5C2XA

Crystal structure of deoxyribose-phosphate aldolase from colwellia psychrerythraea (tetragonal form)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
246
structure length
246
Chain Sequence
SDIKAVAQRALSLMDLTSLTNTETDQEIIDLCRQAKSPAGETAAICIFPRFIPVAKKALKAQQTPHIKIATVTNFPQGNDDLDIALAETRAAVAYGADEVDLVFPYRALIQGNETIGFDMVKVCKQACSGNAKLKVIIETGELKSEELIRKASEIAINAGADFIKTSTGKVAINATPEAAKVMLTVIKNKNTAVGFKPAGGVRNADDAAIYLDLADNILGNEWADANHFRFGASSLLISLLDTLGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Deoxyribose-phosphate aldolase
publication title Trading off stability against activity in extremophilic aldolases.
pubmed doi rcsb
source organism Colwellia psychrerythraea
total genus 96
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c2xA00
4O53A 2OMAA 1RVGA 1JULA 4N4PA 3C52A 4MJMA 2CLFA 4BI7A 3HJZA 4NXKA 1OJXA 2NXHA 4JDBA 4IGHA 4MKNA 4LS0A 2CFFA 4K7VA 4UNKA 3P7YA 2QR6A 5HWNA 2CU0A 2G96A 1S5TA 2YCEA 4EOUA 1UUOA 5AHNA 1Q6LA 4JTIA 3LBMA 2C18A 4X9SA 1DOSA 1LBFA 1F6KA 4Q32A 4IPIA 2ZZ6A 1MXSA 1XUUA 2GJLA 2DZXA 3HF3A 5DXXA 1G7UA 3OEXA 1ZAIA 3NQ8A 5AC8A 3B05A 1LRNA 3C61A 4ZQMA 3TQ0A 1DV7A 1C8VA 1KA9F 3MP5A 3DI1A 4JTLA 1O5XA 4QM1A 3TMLA 3DFOA 3N2MA 3LCWA 5TBOA 2QJGA 2VC6A 3WK3A 4AWSA 2CZEA 3W71A 1OF8A 2IQTA 4O15A 4XWUA 1QOPA 5DCDA 2VKZG 1XDLA 5AHEA 1M7PA 1TTQA 1X6UA 3CWNA 2ZZ7A 3U6WA 3C6CA 2WKJA 4WY0B 4AB4A 1BEUA 3EKLA 1PVNA 3HG4A 2GUUA 3NQ7A 5F4WA 3L5MA 2Y62A 2RDTA 1M7OA 4UTWC 4FNTA 4RLIA 5DY3A 2Y7FA 3TV8A 2ZZ4A 1AG1O 1OFBA 4MZ8A 1TPC1 2QF7A 3T78A 4YWIA 3T7VA 1G67A 4NT0A 2ZZ2A 1JCNA 3M1ZA 1MEIA 4IX2A 3C0JA 4GXMA 3C4UA 2ATSA 1VCVA 2BX7A 1VS1A 4JYFA 4MFEA 5FF4A 5HMSA 1H62A 3TAKA 5FESA 1W31A 4QNEA 3GNNA 4LVDA 3MBFA 1DHPA 3PS7A 2B7PA 4FF7A 5D02A 3QW4B 4UTIA 5DBUA 3W7JA 4JICA 1DVJA 3W2UA 1LP6A 3HO8A 1EX5A 5AOUA 3NAVA 3QQ0A 1RV8A 3GAKA 1YDNA 1G7VA 4MY9A 1QWGA 5C2XA 5K2ZA 4WY0A 3NDOA 3GDRA 4ADTA 4NUWA 4O4WA 1TTPA 1JUKA 4ZL1A 4RKAA 1TREA 5GVJA 3FJ6A 5EPDA 5LNWA 1B9BA 1MSSA 1R2TA 4C1KA 3T4CA 3P5ZA 5AHIA 1VLWA 3L5AA 1OX4B 4O10A 1LORA 4DF0A 5CSRA 3YPIA 4MIMA 2NLIA 1JVNA 3G1VA 3TX9A 4UFLA 5I3JA 2QJIA 1NFBA 4O28A 1NSJA 3W7NA 1SUXA 3NL5A 3MI3A 5CPLA 2Z6IA 3W70A 1VJIA 1AL7A 3B0VC 3W72A 3LM7A 4HN4A 4XUGA 2Z1BA 3F03K 1XDMA 5CZ0A 1QR7A 4H3DA 5L6UA 1JUEA 1LM1A 1GTHA 4OWGA 3M16A 4Z1BA 4QAIA 2CLEA 1H7WA 4HNNA 3TSBA 3W7GA 2YDAA 3UYCA 5AC7A 5BNKA 4UTHA 2BTMA 3BW4A 3FA5A 4JY9A 1XBYA 3BLFA 4BFAA 2CLMA 2RDWA 3FJLA 1AK5A 3GDTA 1GYLA 2FPYA 3IIPA 3KOFA 3FYPA 1WX0A 1JCJA 3SIZA 3W2LA 3W73A 3QSTA 5EBUA 3O1NA 2ZRVA 2ZTKA 3P5YA 1J2WA 1ME7A 1GG1A 4PL1A 3QJAA 3THQA 4YLWA 2V5BA 4QNWA 1LOSA 5HUPA 5AYZA 5LGXA 3PULA 1Y0EA 3STCA 3E96A 4POCA 5CZSA 1GWJA 3DGRA 2HTMA 3B06A 4K37A 1V5XA 3HG5A 1UB3A 1T99A 2YPIA 4U28A 1H7PA 2B0MA 3FKKA 3IVUA 5D38A 1Q45A 3W1RA 3MYOA 5ABTA 4GC4A 2RH9A 1L6YA 4O17A 4NNAA 1K3UA 3G1DA 4UXDA 1DQWA 1T96A 1W3TA 2YGYA 2VOMA 1KBJA 1GVQA 1A5SA 5FEWA 3A24A 3HPSA 4IQLA 2H8XA 1IXQA 3W84A 1FCBA 1FQ0A 1QOQA 5D05A 4XTDA 5LZLA 1LTDA 2H6RA 1FWRA 3A5VA 4PEKA 4LV4A 2A5HA 5D2YA 2Z0IA 1TJPA 1SZFA 4FHAA 1SW0A 4K8EA 1KM2A 5G1TA 2Y7GA 3UZJA 3O06A 5DBTA 3G18A 3DHFA 1D9EA 2QCNA 2Y63A 3DBPA 4JGDA 3GLCA 2OT1A 5BW6A 4ZQNA 4E0CA 3LLDA 3P74A 2VEPA 3HGSA 3SGUA 3DKJA 2A21A 4KFPA 2RFGA 4ICNA 1MO0A 2H8ZA 3TR2A 3QH2A 3WJWA 4AEOA 4EF8A 1R30A 1V7YA 5CGQA 2DZTA 2QJHA 1KM1A 2YW4A 5CZTA 2EHHA 3W7EA 4IMCA 4XZ9A 3G24A 3PC0A 5HUOA 3ELFA 4JN6A 1ZHAA 1VQTA 3BK0A 3M5YA 3DFNA 3P84A 5KZEA 4UFJA 1O5KA 1WQ5A 1K8XA 4RXGA 5D2TA 2C1HA 1MEHA 4UIOA 2P10A 2F7FA 4JTJA 2BLEA 3D0CA 2ISVA 2E6DA 2HMCA 3LB0A 1B57A 3WJSA 3G1YA 5H2ZA 5TQLA 4WX2A 3EWBX 3O05A 3LX9A 4UTMA 2Q8ZA 3W1LA 4N9DA 3EWYA 3R2GA 1HL2A 5EMUA 1TJRA 3H53A 3QMRA 2J27A 3KX6A 1SPQA 4QISA 3PG8A 4Q4KA 4I7WA 4XBSA 3TQVA 3TSMA 1JR1A 4UTTA 3VE9A 1LZOA 3UY7A 2DJXA 4AVFA 2EKCA 3C2VA 1JCXA 3SGZA 4GBUA 4IJBA 1FDZA 2TYSA 2ZBTA 3C3NA 1VH7A 3LCHA 1H1YA 2YFOA 3KRUA 2V0TA 1P1XA 4FX6M 4PCFA 3CEUA 3GDKA 1C29A 5I3FA 3SZ8A 3R5EA 5G5IA 1YXYA 3O07A 5K4XA 3TIMA 3N73A 3L2IA 2XFWA 3PBUA 3PR2A 3IIOA 2VEMA 2Q3OA 4LY8A 4UFMA 2WQPA 1GJPA 3NQCA 1TV5A 2GVLA 4FB7A 2G5WA 1NVMA 3W1TA 1L2UA 2CLLA 5I3HA 3BVJA 2W79A 1EP1A 6ALDA 4NX0A 3RNDA 4LU0A 1CW2A 4KFNA 4DPQA 1ZNNA 2TRSA 2FPVA 3NGJA 3S1XA 3PG9A 3RU6A 3KVMA 3ZS4A 2ZRUA 3W1PA 1LBLA 3I68A 3PVFA 3LCXA 4NX5A 1X1OA 2PE4A 4X3ZA 2YZRA 1W3IA 3UQNA 1OABA 3DENA 2DU2A 4JNMA 1VYPX 1F05A 2E5CA 4N4QA 2FDSA 4Y6GA 1TRIA 2A85A 3W7CA 4FX8A 2FB3A 2WNQA 2V82A 4IOTA 4UR7A 4DO6A 1RQEA 4MYAA 1XKYA 3HG3A 3NQEA 3AJXA 4QQ3A 4JTFA 5G2HA 1ADOA 3ABSA 4PH6A 2KZHA 3SR7A 4S2BA 2NZLA 4ADSA 3NG3A 3UPBA 4LOCA 3TCEA 2ATMA 2FIQA 1Z42A 3ABOA 2J88A 2GOUA 2XN1A 3O6YX 1TRDA 4YMZA 1OX6A 1VPXA 3HOJA 1YDVA 2J6XA 3UPWA 3QPZA 3DFQA 3S5ZA 4NNBA 2FJKA 3L0KA 1EP2A 1KV5A 3OVRA 2RDUA 3OVPA 4TX9A 4AAJA 3T55A 5K7JA 3NEVA 5E93A 2YXGA 1OFQA 3LCLA 4N6FA 3O15A 3TFCA 3GAYA 4B5NA 2R8WA 1KBIA 4JTEA 3DZ1A 1H61A 1OFPA 4ML9A 4GJ1A 3W2KA 1XI3A 3LDVA 3INPA 2R94A 1RZMA 3PBWA 4GRSA 4KWVA 2ISWA 3GB6A 5E0KA 2WV8A 5AYXA 1QO2A 4XBKA 3EWWA 3CTLA 1XM3A 1LROA 1F2JA 1O60A 4JR5A 1R47A 3KVJA 2XN0A 3DU0A 4HSOA 3TC7A 4K7YA 4WZHA 1YTEA 