3QEZA

Crystal structure of the mutant t159v,v182a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
MDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSVRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 83
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qezA00
3S0CA 5EMUA 5CKSA 2JBMA 4ONVA 4JN6A 4ML9A 1JUKA 2VFGA 3W7CA 1W31A 3LCLA 4RV8A 3VI2A 1UB3A 4IXXA 1R2TA 3S5OA 3E49A 4DBDA 1ME8A 3PS7A 2DJLA 3LM7A 5K9CA 1FY6A 3G8EA 3O15A 3LI1A 1YADA 3C52A 1VJIA 3M5XA 1DL3A 2ISSA 4AB4A 4QIUA 3NDOA 2J88A 5DY3A 3HGSA 3RF9A 3EKLA 4FO4A 2J9XA 4NNBA 4QQ3A 3P74A 1VC4A 4FX6M 3HGJA 1TJRA 1EWDA 1ZFJA 1RD5A 4JYFA 3TR2A 4XKYB 4LV4A 4QITA 2HSAA 3NQ8A 2DZUA 3LHYA 2CLLA 3NQAA 3M9YA 2Q3RA 1WV2A 1VPXA 3G1YA 1FWSA 3W1AA 1W5OA 2G97A 3BLFA 3W1UA 3WK1A 4IPIA 4UTWC 5J5DA 3R89A 1SSGA 5D2YA 4PODA 3MP5A 2FDSA 2Y7DA 3G0SA 3IIXA 3OVPA 4PL2A 3ZR4A 1XUZA 3I68A 1TTJA 5D05A 5DELA 1ICQA 1QFEA 4JTKA 3T4CA 4CLMA 2QF7A 1V7YA 3N14A 1LBFA 2V81A 3MHUA 3HJZA 4UMCA 2CU0A 3M7WA 5ABTA 3TDFA 3TJLA 4GJ1A 4RX0A 5G2IA 4TU1A 2H8XA 4Z1BA 3W84A 5C6MA 1RQHA 5I3FA 2Z6JA 2XFWA 4OE7A 3W87A 3MHFA 3DFQA 4E2BA 4XTDA 4O52A 2X1RA 1LROA 3W7EA 4O4WA 3F1QA 3QQ1A 2BZNA 4MVAA 3EEGA 1AL8A 3S42A 1LRQA 3P8IA 1M6JA 5H91A 4YCPA 1KTCA 4RXFA 5DCBA 2JGQA 3CTLA 3S6DA 4MY1A 5U7SA 4P61A 3W76A 4JIPA 3W2KA 3DI1A 1TMHA 1UJPA 3NZRA 2C15A 4KWWA 1UBSA 3NQ2A 2QCEA 1SO5A 4ZQNA 4FF7A 3OA3A 3P82A 2ZRYA 1L6YA 4LNYA 2YFNA 1FDYA 1GYLA 3W1QA 3M43A 5CZJA 2NXHA 1JRCA 3C2EA 4DEFA 4NJIA 3LHZA 4O16A 3T7VA 3OG3A 2NLIA 3UWYA 1XL9A 3C6CA 1I4NA 4GXMA 4O0ZA 1S5VA 3DFOA 4MZYA 5CGQA 1H61A 4OV4A 3W9ZA 2D73A 3NPUA 2C3ZA 5G4WA 4Z0SA 5CG7A 3O6YX 4TMCA 2B7NA 1G7UA 4UCGA 1KM6A 3CEPA 2Z0IA 3G1AA 3NG3A 1PV8A 5FEZA 3UQNA 1K7XA 4AMAA 2AGKA 1Z44A 3MYOA 3W1MA 4MLJA 3QSTA 1G4TA 4O14A 5K9XA 1DV7A 3TC6A 3TW7A 3HPZA 1H62A 4CNOA 1KW1A 3GAKA 1OX5A 5HUOA 3HPSA 1N8FA 3KAOA 4NX0A 1P0KA 3RLVA 1VLWA 4RJEA 2E6DA 1TPC1 5D04C 5KINA 5D38A 4IPJA 3NL3A 1IXNA 4FHAA 3UXDA 2CWNA 3C4UA 2NX9A 2ZA1A 2YPIA 5DLCA 2ZDRA 7TIMA 1G69A 3B0VC 4KKXA 1XM3A 4EVZA 1B4EA 1AG1O 1TPFA 3UWWA 3IGSA 5CSSA 2ZYFA 2NXIA 2A5HA 1D3HA 5EKYA 1G7VA 3Q2DA 1XC4A 1LRTA 1T99A 1J5TA 4CCDA 1LBLA 4WQ6A 3L0GA 1NEYA 1G67A 3NQ6A 4LS1A 5AHNA 5J5RA 3QM3A 2QUTA 2JGYA 5FEPA 1VZWA 1KM3A 5A5WA 1OF6A 1UUMA 3WJWA 2ZTKA 1QWGA 3TU9A 3GDLA 4H4IA 1TPEA 2BLEA 2Z6IA 5CZ0A 2NXGA 4PTNA 1TREA 2FPTA 1KV8A 2XN0A 3PBWA 3MO7A 3O6DA 4M5PA 3EWZA 4KWVA 5FI8A 1FWWA 1ADOA 3LHWA 2CZ5A 3BLEA 3MJYA 1M7OA 1PE1A 4Z08A 3W7QA 3T40A 4R34A 3STGA 1TYGA 1GTHA 1KM2A 1K7FA 3SI9A 3MWAA 4WY0F 1SFJA 3TQ0A 4CQ9A 1OJXA 2OZ0A 3LCGA 1VYRA 3SGUA 4UXDA 3DH7A 3UPWA 3S9YA 4Y9AA 3UYCA 4LUJA 1IXOA 1W54A 1CX9A 3LV6A 1SO6A 1OK4A 4DPQA 3DFSA 1HUVA 1LDCA 3W88A 1FQ0A 4FNQA 1LM1A 3P5ZA 4LRTA 1W5PA 3ABRA 2G5WA 1FDZA 5K2ZA 4RZ4A 5KZEA 5CZSA 4IXHA 2LLEA 3GIYA 1PHWA 2DP3A 3W2NA 4E2DA 4MIMA 2Y62A 1DQWA 3W07A 1Z48A 3VE9A 4BWLA 1NF7A 1FUYA 1YTEA 4HNNA 2QCLA 4FB7A 4PH6A 3BARA 1JQVA 1FWTA 2A7RA 5LNWA 1YTKA 4OBTA 3STCA 2GOUA 1RZMA 3EX4A 3EKZA 3USBA 3M5YA 3U2OA 1MEIA 2QKFA 4Z1CA 3KRSA 3LXCA 1LBMA 1GVSA 2J9YA 1YTDA 4IX0A 2Y6ZA 5KZMA 3G18A 2H3DA 2QAFA 5LNRA 4ALDA 1AK5A 1OK6A 3DFNA 3PR2A 3TSDA 1ZENA 3QJAA 3ANYA 1N7KA 3P7YA 1W8SA 2E68A 2J27A 2FPYA 3GKFA 3HIJA 1Q45A 3WK3A 2WO5A 2QCFA 1EB3A 5AYYA 2EHHA 2G96A 1MXSA 1R30A 3PC0A 3T78A 4D2JA 4M7SA 1CI1A 1NF0A 2E1DA 1I2OA 2ZFAA 3BW3A 2QDGA 1YXDA 3O16A 2J9ZA 5LNUA 1MEHA 3EX1A 1RVGA 1TPB1 3N19B 4A22A 5H2ZA 5IBXA 4ICNA 3THAA 3GB6A 5CSRA 3NVTA 2E5DA 3VNDA 1SSDA 3C2RA 3S5YA 4O13A 1EUNA 2HMCA 4IMFA 3O63A 3I65A 3NL5A 4M19A 3SR7A 3FJLA 3M5ZA 3G1VA 4IMDA 4POCA 1S3HA 3GXNA 2FJKA 4RR4A 4O4VA 3HQ1A 2VFIA 4ZQPA 1WX0A 3JRKA 2B4GA 3GAYA 1AMKA 3PY2A 1GVOA 4IMGA 4ORIA 4LOCA 4N9EA 3V1PA 2CLEA 2QCDA 1ZJIA 2R14A 4GUFA 2A7PA 3M6YA 1JJKA 3L21A 3L0KA 4LVBA 4Q32A 3H53A 1THFD 4NXKA 1KFCA 1Q3NA 4NUWA 5CPOA 4QNEA 1FDJA 3G22A 3UZJA 3W1XA 4YCOA 3PG9A 1H1ZA 1YDNA 4CNPA 3PB0A 4AEOA 4R7JA 3W72A 1ZALA 4XWUA 3WJSA 3NXFA 2ZRUA 2NX3A 3W70A 2DZPA 4Z0JA 1Y0EA 1O95A 4WZHA 2CLOA 3P62A 3QMRA 4RK8A 2GQ8A 3R12A 3TMQA 3W1NA 4MYXA 2CZFA 4BI7A 2UV8G 2F84A 4WX2A 3QW4B 3AJXA 1KFJA 2ZQ0A 3LRMA 3QC3A 1LORA 3P67A 5DN1A 3LB0A 3ATYA 3OEXA 3P61A 1TTQA 2ZZ1A 1H5YA 1SZFA 3NQ7A 4Y90A 2G95A 4OHQA 1OFRA 3EXTA 3N3MA 2GQ9A 4MY9A 1AL7A 1C29A 3FKRA 2H6RA 3VKJA 5LGXA 4IQLA 4DBEA 4UTWA 3HPXA 1QAPA 3CQ0A 4K6AA 4LW7A 4ZQMA 1I45A 1KLZA 4ZQCA 3W7OA 1XDMA 3LTPA 4K37A 4M6QA 4EOUA 2TSYA 1XBZA 3TFXA 5FEWA 4JTLA 2BWGA 3GR7A 2E6AA 1PIIA 3DKLA 5K4ZA 1OYAA 1PS9A 5L9FA 3BG3A 2RKXA 3NOEA 1TRIA 5TQLA 4LC8A 3HO8A 3R8RA 4A2SA 1ZNNA 4UR7A 3HB9A 1CW2A 5E1QA 3FS2A 1RQEA 3S1XA 3RMJA 2VFDA 5FF3A 1WXJA 2GQAA 2X2GA 2BTMA 3L67A 1JCNA 1IF2A 5CPMA 5LKYA 1W5NA 2ALDA 3IVTA 4XUGA 5FF4A 4HT3A 4WOQA 1VLIA 3I7RA 3V75A 2YYUA 3NQMA 4UTLA 3R5EA 4AF0A 2IQTA 2F7FA 5LNVA 5MHBA 2O7SA 3BW4A 3ABQA 1TCDA 4Y8FA 4JD4A 2C13A 3LGEA 2Z1BA 3G1SA 2FTPA 4HIBA 1OVDA 3INPA 3BO9A 1KV5A 4UFJA 5DXXA 2OX1A 2DZWA 4DO5A 2VFFA 2VEMA 1QMLA 2VFHA 3DKJA 3ABSA 3PSVA 3OIXA 1BTMA 4MKNA 2OJPA 1R46A 3WK0A 4BR1A 1SW3A 