1AH4A

Pig aldose reductase, holo form
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
314
structure length
314
Chain Sequence
SHLVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQGQVVKREDLFIVSKLWCTDHEKNLVKGACQTTLRDLKLDYLDLYLIHWPTGFKPGKDPFPLDGDGNVVPDESDFVETWEAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYNRNWRVCALMSCASHKDYPFHEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title A 'specificity' pocket inferred from the crystal structures of the complexes of aldose reductase with the pharmaceutically important inhibitors tolrestat and sorbinil.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 104
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1997-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ah4A00
3ONBA 1C9WA 4IGSA 4GABA 1AH3A 3P2VA 2IKIA 1UR3M 1US0A 1LQAA 3UP8A 4PR4A 1LWIA 4XVDA 5HNUA 1T41A 3CAVA 4F40A 1FRBA 2IPWA 2P5NA 2DUXA 2IKGA 1EXBA 1QWKA 3R8GA 5JH1A 2PZNA 1MRQA 4XZNX 3KRBA 2PDGA 4WDWA 3UFYA 5LIXX 4JTCA 2DUZA 2HVNA 2BP1A 3V0TA 2HE8A 3BURA 3GHTA 5AZ1A 3QKZA 4WRHA 5LIKX 3WBWA 3BV7A 3WG6A 4XO6A 1Z3NA 1AH4A 2QXWA 3GHSA 2PDLA 4RPQA 4LBSA 4GACA 3N2TA 2PD5A 3UZWA 4GQ0A 1EKOA 2F38A 1YE6A 3MB9A 2PDPA 4EXAA 1MZRA 4YVXA 4Q3MA 4QXIA 4FA3A 3RX2A 2CLPA 2ACUA 3GHRA 4H8NA 1S2AA 4XAPA 4DBUA 3Q65A 2PDWA 2PDIA 3UWEA 3V36A 4LBRA 3T42A 2PDYA 3UGRA 3R43A 1X97A 4XO7A 5DANA 3LN3A 4DBSA 5AZ0A 5C7HA 1XF0A 4Q7BA 3Q67A 4HMNA 5HA7A 2PDKA 2PFHA 4PUUA 5JH2A 2HEJA 3EAUA 3F7JA 4IJRA 5HNTA 1VP5A 1IHIA 3G5EA 4JIIX 1XGDA 2FZBA 3CAQA 4YU1A 4AUBA 2ACSA 2FZ9A 1RALA 4XK2A 4I5XA 1K8CA 2PF8A 1OG6A 4OTKA 2PDBA 4PRTA 2R24A 3WBYA 5M2FX 1T40A 2IKHA 4WEVX 3V0SA 3COTA 4YS1A 1QRQA 2A79A 4DBWA 2IPJA 3H7RA 3R6IA 2PDUA 4PRRA 4JQ4A 2FVLA 2VDGA 1Z9AA 1SM9A 1XJBA 4JQ2A 4HBKA 3UZXA 3R7MA 1GVEA 1S1RA 3B3DA 3FJNA 1PZ0A 4GIEA 4WDXA 3EB4A 1MI3A 1YNPA 3R58A 2NVDA 3CV6A 4YVPA 3ERPA 1HW6A 3WBXA 4GA8A 2I16A 4L1WA 1J96A 1JEZA 1HQTA 1ZUAX 1X98A 3LD5A 2IPGA 1PWLA 4ZFCA 3EB3A 2FZ8A 1RY0A 4JTRA 3UZYA 2BGQA 3D3FA 3LUTA 2ACRA 1ZSXA 4NKCA 4LAZA 2HV5A 1EL3A 3LQLA 2IKJA 2IQDA 4WGHA 1AH0A 1R38A 1IEIA 3V35A 4LB4A 4JIRA 1YE4A 2HE5A 2WZMA 3ONCA 1A80A 4JTDA 4ASTA 2NVCA 2PDCA 3FX4A 4MHBA 1AZ1A 2AGTA 5KETA 1EF3A 3UYIA 4XZIA 1RY8A 4R9OA 3M0IA 3M4HA 2FZDA 2ACQA 1S1PA 2PEVA 3CASA 2ALRA 3MC5A 1PZ1A 1ZQ5A 3R94A 1ZGDA 1Q5MA 1Z8AA 2F2KA 3H4GA 2WZTA 4XZHA 2R9RA 5LIUX 1PWMA 1Q13A 3R8HA 4PUWA 3H7UA 3U2CA 1X96A 3G1RA 1AFSA 2C91A 4JTQA 5LIYX 3S3GA 1S2CA 4JQAA 3UZZA 3DN5A 1M9HA 2ISFA 2PDJA 4LAUA 4XVEA 4JQ3A 3VXGA 5LIWX 3LZ3A 4DZ5A 3NTYA 4H7CA 4FAMA 2PDMA 2PD9A 2PDXA 2I17A 1VBJA 3C3UA 3GHUA 3O3RA 3LZ5A 4QBXA 4QR6A 3WCZA 4YVVA 4JIHA 1ADSA 4JQ1A 3UG8A 4FZIA 4JTAA 4FALA 3LENA 2HVOA 3V0UA 1YNQA 4WDUA 2PDNA 2FGBA 2PDHA 2PDQA 3LEPA 4L1XA 2IPFA 3DOPA 3LBOA 2INEA 4GQGA 4PMJA 2PDFA 4ICCX 3BUVA 4XZLX 3BCJA 3LNMA 1AZ2A 3M64A 3CMFA 4WDTA 3RX4A 4G5DA 2INZA 3CV7A 3O0KA 2IQ0A 4IJCA 3LQGA 2DV0A 4EXBA 2J8TA 4LB3A 2HDJA 2IS7A 3N6QA 4GCAA 4QX4A 4XZMX 2BGSA 3GUGA 1PYFA 3RX3A 1Z89A
chains in the Genus database with same CATH superfamily
4EXQA 4XB3A 4L6OA 4PUNA 1F73A 2DEPA 2C79A 1ML1A 3KOXA 4O10A 1O12A 2ZX8A 4EVZA 1XSJA 4DWDA 3ES8A 5A6SA 4M24A 4I9TA 5I3GA 1S5VA 2V2CA 3EPNA 1DQUA 3QXBA 4RLIA 2R1KA 4PUMA 4I6KA 4TMBA 2WW5A 5I3DA 5AC5A 2W9MA 3WUEA 2Y89A 3UA3A 2A3HA 1LJYA 2I1OA 4F2UA 1FUYA 2X7VA 1J6PA 1EYEA 3QV8A 4MJ2A 2ZBTA 4Q7NA 4AXNA 4DNMA 4WDWA 1G9HA 1MXGA 2AAAA 4KWUA 1S38A 3APTA 4OV4A 2A85A 3TP4A 3KL3A 2POZA 2NWRA 2X1RA 2E6YA 7PTDA 4KKXA 2G41A 2PTYA 1N8IA 3MUY1 2UY3A 2J77A 3VABA 4DX3A 1EGZA 1XW8A 1OFEA 4PMVA 5A2CA 1W9PA 1YMYA 3DAQA 4L4MA 3W1AA 3KW3A 1TRIA 1OF8A 4C6MA 2WLZA 4H00A 2QJJA 4MNMA 3WDIA 1WDDA 1TTQA 3W1XA 3N9RA 4DXXA 1HVXA 2J9XA 3B04A 2NQZA 5D04C 1S2AA 1UJPA 1IWAA 3T09A 1L8PA 1EUAA 5EY5A 4MZ8A 4XAZA 3WLTA 1ZPTA 3W86A 1P1XA 4LBRA 3APGA 1X97A 1W9XA 4WXYA 5DANA 4ZQPA 1V0LA 1RP9A 1NDVA 1VCFA 5HULA 1KR0A 3LPGA 5C7HA 3CHDA 5IRPA 1ZAIA 3WD1A 4E2OA 1BTMA 5FEWA 1R3YA 1H50A 3RLVA 2Y62A 2VUYA 2X7WA 4MUPA 1H3GA 3A3XA 3SUSA 2O7SA 3H2CA 4AVFA 3UWQA 1CENA 3QTGA 3TYBA 1RK5A 3LHZA 4XD3A 5F2IA 3S1WA 1C3FA 2OCZA 1TA3B 1PVNA 4RJEA 1PV8A 4UCFA 2P8CA 3G0XA 4Z2IA 3S9ZA 1AQMA 2VEPA 3TH6A 2PI6A 4XAGA 1OX6A 2ZUNA 2PDBA 4M6VA 5LNUA 1BEUA 1IXPA 3IPWA 1ITUA 4OU1A 4YIWA 3T1GA 3OOQA 3V0SA 5BXPA 1QBBA 4OE7A 2VEIA 2FGZA 2WVUA 4HMDA 3PBVA 4QRNA 3TYUA 1FWEC 2QPSA 3UWYA 2FVLA 3AZSA 3E0VA 1YXDA 1O6IA 4AMCA 1XLFA 3B40A 4MKNA 3MVIA 3PWGA 1U5HA 2UY4A 3EB4A 1E9YB 1OX4A 4M7SA 5JBFA 1GVOA 3O1NA 3RCNA 1NIUA 3VIGA 2JBMA 3LRMA 4GA8A 1ZJIA 3JR2A 2V30A 1DJNA 1YHTA 1B2YA 4WVXA 2WKGA 3FXYA 1A5CA 4GIYA 4Y9PA 3UT0A 3UJ2A 1KNWA 1B3VA 3PB0A 4FO4A 1ZSXA 5D38A 3DYOA 3CEUA 2Y5JA 2A6NA 3KE0A 2VZUA 4LBUA 4PL2A 4CD5A 4KBXA 4M0XA 5C9UA 4BY3A 5DCDA 1YDYA 4GI6A 2D23A 2W63A 3TE9A 1TV3A 5F1UA 1A80A 4KEVA 3LSBA 1VCVA 3VI2A 3VTRA 3HPXA 4O50A 1L6SA 4Z1BA 4MYAA 3DFQA 4W8BA 5SWUA 5EL1A 3JZEA 1ADOA 2PC8A 4M3PA 5DMNA 2ACQA 1UPMB 4J2PA 4Y8FA 4S2CA 4RZ4A 1ZAJA 2OGJA 4DO4A 1CCWB 1I9CB 4UTFA 2ZRYA 3CQIA 3PZOA 2CLMA 1Q13A 4XSLA 2BLEA 3F2BA 3ZMRA 5FL0A 3TOPA 1E6NA 1W9BM 4FPSA 1S2CA 2YA1A 