5DXYA 3W2MA 5KZDA 1H5YA 1H63A 4QITA 1W1ZA 5HR6A 5H91A 4XKYB 1OK4A 3IIVA 4UTWA 3Q37A 4ZMGA 5HWMA 2JK2A 3TK7A 5DN1A 1F73A 4Q33A 5IBXC 2JGQA 2PRHA 1PCKA 1YXDA 1Z41A 1TPB1 3HGOA 1RQHA 1M6JA 3S1WA 4RJEA 1EB3A 3CPRA 4NZFA 1NF7A 3GZ3A 1L9WA 2W0UA 3G1FA 4IMFA 1SZNA 3SJ3A 3W76A 4WOQA 4O8RA 2EF9A 3BLEA 4ADUA 4JDYA 2HSAA 4O19A 4R53A 5F2MA 1SO3A 1HTIA 3FS2A 1WOAA 2OT0A 3LI0A 3QW3A 2QCLA 1LRQA 2Z6JA 3NPWA 1TPEA 1UBSA 3IIZA 3G0XA 1QFEA 2WNNA 1LCOA 4XKYA 1L6SA 3UZ5A 1OX5A 2TPSA 3TDFA 4LWWA 3B8DA 3ZWTA 2X16A 5HR7A 1OHLA 3KRZA 1F5ZA 3M5VA 3TE9A 3BGJA 3TW6A 1TO3A 1QPRA 4JTUA 1KW1A 4UTUA 4HPXA 5I3KA 3PB2A 4ALDA 2V9DA 3RLUA 3GXTA 3M44A 2TSYA 4NU7A 4JIPA 1O94A 3HB9A 2E68A 1VC4A 2YSWA 4O0KA 4MPQA 1KLYA 5FF0A 4O14A 3W07A 1S5WA 4NZJA 3W7DA 3UNDA 3W85A 3AO0A 1XBXA 1UUMA 1L6WA 5AHFA 3R89A 3L0NA 4NJKA 3GR7A 3GR8A 4JXCA 2CZDA 2Y70A 4FEZA 2A7PA 4N9BA 4A3UA 4MLRA 3LHZA 3BW2A 4K39A 3P82A 1H7OA 2WSYA 4O13A 5CSSA 2V2DA 2DZSA 3QM3A 3N2XA 2GPTA 2WOQA 4EWND 1QMLA 5CG7A 3W1NA 1SSDA 2VFGA 1VR6A 2ZRWA 4TR9A 2VFDA 3M5XA 1U83A 4N2YA 1XC4A 4O16A 4A21A 2VELA 3GX9A 3WK0A 1JCLA 5HULA 2E6AA 2P0OA 3STFA 5DLCA 5LNSA 2B7NA 4Y9AA 5K4ZA 5LNVA 3DI0A 4Z08A 1K7EA 1TPH1 2NX1A 5IM51 3NO5A 3IIXA 1QPOA 2AAMA 1JQXA 2DORA 4LV9A 1VCFA 4MFDA 3SI9A 4TIMA 3LLFA 2E6FA 3GDLA 3WK1A 3HG2A 3FEMA 3EXTA 3KXQA 1TPUA 1SZEA 2OZ0A 1BTMA 5EA9A 1GVRA 3STEA 1G4SA 3O63A 4NVTA 5LHFA 3LHTA 4IMGA 1FDYA 2JKEA 3QMSA 2GQ8A 1FCQA 2FTPA 1TB3A 1Q6QA 3N34A 2CLIA 4OE7A 3HGJA 4LVAA 2W6RA 3H55A 3GXNA 2X1UA 3STGA 4LRTA 5C55A 2ZRXA 1XBZA 3W1XA 4FXRA 5T26A 1FCVA 2WSRA 2X1SA 5L9FA 5HJLA 4TMCA 3EB2A 4XQ6A 1S5VA 4L4LA 1VZWA 3TNOA 3MHFA 5LGZA 2B4GA 5C5YA 4MY8A 3PBYA 1UASA 3B04A 2ISSA 2DZPA 1YDOA 5DCEA 2VXNA 3HMJG 1LRTA 4AHPA 1FWSA 4MZ1A 3CEPA 4R33A 4KKXA 2QCEA 3PWAA 1A53A 1G4EA 3N9SA 4TU1A 3NQFA 2V2CA 4NJJA 5BOOA 1O95A 4FXSA 3VE7A 3LXCA 3CB8A 2RHGA 5HQEA 2NWRA 2NUWA 4YCPA 1YXCA 4PC8A 3TXZA 4MLJA 3BV4A 1RQBA 5DELA 4JX4A 4LRSA 2ZA2A 1GG0A 1UJPA 4O52A 3TQKA 1TCDA 2Z2UA 4LT9A 3TROA 3NA8A 4I9AA 1OF6A 3LOTA 1KFBA 5D37A 2CZ5A 3W9ZA 3S1VA 3MHUA 4UTLA 3DFSA 4O11A 2QCCA 4UTJA 1GQNA 3R13A 1DL3A 4I7UA 4HIBA 2C14A 3S6DA 3E02A 3S1UA 2J9YA 1EWDA 4HSNA 1IIGA 1N55A 2VFFA 1M5WA 4BF9A 4UMAA 3TJLA 1W0MA 3GKAA 4Z1CA 8TIMA 1GVSA 5FEXA 3LRMA 3PUOA 1ZFJA 4N9EA 1TYGA 1FX6A 3NPVA 1I2OA 4FNSA 1EUAA 2J9XA 3W1UA 1K7FA 5AHMA 2E77A 3LHUA 4IWWA 1GOXA 1TSIA 3LI1A 4O50A 3MP3A 3KRSA 4O57A 3UD6A 4PTNA 3C2OA 5U7SA 3QPYA 3LERA 1I2NA 4OBTA 5FF2A 1VYSX 1NAL1 1XFBA 4MZYA 3V1PA 5FEPA 3MMTA 4IMDA 1YTKA 3M9YA 1Z48A 2NXIA 1GEQA 4HKPA 4D2JA 5TIMA 1KM3A 4C1LA 1YPFA 3W2NA 3Q94A 1TPFA 2E5BA 4UC5A 1AW5A 4CLMA 1FDJA 4WOZA 3BW3A 1W5QA 4GUJA 3C2EA 2Y6ZA 5D03A 4O1CA 1O4UA 3LTPA 4UUIA 2X1TA 1WAUA 1SSGA 1SO5A 1G4TA 3A5FA 2QUUA 4Z1AA 3G8EA 2D73A 2I9EA 3WJXA 1JQVA 3BO9A 5D33A 5F2GA 1H7NA 1SFJA 2FB2A 4LS2A 4IPJA 1OYBA 4E2BA 1QAPA 3E9AA 1DKWA 4RZ4A 2H3BA 2WNZA 3W88A 1W37A 1OYAA 1GYNA 1ZY9A 3WFAA 1P4CA 4WY0F 4DBEA 1NF0A 2EAWA 3L65A 1FXQA 2GQ9A 3TJXA 4EF9A 1KM6A 5F2IA 4A2RA 2DZUA 4CCCA 3IRDA 4AF0B 2BXVA 5D04C 1PIIA 1R2SA 5D2XA 1IGSA 4JTHA 2AGKA 1TPVA 4LUJA 4RX0A 2Q8LA 5MHBA 1N7KA 2C16A 4CQ8A 5CKSA 1DORA 1XBVA 4MUZA 1H60A 4XTIA 1WDWA 4AH7A 1W8SA 3O6DA 3QC3A 3QQ1A 1X8FA 4IX0A 1W5MA 4K36A 1TQXA 4FNPA 4GWEA 5K9XA 1F74A 1DJQA 3E12A 4O0ZA 2V5LA 4FX7A 3EX3A 3H54A 3EWXA 5BRBA 3G3DA 3NQ6A 5K3VA 3SY5A 1GVFA 2A7RA 4JTTA 3V75A 3EXSA 3CLMA 2C6QA 5IBXA 4OQVA 3T44A 1YYAA 2CW6A 1N8FA 3N3MA 2C19A 1THFD 3O8AA 4AF0A 1OFEA 3F1QA 3P80A 5I3GA 5FF7A 3NPUA 3U8GA 1OG0A 3GXPA 3W7LA 1JCYA 5HWJA 2ZZ3A 1Q6OA 2PCQA 3TUUA 1JUBA 5F2LA 2HS6A 5EKYA 1BWLA 4MJZA 3L0GA 3DXIA 3W83A 2A2IA 3UWYA 4GFSA 3TH6A 1TV7A 3S5NA 4WD0A 1I2PA 5LHEA 3WK2A 4CNOA 3M41A 4BWLC 2OJPA 3G1XA 1SZGA 2A7NA 1XCFA 2ZDRA 3CM4A 3LRKA 4LNYA 3W2JA 1OFDA 1Q6RA 4UFHA 3QF0A 3P81A 2NV2A 3PM6A 2ZA3A 1OYCA 2ZCGA 1GZGA 1JRBA 2VENA 2NUYA 2RKXA 4RCXA 4DPPA 1SW3A 3LCFA 4ZQOA 3IVSA 2QKFA 2X2GA 3E49A 2LLEA 4DO4A 2O7QA 3BG9A 5J5DA 4PODA 5J5RA 1LBMA 1MEWA 3MBDA 2CWNA 4EVZA 1HUVA 4LC6A 2A6NA 4NXSA 2BZNA 3A23A 5AFDA 5U4NA 3EXRA 4J9JA 1EPXA 3RF9A 1LOQA 3MYPA 3BG3A 1W3NA 1SW7A 3B0UX 4DO5A 4E2DA 2V2HA 3CU2A 4JIQA 4R7JA 3KHJA 4AXKA 1VHNA 3W74A 3LRLA 3ZFHA 4CNNA 4JEQA 5FEZA 3RK8A 3Q58A 1RD5A 2PRLA 5K9DA 1TPDA 1Z44A 3S5OA 2ZRYA 3W7MA 3LXAA 4OHQA 1ME8A 3F4NA 1LDCA 4I7VA 2B7QA 4RR4A 5KSWA 1OFRA 3JR2A 3GVGA 5F4XA 1DQXA 1E51A 4DXVA 2QAPA 2CZFA 4GUFA 3SECA 3L67A 2H90A 3CT7A 3GIYA 3G22A 3OIXA 3MUXA 4WJEA 2CLKA 1K03A 3EKZA 3NL6A 4A2SA 3TAOA 4CCEA 4LS1A 3ABRA 2DJLA 4K8HA 3NOEA 2UV8G 3I6RA 3CIWA 3UWWA 1UCWA 4O18A 2NXGA 2NUXA 5AHLA 2WSQA 3PSVA 3EX6A 3LCGA 3BARA 1KTBA 4K6AA 4JS3A 2Y61A 1LOLA 1OK6A 1EIXA 2V8ZA 3NR0A 3ANYA 5LNUA 5I3IA 4FIRA 3PUDA 2JGYA 1ICPA 3S5YA 1K7XA 1ZCOA 3W7IA 4K38A 4H6KA 4HT3A 5LNRA 3U2OA 1ICQA 1KFLA 2BWGA 3NXFA 4FO4A 3R12A 4O54A 3GNDA 4RK8A 4CQ9A 4FNRA 1TTIA 2QDHA 2E1DA 5DCBA 3M0ZA 1ONRA 1FWTA 3L5LA 3FKRA 5FI8A 1DJNA 5D2VA 3EWZA 3BG5A 2C3ZA 2C13A 2EGZA 1XUZA 1ZAHA 2QEZA 3BLIA 1QDSA 4GE8A 3G1HA 4DF2A 4BK9A 1R2RA 4RZ5A 2I1OA 3O6CA 2ZZ5A 3NL2A 2R14A 1G69A 1KM5A 3EX1A 1EEPA 2E09A 4LVBA 3B4UA 