2CXGA

Cyclodextrin glycosyltransferase complexed to the inhibitor acarbose
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title X-ray structure of cyclodextrin glycosyltransferase complexed with acarbose. Implications for the catalytic mechanism of glycosidases.
pubmed doi rcsb
total genus 233
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cxgA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cxgA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2cxgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cxgA01
3QFDA 1XCQB 4AENB 1U8IB 3CUFA 4UB0L 5EIIA 2GUOB 2IANA 3NCJH 4G42B 4XMPH 5GRZA 5DRZB 3QHNA 5KTEL 4TSBL 3VW3H 2MQCA 3WH6A 2YPLB 5I1IL 4ELME 1I1YA 3F62A 2ZUXA 4QGYA 4EBQL 2NY5L 1JNNH 2DS4A 2CR6A 1XF1A 4HK0B 4L8BA 4MA3A 2FD6H 4P2OB 1I3RB 2C5DC 3BW9A 3MLVL 2OWWA 3SDXB 1BAFH 1UKPA 4TVUA 1RU9L 1T5WA 3BSGA 3P4OB 4XAKD 4UDUA 4NF7A 5I5RA 4ML4A 4ZD3L 1VFAA 2DQGH 4LIQE 4Z7VA 1NL0L 2OYPA 3FAXA 4KKAC 5IB2A 5DD3H 1OD8A 4XVJL 3THMH 1K3ZA 3O3AA 4LLUA 3DVIA 1GUVA 3NMEA 4MDJB 3RBSA 2EPNA 3WL1A 5HYJA 4JCMA 4U1LA 3ZDXE 3QOKA 1B0GB 1CDJA 5C3LD 5A6BA 3O4LA 5T3XL 2FHFA 4R3SA 3BRGC 3VCLA 1HH9B 3BKCH 4OKDA 5GNXA 3CK0H 4NUGL 5D7LE 4EN3B 1AP2B 1GOWA 1MQQA 4OCXL 1XIWB 3O11A 4DWSB 5C0BB 2D22A 1FNGA 3HZKB 1OM0A 4WHDA 1VIWA 4ALAH 4NQDA 1K6AA 2GVYA 3SBWA 4WIQA 4OB5L 2MQ3A 4ZFOL 3RY6A 4J27A 5GGUB 4JKPH 4P2YA 1ECEA 4HMCA 1N8ZB 2BRRH 5JPNB 3FOLB 2XZAH 3HMXH 2EPMX 4YHZL 1BFNA 5M5DA 2MHAB 4OV6F 2JELH 3W11D 1K2DB 4YX2L 2ADGA 3PGCA 43CAA 1NMCC 5CEXA 2J8UE 1EVUA 5SX4I 1EDGA 1L0QA 3PIQB 1CLZL 1F3JA 3TNMB 3EO1B 1JF1B 4IOIB 3W6LA 4P2QD 2DDQH 2LABA 2ALWA 3SHSA 3C5JB 3FCTB 4R0LC 4KAQL 3TO4B 3EJZC 2ESCA 4LLYB 1NDMB 4ODWB 3GGWA 3IDYC 1ORQB 5LBSH 3GMRA 4HIXH 3DX7A 4HZLB 1PLGH 3MGOB 4Z6AT 3GMMB 4KHTH 5KVGH 3P9MA 5LGHL 2CDGA 4JRWA 4S0TD 1YN7A 1IT9H 4PJEB 2E9WA 5HJ3B 1JZ6A 1AGCA 4UQ3A 5JXEA 3FB5A 2VMFA 3SCMC 5DD1H 3FMGL 4XBGB 1VFMA 5T33L 5KVEL 1IGJA 1Y18B 3HZYA 3TA3C 3KNBA 2VO5A 4BZ1H 4NQCE 2OYMA 1CGYA 2XTKA 4KVNL 4K23H 3V4UL 2DTML 5E2WH 4BYHA 3K1DA 1S9XB 2XSBA 1QPKA 3GSQB 1NCCL 3QXTA 5JORB 1LP9F 3WCYA 5JOPE 2WUCH 3MCG1 1WSST 2RCSH 1Y6NR 3BKJL 3MCLH 5F3HA 4R4NC 5D6CA 3ZTNL 1LDSA 2ZCKH 3WF0A 4G6JH 2W9EH 3MJ7A 4CKQA 3ZE1F 5IW1A 4UMGA 5DDHB 1BOGA 2E40A 4JO1L 1J0KA 3ZL4L 5D70H 3OJDB 3SKJL 1MCPH 1RURH 3C5ZA 3LDBB 4DVRH 5B4MD 5D7IB 3LRSB 3LV3B 2LVCA 4KPHH 4PJHB 4C7FA 5CPSA 3WS3A 3QIUB 4JM2C 4FNPA 1L7IH 2PCPA 3FRUB 3A5VA 4MNGE 4NN5C 1F4WL 5D7KD 5JHDE 3DX8A 2BNJA 4WKFA 2AJZB 3VX1A 4MJ2A 5GGTL 3RWDA 3FO1B 4G6FD 1YMHA 4X6FA 3HC0B 2PR4L 4N8VB 4UUJA 5FO8B 1QR1A 4X7SL 5ANMB 4WGWB 1E9LA 4NXKA 3ILQC 4QHUB 3LEYH 1NEZB 1S7TB 4U1KA 4N0YL 4QRTB 3BP4A 1GOKA 1X5XA 1PG7W 4Y1AD 1WFNA 3MRGB 4MMZC 4Y4FC 2P48B 2IANB 1U95B 1ZBVA 2J8OA 5DJ8A 1CDIA 3AI0A 2BV9A 3UYOD 4DM1A 1C12A 3NIGF 3TVMA 4Z77A 5L2KD 1V5JA 2PKDA 4GQQA 2QADC 4JRYD 3EOYG 4IRZL 4KJYB 1UHVA 1YEEH 1I75A 3QDGA 5EO1A 3BW9B 5I0ZA 4L8CA 1QFOA 4ODHH 1JZ8A 1MHPL 4HPYL 3MNWA 1QP1A 2NMSA 4NCC2 1BLNB 1T1XB 2NY2C 4PBGA 2GUYA 3NIFE 3GIZL 1VFAB 5K9JH 4NM4L 2BMKB 5EZIL 2ZX6A 4YZFF 3KLHD 4Z7VB 1R3LA 1HYRC 5I0DA 3V0WL 5IB2B 3PHAA 4LAQL 2DL9A 4Q6IA 2ED7A 1CL7H 5LXGL 5C9JB 1KIPB 4RMWA 4LLUB 2BC4A 4NC0B 3DHMA 1I9RL 1KXTA 3VA2C 2D03H 4FP8L 3O6FC 4WO4D 3V6ZB 4F7MB 3CZKA 1JXKA 4K8RH 4Q22A 1V0KA 3UR7A 3GHEH 4YGAB 5DC4B 4BQ3A 1HIZA 5E8DL 4IOSD 2VDQL 3G6JF 1LK2A 3RZWA 2IBZY 5DA4A 2Q1EA 5C0JA 1NUDA 4RIRB 3CAFA 3MLWL 1HHKB 1RVFH 3QDJE 3C9NA 2OTWA 1C16B 1F2QA 2ZOLA 4W8BA 1CQKA 4PD4K 4NQDB 1FFQA 5F3BA 4P46C 5J1AB 4KKBD 3IFLL 3BIKA 3PWLB 3HG2A 2E3ZA 3DIFA 5A2AA 5MENE 4P3CL 1R0AH 3MRBB 2JTDA 5AUMB 4P7RA 5DFTA 4C56E 2XM2A 1JTOA 3RILA 1QACA 1LMKA 4XC1H 4ZE4A 2N7AA 4HAGA 1OQOA 2EH8L 1G7HB 1OTSC 1WUNT 2CBJA 1T5XB 1SJHB 3PGCB 4OLXH 3SKUD 3P2TA 4JFDA 5CEXB 4ONHB 5DS8A 3EJQA 5FECA 1XT5A 1WAAA 3IDNA 3D18A 2J4WL 3VFRA 3ISWA 2CXKA 4PJIB 1RK1B 4JLRA 4NPYB 4JN2A 2CMRL 5C0IA 1GOFA 4J3SA 4XVUD 1JGEA 5EOCH 2VLJE 2XPGA 5E9AA 4U1HB 2H2PC 4ZDHB 1UA3A 1OAUL 3VWKA 3MBED 1G7JB 3CH8A 5AYUH 3IJHB 5IVXE 2ZUWA 4DW2L 3CZJA 4PUDA 3L1OH 4K3DL 3NZHH 1BQHB 2EEAA 3OR6B 3AXIA 4W5ZA 1GGIL 3MUY1 5BZDA 1NFDF 2AJVL 4YEFA 1NDGA 2ARJA 4KK9C 4WDIA 5EU5A 3HZYB 3BT2H 1EJOL 2FBOJ 1JPSL 3TWCH 3KPRA 4BFIA 3VNZA 1D5MA 3FT4A 1N6UA 3LXAA 3WNMA 5B8CA 1C8QA 2APTA 4X6DA 3VX0A 2M26A 2X4OB 4PJ7E 5FK9A 4OLWH 1YNTA 4LPXA 1ZLVK 2NXZC 1KELH 4PJBF 4OIAA 4WRLA 3O45A 3MLZL 4FQJL 4X9FA 4HOXA 2F8VA 4HLJA 3QNXA 4AT6B 1FO0A 4H88H 1V08A 1UD6A 1EFQA 4D0DB 4IRJA 4RFOL 4YHLH 4PGJA 3RWJA 1M6OB 3QWRA 3KPSB 5CWSA 4IRSA 1N64L 4FS0A 3MRNA 3WS3B 4JAWA 4FQCL 2JK5B 2AXGA 4JRXD 4I13B 1XV8A 4LARL 4F33B 1N0XL 1M05B 1BZ9A 2WP3O 5DMGD 1YEJL 1UCBL 5MEOA 1FFOA 1VEMA 2YA2A 4CDHA 1Q1JL 4D9LL 5E03A 3VH8G 5DFAA 2Z35A 5ADPL 1H0IA 4ISVA 1CFTB 1XGTA 4GMTH 1I1AA 5CZXD 3CDGA 5KSUB 4RGOH 2CQVA 5DXWA 5DJ8B 5EU3A 1KJ3H 2FGLA 2VC2H 2ADJA 4LP4A 1K6QH 4GS7C 3TVMB 5CIPB 5L8LB 4RFNC 4GUPA 4PGEB 3SJVA 1UJTA 3FQRA 1RZJL 1WBYB 2OI9B 4BQ5A 3V6OA 3CMJA 2X4NB 1WWWX 3GNMH 3GBNH 4NGHH 1KEMH 4OM1L 5FYKU 3LQZB 3EAKA 3KPMA 1ZT7A 3UTQB 4F58H 3VFUA 4P3DB 