3RU6A

1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
228
structure length
220
Chain Sequence
AMKLCVALDLSTKEECLQLAKELKNLDIWLKVGLRAYLRDGFKFIEELKKVDDFKIFLDLKFHDIPNTMADACEEVSKLGVDMINIHASAGKIAIQEVMTRLSKFSKRPLVLAVSALTSFDEENFFSIYRQKIEEAVINFSKISYENGLDGMVCSVFESKKIKEHTSSNFLTLTPGIRPFGVANLAMARENLSDYIVVGRPIYKNENPRAVCEKILNKIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.8 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrF) from Campylobacter jejuni subsp. jejuni NCTC 11168
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 80
structure length 220
sequence length 228
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ru6A00
4UTTC 3BW2A 1NFBA 5BRBA 3QM3A 1B3OA 4ZMGA 1OFOA 4UMAA 1OK4A 1ME8A 3LERA 2E5BA 3KHJA 2BLEA 3SIZA 1JCLA 4O13A 3MBDA 4IX2A 2UV8G 3R2GA 1F76A 1QWGA 3W7CA 4OT7A 2V8ZA 3BG3A 4LC6A 4FIQA 2WOQA 3RFAA 3HG2A 4XTDA 1TV7A 4FXRA 4FNRA 5ABTA 2CLOA 2QDHA 3P67A 4KFNA 3IVUA 1I2NA 2VFEA 2XN2A 3CEPA 1VCGA 2Y6ZA 2GQAA 3HG5A 3U2OA 2D73A 2NX9A 1YTDA 4LS0A 3H53A 4AH7A 5F1VA 2QCDA 4JTHA 3KVMA 3TFCA 1VLIA 5LZLA 1RD5A 1TCDA 4OWGA 4JXCA 3QQ0A 3G0XA 4WQ6A 1EUNA 3M9YA 4HHPA 4NZFA 2QCDB 2NLIA 1EB3A 3S5OA 3T78A 3W2LA 3V1PA 2Y7FA 1TPFA 3HG3A 1KTBA 3L9CA 4S1FA 3S5ZA 3W86A 5G2HA 1FCUA 3JS3A 4R53A 4TO8A 3S6DA 2AQWA 1KFLA 4AHPA 3EX2A 1QMLA 4JICA 5F4SA 2WSQA 4MOZA 3M0ZA 4MVAA 4AWSA 4O0KA 4AHOA 1SFLA 1X8FA 3L21A 1WOBA 3NPWA 3G1YA 3GIYA 3FYOA 3G1DA 3PAJA 4S2BA 1P5BA 5KSWA 5C55A 1G69A 2H3BA 3DKLA 1UJPA 2OMAA 1GPWA 4DELA 2QDGA 1TIMA 1R2SA 3A21A 4RV8A 3PM6A 3OVPA 3ABOA 4HNNA 5A8GA 3P62A 3TC7A 4TIMA 2NV1A 3S1UA 4JNMA 4HSOA 4O54A 1QPNA 2H8XA 3SGUA 1TPWA 4O28A 5K9CA 3G1HA 3OVQA 4OE7A 2V2DA 2JKAA 2QR6A 4OGZA 4CQ8A 1H5YA 1L6WA 1ZCOA 3WJYA 5H91A 4O15A 3DZ1A 2V30A 1PHWA 5E0KA 3CM4A 1PHQA 5DN1A 2HSAA 4H6KA 3T4CA 4DO4A 4BFAA 1HO1A 1T96A 4K8HA 4N9EA 2FIQA 4RK8A 1H50A 4O1BA 5LNRA 3PBWA 3ELFA 1QNVA 2BSLA 2CZDA 3NVTA 3TA6A 3DKJA 1OX6A 1JCNA 4RXFA 1OYAA 3TX9A 1PS9A 4ADSA 3Q94A 1A50A 1AW5A 2ATSA 4N6FA 3TW6A 2ZYFA 5CPMA 3SGZA 2W79A 3W2MA 4UTTA 3QQ1A 3RLVA 3M5YA 1W5OA 3GDTA 4O17A 5DCDA 4N4QA 3EX3A 2OT0A 3DBPA 4JTJA 3QJAA 3LXCA 3N2XA 5DY3A 1IXNA 1VRDA 5FESA 1TTIA 2RHGA 3MJYA 3QFEA 4NNBA 2Q8ZA 3ZFHA 2C1HA 4LUJA 1RQBA 1W31A 3IIZA 1ME7A 4FXSA 3G1AA 4LWWA 4N9DA 1C8VA 2J6XA 5I3IA 1T0OA 4UTMA 3P5YA 1KM4A 3GB6A 1FUYA 1LBMA 3PY2A 1SW3A 2NWSA 1XFBA 3MO7A 3HGOA 4K36A 4FEZA 4U28A 1YDVA 5T26A 1W5QA 5D33A 1LBFA 3E49A 4BF9A 2IQTA 3ZWSA 4TMBA 5HWMA 1RVGA 1Q3NA 1OG0A 3C6CA 3EWZA 5TIMA 4M5PA 3LOTA 1W5PA 1IF2A 4UNLA 3UPBA 5J5DA 4EVZA 4X2RA 1HO4A 4C1LA 1ZALA 3OIXA 1LM1A 3IV3A 4IXHA 1L6YA 2QCFA 2DZSA 3CC1A 5FEXA 1P0KA 1ICQA 2ISSA 2E6FA 4O16A 2VENA 4CQ9A 4GE8A 4NT0A 2YPIA 4PH6A 4O57A 3QSTA 3W72A 3EKZA 2PC4A 4WOQA 1E51A 1JUEA 3LB0A 1B4EA 5FF4A 1MEHA 3IGXA 4UFIA 3WK0A 4NX0A 2DORA 3CWOX 1I45A 2DU2A 4FF7A 1M5WA 1Z48A 1I2PA 5DCBA 2NXGA 2ZZ5A 3CT7A 2ZZ7A 4CNNA 4NXSA 1TYGA 2H90A 3GDKA 2RH9A 2RDTA 3TKFA 5FF7A 3PUOA 1FCVA 1KA9F 3G1SA 2TRSA 1S5VA 2YZRA 1L9WA 3IIXA 3FKKA 4DO5A 3KRSA 1TPDA 1O94A 1DOSA 4R34A 4PC8A 1EEPA 5AB3A 1EP3A 4JDYA 4KWVA 4Q4KA 4UTUA 4OHQA 3TSMA 4RZ4A 4DF2A 3HGSA 1GG1A 3M44A 1TJRA 2Y62A 3M41A 3NL3A 3C2VA 4DBDA 4UTHA 4TX9A 4ZZ9A 4O4WA 3CHVA 3ZWTA 3HO8A 2J9ZA 1SFJA 3M7WA 5HULA 3PG9A 1SO4A 3HB9A 3TMLA 3W1AA 4O52A 1ME9A 2BTMA 4JTEA 4OBTA 4UXDA 2XN0A 1Q6RA 4JS3A 1CX9A 4QJ1A 4GUHA 3NL5A 4LC8A 4OV9A 3RLUA 1UASA 1NF0A 2DZTA 1FWWA 4FNPA 5D32A 3NQ7A 3FA5A 2ZA1A 4PTNA 2XN1A 1ICPA 1W37A 3GDMA 2CLKA 4YL2A 2ZZ3A 3WK2A 1VZWA 3RU6A 2QCMA 1LDCA 1JCXA 3TJXA 4JYDA 4FHAA 3P7YA 1DV7A 1WX0A 3Q2DA 4TR9A 1FWNA 4ADUA 4L4MA 4DBEA 3LTSA 4EF8A 3CLMA 4JX4A 5AYZA 1K02A 3A22A 1TPB1 1MEWA 5DCEA 3B0UX 2DJLA 2WQPA 4KFPA 1JCYA 3E0IA 3SR7A 4EWND 1OHLA 3LRLA 2A0NA 4MZ1A 3JRKA 3OVRA 2C13A 3L66A 3LHUA 3MHFA 5HR6A 1H7XA 1RR2A 1JULA 3W1XA 5K7JA 4LUIA 4IJBA 2VEIA 1O5XA 1WXJA 1YXDA 4POCA 1OFAA 2PRLA 4CCEA 5CPLA 5AC8A 4GUIA 3Q58A 4X9SA 2WSRA 3FKRA 3NPVA 4OV4A 2Z6IA 5G2WA 3PF3A 5L6UA 4GRSA 3STGA 1ZNNA 5CPOA 1GVFA 1YXYA 3DHFA 2JBMA 1H61A 1KBIA 2R91A 3LV6A 1M7PA 1XKYA 1LOQA 4QIUA 1T99A 1N7KA 3W7JA 4YWIA 4GJ1A 1HG3A 4IXXA 3NPUA 2EAWA 3VKJA 4O18A 3NYZA 3LCHA 4Y9AA 3N19B 1O95A 4DF1A 5HMSA 8TIMA 3KRUA 4IPIA 3NNTA 2C14A 1J2WA 3RNDA 1EP2A 3W74A 1VYRA 1OFDA 4NX5A 2HS6A 3W1QA 3O05A 1BWLA 2ABBA 2GQ9A 4O11A 4PEKA 5LGZA 1DBTA 5AHMA 4QNEA 1AG1O 1EWDA 2ALDA 3L5MA 4JGDA 2X1RA 2Z1BA 2GOUA 4ZQPA 1A5AA 1RV8A 3I7SA 1RQHA 3CIXA 5CSSA 1H7WA 3V75A 3HG4A 5AHNA 1Q6LA 1L2UA 3QF0A 3L5LA 4K6AA 2ZZ4A 2V2HA 1GEQA 3S1WA 5AC6A 4NJHA 3LTPA 4MKNA 3PSWA 1XBVA 2CLHA 3AO0A 3PB0A 1FDYA 3NM1A 4GXMA 3M16A 1UUMA 2V5LA 4Y96A 2ISVA 3GNDA 4AWUA 1TPVA 1OFRA 2QUTA 4P61A 3NM3A 5E1QA 4BI7A 4MZ8A 1GG0A 3A24A 1N55A 1B57A 2JK2A 3PC0A 2J9YA 3MYPA 1LORA 4YCOA 5MHBA 1NAL1 3R89A 1KV8A 5BNKA 2OJPA 3SW6A 5BW6A 3IVTA 5AHIA 2FPYA 5CGQA 4FIRA 5C5YA 1QO2A 4MY1A 3BK0A 4A2SA 3N14A 5C2XA 5LHFA 4YCPA 3TUUA 1AMKA 3GAYA 3VE9A 1NVMA 1OYCA 2C15A 1QPOA 1W5MA 6TIMA 1W54A 3QPYA 3LCWA 3LHWA 3GKFA 1A5SA 3LM7A 3EWBX 4UMCA 2E5CA 4Z0JA 2F7FA 2Y70A 4XBSA 2GPTA 1QDSA 4IX0A 3GAKA 1KM1A 1Z41A 3O16A 4KWWA 