3QEZA

Crystal structure of the mutant t159v,v182a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
MDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSVRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 83
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qezA00
3W1UA 3FIGA 2RFGA 4O8RA 3P8JA 1MZHA 1VPXA 3PBYA 5G2HA 3L65A 3W1PA 4FX6M 1ME8A 2G96A 4Y90A 1EP2A 4IMDA 1K7XA 2Y89A 1LORA 4UFIA 3FLUA 3P60A 3EXTA 3DHDA 5SWUA 3B8DA 3MI6A 2QJHA 2V0TA 2CLEA 3TXZA 1A5AA 3EXSA 3NQDA 4EF9A 1A5SA 5BMXA 1M7PA 4QJ1A 1FXQA 2C13A 1KLYA 3A21A 3HG2A 3M1ZA 4LW7A 3LV6A 4CNPA 4HSNA 4NNBA 1OFRA 1IIGA 5AOUA 3NQGA 1KM4A 1XBVA 3BLEA 4MZYA 4A21A 4MLJA 1ZAIA 3IV3A 2DZTA 1FDJA 3HOJA 3SW6A 2VEIA 2Z6IA 2RDUA 5FEPA 2C15A 4HNNA 1TCDA 1PE1A 2E6DA 1GVOA 3DXIA 3DFNA 1PL9A 2FB3A 3IVUA 5F2IA 2NXHA 3SY5A 3ANYA 1W1ZA 2YZRA 2DJXA 1IXQA 1QO5A 3TFXA 3TX9A 1L6WA 2GJNA 2YW4A 1JUBA 5BNKA 1QO2A 3OHIA 2E68A 4E38A 5HR6A 1TV7A 4JX5A 4RZ6A 1DJNA 2QAFA 2J24A 3G1XA 2QKFA 1SW0A 3SIZA 1UB3A 3GK0A 3WFAA 3HPXA 2FFCA 3NM3A 5E1QA 5IBXC 1XL9A 1LOQA 4UCGA 2QCDA 1H1YA 1RQEA 2X1RA 4JNMA 3V1PA 3WK0A 1TTQA 4UTUA 4D2JA 1OX6A 4YWIA 1WX0A 4AHPA 1FUYA 3C61A 3UQNA 5LHEA 1FWSA 1W3IA 3TSDA 3BG9A 1YDVA 2HMCA 4NQ1A 2VEPA 4I7VA 1KM2A 1R2RA 1UUOA 3C4UA 4ZQCA 5G2WA 4G1KA 1LCOA 5DXXA 3W85A 1QWGA 3N73A 1R2SA 4Y8FA 1WA3A 3RLUA 1SW3A 4LS2A 1WQ5A 3EXRA 3O15A 1EUAA 1FQ0A 1TJPA 3PM6A 4NJJA 4FIQA 5A8GA 2H90A 3MHGA 1PIIA 2YYTA 4BI6A 2WO5A 2TPSA 1Q6OA 1L9WA 4UTMA 3K30A 5I3GA 1GG1A 3LERA 4PFMA 4JTKA 4GJ1A 1VCVA 4UFHA 3SI9A 5EKYA 3O16A 3UZJA 2ZZ1A 3LTYA 1H7XA 3C2OA 5D04C 3W7HA 1VCGA 4NVTA 4MUZA 1THFD 2CZEA 1FBAA 3W7QA 1WAUA 2EPHA 4RLIA 4MFDA 4M7TA 1M7OA 3MI3A 4AF0B 5LNUA 1FCQA 5FESA 2QCNA 3PUDA 1J5TA 1E51A 3IIPA 5G5IA 4MZ8A 1O5KA 2A5HA 5LNRA 1RVGA 1W0MA 3A9IA 3MP4A 4UTTC 5EYWA 1O4UA 5F4WA 5HINA 3CWOX 3G1FA 4MYAA 3GDKA 4DO5A 3TAOA 4TMCA 1SZNA 1XUUA 1N55A 1L2UA 5AHFA 5AYXA 2FPYA 3FFSA 5D2VA 4GUFA 2YGYA 1DVJA 1EB3A 3TJLA 1EX5A 2ZRUA 1JQVA 4YCOA 1GVQA 1ZJIA 1AL8A 1DQXA 4HPJA 2R94A 3R5EA 1WOBA 2GQ9A 2WNNA 3VI2A 4S1FA 1RZMA 1FWWA 1R47A 3GIYA 4R7JA 3EWUA 1QPNA 1RR2A 1K02A 2FLIA 1T8XA 2H3DA 2J9ZA 3MP5A 2W0UA 4LY8A 1P1XA 2VOMA 3OG3A 1X7FA 3ABQA 3VE9A 7TIMA 2PC4A 1W5NA 4IX0A 1DORA 1VLWA 2DZPA 1L6YA 3EB2A 1VGAA 1QPOA 4MPQA 3SSJA 1JJKA 1Z44A 4Z1CA 3UWWA 4FB7A 1H7OA 3WJXA 1RPXA 2VFDA 4MJZA 1JCXA 1XBXA 4UXDA 3O06A 3MW7A 4KKXA 4ONVA 1OX4A 3M5YA 1I2QA 3LRMA 3N3MA 5AYZA 5LGZA 1SW7A 4XKYB 3HGJA 3HB9A 3W73A 1SUXA 4O54A 2NWSA 2O7QA 5H91A 4K39A 2ZBTA 2ZCGA 1YTDA 4P2VA 3W1RA 3I68A 3GYEA 5AB3A 2CLOA 4N02A 3M44A 3NYZA 2BTMA 4O11A 3WJZA 4LTSA 5D37A 5G4WA 2ZTKA 1B57A 3JS3A 2BXVA 1YPFA 3W72A 3QMTA 1KFCA 1HTIA 5CGQA 1VC4A 3UPWA 5H2ZA 3WK3A 1X8FA 1G67A 1RV8A 2C18A 3S5ZA 1MSSA 1T0OA 4JTHA 4YLWA 4POCA 4YMZA 4KWWA 4ORIA 1G69A 3ZWSA 3LV5A 4K38A 4LVGA 3W9ZA 4PA8A 3TU9A 1TQJA 1S5VA 4LV4A 1TTJA 5G1YA 1A53A 3LCLA 3LTSA 2O7SA 3NO5A 1I2PA 4N9BA 1OK6A 1G4EA 2ZFAA 1MEWA 3WJSA 3N14A 1Q6LA 3MJYA 1YXDA 3RLVA 3BLIA 3CEUA 3P5ZA 1KTCA 3GAYA 1NEYA 4BR1A 2F7FA 1A5CA 3LDVA 5FF0A 1BWLA 3PUOA 3KFTA 3BPWA 3A24A 4O16A 1AW2A 3LHZA 5CPLA 1LBLA 2Y62A 5CKSA 1YADA 2OX1A 3LCHA 1TPEA 1GWJA 1JCNA 3BVJA 5E93A 5LKYA 5AN7A 4RJEA 1EP1A 3NQCA 1QR7A 4NU7A 2CWNA 5CSSA 1ALDA 1R30A 2I1OA 2P1FA 1PCKA 1ZY9A 2OT0A 3W87A 1H1ZA 2AAMA 1LYXA 3LXCA 1BEUA 2QCDB 3CU2A 4NX5A 4FIRA 3BGGA 4PH6A 4BI5A 1K7FA 3ATYA 1ADOA 2G97A 1FX6A 1VQTA 2B4GA 3S5OA 4UMBA 3M6YA 4ZMGA 2QDHA 1DV7A 1SFLA 3GKFA 4UMAA 1JCJA 2GJLA 1RD5A 4K8EA 1XXXA 4J9JA 2J88A 2XFWA 1W37A 3TJXA 3BW3A 3PAJA 1C9DA 1KV8A 2A6LA 1F6KA 2QDGA 3C8FA 3VNDA 3W7IA 1VLIA 1TV8A 1I2OA 1N7KA 3IIOA 3W1LA 3W75A 1A5BA 3PG9A 1ZALA 3QC3A 1GTHA 4BWLA 2OCZA 5LZLA 1PVNA 4FNQA 3N9SA 3HMJG 5TQLA 3RU6A 2VELA 1FY6A 3E12A 4Z08A 3GXNA 3OVQA 2A4AA 4OV9A 1F6PA 1GVFA 3NPVA 2ZZ6A 4LRSA 1JRCA 2A7RA 1FDYA 3BW2A 5HULA 3NVTA 3B0UX 3EX6A 3HGRA 1N8FA 4B5NA 3THAA 4GRSA 1J4EA 5BMWA 2CZDA 3T78A 1KFEA 1OF8A 3BLFA 4NT0A 4JTFA 1BTMA 3LGEA 4FX8A 3NZ1A 4AB4A 3O6DA 3SZ8A 4Y96A 4EWND 3O6CA 4JY8A 3BW4A 3VKJA 4EF8A 3H53A 1UBSA 3C52A 3OIXA 3P5YA 1HFBA 3WK2A 4WXZA 5DBUA 3CPRA 2I14A 3G1HA 1QDSA 2J9YA 3BG5A 3UXDA 1TTPA 4LWWA 2B0MA 4A29A 2YFNA 3USBA 3R2GA 3VCRA 2JKAA 1H7RA 4N4PA 2QR6A 5LNSA 3EX1A 1OFBA 3NM1A 3DAQA 5D2YA 5T26A 1JUKA 3QEZA 1HUVA 1B9BA 3G18A 2A6NA 3PR2A 3FEMA 2IQTA 3UWZA 1K8YA 3NA8A 4A22A 4FHAA 1KA9F 3MUXA 5KZMA 3W71A 4HNVA 1DKWA 1X1ZA 4JTTA 3PBWA 3TKFA 3W7GA 3G3MA 5DCBA 3DI1A 3S42A 5KITA 1S5WA 3H54A 5I3JA 5AHEA 4HSOA 3LI0A 1YDOA 3HPSA 3FJ6A 2J27A 4GNJA 3W1NA 3NQVA 5BRBA 3W1QA 1OX4B 1SO3A 2QUUA 3KX6A 4WD0A 3W7PA 4PEKA 2CW6A 4WOZA 5FF7A 5I3FA 3GB6A 3O6YX 4OGZA 1KM3A 4WX2A 2WSRA 1XC4A 3M5XA 2LLEA 3DFPA 5EBUA 3LRLA 4BFAA 4GUHA 4JICA 1Q45A 4JTIA 5F2GA 2TMDA 4JTJA 3TH6A 3W7EA 3IVTA 4CQ8A 5LGXA 2V82A 1IXNA 1GYNA 3TXVA 5J5RA 3MYOA 3T55A 5D2WA 5F1UA 3FKRA 3G1YA 3N2XA 2RDTA 3W2MA 3UNDA 1R2TA 3L5MA 4LS0A 1TRIA 2ZZ5A 2HS6A 2ZRZA 2GVJA 1TRDA 3WJWA 5LNVA 5I3KA 1FCUA 4TIMA 4O4VA 2B7QA 3P84A 1WDWA 3QZEA 3W2UA 3M5VA 1H62A 2C16A 2Y88A 3P82A 4LT9A 