2OCZA

The structure of a putative 3-dehydroquinate dehydratase from streptococcus pyogenes.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
218
Chain Sequence
AMRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLGQVTLNDMKRIIEVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
publication title The Structure of a Putative 3-Dehydroquinate Dehydratase from Streptococcus pyogenes.
rcsb
source organism Streptococcus pyogenes serotype m1
total genus 73
structure length 218
sequence length 224
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2oczA00
5D38A 4LVBA 4PL1A 4MVAA 4QSHA 5LGXA 3W70A 5KTLA 2QCDA 3W23A 2F84A 4XBKA 4Z0SA 3G3MA 4AF0B 3GVGA 4LOCA 3W7QA 1YTDA 5LNUA 4O13A 3T4CA 3W2MA 2X30A 4LVAA 1R46A 5F2MA 2X1TA 3LHWA 1XDMA 4KFOA 1XDLA 3STGA 1L6YA 2ZRWA 1JJKA 3M41A 3EX4A 5KZEA 4JX5A 2PURA 2NWSA 2ZBTA 3INPA 5K4ZA 4K38A 3EEGA 3UZJA 1MSSA 1F74A 1R30A 4O4VA 3NL3A 1OYAA 5EYWA 1WV2A 4CNNA 4R53A 1FXPA 4JS3A 1UBSA 3P7YA 3L0NA 3LGEA 5IBXA 1SZNA 4X3ZA 3PBUA 1X1ZA 3W7OA 4RLIA 4ADSA 2UV8G 3FA5A 5K4XA 3NM1A 1PS9A 4QISA 5H2ZA 3NL5A 3O8AA 3SY5A 2PRHA 1FDZA 5FEPA 1XBZA 4TIMA 1EUNA 1RV8A 2GQ8A 2VOMA 2PCQA 3DI0A 3LTPA 4UTIA 2VC6A 3G8EA 2GVGA 2A6NA 4RXGA 1SO4A 3THQA 3U8GA 5FI8A 2OJPA 1H62A 1W37A 4XKYA 3HQ1A 4NJGA 1RZMA 3BLEA 1O4UA 1DJNA 3A24A 3QMRA 2ABBA 1YPIA 3QSRA 5EPDA 2EHHA 1H7PA 3LHZA 1YXDA 2G95A 1TRIA 3MHFA 3W2NA 2G97A 2GOUA 1X6UA 1P1XA 5D04C 3NPVA 1I2QA 3IEBA 1A5BA 2E6FA 2FTPA 3S1VA 2ZZ6A 1F6PA 3S5YA 2TMDA 2V2CA 4O1AA 2WO5A 2Y7EA 1K8XA 4QITA 2WSYA 1LBMA 2V8ZA 3FYPA 5G2WA 4YCPA 2EGZA 1EEPA 4H6KA 4MYXA 4NNCA 2Y61A 3GR7A 2VFHA 2ZRUA 4M7TA 4WY0F 1XCFA 1JCYA 5DY2A 4OGZA 3LXAA 3DGRA 1PV8A 4FNTA 3HGOA 1W5NA 4O18A 4MKNA 3QW3A 3GXTA 1XL9A 4NUWA 1EX5A 5F4SA 4DO6A 2X1UA 1IF2A 4M6VA 4ZQOA 1MEIA 3EWUA 3MW7A 1GVQA 4UTTC 2QUTA 1U5JA 1OFQA 3PUOA 1IGSA 1KFKA 2IQTA 1WQ5A 4FX8A 3S8HA 3Q94A 1YDNA 4IXXA 5AOUA 4G1KA 1LCOA 1R2RA 3W1LA 1AK5A 1J2WA 3STFA 2A4AA 1M6JA 1D3HA 3E96A 1KV5A 3F1QA 3IIZA 4AVFA 2B7QA 4LVDA 4O0KA 3QQ0A 2RHGA 1VPXA 3C0JA 2YPIA 3LI0A 1JUKA 3TW6A 4OQVA 2EF9A 3NPWA 5AC8A 4JYEA 1TTQA 4JDBA 2YYTA 3M47A 3THAA 1TV5A 4QM1A 4MYAA 3SI9A 1SZFA 2YDAA 5D05A 4WY0B 3ZWSA 3W2UA 4RCXA 4IMFA 5LZLA 4Q33A 2OMAA 1EWDA 3I7SA 2XFWA 1F76A 3W7DA 4IQLA 4WOQA 4X2RA 1GTHA 3N3MA 1BTMA 3TSMA 3P74A 1Z42A 1TQJA 4IGHA 3T40A 3AO0A 4RZ5A 4PA8A 1OFEA 4N9EA 3FFSA 2JBMA 1YPFA 3IIXA 1KLYA 3B0PA 4ICNA 1MO0A 2VFGA 3GNDA 1VCFA 1VGAA 3FKKA 1Q6LA 3P84A 1GG1A 3B04A 3EWWA 2QF7A 5FEWA 3EWXA 2A1YA 1YYAA 3IVTA 3LBMA 2PE4A 4NT0A 1VS1A 4JY8A 3VCRA 3N2XA 2KZHA 1TSIA 5IBXC 1G7VA 4EIVA 3I7QA 1ZENA 2H6RA 3M44A 3DU0A 4Z1AA 2ZCGA 4UFIA 3NQGA 3P8JA 3NNTA 3LI1A 4HHPA 1YDVA 3RFAA 1OF8A 4YL2A 2OT1A 3LB0A 3NGJA 1LOSA 3TDFA 3LLDA 1KFJA 1A5SA 1TPFA 4MZYA 3TAKA 3W75A 4YXGA 4Z1DA 1TTIA 3C2RA 3NQ2A 4QNEA 1MXSA 1PHQA 2ZRXA 3MO7A 4HKPA 3LCWA 1GZGA 3R89A 2GVLA 2DZUA 3W07A 1OYCA 3B4UA 1FWNA 4K37A 3W1RA 3W7MA 4DXVA 4O1DA 2WSQA 5CGQA 3BG9A 1LORA 4PH6A 1FY6A 1QPQA 3QZEA 3DFNA 3GLCA 2YGYA 1GYNA 3C6CA 3S1XA 3DXIA 1KFBA 2NXGA 4O10A 3WJYA 5DN1A 4ZQRA 1OFPA 2DZXA 2WQPA 3D0CA 3IVUA 1BKSA 3KVMA 4PC8A 3F03K 2FQIA 4XTDA 3B0VC 1QMLA 3NG3A 3PY2A 4BWLA 3TH6A 1L6WA 3GR8A 1O5KA 2WNQA 4FNSA 1YXYA 2YW3A 1I8JA 2ZRYA 5D2TA 3OEXA 2QJGA 4O57A 3P5YA 3GK0A 5D30A 1RQHA 1KTCA 4DPQA 4Y96A 5AYXA 4M6PA 1SSGA 2CZ5A 2DZPA 2VEIA 2DJLA 4QNWA 5C2XA 1A5AA 1RPXA 2XN1A 2GQ9A 3MWAA 5TBOA 5BW6A 2QCCA 4L4MA 3BGJA 4WX2A 3W1AA 1WX0A 2QCEA 4RZ6A 5EA9A 1JCXA 3HOJA 4DF2A 2W6RA 3C2FA 1F7BA 3DBPA 2NX9A 1QOQA 4MLRA 3BW4A 4TR9A 1YADA 3BVJA 1NAL1 3O6YX 4YMZA 5TIMA 4DEFA 4EWND 3FYOA 5MHBA 3EWYA 3S5NA 1SUXA 4NJJA 1PE1A 2Q3RA 3DFOA 4PFMA 2FB3A 2Y6ZA 3QSTA 2NV2A 3N2MA 1K8ZA 3W71A 2QUVA 2C1HA 3KVKA 5LNWA 2ZRZA 1H5YA 1R2TA 1DQWA 4AWUA 3N9SA 4IJBA 3LOTA 4JIQA 3HIJA 3W7JA 3Q2DA 4U28A 1HO1A 3SW6A 3O05A 4Y8FA 1RD5A 4LW7A 2Y7DA 1F6KA 3NQ7A 5I3HA 2Y7FA 2Z0IA 3HPZA 4RZ4A 1KBIA 1EUAA 1KFLA 2C18A 3SJ3A 1EPXA 4ZVJA 3P80A 1TPVA 2FJKA 1SQ7A 1OFAA 4LV9A 2BLEA 1JR1A 3Q37A 5TQLA 2EAWA 3S42A 3UWVA 5AN7A 1GOXA 2ZZ5A 2FDSA 5T26A 1X7FA 2QCGA 1X8FA 3HGSA 2BZNA 3MP5A 3NOEA 1AW5A 3U2OA 4N2YA 1GT8A 2F7FA 1XUUA 2VXNA 3A22A 1S3HA 1QDSA 1X1OA 4L4LA 2I9EA 4DO4A 2GJLA 3P8IA 1WOAA 4C1KA 3M0ZA 3W7RA 3B06A 2V30A 1ZAHA 1GVOA 1ME8A 1THFD 3I65A 1OHLA 2YW4A 5AC7A 2AQWA 1QOPA 2V5BA 2H3BA 1O5XA 3HBLA 3C56A 2ZZ1A 4R34A 4TMCA 3RU6A 4TMBA 3W22A 5LNRA 4DQWA 4K39A 1LROA 3PC0A 5HR6A 5F1UA 2PRMA 3N34A 1JUBA 3BARA 3QJAA 3UYCA 3SR7A 3KX6A 2OZ0A 2VFIA 1B4EA 4N6FA 3NEVA 3W88A 2E6YA 4UTTA 1FWTA 2QUUA 3NL2A 3R8RA 3M6YA 3MP4A 5LNVA 1W31A 2ATMA 3M5XA 4O54A 5CZJA 5HWNA 4RR4A 3KXQA 2JGQA 3G1HA 4GRSA 6ALDA 3G3DA 3F4NA 4LTSA 2GQAA 1CW2A 4NZJA 4E2DA 3BO9A 4DF1A 3OA3A 1GG0A 4UTKA 3K30A 4K7YA 1I2RA 4J9JA 1GTEA 5F2LA 1LOQA 3CPRA 3ATZA 4ZL1A 2DZVA 4BWLC 3W7PA 4NX0A 3GKFA 3L5AA 5LKYA 1VH7A 5DLCA 1XBVA 1K03A 3HO8A 1BEUA 3WK1A 1FWSA 3UXDA 1V5XA 4LU0A 2QDHA 2LLEA 3TV8A 3GXPA 2J9YA 2W0UA 1QNVA 1TO3A 1UJPA 1LRQA 1W56A 4UC5A 3T44A 3N9RA 3W84A 1OG0A 4MJZA 3UWQA 2VEMA 4M6QA 3RLUA 1VYSX 4HSOA 4CNPA 4KFNA 4IOTA 5CPNA 1SZEA 2ZDRA 