3QEZA

Crystal structure of the mutant t159v,v182a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
b'MDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSVRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
molecule tags Lyase/lyase inhibitor
source organism Methanothermobacter thermautotrophicus str. delta h
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
total genus 83
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qezA00
1KLZA 4JS3A 1TV7A 3EB2A 1OYAA 1I8JA 3GDLA 3W1AA 3S5ZA 4CNOA 3LGEA 3IRDA 3KVJA 3IIPA 4NZJA 5HNRA 1X1OA 3W7LA 1AW1A 1WBJA 5E0KA 2QCCA 1W5PA 3FEMA 5CPOA 2YXGA 4FNQA 3G1AA 1QPRA 2NXIA 1M6JA 4JNMA 3W7PA 3W7OA 4LOCA 4UFKA 4UFJA 4UFLA 4FNUA 1SU5A 1J4EA 2DP3A 5DCEA 1I4NA 4LS1A 3ABSA 4LY8A 2CZDA 3TW7A 1LDCA 4JN6A 4LU0A 3QQ1A 3PUDA 2CZFA 2HTMA 3PB2A 1NSJA 1BTMA 4MFEA 3W7MA 2QCGA 2ZRYA 2J9ZA 2VFHA 4K7VA 3M5XA 5IBXC 1FDZA 3LXCA 1IF2A 1OK4A 3GAYA 5F4SA 2QUUA 5D04C 1VPXA 3T40A 1QPOA 1KW1A 3G1HA 4R33A 4DO6A 2E6DA 2ZZ3A 5HULA 1FXQA 1OFRA 3M5YA 5CSSA 4N9EA 4UR8A 1VCVA 1JULA 3P74A 1OK6A 1Q45A 3EWZA 5DBTA 5D05A 4PL1A 3S5YA 2NUWA 1OX4A 3HPSA 4DELA 4EF9A 1TPEA 4Q33A 7TIMA 4CNNA 1JCMP 1ZAJA 2R8WA 4AAJA 4DO4A 3FA5A 3W76A 3C61A 1TPUA 1XXXA 4L4LA 1QOPA 3W7NA 3W75A 4UTMA 3ATZA 4Q4KA 3EX1A 1YADA 2AQWA 4O1DA 4JXCA 3DGRA 4I7VA 2RKXA 4JX6A 3CU2A 3GNNA 1RVGA 5BMXA 3PB0A 5CZTA 5TQLA 3MBFA 2G95A 3IVSA 1WBHA 3HGSA 4OU1A 1NAL1 3O63A 2V82A 4CCDA 1G7VA 4C1KA 1PS9A 1S3HA 5LSMA 2X1RA 3WJWA 3TNOA 3LV5A 1IXQA 3OVPA 1EIXA 1UASA 3L66A 3A22A 3P67A 5K7JA 4BFAA 3UQNA 3UWVA 1GTEA 3QM3A 2ZBTA 5AHNA 1A5CA 4UFIA 2Y7EA 3NQ8A 2A6NA 1YXDA 3W2KA 1DQXA 1H61A 2ATSA 4ZQCA 3DH7A 2OZ0A 2YX0A 3W74A 1ICPA 3TJLA 3P82A 3UXDA 2NXGA 2I14A 1QNVA 2ZDRA 3W85A 5LHFA 1C8VA 1W8SA 3RU6A 1KTCA 1OX6A 4I9AA 3T55A 1QWGA 2C16A 1VHNA 4CQ8A 1CW2A 3AJXA 3S6DA 2GQ9A 2B4GA 3P80A 5T26A 5KTLA 5F2MA 4PEKA 2A2IA 1VC4A 2GVJA 3NR0A 1O4UA 1SZFA 1PV8A 3SSJA 3PF3A 3TUUA 3G3MA 3WJSA 3NPWA 4AF0A 3A23A 3TJXA 2JKAA 2DZTA 1WDWA 1NVMA 2VENA 2EHHA 2A4AA 2YFNA 2Y88A 3NQ7A 2C13A 2Y61A 3F03K 1B57A 1TYGA 4YCPA 4MVAA 5G1YA 2EKCA 4ZQMA 1C9DA 1ICQA 2WPBA 5F2LA 4JR5A 2J24A 3C2RA 1AW2A 4MY1A 1F2JA 1RV8A 3BG5A 1GYLA 1WV2A 5FESA 4UFHA 4FIQA 1JCNA 1SR9A 4EWND 5MHBA 5LHEA 1TV5A 2DZWA 4Z1AA 3EEGA 1F73A 5LNUA 4N9CA 1XI3A 3M6YA 1JRBA 1HFBA 2NWRA 4LV9A 4WQ6A 4QM1A 1EWEA 3DFOA 5G2HA 2C0AA 3UWUA 1L6SA 4OV4A 4LTSA 2FLIA 3P7YA 1TPWA 3UWYA 1DOSA 4NXSA 5BOOA 2CWNA 4Z1DA 2FIQA 2VEMA 1UJPA 4TO8A 4FX7A 5HWNA 1H7NA 5IBXA 2VFIA 3THAA 2DZSA 5LNWA 3TC6A 2TRSA 1FQ0A 3QQ0A 3MJYA 3NQGA 4IOTA 4QITA 3N34A 2FPYA 1F74A 4IPJA 4FIRA 2A7PA 1KV5A 2G97A 4BR1A 1GPWA 3LHTA 1WOAA 1OYCA 1AL8A 4NNAA 5FI8A 3HJZA 4IMCA 3S9YA 3PBYA 3BW3A 4NJHA 3T44A 2PRLA 1YXCA 3NQ6A 5BMWA 3R8RA 2JGQA 3OA3A 3TMQA 4DXVA 4MYAA 4PL2A 2OT0A 3KXQA 5LGZA 3QRHA 4M7TA 3TFCA 2ZRVA 4O18A 3LCIA 5BNKA 3WK2A 3LI0A 2QEZA 1UUMA 4LVAA 3R5EA 3UD6A 1R46A 1XL9A 3LHWA 3M43A 3BLFA 3P81A 4LS2A 4MLJA 3UWZA 2E5BA 3BG3A 4O54A 3TDFA 3STCA 1M7PA 1S5VA 4E2DA 1Q6LA 4NQ1A 1D3HA 4NNBA 3W1NA 5DY3A 1KTNA 1XBYA 4K36A 4I7WA 4O11A 3S1VA 2FTPA 1IXPA 3IGXA 4HT3A 3W72A 2DZPA 1IIHA 2LLEA 4K37A 4A21A 2OMAA 2V2HA 2WNZA 2B7OA 3O07A 2HS6A 3IVUA 1V7YA 2E5DA 3WK1A 4FNTA 3SJ3A 2F84A 2DORA 1PHWA 1PCWA 1RQEA 4I7UA 1OABA 4JICA 1FWNA 4ALDA 1XDMA 3CC1A 4AMAA 5DCDA 2ABAA 4O12A 4CQ9A 2A6LA 4N9DA 4GE8A 3EWYA 2NX9A 1GVOA 4LV4A 1OFDA 1FCQA 1O5XA 5AC7A 3M5ZA 5KMYA 3W2MA 1F7BA 1VJIA 3USBA 3W7CA 3NQ2A 3DKJA 5I3FA 1UBSA 3C8FA 1H60A 4NXKA 1NEYA 4RKAA 3THQA 3M7WA 1EP1A 1KM0A 5A5WA 4ZMGA 1OFQA 2FJKA 4PFMA 3B05A 2V2DA 4N9BA 5LGXA 4IWWA 5CKSA 1XUZA 1F6PA 3HIJA 4RZ6A 1KV8A 1SO6A 4IXXA 2P10A 3O16A 1X6UA 3P8IA 3NQMA 1I2NA 5HUPA 3U8GA 4LVFA 1DBTA 1W56A 2W6RA 4R7JA 1JUEA 3CWOX 3LX9A 3E49A 1TMHA 3W88A 3LHZA 1PL9A 4N2YA 1YDVA 3TQVA 3LERA 4JGDA 4WXZA 1K7EA 4UFMA 2XN2A 3OHIA 4LRTA 3PUEA 4Z0JA 2XN0A 5D09A 4MKNA 3EXRA 3B4UA 3N73A 3QSRA 3NZRA 1FCUA 2H8ZA 1PHQA 4JTSA 3TA6A 2CLMA 1T96A 3GZ3A 3GXPA 3WJZA 1QAPA 1LOQA 4JIQA 2WJZA 4O13A 4NU7A 1L6WA 3LV6A 1Z42A 3NO5A 3RF9A 3TXVA 2QCDA 4K8EA 3B0PA 3HGRA 3L0NA 1K8XA 3W7JA 4NJIA 3W7QA 3PBWA 1SZEA 2A7NA 4DF0A 1VH7A 4HPJA 1Q6OA 1W1ZA 4N6EA 1LM1A 2E6FA 1TREA 3GR8A 1XCFA 3HOJA 3W7EA 3NQDA 1TJRA 3DFPA 4ADUA 2ZZ7A 1FUYA 4OV9A 5BW6A 3I7QA 3GR7A 4NZFA 3W83A 5KSWA 1VGAA 4RV8A 3L21A 1BWLA 3TW6A 4DF2A 3KFTA 5AFDA 2YYTA 4XKYB 4FNPA 2NXHA 1TQJA 1H7XA 2QCDB 1EPXA 1XBXA 1YTEA 4JDBA 4YL2A 4IQLA 3P5YA 1OX5A 3C2FA 4JTHA 1G4TA 1SW3A 1EX5A 4LVBA 1EB3A 4UXDA 5EKYA 3QSTA 3QMRA 1D9EA 1ZFJA 4IMEA 4GFSA 2Z2UA 2HMCA 3LTPA 4W9TA 2XN1A 5G5IA 3UY7A 3L2IA 2ZCGA 3W22A 4O52A 4O4VA 3IIOA 2Y62A 2CLLA 3Q37A 5F2IA 5K9XA 3OVRA 2QCLA 3UWQA 4FXSA 1QFEA 3EWXA 3G24A 4JTUA 1YLVA 4ORIA 1ME8A 4UIOA 3B04A 5K4ZA 4ONVA 1KM5A 3LBMA 2AGKA 3PG8A 3OG3A 4YWIA 2V30A 2QUTA 4JX5A 4AWUA 5HINA 3BLEA 1Y0EA 3UXAA 1GWJA 4H4IA 4RX0A 4K7YA 3IIZA 2AAMA 1T0OA 1SPQA 1YTDA 2I1OA 5DBUA 3NAVA 1O95A 3W1RA 1VYSX 4GXMA 4A29A 3MYOA 4GBUA 3LDVA 4KWVA 4IX2A 3FYOA 5LNSA 4NNCA 1YDOA 2J27A 2PC4A 3DFQA 2QAFA 2Y7FA 1GG0A 1EP3A 2WSRA 3SI9A 3HG5A 