3W83A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-6-097
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-6-097
rcsb
source organism Trypanosoma cruzi
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w83A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w83A01
1OJXA 4YXGA 2E09A 3EX1A 3HF3A 1P4CA 3G1VA 3PB2A 1FWWA 1G67A 2ZRVA 3GKAA 1B9BA 3THAA 4CLMA 3IIVA 5DBTA 4AWSA 2H8XA 2PCQA 3C6CA 3Q37A 4NZJA 4AF0B 5F2MA 4K39A 3W84A 4XWUA 1FCBA 5CSSA 3UXDA 5T26A 1VS1A 1QMLA 3EWBX 4UTLA 1RPXA 5D2YA 3TROA 1TPEA 1JQVA 3MYOA 4S2CA 3B0UX 3NQVA 2CZ5A 4RXGA 2ZDRA 3LHUA 4ML9A 1VLIA 3MW7A 1K8XA 3BW2A 1H50A 3W7DA 2NZLA 5I3KA 3W6YA 3A5FA 2NWSA 4K6AA 4XZ9A 1K03A 2ZZ3A 3HIJA 3UNDA 2H8ZA 4DBDA 4DO5A 4PH6A 1F6KA 5HWMA 5DXXA 1L2UA 3FLUA 5D38A 5CG7A 1H7OA 3HGRA 4AHQA 1YTDA 3C56A 2ZFAA 4O18A 4UUIA 1OFEA 3CWOX 3FKRA 3QPYA 1R46A 2NX3A 5AHLA 4MZYA 4R34A 4UMAA 2YCEA 1ME7A 2CLLA 2X2GA 4CCCA 4UMBA 1IXPA 2B7NA 3QH2A 3LI0A 4X3ZA 3C4UA 3EX6A 3FYPA 4JN6A 2ZRXA 4PL2A 4K8EA 3M47A 1WV2A 3O8AA 4LY8A 4CQAA 2QDHA 2FTPA 4UTHA 3BW4A 4IMCA 3LRMA 2CZFA 2CLIA 1YXYA 1PHQA 4BI7A 3ATYA 5HQEA 2DP3A 1JULA 1RQEA 3DHDA 1LOLA 4JTUA 4UFIA 5EA9A 3W7JA 1M5WA 4JYFA 3CEUA 5C55A 3LLFA 3PAJA 4YMZA 1FCQA 5K4XA 4PL1A 5HR6A 3U8GA 1MXSA 1W3NA 3TU9A 1SSDA 1UJPA 1IIGA 5BOOA 2ABBA 3LHTA 4MZ8A 3BLFA 4M19A 3C2OA 1ZCOA 3N2XA 3ABRA 1TPH1 3T78A 3M5XA 1LBLA 1ZHAA 3TW6A 1QOQA 5KMYA 5LNRA 3P60A 3QPZA 2RDWA 1W3TA 5HWJA 5C54A 2F84A 2NUYA 5AC6A 3L65A 3O6YX 2NXGA 3C2RA 3FS2A 2FLIA 3TJXA 1KA9F 1VYSX 5LNSA 4AXKA 2PRLA 1G69A 4N4PA 3BPWA 2A4AA 1F05A 3GAYA 1ML1A 5CKSA 3LCXA 1UCWA 3NQDA 1R2SA 4NJGA 4M5PA 2YW3A 3W76A 1DJQA 5D2TA 2ZA2A 3HPZA 4AAJA 3HJZA 4UTTC 2J9XA 1JUEA 3LB0A 3LCHA 2ZZ5A 5BMXA 1VH7A 1EPXA 2DJXA 1ALDA 1JUKA 1QO5A 3NG3A 2Y62A 3K30A 1UBSA 1FDYA 1NF0A 3LTPA 4O50A 2XN2A 1W31A 4OV9A 2B4GA 5HWNA 3LCLA 3DU0A 3NPWA 3Q94A 5G2WA 3B4UA 1W5NA 3LLDA 5KZDA 5FESA 4WXYA 3NEVA 5A5WA 1TPDA 2ZRZA 1VQTA 3RLVA 3NYZA 1GYLA 3T55A 4NU7A 4AMAA 3IIPA 5K2ZA 1WQ5A 4H3DA 4UFHA 4JTLA 2NV2A 3MP3A 1KTCA 3F4NA 1TV7A 4O54A 1I2OA 4O11A 5D37A 4RZ6A 4JXCA 1XXXA 3O15A 3W7NA 4E2BA 3TQVA 1MEHA 1YDNA 4FX7A 3LV5A 1JQXA 4MFEA 1FY6A 3GKFA 4CNNA 4WJEA 3S5YA 3FJ6A 2WQPA 3MJYA 2PRHA 3CEPA 3TX9A 4HT3A 1N7KA 5E1QA 2J9ZA 3O07A 2DZXA 1E51A 3S1VA 2I9EA 3LCIA 1RR2A 1TSIA 1SSGA 3FIGA 2DJLA 2PC4A 3GK0A 2A0NA 3NPXA 1TIMA 3QF0A 3G1XA 2QCDB 3WFAA 2H3BA 3CT7A 1TV5A 3NQEA 3S1WA 1KM0A 3DFOA 2JBMA 3DKJA 1LYXA 2A21A 1LZOA 2YW4A 3G18A 1F74A 1P5BA 1F73A 1TPVA 3W1QA 2R94A 1DL3A 5G4EA 1T0OA 5HUPA 4GUJA 4BR1A 3LHVA 4UNKA 1UASA 2J6XA 5AYZA 4O57A 1KFCA 1TQXA 3OVRA 4UTTA 4ZQNA 4ZZ9A 1LLZA 3B03A 4QJ1A 1P0NA 1GTHA 4NQ1A 1OG0A 4A21A 4UTIA 2QUTA 2WSYA 3GR8A 5D09A 3UYCA 2GQ9A 3C8FA 1O95A 3CWNA 1OFQA 1TPB1 3B06A 4ADTA 2AGKA 3ABSA 2OMAA 3G1FA 3SR7A 1RQHA 4TU1A 4MYAA 3JS3A 1VLWA 2H3DA 3I7SA 3LXCA 1TPC1 3M7WA 2YGYA 3W86A 3NQ7A 2QCCA 5EKYA 2B7QA 2TRSA 3I65A 1TPUA 3HMJG 3DFTA 1FDZA 5C6MA 4S1FA 2GUUA 2G5WA 2R14A 3S6DA 1VRDA 3PG9A 2ZZ6A 5K3VA 1NF7A 4JD4A 3HG5A 2VOMA 4KWWA 1MSSA 3M44A 4O0ZA 4UTKA 3LERA 4IMGA 4HPXA 5C2XA 4O1DA 3KXQA 2GPTA 2YZRA 3QEZA 5L9FA 3GXNA 4IX2A 2J9YA 4K7VA 4UIOA 2OCZA 5BMWA 1I2QA 2DZWA 3GDLA 3V75A 5F1VA 4BI5A 2ATSA 5AN7A 5F4WA 3JR2A 3GDMA 4LS2A 4NNBA 2CLHA 4ORIA 1W56A 2QCEA 1GQNA 3W83A 3A9IA 4NX5A 2CLEA 1KW1A 4O10A 3W7LA 2D73A 2NXHA 2OZ0A 4FXSA 3T4CA 4LVAA 3KHJA 1EWDA 1YTEA 5ABTA 1X1OA 1PE1A 2TMDA 2Y7EA 1HFBA 2YFNA 1OX6A 3WK3A 3W7RA 1FXPA 3GIYA 1TMHA 2VEMA 4OU1A 1B57A 4U4MA 4MLRA 2ZCGA 1WA3A 4LRSA 3LCWA 2GVLA 3EWUA 1ADOA 2VELA 3F03K 4GFSA 3MP4A 4HN4A 3N14A 3B05A 4Z0SA 4CQ8A 5HULA 2QEZA 1LROA 1DOSA 2CLKA 2P10A 4UFKA 1ME9A 3W7KA 2V2HA 1VGAA 3W71A 5FF2A 3G3DA 3SECA 3F1QA 2WJZA 3EKZA 2QUUA 5EY5A 1FWNA 2IQTA 1VZWA 2NV1A 5CPLA 4RLIA 3WJZA 1RV8A 1OF6A 3P62A 1KFJA 3HOJA 1FCUA 3L0GA 2WSQA 1I45A 2AAMA 1NSJA 2VFIA 3CLMA 1EUAA 4HKPA 3GVGA 3RF9A 1BKSA 1MO0A 3DI1A 2O7QA 4MJZA 3N3MA 4JTEA 1TO3A 4ICNA 1GG0A 1QAPA 4JX6A 1AW2A 1HO4A 1Y0EA 3I6RA 4OV4A 1PCWA 3EXTA 3TJLA 3V1PA 4TR9A 2WNZA 5CPNA 3ZR4A 3NL6A 3G22A 4UR7A 4LS1A 3W07A 3HGSA 3LHYA 1JCLA 3M9YA 4JTKA 3HQ1A 2ISVA 1XUZA 4QQ3A 4Q32A 1VCGA 3W2JA 4FNUA 3P8JA 4JIPA 5KZMA 5D02A 5MHBA 1GG1A 3G24A 5FF0A 1EP2A 1GVFA 3N9SA 3R5EA 4FIQA 1KBJA 1S5TA 4G1KA 1AL7A 1G4TA 3QM3A 3DFPA 3MMTA 5AYXA 1T96A 4MJMA 2Y88A 4QIUA 5D05A 3ZFHA 4JTGA 1ICQA 1DORA 5IBXC 5FF3A 2E1DA 1YDOA 2YX0A 3TMLA 3TXVA 4EVZA 3TKFA 1A50A 1ZALA 1Q6QA 1WOAA 2E5BA 1SZFA 4K38A 4JY9A 1D3GA 3S5OA 3UXAA 1Q6OA 2DZUA 4JICA 1JCJA 3W2NA 4K8HA 5LGZA 4L4LA 3UWUA 3VI2A 1UUMA 2CW6A 1T99A 1I4NA 3T44A 1DQXA 2I1OA 3G3MA 1W5QA 3CM4A 2WNNA 1WXJA 2YR1A 3G1YA 2OT1A 4XBSA 4C1LA 5L6UA 3S5NA 5CZSA 3RU6A 3S0CA 3ELFA 3BV4A 3MHUA 3PULA 2J24A 1X8FA 4BWLA 3EKLA 1EX5A 3STGA 2Y85A 3MUXA 4R33A 3S1XA 2G97A 3P67A 1G7VA 5K9CA 2WKJA 4FNPA 1X6UA 2VFDA 1I2NA 1OFBA 3TV8A 4TMCA 2Y7DA 1RVGA 1XKYA 2VFEA 3NM3A 4Q4KA 4I9AA 3L0KA 1D9EA 1G4PA 2CZDA 4N02A 3P82A 5CGQA 1H5YA 2E5DA 1OX5A 2KZHA 2P0OA 3DFNA 1H7PA 3DGRA 3C61A 3LXBA 4CCDA 3LX9A 4IX0A 1FXQA 3NL3A 3TH6A 4UXDA 