUA 2GYIA 3A22A 3WMSA 1MYRA 3B04A 1HJSA 3THUA 2XGZA 1JUEA 4GE8A 4JIQA 4JTLA 3WUBA 3G8EA 4Q8PA 4XX6A 2XH7A 1QI0A 1RY0A 4TIMA 2BOGX 2QDGA 4S2BA 1V3IA 3OW1A 1XXXA 3PZMA 2DZXA 4GFSA 1XUZA 2GVGA 2ZZ3A 3VGBA 2BSLA 4MY1A 1K4HA 4GQGA 1TYGA 1FWDC 4PEEA 4XISA 4KH2A 4JYEA 1VEOA 2A3LA 1HW6A 4L64A 1M7PA 1SFSA 2J7HA 3RITA 3TXZA 3CYVA 4OV9A 3SCPA 4AHQA 4QJ4B 1YNYA 2CLMA 4PMZA 5EYWA 3G1VA 4MFEA 1QNVA 3GDMA 2V5DA 1IZCA 3ABZA 2PCEA 4J3UA 2ALDA 1R30A 4LQ1A 2D2GA 2ZRZA 1N7KA 3MCMA 5TF0A 1UD2A 4JR5A 1E9IA 1BKSA 4KRTA 2PURA 4Q8QA 1THFD 3N2CA 1V0KA 4HA4A 2NV9A 2DJLA 5M03A 4RJEA 1OFBA 1UBSA 3EOUA 5KZDA 2A7NA 3BAKA 3RYSA 2XN2A 3RLGA 9XIAA 1ZENA 4LC6A 3MKVA 1L6SA 2XTKA 1HIZA 4GZIA 1AG1O 2O4MA 1MEIA 2HXTA 4JQ3A 3N6QA 4QFUA 4C6FA 4JCMA 3QKZA 4HIBA 2X8RA 2NQ5A 1PXGA 3HZ3A 4S3AA 1EA9C 3L2LA 1LLWA 4YVVA 3AXIA 4BQ3A 1J5SA 1IV8A 4WUIA 2RAGA 3FSTA 3CQ0A 3QTGA 1XW8A 4S39A 4US5D 2NQLA 4CU6A 4LS0A 3PVFA 2RUSA 3JS3A 5ECVA 2E0PA 2DZTA 5G1TA 2VEMA 5MHBA 1LRQA 5LKYA 4ZQOA 1E6QM 1UZDA 2PA6A 1IEWA 2WHKA 3EMQA 4M0XA 1UOKA 3LCWA 1XP3A 1E70M 5K3VA 1PTGA 1PJ9A 2AGKA 3EBVA 4D72A 4YVXA 1CEOA 1J11A 3MMUA 2ZXBA 3G22A 1RBAA 1ZB5A 3THQA 3WUFA 2FZDA 1GCYA 3Q94A 2C7FA 1GQJA 1TPUA 3FGCB 1YE6A 5EFDA 3MWCA 2WKLA 1OF8A 1U2YA 3NO3A 3S1WA 2ATMA 2G4JA 3O0KA 1TMLA 5KTLA 2E7FA 4AZ5A 1MUCA 3WK2A 3HGRA 2GPTA 4CVUA 2HDJA 4G7EA 1GTEA 2Q01A 4ZEPA 3QZAA 1JCXA 5HXMA 2H8XA 4DM1A 3VOJA 1W91A 1R7AA 2WMFA 2QCMA 4PMQA 2Z1XA 4AD3A 1ZAHA 1WDPA 3LERA 4W8AA 3DFQA 3TN5A 3FA3A 5C55A 4MYXA 4DI9A 4CQBA 4PB5A 4XZ9A 3A4JA 3SRKA 4EE9A 1L6GA 2D23A 3ZOAA 2DQXA 1CIUA 3PZ9A 2W9MA 1LWIA 5CSRA 5I06A 4FNUA 3UJ2A 2G3NA 1UKQA 3LMZA 4LH8A 1D3HA 4GHRA 1B3YA 3MI6A 3R5EA 1A3HA 1OYAA 1TUFA 2PD9A 3TFCA 4YPJA 3VNJA 3E6EA 1VJSA 5HQMA 4GO8A 3W7KA 1R3YA 3HPAA 1X8CA 5HAOA 3MS8A 3N13A 2GQ3A 4O1AA 5E9AA 3N34A 4GI9A 3VDCA 5LGZA 1WZKA 3SUUA 5EU9A 4IQLA 1K4GA 1NWTA 5G4EA 2EBNA 3FKKA 3L9CA 2PDLA 3M46A 3GG1A 4O28A 4HPNA 3MP4A 1EJ7L 1JPIA 5CJMA 4CEXC 4CD5A 1XLCA 1YBQA 3CO8A 1E9ZB 1Q6EA 3ARVA 3OLIA 2J8FA 3GUGA 2OJPA 2XVKA 2Z6JA 2YFNA 3RX2A 3GYEA 2YL6A 1V4YA 4MY9A 1I2RA 3FK4A 2HNHA 3EB2A 3QMRA 2PTDA 5DT7A 2G3FA 4ADSA 2D2JA 3IS4A 1HX0A 1J0JA 2ACQA 2VKZG 3IK2A 4WDWA 3RR1A 3VOIA 1W3NA 3KL3A 1I60A 3FEMA 3PWIA 3VE9A 4WOZA 5AYXA 1OABA 1L2UA 1TV2A 4IUOA 3RCYA 3ARYA 3NQVA 2F7FA 2Y8VA 4GIRA 4M80A 5T8GA 3GE7A 1E4NA 1K02A 4A4AA 5BXTA 5HOSA 1EJWC 1MNSA 4O4WA 1RA5A 1H7PA 3GXDA 4JFTA 1L6FA 4LXFA 2P0OA 4UTWC 2D2OA 2BODX 2NXHA 5XIAA 1J2WA 1XLHA 5E70A 4AZGA 4ATDA 5C6MA 2VGFA 5GNZA 2J13A 5A94A 4B16A 5JVLA 1YKWA 2PC4A 1VZWA 4RXFA 3C2VA 1XH0A 1MQRA 2Z25A 3DFSA 4GG9A 3QV8A 5TQLA 4ZXOA 3LCHA 2E9LA 4AAJA 1EYWA 2FDSA 2RHGA 2WJFA 3H2OA 4Q4PA 2QV4A 1K9FA 4NYYA 2FIQA 4XUYA 1YDYA 4MJ2A 4RV3A 3GU2A 4P8VA 3GDRA 2XZ9A 4K37A 4NNBA 2YIHA 4BA0A 2B7OA 4XO6A 3WH7A 2FMNA 2XPKA 3AQUA 2ZUSA 4E3VA 2PDHA 3KRSA 2DT3A 4UQDA 1S5WA 1BSLA 