1SO3A 1YPFA 2VFEA 2J6XA 2BTMA 3EWBX 3NPXA 3HMJG 3N19B 4HHPA 3BW2A 5IM51 4Y90A 3G22A 1P5BA 1TTIA 5D37A 2W0UA 3U2OA 4HPXA 3O05A 4JTLA 4JX4A 2X1SA 4UTJA 2C6QA 1ZAHA 1FWTA 4M6VA 1HL2A 3W2NA 1QOQA 4L4MA 3MO7A 2C1HA 4TIMA 1PVNA 3YPIA 5AC6A 2B7QA 3GK0A 5D03A 5D30A 1TPH1 2WSQA 3NDOA 4IMDA 4XZ9A 5C2XA 3O6CA 1B4KA 1QPNA 4TMBA 4ORMA 4X2RA 3GDKA 4XBSA 3QW3A 1DVJA 4JD4A 5EYWA 1OFOA 1VCGA 3C2EA 1F76A 3P84A 3LTYA 4UTTC 3RK8A 2E6YA 5LZLA 3EKZA 1T8XA 1Q6QA 5FEXA 1GT8A 3P60A 3HF3A 3IV3A 4HNTA 4O16A 3Q58A 4FNSA 3TAOA 2CW6A 3MUXA 1OYBA 4UMAA 5D2XA 3DI1A 1KA9F 2CZ5A 4JTKA 5HWMA 3OVQA 3G1YA 3PBUA 4K8HA 5D2WA 4WY0B 4KFPA 1K7FA 4MZYA 1KFBA 1X1ZA 1W3NA 1KTBA 1KM4A 1K7XA 4D2JA 1S5TA 4TU1A 2WOQA 3HQ1A 5F1VA 1FX6A 2ZTKA 3B06A 1TV8A 1ZJIA 4LS0A 3W2JA 3OBKA 2C3ZA 1JQVA 4IMGA 3PS7A 3A5FA 4DF1A 4ADTA 1W5OA 4WY0F 1F5ZA 3E96A 4M19A 2Q8LA 3LM7A 5D2VA 2X2GA 3NVTA 3MBDA 4UTTA 2BLEA 4X9SA 4LWWA 5AC8A 3W87A 4Z1CA 4BF9A 1LBMA 3M0ZA 3F4NA 2EPHA 2QJHA 2TPSA 4AB4A 4WD0A 4JDYA 2VXNA 1TJPA 3G1SA 4RXFA 1ZENA 2Q3OA 1MSSA 4DPQA 4QQ3A 4FEZA 3VE7A 4QIUA 1TPDA 2JGYA 1JQXA 2WQPA 4IX0A 3TK7A 2ZA1A 1BWKA 1WYIA 4GNJA 5CZJA 3W9ZA 4CQAA 3NZ1A 4R53A 2Z6IA 1B4EA 1OX4B 4OT7A 3LCWA 3NL3A 1ZNNA 4YLWA 1TB3A 3TC7A 4ZQRA 1SQ7A 3BG9A 3U6WA 4UMBA 3DFSA 4K39A 3FJLA 4RJEA 5CZSA 1G69A 3W73A 1GYNA 2BSLA 3I7RA 1AW5A 3MWAA 5DCBA 3G1VA 1TPVA 1JUBA 3ANYA 1LLZA 3DI0A 1KM3A 3TSMA 1B9BA 4NX0A 2FPTA 3NOEA 4E0CA 1TPC1 5D2YA 1H7OA 1W31A 2A1YA 4MJZA 3NQVA 4MJMA 3EX2A 3RLVA 3QYQA 4AHOA 1EUAA 1H62A 5L9FA 2WKJA 4C1LA 2Y7DA 4IUOA 1UB3A 2QDGA 3B0VC 2ZA2A 1N7KA 2YR1A 2KZHA 2FFCA 1OJXA 4O0ZA 5A8GA 3W1PA 1W54A 3MMTA 3LHUA 5E93A 1XC4A 5AYXA 1VZWA 3NNTA 4O53A 3W07A 2Q3RA 2VEPA 1SZNA 5C5YA 3EWWA 1ZY9A 4O50A 1U83A 1QDSA 1ZALA 1MXSA 3DHFA 4OQVA 5EPDA 3L5AA 3TQ0A 3Q94A 2Y7GA 5TBOA 3OIXA 3G3DA 3PVFA 3CPRA 1DJNA 5I3JA 1H7RA 4RK8A 5HMSA 4KWWA 3O1NA 1J5TA 1TQXA 2XFWA 4UC5A 2ZZ6A 4CLMA 4DO5A 3W7RA 3MYPA 4M6PA 1A5SA 3BV4A 1E51A 5H2ZA 1LRNA 2E68A 4O4WA 3NEVA 5I3GA 4BWLC 4S2CA 2YCEA 3G1FA 1ML1A 2PE4A 3SFKA 1QO5A 1KFJA 4MFDA 1THFD 2Z6JA 1NF0A 1RD5A 4AF0B 4LVDA 5AYZA 2E1DA 3DXIA 3LCHA 2EGZA 3P61A 2H3DA 3FKRA 5DLCA 3V75A 4S1FA 3MI2A 4UUIA 5H91A 3G18A 2R94A 1RQBA 3MHUA 1SSGA 2QDHA 3QPZA 3SIZA 5D02A 1VYRA 3DAQA 1KFKA 3HPXA 3DHDA 4OHQA 2ZFAA 5TIMA 2VFFA 2VKZG 4ADSA 1A5BA 1R30A 3VNDA 2TSYA 2PCQA 1GVQA 1G6CA 1X8FA 3QMTA 3FJ6A 1P0KA 1MZHA 4KFNA 3C2OA 1P0NA 5CSRA 3G1XA 1ALDA 3O06A 4OBTA 3LI1A 2ABBA 1ME9A 3FOKA 5BRBA 3EWUA 2BWGA 3OEXA 5DN1A 2PRHA 5KITA 3S8HA 3KHJA 4J9JA 3SR7A 3WK0A 3ABOA 1LORA 2VEKA 3ATYA 1LLWA 3PY2A 4K6AA 2QAPA 3E02A 3VCRA 1RQHA 1KM1A 3NQAA 5EY5A 1IGSA 4WOQA 1TTPA 4O8RA 3RLUA 1V5XA 6ALDA 1AG1O 3LCXA 5I3KA 3HGOA 1RZMA 4TMCA 3QJAA 4LC6A 4N4PA 4P61A 4XUGA 2A0NA 2YW4A 1SW0A 3NPUA 3TX9A 2V81A 4JYFA 1WX0A 1LTDA 4Z1BA 2VC6A 4UCGA 3SGUA 2ZZ2A 1UCWA 1GG1A 3FFSA 3R2GA 3G1DA 3M5VA 1XM3A 3QZEA 2DU2A 3ABRA 3AO0A 4Z08A 4KKXA 5G4WA 5DXYA 2R14A 4AH7A 4ML9A 1L9WA 3TV8A 1AK5A 2R91A 3BVJA 4RZ5A 1VR6A 3LLFA 1S5WA 1K8ZA 2FB2A 2H3BA 3WK3A 2RDUA 4WJEA 5CPNA 3ZR4A 1KFCA 1OG0A 3UZ5A 2GQAA 4NJJA 5SWUA 3PG9A 4JIPA 2H6RA 3N9RA 1K02A 3L0KA 3IIVA 5CG7A 4R34A 2PRMA 3SECA 1KM2A 1EUNA 5G4EA 1SZGA 2Y89A 2CFFA 4QISA 2ZRXA 4PH6A 4GUGA 5F1UA 2ZA3A 3LHVA 3UZJA 4NUWA 2YZRA 4FNRA 4LRSA 4ICNA 1LOSA 5K3VA 2ZZ4A 3LXAA 3MI3A 1Z44A 1F05A 4DEFA 3GDMA 3MI6A 3QC3A 4PC8A 1ME7A 3W70A 1J2WA 1FWWA 5DY2A 3HG2A 1UUOA 4A2RA 1TRDA 3GDTA 2A5HA 2YYUA 1I45A 1VLWA 3F4WA 5J5RA 3SY5A 1IXNA 3W1LA 3N3MA 2CU0A 1H1ZA 4UTWC 3GNDA 3CHVA 2OT1A 4WZHA 3STEA 5KZEA 3W1QA 3W7KA 2E09A 1YDNA 4EVZA 4MPQA 3GB6A 3GXNA 3TROA 2YW3A 3KAOA 1I2PA 5D33A 3P8JA 1PIIA 1YXYA 1EWDA 3MHGA 4NJKA 3TR2A 4HN4A 3D0CA 3TAKA 5FF4A 2GVGA 3L5MA 1OF8A 4UR7A 2NUXA 2CLIA 2YPIA 4EOUA 2EF9A 3C2VA 4GWEA 1ONRA 3EX4A 5GVJA 3R13A 3CT7A 1JR1A 1O94A 3ZFHA 4O57A 2X1TA 1SUXA 3DKLA 3N2XA 4LUJA 2W79A 1W5NA 3VI2A 4Y9AA 4MIMA 3SGZA 4ZQOA 5L6UA 3L5LA 3KOFA 1M5WA 1G4SA 3KRZA 4MLRA 4GUJA 1DHPA 3STGA 3G8RA 4UTLA 3H55A 1U5JA 1WXJA 4RZ4A 2ZQ0A 3N9SA 5J5DA 4HKPA 3GKAA 2C19A 5CGQA 3UY8A 2ZYFA 3CLMA 1LP6A 3NA8A 4WY0A 1HO1A 5LNRA 5I3IA 2Y6ZA 4MZ8A 2QCNA 3HG3A 2V5LA 5DXXA 3E0IA 1LRQA 1H50A 3WJXA 4QNEA 1XFBA 2ISVA 3IGSA 1JCLA 3EXSA 5EMUA 1TO3A 5C55A 1EEPA 4JY9A 1L6YA 4BI5A 2E6AA 4NT0A 3VE9A 5EL1A 3ZWSA 2NLIA 3HO8A 5AHFA 3M1ZA 2VOMA 2QR6A 1H7PA 3W7GA 2EAWA 3TQKA 2NX3A 3DZ1A 5AYYA 2QCEA 4HIBA 1RPXA 1MO0A 3TIMA 3P62A 1KFLA 1FDYA 3I68A 1FXPA 2ISSA 3JS3A 3B8DA 3QMSA 4JEQA 3C56A 3CIXA 3PBVA 1OFPA 3LBCA 4K38A 3BARA 1W37A 1AMKA 3RNDA 1F6KA 1SSDA 1XBZA 3GXTA 4AVFA 5LKYA 3W84A 1OFBA 2WNQA 1TPB1 3S1WA 1GTHA 2PURA 4O19A 1H7WA 3NL5A 3G8EA 4UTIA 4OWGA 3PULA 3TH6A 4PODA 2QCHA 5EA9A 1TIMA 3GLCA 1JCXA 1ZAIA 3I65A 1Q6RA 4DBEA 3NQEA 3TXZA 1R2SA 4ZZ9A 3DFNA 3M44A 3A5VA 3I7SA 1GVRA 4AHPA 5G2WA 2JKPA 1DKWA 3W23A 3IGUA 4UTKA 1TSIA 4PTNA 3PM6A 5HR7A 1LOLA 4GC4A 3TKFA 3FKKA 2E77A 2GOUA 1H5YA 2A85A 1LCOA 3S1XA 4NX5A 3M41A 4NVTA 2CZEA 4LW7A 5FEWA 2JK2A 3QH2A 3STFA 4XTDA 2TMDA 3GIYA 2CLEA 4X22A 2ZRUA 3BW4A 5CPLA 5KZMA 3GKFA 1I2RA 3O6YX 5D32A 3C3NA 5D38A 2YGYA 3R89A 