3QEZA

Crystal structure of the mutant t159v,v182a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
MDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSVRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 83
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qezA00
3MBDA 4O4WA 2CZFA 4X2RA 4A2SA 4HSOA 4ADTA 3G18A 2H6RA 2DZWA 2A7PA 4NNBA 4AH7A 1R46A 2VXNA 3G3MA 3CC1A 1TRIA 1JJKA 1AW1A 2RHGA 3QF0A 1KFJA 3F4NA 2GVJA 4AMAA 2ISSA 1C8VA 4AWUA 1BWLA 3MYPA 3W83A 3VKJA 3NQVA 2F7FA 3UXDA 3P84A 1K03A 1JRCA 1QOQA 3PUDA 5HWNA 2VC6A 1EP1A 3KHJA 3TROA 5CPMA 4R33A 1PVNA 2ZCGA 2GVLA 2YYUA 4NX5A 1HO4A 4MOZA 2NWSA 4MPQA 2ZRZA 3CEPA 3UPBA 2ABBA 4LW7A 4JX5A 5D04C 4OQVA 3W7EA 2YGYA 1TMHA 2QDHA 3L9CA 3W1XA 1RPXA 4Z0SA 1HFBA 1OFEA 3NEVA 5CZTA 4A21A 5CSSA 1YADA 1GVSA 1G4TA 3DHDA 4O1CA 1UUMA 4JXCA 1KFLA 3LXBA 4UR7A 1H50A 3Q37A 4LU0A 2I9EA 5LNSA 1JCLA 1LZOA 3HJZA 3IVSA 4LVAA 5D33A 3P5YA 1WAUA 4LUJA 2V0TA 1MXSA 4I9AA 5D30A 4NJHA 3HG2A 1OJXA 5D37A 1G4PA 4AAJA 4MZYA 2FB3A 5C6MA 1AL7A 4UTKA 2CZEA 4IX2A 4WQ6A 1KV8A 3NG3A 3C2FA 1FQ0A 2YSWA 4YCOA 1O94A 4PTNA 4N6FA 4GE8A 5HR7A 1OYCA 1VZWA 2C18A 4O8RA 1M5WA 4FEZA 2ZZ3A 4BI5A 1OABA 5I3KA 4DXVA 1PCKA 1X1OA 2ZRYA 5F2IA 1ML1A 4DO4A 3IIXA 3VNDA 2XN1A 4MFDA 3NQ7A 4YCPA 3W7GA 4HNVA 4IMGA 2QF7A 4O1DA 3PY2A 4CNPA 4XUGA 1SZEA 4UMCA 3W7NA 3LXAA 1TPWA 4TU1A 1P1XA 1LBLA 1ZFJA 4FF7A 4FB7A 3LLFA 3T55A 5BW6A 1OX6A 1EX5A 2BX7A 3CPRA 3WJYA 2ZRXA 3DI1A 2EHHA 3P61A 4HPJA 2Q8ZA 1H5YA 3KVMA 4OV4A 1H7WA 1OFPA 1ME8A 4AWTA 4B5NA 5FI8A 1Q45A 3F03K 5I3HA 1K7FA 1T99A 3UPWA 3KVJA 4O0ZA 3DGRA 5F1UA 4Z1AA 3W23A 3TQ0A 4UFIA 3LCFA 2P0OA 3C8FA 5U7SA 3LRMA 5LHEA 4GWEA 3VE7A 3BLFA 1GEQA 2V2CA 3SY5A 4QSHA 2E1DA 5D2XA 1FWSA 1ZHAA 3NQCA 2H8ZA 2X16A 3HGOA 1LRTA 3B0UX 3LHVA 2JGYA 5A8GA 4CQ8A 4JIPA 3Q2DA 3W1UA 3QZEA 1EPXA 3W1LA 3NZRA 3GKFA 3JR2A 3M5YA 3WJXA 1M7PA 2YZRA 4AWSA 5H91A 3I68A 5HWMA 4GBUA 3W87A 2V81A 1WOAA 3LCHA 1W5NA 1VR6A 6TIMA 1DJNA 1W0MA 5SWUA 3DKJA 4U4MA 2B7PA 5CPLA 2H90A 3LBCA 1OX4A 1U5JA 3LRLA 2FPYA 3IIZA 4RZ6A 4EIVA 1XM3A 3LCGA 3RU6A 3G3DA 1IF2A 1FWTA 4NU7A 4JTKA 2CLFA 1VQTA 5GVJA 1BWKA 1ZJIA 3PBVA 1EP2A 3DFSA 1FDYA 3RNDA 3RLVA 4YL2A 2G5WA 1SR9A 2ZZ6A 1TCDA 1OX4B 2RDUA 1LROA 4JTUA 2TPSA 4K36A 1K02A 1BTMA 1SPQA 3UZ5A 3TMQA 1QNVA 4UMAA 4UTTA 1GVQA 2C0AA 5DN1A 4N9CA 2A7NA 1VJIA 3QM3A 3DKLA 5A5WA 1XUZA 2TRSA 3STCA 5IM51 3NQFA 1XCFA 4UTUA 3TA6A 4XQ6A 5KINA 5AN7A 3G1DA 3W1NA 3E0IA 1JRBA 3PB0A 1Z48A 3TJLA 4JDBA 1SZGA 1Q6LA 4IUOA 2Y70A 4NQ1A 3LTSA 3ABSA 5IBXA 1O4UA 3EX6A 5EMUA 3KVLA 2QKFA 1GYNA 2WV8A 3NL5A 3BPWA 4MY1A 4Z08A 1QO5A 3FFSA 3NZ1A 3UWUA 3QRHA 1Y0EA 1GVRA 3GXNA 3R2GA 5AYYA 3W7OA 1ZNNA 2X1RA 2BLEA 1A5SA 4HSNA 3MWAA 2GQ8A 2VFHA 3TE9A 3NO5A 2EAWA 4LVGA 4N9EA 4IPJA 1KBIA 5CG7A 4JYFA 2NLIA 4E0CA 4Q32A 1LRNA 3STEA 2CW6A 1C29A 5CKSA 4ZQPA 5K9CA 1GJPA 3L67A 2E5DA 4FNQA 1J2WA 2VFGA 1YDNA 1JCNA 1O60A 1DORA 3R89A 3P62A 4HKPA 5HNRA 3LI0A 4JICA 5KZDA 3OIXA 2YFOA 3HF3A 5LNWA 4ADUA 1I45A 2DZXA 4GUJA 5HULA 1O5XA 4G1KA 3QC3A 1F7BA 2W79A 4E2DA 3SFKA 3W7KA 1QWGA 5FF0A 5G5IA 2NXGA 5DCDA 1DHPA 3T40A 1FUYA 3U2OA 3F4WA 3QMRA 7TIMA 4X9SA 3HGSA 2VFFA 3SSJA 1LOQA 3LB0A 4M7SA 4R34A 4IMFA 4GC4A 3KAOA 1G7VA 6ALDA 3ZWSA 4ML9A 1XUUA 1G6CA 2ATMA 3SGZA 3UWWA 1M6JA 1QCWA 3NPUA 3WJZA 4CNOA 2B7QA 3QEZA 3G0SA 3UY8A 1TPB1 2TSYA 1GPWA 1TV5A 5C5YA 4P2VA 3EXSA 4K7VA 3BARA 4JN6A 1QOPA 4OE7A 4AXKA 4RZ5A 3NQ8A 3O6DA 4PEKA 2QJIA 4O54A 3W6YA 1PV8A 1H51A 5EA9A 3GR7A 4LS0A 3DBPA 1ICPA 5AFDA 3FS2A 3E02A 3PF3A 1SO3A 3S42A 3TUUA 4OHQA 3R8RA 3V1PA 4MYXA 5AC6A 1W3IA 2J9XA 4JTJA 4UMBA 4N4QA 1JCXA 4YMZA 1GOXA 1QPOA 4ZMGA 2WPBA 3W7RA 3W7IA 2H3DA 4GUHA 3ZWTA 2ATSA 3GZ3A 3T4CA 2A6NA 3BW3A 2NUXA 4BF9A 4DEFA 3PUOA 5FEWA 1W54A 3PS7A 3C2VA 3NVTA 5EPDA 2FLIA 1IGSA 4O1AA 1TV8A 4UFHA 3HOJA 4PFMA 5HUOA 3MHGA 3BVJA 4DPPA 1P4CA 3LV5A 4MFEA 1ZAIA 2YX0A 1SO5A 2O7QA 2HTMA 4M6PA 4H3DA 2CZDA 4M5PA 2PC4A 3KOFA 2QDGA 4Q4KA 3TCEA 1H7RA 3LXCA 5HMSA 3WK2A 1P0KA 1BEUA 4TO8A 3QQ1A 2NUYA 1N8FA 2Z6JA 1PE1A 4MIMA 2C15A 4S2CA 4IPIA 1QMLA 5DY2A 1YLVA 3STGA 2CLEA 5AHMA 4RLIA 1Q6OA 4KFPA 4FNUA 4CCCA 4NXKA 1M7OA 3G8EA 1QFEA 4ZQOA 1THFD 3EEGA 4JY8A 1TTIA 3O6CA 1EUNA 1VCVA 3DFNA 2G95A 2NX3A 4DBDA 2YYTA 3QSTA 1JVNA 5LNVA 1KTCA 1NSJA 1ZAJA 2OJPA 1SO4A 5CPNA 4LC6A 3L0GA 5G2HA 1W1ZA 4AHOA 4DO5A 4HPXA 2V82A 4UTJA 1F74A 2DJLA 3HMJG 5J5DA 4O50A 4RCXA 4UTMA 3BV4A 1K8YA 4JYEA 4NZJA 4O11A 3LV6A 4N9BA 4JD4A 4OT7A 1JUKA 2PRHA 4MLRA 3EWZA 3N3MA 4LC8A 5TBOA 1A50A 3DI0A 4MZ8A 5KSWA 3L21A 1OYBA 1XBYA 3GAYA 1KFKA 3GKAA 3OVPA 3EWUA 2V9DA 4NJIA 5K9XA 3CWNA 3W2JA 4JTGA 4UTTC 3TSDA 1MZHA 1TTQA 2CFFA 4JY9A 4IMCA 3SGUA 1B9BA 4Y9AA 5LKYA 2P1FA 4AHQA 4UNLA 1XKYA 4YWIA 2JKEA 1OFDA 3BO9A 3W1TA 3FIGA 1D3GA 1PL9A 3LHTA 4K39A 2G96A 2PRMA 1EUAA 3EWBX 3MP5A 1R47A 3M16A 3A23A 1S3HA 3GK0A 2C19A 5F4SA 2ZTKA 3O63A 1KFCA 4NVTA 2HS8A 3PUEA 2NXIA 4RKAA 1ZALA 3Q58A 2RKXA 1NVMA 1E51A 1HUVA 3TW7A 1NAL1 3EXTA 3F1QA 1B4EA 3M6YA 2Z0IA 4FNPA 3DAQA 4RK8A 3CHVA 4JDYA 1SW3A 5E0KA 3M41A 3S0CA 3UD6A 4MZ1A 3M43A 3W2LA 3MYOA 3LTPA 