1N8FA 3N73A 3NZ1A 3LX9A 1XFBA 3LTYA 1CI1A 3SSJA 1LM1A 1EA0A 1FX6A 3R13A 3C2EA 4WOZA 4OT7A 4GUGA 3GIYA 3EX6A 1SO5A 3LV6A 1VC4A 2BX7A 4JNMA 1TPWA 5DXYA 2WSRA 3LHYA 2ZZ3A 1GVRA 3W7LA 4BR1A 3B0UX 1EIXA 4MIMA 5F4XA 3W3OA 1H7OA 4UXDA 3B03A 3CM4A 4Y6GA 2R94A 3GZ3A 3JR2A 2TSYA 3LHVA 4Z0JA 1VHCA 4M7SA 2C13A 5AYYA 4MFEA 5FF3A 1UUOA 5G2IA 5K7JA 1OFDA 1WBHA 2Q8LA 4MJMA 3UY8A 3LRMA 4JX4A 3UPBA 3NR0A 3W7HA 3PAJA 4AWTA 3TW7A 1GJPA 3W7KA 4K8HA 5F4WA 3UY7A 1B57A 2Z1BA 5FF2A 3H55A 3KHJA 5HNRA 3G1VA 3G18A 1SR9A 5LHEA 1TTPA 4FNQA 3WFAA 2ZA1A 1ZHAA 4O14A 3G0XA 3GX9A 2OCZA 5K3VA 1RQBA 3MHUA 2FPTA 5EL1A 1ZNNA 2YZRA 4KKXA 2A7NA 2NWRA 4ORIA 1LP6A 3PWAA 4WUIA 1W54A 5CG7A 3LRLA 1T99A 4D2JA 3LERA 1Q6OA 3MYPA 5U4NA 1JRCA 2P1FA 3DFSA 1QCWA 1JCMP 2E09A 1NSJA 1SW0A 1C8VA 3W1UA 1KM4A 2Q3OA 2E1DA 4A2SA 2ALDA 4UFLA 3SECA 3BW3A 3IIVA 3W73A 1A53A 1IXQA 3G1FA 2QEZA 4P61A 4N9BA 4JYDA 4JTUA 3C3NA 3EX2A 2V0TA 1JQXA 4FX6M 1SU5A 4PTNA 3N14A 4UR8A 4Z08A 1M5WA 3HGJA 1I2OA 1L9WA 2CFFA 4LC8A 4BI6A 3CIXA 1SW3A 2B4GA 3W83A 1G4TA 1WBJA 5C55A 4LWWA 3P61A 3VNDA 3ABOA 4ZZ9A 4UMBA 4H3DA 4GUFA 4CNOA 4TX9A 4O52A 4BK9A 4CQ9A 1JQVA 3QC3A 2BWGA 3R2GA 5D09A 1KTBA 1K02A 2E6DA 3NDOA 3W7GA 2VEKA 1VJIA 5G4WA 1QPNA 2X1RA 2Y70A 1TV8A 4NNAA 2V81A 5IM51 1LLZA 1YTKA 3UWUA 3LCLA 1ME9A 3IV3A 3KRZA 1EWEA 3S9YA 4JTLA 4U4MA 4Y90A 3SGUA 2FPYA 4IXHA 3PR2A 2DP3A 3HGRA 4S2CA 1W5OA 3HG2A 2YSWA 2WOQA 3LCIA 1G69A 3TSDA 1Z44A 1QR7A 4A22A 3NM3A 4HNVA 3OG3A 1W3IA 4A21A 4I7VA 1ZJIA 3W7NA 2WV8A 4K6AA 1TB3A 2P10A 5AHNA 1JVNA 5HUPA 5AFDA 3EKLA 1MZHA 3BG3A 2H90A 2Y88A 2PRLA 1IIHA 2NX1A 4FX7A 2V2DA 3W74A 1H7WA 4UFHA 4PEKA 3NYZA 1P0KA 1TCDA 1EP2A 1I2PA 1L6SA 2YFNA 4CCDA 1OX4B 5LGZA 4FB7A 1IIGA 2QCDB 3QRHA 4LT9A 5LSMA 4UTLA 3BG5A 3EKZA 5GVJA 4GUHA 4OE7A 4TU1A 3W72A 3OBKA 4CLMA 2VFFA 3QYQA 3E02A 2VFEA 1SZGA 4O1BA 2OT0A 1R2SA 3SFKA 4GJ1A 1VZWA 1YDOA 1TPEA 2RDTA 6TIMA 2BXVA 1NFBA 2QCHA 3LTSA 3UXAA 1TTJA 2V5LA 4AXKA 3CC1A 4AHQA 2I14A 1SFLA 5DELA 5FF4A 3RLVA 1WDWA 3H54A 2NUYA 5DCDA 2GUUA 4FF7A 2EKCA 1FWWA 2FLIA 1SO3A 2BSLA 2J27A 3LCHA 2NUWA 3W1MA 3NL6A 3ZWTA 5LNSA 3CHVA 2YXGA 2WPBA 1RVGA 4IWWA 3MBDA 4ZQCA 3S5OA 3W86A 5A8GA 5E1QA 4JTEA 5L6UA 3NQMA 1K7XA 2VEPA 1K8YA 4RK8A 5EBUA 2H8ZA 5HQEA 3DI1A 3BPWA 3UWYA 4O17A 3C8FA 2V82A 1T8XA 3KVJA 4JYFA 1IXOA 1OF6A 4AAJA 3NZRA 4NU7A 3EWBX 3R12A 4MUZA 5D32A 4CCEA 1TPB1 4C1LA 3WJXA 5KZDA 3EXTA 1TRDA 1FXQA 5AC6A 3ZFHA 4WXZA 1C9DA 3DZ1A 3S1UA 4QAIA 1PHWA 2E6AA 2FIQA 5CZTA 2ISWA 2C16A 4XKYB 3USBA 4JDYA 5CZSA 3BLIA 5SWUA 1U83A 3DKJA 2YYUA 3M43A 1IXNA 2CLIA 2R8WA 3S6DA 2C15A 1W5PA 4HPJA 4LRSA 5HWJA 3G24A 4AEOA 3KOFA 3EX3A 3M5YA 3W85A 2AGKA 2C0AA 3P81A 3L0GA 3NO5A 1A50A 1WXJA 4JIPA 1S5VA 5C6MA 1DHPA 4B5NA 2ZA3A 2ZYFA 3YPIA 4AF0A 3M16A 3VI2A 3VKJA 3OIXA 5KMYA 5J5DA 5CSRA 5CPOA 1Q45A 5G1YA 5AHMA 4WD0A 3G1DA 3ZS4A 2HSAA 1VCVA 3GDLA 4FXRA 4JTGA 2CLFA 4XUGA 1Q6RA 2A6LA 3LXBA 3TUUA 1OYBA 4UFMA 4LS2A 3DHFA 3HMJG 2JKAA 2QCMA 1PCKA 1K7EA 2QAFA 1B4KA 3L5LA 4O11A 4GWEA 1JULA 1QPOA 5HWMA 1FCBA 1TJPA 1KM2A 4AWSA 1OFBA 2I1OA 3PBWA 4MY9A 1V7YA 2A21A 4XBSA 3O1NA 3ATYA 1W3NA 3W7CA 3RF9A 1G6CA 3LRKA 3PULA 2VELA 1UUMA 4GUJA 1UCWA 1S5WA 1TPDA 2QJIA 3PSVA 4ONVA 3PBYA 2ZZ4A 3NVTA 4W9TA 2WKJA 2D73A 1KM0A 4ZQMA 1KW1A 3NQDA 4N6EA 2JKEA 3A5VA 4ZQPA 3F4WA 1S5TA 3TCEA 1VRDA 3SIZA 3W1TA 3UD6A 2ISVA 4OU1A 4N9DA 4MOZA 3CQ0A 3L66A 3EB2A 4S1FA 3IIPA 1ML1A 1IXPA 2VFDA 3PBVA 2CZEA 5K9XA 1MEWA 1I45A 2ZQ0A 1I4NA 2WNNA 3WK0A 2QCFA 4N4QA 1LBLA 3G8RA 1ZAIA 2ATSA 4FIQA 1XBXA 1W3TA 4UNLA 5I3KA 2NV1A 2CLOA 3G1SA 3W87A 3A5FA 3CIWA 3W2JA 5AHIA 4HT3A 4MZ8A 3LCXA 1ZCOA 1NVMA 4IX2A 5EY5A 2B7OA 3NXFA 4Q4KA 2WNZA 1H7NA 5F2GA 2ZZ7A 3GB6A 5I3JA 2B7PA 1J5TA 1EB3A 4IPJA 3O07A 2A0NA 3G1XA 5FF7A 3AJXA 5A5WA 1JUEA 2YFOA 1WOBA 4XWUA 1SW7A 1NF7A 5AHEA 5HMSA 3IGXA 5D33A 4JGDA 2CU0A 2O7SA 4MFDA 3BK0A 2ZA2A 3V75A 5AHLA 4WQ6A 3QM3A 4NJKA 3L65A 2O7QA 1TMHA 3GDMA 1ZAJA 3GDTA 1LDCA 2Z2UA 3E49A 5J5RA 3CLMA 4UMCA 3B05A 1DKWA 2A7RA 2NZLA 4GBUA 3B8DA 1OK4A 1WAUA 3QFEA 4YCOA 1H63A 2A85A 1H60A 3A21A 4JD4A 4NXKA 5CPLA 4FNUA 3PG8A 3PVFA 3LCGA 2QCLA 1KM3A 3T55A 1LZOA 1GPWA 3G1AA 3PG9A 3NQVA 1H7RA 2ZFAA 3I6RA 3LLFA 1KFCA 4I9AA 1ZY9A 3IRDA 3R5EA 3WK3A 1PCWA 1HG3A 3IVSA 4FNRA 4GXMA 1GEQA 1AG1O 3I7RA 1TPUA 3KVLA 1N7KA 1VR6A 4UUIA 4WY0A 3QF0A 1N55A 3LCFA 3TC7A 4HNUA 2Y85A 1F73A 3W2LA 1OFRA 1HL2A 4Y9AA 4LUIA 3O6CA 3NQEA 1O95A 4JTJA 5G1TA 3TXVA 1OX4A 1UASA 2CZDA 1GVSA 4JN6A 4KWWA 5BMWA 1RR2A 2CLEA 5HINA 3TMQA 5K2ZA 1HFBA 5EMUA 1TQXA 1F05A 3C2OA 4QQ3A 4O53A 1JRBA 3DAQA 5LHFA 1H1ZA 3LM7A 3TAOA 2NUXA 3CB8A 1TYGA 5G4EA 4S2BA 4LVFA 5DCBA 5BOOA 1AW1A 5D2XA 5AYZA 2JK2A 1KA9F 2XN2A 2YCEA 3W2KA 1LOLA 2QJHA 4AMAA 3C52A 5G2HA 4HSNA 4POCA 4UIOA 4Z1CA 4NX5A 3JRKA 1KBJA 3W76A 3E12A 1QFEA 4OV4A 3UPWA 3UZ5A 4UNKA 3O16A 4QJ1A 3W1QA 1OFOA 3KRUA 1D3GA 1W0MA 1VLWA 3NQCA 3GXNA 1O60A 1QO2A 2B0MA 3DENA 4A2RA 1SPQA 3W9ZA 1QAPA 3PB0A 4GNJA 1W1ZA 4JTSA 3P82A 1AL8A 1GYLA 4FO4A 3S5ZA 4RV8A 1KM6A 1SFJA 8TIMA 3SGZA 2H3DA 3DH7A 1Q3NA 1C29A 2E5BA 1KTNA 3CTLA 5CKSA 2QR6A 3QMTA 5HULA 2G96A 3TQ0A 1AW2A 3CEPA 1LLWA 