2CXGA

Cyclodextrin glycosyltransferase complexed to the inhibitor acarbose
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
686
structure length
686
Chain Sequence
b'APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title X-ray structure of cyclodextrin glycosyltransferase complexed with acarbose. Implications for the catalytic mechanism of glycosidases.
pubmed doi rcsb
molecule tags Glycosyltransferase
total genus 233
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cxgA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cxgA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2cxgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cxgA01
4I18B 3P0YL 3P73A 1JV5A 1FZKA 5TDOB 5J1AB 2ATKB 1T7YA 4HWNA 4IISA 5DQ9A 4CADA 5HVWA 4LLUB 3FO2B 4HULB 5AYUH 2ZUYA 2I5YL 3MREA 3QDMD 1C8YA 1HHIA 1R33A 4PTUA 4NQVB 4XI5C 5TDNA 3T4AB 2GJ6E 2E9IA 1HXJA 1G7MA 3PP3H 4ALAL 4Y4HB 2CK0H 4IHOB 3ARUA 4TSCL 3TVMB 2QQQA 4PRNB 2EEAA 5I1AB 1U8IB 2ZPKL 1R85A 2LQRA 2X1OA 4QHLA 3MOAH 4L4OA 1LQ0A 2JF6A 5B38B 3B6SA 4W5ZA 3BT2L 3SDXF 3BAJA 2P47B 1H8NA 1NC2D 5CJXC 2YPLE 5I1DA 4BCEA 3QEQA 1U42A 1ONQA 2IPKB 2PYED 4GBXA 4LBEA 4J12A 3AS0A 4UTAL 3QDMB 2FSEA 2ZOKA 1IGTB 2NY7H 2Q76A 3EUUA 5BXRA 1F4YL 1FCCA 4XNXH 2W0FA 5ID0B 3U30B 5DJAA 1MFUA 3LKOA 2P5EB 1CFSB 3RJXA 5H94A 1IQDA 3NABL 2VNCA 2NXYD 4UT7H 1F2XK 5FOBA 3EYFA 3MUAA 3U4EA 3G5VA 1X3DA 3PV6B 5I66A 4G6AC 2WMFA 4JDZA 1TJHL 1LEKB 5AY7A 1IFHH 5JQHC 1N2RA 3DX6B 2I26N 4Y4KA 3GK8L 4HWBL 1CL7H 3RKPA 3S98A 3QA3A 5KJRH 3RVVD 4HK3N 4AZGA 3GSNL 3BVVA 3NIGF 3EOTL 2J4WH 3DYPA 4RMSA 1BFTA 4JFED 3ZO9A 4M7LH 4UV7L 1IM3A 4GKZB 1JXKA 2Z35A 4MAYB 1E27B 2VIRA 3NMEA 4JFYB 3EFFB 4KAQL 2ENYA 3UTTE 1HT6A 4XCYB 1EOMA 3SGDI 5L8JB 1IGFH 5H2BA 5F7DB 5E7FA 1P2CB 3IDNA 1KLUB 3V0VB 4H1LG 1KSRA 5FO7B 1KTDB 1MAKA 3VFSA 1U8KA 2YS4A 2I5YH 3VXUB 1A6ZB 1IGJB 2APFA 2ESVB 1J87A 1FFOB 4D9QD 5KVDL 5CEXA 1VFBB 4XVUC 5EDXA 2EH7H 4AEEA 4PGEB 1C8XA 1KACB 3KHQA 4TSCH 4RMRA 2ZPKH 1FNAA 3HE7B 3RAJL 1A1NA 3BT2H 4MWFA 4W7WA 1IKFL 1S7QA 4QHKJ 4FQCL 4E4PA 4O2CA 1Q72H 4JQVC 1HQRB 3HI6L 4Y5XC 3DRQB 5EBWB 4L8DB 4UTAH 1XRVA 5A6JA 1EZVY 3GKWL 1QRND 4AC1X 4GQ9H 2R2EB 1F4YH 2IQAB 3AC0A 1VAHA 5TDOA 1ZHLA 4Z76B 2ATKA 1HKMA 3N9KA 4MNLA 3LZFL 2F8VA 2P8LA 1H5BC 5IR1A 2DDQH 3G6JE 2G2RA 3AYSA 3NABH 3LQZA 4NO2B 2Y7QB 1Q9WB 1D5IL 4L4VE 1OM3L 1RJYB 4IRJA 4NCC1 3SDAC 1TJHH 3HB3C 4OM0H 5FKAB 3ZE2E 1V6WA 3GK8H 4U2YA 4HWBH 2JJTA 4LLVB 4LYPA 4MXVE 4JPWL 5I1AA 4P2QE 1DBKL 3MO1A 3GNOA 5I1CL 2V6HA 4PPTA 1FNSL 3AHTA 4PYGA 4PJGF 4U0RB 2G8ZA 1X44A 4JZJC 1SEQL 4UV7H 5IK3B 5JNYB 1I1WA 2DQDL 1HXYA 2DQJH 3QDMA 3QH3B 5IVXF 3AISA 2DQXA 4KAQH 3DETD 5CIPB 5M7QA 5ID0A 3QO0A 5JBEA 3PP3K 1JFXA 2P44B 3CDCA 1QW8A 3QHZL 4D9LL 3BQUD 1UACL 1G01A 4MMZC 2A6IA 4IOIA 3PV6A 2BY2A 3HG1B 5D1ZB 5F44A 1LEKA 1NC2A 3LEYL 1NLBL 2PYEA 4X0KB 2W0LA 1TR1A 4GXUM 2H2SD 3I6GB 5E8EA 3PGDA 3QIUB 3VILA 3VWJD 5MEOB 2G9HB 5JDJA 4TXEA 2OSWA 1JCKA 5A16A 4XMKH 4DWSC 4JZOB 2ED8A 1LWRA 3HNTL 1J1PL 4MAYA 1OCWH 4NBYB 3BSHA 4L9DA 1HINL 4KROC 3TBVB 4GS7C 5FO9B 3OHXA 4XCYA 4J3TA 3QCUL 5DMIL 4AQOA 5DEGA 3WDQA 1X5JA 4JO1L 1U8QB 4OZ4A 1KTDA 5MEQB 1U30A 1OM3H 1E5NA 3WIHL 3WL1A 4U3HA 1JGLL 2XT1B 2YC1A 1A6ZA 4JFEA 3GO1L 1HYSC 1FFOA 1JPTL 1D6VL 5C07D 3D69A 2HFFA 4P5MA 4UIKH 3THDA 1VFBA 3UTSE 2H26A 2X9WA 4PGEA 4QGTA 1ZT4A 4UBDC 4WI5A 3ARSA 2W59A 3MOBH 3PHOA 3WNNA 3HE7A 3HC0B 5I1CH 1E4KA 1FNSH 3LQMA 3QQ3B 3CZFB 3T3PE 4UT6L 4P2RD 4NM8L 2RGLA 1SEQH 4JQIL 2GSGB 4NO3B 1QEWB 5A3IC 2DQDH 5E2VL 5D1QC 4IMKC 2DTML 1I7RA 4OZFG 1W32A 1LP9E 1ZGLA 2ADJB 3CUJA 4M7KH 2WW5A 3QHZH 4D8PA 3PWLA 5IQ7H 4NO2A 4D9LH 5FKYA 2RJMA 1Q9WA 4D72A 4H25A 3SO5A 3VXRD 4U1HB 2OMBA 4PJIA 1QLFA 2NY4C 3U2SA 4ELMF 1GJUA 1OAXL 5JOEA 3LEYH 3LVEA 1OARL 4HJ0C 1NLBH 1S9YA 4LLVA 4I2XA 1E4IA 1YJDC 3REWA 1QRNA 2HG5A 4JO3H 4XPAH 4YUEL 2VDML 1B0GB 3PGCB 1EO8L 3HC4L 4TTDC 3TO4D 1HSBA 5KSVA 5CP3H 4ML4A 1SEBA 1E3XA 1ZBKA 4ZMAT 5JNYA 2V3FA 3SBWC 1M4KA 3HNTH 2D24A 5HHOB 4NHCH 1IAII 4WFFD 5DD1L 2J2ZA 5AC4A 3QH3A 1XCQB 3CLEL 1YYLL 1MREH 3RZCB 2CYGA 3L3DB 3PGFH 1US2A 2WPGA 3HNVL 5C2UB 1GOGA 5ICYA 4UQCA 4S2SA 1KEML 1JZ4A 3DI2B 3QCUH 4TSAL 3WBAA 1EGJL 2Y6SC 2Z8VC 1RULH 4P9HL 5IB4B 4NKQB 1VBRA 3WCYA 3TO4B 5FYKL 3IJSB 2HJLB 4NWTH 3WIHH 1OCQA 3QUXC 1JGLH 4KUZH 3O3BA 5CLTA 1BWWA 3KPOA 1QUNA 3BAIA 3WHE0 3GKZA 5CGYC 1D6VH 4L9LB 2X4NB 4I1NB 4X0KA 5CS7A 2Q3AA 4IOSD 4E0RB 3UBXG 4E9LA 2F7OA 1U3YA 3RTQD 4FXGB 2CPCA 4JHWL 3AMCA 1TQBC 4UINL 4B7LA 4DM1A 4CU6A 1CDYA 2Z8RA 5DJCA 1KT2B 1T7XA 4JZOA 3BQUA 4NM8H 3ZYJA 5EUKB 1G0CA 5HBFA 1VRXA 2BCKB 1BQHG 3TPUA 1TCRA 3P9MA 3QNZB 3VI4E 1NGXB 2FR4B 4APQC 3L1OL 2E3VA 5FO9A 3TBVA 5E6YA 2KPNA 5C6TH 3KZSA 2XY2A 2WZIA 4KJQD 5DGQA 3CFJB 5T33L 2ZCKL 1LF1A 1I8KB 4XHJD 4O2FB 1MFDL 2DN7A 3VWJA 4ZO7A 4KRLB 3VRLE 1H2JA 5CINL 2PO6D 1ADQA 2ITCB 5E2UL 1OAXH 4IS6B 1YPZB 4UFHA 4CU8A 2RGSA 1L4IA 4LRNH 1KCLA 2J8UB 1IZKA 1M03A 2HWZL 2WM0A 1QWUA 4UAOC 1XGTB 4KJWC 5TQ0H 3SKUD 2F8OA 2VDMH 3HC0A 1EO8H 1VERA 1LGVA 3HC4H 4G7YL 5IW6B 1Q9OB 2QKIA 3SKMB 3G5YB 2X9XA 2HFGL 2CGRL 3AFBA 3K80A 4XH2B 4UR9A 