5C2XA

Crystal structure of deoxyribose-phosphate aldolase from colwellia psychrerythraea (tetragonal form)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
246
structure length
246
Chain Sequence
SDIKAVAQRALSLMDLTSLTNTETDQEIIDLCRQAKSPAGETAAICIFPRFIPVAKKALKAQQTPHIKIATVTNFPQGNDDLDIALAETRAAVAYGADEVDLVFPYRALIQGNETIGFDMVKVCKQACSGNAKLKVIIETGELKSEELIRKASEIAINAGADFIKTSTGKVAINATPEAAKVMLTVIKNKNTAVGFKPAGGVRNADDAAIYLDLADNILGNEWADANHFRFGASSLLISLLDTLGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Trading off stability against activity in extremophilic aldolases.
pubmed doi rcsb
source organism Colwellia psychrerythraea
molecule tags Lyase
total genus 96
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c2xA00
1JCYA 4WOQA 3W9ZA 3HPSA 3D0CA 5CSSA 1ADOA 2VENA 2HS6A 1TO3A 1EX5A 1XFBA 2R14A 2F7FA 4LOCA 3BGJA 1G4SA 3BK0A 3H54A 1OX4A 2Y7DA 1QAPA 4JD4A 1QPQA 4P61A 1Z42A 2B7NA 2G97A 3PVFA 1XBZA 3GDRA 1EUAA 1JR1A 1FBAA 3NQ2A 5LHEA 2VXNA 4KFOA 2A6LA 2WPBA 4IQLA 3VFLA 1OX5A 1FDJA 3OA3A 4PL1A 4AF0B 3LRMA 5HNRA 4HNTA 1ZJIA 3GXTA 3MI6A 3G1YA 5D30A 4IGHA 4WD0A 3CQ0A 1VLWA 5BRBA 1ME7A 4J9JA 4N4QA 4JX6A 4O0KA 5EPDA 1F2JA 2CLEA 1W3TA 3WJSA 3N2XA 4NJIA 4TMCA 1H63A 1VGAA 4Q4KA 2VFHA 3O1NA 1WXJA 3IIXA 5D2YA 4O10A 4OBTA 3NQMA 3UZJA 2DZTA 3PAJA 4HNNA 3O06A 2YCEA 3PB0A 2FPVA 2QDGA 1Q6RA 1BEUA 5DCDA 5AYXA 1WYIA 3QRHA 3GLCA 3W7QA 1KFKA 2H6RA 2ZRYA 4DF2A 5D04C 2ZA3A 1TCDA 3NPUA 1WX0A 3BW4A 4JTEA 5EA9A 1E51A 4LVBA 2QAPA 1MEWA 2ISWA 3HIJA 3HF3A 4IWWA 3L65A 3M41A 3R5EA 3DH7A 5G5IA 4AWSA 1B4KA 1UB3A 4YMZA 4NX5A 5DXXA 3W7DA 3BGGA 5BW6A 1LCOA 1OF6A 4E0CA 1OFQA 1Z48A 3MBDA 2I9EA 4TO8A 3W22A 2OMAA 4LW7A 3O07A 2P10A 4UC5A 1P4CA 1TTQA 3QC3A 4B5NA 1LRTA 3GR8A 3PWAA 1XBXA 4LRSA 3BG3A 3L66A 4GWEA 1D3GA 1DQWA 3VE9A 3U8GA 1FWWA 5AHIA 1TTIA 1PHQA 1H7XA 4ZQNA 1OFEA 4P2VA 2VKZG 3SGUA 3A21A 3GXPA 2WNQA 3IVSA 4XBSA 4OQVA 3F03K 4MOZA 3VI2A 1VHCA 1X6UA 2BLEA 4YXGA 1MEHA 5EMUA 3W2KA 1VCVA 5LNWA 3TSMA 1I2RA 4OE7A 3EX2A 1LBLA 2JK2A 3GX9A 2B7OA 4JGDA 4MPQA 2KZHA 3UPBA 3NL5A 3PR2A 4FNQA 2ABBA 3TX9A 4E2DA 3OIXA 5C55A 5I3HA 4JTIA 2WSRA 4QNWA 1F6PA 4RK8A 5EYWA 2ZA2A 2CFFA 1ICPA 4ZVJA 1VZWA 3TV8A 1FWTA 3UWUA 1ALDA 3I6RA 2VFFA 1GVSA 5F2IA 3VNDA 1KW1A 1NVMA 2YFOA 4HN4A 4N9BA 4GUFA 1I45A 1W5QA 3DFOA 3W7IA 2B0MA 3C56A 3SFKA 3L0KA 1K03A 1ZCOA 3DI1A 4UMBA 2ISVA 3W85A 1OF8A 3HJZA 4RZ5A 1FWRA 1OFDA 2EPHA 1T96A 2X1RA 2GJLA 3TQ0A 4XQ6A 3WJXA 2A1YA 1WDWA 4Y96A 1SO6A 3EWWA 3STCA 3W1MA 2GVGA 3PUEA 4JTGA 3TC6A 2FIQA 3VKJA 1YDOA 3IIOA 5CZSA 4OHQA 3VCRA 5MHBA 1O60A 3OHIA 4RZ6A 2PRHA 4WXZA 5TBOA 3UNDA 5AC7A 3I65A 1CI1A 3P84A 3B06A 2CLIA 3CLMA 4LUJA 1G7VA 3LHTA 5F1UA 1QOPA 2QCHA 5K9CA 4NXSA 1O4UA 1W37A 3N2MA 2GPTA 5D09A 4DBDA 3CEUA 3GAYA 4D2JA 1W3NA 5A5WA 1H7OA 4GUGA 2I14A 4O52A 1YYAA 4K39A 3UWQA 1JUKA 4A2RA 4CQAA 5D03A 5LNSA 3DHFA 3WFAA 1QPNA 1LOQA 1Z41A 1J2WA 3N3MA 3W87A 1BWKA 3W1RA 4XUGA 1HO4A 4EIVA 3F1QA 1XI3A 1QDSA 1TPUA 4FNSA 2YDAA 4XKYB 3PULA 1VLIA 4XTIA 3HPXA 4JYEA 1ZY9A 1O5XA 3EX1A 3BG5A 3HPZA 3I7QA 5K7JA 5C6MA 2EHHA 3BLEA 3RF9A 3GB6A 3W2UA 4MIMA 4O4VA 3LTPA 3RK8A 1L6SA 3NAVA 1UJPA 3TU9A 4A3UA 3L68A 1FCBA 4O13A 4Z1AA 3W7CA 1FDZA 1DHPA 4N9CA 3T78A 2C3ZA 3EWYA 1LZOA 3G1HA 4A29A 1SW0A 4AEOA 1TMHA 4XWUA 8TIMA 1XCFA 4FB7A 2Y61A 4BK9A 2JKEA 1AW5A 2Y63A 4WY0F 3U2OA 4WQ6A 3S5YA 3GR7A 3F4NA 4KWWA 1VR6A 4R34A 1QO5A 1GEQA 1GG1A 5GVJA 5U7SA 2ZRZA 3W86A 3S9YA 5G2WA 3L0GA 4NZFA 1IXPA 1TRIA 2EKCA 1GTEA 2UV8G 4DPQA 1VYSX 3PG8A 3QM3A 5CPNA 1GVFA 2HTMA 4O1DA 2CZFA 2FQIA 3MI3A 3P60A 1FWSA 4A22A 2GOUA 4KFNA 1XDMA 3N9RA 1LYXA 3SGZA 5F2LA 1LBFA 1FCUA 5KZMA 4PFMA 2FLIA 5G4WA 4LT9A 1FUYA 3GDMA 1EEPA 3GNNA 3PY2A 2P1FA 4TIMA 3W2NA 3TQKA 4UFLA 2YGYA 4PTNA 5D32A 2NXGA 3FOKA 4RZ4A 1GPWA 1RZMA 2ZYFA 1TJRA 4IJBA 1RR2A 5LNUA 3TE9A 1GJPA 2HSAA 4TR9A 3M5ZA 2RFGA 5CKSA 1TB3A 1KM4A 2NWSA 3QPYA 3HGRA 1B9BA 1OFAA 2NV1A 2GQ8A 1THFD 4NXKA 4Y6GA 5J5RA 1F6KA 2BTMA 4UR8A 5C5YA 1FQ0A 2E68A 1TSIA 3CWNA 2A4AA 1JUBA 2ZZ2A 4FO4A 1A5SA 1VPXA 5U4NA 5EL1A 3OBKA 4YCOA 4LRTA 4S2BA 1SO5A 5AHEA 3IVTA 3NQDA 3NDOA 5DXYA 2RDUA 1X1OA 2QF7A 2Y6ZA 4JY8A 2E5CA 3TQVA 1EIXA 2VEPA 3OVRA 2V82A 1IXQA 1RV8A 4O11A 4POCA 5E0KA 1TPEA 3NOEA 3W7OA 5EY5A 3IIZA 1SW7A 3GDKA 1OJXA 3QSRA 2Q8LA 2CU0A 4MZ1A 4CCEA 4O28A 3EWXA 3O63A 3LV6A 5F4XA 1S5WA 3GK0A 2YX0A 4MKNA 3C3NA 2YW3A 4CLMA 1VYPX 5F2GA 3WK1A 1XC4A 4PA8A 2A2IA 3WK0A 5D02A 4GC4A 3NXFA 3W7NA 2NXHA 4M7SA 3C2EA 1PS9A 3DKLA 1QCWA 2YR1A 3PSVA 4O15A 1O95A 4XTDA 3UY7A 3KVJA 4DO4A 4DPPA 1YXYA 3G8RA 5K9DA 3ATZA 4PEKA 3EKLA 1A5AA 3H53A 2A7RA 2C18A 3CPRA 5BMXA 4JTSA 1U83A 5DN1A 2A21A 3W2JA 5L9FA 1TRDA 4RKAA 4JXCA 1PCWA 1RQEA 3KVKA 3G1SA 3TAOA 3W23A 1EPXA 3TIMA 1FXQA 5KZDA 1AMKA 3T4CA 4AHOA 1QPRA 4K7YA 1ZHAA 5DY2A 1JCXA 4Q33A 1R2RA 2WJZA 3IVUA 3SY5A 3DBPA 5HINA 2QJGA 2EAWA 1RD5A 3NPWA 4IXXA 1DORA 3FA5A 3FS2A 5DCEA 2NUYA 1HUVA 5HR7A 4AWUA 3NL2A 2VEMA 3NQEA 2YW4A 3RFAA 3EWBX 4DELA 2GQAA 1KFBA 4JEQA 1TTJA 1FCQA 4ZMGA 4LV4A 3M6YA 1W5NA 1WA3A 3N19B 5TIMA 3PC0A 3W75A 2ZTKA 4ZQPA 1SO4A 1TV7A 3NGJA 3P8JA 4HPXA 4DF0A 1W0MA 4QJ1A 2VFDA 4WY0B 4QIUA 1OX6A 2QCEA 