4ZXOA 1ZHBA 2GAZA 5FKAB 4XMLL 3HI6H 3B2UC 5J0BA 4NJ9L 1NGYB 4QTIL 4Y16C 4H41A 1EDTA 4M7LT 2W59A 4W81A 5JXAH 3B9KD 4XX1G 4P23C 2VABA 4UQEA 1FZOA 1JG9A 3T1FA 1KXTB 3UTPE 2WZHA 3NIDF 1PBGA 4D6JA 4ETQA 2VAJA 1B3XA 1V7NL 4XVTL 2WSPA 1IARB 4DEPB 3W39B 4JZNA 3VI3E 5C2BL 5E99L 3L3GB 4PMNA 2BVPB 1QLEH 2V5SA 2VLRE 2B31A 5C0JB 3RVTC 1YYMH 3AXXA 3OLIA 4NNXA 1AXIB 1NAMB 5DUMH 3MZTA 3VVGA 1CBVH 3SO3B 4AYGA 1WITA 2ZOLB 2GY7B 4NFBA 1S9KC 4PJAF 2YBTA 3KLDA 3MRMB 3QHTC 4OCRL 2E0PA 2QPSA 5DJZA 5LJYH 5JQ6H 3OKKB 4PG2A 2EPLX 5F9OH 4WKAA 1OARH 3BIKB 1VBUA 5BVJB 4PEEA 4MCZB 1I8KA 3ULSA 4K94C 1A64A 4WNQA 1CVRA 4K3EH 2ITDA 1UM5L 3S88L 4ACZA 3D9AH 5K59E 3GXPA 1K9FA 5EUOF 1D5XA 1MRFL 1CFNB 1XSIA 1B0WA 1PSKH 3UPRA 3S7GA 3VI4E 1BLIA 5K9OA 2EXWC 2Q8BH 2EAEA 1ITXA 1QNSA 1G9MC 5FECB 3DYPA 5DD5H 4EXKA 3A6OA 3D18B 2CERA 1A0QL 1EEQA 1R3KA 4PJFA 1YPZE 5CIPH 3N1PC 2P5EE 5EA0L 3B83A 3VXSE 1EEYB 5KVDH 1EEZB 4MS8C 4YBQD 5GXBB 2FGZA 3OTTA 5C0IB 1AJ7H 3VILA 2ZXBA 5H8DA 4GAJH 1UADC 4TSAH 5TD4A 2XIIA 1DWFM 3HHRB 3DJ9A 1BGGA 3IRPX 2CYGA 1GC1H 4O00A 1OD0A 4GPNA 2R0WH 2PO6A 4GAGL 3WFDL 3VGAC 3KS0H 5E6IA 1PKQE 3F5WA 3MRLA 5BZDB 1TVPA 3MNVA 1NDGB 1P6AB 4WDIB 1FJ1B 1N59A 4JY4A 4MJID 1UZ1A 3DWTA 2E27H 4XP6L 3WLBB 2IUZA 4ZPVA 3WBAA 3H9SE 2R4SH 5BS0A 1A6UL 4TUFA 3CZSA 3GFUA 4HIIB 4KK8C 4M48H 4PJ9C 1G7PA 2BSSA 2V17H 5I19L 3FB8B 3C6LA 2D7OA 4X6DB 1PPIA 5FYKH 2CBIA 5FIEA 4NBYB 3WSQH 5I1DB 2VCBA 5FK9B 1YNTB 4ERSL 4E0RB 4GXVL 5EORL 4OGZA 1UR8A 3BUBA 1NBVH 4G9FB 4FFYH 3MRQA 3M1BB 3JZ7A 3DMMC 4M1CC 2FRGP 1WV7T 1BQLH 3KDMA 3QNXB 5KANI 1NAMH 1FO0B 1VPOH 3S3PA 4QYOB 2YDSA 5KANG 1JRHL 2CR3A 3GBMH 4JDTH 3RDTA 3LPWA 4OF0A 1YN6A 1KIUA 2NW2A 4M5YL 4JG1L 3MZGB 3NZ8B 4IRSB 3WDJA 3MRJB 1QLFA 4LKXB 2YPKB 2E9BA 1BJ1J 3DSFH 4AG4H 4NRXB 3IF1A 3SDDB 3O0RH 2F8OA 2OQJA 5C07B 3ZR5A 1NCWH 3STZA 4M00A 4FNUA 4M7KH 4F37K 2OTPA 5IESL 5KSVA 1AI1L 2DQIL 5GGQH 3RIKA 3PE9A 4UINL 1P7HL 1NC4A 1SEQH 1DQJA 2CLRB 1FFOB 5IG7A 3AIWA 1IC1A 5C08D 3L6FB 3EJUA 4ZUTA 1T2JA 4HHAA 4NKOA 3FT2B 4ISVB 4QXUH 4I3SL 3BH9A 2ZUUA 1TR1A 4E8CA 1JGLL 2J8UA 3W5NA 5A94A 2X4RB 2VQUA 3BSZL 3MACL 4M02A 4WWKD 5IROA 3V8OA 3HFMH 1TJIL 4ZUWB 4M24A 3KLKA 2Q6WB 4QRRA 1AQMA 4FZ8L 1XF3B 5LG1A 5IT2H 4LCCB 3LIZH 4OQ1A 4FMKA 5L2JA 3GSWB 5SX5K 2BK8A 1R8LA 4LCYA 1ZT1A 2F8XC 2ZUNA 1UM6L 2DAVA 3U46A 3KPMB 3TZVD 4YHOL 3RHWK 1T0PB 4NXSA 1A3LL 2J6EA 1ZHBB 3HZMA 3GYCA 1OTTD 5DFVD 3RAJL 1GH7A 2BY0A 1MLBB 2WINA 4M56A 1KCKA 2R1XA 4WTZG 2Y06H 4AL8L 4BQ8A 3BWUC 3T3MF 3NH7L 4S1SL 5GS0L 3S96A 1FZOB 1R5VA 4NQCA 5AWNL 4FQXA 1JZ5A 1IM9A 3T0BA 4ETQB 2X4TA 5TGBA 1FO0H 5CSYA 2VLMD 4UQDA 2ZUVA 4B53A 1ZSDB 2GQHA 4G43A 2HN7A 5I1LB 2VXTH 3KL3A 3A6BH 3MMUA 2OL3L 2VZUA 1X6NA 2EDHA 5D96B 2BOBA 1DBKL 4PTVA 3K80A 4AD3A 4KJWD 4YFLI 1SY6H 3SCNA 4XHJD 1F58H 3CZGA 2NX5D 2NY0D 3ULSB 1J8HD 4XXCC 5CJXA 5HVGB 4MA1C 4MNGA 5JHDA 2ITDB 3N9GL 4ACZB 3WDRA 4RGNC 3UBXG 3JTSA 5HHPA 4LLWB 1OSEA 5FB8B 4RQQB 1W0VA 4Q7DA 3BVWA 4JDZB 1MIMH 4OZHF 4HAFA 2QR0A 2DSZA 3BHBA 4DFIA 4U1SB 1VDGA 3HE7D 2V5RA 3BP6A 1FQ9C 5CJ8A 1R3KB 1FN4B 3WIIH 4PJFB 5IW6A 3G04A 3G5ZB 5D1XC 5FHAL 32C2A 3GB7B 3A23A 3RWFA 1DUZA 5AYIA 1TZGL 2ICES 5D7SH 1KENL 1OAKH 3L3DA 5TFSH 2VCAA 1PG7H 8FABB 5HYEA 5I1EL 2J77A 5C3TA 4ELMB 5DJ2A 4PB9H 4LYQA 2EZ0D 4XB3A 3W2DL 2BNUB 3U4BH 4D6EA 3O9WC 2PO6B 1GGBL 4FQHB 1MAML 1ADQA 3EJJX 5C09E 3QUYC 4KDWA 3T77A 3ECBA 3F5WB 1YEFL 1BQSA 5IWLA 2GJZB 4OCLC 2F54D 1P4IL 4JEGB 4JY4B 1WTGT 4Y5VC 3ARGA 3WUWB 2ZSWA 2O5YL 3HNVH 5J11B 2DQJL 4WI2A 5BMFL 1IL1B 3EMCA 1QSEA 1A9BA 3WEXB 4EI5B 2X9YA 1FPTH 3OAZK 4ZTOL 4PJXA 4ZS7L 3OL2A 1NLDL 1ONQA 1DLFL 2EEDA 5L8KB 2BHYA 2QQNL 4P8UA 2XICA 1ES0A 2YMXH 2AJSL 4IOFC 4ORGA 1MXGA 3K4ZA 4L8DB 1FV1B 4CVZB 3FQNB 3P73A 4RX4A 4X7CC 1AXTH 1HH6A 3AREB 3LEVL 1E5NA 1A4JB 3KZSA 1IGCH 3NACH 2YWZA 2VDRL 1GRWA 4OSUH 1D9KA 2FSEA 1EZVX 5D7LB 4MPKA 3DXAD 3W81A 1IRAY 2NW2B 3CBWA 5I79A 3RWHA 4RDQG 3ARBA 5DO8A 3WD5L 1QLFB 4PJ8C 4YHMH 4P9HH 1QKZL 1WDRA 2ZG3A 3ARWA 4OCNC 1SYSB 1RK0A 2HJFA 3LRMA 1E6OH 4JFYA 5F1NB 1RUML 3MREB 2D4FA 2X9XA 5I2UA 5DTFB 5FUOH 2NQCA 3OAUL 5MENA 2DL2A 5FAAA 4RWYL 2FX8H 4C56A 3SPVA 5JBFA 4X8JB 3ZTJH 2EDKA 2V2WB 4OCMC 1BG4A 1BVKB 5HHXL 4K07A 1PYWA 4HPHA 1KG0A 1FNEA 2NY4C 1QQDB 4GQ9L 4NWUL 1QO3A 3LQAC 5FCUH 5D7JB 1ZGLP 4M6NH 1DQLL 1E70M 1MUJA 5KN5A 3KPQB 4M1RA 5F21B 5IMKB 3CMGA 3AS3A 5E09A 5EOQH 3ZKQD 3P4NB 5IF0A 4DGYL 3WD3A 3PZUA 1B4RA 2Y6SD 5L2JB 1KLUB 2WW5A 4TVPE 3H42L 4LCYB 4PS4L 1LO2H 3L5XL 3GJFB 4ORZC 3KPPB 3W53A 1Q9LB 3N85H 3HRZB 5IVXA 2AJ3B 2DLFH 3GNRA 2QHAA 1M7DA 5DK3A 3LKNB 3EBAA 5EFDA 1RZKL 3OXRA 2CKBL 4F9JA 2R1XB 1MEXL 5KZCD 4CVUA 4PRPD 1A6ZA 4JZJA 3BE1L 3F7QA 3NVQA 4XMKH 3X11A 3IVKA 1R5VB 2G9HB 3TT1L 4A6YA 4FQ2L 5T1KA 5HVHB 4L8SA 1DSFH 4LHJB 2X4TB 5ISZE 4JO4L 5JW5B 1IMHC 2H26A 2WCGA 1FIGL 4PJ7A 4URTB 4WY7H 4LOUD 1U8MB 1T20A 1IEBA 2AERT 4B7IA 4GBXA 4R2GB 1S3KH 3RTQA 4LCIH 3MOQA 1KJMB 2VDPH 2IQ9L 5IGXL 4ACPA 3P0VL 5E08L 4MX7A 5I66A 3PP4L 1S7XB 4LVHC 4TQEL 3C8KA 1INQB 4HWZA 2R69H 1G7IA 2Q86A 3O6LH 4C54A 1PZ5A 4U6XA 2NW0A 5I16A 2B4CL 2J7CA 4L3EE 3B2VL 4PRHE 