2QCLA 3OHIA 1DBTA 4ZL1A 3VCRA 2VEKA 4NX0A 3P81A 3MHGA 1PL9A 2Y6ZA 3R12A 1TYGA 1G6CA 4R7JA 4O1AA 3JRKA 1W1ZA 5FI8A 1WBHA 2DZTA 1FDJA 4IGHA 4X9SA 1IIHA 2BSLA 4IPJA 4EOUA 1GYNA 4MKNA 3P5ZA 4P2VA 1K02A 1QOPA 3G0UA 2JKPA 5AFDA 3E9AA 1IXNA 4PODA 2YFOA 4KFOA 2RDUA 4ORMA 1TREA 3BO9A 3IIZA 3A23A 5I3FA 1B4KA 3TFCA 2YYTA 3UWQA 3PUOA 1AG1O 3L5LA 3MI6A 4Y8FA 3S1UA 2XN0A 3M0ZA 5DELA 1ZAIA 3NZ1A 2ZRYA 3G1HA 5GVJA 1CI1A 5KINA 4N6EA 1QPNA 2B7OA 1XI3A 2ZA3A 3O6DA 4EF8A 1U5JA 1XL9A 5LGXA 4JEQA 2FPVA 1KTNA 3TNOA 3GXTA 4MLJA 1W5PA 4LVFA 1AK5A 5D2WA 3HG2A 2QAPA 5TBOA 2VKZG 3TSDA 2Z6IA 5LKYA 5D2VA 4NJHA 1ME8A 5TQLA 3W1AA 1C8VA 3STFA 1OF8A 4QAIA 1PIIA 1H63A 4OE7A 1RQBA 1XBZA 3TAKA 3E12A 4DXVA 2WPBA 5BNKA 4JDBA 1UUOA 2TPSA 3RK8A 1SU5A 1KFLA 5D04C 4GUGA 4O0KA 3GDKA 3IGUA 3A21A 2EPHA 3DXIA 5HMSA 3LRLA 1Z44A 1XM3A 3BK0A 3YPIA 4Z1CA 1S3HA 2TSYA 1AW1A 2R8WA 1AMKA 8TIMA 1GVSA 4I7VA 4DF2A 4QNWA 3LHWA 1L6WA 7TIMA 1QPRA 4DQWA 2JKEA 2JKAA 4YLWA 5LNWA 2ALDA 2OT0A 1QFEA 3FYOA 5G2HA 4DF1A 4U28A 3C2VA 3A24A 4ZQOA 4UFMA 4ADSA 2TYSA 4QISA 2QCFA 1KM4A 3W70A 2Y89A 1KM6A 1K7FA 5EL1A 4LU0A 3ZWTA 1ONRA 4AB4A 1WOBA 2WV8A 3QMSA 3BLIA 4ZQRA 3BVJA 1QNVA 3QW3A 5I3JA 4DF0A 1HL2A 3QSTA 2YYUA 3NQ2A 4RX0A 4A3UA 2RFGA 5BRBA 4UMCA 4UC5A 4FX6M 3NQ8A 4P61A 4FIRA 1A5SA 1M7PA 3DZ1A 4RCXA 3Q2DA 1F6PA 5I3GA 5K7JA 1PV8A 3NR0A 3KRUA 3KVMA 3LBMA 1C29A 2V2DA 3GDRA 2ZA1A 4M6PA 4A29A 4ONVA 2CLOA 4S2BA 1TPWA 5CZJA 2V2CA 1NEYA 5F1UA 3N19B 3PUDA 2H6RA 3WK2A 1HTIA 2FIQA 1ZFJA 1FBAA 1OYBA 2VXNA 5I3IA 3EXSA 1XDLA 3NGJA 1P1XA 3DFSA 1Q6RA 3CU2A 2QCNA 1OYCA 3W2MA 1KV8A 3GXPA 3STEA 4IMDA 4O14A 4Q33A 1GVQA 1TV8A 5CZ0A 1P0KA 3SW6A 4DEFA 3OVPA 3LBCA 3KVJA 3UWWA 3H54A 3W85A 2A2IA 4A2SA 3EWWA 2Z0IA 1XBXA 1THFD 3NNTA 5LHFA 1TTIA 3B0VC 2VFHA 2X16A 3EXRA 4JTIA 3M1ZA 4GJ1A 2B7PA 2UV8G 3RLUA 2OJPA 3LV6A 2CLMA 1TPFA 3L9CA 3W1MA 5KZEA 2E6YA 1SZGA 1FUYA 2X1TA 2E68A 3N2MA 3R8RA 4RZ5A 4IWWA 2VFGA 3NAVA 5AHMA 4JX5A 4WY0A 1DVJA 2ISWA 1W54A 3HBLA 1G4EA 3MI3A 1ZY9A 4JS3A 1LRTA 3IVTA 4GC4A 4OHQA 5D2XA 3TXZA 2BZNA 3W75A 4FX8A 4CNPA 3GB6A 2CU0A 1EA0A 1JCNA 4PC8A 2YSWA 3E96A 3EWZA 3GNDA 4NXKA 5KTLA 4MY8A 1ICPA 1OABA 3AJXA 3WJWA 3SZ8A 1OX4A 5CZTA 1GVOA 4WXZA 3KVLA 4AVFA 3IV3A 3G1SA 3H55A 5FEXA 1SR9A 3UZJA 5DCBA 3B0PA 1JRCA 4FNQA 2NXIA 3CQ0A 2VEIA 4HIBA 3QMTA 1YPFA 1G4SA 1SO6A 3SSJA 1CX9A 4LT9A 4H6KA 2X30A 1YDVA 1XBVA 2GVJA 1LLWA 2CWNA 4GUFA 1B3OA 4Z1BA 2J27A 5F2GA 3IRDA 5DY3A 4BFAA 4OWGA 4FNSA 1JCXA 3GAKA 1ZJIA 2ZTJA 1FX6A 3LCGA 4CQ9A 1FWSA 2QCGA 5LNVA 1IXOA 1V7YA 2E6AA 1SO4A 3CIXA 1IGSA 4N6FA 2OX1A 4AH7A 1A5CA 5G1YA 1LRQA 2X1RA 5IM51 3QMRA 2V0TA 3A5VA 3PBUA 1K8ZA 4WD0A 1KBIA 4NNCA 1VCFA 4N4QA 4RK8A 5G2IA 1KLYA 3W22A 3S9YA 3LXAA 3G0SA 5DN1A 4DBEA 1LP6A 2GQAA 5U4NA 1H61A 3EEGA 1QR7A 1T8XA 2A1YA 2AQWA 5FEPA 3MBFA 3NA8A 4IMFA 4MY9A 4RKAA 1F76A 3CTLA 2DZVA 4IOTA 4AWTA 1M6JA 4WOQA 4C1KA 3G1AA 3W1TA 4O19A 3DKLA 2V81A 2XFWA 3L5MA 4NJKA 4N9BA 4NJJA 1BEUA 5HINA 2LLEA 3BG5A 1R2TA 5EBUA 1DV7A 1S5VA 3FEMA 4JGDA 1F7BA 1LRNA 4K7YA 2V5BA 3N9RA 4UFJA 1YYAA 2JK2A 1OVDA 1SO3A 2WNQA 3QRHA 4MUZA 5D03A 1TJRA 2W6RA 3FA5A 4UTUA 2WO5A 4GE8A 1L6SA 1WDWA 3WJSA 3CHVA 1WAUA 1YXDA 2QJIA 5FF7A 4ALDA 3W7HA 2V5LA 2ATMA 4DO4A 1GEQA 1R47A 1WYIA 1UB3A 3WK0A 3M5ZA 5AC7A 2FB3A 2B0MA 3W7GA 3FOKA 2E6FA 3O16A 4EWND 2Y70A 3W2KA 1EB3A 4XTIA 3BG3A 2FPYA 5LNUA 3H53A 3TQ0A 3LM7A 1W0MA 4ADUA 2EF9A 3WJYA 3OBKA 3TQKA 1SO5A 4DO6A 1O94A 1O5KA 1M7OA 3KFTA 2HS6A 1MEIA 3I68A 4WQ6A 2BLEA 3C0JA 3OEXA 3KVKA 1F5ZA 3EX4A 4AHOA 4IXHA 3TFXA 1XFBA 1OFDA 1TTQA 1I2RA 4NJIA 1YLVA 3P74A 1SW3A 4D2JA 4TIMA 3W72A 3UPBA 4HNUA 5AB3A 5G4WA 2GOUA 3M43A 1A53A 2Q3OA 4I7UA 3KRZA 4LUIA 1ZAHA 2G96A 3D0CA 3TC7A 4O12A 3TSBA 4J9JA 2HMCA 3W7PA 1U83A 3RMJA 3TSMA 5EMUA 3O05A 1W3IA 3HB9A 2QUVA 4UR8A 3GNNA 1DHPA 1S5WA 3E49A 3TUUA 3BGGA 3VKJA 3O1NA 1F2JA 5FEZA 3UZ5A 4N9DA 2GVGA 2EHHA 3RNDA 2A85A 4O15A 2HSAA 5BW6A 3W1LA 4GNJA 3LHZA 1L6YA 4POCA 1QPQA 2CFFA 2QR6A 4WY0B 3U2OA 1H60A 3E02A 2V8ZA 3PM6A 3PC0A 5F4XA 4UTMA 4EF9A 2PURA 5AHIA 1VYPX 3W2UA 3PG8A 3PWAA 2BTMA 3PBWA 3W7CA 5SWUA 4WOZA 1N55A 4A22A 4JIQA 3IVUA 3N34A 5K9XA 2QJHA 3NL5A 1FWRA 3W1NA 1NVMA 3NQCA 1R30A 5LHEA 2QAFA 3W1PA 3IIOA 2ZRUA 1OX4B 1ZENA 1Z41A 3ABQA 1WBJA 4JR5A 4NXSA 3WK1A 3W7MA 3LTSA 1BTMA 3F4WA 1X7FA 2C13A 3DI0A 3W88A 4FNRA 4I7WA 4LS0A 3R13A 3W7EA 1SFLA 3R2GA 3A22A 2C1HA 1GZGA 4KKXA 1LBFA 3MYPA 4PEKA 2DZPA 3SGUA 4XBKA 3INPA 5IBXA 3LGEA 3M6YA 3B04A 1EUNA 3OG3A 2JGYA 3P7YA 1O60A 3DENA 2HTMA 5K4ZA 1HUVA 2CLFA 3TC6A 3BG9A 4LV4A 1TB3A 3LCFA 2ZQ0A 4LNYA 1G7UA 4DELA 3LI1A 3T7VA 1KV5A 3DAQA 3HO8A 3NQMA 2Q3RA 3W1XA 1JR1A 1MZHA 1Z48A 5HR7A 1R2RA 1K7EA 4GBUA 4O8RA 5EYWA 3USBA 2WOQA 1EIXA 3P5YA 2ZZ7A 4O52A 4O16A 4RXFA 4CNOA 2ZZ2A 2JGQA 1K7XA 4YWIA 3UD6A 1VHCA 3C2FA 1JCMP 3CC1A 5A8GA 5DCDA 4Z1DA 1XCFA 1JUBA 4LC8A 4Y9AA 2A6NA 1GVRA 3OIXA 2NLIA 5C5YA 2HS8A 3NPVA 4WZHA 3W1RA 3I7QA 5K9DA 1OK4A 1OFPA 4UTJA 4O13A 2DU2A 3TIMA 3UWZA 4JTFA 2EKCA 1O4UA 5AYYA 3O6CA 1K3UA 1L9WA 2Y61A 2RDTA 2A7NA 2C15A 2PRMA 3AO0A 1OFAA 3W3OA 1OYAA 3NO5A 