4MNQB 4NT6B 2LFGA 3DX8B 3P9WB 4QY8B 3ZMRA 4QRPE 5C07A 4JM4L 5IGXH 3MJGX 1T89A 2OQJB 3MMUA 1KEMH 1UZ6F 4RRPG 4TSAH 1MY5A 1EGJH 3T4YB 2DL9A 2QQLH 4KKLC 1BGGA 5JUEH 2A77H 5FYKH 1HIML 1ND0A 2R2BA 2OYLA 2DI8A 4M4RA 4P2RA 3NCEB 1NBZA 2I9TA 1UKPA 3VU2A 3R8BB 3IGUA 3A22A 4ZFOA 3JUGA 3GMLB 1AC6A 2EEBA 4FZEL 1HCFX 1WNOA 4GKNB 4YDKL 2NZ9C 4BQ3A 4JHWH 4JANA 3UPAA 3AMKA 3C5ZD 4P0DA 2DSUA 3VFWB 1E15A 1T1ZA 5IROA 3VXRA 1FYHB 3O2VL 3AIUA 5FV2A 4HJJL 2PI6A 1R5WA 4ONFL 3O6MH 3NSXA 2CMRH 4MD0A 3C6LC 4JHAL 4FNPA 4AM0B 3HI5L 5F3HB 3WDPP 3IFNL 5T33H 5EBLA 4UNIA 3RWDB 2JKXA 3D52A 1ZS2A 3TO4A 2E6QA 1MFDH 4AG4L 1D5BB 4JY5H 1XGQB 5AUMA 1T6WA 4YC2B 2WBGA 5FCUL 3UYRH 2YL5A 5AD0A 4JFXB 2HWZH 1FZOA 2GSIA 3HHRB 5EN2A 1HKIA 1ZKAA 2IG2L 1HNYA 1JFQL 4G7YH 1JRHI 1KIRA 2P5WB 2ZG3A 3L5XL 4X9FA 5F1SA 3TA3D 3WH9A 1YN6A 2HN7B 3DJ9A 3AQUA 5C0AE 2HFGH 3H42L 2CGRH 1X5HA 4D9RD 3DX9A 3H9YA 4LKCB 3QI9D 1T2JA 2P7TB 4NZTL 1E43A 2PXYB 1GXEA 5D72H 3B8SA 1XH3B 2OI9C 3DUHA 3RTQA 4O2FA 1BLNB 1HHJA 2D03H 3L3GA 5I8CA 4E2OA 2IPUK 2QADB 4D6DA 1FH5L 2FJGA 1XD0A 4WU7A 3DLQR 4Y0GA 2VDNH 1HIMH 3F4VA 5IQ9B 2E8ZA 3VFPA 1MY7A 4B16A 5IEHB 4OKVB 3HZMB 4X9IA 4M1GL 2HTKC 1PG7L 3OKLA 1UXWB 4YHIA 3WUWB 4GG6A 3NIFE 1GH7A 4DO4A 4FZEH 4YIQB 5EU3A 2FYYA 2WVTA 4YDKH 1CVSC 1CS6A 2J5LC 3RNKB 2R1WA 1NGQL 3TH3T 1VPOL 2NY1B 3S5LG 1PW3A 3WQ5A 1XF2B 1NEZA 4EEEA 2Y07L 1E4LA 2PO6A 4ETYA 3WLWC 3O2VH 3SDCB 2BV9A 4ONFH 3VFTB 5GISH 4MA7L 2OQJA 5GRVK 3OAYH 3REVA 5MHSE 1H3PL 4JHAH 4JKMA 3HI5H 3T4YA 4BS0A 1D5XA 3IFNH 4X98B 3RDTB 5HVHC 2YEZB 3SCPA 4LCCA 1T0NB 4AG4H 1W0YT 4MDJB 4V2XA 5SV3A 4U33A 1UKTA 5C0RH 5JXAL 1KLGA 4HU8A 1A6AA 4YHNA 3DX7A 3W11C 2A3BA 3WQ4A 1GC1H 1UOKA 1UZ8B 5C08E 2XN1A 3L3IA 4U1LB 1FO0A 1V7NL 4Z0BH 1KENH 4NF7A 2IG2H 3WS3B 3ULVC 4IPLA 1JFQH 3L5XH 2OCFD 3SHSA 3VFWA 4RA3A 3EBVA 1RZ8A 3H42H 1JPSH 3RWHA 1D6EB 1EERB 1QFUL 2VXTH 4BH8B 3U0WH 3U0PA 1EHNA 3N17A 4NZTH 3WFBH 1FFNB 1WEJL 4EUPH 4NPYB 5D2NC 2AJUH 2YUVA 5IG7A 3LB6C 5HHXL 4EANA 4RMTA 5FYLE 2UY4A 2IADA 1B3XA 4V2BA 2WHJA 1HILA 4MLIA 1FH5H 3UO1L 1JHTB 1RIUL 1AY1H 1XGQA 2YFNA 2I9LA 1NPUA 3LN9A 4YDLC 3LDBC 4M1GH 4UZSA 5I3DA 1PG7H 4U3AA 3ZJKA 2WSKA 3BH9A 4PJHE 3F7VA 4HTYA 1V3JA 3VIKA 4XCEA 1NGQH 1FL3B 2H32H 4KTYA 4WJ5B 5D4QA 1VPOH 3Q0HA 1E4WL 3WD1A 1AI1H 1J8HD 3GEWB 2SEBA 2P7TA 4MB4A 5C0BE 1P7HL 4WV1C 4WHTB 2YPVH 4MA7H 2PW1B 3WXWH 1H3PH 1XH3A 4LFHG 5E6IB 2O5YL 4DCQA 3FB6B 3WDIA 3OGVA 4HIEB 3CPUA 1SY6L 2A6JA 2PW2B 3LQAC 3EYPA 1J05A 1OAUL 5I6XC 1O6IA 4XC1L 4CL7A 1T7VA 4JJHA 5IQ9A 2BSRB 1P7QD 5K93A 5C0DA 4PMUA 1HL9A 2OW6A 4EBQL 2VKXA 4KK8D 2UWEB 3QI9A 3MO4A 3MLYL 4AEIL 3WD2A 1MVYA 3X14B 1T3FA 2P8PB 4YIQA 3HLAB 1IC1A 3ES6B 4S1QL 3TV8A 2DQGL 1FN4B 4H5SB 1XF2A 2EEDA 1J10A 4JREC 3BVWA 3QIWD 3SGEI 1QFUH 3LXCA 4POUB 1WBYB 1WEJH 4I48B 4WKAA 1R5VB 5IJVB 1WZ1H 3VJ6B 1KJVA 3C5JB 2W0KA 4FQJH 1G9MH 4AISA 2YSSB 3RDTA 5HHXH 1FA2A 5FF6A 5KSBE 4JPKL 1BHGA 1JBJA 4NNPL 2XACC 4B15A 3MLTA 1VJSA 1U91B 3UO1H 4OZIB 4NFCA 4LCWD 4YHLH 3AU1B 1MCIA 1RIUH 1U95B 1ZJAA 1FIGL 4NDMA 4U1MB 1JWMB 5K9KA 1UZ8A 3MRFB 2VCAA 4NSBA 3S96B 3O3EA 4U6VL 3WS3A 3BW9A 3T8XA 3IJ9A 5L2JB 4KRUA 2AXGB 1I3VA 2EPOA 5A2FA 1AP2A 1E4WH 1B6UA 5IVZB 1Q0YL 2BFVL 1QNQA 2E9LA 3AUVA 3MC0A 3DXAD 4N0UE 4WWKD 3AMDA 2R23A 3C2AH 3HE6C 3PF2A 5F6IC 1BVKA 1OWQA 1L0XA 2HT2C 3QUMB 1MWAB 2OSLA 4XBGA 2X89A 3ARFB 5M3WA 1SY6H 1F4AA 5DO2D 3QYCA 3W0WB 1I4FB 1OAUH 5MEND 4XC1H 4S0TD 3OG4B 5E95B 1JHTA 3STLB 3S3PA 4EKXA 3BWAB 3PWVA 4AEIH 1CQYA 4OZGF 4XVJL 3OKOA 1F4XL 4CD5A 1JK8A 3JWOL 5EMYA 4S1QH 1E1EA 3G5ZB 2DQGH 3FT3A 1Z2KA 4LKXB 4PJDE 3H7BB 4QXTB 4FNUA 5EIIA 1F3RB 1JJUA 1HI6A 5IB2A 2CBJA 2F58L 4JG1L 4MJ2A 4LEXL 1TTGA 2W1NA 4M56A 4DGIL 4W5UA 1MJ7L 4JPKH 2VH5H 4NNPH 3CVHL 4G5ZH 1DVFB 1QLRB 4X7DC 2VDRH 3BX7C 3UG4A 1W9VA 4Y1AB 4TOYL 5INDB 1J8HA 1YNLH 1KC5H 4KRPC 1T66C 4PD4J 3SE4A 4HZ7A 5E4EC 2EH8L 2ZXAA 3AB0C 3GXDA 2JFEX 3FONA 4ZQKB 4GBXC 3ALGA 3LRSB 5GGUB 1KIUA 3RL1A 3BOVA 3TBWB 1N6QH 3RIKA 1V03A 1CDCA 2UYLA 4QNPE 1P7QA 3EHBC 4P4RA 1Q0YH 3B9AA 1QW9A 1I8LA 3KLDA 4Z78B 5AZEL 5AAMA 3MRKA 2KZ1B 3UCQA 1Q6GA 4NZDA 3E8UH 3TIEA 3QWQB 3GSOA 5EO1A 3RPKA 2W63A 3U7YL 5DDHB 2RB8A 4LSQL 1OGAD 1TMQA 1EA9C 3EMZA 5D7KE 3FFCD 1MHCA 3AU1A 2PBGA 7FABH 4U1MA 2XZZA 3QIWA 4RGNC 2ZOLA 3T0ED 1KQZA 4NN7B 2VZ1A 3S96A 4KU1A 5CD3B 3MLRL 4XVJH 4NGHH 5A2JH 3OGCA 5I8KH 3U5UA 5C8JA 3BPCA 5L2JA 1M04A 4KKCD 4YWGL 4XTRD 1Y6KR 4LPYA 1MRFH 3JWOH 3KPSE 4FNSA 4RSVA 1B9ZA 5F7EL 2X70A 4OGYL 3ZE0E 4BUGA 3KVQA 4F8TA 2JCCE 3PWPE 3WKML 2CKBL 5IVZA 1FGVL 4LCWA 3D3VD 3EOBA 5EFIB 4JG1H 4J2XA 1S7UA 2D0GA 3ZDXF 4LEXH 4U1GC 2CSPA 4NCC2 4JFPB 1ES0A 4DGIH 4W85A 3W0WA 5L7XH 2HJKB 1MEXH 3OKDB 1HJVA 3CVHH 2NX5E 3U48A 1EK3A 3DMMD 5DLML 3STLA 1IMHC 1UB5B 4HW6A 3PZOA 5CBAB 4M9PA 3GSVB 3H53A 4O4YL 1CGYA 3BAXA 4ODVL 2DOCA 3D3VB 4LQFL 3VX1A 2EH8H 4I0KA 3DXAA 2X1QA 1FNGA 4WWKA 3CDGA 5SWQA 2BVTA 5FDYA 3EO0B 2ZICA 3CDFA 4TVUA 3SDYL 3BYYA 5DT1L 1CVRA 3B9KD 3NOIA 2JIEA 3MGAA 5CSBA 5AZEH 4X6DA 5HSFA 4IRJC 2IALA 4N1EA 3GXMA 4M1CC 2J6EL 1IILE 5B4MD 4HCRL 1BD2D 3U7YH 4PJFF 2HKHL 2JJTC 4OFDA 7CGTA 3BKML 5E8PB 5C0GA 2GJXA 