2OCZA

The structure of a putative 3-dehydroquinate dehydratase from streptococcus pyogenes.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
218
Chain Sequence
AMRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLGQVTLNDMKRIIEVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title The Structure of a Putative 3-Dehydroquinate Dehydratase from Streptococcus pyogenes.
rcsb
source organism Streptococcus pyogenes serotype m1
molecule tags Lyase
total genus 73
structure length 218
sequence length 224
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2oczA00
1P5BA 1W5OA 2Y88A 5CPLA 1QO2A 1GPWA 3ABSA 3I6RA 2A6NA 3IEBA 4QSHA 4OT7A 3R13A 3TMLA 4M5PA 3W2LA 3LHTA 4O13A 2PCQA 2AAMA 2FDSA 4MUZA 1OVDA 5D30A 1JUEA 2C14A 4DO6A 4K8EA 2WKJA 4O28A 2E6YA 4PTNA 4Y9AA 4RXFA 2J24A 5EA9A 2GQ9A 3GXTA 1HG3A 4K39A 5F2IA 3TAOA 4YXGA 2Y62A 3STGA 5CSSA 4I7UA 4O54A 4XTDA 3QJAA 2B7NA 1VYRA 1KLZA 3ABRA 4LC6A 3CLMA 3P61A 3A5VA 3VCRA 4KFPA 4BWLA 2YSWA 1XM3A 3PR2A 1DL3A 1G69A 2EAWA 1G7VA 1KBIA 1OFBA 1M7OA 3R12A 1VJIA 1V7YA 3DH7A 1XXXA 4X3ZA 3G8EA 1XBYA 3S1XA 4GUGA 3UYCA 4DPPA 4AHPA 3LI0A 2FJKA 2CZEA 1OFPA 2ZFAA 5AYZA 5AOUA 1B57A 3EWYA 4XTIA 3S0CA 3P8IA 4O4VA 1W0MA 1SO3A 3SW6A 5HUOA 2E5DA 4A2SA 2E09A 3C61A 2RHGA 1RVGA 3C2EA 4AHQA 1TPVA 3GNNA 3LLDA 4X9SA 4BFAA 3NO5A 4K36A 3P60A 1TCDA 1QCWA 2NUXA 1LRQA 2C13A 5DLCA 2CLIA 3FKRA 4O10A 1OYCA 1AMKA 4NX0A 1JCNA 1JUKA 1TTQA 3QW3A 3TW7A 1H62A 5D37A 5U4NA 2A85A 2EGZA 2BTMA 3KVMA 4N4PA 5J5RA 4IXXA 3HG3A 3LXAA 3W1LA 1FWWA 3UWUA 3STEA 3U6WA 1VQTA 4RZ5A 3TSDA 4MY9A 2B7QA 1MEIA 3BV4A 1K3UA 4RZ6A 4ZQRA 4GBUA 2H90A 3L5AA 5F1VA 5G2WA 1ZJIA 4CCDA 3S6DA 5KINA 2ZRVA 4UFHA 3QSTA 4N9BA 1KTCA 4Z1BA 4ALDA 1LYXA 4S1FA 3UPWA 3LM7A 3TFXA 5AFDA 4JIQA 3TA6A 2OMAA 4YCOA 1YXCA 1Q6LA 3W3OA 1X6UA 1C8VA 2QCDB 1SFJA 1VCFA 2GJNA 1GVRA 4JDBA 2QCCA 4MJMA 3WFAA 3RMJA 2G5WA 2YW3A 3WJZA 5TIMA 3DFTA 4O1CA 1KFCA 3IIVA 5EY5A 2J9YA 2RDUA 3KRZA 3BGJA 3GXNA 3C0JA 1L9WA 1FDZA 4JNMA 1TO3A 2BZNA 3NQFA 3SY5A 1W31A 5HUPA 1W56A 1Q3NA 5AYYA 4BI6A 3LXBA 1G4EA 3M5ZA 4DO5A 3NM1A 3FOKA 2ZZ5A 2CZ5A 3B06A 3M1ZA 4M19A 1PV8A 4Z1AA 2ZRWA 4Y8FA 6ALDA 4KWWA 4JIPA 4M7SA 1WXJA 3L66A 2A1YA 1WOBA 3TQVA 4H3DA 1E51A 4IMDA 5FF0A 3NGJA 3QZEA 4TR9A 2QJIA 2VEMA 1K7EA 4O12A 1GQNA 4MIMA 1KM1A 4R33A 4YCPA 5G2IA 4LVFA 4RK8A 1TJPA 1D3HA 1I2RA 1V5XA 1MZHA 1EIXA 4K8HA 4YWIA 5I3JA 1OFQA 1LOQA 3O07A 2ATSA 1YTKA 4H4IA 4WOQA 5HULA 2A7RA 3KVJA 4I7WA 4FNUA 3C2RA 3LRKA 4Z1DA 1TTIA 2QCNA 1MXSA 1G7UA 1ZHAA 3EWZA 3WJYA 1K8XA 3GNDA 4JEQA 3QEZA 3BGGA 2FIQA 4LS1A 5LNUA 4L4MA 2WNQA 4JD4A 5LNVA 1Z48A 3C2FA 1JRCA 3G24A 3I7QA 3VFLA 4UTMA 3N2XA 3IIZA 1TV7A 2VELA 3T78A 1JQVA 3S1WA 3E12A 3E49A 4TMBA 1R2SA 4ZMGA 3H55A 5SWUA 2YCEA 2DORA 1U5JA 3EWBX 3MI3A 4UTJA 1H61A 3ZWTA 4RKAA 3R8RA 3C2VA 4IOTA 1CW2A 2J9XA 1JJKA 4UFKA 1ICQA 2B7PA 3NL3A 3PB0A 2OJPA 4IMEA 4K6AA 4Y96A 3TJXA 1WOAA 2ABAA 3EXTA 3NL5A 1Y0EA 3QQ1A 3PUDA 3H53A 1P0NA 4FXSA 3W72A 3UNDA 3L2IA 1WDWA 3NXFA 4X2RA 3P5ZA 2RFGA 1KFJA 5AC7A 3GDLA 3IVSA 1J4EA 3IRDA 4MPQA 4BI7A 1RQBA 1LROA 1KFEA 5K4XA 3QQ0A 4OHQA 1A5AA 4DBDA 3LCXA 1FX6A 1FDJA 2VEPA 3W9ZA 3E96A 3ELFA 4GXMA 3P82A 5HMSA 4O18A 5CPNA 1VRDA 3CPRA 1VYSX 5DN1A 1CX9A 1L6YA 2NZLA 3V75A 2JKPA 4O11A 1DORA 5LZLA 3G1FA 2TPSA 1C9DA 2A4AA 4UMAA 1C29A 5D2YA 4FO4A 4MOZA 4BF9A 1RZMA 1KM3A 2Y6ZA 1DV7A 1EWEA 5CGQA 4H6KA 1FXPA 5TBOA 3R89A 3F03K 3TXVA 1RQHA 3L67A 2X30A 3EEGA 1TV5A 3B4UA 2Q8LA 2FB2A 3OVQA 4TO8A 2GJLA 4UTLA 3TSBA 5HQEA 3SZ8A 2Y7DA 5DXYA 3LCWA 2OT1A 1QMLA 3I65A 4PL1A 3A9IA 3W7KA 3RLUA 5D02A 4S2CA 3W83A 4WJEA 1TJRA 1T8XA 3OIXA 2Y7EA 4IJBA 3O6CA 4PH6A 4DELA 5K4ZA 3TXZA 1LBFA 1VCVA 3UPBA 5F4XA 2QKFA 3HGJA 1TIMA 2QDHA 4R34A 4ZL1A 1OK6A 4UNLA 5DY2A 4M6VA 3W7RA 1EP1A 3W75A 3S9YA 1DJNA 3OVRA 4LW7A 1OF6A 5FF2A 2LLEA 2Y70A 2NXGA 4EF8A 1LM1A 4ZZ9A 3CEUA 3GAKA 3DFPA 3SECA 2J27A 4HN4A 5CG7A 3STCA 4ZQPA 3UQNA 4UTHA 4EVZA 1I4NA 2HTMA 1W5PA 2F84A 3HG4A 2TSYA 1SO6A 4JN6A 3UY8A 2A6LA 4UFMA 4O0ZA 1TPDA 3LCFA 4UFLA 1OFAA 4XQ6A 2EKCA 5FEPA 1KBJA 5AHMA 4JTSA 1G4PA 3M43A 4RX0A 3TNOA 3NPVA 4HIBA 4K37A 1VCGA 3P74A 3OVPA 1OFEA 3KHJA 2WV8A 4UTTC 2CWNA 2Y89A 4IGHA 4GUFA 3USBA 4IMGA 1VPXA 1VR6A 4MLRA 2X1SA 1JCYA 3N19B 2ZYFA 4IPIA 1W54A 5AC8A 1SZEA 1QFEA 2ISWA 2JK2A 5CZTA 3W7LA 4NJGA 2R8WA 3W74A 3PF3A 5L9FA 1Q6RA 3UD6A 3WJWA 2QCLA 3GB6A 5D38A 5C6MA 4BI5A 2E6FA 1I2PA 3EXSA 4JTJA 5J5DA 2H8ZA 3L65A 3GX9A 2ZBTA 3S5YA 1F76A 4GJ1A 2HS6A 4ADUA 1F6KA 1HO1A 4NNAA 1PCWA 3HOJA 3P67A 1UBSA 1PS9A 2ZZ7A 1EX5A 4NX5A 1L6WA 4K7VA 3N14A 1F05A 3DAQA 3TC6A 2X16A 4CNNA 1OABA 1WA3A 2CLFA 3JS3A 5CPMA 3KFTA 2JGYA 3PAJA 4AWSA 4JTLA 2C16A 2NWRA 4CCEA 4QJ1A 1XFBA 2J88A 1I2OA 4AMAA 2QDGA 2OX1A 1ONRA 4PC8A 2H8XA 2X2GA 3W2UA 1H7OA 4TU1A 5EKYA 1BKSA 1I45A 4HNVA 2YFOA 4KWVA 5LGZA 5G5IA 3NA8A 2CU0A 5BMWA 3CB8A 3TK7A 1H50A 4PA8A 3PUOA 4CQAA 3LHZA 2PRLA 3MYOA 2XN2A 4Q32A 2E6DA 4LVBA 3LX9A 3C6CA 3GVGA 4DF1A 1GVQA 3G0SA 3CHVA 3W1AA 3BVJA 2YPIA 1FXQA 2QCFA 3TDFA 5E1QA 3O15A 1YXDA 4UCGA 3AJXA 3MHGA 4FNSA 4UXDA 1LBLA 1U83A 1FWTA 3LCIA 2B0MA 3FJ6A 1ME8A 2C3ZA 1XI3A 4WX2A 