2CXGA

Cyclodextrin glycosyltransferase complexed to the inhibitor acarbose
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title X-ray structure of cyclodextrin glycosyltransferase complexed with acarbose. Implications for the catalytic mechanism of glycosidases.
pubmed doi rcsb
molecule tags Glycosyltransferase
total genus 233
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cxgA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cxgA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2cxgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cxgA01
4JY5L 1B3VA 4PGDB 1OHQA 4Z2HA 2EQDA 5JO5A 1ZA6A 4NQDB 4PTTB 4Z18A 4UQ3A 4NQDD 4L8CA 3FT3A 3TBVB 5DK0B 1ZJBA 2XKNB 4D71A 2G5RA 5DO2C 3IKKA 3O4OB 4ODBD 1YNTA 5DT5A 3I50L 4WI4A 1IGML 3HHRB 3V6OE 5I19H 1NAML 5IEKA 4A6YA 4KI5F 1MRCL 3RUGB 1CGYA 4JM2F 5T3XL 5CZKA 2QKIB 4LCUB 4W84A 2QBWA 3OAYK 4ZFGL 2H2SD 1FFQA 4QRPD 4WI3A 4DKAA 2IXUA 3O11A 3WKNA 4KHXH 4JO1L 3ARWA 4K7PX 1G7QB 5SWSB 4NRZB 4UI2A 5CSGA 4X9HA 1B0WA 4LVHC 3OJDB 1KNOB 2WC4A 4O58L 1WEJH 1W3LA 4Y19B 4LGXA 5IESH 3G6AA 5I18L 1UA3A 6FABH 5FEBA 4X9YA 1BJ1J 1DWAM 4HKZA 3WIFA 3RWJB 4WJ5A 2OR8A 2EC8A 5IT2L 1YYML 3U7YH 4ZO9A 5I17A 2AJ3A 3AMGA 4AXNA 1QWNA 1J1PL 3WNMA 1KB5L 3QWRD 3AS0A 1G7HB 1ZHBA 4LLDB 4QY8B 1BFOA 3L3HB 4H5SB 1YPZA 3B9KC 2NY5H 3VFWA 4ZUTA 5CXPA 3FB8B 1MCIA 4CGTA 3WUGA 3BUYB 5FM5O 3KLHD 1VKXB 1A1NA 5IHZB 3D0LB 3ZE2F 4FXLA 3U5YA 3CAFA 5E2TH 2PWFA 3RVUC 1RIUL 1TQBB 5I75B 4P46A 2J74A 2WBJC 1EK3A 1E6OL 3I84A 1MCRA 5I66A 2YLAA 4ZOCA 5E8EB 1TNNA 1QI0A 4M43H 1K2DB 3ZHKA 2IXVA 3GKZA 3MGOB 5TDOA 3VXRA 3T2NL 4HWZB 1UD8A 3MV7D 3O4LD 3V0VA 1QSFA 3C09C 1RJYB 1FGVH 1ZTXL 3VH8A 4NBXB 3T09A 2P8MB 3IFOA 5IKCB 4JFDA 4JQIH 3X14B 3I3DA 3WDRA 2KDGA 4YXLH 4LSQH 5FUCC 2JJUA 4R9HA 4WGWB 2FR4B 5ABHA 3FB7A 4HS6B 1F00I 3MS8A 1A14L 5IV2B 1WAAE 3QIWC 4NC1C 1Q6GA 4JFWA 3VD3A 2QR0B 3V6ZB 3VD5A 2BOCB 1WWWX 4ODUA 4TTDC 4NWTH 2BY0A 1MWAH 3RVTD 3WDQA 3JSSA 1CICD 2DTML 4LRIC 1AH1A 5HI3C 1OGAA 1HHJA 2AXGB 4Y5XA 5KVMC 2OR9L 2UZIH 2B2XH 3GI9H 3QHFH 5LAXB 5JXED 5L88H 1JDDA 3GO1L 5JHLL 1HKLL 1Q9OA 4XMLL 3MLSH 2WVUA 1QFUH 1D9KC 2CLVA 3GMQA 3VGEA 2WCGA 5FECA 3HE7A 4F79A 2D20A 3G9VA 2EBNA 4NO3B 1IL1B 2NY5L 1MCNA 3UC0L 1WJ3A 3FOLA 1DBML 3UBXG 5C0CE 3VIMA 4HH9B 4DCQA 4KRNA 3CU1A 4MNGE 4YFEA 2YZ8A 5EZJB 4L8BA 5BXFA 5KSBB 2NT1A 1HKFA 3W29A 1NCCH 2VDMH 1QHZA 2KPNA 4N0UA 3RM9A 4OZIA 2JIEA 4L4TA 4W86A 2NNAB 5ENWA 1BECA 1S9YA 3FT2A 4NFBA 3EUUA 1QNZH 4QT5A 4XBGA 3O45B 1N26A 2GFBB 4XNXH 1T1YB 2CSPA 4KK9D 2PWGA 2F19H 1PGRB 4YHYB 4RMUA 5FB8B 5BXPA 1TDQA 4X7FC 3HFMH 4PRPA 5JOPE 3OKDA 4N8CH 5D7LB 4MJ5B 3X3GH 4ZFOA 1G01A 3QHMA 2X4TA 1KG0B 5MEQA 4Q9CA 3QDGB 3JWDC 1I1YB 4LVOB 3FO1A 4JQIL 3MRBA 4NN5C 3D87B 4B0MM 8FABB 4YXLL 3VGAC 4TTGA 2AK1H 4XHQA 3WMSA 2MPAH 2ZSVA 4P9MH 4G6MH 2F5AL 3RAJH 1EJOH 3BZ4B 4JHOA 1U3HB 1TNMA 4GBXB 4PJ8A 1U3HD 4UU9A 4EEEA 4NKIL 3UXFA 3BISA 2EDWA 3MXVL 1F8TH 1QNRA 1BG9A 3ZO9A 4F9LA 3BO8A 3EKCA 4ZD3H 4XCCL 1ZB5A 1UXWB 2E7HA 2UZIL 3WENA 4JY6A 1A6UH 4WWID 2HT3C 3WO4C 5K9JH 2JIWA 5L88L 4LNVA 5DD6B 5AC4A 5T1MA 4WF7A 2XSBA 4KUZL 3PHOB 5JA9A 4HIJA 3MLSL 2HJLA 4UTBH 2HT2D 2E9LA 4OZHF 4GRWB 5A6BD 4G6AC 1N5YL 2E0PA 5DQDL 1FFOB 4ZOAA 1I7ZA 4BJLA 1PSKH 4H0IA 2VCAA 5I1IL 4MQTB 3W39A 3EOYG 4IDLA 1BBJA 1HJQA 1UJ3A 2D2OA 2OJZH 5IB5A 1U8PB 2BNQA 2WLZA 2BOBA 4MJIB 4ZSOE 1NCCL 4JFHD 4YAQA 3KPOA 3RX5A 3V5DB 1OT1A 4HF5H 1RULH 3STZA 2IMNA 4AY0A 5SX5K 5T1DH 3H7BA 1E3XA 4IJ3C 4Y89A 1FDLH 5CQ1A 3AS2A 3F6LA 3GGWB 3DHJA 2WC7A 5FYLE 3P4OA 4S1QL 3VFUA 2VL5B 5BV7C 2XN9B 1MLCA 3PGDB 4ZNEE 3CZFB 1WAAA 3KLDA 5I74C 1J0HA 1ACYH 3L9RA 3WUFA 3MRQB 4KMLB 2FEEL 3DGGA 5EU4B 2AMGA 3SDCB 2BVYA 4YHMH 1WZLA 4PBVC 2DM4A 2R2HB 4Y8AA 2HVKB 2D3NA 4ZYKA 4FS0A 2HJKA 3NJ3A 4BFBD 4XWGH 4AG4L 3ULVL 1XSKA 3UJJH 4G3YH 3SE4A 5BMFH 1KPVB 3RAJL 1CLZH 4S1RL 2SEBB 3JBG7 3KYOB 4I77L 1JYWA 1LWHA 1HL8A 1HSAA 4F7TB 1U95A 3S3PA 2X0YA 3CSPA 1WV7T 5GGQH 2DI7A 1P84J 5D9OA 1LP9B 1A6UL 5I8KH 3DROB 2B4CL 4TSAH 4MCYA 5FFLA 4U6XB 4MNGA 1BZQK 1DQQA 3LD8B 4OCMC 1WWAX 1IJ9A 4UTBL 5JW3L 3V4UH 3N85L 4ETQA 3EOTH 1FCGA 4H8WC 4DK6A 2XKUA 5HHVL 4KV5F 2AEWA 4PYHA 4ISVA 1HSBA 1PSKL 5DFWH 5LQBL 1E5JA 1J1XH 4PRHE 4UT9L 5D1QD 1E56A 3VNZA 2W62A 2OJZL 1YMMD 2BNRE 3L6FB 3VE0A 4LCWD 1LDPH 2VLJD 3ZSTA 3W37A 3HCVA 3S34H 1FVDA 4Q6IB 1F4WH 1S78D 1GH7A 3O9WB 1PZUB 4LKXA 3ZDZF 5C6TH 2F58L 5K33A 2NY1B 3RM4A 3EYFB 1UYWH 4HTYA 1FDLL 4Z7UA 3VGDA 4BKLB 3EO0B 5TQ2H 1CECA 5ISZA 4PUDA 4L4VA 5HHMD 4U3HA 4RNRA 1UASA 1A0QH 3TN0B 2A9MH 1ZV5A 5LJYH 1B3JA 4OZGE 1GAFH 4BQCA 1NDGA 4HKJA 4PJ9C 5EBMA 1JG9A 4AZ7A 5IR1A 4X6DB 1IQDA 1N7MH 1TG7A 3DETC 1QFWL 4ELKA 3C5ZD 5I1KL 4LP4A 4YHML 3KL0A 2VNCA 3QUYA 4OCRH 3SKUD 1AQDB 1KR1A 4K3EH 4Q9RH 3AS3A 4LQFH 4XWGL 4OD3L 3C60B 4UTAH 4KRUA 5BMFL 3GMPB 4G3YL 3QEQE 2DQFB 1CLZL 3C60D 2EIDA 1CD9B 1MF2L 3W6MA 4DAGL 2EDXA 4XCEA 1MCQA 4GI8A 2QF8A 5GGQL 1MVYA 1JN6B 1D6EB 1MHEB 2FGWH 4MA3B 4GG8A 5M7QA 3FQXB 4NNXA 4XPFL 4Y5YB 1NEZB 2WNGA 5I8KL 5JHDA 4HV8B 4JFPA 2UY6A 3TTQA 5CJ5A 1AO7A 2JIXB 4NPYB 2VDQH 4JFED 2N4IA 1CU4H 1ODAA 1LE5A 