1QPNA 4FX6M 3N19B 4UFMA 2OMAA 2C16A 4RXGA 4IWWA 3SW6A 2YFNA 4ONVA 1CX9A 2ZZ1A 3NAVA 1TPDA 4ZQRA 5DBUA 1W31A 1UB3A 5FF3A 4LVDA 3W1MA 1QO2A 3W71A 3HBLA 3S1XA 3W07A 1XI3A 1FY6A 3TAOA 2WNNA 4RXFA 3MMTA 1FXQA 4CNNA 2J6XA 2YXGA 3A22A 4MVAA 1EEPA 3S5YA 2FFCA 3I6RA 3IIOA 3BG9A 4JYDA 4NJKA 1EP3A 4RR4A 3TNOA 4R53A 1KBJA 3L5MA 4I7WA 3EX4A 5K2ZA 5F2LA 1VPXA 3LI1A 3N14A 4O16A 3W85A 2OZ0A 5CZJA 4Y96A 5CSRA 1UUOA 4HNTA 3GNDA 1TPEA 1EIXA 4JS3A 3PVFA 2Y6ZA 2XFWA 4MLJA 2G97A 3EB2A 5AHFA 1S5TA 5FESA 4XBKA 2Y7GA 2PE4A 1LOSA 1D9EA 1TJPA 3QPZA 3IIPA 4UTWC 3G8RA 5HWJA 3GLCA 2GQ9A 3I7RA 1XBVA 2WQPA 2J88A 3DXIA 1LDCA 4D2JA 1R30A 2ZFAA 2CU0A 3LERA 4WUIA 3G0XA 3FYOA 1N7KA 1OFOA 2ZZ2A 2J9YA 2VFDA 3FEMA 3P7YA 3W7CA 3W7HA 1TQXA 2ZYFA 2VOMA 2A6LA 2Y7DA 1W5PA 4K37A 1XFBA 3JRKA 2GUUA 1YPIA 3EWYA 1I8JA 5G4WA 3A5FA 4U28A 3NQDA 3VI2A 3G1XA 4JTTA 4C1KA 3G1AA 4CQAA 4PA8A 1S5VA 1TTPA 5I3IA 5K4XA 3UY7A 2OCZA 3BK0A 2VEPA 3W7PA 3L68A 4TX9A 2X1UA 3NQAA 2FPVA 3W75A 5HINA 2J24A 4FXRA 4NNAA 1Z44A 4X3ZA 3BG5A 3DFQA 5AC7A 1GWJA 3W7LA 2E6YA 3ABQA 1RR2A 4E2BA 3NQ6A 4IJBA 1HTIA 1MEWA 3LHYA 4Z1CA 4NUWA 5HJLA 2Z2UA 5LZLA 1OF8A 1UASA 2D73A 1OVDA 4TIMA 2EKCA 3P74A 2YCEA 2C3ZA 1N55A 1XDMA 1NF7A 3P5ZA 5C54A 3MO7A 3NPXA 4K8EA 3QMTA 4UFKA 2ABAA 1B57A 3ANYA 4HNUA 3L65A 1TB3A 3KFTA 3C6CA 1L6YA 2A21A 3A21A 5EKYA 3O07A 1IIHA 2HSAA 4Z0JA 2QUUA 4Q33A 2FDSA 5D03A 4KKXA 3TV8A 1A5BA 1JQXA 1DBTA 3GIYA 4QAIA 5FEZA 3LGEA 2NV2A 3TFXA 3NYZA 1UBSA 4CCDA 4UCGA 3N9SA 2AQWA 3UWYA 3N2XA 2ISVA 1AW2A 3EX1A 2AAMA 3IGXA 3W2UA 1EB3A 3O16A 3CLMA 3MUXA 2VKZG 5J5RA 5MHBA 3OEXA 2OT1A 4UTWA 2CWNA 5HUPA 4P61A 4ICNA 4LUIA 5BNKA 1W5OA 4JTLA 3CT7A 4MYAA 5AYXA 3C2OA 5G1TA 3C3NA 2ZBTA 5AB3A 5U4NA 5D38A 3LCWA 4UFJA 2ISWA 2VEMA 1X1ZA 4XTDA 4O18A 1UCWA 4O17A 2WSRA 1H60A 3RFAA 1DVJA 3TSBA 1VYRA 4GUFA 4MJZA 3ZR4A 2VEKA 3L0KA 4O53A 3FOKA 4A2RA 3NOEA 4PODA 4MUZA 5EY5A 1GTHA 3MHFA 4OWGA 3NR0A 5IBXC 4O57A 2GVGA 3A9IA 2ZRUA 3PBUA 3NL3A 1WV2A 1LBFA 3LLDA 3W7MA 1L6WA 3I7SA 5DBTA 1KM1A 3AJXA 3P8IA 4RZ4A 3IVUA 1QPQA 1TIMA 3CM4A 4GUIA 5FEPA 1GT8A 1KW1A 2Y62A 1K7XA 4ORIA 3HGRA 2R8WA 3IGUA 2Y88A 5KMYA 3NPWA 5D2TA 1GQNA 1SSDA 1TPUA 3B0VC 2DORA 3GB6A 1YDVA 5F1VA 1ZAHA 1IXPA 2ALDA 2LLEA 2Z6IA 5LHFA 3NQMA 4H6KA 2QUVA 5CZ0A 3FKRA 4IXHA 1QPRA 3C4UA 1L9WA 2QCDA 1I2PA 4UFLA 3EX2A 3L0NA 3G1VA 4GRSA 4DF0A 1TRDA 3C61A 5HR6A 1I4NA 3TAKA 2NX1A 4AF0A 1J4EA 2OT0A 5K3VA 1H7NA 2E6AA 3M0ZA 4FX7A 3BLIA 3L66A 4M6QA 1SW7A 2YW3A 2E5CA 4UXDA 3W86A 5D02A 2TMDA 2V5LA 1P0NA 1IXQA 3B06A 3H55A 2PRLA 4IXXA 1OX5A 1WA3A 2E6DA 3PAJA 1DV7A 3N73A 3TDFA 2CLKA 4EF9A 1VCGA 1WOBA 1VH7A 5C2XA 3QQ0A 2R14A 3EWXA 3PG8A 5FF2A 1LP6A 2ZZ5A 2WKJA 3E96A 2NZLA 1TSIA 2PURA 3SIZA 4C1LA 1WQ5A 1WBHA 4W9TA 3M7WA 4TMCA 1QDSA 4QQ3A 3S5OA 5I3FA 3MI6A 1GVOA 3CB8A 4DPQA 2O7SA 2X30A 3GDKA 3TJXA 1CW2A 1DOSA 2PCQA 3NM3A 5H2ZA 1RD5A 1SSGA 4LV9A 3W72A 1YXDA 4A29A 4I7VA 1YPFA 2CLMA 2QJHA 5CGQA 2TYSA 3FKKA 3IRDA 3O15A 4O13A 2DU2A 3T7VA 3GVGA 2NV1A 4YLWA 1SZFA 3PC0A 4JEQA 1HL2A 3G1HA 5DCEA 2WSQA 3GNNA 4LVBA 2QR6A 3R12A 3WK1A 2WSYA 3G1FA 4O1BA 2NUWA 5D09A 3MP3A 3Q94A 5DXXA 3PSVA 4XBSA 3ATZA 4HN4A 3I7QA 3HG5A 3LDVA 2GJLA 4O0KA 2VELA 4I7UA 3HQ1A 3QW3A 4UUIA 4AF0B 1KM5A 4H4IA 3VE9A 3ZFHA 1ME7A 4FNRA 2A1YA 1W8SA 4Z1DA 2Z1BA 4UTIA 5F4WA 3MBFA 1W56A 2V30A 4WXZA 4IOTA 1GG0A 3LM7A 3LHUA 4Y90A 3NM1A 3HG4A 1XXXA 5CPOA 1VC4A 2OX1A 1K8XA 5L6UA 3NQ2A 2QCGA 1LYXA 5G1YA 3LX9A 2P10A 2X1SA 1PIIA 1PHWA 2FQIA 1A5AA 4XKYA 4LRSA 1TO3A 1ICQA 5G2WA 2QCMA 1H1ZA 1EWDA 1WX0A 2QCHA 4HIBA 2DZTA 3DFTA 1B3OA 1LBMA 4UR8A 3LHZA 1KV5A 4XKYB 1W3TA 3QH2A 5BOOA 4K38A 2EGZA 2C1HA 3S5NA 3SI9A 4HT3A 1FWWA 5KTLA 1LTDA 3SJ3A 3O1NA 2YW4A 3VCRA 1TQJA 4DBEA 1F5ZA 1T8XA 5LSMA 2H3BA 3JS3A 3TH6A 3C56A 3R5EA 4PCFA 4QITA 3DFOA 5DCBA 1F6KA 1LCOA 1RQHA 3U8GA 2R91A 3W2NA 4DF1A 2FB2A 2FJKA 4ALDA 3UNDA 1T0OA 3RF9A 3QFEA 3CWOX 4FXSA 2RDWA 4M19A 3OBKA 4LY8A 1F76A 5F2GA 3PM6A 1Z42A 3HG3A 1SQ7A 1X7FA 3CIWA 1SO6A 3R13A 2R94A 4K6AA 4WY0F 1MEIA 1JQVA 1GG1A 3WJSA 1TYGA 1FX6A 2QUTA 4GXMA 4N9DA 3N34A 3TXZA 2ZA2A 3T78A 1EWEA 1F05A 1GYLA 1J5TA 4JX6A 1SFLA 3S9YA 3PULA 2CZ5A 1HG3A 1TPFA 3IGSA 5FF4A 3DZ1A 3A24A 2ZRWA 3SZ8A 3W3OA 3EKZA 3I65A 2ZA3A 2B4GA 1A53A 2W0UA 3USBA 5DY3A 4POCA 1TPH1 3PR2A 3C0JA 4AVFA 5AYZA 4NX0A 2CLOA 1GZGA 5T26A 4WOZA 5BMXA 2JK2A 3NGJA 1H7XA 3HPZA 4JR5A 4UNKA 4IMEA 3BGJA 4RX0A 2QEZA 4O10A 4LS1A 2QCLA 5F4XA 1FWRA 1BKSA 1SFJA 2V2DA 3E9AA 4HNNA 3O6YX 1H63A 3THAA 4NXSA 4PL2A 3N9RA 1IXOA 5I3JA 5TIMA 2I1OA 1VS1A 1FCVA 3GR8A 2ZTJA 3THQA 3DH7A 4JX4A 4Y6GA 5AHNA 5ABTA 3KRUA 4DO6A 3H53A 1K8ZA 4ZQCA 3B05A 2ZA1A 4LOCA 2C6QA 4TR9A 3W74A 1H7PA 1LLZA 1AW5A 4M7TA 1C9DA 3PBWA 1UJPA 3PBYA 5AHLA 5C55A 3IEBA 1HO1A 1P5BA 3FLUA 2EPHA 4FNTA 1VLWA 2FTPA 1L2UA 1O95A 3MI2A 3W76A 3TC6A 3A5VA 3NL6A 4WY0B 3H54A 2V5BA 1XBZA 4FO4A 3ATYA 3TQKA 4X22A 1ZENA 2UV8G 2Y61A 1KTBA 3M1ZA 4HHPA 3YPIA 4EOUA 3TKFA 4L4MA 2E68A 1I2NA 1PS9A 2C13A 3L5LA 4O14A 1NEYA 4BI7A 1FCUA 5LNRA 2QCCA 3GAKA 3NL2A 3INPA 2WO5A 1X8FA 3MW7A 3N2MA 2E77A 5D2WA 2BXVA 1FWNA 1TV7A 