2OCZA

The structure of a putative 3-dehydroquinate dehydratase from streptococcus pyogenes.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
218
Chain Sequence
b'AMRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLGQVTLNDMKRIIEVLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title The Structure of a Putative 3-Dehydroquinate Dehydratase from Streptococcus pyogenes.
rcsb
source organism Streptococcus pyogenes serotype m1
molecule tags Lyase
total genus 73
structure length 218
sequence length 224
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2oczA00
1SFJA 1Q6RA 3KRSA 3S5NA 3LV6A 1NF7A 4IPIA 5D02A 1JJKA 2WSQA 4ML9A 2Y63A 5HUOA 4P61A 1KTCA 4OV9A 3KRZA 2QR6A 5LGZA 2DJXA 2QAPA 3UNDA 1Q6LA 2QCMA 3LLFA 1W5QA 3K30A 4MLJA 5F2MA 5EMUA 3PUEA 3IV3A 1GVQA 4L4MA 4WX2A 3FKRA 1VZWA 4MFDA 3ZWTA 4JN6A 4NU7A 1L2UA 4GWEA 3UQNA 4HNNA 3L5MA 1KW1A 2BLEA 2YFOA 3W7LA 1Z41A 4O1AA 5DN1A 4ADTA 3F4WA 2CLLA 4RR4A 4UFLA 5D33A 3TCEA 4R53A 2F84A 3O1NA 5K4XA 1I2PA 5EL1A 2E6FA 4O14A 2C18A 1DV7A 2YDAA 3ABOA 3S5YA 2B7QA 3GLCA 2WNZA 4LTSA 3M16A 1W5NA 3GAKA 1KM2A 1SO4A 3W87A 3PY2A 1FBAA 2LLEA 3FEMA 4O15A 3W1AA 3OBKA 1L6SA 3GAYA 2QCDA 4NX5A 1JUKA 1TPC1 2FIQA 1PL9A 3UZJA 1SZGA 4FX8A 3W71A 1IIGA 3P61A 3UWZA 4O1BA 1OF8A 4HT3A 2DZSA 2FPTA 4N9CA 4GUHA 4ZQCA 1GG1A 2YYTA 2R94A 3IEBA 1AW2A 1UUMA 3W1NA 1MEIA 5D38A 1YXYA 3L66A 2FPYA 2DZWA 1K03A 2FFCA 1M7OA 4RZ6A 3KAOA 4GBUA 3GIYA 4CCCA 1WDWA 2PCQA 3RNDA 1W31A 2OZ0A 3QMTA 3UWVA 4JX5A 2XFWA 1A53A 3O6YX 4YLWA 2Z6IA 2CLFA 2YX0A 2VKZG 1TPB1 4AAJA 4FEZA 3W7RA 4FNTA 5EKYA 5MHBA 4OV4A 4RLIA 1HL2A 3E0IA 2EPHA 1WOBA 1GYLA 2C14A 2V82A 3W2KA 3TU9A 2QDGA 1RQBA 3IGUA 2PC4A 3W2NA 1TB3A 3TQ0A 3QYQA 3EEGA 2FB3A 4P2VA 4RV8A 2H3BA 2ZZ3A 5DY3A 5BOOA 4I9AA 4UFIA 5HJLA 1F73A 2HTMA 3TX9A 1PVNA 3P67A 4MUZA 3HGSA 4UFKA 2VFIA 1QOQA 2I9EA 3MHFA 3NO5A 5DLCA 2GJNA 4XBSA 3W88A 2QJHA 5D2WA 1VYRA 1B4KA 3TAOA 2DZPA 1ALDA 2VFFA 4O1DA 1KTNA 3P82A 4WD0A 4PL2A 2A1YA 3TSDA 2C16A 2E77A 1SW7A 1R30A 3OHIA 2HSAA 2ISSA 3HIJA 5A5WA 3QQ1A 3SI9A 3M0ZA 2C1HA 1GQNA 3MYPA 3LCWA 5HMSA 3BPWA 3OVQA 1YDVA 5KZDA 1YXDA 1LM1A 2RDTA 4K7VA 3LI1A 4KWVA 1VR6A 5GVJA 3B04A 4BI7A 3G1DA 4WY0A 1HTIA 3LX9A 3W3OA 3LV5A 1LORA 5H91A 1DQWA 2WPBA 2OT1A 2B7PA 1QPNA 3CM4A 4O54A 4X2RA 3W07A 4DO6A 5AFDA 1BEUA 1VCVA 1TJPA 4M7TA 3B4UA 3DFNA 1SU5A 4PTNA 3GDKA 4H4IA 2E6DA 1FDYA 3B05A 5IBXA 4Z0SA 1I45A 4K7YA 4JTTA 1M7PA 1NVMA 1KBJA 4KFPA 1S3HA 2QCGA 4A2SA 1KM0A 3W7NA 3NG3A 3SZ8A 3S9YA 3W7JA 1LBMA 3T78A 3PSWA 4MZ1A 4JTUA 3EX1A 1XL9A 4X22A 3HG4A 2RDWA 5C6MA 1JCJA 2QUTA 1C9DA 4UUIA 3VNDA 5D2VA 4FO4A 4OE7A 2E09A 3C2VA 1S5VA 4IMFA 3BGJA 6TIMA 1BKSA 3LOTA 1YTDA 3HPXA 3E9AA 2Y61A 3UPBA 3W84A 1SFLA 3G8RA 3W85A 3UXAA 3TAKA 4A22A 4AMAA 4IXHA 5I3JA 4MJZA 1R47A 3UWYA 4NZFA 2YXGA 4HKPA 1W5MA 4Q33A 3TV8A 3LCFA 3QM3A 4ZZ9A 1M5WA 1R2RA 1ME8A 2ABAA 3NZRA 1QWGA 3CT7A 4ORIA 1SO6A 5LZLA 3W7EA 3LRKA 3R13A 2QKFA 3LTPA 2C0AA 3FS2A 2XN2A 4HHPA 5DBTA 4WXYA 1ZAHA 2AAMA 4EF9A 3WJZA 1V5XA 3PWAA 1GVOA 1RVGA 2J9YA 3PBUA 1G4SA 4AXKA 3LXAA 3HG3A 3WFAA 4AHPA 3NQ6A 4N6EA 2YPIA 4GXMA 1P5BA 3NL2A 2NLIA 2BZNA 2JBMA 5FF4A 3IGSA 1YDOA 1TV7A 5F4XA 4GFSA 3LXCA 1WXJA 3UZ5A 1YPFA 2TPSA 3NL6A 2NXIA 3HMJG 1JCMP 1WBJA 1G7VA 4JTSA 4UR8A 1KTBA 1BWKA 4B5NA 1OVDA 1P1XA 3ZFHA 4AF0A 1LRTA 3NQAA 4R34A 4WOQA 4RX0A 3M44A 3CWOX 2GPTA 2ZFAA 3GB6A 3EX3A 2TSYA 1RD5A 2H90A 2VC6A 3G18A 2A7PA 3ATYA 3NXFA 2CLOA 4FHAA 1KM5A 3NQ7A 2TRSA 5E1QA 2WOQA 1VYPX 1GVSA 3MWAA 2H8ZA 4PL1A 2ZRZA 2X1TA 1PHQA 5AHMA 1FWSA 1H7NA 3P8IA 3IVTA 1KFBA 1KV5A 4NJGA 2ATSA 2ZQ0A 5BMXA 2C6QA 1T8XA 4O16A 1FY6A 3L67A 3M41A 1W0MA 1XCFA 2ZZ6A 3BG3A 1FX6A 1O5XA 3TUUA 2O7QA 3N2XA 3TR2A 1WAUA 1K7XA 2WNNA 3GXPA 3IIVA 4KFNA 4ZQOA 2YGYA 1A5SA 4JYDA 2VOMA 3M1ZA 2QCDB 4Z0JA 1DVJA 2ZRUA 2V5LA 3L9CA 5FEWA 3BW2A 3CPRA 1H7OA 2G5WA 4OQVA 3B0UX 2ZDRA 4LVGA 2W79A 2BWGA 3OEXA 3PULA 1JUBA 3G1FA 5AYXA 4WQ6A 1R2TA 3WJYA 3AJXA 1NF0A 1ZJIA 3TROA 3LM7A 4XKYB 1IXOA 3HGRA 1SZNA 4XUGA 2C15A 1FXQA 3PF3A 8TIMA 3QSRA 1YYAA 3GXNA 1NEYA 4BF9A 3VFLA 3W22A 5F1UA 1J2WA 1QMLA 3BG5A 3SFKA 3IVSA 2G96A 2E68A 1G69A 3ATZA 4LS0A 3FYOA 1QPOA 1SW0A 1YTKA 5TIMA 1UJPA 4DF2A 1YLVA 3GVGA 1BWLA 4LRTA 5U4NA 1R46A 4N6FA 3UWQA 3PBVA 1DOSA 2DZVA 2ZBTA 3W7OA 1H7XA 5FEPA 2J88A 2Z1BA 5DBUA 3G1HA 3W2UA 4JTLA 3YPIA 3H55A 2QUVA 3N2MA 4ICNA 4QM1A 1W5PA 1DORA 2DP3A 4UXDA 4UNKA 3EWZA 4JY9A 5E0KA 2JKAA 2QJGA 1JR1A 4NJHA 2GVGA 3PAJA 1OFOA 1H7WA 3W70A 1O60A 1OFDA 2V2DA 4OHQA 1KFKA 5F2GA 2WQPA 3NA8A 5AYYA 4MZ8A 1HG3A 2A0NA 4CQAA 4CCEA 3CHVA 1FXPA 4ZVJA 3NPVA 4FX7A 3LCLA 1AW5A 3BV4A 3LB0A 5I3HA 1TPUA 2RKXA 4UTMA 2QEZA 2YW4A 3HO8A 4UTJA 2ZRXA 1W3TA 1JCNA 2QF7A 3M7WA 1X1ZA 3U6WA 4WJEA 3A24A 5CZTA 4UTWC 3EX2A 2BXVA 4M6PA 1LZOA 5F1VA 3TJLA 2TMDA 3W7GA 3C61A 3STCA 4BI5A 1AK5A 2ISVA 3C56A 3FA5A 2CLHA 1I4NA 1LRNA 3I7SA 2FJKA 5FF0A 3STEA 3BW3A 4IJBA 1G4PA 1PS9A 3LBMA 3BO9A 4YXGA 4O1CA 5HR7A 2GVLA 3ABSA 3W2MA 4GUGA 4E2DA 1TO3A 1RZMA 4WY0B 4Y9AA 1QFEA 3ZR4A 3LCHA 2QAFA 5CZ0A 3CWNA 1XI3A 3BLIA 5EYWA 1VHNA 4RCXA 4DF1A 3L0NA 3DAQA 3G0XA 1PIIA 3HF3A 4LVFA 4ZQMA 