5C5YA 3TW6A 1JUEA 1P5BA 1M5WA 3W1TA 1G4SA 1OYBA 5AFDA 1I2NA 4JGDA 1XBXA 5F4WA 4A2RA 3G1XA 3OBKA 5F2GA 3BGJA 2B7PA 5TBOA 1G4EA 3S1WA 3NA8A 2A0NA 4G1KA 5K3VA 3QEZA 1OF8A 4ADSA 1F74A 5D2VA 4NNCA 4XTIA 3H55A 3NL6A 1E51A 4WY0B 3G0XA 2WNNA 3NM1A 1M7PA 1HTIA 2H90A 1OFPA 2QCCA 3ZWTA 3GDTA 5LHEA 3KX6A 4LU0A 4UFHA 1RQBA 2QJGA 4K36A 4I9AA 4FEZA 4AH7A 4IOTA 1XCFA 1TSIA 2DZSA 1TPH1 3N9RA 5KZDA 3SSJA 3B0PA 1ME7A 4LV9A 1LYXA 3NPWA 4GUGA 1LRNA 3P60A 3M0ZA 4JTFA 2A2IA 1D9EA 4I7UA 1KM0A 3C2OA 2V8ZA 3EWYA 3UY7A 3F03K 4JTIA 1VHNA 1XUUA 5AB3A 2CLFA 2V5LA 3QMSA 3W7KA 3P80A 3LERA 1DOSA 2YXGA 4U4MA 1NVMA 2NWRA 3KVKA 2WV8A 1Q6LA 4UNKA 2E5BA 3UXAA 1DQXA 5AHIA 3B03A 5I3KA 1GG1A 4O53A 4UTTC 4HN4A 2YZRA 4QAIA 3UY8A 3TAKA 1JR1A 4UTIA 4BK9A 3BG5A 5F2LA 1QPNA 4RLIA 2QEZA 1H1YA 4LVDA 2DU2A 4E0CA 3TIMA 2VEPA 3TJXA 3F4NA 1K3UA 2X16A 3GDMA 4NZJA 3W86A 1B4KA 1JQXA 4EF8A 1F6KA 4K8HA 5AC6A 3LHTA 1DHPA 4LTSA 1LZOA 2ZA2A 1A5BA 1DVJA 4BFAA 4WXZA 1XKYA 4FIRA 3NO5A 4LS2A 4UIOA 1K8YA 5HINA 2JKEA 2NV1A 3W7PA 2E09A 1KFLA 4Z1DA 5DCDA 1U83A 3A23A 3HGRA 5C55A 4ORMA 5G1TA 5HR7A 3M5VA 2AAMA 2BSLA 1W37A 2W0UA 5LSMA 1SZGA 3SIZA 5K4XA 3DXIA 2B7OA 3NYZA 3QW3A 2CLKA 3L2IA 4O57A 3I7SA 3N2XA 3LTSA 3GXTA 4K39A 2GJNA 4IUOA 4U28A 1XBYA 4CCCA 1A5CA 5LGZA 3HGOA 1QO5A 4JIQA 3TH6A 1J2WA 3CU2A 4JY8A 3TXZA 4OGZA 3LOTA 4DF1A 3MHGA 3W85A 1WYIA 3O06A 4X3ZA 2QUUA 3UD6A 1FWNA 5C2XA 4ADTA 1GVQA 3MI2A 1JCXA 2Q8ZA 3QYQA 2A4AA 2X1UA 3WJZA 1TPUA 2Q8LA 1FWRA 3MYPA 3TSBA 4DELA 3RU6A 3CWOX 2WSYA 2ZCGA 4NXSA 4TR9A 4QSHA 1ML1A 3QRHA 5D02A 1VH7A 1SUXA 2ABBA 3L5LA 2TMDA 1ALDA 3NQGA 3P8JA 1YPFA 3STEA 2CLIA 1TQJA 2QCNA 2Y61A 2YDAA 6TIMA 2PURA 3BG9A 4I7VA 5D09A 5KMYA 1S5TA 2YR1A 2R91A 2ZTJA 3NAVA 4P2VA 4AWTA 1OX4A 4ZL1A 1MEWA 1OHLA 5T26A 1QPOA 4N6EA 4UR8A 3N73A 1RR2A 2V2DA 3H54A 4H6KA 4O17A 2VC6A 3TQVA 2NX1A 3CB8A 4JYDA 5DY2A 1C9DA 3MP4A 1LOQA 1EX5A 4JX4A 3W7IA 1RPXA 1QDSA 3OVQA 1KTBA 4DPPA 1QOQA 2NZLA 3W1RA 4NJHA 4JX6A 5G4EA 1OFOA 2Y88A 1I8JA 1ICSA 4GUJA 2WJZA 4O12A 1GZGA 5C54A 3THQA 1YLVA 3L9CA 3S1UA 1PVNA 3N2MA 3W7HA 2OMAA 3TV8A 1ICPA 4LRSA 4L4LA 3F4WA 1LLZA 3PUEA 4DXVA 5LHFA 3FEMA 4EIVA 2CLMA 1OFQA 1WA3A 2V82A 3CPRA 1ZCOA 2C16A 4O15A 4LY8A 1XFBA 1VHCA 1Q6RA 3TCEA 5GVJA 3QPYA 1PL9A 2ZZ4A 4UFLA 3L65A 5BNKA 1K8ZA 1FCQA 5G1YA 1SZEA 5AYZA 4BI6A 4CCEA 4K8EA 3PAJA 3FIGA 4UTHA 2V0TA 3NR0A 1QCWA 2QUVA 4AXKA 1FCVA 5EL1A 2CZEA 1SQ7A 3PVFA 5FF0A 2NUWA 3DU0A 3K30A 3MW7A 3GNNA 3S5ZA 3C8FA 1LOLA 1DORA 1LTDA 3HF3A 4FXSA 1VYPX 5E0KA 1G6CA 1TTPA 4PA8A 1ZAHA 1IIGA 3NPXA 2Y85A 4MJZA 4DF0A 2V2CA 5D03A 2ZZ3A 3RNDA 1GYNA 1XBVA 1VCGA 4FNSA 2VKZG 3KRUA 1SR9A 2RDTA 2Y63A 3BW2A 2A21A 2V5BA 1FBAA 4HSNA 1K03A 3KOFA 3LLDA 3RFAA 2P0OA 3Q58A 3KHJA 3T55A 2PRMA 3W6YA 3AO0A 4IWWA 3W75A 3IVSA 4FX7A 3EWXA 1HFBA 1JULA 3CIXA 3IIPA 5F2MA 3S8HA 3TAOA 3SGZA 2ZRZA 1OX4B 3W7MA 4RCXA 2P10A 3TNOA 4TMBA 4JTHA 3NQCA 3NGJA 4NX5A 4RZ5A 3BVJA 5BMXA 4OT7A 4YWIA 5F1UA 2FB2A 3DHFA 3N34A 1Q6QA 1LOSA 4O8RA 1OX6A 3NQEA 1QO2A 2ZRXA 3PULA 4ZMGA 4HNUA 1JUBA 3HBLA 4LVAA 1L9WA 5KTLA 4IMEA 1SFLA 4JTGA 3HG2A 4FNTA 4ZZ9A 3CHVA 3U8GA 4DQWA 4HPJA 3CLMA 3GKAA 2NWSA 2ATSA 3LRLA 2OT1A 2VEIA 1R2SA 1FCBA 1OYCA 2FB3A 3IGUA 3G1HA 2CZDA 3VFLA 4Q33A 3CM4A 4MLRA 5LNSA 3L0NA 3PSWA 5TIMA 3R13A 2GUUA 4UFIA 4KFNA 1TRDA 3B8DA 2YW4A 2Y70A 2YGYA 1XI3A 3B05A 2CLHA 5F4SA 1OFDA 3A5FA 4N4PA 3VE7A 4Q4KA 3U6WA 2A6LA 4LVGA 1GTEA 3CWNA 5KITA 3ZWSA 4ZVJA 3M47A 4PFMA 3EX3A 1IXQA 5EBUA 5K7JA 3LRKA 5D2WA 4M7TA 1LLWA 3FA5A 3TXVA 4CNNA 1B3OA 2BXVA 3IRDA 3HG4A 4HNVA 5HR6A 4TIMA 4UTKA 3E0IA 5D33A 2ISWA 1BEUA 3ZFHA 4AF0B 4XQ6A 1KLYA 4JTTA 2QCDB 5HMSA 1HG3A 3GYEA 3C3NA 1KM5A 3NQFA 3TFCA 1GPWA 4BI5A 4N2YA 3SW6A 5D37A 1W5MA 3PG8A 1XXXA 1YYAA 1DJNA 1FXPA 5LZLA 3WK2A 4GE8A 2ZZ2A 2Y7EA 2ABAA 3D0CA 4O28A 4M6VA 5AHEA 3W3OA 3TE9A 3PF3A 3A9IA 3W7RA 3NPVA 1BKSA 1GT8A 1JCMP 4AHQA 2EKCA 2A6NA 2X30A 4N02A 3CIWA 1OABA 4HPXA 5HUPA 1W56A 2NV2A 1WOBA 3IIVA 4AVFA 5SWUA 1U5JA 1P1XA 3TSMA 3A21A 5AHLA 4GBUA 1UASA 3W2UA 3DFTA 1JCYA 4MFEA 3M1ZA 3SECA 1I2QA 3LHVA 2I9EA 3GVGA 2C0AA 3RLUA 4FNPA 3E9AA 3ELFA 1VQTA 3KFTA 1N55A 4JTUA 3PUDA 2YCEA 5EA9A 3JR2A 5AC8A 4KFPA 4UC5A 2VXNA 2OCZA 1A5AA 1UCWA 3W2LA 3HG5A 1KBIA 1ONRA 1EUAA 2Y7FA 1TO3A 2FPVA 4MJMA 3W7NA 1G4PA 1LCOA 3PWAA 1VGAA 4N9CA 4UFKA 4YLWA 2DZXA 3GDKA 5AHMA 1IIHA 2Y89A 2DZTA 4YMZA 2VELA 3BLIA 4TO8A 1L6SA 4LUIA 4ADUA 2WNZA 4UMBA 4S2CA 4GWEA 1F5ZA 5EY5A 1TIMA 5CZTA 1DBTA 1P0NA 2YSWA 1KFBA 5K9DA 2V30A 3NQVA 1NSJA 2GPTA 4JNMA 4HSOA 1H50A 1PCKA 3L5MA 5BMWA 3BK0A 2E77A 3SJ3A 5L6UA 2HS8A 1F76A 4JX5A 1VS1A 3Q37A 3S1VA 1EP3A 3EXSA 1I2RA 2EAWA 3ATZA 4AHPA 2VENA 3QF0A 1TJPA 2B0MA 5HNRA 2CFFA 3W2JA 4GRSA 4R53A 1T8XA 4LC6A 2I14A 4O1CA 1GG0A 1R47A 4FNRA 1A5SA 2J24A 4HNTA 1L2UA 3MMTA 3LCXA 3W2MA 2GVJA 5F2IA 1A50A 3W7GA 4H3DA 3G1DA 4C1KA 3G8RA 2W6RA 2C19A 2PC4A 1EP2A 1T96A 3M41A 3W1PA 6ALDA 4O18A 4I7WA 1SO4A 4O1AA 4DO4A 4O50A 3UPBA 3B04A 2X1SA 3T44A 1A53A 1W1ZA 3W71A 1JCJA 1O4UA 5AYXA 3UNDA 4PC8A 5D2TA 3DENA 1F6PA 4B5NA 3P81A 3MBDA 3GDRA 4O19A 3TMLA 3W1LA 3S5NA 