2C19A 1ZPTA 4PFMA 3DI0A 3SSZA 2I9UA 2WSRA 4H8UA 2GGHA 2PZ0A 3STEA 2X2YA 4QCEA 3IPWA 3H2NA 3GTFA 2J79A 5I23A 3O16A 4EPKA 8CGTA 2J66A 4FPSA 4FX6M 1P7TB 3CQHA 1FHVA 3ARZA 3QVQA 3M0YA 4ZQRA 4MTVA 1DJYA 5KITA 1CGXA 4R85A 4MB5A 2W6RA 2X0YA 2ZZ5A 3P0WA 4FB7A 4WQ6A 2VJXA 4JYFA 2VD8A 1L8NA 1Q6CA 4JAWA 1VCVA 3WJXA 4RCXA 1XSIA 2W79A 3T0CA 1QI5A 4Z1CA 1D7KA 4LGXA 5AC4A 1FY6A 3YPIA 1WAWA 1V77A 2IXVA 3BJSA 3DN5A 3JU2A 5AN7A 3PTDA 4W4QA 2XIOA 1VD6A 4XZMX 3TAOA 4AC1X 4JEQA 1JCYA 1A4LA 3L4XA 1KFWA 1E51A 1XKJA 1S2AA 4GBUA 3LA4A 2W4XA 5DO8A 5HPOA 2VO5A 3UESA 3TLLA 1VIWA 4UR7A 2HV5A 4Y7EA 2YXGA 2QJHA 3K2GA 1VBUA 4ZODA 2VZVA 2Y7EA 3C2YA 1LOLA 4Q4SA 4GIAA 3E3HA 2DT2A 1QU4A 4NRSA 3M0VA 1QRQA 4JPGA 1TTPA 5EA9A 3IJ8A 4O14A 4GGBA 1ESWA 2HK0A 3ERPA 1LORA 3AALA 4MWAB 1POKA 2PP3A 4WIWA 1DXFA 5FEZA 1E43A 1T0OA 2GOKA 4GK8A 3KOXA 2C1GA 3FVMA 3VNMA 3W38A 1F5ZA 5AYZA 2Z24A 1ADOA 1BQGA 3IRSA 4HPGA 2VVNA 4HNVA 4HSNA 1DXEA 1JQVA 1TZ7A 4M81A 1SJAA 1HJVA 3DFHA 1LP6A 2HMCA 6XIAA 2DT0A 3KEHA 1JULA 1MRQA 2Y70A 3CL6A 2CZ5A 4NU7A 3L2IA 3QPEA 4WJEA 5LSMA 2PWEA 3V35A 3QOKA 3C0QA 4Z17A 2VD9A 5CZTA 4PTNA 3QKEA 1TIMA 4ORIA 4DZAA 1H11A 2CNCA 2Z28A 4PRWA 3SEPA 4D6FA 1WQ5A 1B9BA 3C5QA 5AVHA 2YL9A 3IVSA 2FMOA 4Z42C 1FWTA 4UZSA 3BGAA 1MUMA 1QHZA 3HG4A 4ZE5A 2RJHA 2GGEA 2P1FA 2PDXA 4QEHA 3STPA 1GOQA 1Y0EA 1P0EA 3ISIX 4A2RA 3SW6A 2GJXA 5FF3A 3SN4A 2Y2WA 4HYVA 5K4XA 1S5NA 1BD0A 1FCUA 2IUZA 2VRQA 7ODCA 3E49A 2E77A 2Q8ZA 3CH9A 3CEPA 1DQXA 2E8ZA 3TN3A 4CQAA 2ANUA 2PGEA 1H1NA 3QRHA 2YB1A 4LRTA 3MSYA 3VGDA 1WE5A 1V0LA 3EEZA 1MUWA 1OZQA 3GR8A 8XIMA 1NOWA 2Y0FA 3N9SA 3M43A 3EMCA 5I5RA 4UNKA 2HPMA 3ABSA 4TVCA 5KINA 1TO3A 4MDOA 1BFNA 3F5LA 1B1YA 3KTXA 2GWGA 2PC8A 3NGFA 4JGDA 5HJXA 1XL9A 1H7WA 3KZSA 2A85A 1O12A 4W8BA 3MCOA 3GNDA 5F2LA 2XWEA 3SJ3A 3V16A 1UUOA 3VD7A 1MDRA 2EEXA 1XUUA 4GIEA 2Z1WA 3MP5A 3M07A 3OLGA 3SGGA 1NP0A 4KCUA 2IKIA 4J3XA 4IWWA 2INZA 3PNZA 4PB3A 3VNIA 3OVRA 2DUXA 3BLEA 1QPNA 2PP0A 5AKQA 2BASA 3GO2A 2ALRA 1GGOA 4LCSA 5C71A 3GH5A 2DIJA 1HF6A 4PZVA 1AA1B 1Q5MA 3P14A 4OBTA 4FXRA 2ZZ4A 1W9VA 1E0TA 1H62A 3DYMA 3QZEA 2Q3OA 1EYEA 3V0TA 4MNKA 1B90A 4FMVA 2CEQA 4N9BA 1V0NA 3K4AA 5F4WA 2W67A 3ARUA 1TWSA 3COTA 5EMKA 4UFIA 3E2RA 4S3KA 3CB8A 2ZBTA 2OGJA 5I7GA 4PCSA 3POCA 3O3RA 5CAHA 3KXQA 1C8YA 3QOMA 5C2XA 4MNMA 3PUEA 4UTIA 1HUVA 1I2OA 2H8ZA 2ZDSA 3AS1A 2GQ9A 1LUCB 1ME9A 3CWNA 4O53A 3RLHA 2I7GA 2Z1SA 1DWHM 4ML9A 5E93A 4I9MA 1B3VA 2BP1A 5CG0A 3GR7A 4AB4A 4CNSA 5I07A 1RD6A 1E0WA 4LVDA 1DWFM 5HWMA 2G37A 1ZU8A 2VDHA 4RE4A 4U2YA 2WBGA 4CN1A 1IWAA 2HBXA 2JKEA 1W1YA 5KSWA 4AY1A 3QPYA 2ACRA 3GBEA 1US0A 4F0HA 2NT1A 4ZSUA 2VTFA 4HPXA 5LNWA 1J01A 4D71A 3G6MA 2DEPA 1F61A 2I17A 5EBUA 1Z48A 2P53A 4TOQA 2PDYA 1EJSC 4LEFA 3UNDA 2XFFA 3BW3A 5J5RA 5C0QA 3CASA 3LI1A 1H49A 1X7IA 3OG3A 3W88A 3R89A 3WJYA 1NOFA 4DPQA 3BH4A 1ADDA 3DGRA 4RW5A 3W1RA 3LHYA 3ZR4A 