5A6AA 1YZZA 2C3VB 2CBVA 5DJCB 2ITDB 3EOTL 1WICA 3QNYA 4M7LT 4N8VG 2IGTA 3VKKA 2IUZA 1ZA3B 4N1EA 1KENL 5DK3A 1J1XL 3UTZA 5E24E 1H0GA 5IVNA 1N4XH 1XR9B 4O5LL 4PYSA 2A3BA 1REIA 4X8XA 4EVNA 3CH1A 3VGHA 1RPKA 35C8L 1HWHB 2JK5A 4F7CB 1OLLA 2O92A 5TDNB 3M1BA 1FHLA 3B2UD 1KGXA 1F4WL 4JDZA 1CIUA 1GL4B 1PG7H 3P3YA 1U3ZA 5C6TL 5JZ7D 3K81A 2E6QA 4YHNA 1R3JA 1PJ9A 1I9RL 1MH5B 2ZXBA 1S7RB 2YD7A 1CL7H 1OARL 2QSCH 1T04B 4PJAB 3T2PA 4HJ0D 2DSKA 2VR4A 3UCRA 4Z2JA 2A9ML 1RZ7H 2PO6B 1C93A 1A6WL 4FZ8H 3R4DA 1GAFL 3EZJB 2VTFA 4CMMB 1LEGA 2CO7B 3A6CH 3DRTA 5FYJD 3V6FB 1ZJAA 3FMGH 1IEBB 1NDMB 3AHZA 1CNVA 1KLUA 4YHKH 3KPPB 4QHKJ 4UILL 3CVIL 5MHSE 3NIFF 5IVOA 1WT5A 3MRHB 4PJDF 5C07D 5IBLD 5KN5A 4P5MB 2A83A 3C8DA 4XB8A 4EIGB 4UTAL 1DWGM 5INDA 1ORSB 3KYMB 4HXBL 5JUEL 1KULA 4HA3A 1Z5LB 5I73B 1YPZF 1L0QA 1G94A 3OKLA 1R3LB 5GRUH 1G6RB 5C8JB 4R7DA 5T5NF 3WFCL 3IU3A 3RDTA 1D5BB 1F5WA 3DYPA 2FGWL 5GRZA 1FE8L 3MRJB 4RMTA 1JPSH 3HI5L 5BROA 3N1MC 1C5DB 1B0GB 5BRZE 3A67H 3T65A 1OSPL 3D52A 2VDQL 3DMMA 3IJSB 5DRXB 1ZU8A 1CU4L 1KXTA 4M6NL 2OR7A 1NMAH 3O8XC 4X7TA 1OSZA 3GSVB 3AIWA 1LDSA 4XVJL 5HHOB 2VVNA 1DEDA 5E9DE 1E4WH 5HHOD 3EYSH 4DZ8B 3KJ4C 3MCKA 2YR3A 2YA1A 1EEZA 1IKFH 4Z78B 4OLZH 5KVEL 2BHUA 4YDJA 4YHPB 5KZ6A 3OA5A 2FHFA 2ZUUA 2ZKHL 3EYUH 4HS3A 4PJ5A 2EO9A 4E5XA 3E6FB 5JW5A 2D3LA 1EO8H 3QPQD 4MQXC 4OZGA 5D71L 3TZVC 1DANU 3BPNB 4PR5B 1WQVT 4ORGA 3TWCL 4JVWA 1RZ7L 1L9NA 1DVFC 4FZ8L 2EXYC 3U0TB 3IKCA 3MJ7B 1GVIA 3JWDH 2DKSA 2DQUH 3AXLA 4GAYB 2RQ8A 1S46A 3FMGL 5CLTA 3LHPH 4M62H 4Q2ZB 4YHKL 1Y6KR 4JFFA 5BXRA 3LN5B 2PWDA 2F54E 3NZ8B 4NQXA 4RAUA 2ZWLT 2NY4C 4U1SB 3VDAA 5IFAL 3L3IA 4PJGA 2C1PA 3ZKSD 5CIPB 5GSRB 2OMBA 1TQSA 4PRIB 2Q8BL 4D3CH 4KI5E 4PRID 5GRUL 1T0PB 4O2FA 4X6FB 5IDIA 1M6OA 4TSCH 3CH9A 1J5OH 4LHUB 3GH5A 4ODWA 1JPSL 4OZIF 2GCYB 1RZKC 3HNSH 2P5WE 4MB1A 5DJ8B 3RZCB 2F8OA 2VKXA 4PRNB 3RZCD 2R0LL 4Z76B 1JJUA 3EJPA 2NW3A 3ZO0A 3L5XH 3PWUB 5CEZE 2V3DA 4BQ5A 3HUJF 2DQDL 3WN5C 1SYSA 2Z91A 5EZOL 1QW8A 2ZOXA 2WPGA 2DLEA 3MO4A 3DX4A 1A9EB 4DKEH 3BCFA 1E4WL 4G8GA 3EYSL 3VFNB 1E4MM 3POCA 1R0AL 3VFVB 2O5ZH 4QHNB 3OGSA 1KBBA 1DTUA 1G9MH 5KSUA 3EYUL 4KQ4H 3MV9B 1UGNA 3DXAB 4N0FB 3DXAD 4DN3L 1F4YH 4HT1H 1I8IB 3JV4B 3FO9A 2R0KH 4Y2OA 4MNQE 1GUVA 3S5LB 1IAOA 1UEYA 3ZE2E 3HTLX 4LPWA 3NZHH 5BV7H 1OY3B 3TBWB 3UPRB 1N6QL 4M93C 3PN8A 3QDJB 3CFEA 4X80L 2BSTA 5DHYB 4AMWA 2V5DA 4HEME 3JWDL 4HBQA 4HLZH 4PCSA 3LRKA 1H8SA 3P4MA 1I7TA 1ZLSH 2DQUL 4EXKA 1WC7A 1K9TA 5B39G 4ACPA 4JRYA 4M7KL 2DLIA 1VEOA 1MYRA 2DT3A 2Y8KA 2R39A 2Q7YB 4G8IB 3MRIB 1EFXB 4P5TA 2O9RA 1FJ1A 1T1ZA 3BJ91 1FAKT 1NSNL 2ARJA 4PJXA 4R5EA 4QRQA 4W6XB 3F5KA 3BVNB 1T66D 5L2KD 1HQ4B 5CSYA 3CIVA 4XCNB 4JL1A 1QWUA 4P23C 1SM3H 3UTSB 2ED7A 1I1FA 2H6PA 3UTSD 4GAGH 3VNYA 3GSWB 1J5OL 2E7CA 4K8RD 4XBPA 1WITA 1JI1A 1WFUA 2X42A 3HNSL 4HDIA 5DJ6A 3TYGH 3NYDA 3PL6B 1GNXA 4WWKC 1LLOA 4CD7A 2GSIA 4X5WB 1EOMA 1RZ8B 3B9VA 3TBYB 5EFIB 4H8WH 4CD8A 4DGYH 4C56D 1M71A 4RFNB 1E4IA 3IGAB 5F7DA 3HLAB 3BN9C 4Y2DA 1BFSA 4DKEL 4TOYH 3BVXA 2A6KA 5HVFB 1MIMH 1GZQB 3WUWG 1U3JA 2YD2A 2JF7A 4HQQH 5IMMB 2R29H 3VSTA 4AD5A 3EYPA 5FKAA 2FO1A 4YR6A 1CLOH 2GUOA 3NN8B 4HT1L 4EKJA 2DQTL 3KXFD 5F3BB 4GRLC 1J0JA 1G9HA 4M1DH 1KELH 1U93A 4JY4B 5A3HA 2ZG3A 4HA4A 3GJFH 4KKCC 3NZHL 3CFDB 4K3DH 5BV7L 1KTLA 1T22A 2J8UB 2VZTA 5C0GB 3O2DA 3PXHA 1NBYA 1I1CA 1Q72H 1MFUA 2CYGA 4MX7B 5GRVK 3C8KA 3G9AB 3BFOA 1JNEA 3NGBB 1W9UA 3ALGA 4L4OA 5D2NA 5GS1A 1KJVB 1IC4L 3C08H 2WZHA 2WW8A 3BKYL 4RQQB 1YEDA 2G4FA 2WMGA 4UOZA 1X9QA 4WV1B 1JWSA 1M05B 4MWFB 5HYSA 1I7RB 1MRDL 4AD3A 1BQLL 2FZ3A 3ME0A 2G60H 3S36H 2VN7A 3OKKA 3LEYH 4NO5A 4Z5RA 1J8HD 3UR7A 4GAGL 4JZJB 1SZNA 4LARH 3GM8A 5ECJE 5EU6D 4QRSB 3OKMA 4H7VA 4M24A 2AJYL 2HN7B 2W63A 3FO0H 4ZUVA 2X09A 4G80B 1TXKA 4H8WL 4WSKA 4LVNB 4AEIL 4I0PB 2D0GA 3VXTB 1G7PB 1RUAL 5LGKA 2H8PA 3SDDB 3O0RH 2IAMC 3SDDD 5AYIA 4TOYL 3PHAA 2F74B 3MRPA 4RSVA 1WCQA 2WIIA 4MXVF 5F70A 3TYFB 1RAMA 3KL3A 2QLYA 3S6TA 2QQKH 2ZG2A 1X4YA 3QEQB 1HXYB 3FAWA 1W9BM 1AGBB 3DTXB 4OZHE 4K7FA 3MLTA 3AIQA 3BN3B 1CLOL 1J0ZA 4BH7B 1CFTB 5DJ2A 1OP3K 1CS6A 1OCQA 4M1DL 4PTWA 3ULUC 5E56A 4GW1B 1FBIH 5KBNC 2VB5A 1KCVL 2LVEA 4PG9A 5JXAH 3OR7A 2XY1A 4K3DL 4RMVA 2CETA 1HCFX 4S10A 4RMQA 2CCRA 3ARBA 1KFWA 4JFYB 2Q3AA 3DX9A 1UR9A 4J8RB 1NOUA 2VXQH 2AKRA 3UEQA 1MW2A 3Q3GA 3VFRB 3C08L 5DZLA 5F88B 4TUJA 1JPFB 5F6HI 3S5YA 4QXGH 3WH9A 2BFGA 1ISXA 2EH8H 2AERT 3GMOA 1R24A 2XN0A 3AI0A 2ZX5A 3I3EA 3A47A 1GVYA 4KPHH 3J8F7 2BSSB 4OUUA 4LAJH 5DC9B 1GOFA 2G3NA 1BJ8A 2X7LB 3MBXH 4Z77A 3WELA 4MD5B 1ZT7A 3SQBA 5E1AA 5A6MA 3ZTJG 1I1AA 1NFIB 4KRTA 4M5YL 3PGCA 3QIBB 1T0NB 3FO0L 1TLKA 3WLBB 3QIBD 3T3MF 3TF7C 3D48R 2J25A 4WHYG 1KFAL 3RZWA 3O0RL 2V5YA 1MCLA 1QA9A 4OD2B 1LK2A 1M7IA 1IGIH 5C0AA 5A2IH 1AIFA 4OLVH 1NCTA 2Q76B 4GUPA 4IOFD 4POZC 1XYFA 3EOAB 3QSKB 2UUDK 3BHBA 1BOYA 1S7XA 5AD0B 4KV5E 3MRMB 3HS0A 1TVDA 3CUPB 4DUVA 4PBXA 4PMZA 3SOBL 2R69H 5DUML 4KK8C 4YC2B 4PGBA 3HB3C 3NDZA 2GIYA 4QRRA 2FYYA 3BDYL 5DMGC 3U0PA 4PMNA 3JWNC 3QXDB 4V1DE 4PV8A 3VFOA 3JTSA 3SDAC 1OAQH 1B3WA 5MERB 4OGZA 5IJKA 3BW9B 3ZDZE 3D85B 