5DCEA 1G67A 2YFNA 2ZRYA 1GYLA 2C0AA 4R53A 3W1NA 1LLZA 4JX5A 1K8ZA 3Q37A 4ORIA 1ZAJA 1OFOA 1PL9A 1ICSA 1D3GA 1LRNA 1TPC1 2ZRUA 2ZTKA 5K9CA 2HSAA 1M5WA 1W5NA 3O63A 1TREA 3W1RA 3KXQA 4FB7A 2VC6A 3HPSA 3GDRA 3C8FA 3IGUA 4PL2A 3RFAA 3MBDA 1RV8A 5GVJA 1LTDA 1Q45A 3DI1A 2FQIA 2NXIA 4ZQNA 4ZVJA 1DQXA 4NT0A 2JKEA 1NF0A 2V9DA 3SSJA 3TX9A 5LNSA 2FFCA 5AHIA 3BW3A 4Q33A 2NV2A 3W6YA 1IIGA 4XKYA 5I3KA 1YPFA 3MBFA 4ICNA 1AW5A 3GAYA 3G1XA 3PVFA 3Q94A 3MP5A 4ML9A 5FEWA 4O1BA 3PB2A 4E38A 1HTIA 3N2MA 3D0CA 3A21A 4O14A 1F7BA 4FNRA 3GIYA 3MUXA 2TRSA 2DZWA 1QO5A 3EWUA 1B4EA 2BLEA 3SFKA 3OG3A 3T4CA 4N2YA 1WBHA 3NPWA 3M0ZA 1EUAA 3PG8A 1KW1A 4JR5A 3BG3A 4OV4A 3N9RA 3M5YA 1S5TA 1Q6QA 4MVAA 2VENA 1OYBA 1GJPA 1XUZA 1NFBA 1TPWA 3RNDA 1QPNA 2WNNA 4AB4A 4MZYA 4ORMA 3DFOA 4L4LA 1TTJA 4N6FA 2QJHA 1X1OA 1DOSA 3W76A 1O4UA 3EWWA 4JTHA 3W7GA 3QPYA 4RV8A 5D03A 1FWNA 3CC1A 3W7EA 3ATZA 3W7HA 3CM4A 2G95A 1TPH1 4JTGA 4LWWA 1PHWA 1W37A 3DXIA 3VKJA 5KTLA 3GR8A 1O60A 5D32A 2G96A 3EKLA 1H7PA 5AC6A 4O50A 3S8HA 3LV5A 1GVSA 3FYOA 3G0XA 1W5MA 4RCXA 4LS2A 3FA5A 5FEXA 5IBXC 1Z44A 4IWWA 5EPDA 5G1YA 1EP3A 4NVTA 4FX8A 3W23A 1JR1A 3EX1A 5DELA 2QCMA 3PBYA 3ZR4A 1WQ5A 3LTSA 3Q58A 4O57A 3JR2A 1ADOA 3PULA 3C3NA 3B05A 3LBCA 2ABBA 3LBMA 4NXKA 3UWYA 1O5KA 4NZJA 1YTDA 3HBLA 3F4NA 2OZ0A 2QUUA 2VKZG 5K2ZA 3DBPA 2RDWA 5HNRA 2GOUA 1K8YA 3BLIA 3QYQA 4DF0A 4NJHA 4NXSA 3QMSA 3I7RA 4JTTA 4UTUA 4XZ9A 2J9ZA 5DXXA 4GFSA 1FWRA 4O1DA 2JGQA 4XBSA 2DU2A 5I3FA 1EPXA 1G4TA 2FLIA 4WD0A 5H91A 4JYEA 1AL7A 4Y90A 3LHVA 1LRTA 3EB2A 3TR2A 4DF2A 4AH7A 4WZHA 3NL6A 3W1QA 2WQPA 5C5YA 2QJGA 1YLVA 1UUMA 3FEMA 4AF0B 4X22A 2V0TA 3C4UA 3OBKA 3THQA 4QNEA 4FIRA 4LU0A 1L2UA 3NQMA 2X1TA 3TROA 4MYXA 5G4WA 4NJKA 1AW2A 1KM2A 2JBMA 2YYTA 1W3IA 3P5YA 4GNJA 2BWGA 4JTFA 4LOCA 3HQ1A 1GWJA 3TH6A 2H3DA 1XBVA 3P7YA 2QCDA 2C1HA 4UR7A 1OF8A 5F2MA 3M41A 2ZZ1A 3KOFA 1FCQA 1N7KA 4NNBA 3LCGA 3HG5A 1M6JA 1SO5A 3MW7A 4GE8A 3W86A 3WK0A 1VHNA 3B03A 1JRBA 3NQVA 3PSVA 2WSRA 4AWTA 3LDVA 2XN0A 2EF9A 3QSRA 4Z0SA 4MZ8A 1GVFA 5A8GA 1D9EA 2H3BA 3L0NA 4GUHA 4AVFA 2B7OA 3EXRA 1GYNA 2PE4A 4ADSA 3FKKA 5EBUA 1ZY9A 4WXZA 2FB3A 1SW0A 4JGDA 3YPIA 1TV8A 1YDOA 1S3HA 4GRSA 4LNYA 1GTEA 2CZDA 4MZ1A 1FBAA 4O8RA 3U2OA 1FDYA 5LKYA 4LVAA 3PM6A 2DZXA 3O8AA 4Z08A 1YDNA 3PSWA 2Q8ZA 1TPB1 2B4GA 1J5TA 1A5BA 3IV3A 4QM1A 1EA0A 2AGKA 3I7SA 2WNZA 3WK2A 4QAIA 4AAJA 5FESA 3G1VA 6TIMA 2OCZA 3N9SA 3NL2A 3LRMA 3PBVA 2XFWA 3LGEA 1VGAA 2A7PA 2A2IA 1SPQA 2KZHA 3W1XA 3NQAA 4EF9A 3BG5A 4GWEA 1T96A 2WJZA 1QPQA 2YXGA 4IPJA 3DHDA 2DP3A 3L5MA 3CIXA 1SZNA 1AK5A 1PCKA 2E5BA 1FCUA 5BW6A 3L9CA 3LOTA 4QQ3A 4UR8A 3NQEA 3W1MA 1DJQA 2C15A 3IGXA 5D2TA 3KVLA 2YDAA 3LERA 3STFA 3GDMA 2XN1A 1SU5A 2VOMA 2HMCA 4CQ8A 4UNKA 3NDOA 2WPBA 1SW3A 1N55A 4LUJA 1XBXA 4K38A 3BLFA 3HGOA 3M47A 2FPVA 3GYEA 3QM3A 1AG1O 1A5CA 2GVGA 1SO4A 5K3VA 1H7WA 4HSOA 4O15A 3P8JA 1TSIA 3FLUA 4Y6GA 5LGXA 2DZTA 4LVGA 3V1PA 1F74A 4XBKA 2YYUA 1RD5A 3MO7A 5DCDA 1XKYA 2ZA3A 3W84A 4IX0A 3M7WA 1OJXA 2Y7GA 1H7NA 5DY3A 4DO4A 1XC4A 5C54A 3DFNA 3EX2A 2OT0A 5IBXA 1F73A 2E5CA 1ZNNA 2ZZ4A 2DJXA 2BXVA 3E9AA 3LHYA 2DJLA 2CFFA 4NJIA 2TMDA 3HPZA 3R2GA 4A29A 4LRSA 3IGSA 5LSMA 2FPTA 3G1DA 3DHFA 1QOPA 2GQAA 3IIPA 4ONVA 4JYFA 3W7PA 2CW6A 3DKJA 3W1UA 1PVNA 2VFEA 3M5XA 1EEPA 4UFJA 4N9EA 2QEZA 1FWSA 3PWAA 1BTMA 4C1KA 3TMQA 4JXCA 5CZSA 1OX4B 1S5VA 1N8FA 4I7VA 1JCJA 3QC3A 5CSRA 1KFKA 4NU7A 3G1YA 1ZENA 4I9AA 2CLLA 1QDSA 1W5QA 3A5FA 2BSLA 5AN7A 4QIUA 2O7QA 3CTLA 5LNRA 1VZWA 1R30A 3HF3A 2IQTA 2NX9A 5D05A 1BEUA 1O94A 5F1UA 4FF7A 3BG9A 1O5XA 2WSQA 3B0PA 3R5EA 2A0NA 4ZQMA 3OA3A 3WJSA 1SW7A 1GOXA 1JVNA 5K9DA 5EYWA 1A50A 2V5BA 3NPXA 5AHEA 4FNQA 5CZJA 4TIMA 2ALDA 2V2DA 3QF0A 1XDLA 4OQVA 4JTUA 1SR9A 4KKXA 3UWZA 1QPRA 3UY7A 5K9XA 1K7XA 3QMRA 1R2TA 4QNWA 2C19A 3LV6A 1UJPA 1ZCOA 4W9TA 2ZRXA 4NUWA 5DCBA 3KX6A 3GXPA 3LCLA 5BNKA 3NQ8A 3TIMA 2TYSA 2CLKA 1NF7A 3P81A 2NV1A 1LDCA 4LV9A 2PURA 4GUJA 4MY1A 1EB3A 5D2VA 5KZDA 1QNVA 1TQJA 3SIZA 4MKNA 2W6RA 5HWMA 4GC4A 3LTPA 1SZFA 2P10A 5AHLA 2HS8A 1OK4A 2QUVA 2VFFA 3NQGA 2V2CA 4JY9A 5KMYA 3VE7A 5KITA 3EX4A 3H54A 4MJZA 4NJJA 2R14A 5G2HA 1YYAA 3BPWA 3CIWA 4KFOA 3TJLA 4WXYA 2ZA2A 2RKXA 3BARA 3KAOA 2PRMA 3ANYA 2V30A 1PHQA 2YGYA 2AQWA 1PE1A 5DBUA 1VS1A 1FY6A 1FCVA 5T26A 3UWQA 1H51A 1X1ZA 2GPTA 4OU1A 1CI1A 4TMCA 1KM6A 3LLFA 2VFIA 3W2MA 1LORA 2P1FA 3MI2A 4CLMA 3F1QA 3RF9A 3M16A 3MP4A 3NZRA 1IXNA 1KTNA 3ZWSA 1FCBA 4IXHA 3L0GA 3G1SA 1ZAHA 4JDYA 1H5YA 1QWGA 3I68A 3IVUA 3HPXA 3LHWA 3IIXA 4D2JA 4IMFA 4IX2A 3W1TA 5DBTA 4Z1CA 3DU0A 1IXPA 3W22A 4O0KA 1DQWA 4FNPA 1G4SA 2Z1BA 3LHUA 1TPFA 3M9YA 1WAUA 3DFQA 4U4MA 4OV9A 3S5OA 3KVKA 3UXDA 3KRUA 3C2OA 1F2JA 2A5HA 1A5SA 4AWUA 4JTEA 1OYAA 4HSNA 4WUIA 5BMXA 3GKFA 3MMTA 5FF3A 7TIMA 4IMCA 4HNUA 1QOQA 4G1KA 1GG1A 1TTPA 1VLWA 4FIQA 4N02A 4N4QA 3F4WA 3KRSA 1KTBA 3G0UA 3O16A 2I14A 3ATYA 3O1NA 4OWGA 1XL9A 2ZCGA 5D2XA 2NLIA 1EP2A 4HT3A 3ABOA 1QAPA 4O17A 3TV8A 3HGSA 1W3NA 4FHAA 1YXYA 3W7DA 1XDMA 5F2LA 1Q6OA 1MEWA 3L5LA 1VHCA 4C1LA 3DENA 4O52A 1SQ7A 4BK9A 4O4WA 4P61A 3C52A 3OEXA 1HFBA 2DZVA 3FJLA 3W71A 1IIHA 2ISVA 2WSYA 4LY8A 3LI1A 