1H7WA 4DPQA 1A5AA 1I8JA 3CIWA 4TX9A 1ZAJA 2PE4A 5F2LA 1W37A 5HNRA 1H1YA 2A7PA 1SQ7A 2P1FA 4N9CA 1Q45A 4ZQMA 4NNAA 2ZZ1A 2Y63A 3PBVA 1NAL1 4MYXA 1VR6A 1X1ZA 3P8IA 4OT7A 4HNVA 3E0IA 5D32A 4MPQA 3BGJA 4YCOA 4GWEA 2C18A 3BW3A 2GJLA 3P84A 1W8SA 4JYDA 3S5ZA 2RKXA 4M7TA 5KITA 4JTHA 3GDTA 3OA3A 4YL2A 3PB0A 4JTSA 2C19A 4PTNA 1PCKA 4HHPA 3NZRA 4UNLA 3KRSA 5DXYA 3HGOA 4LVDA 4KFPA 4GRSA 3VE9A 3THQA 2C14A 3DFQA 4B5NA 1Q3NA 2Q8ZA 3UY8A 3WJXA 4JX4A 4X22A 3STCA 2NX1A 4LTSA 4GUHA 3GLCA 1O5XA 4QM1A 4IUOA 1BWLA 1KFBA 2C6QA 3HPSA 3LOTA 1QCWA 4DPPA 1W5MA 3QQ1A 2NUXA 1TTJA 3MBDA 3L21A 4JTTA 4GUIA 1A5BA 2W0UA 4M6QA 1H51A 2V9DA 3VE7A 3TAOA 4YCPA 1YADA 2YPIA 1FCVA 4XTDA 3ZWSA 2R91A 5DBUA 2G95A 1LORA 4WY0F 3M5VA 4A2RA 4K37A 4ZQCA 2W79A 2RH9A 2FPTA 4KWVA 4RZ4A 3N73A 5TIMA 4N2YA 1QO2A 5DCEA 5AHEA 5D30A 5I3HA 2F7FA 1KFKA 4UFLA 1LCOA 3NL2A 3Q58A 3L68A 1QWGA 3OVQA 3NQGA 2ZBTA 4XUGA 3T40A 1ZNNA 3UWYA 2DORA 1LBMA 2Y7GA 3M16A 3IGSA 3RFAA 4AEOA 4AWUA 3W87A 5U7SA 5LZLA 1IXQA 5G1TA 5J5RA 1XC4A 2QJGA 2VC6A 2NUWA 4PFMA 3L67A 4ZVJA 4BI6A 4WUIA 2EGZA 4Z0JA 2FFCA 2V30A 2EAWA 1KFEA 5FEWA 4FNTA 3IEBA 1H7XA 1VCVA 3KAOA 6ALDA 2J88A 4XKYA 3L66A 4HSNA 4PCFA 5LSMA 4RV8A 1RD5A 4RR4A 5AOUA 1H7RA 3QSRA 1VYRA 4RJEA 5DLCA 1V5XA 3C2EA 1VC4A 4O28A 2ZTKA 1TQJA 4AF0A 3W9ZA 3TMQA 1KM1A 3MP5A 4O1BA 3GR7A 4IMEA 4IJBA 4HNNA 3W74A 1DKWA 1VJIA 3PY2A 1TJPA 5FF4A 2Z1BA 3NQ6A 3P61A 1KM5A 1GPWA 1PS9A 3ANYA 3TDFA 1YTKA 4BF9A 1C9DA 1KM2A 3HPXA 4FEZA 5AHFA 4OGZA 1Q6LA 1J5TA 4FHAA 2A5HA 4LV9A 3EB2A 1AL8A 1LTDA 3PBYA 3W2LA 3P80A 1SZNA 4HSOA 4MOZA 4M6VA 5H2ZA 2ABAA 4LW7A 3DH7A 3SGZA 2A6LA 2RHGA 3M5YA 3IVSA 3NQAA 3KX6A 2BWGA 3EWXA 1J2WA 2ZZ4A 1FWTA 4EIVA 4WX2A 3TCEA 1K8YA 1SUXA 1QPOA 2A7RA 3HG3A 2O7SA 1EWEA 3PVFA 4LOCA 4O4VA 3TE9A 3I7RA 2NX9A 4LRTA 2QCHA 3QZEA 3QQ0A 2C0AA 2GJNA 4H4IA 4UTWC 4E2DA 5F2IA 1YPIA 2Y7FA 4JDYA 4HNTA 3BLEA 1VPXA 5CPMA 1GT8A 4O53A 1OK6A 3PSVA 1DJNA 2QDGA 4JNMA 4L4MA 3PR2A 2ZRWA 1AW5A 2Q8LA 3S42A 1ICSA 3SI9A 3PS7A 4LVGA 4Z1AA 3L0NA 4N9EA 1HO1A 4FO4A 5KSWA 1MEWA 3NOEA 1TRDA 3S8HA 3B8DA 4R53A 5H91A 2VENA 4UCGA 3ZS4A 3UY7A 1W5OA 2VFFA 4Y6GA 4OQVA 4Y96A 1N8FA 2VEPA 4TMBA 1IF2A 1JRBA 4ZQPA 3ABOA 2CZEA 5E0KA 2E5CA 1JCYA 3TK7A 1RZMA 3C52A 1DQWA 1FQ0A 4W9TA 4X2RA 3QC3A 4ZMGA 3EWYA 3W1UA 3W7OA 3CPRA 4O4WA 3W7IA 3UQNA 1CW2A 1GJPA 1JJKA 3NQFA 3O63A 1LDCA 3M41A 1OFOA 1EEPA 2C3ZA 5AC8A 3NPUA 1OHLA 2BXVA 2FJKA 1TRIA 1KM3A 5AHNA 4PA8A 1Z42A 1SZEA 5EPDA 1H1ZA 5G5IA 5HJLA 1SFJA 1HG3A 5CPOA 1SPQA 2DZSA 4BWLC 4IPIA 4LC6A 3PF3A 3QYQA 3W23A 3O06A 4NZFA 2E77A 3UWVA 3IGXA 3GX9A 4NVTA 5HUOA 3NDOA 3L5AA 4LVBA 1B4EA 4M7SA 3C3NA 3TA6A 2GQ8A 4JYEA 3G8RA 3VFLA 3VNDA 5J5DA 4QNEA 1H7NA 2Z2UA 4FF7A 2NWRA 3DBPA 4NT0A 3HGJA 3FJLA 4QSHA 2WSRA 4E38A 5DY2A 3NM1A 3W7QA 4IXXA 1BWKA 4UTWA 1J4EA 6TIMA 1KLZA 1LOSA 2ZYFA 3FKKA 1H62A 3MWAA 4FB7A 2FDSA 4LUJA 3SY5A 4XQ6A 3G0XA 3MHFA 2H90A 2ISSA 1SW7A 4MIMA 4MZ1A 4JTJA 1OFRA 4TO8A 1QDSA 2QKFA 3LTYA 3EX3A 4IQLA 4O17A 1WX0A 2X1SA 5E93A 2XN1A 3SFKA 1YXCA 3LRKA 1LM1A 3QFEA 3HG4A 3TR2A 2YXGA 3UPWA 1D3HA 3BARA 2BX7A 1LOQA 2Z6JA 2YDAA 2QF7A 3DHFA 2QCMA 3W73A 3MI2A 4K36A 4LWWA 1GWJA 3GZ3A 3QW4B 3PSWA 4AHPA 5CSRA 3GYEA 1I2PA 3SJ3A 1EP3A 4HPJA 4MFDA 1TCDA 2C16A 3EX2A 3R89A 4OBTA 4GXMA 1PVNA 3NXFA 4E0CA 1GOXA 4QITA 4MVAA 3KOFA 3TW7A 5F4SA 1SW0A 1KTBA 3G8EA 1GTEA 3MO7A 5D33A 1EP1A 4KFNA 3NVTA 4NUWA 3SIZA 2QCDA 1PHWA 3LDVA 2X1UA 4BK9A 2V82A 1NFBA 3QJAA 4Y90A 3IIXA 4CCEA 3U6WA 3CB8A 1VHNA 2I14A 1TTPA 2FQIA 2E6DA 3PUEA 1XDMA 4FXRA 3FFSA 2FB2A 3G1DA 1XUUA 1XBYA 3ATZA 1JVNA 4XKYB 4JY8A 4O1CA 4Z08A 4MY1A 3L2IA
chains in the Genus database with same CATH superfamily
2OYKA 1OJXA 4YXGA 2E09A 3EX1A 3K4WA 3WIJA 3HF3A 3G1VA 4IQJA 2ZRVA 3K1DA 1AH0A 3GC4A 3THAA 3IIVA 4AWSA 4RDYA 4AF0B 1FHDA 2FKPA 4XWUA 5CSSA 5IDIA 1TJ2A 1QMLA 3TROA 2PDIA 5JXQA 1JQVA 4UOQA 2J6VA 3MYOA 3B0UX 4M80A 2CZ5A 4RXGA 2OSXA 1RY8A 1BRLB 1H50A 2ADAA 3W7DA 1MYRA 3W6YA 3UNTA 1K03A 2WBKA 4Z2HA 5ABEA 3VMPA 3AMKA 4DBDA 1GK8A 4DO5A 5HWMA 3VM7A 5CG7A 1H7OA 3HGRA 4MKVA 1P7TA 1YTDA 2ZFAA 1OFEA 2QV5A 3CWOX 3QPYA 1HXJA 1JFHA 4R34A 2WVVB 3OHMB 2YCEA 1ME7A 2CLLA 4CCCA 1HJXA 1R9XA 3GW0A 1B9ZA 3WF2A 3EX6A 3FYPA 3S6OA 4K8EA 3VZXA 3MSRA 3O8AA 1OC6A 4O1EA 4UTHA 2VEGA 2CZFA 2CLIA 3N4AA 3E74A 1J11A 2E7FA 4V15A 4JTUA 4UFIA 1C8XA 1M5WA 3CEUA 3TWBA 1R5YA 1S2AA 4E5TA 3RCYA 3VKDA 3WNPA 1ZLPA 3HV9A 2CBVA 5BU9A 4PL1A 3U8GA 1TZ9A 1IV8A 1FH8A 4HMNA 1W3NA 1O5QA 4IISA 3COTA 3TTEA 3TJ4A 1T5AA 1ZCOA 3M5XA 4ZXOA 3TW6A 3QQWA 1Q4WA 4GH3A 3P60A 4NI3A 1OCBA 1W3TA 5C54A 3WLSA 5AC6A 1RY0A 5CG0A 3B9AA 1EJUC 1UWTA 1YW1A 2NXGA 2FLIA 2QXWA 3RPMA 3TJXA 4KPLA 3U5UA 3MKVA 2PWUA 4AUBA 2ZICA 4RE4A 3WQ4A 4GLEA 1EBHA 4FP1A 3B9NA 3VKKA 1ML1A 1NH6A 1EEXA 3RM9A 3VD7A 3WLTA 2CYGA 2YW3A 4QFUA 4AX7A 2ZXAA 1U1JA 2QIWA 1HQTA 2VYOA 3XIMA 3DCPA 1UC4A 1YX1A 3HJZA 2J9XA 3M4HA 3ID7A 1JUEA 2ZZ5A 1VH7A 1XF0A 2DJXA 2XZ7A 3SBFA 3K30A 1FDYA 2INFA 4YHEA 5AVNA 1YEYA 2XN2A 1TKKA 3FXGA 4ZB2A 3NO1A 3SCQA 3FV9A 1S2CA 2HE5A 3B4UA 4LYQA 4KT2A 1J0ZA 4GZ7A 1W9UA 5A5WA 1E3XA 