3PZVA 4LGSB 5A1AA 1G6RL 3PL6B 1DQML 3C60C 4HQQL 1KN2L 1IE5A 4HIJA 3SO3B 1V02E 1X7QB 3WF1A 1W0WA 2HVMA 3MLRH 3WKZA 3IDJA 2UVEA 4YPGB 2IH3B 4YWGH 3DHJA 1TITA 3TTSA 3TBWA 4KZDH 1N59A 1QFPA 1WZKA 3WKMH 2CKBH 3L4TA 4WWID 4OCSH 2FL5A 2V2WA 1TJGL 5HOSA 1P4IL 5I1JH 3I85A 1LWHA 1K4CA 3INUL 2CUIA 5EZIH 3CK0L 4K23L 3SGJA 1DQQA 3I2CL 1MFEL 4MQSB 5L8LB 4NN6C 3FB8A 4G6FD 2WC3A 1YEIH 4E41D 2YFOA 1CBVL 2VXVH 5DLMH 3VE0A 3CMGA 3PWUA 4K55A 3SJVB 3ZYIA 1JWSB 2O26U 3K0WA 1PX8A 1T1YA 5CD3A 4UOW1 5JBFA 4ZSOE 4O4YH 1UXSA 2NXYC 4ODVH 2CH8A 4LQFH 3ZOAA 3OGRA 3MJ9A 3V5DB 5DRNA 1YNTA 1ZLSL 4LSRL 3FT4A 3I9GL 4H1LA 5H8DA 4Z7UF 1HIZA 4PLNC 3SDYH 1T20A 3TCXA 3F5LA 1K5NA 3FFCA 3CFCH 4JGJA 3RVVC 4DK3A 1I9IL 3CFEB 5DT1H 2RBLA 1KG0A 2DLFL 3EZJB 2ZUNA 4P8XA 1CXLA 1UB6B 5ALBH 1FPTL 3T0EA 1E1FA 4JAWA 1MXDA 1QSED 3WUBA 5IM7B 3RBGA 3POCA 3BMWA 2HJKA 2DKMA 1JZ8A 4XVSH 3U0TA 2HKHH 3BKMH 5IKCB 2EYSB 2XWTB 1VEOA 1N5AA 4P9ML 5D7JB 5CEYB 1BOGB 5IFJB 4PTMA 1DQMH 4X5XB 4HQQH 1KN2H 3D3VA 2EICA 2YWYA 3T3ME 3EZ8A 1JWUA 1RURL 2PF0A 2ZKHL 3VGBA 1IEAA 2V7HB 3EJYD 4LNVA 4I13B 2E40A 2VLKE 4U6HB 5L2KD 5EC1A 1DHKA 3VFGL 4W8LA 4PRPB 3DMMA 25C8L 3LXBA 4KV5F 1TJGH 1RJZB 5HYQA 3VD9A 2AABL 2HKFL 3INUH 1UD5A 4JVPA 3CK0H 2K7PA 4K23H 3O4LB 4HOWA 3S88H 1F4HA 3PZUA 3DIFA 3I2CH 1G7IB 1BVLB 1A6PA 1BZ7B 3FTGB 2N56A 4I9WD 1Q94B 2DICA 4HMDA 5FCSH 3S3JA 4ODUA 3QBTB 2JK5B 1J8KA 2NY6B 1YY8A 4W87A 4AIXA 1F8TH 5IBUB 1YEJL 3K8MA 1F00I 3MYZA 1X7QA 2BC4A 4KTEL 3B9KA 4PBVC 3D51A 3TTOA 2AS5M 4OF7A 4AD4A 1X5FA 2IH3A 2X2HA 1EEYB 1ZLSH 4LSRH 4I5BB 1HOCA 4OCRL 3BXNB 1BD2A 1OSPL 1HNFA 3UTPD 3EJTA 1KPVB 3L5WA 1CLYL 1BAGA 1AHWA 5C8BB 3VD3A 2DLFH 5SX5H 1VGKA 5HD8D 4UCFA 3IDXL 5JW5B 1RAMA 1A6VL 3KDMA 1CLOL 4P2OB 4HA1A 2Z91B 2DT2A 4RISH 4QOKB 2AKRA 2R1YA 4GAGH 2Z4QA 1JUFB 4NN5C 2BZDA 2HJFA 4QRUA 4YXKL 3DETC 2XQBH 4L1HA 4RMVA 1DE4B 2HT4C 1XYFA 3Q3GB 3MFFB 4ERSL 3LS4H 1G1YA 1EOKA 2VI0A 2OLDA 5I1IL 4P23D 4NYLB 3BQUC 3BKCL 5E94B 1ZHBB 1M6OB 1PKOA 2NTFB 1FBIL 2ZKHH 5CKAA 3F6IA 1YMMB 5DC0A 3WBDA 1A4JA 3SDXE 4D94A 3NAAL 2AI0H 3NGBB 5FECA 5FAAA 3N1PC 4E41A 1WFTA 2H2SC 3JWDL 3VFGH 1S7XA 1INEH 5SWZB 2Z0BA 5F1IB 25C8H 1RHHB 4UI2A 3S36X 2F7PA 3VWJC 4OF6A 2B4CL 5I2IB 3VGAB 2TAAA 3HC3L 4F7MA 2VLRD 1ZWIB 2XN9D 3FAWA 4POZD 4Q0XH 4EOWL 1YUHB 3ZTJG 2EYSA 2ARJB 2WQRA 4H8HA 4PJBF 3NUKA 5E2WL 4NJAL 3WF4A 3LKSA 3MSGA 4XPHH 2HH0L 5I75C 5MEPB 4P5TB 5IMOA 3BI9X 4MJ6B 1FQ9C 4BFGA 1HK6A 1K2DB 4HS6A 1YEJH 3CZ8A 4Y5YB 2OTWB 1RIHL 3VWKD 3MRDB 2V7HA 2O9RA 4R7NA 1NDGB 5J6HB 2R2CA 4U6HA 2HT3D 2AJZA 2ICWJ 1T89C 3WY2A 1OSPH 2V38A 1U36A 2ZUSA 4CVWA 4Q22A 1GZQA 4G3YL 4JR9L 1CLYH 1E6NA 1UA3A 1M01A 3LN4B 5F1KC 3OG6B 5EZOH 3SCNA 3RO8A 2X2IA 4X4XB 1V7ML 4K07A 3GTNA 1CLOH 3D87B 3P30L 4Q2ZB 1MHHA 1LL6A 2E9MA 3QXAA 1G7IA 3TN0D 3BEWA 4P3WA 1UJ3A 4MA3B 3NIDF 1Y0LB 3Q2CA 2M8XA 2UUDH 4PJAB 2JK5A 4GMTL 5L2KA 2JLLA 3Q48A 2L7JA 4HS8L 1QFHA 2GIYA 2E9BA 3BKCH 4TUOB 5JTWA 1FBIH 4MS8D 4Z5RA 1EEYA 4LU5L 2XFXB 1I7ZB 5TDPB 1RU9L 3RMEA 3GSWA 4JFSA 2YKLL 2X2JA 4PEEA 2D31A 3NAAH 5FA4B 1EBAA 3JWDH 4M6AA 4XNZB 2Z1KA 4WK9A 5GGRY 1FH7A 3WFCL 2JB6B 4D6IA 5I15L 4XWOD 2LTQC 2B4CH 4KI1A 2CPUA 3IAQA 5F1NB 5A8MA 3PXHA 4PV9B 2NXZD 4EOWH 3LPWA 4RZCB 2AXFB 4HKZB 1F42A 4HF5L 4NJAH 3CPLA 4EJ1C 1NAMA 4OFIA 1FFPA 4P7NA 2HH0H 4NM4L 3VW3L 3ME0A 1WAWA 2GJ6D 1ZHBA 1M6OA 4MA1B 4LVNB 2NTFA 2FATL 3IU3A 4W70A 2XQYG 1R24A 2B1HL 2GDUA 4WLCA 3IFPB 2J7GA 3PE9A 1NH6A 4PJ7B 4PJGE 5KSAD 4Z7VB 3ULVF 5KZ6A 4G3YH 1ERNA 2Z31B 4JR9H 3RTQC 3K8KA 2VLJD 3LD8C 5DUBA 4WW1A 2I27N 1T83C 1E4MM 2EKSB 4BA0A 2X1PA 2D7TH 1I8IA 1V7MH 3DOSA 4P23A 1ZWIA 3P30H 2EDNA 1DQJB 3WDHA 3IAGC 5A6KA 1YUHA 4ZOAA 3RRQA 3EYSL 2UVFA 1FG2A 4HUXB 2QHLA 3FB7B 3MUY1 4M93C 5MEPA 5GNYA 4MJ6A 2BVOA 4KJQC 4QRRD 5TF1L 4YK4C 2V5CA 5DJDB 2YPLB 1QBBA 1TJIL 4HS8H 2J1KA 4XHJC 3MRDA 3PQYE 5H35B 1AQMA 4HLZH 1N8ZB 1X5IA 3DDGA 3DURB 2PO6C 4RRPA 2A9NL 3V52L 2FWOA 4BJLA 4LU5H 4WTXA 3VM5A 2VLRA 2XN9A 1OW0A 3STZB 1RU9H 5HYSB 5GSVB 2QEJA 3AHXA 5JQ6L 3W37A 4OFVA 4JFTA 4K7PX 5KW9L 2C1OB 4KJYA 4LCCC 4U7SA 3WFCH 1S3KL 3D6GA 5I15H 4PRDB 1JHLH 3MRNA 2EDRA 4Q2ZA 5CMAA 5IUSA 3GMMB 2J3SA 4TVPL 1RIVL 2ZUXA 5BO1L 3VWKA 3IVKA 5BXFA 2F15A 1OAYH 3ECQA 5CJBA 4QF1B 1UWGL 1F4WH 3JV6A 4P59H 4W81A 4B0MM 3KPRE 4HF5H 3EO1A 3KWWA 5JIHA 4WKFA 2ZSWA 1CGUA 3C6SA 3WSQH 4NM4H 2V5DA 4XXDB 5DUML 2XZCL 3RIAK 3MRMB 1B3WA 2FATH 3RWJA 1IGYB 4AMWA 3D2UB 4NQSA 3MGOA 2F74A 2B1HH 3JBG7 3ARGD 3UTTB 3TN0A 5FA4A 4M8UA 4KI5E 2AGJL 3O9NA 1NANH 2CLRB 1MCOL 1WV7T 2AJVH 2ZUUA 4U3CA 2EC8A 1A7RL 1PLGL 1E0VA 3MRJB 2DSWA 3O2WL 4JRXE 5AEAA 5JUVA 4LFHD 3C5ZC 5FEBA 4NSKB 2JEQA 4AEHL 4PJEF 4JDVA 5E56A 2WVVB 1BZQK 1OAKH 1WICA 4PJCF 4W4OA 1UG9A 4NC2B 5LGJB 5JR1L 1K4DA 3U7AA 1IGCL 5BMFL 5L0QC 4GO8A 4ELME 4JFFE 3CUPA 3MRHB 2IBBA 1JYVA 4X99B 2V5YA 5TF1H 4PTTA 1Q38A 4PRAB 1J0KA 1XR9A 5C86A 1H4PA 4B9YA 1FGNL 4AZ8A 4EI5D 4DQOH 3PABA 3TFKD 1ZE3C 2A9NH 3SKJL 3V52H 4LGXA 1NJ9B 4DGVL 3O9WD 3QJFB 3QHFL 3RP1A 2CLVB 2F61A 1US3A 4G80B 5IMKB 3G6JB 2D3NA 1UQZA 2ZNXA 5F88A 5KW9H 4LMQI 4L4VB 1TVHB 1XGUB 1R3KB 1SM3L 5E0CA 2P24B 3GXNA 4M81A 3TA3C 