1AH4A

Pig aldose reductase, holo form
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
314
structure length
314
Chain Sequence
SHLVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQGQVVKREDLFIVSKLWCTDHEKNLVKGACQTTLRDLKLDYLDLYLIHWPTGFKPGKDPFPLDGDGNVVPDESDFVETWEAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYNRNWRVCALMSCASHKDYPFHEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
publication title A 'specificity' pocket inferred from the crystal structures of the complexes of aldose reductase with the pharmaceutically important inhibitors tolrestat and sorbinil.
pubmed doi rcsb
total genus 104
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1997-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ah4A00
2IPWA 5LIUX 2IKHA 1S1RA 2ALRA 3V35A 2INEA 4YU1A 3ERPA 4L1WA 4XZLX 3H7RA 3WBWA 3Q67A 1MZRA 2IPGA 5AZ0A 4MHBA 4F40A 3UP8A 2ACQA 2J8TA 3N2TA 1FRBA 3LZ5A 3UYIA 1OG6A 2IPJA 5KETA 4WRHA 2IPFA 2IQ0A 3MB9A 1ADSA 2IKIA 4XZHA 3RX4A 4JQAA 3GHRA 4GIEA 4IGSA 3EAUA 2FGBA 3UWEA 2PDPA 3LBOA 1AH4A 3GHUA 3M0IA 3R43A 1C9WA 4H8NA 4FALA 4YS1A 4JTQA 1LQAA 4OTKA 1Z8AA 1PZ0A 2AGTA 3T42A 2PEVA 4XZMX 1Z89A 3UGRA 3BV7A 1US0A 1MRQA 1MI3A 1ZGDA 2FVLA 3UZYA 2BGQA 2PDNA 2HV5A 3B3DA 3WG6A 1IEIA 4LB3A 2PDIA 1HQTA 3G5EA 4DBUA 2IS7A 2R9RA 3UFYA 2PF8A 3CASA 2P5NA 4PRRA 2PDHA 4XAPA 1ZUAX 4FAMA 5LIYX 2PDYA 1LWIA 4JQ2A 4JTAA 1HW6A 1Z3NA 1IHIA 2FZBA 2VDGA 4XK2A 3DN5A 4JIRA 4JQ4A 1AZ1A 1XGDA 3DOPA 2FZ9A 3ONBA 2PDLA 2FZDA 2CLPA 4HBKA 2PDXA 1YNQA 3R94A 4G5DA 1Z9AA 3S3GA 1PZ1A 2ISFA 3LZ3A 2C91A 4JQ3A 1T40A 2HVOA 3BUVA 2DV0A 3KRBA 2HDJA 1QWKA 1J96A 2PD5A 4PUWA 1AFSA 2WZTA 2DUZA 4WDWA 3NTYA 4LBSA 2I16A 4JTCA 4I5XA 5HA7A 3Q65A 4WDXA 4PRTA 3V0UA 3FJNA 4JTDA 1RY0A 1YNPA 5JH1A 3V0SA 3BURA 3H7UA 2PDJA 3GHSA 4XO7A 1ZSXA 1AZ2A 1SM9A 2DUXA 1AH3A 4JQ1A 5HNTA 2WZMA 4QXIA 3VXGA 3UG8A 4WDUA 4QX4A 1UR3M 4GCAA 2F38A 2BP1A 4GA8A 2ACSA 5AZ1A 1AH0A 3GUGA 4XZNX 2BGSA 2PDWA 3CV6A 2R24A 4XVEA 2QXWA 1R38A 4ICCX 4NKCA 4JTRA 4WDTA 4LAZA 4GACA 4LB4A 1Q13A 2IKGA 3D3FA 3WCZA 3F7JA 4IJCA 3GHTA 4DBSA 1YE4A 3LENA 3V36A 4GABA 4YVXA 1Q5MA 3CAVA 3QKZA 2HEJA 4GQGA 4XVDA 5LIKX 3CMFA 1EL3A 1RALA 3ONCA 3CAQA 2HE5A 4Q3MA 5JH2A 5LIWX 3RX2A 4YVVA 3COTA 4PR4A 5HNUA 2FZ8A 3LQGA 2PZNA 1S2AA 4XZIA 2PDMA 2PFHA 4YVPA 4EXBA 1PWMA 2PDBA 3EB3A 4RPQA 4GQ0A 4QBXA 2PDFA 4FA3A 4PUUA 5LIXX 2PDKA 2ACRA 1RY8A 1EKOA 2I17A 4LAUA 3FX4A 3UZXA 4JIIX 1EXBA 5DANA 3LEPA 5M2FX 1JEZA 1XJBA 4XO6A 4IJRA 2A79A 3M64A 2IQDA 4WEVX 1XF0A 3H4GA 3EB4A 3G1RA 4Q7BA 3R8HA 2HE8A 4EXAA 3N6QA 3P2VA 1ZQ5A 1YE6A 3MC5A 1PWLA 4WGHA 2PDCA 1QRQA 3V0TA 2ACUA 2NVCA 1X96A 3O3RA 3R7MA 3U2CA 4R9OA 3CV7A 4ZFCA 4H7CA 4JIHA 1T41A 3WBXA 1A80A 2INZA 2PD9A 1X98A 4ASTA 4AUBA 1VBJA 3RX3A 2PDQA 3LUTA 1S1PA 5C7HA 3BCJA 3UZWA 4LBRA 2PDUA 4HMNA 3R8GA 4QR6A 3R58A 3C3UA 2NVDA 4FZIA 4L1XA 2IKJA 1GVEA 1PYFA 2F2KA 3WBYA 1X97A 3LD5A 3LQLA 4PMJA 3R6IA 1EF3A 4DZ5A 1S2CA 3LN3A 1VP5A 3M4HA 4DBWA 3O0KA 2HVNA 1M9HA 3UZZA 1K8CA 3LNMA 2PDGA
chains in the Genus database with same CATH superfamily
2IPWA 2G3NA 2VRKA 4YCOA 2EG8A 4Z1BA 2AQOA 3V35A 4NJIA 4EF9A 5C9XA 1GVIA 1IXQA 1VYRA 4AZCA 4C6OA 1EJXC 3AJ7A 3T7VA 5E9AA 4KETA 2FDMA 2WVVA 3AHVA 2W63A 4Z2KA 3GVQA 3CWNA 1A4MA 5ABFA 4OBRA 5A2BA 3GW3A 2J8TA 3TN4A 2G97A 1W2PA 3MSRA 1B2YA 1ZRQA 4DUXA 2G8ZA 1ZNNA 4ZGYA 1QPNA 2D2JA 2EBNA 1YDVA 1TTJA 1LM1A 3ITVA 1U2YA 3WF2A 3K46A 3KP0A 6CGTA 3OPSA 5KTLA 2PE4A 4AF0B 1VPQA 3VDAA 3N6JA 3S1XA 3P8JA 1KRBC 1AH4A 4KRUA 3GHUA 4NAFB 4JR5A 4UR7A 3BOFA 6XIAA 3C8FA 1ONEA 1LOLA 4MY8A 1US2A 4H6QA 4PTVA 1Z44A 2VUNA 2ZXAA 3GS6A 5DXYA 1AL7A 1DIEA 2BVYA 3E2QA 6PTDA 4AD0A 2F84A 3NWRA 4H1ZA 3ZJ6A 3O63A 1MRQA 1ZGDA 2PDNA 4HK7A 2X2GA 3EPMA 3NVTA 4TMBA 3K2GA 1IIHA 3B06A 1QW8A 1AVAA 2GSJA 2PU0A 2XIOA 3K8MA 3H7VA 3K13A 4ZO8A 1HTIA 4ZB0A 1JYWA 1WOAA 3OYXA 5AYZA 3ITLA 1T6MA 4QITA 3LRKA 5FI8A 3EEZA 1HW6A 1JQXA 4QS6A 1VBGA 2OELA 4IPPA 1CCWB 1Q63A 1ME8A 3AYTA 3WLIA 2A4AA 2HTMA 3NEVA 4BF9A 4CQDA 1HNYA 1AW1A 5J8LA 4MPQA 1QAPA 2W4XA 3BSHA 4JTSA 5IM51 5IXEA 5HQLA 2CYGA 3STGA 1W9DM 4MOZA 3DERA 4D8AA 1ZJHA 4H9XA 3FV9A 3AXMA 3KOFA 3L68A 4K1GA 1J18A 4F9JA 3CUIA 1Q7MA 3TU9A 3VNDA 3R5EA 1G4EA 3FJNA 2WM0A 3W88A 1UH4A 3OIHA 3LHTA 2VO5A 2ZBTA 3U3HA 1I4NA 5JH1A 4F9DA 3CLMA 3N1AA 4AVOA 3P8IA 4DXXA 1HJUA 7A3HA 2PLJA 3W7IA 2E1DA 2WZIA 4CCEA 1WZMA 2D2GA 5U7SA 2RHGA 4QHRA 4DJEA 4JYEA 3VMNA 2B0MA 3WD1A 3RR4A 3GFZA 5I00A 1G1YA 5D9NA 3CV2A 1H7XA 2J62A 3CZEA 3EBVA 1RA5A 4WJ8A 1WKDA 1H7OA 1PDYA 4IM4A 1G4SA 3KBNA 1Q7ZA 3HGOA 5T9CE 1UZ1A 1KWGA 1WUFA 3SZ8A 3VKKA 3WH7A 1NWTA 3IS4A 3PANA 1P1MA 2VGIA 5HR7A 3QHMA 5D8WA 3IJLA 4HZ8A 3RO6A 4LEQA 4KW2A 3HIJA 1V93A 3PUDA 3QV6A 4F2UA 3MBFA 2XIMA 1E5JA 1UMLA 3B8DA 4GQGA 4K1WA 1V3JA 3NUKA 4E8GA 4P7RA 1Q6EA 1JZ6A 2Q02A 4Z17A 2WSQA 4MFDA 2E09A 3WF4A 4EXQA 4GINA 4DZIA 2POTA 4ZQOA 4M1RA 3LSCA 4GQ0A 4N7QA 2FDSA 2AKZA 1YPIA 4H9TA 3H24A 3JU2A 4BHYA 1XUUA 4DM2A 4UTTA 1FWSA 3MA8A 1GOQA 1IYXA 2R1KA 2VYOA 4AC1X 1F5ZA 1CXLA 8XIMA 5B7YA 2I5IA 3LBCA 1XHGA 3H2NA 2GGJA 3IAPA 1KM2A 7TAAA 4JFVA 1M53A 3KE0A 3PWIA 3P2VA 3FLUA 1RAKA 3C4UA 3ZT7A 