3W83A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-6-097
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-6-097
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w83A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w83A01
3LHTA 1A5AA 3QZEA 3S1VA 5FEPA 3IGUA 3CT7A 5AC8A 1F6PA 1G4TA 1Z44A 3LHUA 4JTHA 4RK8A 4EF8A 1XDLA 3SSJA 1PVNA 3HGRA 4Y90A 3W1MA 4MZ8A 1BWLA 4MPQA 4AWTA 5LKYA 3K30A 4FX7A 3VI2A 4UTLA 4K39A 4AH7A 1J5TA 3A5VA 5BMWA 4JYEA 5G4WA 4JEQA 4CCCA 3NPVA 3O07A 4JTFA 3UNDA 3PS7A 5LGZA 1IF2A 2TSYA 3P5YA 1T99A 5KSWA 2I14A 1FCUA 1FXQA 4FIQA 5FF4A 3VFLA 4RZ5A 3M43A 1KFEA 3W71A 3LERA 3TAOA 1PE1A 7TIMA 1G67A 2HS6A 4K7YA 1TB3A 2NUYA 2JKPA 3LCGA 1GWJA 4HNVA 4KWVA 2ZZ2A 1KBIA 1RR2A 3O6DA 3NQAA 3P61A 5EBUA 1JR1A 3TSDA 2PRMA 3TAKA 1Q3NA 1PL9A 1DKWA 2DZUA 1VHNA 3S1WA 1KTCA 5FEWA 1J2WA 1TPDA 4UMAA 3M5YA 2V2HA 2H90A 1OX4B 2OMAA 3W22A 3P74A 1QR7A 4HIBA 3W75A 3OG3A 2H8XA 4PFMA 1E51A 1RZMA 2Y6ZA 3EXTA 4KFOA 2VELA 2V81A 1I2QA 1A53A 3RLUA 1TYGA 4DO5A 4RLIA 2OX1A 1OHLA 2Q8ZA 3WJSA 5D32A 3TV8A 1SZEA 4M19A 3M9YA 3NL5A 1WAUA 3W7LA 1NF7A 3QM3A 3L0GA 3CIXA 2BSLA 1G4SA 3MYPA 5LNSA 1TMHA 4UFJA 3BLFA 2HMCA 3QC3A 3KAOA 4Z08A 5CZJA 4CNPA 4Y96A 1XBXA 1I2PA 3HPXA 1EEPA 4A29A 1VJIA 3GNDA 3PUEA 2QCEA 1KBJA 1EA0A 4R7JA 4PH6A 3RF9A 1ZCOA 1H51A 1RV8A 3GVGA 2VFDA 3S5ZA 4WY0A 3UY8A 1AL8A 3B03A 2UV8G 2FFCA 2NV2A 3FEMA 4N9BA 1FDYA 3TCEA 1ADOA 2A7RA 4CQAA 4ADUA 4Y9AA 5AHLA 4E2BA 4EF9A 5K3VA 4ZQPA 4POCA 3P67A 3W07A 1QAPA 1SZGA 1F74A 4GJ1A 2VEIA 5CSRA 3IIZA 3FOKA 5F4WA 3P82A 2PE4A 5FESA 5T26A 1YXYA 1KM6A 4CNNA 3T40A 3KRUA 5FF3A 5K9XA 3GYEA 4KFPA 2QCGA 1KA9F 1OG0A 2A2IA 1JRCA 2VFFA 2QUVA 4IUOA 3TH6A 4UIOA 4ZQMA 3GDRA 2BZNA 2QR6A 1A5SA 1D3HA 4XWUA 4ONVA 5EL1A 2VOMA 1DV7A 4IOTA 3BG3A 1FXPA 3KFTA 4AHQA 3PUOA 1DBTA 1U5JA 1S5VA 3UPBA 3V75A 1OFDA 3SGZA 3HIJA 2DORA 1AK5A 4O50A 3L5LA 2ZTKA 3I7QA 4IMGA 2OZ0A 3W7KA 1UASA 3M5XA 5AFDA 1C8VA 4QIUA 1XXXA 5HJLA 4M7TA 3M7WA 1M5WA 1PV8A 1ZY9A 1YDNA 3CLMA 3CHVA 2C16A 4N6FA 2I9EA 1H5YA 3TX9A 1QNVA 1K7EA 4O1DA 4LRTA 2PRHA 2ISWA 3EWXA 1OX5A 3QEZA 3PULA 4XUGA 1Z42A 3TNOA 1WXJA 4GRSA 3N9SA 3PAJA 4ZZ9A 3MUXA 1XCFA 1O5KA 3NAVA 1WOAA 3MBDA 4WY0B 3A22A 4RX0A 2FLIA 2F7FA 4LVBA 2ZCGA 3QMTA 2Y88A 3E12A 3C0JA 4LVAA 5C55A 3PC0A 5KZEA 4ZQCA 3KHJA 3ATYA 4XBSA 2DU2A 4YMZA 4YCPA 4QNEA 1S5TA 2JKEA 5AHIA 3UQNA 4IX0A 1H7NA 3VE7A 3HGJA 1THFD 2CLLA 1GG1A 3W2LA 3W85A 1OK6A 2GVGA 5KITA 2A7NA 3EX2A 4BK9A 2B7OA 2W6RA 3GB6A 2CZFA 3FIGA 4N9EA 4UFIA 2B4GA 4LY8A 2YDAA 4K6AA 3NA8A 1FUYA 3F03K 4K8EA 1QFEA 3TR2A 1R46A 1KFKA 1VRDA 3L65A 1KM2A 3JRKA 1AW5A 1GVOA 3EWWA 1GJPA 3M6YA 4QJ1A 4OGZA 4LVFA 3QJAA 4LWWA 4XTIA 1LTDA 2ZTJA 3EX4A 2RDTA 1N55A 3GDKA 1EUNA 2X1RA 5F2GA 5DBTA 1KFJA 3HPZA 1HTIA 3A5FA 2FIQA 2NX1A 3A23A 3GDLA 3NYZA 3FLUA 3HB9A 3TIMA 1RPXA 2V9DA 2ISVA 4FXRA 5CSSA 4JY8A 4AWUA 3KX6A 5C5YA 1O60A 4O53A 4NXKA 1YTDA 5BW6A 1GG0A 1W37A 1B3OA 3LCFA 5FF0A 1X7FA 4O10A 1K7XA 1WYIA 2ATMA 1TIMA 5C54A 3GIYA 3NPXA 3W7HA 1O4UA 1B4EA 1SSGA 3WK3A 1UB3A 2X30A 4O17A 3AO0A 2NX9A 3PG9A 3NVTA 1VLIA 1H7PA 3NZRA 3B0PA 5E0KA 4E0CA 4LTSA 2NUWA 1GYNA 4LUIA 3EX3A 4FX8A 1S5WA 3STCA 3S0CA 4JIQA 1UUMA 1W3NA 4AF0A 3STEA 2WKJA 4ADSA 3NQCA 4ZQOA 3UY7A 4HPXA 4M6VA 2VFEA 3T78A 1TJRA 5C6MA 5EA9A 3C2VA 3L68A 1SO4A 2VEMA 3USBA 3HF3A 5KTLA 2RDUA 1XBVA 4X22A 1L6SA 1GZGA 3L2IA 4TO8A 1AW1A 4O1AA 4ORMA 4FEZA 3G1VA 5HWNA 1ICSA 3GKFA 4RJEA 2E1DA 3PB0A 4OV9A 4JGDA 3LB0A 2R14A 1OYBA 1FWTA 2QJHA 1H1ZA 3HO8A 5F4SA 2X2GA 3F1QA 4DF2A 3H55A 1LRNA 4LVGA 4IMCA 1LBLA 2H3BA 4Z1DA 1PHQA 4HN4A 2BTMA 3EWBX 3LM7A 4AMAA 3S1UA 2Y7EA 1HL2A 4JTEA 5FF2A 3TK7A 5F1VA 3C56A 4JX6A 3V1PA 4DELA 1KLYA 5AN7A 5J5DA 3TW7A 4JS3A 1R47A 3NGJA 3RU6A 4UMBA 5CZ0A 2DZSA 3NQDA 1J4EA 2C13A 3TJLA 3W1RA 3OA3A 3O1NA 3UWVA 1YPFA 3M16A 4CQ8A 1OFBA 1ZHAA 3TC6A 4NXSA 4IPJA 4IXHA 1WOBA 5D04C 3IIVA 4FNTA 2E5DA 3YPIA 2OCZA 4CQ9A 1ZNNA 1LRQA 1Z41A 1ICQA 1W3IA 3LOTA 3S5YA 2FB2A 2DZWA 3W3OA 2Q3RA 5G2WA 5HQEA 1EWDA 3ZFHA 2CFFA 3WJXA 1K8YA 4UTTC 4MUZA 5A8GA 3F4WA 5LSMA 3UWYA 3WJYA 3W7EA 3B06A 2Z2UA 5H2ZA 2ZZ5A 4U4MA 5AOUA 1FQ0A 4AF0B 3W2MA 4RCXA 3MHFA 1SUXA 4GC4A 3Q94A 3Q2DA 3PSVA 3OIXA 1H7WA 4AHOA 1AW2A 1KV5A 3CEPA 5E1QA 3TMQA 1H61A 1GTEA 1XBYA 4MVAA 2J27A 5HMSA 1O95A 3DI0A 2YYUA 4YXGA 1KV8A 1XUZA 5G2IA 1XM3A 2PC4A 2ZZ3A 1XI3A 5GVJA 1VZWA 3QW4B 4UTIA 5G5IA 3TW6A 1WQ5A 5HULA 1IXNA 2WSYA 5LNUA 4O8RA 5BOOA 4X3ZA 2NZLA 3I65A 2QEZA 4BWLC 2NX3A 4ZQNA 1VC4A 2QDGA 1DORA 2CLKA 4MYXA 3TC7A 3OBKA 2BXVA 3EWUA 1HO4A 2Y7GA 3QF0A 4K36A 2ZRZA 3VKJA 2E6FA 1LOSA 4UTMA 1BKSA 1FCQA 3IIPA 3NQEA 1JCXA 1RQHA 2G5WA 3BW2A 4N2YA 5D02A 5K4ZA 2Z6JA 5DBUA 4DXVA 4XZ9A 1ZENA 3CIWA 4TU1A 1YLVA 4HSOA 5F2MA 4UTTA 5BNKA 2WQPA 1GVFA 3W7DA 4ZVJA 2FJKA 3SZ8A 1P0KA 4Q33A 5EPDA 1W0MA 3A21A 2YW4A 4NNBA 4GE8A 5LZLA 1DVJA 4NT0A 3WFAA 3BGJA 3RK8A 3N73A 3Q37A 4C1LA 5DCEA 2WSQA 1RQBA 5FEZA 3QPZA 5DY2A 2Q8LA 3EX6A 2CLEA 3LGEA 5F1UA 4HT3A 1YTEA 2CW6A 3TMLA 1FX6A 1OF6A 1N7KA 1XL9A 3LRKA 5I3JA 2G96A 5I3FA 2R8WA 2W0UA 2CWNA 4EIVA 4RV8A 3SI9A 3QSTA 1W8SA 