4M6PA 1MSSA 4WY0B 2NUYA 4E0CA 3HMJG 4LS0A 3NQ6A 1SFLA 1Z41A 5L6UA 4MFDA 1W8SA 3W70A 4M7TA 2WOQA 5TQLA 1F6PA 2A7NA 1ICPA 3QPZA 3WJXA 5LHEA 4RJEA 3S5NA 5EL1A 2GVLA 1IF2A 4WQ6A 2PRHA 4A2RA 1HO4A 5AHFA 1GG0A 3C56A 2Z6JA 3M6YA 2NX3A 3G8RA 4LVDA 4N6EA 4YLWA 4Z0JA 1WYIA 3NR0A 4UTTA 4EIVA 3TCEA 1VC4A 4UC5A 5F2GA 1QPOA 3NEVA 4MLJA 4JX6A 2ZA1A 3FIGA 3N34A 2Y85A 3CU2A 5CPOA 2VFDA 4IUOA 3TFCA 1B3OA 1GT8A 2GUUA 3NYZA 3PY2A 3THAA 2E6AA 4QITA 1GZGA 1TB3A 3HJZA 3SGUA 3W1PA 2DZSA 2VEIA 4JX4A 2W79A 4MY8A 4UTKA 1H1ZA 3NNTA 4FXRA 1T99A 1KLYA 3CT7A 1P1XA 4AXKA 4CNPA 1JCLA 1XBZA 2G97A 3M44A 4JTIA 2NX1A 2VFGA 3TKFA 4UTWC 1I8JA 4ADTA 1HL2A 5A5WA 2JKAA 5G4EA 3L0KA 1X8FA 2V81A 4LT9A 4WOZA 5HINA 3N73A 4MFEA 4O53A 1HUVA 1IXOA 3P84A 3SR7A 4GUIA 3W87A 2QCHA 3PUEA 1LBMA 3GK0A 3DZ1A 1OX5A 1FQ0A 1EWDA 4WY0A 2C18A 3B04A 2Z0IA 3NZ1A 2YX0A 3W2KA 4UUIA 1QR7A 4JS3A 4S2BA 3ABQA 3GDTA 4B5NA 1W1ZA 3L68A 2VEKA 1KFLA 2I1OA 5HR6A 3G18A 3FYPA 3O6DA 1ME9A 5CZ0A 3TQ0A 5HJLA 1R47A 3T40A 1OG0A 3ZFHA 3UZJA 1UB3A 4Q4KA 1KA9F 1ALDA 1OFRA 1ZAIA 1H7RA 1OFDA 2F7FA 3G1HA 4JYDA 5H2ZA 2O7SA 4E2BA 2H6RA 2V82A 2X1RA 3INPA 3L21A 1THFD 4UIOA 5KZMA 5CKSA 5HWNA 1ME7A 1RQEA 3MHFA 4U28A 3UXAA 4E2DA 3SI9A 4BR1A 4RLIA 1H7XA 1JCXA 2GQ8A 1M7PA 3MI6A 4PCFA 1DKWA 4POCA 3UZ5A 3UWVA 3W7IA 1B9BA 3BW4A 1XUUA 3VE9A 4R7JA 3B8DA 1SZGA 3QMTA 5D2WA 3NG3A 2YW4A 4LTSA 2QR6A 5LHFA 3BK0A 3A24A 5AHNA 1NSJA 3LXCA 3NQ7A 3HGRA 1LLWA 2D73A 3RLVA 2NWSA 5FI8A 3TE9A 2Y63A 1KFBA 4UTIA 1J2WA 3QH2A 4FNTA 4EWND 3NOEA 2PC4A 2QF7A 3MHUA 5BOOA 5D04C 2V2HA 4O1AA 3TW6A 4JTKA 3SGZA 5D33A 3W88A 2RDTA 1XCFA 2ZTJA 2ATMA 3W2NA 5HR7A 3QFEA 3LCHA 5AYXA 3O05A 1AL8A 2QAPA 3O6YX 2ZDRA 5C2XA 3G1AA 4HNTA 3MWAA 2C6QA 5FF4A 1KM5A 2Y61A 3W85A 2QUTA 3W7OA 1TYGA 2EHHA 3HG2A 1JQXA 3W7MA 5LNWA 4AF0A 3WK1A 4KFNA 1I2QA 4DBEA 1A53A 1ZFJA 1H63A 3HO8A 4HNNA 2VXNA 1DVJA 1H60A 4YL2A 3VI2A 5EMUA 5HWJA 8TIMA 3PBWA 3EX6A 1I2NA 5I3HA 3A23A 5K7JA 3NQCA 1GEQA 1WV2A 5BRBA 4RR4A 4NZFA 2V8ZA 5I3IA 3EWXA 2CLMA 3B0VC 1ZALA 4IQLA 2NXHA 4OGZA 2YZRA 3NAVA 2E68A 1UUOA 4PFMA 3VNDA 4ZQOA 2Z2UA 1IXQA 4CNOA 4A21A 1K02A 1RR2A 1RPXA 3GZ3A 4OE7A 2EPHA 5F4WA 5E0KA 4N9CA 2A21A 4CQ9A 1BWKA 3G22A 2I9EA 2X1UA 3JRKA 1W3TA 2UV8G 3NVTA 3A22A 4FEZA 4LC8A 1S5WA 1LP6A 3Q2DA 1K7FA 3SJ3A 4DQWA 4LRTA 3W7JA 2Q3RA 1X7FA 3AO0A 3OHIA 2CLEA 3P62A 2W0UA 4QISA 2VFHA 2ZQ0A 4LUIA 4UFIA 1JULA 1L6SA 3WK3A 3W7NA 3W7CA 2DZUA 2ZZ2A 3PBUA 1AW1A 3O06A 4BWLC 4O16A 4OBTA 3RU6A 1LCOA 5C55A 1IGSA 1KM0A 2E77A 2V5LA 2CZFA 3EX3A 2QCGA 4RZ4A 2FPYA 3MP3A 3PG9A 5G1TA 3IVTA 4RXGA 3E02A 1VLIA 1GTHA 4UTWA 2GVJA 3DGRA 2BX7A 3BW2A 4DEFA 1KV5A 3T7VA 3QRHA 2QAFA 3W73A 3E0IA 1MO0A 2WO5A 1OHLA 1UCWA 4JY8A 3S42A 1DHPA 3HB9A 3LB0A 3TC7A 5F4SA 3DI0A 1TRIA 3CEPA 4YMZA 3B0UX 3IIOA 4DPQA 5U7SA 4HKPA 1KM4A 1NAL1 1LOSA 2ZZ6A 3T44A 3TQKA 1KV8A 2RH9A 2Y7FA 3LRLA 1BWLA 2QCEA 5FF7A 4LV4A 3CQ0A 2ZRZA 3S5ZA 3W07A 1OX6A 1YTEA 1NEYA 2YR1A 5IM51 3GKAA 3G3MA 5FEZA 1P4CA 4EOUA 3GDKA 1TQXA 4MYAA 4FX6M 4ZQCA 3TU9A 4CCCA 3NQ2A 3DFSA 1TRDA 5E93A 3MJYA 1TPUA 5ABTA 1B4KA 4J9JA 2ZZ3A 5KSWA 3S1VA 1O95A 1LZOA 3LTYA 1H1YA 1T0OA 4JICA 2CLHA 3DKLA 1UASA 4DXVA 1NVMA 1FUYA 3K30A 1R2RA 4NNCA 2R94A 3HIJA 4HPXA 2DZPA 4P2VA 1YPIA 4FX7A 1YDVA 1MEHA 3BO9A 1DBTA 3NPUA 1R46A 1JCMP 4XUGA 1WBJA 1GVOA 1WX0A 3MYPA 3NM3A 4A22A 3NQDA 1SSDA 3G3DA 4K7YA 2CLOA 1YADA 1JUBA 3T55A 2E1DA 1Z42A 2FTPA 3TSMA 3GR7A 3QW4B 3P80A 3M5VA 4NQ1A 1K03A 4AHOA 3S1UA 3BLEA 1OX4A 3EKZA 3TAKA 4HHPA 3TUUA 3PC0A 5KZEA 1TPEA 3N3MA 1VYPX 3GLCA 1SUXA 1P0KA 1PIIA 4M6QA 4PODA 3ZS4A 4A3UA 5MHBA 2Q3OA 4TX9A 3W7QA 3UWWA 1SSGA 2J6XA 4UMBA 2Z6IA 4O19A 4AEOA 2ISSA 1EUNA 4HPJA 4WY0F 4XKYB 1F5ZA 2R91A 3RK8A 5D09A 1ML1A 1G6CA 5AB3A 3FFSA 4XWUA 3PS7A 4N9DA 1LOLA 3W2JA 5I3GA 3FS2A 3CWNA 4UMCA 4PEKA 3CWOX 1TMHA 3U8GA 1VH7A 2NUWA 2P0OA
chains in the Genus database with same CATH superfamily
1P5BA 2AMGA 4P8XA 4BJHA 1XQLA 1QO2A 1JEZA 1GPWA 3ABSA 3IEBA 4H8UA 3W2LA 4IFKB 1MI3A 4ZOAA 4IL2A 4GD0A 4Q7NA 2XINA 2AAMA 3TJIA 5D30A 4AIOA 4WDXA 4K8EA 5EU9A 1UKPA 2E6YA 2QUMA 1E3ZA 4RXFA 1P0DA 1EXBA 3B9OA 3CIVA 1OBAA 1R85A 3CNYA 4PCTA 2GQ9A 5EA9A 2YXOA 2VR4A 1Q2SA 1HG3A 4K39A 5F2IA 4KETA 5EB8A 3VZZA 1MXGA 2B7NA 3A4AA 4UQAA 1AMYA 3ARQA 4J2PA 5LIUX 3CLMA 4S3DA 3VCRA 4BWLA 4DAFA 1C90A 3M0MA 4YNGA 4GKTA 4V33A 5JIPA 1DL3A 1TCMA 1QBAA 4JOMA 1G7VA 1MW1A 1UP2A 3H2OA 1V7YA 3S1XA 3UYCA 4AHPA 3V36A 1QNQA 2ZFAA 3AIBA 4DZAA 1IZJA 2CWXA 4XTIA 3L4XA 4O4VA 1SO3A 5HUOA 2RHGA 4NP7A 3C2EA 3GNNA 1ZQ5A 4US5A 3NO5A 2Q8XA 4K36A 5BRQA 3P60A 4YYCA 2E9LA 2OLAA 1QCWA 1T8QA 2C13A 2CLIA 1ISYA 2QV4A 1JCNA 3QW3A 1P6BA 3PPCA 1FFRA 3STEA 3TSDA 2PGFA 3QY6A 2WHLA 3DYPA 2B7QA 1YQ2A 3BV4A 3U9IA 4NAEA 3F7JA 5F1VA 1QI4A 4F48A 4M3PA 4CCDA 4C6FA 1DYSA 1R8LA 1PTAA 4UFHA 2NQJA 3VVGA 3U2EA 4KH2A 1KTCA 1UP0A 4Z1BA 4ALDA 2XH0A 4D1IA 3TQPA 3GXIA 3LM7A 3TFXA 3UA3A 5AFDA 3IV8A 2OMAA 4YCOA 1V08A 2WC7A 1LL6A 1FWFC 3M46A 1SFJA 1VCFA 2GJNA 3WQFA 5CXPA 4MJMA 3WFAA 4IF2A 2VJXA 3L4ZA 3WJZA 3DFTA 1KFCA 4AZBA 3IIVA 5HQLA 1W9PA 2J9YA 3KRZA 2RDUA 3GXNA 1FDZA 4JNMA 1TO3A 4PUEA 3SY5A 1BG4A 1TUFA 