2CXGA

Cyclodextrin glycosyltransferase complexed to the inhibitor acarbose
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structure of cyclodextrin glycosyltransferase complexed with acarbose. Implications for the catalytic mechanism of glycosidases.
pubmed doi rcsb
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 233
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cxgA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cxgA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2cxgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cxgA01
5HY9B 1AXTH 3BSHA 3U1SL 1C7SA 2QSVA 2D0GA 5DGQA 3GSQB 3WH8A 3RWJB 3MRKB 4LSUH 2IH1A 3MU7A 2YPKB 3QB7C 4L29B 4C59B 1Q4NX 1P7HL 5J0BA 1E6QM 4HD9A 1TUXA 3MV8B 1JRHI 1D5XA 2IGFH 3KDMB 1T89C 2VKWA 4YHYB 4KKCC 4YH6A 3MA7A 1V5JA 4O9HL 2VLKB 2O61A 2GYSA 3HRZB 4EUPH 2P44B 4L3EE 4Y19D 5HYSG 1CDJA 3VCLA 1QSVA 1N64H 3BQUB 2ADJB 4CDGC 3GSRB 2AV1B 1UZ8A 1OGAA 1F00I 4OSUH 2GJ6E 3FN3A 1I3UA 2J1KA 4GAGL 2FO4B 3HMXH 3IU4H 1TVHA 1CXFA 3WKZA 5E09A 1OTUC 4M00A 5T5NG 3ORJA 4JHAL 4OZFH 1LP9B 4NHUA 4CCCA 2NYYC 4B16A 3L5WB 3KYMB 4Y4FC 1DL7L 3BGFC 2DQUH 1FN4A 3TOPA 3HG1D 4J4PA 5EUOE 1WEJL 3O6LL 5C0AA 3HE6C 3T8XB 4V1DB 1KIUA 5KW9H 3EOAA 3IDYC 3QDJB 4H8WC 4MAUL 5F3HA 2W62A 2A9NH 3GSNL 3WFHB 4QHMB 2PWGA 3DVGA 1AO7D 3NAAH 3GNMH 5DT5A 1G6RA 3MLYH 4J3OC 1NMAH 5HGDA 5KBNC 3LB6D 2YKKA 1HNGA 4CGTA 4P5TB 4RMTA 1KB5B 1FCGA 3L9RA 4FXKB 5ALCL 3UTSD 2P43B 1Q72H 1KB5L 4CMHB 3CFEA 3RJQB 2DM4A 4P2RE 2YIHA 3QIUB 2H1PH 2VTFA 3U0WL 3EOTL 1D9KC 4XXCC 3U9PL 2HTLC 3KPQA 2G3NA 3W24A 5EA0H 2VRAA 3O3EA 1JZ4A 1Y6KR 3WD4A 4JO4H 2Q7YA 3C5SA 3R8QA 5A8OA 1ONQA 5LA0A 3V8OA 4F7TB 1RK1A 2W61A 3SKJL 2NX5E 1UD2A 1YYMH 3ULUF 5HGBB 4HDIB 3BHBA 1UYQA 4U6XB 4G8FB 3MRHB 3MODH 4JFZH 4S1DC 3CFKB 4AH2B 4LSPL 4NPYB 1HINL 1KV3A 3P4LA 4Z2LA 1DBAH 1M71B 1ISWA 1HH9A 3PABA 2ITDB 1BZ7A 4ZAKD 4GO9A 3CZLA 1INQB 2A0LD 1F8TL 4WENB 1WDSA 1UCBL 4RFEA 3NSNA 3QEGH 4LCCC 3TEUA 3WNKA 4IRSC 2G4FA 1A7QL 4HBCH 3WELA 4WIQA 4DKEH 3CD4A 4H88H 2Y06H 5DC4B 1TVBB 4HG4K 4IIQA 4FMKA 2F74A 4OLWL 3EYVA 1XH2A 2FZ3A 1T7XA 2VITA 2D0HA 3OJDB 1MAMH 2ADJA 2EYSB 5CCKL 4MWFB 4F7MB 1FV1A 1R87A 4XVSH 4HJ0C 1WBZA 4HKBA 1GQJA 1OOAA 5CS7A 4PPTA 3CX5K 2X2HA 3E8UH 2WWCA 2WZIA 2ICWI 4MJID 3DUUB 2JEQA 3OKMA 4Y4HC 4YWGH 1MI5A 3IFLH 3KYMA 2EXYC 5E1AA 5EUOF 3RDTA 3QXVA 2CIPA 2VJXA 5DRXA 1UWGH 1FNLA 1H3WM 2R2BB 4NRYA 4UT9L 4AT6B 4PD4K 1E27B 5CP3A 1KB9K 1MLCA 2UY6A 3HUJA 2X5PA 3PTQA 5GGSB 5DEZA 1V02E 2XGIA 2O9TA 5GS1B 3LH2H 3ZSTA 3H2WA 4ZTPH 3A3HA 3D39D 3F5WB 4WJ5A 3SGKA 3QEQA 1Q38A 3JTTB 3BGMB 3QIWA 4TUFA 4AYFA 1SJXA 4X6DE 1BGAA 3EYSH 5DI8B 3SGDH 2R2BA 3VILA 4JFOA 3GBNH 1P5UA 3L3JA 1M6OB 2EH7L 4ZPTB 5CMAB 5D7LA 4F33B 4IRZH 4E5XB 2IADA 3VKKA 4XB7A 2XG5A 3TA3B 3ARBA 1JNHB 2J4WH 3RWEB 4F9JA 2CEQA 2CIIA 2XTJE 4OD3H 2YD9A 4P7RA 3P0GB 4ZO7A 4OLEA 4O51B 4K94H 2F5BL 2YC1B 4ZQKA 3EJUA 2EIZA 2JALA 4OKDA 5D70L 1XR9A 1JNJA 5KVFL 3ABZA 3HC4H 1FZJA 2Y5EA 3WL1A 1UJTA 4QOKD 4Y88A 2QHAA 4ZUWB 3NDYA 1FZOA 1FFRA 3BE1L 1NEZG 1RZ8A 4I4WA 5FM5M 2EBNA 1CXEA 2A3CA 5B39B 1VADB 1XF1A 4LRNL 1R3IH 1QRNE 3AHZA 5DJ8A 1MCIA 4PTXA 4ZO6A 1QNZL 2JIWA 1S9YA 5JW4Q 4JY4A 4HA4A 4IHOA 1AH1A 4G3YH 2FDMA 1GQKA 3CVHB 3KPMA 4HIXL 5DQJA 1YEDA 2DRUA 4YBHA 4P2RB 5CIPH 3RVUD 4XCEB 3ZYJA 4RE3A 1NAML 2B2XH 3A0OA 5E7FA 4O5LH 4GKSB 4HKJB 3O45B 4MX7A 4HHAB 2XYLA 3OLGA 4FTVD 1IARB 1BPVA 3ARBB 3RX5A 1WUNT 3RVWC 5DS8B 1RJCA 1NL0L 4L3EB 2DLHA 1A0QL 4F7CA 1WBYB 5E56A 3C2SA 1J8KA 5D96C 5I18H 3OJ2C 3EBVA 5F1IB 1GIGL 5AEAA 3S4SG 3VXMD 1JGVH 4HWZA 1ZHKB 1KFWA 5BXFB 5DD3H 1X5YA 3EDJA 3VXUB 5IFHH 1UA6H 5CGMA 1T1YB 3WNOA 3IJ8A 4G6FB 1A5FL 1EEUA 1MJ8H 1S7QB 3EO9H 4H88L 3SDDA 1HT6A 4AZ5A 3DMMA 5A6SA 2HT2C 5D96B 1SR0A 2RIKA 4XCNA 2ENYA 3LQZA 2BDNH 4R0LB 1T1XA 3HPJA 4JRYE 1BD2E 5F9AC 1MVYA 2GKIA 4LEXL 5GNZA 2HKHH 4LLUB 1CIDA 2GI7A 3RIAK 4RFOH 5DXWA 2HT4C 4KPHL 4MNJA 1S7QA 3TTYA 2YD4A 5CEYA 5AAMA 1OF2A 1OAUH 4WEMB 2OXHA 1U8LA 3D3VE 3KLSA 3MLXL 1JTTA 2YFOA 1ZS2A 5F7UA 3KVQA 3HC0B 1RU9L 4P5KB 1Q94A 4NNXA 2LU4A 1YA5A 4YHOH 4M4PA 3V7MA 1RZKC 2R23A 1RZFH 1J05B 3LKPB 1CLZL 1L7IH 3EYFA 4PRPA 4YHPA 3MBEC 3LPFA 4N8PA 4FQLL 3BOVA 4P2OD 3W9EB 5EO9B 5DRWA 4Y4FA 1Q72L 2YXMA 2JJVA 3BO8B 4OIIH 1XF5B 4MDIA 3QRGH 1F3DH 1HEZB 4FNLL 3PHQA 2MKWA 3KYOA 2EZ0C 1NL0H 1BAFH 4LFHD 4JZNB 2V5RA 2BCKB 4OZ4A 5A3HA 5JOFA 3I3DA 4HK3N 4LSDA 5T1LB 4H8WH 1PX4A 2ESCA 1NBVL 4JANA 4MA7H 4YX2L 2HVKB 4KVNH 4AQ1B 3FRUA 4C57C 4X4YA 4FFWC 2ZWYA 4Z7QE 4UOQA 4NN7B 1BJMA 3VFMB 5E2VL 1KJ3L 1PW3A 4AD2A 5IHLB 1JD7A 3BAEH 1B1YA 4HKZA 4XPTL 4TSCL 1EERB 1T2QL 1RZGA 1F6AB 4X5XB 4M7KH 4UAOB 3W0WD 1FYTD 5DWUH 3KE0A 4MTVA 2UYLB 2W0FA 3CDFA 3CHCA 1H0DA 1YY8B 5EPMA 3BW9A 4XNQA 1FP8A 3TO2A 3PWUA 4I18A 1B4JH 1DQML 1HNYA 1YY9D 2JJTA 4ZOAA 4NZJA 4NJAH 1WFNA 4DW2H 1G9EA 1IBGH 1QA9A 5IVXA 1CYGA 1I3GL 4N0CC 2XKUA 4JFDB 4UNTA 1WWCA 3JWDC 1RURL 2DEPA 1TA3B 4YDJA 4AQOA 4KTEL 3X13A 4QXGL 3DVNB 3WF0A 1XCQA 3WIJA 3QJFA 3PWLB 3HC0A 5I71B 1M01A 3JWNC 2FIRT 5D4YA 1SM3H 4NKMA 1G1CA 4K8RD 4JO1L 3NZ8B 2FR4B 4GH7B 4NM8L 3E0GA 3QUXA 