2B0MA 3W1AA 2X1TA 3IIOA 4EOUA 4NX0A 1KLZA 1YXDA 4BWLA 1B9BA 4YWIA 1GOXA 2QAPA 3W2NA 1QMLA 1WA3A 3PWAA 5K2ZA 4MKNA 5F2LA 1I2NA 3I7SA 2YFNA 3IRDA 5I3HA 4O0KA 3WK2A 3W7GA 3BG5A 4MIMA 3MI3A 3W7IA 5ABTA 4O19A 1LBMA 1LRTA 3LI0A 1B57A 2XFWA 1ME7A 4TR9A 2EHHA 5D30A 4FO4A 4O12A 2DZXA 1QOQA 3H54A 4O11A 1O94A 1RVGA 1R2TA 4WY0F 1PCWA 5FI8A 5CPMA 1QPRA 3L67A 2B7NA 5CKSA 2GQ8A 3Q58A 3PBYA 4NVTA 3CWOX 3NQGA 2QUUA 4RR4A 1EB3A 4JX5A 1VCVA 4JR5A 4LVDA 3G1FA 5KMYA 5LNWA 3A24A 3R13A 3P8IA 4JXCA 4WZHA 4LS2A 5K4XA 3IEBA 1BTMA 3KXQA 4JN6A 2EKCA 1K3UA 1QPQA 1YDVA 4AHPA 3LBCA 2DZTA 3NL2A 3N19B 5G2HA 3W7CA 3O15A 3LHVA 4DPQA 4XQ6A 1T0OA 1H60A 1TQJA 1CI1A 3OEXA 1VH7A 2FDSA 3HG5A 4FNUA 2C14A 5D2VA 1K8ZA 3T7VA 3W7MA 3QFEA 4HPJA 3G3DA 3GK0A 2Y89A 3TROA 3ABQA 6ALDA 3W86A 1P0NA 4OHQA 2WNZA 4LW7A 1HFBA 2DZPA 2VEPA 3B04A 2GOUA 3SY5A 4MZYA 4ORIA 1W54A 4LNYA 4I7WA 1LOLA 3ANYA 3DFNA 3F4NA 4S2CA 2WO5A 4I7UA 3W1PA 3W7RA 3DFQA 1D3GA 1CX9A 1TO3A 2V82A 3DFOA 4S2BA 4IPIA 3NQ8A 3ABRA 3B4UA 4O28A 3B8DA 1FWSA 2QCLA 5CZTA 4O1CA 4UTJA 4OQVA 4UNLA 3S42A 1LORA 4M6PA 1PIIA 4OE7A 2XN2A 3L66A 3KOFA 3OVRA 5D2WA 4MY1A 4NX5A 3PR2A 2WNQA 5DLCA 4E2DA 3W74A 3THAA 3NOEA 1VCFA 4ADTA 3SW6A 1YTKA 4AWSA 3IGSA 3KVLA 4O15A 4MLJA 3EXSA 3THQA 5TIMA 4AB4A 2DJXA 4A3UA 3NQ2A 1F6KA 1S3HA 2H3DA 4JD4A 1M6JA 3TA6A 1ZAHA 4H4IA 4NJIA 4N9CA 1YADA 3N3MA 3LRLA 4H6KA 2EAWA 4UR8A 1DQXA 3CTLA 4Z1AA 3QMSA 4Z0SA 2GPTA 3PVFA 2NXHA 3QW3A 4JICA 3G1XA 4LT9A 1RQEA 1VYPX 4GUIA 3W1NA 4EWND 1I8JA 3P80A 3NEVA 3RMJA 1O5XA 1KTNA 3C8FA 4NNAA 2DZVA 5D09A 5CGQA 3UWWA 3GX9A 3LCHA 1ZAIA 3W1XA 4EVZA 4JDBA 3LV6A 2RFGA 2TMDA 1VYRA 3C6CA 3EKZA 5AHMA 2XN1A 3BW4A 4TMBA 3AJXA 3UD6A 3N9RA 3FKRA 3LTPA 5FEXA 3W2UA 1LZOA 1TTPA 2PURA 6TIMA 2NXIA 3MYOA 3P7YA 3UWUA 3UYCA 5HWJA 2QAFA 3LI1A 4P2VA 4HHPA 1G7UA 3MI2A 3BV4A 2E5CA 4QAIA 3I6RA 2VFHA 3B0UX 1G69A 2GUUA 1LOQA 5AHFA 1BEUA 1W5MA 1OF8A 5DXXA 4O16A 2TRSA 4ALDA 3TJXA 1DOSA 3O63A 3FKKA 1D9EA 2ZA3A 3QQ0A 1UUOA 1OJXA 5K9DA 1IIGA 2O7SA 3N14A 3NL6A 1VLWA 5DN1A 4ZQRA 1K03A 1M7PA 3E9AA 3MO7A 1WX0A 1SU5A 2YYTA 1PHWA 3STGA 1TV8A 5HUOA 5I3GA 2Z6IA 3BVJA 4DQWA 1LP6A 4UTHA 3TQ0A 1Y0EA 4U28A 2GJLA 4JYFA 3MWAA 4N9DA 3NXFA 1T96A 5AB3A 1JUKA 4WOZA 3PBUA 1PCKA 1W5NA 2HSAA 3O06A 3WK1A 3SJ3A 1W5OA 4ZMGA 2CLHA 5DELA 5D38A 3N2XA 3S5OA 3LV5A 3W1UA 2ZYFA 1SO3A 3UWZA 5C2XA 3P81A 1H63A 1OYCA 4XBKA 3L21A 1OFEA 1LCOA 3W7NA 3WJZA 2R91A 3DBPA 3HG4A 1X1ZA 3HQ1A 2NLIA 3L5MA 1G4PA 5D2YA 4RXFA 5D37A 3BG9A 4UTWC 1FY6A 4CNOA 1TPVA 4I9AA 2V2DA 4IMEA 3TKFA 3UPWA 3BW3A 3KRSA 3UXAA 1KFCA 4QNWA 2VXNA 3C2OA 4W9TA 3W73A 4QISA 2Y63A 1ALDA 3O6CA 1FDZA 5F2IA 2B7PA 2JKAA 2C0AA 2P0OA 3UZJA 1RD5A 3W1LA 3E96A 1LLWA 5EYWA 3G0XA 1JUEA 5KZMA 5LHEA 2AGKA 1FWRA 5TQLA 3LRMA 1MEIA 1I45A 1JCYA 1I4NA 3GXPA 1M7OA 2YZRA 5EMUA 2VFGA 3DH7A 3TSBA 3C61A 3ZS4A 1TPEA 2DJLA 4S1FA 1LROA 4IMFA 2WNNA 2NXGA 1H7XA 5CPLA 4DF1A 1L6YA 3WJWA 1DJQA 2A7PA 2ZRUA 1IXPA 2TYSA 3TQKA 2BLEA 4N4PA 5U4NA 4KFNA 1FWNA 3GAYA 1TPFA 5LHFA 1IXOA 4GUGA 2E77A 2HS8A 4GUHA 1GT8A 2HTMA 3PSWA 2ZDRA 2QCMA 2DP3A 4I7VA 2NV1A 1HG3A 3DFPA 1NVMA 1OX6A 1X1OA 1DJNA 3GKAA 3S6DA 4GNJA 4UTWA 1X6UA 2E09A 5CZSA 3VCRA 4FIRA 5L6UA 4LOCA 2Z1BA 4NJKA 1SQ7A 4DF0A 1JQVA 1OFQA 2WJZA 3BARA 3ATZA 2C1HA 1JCMP 3U8GA 4WX2A 1OABA 4KWWA 3I68A 2A21A 3MP3A 5E93A 1LLZA 4K38A 2V30A 2FTPA 3W7OA 1JCLA 2V0TA 3O05A 4MYAA 2Z0IA 2Y70A 1IXQA 1QOPA 4PEKA 2H6RA 4NNCA 1TTJA 4JTTA 2A0NA 3BK0A 3GXTA 1R2RA 2A6LA 2GJNA 1TQXA 5HUPA 1K8XA 1GQNA 2NUXA 1NSJA 5HWMA 4NJGA 5AYXA 5AHEA 4NQ1A 3GLCA 1UJPA 3W88A 1VYSX 1EP1A 3HOJA 1G6CA 3JR2A 3T4CA 3DFTA 4IXXA 5KZDA 3LHWA 2PRLA 2A5HA 4D2JA 5AYZA 2OT0A 5MHBA 4Y6GA 2JGYA 3EEGA 3GNNA 1EX5A 3U6WA 3QMRA 3STFA 2CU0A 2FB3A 1YPIA 4FXSA 3L5AA 4JTIA 2BWGA 2ISSA 3PM6A 5HNRA 2VENA 4GFSA 8TIMA 1AG1O 1FWWA 1SFJA 1T8XA 1VR6A 3R12A 4NUWA 4MFEA 2WSRA 4IQLA 2EGZA 3NQMA 2ATSA 4QM1A 4JY9A 3EX1A 1H1YA 5HR7A 3NO5A 4UTUA 1A5BA 1W3TA 1KFLA 2C19A 3DENA 3EWZA 1X8FA 2ZA2A 3S8HA 1GYLA 3C2RA 1YDOA 3LHZA 1ONRA 1I2RA 1WDWA 2ALDA 4A22A 2E68A 2Y7FA 3HPSA 2JGQA 1W1ZA 3I7RA 2YX0A 3G18A 4DEFA 4RZ4A 1XBZA 2NWSA 3KVMA 1HO1A 3NQFA 3DAQA 3NZ1A 5AYYA 3FYPA 3BPWA 4JX4A 1SO6A 3RLVA 2C18A 1XDMA 3TE9A 3P5ZA 3BLEA 3IVUA 2WV8A 5DXYA 3C3NA 2KZHA 1AMKA 3IVTA 3TFXA 2LLEA 3G0SA 1UBSA 3L0KA 4IGHA 3LXBA 3R5EA 1QO5A 2R94A 4PTNA 3G8RA 3FA5A 5HINA 1Q6LA 4NJHA 1JCNA 3E0IA 4AAJA 3EXRA 3NQ7A 2QCDA 1C29A 4O18A 3G1DA 5DCBA 3SIZA 4YL2A 5AHNA 1VS1A 4Z0JA 2CZDA 1JQXA 1H7RA 3N34A 1P5BA 4OWGA 4UNKA 2PCQA 1EUAA 1GTHA 1ICPA 4LV9A 3CQ0A 1TRIA 4JTUA 2CZ5A 1QO2A 1SW0A 4UMCA 4R53A 4FHAA 4K7VA 5LGXA 4QSHA 2WPBA 3MBFA 4MZ1A 3IGXA 4JYDA 4NU7A 4M7SA 1DL3A 3EB2A 2J9ZA 3GAKA 3W1QA 2ZBTA 5IBXA 3DFSA 4OBTA 2YXGA 1JRBA 3ZWTA 2E5BA 1FBAA 2FQIA 3M5ZA 4AXKA 1TSIA 2RH9A 1TV7A 4M6QA 1LYXA 3ABOA 3UXDA 1F76A 1MO0A 4IJBA 4PC8A 3GZ3A 1JCJA 1V5XA 2H8ZA 3GDTA 2E6AA 4NZJA 2QCFA 5H91A 4DPPA 3R2GA 2CLMA 3M47A 2FPVA 4FF7A 4C1KA 3G0UA 3HGOA 3GR8A 2ABBA 2W79A 2YR1A 4FNRA 3W87A 1EP2A 1OFRA 2I1OA 3NQVA 1KM1A 1R2SA 2GVLA 2J88A 5K7JA 2ZRYA 4E38A 1QCWA 