3W86A 1B4KA 3QFEA 3A22A 1KFKA 4X2RA 1GPWA 3G1AA 4CCDA 4IUOA 3TSDA 1B4EA 1ICSA 3UWQA 1TQJA 4DEFA 2XN2A 3A9IA 1T0OA 3P61A 1KM0A 3HQ1A 3NQ2A 1YTDA 1SFLA 1A5BA 1PL9A 1PHWA 1JJKA 2HS8A 3NM3A 4CNPA 2E6YA 3TW7A 1TTJA 1IIHA 4BI6A 3SSJA 1WBHA 1HO1A 3HPXA 3ZWSA 4EIVA 5SWUA 1LLWA 6TIMA 3S8HA 3NYZA 4JYDA 1DBTA 4NJIA 2BSLA 1XL9A 1B3OA 3P62A 3IV3A 2FFCA 5D2WA 1LYXA 4ZZ9A 2J24A 1A5AA 3DFTA 2C15A 3NQAA 4UNLA 3NQGA 4QIUA 3R8RA 4E38A 1HG3A 3GKFA 3G3MA 4UMCA 2ZA1A 3L9CA 2TMDA 2B7OA 3PSWA 3W23A 3KFTA 3W6YA 2GJNA 3M6YA 3DHDA 1MZHA 3TXVA 3LTSA 5C6MA 1CI1A 2YR1A 3W3OA 2ABAA 5G1YA 1ZAJA 3B03A 5G2WA 4TO8A 1KFCA 4Y96A 4MVAA 4LW7A 5CPNA 5F4SA 4Y8FA 3W7HA 5F1VA 2WPBA 4GNJA 1AMKA 1J4EA 4CQAA 2QCDB 2DZVA 4HNTA 3NQVA 4ONVA 4WXYA 3PY2A 3CHVA 2QCMA 1HO4A 3MW7A 1PE1A 2JKPA 3SW6A 4WQ6A 3BPWA 3PUEA 4ORIA 3CQ0A 2Y7EA 1YADA 5D32A 5F1UA 1KTNA 3S9YA 3HBLA 3LHVA 3E0IA 4M6VA 4BI5A 3UXAA 1X1ZA 5E1QA 3SFKA 4UMBA 5G2IA 4RZ6A 1KLZA 3W87A 2VEIA 1IF2A 3EX2A 3G1SA 4KFOA 2GVJA 4ZQRA 5C54A 1AW1A 4GUIA 1P5BA 4X22A 1QCWA 4ZQPA 1GVOA 4JX6A 1I4NA 4AWUA 3QEZA 2H3DA 4R34A 3QZEA 3NNTA 3HGRA 1H7XA 3LGEA 3W1MA 1XXXA 1OX4A 1RR2A 3P67A 3LV6A 3IGUA 4Z1DA 5CPOA 2FQIA 3PBVA 4IXHA 2QCDA 1GTEA 3M5ZA 1P0KA 1AL8A 4IXXA 1I2QA 4Z0JA 3THAA 1SO4A 3FYOA 2GQAA 4LTSA 3VCRA 4UTKA 3W1QA 3W7PA 3W22A 1CX9A 3G0UA 1H50A 2QUTA 4M6PA 3O16A 1EP3A 1KV8A 1X7FA 3KVKA 3HIJA 4FIQA 3S42A 4MY1A 3P60A 3QSRA 3MWAA 3UWVA 3F4WA 2YFNA 1QPNA 4UCGA 1YPIA 2G95A 2Y88A 4PL2A 2VFHA 5AYYA 1H1ZA 4WXZA 1TMHA 3OVQA 4RV8A 3M7WA 3CWOX 4DELA 5KITA 2C0AA 2Q3RA 1HFBA 1SQ7A 1BKSA 1I8JA 5EYWA 1IXPA 2DP3A 2WO5A 1ZJIA 4DQWA 1LLZA 2X30A 3PAJA 4O12A 3I65A 3C2RA 1T8XA 4JTGA 3MJYA 1VRDA 2ALDA 3BGGA 3UY8A 1W5PA 3NZRA 3FFSA 5HNRA 2Y85A 3QRHA 3QYQA 5G4EA 3TKFA 2PRMA 4JYEA 4WUIA 2X1RA 1EUNA 3TC6A 1K8YA 4NNCA 3ZR4A 3GK0A 3FIGA 4Y90A 2OX1A 1VCGA 1ML1A 2FLIA 1FBAA 4L4MA 4TMBA 4YCOA 2QUVA 2P1FA 2JKAA 2WJZA 5D09A 3G0SA 1P0NA 2NX9A 1KFJA 2A1YA 3I7SA 2FPTA 1G6CA 2GVGA 2J9ZA 2ZQ0A 3CC1A 3NL3A 4AHOA 3W7OA 3KAOA 1WYIA 3UXDA 1GT8A 3DKLA 4O1DA 2R91A 2EPHA 1PHQA 3LHYA 1R46A 3W7RA 3NQDA 3UWZA 3HPZA 1FXPA 2A0NA 1FY6A 3MHGA 3OBKA 1A5CA 4O1AA 3NPXA 3LXBA 3USBA 3OA3A 5HINA 2Y7DA 2NX3A 1ZALA 2JBMA 1BWKA 3ATZA 3RFAA 1H51A 4PFMA 3EWUA 1W5NA 2YYTA 4G1KA 3UWUA 1QPQA 1TPWA 1F6PA 3MI6A 3NVTA 4BWLA 4QJ1A 3TMQA 3LCIA 1WBJA 2ABBA 2G97A 1QNVA 4O4VA 2YW3A 1K02A 2A6LA 1IXOA 1U5JA 3ATYA 2OCZA 1SR9A 3OG3A 1VLIA 4LVGA 5KINA 4AHQA 2ZFAA 1K8ZA 4JY8A 1YLVA 3QMTA 5BMWA 3B0PA 5EL1A 4HHPA 2DZWA 1VHCA 3JRKA 1D3GA 3PB0A 2NV1A 1H7RA 1FCUA 4MYXA 1VGAA 4GUHA 4NJHA 4PA8A 4IMEA 1KM4A 4FNUA 4KWWA 4HNUA 3TA6A 5BMXA 3VI2A 4H4IA 1W5OA 5CPMA 4W9TA 1C9DA 1Q3NA 1ME9A 4JD4A 3WJYA 4S1FA 3VNDA 1J5TA 5K9CA 3RMJA 4N6EA 3P8JA 3N14A 3NQMA 4AWTA 3LTYA 5D30A 2NWSA 3T40A 2QCHA 3LV5A 4RXFA 3GDMA 3MP4A 4JTKA 2V81A 3IEBA 3W7KA 5G4WA 3M43A 2Y89A 3I7RA 4M19A 2O7SA 2PC4A 1PS9A 2ZTJA 1OVDA 5A8GA 5KTLA 1NEYA 2AQWA 4UFKA 3LHWA 1PCWA 1ZENA 3L68A 2F84A 4U4MA 3FLUA 3P8IA 1WV2A 3C56A 4FNQA 3MI2A 3JS3A 3TU9A 5LSMA 4LUIA 4P2VA 3DH7A 3W1AA 3N19B 2VFEA 1W56A 2CLOA 3K30A 1SU5A 3VKJA 5AN7A 2YYUA 3G8RA 3M47A 4GUGA 1VYRA 1WOBA 3C8FA 1A50A 4ZVJA 4A29A 4HPJA 3Q2DA 1W54A 5LKYA 2CLHA 2YX0A 3ABQA 3C2FA 4OV9A 4OU1A 4AMAA 4NJGA 4P61A 3DFPA 4DBDA 1WXJA 1FWWA 2A4AA 1KFEA 1S3HA 4LC8A 1OFOA 2VFIA 7TIMA 3A21A 4M7TA 3GYEA 4A22A 1SO6A 4Z0SA 3NZ1A 4N9CA 1ALDA 2I14A 2ZRZA 3OHIA 1F76A 4UTTC 3I7QA 3VFLA 4M6QA 1WA3A 1KTCA 4JTSA 4O1BA 5AC6A 2E5DA 4YL2A 3MO7A 2QCGA 3L21A 1TV8A 3DAQA 4OGZA 4YXGA 1I2RA 4DF1A 4BR1A 4MOZA 3FOKA 1RPXA 5A5WA 1F7BA 3IVTA 2V30A 1D3HA 4OV4A 3L66A 1G4PA 3N9RA 3W7QA 1I45A 3LBCA 2QCFA 3PF3A 1FWNA 5KMYA 2QAFA 5AB3A 2ZYFA 5DY2A 1PV8A 4UFIA 4QSHA 2VEKA 1TIMA 4OT7A 4NQ1A 1EWEA 3KVLA 4S2CA 3WJZA 3IGSA 4HNVA 5KZMA 5FF3A 4M7SA 4JX5A 1JRCA 1FUYA 1OFAA 2QDGA 4ORMA 5CZJA 1EA0A 5EY5A 3NM1A 1JCMP 3IGXA 3S0CA 3EEGA 3W75A 3TFXA 2ZZ1A 1AW2A 3EX4A 3CIXA 1IXNA 4LVFA 4UR8A 4ZQCA 4M5PA 1QO5A 2PURA 4N02A 3RLVA
chains in the Genus database with same CATH superfamily
4L4OA 2XIOA 3C52A 2CLFA 1EJSC 3A4AA 4NXKA 2HQAA 2NXHA 4TVDA 3O3RA 2VYOA 4LS0A 3GXIA 4K7VA 4MDOA 2YCEA 4LNCA 3V16A 1BLIA 4YS1A 3KOYA 4JTIA 3E2QA 3TTSA 1Z7AA 1DOSA 4MGGA 3BGAA 5AC4A 3V0SA 1ZL1A 5GNZA 1MXSA 1HJWA 3VNLA 3GIQA 1FWHC 4C6EA 1FHUA 3OEXA 1ZAIA 4BZYA 4QJ3B 1WAWA 1O5XA 3AWNA 5A6JA 3VGHA 2ZX9A 3EA2A 3TMLA 3DFOA 3N2MA 3VIMA 3K8KA 1ESWA 1IT0A 1D3CA 2VC6A 3WK3A 1UOZA 5FL1A 1R9ZA 1UJQA 3OZYA 4AWSA 4JNZA 3W71A 1OF8A 5HMDA 2IQTA 4PTWA 3U6WA 2HE8A 2WKJA 3EDFA 5BXRA 1BWVA 4Q4OA 4AB4A 2GGEA 1BEUA 3EKLA 3FXGA 3L12A 5C9WA 4UZSA 4M1BA 3FX4A 2XVGA 1M7OA 4C6QA 1Q6FA 3DC8A 1A4MA 4LBUA 3T78A 4YWIA 1NOUA 4PUMA 1JCNA 3CPUA 1MEIA 4GZJA 1OINA 3C4UA 2BX7A 3TAKA 2XIJA 4PUWA 2YBUA 3GNNA 4LVDA 3MBFA 1DHPA 3S83A 3VCCA 4WJXA 4JKLA 1W9XA 4F0SA 5D02A 5DBUA 3EBVA 3W7JA 4JICA 3W2UA 1M65A 1PPIA 2X0YA 3UETA 5BWAA 1TZ9A 4H8UA 1UD8A 4WY0A 3VOIA 2PDMA 4ADTA 4NUWA 1TTPA 3PAOA 3AIEA 1TREA 1CXIA 2PC8A 4KETA 2QZRA 1B9BA 1HGWA 1MSSA 3T4CA 2ZXAA 4LF2A 2WCAA 3RIKA 3ES7A 5CSRA 3OYXA 1JVNA 2VX7A 3G1VA 1YNQA 3VIGA 3ITTA 4Y9OA 5AVHA 4F79A 2Z6IA 3SADA 1AODA 