4L4TB 2E6PA 1JNLH 4ZXBA 2XNAB 3N85H 3DO7A 1JPGB 2VE6A 5BZDB 4LPWA 3LQAL 3IAQA 4RAVB 5I1GH 2CLZB 3QDMD 4ZS6D 1LDSA 2D7OA 1MVFA 1G7PA 5HHME 4R26H 4KDTC 3X11B 3QQNA 4BSWA 3RWFA 3QUMH 4FNTA 3RWGA 2GQHA 2JB5H 5DYOA 4C54A 1MHCB 1U92B 2W0KA 2YA1A 1HHIA 1O7VA 3JWOH 1KIRA 2NW3B 2WVTA 2D3VA 4MJIB 5HGHB 3RCNA 4WHYH 1S7XA 4QXTB 3RDTC 3N9GL 4NWTL 4PJBE 1UXWA 2XRAL 3QWQB 5I1AB 3OB0K 2I24N 2BNJA 3QO1A 3PZ9A 3QIBB 2A9NL 3GSNH 4OLYL 4HQQH 3MNVA 4KHXH 2UUDK 3O3DA 5EC1B 1CG9A 2IBZX 1PIFA 2DQGL 5B39G 2PB1A 3SOBL 5I1HH 1A6WH 5D2NE 5LWYH 4XNMA 2A6IB 2DH3A 4P2QB 1FNFA 3T0VA 3ZYIA 3EDDA 5D6CB 1I8IB 2E9WA 1DCLA 3SDYH 4F80A 4GG6B 3PIQB 4D6DA 5FF6B 4PTWA 2HWZL 2FJHB 3QDMB 5FIPA 5CJ8A 4PY8J 1FYTE 5C1MB 3CVIL 3T8XA 2DDQL 2DGAA 1KQYA 3ALWA 2V3GA 5EC1A 2VUYA 4WUUB 4E5XA 2IANB 3HTLX 3MODL 4JFZL 1ZB5A 2YK1L 3VFNA 1MCRA 3LQAC 4LCWD 4FF5A 3U1SH 1CL7H 1U3HD 4OLVH 4AZ7A 1D6EA 3V6FB 4HXAH 1DQDL 2X41A 2FSEA 5E9DE 1P53A 1S7SA 4B7LA 5F93C 3K1KC 3MCG1 4L9LA 4KQ3L 1SJVA 4JN1H 1HILA 3W2DH 2V6HA 3BP7A 3PWJA 4KMTL 5HDLA 3PP3H 3MYJB 4G6KH 3DUSA 1B31A 2YD5A 4OM1H 2ZXBA 3GZKA 5ERWB 3V5KB 3U30C 4RMUA 4V1DE 5EORL 5CINL 1Y18A 3TH3T 1BTCA 1EDTA 1JDDA 3VXQB 2ZP0T 4UNVA 4XAWL 2AK4D 3UG4A 1MQRA 1X44A 1OAXL 4IJ3C 1P2CA 2ZE0A 3H3PH 4HOXA 5D7IB 3RVVD 1RURH 2E3ZA 1K8DA 4DOHE 4LDEB 4RBPK 3ZJ6A 3LN4B 1CGWA 4GW1A 3BD3A 4EXKA 4S1DD 2D73A 4Z18A 2AABL 4AD1A 3BKML 3DX1A 3M7SA 1BBJB 3H7LA 1C7TA 2AXGB 4Z7OF 3HZYA 5DMIL 1NAMB 3MUJA 4YDKH 4YHNB 2A73A 2H26A 4LEOA 1NGPL 5F1OB 3D3VB 1IGCL 3C6LB 1EZVY 1W0WB 2EXOA 1REIA 4Z0BH 2R2EB 4PUDA 4G8IA 1QHOA 3C2AL 2ADFH 1ORSB 5IB4A 2FEEI 4TQEL 3DUSB 2DBJA 4YXHH 1K4CB 1KTCA 2AV7A 1FRGL 5DR5H 1HF6A 1FP5A 2OP4H 2ZX8A 2QQQA 1NOWA 1ODZA 3ILPB 5IMMA 1WDPA 3SGJC 3OGCB 3RWDA 2O5YL 2CO6B 2JLLA 2XFXA 1ZBWA 4NC2B 2IAMA 3PBGA 1K4DB 3F7YB 1HHKB 4R4ND 1M4KA 2ZIDA 5HHOD 4D6CA 2R39A 5A6AA 5DJ2A 4NX0A 1EQCA 1BGXL 1AKJD 4HCRA 2J8UA 1MCCA 2WKLA 3BPCB 3N9GH 4J1UB 4NWTH 5D71H 3GH4A 5T3ZL 1JHLH 2R9HC 2QQKL 1GYAA 4LYRA 5FA4A 4B3LA 4H25B 3BDBA 2EEXA 3DYPA 4N0YH 1QP1A 4KI5E 2KUTA 5FV1L 1JPSH 3UBXA 1NMBH 2V7NB 4OZHA 5ADPL 3LKQA 1V7MH 1RIVH 3F6IA 4H26B 3S96A 5EUKB 3KL5A 3IT8D 1VGEH 4YK4B 3BP4A 1FO0L 3MRQB 5IVXF 1FL5A 5E2JA 3VFVB 3DMMC 4M1DH 4U1GB 4NRYB 1OBAA 3GJFK 4ZFGH 3OKNA 4NI3A 1RUPH 1JGDB 5BS0B 2KZ1B 4GSDL 4Y5XC 3MO1B 4X98A 3AMCA 4TVUA 1UG9A 4AM0B 43C9A 2DLEA 4JB9L 4Z0XB 4KUZL 2EC9U 1NEUA 1UH3A 2R1YA 2XVPA 3SEPA 4G7YL 3F62A 3RU8H 2VERN 4JFPA 4LSRL 2JTDA 2GEEA 3L3KA 4YBLB 4XPHL 2IQ9L 1NP2A 3VXRD 2EEAA 3IDGA 1S78D 3QIWD 1JPGA 2VE6B 4IIQB 4UBDD 1ND0B 2PBOA 3GKWL 4RMSA 1MJJA 5IF0B 1UR2A 3HUJB 1YPZB 4WWID 3OIHA 4NN6C 1RJZB 4R4BB 4NC1E 3UG5A 2PNDA 5I5RA 4AL8L 4UQ9A 2GTZB 1FO0A 4P5TD 5BVJB 1AQKL 3D3VD 3ALGA 4WHTB 2DKSA 5ABDE 3ZT7A 4LNRB 5EBLB 3VFWB 3WN5C 4NGHL 4S1SL 4E42A 4MVBC 1GW1A 3N0PB 1QI5A 2XUCA 1K5NA 5FYJH 3LKPA 1YN6B 4WEBH 3L95A 5IQ9A 3G6DL 3PNWB 3GMOA 5H94A 3FQXB 1UM6L 3ARFC 4OLWH 1OAYH 1CICA 4QXUH 2FNBA 1YEHH 1QLEL 4JAMA 3UPCA 3PZQA 3H8NA 4L3EA 4C7DA 1XH0A 4V2CB 1L0YA 1WNOA 2D1ZA 3N13A 1G9ML 4KHTH 5E8OA 5IM7A 5F1IA 3FB8B 4IDLA 3QQ4B 4KWUA 5IHBA 4UUJA 2YBTA 4LRNH 3DXAD 1LG2A 3EGSA 4HBQA 4NZRH 4DKDC 1JGEA 5CP7B 3FONB 1D9KA 4XXCA 3TVMD 1F11B 1EEZA 3GI9H 1NMCC 2ITDA 4KTYA 5DHYB 2ZKHH 1X5HA 2D4DA 3UTTB 4H1LH 2EEDA 2Y36H 1RUMH 3WF1A 4HV8A 3F4VA 2QPSA 3SDAD 2XQBH 1U8NA 3MRGB 2G75B 5F6IB 3EYOB 3B2UD 5HYEA 1BJ1H 4G7YH 3BP4B 2F19L 2FH6A 3TYGH 3HZKA 1CPUA 3HE7B 3H9SB 3Q1SH 4L5FL 3UP1A 3S37X 5E99L 4JFYA 4YBQC 1C5CL 1XMWA 1FZOB 4HGMA 2GJ6D 1H5BB 3C5ZC 4W86A 4ZFGL 4ZNEE 1A0QH 3ECBA 3BVNA 3PGDB 1MVUA 1BIIB 2MJWA 1UB5A 1TQSA 5IMLB 5J4MA 2AEWA 2YPLA 4KGJA 3NPZB 3QHZH 3QDAA 1IAOA 1NC4B 5HYFA 3QIBA 2FIKA 4LLDA 1A4KB 4ZUVB 3QUZA 2EJ1A 3RVUC 1EDGA 1NFDB 1WP6A 3G04B 4Y16B 3FT4A 3KPSB 1R86A 5F71A 1M7DB 3BEVA 4D9QD 1QW8A 2HJLB 3AM8A 3LEVH 1UD3A 2NT1A 4NFDA 2DSZA 1R33A 3QIWB 4M1CC 2ERJC 1WCBA 1S5HA 4LCUB 1QNZH 5EOTB 1BZ9A 5J1AA 3WS3A 2WWKO 5CD5D 5I1EH 3Q3GA 3MRKA 3EYUL 5E4EC 2CGRH 3NFPB 5E8OB 3SCMC 1PZ3A 1HQRB 1GXEA 1A7BA 1UJ3B 4ZS7H 3GH7A 1P7QB 5BV7B 2P5WE 1AMYA 5EO0B 3NGBC 1EHLH 3OXSA 2MWCA 1HOCA 4UQBA 4QHUB 2X6MA 5GS3A 4V2BA 1ZT7A 5IW1A 3QP3A 3VFOB 1N64L 2Q86A 1XH3A 2Z93A 2UV3A 3MLUL 2J62A 1X5ZA 1T0PB 3UTTE 4R5EA 3ILPA 4M8QA 2DQEL 1NFDF 5IW6B 4DUWA 3K74B 4WUUE 2O5ZH 5FGBA 3RTQA 3RZWA 2OK0L 4P2CG 4GKNA 3BD4A 4X6DF 2RBLA 1X5IA 3STZA 4R8WL 5ACZA 4HUXB 4XNUL 1D5BB 3D4ZA 4NCC2 4X9GA 4CVUA 4V28A 3C6SA 3QG7L 1YEJH 5DRWB 5J56B 2J12B 4Q2ZB 3ZE1E 4OLZH 3RGVA 1LO0L 3VI3E 1VRXA 4P0DA 3SY0B 4D9RD 2VDMH 1Z6JT 4ELKB 4CW1B 3L7EB 1UJ3A 1QI2A 4P5KA 1LP9E 5DMJB 2GFTA 2CBIA 1RK0A 3FO0L 4NQSB 3VGAB 2WVVA 4J28A 5DJ0B 1UA7A 5EFIA 5C07D 1RZJL 1JRHH 4Y1AD 2XVKA 1D2KA 4M24A 5MEND 2BXYA 4O2EA 5ESVA 2PUQT 4A6YB 5IJVB 4CVXA 2R0LH 1DEDA 1IFHL 4LGPB 3GSXA 4XP1L 5KANI 3AIRA 3QXAB 4X9HA 5CLTA 3QUYD 1ZHNB 4BZ1L 4JO3H 2AJZB 3GI9L 1ZTXL 5EZJA 3T65B 1XEDA 5ERWA 2V5SA 4LVHC 1H5BC 3V5KA 2WHMA 2PXYD 4L3AA 4YHIA 5EZLB 1KXTB 1KLGA 5SWSE 5I6XB 4QRSB 4NRZA 1D5MA 3HI1B 3IXTA 4NWUH 1QG3A 4RE4A 1NC4D 4WGWB 5FL1A 2ARJQ 4B50A 3H54A 4FQCH 4G8EB 1AQDB 