3QEZA

Crystal structure of the mutant t159v,v182a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
MDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSVRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/lyase inhibitor
total genus 83
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qezA00
3NO5A 5FEXA 1LZOA 1EP2A 5DELA 4GUFA 2WJZA 3A24A 3BGJA 3EKLA 3W87A 2FFCA 1H7WA 4O17A 4ICNA 3ZWSA 3E9AA 4QNEA 4UFJA 3ZS4A 1LRNA 3QW3A 1YDNA 2Z6JA 3QQ0A 3W7CA 2WSQA 1EIXA 3W84A 3W2LA 3JS3A 3EWXA 1JCNA 1QAPA 2LLEA 3LERA 1FBAA 2QKFA 3WK3A 1BWKA 1RR2A 1XM3A 1KM4A 4K37A 3W2KA 1AW5A 3N19B 3S42A 1PHQA 3FFSA 1KBJA 4HN4A 1I2RA 4LT9A 4O1DA 3GLCA 4PEKA 1DL3A 3UZ5A 5DY2A 3KFTA 2V2DA 3DFQA 2KZHA 2ATMA 5TQLA 3W7QA 3BV4A 1TTQA 2H8XA 4UC5A 4MYXA 1J2WA 2E77A 4DQWA 3KRSA 2NXGA 1NF0A 2ZRVA 3LCGA 1VZWA 4DPPA 4UXDA 1OVDA 2VFDA 2EPHA 2VFHA 2XN2A 2Y88A 1F7BA 1TJPA 4RR4A 5L6UA 2G97A 1ZALA 2QCLA 1GJPA 5CKSA 1EUAA 1ALDA 4GUHA 2DZXA 4JN6A 5C6MA 4LRSA 2E5CA 1RZMA 1O4UA 3TAOA 3P8IA 1P0KA 1OX6A 3HPZA 2DU2A 1RPXA 1C9DA 3IRDA 4S2BA 1T0OA 1QR7A 1M7PA 5D04C 2BZNA 3QH2A 3W23A 3WJZA 3T4CA 5G2IA 1LBMA 4WY0A 3GX9A 3NAVA 4NXKA 4RZ6A 3UZJA 1ME9A 3MHFA 1OYAA 3TFCA 2CLKA 3Q58A 3T78A 2C18A 4O12A 2FQIA 3EWUA 3R8RA 3S5YA 2E6DA 5AHFA 5AC7A 2EKCA 4MVAA 2NWRA 1MEWA 3HG2A 1OF6A 4EOUA 1FQ0A 4JNMA 4WY0B 4PC8A 3M0ZA 4N9EA 3LHUA 3NQCA 1XI3A 3BG5A 1KFLA 2V30A 2ZZ5A 2JGYA 4QQ3A 5FF4A 4Y8FA 4AWUA 4WX2A 1MXSA 3LI1A 3HGOA 4MZ1A 2QAFA 1JUBA 3BW2A 2WO5A 3LCHA 5FF7A 4HKPA 4JTSA 1FX6A 2XN0A 3P82A 2ZZ3A 5KZMA 5LNUA 5A8GA 4UR7A 2CFFA 1LBFA 1TRIA 4LVGA 1UCWA 4O4VA 2J27A 3NDOA 3CQ0A 2E5DA 4X22A 3G1SA 4ORMA 1S5WA 1QNVA 4FIRA 1PCKA 3W7IA 4OE7A 1FWSA 1SZEA 2WV8A 3TQVA 1W54A 1I2OA 5AC6A 3TIMA 4LY8A 2ZA2A 4JIPA 4LW7A 1JCMP 3PSWA 4PA8A 3TMLA 3BLIA 4IX0A 4LV9A 4CCEA 3TX9A 2BLEA 3O1NA 4O1AA 1RD5A 1EA0A 3M5ZA 2DZWA 3DFPA 3GR7A 3NPVA 2BWGA 4UTWC 4BI6A 3R2GA 2G95A 3DGRA 3IVSA 4ZQNA 4OQVA 3JR2A 3W7HA 4NUWA 3S8HA 1LOQA 2Z6IA 3LX9A 1LLZA 3PBVA 4NJKA 1X7FA 5K4XA 3IVTA 3U2OA 4BWLA 3C6CA 5D03A 1FXQA 1KBIA 1PL9A 1ZNNA 3F1QA 3QJAA 3RF9A 3UWWA 3O15A 3B8DA 1H1YA 3LBCA 1SR9A 4AMAA 2X1RA 1SZFA 2Y85A 4XBSA 5KZEA 2QCMA 2ZZ4A 4QIUA 5E1QA 2B0MA 3P8JA 1BKSA 1VYRA 3EXSA 3B0VC 4ZQMA 3HF3A 1FDJA 2DJXA 4JDYA 4MUZA 4AWSA 3TJXA 3QC3A 3F4WA 5K7JA 4LU0A 3TW6A 4D2JA 4PCFA 3O6DA 2VC6A 3MP4A 3IIXA 3W1RA 3NG3A 1IXNA 4K8EA 1VH7A 3S1VA 1IGSA 4C1KA 2A1YA 3GR8A 3GXPA 3QMTA 5K9DA 1FXPA 4N02A 5HUOA 4ZVJA 3M5XA 4WUIA 1O5XA 3KXQA 2ZTKA 4I7WA 4A3UA 2VFEA 4A21A 1VGAA 3OHIA 1IIGA 4JTFA 5LNWA 3MP3A 1VHNA 4HNNA 4DO4A 4O54A 1K03A 2V5LA 1K7FA 3CLMA 5DN1A 4AEOA 3PB0A 5KZDA 3L5LA 4IPIA 5FF0A 1Q6LA 3OVQA 1JQVA 4UTTC 5H91A 2BSLA 2RDUA 3C61A 2NUWA 1ADOA 4IX2A 4U4MA 5H2ZA 1WDWA 5HJLA 4IMEA 1EEPA 3GDRA 5AHEA 1OX4A 2ZA1A 3HBLA 1GEQA 4R34A 1MEHA 1EWEA 5HQEA 1XL9A 4DF0A 3WK0A 1KM6A 1QMLA 1LOLA 1D3GA 3W7MA 4CQ8A 2QCFA 3G1VA 2Q8LA 3KVMA 4HHPA 2WNZA 1PVNA 1H61A 1J5TA 1O60A 4JX6A 1S5TA 4GJ1A 4FNPA 1LOSA 4AVFA 4NNCA 3WFAA 3IGUA 1L9WA 4O4WA 1R2SA 4O57A 4M6PA 2QCDA 4RCXA 2ZBTA 1H1ZA 4NZFA 1GT8A 2VENA 4NJGA 4CLMA 5AFDA 1OFPA 1H60A 1V7YA 3NQAA 2WSRA 3DFSA 4O50A 4TIMA 3LHVA 5EYWA 2Q3RA 4MZYA 2J24A 3HJZA 3CIWA 2V8ZA 4FX6M 3P5ZA 2Z1BA 4O18A 4CNOA 3TQ0A 1WX0A 1TTJA 4GNJA 3TJLA 3W1TA 1G4EA 1YXYA 1W37A 4LUIA 1JVNA 1ME8A 4OV4A 1A5AA 1D9EA 1GVFA 1TCDA 1UUOA 4PL1A 3W2MA 4QAIA 4OV9A 4TU1A 2PC4A 3LCLA 2YFNA 3HIJA 2DZSA 2ISWA 2FJKA 3LV6A 2AGKA 5CG7A 4FNQA 2RDWA 3I7RA 2NXHA 3N34A 5AHNA 4XBKA 3NQ7A 2RH9A 5D2XA 1TQXA 2I9EA 1FDYA 3AJXA 4OHQA 1GYNA 5LNSA 1G67A 2I1OA 3VE9A 4XZ9A 1EB3A 4UFLA 1H51A 5I3KA 5G4EA 5D02A 1QOPA 5IBXA 1U5JA 4UTJA 2ZQ0A 4GXMA 1QPRA 3GKAA 2HTMA 1CX9A 4LS0A 1W31A 1H7PA 3F4NA 5G1YA 4YCOA 2A6LA 5AHMA 1RQEA 3C4UA 3G0XA 3CEUA 5F1VA 3STFA 4R53A 3R89A 1IF2A 1H5YA 1DBTA 3W22A 2ZDRA 2FDSA 4RV8A 2YX0A 3CEPA 1WAUA 3NL2A 3B04A 3GAYA 3P80A 4N9CA 2V82A 2QDHA 4CQ9A 4DO5A 3BK0A 1BEUA 3MBDA 1I2QA 3OA3A 3DU0A 4L4MA 4DO6A 1XBXA 3W1NA 2A85A 4B5NA 3LTPA 1DHPA 1S5VA 3H53A 4NT0A 3TC7A 1PS9A 3KVJA 3TU9A 4NJHA 1ZAHA 1TPVA 4LTSA 4JYEA 2NX3A 5CPNA 3DFTA 3NM3A 1WBJA 3QYQA 1GVQA 5LSMA 2C3ZA 4DF1A 4ZZ9A 5KINA 1Z41A 3LV5A 5FEPA 3W6YA 3P67A 5IBXC 3W7DA 3KAOA 5C2XA 1KFCA 3E96A 1XBYA 2QAPA 2J9ZA 1JQXA 4QSHA 4FHAA 1FWNA 4FF7A 1F6PA 4NNBA 4FEZA 2VKZG 2F7FA 4LC6A 2H6RA 4ZQOA 1XFBA 3QSTA 3HG5A 2V0TA 2OT1A 3HG4A 3NR0A 4NX0A 2HS6A 4UTMA 2ZRUA 2J88A 1XBVA 3DZ1A 1YPFA 1H7RA 3MO7A 3LHYA 3PVFA 1TRDA 2G5WA 3W1XA 2V81A 3EXTA 4K8HA 2NWSA 3VNDA 5EY5A 4UIOA 3CTLA 3L65A 1JUEA 1KV5A 3Q37A 5BMXA 4O19A 5HWMA 4HIBA 3W83A 1MSSA 4FNSA 2JGQA 4JYFA 4RXGA 3B4UA 4BK9A 2YXGA 3TXZA 3CU2A 3S6DA 3NQMA 1LTDA 3OG3A 1LBLA 4LVAA 2TMDA 2NX9A 1W3NA 3QSRA 3WK2A 1H7XA 2QF7A 3QFEA 4O8RA 1W5PA 3STCA 5AHIA 5K2ZA 2NV1A 1TO3A 4A29A 3TH6A 5LGZA 1Q6OA 1G4TA 4CNNA 3V75A 2ZZ6A 3HGSA 3UPBA 2ZCGA 3UYCA 3N9RA 3NQ2A 1MEIA 5LHFA 1WBHA 4PL2A 1IXPA 3DKLA 3MJYA 1GVOA 5AYYA 3CT7A 3O07A 4I9AA 1G4SA 1OABA 3HGRA 4JY8A 1PV8A 1ZY9A 5C5YA 3L67A 3O8AA 1DJQA 1WYIA 6TIMA 3LCWA 2Q8ZA 1TPB1 1DQXA 1F6KA 3O6YX 4NVTA 2Y6ZA 2V5BA 