1KTBA 3PBVA 3G1AA 3DXIA 5KINA 5IM51 3W2KA 1GPWA 1SSDA 1TPH1 3EWYA 3DHFA 5I3KA 3MP5A 3T44A 2CLFA 1R30A 1W5QA 2FPTA 3M44A 2YGYA 1SZFA 3DKLA 1MSSA 4HNUA 2YSWA 4GUFA 1WV2A 1KW1A 2NWRA 4A2RA 4YCOA 4UFHA 3LCWA 1JULA 4WOQA 4UFMA 5FF7A 1GEQA 1I2OA 3LTYA 4UXDA 1KM3A 4RZ6A 5U7SA 3LBMA 3DI1A 4MOZA 3GDMA 2ZA1A 3INPA 2EPHA 1W31A 4Q32A 4MJMA 3C4UA 3NPUA 1VGAA 4NJJA 4ML9A 4LS0A 5CPOA 3W9ZA 1FDJA 3H53A 2CLOA 3OHIA 4MY9A 4WD0A 4WXZA 1SPQA 4UUIA 4MY8A 2QCDB 3JS3A 4QITA 3NPWA 4UTKA 1AL7A 2A6NA 4JDYA 4BF9A 4Z1CA 4PL2A 1ME8A 3TFCA 1A50A 4N6EA 5CG7A 4J9JA 4JTSA 3G1SA 2ZFAA 4H3DA 1V7YA 3QRHA 2VEKA 3ZWSA 3OVQA 2GVJA 4UR7A 1ZJIA 4G1KA 3P8JA 2Q3OA 1TREA 2V2CA 3NDOA 1XKYA 3O8AA 3HG3A 1SR9A 1TPUA 2CLIA 2F84A 4LC8A 3U2OA 4O52A 3PBWA 3PG8A 3LCXA 1KM4A 3MHGA 1WBHA 1SFLA 4PODA 2V8ZA 3DKJA 3PUDA 1GVQA 3NM3A 4B5NA 4CCEA 3LHYA 1OYAA 2EF9A 3KRZA 3LCIA 1IGSA 3W84A 3G24A 3E49A 4YLWA 5D03A 3D0CA 1F05A 3ABSA 1WBJA 4JTGA 4KKXA 1W5PA 3M5VA 4O57A 1JVNA 5J5RA 4LUJA 4R34A 2JK2A 3FJLA 4O4VA 2IQTA 4GXMA 5G4EA 5K9CA 2ZQ0A 1KM0A 4BI5A 4LU0A 5G1YA 1G4EA 4OT7A 4UFKA 3PB2A 4O14A 3BLIA 4L4MA 2J9YA 4A21A 2XN0A 3G22A 2AAMA 2J9XA 2V5LA 3CEUA 5D05A 1UCWA 4L4LA 2E6YA 3T55A 1EWEA 1ML1A 4DO6A 1FCBA 3KVJA 4HNNA 1GVRA 2ABAA 4CCDA 4HSNA 4OV4A 4UFLA 2YW3A 3TU9A 4K8HA 3DHDA 1H7OA 3HG2A 4RKAA 4JIPA 3FFSA 4DBDA 2C3ZA 1Z48A 2ZZ4A 3L0NA 2ZRXA 3EKLA 3C2EA 1ZAJA 3TUUA 3M0ZA 1YYAA 2WOQA 3LCLA 4LRSA 3RFAA 4HNTA 4GWEA 4UCGA 1KFBA 3TQVA 1VPXA 5HR6A 2QKFA 3S5NA 3SFKA 5LNVA 3W83A 3QPYA 1Q6QA 5DCDA 3VE9A 1C9DA 1U83A 3G1YA 3NNTA 3W76A 2CZEA 1NF0A 1ZFJA 2QCNA 3LXAA 2P1FA 3KVKA 3MHUA 3LTSA 4GUJA 2QDHA 2GQ9A 3M41A 1P4CA 3RNDA 4JTJA 1K02A 2Y85A 2E6DA 2QCHA 3VNDA 5AC6A 1F73A 1TTQA 2VC6A 3PY2A 4JTLA 4O13A 5I3IA 5DY3A 4IX2A 1VQTA 2Y7DA 3R8RA 1JJKA 1B4KA 3C2FA 3MW7A 3W7QA 2VKZG 2A1YA 1L9WA 2OT1A 3M1ZA 1IIHA 3CU2A 2V5BA 1LBFA 2ZRWA 4IWWA 4N4QA 1TTIA 3HGSA 3ZR4A 4FX6M 5D2TA 3TXZA 2X16A 1Q6RA 3ELFA 3CWNA 2C15A 5A5WA 3OVPA 1A5CA 2YPIA 4IMDA 1XUUA 1N8FA 3CPRA 4BI7A 4ZL1A 4XKYA 3W7PA 4O54A 3MI6A 4XTDA 3IV3A 3O16A 1EIXA 2A4AA 5D2XA 3NL3A 3CB8A 1TJPA 3G8EA 1ZALA 3TDFA 4TX9A 3HJZA 2G97A 4O4WA 3DGRA 4TIMA 4GBUA 3TSMA 3UWQA 3BO9A 3O6YX 4MJZA 1TCDA 3DZ1A 4BR1A 1XC4A 1PS9A 3W72A 3HBLA 3SR7A 5BMXA 4FB7A 1W56A 3PF3A 4LC6A 1NAL1 4X9SA 2QJGA 2RDWA 2YFOA 4PCFA 2OJPA 2ZZ7A 4PA8A 1QDSA 3MP4A 1K7FA 4O0ZA 2X1SA 3P60A 3W7JA 4CLMA 1F7BA 1TPWA 2C6QA 3NQ6A 2J24A 4O1BA 1TV5A 2ZZ1A 4ICNA 3C52A 2AQWA 3UZ5A 3B0VC 1NFBA 3B05A 4MLRA 3FS2A 1SZNA 4X2RA 3QQ1A 4Z1BA 4LV4A 2QF7A 4PL1A 2RHGA 3G1HA 1QPOA 1F5ZA 5SWUA 1OK4A 3LX9A 1SO5A 4M5PA 3FJ6A 3P84A 4N02A 2B7QA 4OU1A 1VCGA 1EPXA 4FNQA 1DHPA 5AC7A 4NZFA 1OFAA 1QWGA 1CW2A 2YCEA 1XFBA 4WXYA 1TRDA 2QJIA 1BWKA 3L9CA 1JUBA 1LM1A 1FCVA 2QCCA 3NG3A 3NM1A 1MEHA 3TXVA 4FNPA 2A85A 3G3MA 2BX7A 4A2SA 4WJEA 4MFDA 3N2MA 2ZRVA 4K37A 5EY5A 1HUVA 3W70A 3LLFA 5LNRA 1MZHA 3QSRA 4BFAA 3IIXA 4FNSA 4P61A 1L6WA 3BGGA 4JTKA 3E02A 1QPNA 4XKYB 5L9FA 1OFPA 5D33A 1EP3A 4DO4A 4R33A 1VHCA 4BI6A 1F2JA 3LDVA 4Q4KA 4QQ3A 3P62A 5G1TA 5CPNA 1LDCA 2ZZ6A 1MXSA 1SW7A 2O7QA 4JNMA 2RKXA 3LLDA 3CC1A 3S9YA 2Y61A 3NR0A 1OX4A 1NEYA 4Y8FA 4AVFA 3GXNA 2JBMA 1Q6OA 1ME9A 1MEWA 1TPC1 1YXCA 3IVSA 4WQ6A 3GR7A 1TPB1 3QH2A 5EKYA 4TMCA 3QYQA 5TBOA 1Q45A 3W1TA 4RXGA 2VFIA 3LXCA 4WUIA 3MMTA 5BRBA 3R89A 1OVDA 1KM5A 3DU0A 1P1XA 3SECA 3SGUA 1H62A 3S1XA 4UC5A 3HMJG 2J6XA 3W23A 2GQAA 2QUTA 1H50A 2TPSA 2FPYA 1DQWA 4AEOA 1SW3A 2X1UA 3A9IA 4LS1A 1OFOA 4DBEA 2P10A 1L2UA 3WK0A 3W2JA 2G95A 1GVSA 2D73A 3FYOA 5IBXC 1G7VA 3MJYA 2Y62A 5F4XA 4HKPA 3W6YA 3CM4A
chains in the Genus database with same CATH superfamily
2VRQA 1A5AA 3LPOA 5FEPA 5JMUA 3LHUA 1G4TA 4I3GA 1PAMA 3WD2A 3N11A 2PLJA 5LKYA 4GYPA 3D3FA 3RM4A 1JZ2A 4UTLA 3A5VA 5BMWA 2Q6ZA 3TZFA 3MB9A 2PMQA 4H00A 3O07A 3PS7A 3P5YA 1T99A 3PK7A 5KSWA 3RLGA 2DIJA 3OODA 2I14A 1FXQA 3FCPA 3S46A 3VFLA 5I6SA 1Q6FA 4RZ5A 4NRSA 1ZJAA 5A6BA 1KFEA 2W27A 1DJGA 4S3EA 4K7YA 2NUYA 4CQBA 2FZBA 3TN3A 1B0IA 3CH0A 1FHUA 3VIOA 2ZZ2A 4GKTA 4EX4A 1RR2A 3O6DA 3NQAA 3P61A 2XGIA 4GKLA 2DZUA 2DVXA 3POCA 1TPDA 4Q8WA 5B7ZA 1GVYA 2J79A 4NP7A 1OX4B 4IFKA 4HIBA 4HHHA 1E51A 1AQHA 1WCGA 3EXTA 3ISIX 3XINA 3OW1A 3IWPA 4PUUA 2VX6A 3IANA 1TYGA 4YWSA 4EAYA 4O1FA 5FL1A 5BCAA 3W7LA 3QM3A 3CIXA 2J8FA 1G4SA 4G6CA 3KZSA 4UFJA 3BLFA 3VA8A 3ZZ1A 4IP4A 3QC3A 4CNPA 4MNMA 2VR5A 4NZ5A 3U4AA 4F4RA 4ACZA 1DTNA 3H7RA 3NXLA 3GNDA 2QCEA 1A4MA 2DW7A 4R7JA 2XIJA 1E6XM 3RF9A 3ZVIA 3I6TA 4QSFA 2OEMA 4H8HA 1EF3A 2D0FA 3H8AA 3O2LA 2OU4A 2VX4A 4PUEA 1FWBC 3AHTA 3FEMA 4GVIA 1FDYA 4F9JA 1OC5A 1Q7QA 1NU5A 4LNCA 5K3VA 4PMJA 5FD0A 4CU7A 4POCA 3M0KA 5CC3A 2WMIB 1F74A 4GJ1A 2VEIA 5CSRA 2D23A 3P82A 4XD3A 1BXNA 3BOLA 4PE8A 3GYEA 2YOCA 4H6EA 5CC5A 6XIMA 2L5HA 5HATA 3TH6A 4IPLA 3T0BA 5I03A 3MV01 1D3HA 3ITXA 4ONVA 4IFOA 4H2CA 3BG3A 3ITTA 4AHQA 4AC1X 1RJPA 4GQGA 1Q8AA 1UWRA 2BY3A 2ZADA 1XYLA 4A35A 2OZ0A 3HZ3A 1AJZA 3NTYA 3M5XA 1FP8A 1C8VA 1L8PA 5HJLA 4GOAA 1RSCA 4Q8TA 1RCXB 3R1ZA 2C16A 1PSCA 3EMZA 4B4HA 4LGXA 3TX9A 1QNVA 1K7EA 4O1DA 3SAZA 4LRTA 1XV8A 3TLLA 