2AL1A 4C7GA 4NZCA 4GJJA 2ACUA 1KQZA 1JCYA 1MW2A 2WZHA 4GI9A 5BCAA 4JPGA 4RK8A 4ACZA 1BTCA 1IT8A 3REQB 3SUTA 2CXEA 2GOUA 4D6HA 1J0KA 1WE5A 1K03A 1G69A 2GUBA 3E38A 1JF5A 5M5DA 3LCLA 2IXUA 3QR0A 1EP3A 2ZRXA 3QQ1A 1BYDA 4QR6A 1FWGC 4PRWA 1E5NA 4ZMGA 1GKQA 3EWYA 3ITTA 4C6CA 3W3OA 3URAA 3HPSA 4FXFA 2WBGA 1YXCA 7PTDA 3TQPA 4DAFA 5FJOA 5A1AA 4YTQA 4DZ5A 4D6DA 3LX9A 4L80A 3H6OA 1PKNA 5TQLA 3H2EA 3NQ8A 2O7SA 3QPYA 1V6XA 1YQ2A 4FMVA 4LAKA 1WDWA 2X09A 1Y5VA 4RX0A 4BK9A 1VB9A 1GOKA 5KEZA 2KAUC 4ADUA 1XIJA 3URBA 1SZNA 2Y2WA 4CEUC 3CK5A 3U7VA 1QOQA 2ZDRA 1JULA 1BG4A 3APTA 1FCQA 1OBAA 2HS6A 1E0TA 3PG9A 4HVXA 3Q67A 1IT7A 1SO4A 4LCSA 1X6UA 4EKJA 3NQAA 3R0UA 2OLHA 4QJ1A 4TX6A 2VEIA 5EA9A 4N9DA 3ARZA 2WHLA 3C3NA 3W1NA 1XGEA 3SGZA 1FRBA 1K9TA 3MMDA 2ZRWA 2E8YA 1QI2A 5CEWA 3B4YA 2DZPA 5FA5A 4GYJA 1U30A 2DZBA 1K1DA 1L9WA 4OV4A 1UIOA 2GQ8A 4PMQA 4C7FA 3QN3A 3E6EA 4DYKA 2Y89A 3UA3A 4X22A 1KXQA 2Z1SA 3GYEA 1FCBA 4IIDA 4FALA 2Q8ZA 3B8TA 1L8PA 2CLMA 2JEPA 5FOOA 3AZTA 3GNDA 3U2ZA 3VGBA 1PE1A 1DIDA 3LTSA 1UOZA 5HWJA 3Q2DA 4OKDA 2GJPA 2CC0A 3RRAA 3MI3A 1W1PA 4NILA 3QYSA 4D2JA 2XVNA 4LVAA 1YMYA 1GJPA 3IUIA 4UB9A 2J7FA 3EXTA 5CG7A 1R3WA 1F4AA 4UIOA 1W1ZA 2Y4SA 5FL0A 2OO6A 2QVNA 1DWHM 1XDJA 4A8NA 2BMBA 3GO2A 4M81A 4WKFA 2I1OA 4J40A 5IFPA 3ANVA 1WX0A 3IIZA 2I7GA 4XAPA 5HPOA 4H00A 1Q6QA 1WAWA 3CAKA 4RDYA 5HINA 4OVXA 4PMXA 5DRIA 1X7FA 2BVWA 2WMJA 3M1ZA 4MYXA 2VGFA 4CVUA 4C6QA 1NARA 4O8RA 5EBUA 3BL3A 1YW1A 1W17A 2EXOA 2O9PA 1BLIA 1P43A 3FJLA 1W56A 4S3EA 4FO4A 3CEUA 1JG9A 4WSJA 3TW7A 3UETA 2XH4A 2VELA 5D8ZA 3PPHA 4KIEA 1HKWA 4HZ6A 1CT5A 4ZB5A 3H2OA 2AGKA 1XIEA 1MSSA 4J3ZA 4QG9A 5IHSA 1KLZA 1TB3A 4IUGA 1TV7A 1GZGA 1H2JA 4W5ZA 4PMVA 3QQ0A 4AW7A 2VR5A 5HA7A 4AQLA 1A5NC 1U5HA 1KRMA 4ZE4A 2BLEA 4O1FA 4UZUA 1EOKA 1VCGA 4RV8A 4S3DA 5B7ZA 1FCUA 1WKYA 4V28A 3WMCA 4RPPA 3AMCA 5I23A 1G5AA 1E0UA 3V0SA 3QV7A 1XLGA 5I5RA 3ZMRA 3ABZA 2PA6A 3NNTA 4CN6A 1A5UA 5CPTA 2HSAA 5GPRA 2VCAA 4AIUA 1RK6A 2P76A 4GWEA 1V5XA 2OOGA 3KLKA 3K30A 2OZ8A 2YBUA 1MXSA 2VHLA 2BWGA 3BH4A 4Q22A 4IMDA 2ZA1A 3F5JA 1CGUA 1XIIA 2F7FA 4HYRA 3POCA 2ZUNA 3U5YA 2Y24A 4M56A 2JQXA 4U28A 3KZSA 3QPZA 2A3CA 5CBBA 3MUIA 1UWSA 5BU6A 3AIVA 3KBJA 3ARYA 3BC9A 1Q13A 4B2DA 3GR8A 2QAFA 3QV9A 1QHPA 1FY6A 2Q8XA 3PZVA 1G4PA 1Q45A 3T0DA 3TA9A 4Q4MA 1ZJAA 5H91A 3HPFA 4Y9MA 3VDGA 3QKZA 4GIRA 3SSJA 3UD6A 1H62A 4U33A 4C6PA 3SRDA 1IQ8A 1MMFA 1DP0A 1JD7A 2NXIA 4FOUA 1TWZA 3L9CA 5A8QA 5LIWX 1ITUA 4JTGA 2VEPA 5J5DA 2YB4A 4ERGA 2PWHA 4KMQA 3SR7A 4UTLA 3NQFA 2OX4A 4E4UA 1V3HA 3BOLA 2G37A 4WIWA 2W79A 5CBIA 2PDFA 1VPXA 5D9MA 3ZT5A 4PUJA 1FWEC 2W3ZA 3WQFA 2JE8A 4XSLA 3FDGA 1QNSA 3PULA 4IFRA 2H6RA 1F73A 1X38A 3SIMA 3A3WA 4S2CA 3SO7A 1RJPA 1R0MA 4GI6A 5A6JA 4AHPA 1AMKA 1XM3A 2A3AA 2VWTA 3E1F1 4IJRA 2C19A 3N19B 4JCLA 5A8MA 3TIMA 3LI0A 3CMGA 4E2OA 4FOKA 3WD4A 5I24A 3AAMA 3D6NA 1DV7A 4GQBA 3TSBA 4CCZA 5I07A 4GZIA 2VUYA 4WGHA 4K7VA 2PDCA 1XLFA 3AU2A 5AHEA 1XBVA 4ORIA 3R7MA 1HO4A 2J27A 3U2CA 5GJMA 5DY2A 1B3VA 4AX7A 2XJ7A 1KKOA 1VH7A 2F8QA 5I3IA 1OCQA 4N02A 4EPKA 2WWDA 1DIKA 4B3KA 3THDA 3PPCA 4AUBA 1H63A 1BWKA 2OODA 2XSAA 4OUEA 5HK4A 3AS2A 3N12A 1NF0A 4JY8A 5C7HA 4LBRA 3VNYA 3R8GA 4HNCA 5HMEA 3WJWA 4RDVA 5CKSA 3APGA 4TMCA 5M03A 2WNNA 4XBKA 3XISA 3GSMA 1ZPTA 3QRHA 5AVNA 1L6GA 1V0MA 2RDUA 4C65A 1H50A 3PB0A 3L7RA 4UTTC 4CNNA 4JEQA 3T2OA 3FXYA 1GG0A 4W4QA 3I6TA 2C16A 3NO3A 5AOUA 3ZM8A 4V15A 1E40A 4P61A 4CUCA 3T8QA 3W7LA 1UZHA 1JPDX 1XLHA 1SFJA 1NELA 2V0TA 3OZYA 1I0BA 3ARUA 3W2NA 3G8RA 4HNOA 5AECA 4HOWA 3I3EA 5H1WA 3IGXA 3KL3A 3SUWA 3VIOA 4DZHA 1CGVA 1YTDA 2VZUA 3LOTA 4ZQRA 2J7BA 1CXHA 3N14A 1BVWA 4K37A 2D1ZA 2DIEA 2W62A 4Y8EA 1E9LA 4WRHA 3WNOA 4YWSA 3MMWA 4PUEA 4UFJA 3M44A 1KFKA 4DVOA 3M41A 5BXTA 3RX4A 2A7PA 3ZJ7A 4GIEA 5BROA 4JL2A 3ARTA 4AC7C 1MUMA 1PDZA 3OHIA 4D1JA 2V67A 2VMFA 4ES4A 5HMFA 3IJ8A 1OSEA 4RDWA 1UPPA 3ZS4A 2EG7A 4PBGA 1NVMA 4K8EA 3DHDA 1KV5A 3R79A 4IZGA 4Q7NA 3DDMA 2V2CA 2WMGA 1OIMA 3DKJA 4P7OA 3V1PA 3WG6A 1NWUA 2ZX8A 4NI8A 5AHFA 3MZ2A 2I57A 4HJWA 1GOOA 3RN6A 3M6YA 1MQQA 3GR7A 5C7VA 2X05A 3OBAA 1YDNA 2XVGA 3VTRA 3E2SA 2CKSA 1NTHA 3DI1A 4O53A 5AVHA 5CZ0A 4JTAA 1E6QM 3ZO9A 1KWKA 3QVQA 4WXZA 4ZQMA 3FVDA 2OZTA 5C6MA 4MPKA 1R3TA 4HP5A 3FHQA 3DN5A 4MWAA 4K39A 2J79A 1LBFA 2NWSA 1XDLA 3EPOA 5HNNA 4MMWA 5PTDA 1AJZA 1C92A 2ZZ6A 1G01A 4TR9A 1HG3A 1PTAA 3PWAA 3R94A 1Z9AA 4LYPA 2QUNA 3SN1A 1HKJA 3GG8A 2OJPA 3NL2A 1GQNA 2ISSA 1Z7AA 5BOEA 2ZUTA 2X1UA 1QWKA 4NVTA 1TREA 1TIWA 2BXVA 3AIEA 2BODX 1AFSA 1UMYA 3W1TA 1XIGA 4IPLA 3DCPA 1TMQA 3RR1A 4JTTA 1TVPA 4FS9A 3W7DA 2V5LA 1K8ZA 4E6MA 3W0KA 3W28A 8CGTA 2B7QA 4F48A 4Q8OA 3W76A 1B4KA 4C6JA 1N2VA 4IISA 3AIUA 2V82A 1GTEA 1VFUA 2VFIA 1EP1A 4JXCA 3ID7A 1XYFA 3MUCA 3BGJA 4K8GA 5GJNA 1EC9A 2GQ9A 4BEUA 1G67A 3T8LA 2RJHA 3M0MA 3QYQA 3B0PA 2J7HA 3LTPA 1BF2A 5F2LA 3ZR6A 5HANA 2D0GA 3B0UX 5LNRA 3RLGA 2EPHA 4G6CA 1GWJA 1JZ8A 4M24A 4MKSA 1FHUA 3G1DA 5DX7A 3TX9A 4EVZA 1KRAC 1PEZA 3PBMA 1VBUA 2BGSA 5BNKA 4G9PA 2CZDA 1K4GA 4OWGA 1QI0A 5CPQA 2DT2A 4X61A 2JBMA 2ZZ5A 4DJED 3M5XA 3WCZA 3MCOA 1TSIA 2CKRA 3UR5A 1W8GA 4IMGA 4IJCA 3WMSA 4PSPA 3TC3A 1UA3A 1XH0A 1X1NA 