1VJIA 1W1IE 3B0VC 5CPSA 3LM7A 4KGJA 3CASA 3NSXA 1E15A 1FWDC 4LANA 5CZ0A 6REQB 1NIUA 4H3DA 2ZUWA 3KBJA 4PEEA 1JUEA 3P6LA 2DW7A 1GTHA 4XBJA 2V5JA 1XLEA 4OWGA 3M16A 2V68A 3U7BA 1H7WA 4I5UA 4HNNA 3WZ0E 2YDAA 1RBOB 2VJXA 5AC7A 4UTHA 4LB3A 3FA5A 3SCTA 1XD1A 2PDBA 3FJLA 4Q7NA 4GI6A 2FPYA 4F9DA 3IIPA 4GISA 2VVSA 3FYPA 1OY0A 3BCJA 4G6CA 3AU2A 1N82A 3P5YA 4XAYA 2ZUVA 3THQA 5DQPA 1E43A 1DWHM 2CWXA 4H8VA 5LGXA 1Y0EA 4POCA 3DGRA 4K37A 2HTMA 3HG5A 2Y2WA 1UB3A 1T99A 3FKKA 3IVUA 5D38A 3OA5A 2W3ZA 4GIAA 4HHHA 3DC0A 2DT3A 4JIEA 4XAZA 2D1ZA 3QZ6A 2AMGA 4N42A 4A05A 3ZM8A 1VJSA 4KF1A 3HPSA 2HDJA 2H8XA 1IXQA 1Q13A 1FQ0A 1QOQA 1W2PA 2H6RA 1T7LA 2QIWA 3A5VA 4DVOA 1FOBA 4LV4A 4DJEC 1JDEA 4P8WA 2PTZA 2YCKX 5I79A 3EA1A 3S9ZA 1RP8A 2DT2A 2Q71A 3O06A 3V18A 3G18A 3QN3A 4ILSA 6CGTA 1DJGA 2OT1A 3CZ8A 1OBAA 3W37A 3LLDA 4WDXA 2RGMA 3RN6A 2CNCA 3REQB 3SGUA 3DKJA 1S39A 2NQ5A 4B2DA 1Q8JA 4ICNA 3PNUA 3QH2A 3WJWA 1XGZA 5HPOA 4S3BA 2WLYA 4AEOA 3ZMRA 1V7YA 1MRAA 3PZIA 2PP3A 3PZQA 4JAWA 2QJHA 1WZLA 2BVTA 2EHHA 3CPGA 4XZ9A 2Y4SA 3W0KA 3ELFA 2D22A 1VQTA 3BK0A 5HK4A 1I1WA 3DFNA 3P84A 1UPPA 1WQ5A 2XIQA 1K8XA 4GVIA 1US2A 1V6TA 4GIYA 3SDOA 4XAGA 2F7FA 2BLEA 4EXBA 2HMCA 1DQUA 3CAVA 1JZ4A 3QXBA 3LX9A 4UTMA 3WBXA 3R2GA 3GU2A 1PYMA 3CUGA 2ZOXA 2UZ9A 3KX6A 4GQBA 1HKWA 2Y8UA 3TQVA 1Q66A 1JR1A 5JBFA 1GOWA 1HX0A 2QUNA 3FA4A 3E5BA 2Z28A 1DWIM 3C3NA 1ZS2A 3I4EA 2YFOA 3B8VA 3MSGA 3TTOA 3C8NA 4FX6M 3GDKA 2Z4GA 5I3FA 1NQKA 5G5IA 4J3VA 3UJFA 1PXGA 3TIMA 4D71A 3WNMA 1XIMA 2XFWA 3PBUA 3RPMA 2VEMA 2PS2A 3WUEA 3WH5A 1AZ2A 1GKRA 2WQPA 4X0NA 3AWOA 3CHFA 2G5WA 3ARXA 3W1TA 5I3HA 3BVJA 1ZJAA 6ALDA 4Z2IA 1CW2A 4L56A 4DPQA 3N12A 4HP5A 1LBLA 1BGAA 2G3NA 3DGBA 5CEWA 1X1OA 2WSKA 3HV9A 1Q5MA 1OABA 2WMIB 4JNMA 4ZO8A 3RILA 1Q4NX 4DYJA 3ME3A 1TR9A 2E5CA 2G3FA 5IFTA 5A8MA 1TRIA 1QUMA 3W25A 2WMGA 4FX8A 3ZT6A 1VKFA 2WNQA 4IOTA 4UR7A 2OLSA 1NWSA 4MYAA 4A3HA 2YBVA 2YZ5A 3CL8A 4QQ3A 5G2HA 2KZHA 3S2MA 1H4PA 2NZLA 3KS5A 3NG3A 1NQ6A 4JL1A 1JAEA 1Z42A 1ZP4A 2QNEA 3B9OA 4NP7A 2GOUA 1TRDA 1V3HA 1OX6A 1EJVC 3VPLA 3DFQA 2EPKX 4MWAC 4NNBA 2RDUA 4AIOA 3OVPA 2WZTA 4PE8A 1U22A 3NEVA 5E93A 4JCMA 4B5NA 3SRDA 4JTEA 3DZ1A 4D8AA 1WZMA 3GTNA 2OOGA 3GB6A 4F66A 3BLKA 3CTLA 1XM3A 3LD5A 1LROA 2EG8A 4JR5A 1R47A 1SMDA 4UB9A 1OIFA 1H5YA 2WAGA 1W1ZA 1I0BA 3E2RA 5ENLA 4XKYB 1OK4A 2AQVA 5JBEA 4UTWA 2OKTA 5RUBA 3GDBA 3D47A 1BG4A 5CLWA 1NP2A 2JK2A 4Q33A 2A3EA 2CKSA 5IBXC 2PRHA 1PCKA 2IMRA 2AMXA 1TPB1 1RQHA 3PZGA 4GOAA 4IM4A 4RJEA 1EB3A 3CPRA 1NF7A 2W0UA 3WDRA 1A0CA 4GNVA 4WK9A 1LL7A 1JDDA 2EF9A 4ADUA 4JDYA 5F2MA 2O9RA 3FS2A 3VD4A 1XQLA 2HCVA 3S2NA 2QCLA 1VPYA 1LRQA 1WXYA 3VGDA 3V35A 1UBSA 1EBHA 1X8CA 1QFEA 2WNNA 1L6SA 1JI1A 3TDFA 4Q8MA 2Z25A 3WNNA 2X16A 1F5ZA 4C6OA 3AYVA 4DYEA 5E9AA 3VZYA 1QBBA 1RCXB 1QW7A 3NSNA 5D8ZA 3AFBA 4HPXA 3LNPA 4W84A 1EC9A 1K77A 3PB2A 1OT2A 3W01A 3H2CA 2EEXA 1JZ8A 4QXIA 4AZ6A 1O94A 4BF7A 1JDFA 5HNTA 1VC4A 3D5HA 4MB1A 3AUOA 4LAOA 1VB9A 2J8TA 3IUDA 3UXKA 1VENA 3WLQA 1UUMA 3R89A 3O0FA 4TTGA 2OQLA 2XFYA 4N9BA 2E9MA 1PZ1A 2WSYA 1KR0A 3CTTA 3L4TA 2V2DA 2VC5A 3R58A 2PWVA 3T81A 1QMLA 3FY1A 1QJWA 1V77A 2MNRA 4JTDA 5E09A 4N2YA 3GVWA 4C5YA 2GGJA 3AMLA 4GIEA 3F5KA 1JCLA 5HULA 2P0OA 5D9OA 1C8XA 2QLYA 1F3EA 1EQPA 4DZIA 3B40A 4PRWA 1TPH1 2NX1A 4IGSA 2V38A 1QPOA 1GQIA 2DORA 4LV9A 1IGWA 3TJIA 2OEMA 1VCFA 1O12A 3WD2A 3LLFA 1RA0A 4LAZA 4NKCA 4GX9A 1PWLA 2ZUMA 4GYPA 5HXMA 1I60A 1TPUA 2DVXA 1EGVA 2VRKA 4CD8A 4R7OA 1BTMA 1GVRA 3STEA 3SM0A 4NVTA 1Q7MA 3LHTA 1FDYA 4OFCA 3U3HA 3W28A 3IJ8A 3D3AA 2VCBA 1BHGA 3VD7A 1FKWA 2XM1A 4OE7A 1QNSA 1CB7B 3QPEA 3GNRA 1ZJHA 4PB3A 1QPKA 1Y5XA 3W1XA 5T26A 4ZO7A 4YTUA 1UH3A 2Z00A 1NDVA 4DWSB 3OTRA 5C5YA 4MY8A 3PBYA 2WM1A 4ROQA 2W9MA 4Q7IA 2ZUSA 4MZ1A 2Z7GA 3PWAA 4DJDD 3N9SA 5C2GA 3V5CA 1QHZA 2Y5SA 3ZSSA 5BOOA 1O95A 3VE7A 4Y9NA 3OGSA 4KRUA 3WMSA 4LXFA 4KIRA 2FTYA 2NUWA 3ZT5A 3TXZA 4GVFA 3BV4A 1RQBA 3B9EA 5LA1A 4JX4A 5JIPA 2C91A 1F4HA 4LUSA 4GYFA 1TCDA 1E1EA 2Z2UA 4X0VA 2QW5A 1KO0A 4LT9A 3GFYA 1OF6A 3RHGA 3BSGA 4QHRA 1MW1A 5D37A 2ZC1A 2E4TA 1W17A 2QVNA 4H83A 4GINA 5LXXA 3VUPA 4JN7A 1PX8A 4I7UA 4HIBA 3QVQA 3VKDA 1EWDA 4HCLA 3N3TA 1PWMA 3AZSA 3NIYA 1W0MA 4TX6A 3TJLA 1PJ9A 4Z1CA 5FEXA 1TUFA 1TYGA 4M8UA 1IZJA 4ECLA 2XHYA 5E0CA 3GBEA 2YL9A 4US5D 3LHUA 4IWWA 2NW0A 1TSIA 3LI1A 4XSLA 3XISA 2Q6ZA 4O50A 4DZAA 2CETA 3PTKA 4A8LA 3IJ9A 3QFWA 4L80A 3KRSA 4TV6A 6TAAA 1WKDA 1G94A 4CN6A 2ODOA 1HJVA 5U7SA 3KBVA 3QPYA 4MF4A 1I2NA 4OBTA 1NAL1 3V1PA 2FVLA 1SVDA 3BTNA 1YTKA 4ZTXA 1E9IA 3EPNA 3RLGA 1HKKA 2NXIA 3WD1A 1XISA 3SUVA 3T42A 5BXPA 1UG6A 2AQOA 2E3ZA 2Z1KA 1Y8BA 3BW3A 3SQLA 5CJNA 3GFXA 5D03A 4UUIA 2DT1A 2X1TA 2BXZA 2DY3A 4C7DA 1XFCA 2EBNA 3HA1A 5REQA 1G4TA 1YX1A 2WZIA 4Z1AA 1XLCA 4PCPA 3BO9A 2ACUA 1SFJA 4ERAA 1UKPA 1R9XA 4NL1A 1OYAA 3WD4A 4HYVA 1I0DA 1GYNA 2VX5A 1FKXA 3WFAA 4DBEA 2EAWA 3L65A 3QHMA 3GXFA 3ITGA 1UD3A 2PF0A 4EF9A 3PANA 4Z17A 4AF0B 3SQMA 5D04C 1PIIA 1U5HA 2WHJA 2AGKA 3WEZA 4LUJA 2Q8LA 5FOOA 1N7KA 3ITXA 1H60A 4ACZB 4XTIA 4LX4A 3QC3A 2RGLA 1X8FA 4JQ3A 5CQ1A 1P6BA 4IX0A 3GW0A 4PRTA 4TV5A 2P76A 3WLMA 5HBFA 1QW9A 4FX7A 3EWXA 3CQHA 5BRBA 3WEOA 