7CGTA 6PTDA 3PULA 4XUGA 1Z42A 1E15A 3EDKA 4DZHA 3PAJA 2FKPA 3SN1A 2DUZA 4LF2A 1O5KA 1XIMA 1CXIA 3VZZA 2VZVA 4WY0B 4LB3A 2WVTA 4W8AA 1VFUA 2VQUA 3U0HA 3B9OA 1TELA 4QG9A 1F3TA 3A3WA 3LUTA 2HV5A 5KZEA 4FALA 3W02A 1UHVA 5CAHA 3POHA 2EXOA 4QGCA 2BNJA 4JNZA 3HGJA 4P7LA 1VEPA 2CLLA 3AMDA 3K4AA 1TE1A 1OK6A 4A8RA 2QV4A 4HP5A 5KITA 4BK9A 2B7OA 3M0XA 4UFIA 4LY8A 1NWUA 1XP3A 1V6YA 3WDPP 3UZZA 3F03K 4K8EA 3TR2A 4QEEA 4S38A 1XX1A 3IJ7A 3E2SA 3JZEA 4JFTA 1CB7B 4LAOA 2DUAA 3UG8A 1XCXA 4OGZA 3W28A 2IS7A 3WNPA 1MWOA 1BYBA 2QJJA 1TZZA 1QHPA 5LIYX 5DBTA 1HTIA 4L61A 5AKQA 3AC0A 2V9DA 4FXRA 5CSSA 3ENLA 4AWUA 1JDAA 1UR0A 1O60A 1X39A 4O53A 1W37A 3WYZA 3N9KA 5FF0A 1X7FA 2EPLX 4QFUA 1W32A 4U5KA 3HQPA 1RD6A 3GIYA 3LY0A 3MTWA 2XZ7A 1B4EA 4JHMA 3TYUA 2O9OA 1Z32X 2YZ5A 3PPGA 3QHMA 5BXRA 1E6PA 3PG9A 2FZMA 1TVPA 5E0KA 3SCSA 4RDVA 1CYGA 4LTSA 2XVPA 3N18A 3P0WA 4GYFA 1GYNA 5RUBA 2V3GA 2YIHA 1P0BA 1S5WA 3STCA 1W3NA 4Y9MA 3WDHA 2ZUVA 5T9CE 5CZKA 2HVOA 5LA2A 1IWPA 4HPXA 4YU1A 3SCPA 4DWSA 1G01A 2VFEA 4E4PA 1CXEA 3T78A 5C6MA 4PEEA 4LYKA 3L68A 1SO4A 4JKMA 2WPGA 1L6SA 3I3BA 4P7RA 4RDWA 3C2YA 1KKRA 4FEZA 3G1VA 1GOMA 2E1DA 3G1RA 3LB0A 4Q8NA 2R14A 4KBXA 3RUBL 1H1ZA 1K8CA 1CCWB 3L2MA 2NT1A 4X60A 3WF1A 2AL2B 1LBLA 1JZ6A 1E9ZB 1PHQA 1NIUA 1TA3B 3EWBX 2Y7EA 4MDPA 3TK7A 3R4IA 5CC7A 4JX6A 4HSHA 4JS3A 4WHBA 1R47A 4FS9A 1ELSA 2DZSA 4ZB2A 3DECA 1J4EA 3BAJA 2ISDA 5MF5A 2FZDA 4CQ8A 1OFBA 4MB4A 4NXSA 4IPJA 1E6RA 5D04C 4DUVA 2E40A 1UZDA 2YJQA 3RMEA 1L0PA 4GJIA 2OKTA 1W1VA 2PSNA 4H2HA 5CCZA 1PX3A 4B92A 4AZCB 1ICQA 2A79A 1P1MA 3LOTA 1QNPA 2Q3RA 1GZ1A 2V6AA 2R1PA 4RNHA 1F6YA 3IPWA 3WJXA 7XIMA 1XSIA 3B06A 2Z2UA 5H2ZA 4LY4A 3IGHX 2PWHA 3Q94A 1AW2A 1HP4A 3H2FA 1BVNP 5HJYA 5E1QA 4QCEA 1UD8A 4DN1A 3GXIA 1O95A 2FMOA 3D47A 1QW8A 3ITVA 5G5IA 3TW6A 4IIEA 3B8WA 2WSYA 2QJMA 5LNUA 1PTAA 3BJTA 2NZLA 4X3ZA 3I65A 4I5XA 5I02A 4TVUA 4BWLC 2EG6A 2CLKA 4MYXA 4AD0A 4PCNA 2C7FA 1S2UA 3QY8A 4X2PA 3EWUA 1HO4A 4K36A 1FCQA 3NQEA 3BW2A 5D02A 1XLIA 2Z6JA 5LIUX 1VJSA 1RPKA 2JIEA 2MNRA 3N15A 4W85A 1XPGA 1YPXA 4HSOA 5F2MA 1EJUC 3OGSA 3SUWA 2WQPA 1UIOA 1XG4A 3WCZA 1P0KA 4Q33A 1RUSA 2XGBA 3ECQA 4GE8A 4TOQA 2GQ3A 4NT0A 2F6XA 3N73A 2REQA 1E0UA 2OWCA 4CD6A 2WSQA 1RQBA 2INZA 1K6AA 2CLEA 5F1UA 3UFYA 5C2GA 1YTEA 3TMLA 2X42A 1OF6A 1TVLA 3LRKA 2FGBA 2E3ZA 3SI9A 5CSYA 3QSTA 4H9XA 1W8SA 2B0MA 1H3GA 3IIOA 3V5FA 4UOJA 1GOXA 2QAPA 3VGFA 2NVCA 1WA3A 4AG0A 3PWAA 1I2NA 2YFNA 3GHTA 4WLCA 1Q4WA 3ERPA 3WK2A 2WXDM 1R9XA 2PF8A 2AKZA 1B57A 3UXKA 4J2PA 1ME7A 5REQB 2OOFA 2EHHA 5D30A 5TD4A 4O12A 2DZXA 1QOQA 4J2MA 5FJRA 3RLHA 4D6CA 4WY0F 4S3CA 1PCWA 3RGTA 1XRTA 5FI8A 3LYEA 4NSBA 2OZTA 2E4TA 4OZOA 4WJXA 1BRLA 3NQGA 2D24A 1IWBA 3QR0A 4RR4A 3VNZA 4JX5A 1K77A 3KWSA 8XIMA 5GNZA 5I2UA 4D71A 3P8IA 4WZHA 4NL1A 3GRIA 4G56A 2BODX 3AZRA 4JKLA 2EKCA 1K3UA 1QPQA 4FI4A 1RAKA 4G1NA 1H60A 1QNSA 5EMLA 1TWDA 1R5YA 2OVLA 3TONA 4GH1A 4Q4RA 1Z69A 2PDNA 4HPJA 3GK0A 1REQB 3VXGA 4C1NB 4FXJA 1P0NA 3AHVA 2WNZA 5D8ZA 4PTXA 2ZX6A 3BICA 4LW7A 2VEPA 2NT0A 4ORIA 4LNYA 4I7WA 2VUNA 4AUBA 4S2CA 4AX7A 1IE7C 1CX9A 3UR8A 4LCQA 4DUWA 1PKYA 3ABRA 3B4UA 3B8DA 3BSHA 5CZTA 1TJ2A 4O1CA 4GMEA 3UXLA 3S42A 3DHUA 4IP5A 2XN2A 3L66A 3KOFA 2PU1A 2FJUB 1J6OA 3QOMA 2UY2A 2ISFA 1US0A 1KC7A 4F8XA 3WIJA 4ADTA 4IGMA 3SW6A 3SRKA 3KVLA 4MLJA 2C8NA 1LG1A 3THQA 3ALGA 3NIYA 2VZOA 2P53A 3QC0A 3NQ2A 1F6KA 2H3DA 4DNMA 1QXLA 4C6EA 4CN1A 1E3XA 1ITCA 3F5KA 4WDTA 5M1TA 2EAWA 4UR8A 3CTLA 4Z1AA 1UQYA 1R38A 1V0MA 4Z2GA 3W1NA 5HMEA 4EWND 3P80A 3NEVA 3KUMA 5FJOA 3RMJA 4F66A 1O5XA 1KTNA 2CBUA 1A5UA 1RLDA 2DZVA 1CENA 3UWWA 2FZ8A 2V3EA 3W1XA 4EVZA 4JDBA 4O1EA 1RALA 1UC4A 2I9UA 1U22A 5AHMA 3EAUA 6REQB 1N2VA 1V0NA 3FXYA 3TYBA 3PP7A 1LZOA 1CT5A 2QF8A 3B9AA 2NXIA 3CPGA 1AZ2A 3MYOA 1EHAA 3P7YA 2QAFA 3QVQA 3VKDA 4HHPA 1FKWA 1UR9A 4W87A 2E5CA 2X8RA 4QAIA 2VC7A 5D4YA 4PMRA 4NIRA 4MTVA 3WH7A 3B0UX 1PX4A 4BS0A 3D46A 5AHFA 1OF8A 4WKHA 3TYCA 4KT2A 3QQ0A 2IPFA 3N14A 1E9LA 1B3WA 1K03A 4WJ8A 1R0MA 2Y1HA 1WX0A 3T8QA 4MWAA 3BVJA 1ZJBA 4ECLA 1L6FA 3UG4A 1NDZA 3OLDA 2GGHA 3WD3A 4Z42C 3NCOA 2GJLA 4Z2KA 4JYFA 4N9DA 1PCKA 1E9YB 3MC5A 3L23A 4GNKB 4ZMGA 5DELA 2V38A 3CPUA 4E8GA 1ECEA 4CGTA 1VEOA 3N2XA 5D38A 2QVNA 4J5NA 2ZYFA 3EDJA 1GONA 4PMYA 1OYCA 1Q6DA 1T7LA 4XBKA 3L21A 4FZIA 1LCOA 3HG4A 1VENA 4B3KA 1VFTA 1X1ZA 2NLIA 1JNDA 4RXFA 1HQTA 4PUKA 4UTWC 3U2CA 4CNOA 4I8DA 1OGBA 4AY1A 4J3UA 3WQPA 3UPWA 4QRNA 5HPOA 2XVLA 4QNWA 4QISA 1V6TA 1ALDA 1FDZA 1EHNA 2C0AA 4AU0A 2P0OA 3AFBA 3GBDA 1JYVA 4DO7A 1EJWC 3CBWA 4S3AA 4B3ZA 5KZMA 3DYOA 3RX4A 2R24A 3H7VA 4OFCA 3GXPA 3AALA 2IPJA 2WZHA 2IQDA 2VFGA 5EMUA 1B5TA 3SURA 3UCCA 3DH7A 3UG5A 3C61A 4XO6A 1WB0A 1LROA 1T41A 2AMXA 2A7PA 2BG5A 1R9YA 1TX0A 3ZSTA 1E6ZA 2BLEA 4N4PA 5U4NA 4KFNA 1IQ8A 3NVDA 1IXOA 4GUGA 2ZX8A 2HS8A 1T6MA 4PCPA 3H2AA 2NV1A 3PJTA 5LA1A 5D9OA 4NRRA 5BROA 1X1OA 4QX4A 2C1IA 1DJNA 3S6DA 2KAUC 4WKFA 1CTNA 2EG7A 3VCRA 1EJSC 4LOCA 5TNVA 1OBAA 4BHYA 1PKMA 3V5CA 3IACA 3ZT5A 1ISZA 2C1HA 2PP3A 2XUCA 2NW0A 4KWWA 3I68A 1M68A 2ZE0A 3PZGA 1JCLA 4GC3A 2ZE3A 4JIEA 4MYAA 