1RQEA 2J9XA 3I68A 4I7UA 1GQNA 3W7IA 1H61A 4A29A 4HIBA 1YXCA 4R33A 3UNDA 3PUEA 4MY8A 3FS2A 2ISSA 4RXFA 2QKFA 3BW2A 2JKPA 5HJLA 3BGGA 3OVRA 1ZALA 1SSDA 2Z6JA 1FCVA 4PODA 4MPQA 4AB4A 1H7XA 2CLKA 3LBCA 2JGYA 3NAVA 3HF3A 4LNYA 3TC6A 2X16A 3UWZA 3QW4B 3RMJA 4E38A 1G4EA 1LYXA 2X1SA 3QPYA 3L0KA 5FF0A 3HPXA 3O63A 3C4UA 4UCGA 3DFQA 4WZHA 4ORMA 3CT7A 3TSBA 3PUDA 1KM1A 1W5QA 3FKRA 4QIUA 4UTMA 1OX5A 3M9YA 2EPHA 4IX0A 1FQ0A 4EOUA 3JS3A 3WK2A 3RK8A 3ANYA 1ICQA 4A3UA 1XBYA 1XUZA 2DZWA 2HS8A 1G7UA 1G4SA 3STCA 4ALDA 1JCJA 3OHIA 5I3FA 5FEZA 1M7PA 4LS1A 1M7OA 4JR5A 4JY9A 5DY3A 1DJQA 5F2IA 1DOSA 4FXSA 4CQ8A 4BI5A 2CLMA 4ZQNA 2YR1A 3MI3A 3GAKA 5DBUA 1L2UA 3PM6A 2J24A 4XQ6A 3T78A 2CZFA 3L68A 4R7JA 5I3IA 3TKFA 3M7WA 2C6QA 1HTIA 1YTEA 4LVGA 3ABQA 1G67A 1G4PA 2XN0A 3ABSA 1QPRA 4LC6A 2ABAA 1VHNA 3TK7A 5E93A 2J6XA 4IMGA 4ADUA 4YLWA 3L67A 2TYSA 4I7WA 3EWZA 4OHQA 2H8XA 3MUXA 4DBDA 1E51A 3U6WA 3TE9A 4K36A 4XTIA 3O06A 1SO6A 3GDKA 5C54A 2OX1A 2NLIA 2VENA 5D2VA 4AHPA 1ZFJA 4ML9A 3NQ8A 3T7VA 3TJLA 1ICSA 5KZMA 4UTUA 4O0ZA 2FB2A 2X2GA 1FDYA 3NA8A 1XKYA 1HO4A 3HB9A 2ZZ2A 3P67A 3G22A 1KFEA 5U7SA 1DQXA 1PIIA 1PVNA 3L21A 2CWNA 3SZ8A 3CU2A 3TROA 1T96A 3A23A 1FUYA 1K7FA 4O12A 1P5BA 3WJZA 4GC4A 4WXYA 3HJZA 1QWGA 2NXHA 2R14A 4O1CA 4IMCA 1OK6A 3HG4A 5CSSA 2RDWA 4N9CA 3VE7A 4LRTA 3MI6A 4PL2A 4RJEA 4IMDA 1P4CA 3MYOA 3O6DA 2A5HA 3EXRA 2ZTKA 4EF9A 3WJWA 5F1VA 1FWRA 1AL7A 1TV7A 2QCNA 2CLHA 3LV5A 5D2YA 4O4WA 3TXZA 5D02A 3TX9A 3G0UA 4IMEA 3DKLA 4Z1BA 3PS7A 1KV8A 3P60A 2RDUA 4DPPA 3BV4A 1TJRA 3CWOX 5HUOA 7TIMA 1ME7A 1XXXA 3RNDA 3TR2A 2E5DA 4O16A 4DF0A 1ONRA 5G5IA 5H91A 1Y0EA 1DL3A 3CWNA 4BFAA 2DORA 3NPUA 4UFJA 4KWVA 1CX9A 4O8RA 4JICA 1Q6QA 1QO5A 2BTMA 3QMSA 3TU9A 5BMXA 4TO8A 3MBFA 3P5ZA 2W79A 1Z41A 4NXSA 2TPSA 2J88A 4OBTA 1OJXA 1YLVA 1OVDA 2HS6A 3HG5A 3GDRA 3IGUA 4UR7A 1EP3A 4HNTA 2C14A 3UQNA 1DORA 2DU2A 4O50A 4OWGA 1LRNA 3UWWA 1A5CA 1EP1A 1KLZA 2B7NA 3W1PA 2Y7GA 3L5MA 1H50A 1XC4A 3NQAA 3DHDA 3MMTA 1FBAA 2C19A 3OVPA 1FCUA 2V2HA 5DXXA 2NXIA 4EVZA 4K8EA 3HPSA 4H4IA 3PSWA 5CZ0A 5AB3A 3M5VA 1W5MA 3MI2A 4DBEA 1LRTA 1VLIA 4UTWA 1ICPA 2TRSA 4M19A 2DZTA 3ELFA 3TQVA 1MEHA 2J9ZA 4O19A 3PF3A 2QAPA 1J4EA 1DVJA 2P0OA 3ZR4A 1GVFA 2DZSA 4MLJA 4K7VA 3KFTA 4YWIA 5HR7A 3W1NA 1TIMA 3STEA 5C5YA 2E68A 1F2JA 5AHFA 4OV9A 4JXCA 4NZFA 2Z6IA 1B9BA 4UMAA 3G0SA 4HPXA 4JEQA 2Y63A 4M5PA 5E0KA 3Q58A 4P2VA 1VQTA 1Z48A 1I2NA 5FEXA 4UTHA 1VYPX 4PCFA 3KRSA 4XZ9A 3MHGA 2GJNA 2G5WA 4FNPA 1FDJA 2NX3A 3ABRA 1GWJA 5I3GA 3TA6A 3GAYA 1XI3A 2CLLA 4JTHA 1DV7A 3TQKA 5L9FA 3S0CA 5DBTA 2HTMA 3O15A 5D2WA 3FJLA 3IIOA 2AAMA 1VYRA 2V9DA 5KSWA 3HG3A 2WJZA 3L2IA 1AMKA 2YX0A 3E9AA 2RH9A 4JTFA 1OABA 1VCGA 1W8SA 4UFKA 3L9CA 4HNNA 5K9DA 3QPZA 2HMCA 4GE8A 4O15A 3EX1A 1P0NA 3IGSA 1LTDA 3TJXA 3NPXA 1TPC1 3GKAA 3W6YA 4N02A 4NNBA 1UB3A 4NQ1A 3PB2A 3FOKA 5D37A 3GNNA 2RKXA 1H51A 2ZTJA 2A7PA 1T0OA 4O28A 3DFTA 3S1WA 4KFPA 3NQ6A 4BI7A 4FIRA 4RX0A 2PC4A 4AHOA 3N19B 1TREA 1D9EA 3WJSA 4HN4A 4LY8A 3C61A 3V1PA 4NJIA 3GYEA 2A2IA 3MP3A 4CQAA 4E2BA 3EXSA 4DO5A 5K9CA 1DBTA 1FCQA 1F5ZA 2FFCA 1H1YA 4CCCA 3NQFA 4N4PA 5BNKA 3H53A 4MZ1A 3C2VA 4JTTA 3MJYA 3G1YA 3TFCA 3TNOA 3TMLA 1OX6A 5DCEA 3CEUA 3DFPA 5FESA 2Y89A 4DELA 1ALDA 2ZRVA 4AH7A 5KITA 4EF8A 3FEMA 5EKYA 3M1ZA 4GUIA 4WJEA 4ZMGA 3FLUA 5BRBA 5D03A 4LS0A 4NVTA 3M5ZA 4GFSA 4JX6A 1R47A 3LXCA 2R91A 2C3ZA 3QQ1A 2DJXA 3LHTA 3TIMA 4MY1A 3QH2A 3VE9A 4LV4A 2FPVA 3P62A 3BLFA 3LHUA 1TPH1 1PL9A 1NEYA 2GPTA 1KM5A 1NF0A 2Y62A 3LDVA 1K3UA 3QEZA 1B3OA 1WYIA 4NJHA 4UTJA 2GVJA 5ABTA 2Q8ZA 1O94A 4LUJA 3OVQA 5CPMA 4Q32A 1WA3A 4X9SA 3FJ6A 2CW6A 3FIGA 4JTIA 1JCNA 4BF9A 1XM3A 1ADOA 3VFLA 3TFXA 2E77A 1HUVA 2QDGA 3E0IA 3W7EA 4IUOA 1BWLA 1BWKA 4X22A 1JCLA 4ADTA 3KAOA 3A9IA 4JTKA 4FHAA 4UTWC 4E0CA 2RFGA 4IPIA 4FEZA 1LBFA 2VKZG 4RKAA 5KINA 3W1XA 2E5CA
chains in the Genus database with same CATH superfamily
5D38A 2ZIDA 3WKZA 5KTLA 1O5RA 3G3MA 5IFPA 3BAYA 1OGGA 3VM5A 2X30A 2ZX8A 2J7GA 2ZX5A 3KCLA 1T40A 3M41A 2BGQA 5KZEA 2GGGA 1M01A 5K4ZA 1GHSA 1XGDA 3CUGA 1F74A 1OYAA 5E6YA 2PF8A 1J2BA 3FW6A 1WV2A 4B90A 4R53A 2BHUA 5CC5A 2I17A 2WHKA 3P7YA 1IT0A 5DT7A 5IBXA 1X1ZA 1EF3A 4GVIA 4RLIA 2FDMA 4DWSB 2BXYA 1VPYA 2FH8A 1EA9C 2DSUA 2PDNA 2PRHA 1E43A 2QYGA 2VOMA 2PCQA 4W85A 1F6YA 4GC3A 2A6NA 2PLKA 4RXGA 1SO4A 3H8AA 4W87A 3THQA 5FI8A 4X60A 1GUVA 1W37A 4F48A 4HPGA 1E6PA 4XKYA 4HMCA 4ZFMA 2I7GA 4NJGA 2DW6A 1RZMA 2FYMA 1O4UA 1YPIA 1KRBC 3QSRA 4RDVA 4WSKA 1F4AA 1H7PA 3QPEA 3RG6A 2BNJA 1TRIA 4R7OA 4XD6A 1WDPA 3MC5A 1XICA 5D04C 4IJRA 1ONEA 1RY8A 1V3JA 3RDKA 3HV9A 4CEXC 1ZBKA 3S5YA 3CGTA 4AY8A 4LAZA 4O1AA 3OOQA 4JQ2A 4M1BA 2Y7EA 2EGZA 4DJEA 3GR7A 1CENA 3CPUA 3VIKA 2ZRUA 4M7TA 4H6EA 4WY0F 4DVOA 5DY2A 4OGZA 4FNTA 1E0VA 1W5NA 4HU3A 3SUWA 3FHQA 4R3UA 3UBPC 1XL9A 1U5VA 1UMLA 5ENLA 1TVLA 2GK1A 1IF2A 3N12A 3EWUA 4D71A 3B8VA 4WR3A 1E40A 1C90A 3AIWA 4NY2A 3FAXA 2VMFA 3S8HA 2WPGA 1YDNA 4IXXA 1GVIA 3W1LA 1AK5A 3THUA 2XWEA 4KEZA 3GH7A 3L7RA 1M6JA 1T41A 3UPMA 1XIFA 4JQ4A 2R82A 5T9BG 4PMXA 2XVPA 3KCOA 4AVFA 1F3EA 4GYJA 1PKNA 1VPXA 3LI0A 1JUKA 3TW6A 1ZBWA 2EF9A 1UQYA 5GNYA 3QY7A 