1DP0A 1A5OC 2XIMA 3KTCA 1V3HA 5G1MA 4DF2A 3LI0A 1V77A 1SZNA 4GFIA 2QAFA 2C14A 1EEPA 1R7AA 4MDPA 4BWLA 4IPLA 3B4YA 1V3IA 3MDUA 4U3CA 3KS6A 1EHNA 2G0WA 3M0VA 2YPIA 5HDRA 3W75A 4ORMA 4EAMA 1W3IA 2OELA 4BF7A 2CPUA 3ZYZA 1EZWA 2E09A 3EMZA 3PPFA 2ANUA 2YL8A 3EDKA 1V7YA 3TLLA 1J5TA 4IT1A 1JCMP 4E3TA 1KRBC 4ZVJA 4LY4A 5DBTA 4L9ZA 3BGAA 4X61A 1G0CA 1RLCL 3AXIA 3ARSA 2FPYA 4XZLX 3P60A 4JL1A 3BGGA 4HPJA 4XTDA 5DN1A 2GJXA 2REQA 1HXJA 4V33A 4HNCA 4WDTA 4NZ1A 5TIMA 4JBRA 1QVBA 2W0UA 3S5ZA 4HNVA 3NUKA 1OINA 5HATA 4JFVA 6TAAA 3T2OA 1DJHA 5FCZA 4HPNA 3PJUA 3BSMA 1UB3A 3AMKA 1ZZMA 4KW2A 4J3ZA 2E5DA 3OPSA 1W1TA 2HNEA 3ABRA 3ONBA 4C7DA 4KCWA 1JPMA 1M01A 4F0SA 3W9ZA 4NZ4A 3LA4A 3H4XA 4G1KA 3F03K 1PDYA 3R1ZA 1FWGC 4R85A 1NH6A 3QHMA 2QPXA 1MNSA 1MMFA 3P93A 5CSUA 2WSRA 3G1XA 4Q8OA 2GFTA 4H41A 4H7ZA 1CZ1A 1CWYA 1M5WA 4O1DA 1XRSA 2PLKA 4GYPC 1LT8A 1QWKA 1QW9A 1OSEA 2W66A 2FVKA 1WBHA 4AIUA 2OEKA 1A5BA 3KDNA 3T8LA 1AQ0A 1UZ4A 2ATMA 2NVAA 1WB0A 2Y6ZA 2HE8A 3FVDA 2G3IA 1IZJA 4FEZA 1OFBA 3K8KA 4N2YA 2CHOA 4LANA 3C0QA 2O56A 3DHUA 4QJ1A 3CTTA 1NQ6A 4B5NA 2Y4SA 3W81A 1S3HA 4JOMA 2PD5A 1KWGA 2PLJA 3E2RA 1EKOA 2F38A 3NEVA 5E09A 3ZR5A 5JU6A 3PWAA 1RBLA 3CHFA 4HSNA 4MFEA 3FYPA 4G7EA 3WJXA 4PUJA 4QXIA 1TWWA 2ZX7A 4WSHA 3LTSA 3H6OA 1UD4A 3R13A 2C18A 4ICNA 3I10A 2VRQA 3AIUA 3CHCA 2GGHA 2Z6JA 2WHJA 3Q37A 4IL2A 3QC0A 2B4GA 4UMBA 3QEZA 3TW9A 1QU4A 1QPOA 1IR1A 4WD0A 4KIEA 3CYJA 4A8IA 3RFAA 1LBMA 3WF2A 1W1A1 4HHMA 5DMLA 1BYCA 3PC0A 2XWDA 4ZSTA 2H8ZA 3KWXA 3UESA 1Q6RA 4AH7A 4YWSA 3NM3A 3IVSA 3CMGA 1WZMA 3W7DA 5EGRA 1YYAA 1AA1B 1E6XM 2DGAA 1LWHA 3CZJA 1ZBCA 3VPLA 1QOPA 4A3QA 3PBWA 1AQHA 2PURA 1YKWA 3W00A 5M2FX 2YIHA 4K8EA 3R89A 4FNUA 4Q8UA 4XG1A 3TZFA 4EAYA 4F2BA 2CIPA 2Y7DA 4RNIA 2Q02A 1B5TA 3CU2A 4D2JA 1SW0A 4W87A 4IIHA 2HBVA 1F2JA 1XQLA 4D9PA 3F4CA 1AMKA 1HF6A 4H9TA 1CGUA 4IISA 5B7ZA 2EO7A 4R33A 4JTEA 2DVXA 1E1FA 3TEVA 3R58A 1TZ9A 1MDRA 4S3KA 3ERPA 1WXJA 1W2VA 3DUGA 1BWLA 1TPEA 4C6JA 4Q33A 3TYZA 4IFKA 4BFAA 2ASHA 2I16A 1WDPA 4NZJA 3HV8A 3IGSA 1JEZA 3ZVHB 1JZ8A 2HXUA 2YBVA 3EOOA 1NWRA 3K4AA 2VUNA 3WZ0E 4DUOA 3K8LA 3WDPP 1TZZA 2Y7GA 3YPIA 1XKYA 3WJWA 2QT3A 3I7SA 5D9OA 4WGHA 5M5DA 4C1KA 3HJZA 1W5OA 1K7XA 4DWSA 3U2EA 2VURA 1C8QA 4IJBA 1RCQA 3KDOA 4HA4A 4EIVA 3WO8A 4LNCA 2GVLA 4ECLA 4JTDA 1R9XA 3MSRA 4MHBA 4AQLA 2OQYA 1XRTA 3C3NA 4FXJA 1Q7QA 4B5TA 1FDZA 3UG5A 3CEPA 2AL2A 5EMUA 1C29A 3IIZA 5HR6A 2CBJA 4WKAA 5CZSA 3A13A 2ZC8A 4NG3A 3E9AA 3R94A 1ZGDA 1Q5MA 1Z8AA 2ZA2A 3GS6A 4GO8A 4FLOA 3NZQA 1E70M 3MJYA 2XJ7A 1EYWA 1WZAA 2CLKA 3W7GA 4TTGA 5A6JA 2RJHA 3ZM8A 4P7NA 3ZJ8A 3INPA 4R5EA 2Q3RA 5LIYX 2WQPA 2ZDRA 1W91A 3FVMA 1TE6A 1RJQA 1UW9A 1FCVA 1PKYA 1AD1A 3NPUA 3REQB 2J8GA 4LJ3A 1M6JA 3AISA 3A5VA 3PJTA 4H7CA 4G1NA 1K9EA 1NP2A 1WV2A 4QG8A 1C91A 1OK6A 1R3QA 3ISIX 1XLKA 2YDSA 3WMSA 2INFA 3TQVA 3F2DA 1UD3A 4FNQA 4PUDA 3ZJ6A 3S8HA 5HMDA 3T9PA 4TMCA 5E9XA 2VEGA 3WLPA 3PZIA 3PZNA 5JMUA 2O9PA 3TQ0A 4QHRA 3DFSA 5CGQA 4Z2HA 3G8RA 3G1VA 5D8ZA 3UG4A 1LL7A 1B0IA 4JCLA 2WVVB 4EPEC 1F7BA 1PIIA 2PU1A 5CPOA 3GKAA 3ITLA 4BR1A 1JXKA 4YHGA 3S2NA 2V5BA 4GX9A 4LW7A 3CMFA 3VKBA 4QGCA 1KCKA 1XYBA 5E0KA 3VIOA 1J0KA 3QV7A 1UWUA 2G97A 1M41A 3WK0A 1F6YA 3I4EA 3QGKC 3IRSA 3RN6A 5FJRA 2J8TA 4OWGA 2IS7A 4QX4A 1E0TA 2EG7A 4CQBA 3MMDA 4RZ6A 2EPKX 1TFVA 2NXHA 1PHQA 1W9DM 2GUUA 5AHEA 9CGTA 2OG9A 2QCCA 5BOEA 3NM1A 3TTSA 4KEUA 4PBEA 2Y8KA 2NV1A 2BY1A 3L5AA 2JGYA 2YZ5A 3G1AA 1NAL1 3DKLA 4QCEA 2F8QA 1HJSA 4AX7A 1CNVA 3C2YA 1KLZA 1GQIA 2E7FA 3WDHA 3UWVA 2V68A 1M7JA 1B90A 1B3YA 1HNYA 3KHJA 4M6PA 1GHRA 2ZRUA 4QQ3A 3ITVA 1E72M 2J47A 3II1A 4K3ZA 4UTWC 4IPPA 4NI3A 3CPRA 1GZGA 2DZBA 4GYKA 1YIXA 1LWJA 3NWRA 1RUSA 4NQ1A 3TC7A 1ODZA 4JCMA 4GVIA 4WRHA 3SCTA 4GFSA 1B30A 4XO6A 3BV4A 3D0CA 5A1AA 1OFQA 1Z3NA 4CQDA 4RPQA 3M5YA 3S1XA 5HJLA 4IPIA 1O5RA 3O6YX 4GC4A 2HPIA 4P8XA 4PTXA 3THDA 1QMLA 2PP1A 4U2YA 1KR1A 3N4EA 3K1GA 4ATWA 4W5UA 3E74A 1QNSA 4G9PA 4XBJA 3NYDA 3ZLHA 3VZZA 5IDZA 4L5ZA 2AQOA 3DGRA 4DBUA 3MP4A 3Q65A 4IMEA 2X0HA 2OYKA 1XD1A 3UWEA 2HS8A 3WBAA 3U7VA 1HTIA 3C0SA 2PGWA 1Q4NX 2BXYA 1ZCCA 2ZRVA 1RD5A 1PX3A 1SO4A 5AZ0A 3MMWA 3VE9A 1ICQA 3P8IA 2WC7A 4M29A 3H12A 3R12A 4GE8A 4DXKA 3WLHA 4FB7A 1NF7A 2PFHA 4XD6A 1BGGA 3WH6A 1G4SA 2HEJA 3LHUA 3WNPA 4P8VA 3ARVA 1FFRA 3GW0A 3VIIA 2Z26A 3RLUA 4M1RA 5LZLA 1XUZA 2QGYA 1BHGA 1M68A 4O1BA 3VA8A 4GGBA 2OVLA 2A7PA 1TYGA 3O6CA 1XLBA 1O60A 3LERA 1XLCA 1J12A 4MG4A 4Y2WA 3I3BA 3VC6A 5ABTA 1OG6A 4HOZA 1C8XA 3RK8A 3QYSA 4GY1A 3RHGA 3EXSA 4H9VA 5DELA 1QRQA 2H90A 1A5SA 2IPJA 4JTJA 2X42A 4JYFA 1VFUA 1R3WA 5L6UA 3F4DA 2DSKA 3L12A 1XG3A 4UFHA 1C7SA 3Q45A 2GVEA 3SQSA 3BAKA 3BJFA 3VC5A 1PJ9A 5LNVA 1Q8AA 1UP3A 1UIPA 4X22A 4R7OA 2ZUMA 3C56A 4V15A 1DIEA 2DT0A 1P6BA 3T0AA 2Z1WA 2DDXA 2XGBA 1B9BA 4KF1A 2DJXA 2GVJA 1N8WA 1EP2A 1BYBA 1UR9A 1FWNA 3ZS4A 3VGEA 3S4TA 1IT7A 3QBUA 1Q6GA 3EEGA 1PUDA 3LD5A 1PO9A 4A22A 3K2GA 2PWEA 2HZGA 3AMCA 1L6GA 4GUFA 3NQ8A 3JW7A 5JXQA 1GTHA 1KRMA 3AOFA 3C5QA 3CPGA 1DKWA 4HNOA 2XN2A 1RA0A 4Z2KA 4D6CA 2J88A 4U10A 4PMZA 2A3AA 1RVGA 1UOKA 1DQWA 1XDMA 4HHPA 4E2DA 2Y0FA 3FNDA 3W2NA 5GNZA 2DT1A 1TREA 3BAXA 1WKEA 1POKA 1EF3A 