3ARDC 4RMWA 2ATPB 2VXQL 5GGUB 3MACL 2AABL 3IRZA 3C9NA 5CPTA 1XIWC 2BVUA 5ABFB 2OMNA 1ZSDB 2FL5A 5A3IC 1MNUH 2KZWA 2XTJC 2YZ1A 3GSNA 2FHBA 2V9RA 1UWXK 3CMJA 5AYQA 4QXGL 4P7OA 1I4FB 2EH8L 2PYED 3CXHJ 4CUCA 3M7SA 3EJZC 3EZ8A 4D0BB 3L3OA 4YXHH 5J0BA 3MNVB 1AQKH 2WCSA 3VCLB 3OWEA 4WVRA 5C0NC 2J7BA 3KLLA 5EBWA 1OWWA 4IRSA 5F1NB 4EI5B 3C6SA 3L95A 3LQAC 4EI5D 1WZKA 1MVFA 1FC2D 4XP9H 3GHBL 4E41A 1G6VK 5T3XE 3IFLH 4KK6D 4YHEA 1GOGA 1N8ZA 1FNLA 3DVGA 2FJFA 3VIIA 5JLZA 3RILA 2O5YH 3FTGA 4PG2A 1A6TB 5A8OA 1CEOA 1D3CA 1IGIL 4YHOL 4OLVL 5ERWA 1Z32X 2OBGA 1FH8A 4H26B 4N0CD 5A8NA 3HKFA 3BIKB 2ICEB 3AU1B 1FOBA 4JM2B 2ALWA 3BGFB 3KPNB 1HXJA 4B50A 3MX0A 3HJEA 4E2OA 4OCXH 1QQDA 1L4IA 1IT0A 3P4NB 4ONHA 4UB0H 7A3HA 1FO0H 4PMVA 4XH2B 2V6HA 1HIMH 1X7QB 4OCYH 2P5WB 1OINA 3QUKA 2V2WB 43C9A 4QKXB 4CVZB 3O3EB 4H04A 2XFXA 3BEVA 1UM5H 4MJ6A 1HJUA 3SDYH 5L9DH 4NC0B 2UWFA 4MXWL 4UT7H 2XZZA 1YEKH 1H4PA 4KRLB 2OSWA 1QACA 1FHGA 2PXYA 4P3DB 4AIZA 1FIGL 3QAZC 3OMZA 4JFQB 1WBYA 5DI8B 3ZT5A 5IW1A 2CITA 3V95A 1V3IA 5DJZA 4OGAD 4GZIA 2AAVA 3WJLA 4ZXBA 4E0RA 3GSQB 4Z7NF 3WHXB 5I2IA 4UT6H 2Z92A 4Y88A 4YXHL 5TE7H 1Q6CA 1JZ3A 5HHQA 1R34A 3O2LA 2NY6D 4KROC 3REVB 5F7EL 2Q6WB 1AQKL 1AQHA 3U2SB 4S11A 2EDNA 3ZJ7A 1Y6MR 1RZKL 3NIFE 2JALA 4PJDE 4A2LA 5FYKD 1WDSA 4E8DA 3FKUS 3SO5A 3QUMB 5I1LA 4KK5D 2WHJA 1OW0C 3TA3A 4R2GC 5DD5H 1BF2A 4XP9L 1BVLB 3BPCA 4LCCA 1WCGA 1R3HA 2YXFA 1J9CT 4OZFA 3WD5H 3W11C 4PBWD 3MRNB 3K1DA 1X6NA 5BZDB 1E72M 1BFTA 2DD8H 2O5YL 3P77A 1W0VB 1R5WB 4PJHA 4LPTA 3RWGB 4PRBB 2KH2B 4UZUA 5E08H 5H2BB 1PZ5B 4LGPB 3IJYA 5D1XB 4YDLB 1P2CA 1G7LB 4K2UH 4QHLB 3OG6B 3GK8H 1E27B 4GKZB 5IB4A 1H5BA 3NTCH 4FNTA 1P4BL 5IJVB 1TVHB 4U7MA 5CZVL 4MA7L 3MZGB 4PJXF 2BVQA 4XI5C 1UB6B 3BUTA 2FJGB 4OKVB 4JRXE 3U48A 4OCXL 5SWQA 2X4PA 4UB0L 4A3YA 4OCYL 5D1ZD 1A3RH 1CZ1A 4EZMA 3D3VA 3ARPA 5HD8C 3IAQA 4PREB 1QW9A 1NQ6A 5F9JB 2HH0L 5L9DL 3GJEB 2P5EB 1ZT1B 5E5MB 3QXAA 1E4KC 2EE6A 5MENB 1Q0YH 4PSRA 4PJIA 3QDHA 3PTKA 4G9FE 1NC2A 2MKLC 4NQUA 4JDVA 2IMMA 3IDMA 2G3JA 5C0JA 2HVJA 3MO1B 3ECBA 3HAEB 5HY9A 4UT6L 4OUEA 2COQA 1MY5A 5A2LH 5TE7L 5BJTA 1JF1A 1H3PL 3Q6FA 3AHXA 4PGEB 3STLA 4TSBL 3ZLQC 1UKQA 3O4OC 4P2RE 1WZ1L 5ICZA 1MVUB 1FSKC 1TTFA 4JN2A 1RUKH 2J79A 3HG3A 2WP3O 3U36B 4FXGA 1OB1B 5CMAB 1UXSB 1X5FA 3ARSA 2IPUK 5DD5L 2DQXA 4OGYL 1E4XI 4DJMA 3WD5L 3TO4D 3AZRA 2YBRB 4XP6H 3H9ZA 3L3JB 2AQ1A 3DX1A 4GXPA 3RGVB 3X11A 2Z93B 1X5JA 4WTXA 3VXUB 4UQEA 3RGVD 2X1PA 1JAKA 2X2HA 5SV4A 2DOCA 2R1WA 3BYYA 5E08L 1K8IB 2CEQA 1DUZA 3KDMB 3H9SE 5C08E 4RMRA 2VLRB 2C7FA 4EUPB 4DM1A 3RX8A 2VLRD 4XAKD 2XVLA 1H49A 4KUCF 4R3SA 3GK8L 2A6JA 3HUJE 4XNYH 1NEZG 3O41A 3OF6A 1ADQH 1MCKA 1GSMA 3VPLA 1P84K 1U42A 1Y6NR 1MCHA 2HRPH 5FA3B 1MI5E 4I5BA 3EJJX 4JPIB 3VIKA 3KLHC 3N13A 5FUOH 4K7PH 4U0RB 3TVMB 2XPGB 3MA9H 3GB7A 4B5EA 5I16A 4HUWB 3C5JB 5HHPB 1K4CB 2CH8A 3BZEA 1WWBX 1Q9WA 3L3DB 2WBWB 1Q0YL 1TQBC 2W60B 5I75C 4HZLA 2AS5M 4J2XA 5FCZA 2X4RB 1U8KA 5EORH 5CWSB 3ZYZA 3QDAA 2BDNH 1TE1A 3ROOA 3MFFB 1V02A 4I13B 4LPYA 3L5WB 3BP7A 4M3JA 4YDKL 4OZHB 5FGBA 3T0WA 4NM4H 4P2QA 1VEPA 4PRAB 3L7EA 3V79C 2D1ZA 3DVFA 2CMRL 5B3JF 1SJEB 2W65A 3IF1A 1BIIA 1G0YR 1MRFH 1BD2A 1ED3B 1RUKL 4KGJA 2BJML 4U1GB 3T0ED 3T1FB 2WKGA 5IVZA 3P30H 1D5IH 3SE8L 2HISA 1I9IL 1CG9B 5E8PA 3WIHA 2P8PB 4RRPA 1CE6B 1DN0B 1NGYA 1XCTB 4WFHE 4YHIB 1U2YA 1S9WA 4TX6A 3TNMA 4S1SH 3O2WH 3UDWA 3GUTB 1JRHH 3SGDH 3WH5A 3HG2A 1IM9A 4XVUD 4JHAL 3ULVE 2EDHA 1QRNA 3LMJH 3MRFA 1A7QL 2ZPKL 3KPSE 3WF4A 4JCLA 1WBXA 5BRPA 3EGSB 3LZFH 1NCDH 2NW2A 1BIHA 2DKMA 1D5XA 4WEUD 5C0DB 4WHTA 3UTTA 2FSEB 4JLRB 3V5HB 4XNYL 3ARVA 1LEIA 1AKJA 3NCBB 1XF1A 4JZNA 2GK0A 5E8OB 2AW2A 3ULUL 3CVHA 1RIVL 3RY6A 2DYPA 1V6WA 2X4UA 1IQWL 3VW3L 3D4YA 1QO3B 4MB3A 1IGCH 3TIDB 1KGCD 1NP2A 2BY2A 3NCYP 5DRZB 1T1XA 4NRXB 3G08B 4K7PL 5EOTB 3SCQA 3LPOA 3KPLB 1ZVSA 4PMUA 4Z7VA 4M9OA 4NYLA 1GOWA 3FNDA 1HINH 5DEGA 2AP2A 3BP6B 5K9KA 4AZ5A 3O3UN 5EORL 5ABGA 3QXVA 5DMKB 1N2RB 1KEMH 3CO4A 2VQ1B 3F62A 5C70A 5GGSY 2BDNL 4P7LA 5HPMA 4AK1A 4YHYC 3AMCA 3TCXA 4ZXLA 1AHWA 1UWRA 1JWUB 4XCFH 1EAPA 4E8CA 4CAGA 2YMXH 4ZPTA 3SPVB 4MAVA 4LVOC 3LQAH 3P30L 3WQVA 1JZ4A 1D5IL 1L0PA 1T1WB 3CFBB 2MHAB 4LOUC 2YUWA 3BIAX 2IH3B 2AJZA 4TN9A 4TNWK 3OLEA 3DC0A 5A94A 1XD1A 4S1SL 3O2WL 3R06B 4U6HA 5DHVB 1U3HC 4GBXC 4W4OA 4GRMA 5KANG 5HYEA 2DI9A 3LB6D 5FCUH 3TJHD 7TAAA 2J4GA 4PUEA 1B3YA 1ROWA 3LMJL 3ZT6A 2OYLA 2XKSA 3AUVA 3EYOB 1DE4A 2V3FA 1K5NA 3SKMA 3WFHB 3NBNA 1NCDL 2G5BA 1QNSA 3IFNH 4EN3B 2HA1A 1AE6H 4LHUG 4Y1AA 3QEGH 4AMXA 4EN3D 4G7YL 4GG6B 4KAQH 1C91A 5ELIA 1JFHA 3P9LA 4DZBA 3P40A 3LPFA 5BXTA 2HT2C 1YUHB 4UINH 4C7GA 1JHTB 1OT2A 1U8MA 2Z8WC 1W8NA 2R8SH 2BNUA 5AZ2H 4PJ7A 2YC1A 3D39B 5KSAB 4NFCA 4DKFL 5C09D 3SGJC 1Y18A 2CJUL 3D39D 3TNNA 4NRYA 5GISL 3UERA 5EWIH 5E4EB 4TOQA 4FRWA 2BVOA 2HFGH 4E42A 1DQDL 2I07B 3MLRH 2VOTA 5IROC 1HINL 3KLAA 4Z0BH 1U2CA 3OV6A 1TFHA 2YPLD 2CRZA 2YXMA 4YIQB 3SDXE 3S3SA 2A1WH 1HVXA 1KEML 2VZ1A 3AOFA 4J4PD 1FLRH 1RJZB 4QHKI 3N17A 5DK2A 4NBYB 2DDXA 1MCJA 1NCAH 2A3HA 4JPKH 4L8CB 4UQ3B 1OLZA 1EZVX 3NMEA 3VGFA 4DGVH 3S5LG 5IGXH 2G3IA 