1Z7AA 3M47A 4QM1A 3K8MA 4E2OA 3SI9A 2IPGA 5D05A 4WY0B 5A2BA 4IQDA 3QLLA 4Q33A 4D6FA 1EWDA 3I7SA 1KCLA 3B9AA 4QCEA 3WQFA 1F07A 4GG9A 4DO7A 3R8HA 1GTHA 1GK8A 2GJXB 1BTMA 3TSMA 1BQCA 5ABFB 4M24A 3ARYA 3T40A 3BC9A 4ATDA 3RN6A 4RZ5A 4X0VA 3AS2A 2F38A 2BFGA 1MI3A 1MDLA 4LUSB 3TW9A 2FGLA 2VFGA 4GVGA 2W67A 3P84A 4H8VA 2W66A 5FEWA 1YYAA 3LBMA 4F0MA 3TYUA 4JY8A 3VCRA 5IBXC 1X39A 3IUDA 3I3EA 1DIOA 3E2VA 3BAXA 4LYRA 2XIQA 2ZCGA 1V4YA 3P8JA 2J7BA 1KFWA 3TN4A 4M8UA 1IZKA 3LB0A 1O12A 4NZ4A 3NGJA 4RPPA 3VOGA 3WYZA 4Q7IA 3W75A 3UG4A 2WC4A 3POHA 3C2RA 1MXSA 1BF6A 3R43A 3WSUA 5C7HA 1OYCA 4RUBA 2VP8A 3L23A 3ORWA 1R5YA 1PO9A 2WSQA 1XRSA 1FWFC 2VRJA 4PH6A 1FY6A 1QPQA 3APTA 3V0TA 2VM8A 1EHNA 3C6CA 2G4JA 4QROA 3M46A 3DXIA 1KFBA 3WJYA 1OFPA 1XG4A 4D6GA 4UQ9A 3LBOA 2GJRA 4LF1A 2WKLA 3KVMA 3WLTA 4MSSA 5GNXA 1TA3A 3PY2A 3SURA 4BWLA 3S6TA 1L6WA 3GR8A 1O5KA 5E6ZA 2QUMA 3RU8X 1V0KA 4V15A 4U3AA 2OOFA 2ZRYA 2QJGA 3P5YA 3GK0A 1RQHA 1KTCA 4DJEC 3VC5A 4GX8A 3AHYA 3EOLA 1SSGA 2CZ5A 4N0RA 2DZPA 2DJLA 4GVHA 1UWUA 2XIBA 4NYYA 3RLGA 2WXDM 1FWJC 2GZXA 4LB3A 5EA9A 4GIEA 1DEDA 4P8UA 1W1VA 1TVPA 3TEVA 2WWCA 4PTXA 3L4WA 4IIDA 3GFYA 1QOQA 3WD3A 1XLMA 1YADA 3O6YX 1EDQA 5TIMA 2VDIA 2XHYA 4EWND 3N2TA 3CLWA 3AIEA 4NJJA 2YBTA 4F66A 2Q3RA 4X9YA 2AL2B 3WMLA 3T05A 2NV2A 2Z1SA 4FLOA 5HPCA 2ZOXA 5FJJA 2ZXDA 2C1HA 1KXVA 2VX6A 4NI8A 4Z2GA 3LOTA 3HIJA 1FHLA 3FXGA 5DT5A 4GFIA 1F6KA 5DRIA 3SCUA 2OXNA 1EUAA 3KUMA 3P80A 1TPVA 4ATLA 1UR9A 8XIMA 2PTZA 2XGBA 2INFA 2J74A 3M07A 2BLEA 4IISA 4DHGA 1XIIA 1JD7A 1C9WA 2E28A 3KL0A 1T8QA 1KCZA 2ZZ5A 3EZ4A 4WIWA 3CV6A 5EFFA 4XSLA 1X7FA 3FHAA 1X8FA 1Q85A 3MPGA 3UESA 4B5SA 3MCNA 4R9XA 3MP5A 3GG1A 2Q01A 2WVTA 3ECQA 3HA1A 2IQDA 3AS3A 4L4LA 3AWNA 3QZAA 1WOAA 4C1KA 3VOFA 3AXIA 3LPPA 2PU0A 1ME8A 1OHLA 2YW4A 4AY7A 1OSEA 1O5XA 1GW9A 5E5CA 1AJ0A 3GG8A 1WXZA 1MNSA 3P14A 4H9TA 2ZZ1A 4R34A 4KWOA 1XRVA 4GI6A 4TMBA 3W22A 2CESA 3MUY1 3AMKA 3DOPA 3ITVA 1EFZA 2FHFA 1F8IA 3ZVIA 4L9XA 3SR7A 3K13A 1QHZA 1AQ0A 3CASA 3O9NA 3W88A 1UKOA 2IKGA 4FZIA 4PUUA 5A6JA 4P8VA 5JVLA 2WC7A 1UD6A 1W31A 2ATMA 2J66A 5CZJA 1FA2A 3SFWA 3ZT7A 2JGQA 4GKLA 4DJFA 4GRSA 2NQJA 6ALDA 1CW2A 4C6BA 1UH2A 3DIPA 4OZOA 1I2RA 3BMVA 1TE6A 5F2LA 3ATZA 4BWLC 4NX0A 3L5AA 5DQPA 3H2OA 4BY3A 5JUVA 1V5XA 4MB1A 4LU0A 2LLEA 4GA8A 1QW8A 3GXPA 3OGVA 3A6OA 2RUSA 2OSWA 4F4RA 2V68A 4MJZA 3UWQA 2PDUA 2VEMA 1XYCA 2AKZA 1VYSX 4HSOA 3RLUA 4S3GA 1NOFA 1SZEA 3PZUA 3LTYA 1B9ZA 2Y2WA 3R13A 4OT7A 2FVLA 1JF6A 3GTXA 1UD4A 3GIYA 1X8CA 3U4FA 3N2CA 5DXYA 2WSRA 2ZADA 3PZTA 4GY0A 1HKIA 4BR1A 3PPGA 3N9KA 4UXDA 1KKOA 1MRQA 3NTYA 4Y6GA 3VTRA 1KCKA 1K9EA 5AYYA 3W4RA 3SCQA 1HKWA 1UUOA 5AYIA 4KPLA 1WBHA 4DWSC 3AYSA 4GCXA 5CG0A 4AWTA 1GJPA 3HN3A 5F4WA 4H7ZA 2XG9A 1R85A 5FF2A 4AZGA 3H55A 3G1VA 1SR9A 1TTPA 3ABZA 3WFAA 4O14A 4H9MA 2OCZA 3BURA 4AQLA 1XHGA 2P3EA 1JDDA 3FYYA 1LP6A 3PWAA 4WUIA 2DVTA 4W84A 3QHOA 1W54A 5CG7A 3LRLA 3K1DA 1T99A 1TELA 1VBRA 3OG2A 4DB7A 1M7XA 3DFSA 1JZ6A 1C8VA 5A6MA 3W1UA 4XVEA 2Q3OA 4EKJA 4UFLA 3BW3A 3ALFA 4GX9A 3IIVA 5TAOA 3B0YA 3GVRA 1ZTVA 1MNZA 3G1FA 3BUVA 2XM2A 4JYDA 1JZ3A 2V0TA 4Q8WA 1B5TA 4IPNB 2A3LA 4PTNA 5I23A 2GSHA 1I2OA 3WEMA 3KOYA 1L9WA 3PJXA 1RP9A 3W83A 3SSZA 1TWWA 4LWWA 4H7VA 2Y5JA 3UZWA 3NVDA 3H6OA 2Z24A 3QLDA 4CNOA 4O52A 1JQVA 3QC3A 9XIAA 2QJNA 1XIHA 2VCCA 1KTBA 1O5QA 1R9YA 3NDOA 3VDHA 3W7GA 4NILA 1ADDA 1VJIA 2CKSA 1QPNA 2X1RA 2DIJA 1S3TC 3WNOA 1TV8A 3KDNA 1UWQA 4HZ7A 5IM51 4X0NA 2OWCA 1LLZA 1YTKA 1WCGA 3LCLA 2AL2A 4LALA 4H83A 1KB3A 4DN1A 1PZ0A 2VQUA 3W38A 1EWEA 2MANA 4BA0A 4JN7A 3LU2A 2IPFA 1A3XA 4JEJA 3SGUA 1V6XA 2FPYA 2I9UA 2QV4A 3RLHA 1SMDA 1X7IA 2WNWA 3TSDA 1QR7A 1B2YA 4XZMX 4WSJA 4XAGA 2PWGA 4HNVA 1TFVA 4E8GA 5H8UA 1W1PA 1ZJIA 4I7VA 3WG6A 3ZIZA 2FGBA 4C1NB 1LL6A 1A5LC 1K6AA 4AZIA 4A05A 4PUNA 2TODA 3BG3A 2D2OA 2Y88A 3V35A 5CZKA 3BLDA 3VC6A 2YFNA 4JKMA 1YNQA 4CCDA 3SRHA 3T2OA 1HJVA 4RE0A 2PEVA 3W72A 5I3DA 4CLMA 3E02A 1SZGA 4BZYA 1R2SA 4S3DA 3SFKA 2Z28A 4O8AA 3NCOA 1SFLA 3H2EA 5DELA 3JZEA 4Q4PA 3KEHA 2P76A 5DCDA 2R1LA 4FF7A 3SBFA 2FLIA 4WRHA 3SRDA 1QBAA 3LCHA 4ZCWA 3NL6A 4KBXA 2OGJA 1K70A 1RVGA 2JALA 4IWWA 4TUFA 4HYRA 3S5OA 2ZKMX 5L6UA 1K7XA 5JH2A 4LBSA 1B3WA 3BPWA 5HNUA 1XGZA 5FJPA 2PAJA 1HKKA 4PCSA 4JIHA 1Q6FA 4BJHA 3AIQA 1H0IA 4I5UA 3RX3A 4UQDA 3TTSA 4CCEA 1KBKA 1TPB1 4MB3A 5AC6A 3U3HA 4WXZA 3DZ1A 3CHFA 4DLMA 2IS7A 3MCOA 2ISWA 1US3A 2OYLA 3USBA 1UW9A 4H00A 2YYUA 2CLIA 3S6DA 2C15A 1W5PA 4XG1A 3T09A 4LRSA 5HWJA 3ICJA 4XZIA 2AGKA 4KCUA 2QMJA 3NO5A 2PWUA 1YHTA 3VOIA 1IT8A 1UKPA 1DHPA 4R5EA 4WJ8A 4B5NA 4QEEA 2ZYFA 4S39A 3SUTA 3VM7A 3M16A 3VI2A 5J5DA 4NYUA 4N42A 3F7JA 4BKNA 1QVBA 3DYPA 5DEZA 3BLLA 1VIZA 2EPLX 2ZUMA 4YTQA 4MPKA 4FXRA 4H1ZA 3TUUA 4J35A 4UFMA 4LF2A 3HMJG 4GINA 2WZMA 2QCMA 3JZUA 3GW0A 1K7EA 3QOMA 4JHMA 1B4KA 3FNDA 3L5LA 4B3ZA 1GHRA 4S3AA 7ENLA 2OR2A 3W82A 3KP0A 1TJ1A 4B15A 1KM2A 2XISA 4PMRA 2A21A 1XQLA 3RR4A 2NVAA 1QNOA 4HHMA 3ATYA 3C2YA 1J9YA 4GO9A 1OCBA 3ZJ6A 4GUJA 2QJIA 4ONVA 3S2MA 4JPGA 3TQPA 2WKJA 3XIMA 1QNQA 2D73A 3KOZA 1EC9A 4N6EA 2PPGA 5FL1A 3T8QA 3A5VA 4ZQPA 3CO4A 3U2CA 4Q7BA 1QWKA 4HMDA 