3W7EA 4BI6A 4XKYB 2X2GA 2ATMA 1ZAIA 1W3NA 2ZBTA 1KM3A 4AVFA 1TQJA 2CW6A 3PVFA 3W6YA 1FDJA 3F03K 4LW7A 3O1NA 2B7PA 4JR5A 3N34A 3DI0A 1I4NA 1F74A 3MWAA 1G6CA 5KZDA 4HIBA 3GXPA 2ZTKA 3OG3A 4HPJA 2EKCA 1H62A 3TC6A 4N2YA 1JRBA 3B8DA 4XQ6A 3B06A 1NF7A 1MXSA 3BW4A 3UWWA 3BARA 4NZJA 3R13A 2JGYA 2A6NA 3L2IA 4NJGA 4O50A 4UC5A 3QMSA 4MYXA 3NEVA 2Y85A 2Z2UA 3S0CA 2CZFA 4AF0B 3TH6A 2DZPA 1SU5A 2E1DA 1SO6A 2VC6A 4M6VA 1TJPA 2BXVA 3L0GA 4PODA 3M5ZA 1QOPA 4PCFA 3NQMA 1O5KA 2J27A 4H3DA 5D37A 2X1UA 2ZZ1A 3GXNA 2GVGA 2ZFAA 2ZRXA 3QW4B 4YMZA 4RKAA 3W70A 3B0PA 1XL9A 4BI5A 4O14A 2FQIA 1F73A 1SZEA 5BMWA 3PSVA 3ABSA 2HTMA 1YDNA 1YDOA 3W1MA 4LVFA 4N4PA 3W7KA 3W7PA 2X16A 3N2MA 1TMHA 4WX2A 2A1YA 2C3ZA 3TXZA 4K7YA 2GVJA 2H8ZA 1K03A 3U8GA 3C4UA 4JX5A 2RDUA 1Q6QA 4B5NA 4EOUA 5K9DA 5LNSA 4A3UA 4FB7A 1LCOA 2GJLA 3M6YA 1EX5A 3G3MA 3HGRA 3LHTA 5EA9A 1IIHA 1D3GA 4O1DA 1ZAJA 2YDAA 3P61A 4S2CA 4UTWC 1YPIA 1JJKA 2CLMA 3W83A 3LCGA 3DU0A 3SFKA 1SR9A 4H4IA 3GDLA 1S5TA 3B03A 1RQEA 1OX5A 4ZQRA 2V82A 4O1CA 5FEPA 3RF9A 2F84A 3WJWA 1H7RA 1HFBA 1OFPA 1XUZA 2PE4A 3IIPA 3OA3A 2NXHA 2DZVA 4K38A 1VQTA 4DF0A 2DP3A 1TSIA 4NVTA 2NX1A 5EPDA 3W07A 2YSWA 3TSBA 2BX7A 1LZOA 4XTIA 3TROA 2C18A 3KOFA 5D30A 2EHHA 4P2VA 3HIJA 4RLIA 4K39A 1G7UA 1M7OA 4IGHA 3ZS4A 1QCWA 2VFDA 1FXPA 5D2YA 1VLWA 3SECA 1D3HA 1K8YA 3I68A 1DHPA 3B05A 3UNDA 2YW4A 5G2IA 4LY8A 4OU1A 4N6EA 4RZ6A 3NOEA 2A5HA 3HPZA 3RMJA 1QO5A 3R5EA 3SY5A 3EWUA 3NQFA 2QCNA 5AHFA 1MSSA 3UWZA 4ALDA 3G24A 3TMQA 1U83A 1S3HA 3L65A 2ZA3A 4PFMA 4DPQA 1VH7A 1WDWA 1SZGA 3W87A 3TIMA 4JYEA 3O6CA 4MLRA 1OX4A 3P82A 3C52A 2Y61A 1S5WA 4I7VA 3W23A 4IPJA 1FCQA 5KZEA 1GT8A 2E68A 2VEKA 1H1YA 1G4SA 3STCA 5K2ZA 5EBUA 3KX6A 3NQGA 4O8RA 3O06A 1PL9A 3L5AA 1KFEA 5CZTA 5U7SA 1KFCA 4ICNA 3I6RA 3GYEA 4UR8A 5EL1A 3IIOA 3C0JA 1PV8A 4JTKA 1JUBA 1W1ZA 2CLEA 3I7RA 4GUFA 3LHZA 5C6MA 1KFBA 1WOAA 1X7FA 3HMJG 4QISA 5HINA 3ANYA 3L68A 3NQ8A 3I7QA 4Z1AA 1WA3A 3GK0A 4FNTA 2ZRVA 3G8RA 2ZDRA 4CQAA 1TQXA 3DFOA 3W1RA 5KMYA 5I3JA 1PCKA 3EXSA 1TPH1 2TPSA 2WNNA 3KRZA 2GQ8A 1FCBA 2FFCA 5IBXA 3F4NA 4WXYA 1HUVA 4O1AA 1W5NA 2V0TA 3P8IA 5G4WA 4D2JA 4TMCA 4UTJA 2QF7A 4MJZA 4LRSA 1HL2A 3CIWA 5D09A 4JYFA 4WZHA 1IXQA 3G1VA 4IMGA 3HF3A 1KLYA 1YXCA 5SWUA 3TQKA 3W7OA 1VHCA 2NX3A 4UIOA 5AYYA 3TV8A 2QCEA 1Y0EA 3E9AA 3C2OA 2Y88A 3O8AA 3T44A 3C2FA 1XC4A 4CCDA 5I3FA 4UMBA 1SPQA 3W88A 1XDLA 5AC7A 1K8ZA 1ML1A 4Y90A 1UB3A 3PULA 4IMCA 4WUIA 3C56A 1GJPA 3NQDA 5L9FA 3TK7A 4RX0A 4YLWA 1CW2A 4UTLA 5AYXA 2NV2A 4LVGA 4MY8A 3W1PA 3E12A 2HS8A 5D04C 3BG9A 1K8XA 4MIMA 1YADA 1W3TA 3TNOA 3G22A 5LNVA 3W1NA 5IBXC 1YYAA 5F4XA 4WY0A 4BR1A 1W3IA 3SI9A 1LTDA 2QCGA 1OYBA 3W22A 3NL6A 4K7VA 5CPNA 3THAA 1YTEA 4DEFA 2OT1A 3FYPA 3TQ0A 2OX1A 5F2LA 3T40A 3B0VC 1EPXA 2CZ5A 3NG3A 3ATZA 3TAKA 1VPXA 2A4AA 5TBOA 5EMUA 1KFJA 2FPVA 2YFOA 3LXBA 3F1QA 1TTJA 5U4NA 4JTUA 4Z1BA 4UNKA 3MI6A 1B4KA 3FEMA 5DLCA 3VCRA 2OCZA 2TYSA 2C6QA 2I9EA 4ZQCA 1UBSA 1OJXA 2YCEA 3K30A 2LLEA 2AGKA 2R8WA 4M6PA 2JKPA 3HGJA 5IM51 2TSYA 3WJZA 4A21A 3LRMA 3QRHA 3JR2A 2ZCGA 3W2UA 1DL3A 3OEXA 3PUDA 3I65A 3VE7A 2GUUA 2NUWA 4UFMA 3G1XA 3MUXA 5KZMA 5LSMA 2FB3A 2G96A 4M6QA 1RPXA 3SZ8A 2QJGA 1DVJA 3KAOA 3W75A 4JY8A 5HNRA 1XBZA 1OFQA 4M19A 4JTFA 1QOQA 2GJNA 1O4UA 1BKSA 1CI1A 4K37A 3KVJA 4FNSA 5HQEA 4JIQA 4Q33A 2NUYA 1LRNA 2X1SA 2VFFA 1LYXA 3LHVA 4LS1A 2QCHA 3NQCA 3MYOA 3VNDA 4KFOA 1OX4B 2NZLA 3MI3A 1EP1A 1P4CA 4HT3A 1BTMA 1SW0A 3WFAA 1LBLA 1NSJA 5K4XA 4OQVA 1IXPA 5D2VA 3ATYA 1AK5A 3KFTA 1WAUA 3UPWA 4HN4A 2ZQ0A 1F6KA 1F7BA 2A2IA 2VOMA 2DJXA 1PIIA 3FLUA 2B7OA 1C9DA 4E2BA 3CTLA 2PRHA 4UFHA 5D03A 4GNJA 1YPFA 3N3MA 3S8HA 4L4LA 3C2EA 3DGRA 4JD4A 2EPHA 3LLDA 3PG8A 2NXIA 5DXYA 1DJQA 5CZ0A 3PBVA 4G1KA 3DENA 5D2WA 1GZGA 5K9XA 3BO9A 4MFDA 3S5NA 5FF0A 1YTKA 5HWJA 1U5JA 2PCQA 4FX7A 3NZ1A 3CPRA 5G4EA 4GUJA 3W73A 1WV2A 4PL2A 1W8SA 1TV8A 1J5TA 3M47A 2B7NA 2Y7DA 1K7XA 3P5ZA 2Y7GA 1UUOA 6ALDA 3EXTA 3IGUA 3UZJA 4GFSA 4GBUA 2I1OA 3NQVA 3MP4A 3P84A 2E6AA 3A23A 4TU1A 3UWUA 1TPUA 2H6RA 2CZEA 3G0UA 3UY7A 2JKEA 3W7NA 1MO0A 3S42A 2WPBA 3LRKA 5H2ZA 3M5VA 2BWGA 3EX4A 4QITA 1JRCA 1BEUA 1KM2A 1EUAA 3FS2A 3G8EA 1DQWA 4RXGA 1LLWA 3NA8A 2J9XA 3VI2A 3DFNA 3MBFA 1VCFA 1VJIA 2E6DA 3PUEA 1OF8A 1OABA 1VYPX 5DELA 1ZENA 1I2RA 3G0SA 5AHLA 5FEZA 4HKPA 4DXVA 3KXQA 1GVOA 4A29A 3LTYA 2E09A 2HMCA 3EB2A 1G4TA 2A7PA 2B4GA 3W7QA 5HR7A 1TPEA 1FWTA 3HBLA 3UWVA 2P1FA 3MMTA 5KTLA 2R14A 4ORIA 3R8RA 3IVSA 2C0AA 3HPSA 4JTTA 5C54A 2VFGA 5D02A 2JGQA 3NDOA 3ABQA 1FXQA 2QAFA 1Z42A 3TDFA 2Q8LA 1R46A 1EWEA 1VCVA 2QEZA 3FOKA 4BWLA 2ZRYA 1TTQA 3B04A 3BVJA 1SSDA 3G1FA 1XCFA 4R7JA 1IXOA 2YYUA 2CLIA 4RR4A 4LNYA 2DZUA 4O10A 3S9YA 4NNCA 4IUOA 1H7OA 3FIGA 4IMFA 1SZFA 5AOUA 5I3GA 3S1VA 4IMEA 3W1LA 1KTCA 1HTIA 4BK9A 1PCWA 2QAPA 3UQNA 4RCXA 3BV4A 4LRTA 5J5RA 2G5WA 4Y6GA 3EXRA 4I9AA 3HJZA 4ZQNA 3W7LA 1DJNA 3KVLA 2W0UA 5DY2A 2YX0A 4X22A 3GNNA 5EYWA 3O07A 3PS7A 4WXZA 1XXXA 4JN6A 4W9TA 5I3KA 3QZEA 2V9DA 3T7VA 3MHUA 1PVNA 1SZNA 2QUUA 4AWTA 4A2RA 2J88A 3P8JA 1K7EA 3BPWA 2A7NA 1NEYA 1ZAHA 2R94A 3TU9A 5D05A 2J24A 2ZA2A 1UCWA 4JTIA 4AF0A 4LVBA 1GQNA 1FBAA 3STEA 3KVKA 