2TPSA 4K38A 4JDBA 5F4SA 3WJWA 3QW4B 1W56A 2P10A 4LVBA 3G1XA 1VCFA 3BW3A 1KM3A 2P1FA 5K4ZA 4JTLA 4OGZA 1HUVA 2NUYA 3ABSA 2B7NA 4IMGA 2GPTA 3LHWA 3DFOA 1L6YA 1W3IA 3NQDA 3E12A 3GAKA 5CSSA 1T8XA 3TFXA 3WK1A 5HWNA 3GDLA 6ALDA 2FB2A 2A4AA 4WY0F 1QPNA 3N73A 3M1ZA 3PS7A 3M7WA 3G1DA 1B9BA 2DZTA 4YMZA 1HO1A 4UMAA 1YDOA 3M41A 1GZGA 3UY8A 3S5ZA 1TB3A 4YL2A 2RFGA 5DCDA 1GOXA 4RKAA 5F4XA 2CLLA 1TSIA 1FUYA 1ICQA 5DBTA 3UXDA 1DJNA 4NNAA 4DEFA 3P62A 4MY1A 3PWAA 1P5BA 4QITA 3I7QA 2RKXA 1EPXA 1JCXA 5LHEA 1M6JA 3A23A 4EIVA 3SY5A 2C13A 2NUXA 5BNKA 1VYSX 1B4KA 3C2RA 2DJLA 4MZ8A 3UWUA 5D2YA 2CLOA 3NOEA 2CLFA 5LKYA 2A7PA 4R7JA 3NA8A 3NQVA 4I7UA 3UPWA 1KM5A 3C2OA 2C6QA 3P60A 4AHQA 4GE8A 2YCEA 4FIQA 4UTWA 2QJGA 3I7SA 3A5VA 4JTHA 4ADSA 3NL5A 4S1FA 1FWRA 1JR1A 3O63A 3C8FA 3TSDA 1OYCA 4OWGA 3V1PA 4TMCA 3DFNA 5CSRA 3EX1A 1IIHA 2DZUA 4FX7A 3NZ1A 1JCLA 1W5QA 3O05A 4JTKA 1VYPX 4IGHA 1SSGA 4N9BA 1VQTA 5CGQA 4JIQA 1LLWA 2YDAA 4UR8A 3FA5A 3G1FA 1I45A 1NF7A 4X2RA 1X1ZA 1XXXA 4ALDA 3C3NA 3HPSA 4ONVA 2ZZ7A 1G6CA 2Y61A 3R12A 1KV8A 2GQ9A 2GOUA 3OEXA 3F03K 2ZZ2A 5BMWA 3GDMA 4JS3A 4JY9A 4UTIA 5AB3A 3MP5A 4BR1A 4LS2A 3KRUA 2BXVA 5U7SA 3B05A 1GQNA 2J9XA 1K8YA 5D2VA 3NZRA 1X8FA 3N3MA 1GTHA 4Q32A 4XKYB 3MWAA 3VFLA 5HUPA 1R47A 4KWVA 2XFWA 1W5NA 3T55A 1LM1A 1SFJA 1VR6A 4IPJA 4O13A 2YFOA 1W0MA 3SGUA 3FYOA 1UASA 3DBPA 2Y70A 1W8SA 2EGZA 1QWGA 2YGYA 5C54A 2VELA 1O95A 4FNTA 4AWTA 4O15A 1OK6A 2A6NA 4L4LA 4OT7A 3PM6A 1FCBA 3G3DA 4DF2A 1YTKA 1F05A 1ZHAA 3LBMA 2AAMA 1LCOA 3DHFA 3G18A 5EMUA 4G1KA 4O1CA 1FWTA 3C52A 4UTTA 1C8VA 1YADA 4MOZA 3IIPA 4PODA 2DZPA 2WSYA 4AHPA 3TCEA 3W7EA 2R94A 3FYPA 2QUTA 4K36A 2GJLA 2Y7DA 3MUXA 3PUDA 4WOZA 2UV8G 2R91A 4M6VA 2B7OA 5CZTA 5AHLA 4AH7A 2Y63A 1GVRA 1O5KA 4MY8A 3NQ6A 5FF3A 3GKFA 1THFD 3SJ3A 3FLUA 3W7JA 1DQWA 1DOSA 3AO0A 5K9CA 4M7TA 4Z0JA 2RDTA 2FPTA 3W7OA 2OX1A 3UWZA 1P0NA 3MI2A 3PBUA 2ABAA 3M16A 4S2CA 4LRTA 3TAKA 3PULA 2YR1A 3GYEA 1IXOA 4LWWA 3ATYA 3DI0A 3BG3A 3PY2A 4UTHA 4TR9A 2A7RA 3OVPA 3PR2A 1B57A 5CPOA 5I3FA 1RV8A 3IGSA 2ISVA 2OZ0A 1VHCA 2CLMA 2V9DA 3A9IA 4C1LA 1A50A 3UWVA 1I2NA 1TTIA 1W1ZA 1QPQA 1TQJA 5J5RA 2ZYFA 2CW6A 1OFRA 4DPQA 4O14A 1PHWA 3LRLA 1VCGA 4K39A 1V5XA 1I2PA 4GRSA 2C16A 5E93A 3LM7A 1AL8A 1R2RA 1GPWA 3C2FA 4O0ZA 3UNDA 4Q33A 1SO5A 1FWWA 2F84A 5CZ0A 3TC6A 3ELFA 5AYZA 4O28A 2O7QA 1F2JA 4MYAA 3TKFA 5I3HA 1WA3A 3P74A 2VEMA 3WJXA 1JULA 3CB8A 4WXZA 3W1MA 4POCA 4QNWA 4UNLA 2Y89A 2XN1A 1OX5A 2ZZ1A 4IMFA 4CCDA 3NPUA 1MZHA 4A2SA 1AW1A 2Y7FA 3W88A 1ICSA 4JGDA 4M5PA 2QUUA 1CW2A 4TMBA 1KFKA 1F5ZA 3SIZA 4BFAA 1RQHA 4UFIA 1EUNA 2OMAA 2E6YA 8TIMA 3IIVA 4JXCA 4IUOA 3CHVA 4UFKA 3EX2A 1JCJA 4AXKA 2HMCA 3IVUA 3KVKA 4ML9A 3W73A 3KOFA 3TW7A 2CZ5A 1ZCOA 2PRMA 3OIXA 5CZJA 1I4NA 3QRHA 3E02A 5DLCA 1NSJA 1K7XA 3W71A 3QMSA 1WOAA 3NPXA 2PRHA 4BI7A 3PUEA 3USBA 3QF0A 4AF0B 4BF9A 1GG0A 4UCGA 3W7RA 3LCXA 3HB9A 2VOMA 5HR6A 4N6FA 5G2WA 5DBUA 2VFIA 4AB4A 1H7NA 4QJ1A 3NQGA 3LHZA 3MHUA 5LNRA 3TXVA 4MLJA 1ZAJA 1G7UA 3S1WA 1F76A 4AAJA 1KTCA 3IIOA 3H54A 3O6CA 3NQ8A 3HQ1A 3MI3A 2JKPA 3DHDA 1VPXA 2HS8A 3B06A 3W72A 4E2DA 1QPOA 4JTJA 1TPUA 4JTGA 3HOJA 3W07A 5I3GA 4MJMA 2E1DA 4WXYA 4GUGA 2V2CA 1J4EA 3IIZA 4EF8A 3TR2A 2Z0IA 1AW2A 2NLIA 5EPDA 3W1QA 3GDTA 3TSBA 3SFKA 1PE1A 5CPLA 4WZHA 2H3DA 1SSDA 3HMJG 4IQLA 5E0KA 3EX6A 1T99A 4JR5A 5D33A 1L6SA 4JX5A 3TSMA 2Q3OA 1P4CA 3HGJA 1S3HA 3C0JA 3B0PA 3SR7A 1U83A 2ISSA 3DKJA 1LP6A 4IWWA 3KVLA 2VXNA 1Q45A 3MYPA 3B0UX 2ZTJA 1VRDA 4DXVA 4H6KA 3LB0A 4HT3A 1K3UA 4LOCA 3NM1A 3CIXA 1TV5A 4KFOA 3G8RA 3W2UA 4MKNA 1A5BA 3RLVA 2IQTA 4W9TA 2HSAA 5F2MA 3PAJA 2YZRA 2B4GA 2OCZA 3EEGA 4LUJA 3ABRA 4X3ZA 1SPQA 4NU7A 4NXSA 1LRTA 4MIMA 2QCNA 3CWOX 2CLHA 1W3TA 3DENA 3P61A 5AYXA 3UWQA 1N55A 1MO0A 1Z44A 4TX9A 3UD6A 3W1UA 4RK8A 1ML1A 1A53A 2FIQA 3UQNA 4ZL1A 4N2YA 3S5OA 3LXAA 4IJBA 3W3OA 4IMCA 2X2GA 4LNYA 1SW7A 1YTDA 1NVMA 1X1OA 3SZ8A 1SUXA 5HULA 2NXIA 3UWYA 4Z1AA 2GJNA 1YPIA 3G1HA 1LRQA 3S1XA 3A5FA 1VJIA 5HNRA 2H3BA 4KFNA 2GVGA 3TMQA 2RHGA 4O11A 3KX6A 3A22A 3E0IA 4FX8A 3BG9A 3W85A 2YW4A 4ZQPA 3EWZA 3L0NA 3TE9A 2Z2UA 3SGZA 3ATZA 4ORIA 2PRLA 2C0AA 3L66A 1OYBA 3THQA 2VEIA 1LDCA 2GQAA 3CC1A 1KM2A 4KFPA 1BTMA 1TYGA 3GXNA 2Y7GA 1KFEA 1N8FA 1WOBA 4KWWA 2E68A 3W75A 4JX4A 4UNKA 3TROA 1T96A 5EKYA 2FB3A 3W2JA 1K7EA 2NX1A 3LRKA 2H90A 5DY3A 1VLIA 1ZENA 4N6EA 4NZJA 4UUIA 2VFGA 3C56A 4LS1A 2J6XA 4PTNA 3M44A 1XKYA 3WJSA 4WD0A 4GC4A 3BVJA 1JCYA 3G8EA 2DORA 2WQPA 1SFLA 3B03A 1AL7A 2B7PA 3NVTA 3FEMA 2ALDA 1GTEA 1CI1A 3G1YA 4Z1CA 3M47A 3STGA 1OG0A 1RVGA 1NFBA 4X9SA 5EA9A 2VFFA 2WKJA 2A0NA 3FIGA 3M9YA 4NJIA 5DCEA 3EWWA 1FCVA 2ZFAA 3MMTA 3PSVA 5GVJA 4O10A 1Q3NA 2CZEA 3U8GA 3L9CA 3R13A 1OFQA 3HO8A 3L21A 5DCBA 4HNTA 1G69A 3G0UA 2JKAA 4FB7A 3LOTA 1A5SA 3N2MA 4M6QA 3CPRA 5C55A 2X16A 2P0OA 3C2EA 3RNDA 4XQ6A 5KTLA 2CU0A 2CWNA 4LVFA 2JBMA 2B7QA 3HPXA 4HNUA 3RU6A 3GK0A 4EVZA 1RQBA 5LGXA 2PCQA 1OJXA 5G2HA 3W76A 4DBDA 2QCHA 4NQ1A 5D05A 3WJYA 1H7OA 2EF9A 4WOQA 3N14A 1AK5A 1SU5A 1TV8A 3TV8A 1LROA 1KTNA 4LV4A 3S9YA 1N7KA 2WOQA 1EX5A 2NZLA 3EKZA 4DBEA 3QEZA 2ATSA 3FJ6A 