3W2JA 2VC9A 3CH9A 3WUBA 1BF6A 1J10A 4ILSA 3COTA 4FNPA 4RE3A 4G7EB 3SDOA 4G56A 1SSGA 3KDOA 3FSTA 3WLLA 1PKYA 4F2BA 5LSMA 3DBNA 3M0KA 4IT1A 5EPDA 2GSEA 2VRJA 3SJ3A 3WIJA 4MUZA 4REQB 5LYRA 4ACYA 1PWMA 1FFRA 3U9IA 3W7KA 4L9XA 1Q6OA 4DZAA 4HU0A 4AZ6A 3VOGA 4EANA 3R2GA 3HBLA 4O0QA 1ZU8A 2HPIA 3CS2A 1CNVA 1OD0A 2BOEX 2OYLA 1K02A 2PGWA 1GKPA 3SB0A 1C7SA 4NI3A 2PUZA 1JR1A 4DJDC 2HJPA 1DXIA 1GYMA 4XO6A 2A79A 5T26A 2R1LA 3TVAA 3S1VA 3W27A 2VNCA 4DUWA 3AXKA 2WZEA 1W3LA 4LUSB 3SRHA 1KV8A 1XL9A 1VJIA 1OF8A 3RGTA 4FLOA 4HYWA 1XDMA 1GJUA 1NSJA 1CIUA 2GJLA 5AHLA 2B31A 4N9CA 4Q4QA 3GKFA 2Y0FA 1D3HA 4Z0JA 4OBSA 4O19A 1UWIA 3OA3A 3CYJA 5M1TA 2XGBA 4JIHA 1WZAA 1K7EA 3WBXA 2QDGA 3MI6A 4PL1A 1DJHA 4JYFA 3EOUA 3RX3A 1EA0A 2FHCA 2ATMA 2PGRA 1OK6A 1X8FA 3B8IA 1UUMA 3NO1A 1TPUA 3PZMA 5BWAA 3OVQA 4Q4PA 4Y9OA 4QQ3A 2NVDA 5DBTA 1EDTA 5T91A 3G1FA 2NWRA 4DI8A 4CD6A 1W3IA 1DTNA 1X97A 1ME7A 3LQLA 3S9ZA 2NQLA 1GKRA 4MB3A 1XICA 1VBRA 3GXMA 5FL1A 1MDLA 1B30A 4GXWA 2INEA 3U5UA 5CSRA 1M1BA 2WJDA 2XN1A 1VS1A 4O52A 4R7OA 3CPGA 1O1ZA 1OCNA 4YIWA 5K9XA 1MZRA 5AHIA 3QLDA 5BRBA 4Y9AA 2OQHA 1Z69A 2JKEA 3DGBA 1FDZA 4EAMA 1B54A 2DZXA 2IQTA 3HGJA 3TYUA 2ZVIA 3CB3A 2OWCA 5A6LA 9RUBA 1REQA 3RXZA 3QTGA 4V2XA 3RJXA 3N15A 1ISWA 3TTYA 1L6WA 4ML9A 2J7EA 3L5LA 3PZQA 2E0PA 2E67A 4IPJA 3OLGA 1M7JA 3E49A 3ELFA 3FHAA 1KCXA 4L6OA 4YS1A 2XG9A 3EOEA 3OO2A 3QKEA 4Y7EA 4X0NA 1P0DA 3OTRA 1UOKA 1VFMA 1Z48A 3URNA 4LVFA 3VIGA 3GLCA 2W5FA 1Q2RA 1QU4A 2PZ0A 1TKKA 3GC2A 2HV5A 2D3NA 3HTWA 2YZRA 3DGRA 3IK2A 4IF2A 2OEKA 3EZ4A 4MNKA 4NNAA 3WLQA 2CLEA 2I5QA 1AD4A 3A64A 4CN1A 4JFTA 1JRCA 2FQIA 2P5NA 4P8WA 3JUGA 4DX3A 3NQ6A 2WSKA 4AXNA 4JFSA 1F7BA 3TN3A 1J0IA 4Q8MA 2CW6A 3LCGA 1QVBA 3CEPA 1GORA 1QNRA 3CHVA 1K9DA 5I3GA 3CPUA 3S47A 1YRRA 3NOEA 4XK2A 3FKRA 3CZLA 1W3TA 3V5FA 2VFEA 3MT1A 2PLMA 4IIEA 1KW1A 2ZUVA 4ZENA 5CJMA 2WAGA 1UP2A 1E55A 2J13A 2G3FA 1GW1A 3S83A 1PZ1A 4LGXA 5EB8A 1JCTA 4FSAA 1UKTA 1OINA 3RRXA 1NFBA 3BAYA 2V3FA 2A2IA 1WCGA 2B7PA 2E7FA 3E0FA 1JNDA 2E9LA 4CGTA 5H8PA 1NOWA 1WDQA 1R3QA 2V5JA 2ZXDA 3B04A 5JBFA 4Q8PA 2R1NA 3SRKA 1E6RA 5CLWA 2VDHA 2UZ9A 3Q58A 3FGCB 2HXTA 3E0WA 5JBEA 1MXGA 3UJRA 1XYLA 3OJGA 2QCDA 2C1IA 1W3NA 3DC8A 3H7UA 1A5AA 2PDJA 1GPWA 4PUNA 1GK8A 2C0HA 1ZBVA 3S5NA 2Z1BA 3WD0A 2JALA 2WLYA 5CG0A 4MWAC 2PRLA 3FOKA 3GE7A 5F2MA 4Z2LA 1EUAA 5HQMA 4Q8NA 1PXGA 1NF7A 1VEPA 3C2YA 3GKAA 4GA8A 1C90A 1TRIA 3TJXA 3VAVA 2OKOA 3G1YA 1QJWA 4RV3A 1RD6A 2ZA3A 3ZYZA 4J3TA 2QCFA 4EWND 1TR1A 4AZCB 2YGYA 3IJ9A 4OT7A 4O4WA 1C7TA 4INFA 1SZGA 2WVVB 5EMKA 3WH8A 2TRSA 1AD1A 4AG0A 4J2MA 1OYCA 1B31A 4L4PA 4NYYA 3T6CA 5ABFB 3RLUA 2UY4A 1HFBA 4XVDA 4ZQCA 4IGHA 1XFBA 1VFFA 1EL3A 2CITA 4HPHA 4M82A 4C1NA 2DZVA 3T78A 4Z2GA 1AMYA 3RPTA 3T0CA 2AQWA 4J3VA 4OOZA 4QP0A 1JDEA 1XGZA 2YW3A 4FIQA 4EE9A 3MKVA 1XW8A 4TTGA 1TA3A 4QLJA 2PFHA 3STEA 3W7GA 3W1XA 1HGYA 1IGSA 4MJZA 3HM7A 4I8YA 5CPNA 4GVGA 1V8EA 3R11A 1TZ9A 3W00A 3S9IA 3E2RA 2XFYA 1HGWA 4DO5A 3L4WA 4UMCA 1W1VA 1B5TA 3LA4A 1DWIM 1FWFC 4AH7A 1BKHA 3DFHA 3NM1A 4J3XA 2JKAA 4B5SA 3R8HA 3AMKA 3N6QA 3BPWA 1PX4A 4C6LA 4DUVA 4QDWA 1R9ZA 2R94A 3N4EA 3JZEA 1GOXA 3C56A 1DEDA 2ANUA 3ANYA 1MFVA 1D7FA 1LWJA 1FVPA 1X96A 1K3UA 4DWSC 1E0VA 2C1HA 1JI1A 4R9OA 4OQVA 2TYSA 5BRPA 1KM6A 2BTMA 4Z1YA 1RCXB 4ZFCA 2P10A 4I7WA 3BAWA 4MKNA 4A8RA 1RBOB 2ZZ1A 1VBJA 2PDQA 4TTUA 1J9YA 1V02E 4HNUA 5A5WA 3FA5A 5FEWA 5BXPA 3BMXA 3S6TA 3E5PA 4PCNA 2FB3A 1N82A 4FZIA 3HU7A 5G4HC 2G0WA 1S46A 2NXGA 1EF3A 1GOMA 2GDUA 1W3JA 3M4HA 2QULA 3PC0A 2Y61A 4RE4A 3W2LA 5IOBA 1J11A 1EIBA 1YTKA 1U33A 5U4NA 4MSSA 5EFFA 1OWQA 1LG1A 3G24A 4DO6A 2WQPA 1JIBA 3N2XA 5A8NA 3FSUA 4L1WA 4Q8QA 1H1YA 3BO9A 3WLTA 1NQ6A 3WBWA 3IRDA 4JFUA 2IPGA 2ZXBA 4KCVA 3ARXA 3MKKA 2VJXA 2VD8A 3GVRA 3STPA 3W83A 1ZBCA 3PSWA 1FH8A 5M3WA 1WDPA 4BS0A 4YWIA 4WY0F 1X1ZA 2BB0A 2F2HA 1I2PA 3CQKA 4Z2IA 2NX9A 3BXWA 4O0ZA 3W74A 5ABGA 3WLPA 2EG6A 2PWDA 4GVFA 3PZUA 1ADSA 1G7UA 3KRSA 4U5IA 5D37A 1I1XA 1UKPA 4O28A 4RKAA 3IWPA 1TPH1 1DPMA 3GNPA 5A95A 3P6LA 4RJEA 2WVTA 4H41A 1M01A 1PTGA 1TZZA 3O9NA 1C9WA 1W1B1 3TA6A 3THAA 4MJ2A 3RDKA 4PMNA 2QAPA 1TV4A 2J4GA 4MDPA 2HCVA 1GVRA 4ATWA 4Q8WA 1W31A 4NG3A 3BV7A 4WLCA 2NV9A 1EP2A 1US0A 1MI3A 3SCVA 1JVNA 2VURA 3VINA 1C93A 2QR6A 4LB3A 3N4AA 2WLZA 4NASA 4GOAA 3W7HA 4ZSTA 4MYAA 5ABTA 4PTDA 1UWTA 3BAIA 1WXJA 3NSMA 4O1BA 4X2PA 2EQDA 3LYEA 5JIPA 2J7GA 3I68A 5FJTA 1S2WA 4WVXA 2OYKA 1KM1A 1F8IA 5CZKA 1LWIA 3A6OA 1UB3A 2OR2A 1FWDC 1HXJA 4DBDA 3EMCA 3BGGA 5C8BB 1EGZA 4N0RA 3W1RA 3NDYA 1S5VA 2QIWA 4L4LA 3L4ZA 4LT9A 2Z7KA 2OCZA 2WXDM 3DFOA 6ENLA 1OIFA 3FY1A 4HBKA 2ZWZA 4K7YA 5BRQA 4RXFA 1ONRA 1PTDA 3DG7A 4FX7A 3TR9A 2YBTA 2ASHA 2C0AA 1H51A 4HMEA 3WQEA 1NEYA 3G6LA 4M5PA 3EMQA 4KRZA 2CIPA 4MM1A 4K8HA 1BQCA 5EMMA 1XLMA 4U2ZA 5CPLA 2CFFA 3ENLA 1P4CA 2XIBA 3NSNA 4W88A 1CGYA 4FB7A 4JTCA 1HP4A 1W32A 1LTDA 1BXCA 1DORA 1VEMA 2W6RA 1M03A 2GGHA 3ABRA 4XUGA 1PKLA 4ACZB 4K6AA 2JF6A 3ZR4A 1ZALA 3WN6A 3SIZA 2H8ZA 5HUOA 3UWYA 1ZZMA 1UWQA 3GHSA 4E3VA 3SURA 2EPLX 4L4MA 1E4NA 2PP3A 2DSZA 2VOMA 4O8AA 3VIFA 1VCFA 5FD0A 5C71A 1AW2A 3PJTA 5EMUA 2GOKA 2YL9A 3OA5A 1DTUA 3VPLA 5KZDA 1VIWA 