3W83A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-6-097
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Trypanosoma cruzi
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-6-097
rcsb
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w83A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w83A01
4LRSA 2VEIA 2ZZ1A 1YPIA 3GNNA 3QMRA 5AYXA 5J5RA 1RQHA 1VH7A 2H6RA 1AK5A 1XI3A 1A5AA 3DI1A 3JS3A 4Y8FA 1VR6A 3NG3A 2FQIA 4LC6A 4CQ9A 4YXGA 4DELA 4MVAA 1X6UA 5F4SA 1PS9A 3DFPA 3TCEA 2C0AA 3W2JA 4XBSA 4UNLA 3STEA 1MXSA 2NX3A 3W83A 1O5KA 4AXKA 2JK2A 2PURA 1XCFA 2TRSA 4UTIA 3LHWA 3BW2A 4O4WA 5D37A 3MW7A 1C9DA 2VOMA 4QJ1A 3TW7A 2E5BA 3BVJA 3PAJA 4Q32A 1OX4B 3G1SA 4NNCA 4TX9A 3B0UX 3PBYA 3A23A 3WK0A 5G4EA 3LV6A 3W22A 4IMCA 4RJEA 3NQ8A 4ADUA 3TKFA 1JQVA 2NV1A 2QCMA 3TMQA 4DPQA 4QQ3A 6ALDA 2ZFAA 5IM51 5H91A 3E02A 2ZA2A 1HFBA 3UWUA 2ZZ5A 1TREA 5TBOA 3JR2A 3TDFA 1YADA 3QEZA 4BFAA 2G95A 2YCEA 2W0UA 4OHQA 2NV2A 3FEMA 3W1MA 4DO4A 4K7YA 4KFOA 4HNUA 1XBYA 4CCDA 3QFEA 2I1OA 5DELA 2A2IA 3H54A 3M41A 2YYUA 2NX1A 2V9DA 3HF3A 1GVRA 2YXGA 4RLIA 4NX5A 1H1YA 5AHNA 3LLDA 4XWUA 2TPSA 4EIVA 1NF0A 3NYZA 3DH7A 3I7RA 2V81A 3W7RA 1W31A 2FDSA 3C2OA 2W6RA 2BX7A 2Y7DA 5D03A 1S3HA 4Y90A 3A22A 3CU2A 2A6LA 5EBUA 3MI2A 2Q8LA 2QCDB 4JTSA 1E51A 1OFEA 3G8EA 3P82A 1FBAA 3PSWA 3FS2A 2ISWA 3FJ6A 3P5YA 2CWNA 3NZRA 3GAYA 3KXQA 1QPQA 2Q3OA 5C6MA 1OYBA 3TUUA 2VEMA 2OCZA 3ELFA 1QPRA 3G22A 1DV7A 2B7PA 1KLZA 1LM1A 3LTPA 3S6DA 1W0MA 2CW6A 3CPRA 3U8GA 4WUIA 4RZ5A 2C1HA 3MI3A 4I7VA 4ICNA 3HPXA 1AG1O 1CW2A 4H4IA 3TK7A 3BV4A 3P8JA 1GEQA 2HS8A 2NXGA 3W7JA 3M9YA 3NQCA 5FI8A 3NL2A 1TCDA 4FXSA 2R14A 3PSVA 1K02A 1WV2A 4Q4KA 3W7IA 4YCPA 5D04C 3GLCA 3CLMA 1RD5A 4N9DA 4NZJA 3TQ0A 4UR8A 3UWQA 3LX9A 4JX4A 1YPFA 1WX0A 7TIMA 2BXVA 3MHUA 3QSTA 3HIJA 3O8AA 3NNTA 3W70A 1BTMA 5AC6A 1UB3A 1T99A 4LWWA 5TIMA 1Y0EA 3TH6A 4LVBA 2ZZ2A 1C29A 2CLEA 4CCEA 1H7OA 2VFIA 1K8YA 1VHCA 2OT0A 3RU6A 1RVGA 3NA8A 1GJPA 3BLEA 3R12A 1YLVA 2ZRUA 4LS1A 1SW0A 3R13A 1M7PA 1WOAA 1TJRA 1TYGA 5G5IA 3CEUA 1SR9A 4O18A 1MZHA 3GR8A 4IX2A 5G2WA 4RV8A 4O12A 4LOCA 3IVUA 1QDSA 1DOSA 3A21A 2ZA3A 1EWEA 2ZDRA 1K7XA 4O16A 4RXFA 5C55A 4Y6GA 1W3NA 2V8ZA 3FYOA 3BARA 3QH2A 5LKYA 4O53A 5LZLA 3ABQA 3EXSA 3AJXA 4WOQA 3BG5A 2A0NA 4DF1A 1J5TA 4XQ6A 1FDYA 4JTHA 1NVMA 3GAKA 3L9CA 2DJXA 1ICPA 4TMBA 3DFOA 5CSSA 3W1NA 5D2WA 1DQXA 3S1WA 2Y70A 1QAPA 2X1SA 1YXYA 3NGJA 1AL7A 1HL2A 4MUZA 4NJGA 3O1NA 4K7VA 2BLEA 5TQLA 1Z41A 2E6DA 3LCIA 4EVZA 4ZQPA 2E68A 2NLIA 2B0MA 4WY0A 5DY2A 3YPIA 2Y7GA 3LCHA 3C56A 3WJSA 4GNJA 2QAPA 4PFMA 3EWXA 3I68A 3VCRA 1H7WA 3NQFA 4HT3A 4HNVA 1TPDA 3LI0A 2E09A 5HUPA 3V1PA 3STGA 3TIMA 1TV5A 4FNPA 3B0PA 4PODA 4WQ6A 3UY8A 3HG3A 3STCA 3BW4A 3PUDA 1N7KA 4FIQA 3DKLA 2F7FA 2GOUA 3VE7A 2ZZ6A 4MZYA 2X2GA 1XFBA 5CPNA 1Q6RA 3C2FA 4UNKA 2QR6A 2Y62A 2UV8G 4UR7A 1GG0A 1KFLA 3S9YA 3W72A 3QM3A 2Y88A 5CZJA 2JKPA 3W84A 2CLMA 4N02A 4XBKA 4A2RA 1TPVA 2C15A 5D09A 4E0CA 1XUUA 4IMDA 1EIXA 4FO4A 4M19A 1F05A 5I3JA 3PM6A 2FIQA 3GKAA 1DQWA 3M1ZA 1SPQA 3BK0A 3ABSA 1RQEA 1PE1A 2GVLA 1QFEA 3KX6A 3EWWA 3TXZA 4LVFA 4AF0B 4FIRA 4N9EA 3N2XA 5LGXA 3S42A 4OBTA 3THQA 4E38A 4ALDA 4JTFA 4O50A 4O13A 3KVJA 3KVMA 5C5YA 3OEXA 1P0KA 3GDTA 3QPYA 4JNMA 3S5YA 3FJLA 3NVTA 1EP2A 1LBMA 1HO4A 1FY6A 4GFSA 2XN0A 3DHDA 1W54A 3CC1A 3C52A 1NSJA 5DLCA 3W2MA 2DJLA 1WBHA 3PBWA 3NEVA 1GVQA 3W7QA 4RX0A 4UMBA 4AEOA 1ML1A 1VC4A 2ZYFA 1D3HA 3L0KA 2O7QA 2Y89A 4LVAA 3PULA 3DXIA 1H1ZA 1ZNNA 5K9CA 1GOXA 3G3DA 4HIBA 1M7OA 2BTMA 5HJLA 3DFSA 4ONVA 2Y85A 5DXYA 1TIMA 2Z0IA 3FYPA 4MYAA 1HTIA 2FB3A 3O16A 4NT0A 2DU2A 5LNSA 5LSMA 2WNZA 2JKAA 3OVQA 3UNDA 2CLFA 4RZ4A 3N73A 4FNQA 4JTTA 5FEXA 2CFFA 3W7OA 4OGZA 5CPMA 5HNRA 3E49A 2ALDA 3O6DA 4K37A 4UMCA 4A21A 2H8XA 8TIMA 1HUVA 4LRTA 1QOQA 5K4XA 2QUUA 3SIZA 1LRTA 1RPXA 2E5DA 2TMDA 3UQNA 2Q8ZA 1UASA 1OJXA 3AO0A 4DEFA 1NF7A 4YLWA 2C3ZA 1B4EA 2QDGA 4ZL1A 1O94A 3GXTA 2ZCGA 4TMCA 4A3UA 1KTNA 3WJWA 1L2UA 3W86A 3DFNA 1WOBA 1PCWA 4LU0A 3P81A 1W5NA 3W7HA 3SECA 2YZRA 1OYAA 3LV5A 1YTDA 4UCGA 2QF7A 4NJHA 5EY5A 3TC7A 3BG3A 1H50A 3G8RA 4G1KA 3UXAA 5F2GA 3S1VA 2E6FA 1ZALA 2PRMA 5HWJA 4D2JA 1KFKA 4WOZA 2OX1A 3W85A 3M44A 1RV8A 3WK1A 2EPHA 4TO8A 3VKJA 1DJQA 3BPWA 3UD6A 3EWBX 3W2LA 1JCYA 5DCDA 2QCFA 4UFIA 3OA3A 3QSRA 4O57A 3EB2A 4WY0F 5LNUA 3IRDA 3PUEA 4LS0A 3N2MA 1JCXA 3P84A 4MLRA 2CZEA 4N4PA 3S1XA 1ME9A 4O8RA 4IWWA 4JIPA 1JUEA 3UWWA 2D73A 1W8SA 5FF0A 2X1RA 3SSJA 5F2LA 1KBIA 1FXPA 1OHLA 4MY9A 4J9JA 5KSWA 2DORA 3UWYA 1TPEA 3NPUA 3L21A 1K03A 2A5HA 1W37A 4FNUA 4X3ZA 4MZ1A 5CZSA 2QJIA 2YFOA 2J24A 2XN1A 2E1DA 3RF9A 3W1XA 1XDLA 4UTWA 3NXFA 4NJKA 2WKJA 4K39A 1TRIA 3L5LA 4CQAA 3TQKA 3HGOA 4M7TA 4CCCA 5D02A 5F4XA 1O60A 3NM3A 2WPBA 3QJAA 3LCGA 3DFTA 3G0XA 5K3VA 5EYWA 5AHEA 3N19B 5A8GA 3EEGA 4CNNA 1V7YA 3HGRA 3MYOA 2BWGA 2Y7EA 2PRHA 3UPWA 1LLZA 5I3IA 4BI6A 2FPTA 4OQVA 1A5BA 2Y6ZA 3W6YA 4O1CA 1G6CA 3G1XA 3HMJG 3LXAA 4GE8A 1V5XA 1I2QA 3LLFA 1JJKA 1T96A 3LHVA 3W7LA 3IIPA 3M43A 1SO6A 3W2KA 5HUOA 1W5PA 2H8ZA 1PHWA 3BLIA 5G1YA 5HQEA 5IBXC 5F2MA 4Z0JA 1ZCOA 3PG9A 