1W31A 5HUPA 4JZ5A 2PD9A 5AYYA 4Q8OA 3LXBA 1TVLA 4WDWA 4DI9A 1GOQA 4DO5A 4XD5A 1P48A 2PWHA 2V38A 4GY1A 1B31A 2W5FA 3M1ZA 1PV8A 4Z1AA 1FWBC 3AZSA 3ZQ9A 2REQA 3VNIA 4F3HA 2E3ZA 2F2KA 2A1YA 1EOMA 4KESA 4R7WA 1E51A 1XPYA 3NGJA 3T1GA 1JFXA 2QJIA 4F0SA 3LN3A 3LNPA 1K7EA 4O12A 1V02E 5MKGB 4MIMA 5ABFB 2QF8A 2W63A 3M4HA 1UWIA 3AMCA 1V5XA 1MZHA 3CYVA 1LOQA 3LD5A 3O07A 3UCCA 1YTKA 3GC4A 5HULA 2A7RA 4FNUA 1XLAA 5G4HC 1VFMA 4Z1DA 4PB3A 5AZ0A 1G7UA 4KEVA 1TV2A 4JEQA 4QXIA 4CQCA 2I5IA 1M7JA 4BF5A 3O7UA 1H11A 4JD4A 4KMQA 5LNVA 3VFLA 1NM9A 2VELA 1FWHC 4GQGA 3WBEA 1JQVA 2D23A 3E12A 3S1WA 1R2SA 4ZMGA 3NSXA 5A69A 2WZIA 1MW3A 4UTJA 1H61A 3ZWTA 4RKAA 4XD4A 4DJDA 1VBUA 2PTZA 3RO6A 4E4PA 5GJPA 3A12A 4GIAA 4GQRA 1AH3A 2PLCA 2ACSA 2ZOXA 4IMEA 1UD5A 1SJDA 2ABAA 5FJPA 3NL5A 3AMDA 3JUGA 1DE5A 4YTSA 4EPDC 1VBHA 4TX8A 3EWCA 1L0PA 5I0DA 1J4EA 1W32A 4MPQA 4BI7A 1RQBA 4F4RA 2VGGA 9XIMA 1ZB5A 3V0TA 4GYKA 4QE4A 3E96A 1JGMA 1J10A 1D2KA 1LL4A 5TNVA 1B3YA 1FOBA 4IICA 3CPRA 5DN1A 1L6YA 2NZLA 2JKPA 1C9DA 1CB2A 6A3HA 4D6HA 1GCYA 1RZMA 3A3HA 4D6JA 1C7SA 4F8XA 4H6KA 3DG3A 4ML4A 3DHUA 3EEGA 2J7HA 3MKVA 2BB0A 2HWGA 1CGXA 2GJLA 2WZHA 5HQEA 5D9MA 5LIWX 3A4JA 3LGGA 1IHIA 1XRTA 2FHFA 5D9PA 3MC5A 2XSAA 3HZ3A 3AMGA 2XH4A 4OBSA 2PF8A 5F4XA 2YB4A 4ZL1A 3T0BA 5DY2A 2WBKA 3W75A 1XYCA 2W61A 3S9YA 3VYLA 1GGOA 2IXVA 4MDOA 3MVTA 3CV6A 2LLEA 2OSXA 2PTYA 2Y70A 1UWQA 3HPAA 4ZZ9A 3CEUA 2XM1A 4W93A 3TYZA 3HV9A 3CHCA 1KO0A 4B3KA 5C9UA 1XLIA 3CUHA 3UQNA 1I4NA 1W5PA 4HZ8A 2X40A 3FY1A 1SO6A 4UFMA 4W84A 5CC3A 4XZIA 3WLHA 4UFLA 4L6OA 1RA5A 4B9YA 2FTYA 3T8LA 3DCPA 1G4PA 4XIAA 2QV5A 1EOKA 4RX0A 1A3WA 3WF3A 2GDUA 2VOTA 3GRIA 3P74A 5AYIA 4ATDA 4DWSD 4DNMA 3MKKA 4NZ4A 4GUFA 3USBA 4IMGA 1VPXA 5FIPA 4FF5A 2R82A 2WKGA 1QFEA 4NJGA 3PF3A 2FFIA 3UD6A 4LYKA 1Q5MA 5D38A 1HW6A 4DLFA 2PZNA 4KCWA 4MAVA 4JTJA 1CZ1A 4NASA 4AZCB 4ATLA 2ZBTA 3AUOA 1UWSA 4DWSB 8XIMA 2GYIA 1F76A 4FP1A 3MSDA 1PZ1A 4MM1A 3HOJA 1KCXA 5CJ5A 1UBSA 1PS9A 1XGEA 1US3A 3GNRA 3OZYA 4C1NA 2XIOA 3BQ6A 2X16A 4EPKA 4ACZA 3WN6A 3WLJA 4MKVA 5BXRA 1GVEA 2JGYA 2DT1A 5DEZA 2NWRA 1XIBA 4TV6A 4CCEA 4KPLA 1CXEA 2FVMA 3T6CA 2QDGA 2OX1A 5H1WA 3N17A 3SCUA 4LPCA 1BXCA 1AODA 1LJYA 4WSKA 5I5RA 1I45A 4HNVA 1NU5A 5G5IA 3WQGA 3NA8A 1Z3NA 3LA4A 4LUTA 2J13A 3MYOA 2PRLA 3ES7A 4LVBA 4DF1A 3CHVA 3SJNA 1JGIA 3GC2A 4LF2A 4Q8UA 2QCFA 5E1QA 5A6MA 1R7OA 2QNEA 5M1TA 1YXDA 3H2AA 1FWEC 1U1HA 3MHGA 3QFWA 2PDQA 4FNSA 4R5EA 7REQB 5KETA 1ME8A 1ENUA 1G67A 2ZRYA 3E0VA 3VIOA 1PZ3A 1XLEA 2WM1A 5LIXX 4GOAA 1NWSA 1ZAJA 1ICSA 3WMBA 4MNMA 2ZRUA 2ZTKA 1MMFA 3VKDA 2HSAA 3ZSTA 1M5WA 2D2GA 3O63A 3KXQA 2VC6A 2XZ9A 4X63A 4CVWA 3N9KA 3IGUA 1JPDX 4E4FA 1VD6A 3KM8A 3MBDA 1ISXA 1LTDA 3LU2A 5CLWA 4ES4A 3S2MA 2ADAA 3CGTA 2JKEA 1NF0A 4I90A 2VZTA 3SSJA 4XAFA 2QPUA 2NV2A 4YTUA 3QLDA 3W6YA 5I3KA 4ICNA 5EBAA 3PVFA 3Q94A 4OBRA 3U2CA 5E0FA 1HTIA 2WANA 3D0CA 3WQEA 1E6QM 1F7BA 2O4QA 2TRSA 2DZWA 1QO5A 2PEVA 3SFKA 4XZWA 1JZ4A 4GZEA 1BVWA 3M0ZA 1JYWA 1JDCA 1EUAA 2NV9A 2IPFA 4JR5A 1XLDA 4OV4A 3M5YA 1Q2RA 1S5TA 4H9MA 2XG9A 3CUIA 3GHUA 4LCRA 3BH4A 4AB4A 1DE6A 4JNYA 1JF6A 1EF2A 3DFOA 1TTJA 1E70M 4N6FA 5GNYA 1C93A 1X1OA 4ZOBA 1DOSA 1R3WA 3LLXA 4GPNA 4RV8A 5CSUA 1E72M 3W7HA 4UOZA 1XCWA 4ZSTA 4JTGA 3UJRA 1TIWA 1O60A 5ECVA 4JQAA 5HK4A 1OGSA 4MGGA 3G0XA 4GXWA 4H9ZA 4RCXA 3WLIA 5IBXC 2R9RA 2AL1A 4FX8A 3EX1A 3RPMA 3ZR4A 2HCVA 3R43A 1ADOA 1RLCL 3H7VA 2OXNA 1JAEA 4NXKA 1MRAA 2VO5A 4NZJA 1YTDA 4MNKA 3F4NA 1ITXA 4E8DA 3DBPA 4H6EA 4MWAE 2GOUA 2ZWYA 3FDGA 2G4FA 3EB3A 4NXSA 3I7RA 3LEPA 3LPFA 3VM5A 4CEUC 4IP7A 2YL9A 3LYEA 1EJTC 4NYUA 2RGMA 4XBSA 4P8UA 2FLIA 3B8IA 5H91A 5I3DA 3DX5A 3H8AA 4XISA 1AL7A 2QULA 2WVSA 3ZSSA 3TR2A 3EB2A 1OB0A 4GBDA 4WZHA 4AH7A 3NL6A 3AIUA 3W1QA 2WQPA 2OKTA 2QJGA 1YLVA 4Z2JA 3FEMA 4AF0B 2Y5SA 2GGIA 3OBKA 1HVXA 2C1IA 1R86A 4BY3A 3KTSA 3S6OA 3BAXA 5G4WA 1V6WA 4N42A 4CKQA 3GNPA 1W3IA 1E6NA 4GNJA 2VVNA 3L2LA 3HQ1A 4OZOA 1MVYA 3E5PA 4HJFA 3TA9A 2ZZ1A 1JI1A 3K8MA 3FJNA 1N7KA 1CLKA 4CD7A 3WK0A 3B03A 1US2A 4AWTA 4S23A 2WSRA 4IIHA 2XN0A 4BQ4A 3QSRA 4Z0SA 4MZ8A 4LF1A 1D9EA 3H24A 1UQZA 1VB9A 1UR3M 2JALA 5E70A 2NQHA 4ADSA 3FKKA 5EBUA 1OT1A 3SCSA 2GZXA 1O1HA 1TV8A 1YDOA 3AZRA 1MDLA 2G4JA 1FDYA 2HDJA 5HPCA 3GQYA 3PM6A 2DZXA 4GK8A 2PTWA 3ZT6A 4RDZA 2X05A 2AGKA 2WNZA 2JIWA 3VPLA 3UEQA 4MB4A 3H6OA 2OCZA 4L6DA 1OCBA 1PTDA 1TZ9A 1D7KA 1VGAA 1VF8A 3W1XA 4EF9A 3BG5A 1RUSA 3QKEA 1QPQA 4Q7BA 4IPJA 1ISZA 3CIXA 1AK5A 1PCKA 1FCUA 3LOTA 2XSBA 3BL3A 3P0XA 1VFFA 3NQBA 3NQEA 3W1MA 1KRAC 2C15A 2VHLA 1I9CB 4I5XA 3LERA 2XN1A 1SU5A 5CPTA 2OOGA 2HMCA 3HGOA 3M47A 2FPVA 2IMRA 3N2CA 2GVGA 1GQKA 5K3VA 3TOYA 4LAMA 2GGJA 3BJFA 4PMQA 4Y6GA 5LGXA 1XYLA 2YYUA 1RD5A 3MO7A 3QGAC 5DCDA 1K9TA 4QBXA 1Y5XA 3D47A 3HA1A 4IX0A 3M7WA 3PPGA 5AY7A 5C54A 4UQ9A 2I5GA 1W1PA 1OT2A 1RY8A 1F73A 3E9AA 2W4XA 1GKPA 2HPMA 4KWOA 3R2GA 1V3MA 2A79A 4QAWA 4L65A 3G1DA 3ZR6A 1NOFA 3PZTA 3IIPA 2YB1A 4XB3A 3RCYA 3D46A 4A05A 1CECA 3ANVA 3VD9A 4K2SA 2VFEA 1EEPA 3GUGA 3IAPA 4UFJA 1QASA 1HKVA 5ABHA 3BLDA 3CZEA 1FWAC 1MDRA 1MUWA 1Q65A 5XINA 2DH3A 2WJEA 4LXFA 4NU7A 3M0XA 2FZMA 1QDSA 2BSLA 3NUKA 