4FX8A 1LOLA 3GXTA 2DZVA 3TFCA 3BLEA 4QJ1A 5BMWA 1O5KA 3M9YA 4J9JA 3RLUA 1W5MA 3PSWA 3W1QA 2A5HA 2VEIA 1TREA 3TR2A 5K4ZA 2VENA 3KRSA 3W22A 3W7QA 2YDAA 4RV8A 1L6SA 4FNSA 1ZCOA 1AMKA 2DZSA 4JTEA 5G4EA 2RDTA 1H7OA 1LLWA 3G1YA 4M6VA 3L2IA 3RMJA 3NQGA 3W2KA 1XBXA 4MY9A 4OV9A 4Y8FA 3FJ6A 3M5ZA 3W2MA 3CEUA 5AHIA 3KXQA 4PH6A 1VRDA 1YDOA 2QCNA 4ZZ9A 4JTFA 1R2TA 3TU9A 3O06A 3W84A 2X2GA 3NDOA 4O12A 4UTLA 3TX9A 3UWVA 1VLIA 2VFEA 4AHPA 1KLZA 2HS6A 3GYEA 2A85A 2YR1A 3BG3A 3NXFA 1OK4A 3D0CA 2QCDB 5FEXA 2NX9A 3NNTA 3DHFA 1ME9A 1D3HA 4K7YA 3P82A 4AEOA 3OG3A 4O4VA 5LGXA 5KZMA 4BK9A 5DELA 2DZPA 3O05A 3KVKA 5LGZA 3L5AA 3G1SA 3GX9A 3NQEA 4DELA 1I2OA 3DFPA 3FA5A 3LBMA 4ZQNA 3M44A 3CU2A 3LCXA 4LV4A 3GDTA 1KM2A 3HPSA 4TMBA 3M5XA 4NJJA 2BSLA 3SR7A 1AK5A 1RVGA 5TQLA 3E12A 3OVQA 1TPC1 4JTSA 3WJWA 3TIMA 4FIRA 1NF0A 1RV8A 2V2HA 2Q8LA 2F84A 2GPTA 4N6EA 3EX3A 4BR1A 1CI1A 3G0UA 2XN0A 1KM4A 5E93A 3VFLA 4AB4A 3CIXA 1NFBA 4MJMA 3KRZA 4XZ9A 4IMDA 3AO0A 4OGZA 4L4LA 1F73A 3P67A 5HQEA 3UZJA 4N2YA 5L9FA 3UYCA 3B03A 3BGGA 1KFBA 2QCFA 3S1WA 3B8DA 4UIOA 2GQAA 2JKPA 3DENA 3PG9A 3QSRA 5I3GA 3W1RA 3S6DA 1LRQA 3W1PA 1OG0A 5BRBA 1QAPA 3W7JA 3WFAA 4DF2A 2CLLA 3UWQA 2DJXA 4LWWA 1Q6QA 1ICSA 3ELFA 3MHUA 3W70A 3TXVA 3B4UA 1VHNA 3G24A 1FBAA 2ZRVA 4IQLA 4BWLA 4JTIA 2QJGA 1OK6A 1G7UA 2YPIA 2E09A 4ZVJA 4OBTA 4MY8A 2Q3RA 3CTLA 2WNZA 2GOUA 3OVRA 2JKAA 4O15A 3HIJA 2ZZ7A 4KWWA 1SW0A 2EF9A 3V75A 3GDLA 4BWLC 2CLIA 1VHCA 3T44A 2XN2A 2QCEA 3G22A 4LVFA 3C2EA 2V8ZA 2RH9A 1XC4A 2WOQA 4ZL1A 1G4SA 1H62A 3NPVA 3W73A 4UC5A 1G67A 4QIUA 3WK0A 3MJYA 4CLMA 4XTIA 1IXNA 3KX6A 1W3NA 1G69A 4CCEA 1FCBA 5LNUA 5K7JA 2B7OA 2A0NA 4PL1A 3MI3A 1VYPX 1KLYA 5KITA 1U83A 1S5WA 3C52A 2J9ZA 4WZHA 3UXAA 3DU0A 1YYAA 2DZUA 3E49A 1YTDA 2W6RA 4KFOA 1DJQA 3UWZA 3LCLA 1XL9A 5CZSA 1R2RA 1PHQA 5AOUA 1OF6A 1ADOA 1QR7A 3HO8A 5FF7A 5D2YA 2IQTA 4NZFA 4QISA 3S8HA 2FIQA 4YXGA 3LCIA 1ALDA 1K3UA 1KM6A 3MP4A 3W1AA 4WY0A 2ZDRA 3NA8A 4N02A 1W5QA 3CQ0A 1YTEA 1H61A 4BFAA 1RQBA 2WJZA 1YTKA 3IVTA 3HPXA 1T96A 1I2QA 1I2RA 2A7RA 1MO0A 1SUXA 1EA0A 4BI6A 1FXPA 1RZMA 3LTYA 1AL8A 2CLHA 4WXYA 3WK3A 5DXYA 5E1QA 4S1FA 1R2SA 3PB2A 3QJAA 3HGJA 4MKNA 4RJEA 1YXCA 1OYAA 2BZNA 4LTSA 4WD0A 1F2JA 1DKWA 3M47A 2QAPA 4NNCA 2Q3OA 1A5CA 3TSMA 3GDRA 3ABRA 2ZQ0A 3B04A 1DQWA 2JBMA 1WBJA 1ZY9A 3EXRA 4LNYA 4ORMA 5D2VA 4R7JA 1H1YA 2DP3A 2GJNA 3LRKA 1RQEA 3TMLA 3P60A 1OFQA 3TC7A 4O28A 4QM1A 4A3UA 1Q3NA 3ABOA 5D05A 4UTHA 1Z41A 4GUGA 3FJLA 1ONRA 2X1TA 3TW6A 1B4KA 4GNJA 2A4AA 2B7NA 2Y85A 2HMCA 3S5ZA 1TJRA 2Y89A 1KA9F 2Y63A 5EL1A 1DQXA 3LOTA 4O19A 1KM3A 4WOQA 2Y7FA 5K9DA 1TTJA 1FCQA 3EKLA 3K30A 5DLCA 5EBUA 1X6UA 3W88A 1G4EA 4OU1A 4NT0A 1VCFA 3P80A 8TIMA 1KTNA 1JCYA 2BWGA 2JGQA 2ZZ4A 2B0MA 2H8XA 3QMSA 1JR1A 1OFRA 1XDLA 1FDJA 4KFNA 4E38A 3QPYA 4GFSA 3TK7A 4EVZA 3ZS4A 4KWVA 1SZNA 3IIVA 4XWUA 3OHIA 2FPTA 1JUEA 3B0PA 4JNMA 4GJ1A 5AHEA 4EF8A 2BTMA 4LT9A 1YXYA 1TPVA 3QW4B 1WYIA 3EWWA 3W7DA 1LM1A 1OFBA 3UQNA 3U6WA 1PCWA 3OA3A 2Y7EA 4LRTA 5AC8A 3P8JA 4QNEA 1KM0A 1JCJA 4O52A 1GTEA 1F6PA 1V5XA 3HB9A 3W9ZA 3GXPA 4JTHA 4JGDA 4DQWA 1OFAA 4A22A 4CQ9A 2E6FA 1MEHA 5EYWA 4NJGA 1DL3A 3S1VA 4WJEA 1MSSA 1AG1O 1V7YA 2C14A 4QNWA 4K8HA 2KZHA 1LORA 2RFGA 4IX0A 3FYPA 3SECA 3TQVA 2NXHA 4N4PA 1FDZA 2E5BA 4ZQMA 5F2MA 1W37A 2AGKA 3GDMA 1WXJA 1K7EA 3BW2A 1KFEA 1SU5A 4ADSA 4LS2A 3RK8A 3S1UA 4PC8A 1VYSX 5KZEA 1OHLA 3QYQA 2J27A 5G2IA 2QAFA 4S2BA 1VGAA 2VFIA 3P81A 4IGHA 1IIGA 2NWRA 1WDWA 3IV3A 3PWAA 4FIQA 1JUBA 3O8AA 4JIQA 1JCMP 3C2RA 3M5VA 2WNQA 4EWND 4WX2A 3STFA 3BW4A 4Z1BA 3LHWA 1Q6RA 1JULA 5D32A 2A2IA 2I14A 1GVFA 4FHAA
chains in the Genus database with same CATH superfamily
2CZFA 1ADDA 1K70A 4L1XA 3N4AA 3W27A 1F3WA 2ON3A 3VD7A 6PTDA 1E73M 4URIA 1R46A 2QVHA 1V6TA 6A3HA 1SFSA 3DYPA 1KFJA 2ISSA 2E9MA 1C8VA 4GIEA 1BWLA 2VGFA 1RLCL 3H7VA 4V1YA 4W5ZA 2NQZA 2W4XA 1JRCA 5HWNA 2VDGA 4MJ4A 3KHJA 3TROA 4EE9A 5AVHA 3AWNA 3OBAA 7CGTA 2QT3A 1KGXA 1V79A 2YYUA 2CZVA 3AIWA 1A49A 1J10A 3IANA 1W1VA 1VJZA 2YCLB 5DF0A 4QDMA 2YGYA 3L9CA 2CHRA 2NW0A 4UQBA 1HFBA 3WLJA 3P93A 2ODOA 1OFEA 4LAUA 3GU1A 3K5XA 3AHZA 3NEVA 3AFBA 3ZJ8A 5CZTA 5CSSA 3WQ5A 4GZ7A 5H8PA 4LU0A 1LZOA 4LVAA 5D33A 2E25A 3PJWA 1MXSA 1OJXA 3GTHA 2PDJA 4X60A 5D37A 4AAJA 1AL7A 3GHSA 4E8DA 4KEUA 1RY0A 4UTKA 2CZEA 4WQ6A 1KV8A 4YCOA 2VM8A 2D2GA 4PULA 4N6FA 3TA9A 1PKYA 2ZZ3A 1OABA 3C0QA 5I3KA 2ZRYA 1KQZA 2F6KA 3NQ7A 1QVBA 5HXMA 4O1DA 3PY2A 4GOAA 4JIHA 4UMCA 3LXAA 1E0WA 3PANA 1P1XA 4HQVA 2PWUA 4C7GA 2HISA 4QS6A 1EX5A 4CN1A 3WEOA 3CPRA 4HPJA 4OV4A 1R3RA 1CECA 3KVMA 2DZBA 2PDKA 3C2YA 1VFSA 4PMOA 1ME8A 3FHAA 4WVXA 4YYFA 4FI4A 2PZNA 3PJXA 3KE0A 1MUMA 4P7QA 4G8TA 4UFIA 2OSWA 3C8FA 1QRQA 3T81A 2YIHA 5I02A 3S9ZA 3O0FA 5D9NA 2VEFA 2RAGA 4GYFA 3WQGA 4F0LA 1Y7VA 1V3HA 3ZVHB 1M3UA 1S5NA 2X16A 1LRTA 4TVDA 3UZYA 3T08A 4D1JA 1B54A 1JDFA 3AJ7A 4EAMA 2XH7A 1RP8A 4HYRA 3W1UA 3QZEA 4GGBA 3LENA 1WUFA 3NZRA 2ADAA 3JR2A 1DHKA 1L8PA 5D8ZA 5H91A 5HWMA 3HN3A 1RA5A 1LWHA 3LCHA 4UQDA 4GNVA 2VZVA 6TIMA 1EF2A 4L61A 5SWUA 1Q2RA 4CNSA 1Z7AA 2H90A 1UKQA 5FJIA 4C6FA 