5K3VA 3SY5A 1HP4A 1PB0A 3WH7A 5FJIA 3EXSA 2DDXA 2C6QA 1JPKA 3ANUA 3BAKA 1PX4A 1UPMB 3FEQA 3HM7A 3GHUA 2ICSA 4B4FA 2C19A 1OFEA 3F1QA 1CXEA 1OC5A 1OG0A 3GXPA 3TYAA 3KUMA 2ZZ3A 4E2VA 1KKOA 5F2LA 5HATA 3CQKA 4MJZA 5ABFB 3W83A 3UWYA 4GFSA 3S5SA 1TV7A 3S5NA 1I2PA 1J0ZA 4XKMA 3M41A 3IGHX 2A7NA 3FJNA 3W2JA 1L8NA 3K46A 2W4XA 3K8MA 2ZCGA 1JRBA 1K9TA 2I16A 3UR5A 3FXYA 3ARZA 3BZGA 4RCXA 2G3IA 2LLEA 3BG9A 5J5DA 4PODA 3W24A 1MEWA 3H2MA 2CWNA 4EVZA 1HUVA 1E55A 4LC6A 3A23A 5AFDA 4TXEA 3H6OA 3WY1A 4J9JA 4C90A 5CC7A 1LOQA 2PWFA 4ZOAA 3BG3A 3EWCA 4WGXA 4E2DA 3QOKA 3LQGA 1A5MC 3UGVA 4C6FA 1VPQA 3T1GA 4I9MA 1RD5A 3ISIX 5K9DA 1TPDA 1Z44A 5C9XA 1BVWA 3MKCA 1ME8A 1DP0A 2VWTA 1BFNA 4HMEA 1JZ3A 1LDCA 1O1ZA 4GFIA 5J8LA 2W61A 1Z32X 3N4EA 3NWRA 2H90A 2OZ8A 1YDYA 3CT7A 3GIYA 1DJWA 3OIXA 2E9LA 4D6DA 3OODA 3EKZA 3CV1A 4HK6A 4A2SA 3MV11 3E6EA 2DJLA 4E8CA 5FIPA 2UV8G 2PAJA 2E0PA 6XIAA 4J3XA 3I6RA 2VR2A 1UKOA 2WSQA 3PSVA 3HQPA 1F07A 3BARA 4JS3A 1LOLA 3NTYA 1E4LA 3AS2A 1EIXA 4CD4A 1TMQA 4FIRA 2JGYA 3CIVA 2HPIA 3S5YA 1T5AA 4K38A 1KRMA 3PJXA 3U2OA 4EAMA 1KFLA 4EAYA 4FO4A 3R12A 4O54A 3T2OA 3GNDA 1MNSA 5AYIA 1TTIA 5DCBA 1UP3A 1FWTA 5A6BD 3L5LA 3OO2A 3BG5A 4C1NB 3H21A 2EGZA 1ZAHA 2QEZA 4GE8A 2NSXA 4DF2A 1E3ZA 1FH8A 1LT8A 3O6CA 1B5TA 2R14A 1G69A 1KM5A 3EX1A 3NQBA 2E09A 1A5UA 3B4UA 4NI8A 2PDFA 1W91A 4AMCA 5I03A 4NAFA 3A4JA 3DG6A 2O9TA 5C9ZA 1EJXC 2OZTA 3UWQA 1DXEA 2BGNE 4DEFA 4JHMA 1ONEA 4HK7A 3VX1A 3AMDA 1E9ZB 1NJJA 1A5BA 1B2YA 3I10A 3AMKA 3OZPA 2YXOA 1E6NA 1TZZA 3SSJA 2HVNA 1LLWA 1IQ8A 1XL9A 4J1OA 1JPDX 3P62A 2XYLA 1LYXA 4V2XA 1HKJA 4PMZA 5FAJA 1GJUA 2DGAA 3NQAA 3SRKA 3O9NA 2BGSA 4QIUA 4B5TA 4E38A 1HG3A 3POCA 2D3LA 5HANA 3PSWA 3F5JA 3DHDA 3LTSA 4A3RA 4WR3A 2HWGA 1Y5VA 4ROPA 4S3AA 2ZICA 3N29A 4G7FA 1PZ3A 2EQDA 5F1VA 5EBAA 1AMKA 1J4EA 1ZU8A 4CQAA 1PAMA 2QCDB 4KGLA 2DZVA 4ONVA 1BSIA 4PMYA 4EANA 1DWAM 2V5CA 3UCDA 1PE1A 3SW6A 3VGBA 3QHNA 1XCXA 5DF0A 1Q2SA 1DYSA 1FA2A 4QEHA 5F1UA 1KTNA 4M6VA 3R25A 2VURA 1IWBA 4ICCX 5C54A 1CBGA 3KWXA 5B80A 4AZGA 3KDNA 3ENLA 4NAEA 1CNVA 3GE7A 4HN8A 4AWUA 2H3DA 4IP5A 1JGMA 4IP7A 4JBRA 4W4QA 1H7XA 1XXXA 3M0MA 3WCZA 3L4ZA 2VDGA 3CZEA 3P67A 2QV5A 4ERIA 3IGUA 2PGEA 5CC6A 5PTDA 5CPOA 4AX7A 3PTDA 1CIUA 4GJJA 1J01A 4IXXA 2OSWA 3THAA 3SUUA 4YWSA 2GQAA 4D8LA 3VCRA 1JYWA 4UTKA 1S46A 4NYYA 3W22A 3BQ6A 1EJRC 6REQA 3IJIA 4QROA 3HIJA 2BHYA 3P2VA 3S42A 1CPUA 2NVDA 3P60A 4PL2A 4IJRA 1MDLA 4WXZA 3OVQA 4H6QA 4KW2A 1UWSA 3M7WA 4RV8A 3BLLA 5KITA 3NDYA 2Q3RA 1SQ7A 1GKPA 1MUMA 3ICJA 2WO5A 1LLZA 1TWDA 2QDEA 4YTQA 2VL4A 3OZOA 3RRAA 4BHYA 4AEFA 4HA3A 3FFSA 4MHBA 3TKFA 1XLIA 4L4PA 1I9CB 4WUIA 3WO8A 3QKEA 3TC6A 4OBRA 4PSPA 2D0HA 4NNCA 3IJQA 5CG0A 4TMBA 1DJHA 2QUVA 2BY2A 1O66A 4HNLA 4A4AA 4E3TA 3BURA 1P0NA 5M03A 1EQCA 2A1YA 1QNQA 3I7SA 4DAIA 3NL3A 4AHOA 4GGHA 4CVUA 3P93A 3GG8A 2WANA 4O1DA 3MVIA 1HKVA 2R91A 3T0AA 1QATA 3LHYA 3W7RA 2EG7A 3AYRA 3NQDA 3HPZA 3TCSA 4F9JA 2XGIA 4DJDA 2EG6A 1CB2A 5BWFA 4RDWA 4GKTA 7ENLA 4AVNA 2NX3A 1M01A 1RLCL 1BWKA 3WF2A 1E72M 1GJWA 3RGTA 2PI6A 1KXHA 4HZ8A 1AMYA 3MI6A 4BWLA 1A5KC 1V3KA 3GU9A 1RXOB 4RW3A 3TMQA 3LCIA 5BRQA 4WJ8A 4O4VA 1U5JA 3CUFA 3VMOA 4C6MA 4IFKB 1RHCA 3REQA 4AHQA 1K6WA 2OWWA 2HVOA 2JFEX 2OPJA 2PDUA 1YLVA 2WHLA 1YNPA 4HHPA 5DMMA 4ZSUA 4GH3A 3O6AA 1VD6A 2PB1A 2DFAA 2P0IA 1D3GA 1MDRA 3T4WA 4PA8A 3BCDA 4QE4A 3KDOA 1DWFM 1WB0A 4KWWA 5JBDA 5BMXA 1NDYA 4PTVA 1W5OA 3K1GA 1W9VA 1DXFA 1QI4A 1KNWA 3L4UA 3RMJA 2J79A 3NQMA 4CQBA 5C2CA 4AD1A 4PTXA 3THDA 1XC6A 3GDMA 2DPEA 1YQ2A 3GIPA 1C91A 3LS9A 4GXPA 4WDWA 4UOZA 1XLHA 4KT2A 1PS9A 1OVDA 1BG9A 1NEYA 3UW6A 3UPMA 3LHWA 1ONWA 4Q6JA 4P5UA 2WXDM 4DLFA 1V4YA 4GK8A 4X63A 5J04A 3CZJA 4M3PA 4FNQA 3VNKA 3U0HA 1ZSXA 3DH7A 4AU0A 2VFEA 1W56A 2CLOA 3ARYA 2IKJA 3K30A 1YBQA 1LG2A 3UGRA 4S23A 2X7WA 3G8RA 3VIFA 1A50A 4GZ7A 3GY1A 1TVNA 4A29A 4GBDA 4KS0A 2A79A 1NTHA 4S38A 4OU1A 4GO8A 1XWYA 4P61A 1FWWA 2OYKA 4GYJA 3GH7A 3BH4A 1JFHA 3P14A 1SFTA 4N9CA 1ALDA 2CCRA 2EPOA 4M6QA 1WA3A 4IG2B 2E5DA 1V6XA 4C6KA 4YL2A 3UXLA 2QCGA 3L21A 3LPPA 1TV2A 3DAQA 4YXGA 3PHAA 1VIWA 4DF1A 3TP4A 3CYVA 1ISXA 3WLSA 2BMBA 3AAMA 4C5ZA 4GQRA 1EF3A 3V4BA 1FWGC 2WMIA 3I6EA 2ZX8A 3VD3A 1QVBA 3P3BA 3KL3A 3PF3A 1WUEA 5KMYA 2QAFA 4YHEA 2ZYFA 4B91A 3GTXA 1TUXA 3VKKA 4LCSA 4KCTA 2OODA 1TIMA 2VEKA 4OT7A 4NQ1A 1EWEA 3S4TA 2C0HA 3IGSA 5KZMA 5FF3A 3FDGA 4IT1A 4NSBA 2O9PA 4JX5A 1FUYA 1PO9A 3FSUA 4ORMA 5CZJA 3K1DA 5AKQA 2HXUA 4AG0A 4IIFA 3S0CA 3TFXA 2BV9A 4QSFA 1AW2A 1E56A 4LVFA 1IXNA 4UR8A 4AD0A 3R10A 4QJ4B 1WE5A 1DIDA 4O53A 1F4AA 4DJFC 1OEPA 3U9IA 4UZUA 3M6DA 4JDBA 1N8WA 3P7YA 2P3ZA 2WVSA 2HK0A 5HWNA 1S5TA 4EOUA 1UUOA 1TV3A 2WMHA 4NASA 4JPGA 3BAXA 1IWPA 4Q32A 2V6AA 3R8HA 3TN3A 4IPIA 4F3HA 3DOPA 1DIOA 5DXXA 1G7UA 3NQ8A 3C61A 4NG3A 3ARSA 4ZQMA 4DJED 2AOSA 2OR2A 1O5QA 3KTCA 4HJFA 3CMJA 1FFQA 3AIUA 3GC4A 2QJMA 3GVQA 3F2DA 1LJYA 5HMFA 4XD4A 3BXWA 2CZEA 3T6CA 4O15A 2VKZG 1XDLA 4NZ5A 2ZZ7A 1FWIC 1CGUA 4WY0B 1E0TA 1E70M 4J4KA 1F8IA 2DSKA 2XFRA 3OYZA 3HG4A 3NQ7A 1EOMA 5F4WA 1U33A 2V3FA 2Y62A 5T91A 3ZLFA 4RLIA 4YU1A 1B30A 1E9YB 3UESA 2Y7FA 2ZZ4A 1PX3A 1CXFA 4M6UA 4M82A 1XGDA 2OLHA 3M1ZA 