1UMLA 3PNUA 3T55A 2ZX7A 2OR2A 5K2ZA 3VD3A 4HHHA 2ODOA 4JTLA 5EMLA 5FJJA 3MP3A 1F61A 4O1FA 5D9OA 5D37A 3EDEA 7ODCA 4J35A 3O15A 2HE8A 1JD9A 2P5NA 4MFEA 3GKFA 5AYIA 1BVNP 4GK8A 4K1GA 2ZC1A 4DJEC 1MDLA 3R6IA 3CEPA 1E51A 3S1VA 1TSIA 3DN5A 2IKGA 3FIGA 3WENA 1DJXA 1ZB5A 3QF0A 3AHVA 3TLLA 2QCDB 1ONXA 1S5MA 3WLKX 4JQAA 4S38A 2JBMA 1LYXA 3F2CA 2YW4A 4AZ7A 3SADA 2AKMA 1P5BA 1TPVA 1DL3A 1XIMA 5G4EA 4PUKA 3TWAA 1X1NA 3LHVA 3UZXA 2J6XA 5AYZA 3MZ2A 3DYMA 3OVRA 1J6PA 4FXFA 4ZQNA 1OIMA 1GTHA 1WUFA 4A21A 1TG7A 4XUYA 4LX4A 4DNHA 1O95A 5AZ1A 4ADTA 1R7OA 2AGKA 4EPDC 2I57A 1CGTA 3G1FA 4AQLA 4TU1A 3D47A 1XLLA 1TPC1 1ZJAA 4DRSA 1PIGA 3BLKA 4GI8A 3I65A 2XWEA 3WEOA 3ARYA 2GUUA 1VRDA 3EB4A 2ZZ6A 2JFEX 3F5LA 4JD4A 1FWCC 2PZNA 2VOMA 1EOMA 4KWWA 1JNEA 1IT8A 4O0ZA 4PMOA 1MQQA 4W93A 3M0KA 1J0KA 1HF6A 1QASA 3ITGA 4LF2A 4HK6A 1CXIA 2GJXA 1M68A 1Y7VA 3URAA 5PTDA 3GDLA 5F1VA 2NQ9A 3GBDA 5I09A 2ATSA 5AN7A 5HQMA 3KDNA 4M51A 4GNKB 1XYZA 4ORIA 1W56A 1GQNA 3A9IA 1DPMA 1XLAA 4C5YA 2NXHA 2OZ0A 3TTQA 2DFAA 1ODUA 5HQLA 3T9PA 3CHDA 4R85A 1X1OA 1PE1A 4HBKA 2YFNA 3WK3A 4C90A 2GJPA 1TMHA 1MW0A 2A3CA 2ZCGA 2BHUA 1WA3A 4GJJA 1ONWA 1TMLA 4H2HA 5CC7A 4DNMA 4U3CA 1WB0A 3VNYA 1DXFA 1WKYA 5I79A 5E0CA 3B05A 4CQ8A 2QEZA 5FAJA 2PGRA 1ME9A 3W7KA 3KZPA 3RM8A 3W71A 4GC3A 1MNZA 1PYFA 3LLXA 3RX2A 5JIPA 3F1QA 2WJZA 1EQCA 4H6EA 4JIEA 5GPRA 3NCOA 5CPLA 1KFJA 4HCHA 1FCUA 3C2YA 2EXOA 3TN5A 3TW9A 1EPVA 1V3IA 2WSQA 2VFIA 1NSJA 3AYRA 3WLRA 1XG4A 2XU2A 3WDPP 3VNKA 4F4RA 1GEHA 4UQ9A 2XGZA 3UF9A 3AHZA 1XYBA 4M6UA 1QAPA 1AW2A 1HO4A 3KWXA 3R7MA 2NSOA 2WNZA 2VRQA 4UR7A 4LS1A 2GK1B 2J74A 1ECEA 1E40A 3P8JA 4HVXA 1EJVC 4JTQA 5D02A 1S38A 1GG1A 4E4UA 3G24A 4QLJA 1CXEA 2GDQA 1XLDA 1NTHA 2YB1A 5CXPA 3H8AA 1C92A 4G1KA 4PBGA 3FAWA 3DFPA 5AYXA 1Q7MA 2Y88A 4JTGA 3RILA 1C3FA 3NXLA 1ZALA 1MXDA 2OGJA 1C7TA 1D3GA 1V3JA 3R0KA 2YL8A 1UBPC 2DZUA 1UUMA 2CW6A 1T99A 1ZBWA 2I1OA 2D24A 3CM4A 3RX4A 4XBSA 1UC5A 1RBOB 5L6UA 2VWSA 5CZSA 1QJWA 4AY8A 3ELFA 4ZE4A 3MHUA 1WDDA 1H2JA 4BWLA 3VC6A 1LLOA 1C7SA 3GG1A 4LBSA 4W88A 4ICMA 2Y85A 1PDYA 3MUXA 1OBAA 2G97A 5M2FX 5K9CA 2WKJA 1R3QA 3JUGA 5BXSA 3DHUA 4PR4A 2WLYA 1G1YA 2NVAA 3TV8A 4TMCA 1RVGA 1KB3A 2Z26A 1VEPA 4Q4KA 1TZ7A 1UH2A 4WLCA 2KZHA 3DFNA 5GJPA 3MT1A 2ZOXA 2PTWA 4CN4A 3UA3A 4H8NA 4UOJA 2GVEA 4NX0A 2HJPA 5HAOA 4HZMA 1K9TA 4O1AA 3JRKA 1HKJA 2FTWA 4NZCA 4X9SA 4EOUA 4F40A 4P2VA 1K02A 4C5ZA 4PCTA 3G0UA 5E0FA 2VTFA 4KFOA 1E4MM 1E15A 2PDHA 4JIHA 1BXNA 3BO9A 1PEZA 4H19A 4AD3A 4Y2WA 1DXEA 1TFVA 2CBIA 3O0FA 4D1JA 3PPFA 4OBRA 3MI6A 4M81A 1KCXA 2VC5A 3WUFA 3G1HA 1JGMA 3A6OA 4KERA 4CN6A 1EGVA 3A3HA 3AU6A 1XL9A 1NDVA 5LGXA 1OINA 3P93A 1QI3A 1DIKA 1KTNA 4MLJA 2X0SA 3O0KA 1W5PA 4LVFA 4Z42C 1VBRA 1AK5A 5D2WA 1B31A 1KKRA 2VKZG 3RN6A 8XIMA 4DY1A 5LKYA 1S1PA 1RK5A 3H7VA 5TQLA 2V5KA 4Q8QA 3VTRA 1M04A 1UR4A 4QAIA 1PIIA 3UETA 1UROA 3E12A 3JW7A 5B7YA 4JDBA 1JPKA 1E55A 3RK8A 3E5PA 2PWDA 5MKGA 4WVXA 3ZOAA 4O0KA 3EDKA 3IGUA 1OGBA 1B54A 2EPHA 5HMSA 4F8XA 3BK0A 4Z1CA 4XKMA 3CPUA 1O68A 2PSNA 4EP8C 4I7VA 5XIMA 1MW2A 1D8WA 7TIMA 1QPRA 4DQWA 3GXDA 4AZCB 2E25A 2WC3A 1DE6A 3VIIA 1O5RA 1WZKA 4AYSA 3GTHA 3C2VA 3A24A 4ZQOA 4HNOA 1KM4A 5EL1A 5FJUA 2NLYA 4LU0A 3ZWTA 2CKRA 2WV8A 3I10A 4ZQRA 3QW3A 1HL2A 1GQIA 2BGNE 4MNJA 4A3UA 3R43A 4LBUA 3KCLA 5BRBA 4UMCA 4FX6M 4P61A 4ERGA 4FIRA 5A8NA 4MAVA 1XIIA 3OW1A 4C6PA 4KGLA 4DM1A 3N29A 2GGEA 4A29A 1UR2A 2QF8A 3CL7A 2DEPA 3GNPA 2W66A 3CTTA 4NAFA 1R87A 2Z1XA 4IG2B 2VI0A 4QE1A 4PRWA 1PTAA 3WK2A 1AVAA 1TWDA 1VF8A 2FIQA 1B0IA 1OYBA 5T9BG 1ITUA 1OYCA 4CD6A 1KV8A 2DH3A 3QHOA 3STEA 1VIZA 2PODA 4E8DA 1TV8A 1P0KA 1U22A 4DEFA 3CHCA 4EANA 7PTDA 4A3QA 4MM1A 1K9DA 3KBMA 1NWRA 3OLEA 1DWGM 5LHFA 2XDFA 4AIBA 4I5RA 2P3EA 6XIAA 4JTIA 4GIRA 1AQHA 4GY7A 1RBLA 2CLMA 3W1MA 1PUDA 3WSUA 2E6YA 3ZT6A 1FUYA 2X1TA 2E68A 3R8RA 1E6SM 2ZUWA 4IWWA 3NAVA 4FALA 4TOQA 3EKGA 3UJSA 2PP3A 1G4EA 1S2TA 5JU6A 4QBXA 3IVTA 2PWFA 4AMCA 4FX8A 3BOFA 1Q6EA 2XFRA 3GB6A 3POCA 4CNTA 2YSWA 3GS6A 4FSAA 3REQA 4NXKA 5KTLA 3AI0A 1KBBA 4M1RA 1OABA 2DY3A 1KFWA 1V8EA 2Y5JA 3ONCA 2OG9A 4WXZA 4AVFA 4V1XA 1MQPA 5FEXA 1MVYA 3AYTA 4ROPA 2V69A 4NZ4A 2QUNA 2WWDA 1ADSA 1W3HA 1NQKA 2VEIA 4DJFD 3NDYA 3SSJA 2G4JA 1UH4A 2X30A 1WDPA 1XBVA 2GVJA 3GSMA 3PJXA 4NRRA 4XZWA 1R3RA 3CL8A 2BB0A 2J27A 5F2GA 1HJVA 3JVAA 5DY3A 1MWOA 1Z8AA 4QDWA 4ASTA 2WM1A 1V7AA 1X6NA 2P3ZA 4FNSA 4HMEA 4YVXA 1XIBA 2WAGA 2BHYA 2ZTJA 1FX6A 4CQ9A 1FWSA 1QWKA 2QCGA 4GY1A 3W81A 3VNZA 4XZHA 1Y5XA 2OX1A 1CLXA 5CC3A 3EB3A 4ZO9A 3NSMA 4FXJA 5CEWA 5CPSA 4NNCA 2UY4A 4Z2KA 2DDXA 4N4QA 4NG3A 2XVLA 1BD0A 1JGIA 1XIHA 5DN1A 1LP6A 1H61A 1T8XA 2A1YA 3MBFA 2E9BA 4RKAA 2FZMA 1M6JA 5I02A 4GIAA 3G1AA 4B3ZA 3W1TA 4O19A 2V81A 4NJKA 3T0TA 2ZVRA 4B92A 1POKA 1E43A 1BEUA 1DV7A 4ECLA 3ZSTA 1S5VA 4QEEA 1N82A 4V28A 4NYYA 3N9RA 3WNOA 3GU2A 2YA1A 4XZIA 1OVDA 3BSMA 5EMKA 2W6RA 3AS1A 3CV2A 1WDWA 3E2QA 3ZJ8A 3PBGA 4JNYA 1WAUA 1YXDA 2OLHA 3ES7A 4V1YA 1V3HA 4ALDA 2V5LA 3WQVA 4GGBA 2Z1KA 4MB3A 1WYIA 3MY9A 1CECA 2B0MA 3GE7A 2E6FA 2XISA 2Y70A 3WBWA 3KRBA 1E1CB 3B8IA 2ZXBA 4PE8A 5JH1A 