3ILPA 4MDPA 3PP4H 2GJ6A 1HKLL 1QBMH 1QSFE 4WNQB 3LN5A 4V1DB 5GPRA 1WP6A 2EPNA 5HGAB 1B30A 1T22A 5BO1H 1RIVH 1KR1A 3DNKA 3QI9C 2IFFH 1UWGH 4P2QB 4PRID 4ONHB 3CO4A 4NQXA 4FS0A 4U7MA 5KSAA 5ACZB 1PKQE 3UXFA 5EOQL 4HV8A 5DJDA 2Z1SA 2MWCA 5DRXA 3MV9E 2E3ZA 4LLQA 5DUMH 1T1WA 4YH6A 2VLJA 2XZCH 4YLQT 1I1RA 2BS9A 2IBZX 5J11C 4XP6L 1OBAA 4OLUH 4LHUD 4FQ1L 3RUGE 1FDLL 5EPMA 4OUUB 4Q9QL 1QP1A 4HXAL 2CXKA 2AGJH 4PJ8D 3K4ZA 1MCOH 5JW3L 4OD2A 1CFNA 1QLEL 3QZWG 1A7RH 4PRDA 1PLGH 1PY9A 1FC1A 4QRRA 2VWEE 5CEZL 1SJVA 4ZE4A 1ETZA 4R26L 5D6CA 3SDDB 1ZLWH 4UNVA 2I24N 3BAWA 5DURD 4AEHH 3UZEA 5LVEA 5HPMA 3TBTA 1A3LH 4BUHA 2PKDA 3BUYB 4LSDA 1CIUA 4AD2A 3D9AH 5JR1H 2EDWA 2ZUTA 1IGCH 1LO5A 1PIGA 1JNHB 5HYFA 1NFDA 4HPYL 4OLXL 3BD3A 1XZ0B 1B0WA 4MVBD 2XJ7A 3X12A 4W8BA 4XNYL 1D7FA 5D5MA 1TZHB 1HN1A 2MQ0A 5DO8A 2B31A 4YJZL 1FFQA 4J7RA 2F53D 3SKJH 3BXWA 2HFEB 1MOEA 4DGVH 1FHLA 1AD9B 5T3XE 4WIWA 5A6MA 2ZX6A 5CG0A 3GJFK 4M5YH 2DQHL 3SKOB 1QOKA 1MJ8L 3MRJA 3QOKA 1TPXB 4HWBA 1S46A 1OD8A 1SM3H 2ZSVB 4YHYB 3LKRA 4G8GD 4RFNC 3T2QA 1ZK9A 2EDYA 1HKLH 2XKNA 2YD5A 2X4UB 4OGAD 3UTSB 3MR9B 2CITA 3QEUA 4U3XA 3U9PH 1XHGA 3VXSE 3O8XB 1ZEAL 2XPKA 3ARGA 4AZ5A 2FEDD 4HKXB 3L9RB 1AD0B 4WUUE 5HGDB 3MCLL 2WP3T 3MUZ1 4U1IA 3VFNA 3BVUA 3MNVA 2YBTA 3OWEA 1LP9B 3D39E 1GJIA 2CLVA 4JO4L 4Q9QH 4X6CA 2C7UA 4G80A 2FJFA 4U5IA 4HXAH 5IMKA 3MLZL 3OSKA 5D8JL 1J7VR 1BX2B 3U46B 4LPXA 1QLEH 5T3XH 4QXWA 3AJ7A 4TULH 5CEZH 3PWNA 4R26H 3L4VA 2QL1A 4WNQA 1XF5B 1LQSR 2QQKL 3UTQA 3WY4A 2OL3H 3K74B 2BOBA 4XP5H 3AFLA 4K94L 1U92B 3SE4C 1MFAL 2X09A 5EU6E 3VXQB 1SJHB 4AY0A 2DH2A 3L3HB 3O9WA 3PZTA 1W91A 3PZMA 4LLWB 1C93A 1IAMA 4L8SA 3SE3C 3I6KA 4HPYH 1CL7I 1B4JL 5CSZA 4XNYH 35C8L 3K46A 4H8WH 2ZX5A 1KXTB 4XZUA 4NC1C 2NW2A 4O9HH 1I8LC 1KXQE 4KK8C 4XXCC 2V5RA 4ESKA 5CGTA 3MBEC 4PP2A 3AOFA 1Z9SA 1VCAA 3TT1L 4PRIA 3IGAB 3WN5A 2DQHH 3WIIL 3E6FB 1MJ8H 1RZKH 1I1CA 4HHAB 4ZEPA 3HZVA 4NRXB 2QSCL 1BF2A 2DIAA 2VSDA 3CFKA 4AL8L 3B9VA 4V27A 1T4KB 5FYKD 1WAAF 3QIWC 3PWJA 1DUYA 3MA7B 2EDDA 2EE2A 5ESAA 5DZNA 4LHUA 4BZ1L 1ZEAH 1JNHA 2IANE 1DL7H 4N8VB 1LL4A 2CETA 4PJ8A 3W53A 1II4E 4ETQB 4ZAKD 3HU7A 4CMHC 1AGBB 1I7UA 2DWEB 3MCLH 2FHFA 5HHME 5TD4A 2P49B 2X0YA 3W29A 4QYOB 4KRNA 4OUEA 3QP3A 3V4PL 4TNVF 4JO4H 1PYWB 4N0FB 4HJGA 4R7DB 1F11B 1JPGA 1VFAB 2EE6A 3RBSA 3MLZH 3MGTB 2YD4A 3SKOA 4MD5A 3TNNA 2ZSVA 3PDOB 4O02H 3CXHJ 4E42B 3V5HB 4G6KL 3EFDL 2ADGA 3PUCA 2OP4L 4ZUWB 3UTSA 3PTMA 1U8LB 2BXZA 1MAJA 1Q6CA 1A1OA 1TZ7A 4GMSL 4K94H 1ZMYA 5DT7A 1MFAH 4L29B 5SV4A 4L3EE 2IQ9L 3OAUL 1AGFB 5FL1A 4U0QB 5GS1B 1SQ2N 3WENA 4Z7NE 4F37K 5DO2C 1EHAA 1KQYA 3V6OA 3E2HC 1OD7A 3N1MC 4GRLD 1XGZA 4QRPB 1FVDA 4G8GA 1HF6A 4DJMA 1UH3A 3N12A 2LE9A 3O6FD 4BQCA 2QSQA 2NY5C 3WIHA 5K9QI 2AEPH 4GRWF 4PGCB 3VXUE 2ESVE 2OTUB 3UPRB 1ORSB 3H9SE 1I1FA 3QXVA 3TT1H 1KR0A 1I7TB 5CJ5A 3C8HA 3SKNB 4JRYD 3QSKB 8FABB 5T1DL 4CCEA 3FQWA 3H0TA 4QHKI 5IOPB 2QSCH 1XF5A 3QJHA 3II1A 4AL8H 2EIEA 3F12B 1HHGB 1IAIM 1WCBA 4FA8A 3ARQA 2NZIA 3L3HA 3AXIA 4BZ1H 1A9EB 3O6FB 4BK4A 4Z2IA 3EJJX 1KB9J 5L88L 5ADOL 2DSZA 1IRAY 3B3IA 2RHEA 3CU7A 1WWWX 1UQSB 5D2LE 2EQDA 3WDJA 3W27A 2WHMA 4JFHE 4AMCA 5HGHA 3Q6GL 2DI9A 4J28A 1DCLA 3AVEA 3V4PH 2MPAH 4IRSD 3RWEA 3SGJC 3V4VH 2JJUA 2I07B 4TVDA 4LLYA 3CH1B 5IB3A 1R7AA 4JZNA 1E9LA 4MXQD 3WMCA 1H3TA 1JRHL 4OD3L 4AMXA 4YDIH 2VLLA 3E6FA 4HHAA 3ZKXB 5EC2B 2OSYA 3S2CA 2VOTA 3AIQA 1LE9B 2AQ3A 1S9XB 4CGTA 3CIQA 4XB3A 4OCWL 3QEGH 4G6KH 4PMOA 1HTYA 4NKDB 1YECL 1UM4H 3IF1A 2WMPA 2OP4H 2D73A 2C1PB 4X7SH 1UCBL 5F7YC 1T2XA 2DBJA 4PJIF 5C0EA 3KR3L 3WFHA 2PYFA 1YEKL 1DWGM 3A6OA 4P7LA 1GOKA 3MRRA 2IQ9H 4F3FA 5DFVC 3OAUH 4K71C 4D6GA 2WBJD 4B9ZA 5C0AB 2CERA 2ZWLT 4HBQA 3W39A 2QHAA 4QCEA 4I3RL 1LO3L 3KLAB 2DH3A 2DYPB 2NCMA 3WUFA 4LPCA 1CICD 1UZ1A 1UM6L 4CN6A 1PZ2A 1U8MB 4PB9L 4MMXC 4DTGL 2G3NA 2ZCHL 3HG1E 1TQWA 3T0EC 1JIBA 1N64H 4YXLL 4ZYKB 3AAZB 1QYGL 1FYTD 5K9JL 3PDOA 3OJMB 4KKCC 4XTRC 1Z5LA 3KYOB 3V5HA 5T1DH 3QIBB 4ZAKA 1BP3B 4ZUWA 3NCMA 5MHSD 3AXLB 2YHGA 4H20H 1KNOA 4L4TD 3QUKA 3MQIA 3GSXB 5JIKA 3LRKA 5BQ7A 1CICB 3MJ7B 3QULB 4M82A 1KPUB 4L29A 4DZ8A 3KAAA 3FO0H 1P4LA 4ZXBD 2CUHA 2V9RA 4KHXL 3N9GL 5I73B 1NWTA 5L88H 1AGFA 1S7TA 3PHQB 3NPSB 1JNDA 4DUVA 4NQDD 2VABB 1CDGA 4R0LB 4QRSB 5D7SL 3DMMC 1W8OA 5KVGL 1MCWW 5CIPH 1E3ZA 3OR7A 2NLJB 2XTJC 1H0DA 2VYRE 4QHNB 4K8RL 4PGCA 5EU7C 2OTUA 1ORSA 5DJ6B 2BX5A 2D7PA 5D9MA 2QMKA 5GGVY 3IJHA 4U6YB 3UYPA 5C0IA 3SKNA 2ZX9A 4OD3H 2HLAA 3HMWL 3QFDA 4QLRA 1KPRA 4JN2B 3GSRB 3VXOB 1GOQA 5IOPA 1FL5A 4C7GA 3CD4A 2J8OA 3KPMB 4PG9A 4GRLA 2FO1A 2PR4H 1HHGA 1L8NA 1NCDL 4PMDA 4D1JA 4IMLB 5C08B 4ORGA 4UFLA 3FQXA 3BCDA 1E40A 3B9KC 3CZJA 3O6FA 2XVPA 4WFHD 3KR3H 3ARBD 1YEKH 3EYVB 4U1NB 4UQBA 5E0QA 2UY6A 3HRPA 2GITB 4FRWA 1U8JB 4UTBL 4Y16D 5DD3L 3U9UB 2WKGA 5B4MC 3JTTA 4JRYA 3CZKA 4FTVB 2QQNL 1LO3H 4OZGE 1AQDA 2YLAA 4LVHC 5C0CD 1AHWC 1UM6H 2IH1B 2ZWYA 4DTGH 4JY6B 3RVXD 2ED9A 3CH1A 1RUMH 2DQFB 5I8EB 1RJCA 5C9JA 3A6CL 4HSQA 3T2PA 3IDIB 3TM6A 1WJ3A 4BQ8A 2A6KA 5K9JH 1HQ4A 3N85L 1S9XA 2CDEA 2F5AL 1C1EH 5TPWL 1W8NA 4BELD 4MNMA 3VFRA 2N4IA 2K9UA 2GCYA 5CWSA 5HHOE 2EPKX 