3RU6A

1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
228
structure length
220
Chain Sequence
AMKLCVALDLSTKEECLQLAKELKNLDIWLKVGLRAYLRDGFKFIEELKKVDDFKIFLDLKFHDIPNTMADACEEVSKLGVDMINIHASAGKIAIQEVMTRLSKFSKRPLVLAVSALTSFDEENFFSIYRQKIEEAVINFSKISYENGLDGMVCSVFESKKIKEHTSSNFLTLTPGIRPFGVANLAMARENLSDYIVVGRPIYKNENPRAVCEKILNKIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title 1.8 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrF) from Campylobacter jejuni subsp. jejuni NCTC 11168
rcsb
source organism Campylobacter jejuni subsp. jejuni
total genus 80
structure length 220
sequence length 228
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ru6A00
1C29A 3O05A 1TTJA 1ALDA 3PVFA 2VFDA 1GVFA 4R53A 4XKYA 3MO7A 2QCNA 3MWAA 3OVQA 4FNSA 3QMRA 3SI9A 1Q6QA 3C2RA 2NX3A 4AHOA 3C2VA 3PWAA 4KWWA 4MZ1A 1NFBA 1VZWA 4LW7A 3UZ5A 5C6MA 3SIZA 1Q45A 1A53A 1FDZA 1GVSA 2V0TA 3STCA 1OX4B 1A5SA 1M7OA 1VPXA 2WV8A 2FFCA 3QC3A 1VHCA 4UFJA 3UWYA 4LS0A 3LM7A 2J9ZA 4NZJA 1E51A 3EX2A 4MZYA 2VFFA 1TPC1 3BPWA 2QUVA 3L0KA 3LHTA 4MYXA 4UTIA 3GVGA 3V1PA 2WNZA 4EOUA 1W0MA 3OG3A 4LU0A 1NVMA 4GRSA 1S3HA 3S9YA 1GG0A 1FWNA 1GVQA 2I14A 4GXMA 3P81A 1YTDA 4O53A 1FQ0A 1FWWA 4I9AA 1X1OA 1TMHA 1OK6A 4LTSA 4CCCA 1B57A 5I3GA 1W3NA 3M44A 1TRDA 3TAOA 1YXDA 3OHIA 3E49A 4YCPA 2Q3OA 1YDOA 3BW2A 2ZZ5A 4NX0A 3TQKA 4FNRA 1TSIA 1UASA 1F7BA 2ZZ4A 1KV8A 2H3DA 4PH6A 2HMCA 2YYUA 3KXQA 5C5YA 2A4AA 1QMLA 1THFD 2A85A 5EBUA 1PVNA 4RKAA 1H62A 3NQ7A 3W7OA 3ZR4A 4UFMA 2Y63A 4IMFA 3PB2A 2YDAA 3HGSA 2YFNA 1VH7A 2NLIA 5F2IA 3NG3A 1LRTA 1W3IA 5HJLA 3TR2A 1Y0EA 2TYSA 4HT3A 4IMGA 4FX6M 3C6CA 1GT8A 5TBOA 4MKNA 1B9BA 1L6WA 4LVFA 2VOMA 3IGSA 4HSOA 1WOAA 4LT9A 4TO8A 1HG3A 3LXAA 1HUVA 2B0MA 1OF8A 5DY3A 3LXCA 3PG8A 1TV5A 4LVGA 4IX0A 2DP3A 5F2GA 1NSJA 2VFIA 2QR6A 4N6EA 3PBYA 3NPUA 2HS6A 2V9DA 3GZ3A 4JDBA 1EWEA 4O16A 1H1YA 3THQA 2NUYA 1VS1A 5LGZA 2NUWA 3TIMA 4UMCA 3TROA 4JX6A 1YPFA 3W07A 3NQFA 3O07A 4H6KA 1EPXA 2P0OA 1O5XA 2A7RA 3NAVA 4O0ZA 1O5KA 3FYOA 3I68A 5EPDA 3W23A 1YTKA 4KKXA 4Y90A 2OCZA 1JQVA 5AC6A 3FS2A 1DJQA 3PUEA 4FX7A 3P67A 2ISSA 1I2OA 3NM1A 3W9ZA 3P61A 2H8ZA 4YXGA 3NZ1A 5D2XA 4NZFA 5HQEA 1G6CA 5I3IA 1LLWA 4JTGA 1VHNA 5D38A 2JKEA 4U4MA 1H5YA 1GTHA 3QPZA 4ALDA 5LNVA 3WJZA 4POCA 3F03K 2F7FA 1P5BA 3O16A 4ORIA 5LKYA 2I9EA 4UTTA 3USBA 1CI1A 1KFJA 4N2YA 2FPTA 3W1MA 4A29A 4O0KA 1I4NA 2TPSA 4K7YA 1IXNA 2RKXA 2H3BA 4UTLA 1XBVA 5F4XA 2FIQA 2Y88A 4K8HA 2J88A 2B7QA 2V81A 5LNUA 3N2MA 5KZMA 2ZRZA 1FDYA 1GZGA 3STEA 1MO0A 1SO6A 1W3TA 1OYBA 4AHPA 1OJXA 1VYSX 3UWWA 3LBCA 1K8ZA 2GQ8A 5FESA 3EX4A 2GUUA 4XTIA 2Q3RA 3WFAA 5BMXA 1R47A 2EKCA 5HUPA 4UMBA 4X2RA 1WXJA 1ME9A 4AEOA 4QAIA 1SW3A 1S5VA 4Z1DA 4IOTA 1EP2A 2Y7DA 2GOUA 1NEYA 3ATZA 3ZWSA 2NWSA 2NX9A 4IPJA 1KLZA 4JTTA 5FEPA 4QJ1A 2WJZA 4N9CA 1SFLA 5I3KA 1QPNA 2OT1A 3LI1A 1W56A 1OHLA 2I1OA 3TDFA 1JULA 3VFLA 1XFBA 3LRLA 4UFIA 3NVTA 1VCGA 1SO4A 3A5VA 3STGA 4JD4A 4W9TA 2NZLA 3WK1A 3NGJA 1K02A 1FX6A 2F84A 4DO6A 3W7NA 1N7KA 4N4PA 5FF3A 1EA0A 4OGZA 1Q3NA 2PCQA 2JGYA 3TJXA 4O52A 3WJWA 1SW7A 2X30A 4K8EA 4MY9A 5FEZA 4UR8A 2YX0A 3FJ6A 3G22A 3LTPA 5FF0A 3NPXA 1ML1A 1GPWA 3O8AA 1I45A 4O14A 1TO3A 3HJZA 1FDJA 3W7IA 3BARA 4UNKA 2R8WA 4JTEA 1LBFA 4M6VA 1ZALA 3QSRA 3BW3A 3KOFA 3ZS4A 4TU1A 5AHNA 1VYPX 2NXIA 3DFNA 1W5OA 2FLIA 3TXVA 5D05A 1H7OA 4FXRA 2VELA 5T26A 2YXGA 4UFKA 3MP3A 2FTPA 1FY6A 5H2ZA 4XBSA 4O28A 1MEWA 1VCVA 3N9RA 1TTPA 1X1ZA 1JCXA 5FF7A 3W71A 5I3HA 5FEWA 3P80A 1OFPA 3BLFA 1EUAA 1G67A 1P4CA 3KVLA 3HMJG 4Z0JA 1L2UA 2QCFA 4TX9A 1OK4A 4XQ6A 5LNWA 1IXQA 1K3UA 3NR0A 2R94A 4LS2A 2QKFA 3NQVA 4WQ6A 4PEKA 4RR4A 3IEBA 2XFWA 4UMAA 2PE4A 1UBSA 5G4EA 5A8GA 3WJYA 3DHFA 3L21A 3NNTA 3BG5A 3HPZA 4Z1AA 3OEXA 5D33A 3CHVA 1Z42A 4XTDA 4DELA 5F4SA 2CZDA 1F76A 3E0IA 3QW4B 4PFMA 2EAWA 3ZWTA 1J5TA 4Y96A 4S2BA 1XBXA 5L6UA 1GWJA 3S1VA 1PS9A 3DFPA 3BLEA 3IIOA 3CM4A 4DBEA 2QDHA 2DU2A 4FNQA 4ZQCA 3W1XA 1VCFA 3S1XA 3C56A 2WNQA 3UXDA 6ALDA 4JIPA 4DEFA 1X6UA 4LUIA 3PUOA 3SY5A 5BRBA 1N55A 1ONRA 3OBKA 1GOXA 3CIWA 3W88A 3TNOA 2JK2A 3PG9A 1UJPA 3QRHA 3RNDA 3GXPA 5BNKA 1LORA 3RFAA 5SWUA 4BR1A 1XUZA 1C8VA 5J5DA 3TU9A 2CZFA 2JGQA 4K36A 1FCVA 2H6RA 2QAFA 2QJIA 3ATYA 1CW2A 5FI8A 3MHGA 3TSMA 1WDWA 1TPEA 1EP3A 3DKLA 4S1FA 4K37A 1H7XA 5I3JA 1I2QA 3FFSA 2C13A 2X1RA 4A3UA 4ZMGA 3AO0A 4YWIA 1AW1A 2GPTA 4OWGA 1ME7A 2ABAA 1QO5A 5CZ0A 3G24A 3LV6A 3L2IA 1H1ZA 3R89A 3L5LA 1KFKA 3O63A 2G95A 3WJSA 3W2LA 3TUUA 1XBZA 3MBDA 3DH7A 1G69A 5BOOA 1ZHAA 3M6YA 1D3HA 1LDCA 3R12A 4E2BA 1QWGA 8TIMA 3EX1A 3W72A 4Z08A 5LHEA 1GEQA 4HNTA 3PF3A 3W1QA 2J24A 3C3NA 3OVRA 2WQPA 5D37A 3SECA 1TRIA 3W7LA 2Z6IA 3UZJA 4M7SA 4U28A 2RFGA 3RK8A 1RR2A 1ZENA 1JUEA 1H7WA 3GR8A 5K3VA 1EUNA 1U5JA 1FUYA 1P1XA 1UUMA 3L67A 4UIOA 5CGQA 2QCCA 4IPIA 1AG1O 5DXYA 3LDVA 3FLUA 1BEUA 2CLOA 2KZHA 3P8IA 4X3ZA 1LLZA 4GUFA 3S5YA 1RD5A 2GJNA 2VEMA 2DJLA 3L5AA 3TMLA 4BI5A 3L0NA 3MW7A 1O60A 4UR7A 5F1VA 4JNMA 4AMAA 1HTIA 1PE1A 1Z48A 2AGKA 1SW0A 4O1BA 3NEVA 3GDTA 2FPYA 3QM3A 4X9SA 4XUGA 4UTTC 4A22A 3MYOA 3SR7A 5DLCA 3N14A 5E0KA 3IIZA 2FDSA 5AOUA 4BWLA 3HG5A 1K8YA 3UD6A 4X22A 1JCYA 3ZFHA 3MI6A 