2HDJA 3DERA 1JZ3A 1W0MA 2EF9A 1CXFA 4DO6A 2YDRA 3KOYA 3EDDA 1M7OA 2V68A 5XINA 3CHEA 3C0JA 4JL1A 3OEXA 3ALGA 1F5ZA 1YKWA 4IXHA 1XFBA 1OFDA 1TTQA 3B40A 1POJA 2J7FA 3VDHA 3BANA 4GYJA 2E9MA 1TELA 1SW3A 3P74A 7ENLA 4D2JA 4TIMA 3UPBA 3ERPA 4HNUA 2FGLA 1SJDA 3KL5A 4PRTA 2GOUA 3SURA 4I7UA 1FWHC 4DBWA 1K6AA 4XZMX 1PTDA 1R9YA 2FVLA 3VD4A 2EG7A 3RMJA 3TSMA 4CCZA 5EMUA 3V7PA 2QUVA 1S5WA 2E40A 1ZRQA 3UG3A 2YLAA 4N9DA 3GNXA 4DJFA 2WMGA 5LYRA 1QK2A 3GU9A 2GVGA 1BLIA 2EHHA 3RNDA 4O15A 1BSLA 1MXGA 5I3DA 4FPSA 4GNJA 3LHZA 1L6YA 4POCA 3N4EA 5JBEA 4WY0B 1V3LA 3U2OA 2BS9A 2V8ZA 3RJXA 3PM6A 1YIXA 5D8ZA 2GGIA 1VYPX 1F3XA 4IJCA 3PG8A 2BTMA 5SWUA 1DJGA 3GC2A 4ML4A 3N34A 5K9XA 1E1EA 2QJHA 2A3AA 4D6JA 2ASHA 3NQCA 3PZOA 3B9OA 3W1PA 1UR0A 2AQVA 1OX4B 1ZENA 3FJNA 5CC5A 1Z41A 2XPKA 3UFYA 3RG6A 3BICA 3W7MA 2XFYA 2I17A 3F4WA 1X7FA 2XJ7A 3O6AA 1P43A 4KQNA 4FNRA 3CO8A 2C91A 4JKKA 3BDKA 4LS0A 3R13A 2F6XA 4H8HA 1AJ0A 4KKXA 3SCVA 1RCOB 3MYPA 4CVWA 4PEKA 3S83A 5HJYA 1FP9A 3INPA 2Y0FA 1XSKA 1EUNA 3LUTA 4QJ5B 1XYMA 3Q65A 3P7YA 1UZ4A 3VNIA 2QVHA 3WNMA 5CBBA 3TC6A 4A8LA 4DO7A 3EAUA 1XP3A 2KAUC 3KTXA 1Q85A 4LNCA 3T0AA 4PMYA 3CAQA 3HO8A 4GO9A 3AIRA 3W1XA 1JR1A 1MZHA 1Z48A 3BLLA 4GBUA 3UERA 4DUOA 4B4FA 4QE4A 2J7EA 3USBA 3WQGA 4JBRA 5DMLA 2WOQA 5A6JA 3RCNA 3P5YA 3TOYA 4KCTA 2HV5A 4KIEA 3F4VA 5A8GA 1QK0A 1JUBA 1XCFA 4LC8A 4LEQA 2B31A 4NP7A 3LPPA 3SUWA 1OK4A 2GDUA 2YJQA 1KNWA 4DZAA 1XKJA 4X63A 2EKCA 1O4UA 3WQDA 1OFAA 4M0XA 1IT7A 4L6OA 2J66A 1H7WA 5E6ZA 4DPQA 1I8JA 4TX9A 1ZAJA 2PE4A 2A7PA 2P53A 4EAMA 4GI6A 4MJ4A 4UBPC 4Q8VA 1QATA 3THDA 3CUJA 1V6TA 5HNNA 2R9RA 2CHOA 2W3ZA 1UIPA 3P84A 2WVUA 4WEVX 1DP0A 2RKXA 4M7TA 2XFFA 5KITA 3OA3A 4YL2A 1OCNA 1EL3A 1HW6A 1WCGA 4UNLA 1VBUA 1YDYA 3KM8A 4LVDA 1ODZA 2ZC8A 4KCVA 2RJHA 3WMSA 4GRSA 1Q7ZA 4LUTA 4B5NA 4XO7A 5IFTA 3DUGA 3UY8A 1IEIA 3STCA 2NX1A 4N7QA 5CAHA 1O5XA 5LXXA 4QM1A 1LWJA 4UQEA 4GA8A 4IUOA 5M3WA 4INFA 3LOTA 1NFGA 4GBDA 4V27A 4DPPA 2C1GA 1R9ZA 1DWIM 1W1TA 2DH2A 1TR9A 3IRSA 2BVYA 2QUMA 4KCWA 1M01A 2OQLA 4PB4A 1R8LA 3F4CA 1S1RA 2W0UA 3VE7A 3TAOA 4YCPA 1I1XA 3M07A 4CNSA 1LUCA 1XLCA 5T8GA 4XTDA 2GOKA 2G95A 1E71M 4HYVA 4WY0F 1DWJM 1XH2A 2W79A 1ITXA 3WH6A 4KWVA 1NM9A 3W6LA 4OJYA 5TIMA 3OBAA 5AHEA 5D30A 2F7FA 1QW9A 3L68A 3UZZA 4C65A 3NQGA 3CUGA 2H9AA 3GWQA 3M16A 3NSXA 3RFAA 3QLDA 2NQJA 3MDWA 5LZLA 3OZYA 1XH0A 3H2EA 2QJGA 4ZVJA 3AMDA 3FAXA 3JZUA 3GVQA 4L5ZA 4NF7A 4AVOA 3UG4A 4DWSC 2L5HA 3VGEA 4YS1A 1PZ3A 5FEWA 3E2SA 4P8WA 1FP8A 1H7XA 1VCVA 4PMDA 1VBJA 4LB3A 3FXYA 5DO8A 4PCFA 4HOWA 4LYRA 1JZ6A 3QSRA 4HQVA 1GKQA 1RJPA 4F0RA 4WF7A 4O28A 2ZTKA 1JYNA 4WSKA 2CXGA 4AF0A 3MP5A 1E56A 3QFWA 1VJIA 3HPAA 3PY2A 4M29A 4QQUA 4Y9NA 4O8AA 1BRLA 3BSHA 3HPXA 4FEZA 2GDVA 1XRTA 3QR1A 1AL8A 2Y5SA 3W2LA 5CPQA 3TN4A 3KBSA 1SZNA 4HSOA 2NW0A 1AZ1A 3DH7A 3SGZA 2VUNA 1EXPA 4FF5A 2QHAA 1G9HA 4UQCA 1X7IA 1XISA 2BWGA 3VIFA 4Q4PA 2J79A 4EIVA 1K8YA 1QPOA 2BVDA 1NP0A 2WVVA 1TZZA 2AMXA 3TE9A 4GCAA 3D3AA 2WPGA 3UGRA 4EKJA 4PZVA 3LQGA 1ISWA 4HNTA 1GVIA 4HPNA 3AIEA 3N6JA 1DJNA 2HBXA 1RK6A 1UKQA 3A3XA 1REQA 3SI9A 1RALA 4Z1AA 4LAUA 1HO1A 1R7AA 3B8DA 5H91A 5CQ1A 4QAWA 3MVTA 2VENA 4HTYA 2IPWA 3UY7A 1W5OA 4Y96A 3OG2A 1N8FA 2IPGA 3R25A 3O9NA 4GVIA 2PMQA 1A49A 2CZEA 2XVKA 2E5CA 1JCYA 1WXZA 4GZIA 1UJQA 3TK7A 1RZMA 2HWGA 1DQWA 5LIYX 4X2RA 2F2HA 1XCWA 4Z17A 3CQHA 1CW2A 1GJPA 3EOEA 1SMDA 1PBGA 4P7LA 4PSRA 1HKMA 4MKSA 4PUWA 3CH0A 1EEPA 5AC8A 1QOXA 4DAFA 4PA8A 1Z42A 5G5IA 3UVIA 5HJLA 2Q02A 3UXKA 1MW3A 3I3EA 2DZSA 4IPIA 3KS5A 4LC6A 4AW7A 2E77A 3LD5A 3UWVA 3GX9A 4NVTA 3L5AA 3LSCA 1KXQA 4XD3A 3TA6A 1DXIA 1GHRA 2X7WA 3G8RA 3VFLA 4YYCA 3VNDA 3ZT7A 3L4UA 4YN5A 3VNMA 3TEVA 2POZA 3VIKA 2GGHA 1OC5A 2CPUA 1EJTC 3FX4A 1TWSA 3MWAA 3S5SA 3WLJA 2FDSA 1CB2A 3QPEA 2HBVA 3WDRA 2H90A 3ARQA 4AC7C 3S2NA 4PUJA 2X7VA 2VMFA 4IQLA 4O17A 1WX0A 3SFWA 1CGWA 3E0WA 1KGWA 1ADDA 2YKKA 4P8VA 3QYSA 2QJMA 1W1A1 2BX7A 2J8TA 4Y7EA 4XAFA 4LWWA 1UR8A 4C6CA 3RLGA 1JDAA 4IGMA 3GYEA 2WMHA 1EP3A 4HPJA 4MFDA 1TCDA 1AZ2A 5HJXA 3R89A 4MWAB 2PDQA 5CJMA 3WMCA 3EZ4A 1RVKA 3TW7A 4AWEA 5HOSA 3BLPX 4DUXA 1XC6A 1L8NA 1S2UA 2YZ5A 1RXOB 5I00A 1X97A 4B5XA 3NVTA 2QCDA 1PHWA 4YIWA 4L9ZA 4HU3A 1NFBA 1NDWA 2V63A 3IIXA 3UXLA 1VHNA 1LT8A 1DJYA 2W67A 2HROA 5CLWA 3I6TA 2HVNA 3PUEA 2FB2A 1HJWA 3H12A 4ZA0A 1U1UA 1XBYA 3UJEA 4GKTA 5C71A 4Z08A 4MY1A 5A2BA 1UHVA 3H24A 3TYEA 5BWAA 3FHAA 1JPIA 3EOLA 1P4CA 5ABFB 2XSAA 1W17A 3TZNA 1CNVA 5DBTA 3BZJA 2H8XA 2D2HA 2PCQA 4H00A 3BE7A 2VGBA 1FCBA 1VS1A 2VP8A 3PTKA 3EWBX 4UTLA 4PMQA 4HCLA 3A4XA 4S2CA 3NZQA 3NQVA 3LHUA 1V08A 1VLIA 2VJXA 2OGYA 4GQBA 4Q8UA 3CUZA 4PCPA 5JUVA 3B8TA 2NZLA 5I3KA 2VX6A 3A5FA 3ES8A 3K8KA 1Q65A 1R0MA 2IMRA 3UNDA 2H8ZA 1ZSXA 3RO8A 2QJNA 2XH7A 4TUFA 1E9ZB 3VUSA 4AHQA 3C56A 5C7VA 1R46A 3C0QA 2X2GA 3N18A 2GJXB 1UWRA 3QH2A 1Q6GA 4HA0A 1MI3A 2C0HA 1Q6FA 1F4AA 3C4UA 4LY8A 2CBUA 2QDHA 4C6KA 2FTPA 3H4WA 4BQ4A 4NZ1A 5HQEA 4JTDA 5D4YA 3L2MA 3DHDA 1L2QA 1IZCA 4NKCA 4ATDA 2PDXA 5C55A 2Z2BA 4L6HA 1PKNA 1P6BA 3LLFA 1Q6CA 4ZB0A 5HR6A 3GXIA 3HQOA 4U31A 3TU9A 5BOOA 1L6GA 1BVZA 