3N14A 3HGJA 1OX5A 1EUNA 1YDVA 2P0OA 1F74A 5EMUA 3NL3A 4MIMA 3TROA 2YR1A 1VYRA 1P5BA 3NQ6A 1W56A 3LRKA 2QJHA 5CKSA 4JD4A 1SU5A 3SGUA 3N9SA 1XC4A 5C2XA 4IQLA 3NAVA 2AQWA 5LNVA 1XBVA 1LOLA 2LLEA 2PCQA 4JGDA 3I65A 3LHZA 4UTJA 1VYSX 3E9AA 1H7XA 4EF9A 5KZDA 3M5XA 3HOJA 4O10A 4ADSA 1K8ZA 5EKYA 2O7SA 3G24A 3KOFA 3P5ZA 3QZEA 3OVPA 5AHIA 1TTQA 2ATMA 4DBDA 4P61A 1MO0A 1X7FA 1VS1A 2X30A 1ICQA 2QKFA 1JVNA 1TV7A 3CWOX 3MP4A 1KA9F 1I2RA 3GYEA 4R53A 4DXVA 2YYTA 1YDOA 2TSYA 4K38A 4AHPA 3T7VA 2PE4A 4PEKA 5CPOA 3FA5A 3G1VA 3BLFA 4UMAA 4JYDA 1C8VA 1RR2A 4EF8A 2CLKA 2X1TA 4WXZA 5I3GA 3EKLA 1J2WA 3TNOA 2GQ9A 1G7UA 3NPWA 3CHVA 3NQ7A 1HG3A 1LBLA 5HWMA 1FWTA 1O4UA 4UTMA 2JGQA 1GQNA 2ZRZA 1QO5A 5BOOA 1GVOA 2WV8A 1LORA 3MI6A 2QAFA 1FCBA 5I3FA 1WYIA 3W76A 1JUBA 2HS6A 1XXXA 3QQ1A 4UTTC 2NUWA 3R8RA 1VGAA 1OFAA 4NZFA 3QQ0A 3ZFHA 4ORMA 4NU7A 4KWVA 5FESA 2V2HA 4O15A 1TRDA 5L9FA 3CIWA 1WBJA 4WX2A 1X8FA 1LCOA 3W7CA 4MJMA 1EWDA 3U6WA 1Z42A 3S0CA 3H55A 4MZ8A 1S5TA 3DAQA 4HKPA 3RFAA 4DO5A 4E2BA 2G96A 1G67A 3N34A 1SSGA 4MFEA 4Y96A 3C61A 1SZFA 3EX6A 1HO1A 3NQDA 1H63A 1ZAJA 3MHFA 3LXBA 1PIIA 3UYCA 5BNKA 1U83A 1QR7A 3ABRA 1TPH1 1TQXA 1W5MA 1YTEA 2NX9A 3W2UA 3IEBA 3P8IA 4GBUA 4U28A 4Z1BA 3EX4A 3L2IA 2DZSA 2ZRYA 1KM5A 2ZZ7A 4NNAA 4JDYA 5F1UA 1I8JA 4UFKA 1GVFA 4IX0A 2QUVA 4ZVJA 2AGKA 5CGQA 4LS2A 4GUHA 1THFD 4PH6A 2ZRVA 4AVFA 2FB2A 1XBXA 3W75A 5CG7A 5HR6A 2E5CA 1KV5A 3TV8A 2X1UA 3G18A 1RZMA 2VENA 3TAOA 1Z44A 4XZ9A 5I3HA 3NOEA 2RHGA 1VCFA 2NUYA 4NUWA 3SFKA 4AAJA 4PC8A 5D32A 3QF0A 1P0NA 4GJ1A 3KFTA 2BSLA 4GRSA 3LHTA 4FX8A 5CZTA 1BEUA 3PR2A 4N9BA 3G3MA 1UBSA 3W1PA 4JIQA 1TPB1 4JX6A 3FFSA 3LBCA 2CLIA 2EGZA 4JTKA 3GZ3A 3WJYA 3DFQA 4LV9A 1TSIA 2B7NA 1LZOA 4WZHA 5BW6A 2EHHA 1OFRA 4KKXA 1WAUA 3TFXA 3KAOA 3NZ1A 4UTHA 3W71A 3RMJA 2P10A 4JDBA 5HMSA 1ZENA 3A9IA 2V2CA 3MP5A 4IXHA 1R46A 3TJLA 2Q3RA 3PB0A 4NNBA 3L5MA 2YX0A 3F03K 1P4CA 2WNQA 5D30A 5AC7A 1B3OA 1R2SA 5KINA 1A53A 3TSDA 3N3MA 4M6PA 3PS7A 1ADOA 4N2YA 1SW7A 1G4PA 3OG3A 1WXJA 2HMCA 4IMFA 2GJLA 2J88A 2ZBTA 1JQXA 4O1DA 4JN6A 1SFLA 4PA8A 3DBPA 5FEPA 1IXNA 3Q58A 3CTLA 1ICSA 1A50A 2WOQA 1CX9A 1VRDA 3RK8A 3L68A 3LDVA 3EX1A 1ZFJA 2J9ZA 5D2XA 3C8FA 3IIZA 1K8XA 3P74A 2H90A 3TFCA 4POCA 4AH7A 4OU1A 4IPIA 4JTJA 5G2HA 2F84A 3W07A 2WSQA 4IPJA 3SI9A 1TO3A 1QNVA 2I14A 2QCDA 4AHQA 3P7YA 1M5WA 1EB3A 3GNDA 3TC6A 3LBMA 3W1LA 1DJNA 3HG2A 2C13A 4MOZA 3TE9A 1YYAA 1JCJA 1F5ZA 1GWJA 4RR4A 1H60A 1H7NA 2B7QA 1Q6OA 5DBUA 2C18A 4X9SA 3JRKA 1ZAIA 3NO5A 1IXOA 3RNDA 4O4VA 3KRSA 3W7EA 3MJYA 4X2RA 3IIOA 2WNNA 2TYSA 4O52A 1RQBA 5I3KA 1H7PA 3TMLA 1OX4A 3HB9A 4QNWA 5FF3A 1F76A 2C14A 2FLIA 4NJJA 1B57A 2DZTA 3EWUA 3QPZA 1MSSA 4MJZA 3SW6A 1ALDA 4AWTA 1G69A 2WJZA 5EPDA 4QISA 1UJPA 3NQEA 3M5ZA 4CNPA 4HPXA 4UFJA 5EA9A 4S2BA 5DN1A 3CIXA 3L67A 4R33A 2DP3A 2VEPA 3W1QA 4OV4A 1KM6A 3HPZA 1JULA 3HJZA 5CZ0A 3W73A 2GQAA 3W1RA 4FX6M 1OFPA 3PWAA 1IGSA 1Q3NA 3TAKA 3G1FA 1FDZA 4ZQNA 5HINA 3TU9A 3ZS4A 1LTDA 4GWEA 5AB3A 4O54A 1AW2A 3ABOA 2ZTJA 2OMAA 3ATZA 1R30A 3O63A 4FF7A 1OX6A 1SSDA 4O19A 3LHUA 2RFGA 3DGRA 3W1AA 3NDOA 4FNRA 3WJZA 2A6NA 3M16A 3GR7A 2NWSA 4GXMA 1I2NA 1G7VA 3CEPA 3IVTA 5K2ZA 4PCFA 5KITA 4CNOA 3QMSA 3FIGA 1KM0A 4NXKA 5H2ZA 4GUFA 1B9BA 5GVJA 1BKSA 1YXDA 1XDMA 4HPJA 2VFDA 3LHYA 3O07A 3G1DA 3L5AA 1D9EA 1SO4A 5L6UA 3F4WA 4TR9A 4GC4A 4O0KA 3VE9A 3OHIA 1IF2A 4OWGA 1EUAA 2VXNA 2W79A 1QO2A 1FCQA 4S1FA 1KW1A 4Z1DA 3THAA 1T0OA 3TQVA 4M6QA 1LOQA 4MPQA 4PL2A 4O28A 2JBMA 3MBDA 3I6RA 2ZA1A 4K8EA 5K9XA 4KWWA 3MHGA 1L6WA 4HNTA 1H5YA 1VYPX 4LV4A 1SZNA 3BG9A 3EX2A 2J9YA 4I7UA 1P1XA 1EX5A 4FNSA 3W9ZA 5D2VA 1WDWA 4ZQCA 1VJIA 3GXNA 1OVDA 4JEQA 2E6AA 4DPPA 4IJBA 3S5NA 3UPBA 4L4LA 2GQ8A 3O15A 5J5DA 3O06A 4ADTA 4YMZA 1PL9A 5FF7A 5MHBA 2QUTA 4NJIA 1W5OA 3EX3A 3LTSA 3VI2A 1LROA 2GVGA 3BGJA 3KRUA 2RDWA 2IQTA 4K36A 4JTIA 1R2RA 3A24A 2RDUA 4RZ6A 1TJPA 3C2VA 4FXRA 4JTEA 2DZXA 3T55A 2V5LA 2C19A 1JR1A 5F2IA 1JCNA 1VLIA 2V0TA 3M47A 1XM3A 5AHFA 1I45A 3CWNA 4QITA 1DVJA 5LNRA 2YDAA 4UTKA 3W1UA 5HWNA 3STFA 4BI5A 1XKYA 2GUUA 5FEZA 3INPA 2ZRWA 4MY1A 4UTUA 4LUJA 3P62A 1VZWA 4DO6A 3MMTA 2C6QA 3R2GA 3TXVA 3SJ3A 2DZWA 3NQAA 3HBLA 1AL8A 4C1KA 3Q2DA 4JTLA 1FWNA 1YXCA 3USBA 1AMKA 2H3BA 1DBTA 2QJGA 4AB4A 4N6EA 3PB2A 4I7WA 4JY8A 2ISSA 1T8XA 3W7DA 2JKEA 2A1YA 3C4UA 4WXYA 2KZHA 3M7WA 4UTLA 2QCNA 1QWGA 3T40A 1F7BA 3DENA 3BW3A 2A21A 5BRBA 2DZVA 3HO8A 1KBJA 2FFCA 3GX9A 3QRHA 1N55A 3PBVA 1JCLA 2HSAA 3NPVA 2BZNA 4FB7A 1DKWA 5HULA 1FWWA 1EEPA 4KFPA 3T44A 1SQ7A 5T26A 2VEKA 5G4WA 3WK3A 1OABA 3LCLA 4YWIA 5K7JA 1OK6A 4FHAA 2X16A 5E93A 2R94A 4OE7A 2VFHA 1KV8A 1SFJA 3U2OA 1F2JA 3P67A 1JUKA 4DF0A 1OFOA 2NWRA 3UZJA 3BO9A 4LC8A 2ZRXA 1M6JA 3EWZA 1TPUA 2XFWA 5SWUA 3L0GA 3B8DA 1GTEA 1G4EA 1BWKA 2A7NA 3FOKA 1F6PA 4A29A 3S5ZA 4PTNA 1IXPA 2YSWA 4NXSA 1KTCA 1OFQA 5D38A 1ZHAA 4JYFA 4M7SA 4AF0A 2CZ5A 1TB3A 4P2VA 2YFNA 1VPXA 2JGYA 1CI1A 4IXXA 1VLWA 4WD0A 3MWAA 4JR5A 1H7RA 1SO3A 5AC8A 3A5VA 3EXTA 2G97A 3PF3A 2RKXA 2Y7FA 5FF4A 3W1TA 2YW3A 3L0NA 1L6YA 3G0UA 1LBFA 1DHPA 1S5VA 3PY2A 2J9XA 1EP1A 3SR7A 3C6CA 3UZ5A 4U4MA 