5HWNA 3NL6A 4IFRA 3C2OA 3ABQA 2FJUB 3KFTA 4DJFD 3N2MA 3MC5A 4JFSA 1MNZA 3S2MA 1S46A 2HROA 2PLJA 4JD4A 4E6MA 4DLMA 4P5UA 4N9CA 1G4PA 5K7JA 4TV6A 3K4WA 1WB0A 3B8DA 2MUCA 4YYCA 2W0UA 2CCRA 4MF4A 4O1DA 4PMYA 5G1MA 1JYVA 4LCRA 1VQTA 4MAVA 3W1XA 1XLMA 2XZ7A 3W7NA 1H1ZA 3GIQA 4EF8A 4Q8WA 4WR3A 2D22A 4MKNA 5K9DA 2O9OA 3E74A 2O9RA 2ASHA 1IQ8A 4IH3A 4Y8EA 1KFKA 2Y7FA 3BAIA 1PS9A 3W01A 2A7RA 3SIZA 2VENA 2IPWA 5CKSA 2VX5A 3CV1A 3WBWA 4M7SA 3BCJA 2PWHA 3IVUA 3WDHA 4EACA 1W17A 2VP8A 1JXKA 1AD4A 1LRNA 1TR1A 5HNTA 1B3ZA 3CAVA 1W9XA 4XKYB 3OB8A 4NI8A 3KLLA 1EP2A 4FOJA 1E5NA 1SO5A 3LB0A 4AQLA 3MA8A 4UTTA 2PDGA 1BF6A 1J4EA 3AYVA 3DC0A 4H9MA 3SI9A 3AIWA 2IQTA 1CENA 2IPJA 2P0IA 2Z27A 3LPGA 1NDWA 3QHMA 5F2GA 1O1ZA 1U5HA 1P5BA 3DFNA 3UJSA 4Q8OA 3PJTA 3WFAA 1AH4A 2NQZA 3KP0A 5ENLA 4Q32A 3WLRA 4G1KA 3HM7A 3UY8A 2WSQA 2BLEA 1DJGA 2YR1A 1CWYA 3N14A 2Q71A 4C6LA 1M68A 4WSKA 2HVMA 4IP4A 1RVKA 4JTDA 1RK6A 4DHGA 1OCQA 3SUTA 3M47A 3ELFA 4C1LA 5E0CA 2FJKA 1SO3A 4XAZA 4QTGA 4W7UA 4FNRA 3CQKA 2HWGA 2AGTA 1TTJA 1GOWA 2R6OA 2EPLX 1XD1A 3S2LA 3OEXA 4LV4A 4FIRA 2BY3A 4S3EA 2C71A 2DQWA 2AKMA 4LF1A 4NZFA 2KAUC 3R8GA 3MY9A 2JGYA 4F3HA 4G5DA 4AF0B 4LJ3A 2TYSA 4ZB5A 3WEOA 1D8CA 3WLNA 1DWIM 1FH7A 4QSHA 1WOAA 3H53A 2V69A 4HCHA 1E0UA 3S5ZA 3SDOA 4UTJA 4BFAA 1ML1A 2ZZ6A 2FFCA 1KM5A 5H8UA 4LVFA 2GK1B 3LGDA 2VFHA 4JXCA 1XGEA 2YCJA 3W84A 3IJ9A 4A3HA 1V6YA 2EPOA 1EHNA 1ELSA 4M5PA 2A79A 5DX7A 3LXAA 3S8HA 3GKFA 2EXOA 3LU2A 1NWSA 2OLAA 4FEZA 4J28A 1UR0A 3W87A 4IMAA 3NQ6A 4WRHA 4RLIA 4D9PA 3FHAA 5LIWX 3BTNA 9XIMA 3TK7A 1PVNA 1TWZA 1Z44A 2XIJA 2WNWA 3OLEA 4LANA 3TR9A 3AXKA 3UXLA 3PPHA 3SCUA 3WD4A 1ZSXA 3UZXA 2FTWA 4NAEB 1PKYA 1GOOA 3BJTA 3KL0A 3MZNA 4I9TA 2ZE0A 2INEA 4UQCA 6ENLA 4F0LA 3WBEA 3FDGA 4WY0F 3S9YA 3UERA 3UR2A 3TAKA 1KLYA 4UTLA 4KEMA 4PRTA 4XZNX 2PLMA 3GXIA 4PH6A 3FJ6A 3MCNA 4UQEA 2WANA 2ZX9A 3CZKA 2NLIA 2PGWA 1PHWA 3UZYA 3MI2A 4AMCA 4CCZA 2G41A 5GVJA 8RUCA 5DCBA 1REQB 3DUGA 2YLAA 3VFLA 7TAAA 1K3UA 1JPDX 3GD6A 1WUFA 4HOZA 4FZIA 4L6OA 4N7QA 4OTKA 4D8AA 4H01A 4ML4A 2X1IA 3W86A 3NQ2A 1X6UA 1GVYA 4NJGA 1S3TC 4AY8A 4AEFA 4ZBCA 2PTXA 2SFPA 1WPCA 3U2OA 3P7YA 2E67A 1WAUA 4B92A 3AISA 2E68A 2EJ1A 2QMKA 1TX0A 3HU7A 3PN8A 3ZSTA 1K6AA 2CBVA 1BSIA 2VELA 1NARA 2E3ZA 5I77A 4PCFA 4TXEA 2J7CA 3S6DA 2HVNA 2V3EA 3OOQA 4M6PA 2V30A 1TJ2A 1KM2A 4RR4A 2C15A 3QV7A 3F7JA 3H4GA 3CUGA 1UP0A 3EWXA 3HV8A 2QZRA 1QBBA 4OOUA 3BLKA 1I75A 3W2MA 1QPRA 2EPKX 2WNQA 1JI2A 5FL1A 3TOYA 1V6TA 2ZRVA 3LLFA 2OOGA 3R0KA 3L4UA 1CT5A 1OM0A 4PFHA 2I5IA 1KRBC 2NQHA 2WSKA 3P0XA 5HMFA 5IXEA 1RCXB 4KFOA 1J18A 2Q8XA 4BI6A 4EP8C 4PMXA 2QCFA 4ADTA 2VFEA 3APGA 5GPRA 3EX4A 5KEZA 6CGTA 2A6NA 2ZYFA 2VM8A 4X9YA 2F6UA 4CD7A 2EPMX 1XGZA 3G2GA 1ICQA 4DI8A 3P82A 3EAUA 4WJXA 1XRSA 4B3KA 3HJZA 4B90A 4XZIA 3F1QA 3LSBA 5A3HA 2CLLA 3TJXA 3R13A 3J7HA 2V2DA 2H9AA 2BB0A 3OA5A 3PBGA 4NXSA 1HJUA 5JBFA 