4XVTL 4XX1E 3MODL 1TJIL 3HC4H 2ZX6A 5A8MA 3IJ7A 5KTEL 1YNTB 5C0IB 1AR1C 3RHWK 2XWTB 1EEYA 4P2YA 4N1HB 2DT2A 3LQAL 4FQPA 3SDCC 4A6YB 3QIUA 5TH2A 4IDJH 1KB5B 2P45B 3O6FA 3ZDYF 5DQ9A 4BFEA 1TVBA 3IXTA 2VDLL 4MQ7A 3ZKXB 1J88A 5T3ZL 3F58L 3BD5A 3C6LA 4P7QA 1PX8A 5LA2A 3O11B 2B1AH 1SFSA 2D9CA 1UJTA 2DKUA 2XFYA 2GK2A 1I7UB 4NHCL 4EDXA 3BLPX 5DRNA 2DH2A 2D0HA 4FFZH 1KIQB 2FDBP 1A7RH 3EYQC 3BPLB 3QCUH 2DLFL 1N3NB 4OUOA 2WKLA 5A6SA 2Y1VA 2AQ2A 3WSUA 4L8SA 3IFNL 5AYBA 3CZGA 3AREB 1XSJA 4N9GB 3I75B 2FH8A 4PIRF 4WJ5B 4OSUH 4MD4A 2Y07L 5DS8A 4OQTH 2XTLA 3LD8C 2AJ3B 4PJDB 1Z2KA 3MBEC 2R8SL 5GZND 1ZHBB 1TQTA 3G6JF 2L7UA 3QXWA 4U0QB 1BFOB 4X9GA 3NSMA 1MFEH 3PGFL 5I15H 5DFTA 1EMTL 2G41A 2QPSA 1YPZB 1WKYA 3MNWB 3WY2A 3VFWB 1Q38A 2BCKA 3SHSA 1UR0A 1DDHA 5EWIL 1F2QA 3HE6B 3T0BA 2HFGL 2EYRA 5D7IA 1UKOA 1KTRL 2YK1H 3MLRL 3RTQD 4AJ0A 4BZ1H 1DBBH 1S3KH 3MXWH 3DRQB 2D03H 1S78C 4M8QB 2FIKA 2BY3A 3OAYH 4KKLC 4Q6IC 4J12A 4Z0BL 3O9WC 2UVEA 4LP5A 4P46D 4PRWA 3OGOE 5EBLB 1ONQB 3PZGA 3QOKA 3K2UL 2NY1C 2Z31A 2EO7A 4WY7H 1NCAL 2VX7A 4GW4B 3T4YB 4O51A 3OB0K 4J1UA 4DGVL 4PJHF 3TN0C 5IGXL 1RIHL 5J13B 3HC4L 5TDOB 2P48B 3V0VB 1J01A 2V3GA 3VXRD 4WU7A 1F2XK 1QSFB 3GRWH 4PN2A 4PMXA 5GNXA 5DURB 5BRQA 4AZCA 1QSFD 1XZ0A 1EUUA 3IFOB 5J9PB 4JFDB 4R8WL 2IGFH 2XN1A 5ID1A 3CC5A 5D9SA 1OTUD 3F7YB 1U58A 5FUCE 4NUJB 3WD2A 3FB7B 1AXIB 3C60C 4ZOBA 1MFAH 3WCYA 1UB5B 4NC1E 1BX2A 2J7FA 2DMBA 5EC2B 4ZTPL 2QEJA 1MQ8A 4FFZL 4KZDH 4ZAKA 4G9FB 4ODUB 3UO1H 1MCOH 3ZKMC 2CBJA 5IB2A 2RAMA 1OGAD 4AZHA 4Y5YC 5EO9A 4AT6A 2Y8VA 5KS9F 4PJIF 3RVWC 5EN2B 4HGWB 4X7CC 2NY2B 1C8QA 4OSUL 4P2RB 5KG9A 2CIPA 4OQTL 1QLFA 4FTVE 3VXSE 2CLVB 2QADD 4QXTA 3U30B 1KPUA 3V6OC 5FECB 3HE7B 3U5UA 5CP3H 1G1CA 1LEKA 1ODUA 1AGCA 3HE7D 1L6XA 1WZMA 2ICWB 1V6VA 1NMBL 2IPTL 4KXZI 4DCQB 4WI2A 3VDBA 3QGVA 1RH9A 2G75A 1L0XA 1ZMYA 1HH9A 1QKZH 2P43B 4UV4L 5TE4H 2M8XA 3T8XA 5M3WA 3BC9A 1DBBL 2NYYC 3MXWL 3OKEB 4Y4HB 4OZIB 2D03L 4L4TB 1TZHA 5ENWB 4L4TD 2GJZB 1S9YB 4H1LH 4WUUE 2C0HA 2XACC 4QT5B 4XBGB 4ZFFA 2A3EA 1MWAB 3N11A 4ONFH 3P0GB 1MHHA 4WY7L 3VFPB 3HUJB 2PO6C 3SKOA 1ZXQA 3LVEA 5ITFA 1FZKB 3MLVL 2EIZB 4PRPB 4UDTB 1QPKA 3OKDB 1VFUA 2YD3A 4U1JA 3GKWH 3QWRA 3ZTJH 4M00A 5IB3A 1Q8MA 5MEPB 4U1NA 2IANE 2W9EH 3IJHA 1MI5B 2OI9C 3KR3H 3FO1B 4Z7NE 4XB3A 2WSPA 4RA0C 1JNLL 3F8UB 2EPKX 4Q7DA 1UKSA 2ZUYA 5ID0B 1ZT4A 3OPZH 2ZSVB 1MFAL 2L4OA 3MLYL 4Y4KA 3MJGX 5I73C 5JW4M 3AHVA 2LU4A 5DUBB 5CS7A 3UO1L 4XPGH 1CDJA 4BF7A 4PJ8D 1GIGH 1EIBA 5JOFA 3BXNA 3BO8B 4H1LA 3EJSA 4OGXH 4FQ1L 4JY6B 3CK0H 3VILA 3O3BA 1VADA 2OTPA 2UV3A 2N56A 3VMOA 1FV1B 3O4LA 5I1AB 2QQLH 3IAPA 3VD7A 3WQWA 4HIJB 2AEIT 3AIEA 4UAOB 32C2A 4U1LA 2OYMA 3FRPG 3EO9L 3UG3A 1S9XA 4X7EC 2QLVB 4XPAH 3CMOH 4MQSB 3WNLA 3QEUA 4NZRH 2DQHL 4XBEH 3VXOA 1I7ZB 3BRDA 2EZ0D 2WBJA 2XY2A 1OAYH 4JDTH 1V3JA 4LLYA 1LO2H 3GBMH 1UJ3B 2PYFB 5IB5B 5TE4L 4V27A 5L2JA 2BOBB 1D7FA 2BNQD 4IM8A 4MAZA 4YAQB 3KPOB 4G8EA 3STZB 1HNGA 5TF1H 1T6VN 2A0LD 4OBRA 4M29A 3BPNC 4HFWA 1OTTD 1TETH 4JRWA 5HYJE 1KPRA 2ORBH 3GXDA 1ULVA 3G6MA 4UFIA 1YQVL 1CDHA 4DQOL 1ZBKA 3VFUB 3GKWL 4LIQL 1J0IA 4XC3H 1MY7A 2W9EL 3L9RB 1DFBH 3TIEB 2EDBA 3KR3L 3K8KA 4ALAH 1L7TH 3IB4A 4K23H 3DGGB 4DW2H 1TFVA 3MUAA 3NSXA 5K59F 4HW6A 5C3LD 1H8NA 3AYSA 3VA6A 4ZYKB 2HJKB 1IGTA 3W0WE 3MRLA 3QFDA 1FH5H 4JKMA 3DURA 3VIPA 1E6JH 2E7BA 2VISA 5I3DA 3FQTB 1WIPA 4LKCB 1BJMA 1TTUA 3GI8L 4XPGL 4F2MA 1EX0A 4QRUB 1D9KA 4D0DA 2VITB 4X6BB 4HOZA 3H42H 4OGXL 1TZGH 1JPTH 4GO8A 3CK0L 3VGBA 1CFQB 3F7VA 3QFJA 5SX5H 4KTEH 4OM1H 3RZCC 5HVHB 2Y72A 2VO5A 2NX5A 5F72S 3VX1A 1DQQB 1GGBL 1N0LA 4JL2A 1YEEH 5L6YH 4XPAL 3LSOA 1BLNB 4ETQB 3H3KA 4NKMA 5BYWA 4B9ZA 4UNTA 3ZDXF 2YFOA 1OAYL 4JDTL 1FYTA 1LO2L 1G7JA 4RFEA 3VE0B 4FK9A 4YBQC 5LGJA 3RL2A 4CN1A 1JPGA 5TF1L 3S2CA 2WQ8A 5SWZA 5MI0B 3AXHA 4LKXB 1TETL 3U0WH 3OL2A 4LSPH 1FA2A 2NLJB 2BERA 4YFLF 5J8OA 3RWEB 5ISZB 4L4VB 4RX4A 4RNRB 1EPFA 3WDIA 4L4VD 5ISZD 1LO4L 1KLGA 1BGXL 5ACZA 1NDGB 4HKJB 4CVXB 5EBMB 1WUNT 1BQCA 1CK0H 4XC3L 1BFVH 3WUEA 1CZ8L 1C3FA 4ODXA 4K23L 4DW2L 3WV0A 2DDQL 1V3MA 2DICA 4OIIL 3N50A 5C7XL 2JELH 4ZOEA 2DQEH 1T66C 4RWYH 4BZYA 2WMHA 2DL2A 3VWJB 3PZMA 1H15A 3QUYD 4HOWA 1Q9LB 3CXDH 1FH5L 3LPGA 1TQCB 2ADFL 2VL4A 3LEXA 2I9TA 2WAGA 3U4BL 3QT2A 5TD4A 2EDLA 4ZUWA 4KZEL 1WK0A 1GOMA 1S7QA 1G7IA 4XCEB 1W0WA 1SYTA 4MNJA 1RK0A 1RPQA 4G42A 4U3AA 3CXHK 2B7DT 4K8RC 4EQ3A 3L1OL 3U6RA 5BOPA 1DUYA 1RK1B 5CGYC 5CSBA 3WD4A 1TZGL 4NNXB 1HOCB 1JPTL 4RGNB 5GS0C 3PL6C 4F7PA 4JFPB 4QOKE 4OM1L 4RGND 5JHDD 4H8VA 5ANMA 5E2VL 4P57A 2LU7A 1AO7D 4RFNC 1JNNH 3NIGF 1YEEL 3ZE0F 2FECL 1I8LC 5E6YA 3E6HB 4CDGC 1AP2A 1EHAA 3M45A 4OIFA 1YY9C 3UTZB 2E9WA 4ZO8A 5EH1A 3GDBA 4BFGA 4QHMA 3CH1B 1JGIA 3NCJL 4DN4H 2JK5B 3AMLA 4UOW0 4LFHG 4JO3L 5CJXA 1GYAA 5DA4A 4JDZB 1JXJA 5IW6B 1BMGA 1UG9A 3K1KC 1RZFL 3U0WL 1CGSL 4LSPL 5E4IA 1SJHB 3LKRA 5FO9A 3HG1A 1II4E 2DQJL 5I6XB 2OCFD 3DVNA 1U0QA 4H8HA 3ES6A 3D25B 4XT1C 1INQA 3S37H 1BFVL 3WY1A 3MGTA 4PB0H 4Z95H 3KPRB 3NGBC 1KLUB 1BVKB 4OAWA 1ZGLA 1V7NL 2DQEL 2GT9A 4GKOA 2BMKA 2DH3A 4RZCA 5KN5B 4WV1C 2IPUG 3QOMA 3CXDL 4KJYB 4PY7A 5CKAA 