4N9BA 1NAL1 2EF9A 1TQXA 5CPLA 5G5IA 5FEXA 1GVRA 1WDWA 1TTIA 3I7QA 5F4XA 3MI6A 2B7QA 3IIOA 4OQVA 1VCFA 1JVNA 5I3GA 5AN7A 8TIMA 4JTSA 4E38A 2PE4A 1KFKA 3P84A 3QZEA 2RH9A 2TYSA 4LWWA 4MFDA 1KM4A 3UWVA 1SPQA 4RKAA 4PL1A 3LV5A 2FQIA 3I6RA 1TB3A 2ATMA 4O0KA 4O1BA 3LCFA 3BV4A 2EPHA 3TA6A 1JRBA 1H7WA 1O60A 3TKFA 3LCHA 4JXCA 3G0UA 2CW6A 4JS3A 4O54A 3GX9A 1OFAA 2V9DA 2ZRVA 4MZ8A 3N9SA 4UFMA 3E12A 5DCEA 3PM6A 4JTJA 3W83A 4YXGA 3HG3A 3MI3A 2QJIA 3LCIA 3LDVA 4GFSA 4Y96A 4WY0A 2RDWA 3GLCA 4DF2A 2QCGA 1YPIA 3WJYA 3NQDA 3W22A 4FNUA 4QISA 2HS6A 4UTMA 4NJGA 1X1ZA 1SZNA 1MZHA 3C0JA 2E6YA 3UZ5A 2AQWA 1X6UA 3LX9A 1ZAJA 3UWQA 1QNVA 5G2HA 5IBXC 4UTJA 1PCWA 4J9JA 4MPQA 3NEVA 4O1DA 1W3NA 1H60A 5D30A 5HQEA 4S2BA 4TX9A 3QFEA 2J6XA 3FOKA 2RDUA 4NVTA 1MSSA 5BRBA 2I1OA 2WOQA 4EWND 3A5VA 3HOJA 4N4QA 2TRSA 1VCVA 1X1OA 3NZ1A 3PUOA 1WOAA 3MBFA 5F1VA 3DBPA 3DZ1A 2ZZ6A 4JICA 4AHOA 4JY9A 3TUUA 3W73A 3IEBA 3O6CA 3TK7A 4NJJA 4S1FA 2WNQA 3UWZA 1FX6A 4IJBA 2WPBA 4X2RA 4K7VA 4A3UA 5A8GA 5HULA 3SZ8A 3DI0A 3LCWA 3KVJA 4OWGA 3GZ3A 4NU7A 1GWJA 1LP6A 3LI0A 1H7XA 3KRZA 3CT7A 4GUIA 5HJLA 3WFAA 4CQ8A 1IXPA 3EB2A 4WUIA 2GJLA 3DFPA 1QPQA 4XZ9A 3ABOA 4IGHA 2JK2A 4DO6A 1X8FA 1TPVA 1QR7A 1W3TA 3IGXA 1K02A 4NQ1A 2ZZ5A 1F05A 2BX7A 1VRDA 4Y6GA 2FFCA 3YPIA 4OV9A 1NFBA 1WQ5A 3PBYA 4ZQRA 1H7PA 4MYAA 3IV3A 2FLIA 2RHGA 3CEUA 3KVLA 2H8ZA 1GJPA 1AW5A 1D3GA 1ZAIA 2QCMA 1EPXA 2C1HA 3EWWA 3MP3A 1J4EA 2VFEA 1O5XA 3O1NA 2Z2UA 5KSWA 1YDOA 1S5WA 4A21A 3JS3A 1TPWA 3G3DA 4UNLA 4X22A 1YXCA 4N6FA 1IGSA 2WSRA 3EXRA 3EWUA 5G2WA 3NL2A 5HWJA 2VEKA 5AHFA 4PCFA 1X7FA 4QNWA 3W74A 1HL2A 1ME9A 4UTTA 4JTEA 5I3IA 3IIZA 1WAUA 5HWMA 5AC7A 4PEKA 2FIQA 3FKKA 3B4UA 2YX0A 4MZ1A 2KZHA 1AW2A 1YDVA 1Z41A 4MY8A 4QJ1A 3GNDA 4W9TA 3L68A 2E5CA 2PCQA 2EGZA 5D32A 3EWBX 1T0OA 4HKPA 2ZBTA 2Q3OA 3C56A 3LXAA 4FX8A 5AOUA 4JDYA 4A29A 3W7JA 3LXBA 1GOXA 4LT9A 4YL2A 3LHUA 5FF2A 3KXQA 1UUOA 2ISVA 3R2GA 3TX9A 4L4MA 3M16A 4M6PA 1H7OA 1OFEA 5BOOA 3SY5A 1YXYA 4GUHA 1B57A 1H7RA 2PRHA 3PB2A 4WXYA 2WKJA 3DGRA 1JCLA 2C18A 3FFSA 1F7BA 1MO0A 4XBKA 2DJXA 2W79A 3E02A 2C14A 4C1LA 3C2VA 2O7QA 3ZS4A 4FIQA 3G3MA 3KVMA 3STFA 2V2HA 1KFEA 3GXPA 3E96A 5FESA 4WOZA 2E6FA 3M44A 3FLUA 1K8XA 3G24A 1XDLA 1R2RA 4EF9A 1EEPA 3MUXA 4LVFA 2ZRWA 3O8AA 1DJQA 1GQNA 5U4NA 2A1YA 1FCUA 1SW7A 4FXRA 1ZHAA 4AWSA 2WSQA 1KTNA 2QJHA 3LBMA 3DHDA 3O05A 1W5QA 2QR6A 1L6WA 1BWKA 2WQPA 3UWUA 2X1TA 1BWLA 1SO3A 1TV5A 2YFOA 4MUZA 4NNAA 1SW0A 1VYSX 4JR5A 1F2JA 1WBJA 2DZVA 2NUYA 3BGGA 4GNJA 4HHPA 5EYWA 3TROA 2QDHA 1H7NA 1VR6A 1HO4A 2GVGA 4O10A 4JYEA 2TPSA 3L5AA 1Z42A 5IM51 1TPDA 2H3BA 3L66A 2A85A 3LBCA 1EP1A 2RFGA 1GVFA 4OU1A 4Z1AA 1GEQA 3NNTA 1P4CA 5DXYA 3DAQA 4WD0A 1OG0A 3LTYA 3W7DA 4XBSA 3C2FA 4AWUA 5EPDA 3GR8A 1QOPA 4NJKA 4BF9A 4MOZA 1F73A 1H63A 3W7LA 1HO1A 4QM1A 1OFBA 2QCHA 1AW1A 5FF7A 1KA9F 3QSRA 2XN2A 1WBHA 1W3IA 2OT0A 1FXQA 3G1FA 3LLFA 3PBVA 4XKYA 3QH2A 2C6QA 1I2PA 3P5YA 4X9SA 5BW6A 1W0MA 3HMJG 4K38A 2ZZ7A 4N9DA 2QAPA 4NT0A 3TQKA 3BPWA 1KBJA 4RZ6A 1EIXA 2R94A 3RK8A 3C61A 4AAJA 4BWLC 4GC4A 2ZA3A 3IVUA 1TV7A 5D2XA 1SU5A 2GVLA 2DORA 5I3HA 2JKPA 3QPZA 4UMAA 5HWNA 4IMCA 3VCRA 1O5KA 3FYPA 3QQ0A 4UTUA 5E93A 3EX2A 1QPRA 2XN1A 4O11A 3W23A 1EA0A 4R33A 4K7YA 1TV8A 3B0UX 3A22A 1PHQA 3OHIA 4KFOA 2A7NA 4RXGA 1ZY9A 1V5XA 5DBUA 5CPNA 1DKWA 2PRLA 2YW3A 5DBTA 1O94A 1C8VA 2HTMA 3O07A 3QMTA 3NM3A 2VOMA 1KM1A 1H51A 4JDBA 3CC1A 2P1FA 1RV8A 3GK0A 3FJ6A 4WJEA 3EX6A 5I3JA 4IX2A 2NUXA 4CQAA 1B9BA 3OVRA 1Q6OA 4LS0A 4JEQA 3WJXA 3Q94A 4UUIA 3TC7A 2JKAA 3PBUA 2Y7GA 2R8WA 1EWEA 3SFKA 2YYTA 3B06A 3FYOA 4NZFA 4ZQOA 1K7EA 3A24A
chains in the Genus database with same CATH superfamily
1Q4NX 5CKSA 4D9PA 2D1ZA 3NSXA 3UCDA 3WKZA 1W1IE 4ONVA 5H8UA 1JUKA 3O3RA 3LQGA 3VI2A 5LIWX 3W24A 1ME8A 4Q3MA 3LM7A 1R3QA 4HCLA 1FY6A 3V16A 3W28A 4HBKA 4QXIA 2ESCA 2XPKA 5A2CA 1T40A 1OB0A 1OINA 3C0QA 1EEXA 3VMOA 4QIUA 5I03A 4W8AA 2TODA 3BLKA 3HGSA 2QUNA 4AMCA 1NM9A 4NNBA 1VC4A 4Q7IA 4FX6M 1LLOA 1CXHA 4XKYB 3RLHA 3AXKA 2CLLA 1GQIA 3Q4DA 4L7ZA 3BJFA 3WMSA 4AXNA 1G0CA 1WV2A 2XIOA 4R7WA 4P7LA 3W1AA 3WCZA 1B1YA 1TJ0A 3BLFA 4IPIA 1SSGA 4IG2A 4PODA 2FDSA 2Y7DA 3B9OA 3G0SA 3IIXA 3TLQA 1XUZA 4J3TA 1TFVA 1OT1A 2DQWA 4XD6A 1KB3A 4K68A 2RJHA 1V7YA 2CWXA 2V81A 3ORWA 1QI3A 2BXZA 1ZRQA 4Z2HA 1UR3M 5XIMA 5G2IA 4Y9NA 1GVYA 4NZ5A 2WHMA 1E43A 3W84A 5I3FA 2XFWA 3MHFA 4E2BA 2FMNA 4UQBA 5HOSA 1LROA 4GNKB 3IJ6A 2HPIA 3F1QA 4PULA 3QQ1A 4G5DA 4MVAA 3TN4A 3MCMA 1LRQA 1B9ZA 1M6JA 5H91A 2JGQA 1CLKA 4L5ZA 3W76A 1TMHA 4R3UA 3QBUA 2C15A 2INZA 3AICA 4KWWA 1UBSA 1LQAA 3DN5A 1WKFA 4HHLA 2C7FA 4U3CA 4D8LA 4I3GA 4MUPA 4WCJA 5KEZA 3KOYA 4BQ3A 2DZAA 3UXLA 3C2EA 4XZMX 4NJIA 2GFTA 1HP4A 3OG3A 3AU6A 3W6LA 3EZ4A 1J12A 4GXMA 1S5VA 3NDZA 3AISA 4C7DA 2Y4SA 2I5IA 1BVWA 3NPUA 2HE5A 1VAHA 3GNOA 3PZUA 2XM2A 1G7UA 2OYMA 4AMAA 3W37A 3VAVA 3MYOA 4IJCA 3WF1A 1P0EA 1F3XA 3VOIA 3TC6A 3HPZA 1FWBC 1W2VA 1MZRA 3OTRA 4RJEA 5KINA 1TPC1 1ITCA 1DJYA 3NL3A 1KXHA 2G8ZA 4J1OA 4A8IA 2AL1A 1S5NA 1R8LA 7TIMA 2XH0A 1XM3A 2G3IA 3V7PA 7PTDA 1FKWA 3MPGA 2X42A 3UVAA 1D3HA 