3CQ0A 3RFAA 2E4TA 2FVMA 3M9YA 5AZ1A 4UR8A 1WXZA 3A9BA 2OO0A 4XZNX 4D8ZA 1PS9A 1RHCA 1TWSA 2QCCA 2WHJA 2QXWA 4R27A 3W1UA 3CLWA 1Q6CA 2Z6IA 3NPUA 5D38A 1CI1A 3LMZA 1W0MA 3CL7A 2ZCGA 4L61A 5D9PA 3NIYA 4RW5A 4H6KA 3NEHA 3UWUA 1KFJA 4UTWA 4LF1A 3SM0A 2ADAA 2QCHA 4FNTA 4QNWA 1N8FA 4UNLA 1JZ2A 4X60A 1W9VA 3CMFA 2A0NA 1I6NA 4A3HA 1BRLA 4J35A 1VBHA 2Z1WA 4DYJA 4O15A 3GXIA 2GGGA 1WO2A 1S2UA 4XAYA 3BQ5A 4O16A 4QRNA 3WNLA 2FZ8A 3EX6A 2E6FA 2E5DA 3GXPA 4XIMA 1VYSX 2OGJA 4GH3A 4YTSA 2ABBA 2ZUWA 1XPGA 4QSFA 3VD7A 3ZSTA 1XV8A 3KBWA 2ACRA 3WUFA 1S2VA 3C0JA 1S39A 4H83A 5E6YA 5JMUA 3CBWA 4FIRA 4PGLA 1DJWA 3YPIA 2VC7A 3NZGA 3VM5A 1HL8A 2QPSA 4XKYA 1JEZA 3QY8A 1H7WA 5F1UA 1EC7A 5A2AA 3B9NA 4PMOA 1VD6A 3NXFA 1TPWA 5DFAA 3M0XA 4IXXA 5J04A 3R4IA 3M47A 2BBFA 3POHA 3VE7A 4HZ7A 4L1GA 2OVLA 3CZ8A 3THQA 1CTNA 3QSTA 3CT2A 5D32A 1LDCA 3B9DA 1OCJA 1F4HA 4O10A 4ZSUA 5HJLA 3TQKA 4GFIA 2J9YA 3PTMA 2PTYA 4GH1A 1U1HA 1GTHA 4IGMA 1U5VA 3OGRA 4LY4A 5AC6A 1KKRA 4S3BA 4H01A 3G0XA 1RZMA 1UD8A 1F8MA 2OZ0A 1JD9A 3UNDA 4NUWA 3MP5A 1I75A 5LNUA 2QQ6A 2GGIA 1IEQA 4NSBA 3GC4A 4H04A 4LFYA 3PWGA 5AKQA 2D2OA 4E8DA 1V6WA 4EOUA 2VOTA 3DHFA 4CD8A 3RITA 1IXPA 1R9YA 5A6BD 1UBSA 3LNMA 1ZENA 4WJEA 1ZJBA 3CU2A 2NQ5A 2PDGA 3IAQA 3F4DA 2ZQ0A 4H8VA 1GQJA 4PMRA 1SZRA 1HKKA 1TQJA 1NDWA 2BY0A 7TIMA 3VUPA 3W29A 1OFOA 7CGTA 1EOMA 1TVNA 3WO8A 4PC8A 1B0IA 1YXYA 4PCFA 4GUGA 3FDKA 3RJYA 3LHVA 1ICQA 2E5BA 2HK1A 3OVRA 4A22A 4ZBCA 3UF9A 3FAWA 3OG3A 1OG6A 3BMVA 3ZVIA 4DHGA 1YIXA 2J8FA 3ABSA 3LS9A 3EA2A 3VGHA 1T5AA 1Y65A 2GWGA 4DRSA 5FKYA 4JTUA 2CZVA 4UQ9A 1TWDA 3I7RA 1OK4A 4GO8A 2OX1A 4XZBA 4NJHA 1XBXA 3VD3A 4DJFA 4AZGA 1I60A 4DXKA 1E1EA 3VIMA 4V27A 2CETA 1EF2A 2ZX5A 3MWCA 5I79A 4C6FA 2NQHA 3VNKA 4UOJA 3NZRA 3CXOA 3UGRA 3TJIA 1AW5A 1O6IA 1EA9C 3WNMA 3TTOA 4X0VA 3RPMA 3G1SA 2YL5A 1TCDA 2QVHA 3GIQA 4GGBA 4QEEA 4H9ZA 3W7RA 3DHUA 3RLHA 5I3HA 3WDRA 1HVXA 3FVMA 2XINA 9CGTA 5FJPA 3AHTA 7XIMA 3CZKA 4KEVA 3PUEA 7ODCA 3EWWA 1GVOA 2V30A 5CAHA 3MZNA 2XU2A 1XSKA 4A8IA 2VQUA 4NJKA 2FZBA 3T81A 1ZL1A 4W9TA 4UTMA 2FFIA 4AIBA 3B0XA 3NPXA 2NQZA 1QATA 5GVJA 1FA2A 3CM4A 5DMMA 3WLRA 1IWAA 2VR4A 1O94A 1FX6A 5I3FA 3V16A 2V38A 5EYWA 2YLAA 3N2OA 3SGUA 4DELA 1AJ0A 4WR3A 1NH6A 1EJRC 4PUKA 4X9SA 2Y5EA 3S2NA 3ZOAA 4JDYA 3W70A 3KRBA 2ZWYA 1J96A 3ZLGA 3R89A 3PB2A 4QS5A 1G0CA 2YCKX 3UXDA 4C5ZA 3W75A 3W87A 4G1KA 3EWUA 3UEQA 2ZTKA 4BEQA 4DQWA 1BPLB 5CPOA 3EX4A 4F0HA 4LOCA 1JNEA 2JIWA 3UVAA 4GUIA 2ONEA 1AZ2A 1WBJA 3CGTA 3KM8A 3IARA 4J28A 4QDPA 3T08A 5IHRA 3CUXA 4B5NA 2JGQA 3KP1A 1W37A 4TVDA 3P80A 1AK5A 4NZ3A 1CXIA 3LXCA 3IV8A 2PBGA 1A5CA 5GNXA 3BK0A 2PDWA 4HU3A 3DENA 1Q6DA 4A35A 1ML1A 4JTRA 4PYSA 1DWAM 3I4EA 4WDTA 4GIYA 1H7RA 3D3FA 3FA4A 2VT0A 2WNQA 3BSMA 3W01A 1SMAA 4B90A 2FH8A 4AIOA 3ITCA 4HMCA 3SFWA 1QXLA 1EEPA 1R2RA 2HEJA 1WV2A 2V69A 4U4MA 4HA3A 5DBUA 4KRTA 4L6HA 1JYVA 1AQ0A 3F2BA 4QNEA 1I8JA 2DW7A 4DNMA 1UWAA 4HN8A 5A8OA 4EX4A 2XSBA 4PR4A 1P5BA 1F74A 2ZRZA 1VFTA 3HQOA 1W5QA 2IMRA 3GH7A 3VGDA 2PDBA 1SZFA 2DORA 2Z1KA 2R91A 4I5RA 4UTFA 4CD7A 1BYBA 3NURA 1BGGA 3GVGA 2O4MA 1KTNA 5MF5A 2PWFA 2BFGA 4JD4A 4HHPA 1ENUA 1R3YA 3FX4A 2DVXA 1UD2A 2YIHA 3RCNA 2GUYA 3P0XA 2PSNA 4W8AA 1S5TA 5CGTA 3L4VA 3H2FA 1MQPA 3VD4A 2G4JA 4LUTA 4H9MA 3ALFA 1NOUA 1EO5A 3AS1A 4O11A 4IUOA 3ZXWA 2RAGA 1DJIA 4GG9A 1PWLA 3EWXA 4L4OA 3TQVA 4BQ4A 2GVEA 1O5XA 3O3RA 2Z1VA 2BS9A 4AZ5A 4KH2A 2Y7FA 4QM1A 3UW6A 3UJFA 3UY8A 2VFFA 4NF7A 1C3FA 3M7SA 4V1YA 3UWVA 5CGMA 4G7FA 4LUSA 4C6EA 1VFHA 2PDUA 3QQWA 3AIWA 4MWAB 2QV5A 1FP9A 1RQHA 4GK8A 1TPEA 3G77A 3U7BA 1KM4A 1ADOA 1OFRA 2B7OA 2DVTA 4DIAA 1KTCA 3GC5A 1SJAA 3P61A 1I2QA 1M7PA 3QFEA 1PYFA 2F2KA 4UOQA 2H8XA 5I03A 5H2ZA 3RCMA 1W9BM 3I6EA 3SY8A 1UH3A 5CC7A 3WZ0E 2C79A 2G3JA 4ZA0A 3KCOA 1B9BA 1ZTVA 1RLCL 5F4SA 2QYGA 3QC0A 1ZP3A 1MZHA 4PUMA 1C91A 3H7RA 3IEBA 2QEZA 1HIZA 4C6MA 5K2ZA 1OT1A 4FF7A 4DWDA 1UQYA 2P50A 5HQEA 3S0CA 1V0NA 5A6TC 3SCPA 4H9VA 5D9OA 2NW0A 5XINA 2ZZ3A 3MMTA 4Z0SA 3LNPA 5G1TA 3U6WA 3TWAA 3ZWTA 3VD9A 3GG0A 3L67A 3T44A 4MLRA 3SCUA 4LV9A 1HF6A 1KGWA 2GVYA 3PN8A 1RD5A 2Z7GA 1VEOA 1NAL1 3VKAA 2J6XA 2A85A 3PPFA 2R6OA 3GHRA 1GJWA 3GDLA 2HPMA 5H8UA 5GQBA 3W71A 4KFPA 5BW6A 3CZGA 3M0IA 3PZOA 3BLDA 1XRVA 4MIMA 3WDQA 1FWAC 4WOZA 1MYRA 4D6EA 3O16A 2RGMA 4PSRA 3GNRA 4JTQA 2DIKA 3GXTA 1LQAA 4HU4A 3WH9A 4GO9A 4IQJA 4Y90A 5LA1A 4AAJA 6TIMA 4C90A 1TFVA 4FR6A 3F03K 4KCTA 2V81A 1TUFA 2FHBA 3VIKA 1B3WA 3UZYA 4IG2A 5AYBA 3QBUA 5AHMA 3DECA 3NL3A 4F79A 1GEQA 2C8NA 3P81A 3WL1A 1MEHA 4PRRA 2FTPA 1U5JA 1EQCA 4FLRA 1XCWA 1FQ0A 5F7UA 5I3DA 3FYPA 4RCXA 1MFUA 3PUOA 3DZ1A 2YXXA 4UXDA 3EX1A 1XIMA 2GDVA 1FWHC 2E9MA 9XIMA 2X30A 1BD0A 3VNLA 4F66A 2PC8A 3TH6A 1E3ZA 3TTQA 1C9DA 1QHOA 3WLKX 4EPBC 2FTYA 4NZ4A 3EOLA 4JHZA 4XZWA 4EK7A 4DJFC 2OSXA 1SO5A 1ONXA 2D2HA 2DZSA 4CQ9A 3A3XA 4UNIA 3S3GA 5BOOA 5C2CA 3KBVA 3SUVA 4U3AA 4JIQA 2Y1HA 3C0QA 3S8HA 4MVAA 4US6A 4MF4A 1I2OA 3IJQA 2PBOA 1TG7A 3W53A 1HX0A 1M7OA 1OYAA 1O5QA 2QKFA 4ZE5A 1EBGA 4TX9A 3ARQA 3MWAA 4FHAA 4AY7A 4RZ4A 3OB8A 1GCYA 2DT3A 4KESA 1W2VA 2F9RA 3N3MA 3RMEA 2Y70A 2QUTA 3B97A 3V4BA 2JKPA 3CQHA 1KM5A 1BKSA 2FB2A 4M6QA 1RJQA 