1SZEA 3O15A 3QJAA 5AHIA 2R91A 3QF0A 4AF0B 4BFAA 2TMDA 1GVOA 2WSQA 2Y61A 4H3DA 3KFTA 4EIVA 4YLWA 3LOTA 2G97A 5LHFA 1TTIA 4ADSA 4JY8A 2WSYA 4NXKA 1IF2A 4L4MA 4IJBA 4O4VA 2J9XA 4GWEA 1OX4A 4JYDA 3W1NA 4CCDA 2BWGA 5CZJA 1FXQA 1VR6A 4J9JA 1VJIA 3NO5A 4O13A 4ZQPA 3IVTA 3KHJA 4PL1A 1W5MA 2WPBA 2VFHA 1ZJIA 2BX7A 4C1KA 3MI3A 4PODA 4MYAA 1GTEA 3C52A 4CCEA 1L9WA 3P7YA 3TA6A 1QPQA 1FCBA 1T99A 1EIXA 4Y6GA 3LCFA 4O54A 3RU6A 2G96A 4FEZA 1M7PA 3A9IA 2FPVA 5DY2A 4Y9AA 2C19A 3F4WA 1GJPA 3W1TA 1R2TA 4PC8A 1OFDA 1WOBA 3F4NA 3HG2A 3N9SA 3CB8A 4UFLA 2QAPA 3CWOX 5G2IA 1KM4A 5D04C 3W3OA 4IXXA 3PUDA 1G7UA 2ATSA 2EF9A 4FX8A 3M5XA 4K7VA 5AC7A 5L9FA 3OA3A 4AWUA 3M47A 7TIMA 1EP1A 3DFTA 3BK0A 3GAYA 3W7CA 3L5MA 2AAMA 3Q37A 2YCEA 3LXBA 1XL9A 4FF7A 4UC5A 2CLKA 3SW6A 5AHLA 3TXZA 1SU5A 4LRSA 5DCBA 4N9DA 3M16A 2QUTA 3W2MA 4PL2A 4TR9A 3TQ0A 1K7EA 3WK0A 3M5YA 2Y7GA 3LHVA 4O12A 3T78A 4HPXA 3UPBA 1TV8A 2TRSA 4WY0A 5D2WA 3HQ1A 2A6NA 2XN1A 3G1FA 2CLIA 1MZHA 3O6YX 4O11A 4Z1BA 3NL5A 3VI2A 1UCWA 1TIMA 1U83A 2VENA 1OFBA 4MFDA 4M6PA 2ZA1A 3KVMA 2O7QA 4AHQA 1ZFJA 5EKYA 4N4QA 3W87A 2BLEA 4HKPA 3CPRA 2Y7FA 4NJJA 2A7PA 2CLHA 2YZRA 1FWTA 3C2FA 4UXDA 5LGXA 3SGUA 3W7RA 3EKZA 3N34A 3QFEA 1JVNA 4DXVA 5K9CA 1F6KA 1RQBA 5CPOA 4A21A 2ZZ2A 2CLLA 1N8FA 1Z41A 1W1ZA 2C15A 2XN0A 3M7WA 4E0CA 1MEHA 3LV5A 1QO2A 3G1HA 1PHQA 4UTWA 2C1HA 2JKPA 2YYTA 4N6FA 1H7PA 1X8FA 3EB2A 5TQLA 2X2GA 3B04A 5EYWA 3PSVA 1W8SA 2QJGA 3GK0A 4JY9A 1QCWA 1F05A 2C16A 5CSSA 4GFSA 4IQLA 2ABBA 3QMSA 2CW6A 4B5NA 3L0GA 2YSWA 1KV5A 3EWBX 2CZ5A 5E93A 3NQGA 3TQVA 5I3FA 2ZTJA 3P82A 1OFOA 4JXCA 5DBTA 3EXTA 2RDUA 5K2ZA 4LS1A 1RVGA 5DBUA 5EA9A 2ZRVA 1QAPA 1A50A 4QNEA 4AH7A 2ZA2A 5AB3A 1Q6LA 4LWWA 3Q2DA 3GR7A 3NQ8A 4JEQA 2E09A 3ANYA 1UB3A 4Q33A 3R5EA 5C55A 3WK3A 3NDOA 2H90A 4TMCA 3UQNA 3GXNA 2CLFA 3IIPA 3BGGA 3DI0A 3FKKA 3PM6A 3UNDA 3TFCA 2CFFA 3NQDA 3VKJA 2BXVA 4R7JA 3DZ1A 3MJYA 4NJGA 1R2SA 4RZ6A 3N3MA 3QW3A 4HHPA 3W1UA 1LRNA 2YW4A 5F1UA 1OF6A 3LCWA 4LNYA 3GDLA 3L9CA 2C3ZA 4RCXA 1EWDA 4JTJA 4H4IA 4IXHA 5G2HA 3RLUA 3OIXA 3MHUA 3G0XA 1K03A 1GYLA 1XXXA 4GJ1A 3JR2A 4RXGA 3EXRA 3C2OA 2OJPA 3W1AA 3IVSA 3NQ2A 5F2MA 3E96A 1T0OA 3UY8A 4PA8A 4ZVJA 4GC4A 3EWXA 3EKLA 1XUUA 1PIIA 3OVPA 1IIGA 3R8RA 4ML9A 5J5RA 2ZZ1A 4IUOA 4ZQNA 3FKRA 4BI6A 1MXSA 2EPHA 4DO5A 2VXNA 1TPFA 3ABSA 5FF4A 1DBTA 3LCXA 2X1SA 3VNDA 2Y89A 4JDYA 2ZYFA 4RLIA 3PB0A 2V8ZA 3HIJA 2Y70A 4GBUA 1DQWA 4A2RA 4JS3A 4BWLC 2FQIA 1LBMA 4AWTA 1WX0A 2BZNA 5KZEA 4ZL1A 3L66A 5G5IA 4HN4A 1H7NA 1T96A 4DO4A 1RZMA 2TSYA 4O17A 5CPNA 2QCLA 4WOZA 1H63A 1J2WA 2ZZ7A 3TE9A 1WYIA 1SO5A 4LC8A 2Z1BA 4NJHA 3B0UX 4JR5A 3PY2A 3DU0A 5U4NA 2A2IA 5G4WA 3O06A 2E6DA 5KMYA 1G4EA 1OFAA 4NVTA 2A7NA 2ALDA 1K8XA 1TV7A 4ADUA 1KW1A 5D2TA 2V5BA 5DXXA 1KFCA 2V5LA 3UWZA 1WAUA 5TIMA 3MHFA 1QDSA 1TCDA 5CZTA 3UYCA 1ZCOA 2QDGA 2ZRUA 3A22A 1V7YA 3ABQA 3DHDA 4RXFA 1JUKA 4UTHA 2Z6JA 1KM6A 1JUBA 3MP5A 3Q58A 4JYFA 4JTFA 4O10A 2CU0A 1ZY9A 4E2DA 1ZAHA 1KFLA 2QCMA 3GNDA 2X1UA 4MUZA 2OT0A 3WK2A 1H50A 1ADOA 3W2KA 5ABTA 3KVJA 5DN1A 4MFEA 4OU1A 5KINA 4Q4KA 1HFBA 1UUOA 3EX6A 4M19A 4XZ9A 1SO3A 1QOQA 3I7SA 4LVAA 4UFHA 2DZPA 3STFA 3FIGA 3CC1A 5BW6A 1D3GA 4HNUA 3W75A 1OFEA 1TPH1 1C9DA 3T44A 4MOZA 1I2NA 3S5NA 1HO4A 1JCMP 2NWRA 3VE7A 3UWQA 5K4XA 4GUIA 3S0CA 4I7VA 3IVUA 3TMQA 2E68A 3M1ZA 4KFOA 3O6CA 6TIMA 3B03A 1YLVA 1KFEA 4P61A 3IIXA 1SR9A 3PULA 4ADTA 4QQ3A 4EF9A 3N73A 3FJLA 1OX5A 1BTMA 1TQXA 3TW6A 2C18A 4ONVA 1ME8A 3E12A 3HBLA 2VEKA 2ISWA 3P60A 3LHUA 4LVDA 3AJXA 2NX1A 3M43A 4IWWA 1LZOA 2QCEA 1VYRA 3A5FA 1KTCA 3NQCA 4NU7A 3SSJA 3TC6A 4CLMA 3S42A 3QYQA 3JS3A 4MY1A 3SGZA 4AWSA 1LOQA 3I65A 5K4ZA 3GX9A 2GVJA 4AAJA 1IXOA 5HR7A 4AVFA 3GKFA 4Q32A 3W7HA 1TYGA 3TSBA 3TJLA 2CWNA 3W7MA 3W2NA 1FCUA 4FXSA 1G4SA 5KSWA 1RPXA 5F4WA 3T4CA 1EEPA 1TPWA 3B4UA 3B8DA 2BSLA 1QR7A 3Q94A 1IIHA 2A6LA 5HR6A 1NF0A 1FBAA 1SFJA 4O1AA 5AHEA 4WXYA 4MJZA 3PS7A 4FIRA 4LV9A 4JYEA 1OYAA 3TAKA 1FWSA 4L4LA 4MLJA 2ISVA 5HWMA 3LTYA 4WXZA 3PBWA 5CPMA 3N19B 3LCIA 1SUXA 3P74A 3QQ0A 3HG3A 4HNNA 3GNNA 4FHAA 5KTLA 3FOKA 1JCJA 4UTMA 3A24A 5DCEA 4OQVA 1BWLA 1DV7A 1JQXA 5KITA 1VLIA 1FWRA 1H7RA 4GNJA 2PRMA 3L65A 3LHYA 2Z2UA 4WD0A 3GKAA 4OHQA 3KRUA 2WSRA 3G3DA 4MY8A 4NNCA 1OYCA 2A0NA 3INPA 4C1LA 3BG3A 3SFKA 2V2DA 5EY5A 3W22A 2D73A 1OFQA 4JX4A 3NXFA 4CNNA 3CEPA 3DI1A 4ZQMA 3W1PA 4EWND 1B4EA 3QPYA 3SZ8A 5LNSA 2ZCGA 1SZGA 3CTLA 1G7VA 4ORMA 2B7OA 2FB3A 3W6YA 3W2JA 3DFQA 2DZSA 4GUJA 4GUHA 1LRQA 2ZRXA 2UV8G 3S1UA 3TC7A 3CT7A 4QIUA 5EL1A 1V5XA 3I6RA 2VEIA 3UXAA 1IXPA 3V75A 4IX2A 1KFBA 2GJLA 3K30A 5AHFA 1PCKA 3LHZA 1QPOA 1OG0A 1LP6A 2C6QA 3B0PA 5HMSA 2VEPA 4R33A 4S2CA 4MIMA 1AL8A 1ZNNA 3LLFA 4ZZ9A 1GYNA 4N02A 2QF7A 2YGYA 3IGUA 3W1LA 4AB4A 3TK7A 5C2XA 1XBYA 5IM51 1BWKA 1DORA 4WX2A 3THAA 2WO5A 4CQ9A 1VC4A 4G1KA 3W74A 1CX9A 3G0UA 3G1AA 5F2LA 3KAOA 4DF2A 2FB2A 2B4GA 3DFSA 3LX9A 4O57A 2B7PA 5CSRA 3NQMA 3G18A 3HF3A 4TIMA 3EWZA 1RQHA 1ICPA 1GVRA 3T40A 1LM1A 3W86A 3S5ZA 1YYAA 3QMTA 1L6SA 3P62A 3GDRA 2QCDB 2A5HA 2C0AA 1OFRA 5G1TA 2E5DA 3G1VA 4QM1A 3I7QA 4O1DA 3KRZA 4XKYB 3HPXA 3LCGA 4EVZA 2GVLA 3A23A 3NYZA 1KM2A 2YPIA 3IV3A 