2QJHA 3L67A 4UFJA 1VYSX 1TV5A 1JCMP 5A5WA 1I8JA 1N8FA 4ML9A 2WNZA 3O6DA 1LRQA 3EKLA 5F4WA 1A53A 1P0NA 2WNQA 2QJIA 2CFFA 3C8FA 1QPRA 1VC4A 3GVGA 1MEIA 1WBJA 5HUOA 4AB4A 5AHEA 2XFWA 3W7HA 2V2CA 4NQ1A 1FQ0A 1XUUA 1GVRA 2FLIA 5DXXA 4Q32A 2QCLA 3NXFA 1G4EA 1SW7A 2ISWA 4UFLA 2ZZ6A 4O53A 4FX6M 5CSRA 3TFXA 1KW1A 3BLFA 1QR7A 4WOZA 3TAOA 1LLZA 3USBA 1H7NA 4DQWA 1GTHA 3LBMA 1PE1A 2ZRWA 3B4UA 3IGSA 3BG5A 1VGAA 4WJEA 4E38A 4LT9A 4O12A 4QSHA 3QSRA 1KM0A 4NJKA 2FB2A 2V81A 7TIMA 1XI3A 2A6LA 3L0NA 3DH7A 3LCXA 4LV9A 2RFGA 4EF9A 3CB8A 3D0CA 1EIXA 4MLJA 3LXAA 4LVAA 3EX6A 3QEZA 2Z0IA 5BOOA 1GWJA 1JUKA 2YYTA 4XUGA 3LCFA 2QKFA 3W84A 2E5DA 2VEMA 1Q6OA 4AXKA 3IIVA 3CEUA 3YPIA 3EWWA 3PBUA 1H60A 3QC3A 1R2TA 2PURA 1R30A 5CG7A 3NQAA 4U4MA 3MP3A 1KM6A 4NJIA 3MHGA 5F2GA 3GKAA 3INPA 3LI0A 1OFBA 5K4ZA 2Q3OA 4GUGA 3NQEA 3LHYA 1A5BA 4M7SA 3NO5A 1SSGA 1K3UA 3W85A 3UXAA 3DAQA 1X1ZA 3QPZA 2C19A 4UUIA 5CZSA 1L6SA 4JTSA 3LCLA 3GX9A 4I7WA 1X6UA 3GR8A 4MFEA 3M1ZA 4FNQA 3THQA 5K3VA 3W7DA 2H3DA 3HQ1A 3HPXA 3ABRA 3NR0A 4ZQMA 3WJSA 1OFEA 5TQLA 4NNAA 3OHIA 5DBTA 3MP5A 4LTSA 1THFD 4RJEA 5F1UA 2VEPA 1ZFJA 2P10A 5FF2A 1Q45A 4HNUA 1TRIA 3NQ6A 1XM3A 2FJKA 3W7GA 3A5VA 1VR6A 2BZNA 3TQVA 1RZMA 4UTKA 3FFSA 4CNPA 3QH2A 3E02A 3E96A 2Q3RA 4FNUA 1LOLA 1GYNA 4ZQOA 2G97A 4O4VA 4MYAA 4O0ZA 4HSNA 2Z6JA 1AL8A 1WBHA 3GLCA 1YLVA 3OBKA 4IWWA 3FJ6A 3PWAA 1DORA 2O7QA 5DBUA 4RZ5A 2YFNA 4K8EA 4X3ZA 3GZ3A 5G5IA 2C16A 1W56A 3U6WA 1QFEA 1GVQA 3EWYA 4HPXA 3QMTA 4GC4A 1KM5A 4O19A 1G7VA 3HOJA 1JR1A 4HNTA 2YR1A 2CLFA 4AHQA 3NQ2A 1R2RA 2DZWA 3S1XA 1OK6A 4AEOA 3UYCA 1XDMA 4E0CA 3P80A 3R12A 1ALDA 3RK8A 1D9EA 2WSYA 5KITA 3CWNA 5BMXA 1LP6A 2E6YA 2G95A 4DPPA 2E77A 3L0KA 3W2NA 2VKZG 4FO4A 2A7RA 3M5XA 3M43A 3LCIA 4GWEA 5E93A 4FX8A 1IGSA 4UCGA 3VFLA 1I2OA 1H1ZA 5G1YA 3WK3A 3SJ3A 4QAIA 1FDZA 2GVLA 1GVSA 4JTGA 4QQ3A 4NJJA 4CLMA 3T55A 4PL1A 2Y89A 5G1TA 2YW3A 1SO5A 3MW7A 4AAJA 5LNUA 1OVDA 4JY9A 4MY9A 1I2QA 3TXVA 2ABAA 5EY5A 3N9SA 3DFQA 4DO6A 1W0MA 2QUVA 1F05A 5CZJA 3AJXA 1C29A 4WY0F 3C3NA 2ZRZA 3LDVA 4NUWA 5FF3A 4IMDA 1T8XA 1A5CA 2X30A 3F4WA 1LOSA 2ZZ2A 2CWNA 3MI2A 2VFHA 3DI1A 1FWRA 3H55A 4KKXA 3WJXA 2PRMA 1DQXA 2WV8A 3EX1A 4Z1DA 4WD0A 4EIVA 5GVJA 5LNWA 3TJLA 1O60A 1AL7A 2YXGA 2OZ0A 4IQLA 4CNOA 1ONRA 3BGGA 4NU7A 1F5ZA 4NXKA 4C1KA 5D2TA 1QAPA 1J4EA 4R33A 5F2IA 2WO5A 3GDRA 1TREA 1B9BA 3LBCA 3W2JA 4MUZA 5D2XA 3BLEA 1K7FA 1KBJA 3W1TA 1KFKA 3W9ZA 2P0OA 3DFPA 3EWXA 3SSJA 3P74A 2FPTA 1ZY9A 1G4PA 4JX6A 1DKWA 3LV5A 3BGJA 3GXTA 3DFSA 4YXGA 5AFDA 3BLIA 3TCEA 3FJLA 4MJMA 3N9RA 3BW3A 3LI1A 3NPXA 1QPQA 3UXDA 4Z08A 1ZJIA 5D38A 4UFKA 1MZHA 4M7TA 1M6JA 1SUXA 2DZXA 2RKXA 1FWSA 1SQ7A 2O7SA 4MPQA 1ICSA 1Z44A 2RDWA 2ZRUA 3O15A 3P60A 1OF6A 5I3HA 2EF9A 1JQXA 4JEQA 2X1TA 4ONVA 2EGZA 1LRTA 1GYLA 2Y63A 4ORMA 4JTLA 1ADOA 4LU0A 3QYQA 3TSDA 3S5YA 1V5XA 1GTEA 1H7PA 1LROA 5HUPA 3A9IA 4Y8FA 1H63A 4A22A 1X1OA 2A21A 5F2MA 5HWNA 3NAVA 1VHNA 3WK1A 3STFA 3QW3A 3EEGA 3O63A 3W7IA 3DFTA 2VXNA 2YGYA 4ZL1A 2I14A 5LGXA 4HNVA 3PR2A 3UD6A 3DHDA 4XWUA 5CKSA 1P1XA 1TO3A 3DXIA 1H51A 3CU2A 3W2KA 1XBXA 1JCJA 3PBYA 2Y7EA 5FI8A 4IOTA 4N02A 4Z0SA 3LGEA 1AW1A 5FEWA 2WJZA 4UTIA 1AW2A 3GR7A 3IEBA 3ZR4A 2FDSA 4QNWA 1KLZA 1BWKA 2V5BA 3UWYA 3W71A 1V7YA 1XBYA 1WQ5A 4LVDA 3W1UA 5HJLA 1GOXA 3O6YX 3NGJA 3W76A 3A5FA 3TE9A 1TPC1 1ZHAA 2W6RA 4AMAA 3QMRA 4CCCA 4ADTA 3TW7A 3NZRA 4UR7A 4J9JA 4XKYA 4LS2A 3TR2A 2VELA 1TRDA 3UWQA 1FX6A 4WY0B 4PA8A 4N9CA 2B0MA 2B7QA 2KZHA 3IRDA 3N73A 5LKYA 1WYIA 5LHEA 4MZYA 4I7UA 4ZVJA 5AN7A 4UTWA 4JIPA 4BWLC 1JVNA 1FY6A 2CLLA 3CQ0A 3W7RA 2WKJA 4Z1CA 4E2DA 2AAMA 3C61A 2NUXA 4QM1A 2NWRA 1VS1A 4XBKA 3UY8A 4N9BA 1G67A 1F6PA 1EA0A 2TMDA 2QCCA 3LLFA 3C2RA 3W3OA 2CU0A 4LV4A 4XZ9A 5KINA 3Q37A 3P81A 1JQVA 3W7MA 1TB3A 1SO3A 3UZ5A 2VFIA 5EKYA 1TTPA 1F2JA 3G3DA 1KV5A 3PB2A 4LOCA 1IIGA 1KTNA 1R47A 2ZTJA 3LX9A 2FTPA 3G18A 4JDBA 2A85A 3NL2A 3H54A
chains in the Genus database with same CATH superfamily
4UTTC 3TQPA 3CJPA 5DQPA 2WMHA 5BRBA 5B7YA 1VB9A 3KCLA 4UMAA 3KCJA 2I5GA 2E5BA 3KHJA 1DYSA 5CAHA 1JCLA 4DLFA 4YHEA 3GNOA 2UV8G 4Q22A 3VC5A 1E0TA 3SB0A 4IL0A 4GBDA 1LWHA 2W91A 4OT7A 4HP5A 5CQ1A 4ZE5A 4FXRA 3ARTA 5ABTA 4CEUC 1DWGM 3CBWA 5GJPA 3REQA 3IVUA 4QBXA 1BLIA 8RUCA 2FGBA 2XN2A 3AZSA 3SCOA 4CVUA 2AMXA 3U2OA 2D73A 1MRAA 4EXQA 1YTDA 4LS0A 3H53A 1E0VA 1LL4A 4GXPA 3WD0A 5AC5A 5F1VA 2QCDA 3KVMA 1NOUA 1U30A 1POJA 3G0XA 3M0XA 4K8GA 2NLIA 3TTQA 3VOHA 3AWOA 3S5OA 1TMLA 1BYDA 1VEMA 4RPPA 2BGNE 3WH9A 4DNMA 2Y7FA 5FJRA 3L9CA 3UG4A 2IQDA 1E0WA 2Q6ZA 3ZLGA 3RITA 1J96A 1QMLA 1MW1A 4ZO7A 4HMDA 1GK8A 5EMMA 4MVAA 3VM7A 3L21A 2QIWA 4GVIA 3G1YA 3GIYA 4AISA 1P5BA 1UWTA 4D6HA 5KSWA 3B0XA 3WF1A 4XX6A 2OMAA 2V5DA 2ZC8A 1TIMA 3OLGA 3O0FA 2GSEA 1CT5A 1OY0A 3PM6A 1W9PA 4DI9A 1DXIA 1UKPA 2PTYA 3W0KA 1EEXA 3TC7A 5A3HA 2NV1A 4JNMA 4O54A 1QPNA 4AIBA 1S5NA 2YLLA 4M80A 2C91A 1TVLA 3CASA 5EMYA 2V2DA 4U5IA 3WUGA 2YDQA 1UWQA 2JIEA 2AKMA 4CQ8A 3A3HA 1L6WA 1AQHA 5H91A 1JDAA 1G5AA 3E0LA 2EQDA 4IGNA 1F07A 4K8HA 1TA3B 2FIQA 4RK8A 1ZBVA 3ELFA 1OG6A 2XM1A 3P2VA 3E3HA 3TA6A 1OIFA 4I6VA 1E1FA 3SUUA 4ADSA 1GOIA 2W79A 4UTTA 2QV5A 