3USZA 4S3AA 2CPUA 1H5VA 1SM9A 3PJWA 5I7GA 4PCTA 1KGXA 1YPXA 3KXQA 3MP4A 3LV5A 4RDZA 4KPLA 5DRCA 1GQKA 3UCDA 1JRBA 1PHQA 3CMJA 3G6MA 3WUGA 1N7KA 4AMCA 2CZ5A 4NJJA 1JI2A 1A5LC 1V7AA 2WC4A 3H8AA 4LH8A 3A23A 4UWMA 1DJXA 3C61A 1Z41A 3WEMA 1VJSA 2DU2A 3MUXA 4WY0A 3MY9A 1XYBA 2PP1A 2ZC1A 4HCHA 4LJ3A 4I9JA 1A3WA 2ZADA 4ICCX 4H8UA 3BLIA 2BNJA 1MEIA 3HPZA 3IK4A 4NKCA 3HGRA 3H2AA 2VVSA 4IL0A 3Q4DA 4HPXA 2IKGA 2PB1A 1EFZA 1SO6A 1HJQA 2J25A 1V6VA 1E6NA 2XIJA 1V3KA 2WPGA 1EWEA 3EGJA 3RIKA 2ZE0A 4ZCWA 4O54A 2YXGA 4LC6A 4PTWA 3GHTA 4DBSA 4Z1AA 4HNNA 4MGGA 2QJHA 3M0YA 2YDQA 1NM9A 3ISIX 1J5SA 3MJMA 4TO8A 1XIFA 4QSHA 3KOYA 1Q65A 1XC4A 3TYBA 3ECQA 4QE5A 4DBEA 1NDYA 3O6DA 3TEVA 3WDJA 3W84A 2E6AA 5E0KA 1REQB 2WB5A 3NQ7A 4XZIA 2ZRUA 4KCUA 3DIPA 1P6BA 3H54A 3P14A 1ISXA 2CXGA 2P0OA 2RKXA 4F0MA 4FP1A 3UWQA 2GQ3A 3D3AA 3WDIA 4PTXA 1IGWA 1HN1A 1XIDA 3ITYA 4B5VA 3I7SA 4ICMA 1UKSA 4CN4A 1SYTA 1GVQA 3GAKA 3KW3A 4WEVX 5AC4A 4HCDA 2AOSA 4K36A 3PBYA 5I02A 4TVUA 4KEZA 1B3OA 1YE6A 3P0WA 1AQMA 1F6YA 4XD5A 4AEFA 1RCQA 3W37A 1EX1A 1XCXA 2YR1A 5TNVA 1BAGA 4JTHA 1TJ2A 4AZHA 3WQ4A 3AIRA 3UG3A 3T4CA 3WQGA 2ISDA 2BOGX 1H0IA 4LEFA 2GJXA 2XN0A 3GBEA 1JF6A 1M7XA 1VFLA 1BVNP 4JKLA 4HMNA 4HD5A 3RU6A 1LRQA 3R58A 3RK8A 4Q4OA 1BQGA 3BJFA 1EHAA 3PFMA 4PTMA 1WKFA 4ROQA 5HAOA 4L1XA 3CWHA 1FDYA 1TPDA 1CPUA 1A50A 1IT0A 2GVJA 5D4YA 3SFKA 3LN3A 4DBWA 4WSHA 3MPGA 4ERIA 1S3HA 2JF7A 2AMGA 1UJQA 1TWIA 2WWCA 1FKWA 1ZCOA 4ZL1A 5EBAA 4XAGA 2G95A 4RE0A 2Q6ZA 1BYCA 4AFYA 1RBLA 1B3YA 5KSWA 3TN6A 5C54A 3SJNA 1C8XA 2XUCA 1LP6A 3CHEA 2OTDA 3NQVA 1ZJIA 3CIWA 4GFSA 5BMXA 1POJA 2QCDB 2OFJA 1VCVA 5TD4A 1X6NA 4UQBA 2EKGA 1U1UA 1DWGM 3AMLA 1E6SM 4LC8A 1XLDA 1I1WA 1T7LA 2Y7GA 3A3HA 5L9FA 5LNSA 3B8SA 5CC6A 1F2JA 1EXPA 3ES8A 1LRNA 1R85A 1RLDA 2VCBA 3THUA 4D8LA 4JNMA 1KTBA 3LHYA 5F4XA 3TNBA 1SFTA 3A4JA 4TU1A 4O4VA 2CESA 4OTKA 1OFDA 1DJNA 3VIPA 5JVLA 1Z8AA 5LKYA 1PZ0A 4QJ4B 1SO3A 2VVNA 1EZWA 4UNKA 3WNPA 3P67A 1KFWA 4PFMA 4ENLA 3MO4A 3E02A 4BQ5A 2R1MA 4GBUA 1ZBWA 3FEQA 3W6MA 5D05A 3UZ5A 3UFYA 2VM8A 5HMDA 1TZ7A 1J0YA 2GK1B 4C1NB 1GVYA 1K77A 1H3GA 4XX6A 2EEXA 1DHKA 1P0BA 4O13A 3FS2A 3LCIA 1W8SA 3XINA 2VI0A 3DX5A 1IF2A 2A7NA 1OJXA 1ODZA 1TA3B 4PBEA 1PX3A 3V7PA 3WJYA 4JN6A 3KS6A 4GNKB 4C6BA 1KQYA 5F1VA 5HNRA 5HBFA 2PWVA 1P48A 5A8GA 3WQCA 1KBLA 5C2GA 3L4XA 5HJYA 2POZA 3TP4A 3PFRA 2VEKA 1XLAA 3AQUA 1EQPA 3AI0A 2AL2A 4OIFA 5DCBA 2J24A 3LZ3A 3BAXA 4HIBA 4YYCA 2XFRA 2ZA2A 4NZFA 2GYIA 3VKCA 1R2TA 1H41A 2CZFA 1GGOA 3LV6A 3C2VA 2YCLA 4GI8A 4RNHA 1TX0A 1ICSA 1DXEA 1QMLA 4I5XA 3HV9A 3T55A 1E1FA 4X63A 1W5OA 3BWWA 3GFXA 2A21A 3TKFA 1WAUA 4I90A 2WMFA 3K8LA 2ZIDA 1V79A 2ISVA 3U0HA 3H70A 2W66A 2JK2A 3BURA 2ZICA 2XH7A 3DFTA 4UCFA 1K8YA 2VL4A 3W4RA 1W9UA 4GXMA 4NRRA 6TAAA 4D71A 1EUNA 4JYDA 1LYXA 1MRAA 4F4RA 4W7UA 1EGMA 4PE8A 3SBFA 4JQ1A 3GNNA 8XIAA 1JAEA 3LLFA 1KLYA 1NP2A 3OG2A 4N2YA 2E5CA 3BSGA 3QZAA 3ALGA 2CEQA 4J4KA 1J2WA 1KCLA 5I0DA 4B5XA 4JN8A 4GHRA 1XRSA 4MNMA 2PS2A 1JXJA 2CLFA 3KS5A 4QISA 4IL2A 1THFD 3QW3A 3CV6A 4QQUA 3GTNA 1OFBA 4FLSA 3NVDA 2O55A 4ZO7A 4US5D 3B0YA 3SRFA 4O50A 1H61A 1N55A 4N4QA 1PIGA 1AL8A 4R5EA 3LHZA 4EPDC 3AZRA 2BY2A 1A5MC 2B81A 3IUHA 1TR9A 2B7NA 1ZLPA 2D24A 1E6ZA 2D0FA 3P74A 5AC7A 3PTKA 5F2GA 4WK9A 3R0DA 4M19A 4CD5A 4ZOBA 3W1AA 3HPXA 4TXEA 1K9EA 3TNOA 1UC5A 3IPWA 5IBXC 3OIXA 3LBMA 3EYPA 2GVLA 2PGEA 3IANA 3L2LA 1WKEA 2QPUA 3W1LA 2FJKA 3N9RA 2YFNA 4M29A 3VKDA 2X8RA 3VABA 1GW9A 4FA3A 3S2MA 4CU8A 2NLIA 1XQKA 4URIA 2PDKA 4LVGA 3RNDA 1EYEA 1OM0A 4LWWA 1R3VA 1RY8A 2QIIA 1TPFA 4LAUA 5DANA 1LG2A 4Z08A 5M2FX 3JZUA 4UFKA 2QHAA 3AALA 2Y6ZA 2DQWA 3W2UA 4E4FA 1J01A 3GX9A 3HQPA 5DCEA 1ITQA 3EXRA 1JL8A 4Q33A 1UJPA 1X39A 3A4WA 1OZQA 3UPBA 2HS8A 3MC5A 1H11A 4HSHA 3WDPP 2H3DA 2CHNA 4RUBA 3PAOA 3WQPA 5AN7A 4MY9A 4FX6M 2G5WA 2JIEA 4PCSA 1IEWA 4AHQA 3MUY1 4CNTA 2PWEA 1PO9A 2W61A 5AYIA 3CYVA 4S3KA 3HZ3A 4HNLA 1TVLA 2PP0A 4U5KA 4JTFA 2YKKA 4GZ7A 3WK0A 3II1A 2FMOA 2ZUSA 1PZ3A 1H1ZA 4MB5A 3BG9A 1M5WA 2VENA 4LTSA 1RCOB 3EPNA 4IX0A 3C2EA 3UWZA 4W5UA 5LXEA 4XTDA 3AJXA 4FNQA 3WEOA 3BE7A 2D0HA 3LDVA 3HOJA 3TE9A 4XWUA 1XFCA 3UZJA 1R3SA 1TV3A 1HKVA 1M6JA 5D2WA 4A3QA 2ON3A 2QW5A 3MHGA 3IVUA 3ITOA 1R5YA 1M04A 3MVIA 3N9SA 1ONWA 3SUUA 3MKCA 4RNFA 4QEHA 3O06A 4LVBA 4HOZA 2E3ZA 4O1AA 4DEFA 2Z1XA 4O0KA 1QW9A 2SFPA 3KX6A 3DBPA 3F2DA 3LCHA 3S4TA 4E38A 2V2DA 4S23A 1R46A 1W1IE 4LNYA 1IEVA 3GR4A 2IPJA 3L2MA 2VCCA 4E4PA 5FEPA 1Q6RA 1FDJA 4AEEA 1OCBA 1ECQA 4YHEA 4Y96A 2Q8LA 4LAMA 3TQ0A 2HROA 5MKGA 2FGBA 3G0SA 4U2YA 3VCCA 4O57A 4CEXC 1SFLA 3RU8X 2CU0A 3QXBA 3WJSA 4O17A 3LGGA 4CVWA 4I9MA 4XZ9A 2VX4A 3WQWA 2ZKMX 3PTQA 4Q32A 4Y8FA 4A2SA 3JRKA 3H4WA 5FJRA 1ZAIA 3C0LA 2I9EA 1NJJA 3FK4A 4FLQA 5FIPA 4M3PA 1UCWA 1XISA 1EGVA 3DYMA 2OG9A 5D09A 4H7ZA 1LQ0A 3CTTA 3K1GA 1BRLB 3SY1A 4RR4A 4QDMA 4DJDA 2X1TA 5K4XA 3NZ1A 1TPC1 5FSDC 3OZPA 2XPKA 3MSDA 2GJRA 1CEOA 1K4HA 2Q01A 3W7MA 1XYMA 3IIOA 4AD3A 4L64A 4QE1A 1Z3NA 3N2BA 2R8WA 2O9TA 4QTGA 1OD8A 1RBAA 4G8TA 5AYXA 4LV4A 5DEZA 4Q6XA 4ZODA 3E12A 2EGZA 3ZJKA 2V6AA 3DFPA 2FZDA 2PWUA 1FWNA 3C6CA 1R9XA 1F61A 3ARVA 5CGQA 2ZVRA 4L65A 3EDEA 5LA2A 4WCJA 4XKYB 