3S1UA 3KX6A 2BZNA 3BPWA 1JJKA 2QCMA 4DBDA 5F2GA 4JYEA 2A7RA 4XTIA 4OGZA 3W1XA 2OX1A 5FEZA 1FDJA 1PCKA 4A2SA 3EX6A 3W2LA 1OVDA 4EF8A 5HJLA 2H8XA 2VEIA 3GAKA 1SO4A 3MP5A 1G7UA 2F7FA 4FX6M 1TRIA 2WSYA 1I2QA 3IIXA 1KBJA 4Y96A 4FF7A 4U4MA 3TCEA 2G96A 5K9CA 3GYEA 2V5BA 2ZZ5A 3NL6A 3INPA 4HSOA 4Y8FA 1C29A 3JR2A 2Y63A 1W3IA 3A9IA 3CEUA 4M6QA 3M47A 3K30A 4RCXA 3DFTA 3E9AA 2FQIA 1WOBA 3NQFA 3T4CA 1W5QA 3V1PA 3RMJA 2H90A 3O8AA 3LLDA 2GVLA 1N8FA 5ABTA 1DORA 4X3ZA 1QPQA 1QCWA 1A53A 1Z48A 3NQCA 4E38A 1M7OA 2RHGA 3G0SA 4OE7A 1SO5A 3W6YA 4O1BA 1VHCA 4Z0SA 2VFGA 3ZS4A 4O28A 4XWUA 5AHLA 3R12A 1A50A 3T7VA 4ZL1A 3WFAA 3B03A 4LVGA 1IXOA 4JTEA 3CEPA 1H63A 1L2UA 4JY8A 4E2BA 2YDAA 4RR4A 1LROA 5U7SA 4B5NA 3W71A 2NV1A 1GJPA 1XBVA 4MY9A 3KRUA 4AXKA 1FWRA 1ADOA 4HNNA 3PWAA 1GEQA 1DV7A 1HUVA 5KZDA 3KRSA 3W1TA 3BGJA 3FLUA 3LXBA 4CNPA 3UWWA 4ZQNA 1LBFA 1JCJA 2V8ZA 3CB8A 3KVLA 3NXFA 4JTIA 5U4NA 4RXGA 3DBPA 3QFEA 1G4EA 3C6CA 1G67A 2J88A 5HWJA 1P4CA 3MHFA 1YYAA 3LCFA 1HO4A 2P0OA 5CZ0A 4AEOA 2ZRWA 1VYPX 4O0KA 1HTIA 1T99A 2B7NA 2ZRZA 4FX8A 3NL2A 4AWSA 3JRKA 2CLKA 4IJBA 2VELA 2B0MA 2WNNA 5C54A 3MP3A 4UNKA 1ICSA 2VFDA 1TTJA 3UPBA 3HPZA 4JYDA 3W86A 3KVMA 2ALDA 5FF7A 3BO9A 5AOUA 3SZ8A 4DPPA 1FBAA 2TYSA 3VFLA 5AB3A 4GUFA 1JUKA 2I9EA 1A5AA 1KFEA 4S2BA 4IPIA 1LZOA 2J9YA 2X16A 4XBKA 3LB0A 1BEUA 8TIMA 2E5CA 1SW7A 3CM4A 3CWNA 3C4UA 1QO2A 4CCCA 4QSHA 1FCVA 3W1UA 3CQ0A 4FXRA 4LUIA 3Q2DA 4MOZA 1DQWA 3LCLA 4TX9A 2CLOA 1TPFA 1JCYA 3QW4B 4LC8A 2WV8A 4U28A 5AHEA 3C52A 3M9YA 3NGJA 5AHIA 2C15A 1KM6A 4P2VA 4O15A 2V2CA 1FY6A 3L65A 4ZVJA 3M16A 4MYXA 1TCDA 2J9XA 5HR6A 2Z1BA 3DENA 4POCA 4UTHA 4UTWA 3ZWTA 4JTGA 3TSDA 4ZQPA 2JKEA 1YTKA 4JTTA 5F4WA 4LNYA 4MZ1A 4JTJA 1SFLA 1GOXA 1K03A 1I2OA 3ABQA 3S0CA 1NFBA 2DZVA 2O7QA 3FS2A 3FYPA 3S5OA 2QUVA 4IMFA 3GX9A 3NM3A 4PA8A 4O14A 1LYXA 2YSWA 4GUHA 3UYCA 4YXGA 1H1YA 3LRLA 4BWLA 2X30A 3KVKA 3FIGA 1KBIA 4XQ6A 3MW7A 3RFAA 3IVTA 1FWSA 5D2TA 2GQ8A 1MEIA 2GUUA 2D73A 2DJLA 4N6FA 2Y85A 4A22A 4BI6A 3T78A 1N55A 3B0UX 4IXHA 1WAUA 3EKLA 3A24A 2V0TA 1H51A 2RDWA 3L67A 2C18A 4O17A 3HGJA 3PSVA 1W3TA 3DU0A 1B3OA 2BXVA 4WXYA 3LHYA 3HG4A 1EA0A 4AWTA 4XKYA 2CLFA 2JBMA 1DL3A 3G0XA 6TIMA 1XDLA 2FDSA 5AN7A 3W7DA 2Z0IA 3W3OA 1LRTA 1K3UA 3W7HA 1VQTA 1VCFA 3TFXA 2HSAA 2ZTJA 4WUIA 3EX3A 4N4QA 3H53A 4Q32A 2NV2A 5C6MA 2QKFA 5CPMA 2ISWA 1YPIA 4BK9A 5FF3A 1JVNA 3S42A 3PR2A 2Q8ZA 4QNWA 4FB7A 4GRSA 4YCOA 3G0UA 3TMLA 1VRDA 1OFEA 3HBLA 3QF0A 4GUIA 2GJNA 3H54A 4MY8A 3BGGA 4BI7A 3SW6A 1GQNA 1RR2A 1ZCOA 1R47A 1GVFA 1Q3NA 3EXTA 4QAIA 4CCEA 3UNDA 4HNUA 2FB3A 5F4XA 1GZGA 2B7PA 3W7IA 5K2ZA 2WO5A 3S5NA 3TSBA 3BLIA 1P1XA 5FEPA 2HS8A 3VKJA 3E12A 3O6DA 3PAJA 5FF0A 3PC0A 1CX9A 1G4PA 1BKSA 3N14A 5G1TA 1JRCA 1W5MA 1QR7A 4O10A 1PE1A 1DJQA 3CTLA 2QCFA 3TU9A 3LOTA 1TTQA 4N02A 3I6RA 1LBLA 1XUUA 2G5WA 4O1AA 2OJPA 3QPYA 4QJ1A 1OFAA 1MEHA 2OCZA 1GVSA 4KFOA 3LCGA 3WJYA 3W1MA 1CI1A 2UV8G 4WOZA 4UTUA 2RH9A 3NYZA 3BK0A 3GVGA 3CIWA 3C0JA 1NF7A 1ZHAA 2X1UA 5AHMA 1OF6A 4MUZA 2IQTA 3HB9A 3PSWA 3LTSA 4YMZA 4IGHA 3F1QA 4UNLA 1QMLA 4LT9A 5DELA 3O15A 4JTFA 4NJGA 3NPVA 5LNVA 4WX2A 1VS1A 3L0GA 3ELFA 2A21A 2QF7A 2C14A 1VLIA 3NM1A 2GPTA 3IEBA 2NUYA 4EIVA 1O60A 2DJXA 3MP4A 4FHAA 3TE9A 1OHLA 3L9CA 4O1CA 1WQ5A 2NX1A 5HQEA 5KINA 5HUOA 2YFOA 4HSNA 4TR9A 2BX7A 3N2MA 4AHQA 1FCBA 4HNVA 3LRKA 4UMCA 2V9DA 1R2RA 1R2TA 1Z41A 2DZXA 3LRMA 4Y6GA 5E1QA 2GJLA 4GJ1A 5EBUA 1W0MA 2ZZ1A 4FO4A 2QJIA 2ATMA 2RDTA 2QJGA 4H6KA 4PCFA 3QEZA 2DZUA 4M5PA 2O7SA 2CLHA 3NG3A 1XKYA 5FF2A 2Y70A 3W2UA 5G2IA 1O5KA 2NZLA 5K4XA 3GDRA 1D3GA 1AL7A 4H3DA 3PUOA 2RFGA 3P5ZA 2P1FA 4M7SA 1HG3A 1WA3A 1KLYA 1X7FA 4RLIA 4G1KA 1MEWA 2FPVA 1IIGA 4DQWA 3A21A 3UPWA 1SFJA 3L68A 1K8YA 5K9DA 1EP2A 5I3HA 4A3UA 2NWSA
chains in the Genus database with same CATH superfamily
2JEQA 4M1BA 3EB2A 1OYAA 1Q4WA 2D69A 4AX6A 3IRDA 3QYSA 1RBOB 4GYPA 2E7FA 2GGEA 3OLIA 1R85A 1WBJA 5E0KA 3TLLA 1W5PA 3WLRA 3KP0A 1TVPA 4FNQA 4JNMA 4BKNA 5A8OA 2ZOXA 2FVLA 2GZXA 1E9YB 4GACA 2HROA 4LOCA 3IJIA 3W37A 1GOIA 4S3JA 3QFWA 4K8GA 1TVLA 1PBGA 3TNBA 3OPSA 4ACZA 3M0KA 2IXVA 3H2AA 4LNCA 2QCGA 2VFHA 5C8BB 4K7VA 3M5XA 1IF2A 1OK4A 2I57A 3CL8A 3H7UA 1EX1A 5D04C 1VPXA 1QPOA 2A3HA 3N13A 2P8CA 3MB9A 3NSXA 1OFRA 9XIAA 2XIJA 1ISVA 4GG9A 1VCVA 3P74A 1DTNA 4CQCA 1FVPA 2V5CA 4IIEA 3WQDA 6XIMA 4KWUA 4KRTA 7A3HA 4NIRA 7TIMA 1HZYA 2CERA 1Q6CA 2XVPA 4OOUA 4AAJA 4DO4A 3FA5A 3W76A 2GWGA 1TPUA 4KBXA 4G7EA 4DJDD 5C7VA 2R1PA 1YADA 3CBWA 2W91A 3LLXA 1BHGA 3CV7A 2XH0A 1W1IE 1AH4A 4BF7A 4B5VA 3IACA 1IHIA 5CZTA 4LYRA 4OBRA 4IISA 1HX0A 3IVSA 5TAOA 2VQTA 1NAL1 3VO0A 4CCDA 3RCYA 1E1CB 4FALA 3AMLA 4HQVA 2F2HA 3TYBA 1RH9A 5DMNA 4HZ6A 3VTRA 1IXQA 4EE9A 1EIXA 3OVPA 3A22A 4FA3A 4DJFC 2YDRA 3VD7A 3VXGA 3N2TA 4UFIA 2FHBA 3EZ4A 2Z00A 4W7VA 3NQ8A 5JXQA 3W2KA 1Q6FA 1YXDA 1DJHA 4A8IA 3B3DA 2OZ0A 4DYJA 3W74A 3K8KA 1VEPA 4XZWA 1HJQA 4ZOBA 3UR8A 2ZDRA 1C8VA 1VBHA 3T55A 3CB3A 1A5LC 1MMFA 1AJ2A 3AJXA 2EG7A 3B9NA 5MF5A 2B4GA 4GIAA 1XIMA 4H8HA 4LUTA 3N29A 2VC7A 4R88A 5F2MA 3NR0A 1P0BA 3SQLA 3MUAA 4UOJA 2OEKA 3PF3A 4JQAA 2X7WA 3TUUA 3CO4A 