4XWUA 1AG1O 5F1UA 1XUZA 3A21A 5D30A 3I6RA 3S5NA 2QR6A 1D3HA 4Z08A 3GIYA 1TPWA 2C19A 1VCVA 3LTYA 4N9DA 1YTEA 4JEQA 2A21A 3LGEA 4GUIA 4ZMGA 4FNUA 4U28A 4MY9A 5F2GA 1UUMA 1HL2A 1KFJA 5FF2A 3M6YA 2GUUA 3E49A 2YYUA 3L0KA 3D0CA 1GWJA 2H8ZA 1WV2A 3U6WA 5D37A 3BLFA 4NX5A 5K9XA 1LYXA 4WJEA 4MLRA 3NQEA 1HTIA 1QFEA 5K3VA 2A7NA 2FPYA 5KMYA 5HWJA 1W5MA 4XKYA 3SI9A 4O53A 3C2VA 1L2UA 5D38A 3QZEA 4Y96A 5D2WA 1OFEA 1LORA 4XTDA 4MPQA 4P61A 3H55A 2E6AA 2NV2A 4ZQRA 3TDFA 4UFHA 2ZRXA 1WQ5A 3T40A 3LLDA 1H62A 4UMBA 4K7YA 2A2IA 4K6AA 1KW1A 1XC4A 4UTUA 4JTTA 1H50A 3QQ1A 5G4WA 3L5AA 2VEKA 2YSWA 5HINA 1XUUA 3BGGA 3FKKA 3Q94A 1SW3A 2JK2A 3LXCA 4AHOA 1JRCA 3OVRA 5SWUA 3FOKA 3GNNA 4HPXA 3TNOA 2W79A 1XDMA 3QMRA 2GQ8A 5F4WA 3W7LA 3NQFA 1G4PA 5CZSA 3W1LA 4UTLA 4TO8A 2G96A 3MI6A 3PG9A 1YLVA 4JICA 1H63A 5A5WA 4UMCA 1VLWA 3MHGA 3LTSA 2V2HA 3K30A 3TA6A 1ZFJA 2I14A 4FXSA 4Y6GA 1C29A 1Y0EA 3PUOA 4FNRA 2QEZA 1YDVA 4JTUA 3PF3A 3THAA 3TUUA 4YWIA 2QDGA 4UFMA 3MW7A 2BTMA 3NEVA 4GUJA 4E0CA 4DELA 2ZA3A 3INPA 3M5YA 3EWBX 1OFAA 4MJZA 3RLUA 1SZGA 4P2VA 5DXYA 2R14A 2FLIA 3T44A 3T7VA 1QCWA 5MHBA 1HFBA 4IXHA 5T26A 3NXFA 3JRKA 4JD4A 3W7GA 3I68A 3O16A 4Z0SA 1TPFA 3O06A 3R5EA 2CLIA 1QO5A 3QM3A 5KSWA 1TPC1 3ABOA 5BW6A 2J9YA 3G3MA 1TJRA 4WQ6A 4O0KA 1R2TA 2YYTA 1KFBA 3OBKA 2CLEA 4GFSA 4GWEA 1TREA 1F73A 5EBUA 4YLWA 1TV7A 2ZRZA 1SQ7A 1TMHA 1HO4A 5AOUA 1YXCA 1SW0A 3QPYA 1K8ZA 3EX3A 1FY6A 1YXDA 1ICPA 3G24A 2OT0A 1Z48A 3Q2DA 3GDKA 3MYOA 3LCIA 1B3OA 5IM51 4LVDA 3M5VA 4Z1BA 4YXGA 3LCFA 1VC4A 1W5OA 4ADTA 3G1AA 3BARA 4BWLC 5HMSA 1O94A 5AN7A 3W86A 4FXRA 4O1BA 1ZAIA 1EWDA 3FS2A 4MFDA 1GVSA 3ABQA 3MBFA 3CM4A 4CQAA 3KHJA 4FO4A 4ZQCA 4N4PA 4Z1DA 1R46A 1QO2A 1TPDA 3UY7A 1KA9F 5TIMA 1BWLA 5FEZA 4CNPA 2EHHA 3ANYA 5J5DA 5HR7A 3STEA 1KM0A 4XUGA 3VKJA 3PBYA 3EB2A 3DXIA 3NL3A 2X1UA 3GVGA 1WXJA 2WPBA 3LI0A 2GVLA 4AF0A 4JTEA 3NYZA 3PBWA 2QJIA 1OX4B 3P5YA 3ZFHA 2ABBA 3P81A 3G0SA 1GYLA 4HNVA 1XBZA 3DI1A 1QOQA 5AC8A 5F2IA 1R30A 5LZLA 1KLYA 5D32A 2Y7EA 2CZDA 2W0UA 4J9JA 4YCPA 3L0GA 2CZFA 1AMKA 4ADUA 4CCCA 3G22A 3EXRA 1XCFA 3L5MA 1P1XA 3VCRA 5F2LA 1KLZA 2E6FA 1B4EA 1DV7A 1Z42A 4IMDA 3M43A 3LRMA 2QCDB 4IOTA 3RFAA 1YYAA 5DXXA 3IGXA 3TQKA 4NJJA 1SO6A 4RX0A 1OFDA 5TBOA 4IXXA 2PE4A 4HSNA 4XTIA 5I3IA 4MFEA 1G7VA 4QISA 3LDVA 2E5BA 1TTPA 4RZ5A 3DH7A 4EF9A 1F74A 4PFMA 1EP1A 5BRBA 3LLFA 3S1UA 3LXBA 1OF8A 3BLEA 1L6WA 1UB3A 2QCCA 4HPJA 2QCGA 4QM1A 1JRBA 1OFBA 4N4QA 2FTPA 5D09A 2X1SA 1OHLA 3L2IA 1TIMA 1NAL1 3FJLA 1I8JA 1IXQA 1Q6QA 3YPIA 1DVJA 1GG1A 4A2RA 3ZWTA 1KTBA 3TK7A 2TRSA 1A5CA 3SSJA 5G1TA 4A22A 1FDZA 3P7YA 4UTKA 1VS1A 1ME7A 2W6RA 2DZVA 2C1HA 4BI5A 2QUVA 4RJEA 3W70A 4I7VA 2GVJA 4HSOA 1Q6RA 4EWND 3RK8A 1ONRA 2E09A 4H3DA 1K8XA 3GNDA 4R33A 2JKEA 3W7PA 2WNQA 3BO9A 1FCQA 1UBSA 2YPIA 3EWYA 4OU1A 4E2BA 4O52A 3GZ3A 2PURA 3EX4A 1TPEA 1PCWA 1E51A 2D73A 1FCUA 3IEBA 2R8WA 2TYSA 2A5HA 3NPWA 3W1AA 3DAQA 3W2NA 5LNVA 3FKRA 3IV3A 5FI8A 2BX7A 5I3JA 5ABTA 2O7SA 2TSYA 4PH6A 4LC8A 4RLIA 4JTIA 5G5IA 3W7KA 3SECA 2FPVA 2X1TA 1X6UA 3W74A 1XDLA 3CWNA 1SZNA 3GB6A 2AQWA 4JYDA 1UJPA 3N9SA 4M19A 1JJKA 2QJHA 3UXAA 3VE7A 3SW6A 2Y62A 3HG3A 1TPH1 7TIMA 3PG8A 5FEWA 1QDSA 4H4IA 3PB2A 4OBTA 1KM1A 1PIIA 3P84A 5U4NA 1SO4A 5EL1A 3S0CA 3BPWA 4O16A 4GBUA 2ZRWA 1DKWA 3NGJA 3ZR4A 3W9ZA 1OK4A 1SO3A 5L9FA 3N2XA 3PC0A 5FESA 3I65A 2C15A 4KKXA 1OFOA 5BOOA 4RXFA 1M7OA 1ZJIA 5KITA 2X30A 4K7VA 2WNNA 3VI2A 1DORA 1M5WA 1JUKA 2QCEA 3NL6A 2OJPA 4E38A 3GXTA 3NNTA 1K02A 3RMJA 2DP3A 4Y9AA 4M7SA 2EAWA 3BW4A 1NEYA 1HG3A 5CPMA 1EP3A 3LHTA 3W1PA 2YW3A 4Y90A 2ZRYA 3KRZA 3L68A 4RZ4A 3W7NA 2C14A 3QPZA 4Q4KA 5D2TA 2VEPA
chains in the Genus database with same CATH superfamily
4HB7A 5FEXA 2E9MA 3LENA 2WJZA 3A24A 1ONWA 4HPHA 3E9AA 1RXOB 3ZS4A 2HVOA 3W7CA 1EIXA 1UA3A 2ANUA 3W2LA 3RR4A 3JS3A 2WMIB 1H0GA 4R88A 3ZR6A 1QAPA 2R6OA 1RR2A 1K4HA 1XM3A 4QS6A 4ATWA 4Z1YA 1GVEA 3N19B 1W9VA 4OOUA 2I5IA 3KW3A 3WFZA 1UPMB 5HANA 4PEKA 1VP5A 3VM5A 5IHRA 1OCNA 2H8XA 2E77A 4TQTA 5E0FA 4AZHA 3KEHA 3ZLGA 4W5UA 5B80A 1VZWA 2VWSA 2EPHA 3TTEA 2WYSA 3WQEA 1MI3A 2QCLA 3QY8A 1GJPA 4JN6A 1BSLA 4L6OA 3CZEA 4TV5A 1EF3A 3P8IA 1E15A 2DU2A 4U33A 4DRSA 1C9DA 2QS8A 5I06A 5D04C 2GOKA 1W2VA 4L6HA 3NIYA 3WJZA 5G2IA 4DXKA 3QYSA 3UZJA 1ME9A 3MHFA 4D6FA 1NFGA 3DUGA 2E67A 3HU7A 2CLKA 3Q58A 1F6YA 3IUDA 2WHJA 3R8RA 3FN9A 3SCVA 2EKCA 2NWRA 1MEWA 3HG2A 2R1LA 3CAWA 1FQ0A 4BZYA 4L1XA 2XH0A 4AYSA 1KQZA 3WD3A 4JNMA 3TEVA 3SJNA 1PX8A 1UD3A 2JGYA 3VYLA 3SRKA 3N3TA 4RPQA 4EAMA 4Q22A 4Y8FA 2OTDA 3LI1A 5LA2A 1JAEA 4B90A 4UQCA 5FF7A 1E0WA 3WQ6A 4DI9A 3P82A 3HV8A 4H6EA 4DUOA 1UROA 2VVSA 5A8GA 1UWSA 3LA4A 1R7OA 1TRIA 2VURA 1UCWA 2J27A 1C3FA 2NQ5A 1LQ2A 4H1ZA 2GJRA 3WQ8A 3C5QA 1PCKA 3W7IA 4OE7A 3TQVA 2RDXA 1EA9C 3VGGA 4LY8A 4LW7A 5I78A 2R1KA 4XD6A 2V69A 3TMLA 2WC7A 2VZSA 2E3ZA 1GQIA 1YE4A 4O1AA 3M5ZA 2YKKA 1OB0A 2PP0A 4UTWC 4S3GA 4IPPA 1FWFC 2I57A 3QKZA 1ZPTA 1F3WA 1UHVA 2BHZA 3S8HA 3AHVA 1W1B1 3LX9A 3QHNA 4XZWA 3UGVA 3U2OA 4BWLA 1KBIA 4JQ4A 1PL9A 3KM8A 3QJAA 3UWWA 3CUZA 3KTCA 1H1YA 4AMAA 4NHVA 1E0UA 1Y5XA 2QCMA 