3HF3A 3M46A 1R6WA 1D2KA 3KDNA 4H2CA 3VZXA 5D2VA 4BF7A 3LPGA 1W54A 3WQ6A 2WMIA 4O12A 2P1FA 3CUHA 4J5NA 2DV0A 4MDOA 3CHFA 4PB3A 3GM8A 4C6NA 1OGSA 4GC4A 4WDWA 3VI2A 1XKJA 3UJSA 2E77A 3W9ZA 1FXPA 4WHBA 1U83A 3N9KA 3Q65A 1WNOA 4HK5A 3VFLA 3OP2A 4WDXA 1OQFA 1SUXA 3WNKA 3AO0A 1FWRA 3DYPA 4JTDA 4PB4A 5KINA 2F6XA 2D23A 1EPVA 4DLMA 3N2MA 2P0IA 3M6DA 4JKMA 3GVWA 2VP8A 2VRQA 4MJMA 1MO0A 1XCFA 1KR0A 2PTZA 2GGEA 1CYGA 5ECUA 1G94A 5CXPA 1DQUA 1CW2A 1U22A 3AIQA 3S1GA 3G2GA 3WQVA 2NLYA 1JZ4A 2Z24A 5IDIA 1PBGA 4JKKA 4LW7A 3VOCA 2Q09A 4GCAA 2WNWA 2OQYA 2F6UA 4AXKA 1T8QA 4UQCA 1O68A 3L0KA 3P62A 1PIFA 3FNDA 1IR1A 4XVEA 5BWFA 1XYAA 3MW7A 3KOWA 2GPTA 4GACA 4LB4A 4NHVA 1DOSA 5EL1A 4S3JA 4JL1A 3NSXA 4MADA 3RCYA 4R7WA 2ABAA 1VLWA 4LBUA 2TAAA 2DH2A 1YDYA 3IRSA 2PGFA 4XUYA 1VYPX 2O7QA 3HJEA 4OJYA 4GABA 2DQXA 2YYUA 1R30A 4H6RA 3GY1A 5CC5A 4LX4A 5DMYA 5E70A 4FPSA 3B8WA 1WP6A 1UA7A 3WK3A 1MQRA 4CCCA 2V63A 3CIVA 5CZTA 2QDEA 1L6SA 4R34A 2CBIA 3SCRA 1QBAA 2ZUUA 3KTSA 1D8CA 4EWJA 1BTMA 5DO8A 2VFDA 2XDFA 1AUSL 4XTIA 1J93A 2V8ZA 2X1SA 3W38A 4QBXA 3P60A 5L6UA 3WLOA 1DXFA 1EKOA 3W6YA 3RM9A 1D3CA 1WQ5A 1FHLA 3MYPA 4JIIX 3TAOA 5ECVA 1W3HA 4OFCA 1SW7A 2A3EA 3LRMA 4D72A 3PNUA 1O60A 3CO8A 3M5VA 3JR2A 3TK7A 4HPJA 3M7WA 2H3BA 5BOFA 3VZZA 1XD1A 3C8NA 3AU6A 2E1WA 4RZ5A 1KBBA 3GVVA 3KZPA 1UD6A 3EX3A 3VDHA 3MHFA 1Q3NA 3VIHA 5ABEA 5DCDA 3TW6A 1A3HA 5IRPA 4FI4A 1H5YA 4JFWA 4DAIA 3R25A 4PH6A 3EDFA 4LS0A 4N9EA 1JQVA 3WH6A 4XQ6A 3IGUA 4HHHA 1O66A 3DFYA 1OX4A 5H6HA 1B1YA 1B4EA 2QCLA 3NXLA 1DJQA 3E0IA 3LUTA 1FTXA 1XG3A 3BCJA 4EAYA 1V0KA 4BQ3A 3W7NA 6ALDA 2CERA 2V3EA 5C9ZA 4J3UA 1ODUA 1TX2A 4JTIA 1Q6GA 2O92A 1GT8A 3LD5A 2D3LA 1UD5A 2REQA 3G8EA 3UR2A 2CWXA 3U57A 4OHQA 1KCKA 2CHRA 1AG1O 1TRDA 1JDDA 1XLKA 1JCMP 4H2HA 4ML4A 5G2IA 2ALRA 2HK0A 4FXJA 3ZWSA 2DT0A 3T2QA 3L5MA 2DFAA 1A47A 3VFCA 3S1WA 1E1CA 3A4AA 4A6GA 1MW3A 3WF1A 4GE8A 3V5CA 1V6TA 3WY1A 1XBYA 1HJWA 3K1DA 3ABXA 2J74A 2YW4A 2R82A 2ZDSA 4JY9A 3B03A 2VX5A 1NOFA 2PMQA 4B91A 3LZ5A 3KOXA 3CIXA 3W07A 2EF9A 2YOCA 2Z2UA 2IQ0A 1GOWA 1RVKA 1LUCA 2NV2A 2XVPA 2HXUA 4UZSA 1ICPA 4JQAA 5AHNA 3EAUA 1QOXA 3NJ3A 3WYZA 5KZMA 2X0HA 4AWEA 5GJPA 2OYMA 3CL8A 3R43A 4H8NA 3IACA 3RO8A 3BCDA 4TIMA 4V1XA 2Y8UA 1X1OA 4OE7A 3A24A 3TYZA 3EKZA 2AGTA 5DLCA 3TZNA 2PEVA 4QIUA 2GVGA 5H8MA 4GZJA 3AFBA 1HP5A 1QWGA 5LGZA 2VQTA 3QOKA 2Z25A 4J9JA 5KITA 3ZIZA 4A8LA 4AWUA 3FYYA 1ISVA 1UR1A 2W0UA 3QZEA 1PB0A 3CASA 3LHWA 3B4UA 4M6PA 3NL6A 4ZB2A 1LL4A 4UFLA 3W2MA 3ANUA 1ZUAX 4Z2HA 1BSIA 1OC5A 3VM7A 1YBQA 4QG6A 1ME9A 1OC7A 3V5OA 2WJZA 2NSXA 3VU2A 2A3HA 5AY7A 3NQCA 3UESA 3ORWA 2Y7DA 1TMHA 1NU5A 3MCMA 4D6IA 4UFMA 5A6MA 2XM1A 4JQ4A 1AZ1A 4JGDA 3W02A 1F6PA 2WO5A 2QUUA 4DWSA 1LLOA 2PAJA 2WVSA 1EJVC 1DWFM 3WDHA 2BXYA 1VRDA 1GQLA 1NFPA 3KWXA 3WQ8A 2QUMA 2C91A 4LUTB 3H53A 2HDJA 4L9YA 4AD4A 1XLBA 2UY3A 5D04C 5HMSA 4PN2A 1B3XA 1XH2A 4IP5A 1C8YA 3GD6A 2P53A 5D2XA 1EJUC 2CBVA 3BMWA 3RHGA 3S5SA 2MNRA 3NO5A 4PRTA 5AFDA 2DT1A 4GNJA 1B90A 2RDTA 4X9YA 3W7EA 1YNPA 4W84A 1T96A 1KXHA 2NVAA 1UQZA 2VGBA 3Q45A 4AU0A 2WJFA 4MY1A 3GDTA 3HFYA 1OVDA 4NXSA 3SI9A 4HTBA 5JXQA 1W1A1 2XGIA 1E43A 4XB3A 4PMYA 4HNTA 2ALDA 4Q4SA 3RILA 2Q3OA 3T09A 3HO8A 3VILA 5CCZA 3A4XA 3BAJA 3EWBX 1IIGA 1JDAA 2H9AA 3T0TA 3W85A 3WMLA 1XXXA 4OUIA 1E73M 1SU5A 4ALDA 2V5DA 4NIRA 1VF8A 3HV8A 1O4UA 4Q6JA 3TLQA 3I3BA 5D33A 2IW0A 3VIIA 3MP3A 1OB0A 3WBAA 2PCQA 4V33A 1U1JA 4AD1A 4KEMA 4DF0A 3MV01 3PNZA 3VNMA 1XD0A 3OODA 3QGAC 3THCA 3C5QA 3DEQA 1JDFA 4I6KA 3CAVA 1S3TC 2QMKA 3QR3A 1L0PA 4RNJA 4LXFA 5BYWA 4L9ZA 3VDBA 2E6YA 3KL0A 4HT3A 3WQOA 1SVDA 2PU1A 3L4YA 4TV6A 1YNYA 3LPOA 3SEPA 7ENLA 1FP8A 4FNRA 3MQTA 4ATLA 2XH0A 3PJUA 1HVQA 2PDMA 1XH1A 1PV8A 2AMXA 2O9RA 4B16A 3GXNA 4BQ2A 3F1QA 3BICA 2VXNA 3F4VA 3SCTA 4PUUA 4K68A 3LM7A 1JPMA 3GTHA 2EHHA 4CQBA 4NNCA 5HULA 1LLZA 4B4HA 5DMLA 3O0FA 5B80A 5I06A 2VD9A 3NGFA 3W86A 3L66A 3R13A 5LNWA 1UW9A 1E4LA 1J12A 4CQ8A 3BANA 4HKPA 4IG2B 3LM3A 1ZAJA 4PEEA 1LOSA 1UR2A 2NQ9A 4IIHA 3WK2A 2E28A 3VVGA 4PMUA 3VD5A 2JFEX 5EY5A 1HKIA 4DM1A 1SJCA 3STCA 4K3ZA 3S2CA 4HA4A 1MW0A 5HDRA 1ITXA 3PAJA 3UXIA 3OGSA 4XSMA 3FIGA 2XTKA 1OC6A 1NWSA 4QGCA 3CV7A 4LANA 4OGZA 3FYOA 4CKQA 5E0FA 4BWLA 1DJYA 2Y88A 1X98A 4QCFA 3W7QA 1GYNA 3UGVA 4I6VA 3VC5A 4YHGA 2DEPA 3U2EA 3OU8A 1W1YA 4QFUA 3NYDA 2CBUA 3B9EA 2VTFA 3DC0A 2QF8A 3VGGA 1EDQA 2KZHA 1IZKA 1DHPA 5FAGA 1K8CA 2HMCA 3WL0A 5FF0A 4QROA 3TFXA 2OLSA 4WX2A 1GYLA 1LL6A 3SUSA 3EMZA 2C1GA 4YU1A 4U10A 1A5KC 5E9XA 3H23A 1VC4A 3VX0A 3FJ4A 4JTEA 3DFNA 5LHFA 3NA8A 2YL8A 3IJ6A 1PZ2A 1RR2A 2Y7EA 4XD3A 3ZQ9A 4AY1A 4F40A 2X16A 1TJRA 1UR8A 1YTEA 1OT2A 4R7JA 2YJQA 3UR7A 1LROA 2XVLA 4GXPA 1RUSA 3NAVA 1JCJA 1DE5A 4JAWA 1SJDA 1YKWA 1LRTA 4A29A 3GG7A 4KGLA 4H7VA 3VOHA 1FXQA 4ZXOA 6A3HA 5K9CA 1MUCA 3LBOA 4JX5A 2X7WA 1R87A 2DSWA 1BYAA 2NX3A 2OLAA 2XVKA 3GUWA 4WY0B 4Z1CA 4LYQA 3UBPC 2XFWA 5CBJA 3BCFA 4I7UA 3WSUA 4HPNA 4LVDA 1TV5A 1FHDA 3CL6A 5HATA 5I78A 1E4IA 3QLLA 1R47A 5E0CA 3O6CA 3A13A 4TV5A 4X2RA 5FJIA 1A53A 1J6OA 1QK0A 2BY1A 2WPBA 2PDIA 1HQTA 3VNIA 2TSYA 1J79A 1QI5A 3TOPA 2EO7A 4B5UA 1N8WA 2ZTJA 2PF8A 1S5MA 2V3DA 3CQJA 4LYRA 