3ITVA 3IUIA 4QS5A 2ATSA 1VCVA 2W91A 4L7ZA 4JYFA 1YPXA 4HHMA 3N2CA 3VAVA 3PS7A 3IV8A 4FF7A 4D9PA 3R4IA 1R86A 3QW4B 4UTIA 2YCJA 5DMLA 2WVVB 1EX5A 2J62A 5AOUA 3NAVA 3UBPC 3QQ0A 4GVHA 5I0DA 1G7VA 1QWGA 5K2ZA 4QS6A 4KWSA 1JUKA 4RKAA 4RE4A 1MQPA 5EPDA 1V3IA 1UZDA 5H1WA 2OKOA 4BQ2A 3S1GA 4AZCA 1VLWA 4O10A 2OEJA 3MKVA 3N15A 1EIBA 2NLIA 2WKGA 2J7EA 5JMUA 4NZCA 4S3KA 2OTDA 4ZO6A 1BXNA 1ZTVA 1NFBA 2QJIA 4HGXA 1AZ1A 5A6BA 3W7NA 3W70A 1KC7A 3W72A 2PDLA 1BQCA 3F03K 1XDMA 3UERA 3URAA 3BE7A 1TJ2A 2D3NA 4Y7EA 1V03A 3TZNA 3TA9A 3SUTA 3R94A 3CV6A 2CLEA 4PBGA 3PPGA 3TOPA 2GDQA 3W7GA 4J5NA 2XIBA 3UYCA 5BNKA 1BPLB 2ZDSA 1XBYA 3BLFA 1JZ7A 1UIPA 4EXQA 3GDTA 2QPSA 1R6WA 1K9EA 4N0RA 3KOFA 5BZAA 4ASTA 3AS0A 1JCJA 2CHOA 2XTKA 5CSUA 4WDTA 1W1A1 1UKSA 1V0NA 4P7RA 4H9MA 1OT1A 2ZRVA 4LBSA 3WFZA 1J2WA 1ME7A 4PL1A 4YLWA 1YRRA 2HRWA 2P50A 5AYZA 1VFTA 2RUSA 1GWJA 1UQZA 2YPIA 3WUBA 1JDAA 4EPKA 4JFWA 4GC4A 4AD5A 1G1YA 4O17A 3EPOA 3LMYA 4MWAD 4NNAA 1YE4A 2XWEA 3OLEA 3U5UA 4H8NA 2YGYA 1W3TA 1GVQA 5FEWA 3A24A 4IQLA 3WD0A 1T8QA 3UG4A 3PJWA 4PEKA 4PGLA 5A6SA 1C8QA 3G6MA 2HVMA 2Z0IA 3VNYA 4Y9MA 1SZFA 1B9ZA 4FHAA 4LSBA 5G1TA 4ICMA 4S3GA 1I75A 3DHFA 1D9EA 4JGDA 4ZQNA 1WDSA 3OVGA 3WH6A 4CKQA 5CAHA 2FZNA 2A21A 3QOMA 2RFGA 3TR2A 4EF8A 5CGQA 2NT1A 2DZTA 2PDHA 5CZTA 2VR5A 3G24A 2YA1A 4HPNA 4JN6A 1ZHAA 5HAOA 3M0HA 3VGFA 3ZZ1A 1BF2A 5EFFA 7REQA 5D2TA 3TONA 3CXOA 5XIMA 1IV8A 3HQNA 4A8IA 2J74A 2D20A 3BOFA 2XVLA 2E6DA 3EYPA 4AD3A 4WX2A 3OP2A 3EWBX 3O05A 4XD5A 3AIRA 5CC5A 4UQAA 2Q8ZA 3QV6A 3EWYA 1A3HA 1NFGA 3MSDA 3BLOA 3H53A 2VGFA 3T0BA 4DUXA 1KGXA 1WDDA 2YLAA 1V6UA 2ZKMX 1GONA 1JG9A 3K4DA 3PG8A 1OD8A 4Q4KA 4I7WA 2WMJA 5LXEA 3VE9A 3OB8A 3WLTA 5XIAA 3SGZA 4IJBA 3CO8A 3SJNA 3QTGA 2TYSA 2ZBTA 3A6OA 1H1YA 3KRUA 2V0TA 1P1XA 1P1MA 3WG6A 3SZ8A 3R5EA 2PBOA 1KGWA 1YXYA 1S38A 3O07A 5K4XA 2D69A 3DN5A 3N73A 4F2BA 3NXLA 1KCZA 3L2IA 4OZOA 1LWJA 2Z1SA 3AOFA 3SN1A 4F8XA 4ZEPA 1EO5A 1PDZA 4UFMA 3VIKA 4MSSA 1XYMA 1NVMA 2VD8A 1L2UA 2CLLA 2W79A 2QHAA 1EP1A 4P7LA 3VINA 2PTDA 1TCMA 2TRSA 5MKGB 5JIWA 3NGJA 3PG9A 3KVMA 3CHCA 3M4HA 2ZRUA 4H9UA 3W1PA 3I68A 3PVFA 1L8PA 3UJ2A 4XK2A 4I6VA 1W3IA 3DENA 2HNEA 4M51A 1F05A 3DFHA 2VDIA 4N4QA 1R8LA 1GOIA 2BNJA 4Q8UA 3B8TA 2V82A 2XIMA 2XZ7A 1F6YA 3HG3A 4ACZA 4TQTA 1BQGA 2PWUA 4ZOBA 4JTFA 1ADOA 1R3YA 3AXMA 2AL1A 3AU6A 4LOCA 2ATMA 4ZB2A 2Z24A 1G0CA 3ABOA 2HROA 2XN1A 5E9XA 3HJEA 3O6YX 2W67A 5LA2A 3AXHA 3CMGA 3UPWA 1S5NA 2IQ0A 4MKSA 5IHRA 3L0KA 1EP2A 4KEVA 3AZRA 3T55A 1GQLA 3DX5A 1OFQA 2ZX6A 1WKEA 1TZ7A 3O15A 1KBIA 1LUCA 3ARVA 1RZMA 3PBWA 4WCJA 2CBVA 5FJTA 5AYXA 2WV8A 4XBKA 3NJ3A 2Q02A 1F2JA 5ABFA 3AMGA 3RX3A 1E73M 1JPHA 1YTEA 3W2MA 1XH1A 4QITA 5H91A 2O56A 1DJIA 1M53A 2CKRA 1PZ0A 3Q37A 3UWEA 2YXXA 4ZMGA 1KQZA 5HWMA 3TK7A 4LJ3A 3WLKX 1G5AA 3PPFA 5HJYA 3TYBA 5A6AA 3S1WA 3LUTA 1V0KA 4ACYA 2MANA 4HU8A 3GZ3A 3CAQA 1J5SA 4H7CA 3H26A 3W76A 4O8RA 1KQYA 3JZEA 1SO3A 3ZT7A 4F2UA 4CD6A 2RJHA 3MV01 4IQEA 4W93A 3NPWA 5A95A 2QJJA 3IIZA 1UYQA 2YCLB 5E0FA 3DYOA 2G3MA 1FH9A 3UZ5A 2TPSA 3L2MA 4YJ5A 2Y8VA 4LWWA 3ZWTA 3N13A 3C5QA 5HR7A 3W38A 3KRZA 1XG3A 1TO3A 1DHKA 1QPRA 4JTUA 1KW1A 1JYXA 5I3KA 4ALDA 5E6YA 2V9DA 3RLUA 1HJQA 2GK1A 1RY0A 2POTA 4YVXA 3N1AA 3O7UA 2GJXA 4H2HA 2YSWA 1JFXA 4O14A 4NZJA 3UNDA 3W85A 8RUCA 2WCGA 5I3DA 1L6WA 5AHFA 1F3WA 1K70A 2DSZA 4IIEA 3EPMA 3PTMA 4PTMA 3LHZA 4HNCA 4W86A 4K39A 4O8AA 4KWUA 4O13A 5CSSA 1KWKA 2DZSA 1EX1A 1J79A 3W1NA 1SSDA 3CL6A 5GJMA 3RXZA 1U83A 5BU9A 3WQDA 4IIBA 5FA5A 2PDWA 1MQQA 2QMKA 4CU7A 2E6AA 3MCMA 5GJPA 3WQPA 1MVYA 1KRAC 5LNSA 2B7NA 4O1EA 4Y9AA 3UZXA 5K4ZA 4DUWA 3DI0A 4Z08A 4KCUA 2WSPA 3NO5A 1RJPA 3IIXA 4M29A 1TWIA 1UWTA 1E4IA 4HZ6A 2XH2A 2PEVA 4MFDA 2YCIX 3T2PA 3EMQA 1GVEA 2CLPA 1TE1A 3R0KA 2E6FA 1PKLA 3GDLA 3WK1A 3QY6A 3FEMA 3EXTA 4YIWA 4QLJA 3SCOA 3OLDA 3RAOA 2PUZA 4R7WA 4DM1A 3O63A 3L4YA 5I07A 4AC1X 5LHFA 4IMGA 2JKEA 3QMSA 3NCOA 2GQ8A 1Q6QA 1J93A 2CLIA 1RH9A 3HGJA 4LVAA 4XD6A 4DI8A 1FP8A 2X1UA 2EPMX 5ECUA 4LRTA 3RJYA 3RM9A 1BGGA 2PGFA 2TAAA 2YLLA 1XBZA 3SGGA 1ECEA 4FXRA 2WSRA 2F61A 5L9FA 5HJLA 3A64A 2DZBA 4M80A 2X05A 3C0QA 2PODA 3UVAA 4JL2A 1GCYA 3CAWA 3VIHA 3B04A 1EDTA 2DZPA 1ODZA 4PMUA 3HMJG 1LRTA 4AHPA 1LWIA 4R33A 1UZHA 3SFWA 3QV9A 1NOFA 4NJJA 3WBWA 2GQ3A 1UR0A 2GUYA 4GI9A 2J13A 1OWQA 4MLJA 1SFSA 2WYSA 5I24A 2QDDA 4O52A 2NVCA 1HN1A 3MKKA 1Q6EA 3V5FA 1GZ1A 4Q6XA 1EA9C 4K1GA 2CZ5A 2YDQA 4KERA 3DEQA 4UTLA 4O11A 4W7VA 1DWJM 4UTJA 4GA8A 1GQNA 4HOWA 3R13A 1DL3A 3GU1A 3S6DA 4HMCA 2I9UA 1FWBC 1V7AA 1N55A 2PD5A 4UMAA 3UXIA 2BBFA 1SJBA 4S3CA 2VDHA 8TIMA 3MCOA 2PWHA 5EMKA 4YYFA 1FX6A 3NPVA 4FNSA 4JIRA 5A6MA 2J9XA 2Y5EA 2ISDA 3LBOA 3AYSA 5D9PA 1HP5A 1GOXA 4D1IA 5REQB 1XYBA 1EL3A 2VC9A 1QNPA 3MP3A 3QC0A 3Q67A 2BHZA 4LFYA 3UD6A 7XIMA 1TX0A 3C2OA 5FJRA 2NQHA 2OSXA 4MZYA 2WC3A 4G2DA 1K4HA 1Z48A 4EPBC 5BXSA 4QRNA 1GEQA 1VFOA 4JFSA 3M07A 4D2JA 4FR6A 1YPFA 3W2NA 1AW5A 1P0DA 4CLMA 2EXOA 5DMNA 2YDRA 1W5QA 5LYRA 1O4UA 3TWBA 1OD0A 3Q45A 5C71A 2D73A 3J7HA 1KRCC 1JQVA 5D33A 3VOGA 2FB2A 1OCNA 4O0QA 1TWSA 4K3ZA 1OYBA 1S2TA 3AIVA 4E2BA 4W89A 2X2YA 2H3BA 1ZY9A 2VZOA 2BOFX 4WY0F 1XLAA 3BICA 1H1NA 