4PUEA 3ABRA 1IHIA 3T78A 1LBLA 4WDUA 2IKJA 1E0WA 3U7BA 5DRCA 4XZLX 1DJWA 2RGMA 2VCCA 5GNYA 2GGJA 2RDWA 2NUYA 1QXLA 3DC0A 1ZBVA 4KWUA 4GVHA 3C2RA 3WEZA 3FS2A 3B0XA 1VYSX 4Q8MA 5IHSA 4BEQA 3GIQA 1TVLA 1CXLA 4OFCA 5HDRA 2EG8A 5CKSA 1UCWA 2F6KA 4M5PA 2OOFA 4G5DA 2X41A 2ZA2A 1IYXA 4IL2A 4IIFA 3PN8A 3M0VA 4UTTC 5BOFA 3LB0A 3WLHA 2YCIX 5A3HA 1BF2A 1E6RA 1HKIA 4XD5A 1UBSA 3LTPA 3T8QA 2I16A 3EEZA 2GK1A 3LCLA 3DU0A 3NPWA 3OB8A 1W5NA 3WF4A 3DOPA 3N3TA 1ITCA 2ZRZA 3APGA 4AMAA 3IIPA 3L4YA 1ZJBA 2NV2A 1KTCA 3F4NA 3U2EA 1I2OA 4JXCA 4NL1A 3W7NA 4JKMA 3SAZA 1NJJA 3CAVA 3TQVA 5FACA 4FX7A 3F2DA 3LV5A 2BASA 3KTSA 4UQDA 3QN3A 1YNYA 4FMVA 1D7KA 3H21A 3MWCA 4CNNA 2ZXDA 4Q8OA 1JI1A 2G41A 2POTA 1GONA 4Q6JA 3AHYA 3HZ3A 4ZGYA 3GQYA 3EWCA 3SCNA 2I9EA 1RR2A 3CZEA 2DJLA 2VR2A 3CJPA 3M0LA 3P0WA 2C79A 1XIEA 3WFAA 1FWGC 2H3BA 3CT7A 1Q4NX 3DFOA 1UD8A 1NARA 1BVWA 2A21A 5FL0A 1ISYA 1MW1A 3VIOA 3WL1A 5HUPA 1IZKA 3OGRA 4A3YA 1UASA 3THUA 4XAGA 1TQXA 5A6BD 4UTTA 1VFUA 4ZZ9A 1DJHA 1J0IA 4QJ1A 1DWHM 3UG8A 2ZIDA 3VABA 2XIIA 1UP2A 5D09A 3UYCA 1GGOA 3UGVA 4PBFA 1OFQA 2OMAA 4MYAA 3U5YA 1VLWA 1XQLA 4B16A 1JAKA 2H3DA 5C2CA 3SRFA 1Q8JA 4CGTA 4W8LA 1LL6A 2YGYA 4LPCA 3W86A 3IJQA 3NQ7A 3WFZA 3H22A 2ZE3A 4GXPA 3DFTA 1FDZA 2G5WA 3S6DA 3PG9A 1JI2A 2VQUA 2Q71A 3M44A 4UTKA 3ITVA 2XINA 2PBGA 3LERA 1QW8A 1NQ6A 4HPXA 2DIEA 2J25A 2GPTA 3GBEA 3QEZA 1KBKA 5L9FA 4P5UA 3CUFA 3W26A 4WGHA 3F7JA 6CGTA 4CNUA 4RPQA 2QNEA 4UIOA 5BMWA 1I2QA 1G01A 2WVSA 2VC9A 3V75A 3VCCA 2ZXQA 2O4MA 2W61A 5F4WA 3W02A 4ZFCA 1UPMB 3JR2A 4BQ3A 3GDMA 1N2VA 5BOEA 2QCEA 3W83A 1E6XM 2VD8A 4NX5A 4OBSA 3WNNA 3W7LA 4LVAA 3GG8A 3IJDA 4IZGA 3T2OA 1Q66A 3B8UA 3E2VA 4YTSA 3PTMA 3DHPA 1OX6A 4C6DA 3W7RA 5LIUX 2WANA 4QJ4B 3LQLA 3N12A 3VOCA 4MLRA 4D1IA 1HX0A 3EWUA 3RCMA 1TWWA 2VELA 2CBJA 1JZ7A 4ZE5A 5HULA 2WWCA 2BP1A 2P10A 3VKAA 2DUZA 4ERIA 5FF2A 1MRQA 3G3DA 3L4WA 3NZGA 1UA7A 4NILA 3RXZA 2R1PA 4U2ZA 3EKZA 2XIBA 3MA8A 1RAKA 3K13A 4AZCA 4RLIA 3H7RA 3APYA 1RV8A 5TNVA 2F6UA 4BZYA 3OGSA 2IXVA 3IUHA 4KW2A 2F8QA 1FHLA 1B90A 1QPKA 1IZJA 1EUAA 5I2UA 3MANA 3GVGA 2XGIA 1BKSA 4ZODA 2PA6A 3C86A 5FJPA 3VIPA 4ICNA 1GG0A 3I6RA 2AGTA 3AUJA 2YXOA 2Z7KA 2OXNA 3FN9A 1R3TA 4TR9A 5CAKA 3QZ6A 3ZR4A 3UW6A 5DMYA 3LHYA 1S3TC 1P1MA 4JTKA 4QQ3A 2ISVA 1XUZA 4GOAA 4FLQA 4QG8A 3VGHA 4FNUA 2FMOA 4S39A 2XWDA 3L4TA 1EBGA 2FGZA 1EP2A 4LEFA 3N9SA 4HHMA 3PTDA 5A6BA 3R5EA 4H9XA 4HMDA 4FIQA 1T6MA 4IG2A 5BRQA 5CH9A 2OYMA 3OP2A 1AL7A 1G4TA 1R3VA 1M65A 5IBXC 5FF3A 4IHCA 1YDOA 4EVZA 3TKFA 1KCKA 2HPMA 1Q6QA 2XHYA 1UKOA 1WOAA 4MWAE 2E5BA 4F0KA 1N8WA 1GORA 1XPGA 5T9CE 3ZVIA 3UXAA 3Q45A 3WBAA 4H8UA 4JICA 1JCJA 5LGZA 4K8HA 4D8LA 4AZHA 4PMJA 1EGMA 3GFYA 1PSCA 2MANA 2YR1A 3AXKA 4IIDA 1UP3A 3BQ6A 2OEKA 4IT1A 4MPKA 3RU6A 2NT1A 3S0CA 3EMQA 2J24A 3SGGA 1V0MA 3FJ4A 5ECUA 3PZNA 1KGUA 4R33A 1UWSA 2EPKX 1G7VA 1US2A 3PUGA 2VFDA 1KWGA 1I2NA 3FDGA 2IXUA 1RLDA 1PX8A 3VINA 3CZJA 4MUPA 2PTYA 3BCJA 3NM3A 3POHA 3L0KA 1FWJC 3AJ7A 2DVTA 3S2CA 1H7PA 2VZSA 4IX0A 1FXQA 3NL3A 4AZ5A 4F0LA 2VVSA 2ZVIA 2WZIA 3I3BA 3P81A 4R7JA 1W1ZA 1QNRA 2RGLA 4AISA 1BYDA 3C0LA 3CT2A 4RNIA 2VCAA 1GYNA 1XLJA 4A8IA 1QNOA 2WCSA 1OGSA 5AFDA 3GYCA 4YTRA 3XINA 1PKLA 2YFOA 2XVNA 2ZUNA 1VFMA 4AG0A 1TREA 3WLIA 3H2FA 1VFSA 1XG3A 3A23A 2YYTA 2PI6A 4EPBC 2PAJA 1XYAA 2XN0A 3M0ZA 3S1UA 1ZAIA 3NZ1A 2FZ8A 4OECA 4KEVA 3VOGA 2ZRYA 1QPNA 2B7OA 1XI3A 4EF8A 1U5JA 3T1GA 3ICJA 2YBTA 3GXTA 4GZJA 3RDKA 1EJRC 2X09A 3SUUA 4ZTXA 3S9IA 3TSDA 4NJHA 4XAZA 3W1AA 4B5UA 1C8VA 4M3PA 3SN1A 3APTA 3DGBA 2DZAA 1OF8A 3S46A 4XD4A 3CXOA 4OE7A 3V18A 3QBUA 2WPBA 1UUOA 5TF0A 1J96A 1A3XA 3AZTA 3IJIA 3IGHX 4OUEA 1J12A 4GI9A 4WGXA 4L1GA 5A6AA 2TSYA 4K8GA 1GVSA 4DF2A 1CB7B 1EJ7L 1OG6A 4ERAA 3TC3A 1L6WA 2J4GA 3M0MA 3CZGA 3L4ZA 3WZ0E 4YLWA 3GNOA 5LNWA 1MMFA 3E6EA 4U28A 4Q4OA 4KWOA 4QISA 1U2YA 5AECA 1RP8A 1K7FA 1PZ1A 4AB4A 1WOBA 1E72M 3AXXA 5DRIA 4QSFA 5I3JA 1XW8A 4MMWA 3NQ2A 2ACSA 2X0YA 1A4MA 1WUEA 1QBAA 4B3LA 5XIAA 2RFGA 2O92A 3EPOA 4A3HA 1A5SA 3H4GA 4RCXA 1E1CA 5K7JA 3GD6A 3NR0A 2DW6A 3GDRA 3KE0A 1GOQA 2CLOA 1OY0A 2ON3A 2OO6A 3NEHA 7REQB 1UPPA 1B3XA 2R1MA 2YLLA 1FVPA 1CENA 3K4DA 2KX9A 5I5RA 1ZL1A 1NWUA 5F1UA 3PUDA 4GKLA 3WUGA 2WYSA 3DG6A 5I3IA 4DAIA 3EXSA 2XSBA 4RDWA 3NGJA 2QCNA 3JZEA 1US3A 4G7EA 2DSUA 1XLKA 4Q33A 1XYFA 3SW6A 3OVPA 3TTSA 3W85A 4CKQA 1XHGA 2QULA 1XBXA 5HBFA 3SCOA 3BWWA 4NIRA 2WBGA 3B4YA 3SJNA 3EXRA 2B7PA 4IFKB 4R7WA 3RLUA 3AYSA 3WBYA 1DHKA 5FA5A 2ACUA 2PU1A 1Z7AA 2EPNA 4RZ5A 3S47A 4WY0A 4QS6A 4AD0A 5A8QA 4HB7A 2J75A 5A6SA 1EJXC 2CZVA 3TXZA 3ZLGA 4ZCWA 3B8WA 4I3GA 1W9DM 4IMAA 3HJEA 5LIWX 3EWZA 3GNDA 2UY5A 1TCMA 3AJXA 3WJWA 1VRXA 1OX4A 2X05A 3VNLA 3TOPA 2OSWA 1KRMA 3G1SA 4XISA 4AIOA 3UR7A 3CUHA 3B0PA 5C7HA 3OPSA 2R1KA 2PWVA 1RSCA 2NXIA 4X9YA 3ZR6A 3UBPC 3QMTA 1YPFA 1SO6A 3E3HA 4LT9A 2FZ9A 1J0HA 4JCMA 3B0YA 2CITA 2CWNA 4MSSA 1BYCA 2NSXA 2CCRA 4W7WA 1CBGA 4HA3A 8XIAA 3EOSA 3MKCA 4B2DD 2PTZA 2FVKA 2XIOA 4XSLA 1VEOA 3ZYZA 2Q01A 2AKZA 4JTAA 3LCGA 1IXOA 1V7YA 4UR9A 3TNBA 2OO0A 3M0JA 3U7VA 1IGSA 4NRSA 3H70A 4PUUA 5G1YA 5D9MA 3MSYA 