2ISVA 4XAPA 3VKBA 3EB2A 3HMCA 5A95A 3R79A 3VPLA 4DM1A 4WKFA 3T2QA 1C92A 2VVSA 1G1YA 2VC7A 4LCRA 4AXNA 4AZ7A 2ATSA 1G01A 1E1FA 4AEFA 3HQOA 2W5FA 2NV1A 1HP5A 4OIFA 3CIWA 4LY4A 3SAZA 3W2JA 4MZ8A 1ZCOA 1E1CB 4BF5A 2UY2A 3NXFA 4RNIA 4Q4KA 2FFIA 1CTNA 3KOXA 5I3JA 2QJMA 4J3WA 1KR1A 4IPJA 6A3HA 3G1XA 4I6VA 4XD4A 1IYXA 2PWFA 1ZU8A 4GJIA 1WOBA 4XWUA 3SN0A 3VGGA 1NF7A 1IEIA 5HMSA 4B5VA 3WLKX 4JGDA 1K1DA 3KBMA 3BK0A 3V75A 1K4GA 3QM3A 2WAGA 1J0YA 3DYMA 1ZAJA 3GDMA 4JFWA 1LDCA 1DXIA 2Z2UA 5XIMA 3E49A 5A6SA 1JDCA 3U9IA 4AX7A 5T8GA 3QFEA 1H63A 2A85A 5CPLA 1ZJHA 1WE5A 3PG8A 3PVFA 1BVNP 2PP3A 3LCGA 3W24A 1KM3A 3GNXA 4HA4A 1JAEA 3PG9A 1H7RA 3UA4A 4HGXA 4Q4QA 3DC0A 3WK3A 2HRWA 3IVSA 4GXMA 2G3JA 3TOYA 4TVCA 1CT5A 3W2LA 3B9OA 1L6GA 2FZ8A 4J3SA 4FR6A 4INFA 3TOPA 3NQEA 5G1TA 2ANUA 8RUCA 2GDQA 3GIPA 2GVYA 1GVSA 3MSGA 1ZP4A 1RR2A 2CLEA 1X38A 5HINA 6REQA 4HQVA 5K2ZA 2CLPA 5I06A 3B97A 5EMUA 1TQXA 1ZBVA 1H1NA 3ITCA 1HJUA 4HJWA 1PX4A 4D6CA 2I57A 3CB8A 5DCBA 5BOOA 1FH7A 4TQTA 1MXGA 3WQDA 1AUSL 4TXEA 1TG7A 1PKMA 2VD9A 1BG4A 1J11A 2IXVA 2QJHA 4B92A 5G2HA 4Z1CA 4UIOA 3K5XA 4UCFA 2R24A 4QJ3B 1JYVA 1KBBA 2WJDA 4KRUA 3W76A 2E67A 3UPWA 3UZ5A 1HJWA 4A35A 4AD3A 3U4AA 3NSNA 3KRUA 3W25A 2VEGA 1RCQA 5ABGA 1ISVA 1W1A1 3VNKA 4KCVA 3R11A 1O60A 3KTCA 1SPQA 4GNJA 1W1ZA 4JTSA 4EP8C 1F61A 2EEXA 4RV8A 2W63A 1SFJA 3FK4A 3AOFA 1S39A 3SGZA 3Q45A 3RPTA 4HZMA 4C6KA 2OQYA 2QR6A 3QMTA 2G96A 4GQRA 2OWXA 2RJHA 1AW2A 1RQEA 4Q4OA 1W17A 3W7IA 3AXKA 2EPNA 4V1YA 1VFTA 1TJ2A 3WUEA 1A3HA 4L6OA 3UNDA 2PDQA 3PUEA 1RAKA 4MY8A 1IWAA 4RXFA 2QKFA 2J6VA 5CJMA 2G3FA 2JKPA 3P3BA 5JIWA 5DMLA 2P53A 1FCVA 2O9RA 4MPQA 4AX6A 1UQZA 3AYVA 5I24A 1GJWA 3BXWA 5JQ9A 2JGYA 3NAVA 4WGXA 3STPA 4UQAA 5H8MA 4D72A 1PX3A 3VGHA 2X1SA 3QPYA 5FF0A 3HPXA 5I02A 3O63A 5A3HA 3C4UA 4UZUA 3DFQA 3CT7A 3TSBA 3ZO9A 4HN8A 4V28A 3RJYA 4GI9A 4QIUA 2VWTA 1OX5A 1DWFM 2EPHA 1FQ0A 2A3BA 1N8IA 3BAJA 3T4WA 1VFLA 3JS3A 3BE7A 2CEQA 3WFZA 3ZZ1A 3IPWA 5I3FA 1AA1B 5FEZA 4IHCA 1XLFA 3AIUA 4DYKA 4LS1A 1M7OA 3HFYA 5DY3A 4JTRA 1XLCA 4RV3A 4EPKA 4FXSA 3UJEA 4YU1A 2CLMA 2YJQA 3OLEA 1L2UA 3PM6A 3T78A 2P5NA 2CZFA 4R7JA 3H7UA 3QY6A 2HPIA 2C6QA 1DWIM 1W1YA 2OKTA 4E6MA 2OVLA 4Q8MA 1VHNA 4ZOCA 2DFAA 2J6XA 4GI8A 1ITCA 4ADUA 1KC7A 2TYSA 4I7WA 1ITUA 2H8XA 1T6MA 3TTQA 4LAOA 3L2LA 3RM8A 2ON3A 1QI3A 2NV9A 2ICSA 4B2DA 2PC8A 4Q8QA 3GDKA 1UR3M 4XSMA 3AMCA 4ML9A 4JBRA 5A1AA 2WCAA 1FKXA 1NDZA 4CD8A 3EOUA 2JIWA 3H4GA 3G22A 3CJPA 3L21A 4WLCA 3MCMA 1ZB5A 3CQHA 3GVQA 3P0XA 3TROA 1AH4A 1K7FA 2HJPA 2IKIA 1LUCB 1QWGA 1U1JA 5FCZA 3HG4A 2OO6A 2ZICA 4N9CA 3V7PA 3VE7A 1EJXC 2PBGA 1XQKA 1DIEA 2ZTKA 1FWRA 4J3VA 4GXPA 2CLHA 2WWDA 3LV5A 2QT3A 3TXZA 1AVAA 1XYZA 1E9ZB 4DM2A 3P60A 3R94A 4DPPA 1E3ZA 1UD5A 1TJRA 2E5DA 2UWFA 4O16A 1QOXA 2PDYA 4DF0A 5G5IA 4WCJA 4HZ6A 3IAQA 3SB0A 1CX9A 2VGIA 3R6IA 3SQSA 3WNPA 4JICA 1Q6QA 3TU9A 5BMXA 1SFSA 4AW7A 2PDHA 1Z41A 3CPGA 2D3NA 4CCZA 1RPKA 1YLVA 1POJA 3HG5A 1EP3A 2J78A 1R8LA 3T0TA 3MUAA 1KLZA 1YKWA 1OT2A 3BLOA 1H50A 3DHDA 3LPGA 1A80A 1FBAA 1UC5A 2XSAA 2C19A 4H7CA 5DXXA 1U5HA 4H4IA 3PSWA 1QU4A 4E4PA 3SCNA 3UZYA 1UH4A 1Y7VA 3OZPA 1LRTA 2G3IA 5G4HC 4C6IA 4CQDA 4QG8A 2TRSA 2GDVA 3TQVA 1HX0A 3SADA 4D6HA 1DVJA 3ZR4A 3PAOA 5C2GA 3KFTA 4YWIA 1YE4A 2OG9A 2BY0A 3WLQA 3B0XA 5C5YA 1GZJA 2OLHA 5M5DA 3UCDA 2E68A 2PD5A 1BWVA 3H4WA 3WF0A 2P88A 3NOYA 4Y9NA 4JXCA 3TYZA 3W27A 1OT1A 1B9BA 1J6OA 4UMAA 2X1IA 4JEQA 2PD9A 2E0PA 4G2DA 3Q58A 4HK7A 4JIEA 1VQTA 5FEXA 5E09A 5C8BB 4XZ9A 3WBAA 1UKTA 2G5WA 4HK5A 1GWJA 3VOHA 4XK2A 3TA6A 4E8DA 2X40A 1XI3A 3HURA 3S0CA 4W89A 3UT0A 4F0RA 1PBGA 1BXNA 1VYRA 3N6HA 2YL5A 2CHRA 2V9DA 1Q7MA 4BEUA 3HG3A 1AMKA 2YX0A 1IEWA 4P7QA 4NI3A 1Q63A 1KKRA 2WMKA 4PCPA 5A8QA 5RUBA 4IJCA 3M7SA 4ZODA 1QRQA 4O15A 1P0NA 3IGSA 3TJXA 1E6NA 1EO5A 2QS8A 3KZSA 2D2GA 4NNBA 4EPEC 1UB3A 3FOKA 5D37A 2J8GA 1XLGA 2ZTJA 1T0OA 4O28A 3DFTA 1FHDA 3S1WA 3NQ6A 1XRFA 4BI7A 5BCAA 3IGHX 2PC4A 2O9TA 1TREA 2X0YA 1BRLA 4HN4A 4LY8A 4WDWA 1HZYA 2E4TA 4IZGA 1TV4A 2ONEA 3R0KA 2NT1A 2OZ8A 4DYEA 4CCCA 1QI5A 3PHAA 5BNKA 4U2ZA 2FVKA 2VURA 3C2VA 2OYKA 3ERPA 4JTTA 3AJ7A 3MJYA 1UA3A 4C6MA 1US2A 3VNZA 2Z2AA 3IARA 2W61A 2D0FA 3ARTA 1PB0A 3TJIA 4LS0A 3DBNA 4YTRA 2Z1VA 3K8LA 1R47A 2WJFA 3QQ1A 5ECUA 5I78A 3TIMA 1VJZA 1M53A 4AZHA 5IHSA 1QW9A 4W7WA 4I5XA 4IIBA 4LV4A 5I07A 2J62A 4I90A 1PL9A 1KM5A 3QEZA 1DTNA 5ABTA 2Q8ZA 4LUJA 1BYDA 3OVQA 4TTUA 4Q32A 3ARXA 4X9SA 2CW6A 2HCVA 2QGHA 6XIAA 5T9CE 1ADOA 3PTKA 3TFXA 2DQXA 4FS9A 4PR4A 4ROPA 1BWKA 4X22A 5HBFA 5HXMA 2PCEA 3A9IA 4JTKA 2C1IA 3IJ9A 4AVOA 2GGJA 4FEZA 2VKZG 5KINA 5EBAA 3W1XA 3MZ2A 4LVBA 3OHMB 4QSHA 5LGXA 2QCDA 3KL5A 4XBKA 1ZJAA 4LGXA 4HBKA 4AF0B 4JAWA 4G7EB 4ICCX 4LOCA 2INEA 4O13A 2VCBA 4GD0A 1ZRQA 3ARRA 1EJVC 2X1TA 4ZGYA 3EOOA 3HM7A 3MDWA 1P7TB 5C9WA 2DSZA 3PPCA 1XDMA 1RALA 1B90A 3EX4A 1V51A 5B80A 4JX5A 2PURA 1WPCA 2NWSA 3INPA 2OB3A 1E3XA 4ECLA 3EEGA 1MSSA 1R30A 2Y8KA 4O4VA 1MZRA 2FZBA 3TYCA 2ODOA 4CNNA 4QJ4B 5A8NA 1EX1A 4FR1A 4ZTXA 3UR2A 3EA3A 2NW0A 3C8NA 3PBUA 2WZIA 3FA5A 3ARPA 4BS0A 1PS9A 4QLJA 3CV1A 5AKQA 3AS1A 1XIEA 3O8AA 1FDZA 3A13A 3WNNA 7REQB 1UD2A 