4FLRA 1E4WL 4AL8H 4CCDA 5GISH 1IGMH 2IGFL 5BWFA 1ZHNA 4NZDA 4P8WA 4LQFH 5DO2D 2WC3A 3P11L 2EE6A 1V05A 4EDXB 2VSDA 1VPOL 5D8JL 2VZOA 4YHYC 3BVXA 1DWHM 1TNNA 4PMYA 4TXEA 3H0TA 3QI9C 2WAGA 3SDCC 3V6BR 4NN5B 2X05A 1IC4H 3PWVB 3SUWA 3F12A 5CWSA 5E6IC 2P8LA 4PG2C 1FAIH 4ELMB 1NCCH 1XH3B 1HCFX 5DQ9A 2QQLL 2CLZA 1LE9B 1FN4B 4RMRA 1Z32X 1NAKL 5J57B 4YBQD 3INUL 4J8RB 3FY1A 5A8NA 1ZLSL 4LCIH 1XGYH 2VT0A 1NUGA 3NTCL 3WUBA 3UC0L 3O4LB 3H53A 3QFJD 1NSNH 2X9XA 4ODSH 4U0RC 5D2LA 1Q9WA 4HK3J 5T1KD 5ACZB 4Z6AT 2XKNA 3KPLB 1JL8A 1KF9B 2BVYA 2BVPA 2CH8A 4N5UA 4MA1B 3VIJA 4K71B 1FGNH 2A38A 2W59A 4Z7UE 5ABFA 4JG1H 2YOCA 3TBWA 1S9XB 2AJZA 2APBA 2NY1D 1KTLA 1QTYT 3MRFB 4XCFH 1FBIL 2NXZD 4R4FH 1YPZE 5FM4A 3BUPA 5HI3C 4OF7A 1MFCH 2DTMH 4JO1H 5D1XC 1NFIA 2VC2H 5A3IC 5KS9F 1BQLL 3VRJB 4FNQA 5J6HA 3VFSB 3LN5B 1G9HA 5C0JB 2FGWL 4HLZH 4P46B 2J88H 1SYSB 1JVKA 3L3JB 1R5IB 1ZGLB 3MRQA 1L0QA 4M02A 5JQ6H 5DK0A 3QXWA 1KEML 4M6NL 2X1XR 5BXPA 3BZ4B 5C0DB 4NJAL 3B5GA 1BFOA 1I9RH 3MNVB 1BZ7B 4P4RA 3TIEB 1OSPH 3TJEL 1U8KA 4KVCH 1BEYH 1KXTA 3MSDA 1DUYA 4RDQF 4AZ8A 1HIMH 3NIFE 4HKXB 1HWHB 4GRWE 1YYLL 4Z7NF 5IR1B 1FH9A 1MUJA 5JBDA 5L6YL 4XPFL 4NQEA 4PGBA 4M1RA 1B3VA 1FLRL 1CD1A 4PJEB 4NQTA 2UWEA 2DLFL 4WKHA 5E2UH 3U7YH 3UR8A 5GS2D 3VIOA 3MANA 2QLYA 1EAJA 5D4QA 4X80L 3I6LD 4HQQL 3L3DA 3QIUA 3EMZA 4HULB 2NY5L 2YUXA 5E94B 4PJGF 5FYLE 1KXVA 4HOWA 3O6FD 1T20A 2APTA 4YHZH 3V0WL 1B30A 3TH2T 3S36X 2JJSC 4RGOL 3BH4A 1HSBB 5I8CA 3ES6A 1BM3L 4ZDHA 3GMPB 3MLWH 2VLJA 2R0ZL 2NY0B 2CKSA 5EO0A 5AZ2H 4RFNC 4JDVB 1LD9B 1JNLL 3JUYA 3OF6D 2XIDA 5MP6H 5FAAA 3MV9A 4ATWA 2BHZA 3AFBA 4HZ7A 3RPMA 1ZE3C 3QHMA 5IW6A 3GJFA 4GRMB 4ATDA 1MCBA 3RWCB 3WHXB 2ZXAA 2Q8BL 3SCMB 5JZ7C 4X0KA 2ZUWA 3L5WA 1K3IA 4UIKL 2O61B 2Q6WB 2ZCHH 5IM7B 4YFLI 4MA8L 4OGZA 2XIBA 1R3KB 1Q8MA 2JCCB 3CU7A 1J88A 1FBIH 1JF1B 3OJVC 2CKBL 2G3MA 4HMCA 3WH6A 4NKOB 3IRZA 4JFXA 5ILTL 3TF7C 3AISA 4F7MA 4D8PB 1PBYA 2D03L 3U2SA 1QPKA 4JFPB 4IRJD 4OCYL 5FOBB 2WINA 4YXKH 2CETA 2X0YA 4AZHA 3LMJL 1T1ZB 5MERA 3LKOB 1SYVA 4R90L 1FDLH 3FKUS 3DVIA 2W1NA 1OGGA 1UM4L 5DD0H 2VX5A 1M71A 1X5AA 5GNYA 1VF8A 4LSSL 5FGSA 1DZBA 1KN4L 4PJEE 3TESA 3N1QC 3P4OA 4YFEA 1UXSA 5C0CA 4Q9QL 5F7LB 4KK9C 4LGXA 5E2TL 3FQRB 1BAFL 1U2CA 4XPFH 1CN4A 3REVB 4PUEA 3W28A 1I8KB 3D69A 4P2RA 2ESVD 2QQNH 2WWMD 3JWOL 4K3EH 1IKFL 4P3WA 5F6IC 2G2RB 1W9DM 1LP9F 2QPUA 5E4IA 5HHPA 1EO8H 4UILL 3KPSD 3KPNB 3LEYL 3H9SE 2RHEA 3OKKB 1N5AA 4JPVH 4XP5H 2PETA 4HXBL 2BV9A 1YJDH 5L2KA 5B39A 4G6JL 2WNGA 4JO3L 5D7JB 2E8ZA 1V6XA 3MFFB 1MY5A 2VDPL 1ITBB 3CHFA 3ULSB 3FB5B 3F58L 1A1NB 4JM2C 5TE4L 4MSWA 2X40A 5KSAD 5INCA 5IVNA 4UBDC 3BUYB 4LHQB 4NQDD 4J6RH 3SKMA 5HHQB 3A6BL 1L9NA 4P5TA 1LVEA 4XP4H 1NAMA 5JORA 3RHWF 4U2ZA 3UESA 3B3IA 4LMQE 2HTKD 5INDA 2LVCA 2QR0B 5CGYD 1TVDA 4P7NA 4IMKA 1I7TA 1OCWL 1RULL 5EMYA 4D3CH 4NNPL 3U57A 1YNLH 1Z3GH 4Z76A 2JELL 2VAAB 4QOKE 3RVWD 2WBJD 2PW1A 2X2IA 5B3JF 3QPQC 5T5NF 2XZQH 2ORBL 3QBTB 4JKPL 4YFDB 4GRLA 5FOJA 2D7QA 1KSRA 1SEQL 2X4OA 5SWQA 2XXCB 4EUPA 2VWEC 4U3HA 3KLHD 2JCCA 1JBJA 1ZHKA 3W25A 1BYDA 3AYSA 5EU5B 5I1LA 5IQ9B 2RGSA 2X9YA 3W11C 3VWKA 4PCTA 4X7TB 4QXGH 3AIVA 4MD5A 1D5BA 1XAUA 4Y16D 4A2LA 5A6JA 1AGBB 1FSKC 3H7BA 4L4TE 1FZMA 1I3RB 5FYJD 4DO5A 2R69H 4G6AC 2AOSA 1MHEA 5JBFA 2E27H 2GAZB 1P6WA 4PJBF 4YZFE 3QULB 2DM7A 2BNUB 3DURB 1RZKH 4KKLD 3O0RH 1A6ZB 5F96L 2OW7A 2IAMC 4G9DA 5CEXA 1JPST 4PY7A 1DEEB 4BFBD 1W1VA 3KHQA 3GBLA 2AXFB 4X6FA 1JYXA 1XYFA 5L7XH 1XCWA 2WHLA 1CXIA 1V3HA 5EU3A 1WO2A 1OWWA 2P8MB 4JFWA 3VIIA 5A2FA 4AD0A 4D0BA 3T09A 5DJAA 2YPLB 2X1IA 5AD0B 4U6HB 1SMDA 1L7TH 4WKFA 3QCUL 3K7UA 2Q1EA 1JHTB 3W5NA 3O6AA 1VIWA 3L4XA 4PGDB 3ZJ7A 4HP5A 2EH8H 4Y16C 1NDGB 1KG0B 5CBEB 2UWEF 3D6GA 1U8OB 3QUMB 1KN4H 4J27A 1UC6A 2EDXA 2F19H 3ULVD 1W2VA 1LDPL 2B2XL 4TUJA 2FWOB 4XP1H 4LPYA 4F9PC 3VFUA 1WIUA 1LE5B 1U91A 1WAAF 4P23B 3M1BA 3BZDA 2JF6A 3DECA 4DWSD 2CPCA 4U1SA 3SCVA 4LSRH 4HX1B 2JIXA 5KG9B 4DVRL 4MS8C 4O58H 3WDHA 1GOFA 4Y2OA 3MJ8A 3S35L 3WL9A 2WCSA 4MSWB 2ZKHL 2GAZA 3HFML 2J8UE 4N0FB 2AQ3A 1YY8A 4OZOA 4QY8A 1S9WA 1NQ6A 4AEIL 3D39B 4NUJB 4WSKA 4Q22A 4ZFFA 4QRRD 5E99H 2V2TB 5IWLA 3WF4A 5HGAA 1HHHB 4LPXA 1QEWB 4NQDB 3MZTA 4WCYH 2V3DA 1BFNA 3KPOA 1OWRM 1WZ1H 1QSFD 3X3GH 3QNXA 2CDEB 5LQBL 2Z8WC 4XXDA 1RIVL 1H3TA 3RL2A 3GI8L 3N06B 2PW1B 3MXVH 3WIFA 4MJ4A 1NCTA 4HXBH 1FC2D 4LLWA 2VAJA 3SDXE 4GIAA 5KSVA 3RZCD 4CVZB 3DUHA 1IGFH 2V2WB 2XN1A 4N8VB 1I9EA 1T0OA 1GPOH 2VLKE 2MMXA 2EICA 4X0KB 1VBUA 4QRTA 5TQ0H 5MEOA 2GSIA 3ZE1F 2F54B 3MLTB 5JLZB 3MUY1 1YUHB 2CPUA 1AKJB 3GXNA 4BH8B 1GHSA 1MI5E 2ICEA 4PN2A 2HJKA 5FUCE 4OLXL 4Z7WA 3VDBA 1MIMH 4O2CB 4X7SH 1PX8A 4HEME 3ARWA 4JFFA 2YPVH 3BLBA 5F96H 4YC2C 1FG2B 4V1DD 5DC9B 4WEBL 3PV6A 3WDJA 3AHYA 1QZ1A 1A4JA 1KIRB 5I1EL 4GKZB 5DJZA 5JDSA 2E7CA 1FFQA 3L1OH 4C4KT 5JLZA 3WDRA 2ADIB 3O9NA 2BNRA 2HMIC 3HG5A 4ODVL 5E0FA 3EBAA 2AK4E 3UTZB 5DFVD 3RM8A 1H1NA 1KLUB 4WFGE 1JPFA 3SDAB 4YE4L 4BM7A 1QLEH 4LAQL 3EFDL 1U42A 2FYVA 3K0WA 4WUUA 4D94A 3ZJKA 3RY5A 5I73C 5M95B 1GGIH 1UM4H 5DD0L 1UG6A 4M6MH 4R4NC 5A2IH 5D70H 1GGCL 4XNXH 1P9MC 4XV0A 4OFIA 