2E9BA 4FXJA 2PDBA 3MKVA 1I1WA 1S2UA 5IFTA 5D9NA 1T99A 1S38A 3TWAA 1V6YA 2QJJA 1NEYA 1XJBA 4Z2IA 1NOUA 1EO7A 4V1YA 4UQ9A 5J5RA 2P8BA 2JGYA 5FEPA 1KM3A 1CWYA 1OF6A 3MV01 3WJWA 1QWGA 2HROA 2OTDA 4H4IA 2BLEA 3CUGA 2ON3A 2FPTA 3MO7A 4HPGA 3PBWA 2PD9A 3VKCA 3MCOA 3LHWA 3WDQA 2Z2AA 3BCJA 3MJYA 2PDMA 1XYCA 3KDNA 1M7OA 3M7SA 2G41A 1EGZA 1XYMA 2QJNA 2V69A 4R34A 5C7HA 1GTHA 1CXEA 1KM2A 3BMVA 2OEJA 4WY0F 4CQ9A 1OJXA 2E8YA 2ZXQA 2FVLA 3SGUA 1F8MA 4R27A 3BV7A 1A5UA 3UYCA 2V63A 2DSVA 1F61A 2BVWA 1CX9A 3LV6A 3H2EA 1UG6A 1OK4A 2VZUA 3UW6A 3MB9A 4LALA 4FNQA 2BBFA 1MXDA 1MW0A 2XM1A 2I5QA 1XIHA 4RZ4A 5KZEA 3FAWA 2DQXA 4LAMA 5CZSA 4FMVA 2DP3A 3W2NA 2Y62A 1RH9A 3DG6A 2OODA 4LCSA 1FUYA 4GZEA 5HXMA 3EA1A 2JALA 1JQVA 2O56A 3BARA 4HJFA 4HMEA 4OBTA 5LYRA 4IICA 3WLHA 1E6PA 4AD0A 4C65A 4C6FA 3NZGA 3VDHA 3EKZA 3CAQA 5B80A 3L23A 3UR8A 3CV7A 3KRSA 1YTDA 1GORA 2WSKA 3HQNA 1HF6A 1RCOB 3G18A 4AIOA 4RE3A 1HZYA 2YZ5A 4X9YA 3E0VA 3P7YA 2FPYA 3V1HA 7ENLA 1KCXA 2PS2A 1IR1A 3HIJA 3VM5A 1JF6A 5AYYA 2HRWA 4XB3A 4KS0A 1CI1A 4HZ7A 4KQNA 1NF0A 1CYGA 4ZB2A 2QDGA 4PUNA 4P7NA 1YXDA 1QK2A 2J9ZA 5BYWA 2PTZA 3DGBA 4XZLX 2QYGA 2QT3A 3VFCA 5H2ZA 5IBXA 3H21A 3NVTA 1X98A 4H9MA 3S5YA 1NOFA 1Q6DA 3OLGA 1EUNA 3K8MA 3O63A 1KKRA 3SR7A 1VB9A 1GNXA 4AIEA 1UR1A 4IMDA 1EDTA 4O4VA 3SURA 3GR4A 4HNLA 4N9EA 3EWDA 2QCDA 2A7PA 4QQUA 5FJPA 3H2NA 4AQLA 1Q3NA 4NUWA 2VRKA 4GLEA 1W6TA 1FDJA 3G22A 4HSHA 2PDGA 3PG9A 1YDNA 4B5VA 1XLCA 3M0YA 2VI0A 1OC5A 5HNTA 4XWUA 1Q6GA 1EC9A 2DZPA 3UJEA 2WVTA 2A3CA 1UZDA 1MWOA 2PDNA 3W1NA 2XFYA 2CZFA 3AJXA 1EDQA 3P67A 1V0MA 3LB0A 3ATYA 2ZZ1A 1AQ0A 3EA2A 4Y90A 2PDQA 3N12A 3TJIA 1C29A 3FKRA 1S46A 1AQFA 2JQXA 4UTWA 3W02A 2DSZA 2ZE3A 4BEQA 2VNCA 1VFUA 3CQ0A 1KWGA 4WHBA 1I45A 5FJOA 1KLZA 4ZQCA 1OIFA 1SM9A 4K37A 4JFTA 2BWGA 5K4ZA 1Q85A 4MNJA 4I90A 4A8LA 1E6XM 1NDVA 2RKXA 2CITA 4LC8A 1CLVA 4UR7A 3K1GA 3TYAA 1CW2A 2DUAA 5E1QA 1K4GA 1HGYA 1RQEA 3S1XA 4GINA 1DHKA 5CAHA 5FF3A 4LQ1A 3NJ3A 2Y8KA 2ZUVA 1JCNA 3DEQA 1IF2A 1DIOA 5LKYA 2D2OA 5FF4A 1JFHA 3NURA 4BQ4A 5I5RA 4ZENA 1VLIA 1UZ1A 2YYUA 3BZGA 1BQCA 4F0SA 3VXGA 5DMNA 4U33A 3UESA 4WDXA 4ZTXA 5LNVA 2R9RA 1TCDA 1W1PA 1TELA 1XLEA 3ABQA 4JD4A 3RO6A 2Z1BA 3INPA 1JAKA 2YXXA 3TYDA 1L8NA 1I6NA 4P7OA 4CQDA 2ZKMX 5FACA 2VFFA 3E3HA 1QMLA 2YL5A 3DKJA 3GU2A 2HBVA 3UZZA 2D2GA 3OIXA 1BTMA 1QU4A 2OJPA 5DFAA 1D7KA 4BR1A 4C90A 4NZ4A 1OYBA 2AGTA 5D9OA 3ZJ8A 2ZX9A 2PWEA 4JGDA 1XBXA 2VUYA 2ZUNA 5IOBA 4GXPA 4D6IA 4QS6A 3BGJA 1SMDA 4G1KA 3WD3A 4ADSA 4F9JA 5D2VA 4XTIA 2ACRA 5HMDA 3VIHA 3NM1A 2H90A 1A4MA 2QCCA 3JVAA 1GZ1A 4LU0A 4JFUA 4IISA 4F0RA 1V6VA 2WK2A 3UERA 4UR9A 1XCFA 2DZSA 4AYGA 1O12A 1ME7A 2PWUA 4GYPC 2BVDA 2X0SA 3WNNA 4J40A 4JTFA 1JCTA 1V3HA 2A2IA 2FJUB 2AAAA 2J7HA 4MHBA 5DQPA 2PD5A 2WZHA 3C2OA 3VD3A 2V8ZA 1EQPA 1KRCC 2ZX7A 3UY7A 1XUUA 1FWIC 2NVAA 5AB3A 2CLFA 3QMSA 2J77A 4DJEA 1X8CA 2X8RA 3KVKA 1WKYA 5GNZA 4QGCA 4NI8A 5AHIA 3UG8A 4O53A 2PA6A 3C2YA 2YZRA 3KP0A 1JR1A 4RE0A 4UTIA 1EHAA 3E1F1 1QPNA 2CESA 4QEHA 4RLIA 2V68A 4LVDA 3M0JA 1WE5A 3F4NA 2PDXA 5HK4A 4QLJA 5AC5A 5KZ6A 4WDTA 4EF8A 4Q4RA 3QHNA 4XAFA 2WWCA 2JF6A 4UOQA 3BH4A 2F2HA 1LZOA 3MSYA 1BSLA 1A5BA 4REQA 4KPLA 1RJPA 3K4WA 1KO0A 4IPPA 2OOGA 3CZJA 2O9TA 3NO5A 4LS2A 4UCFA 4ACZA 4UIOA 1L0PA 3T0TA 1QJWA 2YA2A 3IGHX 2NV1A 2E09A 1OGSA 3L4YA 1PKYA 1KFLA 3XINA 2VR4A 1TV3A 2BSLA 1Y8BA 4W5UA 3SIZA 5K4XA 2B7OA 3NYZA 4GNVA 2VUNA 3ITYA 3L2IA 3TYZA 4O57A 2GGIA 2OFJA 3O2LA 5CC3A 1GONA 2PB1A 1A5CA 3ARSA 4JIQA 1JDDA 1OCQA 1MQRA 3EOSA 3BAKA 1J2WA 4JY8A 1GJWA 1P6CA 3S1GA 1EC7A 2Z00A 4CU7A 3WZ0E 1WYIA 3O06A 4MB3A 4V28A 1JXKA 5FL1A 1GVQA 2Q8ZA 3QYQA 3WJZA 3AZSA 3N04A 5I09A 3TSBA 3VYLA 4DELA 1ML1A 3QRHA 4RW3A 1VH7A 1SUXA 3JW7A 3H6OA 2TMDA 3W25A 1YNQA 3RYSA 4H2HA 2IQDA 1F3EA 2YDAA 2VZSA 2PURA 5LXXA 3W53A 3BG9A 4LBSA 3CLWA 5KMYA 2FZMA 1IR2A 3GG1A 3CV1A 4AWTA 4BZYA 1OHLA 1QI5A 5ABGA 3BSHA 1RR2A 3H54A 4H6KA 3H7RA 1C9DA 4R9XA 3T42A 1EX5A 4DY1A 4DYEA 2WMHA 1QDSA 3OYZA 4GVIA 2NZLA 4C5ZA 2VDGA 2D20A 4WGHA 3VOJA 3UZXA 2QLYA 1NH6A 4JX6A 1OC7A 1WDDA 2HXTA 1I8JA 5CG0A 1VFOA 1ICSA 2JFEX 3M0XA 3VGGA 2WCSA 3FN9A 3ALGA 5C54A 3THQA 3S1UA 3AOFA 2F9RA 1V3JA 3S2MA 3N2MA 3KS5A 3IUHA 1CGVA 1V3LA 4DXVA 5LHFA 3FEMA 2V82A 4DIAA 4S3GA 1Q6FA 3WDHA 1A0EA 1TR9A 3KL0A 5GVJA 3TJ4A 2ZZ4A 4PMDA 2PU1A 1FCQA 5AECA 2P88A 1DP0A 3GH7A 4Z2JA 4K8EA 4UTHA 1Q2SA 2PF0A 2WC3A 1TUXA 2PTWA 2NQHA 2X09A 3PVFA 5FF0A 3GU1A 2NUWA 1FA2A 4JIRA 1J18A 1TE6A 3PZMA 3TN3A 1PEZA 1ENUA 4PA8A 1ZAHA 3MDUA 2GDQA 4DF0A 1QXLA 5FL0A 3W38A 1H0IA 4Z2KA 2VKZG 5CJNA 1AODA 2RDTA 3MV11 2D0HA 3JUGA 1FFRA 1OGBA 3IUIA 1PYFA 2A21A 1OADA 4ILSA 4HSNA 2QJMA 1LQ2A 1W1A1 4L4PA 2P0OA 3BC9A 3BOLA 4NAFB 1SFTA 3R10A 1GCYA 3FNDA 4DX3A 4M51A 3VMNA 4NAEA 3IVSA 2EQDA 1A5LC 1HFBA 1JD7A 1JULA 1TWZA 4ZOCA 3LA4A 3SGZA 2WZIA 5C2GA 1YBQA 3HTWA 3W7MA 1YX1A 5DT5A 1RALA 3VNJA 4B92A 3NQCA 4YWIA 3CMFA 4UWMA 4NZCA 3AU2A 1DXEA 3WYZA 3DHFA 1H49A 1Q6QA 4O8RA 1HP5A 4GGBA 3IAPA 2AQVA 3UA3A 5LXEA 4B90A 3COTA 1QNSA 1JUBA 3FY1A 1L9WA 5EBAA 3GC5A 1X6NA 5KTLA 4WRHA 3HG2A 3CLMA 4OVXA 3GKAA 