4TIMA 2ACQA 4Z2IA 2XH4A 3BTNA 1MYRA 3WH9A 3PZOA 3KOWA 4JNZA 2VC6A 4U5KA 1GKRA 2WMJA 4QQUA 5IOBA 2OJPA 3FDKA 5JH1A 1ZJBA 4GZIA 4U33A 3BLEA 2EPOA 3WZ0E 1R3QA 3A24A 4Y2WA 2ABBA 3BSGA 2EHHA 1XP3A 4DLFA 1YXDA 3H2MA 1CB2A 4GQBA 4EAYA 3W2NA 2G97A 1X6UA 3UCQA 1LG2A 1XX1A 4H8HA 3AMLA 2Y5EA 3NPVA 3DERA 3OLIA 2DZBA 2ZZ6A 3SCOA 5TNVA 1XPGA 2DUZA 2Z7KA 1K8XA 2V8ZA 4YCPA 3FA4A 4KERA 1GW1A 4H6KA 4NNCA 5EU9A 2Y61A 3IJLA 1YW1A 3MWCA 4P7OA 1EGVA 2XVNA 4HVXA 5A6LA 3LXAA 1EGMA 4GQ0A 4JTQA 2OZTA 3GXTA 4Q4SA 4DO6A 2OQHA 1DJIA 3N25A 1ZLPA 1MEIA 4L1WA 3MW7A 1DJYA 1TCMA 1WKYA 4UTTC 3ARUA 3GY1A 4PUWA 3U57A 4NZ5A 3WF2A 3LZ3A 1W3HA 3RRXA 2F6XA 3ARZA 1Q6GA 4J3ZA 4QDPA 3KLKA 5AOUA 1LCOA 1Q6EA 2WSPA 2WZEA 3VX1A 3SUSA 4C6NA 2X09A 1HKMA 2PB1A 3CK5A 5I5RA 2HXUA 2B7QA 4MNLA 5JBEA 3CV7A 3F2BA 1R3SA 3D3FA 3H4XA 1EO7A 1E73M 1TTQA 4JDBA 3BWWA 3THAA 1TV5A 3UG5A 3W2UA 2OMAA 2XFWA 3TWAA 3VD9A 3MANA 2CWXA 3ITTA 3GU1A 2HBXA 3P74A 4IGHA 4NZ1A 4PA8A 4N9EA 2HNEA 1A4MA 3W01A 3W02A 2F6KA 2PGFA 4Z2LA 1H09A 2DSKA 4ES4A 1GQIA 1GNXA 1GG1A 3VZXA 4U2YA 3EWXA 3T42A 3PN8A 3V0UA 3FX4A 4NF7A 3VKAA 2PE4A 3S46A 4EIVA 3B9DA 4Z1AA 3A64A 4UFIA 3BZJA 4JFSA 4HHPA 3FGCB 3GXIA 1WDSA 1YDVA 2QMKA 2AQVA 1OF8A 4YL2A 2QW5A 3CT2A 1JPIA 4PSRA 2ZXQA 1LOSA 1TPFA 4MZYA 1A0DA 3NIYA 3CL8A 4AC7C 1GZ1A 3EPOA 4HKPA 1GONA 3AC0A 2EJAA 2GVLA 1NARA 2DZUA 3IANA 3PPFA 3WQCA 2GWGA 2GOKA 3B4UA 2SFPA 3CWHA 1GKPA 4XIMA 4W8BA 4K37A 5I77A 3VIIA 5CGQA 1LORA 4L7ZA 3E2SA 1U33A 4ZENA 3IJIA 1UOKA 3BQ5A 3EKGA 3GLCA 2YGYA 3GTFA 2HBVA 4MKVA 4O0QA 4ZQRA 4E8CA 4H6RA 3ZT5A 2WQPA 3B8SA 2BOGX 4WKAA 4GIRA 4PC8A 3VOJA 2EBNA 2XZ7A 4XBJA 3B0VC 1QMLA 1E9IA 3NG3A 2IPJA 1R7OA 4A8LA 2G37A 2EO7A 4RW5A 2WNQA 4JTDA 2A3AA 3FA3A 1YNPA 3PWGA 1I8JA 5D2TA 3OEXA 1XD1A 4O57A 2Z7GA 1V02A 2HE5A 1ECQA 2VEIA 4QNWA 5C2XA 1A5AA 1RPXA 2XN1A 3VGDA 2B81A 4WX2A 3W1AA 4CN1A 3QKEA 3HOJA 3GXMA 3C2FA 1L6FA 3BJFA 3THDA 4ACZA 2Z27A 3TC3A 2VUYA 1BYAA 3UR7A 4C5YA 3TP4A 3WF4A 1HVQA 3L4VA 3EWYA 1ZL1A 1PE1A 1QNPA 3GUWA 4WHBA 4NIRA 4NP7A 3QSTA 1GOWA 1OC6A 2FKPA 4HCHA 1K8ZA 3KVKA 5LNWA 2ZRZA 1R2TA 1KGUA 1X96A 3CMJA 4IJBA 3W7JA 2XTKA 3ZJKA 3VA8A 2GUBA 4Y8FA 1RD5A 3EDDA 1GOMA 1CGTA 4PTDA 3R25A 4PSPA 3PP7A 1YEYA 1EPXA 3V18A 4US5A 3OYXA 2FJKA 3TNBA 3LSBA 1SQ7A 3Q65A 1JR1A 3Q37A 5TQLA 1VEPA 2DPEA 1JIBA 2VX5A 1XINA 1FP9A 5T26A 2YCIX 4C91A 1DXEA 2QCGA 4RW3A 3CMGA 4IG2A 2BZNA 1XIJA 3NOEA 1TR9A 4N2YA 3ZVHA 2F7FA 1SR0A 3A9BA 3G77A 3A22A 5EB8A 4JCLA 1S3HA 2H9AB 4DO4A 3VDBA 4RE2A 2GJLA 3P8IA 3N1AA 3DGBA 1EC8A 2XZ9A 3TVAA 1XS2A 5LXXA 2R1MA 1JYWA 1QK0A 4CNSA 4HU0A 3H21A 2AQWA 1QOPA 4M6UA 2H3BA 3HBLA 4IICA 2PDFA 3AHVA 3N4FA 2BOFX 3G6MA 5LNRA 4H04A 2XFYA 1QBBA 1GCYA 1QW7A 4ZEPA 1HJXA 4IGMA 5HR6A 5F1UA 4HD5A 3ITOA 1E6RA 3U2ZA 2WYSA 1MQQA 3QJAA 3UYCA 2VFIA 3D46A 2HE8A 4N6FA 3UXIA 5M2FX 2E6YA 3T6CA 4PRTA 1HXJA 4YTSA 1AODA 3M6YA 4IGNA 3M5XA 4O54A 4TX6A 3UXKA 1KQZA 3KXQA 3G1HA 4G56A 4LAKA 3G3DA 3F4NA 4E2DA 3BO9A 2XH0A 4UTKA 3WLIA 3K30A 4S23A 3FY1A 3V1HA 2QJJA 3CPRA 2DZVA 3WENA 1UR0A 5DLCA 1PTAA 1FWSA 3UXDA 3UVIA 3S2CA 5EFDA 3XINA 5FJTA 4HYVA 1QNVA 1BYCA 2O4MA 4WGHA 1TO3A 2D3LA 1UJPA 2DEPA 3CUXA 1LRQA 5CBJA 3T44A 3N9RA 3W84A 1OG0A 1CXKA 1G5AA 3ZLFA 2R1PA 1RVKA 3WF3A 2ZWZA 5CPNA 2ZDRA 4JIRA 1GOQA 1POKA 1XFBA 1CI1A 2DIEA 3FVMA 3MMDA 2AQOA 4WOZA 3C2EA 6XIMA 1M3UA 2PLCA 4NAEB 3EX6A 3LV6A 3FJNA 1IWBA 3LHYA 2ZZ3A 3W7LA 3B0UX 4MIMA 4JNYA 3WQOA 4EAMA 3W3OA 2BG5A 2D23A 3B03A 5AVHA 4IIHA 3U2EA 2R94A 3L4UA 3V0SA 2TSYA 3DDMA 4M7SA 2C13A 3SCWA 1E5NA 4J3TA 4G7FA 3UY8A 3UPBA 4F9DA 3PAJA 3MT1A 2VX7A 3W7KA 2C7FA 2YL8A 4ACYA 1B57A 3ANUA 2BHZA 3WMBA 3WDJA 3KHJA 3G18A 5LHEA 1R3RA 2PLMA 4G6CA 3G0XA 5K3VA 1RQBA 3MHUA 4CKQA 1ZNNA 2C0HA 4KKXA 1UUQA 3DYOA 2VCAA 4PZVA 1JRCA 2PDBA 1JCMP 1NSJA 1SW0A 4QHRA 2ALDA 2I56A 5HPOA 1CXHA 3P2VA 4F0LA 3W73A 1A53A 2QEZA 4N9BA 4GYKA 4XD5A 3C3NA 1PYMA 3EX2A 3AXHA 1UD8A 1JQXA 3CH0A 1KXTA 3CMFA 3QHMA 4DAFA 4GZJA 2CETA 3WDRA 2GGIA 1I0BA 4LC8A 3CIXA 1SW3A 1G4TA 3KDOA 5C55A 3VNDA 2FZNA 4UMBA 1P6BA 3HJEA 3AQUA 4TX9A 2BWGA 3R2GA 2E6DA 1K02A 1DJXA 3I3DA 3PZNA 3KP1A 3PTQA 1FKWA 4NNAA 4XIAA 3NO3A 1FVPA 1CDGA 4S3KA 1RP8A 4DNMA 4IUGA 5CAHA 3B4YA 4J40A 3S9YA 2QPUA 4JTLA 5CLTA 2VT0A 1A3WA 5MF5A 2PF0A 4IXHA 4YVVA 2NLYA 2DP3A 3HGRA 2FH6A 2VUNA 4GBDA 2QGYA 4W8LA 4PMUA 4A22A 7CGTA 2VC9A 3EWCA 3S2JA 3OG3A 3N3TA 2BODX 1W3IA 3M0MA 3R10A 1X1NA 2E1WA 2WV8A 3ITLA 4K6AA 2DT3A 3IK4A 2E8ZA 5TF0A 4ZTYA 3WUFA 1JAKA 4U3CA 4CNTA 1IHIA 1P43A 1VEMA 3KS5A 3UP8A 4CD6A 1OCJA 4XZBA 1IIHA 4FX7A 3VNMA 2V2DA 3W74A 3PUGA 2V67A 1H7WA 4UFHA 4PEKA 3ME3A 3T0DA 1W2PA 3L4ZA 3WQ4A 1I2PA 3MMWA 4QE4A 5LGZA 4FB7A 2CBJA 4C7FA 4LT9A 5LSMA 5BOEA 3LMYA 4UTLA 5GVJA 4GUHA 4TU1A 3SDOA 2VFFA 2QDEA 4O1BA 1QK2A 1OIFA 1HN1A 2F8QA 1TPEA 4P5UA 1NFBA 3WLRA 2CKRA 3UXAA 3ZOAA 3CC1A 3MA8A 1ZUAX 3RLVA 1A0EA 4GACA 1XDJA 1J12A 5AZ0A 1M65A 5IHRA 3OP2A 3MSYA 1Z32X 2D22A 1AFSA 3TZNA 5LIXX 1EXPA 4ZQCA 2WANA 4JTEA 3NQMA 3VABA 4RK8A 5EBUA 1JZ4A 5HQEA 1VFHA 2V82A 1T8XA 3KVJA 4FI4A 4AAJA 1WP6A 4MDPA 1S2WA 5KZDA 3VCCA 1FXQA 1V3IA 4HNLA 2G41A 4AD5A 3ALGA 1C9DA 5C71A 1TR1A 