5A6KA 4OFCA 3L68A 4HGXA 3GXFA 4OU1A 4OBSA 4ROQA 5A6SA 1UZ4A 3F4CA 4GQQA 1UWRA 5BXRA 3TCSA 3L5MA 3BOLA 4GJJA 1LWHA 1XICA 4AIEA 4FNPA 3LEPA 4BWLC 3NL2A 2J75A 2QGYA 1O7AA 4EPDC 4H7ZA 2JEQA 5KZ6A 3WZ0E 1JYWA 3VILA 1PIFA 3F2CA 4POCA 1H7NA 3VNKA 4XQ6A 5A8GA 1NM9A 5D05A 3O6CA 3HV9A 3RX3A 4DJDC 4HKPA 2VT0A 5KZMA 5I02A 3GVWA 4DYJA 6REQA 1IXOA 4UWMA 5HULA 2OWXA 4CEUC 2FH6A 3QXBA 3VZYA 2ISFA 3G1DA 3ITVA 3LV5A 1AD1A 4JTIA 4F0KA 5F2IA 1OX6A 3FVDA 3EWBX 3WDRA 3BLDA 1OIFA 1EXPA 1TELA 3W2LA 2ZUNA 2DH3A 2WCGA 4L9ZA 4JTFA 5D2WA 1DL3A 1MO0A 3N18A 4UFHA 2GGJA 4XUGA 3W9ZA 4GQ0A 3W4RA 4O19A 4YLWA 1K8XA 3W85A 4HVXA 1KXQA 3Q4DA 2PGFA 5DMNA 3E2SA 1SZRA 1DJXA 4PTXA 1KM1A 4AYSA 2WJDA 3CM4A 1RBOB 4IX0A 3QFWA 3BCFA 2NLYA 4HA0A 1FCBA 3GLCA 1TUXA 1AODA 1SJCA 3C8NA 4YVPA 3WQGA 1DBTA 1QR7A 2PLCA 2VEIA 5JXQA 3PPGA 3N29A 3NO5A 3GDLA 2OQYA 4WSHA 1PYMA 3VM5A 2WLZA 3GZAA 3IJIA 1NTHA 2IQ0A 3LSCA 2V5BA 1A5AA 3H26A 4FOUA 3NDYA 5A8MA 1S5VA 5M2FX 5GNYA 3STFA 4X2RA 1MSSA 3G3DA 1I9CB 2NX1A 4BQ4A 3LXCA 1UWAA 4Z1DA 3TUUA 5LNVA 3IIOA 7A3HA 5EBAA 4UFKA 1T40A 1IR1A 4Z08A 1ZJBA 4QJ5B 3W0KA 3TFXA 2YX0A 1HGWA 3WX7A 4WHBA 3NR0A 3K13A 3NQEA 1ONWA 4F48A 4GPNA 1XH2A 4P61A 4RPQA 1HL2A 4U3CA 3FN9A 1R9XA 2PPGA 4HOXA 2VQTA 1NU5A 3SY1A 1JEZA 1K6WA 3KRZA 4X61A 4Z2IA 4I9AA 2FGBA 3OBAA 5FAGA 1O60A 5D9NA 2YBUA 3BG9A 4DXVA 4NKCA 4YCOA 3W53A 2ON3A 1ZJHA 2W62A 4V15A 3PULA 3HFTA 2ZZ2A 4LF2A 1S3HA 4FF5A 3WENA 1QT1A 2RFGA 5BNKA 4C6PA 2Z2UA 4JIEA 4IIBA 3DHDA 3MMTA 1E1CA 1GW1A 2OPJA 4JYDA 2G95A 1PKNA 1IEIA 4LNCA 1GOXA 3MUZ1 1TPDA 1F3WA 3CQJA 5LIXX 1V6UA 2Q02A 3NDOA 2EQDA 4ZENA 3TN6A 1XLLA 2NVAA 3A5VA 3L21A 4E0CA 4ZO9A 2R14A 3LHVA 4ZOBA 3WF3A 1RQBA 4Q6JA 1GNXA 2O56A 4MZ1A 1K7XA 2WO5A 3MKCA 4LS2A 1KGUA 1NP2A 1EL3A 1UWTA 2C6QA 1S38A 3XIMA 2YBVA 4L4LA 1H09A 3W6MA 1E6XM 2BY2A 3F2BA 2GJNA 4GKLA 3DG3A 4PL1A 3UJEA 5HJYA 1GKPA 6XIMA 2Q8LA 4KEUA 4AWSA 3BSHA 4YHEA 1WX0A 4JNMA 2YYTA 3EA1A 4S1FA 4R53A 1XS2A 3T09A 4A3UA 1O4UA 1MXDA 1KB3A 4DAFA 4BY3A 4MM1A 1AVAA 5AHMA 1YYAA 5IDIA 2IPFA 3H7RA 2IKJA 2VUNA 4NXKA 3CL8A 3KHDA 1PX4A 3XINA 1FWIC 2VZUA 4R7OA 1GEQA 4HN4A 1RSCA 2LLEA 2POTA 3LHUA 2YW4A 1B4EA 2WVVA 5ABFA 2J9ZA 3JVAA 5I3JA 3DKJA 3S6OA 3IANA 5HUPA 3RR4A 3VD3A 3W2JA 1UH3A 1JQXA 1HQTA 3AMKA 3TEVA 2ZWYA 4GWEA 1TCMA 5I0DA 1JAKA 4L61A 3H70A 3N25A 3G0SA 1AJZA 3OZYA 5AVNA 4L4PA 3T7VA 4GC4A 1R87A 1RUSA 4IPLA 1IIHA 4QBXA 5A6JA 1QFEA 3RLVA 1UD6A 4EK7A 1A0EA 2D20A 4WDXA 5BU6A 3R79A 4C6BA 3QMSA 2YB4A 5E1QA 1HKIA 1E72M 3E2VA 3QLLA 2JIWA 4P8WA 1XI3A 2WXDM 3P61A 4AX6A 3RJYA 1JPHA 3DFPA 3BAYA 3PC0A 4ADUA 1TQJA 2E8YA 2XVGA 2W63A 3UP8A 1K8YA 3LTYA 3V5CA 4GYFA 3MSRA 1VKFA 3GFYA 3QY7A 2BVDA 1DKWA 3L66A 4ES4A 2Z1KA 4PBFA 3CTLA 2OX4A 2PEVA 3E2QA 3TQPA 1DE6A 3P8IA 3V18A 2IPGA 2QULA 3UQNA 1YPFA 5ABGA 1JDEA 8TIMA 3SUSA 4IFOA 2RGMA 4QDMA 3BW2A 4HZMA 3USZA 1HJWA 1IR2A 3ARSA 3TTOA 3ENLA 