2NWSA 3AHYA 1UC4A 4LFYA 4C6JA 2OT1A 1OYCA 1IEVA 2FB3A 2Z1WA 1JI2A 1GYMA 4IL2A 3G1HA 5HATA 2CZDA 4ZOEA 1LG2A 2VX5A 5EGRA 2PC8A 3BJTA 5CH9A 3H2MA 3L0NA 1IYXA 4I9MA 1M04A 2GUUA 3LYEA 2YW4A 2YB1A 7CGTA 5C7VA 1J96A 1BLIA 2CKSA 3E38A 3CWNA 3ZWSA 4ZVJA 1EZ2A 1OWQA 1LLWA 1N8WA 1RCXB 2ZXBA 4B9YA 3IRDA 3B0XA 4HNVA 3E0IA 1MVYA 2YJQA 5DMLA 5D33A 3ZFHA 1VJSA 3LQLA 4KIRA 3ERPA 4L1XA 5HMSA 1E6QM 3WDIA 1JDCA 1HG3A 3MY9A 3C3NA 4HYWA 3NQFA 1GPWA 5I6SA 1TA3A 3SW6A 5D37A 2BVTA 1YYAA 5C2CA 1DJNA 1FXPA 4GE8A 2ZZ2A 3WLMA 2POTA 3W27A 3I4EA 4LPCA 1QI4A 5AHEA 2W27A 1BKSA 2EKCA 5IXEA 4N02A 1OABA 3GXIA 4MWAD 3AIQA 1W56A 3A3XA 4V2XA 4DI8A 1P1XA 2BHYA 4H9TA 3A21A 5AHLA 1ZGDA 1QNOA 4CEXC 4ZGYA 3W2UA 1SJAA 2XZ7A 1P6WA 1IHIA 4MFEA 3M1ZA 5HPCA 5ECUA 3REQB 2I9EA 2X0YA 4FNPA 1KWKA 1XLMA 3KFTA 1WKDA 3PUDA 3QKZA 3EDDA 3N13A 3AIVA 4QROA 4UC5A 3GTNA 4GI6A 4WIWA 2DUZA 4RDVA 1JZ2A 3WQOA 1EUAA 2Y7FA 4O1EA 3WSUA 2FPVA 4MJMA 3W7NA 3FDKA 1C93A 1G4PA 2P3ZA 1QOXA 1VGAA 2JIEA 4UFKA 1EFZA 1Q7MA 2V3EA 4HK6A 2PDIA 5AHMA 2Y89A 2DZTA 3BLIA 3DC8A 2BY2A 1WDRA 4ADUA 1QPKA 1POKA 6REQB 4UNIA 3WDPP 1KFBA 2V30A 1NTHA 2DT3A 4ZBCA 4JKLA 5TF0A 1CDGA 3SJ3A 1S2CA 3R1ZA 5L6UA 1SJBA 3WH8A 1VS1A 3H4WA 5PTDA 1ZP4A 4H7VA 1XIBA 4MMWA 4DN1A 4DJFA 2EAWA 1G1YA 3OW1A 3EPNA 4L80A 2PP1A 3ARYA 4I6KA 4GRSA 3STPA 4LC6A 2I14A 4O1CA 1GG0A 1UROA 3UEQA 3WQPA 1O1ZA 1T7LA 4IUGA 4PBEA 1S39A 4GKLA 3MMTA 4WDUA 3LCXA 3W2MA 4ATWA 2GVJA 4XO7A 4JTRA 1XIEA 3G1DA 4C1KA 1LWJA 1V08A 2GK1B 1T96A 1SO4A 4O1AA 3VDCA 2OR2A 1XLHA 1EPVA 1O4UA 2YOCA 4A4AA 1G94A 2C1GA 3SUWA 1BF6A 3A9BA 4DYKA 3GSMA 4JIIX 3MBDA 4PGLA 3TMLA 3W1LA 3S5NA 1NAL1 1VBUA 3THUA 3AHXA 2HVMA 3F4DA 1WDWA 3SN1A 4PMOA 5IDZA 3MA8A 2POZA 3FW6A 4HU0A 1BFNA 3VM7A 2XIMA 3WNOA 1GPFA 3VDBA 3OZPA 2DIKA 4HK5A 4U3AA 2QVNA 1BYBA 2TYSA 2RH9A 3RMEA 2INFA 1KM4A 1SPQA 4CVWA 4Q8OA 3EGJA 5C0QA 3I6RA 4KWUA 3WD1A 2ATMA 4O0KA 2E9LA 3LCFA 3IJ7A 1WZKA 3VVGA 2F8QA 3LGGA 1RLCL 3UGRA 4QR6A 3QR1A 2PP0A 5A6MA 3GX9A 1OFAA 2V5CA 1R87A 2IUZA 4MZ8A 1XHGA 4UFMA 2PTDA 2W91A 3IARA 5AY7A 1FP9A 3W83A 3MI3A 3OBEA 2PEVA 4GFSA 3WLKX 2RDWA 4DF2A 3TYBA 3TP4A 3O6AA 3SCUA 3B0YA 3NQDA 2ONEA 4FNUA 4JN8A 4M1RA 3AIEA 4UTMA 4IP4A 1SYTA 3VCCA 3KUMA 4NJGA 1X1ZA 1SZNA 4PRTA 1E9ZB 3C0JA 4GI4A 2E6YA 1U33A 3LX9A 1ZAJA 2YCLA 1QNVA 5IBXC 2FGBA 4G9PA 3ZO9A 4BY3A 4ZB5A 3SIMA 2OZTA 2OLAA 5RUBA 4J3UA 3CUXA 4XD4A 2J6XA 4IJRA 1MSSA 1F4HA 1PTDA 4LAOA 4Q7BA 2ANUA 1XIGA 4IQDA 4AWEA 3PUOA 1WOAA 3QV8A 3D46A 2CHNA 4AHOA 4JY9A 1E0TA 1CXIA 2G3MA 4JZ5A 4F0HA 2J62A 3UWEA 2WNQA 3UWZA 2OXNA 3K1DA 3M07A 1B0IA 4A3UA 5A6AA 2INEA 4CU8A 4US5D 4OKDA 3SZ8A 4HA3A 3DI0A 2VP8A 4XZNX 3RCMA 3VD9A 3KVJA 4GPNA 3GZ3A 1FHDA 2I16A 3GIQA 1H7XA 3BMXA 4GUIA 5HJLA 1R9XA 4CQ8A 2Q02A 4RL3A 3EBVA 4M82A 4XZ9A 1A3HA 3A6OA 3AS2A 3R0UA 1RA0A 4KESA 3WN6A 3KHDA 2FFCA 2WMGA 4GQQA 4ZQRA 3V18A 2VO5A 3RRXA 2J25A 5A8QA 1ZAIA 3MP3A 3EWWA 1L2QA 3NDYA 2WCGA 3UF9A 1TPWA 4X22A 1YXCA 1KFWA 3N18A 3RPDA 1LT7A 3TNBA 1IGSA 2WSRA 1JEZA 5AYIA 3H70A 3KOWA 3NL2A 4C5YA 2EG6A 4PCFA 4AZ6A 3W74A 1ME9A 4P5UA 1WAUA 4QTGA 3UYIA 1GOKA 5J8LA 1ISWA 3WFZA 2ASHA 1JXJA 2FIQA 4J2PA 1LUCA 1XIJA 3QOMA 4GQGA 3I6EA 1LG1A 1MXGA 4H01A 3DCPA 2VGIA 3GNDA 1WDPA 3L68A 2E5CA 2VCAA 4HCHA 5D32A 2ISFA 4LBUA 4HKPA 1TV2A 4KERA 4DJDD 2D0GA 4JDYA 3ARXA 3OA5A 1BXNA 4QE4A 1GOXA 1JDEA 2SFPA 3TX9A 3M16A 1H7OA 5BOOA 5C9WA 3THDA 1YXYA 4GUHA 4H8UA 4UZSA 2GVEA 3VX0A 4XV0A 3C8NA 1JCLA 3FFSA 3PTMA 4XBKA 4Q22A 3NQBA 2C14A 4C1LA 4C6CA 4FIQA 3KVMA 3STFA 3E96A 5FESA 1IT7A 1X38A 3RG6A 3WUFA 4GO8A 3RJYA 1IT8A 1DJQA 5U4NA 3SUVA 3V36A 4PBGA 2HVNA 3N2TA 2VEGA 4B3KA 3PWIA 1UPMB 4EPBC 1E3ZA 4AZHA 2GWNA 2ZWZA 1L6WA 1BWKA 1EKOA 3VIMA 1TV5A 4QAWA 3B9DA 4WKHA 3DOPA 3AXMA 5TD4A 2VZOA 4ZB0A 4NNAA 1SW0A 1HKJA 2NUYA 4HHPA 3L7RA 4MKVA 5EYWA 2QDHA 5EMMA 2CEQA 1DJWA 1HO4A 4GVHA 5IM51 2H3BA 1HKIA 3CUHA 2ISDA 1WCGA 3LBCA 2RFGA 4OJYA 3R43A 1JPIA 2YCIX 4DNHA 3RAOA 1OG0A 5EPDA 4H8NA 1H63A 1HJSA 4U2ZA 4J28A 1HO1A 1AW1A 1EF3A 1KA9F 4PSRA 3EOOA 3QSRA 2XN2A 1MQPA 1W3IA 3H4XA 4Z17A 3LLFA 4AY8A 4XKYA 1TWWA 1GZJA 1Q13A 1EO5A 4X9SA 1OD0A 3ANVA 1N8IA 2ZZ7A 1NWSA 2YL6A 4F2TA 3VUSA 2PDYA 3EWCA 2XGBA 3M64A 2UWFA 1HX0A 1JYXA 3H12A 1TV7A 1GW1A 2JKPA 2EXOA 1D7FA 3LS9A 5DANA 2CLPA 1BKHA 5E93A 3EX2A 2XN1A 3W23A 2YL9A 3A22A 4GC3A 1DWGM 1DKWA 1P7TB 2FYMA 4KWOA 1Z7AA 3EYPA 4J3XA 2Z7KA 3GK0A 3FJ6A 1UKOA 1TJ1A 1P43A 4LAUA 2FTYA 3OVRA 1XQLA 4LS0A 4D1JA 4UUIA 3TC7A 5AVNA 1W3HA 2JKAA 5IHRA 3VIGA 3U5UA 3OP2A 1OCJA 2CIPA 3SFKA 1VEOA 2YYTA 3B06A 1W1VA 4NZFA 1V93A 1K7EA 3EOLA 2JBMA 1ITQA 4NYUA 1W31A 2WVSA 4RV8A 3SO7A 3UGVA 4PFHA 3II1A 4KCWA 1ECEA 3CGTA 3E49A 4DBDA 1QW8A 5CSUA 3LNPA 4Q8PA 3CZLA 3PS7A 3DX5A 1XG4A 2W4XA 4X61A 4DHGA 3G8EA 3E5BA 3O15A 3QXBA 3SCSA 4TTUA 4ACZB 3AXIA 1Q65A 3SB0A 3WDRA 3UETA 4YYFA 4H83A 3PN8A 3ZVIA 1KRAC 4L56A 1NWTA 2ISSA 4PYSA 3NO1A 2J88A 3H2CA 3GBEA 3RR1A 3BAWA 4FO4A 5A6JA 4S3KA 4CU6A 3HGJA 4YVPA 3UG5A 1RD5A 4QITA 4ZTYA 1HKMA 4XIAA 6PTDA 4H6RA 3S3GA 3NQAA 3M9YA 4IIGA 1FWSA 3MANA 1W5OA 4C6KA 3W1UA 1JNDA 5REQA 2IXVA 5D2YA 5I23A 