4XKYB 2QV5A 4QX4A 3DKJA 3MJMA 1IXNA 2R8WA 2PGWA 4A8IA 4HPJA 2PZNA 4XZNX 1BPLB 3OLGA 3PFRA 5D8ZA 3M5YA 3W85A 2C0AA 3P81A 1WXJA 4JIPA 4QRNA 3OGRA 2V63A 4HOZA 4FOKA 3RIKA 2ZA3A 4MDOA 2YXOA 4R88A 4V2XA 1VFOA 2YA2A 1CPUA 2YDSA 3LQLA 3GC5A 2DH3A 4LYPA 1W9PA 1JXKA 5KMYA 1MQPA 3CZKA 5CPOA 1Q45A 1Z89A 4L6DA 4YWSA 1NY1A 5AHMA 2XFFA 1VCVA 4YPJA 4JTGA 1I1WA 1OYBA 2G4FA 4MF4A 1BLIA 2JKAA 3LN3A 4AC1X 3F4CA 4P7LA 2QAFA 3V3WA 4O11A 2X0HA 3EBVA 4GWEA 1JULA 1QPOA 4LAMA 3B8WA 2GK1B 2DUXA 4AWSA 1OFBA 3D5HA 3PJWA 3GM8A 1GVEA 1Q4WA 3TTOA 3QOKA 3W7CA 1D7KA 1Q8JA 4PBEA 2HROA 1UG6A 2O4QA 1E0WA 1S5WA 4OUIA 4B16A 3NVTA 4L9ZA 1Q7ZA 1LLOA 4P7NA 3NO1A 1KW1A 3NQDA 4MGGA 3AHTA 3T08A 4PMVA 1S2TA 2CBUA 1S5TA 1VRDA 3SIZA 1CIUA 4F8XA 1Y65A 4MOZA 4S1FA 1ML1A 3PBVA 2CZEA 2PGRA 3LUTA 2QVNA 3N17A 1T7LA 1VFFA 2ZQ0A 1HIZA 2QCFA 3AUJA 3L4TA 3WL1A 4FIQA 2GUYA 1XBXA 2DH2A 7PTDA 5I3KA 2IKJA 4GNKB 4DI8A 2CLOA 3G1SA 4AUBA 3TCSA 3W87A 4MWAA 5AHIA 1NVMA 2UY5A 3H24A 2WNZA 5M17A 5F2GA 3NSMA 1X98A 4FMVA 1V3LA 3SRKA 3UETA 5D9MA 3JVAA 2A0NA 2D24A 2REQA 3O3RA 2G3MA 2VZTA 2O0TA 1TJ0A 2XVLA 3EOSA 1V0MA 1W2VA 5AHEA 4JFTA 2J77A 1L0PA 2O7SA 3VNJA 1JD9A 4WQ6A 3N18A 1A5OC 2YB1A 3L65A 2ASHA 2PWVA 4EXAA 3FAWA 3NDZA 1TMHA 1RD6A 3E0VA 2AOSA 3E74A 3VIFA 5J5RA 4JKLA 2XSBA 3I4EA 1ZQ5A 1OK4A 1WAUA 4YCOA 1K9DA 5LA2A 2VR5A 3A21A 3KTXA 4LB4A 3RO8A 2Z1KA 3UZXA 2GSEA 2HVMA 3DG3A 3TYAA 1UWIA 4B3LA 3PJTA 3R7MA 3CBWA 3VFCA 1GPWA 1XCWA 3NQVA 1UP0A 1KFCA 1PZ3A 2C71A 5XIAA 3WN6A 1MXDA 2IXUA 4UR9A 1ZY9A 2XPKA 5JBDA 5AZ1A 1W1TA 3MMUA 1AG1O 1NOUA 1TPUA 1N7KA 1C3FA 4IL0A 1TA3B 3MTWA 3LCFA 1VP5A 3TC7A 3F2CA 2Y85A 3VDGA 4JTJA 4C90A 3TXVA 1UASA 4KWWA 3MVTA 4PMJA 4JQ3A 4HZ8A 1UPPA 3AIRA 3LQGA 4QQ3A 1XLKA 4O53A 5LHFA 3GS6A 5DMMA 1CEOA 4FLRA 3TAOA 3WY1A 2NUXA 2Z2BA 1HF6A 1WZAA 1TYGA 3K1GA 4S2BA 4LVFA 3VGFA 1R7AA 5HJYA 1LOLA 2J7DA 3BZGA 3C52A 1RCOB 4NX5A 3UYIA 2BHYA 4OOZA 4OV4A 4QJ1A 3W1QA 1D3GA 4KIRA 5HDRA 1W0MA 4EPBC 3APGA 4A2RA 3WNMA 2GGHA 3SO7A 5DFAA 2VDGA 2XIOA 2UY3A 4LUYA 3P82A 1AL8A 4AY1A 1PAMA 2EXOA 2O9PA 2FTYA 1AQMA 2DT2A 1Q3NA 3IJDA 5CKSA 4MAVA 1LL4A 5HULA 3TQ0A 4R9OA 3CEPA 4ZB5A 2J9XA 3I68A 4HP5A 3GTIA 1H61A 1NP2A 5E0FA 1YXCA 1B3ZA 3QHNA 4IFOA 1XFCA 3FS2A 2ISSA 2Y0FA 4PODA 3UJRA 1U22A 1QNRA 2CLKA 4IFKA 1WXYA 3E2QA 3FN9A 4LYKA 3RMJA 4L64A 2Z1WA 1UKQA 3WQVA 5LXEA 2VZVA 2HK0A 4ORMA 4H2HA 1KM1A 3QTPA 3UWEA 1W5QA 3FKRA 4UTMA 1VAHA 1WAWA 2DSWA 4A3UA 1EJ7L 1G7UA 4DWSD 2PFHA 1BQGA 3AYTA 2IPWA 3WEOA 5CQ1A 4JY9A 5ABEA 3AYRA 1DJQA 2VZSA 2XH2A 2YOCA 3EPNA 3PJUA 5C9RA 3O6AA 5TD4A 4CQ8A 3CZLA 4BI5A 4ZQNA 3ZXWA 1E4NA 5CGTA 4Q4MA 5I3IA 1JPMA 1M03A 1R9XA 3VIGA 1G67A 4FF5A 1UYQA 1QPRA 5FSDC 4QFUA 4NL1A 3TK7A 4RZBA 4B91A 4K68A 1VKFA 4Q7NA 1FH8A 2WC3A 3MUXA 3N6QA 1FHUA 3TE9A 4ZO9A 1TX2A 4XTIA 3O06A 4YN5A 1RHCA 2JF7A 1GORA 3CL7A 2X42A 3WCZA 3S9IA 3KM8A 2OX1A 2AMXA 2NLIA 2VENA 4AHPA 4Q8PA 2WSKA 3VMOA 3IJQA 1XIGA 3NQ8A 3TJLA 5KZMA 2X2GA 1FDYA 3HB9A 4FSAA 4NRSA 5KZ6A 3P67A 1H11A 4FP1A 1KFEA 5U7SA 1PVNA 2WMGA 2CWNA 3SZ8A 3H26A 3CU2A 2HWGA 2ZUSA 4O12A 3F4VA 4Y8EA 3C0LA 4NKCA 4WXYA 4FOUA 4WEVX 4P8XA 4IQEA 1OK6A 3AISA 2FMNA 1UWAA 5CSSA 3DN5A 4LRTA 3MI6A 1JYXA 4IMDA 1P4CA 3CHCA 2QCNA 3VXGA 3VZZA 5CSYA 1UZ1A 2J13A 3G0UA 4YHGA 3EDJA 4IMEA 2I5IA 3DKLA 3PS7A 4ZO8A 4D6EA 1R38A 2RDUA 3ZQ9A 3BV4A 3CWOX 3F5LA 3PZ9A 5HUOA 3K8KA 3TR2A 1ONRA 1DL3A 3CWNA 3K2GA 4UFJA 4O8RA 1AH0A 1WDQA 4GY7A 1W8GA 1ZBCA 3QMSA 4TO8A 4OBSA 3P5ZA 3POCA 2W79A 5DF0A 2TPSA 2CITA 1PXGA 4ZXOA 1OGBA 3IGUA 4UR7A 2ZE0A 4HNTA 2C14A 2VEFA 3WH7A 1LRNA 3ZSSA 2W91A 1A5CA 1EP1A 3WELA 5AECA 4Q22A 2JEPA 3W1PA 2Y7GA 3U0HA 4HOWA 5JIPA 3L5MA 4F3HA 3BOXA 5C70A 1KRAC 3MMTA 2J4GA 3F2DA 4EVZA 3RR1A 4AEEA 5CPSA 5AB3A 1KCXA 3M5VA 5CXPA 4DBEA 4C6LA 2BV9A 4UTWA 4UB9A 1ICPA 1CLXA 2DZTA 2HPMA 3QC0A 1J4EA 1JDAA 1VBGA 2BVDA 2QNEA 1REQA 1B3YA 5HR7A 3OQ8A 4ZA0A 2DVXA 1PX8A 2I16A 1YQ2A 3SCTA 1F2JA 4KESA 4NZCA 4OV9A 5A2CA 2WBKA 3GWQA 4UQBA 3QFWA 4KRZA 3GE7A 4NZFA 2J75A 3RXZA 3F5JA 5B7YA 3G0SA 4ZB0A 4QG9A 1M41A 1FFRA 1UJQA 2OO0A 1E9YB 1BGGA 1CLKA 2GJNA 4FNPA 1FDJA 3ABRA 3TN6A 5I3GA 4L1XA 1RSCA 5CJ5A 3U5YA 4JTHA 1XLAA 1DV7A 3AICA 1FH9A 4CGTA 4S3BA 1F4HA 3WQEA 2OELA 1CZ1A 5KSWA 3WLHA 2WJZA 2D2HA 4REQA 1K77A 2X8RA 2RH9A 4F79A 1W8SA 2G8ZA 4UFKA 4HNNA 5M3WA 2EPKX 2HMCA 4GE8A 3EX1A 2NSXA 4HJFA 1NOWA 3GKAA 1XCXA 1TX0A 3N4AA 1IEQA 3PB2A 1UC4A 4PUEA 3WIJA 2RKXA 3WBEA 3VIHA 3CUIA 2D0HA 1LJYA 4AZCA 1HJSA 4AHOA 1ZGDA 3KLLA 3J7HA 2WLZA 2Q71A 1IE7C 1ADSA 3LA4A 3C61A 1S5MA 2PODA 4CQAA 1R9ZA 3B3DA 1KWGA 1F5ZA 5CPQA 1H1YA 3GVVA 3NQFA 2OODA 4N4PA 1CB7B 3H53A 1YMYA 3R58A 3AHXA 3G1YA 2A3HA 3TFCA 1NTHA 5DCEA 4ZBCA 1C8YA 3CEUA 3WMCA 5FESA 4DELA 2ZRVA 4AH7A 2JF6A 2IMRA 3FEMA 1OINA 1A5UA 1UD3A 3RHGA 3WH8A 2DSVA 2G3NA 3M5ZA 4Y9MA 2V6AA 4WDTA 2VI0A 5HJXA 2R91A 3QQWA 4F2TA 1PZ1A 3V5OA 3LHTA 1OCNA 4I8YA 2WM1A 2Y1HA 3QH2A 3VE9A 5FJIA 1JGMA 3P62A 4C6FA 4DZIA 1TPH1 3DECA 4CEUC 4FLQA 2GPTA 4PB5A 2Y62A 1CLVA 3LDVA 1WYIA 2G0WA 1KRMA 1FWGC 3EA1A 1QI4A 4HHLA 1NDYA 1O94A 3USZA 5CPTA 3V36A 2XGZA 2ZUTA 1WA3A 2OPJA 4JTIA 1JCNA 2WB5A 1XM3A 3GDBA 1IV8A 