1FX6A 3O6YX 2B7OA 5ABTA 3M0ZA 5E0KA 2NXHA 1JCMP 4LW7A 5U7SA 3G1YA 4RKAA 3B05A 4ZQMA 2WO5A 3WJXA 1XBZA 2HTMA 5FEWA 3GB6A 4ZQOA 2A4AA 4NX0A 4LVDA 4LTSA 5D33A 5AN7A 1KM1A 3MP3A 4AWUA 4ORIA 3VFLA 1DORA 1GG1A 2EKCA 4QNEA 3TSMA 3NPXA 2PC4A 1TQJA 2CZFA 5DCEA 3ZWSA 3F1QA 4E2DA 1ME7A 4XUGA 4IOTA 4FEZA 2V5BA 3QYQA 4AWSA 4K8HA 3UXDA 1IIHA 1QOPA 1DL3A 5G1TA 2OZ0A 3KRZA 5F4WA 4QSHA 3W3OA 3IVSA 3CM4A 1G4TA 4EOUA 3DI0A 3E0IA 3W23A 4R34A 2A7PA 3W2NA 1VCGA 2OT1A 1QCWA 2EAWA 3M5YA 2FPYA 5LHEA 4XTIA 2NZLA 3LB0A 5K4ZA 1MEHA 1GZGA 3T78A 1AW1A 4HNNA 1GVSA 4RK8A 1EPXA 3V75A 1OF6A 4JX5A 3GDKA 5BMXA 5AOUA 5LHFA 3HG4A 5LGZA 3F4NA 5DXXA 2I9EA 1MEWA 1I2OA 1KTBA 3M5VA 1LOSA 1PCKA 3IIVA 4WJEA 3E96A 1GPWA 1S5WA 1KM4A 2A7RA 3Q37A 4LNYA 3MYPA 1AW5A 3LRMA 1LYXA 2E6YA 1TPWA 3TW6A 3UWVA 4XKYB 1W3TA 3LXCA 4JS3A 3M6YA 1Q6QA 3NL5A 2Z6IA 4GUJA 1WQ5A 2QCHA 4IMGA 4DQWA 2NXIA 2YGYA 1GT8A 3SZ8A 5DCBA 4UC5A 1OFDA 4OT7A 4W9TA 3G1HA 1FDJA 2FJKA 3MUXA 2VC6A 3TSBA 1O5XA 5HR7A 3HGSA 2CZDA 1OFBA 2VELA 3UWZA 3W7MA 1PHQA 3IGXA 4HSNA 4LVGA 3P60A 1XL9A 4FX7A 4M6VA 4QM1A 3GVGA 1KFEA 1KM2A 2GVJA 3D0CA 3FLUA 3L65A 2ZTKA 2VFEA 4HN4A 1KFJA 3TJXA 3GK0A 3MBFA 1SW3A 2FPVA 3LM7A 2QEZA 2WSRA 3Q94A 2J27A 3LERA 4YCOA 4ZZ9A 1FUYA 3P61A 1Q6LA 3B4UA 4X22A 4JTUA 3DZ1A 1K7EA 2ISVA 1UUOA 4N4QA 1KM3A 4EWND 1QPOA 3CB8A 3LGEA 3EXRA 4Z08A 1KFCA 3ANYA 3LI1A 4NQ1A 4DBEA 5D2YA 1BWLA 1UCWA 1FWSA 5KZEA 5D05A 4LUIA 4Z1CA 3NQGA 3R89A 4UXDA 5EL1A 1ME8A 3PUOA 4LT9A 2V30A 3DKJA 3NM1A 2GPTA 1G4SA 2CLOA 1K7FA 1NEYA 1NAL1 1LRNA 4B5NA 3WFAA 1IIGA 5AFDA 3RLUA 3O05A 3W87A 1OG0A 1SZGA 2AAMA 2RH9A 2ZZ4A 3CQ0A 4L4MA 4CQ8A 3S5OA 2VFFA 5CSRA 4JYEA 1TPC1 4Z0SA 2QCCA 5KZMA 1O95A 4N6FA 1TPFA 4UTTA 1YTKA 1JRBA 3C2EA 1LRQA 4JTGA 5AYZA 1QMLA 1LLWA 3A5FA 4KFNA 2OJPA 4GUGA 4BR1A 3C2RA 3I7QA 2WQPA 1A5CA 3OBKA 2QDHA 4O1BA 3KHJA 1K3UA 3LOTA 3QMTA 4MFDA 3WK2A 4IMEA 3IV3A 4O0ZA 4BI7A 4BWLC 1IXQA 5K9DA 2XN2A 4Y9AA 5IBXA 3B0VC 5KTLA 3KVLA 3NQMA 1H62A 2R91A 4RCXA 1H61A 3UY7A 4BWLA 4H3DA 1LP6A 1L9WA 4MYXA 2ATSA 3W88A 1H51A 3S1UA 3O6CA 1XUZA 4AMAA 4C1LA 2GJNA 2QCEA 3BGGA 2J6XA 3ZWTA 3GIYA 5C54A 1PVNA 5DY3A 5A5WA 3CT7A 4JXCA 3GXPA 4MY8A 3LCXA 4QAIA 3IIXA 1TMHA 3NR0A 2QCLA 3PBUA 4MKNA 3W7KA 4GUIA 4UUIA 3VNDA 3LRLA 1EP3A 1FXQA 2B4GA 4IUOA 3S8HA 1U5JA 4ZQRA 1PV8A 3GKFA 5BMWA 3ZR4A 4UIOA 5D2TA 3PVFA 3TR2A 3GDLA 2VFGA 1EA0A 4WY0B 4TIMA 2WSYA 3HPSA 1ZJIA 1B4KA 5KMYA 2NUXA 1W1ZA 4AHOA 2VKZG 2P1FA 1FWRA 3GDMA 3QW4B 4NVTA 2C16A 3NQVA 1A5SA 1GYNA 1OYCA 1F73A 2R8WA 3W7NA 3I7SA 4LY8A 1L6SA 3OIXA 2V82A 2EF9A 3LTYA 3ATYA 3DU0A 4JICA 3HQ1A 1SZEA 2CLLA 1I2PA 1GTHA 1ZAHA 2QCGA 4N9CA 3IGUA 1W3IA 2Z1BA 3B04A 1D3GA 3RLVA 3TA6A 1TTPA 2Y61A 2ZZ3A 3HG5A 4Q33A 2YPIA 4K6AA 3QC3A 2V2DA 3SY5A 1ZY9A 3QW3A 2FTPA 2Z6JA 4OV9A 4UFMA 4Z1AA 3W7PA 5DBTA 4ML9A 3PG8A 1LDCA 3EKZA 3SGZA 3B06A 4O1AA 5U4NA 3MO7A 3R5EA 3KVKA 4HHPA 3G0SA 3OVRA 2G5WA 4O11A 4S2CA 1TTIA 5CPLA 2CU0A 1R2TA 1OF8A 1J4EA 4M5PA 4MLJA 1NFBA 1VQTA 1FCVA 3GDRA 4TU1A 1X1OA 3FKKA 4DF2A 1N8FA 4HSOA 1TV8A 4IGHA 4A2SA 1JRCA 2E77A 3H53A 2ABBA 2DZUA 4XKYA 1R47A 4ZMGA 3C0JA 4UFLA 1SUXA 4QIUA 1F6KA 3C3NA 1FCUA 1WA3A 3T4CA 3G1AA 4H6KA 2ABAA 3FKRA 1FQ0A 4JY9A 3N9RA 3E12A 4PL1A 3K30A 1TTJA 1YDNA 4RXGA 4UFHA 1KFBA 3TX9A 4O17A 1QPNA 3L66A 1MEIA 4XTDA 1Z48A 4FNTA 4UTWC 1X1ZA 4A22A 2A85A 4BK9A 5AHMA 1VHNA 5AYYA 1I4NA 1VCVA 1Q45A 3LCFA 3IGSA 4R7JA 1UUMA 2H3DA 4YL2A 3EWYA 1OK4A 3LCWA 2YW4A 5FF2A 1GYLA 2CLHA 5AHLA 5F1VA 4BF9A 3W7GA 4I9AA 2ZQ0A 3P80A 3W74A 4CLMA 3NL6A 2Z2UA 5E1QA 3B03A 3DHFA 6TIMA 5LNWA 1W5QA 3NQ2A 3PC0A 2RDTA 2DZPA 1ONRA 1SO5A 2Y63A 5G2IA 2PRLA 1KLYA 4O14A
chains in the Genus database with same CATH superfamily
2ZZ1A 3L4TA 3WQVA 1VBRA 2FVMA 1VH7A 2H6RA 2QYGA 1A5AA 3DI1A 4ZOBA 4NRSA 3RPTA 1VR6A 2EKGA 3QHOA 4M1BA 3FY1A 3ENLA 4MVAA 3FJNA 2HBXA 3QFWA 5F4SA 3VGEA 3DFPA 4C1NA 3B9NA 3TCEA 4F4RA 3C2YA 1EXPA 4ZO9A 1NDYA 1O5KA 4AXKA 1WKEA 1XCFA 1NWSA 2TRSA 1BVWA 4KF1A 4D6CA 3NIYA 4O4WA 1R3TA 3TW7A 3BVJA 3G1SA 4Q8QA 3T81A 1H09A 2OSYA 3WK0A 1EA9C 3G77A 4CNUA 4XBJA 2NT1A 4RJEA 3NQ8A 2QCMA 4DPQA 1V0KA 3Q4DA 5IM51 2QV4A 4Y9OA 1GZJA 2F9RA 3WH6A 2DPEA 3BQ6A 5AYIA 3PWGA 3TDFA 3N29A 5I2UA 4LBUA 4BFAA 2YCEA 3MMDA 3UFYA 4GJIA 2NV2A 3W1MA 1XBYA 4CCDA 3QFEA 3H54A 4P8XA 2NX1A 4XV0A 4ZTYA 1T8QA 2L5HA 1IZKA 2CHNA 1IEIA 4RLIA 4J3ZA 5BCAA 4XWUA 4EIVA 2OEKA 1FWCC 3PZUA 5ABFB 1YRRA 5XIMA 1NY1A 2HDJA 1T7LA 2V6AA 1UZDA 1X98A 3CJPA 4Y90A 3KL0A 2A6LA 4MJ4A 5EBUA 3N2CA 2QCDB 1E51A 4QEHA 4AZ5A 1OFEA 1GOOA 3G8EA 3R0DA 3ONCA 4XAGA 4FF5A 3R11A 4AUBA 2ISWA 3FJ6A 5IXEA 4DWSB 3P5YA 3S83A 1IEQA 1FH8A 3AMGA 5C6MA 3MTWA 2OCZA 3TTEA 1PO9A 1XLAA 3LTPA 2HNHA 5FJUA 1PXGA 3WMLA 3EWCA 2YCLA 2E40A 3GNRA 2AKMA 4I7VA 5AC5A 3GXDA 1ONXA 4ML4A 1AG1O 1CW2A 4H4IA 3TK7A 1GJUA 1GEQA 3NQCA 1TCDA 2VDGA 3WD4A 3ANVA 2R14A 4YCPA 5JIWA 2F6XA 3TYDA 5CPTA 4HNCA 3RILA 3GLCA 3CLMA 3TQ0A 3PBGA 3LX9A 1DP0A 4JFWA 1YPFA 3I6EA 2XSXA 3MHUA 1OADA 3HIJA 4GD0A 3W70A 1X38A 1EIBA 4ZO8A 3TH6A 1T99A 5TIMA 2WWCA 1C29A 1W3LA 4XAPA 2VFIA 5JIPA 5GNYA 2OT0A 3W38A 3RU6A 