4O52A 4OQVA 1YYAA 5AHIA 1Q3NA 4RZ4A 2CLKA 1ML1A 2YFOA 3TQ0A 3KHJA 4TU1A 5AC7A 3BV4A 2C3ZA 4BK9A 3G8RA 4WJEA 4C1LA 2PRLA 4TX9A 3TNOA 3RFAA 4PC8A 4JEQA 3QFEA 3MYPA 4UTWA 3UD6A 1W3TA 3G22A 1ZNNA 1H7PA 4S2BA 4FNSA 4NXSA 2W79A 1UUMA 2GVLA 5K3VA 1G4TA 1TPH1 2FQIA 3RK8A 1EWEA 1I45A 1JUEA 2H3BA 3W2LA 1EEPA 2WKJA 4JDYA 4GUGA 1TIMA 2ISSA 4LUJA 4JTGA 4KFPA 4GC4A 4BWLC 3B4UA 2TYSA 1B4KA 1W3NA 5FEZA 3I7RA 4W9TA 1TB3A 4JTEA 1QOQA 3M43A 3PY2A 2D73A 1M5WA 4JTLA 4AWTA 3D0CA 2YPIA 3UWYA 3LHWA 1ME9A 3LHVA 1UCWA 3STCA 1H7WA 3KOFA 4L4LA 2CLHA 2X1UA 4CCEA 3VFLA 3A5FA 2DORA 5AFDA 3HG3A 2A2IA 2B7NA 2E6AA 2Q3RA 3W7JA 2FPVA 4K37A 3MI2A 3UWVA 5K2ZA 1AL7A 4TMBA 3KRUA 3C56A 1TPWA 5AYYA 1W54A 3GR8A 2A85A 3OEXA 4CCCA 2WOQA 1JULA 3M9YA 2OJPA 3U8GA 4LS1A 3NOEA 1IXOA 3TUUA 1HO1A 2JGQA 3RMJA 4NUWA 2RKXA 2G5WA 1HG3A 1QMLA 3S0CA 3AO0A 1F7BA 3NQ7A 5K4XA 1G7VA 2ZRWA 2GUUA 3LXBA 1NVMA 3LCXA 1Z48A 1TTIA 4UFMA 1I8JA 3SJ3A 5EA9A 3C2RA 3QM3A 5KINA 5D38A 3TQVA 1B3OA 1LRQA 4EIVA 4HNTA 3CIXA 1ONRA 3W7RA 1P4CA 3WK1A 3TSBA 1TYGA 4O4WA 3W7MA 5K9CA 1TSIA 4QNWA 1SO5A 1ICPA 1D3HA 2V2DA 2YSWA 2WNZA 3LLDA 2CLIA 4IQLA 3RNDA 2VKZG 5AC8A 4PCFA 2V5LA 3S1VA 1U83A 2PURA 3LBCA 4C1KA 5HJLA 3TFCA 1XBZA 4X22A 4WXYA 3M16A 3QJAA 2QUVA 3W70A 3S6DA 1YDNA 2ISWA 3L0NA 3LHUA 3MBDA 2V30A 4RK8A 3B06A 5DXYA 2QJGA 3STFA 3YPIA 2EHHA 3GXPA 3W7LA 3PBVA 1LLZA 1EP3A 4JYFA 4OT7A 1KTBA 3HGOA 2JKEA 3GNNA 1JCLA 3LI1A 4H3DA 6TIMA 3A5VA 2Y70A 4UTKA 3L9CA 5I3HA 4HPXA 4JIPA 3PWAA 3TQKA 3P80A 2FB2A 2ISVA 2VEKA 3PF3A 5EL1A 3GDTA 1J2WA 5DBTA 2J6XA 3CLMA 1I4NA 3E02A 3NZRA 2GQAA 4IPIA 3LX9A 4NX0A 3TC6A 4ZQPA 2GPTA 4N6EA 2YW3A 2J9XA 2X1SA 1WBHA 3OA3A 2H8XA 3HG4A 4NZFA 1OYCA 1G6CA 2VFEA 3PBUA 2BSLA 4DF0A 4MIMA 1SZEA 3QQ0A 4Q32A 1OK4A 5F2MA 3KXQA 3GKAA 5D33A 2VFGA 3MHFA 3PG8A 5TBOA 1EPXA 1VZWA 2WQPA 4IMFA 5FEWA 2FTPA 5AHNA 5HWNA 2ZA3A 3A23A 5I3IA 3OVPA 3TSMA 1JCMP 3IRDA 4DBDA 2OMAA 2HSAA 4FNPA 3HQ1A 4JN6A 1AG1O 4NJKA 3GVGA 4LVDA 1VCFA 5GVJA 4XWUA 1TO3A 1F76A 2Y61A 2Y85A 4UTJA 3PB2A 3SFKA 4N9CA 4RCXA 5D2XA 3KVLA 4JGDA 5FI8A 1QNVA 2ZQ0A 3LCFA 3QSTA 1L6SA 3HF3A 3HG5A 3EX4A 4YCPA 4CCDA 1NAL1 2C19A 2WJZA 1OFOA 4XUGA 1K7EA 4ORMA 3F03K 3P81A 3FJLA 1VHNA 3NEVA 4UUIA 3W1AA 2WPBA 5F4XA 4ZVJA 2VXNA 4NJGA 3M47A 2R91A 3C2FA 2ZDRA 5D03A 1GPWA 2VEMA 1LLWA 1W5OA 4LVBA 4QITA 2QUTA 3S1XA 4IXXA 1O5XA 2A0NA 4Z1DA 3DZ1A 3G1DA 4IJBA 3LCIA 1D9EA 3CQ0A 1TPC1 2YCEA 1IXPA 4R34A 3NQ8A 1H50A 1TPUA 2V5BA 3CWNA 3PS7A 1HO4A 2GVGA 4NJIA 1ME7A 3W3OA 2NV2A 3G0UA 4UC5A 2JGYA 1XFBA 3G3DA 3R13A 4ALDA 4MY8A 1VYPX 1K8XA 2ALDA 3W76A 4ZZ9A 2RDWA 1FWNA 4Z0JA 4IUOA 3IIXA 2TSYA 1Q6QA 2ZA1A 4NXKA 5G1TA 5HWMA 3E49A 4HHPA 4RX0A 1EIXA 4MLRA 3FKKA 3SGUA 1OFDA 1LTDA 1H7NA 2HTMA 4HT3A 2PE4A 4A2SA 4KFNA 3TK7A 4M19A 5MHBA 1DOSA 2E5BA 4FEZA 3NNTA 4XQ6A 3MWAA 1SSDA 5CSRA 3EX3A 3UXAA 3FYPA 1KFBA 3GLCA 5BOOA 1GOXA 1EA0A 3NL5A 3G0SA 3AJXA 1VJIA 2PRHA 4O15A 5LHFA 2X2GA 2PRMA 5E0KA 3ABOA 1ZENA 1DHPA 2DZXA 5G4EA 1SZFA 4YL2A 2JK2A 1P0KA 1GQNA 3CIWA 4LV9A 2ZZ4A 5FF2A 3ATZA 3CHVA 4N6FA 1JR1A 4GUJA 1Y0EA 3FA5A 1OHLA 2ZRVA 5DCEA 5IBXA 3FS2A 5LNWA 4H6KA 2TRSA 3TR2A 2BZNA 1IIHA 2X16A 2ATSA 1VHCA 1GYLA 2NUWA 4GFSA 2WSYA 4OU1A 2QCMA 3W86A 3W7KA 3C3NA 3ELFA 2Z1BA 3LM7A 4PL2A 2YXGA 1OYAA 4YXGA 4AH7A 3B0PA 2Z0IA 4TO8A 4DF1A 3O1NA 3R89A 3VE7A 4NNCA 3Q58A 1CX9A 1WV2A 1W8SA 1LP6A 3LOTA 4HN4A 5FF3A 1LZOA 4JDBA 3WJYA 3BARA 3W2JA 1P0NA 4DPQA 5L6UA 4XBKA 1VYSX 3M41A 1LOSA 3DFOA 4K7YA 3UY7A 3NDOA 4N9DA 5AHLA 1FDZA 1SQ7A 1LOLA 1O94A 4WQ6A 1A50A 3TV8A 2XN2A 2VC6A 3DKLA 1TPFA 1JRBA 1C8VA 3EWYA 3B04A 4QNEA 2DZSA 3L0GA 2FJKA 3EWBX 1TPB1 1GVSA 3UPBA 1ZAJA 1CW2A 2QF7A 1WXJA 3LTPA 3W7OA 1X6UA 4CLMA 5AHMA 1W56A 4LUIA 2CLFA 3P7YA 4Z0SA 3UY8A 1WYIA 3LCGA 3TROA 3W23A 2OZ0A 1YPIA 3N34A 4UTLA 4AWUA 2EAWA 3HGSA 1S5TA 4K7VA 1I2RA 4K6AA 2JBMA 3TE9A 4JTSA 4MZ1A 4UTTA 1IGSA 4NJHA 1TJRA 3W22A 3L0KA 1XM3A 2XN1A 4AHQA 1GEQA 3R8RA 2AQWA 1WBJA 3B03A 4LC6A 3SR7A 3HO8A 5CG7A 1W5PA 1KM0A 2ZTJA 3EWWA 3W07A 5CZSA 5D32A 4O1BA 3F4NA 3KAOA 1GVRA 2V2HA 4FNUA 1OF6A 3QSRA 3ZR4A 1SZGA 4FO4A 4RV8A 2E77A 4MOZA 2NV1A 5AC6A 2RH9A 5BW6A 2GQ8A 3HIJA 3JRKA 1LRTA 4Y9AA 2HS8A 2QCFA 1PV8A 1LDCA 4RR4A 5DY3A 2NX9A 2E5DA 1RQHA 5CZ0A 2UV8G 1ZCOA 3SGZA 1JVNA 1SFJA 4O57A 1XDLA 4U28A 3IEBA 1KW1A 3U6WA 5FF4A 3P67A 1MO0A 1OYBA 3W7DA 3Q94A 2E09A 4UR7A 1LM1A 1GZGA 4XTIA 3GAKA 4ZQRA 5J5DA 4QAIA 3MHUA 2C1HA 4DO4A 1XBYA 3NQ6A 4JY9A 3KVJA 4FNRA 2NUXA 3V75A 2Q3OA 4O12A 1SPQA 4QIUA 1LRNA 4JYEA 2QCEA 3C0JA 2ATMA 2YR1A 1Q6RA 1TQXA 5C54A 4FX7A 1FXPA 3E96A 5D02A 3IGUA 2JKPA 3T44A 2V2CA 3O05A 1FCBA 4JR5A 4R53A 1T99A 4Z1BA 3N2MA 4NZJA 2DZVA 2E6YA 1K3UA 1W5QA 3NQFA 3QF0A 4N2YA 5CZJA 3DBPA 4BF9A 3I65A 4DPPA 3BGJA 3MBFA 3DENA 4KWVA 3TIMA 4JTUA 4LC8A 3T7VA 3TC7A 1G4SA 4K36A 2BWGA 3W88A 4O53A 2DZUA 5DELA 4M6PA 2CFFA 1WOAA 4O14A 2BX7A 3TA6A 1SR9A 4OHQA 3G24A 2FPTA 3EKLA 1GT8A 3DFSA 3NQ2A 5EMUA 4A2RA 1YTKA 3ZWTA 2QCHA 1R46A 5U7SA 2YYUA 1V7YA 2Q8LA 1KBIA 3A22A 3NG3A 2VFIA 2FDSA 2P10A 1VR6A 5C55A 1OABA 3LHTA 2ZYFA 5HQEA 3IGSA 3BK0A 2OT1A 3ZFHA 