4JQ4A 2R1KA 3ZLGA 3K2GA 3BURA 4UOJA 1YW1A 3ZR4A 1NU5A 2WB5A 3ARZA 1XR2A 4IFOA 5D05A 3WF3A 4F0MA 1ICQA 3WLQA 4JTKA 4CLMA 2QF7A 3L2LA 5XIAA 1ITXA 1ZP3A 3N14A 1LBFA 2XIBA 3M7WA 2OPJA 4GI9A 1WP6A 2H8XA 5C6MA 1RQHA 4OE7A 1TWDA 5GQBA 1YIXA 4O52A 2X1RA 1UD3A 3W7EA 4O4WA 1B31A 2PSNA 3EEGA 1AL8A 3S42A 3P8IA 1E55A 5DCBA 1C8QA 3CTLA 1QW9A 5U7SA 4P61A 4MNMA 3W2KA 4MGGA 2DEPA 4Q8MA 3T0BA 3NQ2A 3LN3A 1SO5A 5BXTA 1E40A 4BHYA 1Z9AA 4FF7A 3OA3A 1L6YA 1L6GA 4MKSA 5HNNA 2YA1A 2EEXA 4ERGA 1E4MM 1UMLA 1V6UA 2PDCA 4L6DA 4O16A 3C6CA 3AIBA 3DFOA 1FWHC 3AROA 1EXBA 3AYRA 1H61A 4OV4A 3W9ZA 5ABHA 4Z0SA 4YJ5A 3VIIA 4RE2A 1E6ZA 2HISA 4QX4A 2VMFA 1Y5WA 4HMCA 4HHHA 3WH5A 4CN1A 5FEZA 4ACYA 5JBFA 3AYTA 2GSJA 1ISXA 4N0RA 1K70A 3QQWA 3QSTA 2V5JA 1QRQA 2RGMA 1DV7A 1Q63A 2RJGA 4MB5A 2PP3A 2NW0A 5HJXA 3HPSA 1JD9A 3RPTA 1P0KA 2NQ9A 1PZ2A 1IXNA 4FHAA 1FP8A 2ZICA 2NVDA 2ZA1A 5DLCA 5CJ5A 4R9OA 3GU9A 1C91A 4KKXA 4E8GA 2MNRA 1TPFA 3UWWA 2ACSA 1HNYA 3FA4A 5IFPA 1XH0A 4FI4A 2A5HA 3WEOA 2DH2A 2D22A 1G7VA 1T5AA 3AAMA 3Q2DA 2IQ0A 4AZBA 1XC4A 3Q65A 1WZLA 4MB4A 1DJXA 1B5TA 3CHFA 4CCDA 3VZXA 2Q6ZA 3L0GA 3T0CA 1PXGA 1Y5XA 4IT1A 3EPOA 3NQ6A 2IKGA 3WY1A 1HKWA 4LS1A 1OIMA 2XSBA 1XYLA 1UUMA 5G1MA 4KRUA 5CZ0A 2XN0A 3O6DA 4FS9A 4W85A 4KWVA 5GJPA 3KDOA 2CZ5A 4ZA0A 1XQKA 1PE1A 4Z08A 4JCLA 3W7QA 3GHRA 3T40A 1S2AA 1TYGA 5JIWA 3SI9A 1DE6A 1PIGA 3ECQA 3I4KA 3MTWA 3IUDA 1SFJA 3WFLA 3TQ0A 2WHLA 1W32A 3DG3A 3LCGA 1U5VA 4UXDA 3DH7A 3KTXA 3UPWA 4PTWA 2EJ1A 4LUJA 3W00A 1JZ3A 1PWLA 1H4PA 1SO6A 7A3HA 3WELA 3T8LA 1LDCA 3W88A 1FQ0A 4YTRA 3A12A 4L9XA 3P5ZA 4W7UA 1J2BA 3NO3A 3KL5A 1MMFA 4LB3A 4RUBA 5K2ZA 3LG3A 3RX3A 3HA1A 5CCZA 4S38A 2J4GA 4H19A 1Z48A 2E3ZA 1NF7A 2G50A 4HNNA 2QCLA 3EPMA 1YTKA 1W1B1 3VZZA 3WLPA 2F6XA 3STCA 2GOUA 5JBEA 3GZAA 3T6CA 3UJFA 3M5YA 3ZVHB 1MEIA 1KGUA 3OHMB 3SQLA 4Z1CA 1N82A 4F9DA 2J9YA 4HTBA 4M80A 3VPLA 1CGWA 5LNRA 2P53A 3WQ6A 1OK6A 4M8UA 4TOQA 2OKOA 2WBKA 4MJ4A 3WD4A 4YTTA 4FPSA 1W8SA 3TVAA 1R86A 2J27A 3AFBA 1Q5MA 2FHCA 5A6SA 3SADA 6ENLA 2QCFA 4LUYA 1EB3A 3T78A 2EHHA 3PC0A 3VC6A 1Y7VA 4OBRA 1CCWB 4M7SA 2VD9A 3ZSTA 3DHPA 3QY8A 1TR1A 2E1DA 1I2OA 3BW3A 1XP3A 1DTNA 3O16A 3WH7A 4GIEA 1E9IA 2OX4A 5LNUA 3CPUA 8XIAA 3EX1A 3SCVA 1NP2A 3CHCA 3NSNA 4LF1A 2Y5SA 4A22A 4HD5A 1XLJA 3GB6A 1GKQA 3BL3A 1YHTA 1UKSA 2HMCA 3DUGA 4B5WA 2PBGA 4IMFA 2VQTA 3NL5A 4M19A 3KOXA 3M5ZA 3G1VA 3ABZA 1S3HA 3GXNA 3M0HA 2FJKA 3N4FA 3ZT7A 4ZQPA 1WX0A 3GAYA 3PY2A 2EBNA 4ORIA 4F4RA 2CLEA 3P93A 2R14A 3GG8A 3WX7A 1TG7A 3L0KA 3H53A 1THFD 4PUUA 2O9RA 4QNEA 5DF0A 1YMYA 4E8DA 3PB0A 1O1HA 4R7JA 3W72A 3TYEA 3FYYA 2NX3A 4CNTA 1DEDA 3W70A 1XLLA 4RZBA 1Y0EA 2P50A 1O95A 3P62A 2GQ8A 2NT0A 3R12A 3TMQA 2J7GA 4H9YA 4BI7A 3GUWA 4REQB 8RUCA 1PX3A 1VRXA 2ZQ0A 1LORA 4GK8A 1HN1A 4LBRA 1H5YA 1SZFA 5FIPA 1D2KA 2G95A 1ECQA 3LPOA 1XLAA 3EXTA 3N3MA 4MY9A 3R58A 1GOWA 1SJDA 1NIUA 3CMGA 2X41A 3L4VA 3MC5A 4LW7A 2WMJA 3ONBA 3W7OA 2O9OA 4PEEA 4EOUA 3GXMA 1XISA 2E6AA 3SCOA 3KCJA 4QG8A 1BYCA 2J79A 3NOEA 5TQLA 4DNMA 1ZNNA 1MI3A 3RX2A 3WQGA 3RMJA 4XZBA 2BTMA 1HW6A 1UOZA 2Z26A 4X0NA 2A79A 2ALDA 4M0XA 5CEWA 4HT3A 2WNWA 1C9WA 4WOQA 3FSTA 1NY1A 2MUCA 3NQMA 3BQ6A 4ERAA 4AF0A 3A47A 2IQTA 2OSXA 2GJXA 3BW4A 2ZVIA 3KM8A 4BEUA 3LGEA 1M41A 3GTXA 3MQTA 4MSSA 3BO9A 2WCAA 2PLJA 5DXXA 2OX1A 1AA1B 5FSDC 2VEMA 3BICA 2GVYA 4JNYA 2GZXA 4KRTA 1EOKA 3GFYA 5KETA 1W2PA 5C5YA 1R38A 3TW6A 1CB7B 1P5BA 1M5WA 4W87A 1ZBWA 3W01A 1C7TA 5JXQA 3WG6A 2GJXB 3G1XA 5F2GA 1G4EA 2DSUA 4HQVA 3S1WA 1OF8A 4IHCA 1F74A 4YU1A 3VX1A 3H55A 3A64A 5A94A 3A4AA 3EDEA 1M7PA 3KRBA 4DZAA 1OFPA 4Z1YA 3GDTA 1RQBA 1QW7A 4AH7A 3LPFA 4LYRA 4IOTA 1J6OA 3UZWA 1TSIA 3N9RA 3SSJA 3VIFA 4AX6A 1VD6A 3WQ5A 3ITVA 2ZC1A 1DJGA 1M65A 2GGEA 2V6AA 2Z1XA 3F03K 3P6LA 3V35A 1HJQA 2PTXA 4HU8A 3LERA 4HB7A 1DOSA 2YXGA 1NVMA 1I9CB 2WV8A 4UNKA 3N6JA 1ZJHA 7REQA 3ITTA 5I3KA 4JL2A 4K3ZA 1BGAA 3APYA 4HN4A 3R8HA 3AZRA 3HPFA 3ARWA 3KTSA 5A8OA 3DECA 3BG5A 2Y5JA 3QOKA 3FXGA 1H1YA 1UWRA 1M01A 4E0CA 1K3UA 3GDMA 3W86A 4ZXOA 3XISA 4TX8A 4BQ2A 4A8NA 3LHTA 4XAZA 2ZA2A 1QHOA 4BFAA 4FALA 1K8YA 3RJXA 1EZWA 3TZNA 2VR2A 1DIEA 1U2YA 5HR7A 1W37A 4PMXA 2OEMA 3QW3A 5M5DA 1X97A 3N2XA 4LGXA 4Z42C 4AIBA 4CGTA 1AH3A 3GXTA 4K39A 4U28A 4CCCA 4MNLA 4FOUA 1E71M 3HGOA 1UC5A 1RJQA 1XYAA 3TH6A 1PWMA 3UG3A 2WPGA 4L9YA 3OJGA 3KE0A 4IQJA 1NWRA 4DLFA 4EK7A 2E25A 3RM8A 5MF5A 3OPSA 2QUUA 5C2XA 1IEQA 4H00A 3LMYA 2QHAA 2X1UA 1V77A 2FZ8A 1TPUA 1M7XA 3AIUA 3RU6A 1LJYA 2C8NA 4S3AA 3T2OA 1F3TA 1PDZA 2BOEX 3E0WA 2ABBA 3WQCA 2PDHA 3SUUA 3LBOA 2Q01A 3L2MA 4N42A 1S3TC 1E0UA 3STEA 5LA0A 2QCNA 6TIMA 4DWSD 2PZNA 1BSIA 5E5CA 3SCWA 4BF7A 1W9VA 4I7VA 1Y5VA 2YR1A 3NAVA 1FH8A 2WHKA 1MEWA 3AXHA 2D2HA 5T26A 1DWJM 1BQGA 2EPKX 3AHTA 1QPOA 3QHOA 5ABEA 3MKKA 1WDSA 2XVGA 4DM2A 4O17A 1X6LA 3CB8A 4LSBA 2X05A 4JYDA 5DY2A 3QN3A 3QGVA 2MANA 1RPKA 4GFIA 3H2OA 4DPPA 1VKFA 5I02A 3E2RA 3EMCA 1OFOA 4DJDC 3CQKA 2D24A 2Y88A 1SZRA 4GUJA 1CXKA 4W86A 2F2KA 2XH2A 4O12A 4NL1A 3GW0A 1GZGA 4D72A 2IKHA 4C6MA 3WH9A 2P5NA 1YLVA 2OWXA 3L9CA 1XGEA 1OCNA 2L5HA 3W7HA 2DW6A 2OMAA 5I79A 