1A0QL 2YR3A 4OCNC 1MFCL 4IRSA 5MI0C 3N9GH 2J7EA 4EN3B 1IGIH 5ERWB 4PJ9B 1UH2A 3P0VH 3U6RB 2DYPA 4HUNB 3VGGA 1SR0A 5C0BB 5GRZA 3A4XA 3C87A 2YA0A 3B8YA 3QWOB 4ELKB 1ZOXA 5KVGH 1JNNL 3I75B 5EBAA 5C09B 3BZEB 1H49A 3E3QC 4JQXA 2VERN 5IMLB 2ICCA 4K8RH 3X3FH 2RFXB 2DM7A 4ZYKA 4F2MA 4CDHA 4PP1D 3JSSA 4RBPK 4HAFA 3S36L 2EZ0D 3A67L 2WBJA 3IYLW 3QDAA 1C12B 5FHAH 5J4MA 3VA2C 1SVZA 3FQTA 1CICA 4XHQA 3WO4B 2FGWL 3MCKB 4JFDD 1KB9K 2E5EA 5DGRA 3QNYB 1OTSD 3PHQA 4Y7EA 4UTBH 3GBDA 5DD3H 4EUPA 4F7CA 3RHWK 5IIEA 5DRWA 2VDLH 5CPTA 4OLVH 1BZ9B 3RCNA 1H3GA 3QXDA 4CCDA 1ROWA 4L4TA 1YQVL 2YD3A 3QCTL 2MHAB 3O4OC 5I18L 2R9HD 5KSBB 4ZXBA 4JCLA 7TAAA 2EDQA 5DMKA 3EJYC 4JN2A 3VFOB 3VXOA 1UJ3C 2DQTL 4KVNH 4H8VA 2W4XA 4NQDA 2Z93B 3QXTA 3ZDXE 3TTYA 5TPWH 4KK6D 12E8L 4WI3A 5C08A 1EO5A 2CDGA 1REIA 2H32A 2VX4A 4HIIB 2FBJL 1FO0L 3QUZB 3WF0A 2GFBA 5CQ1A 5BV7C 1TXKA 1PIFA 1UENA 3NFNB 1AR2A 4J4PA 3TF7C 3QAZC 3CSYA 2O9PA 4UFJA 1B4RA 4GZIA 2XHYA 1TNMA 4Z2KA 1DN0A 2FDMA 5HXMA 4GG6F 1EAJA 1RZGB 4KKNA 5DXWA 1NUNB 2IH1A 1OSEA 2PTUA 4LLMB 2QHRH 4N0UB 1CWVA 3RNQB 3WQVA 3H2WA 4P3DB 2MANA 4GFTB 5DA0B 3HZYA 5ENWA 4IIQB 5ESVB 4D0CA 1DLHB 3ARBA 5KAQG 1HEZA 1UEMA 4OIBA 4JM2D 3BUQA 4Y16A 2D7OA 1AKJB 4QXGL 1E6RA 4IJ3B 4PRHB 2EYTA 2WIIA 4PYHA 5C0CA 4KZEH 4NO5B 3UG3A 4OFPA 4PJFE 4UMGA 4PJHA 5MERB 4M3JA 4MNJA 2CJUL 4URTB 2YUXA 4WDIA 2B5IC 5HD8C 3WELA 5I9QC 3S6TA 1M7IB 1VA9A 1BQLL 1JMXA 3NZ8A 1DR9A 4QHMB 2EADA 4Y89A 3VG0L 5HI3D 5IFTA 1CEOA 1X1NA 2CQVA 3GXIA 1EHXA 5CLWA 3MV8E 4KH2A 5IMLA 5HDQL 4EI6B 3OAZH 3RDKA 1YQVH 2RFXA 3QCTH 4P23C 1OLLA 1D9KB 5GRWA 2DTSA 4W6WB 4JKWA 4Y4FB 2J7DA 1CQKA 2WB5A 2EEXA 1H9VA 2VAAA 2X4RA 2DQTH 2C3HA 2G5BA 3Q6FA 5AWNL 3V7AG 5D9SA 3DVNA 1GVYA 1IC4L 1NDMA 4KMTL 4M02A 3RY6A 3TBYB 12E8H 2OYPA 2P5WE 4LCIL 1JYWA 4Q74A 4Y19E 3UC0H 5FCZA 3GM8A 4G6JH 4OLWL 1RVFL 4XX1G 1HKJA 3MRLB 5T3ZE 1QNRA 5CJQL 1WLHA 4R4ND 1ZVHA 3QDGE 3BAEH 5C1MB 5D7KD 1M71A 4J1UA 4H26A 2GAZB 1MRDL 4CNIA 2NY0D 1ZLUH 2OS7A 2IAMD 4A4AA 3GRWL 4F9PA 2Q6WA 5CCKL 4POZC 3O3UN 1Q6EA 1BZ9A 4OFKA 1NMCB 1UKQA 3S6CA 1SY6A 2RCSL 5F6HJ 3HZ3A 4M8QB 1V05A 1MQKL 5GGTL 1CZ8L 3KPSD 3CMOL 4Z7UE 4JFDA 43CAB 3VWKC 1FSKC 4K7PL 1R34A 2R8SH 5KVFL 2HT3C 5IHUL 3RWGB 5ADPL 4QXGH 1QVOB 1BIIA 2DRUA 1KFAH 1MCQA 1KEGH 3OPZL 4QTHB 3QUZA 4HKBB 1RUAL 1TFHA 2H6PA 4P4KD 5F97E 5ICZA 5DD5L 2HTLD 5T1KB 2PBOA 2JCCB 3TN0C 4Y8DC 3PWPB 1BMGA 3VG0H 3PJSB 2DJUA 4DGYL 1GGIL 2AJ3B 5IT2L 1T04A 4DFHA 1MUJB 3KJ6L 1ZA3A 3KXFE 4N0UA 3TWCH 3GBNL 1OIMA 1JPFA 4GJTB 4BKLB 3A3HA 4H04A 2D3VA 1KCSL 4GW1B 4QKXB 1XF4A 3BP5A 2WLZA 4LASL 5ICXB 4MS8C 1I9RL 4OZHA 3U5YA 2FO4A 2NX5B 4MQ7B 5E4IA 3BIKB 4KY1L 1GZPA 3FO1B 4OZFB 1JHKL 1IC4H 4KMTH 1UR4A 2EC9T 3L2LA 2LABA 5E8OB 2DPEA 4NO5A 3FT2A 1EXUB 4OLWH 1L7IL 1W3JA 2QPUA 4GUPA 4XWOC 5CJQH 1JMZA 1MELA 1F6FB 3AI0A 1YHTA 3VNZA 2Y9RT 4AWEA 2JIXD 1MSPA 1YQ2A 4PJDA 2DMCA 3GRWH 4OLYL 2NXZC 4O2EB 4G9FB 3UEZA 5EO0B 1E55A 5EOTA 4A2MA 1WK0A 3WSUA 1J9YA 2L4OA 1J12A 2QBWA 2RCSH 4UQ2B 5LKNA 2A74B 5SWSB 5EU5B 1V8HA 5GGTH 1XD1A 1EUUA 4EZMA 1CU4H 5GRYA 3CMOH 1WO2A 1RZFH 5HYEA 2R0LL 1DUZA 5GGSY 1QI3A 1AIFB 2OBGA 1UWEH 5KVFH 4OLEA 5ADPH 3TBYA 5KSAC 3VNYA 1DWFM 2NMSA 3UETA 3ECBB 4I0PB 1CE6B 1OWRM 2BJML 3T2NL 1ZSDA 4HUUA 1RUAH 1U2CA 1P6AB 4DK6A 4V28A 1MNUL 3GJEB 3BKJL 4YDJB 3POHA 5DD5H 4NKIH 5I76B 3VRIB 3T65B 5IBTL 3NH7L 1CGXA 2V3EA 1A6UL 3BKYL 5A8OA 3H9HB 4C56B 4A6YB 4BYHA 4X7FC 4DGYH 3QFJE 1GGIH 2VX5A 4MQXD 5JW4R 3QHTC 3GBNH 1F3JB 1KTRL 3U36A 4D0BB 3TYFB 1ZHKB 3LCYA 3L4YA 1HHHB 2ITDB 4LCYB 4Y5VB 3DGCR 3VXTA 5JHDE 1KCSH 4NUGL 2D4FA 1DDHA 1MCSA 4NZJA 1VSCA 4KY1H 2IAMA 1ZLUK 5GJTH 3LIZL 1S7RB 1OQXA 3O3DA 3ARED 2AAAA 4E5XB 3EYQD 4ZSOB 5DS8B 1S5HA 1L7IH 3F7YB 4OM1H 2AK1L 2VQ1B 2WUCL 1WZAA 3KPSA 3G5XA 2W07A 2ERJC 5F7NC 3BAYA 5T1KA 1FVCA 4IDJL 2JCCA 5FYJE 1B3VA 3BMVA 3C5SA 4OLYH 3VDAA 2KDGA 2CHNA 5EFDA 3P9LB 1K8IA 2IC2A 2WLYA 3D4YA 3V9FA 1MUJA 1NARA 4M5ZL 2LU7A 3LS5L 3V5KB 1BFNA 4LP5A 3TGXA 3LKQB 1MWAL 2DIJA 5HY9B 5IESL 5KTEL 1L0PA 1R47A 2VLKD 2VRAA 4OTXL 4P4KA 4AXNA 1AQ0A 4UDTB 5ICXA 5KS9A 3BP4B 2XWJB 5I1GL 4MQ7A 1CF8L 2R0LH 2VSCA 2A0LD 3W9EA 3OX8B 3ARGC 5GXBB 2VXSL 2F54D 1R5IA 3EDJA 4XVTH 4P2CG 5ITBL 2WIMA 2ZUQC 5HJ3B 2BJMH 3CTTA 1NBYB 4DZBB 2LAAA 3QUYB 2IBGA 3NIDE 4QTIL 1NOFA 2CKBA 1P4BL 3WNMA 4Q9RL 2XM1A 1OY3B 4UB0L 1NAKL 2ATPA 5IBTH 1BJ1J 3NH7H 4O2EA 2EBNA 1A6UH 3BKYH 3U1SL 3H3PL 4LLDB 1MCDA 4CVXA 5TE7L 1QHOA 1XH0A 2K3TA 3IFOB 4KQ3L 2NY5L 4GRMB 3G6MA 2EDJA 4PJ5E 1PS3A 3ARWA 2J4GA 4MDOA 3DBXB 1OGTA 3EBAA 4NO0D 2P4AB 4EI5C 3EIFA 3TFKC 4NUGH 1AIFA 2JIXA 2V7NB 2A83B 4Q58C 1CXIA 3O9WC 4HC1L 2HLFD 3ZR5A 4H41A 4BFIB 1XH2A 4KFZC 3ZT5A 3GJEA 1XIWD 2AK1H 5TJWK 2ZNWA 2WUCH 3B4NA 3IFLL 3QPXL 1AO7D 1KGWA 3T65A 4LSSH 4Q9BA 2UZYB 3ARDD 1ZA6A 4LP4A 3BD4A 2VE6B 4X8XA 3VXPB 3AHVA 1MQRA 5A6BD 2E7BA 5DQDH 5J9PB 3WN5C 4M5ZH 3LS5H 2XIBA 2FGLA 3BP6A 1H3VA 5JDSA 3EW3B 3TYFA 3QUMH 2XIIA 3VIOA 1MWAH 3QXWA 4DUXA 1CZ1A 1HHHA 1TUXA 3BPLB 2DI7A 4OTXH 4Y1AE 3ULVE 5F71A 3NA4A 4M7ZC 5IF0B 3S37X 5I1GH 4X6DF 4BZ2H 1CF8H 1IC5L 1YMHB 1EGZA 2IFGA 3HRZA 3V0WL 3BH4A 3RWIB 4FXLA 5JMRA 4HKJB 