3LRLA 4EIVA 3LCGA 3VOCA 1QU4A 1YMYA 1JDAA 3OGSA 1TWSA 1RHCA 1VBHA 4YTTA 4DYKA 1HP4A 4JTRA 2VEGA 4FXJA 1FWTA 4A4AA 1E9IA 3GH4A 4JTKA 2CLFA 1BWKA 1ZJIA 4H04A 4GABA 1MQPA 3RLVA 3VMOA 4YL2A 2G5WA 1SR9A 3ONCA 1X6LA 2ZZ6A 1OX4B 2UY2A 4JTUA 4HJWA 1P6WA 4WR3A 1SPQA 1V3LA 4YVXA 4UMAA 1EOKA 4WJ8A 1JGMA 1S1RA 5JXQA 3O7UA 4FR1A 1VJIA 4MB3A 3QM3A 1XFCA 3R8HA 1XCFA 3TA6A 4XAZA 4XQ6A 4AUBA 3E0IA 1UHVA 1AZ2A 1Z48A 3TJLA 1SZGA 1Q6LA 4J3VA 2Y70A 1BKHA 3H4XA 3LTSA 2IUZA 4AZ6A 1US0A 2J6VA 1GVEA 1Q63A 5JH2A 1HL9A 3FFSA 4IHCA 2OTDA 4XD3A 1GVRA 3R2GA 4QTGA 2BLEA 1JAKA 3IK2A 3QLLA 4HYVA 3MWAA 2VFHA 3TE9A 4JTQA 4N9EA 4AY1A 4HU8A 2E67A 4JYFA 3H4WA 1KRMA 4C6KA 4HSHA 1R7OA 1E6ZA 4Q32A 3BAYA 3MB9A 5K9CA 3TZNA 1TVNA 1IEVA 3LI0A 2I56A 1CT5A 3OIXA 3HF3A 3OLGA 4GUJA 5HULA 3GW3A 1O5XA 4G1KA 5BU6A 1Q5MA 4PUUA 1V6UA 5I23A 4E2DA 3W7KA 2GUYA 4LFYA 3KW3A 1QWGA 4MKSA 3ID7A 2PB1A 5DCDA 2E9LA 2V3EA 1YKWA 5I78A 4X9SA 3HGSA 3R25A 3SSJA 4HA3A 5GNZA 6ALDA 1YNQA 1XUUA 3I10A 4A8RA 1M6JA 3NPUA 1XLJA 1HNYA 3BANA 3WQFA 2GJPA 1N2VA 3UY8A 1DE5A 1UWRA 1Q7ZA 1HJQA 1TV5A 1TA3B 2F2HA 3U48A 4Q6XA 4LUTA 4OE7A 1TV2A 3BLKA 3S6TA 4OBSA 3O6DA 3TONA 4O54A 4DWDA 1PV8A 1AODA 3GR7A 1XIIA 2DEPA 3E74A 2JFEX 2ZXAA 4QAWA 5CG0A 3FS2A 3F4VA 3PF3A 3IJ6A 1XV8A 3VIHA 1WDRA 4OHQA 3V1PA 4RDWA 5HNTA 4JTJA 4YTSA 3CV2A 1GOXA 3VKAA 3W7RA 4ZMGA 2HNEA 4Q3MA 2WB5A 3ZWTA 4NKCA 5I07A 1EX1A 2X0YA 3VGFA 2QGYA 4INFA 2MANA 3PUOA 3NDZA 5FEWA 1W54A 1VKFA 3EA2A 4ATWA 1IGSA 4O1AA 5C70A 5I06A 4O1EA 4S3JA 1TE6A 2PDQA 2RJGA 4WK9A 1XLDA 1SO5A 2HTMA 3DX5A 4H3DA 2CZDA 2PC4A 3NIYA 1H7RA 2J75A 2J7DA 2WCSA 1P0KA 3E2RA 4KIEA 3QQ1A 5FOOA 2NUYA 2Z6JA 3KOWA 4S2CA 3PPGA 3GNRA 1EDGA 5DY2A 3ANVA 2PDCA 3LU2A 4M56A 4FNUA 4CCCA 2EG7A 3GVVA 4DI8A 4ZQOA 1TTIA 3O6CA 1H0GA 2WM1A 2G95A 1YNYA 1EPVA 1TV4A 3QSTA 4XD4A 1XP3A 4XKMA 1ZAJA 2ZADA 5CPNA 1DIKA 4HPXA 4D6IA 2V82A 3BDKA 5E70A 1DE6A 1A3WA 5J5DA 1EA9C 2WMKA 4RCXA 2HV5A 3ALGA 1ZCCA 3NGFA 2QPXA 3GFXA 4ENLA 1H4PA 1JUKA 1W6TA 3GH7A 4XAFA 1O5QA 1KKOA 2OGYA 5TBOA 3H23A 2VX4A 4MZ8A 4CD6A 5KSWA 3B40A 4PMRA 4F9JA 3GAYA 3D46A 1K4HA 3GKAA 3OVPA 4GQBA 2VGBA 2IKJA 1E0VA 4W87A 3TSDA 1GHSA 1A4LA 2CFFA 3UP8A 1YX1A 4AHQA 4UNLA 2ACSA 3N6JA 3NDYA 3KCOA 2JKEA 3W1TA 3IUHA 3FIGA 2G3NA 1BQGA 3SQSA 2PRMA 3QY8A 3WSUA 3EBVA 4BF7A 3U4FA 4G9PA 3GK0A 5F4SA 3VX1A 3VNIA 2QZRA 2HS8A 2IPJA 2V3GA 2NXIA 3Q58A 2RKXA 4JHZA 1UROA 3TW7A 1NAL1 2J47A 4ECLA 3EXTA 1W3KA 3M6YA 4NRRA 5HPCA 2DPEA 4JQ2A 4DNMA 1K77A 5HMEA 4RV3A 4HZ7A 3CB3A 3ITOA 3W2LA 2WAGA 1QPNA 1FHVA 4FX6M 3N19B 4UFMA 2OMAA 2C16A 5A2CA 2YFNA 1R0MA 1CX9A 3ZJKA 1HJSA 4Q22A 1LJYA 1DJXA 4K68A 3TAOA 2WNNA 4GQRA 2QJNA 3S5YA 2FFCA 3I6RA 3IIOA 2YLLA 4RR4A 4NJKA 1EP3A 4IGMA 3TNOA 3PK7A 4PB3A 3KS5A 3L5MA 4HHMA 3GC5A 3F5LA 3LI1A 1EC7A 1EJXC 5CSRA 4QJ3B 1UUOA 4HNTA 3PPHA 1XISA 3TYCA 4HN8A 4JKKA 4J35A 4MLJA 3THDA 5FESA 1TR9A 3B9OA 5LIUX 3GG0A 1D9EA 3VIJA 3QPZA 4HBKA 3GLCA 2H9AA 3H2OA 2J88A 1OZQA 3F7JA 4WUIA 3G0XA 3FYOA 1A0DA 2ZZ2A 3KOZA 3WMBA 1MXDA 1OC5A 1TQXA 3B8UA 1A5KC 1P6CA 1W5PA 1EJ7L 4X2PA 3MA8A 3MC5A 2OODA 4IIGA 3A5FA 4U28A 3VI2A 3G1XA 3NZPA 1T7LA 4BHYA 4PA8A 1A4MA 2YBVA 3GXFA 5K4XA 1R8LA 1H2JA 1UKOA 1XSKA 4PBGA 4Q7NA 4DJFA 2VEPA 3AU6A 1POKA 3MKVA 1Q7MA 3HTWA 2EPOA 3L68A 4YYCA 2X1UA 5HINA 3VIMA 1KR0A 3BG5A 3K1GA 1OGGA 1GWJA 2E6YA 3NTYA 3NQ6A 2QF8A 3T8LA 2A3EA 4Z1CA 4NUWA 4PMXA 5M03A 2F6XA 1E15A 2A3LA 3ITLA 4AEFA 3PZTA 1L8NA 4DBUA 3UZZA 3WF4A 4TUFA 3MO7A 3NPXA 3QMTA 1BRLB 4HNUA 1E71M 5I3DA 5GNYA 1TB3A 2A21A 5FACA 4JKLA 3RLGA 1IIHA 2QUUA 1NDVA 2GGGA 2VURA 3A4XA 2UWFA 3LGEA 1TX0A 2VVNA 3NYZA 4UCGA 1DYSA 4AYGA 3GTNA 2F2KA 4EXQA 4US5A 3ICJA 3AHTA 2OEJA 3QGKC 1GKQA 3V5OA 4HA4A 2FTWA 5MHBA 3B97A 3OEXA 1V6YA 1S46A 2CCRA 1UWAA 3RR4A 1EO7A 4ICNA 5AC4A 2XZ9A 4PRRA 5JBDA 3B9NA 4E4PA 5IHSA 3CMFA 3VKKA 1JPKA 2P76A 3N3TA 2BS9A 1ISZA 3H2FA 3POHA 3GC2A 1UCWA 4CD7A 5LXXA 1K8CA 1UR8A 1H60A 3UCDA 5JIPA 3TSBA 4GUFA 3ZR4A 4O53A 4PODA 1C7TA 1CGTA 7XIMA 1BG4A 6ENLA 2BXYA 4MUZA 4OUEA 4PCTA 3MMDA 1I0BA 3GY1A 2JF7A 3GXDA 1GTHA 2GVGA 5I79A 3T0TA 5BYWA 1O6IA 4J2PA 1GQIA 3PBUA 1PDYA 1VFLA 3TOPA 2WVSA 4Q4OA 3I7SA 4IICA 5DBTA 3AJXA 3P8IA 4RZ4A 1FWDC 1GK8A 1QPQA 1TIMA 1GT8A 4IFRA 4GIRA 1XWYA 4B4FA 1NM9A 2YDSA 5EFDA 3RPDA 5D2TA 1MUWA 1SSDA 1VBJA 3GB6A 1YDVA 1ZAHA 3DYMA 1V6XA 2ALDA 2YOCA 3NZQA 5LHFA 5CZ0A 3FKRA 1BSIA 4IXHA 3CZEA 4JPGA 4UFLA 1KGUA 3L0NA 2F38A 4GRSA 2PWGA 1CZ1A 2AL1A 4AZIA 2OT0A 1BPLB 1XKJA 1O68A 3AYSA 1H7NA 3OIHA 4QE1A 5AZ0A 4DHGA 2YCIX 4RUBA 1ZRQA 3MUAA 2V5LA 2CEQA 1IXQA 2EPLX 2VX7A 3H55A 2HE8A 1WA3A 1F4AA 1LQAA 2PP1A 2B31A 1VH7A 3VNLA 3UETA 4B5UA 3EWXA 3PG8A 3RLHA 1MW3A 3CNYA 4GZJA 3SIZA 3GSMA 4M82A 3PPCA 3SAZA 2P50A 3CTTA 3IRSA 1B3XA 4DYEA 4ZFMA 4E5TA 3MI6A 1NH6A 3FAWA 4GVFA 4IT1A 2O7SA 4HZ6A 4ZSUA 4PR4A 4UOZA 1CW2A 2OZ3A 2D24A 3AMDA 4LSBA 4TVUA 2OB3A 1RD5A 3W72A 2JIEA 5AZ1A 4A29A 1YPFA 2CLMA 1IR1A 5CGQA 2OWWA 3FKKA 2VT0A 4JFWA 4AD1A 4IQDA 4O13A 3LSBA 4GY1A 3RN6A 3PC0A 1B3WA 3FYYA 3LM3A 5DCEA 3GNNA 2Q8XA 3RU8X 3R12A 1A5NC 1I75A 1S2VA 4DXKA 1ZS2A 4KH2A 1JZ2A 