5DJDA 4U3AA 3FB7A 5K9JL 1U2HA 5C2BH 3L2MA 3MYJA 4LVNB 5GS0C 4YGVA 1ZGLM 8FABB 2D9QB 3HNVH 5ITBL 5FGRA 2GFBB 4N8CL 2VZ3A 2OMBA 1DQQA 1Q0XL 3QUXD 4UAOC 2IPTL 2XM1A 3MMDA 7TAAA 1HJXA 3IDUA 4LHJB 5IBTH 1INQA 5T3ZE 3GSUB 4D8PA 3MUGA 4PRIA 3SURA 2WW8A 5I1DB 1OTSC 2DQCL 2X4RA 4GUPA 3RP1A 4OD3L 4Y2DC 5HHNB 1RULH 3GJFH 4A6YL 1GJUA 4U0RB 1U8NB 2UYLA 3S2CA 4NRSA 2BSRB 4WI9A 2NY5H 3GSQA 2KQMA 5DMYA 1RUKL 5CPQA 5H37G 3LXAA 1JNHA 4FG6D 3RKPA 1A1MA 3LV3B 5BXTA 3S96B 3CFBB 4QGYA 5E2UL 1MW2A 5I77A 3BC9A 2D4FA 1Q9OA 1R3LB 4OV6F 5IW1B 5CAYB 3GBDA 2WP3T 2Q8XA 5HYQA 2XG9A 2HG5A 3GTNA 3W82A 4WFHE 3JTSA 1G84A 1WFOA 1CWYA 5FXCH 4U6YA 3UJTH 3BPLC 3LH2L 1HVXA 2ZX6A 3V0WH 4XVSL 3U83A 4YHZL 1E1FA 1YYLH 4U6VH 2YR3A 3QR2A 2LAAA 4C56E 1S7TB 5TDPA 5FL0A 2F54D 1UZ8B 5E8NA 1UWGL 4Q6IC 5BV7C 3RNQB 2BOBA 5JNYB 2EDHA 5BS0E 4WI7A 4TYUA 2ZUUA 5LBSL 3UTZA 4X6DB 1EPFA 2WBWB 1E4WH 3MO4A 3S6TA 5C8JA 3GB7B 3CMGA 2R8SH 2EDWA 4PV9A 4R4BA 5EORH 2BS9A 3MV7D 4MJ6A 2VXUH 3E1F1 1CK0H 4NCC1 4MA8H 3ZE0E 1E9LA 1QD0A 2FO4A 1HKLH 5DRNA 1SY6H 2EDTA 4MXQD 5EUKA 1J8HA 1G7MB 4LIQH 3HNSH 3MLVH 2CO7B 3DJ9A 4QOKB 2P5EA 3LQAH 4XWOC 3WKNA 3GIVA 4DGYL 1DQLH 5K9KB 1DN0A 1XCTA 5SWZA 3LN9A 2AJXH 4XMPL 3GGWA 5EO1B 4WTWA 3HR5B 3F5LA 1ZLSH 3VDHA 3AXHA 5FD0A 3CFBA 1KXQE 3NIYA 3QQ3B 5KTEH 4BQCA 4F7TA 3OR6B 1FORL 1G0DA 3QFJE 4RGOH 1W9PA 1AC6A 1HZHL 5K9QG 3EZJB 5ISZB 3ET9F 5GRXG 5LG1A 1SVCP 4KJYA 5ETUA 1T5WB 5DA4A 4TVCA 4MCYB 2ZUNA 3U0PB 3WKMH 1ETZA 1F3JA 4JDZB 5LCVL 3V6OA 1BX2B 3S34L 4AM0A 4F37F 1KNOA 5D7KD 2E9MA 2OQJA 5DFVC 3MLWL 3W39B 1FLRH 1CE1L 2VZVA 4E41A 3MV9D 4LVEA 4YR6A 2YZ8A 4XBPB 4YPJA 3RUGA 5GISL 3NZHH 4J1UA 4HWUA 3SCQA 5CBEA 3AMGA 4APQC 1EUTA 1IE5A 3NSXA 2WM0A 3CFCL 4BSVA 1TZHA 3VXUE 3VD3A 4PBWD 3QDJA 5TDNB 4FQ1L 1QSFE 4RWYH 3QFDB 2A74B 2Q7NA 3BPLB 5SWSA 4EN3C 5LGHL 1P2CB 1PG7H 1ZAGA 5J12B 5JR1L 5I23A 4RFNB 1FQ9C 2J8GA 1ECEA 4UV7L 5E95B 2H32B 5C0FA 5LBSH 3PTMA 1FAKT 1RIUL 1U8QB 3TVMB 3S4SB 1YQ2A 3WENA 4OTXL 5IQ7L 4GI8A 3LRSB 5F6HJ 2CK0H 3KJ6L 4FZ8L 2Z31D 4JRYB 4R7DB 1QBMH 3IDMA 1IRAY 1YN6A 4AEFA 3LMYA 4KC3B 4Y19A 3L3HA 4A3HA 1RUAL 2EDRA 3OGCA 4ZOBA 4TUKH 1F4XH 1US3A 4FQPA 1JF1A 1RZFL 4YXLL 4ZUTA 1BZ9B 4ZNEA 2HRPH 3QUKB 3KDMA 2PCPB 2J88L 4OGXL 3Q5YA 2V38A 2FSEB 3NH7L 2C3GA 4Y5YC 2VDOH 1W1TA 3QHTC 5DQDH 3IDJA 3TONA 4NO2A 4HOZA 3LAFA 1OP3K 2A3HA 5IROA 4LNRA 1E6PA 4YEEA 1HXKA 1ZT7B 4PP1D 1Q0XH 3EYVB 5ENWB 4MCZA 1U93A 2PR4L 1CBGA 3P4NA 4YHNA 5C0AD 3QUMA 2XHYA 3QNZA 4I3SL 3T0XA 5FEBA 4MA1C 3TO4D 4QF1A 1JGUH 4FXLA 3W39A 3UTQA 3OTTA 5FCUL 3C8DA 4NKMB 4IRJC 1RZ7H 2J8FA 1AO7A 5K9JH 4UIMB 1CL7L 1F4XL 5E08H 1GZQB 4X9FA 4Z7NE 1HQ4B 3VA6A 1CK0L 3J8F7 1G9NC 3U0PA 5D2NC 4I0PA 2DDQH 5LGJB 3L3DB 2D3NA 3LRKA 2EYRB 5HYJD 4XP9H 4P2QD 4Z0XA 3UTPD 5JW4N 4P4KB 5EIVA 2CD0A 2XFXB 5T1MA 1MSPA 4FFYH 3ZDYE 32C2B 5BMFL 3CUIA 1N3NB 5E8PA 4KFZC 2PKDA 1IAOB 5IDIA 3KPSE 1KELH 4HZ6A 4OOUA 2C3HA 1C91A 5CZVL 1UB6A 5D72H 4KH2A 3VXTB 2OJZH 2J5LB 1CLYH 1HKJA 1I3VA 4MB5A 5HYQB 2OWXA 4NO0D 4X4XB 4KQ4H 3RPIB 2XTLA 4KVNL 3EUUA 3VWKB 4UZSA 1G6RH 2NTSP 2OXGA 2EO1A 5GGRB 4ONOA 5JXEA 4JM4H 1WFTA 3FW6A 1DDHA 5DUMH 4ZAKA 1E70M 1CE1H 1G1YA 2N1KA 4EDWH 5IBLD 3W11D 1D6VH 3BLKA 4S1QH 4NN6B 3WD1A 3LKRB 2VC9A 2XWDA 4FFZL 4O51A 4U6XA 4UFKA 1HQRA 3OX8B 2WAHA 5GGRY 3MC0A 3WFBH 2NY2C 4PSRA 3HC3L 3ZO0A 5D2NB 3B9KD 4GJTB 4P8UA 4RGNB 1UCTA 4TNVK 3QWRA 4FTVE 3UPRB 1PY9A 2AGJH 1AGEA 2BVOB 1B2YA 1K8IA 2Y25A 5CMAA 5D7LB 5K59E 4UQDA 3MGOB 1V3MA 3QUYC 1A14L 3MV7B 2QEJA 4ZUUB 1MCHA 4JHBA 4Z2JA 4L1DA 3UEQA 1J9YA 3OKOA 4F57H 3MNZA 1CR9H 3AYRA 1XR8A 1I1CA 2FIKB 4LLDB 5CPTA 3T4YB 1KPRB 5HXMA 3SCNA 4FQXA 4IRZL 1R5IA 2O5ZL 3MOAH 2G3JA 4MNLA 2BC4B 3SE3A 5DD1L 1AXSA 2DT2A 3P4NB 3TZVA 1IGTB 3UYOD 5ABGA 3TV3L 3ZYOA 3F7QA 1V6WA 4XH2A 3PZNA 4WU5A 3NCEB 3S3PA 2VN7A 3O4LE 1HKLL 1I7RA 4NC0B 2OS7A 3PZVA 4BKLA 3LQZB 4ZTPL 1TLKA 4XMLH 4W4OA 5BV7H 2AI0L 4OJYA 1U8MA 3ZDXE 3LKSA 2C7UA 5DUBA 5HSFA 4X5WB 1LQ0A 4G43B 2BOBB 3O81A 4NHCL 4X4MA 5F7YC 4FXGB 2E4TA 2X8RA 4PJXA 2FECL 1JPSL 5DMKB 3CJJA 5D7LD 4YWGL 4AEHH 5BOPA 4ZXLA 3THMH 3AAZA 4W5ZA 5F1NB 3MJGX 3VNYA 3BRGC 3BUYA 3SKUD 1IEHA 1CXLA 1RPQA 3ULVH 4QHNB 4TTUA 4P57A 4W4NA 5CGTA 3WIIH 1E6OL 1X3DA 5EOCH 3O2VH 5EBGA 2RGLA 4LFHG 3RZCA 1XGPA 5CIPA 4PJ5D 4U1SB 5JOFB 5J8OA 4P5TC 4K9EC 3OKEB 1I8KA 2DQIL 5BO1H 4Q9RH 2WMJA 2J7HA 5J13B 2CDEA 2HTKC 2VLMD 4GRMA 2ED8A 4I8DA 4XNYH 1FVEB 1LK3H 1DBAL 2JJUA 3WIIL 5HPMB 3VFMA 3U36A 4GG6F 4M1DL 4YHPB 4MNGA 2NR6D 2JKXA 5FDWB 3BKMH 5HGAB 4HWEL 1AXSB 4IM8A 4LF3A 3ULVL 1NGYB 5HI4C 3FFDA 4MA3B 4HUWA 1G9MC 3VDCA 4GMTH 1A9BA 4AY1A 3Q48A 3S36H 1BJ1J 5D6DA 5TQ0L 3CCHA 3W29A 4OZFG 4I2XA 1VSCA 3OKOB 3RILA 1TJIL 2P49B 1C5CH 4RBPH 2FX9L 3WFDL 3F6LA 2CUHA 1TQVA 1TJIH 2D7NA 4FN0A 1CDUA 4HUXA 1Q9LA 4JFHE 4WUUD 3EYFB 4PRPB 2ZOLA 2X4PB 4JZJA 2DWDA 1VFBB 4F9DA 2NTFB 4HIEA 1W0YT 1V02A 3I9GL 1A14H 2R4RH 1CFSB 1YEHL 3F12B 4RAHA 3PL6D 1TQBC 5K9OA 3BQUD 1IEBB 1CZ1A 3SCSA 2V2XB 4BSWB 4ORZC 4PB9L 3NIGE 4CN6A 1QLFA 4F37K 2PXYA 3H3BC 2C9AA 5FYJL 4ZSOA 1PG7X 4EDXA 5D1XB 4K7PY 2A9ML 3HZMB 2FHCA 3MMEB 1I9IH 3WV0A 2JCCE 1FIGH 