4HNUA 1VYRA 3PSVA 2C14A 4IGHA 5C2XA 4XBSA 3NXFA 1G4PA 5D09A 1YLVA 3QYQA 3LLFA 1LBFA 3DH7A 4O0ZA 3W2NA 3LRKA 1ZAHA 4QM1A 1LBMA 3TCEA 1F5ZA 1EUNA 3P74A 2AGKA 4IX2A 3QMSA 4LU0A 3KRZA 4AVFA 4AXKA 1HL2A 2EKCA 4M5PA 4EOUA 2H8ZA 4JX6A 3M0ZA 4GE8A 1ICQA 1PS9A 3NQAA 1T96A 4I7WA 3S5YA 5K4ZA 1EWDA 2F84A 3MMTA 4DF2A 1GG0A 3EKZA 4P61A 1OFAA 3S1UA 5A5WA 1H5YA 8TIMA 3DU0A 4ZL1A 3P8IA 2C0AA 1H60A 3GDMA 4LNYA 4WUIA 5CZTA 5ABTA 3W7CA 1TPDA 2ABBA 3CTLA 3QRHA 4MJMA 3SECA 4AHOA 1KM6A 3W1XA 2ZZ3A 4NNAA 2NWRA 3S8HA 5C6MA 3W74A 3QW4B 4O1AA 4O18A 4O50A 3QMRA 2ZZ2A 2ZRYA 4TR9A 1QOPA 3NPUA 2C6QA 4GUIA 4OWGA 3U2OA 5D2TA 1S3HA 3FYOA 4O1DA 3NAVA 1K03A 3IVSA 4M7SA 4H4IA 4ZQMA 3DKJA 1SO4A 3G8EA 4UFJA 1UJPA 1CI1A 2I9EA 4CNNA 1O60A 2E5CA 3BO9A 3LBMA 3PC0A 2QAPA 6ALDA 1ZHAA 3NPXA 4I9AA 2FIQA 2B7PA 4GBUA 3OVRA 4GXMA 5F1VA 4JYDA 2B7OA 4O17A 1OVDA 4ADUA 1BKSA 2Y6ZA 1YXYA 4FF7A 1AK5A 1TREA 4EVZA 5KTLA 4UR8A 2NXGA 1JCYA 2V8ZA 1VS1A 3C2EA 5L9FA 3P61A 4MY1A 2W6RA 3EWXA 3L5LA 1PHWA 4X3ZA 4X9SA 3CEPA 1W5MA 2Y7GA 4ML9A 2E1DA 1F73A 4WY0A 3S5NA 1PHQA 2YDAA 3HPZA 5FEXA 3NQMA 1H63A 2DU2A 1OJXA 2WNQA 1GTEA 4ZQNA 5G2IA 3W2KA 4UTHA 1DL3A 4DELA 3DGRA 3IIZA 1M6JA 1OX5A 3INPA 2PCQA 2A21A 2ZZ7A 2QCGA 3N9RA 1SU5A 3O8AA 1QAPA 3NGJA 3FOKA 4UMCA 2EGZA 2YX0A 4OV4A 1MEHA 1I2NA 2CZ5A 3F4WA 4O0KA 3NR0A 4O28A 4Q4KA 3S1WA 3W1TA 2VFFA 4O1CA 4IMEA 4ADTA 4PODA 4JS3A 2V81A 1W31A 2Q8ZA 3G0XA 3IIVA 4X2RA 3NL2A 4AWSA 4UTWC 1OG0A 5HNRA 4HIBA 3EX2A 1V5XA 2Z6JA 4WY0F 2G95A 3DHFA 5CPNA 5DN1A 2CU0A 4XTDA 2A7NA 2CLMA 3L67A 3L2IA 2BLEA 3GNDA 3W6YA 3GXTA 3PUEA 4LRTA 4PTNA 3THQA 3GDLA 4WZHA 5K9XA 4Y6GA 2QCLA 3KVKA 4O13A 2R8WA 3KVMA 1OFQA 4QQ3A 5HUOA 4JIQA 3E9AA 4S2CA 3JR2A 5DLCA 4O19A 3PVFA 2NX1A 3TMLA 3GR7A 3QPYA 1Z42A 1SO6A 4DEFA 1ZFJA 2NX3A 3MO7A 4IPJA 5D30A 2NLIA 5C5YA 3GDRA 3EEGA 5TIMA 3CB8A 3HJZA 4CQAA 1B4EA 3ABSA 3TW6A 1KFLA 1F2JA 4RXGA 4E0CA 4RZ5A 3LHYA 4BI7A 4JD4A 2EF9A 1XUZA 1DQWA 1P5BA 2NZLA 1MXSA 2DP3A 2Y7FA 3OBKA 3UWUA 4O10A 2ZRXA 1QPQA 1BWKA 3STGA 4PL1A 3TDFA 3C2VA 4CQ9A 3G1SA 4Z1AA 5DCDA 4R33A 1TPVA 1MEIA 3I7QA 4A3UA 3BG3A 2QJIA 3G1AA 2XN0A 2ABAA 3TMQA 1QPRA 5U4NA 3GX9A 1F74A 1VRDA 4M6VA 3T4CA 1H61A 3P62A 2H6RA 1VH7A 1KTNA 3L21A 2X1TA 2VENA 3IGXA 3M7WA 3NPWA 4RXFA 4WOQA 5KZEA 1JQXA 3W83A 4AEOA 3W7NA 1KBJA 3B05A 3LXAA 1GJPA 1XCFA 4N4QA 2X30A 4ICNA 3UYCA 1AW5A 2KZHA 2QCCA 5KSWA 1QFEA 4MKNA 3EWZA 4IMGA 1OFEA 3M5ZA 4N9EA 3W84A 4LVFA 4IMCA 3CC1A 3STEA 1XKYA 3L66A 4E2BA 3ABRA 2V9DA 2WSQA 3DI0A 3N19B 1AMKA 3L68A 3L5AA 2Y7EA 1YXCA 4UIOA 3NL3A 1LROA 5HUPA 2Y63A 3UWQA 3RF9A 1KFJA 4MY9A 4KFOA 1PCWA 1D3GA 4Q33A 3UZ5A 1SSGA 3I7SA 4IXHA 1TV5A 4QSHA 3B0VC 1KV5A 3G1VA 4UNLA 2A7PA 1G7UA 5K7JA 2DZWA 2E6FA 4FXSA 1H51A 3LCWA 4AF0A 1OFPA 4RKAA 4ZQOA 5D05A 3NQEA 1AW1A 4JXCA 4UFKA 4XZ9A 4MVAA 3LB0A 2P0OA 5EY5A 5F4SA 3PB0A 5EPDA 1NFBA 3C6CA 1NF0A 2RHGA 4MFEA 2CLLA 1RQBA 1O95A 1KLZA 3KRSA 4GWEA 3O07A 1F05A 1U5JA 1UASA 4UNKA 2A1YA 4UFLA 2CZFA 4L4MA 3GZ3A 5K9DA 3MP3A 3Q37A 1C29A 1NSJA 1FWRA 1QCWA 1X1OA 4HKPA 4U4MA 4IOTA 4JX4A 4MYXA 3HBLA 3TW7A 2VFHA 4OE7A 2WV8A 2NUYA 5KZDA 4M6QA 5CPMA 1IF2A 3R12A 2NXIA 5F2LA 4AAJA 1DJQA 1KM1A 3S9YA 2Y7DA 5LSMA 3DFTA 1XI3A 4OBTA 4I7UA 1Z41A 4DQWA 3I6RA 1K8ZA 4LOCA 3Q2DA 3NL6A 5HWJA 4WY0B 1DBTA 4QISA 4DO6A 1TMHA 1FCVA 3E0IA 5HMSA 1FWTA 3QW3A 3TAKA 4AMAA 2R14A 4DBEA 3PSWA 4IWWA 2GOUA 3W1MA 4LVAA 3CM4A 2ZA2A 3PULA 3F1QA 3ZS4A 4E2DA 5DY2A 1XDMA 3QPZA 1KFKA 1YTEA 3QH2A 1KM5A 3QQ1A 4FNTA 5HR7A 1ICSA 3T40A 2DJLA 4XKYA 4CNOA 2QEZA 3CT7A 5IM51 5KMYA 3O63A 3H55A 4UTIA 4DXVA 4FXRA 4K8HA 5CPOA 4ADSA 2Z2UA 1NF7A 3DFQA
chains in the Genus database with same CATH superfamily
3W1UA 1OC5A 2V5JA 4EPKA 1Y65A 3L65A 4FX6M 2EJ1A 1K7XA 1LORA 3AXKA 4UFIA 3KS6A 3DHDA 5SWUA 2F2HA 2V68A 3MI6A 3N12A 3GS6A 3NQDA 3QN3A 4E6MA 3AISA 1A5SA 1PTGA 2C13A 4LW7A 3U7VA 4HSNA 3Q67A 4NNBA 5ABFB 1YE4A 3S2CA 1QBBA 4HJFA 4Q4PA 1XBVA 4U31A 2D23A 4JCMA 4QCEA 4WLCA 3SCPA 1FDJA 4GFIA 3FVMA 1XYFA 2VEIA 2OWXA 2VC5A 3R43A 1W17A 2RDUA 5FEPA 4HNNA 1U1JA 3CL6A 3PWIA 1E1EA 3IVUA 2ZVRA 2HISA 3GFXA 3ANYA 5JBEA 3GXMA 3A4WA 1SVDA 3ARSA 1IXQA 4XG1A 3ANUA 5IOBA 2YW4A 1JUBA 4UR9A 2EG7A 3MTWA 1IT0A 4NZ4A 1YW1A 2E68A 1TV7A 3FHAA 4X61A 3G1XA 2QAFA 1A80A 1CECA 1UB3A 2C91A 5E1QA 4DWDA 3E74A 4UCGA 4W8LA 4ZEPA 1UA7A 2X1RA 3II1A 4XIMA 3OGRA 3V1PA 1TTQA 1OX6A 2F38A 1WX0A 4AHPA 1PZ1A 3TSDA 3W26A 1YDVA 4NQ1A 3CQKA 2VEPA 1EC7A 1R2RA 4I7VA 4G1KA 5E9XA 4NY2A 1QWGA 1R2SA 3UA4A 2R1KA 3KWXA 1HVXA 4L61A 1FQ0A 4PBGA 2VX7A 2NQ5A 1UKPA 3MHGA 3CH0A 2Q8XA 4GO8A 3SURA 2TPSA 2H9AA 1Q6OA 1L9WA 3DG3A 3K30A 3WZ0E 1IEIA 1GG1A 3UCDA 4JTKA 3FYYA 3SI9A 5EKYA 3UZJA 3E1F1 3LTYA 4DJEC 1H7XA 5GQBA 3W7HA 2VCBA 5D04C 2G4JA 3K8KA 2EPHA 3MSYA 4MFDA 1M7OA 2VHLA 2V3EA 3B9AA 5LNUA 1X1NA 3LBOA 3BDKA 3IIPA 2VR5A 1O5KA 3D3AA 4PCSA 3AYTA 4QE5A 4AD2A 3ZVHB 4IIBA 1HXJA 4MM1A 5F4WA 4MPKA 2PCEA 1R3TA 1DJWA 1A4LA 1L2UA 3AZTA 4LYKA 5AYXA 2DVXA 1HJUA 2GGHA 4ZXLA 4GUFA 5HMFA 3PZNA 2DW7A 2Y4SA 1AL8A 2R94A 3R5EA 1WOBA 3QZAA 3N17A 2BOGX 3GIYA 3N25A 4NRRA 2BODX 3BJSA 4H9UA 