1NCBH 3MUGA 1MCPH 4XZUB 3HAEG 1HN1A 4P4KC 4IHOA 1UD6A 1B31A 1R85A 2X4OA 4LAQH 1T83C 2ZCKH 1JNHA 2HG5A 3IU3B 3RDTB 1TQVA 1OAXL 3RDTD 2FEDD 3SUUA 4C4KT 3F5LA 1EEQA 4I2XE 4L5FL 3T65B 5DGQA 2AI0L 3V5KA 5B8CB 2P8LA 4GLRH 4IIQA 3PE9A 4LVNC 2AJUH 4HIIB 3DMMD 4I0PC 3C5ZA 4Q97A 3MUIA 2BNRD 4LCYA 4NHUA 3SDDC 2J78A 1OSZB 5CJQH 3DUSA 1J0YA 1BPLB 1QNOA 1CGUA 4YQXH 5IWLC 4EAMA 3DNKA 2A9NL 3EIFA 3UTOA 5I8CA 4AEHH 3NCYS 4YDJB 2ZUVA 4EUPG 1VACA 4UMGA 4HS3B 1X5HA 4UIKH 3KLKA 4PJ5B 2CXGA 4E5XB 4PJ5D 4CMHB 4D9LH 4EDWH 1QI4A 5K9QI 4L3EE 5TE6H 5IHLB 5JTWA 3G5XB 4PJ9A 4HZ6A 3X17A 3MOAL 2J6EL 2HLAA 4W6WB 4ORGB 3AIVA 5EUOA 3LPPA 4IMKA 1K8DA 1GJWA 2RCSH 5D2LA 2QSTA 3A4AA 5FYJH 4M6AA 4JFEA 3CIQA 4NT6A 4U4BA 3VXSB 1FHDA 5IF0A 4PMOA 1CYGA 3AXLB 4AENA 4Z7QF 4Z95L 3QZWB 4GMTH 5CD5D 1MCFA 3LS4H 4JFFB 5B3NA 2AQ3A 4JFFD 5I1GH 5LCVH 4RAUB 3BD4A 3L3IB 4P5KA 2H45A 1GZJA 1NCBL 4ML4A 4X4YB 4D6IA 1MCPL 2UY7A 4FG6C 1BQUA 5DWUH 1QBMH 3ZDYE 4WUUB 3KWWB 2I24N 1DWHM 3PV7A 5IM7A 3ELAT 2X1OA 4UZGA 2V5TA 4ZUSA 5DVNA 5FYKU 3QNXA 1CDGA 3OXSA 5D9NA 1QEWA 3GM0A 5D8JH 5FO8A 3MUY1 4AYFA 3LKQA 4PGJA 3LN9A 2APXA 1MIEH 2UWEA 1F6AB 3QIBC 1SEBB 3DO7A 2C3GA 4WKHA 5I8OL 2AJUL 1ZLUK 2IANB 2MWCA 3AISA 3VINA 5A8QA 5KOVC 4K3HA 3UZEA 1PQZA 4QF1A 5GGRB 2DM7A 4G8GB 3MCG1 3GNPA 4R4FL 1BG4A 1ZLWK 4NKDB 2CNCA 3FFCE 4HFUH 1T89C 3G6JE 5HGAA 5F9DC 5LVEA 5HPOA 1ISWA 3BKCH 3V4VH 1XGUA 4EDWL 2KUTA 2GQHA 5TE6L 1E0OB 2MCPL 3FO9B 4F58L 5BO1H 3EDDA 2GJ6E 4YC2C 4NNYB 3LKOA 3H55A 1IAOB 4XP4L 4CVWA 2RCSL 4JO2L 2ZUMA 3WNKA 3FQRB 5GSVA 1IAMA 1KJMB 2OTUA 4Z7WA 5AYUH 3CFEB 2FCBA 2BSTB 4ZQKA 5ABDE 4NSBA 1YN7B 1FZJA 5MHSD 5CCKL 1I7TB 3V4PH 1F3JB 2ZUQB 3BAWA 1W1TA 1K4DA 1G0XA 2AXHA 4GMTL 4JRYD 3LS4L 4P5TB 2JEPA 2ARJB 4PJXB 3RKDD 3IVKB 1U8JA 3HI1B 4KVCH 1T3FB 5JR1L 2IALA 4OF6A 2V3EA 3ZSSA 3QR2A 3B5TA 1G6RL 5C9JA 3DX6A 3UG4A 1NMCB 4PRDB 1XCQA 2MMXA 5DWUL 1V08A 3WNOA 5E2WL 1I1FB 4GOSA 4FZEH 3IGUA 3FFDB 4YK4B 4EI5C 3KS0H 4U5KA 3O8XA 1W9VA 1P7QA 4U1KA 4KK6C 1MIEL 3QG7H 4LYQA 4HK0A 1P9MA 2GSIB 1T7YA 4L4JA 5CZXC 5E9DD 2YUXA 4PJCA 2JFEX 1GPOH 1VCAA 1UWGH 4HPOH 2OP4H 2D4FA 2HFFA 1A3HA 1M71B 3SUSA 4PS4H 4CJ0A 3D6GA 4D9QE 5KS9E 4Y2DB 3REWA 3G6DH 3SGEI 1Q94A 4OLUL 4M6OH 3TZVA 5JDSB 2AEPH 4QYOA 2EEXA 3I6LE 2EDEA 5M95B 5GGSA 3Q0HA 4CU7A 2EXWD 5D7KE 2OX5A 4KI5C 4PLNC 4JM2C 4S1DD 3BGFC 4C83B 4BK5A 3V4VL 1CGVA 2GUOB 2EKSB 1W91A 1DVFA 2G2RB 5EU3B 4LRNH 1FIEA 3BT2L 5BO1L 5SV3A 1HF6A 3ZOAA 1PYWA 1C90A 2AEQL 4PUBH 4CW1A 4M6MH 1AQMA 3OGRA 1T22B 1CQKA 4LEOA 5AYUL 3MROA 3OXRA 1MQQA 1XGYH 1HP4A 3CFJA 1NBYB 2FD6H 3RY4A 4HLJA 4KC3B 1GHSA 5D96B 1PX3A 3T77B 3W81A 5C0BE 5FDYA 4O9HH 5DJAA 5D2NB 2AJXH 3H2WA 5GS1B 4XV0A 2ADJA 2I60L 5F7KC 5I8EB 1HIZA 1YEDB 3KNBB 1OP5K 2XFFA 3TBTB 3O6MH 2QHAA 1A4JA 1PKQA 1VF8A 1IAIL 3BH8A 3T0XA 4Z0XA 3VRIA 3ZYJA 2FZ3B 3SJVE 4JEGB 3DGCR 3WFBH 3AGVA 2V9TA 4NX0A 2CBUA 4K8RH 4XMKH 3NUKA 3VJ6B 4NO5B 4Z5RB 4WI5A 3WKZA 4KHTL 4RL3A 5GS0H 4XPBH 3WN5A 4KKBD 3CBWA 5B22A 1S9KC 3QWOB 4GXUN 2Y9RT 4M7LH 3TJEH 1UWGL 1FP9A 1SY6H 4HPOL 4APQB 3LRMA 3ARFC 3LRSA 2YRLA 4POUB 3B8YA 1DL7L 5CEXA 3IJ8A 1CVSC 5IEHB 3FO2B 3MRPB 4BFIA 1CF8H 3QJFA 1KF9B 1B0RA 1T0MB 2BHYA 2RGLA 5D1XC 4CBPA 5I76B 3E8UH 1MFDH 4FQXC 3PZUA 3RPKA 1LHZA 3LIZL 3CHDA 2ADGB 4RFOH 2O26U 4P7NA 2IJ0C 5D5MA 4JFOA 4NQCE 3IDGA 3V9FA 1OGTA 4LRNL 4MGXA 5ICYB 3WF2A 2ESVA 1GHFH 1PG7X 1OF2B 3ULUE 1HK6A 3OR7B 1CXIA 4PUBL 4M6ML 1C8XA 3QUXA 1OM3H 5F7HA 3ARBB 1CFSB 3F4VA 2FB4L 3TCLB 3ARBD 2FD6L 3I9GH 1HKIA 2AKRB 4O9HL 4OF0A 1GGUA 3Q3GB 2VE6B 3QDME 1INEH 3DVIA 5ECUA 2NR6C 4P23A 2HFTA 2V17H 5JMRA 4YGVA 4R97B 2EDQA 3GMOB 1R24B 5TGBA 2EPNA 5GRYA 3ZMRA 1JD9A 2H26A 4NKOB 3O3DA 5K59E 3MOQA 3KXFA 2FX9H 4K8RL 4OF3A 4XMKL 2V2XA 5LXGH 3EO1B 1I8MA 4QAWA 1KCRH 2NXZB 4X0NA 4IM4A 5FYLL 3ARUA 2HKFL 5GS0L 4HHAA 4Z77B 5DJXA 4XPBL 3PZOA 3RIKA 5E1AB 4GAFB 1FVEB 1TJGL 2Y6SC 1V5JA 2MOVA 3OKYA 4FQCH 2BRRH 4ODTH 1I1AD 2WWMD 1HHHA 3QQ9C 4HC1A 4TVPD 4M7LL 1OP3H 4UFJA 2G9HB 4HK3J 3ORJA 3PGCB 5I71B 4K3GA 1SY6L 4EBQH 4JM4H 3D9AH 1T4KA 2YD6A 4Z7OF 1KQYA 3DV6B 3H3PH 4KKNA 2OQJB 3N06B 1QA9B 1LK2B 1M7IB 2C1OA 3IFPB 5C0AB 5K9OA 3MV8A 5D72H 1NKRA 2NY0B 1LMKA 4GUPB 2FIRT 5EB8A 1RY7B 4MHHG 1MFDL 3KGRA 1JK8A 5GGVL 1S7XB 1LK3H 1NBZA 1S5IH 1IKNC 4MSWB 4Y4FB 3VXMA 3PWLA 3ZDXE 3BUBA 1JBJA 3MR9B 1N59A 2XA3A 3RIAK 3BWAA 1LJYA 4PGBB 5C0BA 7FABH 2F53A 3QA3A 4QRRB 2FYYB 5E6ID 3U0PB 2X70A 4LU5H 1H0DA 3SCMB 1N64H 1OM3L 3TVMC 2E8YA 3VFOB 2A77L 3JTSB 4ACZB 4YHZL 2BZDA 1M7DB 2APBA 4LF3B 2Q87A 2NY7H 1D2KA 1RUQL 2OW6A 5J1AA 1HEZA 3RM8A 4QLLA 3C9NB 3IETA 5IVXF 4CKVX 3MJ8A 3THML 3FQWB 2FL5B 5GGTH 3BUQA 2XTJE 5E2JA 3GSNB 2E9IA 1CBGA 1NUGA 3BJLA 2V17L 5FM5M 4YXKL 2AK4B 4LLMB 1N0XL 1B4RA 3OBAA 5HTSA 4QRTA 3PIQB 2YEZA 1RUMH 3PUCA 2QHRL 1S7VA 2FX9L 4L3EB 3HZ3A 1QSEE 2D31A 4U1GC 2UUDH 2FDMA 5GXBB 1QP1A 1WFNA 4G9DA 2Q20A 3PNWB 3RWFB 3C6SB 3L95B 1T21B 2HTKD 4IRSD 2ZUWA 2BRRL 2IAMA 5ACMA 4O4YH 4E41B 1BJ1H 2V2TA 4E41D 5DSCB 2VURA 4HUVA 4JR9H 4EBQL 4YDIH 3DVGB 3RIFK 1ORQA 4JFXA 5T3ZE 1BZ9B 4XVUC 1FG2B 4YHLH 4ELMF 2ZICA 5F1SA 2F8XC 3F7PC 3FTGB 1AGDA 