5T8GA 1CBGA 2QDDA 1CGXA 4IICA 5HXMA 3OBKA 4HGXA 5BMWA 2P3ZA 5JIWA 2WM1A 1NQKA 1HO1A 2EJAA 1GOIA 2WSPA 1JUKA 2YDAA 1Q4WA 1NDZA 4RLIA 3TWBA 5JQ9A 4Q4KA 3EA1A 4JIPA 4NX0A 2FZ9A 2TODA 3W25A 3UQNA 3W6LA 4DJDD 2PDLA 1TJPA 1UKOA 3N17A 4ZTXA 1H7PA 2GK1A 4KKXA 2PDXA 2ZRVA 1NWRA 1RP8A 4B2DD 4G5DA 4KWSA 2OWWA 4W8LA 3OBEA 3QJAA 4XV0A 4L6DA 1Z6KA 2HISA 4KWWA 1S5NA 2VGGA 2Q3RA 2C18A 2EPMX 4S38A 3A5VA 2ESCA 3GU1A 1HL9A 4G2DA 1V02A 3BG3A 4DF1A 2QGHA 4AYGA 3LY0A 4E2BA 4UMBA 2WHMA 4AWSA 2OZ3A 1PL9A 3ZSSA 1FWWA 5DT5A 1S2TA 4IP4A 2VZSA 1VJZA 3R12A 3VGFA 3KRUA 2V2HA 3SGGA 1A5SA 1WZKA 1UPMB 4GCXA 4HTYA 5AYYA 4NU7A 3BLFA 4H3DA 2GJXB 3CT7A 3TTEA 2X42A 4Z1DA 3G1XA 4NAEA 1MNZA 2FLIA 3B9AA 3NM3A 2Z00A 1Q85A 2V5CA 2NUXA 2WZMA 2VC6A 2J9ZA 3TUUA 4YL2A 2F61A 5DF0A 3SN4A 4QG8A 3ATZA 3N73A 2X0YA 3GUGA 2XYLA 4X3ZA 2OMAA 1YHTA 2FYMA 4PODA 2QCGA 4WF7A 3NQBA 1F3EA 3HJZA 1SZEA 2WSRA 3PZ9A 4MTVA 2Y8KA 2V9DA 3IJ7A 1AJ2A 4GGHA 1UR4A 4PBFA 1Q4NX 3ITGA 3DUGA 1ZS2A 2XN2A 4E2DA 4A4AA 3GK0A 4CU7A 1H0GA 2EPOA 4UUIA 3VOJA 1UP0A 1WPCA 2G3IA 2X40A 1CB7B 4IWWA 4LPCA 1OZMA 2FMNA 1DJGA 4Q3MA 1F05A 1UASA 2E6DA 5TAOA 1CLVA 3UXKA 2Z29A 3LPPA 3VMOA 1H7NA 1L2UA 3FN9A 3L65A 3OOQA 3SQSA 1MUWA 4GY0A 4PTNA 2YX0A 4RPQA 3RMJA 3MI2A 2PCEA 3C86A 5FEZA 2PTXA 1EJTC 3GTIA 3S2JA 1C8QA 1Y8BA 3LPFA 4AWTA 1BHGA 1F9CA 2GUUA 4HJFA 3E9AA 4JHOA 1UR9A 1ECEA 4DY1A 3L12A 1LJYA 4NZ5A 3WH5A 1EEXA 2DDXA 1Y0EA 5FSEC 3N04A 3V75A 3WK1A 4LS1A 4MZ1A 1DL3A 1EYWA 1GZ1A 5BXRA 4JNYA 3E74A 2MANA 5CQ1A 5T9BG 3T9PA 3V0TA 1RPKA 3SY5A 4PEKA 3FCPA 2DIJA 1XC6A 1I0DA 3BJTA 4AD5A 2CZEA 2V68A 4GYKA 3C2RA 3W24A 4ZR8A 1A80A 1QASA 2XM2A 1DBTA 4KGJA 4MG4A 5DY3A 1OEPA 3G22A 4J7RA 3AS3A 1CLKA 2ZOXA 3PTDA 2VFHA 3QFWA 1IZCA 4M80A 4GX8A 5KZEA 1A0EA 1XQLA 3T40A 4OZOA 2CLKA 3IIXA 1TCMA 1XYCA 5G1MA 3VDCA 1R7OA 4ZOAA 3WBYA 3SCSA 3TTSA 1EZ2A 2GQAA 2NXHA 4IH3A 3WLNA 2AL2B 3P7YA 3A47A 4NRSA 4GPNA 2HVNA 5EU9A 3HG5A 2G4FA 1R7AA 4QE4A 3KFTA 3OYZA 3I6RA 4FR1A 4QAWA 1BFNA 4ZQPA 3WELA 2W27A 4Q8UA 4Y2WA 4AD2A 1H49A 2YCLB 2ATSA 1YLVA 1DE6A 2XWEA 3VCNA 2BVDA 2QJMA 2QT3A 1UC4A 1E0XA 2W67A 4NX5A 2GLKA 4DJEC 3G1AA 5A3HA 2C14A 2Z28A 4MHBA 2DZTA 4PZVA 2NT0A 3K4DA 4DI9A 3QZ6A 5KZ6A 3ABOA 3TC7A 4B5WA 2NQJA 4BWLC 5FF4A 4MWAD 4ADSA 4WJXA 2TPSA 3L5AA 3ZLFA 1HL2A 1RXOB 2IUZA 1QTWA 1OABA 2BX7A 2WANA 5FCZA 2NX1A 1W5MA 2VR2A 3KVLA 4HSNA 3QM3A 3UNTA 1XP3A 3EKLA 1QCWA 1M41A 3G0UA 3BZGA 4IOTA 3KVMA 3H2MA 4B9ZA 1V6UA 1Q66A 3N4FA 1XINA 4IMCA 4RL3A 3PM6A 1FWIC 2EPKX 2QZRA 1EC8A 1M65A 1YADA 4RZBA 3D5HA 1VLIA 4N9BA 4GVHA 4GKLA 1CB2A 4GQQA 4G1NA 3PVFA 2GDQA 2QGYA 2VZOA 3UA4A 3S42A 3IGSA 5G5IA 2QJGA 5I3JA 4GD0A 2WVUA 2A7RA 3TOYA 3GB6A 1XUZA 2FHFA 1QBBA 4IFOA 3S46A 1LF1A 2FZNA 3WLHA 4ECLA 4TQTA 2VEGA 3P82A 7REQA 2ZZ4A 5LXXA 2R14A 1TE6A 3U8GA 1X7IA 2QPXA 3HQ1A 3TDFA 4NL1A 2VX6A 3VYLA 4W8BA 2RFGA 3GG1A 3GDKA 3BW4A 4I9TA 1EWDA 3EA3A 4PUDA 3ZVHA 4IFKA 2ISWA 3T05A 2Z27A 1P6WA 4BR1A 1OFEA 4EPEC 4ZOEA 4ZTYA 3GBDA 4O1DA 3WKZA 1IXOA 1TWWA 4K38A 4A05A 1W1TA 2WKGA 1QNVA 3HFTA 3NPWA 1ELSA 4GMEA 2H90A 3K4WA 1XWYA 2W9MA 4DWSD 4AZBA 3STFA 4E2VA 1RH9A 3FEMA 4GYFA 2WQDA 3SCNA 2XISA 1UHVA 3QEZA 4B92A 3PZTA 4C5YA 3V0UA 1ISZA 1IWBA 4DPPA 3HB9A 5A2CA 3M0HA 1T0OA 5CPMA 1PVNA 1J0JA 4MUPA 1V3MA 5G4WA 3NPVA 2GWNA 4R88A 1Q8AA 1T8XA 3NQGA 2HNHA 2YFOA 1AH3A 4H9UA 1V3LA 3U4AA 1UROA 1Y5XA 4NT0A 3MANA 3TROA 3O15A 5I6SA 1PX8A 3OQ8A 4BF5A 1P7TA 2F38A 4Q8TA 4CNOA 5FF2A 2DJLA 3GTFA 3B05A 1XG4A 3W23A 3L23A 1DYSA 2Y62A 1E15A 3N3TA 1R38A 4NZ1A 3LMYA 1H4PA 4EACA 5REQA 4TX8A 3I7QA 3ZJ8A 3EDJA 5G2HA 4AEOA 1FWCC 3LG3A 3RG6A 1VPYA 2XZ7A 1K70A 2J66A 1QW7A 4HA0A 2Z6JA 3CTLA 3KOZA 5D03A 4YVXA 3I3DA 1Q5MA 3BV4A 1K6WA 4PFHA 4POCA 4M1BA 2BXZA 3RM4A 5K7JA 5LIKX 1Z42A 1RALA 4XBSA 5F4WA 3SSZA 2HE5A 3AMDA 3UERA 2DSKA 1FWTA 1H60A 1RPXA 1BWLA 1J0ZA 6REQA 4GVIA 3LQGA 3AYVA 1S2AA 3TAKA 3AICA 4JZ5A 4YVPA 5JUVA 2B4GA 3EB3A 1G6CA 1WUEA 3WLSA 5MKGB 4M7SA 3SCQA 3Q94A 4YTTA 2D20A 2QJIA 1X8CA 1TJ1A 1VHNA 1AODA 2ZX7A 4XD6A 1OY0A 3GDMA 4N4PA 3I10A 1OYBA 1I2NA 3A22A 3OLIA 1CGTA 4GIAA 2NT1A 1WDRA 1DVJA 1XF0A 3H4GA 4DPQA 3OHMB 2HE8A 2JEQA 4MWAE 3EEGA 1ZQ5A 3WFZA 1Q6FA 3WENA 1QPOA 2J75A 4AISA 5EMLA 3FW6A 4Z42C 3UPWA 4XAFA 3SAZA 1FWJC 4IQDA 3NL5A 1YX1A 2P8BA 1OF6A 4HHLA 4AY8A 1XLLA 2X1RA 4H7CA 3HMCA 2WW5A 4JCMA 4ORMA 2INZA 4Q4RA 1E9YB 3GWQA 1EPXA 3BAKA 3G3MA 4PB5A 2RH9A 2P3EA 3QTPA 3M0VA 4BJHA 3MUZ1 1PPIA 1DQXA 3SW6A 3S5YA 3P5YA 3KVKA 3C3UA 1A3XA 3WLJA 1WZLA 3CUFA 4JNZA 1UIPA 5TBOA 3V3WA 2DP3A 2WC7A 2X1IA 2KX9A 2FGZA 5CZJA 1CWYA 1W5PA 3KCJA 2HRWA 1QPQA 1JUEA 1S2CA 1I9CB 4H19A 1KO0A 4ZQNA 4WXYA 3TJLA 1R2SA 4J27A 1K6AA 2WMIB 4CLMA 2OSYA 2RUSA 2VEMA 1S1RA 3IGHX 4UOZA 2NZLA 2QNEA 2QF7A 3ERPA 4XZLX 4LY8A 1FOBA 4C1KA 3G3DA 3WJXA 2OU4A 3KUMA 1KBIA 2WKJA 4UTHA 5FJUA 1UWUA 2QCEA 3QR1A 3CUZA 5CH9A 3MVTA 4DB7A 5LZLA 2DY3A 3UP8A 3IVTA 5DN1A 4ZOCA 1WA3A 3UR8A 1LBMA 4HQVA 4MKVA 4Y6GA 3N2TA 3W1QA 1LBLA 3UCCA 4F0SA 4W87A 4UR9A 3A12A 1J8VA 3BLKA 2FKPA 2OXNA 2EJ1A 2G50A 1L6YA 4R3UA 3VX1A 3NYZA 3E2VA 4UFHA 2PODA 1E4MM 1XLCA 1IE7C 4IGSA 3DESA 2FJUB 1F3WA 2CLLA 1K7XA 3VUSA 3T0BA 2O4QA 4AX6A 