3ZSTA 3V18A 4Q8TA 4ZOAA 3QZ6A 4MLRA 2ISVA 1VCGA 2ICSA 1A4MA 4ZQOA 3ELFA 1DOSA 3DG3A 4UZSA 4WKHA 2DH2A 3MC5A 4XD4A 4A3RA 5F4WA 4N7QA 2P3ZA 3DIPA 4XKYA 2F84A 4DJDD 3H7UA 2EG8A 2C91A 1CLKA 1AQFA 3CZEA 2Y8VA 2DPEA 1E3ZA 4KT2A 4O54A 1POJA 3PUDA 3B9EA 1UUOA 3LRKA 1JRBA 4CGTA 1QI3A 4BS0A 1FQ0A 1KXQA 2FH8A 2DSUA 5FF2A 2DIJA 5GNYA 1MEWA 1P48A 1DXEA 2QEZA 2PDXA 3CH0A 5DF0A 3CJPA 1XBZA 2YCLB 3A9BA 1EO7A 1B3ZA 2OYLA 5M17A 3M0XA 5TBOA 3RUBL 5HQLA 4QG9A 1LORA 1I60A 1JPKA 3GH5A 5HINA 1WDWA 4E6MA 3CT7A 4AEOA 3HB9A 3BPWA 3MPGA 4XQ6A 4TXEA 1DWFM 1EEXA 2PDQA 3PB2A 3S5OA 1GOMA 1ZTVA 3VDBA 5TAOA 4TVCA 4QP0A 4NP7A 4P7LA 4NNCA 1RP8A 3WYZA 1OYAA 3BCJA 4DM1A 3FHQA 2GWNA 4G7FA 2ZUVA 4EACA 3C8FA 1H0IA 3WUFA 1C8VA 4LUSB 3CV7A 4UFMA 2Z2AA 3LLDA 2HROA 4JL2A 4KEMA 2VR5A 5CQ1A 4OHQA 4IMCA 3M0YA 1XI3A 1JPDX 1FH7A 2GK1A 1OCBA 1VEOA 1KO0A 1J2BA 3GUGA 3RX3A 3LV5A 5MHBA 1C9WA 2QZRA 4GVHA 4IICA 3CL8A 3GIPA 1X1ZA 3NG3A 4HCLA 2GJPA 5HWJA 3UPMA 5DO8A 3P80A 4D6EA 3LPPA 3RITA 1W54A 4HPHA 1LWIA 3M0JA 1CGXA 1ZU8A 4QFUA 2GUBA 5BYWA 1OC5A 4FXFA 3CZKA 5A8PA 3EX3A 2I57A 1ISXA 4CQ8A 4H9UA 3BAWA 2GGGA 3R0DA 3L2LA 2V82A 3M9YA 1KBIA 3ALGA 2EPLX 4WY0B 5D32A 4CNTA 4YYFA 4O0QA 1KTBA 4EX4A 2YGYA 1V6YA 5I06A 2PE4A 3IGUA 3WQFA 1OY0A 3V0TA 4N9CA 4I9JA 1RCXB 5LIKX 3WBWA 4AW7A 2QDGA 4CEUC 1FWSA 4M56A 2AKMA 4N42A 3WH7A 5CSSA 3TROA 2NV9A 4GACA 5GJMA 1ISWA 1R3RA 3NDZA 4PFMA 1K7FA 3B0UX 3DHPA 4GO9A 3E2QA 2XDFA 4YVXA 4JGDA 4CCCA 4AZGA 5M1TA 4H01A 4FA3A 1K70A 4PGLA 2ACUA 1EA9C 1TPB1 4FIRA 3C52A 4JHZA 2QF8A 3CB8A 1SZFA 5BMXA 1UKPA 4K38A 3GTIA 2UY5A 1ECEA 3N25A 4WSJA 3NQMA 3W71A 1K02A 3UGRA 1K4GA 1GEHA 4GKTA 1W5MA 1UBSA 2V5LA 3GAYA 5T9CE 1XQKA 1UJQA 1IEVA 1TA3A 3Q67A 1H7WA 1A53A 1LRNA 3HO8A 3E3HA 1LLOA 1UROA 4LCRA 2VZTA 3VOJA 3ICJA 4W7WA 2J78A 3KBWA 3SCPA 4A29A 3OZPA 3PZ9A 1P0DA 3LRLA 4PBGA 1OGSA 1HFBA 4WZHA 2WXDM 1H1YA 5EKYA 1EC9A 1JYNA 4DI9A 4H3DA 4OTKA 2GQ9A 3EXRA 2CEQA 1GVRA 4ZO9A 3CHEA 3VX0A 1JDDA 1LOLA 2TYSA 2XUCA 5CH9A 1SQ7A 4DBWA 3UXIA 1C7TA 2BXZA 1ENUA 1EHAA 3O07A 3W7PA 1EPVA 4IUOA 1JCJA 1DJQA 2PDUA 2PTWA 1QK0A 2W91A 4KWOA 3HN3A 2Z00A 2VQUA 3WF1A 3UZXA 4O0ZA 2RFGA 3TYCA 3A5FA 3WKZA 2YA2A 3AU2A 1S46A 1A3XA 4RXFA 4RL3A 1VEPA 3QRHA 1PL9A 2B7PA 2PLCA 2ESCA 3GDBA 3THCA 5C70A 1A4LA 3BLOA 2WZEA 4F9JA 3CV2A 1QPNA 1TQXA 3SUTA 1XLLA 1DTNA 4TX8A 1GG1A 4NZ3A 1YRRA 3ID7A 1AH0A 3VNJA 1PKLA 3IS4A 3VIFA 8A3HA 3ABSA 3V35A 4NJHA 4B9ZA 5I07A 3F4WA 1FX6A 2HE5A 2ZYFA 1F8IA 4B2DD 1H60A 2ZE0A 5AC7A 1IIHA 4HP5A 4MWAD 3W6YA 3WUBA 4GGHA 1XISA 1ZHAA 3VNMA 3LB0A 4NZ5A 1DPMA 4A4AA 1F4AA 3HQPA 4IM4A 1TJ0A 4LS2A 1WAUA 3S5NA 4JS3A 4X0VA 3R0KA 1TV5A 4G56A 3FDKA 4I6VA 1KW1A 2X16A 5LIUX 2RDUA 4LRSA 2E6DA 5DT5A 3WD4A 1X96A 1IXOA 4LX4A 5K2ZA 3M5VA 1Q7MA 3SFKA 5MF5A 1O5XA 4X3ZA 5LKYA 3S46A 6ALDA 1IZCA 2CETA 3W7QA 5C9WA 1EO5A 3ZQ9A 1JF5A 3R10A 4A3HA 1F3WA 4HK7A 4IG2B 1VKFA 3CZ8A 1FDJA 2G37A 1FY6A 3UCCA 4ZE4A 2J7HA 1MUWA 1ZL1A 4ADUA 1Y65A 2HWGA 1EXPA 2O55A 3A3HA 1DJGA 2AGKA 1M53A 1Q7ZA 1E4NA 1SFLA 3LNPA 1XLAA 2Z6IA 4GQRA 3A24A 5A2BA 3FEMA 4FZIA 2GGIA 3DFYA 3E0LA 3KBMA 4FALA 4C6EA 3AXXA 3V0UA 3BK0A 1W9VA 1KGUA 1RV8A 1KFBA 1DTUA 1JFXA 2H3BA 1SZRA 4QJ5B 1TELA 3B4UA 4I90A 3AQUA 3W1RA 3GXNA 1HUVA 1NY1A 2BOGX 3QLDA 1Q4WA 2YCKX 3LYEA 4O1AA 1U1UA 4ZBCA 2VRKA 3IAQA 5F2MA 2IQ0A 5A2AA 2Z24A 3T44A 1SO6A 4MJ4A 4H19A 1MXSA 2DV0A 1E4LA 3WFAA 3VM5A 1G4TA 1ECQA 4JTUA 4XZMX 3P3BA 1UC5A 3BMVA 2OT1A 2V6AA 3KM8A 3B8DA 1GYLA 1BYAA 3QH2A 1PIGA 3GG1A 4JTKA 4FNSA 1ME7A 4FK9A 5M03A 1GTEA 1J5SA 3FJLA 1LQAA 1W5QA 4NIRA 3HPZA 3DG6A 1LCOA 3HQNA 3CUJA 3FW6A 3UJSA 1A5NC 4REQB 1IWBA 3NQVA 3MWCA 2VGBA 3TN4A 1R2TA 1LOSA 2P5NA 2DUXA 1JJKA 1G01A 1TZ7A 2J62A 2WKLA 2CHNA 5LA1A 2GPTA 3WQ4A 1QNOA 1KM1A 1YTEA 5BXTA 4ADTA 3M7WA 3CUGA 1DQXA 5H1WA 3RRXA 1R6WA 4GIRA 4LVBA 2Q8LA 3GB6A 2F6XA 3KRZA 2IXUA 2YL5A 1OFDA 4YMZA 4MNKA 2V63A 3S9YA 3VGHA 2CLHA 1BKSA 4CNPA 5D2WA 3LY0A 4TUFA 4X60A 5HUPA 4DZHA 3VNIA 3W01A 5I78A 2IXVA 4MWAB 3VGBA 2QV4A 1GEQA 3MB9A 1Q63A 4Z1AA 3KVKA 2BX7A 4UNIA 3L0GA 1FWFC 3FIGA 2Y7FA 4HSHA 1EIXA 3KZPA 3WQ6A 3W87A 1CI1A 4CD6A 3GHRA 4J4KA 4IZGA 3BARA 2BSLA 3N14A 1C9DA 3VK5A 1JL8A 1XINA 4S3AA 1OX5A 5HMFA 2I7GA 1K6AA 2A3EA 2DU2A 4B5XA 1NP0A 1VD6A 3LOTA 3TONA 1Y5WA 1TR1A 2NT1A 5CZTA 1H0GA 3L4YA 1UWTA 1CGWA 3OIXA 3VNDA 4O19A 5C9ZA 2F2HA 3IIPA 5D9NA 4NU7A 2DW7A 3MJMA 3GK0A 3NO1A 2CWNA 3WQGA 1IHIA 3TCSA 5KEZA 1UWAA 3V5CA 5LGZA 1XGDA 4JEJA 2NQLA 1TJ2A 3PBGA 1RALA 1V79A 4HA3A 1SPQA 2Z2UA 4Y9MA 4Y96A 4HMCA 4RZ5A 2A6LA 3S1VA 3AYVA 3CIVA 1JZ3A 1UQZA 1OFRA 3UBPC 2E6FA 3NZ1A 3AYSA 3R0UA 4ZSUA 1KM6A 4ZOCA 5DLCA 1H5VA 3GO2A 4BF5A 3EWZA 3NQ7A 5AHMA 4P7OA 2ZZ6A 2B7QA 3WF0A 2E6AA 2YDAA 2VENA 3SGUA 1EGMA 1OFAA 4LF2A 4PRRA 3ZVHA 1GKQA 5AYZA 1ZBWA 1E4MM 1UC4A 3R7MA 2WJFA 1GVEA 2VELA 1MZHA 5AYYA 1SO5A 2XVNA 2CNCA 3KZSA 2TAAA 3VIPA 1X6LA 3CQ0A 2AQWA 1TVPA 3LTPA 4FLQA 5MKGB 5F1VA 1X98A 3AS0A 4DI8A 1Y0EA 3PS7A 4O1FA 4LAZA 4M6UA 3VIMA 1KKOA 1XSKA 1LRTA 4GCXA 3M6DA 1ZRQA 3VNYA 2WAGA 3ANYA 4GY7A 8XIAA 5ABEA 2WCSA 2FMOA 3DECA 4UTMA 3VAVA 3G1DA 2WNQA 1SW7A 4QDMA 3UJFA 1K03A 3IJ9A 4ASTA 1YXCA 3IARA 1HVQA 2BDQA 1REQB 