4NXKA 4Z1CA 3FYPA 3C2OA 1F6KA 3T55A 5D03A 4I7WA 3W7DA 5D30A 1ZENA 2Q3OA 3NR0A 3W1UA 1LP6A 3C2FA 4JIQA 2FTPA 1EEPA 1Z48A 1DQXA 3TJXA 2ZA3A 1QOPA 1LOLA 3KX6A 4UTIA 3TH6A 1TQJA 3HBLA 5AHIA 5J5RA 3PUOA 2NV1A 1FCBA 3W1QA 4TU1A 3W7QA 5KITA 4WXZA 1G6CA 5F4WA 4FXSA 2EKCA 4NX0A 2X2GA 4NJKA 3F03K 3L0GA 3R5EA 2YR1A 4LS1A 1W5OA 3LCGA 1LOSA 1IXPA 2Y7DA 1TRIA 5KMYA 5CSSA 4MOZA 1H7PA 5TQLA 3CEUA 4OBTA 3SY5A 3W2JA 3WJSA 5F2IA 4ADUA 2VEKA 1B57A 4DO5A 3EWYA 3I65A 2A5HA 1KFJA 4ORMA 1GYNA 2A6LA 5KSWA 1KM3A 4UNLA 3NQFA 4LOCA 5I3FA 4N9EA 1UBSA 4CQ8A 1GVRA 1SO3A 3BW4A 3BARA 1EIXA 3W1RA 3CEPA 1LBFA 4FIQA 3M9YA 3NQEA 3B0VC 1GZGA 3P80A 4OT7A 3KOFA 2GJLA 1T96A 3QC3A 3DXIA 4JTKA 4K36A 4NQ1A 5FF7A 4MKNA 2R14A 5EY5A 4Z1BA 3W75A 4JTJA 2NX9A 5DCDA 2I1OA 3BG9A 5DXXA 3U2OA 1SQ7A 3W6YA 1O4UA 1D3GA 2G95A 3TXVA 4JTHA 4K8HA 1OX5A 3LI0A 3N9RA 1IF2A 3QH2A 5C2XA 4FNRA 4UTTC 4C1LA 4UR7A 4PC8A 3LGEA 1THFD 4JIPA 2P10A 4FNQA 1X6UA 2ZZ4A 2Q8LA 4DEFA 3P8JA 3RF9A 2VEIA 4QITA 2WSRA 2TYSA 1L9WA 2G97A 3HPZA 4LC8A 1G4TA 4O28A 3QPYA 1QPRA 2R91A 1I2RA 4AF0B 4WUIA 5K4ZA 3L5LA 3GR7A 1ICPA 1RQEA 3THQA 3PBYA 5LHFA 2B4GA 3R2GA 2YW3A 4O0KA 3S5ZA 3DFSA 3I7RA 5BRBA 3DHDA 1BTMA 1VJIA 4AB4A 4Y96A 4JGDA 1FWTA 5G2WA 3SGZA 4MY8A 4JYFA 4Y6GA 4YWIA 1H63A 2HS6A 1JCYA 1V7YA 2IQTA 1N8FA 2X1RA 3A5VA 2ZA1A 3O07A 1VH7A 5HINA 2EGZA 3SR7A 4WY0F 1RQHA 2QCEA 1XC4A 5D2TA 4EIVA 1GWJA 4N4PA 4PCFA 3PB0A 3WK2A 3L21A 3S1WA 5K9CA 1MO0A 2RDUA 1ZAIA 4JEQA 3L0KA 3TQVA 4M7SA 2GVJA 4FXRA 3W73A 3A22A 2NZLA 3O16A 3GR8A 3T44A 3U8GA 4NXSA 4JDYA 3PSVA 3H54A 4E2BA 3FIGA 3TMLA 4AEOA 3EKLA 3B06A 1TSIA 4MYXA 4NT0A 1F76A 4O13A 4AWSA 3TMQA 3P84A 3FJLA 2ZRWA 1WA3A 1VGAA 2V30A 5DCBA 3LTSA 3OA3A 1FCVA 4JS3A 3L5AA 4QNWA 1OABA 1DBTA 1OFQA 1D3HA 3TXZA 3WK0A 3I68A 2CLEA 5D2YA 3O6DA 1WX0A 4R7JA 4RJEA 3VE9A 3S8HA 3MBFA 2ZRYA 2OJPA 4JTGA 4RXGA 3DKLA 2B7OA 1H50A 3OVPA 5G4EA 4LRSA 3TW6A 3P5YA 3TDFA 3QF0A 3HB9A 4ALDA 2V81A 4Z1DA 2OCZA 3LXBA 3NQMA 4M6QA 1JCXA 1P0NA 2Y7GA 3WJWA 4GUJA 4JX6A 3NM3A 4BR1A 2DZUA 3D0CA 3TA6A 3GK0A 3IRDA 3Q2DA 4LV4A 2C13A 2YZRA 3KVLA 2V2CA 2YSWA 3RMJA 1JQVA 3KFTA 4H3DA 3M6YA 3LTYA 2W0UA 1U83A 2RFGA 3LHVA 4G1KA 2NUXA 3PUDA 3O8AA 4MVAA 2ZZ1A 2CWNA 4UTWA 1EP2A 3MYOA 1VC4A 1IXQA 4TIMA 2UV8G 1KM1A 1VQTA 4JR5A 4I7VA 1ZALA 3O15A 3TC7A 1JUEA 4KKXA 3B03A 4JX4A 3DZ1A 3BK0A 3NGJA 4J9JA 4JD4A 5AHEA 2P1FA 4GC4A 4O0ZA 5I3GA 1RPXA 1OFBA 2CZFA 2GUUA 1TJRA 3P5ZA 4UFMA 2F7FA 4UTLA 1VCGA 1W3NA 3TE9A 4XWUA 2CLIA 3GZ3A 1W3IA 5F2LA 5K9XA 1NAL1 5AOUA 2NUWA 4KFOA 1L6WA 4RZ4A 4YL2A 3HG5A 3GKFA 2A2IA 1VCFA 5G1TA 4BFAA 1OK6A 5AC6A 4NJJA 1TPEA 3P7YA 3TC6A 5FEXA 1EUAA 1T0OA 3ANYA 3S1XA 1P4CA 1SR9A 1FCUA 4UTUA 2NX3A 4IMCA 3DI1A 4HPJA 2V0TA 1GPWA 2A85A 4EWND 1H1YA 4R33A 2ZCGA 5I3KA 3W7MA 5D32A 5C5YA 2AQWA 4ZQPA 1Z44A 1TCDA 2AGKA 2Y6ZA 3MHGA 3IIZA 1GTEA 4JXCA 4IXXA 2VFGA 1F05A 5LHEA 4N2YA 5CG7A 1W1ZA 2ZTKA 3EWUA 3NYZA 3C2RA 4HSOA 3UD6A 1ZFJA 1Q6QA 2X1SA 5FI8A 4N9BA 4FNPA 4FIRA 4TX9A 2Y70A 3N9SA 3GDMA 3C4UA 3BVJA 3C8FA 5LNWA 5CPNA 5D37A 3QQ0A 5G2HA 1KLYA 3A5FA 4QNEA 3DU0A 1IGSA 2ABBA 4K8EA 1MEHA 3TNOA 2DJLA 2JKEA 3UXDA 5HWNA 3QPZA 3S1UA 1HO4A 1X7FA 1O95A 1OX6A 6ALDA 4LS2A 3EX6A 4UMAA 4N02A 4JNMA 2Y7EA 2FPVA 5G5IA 1E51A 1U5JA 2PRLA 1S5TA 3TW7A 4IQLA 5AHLA 3WK3A 3L2IA 4K6AA 4U28A 2DU2A 1J4EA 5SWUA 3MJYA 4JY8A 1EP3A 3T4CA 3G1YA 3PR2A 5BW6A 3TFXA 1KFEA 4DELA 2CLKA 4I7UA 4TR9A 2QCHA 3FKKA 2X16A 4TMBA 4EVZA 4MPQA 2CW6A 4NJIA 4UTTA 4LUIA 3GKAA 4YMZA 4UCGA 3MI3A 1H5YA 1YPIA 2PRMA 3B0PA 5A8GA 1ME9A 5DXYA 2E6YA 4LW7A 5K2ZA 5CPMA 3SJ3A 3NNTA 4AHOA 2DZTA 1I2QA 3KRUA 3RLVA 4PH6A 1SO5A 4RXFA 4CQ9A 1TV5A 1KM4A 4UTKA 1EX5A 2X30A 4GUIA 1UB3A 4IWWA 4X3ZA 4IUOA 4Z08A 3G1SA 1YXCA 3WK1A 4KWWA 4UIOA 1TPDA 4FX6M 4MYAA 1EWDA 4S2CA 3I7QA 1WQ5A 2JK2A 7TIMA 3W23A 2O7SA 3N73A 1OJXA 5U7SA 3EKZA 4IPJA 4PA8A 1QNVA 4MFEA 5G4WA 1LDCA 5HWMA 2A6NA 1QDSA 1LLZA 3C0JA 5AB3A 3W1PA 4YCOA 4ZL1A 3JR2A 3R8RA 2XN0A 3DBPA 1PCWA 2H3DA 1JCLA 3H53A 4EF8A 4FNUA 3EB2A 3F1QA 4HSNA 5AC7A 4UC5A 4QISA 3HOJA 4O18A 3THAA 1OX4A 3P62A 4IOTA 2NUYA 4UFHA 2I14A 1H7RA 3UWWA 4FNSA 1YTEA 4U4MA 3USBA 1N55A 3LHYA 1XBYA 2WV8A 5D05A 3VCRA 3W1LA 3OG3A 5EBUA 2ZZ5A 5EA9A 1A5CA 2NXGA 3R12A 3M5ZA 5EPDA 4A21A 3LRMA 1IXNA 4RKAA 3NL5A 3PS7A 5CZSA 4AH7A 3E12A 4LC6A 5LKYA 2P0OA 3O06A 4D2JA 3TFCA 2Q3RA 1K7FA 3EWWA 3MHUA 2JGYA 5CZJA 2HS8A 3MO7A 4AHQA 1GVFA 1FWRA 1XUZA 1VHCA 2VFDA 3NPWA 4H6KA 4O4VA 4WZHA 1H61A 3STFA 3W76A 3TKFA 2OX1A 2ZTJA 3LRLA 1F7BA 2D73A 3B8DA 3PVFA 3HPSA 1ONRA 2FQIA 1TIMA 3N3MA 2PURA 1PHWA 1K8ZA 3FFSA 4POCA 2E5DA 4LWWA 4S2BA 4FF7A 4Q32A 3DH7A 3N19B 2VFHA 3RU6A 3GDRA 3STGA 5F4SA 2WJZA 1KA9F 5FESA 1JRBA 1G67A 2NV2A 2YFNA 2ZZ7A 3I6RA 4MZYA 1FCQA 3QJAA 5CSRA 2Z0IA 3SECA 5CKSA 3E02A 3ZS4A 2WO5A 3W7KA 3W1XA 4N4QA 4NNCA 3M5VA 1JQXA 4QAIA 5HNRA 1CI1A 1W8SA 3DFPA 3IGXA 4MLRA 1AW1A 1K8YA 1GJPA 3EXSA 4O17A 5CGQA 3NAVA 3R89A 1F5ZA 2BTMA 3QZEA 3VKJA 2V9DA 3W74A 1DJQA 1JVNA 2Y88A 3UY8A 1XUUA 3TK7A 4CNPA 3VI2A 3A21A 3PG8A 2CZDA 1TV8A 3NZ1A 1EA0A 4O8RA 3CTLA 4DBEA 1HFBA 1MSSA 1ZHAA 1K8XA 5D2XA 3SSJA 2WKJA 2B7NA 2QDHA 3DI0A 4W9TA 