4CCDA 3ES8A 1DV7A 4FX8A 3M4HA 3S0CA 3KX6A 5HDRA 3MWAA 4ZO7A 2PZNA 4RDVA 3LPPA 1BXCA 2BGQA 4GBDA 2PWVA 3BAWA 4C6NA 5T91A 1ZZMA 4P2VA 4WDUA 4E2BA 1VEPA 4AZHA 1EC7A 4AZ7A 3S46A 1PTDA 3FEQA 4QJ1A 1PBGA 3MHGA 1HO1A 2QQ6A 3R25A 3RMJA 3U5UA 2VFGA 5FEPA 1POJA 3ITYA 5AC5A 4ILSA 3KVKA 4O8AA 3NG3A 4UCGA 4NJIA 3HTWA 4KIEA 1KRCC 4J35A 1CZ1A 3QQ0A 3AXXA 3S2CA 4PBGA 2ZZ7A 1B2YA 1IXPA 3HPXA 4FR1A 1W31A 3MI3A 4IHCA 3P6LA 3ARWA 5G1YA 4YCPA 2QCNA 3ALGA 4U2ZA 1BVZA 2QCDA 3WK3A 4I6KA 4R27A 3FFSA 3QJAA 1D9EA 1MQQA 2ZXDA 3ONCA 1H3GA 1Q7MA 2AKZA 3H2FA 1VYSX 2VR4A 1J9YA 5DBTA 4BZYA 1RCQA 4GH3A 3WJSA 4DWDA 4RUBA 1OFOA 2RDWA 2ZKMX 3WNNA 3URAA 3LNPA 2YFOA 1ADSA 3L5LA 5DF0A 4X63A 3M5YA 1EPXA 1FHDA 2PD5A 3VIHA 4F8XA 4UBPC 3B8VA 1HFBA 3DU0A 4U28A 1DJWA 1JYNA 1A5KC 4QLKA 4Z1YA 4JIPA 3GVVA 2Z29A 4RDYA 1QCWA 3LGEA 4Y9OA 4Y2WA 1QPOA 1J0HA 2VR5A 2ZA2A 1I6NA 4R88A 1BQCA 3NZQA 1NQ6A 3PFRA 2A3AA 2ONEA 2QUTA 3Q2DA 4ERGA 4XIAA 4DWSA 4CKQA 2YW3A 4PTVA 1H63A 3B8WA 4JTEA 2YJQA 1R9YA 4HD5A 3A64A 4S3GA 3S9IA 1JF6A 1K7FA 1J0ZA 4ICCX 4I3GA 1UR4A 1XIHA 2C13A 3U3HA 3FOKA 3EXTA 2V63A 5E0FA 1FKXA 3G0UA 3OQ8A 3N19B 5CGQA 4JTGA 4LYPA 5FACA 4ROPA 2HZGA 1T41A 4DYEA 4GFIA 1CGVA 2XINA 5D30A 3T0BA 2NQ9A 4CU8A 3QV9A 2QXWA 3DECA 4PMDA 1V3JA 2W92A 3CT7A 3LRKA 2FZMA 2YZRA 4BK9A 2RDTA 3MVTA 4Z0SA 1KW1A 4LAMA 3BPWA 3SB0A 5FIPA 4KWOA 3WYZA 4LVGA 2DFAA 4HK6A 4EANA 3QM3A 1QPKA 3MYOA 4IQJA 4ACYA 2QGHA 4UIOA 1J2BA 1F73A 4FALA 4IGNA 4F2BA 4LT9A 3ITXA 2I57A 1XRVA 3DGBA 5F1UA 1OVDA 1MXGA 1TA3B 3SY5A 4UUIA 4RV8A 2ZX6A 3WY1A 3WD0A 3VIOA 1ENUA 3N12A 4OVXA 3KOYA 3V36A 1IGWA 1SZGA 1QO5A 4LVBA 5CAKA 3TX9A 1NY1A 1EA0A 1JUKA 3KDOA 3T05A 1Z3NA 4B5WA 4QGCA 3UG3A 2G0WA 1KA9F 1ZRQA 3QN3A 4ZQCA 4E8CA 1AQHA 2OR2A 1JPMA 3S83A 4GVGA 3BXWA 4R5EA 4MUPA 4DIAA 4NAFA 2ZADA 3QHNA 5I3FA 4FHAA 3ZLFA 3A9IA 3CPUA 1TQXA 1E4IA 2Y5EA 3CPGA 3PZQA 3TOPA 3H55A 4GUGA 3CL7A 1MZHA 2DUAA 3GC4A 1GZJA 5A8NA 1XLKA 5DT5A 1C8QA 1C93A 1SM9A 4XAFA 3UCDA 5CPOA 1P1XA 2Z0IA 2ACSA 4YL2A 1W1TA 5M5DA 1OCNA 4Y6GA 3PPCA 3EKGA 3ICJA 1IIGA 4X9SA 1VFLA 3RF9A 2GSJA 3VKKA 4M8UA 2TAAA 2YGYA 3DYOA 3U6WA 3BARA 1CDGA 3ARTA 4KGJA 1QDSA 4REQA 3PB2A 3B40A 2WSYA 2B7PA 2WVSA 4U33A 4UFMA 3TJIA 3QYQA 1FWHC 3JRKA 3ZR6A 1OX5A 4DX3A 4RZ5A 5CQ1A 5DXYA 4LBUA 1VHNA 1SMAA 1XKYA 3QZ6A 3GIYA 3CLMA 1EDQA 1AQFA 2OKTA 2IQDA 1IF2A 1EZWA 1G0CA 3A6OA 3P3BA 4CQCA 2GUUA 4TO8A 3N4EA 4UOZA 2R9RA 4O8RA 3DKLA 3SR7A 4KCVA 1JPKA 2PBGA 4C6MA 1GG1A 4F0SA 3WNLA 1VH7A 4CNUA 1K1DA 5EPDA 2QPSA 2AMGA 4IPPA 5G5IA 1PUDA 1YXCA 2HEJA 2PS2A 5E5CA 1OCBA 1NWRA 1YADA 3GB6A 2DUZA 4C6IA 1A0CA 3GU9A 4GCAA 5B7ZA 3WF4A 2VEFA 3ZVHA 2J9YA 3GH7A 3O63A 3NSMA 2WVUA 1VJIA 1IHIA 4IQDA 4QHRA 3PBMA 5H1WA 3UJRA 1UZ1A 3W7MA 1FWEC 1EJXC 1O94A 2PGRA 5FAJA 1EJRC 4D6IA 1VBJA 4E4UA 4UFJA 1SZEA 1EJTC 2QJIA 2ZRYA 3FDKA 1OFQA 3Q37A 2Y85A 3WQ5A 6PTDA 1YE4A 3AXHA 2DT1A 1R3QA 1X8FA 