4PSPA 4PMVA 2IS7A 3R12A 2WPGA 1WOAA 3EPOA 1TYGA 2J25A 1DHKA 1BG4A 1GJWA 2ZA3A 4DIAA 4PUNA 1UH4A 1HIZA 4O16A 4RXFA 5C55A 3W37A 4C1NB 2Z1WA 2PPGA 2VD8A 3WCZA 1XYCA 3MS8A 2R1MA 5A2BA 1V3HA 4ASTA 3GDBA 4XO6A 3EDJA 3R8GA 3CAKA 3AJXA 4URIA 3BG5A 3EMZA 3EA2A 1NVMA 1VFSA 4V1YA 4HD5A 5CSSA 3W1NA 2Y70A 1KC7A 2X1SA 5TAOA 3NGJA 1HL2A 2J4GA 1LT8A 3O1NA 1J0YA 1BQCA 4ACZB 1TR1A 5TQLA 3MMWA 1ADDA 1J0KA 4KERA 3TTOA 3R1ZA 2NLIA 4WY0A 4EPEC 2MUCA 2AMXA 5DY2A 3WJSA 3EWXA 3GNOA 3VCRA 1H7WA 3EZ4A 3LI0A 1ZP3A 4GNKB 3UXKA 2VC7A 3STGA 5HBFA 1B30A 3ZSSA 3STCA 3POCA 3L4YA 4FIQA 2G37A 1ITCA 3GZAA 3MPGA 4MB5A 3PPHA 5CPNA 4R27A 2QR6A 2Y62A 4S3FA 3VIHA 1GG0A 2R9RA 1E9LA 1KFLA 1J12A 3QM3A 2Y88A 5FACA 4CNTA 2V38A 2WHJA 4KGLA 2CLMA 4N02A 1PZ2A 2ASHA 4KGJA 4A8LA 4C91A 1BVZA 1KRMA 4UCFA 2P3ZA 2WVTA 4E4FA 1F05A 9XIAA 4AMCA 4KBXA 2FIQA 3GKAA 1DIKA 3BK0A 1QFEA 4HJWA 5CGTA 4EACA 1Q7ZA 3LPPA 3OU8A 1EJRC 3GUWA 1B3YA 1XYAA 5EBAA 1CPUA 4FPSA 3MY9A 5LIUX 3L23A 1L6FA 1VJSA 3BLDA 3TWAA 4ALDA 2ZE0A 4WSJA 4O13A 4H6RA 4I3GA 3OEXA 3VNZA 8XIAA 4ACYA 3SADA 3QXBA 1P0KA 3QPYA 2WAGA 4P8WA 3C5QA 1UR1A 3S5YA 4F2UA 1J18A 1LBMA 3RAOA 2D0HA 3RDKA 2XN0A 3DHDA 4R88A 1VAHA 1S2UA 4J5NA 1WZKA 4LAOA 4QCEA 4EXAA 3CZGA 5CPQA 3WF4A 1VP5A 2VCBA 3WG6A 1YBQA 3JU2A 1GVQA 3W7QA 2OXNA 2QDEA 4AX6A 1ML1A 2G8ZA 2Y89A 4LVAA 2VGFA 4YYFA 1SJBA 3OODA 2ZE3A 3WLMA 3PTQA 1HGWA 2R6OA 1WO2A 1XLBA 2BOEX 2WANA 2BTMA 4GYKA 5HJLA 1NP0A 3CZLA 1HTIA 2FB3A 2PDMA 1GKRA 8CGTA 1QWKA 3UNDA 1AQHA 4HPGA 1GHSA 2Y8KA 5HNRA 4FALA 3E49A 3SCQA 3O6DA 3LYEA 2Z7KA 3R7MA 1WKYA 4A21A 2ODOA 1QOQA 2QUUA 4X0VA 2E5DA 1G01A 1MZRA 2ZIDA 1GONA 3AO0A 4DEFA 1NF7A 4YLWA 1UPPA 1AZ1A 4UZSA 4C6MA 3HURA 3RRAA 2PODA 3W86A 4R3UA 3THDA 2G4JA 3SECA 3W7HA 4HN8A 1DIOA 1RSCA 1YTDA 4LUTB 5EY5A 3ARQA 3H7RA 3DECA 4XKMA 5HWJA 4D2JA 3RHGA 2OX1A 3U7VA 5I23A 4IPNB 3TCSA 3NZPA 3TTQA 2I56A 2DSWA 1XICA 1FWFC 1UYQA 1EF2A 4PTXA 3GFZA 4WY0F 1J79A 1FA2A 1FWHC 4LS0A 4AW7A 1ME9A 1K70A 2D73A 3SSJA 3FK4A 5F2LA 1KBIA 1FXPA 5HJYA 4M80A 4AY8A 2GL5A 4F8XA 3EDFA 3RO8A 1MRAA 4FNUA 4MZ1A 5CZSA 2FMOA 2QW5A 2VC5A 3H70A 3LQGA 1NQ6A 1K9EA 2WKJA 1QU4A 2PA6A 4K39A 4D6GA 3AYRA 3L5LA 3TQKA 4M7TA 3NM3A 4DJDD 3VNMA 3B8SA 4GYJA 2WBKA 1KCLA 1EQPA 3ITVA 4RUBA 3BANA 5AKQA 4PUDA 3ITCA 2Y7EA 3ZM8A 4IH3A 2F61A 4B5TA 3WH7A 3A13A 1G6CA 4C7FA 5E9XA 3FX4A 3MUY1 3SUUA 3UP8A 5FOOA 4FLSA 3WH5A 1R5YA 3W2KA 3I3DA 1PHWA 1G0CA 2XVLA 4ACZA 4W89A 4D8AA 4U33A 3L12A 1OX5A 4Z2KA 3WBXA 3NL3A 4A3YA 1S38A 3PZIA 1VYRA 1XH2A 1P5BA 1W56A 5CKSA 1SU5A 3IJLA 4IFRA 4HPHA 1ZL1A 2E9LA 4IQLA 5C2XA 1K9DA 4XIAA 1LOLA 4E8DA 2E3ZA 2ZC1A 3I65A 4UTJA 5ENLA 5CPSA 4EF9A 4UBPC 3HOJA 4QEEA 1K8ZA 5EKYA 3G24A 1RAKA 4JQ4A 2GFTA 2BHZA 2OYLA 1WXZA 3QR1A 5MF5A 3OVPA 1QATA 1RHCA 2I5QA 3H8AA 1MO0A 1X7FA 4HA0A 1VS1A 2XHYA 3VZZA 2ZVIA 4FZIA 1J01A 3IUIA 1FOBA 1E5NA 4H9VA 3T4WA 4H9UA 5CPOA 4LAKA 4JYDA 2VWSA 2CLKA 1LBLA 1RBLA 4GXPA 1ITXA 1RJRA 3KLKA 2ZRZA 1QO5A 5A8NA 1W1B1 1L8PA 1GVOA 1LORA 2I5GA 1WYIA 3W76A 3ABZA 1X6LA 1JUBA 3QQ1A 3GHTA 4ORMA 3LMZA 4WHBA 2WMKA 4E6MA 3P0XA 1Z7AA 4FOJA 4O15A 5L9FA 1KD0A 3P6LA 3T2OA 4C7GA 1V4YA 3XIMA 4X0NA 3DAQA 4HKPA 1UD8A 3ABXA 5GPRA 3N34A 4GQQA 4OUIA 1SZFA 1Y8BA 4CQDA 3NQDA 3LXBA 4F0SA 3NVDA 3ABRA 4FLRA 3VFCA 3AWNA 1A5LC 3EEZA 2NX9A 3IEBA 3P8IA 3CO4A 4Z1BA 3CGTA 4C6QA 3DBNA 2ZRYA 3GHSA 1PJ9A 3N1AA 3BAYA 1CGUA 1XISA 2QUVA 3SRKA 2XG9A 1UQZA 1I60A 3WL1A 1XIMA 5C70A 4LS2A 3BCJA 2PDBA 1THFD 4PH6A 4QDMA 3B8WA 2WB5A 5CG7A 5HR6A 4XSLA 4F0RA 1KV5A 3TV8A 4D6HA 2X1UA 3TAOA 1H0IA 4AC7C 3NOEA 4B3ZA 1EZWA 4BS0A 4NUWA 4IIHA 3ALFA 5EMMA 4D6DA 5D32A 3QF0A 2PTZA 1IEWA 3ZMRA 4GRSA 2WVUA 4FX8A 3SQSA 3QY6A 1YNPA 4H8HA 3LBCA 3KDOA 2WC7A 4GQRA 4JAWA 3VX1A 2DDXA 3DFQA 1ECQA 4LV9A 1LZOA 2R1KA 1QBAA 4GMEA 3TFXA 3AROA 3UJSA 1BXCA 1Q4WA 2V2CA 3FHQA 3LUTA 4LALA 3BJTA 1F4HA 4R9OA 4NNBA 3L5MA 3FCPA 1XIFA 3UYIA 1EKOA 1ADOA 2E28A 4GO9A 1WXYA 1G4PA 3OG3A 1WXJA 2FH8A 4ZB0A 2GJLA 2J88A 1TV2A 2Z1VA 1JQXA 2ZBTA 4GA8A 4AZIA 1EJSC 4JN6A 1JNEA 1XRSA 2WOQA 1CX9A 1VRDA 3RK8A 2VGGA 3L68A 3LDVA 1GVEA 5FJRA 5D2XA 2O55A 3H2AA 4M56A 2D2GA 4POCA 4R7WA 4KEZA 3MWCA 1TCMA 3GVWA 4IPJA 2V5JA 2QCDA 2Q8XA 2VRKA 1YYAA 1VFLA 1JCJA 4RR4A 1H60A 1YE4A 3AHXA 1IXOA 4ECLA 3W7EA 5E5CA 1RQBA 4ZODA 3TMLA 4H8NA 4OBRA 5FF3A 5G4HC 3QPZA 1JCTA 3TC3A 4C7DA 5FKYA 3DIPA 4JCLA 1UJPA 4MAZA 1XDJA 3NQEA 4HPXA 5AY7A 4GIRA 4S2BA 3WLJA 1JZ7A 1MMFA 1YKWA 4R33A 3QZ6A 4GBDA 4GGBA 2X05A 4HZMA 1UUQA 3S9IA 2GQAA 1XRTA 3W1RA 3SSZA 3KTCA 1IGSA 1HN1A 4XVDA 4ZQNA 4E2VA 5HINA 4HMNA 1LTDA 1IHIA 4ZGYA 4C6OA 1AW2A 4F48A 2PDQA 2J8TA 3WUFA 3ATZA 4NILA 4N42A 3P0WA 4O19A 1TJ1A 2XVGA 5A6LA 3TNBA 2IKIA 4UQCA 3OLDA 4J2MA 3VOHA 2A6NA 4QXIA 1OIMA 5FJOA 3RM8A 3UGVA 4B5VA 1G7VA 3CEPA 2XUCA 2Q09A 4C90A 1V6VA 1PIGA 2J74A 3SCRA 3F2BA 5H2ZA 4GUFA 5C0QA 1B9BA 4HPJA 3G1DA 1UC4A 1Z9AA 3PJUA 2WMGA 1BRLA 4GZIA 1SO4A 1BYBA 1QI0A 2PB1A 3BLOA 2D23A 4ROPA 4FLQA 4O0KA 3ARPA 3OHIA 1WE5A 3WQ4A 4F9JA 1KW1A 2PCEA 2CBJA 1EOMA 4M6QA 4FR6A 4C6FA 2DW6A 3HTWA 2VX4A 2QJMA 1EX1A 2JBMA 1TG7A 3I4EA 4KWWA 4PCNA 1L6WA 