2W79A 4HSNA 4PTNA 3W83A 1AMKA 1G4TA 1JRBA 2ZFAA 1I2PA 3EX3A 4UNLA 3S1WA 3PC0A 4DF0A 2Y6ZA 3S5OA 4FB7A 4I7UA 5AYXA 4MLRA 1O95A 5D2YA 1YXCA 1YDNA 5E1QA 3G8EA 3LCLA 4K38A 5G1YA 1MSSA 1JCLA 1LTDA 4JX5A 3P5ZA 2VKZG 3HG4A 1Q6OA 3H55A 5MHBA 2W0UA 3CWNA 4HNVA 3G1XA 4MZ8A 2ZQ0A 1F5ZA 4IMEA 1YPIA 4RX0A 2RDWA 3IGXA 2P10A 4UTJA 3A21A 2GQAA 4O50A 4FO4A 2E6FA 2P1FA 5D02A 5HWNA 1SQ7A 2E5BA 4O1CA 2X16A 3W84A 3LERA 2CZEA 1KM3A 1SZNA 1F73A 3H53A 1XC4A 3BW4A 5CPLA 4NX5A 4N9EA 2VFGA 2DJXA 2DZXA 4WZHA 3BGJA 4OT7A 3HB9A 3T7VA 4WY0B 3IRDA 2PRHA 4NXSA 4NJIA 5DCDA 4FNUA 2J27A 2QJHA 2YFOA 3DXIA 3R2GA 3TH6A 4WJEA 5HINA 3HGJA 3HGOA 1WQ5A 3HOJA 3GAKA 3NM3A 1MEIA 3GYEA 3HPSA 4AXKA 4Z0SA 5LSMA 3E9AA 3NL2A 1LROA 4DBDA 1HO1A 4PCFA 5D32A 4WOQA 2ZA3A 1SSGA 1QPRA 1I2RA 4WUIA 1YTEA 1JR1A 1LBLA 2XN2A 3NQAA 4LY8A 4NT0A 3U8GA 4LOCA 3NQ6A 2FJKA 2C14A 5AHMA 4FIQA 2CLEA 2A21A 3W1RA 4CNOA 1H51A 4OE7A 1ZAIA 3DKJA 1VQTA 1TPUA 2ZDRA 2JBMA 3E02A 3D0CA 3G3MA 5A5WA 2DZVA 5D30A 3TKFA 5AN7A 3ELFA 1G4PA 1K7FA 1R2RA 3YPIA 4HIBA 3ABOA 1D9EA 1KTNA 4JTHA 1XKYA 2ZZ3A 4UUIA 2A1YA 2Y7EA 1Z44A 1FXPA 4O18A 3CIXA 1K7XA 3EWYA 3MP4A 3C8FA 5IBXA 4YCOA 3PSWA 2OMAA 3LBMA 1KA9F 4JN6A 1L6YA 1PL9A 1H60A 4I7WA 3S8HA 4RV8A 3W76A 1GG1A 3S6DA 1M5WA 1TPDA 1S5TA 2OZ0A 4CNPA 1QFEA 2RH9A 4TMBA 3DENA 4QISA 5HWJA 3CU2A 2E77A 1PCWA 2NUXA 3RF9A 3M9YA 3LGEA 3TFXA 4YMZA 1PV8A 1ICSA 1TPB1 4LUJA 3B0VC 4JIQA 2E5CA 4NJKA 4UCGA 5FEXA 1W54A 3W7PA 1XI3A 1TQJA 4GUGA 2AQWA 4JICA 2IQTA 3QEZA 3UY7A 1TB3A 1B4KA 2ZTKA 3ABRA 1X7FA 3M5VA 1OABA 1R46A 1AL7A 4N9BA 4JTLA 3W70A 1DQXA 3LTSA 3VE9A 5K7JA 3C61A 2VC6A 3CQ0A 4BF9A 1W5PA 3EWWA 2H8XA 1TREA 3LRMA 4RK8A 2DZTA 2G5WA 1DHPA 3NPWA 4D2JA 2YW3A 1RV8A 1VRDA 1OX6A 4MPQA 3SJ3A 1O94A 3U2OA 4FNPA 4LVBA 5HULA 4IGHA 4YL2A 4NQ1A 4O15A 5U7SA 1KM1A 1F2JA 1XDLA 2VFEA 4DPPA 2WNNA 2HS8A 4A2SA 2NXHA 1WA3A 2E6AA 1W37A 4OBTA 4CQAA 3T55A 2O7SA 3N2XA 3KRSA 4KWVA 1J4EA 2QCHA 4EF8A 4UTUA 2ZRWA 3P8JA 2DZWA 3LHWA 4DQWA 1EB3A 2HTMA 2ATMA 2JKAA 1Q6RA 4R34A 5C54A 2ZRYA 3P84A 1JJKA 1W31A 4JTUA 1I8JA 5DELA 1YADA 3W7KA 3W7JA 5HNRA 1F6PA 2RHGA 4Y8FA 2DZUA 3PR2A 5D03A 3FYPA 3BVJA 1AW2A 1TJPA 3UPWA 5CKSA 2DORA 5KZDA 4GE8A 2W6RA 3LRKA 5K9XA 1RQEA 4DPQA 1VLWA 2Y85A 4OV9A 3G1YA 4UTKA 1O4UA 1LYXA 2LLEA 3DAQA 3LLDA 3RMJA 2BTMA 4KFNA 4WY0F 2ZZ6A 3W85A 4JGDA 5CZSA 3M41A 3IIVA 5EMUA 1KM0A 1TJRA 3H54A 4RZ4A 4Z1CA 2EHHA 2CLMA 2PRLA 1XDMA 1QNVA 1GQNA 1NF7A 4K39A 3EXSA 3B05A 4FNTA 4M7TA 1AK5A 4IMDA 5AYZA 3JRKA 1JRCA 4OV4A 1P0KA 1OVDA 1ICQA 2Q8LA 4CQ8A 3R13A 3HO8A 3QH2A 1NAL1 4DF1A 2YR1A 1A5CA 3DFOA 1H61A 4BI7A 1LOLA 3F1QA 3MYPA 3QSTA 2RDTA 1A5BA 3P5YA 4RZ5A 1WBJA 3G1SA 2NV1A 3C0JA 1LCOA 2QUUA 3CEUA 4P2VA 1W5QA 3GDKA 3W7GA 3EWUA 2J6XA 4KFPA 4LV4A 1QOPA 1YXYA 3PAJA 3B06A 3W7DA 4O8RA 2WOQA 4M6QA 3W7QA 1WV2A 3QQ1A 1KBIA 5FF2A 5D2VA 3G0SA 4NNBA 3G8RA 1WBHA 3VCRA 3C2EA 3NL6A 5H91A 4UTWC 2EGZA 3NZRA 3GXTA 1VGAA 1DL3A 3GDMA 3NL3A 3LB0A 1DVJA 3FA5A 1DOSA 2V2CA 2HSAA 1EX5A 3NQEA 1PHWA 1TTQA 4IMCA 1IGSA 4QNWA 5AYYA 3M0ZA 3FEMA 3DBPA 5BMWA 1KM5A 2GVGA 4LC6A 5AFDA 4LRTA 4AF0A 3M5ZA 2QCGA 3G1DA 1BKSA 1TPVA 3U6WA 3BG9A 1AW5A 2R14A 3WJXA 2V2HA 1XM3A 2V30A 2PURA 1SZFA 2V82A 3I7RA 1A5AA 1XCFA 3MUXA 4HPJA 1T8XA 3W2UA 4O19A 5LNRA 4E38A 1FCQA 3CLMA 3BLIA 4ZQRA 3NOEA 1HL2A 1B3OA 3KX6A 5K9DA 1KBJA 5G2WA 3BO9A 3MI2A 3MMTA 3QZEA 4XBKA 3TCEA 4NNAA 4O4WA 4M5PA 4NUWA 3TW7A 5HUOA 4K6AA 4JTKA 3TV8A 3MBFA 1SSDA 3O1NA 3LCHA 1DJNA 2NV2A 3KVKA 3TX9A 3HGRA 4XWUA 3UWVA 2Z0IA 3W7EA 1W5NA 3PBUA 4JTSA 3GLCA 2X1TA 5D09A 2QEZA 4MJMA 3O6DA 1P0NA 1LOSA 2PC4A 4MVAA 3L68A 1DKWA 2NXGA 1JCNA 3LI0A 1F74A 2E1DA 5LZLA 1KTBA 4ICNA 4BK9A 1R30A 1S5WA 3GIYA 2WKJA 3EEGA 5IBXC 4QSHA 4ZQOA 5GVJA 2ZBTA 1YDVA 3GB6A 3TSDA 3W73A 1SPQA 2J9YA 5CG7A 1M6JA 3UWUA 2Y62A 2Q8ZA 4JTIA 1ZAJA 3NPVA 3PBVA 4QITA 2GQ9A 1KLYA 3BV4A 2E6YA 3C4UA 3RLVA 3DGRA 4RJEA 3NA8A 2QCDA 5AC8A 2OX1A 2B7NA
chains in the Genus database with same CATH superfamily
2HISA 3O05A 2OWXA 3OP2A 3PVFA 2EPLX 4MF4A 1CGYA 5BXSA 1GVFA 4JCMA 1FWHC 1VEPA 3CGTA 3MWAA 4HNOA 4NZCA 1JPIA 3PZGA 4QE4A 4CVUA 1Q6QA 3C2RA 2DT3A 4AHOA 3C2VA 3PWAA 3T4WA 3SIZA 3ZOAA 1KXVA 1QK0A 1OT2A 1FDZA 1GVSA 2WMGA 3WLQA 1GQIA 3WLKX 3HV8A 2FFCA 1YBQB 4CQBA 2ZUWA 2V5DA 2XM2A 1E51A 2VFFA 2E9BA 4MYXA 3V1PA 2WNZA 1UIOA 3HQNA 4EOUA 5CLWA 1XKJA 4AVOA 3WY1A 2PMQA 2CIPA 3P81A 4O53A 3SN1A 4QQUA 1PZ3A 4HD5A 1OK6A 4L9XA 1MVYA 1UMLA 3TAOA 4B5UA 2Z24A 1YXDA 3WNMA 1BTCA 3GXFA 3TQKA 3W02A 1NWTA 2WVTA 2X42A 1UASA 2ZZ4A 2ADAA 2BY1A 2H3DA 3ARRA 3DGBA 3FK4A 3RMEA 1V0LA 2Z7KA 2CXEA 1XLCA 4HGXA 2INZA 2I57A 1VB9A 5HAOA 4ACYA 3PB2A 2VEGA 2YDAA 4MB4A 2ZXBA 2NLIA 1WKDA 4S38A 5HJLA 1Y0EA 2TYSA 1K9TA 4IQDA 3W25A 3C6CA 5TBOA 1B9BA 1L6WA 2VOMA 3IGSA 4TO8A 1HUVA 3RM8A 2UZ9A 1NWRA 4QAWA 1IZCA 4LVGA 4G7FA 2DP3A 4OECA 1NFPA 2V9DA 4MJ4A 1EWEA 2FZ9A 3THQA 2ACQA 4JZ5A 1SR0A 3AMDA 3L4WA 3TIMA 5IHSA 1YPFA 1F3TA 2DW7A 3MSRA 1O5KA 1GORA 1E72M 3I68A 1L0PA 4F2BA 1E6PA 2WMHA 1JQVA 3FS2A 3WH9A 1Q6GA 4FMVA 1OG6A 4YXGA 4YNGA 4H9XA 3DUGA 3ALGA 3MUAA 2PZNA 2J79A 3SDOA 4ZOCA 1E6XM 1CXEA 4H00A 1H5YA 1GTHA 3QPZA 4ALDA 