3DHPA 2PDLA 2VEFA 2EO7A 3NVDA 2WBGA 3LXCA 4NAEA 3SCUA 5DY3A 3WZ0E 2WHKA 2RHGA 1ONXA 2X40A 2Q8ZA 1RY0A 1BGGA 3TTEA 1PEZA 1W31A 3IIZA 1ME7A 1PZ2A 2OSXA 4YN5A 1WE5A 1J2BA 1C8VA 5I3IA 3QV6A 4HBKA 3RPDA 4CQDA 1C8YA 2E8YA 3KL0A 2PB1A 4FEZA 4BJHA 1W5QA 2VRKA 3FN9A 3N17A 2A79A 2IQTA 4TMBA 1OG0A 3MVIA 4V27A 4JN8A 1V7AA 2FZBA 3MMUA 1EF2A 5J5DA 1M7JA 4X2RA 2Y5SA 3ERPA 1CECA 3IV3A 3CC1A 5FEXA 1ICQA 2PDXA 3V18A 1IT8A 4GE8A 2WANA 3PZTA 2PEVA 2YPIA 4XSMA 1A4MA 3QSTA 1BF6A 1W1TA 1OEPA 5FF4A 4IUGA 4DJEA 4ZXLA 3WK0A 3I3BA 3UGRA 2DIJA 1WB0A 1CB2A 2UBPC 4IIHA 5DCBA 2BVWA 5C2CA 1KCZA 3FDGA 2ZZ7A 4MJ2A 4F9JA 4CNNA 3TA9A 4HVXA 1TVNA 4XZIA 3WELA 3U7VA 1PAMA 5HMFA 4D6FA 1H0IA 2IKHA 1EP3A 4KWVA 4OHQA 3TSMA 3NZGA 3RX3A 5CG0A 4W84A 1TJRA 4G9PA 3M41A 3CLWA 1XLGA 3OGRA 3M7WA 4F0MA 1H09A 3MB9A 2XINA 3ZJ7A 3IJLA 4O52A 1ME9A 2BTMA 4UXDA 4JS3A 3GIQA 2HVOA 3NL5A 1US0A 1UASA 1NF0A 2DZTA 4FF5A 1FWWA 4FNPA 4NZ3A 2HPMA 5D32A 3NQ7A 2ONEA 3CV7A 3FA5A 2ZA1A 4GISA 4REQA 1ICPA 2CLKA 2QGHA 4KWSA 2OLAA 3P7YA 3N6QA 4ADUA 2DUZA 2HISA 3MQTA 3A22A 1KBKA 1MEWA 1EXPA 4AC1X 3E0IA 3DC8A 4IPPA 4LF1A 3VM5A 1N8WA 4MZ1A 2A0NA 3DN5A 2O9TA 2WZIA 5HR6A 1W9VA 1H7XA 3H70A 4AD0A 3QLLA 1UC4A 4IJBA 1WXJA 1YXDA 3ZOAA 1UMLA 4OOZA 1OFAA 1CZ1A 2WWCA 5CPLA 1J12A 4ZO6A 3Q58A 2BG5A 4H8NA 2POZA 2Z1WA 4BF7A 3WLTA 3QQWA 5CPOA 4GQRA 3LMZA 2G37A 4BF5A 3H4XA 1KBIA 3LD5A 3ZIZA 4RNFA 2BY1A 2FDMA 5ABFB 4QIUA 3VD7A 1N7KA 4YWIA 5A8PA 3NPUA 2EAWA 2PGRA 4O18A 3NYZA 3LYEA 2GWGA 3S47A 3MMWA 2PSNA 4DF1A 3EAUA 1WZKA 2PLJA 3UWEA 4J3ZA 1RLCL 5LA0A 5ABGA 3H21A 4LBSA 3O05A 1XLJA 2PGEA 4YTTA 3FJ4A 2GOUA 2GGJA 3NOYA 5HOSA 1RQHA 3EDFA 3ABZA 2VD9A 1L2UA 2GK1A 1JF6A 2ACQA 3L5LA 2VZSA 2ZZ4A 2DH3A 4B2DD 2CLHA 3NM1A 4GXMA 1UUMA 2WC7A 4GZEA 4GK8A 4G7FA 1TPVA 2QUTA 3IJIA 1RBOB 1I6NA 1XV8A 1E4MM 5I24A 3PC0A 2J9YA 3FNDA 4WGHA 1DP0A 1UZDA 4H04A 1WXYA 4XAFA 5AHIA 2FPYA 3COTA 4LUTB 1QO2A 4PRTA 3A9BA 4A2SA 3UP8A 2H9AB 2PDBA 1P7TA 3VE9A 3THDA 1OYCA 4DO7A 2QHAA 5A8QA 3QPYA 3LHWA 2Y5JA 3GKFA 4NZCA 3EWBX 2BY0A 4QEEA 2XHYA 3OYZA 2OO0A 4HHLA 1Z41A 3NCOA 4AZ5A 3ENLA 2GQ3A 4XKYB 2RGMA 4LPCA 3W6YA 3UNTA 4MMWA 1AVAA 3WQ8A 1Q4WA 1G6CA 3BOXA 3P14A 2EKCA 1H62A 3TC6A 3V3WA 4N2YA 1JRBA 5EFFA 4QDPA 3UWWA 4DXKA 5H1WA 3L2IA 3OQ8A 2RGLA 1O66A 4NJGA 1WO2A 2VGIA 1WKEA 4UC5A 3QMSA 3VNMA 2WZEA 3U2CA 1OSEA 3NEVA 2CZFA 2XSAA 5FD0A 1MQRA 4OBRA 3TH6A 5DFAA 4P8WA 1SU5A 1MZRA 3IPWA 1SO6A 2PDGA 4PODA 3M5ZA 4GGBA 4PCFA 1JFXA 7REQB 2WJFA 4KRUA 3ZQ9A 2QJMA 1GJWA 1HKKA 2Y8KA 3B9AA 2E3ZA 3SCTA 1YDNA 1TE1A 3W7KA 2X16A 4KQNA 3HTWA 3N2MA 2PLCA 4WX2A 2A1YA 1XIDA 2J8TA 2GVJA 3WMLA 1K03A 1AD4A 3U8GA 3C4UA 3EGJA 4EK7A 4QXIA 2F6UA 2ZX7A 4B5NA 4EOUA 5K9DA 4AUBA 5FACA 3ISIX 3M6YA 5FL0A 3CPUA 3G3MA 3HGRA 3S2NA 1TIWA 3F4CA 4GVHA 1ZAJA 3P61A 4MNJA 4V28A 1E6XM 3ZJ8A 1EPVA 1JJKA 3W83A 1HT6A 1XIMA 1SR9A 3I3EA 4ZBCA 1OGGA 1TX2A 3N2CA 4GC3A 2F84A 1YMYA 3S83A 3V0UA 1XUZA 2PE4A 3OA3A 2DZVA 1VQTA 4QLLA 4QLJA 4AU0A 4CD5A 2NX1A 1ZS2A 5EPDA 3HA1A 5FAJA 2BX7A 2A3EA 2D24A 1XCWA 1H11A 1YBQA 3TROA 4L80A 1BWVA 4P2VA 3CXOA 2J78A 4XKMA 3XIMA 3ZS4A 5A6LA 3QV7A 4EPBC 2VFDA 1CBGA 3SECA 1QU4A 2CXEA 3C0LA 3B05A 1KCXA 4MKVA 2VGGA 4F0KA 4LY8A 4N6EA 4GH3A 3KLLA 3WQCA 2F2KA 1R3VA 3D5HA 1YQ2A 3HPZA 1EJRC 2P8CA 1EJUC 1UKSA 2VDHA 4ZE4A 4JN7A 3L4TA 1I1XA 3FCPA 3WDPP 4ALDA 1N82A 3G24A 1S3HA 3F2BA 5I5RA 4PFMA 1WDWA 1SZGA 4GZJA 3TIMA 1SYTA 1MXDA 7A3HA 4MLRA 4NZ5A 4CD6A 3P82A 4QEHA 3C52A 4I7VA 4U31A 4IPJA 3GU9A 3S9IA 2DEPA 2VGFA 2VP8A 1PL9A 2BVYA 3L5AA 1KFEA 5CZTA 1PUDA 3CQIA 2I5IA 3V35A 1V0LA 1QT1A 2ODOA 4A3RA 4S3JA 1NH6A 3LHZA 1KFBA 3MANA 3WH5A 1WOAA 4QISA 2G3MA 3NFUA 3WEOA 4Z1AA 1WA3A 3GK0A 1E4IA 1R85A 5IOBA 1GVIA 1VBHA 2ZRVA 3ZSTA 1M68A 4NAFA 1TQXA 3H4GA 3W1RA 4CQAA 5KMYA 3UERA 2R9RA 1SJDA 3RMEA 1JL8A 4L61A 3VOCA 2TPSA 3WUBA 2PP1A 2WNNA 3KRZA 2GQ8A 1MFVA 1WPCA 4UR9A 3BAXA 2FFCA 3F4NA 1EIBA 5BROA 3M6DA 2V5CA 5LA2A 4TMCA 1VFTA 4Y9MA 3W29A 5DT7A 2JF6A 3CIWA 5BZAA 3RO8A 4LF2A 1C90A 4X63A 1R9YA 4WZHA 1E9IA 3SN4A 1KLYA 3IJ6A 4WVXA 3TQKA 1VIZA 4D6EA 1ZBWA 1PTGA 2XFRA 1PZ0A 2Y88A 4KPLA 3WL1A 1XC4A 1IZCA 2WHLA 3IUHA 3SFWA 3C8NA 4RW5A 1TG7A 1K8ZA 4Y90A 2WHMA 1UB3A 4IJRA 4W8LA 4IZGA 3QPEA 2VX5A 5JBDA 4PUNA 4U2YA 3SRFA 2QNEA 2Y8UA 1CW2A 5D9MA 4FP1A 3QFWA 3E12A 5D04C 2CHOA 3PWGA 2EEXA 1CENA 3BTNA 2V38A 1R3QA 4XO7A 1ODZA 3N13A 1XW8A 3B8IA 3LPPA 4K7VA 4DEFA 3TQ0A 3VAVA 4Q4PA 3VC6A 2CZ5A 3NG3A 1CXKA 4P8UA 1XC6A 2A4AA 3OOQA 1KFJA 3GG7A 1LT7A 2VR5A 4Q4SA 4C6PA 4Z1BA 4QFUA 1JXJA 3L4ZA 4HOZA 4PEEA 5GNXA 4ZQCA 2PDWA 4B91A 4Z2KA 4IQDA 2YCEA 4M6UA 2R8WA 4M6PA 1XPGA 1XYFA 1S1PA 3WJZA 3LRMA 2ZCGA 3CIVA 2HJPA 3STPA 5BRPA 3OEXA 3MUXA 2D1ZA 3OA5A 8XIMA 1DWJM 5CPTA 3SZ8A 4JY8A 5HNRA 1OB0A 1O4UA 3KL5A 1BKSA 3H8AA 4FNSA 4JIQA 2NUYA 1GYMA 3AIRA 3LHVA 2QCHA 3NIYA 3NQCA 3MYOA 2YB4A 1P4CA 4RW3A 4HT3A 1BTMA 1SW0A 1NSJA 2INEA 1AK5A 3W02A 3KDNA 2EPMX 1F6KA 2IS7A 3NJ3A 4GINA 2RAGA 2INZA 3FLUA 3VGGA 1C9DA 3CUIA 2OZ3A 1E9YB 4L9YA 5D03A 1PKMA 1REQB 2C0HA 3N3MA 3S8HA 3DGRA 4XZMX 2Q02A 1TWZA 2EPHA 2ZXDA 4QE4A 2F9RA 5DXYA 2XWDA 5CZ0A 1D8CA 3BMWA 2TAAA 3L2LA 4L5ZA 5LIKX 