4XD5A 3AMGA 3GLCA 4A2SA 5K9XA 3DG7A 4F0RA 3OVGA 1S1PA 3QSTA 3PNUA 4ZOBA 5A6BD 1J0IA 1DHKA 4DBDA 2Z1XA 4Y90A 4ZA0A 3SZ8A 2YSWA 3REQA 1FWIC 1PWMA 2E77A 1Q6CA 1JXJA 4GNJA 4DPPA 4GINA 4UR7A 1D9EA 1JDEA 3SRDA 3Q4DA 4C6NA 2R94A 5BRPA 4N9BA 2V5JA 3CT2A 5F4XA 3VDCA 4S3DA 1L6WA 3KBNA 4O13A 3MI3A 3R79A 5I3HA 3BAJA 1UWIA 2PDJA 5LXEA 2ON3A 1PEZA 4DJFC 2UBPC 1GZJA 1DJXA 3KHDA 4Q4SA 2PB1A 1XIMA 1Z6KA 2DP3A 5BU9A 2EPNA 2QMJA 3SY5A 2UWFA 2C8NA 1OD0A 3B06A 3RO8A 3B9DA 1IEWA 2GGEA 2JK2A 1G94A 4F0MA 2WVVA 1JPIA 2W92A 1UR8A 5I7GA 3E02A 4FX7A 4YTTA 3ABZA 3HIJA 3TDFA 2WZHA 1SFSA 4US6A 3MI6A 1JZ2A 1TIMA 1T8QA 3VMOA 3WLIA 1V0NA 3DH7A 1ONWA 4NYYA 1XIFA 2ZZ7A 3B9NA 4LYQA 2HTMA 1W17A 4L1XA 3VMNA 3G0SA 2INEA 4PMJA 2JEQA 3VILA 3BUVA 1QOQA 3RAOA 5D2VA 5ECUA 3H2AA 1LTDA 3SADA 1UD2A 1B1YA 3UR5A 2OEJA 4RDZA 2JQXA 1EA0A 3TNOA 8TIMA 2PRHA 1TO3A 4PUEA 1S5WA 4FXRA 2XZ7A 2EKCA 5HANA 2OLHA 2HISA 3DZ1A 1FHDA 5E0CA 5FJPA 4DM2A 2XH2A 4GCAA 1RBOB 4JYEA 3MVTA 3CM4A 1ALDA 1NWSA 1CLXA 4KFPA 5FSDC 2Y2WA 1PYFA 3FOKA 3OGVA 2GDUA 1Z89A 2CLOA 3QW4B 3L0NA 4JTGA 5I09A 3ZFHA 4AEEA 4YL2A 3VKKA 2Y88A 1WXZA 2ZX6A 3LHTA 3SEPA 3HU7A 2CLFA 3VZYA 3IGXA 1RLDA 4MOZA 2OWCA 5H8UA 4B16A 4QDPA 2G5WA 3UVIA 3T0BA 4Q8MA 1GOXA 4PMYA 3LPOA 1K9FA 2CLLA 4MY8A 3W76A 1JUEA 1PE1A 2VRJA 4Q4MA 5FF4A 4PCSA 1NWTA 4FOJA 5AHIA 4O15A 3H7VA 3BOXA 3TJXA 2TPSA 1ONXA 4OVXA 4QSHA 5AZ1A 2VCCA 1VJSA 3OTRA 1RQEA 4MB1A 4DVOA 2YL6A 4MAVA 2PDLA 2X1IA 5HK4A 1J93A 4GC3A 4EP8C 4AC1X 4WY0F 3S47A 4UZUA 4UTKA 1YE6A 4EXAA 3BMWA 4WUIA 1VF8A 3TFXA 3BW3A 3GFZA 1VH7A 3LM7A 2EXOA 5C0QA 4K8GA 4AWEA 5D9MA 3UJEA 4PMQA 1SO3A 4EF8A 4ERGA 3FKKA 4H8NA 5CZKA 3IK4A 4EE9A 2W62A 2X0YA 1W5NA 4DYEA 2PDWA 1YPFA 4EOUA 4MKVA 4NRRA 3R11A 1HP4A 4KCUA 3PULA 4DNHA 3WN6A 3PR2A 4C6IA 4IXXA 1RSCA 1KBJA 4WKFA 5BROA 5IM51 1DIOA 4CCEA 1EX5A 3JS3A 1KA9F 4BF9A 2B81A 2VEMA 4HMNA 3MUZ1 5HA7A 4DO7A 3TOYA 1FXPA 4PUUA 3EBVA 1IR2A 5FL1A 5BZAA 2YLLA 2YA0A 2ZOXA 3HZ3A 1F6KA 5HXMA 4A3UA 4HD5A 1XDJA 1WNOA 3DXIA 3M07A 3MMTA 1W31A 1QAPA 3B0YA 1F05A 4OUIA 2PF8A 2PWDA 3OW1A 3SRHA 4ALDA 4PRTA 2C16A 3W37A 3EKGA 1BG9A 3L2MA 2VFDA 4TV5A 1JPHA 4GJJA 1AK5A 3P84A 1GOKA 4JKLA 2P50A 4Q8NA 3W2JA 3WEOA 3CO4A 4LEQA 4ZQNA 2XU2A 2VC6A 3B3DA 3H55A 3BL3A 1H7NA 1MW1A 1S2VA 3USBA 4WF7A 1HKJA 2FH6A 2RHGA 2ZZ4A 3CS2A 3WL0A 4A3YA 1PDZA 3ZR6A 1MQQA 1R46A 3UR8A 3DC8A 1UKOA 1UH4A 2VM8A 3OZOA 1Y8BA 3P8JA 1ODUA 3HPFA 1ESWA 3TAKA 1UZDA 3FFSA 1V6VA 1R38A 3VIJA 3ABOA 3OQEA 3T0DA 4LB4A 3H22A 3AALA 2C6QA 2B0MA 3SW6A 1SJBA 2FB2A 1FCBA 4GJ1A 1TWDA 3HQ1A 3FK4A 3SCRA 4KCVA 1JIBA 4K1WA 3FX4A 5BMWA 4V2XA 4QAIA 5D4YA 2J7GA 5ECVA 3EA3A 2QCGA 1PBGA 1NOWA 5BWAA 5I3KA 4UQBA 1XHGA 3WQWA 2OOGA 4B4FA 5EPDA 1W1ZA 4WJXA 1R9YA 3SURA 1XL9A 4D6IA 1GW9A 4PTWA 3VOHA 3P0WA 3A21A 1XBXA 2C13A 4I9MA 3FXGA 3RMEA 2PAJA 1IWPA 1F74A 4CN1A 2G95A 5DRCA 3PSVA 2VT0A 3GE7A 3M0ZA 2HK0A 6XIMA 4AMAA 1M9HA 3WEZA 2OZ0A 2YCLA 4PE8A 1G4EA 4H9ZA 2YKKA 2HS6A 1EQCA 4AD5A 4LYKA 1ZJBA 4ZCWA 1G67A 1KV8A 3DFOA 3LZ3A 5E0FA 4BEUA 3RG6A 4J27A 1PZ3A 3P5YA 4AVNA 5I3JA 4JTTA 2BY3A 2QCLA 3NQ6A 4PTMA 4E5TA 4EWND 3ZOAA 1X8CA 3N1AA 1ISZA 3RM4A 3V7PA 1R30A 2ZXBA 4ORIA 4GVGA 3VO0A 2Q6ZA 5CGMA 1EJ7L 1OT1A 3PM6A 1JG9A 5J5RA 3AHTA 3WQ8A 3OZYA 2BZNA 1RD6A 4NX5A 3QY6A 4IGHA 4LUSA 4GWEA 2PGEA 1W1IE 3W7CA 2YB4A 4NILA 3M41A 3V4BA 4CCDA 1SMDA 2G3JA 3W22A 2V3DA 4OZOA 8CGTA 1O1HA 3ITYA 2TMDA 3SRFA 2XIJA 1AZ2A 4S23A 1H11A 3KS5A 2PGRA 5G2IA 5I02A 2J79A 3VFLA 3KEHA 1LT7A 4QLKA 3LI1A 4Q22A 3U9IA 2VO5A 3AWNA 2PTDA 1WAWA 2FFCA 4EXBA 5D2YA 3WJZA 1FWWA 4HCDA 1TPFA 2POTA 1OGGA 1P7TB 2BY2A 2I5IA 2YZRA 3NPVA 3KOWA 2QUMA 4Q7IA 4MDOA 2FHFA 1XICA 3UXLA 3OLEA 2X1TA 5JBDA 3QLLA 1EC7A 2EJ1A 2QIWA 4IGSA 4WIWA 3PAOA 1KRCC 3S5YA 3HA1A 5EYWA 1LP6A 1O94A 4Z2GA 5I3IA 4WY0A 2DORA 2FHCA 3UEQA 1UWRA 2P3EA 4A8LA 3CB3A 4XVDA 3RLHA 3N18A 4S3GA 1T41A 2JF7A 2BASA 4LWWA 2OLAA 3NL5A 4F40A 4QS6A 4QISA 5A8OA 1P0NA 1EXBA 2EEXA 4ERAA 3IVUA 2GVGA 3GKFA 4ADSA 1VYRA 3Q58A 1JULA 1IIGA 1WCGA 3GD6A 4TQTA 2HVNA 2J27A 3A12A 5DCEA 2ZA1A 4O12A 2WWCA 1TV8A 2ALDA 1VZWA 3APYA 3NPXA 2WM0A 3OP2A 1Q6FA 4AZBA 3SN0A 2DZPA 3NSMA 1HL2A 3BLDA 1HKKA 3BLIA 1UD6A 5D2XA 1HN1A 1LROA 1UCWA 2EBNA 2WCGA 1ME8A 1UWSA 1S2WA 2WLYA 2AOSA 4DJDA 1G7UA 1R2SA 4DBEA 3GG0A 1TVLA 5IFPA 3C0LA 3J7HA 4TVDA 2CBVA 2Z2BA 3P0XA 2Z7GA 3WQEA 1HKIA 4AEFA 1IQ8A 4F0HA 3RRAA 5I00A 3HGJA 2PDIA 2B7OA 4AY8A 3RYSA 4ZTXA 4ZQRA 1HX0A 1BVWA 4XO7A 4NJGA 4OQVA 2AMXA 4DJFD 3CUIA 5JBEA 4D8ZA 2E5BA 4QJ4B 3THQA 2PP0A 3W29A 2ABBA 1YTKA 4K8HA 1KFCA 4I7VA 3KVJA 1EDQA 3FSTA 2MANA 3EAUA 4QTGA 1J0HA 4JNYA 3FGCB 2XSXA 2VWSA 3BXWA 4QS5A 4MADA 3LDVA 4JIIX 1BG4A 1CPUA 1X1NA 2OKOA 3N6HA 4MB4A 1LM1A 2ODOA 2EF9A 2J74A 3A6OA 4LUTB 1R86A 4A6GA 1E0WA 3EWBX 4ZR8A 4RX0A 1W2PA 2ABAA 1FP8A 2DH3A 3NFUA 3BGJA 1VIZA 3XINA 3WBYA 3LK6A 1LYXA 2D2GA 1VBRA 5T8GA 2GGJA 1XLJA 4M7TA 1E1CB 3GWQA 4QCFA 5EMYA 1E6SM 3W6LA 3KL0A 1JCLA 1UUQA 1IEQA 3RGTA 3STFA 3ZT7A 5REQB 1FWDC 2FKPA 3POHA 4BHYA 3BOFA 1SM9A 3GDRA 3AIBA 3NO5A 1EJWC 3LHYA 1GOQA 3MA8A 4LFYA 1XSIA 3DHFA 3NJ3A 4YVPA 4GZIA 1HW6A 4YTQA 1JCYA 1J96A 3LLFA 2FDMA 2C0AA 4ZFCA 3EB3A 