5CLTA 1B90A 3I7QA 3LDVA 3HQ1A 3QW3A 4JN7A 4UUIA 4GY0A 4XZLX 2IKHA 2A1YA 1W8SA 2Z1BA 4PUMA 2REQA 2V30A 1KO0A 1GG0A 3CO8A 3LM7A 7ODCA 4H9XA 6XIMA 3HG4A 3FDGA 3W53A 2GWNA 2OX1A 4GYPC 2FQIA 6REQB 3ARTA 4QG6A 3AISA 5TD4A 2VWTA 1TO3A 5A8QA 1GKPA 4DZIA 1S2UA 2J8GA 4N7QA 3DFTA 1B3OA 1LBMA 3FA4A 4XKYB 2W91A 3NQBA 3UXIA 8A3HA 4K38A 2WZHA 4GXPA 3KP1A 1HKKA 4I6VA 2F6UA 2YW4A 4DBEA 3IS4A 3WLOA 2DV0A 1UD3A 4B4HA 3R5EA 5T9BG 3DFOA 1WZAA 3IJ8A 2GVEA 1DPMA 3UA3A 3GHRA 4DYJA 2FZDA 1T0OA 1HKWA 3ZSTA 3CWOX 5EMJA 2RDWA 4FOUA 1C9WA 1X7FA 3VNKA 3UGRA 2CNCA 4IGNA 1EIBA 1GG1A 3RPMA 3UBPC 4QSFA 2ZUSA 2QIWA 3MANA 2D23A 1KBLA 1PPIA 3V18A 1XSIA 3W24A 2O9TA 1GYLA 3F4DA 5A6JA 4FAMA 4JX6A 3S9YA 4PN2A 5E9AA 3UG4A 1TPFA 4DZAA 5A6BA 3DZ1A 4PGLA 3W3OA 3EKZA 3I65A 4E8CA 4W8AA 1JPIA 1NQKA 1HGYA 5REQA 1UZ1A 4S3KA 1E70M 3VM7A 4QXIA 3TN4A 3BLDA 4WOZA 5BMXA 3NGJA 4JR5A 1IEIA 3EAUA 4FLOA 4D1IA 4LY4A 1F9CA 2GSEA 2VZOA 3B8SA 4GGHA 4ZBCA 1J8VA 2V2DA 3E9AA 4C1NB 4HNNA 1TG7A 3O6YX 1H63A 1Z3NA 3Q4DA 4NXSA 2Z4GA 3CAKA 1VS1A 4UZSA 1AH3A 1UZHA 4AY7A 2J8TA 1UIOA 4HOWA 5A95A 4DO6A 4ZQCA 3SCVA 4WSJA 3ITVA 4WDWA 4KWOA 4TR9A 1J2BA 2GQ3A 1RCXB 1LLZA 4IG2B 2ZUWA 3XINA 4KESA 3ZOAA 3VUPA 1LL7A 3K4WA 3MKKA 1W91A 1VLWA 1AH4A 1JZ4A 2RUSA 1R3YA 1UJQA 3E5PA 1Z9AA 4JIRA 4WY0B 4YVPA 1K9EA 2UV8G 3QR1A 2Y61A 4AX6A 1W17A 3YPIA 3TKFA 7REQB 1I2NA 4PMQA 4R9XA 1ZL1A 3NL2A 1VRXA 5ABGA 1H49A 3A3XA 3D3AA 1X8FA 2G3JA 2W92A 4BZYA 3TOYA 2E77A 1EJWC 5D8WA 1FWNA 4W7VA 1RCQA 2W3ZA 1EL3A 3UXLA 3WENA 4L5ZA 5BMWA 3JU2A 4J9JA 1PSCA 2IXUA 1OCJA 3PSWA 3W1QA 4AZCA 1NJJA 2W62A 3WDPP 4ZSTA 3W7QA 5CEWA 1ZCOA 2DZSA 2RDTA 4H2HA 2WNWA 1W32A 1LLWA 1UR4A 4M6VA 5DANA 3CEUA 4JL2A 2PLJA 2QCNA 4JNYA 4JTFA 2BNJA 5BRPA 1XX1A 3NDOA 1O1ZA 2G3IA 1VLIA 4RPQA 3CL8A 5EMYA 2QUNA 2V5KA 3BG3A 1KB3A 3LA4A 3NXFA 2ANUA 1OK4A 3TP4A 5J04A 5JMUA 1D3HA 4K7YA 1TWZA 2DW6A 3VOGA 4F0SA 4BK9A 3O05A 1UWIA 1TVPA 4DELA 2PF8A 3VXGA 3LBMA 3WZ0E 4CGTA 1IQ8A 3QTGA 3W28A 2DVXA 3S2NA 4B5VA 1B2YA 1ZSXA 4D72A 1IZKA 2HRWA 3AIEA 3E12A 2VR5A 3TWBA 2V2HA 1JNDA 5T9CE 5M17A 3IAQA 1EJRC 1TMLA 2GPTA 3EX3A 3G0UA 2E8ZA 3WMLA 1IWBA 1KM4A 3LPFA 4CUCA 4NAFB 3AROA 3CIXA 3ITTA 3VOIA 3BCJA 1NWRA 3K1DA 4F2UA 1QI3A 1EQCA 3R0UA 2VZUA 4U5KA 5HQEA 4N2YA 5L9FA 3B03A 3QQWA 4UCFA 2QCFA 4TVCA 5TAOA 1VBRA 3LNMA 2PU0A 2ISFA 1Z32X 2JKPA 4MNJA 3FW6A 1CCWB 1XIHA 4U33A 1LRQA 4GVHA 3AXMA 3UCCA 3QZ6A 5BRBA 1QAPA 3RHGA 1CGYA 2Z24A 4D9PA 2CKRA 1E5NA 3MHUA 3W70A 1KNWA 2PDYA 4DJED 4C5ZA 1TZZA 4OOUA 1V3MA 1DWFM 2QV4A 2VX5A 1JPHA 4IIFA 1CEOA 2YPIA 4L9XA 3ANUA 4EWJA 1QI0A 3QY6A 4NY2A 3OVRA 2JKAA 3HIJA 4KWWA 2NVAA 5JIWA 3V75A 1PX8A 4HZMA 4F0MA 3T44A 4NYUA 1OSEA 2REQB 2QCEA 4MWAB 2V8ZA 2RH9A 5FJUA 1DXEA 2G37A 4QQUA 3QZAA 1H62A 3PZUA 3E2SA 4S3EA 4QIUA 3WK0A 1UR1A 4CLMA 4FLQA 1IXNA 1J18A 1EGMA 3VCCA 2WHLA 5LNUA 5CPQA 4ACZA 5LA1A 1FWBC 4PL1A 1KLYA 1U83A 2EQDA 1UD2A 2J9ZA 4WZHA 3VOFA 4HU0A 3DUGA 3E49A 3THCA 1YTDA 1DJQA 3UWZA 4ZO9A 4AYSA 1R2RA 4H9VA 5AOUA 2QJMA 1QR7A 4QISA 3XISA 4R7OA 4YNGA 3LCIA 1ALDA 3W1AA 4WY0A 3NA8A 1DJZA 5A2BA 1H61A 4Z2KA 1RQBA 4Q4MA 4BQ3A 4C6DA 1I2QA 1MO0A 1EA0A 4RE0A 1T8QA 3WH7A 1AL8A 5JUVA 3N15A 5E1QA 3QOKA 4S1FA 1IT7A 3PB2A 1RXOB 1UOZA 3M47A 1KRAC 1A5CA 3EA1A 3ABRA 5IFPA 3VD9A 2EPKX 2JBMA 4LNYA 4ORMA 5D2VA 2DP3A 4CD5A 3TYBA 4I90A 1UA7A 8CGTA 2DT0A 3TC7A 4O28A 2FVKA 3ABOA 3VD3A 2JE8A 1Z41A 2PCEA 3EOEA 3TW6A 1K1DA 4GNJA 2A4AA 2B7NA 4JKMA 2HMCA 5LXEA 4IPNB 2XJ7A 2Y89A 4US5D 1S5MA 5EL1A 1GVIA 2XZ7A 3T0DA 1X8CA 1FWHC 1PTAA 4GYPA 3K30A 1B30A 5DLCA 4PCSA 2Q09A 5EBUA 1IZJA 3J7HA 1G4EA 3P0XA 4OU1A 4C6MA 2PC8A 5MKGA 2JGQA 1M65A 4KWUA 3BOXA 2VR2A 4AIEA 4R7WA 4B3LA 3AQUA 1RALA 1XC6A 3ZS4A 3AOFA 1ZJAA 4JNMA 4XK2A 2EJAA 4ZOBA 4LT9A 2XVLA 5TF0A 3H21A 1LM1A 2DDXA 1Q6CA 1Y65A 1EKOA 3VILA 5I2UA 1JCJA 4EAYA 1GTEA 1F6PA 1V5XA 4QDWA 3W9ZA 3AI0A 2ZVIA 1DIOA 2VUYA 4PMUA 3H24A 1XYLA 5FJJA 5EYWA 4DJEC 3S1VA 4DUVA 1V7YA 1K9TA 3KWSA 4K2SA 3UG8A 1L6FA 2RFGA 4OECA 1W9VA 4H6EA 1TKKA 2NXHA 4N4PA 4RW3A 1W37A 5F2MA 4ACZB 4P8VA 2CWXA 3S1UA 2IW0A 2HBVA 4J3WA 4PC8A 4X0VA 2GDQA 2YL6A 4YWSA 1OHLA 4S2BA 1PZ0A 5FAGA 3NYDA 3P81A 2VFIA 3ZJ6A 2DIJA 2NWRA 4LXFA 3PWAA 2G41A 4FIQA 1JUBA 3UR8A 1JCMP 4CNUA 2VC7A 2HE5A 1E4NA 3STFA 2DVTA 1E0XA 4DJDD 1Q6RA 2J7HA 2A2IA 3E0LA 5A6TC 1DJWA 4FHAA 2OSXA 4L6DA 1M7JA 1DJIA 4HSOA 1V51A 4ADTA 3WO8A 2X7WA 1F3TA 1IT8A 4TV6A 1X98A 3G3MA 1TRIA 5CCZA 3QF0A 5IDZA 4AMAA 2PWHA 2GVJA 3F4NA 2DUXA 4AWUA 3ZT7A 4QCFA 3VKJA 2YJQA 1UUQA 3P84A 1QOQA 2Y8VA 2VC6A 1ISWA 5CPMA 4R33A 2VD9A 1PVNA 3VNZA 1WKEA 2ZCGA 4P8UA 3BWWA 1HO4A 4MOZA 2ZRZA 4UR9A 3OHMB 2CBJA 4NSBA 5BXTA 3SUVA 3EMQA 1TMHA 1PWMA 5XIAA 3L2LA 3TN6A 2ZVRA 1E56A 4UQ9A 4JOMA 3EDFA 1GVSA 1G4TA 3DHDA 1LUCA 3S6OA 4O1CA 1AJZA 4AVOA 1KFLA 4GI8A 3LXBA 3ZYZA 4L9YA 5HATA 5LNSA 4E8GA 1JCLA 3VDAA 3P5YA 4LUJA 2V0TA 3KM8A 5D30A 1PJ9A 2AQVA 1P0BA 4MZYA 2FB3A 5C6MA 2WWDA 1QNPA 3EYPA 3NG3A 1UR0A 1O94A 1B0IA 3N29A 5HR7A 5BXPA 2CBVA 2VGIA 1M5WA 4Q8PA 4FEZA 4H8VA 1PCKA 3QFWA 1ML1A 3IIXA 4MFDA 4G6CA 1SMDA 3B4YA 5REQB 4C6EA 2V3FA 9XIMA 3W7NA 