5DT7A 1CGXA 1VCAA 5IHZA 4U1MB 3LEXB 2HMID 3VGAC 4YQXH 5JW4M 4FQQA 2A6DA 2ZXQA 4YPGA 4LQ1A 4OKVB 2QF8A 3X13B 3ALPA 4UINH 1Q0YH 5FB8B 4GRWB 2DQTH 3KNBA 2ZZUT 3G9VA 5JUEH 3ULUH 2NW2A 1JYVA 1N82A 1TETH 3L2LA 4FTVA 3L4TA 4YNYB 3V4VH 5GZOC 1GHFH 1S7UA 3G5VA 3UX9B 5IR1A 1QPXA 2D2OA 4HJJL 3VINA 2WMKA 3VVGA 1C93A 1E6SM 4KRPC 1RAMA 4P5MA 5C7XH 1YECL 3AB0C 1FL6A 3HE7D 4PGZA 4OQTA 4JQIH 1KFAH 4WFFD 4HW6A 3WH7A 4G9FB 4YGVB 3SBWC 1KPUA 1D7FA 3BUQA 4LSUL 4I77L 3VXMA 2XWJA 3UYRL 1NCWH 1ROWA 3ARVA 3C9NB 1MPAH 3CLWA 1JWMB 3L5XH 1OP5K 4OUOA 1LQSR 5IUSA 1G7MA 3O6KL 3OZ9L 2GT9B 4P7OA 5D7JD 5HGHA 1FNGB 4NZTH 5A2LH 5J6GB 1ZEAH 3TCLA 1I8LA 2VXVH 4A6YA 5IJVA 2QLVB 3BKJH 5FHAL 2H45A 1LE9A 2DD8L 2DDXA 3MRHA 1EEZB 1SYSA 2XYCA 1FORH 1MLCB 4JPIA 2XSAA 1CE6A 4HXAL 4HUKB 5I66A 4N42A 4PV9B 4JHOA 1E6XM 1DE4A 2O9PA 1QVBA 1INDH 3KLDA 2AJVH 1M03A 4WFHD 1IZKA 2H2PD 4D9QE 4LASH 4J6RL 5DUPL 5LAXB 4ZUTB 4PJXE 1EFQA 3E3QE 2E7HA 3O3BB 4X7FC 1KTDB 1IAIH 4DK6A 4EI5B 2MANA 4TPRH 2WBGA 4XWGH 2E9JA 5ISZA 5IHZB 2J7EA 4FHBD 5CEYB 3VM5A 4Z7QF 2L0DA 1KCLA 4MAYB 1ZGLP 4YXLH 4G9FD 3BEWB 1G7IB 3N11A 4JFVA 4PMRA 3T0ED 1TMQA 5I8KH 3BT2H 1GCFA 1B6DA 1X9QA 4OCSL 2CLRB 2I5YL 2WZPD 4RE2A 5L8KB 1LNUB 2J8HA 4NRZB 3QCUH 4QNPE 3QFJB 4W85A 5D5MF 1RIUH 3BIAX 4EOWH 2CLVB 3O6MH 4LVOC 4R9HA 1OINA 2VLKA 5ACLA 1HL9A 3FFCB 3STLA 1VFOA 1MHHB 3CZFA 4PREB 3IU3A 2J78A 4OGYL 3C08L 3NIGF 3BVUA 4OGXH 3A67H 1QR1A 2FHBA 2VISB 5T5FH 2YKLL 3CFKA 3VPLA 4QRRE 4O02H 4QHKJ 3MJ7B 3CH9A 2R69L 1KEMH 2ALWA 1QI3A 2QKIA 5L8LB 4PY8I 3O3BA 1HZHH 3ULSA 5DSCB 4L8BB 4XRCB 3AREA 2VABB 3LX9A 4AD4A 1PYWB 3C5SB 2Q7YB 1NMCB 1RJYA 5DZLA 5EOQH 5FECB 1R7AA 2E9BA 3W0WA 3C09B 1C92A 3NCFB 3C5JB 1X4XA 4MB3A 1EIBA 5C0EB 4LSSH 1Z9LA 2XZAL 1FNEB 2VLRE 3WEXA 2F7OA 4JY6B 2DBLH 2Z0BA 4TVPL 5T33L 3LCYA 1OAZL 3PQYB 4AIUA 1DQLL 4XMKH 3GRWL 2PC8A 2DT3A 4OCYH 1CDHA 2VXVL 3CSBA 3CPUA 3GRWH 4KKLC 3H9HB 4JDVA 1IAIL 3F5KA 2B1HL 3C5JA 3O6KH 3OZ9H 4H0HB 5GGTA 2HT2D 2YDSA 3VWJD 4XGZB 4TUJB 2A77L 2XFRA 2A3EA 4M6OH 5CLWA 5JW3H 5C92A 2XKSA 2F7PA 3RI5F 3GXMA 4Z8FL 1UWUA 1BREA 3GH5A 4WTZG 3SDYL 3SKNA 1HHKA 1ZLUH 2AP2A 4KTEH 3VH8A 2EACA 5A2CA 1OARH 1QSEB 4HDIA 1ZEAL 3LN5A 1ES0B 3MRNA 3UROR 1A6WL 5LWYL 1BFTA 3KL0A 3TFKC 5GS1C 2CHOA 3BGFB 1G9NH 4PJIA 5IFHL 4G9DB 2BY2A 5CEXB 4HWBH 1QFUL 1DQMH 2X9WA 4W4OC 2R1XA 3U7YL 3LHPH 3OMZA 1MREH 2H6PA 2WWKT 2G9HA 3A21A 1B0RA 3EOAB 5IMMB 4M82A 2G5BA 3WQVA 4KGLA 3UJJH 2HVJA 4LAQH 5C6TH 3SCOA 1FVCA 2OSLB 1NCCL 2IFFH 2AW2A 2WK2A 2XTJD 3HE7C 4OBRA 1OPGL 3RTQC 4UIMA 4ZYKA 1UYWH 3S88L 3EMQA 5D9SB 3C60C 4X99A 2OR8A 2V9TA 1H8SA 4PRAB 4CVZA 5ECUA 3VW3L 2CKRA 4Z95H 1OGBA 1SY6L 3CV5A 3D5HA 1ZT4B 4XCYA 3L95B 3ETBF 4O02L 1CLCA 3PTKA 2DIAA 3MRCB 4R90H 2Y6SC 3RGVC 4KMLB 3D18A 3D5OF 4FFWD 1IV8A 4AWEA 4JZOB 5F88B 1HSAA 5DHXB 3SDXF 1MWAL 3JWDH 1XGUA 4L8DB 1UWXK 2AEQL 4PJEF 5J89A 2FBJH 4KKAC 3ARGA 3UTSA 4U3XA 2R1YB 1WT5C 4D0CA 3PQYE 2YMXL 4HIJA 1RHHB 3EOBA 3RWCA 2ICWA 1MI5B 1NANI 2DTML 3U46A 4ZPVA 1I7UA 1X6NA 1GQLA 3BHBB 3T77B 3KG5A 2X4QB 3TVMC 1I7ZA 1A3RL 2X1OA 1R3IL 4KI5C 4ODWA 4KK5D 1Y7VA 4BQ9A 5HD8C 3CXDL 1E4KA 3UTTA 1HEZA 1ZTXH 2NX5D 2VVNA 4PJ7B 3OAZK 2Y8KA 5I1LB 1V6VA 2AXJA 1S5IL 3GO1H 5E9DD 2DN7A 2IAMD 3EJZD 3NA4A 3KYAA 3DV4B 3GMRB 2GITA 5L0QC 3V52H 2HJFB 2NY3C 3S6CA 2W38A 4HS8H 5LXGH 3DIFA 1XGRA 1H4PA 3UTSE 1O7SA 3O41A 4ODXA 4ZXOA 1P1ZB 3GM0A 2F8VA 3O11A 3SUVA 3AS1A 4OCNC 1J0JA 4CMHC 1BG4A 4PMQA 2ZOKA 1MXDA 4M7KL 1I85C 3CLFL 3PGCA 3HLAA 1ZA3B 4L9DA 1LE5A 3BPCA 3IANA 1B0WA 4XPTH 3TJHC 5I6XC 1U6AL 4ZAKB 1P84K 4XBGB 2W4XA 2WC7A 4L4OA 1E4NA 1ORQB 4MNQB 4OUUB 3BZEB 4IRJB 1T1ZA 3O41B 1YPZF 3QXDB 4PGDA 4JRYD 4WFEE 1VACA 2NY4D 2JIEA 3P40A 4F15B 4HCRH 3VIHA 1CFNA 2ADIA 4GI6A 2V5TA 5ICXA 5BRZE 4ODHL 2DQDL 4ZFOL 1XRVA 3BN9C 3HR6A 5BO1L 1AVAA 1I75A 5C07B 5JW5A 3VOCA 1XZ0A 1CZ8L 1T03H 1BOYA 3BUTA 1R5WB 5JOPD 4OF3A 2JIXB 5KG9A 1TZ7A 4TNVF 2ICWB 3HI5L 4GRLB 4GO6B 1GVIA 3ILQC 1QSZA 1XIWC 1LL4A 2NW0A 3TBTB 3EFFA 3WBEA 4NHCH 3T0EB 1T7VA 4F3FA 3QEQD 3GIZH 1RIHL 4DWSC 2CGRL 2W0PA 5F9WB 4AD5A 2X89D 3H42H 2VDKL 4DVBB 4YLQT 1H0GA 3WQ4A 3MRDA 2DI7A 1P6AB 4QHKI 4HH9A 1HHJB 2D31B 3BGMA 1WWBX 3Q0HA 2OI9C 3HA0A 1GGBL 1QHPA 4IS6A 5FO7B 5A16A 4PJ9B 2EDEA 3KL3A 3CLEL 5IF0A 1PGRB 3GBNL 5IOPB 1FFPB 2AI0H 1QWNA 1KTDA 3ARFA 4RQQB 5GGUB 5IMKB 2HFGH 3TT3H 4JRXB 4WI5A 4R6UA 2PCPA 3P9MA 3MRMA 4M8QB 4P5MB 5TE7L 5B38B 1UKQA 3PWPB 1ZLUK 2FO1A 3LXCA 2YUVA 2IGTA 2XPGA 1MRFH 2FEEL 2LU3A 3G6LA 1LK3L 1RMFL 5KS9E 3G04A 5E5MA 1J86A 5E8DL 3NCYS 4P3DA 4I18B 4EXPX 1UEMA 3VFUB 3QWOB 3A6BH 4HWBA 4EK7A 2VX7A 2IXUA 5C3LD 3W0KA 1GUVA 3P9MB 4S1QL 2ZSWA 3VSUA 1K9DA 3O8XC 3MV01 1AFVL 4LKXB 5JUEL 3WXWH 1N4XL 3QHNA 2C5DC 1BMGA 1E3XA 2OLHA 4TVPD 3O3DB 2AGJL 3SKOA 3CPLB 2DH2A 1M04A 3APGA 3Q6GH 4K8RC 3V4PL 2OJZL 5ELIA 1EO8L 4L4VD 1MFAH 3O6FB 1S3KH 1XD0A 2V7HA 5F7DA 3OPZL 5FO8B 3LZFL 1DANT 2OJEA 3O9WB 4PD4J 5JO5A 2FHFA 2DQDH 2I9TB 5A8QA 1BJ8A 2J8OA 2BXZA 3GRWA 1QX1A 1KNOB 2P46B 3O2LA 4AMCA 1DWAM 4PRWA 4JKPH 1HYSD 4HPHA 4RGNE 4PP2A 3U4AA 3O6FC 4ISVA 2OYMA 1JXJA 3G5ZB 5EFDA 4XPHH 1AFVH 3GJFB 4I5BB 