5E93A 1DJNA 5AHNA 3PBWA 1VS1A 2EAWA 1KBIA 2JGQA 4OGZA 3QW3A 3EXTA 3NVTA 3O6CA 2QUUA 4X9SA 1G4EA 3NPXA 2OMAA 1SUXA 1XFBA 2V2HA 3CU2A 4AVFA 1J5TA 1X8FA 4XQ6A 3UY7A 1I2OA 1I2NA 3EX4A 4DQWA 4JTIA 1I8JA 1MZHA 2XN1A 4LVDA 4XKYA 3RFAA 4XTIA 3W7IA 5BMWA 1LOQA 4JDBA 2FB2A 1XKYA 3G1VA 1C8VA 1H62A 4DBDA 2PRHA 1P0KA 3ABRA 1NFBA 3F4NA 3GDLA 2NWSA 3MI2A 5FEZA 3CIWA 3NQGA 1JRCA 2CU0A 3LCIA 5LNSA 3S42A 4UTHA 2Y89A 4PEKA 2Z2UA 3T7VA 3QFEA 3C2EA 4FB7A 1JULA 3CLMA 1D9EA 3JRKA 1IIHA 3DKJA 2Y62A 3L65A 1L6YA 3LDVA 4TO8A 2CFFA 3CIXA 3MP4A 4YCPA 1K02A 3NQCA 3NDOA 3P60A 3G1AA 5L9FA 5L6UA 1KFCA 3V1PA 3TSBA 4A2RA 4IGHA 1MEWA 4HNUA 2A21A 2GQAA 3HGJA 5AHFA 2WSYA 1W54A 4AWUA 4ZQNA 5IM51 2WNQA 4O50A 3P81A 2A4AA 1ZY9A 4OWGA 3DFTA 4K39A 4JYEA 5KZMA 3T40A 3Q58A 1GEQA 2QJIA 2ALDA 3OIXA 4BWLC 2DORA 5K7JA 3O05A 3LHTA 3G3DA 2FLIA 3OVRA 1GOXA 5T26A 2GQ9A 3AO0A 2NWRA 2E5CA 2RH9A 2W6RA 2KZHA 1PE1A 4O53A 2Z6JA 3LCXA 3W1MA 2OT0A 4NNAA 3M5YA 5G2IA 4E38A 2ZYFA 2E6AA 3NPUA 5AYZA 3W2LA 1Q3NA 1SZEA 1TPFA 1G7UA 1LBLA 3G0SA 3HGOA 3BLEA 5CPLA 1OK4A 5LGXA 3DFOA 1ME7A 4QSHA 1KM6A 1VPXA 3RLUA 1XDLA 4MY1A 1F6PA 1AG1O 4HN4A 2RHGA 4Q4KA 3SIZA 1AL7A 3HJZA 4NUWA 2VEPA 4O52A 1KV8A 5ABTA 1SSGA 4M19A 3UYCA 1WBHA 1B4EA 4O57A 4HNTA 3FOKA 1OFEA 2YYUA 3LHWA 2BSLA 1O94A 5J5DA 1KLZA 5KZEA 3KHJA 2ZA2A 5LNRA 5LNVA 1B9BA 5DELA 5LSMA 1YDNA 3BLFA 3TQKA 1LRQA 2ATMA 2EF9A 3CB8A 3G1XA 3DHFA 4GJ1A 3G22A 3LHUA 2Y85A 4DPQA 5HUPA 1TPVA 4XTDA 3C3NA 4LNYA 2VENA 3M5XA 4IX0A 3W7HA 3MMTA 2ZRVA 4LY8A 5I3IA 3PB2A 1YADA 2DZXA 4NVTA 1VRDA 1SW3A 3KVJA 1Q6OA 3DGRA 5KTLA 1M6JA 5G1YA 4K37A 5K3VA 2CZ5A 3MUXA 4UMCA 4Y8FA 3LERA 4O19A 2H8XA 1ZNNA 1LTDA 1FUYA 4Y90A 4LT9A 4DXVA 3S1VA 4IMDA 2CLMA 3INPA 1SPQA 5BNKA 4Z1AA 1X1OA 4PFMA 1C29A 3GDTA 1EPXA 1WOAA 1OYAA 3QRHA 2GOUA 1XBXA 3Q94A 1LLWA 2E1DA 1GG0A 1O5KA 3W7CA 1ZCOA 1OX4B 4GE8A 2B0MA 1TTIA 2C19A 3KVKA 3MP5A 4LVBA 4CNOA 3NQ8A 3G8EA 3GX9A 1GTHA 4LUJA 1DL3A 2HMCA 2J9ZA 3L68A 1VYSX 1Q45A 4ZMGA 4LU0A 4GRSA 1UCWA 1CW2A 4HIBA 3W1TA 1OFRA 4MJMA 5H2ZA 1DHPA 3TSMA 3CC1A 1T99A 3EWXA 1XBZA 1TPWA 4IMGA 4LVAA 4A29A 4O10A 3N34A 3M47A 1QO5A 3FJ6A 3GNNA 4RK8A 1W37A 3NOEA 4UFJA 5C54A 4UMBA 4JICA 2ISWA 1VLWA 5FF2A 1A50A 3G3MA 3W9ZA 1SSDA 3IIOA 3KVMA 4GUFA 4O4WA 1HO1A 3P74A 4ONVA 2BX7A 3LBCA 4S1FA 4CCDA 4L4LA 1FWWA 1UASA 4CNNA 1XM3A 1OF6A 4O12A 2EHHA 1TQXA 4M6VA 3ZWSA 3O63A 4QJ1A 5DY2A 2J24A 5K9DA 1AMKA 3GNDA 1ADOA 4BK9A 3LLDA 1EUNA 4N9DA 1WYIA 2H6RA 5DCEA 3W83A 3IIPA 2VEMA 4E0CA 1ICSA 1N7KA 3UWUA 3MBDA 1QAPA 1FDZA 3WJXA 3QEZA 3NQ2A 3S5OA 3W7PA 4BI6A 4O11A 1TRDA 3BGGA 3LHZA 1XDMA 4JTEA 1H60A 1LROA 5D04C 1RR2A 2QCLA 3CQ0A 4TMCA 1H1ZA 2ZZ2A 1FQ0A 3ELFA 5HWJA 5C55A 2R8WA 4HNVA 1OYCA 1QCWA 4OU1A 3VE7A 1PCKA 4CLMA 4QQ3A 2J6XA 4DO4A 2Q8ZA 4A3UA 5D09A 2A7NA 2GQ8A 1XXXA 4WOZA 1OHLA 2VELA 1AL8A 1R2SA 2JKPA 1TPH1 1ICQA 1OFAA 1PV8A 3DFQA 2FDSA 1GT8A 3QMSA 2PE4A 5AC8A 3PG9A 3UPWA 3RK8A 1NSJA 3Q37A 4ADSA 1TTJA 1TYGA 1OG0A 5HQEA 5TBOA 3EXRA 1RV8A 3IVUA 3PM6A 1W56A 3V75A 2CZEA 3N14A 1S5WA 3W86A 2Y7FA 3IIXA 3QMRA 1WV2A 3C52A 3GYEA 5KINA 1F2JA 4EOUA 5AN7A 3JS3A 5FF3A 3QSTA 3MW7A 3M43A 3DENA 3HQ1A 2J9XA 3HG2A 3G0UA 2J27A 4RZ5A 4ZQRA 1Y0EA 3C6CA 3NQDA 3FLUA 4MIMA 2QCNA 3NEVA 1KFLA 1QR7A 2C3ZA 1HUVA 1MXSA 1FWNA 4NNBA 2V8ZA 2A7RA 1F74A 1LYXA 4DPPA 3KXQA 2E5BA 3W72A 1ZAJA 3TIMA 1H51A 5IBXC 1B3OA 1DKWA 3G24A 2VFEA 4MY9A 1Z42A 4BWLA 2YCEA 3SW6A 1CX9A 1QO2A 2VXNA 3QW4B 1OFPA 2QCCA 2X1UA 3MP3A 4C1KA 2QCFA 1LCOA 1TTPA 2NX1A 3NM1A 4PODA 4QIUA 4DF0A 4NZJA 4XZ9A 1QPQA 4IX2A 4LV9A 3E96A 4JTFA 1SZFA 4HPXA 4GNJA 3PC0A 2V5BA 3SGUA 5HR6A 4K38A 1TMHA 3E49A 3GXTA 1EP1A 5LNUA 5CPOA 1XBVA 3A9IA 3NL3A 3EWBX 3S0CA 1TREA 1A5AA 5HULA 4M5PA 4IMEA 3S6DA 1K7EA 1VLIA 1UUOA 3MI6A 4AWTA 3A23A 1TTQA 1EWEA 3NQVA 1OYBA 1K3UA 1FDJA 4XBKA 1EB3A 3ABQA 2NXHA 1A5BA 1ML1A
chains in the Genus database with same CATH superfamily
1BXCA 3S1GA 1EJRC 3OO2A 1PEZA 4Q8OA 1YPXA 2GL5A 2W62A 3GM8A 1QK0A 5FJUA 1WZMA 5EBAA 1AA1B 4H9UA 4P61A 4FPSA 5LGZA 2QCMA 3FAXA 1H5VA 1PAMA 1XC6A 1UKOA 4MLJA 4S3BA 1VFUA 2VVSA 1GVQA 6PTDA 3CJPA 3FKRA 4YWSA 1XLLA 1VZWA 4TOQA 1EZWA 1NDVA 4O1AA 1DWHM 4W85A 5DN1A 4ADTA 2AQOA 4RR4A 2Z2AA 2WBGA 4XAGA 5D33A 4R53A 4IFRA 1OY0A 4JL2A 5DRCA 3T0DA 3G77A 3B8SA 3L7RA 4J3TA 1OC6A 4YU1A 1E1FA 3WDRA 1IQ8A 1E0UA 3W87A 1FBAA 2LLEA 4GINA 3AALA 3W1AA 3OBKA 1ADDA 3FGCA 2WHMA 4PTXA 2QCDA 4RNHA 2FIQA 3KW3A 4F66A 1IIGA 2Y8VA 3MB9A 3II1A 1KC7A 1GG1A 2YYTA 3CBWA 3WNKA 2PCEA 2CIPA 3VU2A 1UUMA 1MEIA 1T40A 3RJXA 4A05A 2FFCA 4GYPA 2PF8A 1QHZA 4GBUA 3GIYA 4L9YA 4M1RA 2OZ0A 3QMTA 4AZ7A 4JX5A 1A53A 3O6YX 3W38A 2Z6IA 1HX0A 4M1BA 2BOGX 5IFPA 3BLOA 2YX0A 4FEZA 5MHBA 3OBAA 3B8VA 1WOBA 1B3YA 3HPAA 1BYBA 4DJFA 3TU9A 3CV6A 4OECA 4HN8A 3V0TA 1TB3A 4WHBA 3V3WA 3EEGA 4FS9A 4FLOA 3GW0A 1NFPA 3UCDA 3GVVA 2D23A 2XM1A 3JVAA 4OZOA 1Q8JA 5BOOA 1O1ZA 4UFIA 3TOYA 2V3EA 2ODOA 2WCAA 1M03A 3P67A 5EU9A 3FY1A 4JFTA 2I9EA 3UZYA 1WUFA 4CQCA 3QHOA 2DUZA 2GJNA 3KOXA 2QJHA 2BY0A 3BUVA 2PWVA 3ZR5A 1ITCA 1B4KA 3QKEA 3P82A 3WQWA 5I07A 2A1YA 4QP0A 1BRLB 2C16A 3O0FA 4CEUC 1QATA 3OHIA 3SI9A 3W24A 1GQNA 