2Y70A 3V1HA 4PEKA 4NI8A 1EXBA 3FSTA 5EMYA 4U2ZA 1R2RA 1ZBVA 2DEPA 4KEUA 4P7QA 1D8CA 3EWDA 1YBQB 3CO8A 3CZKA 1GQNA 2NUXA 1E40A 8CGTA 1OD0A 3RM9A 4NQ1A 2P88A 3GLCA 4PR4A 1G6CA 3JR2A 2ZVIA 4PCSA 2XM2A 2WK2A 3TCSA 1DPMA 3VINA 1B3XA 3O0KA 2JGYA 1JGMA 3II1A 1EX5A 3GH4A 3P14A 3STFA 2OG9A 1DEDA 4JTIA 1RY0A 2BWGA 4GFSA 1P7TB 1E5NA 4CQCA 1FWWA 4AEEA 4ZEPA 1QRQA 5AZ1A 1VR6A 5JXQA 5MKGA 1K4GA 3IUIA 5FSDC 1W3TA 1KFLA 1NFPA 2C19A 3EWZA 3VOGA 3C0SA 2WW5A 1X8FA 1GYLA 1B9ZA 1ONRA 4CKQA 1UKQA 4B5SA 1WDWA 2ALDA 3L7RA 2HCVA 1W1ZA 4V1XA 3G18A 3SO7A 4RZ4A 2VMFA 1O1HA 3T05A 2GGIA 1F8IA 1HO1A 2WKGA 3NQFA 3DAQA 5AYYA 3BPWA 3BQ5A 1SO6A 4JX4A 2C18A 3WLSA 4S3KA 4M81A 3D3AA 3TE9A 3H2EA 2ODOA 3IVUA 1H0IA 2WV8A 4IUGA 3HM7A 1OC6A 3OTRA 2VI0A 2KZHA 1AMKA 5DMLA 1FP9A 3TFXA 1OGGA 3LPGA 2DQWA 3THCA 1UBSA 2Y8VA 2O56A 4GX8A 1FWFC 2C79A 2QUMA 3FA5A 4DZAA 4W88A 4AAJA 4G8TA 1H09A 3MPGA 3A9BA 3VNJA 4QROA 4ZTXA 2VGBA 2WVVA 3OQEA 1FWIC 4AY8A 3W29A 4E2VA 4Z0JA 2V3FA 2GUBA 1H7RA 1P5BA 2IXUA 4QXIA 3UR2A 4B9ZA 1ICPA 7A3HA 1SW0A 1T40A 3VD9A 1XLGA 1J9YA 4LB4A 2WPBA 2ALRA 3V36A 2GZXA 3WQ5A 3I3DA 4M7SA 4AIOA 3EB2A 4F2TA 4XX6A 3C0LA 2YXGA 2X40A 4D8ZA 3F4CA 3PNUA 5AECA 1FBAA 3AIBA 4JN7A 1R3TA 3M5ZA 4AXKA 3QN3A 1TV7A 3R8HA 3UR7A 1LYXA 3AXMA 5CPSA 3L4VA 2RJHA 1DWGM 2H8ZA 2QW5A 2XZ9A 1Z8AA 4XVDA 2CLMA 4DX3A 4A3HA 3M47A 2FPVA 3ARWA 4C1KA 4N42A 1DJWA 1KKOA 2XIQA 1EP2A 3NQVA 1TV3A 4QAWA 4QQUA 4AW7A 1R2SA 2GVLA 2BP1A 3OVGA 3VABA 5I7GA 3TJ4A 3G1AA 2W9MA 1VPYA 3CS2A 3DXIA 4HCLA 1SSDA 2Z25A 3FDGA 4S39A 3DHFA 1EH9A 3MP5A 1R30A 4RE2A 3M44A 4HNUA 3Q45A 5BWAA 1KWGA 1U5HA 4A2RA 5C7HA 3LCWA 1GEQA 4HCDA 3T08A 4RZ6A 4ZO7A 4OUEA 5U7SA 4M29A 4M51A 3DI1A 4MOZA 2DSUA 2ZA1A 3INPA 1W31A 4X0NA 3IJIA 3C4UA 4WIWA 1FH8A 2OLAA 2VGIA 4LS0A 3WDIA 3KP0A 3DYMA 3OHIA 2XH7A 4UUIA 3IUDA 3H24A 4UOQA 1JGIA 3JS3A 4QITA 2P76A 2OSWA 3NPWA 2VZSA 2A6NA 4HOXA 1DIEA 3IUHA 3TFCA 2GK1B 3S5SA 1SGJA 1A50A 3R8GA 3KHDA 4J9JA 4JTSA 2WLYA 1OCJA 3ARYA 2FZ9A 5GNXA 3ZWSA 1CEOA 1WZMA 2PWFA 1HJXA 3MSGA 3R0UA 4LALA 1E0WA 1I0DA 3NDOA 2YCLB 3O8AA 3E2QA 4MNLA 3QTPA 1SR9A 2CLIA 4LC8A 3U2OA 4O52A 1V3IA 3PBWA 1KM4A 5DO8A 3T09A 1WBHA 1SFLA 1Y5XA 4J28A 3WLHA 4BZYA 1EJ7L 4JTDA 3EPMA 3GU9A 2WBKA 2PGWA 1RCQA 1UKSA 3LHYA 1BF6A 4PTVA 3LCIA 3G24A 5D03A 3Q67A 1NM9A 3EZ4A 1VIZA 4KKXA 1HL9A 1W5PA 3ZIZA 4O57A 4JKKA 1JVNA 3BXWA 4R34A 3CUIA 2HDJA 2OQHA 3SUSA 3PB2A 2YDQA 1XJBA 1SR0A 4GYKA 1MDRA 5CQ1A 5D05A 5A8NA 4KCUA 3VAVA 2E6YA 2P5NA 4IGNA 3SGGA 4HSNA 4I6VA 3O3RA 4OV4A 4S3BA 4RDYA 5A1AA 1WUEA 1CXHA 4ZOBA 3TU9A 3BMVA 4RKAA 5CH9A 1UPPA 1W3JA 4LEQA 1Q6CA 1Z48A 2QT3A 4JAWA 1V93A 3L0NA 1KQYA 4R5EA 1FHDA 2YB4A 2O55A 2VDHA 2XFYA 3PZNA 3C2EA 3TUUA 3M0ZA 3CUXA 4ROQA 3H6OA 4HNTA 2NSXA 1XPYA 4GWEA 1VPXA 3CT2A 1Q6QA 3VE9A 3C3UA 1S2WA 4PUNA 3G1YA 4MKVA 4LAKA 1KNWA 2CLPA 5E9AA 1EC9A 2QDHA 5HA7A 2GQ9A 2OXNA 1P4CA 3UJSA 4JTJA 4U3AA 3WLIA 2E6DA 1K9DA 2OB3A 5AC6A 1FH9A 3PY2A 5DFAA 4O13A 1UR8A 5DY3A 2Y7DA 4KF1A 3W7QA 2PF0A 1PTDA 4L56A 4B5VA 5ECVA 5D2TA 1IZJA 1Q65A 4L6HA 3MMUA 3SN4A 3CAVA 2C15A 1VFOA 1N8FA 3WFZA 4ZL1A 4YTQA 5H8PA 4BQ4A 4O54A 3E74A 3HQNA 4IG2B 3UESA 3LGDA 2GGEA 3PTQA 3DCPA 1TJPA 2PTXA 3D6NA 2O9RA 5DEZA 5EMJA 3TDFA 5AC5A 4V2XA 2BGQA 1HKIA 2G97A 2CEQA 2ACSA 3BO9A 3TEVA 5JBEA 3MQTA 1TCDA 3DZ1A 4E8DA 1WO2A 1QI5A 1PS9A 3VYLA 3CUGA 4C6QA 1J12A 4YVXA 4FB7A 1RVKA 1NAL1 2VC9A 4J3TA 3MCNA 4PCFA 3SCRA 5HXMA 1UW9A 4C6DA 2D2JA 2GOKA 2UZ9A 1K7FA 4Q22A 1WKFA 2XIIA 2ZZ1A 3IAPA 4ICNA 2PGFA 3N25A 1NFBA 3B05A 1YDYA 1BSLA 2QF7A 2YBUA 1YRRA 1QHOA 2PDWA 2WVUA 1XINA 4N02A 1BYAA 4AD1A 4J1OA 4OU1A 4S3FA 2XIBA 1HNYA 1DHPA 5AC7A 4Q6XA 5DMNA 2Z1XA 2GVYA 4JIRA 2VGGA 1LM1A 3NG3A 4HJFA 2R1LA 4B5XA 2OGYA 3ZQ9A 2AOSA 1VB9A 1TWWA 2A85A 3G3MA 2BX7A 1DWHM 4MFDA 3AXIA 4NKCA 3AYSA 1O6IA 3N2MA 5EY5A 3W70A 5J8LA 3WLQA 3IIXA 4FNSA 4OIFA 4P61A 1GKRA 2V5CA 3BGGA 3E02A 5H6HA 4XKYB 4IL2A 4PB4A 5D33A 3QY6A 4GYPC 1ZUAX 3P62A 2I7GA 3PFRA 1LDCA 1MRAA 5G1TA 4RZBA 5CC6A 1DQUA 3VTRA 2XG9A 2Y61A 3NR0A 5HNNA 3O7UA 3M0IA 3AYTA 1J11A 1QI0A 5DX7A 3GXNA 3BZJA 1HJVA 1JI1A 1TPC1 4KWOA 3EPNA 4Q8MA 4H8NA 4TMCA 5FJUA 3COTA 4Q4MA 5BRBA 1OVDA 2CNCA 2QPXA 2WHLA 2UWFA 2VURA 4UC5A 3GXDA 4EKJA 4D1JA 1DQWA 1SW3A 2X1UA 3OZMA 4EPDC 3KOYA 3F7JA 3W2JA 1GVSA 3FYOA 5IBXC 1RBAA 5FOOA 1ZP3A 5F4XA 1V3MA 1C3FA 2J47A 3QZEA 3S1VA 1CWYA 2D20A 5AC8A 1F6PA 1Z44A 4RK8A 3MUAA 1XDLA 3I10A 3SSJA 1PVNA 3HGRA 4TTUA 3K30A 4B9YA 2DIEA 4K39A 4AH7A 2GGJA 4JYEA 4JEQA 1M9HA 2DH2A 4DY1A 2PDIA 4JTFA 3E6EA 4ERAA 1PDYA 1FCUA 2EQDA 1TZ7A 4KGLA 4QLKA 1JAEA 3LERA 4M82A 7TIMA 2H9AA 1QNQA 1TB3A 3WNOA 1V7AA 2ZKMX 3LCGA 3RN6A 3KRBA 2J4GA 4KWVA 1XSJA 1RK6A 5EBUA 3CAWA 1JR1A 3TSDA 2PRMA 3PWIA 1DWIM 3UT0A 1PL9A 1DKWA 4AD2A 3M5YA 5BU9A 1UZHA 2V2HA 4YYFA 1GKPA 2H90A 5BXSA 4MF4A 1QR7A 3BSGA 3NSNA 3WLPA 1BQCA 3OQ8A 2VELA 4L7ZA 1W1YA 1A53A 3RLUA 4DO5A 4M80A 2OX1A 1OHLA 2Q8ZA 3EOEA 2POZA 2E8ZA 3TV8A 3Q4DA 4M19A 3NL5A 4IQEA 1NF7A 2BSLA 2FFIA 1RJRA 1BQGA 3SQMA 1FWHC 1W2VA 3O9NA 1KR0A 1MNZA 3RRXA 2HMCA 3KAOA 1QUMA 1I2PA 1XC6A 3PWGA 3WLRA 