4WR3A 1W8GA 2DSWA 4IMAA 4N02A 4GK8A 2X30A 4HN4A 2WV8A 2ZQ0A 5D2TA 2G8ZA 3MMUA 4GBDA 1A5KC 2JE8A 4C1NB 3TYEA 4ERIA 2X41A 4QDWA 4D6GA 1VFOA 1RHCA 5EFDA 1CXEA 3TW7A 3URAA 4PTNA 1DIDA 3EGJA 4GZJA 3CGTA 3H2FA 5CEWA 2QYGA 4DZAA 1U30A 3NGJA 1XRVA 4R9OA 3OLIA 3AXKA 3XIMA 5I2UA 4OIFA 3MSDA 3HMCA 4AD2A 4CLMA 4IG2A 1OYBA 1W3KA 3R8HA 3HGOA 4JFUA 4NZCA 3BLPX 1NOFA 3FY1A 5K3VA 2I9EA 2GQ8A 1A3HA 4Q4OA 1FBAA 4CNNA 4GUGA 1FKWA 3UYCA 5AYIA 4UBPC 3LLXA 5E6ZA 1OZMA 4NJIA 2TSYA 3ZZ1A 3UWUA 1NFPA 2RJGA 1QI0A 3H8AA 3B8SA 4FI4A 5K4XA 2VZOA 3GHUA 2O92A 4AD3A 3C4UA 4CD8A 1XRFA 3E0WA 3HG5A 4Q4KA 3QR3A 1DJIA 3QOKA 1C93A 1GVQA 1VEMA 4Z42C 4AHPA 3H70A 4K7YA 2YW3A 3HM7A 2JIWA 1LDCA 3GBEA 4FSAA 2OZ8A 4PH6A 4HZ8A 3MCNA 2NQJA 2BVDA 3WF4A 1BRLB 3DOPA 4US5D 3ZT6A 4IMDA 5HWMA 2CWXA 4AISA 2Q01A 3VDGA 1K4HA 3AIWA 3MKKA 2BODX 4QLLA 5A6TC 1P43A 3AU6A 1UZHA 2FGLA 4N4PA 4JY9A 1OEPA 3BC9A 4UC5A 4WK9A 3VZXA 1NDWA 1TMHA 1HZYA 1FVPA 5FJTA 5C2GA 2DQWA 4OBTA 4PC8A 1YQ2A 4NT0A 3D5HA 4GOAA 4FR1A 1RJRA 1CB7B 5CKSA 4HTYA 3BCFA 5F2LA 2FZMA 3UY7A 4WX2A 4REQA 3T4CA 3AUJA 3CWHA 3ZIZA 1B3WA 3E5BA 4DPQA 3DBNA 1M7OA 4MF4A 3WLKX 3WH9A 1Q6OA 1TPVA 3N3TA 3QZEA 4HU4A 4MGGA 3STGA 1OGBA 3N11A 2XSAA 3IVTA 5E5CA 3ENLA 4ATLA 2WKJA 3L7RA 1LF1A 4YTRA 3RM9A 5IFTA 1XH2A 2OTDA 1WE5A 3B03A 2E68A 3VUSA 3SM0A 4IGNA 1T0OA 4U5IA 4JY8A 3MYOA 3OYZA 4V1XA 3EXTA 4QQUA 4XWUA 3A4WA 4B2DA 4KRZA 1MRQA 4UTWA 2BXVA 4MWAA 3ARQA 2Y8UA 2R1LA 3VCCA 5AB3A 1H49A 4R7JA 1B4KA 2WJDA 3BV7A 3STEA 4JEQA 1OHLA 4B3KA 5AYXA 3RMJA 1YPIA 3ITCA 4B5UA 2QV5A 4TX6A 2V8ZA 4OT7A 1MZRA 2P76A 3HOJA 1QO2A 3ARTA 4LC6A 3MZNA 1RQBA 1DORA 2WCAA 4PODA 3CIWA 1JD7A 3ZT5A 5K7JA 2WC4A 3QY8A 5HBFA 4J3UA 4XZBA 4Y7EA 1SZEA 3BLKA 1WPCA 2V5CA 3EB2A 4RZBA 4MY1A 4GZ7A 3H23A 4AAJA 5KSWA 5DQPA 1U5VA 2WVSA 3W74A 3U4AA 3SGZA 1AJ0A 3W53A 4F4RA 1XYAA 2REQB 3L4ZA 1BYDA 1TX2A 4GXWA 5CAKA 3DX5A 3O05A 3LXCA 3LGGA 4WQ6A 2EKGA 1PX8A 3W1MA 3SN4A 2ONEA 3ANVA 5H6HA 1E1EA 2VFHA 5EA9A 5E70A 2V5KA 3AXMA 1R2RA 1D3GA 2XZ9A 3LBMA 3TJIA 4DAFA 1PB0A 4HJWA 3ZWSA 3CL6A 2R24A 1BXCA 1GHSA 2IKHA 3GTNA 1A49A 1C92A 1HL9A 2D2JA 3B97A 3TLQA 2GOUA 1V8EA 3PZTA 4YLWA 3WQPA 5MKGA 4UOZA 3L4TA 4ZB5A 3ABXA 4JQ4A 2XN1A 1SR0A 4O52A 4F3HA 1TPWA 4GVFA 4X9SA 2C1IA 3AXHA 2XVKA 4OUEA 2ZIDA 5H91A 1G7VA 5FESA 2NVDA 3ZXWA 1SSDA 1JQXA 3VVGA 2GWGA 4IQEA 5D09A 3N2XA 1RA5A 4BQ3A 1R47A 3STPA 1XPGA 4W86A 2IPGA 4UCGA 4W8AA 5D8WA 3TYAA 2QJMA 3QMSA 1BQGA 4IP4A 3D3FA 4MYXA 1ME9A 1TB3A 2ZC1A 3QPEA 1JD9A 3U6WA 4YNGA 3T0TA 3QY7A 3AUOA 1QO5A 4H6RA 3ES7A 5EMLA 3AWOA 3AS1A 4E0CA 4G7EB 3H2MA 1YE4A 1ZBVA 3T40A 2WZMA 1TWSA 4EF9A 3KOYA 4ZQCA 1QFEA 3SCUA 4AVOA 3N3MA 1JYVA 2PDCA 4K37A 3PK7A 3IUDA 4MJMA 1OK4A 3L67A 2W5FA 3GW3A 3NQAA 3W1UA 4F8XA 3E12A 1XWYA 1V0MA 3M44A 4O8AA 4QSFA 1JCNA 4HCHA 3M6YA 3WL1A 2XFWA 2JGQA 4C6FA 2JF6A 5XIAA 3NL6A 1FHLA 2BY0A 5FF7A 3FYOA 2OPJA 2WZTA 4O16A 1QUMA 5LHFA 1E73M 1TVNA 1L6YA 4N9EA 3GTXA 1C90A 3W7RA 1FDYA 1W1VA 1OFPA 3WNLA 1XLEA 3LU2A 5CZJA 3AC0A 3WD3A 3QHOA 1KGXA 5DMYA 1QPKA 3B8WA 2ZZ3A 4Q8VA 2NLIA 3KVMA 3ZSSA 5DMMA 3IV8A 1QNQA 4JD4A 3GYEA 3DCPA 2JIEA 5LIWX 4LGXA 3LM3A 4H6KA 4K7VA 3H53A 3VNLA 3U2OA 4PUKA 2DZUA 3UXAA 2HRWA 2ZICA 4UQCA 3UNTA 4KESA 1WYIA 2EAWA 4JIHA 1XIDA 2XH0A 4HKPA 4JFTA 1H41A 4MVAA 1P0BA 4Q6JA 2HNHA 2WBGA 3DI0A 3N2BA 3PZQA 1M7XA 4DJDC 3TV8A 1GJWA 1EZ2A 4Y9OA 1GORA 2VZVA 4L80A 3DKJA 3BZJA 3H2EA 3PZGA 4GY0A 4J1OA 4IXHA 3PUOA 3TFCA 1DIKA 3BJTA 4D8AA 2O4QA 3VDAA 3HG3A 1TMQA 4HNLA 5G4WA 4IIDA 4S3EA 1WZKA 2HXTA 4RE3A 4YJ5A 1QTWA 1GK8A 3GVQA 3GYCA 2ZUTA 5KMYA 5DY2A 1CECA 3NQCA 4E2VA 4UTJA 2EHHA 3L0KA 1TE1A 2Y7EA 1VAHA 2WO5A 1A50A 1ZFJA 1O68A 3G6LA 1VJZA 4NAEB 2WC3A 3N19B 4YCOA 4IWWA 1KCXA 3RF9A 3B8UA 4HOXA 5EBUA 4ZENA 5AC4A 1UD8A 2VDHA 4GUHA 2VCAA 2RUSA 3UETA 1GQNA 1SW3A 1UR3M 2QCEA 2AL2B 2ZXDA 1KFWA 3S42A 1YX1A 3M0KA 1JZ7A 4LYPA 1LL4A 3TU9A 1QXLA 1MW3A 2XSBA 3T2PA 3CMJA 1I1WA 3HPSA 4HZ6A 1FWCC 2DZSA 1UMLA 4C6DA 1Z69A 3T81A 2VI0A 1X6NA 2YCJA 3VOCA 2X1UA 4O11A 2F6UA 2D22A 1A5AA 1XLIA 3SQMA 1H62A 5JVLA 1GPWA 1XDLA 5G2WA 5BCAA 4UNLA 1AH4A 4AZCB 4H9YA 4R88A 3SFWA 1YTDA 1BAGA 3BZGA 3ORWA 1B54A 2J9ZA 3KTXA 1ZNNA 3CUFA 3UZWA 1WUEA 2PDPA 7REQB 1TQJA 1R3VA 2YFOA 3W28A 5FOOA 3JUGA 3MP5A 1KXHA 3W7OA 3OHIA 2Z1VA 5FAJA 3VE7A 3GC4A 4FLSA 2CLPA 3QVQA 4M5PA 4KS0A 1LQ2A 3WH5A 5TNVA 4D6JA 5E6YA 4RPPA 4JIEA 3VKDA 5E9AA 3S1UA 4HU3A 1AODA 2XVGA 3GH4A 2W61A 3OGSA 5BWFA 3TXVA 4HU0A 3LHWA 3PPCA 1TTPA 2G4JA 1KQYA 1OZQA 3ARRA 1XS2A 3QPZA 4JIPA 4XUGA 3B8TA 4U31A 3GDKA 4MPKA 1XLGA 3HPAA 1JAKA 3FV9A 4C7FA 2YCIX 1IZKA 4GX8A 1OCJA 1TWZA 1T99A 4ZQMA 7ODCA 2NQ5A 1JZ6A 5C9RA 1F6PA 4UMCA 2OGYA 1OC6A 3I4KA 2A5HA 3E5PA 3MZ2A 4YTUA 1TV7A 2ACSA 3EWUA 2J13A 1V7AA 2BHZA 3V5FA 1XYZA 1F5ZA 1YNYA 1PCKA 2XGZA 2JALA 6A3HA 2VKZG 2FTPA 2ZWZA 4CNOA 1VYSX 3E96A 1E51A 2GVYA 1SJAA 4IHCA 4WEVX 1L2UA 5DRIA 3IJLA 3PY2A 2OWXA 1Q85A 3BWWA 4JNZA 1L6FA 1EOMA 3H4WA 3H7RA 5FIPA 5F4SA 3OVQA 2WSQA 3SSJA 1GQLA 3BH4A 4OBSA 1EB3A 1XJBA 2W4XA 1WDSA 3MTWA 3M1ZA 3CUZA 4B90A 2DQXA 2NXGA 3BCDA 4LVDA 4ZE5A 2V3FA 2D1ZA 4KWWA 1F3EA 4L6HA 4L1WA 3CAKA 3TA6A 3CO8A 4J3VA 1F9CA 3GC5A 3VIHA 