4GFSA

1.8 angstrom crystal structure of the 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 with nickel bound at active site
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
251
structure length
251
Chain Sequence
KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title 1.8 Angstrom Crystal Structure of the 3-Dehydroquinate Dehydratase (aroD) from Salmonella typhimurium LT2 with Nickel Bound at Active Site
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 94
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4gfsA00
1H5YA 1EP2A 1SPQA 4AEOA 3N2MA 1K7XA 3T44A 4Z1AA 1JCJA 1LM1A 3L5LA 3KRZA 1J4EA 3C8FA 1WQ5A 2RFGA 3RFAA 1B4EA 1KM2A 2QJGA 3W1NA 3FA5A 1IXQA 4UC5A 3W1MA 4IXHA 4FXSA 5FEWA 4FXRA 5H91A 5AHIA 1QWGA 1H7PA 4S2CA 3Q58A 3W1XA 1SO4A 5CSSA 1G6CA 1DL3A 1EP1A 4K6AA 3W2MA 2DJLA 3EWWA 2QUVA 1QMLA 4DPQA 1FDYA 1ZHAA 4O1BA 1AL7A 4Z0SA 1SZNA 5K2ZA 3M5ZA 3GX9A 4O14A 2CZFA 4WZHA 1BEUA 5CPOA 2PRLA 2Z0IA 1R47A 2VENA 1F05A 5EBUA 1E51A 4C1KA 3LHWA 2WNZA 3NNTA 4IPIA 5FF3A 1AW1A 1W5MA 4GC4A 4NQ1A 4Z1CA 3QM3A 4B5NA 1H7RA 4WY0A 1W3NA 1EWDA 1I45A 1SZFA 1W5NA 3W85A 5IBXA 1W5OA 3W7DA 5HUPA 1OABA 1Z48A 4M7SA 3KRUA 1UASA 4HNUA 2JK2A 1SW7A 3T78A 2ABBA 4MIMA 1F74A 1ICPA 1QPOA 1FCQA 3R5EA 4CNNA 3F4NA 3H54A 1P1XA 5KZMA 2G97A 4MZYA 4FNPA 5HMSA 4O11A 5LGXA 2C3ZA 1ONRA 4D2JA 3KVLA 3P84A 1MEWA 2NX1A 3BV4A 4HPJA 3TC7A 3GXTA 3NGJA 2E09A 3MI6A 3E12A 4EF8A 1OHLA 1ZALA 1MZHA 1H61A 3TH6A 2X1UA 5D04C 3M44A 1WV2A 4A22A 1RVGA 5K4XA 3LX9A 4HT3A 1YTDA 1YXYA 2CZ5A 4UTMA 3IGSA 1A5CA 1LBLA 4BI5A 3FKKA 2PCQA 5FF7A 3TAKA 3IGUA 2GVLA 3NL2A 3R12A 5K7JA 4MYXA 1KBIA 3OHIA 5F1UA 3RK8A 3A21A 5I3JA 3UWUA 2TYSA 4BWLA 3TV8A 1Q6OA 1TTJA 4O53A 3NQVA 4Q33A 2HTMA 4JNMA 3THQA 3NQ8A 1MO0A 4N9DA 1XL9A 2ZZ4A 3LB0A 5D05A 3KRSA 3DFPA 3I7RA 1J5TA 3HGJA 4YMZA 1OX5A 5I3KA 4ZMGA 4IMFA 2QR6A 1IXPA 2A7RA 4UFMA 5DXYA 4JTGA 5G4EA 1SW0A 4UFLA 4LUJA 4ICNA 3BG5A 2A6LA 2YW3A 1J2WA 4YXGA 4BFAA 2G96A 3INPA 2NXHA 3EXRA 3O1NA 3PG9A 4JYFA 2G95A 3UWZA 1B3OA 2OMAA 1L9WA 1R2TA 2RDWA 2X30A 5ABTA 2PURA 2WNNA 5IBXC 4DXVA 5BMWA 2HS6A 5EY5A 1RV8A 2ALDA 5F2GA 3VE9A 1LDCA 3S5ZA 3L0KA 4MJZA 5F2LA 2ATSA 3HO8A 4TO8A 3UD6A 3M5YA 3QMSA 4MFDA 1TPWA 1ZAIA 1DJNA 3T55A 3O15A 1C8VA 2FDSA 4LU0A 5D2VA 5LHEA 1Q6LA 1OF8A 2B7NA 2OZ0A 3TIMA 3U8GA 2Z6IA 4LOCA 3G8EA 1W8SA 1TV7A 2AAMA 5AFDA 2ZZ6A 3TAOA 2QJHA 1WAUA 2J9XA 2XN0A 3A22A 3G22A 1VGAA 4EOUA 4MY1A 3S0CA 4NX0A 2VEMA 1W5PA 1EWEA 3YPIA 3PUDA 4RXGA 2AGKA 2JGYA 2R14A 4GUFA 2QCEA 3W7KA 