1ITCA 3AUOA 3T07A 3ITTA 3MP3A 2H90A 4LVAA 5CC6A 4C90A 3N6JA 5CBJA 3VYLA 4FP1A 3UZ5A 4K8EA 1GYMA 3GUWA 2D24A 3GXTA 3EWWA 3CU2A 1TV8A 4OECA 5AHLA 2ZCGA 1IYXA 1OY0A 1MEWA 5AC8A 1A3WA 1TMHA 1Q4WA 2DVTA 5G4HC 2PUZA 2IKGA 1ITQA 1KLZA 4FNQA 3IARA 1MZRA 2CLPA 4GO9A 4RE3A 5DLCA 4IFKA 3CMGA 4KETA 1TPC1 3DXIA 5HUOA 3TQVA 4A8LA 4JBRA 1HL8A 5I3IA 3OLDA 1WZAA 1D7FA 1TCDA 1S2VA 3UPBA 1SW3A 1P6WA 5FJJA 1JFHA 4GQBA 4IICA 1UJQA 4W5UA 4AIBA 4BF9A 3W7LA 5AHEA 1TTQA 1E4MM 1BTCA 1JDCA 1G01A 5CPMA 1F8MA 3AO0A 4HHMA 5CC5A 1TFVA 1VFTA 4FXSA 4AZIA 5T9CE 3KW3A 1GVRA 2R1LA 3P5ZA 3QW3A 2ABBA 4H2CA 4O16A 3MMWA 3MUCA 4LYKA 2OB3A 3KOFA 3Q67A 3CIXA 3PF3A 1D3GA 3ZQ9A 5C8BB 4PTDA 1SW0A 1L2QA 4DXXA 5U7SA 4C65A 4Y9AA 3H2EA 4AHOA 1Z42A 1JR1A 1DTUA 3A13A 1ZBWA 1Q85A 4BJHA 3ABOA 1CLVA 3NCOA 2E5BA 4LAKA 3UPWA 5I09A 2BS9A 1MRAA 3GTHA 4B5SA 2WPGA 4Q7BA 1IEXA 3LLDA 3T81A 1ME8A 1Q6RA 3T1GA 3B8SA 1XIBA 1DP0A 4XAPA 4AW7A 4PEKA 3KDNA 1VGAA 3MO4A 3PTQA 3BMWA 4WKFA 2GWNA 4AUBA 4JTUA 1EH9A 1W2PA 4CU7A 2CLEA 4TQTA 1R9ZA 3P60A 5D9MA 1KGWA 2ZA1A 2ZX8A 3QGAC 4LBSA 2VMFA 4EXBA 1B31A 2RJGA 1QPQA 3SRHA 1W5OA 5B7YA 3S9ZA 2J27A 2DZVA 3MDWA 3MANA 1Z6KA 3AI0A 3K8KA 1W1VA 4GXWA 5JH2A 5CJ5A 1H1YA 5BZAA 1Z41A 1H41A 5A6MA 3BICA 4E3TA 1TREA 4S3DA 5KZEA 1PB0A 4LUTB 1CI1A 4J3VA 4RW3A 1E9LA 2PB1A 3GZ3A 3KLKA 1DHPA 3MHUA 1HG3A 2EPHA 3KCJA 1FBAA 1AL7A 1C3FA 2VI0A 4R3UA 4ERAA 1AFSA 3OYZA 1TJRA 1DWGM 3BCDA 2O55A 2E5CA 4U4MA 1XDMA 5TIMA 3ZYZA 4HTBA 4KFPA 5C2GA 4F66A 1JIBA 4UTTC 2WZTA 3VPLA 1KCKA 1UP2A 2HS6A 2QYGA 4KRZA 3LS9A 2EG8A 3WLJA 4V27A 1JGMA 1EGVA 3GK0A 1XIMA 4RXGA 1A5UA 4HU0A 3BG5A 4UMBA 4AY7A 1ONEA 2PDMA 3VNDA 4I9JA 3QR0A 5KMYA 4XTIA 4CNNA 4DM2A 4PYSA 1P0NA 2FYMA 4KEZA 4Q4OA 1VCFA 1ZCOA 1FWRA 2OMAA 3SFKA 1OFRA 1NQKA 1RCOB 1IT0A 1X1OA 1DWAM 1H2JA 1H5VA 3WNOA 2NV1A 3W7QA 2P8BA 3WIJA 4J9JA 1XFBA 3M5XA 3RCNA 3QHOA 2BOEX 4JL2A 3M0LA 4PMVA 4F2UA 3CTTA 2A0NA 3LCIA 1JCTA 1W3HA 1L6WA 3N3TA 4AWTA 4E2OA 3TDFA 3WQEA 3DBPA 3M6YA 3THAA 4I5XA 3BZJA 5BYWA 3AMLA 1VS1A 2I14A 5F7UA 2PDCA 4PRRA 3GH4A 3N9KA 2VNCA 1JZ3A 4NIRA 3CMFA 2DZBA 5EMMA 3E96A 3SGZA 3MBFA 4JIRA 4FA3A 1HKWA 3S5SA 5F2MA 5FSDC 4I7WA 1MFVA 1OWQA 2GGIA 1X6LA 2DPEA 1V7YA 1BVNP 4S3JA 3AZTA 1XLGA 5D8ZA 2FTYA 3SCNA 3CHDA 3WCZA 3SCQA 1ISXA 2OXNA 4P7QA 4O11A 2A3EA 1EC8A 1CCWB 2B4GA 4ICNA 1ME7A 3BMXA 1UMLA 2ZIDA 4PUEA 3W3OA 4HSOA 1SJDA 3W7GA 4NP7A 3T8LA 4C6JA 4Q4QA 3FLUA 2C18A 3KTCA 3TZFA 4HHLA 1XYZA 5M3WA 1GVQA 4JX4A 1OG6A 2NSXA 3AICA 1G6CA 2OG9A 4C5ZA 4NSBA 5A5WA 2JKPA 3VGFA 2R91A 3ZSSA 1NFBA 3EOOA 4B2DA 1JD9A 3W71A 4AZCB 3WQVA 4LAOA 3RM8A 4EPBC 3PBYA 4J2MA 1P0KA 3SQSA 1UG6A 4CQDA 3AS2A 1K77A 1UJPA 2INFA 2WKJA 2F61A 1ALDA 1G69A 4INFA 4Q8VA 2BX7A 4ZQMA 1XLAA 3CZJA 3W2KA 1KM0A 3L0GA 7TIMA 3L2MA 2YPIA 5SWUA 4Q4KA 4DF0A 4JL1A 2GVEA 4JICA 4DY1A 1QWGA 4DWSD 4MKSA 4GGHA 3QBUA 4IMFA 4NYUA 2HVOA 4TX6A 3DCPA 