1H61A 4DO6A 4LV9A 1LM1A 2A85A 2FPTA 4AAJA 4UTTC 3W76A 3WJYA 3LCLA 2DORA 4ZL1A 5AHLA 1OVDA 1GTHA 3IV3A 2CLHA 2WV8A 3UYCA 1GVQA 1F74A 3EWZA 5D37A 3PBWA 4JYDA 3DI0A 4N2YA 4ZQMA 1LRQA 2ATSA 3DFNA 3QMTA 1J5TA 4XKYA 4FX7A 5E1QA 3AJXA 2QUUA 2A0NA 5LNRA 2Y88A 3L67A 2O7SA 5SWUA 3FLUA 4FF7A 4PC8A 3W72A 2D73A 2ZBTA 3LCFA 1FXPA 1VRDA 4R7JA 1YDNA 4K7VA 4IMDA 1PV8A 2QCMA 3BG9A 1LOSA 3W1TA 4MYAA 4GUJA 4JNMA 2QAFA 1LP6A 1M7OA 1YPIA 4UTIA 3H55A 1KTCA 2A5HA 3NQ6A 3SZ8A 1T99A 5H91A 4UTWC 3ZR4A 1XKYA 2IQTA 2NUXA 3S42A 4MYXA 1QOQA 1AL8A 4UFJA 2Z2UA 1VS1A 2WQPA 3CHVA 4MY1A 3LCXA 3WK3A 1K7FA 3A5FA 5D38A 3UY8A 1Q3NA 4MUZA 5K2ZA 5AHFA 1J4EA 4E2BA 2QR6A 4ADUA 3W7MA 2JBMA 2E6AA 1OG0A 1XUZA 4N6FA 4IPIA 3GIYA 5FI8A 2ZZ1A 5D05A 2Y7FA 1EP3A 4LY8A 4JIQA 4BWLA 4C1KA 4UTMA 1KBJA 5HULA 2ZZ4A 2R94A 3EXRA 4UTUA 5BMWA 1QNVA 5HR6A 2VOMA 3UWVA 4FEZA 4O57A 1TYGA 3CM4A 4U4MA 2QDHA 4X9SA 1LLZA 2OCZA 4MFDA 1KFLA 4H4IA 4OWGA 2E77A 3LTSA 4RV8A 2FB2A 2W0UA 3A24A 2C1HA 1EP2A 3EX3A 3P81A 1L6WA 2W6RA 1W8SA 3W74A 3NQ8A 4AB4A 3BARA 1WOBA 1C29A 1P0NA 2TRSA 4K37A 4NX0A 4K36A 2H3DA 5FESA 3TXZA 3LB0A 2B7QA 3FFSA 1ME8A 3U6WA 4R53A 3LLDA 3GNDA 3BW2A 1T8XA 3LTYA 5DBTA 5LKYA 3EX6A 5DCBA 4N4PA 2OZ0A 4NJKA 4M6VA 4N6EA 3LOTA 1MXSA 1XBVA 1GWJA 5FF2A 3LRLA 2B4GA 4IPJA 4PCFA 1N55A 3C2RA 1HO1A 3LERA 4O50A 1L6YA 3NZRA 5KMYA 3G0UA 1EWDA 3ZWSA 1PL9A 1QPOA 1ZAJA 3IGUA 4K8HA 3ATYA 4O1CA 4RJEA 1Q6OA 3LHZA 3W71A 1YPFA 1ZAIA 1RQBA 3STGA 4M5PA 2H8ZA 4RX0A 1AK5A 4CNPA 1YDVA 1T0OA 3DGRA 3AO0A 3B8DA 2V30A 1CW2A 5A8GA 4NNBA 3MO7A 3V1PA 1SW3A 2VEIA 1PIIA 3TXVA 2YPIA 2VFIA 1QFEA 3LDVA 3R2GA 4H6KA 3R13A 2J9ZA 2ALDA 3KRUA 3Q94A 2CLMA 3PBYA 3YPIA 2EGZA 1IIGA 3G0XA 1W5OA 2J9XA 1G6CA 1SPQA 3M5XA 1KV5A 1G4EA 1WQ5A 3M44A 3QW3A 4CQ8A 4TU1A 3TR2A 3USBA 4X22A 2Y7GA 2WSQA 2PRMA 3NO5A 4DEFA 1GVOA 4JTTA 4JTKA 3KRZA 1SZNA 4YLWA 4PL2A 2FPYA 4RXGA 1I2PA 2V5BA 1HG3A 3P7YA 2WOQA 4MZYA 3NR0A 1P1XA 3MUXA 4IX2A 3TNOA 2E09A 2Y7EA 3BO9A 4UTJA 1F05A 3B04A 3W7LA 5KITA 3QW4B 2A6NA 5I3IA 1IXNA 4LC6A 2QCNA 1A50A 3W84A 1JRBA 1LORA 3P74A 1GYLA 4QNEA 3NA8A 3GYEA 3N73A 3HGOA 1I4NA 3MP3A 3HOJA 4R33A 3TJLA 4RR4A 2H90A 3C4UA 1UUMA 3TC7A 5AFDA 1F73A 3ABQA 3M47A 2E5BA 4GUIA 1H7PA 1DJQA 3PG9A 4FIQA 1K3UA 1GT8A 2HMCA 2QCCA 1UCWA 1H50A 1KFEA 2F84A 3L5LA 4UTLA 4OGZA 1U5JA 1OFPA 3C2OA 3DFTA 3E12A 3HQ1A 5CZ0A 4MVAA 1KLYA 1OK4A 4IMGA 2JKPA 3P67A 2XN2A 3S1WA 1OHLA 5E93A 2YZRA 4WY0A 4E38A 4O1AA 5CPMA 3IEBA 2O7QA 1IIHA 4AHPA 3GDTA 4CCCA 2ZFAA 2NX9A 3EXSA 1RVGA 3GKFA 2P0OA 1Q6LA 2E6YA 6TIMA 2QJIA 4UFMA 3L0NA 1KM0A 5DLCA 2YSWA 5HQEA 1FDYA 2GVJA 5BOOA 1DVJA 1VCFA 3STFA 2CZEA 3M0ZA 3Q2DA 2OT0A 2OX1A 4GUHA 3QPZA 4XZ9A 1MSSA 1DJNA 3LXCA 2DJXA 4O1BA 3W7KA 2EF9A 4K6AA 1OK6A 2A7PA 4OU1A 1SZFA 1UUOA 2PURA 3TFXA 2Y89A 3SR7A 3TDFA 4JY9A 4O18A 4QQ3A 5HUPA 4Z0JA 1KTBA 2V5LA 3QYQA 3MI2A 3W7JA 3O8AA 2QCLA 1EA0A 5HJLA 1W5PA 2Q8ZA 1DKWA 4JYFA 1BTMA 2ZRXA 2V9DA 5CZTA 3LX9A 4M19A 3ABSA 3W1AA 2Z1BA 4K8EA 3F4WA 5AN7A 1R2SA 3HBLA 2C15A 1S5TA 5FEZA 4UNLA 4LS2A 4M6QA 1EUNA 1TTPA 4JTLA 1SFLA 4O0ZA 1D3HA 1PE1A 1F5ZA 3ABOA 3P8IA 2FJKA 3FKKA 4LVDA 3RU6A 2TSYA 2NX1A 3UXDA 1KM5A 3WK2A 1KM1A 2XN0A 1JQXA 3SW6A 4WX2A 1KFJA 1VJIA 1VC4A 1YTDA 5C54A 1XL9A 3QMSA 4HPJA 4NJJA 3NPXA 3UZ5A 2ZRWA 3NL3A 5I3KA 3LBMA 3W7PA 1GYNA 3QSTA 3T7VA 1F76A 1HFBA 1DV7A 4ZQRA 4FNPA 1SSDA 2Y62A 4UUIA 2RKXA 3ZS4A 5F2MA 3WJWA 3JR2A 3W2MA 4JDYA 4UR7A 3GVGA 1PHWA 2YYUA 2QCFA 2X1TA 1A5CA 1XBYA 3EX4A 1B3OA 5AHNA 3BW3A 4JDBA 3W88A 1YLVA 1PVNA 5HWMA 2FB3A 4I7VA 4JX4A 1N8FA 4Y8FA 1WBJA 2H8XA 2ZCGA 4KWVA 3B4UA 2TYSA 1JCLA 1V5XA 3LHVA 4IX0A 5EBUA 1LRNA 1H7RA 1YADA 3W1LA 2ZZ7A 5HWNA 1K7EA 4AMAA 5K4ZA 3KX6A 4OT7A 7TIMA 3KHJA 1N7KA 3TMLA 3W73A 2E1DA 4KKXA 3RLUA 3O16A 5CG7A 2QKFA 3CC1A 1JQVA 3G1XA 1EP1A 4AVFA 4UIOA 4ADSA 1TPWA 4GE8A 1NSJA 3TW7A 2J6XA 1Q45A 1SFJA 1H7WA 4O53A 4BI6A 3CIXA 1V7YA 4FX6M 1QO2A 3QEZA 2NUWA 3TFCA 1VH7A 1JCJA 3GAKA 3HG4A 3I68A 5FEPA 4JIPA 2ZRUA 2C16A 2DZXA 1NEYA 4DF1A 5CPOA 3GKAA 2DP3A 2WNZA 3SI9A 1ICSA 2PC4A 2TMDA 3G1FA 3S0CA 1TPB1 3PUDA 3TA6A 3DFPA 3HG3A 3TAKA 1O5KA 3DHDA 3A23A 3O6YX 3V75A 2ABAA 3S1UA 4ADTA 5CZJA 3W07A 4QISA 3N34A 1I2QA 1HTIA 3NVTA 1DBTA 3NEVA 1SU5A 3HB9A 4BF9A 6ALDA 2Z6JA 2DU2A 1QWGA 1F7BA 3P82A 1VHNA 4LC8A 4WXYA 4OV4A 5BNKA 3TROA 5KSWA 3MWAA 3OG3A 3N14A 4IMFA 4NJHA 3CT7A 3PF3A 1OFOA 3BLFA 3MYPA 3ANYA 3BV4A 4LTSA 4OV9A 2X1SA 3O6CA 1JRCA 4HKPA 1C9DA 3RLVA 3HGJA 2ZZ3A 3Q58A 4LWWA 3M43A 4GBUA 4ORIA 3B0VC 4LVFA 2NWRA 3EEGA 3IRDA 3HG2A 1GG0A 4G1KA 3M7WA 4EWND 3A5VA 3FIGA 4RLIA 4KFPA 4JTUA 1PCKA 3G3MA 3MJYA 1KTNA 4Z0SA 3O6DA 4MY8A 4I7UA 4JN6A 1TPC1 1D9EA 2ISSA 4S1FA 3W1PA 3NL6A 3G1VA 2R8WA 2BWGA 1XUUA 2X30A 1FY6A 3M16A 3T55A 3QQ1A 3DFQA 1NFBA 1SQ7A 2DJLA 4UTHA 2DZWA 3ABRA 4NUWA 3E0IA 4FHAA 1KLZA 1I2NA 3L5MA 3S6DA 3IGSA 3M1ZA 2DZSA 3S1XA 4Y90A 3THAA 1OYCA 4JTHA 3LCIA 3NQVA 4NZJA 3KFTA 3KVLA 3LCWA 5G2IA 3UWWA 5G1TA 1YXCA 5FF3A 5AB3A 2CLKA 4LS0A 3UXAA 2VEKA 3DAQA 4FIRA 3HMJG 3QQ0A 1SUXA 3W70A 3LCHA 3NQFA 4IMEA 3FJLA 4UTKA 1S5VA 1W56A 4L4LA 3LV5A 4NT0A 4Y9AA 5IM51 3W83A 3IGXA 2YFNA 2AGKA 4LVGA 3TW6A 1OYAA 4L4MA 