2I5GA 4L4PA 2VL4A 1FHDA 4EPKA 3A23A 2DZTA 2IPWA 2I56A 3V16A 2A4AA 4C6OA 1B57A 2QT3A 4CGTA 1TYGA 3E74A 3TCSA 3GO2A 1NFPA 2WSPA 3VKKA 3H23A 1FRBA 2Y4SA 4ZODA 4MY1A 1RV8A 1R9YA 1GYLA 2VDGA 5I0DA 2GSHA 3VOHA 1O68A 5FJJA 2JQXA 3OBAA 1WDSA 1F73A 5LNUA 1XI3A 2C7FA 4H19A 3IUIA 4JFVA 4TOQA 4QM1A 1EWEA 3DFOA 1FWAC 2J13A 4M81A 3PTQA 1L6SA 1DWAM 2OWXA 4OV4A 4LTSA 3P7YA 3KWSA 3CK5A 3UWYA 4HU0A 7CGTA 3LGDA 2DSWA 1DXEA 4TO8A 1A49A 5HWNA 2CEQA 1V7AA 1H7NA 2GGGA 5IBXA 2VFIA 2DZSA 3VIKA 2PP0A 1XW8A 4Z2IA 3PTDA 5A1AA 4IOTA 1UIPA 4PMUA 2X09A 1F74A 5FAJA 4FIRA 2A7PA 3LHTA 1WOAA 1OYCA 5FI8A 4HU3A 4E8CA 2EPOA 1ELSA 7ODCA 3S9YA 5ABFA 3AFBA 3WLIA 1HJVA 3BW3A 2UY5A 2PRLA 5BMWA 1XH1A 2JGQA 5AC5A 1FOBA 1IEWA 1PXGA 3TMQA 4DXVA 3NZQA 3C8NA 3QRHA 4M7TA 3TFCA 2ZRVA 5ABGA 3LI0A 1XYZA 4Y2WA 3WQPA 1XYMA 3VIMA 1JL8A 3UD6A 4H41A 4LS2A 3UWZA 2VD9A 1S2UA 3GFYA 3STCA 1Q2RA 4M8UA 3W1NA 5DRIA 3RHGA 3KCOA 4LEFA 3AHYA 3AALA 1Q65A 1XBYA 4K36A 4O11A 5I78A 3BL3A 3ENLA 4V1YA 2OKOA 3AI0A 3K8MA 1IIHA 3SY1A 4X63A 2OMAA 2V2HA 1Q66A 1V7YA 2WMHA 4G9PA 3L2LA 1QW7A 4CNUA 1PHWA 1RQEA 3DYOA 4FP1A 1GZ1A 3ARXA 4JOMA 2O9PA 2O56A 4GX9A 4JICA 3WH5A 2VZUA 2XJ7A 4PBGA 4GQGA 3U4AA 1TR9A 3H70A 2A6LA 4F0LA 4N9DA 4GE8A 3E0LA 4AZIA 3EWYA 1GVOA 4LV4A 1FCQA 3A12A 5ABEA 1F7BA 1G01A 2WYSA 1H60A 1N8IA 3ZT7A 2OG9A 3ZLFA 3WL0A 1KM0A 3VDCA 2W9MA 5D9MA 2G8ZA 3B05A 1F6PA 3CS2A 4RZ6A 1K9TA 1UQYA 4W8AA 2Y8UA 1HL8A 2OO6A 1XD1A 4RUBA 5HUPA 3L4ZA 2EKGA 1W56A 2HEJA 4R7JA 3E49A 1OZMA 3LYEA 3TTEA 3LHZA 1UWRA 1JAKA 2W27A 1HJUA 4N2YA 3LERA 3PZTA 4JGDA 4F0RA 1TZZA 4XZIA 1K7EA 3DEQA 3QPEA 4IL2A 3PUEA 4Q4SA 2FZNA 3EXRA 3N73A 4AZ7A 2ACRA 3NZRA 2H8ZA 4JTSA 3TA6A 3PPCA 3IAQA 3STPA 1QAPA 2XZ7A 3GTNA 2WJZA 1Z42A 3RF9A 3TXVA 2QCDA 4QDWA 5H8MA 3PTMA 3W7JA 2C71A 3PBWA 2A7NA 4DF0A 3EAUA 4IGSA 1Q6OA 4GI6A 1OWQA 1TJRA 1XINA 3DFPA 2ANUA 4LAOA 2ZZ7A 5BW6A 4YTUA 3N12A 3MSGA 3CZGA 4US6A 5HDRA 4XD5A 1A3HA 3RMEA 3EOEA 5AFDA 2YYTA 4D9PA 5DFAA 5IHSA 4JQ4A 4D8AA 1XSJA 3CAQA 1RALA 1H7XA 1WDDA 4YL2A 1ZJHA 3C2FA 4AISA 2XVGA 1EX5A 3UA3A 1MXDA 3PPFA 4F9DA 2HV5A 3GHTA 3ICJA 4TXEA 1ZFJA 4R7WA 2Z2UA 3ZR5A 4L64A 3DX5A 1OM0A 2BGQA 4H9TA 4Q8WA 3UY7A 5A8QA 3H4WA 4O4VA 4HZMA 3RG6A 2CLLA 3DYMA 3VOFA 1M04A 1JDCA 1MRAA 5K9XA 3OVRA 2QCLA 1JPHA 1QFEA 3WH9A 4JTUA 1YLVA 4ORIA 5K4ZA 4YTTA 2RAGA 2Z26A 2EJAA 3PZGA 2V30A 2XVNA 5BCAA 1IR2A 3WBEA 3BLPX 3CAKA 4RE0A 1GWJA 4RX0A 2P0IA 5ECVA 1SPQA 5ABHA 4NASA 2I1OA 3C0LA 3WQ5A 1V3MA 1Q63A 4D6DA 5CJNA 3VIOA 1R8LA 1XLFA 3LDVA 4FF5A 4MMWA 3FSUA 5M3WA 5LNSA 2WJDA 1YDOA 1TX2A 3DFQA 2Y7FA 4QCEA 3RRAA 1Z9AA 1EP3A 2E9MA 2B31A 3SI9A 4E8GA 3CHCA 1RCQA 2J6XA 1US0A 3N19B 4HB7A 3BW2A 5D4YA 5FCZA 4ZENA 4QEEA 3DIPA 1S2WA 2X0YA 1OD0A 1D7KA 4HPXA 1CNVA 4JTLA 2QDEA 5FSDC 4M6VA 4ZTYA 1EGVA 2BXYA 1T41A 3ITLA 3YPIA 4L65A 3UF9A 5D30A 1KGUA 3KS5A 4ORMA 4NSBA 3KL0A 1DVJA 1UPMB 4DO7A 2GJRA 2ACQA 1VCGA 1HVQA 3C2EA 3RK8A 2E6YA 3ZLHA 1Q7MA 3RU8X 1XGEA 3I4KA 3WQWA 3NJ3A 1IR1A 3VUSA 1Q6QA 4YWSA 4HNTA 4O16A 3TAOA 1PKLA 3GG1A 2CW6A 3KL3A 1OYBA 4Y9MA 2CZ5A 1SJDA 2W3ZA 1IWPA 3SO7A 4H2CA 3OVQA 2ZADA 4GC3A 3KM8A 1BXBA 1K7FA 2QJJA 3H8AA 4H83A 1X1ZA 4Y9OA 3V36A 2NT1A 1DP0A 4ZSUA 1K9EA 3CXOA 4F79A 4PMJA 4O8AA 3BAJA 3BMXA 3ITTA 4ASTA 3ECQA 1ITXA 1QT1A 3AISA 1C8QA 1F5ZA 6TAAA 4GOAA 4XKMA 3LM7A 3PJWA 3MBDA 4G7FA 1S2VA 2BLEA 4X9SA 1BVZA 1ZBWA 4Z1CA 5CLTA 4B15A 1R3YA 1ECQA 1DYSA 4YTQA 3H4GA 4NKCA 4PUMA 3DESA 2D0FA 5I23A 3QR1A 4GMEA 2WQPA 4IX0A 1BWKA 4CQAA 2WMJA 1B4EA 1DIOA 1NP2A 1OX4B 4D72A 3F5LA 3NL3A 2TAAA 3TC7A 4ZQRA 3B8UA 5CPQA 1P7TA 3NWRA 1F4HA 4BCEA 4GINA 3WLLA 4PRWA 3I7RA 3UXKA 2ZVRA 3GBDA 3AXMA 4QXIA 3ANYA 2A79A 5D2YA 3ZOAA 2DY3A 3NQVA 3GVVA 1EDGA 4L7ZA 4MJMA 3EX2A 3QYQA 3U5UA 3WD0A 4AHOA 2NVDA 2QDGA 3B0VC 2ZA2A 2Q09A 2YR1A 2FFCA 2J78A 3W53A 5E93A 3LQGA 3U2EA 3OO2A 1YNPA 2QIIA 4O53A 4S39A 3VINA 2Q3RA 3WEMA 2VEPA 5C5YA 1Q7QA 2HZGA 2OOFA 1E0UA 5EPDA 3L5AA 4ZFMA 1X6LA 5FJTA 4IFKA 3OTRA 2Y7GA 5TBOA 3OIXA 1P6CA 3PVFA 1DJNA 3F2CA 3AJ7A 1XRSA 5IRPA 3TW9A 2YLLA 1J5TA 3MSRA 2RGMA 2ZZ6A 4CLMA 2WK2A 4RNIA 1E51A 4LUSA 2WLZA 2CBVA 4WHBA 3T09A 3AWOA 3NEVA 1ITUA 5I3GA 2V68A 1JAEA 4L56A 1VBJA 1QO5A 1THFD 3AU6A 4AMCA 2E1DA 3P61A 1ITQA 5DLCA 2VR5A 4S1FA 5H91A 4EP8C 1RQBA 1NOUA 3QPZA 3TLQA 4L80A 5D02A 2QV4A 4AYGA 3QTPA 1T40A 2ZFAA 1HL9A 2VGBA 5CEWA 2VKZG 1VBGA 3LM3A 1UR0A 4IPLA 1HT6A 2PCQA 2EBNA 1O5QA 4E8DA 3AUOA 3FJ6A 1K9FA 5FA5A 2NLYA 5M1TA 1PJ9A 4AD4A 1BYCA 2QW5A 3T8LA 3LI1A 3V5FA 3EWUA 2BWGA 2DT1A 1HN1A 4GCAA 2PRHA 3S8HA 5A6JA 4J9JA 1WZLA 3ZT6A 2VEKA 1UHVA 3IRSA 4LJ3A 5A8PA 1K6AA 2I17A 2FFIA 1KM1A 4H8UA 4JN8A 4HZ8A 4JCLA 1TTPA 2V69A 4C1NA 2PDJA 3AMGA 5I3KA 1XG3A 3U0HA 1GKPA 2VVNA 3QJAA 3WQ6A 2Z1KA 1UKTA 1UKSA 2ASHA 3NPUA 1AQFA 1V77A 2V81A 3TX9A 4JYFA 4L6OA 1SFTA 3QOKA 3M07A 3N18A 3LGGA 3R2GA 3FXGA 4HVXA 3QZEA 3SQMA 3WUEA 5A6MA 3B8SA 3AO0A 4KCWA 3GTXA 1UYQA 2R91A 4HPHA 4RZ5A 4DYKA 5HQLA 1VR6A 1S5WA 4K2SA 2H3BA 5CPNA 1KFCA 3GSMA 3PG9A 1HNYA 3WLQA 4XO7A 1DHKA 1K02A 4L1WA 1XYLA 2VI0A 1FWEC 5CG7A 1XDJA 2DSZA 4R34A 3VU2A 1KM2A 4HA4A 1EZ2A 4MWAD 3TA9A 1CB2A 3IUHA 