5AN7A 2XH2A 5D4YA 5LNRA 4RNHA 1QHPA 3WBWA 4JHMA 3VOJA 3N6QA 3BG9A 2O55A 5REQB 5IDZA 3OTRA 3GR4A 2WSQA 3UJEA 4ZQMA 3OA3A 2Z4GA 4KBXA 3KCLA 3VGHA 2GUYA 3WH5A 3AU2A 3MA8A 5HQMA 2ALDA 2Q02A 2ZIDA 4RZBA 2V2DA 3QF0A 5GQBA 2ZE3A 4L1XA 1A0CA 4JTUA 2VQTA 4C90A 2GSHA 3UY7A 2X0HA 1X38A 1G01A 4URIA 1HKWA 3KX6A 3H26A 5BNKA 3NQ8A 3TIMA 2TYSA 1NF7A 3ZLGA 4RDVA 1CYGA 2NV1A 3F4DA 3H2MA 1RP8A 2Z1XA 2PP3A 1L8NA 1EB3A 2V68A 4GX8A 3SIZA 4C7FA 5HWMA 3VD4A 3K13A 4GC4A 1SZFA 2G0WA 4Q7IA 3SFWA 3MDWA 2QUVA 4TUFA 2V2CA 4FXJA 4AZ6A 1FH9A 5KITA 2QYGA 4NJJA 2R14A 2CBIA 3BPWA 4WXYA 1CGTA 3KAOA 3ONCA 1KGWA 4QG8A 2PRMA 3ANYA 4RUBA 4IIFA 2POTA 1PE1A 1VS1A 4JN8A 4FALA 2CXGA 5T26A 4DUXA 1X96A 1H51A 4MF4A 2RAGA 1ISWA 1UOKA 5DMLA 3GU1A 3W2MA 4DZ5A 4DNHA 3MB9A 4C6PA 3CV7A 1J11A 3LHWA 2I7GA 4AZCA 3S46A 1M1BA 4D2JA 1AA1B 4DWSA 4GQQA 4H41A 3EB4A 1KBBA 4ZTXA 2Z1BA 2HNEA 1SYTA 3VTRA 1V93A 1WAUA 3DFQA 3OODA 2GK1B 3UZXA 3KVKA 2FZDA 2GFTA 2A5HA 2VZVA 1A5SA 4QE5A 4W88A 4AWUA 4XBJA 4FMVA 4WUIA 3E2VA 4TVCA 4W7VA 4IMCA 1XIDA 2ZXAA 4UTFA 3M07A 3RCNA 2AGTA 1G9HA 2VEGA 2ZCGA 1PJ9A 2NLIA 1EP2A 2FZNA 3TV8A 3OOQA 1W3NA 2EG7A 3E74A 1YXYA 1XDMA 1PTGA 2WCGA 3L5LA 3FA4A 3REQB 3DENA 1QHOA 4BK9A 1S38A 4KT2A 5E5CA 4YS1A 3OEXA 3GE7A 2Z2BA 2DZVA 4MDPA 1Q4NX 3W71A 2WSYA 3B3DA 5I78A 4M6PA 4JL2A 1MSSA 3VC5A 5CAKA 2EJAA 1DXIA 4B2DD 1DTNA 4NZCA 4E0CA 2PBOA 4F2BA 4W7WA 3NQ6A 1SFLA 3TYCA 1Z41A 2WZMA 3RITA 4JIRA 3WJXA 4HNLA 5LHEA 4RJEA 5I2UA 2GVLA 4WQ6A 3VX0A 2VURA 4Z0JA 1NFPA 3NR0A 1VC4A 1RY0A 4PUWA 5F2GA 1OC6A 4JX6A 1B3OA 1KR0A 4F66A 1XIMA 3NZPA 4MY8A 3ZR5A 1ZP4A 4JHOA 1P1XA 3CT7A 5LA1A 1GQJA 4BEQA 4CNPA 2G97A 3M44A 2VFGA 1R0MA 3GVQA 1EQPA 1IEIA 1M01A 3IJ8A 3WNNA 3AHTA 3L4VA 4WOZA 4RE3A 4REQB 1VIWA 4Q4RA 4AZGA 3CQJA 4PBEA 1HUVA 1L6GA 3SR7A 4KIEA 3KL0A 2WB5A 3W87A 1J0YA 3GK0A 1O66A 1PBGA 1AD4A 3U3HA 4A8NA 1X97A 4CN6A 1S2WA 5DT5A 4HVXA 2HJPA 2YX0A 3OYXA 4JFSA 4JS3A 5C2CA 3ABQA 4H00A 4B5NA 1IR2A 1W9UA 1KFLA 3FYPA 1MYRA 3O6DA 1ME9A 2Z25A 3T0AA 1R47A 3T40A 1MQQA 1UB3A 1EHAA 3GNXA 4QP0A 3AYVA 3G1HA 4H9TA 2HVNA 3VNMA 1UR9A 4D6IA 2H6RA 2V82A 3L21A 4EAMA 4Y9NA 5KZMA 3EOOA 1RQEA 4ACYA 2W67A 4E2DA 4RLIA 4DJFC 3ORWA 2OGJA 1XFCA 2VX4A 3WLSA 4POCA 2QVHA 3BW4A 2PMQA 3I3DA 2BVWA 3B8DA 4Z2LA 1CXFA 3QMTA 1NQ6A 1PYFA 3PZUA 1H3GA 1AH0A 1UD3A 1NSJA 3NQ7A 3HGRA 4TQTA 3VKKA 1XKJA 2YA0A 2PSNA 4MJ2A 1KFBA 1J2WA 1QNSA 1CTNA 2A3EA 3QH2A 4FNTA 2BVTA 5E09A 3NOEA 2QF7A 3MHUA 5BOOA 4QX4A 3UCQA 2BY2A 3TW6A 1EC9A 3GG0A 1VFHA 4K3ZA 1UC5A 1DJIA 3W88A 2FZBA 5HR7A 4Y9PA 1B9ZA 2QAPA 2Z1KA 3K5XA 1W3HA 2W3ZA 2Y4SA 3G1AA 3CZLA 2PDCA 3PWIA 3RJYA 3GFZA 3MY9A 5CLTA 1JF5A 3W85A 1TWIA 4H01A 3KOXA 3SUWA 1HN1A 3RN6A 1Y5WA 4AF0A 1I2QA 4DBEA 1JPMA 4ZSUA 4HNNA 2HPIA 2D3LA 5EMUA 5HWJA 4LCSA 1I2NA 4F40A 1EJUC 1GQLA 3TTOA 5I3IA 4C91A 2VCAA 3SRHA 5EGRA 4BEUA 2E68A 3ZVHB 1QI0A 2PDKA 4ZQOA 1IXQA 3T81A 4CNOA 1K02A 1QNOA 1RR2A 3GZ3A 4PUMA 1YMYA 3WG6A 3WBXA 1BGGA 3VIHA 1BWKA 4Q6JA 1HQTA 3A22A 1GZ1A 3VX1A 1LP6A 1J6PA 5A8OA 4LRTA 1ZJAA 1Q6FA 3PZNA 2Q3RA 3OHIA 2V3DA 4ZTYA 2ACQA 3AISA 2NVDA 3IJ9A 3N29A 3W7NA 3GVVA 2D3NA 2ZZ2A 4B15A 4R85A 1AW1A 3O06A 5IHSA 4QFUA 2PWEA 4CGTA 4FSAA 3H23A 2PWGA 3AHYA 1EA9C 1J18A 5JH1A 3T9PA 4M51A 2QCGA 4J28A 5HNUA 2J7CA 4F2TA 1CLVA 3PG9A 3AXHA 3BCJA 3W02A 3E02A 1P0EA 3AJ7A 1UA7A 4FLQA 2GVJA 3BC9A 3U7VA 1BVZA 1FHVA 3CZJA 5BXPA 1U22A 2QAFA 3W73A 4JL1A 3E0IA 1V79A 3PZ9A 3LB0A 5F4SA 3TTYA 5JH2A 2QXWA 1B2YA 4RDWA 1QOXA 1NAL1 1LOSA 1RLDA 4J3VA 3TQKA 1BYBA 2DVTA 2Y7FA 3L12A 1BWLA 1J0IA 2QCEA 3VGDA 3DBNA 3CQ0A 4LV4A 5AKQA 1TELA 1G1YA 3W07A 3O3RA 2XZ7A 5IM51 4I8YA 4KEMA 1P4CA 4MYAA 2NT0A 3NQ2A 4LUYA 4PTWA 2PU1A 2YA2A 1O5QA 1B4KA 1RCOB 4B3LA 3Q4DA 2WWDA 1LZOA 3LTYA 1VKFA 1HJQA 2F61A 3DKLA 3O6AA 1EGZA 2CEQA 1FUYA 3K30A 4NNCA 2WMIB 3A64A 1ZBKA 1MUCA 4FX7A 3TZFA 4WKAA 2XVNA 3NPUA 1BQCA 2PGRA 5EMJA 4ASTA 3EDJA 4U5IA 1WX0A 4GNVA 6PTDA 2VRQA 2ODOA 3NM3A 3NQDA 5C70A 1EF3A 2CLOA 2E1DA 2R1PA 4ZB2A 4JPGA 3QW4B 1UR4A 3LSBA 3BOXA 2PDXA 2P76A 3EKZA 3KDOA 3PUGA 3TUUA 1TPEA 2JQXA 3GLCA 3THCA 1PIIA 1ONXA 2BBFA 4M6QA 4PODA 1PEZA 4QDWA 4PCNA 2DVUA 2J6XA 1DJHA 2G3MA 1IEVA 4DJED 1M7XA 1QUMA 1PDZA 2ISSA 1UMYA 1F5ZA 2R91A 4GVGA 4PMUA 4W7UA 4LFYA 3STPA 1DIEA 3SM0A 3LPGA 3T4WA 3W2JA 4PEKA 5DT7A 3BANA 2P3EA 2NUWA 3QYSA 2P0OA 2ESCA 2WBGA 3RX3A 1XC6A 1W5OA 2J79A 2Y88A 1VPYA 2J62A 1U30A 1QWKA 2J7FA 3BMXA 4PZVA 2JF6A 2E25A 3I6RA 1X1NA 4G9PA 4E2VA 4JCMA 3LHTA 3HQOA 4O13A 2EBNA 3AHZA 3PK7A 3UJ2A 2C14A 2WKJA 3GVWA 3B9NA 2KAUC 2DFAA 3TZNA 3H21A 3STGA 2H9AA 5CSSA 4O54A 1W9XA 1KLZA 3ABRA 2QLYA 5CZKA 4MUPA 2D0HA 4DY1A 1XM3A 4KWSA 3VOHA 3VDHA 4D6DA 1KBIA 4GGBA 1OFBA 1M7OA 4G2DA 5A8QA 3DH7A 3L4WA 4B5VA 1XBYA 3OB8A 3R7MA 4GUGA 4DPPA 2DUZA 1TKKA 3LI0A 2FJKA 5AYZA 1OFPA 2PP0A 2CKRA 4FK9A 4LCQA 1EJSC 2OELA 1E0XA 3DUGA 2E09A 3C61A 5HMFA 3U0HA 4AHQA 3LLDA 4X9SA 1ZLPA 4ZEPA 3WMSA 1R38A 1OM0A 2NSOA 2NUXA 5DLCA 1R3SA 2GK1A 4NX0A 1IEQA 3WUFA 2J7BA 1NDYA 3TW7A 1H62A 1J8VA 4ZE4A 3KZPA 3K8KA 4PGLA 3SUUA 5I23A 2BTMA 2QMJA 4N4PA 4MADA 3AMKA 4IXXA 5JBFA 4A6GA 3IANA 4RZ5A 4R9XA 1J01A 4WJXA 4PMOA 1FVPA 