4JEGB 1GOWA 5D7IF 1LG2A 4E5XA 5ITBH 1QZ1A 4PJ8C 5DS8A 1E6QM 4LAJH 3DX3A 2YL8A 5D2NE 4DAGL 3MJ9L 5JA9A 2E7MA 1OHQA 4HX1B 4QTIH 2G41A 4Q9RH 1P4BH 1MI5D 1QQDA 2BSTA 1DWHM 1IC7H 4UB0H 1NAKH 3VSVA 3SDXB 3BH8B 1ODAA 2YK1L 4XAKE 3U1SH 4BSWA 5TE7H 4MD4A 1OPGL 4NIKB 3AZRA 1JTPA 1QHPA 4GG8B 1D3CA 5LAXB 3QQ4B 5HY9A 4MVBC 3WO3B 1QR1B 3T0BA 4YEFA 1UA7A 3QRGL 4PBWD 4MDIB 1QA9A 4KJPD 4NRZB 4HIHB 4HC1H 4MCYB 1NCCH 3TZVB 4F9DA 3VXME 4XGZA 1FHGA 1MRCL 2Q8AL 3QUYA 3V6OC 1IL1B 1I1AD 4Z95H 4RAUB 2VLKA 4MGXA 5IHBA 3GMRB 4DUWA 2HA1A 4OGAC 5F7MC 5AYQA 3WUEA 3BZ4B 1I1XA 2VDKL 4RA0C 4K2UL 3NCCB 4OOUA 4MHHI 2AJSH 2VR4A 1R6VA 2HVKA 3KPPB 3DHPA 4F7TA 3BD5A 4ZUUB 4NKOA 1B2WL 2A83A 2NW3B 4G8FB 4KRMB 1B2YA 1R7OA 1EO7A 2PWHA 3V0WH 4R4BA 3LSOB 1I3RA 5ECUA 2Q20A 3EDEA 3RJQB 4IEFB 3CXDL 3EMQA 4PJEE 1OTTD 5IV2B 5LYRA 4UNTA 2VITA 1IM9B 2Q1EA 4PJCE 3K4DA 4G9DB 4KPHL 4XBEL 4EDXB 3HA0A 4NNYB 5TQ2H 4Q6IA 4XNQB 5CSUA 2QTEA 1NEZG 1FLTX 4GIAA 1UKSA 3V7MA 4NKMB 5C0JA 4NO0A 3TNMA 2BFGA 2VE6A 3VXPA 3ZSTA 3GSNB 4R2GB 1A7BA 5DMJB 4X83A 3BYTA 1U6AH 3OKEB 4O5LL 5LQBL 3SCUA 1UHVA 5E5RB 3K3QA 1S78D 1OD9A 4MCZB 3RL2B 5D8ZA 1XIWA 4BH7B 3B2VL 4Z7WA 5DZOA 1AO7A 1YMHA 2PTTA 1M53A 4X6FB 3RIFF 4HKJA 4QHUB 3ARDA 5JOFB 2WVSA 1LHZA 4C4KO 4AYGA 4BA8A 1AMYA 3CC5B 3O0RH 5D9NA 1MRCH 2Q8AH 1ZS8A 3ZKQD 3IETA 2L0DA 4PGDA 1CG9A 2ALWA 3ROOB 3VI3F 1K85A 4PJGB 1DBJL 2BNQD 2Q7NA 3RWFA 1NCWL 4F15C 3DUUB 3MMWA 5DUPL 5T1LD 2DDXA 5IVXB 2O9OA 1MCPH 4K2UH 1HH6B 1U93B 3GJFB 2EYRA 4ZAKC 4JGUA 4LSTL 1B3ZA 1QI2A 1FJ1A 1IAKA 2VN7A 3KPQA 1MVFA 5DZLA 4MDIA 4XBPA 4ZO8A 5JXED 3GFUA 1QTYT 4AK1A 2W60B 1MI5A 2GTZA 4I0CC 5DI8A 5GNZA 3RGVD 3GB7B 2CHOA 5GIRA 4RMQA 5I24A 4GW4A 1NSNL 4MA8L 1J0ZA 1HZHL 4RQQB 3CHCA 1Y18B 2AV7A 4X4ME 3P0GB 1V3KA 1IL1A 3PQYB 3V6FA 3BGMB 3L5JA 2P8MB 4RIRB 1OIFA 1RV6X 4FG6C 4KPHH 4RAUA 2ZIDA 2VURA 3IKCB 2NNAB 4NQED 2XRAL 1P1ZB 4YGVA 4WW2C 5DJYB 1EX0A 5ILTH 2XNAA 2ICWA 3LX9A 5TF0A 3RKDD 1QSZA 2DD8L 3VMPA 3D5HA 3P77A 5EZJA 3VFVA 2JTDA 4HMCA 3FQRA 3U79A 1QG3A 1MPAL 3F65A 1FP5A 2ZE0A 4GRLC 4ZUUA 1I1AA 3HI1B 4KI5D 2CNCA 1FNEA 2H9GB 1I3UA 1TQSA 3B2VH 3KPRB 3KNBB 3UMTA 1XR8B 1N0XL 1PAMA 4ZD3L 2F8XC 3GMOB 3WUWG 4MXWH 3K8LA 5IB1B 4W6YB 5HHQA 4EDXA 3HKFA 3LKPA 4AZCA 3HFML 4HWEH 3WF3A 2X4TB 4JFFD 2R0WL 4ZUSA 1RUKL 4LVEA 1W1YA 5E0FA 3TA9A 5AG9A 1NCWH 2IUZA 4U6XA 4YBLB 3FN3A 4OV5B 1Z32X 1WIUA 3HTLX 4LXFA 3CMJA 3FOLB 4RGNE 2J8FA 4JRXB 2VISB 3AMGA 4JJ5A 1NWSA 3M1BA 1J5OL 3RL2A 4LSTH 1CFQB 4M9OA 1MCHA 1FORH 2VLME 4ACYA 1DFBL 4XCNB 4RGMB 1QRKA 4MNGE 4ELMB 2BSSB 4AQ1B 4R96B 3BJLA 5BZDB 5DRZA 1N5YL 1TTFA 3WQWA 4G43B 2GKIA 1NSNH 4MA8H 4QT5A 1HZHH 4MXQC 1MVUA 4QFUA 5D1XB 1AXTL 2AV1B 4F8XA 3HCVB 1QD0A 4ISVA 1RY7B 2V2XB 3WE6B 4PJGA 3VIIA 3IDGA 2XRAH 1U8NA 4JQXC 1KIQA 2JELL 4OJFH 5HDBF 1U8PB 4QOKE 3FKUS 2YUWA 2DD8H 4PR5B 1BYAA 3OKKA 2BOCA 3VO0A 4UTFA 4M61A 4L1DA 5A95A 2WBJC 1QSFB 1W0VA 3QPQD 1MPAH 1QNOA 4LGRB 3D25A 1S7VB 1JN6B 3T0AA 4HGWB 3DVGB 3QNXA 2C4FU 3RJYA 2R1XB 3F5WA 5D8WA 1PKQB 2BNQA 4MJIE 1MJUL 1N0XH 3FO9A 4AJ0A 4ZD3H 1OD0A 5BJTB 5FKPB 4LCUB 3MV9B 1YMME 4UUJA 5T1LA 3M46A 1C16A 1WAAE 2BXYA 3O3AA 4HOXA 5SWZE 3IKCA 3QEQD 2YRLA 3HFMH 43C9A 1KBKA 2XWBA 2R0WH 2R56L 1Q8MA 1RUKH 5JXEA 4K3JH 1VGEL 3SCMB 4GXVH 2Y5TA 1VEPA 5LA1A 3S9DB 4ZXBC 1DBBL 3RGVA 1JGDB 1P9MA 1KJ3L 3DVIA 4S10A 3M17A 4TUFA 4UOQA 5T3XD 3WEXB 1T03L 2H9GA 5CEZD 4AT6B 2ICWI 2ZOXA 3EJRA 3VG9C 4IBLT 1C90A 5DK2A 3Q5OA 3GMOA 1N5YH 5A2AA 3MRIA 2YDRA 3BZFB 4ODHL 5IB1A 1I1YA 6CGTA 1C5CH 3A6BL 1BM3H 4XZWA 4QRQB 1ORQB 2O61B 4X6EA 5D96C 2PYEE 1OINA 5E9DD 4PSRA 2OJEB 3ULUE 3QDJB 4R97B 1DQDL 3VSTA 4JDTH 3WNKA 5J13C 1HHKA 3MRGA 5DHVB 2JELH 2DQIL 1UQYA 4P8WA 3U57A 3BO8B 2CK0L 2OL3B 3ARBC 5DHYB 5ACLA 1JZ7A 2VISA 5EB8A 2R69H 4Y16C 4O51A 4UFMA 2NY2B 3MUHL 3ARPA 2CIKB 3M45A 3VXSB 4XCNA 1QNPA 3X11A 2EE3A 3GBLA 4ELMA 3AS2A 4JFFA 4R96A 2OXHA 3ORJA 3ESUF 1MJUH 1XGPA 2EKJA 2NY7L 1SYSB 4WUUB 3P4MB 3AM8A 1O5DT 4J6RL 5JPMB 3FMGL 5M95B 3HCVA 1UWSA 4BSVA 1G9MC 4JAMA 3WE6A 4UT7L 3TH4T 4Y2DD 3D39B 1U3HB 2R56H 4NC0B 3MROA 2BHZA 1IFHL 1W1VA 1VGEH 1F6AA 5MP6L 3ULUH 2BNUA 5KJRL 2Y06L 3VFMB 2VN4A 1KJ3H 3GIVB 4HUWA 2CDFB 1FV1A 3MODH 3SY0A 1NOWA 2N1KA 4ZPVB 1S7VA 3RY6C 3THCA 1XGRB 4HGWA 4BM7A 3MCG1 5EU6B 4K3EH 1LEGB 4D9QE 3P11H 5DK0A 4Y2DB 1S9WB 4I4WA 3FFDA 2Y36H 3GMQB 4WEMB 4X0NA 3DDFA 4P5KA 4Y4HD 4Q7NA 3OJVC 1MLBB 2GUOB 4HBCL 5FKPA 3TVMD 3BAKA 1CECA 1UVQA 4AD0A 2IPTL 5ISZE 4ODHH 5I0DA 4PJ7E 3FXYA 1I3GH 4PP1C 3GSUA 4AIZA 1IGFL 3A6BH 4PJIE 4Z7VE 2ZG1A 2EZ0C 5DWUH 5EBMB 1VHPA 3WJLA 4ZG1A 3RUGA 3WJJA 4DEPB 3MRBB 1W3HA 2A73B 1E6XM 4LGPB 3WQ6A 5FYJU 4Z2JA 1T0PB 4HFWB 4DOHE 1DQDH 1QRNE 3NCYS 4NUJB 3SCMA 4FQXB 3OKMB 1VDGA 2DQIH 1KTLA 4L4JA 2EH7L 1OTSC 5E03A 2P5ED 1GNXA 4N8PA 3FB5B 4WFGD 1E28B 3QHMA 4BQ9A 1NANI 4TX8A 3LV3B 2W9DH 1SJEA 5E08L 2O5ZH 2ZXDA 3PIQB 5LGHL 1BGAA 1VADB 1DN2A 4F7PB 3BLBA 4ZFZA 1BBDH 5DEFA 1Q72L 1Y7VA 1IGML 2IANB 3GUTA 1PG7W 4KKAD 4GQ9L 3HR5B 3CUFA 2R9HC 4HH9A 2PN5A 1A14H 1G7PB 1F02I 3LEVL 1OAQL 5E1AB 1GGTA 5HHMB 4J6RH 1SYVB 2ICEA 3FMGH 2WZPD 2DDQL 4QRQA 3CJJA 2XZAL 5KG9B 3QEHB 2VDOL 