1XSKA 3W01A 1YHTA 4JEJA 3LCWA 3WF0A 5HMSA 2I57A 4FXJA 1YDVA 3UVAA 3LI1A 1XCWA 1VR6A 5GVJA 3IJ9A 1HTIA 5LA2A 3ALFA 4M8UA 3LX9A 5H91A 1PKMA 2J79A 2OT1A 3W07A 4O54A 3EMZA 2O9RA 3VZZA 3V18A 1BEUA 5TD4A 3DHUA 3EGJA 1S2TA 2D3LA 1UMLA 3BURA 3GDKA 4O8AA 5IBXA 3V4BA 1I45A 4K7YA 1LLOA 1KBJA 2QCGA 4LUSA 1KM0A 3SZ8A 4WJXA 3S9YA 1EDQA 1H3GA 1LBMA 2C0HA 3BLKA 2JEPA 4C6EA 2PZ0A 4DZIA 4X22A 3HG4A 1JCJA 3SDOA 3ZSSA 1UA7A 3VNDA 1ECQA 3TTYA 1P6BA 3LPGA 3LOTA 2IPJA 2Y61A 2RUSA 3UPBA 1I60A 3GG1A 4IXHA 4NY2A 3L4YA 4NZFA 3AIBA 4HKPA 1Z3NA 1QW8A 1ME8A 2AMXA 5AYBA 5IDIA 3H21A 3KRBA 5ECVA 4H01A 2C0AA 4FLRA 3FS2A 2V3FA 6XIAA 2AAMA 3IJLA 4PMYA 2AL2B 4M80A 3LXAA 1REQA 3HG3A 2D2OA 4AHPA 2DPEA 3NQ6A 3PK7A 2YPIA 4Q8PA 3NL2A 2NLIA 4YVVA 5F4XA 1YPFA 1J0KA 3SY1A 1JCMP 1WBJA 1KTBA 1XLIA 2QT3A 1OVDA 1Y5XA 3B8TA 4DUVA 1LWIA 1QNOA 1XHGA 4GGBA 4NAFB 2G4JA 3EX3A 2C91A 4M56A 2VC6A 4ZTYA 4MG4A 3NDYA 3WUGA 3NXFA 4FHAA 2BY1A 3CHEA 2WOQA 1VYPX 4DJDD 1GVSA 1PSCA 3P3BA 2IPGA 5AHMA 3SCWA 1H7NA 3MDWA 4FOKA 3T0TA 1CXIA 1KV5A 2ZQ0A 3OLIA 4LAKA 1PZ0A 1CXHA 1VFMA 5PTDA 3APTA 1GK8A 1O5XA 4P7OA 3TUUA 4ILSA 2O7QA 1WAUA 1LWJA 1VF8A 1EJXC 4ZQOA 2YGYA 5DT5A 3M1ZA 4AG0A 1BSLA 4M3PA 4Z0JA 3FJNA 4DJEA 4UQBA 3L9CA 1H7OA 4LF2A 4DI8A 3DFHA 4LB4A 4XD4A 3AC0A 4IH3A 3VD5A 4MAZA 4E3VA 3KDNA 1PZ2A 1Q4NX 2ISFA 4RE3A 2BHZA 1OGGA 4WQ6A 3AZSA 3NZPA 2XGIA 1F8IA 1R86A 4LAUA 1ZB5A 2C15A 3E5PA 1EIBA 3GXNA 4C6KA 1J2WA 2C1GA 3QY6A 4LS0A 2JIWA 1UD5A 4TTGA 1V3MA 4B3LA 4LF1A 3LD5A 1LUCB 3W26A 4B2DD 3UWQA 3VIGA 2DZVA 4EXBA 1XS2A 2EBNA 5AVHA 1PPIA 4PUUA 4BKNA 4JTLA 5C9UA 2PF0A 1C7TA 5H8MA 6XIMA 4ICNA 3B0XA 3URNA 4UNKA 4Q7BA 2JKAA 3OJGA 4G2DA 5ABFA 2XJ7A 3SRKA 5HAOA 2F6KA 4OHQA 5F2GA 1VEOA 4D6JA 4JKMA 1LL4A 1XQKA 3CHVA 4HPNA 4ZVJA 4FX7A 3RXZA 1J9YA 1F07A 2NSXA 3FN9A 5I3HA 3AMGA 1PUDA 3M7WA 3N4FA 4HOZA 1U22A 3PAOA 5HK4A 3CPGA 2YL9A 4AVNA 2J66A 4UTWC 1CLVA 3EX2A 1JDCA 1RBAA 3AXHA 3W7GA 3STCA 2QW5A 2CNCA 1UD4A 4XAFA 2BS9A 2R1KA 3FA5A 2CLHA 1LRNA 5BXSA 4TTUA 3EDEA 2G3MA 4O1CA 1ISYA 2GVLA 3GQYA 2Q8XA 3W2MA 4GUGA 1QPKA 2ZUTA 4Y9AA 4HK6A 1Q63A 5CZ0A 1MI3A 1KO0A 4KERA 3ISIX 5A8QA 5ECUA 1VHNA 2X7VA 3WD4A 1PIIA 2VR4A 4NXKA 2RDXA 1PXGA 1UHVA 4C6LA 2P76A 3VOJA 3M0HA 4KEZA 1ZENA 2Q3OA 1LP6A 4R5EA 3R43A 3TR9A 1Z48A 4UTIA 3TH6A 4C5ZA 2V69A 3SRHA 3HBLA 5AHIA 2WVTA 4LJ3A 2D2HA 3W1QA 1E4IA 1YX1A 4CQBA 1G6CA 5F4WA 1B1YA 4B2DA 4Y9PA 1ZBKA 3TLLA 2X2GA 3UF9A 3R5EA 5M5DA 1FFRA 3L12A 3VOIA 3CH0A 4H8UA 5HNNA 2Y7DA 1KBLA 1M7JA 6REQA 5CSSA 3GNPA 7A3HA 1XLMA 2P53A 4PMRA 2BG5A 4GFIA 1B3VA 3NQFA 4ZENA 1U33A 3FW6A 1UBSA 4AMCA 1B3ZA 3IJ7A 4AD1A 3BW4A 1EIXA 4MUPA 1LBFA 4FIQA 1CGXA 3M9YA 3UZZA 1GZGA 3GXMA 1VBJA 3P80A 4OT7A 4WDUA 3W53A 4JTKA 5FF7A 5EY5A 2MANA 3W75A 1P7TA 3BAWA 2XIQA 5DCDA 3BG9A 2XTKA 5DXXA 1EGVA 1SQ7A 4AXNA 3TXVA 1LL7A 5C2XA 4GKTA 1FWEC 4PC8A 3FSUA 1YKWA 4KMQA 2C8NA 2GQ3A 4Q8VA 3WBAA 2HISA 3IUHA 3P8JA 4BY3A 1XG3A 3GS6A 3LLXA 2G97A 4PSRA 1CXKA 5FL1A 4MAVA 4F9DA 2BHUA 4A3RA 1G4TA 3QPYA 1QPRA 3MZNA 3GR7A 4KGJA 1RQEA 2NW0A 3H2MA 2WKGA 4GJJA 3EMCA 1MXGA 4IIDA 5BRBA 3WLLA 3KS6A 4Y96A 4JYFA 1UD3A 3N18A 4ENLA 3AMCA 1GZJA 1YNPA 1JCYA 1DTUA 1ITUA 2H9AA 4E3TA 4J40A 4IUGA 2VGIA 2WHLA 3PNZA 5JMUA 2EGZA 2VRKA 4JOMA 4OKDA 5E6YA 4JTAA 4EIVA 3WK2A 3PB0A 3L21A 1ZAIA 1KGXA 4JEQA 4HD5A 4BEQA 3TQVA 2PP3A 3WFZA 4FXRA 1A5OC 3NSXA 2E4TA 3T44A 5CLWA 4R7OA 2GOKA 2OELA 3H12A 3LMYA 3USZA 3H54A 4G56A 3MZ2A 4AEOA 3EKLA 4MYXA 2OZ3A 3DYOA 2R1PA 3AYTA 2V30A 3A64A 1UUQA 1JEZA 3MS8A 2VWSA 4PCNA 1RK6A 3WQOA 3WK0A 3HQNA 3ZLGA 5TAOA 1RD6A 4F2TA 4WKFA 3VOGA 1LQ0A 1F3EA 3S4TA 1E70M 1FKXA 1XLKA 4AIOA 1GJUA 4RNFA 4RXGA 3ZMRA 1E4NA 4M81A 3W25A 2V81A 4NIRA 3MSDA 2HE8A 3UWEA 3BQ5A 4WIWA 3GSMA 1QTWA 4JX6A 1RALA 3NM3A 2V6AA 5FAGA 2IMRA 1NDYA 3AUJA 3IRDA 3S2CA 4LV4A 3KVLA 2V67A 3RMJA 3M0XA 2J78A 4B90A 1EC9A 3E0VA 3GHTA 4H7ZA 1RVKA 3PUDA 5CJ5A 4LYKA 1WDSA 2ZZ1A 2OFJA 5DMNA 4W87A 5FCZA 4HPGA 2PB1A 1UPPA 5BOFA 3VOCA 1KKRA 2WSKA 4C6JA 1VQTA 4JR5A 1HT6A 5FSEC 3T6CA 3O15A 3V35A 3N17A 3QGKC 3B03A 4JX4A 3OGRA 3ARQA 4F0MA 3ONCA 3NGJA 4GC4A 3LQLA 4TXEA 5I3GA 1OFBA 1F61A 2GUUA 4W84A 3VD3A 3VC5A 1UR3M 4L1XA 2YDRA 4UTLA 1KCLA 3TE9A 3OVGA 2HVOA 3MA8A 1TX2A 3NZQA 1NAL1 2NUWA 4LUTB 5I09A 4YL2A 3HG5A 3IJIA 2W61A 4BFAA 5AC6A 3TC6A 1GONA 5FEXA 1QI2A 3S1XA 2CCRA 4DI9A 2NX3A 4HPJA 1PX3A 3OZMA 3S2NA 4M82A 4EWND 2GSHA 2XSXA 2FH8A 5I3KA 5C5YA 2AQWA 1Z44A 1EGMA 4LBRA 4JXCA 4IPLA 4IXXA 2VFGA 5LHEA 4PB5A 4JHOA 1V6XA 1W1ZA 4D6FA 2ZTKA 1KR0A 3QN3A 3IJDA 3C2RA 1EHNA 4HSOA 1ZFJA 2A79A 5FI8A 2Y70A 3S2LA 2W27A 4ZSUA 4QSFA 4AVOA 3N6HA 3SN4A 3VTRA 3FVDA 1MEHA 3LUTA 3UXDA 3VD4A 1EA9C 1KCZA 1OX6A 1TA3A 3EX6A 4UMAA 4JNMA 3PPCA 2FVMA 2PRLA 3TW7A 4IQLA 4MKSA 3L2IA 3AROA 4Z17A 2PAJA 1BPLB 3KBSA 3OW1A 4AY8A 4U28A 1IT8A 3FDKA 5LYRA 2OGJA 3POCA 5SWUA 3MJYA 1MDLA 3G1YA 3PR2A 4F0HA 1JL8A 2CLKA 3KWSA 1HQTA 1AVAA 4BCEA 4MPQA 2CW6A 4LEFA 4NJIA 4PUEA 4YMZA 3RO8A 1GOMA 1JDDA 1YPIA 3M0KA 1O68A 1ME9A 4IGSA 5CPMA 1U5VA 3BV7A 4AHOA 2WMIB 3KRUA 4HK7A 1FTXA 3RLVA 4Q7NA 4CQ9A 1Y5WA 1TV5A 3AHZA 1KM4A 3KBMA 4V2XA 4C7FA 2X30A 5CBJA 1UB3A 4X3ZA 