3NSNA 5CSYA 1K3UA 1EBHA 5EMMA 2F8QA 4B5SA 1CBGA 4RZ6A 3IUIA 5CBJA 5G2WA 1ZJIA 3GWQA 1TWSA 3UF9A 4DX3A 3APTA 3LENA 5A95A 3UPWA 4WDUA 3REQA 1WUEA 1JXJA 2FTWA 4JIQA 3TA6A 2EG6A 5CJNA 1YXCA 1C8VA 3XINA 4W5ZA 4YHGA 5ABEA 1JNEA 4HK7A 2ZXBA 2QCCA 1KB3A 3RMJA 7ENLA 2FVLA 1V0MA 4O1CA 2GJXA 3WQDA 3RGTA 2WHJA 1B3ZA 2OYMA 1L9WA 4ECLA 3N2BA 2JF7A 4IGSA 4QCFA 1L8PA 1W56A 1Q3NA 3AZTA 4ZENA 3IJ6A 3NM1A 2ZZ5A 4XVDA 5B80A 2CZ5A 4MB1A 3KOYA 4M19A 2ZRWA 4L61A 2AAAA 3GM8A 4Y8FA 6ALDA 4J3WA 4KWWA 4UWMA 4P7RA 3TYBA 4IJCA 1B30A 4M7SA 3CO8A 4J3SA 3AIRA 1UR1A 1PAMA 5FF0A 4KCVA 3QZEA 4QLJA 2CHRA 1NP0A 1XCXA 1D7FA 3R6IA 4R33A 4D8LA 1QT1A 4LVFA 4EKJA 4J3XA 4Q22A 3U57A 1ITQA 4WLCA 2OQYA 1TX0A 2UY5A 1EIXA 2MANA 4K8HA 2WVTA 2D2OA 3AIVA 4H4IA 3OLIA 4F0HA 2DT3A 3JW7A 1DWJM 2QCNA 3PNZA 2AQOA 3OHMB 4PULA 1F8IA 3EWZA 1K8XA 3QR3A 1K9FA 2AKMA 5AC5A 5A8MA 3AAMA 2FIQA 4LS1A 4R3UA 4YVPA 1JRCA 3I7QA 1TV7A 3PJUA 4AMCA 4B91A 4NF7A 3E49A 4TMBA 3H55A 3AWOA 3EWBX 3MI3A 4PFHA 3KDNA 4IOTA 4WGHA 1JJKA 3AFBA 3WQOA 2EXOA 3WH7A 1ICQA 2B7PA 2BGSA 3ABZA 4NSBA 3T2PA 1V77A 5IDIA 3PB0A 4CNTA 3DERA 1REQB 3TJXA 4Y96A 1WOAA 3T2OA 3W26A 3QQ1A 3PUDA 3A4XA 3L2IA 4LH8A 1DHKA 3P5ZA 2EQDA 2IW0A 2RFGA 2XIIA 3LY0A 5AC7A 3IVSA 4TTGA 3VDBA 2GSJA 3VDCA 4CQBA 3GH7A 1FKWA 2PGWA 3QQ0A 4OHQA 4Z2HA 1K77A 4UB9A 1MXDA 1FX6A 3LCXA 1FDJA 4CNUA 3VINA 3ELFA 4M82A 1F3TA 2VM8A 5CPNA 1VRDA 2RJGA 3WD3A 4O11A 1EH9A 4DWSC 1EX1A 2A4AA 4MOZA 3UG3A 1DV7A 5CGQA 1YNYA 4ROQA 2HK1A 3TXVA 3WL1A 1HL9A 1RQHA 3RO8A 2FB2A 3OVQA 4DYKA 4F0RA 4L1GA 4XV0A 3SZ8A 2DQXA 4YVXA 1J12A 1XGDA 4HHHA 2OT1A 2FZ9A 3GXDA 3TTSA 5D02A 2OGYA 2A3BA 2HE8A 3PPHA 1OG6A 2UY3A 4PH6A 4DELA 3TXZA 3WUBA 3UPBA 2QKFA 1TIMA 2QDHA 2VRKA 3W7RA 1EP1A 1W91A 1KCKA 5A6SA 4OTKA 1NDWA 4L1WA 1DJNA 3BV7A 3OVRA 4LW7A 1OF6A 2RDXA 1ECEA 3AUJA 4PCPA 2C0HA 3SRKA 4EF8A 2OODA 1LM1A 3GAKA 1LT8A 4B90A 2YZ5A 4HN4A 4CCZA 4DBSA 3ZVHA 2V63A 1YRRA 1UZHA 4YWSA 4HU3A 4ZQPA 4YVVA 4UTHA 4EVZA 2HTMA 2F84A 3WQ6A 3HG4A 4P7OA 3NZGA 1GHSA 2ZXDA 3MSYA 2A6LA 4A8LA 2EKCA 1KBJA 4GVHA 1V7AA 3ZLFA 1SJCA 3M43A 3TNOA 1EPVA 3CHFA 4HIBA 1PDYA 1HP4A 1VCGA 4ZFMA 3KHJA 2WV8A 2CWNA 2Y89A 4MWAD 3IUHA 1A49A 4MLRA 2X1SA 1OCJA 1Q85A 1W54A 4KS0A 5AC8A 1SZEA 2ISWA 3W7LA 3WIJA 1R9YA 5CGTA 5L9FA 2QCLA 3GB6A 4IQEA 4BI5A 1FHUA 1I2PA 2CIPA 1EDGA 1WPCA 3MPGA 4AZ7A 1O1ZA 4MWAB 3CL7A 4GJ1A 4PMYA 3CV2A 4ADUA 3KCJA 3QY8A 4NNAA 3P67A 2CHNA 4Q4PA 3H12A 3AIWA 1EX5A 4ATWA 3WFLA 3GFYA 3TYEA 2DIJA 1AJ0A 4ZB5A 3TC6A 4CNNA 1OABA 2CLFA 2PA6A 2GSEA 1YDYA 5CPMA 4CD4A 4HU0A 1V3IA 1DJYA 3NO3A 2TAAA 5BU6A 3QY7A 4QJ1A 3BAWA 3WLRA 3WF0A 1PSCA 4B92A 3UVAA 3FSTA 6CGTA 4HOXA 3W38A 1H7OA 2DEPA 5EKYA 1E4MM 3RLHA 5BMWA 1W1IE 3CB8A 3KWSA 3WLMA 2XN2A 4OOZA 1XF0A 3LX9A 3C6CA 4EXQA 4IT1A 2DSVA 3VNLA 1WO2A 3U5YA 2G3FA 4B3ZA 2ZVRA 4UCGA 2R1KA 4UXDA 1U83A 3LCIA 2C3ZA 4HA4A 2PZ0A 3TP4A 4A3RA 3NTYA 4R53A 5M2FX 4JX5A 4ORIA 3QVQA 3ID7A 1PL9A 3SUSA 1LUCB 4A35A 5BXTA 4ZOCA 1LRNA 2WNWA 2YLAA 3W1RA 2R1LA 2YBVA 4FB7A 4HBKA 4E6MA 3C8FA 4PL2A 3GVRA 1Q45A 4RE2A 4JFUA 3SAZA 4IL0A 3W00A 2YL6A 1V02A 1DQXA 1TZ7A 2CXEA 1C3FA 1GW1A 2Z00A 2FFCA 4OKDA 3EAUA 4G7FA 4QEHA 4PSRA 1XLCA 4IGNA 4BA0A 1ZJBA 4R27A 3UW6A 3ZVIA 3ZT7A 1TFVA 3AS2A 5FEWA 3N2MA 1EIBA 4ZXLA 2D2JA 3WNLA 3ARTA 4XZLX 1DWGM 1NDVA 2YLLA 2PCEA 2WCAA 3OG3A 3T4CA 1M9HA 4DJEA 4MNJA 1WDRA 4GMEA 3BG3A 3BMVA 3QPEA 1TG7A 2A3AA 4NZ5A 3F4CA 3QQWA 4PMNA 3RNDA 2V6AA 3VOIA 4LAZA 4NI8A 4MZYA 4V1YA 3WD1A 3NJ3A 3WLLA 5A6BD 1WKFA 1O4UA 3EMCA 1UUQA 1ITCA 3QPYA 1M3UA 1OZQA 1WZMA 1FWNA 3ATZA 3CM4A 3S6TA 4LWWA 1S5NA 3VAVA 3VUSA 5KTLA 1VFTA 2CBVA 3TVAA 5AC6A 1H7PA 2E67A 3APYA 3H4XA 2XGZA 4G6CA 3K8LA 1Q4WA 1GVSA 1RALA 3ITCA 4AD4A 2DPEA 3W28A 2X0YA 1Z44A 1LL7A 2IKGA 1OQFA 5G1YA 4NI3A 3BQ5A 3LTSA 3JR2A 3PULA 3B05A 3LBCA 3LBMA 3UWYA 1O5KA 2OZ0A 3U7BA 3QYQA 1K8YA 2DW6A 3RX2A 5EMLA 1PIGA 4I9TA 4EX4A 3QMSA 3QXBA 4GYFA 1JZ7A 1A5KC 2YBUA 3WLPA 1H41A 1KR1A 5AZ1A 3N4EA 3UR7A 2FDMA 3ECQA 4AIUA 4GFSA 4LYQA 1GOMA 2JGQA 3BZGA 1PPIA 5FD0A 2A3CA 4WJ8A 5HMDA 1LRTA 4DF2A 5T9BG 1DIKA 2XIJA 2QZRA 3TONA 3DDMA 4X22A 3THQA 4U3CA 2C71A 2FHBA 4FIRA 5E9AA 2Q09A 2X1TA 3PFRA 4MYXA 1AW2A 4GH3A 4QEEA 2PFHA 3PNUA 1XRVA 4W87A 2ZX8A 1XBVA 2GGEA 3MV11 1BLIA 2OFJA 3W81A 3M41A 3KOFA 3BUVA 1L2QA 1FCQA 3MUY1 3ARZA 4NNBA 3HG5A 4GVIA 1M6JA 3W86A 3RX4A 4CD8A 2IPWA 2PF0A 3NQVA 3CWHA 3WD2A 2PTDA 1JXKA 2VZUA 3ARWA 4L80A 3N04A 5BWAA 4Z1YA 1AUSL 1NTHA 3ZOAA 4WDTA 4JHZA 5A8GA 6REQB 2H3BA 2YL5A 3T07A 4AVFA 4AZHA 1CGYA 1QXLA 1ZY9A 1W2VA 4JGDA 2Z7GA 2OG9A 1S3HA 3BCFA 4LNYA 4O8RA 2CZDA 1FBAA 5I07A 3OA5A 3O8AA 1YPXA 4Z08A 1YDNA 3VD7A 2Q8ZA 2B4GA 3ME3A 1LQAA 3I7SA 1C8QA 2XWEA 1UKTA 3IGHX 2HK0A 4QAIA 5FESA 3N9SA 1JL8A 1I75A 4TXEA 3VABA 5HXMA 3PBMA 1UQYA 2PP1A 3IK2A 1S2CA 4P5UA 1T96A 2WJZA 3ITTA 3B8UA 5HATA 3L5MA 3IJDA 2E5BA 1JAKA 1HKJA 1DQUA 4J3UA 1HVQA 3T0DA 1XLGA 1DJQA 2VVSA 2DSUA 2V3EA 4H6QA 3KVLA 4CQ8A 3EDDA 1DWHM 1N55A 4LUJA 1JD7A 2X0SA 4K38A 3AS0A 1WB0A 1FWJC 3QM3A 4Q4OA 3GTHA 4LAUA 4AC1X 2JE8A 1SO4A 1F3WA 4HSOA 5CPSA 3P8JA 5A6LA 1TSIA 2BMBA 3V1PA 1N8IA 4H9XA 2OQHA 3UYIA 1H7NA 1XIHA 