3WJZA 4C5YA 2BS9A 4AIUA 5A3HA 3O16A 1C90A 4GVFA 5G4HC 1J01A 4WRHA 4UTTA 4KCVA 3XINA 3USBA 1CI1A 3CB3A 4B9YA 2DVXA 3W1MA 1JZ6A 4LX4A 4O0KA 1I4NA 4XB3A 2TPSA 1EDQA 2F2HA 2J62A 4ZO8A 2P8CA 3T0AA 1GZGA 3STEA 1XJBA 1MO0A 4A35A 3EPNA 3B9EA 4S3BA 3LBCA 2GQ8A 1EC7A 3EX4A 2GUUA 4BQ5A 3WFAA 2EPKX 5HUPA 4UMBA 4JQ2A 4MJ2A 3ES7A 3MSDA 3FN9A 2ZXQA 2WNWA 4GINA 3ATZA 3ZWSA 2NWSA 3SCQA 1KLZA 4JTTA 5FEPA 4W93A 2EQDA 4N9CA 5I3KA 1QPNA 4HQVA 1OHLA 2I1OA 2PWFA 3LRLA 1VCGA 1SO4A 2PDQA 3M4HA 4TV6A 2XZ9A 3STGA 1B54A 3ZVIA 3WUGA 3MKVA 4NAFB 3UZYA 3WK1A 3NGJA 3MZNA 5C9WA 3EAUA 4DO6A 1N7KA 5FF3A 1GHRA 1EA0A 4HMDA 4U5IA 3TJXA 4CNSA 2BG5A 3S46A 4K8EA 4MY9A 1UWSA 2AMXA 2IQ0A 4UR8A 4AX7A 3FJ6A 3G22A 3LTPA 1ML1A 1N8IA 2R8WA 4M6VA 1ZALA 3TWAA 3QGKC 3BW3A 4TU1A 1PB0A 3F2BA 2V67A 3MY9A 3DFNA 3UA4A 2FLIA 2C0HA 3LNMA 1M3UA 3TXVA 5A8QA 2VELA 4O1FA 5T26A 2FTPA 1ODUA 4XBSA 4O28A 1E1CA 4HYWA 7TAAA 3E5BA 3LSCA 3N9RA 1OFPA 2OWCA 1JF5A 3BLFA 3KVLA 1RP9A 1D8CA 4TX9A 1IXQA 3NR0A 4OZOA 4A6GA 4UQEA 2ALRA 4LS2A 3OOQA 3N1AA 2QKFA 3CBWA 4KF1A 2WVSA 1CXHA 3IEBA 4RR4A 2J7BA 4PUEA 1UBSA 4PUNA 5A8GA 3WJYA 1FWIC 1TR9A 3L21A 1EX1A 3EA2A 3OEXA 1JYVA 3O6AA 5E9XA 2YOCA 1F76A 2QIWA 4Y96A 1R38A 3W28A 1IEVA 1VFTA 4NKCA 4DBEA 2FYMA 1POJA 4FNQA 4ZQCA 3W1XA 5AVHA 1EJWC 3S1XA 1UKTA 1VRXA 4LUIA 1UJQA 2BOGX 5DT7A 3CIWA 3TNOA 3PG9A 5I09A 4PTDA 2QJNA 1W17A 2EJAA 4QGCA 4YJ5A 5HMFA 4LCRA 1E3ZA 1MMFA 2J7HA 3UCQA 2H6RA 1XISA 1HL8A 4KEUA 1BD0A 3MHGA 4B5TA 1W3HA 1U22A 3DKLA 5I3JA 3H4WA 1WB0A 5TD4A 4A3UA 1PYMA 2WHJA 1AW1A 3BOFA 4EWJA 1ME7A 3GR4A 3FJ4A 3DIPA 1QO5A 2WLZA 3AALA 4H1ZA 3L2IA 4KMQA 1KFKA 3KZPA 3O63A 3WJSA 3W2LA 4A05A 3CQIA 1P7TA 2NVAA 1D3HA 3WLOA 2EKGA 1LUCB 3GBEA 4W7WA 1X7IA 5LHEA 4HZ7A 2F6KA 4JTRA 3W1QA 9XIAA 3OVRA 4WK9A 2WQPA 1E56A 4GZIA 1CB7B 2WZIA 1MRAA 2QPSA 2RFGA 1XCWA 1RR2A 1KCZA 4L6DA 1H7WA 5K3VA 1EUNA 1HIZA 1P1XA 3L67A 2V3FA 4UIOA 4KETA 2OU4A 5DXYA 1JYXA 3GWQA 2KZHA 3AMKA 4Y2WA 4X3ZA 4K2SA 1L8NA 2DJLA 3IUDA 4BI5A 1J96A 1NIUA 4CU6A 1XH0A 4UR7A 5F1VA 4AMAA 3QC0A 1JYWA 2SFPA 4F0RA 3V36A 2HV5A 4GCXA 2QDDA 1SW0A 3HQOA 3QM3A 4XUGA 4UTTC 3LBOA 3K2GA 4GY7A 3H2NA 2Z2BA 4GXPA 1GNXA 4EANA 5C8BB 3HG5A 1K8YA 2Y5SA 3UD6A 3ZFHA 3MI6A 4W8BA 1GVYA 2TMDA 3B9NA 2Y61A 2E8ZA 4YLWA 1CIUA 5LHFA 1TTIA 4JY8A 3LQGA 3U0HA 4GWEA 3WD1A 2VC9A 4JCLA 4PMVA 2BWGA 5CZJA 3ZMRA 1FXQA 1RCXB 1VJIA 4O13A 2OQLA 2HNEA 3KHJA 1BVWA 3MT1A 3TYBA 4GY0A 1GTEA 2PDGA 4WKFA 3ITLA 4Y6GA 4PUJA 3RDKA 2HVNA 3LCFA 3KBWA 5HPOA 1M7PA 4UB9A 2FPVA 3BCFA 1VFHA 4I9MA 1GJPA 3AMGA 3ES8A 3CZKA 1Y5VA 4G9PA 3M0VA 1E0VA 1KM4A 4J5NA 4GOAA 4YU1A 1LWHA 2EF9A 3CHDA 5L9FA 3M47A 2IKGA 1EP1A 1CGUA 1M9HA 3DCPA 3WBXA 3GAYA 1FKXA 4PRWA 5CJMA 3IUHA 1EHAA 1R0MA 2AAMA 3LXBA 3UFYA 4X60A 3W37A 2F38A 4FF7A 4M29A 4UC5A 1IZKA 3SW6A 1SU5A 4LRSA 3LNPA 5DCBA 5BRPA 1EXPA 4Q6JA 5E09A 1BQCA 4IT1A 4TR9A 3R94A 4CNTA 5CBJA 4FK9A 2F6XA 4U5KA 4WR3A 1TV8A 4WY0A 1AUSL 4JNYA 2A6NA 2XN1A 3G1FA 1JDDA 4JBRA 4ERGA 3RG6A 4UNIA 3LQLA 4MMWA 1MZHA 3VI2A 1UCWA 1U83A 3V0SA 1OFBA 4MFDA 2V38A 3FEQA 5C9UA 2ZA1A 1UD4A 3AXMA 3CZGA 5M1TA 1AZ1A 3W0KA 3CTTA 4DYEA 1HX0A 3MZ2A 1J8VA 2FHFA 4KWUA 2Y7FA 1WXYA 4NJJA 3WDRA 1PKMA 2CLHA 3C2FA 4UXDA 4X0NA 4DXVA 3A3HA 4ZB0A 4A21A 3GC4A 4F3HA 1Z41A 2XN0A 2OEKA 3M7WA 4BY3A 3LV5A 3FAXA 4UTWA 2YB1A 1A5LC 3TZFA 2V68A 3PNZA 1UQZA 2DEPA 1B5TA 1DJHA 3NDYA 4JY9A 3SEPA 1GONA 1XSKA 2ABBA 4JFWA 5BU6A 2YSWA 1EJXC 2CZ5A 3QR3A 5E93A 4QE1A 3B0XA 3E0FA 5JMUA 5CC7A 2RDUA 2W66A 1RVGA 3QY7A 5DBUA 1X97A 1QAPA 3C0SA 2J4GA 4AH7A 5AB3A 1VKFA 3Q2DA 4H9MA 3GR7A 3VGEA 3UR7A 3P6LA 2VGFA 4M80A 4QROA 3WK3A 5HOSA 3WNKA 4TMCA 2FFIA 3GXNA 3ITTA 4NZ3A 1TJ0A 3MC5A 1S2WA 4R7JA 4AIEA 4RZ6A 2PF8A 4JFTA 1F4HA 3W1UA 1LRNA 4CU8A 3CHEA 2W9MA 5BXPA 1OF6A 3LCWA 3W6MA 3MUCA 1G0CA 1ZBKA 1CECA 4ATDA 1T40A 1XIJA 1U1UA 3W38A 4H4IA 4MPKA 5G2HA 3RLUA 5KETA 4GVGA 3V5CA 2J25A 3JR2A 1SGJA 3SAZA 3NO1A 2OJPA 3W1AA 1AH4A 4D6EA 1R3WA 4PA8A 1MQPA 3MA8A 4GC4A 5CCZA 3H2EA 3EKLA 3EBVA 4LYQA 3WNPA 4J3UA 3K8MA 1W1TA 1C8XA 5REQA 3T6CA 4QS5A 2XH4A 3FKRA 1R3YA 4NYYA 4Q22A 4IMAA 1EKOA 2EPHA 4EXBA 1TPFA 3AYTA 1DBTA 3KL0A 4E4PA 2BOFX 4JDYA 4ZCWA 2ZYFA 3HIJA 4GBUA 1EPVA 3T8QA 3TTOA 1UC5A 4X9YA 5FJJA 4ZL1A 2PSNA 1UP2A 5CG0A 2VMFA 3K46A 2XYLA 5JXQA 1PO9A 3B0YA 3RPDA 3TNBA 5CPNA 3AAMA 4F0HA 3UG4A 3AWNA 3B0UX 4YVVA 4BHYA 4QLKA 3VIIA 2A2IA 3O06A 1HJQA 3ARPA 1XWYA 4PYSA 5D4YA 1OFAA 4ZOBA 1ONXA 4AYSA 1J0YA 1MNSA 4AWEA 3GRIA 1TMLA 4ZBCA 1TV7A 4IGSA 4ADUA 1MI3A 1KW1A 3LD5A 3KL5A 1FOBA 3AIVA 3H12A 5EB8A 3WH5A 2QZRA 2WMIA 3EOOA 3URNA 1M03A 1MZRA 5EBAA 2PWHA 3B9DA 1XIDA 4JTDA 1AMYA 2WLYA 3A22A 2VWTA 3K8KA 4WHBA 3ITVA 4KRZA 1FHVA 4H6RA 1JCTA 4JYFA 2HZGA 2CU0A 1IEXA 3PJUA 4E2DA 3K5XA 4J3WA 2QCMA 1I9CB 2OT0A 3U4AA 3WK2A 1H50A 5ABTA 3W2KA 4LXFA 5DN1A 4MFEA 2ZUTA 5KINA 1TELA 1MXGA 3TP4A 3EX6A 1GZ1A 3UGRA 1QOQA 3I7SA 4Y8EA 2PTZA 4JQ3A 4C65A 1TWDA 3STFA 1V51A 4R27A 3V0TA 2VZOA 3W75A 4HN8A 4BJHA 4MOZA 1HO4A 2VGGA 2GQ3A 1XV8A 2OLHA 2W27A 3CUGA 4ZFMA 3DYPA 4P8VA 5CH9A 3PK7A 4UQAA 3BAJA 3B03A 1YLVA 5BRQA 3OLEA 3T0CA 1SR9A 3PULA 4AQLA 3WD3A 3EA3A 3N73A 3TW6A 4ONVA 