1UQYA 1UR0A 1FH7A 2PD9A 1X7FA 7TIMA 3CS2A 2PC4A 3REQA 3SUWA 1RBOB 1QPOA 4Z1CA 4F9DA 2YL6A 2NQHA 4J35A 1FFQA 5FJRA 5E70A 4H7CA 4QEEA 3W29A 1D2KA 4R88A 4UTFA 3B0YA 3QY7A 4A6GA 4M1BA 4B3ZA 1XBXA 4J27A 4UXDA 1PSCA 3MW7A 1HN1A 5AYZA 4US5D 3WQPA 4DHGA 4PMVA 5CPQA 2J75A 1CGXA 7REQB 3VABA 2ZCGA 4P2VA 1E6NA 2GGGA 5I09A 2FZMA 4NIRA 1TELA 5KEZA 4J3XA 4GQ0A 3G5EA 1B57A 1OZMA 1YPFA 3W72A 3M0XA 5CGQA 1VC4A 1BRLB 1WCGA 2DSKA 3WLLA 5HQMA 4R7OA 1MRAA 3WFZA 3IV8A 3R25A 1OG6A 4EE9A 3ES7A 1XF0A 2HRWA 5AC5A 1G69A 1Z69A 4LUTA 4K38A 4LVGA 4LV4A 2O7SA 1OK6A 1G4EA 3W38A 1KGWA 3N14A 1Q6LA 3NJ3A 1YXDA 2FHFA 3V1HA 1TX0A 1WE5A 1IZJA 3B9NA 4ICCX 5AECA 3GU9A 4BA0A 4RNHA 1KQYA 4H00A 1TPEA 3CMGA 3BVJA 5LKYA 4J3WA 4RJEA 1PKLA 3NQCA 5CSSA 1ALDA 3URAA 4C7DA 4ILSA 4YVPA 2AAMA 3DESA 3PN8A 3LXCA 3BAJA 1BEUA 4FIRA 1XINA 3GTXA 4PH6A 4W5UA 1V93A 1JGIA 3VK5A 1EOMA 3M6YA 3GKFA 3NVDA 4UMAA 2J8GA 1IZKA 4J9JA 3W82A 2XFWA 2YCKX 2EBNA 1QI3A 3TJXA 4P7OA 2E8ZA 3C8FA 3UJRA 3VNDA 1MWOA 2GFTA 2J7EA 2Y8VA 3WLQA 3GHSA 3W75A 1ZALA 4OVXA 2CPUA 3I10A 1R0MA 3IACA 3MV01 3E12A 3GXNA 1M65A 2A4AA 1ZP4A 1GVFA 3NPVA 3IANA 1UZHA 3RJYA 2ZZ6A 4Q8MA 3UP8A 4PMZA 2WVUA 4IFRA 5HULA 4B5NA 3THAA 4G7EB 2NT0A 3IJ7A 1J4EA 1YKWA 1EJ7L 3T78A 1E0UA 2HXUA 1KFEA 4I9TA 3L4VA 2BASA 4JTFA 1BTMA 1XCXA 2DSZA 3SUVA 3OU8A 3NZ1A 3A3HA 3O6DA 4ZTXA 3QKZA 3O6CA 4CUCA 4JY8A 3H53A 3DYPA 4S38A 3CQJA 1HFBA 3PPCA 1K6WA 5DBUA 2PU0A 2NVAA 1QDSA 2IPGA 2WHMA 4U3CA 4LWWA 1NTHA 3OODA 2B0MA 3R8GA 2FH6A 4WF7A 3W01A 2JKAA 3FCPA 1H7RA 1JPKA 3SRHA 3GTIA 2D2OA 4L6DA 2Y5JA 3R94A 5D2YA 1JUKA 3UZYA 2PWFA 1HUVA 1EJUC 3FEMA 4DO7A 3NA8A 1G9HA 4FHAA 3VMOA 3VOJA 5KZMA 1TWSA 3W71A 1XRFA 2VCAA 3U4AA 4QLLA 4JTTA 4MJ2A 5DCBA 2VM8A 2WZHA 3S42A 5KITA 5A69A 3E0FA 5HOSA 1S5WA 4QJ3B 5I3JA 4DN1A 4GINA 3FJ6A 1UR2A 1YE6A 3NQVA 5BRBA 4XD4A 3W1QA 2DZAA 3WLOA 4TV6A 3KX6A 4WD0A 3W7PA 1CIUA 3OO2A 2CW6A 4WOZA 2WC4A 1AJ0A 1GOMA 1KM3A 5D9PA 1Q6CA 3TCSA 3TZNA 1JXKA 3M5XA 4JICA 4Q8PA 4K2SA 3V18A 3BAIA 4JTJA 3TH6A 5HXMA 3R1ZA 4MDPA 1J0ZA 2XFRA 2ZKMX 4R7WA 5J5RA 1ITQA 3T55A 1E5JA 3IS4A 3W37A 3G1YA 1BSLA 1KCLA 3L5MA 1RLCL 1JL8A 2HS6A 3WH5A 4A35A 2PWHA 2GVJA 4GX8A 4US5A 3LZ5A 1UOZA 4GZJA 1B30A 3WLIA 4R9XA 1ONEA 1UOKA 3NURA 1WDWA 4YTSA 1K1DA 3ECQA 4HU4A 1H62A 3N6QA 4FP1A 4FS9A 4H2HA 1S2CA 2CLKA 1ML1A 3BJTA 2X8RA 1F3EA 2YDQA 3WQOA 2X7VA 3G8RA 2PGRA 1JZ2A 2PRLA 3OBEA 4IPPA 3G22A 1H7PA 1S39A 4CD6A 4S2BA 4FNSA 1TVNA 3UJ2A 4AEFA 1XRVA 5K3VA 2OZ8A 1TPH1 1JGMA 1V3MA 3W2LA 1EWEA 1VFMA 3EWCA 3TN6A 5GPRA 1WXYA 4LUJA 1TIMA 2ISSA 4GUGA 2ACSA 1CLVA 2HQAA 3B4UA 2NVCA 1W3NA 4PEEA 4AEEA 1QOQA 1PKMA 2D73A 3VUSA 3WBWA 4I90A 2QPUA 3EKGA 4GI8A 3LHVA 1UCWA 4REQA 3STCA 5LXXA 2J74A 4CCEA 3A5FA 4ZSUA 4AZ7A 4AZHA 1J5SA 2E6AA 3ENLA 3KP1A 2BOEX 2Q3RA 4KWOA 1E0VA 2JF6A 3H4GA 1KCZA 3MI2A 5BROA 4KCVA 1TJ0A 5IDZA 3KRUA 3C56A 3OZMA 1TPWA 2I5GA 2EQDA 1MDRA 5AYYA 2E0PA 3OEXA 1JULA 3M9YA 1B1YA 3MQTA 2WANA 2P3ZA 1QMLA 3TTOA 3TW9A 3CZGA 4QGCA 1I8JA 4GYPA 4C5YA 2VI0A 5KINA 1LRQA 4ERGA 4HNTA 1XCWA 1TWIA 1W9VA 3WK1A 1TYGA 4O4WA 4PUJA 3W7MA 4QNWA 1SO5A 3RMEA 1ADDA 2J6VA 3EOLA 1V0MA 4IQLA 2VKZG 4Q8NA 2PAJA 2V5LA 4WDTA 4C1KA 5HBFA 3D6NA 4JFSA 4JQAA 1A49A 1V3JA 4ACZB 4P8VA 4ZODA 2FVKA 6TAAA 4W7WA 1JEZA 3KZPA 4U2ZA 2ISWA 3L0NA 3AIEA 3MBDA 4RK8A 5DXYA 2EHHA 3AXXA 5C7VA 3W7LA 1LLZA 3GC2A 4P7QA 3RJXA 3GO2A 4OT7A 1KTBA 3HGOA 3WUBA 5MF5A 3RAOA 2Y70A 1E6QM 2O9RA 4JIPA 3P80A 4BJHA 4CU7A 4O0QA 1E70M 3WCZA 2XGZA 3GDTA 2J6XA 4NYUA 5GNZA 3UYIA 4Q8QA 4ZQPA 5AKQA 3MC5A 4GBDA 2J9XA 5T8GA 3OA3A 2HE5A 3V5CA 2WZTA 5CC5A 1CBGA 3OIHA 5G4HC 1NWRA 4XZIA 3UF9A 3CV7A 1OK4A 2ZOXA 1OIFA 2V3FA 2PA6A 3GKAA 3ZJ7A 3WENA 1W1A1 3LG3A 4JAWA 4W8BA 2D3NA 4U10A 5FOOA 1UWQA 1BAGA 5TBOA 4ATDA 1PEZA 1XSJA 1XQLA 2BY1A 2ZA3A 3K2GA 5I3IA 1RALA 3VZZA 3SCSA 3MO4A 3IRDA 1J0JA 1F4AA 2PI6A 3HA1A 1O1ZA 2OMAA 5JQ9A 1VEMA 3HQ1A 3GVGA 4D71A 3WLPA 3QXBA 3UJSA 1DYSA 3PB2A 4N9CA 1EC9A 4WGXA 1IWPA 3EBVA 1D7FA 5C8BB 4A8LA 3QBUA 3AMGA 1UBPC 1HKMA 4J3ZA 2GVEA 3M6DA 1Z8AA 3F03K 1GQJA 3BSHA 4R9OA 3SQMA 1V02A 2BGSA 2WPBA 2CHNA 1AODA 3WYZA 4PMUA 4F40A 3C2FA 5D03A 5LXEA 1C7TA 2VEMA 1LLWA 1AJZA 1AUSL 2A0NA 3DFHA 4W5ZA 2OSXA 3CH9A 1IXPA 1AMYA 3HTWA 4LXFA 4R34A 3WD4A 3CWNA 3PS7A 5G1MA 1HO4A 2GVGA 3W3OA 1LUCA 4GJIA 2NV2A 5A8MA 1XYMA 5CPTA 4ALDA 4DYKA 4V33A 5I77A 3EDFA 2CZVA 4ZE5A 2E1WA 3W76A 4PUDA 5T91A 1FWNA 4GQRA 4Z0JA 3VFCA 4IUOA 3IIXA 1BGAA 2FTYA 4YPJA 2ZA1A 5G1TA 3R0DA 3TNBA 3ZLFA 3BOXA 4J1OA 5FCZA 4XX6A 3QR1A 4UQ9A 1OFDA 4AZCA 2YDRA 2HTMA 4GIRA 1R3RA 3CYJA 3NNTA 3THUA 1UR3M 3EX3A 4B4HA 5BOOA 4GACA 3LY0A 4FLSA 1EA0A 3G0SA 2ZE0A 5CQ1A 2NVDA 4MNLA 2PRHA 4O15A 5M2FX 2PRMA 5E0KA 2WVSA 3TN4A 2O4MA 3NIYA 1ZENA 2DZXA 1W2VA 3XINA 4YL2A 3ZXWA 2OO0A 1EBHA 5FF2A 3VDGA 3T1GA 5EBAA 3CMJA 4GUJA 1Y0EA 1MUWA 2Z1VA 3W6MA 5LNWA 4H6KA 5DX7A 3TOYA 2QIWA 1IIHA 4HA1A 3KL5A 5FAGA 1QHOA 2NUWA 2IW0A 4OU1A 2QCMA 4HP5A 4PUNA 3C3NA 3ELFA 3VIJA 4XAYA 4WK9A 4Q4MA 1VIZA 3IAQA 4TO8A 1PZ2A 2YXOA 4JIHA 2GYIA 2YA1A 4JDBA 3ITOA 3MSGA 3W2JA 1P0NA 4DPQA 4XBKA 3U48A 2VQTA 1LOSA 