1TX0A 1X8CA 2YL8A 5FJRA 4AUBA 7TIMA 1WXZA 3W23A 5B7YA 3V0UA 4KEMA 2PUZA 5IHSA 2E25A 4PA8A 1QNVA 2C71A 3N11A 2DGAA 1LDCA 5HWMA 3Q67A 3C0JA 1RY8A 4FI4A 1JYWA 1DQUA 3R8RA 4L5ZA 1UD2A 2XN0A 5C2GA 3WD3A 4EF8A 4FNUA 1FH7A 2O56A 3BJSA 3F1QA 2PWEA 2YCKX 3BMWA 1RA0A 4UFHA 1W8GA 4FNSA 4C6BA 3N04A 5D05A 3CHFA 1EBGA 1DIEA 2E8YA 3R12A 3CLWA 5C9XA 3NL5A 5CZSA 3TFCA 1XYMA 3WNLA 4U31A 2Q3RA 4GX9A 3MHUA 2JGYA 1GHRA 4L6DA 2D22A 5M03A 3H2EA 3KTSA 4O4VA 3A4WA 3CK5A 1XINA 1JFHA 2RAGA 3MUAA 2GVYA 2OX1A 4AC7C 4EACA 2XIOA 4L6HA 3HPSA 3PJUA 2PURA 1KD0A 3IJQA 4JQ4A 4POCA 2JE8A 2GDVA 2E5DA 2G37A 1RJRA 4FF7A 5LIUX 1E3XA 5AC5A 3GDRA 4H2CA 3ONBA 1MW3A 3URAA 1KA9F 3WH8A 3QXBA 5FESA 1K4HA 1JRBA 1XIIA 4LNCA 3LPPA 3I6RA 3M64A 3QY8A 3E02A 4NAFA 3ZS4A 2F6XA 3W7KA 2RJHA 4ZE5A 1JQXA 1CLKA 4O0QA 3TONA 4ZCWA 3VUSA 4MLRA 3BSMA 4HU3A 4ZBCA 5CGQA 3ID7A 3LG3A 1BF2A 1RP8A 1F5ZA 4WJ8A 3W74A 1PKLA 3ARPA 2Y88A 4GI6A 4CNPA 1K1DA 4X9YA 4CEXC 1TV8A 1JPHA 3CTLA 4O8RA 2DVXA 1MSSA 3W28A 1J0YA 2J13A 2B7NA 2FZ8A 1RUSA 4ZEPA 3PBWA 1VS1A 2EAWA 5BXPA 3EXTA 4X9SA 3WBXA 4ECLA 5A6BA 4BEUA 2GGJA 3S6OA 1F9CA 1J5TA 1X8FA 4X61A 1I2OA 2XIJA 1A5NC 1C7SA 1SGJA 4INFA 3F4VA 2ZUNA 3VD7A 5CJNA 1I8JA 1UOKA 2GSJA 1E4LA 3RRAA 5CPQA 1YDYA 3L4VA 4AZGA 1XKYA 3G1VA 1R9ZA 2I16A 2XVGA 4KCWA 1P0KA 4P8WA 3GDLA 3S46A 3THUA 2X42A 4UQDA 2DSZA 4DHGA 2Z2UA 1QBBA 3T7VA 1WNOA 3C2EA 4FB7A 3CLMA 2BVWA 3BWWA 3CB3A 3AS2A 3DKJA 3PPFA 1XLHA 2PTZA 2WC7A 3LDVA 4HMEA 3IARA 4JQ3A 3VIIA 3WQ6A 4C90A 2CFFA 3EMQA 2HXUA 3NQCA 3R0KA 1L2QA 4H04A 1KFCA 3V1PA 4QG6A 3U5UA 5CC7A 1OC7A 2WSYA 2WNQA 4G5DA 1CXLA 3SCVA 2CBJA 2A4AA 4GXWA 4K39A 3TTEA 3Q58A 3KCJA 2DORA 4ERIA 4DAFA 2FYMA 1QI4A 3G3DA 2FLIA 3AU2A 5T26A 3WH7A 3AO0A 3CO4A 2NWRA 1GKRA 4DUWA 5FA5A 3CZJA 4O53A 3LCXA 3W1MA 3MSRA 3HMCA 2XH2A 4NNAA 2WMGA 3IK2A 4ZB0A 5G2IA 4E38A 2ZYFA 5A3HA 3WDQA 2WYSA 3HGOA 1IEWA 1ZLPA 3PBMA 4QBXA 1XQLA 3DFOA 4GPNA 3WL1A 1KM6A 1VPXA 3NJ3A 4RV3A 1F6PA 2HBVA 3B97A 1QW9A 5GJPA 1VENA 4U5IA 2G8ZA 3MANA 5ABTA 3RGTA 1DHKA 3DEQA 4Q8UA 2P0IA 4ICMA 1JZ3A 1VFTA 4NKCA 2POTA 2XYLA 2YYUA 1AQMA 4JNYA 4KQNA 3UP8A 1O94A 1KLZA 2XH4A 5LSMA 5DELA 2VOTA 1YDNA 1Q5MA 3PTQA 3G1XA 1UROA 1I1WA 1WCGA 3G22A 4B5WA 3LHUA 2PWHA 4IFKA 2IQ0A 3T81A 4IX0A 4R9XA 5DO8A 1HL9A 5I3IA 1EJVC 2DZXA 4JKLA 4QLLA 1HL8A 1M6JA 5G1YA 4K37A 5K3VA 1GQIA 2CZ5A 3TYZA 3MUXA 2OTDA 3R94A 2WMHA 4Y90A 4S23A 3WUEA 4A8RA 1XG4A 1YBQA 4IMDA 3AUOA 4RE4A 3GDTA 1WOAA 1XH1A 2XFYA 2FMOA 2CITA 1V6UA 2E1DA 4GKLA 3MKKA 3V16A 1ZCOA 1W3LA 4LVBA 4Y8EA 4CNOA 1JPDX 1RLDA 3G8EA 3LEPA 1V3HA 2ZXQA 1Z32X 4BQ3A 1GTHA 1DL3A 3TP4A 5C2CA 1TKKA 1HN1A 1M9HA 3UR7A 3OODA 4CVUA 3H7UA 1R3VA 1MDRA 3OB8A 2J25A 1C8YA 5H2ZA 4AU0A 1E4MM 3OQ8A 3N34A 2OSYA 5D9PA 4UFJA 1EDTA 4H9TA 4PGLA 2ISWA 4PMQA 2Y8KA 4GYPC 4PR4A 3IIOA 4HP5A 3CZEA 5HJXA 4GZIA 4S1FA 4CCDA 3WQVA 1UASA 4CNNA 3F4DA 1XM3A 5BU6A 1W9XA 8XIAA 3WLOA 1D3CA 1TQXA 3A6OA 4M6VA 5BXTA 4IP7A 2G3FA 2OEJA 2DW7A 2Z27A 3BZJA 3KWXA 2J24A 2NV9A 3AYRA 1AMKA 1Q65A 5DCEA 1IEIA 3W83A 1DXIA 1RA5A 1PIGA 4GGHA 4E0CA 3ARRA 2DZBA 4DUXA 5A2CA 2OQHA 3WH6A 3NQ2A 2GUBA 4BI6A 5HDRA 3LHZA 2FKPA 3BGGA 2AL1A 1QWKA 5HANA 1EL3A 4XB3A 1LROA 5D04C 1SMDA 3UXLA 3FXGA 1H1ZA 3GC2A 4XZIA 1FQ0A 3ELFA 4AZCA 3GH4A 1V77A 1NH6A 5FAJA 2J6XA 4GQBA 3HFYA 4S3AA 5D09A 1JFXA 2GQ8A 3MTWA 4A8LA 1V6VA 5C9RA 1HJUA 3S5SA 1OHLA 1WPCA 2CZVA 4FALA 2JKPA 3BOFA 1TPH1 1BXNA 2VNCA 1OFAA 2CBUA 1GT8A 4PRTA 4HCDA 4QDWA 3UPWA 3T42A 1QXLA 3Q37A 4ADSA 4PFHA 5TBOA 1OG0A 3BLPX 3NDZA 3V75A 4GH3A 3VABA 1E5JA 4HZMA 3W86A 1S39A 1W9UA 4QAWA 4IG2B 1Z69A 1O66A 3GYEA 4URIA 5D9NA 3N13A 4I5UA 4JTQA 1HVXA 4Z42C 1ONWA 3MW7A 1I1XA 3DENA 3HQ1A 4CVWA 2XUCA 3K1GA 2J27A 4RZ5A 4ZQRA 1Y0EA 3FLUA 2QCNA 5FIPA 1GYMA 4J5NA 2X0SA 4DYJA 5B80A 5A8PA 3ITTA 4DPPA 4LYPA 4MNJA 2Y1HA 3M7SA 3CAVA 3TIMA 1P0EA 5IBXC 3G24A 2P8CA 4MY9A 3TN3A 3SN0A 3ARZA 1JDAA 3SCNA 1CLXA 1QO2A 3CL6A 1KNWA 4R9OA 4PRRA 1WE5A 1OFPA 1C92A 2WM1A 4C1KA 2QCFA 1UIPA 4QIUA 3LMZA 2ZUUA 2KX9A 3H24A 3OGVA 4GI9A 4R85A 4JTFA 3WUFA 5I3DA 4DYKA 1TE1A 4GNJA 2ADAA 4DY1A 3RAOA 3E49A 4ATWA 2CHNA 2PGEA 1KWKA 1J96A 4UQ9A 1XBVA 4AZ6A 3EWBX 4LBUA 2I5QA 1A5AA 3K8MA 4ZODA 4W89A 1TTQA 1OYBA 3STPA 1RJPA 3DG7A 1A5BA 1ML1A 1Q6RA 3QV7A 3CUFA 3SSZA 3TTQA 1NF7A 3RLHA 2QJJA 2X0HA 3CASA 5D02A 2WSQA 4ML9A 9XIAA 5HUOA 5EMJA 1DJXA 2QR6A 3KRZA 2YL5A 2QAPA 3WN6A 3UNDA 3M07A 3DC0A 5F2MA 3QBUA 3PUEA 2OYMA 5E09A 3CUJA 4MFDA 3WENA 1PBGA 2YCLA 1NOFA 1W2PA 4GWEA 4KWSA 3UQNA 5BZAA 1E56A 1KW1A 1DWFM 2HROA 2ZXAA 4DBSA 1UMYA 3GVWA 2F84A 4MJ2A 4PUKA 2PS2A 1I2PA 1XJBA 2HWGA 4PCTA 4H6RA 2C18A 3H4WA 1DV7A 1PIFA 2YDAA 4XBJA 3RM8A 1MQRA 1KM2A 1NARA 3QGAC 4XG1A 4O15A 4LANA 3GAYA 1QI0A 3AS1A 1ZP3A 3UZJA 1SZGA 4FX8A 3UWZA 2Y5JA 3VGBA 1FKWA 2DZSA 4GUHA 4J3UA 2ZX9A 2R94A 3W1NA 4Q8TA 1C91A 1IEQA 1K03A 5REQA 4L64A 3GUGA 2PWFA 1WDWA 2PCQA 3RNDA 2E28A 2I7GA 1AZ1A 3RRXA 1PZ3A 3RCYA 1UIOA 3R6IA 3K8LA 1VEMA 3EDDA 4AAJA 3W7RA 5EKYA 3E0IA 3D47A 2WMIA 3SFWA 1JYVA 2F2KA 1PKNA 4AIUA 2C14A 5AZ1A 1J2BA 2OSXA 5FJIA 2QDGA 5JH1A 1NFGA 1NQKA 4NI3A 4EE9A 2PC4A 2INZA 1F8MA 5I2UA 2AAAA 2WZTA 1EOKA 