1VYPX 1JEZA 3VOCA 2VM8A 3NZGA 2YDRA 4IL2A 3AXIA 2XFRA 1WDWA 2VR4A 1VJIA 3WZ0E 3CQJA 1AA1B 3V16A 3UPBA 4XZNX 3A4XA 3CH0A 3OYZA 5ECUA 5J5DA 3O06A 3PFMA 1BTCA 1NU5A 1LROA 2GVGA 3BGJA 4I90A 4Z2HA 1EJUC 2DGAA 4TX6A 3ITTA 4RV3A 1R3WA 4HNLA 1UW9A 3B9OA 1ODZA 1R2RA 4PN2A 3A24A 4HB7A 4Q8TA 5HQLA 3GVVA 4FXRA 3BAWA 2DZXA 3T55A 3W0KA 5KEZA 2V0TA 3M47A 5AHFA 2QMKA 3VNYA 4AISA 3PFRA 4AD5A 5LNRA 3SGGA 1VPQA 3DERA 4UTKA 2YDSA 3W1UA 1NWRA 1XKYA 5FEZA 2YB4A 3INPA 2ZRWA 4Q4MA 2UWFA 2ZXDA 4MY1A 4UOZA 4P8UA 3RX4A 4W7VA 4AZCA 2NV9A 3SJ3A 4AD0A 4LUYA 2WHKA 1A4MA 2G3MA 1AL8A 3CV6A 4C1KA 3ZT5A 4JTLA 3CUHA 3QTGA 1AMKA 2EG6A 2OQYA 5CC3A 4BJHA 1GQLA 4R5EA 4N6EA 2ISSA 4Z2LA 3WQPA 1OZQA 3AYSA 1QWGA 3BW3A 2A21A 3IJ8A 1K1DA 4GO8A 3WF0A 4QP0A 4U5IA 2HSAA 4S3EA 1JD9A 1DKWA 3GW3A 1FWWA 5IDIA 4D1IA 3T44A 4QS5A 3M0YA 7REQB 3SM0A 3WK3A 1OABA 3N2OA 1YHTA 5K7JA 2GUBA 1OK6A 5E93A 5HANA 1ZCCA 1NWTA 1U5VA 3CUFA 2BGSA 1M6JA 3E2SA 2XFWA 5SWUA 4MHBA 4US5D 3WLTA 4AYGA 5HNUA 3AHYA 4RDZA 5ABEA 4PTNA 5JQ9A 2GUYA 4PRRA 4AVOA 1ZHAA 4JYFA 4AF0A 1Q6GA 4P2VA 2VQUA 3VM7A 5I00A 2YFNA 1VPXA 1IEVA 1QK2A 3MWAA 1I1WA 3U2ZA 3KOZA 3LPGA 1TR9A 1U5HA 5FF4A 1L6YA 2WW5A 1S5VA 3PY2A 4IG2A 4FK9A 1E5JA 2B7OA 1ZJBA 3M0ZA 5B7ZA 2NSOA 6CGTA 5U7SA 1B3WA 4PBEA 4ZQMA 1W3HA 2WO5A 1XBZA 2AQVA 2OKTA 3GB6A 3SO7A 3EPMA 4NX0A 1V3JA 5D33A 1D8WA 1XX1A 3ARVA 3VFLA 4DJED 1JPHA 3S4TA 4HK5A 3WO8A 5KETA 2EJAA 1ZUAX 1TQJA 2WMIB 4RDWA 3ZWSA 2P8CA 5G1MA 4FLOA 1PWLA 1QASA 1ME7A 1MYRA 4IIEA 3RR1A 2V5BA 4NAEA 2HWGA 1B54A 3AU6A 2YL8A 5F4WA 3KRZA 4RPPA 3W3OA 3IVSA 3LGDA 2GGGA 4V27A 4LEFA 3ONBA 2XFFA 3BXWA 4WDUA 4PB4A 6A3HA 2P88A 1ITQA 2I9UA 4IMAA 1QHOA 3M0MA 1L0PA 2OT1A 2VP8A 5LHEA 2NZLA 4J35A 1Q7QA 4Y8EA 5K4ZA 1DEDA 2CZVA 2WK2A 4RK8A 1OF6A 4JX5A 1RPKA 1Z69A 1Z89A 3XISA 3QOKA 1CWYA 3LLXA 3KZSA 5A8OA 2I9EA 2W66A 1I2OA 1KTBA 3LS9A 4JOMA 1PCKA 3IIVA 1GHRA 5C9XA 4H00A 2NQLA 1KM4A 2A7RA 1E56A 4LNYA 2XYLA 3VX0A 3SY8A 5AZ1A 1LYXA 1BYDA 3H2MA 1NDWA 3GO2A 3VNIA 3LXCA 3M6YA 3NL5A 5DRCA 1QW7A 2YGYA 4HYVA 1B2YA 3HFTA 2PLMA 3P14A 4OT7A 4W9TA 1XD0A 3C0LA 3TSBA 3W00A 4E3VA 3LENA 2GJPA 1S1PA 1OFBA 3UWZA 3VKKA 6XIMA 4HSNA 5CC7A 4LVGA 1I0DA 2I57A 1HXJA 3GVGA 1A3HA 2C79A 5LIYX 2ZTKA 1REQB 1SW3A 1EJVC 3LM7A 2WSRA 1EJWC 4BKNA 2DVXA 1T41A 3ZR5A 3TLQA 4TV6A 4ZZ9A 2ISVA 2WKLA 3CL7A 4IFKB 4XZWA 1KM3A 3ZR6A 2VRJA 3CB8A 3LGEA 1OCNA 2YL9A 3M0HA 2VRQA 2Q6ZA 4NQ1A 3ANYA 1M3UA 4XAYA 3A3HA 3WH8A 1JIBA 3RCMA 4GI6A 5A95A 1JI2A 2VZUA 3RXZA 4W88A 4QLLA 4B5WA 1LWIA 2Y24A 4PTWA 5LIXX 3R89A 3OIHA 4LT9A 3NM1A 4YTUA 1JYWA 2HISA 2QJNA 2CLOA 2G3NA 4QLJA 1OWQA 3PZVA 2V3GA 4B5NA 1IIGA 4AFYA 2F38A 1BXNA 3O05A 1XG3A 3CQ0A 2VEFA 4GPNA 4L4MA 4HU8A 4O1FA 3HQOA 4JYEA 1KCXA 2BBFA 4Q4QA 3KOXA 3CH9A 1SFTA 1JPKA 2PTWA 2PP3A 4NAEB 5AYZA 2J7BA 5B80A 3WBYA 5FA5A 4J7RA 3OBKA 2VX7A 1J0JA 3KHJA 4ZFMA 4MFDA 3WK2A 2VHLA 4IMEA 4S3AA 4O0ZA 2CHRA 2XN2A 4LSBA 2E9BA 4CQCA 1CGWA 3ZVIA 1XYBA 3AZRA 5CCZA 4H3DA 4AQLA 1L9WA 4MYXA 3IK4A 2ATSA 2Z28A 3MO4A 3M0VA 7A3HA 3CHDA 2QCEA 2J6XA 3G1RA 4NIRA 3TTSA 3GU1A 1TMLA 2J7HA 3MB9A 3P93A 3LCXA 4XX6A 3NR0A 3WFZA 1HJQA 3FXYA 3PBUA 2J13A 1EP3A 1FXQA 3ITGA 2DH3A 2O0TA 1ODUA 1XPYA 2PLJA 2UY5A 4ZQRA 4X60A 2GGIA 4UIOA 3TR2A 3CMJA 3ITOA 3GDLA 1RH9A 1EA0A 4WY0B 4KCVA 4DZ5A 5HK4A 4LFYA 2I17A 4AEEA 1NM9A 1VIWA 3E5PA 3F5LA 4EE9A 2NUXA 1O12A 4AHOA 3N25A 1FWRA 3QW4B 4NVTA 2XVNA 1FH9A 3NQVA 1AQFA 3HQPA 4GABA 4L5ZA 3ZLGA 2PGWA 1U1UA 4PYSA 2CBVA 4L6DA 1I2PA 1VJZA 1GTHA 3GC5A 1ZAHA 1W3IA 5CAKA 3RLVA 3ZLHA 3TA6A 4YN5A 2ZZ3A 3HG5A 3NGFA 2DT0A 2YPIA 3IS4A 3MUAA 4JN8A 3IARA 3SCNA 2V2DA 1CGXA 3S6TA 2FTPA 4UFMA 4YHEA 3KW3A 5DBTA 4ML9A 3L7RA 2OEJA 3EKZA 3MO7A 3W27A 1ZBVA 7ODCA 4P7OA 1E6PA 1K4HA 1R2TA 1OF8A 4M5PA 5DQPA 1X1OA 1TX0A 4DF2A 1TV8A 1R3YA 3B8UA 2E77A 3H53A 2ABBA 1OY0A 1FKXA 3EMQA 4ZMGA 4UFLA 3RMEA 4H6KA 1NDZA 1W1YA 2WZTA 1CXEA 3N9RA 1UZ4A 1K9FA 2DQXA 3D6NA 5A1AA 1TTJA 2YCKX 3BCFA 4O17A 1Z3NA 4AX7A 3SRDA 3TN4A 1S1RA 1QNOA 4AYSA 2ACUA 4L9ZA 4UTWC 1E6SM 3CAWA 1X1ZA 3SCVA 3V0SA 2PFHA 4H7CA 3MUCA 3LCFA 3IGSA 4PCSA 4YL2A 1XIJA 1XYFA 2YW4A 5FF2A 3U5YA 5AHLA 5RUBA 2PZNA 3W7GA 4I9AA 4GQBA 2WZIA 3UCCA 3D47A 3CPUA 1XH0A 2O9RA 3MDWA 3VIMA 3B03A 6TIMA 3UJ2A 3K4WA 4J28A 4D71A 3PC0A 1JYNA 2NT0A 1ONRA 2WNWA 3WYZA 3W4RA 1SO5A 5G2IA 3DHUA 4P7NA 5J5RA 2OLAA 1N2VA 2HQAA 1XLLA 4Y8FA 1CECA 3ARXA 2JE8A 2Y4SA 1X6UA 2X7VA 2VCCA 2OWXA 4O1EA 3W2JA 3W83A 1LQ2A 3GXMA 5D37A 1C9DA 1ZBWA 1V51A 2VOMA 1CGVA 3RM4A 3PAJA 1FWAC 3P2VA 1O5RA 4TX9A 4D6JA 3LV6A 4UQ9A 4IMCA 4QQ3A 6ALDA 5H91A 1HFBA 3UWUA 3U4AA 5TBOA 3ERPA 4CN1A 3JR2A 1YADA 3QEZA 4ZOAA 4GXWA 4LQ1A 4XUYA 4EAMA 4DO4A 4K7YA 3U9IA 4HNUA 3BWWA 2PLKA 5DELA 2A2IA 2WCAA 2YYUA 3O3RA 3T09A 2PWGA 4I6VA 1H1YA 4KEVA 1QW9A 3WENA 2NLYA 1S46A 3AIUA 2R24A 2Y7DA 4HSHA 5JBDA 2C1IA 3A22A 3CU2A 4BF5A 3MI2A 1KCKA 2VYOA 3FS2A 2CWNA 1V77A 3KXQA 3TJ4A 4HCHA 2WHMA 1QPQA 2F2HA 3MSGA 1UR0A 1OYBA 1J0ZA 1GKPA 5LA0A 1QPRA 1TA3B 1XW8A 4Q8WA 5T8GA 2B7PA 2ZKMX 3XINA 1LM1A 3S6DA 2O9TA 3CPRA 4FSAA 4WUIA 1DYSA 3K8MA 4ICNA 2PTXA 5CC6A 3WD2A 3CUXA 3T0TA 