2E7FA 2MUCA 3M0VA 1TPWA 1E4MM 2A79A 1X39A 1EXBA 4W5UA 3RGTA 1LBLA 4FF7A 3QBUA 3VAVA 1CGXA 2BHZA 3TVAA 3SRKA 3DECA 3VIKA 3HMCA 3LLFA 3T55A 3C0SA 4H41A 1L0PA 4Q4SA 5JBEA 2RJHA 3IPWA 1OX6A 3WL1A 1KBBA 4J3XA 4C6NA 3VDBA 3P61A 2NT1A 5BXRA 1M7XA 2IQDA 5A69A 1OFPA 4B5NA 1AQFA 5MF5A 5DO8A 1QATA 5FI8A 4RZBA 3KVJA 1CXKA 3KZPA 4B9ZA 4O0ZA 3DC8A 2D69A 3W23A 1NELA 2X8RA 5U7SA 2PDGA 5LHEA 2INEA 5HNUA 3G6LA 1ZPTA 4GWEA 2I17A 5I00A 1V0LA 1JPMA 3SY5A 4QSHA 4HA0A 3FX4A 2E1DA 1FWSA 4K3ZA 1V6WA 1EJUC 2H8ZA 3HGOA 3B0UX 5PTDA 1KD0A 3AYTA 3LPOA 5A8GA 4CQ8A 4JIPA 3ARYA 1XGDA 4HOZA 3VOHA 3NURA 1FH7A 2BGNE 4Q8WA 1RBOB 3M5YA 1M7PA 4AWSA 5T91A 5GPRA 3I68A 3SY8A 2ZUNA 2V81A 4B16A 2C7FA 4GX9A 4YN5A 3LG3A 4F0KA 5JQ9A 2EG6A 5CPLA 1B1YA 4KQNA 4RNHA 1U5JA 1VB9A 4RZ6A 5HMDA 4PTVA 3LPGA 4HTBA 3G3DA 4QCEA 3A12A 3CAVA 2B81A 1QBBA 1GQKA 2RGMA 3L4WA 5GVJA 1WNOA 3QC0A 2GSJA 3FAXA 3OG2A 5CBIA 5G4HC 1EP2A 3FGCB 3DFSA 3RNDA 2GUBA 2PSNA 3OOQA 3UU0A 2RDUA 3VZXA 1FWFC 1OCNA 5HNNA 2R82A 2FHBA 3TMQA 3WEMA 5BXSA 1XLGA 1GVQA 2BHYA 3ARRA 4N9CA 3PZ9A 2A7NA 3CQHA 3WQOA 2TRSA 3STCA 2XG9A 1Y5WA 3MS8A 3W1NA 4W8BA 4A8NA 1VENA 3CPUA 1TELA 4KGJA 3KRBA 5DMLA 4HOXA 3ABSA 4DZHA 4G5DA 5CBBA 1FA2A 4F48A 3KVLA 2ZE0A 1G9HA 3QRHA 4QDPA 1Y0EA 1UWQA 5AYYA 2EG8A 3WNNA 4BKNA 2UY5A 1JF6A 4Y7EA 3WNKA 3W82A 3OLIA 2FDMA 1KBIA 1UD4A 1V3IA 2XYLA 3VDCA 2NLIA 4ZA0A 1E6PA 1LG1A 1V0NA 1Z8AA 1GJPA 4FNQA 1YDNA 3NZGA 1DORA 5I09A 3WCZA 3P62A 4HKPA 5KZDA 4B5TA 5LNWA 2AGTA 4ADUA 4XVEA 1FWIC 1F7BA 3PZIA 1EO5A 3SFKA 1YE6A 3GM8A 5FF0A 3EPOA 2DSUA 1DXFA 4Q8VA 3U2OA 1XIDA 3QMRA 4BS0A 7TIMA 1LOQA 3LB0A 3PPFA 3URNA 3LQLA 2WVVA 4IMFA 3I3EA 3KAOA 2WZMA 3UEQA 1QNOA 2QDDA 1XLEA 1XIMA 1X7IA 4DLMA 4CNOA 3WNLA 4FPSA 1ZZMA 1TPB1 2VHLA 3CBWA 3EXSA 2PBGA 3BARA 4JN6A 4RZ5A 1Q8AA 1OGSA 4LB4A 2J74A 2QJIA 3VNMA 1H51A 4QX4A 2GSHA 4DB7A 4LS0A 2VRQA 5BCAA 3BE7A 3RX2A 2FMNA 5IXEA 3KP0A 3E02A 4JQ3A 1UZDA 1EFZA 3OZMA 1U30A 3TUUA 4J40A 4GPNA 3R8RA 3C8NA 4GCAA 4MYXA 5AC6A 2YB1A 2PDMA 4UMBA 8XIAA 2QV5A 2H3DA 1PTGA 4GUHA 1Q85A 3T0CA 2ATSA 3GZ3A 3BUVA 4GVGA 2RDXA 5FCZA 1RJQA 2OLSA 1Q6GA 4DEFA 3P3BA 3C2VA 3MZ2A 1TV8A 1TX2A 1VIZA 2JQXA 4UFHA 3HOJA 4PFMA 2I57A 3WQ4A 1S2AA 4K1WA 1TCMA 4M5PA 3KOFA 1V02E 3ARZA 4Q4KA 1SVDA 3TCEA 2OZ8A 3LXCA 3WK2A 1AJ2A 3MV01 4TO8A 2VCBA 1N8FA 4BEUA 1PE1A 4MB5A 4MIMA 1H41A 1YLVA 4PZVA 2CLEA 2DT3A 1HZYA 2X41A 3CXOA 4NXKA 3AIBA 3B8WA 2VTFA 3DFNA 4Q8OA 2NX3A 3RMEA 4A35A 4PMJA 2GGJA 3CUIA 2Z27A 2WMJA 1JVNA 3SCPA 3WLMA 4ZB5A 1EQPA 1SO4A 5HQMA 3L0GA 2I5QA 5G2HA 4DO5A 1MFUA 4LAOA 4UTJA 3VIIA 3KDNA 1W2PA 2WWCA 2VYOA 1TJ0A 3CQIA 4PSRA 1IT0A 1K8YA 4JYEA 1NP0A 4F79A 3U0HA 4N9BA 4IGSA 2XISA 3D3FA 4JD4A 4OT7A 3GVWA 4AD5A 1RK6A 3EWZA 3N3MA 3EA3A 1KFKA 2OEMA 3VGDA 5K9XA 2Z1XA 1UC4A 4GFIA 1XIJA 3VM5A 4YWIA 2BOGX 4FP1A 4HK6A 3GG1A 1PL9A 4K39A 2G96A 2PPGA 4NAEA 3PAOA 2VCCA 1EUAA 3EWBX 3L12A 1S3HA 2XGZA 2BMBA 2C19A 3OYXA 4HNCA 4RKAA 3RM4A 3C3UA 1NVMA 4HB7A 1HUVA 1A0EA 1UQYA 3WYZA 3V16A 9RUBA 3F1QA 3WLLA 3M0KA 4FNPA 4RK8A 3AC0A 4CEXC 4JDYA 3M41A 1BGAA 4AX7A 1OM0A 2C0HA 3UD6A 3NUKA 4MZ1A 1XYFA 3TYEA 3M43A 4HHHA 1RJPA 2IPWA 5CAKA 4RXGA 4A8LA 3OO2A 2G50A 1FHUA 3VMPA 2IKGA 2Z7GA 2VL4A 4ZQRA 4CEUC 5DBUA 3WKZA 1XIGA 4LVDA 1UA3A 5A3HA 3W71A 3R10A 3S1XA 1XI3A 1FY6A 3ITGA 3M64A 4UNIA 3QV8A 1IEQA 2BBFA 1TZ7A 1EEPA 3MUCA 3BG9A 3O2LA 4JYDA 3MDWA 3WDQA 5D9MA 4I7WA 5F2LA 3N14A 2HROA 4Y96A 1XGEA 4CQBA 3M0LA 1OB0A 2CXGA 5CGMA 3UCQA 1ENUA 2G97A 2DIEA 2VUNA 5AHFA 1S5TA 4C91A 4XBKA 2PE4A 1HJUA 5HDRA 2ZOXA 1O66A 7TAAA 4HMCA 4C6PA 3K2GA 3SCOA 1M03A 1XBVA 4D6GA 1TWWA 4D2JA 2ZFAA 3LERA 3IAPA 2DW7A 5E09A 1U33A 4NRSA 1N7KA 2QPSA 1OFOA 4EPDC 3FEMA 2YL5A 4QHRA 5LIYX 2ZYFA 2VOMA 5I7GA 4AD4A 3QKEA 3EWYA 1I8JA 5G4WA 1VPYA 1G5AA 4JTTA 4ERAA 4CQAA 2PA6A 1S5VA 1BYBA 4H7ZA 2EKGA 1P7TB 3BAWA 4QJ5B 4NZ1A 3ONBA 3BMVA 3OZOA 5C7HA 2FPVA 3W75A 5HANA 2J24A 1M04A 1Z44A 1EZWA 4DJDA 3CZGA 4XV0A 4BCEA 3DFQA 3RILA 1IYXA 3GVQA 3QVQA 3W7LA 3ABQA 1FFQA 3TW9A 4IJBA 3DHPA 1MEWA 4I8YA 5H8UA 3LHYA 4IP4A 1I1WA 2Z2UA 5LZLA 3SRDA 3GXMA 1OVDA 1UP2A 3P74A 2YCEA 1XJBA 3CYVA 3KZSA 1XDMA 1NF7A 4LYQA 3VKBA 3P5ZA 5C54A 4QLKA 4K8EA 3MZNA 3ANYA 4IIEA 2ZWZA 2XSAA 4B2DD 5EKYA 2HSAA 3FXGA 4Q33A 5D03A 1B3ZA 3TV8A 1JYNA 3GIYA 2V6AA 4EKJA 4QAIA 1P1MA 2Q01A 1ZJBA 4FF5A 3NSXA 2P0IA 3O16A 4WEVX 2OT1A 4WDUA 4P61A 3KL3A 2XH4A 3GWQA 5BNKA 1QW7A 4GD0A 4YHGA 4JTLA 3CT7A 4MYAA 5AYXA 3RCYA 3C3NA 4GJIA 3MPGA 2P88A 4Q4PA 2I5IA 2O56A 1Q13A 3LCWA 3TNBA 1NY1A 2IXVA 4KCUA 4GQ0A 4O18A 1H1NA 4ZB0A 2WSRA 1DVJA 3L0KA 2BV9A 2PTDA 4EACA 3UZWA 1E6RA 2EBNA 3RX4A 2WC4A 3BV7A 3NR0A 3WD3A 2INZA 4O1FA 3TYUA 3VIFA 3RXZA 1PEZA 1BVZA 3LLDA 1FWAC 5EMLA 4JCLA 1L6WA 1CGVA 1MW2A 4NP7A 1KM1A 4I5RA 3DDMA 1QBAA 3IVUA 4AW7A 2X2YA 4CN4A 1REQA 5FEPA 3LNPA 2DQXA 2Q71A 1V0MA 1WAWA 1ZU8A 4U31A 2BASA 2QGHA 1D7KA 3NPWA 4HNOA 3LEPA 3CWHA 2LLEA 2OKTA 1YPXA 4LB3A 3NQMA 4H6KA 3N2OA 4NZ5A 4J3TA 1L9WA 1I2PA 3G1VA 1K4GA 2VD8A 1BQCA 4R5EA 1ELSA 3L4XA 1GYMA 1TRDA 3C61A 3B0YA 5HR6A 3RCMA 3TAKA 1TJ1A 1J4EA 3UR2A 2QIIA 3VC5A 3N6QA 