3MV7D 4LEOB 4L3CA 2P5WD 3A0OA 2VISA 3FXYA 4G5ZH 4IMKA 4GI9A 5FEBA 1T3FA 3VXME 2JALA 4M1DH 4I3RH 3MV11 5EUKB 4OLYL 2DQCL 4LBEA 4MD5B 3HUJA 2OK0H 4FMVA 2P42B 4LQFH 4NOBA 3SOBL 1A4KB 4LRNH 2GTWA 4Y89A 1AR2A 5IKCA 2XVPA 5JLZB 32C2B 4Q0XL 4KQ4L 4NCDA 5BW7C 1DUZB 4XWOD 3L3DB 2Z91B 3ZMRA 1V6UA 1LP9E 3AROA 3DUSB 1KTDA 2XI9A 5C70A 3T4AA 4K68A 3QPQD 2HFFA 3LD8C 3EYSL 1U8JA 3GJFH 3T0EC 1T6WA 5KSAD 3ZE1E 5EFFA 2XACC 3C08L 3T77B 2HT2D 3ECBB 2QL1A 3OGCB 4H1LA 2D3VA 1H49A 4QXGL 1AGFB 4TUOA 4IISA 4LSUL 3ARGB 5I77A 1OAXH 2AEPL 2VQ1A 5FF6A 5JBEA 5DK2B 4UB0H 2XY1A 2IH3A 5EO9A 4XCYB 1BFTA 1J1OL 1UEYA 1UC6A 1AO7A 2X7LA 5I15L 2WWDA 1EVTC 1OAQH 2I60L 2X4SA 4RAHA 3L3OA 2H9GA 4OCYL 2A9MH 1EO5A 1OTUC 2PWHA 5I17B 3P73B 1HH6B 2VWEC 3MLVH 2FGWH 4UTAL 2QQLH 2GJ6E 1QI2A 2DMBA 1WT5A 2NW3A 2NPLX 3CZ8A 2X6MA 3WE6A 2FSEB 1X44A 3BP7A 1FVCB 4Y8DC 2IGTA 5BJTA 4G6KL 3QDJB 3ARBB 3NIGE 1E0OB 4N9GA 4ZD3H 5K9KB 3LPGA 4KQ3L 2CO6B 1OB0A 2YD8A 3TPUA 1MIEH 4F8QA 5F9JB 2PWFA 1GORA 1KCUH 1XZ0B 3KPNA 5MENB 2CIKA 4HV8A 1I7UB 1QBLL 3BN9D 3SPVB 1S78D 3TH4T 3UJIH 1I7ZA 1AR1D 3KHOA 3U30C 5T3XH 1PYWB 4YHPA 5B3JF 2XN0A 1R46A 5D5MB 4AEIL 4HA4A 4O51B 1T0MA 1IZJA 2WUBH 3K0WA 5F7HA 5I8OH 4S1RH 4KVCL 4X0KA 4LGPB 1VJZA 1ZS8B 4IRJD 4U3CA 3DRQB 1YPZA 4JHOA 2P5EA 2VVNA 4C4KT 2W60A 1H5VA 1OGAD 2D9QB 3MV8D 1KCSL 5HGAB 4PMDA 3SKMB 4MSWA 2B1HL 2BNRB 3MOBH 4OTXL 2V5MA 2VLJB 3G6JE 1HHHA 3VSVA 2UZIH 5HI5D 1W1YA 3ZJ6A 1K4CA 2Q76A 2K1MA 3HC3L 3EFFB 5CUSL 2O61B 4AM0A 3QO1B 1JMXA 3BUYA 1CLZH 4RCAA 4YDVB 5DD0L 3V9FA 2UVEA 1IFHH 1R75A 5CFHA 5KW9L 4KAQH 1I1AD 2FJHB 4K71C 4OZFG 4R0LA 1MCLA 3WF3A 2OR9L 4WTXA 4ZEPA 1CXKA 2UY5A 2VXUL 1JNJA 2XVNA 3STLA 4UFKA 1HK6A 3J7HA 4KTYA 4OAWA 2J25A 4X6CE 3UG5A 4PJ7B 1DVFD 5D2NC 3ES6A 3SCQA 1T83A 1K5NA 2AV7B 3MJ9H 4P2RE 5DD6A 4XP1H 2Y23A 1ITBB 2CK2A 3A4AA 2R8SH 1D6VH 4I77L 4MAZA 2RFXA 1NGZB 4UT6H 1GOOA 2OZ4L 3SCMA 1V0LA 3QUZB 4Y2DB 1CFVL 1E40A 4KRTA 5FGRA 4CAGA 3TBSB 2ZXQA 4M8UA 5JZ7D 5B39G 3UTTE 3C8KB 3HC4H 2WBJD 1MVUA 3GSNL 4JIEA 1DWJM 1KSRA 1G7IB 3QJHB 2R0LH 3TA3A 1HOCA 4U6XB 1A6AA 2NYYC 2WQ8A 2V6HA 3CLEL 4TNWF 3OJ2C 2KZWA 3VDAA 2W5FA 2YD3A 4LSSL 3HAEA 4KROB 3LSOA 5ABFB 3V4UH 3VXPB 3AS2A 5F7EH 1T3FB 2RAMA 5H2BB 4MLIA 1G9NH 1VFBB 1GIGH 2FX9L 3UYRH 4Z2HA 1NFDE 1E4WL 3DI3B 3DVGA 3O3DA 3RVWC 1M04A 2EDTA 5E2UH 5I1CH 3D2UB 5HD8D 1R3HB 3ME0A 3MRIA 1S7VA 4FQIL 4MXQC 1I9IH 3SKJH 3NTCL 1TJHH 4FTVE 4FXLA 3ARFD 2DBJA 4AIXA 5IBUB 5FL1A 2DQFB 4UIMA 4JM2A 4PJBE 3KYOB 3OV6A 5BXSA 3DDGA 4RGNE 4H8WH 3FW6A 4QRPD 5FUZH 1KUMA 4LCUA 3QSKB 5GGTH 4AK1A 3QUXD 4JAMA 1W91A 2H3NB 4HX1A 3JUGA 4CVXA 1VA9A 3KWWB 3QQ9D 5IEHA 1OINA 4NZDA 4ZFFB 3MRFB 3B8YA 3TM6A 4KU1A 2P7TB 3FONB 4N0FA 4ZOEA 3RL2B 1I85C 3QZWA 1IBGL 4JKKA 3QOMA 3ROOA 4X98B 1LO3L 1Q4NX 4NQSA 4XX1E 2HMIC 1OT1A 1CQYA 3CUIA 3EDKA 5A40E 1MJJB 2X4SB 1YECH 5E2TL 5HDQL 3ULUE 4MADA 3S8WA 4L4TD 5SWZA 3CXDL 1RY7B 4XVSH 1GQKA 4JFQB 4ZS6D 1H9VA 3E3QE 4W4NA 1KWKA 3SY0A 4M5ZH 3FN3A 3CPLA 5JPMA 1Q6EA 2WVTA 3MUHL 1C8PA 1UACL 5E6ZA 2NW3B 1MHPH 1RUKL 1JYNA 4HPYH 2VLRB 3BDXA 3G5YB 3WE6B 1A6WH 2HJLA 3NA9L 5BJTB 4N9GB 1T04B 4AJ0A 4YHIB 5EZIH 3DX9B 4JGMA 1OIFA 4N90D 4R27A 3GSRA 1RIUL 1AKJA 5JNYA 2C4XA 3VXTA 4J28A 3QUMB 5K33A 4PCSA 5C0CE 3TTQA 4AZHA 4GRWF 1J10A 1W72B 3EFDH 3GI8L 3VMNA 4JZ5A 1J18A 3WD2A 3SIMA 2CUIA 3UZVB 1HVQA 1KJVA 1NMAH 4RAUB 1C90A 3D3VB 3GJEA 5HTSA 4L1DA 2DM2A 2DT1A 4OF5A 2JIEA 1HI6B 1S7QA 3OXSA 2PBOA 1HWHB 5KJRL 1HJQA 2IH1A 5IHRA 2NXYD 1RZFL 3WKML 1NBZA 1WBZB 4GW4A 4N8CH 2GSGA 3MLWH 3IAQA 4X0KB 1FRGH 3U82B 1UD2A 4NQXA 5FXCH 4P5TD 1BX2A 2F58L 2VITA 3NIDE 4JG0L 1YPZB 2EADA 4H5SA 2P5EB 3ZKMC 5A3HA 3VXSB 1UR1A 7CGTA 4Z95H 1FL5B 4P46A 2QQQA 3IFLH 1YEKL 3QUKB 1MW2A 4PR5A 1AHWC 1O7VA 3FOMA 1CG9B 4LMQE 1XGPA 2H45A 4NIKB 4DOHE 5HGDB 2CKNA 1IKFL 2YFNA 3N1GC 4G8FB 3GKWL 1MLCA 4RA0C 1Z3GH 2EH8H 3ARDC 3WFHB 1CNVA 4CVWA 2Q76B 3BZEA 4B7LA 3W27A 2EDNA 4X80L 1V6XA 4PJAE 3W11C 1NLBH 1NMCB 2JCCB 4D9QE 4XUYA 4N42A 1PKQB 2H2SD 3HMWH 4M43L 4OD3H 2XV6B 3ALPA 3IJYB 1BZQK 1H3PL 4D3CH 2DLIA 3H9SB 5EO0B 4HW6A 3CC1A 4PB0L 2A1WL 4WV1C 2EDDA 4YWGH 4PTWA 4J3VA 1R24B 4PJ5E 2CMRH 3CLWA 4X0VA 3STLB 3NPZB 1WLHA 3DX6B 3IDYB 5A2CA 2XWBA 3L7FB 5D1ZC 1DWHM 1JPTH 5DI8A 3ES6B 5TPWL 3B4NA 3HI5H 2DKSA 3MJ8A 3NOIA 4Y5YA 5DLMH 2QSCH 1NANH 2OM5A 5I30L 5AZ2H 4K3DH 3W28A 1TTGA 3PHSA 3SCMB 4K3JL 1KB5A 4FFVD 5JO5A 4FQPA 1TZHB 5E7FA 3F5KA 3P4LA 4WI8A 5MEPA 3QUMH 3SKOA 5FIPA 3F58H 3TA3B 3W6MA 1QSFE 1A6AB 1W72H 1JWMB 4I18C 5ILTL 3RZCD 3IJ7A 2B39A 2G75B 4UNUA 5DR5H 5C0AD 5H94A 3VFWB 2ILLA 4I5BB 1MJ8L 1A7NL 3MODL 4NX0A 4CW1A 4N5ED 1JWUB 2N56A 4P99A 4GKSA 1B3WA 4Y19E 3LMJH 1CICA 3QDMB 2BVQB 4FQJH 1EZVY 2ZOKA 4A2MA 1SEBB 2JE8A 3EO9H 1E28A 1HSAA 3EYFA 1YEGL 4NKMB 4NZTL 5FA3A 4XCFL 1S7VB 4N1CA 5IBLD 2PYED 1K9EA 1PZ3A 1YY8A 4HLZH 1UZ4A 1G0CA 3C5SA 2FEEI 5I3DA 3LMYA 1UWSA 4F80A 2VDOL 4U05A 1B6UA 2HRPL 3VO0A 5FM4A 4PY7A 2YD9A 3BJLA 3D0LA 4Z5RA 1I8MA 2A6DA 3I3EA 3GSVB 3ZT5A 3B43A 2Y25A 4EDXB 1JV5B 5E0FA 2PXYB 5HGHB 4HOWA 1Q1JH 4Y4KB 2E6JA 3ARTA 1ZA3A 3HCVB 4M6ML 4UT7H 5ADPH 3HG1D 2P1YA 5ETUB 3MRKA 