4K7YA 1FP8A 5A6SA 3HFYA 1RY8A 3LPFA 1SQ7A 1LOLA 1VENA 3K46A 3SBFA 4AD1A 1UWIA 3SY8A 3GE7A 2XN2A 3VIFA 4C1NB 4I5RA 3PAOA 4QNEA 4BQ5A 4I9JA 1RAKA 3WH6A 1GVSA 4PMYA 3V0SA 5M17A 3W7OA 1X6UA 4DWSC 3DHPA 1Z7AA 1OY0A 1WYIA 3LCGA 4HBKA 1U5VA 3CAWA 2OZ0A 4UTLA 4IG2B 2EAWA 1S5TA 3P2VA 4JKMA 3TE9A 1DEDA 1OGBA 4LAZA 4XSLA 4HN8A 2YBUA 4RDYA 4GVHA 3UR8A 1IGSA 1KC7A 3CHDA 1TJRA 2QZRA 4UWMA 3V36A 1ECQA 2IKIA 2WYSA 5A95A 1WBJA 1YBQB 1ISWA 3B03A 1Q8JA 3AMKA 3DX5A 1JDFA 3EWWA 3W07A 5D32A 2I17A 3MKKA 1BG9A 2EO7A 4CD4A 3BLOA 1OF6A 3ZR4A 4G9PA 4PMXA 3BAWA 3WX7A 1X96A 2G3NA 1EJVC 4RL3A 4K1WA 2AKZA 2HS8A 1PV8A 1C91A 3OW1A 4E4PA 1UMLA 4XD5A 2NX9A 1RQHA 3WY1A 2HBXA 2I56A 4TX6A 4JCLA 3W7DA 3B97A 4TXEA 1LM1A 1GZGA 3QOMA 3GAKA 5J5DA 1AZ2A 3MHUA 1VB9A 3VUPA 4JTRA 3AQUA 4F9JA 1I1WA 3FSUA 1RCXB 2XIIA 4HK5A 4NSBA 3KVJA 3STPA 2YCLA 1OINA 1MFVA 3A3XA 4Q4OA 2QDDA 3I6TA 2YR1A 4KIEA 2WZMA 1AFSA 1FXPA 2PLJA 4DB7A 5CZKA 1E4NA 2XVLA 1KRCC 1FCBA 4IFOA 3K5XA 4WDXA 4NAEA 4DPPA 3I65A 3MBFA 3WQ4A 4MSSA 4LC8A 3TC7A 2BWGA 1MNZA 3PZIA 2IKHA 3TA6A 5FD0A 4S3KA 5GJPA 3VGDA 1R86A 1GT8A 4H1ZA 4A2RA 1KD0A 3SCNA 1YTKA 2QCHA 1R46A 3T0CA 2YYUA 1CXLA 2Q8LA 3VGGA 1ZBKA 5EMKA 1KBIA 3NG3A 1VR6A 1NIUA 4DVOA 4PMOA 1OABA 3RX3A 3TTYA 4KQNA 2DUAA 1NY1A 2I5QA 4HNUA 1VYRA 4IGHA 1XIGA 5C2XA 2OYMA 1GHSA 3EEZA 1YLVA 2YCJA 1OSEA 4H6RA 3KHDA 4LH8A 4MJ4A 1MW1A 4QM1A 2QUMA 2AGKA 2DEPA 3ITTA 4GGBA 2NW0A 2IKGA 1QK2A 5I0DA 3M0ZA 2OLSA 4M56A 3NQAA 3S5YA 3B8UA 1QW9A 3MUAA 3VILA 3SRDA 4P61A 2OWWA 5A5WA 4S23A 2BMBA 1H60A 3GDMA 1QBAA 2EEXA 1E5NA 4WUIA 4DJED 3I3BA 2ABBA 1G0CA 4MJMA 4GH1A 4KWSA 2Y5EA 1KM6A 3FGCB 1XRTA 2NWRA 5C6MA 3W74A 3W4RA 4ZO6A 2IXUA 4TR9A 2C6QA 1RUSA 2DIEA 4OWGA 5D2TA 3H4XA 1JPMA 1A5LC 5GNXA 4C6MA 2PS2A 3ZVIA 1HX0A 3CO8A 4ZQMA 1SO4A 2I9EA 1NARA 1O60A 4GPNA 3WFLA 2QVHA 3BO9A 3PC0A 2QAPA 1GOWA 4KPLA 3WDRA 4BQ4A 3VXGA 5FSDC 4N0RA 4O17A 4ZE4A 3MT1A 4FF7A 3QC0A 1AK5A 2Y1HA 5CEWA 1VS1A 3Q4DA 2FJUB 1JZ4A 1PHWA 1NDVA 2X05A 1WZAA 4RDWA 1DJYA 3P93A 4ML9A 2RUSA 2QS8A 3CUJA 2P50A 2ZIDA 3HPZA 2DU2A 2ZXBA 2WNQA 5G2IA 4DELA 4B9YA 3F2DA 3JUGA 3R7MA 3KP0A 3OA5A 2HE8A 1V08A 5CPSA 3S2NA 3QHOA 1TVLA 3N9RA 1QAPA 1NU5A 2EGZA 2OO6A 3SCQA 5CCZA 4OV4A 3F4WA 4N42A 3NR0A 3MV11 3S1WA 3PNUA 2CERA 1LQ0A 1ZP3A 4IMEA 4PODA 5JBDA 2WJFA 1W31A 3NL2A 3GNRA 2Z6JA 4WY0F 5CC7A 3DHFA 1VEOA 5CPNA 3UA3A 1BVNP 4OBSA 1RPKA 3EPMA 4V27A 1MXGA 4PTNA 5EMYA 2GUYA 5ABFA 3S9ZA 5DLCA 3GW0A 3L4UA 3SFWA 2RJHA 1C8QA 3TMLA 3GR7A 1Z42A 2SFPA 1SO6A 3APGA 4DEFA 4R5EA 3ICJA 4QDPA 3MO7A 4IPJA 3L4WA 4EXAA 8RUCA 1PYMA 2NLIA 2G3MA 4HYVA 3CB8A 4HU8A 1B4EA 4AMCA 3U3HA 1HKJA 2DPEA 1KFLA 2HVOA 2E28A 4RXGA 4JD4A 3VGHA 3CZ8A 1DQWA 4FPSA 1GVIA 3GU1A 3W53A 1MXSA 1P48A 1TKKA 2BNJA 1QPQA 1BWKA 1UC5A 3KWSA 1KQZA 5MKGB 1GORA 4LGXA 4KETA 3G1SA 1R3SA 4CD7A 1TPVA 1UUQA 3I7QA 4A3UA 3BG3A 1XGEA 1QNPA 1QW8A 3VGEA 2ICSA 1QPRA 1X38A 5U4NA 1F74A 1VRDA 1NP2A 4CQCA 1H61A 1ZLPA 4NAFB 3L21A 2D22A 3U0HA 3NPWA 1SZRA 3KW3A 5KZEA 3W83A 3FV9A 4H9XA 1FWCC 1RBLA 4DIAA 2OFJA 1Y5VA 2E9BA 4FA3A 1GJPA 4AIEA 1XCFA 4N4QA 1TR9A 3P14A 4GKTA 4GJJA 2WVTA 5KSWA 2A3AA 2O56A 4MKNA 2OYLA 1ZGDA 2XGIA 2KX9A 4LVFA 3VOCA 3HFTA 3A6OA 3STEA 4LJ3A 3DI0A 3I4KA 3N19B 3L68A 3WLJA 4NF7A 1ZZMA 3WQCA 4QR6A 2O9PA 3L2LA 1QHZA 3NL3A 1BYDA 2Y63A 3N2CA 2Q09A 5J04A 3RF9A 1E9IA 3ITVA 3APTA 3UZ5A 1SSGA 1WZLA 2PP3A 4QSHA 2VZVA 3NGFA 3B0VC 2A7PA 1PKNA 4FXSA 3SRKA 4AYGA 4RKAA 1S1RA 3BUVA 4ZQOA 5CBIA 3L23A 3NQEA 4UFKA 4XZ9A 3U5UA 2VGFA 3LB0A 2P0OA 4GABA 2IKJA 5DT5A 4ZOAA 2PD5A 3PB0A 3ZVHA 3M7SA 4ICMA 1PPIA 1JAEA 3RITA 3NOYA 4GWEA 1EEXA 3O07A 4UNKA 2D1ZA 2CZFA 2OEMA 3GZ3A 1CPUA 1B3WA 2ANUA 4V28A 5CGTA 1AQ0A 1QASA 3A3WA 5CH9A 4JX4A 3EDKA 3WMBA 2NUYA 3AXIA 3RYSA 2IMRA 2E9MA 1E56A 5F2LA 4MB5A 1KM1A 4OUIA 3KBNA 2OEJA 4AQLA 5LYRA 3HM7A 1XI3A 4I7UA 1Z41A 4DQWA 3WNPA 2PTWA 2IXVA 3NL6A 5HWJA 2BY3A 2VCCA 2PDIA 4WY0B 4DO6A 2VGGA 3B4YA 4A05A 1FWTA 3N18A 4GCXA 2GK1B 4QDWA 3UEQA 3RN6A 2YOCA 4IWWA 2Y8KA 3W1MA 3ZS4A 3T81A 4G7FA 3ARRA 1YTEA 3QQ1A 4FNTA 3AHZA 3Q45A 4LCRA 1C92A 3CT7A 1UR8A 3H55A 4FXRA 2VZUA 1DIOA 4ADSA 7REQA 2W66A 5EFDA 3KLKA 3PHAA 5A6KA 1Y8BA 3P8JA 2WMIB 1NM9A 1MZHA 2O4QA 3PBYA 4MNJA 3W1PA 5CBBA 2G96A 2Y89A 1CTNA 2QJHA 4C7FA 2Y8UA 3H2AA 3EXSA 4EF9A 3WF1A 4DM1A 5BMXA 3VOIA 3A21A 3UWEA 1E71M 3M1ZA 3LV6A 4UQEA 1GZ1A 4AX7A 1MZRA 1Q2RA 1IIGA 5AOUA 4L5ZA 1GHRA 4QBXA 3PJUA 4A21A 1M68A 1ZAIA 4JKKA 3IV3A 3UR2A 2E25A 1W1PA 2Z1XA 2J7GA 2C15A 3AMLA 1OWQA 2E6DA 3BV7A 1GVOA 1PIFA 4JNZA 5F2IA 3SY5A 2QMJA 3AYRA 1TVPA 4UCFA 2YZRA 4BQ3A 1QO5A 3TFXA 4XO7A 1FWGC 3ARVA 1Q6FA 3WEMA 5BNKA 1MVYA 3DG7A 1QO2A 2DVUA 3OHIA 3SIZA 1PX4A 1C93A 3F7JA 3NM3A 1TV4A 1N8IA 5IBXC 3N4AA 5JMUA 3HPAA 2VYOA 2V3DA 4PBFA 1H1YA 4JNMA 3WK0A 4UTUA 3C61A 1FWSA 3UCCA 1GYMA 1KM2A 1UUOA 4ZQCA 4G8TA 5A6LA 5DXXA 3W85A 5B80A 4Y8FA 1WA3A 4LS2A 4ZB5A 1WQ5A 4QAWA 1QXLA 3BURA 5BXSA 1EDGA 7CGTA 3ARWA 1EUAA 1EJWC 2WMGA 1TR1A 3MCOA 2H90A 1R87A 2WB5A 1Q7QA 1PIIA 2YYTA 1PTDA 4BI6A 4F0MA 2WO5A 5ECVA 4UTMA 3CHFA 4QQUA 4JIEA 4DJDC 3O16A 3WSUA 4H6EA 2ZZ1A 