1FXQA 3KE0A 4MWAA 1KM6A 4IL2A 3ZJKA 4GQ0A 3EA3A 3LPFA 1JGIA 1L6GA 2J6VA 2DUXA 4GO9A 5IRPA 3DCPA 1TPVA 4XISA 1O7AA 5MHBA 2C16A 4CQ8A 5CKSA 1WDWA 4AH7A 2I5QA 1FWJC 3TNBA 1OZQA 4K36A 1XIFA 4GG9A 1DJQA 2XWDA 4EX4A 3MUCA 3C3UA 3TWAA 4O0ZA 2JEPA 3BDKA 1UH2A 4E8DA 3EX3A 3G3DA 3NQ6A 2A7RA 2QMJA 4JTTA 3V75A 1XICA 3VNIA 3SB0A 5IBXA 4JN8A 1OIMA 4RDVA 2CW6A 3T08A 4H9XA 3S46A 2HNHA 4LALA 1THFD 4AQLA 1H41A 3GS6A 3U8GA 1JCYA 2ZUNA 5HWJA 1Q6OA 2PCQA 1V51A 1JUBA 3TUUA 7PTDA 2ACRA 2V63A 3DXIA 4L64A 3UJSA 3WK2A 3TTEA 4XVEA 4D6CA 1PZ2A 3GHTA 3TYCA 2OJPA 2KX9A 1SZGA 1XCFA 2ZDRA 4Q4SA 4HVXA 1OCQA 4LNYA 2ESCA 4UFHA 4Z2KA 4ZB0A 4WF7A 1AH3A 4HTYA 1GZGA 4IZGA 2VENA 2NUYA 4XO6A 5IOBA 2XJ7A 4DPPA 2YKKA 3LCFA 3RPTA 4I8DA 3IVSA 3BWWA 4DYKA 2O7QA 2E25A 1LBMA 3MBDA 4GD0A 1MW3A 3GM8A 2A6NA 4NXSA 2BZNA 2GSEA 4UTFA 5U4NA 4D6GA 3EXRA 4U3CA 4YTSA 5H8PA 1SW7A 2V2HA 5HJXA 2HZGA 1VHNA 3W74A 3ZFHA 2WNWA 4CNNA 4JEQA 2Z2AA 2PRLA 3M46A 1HVXA 3EOSA 3FAXA 4W5UA 3UG3A 4LYQA 2R9RA 2I5IA 2G3JA 2ACQA 1DWGM 3GVGA 1DQXA 1E51A 1US3A 4QX4A 2QAPA 3UG5A 3W26A 2ASHA 3SECA 3OHMB 3MUXA 2NQLA 2CLKA 2QPXA 3NL6A 2W66A 4CCEA 3BLDA 4DM2A 4IG2A 4H19A 3SN4A 4FP1A 1UCWA 4O18A 2NXGA 2NUXA 3LCGA 4K6AA 3CT2A 3LENA 3RO6A 4GQQA 3B8IA 4FLOA 4NAFB 3NR0A 3ANYA 3BV7A 5LNUA 1FWFC 3PZTA 1FWEC 4E4PA 1ICPA 1K7XA 1ZCOA 4CEXC 1VFLA 4FLRA 1MW0A 5FACA 3IJ7A 2F6UA 4HT3A 4IPLA 3ERPA 4KRTA 3NXFA 2PSNA 5FKYA 1OG6A 3FYYA 2OLAA 3GXDA 3AHZA 4FNRA 1DJXA 1TMLA 4TUFA 4LYKA 1OC6A 1ONRA 3FKRA 3WBAA 3PN8A 2ZUTA 4JTRA 3BLIA 1QDSA 4TVUA 4PCTA 3G1HA 1R0MA 4JHOA 4BK9A 2ZZ5A 5GNXA 4WVXA 1UQYA 3KCLA 1EEPA 4RE0A 1B4KA 4NRRA 2G4JA 3A22A 3TEVA 3WQFA 1KFKA 4X2RA 1GPWA 2B31A 2PDYA 3GHSA 3TSDA 3LG3A 3N2OA 1ICSA 4TVCA 2J8GA 2XN2A 3A9IA 3AC0A 1T0OA 3GD6A 4G7EB 4JTAA 3WL0A 1JNEA 1T41A 4J3WA 3ZR5A 1FH7A 4A35A 1JJKA 4I3GA 4D8ZA 4GYKA 1Q7ZA 3OG2A 3N2BA 1TTJA 1YHTA 4ATDA 4HZMA 4BI6A 3HPXA 1KD0A 4H7VA 2I56A 2D2HA 3UJEA 4DUOA 1AD4A 4ES4A 1DBTA 2BSLA 4PSRA 1B3OA 3BZJA 3U5YA 2GOKA 3MMDA 1A4LA 3DFTA 4ZENA 2C15A 4KQNA 1LLOA 3SCWA 1RVKA 3SCSA 3GKFA 3EGJA 3H12A 4MNJA 1CLKA 4EKJA 3L9CA 2TMDA 1XIDA 5LIKX 3BAJA 3W23A 2PFHA 2GJNA 2YA2A 3DG7A 2IXUA 2X0SA 3K2GA 3M6YA 4NZ1A 1EO7A 1CI1A 2XGZA 4DHGA 1XLGA 4NY2A 1J8VA 4NAEB 3GYCA 2ABAA 1HKMA 4TO8A 1KFCA 1J11A 3N04A 2ZWZA 2IPGA 1GOMA 4Y8FA 3W7HA 5D9MA 4GNJA 2L5HA 1UR8A 3RLHA 4GLEA 3SUWA 3CHVA 2IPWA 3I3BA 2JKPA 2GDUA 1XCWA 4CD7A 4ORIA 2IPJA 3E0VA 4J28A 3HFYA 2WJDA 5I77A 1YADA 5D32A 3PZVA 3S9YA 3LHVA 4AX6A 2WVVA 3UXAA 5M5DA 3SN0A 3RCMA 3W87A 4J3SA 3EX2A 2X42A 2GVJA 4GUIA 2FGBA 2YL6A 3W53A 3QBUA 4R34A 3NNTA 3LGEA 4X61A 3VOFA 1X98A 3O2LA 4L6OA 2VVNA 1FHVA 2FQIA 2VZSA 4IXHA 4IMAA 3MANA 1TG7A 1GTEA 3M5ZA 1AL8A 1FWAC 2BXYA 4L5ZA 1I2QA 4Z0JA 5G4HC 2HK1A 1SO4A 2VP8A 2AKZA 1RAKA 4H2CA 1J9YA 3VIPA 3E38A 3F5LA 4M6PA 2B81A 5H8MA 3O16A 4R27A 2WVUA 1UMYA 3AZTA 1KBKA 4MY1A 4N7QA 3MWAA 1W9PA 4F0HA 2YFNA 2G95A 2Y88A 1H1ZA 1QRQA 1V6WA 3MZ2A 1CLVA 4K68A 1XSKA 1IXPA 1PIGA 2DP3A 1V3LA 1S1PA 4XIAA 3MJYA 2NQJA 4MKVA 1PTGA 3JZUA 1HJUA 3IS4A 4IPPA 2ALDA 1W5PA 2CBIA 3QYQA 1LT7A 1CXHA 4JYEA 3VDBA 2CPUA 2X1RA 1EUNA 4GCAA 4XG1A 4XX6A 2DH2A 3N9KA 5A6KA 4Y90A 2Z26A 3MMWA 1FBAA 4NF7A 2WJZA 1AVAA 1EYEA 3DBNA 5CH9A 3WUFA 1R3TA 1XSIA 3KW3A 1R9YA 2O4QA 2OO0A 2A3AA 1ISZA 4B15A 3KOXA 2EPHA 1ECQA 1WNOA 1FXPA 3I4KA 2A0NA 3MHGA 3OBKA 4DJFD 3KRBA 2VGBA 3OA3A 1RA5A 1JZ6A 5HINA 2Y7DA 1ZALA 1XLJA 4NI3A 4H01A 3ATZA 1H51A 1W5NA 4G1KA 3UWUA 1OB0A 1XLDA 3NVTA 2PD9A 3DFYA 3NOYA 1QNVA 1J10A 1K02A 1W9UA 2D0GA 2OCZA 3P0WA 4D6HA 1RBLA 2G50A 3CHDA 3RR1A 4I5XA 3QMTA 2GLKA 3USZA 1MUWA 1MQRA 3OOQA 3ABZA 2VO5A 1VHCA 2IS7A 4HD5A 3JRKA 3PB0A 3STPA 4NJHA 3ITCA 1TKKA 2YB4A 1YBQB 4FNUA 3WLOA 4Q7BA 4H4IA 1KRBC 5CPMA 1KKRA 4EWJA 3WJYA 3VNDA 4N6EA 3P8JA 3FJ4A 3N14A 3TLQA 2INFA 4AWTA 5D30A 2NWSA 3LV5A 1KCLA 1RCQA 3GNOA 2V81A 3CO4A 3URQA 3W7KA 8A3HA 1YW1A 4AISA 4XZBA 4M19A 2O7SA 2PC4A 2IKIA 4W8BA 2GWNA 3B4YA 1ZENA 2E7FA 2PP1A 3L68A 4BCEA 3AROA 3P8IA 4FI4A 3SCUA 4G1NA 1GZJA 3TU9A 5LSMA 4LUIA 4P2VA 3GXMA 3N17A 3N19B 4WKHA 4WSHA 1X39A 1E6RA 3TLLA 4BEQA 1SU5A 3WD3A 1GOOA 4I6KA 4GUGA 3OW1A 2VUYA 1FHDA 9XIMA 5I78A 5BU6A 4B16A 2FHFA 3OBAA 1NOWA 3Q2DA 4TTUA 5LKYA 2YX0A 2ZVRA 3C2FA 3CAKA 3FDKA 5ECVA 1R7OA 1H0GA 1IE7C 4DBDA 1WXJA 4LC8A 2YL5A 2PU0A 2GSHA 3GYEA 2E1WA 4A22A 1ADSA 4BJHA 5HDRA 4AYSA 3AIQA 2P3EA 3NZ1A 1TX2A 2XVNA 4UTTC 2ZRZA 3OHIA 1F76A 4HPHA 1UW9A 4X2PA 3VFLA 4DN1A 5C0QA 3T2QA 3CZGA 4AC7C 4O1BA 5AC6A 1JXJA 5MKGA 3R43A 1RK6A 1GHRA 3MO7A 4E5TA 1TV8A 4OGZA 1DTNA 1OGGA 4ZE4A 3PNZA 3UA4A 1TIWA 2VNCA 3NFUA 3E74A 5A5WA 1TV4A 1F7BA 2EO7A 2V30A 1D3HA 4OV4A 1WCGA 1QI5A 1G4PA 4M56A 3N9RA 1I45A 3LBCA 4KIEA 3N2TA 3H8AA 2A3CA 4RW5A 1XX1A 2FTWA 3UNTA 1FWNA 1JXKA 5TF0A 3A47A 1X6NA 3BSMA 1PV8A 1UR2A 2WC4A 1HJXA 3A12A 3E1F1 4J27A 4QSHA 3CQJA 2CZVA 1XIHA 4OVXA 1TVLA 1FHLA 4HZ7A 4S2CA 1PKYA 1ITXA 1J96A 1JRCA 3NM1A 1W1YA 2XVPA 3ARQA 2WB5A 3IGXA 3T07A 1UHVA 3GTIA 4JCLA 4Z2HA 1QO5A 2OMAA 1JULA 3QY8A 4N4PA 1IT7A 4MJMA 4ZE5A 3VKCA 3HJZA 1OJXA 4CN4A 4IGHA 2CFFA 3S2LA 2HBXA 4X60A 1EJTC 2CU0A 2G96A 1Q6DA 2P8BA 2IUZA 5AHNA 2IXVA 