1XM3A 4NVTA 4JICA 1KBIA 3G24A 3Q37A 2E6FA 3R89A 4YWIA 2LLEA 1R46A 3M5VA 3M9YA 2QJHA 1X7FA 4HSNA 3NM3A 4QM1A 4HNVA 1EB3A 1JUEA 1R47A 3FJ6A 5LHFA 3S8HA 3A22A 3PSWA 5FEWA 2CWNA 3O15A 4AWTA 5F4WA 1MO0A 3NQAA 4FXRA 2NX3A 3EWUA 4JS3A 3W7GA 5D2TA 3W7RA 1W1ZA 5FF7A 1MZHA 2JKAA 4HIBA 2AAMA 2Y70A 5CPLA 5F4SA 5KINA 1ONRA 1SO3A 1KM3A 1H51A 1W31A 4RXFA 3BVJA 4FX8A 4JTJA 5D2WA 3W6YA 2FDSA 1K8XA 2CLFA 3G1AA 1AG1O 3C61A 4NNAA 3KRSA 5I3FA 1B4EA 1OFRA 2TPSA 2Q3RA 4BFAA 4LUIA 4O14A 2RH9A 3QZEA 4UXDA 4JTFA 1W54A 3A9IA 1ZFJA 3K30A 1RQHA 1B57A 5LSMA 4PH6A 1JCMP 1YTKA 1LTDA 5IBXC 4FNRA 2ATMA 2RDTA 2X1UA 2V0TA 3MP5A 5KZEA 4NQ1A 4AXKA 1BWLA 3UWYA 4EF8A 4MY9A 4QITA 2GQ9A 1K8YA 5H2ZA 3C8FA 1LDCA 1SSGA 5AYYA 2R91A 3HGSA 4RCXA 3LLFA 3NZ1A 3THQA 3BPWA 4ZQCA 1H1YA 3SECA 1IF2A 1S3HA 3RMJA 1L2UA 2FFCA 1BKSA 3CIWA 4MZ8A 1LBMA 5FEXA 1TPDA 3QF0A 4BI5A 1JULA 1IGSA 5LGXA 2C13A 3R12A 4UTTA 3MBFA 4Z1CA 1I8JA 4O8RA 4EOUA 3W7HA 1WV2A 3MW7A 2DZPA 3LHYA 3MYOA 3I7RA 3SJ3A 1UBSA 4A2SA 3PB2A 2QUTA 5LZLA 4UFIA 3C52A 3C6CA 1JCNA 3CWOX 1ME9A 5C2XA 2VELA 3SSJA 1WAUA 1ZENA 4O19A 1MEIA 2J24A 5I3JA 1TJPA 3E49A 4K38A 3EXTA 3GDLA 4FNTA 1KFCA 4BR1A 1WOAA 4Z08A 2C19A 2ZA1A 4UMCA 4ALDA 1TQXA 1NAL1 4GFSA 2ZZ6A 5DBUA 1Z44A 5EKYA 2Y85A 1KM2A 4A21A 3CB8A 3SIZA 3S1VA 3P80A 3TK7A 3LI1A 3LCGA 1I2OA 2Z0IA 3P61A 3KVMA 1H5YA 3E02A 3PBVA 4AH7A 3TJXA 3G3DA 1P5BA 4LU0A 4JX5A 4UTWA 3EKZA 1DL3A 3R8RA 4C1LA 2V81A 1YXDA 4NNCA 1M5WA 4XBKA 1R30A 2G96A 1VYRA 2CLOA 1FCVA 1K7XA 1AL7A 2C0AA 3TH6A 3QH2A 2NZLA 3MHGA 1H62A 3N9SA 1KA9F 3LXAA 1TV5A 1TPVA 3TCEA 1QMLA 1ZNNA 3LXBA 3KAOA 5KTLA 5D2VA 2CLLA 3TSDA 2WO5A 1A5BA 1VCGA 1K8ZA 4CNNA 2W79A 1DQXA 2PE4A 2PCQA 3NYZA 5D33A 3VE7A 3OVQA 1SZGA 1TIMA 4TMBA 1O94A 3TSBA 3NG3A 3S5NA 3L5AA 4I7WA 4DQWA 5AHMA 4O16A 3INPA 2AQWA 1AW2A 3QMRA 1ZAHA 2A7NA 2WSYA 3PM6A 1OX4B 2BXVA 5FF0A 1DOSA 4X2RA 2QUVA 4U28A 5G4EA 3LHWA 3GXNA 3G18A 5D2XA 4S2CA 5K4XA 1ZALA 4YL2A 4GJ1A 4DXVA 1SR9A 1JVNA 2C6QA 3O05A 3FYOA 2ZZ5A 2G5WA 4NJGA 4QSHA 3FEMA 3L2IA 4ZZ9A 3TKFA 1TREA 3RNDA 2QCDA 5DY3A 1W5MA 3P62A 3UWZA 3W1UA 5FF4A 3W7EA 4M6PA 2H3BA 5DELA 2WKJA 1R2TA 1QR7A 3LI0A 3P5YA 5AYZA 2CZ5A 3G0SA 3MP4A 4MLJA 3IIPA 3JRKA 4N9DA 1TPH1 1GVRA 2VC6A 4JR5A 4WOZA 2RDWA 4WUIA 3NQCA 3FYPA 4HHPA 3PUOA 1NF7A 3L9CA 4DBEA 3W1NA 1TPFA 1CX9A 4Z1BA 3DFSA 4WJEA 2CW6A 4O12A 3B0UX 1H1ZA 4MJMA 4CQ9A 4AF0A 2C14A 4Z1DA 3MMTA 3DXIA 5LNVA 4GRSA 3W3OA 2BX7A 3B0PA 5K3VA 4DO5A 5IBXA 1IXOA 2DZUA 3CTLA 5G1YA 3FKRA 4LNYA 3T40A 3C2FA 3CU2A 4WZHA 3I7SA 4MFEA 1JJKA 4FXSA 5CGQA 3LGEA 2ZTJA 5HMSA 2GUUA 2VFEA 3HG5A 3KXQA 2J9YA 2ZRVA 3WJZA 4PODA 2V8ZA 3G22A 1L9WA 4GNJA 3NQ7A 4UNKA 4MJZA 3MHFA 2XFWA 2YXGA 2QEZA 2CZDA 2OT1A 1W3IA 1EWEA 1X8FA 3DU0A 1GZGA 1G4TA 5J5DA 4BWLC 3IIVA 3TUUA 1H7NA 3LHUA 3STEA 3TMQA 2GVLA 4UMAA 1G4PA 1GOXA 1K02A 4ICNA 5HWJA 4HNUA 2DZVA 3B05A 2ZQ0A 4YCPA 2FTPA 1ML1A 2X16A 2BSLA 4IOTA 3G8EA 3KOFA 4ONVA 3T44A 4N02A 3NQGA 2PRLA 4H3DA 3CEPA 3EB2A 5AC6A 3DZ1A 1H60A 4FNUA 2VFGA 4W9TA 4UFHA 1XDLA 3OEXA 3LRKA 1OFBA 5L6UA 2QCGA 4CNOA 4M7TA 3UPWA 3UQNA 4IUOA 3LBCA 4HSOA 2E6DA 3QJAA 3DKJA 3OVPA 2NLIA 3NPVA 3G1DA 5CSRA 3NM1A 3PS7A 4NU7A 1C8VA 1OYBA 3BLIA 2J88A 4ZQOA 2WNNA 2V2CA 3E96A 4HT3A 2Q3OA 4I9AA 3W1QA 3HO8A 3QFEA 1ICQA 2E5DA 1VQTA 4TX9A 4BI7A 1TV8A 3E9AA 1XXXA 2G95A 2NXIA 1G69A 4O4WA 2J27A 1TQJA 2OJPA 4N9EA 3GZ3A 2Z6IA 3C0JA 2GJNA 4UCGA 3S5OA 1UASA 3NNTA 4IXHA 3DENA 5I3GA 3L21A 1WBHA 1SZEA 5T26A 4ORMA 2JGYA 2XN1A 1AW1A 1YTEA 5AOUA 2BZNA 4LS1A 1KV8A 1OABA 4EVZA 4UFKA 2B7PA 1Q6QA 5ABTA 1M6JA 3S5ZA 3ZWTA 2V2HA 1M7PA 1G67A 3MHUA 3ELFA 4IMCA 1Y0EA 1HL2A 4CCDA 1LLWA 2RHGA 2JGQA 5AC8A 4QAIA 2I1OA 1LROA 4O17A 4Q32A 3UD6A 3LM7A 4MLRA 3W1XA 1FX6A 3JS3A 1GQNA 1FWNA 2X2GA 1P0KA 1LOLA 3P5ZA 1NF0A 5TQLA 5F1VA 5K9XA 1KM6A 4GXMA 5HUOA 4X3ZA 2HS8A 5LGZA 4ML9A 3ZFHA 2YYTA 3C2VA 3PBUA 2V2DA 4EF9A 2NV2A 4LVAA 4AHQA 4O54A 5G2HA 1A53A 1X1ZA 3W2LA 2QCDB 1G7UA 1RPXA 3M5YA 2ZDRA 3B03A
chains in the Genus database with same CATH superfamily
4MAZA 3W9ZA 6CGTA 4RE3A 1ADOA 2HS6A 3WENA 1XFBA 4LOCA 1G4SA 1OX4A 4LCSA 4C6MA 4PMUA 3GC2A 1VBJA 3HQNA 5LHEA 5IFPA 3MSDA 3VMPA 2VXNA 1A4LA 2A6LA 2WPBA 3SDOA 1M65A 3S1GA 3VIKA 2JE8A 4YTQA 1ITQA 4ZA0A 5JH2A 2XH4A 4IGHA 1TWWA 1AFSA 4WD0A 4J9JA 4I9JA 5EPDA 3RLHA 4NJIA 1I0BA 4PCTA 1HGYA 3OPSA 4Q4KA 2YL6A 3BV7A 5D2YA 1E0XA 4X61A 1GUVA 1GNXA 3PAJA 5DF0A 3PB0A 5LIWX 4ZSTA 2QJJA 3JUGA 5DCDA 4KT2A 2H6RA 3WLPA 3DHUA 1WX0A 1M68A 1OD0A 3UF9A 3WLIA 3EPMA 1GZJA 2VX6A 3HF3A 4IWWA 1Q66A 3L65A 3GTIA 3T4WA 3RPDA 2Z1KA 1GQLA 2GK1B 4YMZA 4NX5A 3W7DA 2VCCA 3E0LA 4E0CA 4C6QA 1MW3A 1FH7A 1I1WA 1XLBA 3O07A 4GGBA 3W37A 1MW2A 4B5NA 3SN0A 1HKMA 2D2HA 2P88A 4AD4A 3A4WA 4KEUA 5A6BD 3F4VA 1W3HA 1TTIA 3FA3A 4J4KA 1PHQA 4PMRA 1I1XA 2VKZG 4PBEA 3IVSA 4JN8A 4N42A 4MOZA 3BE7A 3VI2A 4FS9A 1X6UA 2Y5JA 3TYZA 3COTA 1S2WA 3W2KA 5CGMA 3BLDA 3UXIA 1I2RA 4HYWA 4S3DA 2B7OA 4MPQA 4H9VA 5GNYA 1KBKA 4F79A 4Q8QA 3PR2A 2J8FA 4FNQA 4IG2A 4Y9PA 3OIXA 3ARZA 3BICA 5BXPA 4KGJA 3KRBA 4QNWA 1RBAA 4RK8A 5EYWA 4OKDA 4AYSA 5M17A 5IOBA 4CD6A 1VZWA 3GFYA 3UWUA 5LXXA 1ALDA 3VOJA 1A0CA 3NZPA 4GACA 