4QOKA 1MJUH 1N59B 5DEFA 3DROA 3SDXA 4JRXA 1CZ8H 5FYKE 1T03L 2XVGA 5CSGA 2D03H 1HI6A 2CJUH 2XJ7A 4HH9B 2VVSA 4G43A 1GJWA 2A74A 2MTPA 3DXAA 1Q6GA 2D20A 4M62L 2IMNA 1IAII 4Y4KC 3CUPA 3BAWA 1LF1A 4F79A 1UVQA 3S36L 2Y7QA 5GJSL 3PGFH 1FYHB 4YZFF 1E5JA 4Q6IA 5DQDL 2J79A 1S5IH 3GO1L 3DI2B 5K59F 2FJFB 3L3HB 1VHPA 1BOGB 3PIQA 4PJAA 5FGCB 1CBVH 1IC7L 3RX7A 1OT2A 1EVUA 1AR2A 4ZFMA 4CAGA 4HU8A 2PR4H 3RL2B 3MXWL 3U7BA 4HLJA 1V7NH 4WW2B 3T4YA 3FJTA 2R9HD 3RL1B 1TXKA 5D7IE 4RCAA 4PP1C 1Q9WB 3TBYB 3H9SD 5ESAB 4GQQA 1TTGA 4K55A 1OGSA 1NDMB 2D7PA 4FQIL 3WUGA 2GITB 4JGJA 2DSWA 3RPIA 3RKDD 1WWAX 1UFUA 1NMAL 2JEPA 4QXUL 3BKYH 3NOIA 2DSKA 4BH8A 3CK0H 3RGVD 2QHLA 2ADGA 2J7BA 4L9LC 3VXNB 3QUZD 3QJHB 4DM1A 4XGZA 4NQDE 5SX4I 1IGYA 3TT1H 4NQXA 2VL5B 4M61B 2UZYB 3S5LG 1QKZL 4UFJA 4KKAD 4KZEL 2UZIH 3WD5H 1UH4A 2IANA 4FXGA 4DKEL 3GXPA 2JJWA 2YLAA 1MUJB 4BSJA 1FL5B 5FV2A 4J23A 3AHXA 3PWPE 4MD4B 4D0CB 5DURB 4Y1AA 4P7QA 5E2WL 3GSNA 5M3WA 3SDXB 1G7PB 1MFBH 3RVTC 4TULL 4KKCD 4CNIB 3IGAB 4MCYA 4KQ4L 3DX9B 2FD6L 4L1HA 3FOLB 5D93C 5KANG 4OFKA 1R24B 4M6AA 4MQ7B 4F7PB 1E4IA 2CESA 4JAWA 5KSBE 3TA3D 4X7DC 1DANU 3FB6B 1E4LA 1I1FA 2MCPL 1BF8A 4HC1H 1P4BL 4X8JB 4U3CA 5HGDB 3MLZL 5IK3A 2WB5A 1OVZA 4GUPB 1FVCB 3BKCH 3T0EC 4ODTH 2W65A 4ODHH 1EAPB 3LY6A 1JI2A 3IGUA 2V17H 1TA3A 2XACC 1VENA 4NIKB 4X6CB 3PXJA 3TO4B 1DTUA 4QLKA 5GRUL 1G5AA 2EPLX 4MXVE 3U30B 4ENEC 5JNYA 4G80A 5KOVC 1G9NL 5CZXD 2C3VA 1HYSC 3DRQA 3UPAA 4AZCA 2R56H 3H7BB 1FH7A 3QDME 1MCWM 4R2GC 4ZO9A 3X14A 1MWAA 1JG9A 2MKLC 3HS0B 1LEIB 2F61A 4WIWA 2BJMH 1R34A 1TVHB 2PXYC 3DRTB 3AJ7A 3ARED 4RAVA 1W1PA 1JTOA 3SJVE 4G8GD 4DZ8A 1BQHG 4DUXA 5EIQA 4RISL 3DO3A 3MV8D 3HRPA 3V79C 1Q6DA 4FTVB 5ALCH 1KACB 3MBEB 1EFXB 1RVFL 1J11A 4DKAA 4YHLL 1P6FA 5C07E 4MMZC 3ULVE 2NX5B 3RJXA 3QFJA 1CECA 4UV7H 1YNTA 5MI0B 4NSBA 4WHTA 3TYFA 3U6RB 2FRGP 5F1SA 2EDJA 1F58L 3IKCA 1C5DB 4NQVB 4Z7UF 4OCXL 1H3VA 5MENB 2NZ9C 1R47A 4JLRB 4KKBC 4EBQL 3LPGA 2PYED 1NMBL 2HISA 3OZOA 1BIIA 2PO6B 1V0MA 2Y72A 4P48A 4OBSA 4PMOA 4OLYH 3E6FA 2A6JA 3BCFA 4GAJL 1NC4A 4PG2A 2AJ3B 1AHWA 4BFGA 2XQYK 3TTSA 5EUOA 4WEUD 4J3TA 3DRTA 5FKYA 1WZMA 3OV6A 3D25A 1ZV5A 4JHZA 1ZWIA 2VDLH 1KWKA 2Z31A 2V5DA 4KVCL 2NT0A 2LU7A 4R4FL 4HF5L 4R3SA 1TQUA 4HWBL 5GGTL 4QHLA 5HDQL 3BSZH 4H8UA 4TX8A 4LLAA 4HZLB 5ESQA 5AY7A 3QNXB 4BELD 3O3EB 3MRGA 3OLIA 2A6KA 2IFFL 4LCWB 3LS5L 2W5FA 2WYSA 2F9BT 3MRPA 4JLRA 2VC2L 2VI0A 6FABL 5FKPA 1BVKB 2D24A 2XN9D 1T83A 2ZUXA 4F33A 4WW2F 3I3EA 2I9LA 5HHVH 4JDZA 3WYRA 4HGWB 5CGYC 2YBUA 2WBJB 1NEZB 4LXFA 4LYQA 1VFMA 3UCRA 2Y9RT 3JZ7A 4L3CA 4NSKA 3FT2B 2G41A 4OV5A 3OG6B 3O4LA 4YIQA 5BRZB 4LCWA 4C4KO 2BJML 4PMDA 3VFTB 1C16B 2VR5A 4Z7WB 4HWNA 5JHDD 1J01A 3AIWA 1DQDH 1DBKL 4WHCA 4EIZC 1MF2L 4X4ME 2X4QA 5F9DC 2GTWA 4P59L 4UB0H 1X5GA 5IIEB 1GNXA 1ZLVK 3O11B 2A6DB 4WY7H 1DQJB 2BHUA 3AS0A 2R2HB 4NZFA 4DGIL 2YJQA 4BF7A 2PW2B 1L8NA 5HGGS 3GNPA 3MRJB 5A8PA 3BKCL 2GDUA 3D2UD 3GMNB 3U4BH 1H3PL 1NFDE 4ELKA 3TNMB 5J7CC 2NCMA 4EANA 1N26A 4HT1H 1FL3A 4NYLA 1I4FB 4N8VG 1OTTC 4CD4A 2DTSA 3RDKA 4UTBH 4GZJA 4W89A 3VCLB 1ND0A 3TT1L 1KPRA 1FRGH 3HMWH 5DR5L 1OCQA 1HJVA 4KJWC 3D48R 4LQFL 5DMKA 4OLUH 4PB0H 3GSRA 3GM8A 3RVXD 2P5WB 1UR0A 1XGQA 4XZUA 1K8IB 1N59A 4FA8A 3UJTL 1DBMH 3QH3B 2HN7B 3H3KA 4G6MH 1K6QL 1TJGH 5C0GA 5FYJE 1VKXA 1V08A 3WQ8A 1QNRA 2E6QA 4K8RL 3CAFA 5DJXA 3VM7A 3WQ5A 4LCCA 1TCMA 1VERA 3A4AA 2YC1A 4F8QA 4Q7NA 3B9KA 1N0XH 3RNQA 3VFVA 3ULVC 1I9RL 4LLYA 1YMME 1FH5H 4Z2KA 1NFDA 3VRIB 3ULUL 4LVNC 3MKKA 4CKQA 3SCUA 1KCRH 1VFUA 4TNWF 3VMPA 5GZOD 5CZKA 4JIEA 1NKRA 5EZOL 5CIPB 3MNWB 3ZKXC 3FT2A 4KK6C 3AIBA 5JW5B 3O6FA 2FGWH 3ECBB 4BK5A 3JVGA 5I73B 1UKPA 5DVNA 1KJ2B 3LXBA 1T2JA 4IISA 1S5HB 3BPNC 5I8CB 3L7EA 5GGSY 4OB5H 2E5EA 5F97E 1MFCL 1S9WB 5KVDL 3RVXC 4PS4H 5CILH 3EGSB 3U4EA 5FKPB 1QSFB 1E1EA 4GMSL 2XN2A 4NXKA 3OQ3B 4QYOB 4AIZA 4UTFA 4N8CH 3O9WC 4BZ2L 5DMGC 3I02B 3KPSA 3N1MC 3PWPD 4AZ6A 3CMOL 2DPEA 4TOQA 1FL6B 4QXTA 2GUOA 4UQ3A 3JXAA 3QISA 1H0DB 1IBGL 1UT9A 3IJ7A 4CVWA 1QYGL 3QA3B 2J75A 2XPGB 3NCBB 2AEPH 3OKKA 4AG4H 3U5UA 1HHGB 5E8EB 5IOPA 1KT2B 4U1NB 3FO1A 4I48A 4K9EH 3LKNB 4DO6A 2BDNL 2Y7QB 1ZS8A 3QHFL 1O0VA 2R4SL 1ZVSB 4X0NA 4XCCH 1CICB 3T2OA 5I8OL 1MI5D 1TMCB 3IAPA 4OZIB 2WIIB 3AQUA 4M81A 4TSAH 4AMXA 1A3LL 1E43A 3K4ZA 1U8MB 1UA6L 4RMQA 2VH5L 1JP5A 1J87A 1U8HB 1G0XA 1YNKL 4NO3A 4ZS7L 4H41A 3MR9A 2Y23A 3I2CH 1F11A 1UJ3C 4PG9B 5EO9A 3CC1A 3K1DA 2XVLA 1C3FA 2GSIB 5HYSA 5C0CD 4LOUD 3TPKA 1QFWM 1KLUA 2F5AL 4FNPA 1ISYA 2HN7A 4N5ED 1WICA 4PJCA 1YQVH 1MLBA 4WWKA 4E9LA 2I5YH 2ESVA 3AZSA 3VXME 2F8OA 1MCPH 2YEZA 4XXDB 5EPMB 5KAQG 1DLHB 3DETD 3CX2A 1P7QA 3IJSB 4GW4A 1NCBL 3KJ4B 4P4KC 4R26L 3I3BA 4OFVA 1JHKL 4X6CF 4IMKC 4D6EA 4MB4A 5C6PB 1JNDA 4JQVA 3ALFA 5GS0D 1ZVSA 4XAKD 4GQRA 1AO7E 2DM3A 5D2LF 4D9LH 3V7AG 3DNKA 2HFGL 3TT3L 3L7FB 4HZAA 1RP8A 5IFJB 3CFDB 3QSKB 4NBYB 5KSAA 1JFQH 2WMHA 1IGIH 3UBXB 4D0DB 4C56B 1QRNA 1FG9C 5IB1B 4ALAL 2VDRL 4PJHB 4K2UH 3RWJA 1A7OH 2M26A 1KTKE 1MRFL 3LKSB 4XP4L 3E2HC 5DUBB 4W7WA 2GK1B 2YRPA 1T6WA 4MLIA 1UUQA 3VRJA 2VLJB 4P3DB 3PP3K 4UT7L 5AYBA 3OGSA 4Y89A 