4I6KA 1TX2A 1MW3A 4H9YA 2J78A 1Q7MA 4FOKA 2PWUA 3NO1A 2FTYA 3N6JA 1TFVA 3O0FA 2VFDA 3HU7A 4CEUC 3KTSA 1IR2A 5B7YA 2UV8G 2FFCA 4S3JA 2YL9A 1ADOA 1VFMA 2A7RA 4Y9AA 1VBGA 5AHLA 1F61A 3CHFA 2QGYA 1SFTA 3VMPA 3GXMA 4W8LA 3OOQA 3P67A 1QAPA 5I23A 2X2YA 4GI6A 2PGRA 1LT8A 3JUGA 3WDRA 1YXYA 1KM6A 4E6MA 3KRUA 1IT0A 3WQEA 4KFPA 5D9MA 1P48A 1KA9F 2XVKA 1OG0A 2A2IA 1AH3A 1JRCA 5EB8A 4H8VA 5BU6A 2WKLA 4JQAA 2DIKA 4DRSA 4V27A 4FLOA 5EL1A 4DAFA 1FXPA 5IHSA 4IFKB 3PUOA 1U5JA 1NP2A 1OFDA 2YLAA 1F3EA 4TX8A 2DORA 1S5MA 1UA3A 2ZTKA 2GWGA 3I7QA 5A8PA 1I6NA 1XHGA 2V5DA 2EPOA 3CWHA 3W7KA 4WR3A 2CBJA 2PEVA 3ZMRA 1OADA 3SJNA 4QIUA 3BOFA 4ZENA 3MDUA 4ZOCA 3SFWA 5KZ6A 1EDTA 4V33A 1AJ2A 2X41A 5I09A 3AICA 4N6FA 3GUGA 3TZNA 3KCJA 2I9EA 1KRBC 3CNYA 2PRHA 2ISWA 2Y2WA 1OX5A 3DN5A 3EWXA 4MAZA 1XLMA 1JDEA 3F2DA 3TNOA 3N9SA 3AJ7A 2G3IA 1XCFA 1KGWA 1WOAA 1XLJA 3H4WA 3BCFA 4RX0A 4U33A 4QP0A 1XIEA 1QI4A 2F7FA 1TE6A 4LVBA 2QPSA 3OO2A 3QMTA 2Y88A 5E5CA 4KRUA 4RV3A 3NZGA 3PC0A 4GABA 2G0WA 3KHJA 1L2QA 3ATYA 2E28A 4JL1A 1S5TA 5AHIA 4IX0A 4JTQA 1S2VA 3F2CA 3QOKA 3VE7A 1RHCA 1THFD 1GG1A 3W2LA 2UY5A 2X09A 4ZOAA 3EX2A 2BGSA 3CQKA 4PUJA 3FIGA 2DPEA 2YDAA 3K8LA 3NA8A 4DWSC 1CLXA 3B9NA 3BQ6A 1V77A 1FUYA 2JEPA 3IJ6A 1XRSA 1QFEA 2PA6A 3QKEA 3T8LA 1R46A 1KFKA 1VRDA 4UZUA 2QHAA 1AW5A 1XWYA 4D6JA 4GVHA 4ZO6A 4XTIA 3KEHA 1LTDA 3RAOA 1XGEA 3URNA 5A95A 2RDTA 1PZ2A 3WD1A 2J25A 3PJUA 1FWEC 3AS2A 5T8GA 1BG9A 3EB3A 3N3TA 3A5FA 2XH0A 2NX1A 1R3RA 3NYZA 3FLUA 4JY8A 1A49A 1ISYA 4K68A 4BQ5A 1RXOB 3KX6A 4N7QA 1Q6GA 4XB3A 1GJUA 3LCFA 1BSIA 5FA5A 1W6TA 3DEQA 5CPTA 1K7XA 1WYIA 2EG8A 4DZIA 1EOMA 1FWAC 3UJ2A 1F07A 1O4UA 4DAIA 1F4HA 4O17A 2JQXA 4FR1A 1R3SA 3SB0A 1ZSXA 4E0CA 4PYSA 2DZAA 2NUWA 2V3DA 4IIBA 3S0CA 1NOFA 1UUMA 4AF0A 3STEA 4ADSA 3WQOA 2QYGA 2J7FA 3VD4A 1CNVA 3R6IA 3ES7A 1TR1A 4J3WA 1OT1A 5A6JA 2BMBA 1DXIA 3M0HA 3RXZA 4W5UA 2C91A 1FA2A 2RDUA 3QY7A 1GZGA 4TO8A 4PB5A 4O1AA 4ORMA 5FIPA 4GINA 4NAEA 3IJ9A 1WKEA 5HWNA 2XIOA 3FAXA 4WCJA 3VKBA 4D8LA 3KW3A 3GHRA 1GOIA 4JGDA 4UR9A 2JF7A 4Y9PA 4O0QA 3F1QA 1LRNA 2HVNA 3BLKA 3ORWA 4GZEA 4GO8A 1PZ3A 4D1IA 3REQA 3WY1A 3CZLA 2EO7A 5CAKA 1HL2A 4ZXOA 2B81A 1C92A 3KBSA 1UWSA 3NGJA 7PTDA 3U9IA 2F2KA 5CZ0A 5CBBA 3TJLA 3VKKA 3WQ6A 2Z2AA 3ZXWA 1VAHA 1YPFA 3M16A 3QZ6A 1WKYA 4FLRA 5I24A 1D8WA 1XIJA 4PULA 4FNTA 1Y5WA 1BKHA 2E5DA 4UQEA 4CQ9A 1ZNNA 2Q01A 4QS6A 3BLLA 4W84A 2QDEA 2W92A 2OR2A 2FB2A 3W25A 2ICSA 2CBIA 3ARRA 5G2WA 4GIEA 3TN6A 4EPEC 3VZXA 1K9FA 3N12A 4KGJA 4RCXA 4HNLA 4L5ZA 1F3XA 1GHRA 4DWSB 4PUMA 1VD6A 2PP0A 4XAGA 3CEPA 3PFMA 4GNVA 1JXJA 1S39A 1ZZMA 1XQLA 1UR2A 1XFCA 1OZMA 1PDZA 4KETA 4C90A 1KV8A 1XUZA 4WKAA 1XM3A 1XI3A 2V5KA 4UTFA 1WQ5A 3DG7A 2W66A 1UQZA 2QEZA 1XYAA 2QDGA 3STPA 4GYJA 3UF9A 4XAFA 3DESA 3CIVA 1PYFA 3SCUA 2XPKA 4XKMA 3WZ0E 2E6FA 1LOSA 2BXZA 3RCNA 3VUSA 4WF7A 2CHOA 4AQLA 1JCXA 2QGHA 4HYVA 1YNPA 1EGVA 1V3KA 4EWJA 1OIFA 2IPWA 2JE8A 1X6NA 4XZ9A 3UJRA 1ZENA 2BXYA 2VL4A 3ZOAA 1YLVA 4YVPA 4UTTA 4AY7A 5JIWA 3OLIA 3S2NA 4ZVJA 3CLWA 2YW4A 4CNSA 4NI3A 3ZLFA 1DVJA 3BGJA 4C1LA 4PRRA 2X0HA 3NDYA 4H9UA 4DB7A 3QPZA 5DY2A 2Q8LA 2VT0A 3GE7A 5FJIA 4HT3A 3AZTA 2CW6A 1H49A 3FGCA 2V68A 5I3FA 2R8WA 4EIVA 2CWNA 1XYMA 4FOJA 4GISA 5BOEA 1QASA 3MUCA 3ZYZA 1VRXA 1CECA 4YTSA 2WCAA 1B9BA 2OQLA 2PDGA 5K2ZA 3B8TA 4TX6A 5F2LA 1JCTA 3VC6A 3VGBA 3W7GA 3M64A 1XSKA 3LI0A 2VNCA 1OSEA 4PMQA 4TR9A 3MWCA 4HK6A 4BKNA 3R43A 4ZE5A 4M0XA 4O11A 1O94A 3OIHA 1RVGA 4B5WA 2X0YA 5ENLA 3GC5A 3JU2A 4HNCA 3L67A 3ALFA 3HFTA 2GQ8A 3PBYA 4KEMA 4BA0A 3CWOX 1Z7AA 1E4MM 3L4TA 3HPAA 3FHQA 4WEVX 3QPEA 1V6XA 2CXGA 2YBVA 4R27A 3ZJ8A 4YHGA 5FAGA 3A24A 3R13A 3QZAA 3SRFA 2WJEA 2VUYA 4LCRA 5IHRA 3IEBA 2DVTA 1BTMA 4GIRA 1M04A 1YDVA 1VFSA 3N19B 1UD3A 4DPQA 4ATDA 3S9ZA 1TQJA 4QG8A 4NAFA 1UP2A 2FDSA 3HG5A 4RE0A 4EXBA 3ES8A 5BYWA 3LNMA 4YIWA 2REQB 2PDCA 4IGSA 3XISA 3TROA 3TTEA 4XSLA 3V5OA 4AX6A 1E70M 4WRHA 1AMYA 2YDRA 2PDHA 4JQ4A 3WX7A 3DFNA 5HANA 2PTDA 1D3GA 3TQPA 4LBSA 1EFZA 1YW1A 2IKJA 2V82A 3B40A 4GZJA 3IJLA 4NYYA 4O28A 1FWSA 1TUXA 4UNLA 3IARA 2NQLA 1PIIA 4C6IA 3AWNA 1NWTA 5D2WA 1XD1A 3PR2A 2WNQA 3W74A 3BH4A 3WH9A 1LUCA 4AWSA 4LQ1A 3MO4A 3VDHA 1S3HA 1T5AA 4H9MA 1US3A 4QJ4B 3AAMA 1V3JA 1BGAA 1ZAHA 2WQDA 1B3YA 3WQ4A 4MWAC 2D22A 1BFNA 4H6KA 1AH4A 4Z0SA 2VEGA 3PVFA 3QW3A 4LT9A 4OUIA 4KIEA 1I8JA 2XINA 4B16A 3SQLA 3C8FA 1GHSA 4D6HA 1VBRA 3TN4A 1ZAIA 1FRBA 2RFGA 2R9RA 2CITA 3C6CA 3WQFA 2XN1A 4GZIA 4P7NA 4JIHA 3VIJA 3N9RA 3FKRA 3LTPA 1TTPA 4XZBA 4XK2A 3WQ8A 3E0LA 1IGWA 2C1GA 1XLAA 3K13A 2G3MA 3WD4A 3OP2A 3SRDA 1CPUA 2VFHA 3B3DA 3AYVA 1OWQA 4NZ1A 1W5MA 4P8VA 1TA3A 3M0YA 5TF0A 3T0AA 4DM1A 1DOSA 1PIGA 1D9EA 2E1WA 1SYTA 2XSBA 3VIMA 1JZ7A 5DQPA 5K9DA 3NL6A 1PWLA 4ZQRA 1CGWA 2XIMA 3E9AA 3BAWA 2YYTA 3DFHA 3STGA 5I3GA 1E1EA 5HUOA 1JPKA 4EPKA 3T42A 2EKGA 3U57A 3EDDA 1WDRA 4D6EA 3MWAA 1IEQA 2WBGA 3EBVA 2QQ6A 3PBUA 4E3TA 3O06A 3WK1A 1G1YA 2CLHA 3U3HA 1S2AA 4XSMA 3S5OA 4AZCA 1SO3A 3M07A 1SJAA 2FVMA 3NZQA 1H63A 1OFEA 3W7NA 4GO9A 1J10A 2R91A 4DJED 2DFAA 3VILA 5A3HA 1R3QA 4J7RA 4GPNA 4ZFMA 2ZWZA 