1EA9C 5K9XA 1AJZA 1Q63A 1LG1A 4HGXA 5IHRA 1DPMA 1E6PA 1QVBA 1CEOA 3PFMA 1UZ4A 2ZADA 2J8GA 3P5ZA 3S5SA 6ALDA 1XKJA 3IGUA 3VIKA 3A64A 1ZQ5A 3LZ5A 3PZMA 4WDTA 1PZ1A 4JTCA 3R43A 3A23A 4HB7A 4TU1A 3UWUA 4O1FA 4M3PA 2H6RA 3UXLA 3U9IA 4DWDA 3G0UA 2HBVA 3W7NA 3KP1A 4XD5A 2GJRA 2WPBA 3LRKA 3M5VA 1WKFA 4C6OA 4LAZA 1TWIA 1JRCA 1BEUA 1O5QA 1JYWA 4XVEA 1DQWA 3NA8A 3UXKA 1Q65A 5M3WA 2UZ9A 3FSTA 4EWJA 3VI2A 5BOEA 5FJUA 2PWFA 4F0HA 5EU9A 4PE8A 1OABA 1VYPX 1JPMA 4XAZA 5AHLA 5FEZA 3GQYA 1TZZA 2ZE3A 1ZBKA 2WVUA 3W01A 4A29A 4AIEA 3MTWA 2J75A 4MNKA 4A3YA 2R14A 1MWOA 3KP0A 1BYAA 2QAFA 2Q8LA 3VUSA 1UR9A 3M0JA 1EWEA 3FYYA 4Y9PA 4BWLA 3ZO9A 1SSDA 4HJWA 3BGAA 3K4DA 2YYUA 2CLIA 3AISA 3ITGA 1XQLA 4NNCA 3WF2A 4J4KA 3UF9A 3W1LA 1PCWA 4RCXA 5XIAA 1V02A 5ENLA 3N4EA 4H7VA 1DJNA 2W0UA 4OFCA 2YX0A 4LCSA 1FVPA 2DDXA 4I5UA 1U1JA 1GW1A 2C1GA 2CLPA 2V9DA 1PVNA 3ITYA 1UD5A 4A2RA 3N04A 3P8JA 4P7QA 4AWTA 5KETA 1K7EA 2ZUWA 1VJSA 4RE2A 4F0SA 1UCWA 4PB5A 4AF0A 4NI3A 3SRDA 5CGMA 3AMLA 2PBGA 3C2YA 3KBJA 1DWIM 2QJHA 3L67A 1TV5A 1EOKA 4FOUA 4RZBA 4LBUA 1ZB5A 1XYLA 2PTDA 2WNZA 1LRQA 5A6AA 2E67A 3WQ4A 4AXNA 2VX7A 4Z2GA 2ZX5A 1SFSA 3OPSA 1MEIA 4U33A 1RCXB 1SJBA 5AHEA 2FZNA 3AIVA 4NQ1A 3WDHA 2YA1A 4QE5A 2QCLA 3PK7A 2J62A 4UFLA 2ZZ6A 4FX6M 4GIRA 3USBA 1H7NA 4DQWA 1GTHA 3BAIA 3LBMA 5E6ZA 4S3DA 1VGAA 4WJEA 4E38A 4NJKA 1VFLA 2FB2A 1XI3A 3L0NA 3GC2A 4KBXA 1M9HA 3ARVA 3D0CA 2DSZA 1WZLA 2O4MA 2YYTA 3LCFA 2NQ9A 1Q6OA 2GDQA 4AXKA 3CEUA 3YPIA 3PBUA 4AVOA 3T8LA 3W37A 3VNKA 5CG7A 2OZTA 4NJIA 3MHGA 5F2GA 3PPCA 1AZ1A 3INPA 5JMUA 1OFBA 3CMFA 4AW7A 3NQEA 1A5BA 3QGKC 3ALGA 3RCMA 4CN4A 1GOWA 1K3UA 3W85A 3UXAA 4HU0A 1IHIA 4PSPA 3T05A 1NFPA 1JD9A 2Y24A 4I7WA 1X6UA 4GYPA 2I57A 4UB9A 1XRTA 1BVZA 2H3DA 3HPXA 3ABRA 4ZQMA 4B3LA 3OHIA 1U22A 2VC5A 3FY1A 3QGVA 5DBTA 1WXZA 1E5JA 2AQOA 3IV8A 5FF2A 1JIBA 2Q8XA 2WVSA 4HNUA 3N9KA 2FJKA 3A5VA 4KWOA 1C92A 1RJQA 1E3ZA 4MSSA 3E96A 4FNUA 1GYNA 4PGLA 3WF3A 4B5XA 3MA8A 4QGCA 3ZJKA 4IWWA 5DBUA 4K8EA 5G5IA 3CZJA 2WPGA 1WZAA 1GVQA 3QMTA 1IV8A 1G7VA 2W3ZA 4FOKA 3PBMA 4HNTA 2YR1A 1XDJA 1GVEA 1R2RA 4MKSA 3QGAC 1XLEA 4AEOA 3GUGA 1XDMA 3P80A 4FK9A 1XSJA 3N2OA 3NZPA 2E6YA 2G95A 4QJ3B 3LG3A 1XICA 2QQ6A 4JOMA 3VNZA 1UR8A 3D3AA 4D1IA 2BOFX 3W2NA 3Q4DA 2A7RA 3L4XA 4W5UA 1UUQA 3LCIA 4FX8A 2REQB 4UCGA 4UQEA 4QAIA 2J8FA 4DZHA 1JPDX 2WMIB 1P6WA 4HMEA 1K9DA 1B9ZA 5MF5A 4Q8NA 4HYRA 4F48A 1C9WA 2ZUNA 1Q66A 1B3VA 4DO6A 2EBNA 1W0MA 2QUVA 8A3HA 3I6EA 5CZJA 5LXXA 2DPEA 3H7VA 2NV9A 4WDUA 3GO2A 2OLSA 1A5CA 3RJYA 1G1YA 1HX0A 4TXEA 3WD4A 3F4WA 2AQVA 4WJXA 4PMXA 5AY7A 1M03A 3DI1A 5A95A 1FWRA 3H55A 4LXFA 3EX1A 1CTNA 3VINA 3BGGA 4B90A 1F5ZA 5D2TA 2XU2A 4R33A 3L23A 2WO5A 4INFA 3DCPA 2J77A 1YE6A 2WSKA 2ZUUA 3M0YA 1ISZA 3DYMA 1P0DA 2Z27A 3W1TA 3W9ZA 2ZE0A 2EPKX 3EWXA 3SSJA 4AZ6A 4P7OA 1KR1A 2ZDSA 4A8NA 2XUCA 3UJ2A 3TEVA 2WB5A 5A6MA 1X38A 5I3DA 4DN1A 3BUVA 2SFPA 1EOMA 3QKEA 4JKKA 1MZHA 4AG0A 1SUXA 2DZXA 3U5YA 4I3GA 3U4FA 4WKAA 2RDWA 2ZRUA 3LSBA 3P60A 2OOFA 2EF9A 2X1TA 2EGZA 2PU1A 4ORMA 1ADOA 3AMDA 2NLYA 2R6OA 1V5XA 1GTEA 1LROA 2X41A 3BSMA 5HUPA 4LY4A 4GX9A 2A21A 5F2MA 3H12A 5HWNA 2OTDA 3QW3A 2VXNA 2IPGA 4ZL1A 3OZOA 1B1YA 3DHDA 1TO3A 1MMFA 4RE3A 3B9NA 4B92A 1XBXA 2Y7EA 1UD2A 1OGSA 4N02A 1GKRA 1MFUA 3URQA 1HQTA 4GPNA 1J11A 3GFXA 2WJZA 3QV8A 1A5NC 3TTSA 3N29A 3WKZA 1BWKA 4W87A 1E56A 2V5BA 3N18A 1YDYA 1WQ5A 1D7FA 3S3GA 2W67A 3W76A 1S2WA 4GYPC 3QMRA 4GY1A 4GKTA 1NWRA 2D0GA 4QTGA 4H9MA 4W89A 4XKYA 3PPHA 3TR2A 4A3HA 1TRDA 2D3LA 3UWQA 1C7TA 2PDJA 4N9CA 2B0MA 1SGJA 3IRDA 3N73A 1W32A 1P48A 4ZVJA 4I7UA 1FY6A 4GGHA 3W7RA 1BD0A 2AAMA 3C61A 4QM1A 1VBJA 1G67A 2TMDA 2Z4GA 1YE4A 4R27A 2QDEA 4V1YA 3SM0A 1C7SA 3SQSA 3W3OA 4AC7C 3KUMA 4LV4A 1ADSA 5KINA 2CKRA 3P81A 1PTDA 4AZIA 1TTPA 1KV5A 4LOCA 1IIGA 1KTNA 1BRLA 3BJFA 2J7HA 3LX9A 4GJJA 4JDBA 2UY5A 3K46A 3SIMA 1S2VA 1A5LC 1R86A 1QNSA 2DUXA 2XJ7A 1ZLPA 3O0KA 1OFOA 1OK4A 3LERA 4JBRA 4Q7IA 4QJ4B 2BLEA 1KWGA 1H49A 2RJGA 2EXOA 1RY8A 1UR3M 2V8ZA 4KRZA 3REQB 3FEQA 2WOQA 3RFAA 3H7RA 4FNRA 5JIPA 3F5LA 2QDHA 1JYXA 1Z69A 1HL9A 3L2MA 2Y6ZA 2XIIA 2GQAA 3LEPA 1BGAA 3HG5A 1K4HA 2JEQA 2NX9A 3BWWA 2GDUA 1OCNA 3CH0A 4AH7A 1UH4A 3MSGA 3TFCA 3P0XA 1RD5A 1TCDA 4OWGA 3AU6A 4JXCA 3RCYA 1EUNA 1PYMA 3B9DA 4HHPA 4DUWA 3T78A 2DW6A 4XD3A 3N4FA 1TPFA 3IARA 1KTBA 3S5ZA 2OKOA 2PWHA 3TYZA 2VCBA 1KRAC 1ISWA 1X96A 3WQEA 4TO8A 2PWGA 3S6DA 2AQWA 2X0HA 3WX7A 4AHPA 4PRRA 4F3HA 1KKOA 4JICA 2WSQA 1CGWA 4AHOA 1SFLA 3PP7A 1KO0A 5T9BG 1WOBA 5A94A 3NPWA 4CU6A 1AJ2A 1WDPA 3FYOA 4S2BA 1S3TC 3DECA 2WC3A 1G69A 7REQA 2H3BA 3DKLA 3GWQA 5C9ZA 1GPWA 4B9ZA 4DELA 1A3HA 1HZYA 1KD0A 3AIBA 4XG1A 4RV8A 3MPGA 1VBRA 5HMDA 3OB8A 2V3FA 3R0DA 3P62A 4TIMA 1HNYA 1I9CB 4HSOA 4RNHA 2H8XA 2BHYA 5DF0A 3SGUA 4LYKA 4O28A 3R10A 3OVQA 4D6JA 4ES4A 4AY1A 1DXFA 4UQAA 1ITCA 4A8IA 5A6JA 1SJAA 4J40A 1ITXA 3WJYA 4W88A 4OBSA 1DWAM 3CZ8A 2NVDA 3CM4A 2HSAA 4ATLA 1E0UA 1HO1A 4N9EA 3N2BA 1AQFA 3PBWA 1N8IA 1QNVA 3UZWA 2DSVA 1X98A 3W25A 3NVTA 4RXFA 1OYAA 4NRSA 1JDDA 1E70M 3UEQA 5CSUA 1AW5A 2QJJA 1NWUA 4PUEA 3U3HA 1ONEA 4I90A 1V8EA 3JVAA 1W5OA 4O17A 5DCDA 3EMZA 2OT0A 3QJAA 