4GY1A 1R8LA 4QIUA 2B0MA 2VD9A 1P0BA 1UMYA 1BKSA 4HOZA 1V77A 4MUZA 2WMGA 2AL1A 4LU0A 3ZIZA 4D2JA 2C91A 4PCFA 3A12A 3TYUA 3W1RA 3D47A 4K8EA 2PP3A 5CBJA 4C1KA 2QIIA 1E43A 2POTA 1SVDA 3M5XA 4WUIA 1O5XA 4I7WA 4A3UA 2X8RA 5REQB 1ZJAA 4BHYA 4JTFA 3MP3A 3AC0A 3MV01 5CLWA 3FW6A 2XIMA 2L5HA 3VDGA 4GNKB 1O1ZA 1H5VA 4AEOA 1Y5VA 1MDLA 3PB0A 3ITGA 5HJYA 3L5LA 4IPIA 5A6BA 5H91A 2NUWA 5HATA 5HJLA 2P88A 4YVXA 4X60A 3MJMA 2DIKA 3VU2A 1PX4A 1CLXA 1XL9A 3CZ8A 1TJ2A 1J0YA 1KWKA 4GZ7A 1LOLA 3CV6A 3GU9A 1V7AA 2QCFA 1V6WA 5D8ZA 2Q8LA 1VFMA 2WNZA 2O92A 1H61A 3BL3A 5G1MA 1KCXA 4UQBA 5CG0A 5A8PA 1E4MM 1EBHA 3MC5A 1TV3A 3B4YA 3WQDA 4O4WA 1R2SA 5G4HC 4DWSB 4LF1A 5DEZA 2ZBTA 4NZFA 1GT8A 1UQZA 4EPBC 5JXQA 1EF2A 2WWDA 1EQCA 4Q7BA 1H60A 5I09A 3AU2A 3VIOA 2CERA 4C90A 1XYCA 4QE1A 2FZMA 2J6VA 4FX6M 1EJRC 3BH4A 3C3UA 1PJ9A 1IT8A 1H0IA 1WX0A 2ZXAA 3W1TA 2WCGA 1YXYA 4LUIA 4W8AA 1JVNA 4DYEA 1ME8A 3OLGA 3DC8A 2ADAA 4OUIA 3VKDA 1E55A 2DZSA 2ISWA 3CPGA 2FJKA 1E3XA 5AECA 3FJ4A 1RJPA 2CHRA 2RDWA 1Z8AA 4FSAA 5AHNA 3NQ7A 1NOUA 2CIPA 4OHQA 4XZ9A 4UFLA 1JXKA 1PTGA 1CXFA 2X05A 4UTJA 4OUEA 1UR8A 2ZQ0A 4GXMA 2WC3A 3WO8A 1E6QM 3QR3A 2HTMA 3SY1A 2P76A 2A6LA 3T4WA 3N15A 4QP0A 2IKJA 5ABHA 3WEZA 1FWBC 1XLAA 3IJ6A 3STFA 3R89A 3GU2A 4DM2A 3S83A 3TZFA 3B04A 3KOYA 1KCZA 3VABA 2GWNA 4L6DA 3CK5A 3UJSA 2XIQA 3BK0A 1I2QA 2ZOXA 2XIOA 1ZSXA 2ODOA 1OWQA 2F8QA 1S5VA 3H53A 4NT0A 1E1CA 1P0EA 3TC7A 3H26A 1ZAHA 3L4YA 4JYEA 2PS2A 2NX3A 4Q4PA 3E74A 4WIWA 2VJXA 2XH2A 1ONXA 3ABZA 4US5D 2OEKA 2OB3A 3S46A 4V1XA 2IKHA 3K4WA 3O0FA 2OSWA 3CHDA 2QMKA 8XIMA 3LV5A 5FEPA 2DQXA 1MWOA 3W6YA 3BJFA 1GCYA 3HM7A 2P53A 5C2XA 3E96A 4XB3A 4QSHA 4KPLA 4NNBA 1UZDA 4C91A 4ZE5A 3TTQA 3TYAA 1IR1A 2OU4A 1XFBA 3QSTA 1EC9A 2V0TA 2VD8A 3HG4A 3O2LA 2DFAA 4UTMA 1QHOA 3NQBA 2ZRUA 3BOFA 3MO7A 4Z2JA 3LHYA 4LUSA 4HK5A 1XD1A 2CBVA 3EXTA 1TJ0A 3VNDA 5BWFA 4B4HA 2XWDA 3BJTA 4FR1A 5ECVA 1GW1A 3W83A 2JGQA 3B4UA 3TXZA 3S6DA 4ZO9A 1LBLA 4LVAA 3UG5A 3QSRA 1H7XA 2HZGA 2UY4A 3QFEA 2WMIA 3O7UA 4O8RA 1ADSA 3WIJA 2G0WA 1E4NA 1T7LA 4UCFA 5LGZA 1Q6OA 1UQYA 4F0KA 1F9CA 1QK2A 3VNZA 1XLDA 3UPBA 3UYCA 1MEIA 5LHFA 5AYYA 1TX2A 3CT7A 3O07A 3CTTA 4I9AA 3CAVA 3HGRA 1UP0A 5FJTA 3UR8A 3M46A 2Q8ZA 1DQXA 4DYKA 5HQLA 2DZAA 4JDBA 1J6PA 3WJWA 2GK1B 1VCFA 3H2AA 4C6PA 4MJ2A 3U2EA 3KBMA 1F3TA 4HHMA 1K6WA 2B7NA 4IMGA 3RRXA 3LHWA 1ZP4A 4FALA 4MADA 4WDXA 4D6CA 3GNXA 5CSSA 3T81A 3GTXA 1BF2A 1RD6A 6ALDA 4WY0F 4PMQA 1QPNA 4RE4A 5C9UA 5I5RA 5FSEC 5DX7A 1B9BA 4YMZA 1NFPA 5JBEA 1G9HA 3A4XA 2AQVA 3DBNA 3UY8A 1TB3A 4L56A 1GOXA 2CLLA 2FGZA 4CNSA 4DEFA 4ML4A 4QRNA 2RKXA 3QZ6A 2HE5A 3SRHA 5LHEA 1M6JA 4CN1A 3N9KA 3WNLA 3MSDA 3THUA 3QR1A 2OWWA 3NOEA 2CLFA 3E38A 1C91A 4R7JA 3F4CA 2NV9A 3NA8A 2Z7KA 3UPWA 2VEGA 4GVFA 2EPMX 2C6QA 3BQ5A 3P60A 4AHQA 4FIQA 3OZOA 2CHNA 3W02A 3I7SA 2HISA 3POCA 3S9ZA 4S1FA 4NP7A 3GBEA 1D8WA 3V1PA 1YKWA 3SCNA 4KIRA 1IIHA 2X0SA 3VXGA 1IEXA 4JTKA 1VYPX 1SSGA 2OR2A 3ZXWA 4UR8A 3FA5A 3N12A 3EOOA 1X1ZA 3GBDA 4GYKA 3V3WA 4QG9A 1E9ZB 2ZZ2A 3VO0A 1WNOA 5BMWA 2RJHA 3GDMA 3MDWA 1JCTA 4UTIA 3R8HA 3MP5A 4BR1A 3WLRA 3WD0A 4QHRA 4GQ0A 1K8CA 1F3XA 2CHOA 1XSKA 2BXVA 4Q8PA 1DYSA 5U7SA 2R1MA 3M0XA 1K8YA 2V68A 1W3JA 1X8FA 4XKYB 3VFLA 3R11A 4IIHA 4BQ2A 1LM1A 5AY7A 1C92A 4GI8A 2YFOA 4AIUA 1W0MA 3FYOA 4RDZA 2WXDM 1UASA 2FZ8A 2Y70A 5FA5A 2V6AA 4RNFA 4AUBA 2VELA 3OQEA 4O15A 4L4LA 3PM6A 1YTKA 1BG4A 3OW1A 1LCOA 3G18A 4G1KA 3I3DA 3AYTA 4UTTA 1YADA 4MOZA 2NSXA 3KDOA 4AHPA 5TD4A 3W7EA 2R94A 3FYPA 3CZGA 2Y7DA 3WF3A 4WOZA 1Z69A 2B7OA 1WZMA 5AHLA 4AH7A 5H8PA 3GC5A 4H04A 5A6AA 3AS0A 2F38A 5JH2A 3SJ3A 5REQA 1DQWA 4TTGA 1DOSA 5K9CA 2KAUC 4QJ4B 3WNPA 4ZOEA 1K9FA 2ABAA 3DYPA 3GYEA 1IXOA 3Q4DA 3PY2A 3ITYA 5ABEA 5CPOA 5I3FA 1JDDA 2HEJA 3IGSA 2ISVA 4U3AA 4WJ8A 2OZ0A 3URBA 1DWIM 3BCDA 3TYBA 1A50A 1W2PA 3PHAA 1QPQA 1X38A 2O4QA 3WF1A 4G2DA 3M64A 2XVKA 4LJ3A 1EBGA 4J3VA 3LRLA 1VCGA 3HA1A 3PFRA 2OGJA 4GRSA 2HNEA 1FP8A 1DIKA 4J5NA 1U1HA 2YXXA 4GOAA 1R3SA 4YU1A 3I3BA 3C2FA 1IT7A 2FTYA 4DWSA 4CU8A 5BXTA 3EDKA 1SO5A 2NVDA 3REQB 5AYZA 5GNYA 2O7QA 3AHYA 3GS6A 1F2JA 1HKVA 2BGNE 4LCRA 4YTSA 3CMJA 1PIGA 1V93A 4WXZA 4UNLA 2Y89A 4LBSA 3TTSA 2YL6A 2PDQA 3FA4A 3BICA 2QJMA 3VM7A 4ACZB 2CBIA 4M5PA 9RUBA 4TMBA 4H9XA 4FXJA 4UFIA 3II1A 4L61A 4AWEA 2E6YA 8TIMA 1PO9A 4IUOA 4UFKA 3S4TA 3EX2A 4JFWA 4DUVA 3EMZA 3IVUA 3HFTA 2WQDA 2OO6A 2BXYA 4M80A 2PRMA 3OIXA 2REQA 3C2YA 4PMRA 1WOAA 4BI7A 2PRHA 1WP6A 4FP1A 4AF0B 3QF0A 4BF9A 4DZHA 1B90A 4IP4A 5E6YA 2PCEA 4UZUA 2VOMA 3N2BA 4N6FA 4XVEA 4BEQA 5B7ZA 1AQHA 4AB4A 3D6NA 1H7NA 3BAYA 3LHZA 5GJPA 2OLSA 4GHRA 4CD6A 2CWXA 3TXVA 5PTDA 2J66A 4D1IA 3S1WA 3EGJA 3UPMA 3O6CA 3IV8A 2JKPA 3PNZA 3WQPA 4AIOA 4UB9A 4JTGA 3HOJA 4GUGA 2V2CA 3IIZA 4DJFA 4LCQA 2Z0IA 4CU7A 3GY1A 3DGBA 1UOZA 1YEYA 1FHUA 1SSDA 3TVAA 4GK8A 2MANA 1KD0A 2ZX7A 1T99A 5D33A 4JX5A 1K1DA 4B16A 2PDJA 1E4LA 1P4CA 1C90A 5LA0A 3KL5A 3HGJA 1E6ZA 2ISSA 3N4AA 5CBIA 3KVLA 4Y8EA 5EMJA 1VRDA 5XIMA 3FK4A 1WZAA 3N4FA 4ZEPA 3VIKA 3CIXA 1TV5A 2IKIA 3GXDA 3G8RA 1BSIA 4MKNA 1GOWA 4WK9A 1H49A 4V1YA 3ABRA 1XIFA 1LRTA 4A8RA 