1QNRA 4XZMX 1KGUA 1T7LA 3VIIA 4MTVA 4QLKA 1Q13A 1AQ0A 2OT0A 3EOEA 5IBXA 2E5CA 5C9XA 3THDA 1JD9A 3RRXA 2BOFX 1YW1A 2C1GA 4Y9OA 3HPZA 4C6DA 4A29A 4XAPA 5IOBA 2VD9A 4HK5A 2GQAA 3PANA 2AL2A 3C2YA 3DKJA 3W1UA 3UESA 1UWRA 4H04A 3M5XA 3WLQA 1LT7A 3PZVA 2QEZA 4C5YA 3E38A 3GIQA 3XISA 1WZAA 3PWAA 4JXCA 3AIEA 3QR0A 4KCUA 5LA0A 4GX9A 3PHAA 3LMYA 1N8FA 3SEPA 3BLPX 4Z2IA 1JCJA 3QKZA 3G6MA 4QDMA 1W5QA 3FYYA 3K2GA 1TUXA 3S2CA 3C86A 2O7QA 5ABGA 1VZWA 1R30A 3HF3A 3PZIA 4H8NA 3OGRA 5F1UA 3B0PA 3R5EA 3SY1A 1UC4A 3WJSA 3F4VA 1H0IA 1GOXA 3VZYA 5EYWA 1X39A 3W82A 2V5BA 4FNQA 5CZJA 1UZ1A 4TIMA 3ES8A 1XDLA 4OQVA 1SR9A 4J27A 1QPRA 3E2QA 3NSMA 2E0PA 2XFRA 1UW9A 3RR4A 2D20A 4NUWA 4H7ZA 1CT5A 3LCLA 1HF6A 3N2TA 1EGMA 4HPGA 2IQ0A 1LDCA 2PURA 4GUJA 4MY1A 3HM7A 3T05A 5FCZA 5D8ZA 1TQJA 3H2CA 2P10A 2X09A 4EANA 6XIAA 5CCZA 1OK4A 3HFYA 5KMYA 3VIFA 2XVKA 1WP6A 1JZ8A 3CIWA 3EA3A 2RKXA 3BARA 4FLSA 4AC7C 2V30A 4XAGA 2WAGA 4GCAA 4GG9A 2YGYA 1C7TA 3URAA 1FY6A 3UWQA 3A3XA 1NWUA 4IPLA 3L7RA 4DUWA 3VNYA 3TOPA 1LORA 2P1FA 3U48A 3KOZA 2WXDM 1QW9A 4HZ6A 1XYMA 3ZWSA 2YCLB 4IXHA 3L0GA 8XIAA 1OEPA 4JQ2A 4JDYA 3SN4A 1MNSA 3GW3A 4J2MA 3IVUA 5GNXA 3RCMA 3IIXA 4IMFA 2VGFA 4IX2A 4CU7A 5FAJA 3UZWA 1VFLA 1V03A 4MWAA 2R1MA 2W27A 4FNPA 3M9YA 3OBEA 3UXLA 4OV9A 3S5OA 3WQVA 2ON3A 3BDKA 3CUGA 1OYAA 4HSNA 3EGJA 4H19A 4ERGA 1GUVA 3CQKA 4GINA 3OG2A 1DWAM 5BYWA 1TTPA 4N02A 4GQ0A 1KTBA 3G0UA 2GJPA 3ITYA 1XL9A 2PODA 5D2XA 1IR1A 1BYAA 2PLMA 1EJ7L 4FHAA 1HKMA 3ZLHA 2OYKA 1Q6OA 3S5SA 2J4GA 2W91A 3WUGA 5DMYA 4S3BA 1AD1A 5LXXA 2ZUUA 4O52A 4H1ZA 1EZWA 4OFCA 1EEXA 1X6NA 2DDXA 3FJLA 1PZ0A 4TV5A 5HDRA 1FHDA 4LJ3A 4Z42C 4INFA 4HTYA 5FL1A 2NUYA 2EPKX 4LS0A 2WOQA 2J47A 2VX6A 1F6PA 2A7NA 2XGIA 3IARA 4UZUA 1T40A 4GO8A 1HO4A 5AHFA 2YJQA 4DZHA 4N6EA 3SBFA 1HJVA 4NZ3A 4UTTA 4PTVA 1GONA 2Y85A 4WKHA 1JDAA 1RBOB 1GT8A 4IP4A 2ZICA 4MKSA 3NYZA 3THAA 2E6AA 1T5AA 3FVMA 8RUCA 2VEIA 2W79A 4B5TA 2VDHA 4UTKA 3SB0A 2BP1A 1T99A 1KLYA 3CJPA 1JCLA 1QHZA 1W6TA 2C79A 1U1UA 2NX1A 5HBFA 1YBQA 1XH2A 5DRIA 3P93A 4ADTA 1DPMA 3DESA 4S3AA 3L0KA 3BSMA 1H49A 2V81A 1VPQA 5HANA 2VR5A 4O53A 1Q63A 4AVNA 2P50A 1V6VA 3PUEA 3P3BA 3S2NA 3DZ1A 1OX5A 5CQ1A 4WY0A 4LBUA 3NZ1A 2PLKA 1R9XA 3W2KA 1QR7A 4JTCA 4EPBC 4RV3A 2NLYA 3CASA 3U5UA 3VXGA 2XGBA 4WSJA 3RU8X 4G1NA 2VEKA 2O4MA 2I1OA 5HR6A 3G18A 4PEEA 3FK4A 1OG0A 4L9XA 3ZFHA 1V0LA 4UQDA 1ALDA 1OFRA 1ZAIA 2J7EA 3GDBA 1OFDA 2F7FA 4W86A 3QLLA 4Z2KA 2O7SA 3N6HA 4WSHA 3UGRA 2X1RA 3SIMA 4UIOA 5HWNA 2NQLA 1ME7A 4U28A 3UXAA 1HZYA 3SI9A 4BR1A 1H7XA 1ADDA 3JVAA 2GQ8A 3MUCA 3ZXWA 1DKWA 1B9BA 4ZO9A 3VE9A 1HGYA 4IIGA 1M03A 5A6BA 1E3XA 1SZGA 3PN8A 3NG3A 3VD5A 2Y5EA 2NVAA 4V15A 2Y8KA 1DWIM 4ZFCA 3UXKA 1GOOA 3PFMA 5I7GA 2NWSA 3TE9A 2Y63A 4UTIA 1D3CA 4EWND 1WAWA 1J9YA 5D33A 5DFAA 3I10A 3U4AA 3W2NA 1J93A 2FGLA 3LCHA 5AYXA 3O05A 4Q8MA 3VUPA 4HNTA 1JZ6A 3DG7A 1M68A 3QV7A 3NYDA 2Y61A 1WDSA 3EPMA 3MV01 2GUBA 4GZIA 1JQXA 5LNWA 5DO8A 3WK1A 4KFNA 2XFFA 1A53A 1ZFJA 3HO8A 4RL3A 1DVJA 1H60A 3JU2A 3G1RA 3L23A 4J1OA 5BRBA 4RR4A 4AZ5A 2IQDA 1C91A 1OIFA 3S9ZA 1ZALA 3G77A 4IQLA 1XQKA 4OGZA 3OZMA 3VNDA 3TEVA 3CUFA 3WH9A 3EYPA 4A21A 3TYDA 1GKRA 1RPXA 4OJYA 2BV9A 3FAXA 3KEHA 3V35A 2YCKX 1W3TA 4C6EA 4JQ4A 1Z9AA 3NVTA 4DUOA 1S5WA 2WVVB 1K7FA 4DQWA 1E0TA 2E4TA 2PLJA 6REQA 3K4WA 3AO0A 2CLEA 3P62A 5CH9A 4I5RA 2ZQ0A 2AQVA 2JEQA 4JNZA 3E0LA 1TA3B 4A3HA 4O16A 4ZA0A 5C55A 3PTKA 4PB5A 2V5LA 5J04A 4B5UA 3EX3A 1KBKA 4DN1A 4RZ4A 2FPYA 3MP3A 4F2UA 2QJMA 3IVTA 4RXGA 1ZP3A 1DJWA 1QK2A 5FOOA 3AQUA 4XO7A 3BW2A 4B4HA 2HRWA 1KV5A 1GORA 1MO0A 1UCWA 3BOLA 3S42A 1DHPA 3AYRA 4AD5A 3FVDA 3KOWA 2HE5A 1TRIA 3DI0A 5BOEA 3B0UX 3FGCB 3DOPA 3OGSA 4DJEC 5U7SA 2QMKA 4DRSA 1V51A 5CC6A 4D1JA 3BSHA 5PTDA 2VTFA 2Y0FA 1KV8A 4ICCX 4P8WA 2XTKA 4C6NA 1B54A 1NEYA 3G3MA 1VJZA 3GDKA 1V6TA 4FX6M 3TU9A 4IIBA 1RCQA 1FH8A 1TRDA 1TPUA 3WY1A 4J9JA 2ZZ3A 5KSWA 2E9MA 4S3EA 2YBTA 4DJFA 3UP8A 3UGVA 4JICA 4H2HA 3CZKA 4TOQA 3APGA 2ZXQA 4S39A 3HIJA 2WK2A 3HFTA 3KBNA 2GL5A 2VT0A 1YDVA 4I5UA 3BO9A 1DBTA 2GVEA 1I60A 1R46A 1S2VA 1JCMP 1GEHA 1GHRA 5LIYX 3VKCA 1E6PA 4IJRA 3SCOA 3WNOA 3WEOA 4L6HA 2WW5A 3MYPA 5JMUA 4C65A 1UHVA 1JUBA 3E0WA 1CGWA 3KLLA 3M5VA 1UKOA 1U1JA 4PN2A 3S1UA 3TAKA 4HHPA 3PC0A 4EXAA 5KZEA 3N3MA 1VYPX 1CB7B 1P0KA 2VQUA 4QQUA 4QJ4B 2FHCA 2HVMA 3GTXA 1RK6A 4US5D 3KE0A 4TX9A 3W7QA 2HZGA 1HNYA 3MUZ1 1SMAA 2Z6IA 3W4RA 4DZIA 3VCCA 1HGWA 4WY0F 4DM2A 5C8BB 4XO6A 3DIPA 2FVKA 3A3WA 3WYZA 5ECUA 1TJ0A 4HK6A 3PS7A 3DFYA 1LOLA 4GXPA 1JDFA 1Z7AA 2OEMA 3VOFA 1UKSA 1G94A 3WF4A 4C6OA 5G1MA 3W24A 4MPKA 3L4UA 4MB3A 5CPLA 1CENA 4OT7A 4M5PA 4W89A 3KTXA 3GSMA 2W66A 2FDSA 1OVDA 2DV0A 1JUEA 4PTNA 4Y9AA 2ZC8A 3UG8A 2J24A 4IG2B 1R3VA 3P0WA 3PTMA 3TAOA 1E71M 4JFWA 4KRZA 2VX5A 1Y65A 1IQ8A 1X8CA 2XYLA 4I7UA 4NAFA 2BS9A 3MDUA 1VYRA 3EPOA 5M17A 3P61A 4GI4A 4KFPA 3PR2A 1R6WA 1OCQA 2XJ7A 5TAOA 3R12A 5A6JA 4M1BA 1OGGA 4AU0A 1VJIA 3ZO9A 4EE9A 4RW3A 1XXXA 4X3ZA 1Q7MA 1S46A 1FHLA 4PMZA 5I02A 5AOUA 2YCLA 1B57A 1MW2A 1FRBA 5FA5A 3SW6A 1XYFA 2PBGA 2ONEA 3B0XA 4A2SA 3WENA 2HXTA 1S2UA 2E7FA 1SJAA 3MQTA 1B5TA 5A3HA 1TCDA 3KL3A 2FGBA 2ANUA 