4HN4A 3AIRA 1YMYA 1DE6A 4O8AA 1I45A 3MPGA 3TYEA 1W5QA 1Z69A 1ZBWA 1FWJC 3WNLA 2DUAA 4BJHA 2CXEA 2IPWA 1OF8A 2BHUA 3N17A 4GYFA 2X1RA 2HQAA 4TX8A 5RUBA 1KWGA 4MM1A 1NOWA 3EWWA 1RUSA 3UG3A 2CNCA 2OFJA 3LPFA 1J12A 3CUXA 3PFRA 3VCRA 4ZE4A 4JNZA 3ZZ1A 3HV8A 3UNDA 4CQBA 2ZADA 3B06A 2CLIA 4LUJA 1G7VA 3LHTA 4S39A 4C6NA 1B90A 2VMFA 3N2MA 1H0GA 5D09A 4FA3A 2CZVA 3CEUA 4HHHA 3IUHA 3TEVA 3ZT7A 1R0MA 5A5WA 1H7OA 1WB0A 4V28A 4Z2KA 5IDIA 1E70M 2VWTA 3FYYA 1PDZA 1XI3A 3OGSA 1EJTC 1Q6GA 4Q4RA 4D1JA 5CLWA 2VDHA 4GABA 3I3DA 4M0XA 1SFSA 1XX1A 2Z4GA 2NSXA 3MUCA 2XFYA 1TIWA 2Y8UA 1XYMA 3WLSA 2EHHA 3BLEA 1VEMA 1XIDA 2EBNA 2BOEX 4O4VA 1UJPA 1VEOA 2NVAA 5CG0A 1DEDA 3W7CA 1CGXA 4C60A 4E2VA 2XZ9A 1FDZA 5E6ZA 5EBAA 2F2KA 4A29A 1SW0A 4AEOA 3GTFA 4QAWA 1XCFA 1AW5A 3CL7A 3U2OA 4J3ZA 4WQ6A 4TVCA 1VR6A 3CAKA 4C7DA 1GG1A 1RY0A 2Z00A 5BRPA 1WKDA 4AC7C 1CB2A 3AMCA 1JGMA 3CUHA 2ZVRA 1JZ3A 1GTEA 3EOOA 3LM3A 2DH2A 1WDQA 2HTMA 4O1DA 1A5OC 2CZFA 2W61A 2YIHA 3Q45A 4QE5A 4A22A 1LUCA 1UWUA 2GOUA 2EPLX 1XDMA 2EG6A 3PZUA 3NVDA 4IP7A 3SGZA 1FCUA 2J7FA 3BMXA 4LUTA 3R7MA 4GH3A 4LT9A 3GDMA 3WH9A 3GNNA 1XR2A 5IRPA 4UFLA 1W1PA 3V0UA 5D32A 1W9PA 1A4MA 3FOKA 1RR2A 3MDWA 4MWAA 3IAQA 3TE9A 2HSAA 3M5ZA 2RFGA 4KIEA 5DQPA 1P7TA 1KM4A 3QZ6A 1O5RA 3RR4A 3GG0A 2WC4A 2NV1A 2QHAA 1F6KA 4DJFD 1XRTA 4UR8A 2E68A 5EFDA 1MW1A 3BJTA 1JUBA 5EL1A 3LSBA 2QUMA 3NQDA 4AZCB 5JUVA 3VUSA 2PTWA 2NQ9A 4I90A 4JY8A 1EHNA 3SB0A 2VEPA 3BLKA 2V82A 1EJXC 3KW3A 1PWLA 1IXQA 2WVVA 3PANA 4R3UA 3VDBA 1TPEA 2GSHA 3QHMA 3VMOA 4M1BA 3WFZA 3IIZA 1H4PA 3A12A 3BDKA 3GDKA 4C6LA 1OJXA 3DDMA 4MZ1A 1T8QA 5LIYX 3GK0A 4EP8C 2NSOA 1ZTVA 4F4RA 1ZU8A 4WJ8A 2V5CA 1Z32X 5BCAA 5F2GA 3AJ7A 4ZB2A 2E25A 3VCNA 4QTGA 3C2EA 3DKLA 4URIA 3UFYA 3UR7A 3KS5A 1O95A 3UY7A 3VC5A 1UR1A 4GIRA 4O1EA 4DPPA 3T2OA 3G2GA 3ATZA 3CWHA 3EKLA 3VC6A 3HQPA 2A7RA 1BYDA 2VGGA 1SJBA 4EAMA 1JAEA 2OEKA 3I3BA 2XSBA 3WSUA 5L9FA 1AH4A 1RQEA 3KVKA 5CQ1A 4RDYA 2CESA 1FXQA 3T4CA 1A3HA 2VRJA 3N15A 1Y5VA 4Y9OA 2W66A 4QFUA 3SY5A 4DO7A 1ADSA 3NPWA 3AZSA 4PMXA 5CGTA 3GVVA 3ZLGA 4WK9A 4FF5A 2Z7KA 2NUYA 3WBEA 4MDOA 4PUMA 1TE1A 4K1GA 3UJ2A 3NQEA 3BLOA 1KFBA 1FCQA 3M6YA 4YYCA 1W5NA 3N19B 4AMCA 5A94A 1YEYA 2OLHA 2ZTKA 1TV7A 3NGJA 4LAUA 2VX7A 4QJ1A 4H00A 2XVLA 3F5JA 1MDLA 1OX6A 5BU6A 4LV9A 2FPTA 3GSMA 4IFRA 4AAJA 5LIKX 4UTTC 2XJ7A 3W76A 3A47A 2V3DA 3NQBA 4I9MA 4MNLA 4H8NA 5LXEA 3B9AA 3IV3A 3UYCA 4R27A 4B16A 3EWZA 3ZJ8A 1V79A 3DI0A 1HJVA 2D0HA 1EDTA 5FAGA 1CXEA 1D3CA 3SFWA 3E74A 3AJXA 1X98A 1Y65A 2A3AA 3FLUA 3WLHA 2X7VA 4ECLA 2D73A 1FXPA 1YDNA 4GOAA 4K7VA 4IMDA 1PV8A 4J3WA 2QCMA 1KGWA 1LOSA 3S2JA 3Q65A 4MYAA 3FY1A 5JQ9A 1M7OA 1YPIA 2IPFA 1S46A 1WUEA 1LUCB 3H26A 5C9UA 1XQLA 1QOQA 1AL8A 1XCXA 1TV3A 1T40A 3H12A 2ONEA 3CHVA 1JPHA 3WK3A 1C8XA 1DJHA 2QV5A 1U5HA 2VC7A 1J4EA 1V6YA 2QR6A 2JBMA 2E6AA 3K4AA 1OG0A 1WPCA 4DYJA 4C1NA 5H1WA 4BWLA 1BVWA 3FN9A 4MWAB 1P7TB 1QNVA 6REQB 3AI0A 2F6XA 1IYXA 1S2TA 4FEZA 4O57A 1NP0A 3OZYA 5AKQA 1LLZA 1KFLA 4QE4A 4OWGA 3O0KA 3F2CA 4ZOAA 4JL1A 4WF7A 1EC8A 1XS2A 3N2TA 2FB2A 4JIHA 2W0UA 3VMNA 3A24A 4QQUA 1H3GA 3L2MA 3P81A 3AS1A 4GQBA 1NWUA 2W6RA 3CHEA 1FH8A 4H9TA 4GH1A 2WVVB 3PZNA 3MUIA 3ZJ6A 3LB0A 2DT2A 4LSBA 3EDKA 3EPOA 4B90A 2I7GA 3FFSA 2P0IA 4C6CA 1ME8A 3OP2A 2WPGA 4R53A 1DTUA 3U57A 2YXXA 4ZENA 3K4WA 5LIXX 1ZP4A 2HROA 1P1MA 3EKGA 4N6EA 1UH2A 1MXSA 5M2FX 3LRLA 1N55A 5ABGA 1QW8A 2VEGA 4BQ5A 1ONWA 7REQB 5HDRA 1EWDA 1QPOA 1VF8A 3M0LA 4F2UA 1ADDA 3ATYA 4O1CA 3W71A 4XAFA 3QZAA 1ZAIA 3STGA 1CXLA 2H8ZA 2XFRA 4RX0A 4HYVA 4HPHA 1HKIA 1T0OA 3M0IA 1RCXB 4UB9A 1CW2A 5I03A 3R11A 4AVOA 2OO6A 3DERA 3S46A 4FXJA 1PIIA 3OLGA 1VBUA 1QFEA 4REQA 3LDVA 1DWJM 3WUBA 3R13A 3KRUA 3QV7A 2CLMA 3SEPA 1R7OA 4ZXLA 3G0XA 1EF2A 1VPQA 1B5TA 3QW3A 1G4EA 1HQTA 3M44A 1DPMA 1QNOA 3KWSA 4XAYA 2Y7GA 2PRMA 5AC5A 4B2DA 3KRZA 2JALA 2X8RA 1EGMA 4ASTA 1EXPA 2TODA 1U1JA 2PA6A 1XYBA 2V5BA 2WOQA 1M3UA 4AZ7A 3TNOA 2E09A 4E4FA 1J96A 3BO9A 1F05A 2HRWA 3HJEA 4E5TA 4GVGA 3WF2A 8XIMA 3ARQA 1TVPA 1LT7A 1EXBA 3NA8A 2PS2A 2OTDA 3TYBA 2XVNA 1R9XA 4DJEA 5CLTA 1OIMA 3HOJA 3I10A 3QBUA 4G8TA 3C4UA 3CMJA 2XM2A 3TC7A 1F73A 3M47A 4S3JA 1DJQA 2OGYA 4NY2A 1P0BA 3GVWA 1LLOA 1H50A 2VR5A 3ANVA 3UCDA 4UTLA 4G5DA 3HQ1A 5CZ0A 4MVAA 1KLYA 3P67A 4XVEA 1P6CA 4WY0A 2VQUA 3DBNA 4XZNX 1ZQ5A 4AHPA 4CCCA 1FWDC 2ZUWA 1UPMB 4W87A 2ZFAA 1V93A 3GS6A 1B3ZA 4BCEA 6TIMA 1F8IA 5FAJA 4Z42C 2O56A 5CAHA 3L0NA 1KM0A 2YSWA 3PZ9A 1FDYA 1PKLA 1V77A 5BOOA 1DVJA 4JTDA 2OT0A 1MSSA 2DJXA 3WMBA 2EF9A 3FK4A 1OK6A 2A7PA 2YB1A 1SZFA 1PAMA 1UUOA 2Z27A 3VNIA 1KTBA 3O8AA 2R6OA 5CXPA 1MFVA 2PPGA 2QCLA 4HJWA 3N6QA 4JYFA 2JIWA 1XKJA 4HCHA 4DZIA 1Q2RA 4GJJA 4M19A 4YTTA 1R85A 2C1GA 3KUMA 3WD2A 1R2SA 3OZOA 4H9UA 2AMGA 1HL8A 5JBFA 1C7SA 4M6QA 5TAOA 1TTPA 4HU3A 4O0ZA 3KTCA 4H2HA 8RUCA 2Z1SA 2J7EA 1MMFA 3TZFA 1F5ZA 4XSLA 1CXKA 1Z9AA 1SVDA 2FJKA 3RU6A 3UBPC 1BAGA 2TSYA 2G0WA 1KM1A 3MMDA 4LYQA 1YHTA 1K6WA 3R0KA 1VJIA 3ARVA 1VC4A 4LBUA 1DXFA 4AYGA 4L6OA 3QSTA 4KQNA 3IK2A 1F76A 4FNPA 1B9ZA 1X39A 3CT2A 5B7YA 2X0YA 2RKXA 4KEVA 1C7TA 4DJDC 3UEQA 1PHWA 3EX4A 1B3OA 5AHNA 2Q71A 1JYVA 5HWMA 1B1YA 2ZOXA 