4JFWA 2QVNA 4RPPA 4KCTA 1QNPA 3TYBA 2ZZ3A 4I9AA 2X1IA 5HJLA 2HTMA 3GWQA 3PANA 1PVNA 1MQQA 2X2YA 2O4QA 4MNKA 4MUZA 3D3AA 2PSNA 4UFKA 2VFIA 4ATDA 2GJXB 1QOQA 3UZWA 2GGHA 1LG1A 3GU9A 4G8TA 5DLCA 3VMPA 3W88A 1U2YA 5D2WA 3UG8A 2WJFA 4FSAA 4NZCA 3H2CA 3ITVA 3UETA 3KEHA 3VXGA 1UQYA 3TN6A 4BS0A 1OT1A 1OBAA 4FLSA 3M0ZA 2Z24A 4J1OA 2DDXA 4FAMA 1U30A 3EPMA 4C5YA 4K1GA 2DSWA 3B04A 4BI7A 3TNBA 4QFUA 4DN1A 3IRSA 5JIWA 3LV5A 2R1MA 3GC5A 2Z1XA 1KGWA 2BXYA 2WPBA 1V3LA 3CM4A 2ZKMX 1V3IA 3DC8A 3RR1A 1V0NA 4M7TA 3T0BA 1V0LA 4XAYA 4GC3A 4F0LA 4DBWA 2WMKA 4Z0SA 4V33A 3VIHA 1M7PA 4PN2A 1S3HA 4A2SA 2PP1A 3NG3A 4PUJA 4NZ4A 4XO6A 3PSWA 4MZ1A 1V3JA 3NQBA 2RDWA 3BAJA 1HKKA 5I6SA 4ZO6A 4OE7A 3KL3A 4IMFA 3BGJA 2OQLA 4TV5A 4DBUA 3HPXA 1S38A 3DESA 2R6OA 3W84A 3QLDA 1SFLA 3QV8A 4RNIA 3W85A 3BJTA 1WKDA 4S3EA 3UXAA 4A22A 4AMAA 5I5RA 1AJ0A 1MYRA 3UWYA 5CLTA 2VR2A 3C2YA 1ISVA 4HJWA 2W92A 4U2ZA 4XIAA 2ABAA 3BCJA 4ORIA 1GOWA 1SO6A 2ZC1A 3W7EA 3R13A 3GTNA 4HHPA 3ZT6A 4H9YA 5DBTA 4H9VA 1DJWA 3DBNA 1VFSA 2Z26A 4PUNA 1V5XA 1UH3A 4JFUA 2PDJA 5TNVA 3SURA 3PWAA 3IK4A 4ICCX 2OB3A 2QJNA 1RVGA 3WLNA 4H9MA 3N6JA 2IPFA 2I17A 2DVTA 1SZRA 3OLEA 4HU4A 2WMJA 2ZVIA 4C60A 3MC5A 1TE6A 1F6YA 4XX6A 1FHDA 3O9NA 1A4LA 3IGSA 1YDOA 1TV7A 1HKMA 1DEDA 2QXWA 5LIXX 2W3ZA 2NXIA 1XIJA 3HMJG 4JTSA 2BV9A 3ZFHA 4AF0A 3WLRA 4ACYA 4R34A 3NQAA 4PMUA 3G2GA 2AKMA 1V51A 4QEEA 1RD5A 1RAKA 4EKJA 3ATYA 5IXEA 3CMGA 3SCQA 1KM5A 2TRSA 2O9OA 5JU6A 3MWAA 4PL1A 1UBPC 3OBEA 1PHQA 3P8IA 3IVTA 5T8GA 1W1YA 5BMXA 4F0KA 1AQHA 4IGMA 1OGSA 1RCXB 3BZGA 4ZOCA 5CC3A 4KFNA 4EAYA 3HV9A 4JKKA 3I6EA 1A5SA 4JYDA 3ARTA 2QCDB 1DVJA 4R7WA 2ZRUA 1W3HA 4PBEA 3VIMA 3BW2A 4HGXA 4OQVA 1M53A 2FHBA 2VRJA 2YOCA 1FWHC 3KP1A 1CZ1A 2W79A 1MW2A 2BWGA 3OEXA 3THDA 1IGWA 3G1FA 4AD3A 3AJXA 3LENA 1SZNA 4XUGA 3PF3A 2FZBA 8TIMA 3PZGA 1S2AA 1NEYA 4BF9A 3W22A 2VVNA 1VIWA 3VNYA 3I10A 1G69A 4DWSB 1YTKA 3OP2A 1BG9A 1KQYA 1E40A 2XHYA 1BWLA 5BYWA 1P6CA 1R46A 3TEVA 2VDIA 1XYAA 4FOUA 4S3FA 2QUNA 2Z1BA 5BXRA 1XLFA 3C8NA 4J28A 3G1HA 4H7CA 3PZOA 4AZ5A 2O55A 4Q8NA 1QK2A 3TYAA 2QUVA 3SB0A 3QZAA 2OXNA 3O6AA 1JDFA 3JZEA 4OUEA 1R7AA 4GVHA 1RCOB 3CNYA 2XPKA 2QJGA 1BYCA 1TV2A 2GVGA 3UG4A 4GHRA 3B9EA 1IZCA 1HG3A 4J27A 5A94A 1A3HA 1OZQA 3AMKA 1X96A 1B30A 3VGGA 2FDMA 1DP0A 4HU8A 1A3XA 4I9TA 1SYTA 4WLCA 1LF1A 1RHCA 4JQ1A 3BV4A 4IJCA 3DYPA 3LB0A 3GUWA 2QEZA 3HO8A 3TVAA 4UTJA 2C79A 1TZ7A 2ZRXA 4DXKA 2QF7A 4GI8A 1A80A 1X1ZA 3U6WA 2VEFA 1R38A 2EPOA 2VD9A 5XIMA 3TJLA 2TMDA 3WLKX 4IF2A 1I4NA 1KXQA 3I7SA 1NDWA 3KL5A 4XZBA 4HBKA 3K8KA 7CGTA 3WELA 4YXGA 2FFIA 4MGGA 1TO3A 1RZMA 3REQA 4X2PA 1EX1A 4NP7A 4X0NA 2EJ1A 1QFEA 2XM2A 3LCHA 2CWXA 1X6LA 2SFPA 5C71A 4AWEA 5EYWA 1G01A 4A3HA 4DWDA 3G0XA 3HF3A 3XIMA 2R1NA 1XRSA 3KCOA 1F6KA 3T55A 4KRZA 3RG6A 3GW3A 3W7DA 2MUCA 2WAGA 3VX1A 4Q4OA 5DQPA 3A12A 3C2FA 3ZM8A 1CGUA 2FTPA 1P48A 4QRNA 1ZU8A 3TJXA 1IR2A 1QOPA 1PKYA 2DV0A 1GOIA 1TQJA 4ZGYA 2FJUB 2ZXDA 4H2HA 3PUOA 2NV1A 1FCBA 4TU1A 3KUMA 4WXZA 3RO6A 1EO5A 2VDHA 4NJKA 2YR1A 2DIKA 1K70A 1LOSA 1IXPA 4N7QA 3FA4A 2PBOA 2WWCA 1R3RA 4OBTA 3WJSA 5F2IA 3VA8A 4V1YA 4DO5A 3GHUA 4DLFA 1KFJA 3ZQ9A 1UPMB 2PDXA 1E6PA 1GYNA 4UNLA 4LOCA 5I3FA 4CQ8A 2W91A 3U2CA 3W1RA 3NQEA 2A3AA 4XD5A 3OZPA 3ARXA 4ZB5A 3KOFA 2GJLA 4D6IA 2HPIA 3KE0A 3QC3A 3DXIA 4EPBC 4NQ1A 4MKNA 2R14A 4Z1BA 1JAEA 2NX9A 1O4UA 1D3GA 4JL1A 2G95A 4K8HA 3N9RA 4UTFA 2EPKX 3WQGA 3QH2A 4J3SA 4FNRA 3B40A 1N2VA 2Q09A 3UXKA 3DUGA 4C1LA 4HMCA 1R8LA 1SM9A 5T9BG 5CZKA 4FNQA 1X6UA 1V03A 1RJQA 2VEIA 3CQJA 3S47A 2WSRA 4YYFA 4GJIA 1L9WA 3HPZA 1OT2A 3VNZA 4Z2KA 4JN8A 2OX4A 4WUIA 1OM0A 3THQA 5LHFA 2B4GA 3R2GA 2YW3A 2XVPA 2YBTA 3S5ZA 1E72M 1JGMA 3DFSA 3I7RA 2X41A 4AB4A 4EP8C 3WY1A 2VQUA 1FWTA 4NZ1A 2DH3A 4Y6GA 3B9NA 4GO9A 3P0WA 3R1ZA 3WH9A 1V7YA 4F4RA 3UERA 3DOPA 5CPSA 3BAYA 3RHGA 2RGMA 4XKMA 2E9LA 1G9HA 2J7EA 4Q4MA 2D3NA 2XSAA 3N2CA 3SR7A 4H6EA 2QCEA 2BFGA 5D2TA 4W86A 1GWJA 2NQZA 4N4PA 5K9CA 3L0KA 5DEZA 2DT2A 4GZ7A 3W73A 3A22A 2Z1SA 4AISA 1XIBA 2NZLA 5FACA 3GR8A 1RH9A 4JIIX 3IANA 3U8GA 4I90A 2BMBA 2VZVA 2CHOA 3GIQA 3PSVA 4MF4A 4JIEA 4H8VA 4PMVA 4E2BA 3VOHA 4GQGA 3B06A 2GGGA 4NT0A 4AWSA 3FJLA 1VGAA 3LTSA 1XIEA 1FCVA 4PRWA 1KWGA 3HZ3A 2J7FA 4B5UA 3SUUA 4Y9NA 4YTUA 1OCBA 3KHDA 3PZ9A 1CXFA 2CLEA 3NWRA 2ASHA 1T41A 1AH0A 4RJEA 1BTCA 3MBFA 3DKLA 3OVPA 5G4EA 3TW6A 4KETA 3P5YA 3QF0A 2X7WA 3NQMA 4GY7A 2DFAA 4M6QA 1JCXA 3WJWA 4LB3A 1S3TC 3D0CA 1Q85A 3TA6A 3WO8A 4UCFA 3HN3A 3GK0A 3R58A 3WEOA 1LQAA 1V93A 2C13A 2V2CA 5ABFB 5MF5A 1JQVA 1WB0A 4YS1A 3UYIA 2OO0A 4H3DA 1JDEA 1U83A 3LHVA 2ZX7A 1K77A 1B2YA 4MJ4A 2CPUA 4MVAA 3PP7A 2ZX6A 4P5UA 1M04A 3GTXA 1IXQA 4TIMA 1TELA 2PDIA 1I9CB 4I7VA 3DZ1A 4GIRA 2BGQA 3BK0A 4ZOEA 3CMFA 4O0ZA 1BG4A 2CZFA 4MWAA 5DMLA 1TJRA 2O0TA 3P5ZA 2X09A 3ABXA 2CLIA 2J8TA 2XFFA 1EXBA 5AOUA 1UZ4A 4LQ1A 4HVXA 1VFHA 3UZXA 2GZXA 3ABZA 2HDJA 2A2IA 1V02A 2QDDA 4E6MA 4XAPA 1OK6A 1VP5A 4YTQA 1EUAA 4HMDA 2XH0A 4PTVA 1SR9A 3S2MA 2WLYA 4UTUA 3CV2A 2HCVA 3DI1A 3SUVA 2WZHA 5EMYA 3S83A 1H1YA 4L80A 4ZQPA 3AXXA 1EKOA 3ZVHA 3MHGA 3IIZA 4N2YA 2E3ZA 3BSHA 1R7OA 3E74A 4I3GA 3T05A 3AMDA 3EWUA 