2CFFA 4PH6A 5F1UA 4KETA 3UZJA 4FNRA 1E4LA 3VKDA 2H9AB 2Z1VA 4RNFA 3GW0A 2WVVB 1ME7A 1FWWA 1P6WA 4EACA 5GPRA 1KGWA 3LBOA 5EBAA 1UH2A 1EXPA 3OQEA 4E4FA 3SCWA 5CC3A 1PSCA 3ITCA 5KZEA 3W7KA 1J96A 3WDHA 4N0RA 1JFHA 4IL0A 1K77A 3GXNA 3VOJA 1PIIA 2ZVIA 3ARPA 3TAKA 3L5MA 4RPQA 4QSFA 1BG9A 2YPIA 2C1GA 4Q8TA 3C2VA 1ONRA 3R13A 3CT7A 3LZ5A 4Z2JA 3V0UA 2PDKA 5CBBA 2X1TA 4LUJA 3T42A 3JZEA 2W79A 1QI4A 1W5NA 1Y65A 1V3LA 3KOFA 1WXJA 3U5YA 3N9SA 5J5DA 1X96A 5BXSA 5CGQA 1IGWA 3UY8A 4GNVA 5D8WA 2GDQA 4WY0A 1HO1A 2PF8A 1C91A 1BQCA 2BBFA 3AIRA 2CCRA 3HG3A 5CAHA 3SCSA 2V5LA 2VCCA 2DW7A 1KXQA 3ARTA 4QNEA 4EXBA 3EXSA 1EKOA 1EEPA 4JY9A 3T05A 4KS0A 4NT0A 5IDZA 3HO8A 4BEQA 5AHFA 5AC4A 1G9HA 1H7PA 2EAWA 2EXOA 2NX3A 4W84A 5FL1A 4IZGA 3P62A 3CPUA 3T2QA 3CZEA 2PWFA 2BHUA 1NOFA 3GHSA 4AVOA 3FA4A 3JS3A 1UROA 4JEQA 2WXDM 4PMQA 3PBVA 5E6ZA 4PSPA 4P7NA 3BARA 1AMKA 4HNLA 2I5IA 1F6KA 4AVFA 4B5TA 3VDAA 1CZ1A 2Y2WA 3N4AA 5FOOA 4O19A 1J0HA 3K8LA 4UTIA 1E0XA 1EFZA 3S2MA 3SB0A 1TIMA 3GLCA 1RP8A 3I65A 1TA3B 1WE5A 1UIOA 3A4AA 2HNEA 2VOTA 3QOMA 3VIGA 5AVNA 4W87A 4XB3A 1JD9A 1OIMA 3VILA 2J79A 2HBVA 4M6UA 5CBIA 1CWYA 1PWMA 4XZMX 2PC8A 3FKKA 2GOUA 1H5YA 1L8PA 4F3HA 3KBWA 5A69A 3M41A 3A4JA 5FEWA 2JK2A 1E9IA 3LZ3A 3STFA 4XTDA 3GIYA 2D2OA 4X22A 4TV5A 3LK6A 4PCNA 1FWIC 5CPLA 5KZMA 3GKFA 1V6WA 1LF1A 3QBUA 2E9LA 4R85A 3S1UA 3CPGA 3F4VA 3BPWA 1JJKA 3BE7A 3E5PA 2P8BA 2ZUUA 4GYKA 4OGZA 2WHMA 2OX1A 5FEZA 3AS3A 3EX6A 3W2LA 4EF8A 3FVDA 4NZ5A 1TV4A 3AHXA 3NO3A 2VEIA 1SO4A 3OA5A 3OBEA 2F7FA 3QGKC 5IDIA 1BSIA 1J11A 2DZBA 3RCMA 4D71A 3N11A 3OVGA 3TCEA 3SFWA 5K9CA 3GYEA 2V5BA 2BS9A 4V27A 3L4WA 4ZB5A 3OGSA 3T0CA 1W3IA 4UQCA 3RITA 5I03A 3IJDA 3KCJA 2YZ5A 4M6QA 3E9AA 2FQIA 2A3AA 3NQFA 2F61A 4LANA 3RMJA 3ZYZA 3EA3A 4W89A 5ABTA 3W25A 4ERIA 1QPQA 1QCWA 4E38A 2QJMA 1PDZA 3GNXA 1P43A 1CT5A 3CH9A 3WQOA 4O28A 3GFZA 3R12A 3T7VA 2G3MA 2OZ3A 5CJ5A 1Z8AA 2RJGA 4BHYA 3PZIA 3BCJA 4B5NA 3W71A 2NV1A 1XG4A 4F40A 4AXKA 1FWRA 1ADOA 1UD2A 1GEQA 5B7ZA 4HA3A 1EJXC 1TWZA 3MANA 2V3GA 5KZDA 2OWWA 3LXBA 4CNPA 2QPSA 5FJOA 3AXIA 3RM9A 4PRTA 2ZICA 1US3A 4ZQNA 1REQB 1A80A 1SM9A 3H2EA 4MWAA 1V3IA 4GK8A 5T8GA 4C6MA 1G67A 3N2OA 3PBMA 4IG2B 5HWJA 3MHFA 1HO4A 2PDQA 1VYPX 4ICCX 3RXZA 3DHPA 3W4RA 3TN4A 3NL2A 1Z3NA 2CIPA 4XAZA 2B0MA 2WNNA 5AYIA 3MP3A 4UNKA 2VFDA 1F6YA 1TTJA 3CZJA 3UPBA 5DX7A 1OD8A 1Q2SA 2VO5A 1A3WA 3SZ8A 3VPLA 1FBAA 2I5QA 5AB3A 4JTCA 3WMSA 4GUFA 1A5AA 3TQPA 4HZ7A 3T4WA 4XBKA 1SMDA 3TYCA 1SW7A 2UZ9A 1R7AA 1FCVA 5A8MA 3WBYA 2O9RA 1XIHA 4ZOCA 2GOKA 3W1UA 1C7SA 1XP3A 4WDUA 4TX9A 1KFWA 3QN3A 3WF2A 1CIUA 3SIMA 1LUCB 4LC8A 2DV0A 2WV8A 4U28A 5AHEA 1E70M 3C52A 4MAZA 3M9YA 1TWDA 3S46A 2C15A 1KM6A 4O15A 2V2CA 3ZJ8A 4E5TA 4ZVJA 3M16A 4MYXA 2HXUA 3TN6A 3A9BA 4UTHA 1FWHC 4FK9A 4XISA 2JKEA 4HTBA 1YTKA 3V5CA 4WDXA 4M82A 3KBNA 4LNYA 3OZOA 4Q7NA 4ZXLA 1ZB5A 2WWCA 1PX8A 5D9OA 2A3CA 3NM3A 4JKMA 1LYXA 3G5EA 4RV3A 1JPDX 3LRLA 3ES7A 3P3BA 4J4KA 1XR2A 2X30A 3FW6A 3RFAA 3IVTA 5D2TA 2XH4A 2AKMA 3KW3A 4C6KA 1TJ1A 4A22A 3WF3A 3PZ9A 2PWDA 2GSJA 3VD9A 1XIGA 3EKLA 3A24A 1H51A 4O1EA 3L67A 4O17A 2WMIB 1W3TA 4WXYA 2Z7KA 1R3SA 2OXNA 4XKYA 1L6GA 4MDOA 1XV8A 2JBMA 4DJEA 1VP5A 1DL3A 3F2BA 1HKWA 4PUNA 2HSAA 3EX3A 1E72M 1Q6EA 2HVMA 5C6MA 2Z1WA 3T08A 3KLKA 3VIHA 1M41A 2ISWA 1YPIA 5MKGA 3S42A 2QQ6A 1FFRA 2Q8ZA 3JUGA 1PZ1A 4FB7A 2DW6A 3IARA 1F3EA 4H6QA 1IEQA 1HVXA 4ZTXA 1KBKA 2PLCA 3SY8A 3MV01 3WMBA 3GU1A 4PYSA 3B4YA 1R47A 3CHDA 5ENLA 2BVYA 3UNDA 1W3KA 3R94A 4HNUA 1JZ5A 3S5NA 2YKKA 1ZBVA 3TSBA 3BLIA 4TVUA 5FEPA 3VKJA 3E12A 2Y8VA 3PAJA 4GD0A 4CN1A 1CX9A 5G1TA 4C65A 1ADDA 1W5MA 4R9XA 1QR7A 4O10A 4YTSA 2QCFA 3RCNA 1TTQA 3OLEA 3C0SA 3G77A 1BYDA 4N02A 1MYRA 1XUUA 4K3ZA 2OJPA 2J75A 3QPYA 4GYPC 4PUJA 4HHHA 2FJUB 5D9PA 7PTDA 1H5VA 2DUXA 4XBJA 2IMRA 2BVDA 2VDHA 4WLCA 3R11A 3GVGA 5BZAA 3C0JA 1ZHAA 4ERAA 3G2GA 4GZIA 5AHMA 1OADA 4YYFA 4B2DD 3RAOA 3FXYA 3F1QA 4UNLA 1E9ZB 1SZRA 1MI3A 5DELA 3TJIA 5AYBA 1UKOA 5LNVA 1HF6A 2A21A 1AJ0A 3I6TA 4F2UA 3NGFA 4GGHA 4BA0A 1V02E 3HV8A 4GYJA 4DI8A 4QE5A 1S5MA 4O1CA 1JFXA 1WQ5A 3NQBA 3N2BA 5KINA 4D6GA 3BJTA 2CKSA 1AH3A 4TR9A 2BX7A 3UR2A 4M51A 3VFCA 4KQNA 3LRKA 1UP0A 4UMCA 3AS2A 1XYBA 3GVQA 1FH9A 1Z41A 3LRMA 3NUKA 4Q4PA 4AC7C 3EA2A 3ZO9A 5C9ZA 2V63A 4GJ1A 4LYPA 3N15A 2QJGA 4OJYA 4IUGA 5IFTA 4FMVA 4MKVA 5FF2A 3W2UA 1O5KA 1D3GA 3PUOA 1FH7A 2POZA 1WA3A 3HA1A 2WB5A 3VK5A 3ZR6A 1GOWA 4B9ZA 1MEWA 2FPVA 4EPEC 4H8NA 3H21A 1ZPTA 3UJSA 2BDQA 1CECA 4KF1A 3LA4A 3R79A 1A5NC 4YNGA 1TV7A 4DUOA 3W1AA 1RCOB 3S5ZA 4CNOA 8RUCA 2PU0A 2VP8A 2IKJA 3WF4A 1L6FA 1E55A 2O9TA 3OB8A 3TP4A 2XM1A 5I2UA 1PWLA 1VPYA 2NXIA 1JZ7A 4US5D 1JF5A 3PANA 3S3GA 5C7HA 1LL6A 4UFKA 1IT0A 1QNOA 3OU8A 3QV7A 4FNUA 1P1MA 3VMOA 3WDJA 2V67A 3GFXA 1J4EA 5DCEA 1HJWA 3AHZA 2ZE0A 3RIKA 3ABSA 4LY8A 3TW7A 2ZX8A 4JN6A 4LU0A 4U3AA 3QQ1A 4DWSA 3V3WA 3PUDA 5C9WA 3GHRA 2IW0A 1JZ6A 1KKRA 4MFEA 3RGTA 3W7MA 4NZ3A 1IYXA 2QDDA 5IBXC 1FDZA 3LXCA 3CQIA 2F2KA 4JL1A 5F4SA 3UU0A 3U2ZA 1KW1A 3CHEA 5I07A 1KO0A 4R33A 4DO6A 5I6SA 5HULA 2AL1A 1FXQA 3W24A 4W5UA 1JULA 5HNTA 2E1WA 4HYVA 5DBTA 1X7IA 3B9OA 