2WAGA 4H20L 3ILPA 1N5YL 4R96A 1YZZA 4AISA 4Z7WF 5IDIA 1NFKA 4Y4FB 5C6TL 5I73C 4N9OB 1W3JA 1M4KA 1BHGA 1JNEA 3H9HA 3TGXA 2QADB 3IAGC 3GBLA 5FOBA 1KPVA 3OJMB 3OLGA 5IMLA 2XNAA 4NYLA 3T0EE 5ISZA 4ZAKD 4TXEA 4YR6B 3HNTH 4LPUA 4RNRA 3IU3A 3QR2A 3VFOB 3LZFL 5M03A 4IHOA 2IQAA 4QF1A 1QBML 4WVRA 1QI3A 3DRTA 3E8UL 5L6YL 3QQ3A 2V38A 2CPUA 1PJ9A 4QRUA 1J7VR 4JPWH 3GSRB 4UV7L 3SGKC 1KIRB 1DFBH 4QTIH 3KLHC 4Y16A 5E00B 4UV4L 3C2AL 3BEVB 4P23A 4L3EA 1W2VA 3O6FB 2I9TB 5AZEH 2J7LA 1PX8A 4WW2A 2G3MA 3K2UL 1KJVB 4O2EA 1RUAH 1HHIA 4WO4C 4N1HB 5INDB 2ICWA 3IFNL 1QRNE 2VWEE 5E8EA 4MYWB 4R4BB 4ZUVA 3TYGH 2IH1B 1HIML 2M1KA 1FHGA 3EYVA 3BFOA 4PGBA 2D7MA 1NBZB 3IFPB 4WTWA 3T3ME 3MOAL 1EXUA 2X4QB 3RWEB 4IDLA 4LF3B 3TBTA 2F53E 3K2MC 2VITB 1L9MA 4WI5A 1D9KD 2VLKE 3RGVB 5EBMA 3MFFB 2FH8A 4AWEA 1S7SA 2W63A 4KKBC 4APQD 2IFGA 1LP9A 5B22A 1XGPB 3S88H 1OCWL 2XN9A 1OGSA 4OFPA 1C5CL 1BP3B 4XXDA 5I1KL 2AJYH 4LSQH 3IJSB 3BZEB 1KXQE 1I1WA 5HPMB 1NKRA 5C09B 5DQJA 2J3SA 4UIKH 3L3KB 5IFTA 5DMJB 4QCFA 3LPFA 4OV5B 2DQDL 3HPJB 3D48R 3TJHD 3CSYA 3VFTB 4WF7A 3WDHA 3EYQD 4K9EL 5EA0H 5I1AA 3FQUB 4N0RA 4LVOC 5KSBF 2GFBA 1RPQA 2YLAA 2YRLA 2XN1A 1MFAL 1B4JL 2ENSA 1E6ZA 1LO5A 1WEJL 4HJJH 2XSAA 2J74A 4P8VA 5DI8B 3I3BA 2C9AA 5EOCJ 4EE9A 1CL7I 4OZHE 5B38G 3BVNB 2ZE0A 3VIMA 1X5AA 4D1IA 3D4ZA 5JA9A 4DO5A 3CC5A 2F2HA 5J1SC 1X5FA 2Z4QB 4ODSL 3S35X 5E94B 5IIEA 3H6JA 5JO5B 2F1BA 3WENA 2C1OB 1MI5E 5MEPB 4D9RE 1MJUH 4IDJL 4PRAA 3TNNA 4HA1A 1FYTD 1A6UH 3JWDC 1BZ7A 3BAEH 4ONFL 1QLRB 4KRPD 3O2DL 4HS8L 3H8NA 4PRIE 3VM5A 3L4VA 3EJTA 5IW3A 4JPVH 3A67L 5EORH 1IAOB 2NXZB 3QG6A 2V9TA 5HHVH 4HC1L 3DMMA 1HWWA 4CGTA 1PW3A 4XCCH 1E28B 2WBKA 2YSSB 4S10A 3IETA 3RTQD 1WB0A 3MO1B 1I3VA 2ARWA 2OS7A 1BVZA 1BWWA 4DZ8B 4TUJB 3WFEL 3SUVA 2UY3A 5E4EC 1U2HA 4S1DD 4DKEL 2VXQL 1RUQH 1PD6A 4WCYH 4Z5RB 1QFWM 1EQCA 4I0PB 4UINH 4HZAA 1RJYA 4X7TA 3G6JA 1J88A 4LFHD 2YPLD 2BJML 3HU7A 5J8OA 4M7LL 5DMGC 1YMMD 3W0WE 4KUCD 4XP9L 1KN4H 1HHJA 1MPAL 5ENWA 3BP5B 1LNUB 4XZBA 4G7YL 1IE5A 2D73A 1RUPL 3CFCL 4P2OD 5T5FH 3D1MC 4BQ9A 4C83B 4CD7A 4FNRA 5F96H 2GITB 3FQWA 5CZXC 4JPKL 2QV4A 1FFPB 4GS7B 4U33A 3H9HB 2NT1A 2QLYA 5LA1A 4KZDL 4FZ8H 5FOBB 1G5AA 3CVHL 1UWRA 4DK6A 1ZU8A 1TZIA 3V7AG 5L9DH 5A6AA 1BGAA 1H3XA 2E6PA 4CU7A 4G3YL 4EDWH 3ORJA 4RNRB 5F89A 2NTFB 3B6SB 1CLOH 4L4VE 4F9LC 3QIBD 5ELIA 2NLJB 5ICYA 5IV2A 1R5WA 2VSDA 3S2CA 4KMQA 3RAJH 1JVKA 4L29A 2DQHL 4QRUB 1UWEL 4UT9L 2ED9A 1MCOL 1ZGLA 4M6AA 4MXVF 4AL8H 5CSZA 3S4SA 2GCYB 4EN3D 3SDAB 1XD1A 4DWSD 1XIWD 3Q6FB 5C0BD 1GHSA 1JK8A 1ODZA 4FLSA 1ZBKA 1A9EA 4L3EB 2MJWA 4HS6B 1XF5B 3B9KC 1FFRA 4PRHB 2G5BB 2O5XH 3A6CL 3DGCR 2HISA 1A1MB 2DD8H 2DYPA 4D0BB 5A16A 1TCRA 3VXMB 2ICWB 2KUTA 5EU7E 4X0NA 1AGDA 3TIEA 4BK4A 5IB3B 1IAKA 2UV3A 3KE0A 5ESVA 1I7TB 3MJGX 5JMRA 3QHFL 3L3HA 3NCYS 3DHUA 1NFDA 4PGBB 3VGFA 3AU1A 4U1JA 4W70A 4XAWH 2XWTA 4P8WA 1TNNA 5F1OB 4XAKE 1A2YA 1HJVA 3VH8A 2F74B 5SX4H 3TOPA 1DBKH 3GZKA 4PCTA 1MRCH 4FTVA 4IUGA 4LLVB 5MERB 1QVOA 1TVNA 4W87A 1S7SB 1WVZA 1LP9B 1T1ZB 4PJBA 3OG6B 2F18A 4A3HA 2COQA 2GEEA 5FV2A 5E9DE 4UNIA 4YXLL 3U7WH 5LWYL 2FO4A 5DZLA 3L5JA 3M45A 5CBEB 2QSVA 3OB0K 1W8OA 5JUVA 1TVHA 1N7ML 1HINL 3W4RA 1DN0A 4P57A 2J5LC 3MLRH 3P30L 4HXAH 5IJVA 3Q5TA 4ZTPL 5IVOA 3DROB 3CSYB 1V7MH 4DAGL 1RHFA 5I1AB 1EJ6A 4OUEA 2XJ7A 3EZJB 5F71A 4Y0GA 5TF0A 1TZGH 4AQOA 4YBQC 4HFUL 5T1LA 2AKRA 5HY9B 1LO5B 2WZEA 2CRIA 1NWRA 1ZA6A 3P11L 1TVBA 5DSCA 3O9WA 5F7MC 2Q87A 4AXNA 4NRZB 2P8MA 1MAMH 5F8QC 4E41A 2R9HD 3QUYA 3OKMA 4M1GL 3DTXA 5IIEB 2GJ6B 4HCRH 2ICEB 2HFTA 1LE5B 1OM3L 3KS0J 1LD9B 3CFJA 5DEFB 4FNSA 5DJ0B 3IDIA 3LKPA 4K8RD 1HNFA 4YDLB 4X4XA 3TNNB 4Y5VA 4TSCL 1CDBA 2OBGA 2R2EA 2J7BA 1N2RA 2O5YH 5ERWA 2B5IC 4AMKL 2DQJH 1DDHA 5BMFH 5BO1H 1NEUA 1JGVL 2YA0A 4PJ9B 1PGRB 2W65B 3UTSB 4OCSH 5F9WB 3PZMA 1IQDB 4LLDA 3VXNB 2F5AH 12E8L 4ZS7H 3QIUD 3M17B 3VXQB 1NLDH 4D6FA 2CK0L 4UCFA 4NN6C 4ZXBA 4HH9B 3DMMB 2AJSH 1AE6L 1DQQB 4G8EA 2LTQB 2DQXA 1VEOA 5A2LH 3WQ8A 2HT4D 3PJSA 3HNSH 3FO9A 3D85A 4HF5L 4Z7UE 5DO2D 1KFAL 5A43C 5JDSB 4AMCA 3NJ3A 1U8KB 3FN0L 1U91B 5TDNA 1Q72L 4PJ8A 1QKZH 2WMFA 2MCPH 2ERJB 1EK3A 1H41A 2WC3A 2GI7A 4M8QB 4NC2B 2I24N 1DBBL 3OAUH 1OAZL 2M2DA 4LXFA 3NDZA 4X7TB 1KV3A 3G6JB 5ALCL 3VXUA 5C71A 3PWPA 4H26B 2O5ZH 1G9MH 3D4YA 5F88A 1K8IA 1U8QB 1UKQA 3VRLF 1LEIA 4YIQB 3BDBA 4RL3A 4U1MB 3PWNB 4BF7A 4J3XA 4DO4A 4NO5B 3MRCA 3LKQB 4OQTL 2HP4A 2BSTB 4F57L 1A1OB 2EO1A 5DRNA 4JB9L 1UWGL 1OP3K 5ID0A 3VE0A 4HWUA 4WWKC 4DQOH 4JQXC 1O6IA 1FNHA 5BRZA 1ZLVH 5HHNA 1TZIB 3D39A 1J01A 5D7KE 3UO1H 1KIQA 5EUOA 2BSRB 3MBXH 5B3JE 4CU8A 4X6CB 5F89B 5LA2A 3HPLA 5EZOL 2YUZA 5CCKL 1HXMA 1O0VA 4LSVL 4P2RB 4PS4H 3TYFB 3MRHA 4UFHA 3CIQA 3WKNA 3FB6A 1CWVA 4JKWA 1XH1A 1GHFL 5ICYB 1OB1B 1QSVA 4IIQA 5IV2B 3CD4A 3TZVC 1R5WB 2CJUL 3DV4A 1RZKH 4L29B 4Y5XC 1T21B 5A6LA 4N0CD 1MEXH 5IFAH 5DFVC 5CSZB 2ZG1A 3UTTB 3Q5OA 2A3AA 3BE1H 1UG9A 5AD0A 5FKPB 1FZJA 4FQ2H 4KXZI 3CHDA 4QNPF 1CLYL 3ARXA 3NCJL 3IS1X 2EE2A 4DCQB 5AG8A 2EDBA 1IKNC 4ZFOA 1AGDB 3PNWB 1P7QA 5GRUH 1CDGA 5AYQA 2X2IA 1JNNL 4DZBA 1A2YB 5IGXH 3VH8B 3EDJA 4A4AA 2XT1B 