1XLIA 3AS0A 2Y24A 3W28A 1BGGA 1VCGA 4G7EA 1THFD 1UP3A 2DIJA 1WAUA 4M6UA 1GQIA 4M7TA 3CHCA 2I9UA 3FNDA 4AF0B 1FCQA 4MB3A 2O0TA 2QCNA 3PUDA 3EA3A 5G5IA 1WO2A 1RVGA 4IIFA 3BAXA 3KEHA 2XZ7A 4UTTC 4IL2A 5FACA 1O4UA 3OPSA 5HINA 3G1FA 4MYAA 3GDKA 4QJ4B 1SZNA 2PWUA 2OSYA 1P1MA 5AHFA 5C2GA 3GC5A 3KM8A 5FJUA 2YA0A 1W3KA 4RE3A 1Z9AA 2YGYA 1NJJA 1DIEA 1TX2A 2ZRUA 4PTMA 3MSDA 1DQXA 1BHGA 3OQ8A 4HPJA 2FZNA 4AD3A 1DJGA 3AMDA 5EMJA 2GQ9A 1ZCCA 2WNNA 1RZMA 1R47A 4C7GA 4R7JA 1CXKA 3TOPA 3SEPA 4KRTA 5A1AA 1PIGA 4WSHA 2H3DA 2J9ZA 5C7HA 1RK5A 3BOFA 4QLKA 3OG3A 1W5NA 1DORA 1VLWA 2DZPA 4Q8WA 1XYAA 2OQYA 1JYXA 1EYEA 1L6YA 1JJKA 1Z44A 4BF7A 4FB7A 1UIPA 2XZ9A 2WQDA 1CT5A 3SCRA 2VFDA 4MJZA 2IS7A 1JZ7A 1JCXA 1V4YA 3OQEA 4KKXA 2WCAA 4EPDC 3LRMA 4KWUA 3NYDA 1K70A 1SW7A 4XKYB 2MNRA 7ODCA 1SUXA 3RPMA 3P3BA 4O54A 2NWSA 2NSXA 2O7QA 2V6AA 1UIOA 2DV0A 3TLQA 1MQPA 2ZBTA 3O7UA 5A8OA 3W1RA 3I68A 2A3EA 1WPCA 3ITYA 3TYDA 3VNIA 1VJZA 2F61A 1A0CA 4L1XA 3B40A 3NYZA 5ECUA 3BC9A 5CGMA 5C9RA 4QS6A 4LTSA 4HQVA 5D37A 3JS3A 4LCQA 3NQBA 3WK3A 1ZU8A 1G67A 1RV8A 2VEGA 3S5ZA 3B9DA 1MSSA 4HTYA 4XISA 4JTCA 3VIIA 1PYFA 2PDUA 4C6LA 4XIAA 3GDBA 1DIDA 3LV5A 1I0DA 4WKFA 3W9ZA 4MWAB 5G1YA 1P6BA 4OJYA 1D3CA 3LNPA 1ZL1A 3L4XA 4JTDA 2ZDSA 3WJSA 3MJYA 4RE0A 3M0LA 3P5ZA 3EYPA 4BR1A 2F7FA 1EPVA 3LDVA 5FF0A 3AICA 1BWLA 2ZWZA 5PTDA 1N82A 3A24A 4O16A 4GZ7A 3N15A 1OGSA 3GG0A 3EOEA 4DNHA 5CKSA 2OX1A 2PSNA 5AZ1A 3LCHA 1MXDA 3MUCA 4TV5A 4YTRA 1V03A 3CXOA 4ZR8A 3CMFA 4CCZA 3POCA 3CAVA 1H1ZA 3OVGA 2X2YA 5FKYA 4DX3A 4PR4A 3AALA 3BGGA 4I9MA 1Z6KA 4W4QA 3L4ZA 3B0XA 3ATYA 2G97A 1VQTA 3ITCA 1GW9A 3GVQA 4ZMGA 2J7BA 3IRSA 1DV7A 1JCJA 3KL0A 4K8EA 1XXXA 2J88A 5A94A 1VIWA 3L4YA 3BW3A 1C9DA 4X63A 1F6KA 2QDGA 1VLIA 2AGTA 1TV8A 1N7KA 1A5BA 3PG9A 3QC3A 4FR1A 1PVNA 4FNQA 4UQBA 3RU6A 4Y2WA 5GJMA 2PDBA 3KTXA 1RSCA 5BXRA 3MKCA 1Q63A 2A7RA 1UWUA 1FDYA 1G01A 3O2LA 2AKMA 3KUMA 3B0UX 3HGRA 2QV5A 2CZDA 1OF8A 1I1XA 3RCNA 1FRBA 4NT0A 4AB4A 2GGJA 4UOQA 2WJEA 1AVAA 4ACZA 1EF2A 4EWND 1V6VA 4AW7A 1UBSA 2ONEA 3C52A 3WK2A 4WXZA 3BG5A 1PDYA 3UXDA 3WQFA 1YNYA 3UJEA 4A29A 1BF6A 1R3QA 3H26A 4N4PA 3WD3A 3KBVA 3GUWA 4OTKA 3UW6A 1OFBA 3GQYA 3NM1A 3M64A 1M41A 1B3ZA 2AMGA 2GOKA 3IJ8A 3IK2A 3O0FA 3BZJA 1EGMA 4H01A 1VJSA 2MANA 2QGYA 4S3FA 3UWZA 3WD0A 1K8YA 2Z27A 3KE0A 1LL6A 4DWSD 3GG7A 4GOAA 1DKWA 3T0TA 3EAUA 3TKFA 1FWAC 5CC3A 1FHUA 4XAFA 3RCYA 3U5YA 1IT7A 4LF1A 2PDLA 2J27A 3IUDA 1V6XA 5D8ZA 3W1NA 2FZ9A 3AZRA 3SRFA 4PUUA 3AWNA 2XGBA 4ZO7A 1FWIC 3BAYA 2F6XA 5HANA 5FF7A 3VNZA 1B0IA 1IR2A 1PWLA 3GB6A 4QFUA 3O6YX 3K13A 4OGZA 4WX2A 1MUMA 2LLEA 3DFPA 5EBUA 4C6QA 2XPKA 5CSUA 4I6VA 3WQVA 4JTIA 2TMDA 3W7EA 5LGXA 3PJTA 3TXVA 1IXNA 3MYOA 3VNJA 1AQFA 2V69A 4UQDA 3UNDA 1R2TA 2DY3A 4MTVA 2ZRZA 3HQOA 3PJXA 1TRDA 4P8UA 2ZICA 3U2ZA 3DDMA 4BHYA 4TIMA 1OD0A 3RPTA 3P84A 3NCOA 3QZEA 3CT2A 3W2UA 2R1PA 1UH2A 4LT9A 3T4WA 3M0VA 3BLLA 3KHJA 4GD0A 4J3TA 3L12A 4BK9A 3SB0A 4KH2A 3ZSTA 1T41A 1V3IA 3PZVA 4PC8A 4JEQA 4O1FA 3MYPA 1QNRA 1W3TA 1ZNNA 1DJHA 2PDPA 3TYZA 3URBA 1X6LA 3WEOA 1E55A 2DFAA 1UUMA 4D6HA 2XIBA 4IP5A 2E4TA 1W3HA 5A6MA 1VFLA 1I45A 2H3BA 4CN6A 1EEPA 2WKJA 4JTGA 3M07A 4KFPA 4MWAE 4BWLC 3BCDA 5I24A 2OLAA 3ZT5A 4MAZA 4DM2A 1NQKA 3V5OA 3M43A 2WSPA 3VKAA 2ON3A 4CD8A 3BH4A 4R3UA 3FN9A 4AWTA 4L4OA 4F0KA 4CVWA 3LHWA 4W8AA 1H7WA 1DWHM 3KOFA 4RDVA 4L4LA 2CLHA 3OLIA 3VFLA 3HG3A 3PTDA 4LYPA 3BLDA 2B7NA 1BLIA 5K2ZA 3COTA 2QT3A 4OOZA 4TMBA 4E4UA 1XH2A 4NZ1A 3LSCA 3GR8A 5BOEA 2A85A 2WOQA 2JF7A 2WNWA 4LS1A 2PMQA 2FGBA 3TJIA 3VX1A 1IXOA 3TUUA 4NUWA 2RKXA 2G5WA 1F7BA 3NQ7A 1S2TA 1G7VA 1S2WA 2ZRWA 3LXBA 3H8AA 2AOSA 3WN6A 5ABHA 1IEVA 3LCXA 4A8IA 1ISYA 3SJ3A 4H19A 5EA9A 4KMQA 2TAAA 2YJQA 3C2RA 5IHRA 3TQVA 4EIVA 3QTGA 5E5CA 3TSBA 5K9CA 1TSIA 1YPXA 2V2DA 1R5YA 4HTBA 3LZ3A 5I7GA 1K9EA 1JPHA 4PCFA 1ESWA 5HJLA 2J66A 2WSKA 4YJ5A 3PZGA 5I06A 3QJAA 1L6FA 3W70A 3S6DA 3MDWA 7A3HA 3GG1A 4KBXA 2XSAA 1KXTA 3TWAA 1JZ6A 2QJGA 3STFA 2A79A 4E2OA 4C1NA 1ITCA 4AVOA 2X1IA 5HAOA 4GHRA 4P7LA 5AYIA 4JYFA 2AAAA 3PJWA 6XIAA 7XIMA 3LI1A 2BHUA 1O5QA 5I3HA 5GJNA 3TQKA 1DTUA 1HVQA 4JIIX 3VNKA 2VEKA 3UZWA 4IG2A 1XQKA 3NZRA 3UPMA 4YVXA 3AU6A 3LX9A 2XHYA 3PZTA 3E6EA 1TZ7A 1TG7A 4HPHA 4N6EA 2YW3A 4UZUA 4OZOA 1V7AA 2X1SA 3SJNA 2H8XA 3O0KA 4TVCA 3QY8A 4NZFA 1OYCA 4PUMA 2OQLA 5IFTA 4DF0A 4MIMA 4UB9A 1SZEA 4H9YA 3QQ0A 2CKSA 4LBRA 3WL1A 1YBQA 5E0CA 2BP1A 1OQFA 4HJWA 3M46A 5CJMA 3RRAA 2WWCA 4DWSA 4EAMA 1EOKA 5LA0A 2ZC1A 3TSMA 2ZVIA 1JCMP 1R8LA 1PAMA 5EB8A 1MW0A 4C90A 1A5KC 4ZO8A 2VR2A 1VCFA 4PMQA 2Y61A 2NV9A 4F8XA 5C70A 1HP5A 4JGDA 4Y7EA 2ZQ0A 3LCFA 3TP4A 3HF3A 3WMSA 1J2BA 4XUGA 1CXHA 5IHSA 3KOWA 4DZ5A 3FJLA 1VHNA 3NEVA 4UUIA 3E2RA 3VIPA 3W1AA 4D6IA 4JQ3A 4GYKA 5BYWA 2FZDA 2R91A 2E7FA 2REQB 3IUIA 5IDIA 4AU0A 4G6CA 1W5OA 2QUTA 3S1XA 1EFZA 3VKCA 3CUGA 1POJA 3DZ1A 1EGVA 4ROQA 2G3FA 1D9EA 3CQ0A 1TWZA 1W6TA 3GTHA 2XG9A 1YDYA 1T5AA 1YHTA 2BVWA 4NJIA 3GY1A 3G0UA 3LYEA 2JGYA 4W7UA 4GX9A 3G3DA 4F79A 5I03A 3R79A 1LLOA 1V02E 3BJFA 1FWFC 2RDWA 3ZJ6A 1IV8A 5JU6A 3PP7A 5HWMA 3MDUA 4RX0A 4YTTA 3FKKA 