5A6KA 2IF7A 3K2MC 2X1QA 1MSPA 3LMYA 3KJ6L 2GSGA 1XF2B 3AFLA 3Q6GH 1IVLA 5GGTA 5D72L 1N5AB 1DBAH 4XAWH 3GMNB 1E40A 3AYRA 1FLTX 1KCKA 1FL5A 3ZE0E 1LK3L 1HHIA 4IRJB 3TV8A 5MEOA 3CDGB 4KJQC 1Q6DA 2W67A 3QRGH 1XF4B 5FIPA 4LU5L 2XFXB 5FXCH 3BEVB 1N64L 4OF5A 3BKJL 3VXPA 5EC1B 1LL6A 4WK9A 4PTUA 1GOOA 1NWRA 4O2EA 2NY7L 2VH5H 3A23A 2PI6A 4AIZB 1MPAH 5DRWA 2PXYD 4OLYH 1R33A 3LDBB 1V0KA 3RRQA 4P4RA 4OLXH 4NRSA 5EZLA 3EDFA 1NJ9A 1XH3A 1ZGLM 4ZXBD 1B2WL 2NZ9C 3G6JB 5HHQB 2R2BB 4P2OB 4AD0A 2FWOA 4X99A 3QB7C 1WISA 1KXQA 3CZNA 2QQNH 2XRAH 1QI5A 3L3GB 4LHQB 3B6SB 5I1LB 2J7DA 4XTRD 4XGZA 5F3HA 3S4SA 4UOQA 4HA1A 2EJ1A 4BSWB 1BBDL 1FO0B 1T5XA 3BPCB 1TIUA 4LCCB 3TA3D 4OZFB 3EHBC 3QRFM 4PJFF 2V7NB 1XV8A 4F9PC 1YDPB 4YDIL 4HUKB 2AXFB 2ESCA 2OL3A 4YHLL 2ATKA 4KQ3L 4FMVA 3CGTA 1CE1L 2YD9A 3P77B 1MLBB 4BQBA 1W3HA 4LYRA 4I18A 4PJHB 3RVVC 4AEEA 4F7MA 4G5ZH 3VIHA 3Q6GL 1YECH 2I25N 3VI3F 5J06A 2C4FU 1DBAL 1P2CB 4X7SH 2X0HA 2A73B 4MCZA 3CUGA 5T1KA 5FKPA 4EN3C 2PC8A 2B31A 5IB4B 4UUJA 3BQUB 3WS3A 1AD9A 1G7MA 2BVQB 1MW0A 2FHCA 4L4PA 4HWEH 3SDAA 3UTPE 3PWPE 2IG2H 2X4PB 3HC3L 5KSAC 4DO4A 4H88L 2L7JA 4CNIA 5HDOA 1IC7L 3L5HA 5F7FA 3QUZB 4NNPH 3SE9L 3D3VD 5E4EC 3CLFH 5ACLA 4A4AA 2LU3A 4ZE5A 4KKAC 4X83A 3K4ZA 4JGMA 2EXOA 4HAGA 2VQUA 3PDDA 3TBSA 5KS9B 3HNTL 4PJIB 3WUBA 4HMEA 4TVDA 3S96A 4J4PC 4OLXL 1NC2D 4LSTL 4OJFH 5DLMH 4X5XA 4JDVB 3T3PF 3CV5A 4B7IA 5C0JB 2HVJB 3ECBB 4NQDE 3EJQA 1ZKAA 2PTUA 4HIHA 4FQIH 4Z7QE 3AJ7A 1WO2A 5DT1L 4W70A 3Q6FB 3GMMA 5FYKH 3STLB 4IMLA 2JB6A 4PJBA 3PQYA 3G04A 4HGMA 3QUMH 4IOIA 3WD0A 5T3XD 2XRAL 4JN2B 4NWUH 3S36X 1JTPA 1MUJA 2DIJA 1M03A 3FQNA 4FXGB 4ATWA 2D7NA 2IQAB 1D6VH 1YEFL 2ZCHH 3R8BB 3L4XA 1A47A 2V7HA 4KTDL 5DUPH 3RUGE 3ZKXC 4EANA 1UH2A 4NDMA 1TJHL 1BOGA 2VLMD 2Y7QB 5HHXH 4CRPA 3QEHB 3VWKA 5BVPH 1U8QA 1UH4A 4AM0A 1BWMA 2C4XA 2Q3ZA 2O9OA 2R1WB 1LO0H 5C0EA 4G5ZL 5C2BH 5IMKA 1DUZB 1WFOA 2GDVA 4Y19E 4J7RA 4B41A 5DT7A 3FHAA 2XQYG 2R4RH 2DIAA 3QBTB 4R3SB 3AREC 1NWSA 3SJVB 3R1GL 2YD8A 3O41B 3T04D 2PF0A 3QQNA 4XX1G 5HDRA 3OF6D 4DWSD 1J10A 4NQEB 1OP9A 1X6LA 1A22B 4KVNH 2IG2L 4NQVA 3H7LA 1GGCH 4I5BB 3GXTA 1LNUA 4MXQC 3TONA 1M04A 3HRZA 2VMFA 4M48H 1ES0A 3HE6C 2J7GA 2IFFL 1B3XA 2XIDA 5EPMA 4HG4J 5I16B 4XC1H 3BZEB 1FVCA 1Q9WB 2WUCH 4LGSB 2X9YA 4YFDB 2X4NA 4P48A 1WZAA 4IOSD 4HMDA 1U8KB 2CUMA 4W81A 2OK0L 3NSNA 3JV6B 4KU1A 3CDFA 3P73A 4ZPVB 4YN5A 1MQRA 3BP7B 3D5HA 3PP4H 3UETA 3V2AR 4I3SH 5BS0A 3W24A 1OW0A 3DX7B 5J13C 5T5FL 3PWJA 3VRJA 4P2QB 3MV7E 5FYKL 2WWDA 3WEXA 4P2QD 1C12B 3QUML 4MAYB 1W1YA 1V0NA 3IF1B 5EIIB 3VSVA 4L8DA 1BD2B 5DMIH 3X12A 1P6FA 4LIQE 1D6VL 1Q4NX 5DUPL 1UD3A 4OF7A 4M1CC 1NGYB 1A02N 1CFNA 4YUEH 1CPUA 5L8LB 5HHXL 3HI6H 2HVMA 1S9WB 1YNLH 5IFJA 1KBGH 1NANI 3ARGC 5FGSA 1CTNA 3C5SA 3JUGA 1MJ8L 1OTSC 1IM9B 1GQLA 1XC6A 3WJJC 4W88A 1Q9KB 1KTDB 5EOQH 5KSVA 1QRNB 1FC1A 2QTEA 1K85A 4YPGA 3MRFB 3PHSA 4HBCL 3WDPP 1QRND 1DBKL 4JRXD 1U36A 2NW2B 3MLWH 3RY5A 1D5XB 2NY2C 5DA0B 5D4QA 3UTTB 1MW3A 1W72H 3UTTD 4UQ9A 5F44A 2APFA 2FO4B 4JZNB 5DXWA 3RWDB 2W0LA 1AKJD 3CVHB 1UCTA 2DYPB 3U30C 4IISA 5FOBB 3HE7C 2R2CA 1E4KA 2W9LA 3DSFL 5KVFL 2EDRA 5ETUA 2WVVB 4LNRA 1C16A 5C6PB 2D23A 1T1XB 3BZDA 3CCHB 4PGDA 4RGOH 1E3ZA 1LQ0A 1JGVL 1UCBH 2B0SL 3WSQL 2VN4A 5CPSA 5D7JD 3TV3H 4XC1L 4Z7VB 4NYLB 3QQ3B 4PTTA 5HOSA 4Y4HC 2WLYA 5DEGB 4D8PB 3ABZA 1WF5A 1YEJH 1QG3A 1HCVA 3MSPA 4JKPH 2GJXA 1AC6A 1X5IA 5HPMB 1MJUH 4NJAL 4S3KA 4U1HB 2GUYA 3PP4L 3AVEA 5EULV 1IM3B 5B4MD 2QKIA 1AHWB 4LCUA 2VCBA 2VXTH 3MREB 3NPSB 3UAJD 1S7SA 4C57C 1J12A 3QDGE 4BZ2L 2J8HA 4OI7A 5SWSA 1JZ8A 4NRZA 1NAKH 1R86A 4HS8H 1JGLL 4WNQB 4V28A 3QZWG 4O02L 2DLHA 2Q8AH 3QI9A 4LVEA 4YUEL 4NZTH 2YDRA 2AJZB 5EOCJ 3HI6L 1RFDH 1IGFH 4G43A 5C08D 3IRPX 1X3DA 4U6HB 4WW1A 2DPEA 3CZEA 3ZR6A 4RAHA 1U8IB 3VMPA 4ZS6D 3BZFB 2H3NB 5A2FA 4PGZA 2EECA 4GW5A 4DVBA 3U7BA 1DE4B 5I9QB 1CD0A 4U1MA 2G5BB 4LLDA 4JCMA 3MLWL 4QY8A 3W2DL 5C0RH 1TITA 4LEXL 3OJMB 2W92A 5DEFB 3HG4A 1UA7A 4H5SA 3EFFA 3HRPA 2XTKA 4Y1AD 3V0WH 4UAOC 4P2CG 3BUYA 3DUUB 1U8MB 4ONGH 3D0LA 1ZANL 3E1F1 3RP1A 4PJ7B 1F58H 2YC1B 4E4PA 5GJSH 1Y18B 3TNNB 4OTXL 2VX6A 1WB0A 5DTFA 4RGOL 2A2QT 2BK8A 2BVOB 2J4WH 4X4MA 3PHQB 4JFHE 2F7PA 3PP3K 1TVPA 5FL0A 2R56L 2DLGA 4JKPL 5JNYB 4QXUH 2CHNA 4CCDA 2HT4C 1CBVL 2YKLH 4OOUA 5DK2B 1A64A 2G3MA 3RFZC 1MJUL 5KJRH 2P8MA 5IKCA 2J12B 2CO6B 8CGTA 3X14A 1LL7A 1HHGB 2EC9T 3U7WL 4WI8A 2UYLB 2XN9E 5HGDA 1EEYB 5IV2A 2XQBH 4P8WA 2EYTA 1EHLH 5GZOC 1KLFA 2FLRT 1GHRA 2A74B 4NUGL 2QR0A 3QIUB 5TH2B 3OR6B 2BOCA 3PG2A 4HS8L 4R90H 1WVZA 3O6FB 3EBVA 4L29B 4M7JH 1UKPA 2Q8AL 1TVBB 3IXTB 3LN4B 3HZMA 2B39A 3O6FD 3ULVD 4P8XA 4NZTL 4D94A 5E09A 1C7TA 3C6LB 1RFDL 1NLDH 2IBGA 3CSYA 1UR4A 3Q1SL 1IGFL 1U6AH 3KPSD 1AGFA 3B83A 5HYIA 2Z1SA 5D8WA 3KHOA 3U1SH 3VX0A 1BYCA 3HMXH 2VR5A 4K3JL 2X4QB 4HUNB 4M4PA 4V2BA 5HGHA 2CPUA 4MD0B 5DJYA 2ADIB 2WZIA 1MXGA 4D1JA 4F57H 5C0RL 1F97A 3VIFA 2YFNA 4Z7OE 4NO3A 5FUZH 5HVHC 3OAUH 2HKHH 5CHNB 4MD4B 5IG7A 5IBTL 3V0WL 5KAQF 2X89D 3TTOA 2IH1A 2O5XL 5EZJA 3MPCA 3TTYA 4ONGL 3SCOA 5KSBA 1RZJH 4OIBA 1NCUA 1R46A 1F58L 3HPLA 4HK3N 2GFTA 4HLZG 