4I7VA 4E4UA 1MXGA 4Y8FA 5F7UA 4KWVA 2TYSA 1JCLA 3UCCA 3I4KA 2AMXA 2WVTA 5HAOA 2FVLA 3W1LA 2EEXA 4AMAA 4ZOBA 4QEEA 5K4ZA 3KX6A 4OT7A 4GI4A 1FP8A 5DO8A 4U3AA 4ZEPA 3W73A 3BJSA 2ZIDA 3PBMA 1ISWA 1JQVA 2OWCA 1EP1A 3WF0A 4M29A 1TPWA 2QDDA 2PC8A 1NSJA 3TW7A 1W1YA 4GX9A 1XRVA 3GDBA 2DW7A 3UG8A 3UR5A 5BXTA 1VH7A 3GUWA 3HG4A 1R8LA 3QR1A 3I68A 2PDLA 2YA1A 3VOFA 3IJQA 1F9CA 1G9HA 2WBKA 5A2BA 2WW5A 5CBJA 1NEYA 4DF1A 2XISA 3GKAA 2DP3A 1NQ6A 3G5EA 5I02A 3SO7A 3TA6A 1X38A 3DFPA 1XGZA 2OZ3A 4G1NA 2GUYA 2V6AA 2FZNA 3DHDA 2E3ZA 3EWCA 4Z2JA 3P0WA 3AWOA 1QW9A 1DXEA 2F2HA 3LY0A 2FJUB 4BQ4A 2Y1HA 3ZO9A 1RPKA 3SCVA 2Z6JA 1QWGA 1F7BA 4JQ2A 2CEQA 2NLYA 3DG3A 5BNKA 3U2EA 3VDCA 1UZHA 4IMFA 4Q8TA 2PGRA 4Q6JA 2IMRA 4OV9A 3RITA 3O6CA 4HKPA 3H7VA 2QMJA 2ZZ3A 5TNVA 3IRDA 3VINA 3ZM8A 4G1KA 4AZGA 3SRHA 4F2TA 3KCJA 3VIPA 3IJLA 3A4JA 1PCKA 5C7VA 1E73M 3SN1A 4G7FA 4NZ5A 4GY7A 1YE6A 4O1FA 4I7UA 4LEFA 3QY8A 1UQYA 4S1FA 1AQHA 3G1VA 1XUUA 3M0HA 2VOTA 3U4AA 3DFQA 2UBPC 3EA2A 4UTHA 3ABRA 4NUWA 4FHAA 1REQA 4UQ9A 3H8AA 3S1XA 1OYCA 5T9BG 5DMYA 2Z2AA 2W62A 5G2IA 2GSJA 5G1TA 1GOOA 5FF3A 5AB3A 3FSTA 3I6EA 3CUJA 4FIRA 3AAMA 3R58A 3QQ0A 2W3ZA 1G94A 3LCHA 3OO2A 4IMEA 1EEXA 3IJDA 3G1RA 2HVOA 4L4LA 4NT0A 4Y9AA 1E4LA 1R3SA 3W83A 3C0LA 1WXYA 2AAAA 1LL4A 2YFNA 4LVGA 4E2OA 4GZEA 1KBIA 3Q37A 4EX4A 3R89A 4YWIA 4H04A 4FLRA 1R46A 2YL9A 3B8SA 1PZ2A 5CAKA 2NQJA 1EB3A 3RU8X 5LHFA 3S8HA 1DJWA 3PJWA 4E6MA 3A22A 3PSWA 4NI8A 3QKZA 3NFUA 3BLLA 1MO0A 3NQAA 1KGUA 2HV5A 4JS3A 3W7GA 4HU0A 1T5AA 2OQLA 2PLJA 3S9IA 2WK2A 1MZHA 5LYRA 2WBGA 1PEZA 1YNPA 5F4SA 1ONRA 1SO3A 1H2JA 1KM3A 1H51A 1Q4WA 2PWUA 4E4PA 3PTQA 3BVJA 1X6NA 2Z7GA 4H9ZA 1ONEA 3EMQA 1AG1O 2OYMA 3C61A 3KRSA 5I3FA 1OFRA 1SR0A 3L4YA 2RH9A 4ERIA 4X2PA 3WLOA 1W54A 4DBUA 2YB4A 4XZMX 3RRAA 4C6BA 3F2DA 1YTKA 3N3TA 2QVNA 3BCJA 3VD3A 3WNMA 1DIKA 4MY9A 2PB1A 3T0CA 4I5UA 4HP5A 2GQ9A 1K8YA 3RXZA 3C8FA 1L2QA 1LDCA 1SSGA 3HGSA 2GJXB 3BPWA 2OX4A 3SECA 3GNOA 1BKSA 4MKSA 5HXMA 5LGXA 4HMCA 3DC0A 3EB4A 3R12A 3T0BA 1J8VA 8XIAA 4XO7A 4O8RA 2DZPA 3VIMA 4ATWA 4KCTA 1UBSA 3PB2A 1TZZA 5LZLA 4UFIA 1JCNA 3VGBA 1SM9A 1R7AA 1ZENA 1MEIA 4NILA 5I3JA 3E38A 3BUVA 1TJPA 2BXYA 4W86A 2CBVA 4K38A 3R8HA 4HMNA 2Q01A 3GDLA 1UWTA 5A8MA 3AALA 3RO8A 4ALDA 3AXIA 3DEQA 1RP8A 2ZZ6A 1FFRA 2CHRA 3ZXWA 1QI5A 1Z44A 5EKYA 3PUGA 5HANA 4TXEA 4XX6A 1GQKA 4ZFCA 1QWKA 1I2OA 2Z0IA 3E02A 3VABA 3UJRA 1RALA 7XIMA 2YLAA 4LU0A 4C6PA 4H6EA 4C1LA 2V81A 1YXDA 4BF7A 4NNCA 1VBRA 4GLEA 2XSAA 4HNLA 1FCVA 3A3HA 5GNXA 3SRDA 1K7XA 1ZL1A 2C0AA 3PFMA 3QH2A 2NZLA 1KO0A 4GISA 1FWCC 4DZHA 1QMLA 1E5JA 1V6XA 1GVYA 2W91A 5D2VA 3CUGA 2VC9A 2WKGA 1DQXA 2PE4A 5D33A 3VE7A 1TIMA 4F8XA 3TSBA 1YNYA 3L5AA 4O16A 1CPUA 1AW2A 4QG8A 4X2RA 4G6CA 1JYNA 3S2LA 3GXNA 3BXWA 3WMSA 3V18A 1VFMA 3UZWA 3UXLA 4CN1A 4YL2A 2C6QA 4FLOA 1A3WA 4NJGA 3XINA 3FEMA 2O4MA 3L2IA 4ZZ9A 3RNDA 3P62A 3T09A 1DJZA 3W1UA 4PBGA 4OFCA 2OOGA 5DELA 2W4XA 4YIWA 3BAJA 4AZBA 4L61A 3SRKA 3VTRA 3WBYA 1ISXA 1GVRA 4W4QA 2VC6A 2RDWA 1W2VA 1UKSA 2DIEA 4US5A 3THCA 4DZ5A 1EPVA 1H1ZA 4MJMA 1MQQA 1A5MC 4B9YA 5A8QA 3DXIA 3WDPP 1X96A 2HVMA 3KDOA 1FHDA 4CVWA 2D22A 1IXOA 4IZGA 5CPTA 1FHVA 4UOJA 1UD4A 1JFHA 4GY1A 1V02A 4FXSA 5CGQA 3L4XA 3K5XA 2GUUA 2VFEA 2JIEA 1GKRA 3KXQA 1E3ZA 4HSHA 2WJFA 2VWSA 2ZUNA 3QY6A 3S2MA 4PODA 2V8ZA 1L9WA 1FTXA 4IQDA 4MJZA 4D6IA 1BPLB 4H7CA 3S2NA 1S2CA 1EWEA 2NV9A 1X8FA 1NDVA 2E8YA 1G4TA 1LWHA 4B5UA 1PTGA 3TUUA 3LHUA 1PSCA 3M4HA 2GVLA 2G4JA 1K02A 4ICNA 5HWJA 3BJFA 2DZVA 3B05A 2ZQ0A 1GK8A 1UMYA 2ZUMA 2GGHA 4W5UA 3PN8A 2FTPA 2WANA 4ONVA 2PGWA 3AQUA 3CEPA 5C2GA 3EB2A 4ICMA 4QSFA 3AC0A 5EFFA 1XDLA 2Z25A 1XD0A 1BYCA 1OFBA 3TTQA 4M7TA 3UPWA 3LBCA 4HSOA 3O2LA 3OVPA 5CSRA 3WUFA 3WD0A 2J88A 4AEFA 1GPFA 3E96A 1CGYA 2HISA 3QFEA 4PMVA 3WF1A 1PBGA 4AZHA 1Q6FA 2O4QA 5GPRA 1VQTA 4TX9A 1CLXA 3FW6A 4BI7A 4EE9A 1UC4A 3AIEA 3TTOA 2NXIA 1RHCA 3NIYA 3GQYA 2J27A 2OJPA 1XH2A 3GZ3A 2GVYA 3WZ0E 2FHFA 2Z6IA 3OHMB 1WUFA 3U3HA 4XIMA 2WZHA 3BAWA 3BAXA 4W7UA 4IP4A 3ARRA 2R82A 2VI0A 5EGRA 2ZWYA 1UASA 3H2EA 4M51A 5I3GA 1U22A 1WBHA 2J7DA 4HK6A 2XN1A 4HTBA 4MNKA 5AOUA 4HJFA 5E0FA 2RGMA 3CJPA 4Q4QA 5ABTA 3CHDA 3AUOA 3ONCA 2PDUA 4OUEA 1XLLA 3URAA 1JDDA 1RD6A 1VENA 2G3JA 3BH4A 4CU7A 1BWVA 5H6HA 4Q32A 4XAGA 1M53A 3JS3A 5A69A 1P0KA 1E43A 2QIIA 1ENUA 1LOLA 3ERPA 4MG4A 1QOXA 5HUOA 1MWOA 4X3ZA 3GU2A 5FD0A 2HPMA 2Z26A 1RAKA 1RJQA 1XYFA 4L80A 2DIJA 4QG9A 3RM4A 2NV2A 4LVAA 4NI3A 4Q7IA 4M81A 1JAKA 4BKNA 1UWQA 1G7UA 1J0ZA 1UHVA 3ES7A 3KBWA 3AHZA 1J0YA 1RJPA 5H8UA 3B03A 3LMYA 5TF0A 4H6QA 4Z2IA 1XGDA 2GL5A 3QFWA 3D0CA 1TO3A 3VM5A 5CJNA 2J66A 2BHYA 2BDQA 2Y7DA 1QAPA 4C91A 4P61A 4GD0A 1UKPA 1Z42A 5HK4A 3HU7A 3PVFA 1EUAA 1JR1A 4J2PA 3NQ2A 3RX3A 1UWRA 2Y8VA 1F3WA 2PDIA 3UVAA 6XIMA 3VZYA 3GHSA 1L6FA 1GW1A 5HNRA 4HNTA 1ZJIA 3MI6A 1CCWB 5CPQA 5BRBA 4DBSA 1H41A 4JX6A 1F2JA 2G3NA 2CLEA 1W3TA 4TMCA 5CEWA 1VGAA 2VFHA 4PMJA 1WXJA 3GG7A 3IIXA 2BY2A 4L65A 3KP0A 2VX5A 4AISA 2CXGA 1CXFA 2DZTA 5E9XA 2YCEA 2QDGA 4DVOA 4AD2A 2HXUA 1TR1A 3JW7A 3MUAA 3QRHA 3GLCA 3PBGA 4KPLA 4DF2A 2CBUA 2ZA3A 1UH3A 3KOXA 1VPYA 4IT1A 1MEWA 3HPAA 2J7HA 2GDUA 3U4FA 3M41A 