2X05A 1EGZA 1JNDA 2L5HA 2X1SA 4TX9A 3RCMA 1YQ2A 3GDMA 3BVJA 3C8FA 5CPNA 3A47A 5D37A 5G2HA 3VUPA 3WQPA 1IGSA 2ABBA 3ARYA 3CIVA 4DM1A 3IUIA 1G94A 3U7BA 5HWNA 4GQ0A 1MRQA 4PBGA 1O95A 6ALDA 5EGRA 4LS2A 3RPMA 4N02A 4B5XA 2Y7EA 2V5KA 1S5TA 5AHLA 3QOKA 1UKPA 2WVVA 4HMNA 1P6WA 3N25A 4BA0A 2GWGA 1X98A 4QE1A 2DU2A 2P50A 2QDEA 1YRRA 3MO4A 1XPYA 3GH7A 2BDQA 3WL0A 1KFEA 2V3DA 3RJYA 2W66A 2QCHA 2E67A 2X16A 1NWUA 4UTTA 1PDYA 3MI3A 1P7TB 3E0WA 4PCPA 2PRMA 4D6CA 3W81A 4WEVX 3LQGA 2E6YA 3RDKA 4C6PA 3WDPP 3ES7A 4H83A 1UR2A 1SO5A 6A3HA 2C1IA 3VMOA 5FOOA 2XIIA 2VC9A 4KF1A 3UESA 2AOSA 3H2AA 4RL3A 4GUIA 1YXCA 4UIOA 1I0DA 3UBPC 4Y2WA 1EWDA 1EH9A 2PWUA 3WNNA 4DM2A 2A3EA 5KETA 2O7SA 4W7UA 3N73A 2EPLX 1OJXA 5U7SA 4IPJA 2YLLA 4MFEA 4ERGA 5G4WA 1JNEA 2Z28A 1QDSA 3SCOA 3KTCA 4D6GA 3QHNA 2PDMA 3ZYZA 4PTDA 1PCWA 3UNTA 5HMEA 3V0SA 4L9ZA 2H9AB 3EB2A 1N8IA 5AC7A 4QISA 3HFTA 3ECQA 4O18A 1VPQA 3FYYA 3THAA 1OX4A 3P62A 4B9YA 3UWWA 2PWDA 2V5CA 1YTEA 4GZJA 3USBA 3QR3A 3LHYA 2WV8A 4CCZA 3VCRA 3W1LA 2GVEA 4JAWA 4LH8A 1Q6CA 2NXGA 3M5ZA 1HKWA 5EPDA 3PHAA 1RPKA 3LRMA 4RKAA 4ZE4A 4EWJA 3E12A 2P0OA 1K7FA 2DQXA 2HS8A 5DFAA 2PDKA 1FWRA 1XX1A 1NQ6A 5CBIA 4H6KA 1H61A 3STFA 3W76A 4HCLA 4QG8A 3TKFA 1NU5A 1E6QM 1HKJA 2ZTJA 3LRLA 2D73A 3E2SA 1TIMA 2POZA 3N3MA 1K8ZA 4Q7IA 3M0LA 1US3A 1J6PA 2W67A 4S39A 1GNXA 3VDGA 3VOFA 2HVMA 2VDGA 1KKOA 3AWOA 3RU6A 2WBKA 2D0FA 3SQLA 3POHA 2WJZA 3PTKA 4B5SA 1W9BM 1EFZA 3AHYA 4OBRA 1LG2A 2ZZ7A 1FCQA 4IFOA 1KXHA 2JQXA 3MMDA 3QV6A 6TAAA 3UJEA 2WJDA 3F2BA 3SECA 4N0RA 5CKSA 3UFYA 3W1XA 5GJNA 3VMNA 4B15A 3LNMA 4RDWA 1GQJA 2OWCA 1I75A 5A2BA 1CI1A 5HNRA 1W8SA 4GLEA 3DFPA 1AW1A 3WNMA 1K8YA 5LIKX 1GJPA 3EXSA 1CCWB 3N4AA 1BSIA 3QZEA 3VKJA 1UR9A 1WZAA 2UY4A 4LGXA 1ZBVA 2GDQA 1XUUA 1JYXA 3VI2A 3A21A 1GZ1A 3PG8A 2CZDA 1EA0A 1SFTA 1UH2A 4W4QA 3BLLA 4XO7A 2TAAA 3VGEA 3MU7A 1HFBA 1IEXA 3CMJA 2PTDA 1ZHAA 1K8XA 2E40A 1XRFA 4NILA 3SSJA 2WKJA 1K9FA 2QDHA 4W9TA 4W7WA 5FJTA 2HPMA 1DJNA 4NZ3A 5A8MA 1DIDA 7REQB 2CERA 2JGQA 1ZBCA 3QW3A 2QUUA 1CDGA 3NPXA 5GPRA 2OMAA 1SUXA 4R88A 2CESA 2V2HA 3CU2A 4XQ6A 3Q65A 3UY7A 1EC8A 1DJYA 1I2NA 3APGA 4JTIA 3NGFA 4Z2LA 2UWFA 4DX3A 2QULA 5BMWA 3T2PA 4J35A 1C8VA 1CB2A 1WO2A 1KXTA 4I9JA 4DWSA 5FEZA 3MI2A 3H2NA 5LNSA 3EYPA 5DRIA 1B3XA 4UTHA 2Y89A 3QLLA 2XINA 3L65A 3PZVA 3I3EA 1K02A 1MUMA 1QNRA 3F5JA 3G1AA 5L6UA 1FVPA 1MEWA 1UR8A 1HJWA 3WKZA 4TVCA 1MVYA 3E3HA 9RUBA 1QVBA 3UPMA 1UOZA 3N2OA 4H6QA 3S3GA 4JYEA 4TV6A 5KZMA 3T40A 1PX8A 3DG6A 1CENA 3SJNA 2V63A 2ACQA 4C7GA 3U4AA 2EKGA 2GQ9A 1A49A 5C0QA 3DHPA 2KZHA 1EJSC 1PE1A 2INEA 1TA3B 1IE7C 1GCYA 3UR2A 1JZ4A 1ISXA 1HKIA 2VM8A 3M5YA 5CQ1A 3U4FA 5HATA 4ZA0A 3E2QA 1IV8A 1SZEA 3G0SA 3IUDA 3P93A 1Q7ZA 1IZKA 4RE2A 3WUBA 4MY1A 5T9CE 2OOGA 3WQ8A 3EKGA 3SIZA 1YE4A 1AL7A 3HJZA 4NUWA 3TZNA 5A6MA 2V5JA 4W5UA 3FNDA 1KV8A 2FTWA 3DDMA 3MUIA 3VKBA 3SRFA 2WCGA 3VGDA 2PDYA 4M19A 3UYCA 4HYWA 4RW3A 5CPTA 4D8LA 3FOKA 4HNTA 2PDWA 3GHSA 3VKDA 2BSLA 5KZEA 3KHJA 3GXDA 1B9BA 1UWIA 3K2GA 1EOMA 3BL3A 2WZEA 1FHVA 3CUXA 1LRQA 2ATMA 3TQKA 3CHDA 4JIHA 4DPQA 4CD8A 5HUPA 1TPVA 4XTDA 3CYVA 2AQVA 3A3WA 3MMTA 4PMJA 3AICA 3P14A 4LY8A 1X1NA 5AECA 3MQTA 1YW1A 4NVTA 1VRDA 3KVJA 4QQUA 4F8XA 3P0XA 3U48A 3WEMA 3B8WA 3CS2A 3LERA 1C93A 1VFOA 3LNPA 3IPWA 3CQKA 4LT9A 4QDMA 4DXVA 2CLMA 3V5FA 4P7NA 4NL1A 3MVIA 1BHGA 5BNKA 4NRSA 2NVCA 2TODA 3MCNA 3BQ6A 3QRHA 4WGHA 2GOUA 4WVXA 2F9RA 3QVQA 2B0MA 1TTIA 3MP5A 4E4FA 3ERPA 1OIFA 3GX9A 1UP0A 2VGFA 2HMCA 3L68A 3M0MA 1RXOB 4GRSA 1UCWA 1CW2A 4LPCA 4HIBA 4UOQA 4GVGA 1DHPA 2OEKA 3CC1A 3NO3A 5AZ0A 4A29A 3M47A 1WAWA 1QO5A 1XKJA 2QV5A 3GNNA 4FOJA 1TJ1A 2PMQA 4UMBA 4AZHA 1A50A 3COTA 4NYUA 3OZOA 5XIAA 3PN8A 2BVDA 1SSDA 4RUBA 3ES8A 2XGZA 7ENLA 1R87A 2YBUA 2VI0A 1FWWA 1OF6A 4O12A 1K6AA 1DPMA 1EF2A 3ZWSA 3KBJA 3O63A 1XR2A 2F6UA 1AD4A 4QJ1A 1ZSXA 5A2AA 1FWGC 4EXAA 2PC8A 1ADOA 1EUNA 4PB4A 1W17A 2OYKA 3GXFA 1PWMA 2VEMA 9XIMA 2OSWA 2ZDSA 1N7KA 3WJXA 1LWHA 3QEZA 3I3BA 3H4XA 2OYLA 1TRDA 1XDMA 1M68A 3KOYA 4E2OA 1RR2A 2G3IA 3GBEA 4XZMX 4KCVA 4GCAA 5HWJA 3H6OA 4Q4PA 4F40A 4CLMA 4QQ3A 2PEVA 2FZ9A 4DO4A 1LQ2A 1H0GA 1XCXA 5A6AA 1EJ7L 1POKA 2VZOA 1CTNA 4U3AA 3OZYA 3DFQA 3HM7A 2A3LA 2VRQA 1OCJA 2FDSA 1ITQA 1K9EA 2G0WA 5IDZA 1TWDA 4UQCA 4QCFA 3TOPA 1TYGA 3EXRA 1RV8A 3IVUA 1W56A 4DB7A 2R82A 4XZNX 2Y7FA 3IIXA 3C52A 2HBXA 4KIEA 3WBYA 3EOSA 3WLPA 3L2LA 4I9MA 1E43A 1J0ZA 5ABHA 3VDHA 5FF3A 3QSTA 1XICA 1C8XA 2YJQA 1R3SA 2J9XA 1MQPA 3DN5A 5E0CA 3GC4A 3G6MA 2WCSA 2CKSA 3WH5A 2G3JA 2WQDA 2QGHA 1PYFA 3C6CA 1EEXA 1UZ1A 4MIMA 3GH5A 4W7VA 1J0HA 3QYSA 2V8ZA 4GOAA 2A7RA 1F74A 4NAEA 4B5TA 3GG0A 1W6TA 1H51A 1R3WA 1B3OA 2IKJA 3FHAA 2VFEA 4BWLA 2YCEA 1FP9A 1BLIA 1H09A 3KOZA 2QCCA 1Y65A 5A6JA 2AMGA 4GYKA 3PWGA 5KEZA 1PYMA 1RBOB 2NX1A 2VC5A 3CQHA 4US5D 4KWOA 4NZJA 2WLZA 2GJRA 4XZ9A 3SY8A 3D5HA 4MB3A 4LV9A 3T08A 1SZFA 3QC0A 4IQDA 3PC0A 1SJCA 3EPOA 4K38A 4LYQA 3WBWA 5CPOA 4DJDA 1GOQA 4HCHA 3CTTA 3RMEA 4CQDA 4MTVA 3S2JA 3H2FA 4M5PA 2GDUA 4IM4A 2OEMA 2JF7A 4DIAA 3OG2A 3A23A 4GNKB 2BGNE 3BMXA 3ABQA 1UWQA 4L1GA 1SFJA 3S5NA 3KRSA 2R9RA 4MB1A 3LV6A 1JAKA 4IQEA 3T0CA 3GVRA 