2E6AA 3ARPA 2GVYA 5CBJA 1LQ0A 1CIUA 3L66A 3P14A 4P5UA 2YW3A 3AUOA 5D02A 3GS6A 1P0NA 3B06A 3GG8A 1OX5A 1VF8A 3D6NA 4EPKA 3N73A 1IEXA 4EF9A 4D71A 1E4LA 1VCGA 1W9UA 1WOBA 3IJQA 4IP7A 1WZMA 3QQ0A 2J7GA 2OWXA 3S5SA 2ZZ5A 2WKJA 3E96A 3N2BA 2DY3A 1TSIA 2PURA 4C1LA 1WQ5A 3NCOA 3M7WA 3LPPA 4QQ3A 3ECQA 2GGEA 3FJ4A 3RJXA 2OR2A 4GKLA 1XLMA 3MSRA 2X30A 3GDKA 4MNMA 3TR9A 1U1UA 3UZXA 1SSGA 1YXDA 3KCLA 4I7VA 4YTUA 1W1A1 2TYSA 3OU8A 1NARA 1POJA 3AMGA 1E4IA 4HCLA 3CUFA 3G1HA 4WSHA 3URQA 3GNXA 2WSYA 4RNIA 2NUWA 3G1FA 4O1BA 2D0FA 3E1F1 2DZAA 3COTA 4HCDA 2ZDSA 3HG5A 4XZHA 4DI9A 3M6DA 2YKKA 1W9PA 5A94A 4I7UA 2XVKA 4AF0B 4FLSA 4H4IA 1HKJA 2PDLA 3ARQA 4IG2A 3BMWA 1ME7A 1E1EA 4FNRA 1NWUA 4Z1DA 4H00A 2F61A 4L9ZA 1SMAA 3LHUA 4H01A 4Y90A 5C2GA 2ALRA 1XXXA 2FZ9A 1VC4A 4DJEA 5L6UA 1K8XA 5F7UA 3CUXA 4WKAA 3LX9A 2P10A 1PHWA 2AL2B 3PTQA 2OWCA 1KRCC 4JQAA 4XKYA 4LRSA 2FMOA 2DH2A 2YZ5A 2QCMA 4PBEA 1H1ZA 1WX0A 2QCHA 2DZTA 4W93A 4UR8A 3LHZA 2WJEA 4LANA 1KV5A 2KAUC 5C0QA 3REQB 4ASTA 2EGZA 2C1HA 3UJFA 5KEZA 3SJ3A 3ZJ7A 3VCRA 1HJVA 3KBSA 4W88A 4QROA 1T8XA 3QHOA 5LSMA 2H3BA 3JS3A 3Q65A 4PCFA 4QITA 3G2GA 1UKTA 5TNVA 1MYRA 4Z17A 1RQHA 3U8GA 3W2NA 3OODA 2FJKA 4GHRA 4XZIA 4ALDA 4UBPC 4WKFA 3UNDA 3ITXA 5HMFA 4FXSA 1PYFA 1C92A 3ISIX 1F76A 5F2GA 3PM6A 2QULA 1E3XA 3CIWA 1SO6A 2R94A 4WY0F 4K6AA 3SURA 5CJMA 1G0CA 1JQVA 2GLKA 2PAJA 2QUTA 4GXMA 4AIOA 3N34A 3TXZA 1VAHA 2ZA2A 1DWGM 1XLHA 3T09A 3PULA 1DQUA 3KBWA 4AC7C 9CGTA 5FF4A 4C6QA 1XIFA 5E6ZA 4JTDA 3SZ8A 3BMXA 2ZA3A 4JIIX 1K9FA 1JYXA 4ZTXA 3USBA 4M8UA 1XLAA 1C3FA 4AVFA 4XVDA 4NX0A 4GI6A 1P6BA 2CLOA 1GZGA 2Y8UA 3HFTA 3LGDA 3GNPA 3CHFA 4YTQA 2AMXA 1ZTVA 1B5TA 1VFFA 3BLOA 1UYQA 5F4XA 1J0YA 1FWRA 3VD5A 4U2YA 3GTIA 4KF1A 3GW0A 4LF2A 5TIMA 1C7SA 2VJXA 1JDCA 4UOJA 4XZNX 5ABTA 3KRUA 1UD8A 3OGVA 3GXIA 2ZA1A 1BGGA 1ISVA 4JFTA 1EGZA 2C6QA 4GLEA 3WBEA 1T5AA 3AMCA 4E3VA 1AW5A 5BWFA 1C9DA 3PBWA 1Z69A 5C55A 2WMHA 3KUMA 4D6DA 1R9ZA 3FLUA 4QGCA 4FK9A 1S2TA 4W7UA 5BOEA 4GI9A 1M68A 3W76A 3SBFA 1HVXA 1XICA 2HZGA 2A3CA 2CHOA 2V5BA 1M53A 4AEEA 1A5LC 3DCPA 2X40A 1ZENA 3ALFA 1KTBA 4DAIA 4MWAE 1NWSA 3CUHA 4HHPA 3FDKA 4L4MA 4AG0A 4TOQA 3W81A 1W8GA 4BI7A 1A5MC 2QCCA 3GU2A 2W63A 3R94A 3INPA 1FHLA 5D2WA 4DAFA 3CASA 2BXVA 3KLKA 2WC7A 3P6LA 4WDXA 1JEZA 1PAMA 1XR2A 3TFCA 3BLEA 3WLPA 1EJTC 4AZBA 3O9NA 1I6NA 3RLUA 4A8IA 2PDHA 4G1NA 1CBGA 2VEIA 5K4ZA 4P7LA 3W22A 4JHMA 4RV8A 2C79A 4FNSA 1H7OA 1RLDA 4IF2A 3L2IA 1HKVA 2Y8KA 3W2KA 4Y8FA 1E9LA 2BB0A 3L7RA 3KXQA 4PH6A 4GINA 1YDOA 4ZZ9A 3MJMA 1R2TA 1PIFA 1Y5XA 4H8UA 3WD2A 3RM8A 4E6MA 1EYWA 1JXJA 2HS6A 2A85A 2DSZA 4GNKB 1OBAA 4GY7A 4XO7A 2QCDB 1DTUA 2G0WA 1NDZA 3IK4A 1GQLA 4XSMA 4AEOA 5LGXA 3WBAA 4IFKA 3A6OA 3SEPA 3KVKA 5LGZA 3FJNA 3G1SA 3NQEA 1ESWA 1I2OA 4EK7A 4ZQNA 2X7VA 1UWUA 2XWEA 3LCXA 4LV4A 4S23A 1XG4A 4MKVA 1ZBWA 4NJJA 4GCXA 4M6UA 1YE4A 2BSLA 1AK5A 1C91A 3S2MA 4GO8A 3BZJA 3APYA 4JTSA 1TPC1 3WJWA 3TIMA 4FIRA 2PTZA 1HQTA 1A80A 1NF0A 1CXEA 3FNDA 3BAKA 4KERA 4LAMA 1MRAA 1TWDA 3VZYA 3TWAA 1R9YA 4R27A 1U22A 1V7AA 3OVGA 4LBSA 1JZ8A 3N13A 4MJMA 3SQMA 2ZIDA 4L4LA 3P67A 3UZJA 4B5WA 3UYCA 3SCRA 4FS9A 5CQ1A 3VGGA 3B8DA 4S3DA 3RUBL 4LUSA 4AD2A 3PG9A 1ECQA 2O0TA 3S6DA 3CV1A 1OG0A 4A3YA 2V63A 3W7JA 3OTRA 1NP2A 3EPMA 3R6IA 4MNKA 2FJUB 2C71A 4HA1A 3ZXWA 4LWWA 3ELFA 1W1YA 2ZE3A 2R1LA 4QLLA 3LSCA 4GYKA 4JTIA 1DWIM 1G7UA 3EDKA 2E09A 4OKDA 2HDJA 1HX0A 4MY8A 3CTLA 5D4YA 1IZCA 1QXLA 1MW0A 1SW0A 4CVWA 3GDLA 3WD0A 1EOMA 4BWLC 2CLIA 1ZBKA 3DN5A 2WOQA 6TAAA 1G4SA 1HN1A 1ONWA 5DMNA 1SM9A 3W73A 2G4JA 2WPGA 3S47A 4TV5A 2JF6A 2XTKA 1Q8JA 3MJYA 1JDDA 3TYAA 1XYZA 2ZICA 2DSWA 3KX6A 1G69A 4LGXA 1EH9A 4CCEA 2A0NA 4S38A 4UB9A 4LYRA 5KITA 4TX6A 1S5WA 1R86A 5ABHA 4BA0A 1XLCA 3DU0A 2DZUA 3ERPA 1BXBA 3RG6A 4KMQA 1ADOA 3HO8A 5FF7A 2OYKA 4CNTA 4NZFA 3FV9A 3S8HA 1K3UA 3MP4A 2J7FA 4N02A 4JN8A 1YTEA 1YTKA 4R88A 1T96A 4S3FA 4BI6A 5GNXA 1ADSA 1FXPA 4MB4A 4PYSA 4NAFA 2CLHA 5CPTA 2G3FA 1R2SA 1GJUA 4D8AA 1YXCA 4AZGA 3W25A 2Y2WA 4NNCA 4PMDA 2OOFA 4G7EB 1QW8A 3WQEA 2FZMA 1EZ2A 1WBJA 2WQDA 3EXRA 4R7JA 3RIKA 1H1YA 1RQEA 4ACYA 3TMLA 4YIWA 3EWCA 3W6LA 4GUGA 2X1TA 1B4KA 2HXTA 2CETA 4U10A 3S5ZA 4P7NA 3IACA 1KA9F 2Y63A 3LOTA 1MQQA 1Y8BA 2FTYA 3S46A 1KM3A 2Y7FA 5K9DA 2V3DA 1TTJA 4DWSD 2DT1A 2EO7A 1XYCA 2W66A 3W88A 3AIUA 1PZ2A 3BZGA 3T4WA 3P80A 8TIMA 2ZZ4A 4KEVA 2P3ZA 1XIBA 1TIWA 1RPKA 1E6SM 4TX8A 5IDIA 3M4HA 3T07A 2ACQA 2XIIA 2OQLA 3TK7A 4F2BA 1SZNA 1V93A 3IIVA 4XSLA 4KPLA 1VEOA 4Q7BA 4GJ1A 3BSMA 5B80A 4MWAA 3AMLA 2BTMA 3QW4B 1TPVA 3EWWA 1NDYA 2PTXA 4DY1A 4QJ4B 1PCWA 1OD0A 3T0AA 2Y7EA 4LRTA 3P8JA 4QNEA 1WB0A 3CL6A 3UGVA 4AC1X 4H9TA 1E72M 3SIMA 4IJCA 2OYMA 5AC5A 1UD6A 1OFAA 1W1PA 1ECEA 4A05A 2E8YA 1MSSA 4QNWA 1NOFA 2QUMA 3DEQA 1HW6A 2KZHA 3IWPA 1JG9A 3W6MA 3DC0A 2Y4SA 5EGRA 4HJFA 3SN0A 4M81A 2E5BA 3SFWA 4HD5A 3QLDA 5G1MA 2AGKA 3GDMA 3CIVA 2JIWA 1SU5A 1N8IA 1VYSX 2AL2A 4OJYA 3P0WA 4QG8A 3QYQA 3RRXA 3KTSA 4S3CA 4HZ8A 4DUXA 2XUCA 4V1XA 1VGAA 5D9PA 5LIXX 1MNSA 3MSDA 4DX3A 1CXIA 3O8AA 3SCWA 3C2RA 3M5VA 1MXGA 3W02A 5B7ZA 2WNQA 3OGRA 3BW4A 4Z1BA 