5GJSL 1CXLA 5F6HJ 2BCKB 1RHHB 4OLWH 1DDHB 2W59A 2R1YA 4U6TA 1K6AA 2ZXDA 1CGXA 4UBDD 1YMME 2GFBA 2J4WL 4RGMB 2DJUA 2EYRB 1T1YA 2PWHA 4LCWE 1QNQA 3SY0B 5FB8A 1FFRA 1T5WA 4XZBA 1ZVYA 5MI0C 5D7LA 2WW5A 4MJ5A 1U41A 3PDGA 4TULH 2FEEI 3GBNH 2W9DH 3QDGA 2Z31D 1I1YA 4O51B 5HHME 3RWIB 3VVGA 4X6CF 3ULSB 1GXEA 4UZSA 1IEHA 5HYQB 8FABA 5KOMC 3GMRB 2XV6B 5DD1H 3T4AB 4X6DE 3W25A 1Q1JH 4A6YH 2XQBL 3PWPB 3AQUA 2Y23A 4AZCB 1MFNA 1WFTA 1KIPA 3ZHLA 3BZ4A 1DBJL 5C09A 1J7VR 4GBXA 4JG0L 3TPUA 5ID1B 1OSEA 1LVEA 3VD4A 1VGKB 3NCCB 4PJEA 3VWJC 2ZX8A 1LWRA 6A3HA 1TQCC 5IMOA 1AMYA 3EDJA 5CPQA 3HMXL 1GQKA 4NZFA 4EI6B 1JHLL 2Q8XA 4ZAKD 2J47A 1RUPL 3PHOA 5IB2B 1CXKA 3WYRA 1OBAA 3P9MB 3GXFA 1QNPA 5EO9B 4RGNC 1A3LL 1HZHH 5FUZL 4ELME 1FFOA 4FNLH 2HFEB 3OAUL 3SGJA 1J1OH 2HKHL 2OZ4L 2F9BT 4LLUB 5A2JH 2ZXQA 1QLFB 1KEGL 4UQCA 4KRMB 4C59B 5IOPB 1IC1A 3OB0H 1NFDF 1U8PA 4QXTB 1KPUB 2FGZA 2ZIDA 4MJIA 1RZJL 3JVGA 2WMFA 5IROA 2W61A 4QGYA 1BTCA 1TPXB 3WS6A 1NOWA 4QRPB 5A6JA 4OD1H 4JGUA 4S0SD 5JQ6L 3D0VB 2E7LA 4HOXA 5CG0A 3L4YA 4OCSL 4HJJH 3N12A 3O6LH 4H2CA 2VZSA 1PLGH 1CXHA 2HJFA 5BQ7A 2GK1A 1BFNA 1SEQH 2XZCH 5E5RB 1CD8A 2VL5A 4JZOB 2XN9A 3PGDA 1QFWI 4KJWD 5DO2D 1YNKH 2NTFA 1EGJA 4TUFA 4AIEA 2PW2B 3F7QA 1MHHB 2OXHA 2W9DL 5BXSA 3MRQA 1YN6A 2ZSWA 2DJ4A 3N9GL 4PJAE 4OM0H 3MRGA 3SDCA 1E28B 2R9HD 4PTMA 5ITFB 3VM7A 2R2HA 4XPHH 2BXYA 4WENB 1OCWH 3NACL 3ARTA 5F7WC 4AZIA 1P4LB 5IB3B 4A6YL 4WDIB 1AGEB 4U1NB 5FM8A 2JCCF 5JW4R 1KPVA 3DDFA 5TPWH 5GRWA 4CU6A 4FFVC 3MLZL 2SEBA 5E8NB 5J3HC 4N5EC 1NGXB 4F7TA 5C07E 1CWVA 3QH3A 3ARRA 1YYLH 2VC2H 3RTQA 1P5VA 1S7UB 2PR4H 5CLWA 4Y4KB 1A5FH 2LTQB 3A6BL 1LP9A 4WW2F 4Y4KD 5FO7B 4CU8A 3ZM8A 2HTLC 3DROA 2GY7B 4RISL 2HLFC 3CUIA 4U6XA 3RDTC 2JJWA 5JOFB 1C5BH 1CFBA 3PWVA 3E3QE 4PJFE 4H1LB 3MBEA 3CH8A 3BCDA 4LSDA 2WNWA 4TUKH 1U92B 3O3BB 4QP0A 3Q5YA 3MV7B 3O4LB 1R3IH 2DWEB 5B8CC 3WMCA 1CT8A 4R4NC 4I9WD 4U1LB 3A4XA 1PEWA 4HAFA 3L6FA 3VI3E 1UZ4A 1S9XB 5I19L 2YBUA 5HHOE 3FB6A 4Q6IA 3RVUD 2WBJB 3O9WA 4OD1L 2WBJD 4LLYB 4MZ3A 4D6JA 3EYFA 3LKNB 3MCLH 2IBBA 3OGCB 4KHXL 4HJJL 1V3LA 4BKLA 2CKBA 2MQCA 5DMYA 3EO0A 3O6LL 5HI5D 5L2JB 2J6EA 4M7ZB 3AZTA 1PLGL 5F9WC 4CMHC 1CICB 1FZMA 3ZIZA 2ITCA 3P9WB 3AZSA 4HFWB 1YNKL 1WEJL 4X6DA 5IESL 4PTXA 1IFHH 1UD4A 1KPRB 6FABL 3PJSB 1QHOA 4AIXA 1PY4A 2VLKA 2K9UA 3PDOB 4R6UA 1AQDA 3U7YL 1WGOA 3D2UA 3FY1A 3KWXA 3T3PE 3U46A 1ZS8B 5TPWL 8A3HA 2RFXA 4TTDD 4MS8D 2VC2L 3MRLB 3QFDB 1ISZA 2PR4L 4H25A 5HI3D 4WCYH 4Y5YA 5E2TL 2VISB 4PLJC 4PRIE 4HV8A 1PVHA 4L1HA 4F2MB 1DLFH 1UWUA 5E0FA 1HI6A 2JIXA 3PBGA 4QWWD 1C5BL 25C8H 4JAMB 2XVNA 4M43L 4D0DB 3V6OA 2C3VA 2XM1A 1D9KD 2ARJQ 3KEHA 1KT2B 3OTTA 2Z4QB 3F7VB 3UYPA 4P49A 4DTGH 2D24A 1R3IL 1ZA3A 4JG1H 3IU4H 3QFJD 4WFEE 1C1EH 2NX5B 3F65A 1YC7A 4HX1B 1WNOA 5CINH 2ZXAA 1IEAB 2NX5D 2FLBT 1B4JH 3A0OA 4KDTA 1FGVL 3WH7A 3LSOB 2FX8H 4WTZG 1F02I 4NKMB 3O81A 5HGBA 4LSQL 1HXMB 1GCFA 2VXUH 3NH7H 1NGPH 2C9AA 2GAZA 2VIRA 1FYTB 2ZOLB 5TF0A 4FQLH 4W7WA 3S7GA 1FYTD 3FONB 3MCLL 1MH5A 1S7RA 4RFEB 3GH7A 2CQVA 4XNMA 3ROLB 5HDQH 4MAUH 3MV9E 2PO6A 1UVQB 5B21A 4NWTL 3DXAE 1MWAL 5SWZB 1V6UA 5DHXB 2DL9A 5SWZD 3NFPA 1GQJA 3B2VH 1P6WA 3IXAB 1GC1H 2B2XL 1IEBA 2NXYB 3PTQA 1HQRB 3GI9L 3QHFL 5J56B 3M8OH 2NXYD 5I1CH 2A3CA 4RX4D 3WFZA 1KLGB 3KPPA 3QDJE 4N1CA 4LQ1A 5ACZB 3MRHA 1QFUL 1LILA 1QBBA 5DEZA 1HL9A 1YY8B 2ZUQC 1ORSA 3KYMA 3WNPA 4Z8FH 3CZSA 3KL5A 2GTWA 2CK2A 3L4TA 4P5TC 3RKDC 4AWEA 2PWEA 4YO0A 1G6RA 3QO1A 1OGBA 5L2KE 4XXCC 2F1AA 1W9PA 3MRJA 3LEXB 2VDML 5AG9A 4HIEA 2VDNH 1OWRM 1NMCC 4OQ1A 1G9MC 1S7QB 1G7IB 4UOJA 2HT3D 3RVXC 3RPIB 3UTSE 2X4SB 1QNZL 4TUOB 3MV11 4QGTA 1UWEH 4YK4C 4XNXL 4IPNB 3U6RB 1F3RB 2F19L 2FATH 3OLGA 3GSVA 1NGWA 4ODHH 5DZOA 4QNPF 4F7PB 3K46A 3HFML 4JG1L 5JUVA 4G6AD 5BVJB 3HR5B 4DZ8A 1NOFA 4N8CL 2IWGA 2DN7A 5CINL 3X3GL 3NIYA 1JDAA 1B4JL 4OZFG 3AXXA 5ADPH 1NL0H 1GOIA 3WL0A 4LX4A 2FX8L 4Y2DC 5IQ7H 3ET9F 2FH6A 4XWOC 3NH7L 1NGPL 1E1FA 4YEFA 2AK1L 2XT1B 3T0DA 1NQBA 2MPAL 4P9ML 1E6NA 4QHMB 4G6ML 2A6DA 1EJOL 1XGQA 5FOOA 3MJ6A 1X4XA 4MAUL 3MYJA 4I4WB 2J5LB 3MLXH 2XFRA 5DMJB 4WEMB 1F8TL 3U0TA 1P7HL 4JFVA 4ZD3L 1TMCB 4UFHA 3B2VL 3NPZB 5I74B 4Q2ZA 4L3CB 5FO9B 3M8OL 4LLWA 5K9JL 5I1CL 4BELD 3HG1D 4B9YA 5C0CA 3LAFA 2J8UE 3MYZA 4N9OB 5B38B 2I9LB 3OQ3B 1VSCA 3ES6B 4TNWF 5CJOH 5DJDA 3IAGC 5D96C 1F11A 4WGVB 4XNUH 4LXFA 3MGTB 5CIPA 5GSRA 3JUZA 4UIMB 5D2NC 5GS1C 3OKNA 2CDEB 1XGPB 4MDIA 2GT9B 5D1QB 4X6FA 1AXSA 1YMMB 4RZCB 2YSSA 3GNMH 4LCWB 3NVQA 2VLJB 5BCAA 4LHUA 4PY7B 3BD3A 3MUGB 2Z35B 2YOCA 5GJTH 3DV4B 4HF5L 1RULL 4NSKB 3ARXA 4IHOB 5DJ8A 4QHUA 2X4OB 5T1DL 3PF2A 1J8HE 2ID5A 2AV7A 1JNHB 1UWEL 1YEIH 1MCSA 2ZG1A 5HHMB 3PWUA 5EU6E 2FATL 1VFAB 3IDYB 5JPNA 5IVXB 4JAWA 3V5KB 3VFNA 4ZTOH 4YZFE 4GKNA 4X98B 4K94H 4IIQB 4APQC 1JGEB 4TNVK 1ACYL 2DS4A 3C5ZB 4LCYB 4NHUB 1CDBA 3WDJA 1SVZA 5IQ7L 3MV9A 3DUSB 4N0FA 4GG6F 2WMIA 3QQ4B 3MOBH 1RJLB 4R0LA 3HR6A 5DFVC 3JV4A 4F33B 4KMQA 3TFKC 4BCEA 1V03A 5I8CB 3UJJL 2GITA 2DM3A 1CIDA 3S5LA 1QVBA 4U05A 1KN2H 5F1IB 3S88H 4PJEF 3TBWA 2Y5TA 3MMEA 3QDJA 1MEXH 4LHJB 4DUWA 2PNDA 3WQ5A 5DHYA 4FXKB 3RHWF 4PJ9D 2VJXA 