1UOZA 1EJUC 1R8LA 4CQAA 2AQVA 5EMJA 2IUZA 1VFMA 1XV8A 4X9YA 3EPOA 2QCDB 4MWAE 1J9YA 3MO4A 3UCDA 2P1FA 3TCEA 4QNEA 3PHAA 1ITCA 3XISA 4J7RA 2PWFA 1WDQA 3AJ7A 4PMUA 3FYYA 3TN6A 5C55A 2NVCA 3KCLA 4RDYA 4HIBA 3P62A 3URQA 4Z0JA 1RY8A 1ZJHA 4F48A 3EMQA 2FZDA 2OFJA 2DUAA 3T08A 4NXSA 5JIPA 1PZ1A 2E1DA 2FQIA 1V6TA 1UH2A 4RV3A 2GDVA 3RPMA 2WVTA 3NQEA 2BG5A 4ZXLA 1WOBA 2R9RA 4XBSA 3WNOA 4YTSA 2H6RA 3UW6A 3GIQA 4GXPA 4UQ9A 1W3JA 2QCFA 3RILA 4JTQA 3SR7A 4CD7A 5C8BB 4PULA 1EJSC 3IIOA 1AL8A 2BS9A 4N4QA 1TWIA 3LCXA 4MJZA 4AHQA 3WD0A 1J11A 4AYGA 1DV7A 2W6RA 5CJ5A 2Z1SA 2WSYA 4JQ3A 4J3SA 2R82A 1RZMA 2PTXA 4MWAC 1UD5A 1DBTA 4B9YA 2EG6A 3GU2A 3EX6A 1DJWA 3BOLA 4NZFA 1XG4A 1GYNA 1X39A 3CC1A 4PSRA 2Y5SA 4A8NA 1U1JA 2F9RA 1JI2A 4JZ5A 3GXTA 3GZ3A 3NOEA 3RCMA 1TV2A 2HVOA 2E8ZA 3MKVA 5CSYA 1DHPA 3FKRA 4P2VA 4IPNB 1HO1A 3MHUA 7CGTA 3T6CA 3QQ0A 4NL1A 3OLDA 5BNKA 1A0EA 3TN3A 5D03A 1P7TA 3GXDA 1VS1A 2BVWA 1HIZA 2PUZA 1CYGA 3HMJG 3T55A 4JX4A 1JF6A 3U3HA 1VRDA 4M6QA 3OVPA 2QHAA 2VHLA 5FJIA 3PG8A 4RNJA 1E6RA 2CYGA 1FHUA 2PBGA 4FX6M 3W7KA 3WLRA 3H2OA 3GSMA 3TTOA 2PWVA 3TYDA 4TTUA 2BGSA 3BJSA 1G6CA 2D3NA 3UR2A 3NYZA 4PB3A 3EZ4A 1A5MC 3BG5A 4ACZB 3B05A 4C65A 3NZRA 2E1WA 5GQBA 4J5NA 1OYCA 2R91A 5FF3A 4IP7A 5I79A 1EC8A 2BFGA 4X2RA 1K77A 4CEXC 3TUUA 1UQYA 1UZ1A 3VM7A 3QYQA 1UBPC 3N73A 2IKGA 4ENLA 6ENLA 4MSSA 4ZFMA 1K9DA 2QCHA 2X2YA 4L9YA 3QW3A 1Z44A 2R1PA 2VWTA 2VX7A 4GI9A 4R34A 5G4EA 3R2GA 1XLMA 4U3AA 4INFA 3L9CA 3MS8A 4EK7A 3BW4A 5LIXX 3QF0A 1CGVA 4JFWA 2BP1A 4IUGA 1LOQA 4L1GA 3W72A 4Z2JA 4EPBC 3PG9A 5DXXA 3TSDA 1I45A 4DELA 3KLKA 2PP3A 1W5PA 2XFRA 1CXKA 3PTMA 4FXSA 4ZO7A 4FOUA 2QNEA 4CN4A 1QHPA 3DESA 5JUVA 2P0IA 3W7IA 2OYMA 3KAOA 2BNJA 2OZTA 2R6OA 1UR0A 1MEIA 1PIFA 4RE4A 1XCFA 2P0OA 1NDZA 5D33A 4XZWA 3BICA 4X2PA 2OX4A 3UG3A 3WQOA 2CHRA 1XD0A 1BKHA 4LEFA 3CQHA 2C3ZA 1KB3A 5G5IA 3HTWA 3N34A 4GD0A 3N2OA 2IMRA 2A3LA 1PPIA 3O15A 5KZ6A 3LN3A 3WF3A 3TZNA 2Y63A 2BVYA 1U5JA 4N9DA 5EMKA 5IOBA 1VIWA 1IYXA 4C6PA 1WKFA 3OG3A 1IF2A 5CBJA 4DIAA 2DVTA 4KWVA 4M19A 3G8EA 5HNTA 3VKJA 1G5AA 4RDVA 4UFIA 3M0HA 2NUWA 3CQKA 3UY8A 1KM3A 1WZLA 1E1CA 3WK3A 3CAQA 4E8CA 2GK1B 3EOSA 1TJPA 2CITA 2CESA 2R8WA 3L4VA 3H54A 5REQA 1AW2A 3M7SA 2VC9A 3TTYA 5XINA 1H7OA 3S2CA 1ZP3A 3GG8A 5FJJA 1J0YA 4C6KA 4OBRA 3W07A 3IGHX 3PN8A 1EBHA 2CZVA 3DBPA 3EX2A 1NQKA 3UGVA 2C71A 1TRDA 2B7NA 5H8MA 4YN5A 1J4EA 3RO6A 3JRKA 3FHAA 2XH7A 3MUAA 3AIVA 1CT5A 3G77A 1HKMA 3QGAC 1Y7VA 2GSEA 3DFHA 1UHVA 2XIQA 3O2LA 4RW5A 4L65A 4WJ8A 3RNDA 3BG9A 4GI8A 1HGYA 3LBCA 3G0UA 1DYSA 2ZE3A 3TVAA 1ZS2A 5JIWA 3MBDA 4C1NA 1KV5A 1OBAA 1TPC1 2XHYA 1OFOA 1G1YA 3N12A 4W8LA 1NELA 1RY0A 1XFCA 2WMFA 3TMQA 4X63A 2PCEA 4KCTA 2NUYA 4CNSA 2CBIA 1EWDA 4J28A 1B57A 4NKCA 4DQWA 1NDYA 2DFAA 3MBFA 2GDQA 4QROA 1RJPA 4IPJA 4NRSA 3U5UA 2E0PA 2QUTA 1FWBC 3W1LA 2H9AB 2C7FA 3MDWA 1H2JA 2BOEX 2GSJA 3MANA 4BK9A 4NHVA 3THUA 4RK8A 1Q66A 1EQPA 1P5BA 3A4XA 5A8GA 2AGTA 5KETA 1OIFA 3ATYA 1GQKA 3UYIA 3W7MA 1ISVA 4RDWA 2CZ5A 3MHGA 1Q2RA 1QNVA 2FLIA 3AYTA 3OBKA 2OB3A 4FNTA 4KERA 6CGTA 3EDFA 1KXVA 2DZWA 3E2SA 3O6DA 4H8HA 2J24A 2GJNA 4L4LA 1XPYA 1MWOA 1CGTA 4O0KA 5ABFB 1FH8A 5LNWA 3FJ6A 5XIMA 2D0HA 5CG0A 2OXNA 3HGRA 2E9MA 4AF0B 5BXSA 1XYMA 1XC4A 3OA5A 1AJZA 5H8PA 2NZLA 4S3FA 2E8YA 2VX4A 3GC2A 2AMGA 5G1TA 2E4TA 1ZB5A 2W3ZA 2BGNE 4GMEA 4D6DA 3VXGA 3TWAA 1E9ZB 2PDMA 4GHRA 4ZL1A 4MB3A 4DJFA 1PTDA 5FI8A 2G3MA 9XIAA 4HYWA 1QI5A 3C3UA 3O3RA 3FA5A 3EDDA 1XCWA 4QBXA 2YXXA 1BRLA 3LCFA 3GNRA 1GUVA 1UKQA 1L0PA 5E93A 3MI2A 3FJ4A 4AIEA 4GUIA 1TV4A 3W82A 4HOWA 1DWAM 2VVSA 2PDNA 3LGEA 2FGBA 3GR4A 4ZO6A 1KBBA 4UOJA 5KZMA 3LEPA 1L9WA 4LV9A 2ZXAA 4QG6A 3AS2A 1K8ZA 1ELSA 4PCPA 3CUHA 2BB0A 1XH0A 5K4ZA 3LNMA 5AOUA 3M64A 3NVDA 2ZRWA 3CLMA 4LVGA 5LHEA 2Y1HA 2R1MA 1S5TA 3QV6A 3CL7A 1K6WA 4KPLA 3SBFA 3MCOA 1GNXA 1MW2A 4BA0A 2WMKA 1CDGA 1JCTA 1RPKA 1IT0A 1XYCA 3N2MA 4JN6A 2WANA 4P61A 5HNNA 4ES4A 3W26A 2OSYA 3FS2A 3W7NA 4RV8A 2OZ3A 1L2QA 1KTCA 1BFNA 4IL0A 5A6KA 3RR4A 2RDXA 4GABA 4H83A 2D73A 1CXLA 3WENA 4U2ZA 3M16A 4WSKA 1QW8A 3GTHA 4D72A 4PR4A 1HJVA 2VP8A 2YX0A 1I0BA 3D47A 5HNUA 3PUEA 2D24A 2NLYA 4NJJA 3S83A 3CAVA 1TJ1A 3WMCA 2Z4GA 1EFZA 1HT6A 3V3WA 1YDNA 2V69A 3AO0A 2WNNA 3R8GA 3LPFA 2W27A 3QZAA 3EA2A 3CPUA 2D69A 2PDGA 3UFYA 3MSGA 2EPMX 4JTCA 4L9XA 3G18A 2BHYA 3HFTA 4E4PA 4DF0A 2VX6A 2DVUA 2J75A 2XFYA 4GUJA 3WG6A 1BQCA 1UA7A 3GVVA 4FOKA 1FP9A 4AXKA 2Y24A 1VBGA 3W7LA 4CUCA 5IXEA 3GHSA 1PZ2A 3LCLA 1V08A 1TPUA 3D6NA 3URNA 1T6MA 4GQ0A 3UVAA 3VGDA 4B5SA 3AHZA 2VQTA 1JCXA 1B4EA 4NASA 2QJNA 2R1NA 5CJNA 4WHBA 3W3OA 4HK6A 4ONVA 1QJWA 1VBHA 3LCWA 1EIBA 1ZALA 1O5KA 2DZXA 1SMAA 2Q8ZA 2VDIA 4IX0A 4UTIA 2E25A 3KBJA 5B7YA 1SFTA 1HL8A 5CLTA 4NNAA 4UFLA 4DJED 3SY8A 4IIGA 2DIEA 1BPLB 1JQVA 1MO0A 1SR9A 2RDWA 1AW1A 4GH1A 5PTDA 1V51A 3N4AA 4O8RA 4QEHA 1QNRA 2FPTA 4CN6A 5EFFA 4D1JA 3NL2A 4ZGYA 4LAMA 2BOFX 5BXRA 5KZEA 3GXMA 2RDTA 1XFBA 3WSUA 3G5EA 3WLMA 1LLZA 1XM3A 4CCZA 4E4UA 1CGYA 1W3NA 5BOOA 2VTFA 1XIGA 1QW7A 2A21A 3SIZA 4I5XA 4HB7A 1M65A 3QV9A 2CCRA 3VKAA 4US5A 2VXNA 1DJYA 2WK2A 4IP5A 3U8GA 4PTDA 3ATZA 1V3LA 4JR5A 5LNSA 2GLKA 3T0CA 2WMIB 1T7LA 3I6RA 