4LAKA 4CKQA 1VEPA 2YKKA 2EKGA 2C8NA 1QRQA 4M81A 4MAVA 2GSHA 4M19A 1DOSA 2E5BA 4FEZA 4RNJA 2WZEA 2ACUA 2VZSA 1SSDA 3N04A 5CSRA 3LQGA 2FZBA 1KGUA 1A5NC 1K6AA 3CIVA 4RDZA 3KLLA 4A3HA 3ABOA 1OT1A 4PGLA 3LK6A 2DT1A 1YIXA 1DHPA 1J79A 2JK2A 3CIWA 3MJMA 4W87A 1JZ5A 3ATZA 3QY6A 3CHVA 3E2QA 4QRNA 2ZRVA 1BSIA 3VM5A 4WGHA 4I5UA 3UVIA 1RK6A 1UZ4A 2TRSA 5C71A 2ATSA 1VHCA 1GYLA 2X41A 3W7KA 3UU0A 4PL2A 2YXGA 5XIAA 4AH7A 4Q7NA 1CX9A 3ZO9A 1I60A 5M3WA 2WLYA 1WV2A 3LOTA 1LP6A 1Z32X 4HSHA 3BARA 3QFWA 3GRIA 3DFOA 4EX4A 4H8HA 1CENA 1XV8A 1O5RA 4V1XA 4Z2KA 4S3AA 4IIGA 1O94A 3IJ9A 2YBTA 1F3TA 1F9CA 3QOKA 2VC6A 1TPFA 1JRBA 1C8VA 2VX5A 1JD9A 3BCFA 1J6OA 3WNLA 2QF7A 2EG6A 3I3EA 5H1WA 3PZ9A 5AHMA 4AIBA 3GU2A 2CLFA 4Z0SA 1CDGA 4JOMA 1SJCA 4ZBCA 4AWUA 1W8GA 6XIMA 4K7VA 1I2RA 1ZJHA 4K6AA 2XVKA 4JTSA 2RDXA 3AUOA 1AA1B 3VD7A 3HPFA 4NJHA 3ITGA 4LBSA 3L0KA 4J3UA 1J12A 3WUGA 1DIKA 4Z2JA 3SADA 4G2DA 3APYA 1OCNA 1US3A 1X6NA 3EMQA 3FHQA 2OZ3A 4GVFA 1HIZA 2XVGA 3CHEA 1JDEA 3ITXA 2CBJA 3KAOA 1GKRA 4EXBA 5HNTA 4FO4A 1EZ2A 2RH9A 5BW6A 1J11A 1RBAA 3UG3A 3HIJA 3N4FA 4BEQA 4CNTA 1Y7VA 3E0LA 4W93A 1GKQA 5CZ0A 1X39A 2DT0A 2UV8G 1JYNA 1KXHA 4FLQA 8CGTA 1XDLA 4U28A 3IEBA 5FF4A 2CXEA 3RO8A 3ONBA 3UG5A 3WELA 3GHRA 2VR4A 4ZSTA 1JFXA 2AL1A 2C1HA 1YRRA 4DO4A 4JY9A 3EOUA 1EL3A 4Y8EA 3WQ6A 1N2VA 1RVKA 1SPQA 4QIUA 4XAGA 2QCEA 5BRQA 3G1RA 1Q6RA 1TQXA 1H1NA 4PMRA 3TVAA 2X0HA 1DJIA 5J8LA 3IGUA 2GGIA 2JKPA 2V2CA 1BF2A 4JR5A 5CJNA 3T08A 3AS1A 1KWKA 2DZVA 4XVEA 1KXQA 1PZ3A 2WLZA 3EDJA 3BGJA 3V35A 2CWXA 3QR3A 1GVYA 3MS8A 5HMDA 5LA2A 2ZUUA 3SUUA 1G4SA 4K36A 5MKGA 1CYGA 2XTKA 4GZEA 5A8PA 1DE6A 4LEQA 2RGLA 3WUFA 1SR9A 4OHQA 4LANA 5AVHA 2F8QA 3DFSA 3RGTA 5EMUA 3ZWTA 1TFVA 3CYVA 4NAFA 5U7SA 2IPWA 4CNUA 4N7QA 2FDSA 3SQLA 5C55A 3EZ4A 3BK0A 2OT1A 3ZFHA 1PBGA 3LLXA 2Z25A 3PSVA 4PB3A 3OGVA 4IT1A 1S5NA 3R10A 3V5FA 3NSNA 5CLWA 3QYQA 3T8QA 2Z4GA 3LLFA 1LBFA 3DH7A 3W2NA 2WZIA 3ID7A 3RILA 3TCEA 3RXZA 1JI2A 4TVUA 1EUNA 3P74A 1S2VA 2QPXA 4IX2A 3WLKX 4JKLA 4M5PA 3AU2A 4Q8VA 1IT8A 2H8ZA 5CXPA 1W1B1 4GE8A 2A3LA 1HP4A 1W1YA 5K4ZA 1AD1A 3CZKA 4DF2A 5CAKA 2BS9A 5ABGA 3AJ7A 3ZLHA 3RU8X 2PTYA 5E9AA 3R11A 2XJ7A 4EP8C 2ZX7A 4LNYA 3T05A 2DQXA 4XD3A 5ABTA 3CTLA 2ACQA 3SECA 4D1IA 1DWFM 3IAPA 3W1XA 1XJBA 4NNAA 3QW4B 3QV8A 4O18A 3R0KA 4HMEA 2ZZ2A 3CUHA 3LGDA 2ODOA 4RPQA 2FTWA 4BQ2A 4O1DA 3SCVA 1XLDA 1EXBA 3IVSA 4M7SA 4H4IA 1A4MA 4WJXA 3PZMA 3G8EA 1XH0A 2W9MA 2Q6ZA 2J7CA 1UJPA 1ISVA 1CI1A 1XDJA 4X60A 3OYXA 4CNNA 3WBXA 6ALDA 1ZHAA 4Y9MA 4KRUA 5FJTA 3F4DA 5F7UA 4QSFA 2DVTA 2B7OA 2A3HA 4ADUA 2DDXA 2Y6ZA 4AZBA 5KTLA 3LPPA 4UR8A 4C60A 1K4HA 1V79A 5L9FA 3B8IA 3P61A 2PP1A 5T9BG 4X3ZA 3CO4A 4X9SA 2ZXAA 2Y7GA 2W67A 1F73A 4GYJA 4WY0A 4AZIA 2YDAA 1PX8A 3NQMA 2GK1A 1DXEA 1OJXA 3EMZA 1GTEA 4GMEA 1YEYA 3OG2A 1BYBA 2A21A 2ZZ7A 2XWDA 4B3LA 4AUBA 2QCGA 1SU5A 3O8AA 5A6BD 3TR9A 4ZCWA 4E4FA 4O0KA 4CEXC 3B8TA 3F4CA 4O28A 4JFWA 3W1TA 5GNYA 1V6TA 3S6TA 1UKQA 2WMIA 4JS3A 2V81A 2Q8ZA 4MWAD 1ZBVA 4KESA 1W91A 4MNMA 3MUZ1 4AWSA 1US0A 1OG0A 1UR9A 7ENLA 5HNRA 3A64A 4HZ6A 3AIWA 2CU0A 1E6RA 4XTDA 3UG8A 2A7NA 4QROA 4C6CA 3GNDA 3NEHA 3PUEA 4LRTA 3ZJKA 1GOQA 3GDLA 1E6XM 4WZHA 1ZJBA 2QCLA 1R9YA 4D6JA 2ZXDA 4JFTA 1OFQA 1H11A 4JIQA 3JR2A 3BMVA 4A3YA 4S39A 2NX1A 2IPJA 3QPYA 2BDQA 2QNEA 1IHIA 1ZFJA 1UD4A 2PDXA 4BKNA 1FTXA 1P0EA 4E5TA 3GDRA 2PEVA 2CBIA 1ZQ5A 4D6FA 4CQAA 3GHUA 3TW6A 1Z89A 3ARXA 4G56A 3CLWA 1P7TB 2P5NA 4RZ5A 3LHYA 2NQ9A 1XUZA 2E8YA 1SJBA 3GD6A 2DH3A 4KCWA 1X98A 2DP3A 2Y7FA 3RLHA 4IICA 1WP6A 1DJXA 2PZ0A 2PC8A 3TC3A 3VNMA 2W4XA 4TTUA 5DCDA 4R33A 3WEZA 7PTDA 4ZOEA 4L7ZA 5D4YA 3WBYA 3QZ6A 4LPCA 4DAIA 2VENA 2DT2A 4IPLA 3IGXA 1M04A 2HK1A 4RXFA 2PF8A 4HZ7A 4AEOA 4GVGA 1RCQA 1WKFA 3B05A 1HQTA 1M53A 3BCJA 4Z2LA 1QNQA 1AW5A 2KZHA 4GYFA 4YHGA 2CBVA 1QFEA 1WAWA 4H04A 1CGTA 4IMGA 1ITXA 1OFEA 4H8UA 3CC1A 3NSMA 1XKYA 3L66A 3T07A 2V9DA 2WSQA 3VX0A 2EPOA 3OTRA 4LSBA 2Y7EA 5HUPA 1V0NA 3K8LA 3UWQA 3FJNA 4Q33A 1WDRA 3I7SA 3GWQA 1LJYA 2HXTA 1NH6A 3HV8A 3WL0A 4D6CA 3IARA 1XICA 2E6FA 1H51A 1IE7C 3LCWA 1DQUA 1E1CB 4AF0A 2J77A 4P8XA 1V77A 1Q66A 2PBGA 1W1IE 1CB2A 1AW1A 2OKTA 5EY5A 4HZMA 2P0IA 1ADSA 3R0UA 5M03A 5EPDA 1NFBA 5HK4A 4GA8A 1SMDA 3GR4A 1OC7A 4PN2A 1QK0A 1UASA 1KNWA 4MGGA 1TMLA 3VIHA 2OSWA 2VWSA 1CB7B 1HW6A 1NSJA 1FWRA 1QCWA 1X1OA 2I7GA 1GONA 4HKPA 4U4MA 1CXEA 4IOTA 1QTWA 4MYXA 1MMFA 3WNMA 2VFHA 9XIMA 2C1GA 3R12A 3GH5A 3E38A 1W2PA 4QP0A 1P0BA 3S9YA 2YB1A 5LSMA 2VRKA 4H8VA 1NOWA 1Q5MA 4LOCA 3VMPA 2XVPA 1SM9A 1H09A 4DLMA 5HMSA 3QW3A 1XIIA 2R14A 1GQKA 3WLMA 1RA0A 2GOUA 4GI6A 3CM4A 4YYCA 1MFUA 4QE4A 5HATA 5DO8A 3QH2A 4C6EA 3D3FA 1KM5A 5HR7A 1ICSA 4XKYA 5ABEA 2QEZA 1A47A 3OGSA 3O63A 2WM1A 3DC0A 2YB4A 4HHHA 3DFQA 1CXIA 2AQVA 5JXQA 2WMKA 1JF5A 2X40A 3VDBA 4O8RA 2HPMA 4X9YA 3B3DA 1VPXA 3LPOA 3RRXA 1ME8A 4KW2A 1EP2A 4OUEA 4W86A 3EXTA 2ZUWA 2WC7A 1E3ZA 1JG9A 2V0TA 2CLEA 2HNHA 2PB1A 1QPKA 4AD5A 4UQCA 1M7PA 1LWHA 4QJ1A 1FXQA 5AY7A 3HG2A 5A6BA 4CNPA 2HWGA 3TYEA 5JUVA 2CETA 4I3GA 1OFRA 1UC4A 1GNXA 3BLEA 4MWAA 4EXQA 4HK7A 2DZTA 3HOJA 1V3KA 4U5KA 