3L7FA 3X3GL 5CD3B 5CSYA 3VDAA 1R5WA 2GCYB 5EBMA 4DW2L 1IQDA 3SCTA 1TPXC 1PEWA 2WBJA 1G0YR 4HG4J 3L5HA 4OZHE 3BAKA 5CKAA 3EJQA 4W7VA 4MQSB 3ZTNL 1S7SB 3FQUB 1JWUA 3DARA 1TCRA 4XT1C 4U2YA 2NW3A 5IWLC 1G6RB 3IJ9A 4Z77B 5DJ2B 2V3EA 4M1GL 4GBXB 2ZUSA 1M05B 3QOKA 4S0SD 2FJFA 4F9LC 3RNKA 2WIMA 3V4PH 2P24A 1A21A 1EGJL 1S7WA 4KRPB 4EKJA 3GIZL 1MRCL 3RWHA 4RGND 4JPKH 1T1XB 4BS0A 4PJFE 5DURD 5C0DA 1MIEL 5ICZB 4YHGA 1NC2A 3G5YA 1RZKL 3QI9D 4PJ8C 5D1QA 2VDQL 2GTZA 1BSIA 3IVKB 5M03A 5IEHB 2XWJB 1B9ZA 3FNDA 2WINB 2XN0A 4U05A 5I1IH 3CZGA 4OZIF 2RGMA 1KELL 4S11A 2NY0D 4YO0A 4KK8C 3B9AA 2VXTL 1CGUA 4XB3A 4U1IB 2WWMC 4EDWL 1QOXA 3OXRB 5TGBA 3E8UL 2XN9B 2B39A 3C2AH 3HZYB 4Y4KB 4ETQA 4K7PL 5GGRA 3HZ3A 5EBWA 1HKFA 4FP8L 3AICA 1MAML 5CCKH 4AXNA 2VUOA 5B22A 1WV7T 1J5OH 1GGUA 4NN5C 2VR4A 4PB9H 5JPNB 5FKAA 5D5ME 4F3FB 3MLTA 1TVPA 3DUUA 1OAUL 5GJTL 3BP6B 4X9IA 3T1FB 1T21A 2CLVA 3PHOA 4LHUD 2ZSVA 3GSOA 3FN9A 1KQZA 2M1KA 1CD9B 4M9PA 1PZ2A 4LPVA 1S7VA 3F65A 4K2UL 4YDLC 3ARDC 2EZ0D 4W70A 4AMKH 4Y5VB 5HI3D 5KVMC 1FGVH 1QRKA 5AUMB 1R0AL 4N0YL 2ZX9A 2P7TB 3BISA 4XNZB 4WI2A 2CDFB 1JZ6A 4KK5C 1VGKA 3VH8B 5J1TC 5CUSL 1P9MA 2WMFA 5M7QA 2E3VA 1LEKA 2FATH 4PIRF 1X4YA 1R85A 3HG1E 5E1AB 5HY9A 1FP9A 3ES6B 1UB6B 4ZDHB 3SIMA 2GCYA 4G9FA 3D9AH 3NN8B 2MHAA 4TRPL 3ZOAA 3B3IB 3WUWB 2P1YA 1BVKA 1FLTX 5E03A 2XTJB 2UWEB 3OAUL 2C1OB 2J2ZA 4XWOD 4IRSB 5C08D 4UQ3B 3VD5A 3FQWB 1N6QH 5ADOL 5L2JA 3EOYG 4HKBB 4OZGE 4JGUA 5KVDH 2MPAL 2DQUL 1G6VK 4GW5A 3WBAA 4YR6B 5IB5B 3DV6A 2V5YA 1FNGA 3WN5A 4BJLA 5I1IL 2VZ1A 1ZJBA 5L6YH 1Z2KA 3LS4L 4JRWA 1C08A 4DZBB 5CBAB 1A6AB 1TVNA 3MJ6A 3W53A 3QT2A 5JHLH 2EC8A 4O00A 1F3JB 4Q7DA 2VLME 4NNYB 2C0HA 4LSQH 1OTTD 3MZGB 4Q9CA 3NACL 5B4MC 3UERA 2VH5H 4GBXD 3QUYA 4X80H 1YMHB 3IGAA 4BUGA 2R0KH 1YZZA 3JVGC 4HUVA 2A3BA 1QFHA 4H0IA 3WMCA 1DJSA 2NY4C 1NCAL 1AHWB 2NPLX 4LPUA 5F7FA 5K93A 1CL7I 4OCWL 1MJ7L 4DAGH 4EZMA 1UCBH 2A0LC 4P9HC 1HKKA 1JWSA 3BAIA 4J7RA 2VWEE 5IEKB 2MSPA 1I7UB 3RRQA 5JR1H 4ELMA 3B9VA 4OZHF 4R3SB 5DMGD 3CDCA 5HGBA 3LN4A 3C6LC 5F8RC 5DRXB 2RB8A 4K7FA 1G7LB 1XCTB 3LHPL 3U79A 1ZANL 3WJLA 4EQ3A 2CLRA 4P59H 1LEGB 4AZIA 2IQ9H 1XSJA 1FNSH 2VCCA 4JZ5A 4BYHA 1KJ2H 3R06B 1EFXA 1GH7A 4LDOB 4KJQD 5HHQA 5I76A 5DD1H 2LE9A 4GW4B 2WVUA 4FXKA 1Q6CA 5EZIL 2R0WH 4KK9D 5E9AA 4YHLH 3ECQA 1S7TA 4GOSA 1JMXA 3ZE0F 3PWLA 3FQNA 3MLRH 2GJZA 1F4HA 2G5RA 4QRPE 3LKNA 3LRGA 4MA3A 3HB3D 1HWGB 1AQHA 1DBJL 2F53B 3WQWA 1A3HA 1MH5A 1B0RB 2EDFA 1MQPA 3WHXA 3M17B 5LAXA 3PHSA 5T1KA 1CFVH 1JHKH 2FX8L 1N2RB 3EJRA 5GRVK 4F8XA 3D69B 2VSCA 5H2BB 3ZM8A 2J77A 2Z35A 4JPVL 5MEQA 15C8L 3OKNB 4UQ2B 3RWIA 3NCMA 5GS2H 3MLSL 1Z0MA 2YWYA 4GKSA 4MX7B 3WS6A 5KN5A 1MJJB 1N0XL 1KB5H 1E4XL 3MRRA 4L4PA 4P2OC 1LO4H 5I1JL 4N5EC 4C83A 3EO0B 4QRQA 3P3YA 5F9OH 4Y0GA 4F7EA 4Z2IA 1RD6A 2GY7B 2R1WA 4OCRL 1ONQB 5EOQL 4F2MB 2GJXB 4ODTL 4HAFA 5C7XL 4PBXA 4QY8B 3MV7E 5MERB 1G7HA 4CJ1A 1MJ7H 4DAGL 2AKRA 3ARBC 1LO4L 2PO6D 4LLQA 1JTPA 3BVVA 2H2SC 5JW4R 2H9GB 1KJ3H 5F1KC 4G7VH 2YK1H 5FYLD 2F54A 1H3UA 2SEBA 1MCOL 5HHXL 1NGQL 2Q3ZA 4Z78A 2DLFH 1C8PA 3F8UB 4HK0A 4S10A 3QPQD 2FD6H 3HG1B 4ZUSA 4ZENA 3QEGL 4BQ4A 2G60H 2IADB 2RFXB 5TFSL 4OQTH 3L5JA 1H3PH 1F8TH 3D0LA 3T0BA 3ZKND 1UACL 2EDDA 4ZD3L 5F89B 5H35B 5FOOA 4M7LH 1CXHA 4XHQA 1TR1A 5EU6E 4A3YA 4GZEA 4U31A 1V8HA 1HQ4A 1NDGA 3ZKQD 1MCOH 5HHXH 2A77H 2A83A 2YA2A 2B1AL 2HFFB 1U8HA 2WVVB 1BLNA 3UAJC 4JL2A 4X4ZA 1JAKA 4GXPA 2E9LA 3NFNA 3ARFB 2WVSA 2O5XL 3MV9B 3MUHL 2Z8SA 3HZVB 1NCDH 4K68A 1EGJA 4OF5A 2DI9A 2GK2A 4WKAA 3P9LA 2FJGA 4GS7C 2V2XA 3TA3C 3SE4A 4M4RA 4DGIH 3OKMB 3PDDA 4LLYB 3V6OC 3VGGA 1D9KB 3K8LA 4OD2A 2BNUA 1TIUA 3DURA 4JFDA 1M7XA 3KPTA 1ODUA 2DT1A 2VR9A 4F9LA 3L4WA 4JO2H 1NBYA 5A6BA 1SMAA 3I75B 4PGEA 2IEPA 4XZUB 1FAIL 4WU5B 3D3AA 3T0DA 3ZO9A 1A1OB 4R96A 2NXZB 1IC4L 3TLRA 5GJTH 4H8HA 4HJGA 5A2JH 1X5JA 4FOMA 4L8SC 1HP4A 1NSNL 5HVHC 4JFFB 2VRJA 4R7DA 1D5IH 5HDQH 5D9OA 1W9BM 1O5DT 2H9GA 4KXZH 3MLRL 2OZ4L 4YX2H 3INUH 3B9DA 4UT6H 1WB0A 2VLJD 5E0QA 4G6ML 2I25N 4MAYC 3RKDC 4L8CA 4GO8A 1UWEH 3S35X 3BPOC 5ANMB 5E24E 2RQ8A 4EJ1C 4OIIL 3DMMB 4IRJA 1CGVA 1CU4L 2G75A 5DJYB 4KUCF 4Z2GA 3BLPX 2LV4A 2GJRA 1WIOA 1A7PH 3ARUA 3EDKA 3TO2B 4N0FA 4MAVA 1L7IL 4HT1L 4O2FA 1IM9D 3F7RA 3WSQL 2F53E 5ESVB 4QTHA 3ARQA 3D9AL 5IV2B 4X7TA 4PGBB 5E6IA 5I74C 1BQSA 1F45A 3CK0L 3I02A 4LOUC 5F7DB 5BRZA 1HJSA 4AC1X 5E0CA 4TVDA 1XZ0B 2PWDA 3WF2A 3LPPA 5C3TA 1CGTA 2OSXA 4DK3A 1T2QH 5F21B 1E6ZA 1BQLH 4PTUB 1KCSH 1ZA6A 3BH8A 4YHML 4FQCL 3LZFH 2VZUA 3CSYB 1N6VA 1D5MB 3HI1A 1CTOA 1HH6A 5E6ZA 2VQ1A 4OM0H 4JKWA 3A6CL 3VH8G 1NGZA 1TQCC 4JE4B 4WDIB 3AC0A 3TN0C 5KZCD 1AXTL 3G5YB 1FVDA 5DC0A 4P49A 4BZ1H 3V6ZB 1HXYA 4KI1A 2HP4A 5ID1A 1S78C 2P8MA 1WDRA 5AG8A 2DQJL 2KL6A 3AIEA 5IFAL 2NY3B 2VDNH 3EO9L 3T2NL 2JFEX 4JPWL 1YUHA 5ALBL 1XF4A 1KIQA 1RHFA 5HHVL 2DL9A 1AGCB 3WUWG 1LL6A 4PJHA 2W9DH 3L4VA 4UZGA 2ZPKH 2EIEA 4HIIB 4PJ7F 1YN7A 1IM9B 2ZPKL 1YHTA 1BHGA 2DQFB 1EMTL 2AAAA 4LSTL 1CGSL 2HLFC 2VB5A 4OAWA 1AJ7H 1OL0A 5ALBH 1YC7A 1NP0A 2H2SD 4I2XB 4MJ6B 5CFHA 3CTTA 1ZHLA 1DVFC 2Y8VA 5FO7A 4KAQL 3KLAA 3OR7A 4MLSA 3P11H 2E7LA 