4GVFA 3USBA 1JNDA 1AZ1A 4MKVA 1EDGA 3LGGA 4X3ZA 4Z0JA 4MJMA 1JCMP 3ZO9A 1T5AA 2Y88A 1VFFA 4XD6A 4M6UA 4GI4A 1TG7A 2Y5JA 3L4WA 3CAWA 4C91A 4M29A 5CSUA 2TPSA 2D1ZA 2GUYA 4OBRA 4F9JA 3UWUA 3GWQA 3LX9A 1XIFA 3TA6A 1XBXA 4K2SA 1PZ1A 3REQA 3LV6A 3QEZA 4EXAA 1JZ2A 1CLXA 5A6TC 4V1XA 4JIIX 4JHOA 1J96A 2X1UA 3NVTA 3OO2A 1LF1A 1DOSA 2Y7DA 5D32A 1P1MA 1UWSA 2ABAA 1BVWA 1GUVA 1V08A 1EKOA 4H9UA 4ATLA 3WLIA 2JIEA 1WA3A 1OX4B 2HK1A 4L6DA 2QIIA 3H4XA 3LCGA 4GUFA 2J62A 4GKTA 3VD5A 1JDAA 2QCLA 5EGRA 4O18A 4D6HA 4G9PA 4DBSA 1S2UA 3TC3A 1T96A 4H4IA 1VFUA 4A35A 1BWLA 2GJPA 3G8RA 4GXMA 4N6EA 2WSPA 1TPWA 4LUSA 2VWSA 3ITCA 3RO8A 1OC6A 2Y63A 2TSYA 3D5HA 4XO7A 1A5LC 1IWBA 1O5KA 3B97A 3FNDA 1LROA 3NOYA 3LLXA 2VRJA 1QUMA 2J7BA 3GXNA 1U33A 2YL8A 1UC5A 3HQ1A 4ZOCA 1A49A 1V0MA 2XN0A 3CZGA 1XC6A 4M6QA 4CQ9A 3CLWA 3PTKA 2PDWA 1GKRA 2A2IA 3ITOA 4LPCA 2WZHA 2PWUA 3NJ3A 4Q7IA 3VC6A 3BV7A 4AD1A 2QIWA 4WCJA 2V82A 4YTTA 3U5YA 3CPRA 3GAKA 4RE0A 2O4QA 4H83A 5A8QA 3W1MA 4QE4A 2PRMA 2Z2AA 1YIXA 2FGLA 1XYAA 5ABHA 4X22A 2Z2BA 3U4FA 3TC6A 1BF2A 3RU6A 2ZXQA 3VABA 3LPOA 3FS2A 5H91A 4CQ8A 1JZ8A 4AVNA 5A95A 3HGSA 3IGSA 2KX9A 4D6GA 1IT7A 2W61A 3PZUA 5FJOA 2DZUA 3FA5A 3V5FA 3UPMA 3DHUA 3ZMRA 2HXUA 2VX4A 5BCAA 4F40A 2H6RA 4ZMGA 1KV8A 1FWWA 1PKLA 1TPVA 3AJ7A 1IEVA 4L6HA 1Q6FA 3OG2A 1A80A 1R47A 4HA1A 3VKBA 1J0YA 4XBJA 1WZLA 1BWVA 5K2ZA 2FQIA 2WWCA 4NG3A 3CWHA 2XN1A 3AU2A 5I2UA 4ZA0A 2DY3A 3IIZA 3KOZA 1UIOA 1S39A 5D04C 3OTRA 4MJZA 3W7RA 4OHQA 1PZ2A 1VBGA 4DUVA 3OODA 2Y5SA 4HU4A 3L7RA 1XG3A 4YS1A 4H04A 4DRSA 3ZJ6A 1MDLA 4XZBA 5BOOA 1W5PA 1BGAA 3UYCA 1BLIA 4I7VA 3LZ3A 4J3SA 4GABA 2RH9A 1I2QA 1PIGA 2UV8G 4DJFA 1CXFA 2A21A 1YPIA 2PMQA 1YX1A 3BLPX 3EX1A 3TJ4A 1D8WA 5I24A 1YTKA 1HN1A 1TR9A 1FOBA 4GY0A 3GFXA 1FWBC 2PLKA 1NF0A 4HPHA 1X6NA 1F8IA 4AISA 1WZMA 2ZVRA 4K38A 3A12A 4IJRA 4G7EB 2NVCA 3UCQA 4Z2GA 3AHYA 3W70A 3AIQA 3PUOA 4O0ZA 5JBEA 4IOTA 4OJYA 3PM6A 4QR6A 5IBXA 3HBLA 1TV7A 2AAAA 4NHVA 2NXGA 1V6VA 1JFXA 3W83A 5IDZA 3EX6A 2WMIA 4H8NA 2VZTA 4PMUA 3BQ6A 1DHKA 3GHTA 1W37A 3CIVA 5JIPA 2NUYA 3W29A 2F38A 4HB7A 2GZXA 2YA2A 2DW7A 5LNSA 2YBTA 3B9EA 2XISA 3BUVA 3W7DA 4J2PA 1UD5A 4GMEA 4H6RA 1GG0A 2GOUA 3IV3A 4U5IA 2PDQA 3QH2A 5EMLA 3M0HA 1JL8A 2C8NA 2JBMA 3T40A 4G7FA 1W54A 2CKSA 1EDTA 5A1AA 1Y65A 3ARQA 1EOMA 1TVPA 2JGQA 2OZ0A 3WLKX 5CGTA 2W27A 4UC5A 3FJNA 1YLVA 1L6YA 1P48A 1EUNA 3UETA 4W7WA 2PDUA 4GJ1A 1XF0A 1JXJA 3VTRA 3PG9A 1I0DA 1R5YA 3LD5A 1HJXA 4NNCA 4TX8A 2XVLA 3WLQA 2QKFA 5D4YA 3L4YA 5JU6A 2AAMA 4XBKA 3CK5A 2R1NA 3MJMA 4MHBA 3O6AA 4RZ4A 1BGGA 1JZ4A 2G96A 1R3VA 3II1A 2HJPA 3R8HA 1C29A 1GVIA 2PTYA 2E4TA 1TJ0A 3SJNA 2QAPA 4GD0A 3SSJA 1VPQA 5K9CA 4P7NA 3K1DA 3SADA 3EXSA 3Q58A 1VBHA 1F3XA 1UOZA 1OG0A 3APTA 3I7SA 3M0KA 1Q66A 1KNWA 4ALDA 4JTCA 3R0DA 2DORA 3S1XA 1UPPA 1YBQB 5EFFA 5PTDA 1SMDA 1F3EA 2XGBA 3IUIA 2CXGA 1Q8AA 5CH9A 1W1ZA 3S47A 3FAXA 