1YN7B 4MAYD 4CN4A 2AJYL 2FB4L 4LDOB 4WUKL 4NNXB 4XRCA 4OM0L 4KKBD 4F7EB 3WH7A 4CD6A 3BO8A 2OL3A 5DHYA 5MP6H 1R75A 1HKKA 3SPVA 1TQCB 2Y06H 3KLSA 2NY3B 3N1QC 5DTFA 3VGEA 4P46D 5JPNA 3GXTA 3CFBB 1SVCP 1P84K 3VXUD 2ESVD 3BPNB 5KANG 3WF2A 1TIUA 4G42A 2BVPA 4RWHA 1MW1A 1QO3A 3ZT6A 3QOMA 2G75B 5E9DA 2DQJL 1TZGL 2A38A 4UQAA 1W72H 4L3EB 1W9UA 4FNTA 3Q5YA 4HBCH 3PZNA 3P4MA 2N7AA 5J6GA 2IPTH 4C57C 1LILA 3HE7D 5JPMA 1DP0A 1CK0H 2XVLA 3WDRA 1CGSH 5DJ2A 4U1JA 4JM2C 1NFDF 3DO3A 3RU8L 2BHYA 2CD0A 3DSFL 2A2QT 4P46B 3HS0B 2B0SL 2DLEA 5D5MF 3MACH 5ESQA 3H9SB 4BFBD 4TNVK 2PCPB 5BS0B 4JFHD 1S8DA 3KG5A 1LK3H 2CDFA 4S0SD 1JG9A 5CSGA 2C3WA 1HH9B 3O81A 3HMXL 2CBVA 2EACA 5E08H 2YA1A 1A4KB 2APTA 5LGHH 1GUVA 1V3MA 4R3SB 4XMKL 3JWOC 5C07E 1NL0H 1JAKA 4Y2DA 5FUCC 5C9KA 4DVRL 1OCWL 1J9CT 1IGMH 2YN3A 4X5WB 3VGHA 4I18A 1E4XL 3LMYA 5D2LB 2XFRA 3LEVH 4OI9A 3C09C 1ED3B 2XA8L 1OAQH 1CD1B 5J1AA 1BLIA 1XGYL 5H37G 4N90D 5EBMA 5A2KH 4LLUA 2XZAH 3FO2A 3H7LA 5TE6H 3MRBA 1KXQA 1FNLA 1A3HA 2VDOH 2AJYH 3ARTA 2FB4H 2QMJA 4NQVA 4UIKL 3T77B 3T4AA 3TPKA 2J78A 2VX6A 4WUKH 4V1DE 3BPOC 4XNMB 4R4NC 2BVQB 2V2TB 5FM5M 4Y4HA 3OKNB 3ZDYE 4IHOA 5FGSA 3TVMA 4X6CF 4PRNA 1U8IA 2NY0C 3R4DA 3MOBL 1PZ5B 3GNRA 1YNKH 2W91A 2IAMC 5B38A 4F79A 3VXRE 1RHFA 5D1ZD 3HG1D 5DMGD 1OF2B 4JCMA 4QXUH 1BECA 3CH8A 2IPKA 3DGGB 5B8CB 1TZGH 3KPTA 4KMLB 1IGTA 3HR5A 5JLZB 4MXVF 4UZGA 3GHEH 4FLRA 3QIUD 4QLLA 1WFOA 4UQ3B 2E0PA 1N7ML 4M7KL 2P5EA 1CFSA 4L8CB 3GNPA 4UQDA 5IQ7L 3RU8H 3DSFH 5B21A 2DL2A 5CPSA 4WFFE 5I1LB 1CT8B 2B0SH 2A6DB 2XOTA 3O6LL 2GJRA 4DO6A 3DX6A 4F7EA 4P4KC 5LA0A 5GHWH 4ACPA 1V3LA 2HTLC 4JO3L 4XPAL 3VD4A 1EMTL 5LWYH 2J8GA 1FZJB 3HMXH 3GH5A 1KGUA 2X4PB 4DFIA 4CD8A 4GKZA 1SYTA 4UU9B 1NMBH 2D9QB 4NHCL 4DVRH 4L3EA 4F33B 1MREL 1E27A 4JFYA 3EFFA 3PGFL 4P3CL 4ZOBA 1E4XH 1KJMB 1MAML 2BMKB 2XA8H 4MJ4A 1LNUB 1M05B 4HK0B 1XGYH 5F7DA 1RULL 3CAFA 4ZUVB 1P2CA 1KLUA 3V0VA 5F70A 5FO7A 4P46A 3HS0A 5B39B 4NWTL 3KS0J 4KUZL 5IB5B 3VXUA 1IGJA 2J7LA 1TVNA 2ESVA 4JL1A 3B5TA 3H9SA 4Z77B 3ZTNH 3ET9F 4GG6E 5TGBB 3FQUB 5EUOF 4JPIB 1ZJBA 1GOIA 4K8RD 4UDUB 1TFVA 2XKUA 1K9EA 4NQCB 1CFTB 1HH9A 2KZWA 5M17A 1EEZB 3MRCB 1W9DM 1A4KA 1T5XB 1MYRA 1ACYL 1TQUA 4R3SA 3S5ZA 3OKYA 1QX1A 1KOAA 4PLJD 1HQRA 2YZ8A 1ZHNB 1CI5A 3DRQA 4N8CH 5EBWA 4L8DA 3M8OH 5D2LA 2R2EA 5C6TL 1CNVA 2IQAA 5BVPH 4FN0A 4Z76A 1G0DA 3LPPA 3DC0A 4OZGB 4R90H 1N7MH 2C7FA 2J79A 3W2DL 4FFZL 1INQB 3VXNB 2Y7QA 5HHOD 1F58L 2F7QA 1RJYA 3D0VB 2GYSA 3RZCD 3O6LH 2FYVA 5GRVL 5M5DA 5FKAA 3IXTB 4CVUA 1PX3A 2V2TA 3DECA 4LRNL 1UUQA 3HPLB 3KLKA 3MRQB 3BFOA 3SQOH 1JE6A 1GRWA 4YFDB 5ITFB 5TQ0L 3KS0H 1EMTH 5I23A 3BWUC 1FLRH 4LDLB 4Z9KB 1T21B 4NWUL 4GXPA 4ZXOA 4EXPX 3IJ8A 1FNHA 5IK3A 5BZWB 1I8MB 3PDGA 4YE4H 4HS3B 4MQXC 3S37L 2X4OB 3DGGA 5IBUG 2K1MA 2EJ1A 5E9AA 5IGXL 1Q9KB 4P3CH 5CIPA 4UQ3A 1MAMH 1MFVA 5GRUL 3E0GA 4RAVB 4OIFA 2QQLL 3NN8B 3L6FB 4PBGA 5JUEL 2A77L 3MLVH 5D1ZA 4DKEL 3HG1A 4ZUTB 1J0JA 2A6DA 4ODTL 5JOPD 4AH2B 1C5DB 3AREC 4K3GA 3EYQC 4XT1C 3UX9B 4P8UA 4QCIB 4ZOEA 2J25A 3A4AA 3I6GA 5FDWB 3UZVB 3THMH 1RJLB 3QIUA 5E1QA 4TVSa 5MEOA 2G9HA 4Y5XB 1ZT7B 3RI5K 1UEYA 3I3DA 1DEDA 1ACYH 4N9GB 2NT1A 3ALWA 1DBML 5HYJE 4F33A 5DJ0B 1FH8A 1H5BB 1RFDL 3O6ML 1ZU8A 2CMRL 1WDPA 2BMKA 4M62L 3ELAT 4P49A 5F7HA 4HK0A 2JJVA 5E5UB 3SDAB 3ILQC 1P6FA 5LCVH 4CKQA 4RAHA 1U8QA 3W2DH 4FFZH 5MEQA 4MNQD 4A3YA 4D9RE 1F58H 5E8NB 3ZKSD 5D93C 3BDYL 3R1GL 4GH7B 4JY5L 4R8WL 4WHYG 3AIVA 4Z7OF 4L3AA 4Z77A 1D5ZB 1DJSA 3H54A 4WSKA 3EYOB 4HMEA 1B3YA 3WL9B 3UYRL 1KB5B 3OBAA 5BRZE 4JZJB 1ODZA 2UV3A 3I3EA 5GZOD 5E8DH 3FHAA 3KJ4C 3QQ3A 3CZFA 5I1EL 5LBSL 1MJJB 2YBUA 4NWUH 1EEUA 1P69B 2VB5A 5I1HL 2DLHA 4PJXF 3N06B 3LRMA 1HX0A 1ZHNA 2GSGA 5E2TH 3L7EB 4NO3A 3S37H 1QEWA 3VCLB 1G9HA 2F2HA 3G04B 4UOZA 3S35H 4DWSD 5D7LB 3FRPA 4Q6IC 5D72L 1NUDA 2ADJA 5GRUH 1WWCA 4GT7A 4OQ1A 3VMOA 2C3GA 2VZSA 1JNEA 2D03L 2F1AA 1INQA 3VXNA 3CDYA 4M00A 3S34L 4D6HA 1ZT1B 3VA6A 1WQVT 4U1HA 4P7OA 2VDNL 1UZ4A 4DKEH 2X7LB 2J7HA 4ODTH 4WKHA 4PTXA 3TT3L 2CUMA 3JV4B 3PZIA 3X3GH 5CP7B 1XIWC 3MRQA 4WW2F 4DWSB 3TOPA 5ANMB 1B0GA 3PGCA 3GDBA 2Q7YB 2H8PB 3T0DA 3ARDC 4JPVL 3WFEL 4F80A 4KROB 4PJFB 4GS7B 2X4OA 4R6UA 5HHOA 2MCG1 4J3VA 4D0DB 3S8WA 1JZ2A 1DBMH 2JE8A 1XCQA 2RIKA 4JKPL 3RZCA 5ABFB 3L3DA 1RFDH 5DVNA 4U6TA 5GISL 4LVOC 2EDHA 4FFVD 4X80H 1P5UA 4M62H 2P5WD 3CVIH 4PY7B 1ZXQA 4K9EL 4AENB 2YWZA 5IB4A 4MSWB 3BGFC 3L5HA 3MV8B 3IJSA 2HJLA 4ZUTA 5F8RC 5F89B 1DTUA 1TZIB 3BDYH 2PXYD 3R1GH 4R8WH 2QSVA 5C0RL 3KL3A 1HJXA 2CESA 4L9LA 3BN9D 4JN1H 2X4NA 4AYFA 1J11A 1GC1L 3MPCA 1A9BB 4E0RA 3NTCL 4Z0XB 2WMIB 3PZ9A 3QCVL 3SUVA 1RZJL 2XI9A 4Z0BL 1X4YA 4FXGA 5DVOA 3CFDB 1KENL 4RNRB 2QADD 4Y5XA 3BVTA 5I1EH 1FNFA 5D1QB 1UWUA 5LBSH 4HZLB 4Y19B 5KVEH 1KT2A 1HKFA 4FQ2H 4KHTH 3BP7B 5EUKA 5I1HH 3BZDA 4AIEA 3BHBB 4D6FA 2BCKA 4MJ5B 3QZWB 1JPSL 3QDGB 3ALPA 4FP8H 2FEEI 2VXTL 3MYJB 2R0ZH 3U0WL 1XV8A 3QG6B 3QNZA 1JI1A 1NGXA 3VVGA 3JWDC 9CGTA 2FR4A 4EAMA 3WFBL 3VPLA 2AJUL 3Q1SH 4AEFA 2B4CC 2NY4B 3SDAA 4F66A 3CFJA 1XSIA 2EIZB 2NY1D 4YO0B 1I8KA 4KJPC 4CJ1A 4HOZA 3S34H 1J8HE 3FJTA 4X8JB 3ZDZF 2ITCA 3SDCD 1AY1L 