4NYUA 1XFCA 2G3FA 1NWSA 2W92A 3R6IA 1TPEA 2UBPC 3GVRA 4Q33A 4UOQA 1JCMP 3E6EA 4TX6A 1H41A 4E4UA 1QOPA 4UTMA 3EX1A 4QS6A 3GM8A 3UCCA 1B3YA 4DNMA 4HCLA 4WGHA 2YBUA 2BOFX 5C9XA 4IMAA 3VNLA 1H1NA 3MBFA 3PP7A 1XICA 3EBVA 2ZWYA 2VT0A 3H2FA 4S3EA 4C1KA 1PS9A 2QNEA 2XSAA 1Z89A 3TYZA 3EDKA 2PWVA 4C91A 4QX4A 1UASA 1BYAA 3L4UA 3SBFA 1F8IA 4BFAA 3UQNA 1E3ZA 4TVCA 4MGGA 3UWVA 1RAKA 3ZIZA 3HM7A 3FHAA 5A95A 1QJWA 3IWPA 1ENUA 3BDKA 4GFIA 1DQXA 2ATSA 5I24A 3E1F1 1NJJA 1UJQA 1K8CA 4LUYA 4S3FA 4AX7A 1QHOA 1ICPA 1XPYA 3P82A 3K2GA 3THCA 4RDYA 3I10A 2ACUA 1B54A 3WH6A 4I9AA 2OGJA 4WR3A 1QWGA 3B8TA 4EXQA 1CW2A 4CN4A 3S6DA 3WQ4A 1S46A 2GJXA 3MO4A 1J93A 4H1ZA 5T26A 5KTLA 3SUSA 4PEKA 2A2IA 4YHEA 3EB4A 3E0WA 1PV8A 2VGGA 3NPWA 3XISA 1MW0A 3SCTA 4AYSA 4AF0A 3DC0A 3TJXA 1JNDA 4ZE4A 2JKAA 2F38A 3APTA 3EDDA 2VENA 5A2AA 2E67A 3LPPA 2Y88A 2VDIA 2DFAA 4CNSA 3E3HA 4MVAA 3GUGA 1JI2A 2WCGA 3UG4A 3PFRA 2W63A 4NF7A 4DAFA 4P7QA 3HQNA 4QGCA 4UFHA 3VIPA 1TV5A 4P7LA 2DZWA 3EEGA 2GGJA 4G8TA 2GGIA 4CU8A 3ZJKA 3W27A 1OGGA 4WQ6A 2XFRA 2ZUMA 1V3HA 3PHAA 1VFUA 4IQJA 3K4AA 1ZJBA 1NWTA 3VKAA 3WH7A 2CWNA 4XD4A 3KCLA 4L1GA 1DJWA 1RY8A 5LNWA 1TIWA 3NCOA 3SAZA 3DUGA 4IQDA 1AFSA 1E1FA 4ATDA 3M0VA 1QI5A 3BV7A 3NQGA 3N34A 1UH3A 4IPJA 3MDWA 4XO6A 3WFZA 2G97A 4BR1A 4I8DA 4J7RA 3N17A 1E0VA 1V6TA 4R7OA 4IMCA 2Q01A 1IEVA 3WF1A 2PDCA 3T44A 3R8RA 3UETA 1E5NA 3T1GA 4S3KA 4PL2A 1HGWA 3WMLA 4O18A 5HPOA 5C0QA 5CC5A 1I1XA 5BNKA 3A4XA 3WEOA 1IE7C 2QEZA 1UUMA 4LVAA 1R46A 3M43A 5E70A 1M7PA 2F6KA 4GQBA 4LAUA 1TCMA 4Q6XA 1KTNA 2FTPA 2A3EA 4JPGA 3KBVA 2OZ8A 3MCOA 3EOLA 4A21A 1E40A 2B7OA 1O6IA 2C0HA 3W6LA 3DOPA 3SJ3A 3GXMA 3UR7A 1BYBA 1OABA 1FWNA 3GWQA 1XDMA 4WGXA 1PO9A 1R3VA 4UQ9A 3QZ6A 3KDOA 5JBFA 3M5ZA 3CGTA 3GQYA 3IPWA 3DKJA 2ICSA 1UBSA 4I9JA 4NXKA 3GUWA 3RPMA 1H2JA 4RKAA 3M7WA 4FAMA 2XGIA 1YDYA 1TVNA 1B0IA 3OLDA 5D9NA 4C6QA 3UJFA 2V2DA 3MUY1 1FHLA 5CKSA 1E15A 3HIJA 4PN2A 1KV8A 1PB0A 3P8IA 3NQMA 3EYPA 2R1KA 4IIDA 1DBTA 5D8ZA 4AEEA 3FCPA 3CWOX 1TMHA 3W88A 2WZEA 1PL9A 1KB3A 7ENLA 1ZL1A 3U9IA 4MWAE 4UFMA 2XN2A 1BKHA 2PDWA 3UP8A 5D09A 3QSRA 1EO5A 1UKPA 3GXPA 2MANA 4LYKA 2DUZA 2BB0A 3LV6A 3FDKA 3NO5A 3B0PA 3W7QA 4NJIA 4PUUA 3NSMA 1H0GA 4LUTB 2VC9A 3NSNA 1HJSA 4N6EA 3GR8A 4G1NA 3NQDA 1GVYA 3EOOA 2ADAA 4ADUA 3MV11 1L0PA 1FUYA 3AS0A 3MMUA 4KEZA 5M2FX 3I7QA 3GR7A 4NZFA 3W83A 1OSEA 8XIMA 3SUVA 4W86A 2XIMA 3VC5A 4IM4A 4DJEC 3TW6A 2IKIA 1CGXA 3KFTA 4KW2A 4CEXC 4XKYB 3HZ3A 2FGLA 3M0MA 2NXHA 1R86A 5AVHA 2QCDB 1XBXA 1DWGM 4W8BA 4DXXA 4JTHA 2UY4A 1G4TA 2ZUNA 3BLDA 1XLIA 3BCDA 3DC8A 4JFUA 2J7CA 3REQB 1LWHA 3TJ4A 4B5SA 1KKOA 1D9EA 2WLYA 4H9MA 3BOXA 4KCVA 1UP3A 4FS9A 4XZHA 4W9TA 1HKKA 5G5IA 2ZCGA 1XJBA 3IIOA 4V15A 4AU0A 1EXBA 2CBUA 4FXSA 3MKKA 4A05A 3WUFA 1ME8A 1V6UA 3WELA 1EBGA 3TWBA 2XU2A 4YWIA 4GQRA 1FWGC 1AODA 2QUTA 4AWUA 5HINA 4B3LA 1Y0EA 5CXPA 3A64A 4WEVX 3TONA 1JCTA 3IIZA 4ZCWA 4NAEA 1YTDA 3NAVA 1O95A 3W1RA 5FSEC 4QQUA 1EJ7L 3O7UA 3WNPA 4ECLA 4KWVA 4IX2A 1POKA 4QR6A 2D0HA 3EEZA 3VOIA 2FZDA 3PPGA 3GS6A 1TV3A 4PTMA 4A8NA 3HG5A 2BTMA 3NPXA 4AC1X 3HMJG 2QVHA 3TYUA 4HHPA 3CZKA 5IM51 2OWCA 1SYTA 2Q6ZA 2P3ZA 3UXLA 1TTIA 2W0UA 3U2OA 3KEHA 2OSXA 4E3VA 2C6QA 3II1A 1FWTA 2IQ0A 4LYQA 2AMGA 1F07A 1PX3A 4L4MA 3RDKA 3A3XA 1PVNA 3M0XA 4PMOA 5AC6A 5D03A 2WSQA 4IGMA 4XZ9A 1EJSC 3UZYA 4CU6A 4X2RA 4G2DA 4XBSA 1W32A 4ROQA 2V3DA 4IP5A 1OFOA 1ZQ5A 3WLMA 3P84A 3LTYA 4NILA 3W00A 4JL2A 5LZLA 1T8XA 5FEXA 4GJIA 3P60A 3Q58A 4FNSA 4Q22A 2DVXA 5TD4A 2XVLA 3VGFA 3FSTA 2C79A 1FFQA 1KA9F 4BQ3A 4NAFB 5HWMA 4DVOA 1W3JA 4K8HA 5D2WA 4DJFD 4F48A 4KFPA 3MDUA 4QRNA 1XLDA 2ZWZA 4WKFA 4C6LA 2PAJA 1YX1A 4TU1A 3BLLA 1MQRA 3E0FA 4J3ZA 3Q65A 5F1VA 3M0YA 2DDXA 1TV8A 3MZ2A 4LS0A 1W2PA 1Z69A 1OGBA 4DF1A 5C70A 3BURA 1W5OA 1XIFA 5M17A 5D2VA 1TZ9A 2YOCA 3NVTA 3VKBA 2XSXA 3W26A 2PLKA 4BF9A 3PTKA 3ALFA 1LBMA 3LUTA 2TPSA 4FLRA 4WD0A 2VXNA 4WF7A 1P0DA 1TJPA 2VVSA 1ZENA 2Q3OA 2NVCA 4XK2A 2VQUA 1N2VA 4QIUA 1ZBCA 4BS0A 1JQXA 3T0AA 2QYGA 4H00A 3TK7A 4H01A 5CZJA 1QI3A 1AUSL 1U1HA 3FN9A 3NZ1A 2Z6IA 3LNMA 2EO7A 1AVAA 1GW9A 4OT7A 3LCWA 4ILSA 4C6BA 2E9BA 1SQ7A 2BODX 2P88A 2YCIX 1GPFA 1J6OA 3AIWA 3G6MA 5HMFA 3W73A 1DE5A 1SMAA 1AW5A 5DCBA 1NQKA 3A6OA 3G1VA 3WKZA 5BRQA 1LLZA 1B3WA 4ZO7A 1VJZA 3TSMA 1B9BA 1W9XA 2FPTA 1W31A 3VNIA 1J0KA 4DXKA 3VABA 3APYA 2PZ0A 2VRKA 1DIKA 2KZHA 5C71A 4ACYA 1J12A 3EDJA 3JZUA 3W1PA 3M6DA 1XC4A 2PTWA 1VZWA 4IFKB 2BVWA 3D5HA 3W07A 5H1WA 3EWWA 2A3BA 6ENLA 1QDSA 2NQJA 2DIEA 4PUWA 3TQ0A 1UR4A 3UG8A 3PBGA 2PWGA 4DJDA 5I3JA 3ANUA 5HMSA 4KWWA 3O1NA 2XFWA 1HP5A 3B9EA 1XLBA 2DZAA 3BV4A 5H2ZA 5DT5A 3RLHA 4I6VA 1XLKA 2E68A 4CN6A 2NQLA 2WZHA 1ZUAX 3SQSA 1C93A 5A6BD 4LAKA 2VNCA 4EANA 3G1FA 1ML1A 4JQ1A 1GK8A 4AY1A 3ARUA 4MFDA 4FLSA 5KETA 4LVDA 2H3DA 1QK0A 1UOKA 3V75A 3SN1A 4XIAA 3MI2A 2R94A 4KEMA 3C3UA 1SSGA 3MHUA 1HIZA 4IJCA 1NIUA 4PB4A 3BAYA 3DAQA 3AMKA 3B8WA 4NHVA 3ABZA 2VX7A 1R30A 1E6RA 4H6RA 3VNDA 2TSYA 1OCQA 1G6CA 3QMTA 1YPXA 1P0KA 3CLWA 3C2OA 2GVYA 3G1XA 3ME3A 4HU4A 3C5QA 2ABBA 1ME9A 1DJXA 3OEXA 3OIHA 2Z29A 5KITA 3KDNA 5BU6A 3GC4A 4DUXA 9RUBA 