1H5VA 4D6JA 3PUEA 4TVUA 4EIVA 3CPRA 1OFQA 3APGA 5BCAA 1KRMA 4F3HA 2E67A 2C16A 1BGGA 3KLKA 3D47A 1PL9A 3L65A 5AYZA 1FHUA 1TMQA 3F4VA 2QUVA 3M0MA 3GBDA 3KBVA 3HM7A 3MO4A 1SQ7A 4PUDA 1DWAM 3QGAC 3DU0A 3K30A 2EPOA 3MW7A 1RD6A 3S5ZA 2BS9A 4FXSA 4LH8A 4WLCA 1EJRC 4IGMA 2Y85A 5D03A 2ZZ3A 4H9XA 4DUVA 3K13A 1GYNA 3UU0A 3BAYA 1SR9A 2Y63A 1S5MA 4ML4A 4C1NA 3B8SA 4QJ3B 3RHGA 3LLDA 1FHLA 3QV9A 3NZPA 1MW2A 3M0KA 3DERA 3K4DA 3EWXA 1CEOA 3CIXA 1OX4B 2PF8A 1SMAA 1C3FA 4MPKA 4CN6A 4PUMA 2ZUMA 2P10A 3TNOA 1AD4A 4JTHA 4OT7A 3OO2A 4CD4A 4NZ1A 1ZL1A 2FB2A 1S1PA 3N34A 3GNRA 1MDRA 1LOSA 1MNSA 1VEPA 2YCJA 3NQEA 2BODX 1QO2A 3CQHA 3G2GA 4LVAA 4DXKA 5HBFA 4IMAA 4FNTA 3CHVA 2J7CA 3WBAA 3O0FA 1B3ZA 3WBXA 3VGBA 2ATSA 4OOZA 2PLCA 2XWDA 1FCBA 1E1EA 3BJSA 1FWGC 3KCLA 2HBXA 4Q33A 2CBVA 4PUKA 2QUMA 4PMUA 5LNSA 1YNYA 3PSWA 4YWSA 2OYLA 3WLRA 2Y70A 2YGYA 4URIA 1Q6EA 2CLHA 4JKMA 1ODZA 3A5FA 4N4PA 3VE7A 3MU7A 1QBAA 4Q4KA 2AL2B 3AYVA 3U6WA 2J8TA 5KITA 2DW7A 2VURA 2QDEA 1B3OA 2PDFA 4GJIA 3LSBA 3IK4A 4W84A 1BTCA 1H1NA 6TAAA 3SCQA 1KM5A 3RGTA 4J5NA 2J47A 4N2YA 4MAVA 5EMJA 3WK2A 1M53A 3R6IA 3TE9A 3A9IA 3PF3A 3TN6A 1JCMP 2A6NA 2X30A 1TX2A 3CIWA 3CWHA 4ASTA 5HUPA 4WVXA 2BNJA 2DVXA 2NV2A 2WHJA 3U7BA 1WOBA 3BAXA 3GNXA 3M4HA 3U2CA 3OB8A 3B40A 5CQ1A 1UASA 1CIUA 1XG3A 3DFTA 4GIRA 5IDIA 1JCYA 3SECA 3OOQA 4EXAA 3LHVA 2A3AA 1WUFA 1UKQA 3ELFA 2WLZA 3OU8A 4JTUA 4ICCX 1DXFA 5AC8A 4KFPA 4AC1X 2WMFA 1J0IA 1A5AA 4HA1A 3W2LA 1KBIA 3BAJA 4F66A 2PGRA 2W9MA 4AZCA 2YCKX 3PWAA 4ZR8A 4U10A 4HP5A 3GDKA 3VU2A 4GZJA 3XIMA 4YMZA 4NIRA 4QS5A 3U4AA 4AD4A 1UA3A 2WNZA 4L4OA 4GWEA 3RILA 1UZHA 1EHNA 5CZTA 3VZYA 5K9DA 1NSJA 3SGGA 4CQBA 1CGTA 2BVYA 3IJLA 3PPHA 1AVAA 2V38A 1UQYA 5FSEC 1GKRA 3EXSA 3B9NA 3W82A 3PHAA 1I2RA 3ATZA 3OZYA 2VENA 4HVXA 4W7WA 4WKAA 1Q8AA 2CFFA 4B2DA 4OECA 3BOFA 1T8XA 1HJUA 5EFFA 2J66A 1PZ3A 4HU4A 4DJFC 1Q7ZA 2Q71A 1ZJAA 2PCEA 2VX4A 3GHTA 1JGIA 1K1DA 1HJWA 1JYWA 5F2IA 4V27A 3TTSA 1CGUA 3APTA 4H3DA 3B97A 3WMLA 2W6RA 3KBJA 1RBLA 4WSKA 6ALDA 4O18A 3L4TA 4KT2A 3T44A 1A53A 1W1ZA 3W71A 5AKQA 3SN0A 4UQEA 3EDKA 4A3RA 4J3VA 3DENA 3F5JA 3FSUA 4B5NA 4NKCA 2B81A 3G6LA 4W89A 3URBA 1UD6A 5CPLA 1TQXA 1WAWA 4WSHA 4LEFA 1TTIA 2E1WA 2V3DA 2B7QA 4QDPA 3IIOA 1V4YA 5B7ZA 3N6QA 4RDYA 4V33A 4IIEA 4PUEA 3GDBA 1JVNA 3BLLA 5I3GA 2Y8VA 2QMKA 4C91A 5E0CA 2PE4A 3BLPX 4UZUA 3FAXA 3F5LA 2XGIA 3C5QA 3LV5A 2FQIA 2FZ9A 3TA6A 4MB1A 3WD0A 2HE8A 1O60A 3TKFA 3LCHA 4JXCA 4ZCWA 3GQYA 1BRLA 3W4RA 4RDZA 4DUOA 3N9SA 3PM6A 4YXGA 4KCVA 4PMVA 2QJIA 4Y96A 5BZAA 1Q66A 3TC3A 2ICSA 1YPIA 2V5DA 3EMZA 4HN8A 2BY0A 1V6XA 2HS6A 4AC7C 1MZHA 2ZX6A 1JF5A 4H9UA 4YTQA 4U2YA 3UWQA 3M46A 1K9FA 4DI9A 1FRBA 2VOTA 4QJ4B 4TTGA 4QJ5B 4MPQA 2DT0A 3U2ZA 3NEVA 1W3NA 5D30A 4JTDA 4TX9A 3UPMA 3O7UA 2I1OA 5BWAA 4G1NA 3U48A 4N4QA 1VCVA 3CUJA 3NZ1A 4DWSC 9XIAA 3DBPA 1OSEA 2ZZ6A 3BCFA 3TR9A 5T9BG 2ZUTA 1OT2A 3QYSA 4I5XA 2OZ8A 1B90A 3WENA 4QG6A 1FX6A 4JOMA 5HULA 2HQAA 4OWGA 2OWWA 4NU7A 3FXYA 4WGXA 1J0KA 1QPQA 1P1MA 1YE6A 1X8FA 1QR7A 4Q8VA 1W3TA 1MUMA 4UOZA 2VC9A 2PGWA 3FGCB 1M68A 3PFRA 4OV9A 1NFBA 1P6BA 1P0BA 3PBYA 2A3EA 2FLIA 3CEUA 1VBJA 2E9MA 1GJPA 4G7EB 2AMGA 5D8ZA 1EPXA 1E6NA 2VFEA 5IRPA 4XIMA 5KSWA 1YDOA 1S5WA 2REQB 5A8PA 3CMJA 3G3DA 5CC7A 3EXRA 4TX6A 2OG9A 4GIAA 2OQLA 3V5OA 1HL2A 1XRSA 1A5NC 2DH3A 3DFHA 4J3SA 5HWMA 2NQLA 1BXCA 3MT1A 4CNUA 1GQKA 4MZ1A 2PODA 4JIHA 1AW2A 1YDVA 1Z41A 2XUCA 2HNHA 4W9TA 4W88A 4D1IA 2Q3OA 3Q67A 1CNVA 3BMWA 4EWJA 1JL8A 4X2PA 4B16A 4XSLA 4A29A 3W7JA 3LXBA 1Z89A 3PK7A 4DUWA 1OGGA 2Z1KA 3BAIA 1UKTA 4GABA 3NWRA 4WEVX 4A8RA 3TWBA 2PBOA 1H7RA 4JFVA 2PDKA 1NOWA 1H2JA 4WXYA 5HDRA 2WKJA 1F7BA 3HV9A 1MO0A 1UR0A 4QHRA 4RE4A 1O68A 1RBOB 3OG2A 4I5UA 4J2MA 1TV4A 1R0MA 2BHUA 3PNZA 1J6PA 3B8WA 3EDJA 4KWSA 4TVDA 3G24A 3WD2A 3OLDA 1R2RA 3MUXA 1W1TA 4JNZA 2ZRWA 2GGJA 5BXSA 5HMEA 2WC7A 2NVCA 4HMDA 3VD7A 2YBVA 5C71A 2W66A 1ZHAA 3A4XA 1KKOA 1KTNA 1ZQ5A 2GWGA 4GQ0A 3O05A 1WB0A 2QR6A 2WVVB 2VCBA 2WQPA 3NFUA 1BWLA 1K6WA 1SO3A 3VINA 2CC0A 1JDFA 2VD8A 3WUGA 1LF1A 4DUXA 5MKGA 1VYSX 1F2JA 1EL3A 3MVTA 2GK1A 4GNJA 4OBSA 2GVGA 3AMKA 2DSWA 3L5AA 2Z25A 1TPDA 3L66A 4W8BA 1GVFA 1A5KC 1GEQA 3RU8X 5HPOA 1P4CA 5DXYA 2FVKA 4LUSB 1HIZA 4E4PA 4XBSA 3CT2A 1W8GA 4AWUA 3GR8A 1DJHA 4GQRA 4BF9A 1NWUA 3ZLHA 3UG4A 4I8DA 2XH4A 3GTHA 1EJUC 3SRHA 1K4HA 1PZ1A 1FXQA 3CUFA 2EG7A 4QFUA 4E8CA 5BW6A 1W0MA 3HMJG 3HQOA 4N9DA 2QAPA 3QY6A 5I07A 1TVNA 2DPEA 4MAZA 1EIXA 2R94A 1WDQA 3VIJA 4AAJA 4GC4A 4X0VA 3FVMA 5D2XA 5HNUA 4BJHA 4JEJA 2DORA 4IH3A 3B4YA 1HJXA 2Q09A 5HWNA 3VCRA 2BY1A 1O5KA 1XIIA 4UTUA 3FHAA 3WNKA 1V0KA 1KR0A 3S2CA 3AIRA 3VGHA 1FH7A 1QHZA 3ID7A 5ABFB 1EA0A 3BTNA 1BAGA 3PZGA 3GC2A 4KFOA 1AH0A 3CL8A 1V5XA 4KIEA 1RUSA 1R7AA 1VFHA 4JFSA 4WDWA 2PRLA 2YW3A 3O07A 3QMTA 4M3PA 1UJQA 4C7GA 1KM1A 1QTWA 2ZIDA 2DT2A 1RV8A 2OKTA 4HOZA 3EX6A 4IX2A 3SN4A 4PCNA 1B9BA 3T0DA 3CYVA 4IZGA 3WJXA 3F2DA 4MJ2A 4DWSB 1UWUA 3N2CA 2HV5A 1XPGA 4F79A 3CUZA 2WJFA 1ONXA 2PDWA 1QK0A 1WZAA 1V0NA 4S23A 2W92A 4PTVA 4ML9A 4GYKA 3W7CA 2XINA 1OZMA 4HA4A 1UB3A 2BOFX 1QASA 5JQ9A 1H3GA 