3PPHA 1RBAA 2V3EA 3L4XA 4QAWA 4EPDC 4MZYA 2OEMA 3N29A 3OA3A 3SCQA 3SB0A 8RUCA 1SJCA 1RVKA 4L4PA 3GFXA 4JQ2A 3CBWA 4IGMA 2DT2A 3ECQA 1V6UA 4L6DA 1PZ0A 3EWCA 1W3LA 1W3HA 4DF1A 4AZHA 1XYLA 1Y5VA 2A3CA 2V81A 2QR6A 2JFEX 3WMLA 3WBXA 4UUIA 2I5QA 3HURA 3ZVIA 7XIMA 3TW6A 1BSLA 3WNKA 2FZ8A 4IFOA 3AJXA 3DU0A 1BTCA 4TR9A 4MPQA 2QDHA 1V4YA 1EL3A 3LQLA 1XGZA 2IKJA 4LT9A 4LY8A 5CC5A 1UR1A 2CKRA 1QPQA 3VIKA 3NZGA 5G1YA 4PEEA 4XAFA 2FMNA 3ONCA 4C91A 3GAKA 1IE7C 1YBQB 3C61A 4OECA 2XTKA 3TX9A 1ZJAA 1FWHC 3UD6A 3T05A 3W6MA 3NOYA 3M0IA 5AVHA 1W3TA 4AD1A 1OADA 3PBYA 2QJHA 1HKVA 4UQEA 3GUWA 3FLUA 2PODA 2PCQA 2YLAA 2GUYA 9RUBA 2J7CA 4MFDA 4O1EA 5RUBA 4O53A 3CAWA 5GVJA 5LXXA 1V93A 1AFSA 2Z28A 3BLFA 1PSCA 3GY1A 3VX1A 5E1QA 1G69A 1GVFA 2OWWA 1OJXA 3GVRA 2OSXA 5C2XA 3DN5A 5I77A 2RKXA 1MQPA 2ZKMX 3C8NA 4D6FA 5AC8A 1KFLA 3NQDA 3WQCA 4FAMA 2Z27A 2PD9A 3SIMA 3C86A 1KCZA 2GQAA 3CTLA 3TA9A 4CQCA 1JDFA 2ZDSA 3CH9A 5FD0A 4AX6A 2GYIA 3WCZA 2P88A 4H9XA 2QUUA 3PVFA 4KFNA 2V9DA 1NARA 2FB3A 4V28A 1YNQA 3QFWA 1XIEA 4JPGA 3EDJA 3EKLA 4DYJA 2UY2A 1MFVA 4HPGA 2ZXQA 4PZVA 3SGGA 3ALFA 3UU0A 4C5YA 1GJUA 3OEXA 4HHHA 3F5JA 1Q3NA 5HQEA 3F2CA 4ICCX 1TTJA 1DWHM 3BO9A 1F61A 4OGZA 3KBSA 1Y5XA 3ARUA 3KOFA 4TU1A 3PPGA 3ARZA 4NAEA 1Q6LA 2QJGA 1JVNA 2INZA 3SCOA 3H21A 2NSXA 3AIRA 3VD9A 1N7KA 3M5XA 1LUCB 4HNUA 2XM2A 3KOZA 1E0VA 1EPXA 2E9BA 1YPXA 4TVUA 3RU8X 4J9JA 3FAXA 1QBAA 3CV1A 3MYPA 4LS1A 5CC6A 1JRCA 4ATDA 3RXZA 4Q6XA 1J01A 1Z48A 3SUWA 4ZMGA 1SUXA 1S5NA 4G6CA 4HA0A 5FEPA 4MY9A 2Q09A 4W4QA 3E2VA 3L2IA 4MMWA 5C6MA 2F61A 4B5WA 4DLMA 4Q8PA 4YYCA 5A69A 2VD8A 2G4FA 4PCFA 3SRKA 4S39A 2A0NA 3TKFA 4Z1CA 3WLLA 4D6HA 4ZO8A 2R14A 4AZCA 5LA0A 1WO2A 2VEKA 2MUCA 3P82A 1KFJA 2PZNA 4NSBA 3TR2A 3KRBA 2VFGA 2OODA 3EWYA 2DW6A 2DUZA 7REQA 2PC4A 5A8MA 4O28A 3UQNA 3FCPA 3PTDA 3VGFA 2QXWA 3DEQA 1UA3A 2QULA 5BOFA 2MNRA 1TIWA 1RAKA 1WKDA 4N0RA 1ITQA 3SJNA 3B8VA 4JX6A 4KMQA 2JKEA 2VNCA 3MSYA 1MEHA 4LRTA 3D3AA 1DXFA 4BJHA 4AHOA 1FWAC 1I2RA 1XCXA 3JVAA 3IUIA 1EWEA 4I5RA 4CU8A 1IXNA 3FEQA 3IAPA 1EBGA 2FTYA 3T78A 1EP3A 4JN7A 2J7DA 4P8WA 4I8YA 1U83A 4AZIA 2ZRXA 4P8UA 3T42A 3ZJKA 4LUYA 3KLLA 4JHOA 5J8LA 4CVUA 2C1HA 3W2LA 3O8AA 2V2HA 1KKRA 3UNDA 5A5WA 5JH2A 3RDKA 4BCEA 2FPVA 3GNDA 1UKSA 3P6LA 2I14A 3GU9A 3VGGA 3PZUA 1M03A 4YU1A 3UWZA 4GPNA 3NQFA 4WCJA 1D8CA 4DRSA 2A7RA 1V5XA 3JZUA 2F6KA 1I75A 3EOLA 5BRQA 4WOQA 2CERA 3TJLA 4W5ZA 1Q6QA 3CWNA 3B0XA 3IANA 1GOWA 3GIYA 1PX4A 2WHKA 4O14A 4XKMA 3A4AA 2VGFA 3HV9A 4UWMA 2RAGA 3WNMA 1E3XA 4YS1A 4LTSA 1O1ZA 3W1PA 3ZO9A 2XIOA 4K39A 2VEFA 3BLEA 3TQPA 1I2NA 1KM2A 3DGBA 2VDGA 1HJUA 1Z9AA 4RUBA 5DCBA 2LLEA 3EOEA 1W1B1 1GPFA 3DYMA 3FJNA 3SCWA 3AZRA 3G22A 1GJPA 2OKTA 1D2KA 3F5LA 4WDXA 4Z1DA 1YNPA 2FJUB 2HQAA 3CV6A 3K13A 1VFSA 2QCDA 4PMRA 4KRTA 1PS9A 1OIMA 3VOGA 3QN3A 4E38A 4KFOA 2ZX5A 2NWSA 3WY1A 1TPH1 2BGQA 3QGVA 2DSVA 4L61A 2E67A 1XLHA 3MCMA 5AHLA 2J6VA 3PJWA 3SECA 5EBAA 1S2UA 1AD4A 4CU7A 3G2GA 3IJ8A 4IIFA 4PSPA 3ITTA 4URIA 2P10A 2XN0A 2Z1KA 5KTLA 3P61A 3S6DA 3WK1A 4DUVA 1OCNA 3PFRA 1S2TA 1WA3A 2XYLA 4NF7A 3AROA 4QE1A 4L7ZA 4QEEA 3BQ5A 4AG0A 3E6EA 3M4HA 1P0EA 3QHNA 1GCYA 3ARYA 3I3EA 4NJKA 2BMBA 1VFFA 1A3WA 4LUIA 4GJIA 3H4GA 5AY7A 3R5EA 4NAFB 4XZHA 5ENLA 4PUWA 3U2CA 2NUXA 3G1RA 5D9PA 2FYMA 1SFJA 1E55A 3HJEA 4UR8A 3TWBA 4UFJA 4JFSA 4Q32A 8XIMA 3NCOA 2HVMA 3U2ZA 3KWSA 3PUGA 3IK2A 5EB8A 1O7AA 4HTBA 4F79A 2VFEA 1DVJA 4BWLC 4LAKA 4W89A 3O06A 4XVEA 1H51A 1OG0A 3TK7A 4DZ5A 1SYTA 4QM1A 9XIMA 2W67A 3MHFA 3QC3A 1KD0A 2EGZA 4GLEA 3VOFA 2X0SA 1T5AA 1V3MA 3W1NA 1R3TA 3NIYA 3M0LA 2C1GA 2YOCA 1J79A 5AKQA 2J6XA 3V75A 2GQ3A 3BANA 4M51A 1KM0A 3ITGA 3P74A 4JQ1A 4IFRA 4H8UA 3NURA 1FFQA 5J5DA 3UJRA 4H8VA 1YADA 1D7KA 2WWDA 4H1ZA 1ZENA 2PDHA 5GPRA 4ROPA 4XTIA 5LA2A 5I0DA 2EJAA 3B0VC 4C1LA 3W85A 3SCVA 1AW5A 1H7PA 3VDHA 2ZZ1A 3TAOA 5A6LA 3C2FA 3MWAA 5DFAA 4C60A 6PTDA 5G2HA 3PSWA 3AHYA 2VGIA 1NOUA 4AYSA 4LCSA 3S1GA 2FZNA 1X8FA 3OIHA 2BVTA 1WDRA 2WHMA 2PPGA 2VCBA 1WXYA 4ACZA 4IJCA 1W6TA 3WH8A 3C0JA 3OG2A 1FWRA 2YDQA 3GDLA 4HNTA 2EPHA 2WOQA 3W7EA 2NQ9A 1EDGA 4C5ZA 3MT1A 3W73A 4FF7A 1UPPA 4IQJA 5FJOA 3W84A 1EUNA 1TJRA 4GG9A 3GTFA 4UTUA 3W4RA 1GZ1A 1ISYA 4P7QA 4QNWA 3AHXA 4N6FA 3P2VA 3MV01 4Q8WA 3UZ5A 2OU4A 3VUPA 3V1PA 3E1F1 4J3TA 3QTPA 5LSMA 3RIKA 1FWJC 1QHOA 2WB5A 3RLGA 3W38A 1FXQA 1I8JA 3NR0A 6TIMA 3K30A 2DY3A 1I4NA 4LCQA 4AB4A 3ITOA 2OOFA 5F2GA 1UR2A 4J3XA 3C2RA 1CX9A 2L5HA 1YXYA 1CEOA 2QQ6A 4HGXA 3B0PA 3QKZA 2QUVA 2G96A 3I68A 3BW2A 5CAHA 3OHMB 1MNZA 1KC7A 3L66A 3WQVA 5M3WA 3W88A 4RE0A 1OF6A 5LYRA 2J7FA 4FP1A 2O9OA 4B15A 4M81A 1RH9A 5GNXA 1YW1A 1NTHA 3W24A 3GX9A 1CTNA 5U7SA 1XX1A 2H3DA 1FH9A 4XISA 3C2EA 3TC6A 4Y9AA 4Q4QA 4UTLA 2AL1A 1J18A 1B9ZA 4ZB2A 1WX0A 3S2MA 1KFKA 3WDRA 1SSGA 5HWNA 5CBIA 1FWTA 7A3HA 2VOMA 4TX9A 1KWKA 5AN7A 4UTHA 1Q6EA 3CHVA 4DBSA 3O0FA 4LXFA 2D2OA 3QKEA 1HKWA 3GQYA 5A6AA 2BV9A 3K1DA 5C71A 4EWJA 3CWOX 3IJ6A 1VBUA 2J4GA 3UF9A 1BF6A 2CW6A 1QNPA 3BVJA 2RGMA 4IJRA 4CNUA 1TG7A 1VENA 4AC7C 4EANA 1ZLPA 1EX1A 5FJUA 2V3GA 1IXQA 1K3UA 1VPQA 2HPMA 3MV11 2WNZA 3NPWA 1R85A 2FZ9A 4GNVA 2CXGA 1TX0A 1W56A 2XIBA 4ZXOA 1K8CA 1F3TA 