1M1BA 2VJXA 3SW6A 1RLDA 4KIRA 2YCIX 3B8SA 1CXFA 1TCDA 1JZ3A 1DXFA 2ACRA 3DXIA 1TZ9A 4ZFCA 4GISA 5C0QA 1VPQA 1X97A 1E73M 1F6YA 1L6WA 2GJNA 3QQWA 4C6FA 1JCTA 1OIMA 2PGWA 3AIRA 3P0XA 3W00A 1A3XA 4E38A 5HR6A 2J24A 2QKFA 1SW0A 2UZ9A 1XLEA 3WFAA 4MB1A 1G5AA 2DSUA 2W91A 1XL9A 5HNUA 3E5PA 1QHPA 3PTQA 4D2JA 5FJIA 4F0HA 2WW5A 1FHLA 1W3IA 2HMCA 4ECLA 1TV2A 3QHNA 3CZEA 3WMLA 3TA9A 5D9NA 3C4UA 5G2WA 4GQGA 4HNCA 5FSEC 3WDPP 4RW5A 3RLUA 3KZSA 1UKTA 2P53A 2VX6A 3RM9A 5H8MA 3O15A 2CITA 1XGDA 1C90A 4CGTA 2IPFA 5LIXX 1NFPA 3ITLA 4EPEC 4NJJA 4FIQA 1IWAA 3VYLA 4MB4A 3KOXA 3VGFA 3GHTA 1REQB 3GTFA 3IJ6A 5DANA 3UCQA 3UT0A 3ZR5A 5I3GA 3LERA 3VNLA 1VCVA 2XISA 1JD7A 1EHAA 2B81A 3EGJA 3PANA 4B91A 1LT7A 2Z1WA 1ZRQA 3W7QA 1FBAA 1VBRA 3AIUA 5HNNA 3SCTA 4HD5A 1ZS2A 4JQ4A 5FESA 1J5TA 4HU0A 5LNRA 3A9IA 2VWTA 1JDDA 3VO0A 3FEQA 5EYWA 1E6ZA 1H41A 4D6DA 2GGEA 3CWOX 3TAOA 4JL2A 1ODZA 1XUUA 1VFTA 1N55A 2EPKX 1T6MA 1O66A 1ZUAX 4XVDA 1DXIA 3NDZA 3FFSA 5D2VA 4AIUA 2Z29A 4IUGA 3SCUA 1EX5A 5DRIA 4UNIA 3WQ8A 3RHGA 4I8DA 4YCOA 1QWKA 4HZ8A 1ZJIA 1TZZA 5TAOA 2YL9A 3AWOA 1KBBA 4S1FA 3QV9A 4W85A 1A5UA 3EWUA 1H3GA 3PNZA 5I02A 3DERA 3LNMA 4LY8A 4H7ZA 2VUNA 3ABQA 4IX0A 4A8NA 3WNNA 1MUCA 3LGGA 3SSJA 1HNYA 2E67A 1H7OA 1J18A 3TEVA 1Q65A 4E8GA 3FW6A 3WJXA 3UERA 4LUSB 1EJXC 3O06A 4ONVA 2JE8A 3M5YA 4YVVA 5LGZA 3GNOA 3HGJA 3HB9A 1X8CA 3VAVA 1WDPA 4MKVA 3MMDA 2QJJA 5H91A 4YU1A 2JFEX 2AL2B 1P0DA 4H8NA 4MG4A 4HNLA 3GYEA 3RM8A 2CLOA 2E40A 4EPBC 4N02A 2WVVB 1QU4A 4WEVX 2DSVA 1G94A 5TD4A 5I6SA 1TA3B 4OOUA 1KFCA 2VT0A 4IH3A 5FL1A 5DF0A 3UPWA 2Z1SA 1XPGA 4YTUA 1UG6A 3OJGA 3F5KA 3PFRA 1CGWA 1T0OA 4KWWA 4ORIA 3ZM8A 3ZWSA 4Z42C 1R85A 4FLRA 4PA8A 1TQJA 2G3IA 1TTJA 4MMWA 4M3PA 1A53A 3LTSA 1I2PA 4N9BA 2ZX6A 4UBPC 2PDCA 1EDTA 2PU1A 3TN3A 2PLKA 4PUEA 4HA3A 3BLIA 1KRMA 1KTCA 3GAYA 1NEYA 2J7FA 2GWNA 2L5HA 1TWDA 1AW2A 1XPYA 2QF8A 4TVDA 4YHEA 2VD9A 3UZZA 1GWJA 2WHLA 5FAJA 4GY0A 2XIQA 1E9YB 4NU7A 2CWNA 1K8CA 2I1OA 4QG9A 1PCKA 4RV3A 1S46A 4XKMA 4V15A 1LYXA 3BXWA 1S2AA 2QCDB 3GW3A 4FOKA 3CU2A 3N29A 1QT1A 3P6LA 4NX5A 5HJYA 4BI5A 1NQ6A 3WQEA 4EAYA 1UH3A 3LPGA 4MUPA 3ZOAA 1ADOA 5I79A 2POTA 2B4GA 3S5OA 1Q85A 1SFLA 4DXXA 3TZFA 3LN3A 3CB3A 3TONA 1RHCA 2W3ZA 1ZBCA 5LIUX 1W37A 3PAJA 1KV8A 2A6LA 4ATWA 4DUOA 3A9BA 3ONCA 1RD6A 2J8FA 2UWFA 1I2OA 2WC3A 3W1LA 2FMOA 1GTHA 4BWLA 2OCZA 4UQAA 4GO9A 3IUHA 4ZXOA 3HMJG 1EO5A 1TE1A 1F3XA 4ZGYA 3SN0A 2VELA 1SMAA 4GK8A 4Z08A 4IF2A 1F6PA 2BB0A 2X0SA 3MVIA 4LRSA 1JRCA 2YLAA 4GIAA 3NVTA 3EX6A 2VMFA 4GRSA 5BMWA 3ABXA 1NFGA 3WH8A 2D20A 4P7NA 3BLFA 4XAZA 4JZ5A 3QVQA 3LGEA 1PJ9A 4CU6A 2GL5A 4XZLX 3SZ8A 4Y96A 1ZTVA 1W3JA 2J78A 2W61A 2W5FA 1MQQA 3BW4A 4DBSA 5C9XA 1EJSC 5B7YA 3OIXA 4GNVA 2J9YA 1R9XA 1GZJA 4PZVA 2GQ3A 2YFNA 2WK2A 3R2GA 3VCRA 2QR6A 2BVTA 2ZUVA 3BGAA 2FFIA 1JPDX 3EX1A 1J93A 2QLYA 3QGKC 3DAQA 4CQDA 4C91A 1B9BA 5I78A 4PB5A 3G18A 1Y5WA 3PR2A 1T8QA 3S4TA 1EF3A 2GVYA 2WMFA 3T9PA 3H2EA 4HHMA 1KA9F 1XLBA 1JF6A 3VU2A 3PBWA 3LS9A 4E8CA 3G3MA 1A5OC 3OZYA 1OD8A 1B9ZA 1U2YA 4HSOA 1LQ2A 3DHUA 4GNJA 4B5UA 3O3RA 3KBSA 1OX4B 1SO3A 3AOFA 3LUTA 2QUUA 2DT3A 4AZGA 4PEKA 2QW5A 1J6PA 3QGVA 2R9RA 1P6WA 3L4TA 2VO5A 2F2KA 4U33A 2WSRA 3CAKA 4NP7A 4DWSB 3GFYA 3LRLA 4BFAA 4GUHA 1Q45A 4D72A 5F2GA 5CG0A 5FL0A 2PPGA 1GYNA 2BXZA 3VA8A 6CGTA 5D2WA 5F1UA 3FKRA 5XIMA 1XIEA 2RDTA 3W2MA 3SGGA 4LS0A 1TRIA 2ZZ5A 3OBAA 3SSZA 2V3GA 1M9HA 1ISZA 1XISA 4Q3MA 3USZA 5I3KA 1FCUA 4HOWA 5EFFA 4D6GA 2B7QA 3KCLA 2ZUMA 1Z3NA 4GIYA 4D8AA 2WHKA 2J4GA 2C7FA 2Y88A 4PFHA 3P82A 4O52A 4OQVA 5AHIA 3WDJA 4RZ4A 4YN5A 3TQ0A 4QE1A 2OTDA 2D2GA 3A12A 3U2CA 4TU1A 1LG2A 2REQA 3MB9A 5A2CA 4XB3A 1ZSXA 4GI9A 2C3ZA 5DMLA 3UJFA 2WKLA 4WJEA 1W9BM 3NTYA 1WDQA 4H83A 4TX9A 3RFAA 3WLSA 2UY4A 3PBMA 4LALA 3QFEA 4UTWA 1XG4A 4H9ZA 5E6YA 4HYWA 1E72M 4ROPA 3VZXA 2DQWA 3QHMA 2W79A 1HJVA 3U2EA 1FFRA 3E2VA 3DUGA 4PRRA 1G4TA 2P3EA 2FQIA 2GDQA 1U30A 2WBKA 4JDYA 3KRBA 9XIAA 2TYSA 1B4KA 4FOJA 2VC9A 3H70A 5FEZA 3I7RA 4EK7A 1TB3A 4JTEA 1C8YA 4H7VA 3PY2A 2CLPA 4JTLA 3TTSA 1TCMA 2PDMA 3UXIA 1XH1A 2YPIA 3UWYA 1ME9A 4LYQA 1UMYA 1YX1A 1KO0A 1TJ2A 2DORA 1N8WA 1AQHA 4TQTA 4K37A 4DXKA 4Z2HA 3L7RA 4C6IA 3UWVA 2Z26A 2VP8A 4NHVA 1FWHC 2WBGA 4S3BA 3VD3A 5LIYX 3B8WA 3DOPA 4CCCA 4GQBA 5JH1A 4XZHA 4ATLA 2JGQA 2PDGA 4DZIA 3BICA 2HBVA 1HG3A 4HHLA 1U1UA 1I0BA 3AO0A 4X2PA 3S0CA 5K4XA 1MI3A 2GUUA 3S2JA 1NVMA 1XW8A 3AC0A 1Z48A 4B2DD 4UFMA 2JIWA 4LUYA 2P88A 3DBNA 2NSOA 1J0IA 2D0FA 3QM3A 5D38A 1B3OA 1ONRA 1WKDA 3W7RA 3LSBA 2BFGA 3JZEA 1A0EA 5BXTA 5EGRA 1EHNA 3S47A 1B3VA 1D3HA 2YSWA 2CLIA 1E9ZB 4RNIA 3RNDA 1CZ1A 3CBWA 5DT7A 1TMQA 2Q71A 3TFCA 1XBZA 3IJDA 4X22A 4WXYA 2KAUC 3M16A 3SUTA 2QUVA 4YIWA 1V6WA 1C7SA 1YDNA 2ADAA 1T7LA 2R1LA 4IFKB 3LHUA 2VDHA 3B06A 3YPIA 1KCKA 3GXPA 2VVSA 3TN5A 3S2MA 4Q22A 3U9IA 1RH9A 4Q8OA 4FK9A 2OOGA 3MA8A 4B5XA 4F48A 4H3DA 1XYLA 3A5VA 4BF5A 1BG4A 3L9CA 1FOBA 4D9PA 2HV5A 1UW9A 3PWAA 4KS0A 4B5WA 2PTDA 2ISVA 3PF3A 1JXJA 3VOFA 1J01A 1I4NA 3CLMA 3E02A 2XINA 2GQAA 1VFFA 2J25A 4NX0A 3TC6A 2GPTA 2WAGA 1BVWA 4AISA 2J7HA 4Q7BA 1TIWA 3PBUA 3C2YA