3U4AA 3SQSA 4X9SA 5JUVA 1IR2A 1V3MA 3VKAA 3NZPA 3LGGA 1W1TA 5DT5A 2ZZ6A 3R1ZA 2OQHA 3HF3A 1LRNA 3P0XA 1AA1B 5I23A 1DV7A 1C8VA 3WMCA 3MP5A 3DI1A 4EK7A 4JQ1A 3TTQA 2ZUUA 1S2UA 3T0DA 5FJJA 3C0LA 4QM1A 4U33A 3LCWA 5TBOA 5T9BG 1P43A 3LN3A 4WSKA 3LYEA 2DVTA 2P5NA 2J8FA 3KL0A 1QOPA 5DCDA 1C3FA 5A69A 5AHEA 2V3DA 2VHLA 3FVMA 3C6CA 1EJ7L 1CZ1A 2QQ6A 1V79A 1OCJA 1J18A 4W88A 1L6FA 3A3XA 2PLMA 3TYEA 4AZCB 2YCLA 4OBSA 3TV8A 1OFBA 4MZ8A 4DBSA 3WENA 2QF7A 2OOFA 1G67A 2Y1HA 2ZZ2A 4H41A 4GXMA 4K8GA 1VS1A 5FF4A 4MFEA 5HMSA 4DZHA 5FESA 3ALFA 4L61A 1W31A 2B7PA 4AIBA 1DVJA 3HO8A 1BRLB 2RDXA 1SZRA 3MCNA 2BVDA 1C93A 2OELA 1YDNA 2BODX 1X7IA 3U57A 4MY9A 5C2XA 4RNFA 1UMLA 3CBWA 3WF1A 3ZSTA 3NDOA 3ITYA 3GDRA 4O4WA 4ZL1A 3WDPP 2F8QA 3EEZA 3FJ6A 4JTQA 3WNOA 1OX4B 1ZLPA 4DF0A 3YPIA 1XIBA 4MIMA 1WO2A 3WF4A 3QR1A 3TX9A 5A8QA 4UFLA 4MUPA 5C7VA 1NSJA 1QNRA 1RCOB 1SUXA 3NL5A 2NV9A 1AL7A 4C6LA 4PMOA 1HXJA 2GFTA 4XUGA 1LQAA 4BEUA 1PEZA 2PTWA 1QR7A 3QR0A 3PPHA 5CPQA 1L2QA 3D3FA 1LM1A 3WLLA 5TNVA 1IHIA 3NUKA 4Z1BA 3GRIA 3C2YA 4HQVA 3DG3A 3GVVA 3HV8A 1DEDA 3TSBA 4QFUA 3THCA 4JY9A 2CLMA 2RDWA 4L65A 1AK5A 1GYLA 1EF2A 3WLHA 3UVIA 2Z29A 3T8LA 2PU1A 1FRBA 1WX0A 3SIZA 3QSTA 1T6MA 2HV5A 4BS0A 3FV9A 4H8HA 2FMOA 3O1NA 5A1AA 4H9YA 1B3XA 1GG1A 3QJAA 3HU7A 2VC7A 4PUNA 4QNWA 5HUPA 3R0DA 3PULA 3E96A 5CZSA 1J6OA 3RITA 2CESA 1BD0A 1V5XA 1X97A 3E0LA 1C7TA 1H7PA 2B0MA 5DMYA 3W1RA 1RD6A 1HKIA 3MYOA 5I00A 5KEZA 1K3UA 3GTHA 4AZHA 3G1DA 4S39A 1A47A 2VOMA 1GHSA 5TD4A 2QULA 1V6VA 2VUNA 5D05A 5LZLA 2HE5A 1WDRA 3QY7A 1QASA 7REQB 1IWAA 2JEQA 4LYRA 2A5HA 3AHVA 1E5JA 1OGSA 4H1ZA 1SW0A 1ZQ5A 4IIGA 3T9PA 4KEUA 1E6PA 1EKOA 2QCNA 3G5EA 4LEFA 3GLCA 2J77A 4QJ5B 3NO3A 3PJTA 4UQ9A 4O1FA 2GGIA 2VEPA 3HGSA 2WZMA 4MB4A 4KFPA 1RBAA 2J7DA 1MO0A 2CITA 4IPNB 3N6HA 2X41A 4JIHA 1CDGA 1R30A 2J25A 2J7HA 4C91A 1W1PA 2YW4A 1JAKA 1KXTA 3M0XA 3W7EA 5HUOA 2W63A 2VX6A 4HU3A 1EGZA 4UFJA 1O5KA 4RXGA 1M03A 1Q8AA 3W4RA 2C1HA 2OEKA 3VYLA 2V69A 3BAYA 3F4VA 3GBDA 1OSEA 2AAAA 2P10A 2R1PA 2E9BA 3KP0A 2ISVA 3LB0A 3UYIA 3WJSA 3G1YA 3TVAA 3ZVIA 5H2ZA 2Y8KA 3MDUA 4N9DA 1GPFA 1JDCA 3M0VA 4JEJA 1HL2A 5EMUA 4AYGA 2J27A 4HHLA 4DWSC 2VZUA 3ARPA 3OGVA 5TAOA 4J3ZA 1ZBWA 4U2YA 2DJXA 3UY7A 3LSBA 4JOMA 3C2VA 4C6IA 5I6SA 4CNUA 3G6LA 5E70A 1Q2RA 1C29A 4BKNA 5LIXX 3RMEA 1CEOA 2A3LA 1ISYA 1VBHA 1EC8A 1BYDA 2Q3OA 4LY8A 1W9DM 2PDIA 3NQCA 3ZR6A 3I3DA 3PBMA 2DQWA 3S3GA 3KOWA 4L1XA 4LCRA 1B90A 4NX0A 3RNDA 1XLMA 4KFNA 1ZNNA 3QQWA 4AW7A 3S1XA 3RU6A 5JVLA 5JH1A 1NDZA 1MUCA 1MW2A 4NX5A 5DT7A 3VTRA 1ONXA 4IHCA 3UQNA 3VM7A 5FSEC 2DU2A 3GG7A 1LUCB 3H2EA 5I09A 1VYPX 3VOCA 4DJFA 2FDSA 4Y6GA 4KBXA 2A85A 5IXEA 2VEGA 1EZWA 4U3AA 1CECA 1WUFA 5T9CE 1XKYA 1M1BA 4IGNA 1W6TA 4M0XA 3ABSA 3GG0A 4QCFA 4S2BA 1FWCC 1NP0A 2HISA 4ADSA 3UPBA 3FGCA 3TCEA 2FIQA 4GQGA 2J88A 3WFLA 4HK5A 1YDVA 1SJDA 2J6XA 4ZB5A 5T8GA 3W6MA 1UR3M 3F2BA 4MM1A 3KZPA 2FJKA 2ZADA 1Q6CA 1KCXA 2PA6A 1KV5A 3OVRA 3AMCA 4AAJA 5K7JA 2Z27A 2VWSA 1B3YA 4EPEC 3ZVHB 3U2CA 3TFCA 5HOSA 3GAYA 5CGMA 4B5VA 1HW6A 5DRIA 1H61A 2R1KA 1POJA 2R94A 4GRSA 6A3HA 5E0KA 1QO2A 3EWWA 1D8WA 3SCVA 4J7RA 2WZEA 4HSOA 4HPGA 3DU0A 3VDGA 3TC7A 3R6IA 4K7YA 1H63A 2J4GA 5HR6A 4MADA 4J40A 1XH2A 2BDQA 1XPGA 3LZ3A 3CJPA 1WKYA 2UY3A 3TN6A 2WPGA 2ZWYA 4GHRA 4FSAA 1ITQA 1YXDA 1Z41A 4AD2A 1M6JA 1A5OC 2DT0A 1JYVA 2GK1B 3VFCA 2PLCA 3EDKA 4IGMA 4NZFA 4ZA0A 5DRCA 3SUSA 1L9WA 4IMFA 1VFSA 1P7TA 8XIAA 3SJ3A 5E5CA 2GJXB 4H9ZA 4WOQA 1J2BA 4FXJA 2HSAA 4R53A 4ZOEA 4Q4RA 4J35A 2AL2A 3CV2A 2OT0A 3LI0A 1UWIA 3QW3A 1UC4A 1GW1A 3IK4A 4DXXA 2O9OA 2Z6JA 1TPEA 3VILA 2PLKA 3ONCA 3SCPA 2XISA 4D6FA 1LCOA 1OX5A 4ZO9A 2ZVIA 1KR1A 3OBEA 1OHLA 2J66A 4LH8A 1XLFA 3TE9A 3BGJA 1JD7A 4L9ZA 5CXPA 1VBRA 2OSYA 4A8RA 3N18A 4XZWA 3M44A 4W8LA 4NU7A 3S9IA 4JIPA 3UP8A 1RJRA 2VD9A 1FVPA 3WMLA 4YNGA 3EOOA 1KLYA 3EDJA 1X38A 3MWCA 1HQTA 3AO0A 3AICA 3WX7A 3WKZA 4F40A 1W3JA 4NJKA 2WBKA 1XYFA 2VEFA 3GR7A 1E4NA 1JF5A 3GR8A 4JXCA 4MAVA 2A7PA 4DB7A 3VNMA 2R1MA 3BW2A 3P82A 1H7OA 2V5KA 3MT1A 3QM3A 3N2XA 2GPTA 1JF6A 3WF0A 3S6TA 2FZMA 1AH0A 4LQ1A 5CG7A 2VFGA 3R0UA 2DIKA 1D7KA 1U1UA 4GZIA 3BANA 4C7FA 1SMAA 3KL5A 4O16A 3GX9A 3LEPA 3STFA 5DLCA 3WBYA 1ENUA 3DHUA 1H49A 2IKHA 5CPTA 5LNVA 2MUCA 1K7EA 3ABXA 5IM51 4PRRA 2TODA 2QYGA 2AAMA 1JQXA 2CBUA 1R3VA 4ZXLA 3L4VA 3SO7A 3ZJ8A 1ODUA 3SI9A 5I2UA 1Y7VA 4D72A 3QGVA 4JFVA 3GG1A 3BJTA 6PTDA 4XV0A 1RSCA 4H9TA 2F38A 2QJNA 2OZ0A 1AQ0A 5CCZA 1M7JA 1W32A 2JF7A 1AUSL 4INFA 3CQIA 4G7EA 3ZOAA 5FAGA 5EMJA 1TB3A 3UZYA 3N34A 2ANUA 1K9FA 4NHVA 3H55A 3GXNA 4QQUA 5C55A 4PFHA 4C6DA 4KESA 4PUKA 4DWDA 2CYGA 3GH5A 1KXVA 5EGRA 1XIGA 1FCVA 2X1SA 3WQ8A 1YEYA 2WWCA 2GL5A 9CGTA 4XQ6A 5FD0A 3V5OA 4L4LA 3TNOA 2ZX5A 2PPGA 3LA4A 4PYSA 5LGZA 3VC6A 2B4GA 1QWKA 4FPSA 1UASA 1VJZA 3H7RA 3IJLA 1YDOA 3FHAA 3MS8A 4US6A 5H6HA 1PKMA 4IQJA 3HFTA 3IANA 1FWSA 4RE2A 2BY1A 4MTVA 4EP8C 4KKXA 3FN9A 2QCEA 2QIIA 4P8VA 4TU1A 3AS1A 3NQFA 2YJQA 3WQGA 2V2CA 4MNKA 4FXSA 1H5VA 3N4FA 3UZWA 3B0XA 4DZ5A 3WL1A 3CB8A 5HQEA 1OGBA 2NWRA 3G2GA 4YCPA 4PC8A 3NO1A 2ZA2A 1GG0A 2IW0A 1RALA 1OM0A 1MI3A 3SSZA 1KFBA 3V0TA 3W9ZA 3O0KA 2V3GA 3K4WA 3MHUA