2O55A 3R5EA 2DQXA 3LENA 3DH7A 1AZ2A 5G5IA 9RUBA 2ZX9A 4NHVA 3BGGA 2V5DA 3VFCA 2YDSA 3EGJA 1XWYA 3W22A 1V6WA 3PK7A 4UC5A 1TTQA 5AECA 4LRSA 3BG3A 4IISA 1IV8A 4GWEA 1KXTA 2IQDA 1DQWA 3U8GA 1FWWA 5AHIA 2PSNA 4PBFA 3AIWA 3J7HA 3A21A 3GXPA 4XBSA 2PLMA 3F03K 2P53A 1VHCA 5CPSA 2BLEA 3SAZA 4YXGA 3ZT5A 4CCZA 2XG9A 2PI6A 2ZC1A 4AZIA 5LNWA 4MWAC 4L9ZA 2QUNA 1LBLA 3E2VA 1GKQA 4JFWA 4WVXA 3B0YA 4INFA 1E1FA 2QF8A 2P5NA 2ABBA 4E2DA 5C55A 5DFAA 1E40A 3CPGA 4AVNA 2J4GA 4LCQA 3V3WA 2QULA 3E1F1 3TV8A 1FWTA 5DMNA 3I6RA 3UERA 1OCBA 1AD1A 3URBA 2CYGA 7A3HA 4N9BA 4GUFA 1FWFC 4HCLA 3W7IA 2WLYA 3BAIA 3SFKA 4KWOA 3POCA 1KRBC 2B31A 2ISVA 4CVUA 6XIAA 4U2YA 4RZ5A 4H8UA 3R4IA 2EPHA 3CBWA 3N29A 3TQ0A 3NUKA 2A1YA 4Y96A 3VCCA 3IPWA 2PDXA 4WHBA 2FIQA 3VKJA 4OHQA 1O60A 5D9NA 1RVKA 2QGHA 5I07A 1CI1A 3P84A 1MNSA 2DIKA 2VL4A 5GQBA 5F1UA 4U3CA 1O4UA 2VR4A 1LL6A 1W37A 2GPTA 3RPTA 4D2JA 1IWPA 3MKCA 4GUGA 1YYAA 3VIFA 4K39A 3L4UA 4CQAA 3DHFA 3ALGA 4KBXA 5FSEC 4Q6XA 1TR9A 2FZDA 2IKGA 2VP8A 4XUGA 1T41A 3LS9A 1S1RA 4FNSA 4DLMA 4XKYB 1TJ2A 1WAWA 1GOQA 3AIVA 2D3NA 4JYEA 4A05A 1MUMA 1ZY9A 1O5XA 3WQVA 1EDGA 3T6CA 2Y2WA 5I24A 3I7QA 5C8BB 3W2UA 2ZUSA 4IL0A 3TU9A 4A3UA 2DV0A 4DUXA 3IANA 1QI2A 1DHPA 1GCYA 4N9CA 3GM8A 3T78A 2AL2B 3AZTA 1TMHA 8TIMA 2V67A 4MKVA 1UMLA 2VD8A 2E67A 4NIRA 2Y63A 4WY0F 5XIAA 4P7OA 3S5YA 3GR7A 3F4NA 3ID7A 1G1YA 4R34A 1QO5A 1GEQA 3E2SA 4Q8OA 1J0KA 2PU1A 2XH2A 1AD4A 3L0GA 1IXPA 2ZUTA 1UR4A 1GYMA 4A3RA 1AJZA 1VYSX 1E6XM 5E6YA 3D6NA 3BSGA 4ZFMA 2G3FA 4WKFA 1XLDA 4NL1A 5F2LA 2J25A 1LBFA 5KZMA 2XIQA 4E8GA 1C8QA 1U2YA 3TQKA 2YGYA 4B3ZA 4DM2A 1GPWA 1TJRA 1R9ZA 3UGVA 4RE4A 3SCTA 4I6KA 5CKSA 1TB3A 1DIOA 3GHUA 1J0IA 2OEJA 1QK2A 4HYRA 3HGRA 1B9BA 2GQ8A 5EMMA 5J5RA 2VRQA 4GK8A 1VEPA 2BTMA 2J6VA 5C5YA 2A4AA 2ZZ2A 4FO4A 4LEQA 1EYWA 1UA7A 3CH0A 5AHEA 1SO5A 2HNHA 3NDOA 5DXYA 2RDUA 1X1OA 2H9AB 2UY3A 3PZTA 3TQVA 1EIXA 4B5XA 3RJYA 1XICA 4AW7A 4NAFB 4O11A 4POCA 2NT0A 3CHFA 4S3EA 2W5FA 5EY5A 3MKKA 4R9OA 2PAJA 2I17A 3BWWA 3KS6A 1BYAA 2YBTA 2J7BA 2P76A 4W89A 1QI0A 3WKZA 1B54A 3RRXA 4GNKB 2WZEA 3LV6A 4ZO8A 5F4XA 3SSZA 3T8LA 1S5WA 3QV6A 5JH1A 3WH6A 4MKNA 3C3NA 2YW3A 4CLMA 1NQKA 3GFZA 4PA8A 1AZ1A 3W7NA 2NXHA 3WBWA 3BOLA 2Z1WA 4UZUA 1EF3A 4OECA 2YR1A 3PSVA 2SFPA 3QR3A 4LB3A 4B15A 4DJDD 4DO4A 4YVPA 3AYTA 1ISVA 4PEKA 3WNOA 1Q2SA 2FTWA 1A5AA 4M3PA 3PTKA 4JTSA 5DN1A 2A21A 2AL1A 4F3HA 1O6IA 4MNJA 2BY3A 4RKAA 4HZ7A 3TNBA 4JXCA 1FHUA 1RA5A 2FFIA 2QYGA 4I8YA 1AJ0A 3WMLA 3QOMA 1J10A 5KZDA 5FL1A 1Q6DA 1ONXA 1VIWA 3E3HA 4D6DA 1ZHAA 3MCOA 4OIFA 5DY2A 2PMQA 3HV9A 2QJGA 2PDQA 2ZX5A 2EAWA 2DZBA 1U30A 4HA1A 1CGUA 1EOKA 3DYOA 5BROA 3VIGA 2XPKA 3T0TA 4AWUA 3NL2A 3T1GA 2YW4A 4D6EA 3EWBX 1VJZA 4H6RA 1CGTA 2O9PA 2DUZA 4LV4A 3A4XA 5TIMA 2HNEA 3W75A 4KS0A 3MVTA 3PPFA 1RJRA 1SO4A 4TUFA 1W0MA 2ZC8A 1RK5A 4JFUA 4D8LA 1KC7A 3WY1A 3APTA 3B97A 3FX4A 4EPEC 1H61A 3GXMA 1BQGA 3GBDA 4LYRA 4AX6A 2PP3A 2I57A 3LCLA 2DORA 3VD4A 3GU1A 4H19A 1W1A1 2CLHA 2V5JA 1F74A 1J6PA 5D37A 4HCDA 3PBWA 3P0XA 3DG7A 2UY4A 4C6OA 1DYSA 4ZQMA 2PP0A 4JTRA 3PZMA 1J5TA 4Z17A 3BZGA 3RLGA 2A0NA 5LNRA 5SWUA 2ZICA 3AHVA 3OQEA 3TYCA 3APGA 3FAXA 3LBOA 1IR1A 3TR9A 1UD3A 1ZUAX 3PJXA 1LP6A 4UTIA 1V0NA 2A5HA 4PR4A 3PJTA 3SZ8A 1T99A 3OBEA 4UTWC 4GINA 1EZWA 4LAZA 4UFJA 2Z2UA 2WQPA 3A5FA 3UY8A 1Q7QA 3VKDA 4E2BA 2F9RA 4KRTA 4ATDA 3W7MA 3EMCA 3H4WA 3EOLA 4IPIA 1EJVC 1E6RA 3GIYA 1RCQA 5FI8A 3B8IA 2Y7FA 1EP3A 4JIQA 4UTMA 5HULA 2ZZ4A 3UCQA 4HHMA 3PZQA 3W82A 3WG6A 1W9DM 3E6EA 5BMWA 5HR6A 4MADA 2PDCA 4PEEA 2QDHA 1RH9A 4DJED 1FA2A 2OCZA 2CITA 5D4YA 5AZ1A 3LTSA 3GVRA 3VIJA 4A35A 1L6WA 1J0JA 1C8YA 2D1ZA 2OODA 3VIHA 2EJ1A 4AB4A 1E5NA 3BARA 4HZMA 4LF1A 1P0NA 4NF7A 3B0XA 3TXZA 2WHMA 1EHAA 1XYZA 4ZCWA 3SCPA 3QV8A 3CAQA 3LLDA 3GNDA 3OGRA 1T8XA 5DBTA 5LKYA 4LQ1A 5AYBA 1ISZA 2BHZA 4JFTA 3LOTA 3UT0A 1XBVA 1GWJA 5FF2A 2F38A 2P8BA 4PCFA 2OOFA 3C2RA 4O50A 5KMYA 1V3JA 3OU8A 1YBQB 2ZXDA 3ZWSA 1HKJA 4J1OA 1ZAJA 2YBVA 2ZXBA 4HQVA 2ALRA 3FVMA 4K8HA 1R38A 2OLAA 1YPFA 1RQBA 2ZUUA 4GIEA 1KBBA 4PRRA 1QT1A 3TLQA 5JIPA 1W17A 3AO0A 2R9RA 1XDJA 3ZYZA 2WMKA 4WSJA 4NNBA 3MO7A 2VT0A 3V1PA 4YJ5A 3H2FA 4I5XA 4KERA 1DXIA 2VEIA 3IJIA 2FKPA 1C93A 4QGCA 2J9ZA 3YPIA 1IIGA 4ERGA 5TD4A 3WF4A 1KV5A 2PDJA 2NVDA 3WIJA 2ZKMX 2Y24A 3TR2A 3CZEA 3NDYA 1TV2A 3WD3A 4DEFA 1GVOA 5I5RA 1SZNA 4YLWA 3KL0A 2VEFA 3LNMA 3N4EA 4NP7A 2PDKA 4OBSA 3B8TA 1ESWA 3MUXA 2ZXAA 4IX2A 1A5LC 2Y7EA 1O68A 2WVUA 3B04A 3SJNA 4MUPA 5KITA 3VGDA 2A6NA 4LC6A 3B9DA 2QCNA 3FJNA 1A50A 3W84A 3P74A 1GYLA 4QNEA 2FMNA 4GXWA 1VFFA 1VFOA 3MP3A 2VC5A 4R33A 4PTMA 5MKGA 1KCLA 3CZJA 1KKRA 4BEUA 2WZTA 1V8EA 5AFDA 3ABQA 3N25A 3S3GA 3KOWA 2C0HA 1J11A 3LGGA 4YN5A 3L4WA 2QJNA 3EYPA 3N18A 4QRNA 3RPMA 4L56A 1E9LA 2F84A 3L5LA 3E12A 4HD5A 4X9YA 3PWGA 3STPA 3WDQA 3MVIA 3S1WA 4Q7NA 1JXKA 3W53A 1IIHA 3GDTA 2WQDA 2NX9A 3EXSA 4HOXA 1QK0A 2E6YA 5CC5A 2I56A 4RNHA 3OYXA 4ZODA 1S5NA 1RBLA 4H41A 3CL8A 3DCPA 4BEQA 1JZ5A 1WDPA 2GYIA 2CZEA 5I78A 4FP1A 1C9WA 2BGNE 3K4DA 5G1MA 2Y0FA 2GJPA 3OVGA 1Q5MA 2QJMA 1K70A 2YOCA 2RJHA 4Z0JA 2V5LA 3MI2A 4DWSB 1EA0A 5HJLA 3NEHA 1OZQA 3WQEA 4IIBA 1BTMA 4ERAA 