1OCJA 5I02A 3CWOX 2C79A 2OG9A 3FDKA 1D8CA 1HVXA 4R3UA 4TX9A 3P3BA 3FY1A 1RSCA 5HXMA 4QFUA 4DJFC 2W3ZA 2P8CA 4N2YA 1VFTA 4IJBA 4KEVA 2X1IA 3ITXA 4LNYA 2GSHA 2IW0A 4YVVA 1SUXA 4RE2A 1L6GA 3G1HA 3SCSA 2XFFA 4ZSTA 1H09A 1VJIA 1XF0A 4YVPA 5HNRA 3FV9A 4GQBA 3E0IA 2C8NA 3KBVA 4LPCA 4AEFA 4XO7A 2XYLA 1R9YA 3AXMA 1BQCA 2CLPA 3THQA 1S38A 1VENA 1PYFA 4MHBA 1DTUA 3CC1A 4KFPA 1TYGA 4HBKA 3UCQA 1R9ZA 2Y7GA 2E68A 3VNMA 2GK1A 5EKYA 3W24A 1JYNA 4G7FA 2NX1A 3CYVA 1S46A 3JZEA 5A2AA 1YHTA 2WMFA 3WQOA 2ASHA 4IIBA 1XRTA 4S3EA 2IPGA 2VYOA 1FWGC 1LQ0A 3AXKA 1UC5A 1M53A 1JGMA 3BVJA 2WQPA 3R0UA 3NVTA 4GGHA 2ALDA 1G5AA 1EZ2A 1WDDA 4US6A 2PLCA 2ZUTA 3VD7A 5AC5A 2VFFA 3CLWA 3WQWA 3HURA 1B3VA 2A0NA 2IKGA 3IUIA 5DCEA 3MMTA 1VEOA 1XYLA 2DT3A 4GCXA 1D7FA 4HJFA 3L21A 1E0VA 3KUMA 4OZOA 2CPUA 4FB7A 4QEEA 1X98A 4DAFA 1E9YB 2XWEA 3WELA 5KTLA 3E0WA 1JDEA 3GFYA 2VDGA 1Q5MA 4HSHA 4PSPA 2BVDA 3NSXA 2QZRA 3CQIA 3AZRA 1QNSA 5A94A 4DBDA 1YW1A 5D05A 4WOQA 1V0KA 1V51A 2BOFX 4UOQA 2VOTA 1LROA 2X41A 1KTNA 3IUHA 2WMHA 1N7KA 4C60A 3AI0A 2WOQA 1KBBA 3VK5A 3NXLA 3B9NA 1XJBA 2J7FA 1J0JA 3AS3A 1D3HA 3NFUA 4MGGA 2ACSA 2FVMA 1YTEA 1EKOA 4PMJA 4XIAA 3AXIA 1HL2A 3ID7A 3TJIA 2YYUA 3I4EA 1M41A 1WV2A 4OTKA 3BLFA 4MLRA 3NQEA 4LGXA 4AD0A 2QW5A 3LNMA 3MQTA 2A7NA 4W7WA 4F3HA 4M29A 3OO2A 4O1FA 5HWJA 1W5MA 4XKYA 3SI9A 4P5UA 3C2VA 2VMFA 1OFEA 5DT5A 1CXHA 3U5UA 4F48A 1AUSL 1LWIA 4MPQA 3E0LA 3H55A 4UZSA 1JPDX 1I0BA 1WQ5A 4MB1A 3T40A 4I5RA 2DVXA 4K7YA 4DN1A 1CXKA 5KEZA 2YZ5A 4UTUA 3QQ1A 2P3EA 3WDRA 3W6LA 5JQ9A 3VILA 1TKKA 2VEKA 2YSWA 3LG3A 4ICMA 1SW3A 4AHOA 1JRCA 2Z29A 3B8WA 1XDMA 4RNJA 3RILA 1BYAA 3AROA 1NARA 5JUVA 4ZENA 3AXXA 5DMLA 3SCWA 5CAKA 3KCOA 2IMRA 1UD4A 1H63A 1XIHA 2Y1HA 3MHGA 5CQ1A 4AG0A 4X61A 1ZFJA 2O4MA 2AL2B 5D4YA 4IIGA 4INFA 5C9WA 4G9PA 1MZRA 3A64A 3THAA 5E70A 1RBLA 4DM1A 2Z1KA 4D6DA 2QDGA 5GNZA 4JTDA 4E0CA 1TG7A 2ZA3A 3M5YA 4IL0A 3EWBX 1Y5WA 3N2OA 3WNMA 1M68A 3G1RA 4P2VA 3WKZA 1VFHA 4HP5A 2WZTA 3Q45A 2G4FA 3WN6A 5T26A 3NXFA 2RGLA 1KGWA 3W7GA 3I68A 3UERA 5B7YA 2W63A 3EDJA 2UWFA 6REQB 2YCJA 3ABOA 5BW6A 3H23A 5C2GA 1WUFA 1TREA 1F73A 3REQA 4YLWA 3Q65A 1V6TA 3VCNA 3KBJA 1YXDA 1ICPA 2NQHA 3H7VA 3MYOA 2E1WA 1OT2A 3PBGA 3UT0A 1V6XA 5I07A 1UR0A 3WNNA 1B3OA 1T6MA 4ACZA 3MPGA 4AZIA 8CGTA 3DIPA 2DT2A 3VVGA 4ZFCA 1UR1A 3BQ6A 3W86A 4FXRA 3FS2A 3WUBA 3A3XA 3ABQA 3ZVHB 1HJSA 5CJ5A 2D0HA 5F7UA 3CM4A 2BASA 4PTMA 1XLKA 3C0QA 4P8UA 1BWLA 4AZ5A 5FEZA 4I5XA 5EFFA 3ANYA 1LLOA 3VKJA 3EB2A 2X1UA 3GVGA 2WPBA 4AF0A 4JTRA 3NYZA 3PWIA 3P5YA 2OYMA 3P81A 5CGMA 1REQB 1OIMA 5LZLA 1XIDA 4YCPA 3WENA 1H2JA 1YBQB 2E7FA 2CZFA 2BP1A 3B9DA 3EZ4A 4NZ4A 4L65A 4F66A 3BLKA 1GOKA 3VMNA 1UWAA 4XZMX 3K4DA 1N2VA 3S5SA 1DV7A 1NTHA 4JFUA 1OD0A 1KBLA 4AISA 5E09A 1SO6A 4DYJA 1FRBA 5TBOA 5I3IA 1G7VA 4H6RA 3LDVA 2WC4A 3H2FA 5C7HA 3MSYA 1BQGA 1HZYA 1L6WA 1W9BM 2QCGA 5BRQA 3VIFA 1ZCCA 4QROA 4QM1A 3VPLA 1JRBA 3TYZA 1XLBA 2PWVA 5D09A 1TIMA 4PRTA 5CPQA 3T0BA 1DJWA 1BHGA 5I0DA 3FJLA 4JCMA 1IXQA 2O9PA 3YPIA 2ZUSA 1GG1A 5LIYX 3IK4A 4A2RA 3TTYA 2PDNA 4X63A 4YS1A 2OO0A 2GUBA 4IG2B 1M1BA 4B92A 2W6RA 4XD4A 4RJEA 3VKBA 2DSWA 4HSOA 1Q6RA 3WBXA 4EWND 3RK8A 1ONRA 3E2VA 3SQSA 1JPMA 1K8XA 4C65A 2JKEA 1W3LA 4JHMA 3H21A 3BO9A 4AY8A 1UBSA 5BROA 3EWYA 4OU1A 3RCYA 4Q4QA 2QGHA 1HGWA 4O52A 3EX4A 1TPEA 1AJ0A 1E51A 4FF5A 5BZAA 5CJMA 2TYSA 3NPWA 3W1AA 3W2NA 2J7GA 4MB3A 1HKJA 3FKRA 3IV3A 1XQKA 3TYDA 3WLNA 3K5XA 1Q65A 2TSYA 1PXGA 1SM9A 3FGCB 2FPVA 4WSHA 4TVDA 5EGRA 4H6QA 1SZNA 2AQWA 4JYDA 1JJKA 3VD3A 4IISA 3UXAA 1XS2A 1A5LC 3HG3A 2PDGA 4OBTA 3ANVA 3GTHA 5DQPA 2W61A 1XYAA 3S0CA 4KWUA 4GI6A 5DANA 1DXEA 1J6OA 2NVAA 4KEUA 1KCLA 4YYFA 4GBUA 1EQPA 3L4XA 1CXEA 4FI4A 2PF0A 5L9FA 2V5CA 4C5ZA 4KKXA 1OFOA 1HP4A 5D9OA 1M7OA 2J7CA 5KITA 3MB9A 2X30A 5TF0A 1IT0A 1O5RA 3ARZA 4ZR8A 1BXCA 3CMFA 1M5WA 1JUKA 2DP3A 3VKCA 2VGIA 1E6NA 3CS2A 1NEYA 4MWAD 4AC7C 1VFSA 3APGA 3RUBL 4GPNA 1LZOA 1XX1A 4O17A 3LPGA 3ZWSA 1UOKA 4QNEA 4UFJA 1I75A 1CGVA 4H19A 2WSQA 3DYMA 3OQ8A 3W84A 2BVYA 1ITUA 1W1YA 1CGWA 3EWXA 3HQNA 1JCNA 5CC3A 4S39A 3M0KA 1H11A 3QFWA 3LM3A 1CECA 3SCTA 2PTWA 1KM4A 4K37A 3W2KA 1EO7A 3OLIA 4J28A 3SDOA 1D2KA 3GLCA 5DY2A 3KFTA 3PJWA 3DFQA 1M04A 3DN5A 2VQUA 1CXLA 5EBAA 4EP8C 4GYJA 3BV4A 4UC5A 1J2WA 4B2DA 3PZOA 2NXGA 5BOFA 1FWJC 4OFCA 2ZRVA 2F6XA 3U57A 2WZMA 3BZJA 4UXDA 4E4FA 3MV11 3PBMA 4UQDA 4PN2A 2Y88A 3IANA 5L6UA 1SMDA 1VFFA 1ZALA 1RA5A 3B8IA 4JHZA 5CKSA 3W6MA 3ARPA 2DZXA 4LRSA 3UG4A 2E5CA 1RZMA 3GUWA 1O4UA 4RZBA 3WYZA 2AGTA 2R9RA 1RPXA 2XSBA 3T0TA 3BDKA 1T0OA 3G5EA 2V3GA 4LEFA 1JDAA 2BZNA 3S6TA 1RLCL 3W23A 7A3HA 4TVUA 1YMYA 2G41A 4J2MA 4JL1A 3GX9A 3AIBA 4HNCA 5BU6A 1OYAA 1J0HA 3TJ4A 1HNYA 2NQJA 3T78A 2FQIA 3EWUA 5AHFA 4MVAA 3C86A 2HV5A 4MPKA 1C7SA 5IOBA 1OF6A 1A0EA 4QR6A 4EOUA 1SR0A 4Z2KA 1UR2A 1AJZA 3QTPA 2W9MA 4WY0B 1VIZA 3M0ZA 4N9EA 1VJSA 1DJXA 1XI3A 3BG5A 4WR3A 2V30A 5HPCA 4Q7NA 1QK0A 5FF4A 3WH5A 1Q85A 1Q7MA 1QBBA 2VCBA 4MZ1A 1QI5A 2ZX9A 3BW2A 2WO5A 1E4IA 4K8GA 3XINA 3ITTA 3I6TA 5KZMA 3A3WA 3R94A 1GEHA 4UR7A 1LBFA 3N6HA 4LVGA 4O4VA 1PDYA 1BPLB 2Y5JA 