4DJDD 4IQEA 1LRQA 2X1RA 2XH2A 3A5VA 2W9MA 2Y5EA 1K8ZA 3LZ5A 5DFAA 1E0UA 3S9YA 2QT3A 5ABHA 4YTQA 5U4NA 1TE6A 3TLQA 1YRRA 2AQWA 2V67A 5FEPA 2VDIA 1PZ0A 3W53A 5A69A 3NZPA 4CEUC 4MDPA 4WK9A 3VX0A 4JEJA 4BJHA 5CSYA 3N04A 3CZKA 3FEMA 4PSPA 2X42A 4UFJA 5HNTA 3SRDA 1E5NA 1TJRA 1L6SA 4QROA 3SCWA 1E6PA 3WJSA 2QJIA 4NYUA 2PDJA 3MO4A 3R10A 3W7HA 3BAWA 1H5VA 6ENLA 4DO4A 4EX4A 4PUDA 3WD3A 1R47A 5AC7A 1LQAA 4LCQA 4H9MA 4EWND 4AX6A 1RJRA 4DJDC 4IIEA 3R58A 1B30A 4L80A 3DDMA 5FJTA 3CLWA 3ONBA 3H53A 2DPEA 3TQ0A 1CEOA 3WJYA 2PLKA 1A5OC 3KFTA 3CQJA 4C6NA 1KXTA 1NOFA 2QPUA 4W5ZA 4F48A 3T2PA 4QEHA 2VWTA 1GQJA 1Q2SA 1YLVA 2DGAA 5G4WA 3KRZA 4MNLA 4LUIA 1VB9A 3D0CA 1T40A 2YL6A 5C8BB 2HMCA 3MC5A 3W7PA 1TUXA 3OQ8A 1PZ2A 1W3IA 4UR8A 1W1YA 3GW3A 4CQCA 2HPIA 3W38A 3U2CA 3WYZA 5FEZA 4JL2A 1WKFA 4A35A 2H9AB 4PMZA 4XIAA 2HSAA 3GY1A 1W32A 5BW6A 3W1LA 2NVCA 2R24A 3L23A 1XIFA 3T0DA 2AAAA 4OUIA 4LH8A 3PHAA 1RA0A 4B2DA 4QHRA 1EC7A 1N55A 3M0YA 3MPGA 3WMBA 4HU4A 1JG9A 4DJDA 3VKCA 1R30A 4GACA 4PMVA 4JN8A 3IIOA 2ANUA 3K4AA 3G2GA 1QHOA 1KRBC 3TYDA 4JR5A 4NXSA 3BV7A 3MUCA 1UH3A 5AYBA 2C13A 3DI0A 3LEPA 1JDEA 2V5DA 5A6LA 1OQFA 1RA5A 4JCLA 3W7EA 1CIUA 3R2GA 1Y8BA 3A22A 4ACZB 4BQ2A 4HK7A 1US0A 4MWAD 3SCTA 2OEMA 3SGUA 3ZZ1A 2FTYA 1HGWA 3LGEA 2EEXA 2OX4A 3N9KA 1SVDA 3TYCA 2PLCA 3B04A 4CQBA 1AH3A 2WHKA 2HTMA 4J40A 2CLFA 2YA0A 2XIJA 1E4LA 2BDQA 1HJUA 1V0LA 4LV4A 4GQRA 4LNYA 1J2BA 3CV1A 1GOMA 3DAQA 4MADA 3U3HA 1R2RA 1K7EA 3FVMA 2O0TA 5HXMA 3FSUA 1UD4A 2IKIA 2A3HA 1OCQA 4AEEA 2ZZ7A 4IP5A 3FEQA 4Q3MA 2HQAA 3BMVA 3UD6A 3BZGA 1J93A 3CC1A 5DCDA 4Z1DA 4ROQA 1M3UA 3II1A 3NSNA 1REQB 1UMYA 2ALRA 5C5YA 2HS8A 3KCJA 4WZHA 4GO8A 2EQDA 4FLSA 5EBAA 4UTJA 5FJRA 2DU2A 3MCNA 3UWZA 5MF5A 4JAWA 3MUAA 1X38A 2QGHA 3T0CA 4I9TA 4O0QA 1K3UA 1L9WA 2Y61A 2RDTA 2C15A 3UYIA 3AO0A 2O55A 6PTDA 3ENLA 3DG3A 4UCFA 1EYEA 2E4TA 1XD1A 4B4HA 2WZMA 5HNRA 1FOBA 2VNCA 1R3YA 4ZQMA 1LG1A 1LF1A 2ZZ1A 1CGYA 4L4PA 1VR6A 1ZPTA 1X1ZA 4OT7A 4HNVA 3E0IA 3LMYA 3G5EA 1ESWA 4MPQA 3WF3A 3CAWA 3WBEA 2GJLA 5EFDA 3AOFA 3ORWA 3KOZA 5CC6A 3WDQA 3N25A 4JTHA 5J8LA 3GDTA 3GDBA 3IPWA 2C19A 4FI4A 3ZXWA 3LA4A 1QI0A 4MTVA 4KFPA 4LCSA 4J2MA 3VE9A 2C14A 3DFQA 2QJJA 5HATA 2R1NA 4GUHA 3GLCA 5DT5A 3HN3A 1BF6A 3R79A 5TAOA 3HPSA 1OEPA 2PGFA 3UCDA 4Q7IA 5C9XA 3WY1A 1YNPA 3SQMA 1D7FA 4KCUA 3KBWA 2E1WA 3N2OA 2OELA 2J8GA 1BG9A 3OLIA 4JTTA 1QRQA 4Z2LA 3RPDA 1H51A 4IIBA 4S23A 3SIMA 4YVVA 5BXTA 4CD7A 4AZIA 1FCVA 3SB0A 3K2GA 2R91A 1LORA 1VFOA 3M5VA 2Y8KA 4A2RA 1OD8A 4Q8NA 4AZBA 4CVUA 2GZXA 4FK9A 4N2YA 1QO2A 5DCEA 5EMMA 1XINA 4MWAA 3URQA 1GYMA 3OVQA 3T40A 2DORA 4J2PA 4AEOA 4AWUA 4E4FA 1OGGA 1J10A 1ZUAX 1XC4A 3PTQA 3UG5A 2VC6A 3CYVA 1OD0A 4DX3A 4BS0A 5IOBA 3ZSSA 4WUIA 3VIHA 1H11A 2EGZA 4Z0JA 2V30A 4PB3A 2ZX9A 3AXIA 1R85A 3NO3A 2AQOA 3KAOA 3KBNA 4IFOA 3LS9A 4ZOBA 4RV8A 2Q8XA 1H7RA 3IANA 5A6TC 1WNOA 1VYRA 5ABFA 4F3HA 2VGFA 4UWMA 4A4AA 4G6CA 1TQJA 3I3DA 1V02A 3W9ZA 1KM1A 2FHCA 2ISFA 1E9IA 3EPNA 3A47A 3VA8A 4WKAA 1TJPA 1PYMA 1IEVA 2Z1BA 3NQ6A 3P61A 4RE3A 4WIWA 3VIMA 4EXBA 1YTKA 3I4KA 1IE7C 2XIMA 4BF9A 1KM2A 4OGZA 4QP0A 1J5TA 4FHAA 2YL5A 5HK4A 4ATLA 1QVBA 2A5HA 3PWGA 4LUYA 4LV9A 3IJ9A 3PBYA 1A0EA 4P7RA 2J78A 3P80A 3QHNA 2ACQA 4M6VA 3UA4A 4L1XA 3FDKA 4M82A 4ZR8A 3K1GA 3VMNA 5CGMA 2A6LA 3OGVA 3KX6A 3EWXA 3H6OA 1JZ5A 1FWTA 2PDMA 3TCEA 1SUXA 1BGAA 1UR3M 2O7SA 3PBMA 1EWEA 2AL1A 3I7RA 2NX9A 2EKGA 3G6MA 2GJNA 2WHLA 4H4IA 1H3GA 5F2IA 5ECVA 3BLEA 2ZUSA 5CPMA 4O53A 1LT7A 2OVLA 4JNMA 4L4MA 1UD6A 3PR2A 5M1TA 2ZRWA 3VVGA 1WXYA 1ICSA 4LVGA 2QGYA 2O9OA 2VFFA 4Y6GA 3GC5A 4FLOA 4OQVA 1YHTA 3L4XA 3VOHA 1F4HA 2YBUA 1SR0A 2P8CA 2EO7A 1XJBA 1B3VA 3R0UA 1VFLA 5E0KA 2P88A 4HZ8A 4L56A 3ITOA 4H9ZA 4ZMGA 3MKKA 1VENA 1P0DA 3W1UA 3W7OA 3CPRA 4RW3A 3W7IA 3PZTA 3ZVHA 4E2VA 1ZCCA 3O63A 4CU7A 5LA2A 3M41A 1M53A 2DIJA 2ZWZA 3FGCB 2BXVA 4IF2A 1TRIA 1KM3A 2PDLA 3PANA 1H1ZA 2J62A 5I0DA 4LXFA 1WDSA 1UWQA 1SFJA 1HG3A 4NY2A 4BWLC 4WR3A 2CWXA 3WLQA 4ENLA 1B4EA 4M7SA 3VGDA 3KS6A 3R8HA 3A3WA 4JNZA 3NJ3A 2MUCA 2OB3A 3HGJA 1LWHA 3LNPA 4LUSA 2WSRA 4E38A 5DY2A 4Q8PA 3S2MA 1NELA 1EXBA 7XIMA 4FR6A 3KLLA 1IEWA 2X0HA 1J4EA 2XM2A 6TIMA 1KLZA 1LOSA 4CD5A 5EU9A 4FB7A 4RE2A 3SY5A 3EDFA 3ZQ9A 2ISSA 4MZ1A 4TO8A 4TTUA 3FNDA 3OA5A 3WEMA 2OWCA 3SEPA 1O7AA 3T4WA 3HPFA 3TR2A 2YXGA 1I60A 4BF5A 4LFYA 4GQ0A 3BURA 2QF7A 3DHFA 2QCMA 1PWMA 4K36A 3GZ3A 1BXCA 5E5CA 1E6ZA 4UB9A 1I2PA 2DVXA 3WDIA 2E67A 2C16A 1E4IA 4KWSA 1V79A 2PDPA 1P0BA 4EPKA 4B91A 1HKKA 1PPIA 5KETA 3QC0A 3VYLA 2E8ZA 1KTBA 1JIBA 4NUWA 3SIZA 2EPMX 4OOZA 4Y90A 1IR2A 2I14A 1TTPA 2E6DA 3DEQA 4GGHA 3EMZA 4S3KA 4EK7A 3ATZA 1JVNA 2HVOA 4Q8TA 1E9LA 2UBPC 4J3XA 3L2IA 2WC4A 1FWWA 4NZJA 4HD5A 2HNHA 5F2MA 3W84A 4PMUA 4OVXA 5T26A 1JF5A 1PJ9A 2AL2B 1I6NA 5D2YA 3L12A 1UZ1A 2XZ9A 1JZ2A 1MQRA 4MB5A 4ML9A 1W3LA 3MQTA 2BVWA 3OLGA 3BW2A 3ARRA 1KKOA 4K6AA 3OQEA 3R94A 2YB4A 3HIJA 3CWHA 1TJ1A 4H2CA 1UD5A 4PH6A 1KO0A 5DXXA 1L2UA 3V35A 2VD9A 3U4FA 1F6YA 4UTFA 3FKRA 2ZUMA 3R11A 4H83A 1AUSL 1HN1A 4E8GA 2J7GA 2B7NA 4X3ZA 3BAIA 4JN6A 2ZRXA 4PL2A 3VD5A 3IWPA 4Z2JA 