2HS8A 3W7JA 3M9YA 5FI8A 3NL2A 2BFGA 4CN4A 4ZBCA 3PSVA 2VQTA 1K02A 1NELA 1WV2A 4Q4KA 3W7IA 2IKGA 1PAMA 5D04C 3LD5A 3QY8A 2GQ3A 1OB0A 4NZJA 3UWQA 3VNJA 1WX0A 2W92A 2BXVA 3AS2A 2RJHA 3O8AA 2QF8A 1BTMA 1NFPA 4HU4A 1TZ9A 2PDGA 2BVWA 1H7OA 1E0UA 1RVGA 3CAQA 3NA8A 3GYCA 4GNVA 2ZRUA 4LS1A 4LCQA 1DWJM 3DG6A 2ZX5A 3GR8A 4IX2A 1VEPA 2FGBA 5G2WA 4O12A 4Z2GA 3IVUA 3VD4A 1DOSA 2PDHA 2UBPC 4H9YA 2ZDRA 1K7XA 4Y6GA 1W9XA 2D69A 5DMYA 2V8ZA 2ESCA 3QH2A 5FAJA 3E74A 3O0KA 3GG1A 4DF1A 1J5TA 2IMRA 3CL6A 4B15A 3VGGA 4MGGA 5D2WA 3S1WA 3AHZA 3PHAA 1QAPA 4INFA 2ISDA 5GJPA 5PTDA 3O2LA 4NJGA 3N18A 1DTUA 1XLFA 4UR9A 1Z41A 2E6DA 3LCIA 4EVZA 3AI0A 3DESA 3WQCA 3LCHA 1HL9A 2ICSA 4PFMA 2P53A 3QTPA 4QAWA 3NQFA 4HT3A 4HNVA 3ARTA 1V8EA 3TIMA 2YBVA 3B0PA 4PODA 1EPVA 3HG3A 3BW4A 5DEZA 2BY2A 3K4DA 1ZS2A 1MDLA 2F7FA 8XIMA 1ZZMA 6TAAA 5ABFA 5BWAA 2ZZ6A 1TIWA 1Q6RA 2A3AA 2NSXA 2UV8G 2OO6A 4KWOA 3S9YA 1E70M 4GZEA 5CZJA 2PLCA 2JQXA 3W84A 3URNA 3GNPA 2C15A 2V68A 1KR1A 3N9KA 4W87A 1D7FA 5HMDA 1KGUA 4IMDA 5A6JA 4M19A 3AXHA 5I3JA 1MXDA 4GLEA 4D8ZA 4EWJA 3M1ZA 1C91A 3ABSA 1RQEA 1PE1A 3KX6A 1KBLA 3EWWA 3TXZA 3VD9A 1IT8A 2XH0A 4GZ7A 3ME3A 4AF0B 5DX7A 3W6LA 4FIRA 4N9EA 2IKJA 1OEPA 4IP7A 1JFXA 2Y8UA 2PGFA 3C0QA 4DJDA 3VOFA 2BP1A 3BOFA 4DXKA 2XTKA 3RPMA 2ALRA 3FJLA 3QLDA 1FY6A 3VD3A 3AZTA 3CC1A 3C52A 2VZOA 5DLCA 4M6UA 3B8TA 1WBHA 2QZRA 2DSZA 3GVQA 3E6EA 2VC9A 2ZYFA 1D3HA 1XYMA 2O7QA 3NSXA 3K2GA 1ZNNA 5K9CA 3BDKA 2Y5EA 2FZ8A 2PDUA 1M7OA 4GH1A 1UMYA 5IHSA 3MANA 1Q2SA 3O16A 1MRQA 3WLIA 5LNSA 3FYYA 5FSEC 4RZ4A 3N73A 4LAZA 4FNQA 4JTTA 3I3BA 1NOWA 4CD8A 4K37A 2H8XA 4Y7EA 1LRTA 1JF6A 4NP7A 1H3GA 3NURA 2C3ZA 1B4EA 4ZL1A 2ZCGA 4A3UA 1KR0A 2JF7A 3EOSA 1L2UA 1Y5XA 1PCWA 3SFWA 4C6NA 4YVVA 2YZRA 3AXKA 3ITYA 3LV5A 1M03A 4UCGA 3DC8A 3EBVA 1M04A 1W3KA 3UXAA 3EOLA 5H8UA 1ZALA 4WOZA 4C60A 2OU4A 1DJQA 3CUJA 3A47A 4UQDA 3W2LA 2WVVA 1JCYA 3AICA 4GI9A 2QCFA 4UFIA 1W32A 5A2AA 1A5MC 4FR1A 4IJRA 3V35A 5LNUA 3P84A 4O8RA 4JNYA 1JUEA 3UWWA 2DSVA 2D3NA 2X1RA 3THCA 1TPEA 4W8BA 3BH4A 4L7ZA 3UWEA 2WZHA 1OBAA 4JHMA 6REQB 4CEUC 4H6EA 2QJIA 1W1A1 2YFOA 4DUWA 4JIRA 1PIFA 2XN1A 3W1XA 4JL2A 5I02A 3NEHA 4HA1A 2XIIA 3OG2A 1TRIA 3MDUA 3HGOA 3THUA 4DBUA 4CCCA 3VU2A 5F4XA 4DZHA 4IHCA 5BROA 4RNIA 4MNJA 3VZYA 3DFTA 3G0XA 3MKVA 5K3VA 3BLLA 5AHEA 2GJXB 3VIKA 4L1GA 2QUMA 3PJWA 2XWDA 2QGYA 3CZEA 4ZB2A 2HNEA 3BGAA 2VDHA 1A5BA 4H2HA 4KS0A 3CL8A 1I75A 2YB1A 4O1CA 4XD4A 3ARSA 1AD4A 3LXAA 5CGMA 1HVXA 3ZJ8A 1FH7A 4GE8A 1I2QA 4W84A 3LLFA 1JJKA 1UA7A 3LHVA 3W7LA 1JAKA 5KZ6A 2W9MA 2H8ZA 1P0BA 1J96A 4UQBA 1W1PA 1BYAA 2QIWA 5IBXC 2HV5A 1KXVA 1E3ZA 3PG9A 3HN3A 3N14A 4NI8A 2FTWA 2R1PA 3HGJA 1PX3A 1R86A 1B0IA 1F74A 1HJSA 2XIQA 2WLZA 1VFMA 1X97A 1PYMA 3FXGA 1F4AA 2YR1A 4REQA 3NQ6A 1AVAA 3LRKA 2QJHA 4JD4A 1V3LA 3E1F1 3VGBA 4GFIA 1EO5A 5LNVA 1XBVA 4J3SA 2LLEA 4Z2JA 3OZYA 3LHZA 2RUSA 3NSMA 3TJIA 3O6AA 4OKDA 3WKZA 3M5XA 2PC8A 2QT3A 4M3PA 4DHGA 4O10A 4ADSA 4AY7A 1HJXA 3VK5A 1VBJA 1PSCA 4V28A 4XK2A 3GXIA 2VOTA 3QZEA 1GOMA 1QNRA 4EPBC 1TTQA 2WM0A 4Q7IA 4OIFA 2PBOA 3RRXA 4UB9A 4JIIX 3MP4A 4Q4RA 4G6CA 3VDBA 4AHPA 1WDDA 3DYPA 2DH2A 5JH2A 1B3VA 1WKFA 3GHUA 4K1WA 3AS0A 4MF4A 1C8VA 1UZHA 3CQKA 4EF8A 1J2WA 4U2ZA 3TNOA 2GQ9A 2UY3A 4PUUA 4CVUA 3CHVA 3NQ7A 3TVAA 5HWMA 3GY1A 3AHVA 1O4UA 2DT3A 1UD2A 1HQTA 3T07A 4DJFC 3M07A 3PZNA 1UKOA 5BOOA 1KGWA 2QAFA 1H41A 1GNXA 5I3FA 2BY1A 1NH6A 2HS6A 1EDTA 2G4FA 2NUWA 4AU0A 4WJ8A 5BYWA 4HK7A 5HNTA 1OFAA 3NDZA 5IRPA 1V6UA 2V2HA 2V67A 4PR4A 2DFAA 3CIWA 3CYVA 4WX2A 4JQ3A 1LCOA 4MJMA 3KBMA 3RX2A 1E9ZB 1Q8AA 3S0CA 3V3WA 3RPDA 4AIBA 3M0IA 3T42A 3EX6A 1H63A 2YJQA 3ZLFA 1PIIA 4Q8UA 4B91A 1QR7A 2BDQA 3A6OA 2PBGA 3W02A 1XWYA 1Q5MA 1TQXA 5T9CE 1A0EA 3M64A 3SURA 3FVDA 1R6WA 3PWIA 1YIXA 2DZSA 4NNAA 4JQ2A 1KXQA 3E5BA 4JDYA 1KRCC 3J7HA 2OQLA 1UHVA 1GVFA 4E8GA 1ONWA 3FGCB 5EB8A 2HE5A 1G94A 2ZX9A 3JW7A 1J0IA 5CGQA 1REQA 4C6BA 4YTRA 4HVXA 3ARWA 5FJJA 1BAGA 2R82A 1RZMA 3G18A 4ZE4A 3N6JA 5EMJA 4C6IA 2RHGA 3EOEA 4W4QA 4PC8A 4W7WA 2WBGA 1SMDA 4IP5A 3WUGA 2BHYA 1PPIA 3LHTA 5CZTA 3AIVA 4JIQA 3WLKX 1TPB1 2PP1A 4JX6A 3FFSA 1WZLA 1CZ1A 2HEJA 3FAXA 1DXIA 3BLKA 2BGNE 5BXRA 2B7NA 4TVCA 4C6CA 5BW6A 5HMEA 4Q4SA 3SUTA 4LBRA 1WAUA 4JHZA 4PTMA 2HXTA 3W71A 3SY1A 1ZENA 1F3EA 4NAFA 4EKJA 1EF3A 3B40A 3NO1A 5D30A 2WNQA 3ITLA 1B3OA 1Q6EA 1W1VA 2PDNA 1A5OC 4MWAB 4Q7NA 3F2DA 3PS7A 1SW7A 2D0GA 1UJQA 1NJJA 5CSYA 2YXXA 2HMCA 2YDQA 4DN1A 4OBSA 4O1DA 3GFXA 3UZXA 3QV7A 2X09A 3CTLA 1E43A 3DG7A 3ZZ1A 1UG6A 3EOUA 3M0LA 6ENLA 5DT5A 2DZBA 3LSBA 3WQ6A 1XLCA 3O0FA 5LYRA 5A8PA 4BHYA 1ZFJA 4NAFB 4Q6XA 2W62A 3P74A 2H90A 2XH7A 3CHFA 3BAIA 4IPIA 3W07A 4PUJA 2WSQA 4JBRA 1TO3A 3SCWA 3APYA 4AHQA 1IEXA 3S9ZA 5E70A 3P7YA 1M5WA 1EB3A 3EDEA 3GNDA 3LBMA 3HG2A 2C13A 2POZA 1OD0A 3TE9A 1F5ZA 5JH1A 2I5IA 2JF6A 2C18A 4CU7A 4X9SA 1UD3A 1ZAIA 2VTFA 1JDFA 2IPJA 1G9HA 4HGXA 3BLPX 3KRSA 3MJYA 3IIOA 1TZZA 2WNNA 3ARUA 4H6QA 1H7PA 1CXFA 3WD0A 2TAAA 1NWUA 4C6JA 1OX4A 4AD1A 2F2KA 2DZTA 2WSPA 5F7UA 3SW6A 1ALDA 2J78A 2WJZA 1RBAA 4QISA 3GTIA 2DY3A 2A3HA 3CIXA 3L67A 5LIKX 3VKAA 