4ORMA 3T0AA 1QNVA 4W7VA 1OGGA 1RA0A 4GI4A 2AL2A 3C0LA 2EJ1A 1I2OA 1N8IA 4B5UA 1BVNP 3QGVA 2ZA2A 3WLMA 1JCMP 4NI3A 4PA8A 4IGSA 2PDBA 3DX5A 1CLVA 4G56A 3BLIA 1A0DA 3OA5A 2BLEA 3M7SA 3UR7A 3DFPA 3LPPA 3GR7A 2BWGA 3R2GA 2DT1A 3IVSA 4YIWA 4OQVA 1SJCA 1MXGA 2BY1A 3JR2A 4E8GA 3VIPA 2A3BA 3N25A 4I5UA 3PBVA 3W82A 1X7FA 2F2KA 5K4XA 3IVTA 2DSVA 1FXQA 2V38A 6REQA 4KWSA 1S5MA 1PEZA 3BAWA 4J3WA 1TV2A 4IZGA 3RF9A 3LBCA 2X1RA 4XBSA 5KZEA 3M0IA 4Q4SA 4YTTA 1B2YA 3GE7A 3B0VC 2DJXA 4JDYA 1R0MA 4K1GA 2PD9A 3QC3A 4DLMA 3I6EA 3TW6A 4JQ1A 4L9YA 2VC6A 5FJJA 3WUGA 1IXNA 1VH7A 3LGDA 4F0RA 5BU9A 3GXPA 5K9DA 5HUOA 4DJED 3MKCA 2INEA 4ZVJA 1FTXA 1F8IA 3T05A 2FVLA 3ZVHA 3GTIA 1XG4A 1IIGA 2WKGA 5LNWA 2ICSA 3C8NA 1VHNA 5DRCA 1LT8A 4O54A 3OBEA 3G77A 1VFOA 1K7FA 3TW9A 3LMYA 4C6KA 5KZDA 3UCDA 3V0UA 1V79A 2RDUA 3C61A 3T9PA 3WH8A 4IFOA 4U4MA 3DECA 3GDRA 2ZXDA 5AHEA 4KF1A 4R34A 1REQA 4F2TA 1QMLA 5I79A 1D3GA 3W7MA 3GUGA 4L4OA 1BGGA 4HHPA 1PVNA 2PTXA 2PU1A 1TR1A 1O60A 6PTDA 1YBQA 3MUIA 1QW7A 4NIRA 1XISA 1BLIA 1O68A 3V7PA 4FNPA 3TN3A 4HGXA 4NNCA 3WFAA 1L9WA 3RPTA 3UVAA 3H7UA 3NEHA 4AD5A 1NWRA 1K70A 4YN5A 5EB8A 1R3VA 1A80A 2VENA 3KZSA 4NJGA 1PPIA 2WSRA 4O50A 5EYWA 2Q3RA 2QJJA 3HJZA 3CIWA 2V8ZA 4GVHA 4CNOA 4A4AA 4PB5A 3TJLA 1EL3A 4MWAE 2E9BA 2VVNA 3N1AA 1G4EA 1EJSC 1W37A 3H4XA 5CCZA 4OV4A 3W00A 2OGYA 3N18A 1A5AA 1D9EA 3CV2A 4PL1A 3GVRA 3E2QA 4QAIA 2SFPA 4OV9A 2V3DA 4TU1A 4DVOA 4TXEA 3LCLA 1WDRA 1ZS2A 3LV6A 4FNQA 4IG2A 1TX0A 1OCQA 3M0HA 1HN1A 1LQAA 2I9EA 3FNDA 3AJXA 4IHCA 1G67A 2I1OA 3AHXA 1EDQA 1H51A 5I3KA 5D02A 1QOPA 2HWGA 1XYBA 1U33A 3D3FA 2GDQA 3GKAA 1CX9A 1W31A 5G1YA 4YCOA 5AHMA 3C4UA 4QQUA 3ANUA 3NURA 4MJ4A 3ARQA 1KFWA 5A2CA 2J8GA 4R53A 1IF2A 2XINA 3HQOA 5A3HA 3W22A 2ZDRA 2FDSA 2VDIA 3VUPA 1WAUA 1TMQA 2PODA 2BHUA 4URIA 5HA7A 1EX1A 2QDHA 4H01A 3OVGA 1TUXA 2BB0A 3U0HA 3T09A 4CQ9A 3OA3A 1LG1A 1OT1A 3FGCA 4M0XA 3DU0A 2OXNA 1POKA 3L4TA 3W1NA 2A85A 3MMWA 1BYCA 4B5NA 4B91A 1DHPA 1EJTC 1LL4A 4NSBA 3KVJA 2WBKA 4NJHA 2XM2A 3KWXA 3SO7A 1TPVA 4B5WA 1DP0A 4W7UA 3NM3A 2PWGA 2HROA 1WBJA 1R7AA 2O9TA 3IJDA 1V3KA 4DF1A 4ZZ9A 5KINA 4IM4A 1OZQA 3W7DA 5BYWA 2JIWA 3APTA 1UD5A 2J9ZA 3DFYA 2G50A 2WVSA 4FHAA 1WAWA 1FWNA 4BQ4A 4ZQOA 2PWUA 5LIUX 3GH7A 3NR0A 4Q4MA 4QG6A 1XBVA 5ABFB 1A3HA 3SUWA 3FEQA 2J77A 3R4IA 5EY5A 4UIOA 1JUEA 4D72A 1KV5A 2R1NA 4LSBA 3Q37A 3WLPA 4O19A 5BMXA 3VUSA 4XAYA 1LL6A 2GSEA 4BK9A 2YXGA 3ITCA 1WZKA 2E4TA 2TMDA 4LH8A 3TN4A 1XG3A 1W5PA 3STCA 1W1TA 3V75A 3VD4A 3QZAA 3BLOA 2ZCGA 4PMUA 2PFHA 3N9RA 3NQ2A 5E6ZA 3MJYA 4ZOAA 1PB0A 4IIFA 1KWGA 5J8LA 1G4SA 3OIHA 1LUCB 1ZY9A 5C5YA 3M0MA 3O8AA 6TIMA 1TPB1 1F6KA 1NELA 1P6CA 5F4SA 3OGVA 1W56A 3GFZA 5IFPA 1GVYA 3BW3A 1X7IA 3BLPX 1KM3A 5K4ZA 4JTLA 4Z2GA 4OGZA 4UQ9A 3ABSA 1TVPA 1PDZA 4DHGA 2XU2A 5A6SA 1ZBVA 3T42A 1L6YA 2CCRA 1W3IA 3NQDA 3JVAA 4D6EA 5JH1A 3RLGA 4US5A 1RCQA 2J7BA 3BMXA 3EOSA 3GDLA 2JEPA 3QV9A 3M0LA 3M07A 3H2NA 3M1ZA 4IICA 4UMAA 4H8NA 2PWFA 1YDOA 3M41A 1XFCA 2PGEA 1CPUA 4QDPA 3RJXA 4XG1A 4GG9A 5F4XA 2XUCA 4Y9NA 1TSIA 1CYGA 1FUYA 3IAPA 1YX1A 4AYGA 4CD4A 5DBTA 1ZJBA 2PSNA 2OZ8A 4NNAA 3STPA 4F4RA 1P5BA 3BAXA 3IACA 3I7QA 2VX5A 3UG3A 1KRCC 5H1WA 4EIVA 3SY5A 2NUXA 1TMLA 4OBSA 1HT6A 4HHHA 3C2RA 2XZ9A 4MZ8A 4B3KA 4YTQA 3WD2A 3ISIX 2VR5A 4L7ZA 1JZ5A 3NQVA 2Q01A 3D5HA 3PZNA 3KS5A 4S3FA 2QJGA 3ZSTA 1CGXA 1FWRA 3O63A 3C8FA 3TSDA 1RLDA 1S2CA 1XLFA 3ARVA 3DFNA 4FOKA 5CSRA 3TN5A 1B0IA 2XISA 1VQTA 2YDAA 4H2HA 4X2RA 1E73M 2Y61A 4ILSA 2GQ9A 2GOUA 3VD5A 4JY9A 1DIDA 5HPOA 4W8LA 5AB3A 4CD7A 4J7RA 3AJ7A 3BMWA 5T9BG 1UR3M 3TLLA 5FAGA 1R3TA 4HZMA 2GLKA 3B05A 1GQNA 3NZRA 3CHFA 3OGRA 3MKVA 4QE5A 3QHMA 5FJIA 5HMEA 3B8UA 1R47A 1J01A 4KWVA 1VR6A 4CU6A 4IPJA 3VKAA 5A95A 4N42A 1L0PA 3SGUA 3MCOA 4W84A 3DBPA 4DAIA 2YGYA 1C93A 1OK6A 1KRBC 1BD0A 3WL0A 3G3DA 2A3LA 4W87A 4G8TA 4AY1A 2DW7A 1CEOA 3CUGA 2YL9A 2ONEA 2WSYA 2OSYA 1JXJA 3QBUA 3MUXA 2UV8G 3ALFA 3PAOA 2R91A 3THDA 4L4PA 3T2QA 2PBOA 4FLRA 3NVDA 5JVLA 3N2TA 1GVRA 3OPSA 3MZ2A 3NQ6A 3NDZA 3GKFA 1CCWB 4PUJA 2FMOA 1NP2A 4AY7A 3AO0A 2RDTA 4HK7A 2FPTA 3WF2A 1V3IA 2OX1A 3H2EA 1P0NA 3PFMA 3BZGA 2Z24A 3L4WA 3M16A 4S2CA 3PULA 4GA8A 3RJYA 3L23A 3SUTA 1JZ2A 1K9TA 1FP9A 3DI0A 3QOMA 3WLLA 3B8SA 2H9AB 4TR9A 2A7RA 2ZWYA 3MUZ1 2DSKA 3VGFA 3BTNA 1TZ7A 1VHCA 2B31A 3A9IA 1W1ZA 4MB4A 2ZYFA 3FXYA 2CW6A 4PUKA 2J78A 1M9HA 4ICCX 4V15A 4MKVA 2GQ3A 3H2MA 1C9WA 1K9DA 4FR6A 4A3YA 2DGAA 3LM7A 3FVMA 2VGGA 4W89A 3EAUA 4MTVA 4XUYA 4H9VA 3MUAA 2P5NA 1IWAA 4A35A 4KRZA 1FWWA 3ELFA 5LIXX 3HTWA 4E6MA 1TJ1A 2DT0A 4MYAA 3RLHA 2VEMA 3WJXA 3CB8A 5GNXA 4POCA 2GGIA 2XN1A 3S1GA 2ZZ1A 4IMFA 2YBUA 2WCAA 3M4HA 1I1XA 3NPUA 2GJXB 1EJWC 2D69A 3QGKC 1OZMA 4A2SA 1AW1A 3W88A 3QV7A 3K4AA 3OLEA 1EXPA 1GJWA 3SIZA 4GLEA 1EJUC 1JNDA 3IIVA 3WMLA 2ZVRA 4Y7EA 3TOPA 1E40A 1E56A 3ES7A 1W91A 3ZLHA 3W73A 2CZ5A 3AMGA 3OU8A 1FHLA 4JL2A 5DLCA 1Q8JA 1K7XA 2Z28A 3QMSA 2CYGA 3E5BA 4RV3A 4D6HA 3CZJA 1B30A 1V8EA 4OOZA 4UCGA 3H2CA 3UJEA 2WLZA 5G2WA 2VRKA 4DBUA 3RCMA 4QJ1A 2D3NA 3NQGA 5LNRA 4AW7A 3ITOA 1TVNA 5CPTA 5I00A 4MLJA 1G7UA 4AAJA 4W85A 