4AWEA 5DX7A 5CZTA 1P0EA 3LX9A 3W1AA 1HXJA 1O7AA 3FAWA 3HBLA 2QZRA 2C15A 1Z6KA 1Z8AA 5FEZA 4Q4MA 3TA9A 2P3ZA 4JTLA 1SFLA 1KD0A 3QGAC 1PE1A 1GHRA 4H1ZA 3ABOA 1C91A 2D3LA 1R6WA 4AUBA 3UXDA 3UR2A 1KM5A 4U31A 1JQXA 3MUY1 4GZIA 5EB8A 1YTDA 1UW9A 5C54A 1XSIA 4NJJA 3UZ5A 3MMWA 3M7SA 4QBXA 3LBMA 2CETA 3T7VA 1DV7A 3TN3A 2Y62A 3B9EA 3VU2A 1BFNA 3CQIA 3GE7A 3TZNA 4JDYA 2VM8A 1UZ4A 3HA1A 3GVGA 1W3LA 4UOQA 2QCFA 2X1TA 1A5CA 5I79A 3BW3A 1YLVA 1QJWA 1EIBA 3SCOA 4RE2A 4TX6A 5HPCA 2MANA 3SQMA 3OLDA 1OC5A 3L4VA 3B4UA 3RUBL 4IX0A 4HMEA 1LRNA 5FCZA 1K8CA 4QROA 3UA4A 1W9BM 2XDFA 3HZ3A 1S2VA 7TIMA 4UQEA 3GH5A 3WDJA 3RCNA 3KHJA 3EA3A 1SGJA 4YWSA 5CBBA 3O16A 5CG7A 2PODA 3V0TA 1V7AA 5HNNA 1XGEA 3G1XA 1KCKA 4AC1X 4AVFA 3JZUA 4H01A 1H7WA 4O53A 4LAOA 1V7YA 2DUXA 1QO2A 2AKMA 3K8MA 2NUWA 3FGCB 3TFCA 3KCLA 1N2VA 2WHLA 2C16A 2DZXA 1IZJA 2ACRA 4EPKA 8A3HA 3KBMA 1XQKA 2PC4A 2TMDA 3G1FA 3S0CA 3C8NA 3TLLA 5MKGB 3ZSTA 4L6HA 3TAKA 3TYUA 4JTQA 3V75A 2ABAA 3CL6A 2BFGA 1X6LA 4ADTA 5CZJA 3MU7A 3NVTA 1DBTA 4CQDA 3CS2A 3HB9A 2VHLA 6ALDA 2DU2A 4MB4A 5FJRA 1OBAA 4JHZA 3W24A 2YCIX 3RDKA 2OZ8A 5KSWA 1EX1A 3CT7A 3PF3A 1OFOA 3ZR5A 4TQTA 5A1AA 3LNPA 4LTSA 4QLKA 1C9DA 1F3TA 1XV8A 3HGJA 3Q58A 4GG9A 3APYA 1O5QA 4ORIA 3AYSA 3ITGA 3B0VC 3BSMA 4LVFA 3O3RA 4ZR8A 2GSEA 9XIAA 4TV5A 1QW7A 1I6NA 1GORA 5FL0A 3VKBA 1JD9A 1CENA 6PTDA 3EDJA 3BAYA 1KQZA 1BGGA 2DT0A 2JF6A 3MJYA 4G7EA 1KTNA 3TTYA 5FSDC 3O6DA 2TAAA 4MY8A 4JN6A 1TPC1 1D9EA 1PXGA 2HVNA 2ISSA 1V03A 1XLHA 2DT1A 4ZB0A 3M16A 1TUFA 2I9UA 3QQ1A 1SQ7A 1VBGA 2V3FA 2DJLA 2DZWA 5IHRA 5I0DA 1AH0A 1S1PA 1KLZA 3QN3A 3L5MA 1HJUA 4Y90A 4Q8PA 3ZOAA 4GI9A 3NQVA 4DM1A 3KFTA 5I09A 3LCWA 3UWWA 1NJJA 4YVVA 1CIUA 4Z1YA 1RLDA 2WWCA 3NO1A 4V27A 1SUXA 3W70A 3NQFA 4UTKA 1W56A 3USZA 1W32A 1PO9A 1WZKA 1CGVA 3UJFA 1UROA 4GX8A 1XFCA 4JICA 3GXDA 1VFLA 2E9MA 2E6FA 4LUSB 1OB0A 1JZ8A 3BL3A 5HQMA 3M5VA 3M9YA 3A64A 5BWFA 4HNVA 1R47A 2HCVA 3PHAA 4D6CA 4EACA 3BZJA 5FEWA 3O15A 4AWTA 1RP9A 1R3WA 4F48A 1HNYA 4WCJA 3KZPA 3UG5A 3MKVA 3UNTA 1JZ6A 3A3WA 3B9OA 4CEUC 4IQJA 2JKAA 3TJIA 1Z3NA 2AAMA 2XVPA 2GQ3A 5CPLA 2POZA 1W31A 4RXFA 4FX8A 4JTJA 2FH6A 2XH7A 1K8XA 2XIMA 4NNAA 4MWAE 5DMMA 3WEZA 3VNMA 2TPSA 2Q3RA 4LUIA 1VFSA 4O14A 2V38A 4ZB5A 4JKLA 1ZFJA 1EQCA 1M7XA 3K30A 1RQHA 1IZKA 1IE7C 1JCMP 2PDPA 4XZIA 1LTDA 2ATMA 2CKSA 2PZNA 4DNHA 2V0TA 1BWLA 3UWYA 4ENLA 4EF8A 2ANUA 3ABXA 1W8GA 5H2ZA 4QCEA 3M0JA 3T05A 4ATLA 3LLFA 3T9PA 1US0A 3M0YA 4RL3A 4P8UA 2VO5A 2FFCA 1WXZA 2G3IA 4PRWA 3CIWA 2W63A 5EMJA 1LBMA 5FEXA 1TPDA 3LD5A 4BI5A 1JULA 1IGSA 4D9PA 2C13A 3SN4A 1US2A 4US5D 4UTTA 3MBFA 4EOUA 3W7HA 3R10A 3CH9A 3MYOA 1T7LA 3LHYA 2E1WA 1O66A 2CC0A 2QUTA 4JHOA 5C2XA 2VELA 1Q85A 4GPNA 1XIEA 1YQ2A 4O19A 2Y5SA 1JF5A 4IICA 3VD7A 4XB3A 1KFCA 1IWAA 4EANA 2ZA1A 1B2YA 4UMCA 1EJ7L 1GOWA 2WXDM 2REQA 2PBGA 5DBUA 5C71A 2E9BA 1UH4A 2V69A 2G4FA 3AXMA 3S1VA 3P80A 5IFTA 3LA4A 3LI1A 3LCGA 2WMJA 5AC4A 4PN2A 3ABZA 2J75A 3G3DA 2OWXA 4TVDA 1VJSA 3SBFA 3OB8A 1M5WA 4XBKA 3DX5A 3SCSA 1H49A 1VYRA 3BANA 1P48A 4BQ3A 2BGSA 1BKHA 1JFXA 3B4YA 1GGOA 1KA9F 4LXFA 1TPVA 5KTLA 3KAOA 4GO8A 3O9NA 1BQCA 3QGVA 4FLSA 2PWHA 1WE5A 1POKA 1DIEA 2WO5A 5ABFA 2W79A 1JL8A 5HJYA 1JI2A 1V3HA 3RG6A 2XSXA 3NYZA 2X05A 4D6FA 3OVQA 3DUGA 4PCPA 3NG3A 5HOSA 4NZ4A 3QMRA 1ZAHA 1OX4B 1GHSA 1TWZA 2J7GA 1CYGA 4MTVA 5G4EA 2WJDA 1JI1A 3LHWA 2DY3A 4A4AA 2QV4A 2GLKA 5D8ZA 1QNSA 4QX4A 4S2CA 3W6LA 5K4XA 4H7VA 2VJXA 3E5PA 4GJ1A 4DXVA 1S39A 3FYOA 3H2MA 1EJUC 4NAEA 3WQ5A 1PUDA 4LYPA 2G5WA 4QSHA 1XLIA 3W25A 1TREA 1ITCA 5DY3A 4RDWA 3UWZA 4IGSA 3AXHA 3SCWA 2H3BA 2WKJA 2XIJA 3LI0A 3P5YA 1HW6A 4AXNA 2YL5A 4Y9MA 2CZ5A 1DJYA 3G0SA 4DJFC 3KCOA 2D2GA 4MLJA 3IIPA 3R6IA 1TPH1 3VKKA 4HHPA 4DUVA 1SMAA 2PWVA 3W1NA 4MB1A 2Z2BA 1CX9A 3GHRA 2CW6A 4BZYA 4BF5A 4AF0A 4Z1DA 2INFA 1BF2A 3GXIA 3IGHX 4ZSUA 4WLCA 5K3VA 5IBXA 3MANA 2BS9A 2DZUA 5G1YA 3T40A 1Q6CA 4WZHA 4MFEA 1GQIA 3LGEA 2ZTJA 3EEZA 4LH8A 2J9YA 4PMZA 2QLYA 3VNKA 2X0SA 3G22A 5EMLA 1XIMA 5CC7A 2F6KA 3NQ7A 3T8QA 2WCGA 2HK1A 3HURA 1G01A 2XU2A 4NRRA 2CKRA 2RGLA 3N13A 4Q8MA 2D23A 2CZDA 2OT1A 4FMVA 3RR1A 3W26A 2HE5A 4UMAA 1G4PA 1PIGA 3KOYA 3R8GA 3KEHA 4IG2B 4IM4A 3E0VA 2BSLA 1V6VA 3T44A 4N02A 5A8NA 3HMCA 4Q4PA 2PBOA 2DPEA 3FDGA 1LJYA 3DZ1A 4FNUA 4W9TA 4W88A 5HNUA 5I7GA 1UKOA 4DHGA 4HVXA 5L6UA 3T42A 1E1CA 4GJIA 4AD3A 3DKJA 3NPVA 1KXQA 5A8OA 3K8LA 1ZBVA 3VYLA 4J3VA 1VBHA 1JEZA 3CK5A 2WNNA 4HT3A 4YTSA 3W1QA 1XLMA 3JZEA 3HO8A 1NTHA 2YCLA 2E5DA 3KLLA 3CB3A 3VK5A 3IACA 4K2SA 1XXXA 4N9EA 4YS1A 1SZRA 2REQB 1VP5A 3CZGA 3GZAA 1WNOA 1BXCA 5JIWA 4DRSA 1TA3A 4MDPA 3UA3A 3CXOA 3NNTA 3RCMA 1YRRA 5T26A 5CJMA 2OVLA 5ABEA 1YPXA 4LS1A 4IQEA 4WIWA 5FJOA 1TG7A 3LQGA 1G67A 3S47A 4IMCA 3WELA 1IQ8A 2RHGA 5ABFB 2JGQA 1HZYA 5AC8A 2I1OA 4J2MA 3UG4A 4PCSA 1DWIM 1FKXA 3LM7A 5A3HA 5A6TC 4TOQA 2J74A 5KEZA 4IIFA 4FSAA 4CNSA 3HM7A 2X2GA 1FH9A 3WBXA 1DJIA 3D5HA 4GXMA 2HS8A 4OVXA 3KE0A 1UR9A 4KWUA 4XD6A 1SFTA 4RW5A 1OD8A 4DUOA 3C2VA 2V2DA 4EF9A 3I4EA 4AHQA 4O54A 2BOGX 3QYSA 3BMVA 1A53A 4HPGA 1CECA 3W2LA 4PUJA 1RPXA 3M5YA 3WBAA 2ZDRA 5AYIA 1AVAA 3ITTA 1JCYA 4JFSA 3HPSA 4NASA 4Y8EA 1F3EA 