5CXPA 1VRDA 1ISYA 3MJYA 1TTIA 3QFEA 1WNOA 4M1BA 3OZMA 4LUJA 1PKNA 3JZUA 4Q8MA 3G1AA 1BTCA 2RDXA 2I9UA 4N9DA 1VFMA 2BMBA 3KL3A 1Q7MA 4KS0A 1T0OA 2FHBA 4UTMA 3P5YA 1LBMA 3EPMA 1JZ2A 1DIDA 3MO7A 3M07A 5HDRA 3HGOA 2BP1A 4K36A 1H41A 3ZLFA 5D33A 1DJGA 4BF9A 3ZWSA 1V6WA 4QG6A 4JTAA 1RVGA 2VR2A 3EWZA 4M5PA 4W7UA 1W5PA 3GE7A 1IF2A 1HJXA 1RCQA 3E1F1 4EVZA 1MUWA 1OC6A 3E0VA 1ZALA 3PHAA 1LM1A 3RO6A 2Z7KA 4RDZA 3M0VA 2E6FA 3WY1A 1YNPA 2VENA 1UC5A 1XLCA 3QHMA 4NT0A 3VDBA 4PH6A 3W72A 3RYSA 2PC4A 1JUEA 3LB0A 1MEHA 2VVSA 4NX0A 2JIWA 4PZVA 3CWOX 3RIKA 3WN6A 1EHAA 4H9YA 4ZA0A 2YIHA 2XG9A 4C6NA 2Y2WA 2FZDA 3EBVA 3ONCA 3V0TA 2RDTA 3TKFA 3B8TA 4H8UA 1MRQA 4QP0A 2P88A 3PUOA 4LAUA 1FCVA 1K8CA 3GR4A 3FKKA 2PDUA 4NAFB 4R34A 1K9FA 5AB3A 2DQXA 4JDYA 4Q4KA 4UTUA 3HGSA 3GH7A 3OIHA 3M44A 3WMSA 2Y62A 1E40A 4M81A 1RK6A 1C93A 4MJ4A 4GX8A 3ZWTA 1KC7A 3WIJA 2AKZA 4XUYA 2BNJA 1SFJA 4G6CA 3QTPA 4Y9NA 3TMLA 3W1AA 4ACZA 2XN0A 1Q6RA 3UGVA 3RUBL 4GUHA 3CWHA 1XWYA 4AMCA 2J25A 1UQYA 4JKLA 2J66A 1HKWA 3BCDA 2XN1A 1W37A 2WZMA 3RN6A 3E5BA 3BANA 4FXJA 3OVGA 4FHAA 3ZM8A 1LWJA 4TR9A 1FWNA 2ON3A 3C0SA 4Q8UA 4EF8A 2W61A 3LPGA 2WJEA 3ITXA 5DCEA 4D6DA 3B0UX 4P7NA 4G7EB 2WQPA 1P7TB 1BPLB 2WMFA 3SR7A 4IG2A 4TVUA 3LHUA 3MSYA 1V79A 3WCZA 1JULA 1IE7C 4QS6A 2VEIA 1UWRA 2QGYA 2OWCA 1R5YA 2PRLA 2WLZA 5AC8A 3RX4A 4X9SA 2Z26A 4OV4A 1M53A 3OLIA 3PJXA 3BMVA 1R9ZA 3I10A 4MF4A 1XGEA 3KRBA 3IRSA 4H00A 1UP2A 1H61A 4YTQA 2XVGA 1SR0A 3F2CA 4Z42C 1NU5A 2CWXA 1T99A 5DEZA 1T8QA 4GJ1A 4I9TA 4D6GA 1HG3A 4ZFCA 5KEZA 1BKHA 3BL3A 4Y9AA 2CCRA 3GHSA 4C90A 1O95A 3WDJA 8TIMA 2DW7A 4C6MA 1FWAC 2VRQA 4DI8A 2QMJA 4IPIA 4FA3A 1J2WA 1EP2A 1VYRA 4NX5A 2HS6A 2J7GA 1RLDA 3VIGA 1CGTA 4PBEA 1UWUA 4O11A 2O9RA 2WM1A 5LGZA 3TYUA 4S3CA 1AH0A 4KMQA 1AG1O 1EWDA 2ALDA 4JGDA 4Q3MA 1RV8A 2OZ8A 3I7SA 1HXJA 2WK2A 3JU2A 2BB0A 3URAA 4P5UA 3HG4A 4LSBA 1Q6LA 4M24A 4F79A 1XISA 1S46A 1J6PA 2V2HA 3QBUA 3LTPA 4D1JA 3PSWA 1XBVA 4LH8A 3AO0A 1FDYA 5D9NA 1RP9A 3CMGA 4AWUA 1UBPC 3AHYA 5F7UA 4MZ8A 3IJ8A 4TTUA 2NQJA 1GG0A 3A24A 2JK2A 2IUZA 3W4RA 1LORA 4MPKA 1CXHA 3R89A 3DX5A 1DIEA 2R1LA 1Z89A 2C1IA 1XYCA 3ZLHA 5CGQA 1ZGDA 3D47A 2NQZA 1XG4A 2YBVA 1J18A 5A69A 3WO8A 3MY9A 4R85A 1LF1A 1E1CA 1AMKA 3GAYA 4H41A 4KEUA 1BYCA 4DJFC 1W54A 3LCWA 1A5SA 1JDEA 4UMCA 2E5CA 4CKQA 4Z0JA 5D9OA 2F7FA 3HN3A 4XBSA 2GPTA 1XCXA 4I9MA 1LG2A 1B0IA 4F9DA 2OEJA 4IGSA 4KWWA 3R58A 4C6JA 2ATMA 2OELA 4B2DA 1KM3A 4AVFA 1XIFA 1TQJA 3UG8A 4LNCA 3F03K 1QW9A 3O1NA 4YTRA 4WHBA 4JR5A 2V3DA 1LLOA 4F2BA 5KZDA 3GXDA 4DUXA 5JBEA 2ZTKA 5JVLA 1XP3A 1U2YA 4PCTA 2V69A 3BARA 4NZJA 1QNOA 3GBEA 1DIOA 4LB3A 2Y85A 4GYJA 3S0CA 5BWFA 4AF0B 4AD5A 2XGBA 4W7WA 3EDEA 4CGTA 2QVHA 4PB3A 1M65A 1BAGA 3L0GA 1EDQA 3T2QA 2J27A 5D37A 1ZSXA 5FJOA 2Z1KA 1OZMA 2ZFAA 4YMZA 3QHNA 1AH3A 3KM8A 4HSHA 3B0PA 4BI5A 2E0PA 1KXVA 2FQIA 1B2YA 1SZEA 4JQAA 1XLBA 4UCFA 3ARZA 5TD4A 4LVFA 4N4PA 5GJNA 3BLPX 3KZSA 1MUCA 3DGBA 2X1IA 4JX5A 2RDUA 3CYJA 5LNSA 1J6OA 4FB7A 1LCOA 4GI8A 3MUY1 1D3GA 2YDAA 4PMUA 1FKXA 4DB7A 2FZMA 4OUIA 3DU0A 3SFKA 1TZ7A 1KQZA 1E6QM 1S1RA 3K8KA 1PYFA 2VRJA 4H4IA 3GDLA 5PTDA 3RF9A 3WJWA 5DT5A 3IIPA 4AZ7A 2NXHA 4DF0A 2PUZA 4D6CA 5G4HC 4OECA 1JGMA 1LZOA 4OOUA 2C18A 3WD1A 5D30A 4B3ZA 3BE7A 4EXBA 1EXBA 3GZAA 1QCWA 1X8CA 2P76A 4US5A 1VLWA 1L6GA 3I68A 1DHPA 3FGCA 2YW4A 3G1RA 5G2IA 2CNCA 3CUJA 2VC9A 2E9LA 2R24A 1UP3A 3D6NA 1GJUA 4Y2WA 3RMJA 1QO5A 3AI0A 3R5EA 4B5SA 2NVAA 3NQFA 1A0DA 2O9PA 3U2EA 1UYQA 2O92A 3TMQA 1U83A 2ZA3A 2J13A 4XB3A 4DPQA 1VH7A 3EWCA 1O1ZA 3W87A 1ITUA 1XYBA 3GHUA 4JYEA 2Y8VA 3SY8A 4XBJA 3WUEA 2R1PA 1S5WA 1XLAA 3W23A 3MT1A 5KZEA 1LT8A 2OG9A 1E9LA 1GT8A 2VEKA 3AUJA 1G4SA 1H5VA 3STCA 3WENA 4DXXA 5EBUA 1CXIA 4O8RA 3V5CA 4UOJA 1VBGA 3O06A 4L1XA 2VVNA 2PWDA 4JFWA 3E2QA 4GJIA 4ICNA 1UROA 4AZBA 3IIOA 3MS8A 3WQ6A 4G8TA 3AS3A 1JUBA 1J9YA 2ZKMX 1W1ZA 3I7RA 5CH9A 3SGGA 1B31A 2E9BA 1UW9A 1X7FA 3HMJG 3L68A 4AD1A 2VGBA 2DVXA 4Z2IA 5A2AA 4WR3A 1WDSA 4S3EA 3TNBA 1XH1A 5A6SA 3DFOA 3RLHA 5CC3A 3ZR5A 1VAHA 3AMKA 2E1WA 3MVTA 1PCKA 3EXSA 3NSNA 2HE8A 3AIQA 3O9NA 3PNZA 5IDIA 3QC0A 5IBXA 1HUVA 2YCIX 2HE5A 2V0TA 3P8IA 3GD6A 3SURA 3UJEA 3OGVA 3VNJA 4MNLA 1GZJA 3GG0A 1GGOA 3MMDA 3G1VA 1W6TA 3T0BA 4QSFA 3VKBA 3HF3A 2WKGA 4ROQA 4DRSA 1UP0A 2G50A 1VHCA 4JFSA 3T42A 4GG9A 1BF2A 3O8AA 4B9YA 1GCYA 3C2FA 4UMBA 3CZGA 4LUTA 1SPQA 3W88A 2JF7A 4NY2A 3T81A 4IMCA 4X2PA 1GJPA 3WD2A 5L9FA 1SJCA 3CNYA 2NV2A 4LFYA 2HS8A 1HVXA 5AECA 2FMOA 4HNCA 4MIMA 1YADA 1W3TA 1A49A 3TNOA 3VZYA 2YZ5A 3W1NA 2GSHA 4QX4A 1W3IA 3H24A 3O3RA 3OTRA 1LL6A 3U0HA 3W22A 4NHVA 5CZKA 4US6A 5CPNA 3FYPA 5BU9A 3PZGA 3I3DA 4PUUA 3VXGA 2HNEA 3T40A 3B0VC 3NYDA 1S2AA 3ATZA 3TAKA 5E5CA 2YFOA 2FPVA 3F1QA 5U4NA 2QV4A 4AZHA 1FWEC 3MI6A 5DLCA 3FEMA 2C6QA 3U57A 4GYFA 1NJJA 3NGFA 3PZOA 3K30A 3WSUA 1VBUA 2W62A 4AZCB 3BLKA 1DQUA 5IM51 5I07A 3TJIA 3A4XA 3GXMA 3JR2A 1UKOA 3B97A 1WDQA 5HNTA 1IWPA 4HQVA 3PUDA 3K13A 3VE7A 2IXVA 4UFMA 3G1XA 3V36A 4JIRA 5KZMA 5LSMA 2G96A 3VYLA 2OQLA 3KLKA 1EQCA 2ZVRA 3ES7A 1I75A 4WEVX 4F40A 1KNWA 4BEQA 4IFRA 3W75A 4TQTA 1XBZA 1OFQA 2G3JA 4WSKA 3WEZA 1XS2A 1QOQA 2GJNA 1CI1A 