5TJWK 2C8NA 3D85A 4OZGB 3I6LE 5KS9A 1LL7A 5JTWA 3FRPA 3T2PA 3TP4A 3GMLB 2A2QT 4QHMA 5MEOB 5DWUL 1UVQB 3AGVA 3B5TA 3BSGA 2ZJSL 1QR4A 5HYSB 2Y1VA 5HYJB 5F44A 1G9MH 4ODVH 1KIQB 3TZVD 4PJIB 2ZJSH 5C0BE 1HCVA 3GSXB 1G0CA 3H42L 3BP5A 5BVJA 2VITB 4NQUA 4QTIH 5A1AA 1J0IA 5GRJH 2BOCA 1HIZA 3IJHB 4QRUB 3PXHA 5HD8D 5KSVB 3PDOB 4JFQB 2QL1A 1KXVC 1YEGH 1JPTH 1R24A 4MQ7A 2MQCA 1F58H 4NO0A 3KWXA 4OFYD 2ED9A 1WVZA 5JXED 5T3XH 1K8DB 4WO4C 5HDRA 2OYKA 3KPOB 4WUKH 5AYUL 3ZKMD 2Q6WA 3THML 3FO0H 2WXDM 2DMKA 3UEZA 3WL9B 3E6FB 1PS3A 1BVZA 2HVKA 4R27A 3PP4H 3EJJX 3FT4B 3F7YA 3BE1H 4KROB 4NRRA 1B3JA 2OLDA 1OY3B 4M8UA 1EOMA 3VFRB 1A1NA 1N4XH 1I1FB 2IPUK 4K07A 3WJJA 2OJEB 1GOOA 3QIBC 4KY1L 1M53A 3SKJH 1CVSC 1S9VB 3VG0L 3L4ZA 5I0ZA 5KJRL 3VXSE 4PJ7E 4M7JL 5MHSE 2NLJA 1AGDB 1FIEA 5C09E 4AZGA 4WK9A 3TIDA 4XZBA 4JY5H 4WW1A 3FQRA 1P4BH 3FB7B 1KCSL 1J1PH 3NFSL 4YHMH 3UXFA 4P46A 4ACPA 5FA4B 4K3DL 1AD0A 2WHKA 5JMOC 3WY1A 1ZLVH 4D3CL 4LCYB 3KWWA 4S1RH 3QJFB 1NCDL 4RNRB 3ZIZA 3BIBX 1NBYB 3X3FH 4GLRI 1URLA 4XP5L 4D6JA 1GL4B 4QRPD 5GGVH 1AGBA 3SGKC 3HC3H 2ZUTA 2Y06L 2CQVA 1NGXB 1YEKH 2F53A 2XZZA 1HTYA 3MROB 1SBBA 4PRIE 5I6SA 1D5XB 5MEPA 3U7WL 4JN2B 3TCXA 4TQEH 1ZL1A 4LCYA 4X8JA 5DVMA 5DRZA 1BQUA 5F6HI 5I0DA 1V3LA 4CD7A 1CFNB 3BQUA 2PBGA 1SFSA 1SEBB 4PV8A 3TN0D 2PW2A 2CERA 3M8OL 1QVOA 3NFNB 3QDJE 3TO4C 4MDOA 1UR9A 1TZHB 1EVTC 1BFSA 3LSOB 4KRMB 4NO5A 4UFHA 1JN6A 4B0MM 4MXQC 5CHNA 2NTFA 4QNPF 4AIEA 2YN5A 2DSUA 3SO3B 3N1PC 3VX0A 1KCUL 2N7AA 2OR9H 3GSNB 1J12A 4JJ5A 4CU6A 4KRUA 1LO2L 1LP9A 4NHUB 4MZ3A 3CLFH 2VIRB 5D7IA 3G6JA 3KJ4C 4XAWH 2J4GA 2IALB 4CCEA 3P4OB 1RMFH 1W0VB 5IKCA 1NGPH 1OLZA 4ODXB 1SY6A 2XT1B 3VG0H 1NEZA 2W92A 3AU1A 5ISZE 3PQYA 4J3UA 4HLZG 3HAEB 5I24A 4BCEA 5JZ7D 1WCQA 2XQBL 4GBXA 1ERNA 2CDGB 2BVQA 1Y0LA 4UDUB 4HKXA 3MRIA 4L4TD 1GC1H 2ZCKL 4JFFD 5H37H 3MRPB 5E7BA 3HU7A 3EAKA 1VB9A 1AIFA 3IJYA 1ORQA 4MNQA 2VZSA 5HYIA 2CITA 2ATKA 3EOTH 5JOPE 1J0ZA 3KPPB 1F4AA 1VACB 3VWKC 1UZ1A 1UQSA 2V9QA 3S35H 1ZLWK 4MXVF 1D6VL 1XF4B 3AMLA 4UFIA 1ZK9A 4DM2A 2GJ6B 5T3ZH 3RWDB 4AYGA 3PZOA 2A6IA 4G6KL 3JUZA 3KGRA 2NY2D 4PRID 1NKOA 1J9CT 1DQTA 5F7MC 2EO7A 4WVRA 3FO2B 1NQBA 5TFSH 4AY0A 2P5EE 3PZIA 3BUDA 1MHHA 3ARPA 2PYEA 4WW2C 1A9EB 3UCQA 4ZNCD 4TUKL 4HFUL 4XPBL 3VXMB 3QO1B 2X2JA 3V5DB 2QJDA 2BZDA 4NNYA 4UILH 4P23D 4NXSA 4DWSB 3DGGB 2X4SA 5L2KE 1XGQB 3RO8A 4ACZB 3GUTB 3O2WL 3JTTA 1CGYA 5IJKC 5EC2A 4JAMB 4OZ4B 3RJDA 5D1XA 1UZ6E 2OTWB 1XIWB 3W9DB 2ZCLH 3GSWA 1N3NA 5E8PB 2N7BA 1QSEE 1H11A 5EWIH 1U58B 3MJ8B 4JN2A 2FCBA 1HHJA 2D31A 4QLRA 5C9JB 4DQOH 2WMIB 4PJBA 3UJJL 4PMVA 1LHZA 4X5WA 1FL3B 4NYLB 3WUEA 5E8EA 2WQRA 3GKWH 3U7AA 3IDJB 3TBWB 1YEEH 1S9KC 3HPLA 1HX0A 4Q97A 1CNVA 4I3GA 5C8JB 1NLDH 4JKKA 4FMFA 3V4UH 2AABH 2B8OT 43CAB 1HJWA 4ATLA 3GGWB 5EO1A 1DUZA 4EBQH 2MQ0A 3KYKH 4XH2B 3QFDA 2OZ4A 4F15C 4C7FA 3H9ZA 3LSOA 2R2HA 5IVZB 2EDBA 5FCUH 2I9TA 2BNQD 4Q58C 4YDIH 1ACYH 3ARGB 1U8LB 3W6MA 1ORSA 1JZ7A 4L8CB 3QEUA 1J0YA 4JFEA 4UFLA 2E40A 4JFQA 3QEHA 5SWZD 5HBFA 1ISXA 3C8KB 2NXZC 1NGWA 1F5WA 4X83A 4EOWL 1V3IA 3BEWA 3BXNA 3U9UB 2YL9A 4KDWA 5FO9B 4DZ8B 2HFFA 3ZYZA 3R1GL 1I1AD 9CGTA 1BFOB 3O8XD 2PO6A 3GSVA 3DX2A 4ACZA 5GGSA 4NQCA 5BCAA 4RMWA 4X4XA 4LLMB 4JQXA 1KJMB 3HB3C 5HHOE 1WBYA 6CGTA 3B9EA 2VMFA 3MQIA 3M46A 1C08B 4DZBA 5CBAA 1FVEA 2EDKA 4PUBH 4JO2L 3ULVF 3QUZB 4N90E 4UV4L 2AVGA 1Y6NR 4MJ5A 4XB8A 3VFRA 2P5ED 5AYQA 2NY7H 1OTUD 5CPSA 2YXFA 1E0XA 2AJXL 4XMPH 5CEZH 3VFOA 4H8VA 2DIBA 1XGPB 2H41A 2NY7L 2Z8VC 4QXWA 4HZLA 5ESQB 1KB3A 5AZEL 1GAFH 1U8IA 2ZX5A 1BGXH 3HCVB 3A4WA 1ADQH 5TQ2H 4X6CE 3S3JA 2EEBA 5LGKA 1MCDA 2PTUA 4GQ9H 2W63A 1IAKA 3QAZB 4H20H 4I18C 4RAUB 2JJTC 3BAEL 1NWRA 5I1CH 1CICC 4J3WA 4TVPH 1Q9OB 1R3LA 4X9YA 3GSVB 2H8PA 4JDTL 4G9FE 1A2YB 1JGLL 1JE6A 2HJLA 4M5YL 3RGVB 5E1HB 5J3HC 4H8WL 4G5ZH 5DHYA 2XTKA 1A47A 3VIPA 4Z2HA 4P99A 5D7KE 4JFDD 2PXYB 5D5MB 1F42A 3G6AA 2JF7A 5DO8A 1UM5L 4FNLH 3ZKNC 5BW7A 4M5YH 3FQUA 3BP6A 3D25B 4BKLB 3RTQB 4FQ2L 3TJEH 5IIEA 1H41A 1P4LB 1KPVA 4JKLA 4CMMB 2DL2A 1VFBA 5IHUH 3V4UL 4YAQB 1WDQA 2N4IA 2RR3A 2F58H 5E6YA 1L0PA 1PPIA 1YEEL 1MRDL 3KYNA 4M93B 1MW3A 2DI8A 3MJ7A 3VIMA 4M5ZL 4M43H 1MRCH 3U2SB 1CFVL 1DP0A 3GFUA 5DJAB 4OV5B 3U4BL 2WCAA 1Q94B 4HPYL 4NNXB 2P7TA 2KBGA 1OB0A 1VJZA 3WE6B 3RIFF 3HAEG 3O6ML 1T0NA 1WBXA 1DBJH 3ELAT 1TVBA 1KPVB 2FECI 4R0LA 4WY7L 1XF3B 5EULV 3IXTB 3ZL4H 4NO2B 4Y4HA 1B3ZA 2HKHL 4P46C 2Q20A 3G6JF 5HPOA 1WF5A 2G9HB 5HJ3A 1OW0A 2K7PA 5IFTA 4HKJA 4PG9A 1J1XL 4HIEB 5EB9A 1LEGA 5E70A 1T1YA 2HLAA 5L9DL 1J1XH 3ZDXF 4LX4A 1I3GH 4Y2DD 1FNSL 4JM2A 3FB8A 3IXAA 4N90D 5ABHA 5HBBA 4JL1A 3RIKA 2ICCA 4RFOL 1OQXA 1JV5B 1NJ9A 3A24A 3IK2A 3LRLA 5HOSA 4U1LA 4KRPD 5BXFA 2QSTA 1SBSL 1MVUB 1YECH 4Z7WF 1MWOA 1T6VN 1W3JA 4NZUL 4ZTOL 5DT1L 3KEHA 2B20A 5E00B 3II1A 4YJZL 2EXYD 2AMGA 1UENA 1B88A 1J0HA 1XGTA 3G6AB 4W6XB 4QCEA 3RBSA 1NGQH 1OAZH 1W32A 2R0KL 1KC5L 5GGTH 4XNUH 1CD0A 4ODWB 1YDPB 2V9RA 3N1FC 3NCCB 3AXLA 1KGCD 3HMXA 1A2YA 3DHMA 3WLWC 1DWIM 1RV6X 3N50A 1JFHA 3TPUA 5E9DB 3NBNA 1HN1A 3PGDA 4FQHA 1E28B 1Z0NA 2XWTA 4HAGA 3O2DA 5DJ6B 4U1JA 1WT5A 1Q6FA 1A7NH