1FY6A 2DV0A 2V2DA 4MB3A 4GVFA 4X9YA 1VPQA 3BW3A 3KRSA 3UXAA 1KFCA 2VXNA 3C2OA 4W9TA 5BWFA 2D0HA 5C70A 2Y63A 3GXFA 2PBGA 5HDRA 1NELA 1UH4A 3ARZA 2PLKA 5TAOA 3UZJA 1RLCL 2GJRA 2OGJA 3K8MA 3E96A 5EYWA 3G0XA 1JUEA 3A4JA 4CNUA 1RK5A 3P6LA 1M7OA 2YCKX 3NQBA 2YZRA 4YTTA 2I57A 4I5RA 1GORA 2J74A 5CPQA 1TPEA 3N2CA 3E5PA 2JEQA 4MSSA 5ABFA 2ZRUA 1UPMB 2TYSA 3VMOA 1C9WA 1AQMA 4HVXA 1FWNA 5LHFA 3E0VA 3TW9A 2G4FA 2FHFA 2E77A 2VVSA 1GOWA 1P6CA 2BFGA 1V08A 2HTMA 2ZDRA 2DP3A 3BAXA 1BXCA 1PWMA 4GCXA 1NVMA 4MWAB 3F2BA 2INEA 5A6SA 1XLLA 1OX6A 3GKAA 1SMAA 4GNJA 1W3HA 1XISA 3D5HA 2HK0A 2VTFA 4U3CA 3KDNA 2HISA 1OFQA 2WJZA 3ATZA 2ZIDA 4WX2A 1OABA 2YL5A 5BXTA 2A21A 5AYBA 3GU2A 2V30A 3W7OA 2J7GA 4YTUA 1AFSA 4J3ZA 1IXQA 1QOPA 4KESA 1U1UA 4NNCA 1TTJA 2ZDSA 2A6LA 1RJQA 1TQXA 4A6GA 3PZUA 5A6LA 3VDCA 1K8XA 4HPGA 4QS5A 5HWMA 1CGUA 5AHEA 3UJEA 3W88A 3ZLHA 1EP1A 3GFXA 3HOJA 3DFTA 2DT0A 4TXEA 2PRLA 4D2JA 3HPFA 5MHBA 4Y6GA 3CYJA 3GNNA 3WDJA 1EKOA 3U6WA 3W24A 2OSYA 3TOYA 4FXSA 3JZUA 3L5AA 3PM6A 9XIMA 4MHBA 2KX9A 2E9LA 3T0DA 1YNQA 3GY1A 1JYNA 3NQMA 3GG1A 2Z29A 4DUXA 2ATSA 4J4KA 1R6WA 4JY9A 1J96A 4H83A 1W9PA 2JF6A 4UTUA 1YEYA 4XISA 4LUSA 3GD6A 1XRFA 1ISXA 2EPMX 3OPSA 2ZA2A 3S8HA 4QCFA 3C2RA 3BLOA 1GOOA 1S3TC 1I2RA 2E68A 4CQDA 1NOUA 2YX0A 4DEFA 2NWSA 5M17A 2ACRA 3KVMA 5CXPA 4C60A 3FYPA 2J66A 4ES4A 5HJXA 3ZLGA 4W93A 3GTFA 4WSKA 3TR9A 1TR9A 1XIFA 1UH3A 1UUQA 4AZIA 4C6OA 3TJIA 3PTMA 3SCOA 4PTNA 3G8RA 5HINA 4GK8A 2OYKA 4W89A 2P50A 4Z2JA 1Y65A 1EYWA 1AD1A 1WNOA 5DF0A 1GQLA 4O18A 2X1IA 5DCBA 3VX0A 1YE4A 2PC8A 1JQXA 5FAJA 3WLNA 2I56A 1CGXA 4ATWA 3CQ0A 1F4AA 3ZJKA 3GU1A 2HPMA 3KL0A 4JTUA 1SJDA 2CZ5A 1UWUA 4UMCA 4ZR8A 2I5GA 4AZBA 2BASA 2ASHA 1HJQA 3IGXA 4JYDA 7REQA 1GOKA 5EMMA 5IBXA 4OBTA 2IKIA 1JRBA 3P2VA 3TYZA 1O1ZA 1JF5A 3WBEA 5FCZA 2RH9A 3ONCA 4UWMA 4HZ6A 2VYOA 3FXGA 3ABOA 4HK5A 1V6WA 5MKGB 1LLOA 3GZ3A 1OT2A 3UZXA 3MU7A 5IDZA 4NZJA 2OSXA 5H91A 3ANUA 4C5ZA 3R2GA 4M1BA 3HGOA 5I0DA 3ONBA 2W79A 3BMXA 3SDOA 1JYXA 2I1OA 3PHAA 3T0TA 1XLHA 2TODA 5K7JA 2ZRYA 1PXGA 2FGZA 3QLLA 4FOUA 3PBVA 3CYVA 3W2KA 2G4JA 1ZJHA 4IJCA 3EWYA 1GQJA 1W5QA 3B97A 3SADA 2YGYA 1SZFA 1MW0A 2YSWA 2PWEA 4GUFA 1TKKA 4UFHA 2YDSA 5FF7A 1I2OA 1KM3A 2DY3A 3LBMA 1E43A 2EPHA 4Q32A 3I3EA 1D7FA 1JEZA 1CXKA 2PWDA 1XDJA 4ML9A 4AIBA 1UMLA 1YHTA 1FDJA 2CLOA 1KXHA 1OCQA 1XLDA 4WD0A 4WXZA 1A47A 1OB0A 2WVVB 3BLDA 5BRQA 1AL7A 1X97A 4Z1CA 3LG3A 4GX9A 2V63A 5CG7A 4L9YA 4WDWA 3G1SA 5GQBA 1KCKA 3B0YA 3BSMA 2W91A 3APYA 2GVJA 1HW6A 4G1KA 4IF2A 1Z6KA 1TREA 3O6AA 1UD2A 5E70A 1TPUA 3NSMA 1ZU8A 3MHGA 3CZEA 3UXIA 1JDFA 3S9IA 3PZMA 4PODA 1S1RA 2V8ZA 1WDSA 3MVTA 2GDQA 1GVQA 4XAPA 2CIPA 4PCTA 1A0DA 4CUCA 2HVMA 1OYAA 2EF9A 2Q8XA 3KRZA 4XBJA 5HBFA 3W38A 3MZNA 3WENA 1F05A 1W17A 3R11A 1WBJA 2DVUA 3LEPA 3M5VA 1FH7A 4CCZA 4LUJA 5E09A 2CBVA 1POKA 1X38A 3T6CA 4GXMA 4CVUA 3S3GA 2IKGA 4O14A 4UNIA 5AVNA 3BLIA 1XIGA 3EEZA 2V5LA 3CEUA 3UGRA 1GVIA 1EWEA 1ADDA 3KVJA 1GVRA 2ABAA 3QV9A 3GS6A 4OJYA 1JG9A 3TYEA 4K8HA 1JFXA 4L1GA 1EEXA 4YJ5A 4PN2A 4AZ5A 1W1A1 2UY3A 3WKZA 2ZRXA 2J62A 3S1GA 1JNEA 3U5YA 4MNJA 1ZAJA 1YYAA 2WOQA 3WNLA 1WAWA 5A2BA 1CXFA 2HPIA 2P8BA 4V28A 3AMKA 2XSXA 3OZPA 3SFKA 1C9DA 4MG4A 1KQZA 3PZQA 5AZ0A 3IJ8A 4FPSA 1NF0A 3R25A 4AD3A 3LXAA 3QKZA 1LWJA 1A5MC 3AYRA 3EWCA 4OVXA 2Z7KA 4G5DA 3RNDA 2QCHA 3GTXA 1L8NA 4EANA 4L9XA 1TTQA 1Q85A 1KBBA 4JTLA 4IX2A 1KBKA 1VQTA 3AIVA 3R8RA 1B4KA 2QNEA 1J8VA 1SZRA 5JU6A 3N6QA 4FX6M 4PTDA 3R7MA 3SUUA 3ELFA 1DJXA 5DRCA 1NARA 3KBJA 3UNTA 3OVPA 2YPIA 1HKWA 4IMDA 4CD5A 2DSWA 4U31A 3CPRA 4BI7A 4XZMX 3TA9A 3MI6A 2VEFA 2WWDA 3PTKA 1G5AA 3LZ5A 3B8VA 4LCSA 5D2XA 3NL3A 2YKKA 3FVDA 3G8EA 4UCFA 4F0MA 2POTA 2GVEA 1JIBA 5FL0A 2CETA 1PTGA 3DGRA 4TIMA 4L9ZA 1KRCC 1H5VA 1K6WA 1UOZA 3W72A 2VX5A 2WM1A 1KCXA 3DDMA 2OLSA 1XCWA 4H41A 5DT7A 1V3HA 4IICA 4YTRA 4HZ8A 1HJWA 3EMQA 3WUEA 1QDSA 1WZKA 1OZQA 4WGHA 3P60A 1S38A 4CLMA 1YQ2A 2CZVA 1TPWA 3NQ6A 2IMRA 2WMGA 1BVZA 3LGGA 1MI3A 3R0KA 4X2RA 3ZO9A 2AKMA 3I4KA 3G1HA 4K8GA 1QPOA 1F5ZA 1JZ3A 3LX9A 5C7VA 1EC7A 4LANA 3FJ6A 1XS2A 3CMFA 4X63A 2B7QA 1HGWA 1EPXA 4KRTA 3WQWA 3ZJ7A 3UA4A 3RJXA 4NZFA 3UCQA 1GGOA 1GVEA 1JD7A 2QJIA 1MZRA 1MEHA 1H11A 2DT3A 3CZ8A 2VR2A 3P93A 4FNPA 1R7AA 5HK4A 1UZ1A 4WJEA 2XFRA 4K37A 2ZRVA 4PBFA 5HNUA 5BOFA 3QYSA 1JYWA 1A80A 1QPNA 1R8LA 1VBJA 1QK2A 4DO4A 4F0RA 1RA5A 1DE5A 4PBGA 1F2JA 3M0LA 5CPNA 4X0VA 5HPCA 4JNMA 3S9YA 4PSPA 3RO8A 4KIRA 1M7JA 4Y8FA 2YLLA 3VCNA 5G1MA 1V8EA 2JBMA 1Q6OA 3DX5A 1PEZA 4DJFA 1TWIA 1YXCA 3IVSA 4WQ6A 2XWEA 2A3BA 1A3XA 3IK2A 1QHZA 5EKYA 4FF5A 1NP0A 4RXGA 3MMTA 4L4OA 1MFUA 3F4DA 3R89A 4L1XA 4HB7A 3DU0A 2FHCA 3SGUA 3S1XA 4FMVA 3KP1A 3OU8A 2FDMA 4AEOA 3AMLA 1OFOA 1PYMA 5AY7A 3WK0A 1XYZA 2D73A 4JQ3A 3OHMB 4PMDA 4C7DA 1GNXA 3E0WA 1IZCA 3WNNA 3L4XA 5C9WA 3CT7A 2VR4A 1J0YA 1MW1A 1UKTA 2NV9A 3BCDA 1ZPTA 4ZOEA 4AWTA 4FX7A 3DG6A 1J5TA 2WYSA 5G4WA 3ZR5A 3UNDA 2ZUSA 1XR2A 1IF2A 2TSYA 4FIQA 5FF4A 2BB0A 4NASA 1EZWA 1EDQA 3TAOA 1UWAA 4PMOA 2OODA 4L1WA 4Y9NA 3WLMA 1E56A 1G67A 4Q6JA 3LD5A 2HS6A 1FWJC 4QR6A 4IMAA 2JKPA 2PS2A 1HF6A 