2QMKA 1J0ZA 3HBLA 3PUGA 1HKVA 3E74A 3P60A 3TOPA 3VK5A 5LXXA 1Q7ZA 4KCWA 3TN4A 2NX1A 1JG9A 2IPJA 4AY7A 3D3AA 1PKYA 1KTCA 2Q09A 4NU7A 1F61A 2QW5A 1ITQA 3S42A 3A64A 3KBJA 4GACA 3SB0A 3VAVA 4K3ZA 2GVJA 4CCZA 4WEVX 5HR7A 1GVIA 1Q5MA 5BOEA 3WBAA 2YA0A 4A4AA 1AODA 1EC9A 3TJLA 5FSDC 1XICA 1RPXA 3KM8A 1XLGA 2PDXA 3T4CA 1OM0A 4RW5A 3ZR6A 2PDJA 5TF0A 3B4UA 3WL0A 1QR7A 4RE0A 3A9BA 2A6LA 2YLAA 5HR6A 5CC5A 5AHEA 3R43A 3PS7A 4FIRA 4PMUA 4C6MA 3UPMA 4Q8MA 1P1MA 4HZ8A 4L4LA 2ISVA 1MW1A 4R7OA 3HG3A 4HNNA 3T8LA 3R0KA 2PDHA 5JBFA 4ICMA 3KBSA 3FOKA 1JCJA 3KW3A 4HCDA 3B3DA 2D69A 4BKNA 3WQVA 4FXFA 3BLKA 3PZ9A 5KITA 2YXXA 1EDGA 4TOQA 3OW1A 2PRMA 3L65A 3CO8A 3CPUA 4WD0A 3GKAA 2QV4A 4OHQA 1V0KA 4JFSA 2H9AB 1AQMA 2A0NA 4GYPA 3INPA 3K13A 3BG3A 3IWPA 1ZGDA 4MDPA 2JFEX 1KCLA 2VD8A 1FP9A 4CGTA 4IIGA 4EWND 1ESWA 3QPYA 2ZCGA 4JKMA 1SZGA 3CTLA 4GGHA 5EFDA 1CXIA 2B7OA 2FB3A 2EBNA 3MTWA 4GMEA 4DJDD 2ZRXA 3NSMA 2UV8G 3S1UA 2PGWA 3R58A 2HK0A 4PZVA 2VEIA 3WF1A 1IXPA 4IX2A 2GJLA 3K30A 1UR3M 2RJGA 4W86A 3H8AA 4I3GA 2C1GA 5HMSA 2VEPA 4MIMA 3UEQA 1GQKA 3EOEA 3PPGA 3VOJA 2GGHA 3W1LA 2BBFA 4AB4A 1CGXA 4G56A 5IM51 1BWKA 4GVIA 2WO5A 3WLRA 3BLDA 4DX3A 3W74A 2ZUUA 3CO4A 1CX9A 3BV7A 1QUMA 2DVUA 3G1AA 1L6FA 5F2LA 3KAOA 3CASA 3DFSA 1PBGA 1UG6A 2XWEA 4O57A 4GO8A 3PZTA 3NQMA 4TQTA 1V3IA 2GVEA 4GPNA 4Z17A 4YN5A 4DHGA 2OGYA 1EJSC 2OOGA 3VINA 4H8VA 3GFXA 1BKHA 3AYRA 4J3TA 1PDZA 4LNCA 3W86A 3FX4A 3GHRA 1L6SA 2QCDB 1OFRA 3WQ5A 4QM1A 1V3JA 4DZAA 3N12A 3HPXA 4EVZA 4FOKA 4H7ZA 1DEDA 2WM1A 2WVUA 3LU2A 5I23A 3IPWA 4PTNA 1SYTA 1AMKA 1JRBA 3HM7A 4D72A 2E67A 1KFWA 2Z1SA 3TW9A 3S5OA 1XF0A 4I7UA 1QATA 1C9WA 2W5FA 1YXCA 1FTXA 3VIPA 1H09A 3GFZA 4XZMX 5C0QA 1Q6OA 1E9LA 3MSYA 2C8NA 1E1FA 1YPIA 2RDWA 2PB1A 3UR8A 1OEPA 4Z2JA 4UTJA 4L65A 1ISXA 3M7SA 2E6FA 5D02A 2E5BA 3N4AA 3W84A 3VTRA 5EU9A 2PP1A 4W5ZA 4CD7A 1HNYA 1SZNA 2ZICA 2FZDA 2WMFA 2Z1WA 1XC4A 4FSAA 4UZSA 5A6JA 5CPLA 4NX5A 2VFGA 4WZHA 4UQBA 4OT7A 3T7VA 3GHTA 4WY0B 3NURA 2ZUMA 1X38A 5DRIA 2PD9A 2FHCA 1QRQA 4AZHA 2PC8A 1KXQA 3PHAA 4FNUA 2J27A 1O12A 2YFOA 1PWLA 4LUTA 4CD6A 5HINA 3VNLA 3SURA 2YCJA 3HOJA 3KDOA 3DG7A 3GBDA 1E70M 4QEEA 1KB3A 3DDMA 2EG6A 1P6BA 1ISVA 3C8NA 4NYUA 1EQPA 1IYXA 4WUIA 2XN2A 2FJKA 4QRNA 2J78A 1N2VA 1CB2A 3AU2A 4JIRA 1ZAIA 1FWGC 1VQTA 3DKJA 5ABHA 1SJBA 1KCXA 3HA1A 3D0CA 3VIHA 3N2BA 4W8AA 5A8MA 5D30A 3TKFA 1Z8AA 4H8UA 4R9OA 3VIOA 3WEZA 2TODA 2NLYA 1KTNA 3CZLA 2PD5A 2E0PA 2A1YA 4O18A 4BCEA 4RE4A 4X61A 1K7XA 1HF6A 3MP4A 3IJ8A 3FGCB 3PSWA 3WMSA 3H22A 1HKJA 1L6YA 1UC4A 1M68A 5FACA 2J7GA 1M5WA 1S5TA 2BVWA 1QFEA 1O7AA 3RHGA 3DENA 5CPTA 1PCWA 2NUXA 4YMZA 3R0UA 3POHA 1UUQA 3I6TA 1ICSA 5A6SA 1B3YA 4IP4A 3QEZA 1ZQ5A 4ERIA 1NDZA 1ITUA 1X7FA 4XZLX 2WC4A 3M5VA 3IJIA 1AL7A 4N9BA 3LTSA 4E2VA 3TYCA 2B81A 1UWUA 1H0GA 1DHPA 4A3HA 2PDUA 4MPQA 1KWKA 2DUXA 2VZSA 2D2JA 5HATA 3MMDA 3R25A 1F2JA 2VFEA 4DPPA 2HS8A 1XSIA 4GI8A 4IPLA 3T0BA 1W37A 4J2PA 5A6BA 2Z27A 4Q6XA 3H6OA 2R1KA 3KRSA 3G1RA 2QCHA 1GKRA 3N4FA 1ZU8A 1OCBA 3P8JA 1W3LA 2DZWA 4DQWA 2PTYA 1EB3A 2ZX9A 2HTMA 3IUIA 1ZP4A 3BXWA 3TQPA 2JKAA 3JZUA 1TFVA 4IG2A 1W31A 4JTUA 3TTYA 1A3HA 2WZTA 5HNRA 4LAZA 2F2KA 1XQKA 4LFYA 2Q71A 5EMYA 3SCVA 1OADA 4H8HA 4L80A 3WNOA 3WMBA 1UR8A 2G37A 1E40A 2YDQA 3FVMA 5K9XA 4US5D 4DPQA 4OV9A 4UTKA 1SMDA 2VZTA 2LLEA 2BGSA 2VX5A 4KFNA 2ZZ6A 4C5ZA 1LQ2A 4JGDA 4PR4A 1EOKA 5ABFB 1TJRA 4HTBA 4JKLA 2EHHA 2AOSA 4IIFA 2PRLA 1QNVA 3EXSA 4M7TA 3THDA 4RE2A 4IMDA 4CUCA 1YX1A 1OVDA 1M1BA 1QTWA 1IR1A 3HO8A 2HXUA 4ZO6A 2CBJA 1RPKA 4Q3MA 1A5CA 3DFOA 1Q6FA 3RRXA 3R6IA 3BLPX 4B3ZA 3V5FA 2BNJA 2XDFA 2RDTA 2VNCA 4DBWA 4X63A 3B8SA 1MUMA 3GH4A 3W7GA 3KWSA 5HQMA 1YXYA 3PAJA 4XISA 7XIMA 4M6QA 5FF2A 5E70A 4WDUA 4MGGA 1XX1A 4H01A 3U5UA 3NL6A 5CZKA 2BY3A 5H91A 4WCJA 5B7YA 3NZRA 2OODA 3RIKA 3OJGA 3CWHA 1KBBA 1DOSA 3NFUA 3NQEA 1PHWA 1TTQA 4QNWA 5FIPA 4PMYA 1ODZA 1U5HA 4P8UA 3M5ZA 3GSMA 3UJ2A 3WBYA 1JI1A 4Z1YA 3I4EA 4B5XA 1AW5A 3WJXA 2V30A 4WKAA 3CYVA 4C6KA 3BJFA 1XCFA 5AZ1A 5HMEA 3MUXA 4RE3A 3GXMA 4HHHA 1RJQA 1IE7C 1ZPTA 5IXEA 1HL2A 2FZNA 3A4AA 3KWXA 1UH3A 3MI2A 3QZEA 2C71A 1FHUA 4RDYA 1J10A 2R24A 1ITCA 4O4WA 4ZB2A 3WZ0E 4A8IA 4LBUA 4HZ6A 4JTKA 3TLLA 3ARQA 3GLCA 4IGMA 4YS1A 3NZGA 4QBXA 3SY1A 4B4HA 3MUZ1 1X1NA 4FP1A 4PTXA 4MVAA 3UR5A 3UJEA 2NXGA 5LZLA 3WLIA 1R30A 1S5WA 4V1YA 3SY8A 2ZX7A 3VIKA 3EYPA 4H8NA 1YE6A 3GB6A 1LG1A 3W73A 3N17A 3ZJ8A 1VFSA 2Q8ZA 4QP0A 4QITA 4GQQA 1WZLA 4M0XA 3DYOA 3ME3A 3C4UA 3D46A 2QMJA 3DGRA 4RJEA 3NA8A 3UJSA 4C6LA 3HMCA 2OX1A 1AJZA 1OIMA 1C29A 2EPNA 2VRQA 1ALDA 2VFDA 3RJYA 1R3RA 4WDTA 1CTNA 2VZUA 3H7RA 3SQMA 1PUDA 2BOEX 1CGTA 1ZRQA 4QXIA 3S3GA 2RAGA 3URBA 3QMRA 2NX3A 3O7UA 1VZWA 3QVQA 3UZ5A 4KEMA 3OA5A 1Q45A 2DZBA 3GDBA 2QQ6A 4DIAA 1A5SA 1QI3A 1M7OA 2WV8A 4MB5A 3UXIA 4UOZA 1VHCA 1R87A 3CLWA 4HTYA 1GHSA 3UWYA 2DSZA 2QUVA 3ENLA 3L0KA 4AY1A 1QT1A 3LHTA 3GVGA 3OG3A 4GRSA 4LPCA 4DWSD 2CKSA 3PP7A 4GXMA 3AIEA 3TEVA 1E71M 3NEHA 2CKRA 1X1OA 2X09A 1EGMA 3SCSA 4LTSA 4O8AA 1B57A 5E6YA 3M44A 3VGDA 3GTHA 1TRDA 4DUOA 1HKKA 4YCPA 3BW2A 3QTGA 5E5CA 1XW8A 1F7BA 4PH6A 1HP4A 3KXQA 1RVKA 1NOFA 3PZNA 1QMLA 1A5UA 1THFD 