4JFTA 3ATYA 1LLWA 2YB4A 3IK4A 2ZKMX 1RQHA 1E5JA 4DNHA 5EY5A 1DJGA 1MDRA 1CXFA 4V1XA 5CSUA 3M0JA 1V3KA 3VGEA 1TFVA 4TMCA 4LC6A 4P61A 2ONEA 2BVTA 1SW0A 1Q7ZA 5A6TC 1QATA 1U5HA 4W4QA 2VC6A 4JHOA 1SFSA 3SGUA 1SJCA 3FFSA 3AMCA 1XIIA 3M5VA 1XM3A 3VZXA 5G4WA 4GI9A 4KKXA 3FDGA 2R14A 2SFPA 3CWHA 3MUIA 4ML9A 4AH7A 4GO8A 3TV8A 1C9WA 1AK5A 3COTA 3EMZA 3QR0A 2FB2A 3CL7A 1BXNA 1VKFA 5C2GA 3ZR4A 4HGXA 1WB0A 3ZMRA 4NJJA 5CSYA 2QHAA 1VFTA 3SRDA 3L0KA 2OPJA 2VCBA 4DB7A 5HJYA 4S3CA 1JGIA 2FHFA 3SECA 1EUNA 5GNYA 2Y89A 4QISA 2ZRXA 4GUGA 1YBQB 5LA0A 2ZA3A 2DSKA 3UVAA 1EGZA 2OEMA 4NUWA 3MU7A 1J18A 5A6AA 5K3VA 3LXAA 3GDMA 4WSKA 4TTGA 3W70A 3ONBA 1QK2A 3HG2A 2A5HA 4M3PA 3TYAA 2YYUA 4AW7A 1EA9C 1UW9A 3WZ0E 1UWSA 4ENLA 3SY5A 3CMGA 4Z2GA 3NYDA 1H1ZA 3EMCA 1XCWA 3GNDA 4I3GA 4WZHA 2XIOA 1Q6GA 3HPAA 3W1QA 1GORA 4GISA 7REQB 4P8UA 4MB5A 2J25A 2YW3A 3D3FA 4HPGA 5D33A 1Q13A 3D0CA 3ABXA 5FF4A 2CBJA 2Z4GA 2D0GA 4EOUA 4RZBA 2C8NA 4GWEA 5GVJA 3WENA 3APGA 1O94A 1PDYA 1MUCA 4O57A 2DVUA 4HN8A 3MCMA 2QS8A 3DKLA 3N2XA 3Q4DA 4CD7A 5EB8A 1CPUA 3FHQA 3WUBA 4ZQOA 2CHRA 4P7RA 4GZJA 1BRLB 3EMQA 3KRZA 2J8FA 1DHPA 4LGXA 4RZ4A 1WAWA 4QBXA 4PBEA 4HKPA 3GKAA 2C19A 3WG6A 4KPLA 1RVKA 4DN1A 2ZYFA 4QJ5B 1VIWA 3W02A 5XIAA 5DXXA 3W0KA 1V02A 2P53A 3ONCA 4B90A 4KMQA 4DBUA 2QGHA 4NI3A 1XFBA 2ISVA 1KXHA 2WZMA 3IJ8A 2P3EA 5C55A 4PB3A 3VE9A 2NLIA 1XLAA 1WDPA 3M1ZA 2VOMA 3TOPA 2ZX5A 1NWRA 1XSIA 3TQKA 2PDBA 1XRTA 2XDFA 3K1GA 1RPXA 1MO0A 4Q8QA 3VDGA 4PTXA 4L4OA 1KWGA 3VNYA 2ZIDA 1FXPA 1RP9A 1Q6DA 3GYCA 3B8DA 3QMSA 3C56A 3FAWA 3A3HA 1E1CA 4EPBC 3R0UA 3GRIA 3FY1A 4JTQA 2DSVA 3GXTA 1OC5A 1BXCA 1GVEA 1XBZA 3WIJA 1OFBA 3S1WA 2NQHA 3JVAA 3NDYA 3NL5A 3PULA 4F0SA 4PODA 2QCHA 1VEMA 5E0FA 1Q6RA 4DBEA 3N3TA 2DQWA 1ESWA 3M44A 1MW3A 4JZ5A 1DKWA 2CXEA 1YRRA 1OCJA 1QU4A 5ECUA 2QF8A 3TKFA 4MB3A 1IEXA 1KCKA 4LCQA 2A85A 3HJEA 3F5KA 1OCBA 3VIJA 4NVTA 2CZEA 1BD0A 3BSHA 3MTWA 2QUNA 2ZRUA 3V0SA 3BW4A 2Z2BA 1QI2A 1TKKA 2HRWA 1I2RA 2PGEA 3C3NA 1SJAA 1UZDA 3ANVA 2PD9A 1EC7A 2YGYA 2O4MA 1XHGA 2B81A 4XTIA 3W1XA 1FDJA 4P7OA 3BAKA 4GQ0A 1MXGA 5HJLA 2GK1B 3MP5A 1UBPC 1G7UA 3H12A 2WSYA 3IIXA 2IKGA 2G96A 2XFFA 3INPA 4HSOA 3E2QA 3JR2A 2Y63A 3USZA 3WD1A 4PGLA 4M80A 4GBDA 3K30A 3DFTA 1AQHA 3T07A 1CGVA 1W5QA 2WVSA 4LCRA 4C6JA 4ZO6A 2YJQA 3N2CA 2HK1A 3NQCA 1E43A 1M7OA 1J0JA 1SO5A 1VBUA 4O1BA 4Z0SA 4LB4A 3L12A 5AHLA 1KXVA 4LVGA 4GVIA 4E2BA 2CETA 1QBBA 5U7SA 3CUIA 1KWKA 1XBVA 4MY9A 1A5UA 2BY0A 1YNYA 2W66A 4HNNA 2GQ3A 2PP3A 4W7WA 1DV7A 1HUVA 2G50A 1REQA 3KRSA 3CIVA 3UERA 2IUZA 1QNPA 4J1OA 4CCZA 5AZ0A 1X97A 4IG2A 5LYRA 4C6NA 3KVLA 4JTIA 1Z6KA 4RXGA 1A3XA 2ZUTA 3C6CA 4TUFA 1A5MC 1BF2A 2J88A 1YYAA 3LCFA 2AQVA 2PWEA 5CZ0A 1PIGA 1HTIA 2B7NA 4IFRA 3ZLGA 2CLKA 4X0VA 5C9UA 2VELA 2R1NA 3VAVA 4F66A 5C54A 4MNMA 3HPZA 2QPXA 4TX8A 1WKYA 3KVMA 5AOUA 1QUMA 3VFLA 3AU2A 1EQCA 1V0NA 3N6QA 4JTDA 1KFEA 4S3GA 4XZLX 1LZOA 2X16A 2CESA 2E5CA 2J66A 4L9YA 4JHZA 1QO2A 4QSHA 1U1UA 5A6LA 1RBAA 1I60A 1LUCA 3CQ0A 3Q2DA 4F4RA 1DQWA 1XRVA 4KEUA 5F7UA 5AY7A 2F6XA 2CLOA 4MF4A 3EWDA 1NFGA 1UZ4A 2R9RA 3NGJA 5AHIA 4PTDA 1FY6A 1WP6A 3L65A 3AIVA 3PJXA 1TCDA 2E40A 2J7BA 2OLHA 3DENA 3E2SA 1V51A 4UTWA 4JTGA 3TSDA 4ZQPA 3WQCA 1I0BA 3DDMA 4B5UA 2X41A 3BLKA 2D2HA 1X1NA 4JTJA 3ZSTA 4Y9PA 4B3ZA 3I6EA 1I2OA 4XD3A 4KRZA 3ABQA 3S0CA 2DZVA 4J27A 3KTCA 1J6PA 2EJ1A 2WC3A 4A8LA 2QUVA 4IMFA 3GX9A 4PA8A 1YIXA 4O14A 1QI0A 2X05A 4DLMA 4YXGA 1RBLA 2YB1A 2BGNE 2NVAA 3FIGA 1UH4A 3HFTA 2Z1SA 3MW7A 3SRKA 1AD4A 1FWSA 1HQTA 1MEIA 2D73A 3U4FA 4N6FA 3A3WA 5CBJA 4ATWA 3S2CA 2PDUA 4AUBA 2C18A 3PSVA 2PFHA 3AZSA 2BXVA 3V5OA 3G0XA 4HJWA 2VWSA 2FDSA 5AN7A 1R6WA 3W3OA 4R9OA 1LRTA 2R1LA 4KERA 1K3UA 2PDNA 2YL6A 1VQTA 4WUIA 1EHAA 3OJGA 2PDGA 2AKZA 3TTQA 3MMWA 3FJNA 2JALA 2QKFA 4B92A 1Q8AA 5FF3A 3AUJA 5J04A 1YEYA 5LIXX 4YCOA 3QLLA 3TMLA 1VRDA 2QVNA 1RA0A 4GUIA 3S2NA 1B90A 1EGMA 3H54A 1NDWA 1GQNA 1RR2A 1ZCOA 1W9BM 1GVFA 4RDVA 1Q3NA 3EXTA 4QAIA 3KWXA 3H26A 5F4XA 3SRFA 2B7PA 3SDOA 2NT0A 2QJNA 1DWJM 4GVGA 3IJLA 3GH7A 3O6DA 1ZJAA 3PC0A 1XISA 4K1GA 1JRCA 1B31A 2FTYA 1E0TA 2FZBA 3MT1A 1VFHA 3WDIA 4OZOA 2XUCA 2G5WA 4GH1A 4NZ1A 4H6EA 4ES4A 1MEHA 1FWJC 4KFOA 3LCGA 3WJYA 5CGMA 1CI1A 1U1JA 4UTUA 3VOGA 1EF2A 3ES8A 1NF7A 4WJXA 2ZUWA 3UNTA 4MUZA 3HB9A 4YN5A 3WDQA 3RO6A 3BCFA 2WC4A 3O15A 4JAWA 3SUTA 1OC7A 4IH3A 1EQPA 4HNOA 5A6BA 2QF7A 1A0DA 1OY0A 4UB9A 1PKMA 4EIVA 4DZ5A 2VEGA 4ZEPA 4FHAA 2JE8A 1OHLA 2D23A 2JIEA 5ABFB 5HUOA 5E6YA 4J40A 4ZE5A 2AL2A 4AHQA 4ZO9A 1NDYA 2ZDSA 2ISDA 1R2TA 2QPUA 3FYYA 3BZGA 5E1QA 2GJLA 2QJIA 2RDTA 3IS4A 3I3BA 3QEZA 4GO9A 4M24A 4GI8A 2CLHA 3GBEA 3NG3A 2Y70A 4US5A 5REQA 9XIMA 1AL7A 2RFGA 2WMFA 3WDPP 3BQ6A 3KRBA 1JPMA 1HG3A 3H6OA 4NI8A 4RLIA 3CUGA 4KIRA 3WNNA 1JYWA 3WNOA 4DQWA 1V08A 1VIZA 2VUNA 1RHCA 3UPWA 4E2VA 1A5KC 3L4VA 1GOOA 3QR3A 2PSNA 1FKXA 2GUBA 4IIFA 3PZOA 1BVNP 4A3UA 4ZB2A 4IFOA 3B8VA 2PGWA 1KLZA 1QBAA 4KESA 2IXUA 2W5FA 3GDLA 3C0QA 3HFYA 1EJRC 3KVJA 1ZSXA 4KWSA 3RX2A 5HNRA 3D6NA 1CXIA 3W7LA 2ZUSA 1BQGA 4JIIX 2GSEA 3GNRA 3R8GA 5CPOA 3GXFA 3P6LA 4H7CA 3G1AA 2DEPA 1M6JA 1OIFA 3W7OA 1QVBA 