1VFOA 4K37A 2R82A 1GORA 2OVLA 1LRNA 2X1SA 3A3WA 3GS6A 2CEQA 2NZLA 1EP1A 1A5KC 1V3HA 1LBLA 4ZXOA 3UBPC 4ZB2A 4OQVA 1IXPA 4IFKA 2QPSA 4NILA 4HMCA 3KFTA 3KOYA 3KBMA 4HOWA 3AZTA 4WDXA 2ZQ0A 3QV9A 3CPGA 4P8XA 3AYTA 3T0TA 3WL0A 5AVHA 3SADA 5E09A 1RA5A 4UFHA 4GNJA 1E3XA 1YPFA 4LYQA 1PX4A 3ARPA 2EG8A 3PG8A 2NXIA 3DENA 3KBVA 2F38A 5REQB 3CAKA 3S5NA 3BO9A 3F5KA 3AFBA 1EYWA 4DYJA 3AMGA 3A3XA 5HXMA 2PTZA 4URIA 3VMOA 3QR0A 3VGFA 1W8SA 2NT0A 2XH2A 3OGSA 4HU8A 1O7AA 1TV8A 3VFCA 3URNA 2IMRA 3GG8A 2B7NA 3HPAA 1K7XA 2Y7GA 4M56A 1RPKA 1V77A 4GBUA 1TV3A 4X0VA 2DT3A 3NQVA 4YPJA 3P84A 1TPUA 6XIMA 2JKEA 1MO0A 1MW3A 4KT2A 2BWGA 1GOKA 5T91A 3N15A 2HK1A 1NOWA 2TODA 3FS2A 3G8EA 3UG5A 2ANUA 3EPOA 5A8NA 7ENLA 5BYWA 1RCOB 6XIAA 4M51A 1R87A 2F6KA 4MGGA 2E6DA 3W00A 1I2RA 1XIEA 2ZX8A 1J01A 4C6IA 4HKPA 3WF4A 4DXVA 1MDLA 3KXQA 1EGMA 2VL4A 2PD9A 2BV9A 1GVOA 1IEVA 2A7PA 4DUOA 5HPOA 5M2FX 1TPEA 3B8WA 3BXWA 1B3WA 3MCMA 1GOMA 3HBLA 3FAXA 3WDRA 1F3WA 1TFVA 1V3IA 5KTLA 3R8RA 4R3UA 3TLQA 4IQJA 3TN6A 4JTTA 5D02A 3G2GA 2JGQA 1FXQA 4GOAA 1EJ7L 3TDFA 1R46A 2PD5A 4L6OA 1R3YA 4DJFD 4LEFA 4H6EA 1D2KA 4HJFA 3AS2A 1TTQA 1RK5A 1YIXA 4PUJA 3KDOA 3G1FA 4N42A 4R7JA 1IXOA 1HJSA 4RR4A 1EGVA 3NO1A 5A6BD 1S5MA 2DZUA 3IANA 4NYUA 1UJQA 3S9YA 3F7JA 4IUOA 1H7OA 1QK0A 1TA3A 4DBUA 3E2VA 2ZXBA 1SZFA 5AOUA 4L1WA 3UQNA 2G5WA 4Y6GA 2WWDA 3EXRA 3W7LA 3KVLA 4YS1A 1UIPA 1Y5XA 3GNNA 3EWDA 5E6YA 5EYWA 5I3KA 3O07A 4WXZA 1V3JA 1FTXA 2DQWA 1XH0A 3MUCA 1EJWC 2PWEA 4KWUA 3MHUA 2J88A 1SZRA 3CB3A 3T4WA 1ZAHA 3TU9A 2VYOA 1J0JA 1HVQA 4LVBA 5J8LA 1F61A 1FBAA 1BRLB 3KVKA 4UFJA 4PTVA 1E9ZB 5BWAA 2VX6A 3AIWA 4WF7A 4HA3A 1KRCC 3O6DA 3EKLA 3AIEA 3CK5A 4KF1A 3D46A 3WLRA 4QR6A 3VIJA 3CMJA 4WDWA 3AUOA 5HUOA 5XINA 3WNPA 3W7HA 1NY1A 2FLIA 5DXXA 4HA1A 3AXIA 5HATA 2X0YA 2ISWA 5GPRA 5CSRA 5E9XA 1NOFA 1ZL1A 1MNSA 4PMOA 2F6XA 2YL9A 3WQOA 3OLEA 2YA0A 1PE1A 2ZRWA 1BVWA 3UJFA 3BG5A 3H2FA 5A1AA 1XGZA 2PTXA 1TR9A 2RFGA 2CIPA 3CB8A 1V0MA 1EIXA 4HZ6A 3EX6A 1KKRA 3LU2A 3B8UA 1HW6A 2OGYA 1FH7A 2E5DA 2VEMA 3ITLA 3MUIA 4B5WA 1I0DA 3N6JA 5AYIA 1R2TA 3F4DA 4U4MA 4UZSA 1KM6A 4MHBA 3N25A 3LI0A 2Q3OA 3U5UA 4GUGA 4IIBA 5LA1A 3LHYA 4M7SA 4GQ0A 5EFDA 2A3LA 4XVDA 1SSGA 3QY8A 3WBEA 1X1ZA 2OGJA 1L6SA 3QPZA 4F66A 1Q6CA 4JTSA 4XK2A 3GR8A 2WW5A 3DHUA 3R94A 3BSHA 4Y9OA 2J79A 3THQA 4PSRA 5K3VA 3WJSA 1OFEA 4NNAA 1DE5A 2VX4A 2YB1A 3VABA 5JIWA 3LLXA 4LTSA 1THFD 3UCDA 3M7SA 1MXGA 4LUSA 3SCNA 1ZFJA 1C91A 2P10A 4IFOA 5D4YA 3NQ6A 3ARWA 2AGTA 4GXWA 1JPIA 1TMQA 1CYGA 5D8WA 4HZMA 3AXMA 1T41A 1RZMA 4LAOA 1US2A 2CHNA 1GUVA 2Q3RA 1OD0A 4ZQOA 4QHRA 4O4VA 2OU4A 2Z6JA 1AL8A 2O7QA 2ZOXA 2YFNA 3AHTA 3GZ3A 3PTMA 1TKKA 3EWYA 1TJ2A 3V16A 4IIGA 4PMZA 1JR1A 2CLFA 4DJDC 5GNZA 3K4AA 4LCQA 1OK6A 5D8ZA 3GW0A 3R12A 3RK8A 1H1NA 1D9EA 2WSYA 5KITA 1U5VA 3K1DA 2E77A 5I23A 4QCEA 4UQ9A 3M43A 4JEJA 3WNKA 3VFLA 4DM2A 1IGSA 2GVEA 2PP0A 3SJ3A 1B3XA 3LQLA 4J5NA 1IEXA 4JTGA 5FKYA 4NJJA 3FGCB 3T55A 6CGTA 4PL1A 2X7WA 4Q8QA 2DIEA 5G1TA 3APGA 2YW3A 1SO5A 2P0IA 1VFUA 1I2QA 4EX4A 3TXVA 4KGJA 2ABAA 5EY5A 3N9SA 3CV6A 1EC9A 3KOWA 3R4IA 3AJXA 4NYYA 1BXNA 3C3NA 3B4YA 3CS2A 1DWHM 3WLOA 4D8LA 2X30A 1F8MA 3E74A 3PZVA 2G3IA 1LOSA 3SCRA 1JNDA 4HK6A 3MI2A 4TVDA 4UBPC 1WAWA 1CGUA 2VFHA 1Q85A 4GKLA 4B5TA 1UKTA 2J4GA 3WJXA 2PRMA 4Z1DA 4WD0A 4UWMA 2WVVA 1Q6FA 1O60A 2YXGA 4IQLA 3SRHA 1ONRA 4NU7A 1R7AA 3U48A 4FZIA 3SCSA 1TREA 3BURA 5ECVA 5D2XA 1K7FA 4C6EA 3NDZA 1KFKA 1X6NA 3DFPA 4FPSA 3W53A 4GI9A 1SMDA 3P74A 2F8QA 3CL7A 2QW5A 1QNRA 4IP7A 4RPQA 1JXKA 4ZSTA 3GXTA 4YXGA 4X61A 3AZRA 3LY0A 3BW3A 3NPXA 1V0KA 2J7FA 4PCNA 4FOJA 4J3UA 4GQGA 1JPKA 4C5ZA 2XSBA 1F4AA 3CUFA 4MPQA 1Z44A 3AIUA 1VD6A 3GXIA 3GUWA 5I3HA 2HVNA 3N2TA 4YTUA 5FL1A 3IUIA 1LRTA 5A8OA 1GYLA 2Y63A 2Y4SA 2DZAA 5DRIA 3S5YA 3BLLA 1O5RA 1H63A 1X1OA 4PBGA 4LUSB 3LPOA 1V6YA 3STFA 1W3LA 3TVAA 4GY0A 1J79A 2YGYA 3VKKA 1HL8A 3PR2A 4HNVA 1AUSL 5TAOA 2VTFA 2IW0A 4ZSUA 3DXIA 3CU2A 1CGVA 1JCJA 3PBYA 5FI8A 4IOTA 1OCJA 4Z0SA 1TELA 4GO9A 1QI2A 2P8BA 3V4BA 3FV9A 4PCPA 3IEBA 3ZR4A 4XZHA 4QNWA 4FLSA 1KLZA 4TX8A 3MV01 1EGZA 4H7ZA 1TPC1 1ZHAA 2W6RA 3AS1A 2G4JA 3AICA 4XV0A 1JDFA 3VK5A 4A8RA 4FAMA 4J9JA 3L4YA 4LJ3A 4LBRA 1FX6A 3GW3A 1L0PA 4FSAA 2B7QA 1XJBA 1NARA 4HU3A 2V6AA 2YOCA 4UTWA 1O1HA 4BWLC 1P6CA 2CLLA 3QTGA 1VS1A 3H2MA 2XSXA 1R3TA 1GHSA 1K77A 2D22A 3BZJA 3WF0A 3WYZA 2C79A 1A0EA 2CU0A 1JFHA 1JQVA 1NIUA 1R3RA 1TB3A 3H26A 2VFIA 3B8SA 1E1EA 1VJZA 1ISXA 2ZTJA 2FTPA 1FWJC 4NG3A 3NL2A 1ITQA 1W17A 3SQLA 1PX3A 3BW2A 4MB3A 2EPOA 4PMNA 1EF3A 5MKGA 3UZZA 1UWSA 1V93A 5FOOA 4JQ2A 4O13A 3PWIA 3UCCA 2PDYA 1F76A 1OM0A 4WK9A 3LS9A 2WKLA 4MB5A 4LC6A 4FIQA 4ZOBA 3PZQA 3R8GA 3HG2A 4XTDA 4KCWA 1H3GA 2CLOA 3P67A 3GVVA 3R0KA 4KFNA 3ZR6A 2Z29A 5CLTA 4F4RA 2VFEA 1AA1B 4N7QA 1VCGA 3BDKA 3R1ZA 3UPMA 3SCQA 4FI4A 3GH4A 1UH3A 4XZBA 4PMJA 1HKJA 3JZEA 3HZ3A 1VLIA 5LZLA 1J8VA 3EKGA 5LXEA 4WQ6A 4DWSB 3FA3A 3S4TA 1E55A 1CXFA 2Y5EA 1EB3A 1DIKA 1KCLA 3W2LA 4S39A 3V1PA 4C5YA 3MSRA 3AYSA 3APTA 3PZUA 4GHRA 3E0FA 2YXXA 4C6DA 1FCUA 3JS3A 3URBA 4M1RA 1HJQA 1KFLA 5CAKA 3EX2A 5F4SA 3SUWA 4AWSA 4O0KA 1W91A 3RAOA 4DNHA 1X8FA 4PRWA 