1V79A 2DP3A 4OV4A 1KM6A 3VVGA 3HPZA 3HJZA 4D6FA 5JUVA 1Z8AA 2PDJA 5BXSA 4FP1A 1LL7A 1IV8A 4J3TA 1OD8A 5I03A 3PBMA 3ZS4A 4LAMA 4H8UA 1TWDA 4ZSUA 4UTFA 4B2DD 4NZ5A 4NZ4A 5I78A 3E0WA 1OX6A 5ABGA 3B97A 4AIUA 2J47A 3L4UA 3VD7A 1XLGA 3IJ9A 1N8WA 1RCOB 2RFGA 3DGRA 3NDOA 3WJZA 4A6GA 3SQLA 2GOKA 5HAOA 3IVTA 2P8BA 1BWVA 1BF2A 3T8QA 4JZ5A 2PD5A 4CNOA 1SZRA 3QMSA 3FIGA 4JTCA 5GVJA 4JTDA 4J4KA 5IDZA 2VFDA 2Z4GA 2FHBA 3ZT7A 1X96A 1D9EA 4DRSA 4S3KA 1PX4A 4NF7A 2PMQA 4GC4A 1U1JA 4ZFCA 3VE9A 4BF7A 1XG4A 2Y2WA 4MSSA 4OWGA 1EUAA 4XO7A 5M3WA 5GJMA 1QO2A 1RVKA 4S1FA 4Z1DA 2NQHA 7PTDA 3DCPA 5DMMA 4R85A 1JGMA 1TWZA 3BZGA 4PL2A 5DT7A 3A3WA 5BXTA 4K8EA 3W82A 2XZ9A 3UJRA 4BQ3A 1BVNP 1XGZA 1E6QM 4GGHA 1OT2A 2J8GA 1H5YA 4QCFA 1SZNA 3KBVA 3MZNA 4WCJA 4FNSA 4LEQA 3F4CA 1POJA 4ZQCA 4DZIA 4RDVA 3AMDA 4UQAA 2E6AA 1IZJA 2PUZA 2IXUA 3S5NA 4L4LA 4B16A 2CBUA 4H1ZA 3O15A 1E6XM 1PZ3A 4JNZA 3U5UA 4YMZA 2HVMA 3AUOA 5MHBA 3M0XA 7TAAA 3VI2A 5ABHA 5HDRA 3SB0A 2IPWA 5A6BD 3E0VA 2TODA 2PWVA 5FJIA 4JTIA 3OZOA 4UOQA 4RZ6A 5CJNA 1XH1A 3VDCA 1GCYA 3OLEA 4NSBA 1JR1A 5F2IA 1EC9A 2PI6A 1VLIA 4HPNA 1XM3A 1M65A 1I45A 3LSCA 1DVJA 3MQTA 2DIKA 4F0HA 3CXOA 4M1RA 4BI5A 5HQMA 3AMKA 1FWEC 4UTUA 3U2CA 4LUJA 1VZWA 3BQ5A 2J7CA 3LY0A 5XINA 3OGRA 3NQAA 3ARRA 3S2LA 4GH3A 1RY8A 3LPOA 4RW3A 3WLOA 2H3BA 4BY3A 1V0NA 4QE1A 2QJGA 3PZTA 4AB4A 3GBDA 2BNJA 2PAJA 3HV8A 4QG6A 4WDWA 3W7DA 2JKEA 3WDHA 3GTXA 1J2BA 3UU0A 4Y2WA 2QCNA 2V5KA 2X2YA 3DENA 5BRBA 1V6WA 2DZVA 2OWWA 3HO8A 1KBJA 3GX9A 1N55A 3PTDA 1E4MM 1Q2RA 1EGMA 3L4VA 3ZJ6A 5HULA 4RDYA 4MTVA 3ZQ9A 5T26A 5G4WA 2PD9A 3LCLA 3UVIA 4YWIA 4FHAA 2J77A 4OE7A 1KV8A 1EHNA 3T0AA 4DWSD 3P67A 4U5KA 1OFOA 1TPUA 2QLYA 4E3TA 3T05A 3L0GA 4HYWA 3WNNA 4MM1A 4A3RA 2J66A 3UPMA 3TZNA 1BWKA 4A29A 4H9TA 4A8IA 1J11A 4NASA 1IXPA 5D38A 4M7SA 1QOXA 3SN1A 3UG5A 4IXXA 4JKLA 3NXLA 4A4AA 1VLWA 4WD0A 4JR5A 1H7RA 4PUKA 3A5VA 3BJSA 1TZ7A 1V7AA 3EXTA 3WBWA 3PF3A 2RKXA 2Y7FA 3BSMA 4H7ZA 4WKFA 2XSBA 3VM5A 5I6SA 5M5DA 3N6QA 1EP1A 3T2PA 4U4MA 1R7AA 1QPKA 5ABTA 5E0KA 1XV8A 2NXHA 4H9MA 2Y5SA 3BE7A 2CHOA 3KP1A 2YCJA 3GG0A 1WB0A 3ALGA 2OX4A 5E9AA 5AN7A 1KM1A 1DJZA 4DWSC 1DORA 1EC8A 1GG1A 4Q6JA 4GCAA 3TSMA 4V2XA 4B3KA 5DCEA 1SFSA 1P7TA 1W2PA 3N3TA 4E2DA 2X41A 4IOTA 4FEZA 4K8HA 1IIHA 1QOPA 3L4WA 3OLGA 3QR0A 4A35A 2PF8A 4QSHA 3CM4A 3GS6A 2QDDA 3BMWA 3UR8A 4EOUA 5BRPA 5I79A 4PB3A 4R34A 3WQ5A 4JFSA 2A7PA 4GYPC 3W2NA 2G3IA 1QCWA 4GINA 3LA4A 1WDQA 2IPFA 4JPGA 1WZAA 4RE2A 1E0VA 4L1WA 2HVNA 1ISWA 3GDKA 2FJUB 3H4GA 5BMXA 5AOUA 4G7FA 4M82A 4RE4A 1E6ZA 1NOUA 3UG4A 5LGZA 4DUXA 1BSLA 1MEWA 1LOSA 4KCTA 1S5WA 3WF1A 4GKTA 4GISA 3Q37A 4J3VA 1CENA 3MYPA 1AW5A 1Z6KA 2NVAA 2W5FA 2E6YA 3NWRA 3UWVA 3F7JA 4XKYB 1MQQA 3DDMA 1MXGA 4DQWA 1XIDA 2NXIA 4JQAA 4LJ3A 3P3BA 2BMBA 4UC5A 1WZMA 4S39A 3WDIA 4K68A 1FDJA 3BMXA 1JXJA 2VELA 3SBFA 1SR0A 2GSHA 3H4XA 3GW0A 3LPFA 1R9YA 3P60A 1XLDA 4QM1A 3WMSA 1XSIA 1KM2A 2ANUA 3TYEA 4IFOA 2VFEA 4HN4A 1KFJA 2YZ5A 3QV6A 3CUIA 2J27A 1ZB5A 3AYVA 3CNYA 4K2SA 4OJYA 3UBPC 1FUYA 3WLPA 1Q6LA 1MW0A 3BICA 3B4UA 4X22A 3AS3A 2BB0A 4QSFA 3D5HA 4KPLA 1KXTA 3VDHA 1KFCA 3NFUA 3S2JA 2PP0A 1LJYA 4MNMA 4MMWA 5D9PA 4LF1A 4W86A 1FWSA 5KZEA 1HGYA 5D05A 4LUIA 3V1HA 2GVYA 2A3LA 4ROQA 1V93A 3NQGA 4F9DA 2FGZA 3ZXWA 3PUOA 2HXUA 3GQYA 2SFPA 1XIIA 2PWHA 4M24A 4TTGA 1UR2A 4QX4A 3WFLA 3WFAA 4PMQA 2J8FA 5AFDA 2J7EA 1GUVA 3RLUA 5A6AA 1FVPA 1OG0A 4MAVA 2ZZ4A 2O92A 4AZ6A 4CQ8A 1XLKA 1P6BA 1HJVA 2VWTA 4X9YA 1UR3M 1TPC1 1Y65A 5KZMA 2O9OA 3H2CA 4LF2A 1B3XA 1FP8A 4UTTA 2MANA 4EANA 5GJNA 4DWDA 4A05A 3IJDA 4PFHA 4JTGA 4LYKA 3K4AA 1LLWA 3A5FA 2REQB 3T0BA 2OJPA 3A9BA 3C2RA 3I7QA 2X40A 3MMUA 2HRWA 4O1BA 1K3UA 3B8IA 4Z1YA 1QTWA 2YXOA 1IXQA 5IBXA 3B0VC 2CXEA 5KTLA 2WVVB 1H62A 3ZSTA 4S23A 3A12A 2R91A 1H1NA 1JF5A 3TN6A 3CMGA 3W88A 1TJ2A 3A4JA 4CGTA 3WDPP 2I16A 3BGGA 3WELA 1PUDA 5C54A 5DY3A 4XAZA 5A5WA 3CT7A 4M81A 4Q7BA 2FMNA 1RALA 3WNMA 2VNCA 2FVKA 4D6IA 1TV4A 2VR5A 5C7VA 1OGSA 1WDRA 3GNXA 4MKNA 3W7KA 4NY2A 3LRLA 1Q66A 1UIOA 2RJGA 2ZX8A 1JYVA 1U5JA 3URAA 3GKFA 1HJWA 3ZR4A 3PVFA 4AZGA 3GH5A 3A4AA 1ZJIA 3M4HA 2FGLA 1POKA 5KMYA 2DVTA 2UZ9A 2D20A 2C16A 5DMNA 1OYCA 1F73A 4HJFA 4LY8A 3OIXA 2EBNA 1UKQA 3DC0A 1V02A 1SZEA 1CXIA 2QPSA 4AXNA 4ZCWA 2Z1BA 4IIDA 2JEPA 1TTPA 1H4PA 1YE6A 4L9XA 1J10A 1EGVA 3QC3A 5CBBA 3QW3A 3W7PA 5LXXA 3QHNA 4M29A 3OOQA 1ISZA 2KX9A 1LDCA 2WJDA 1UA3A 2ZXAA 3B06A 3FN9A 4O1AA 3R5EA 1K77A 1HX0A 3KVKA 3PPFA 4HHPA 1J6OA 4S2CA 3CQHA 5CPLA 3GD6A 3OVGA 1KNWA 2CU0A 1J4EA 3ZJKA 3F2CA 3FDKA 1S2WA 4HSOA 3N2BA 2V3DA 4IGHA 4A2SA 1JRCA 1GGOA 1P6CA 4LYRA 2V3EA 3C0JA 3EWDA 4HHLA 3OB8A 4JY9A 2WZEA 3E12A 4KETA 1R9ZA 1YDNA 1DWIM 4UFHA 4PMOA 1KFBA 5A8MA 3UA4A 4D6EA 2PEVA 1W2VA 2XH2A 4XTDA 2Y0FA 3R0UA 4DNMA 4HYRA 4BK9A 5AHMA 2INFA 4IGNA 4IZGA 3WQEA 3IJ6A 1UUMA 3MJMA 3CQIA 4DJFD 4CD7A 2EO7A 1XSJA 3PNZA 4B5SA 1GYLA 1EJXC 2FH6A 2IKHA 3LBOA 5F1VA 4BF9A 5C2CA 3P80A 3AMLA 2B81A 1HP4A 1PKMA 4C6PA 2Z25A 2Z2UA 5E1QA 3QR3A 1I9CB 2GDUA 4CUCA 2D2OA 5LNWA 1W5QA 3NQ2A 4H01A 1H11A 2ZUSA 4ZA0A 2DZPA 4DUOA 2VZVA 3WQDA 3IRSA 2PRLA 