5LA2A 1EX5A 3BGJA 4PUUA 2XGIA 4JD4A 1QPQA 5E0CA 2B7NA 2Z28A 3VDAA 2PU0A 2HWGA 1XBZA 3GDRA 4A8LA 4C6IA 2J77A 3C5QA 3ARWA 4KFOA 3H24A 2PTXA 4CQCA 4LUTB 3VFLA 1OX5A 1FDJA 5CJ5A 3C86A 3OA3A 4AF0B 5AVNA 4OOZA 3G1YA 5D30A 5M1TA 4DJDA 3CQ0A 1ME7A 4HGXA 3WJSA 3NWRA 4DYEA 3O1NA 4WSKA 3D46A 1D2KA 1UC5A 4PUKA 1NOFA 4XZWA 1ODZA 3W81A 2OYLA 1NWRA 3WQPA 3IJ7A 2PZ0A 1Q6RA 5A6MA 1BEUA 1JNEA 4L9YA 5AYXA 3V36A 1WYIA 4XG1A 1KFKA 3D3AA 4XK2A 1TCDA 3NPUA 2JEQA 1SMDA 4LVBA 2QAPA 2ISWA 1F6YA 2QGYA 2Z1VA 4QHRA 1F07A 2HZGA 4B4FA 4AWSA 1AA1B 3VGHA 4GQQA 4PUNA 1LCOA 1OF6A 4L1WA 1OFQA 1ZJAA 1Z48A 3O6AA 4TO8A 2IS7A 3FVDA 3NXLA 3QC3A 1LRTA 1IR2A 3PWAA 3SCUA 3BC9A 1XBXA 4P8XA 3PZIA 4H9MA 4QJ4B 3GBEA 4GHRA 1H7XA 4F2BA 1UOKA 4ZQNA 3CASA 2X1IA 4P2VA 3ENLA 2WNQA 4IHCA 4OQVA 4AD0A 1E0TA 1GOMA 3BOXA 3N1AA 5ENLA 5EMUA 1RLCL 1SJCA 4RDZA 5CZKA 1VCVA 3TSMA 4OE7A 5A6LA 2JK2A 5CH9A 1QTWA 4QDMA 4JGDA 2KZHA 1GZ1A 1NWSA 1EZ2A 1TWSA 1TELA 3PZOA 1XIFA 3VOHA 2A79A 4GBDA 3WD4A 3WQCA 2XM1A 1R86A 3C3UA 4XVDA 4PMDA 5F2IA 3VNDA 1KW1A 1NVMA 1TA3B 4LBSA 2ICSA 4UTFA 2B0MA 4L7ZA 1K03A 2L5HA 3DI1A 1XIGA 4CD8A 4D1IA 4UMBA 1FP9A 1BG9A 1W1B1 3W85A 1K6AA 4J35A 4ACZA 4IPLA 1XYAA 1FWRA 2VGIA 1ZJHA 2YCKX 4PE8A 1T96A 3MC5A 4HU4A 2GJLA 3SCNA 4XQ6A 3WJXA 1WDWA 4OUIA 1SO6A 4F0KA 5C7HA 3W1MA 1PTAA 2PCEA 2GVGA 1YDOA 3IIOA 3R79A 5CZSA 5MHBA 4MHBA 1PPIA 2PRHA 4WXZA 4M24A 3ZJ7A 4WSHA 1VD6A 2VVSA 5K9CA 3NO3A 3O7UA 1NFPA 1UKQA 4Q22A 4DBDA 4R9XA 4EKJA 3TC3A 3LPGA 1XC6A 2PF0A 3UWQA 1JUKA 1BSLA 4A2RA 5D03A 5LNSA 1K4HA 2FHCA 1MI3A 1LOQA 3N3MA 2F61A 1BWKA 4B5TA 1HO4A 3F1QA 1W9VA 4OTKA 1FWGC 1QDSA 1TPUA 2A3HA 1M01A 2EJAA 5FJJA 3T2PA 3W02A 2HXTA 4JQ4A 1OQFA 4FR1A 4JQ3A 3VM7A 3QR0A 3CV2A 1H0IA 2QS8A 3BG5A 1CTNA 1NM9A 1A49A 5K7JA 3EAUA 5C6MA 2VGBA 1UBPC 1C92A 4DNMA 3L68A 1FCBA 1XISA 4O13A 4Z1AA 2VD9A 2XTKA 3CO8A 3S6OA 4LAMA 3G1HA 4L4OA 1EBHA 2XIOA 2Y61A 4BK9A 4P8VA 3UR8A 4C1NB 1ZRQA 3IJ8A 4PSRA 1S2UA 1XLGA 3E2QA 3ITVA 4NG3A 4YHEA 4LX4A 5U7SA 3V35A 3VOCA 3ZJKA 5G2WA 2XHYA 3MJMA 1Q13A 3LGDA 3K46A 2OU4A 4JNYA 3QM3A 3M0XA 5CPNA 2VZOA 3P60A 2D69A 2EPMX 2YBUA 5CBIA 5G4WA 3DECA 1EEPA 3PP7A 4TIMA 2WVSA 4PTNA 3KZSA 1T6MA 2NXGA 1OT1A 4RZ4A 5I06A 1M03A 1AMYA 2J62A 5I77A 5LNUA 1V3IA 3H4XA 3WX7A 3RO6A 4TR9A 1BXNA 1XIIA 5FJPA 3WLLA 1I75A 3QPYA 1L0PA 3FSUA 2IXUA 4GYPC 5IHSA 2OLSA 2Y4SA 3DESA 4RE0A 4M56A 1THFD 4NXKA 4Y6GA 1A47A 1EKOA 1TSIA 3ME3A 3VX1A 1A5SA 4KESA 1LQ0A 5BOEA 4ZOCA 4LRTA 4S2BA 3FEQA 4PMNA 1Y5XA 3RGTA 2QF7A 2E5CA 7TAAA 3BQ5A 4UQAA 1J01A 3GIQA 3UZZA 5J8LA 1H11A 4PMOA 1RV8A 4GVHA 3OOQA 3NOEA 1N82A 1SW7A 1SYTA 1QVBA 1V08A 4JQ1A 4W5ZA 4DWSC 1V0MA 3CYVA 2ZWZA 1KR0A 3QSRA 3VNZA 1XH0A 1RA0A 4CCEA 1J2BA 1EL3A 3A4AA 4KMQA 5BWAA 4REQB 1MYRA 2WHKA 1CLKA 1XSKA 3ZQ9A 1CEOA 2YX0A 5HA7A 5HNTA 2BVYA 4XZHA 3MSYA 3WK0A 3WN6A 3RM8A 1PS9A 3WL0A 1QCWA 4S3FA 3KVJA 3PNUA 4ACZB 1YXYA 1UWIA 3NSMA 6ENLA 5K9DA 4J3XA 2PDBA 2JQXA 1HP5A 3CTTA 5BMXA 4PUWA 1KXHA 1TRDA 1G5AA 5LA0A 1PCWA 3G1SA 3W23A 1IZCA 1EPXA 2WB5A 1DWHM 3IJ6A 3TIMA 2WSKA 1AMKA 3TN5A 1UPPA 4K7YA 3TWAA 1OM0A 2NW0A 2WJZA 3IVUA 3DBPA 1X1NA 3QTGA 3TN4A 5C0QA 2FZMA 5DCEA 3ITCA 2PP1A 1HUVA 1F4AA 1VFUA 5HR7A 3NCOA 2XGBA 4NYUA 5C2CA 1QBBA 2VEMA 4N7QA 3II1A 4DELA 3S83A 1C90A 4IP5A 4UQDA 4ZMGA 2PD5A 3MV01 3M0VA 3P8JA 2A3BA 1EBGA 5DANA 4WY0B 4LBRA 2AQOA 1UQZA 1LM1A 3OGVA 2BY1A 4GZJA 2C79A 2XWEA 1XCWA 3RMEA 5AHLA 2BMBA 4IJRA 3OBAA 1P6BA 1JNDA 2BP1A 1LRQA 3LG3A 5GJMA 4FX7A 1TJ1A 5BU9A 2QUUA 3L67A 1PX8A 3CZKA 4P7NA 1UZDA 3W72A 2GDVA 3LCFA 3VKAA 1VRDA 3IWPA 5CSUA 1O1HA 4W85A 2GUBA 3BG9A 3KBVA 3W1TA 4GUJA 2D24A 2ZUVA 2G41A 2EKGA 1KTCA 1EOMA 3NQ6A 1NELA 1XKYA 1RBOB 1HKVA 2KAUC 3AIUA 1TKKA 2BVTA 2BY0A 1DJXA 2R1MA 3ZMRA 4LCRA 3LCXA 4HK5A 1K7FA 5JMUA 2FGZA 5D38A 1Q3NA 4MUZA 4JZ5A 3CV1A 2WLZA 5AHFA 4ADUA 4N6FA 3VX0A 4GYJA 3CUFA 2ZZ1A 1YNQA 2ON3A 3UU0A 3EXRA 4UTUA 2INEA 2VOMA 4HA0A 1S5MA 3H6OA 4K3ZA 1TYGA 2IPGA 1BGAA 4U4MA 4X9SA 4MFDA 3ANUA 4H4IA 1E3XA 1W9XA 2E77A 2GJRA 2JFEX 1VFHA 2FVKA 2E7FA 2C1HA 3SUTA 1EP2A 1W8SA 2OB3A 3W74A 2ESCA 1BD0A 1IT7A 1WOBA 1GQJA 1JD7A 1UP2A 2TRSA 4K37A 1YDYA 4NX0A 3ARTA 1XRSA 1J5SA 3WLTA 3UZYA 5FESA 1K1DA 4WDXA 3U6WA 1ZB5A 3BW2A 3LTYA 4NZ1A 2OG9A 3U2CA 3UVIA 1UD8A 1NIUA 4NJKA 1Y7VA 2J47A 4IH3A 2ODOA 2V5KA 3TOPA 4IPJA 1AQMA 2B4GA 4IPNB 1E4MM 1JCTA 1HO1A 3LERA 1OC7A 4GFIA 4S3AA 4AZCA 2IKHA 3WLJA 4WJXA 3TOYA 3CHCA 3G6LA 4DI9A 1JDFA 2NQ5A 1HL9A 4I6VA 1MUWA 4HNOA 3IGUA 4LPCA 4ZOEA 4RJEA 1J6OA 2GFTA 2BODX 2CIPA 2PD9A 1YDVA 4ROPA 1V02E 4YVXA 3AMDA 3DGRA 3ISIX 5HQLA 3B8DA 2HDJA 3PTMA 4JEJA 1SW3A 3CQJA 3LN3A 2ACUA 2XIBA 3TXVA 4EXBA 2YPIA 2VFIA 3LZ5A 3R2GA 4H6KA 2ALDA 4EWJA 4XD4A 3Q94A 3GR4A 1AQ0A 3OG2A 5FACA 4D71A 3VO0A 1G6CA 1SPQA 4P7LA 1I60A 3M5XA 1WZMA 5C9WA 3S4TA 4ACYA 4H9YA 2PDWA 3NO5A 3WNNA 2D20A 2X42A 4JTKA 1JPDX 2FPYA 3U2ZA 4RXGA 3ARPA 3GUGA 1I2PA 1HG3A 2E4TA 3P7YA 4MZYA 3E0FA 1P1XA 4X0NA 3HN3A 3ZLHA 4UTJA 4FK9A 4F0HA 1JPIA 4MMWA 4A8IA 1Q6EA 3B40A 3QW4B 1GONA 4GI6A 1IXNA 5I3IA 2XH0A 5BZAA 2OYKA 1ODUA 2XVGA 3H23A 3W01A 2O9OA 4ROQA 2AOSA 4RR4A 4UNIA 2H90A 1W91A 2FZBA 1WO2A 4L5ZA 4GUIA 2BVDA 1H7PA