5M17A 1WCBB 4LBEB 1K8DB 1W3JA 1Y0LB 2MTPA 3DETD 4ELMB 3UJTH 2VYRE 5D2LB 4TSAL 3MRIA 1EFXA 4MMZC 4TRPH 5A2BA 3BP5A 4JFEB 3W5MA 4N68A 3WHE0 4NT6B 4PYGA 3RI5K 2VXVH 5CJOL 1H11A 5AAMA 5CAYB 3V4UL 4ZSOA 4HUXA 1AJ7H 4PP1D 2W1NA 3OB8A 4XCNA 3R0MA 2VX4A 1QYGH 5DVOA 3IDIA 1JUFB 3VG0H 2YL9A 2VUYA 2F61A 2JB5H 1IGJA 3PABB 4P5KB 2OLHA 1LDPL 3S34L 3PL6A 2AV1A 4F8QA 2BSRB 5DZNA 4X5WA 5D6CB 4LSUH 5DC0A 5IM7B 4ZNEA 2NXZC 3N15A 2DB8A 1YEIL 2WUBH 4ZUSB 1MFCH 2YRZA 3QNXB 1UYWL 1QEWB 4MA1B 3GTNA 5TQ2L 1I8LA 3IGAA 3HLAA 5F7UA 1A0QL 4K07A 5I1EH 1QX1A 1EH9A 2UWEB 4RRPG 5I71C 5KVDH 3DO7B 2V5MA 1GZQA 1GQIA 1UR2A 4LSVH 5BZWA 1N7ML 3LH2H 3MNZB 3WLWC 5IMMA 2OYPA 5L8JB 1KC5H 2GYSA 1B9ZA 1PQZB 4QF1B 3MOBL 1A7OH 4OCRL 1KUMA 5C07B 4K3EL 2NY0C 3BAIA 4Q9RL 1OB0A 4LQFL 1OVZA 1QRKA 3MJ9H 3N0PB 3QG6B 4ZFZA 4XUYA 4FNQA 4FNPA 4WEBH 5FA4B 1KN2L 4OIAA 4Y4FC 3CFDA 5ADOH 1MEXL 2J8UA 1XGUB 1UZ6E 2NW0A 3D18B 1LE9B 4OV5A 2B1HH 4PJFB 4FQQB 5C3TA 3E0GA 5CILH 3VSUA 3UJTL 2O61A 1FH9A 5GSVB 5MP6H 4TRPL 3SCMC 3BIBX 3CPLA 4LDOB 5HVGB 4Z7WB 4PRHA 1KWKA 4RQQA 4FFWC 4ZQKB 5IJKC 2XJ7A 4WV1A 2BNRA 3JTTA 1FL3B 1RQ5A 3QHZH 1G9EA 1I7RA 1K4DB 4X6CE 3TT1H 5C9KA 3BE1H 3SCTA 1QYGL 4P4KA 4HG4K 3HPJA 4LPCA 3VG0L 4EOWH 3B4NA 3NCFB 1U8JB 1N4XL 1T83A 4NZUH 1ZLUH 3SO3C 2JB5L 1P53A 2PYEE 3V8OA 1G9NH 2ZNXA 2BS9A 4OZ4B 5C9JB 3MJ9A 4W7UA 4P59H 3DX6B 3NFNB 2EACA 2X1IA 5DD0H 1XCQB 5FK9B 1KV3A 1O7DC 4AMKH 1PG7L 2HN7A 1ZLWH 1NP0A 4G80A 2CDGB 2WUBL 1MFCL 2I5YH 4I0PA 3VXTA 1WBZA 5HHNB 1CL7L 2EIBA 2QSCL 5LA1A 1BF8A 1P7QB 2MQ3A 5IK3B 4U1KB 3O8XD 5I1EL 3ESUF 1P7QD 2R23A 1BM3H 4GQ9H 3EJUA 5IWLA 4LSVL 1NBVH 3W9DA 1ND0B 4CD6A 2IFGA 3A6CL 1HXYA 2DF3A 3QEQA 5HJ3A 3DTXA 4MVBC 2BV9A 3BOVA 5LBSH 3ZL4H 1A7OL 4BH7A 4I3GA 1CFTA 3U9PH 1U8HB 3TGXA 5HXMA 1IGYB 3SGEH 3TZVD 4NOFA 1LO3H 4R96B 4GW1A 1ZHLA 1LG2A 1FORH 4JJ5A 5GGSB 5JW4Q 3DARA 5ADOL 4L1DA 5E2UH 4IRJC 3DIFB 5F7MC 1DWFM 4N90D 4FP8H 1DVFD 1O5DT 1OQXA 1O0VA 2PB1A 3APGA 3CHEA 1PYWB 1RZIA 4DOHB 2UZYB 4LYPA 3MRKA 3A67L 4CW1B 3UZVB 3LY6A 1RU9H 4HCRA 1DLHA 3CFJB 1K6QH 4YLQT 3K4DA 3M17B 5DR5H 3WF1A 1NMAL 5H94A 1XF5A 3LDBC 4RAVA 2D7QA 3BE1L 5DJAB 5CSZA 2LE9A 4HWBA 4NZUL 1IKFL 4OLZL 1A4JB 4ACYA 3FN3A 4WIWA 2X7LA 4ZUUB 1I3GH 4HKBA 4Z0XB 2JCCE 3O2VH 2C7UA 3V7MA 2VC9A 1RVFH 4P2OC 4OOZA 1TZ7A 2DSZA 1EO8L 5DD0L 4XP5H 1LF1A 3UBXI 4LASH 1T0NA 5FYKE 4XTRC 1CLCA 4BYHA 1KCSH 4AD4A 5IHUH 2E40A 4LCCC 4OD2A 4Z9KB 1PW3A 3GSOA 3HC0B 3VFTB 3LRSB 1NBVL 3TO2B 3KG5A 1OGSA 5E8DH 5CFHA 1ERNA 2D7TH 3LHPL 4M62L 2MNUA 2DMKA 4JQXC 5LBSL 3KYAA 3NABH 3ZL4L 4HKXA 1BYDA 5L2KB 3DDGA 3QJFB 3RPMA 3U9PL 3GNOA 2JJTA 1B0RB 5HI4C 5I5RA 2NT0A 1FFPB 3SKNA 2GJ6D 1KJ2A 3IDNA 3BQUC 5BRZA 4D3CL 3SE3A 5J11B 5D5MB 4W8LA 1OP5H 3IDGB 4M1GH 5I1DA 4FP8L 5MERA 4TSCL 2ESVB 4X4ZA 3D85A 5E1HB 3WKMH 2ESVD 4N8PA 4U1IA 1I9JH 3QUZC 4NQSA 3O2DH 5E9DA 2J7EA 1RURH 3GSXA 2H9GA 2J7CA 3QUXB 1T2QH 5ALCH 3S98A 2P5EE 3QUXD 3QULA 1K6QL 4C56B 5ICXB 1BQSA 1V6XA 3L5XL 2G8ZA 3DHMA 1E0VA 2YDSA 3BDBA 4D0BA 5MENE 3W0KA 3S37X 3LQZB 5AUMA 1MCWM 1UQSA 3JWOH 4P23D 1WAAF 4F7EA 1EDGA 2O5ZL 1NLBH 3QHTC 2HMIC 1I3GL 2FJHA 1G9ML 1FGNH 4D2NA 5ALBH 1ITBB 1EVUA 4KQ4L 4JHWH 1UACH 4JKKA 2H26B 2UY5A 4KJPC 3KXFB 1ZGLP 1F4YL 5F8QC 3BPOB 1PDKA 1WTLA 4LASL 5HYFA 2BNJA 4J23A 2R0KL 2DQGH 1ESWA 3RWCA 1X5KA 4HHAB 1KCSL 3POHA 5DJXB 1A6TA 1HE7A 1XF3B 1HHHB 3BN9D 2F54A 4YBLB 2P7TA 1IZJA 2M26A 5ILTH 2EADA 1ZLSL 2V38A 1SMDA 3BIKA 5E8DL 1B90A 2ICEA 3VXUE 5D7KD 2H1PH 3PZIA 1L9MA 2C1OB 3KPNA 4L9LA 2FGLA 3LX9A 5IUSA 2VLRE 4XAKE 3MV8D 3P4NA 1UM4H 2RGSA 4XH2A 1X7QA 2P5WA 3AM8A 1B6DA 1OL0A 2XIBA 1NBZB 4CVZA 2YN5A 3O3EA 3PWLB 2MFNA 1SM3L 4KKCD 3WIIH 1J8HB 1UZ8B 4O2CA 1BVZA 3VXMD 2P49B 5EZIH 3WKML 1XFPA 5EU6B 3QWQB 2E27H 4YDVA 2NY3B 3GSRA 2F53B 3QA3B 1Y7VA 4JFQA 3TYGL 2NY3D 5C0BD 4FFYH 1E6QM 2F53D 3F5JA 3BAEH 3WHE1 2X70B 4TVUA 3NAAH 5DD3H 1KIUA 4NFDA 1H0DB 5ALCL 5F93C 1R7AA 2J8FA 5SX4I 1DCLA 4BQ9A 4Z7UF 1ETZB 5J1AB 4DGYL 3IETB 2YA2A 3REVA 3FOMA 3U2SA 2H2PC 5KEZA 3X3FH 1KR0A 4ATLA 1MIML 3JWOL 3U9UA 3VM5A 2PKDA 3JXAA 1CGTA 4MNQA 2OSLB 3UX9B 1YEHH 3RNQA 2DSUA 1RMFH 4HQQL 1UEMA 1X5GA 2R29L 1E73M 5ALBL 4MADA 4JHWL 4U6VH 1R75A 2WHMA 2EABA 4ATDA 2GI7A 1E1EA 4MAYC 2EO1A 4MDJB 2D31B 1L8NA 3MRNA 3T0EE 1KELL 2DQGL 3ARFA 3RX7A 4TVPH 4GH7B 2UY2A 5HPCA 4UR9A 1W0VA 2YS4A 4QDMA 3RWGA 4PRBA 5H2BA 1PZ5A 2VDPH 1JD7A 2IAMD 5ILTL 5D1XA 3V0AC 4HUVB 1Q72L 3UDWC 1G7LA 2MJWA 4QHLA 6CGTA 4FQXA 1A7NH 3S3JA 1T03H 1TVHA 4FLOA 5I23A 1UR8A 4QNPE 2KBGA 5E0QA 2ZCLH 1UB6A 1EFQA 4NQCD 2FJGA 4QCFA 3EMCA 1A8JH 5CUSH 4BS0A 3IK2A 1X44A 4ZFMA 5FV1L 3CLWA 1UM4L 4H1LG 4TX8A 1DQMH 1FL5B 3ULUD 1ISVA 5D4YA 3THCA 4PREA 2G60L 3WIIL 4JFTA 3S36L 5A8PA 4W85A 3GJEA 5E99H 3LEYL 2P5EA 3K0WA 1VFOA 3UTQA 5E5MA 5EZIL 1J8KA 4W93A 2JE8A 4LARL 1KXVA 1KGCE 3RCNA 2VAAA 4FFYL 1BQHA 1XAUA 5DD3L 3OX8A 4IS6B 4O2EB 3MO1A 3HAEA 1E6PA 2P24B 1FZOA 4MLSA 4OFYA 3KYKH 3GSNH 3EBAA 4JPVH 5LA0A 4CADA 4PGEA 1A7PH 4P4RB 5A2CA 5EZLB 2QSQA 4CCCA 5FGRA 3X13B 2QQKL 3U36A 5F9OH 5C1MB 5CP7B 1NC4A 1AHWC 3IDUA 1UXSA 2FWOB 3NPSC 4ZENA 4EE9A 2CK0H 3VXNA 1FPTH 1FFNA