3SADA 1VAHA 1D7KA 3IVSA 3TZFA 2E8ZA 3S5ZA 4AMAA 1XRFA 3BLLA 1G7VA 3BGAA 4I8DA 4ZVJA 4LQ1A 3QV8A 5C0QA 5HOSA 3DXIA 1A0DA 3W72A 1TUXA 5I2UA 4C1LA 2YL6A 2BGQA 3B3DA 3C2OA 5A6BA 2C13A 2WV8A 3FJ6A 5AC5A 1V4YA 3OEXA 5AB3A 1CXFA 4GC3A 3F5KA 2Z26A 3WF3A 1XPYA 1EIXA 2A3BA 2IS7A 2BHYA 5A69A 1VFSA 4FF5A 1LT8A 3NZPA 3GIYA 4JOMA 4M8UA 3NQMA 4YCPA 4UFIA 2I56A 4FAMA 5A8PA 2XH2A 3WQDA 2PDYA 3FAXA 3VIJA 3CB8A 3W1MA 4MNLA 3BDKA 2V5BA 2V5KA 3EDKA 5CJNA 4MB4A 2V3GA 1XLJA 1TTIA 2NSOA 1CX9A 3AZSA 2OPJA 4AVNA 2WOQA 4IMAA 2PC4A 3EXSA 1KGUA 4KBXA 2PTWA 2WC3A 1SGJA 4P8UA 1V03A 2BOFX 2J6VA 5CSSA 1OG0A 1P6CA 1E9ZB 1A5OC 4A3RA 1GNXA 2ISFA 2ZUMA 4JQ3A 1VFOA 1LCOA 2RGLA 2VZTA 3AS0A 3QW4B 1JYNA 2BVTA 1I45A 3BQ6A 3R8RA 1D8WA 4IP7A 4OOUA 1DWJM 3DH7A 1K7FA 2WZTA 1N8IA 3UXLA 3MV11 4LBSA 2I16A 4LAOA 1DJZA 4UQDA 3I4KA 2J7CA 4QCEA 3VK5A 1KCZA 4ZO9A 4JHMA 4JBRA 1OX4B 2C6QA 1SQ7A 3VE9A 3SCWA 2HVMA 4BI5A 8RUCA 1KNWA 1A0CA 4PCPA 3VKJA 5HPCA 4S3CA 4C6KA 1T99A 3E0LA 5C2XA 4J3SA 4QXIA 3A9IA 3WUEA 4D9PA 4I7VA 2IXVA 2VFGA 2GZXA 3OVPA 4AF0A 4KF1A 1GEHA 4W7WA 4Q8VA 1W6TA 3K5XA 2WMKA 3AXXA 2YBVA 2REQB 2ACSA 4NAFA 1B57A 4BI7A 3W22A 1E51A 1M68A 2OSWA 2FIQA 2PF0A 6XIMA 2R1PA 1KFEA 4DYEA 1G4TA 1SSDA 3VOIA 1ADDA 3F7JA 1E1CB 3VNZA 3BARA 3HMJG 1OX6A 3EOOA 3T4WA 3QY6A 4J2PA 4B15A 2I9UA 3DYOA 2I5GA 1O1HA 3D47A 1WXYA 1PKMA 1FH9A 3L0NA 1W9XA 3QC3A 2HBVA 3JW7A 2UWFA 3AXHA 4IIBA 3KL5A 5IFTA 4J1OA 3RX2A 3MJYA 2PLCA 5I09A 3H26A 4J3WA 1SMDA 1LUCB 1XX1A 1XBZA 5JBDA 4GZEA 4EXBA 3GXDA 1OADA 3VMPA 4N42A 5DXXA 1UZDA 4IQEA 3PP7A 3ICJA 1ALDA 1TPVA 2BHZA 1MEWA 3LLXA 1KFBA 1EXBA 1CECA 4UC5A 4LALA 1SPQA 4FOJA 2Y63A 4D1IA 4JTLA 3FXGA 3M64A 1VRXA 1LZOA 4YXGA 2YA1A 3U4FA 1GG1A 3ABQA 3CHDA 2Y5SA 3KLLA 4JDBA 2YSWA 3PBVA 3GDRA 3L4UA 4Y9NA 1LOQA 1E70M 4JTJA 4H9YA 1SJBA 1QRQA 3HG4A 4ICNA 3APYA 4ZXLA 4EIVA 2OT0A 1Q6LA 1LWHA 1MVYA 1YBQB 3B40A 4DO7A 4YLWA 3LB0A 2CNCA 1JGMA 2PD9A 3LXAA 4ASTA 3ZFHA 4B4FA 3ZR5A 3M43A 2VEFA 4MZYA 1UG6A 3TV8A 3UZWA 2Y8VA 3PZNA 1O5KA 3WD3A 3AC0A 4M6VA 4S2BA 2FPVA 2O9OA 2CLHA 2ZXQA 2C71A 4IMEA 1JCNA 1EJWC 2FFCA 3NQDA 2FTWA 4KWOA 4DWSB 2CWNA 2HBXA 3RYSA 2IKJA 3M16A 1GVEA 1XIHA 3NOYA 2OQLA 2XSXA 1LQ2A 4M51A 4PMJA 3ME3A 1YEYA 4P2VA 2YCEA 1UD3A 3PF3A 5LIUX 2XWDA 2QJNA 3CC1A 2TMDA 2J9XA 4GY7A 5D2YA 3TSDA 3GNXA 2C7FA 4RW3A 3CHCA 5D02A 4A21A 2Y5JA 2J88A 1NY1A 3LK6A 3GZ3A 3INPA 3TLLA 3CPRA 5C55A 5HWMA 3ARWA 1KA9F 1VQTA 4GI4A 1JZ7A 1WDDA 5AZ0A 2XIIA 1OGGA 3KBMA 3RF9A 1UD4A 4LYKA 1LORA 2DJXA 5MHBA 2G96A 1R86A 3LI1A 3J7HA 3GW0A 1AA1B 4P7LA 2W91A 3UYIA 1JPKA 2ZZ2A 3CV1A 1BXBA 3ZLHA 4JN7A 4DF2A 1IEXA 4P8XA 5M17A 3I65A 3PG8A 1NIUA 2E40A 3FKKA 1X6LA 4HMDA 4GQRA 4AZ7A 3T07A 3JVAA 4YPJA 4XZHA 3CQIA 1D9EA 4AIEA 2PDPA 3V1HA 3QMTA 4BFAA 2XGZA 2H9AB 5JU6A 4HSOA 3VC6A 1P0NA 3C52A 4GJ1A 3XIMA 5IBXA 5DQPA 4QJ5B 1Q7QA 1Q2SA 3TSMA 3IIPA 4I3GA 5IDZA 3TONA 3BVJA 2EPNA 5C9UA 4NYUA 3W2KA 1Z89A 5CC3A 3PBUA 4HA1A 1GONA 2PURA 1PJ9A 5FJJA 4P8VA 4QJ3B 1TPB1 1KFCA 1QPRA 2Y85A 4Q7IA 4PA8A 2FZMA 4W7VA 1KBKA 4DBUA 2A6LA 1BVZA 4R33A 3QGVA 3GQYA 1MW1A 1ZY9A 3RM8A 4P7QA 4PL2A 3W26A 3QSRA 2Z2AA 3WF0A 5LIYX 3REQA 4M7TA 2JGYA 3HG2A 4RE2A 3TC6A 4OV9A 4O1CA 4MLJA 4XAZA 1BSLA 3DOPA 1OX5A 2YA2A 2Q71A 1S5WA 3NCOA 2CLPA 8TIMA 2OKTA 5FF7A 2WYSA 4FX8A 1SW0A 1FCVA 2LLEA 4IHCA 3PHAA 3GYCA 2BGNE 1YDOA 1ZBKA 3L2IA 1UUQA 1UR0A 3RPDA 4KFNA 1KBJA 1TV2A 4HHMA 3F2CA 3GU2A 3KWSA 4LU0A 5E6ZA 3PZIA 1SW3A 3BLEA 3WBEA 3B8VA 2J7DA 4IXHA 4TOQA 4M0XA 2EKCA 4RNIA 2BHUA 3K8KA 2A5HA 5C9WA 3R1ZA 1GVSA 2OWXA 2QV4A 3MCNA 4ADTA 1H09A 4F8XA 5BU9A 3MU7A 1IWPA 1QNOA 1JYXA 4OU1A 3BZJA 2O56A 2AAMA 3H4XA 3QMSA 3TYEA 1RY0A 4UQAA 2PWGA 2PLKA 5A6AA 3E0VA 1L6FA 4UCGA 3SQMA 2DVUA 1VKFA 3AWNA 2ICSA 1W3KA 1HT6A 3T2PA 5G1YA 4XO7A 3DAQA 1ZSXA 4KT2A 5HNTA 4AZIA 3OZOA 4FXRA 1NP0A 5FAJA 3S2LA 1MXDA 4GUFA 4LF2A 2VWSA 1US3A 4CU6A 5D2TA 3QY7A 4QX4A 1UR3M 2YCJA 3O05A 3BOXA 3PK7A 3QPEA 3O6YX 2GJNA 5GNYA 3BW3A 3IJIA 3TYCA 1SFSA 4A2RA 4YJ5A 1CZ1A 4H8HA 2R24A 4QLLA 4DUOA 1DIOA 4UMAA 5EGRA 1TJ0A 5BZAA 3RAOA 3RUBL 3N2CA 3AROA 4XBJA 1YE4A 2GL5A 4ZZ9A 2J78A 3V36A 3M0JA 2G41A 3N18A 3K4AA 2G3MA 3S1UA 4CNSA 3MYOA 5XIMA 3ONCA 4XD4A 1RVGA 1VHCA 2QDHA 4W93A 3EDDA 3EB2A 4LCRA 2L5HA 2PTDA 3TXVA 4CNPA 4BA0A 3L21A 1JFXA 4F0LA 3H22A 4GBDA 1POKA 2OOFA 5LNVA 3ZZ1A 3MTWA 5LIXX 2QS8A 2VDIA 3BLOA 4MAZA 1YXDA 3B0VC 2I17A 1XKYA 3WMBA 4WKAA 3LERA 1QNPA 4NZJA 2ZRYA 1EJ7L 5C9RA 2WCSA 4ONVA 4WZHA 3AMGA 3MSYA 5DT7A 1RQBA 5C5YA 1DKWA 4LS2A 1XLIA 4FEZA 3CAWA 4WGXA 2X0SA 2QJJA 4Y9PA 3VZYA 3B8UA 1MDRA 2GFTA 4HNVA 5K3VA 4N6EA 3PPGA 1ZB5A 1KD0A 3M5YA 3TJ4A 2XHYA 4IJBA 1ESWA 4LUIA 2WBKA 3GDBA 1P0EA 1JPIA 4F0RA 1R3RA 1JGIA 2DSUA 2Z2BA 4HYVA 3DKLA 4IQLA 3P5ZA 1S1PA 1UP3A 3PZGA 4DJFD 2ZX9A 3UVIA 3UCQA 4MB1A 1BEUA 3TYAA 3NR0A 1XSIA 4KWVA 3FFSA 4XG1A 3EWCA 1E6PA 4FNUA 3F4WA 1SR0A 5EKYA 4NP7A 1FUYA 2BASA 2J8GA 1S38A 3ARSA 1V0LA 4NQ1A 3WNNA 1XR2A 4YTRA 2QCMA 4GX9A 4L5ZA 4P5UA 4MJ4A 3GH5A 3TYDA 4ZFMA 4IX2A 1KM0A 4KCWA 3MDWA 4DN1A 4W86A 3NGJA 4E5TA 1FBAA 5E5CA 2C3ZA 3MSGA 1ISYA 2BG5A 3LXBA 2FVKA 1YPFA 5LGXA 2QUVA 3NDOA 2ODOA 4NJGA 4ERAA 1A4LA 3L0GA 3N6HA 3W1P