3KRUA 1XKJA 2E9LA 1A0CA 3OO2A 5HPCA 5HMSA 5J04A 2WNWA 4BQ4A 2G3NA 3G6MA 1NF0A 2O9TA 1AMYA 1K8XA 3COTA 4DLFA 3AYRA 2QCNA 2ZUUA 3W23A 5LGXA 3PZVA 3MO7A 2J7EA 5CPSA 3R25A 2XGIA 3LCIA 5CPMA 3NDOA 5A8NA 3UZJA 1H09A 1OQFA 3GFYA 1QCWA 5AHFA 4GISA 5CCZA 1PCWA 4XV0A 5AC6A 2XINA 1KQZA 5CXPA 3OJGA 4HA1A 3EYPA 2H9AA 5CC7A 1W32A 1XXXA 1X7IA 4BEQA 1OWQA 5C2CA 1ZUAX 3DFPA 3KXQA 1B3XA 3EWWA 4JX5A 6REQB 4JKKA 4FMVA 3WLQA 1UH3A 4JTRA 2O4MA 1O95A 2AKZA 3UZYA 1ZCOA 3NXFA 5AECA 4IF2A 4JN8A 2JKAA 2Y61A 5I3FA 2WMHA 4DWSC 4UTTA 3SDOA 3UR7A 1QDSA 3VCRA 2I5GA 3EWXA 3IWPA 3ITXA 3W27A 3SCNA 4R7WA 4C6LA 2D0GA 1W37A 4S2BA 1IEIA 5D30A 1K7EA 4O1CA 3I3DA 2PWHA 1XIIA 4DAIA 4R53A 1U22A 1JYXA 4W9TA 4RW3A 2IW0A 1JFHA 4O18A 2WJZA 4Y8EA 5ABFA 5K9DA 4GQBA 2AAMA 1R5YA 3EKZA 1X7FA 4J35A 3B8IA 4PEKA 1CW2A 2VMFA 2X09A 1VHNA 4PFHA 5BW6A 1P1MA 3CASA 3N13A 4AF0A 4UB9A 2CLEA 4QE4A 3QM3A 5CPTA 2WQDA 1H5YA 2FFIA 4BQ2A 3GH7A 2FHBA 3VMPA 1Z41A 1GOIA 2QVHA 2H8XA 3E49A 3W0KA 4O57A 1XIJA 2V0TA 1NSJA 3H24A 2DSZA 2DT3A 4PL1A 3KVLA 1J8VA 1TCMA 5BRBA 2XH4A 2J8FA 1M7PA 5C5YA 3FN9A 2E3ZA 2C15A 1G4PA 3NTYA 3WDQA 2PLMA 3NQBA 4WGXA 2OR2A 2PMQA 1W1PA 2I17A 4PMDA 1VBJA 2O0TA 4JTFA 3F1QA 3LZ5A 3WLOA 1B3OA 4H2CA 3E0IA 1H1NA 1QI4A 1PXGA 3OYXA 1LBFA 4BZYA 3LHVA 2HMCA 4S3CA 3ZLGA 1QWGA 1HP5A 4LVFA 3PTKA 3T2QA 3UG8A 2VZSA 3M47A 4OOZA 3LENA 4FS9A 4AWSA 1I6NA 2YB1A 4RXGA 1OD8A 5U4NA 1UP2A 3AFBA 4H6QA 3PNZA 2D0FA 2IPFA 4LS0A 2ZCGA 3U48A 1TKKA 1BSIA 1NVMA 2WSKA 4A35A 2CZFA 3A9IA 3KX6A 3BSGA 2BHUA 1OVDA 4POCA 2YXGA 2ZUSA 3G1SA 1JGIA 3LXAA 4NVTA 1UR4A 1OC7A 3AICA 5I03A 1H61A 1DXIA 1ITXA 1NFBA 3BAYA 4H7VA 3WMBA 4LB3A 4E8GA 3RPTA 2D20A 3QJAA 4IQDA 3ZWTA 3EMCA 1GYMA 2FIQA 3K8MA 3GZAA 3O7UA 4FNPA 2XISA 3MUIA 3UXKA 1HJQA 3IIXA 4C6CA 3UXDA 1CIUA 2OJPA 1JNEA 3FAWA 3MP3A 3VD4A 1YDVA 4HT3A 4L56A 2ZADA 1AG1O 3TJ4A 1AH3A 4LC8A 5IBXA 3PJXA 4BI6A 4R3UA 2IKIA 4HYRA 3U4FA 4GYFA 4IH3A 2YL9A 2OQHA 4UOQA 4C7GA 4JAWA 3EOUA 1O66A 1I2QA 1PTAA 4ML4A 1VR6A 2O7QA 4U33A 1QHZA 1VYPX 1E0UA 5JH1A 4A8RA 1WKYA 4J2MA 1OM0A 4V27A 5CSRA 4MNLA 1OABA 3N17A 3QMRA 3TC3A 3HF3A 4YWIA 2PF0A 1WOAA 4KWSA 2GSHA 3QR1A 4ZTYA 3R4IA 4XX6A 3KCOA 3GHTA 3GDTA 4Y9NA 2YYTA 1IV8A 4IIBA 1SU5A 1VLIA 3RPDA 1X38A 1KGWA 1H7XA 1OB0A 4GH3A 1IEXA 2C19A 3VU2A 4LF1A 4D71A 3DHDA 1OT2A 3WX7A 4GRSA 4MUZA 3GNNA 2VVNA 2J7BA 1MFUA 1E40A 4AIOA 3RX2A 1GOOA 1J10A 4RKAA 2QPUA 3GR8A 1JNDA 3B9OA 3L21A 3VNZA 1MXDA 3U5YA 4KH2A 3N2CA 2ATSA 1M1BA 3TQKA 2QJIA 3SUVA 3QQ1A 2PDYA 3R43A 2VOTA 1BF2A 3MW7A 3F5KA 3GVGA 1W9UA 3I6TA 2QDDA 3NZPA 1US3A 1XF0A 4UIOA 4JIQA 1K1DA 1XYFA 1VC4A 2Y5EA 2XG9A 4OV9A 4I7UA 2KZHA 2OX1A 2QW5A 3O63A 4DY1A 1KXTA 3SJ3A 1VPXA 4AY1A 3K5XA 4Z08A 3Q94A 1VLWA 2WMIA 5DXYA 2NX3A 4S3JA 2OLSA 3GR7A 1KTNA 4S3BA 2VR2A 3CK5A 1MRAA 3BTNA 1J2WA 2CZEA 1EJTC 3D46A 4XIMA 4FLRA 4KIRA 1TCDA 3GU1A 3S6TA 3O16A 2B31A 4Z0SA 2XPKA 1A5LC 1BXNA 3EEZA 3G24A 2YXOA 2J9YA 4XUYA 1T40A 7TAAA 2VX5A 3V1HA 3HGSA 1NM9A 4PCTA 1H7RA 2V5DA 3KP1A 2A79A 3PFMA 1E5NA 1E6ZA 3R6IA 4P7RA 5HMEA 4DB7A 4CVWA 3W7HA 3GNXA 5EMMA 5FACA 3VFCA 3G1HA 3TSMA 3LMZA 4I7WA 5CPQA 3LCGA 1CB2A 4HU8A 3C2OA 1Z32X 1BGAA 2JEPA 3LSCA 1V6WA 3WFZA 2QMKA 1P4CA 2WZIA 3HG2A 3SUUA 1CBGA 3MQTA 2EPOA 1CLVA 4PTVA 2GZXA 1JDCA 4IMFA 1H1ZA 3UERA 3L68A 1W1YA 1HQTA 3U0HA 3N9KA 1SVDA 1R7OA 1W0MA 2YFNA 4K36A 1PWLA 3WNNA 2ZRZA 3WLNA 3AIQA 3CNYA 1YBQA 4IMGA 2QIIA 4DXVA 2ACRA 4MB5A 4CKQA 3H2NA 4U4MA 4RNFA 2HV5A 4GIAA 4LU0A 1OX4B 4UFKA 1SGJA 1MUMA 4LALA 1JUBA 3WBEA 2CFFA 3A4JA 4LNYA 4DUXA 1R3SA 3L5MA 2WMJA 3GXIA 4K1GA 2UZ9A 2OO0A 4M1BA 4R27A 1UUMA 1WQ5A 3IEBA 3N9SA 3KFTA 4H2HA 1D8WA 2XVLA 4GNKB 4XZIA 2QCMA 1DL3A 4AZ5A 5I6SA 2QF7A 1E5JA 3NQGA 4O4WA 3K4WA 4ACYA 2VC5A 3LXBA 1PKMA 2DJLA 2PRMA 1GONA 3EX4A 2TODA 3QFEA 5GJPA 2EQDA 1LL6A 1DJZA 1EDTA 2ISWA 1JGMA 5L9FA 2QLYA 1VJIA 4Q4RA 5CPLA 4K2SA 3C6CA 4XAYA 3WK2A 3IJDA 4RCXA 2HJPA 3WLSA 4WOZA 5DY3A 1GG0A 3IACA 3UZZA 3POCA 1QK2A 1NFGA 3P5ZA 3W2KA 3OBAA 3G1YA 4JYDA 1WP6A 2NX9A 3OVRA 4LAUA 4JTIA 4IOTA 4DJEA 5ABHA 2DZAA 4LVAA 3CQJA 2VD9A 4OJYA 2A2IA 4S38A 2WMGA 2X1SA 4AZ6A 4XBKA 2Z29A 2DZVA 4NXKA 3PANA 3NAVA 4NUWA 3NSNA 4MLJA 4QR6A 3VD5A 4IQLA 1E9IA 4PCNA 3TTEA 1BVZA 1ADSA 1XUUA 3ZJ7A 2WJEA 4ZODA 4JTAA 5FKYA 1BVNP 3G1FA 5CBBA 5HAOA 1VHCA 4WDUA 3ARXA 1VRXA 1JYWA 4AU0A 1EF2A 4W7VA 5AFDA 3BDKA 3TR9A 5KITA 1PKNA 1FHVA 1TUFA 3NDYA 3BE7A 3LBOA 3LTYA 2PA6A 1R87A 1LUCA 4FF5A 2FJKA 3AS3A 4R9XA 2QDEA 1UMYA 1O4UA 4BI5A 4RE2A 5A8QA 2VGGA 4EPKA 3PWIA 4DZIA 3HQOA 1QR7A 3O0KA 4HZMA 3K4DA 5HOSA 1U2YA 1FKXA 3UPWA 3NNTA 1DWIM 1QOXA 2RGLA 3LX9A 1AL7A 4PB4A 4ILSA 1T96A 3WELA 1UKTA 1E15A 2RH9A 4D1IA 3AI0A 3P81A 4F0KA 4B3ZA 4KQNA 2GJXB 4UR9A 3P14A 3WLJA 1EOKA 2PU0A 3PZMA 2D3LA 4HQVA 3A47A 4UXDA 3S2LA 1A5UA 3A22A 5HNRA 5F7UA 3VD7A 2CKSA 1THFD 3MU7A 2BBFA 5A6MA 4E3VA 5I24A 1GVSA 3IUHA 4GYJA 1HJXA 2XM1A 4MTVA 1A0DA 3LG3A 3NGFA 5FEZA 3EPMA 3NL3A 4MM1A 2OO6A 2F7FA 2FVMA 1FRBA 2IPWA 4F2TA 4HYVA 3TIMA 4DWSD 7ENLA 3DI1A 3OU8A 1J0JA 3GRIA 3DENA 2BWGA 7TIMA 1E4IA 2QUNA 1GKPA 3AHVA 3VD3A 3WFLA 4B4HA 1B31A 1MVYA 4W93A 3AZTA 2UV8G 4PYSA 1J6OA 1BLIA 4LV4A 5CZ0A 1D3HA 5G4HC