2FD6L 2WWKO 3BZFA 3EJPA 4HFWB 1BAFL 5EC2A 2ADFL 3WS6A 3JVGC 1QVOB 3DO3A 1P4LB 3VGHA 4LPYA 4KJWC 4XHJC 2DQGL 4PJBB 2NY0C 2W62A 4MA1B 2AEWA 1AGBA 4RGNB 1FBIH 1ZGLM 5DD3L 2FHCA 2FO4B 2AK4A 3MUGA 1EAPA 4O58H 3THML 4ZQKA 1GZQA 5E1AB 4YN5A 2EO9A 1YEDB 3QYCA 1FL6A 1P7KA 3WMSA 2D3LA 1QSZA 2I25N 3IKCB 4YNYA 1HQRB 1KPRB 4MLSA 5L7XL 3DI2B 1E6RA 3AMLA 3HE7C 5D1XB 4YBLC 3BKCL 4BH7B 3CK0L 4F15C 5BW7A 5C0FB 3BXNA 2AKRB 4JFFE 1JIBA 1DWIM 3T8XA 1LWRA 3CJJA 2FR4A 3EYSH 2W07A 4TRPL 1AIFA 2Y1VA 1BVNP 4NKQB 3SBWC 1P1ZA 4W6XB 3QEGH 2EZ0C 2P8MB 2I07B 4JKPL 5SWSE 3QUYB 2XG5A 3REVA 2BRRL 3DTXB 3QXAA 5TE7H 5CJ5A 2UWFA 4QXGH 1LVEA 2LU7A 4YHNA 4ZSOE 3RIFF 3QO0A 4MNLA 2AEPH 2GK0A 3IDJA 3QXWA 1N2RB 3RNKB 2L4OA 1CE6B 4KGJA 1B9ZA 1KJ2B 2FEEL 4I0CC 3KPSD 5C0CB 3QWOA 4GXUN 5I15H 4YGVB 1HE7A 3S9DB 5F72S 1WWAX 1W9XA 4ATLA 1N4XH 1A5FL 2MANA 3CIVA 1UXSA 2CGRH 2VUOA 2NY6C 3ARPA 3TCLA 2PYFB 3ARUA 5F7DB 5LBSL 5EBGA 4YK4B 1QRNA 3IXTB 4GG6F 2YN5A 3QDHA 1PLGL 4XCEB 2QKIA 1NMBH 1I8IB 5E5MA 2DH3A 4XNMA 4KHTL 4NC1C 3OQ3B 1TVDA 2IAMD 4G6KH 4QWWD 4PMVA 3RJXA 1SM3H 1Z9SA 1IT9L 1XCTA 5D4QA 5EU6A 2BFGA 4CNIA 3WMBA 1T22A 5ITFB 5ESAB 5JXEC 1EV2E 4X4MA 5DD1L 2XZQL 5CP7B 4J2XA 2XYCA 3Q3GB 2YKLL 3AAZB 3RUGF 4K7PX 1S7RB 2B20A 5E4IA 3KXFE 2YBRB 5F9AC 3TN0B 5C0ND 1QBLH 5DVLA 3I75B 4DOHB 4BZ1L 2J62A 3BC9A 1KTKE 1UM4H 5GGSY 4BKLB 3P77B 4K23L 5E2WL 4UILL 4GQPH 3IJ9A 4PJAB 2NY4B 1BQUA 2WUCL 1T4KA 3MR9A 1CF8L 3MV9E 5DRNB 4GRWE 2RCSL 1L6ZA 1LO4H 1Z5LB 3MCLL 2LQRA 4EKJA 5ID0B 1MNUH 4JHZA 2ZCKL 2ESVD 4G6JL 2BVOB 2W9EL 3CUHA 3VE0B 4NQED 4ODUB 3BMVA 1US3A 1KCSH 4PJ5B 4JRXE 2GT9A 5D70L 3ULUH 1MCPL 1RURL 4DVRL 1J5OH 3ZHDA 1ZHLA 2YK1H 4KPHL 2YL8A 1SJVA 3AXLB 3GRWA 4OLUH 2Y6SC 1BPVA 4AZCA 2XG4A 2PW2A 3UAJD 5A3ID 1WF5A 2E9IA 3QQ4B 4X99B 4OZHA 1A6VH 3MRHB 1JZ3A 5CILH 5EZJB 3BESR 4OT1H 3BPOC 5FYKD 2CNCA 43C9A 1JPST 5T5NF 3S6CA 4F7EA 5CUSH 1KJ2H 3FQTA 1YYLL 2DQTH 1MI5A 4ZOCA 3NCFB 1CTNA 1QSFB 3S98A 3LEYL 1KXVA 5TDOB 1E56A 2WC4A 3HE6B 4PRBA 4J12A 1DUYB 2UZYB 2JF1A 4XBPA 1AMYA 1BJMA 1QNQA 2UYLA 2DOCA 4PRIA 3R06A 3N11A 5D2NA 3WYRA 1I1CA 4JDVB 4LASH 1G0DA 3MRPA 4Y19B 4LOUC 3O41A 1WBXB 3EGSA 4TX6A 2VURA 4I77H 2OW6A 1VB9A 4HKBB 3GXMA 2JF6A 1YEEL 3POCA 4LVHB 4ODHL 5EC2B 5FYJD 2JEQA 3LOWA 1RMFH 3VFGH 5DMIL 4OOUA 3CLEH 1BYDA 1V02A 4W85A 1MWOA 3EYPA 1L8NA 3BCDA 2J7EA 1KNOA 5K9JL 5GSVB 5SX5H 2HJKA 2CDFA 5EZLA 3WV0A 3EHBD 3FO0H 4JHBA 4EEEA 1KPUB 1Q94A 4Q6IC 3MUGB 4PG9A 1CL7L 5T5NG 2MTPA 4QTHA 2A74B 3V6BR 4PLOB 2BX5A 1MCCA 2D03L 3N9KA 5IMMA 1UASA 5CXPA 3LQAH 4M9PA 1E4WH 3K8LA 4YNYB 1UZ8A 1HKJA 1XHGA 4K8RL 2ZWLT 3RKPA 1HP5A 5IQ9B 3GHEL 4MNHA 4H8UA 3FFCD 4ZPTA 3T08A 1C7TA 4XTRD 4ZO6A 4YPGB 3BXNB 1UVQA 1Y0LB 1XR8A 1A7RH 5J1TC 1RVFL 3QEUB 4NRRA 4HH8A 4C57C 3MGAA 2N7BA 3T8XB 3I6GA 4V1DA 4XWOC 2NNAA 3LD8B 1BFSA 2NY7H 3BJ91 3NA4A 3T0EB 1EFXA 4EUPG 3QPQC 2K9UA 4U5KA 1QHZA 1RI8A 2YD2A 3BISA 3OX8A 2HTLC 1R0AL 2OMNA 3GSXA 5KSAC 1V3JA 4HEME 3QXAB 3BZDA 1JUFB 2JB6A 4G9FD 4JFXA 1OIMA 2NY1D 1IC7H 2A0LD 2N4IA 2ZUMA 2HT2C 2OXHA 4Q9CA 2Q7YA 3QWQB 2IFFL 3BLKA 3UPAA 1FZKB 3T09A 3QO0B 4PV8A 3IDJB 4C55A 5HI4D 4OLXL 4NQVA 1I85A 3UESA 3VIIA 4TULL 1EBPA 4NP4L 3K81A 4WHYG 2V7NB 1ZS2A 2X8RA 4HT1H 4XC3H 2WVVA 3RX8A 1NSNL 3EDEA 4HJGB 1HP4A 3IDGB 4HBCH 1DE4A 2IALA 5H35B 2YDQA 1KFWA 3SDDD 1US2A 2FEDD 1NFIB 2X1QA 4R9HA 3UBXB 5BVPH 2CBVA 4Z7WE 4NOFA 5EOCL 4YE4L 1UACH 5E5MB 4M62L 4Z78A 3LKSA 1CFBA 3VD3A 4G80A 2F53B 1Q0YH 3L1OL 4MJIE 3VG9B 4FNQA 3NZHL 2YUWA 3FTGA 1QA9A 2VLKB 1RIUH 4MTVA 4RAVA 1BEYL 1FH8A 4WEUD 3BT2L 4TTUA 4J3WA 5EPMA 3S3SA 4NRYB 5B8CC 3BN9C 4JFED 1F6AA 1S78C 4N0UE 3U30B 3BLPX 2EIEA 4TOYL 1DJSA 4JY6A 2XVGA 3G5VB 1E1FA 3ESVF 1H3GA 1H1NA 1S8DA 3ZDZE 1WJ3A 4U7SA 4NQTA 5TE4H 3INUH 1OP5K 2A73B 4H88L 3WD4A 3TBWA 4QHMA 4IRJC 4RE2A 3OAZH 4YHLL 3N1QC 2JIWA 1G0XA 2Z8SA 1AHWA 3MYZA 1KN2H 5DEZA 1ZHLB 2A6KA 3EOBA 3I6LE 1IKFH 3VXRD 3BPLC 4HTYA 3ZQ9A 3DNKA 3GKWH 5C08E 1BQCA 5HI5C 4PN2A 43C9B 1TQCC 4JFVA 1MHEB 3L3IB 3LKOA 3BEWB 1W0WA 3U7AA 5DUPH 2XN2A 1K4DB 3V6FB 3VXOB 2FIRT 4U6YB 3MROA 3U0PA 5ABHA 3BAIA 4P7LA 2DMCA 4GMTL 1E27A 4P2QA 1NH6A 2A1WH 3DVNB 4PRBB 4WV1A 1TETH 2SEBA 1B0RA 1I1AC 4XBPB 4RGOL 1QPXA 4OD2A 5CEYB 1KJ3L 3RY5A 3QFJD 2VC2L 2BOCA 5CQ1A 2UUDK 4FQQA 3BWAA 5E8NA 3O41B 4E5XB 2XFFA 3S37H 3TTSA 2WMKA 5I30H 3GI9H 1T03H 5T1MA 4UFJA 4WUUB 3GNML 3GBNL 4NGHL 1KEML 5KSBE 2C0HA 3P4MB 4PJXF 1GGCH 2X1XR 3N18A 1UB5A 1JD9A 4KK5D 1OLZA 2W67A 3OKDB 4F58L 5JZ7C 5FHBH 2WBJC 3Q2CA 2VR4A 1MW0A 4JREB 4GAYA 4YBHA 1J86A 4NHCL 4OGAC 3VFPA 3HI6L 1YUHA 1MJ8H 1A7NH 3CCHA 1QVBA 1QFHA 7TAAA 1T7XA 4MWFA 4PG9B 2PF0A 3U4EB 4QTHB 5GRWA 3U36A 3OWEA 1WCGA 2EXOA 2VLME 3ZE2F 4Z2LA 3Q6GH 5CKGA 3PHQA 4NUJB 4R97C 4R8WH 1UZ8B 1GJWA 5C0GA 1Q9WA 4HIEB 4HKZA 3W0WB 1S7UB 1CDHA 4XCNA 3O6KL 4MNHB 4ENED 4D6CA 1YEGH 5HYIA 2NZ9D 3DYOA 1P6FA 5HD8C 1MWAB 2A77H 5EWIH 1YYML 3UERA 1XR8B 3GMQB 2IGFH 1C5DB 4B5EA 5DUML 1RZGB 1CBVL 5TH2A 1J8HE 2DM3A 1W9BM 5BQ7B 1BM3H 5JQ6L 3V7AE 5F9OL 1OARL 4YXKH 1MFBH 4EI5D 3OX8B 3QIWA 3OGVA 5JIPA 2JB6B 4JFXB 3TBVB 4AIUA 4L4VB 4K3EL 5CKAA 4V2XA 3D9AL 5MHSD 