1HKIA 3H2OA 3ECQA 4Q8TA 1F9CA 4JQ1A 2KX9A 4BEUA 5FAGA 3PAJA 2Z24A 5C55A 2QYGA 2X09A 2PDKA 4DX3A 1E73M 2R1NA 1UG6A 1M1BA 1R2SA 1RVKA 3A21A 3GFYA 4JHOA 3OVPA 3ABOA 4HNNA 3KBWA 3S1UA 2FKPA 1TPWA 4BQ4A 5T9CE 3FHQA 4HTBA 3V1HA 4DAIA 1ZCOA 1MNZA 1YEYA 4B15A 4C65A 3WH8A 3OW1A 3T0CA 4ROPA 1XF0A 1VEPA 3DZ1A 4I5RA 1PHQA 5DN1A 4H6KA 3SUTA 4BFAA 4O1BA 2BSLA 3TYEA 2CZDA 3AYVA 2V5JA 3DG3A 1HKMA 4HMNA 1TV4A 3VU2A 3TX9A 2FH6A 4GA8A 1NDVA 2CHRA 5ABFA 3Q94A 1A50A 4I5XA 4RL3A 2NVCA 4KIEA 4A4AA 2ZYFA 5CPMA 5EB8A 3QQ1A 4GNKB 3M5YA 2R1MA 5HBFA 3A12A 3UCQA 4JTJA 1FWHC 3N2XA 4XSLA 4Z2JA 2FYMA 5FESA 2A3HA 3I6TA 2ZXQA 4YHGA 3EOUA 2J7BA 3VNIA 1RQBA 1UQZA 2J6XA 4GIEA 4I9JA 3W24A 4F2TA 1X1NA 3QOKA 3NQBA 2REQA 3EOSA 3GB6A 1FUYA 2C71A 3CUXA 2NWSA 5I2UA 3PNUA 1XFBA 1A3XA 1PZ3A 3HJEA 1YDVA 3CAWA 5T26A 3E49A 2W92A 5HWMA 2VZUA 3C6CA 3LGGA 4DJFA 2UY3A 1RBAA 2Y1HA 4ZB5A 3LOTA 2Z00A 4ERAA 2CZVA 2DH2A 4UNLA 3UPBA 2QS8A 4IXHA 2QCFA 2GYIA 1J5SA 3JUGA 1P0KA 4UTFA 2ZVIA 4O16A 1GNXA 4RNIA 3PZIA 2V68A 3EKZA 5CSYA 2OYLA 1E51A 3KHDA 3IGXA 3WD3A 4V15A 1I1WA 4EPDC 1I45A 2DU2A 4FF7A 4BA0A 2Z1SA 4ZENA 3VIPA 1ISVA 4ERGA 1I2PA 4FR1A 1UZ1A 2NXGA 2ZZ5A 4K2SA 2AMGA 4NXSA 1TYGA 3W28A 4W8BA 1B3ZA 2P3ZA 2RH9A 4BKNA 3KWXA 1UWIA 5FF7A 3KEHA 1W1B1 4CCZA 3HPFA 2HXUA 1KA9F 4IM4A 4DBSA 1L9WA 4DO5A 1TPDA 1O94A 1DOSA 1PO9A 3VD4A 1GQLA 1W9BM 1VRXA 1ODUA 1ZP3A 4DF2A 2PF8A 3QR3A 1EL3A 3UZYA 2BVTA 3NL3A 1EHNA 3C2VA 5CJNA 4MWAB 2GZXA 4DBDA 1RXOB 1GKQA 4O4WA 1XSKA 4Q4RA 4IICA 5AZ0A 5HULA 1SO4A 4EE9A 3HB9A 4F2UA 1C8XA 3ZMRA 4OBTA 5CPQA 2D2JA 1WDDA 3IJ9A 2IPWA 4LC8A 1A5MC 1EJXC 3ZJ6A 3ZT5A 4EKJA 4F0LA 2X42A 4GQQA 3ITVA 3BJSA 5AVNA 4PTNA 3ME3A 4YL2A 1UKQA 3WK2A 3SQMA 1VZWA 5I6SA 2QCMA 1JCXA 1R7OA 4W7VA 2Q09A 4XZWA 1DV7A 4Z2HA 1WX0A 4L4MA 4DBEA 3LTSA 2Q71A 3CLMA 4JX4A 5LYRA 2XIOA 3MC5A 1TPB1 2FGZA 4NKCA 3DG6A 4KFPA 3UJSA 4CQCA 4EWND 1OHLA 3LRLA 4AEEA 3EEZA 1QASA 1RR2A 4LX4A 3WLSA 6REQA 3W38A 4POCA 3E0WA 2P5NA 3NZQA 1QK2A 1UZHA 2WSRA 1PKLA 3NPVA 4WRHA 5G2WA 2HCVA 1XGDA 3PF3A 4GRSA 3STGA 3FA4A 6ENLA 1QI0A 2OXNA 1ECEA 5HNUA 2XH7A 3T6CA 3CUZA 4NZ4A 3WDQA 1CXLA 2VJXA 4BQ2A 4AD4A 2VURA 4H6RA 3LV6A 3IS4A 3BJTA 3LSCA 4R7OA 4H1ZA 2OQYA 3W7JA 1LUCB 3S46A 4IMAA 1KRMA 1BSLA 4S23A 4H9ZA 3KCOA 4E2OA 3N19B 4MG4A 2PMQA 5HMSA 4I8DA 1DJIA 3KRUA 3AHVA 1CCWB 2QULA 3NNTA 3W74A 1US3A 2W5FA 4NASA 1HJWA 2J7DA 2GQ9A 3W6MA 4PEKA 4PMYA 4PTXA 1DBTA 5AHMA 4CEXC 3T08A 3L5MA 2BGQA 3S6TA 2Z1BA 1EBHA 4ZQPA 2E4TA 4IP4A 3U2ZA 4H83A 2W9MA 3EMCA 5CSSA 5CC6A 3V75A 2NQLA 3HQOA 1JZ3A 5HJXA 4QLKA 2BFGA 3F5JA 5BCAA 3NXLA 1WP6A 4NJHA 4MKNA 4P8VA 1UR4A 3T07A 3M16A 2V5LA 1Q4NX 2ISVA 1YHTA 2G3FA 3GNDA 1E15A 3QXBA 2C7FA 3UFYA 1EX1A 1N55A 1B57A 2A3AA 1GQIA 2VHLA 3IK2A 4YCOA 5MHBA 1NAL1 5BNKA 4RNJA 3SW6A 4CNTA 1E1CB 3E2RA 4FIRA 3BAYA 3CQJA 4MY1A 3EA1A 5C2XA 4YCPA 1NVMA 2C15A 1QPOA 1W5MA 4H7CA 2W27A 1UA3A 3GFZA 3GTXA 2Y70A 1QDSA 1IGWA 4HHHA 3GAKA 2FVMA 2VQTA 4HA4A 1EO5A 4BI6A 1W9UA 1ZAIA 3TN4A 1W3NA 2GJXA 3SUSA 2OKTA 4QCFA 1C3FA 4MWAA 1PIGA 3VNLA 1F74A 3MWAA 1IEQA 3GXPA 4HPJA 3OG3A 5I7GA 2W66A 1NF7A 3VKDA 1MXSA 1W1YA 3BW4A 3R13A 3GRIA 2A6NA 3THCA 4GZ7A 3N6HA 4O50A 3XISA 4YIWA 1E4LA 5M17A 4MYXA 3SUVA 2Z2UA 3NDYA 3PPGA 3IAQA 5DMLA 2OEMA 3OP2A 2VC6A 4M6VA 1TJPA 2PU0A 3TZNA 1ELSA 3AC0A 3RR4A 2ACSA 2XVNA 3P6LA 3NQMA 4H3DA 6REQB 4AFYA 3M0KA 2ACUA 2X1UA 4O0QA 2ZICA 2ZZ1A 2FVKA 4C1NB 3GXNA 2GVGA 2ZRXA 4RKAA 1W9XA 5AZ1A 2D0HA 4KCTA 1J0KA 2DY3A 5FJPA 1VIWA 3R6IA 4FLRA 1XRSA 4OTKA 5BMWA 3ABSA 1YDOA 3W7PA 4ZTXA 1T40A 1CLVA 2C3ZA 2WYSA 3QLDA 4GMEA 4K7YA 5C0QA 2H8ZA 2V3GA 3EZ4A 1LUCA 1Q8JA 4DYKA 1VENA 4A3QA 3ZT7A 5HK4A 4A3UA 2GJLA 1EX5A 3WQPA 1CIUA 5JH2A 4O1DA 1JYNA 4S2CA 4UTWC 3T2PA 3LA4A 2CLMA 5DMMA 4G5DA 4B5VA 4LALA 1V3MA 4FS9A 1S5TA 4H6QA 1S38A 3B03A 3P93A 4GI6A 2WMGA 4ZQRA 5FEPA 2PODA 5A2CA 1H7RA 3CV2A 1Q7ZA 1HFBA 3GTFA 1OFPA 3DESA 1BYBA 1XLMA 5I02A 4K38A 3CUHA 1R3SA 3H2CA 3W07A 2YSWA 4JNZA 3CAQA 3TSBA 3S2LA 4XTIA 3RM9A 2BXZA 1EDGA 1VF8A 3KOFA 3RM8A 2EHHA 2XPKA 3HIJA 4RLIA 1RAKA 4K1WA 1EQPA 4ICMA 4IGHA 2HNHA 5D2YA 1QATA 3QR1A 1D3HA 1K8YA 1QNPA 3ITTA 4PB4A 1W2PA 3QY6A 2I17A 4H8HA 2FTYA 4CVWA 1B90A 3H7UA 4RZ6A 2FZ9A 1B54A 3NOEA 2A5HA 1RD6A 3UU0A 4GABA 2PS2A 4D9PA 2QCNA 5AHFA 4E4PA 1Y5VA 2DZBA 5LIXX 4IJCA 4KEMA 3KOZA 1XD0A 3CO4A 3A4JA 1KGXA 4DJDA 2ZC1A 3T0AA 3VOIA 2EPLX 4DUVA 5DX7A 1FCQA 3ZT6A 1E72M 2E68A 4GACA 2PLMA 4E3TA 1KFCA 4ACYA 3I6RA 1I0BA 3C0JA 4L7ZA 5KZ6A 3N12A 1IR1A 2CLEA 4GVFA 5HINA 3ANYA 3PJUA 3NQ8A 3TYAA 2HWGA 3OO2A 4FNTA 3L7RA 2BGSA 3G8RA 5JQ9A 4OZOA 3ARXA 1MQQA 2ZWYA 1F3EA 1WKYA 4S3FA 7TAAA 1QI4A 4BQ3A 1AH4A 1NQ6A 4NIRA 1UWAA 1WUFA 5G4WA 4PMDA 3GTIA 3UXIA 3BH4A 5M03A 1VFHA 4MJZA 3CAVA 1HL2A 5D09A 2Q01A 2DIKA 2V63A 2YL5A 4IMGA 1MQPA 4L9XA 4Q7BA 5SWUA 3W7OA 1T7LA 5TF0A 4UIOA 4F0RA 1YW1A 3M0LA 2CESA 3LNMA 4JTDA 2QCEA 3OODA 3E9AA 3RHGA 5A2BA 4JNYA 1GZ1A 4JIIX 3DBNA 1ZCCA 2QUMA 1XLHA 1XDLA 5AC7A 4XIMA 2FFIA 1ML1A 3KTSA 2VO5A 3FXGA 4WUIA 3C56A 3NQDA 3TK7A 3MJMA 5AYXA 4A8LA 4J35A 3LGDA 4MY8A 4GQBA 3WQVA 1DTUA 3BG9A 3PZNA 4V1XA 3MUAA 1QPKA 1N2VA 1J0HA 1Q6DA 3G22A 4WY0A