5I07A 1NP0A 3AIQA 4AEFA 4R9XA 3NQ7A 4GD0A 3W7OA 5BOFA 1VFUA 2Y63A 4IMFA 5C7VA 1S38A 4GI9A 3TVAA 3IAQA 3TR2A 4FX6M 4RDWA 4L1GA 4HSOA 1WOAA 5BYWA 2B0MA 1OF8A 5DY3A 1RJRA 2VFIA 4N6EA 3GM8A 1NARA 3DC0A 3GG8A 3GZ3A 3GZAA 1H1YA 2IPGA 2NUYA 3E0WA 4F0MA 4GC3A 4UMCA 3TROA 2WSKA 3O07A 4H6KA 5DT5A 2P0OA 1SFSA 3A13A 1O5XA 2A7RA 4O0ZA 4M8UA 3FYOA 1YTKA 4KKXA 5AC6A 1BQGA 4FPSA 2DFAA 4KEZA 1WPCA 1D7FA 4ZO7A 2QULA 3PUEA 3P67A 5CPQA 4E4UA 3NM1A 2VUNA 3PANA 5D2XA 3ISIX 2OO0A 3TYEA 3E2SA 2I17A 1LLWA 2WHKA 1VHNA 1FVPA 3KLLA 2WVVA 1MFUA 5BU9A 3U4FA 1CENA 1M04A 3VNZA 3V18A 2CHNA 3F03K 2F7FA 1B3WA 3POCA 4ORIA 3GE7A 3AHYA 4C1NA 3VD9A 1VAHA 1NM9A 1KFJA 1QBAA 1LJYA 2RKXA 1OQFA 4K8HA 1PTDA 2J88A 3VGBA 2V81A 5LNUA 2GWNA 2ZRZA 1FDYA 1ZCCA 5A8PA 1SO6A 1JL8A 2XIBA 1OYBA 3XIMA 2BP1A 3UWWA 1J0KA 3RGTA 5E9AA 4D6DA 2Q3RA 4PMDA 1I60A 1QPKA 3H23A 5DMYA 2GGIA 4JAWA 3VMNA 4QAIA 3AUJA 5AVNA 4AD0A 3S6OA 2J8FA 4IOTA 3H4XA 2PLMA 2GOUA 1NEYA 2NX9A 5DEZA 2P50A 4P7RA 2WJZA 4LQ1A 3AIUA 3CNYA 4I9TA 3VABA 3LI1A 4WSJA 1UP0A 1EBGA 1HQTA 1JULA 1NWSA 1E9YB 4A3RA 1SJDA 5BWAA 1WDPA 2OZ3A 1WCGA 4R85A 1KRBC 4AZ5A 4CNUA 2O9PA 1UKPA 1A0DA 2FZMA 2CPUA 4RUBA 1K02A 1FX6A 2G3IA 3W7NA 3VDBA 4N4PA 4OGZA 2JGYA 5HPCA 1UD5A 2R82A 4HNLA 1V0NA 4M1RA 4O52A 1ZBCA 3GW0A 1SW7A 3CT2A 2FTWA 3B8VA 3DOPA 5FF0A 3OLGA 4O14A 2QNEA 4HZMA 4PN2A 4JTEA 3QSRA 3DFYA 4FLRA 5LIYX 4RNIA 4JQ1A 1EZ2A 4DJDA 2HXTA 4FXRA 2YXGA 3URQA 3MP3A 5HNNA 3DC8A 1ZJHA 2ZE0A 4DXKA 4JN7A 4JNZA 3VDGA 4M3PA 1TTPA 1X1ZA 2E9MA 1JCXA 5FF7A 3W71A 3P80A 1P4CA 3LSBA 2DW6A 3ARVA 1L2UA 1YNPA 4IQEA 4PMQA 4XQ6A 4DI9A 1LL6A 3WQFA 2R94A 3WCZA 2P0IA 4WQ6A 4PEKA 4UMAA 2PE4A 5G4EA 1WUFA 5HXMA 2O4QA 1LF1A 3HPZA 4Z1AA 2P5NA 1FP8A 1DWFM 1V02A 4F2TA 3FCPA 1ECQA 3PTMA 3CHVA 1ISYA 4MKVA 2WKGA 1FH9A 4KT2A 3W29A 1Q2SA 3QW4B 4PFMA 1J5TA 1OGGA 3IACA 4GX8A 1Q85A 1JPDX 1XBXA 2YCIX 5T9BG 4B3KA 1GWJA 3S1VA 4Z42C 1JPMA 4DM1A 1XGEA 2P3ZA 2GLKA 3N11A 4H9YA 3IIOA 3CM4A 4RW3A 2DU2A 4IG2B 4UWMA 3R8HA 6ALDA 4JIPA 3N9KA 2I9UA 5DO8A 2VO5A 4ZR8A 3W88A 4H7VA 3RNDA 5BNKA 2D24A 2XSBA 4B3LA 1XUZA 1C8VA 1P43A 5J5DA 3FSTA 3PZIA 2XISA 1FCVA 3G5EA 5A6KA 3ATYA 4V27A 4LAUA 1TPEA 4S1FA 4PULA 2BMBA 5B80A 1H7XA 1HZYA 1I2QA 3WBWA 2G3FA 3AO0A 4YWIA 4LAMA 2GPTA 4OWGA 3VNIA 3WLTA 1C7TA 1B3XA 5CZ0A 3G24A 5D9PA 1H1ZA 1S3TC 2G95A 3MBDA 1XLFA 1S5MA 3DH7A 1ZHAA 5I77A 3SO7A 2D2GA 4DZ5A 2PODA 3AISA 3EX1A 1BRLA 3M0IA 3WUFA 1W3KA 3PF3A 3C3NA 5TAOA 5D37A 1U1JA 1DWIM 3TTSA 4FALA 2UBPC 3UZJA 1UD3A 1OSEA 4JIIX 4TVCA 4BF7A 1ZENA 2FVLA 3GR8A 2IUZA 1U5JA 1JPKA 4MSSA 5CGQA 2QCCA 3DHUA 4NZ1A 3JVAA 3RXZA 3LDVA 1C93A 4D6CA 5I2UA 1K77A 1LLZA 2ZVIA 4MNKA 2F6UA 2CETA 2VEMA 3VZYA 1TE6A 3TTEA 3L0NA 4JNMA 4WVXA 3LM3A 1Z48A 1EYWA 6XIMA 3T1GA 3T42A 1XLIA 3MYOA 4MDOA 3SR7A 4GJIA 3N14A 1EJ7L 2FDSA 5AOUA 1OINA 4BWLA 1EGZA 1JCYA 1GKQA 1TA3B 5AC5A 1SZEA 4B16A 1X8CA 1GVOA 1XYFA 3KFTA 1NDWA 3RAOA 1O1HA 4ADSA 4NXKA 1CXFA 3UCDA 1IF2A 4O4VA 2J9XA 1JYNA 4YYFA 3QHNA 3Q45A 1YBQA 3QN3A 1PKLA 4OUEA 1YRRA 1QHPA 1R3QA 3WSUA 2VFHA 1ZJIA 4C1KA 3VD4A 1R3VA 4CCEA 3TA6A 2OGJA 1KGUA 1S2VA 1FCBA 1EIXA 4GZEA 4E3TA 3L4ZA 5LYRA 2G96A 1RBAA 1XC6A 4XUYA 3VGFA 1WDDA 3QFWA 4QCEA 1PDYA 3E38A 2WYSA 3VKCA 4KWSA 3GY1A 2OLSA 3CL7A 3F4NA 3HG2A 1KXHA 4IFKA 3FSUA 3HPFA 3GNXA 4LJ3A 3VGGA 4D6FA 2VYOA 3PUDA 1J6PA 1W1VA 4K7VA 3OA3A 5HNTA 4J40A 5IDIA 3BK0A 1J18A 4QX4A 2ZUVA 4DJED 3WQDA 3KBNA 2IPFA 5T8GA 1JD9A 1XL9A 2BY0A 2PTDA 2CLKA 3F2DA 3JW7A 4N9DA 3VM7A 2QUTA 3U2ZA 3W2MA 2Q01A 4C7FA 3TQ0A 1K7EA 3CMJA 3C0QA 4MWAD 3LHVA 4LYPA 4O12A 4DJDC 3T78A 1PTGA 2ESCA 3HPAA 1F07A 2CLIA 3GXDA 1PX8A 5GNZA 3F5LA 3S9ZA 2VENA 3UJFA 4C7GA 4L4OA 2O7QA 1ZFJA 1BXNA 3FHAA 4W85A 4N4QA 3UT0A 5MKGB 4J35A 4YTQA 3ZO9A 2BLEA 3NTYA 2YZRA 2OXNA 2XHYA 1A49A 3SGUA 3QFEA 3N34A 1JVNA 1Z6KA 5D9OA 3NZPA 4BA0A 5CPOA 2EG8A 3QV9A 4HYRA 1XLKA 1A5KC 1N8FA 4H41A 1W1ZA 2C15A 1W2PA 1XIEA 3ARUA 4HOXA 2WZHA 2C1HA 2YYTA 1H7PA 2MNRA 5CQ1A 3OZPA 5TQLA 3S4TA 3GK0A 3OG2A 4D8ZA 4LYRA 3TJIA 2C16A 1BG4A 5CSSA 2DUZA 3IANA 2OEMA 2Y1HA 3QMSA 2CW6A 1US0A 4B5NA 3L0GA 1JXKA 3TQVA 5I3FA 1MXDA 2WHLA 4GYKA 5DBTA 5K2ZA 3HU7A 3OB8A 4PFHA 4M6UA 1A50A 2YA2A 2Q02A 3GO2A 1JF6A 1LWIA 3ANYA 3RJXA 2CYGA 5C55A 4AD3A 4PCNA 3THUA 1DXFA 3BGGA 4I8YA 3UNDA 1IEQA 2CFFA 2BXVA 1HGWA 4EXAA 3MJYA 2R1PA 4NJGA 1ZSXA 3N3MA 4HHPA 3WF4A 1ZUAX 2YW4A 4LNYA 3L9CA 4FXJA 3S2MA 3BLLA 3SCPA 4CQDA 4RCXA 1YE4A 1EWDA 3BAXA 1HKWA 3MHUA 4NAFA 1K03A 3UZZA 4F9DA 4BQ2A 3H26A 1GYLA 1XXXA 4A8NA 4YVXA 2V63A 4ZEPA 3SQLA 4L64A 1YIXA 3H7VA 5F2MA 3EOLA 1RA5A 4ZVJA 3EWXA 4U2ZA 2IS7A 4B2DD 2OZ8A 3B9OA 2W61A 4NL1A 1LL4A 3IJQA 3ECQA 1REQA 3CV1A 3R8RA 2V5JA 2ZZ1A 1QI5A 3H4GA 4IUOA 3IJLA 3M0XA 3R10A 2CBVA 1MXSA 3RN6A 4YVPA 2VXNA 4DO5A 1QNRA 1I1WA 3AZRA 2UWFA 2Y89A 3PZOA 3RCNA 3WLMA 2VT0A 3AXHA 4RLIA 2V8ZA 3PBGA 1DQWA 2YCLB 1TZZA 4BWLC 2FQIA 2YBVA 4AWTA 1KQZA 1OGSA 4MB3A 2BZNA 1XFCA 5KZEA 1YPXA 1OD0A 2OO6A 1H7NA 1AQ0A 3QGAC 5RUBA 1RZMA 3CUXA 3WG6A 2QCLA 3DN5A 3WQ6A 1J2WA 2ZZ7A 1WYIA 1SO5A 4LC8A 2VEFA 2GUYA 4XZBA 4JR5A 1O68A 2DDXA 1V6VA 5G4WA 4AZIA 4OTKA 4G6CA 2E6DA 5KMYA 2XIIA 4M56A 1XIGA 