4OBSA 2Y63A 1TUXA 2WB5A 1KTCA 2DSUA 2GK1A 4DNHA 2PTYA 1W3KA 4GABA 1XGEA 3LLFA 1W5QA 2V38A 2XISA 2Y24A 5C9ZA 1DE6A 2ZXBA 4F0SA 4IFKB 3ZWTA 4B91A 1L2UA 4JTCA 2HK1A 4HNNA 4S38A 2BLEA 4J3XA 1BGGA 1YE6A 1Z41A 1MNSA 1F4HA 1XPGA 5AVNA 4UFLA 3UJSA 4UOJA 3LK6A 1A47A 3O1NA 3UJ2A 5K4XA 3WQDA 4B92A 5EL1A 2E6FA 2O92A 4O14A 4YHGA 4EANA 3E6EA 4CD4A 3ABOA 1YBQB 1JZ8A 2B7QA 1NP0A 2WNZA 2QV4A 3M16A 3F5KA 1AMYA 1W5NA 3BDKA 3FEMA 2OKOA 3WD1A 3VDCA 4GBDA 3CUHA 4NX5A 1JUKA 2UY2A 1PL9A 1TV4A 3GFZA 3PUGA 4MHBA 3WIJA 3ITOA 2PBGA 2YA1A 4O1BA 2ZUWA 1CT5A 4ZQCA 4Z2GA 5H1WA 5I06A 2VHLA 3WX7A 1AW2A 3HU7A 3ZVIA 5D38A 2WZMA 3B3DA 4UOZA 1TMQA 2FPYA 3DCPA 3R7MA 1L6GA 3KAOA 1J93A 1JZ2A 4CCCA 3L4XA 1W31A 3MUCA 2XFWA 3MCOA 4YLWA 4F9JA 4PMNA 5TF0A 1HW6A 3E2VA 1TPB1 3NZGA 1HL2A 5D9OA 3W37A 4C6FA 4DLMA 1GYLA 1UD6A 1SJDA 3W2KA 4NG3A 2NQHA 5I02A 1RQBA 4K3ZA 3ITYA 5IHRA 2JFEX 2BB0A 3U2ZA 2FB3A 1A0CA 4Y9MA 3H8AA 3V7PA 4RV8A 5DY3A 3BH4A 3TX9A 5D8WA 1LT8A 1V79A 3HGSA 5M1TA 2HJPA 1BFNA 3EPNA 3NO5A 4AZCB 4XBSA 2Q01A 5GNXA 2XZ7A 1XLBA 3VAVA 3SCTA 2DZPA 1ALDA 5CG0A 4O1DA 4CKQA 5AYIA 1KTNA 3MV11 4OJYA 3OA5A 3TSDA 4DO7A 1SW7A 4AD2A 1R30A 1F3XA 2ISSA 5A5WA 4CU6A 4S3GA 3PFRA 2J77A 1S5NA 3OVQA 2OQYA 2YB4A 4QHRA 1YXDA 1LM1A 2BVYA 5HQMA 2PA6A 4K7VA 2FHCA 1BVWA 1T7LA 1W32A 2WXDM 2PD5A 4WY0A 2YIHA 3W3OA 1XSJA 1DQWA 3AS3A 3OGSA 5ABGA 4F3HA 1MUCA 2B7PA 1QPNA 4DO6A 1ADSA 3N29A 3M0JA 2NT0A 4L9XA 4XISA 1TJPA 3PWIA 1E0TA 2HE5A 1TR1A 4HK5A 4PTNA 1RBLA 4H4IA 3W27A 1FDYA 3B05A 4HU0A 5A6SA 1XLCA 5HNTA 1HJSA 5BWAA 2AKZA 3O0KA 3DX5A 5CJMA 1DJGA 3E0FA 2QGYA 4JTUA 2VEGA 3EX1A 1E0XA 2PLMA 4QR6A 4L61A 2QUTA 1C9DA 1FWIC 1H1NA 4UUIA 4GA8A 1AZ2A 5D2VA 3VKAA 4FO4A 4LFYA 2E09A 1SVDA 3C2VA 4B16A 3SCPA 2GWNA 1BKSA 2E9MA 1YTDA 4Q3MA 3VM7A 3A9BA 3GIPA 2REQA 3UGRA 3CXOA 2PDBA 1W91A 4Z1YA 1W1A1 2XDFA 2WNWA 1TG7A 2YXGA 3WZ0E 3LCFA 5BOEA 4ZZ9A 4FZIA 1M5WA 4TUFA 1QWGA 4MB5A 1OCNA 3L23A 7REQA 3SBFA 1EJWC 5LZLA 4KPLA 5JH2A 3KBNA 3LRKA 4XK2A 1MXDA 2QKFA 3LTPA 1QNQA 2VCCA 2XN2A 1PTGA 1V8EA 4MWAE 3KP0A 4LX4A 3WJZA 1ODUA 4WKAA 1GVOA 1JZ7A 1FA2A 1BGAA 3PBUA 1A4MA 1G4SA 1S1RA 4I6VA 4K2SA 3V5CA 4LCQA 3QR0A 2WHKA 2OWXA 5BCAA 4X63A 3WFAA 3PZNA 1V02E 4N6EA 3CZ8A 3RLGA 3ZO9A 1XD0A 3LGGA 2BZNA 1VAHA 4MKVA 4L56A 3LXCA 1WXJA 1B9ZA 3NL6A 3QHMA 3EWDA 4UR8A 1BWKA 4B5NA 1P1XA 3WMBA 4DZ5A 4Q8QA 1LRTA 2Y8UA 2WHJA 3EB4A 2VCAA 1OWQA 2YCLB 3CAKA 2Y0FA 3M44A 1SJBA 2GGEA 2GPTA 3GB6A 2H90A 2O9TA 3WYZA 3G18A 2I9UA 2CLOA 3FCPA 3H26A 3M0IA 3U57A 2H8ZA 2JALA 2ZRZA 4P7QA 3AU6A 1KFBA 4NJGA 2ATSA 4O16A 1T8XA 2BOEX 3VC6A 3P6LA 1W0MA 1XCFA 3BG3A 3AIWA 3VINA 3GXPA 3IIVA 4DZHA 2V5LA 1J12A 3GU2A 3B0UX 3QFWA 4GI4A 3PTDA 4WR3A 3VNKA 4D8ZA 1DE5A 1Q4WA 1JUBA 2UY3A 1R2TA 1Q2SA 5REQB 3TROA 1NF0A 3LM7A 4XKYB 3GO2A 3HGRA 1HVQA 4IIBA 1AFSA 1FXQA 3HA1A 3ZT7A 1PTDA 4E4PA 1VEPA 3ITCA 3JUGA 3QSRA 1YYAA 1XFCA 2XWEA 3VFLA 3D6NA 3RX3A 1QMLA 3ZJ7A 4YTRA 3IVSA 1UD8A 2E68A 3ATZA 4D6DA 2DSKA 1SW0A 1KCXA 1CPUA 4A3YA 1W1B1 2J8FA 4DF2A 1X38A 3GVGA 5U4NA 4AFYA 4N6FA 2ZX8A 4Q6XA 5FEPA 1NJJA 5DBUA 2VX4A 4FF5A 4IGNA 1UWUA 3WLSA 2Z29A 3N12A 3TJIA 3MMWA 3YPIA 1ZQ5A 3H55A 1IYXA 4HOXA 4I8YA 3N2MA 4QM1A 3WQ4A 1W5PA 3NXLA 3U3HA 4JY9A 4X0VA 2P88A 2QIIA 3C0SA 1VBGA 4P8VA 1JR1A 3E2RA 5I77A 5JVLA 1OFDA 1CXEA 1KFKA 5B7ZA 3NA8A 5AYYA 2VYOA 2PDCA 4MZ8A 2FGZA 1GJWA 4CQAA 1FXPA 5BROA 2GLKA 3LCLA 3AQUA 3GHRA 4IQJA 2VGBA 3UA3A 2QVHA 1GVEA 4UTMA 2XWDA 3MKCA 1HJVA 5CCZA 1W3TA 1JCNA 1V0MA 2DQWA 4QEHA 5LA0A 4WJEA 4NRRA 1MMFA 5CZTA 2DUXA 5HJYA 1QI3A 2UZ9A 1LZOA 3QZ6A 4DJFD 3C61A 4D8AA 4F2UA 1AK5A 1Z89A 3C56A 2XSBA 2FJKA 1GEHA 5FF0A 3AFBA 3STEA 3BW3A 1PS9A 3LBMA 3BO9A 5HR7A 1DXFA 2PDGA 3ABSA 4E2DA 2YCIX 2VO5A 4KGLA 4KT2A 4GG9A 3RITA 4W8AA 2FHFA 2QAFA 3CWHA 4MWAC 3A3XA 4FR6A 3M4HA 3BLIA 1B90A 2J8GA 1X6NA 4RCXA 4AQLA 3DAQA 4REQA 3PZIA 4LVFA 4Z1CA 2PGFA 1MFUA 4RPQA 3FYPA 1SR0A 4RZBA 3H7RA 5D03A 4JBRA 5D30A 1NIUA 1R3TA 3NR0A 3PJXA 5I78A 4P7LA 3D46A 1U1HA 5LA1A 1EEPA 1LOLA 2VMFA 2B31A 5J5RA 3SCRA 2KAUC 3W7QA 4L7ZA 4OIFA 1E73M 1JZ5A 4S3CA 4FXSA 2EJAA 2EKCA 3AAMA 3F03K 3L0GA 2ZE0A 2D0GA 3LCGA 1ZCCA 3GD6A 5EMLA 4A6GA 1TRIA 4V15A 4MOZA 1H7PA 5CEWA 3FVMA 1WDRA 1FHUA 4UQEA 1ONEA 2VEKA 3FXYA 3EWYA 3I65A 4L6OA 1OADA 1M41A 3UW6A 4ORMA 4JFVA 5KSWA 2QLYA 4N9EA 1CNVA 4HHLA 4DXXA 1H2JA 2UY5A 3LA4A 1SO3A 1D2KA 3CEPA 3B0VC 4JHZA 1T96A 4K36A 1TWWA 3NYDA 4DYEA 4JCLA 2VURA 3CO8A 3WQFA 2Y4SA 3U2OA 1V08A 3W6YA 1JGIA 1S2WA 1R9XA 1W1TA 1OX5A 1IF2A 4AD5A 4IL2A 4UTTC 4UR7A 1UWRA 1THFD 3CAWA 3RIKA 4U2YA 3VZXA 2ZZ4A 1W1PA 3AXIA 4DEFA 2OLAA 3RF9A 4IHCA 4QITA 1M1BA 1QOXA 4LC8A 1HP4A 3EOUA 5MKGB 3MSYA 1NWRA 3EA3A 1I2RA 4AF0B 4CU8A 5K4ZA 4JPGA 1FH9A 3L5LA 4GISA 4O0KA 4EPDC 2D69A 3AXKA 3DHDA 1BTMA 3EDFA 2CHRA 1JXKA 4JGDA 3PZMA 1KRBC 2PDPA 1ZUAX 3SGZA 4MY8A 3KS5A 4YWIA 1H63A 3WF2A 5A6TC 1B3WA 5I03A 3OIHA 3GG7A 1C9WA 2X1RA 2D20A 1XH2A 4WGXA 1VH7A 5HINA 4PYSA 4W93A 2HEJA 1E71M 3XISA 4IIFA 2RJGA 1RQHA 5E70A 5A69A 3AIUA 4YTTA 3CZGA 2NVDA 3SIMA 3NFUA 1MO0A 2RDUA 3ITXA 1TV3A 2B81A 3VNLA 5H8UA 3C0QA 3K1DA 4M7SA 2GVJA 1A5MC 1ECEA 3O16A 1XP3A 4NXSA 3F2DA