4GH1A 4NHVA 2IUZA 4IMCA 3LRMA 3FY1A 1PHQA 4BI7A 3ZIZA 3VXGA 5BXRA 1JULA 2EPLX 1O1HA 3W7JA 3CNYA 3ANUA 4TX6A 3PAJA 3P14A 4YMZA 1FCQA 5K4XA 3MCOA 1FWBC 3D46A 2WMJA 1J0JA 4S3EA 3R8GA 3SUTA 4AD2A 2ABBA 3LHTA 3PJWA 1F9CA 3LBOA 4KEUA 1XPYA 3C2OA 4HHLA 4MAZA 1TPH1 1H0IA 4HCDA 3TTYA 1QOQA 2GSEA 3CQIA 3HTWA 5KMYA 5LNRA 1KCLA 4TX8A 4ZOEA 1BWVA 5HWJA 2F84A 1F07A 3GFZA 1YE4A 1XLIA 3O6YX 4QGCA 3BAYA 1KA9F 4XK2A 4AXKA 1EHNA 4CU8A 1G69A 2A4AA 3VOIA 3GAYA 1FA2A 3IACA 3NQDA 3W76A 5D2TA 1T7LA 2D1ZA 3N13A 3RITA 3EYPA 2D3LA 3LCHA 5G4HC 4C1NB 1JUKA 1QO5A 2V3FA 3NG3A 2Y62A 4KRTA 2VURA 4O50A 1W31A 3KP0A 3KW3A 4OV9A 4GFIA 3H2OA 2GGGA 2PCEA 3LLDA 3THCA 2J13A 5KZDA 1C8QA 4ZOCA 4WXYA 1TPDA 3PZVA 2J8FA 1I9CB 1PKMA 4JFUA 4NU7A 2VZTA 5E6YA 2INZA 4UFHA 1R3WA 2YL9A 3UCQA 3F5KA 4RZ6A 1XXXA 3VAVA 4QLLA 2NV9A 3RRAA 1MEHA 3BC9A 1K9EA 2XSXA 1LWIA 3O3RA 1PDZA 2ZADA 3S5YA 3C5QA 2WQPA 1B3WA 2PRHA 2I9UA 4HT3A 1N7KA 2D69A 4Q8WA 2J9ZA 1WKEA 3IJ8A 1BSIA 3AXMA 3LCIA 4C6QA 4G7FA 3TONA 2PDCA 2E0PA 3LPGA 1O6IA 2CHRA 3GK0A 3ISIX 3V0SA 1XIDA 1GPFA 3G1XA 1FHVA 1TV5A 4A8RA 1AJ2A 2VT0A 1SJBA 3S1WA 3GO2A 1ONEA 1CLVA 2ESCA 3SSZA 6A3HA 3BUVA 3MVIA 3G18A 3BOXA 3IK4A 2VUYA 2CC0A 3VGGA 3W1QA 4KMQA 3U4AA 1T0OA 5HMFA 3GH7A 3BCDA 3OO2A 4ZTYA 3J7HA 1HIZA 1KFCA 4L4OA 4ZOAA 3AIQA 3B03A 5IRPA 3CS2A 4B5WA 1RP9A 2WSYA 3GR8A 3GTXA 3WH8A 2GQ9A 3B06A 2PZ0A 1JZ4A 4JHZA 5JBFA 3SR7A 3KHDA 1E70M 1RQHA 2BY3A 4GABA 3OOQA 3OODA 4WDTA 1XSJA 5BYWA 3M64A 2WLZA 1QHZA 5EKYA 1MUMA 2B7QA 2TRSA 2RAGA 4WKHA 1TPUA 3HMJG 1A4LA 5C6MA 4S1FA 4H41A 4A6GA 1VEMA 1Z6KA 2QW5A 4H7ZA 4YYFA 3SDOA 3WH9A 1MSSA 3T2QA 4AU0A 3P6LA 5BCAA 1XLEA 4IMGA 1TE1A 2O9PA 3RX3A 3GUWA 2FFIA 1EX1A 2BOFX 4K7VA 2BV9A 4JOMA 3H7UA 3UEQA 1IWAA 2OCZA 4F2UA 4I5UA 2Z00A 3BOLA 4I5XA 4GCXA 5A8OA 1VBGA 3AS3A 4H9TA 2FJUB 5GJNA 4FXSA 1S2WA 1OSEA 2FZNA 1XFCA 3UT0A 2TMDA 2Y7EA 1HFBA 2BXZA 1RBAA 4KH2A 1FXPA 2P50A 4LJ3A 3RO6A 2VEMA 1WZAA 3QVQA 1GVYA 2IS7A 4U4MA 1VIWA 1EO7A 4LRSA 2GVLA 4RPPA 3N6HA 4GFSA 4W85A 4JKLA 1C90A 4Z0SA 1HGYA 2CNCA 4UFKA 2XM1A 4PFHA 3SECA 3GR4A 1TA3B 4DJFC 2QUUA 5EY5A 1FWNA 3LPFA 3PPCA 1Z32X 2IQTA 5IDZA 1X6LA 4DZIA 4RDZA 5H8UA 1OF6A 4GNVA 4IIHA 3HOJA 1SFTA 3L0GA 1I45A 4DVOA 1AFSA 5FSDC 3DI1A 4JTEA 1TO3A 4J4KA 1N8IA 1PCWA 3AISA 1BQCA 5CPNA 3G22A 3B8VA 3MTWA 3W07A 3HGSA 2VGGA 3M9YA 4M8UA 3HQ1A 4DLMA 4Q32A 3W2JA 4RL3A 1IGWA 2D0GA 2VDHA 4X0NA 4ZO6A 3K5XA 3LU2A 1NOUA 4Y9MA 1E0TA 7REQA 3ZM8A 3GXMA 4LCRA 1ECQA 1S5TA 2WZTA 4D6DA 2BGSA 4PB5A 1ICQA 1DORA 1OZQA 4G7EB 1MDRA 4L1WA 3TMLA 3TXVA 1EIBA 1H4PA 1JNDA 3VDAA 3E0LA 3VNJA 4K38A 4JY9A 3U0HA 5I03A 4Y8EA 1XV8A 3KBVA 3B9DA 3BGAA 1Q6OA 1NDZA 9CGTA 3DECA 3IJLA 2BGQA 4HJFA 3UWUA 3W01A 1DQXA 4A3RA 1W5QA 2WNNA 2YIHA 3S9ZA 3T42A 4RDVA 4IFKA 3CGTA 3SUSA 3CV6A 3BV4A 3ZMRA 4GINA 2BFGA 3RJYA 1X8FA 1EX5A 4QDPA 1M7JA 3EOOA 3S1XA 3AIVA 1CGXA 1SM9A 1X6UA 5REQB 2WMIB 1AQMA 4JHMA 1OFBA 4W4QA 4DM2A 4Q4RA 3MMDA 4HZ7A 3PWIA 3G77A 4IFRA 2Y7DA 2DT0A 1V6WA 1AD4A 2VFEA 4I9AA 2GYIA 7A3HA 1D9EA 1G4PA 2CZDA 3GHRA 3P82A 1DEDA 5CGQA 2JE8A 1OX5A 2P0OA 3DGRA 3LXBA 2HCVA 3TH6A 4UXDA 4LBRA 3VDBA 1R3SA 3GTNA 3VCRA 1ENUA 1UWAA 2VEKA 3RIKA 2Y6ZA 3R12A 3T07A 2V5CA 1W9BM 4EWJA 4OKDA 2AOSA 2DZTA 1FDJA 1J0YA 2Z29A 3LYEA 4IGSA 2BSLA 2G50A 1V77A 1J01A 3IJ7A 4MKNA 3P5ZA 5G1MA 4DUVA 2WB5A 1XSIA 4U5KA 3TYAA 2JKPA 3E9AA 4S3AA 3G6LA 4CD4A 4PODA 4KS0A 1U5VA 1OZMA 2RDUA 4ORMA 1PAMA 5FOOA 1B4KA 3TFCA 4HGXA 3QY8A 1VFHA 3PUOA 2XGBA 4Y8FA 4YHGA 1LJYA 1XLFA 5GVJA 4N6EA 2ZA3A 2WSPA 3H23A 4PCNA 3W28A 4JEQA 3O7UA 4IH3A 5DMMA 3KZSA 2F2KA 4DWSB 5I77A 1U1HA 1JPMA 4Q22A 3STFA 4GYPC 1KXHA 3FW6A 3Q67A 1UKPA 1XBZA 2X1IA 4DXVA 3CHFA 3O2LA 2VZOA 1SU5A 4L64A 4ZBCA 1KFLA 5D04C 3GDKA 1HT6A 5HPCA 3QTPA 2HISA 3T05A 3LRLA 3PAOA 1XM3A 4QTGA 3YPIA 3S3GA 2A3EA 4Q4MA 5CCZA 8TIMA 3A64A 3LHWA 4DJED 3CUIA 3F4DA 2JKEA 3PZGA 3GM8A 2BMBA 5GQBA 1K1DA 2QPSA 2ALDA 2OT0A 1QFEA 3NVDA 3PFMA 4QJ3B 5G2HA 2Z1WA 4ADSA 2TYSA 4GHRA 3W70A 1BHGA 3BMWA 2Y89A 1KM6A 3E38A 1PX3A 3NYDA 5BU6A 3UVAA 1JEZA 1X98A 3WNLA 1BG4A 2OLSA 2YYUA 3D5HA 4HYRA 3QY7A 4RX0A 5DQPA 1WAWA 2YCKX 3OYZA 3S1GA 1XGDA 4K3ZA 3NQ8A 4KEZA 2REQB 4XIMA 1YQ2A 1M7PA 1YNQA 3DZ1A 3BAXA 1F6PA 4S3CA 4Q7NA 1Z69A 2D0FA 1PV8A 4V33A 3H4XA 1E6QM 4LB4A 3LBMA 1C29A 2V2DA 4UZSA 1TPWA 1W6TA 5A6MA 2OWXA 4RW5A 3WO8A 2V2CA 3T0BA 3V36A 3N19B 2SFPA 1HTIA 1E4NA 1CWYA 2VXNA 1XDLA 1QU4A 4GYPA 3DFSA 1Q6RA 3CU2A 4XV0A 3W2MA 3GXPA 2XVPA 8A3HA 4GIYA 4IMDA 4PCSA 4O14A 1UP0A 4L9XA 4XAPA 5CZ0A 3TYUA 3LBCA 3KVJA 3H54A 4JFWA 1P6WA 2FMNA 2A2IA 4A2SA 3EWWA 2Z0IA 1ZBCA 4UOZA 3DBNA 3B0VC 2VFHA 2X16A 2PPGA 2FYMA 4I6VA 2AMGA 4GJ1A 1A3WA 4E6MA 1IEXA 1UWIA 1IT0A 2OJPA 3LV6A 2PF8A 4BHYA 3MUY1 1SZGA 1CPUA 1TUFA 1XYCA 2BOGX 2VFGA 2JF7A 4GIEA 3IAPA 5AHMA 2GFTA 4KF1A 2V3DA 3E5BA 3BCFA 2ZWYA 1GNXA 1PXGA 5F7UA 1DVJA 1W54A 3HBLA 1UQZA 1ZY9A 1B5TA 1LRTA 4P8XA 3VPLA 1IWPA 4OHQA 5D2XA 2BZNA 2PWHA 2GL5A 3URBA 3LENA 1JDCA 3UR8A 1EA0A 4H01A 4KETA 1JCNA 4PC8A 4FA3A 3STPA 1V6VA 3NUKA 1KRAC 1ICPA 4DIAA 1E1FA 3SZ8A 4FOUA 4C6OA 4B15A 2O4QA 3KVLA 3QV6A