4B0MM 4FZEH 4ZNCD 3O4LE 4K3HA 3QQ9C 4QHLB 4PV8B 3ARED 5JOEA 1PSKL 1TXKA 4MQ7A 3WIHH 3F12B 3WJJC 4D0CA 2Q8BL 4Y1AA 1GL4B 4XNZC 5DD5L 1HNGA 2WVVB 2AV1A 2I9LA 1DE4B 2IALB 5L2KA 2O26U 4JRYA 2HYMA 3OGOE 1RJLB 3UEQA 1GQLA 4GAJL 1PX3A 2XFRA 1JYVA 4TSAL 5I1GL 1NCDH 4WJXA 1QBMH 3RCNA 2FWOB 1EHNA 4WI4A 5L6YH 2YEZB 4RRPA 4E41D 1FH5H 1SJXA 4J1UA 4GO9A 2BVEA 2R0WL 4AY1A 3UG4A 2WBGA 3BI9X 2VOTA 3JV4B 3SGKA 3BIBX 4XPAH 1U2YA 4UV4H 5D7JD 5I2IB 4ELKA 3PTKA 4TPRH 4HGMA 3N1AA 6A3HA 2R4SL 4U1IA 4UU9A 3AHXA 1U58A 3EMQA 2P8LB 3MANA 3ZT7A 5E9DB 3V0VA 4PSRA 4M48L 3OKEA 1YA5A 4WO4A 3WIJA 2V17L 2MWCA 5FYKL 3WSQL 2HKHH 5EBLB 5FUCC 1FL3A 4L4JA 5LGJA 4ZXBD 4MXVE 5I74B 4NC1E 3AS0A 1NBVL 1MWAH 1ZKAA 3QJFB 3B9EA 4FFYL 5GISH 1QYGH 3WN5C 2NXYC 5D8ZA 5FA4B 4LVEA 3DXAE 3O6AA 1NAML 1VPOL 3GMNB 5ABDE 4RZCA 5FO9A 2IC2A 4QHMB 1T7WA 3AGVA 3GBML 4JDTL 2G4FA 1S9VB 5A2IH 1UCTA 2UY6A 1I4FA 4UDTA 5CP3H 4DGIL 1R87A 2BY3A 4UZSA 3HUJF 4YHYB 2V9QA 4U1NB 1NQ6A 1ZWIB 3T65A 3V5DA 2X2JA 4Q7NA 1BBJB 3DSFL 4AG4L 4F7CB 5L0QC 4GG8B 3ZJ8A 4AD2A 3O0RL 3ARDB 5I1KH 5FM5O 3PWVA 1Q9OB 3EBVA 5JW3H 2X4UA 2VZVA 1LLOA 1NCWL 4M7KL 5GGQL 2ZWYA 1SEQL 2VX5A 4MB4A 4R2GD 4DJMA 1WTLA 4G9DA 1W0WB 4XV0A 4FNLL 2VX6A 4AD1A 2H2SC 4PTTA 2WBWB 1FP9A 3DURB 4JVPA 4ZSOA 1AC6A 3RIAK 1E4IA 1JTPA 3V95A 4PGCA 5JTWA 2X5PA 4QXUL 1H5BA 1PIFA 3I2CL 3LRLA 2PC8A 1MFAH 1P5VA 3GNPA 4EKXA 1TE1A 5D1ZB 2CXGA 4H25A 3HFML 5IR1A 4LDOB 4W93A 1LEKA 2C3WA 2D31B 3MBEA 3IFOB 5IT2L 3QEQA 1MREH 1NGQH 2Z8WC 3LIZL 4OF8A 1OLLA 4LKCA 1T0NB 5A6MA 4Z7UB 3RQ3A 35C8H 1CENA 4PJDA 4KJPD 2XTLA 4FFVC 4MB5A 1UB5B 3VFVA 4X9GA 2A3EA 5HVWA 1H4PA 1OF2B 3WNNA 4XPBH 4EJ1C 3S36X 4HKJA 2HG5B 1JI1A 3JWOC 5D1QD 5T3XD 4I18B 4ONFH 4QRQB 3MA7A 4GAYB 3BRFA 2QPUA 3U0TA 1T7ZA 2YXMA 4LYRA 3RZCC 5E8PA 3CCHB 3V5HB 1U8OB 4MWFB 1W0YT 3PV7A 2ZJSH 4N5EC 2IJ0C 4PRDA 4EQ3A 4HC1H 4ZFZB 4FQXC 3VIKA 3PHQB 5GZND 4R5EA 1WKYA 5BZWA 4C7GA 2V7HA 1HILA 4XCNB 1CD1A 1FO0L 3QDGE 5A69A 3GK8L 1CE1H 4PJCF 4H1LG 1K85A 4UZUA 1JWSA 3OIHA 3DO7B 1MRDL 3D3AA 5D9PA 3MTRA 3WFEH 2VXTL 5IBLC 2XKSA 5CZKA 1CYGA 3A6BL 1U8NB 5EU4B 3LHPH 4R6UA 4PJEF 4OZFB 1VKXB 3F7YB 4JPIA 3CUJA 1ZT4A 2VLLB 4JRXA 1F8TH 1MHHB 1SY6L 5C0DB 2WB5A 1I1FB 2O92A 2R4RH 4JANA 3ZHLA 2Y5TB 1F6FB 5DT1L 4GW5A 4WFHD 5FM5M 1SJEB 1YNLH 1TNMA 2E7HA 1AD9A 1RJZA 3OGSA 2ATPB 1NANI 1D6EB 4MJ6B 3MMEA 4RMUA 5I73B 1MIML 1EPFA 3NCCB 5B39B 1I9JH 1IGIL 2HVKB 3HZVB 3KPLA 3QDJD 4I4WA 3QH3A 4XWGH 4DGVH 3UETA 4G6ML 4ZOBA 1VENA 1BG9A 3NPSC 2X0YA 2V3GA 2O9RA 2HRLA 4WU5A 3VRLE 4P48A 4Z76A 5FYLE 4D72A 1OAKL 1AGEA 4HS3A 4ZAKC 4EOWH 5HYQA 2QHRH 3PL6B 3VKKA 1EX0A 4PJHF 4BZ2H 1DBJH 1KTBA 1EGJH 3U4BL 3BH8B 3P0YL 1YC8A 4MNMA 4FQLH 1REIA 2C7UB 1C08B 1CGWA 2DQHH 2IPTL 4M3JA 1KYOK 1MCOH 2OW7A 1H8OA 1IGMH 3E6HB 2PWDA 3ZLQC 1U93A 3BGFC 3OKLA 1RZIB 5KVMC 4NM8H 1WAAE 4ELKB 4JN1L 3B9KA 4U1IB 3TBYA 1HSBA 2GJXA 1LILA 2A9NH 4OGYH 2ZCHL 1U58B 3HNVL 4HIJA 1C92A 2XQBH 4AIZB 3V0VB 1JP5A 3O4OC 2FIKA 4QXWA 4EVNA 4FXKA 4D6HA 2BNRD 2VE6B 4PYSA 1FL3B 1OSPH 2VLJD 4JJHA 4DN4H 1YJDH 4Y88A 1OAYH 1W3HA 1OL0A 2YMXL 4U2YA 3JTTA 4TTDD 1QNZH 2DM7A 4OGXH 1AXTL 4RZCB 4U1GC 4OZFH 1IGCL 3NACL 4QNPE 3WNKA 1F4AA 2IEPA 3GUTA 4OSUL 4NO0D 1D9KC 1I4FB 2CKBA 3GMOA 2VIRA 3RI5F 3WY1A 5IM7B 4PTUB 4JFFB 3T65B 1JNHA 3KPRE 3F7VB 4P9HL 4APQC 4AH2B 2IXVA 1E6OL 2X4UB 3WHXB 5SWSB 5FUOL 1JCKA 1E6NA 1F45A 3SUWA 1HINH 5DRWA 4PUEA 2FX8L 2R23B 1E71M 2FYYA 1DLHB 5ABGA 1KBKA 4D8PB 4ZTPH 1WFUA 3EJRA 3ZZ1A 2XTJD 1TFVA 3SCPA 3TJHC 2A3CA 3QUZD 4Y2DD 4J4PD 1DHKA 3EYQC 3FFDA 5DFWH 1HTYA 1WZ1L 2UY2A 5I71B 3WXWH 1IGTA 3CXHJ 3F8UB 4H0IA 4M6NL 4X6BA 3MV8E 4JR9H 1VFOA 4HUMB 1Q6CA 3AY4C 3D25A 4FRWA 3HAEG 2MFNA 1DN2A 1BD2D 4OZOA 5EOQL 2J8HA 4Z0XB 4MAUH 5I76A 1YHTA 1G7MB 4KZEH 4BK5A 2AMGA 4M1GH 4X9BA 4Z7WA 4LKCB 2VXSH 4ESKA 1IILE 3UPCA 5I1HH 1GOMA 3N85L 4U49A 2DLFL 2VAAB 4HKJB 2GDVA 1MCJA 3BAJA 1EHLH 4N1EA 1OSZA 4MJIA 3MA7B 5J6GB 1Q9KB 4P4KB 4TVSa 4LIQL 4YAQA 3OGRA 4XZUA 1SYTA 1BF8A 5E8PB 4M3KB 1CFSB 4KRPC 4JZJC 2DWDB 2JJSA 4BSWB 3KXFB 3GTNA 1CD9B 4XMKL 3SJVE 1HX0A 2ZUQB 1DSFL 1Z32X 5DJAA 4HGWB 1JFHA 4N0UA 1HILB 4PJIF 1W32A 2DSWA 1FCGA 2GW5A 2ZNWA 4WY7L 1MCQA 2V2TA 3G6MA 1ETZA 4GBXC 3L7EA 1MH5B 3C60B 3MV9B 3RTQC 2P46B 2HVJA 3SCSA 4HWBH 4PY8J 4G7VH 1MW1A 1PVHA 2R2CA 3QZWG 4Z8FL 2VQTA 3ZKXB 4S1DC 3NCYP 5CHNA 2VL5A 4W89A 1PX4A 4FNTA 2KZ1B 3D0VA 2R69L 3BKYH 3O6LL 5EIVA 1OAZH 2CIIA 1OHQA 1ZLWH 3IK2A 4JANB 5IEKB 2VXVL 4DM2A 2HT3D 4L9LC 1EMTL 1A8JH 3PG2A 2FYVA 1R7OA 2VUYA 1T1YA 5B38A 4G5ZL 3G9AB 4HG4K 3KLSA 5IMOA 5C08A 4MXWL 2LAAA 3RPIA 4Q2ZA 3WL9B 1IM3A 1ODAA 4M1DL 3TT3H 1T2QH 5JR1H 4J23A 4I3RL 1PY4A 3CX2A 3DBXB 4M61A 3MMEB 2P8PA 3NN8A 5D93C 3X12B 5I8CB 2VLRD 4LQFL 3ABZA 1IAIH 3CUPB 5J3HD 1IC4L 4LRNL 4Z2IA 3P9LA 3MXWL 2FCBA 4WWKA 1WQVT 3RNQA 4DO6A 1YC7A 3ETBF 3TP4A 3WH8A 1Q6FA 4RGMC 1T7YA 1RH9A 4P59H 1MXDA 3ZOAA 1QBAA 1G01A 4MJ5A 4V1DD 1MJ7H 5E8OB 4QRPE 4HS3B 3MNZA 4D2NA 5CCKH 2YD1A 2WMIA 5HYQB 2DLHA 4LSVH 1JBJA 1DWGM 5C0EA 1GHFH 4HUVA 4XNQA 3D3VD 1TQWA 3TZVA 3QIBC 2J6EL 2CJUH 1DBAH 3DX0A 2G41A 2OJEB 2DI9A 1HJSA 5KSBA 1NUGA 4OZGB 