4XG1A 1RCOB 3LHWA 5D32A 4LEFA 1GVFA 1WPCA 2V68A 2BOEX 4HYWA 3SSZA 3ITCA 4O4WA 4A2SA 3PP7A 3G18A 4JAWA 4ERGA 2Z26A 1DEDA 2DZWA 4NNBA 4AH7A 2XGIA 2QNEA 3T0BA 4J2MA 3AWOA 1JJKA 1NQ6A 2RHGA 1XF0A 2I7GA 1W2VA 3MYPA 4ZE4A 4L6OA 1KQYA 2F7FA 3V7PA 3OPSA 3PUDA 3B8IA 3R58A 3TYDA 5DEZA 2GVLA 4NX5A 2NWSA 4MPQA 4P8XA 2NVCA 3CEPA 3UPBA 4LW7A 4JX5A 5D04C 4MM1A 4OQVA 2X0SA 3W7EA 5CC7A 4J3SA 3NEHA 4PMVA 3WQDA 1B3YA 4QS5A 1GEHA 4QR6A 5DRIA 3EDEA 2CKSA 4CN6A 4A21A 1YADA 2R1MA 1BFNA 1UUMA 4JXCA 4H2CA 4UR7A 1JAEA 2I9EA 2PWFA 3HJZA 3IVSA 1WAUA 4IJRA 4I9AA 3A47A 3HG2A 1R3VA 1XDJA 5I0DA 2QMKA 5JU6A 5EFFA 4IX2A 3C2FA 4BY3A 5ABEA 2Y5JA 4ZODA 4MF4A 4PTNA 2O9RA 4GE8A 3CZLA 2O9OA 4Q6JA 2PP3A 3UR7A 1VZWA 3W26A 4O8RA 2W61A 3TYZA 3AS0A 2HQAA 4W8LA 3VNDA 5M3WA 4DBSA 2J13A 3W7GA 1V0KA 2YLAA 4IMGA 3RYSA 4CNPA 4XUGA 2GL5A 2J79A 4TU1A 1OT2A 3VZZA 3U7VA 1AQMA 2J78A 3CV7A 3MWCA 1JD9A 3POCA 3WJYA 4M24A 4P7RA 1J6OA 1TV3A 4E4UA 3DI1A 2EHHA 2Q8ZA 2DGAA 2POZA 1GNXA 1H7WA 2WVTA 3WNMA 3DGBA 2WLZA 3OP2A 1PDZA 4AWTA 2D22A 1Q45A 5I3HA 3APTA 3DGRA 5BRQA 3LCFA 2ZC1A 3LRMA 4XAGA 4DWSC 5EU9A 3VE7A 3V4BA 3BLFA 3UERA 3CUZA 3W38A 3S9IA 1L6GA 3UPMA 2V2CA 2E3ZA 2PLMA 5D2XA 1ZHAA 4EPBC 3M46A 4OBRA 2GDUA 3LHVA 1SJDA 1OC7A 2PF0A 2CC0A 5H1WA 3Q2DA 1PKLA 1E3ZA 3F2CA 2OOGA 3EKGA 1P7TA 2ZX6A 3RITA 3WJXA 2YZRA 3W87A 4C90A 1WOAA 4AZ7A 1VR6A 4MAZA 2Z2BA 3DKJA 4U4MA 2WBKA 3HZ3A 3W01A 2B7PA 4B9YA 3LBCA 1OX4A 3VTRA 3P2VA 1XM3A 4KIRA 3FVDA 1JZ3A 3RU6A 4F66A 1QHZA 2QQ6A 3R0DA 1QI5A 1JYVA 1W9BM 3AS3A 2DIKA 2GK1B 3PBVA 3AHVA 1FDYA 3WH6A 4RPPA 2X1IA 4NIRA 1GUVA 3MCNA 3WG6A 1TCDA 2TPSA 3XIMA 1X6NA 1K02A 3UZ5A 1QNVA 4OFCA 3WH9A 1P43A 2C0AA 1HIZA 1R87A 5DN1A 4ZENA 4Q4QA 1CENA 1WCGA 3APGA 3DKLA 1RBAA 2IKIA 1XUZA 4WCJA 2XDFA 3NQFA 3N4EA 4GIYA 4UTUA 3GHUA 3G1DA 4LYPA 4LJ3A 3AIQA 3I3BA 4IISA 4JDBA 1E6QM 3EOLA 4KCTA 4MTVA 3EMZA 4NQ1A 3VGBA 1O4UA 3RRAA 4ILSA 5EMUA 4OTKA 3CJPA 3K8MA 2WV8A 3NL5A 3BPWA 3UWUA 4ZR8A 3HJEA 3VCNA 1ITQA 3GXNA 3URBA 2VWSA 1GW9A 4XZMX 4FZIA 3SB0A 1ZNNA 2X1RA 4BQ5A 1A5SA 4HSNA 4DZ5A 5AYIA 2GQ8A 4C60A 3I6EA 4FA3A 4LVGA 3MV11 3RAOA 1S2CA 1PO9A 4MNLA 1LRNA 3STEA 1C29A 5CKSA 3ZZ1A 4PCPA 4K8GA 2E5DA 1J2WA 1V4YA 3AYRA 4ICMA 5HNRA 4W85A 4JICA 2YFOA 3ABZA 1QNSA 2DZXA 4NAEB 1QI2A 4L4PA 3UJEA 1FH8A 4B3KA 2W79A 3QV9A 2XFYA 4J3UA 1QTWA 4JL1A 1BAGA 1UOKA 4NF7A 2PDNA 1EBGA 4GC3A 1FUYA 2WHKA 2NQ9A 3ARVA 1V6VA 2WJFA 5E6YA 4M7SA 3NOYA 1YW1A 4R34A 4HPHA 1G7VA 2AOSA 4RW5A 3ZWSA 4ML9A 4DXXA 3UFYA 3UWWA 3FGCA 1QCWA 3WJZA 5HJYA 2I9UA 1QW9A 5FJOA 2CPUA 2TSYA 1GPWA 2V38A 4NG3A 5C5YA 1JL8A 3M0XA 4P2VA 1WZKA 4YS1A 3SCSA 3HURA 4K7VA 1YQ2A 3NQ8A 4GZIA 3IARA 4PEKA 3M0YA 1KXVA 1S38A 3V36A 4B2DA 2V5DA 3VNJA 1UH2A 1LF1A 1CLKA 1J0JA 4ZEPA 3WY1A 1ICPA 5AFDA 1E55A 1UZ4A 3S42A 5CJNA 2OQHA 2JALA 1W3IA 1NWTA 2J9XA 1A5OC 1QPOA 1OG6A 3DOPA 4D6EA 1CXLA 2BVTA 4D6JA 4BF9A 4Y9NA 2R1NA 3ENLA 3PFRA 3V5CA 3NVTA 4XBJA 5EPDA 2PDWA 4MWAC 3TEVA 3IJDA 2X09A 2VC5A 4DPPA 4AIUA 5FIPA 2O7QA 4CQCA 3W4RA 2FH6A 1IR2A 2XGBA 3AZRA 5HMSA 3QOMA 4H7CA 1TE1A 4ZE5A 3CAWA 2C15A 4IPIA 1QMLA 2CIPA 4IL0A 3STGA 1QUMA 4IZGA 4KFPA 2O9PA 3DG6A 4RE2A 3VIPA 3USZA 1J79A 1THFD 3BJSA 3TTYA 3UVIA 4GK8A 3BH4A 2J66A 2YYTA 1JXKA 1MUCA 2AKMA 1KTCA 3TQPA 1NSJA 2XHYA 5C9ZA 4LC6A 4JCMA 1W1ZA 4Y9MA 2POTA 3CYJA 4ZXLA 2WBGA 1F74A 1IV8A 1UC5A 2DJLA 1BSLA 4LAZA 2WCGA 4O50A 3IUIA 3BV4A 4NZJA 1OY0A 4O11A 3LV6A 4LX4A 1C93A 2J7CA 4MLRA 2Q6ZA 1NDWA 3DI0A 1OYBA 1XBYA 6XIAA 4NI8A 4AQLA 1ITUA 2V9DA 4NJIA 3S1GA 3W2JA 2Y0FA 4JTGA 4UTTC 3A4WA 1TTQA 4H9ZA 4JY9A 4IMCA 3SGUA 4Y9AA 3EDDA 3GTFA 3C5QA 4KGLA 4NZCA 2WJDA 3BO9A 1D3GA 3LHTA 1DJYA 1DP0A 1LWIA 4J1OA 3GH5A 3KBJA 2WKLA 4CKQA 2NVDA 3U3HA 3A23A 3DG3A 5DFAA 2ZTKA 1KFCA 4NVTA 1GCYA 4AZCB 1GHRA 5DMYA 1E51A 1TA3A 3KDOA 2NQLA 3B3DA 2C1IA 1R3WA 2A3HA 2P5NA 2Z0IA 1K9DA 1UP0A 1P48A 1OCQA 3CT2A 3OLEA 1UKPA 1SW3A 4H9UA 3IV8A 3S0CA 1XW8A 3ARXA 2A3AA 1XCWA 3LTPA 3OA5A 3VD4A 3F2BA 3EGJA 1SJAA 3GG7A 1GORA 7REQA 2FHFA 3SW6A 2WMIB 2ZZ1A 3NAVA 4KS0A 4GO9A 3TCSA 3W1MA 1QO2A 2ESCA 1E0UA 3HBLA 1XQKA 3QYSA 4N42A 3U9IA 3MMTA 1FXQA 4CNNA 3AS2A 2V67A 4MVAA 3OZPA 2YA2A 1KCLA 7ENLA 4R53A 3WDJA 1K6WA 3PTDA 5K2ZA 2C8NA 2OEKA 1VPXA 3W85A 4O16A 2HJPA 2IQ0A 5CJ5A 1YIXA 1BWVA 3AALA 3GNDA 3I4KA 1AMYA 3QR0A 2XFWA 3EB2A 1OD8A 4S3BA 1DJGA 1BLIA 1XH1A 3VYLA 4J4KA 1LOSA 3G8RA 2BGSA 2GQ9A 3I7RA 1XQLA 3DXIA 4UQCA 1R30A 1XSJA 4M51A 3PBGA 3GYCA 1PWLA 2VFDA 3W7CA 3VABA 3HV9A 4K37A 1M01A 4GXWA 4C1KA 1EEXA 3G1AA 2HPIA 3WLKX 3WN6A 3K4AA 4C7DA 4YU1A 1TTPA 2PDFA 4DWSB 3UY7A 2GDVA 4JZ5A 4XAYA 1E1CB 4NZ3A 3BK0A 2XFRA 3W7PA 5A1AA 1MQRA 1UR3M 3A4JA 4NNAA 1EJVC 3CZJA 4KRZA 5FL0A 4JNZA 3H7UA 2ZXQA 1IE7C 3FK4A 1UASA 2VCAA 2GYIA 3GVRA 2QPUA 4TIMA 4KCWA 4NYYA 2JEQA 1HXJA 2ZUVA 3NSMA 3PWIA 1HKMA 3URAA 3KFTA 3C6CA 1L6YA 3OW1A 3M0MA 1FP8A 3WNOA 2E40A 3PZGA 1VIWA 4Z0JA 4H9YA 2FDSA 4MB1A 3PZQA 4KKXA 1JQXA 2ONEA 4L4OA 3G1RA 3TFXA 2QYGA 4L1GA 4CCDA 3N9SA 3N2XA 4LUTB 5XINA 2ISVA 3EX1A 3UG3A 1E5JA 2ZUTA 2QMJA 2AAMA 4IIDA 3W2UA 3MUXA 1UD5A 4PTXA 3H12A 4UTWA 2GJXA 2CWNA