3V7PA 1OYCA 4LAOA 2V69A 2HV5A 4E3VA 1K6AA 4KW2A 5U4NA 4IFKA 2EGZA 3KVMA 5J5RA 2BNJA 3HG3A 3UJFA 3LXAA 3UWUA 1TWDA 4NIRA 3U6WA 1CLXA 1X7IA 1V6UA 1FWDC 4ZQRA 3L5AA 3P14A 1ZSXA 1EL3A 3S6DA 3LS9A 2A3LA 1S5MA 2OQLA 3QSTA 2YCJA 4N9BA 4QR6A 5LIKX 1LYXA 2BY0A 3IJLA 2VCBA 1QPKA 1DJXA 2R1NA 1OC5A 4DJDD 1UR2A 5A94A 1LWJA 1X6UA 3ANUA 2QCDB 3N11A 1PZ2A 1GVRA 2G5WA 2YW3A 5TIMA 4BS0A 5IFPA 2WM0A 4OOUA 1MRQA 6TAAA 4FR1A 1UG6A 3EA1A 3VGFA 1I1WA 3FOKA 5I06A 1RA0A 3ITXA 2BY1A 4K1WA 1B3WA 3FW6A 2J25A 3HTWA 1RSCA 1Y7VA 3LQGA 3N1AA 2FKPA 2Z1WA 1PIFA 1NH6A 2UY4A 3KP0A 1YEYA 2CKSA 2D0GA 1WOBA 1TR1A 2PAJA 2VP8A 2E28A 3LPPA 2VEMA 3I3BA 3UR5A 2VC7A 3D3AA 2I17A 3MSGA 1G0CA 1FWCC 1W9VA 4RK8A 4WEVX 4AQLA 3V4BA 4AX6A 3NURA 4DBWA 5TF0A 2Z1VA 4N0RA 2V5JA 4LEFA 4YWIA 2PDJA 2EPMX 4WOQA 3KVJA 4I7WA 1VFUA 4GH1A 5I09A 3C2RA 3LRKA 1E43A 3WJYA 1ODZA 1V6XA 3QEZA 3FHQA 2PC8A 1RJRA 3VOCA 2P3ZA 5LNUA 1BGAA 5FSDC 2WNQA 3WBAA 1NWTA 4J4KA 1UYQA 1Z48A 4UTMA 3N2XA 3IIZA 3T78A 3KS6A 3ZJ7A 1QRQA 1Q66A 2DSKA 1U5JA 3EDKA 4ZE5A 3GHSA 1IZCA 1E5JA 3H22A 1WDQA 2PWUA 1C9WA 1VEOA 3CMFA 3NL3A 1EBGA 1PKLA 4K6AA 3EXTA 4XK2A 1YKWA 4HPNA 1P0NA 1SM9A 4FXSA 3W72A 4X2RA 5MKGA 5ABFA 3RYSA 5BZAA 2GDVA 1LROA 1P6CA 2PDIA 3GYCA 2QDDA 1A5AA 3MSRA 4DBDA 1I0DA 4TVUA 2Z7KA 2VEPA 4GABA 4GXMA 4AYSA 1R3YA 2WJDA 4O18A 1VYSX 4GFIA 2QPSA 2VNCA 3UVIA 3V75A 2YDSA 1G5AA 2R6OA 5LZLA 3EEZA 4MWAC 4UMAA 2D24A 4FO4A 4C6KA 1S1PA 2V5DA 4S38A 4AZIA 1KM3A 3L4YA 2Y6ZA 4QJ5B 1EWEA 5JBEA 1FXPA 5TBOA 2X7WA 3F03K 3KBVA 4RNFA 1BD0A 2X30A 1TV5A 3B4UA 1XG4A 2Q8LA 1E1FA 2XVPA 2BY3A 1TJ1A 4UTLA 1H4PA 9CGTA 2Y7DA 7XIMA 3LCWA 2XDFA 1QMLA 3I65A 4PL1A 4S3GA 4V28A 3W7KA 2FGZA 3WLTA 3PAOA 3UFYA 3OO2A 4S2CA 5CG0A 1O6IA 2P88A 4IJBA 3O6CA 5K4ZA 4W8AA 1LBFA 3HGJA 4R34A 1OK6A 4UNLA 4C7GA 3KHDA 4IPPA 1ECQA 1JI2A 2NXGA 4PSPA 3CAWA 5FKYA 2G41A 2J27A 3SECA 2FZ8A 4UR9A 1GZJA 1F9CA 1SVDA 3STCA 4ACZB 2VRJA 5C9RA 2OU4A 1OSEA 2Z28A 4H7CA 2OWWA 4LGXA 5C2GA 3FJ4A 3UY8A 3ZJ6A 1QW7A 1EC8A 2JIEA 4O0ZA 1TPDA 3E3HA 4IIEA 1E6ZA 1N2VA 1OFAA 1WZKA 4XQ6A 2WVVA 4HYRA 1XHGA 4JTSA 4E4UA 4Q4MA 1CNVA 1BFNA 3OVPA 1AH4A 4UTTC 1FP9A 2PWVA 2QS8A 5H6HA 4I3GA 3S2LA 1ZBVA 1TA3A 4P7LA 1VR6A 4D8AA 1XLBA 3N19B 2WMFA 4CQDA 4BQ5A 4R9OA 1RVKA 2JK2A 1K4HA 1WUFA 5CZTA 1Z8AA 4GHRA 1Q6RA 5FJOA 5H8MA 2IS7A 3KUMA 2H8ZA 3L65A 1H09A 4UOJA 2FYMA 3S5YA 3CPUA 1FH7A 3GC5A 1PCWA 4BKNA 3VGBA 1HJUA 4NX5A 1L6WA 3BJTA 2WMGA 4K7VA 3DAQA 1WA3A 2O56A 3PAJA 4AWSA 2GGGA 4GQBA 4HMDA 4LX4A 1E9YB 1UR0A 2C16A 1J0HA 2O92A 1KBLA 4PTMA 3EA2A 2J88A 1I2OA 4JIEA 1UA3A 1ONRA 2H8XA 2X2GA 3ENLA 4C6IA 1DJZA 2CHOA 1BKSA 3MJMA 3WDJA 3BE7A 2X2YA 1KWKA 2YFOA 2PDLA 4UOQA 4KWVA 2DSZA 4K68A 2CU0A 3TLLA 3CH9A 4S3FA 3TK7A 4E2OA 2XISA 4ZO7A 3GHTA 4CQAA 3LHZA 3ZJ8A 1SZRA 3G0SA 2NW0A 3POHA 3SURA 3VNJA 2YPIA 1FXQA 3WDHA 1QK0A 3OU8A 1CCWB 1AZ2A 5EMKA 2ZWZA 1XWYA 3AJXA 5CGMA 4KEZA 1E4NA 1LBLA 1VBJA 3NFUA 1FWTA 4G5DA 3FJ6A 4WX2A 1XI3A 5DCEA 2YFNA 1GYLA 5HAOA 4C6MA 1LLZA 4F79A 3V3WA 2EG8A 3AXXA 4WRHA 4QS5A 4CN1A 3CLWA 1TREA 2ZX5A 5I03A 3C5QA 3HPSA 4KWUA 4HTBA 2WMHA 4D6CA 1A5LC 1RV8A 4MB5A 5GVJA 3QV6A 1CXHA 2FQIA 4EP8C 4ZQNA 4ZVJA 2YIHA 3DC8A 3TC3A 7CGTA 2JEPA 4ZGYA 4IPNB 2V9DA 3QTGA 3TX9A 5LNSA 3HMCA 2BDQA 3B0YA 4WK9A 1WCGA 4GKLA 5AHIA 3BW3A 4Q33A 1IIGA 3VOGA 2OYLA 1YPFA 2EPNA 2HBVA 2IPGA 3AMLA 3MBFA 3GAYA 3PZMA 1KRCC 3HPFA 3MO4A 5LYRA 4MG4A 1QNPA 3BURA 3VMPA 3MTWA 1PX8A 3GG8A 4C7DA 2J66A 3VMNA 4LYRA 1MFVA 4O14A 4FNRA 2VI0A 3GIYA 4NY2A 3RM8A 3MUXA 3E1F1 3EWUA 1B4EA 2BLEA 1OD0A 3Q65A 4N2YA 3R10A 1WBHA 3NPWA 4ZCWA 4DLMA 1WNOA 5T8GA 1UR8A 3K1DA 3PG8A 1KW1A 1QU4A 3N9RA 7REQA 3BOFA 3MCMA 1SGJA 4MVAA 4D72A 2INZA 1OIMA 1DEDA 1TWZA 3CBWA 1XUZA 1NFBA 1TPWA 2WNNA 3N25A 5FACA 2ACUA 4IG2A 1M41A 3WD0A 1QI5A 3WDQA 5B7ZA 2QJHA 4U5KA 2IKJA 5DMMA 3EWWA 4JTHA 1AQHA 1J6OA 3PZOA 4US6A 3CC1A 3QHNA 2ICSA 3W7EA 2CERA 2G95A 1M65A 1TPH1 4XAYA 3CB3A 3DXIA 3VKJA 3EDFA 3GR8A 2G96A 2XIQA 3EKLA 3PZGA 4O50A 3CQHA 3S8HA 2Z24A 3LV5A 4KIRA 1XX1A 3FYOA 3RXZA 3F5LA 5EPDA 3MUIA 4HMNA 4I6KA 4NVTA 4I8DA 5DELA 1NDZA 2I9UA 2QCMA 4IMAA 2GGHA 1WQ5A 1BG9A 2DSWA 4FS9A 4O57A 3C0QA 2ABBA 3H7UA 3VMOA 2PDHA 3HBLA 2QUUA 4I6VA 1BSIA 3K4DA 1XG3A 2BXYA 4P7QA 1FTXA 2AOSA 1TWWA 1R3TA 4NJHA 1BHGA 4JTTA 4CD6A 1TVNA 2J9ZA 5DXXA 1K8CA 3QC0A 1NWRA 2PDPA 1XD1A 5I3FA 2F38A 4JYEA 1HIZA 4Y90A 3M64A 1QW8A 5JIWA 2FMNA 1KKRA 4XZHA 1UH4A 5C5YA 1VIZA 3C0SA 5JU6A 8CGTA 1UUMA 4HU8A 2VX7A 3C4UA 4QNEA 5GJMA 1NJJA 4RE0A 1XLJA 2JBMA 2YYTA 2XVGA 3UCDA 2BGQA 3C8NA 4JTFA 4LOCA 4PBFA 1JYXA 4RE4A 1GWJA 5JBDA 1VBRA 3IACA 2H3DA 3P7YA 2QCDA 2C1HA 1UD8A 3GZAA 3VKAA 2OR2A 1RAKA 3IAQA 1K4GA 1XRFA 1J2BA 3F5KA 2XUCA 3LCGA 1BQGA 2HBXA 3BAYA 1EJVC 4WIWA 2VZOA 3CPGA 2UZ9A 2DVXA 3CL6A 4GI6A 1VHNA 2PTXA 3T8QA 2OTDA 4KERA 2VDIA 3AU6A 2SFPA 1GVFA 2G3NA 4UCFA 3QHMA 3L0NA 5A6AA 4GUHA 3CH0A 3RM4A 2WWCA 2B7OA 2PE4A 2J6VA 5LXEA 4LANA 3ZIZA 4Q8TA 2FB3A 1SW0A 3WELA 4YIWA 5HJYA 2O9PA 2FH8A 4GRSA 1GTEA 4MZ1A 3SO7A 2D22A 3DG6A 2CCRA 3AHVA 1JZ3A 1E9LA 3BJSA 3PSWA 4C60A 1TPB1 1FWGC 3GW0A 3IV3A 4QM1A 3GH5A 1H0GA 3WEZA 1EA0A 1CGVA 3PTQA 1XIF