3VINA 4NF7A 2HCVA 3IIOA 3H54A 2YCLB 1XIEA 1UH2A 1LWHA 3GXFA 1ECEA 4E2DA 1W1PA 1FHDA 1TPUA 5I3GA 4F0MA 1GYMA 4WXYA 2CKSA 1WKFA 1WDPA 2NLIA 5EPDA 2BFGA 3RX2A 6TAAA 2D3LA 3IJ7A 5FL1A 3VX0A 2J62A 1B3ZA 3DKJA 1LP6A 4ROPA 1XICA 3B0UX 6A3HA 1JPIA 3BMVA 4HNOA 5EMLA 2X0YA 3VC6A 4LOCA 3HN3A 4GO8A 4KFOA 1UKSA 3EPNA 4RW3A 3DG7A 1A5BA 4W9TA 2HSAA 1I0DA 2VNCA 5F2MA 3VDHA 3RRAA 2OCZA 4PUUA 4LUJA 2GZXA 4X3ZA 1A3XA 4NXSA 4NZCA 4MIMA 2V3FA 2CLHA 1W3TA 3DENA 3UWQA 5ABFA 1S2TA 3B8VA 3FHAA 4V2XA 4ZL1A 3S5OA 3LXAA 1BYDA 1UZ4A 4IQEA 1MYRA 2X2GA 1SW7A 3TC3A 3T0DA 3UWYA 4N0RA 4C6QA 2GJNA 1YPIA 2I5GA 4OJYA 4Z1AA 1RCOB 4BQ3A 1CB2A 1LRQA 3A5FA 2I56A 3AYRA 1JEZA 2H3BA 1QU4A 3EEZA 3OOQA 1V08A 1ZGDA 3KBNA 2W92A 2CETA 3KX6A 3A22A 3WL1A 5H8MA 4ZQPA 4I9JA 3EWZA 4OECA 2IQ0A 3L0NA 3SGZA 3CPUA 1VBHA 1HL9A 4EXQA 4IH3A 5JIWA 2GQAA 4MNKA 2QULA 2WJEA 1LUCA 2J74A 1BTMA 3LEPA 3MA8A 3CL7A 1KFEA 1N8FA 1JNEA 1WOBA 4FOUA 1DJZA 5GQBA 4JX4A 2OEMA 3TROA 3WDIA 3WQVA 2BVTA 3OJGA 4CN6A 1KR0A 3W2JA 1K7EA 3LRKA 3WNKA 2H90A 1J2BA 4MG4A 4V28A 3GIPA 4PTDA 4NRRA 1FFRA 2Y24A 4N6EA 3VC5A 3CAQA 2VFGA 1NDYA 1VEPA 4PTNA 3UZYA 1AD1A 3M44A 3VKKA 1S1PA 3IJ9A 1XKYA 3WJSA 4D1JA 4GC4A 2Y2WA 5DMMA 3G8EA 3KS6A 4AZGA 9CGTA 1AL7A 4ROQA 3S2CA 2BG5A 1GTEA 1CI1A 3FVDA 4GABA 3STGA 4S3DA 1L6FA 1OG0A 5CGTA 4X9SA 5EA9A 2PD5A 3WBEA 3U4FA 2VUNA 3HPFA 2ZUUA 3SN0A 3FIGA 4IP5A 4NJIA 2WSPA 2ZFAA 1UIOA 2W4XA 4XZHA 3ARYA 1EDTA 8XIAA 1J12A 1Q3NA 2I16A 1J10A 4JNZA 4XBJA 2FZ9A 4H9UA 5GPRA 4AZCB 4HNTA 3G0UA 2JKAA 6XIAA 3LOTA 1EYWA 2EKGA 1A5SA 3GTFA 4M6QA 1AFSA 1EJ7L 1WE5A 3CPRA 1JZ3A 1PUDA 4ZOCA 1KCKA 4GX8A 4WLCA 1A49A 2WVVB 5BXRA 1R3RA 4H7CA 2E8YA 4GIYA 1U22A 4LX4A 2B7QA 5CAHA 1V02E 3HPXA 1GKQA 2NSOA 4L80A 4EVZA 5LGXA 1Z89A 4PB4A 1A4LA 4NQ1A 1HJUA 2EEXA 2EF9A 4A8LA 3WFLA 4D6IA 1AK5A 3UA3A 2VGBA 2DUZA 4H8UA 3EKZA 3HQPA 4XWUA 5BOEA 5D30A 1PWMA 4Y2WA 3TTOA 4Z08A 3VIHA 3QVQA 3LTYA 4NAFB 2A21A 4QTGA 1U1UA 1EH9A 3CMGA 4LXFA 1XLHA 4MMWA 1UKPA 3WNOA 4KRUA 1KFJA 2GUUA 4B5SA 2H8ZA 4Z2IA 2YOCA 1M03A 2AQOA 4NX5A 4W5ZA 1QFEA 4LUYA 1J9YA 2Q09A 1PZ1A 2POZA 3MMDA 2E28A 1IZJA 2QDDA 2VI0A 2VZTA 3AQUA 1LORA 4ZQRA 3TDFA 2ZRXA 3QXBA 4MWAB 1FKXA 3LLDA 1H62A 4CCZA 1HJXA 3SCUA 1ENUA 2JE8A 3LS9A 4KGJA 4A05A 1KW1A 1XC4A 3U5YA 3LZ5A 1H50A 5G4WA 1VBGA 4JFVA 5HINA 1XUUA 1MRQA 3CWHA 3BGGA 5CC5A 3OVRA 4R7OA 3GNNA 4HPXA 4A3QA 4XAPA 2PU0A 3JZUA 1G4PA 4PB3A 3MVIA 1VB9A 3W1LA 4UTLA 2G96A 1AJ2A 1TFVA 3PG9A 1YLVA 1UR9A 4JICA 4QDMA 5A5WA 4UMCA 3AICA 4CNTA 4QLJA 3CUFA 2V2HA 3UG8A 1I60A 3TA6A 1Z32X 2I14A 4FNRA 2HPMA 2J25A 1TE6A 2VCAA 3CL8A 4JTUA 2XH7A 3PF3A 3TUUA 1FWCC 1XW8A 3A4JA 4GUJA 3VNYA 2H9AA 2QHAA 3QV6A 3L4VA 3MUCA 1QOXA 1XQLA 4MJZA 2E40A 3RLUA 1UWQA 4GZJA 5DXYA 5M17A 5E9XA 4QEHA 3T44A 4CD5A 4XZNX 3T7VA 1GQLA 1HFBA 1RPKA 2YL5A 4DXXA 3JRKA 1YQ2A 4GI9A 3O16A 2FZBA 1TPFA 4Z0SA 3O06A 1DWHM 3UJ2A 3QM3A 5KSWA 3ONCA 4LF2A 2VL4A 1TE1A 2CLEA 5EBUA 4CEXC 1TV7A 2ZRZA 4BQ5A 1TMHA 2VQTA 1P7TA 3WQGA 1SYTA 3UVIA 1SW0A 3QPYA 4DIAA 1K8ZA 4LUTB 3AZSA 1BTCA 1FY6A 2ACRA 3Q2DA 1JYWA 1JL8A 3SCOA 5XIAA 1NWUA 3F4VA 4GGBA 2GJXA 3OTRA 4LVDA 4Z1BA 5FKYA 4LYRA 3CAKA 2PEVA 4ADTA 3GTNA 2YDRA 2R1PA 1L2QA 4EK7A 3G1AA 4BWLC 2Y8UA 4JKMA 1O94A 2OX4A 5AN7A 1NOWA 1EWDA 2VX4A 1GOOA 4MFDA 2QXWA 3AISA 3MBFA 3USZA 4CQAA 3VNJA 4IGMA 2OEJA 4ZQCA 4Z1DA 5FJRA 1TPDA 3UY7A 4HVXA 1IGWA 5TIMA 4PGLA 2VZVA 4ZTXA 3E3HA 1ISVA 2HXUA 3DXIA 3NL3A 5HOSA 2X0HA 3LI0A 1ODZA 3PBWA 2IQDA 2QYGA 4I8DA 3MU7A 3WLSA 2ABBA 3QGAC 3NO1A 4DX3A 1Q4NX 2KX9A 1XBZA 1E6XM 1QOQA 1R30A 3RO8A 4MSSA 4NASA 2W0UA 4J9JA 2YCLA 3FAWA 1DXFA 2J7DA 3G22A 3COTA 1XCFA 3GYCA 5LIKX 1UD2A 5F2LA 1UIPA 3EPOA 1Z42A 3M43A 4HZ6A 4IOTA 3RFAA 1Q63A 1YYAA 1RUSA 3OG2A 5DXXA 2W27A 2WNWA 3IGXA 3KWSA 3BXWA 4IXXA 3WUFA 4MFEA 1FH7A 4QISA 3LLFA 3LXBA 1OF8A 5A6LA 1NY1A 1XLJA 4I9MA 3BLEA 4EAYA 1UZHA 4HPJA 3E5PA 4K68A 2ZUVA 1XSIA 1OHLA 1QATA 4GZEA 1NAL1 1ZBCA 2XSAA 1TWIA 1I8JA 1OINA 3LLXA 2TRSA 3LPOA 3BUVA 4AFYA 1FDZA 3ARXA 1VS1A 1ME7A 1C7TA 4BI5A 1WO2A 2C1HA 2QUVA 2GVJA 2E09A 4H3DA 3GNDA 5A8QA 2PTYA 1AZ1A 2YPIA 1IEWA 2PWHA 4UR9A 4E4UA 1PCWA 1FCUA 1DXIA 3VA8A 2Z1WA 5LNVA 3ZSSA 3CBWA 4EPDC 4PFHA 4NAEB 1M7JA 1OQFA 4U2ZA 1S2UA 4QX4A 4PH6A 1X6UA 1XDLA 3UNTA 2EG6A 3ES8A 2FVKA 4GY7A 6XIMA 1OSEA 3SW6A 2Y62A 2BGQA 4QLKA 1TPH1 2IPFA 3HJEA 1US0A 3PG8A 5FEWA 4H4IA 3UXIA 1QXLA 4RDWA 1DIEA 1EFZA 3H2OA 5U4NA 1EJXC 5AZ0A 2OKOA 3BPWA 3VIMA 4ZB2A 4O16A 5DMYA 1FWHC 4X2PA 3IJLA 3GFXA 3W9ZA 4YPJA 1SO3A 3EDDA 3N2XA 3PC0A 3I65A 2C15A 1XYZA 5BOOA 5J04A 4CQBA 2PDIA 3UU0A 4IQJA 2WNNA 3VI2A 1DORA 5JIPA 4D8ZA 3ITVA 4H83A 3RMJA 2FKPA 4M7SA 3H7RA 1V03A 1HG3A 4REQB 3AXHA 5CPMA 1J5SA 4Y90A 4CEUC 3VMPA 2QPXA 3W7NA 3QPZA 4Q4KA 1EO5A 2VEPA 2YIHA 4I6VA 1FWIC 1KKOA 5M3WA 1JYXA 5LIWX 4QS5A 1EP2A 4IJCA 5DELA 3EKLA 3W87A 1H7WA 3A4WA 4ICNA 5CEWA 3VD9A 1LRNA 3A9BA 3QW3A 2Z6JA 4PMZA 1OGBA 4U5IA 2LLEA 4XAZA 3T07A 2X7WA 1N82A 1BWKA 1GPFA 4AD4A 2WVVA 4EX4A 1OC6A 1Q6DA 3S42A 4JIEA 3FFSA 3BLLA 2PWEA 4GJJA 1KBJA 1ODUA 3BWWA 4LT9A 2I9UA 1SJBA 2V2DA 2KZHA 3GNRA 4LB4A 3WF4A 2QIWA 