1GT8A 5CPNA 7CGTA 1OT2A 1R86A 4ZCWA 4E8GA 1EJUC 4WKAA 4XV0A 1I2PA 2XVNA 4K1GA 4AD5A 3PZTA 4J4KA 5T26A 4IPJA 4UXDA 3L0NA 4E2DA 4NJHA 3WQFA 3CNYA 1I0BA 1RQHA 4Y9NA 2QS8A 1WKEA 3OZOA 4C7GA 4RZBA 3RO6A 2PFHA 1JZ7A 3S2NA 3C3UA 4R33A 4G8TA 3NQGA 4XBSA 2CLHA 1OGSA 4U31A 2REQA 1KXHA 4YU1A 3NZPA 1B0IA 1DIDA 4HZ7A 4AIUA 4B5XA 1A3XA 2OSWA 3VIMA 3VIGA 3OPSA 1G4EA 3WLMA 1YDOA 1W9PA 4LW7A 4QG8A 1XBZA 3OHIA 4UOJA 3LRMA 4E38A 3W00A 2JF6A 4LWWA 2P8CA 4LUJA 4JZ5A 4E8DA 4OWGA 3W6YA 3TW7A 4IMGA 2NW0A 1M65A 2CLFA 3GG0A 4C6KA 1XC4A 1E0VA 3EPMA 2OU4A 2HCVA 1F7BA 1QI4A 5MKGA 3MVIA 2BG5A 5HJLA 3R2GA 1OF6A 1IEQA 1V6WA 4HTYA 4AYGA 4KPLA 1J79A 3G6LA 2BZNA 3H6OA 3T2OA 4C6DA 1RA0A 5BW6A 4AD4A 3KCOA 4MB4A 3HN3A 4N4PA 4O0KA 1E3ZA 1GEHA 3SY8A 1A5MC 2UY5A 5AECA 5XIMA 5D02A 4Y9PA 1BWKA 4W93A 1KFBA 2L5HA 1S2CA 5FEWA 1B5TA 3WD3A 3V5OA 3HMJG 2NT0A 4O17A 1EQPA 4GQRA 2YKKA 3NEVA 4MZYA 3NYZA 4QJ3B 5CZJA 2GUBA 4MFDA 1E5JA 1Q8JA 4JY8A 2NUXA 4IIHA 2QEZA 3WDQA 3F2DA 5DN1A 1FDJA 2BDQA 3OIHA 3GYCA 3IEBA 3IJQA 4V1YA 2PE4A 5BU9A 4GRSA 4K68A 4D6JA 2WZMA 1F4HA 1WV2A 4IGMA 1KR1A 4JTTA 1KR0A 1XYBA 2ZQ0A 4AD2A 3WNPA 3O07A 3GXPA 1BRLA 3WLSA 1W3KA 3OHMB 1GVSA 3LHZA 2QPUA 1ISZA 1C8XA 2HQAA 3VM7A 3T78A 4BI7A 4GNKB 2GDVA 1MWOA 1VAHA 3MUXA 1HL9A 3A23A 1NEYA 2JKAA 5AZ0A 3WN6A 1VFHA 4GZJA 1RK5A 4H6QA 2D69A 3VI2A 4IF2A 1AUSL 2QDHA 3E9AA 3AS3A 4F9DA 1QWKA 5FJTA 4WY0A 4EX4A 3ZIZA 4HU8A 2X1RA 4JQAA 2PU1A 3WL1A 7REQA 3NPXA 1VRXA 4M51A 3UVAA 3T4CA 3QLDA 4NVTA 2V3DA 1UWUA 5H6HA 1XIDA 2CXEA 4LRSA 3LUTA 3B9DA 1LJYA 4LCQA 3C56A 1OSEA 2WPBA 3INPA 4JN6A 2VEKA 3UU0A 4A22A 1M5WA 1PAMA 4Q3MA 2X41A 3GTXA 2D2HA 2B31A 1RV8A 3RJXA 2OGYA 3W25A 4J3ZA 4FO4A 3WQ4A 2OT0A 3E5BA 1OGBA 3ABRA 1ZUAX 3LBCA 1UW9A 2GVJA 1SR9A 1M01A 2Z1BA 1WBHA 3LQLA 3AU6A 2WM1A 3B8TA 2R1MA 2ZUVA 3A3WA 3PR2A 3O8AA 2QDDA 4DWSC 3BE7A 5REQA 3H2CA 4B2DD 3CUJA 1DJZA 4DO7A 3F4NA 2E25A 1OINA 3C0LA 3WQCA 1A4MA 1VPXA 1V3LA 4PODA 4Q8MA 1K7EA 4PE8A 3M16A 4AZBA 3ANYA 2WKGA 3K46A 3TV8A 3O6YX 5GJPA 3SCRA 2P5NA 1K9TA 4MJ4A 4CN4A 4J3WA 2D73A 3OZPA 3LRLA 2XFWA 2NVDA 5CPTA 1UR1A 2BXYA 5FF0A 3L12A 4H2HA 3KBWA 1RPKA 2IS7A 2GJXB 4FLOA 3W1TA 4MNJA 1GPWA 3S2JA 2J77A 3WNMA 3CAKA 3CHCA 1U1HA 3D0CA 3UNTA 1O5RA 4IMEA 5CGMA 3NIYA 1DJNA 2GSHA 5HNUA 2BHZA 4GZ7A 3DESA 3G1SA 1QW7A 3HQNA 3G1AA 5FF4A 2CYGA 4MB3A 1LT7A 1AQ0A 2O9TA 1RALA 2WHJA 3BMVA 2BHYA 5L9FA 3BURA 5JMUA 4ZOAA 1BTMA 4DBEA 4C1KA 4JY9A 3W07A 1EBHA 1XD0A 2XWDA 5D8WA 4HMEA 4RZ6A 4HZ8A 1M53A 1N8FA 3VKAA 2HPIA 1N82A 1IT8A 2XDFA 4FXJA 2JALA 1K70A 2WVTA 4F2TA 4TTGA 1AH0A 2G97A 3DFTA 4YWIA 5FJIA 3FY1A 2PU0A 4DELA 3O6DA 4TX9A 3EDEA 2Y24A 4DJEA 3PK7A 2BVYA 2VZSA 1OZMA 2VX7A 3TSBA 3D6NA 1VB9A 1FQ0A 4PUNA 5JBDA 2OYLA 1E6ZA 1SFLA 3WF2A 1CGTA 1CYGA 2UY4A 2J7DA 4KGLA 3T6CA 2IMRA 3PSWA 2Z7KA 2F2KA 4PUUA 1P0DA 4M19A 4HMDA 4HCLA 4CGTA 4S3BA 1VHCA 5D2XA 3PS7A 3FYPA 2BY0A 3V4BA