2ALDA 4AD5A 3WH7A 3APYA 2NQHA 4F0KA 3L23A 4P8WA 6REQB 2V5LA 3R8GA 3UWZA 1WAUA 5TIMA 2Z28A 1RLCL 1BVZA 1TCDA 3KZSA 1WP6A 3ABQA 4UTHA 3VKKA 2Z6JA 2YIHA 4EP8C 2WAGA 8RUCA 2GK1B 4RPQA 3Q58A 4JTFA 3REQB 2INEA 1ZY9A 3GNDA 1EA9C 2R6OA 5I02A 4YTRA 1ADOA 3GUGA 4LCQA 3AIRA 5FJUA 4E2OA 4UQDA 3U48A 4Q4KA 1HFBA 1UUOA 2DUAA 3L12A 4Q4OA 1A80A 1SO3A 3VUSA 3E2QA 2POTA 4LUYA 4HSHA 1EGVA 5DX7A 1W1B1 3PPCA 4LVAA 4UFHA 1BF2A 3KTCA 4Y9PA 4GXWA 1J6OA 4RDVA 1UP3A 1D3GA 1OFEA 1TPH1 3VX1A 5FJRA 2ACRA 2NWRA 5K4XA 4WF7A 3IVUA 3TMQA 5CSYA 3M1ZA 3O6CA 2VUYA 3GNPA 4P61A 2CEQA 3PBMA 4QQ3A 2QPUA 4EF9A 4DI8A 1BTMA 1MNZA 1E0WA 1GW9A 1KRAC 3EDFA 5H8PA 5E0FA 5LXEA 3PJTA 2ISDA 2VJXA 3TZNA 2PDWA 2VCBA 2DSWA 3BCDA 3VDHA 1E6SM 3OGVA 1LZOA 2QCEA 2VDIA 3SSJA 2BXZA 1V3KA 1YNQA 3MKKA 1RCQA 4AWSA 2D2HA 5A8OA 3I65A 5K4ZA 3A4JA 3QV8A 4LB4A 3GKFA 4Q32A 3TSBA 1Z9AA 4IP5A 2ON3A 1GQJA 1FCUA 4FXSA 4EK7A 1T8QA 3WBEA 1TIWA 2BVDA 1EEPA 5T9CE 2ZXAA 2BSLA 3Q94A 4D6GA 4OBSA 7PTDA 4P7OA 2BODX 2GL5A 1SFJA 2Q8XA 4O1AA 1E4MM 4MJZA 3K4AA 1EHNA 1OYAA 1FWSA 1JDEA 3A3XA 4MLJA 4GJJA 1OWQA 1ITXA 2J7DA 3CZEA 3VC6A 1XLBA 1Q13A 5CPMA 4W8LA 1E55A 3P74A 2PDFA 2AL1A 2BHYA 1UPMB 4NRSA 4ZB5A 2GFTA 5KTLA 1ZL1A 3KOWA 2P3EA 4OQVA 1E6RA 1BWLA 4B9ZA 2WJEA 3N2TA 3CUHA 4JL2A 5HDRA 2Z2UA 4PTMA 4C6FA 5CGMA 4PSPA 3KLKA 4MY8A 1XPYA 4NNCA 5DFAA 4WGXA 1Q4NX 2VCAA 2VRJA 3SFKA 1AD1A 2V2DA 5EY5A 1WZKA 3PN8A 4J3SA 3W22A 2AGTA 2WJDA 1CEOA 4JX4A 5A94A 4CN1A 1IWBA 3RYSA 1BRLB 1UA7A 1GEHA 3DI1A 3RX3A 1OBAA 3DBNA 1E9IA 3W1PA 1B4EA 4ACZA 3OLIA 5FL0A 3WFLA 3S9IA 1G7VA 4FF5A 3CK5A 1A5OC 3W6YA 3DHPA 1TUXA 4GUJA 1JNEA 1J2BA 1LRQA 3TC7A 1HJUA 3CT7A 1V5XA 1WXZA 4JHMA 2PWUA 3OPSA 1PCKA 3LHZA 1W2VA 3RO8A 4ZZ9A 1TCMA 3MWCA 2QF7A 2YGYA 4X2PA 2QLYA 3I3EA 4ATWA 1DORA 4WX2A 4L7ZA 3RCMA 4G1KA 1D8WA 4DF2A 3NOYA 1W32A 3WQPA 3V5OA 5CSRA 3T9PA 3GIQA 2CHRA 3HF3A 4LBSA 2YL6A 1R85A 4IPNB 4CN4A 3BSGA 5M03A 2WQDA 1V8EA 1ICPA 1GVRA 1NDVA 3S5ZA 1YYAA 2A3BA 3QMTA 2D23A 3P62A 3N6QA 5DQPA 3WDJA 2E5DA 4E3VA 3I7QA 3PNUA 4O1DA 3KRZA 2Y8UA 4XKYB 2GVLA 3A23A 4QCFA 4ZE4A 5BXRA 3CZJA 3NYZA 5CBIA 3W83A 1S5NA 3CXOA 2ZFAA 3WDPP 3S1WA 1I2PA 3VOCA 4DF0A 4XAZA 5AYXA 1QI0A 2A3HA 4XVEA 1YDNA 5E1QA 1V6YA 3MUIA 3LCLA 4LSBA 1MSSA 1GUVA 2ZX5A 4JX5A 4IFKB 2VKZG 3HG4A 1W9BM 4I9JA 2QVNA 3E2RA 4KS0A 2OSXA 4MHBA 3CWNA 4G7EA 1UWQA 4JL1A 4IMEA 3ERPA 1G9HA 5EMJA 5IFTA 2P10A 2GQAA 4O50A 1HJXA 1JZ5A 3RO6A 3AHTA 2XFRA 1SQ7A 1E4LA 1Z3NA 4O1CA 5JVLA 3BJTA 5A2AA 2CZEA 4GI6A 1KM3A 1PYFA 1KBKA 1C3FA 5HANA 1LQ0A 4LB3A 1M7XA 3BGJA 3HB9A 4NAEB 2FMNA 4R7WA 2PRHA 3AYSA 2PF0A 3TWBA 5DCDA 4MNMA 2GJXB 1BGGA 3R2GA 4WJEA 4TTGA 2WCAA 3HGJA 3GAKA 3NM3A 2ASHA 1C7SA 5LSMA 4Z0SA 1LROA 2OLAA 4DBDA 1KRMA 2ZA3A 4DJFD 1SSGA 4A3QA 1QPRA 1I2RA 1JR1A 1LBLA 3S83A 5B7ZA 3NQ6A 1QNPA 3EKGA 4FIQA 2X7WA 3W1RA 1EBHA 1Y65A 3QLLA 9RUBA 1BXCA 4C90A 2BY2A 1GJWA 2GVYA 2DZVA 3ELFA 3YPIA 4IPPA 4HIBA 2BVYA 3ABOA 3CAKA 4H6QA 4UUIA 2FDMA 4JN8A 1Z44A 1S2TA 3C8FA 3LPGA 3NQBA 1KA9F 5FJIA 2DIKA 4DAIA 2W67A 1H60A 4GVHA 4RV8A 2XIJA 2OQHA 3W76A 5H6HA 5DMLA 1GG1A 2V69A 1WDRA 4TV5A 1GJUA 2OZ0A 2RH9A 4ROPA 5GNYA 1UD2A 5I06A 3GHSA 3RF9A 3LGEA 4C6QA 2IXVA 4EX4A 5JQ9A 3KCJA 2PA6A 1TPB1 4AVNA 3B0VC 2E5CA 4NJKA 3W7PA 1W54A 4XAPA 1XI3A 1TQJA 4GUGA 4JICA 2RJHA 2XJ7A 2ACSA 3KP0A 3UY7A 3B8WA 2ZTKA 4W88A 1OABA 4JTLA 3W70A 2WCGA 1LLOA 3A12A 1KC7A 4F0SA 2H8XA 2YZ5A 1NY1A 2DZTA 2G5WA 1EOMA 2PLKA 3GU1A 3NPWA 4D2JA 5JH2A 1UR9A 1EJRC 4KRUA 3SJ3A 4F48A 3U2OA 4LVBA 4D6HA 4P7QA 1BYAA 5PTDA 4UCFA 4NQ1A 5U7SA 3UG8A 4GQGA 1XGZA 2WNNA 4KW2A 2Y0FA 4A2SA 3OIHA 2Z7GA 1WA3A 4IIBA 1REQB 4CQAA 3BSHA 3N2XA 3EB4A 4EF8A 4PUDA 4ATLA 7CGTA 3LHWA 1FFRA 4HJWA 3FY1A 4Z2KA 1Q6RA 4GYJA 3VNMA 4RV3A 4R34A 2WZMA 1UBPC 2ZRYA 4OIFA 1R6WA 1A3XA 3RM4A 1F6PA 4Y8FA 3N3TA 3GG0A 3OODA 5EFFA 3SUTA 4HPGA 4U3AA 2DORA 1Q4WA 2NT1A 2X2YA 3DERA 1W9UA 4B90A 1RQEA 4GHRA 1VLWA 2Y85A 3A3WA 4KGJA 1TX0A 3G1YA 3L2LA 4HA0A 1AZ2A 4EKJA 1LYXA 3LLDA 1WKEA 3RLHA 1IQ8A 4RZ4A 2CLMA 5GPRA 2POZA 1GQNA 1NF7A 4HHLA 3B05A 4RNFA 1DJGA 4FNTA 3WQCA 3CUIA 1I1XA 5I03A 1F8IA 3QV6A 3WL1A 1JRCA 1XYCA 4L1XA 1MRQA 5A95A 2DQXA 4BQ4A 4DF1A 4H04A 1BXBA 1OZQA 2J75A 4DJEA 4DUXA 3MYPA 3ITOA 2QUNA 1WBJA 4EAYA 4H2HA 3WO8A 3G1SA 3C0JA 3VIMA 1W5QA 3BOXA 3E1F1 8XIAA 1GGOA 2J6XA 2YBUA 4KFPA 1CBGA 1JD7A 3UJRA 3W7DA 2WOQA 2HCVA 3IRSA 2BASA 3G0SA 3HZ3A 4MNLA 5LIUX 2DSKA 4QE5A 5JIPA 3TOYA 3G8RA 3ZZ1A 4LF1A 2D0GA 4OUIA 1UKOA 1GOOA 1VIWA 4JFVA 3CQKA 3LENA 3LB0A 4CQCA 5DF0A 4E4FA 1PZ1A 1UOZA 2H9AA 4HHMA 4IMCA 3EPMA 1CLVA 5IHRA 4DYKA 1X6NA 5BMWA 1XRSA 1KM5A 4DWSB 2QHAA 1K9DA 2ZUSA 1VENA 2FKPA 4Z2IA 4HOWA 1FHDA 1QHOA 3KRBA 1XM3A 1SZFA 5E0CA 1XSJA 1A5AA 4HPJA 5H8MA 1T8XA 3W2UA 4O19A 1H1NA 4E38A 2J13A 2V3DA 3CLMA 1ELSA 1XH1A 1EXBA 3BLIA 4S3KA 3S2LA 1I75A 1SJCA 5K9DA 4B5SA 3BO9A 4XBKA 4MADA 4S3DA 4US6A 4M5PA 1EO7A 4NUWA 3TW7A 3RX2A 5HUOA 4Y9OA 1YW1A 4K6AA 1SSDA 7REQB 2X40A 4A8RA 4XWUA 3WH6A 2Z0IA 1W5NA 1DJZA 5FAJA 3HV9A 3W53A 4MJMA 3D47A 1LOSA 1RP8A 2PBGA 1DKWA 2VGBA 3A6OA 1JCNA 2E1DA 4O1EA 3VKDA 4ZQOA 2HE8A 1YDVA 1E3XA 2VRKA 2NSXA 3UWUA 4C6JA 1ZAJA 3J7HA 