3L5WA 5ALBL 3H53A 5I18H 5DT5A 3W38A 3SCWA 4MQSB 1XIWC 1VACA 4WFFE 2ZPKH 3QA3B 4PY8I 3B9KB 4WW1A 1OAXL 3KYNA 1CLYH 4HIJB 2EH7H 4CJ0A 1QWNA 4XP5H 4R4FH 1V8HA 2BCKB 4FXKB 4L4TE 1IKNA 1E4NA 3U9UB 1JZ2A 3MLYL 1HEZB 1GYAA 3ULVF 1OAQL 1QNPA 4W68A 3REWA 3WIFA 3CGTA 2A9ML 3PWUA 1NOWA 5GRVL 5A6SA 2D4DA 4MD0A 4U7KA 3JTTB 3RA7H 5DVKA 1CFQA 2FGWL 2QQLL 3MA9H 5IB5B 3RO8A 2H6PA 1WT5C 1U3HD 2ADFH 4MB3A 4N90E 3GUTB 3JVGA 2VIRB 3GSOB 2WKLA 1OGTB 5DQ9A 5LKNA 5EB9A 5BS0E 3H9SD 3RVUD 1UA6H 2NX5A 3S35L 3SE3A 5J9PA 3NUKA 1J8HA 2AXHA 3V4VL 3VM7A 1MIEL 2P24B 3VIOA 3OHXB 4LSPH 2H8PA 1KCUL 3QULA 3CXHK 4PIRF 3CFDB 3WELA 5DHYB 1KTCA 2FYYB 3UJIL 5L7XH 5ICZA 2J5LB 4WEMB 5A1AA 4F8XA 4HZ6A 2CETA 1YEHH 4BQ2A 3LN4A 3HE7A 1R3JB 1IGYB 1YQVL 3IGAA 1QR4A 2OZ4A 1R3IL 4M7JH 1KCVL 2WUBL 5I8OL 4S1RL 1I1RA 4X6BB 3HLAA 1JHTA 3GSNA 4F7PA 1CR9H 3CFBA 1I7RA 4GRMA 4R7DA 4TRPH 3ZDYE 5FOOA 2GSIB 4K2UH 4NDMB 4AEEA 4GZEA 4NO3A 3MOBL 1W9DM 1ND0B 1N3NA 3VRIA 2WHJA 1ADQL 3H7BA 2EE9A 2XA8H 3T4YA 2R9HC 3AIUA 2UZIL 3L9RB 3QDMD 5T3ZE 1UQSA 3E6FA 5DEGB 2F54A 3BMWA 1E3ZA 4PD4J 1FFNB 4UAOC 4LSRH 4MJIB 1NGWA 4K8RC 2B5IB 4YO0A 4XZUB 3R4DA 2VDNH 5CEZE 2YC1A 4MDIB 2EKSA 3FRPA 2XGIA 4X5WB 5C0RH 3LDBC 1IFHL 1A5FH 2ICWJ 5F7YC 5M3WA 4QRRE 5IB1A 5DMKA 4NN6B 3QIUC 4F7TB 3GMPB 4LHUD 2AXFB 3EMZA 4FXGA 2O9TA 3T1WA 3AZRA 1AC0A 1O5DT 3HR5B 4YC2C 5C86A 2HT4C 4G8GB 4NHUB 2PXYD 1T83C 3BVXA 1XRVA 1ETZB 3MJ9L 5F6IB 3L7EB 2EEXA 4WW2F 4XP1L 4Y4KD 1SVZA 1XH3A 4JHWH 4DUXA 1PY9A 2DSUA 2YL6A 5IK3A 1CCZA 3ILQD 2R8SL 3QNZB 4KHXH 1D6VL 3DXAA 4WHTB 2L7JA 1K9DA 2IBGA 4UT6L 2TAAA 5I8EA 2XZQH 5KZ6A 5A8QA 2YKLH 1S9WA 3HC4L 2WANA 3AHVA 4P4RB 3SE8L 3VIJA 2R0LL 1FYHB 5LAXA 2AABL 4YXHH 4YPJA 2G2RA 4B50A 3ARYA 4LRIC 1T1YB 2R0KL 5E2VL 5B38B 3PWJA 1KF9B 4UILH 5F7EL 5IMOB 8A3HA 2W9DH 1G9NL 3C6SB 3G08A 1GIGL 4AY0A 2NY3C 3UYRL 4HKXB 1G7LA 3K74B 1CF8H 5SV4A 3EJSA 1I1XA 1GSMA 3IYLW 3BVUA 3MKKA 3QRFM 1R33A 3BQUB 2JIXB 4HZ7A 2H32A 3P9LB 5E2UL 2GFTA 5I1CL 3GSUA 4WWKB 4NZUH 4HJ0C 1FNFA 2RGSA 3DUUB 1I9IL 1MCIA 1UGNA 4WLCA 4AZBA 2MKWA 1TJHL 1G1CA 5CAYB 1QOXA 4F79A 2CD0A 4MJ5B 5IHBA 2BS9A 2FDBP 1T66D 3VFMA 2WMIB 2HFEA 5JBDA 3O6FD 2ICWI 4X9YA 3RWIA 2DSVA 1KQYA 1CBGA 2DB8A 4H8WL 3QIWD 5BV7B 2ZZUT 5TQ0H 4DVBB 2OSXA 1MHCA 2XUCA 5FUZL 4XPTH 2PW1B 3D5HA 1NP2A 4Y5XB 3CHFA 1A6TA 3DGGA 1U8LB 1YYLH 1FH7A 5BXFA 5DJ6A 1IC5H 3WXVH 3L5WB 5AC5A 4N0CC 3DV6B 3BPCA 4X8XA 2V2XA 4KMLB 4PRPA 1S9YB 3MRDA 3QFDB 4PBXA 3OKNA 1QOKA 4WU7A 3KYNB 3RGVD 5EIIB 5IOPA 2UWEF 1F13A 5ACZA 3LRGA 5IHZA 1N5AA 4JFUA 2XKUA 2PBGA 1U42A 3AIVA 1G6RA 2DLTA 4AMWA 1I1YB 3PDOA 4QP0A 1YECL 1R85A 1IZKA 4XVSL 3ZM8A 1SBBA 5KAQF 4ZG1A 3KL0A 4YHKH 3AFLA 4L8BB 4MA3B 1XF2A 2KKQA 2YPVH 4PJGF 3PHOA 1CFQB 4M5ZL 5C09D 1T5WB 3KYMA 5DMIH 1A6WL 4UDUB 3G6AA 5D9SA 1AVAA 4Z7QF 3VD9A 5J9PB 3A4WA 5HYFA 1UWQA 3MV7A 1QSEE 2KBGA 2P5WA 1M7IA 1A7PH 2DWEA 2WNWA 3O3AB 3MYJA 3EFDL 2XFYA 2WAHA 4PJXE 3ZYJA 1C1EH 1FNSH 4NN7B 5DMYA 2O9PA 2PN5A 5HYJB 4U1LB 1NMAL 3DHPA 2GK2A 4XRCA 1VFFA 4OF6A 1WISA 5CMAA 3TIDA 3O4LB 5SV3A 4R3SB 4NNPL 4KRNA 3VGGA 4KI5D 3VCLB 5C2UB 1EA9C 2CBUA 4CL7A 4F15B 2EDYA 4N8CL 3O11B 3DHJA 1FRGL 3WF4A 3S5LG 1KB9K 3WUFA 1FNGB 2OMBA 3CFBB 4GRMB 2X0HA 2E7CA 4BH8A 5KAQG 3LX9A 4Z95L 3VJ6A 1NAKL 5BV7H 4NO3B 4DKFL 1IEHA 5GS0D 1N3NB 5KSAA 1VCAA 1W9VA 2GDUA 3MGTA 4XHQA 2FJGA 2IFFH 1WAWA 1Z3GL 2PTVA 3CTTA 5MEQA 4XBEH 2A38A 1B1YA 3NCMA 2G3NA 3B9VA 2ADGB 2Y07H 4RFEA 1NGWB 43CAB 3UZQA 4L3AA 1NLBL 2WV3A 5CG0A 4TULH 4NP4H 3HMWL 4OD3L 4P3WA 1TLKA 4FFWD 1F3JB 1CN4A 2KPNA 4AEHH 4KKCD 4D3CL 1NSNH 5I8KH 3NFNA 1HYSD 3OB0H 1U3ZA 5IFJA 1IT0A 4YWGL 3CPUA 2UZXB 2NY6B 3GXIA 3GGWB 3KJ6L 4HXBH 4X5XA 3CLFH 1QPPA 3GMRB 2WIMA 3DX7B 4I0PD 4KRUA 4YE4H 1JPTL 1JGDA 3NFPA 4M62H 5T1DH 3P9MB 2CDGB 3QEQD 1C91A 2CEQA 3HI5L 4Y5YC 5DLML 3N17A 2QSCL 1YN7B 5DZOA 5IK3B 1UA7A 2WMPA 2IAMC 5AZ2L 3DXAB 4I8DA 1AGCB 4QWWC 2B8OT 5K93A 4UQ3B 3FB5B 1BEYH 4KK6C 1J0ZA 1IGJB 4PP2A 4MHHG 4LU5H 1AQ0A 3QUML 5JQHC 3VDCA 3F58L 3KNBB 1AD0A 2WLZA 5GHWL 1W72L 3ULVC 3QAZC 5DR5L 1KCRH 1S7WA 3PABA 1H3WM 3O3UN 1A14L 2X1WL 3EJYD 4TOYH 2X2HA 4QLKA 2OI9C 4QOKD 1IJ9A 1QZ1A 4P5KA 1H3VA 1OCQA 1DQDH 1CICC 3LMJL 3KG5A 5F3HB 3N12A 5C8BB 5D6CB 1KTLA 2RBLA 2WMJA 5BRQA 3EO9L 3MJ7B 1GC1C 5IW1B 1AXSA 1VSCA 1BOGB 3S4SG 3OBAA 3C5ZB 5C92A 3SDAD 1OGAA 3MV8A 1BMGA 4D1JA 4FMFA 4X6EA 3D5OF 5FCZA 4PRHD 1NC2D 2PCPB 3CU7A 5GJTH 3MCKA 3DX8B 5EOTA 5HGGS 3UAJC 2HKFH 2FZ3A 1IV8A 1Q6DA 3HKFA 1YMME 4Q9RH 1MHCB 3RWDB 1YMHB 1B0IA 3O3BA 4X6FB 2R29H 4UUJB 1QR1B 3U2SA 3HUJE 3LKRA 4UT7L 5KZCB 5GGVL 4Y7MA 4U1KB 4WI7A 1L6XA 3BP4B 3S34H 3OKNB 4GXUM 1LHZA 2AS5M 4E8DA 5FO7A 1UD8A 3RU8H 2PTUA 4HDIA 5ACZB 1C12B 5IHZB 1U3JA 5ADOH 4Z77B 1DVFA 1BPLB 4XH2A 5F7UA 4WI9A 3IU4L 2FECI 1OP3H 1CXFA 3B5GA 1XF2B 3HNTL 3QDGB 3GIVA 4OLZH 3PHOB 2OX5A 5EO1B 2VSCA 4L8CB 3FB7A 3EYOA 3SDCD 3MNWB 3KVQA 3G6AB 2WBJA 1XGUA 4NHCH 5TE6L 5I24A 5GIRA 1FGNH 1R3LB 4JPWL 2Z92A 1U8HA 4W8AA 4C59B 3SUUA 2QHLA 1DFBL 3HMCA 4Q6IB 1AO7E 3MI6A 1UYWL 3EHBC 2DWEB 1JGUL 4GG6A 3FHAA 4X5LA 5BXRA 1OW0C 2BC4B 4LHQB 2VTFA 5AZEL 4WW2C 4P49A 3TA9A 