1KLYA 4O14A 4RNHA 2VEIA 1YPIA 3GNNA 1RQHA 1AK5A 2P3EA 4G2DA 2IXVA 3NG3A 2V5DA 2FQIA 4LC6A 1W9VA 4PMUA 3WEMA 4OVXA 2A79A 2Y1HA 3APGA 4NZCA 1OIFA 4YXGA 3HA1A 3DYOA 1PS9A 4DJEC 4XBSA 4UNLA 4IUGA 3OBEA 2JK2A 2PURA 3K13A 1X8CA 3ITXA 3BW2A 4WR3A 2E5BA 5JMUA 1OX4B 2YBTA 5HOSA 1CXKA 3B0UX 1A47A 1LL4A 3KHDA 3WNPA 5G4EA 4ADUA 3TKFA 1JQVA 4QR6A 3TMQA 1Q6FA 4DAFA 1TJ0A 2ZFAA 3E02A 4DYKA 2ZZ5A 3G6MA 5JBEA 2HROA 1EBGA 1A0DA 5BU9A 4L6OA 3N4EA 4L9YA 3DX5A 2W0UA 3QYSA 3T9PA 1YNYA 2HCVA 1JZ5A 3FEMA 1A5KC 1WUFA 5A6TC 2W63A 2I1OA 1GYMA 1DXEA 2DT1A 4DXXA 2V9DA 3HF3A 3W26A 4G7EA 1OM0A 1LLOA 2PF0A 3LLDA 1PB0A 2TPSA 4W5UA 4QJ5B 3DH7A 3I7RA 3JZEA 3GG7A 1MW3A 1W31A 2G3FA 4G9PA 3C2OA 2BX7A 3S2NA 2CKRA 1XKJA 4R7OA 1S3HA 3K1DA 4PBFA 2JIWA 3LN3A 4CQBA 2J7FA 3KL5A 3PK7A 3BCDA 1PDZA 1PYFA 3P82A 3LEPA 3TQPA 4DAIA 3MSDA 8A3HA 1C8XA 4L4PA 3GAYA 3S5SA 5GQBA 1LUCB 2VEMA 3G22A 1E9YB 1DV7A 5AC4A 1KLZA 1FHUA 3CUGA 1W0MA 2CW6A 3U8GA 4OZOA 2YL5A 2C1HA 3MI3A 1U1HA 4H7VA 4RL3A 1O5QA 3TWBA 1V6YA 3BV4A 1G1YA 4N7QA 4IQEA 2NXGA 4LB3A 1H5VA 2DQWA 5M1TA 3UZYA 1RK5A 3NO3A 4DM1A 3BV7A 2DEPA 4N9DA 4JX4A 2OR2A 1W9UA 1FFRA 3PZ9A 2GGJA 3UA3A 1RY0A 3NNTA 4IIBA 2J75A 1EH9A 2ACSA 1UB3A 1Y0EA 4LVBA 1EBHA 2CLEA 1VHCA 4BEUA 2OYKA 1M9HA 1GW9A 3AFBA 1R3RA 1YLVA 3BUVA 1M7PA 3W24A 3VIFA 4GKLA 2VL4A 1MZHA 4O18A 4ZENA 3T1GA 1QDSA 1EWEA 3F4VA 3H7UA 4GACA 4JFTA 3WSUA 2IPGA 4ATWA 4NL1A 4O8AA 4I9MA 3JVAA 1WDPA 3IAQA 4WSKA 4FOKA 1VFHA 2YA2A 2YL6A 2A0NA 3R79A 4XQ6A 1FDYA 4JTHA 1VFOA 1HZYA 4GCXA 4GQGA 2HZGA 3FV9A 4DJFA 2CNCA 3IJ7A 4MUZA 3BOLA 3VMPA 2C8NA 1FWJC 2BLEA 3AALA 4PMNA 1W3JA 4ZQPA 3DYMA 2E68A 1H49A 2B0MA 4Q8NA 1L8NA 1UD6A 3YPIA 3ARZA 3PZGA 1QI5A 3I68A 4FXFA 4S3DA 5DO8A 5CXPA 3SCUA 3RN6A 3V1PA 2DV0A 1PWMA 1TV5A 4FNPA 4WQ6A 1R3VA 3UY8A 2NW0A 5D9OA 3VIGA 4B2DA 4J3XA 1YDYA 2XGIA 1N7KA 2GOUA 2VMFA 3VE7A 2BVDA 4MZYA 1F61A 3B0XA 2VUNA 3C2FA 4ERIA 3KEHA 5J04A 2YA1A 1DJGA 3W72A 3LU2A 3IGHX 3PZOA 4CD5A 2JKPA 2POTA 4XBKA 4A2RA 1TPVA 5D09A 3WF2A 4E0CA 2YIHA 1XUUA 1LL6A 1EIXA 1LWJA 4FO4A 1UD5A 3OGVA 3KLLA 3NYDA 2FHFA 4PRTA 3WNKA 2BVTA 3PM6A 3UF9A 2OSWA 3CZKA 1SPQA 5D9NA 2GVLA 3WBAA 5LIWX 3U0HA 1VFTA 2YCIX 2E67A 4LVFA 3VILA 4TXEA 3N2XA 3ZYZA 4LYQA 5LGXA 4OBTA 3THQA 2E8YA 1D3CA 1TX2A 3KVJA 3KVMA 5C5YA 4XD6A 1VBHA 3GDTA 4JNMA 4QGCA 4GIAA 4PB5A 1EP2A 4BA0A 5DMLA 3VTRA 1UBPC 1W54A 2QIIA 1NSJA 4KIRA 3GFYA 1Z32X 3NEVA 3FGCA 4UMBA 4AEOA 3AS1A 1VC4A 3L0KA 2AOSA 3VMNA 3DXIA 1F8MA 4C6EA 1XHGA 4RW5A 1S2AA 3G3DA 4HIBA 4JKKA 2BOFX 2VEGA 1GOQA 1LWHA 3ZOAA 3TZFA 1MFUA 2Z0IA 4HMDA 2DU2A 4U3CA 4M0XA 2CLFA 2G50A 3SUVA 2CFFA 4KCUA 5REQB 2ALDA 2PS2A 1Q8JA 8TIMA 1HUVA 1RJPA 5K4XA 3SIZA 3WD1A 3CV1A 5CLTA 1RPXA 2XGZA 1E4NA 2F6KA 3N4FA 4HCDA 3H4WA 2Q8ZA 3D3AA 3PTKA 3LNMA 2QDGA 2PDFA 3V5OA 4TMCA 3IJQA 2PGEA 3B9EA 1KTNA 1E6NA 4XZMX 1WOBA 3P81A 1W5NA 4MNKA 3EDKA 4NJHA 1H50A 3G8RA 4C5ZA 1IWAA 4G1KA 1E6RA 5F2GA 3S1VA 2E25A 2PRMA 5B7YA 1KFKA 4KH2A 4BCEA 3CZJA 3W85A 3M44A 1RV8A 3WK1A 3JUGA 2EPHA 3H24A 4KT2A 4HOXA 2NQ5A 3EWBX 3UCDA 1OCBA 3ZVHA 2EXOA 3H12A 2QQ6A 3PUEA 7XIMA 4N4PA 3MUZ1 4L6HA 3S1XA 2OFJA 4IWWA 4JIPA 4TV5A 1QI2A 1PZ0A 3G5EA 3GTHA 5KSWA 1UWAA 4PE8A 1P0DA 3B9AA 3U7BA 2A5HA 1W37A 4X3ZA 2ZOXA 4B3LA 5A6BA 1E1CB 4U3AA 3ARYA 2E1DA 3RF9A 4JIEA 3NXFA 2WC3A 1NFGA 4WGHA 4CQAA 1U30A 2OB3A 1O60A 3EA3A 1M01A 3LCGA 5MKGA 4I5RA 3T6CA 3K8KA 4ZR8A 3N19B 5A8GA 3EEGA 1A49A 3OZPA 3QBUA 5BOEA 4WGXA 1QNSA 2BWGA 4E2OA 1OINA 4BI6A 5C8BB 4OQVA 2Y6ZA 3W6YA 1CDGA 1V5XA 3WQ8A 5A6KA 3NTYA 1T96A 4PZVA 1GQIA 1W5PA 4E8CA 4H04A 5G1YA 1S5MA 3BAXA 3I3EA 4FAMA 2FTYA 4MWAE 2VD9A 1YDVA 5EMKA 3AOFA 1UC5A 4MIMA 1GQKA 3TYCA 3TROA 3UCQA 4HZ6A 4GY0A 1XC6A 1GW1A 5CBIA 3SGUA 5JVLA 1XC4A 3NAVA 2AQWA 4LUSA 2YLLA 1UWUA 4JGDA 1TVLA 4MPKA 1HL8A 3E9AA 1TA3A 2OVLA 1H7XA 2GVEA 1CLKA 1VIZA 3DEQA 2Z29A 3V7PA 5KZDA 1RP9A 2PSNA 2KAUC 3R94A 4LY4A 1UWTA 1Y7VA 1GOIA 2O7SA 4UZUA 2XDFA 4R9XA 4OTKA 3CB3A 3SRHA 4DBDA 2X8RA 4B4FA 4P61A 2X30A 5EU9A 4Z42C 1A5UA 4F0LA 1I2RA 3GYEA 1GQJA 4DXVA 2YYTA 4K38A 2ZUMA 4PEKA 4Q8OA 3G1VA 3COTA 3RCYA 3V0TA 3EKGA 3BJFA 1RR2A 2CCRA 2X1TA 4WXZA 1VBUA 2XPKA 5I3GA 4G56A 3CK5A 1CGTA 3RU8X 1G7UA 1JDCA 3NPWA 2H9AA 3QOMA 2FHCA 4XVEA 1MNSA 1X7IA 4UTMA 1OQFA 2JGQA 3KCLA 1D8CA 2WYSA 1LUCA 2FZNA 3GC2A 1JZ6A 4KW2A 4NZ1A 1F9CA 3MC5A 3VINA 1JI1A 4UTTC 2Z1KA 3WDRA 1R9XA 2Z26A 3QQ0A 4KWVA 3UR5A 3QGAC 1EHAA 3QHMA 1Q65A 3N11A 1A80A 3DUGA 3W7CA 1EWDA 3U6WA 4DO5A 1D7KA 2GK1B 1G67A 5A6SA 1JPIA 4UWMA 1US2A 3WUBA 5EMYA 5BNKA 1U83A 5CC5A 1TPH1 1C93A 4PUWA 1W9PA 3KBNA 1XLEA 4DY1A 4V33A 3W6MA 1MQPA 4QG8A 3UNTA 2C0HA 4GBUA 4U28A 1M41A 3EX4A 3TYBA 1BRLB 3L2IA 1F3XA 1KM5A 1I8JA 4UFKA 3TA9A 1QJWA 3W29A 4ZVJA 4PTDA 4RE3A 1BKHA 2FKPA 4GUHA 4AVFA 2C71A 4BZYA 1XBXA 1FTXA 3GRIA 3AWOA 3ZIZA 5I3HA 1FHDA 2XVKA 1OZMA 3H2FA 1UWRA 3FJ4A 3SFKA 1RCXB 4KWUA 4F2TA 3KFTA 2BSLA 1W17A 4Q4PA 4K8GA 4AD3A 3KL3A 1BEUA 3MVIA 3PR2A 3OQ8A 1UBSA 3W1PA 4DBSA 3AXXA 1V6TA 1YQ2A 1M53A 3WJYA 2OLHA 2OWCA 4WZHA 2EHHA 4GI4A 1ISVA 5FL1A 4FMVA 3KAOA 3FHAA 3RMJA 2P10A 3A9IA 3MP5A 3KTSA 4NG3A