3NPVA 1E43A 2GQ9A 3RLVA 1JZ2A 3VC5A 2QCDA 3KOZA 5AC8A 3N4EA 4O0QA 1A5MC 2R1NA 3WF3A 4L5ZA 2PDNA 2ZUNA 3VPLA 1RAKA 1CXLA 1QJWA 1UQYA 1O66A 3MO7A 5C9RA 1C8QA 3FAWA 1VPQA 7ODCA 4WJXA 3SI9A 1UPPA 4B2DA 4KWWA 4PUUA 3LEPA 4GZJA 1A53A 2BHZA 4ACZB 2PWGA 2V0TA 4LYKA 1HP5A 1OX4B 1UH4A 5ECVA 3EEZA 1VPXA 3WD4A 3GG7A 3ITCA 4GIEA 3OGRA 4LS0A 3LM7A 1MW3A 4NZJA 3EX2A 1RALA 4MZYA 1TPC1 5FSEC 5D9NA 4LU0A 1NVMA 1S3HA 3VU2A 3S9YA 3ICJA 1GVQA 3RU8X 2HK1A 2I14A 4YYCA 3GH7A 1FWWA 4INFA 1TMHA 3EMQA 1TV4A 3RR1A 5I3GA 1W3NA 1V3HA 1US3A 2WSPA 3E49A 2Q3OA 4LUSB 3W24A 4NX0A 3EWDA 3EDEA 3GH5A 1TSIA 1VBRA 1O6IA 4FNRA 4WDXA 5I79A 3GVVA 1HN1A 3WN6A 2YYUA 1OZMA 1VJSA 3WELA 5C5YA 4DUWA 2A4AA 2PCEA 5EBUA 4AISA 1PVNA 4AMCA 4NZ5A 5FJOA 2V6AA 4AZBA 3GUWA 3MB9A 1OCQA 3HGSA 2YFNA 3QOKA 1VH7A 1P0DA 2PEVA 1VBUA 5F2IA 1W3IA 4IMGA 5HMDA 1GT8A 1QW9A 4MKNA 4LVFA 1PX4A 1A0EA 1HG3A 3LXAA 3BAYA 2ZWZA 3A4WA 1V6TA 4GX9A 1VJZA 4JIHA 1XRFA 4G1NA 4IX0A 3KTSA 1NSJA 2QR6A 3K8LA 3PBYA 3NPUA 2OSWA 1KCKA 2HS6A 2NQ5A 4JDBA 4O16A 1R9YA 1VS1A 3TR9A 2E9LA 2NUWA 3VOGA 2CERA 2YA1A 3W07A 3EDJA 3NQFA 4A8LA 4PEEA 1EPXA 1LT7A 2VX4A 4DJEC 5I00A 3QXBA 1DQUA 2OQYA 3QQWA 3T2PA 3R1ZA 4NASA 4IIHA 4Y90A 2OCZA 1XRTA 4UR9A 1PZ0A 4G7EB 4FX7A 2ISSA 4LH8A 3W9ZA 2H8ZA 3FGCA 1EEXA 1UROA 3NZ1A 1FWFC 3VFCA 5IRPA 4NZFA 5HQEA 1GW1A 3N18A 4JTCA 1G6CA 1NDYA 1UR1A 4QHRA 1H49A 4C6OA 5T91A 4Q8TA 3LLXA 1U30A 2JKEA 4U4MA 3BUVA 1UWTA 2OPJA 5LNVA 3AHXA 1SJAA 2Z00A 4POCA 4PMRA 3K4WA 1NOWA 5LKYA 3D5HA 4JIEA 4TX8A 4N2YA 4A29A 3AFBA 2X0HA 2H3BA 1XBVA 2FIQA 1NELA 1C92A 5KZMA 4UTFA 1W3TA 4H9UA 2YLLA 3VKAA 1R9XA 1OJXA 2O4MA 2YCKX 3V4BA 4HJFA 5A8NA 1K8ZA 1OC6A 1WKFA 2ACUA 1R47A 2EKCA 4X2RA 1WXJA 4AEOA 1RUSA 1Z7AA 1S5VA 2OEJA 2WC3A 1GOQA 4IPJA 3O9NA 3R11A 1AA1B 5DMMA 4CEXC 4PUKA 1F3WA 4QJ1A 5CAKA 4U31A 2PFHA 2HNHA 3ZXWA 1WE5A 1SFLA 1H4PA 3TDFA 2WBKA 3CUZA 4HVXA 3VD3A 5I24A 3NVTA 4IGNA 3A5VA 4JD4A 4Z2GA 2Y24A 1U2YA 4H7CA 4FR1A 3AIWA 3S2NA 1IT0A 2F84A 4XO6A 2JE8A 2XGZA 1AH3A 1Q3NA 1H11A 3PJXA 3VOHA 5FEZA 2EPOA 2YX0A 5CJNA 4IJCA 2PDPA 3NPXA 1GPWA 3O8AA 1I45A 1FDJA 4Q7IA 3W7IA 3BARA 4UNKA 3NWRA 2JIWA 4JKKA 3G77A 3HFYA 3ZS4A 4F2UA 1WZMA 5ABFA 1VYPX 8CGTA 1B90A 2NXIA 1CYGA 5FOOA 1IT8A 2OR2A 2UY3A 1DP0A 3ANUA 4UFKA 5M2FX 4CD5A 4ZOAA 2OZTA 5AC4A 1DE5A 1US2A 1VCVA 1DXEA 3UXLA 3WLPA 5FEWA 5I3HA 1C91A 1ISZA 2G3JA 2ZWYA 3A47A 1G67A 4E8DA 4HBKA 1RA0A 3VOFA 2AL2B 3SCUA 1K3UA 3BANA 4R88A 3WENA 1F3XA 5AZ0A 2J7EA 1Q2RA 4J3ZA 2XFWA 1J0HA 4AZ6A 3DHFA 2C91A 2Q6ZA 3NNTA 2FZBA 5C9XA 2J74A 3FVDA 1PEZA 4XG1A 3E0IA 3ZWTA 1UH2A 5L6UA 3M0KA 2BFGA 3VA8A 1QXLA 5EGRA 2NQ9A 3QBUA 3DFPA 3BSMA 2Y5EA 2QDHA 2DQWA 4IQJA 3BAKA 1VCFA 3C56A 2WNQA 4M81A 1XYBA 3DYMA 3PUOA 3SY5A 5BRBA 1N55A 1QNSA 3VM5A 2EEXA 1GOXA 2GSJA 2QJJA 1KXTA 3C86A 4GIRA 2JK2A 1UJPA 3AZSA 1D2KA 1LORA 3RFAA 1Q65A 5CC3A 1H5VA 2GSHA 5JIWA 3WQOA 3TU9A 4WGHA 4K36A 1OCJA 1V02E 4ZODA 1DJYA 2QJIA 4HCLA 3T09A 2VR5A 3TSMA 3W26A 6ENLA 3C5QA 1XIIA 3TYAA 1GQLA 1JZ7A 2PLJA 3FFSA 3NIYA 3BLOA 2XWDA 2BHUA 1VBHA 3VKBA 7A3HA 4ZMGA 4PMZA 3OZOA 2A3AA 3CAQA 3F5JA 4AC7C 3ARSA 4QLJA 1OC5A 4Q4QA 4XD4A 2ABAA 1HXJA 3HQPA 5GJNA 4DZIA 2PLCA 3L5LA 2WJFA 3TUUA 3PJWA 5BOOA 3NDZA 2WHMA 1LQAA 4AYGA 2WCSA 1QWGA 1L6GA 3IK2A 8TIMA 4NZ4A 1TV2A 1GEQA 2OTDA 4HNTA 5CLTA 2D2OA 3W7LA 2Z6IA 4D1IA 2J7FA 3AQUA 4AEEA 4P5UA 1W3JA 4M7SA 3RK8A 4MWAB 1JUEA 1EDTA 1G1YA 1FUYA 3CHFA 2QIIA 4EXQA 4H9ZA 3ITXA 3QR0A 2CLOA 1ZJAA 1Y5WA 2WK2A 4GUFA 1E15A 2O0TA 2GJNA 3MCMA 4ZXOA 3TMLA 4QDWA 2ZDSA 4QJ5B 3VCNA 1HTIA 1PE1A 1DIOA 2ZADA 2PBOA 3GDTA 1XR2A 2XGIA 4DJFA 4KEVA 5I7GA 4CEUC 5DLCA 1WDQA 3IIZA 2BV9A 4D6JA 3GQYA 3QJAA 5AHIA 4WDWA 2WSQA 3LOTA 4ZSUA 2G97A 3T08A 1B31A 3BQ6A 1Q7QA 3W6LA 5AY7A 4QJ3B 2EXOA 4L4MA 4JYDA 4H9VA 3GU2A 1VR6A 1B0IA 3M64A 1O5RA 3NO5A 1BLIA 4ZQPA 1TG7A 4PL1A 1W5MA 2WPBA 1CCWB 1V03A 5D8WA 3MI3A 4PODA 3C52A 1BHGA 3GC5A 1L9WA 3P7YA 2VD9A 2CZVA 4RZBA 1KKRA 1P0EA 1QPQA 1T99A 2G4JA 3RU6A 3BJSA 4HB7A 1SMAA 2OOFA 3KOXA 2DZAA 5EMLA 3TA9A 3CS2A 5CAHA 4PC8A 5CEWA 2XH7A 3N9SA 4QR6A 1DYSA 1Q8JA 3CB8A 3UXKA 4GA8A 2QAPA 3EB3A 5G2IA 3RX4A 5D04C 1JAKA 2ONEA 3W3OA 4IXXA 2QGYA 1YKWA 4I5UA 3LMZA 3WQWA 2ATSA 1KKOA 4FX8A 3M5XA 4AWUA 3IJDA 3DFTA 1XINA 1B2YA 3W7CA 3Q67A 3NGFA 3E0VA 4L61A 2R1MA 3JUGA 1VFLA 3C3UA 3L5MA 3Q37A 2D0HA 1P6WA 2EJ1A 4E6MA 1VFMA 2VQTA 3AC0A 1PPIA 5AHLA 2GDUA 3TXZA 3T0DA 1MUWA 3M16A 1W1IE 4PL2A 1NOUA 2OVLA 3NJ3A 2Y7GA 1QK2A 2MUCA 4HPXA 3UPBA 2TRSA 3WYZA 5D2WA 3AS2A 3HQ1A 5LIXX 3F7JA 4DUVA 2CESA 2AKMA 3R0DA 1TIMA 3WKZA 3CUJA 2EPMX 4M6PA 1TVNA 3OYXA 5C71A 3KVMA 3RM9A 4AHQA 3B9AA 3R4IA 2OWWA 1QWKA 3RR4A 3TN5A 2X0SA 5CPSA 1JZ8A 4HKPA 1JFHA 3CPRA 3AMCA 2W91A 4IUGA 2DPEA 2A7PA 3BTNA 3MKCA 4UBPC 2IKHA 3Q4DA 1GVEA 3M46A 5F7UA 3I10A 3EKZA 3O3RA 5K9CA 1NU5A 1F6KA 1F4AA 2BGQA 2ZZ2A 3BMXA 3CZ8A 3BGAA 4TTUA 1MEHA 4JOMA 2P8BA 2JALA 2E1WA 3G1HA 4QG8A 1PHQA 2JKPA 4N6FA 2XU2A 1X8FA 3EB2A 2X2GA 2PDLA 5EYWA 3PSVA 3QLDA 2QJGA 4CN6A 1UWIA 1RXOB 5CJ5A 2PGEA 3PTKA 4IQLA 1KWGA 3NSNA 3P82A 4JXCA 4MUPA 2Z29A 4LS1A 4KH2A 2ZRVA 3ZLHA 4FA3A 2IKIA 4IFOA 1GPFA 1R5YA 2X7VA 2ZA2A 3LPFA 4LWWA