3W7QA 1KNWA 1TTQA 1VF8A 3ZOAA 4PUDA 1R6WA 1G0CA 3KRSA 4TOQA 1NF0A 4DPPA 1E71M 1J79A 3V5CA 2VFHA 4PMVA 2J4GA 1F7BA 1TJPA 4NAFA 1VIWA 3BAIA 1NQKA 1EUAA 4GUHA 4C6NA 1VFUA 4MNLA 5C6MA 1JDFA 5C70A 2QGYA 2F61A 4ZO7A 3TAOA 2PI6A 1P0KA 2J7EA 4XK2A 4B15A 2DW6A 2FFIA 1QR7A 2V67A 1M7PA 3R0KA 2J7HA 1XH2A 2VRJA 3IARA 2IUZA 1MQRA 2F6UA 3NAVA 4NXKA 4RZ6A 2XSXA 4IIDA 4TVCA 5M1TA 1EYEA 3S5YA 2E6DA 3EKGA 5AC7A 1G94A 4JPGA 3R10A 1AMYA 2MUCA 4MWAA 2EPKX 3KBWA 1XWYA 1Z3NA 1IE7C 1KGXA 3KBSA 2VEFA 4PC8A 2VUYA 3CUIA 3LHUA 1SZRA 3NYDA 4IL2A 4L64A 4W88A 4FZIA 3WF0A 4AWUA 1MXSA 3IRSA 3LCHA 4HKPA 4JTSA 1GOMA 2XN0A 2ZZ3A 5LNUA 1RBOB 3UZXA 2CFFA 3DHPA 4TTUA 3BCJA 3L2MA 3GQYA 3CQ0A 1H4PA 2B81A 3WUEA 1JZ6A 2F6KA 5HMDA 4FIRA 5LYRA 1FWSA 1SZEA 2WV8A 4H8HA 1PKNA 5AC6A 3TIMA 4JIPA 4FLQA 3EA2A 2PGRA 5FCZA 2Z1SA 4HK6A 1DIOA 4IX0A 4LV9A 5DF0A 3TX9A 4GACA 1RD5A 3EWCA 1EA0A 2VDHA 2YB1A 2DZWA 5JU6A 1Q4WA 3NPVA 2PZNA 4BI6A 4ZQNA 2ZUWA 4AIBA 3WCZA 1QT1A 3W7HA 4GZIA 1LOQA 4L1WA 4A8NA 4TUFA 1ZNNA 4CN4A 3B8DA 3RU8X 2OKTA 4PCNA 1SZFA 2Y85A 2NT1A 1ITXA 3RCNA 3P8JA 1UBPC 3EXSA 3K1DA 4LUTA 4ZQMA 1A5MC 3HF3A 1B3WA 3H8AA 1KC7A 3CIVA 5AZ1A 3N11A 3IIXA 3S1VA 2PLJA 4JQAA 1XGDA 4IGNA 2A3CA 2HBXA 1SMAA 3QMTA 1FXPA 1JFHA 2ZTKA 3CZLA 2WZHA 1OC7A 1VJZA 4JOMA 2VFEA 2HK1A 2R24A 1VGAA 2PDHA 4KIEA 1MW3A 1S2WA 3V16A 1ISWA 2GDUA 2YCIX 1UA7A 1K03A 2V5LA 3CLMA 5DN1A 1ZLPA 4JIIX 3UFYA 1JZ8A 2CXGA 3B3DA 4UTTC 2BSLA 4B5XA 1ADOA 4IX2A 4PMDA 5LXXA 1GW9A 1WDWA 4QGCA 4IMEA 1EEPA 1TV4A 3AUJA 2JQXA 1GEQA 2YA0A 1EWEA 2WK2A 2ON3A 3CHEA 1HKIA 4KMQA 4MB5A 3H4WA 3TYEA 3WK0A 3P2VA 3SCPA 3IK2A 1U1JA 3OYZA 3G1VA 3KVMA 4UNIA 1J5TA 3TZNA 2FJUB 1DWJM 1S5TA 3SY8A 1LOSA 1IEVA 2WZIA 2ACUA 4PUEA 1CDGA 4O57A 2EO7A 3K2GA 4N7QA 5AFDA 5CXPA 4PMYA 4C6EA 4I90A 2PDPA 3DFSA 2J8TA 2PTDA 3E6EA 3RMEA 2J24A 4W8BA 3V35A 4C6BA 2DH2A 3P5ZA 2Z1BA 3VTRA 3TQ0A 4GNJA 4WSKA 5T91A 3NWRA 2ZXQA 1EOMA 1UUOA 3H24A 2A3AA 1OGSA 3WDQA 5EMYA 1JPHA 3HIJA 4P8WA 4YWSA 3XISA 2AGKA 5CG7A 4DWSC 3MUY1 4KW2A 3MKKA 2D1ZA 3I7RA 3H22A 3N34A 1VRXA 3WH9A 4AX6A 1TQXA 3F5JA 4WCJA 4DJEA 1GYNA 5LNSA 3VOJA 1EB3A 4F0SA 3WMCA 5G4EA 1Y8BA 1U5JA 3CJPA 1QPRA 4H9TA 1A5NC 1B54A 1X6NA 2XIIA 4KS0A 1LT7A 3WD1A 2Q71A 3AMDA 2HJPA 2VCCA 1QW9A 1H5YA 4RV8A 2YX0A 3GW0A 1Z7AA 1O66A 1P1MA 3NL2A 1KO0A 4UQAA 3WLIA 4NAEA 3GNOA 3PZUA 1W1VA 2V82A 3L4ZA 4GYPA 4KBXA 3MBDA 1XV8A 3CUHA 3R79A 3OP2A 4F79A 3H70A 3LTPA 5I23A 1HJVA 1GGOA 1PS9A 5IHSA 4GXWA 2J75A 4MKSA 3FXGA 3T2OA 5CPNA 3DFTA 4J3SA 3M0JA 4PEEA 1V0NA 1GVQA 3GG1A 1ITCA 1DTNA 3RM9A 1Z41A 1GNXA 2EG7A 4Z17A 4WSJA 3GG7A 3KAOA 3ZYZA 1XBYA 3PJXA 1JQXA 4HD5A 3WLKX 4FF7A 4QCEA 1XLGA 2VKZG 2F7FA 2QDEA 2H6RA 4ZO6A 1E6PA 2FZNA 2OT1A 1HF6A 4UOJA 3VNIA 4QXIA 2HS6A 1HIZA 2J88A 5C9RA 4REQA 1YPFA 1H7RA 4W86A 2PDWA 3PVFA 4LAOA 4S3AA 3EDEA 1XLEA 1TRDA 3LBOA 4Q4OA 3W1XA 2V81A 4K8HA 3LU2A 3CTLA 3L65A 4KCVA 1UP2A 3UCCA 3W01A 1UKQA 3NO3A 5HWMA 4HIBA 3APYA 1NH6A 2NX9A 1WKEA 1W3NA 3WK2A 2D2HA 1RALA 3PTMA 4ZB5A 2VC9A 4QSFA 4A29A 3TH6A 1PSCA 4CNNA 4IPLA 3CGTA 2ZZ6A 1WBHA 1IXPA 3S47A 1GVOA 3ICJA 2GVEA 1OABA 1NDZA 3L67A 1DJQA 2NQLA 3LCWA 2QUMA 4NVTA 4IUGA 2Y6ZA 2V5BA 2TPSA 4K38A 3QW4B 1OD8A 4C6FA 4LVBA 3A47A 3GG8A 1GHSA 3N6QA 3TN6A 1HUVA 1E5JA 4KRTA 2HQAA 4XAGA 1NOFA 2GPTA 4F9JA 2CNCA 2OQLA 1TVLA 2R82A 4LYPA 3W29A 3LD5A 3VGHA 1T8XA 3TFXA 1IQ8A 3LYEA 3WK1A 5HWNA 4PCTA 1R87A 3V5OA 2A4AA 1DJGA 4JFTA 4LB3A 3M7WA 3G1DA 2DZTA 4I8YA 3F2BA 3BOXA 3UXKA 5ENLA 2INZA 4GQRA 3S5ZA 4PCSA 2OLAA 3LN3A 4GH1A 3F5KA 5MF5A 3AIUA 1ZZMA 2A3HA 5IFTA 4GKLA 3P62A 4MY1A 3PWAA 4CUCA 5FIPA 3OLDA 1K77A 3F2CA 4V27A 2P0IA 3ZM8A 3A23A 1XIBA 3WMSA 4UBPC 2C13A 3EOEA 1VYSX 1B4KA 4PCPA 1KBKA 3OODA 3ERPA 5D2YA 2CLOA 3LQGA 3AS1A 3ABXA 4PMOA 5LKYA 2A7PA 3MT1A 1IYXA 1B31A 2NT0A 4LY4A 4YYCA 3WLHA 4UTWA 1V6YA 5DO8A 5E0CA 1VBJA 4ADSA 3A5VA 4PBEA 1NDVA 2C1GA 3QY7A 1OCBA 1JF5A 1XYMA 4TMCA 3SQLA 3PPGA 2DZUA 1JCLA 3O05A 3PNUA 4IGHA 1HJQA 3K13A 4N9BA 3PZGA 1YIXA 1M01A 1TIWA 1US3A 1EDGA 3LZ3A 4WJXA 1H1NA 2CKRA 2X7VA 1NF7A 2DH3A 1OY0A 3EOLA 4ALDA 3C3NA 3WLQA 2ZZ7A 3R12A 3CYJA 1KV8A 1UPPA 3OEXA 3F03K 4AZ6A 4WF7A 2AAAA 5RUBA 3U9IA 1MFUA 4XKMA 4GH3A 4LS2A 4XV0A 5EMMA 1XH1A 4QDWA 2J9XA 1TZZA 4KH2A 5D2VA 5EMKA 3MWAA 4Q3MA 4WHBA 2D24A 5D9PA 1W5NA 3T55A 1SFJA 1SJAA 4O13A 4G6CA 4ZBCA 5HDRA 1B1YA 3RIKA 2EGZA 1QWGA 5FJPA 1O95A 1WKYA 1UH3A 3PP7A 4PUWA 2A6NA 4JTAA 5KETA 1FCBA 4DF2A 1F05A 1ZHAA 3I3EA 3LBMA 3E1F1 1F4HA 3DHFA 1EHAA 5EMUA 4DUXA 4O1CA 1FWTA 3C52A 1C8VA 3CHCA 3IIPA 2DZPA 3S9IA 2G8ZA 2Z26A 3W27A 4AU0A 2GJLA 4XVDA 4HYVA 1J11A 4M6VA 1LJYA 2XHYA 2Y63A 2PAJA 1E3ZA 1O5KA 5FF3A 4NYUA 1THFD 5EU9A 4BA0A 4M7TA 4DBWA 1BKHA 4PBGA 3FYYA 2CEQA 3MI2A 2VC7A 3TAKA 1UC4A 3SURA 1GZJA 3ATYA 1XGZA 4UTHA 3SIMA 3UZZA 3DC0A 3OVPA 3MCMA 4IP7A 4M56A 4PE8A 3TA9A 4C1LA 1F8MA 1I2NA 1TTIA 4NRSA 1TQJA 1ADDA 1W3HA 1XSJA 4F40A 1PHWA 5EFDA 2YDSA 5A8MA 4K39A 1A5KC 1I2PA 2C16A 3P6LA 2DY3A 2O55A 5E93A 1J0KA 4EXBA 2DIJA 4NZ5A 1AL8A 4IFKB 1R2RA 1GPWA 3UR2A 3SEPA 1DE5A 3BE7A 3RPMA 1IV8A 3UNDA 3L2LA 5CZ0A 3TC6A 3U48A 4O28