4E3TA 2QDGA 3E0IA 4IUOA 4H9UA 1JCLA 4CQBA 1GOKA 3GFXA 1E70M 3VD7A 4Y9OA 1V6VA 2HEJA 4WSHA 4UTWC 4UBPC 2ZE3A 3NWRA 4G8TA 4EWJA 1E5JA 1LBFA 3MKVA 5DMNA 4PL1A 4MVAA 4KCTA 3W70A 2F84A 2PDLA 4Z0SA 1FHVA 2HQAA 4I3GA 3GVGA 4G9PA 3W7QA 1YTDA 5LNUA 2V5DA 4HA0A 3T4CA 4LVAA 5F2MA 2IQ0A 3LHWA 1UR8A 4D1IA 4KFOA 3STGA 1B30A 1HGWA 1L6YA 2CNCA 1JJKA 1BVZA 1FWBC 1MVYA 2ZRWA 3QR3A 4GISA 4ZXLA 1QASA 2WVVA 2ISDA 2ZBTA 5HATA 3B9EA 5MKGA 2RGLA 1OGSA 5FL0A 8A3HA 3TJ4A 1NIUA 3NL3A 4PUKA 3WUBA 1IEXA 1PPIA 1V8EA 4PTWA 3RITA 1UBSA 5HNNA 3LGEA 1SZNA 4X3ZA 1Q65A 3TWBA 3PZIA 3W7OA 4LCQA 2UV8G 3BV7A 2E40A 4BQ2A 1W9BM 3NM1A 3ONBA 4K3ZA 4LX4A 2HZGA 3NL5A 3SY5A 1E55A 2BY1A 2POZA 5A2AA 4GYPA 1RV8A 2GQ8A 2FVMA 3DI0A 4UTIA 3GNPA 3U8GA 1J0IA 3MVIA 4WK9A 1H62A 3CAWA 1XLIA 2XSXA 2AKMA 3MUZ1 4KWUA 1RY0A 2OGYA 1BHGA 1DJNA 1JNEA 4DJDA 3RGTA 3RX4A 1JGIA 3NGFA 1RBLA 1E71M 2G95A 3VD3A 3MHFA 4B5WA 2GOUA 2V5KA 2WK2A 1I2QA 3IEBA 1BD0A 1A47A 4L5ZA 1F6PA 3FDGA 1MRAA 2V2CA 3WLOA 2WO5A 1HQTA 4W5UA 4QITA 4D6DA 1TVNA 1LBMA 2WSYA 3FYPA 1V08A 4ZSTA 3WH5A 4NHVA 1UIPA 4LUTA 1XCFA 1X97A 1BTCA 3S5SA 3DGRA 1PV8A 4J3UA 4HOXA 3QW3A 4NUWA 1JDEA 3HQNA 3RCYA 1EX5A 3KE0A 3O0FA 4MHBA 5CC6A 2X1UA 4ZQOA 3D47A 1PZ2A 1B54A 1NH6A 4R85A 4S38A 1BSIA 1KFKA 2IQTA 4CQCA 1WQ5A 4DJFC 4FX8A 3Q94A 3GTHA 2EG8A 1S1RA 5JU6A 4G1KA 1R2RA 1S1PA 3TN5A 4CD5A 1NQ6A 3CUZA 3STFA 2A4AA 2PDJA 4EK7A 4US5D 4GNVA 3E96A 1KV5A 3F1QA 1I60A 1W3JA 2MUCA 4HTYA 2ESCA 3QQ0A 2RHGA 1HW6A 3C0JA 4XISA 4GPNA 1S2AA 5AC8A 6PTDA 1DWGM 4JYEA 4XO7A 3T07A 2YCLA 1LWIA 4MYAA 2ZDSA 1SZFA 1G94A 3DEQA 3B40A 4IMFA 1HKJA 2WHLA 4ZO7A 3M4HA 3W7DA 3BJSA 3LG3A 3H12A 2PP1A 4X2RA 1VIWA 1WUFA 1Z42A 4PBGA 4U31A 3N15A 3AO0A 2BBFA 2ZXAA 1OFEA 2JBMA 2VDHA 2OEMA 3CYJA 3WUGA 1EHAA 6REQB 3E1F1 4MG4A 1MO0A 4J4KA 1R3WA 2C91A 1W9UA 3GNDA 3B04A 2QF7A 3O0KA 3IVTA 4Y7EA 2G50A 5CBBA 4NT0A 3N2XA 2KZHA 3PNZA 4L1GA 3GH4A 3AUOA 2XGIA 3LI1A 3RFAA 1EZWA 4JHZA 1KFJA 3P6LA 1A5SA 3TAKA 3CB3A 3PNUA 4YXGA 1ISWA 2CZVA 4Q8NA 4Z1DA 3NQ2A 4F0KA 1PHQA 2ZRXA 3FVDA 3MO7A 3U7BA 3LCWA 1J0HA 4AZ5A 3W07A 1BXCA 4MAZA 1NFGA 1CXLA 3W1RA 3W7MA 4HNOA 2XM1A 4B4FA 3QZEA 3E3HA 1ZS2A 3H2FA 1XLBA 3H23A 4NASA 4AD4A 2DZXA 5C0QA 3F03K 2J47A 4TV6A 1WZMA 4GLEA 5IDIA 2Q09A 3XISA 4H9XA 3WQ6A 4TTGA 4FNSA 1YXYA 2YW3A 2Q8XA 3GRIA 4GQQA 4JFVA 5D30A 2PDWA 5HQLA 4Y96A 5AYXA 1V7AA 1TE1A 3R0UA 5I6SA 1H3GA 3VAVA 3NQBA 3H22A 3MWAA 4J2MA 5BW6A 5IRPA 3LLXA 2QCCA 4L4MA 1JPHA 3BGJA 1P6CA 1WX0A 4RZ6A 1JCXA 4F0HA 1XSIA 1OC7A 4DF2A 2W6RA 1UWTA 2CC0A 1JNDA 5AVNA 1F7BA 1UHVA 4QBXA 3DBPA 1YBQA 2NX9A 3BVJA 1NAL1 5AY7A 4DEFA 3SCRA 1KXHA 5MHBA 5AC5A 3S5NA 1SUXA 3S2NA 1S5NA 3DFOA 3QXBA 1EC7A 3M0LA 3RM9A 4PFMA 3VIMA 2FB3A 4JN8A 4HA1A 3WFLA 3E0LA 3N2MA 3UG8A 4MJ4A 2CERA 1H5YA 1DQWA 1B1YA 3N9SA 4JIQA 2CBIA 3BANA 3SW6A 3O05A 1TZZA 4TV5A 3NFUA 1QXLA 4S3EA 5I3HA 2Y7FA 2Z0IA 3HPZA 3BJTA 4W86A 1KFLA 2C18A 4ZVJA 4C5ZA 1XH1A 1HT6A 5KETA 1K9TA 1R3TA 1AJZA 2NQLA 3HV8A 2EAWA 3S42A 2ZX7A 4Q6JA 3TN3A 1F9CA 1IR1A 3FV9A 4PCNA 3GC2A 3HGSA 3CUJA 1E15A 3U2OA 2BY3A 2YZ5A 3GO2A 4AMCA 3WD1A 1XUUA 2EKGA 3ARWA 1OC5A 5LIUX 1QDSA 1X1OA 3SM0A 4LEFA 3OTRA 3W7RA 2QVHA 2V30A 1XKJA 3C0SA 3LD5A 3I65A 1XF0A 3W29A 1OY0A 3QZ6A 5B7ZA 1H5VA 1WZKA 1I0DA 1JG9A 5C9UA 5LIYX 3A3XA 4EE9A 1EYWA 5GJPA 3RU6A 1W6TA 2UY4A 1SJAA 4K39A 2NVCA 1NWUA 1LROA 4YTUA 3PC0A 5AC4A 3MV01 1BF2A 2F9RA 1R0MA 1SMAA 2PRMA 3N34A 3BARA 4K1WA 2OZ0A 1B4EA 3U7VA 3NUKA 3NEVA 4N7QA 3TYDA 2R6OA 3SGGA 4HK6A 1VRXA 3GHUA 3ZR6A 5HWNA 4P7RA 3G6LA 3GW3A 3C5QA 2CHNA 4LTSA 3WD0A 3F4DA 1JZ5A 5BU9A 5I2UA 4DF1A 3OA3A 4JTCA 1GG0A 5ABHA 2GSJA 1DQUA 1L2QA 4K7YA 1GTEA 5A6AA 1LOQA 1DWJM 3ZJ7A 4PRRA 1CGXA 8XIAA 2VNCA 3GKFA 5LKYA 1VH7A 3LNMA 2DIKA 3HO8A 4Z1YA 4QAWA 3RX2A 3SUUA 3GBEA 2QDHA 4GGBA 1OZMA 3TV8A 2J9YA 2W0UA 4OFCA 1U30A 1RA5A 2OQLA 3WL0A 5HMFA 4YYFA 2CXGA 4L61A 1OEPA 4DY1A 4CNPA 4KFNA 1GPFA 1US0A 3QV7A 2QPXA 3NZ1A 4ENLA 3LX9A 3WQGA 3SSJA 3EDFA 6ENLA 1EA0A 1FX6A 4DZ5A 1UR2A 4AD0A 4QGCA 5IXEA 3RMEA 3CXOA 1W3KA 1VC4A 2BX7A 4KIEA 1TPWA 1GVRA 4HTBA 1UZHA 2WKGA 3CAQA 1EIXA 1AQHA 4LSBA 4XD3A 3T81A 4AIBA 4PMNA 3LHVA 1B3VA 3UR8A 2WVUA 5FF3A 5G2IA 5K7JA 1U2YA 4JX4A 3NR0A 1EL3A 3UY7A 3PZMA 4U5IA 3BAIA 3I6EA 3L4YA 2ZA1A 2QLYA 3II1A 3AIVA 1BXBA 1FWAC 4KGLA 3GX9A 5HOSA 3REQA 2FPTA 3GZAA 1J0KA 5EL1A 2YZRA 1LQ0A 2A7NA 4W8AA 1YE6A 4W7UA 3GXDA 3AROA 4D2JA 3LERA 1I75A 4HYWA 2YDRA 2PA6A 1K4HA 5U4NA 4EPDC 4GVFA 5I09A 1EF2A 4LXFA 4PGLA 1J79A 3OGSA 4FK9A 2DDXA 3AALA 4A2SA 7XIMA 1IXQA 4JTUA 1WNOA 3SY8A 1BGAA 4UR8A 1BRLB 4Z08A 3ZLHA 1M5WA 4I6KA 2FTWA 2CFFA 1WBJA 4KH2A 3P61A 2X41A 4NG3A 6TAAA 2PP0A 4ZR8A 4ZZ9A 1CXIA 3MB9A 4UQCA 4BK9A 4CQ9A 1E4MM 1BYBA 3A4XA 3CTTA 1TUFA 2VTFA 3VU2A 2ACRA 5G4WA 2VHLA 4C6CA 2V81A 1XLJA 4J2PA 5EMJA 1NDWA 1XYLA 2PWEA 4JL1A 2EG6A 3RO6A 1EJWC 2WMIA 3S1GA 1MWOA 1RA0A 4KQNA 4XZLX 4Y90A 5EMMA 3LS9A 5ECVA 4IM4A 5JBFA 1V79A 1V93A 3OBEA 3C0QA 4L4OA 1Y5VA 3W81A 1F3WA 3DFHA 3RPMA 1W5OA 4JL2A 2YSWA 2WOQA 4DYJA 4M56A 4OUEA 3ENLA 4AIUA 4A21A 3OZYA 1OCQA 1TB3A 2P10A 5AHNA 5HUPA 4CU8A 5PTDA 1XJBA 5REQA 1A4LA 3EKLA 1MZHA 2A3EA 3W26A