4Z7UB 2EC9U 4IS6A 1YPZA 1HCVA 2K7QA 3TT3H 1GHSA 5E2JA 2W62A 1I1AC 2J8UA 3WHXB 1R8LA 2OZ4L 1KJ2B 1XGTA 2YRPA 3RDTD 4ENED 4K7FB 4M7LT 1WZLA 1OT1A 3QWRD 5IW6A 1Q9OA 3SKMA 4WO4C 3I02B 4JPVH 3WFEH 3G5YA 2DAVA 1XF3B 3H9ZA 4NC1E 3RPIB 3VCLA 3L7EA 4XH2A 4MNQA 4NT6A 1AI1L 3DX8A 4ACZB 4QY8A 3R06B 4YBHA 1UWIA 4JKPH 4GKSB 1T0MB 1JDDA 1E6SM 2O5XL 4JFOB 2YPVL 2YA2A 3WXWL 1OAZL 4WI8A 3QUXB 2CXGA 4K9EH 3MJ8B 3DPBA 1VBUA 3KXFB 1QPXA 2VRKA 4PSPA 3OXRB 5FYLL 1N82A 3P4NB 1TQTA 1OTTC 4F57L 4LSPL 1SHMA 2B7DT 1TQBB 4PTWA 3NTCH 3GMLA 4DWSA 3QCVH 5F9DC 3F58H 2Q7YA 4IM8A 4XP9L 1RZJH 2X89D 4GKNA 4ZOCA 4DVBB 4GAJL 1KGCE 2AQ2A 5ID1B 1LK2B 4LCWE 4APQB 1HDMB 1A6TB 5A2CA 3EAKA 3HUJF 1B0RB 4FTVE 1U3JA 2MSPA 2E6PA 1H15B 1XSKA 1S78C 4AM0A 1WZ1L 4X4YB 4PY7A 3SCWA 4FQJL 4FQHB 5F3HA 1G9ML 3JUZA 3RWDA 4G7VL 3C08L 4AD1A 4WVRA 1D5BA 3LY6A 4YHLL 5HHVH 4GW5B 4UAOB 1UD8A 3BUPA 3AIWA 3OB8A 3EOAB 1QFWH 1AQHA 1PSKH 1NGZB 5E6ID 3WD0A 4JFXA 3MRPB 2OZ4H 1EUTA 1GGCH 5DQJB 2WZHA 1RQ5A 3CFDA 4RNRA 3DV4B 2Y72A 2P5WA 3NCYP 5MENE 5JW4Q 2HN7A 2B20A 4RE3A 4AIOA 5K9QG 4MJ5A 1XYZA 2NZ9D 1EV2E 4LKCA 3TO2B 3VRJB 3QG6A 4TUKL 5J12C 3ZO0A 2PXYA 3VIMA 2UWFA 2O5XH 1MIEL 2D23A 4OOZA 5D7IE 4DN4L 3C2AL 4PJHF 5C09E 2KUTA 2OYKA 1OAZH 5JXEC 3CLFL 1LO2L 4YO0A 1BLNA 1MLCB 3QFJB 5IP4A 2XPGB 3IJYB 3SGKA 3O41B 3OJ2C 2OLHA 3T2OA 4ORZC 3V8CA 5FYLH 5IEHA 4OKVA 4F57H 3HZMA 4HAGA 3WHXA 4LSPH 5JHDB 2GVYA 1BQSA 4CD4A 1L9MA 1UXWA 3WUWA 2HRLA 2D4DA 1AC0A 1TNNA 4XP9H 3T1FB 1PQZB 1QNSA 3RNKA 4W7UA 3I02A 4GAJH 3EKCA 3CSGA 3RKDC 4LVOB 5F9WC 1MCRA 1T6VN 3C6LB 4ACZA 1K6AA 3UESA 1K3IA 3P4OB 3GRWA 2CEQA 4OD1H 4GKSA 3SDCA 4FLSA 1DWJM 2AK4B 3VFTA 3WEOA 2J77A 1HVQA 3LRGA 1UC6A 3DRTB 4KI5C 3MNZB 5GGTA 2CIIB 4X98A 2YEZA 3BUDA 4G7VH 3C08H 3QWRA 1T0NA 1WISA 2VH5L 3MZGB 4G5ZL 3BEVB 4MDJA 3D18B 1XC6A 2R29L 2VDRL 3P4NA 4D71A 2OWCA 4LPTA 4YX2H 1YNLL 1KC5L 1S7SB 4U1LA 3MUGB 1BREA 5CHNB 3ARFD 1W2PA 3W0WD 1OGAE 1H0IA 2W5FA 3FFCE 5D4YA 1A6TA 4LHUG 1ESWA 5JMOC 4PGZA 1N6QL 1NCNA 1D6EA 1DEEB 4BH8A 3T0EE 2OI9B 4TUKH 2VX7A 1AGCB 5K9OB 1FFNA 1H15A 4YHPB 1KB3A 1RK0B 1MIEH 2VXUH 4NPYA 4DN4H 2MKWA 1BFOB 3E8UL 2MNUA 3PNWB 1CPUA 1KWGA 3O11B 3CLFH 5ETUB 1WE5A 2GTWB 1LO2H 4PLOB 5BW7C 3JZ7A 1JDAA 5I16B 4PUEA 3D0LB 3AGVA 3W5MA 4PJ5B 7FABL 3KYKH 3CNKA 3VIFA 4PRHE 2J5LB 1RZIB 3FQNB 3WIFB 1Z6JT 3CX2A 3RM9A 2A1WL 5I8KL 4NGHL 4FNRA 3EO9L 3ZKND 1CIDA 4P48A 4PRBB 1DVFD 3LAFA 1FL3A 1MRFL 4WRLA 3MLUL 4WJ5A 3V6ZB 4OZHF 4Y1AD 5B3NA 2AXJA 4ODWB 2XTJE 3OJDB 4J3UA 4TTGA 5E6ZA 5EU7E 2IXVA 1Z9MA 2B1AH 2DT0A 3WJLC 3VGDA 5HVHB 2C8NA 1B0IA 3ULSB 2QPSA 4WHTA 1PZUB 3QPQC 2PW1A 3DROB 5E6IA 5HHNB 2XKSA 3FB6A 2XA3A 4DKFL 4HIEA 1R87A 5EO9B 3EOYG 2PW2A 3BVNB 5L7XL 2UZIL 1MEXL 4PJDF 2VJXA 1XF1A 3LB6D 2BSRA 4NRYB 5I71C 1Q6DA 1FFRA 3VI3E 2R29H 4PREB 3V4UH 2J47A 4JM2F 4XAKD 5K33A 3IJ7A 1U58B 1R3LB 2UWEA 3X14A 2IPUG 2MOVA 2P8PA 3MXVL 3HLAA 4P57B 1L0YA 3CCHB 3ES6A 1FN4A 4H5SA 3U83A 3ZJ7A 3P4OA 5A8PA 5D2NB 5J89A 1U8OB 3ZQ9A 1WBYA 4I48A 3OXSB 1HSAB 1R5VA 2CKNA 1M7DB 3X13B 5IJVA 3VJ6A 3C5JA 3MNZA 4BQ4A 3PG2A 3EYUH 2YSSA 1JNLL 1BJMA 1RK1B 3MMDA 4XZBA 4Y4KC 4YAQB 3OG2A 4U7KA 1U91A 2R2HB 4YDLB 2BERA 3LDBB 4FXKB 4OZIA 1U95A 5HVFB 1JWMA 5DHXB 2D1ZA 3MRFA 4N1HB 4Y88A 4Z8FL 3WD3A 4NQUA 4NXSA 1X4XA 4HUKB 2A1WH 4ZENA 3EO9H 3N1GC 1ISVA 3NCJL 1RP8A 1TVPA 3VXMB 2AXGA 1I9JH 2GJZB 3MLUH 4WV1B 1A3RL 4OAWB 4KZDL 2LAGB 3ROLB 1PX4A 1EEQA 3E3QE 5ABDE 4OCSL 1FAIH 1AGCA 4D1IA 5I1JL 3FZUD 3VDHA 4GAYB 1BTCA 4Z2HA 2OTPA 5L9DL 5I6XB 5EZIL 3AZSA 2C3VB 3GXFA 3L4UA 3PNWA 5FV1L 3VH8B 3QUMA 3J7HA 1MWAA 4HZAA 4X7CC 4DKFH 4NQTA 5F7FA 3ARFA 1KULA 4U05A 3QHNA 1YEIL 1I4FA 5I16A 2UZIH 2VC2L 2O9TA 1MCLA 3D0LA 2VXVL 1G7QB 2X05A 1CFVL 3WEZA 2D0HA 4N9OB 2YXMA 1GAFL 1RZIA 1WPCA 3BWAA 1Z9OA 1QSEE 2F5BH 1KV3A 1EFXB 3MXVH 1VJZA 4JREB 3WN6A 4LIQE 4PRBA 4QRTB 5KS9F 3G5ZA 4I18C 4PJEB 2QR0B 3PL6D 4LKXA 3H7BA 4QXTA 3ZM8A 4PJCB 5D70H 5CKGA 3CFCL 1UD4A 4G9FE 5FM5O 1KCVH 1NWRA 3ZYZA 2WVUA 1FE8L 3FCTB 4HXBL 5A8NA 3VD5A 1MCBA 4MX7B 3ABZA 4I3SH 1GHRA 5ALBL 4J3OC 4A6YL 4WEUD 2MJWA 5DJXB 5SWSE 3I6LD 2MKLC 1BGXL 5EO9A 1A47A 1JNLH 1GL4B 5DJ8B 3BVNA 5I17B 5L2KE 3WD4A 4XVSL 4Y4HC 4QP0A 1JFHA 1DVFA 1QLRA 3TVMC 4K94C 1W9PA 5D6DA 4FMFA 1WBZB 3FOMB 4Y1AA 5INDA 4HC1A 1TVBB 5IW1B 4Z8FH 1N6VA 2V9TA 4OZFH 4ZQKA 4CW1B 4JY4B 3CCHA 3PHAA 3QG7L 3HAEB 3NCJH 4HIXL 1LO4H 2XXMB 3LRSA 4OGXL 4YEEA 5GGUA 4I9WE 1V0KA 5M94B 3KYNB 2KBGA 1A3RH 3Q5TA 3SJVD 1A7QH 3EGSB 1U8OA 3U30C 1AE6L 3HE6B 5JIPA 3AS3A 5F6IB 4C56E 1R86A 3AY4A 4X6BB 4UIMB 3IDMB 4Z78A 4EVNB 1NGWB 5L9DH 3TLRA 4NFDA 3S88L 4X7TB 4TTUA 4JB9L 3G6AB 4EDWL 5DDHA 3MNWB 3UTPE 4FXKA 2VC2H 4LMQE 4WTZA 4KKAC 3C8KB 4LYQA 1CFVH 5TH2B 2A3HA 1NWUA 1F8TL 1GAFH 2E6JA 4FHBD 1I85A 3SUTA 2V3DA 1BWMA 3DARA 3P73B 3ALFA 1OGBA 1JV5B 2R4RL 1W1TA 1FZKB 5CJ8A 5HPCA 1E6JL 4MAYC 2V5TA 2IGTA 1GW1A 5F72S 4RFOH 1QPPA 5DQ9B 4CADB 1GZJA 5D7JD 4KKBC 4GLRH 3MREB 3UROR 1X5AA 1HHIB 5C92A 1U9KA 5EFIA 5TDNB 3TJEL 3ZLQC 3TONA 4GAYA 5ALCL 1FE8H 1G7MB 4HXBH 2AMGA 4A6YH 1J0HA 1JGIA 5I30L 2FECL 4JFPA 1BGXH 4QHLB 4RISL 3VIGA 4GAGL 3B6SB 4KQ4L 4KRPB 3KYMB 3MTRA