4EKJA 2HNHA 4UFJA 2YXOA 4DWSB 4DZIA 2J7FA 2DP3A 3UEQA 4BZYA 1GCYA 3GG8A 2CZDA 3BGAA 2WAGA 1UD6A 4RDZA 2CZFA 4QFUA 2XTKA 2HTMA 4I90A 1MRQA 1W3HA 4W8LA 4Z2LA 2RDXA 1BTMA 3VMPA 4O0QA 2J8GA 2ZRYA 3IJ7A 1IT7A 1L8NA 3QY6A 5KEZA 1T5AA 4U31A 3K5XA 3GH5A 2QUUA 1G5AA 4KWOA 5LXXA 4CQBA 2XIBA 2OYKA 4D1JA 1DXFA 3OYXA 3M5YA 5CSSA 4N9EA 1V03A 5JVLA 4E6MA 1PYFA 4B2DA 2V3EA 4PL1A 2PDIA 3S5YA 1EEXA 1EJTC 2NUWA 1OX4A 2ZX9A 3DGBA 4EF9A 4EWJA 4CNNA 4XX6A 2R8WA 2DPEA 1XXXA 2BHYA 3BOLA 5B80A 3ATZA 3ALGA 2VR2A 1EBHA 2AQWA 4O1DA 4JXCA 3K4DA 2CWXA 2PWHA 4I7VA 2RKXA 2NW0A 1NARA 4IP4A 1RVGA 4HK7A 3H24A 4QLLA 3K13A 3PB0A 4AIEA 1EOMA 4EAYA 1WBHA 3HGSA 4C7DA 3RR4A 3O63A 2V82A 1G7VA 2BFGA 4JCMA 5CCZA 3UJEA 2OQHA 2X1RA 3WJWA 3TNOA 2NQ9A 3WL1A 4H9VA 3OHMB 2ODOA 4DAIA 3NEHA 5K7JA 4B4FA 4QLJA 4GY0A 1F3XA 1GTEA 2ZBTA 1A5CA 3VDBA 2HDJA 2Y7EA 2A6NA 4ZQCA 3DH7A 4V28A 4DBSA 5DO8A 4FPSA 1RY0A 2AOSA 3UXDA 2NXGA 3RPTA 5FIPA 4M29A 2I14A 4WCJA 1QNVA 5BWAA 5JBEA 4AY8A 1BGGA 1W8SA 1KTCA 5T91A 3RU6A 2HPMA 1XH2A 4MJ4A 4RNJA 1VHNA 4CQ8A 2RUSA 1SR0A 1V6YA 2GQ9A 4J5NA 3BC9A 3NXLA 2VHLA 5A3HA 3GXIA 5HPCA 4Z17A 1ISZA 1JF6A 4LH8A 1SZFA 2WKGA 3SSJA 3W29A 1UR1A 3PJUA 4AFYA 5FJPA 5JU6A 1ODUA 3OOQA 3G3MA 3VGDA 1OZQA 3SUWA 1VJSA 4U3CA 1VB9A 2DGAA 1WDWA 2EHHA 2YFNA 9CGTA 3UGRA 4ML4A 3NQ7A 2C13A 3NURA 3MMDA 4PZVA 3S6OA 2EKCA 4ZQMA 3NO1A 4JR5A 2J24A 1PPIA 3C2RA 4GY7A 1W8GA 2FZ9A 1WV2A 4FIQA 4PEEA 1G0CA 1T8QA 5LHEA 4Z1AA 2VR4A 4XVEA 4J3TA 1UP2A 2CKRA 2PTXA 4N9CA 3M6YA 2BY2A 1JRBA 1HFBA 5AECA 2Y8KA 4LY4A 4LV9A 3FK4A 3FGCA 3NIYA 3NZPA 4CNTA 8XIAA 3URAA 1JDEA 1TPWA 4A3HA 1DOSA 1OT2A 4NXSA 2FIQA 1JPIA 4LXFA 2Y5SA 2VEMA 1UJPA 4HOWA 2PBOA 5G4HC 2REQA 1JD7A 2TRSA 4UTFA 3QQ0A 2Z2AA 3CASA 4W85A 3O9NA 5BXTA 3R10A 1GPWA 3UYIA 4DM2A 4NNAA 3N1AA 4B5XA 1JIBA 4PR4A 3BWWA 2O55A 3PBYA 4NJHA 3CAVA 3DFYA 3NQ6A 1YXCA 1CGYA 1IZKA 1PAMA 4MYAA 2OT0A 5HNUA 3KOZA 3CUFA 1UR8A 3LCIA 3CMJA 3LMYA 4MB1A 1NQ6A 2NSOA 1XL9A 3EB3A 3LHWA 4UCFA 4MLJA 1R7OA 2W67A 1W91A 2E5BA 3BG3A 4O54A 3TDFA 1S5VA 2BOEX 4NQ1A 1D3HA 4DUVA 4OBSA 4NNBA 4S3AA 2ON3A 3M4HA 4I7WA 4JTRA 3S1VA 2ZXQA 1IXPA 3IGXA 4HT3A 1V8EA 3W72A 1VFSA 4D8LA 2DIKA 3GU9A 4GXWA 3T6CA 1R3QA 2Z27A 1YE6A 4LCSA 2WANA 1DQUA 2WNZA 3POHA 3O07A 2E5DA 3WK1A 4FNTA 1FWBC 2F84A 2DORA 1PCWA 4I7UA 4QP0A 3LPOA 2X0SA 4GHRA 2GUYA 4QG9A 2WMKA 3BXWA 4ALDA 3CC1A 4AMAA 4O12A 4CQ9A 4AD5A 4RE3A 2V5KA 3DG7A 2NX9A 2HE5A 5AC7A 5KMYA 2X8RA 3W2MA 1VJIA 5FJUA 3USBA 5I3FA 4I9TA 1OB0A 3A47A 1NEYA 4OUIA 1OFQA 2FJKA 4H9YA 3SSZA 4NY2A 5LGXA 3SCUA 1SO6A 4IXXA 2P10A 4UQBA 1H0IA 4WDWA 3O16A 1X6UA 1I2NA 1B1YA 4LVFA 4AZ5A 1JUEA 3EWCA 5IFPA 3LX9A 5T9CE 1XIDA 3N4FA 1UWUA 4GPNA 4C6PA 4Q8MA 3ARQA 3TQVA 4WXZA 3GD6A 4AIOA 1PYMA 4Z0JA 2XN0A 4MKNA 1M01A 1XLMA 1GOKA 1PHQA 2O92A 3KOXA 3VIIA 3WNLA 4G56A 3WJZA 4JIQA 6XIAA 1FKWA 3ARRA 4NU7A 2NSXA 3WQEA 2VUYA 1WNOA 3L0NA 1E0WA 3NDZA 2E28A 4MSSA 4IIBA 1VH7A 4YVPA 2VYOA 1MVYA 4HPJA 3WD2A 1QNRA 4YS1A 1XCFA 3HOJA 2AGTA 2W61A 2G3NA 4OV9A 2X2YA 2J47A 3S47A 1VGAA 4RV8A 1CENA 4Z42C 3OZYA 1I6NA 2FMOA 4FNPA 1TQJA 4C6DA 3QLDA 1YTEA 4Q8PA 4JDBA 1VFLA 4IQLA 3P5YA 4OOZA 3GE7A 2G4FA 4H7ZA 4KT2A 1SW3A 4LVBA 1EB3A 4BJHA 2NQZA 1GUVA 1FA2A 3O6AA 2WZIA 4JQ2A 1GOQA 3LTPA 1E6ZA 2XN1A 3GDBA 4L61A 3L2IA 1XF0A 3W22A 1TWIA 3EPNA 3MY9A 3QV8A 1CGWA 2Y62A 3WQVA 5BRPA 4H9XA 2XWEA 3CL6A 2GJPA 3UWQA 3EWXA 4FZIA 3FEQA 1XLHA 1AH0A 2XINA 3T8QA 4UIOA 3GIQA 3LBMA 2AGKA 3WLOA 4NZCA 3OG3A 2QLYA 4C1NB 5DMYA 3GR4A 3KE0A 4KIEA 3M46A 3AYTA 1H3GA 2AAMA 3SCRA 3PWGA 2OTDA 3MJMA 5DBUA 4DWDA 3ARZA 4GXPA 1ZGDA 2WMGA 3GNPA 5BXPA 1KRMA 3MYOA 2H9AA 4MADA 3FYOA 1J9YA 1KGXA 1N8WA 3KHDA 1DJZA 2PGRA 1V79A 4CUCA 2WSRA 3FAXA 2VZTA 4DJDC 1C90A 1SO3A 1YPFA 2VFEA 3EWBX 2E4TA 2D24A 1F8MA 5JIPA 1QWKA 4HA0A 1KRAC 4XAPA 4Y90A 2PLJA 3OODA 5AZ1A 1R87A 4QEHA 1XS2A 3P14A 3O05A 4HMNA 1UOZA 2X1SA 4UTJA 1WKFA 1KRCC 3EGJA 1HL2A 5HA7A 1S1PA 3W2NA 1QOQA 3F5JA 3R25A 3MO7A 2I9UA 1GQJA 4C6CA 3NDOA 4IMDA 3O6CA 1LT7A 4PSRA 1B4KA 1QPNA 4TMBA 5A8NA 1PEZA 3JW7A 3BSMA 3QW3A 4JD4A 5EYWA 4B4HA 5A2BA 3AOFA 3RPDA 2WWDA 2Y1HA 3AROA 5TF0A 4U2YA 3ARYA 3EKZA 2J7EA 4MUPA 1Y7VA 3VX1A 4TVDA 1GT8A 2PDFA 3HF3A 3IV3A 1F61A 4UMAA 5D2XA 1RA5A 3DI1A 3SN0A 3S9IA 1UG6A 1J2BA 1KCXA 4WY0B 1B3VA 4MZYA 1UWQA 5A94A 5JIWA 2Y5EA 4AQLA 4YJ5A 4ZA0A 4D2JA 3CTTA 2WOQA 2PU1A 1P6BA 1FX6A 3OLGA 1EC9A 2HK0A 2ZTKA 3B06A 3W2JA 5I00A 3OBKA 4IMGA 3A5FA 2POTA 4ADTA 1OG6A 4WY0F 3E96A 2Q8LA 3T0DA 1CXEA 3SGGA 4LBUA 4OVXA 3QVQA 3M0ZA 2DIJA 3GNOA 2EPHA 2QJHA 3BQ5A 1E6PA 1QXLA 1EZWA 2INEA 4RXFA 3H2MA 1MNZA 1AD1A 2PODA 2OQYA 4QQ3A 1EIBA 3PZVA 4FEZA 3VE7A 1TPDA 4FLQA 4REQB 5EMLA 1H4PA 4GNJA 3WD3A 4R53A 4J3SA 1B9ZA 2VURA 1JZ3A 1MZRA 5DMMA 4DZAA 2X40A 1XYFA 3LY0A 2OQLA 3BG9A 3DFSA 1LT8A 1UQZA 2VD8A 1KBBA 3FJLA 5CZSA 1G69A 1XKJA 2BSLA 3MWAA 1R9ZA 1W1YA 5HNNA 1M9HA 3U7BA 1TPVA 1RUSA 4PCSA 1DPMA 4NX0A 2HCVA 3MA8A 3RJXA 4UBPC 4Q8OA 1BF6A 3DYPA 1EUAA 1H62A 2Y7DA 4IUOA 1UB3A 4KGLA 1M7XA 3WLSA 4O0ZA 3UZWA 2O9OA 1F4AA 3NZGA 3MPGA 5AYXA 2OSWA 4DWSC 4MDPA 2HBXA 1SZNA 1WO2A 1MW1A 1ZALA 1MXSA 4OQVA </