3R4IA 4FA3A 4PCSA 3LI1A 2VVSA 1YADA 3C52A 5FA5A 2OWCA 5AVHA 1R3VA 1VJIA 3M5XA 2DSKA 2OLSA 1DL3A 5BXPA 4KEUA 1Z8AA 1OCBA 5CLTA 5DEZA 4AB4A 4ZE4A 1E5JA 3GHUA 1VFMA 3VC5A 5DY3A 3RF9A 1E6RA 3P0WA 2J9XA 1JZ7A 4H6QA 3TOPA 3VCNA 2BB0A 3TEVA 1TJRA 1EWDA 1ZFJA 2OLHA 4JYFA 3TR2A 4LV4A 2CHRA 4XVEA 2W3ZA 1F6YA 3LHYA 2GOKA 2VDIA 3QLLA 1VPXA 5DX7A 3PZVA 4A6GA 3WLJA 3WK1A 3R89A 1WXZA 4FR6A 3J7HA 3OVPA 4PL2A 2J78A 5EMYA 1TTJA 5DELA 3T9PA 4B3ZA 3T4CA 2PGFA 2REQA 4LYPA 3HJZA 4F2UA 4UMCA 3IJQA 5AZ1A 2FZBA 5ABTA 3C3UA 4CN4A 3F5KA 2OYKA 3TJLA 3ZLFA 4TU1A 1BXBA 2PWVA 2VX7A 5CGMA 4S3JA 4YIWA 4KF1A 2J74A 4FAMA 4HK7A 3R25A 3PZIA 4YCPA 2C91A 3IJ8A 1KTCA 4RXFA 3ZJ6A 4IP7A 1B2YA 4MY1A 1W3JA 4JIPA 2WZEA 3DI1A 3IJIA 2X1IA 4XISA 5DO8A 3L4WA 5JBDA 5LA1A 2ZRYA 2R6OA 3GXDA 4R5EA 4U5KA 5CBIA 1GYLA 3W1QA 2QF8A 4IF2A 5CZJA 1IGWA 4DO7A 4E2OA 1MRQA 5HJYA 4HZMA 2YIHA 3ITGA 2NLIA 1XL9A 3HPAA 4EANA 4ES4A 2GJRA 3UCQA 2E28A 5DMYA 1UBPC 3TZFA 5A95A 1E1FA 2C3ZA 3VMPA 5G4WA 1J79A 5CG7A 4TMCA 2B7NA 3CTTA 2HK1A 2VGBA 1H09A 1KM6A 1UP0A 4PE8A 3CEPA 5BOFA 3G1AA 3NG3A 1PV8A 1U1JA 3VNKA 3W1MA 4MLJA 3MZ2A 3WLOA 2DIJA 2O55A 1G4TA 4F0KA 4ICMA 9RUBA 3ITLA 2WYSA 3TW7A 1H62A 2HZGA 1KW1A 4AISA 4AY7A 3S2JA 3KAOA 1Q6CA 3RLVA 4Q8QA 1VLWA 4H41A 5D04C 3T05A 2QW5A 4IPJA 4E3VA 2CWNA 3C4UA 2YPIA 4LJ3A 4WSJA 4Y9MA 5CSSA 4AVNA 2DZBA 4LB4A 2ZYFA 2W61A 1R9YA 2OZ3A 2JEQA 1LRTA 3QHMA 4PTDA 3T8QA 4WQ6A 1G67A 4NI3A 1EXPA 1JI1A 4PUWA 1E56A 3WEZA 1WO2A 5AHNA 1EIBA 3QM3A 2QUTA 1VZWA 3GDLA 4PR4A 4Y9OA 1GVEA 2Z6IA 3BGAA 1DWIM 3MS8A 3UXIA 3H26A 3VNMA 1KV8A 2YXOA 3I3EA 5FI8A 1FWWA 2ZDSA 3BLEA 2CXEA 3VKBA 3A13A 4JIEA 5ABFA 3S46A 1E6SM 6XIMA 1O6IA 3ZOAA 2OZ0A 3TA9A 4K2SA 4L1GA 3S9YA 4Y9AA 2D0FA 2BP1A 4INFA 3VIOA 3T1GA 1VP5A 1LM1A 4O1FA 1W5PA 3ABRA 2G5WA 4I9JA 4L65A 3MKCA 1GGOA 1GOQA 1PHWA 4E2DA 4MIMA 3W26A 3ZJKA 1DQWA 3W07A 3CL7A 4AZGA 1QHPA 4FB7A 4PH6A 1FWTA 4ZOAA 4JBRA 5LNWA 2J8FA 3H2FA 1ZTVA 1RZMA 4GVFA 3EX4A 5GJMA 5E6ZA 3USBA 1WZMA 1FWJC 5FOOA 1JDAA 4L6HA 3WO8A 3R11A 1GVSA 3TQPA 3BUVA 1X96A 3OIHA 2QZRA 2Y6ZA 5KZMA 5M1TA 2H3DA 1AK5A 3TCSA 2OQHA 2OO6A 3DFNA 3PR2A 1ZENA 3ANYA 1JPHA 1RP8A 4W8LA 4S39A 3UJRA 4GCXA 3WNLA 3GKFA 2WO5A 2G96A 1MXSA 4NSBA 3SSZA 5E9AA 5HA7A 3I3DA 2JIWA 2ZXAA 3DESA 3QR3A 3PZNA 4B5UA 4GY1A 3AHVA 1MEHA 1DJIA 3RXZA 4B9ZA 3HFYA 2C71A 3R94A 2VQUA 1OEPA 2XWEA 1CLXA 2V3GA 2E5DA 2PWGA 4D6EA 1SSDA 1O66A 3C2RA 1IE7C 3U7VA 1AZ2A 3I65A 3FJLA 3W6MA 2VFIA 1JYNA 3JRKA 5D8WA 1AMKA 1GVOA 4LOCA 2GUYA 5C9ZA 3V1PA 1JJKA 3GHSA 3L21A 4LVBA 4OIFA 5CPOA 1JGMA 4Q4PA 1N2VA 3W1XA 4QG9A 1M7JA 3UZJA 4YCOA 3MWCA 1H1ZA 2NQ5A 4CNPA 4XBJA 1ZALA 3L12A 4NASA 2HWGA 3NXFA 2ZRUA 4ZSTA 2Z7GA 1KRBC 3N15A 4Z0JA 4RDWA 3P2VA 4WZHA 2CLOA 1DYSA 4AD5A 2F84A 3NTYA 3QW4B 3QZ6A 1KFJA 3FJ4A 5CPTA 5E09A 3QC3A 5DN1A 3EAUA 1V3KA 3IRSA 1FWEC 3WBEA 3SBFA 2XYLA 3NQ7A 2ZVRA 4MG4A 2GQ9A 3GH4A 2AKMA 5JVLA 1OG6A 5LGXA 4IQLA 4DBEA 2WMKA 4LNCA 1QAPA 3PP7A 4K6AA 4QSFA 4ZQMA 1XDMA 2IKIA 1VBRA 4W5ZA 3LTPA 4XZIA 4FLQA 4M6QA 2I17A 4P8WA 1PJ9A 1XBZA 2C0HA 4J3ZA 3AI0A 4JTLA 4G8TA 3GH5A 1PIIA 2FTWA 1BG9A 3URQA 5L9FA 1TRIA 3R8RA 3HO8A 4A2SA 1R3TA 3HB9A 2Q8XA 3FS2A 4DBUA 3WL1A 2IXUA 2VFDA 3IJ9A 1WXJA 2GQAA 1WXYA 2X2GA 3ARTA 3L67A 5M2FX 4WKFA 5D9PA 1V79A 1W5NA 1EX1A 3IVTA 4XUGA 1B3YA 2J8GA 2VWTA 4IP5A 1GJUA 2HK0A 2OVLA 3I7RA 1KC7A 3V75A 4GZ7A 1E1CB 3QC0A 4M56A 4N7QA 2O7SA 1GHRA 2C13A 3WQFA 3BOXA 4C1NB 2Z4GA 2AOSA 2PDLA 2DZWA 1JPMA 3MVIA 1W9PA 4GX9A 1UR2A 2VFHA 2GSEA 3VKKA 4OFCA 3SCTA 3KBNA 2XVKA 2FGZA 5IHSA 4H04A 1SW3A 2Z27A 1UD4A 1XYBA 4AD2A 4DJFD 3GVWA 3W1TA 1G4SA 5AFDA 1I2NA 1AD1A 1KQZA 1VEMA 5F4WA 3RN6A 1HT6A 2B7PA 5TBOA 3NA8A 5K3VA 1IZKA 2YBUA 4NNCA 4C6BA 5BWFA 1E51A 2WNNA 2FHBA 4TV5A 3GYCA 1HTIA 5LHEA 3CH0A 3KX6A 4UFHA 4K36A 2Z24A 4I9AA 3PJXA 4FEZA 3MSRA 4LYQA 4K1WA 1PSCA 2R82A 1R9ZA 3PTDA 3WBYA 3ARUA 3B0PA 4LV9A 4GUGA 1TVLA 1U30A 1D9EA 2PU0A 3LENA 3EWYA 1VHNA 4HGXA 2E8ZA 5I77A 3HURA 2YLLA 5EFDA 3CBWA 3P80A 3N4AA 4U4MA 2NWRA 3UJSA 5I24A 5CBBA 1EDGA 2V67A 1PDYA 3B03A 1TZZA 4Q8UA 4UTTC 6CGTA 2HXUA 4QAIA 3LM3A 1Z32X 4GBDA 3UY8A 3TAKA 2QPUA 4M6UA 3OZMA 3WLSA 1FWCC 3ANUA 4DBWA 4A35A 2QEZA 2DVTA 4Q4SA 2DU2A 2VEPA 4F0LA 3LY0A 1TIWA 2EPMX 2X16A 4NZJA 4NHVA 1B4KA 4A3HA 3QKEA 3CAKA 2BDQA 2VDHA 4EXBA 1DVJA 1EGVA 1XKYA 4HYVA 2YCLB 3VABA 1KXQA 5HINA 2JKEA 4P7QA 4NAEB 3W7PA 1JFXA 5FAGA 4OOUA 2JE8A 1U83A 4HTYA 5C55A 3E2VA 5G1TA 3M5VA 2W62A 2AAMA 2QGYA 3W29A 5LIXX 1SZGA 5LSMA 4DB7A 3L4UA 2VYOA 1XICA 2CLKA 4ZFCA 2RGLA 1JIBA 2GJNA 4GZIA 1PIFA 3BQ5A 1XBYA 5LGZA 2BG5A 3UJ2A 1A49A 3V0SA 3IWPA 3LOTA 4DF1A 4AZCB 1XSKA 3RCYA 3W85A 3FV9A 1DPMA 4X3ZA 3UD6A 3LGDA 3SUSA 3ALFA 3KEHA 1FWNA 4IPLA 3MI2A 1JCXA 4GG9A 4ZODA 2A4AA 2PAJA 2Q8LA 1FWRA 3MYPA 4AD1A 4YTSA 2WBGA 3F2BA 4A05A 2WSYA 2ZCGA 1XCWA 4NXSA 1IT0A 1KBKA 4FLSA 4KETA 1RY0A 4KEMA 3NQGA 3LD5A 3P8JA 3V0TA 3GVRA 4D6DA 1J5SA 1TQJA 3TYUA 1K9DA 1XYZA 3VOCA 2R91A 5CC5A 2VHLA 4DJEC 2QV4A 4N6EA 4UR8A 3H7UA 4DLMA 3TQVA 2NX1A 3BDKA 3MP4A 1IEXA 4D8AA 4JX4A 3W7IA 3MSDA 1RPXA 5FD0A 1GQLA 1KTBA 1QOQA 1YNPA