1GWJA 2VP8A 3ZSSA 4HNVA 2BVTA 2J7CA 4KWSA 1Q3NA 4W4QA 4PRTA 4P8XA 1KTCA 3S1WA 1J2WA 5A94A 2ON3A 4A3QA 3QHOA 2OMAA 3W22A 3OG3A 2YCLA 3K46A 1RZMA 3GVVA 1X98A 4K1GA 2Y6ZA 4KFOA 2V81A 2CESA 1WE5A 1Q6EA 3KBMA 3WJSA 3FJNA 5D32A 2D69A 3AMGA 1SZEA 1WAUA 1KGUA 3G6MA 3URQA 3L0GA 3AU6A 5LNSA 1TMHA 1G94A 3S83A 3CAQA 3N1AA 1VIWA 3SRHA 5CZJA 3BAIA 3T0CA 1XBXA 3VOCA 4Q3MA 4JZ5A 4B2DA 1LF1A 3FN9A 2VZTA 3PUEA 4Z2HA 1KBJA 2WLZA 1A3HA 1QI3A 2GYIA 2HEJA 2Y5SA 3KBVA 1H51A 1RV8A 4HN8A 1A5KC 1O5QA 3FEQA 3SCTA 3GVGA 2XFFA 4J40A 3S5ZA 1AL8A 3GNOA 1XKJA 5A6MA 4D8AA 2J7HA 3TCEA 1CB2A 4YYCA 1SFSA 3W82A 4EF9A 4ZFCA 3OYXA 5I00A 1B30A 4KCTA 1DXFA 4P7OA 3W07A 3ICJA 3PZVA 1SZGA 2YXOA 4LJ3A 2G8ZA 3IIZA 2H9AB 3FOKA 5F4WA 2PE4A 5FESA 4MADA 2J75A 1ONXA 1JPIA 3VOHA 5FF3A 4JHOA 5I78A 2QCGA 1EBGA 5E0FA 4DJDD 2QUVA 4IUOA 3WL1A 1OGSA 2G50A 4UIOA 1JZ8A 4L4PA 3SUVA 4UB9A 2QR6A 4LBUA 1QK0A 1A5SA 2HBXA 4JFUA 1A5OC 4DIAA 4XWUA 2VOMA 1DV7A 4IOTA 3S6TA 2CCRA 4WDUA 1S5VA 4OBRA 2F8QA 3SGZA 1VFFA 4HHLA 1M3UA 3V4BA 3HIJA 2FVKA 3L5LA 3WBAA 4KPLA 5C71A 4IMGA 3VUPA 4MJ4A 4LBRA 1U1JA 2CKSA 1LG2A 3KDOA 2YB1A 2DQXA 1FFRA 4HMEA 5LXEA 4LAMA 4HYRA 1M5WA 1PV8A 4E2OA 1ZY9A 1YDNA 2BV9A 4ROPA 4XIMA 1V3LA 4F0KA 2RDXA 1H5YA 2Z4GA 2GSEA 1I1WA 1W91A 2VD9A 3W4RA 4CD8A 1C8QA 1WXJA 1BD0A 3MUXA 4A3RA 1HKVA 1X8CA 3MBDA 1ZBKA 1IEIA 3BDKA 3GVWA 5HOSA 2Q71A 3WMLA 4D72A 4S3GA 2E8YA 3C0JA 4LVAA 5C55A 2WANA 3ZT6A 4ICMA 5I79A 4ZQCA 1W1TA 4XBSA 2DU2A 3PBMA 4AIEA 3UP8A 2JKEA 3UQNA 1H7NA 1X6LA 3PPFA 2GVGA 4PRWA 4BY3A 2A7NA 2W6RA 3GB6A 4FP1A 2CZFA 2B4GA 5FACA 4K6AA 3QQWA 3V0TA 1QNRA 4QE5A 2GSHA 4E4UA 1S2CA 1KCZA 3E1F1 3L65A 1KM2A 4CU8A 1PZ1A 1GVOA 3EWWA 1GJPA 3BUVA 3K4WA 3M6YA 3QJAA 2VWTA 3HURA 4F40A 1N55A 3GDKA 3C8NA 3KL5A 1DIOA 5C0QA 1KFJA 5DMYA 2VOTA 1VF8A 4YS1A 4GD0A 1RPXA 2ISVA 1P6WA 3BANA 3BGAA 1UR4A 3VFCA 2Z7GA 4NXKA 3H4XA 5BW6A 1VJZA 3A12A 4EACA 4C6LA 2ATMA 4JL2A 1TIMA 5C54A 3NPXA 1YX1A 3W7HA 1QOXA 1KRMA 4G7EA 3WK3A 1UB3A 2X30A 3AO0A 4GGBA 2NX9A 1HVQA 1VLIA 3N17A 3NZRA 3B0PA 4L64A 4FR6A 5E9XA 5E6ZA 4PMUA 3WLLA 2QLYA 4MDOA 4FX8A 2CERA 4JIQA 3P0XA 2ONEA 2WKJA 3OJGA 3FA3A 3NZPA 4GG9A 4EK7A 4H8UA 2GWNA 3PZ9A 4ZQOA 1XG3A 4M6VA 3UGVA 2IW0A 2Z00A 1XGZA 3WF2A 4D6GA 2VEMA 3USBA 3VGHA 3DFYA 1U30A 1MRQA 2BVDA 1XBVA 4X22A 2PTZA 1V02A 3SBFA 2PDKA 1OG6A 1AW1A 3KOXA 2X0SA 4G2DA 2WC4A 3E2RA 4RJEA 4OV9A 4F79A 5GJMA 1PJ9A 3VKAA 2WM0A 3RU8X 3HO8A 5F4SA 4MKSA 4DF2A 4LVGA 2YCJA 3CAKA 4DBWA 5M5DA 2BTMA 3S1UA 2D1ZA 4JTEA 5FF2A 4AZHA 3C56A 4DELA 3V1PA 1KLYA 4F0HA 2VVNA 3BJSA 4V1YA 2HQAA 3TW7A 5J5DA 4JOMA 2D2HA 1ZL1A 4KERA 3RU6A 1B54A 4C6MA 4K1WA 2C13A 2J77A 2VZUA 4H19A 3O1NA 1EX1A 1ZHAA 4GIAA 3TC6A 5HNTA 3T2OA 3IAQA 2X05A 3U2ZA 1WOBA 1IT8A 4DXKA 3EB4A 1WXYA 3LN3A 3M0VA 1G0CA 3WUGA 3K2GA 1LRQA 3DERA 3OB8A 4KW2A 1V0KA 1RH9A 1W3IA 4A05A 3S5YA 4MAVA 1UR3M 2OLHA 3JVAA 3W3OA 3A6OA 2NVAA 3PNZA 3UETA 3S4TA 5F7UA 2BOFX 5HQEA 1EWDA 3ZJ6A 3GG8A 2CFFA 3FHAA 4QE1A 1K8YA 4UTTC 4MUZA 1GK8A 5A8GA 5LSMA 3UWYA 3WJYA 1QI2A 1TWSA 3CUHA 4U4MA 5AOUA 1FQ0A 4AF0B 3W2MA 2QIIA 3AIWA 2WZTA 3MHFA 1SUXA 1NOWA 1JI2A 4EE9A 3OIXA 4AC7C 3VVGA 1KV5A 1J5SA 3CQIA 3TMQA 1H61A 1GTEA 1O5RA 2EPNA 3AI0A 5HMSA 4UQAA 1W1PA 3DI0A 1WZAA 2ZOXA 2VDGA 1P6BA 2PC4A 2QUNA 4NAEB 1OEPA 4UTIA 4UQDA 4TVDA 2QIWA 2XSAA 3FDKA 2ESCA 1DJIA 1CBGA 4GQQA 3GIPA 1BYCA 1VC4A 3I4EA 1JL8A 3TC7A 2XU2A 2BXVA 3REQB 3QF0A 2Y7GA 3VKJA 2ZRZA 4DBSA 2OFJA 2QS8A 1BKSA 3IIPA 3WQDA 2G5WA 1GEHA 5DBUA 4CD4A 3K8KA 1RCOB 2HXTA 3CIWA 3CHCA 3EOSA 3VGDA 4XV0A 1PPIA 1TCMA 2NQZA 3CXOA 3ARUA 3OLGA 2FJKA 1R86A 1W0MA 3A21A 4REQA 1FWDC 2W62A 5LZLA 1HX0A 1PKNA 3RK8A 2ADAA 3Q37A 4QLJA 4IFRA 5DCEA 3LGEA 1WDPA 2ZVRA 2OWXA 1XL9A 4PFHA 2G96A 2DSVA 4RV8A 3WQVA 2XISA 2WB5A 3FVMA 1BVWA 1QJWA 3W1AA 3RRAA 5J04A 2DGAA 4Q8VA 4KCWA 4YWIA 3W2NA 2BHYA 3WH8A 3PZIA 3IRDA 3I7SA 1ITXA 3CH9A 1MVYA 1XH2A 4O0KA 4MIMA 5ABTA 2W67A 3SUTA 4RE4A 3MKCA 4FO4A 4HYWA 3H54A 1O68A 1TVNA 4LEFA 5CBIA 1LWIA 1CLVA 1F3WA 3IS4A 5CKSA 3GVQA 5FJPA 2DT1A 7ODCA 2CWXA 2NQ5A 2WC3A 4QHRA 5BXPA 1VCVA 4PMNA 3LZ3A 4US5D 5KMYA 5LNWA 3AMCA 3GNXA 5K4XA 5LIKX 3KXQA 1SJCA 3ARVA 3H22A 2W3ZA 4AEFA 3LBCA 3NL2A 1XIDA 5LIXX 2G37A 3LHVA 3PUGA 3KCOA 4AVOA 1NTHA 4XQ6A 1E3ZA 1XD0A 3LPPA 1UKOA 3VM7A 1CI1A 1A0EA 3NDZA 3OEXA 3V35A 1Z3NA 2W4XA 5D2VA 4Q8QA 1BXBA 1K8ZA 3T7VA 3QFEA 4M24A 2Y89A 3KOZA 2YL8A 3ABQA 3W86A 3MV11 1HKJA 3VIFA 2WZMA 4OHQA 3AS0A 7ENLA 1W3KA 2DZPA 3B04A 3FGCB 3VIKA 1W54A 3A3XA 1LOLA 4J3SA 3LQGA 2GUYA 4I7UA 2WO5A 5JH2A 3DFQA 1UWQA 1E55A 4UBPC 1OY0A 3DFOA 4S2BA 4YN5A 2INFA 4IPIA 3WD0A 2ACUA 3IV8A 3QGVA 4MB1A 1HL8A 4H04A 4D6FA 4UTJA 4DJDC 4W7VA 1X7IA 4OE7A 5A6KA 1TMQA 3OVRA 4MY1A 3WFLA 4CN6A 5DLCA 4E2DA 3PZOA 3DHPA 2OTDA 3PBGA 2PP1A 3C0QA 3THAA 3NOEA 2WSKA 4XG1A 3L4YA 3H12A 2G3JA 1YTKA 5HQLA 4I9JA 5TIMA 5CJMA 4DWDA 2YBTA 4AB4A 3V18A 2DJXA 4A3UA 3EDEA 2AQVA 3TA6A 2ZC8A 1OIMA 4NJIA 1YADA 3N3MA 1LT7A 3MZ2A 4E5TA 3LRLA 1H4PA 3MUZ1 5D9NA 3AZSA 2XJ7A 2IKHA 4JICA 2SFPA 4GUIA 4EAMA 1E4LA 3XIMA 5JQ9A 4ICCX 1I75A 4P5UA 4P8WA 3UW6A 3R0DA