1RUAL 1ZE3C 3O6KH 3TIDB 2X1OA 2KQNA 2JEPA 4MGXA 3TYGL 2GJ6D 5M95B 1GPOH 1LK2B 3TO2A 1S5HA 3GNOA 3RUGA 1JPGA 4XTRC 4LLQA 3ARFA 4CRPA 1OQXA 1UR4A 3KPOA 3C9NB 1WZLA 3BDYH 2OTWB 1UWXH 4GW1A 3G6DH 2OR8A 5F3BB 3VJ6B 3UTSD 3DIFB 1MQKH 1T89C 4QRPA 4PJCE 2JLLA 3WNPA 2B0SH 4IMLA 1YQ2A 2GYSA 1A7QH 4S3KA 1J1XH 1X4ZA 3RVXC 4M1CD 3QUXA 1NCTA 4MAYD 2Q3AA 2C3VA 2NY1C 5DK0A 2AJYL 2A0LC 4LSQL 4N5UA 1PKOA 1GGUA 4X9HA 4RFEB 2Q8XA 4JFDB 4JM4H 3WJJA 1V0NA 2BVTA 4FABL 5M7QA 4KKNA 4UIKL 5DS8B 5HI4C 3MSDA 4D6IA 5ACLA 4GKOA 1MCFA 3IDNB 3AB0B 2A6IA 3D69A 3VFRB 5D8WA 1XC6A 1KTRL 4JLRB 2XZCL 4UQBA 2EYTA 1HF6A 7A3HA 4JN2B 4LMQI 4L4TA 1ZTXH 2YRZA 3WH9A 2FEDC 2J12B 1JGEB 4I2XA 4KY1H 2ORBH 2XPGB 4HJJL 1G7QA 3BKMH 1QFUL 5I1GH 3VWKB 4QCEA 4XPFH 5D8JH 1ORSA 4UTBH 2GTZA 3VD4A 1MAKA 1WCBA 2G60H 5DGQA 1ODUA 1TMQA 2ARJB 5EU5B 2Y7QA 1MJUL 2X09A 1TQTA 3X13A 2EYRA 5A2KH 3KPRB 4BFIB 3ZSSA 3PV6A 1MCNA 1D5MB 3FT4B 3BAEL 5B8CB 2C7FA 1S7WB 2EYSA 1HHGA 3CVHA 1S5IH 4EUPA 2OLHA 4LCCC 4B15A 1J05A 3UCQA 3UJTH 4U0QB 1JTTA 5HHQA 4JPVL 1TPXC 4M93B 5HHVL 4P2RD 4JFZH 3X3GL 3WN5A 3O45B 1MFVA 5ANME 3UROR 4S0SD 1CXIA 2QLVB 3AFBA 4BCEA 3PGDA 4XCCL 5GS2H 1F02I 4IRJB 1LQ0A 4P5TA 3RWJB 4DGIH 4R26H 3UTTD 4HU0A 4WIWA 5CWSB 4KXZH 5FYLH 3MRNB 1II4E 4B3KA 3S6TA 3DDFA 3PQYA 4X6EB 1YY9D 3BPLB 2AXGB 3F6LA 4Z2KA 3WY2A 4E42A 4QY8A 1B30A 1JXJA 1RUQL 2AAAA 5E70A 1Y6KR 4WCYL 3RBGA 1TQCB 5J13C 4HZ8A 3MQIA 1BZ9B 1QNOA 4LCWD 5MEOB 2W1NA 4FNLH 2QEJA 3HR6A 5FDWA 3LKRB 2Z35B 1KN4L 5D72H 1BFOA 1XGTB 4ZE5A 3M8OL 5T5FL 3ESUF 1I1AB 3CDGB 3I2CH 3APGA 2XVKA 1XGRA 5D5MF 4X9IA 5EU3B 5F96L 2ADJB 3I9GH 4U5IA 3CFEA 4MVBD 5GGSA 4GUPB 1VGEH 3SJVB 3EZ8A 4JFOA 3FQRB 3ZO9A 5GZOC 3AIBA 4RGND 4PBVC 5L9DL 3CU1A 2WC7A 4EDWL 3GIVB 4PGDA 1HKKA 1JHKH 3CZFA 1KOAA 3OPZH 1CLOL 5LCVH 3EYOB 2NR6D 1ZT7B 1V3IA 3VFUB 3V79C 2VZTA 3GXNA 2GAZB 1Q0XH 2CLZA 2DIEA 5J6HA 1NGXA 4TUKH 5D1XD 3VMPA 3RZCA 1U8HB 1MCDA 2R1WA 5C0AA 1WDSA 4GSDH 5FL0A 2VABB 3T1FB 5GQBA 1U36A 2O5XL 3AYSA 4R97B 5SWZE 3ULUD 4BELD 2DD8L 4XI5D 3HN3A 4GOSA 3GK8H 1G0YR 1BIIA 4JZNB 3SURA 3PXJA 3C09B 4ENEC 1MRDH 4KGLA 3VWJA 2NZ9C 4JO3L 1J0IA 2K3TA 4NNXB 5JOFA 4S3JA 3HI1A 1CXEA 2PYEA 3OR7A 4XAWL 4R7NA 2NTSP 3KPOB 1QX1A 4BSVA 2Q3ZA 4GW1B 3RKDD 4XPGH 1H3UA 3B3IA 5DJCA 5DJZB 1HKFA 3CH1A 1MRCL 2DLGA 3GM8A 5C0CD 1I8KB 1VADA 4QRPB 1FG2A 5DT1H 4IMLB 4TVPL 2HTKD 2DBLH 4WNQB 4EI5C 2EQDA 4GKNA 3L2MA 3UBXI 3BN3B 3KLLA 1A3HA 3AZTA 1F42A 2R1YA 3U7WL 3AMDA 3H7LA 4HA3A 1D5XB 4UFLA 3MRRA 3OKOA 3HG1A 3UPRB 3V2AR 4JFPA 3QG7H 5K9OB 1LEGA 3G6LA 3AREC 3WJLC 4HUKB 4WHCA 5SWQA 1IGIH 1DBMH 3PZOA 3MLRL 4HXAL 1B2WL 4G6MH 1V7ML 4Y4HD 2V3EA 4QHNA 4M4RA 3A4XA 3PGFH 1U8PA 3TEUA 4AIEA 4M82A 4L4TB 4RISL 4ZAKA 2QQKH 5JW4R 3TN0D 4YJZL 4LLMA 3BXWA 2VKWA 2GK1A 2BXYA 2HLFD 4NKDA 3QPXH 4NNYA 2GTZB 3BIAX 3AS1A 3P0YH 5F7FA 3T2NL 4HQQH 2IPTH 2Q20A 3MPCA 3DETD 4QKXB 5E6IB 1N26A 4HUXA 4JJ5A 4XNXH 3ZO0A 4WSJA 4HCRL 4HPGA 3MRLB 5LGKA 1XGQA 3MNVB 2Y7QB 1PQZA 1N59B 2BDNL 5D7JC 4ZPVB 5F1IA 4JN1H 1KT2A 2D0FA 5BS0B 4F3FA 4LNRA 4XB7A 2ZCHH 1DEDA 2E8ZA 2XIDA 5FGBC 5BO1L 4MDOA 3X14A 4Z7OF 1G7PB 2BSSB 3C6LB 4OCSL 4EUPB 3CMOH 4YLQT 2F5AL 2YN3A 5HHQB 1UJ3A 3OA5A 3QB7C 3L95A 3WFBL 4AQ1B 3MRQB 4ZXBC 4BQCA 2NXYB 4O5LH 3KDMB 3HNSL 4Z0BL 3VGEA 5DHVA 5HHME 3RDTB 2W92A 2AEQH 1YN6B 3U7YH 1JDCA 4JQVC 3I02A 3IGUA 2IXUA 3IDMA 4OKVA 4Z7NF 4CMHB 1QSFD 3ULVE 2EEBA 3HE6D 1B90A 2MCPL 3SCOA 4APQA 3IF1B 3N15A 5EC1A 1IQWL 3FZUD 1M71A 2VN7A 2OQJB 3W24A 1FE8H 3VIPA 4KRMB 3STZB 4M80A 3SQOL 5KSVB 1A1NA 1QUNA 3WFCL 5CGTA 4ODXA 3SE4C 2E7BA 4OIFA 1NC4B 1DQJB 4MD4A 5IG7B 4Y19D 1RPKA 3QHZH 2O5ZL 1G9ML 1ZHKA 4ZUTB 3QCTL 4HHAB 2C26A 2R2BA 4NKOB 1FLTX 4HPOH 2NY5C 1WP6A 1U2CA 5K59F 2ESVE 5GRYA 1JF6A 3JV6A 4QT5A 3BH9B 2CESA 5INCA 1X5IA 4NQEE 1WZ1H 2J8UB 2ZXDA 3LRKA 1QFPA 2GJRA 3SGJC 5GGRA 5DJDA 1PIGA 4U0RC 3VFNA 3CFKA 3AY4A 3ELAT 2WHKA 5IUSA 1XSKA 4OFYD 4QRRB 4DQOL 1FAIH 3UO1L 1VEPA 4XPHH 5IQ7L 3MBXL 2ATKA 1KBBA 1OP5H 1OVZA 1F11A 1ZT1B 4M8VA 5HDBF 5DHXB 4FN0A 3U46B 2WHLA 2VI0A 3RGHA 4IIQC 4KJPC 1QD0A 3HZMB 3IS0X 3WQ6A 5HSFA 5KVFH 4CDGC 1FYTA 5D1QC 2EIZA 1NGXB 4LIQH 3SDYL 2WINB 5CSUA 3TV3L 3O3EA 5IFAL 2JCCF 2OSLA 2O9OA 4NO2A 3CDFA 4EUPH 2WVUA 4CADA 3I85A 3S96B 5F97E 4NQCB 4FQXB 1UT9A 1IM9B 2FE0A 2BNQD 2CO7B 4NSKA 5TGBB 4OD1H 4YEEA 3GHBH 3T0ED 1JNLH 4W7VA 3T0DA 5IP4A 4JL1A 1CK0H 3UTZA 5E0QA 1Z9MA 2E5EA 1HL8A 2OWCA 3RM8A 4Q9BA 4G43B 4NWTH 2HN7B 5GRUL 3HMXA 3VNYA 5FYJE 1W9UA 4WHYH 5HGBA 5TF1H 3IDXH 1HZHH 3TTOA 4Z8FH 2AGJL 1MH5A 1L9NA 2BOBB 1XCQA 4AENA 2UUDH 1U8IA 3RJDA 3WS6C 4FFZH 1HT6A 1HWGB 2GUOA 2WKGA 4G42A 3QCVL 2VXVH 5DRZA 1EMTH 4L9LA 4MNGB 5JHDB 4FOMA 2YPLA 5T3ZH 2XRAH 1OTUD 4MXWH 2EJ1A 1FBIL 3JTSB 1SMOA 5HHPB 1E6JL 1FORH 1YMMA 2MSPA 4O58L 2W91A 3MRRB 4S1QL 3NSXA 4JFHE 1W0VB 4JFPB 3FFCE 4HK0A 3D87B 6CGTA 1ZMYA 3ARSA 4P2OA 1I3RA 3AJ7A 5CEZH 2QR0B 5AY7A 2XWDA 3BHBB 1IC4H 2F53D 3BP6B 3MXWH 3P4OA 3WEOA 4QHNB 5IW6B 3G04B 3NPSB 5ITBL 3HA0A 4TVDA 2VLKD 1XD0A 3RWFB 2J88L 1U8PB 1C93A 3G9VA 1PAMA 3PBGA 3W0KA 4ZAKB 4HUWA 1SQ2N 3LY6A 5F70A 4LNVA 2F61A 2XN9E 5DJ2B 4G6AD 4MQXD