3W3OA 1SZGA 2D73A 1GYNA 3W2UA 1MXSA 1WA3A 5HJLA 2CLIA 1FY6A 4IX2A 3NOEA 3HPSA 1Z41A 4OBTA 3QW3A 1OFQA 2WQPA 2ZZ7A 4CQ9A 4N4PA 4NX5A 5KZEA 3MJYA 4BWLC 4MVAA 1M7PA 2DZWA 3LV6A 2A5HA 4OV9A 1X6UA 1VQTA 3PR2A 4ZQMA 3IVUA 4O8RA 3NO5A 3PB2A 3O8AA 4MLJA 2CLHA 1WX0A 4LUIA 4JXCA 3G24A 1HTIA 1VYPX 2VEIA 3HBLA 1A5BA 1TMHA 2A7NA 4H6KA 4JD4A 4XBSA 3N19B 2QCGA 1F6PA 5CZJA 4OT7A 1G69A 3B04A 5E0KA 2WV8A 1T99A 4X2RA 3DFTA 3P67A 4O10A 4XTDA 3PSVA 3W7GA 1OJXA 2GQ9A 5C2XA 3CC1A 4O16A 5D38A 5DBTA 2X16A 3P61A 1SZEA 1UUMA 3STFA 1D9EA 4O13A 1G4SA 1PCWA 5A8GA 3NM1A 3EB2A 3G3MA 3VKJA 3IVSA 2R91A 2FTPA 2B0MA 3N14A 4L4LA 1FWNA 1Q45A 1IGSA 5AHEA 1KFCA 4LVFA 5CSRA 3LXCA 1H62A 2H3DA 3CWNA 5H2ZA 3CU2A 1GVRA 3NQ7A 4QITA 3NG3A 5AOUA 3KVJA 1OX4A 1GWJA 1VJIA 2QEZA 3TROA 2J9YA 3CWOX 1SFLA 3NM3A 3S5OA 4XKYA 3C2FA 1OYBA 3PY2A 2EKCA 4O0ZA 1LOSA 3QF0A 4QNEA 2P1FA 1ALDA 4NNBA 2QCHA 3DBPA 3GDRA 4FX8A 4ZQOA 3WJXA 3M1ZA 3O63A 1T8XA 3CB8A 4UFIA 3SGUA 3LCXA 1TCDA 4LRSA 2IQTA 2Y7FA 3W1UA 3EX1A 3BO9A 4GUHA 2R8WA 1KM4A 2G5WA 1FWTA 3PBVA 1K7FA 4LW7A 4LT9A 2DZSA 3L0GA 1DJQA 4UR8A 3FLUA 5C54A 3MP3A 5D37A 4M6PA 1SSGA 1F2JA 1XM3A 1P4CA 2QAPA 2E6AA 4AXKA 1CI1A 2EGZA 4IXXA 5KTLA 3H53A 3P5ZA 1JUKA 1OFRA 3DKJA 3TJLA 1KTNA 4GRSA 3BW3A 1GG1A 4FF7A 3WK1A 4FIRA 2DZTA 4TX9A 2VC6A 4A2SA 4I9AA 4Y9AA 1YTKA 1XDMA 2RHGA 2FB2A 2QCFA 5EKYA 3A5FA 4LY8A 4QNWA 3MHUA 2BXVA 3M16A 1TPDA 4N6FA 4PL2A 3W87A 1EUAA 3WJWA 4NJKA 3IIZA 3G1VA 4FNSA 1ZAJA 4WUIA 3TMLA 2TSYA 2H3BA 1OFEA 1LLZA 3TR2A 3UXDA 1C29A 3ANYA 4QISA 1I2NA 4AHPA 4R34A 1GOXA 3L66A 4EIVA 3GYEA 3HGOA 2V30A 1FUYA 4O1CA 1JJKA 3MBFA 4UR7A 4I7VA 4JX5A 2W6RA 4QQ3A 1C9DA 1Z44A 3A23A 1NFBA 3PWAA 3WK0A 5I3FA 5AHMA 1FWWA 4TR9A 4UMBA 5U4NA 2QUUA 5BW6A 2Z6JA 3PF3A 4U28A 2I14A 2EPHA 5D2YA 3W7EA 2V0TA 4UNLA 4WOZA 1QPQA 1NAL1 2VEKA 3BLIA 3BG3A 1ZAHA 2E6DA 3ZS4A 6ALDA 1DORA 1VPXA 1W54A 4KFPA 2C18A 3LXBA 3RF9A 4M7TA 4UTKA 2GQAA 4ALDA 4I7UA 1IIGA 2X1SA 3O06A 5TBOA 3P81A 2NUXA 4PTNA 2J6XA 3M5VA 3FYOA 2PE4A 3C3NA 4FNTA 4DO6A 1VRDA 4HNTA 1FX6A 1JUBA 1PHWA 1VZWA 4AHOA 3SR7A 2V5BA 3BVJA 1A50A 1TB3A 1OFBA 3QFEA 3W7LA 2E5CA 4JTUA 2JKEA 1B9BA 5I3GA 2Y7GA 3W9ZA 1OYAA 1DVJA 3W88A 3PB0A 1OFAA 1RPXA 2ZA3A 1F6KA 2GUUA 3DFSA 4K7VA 3LI0A 1KLYA 4HHPA 4DBEA 4I7WA 4ADSA 3BGJA 1GVQA 2DZVA 2JBMA 3LOTA 3ABOA 3OIXA 3GLCA 4JS3A 3LDVA 3IV3A 1O5XA 1TJPA 3C4UA 4JICA 3W86A 1X1ZA 3A24A 2ZRUA 4K37A 3B0VC 3NQEA 3A9IA 1DQWA 3NAVA 4UFJA 5BRBA 3B4UA 2NUWA 1WYIA 2YR1A 2QCLA 4P61A 4A29A 3M5XA 3EX3A 4WQ6A 2A85A 1TPC1 4HSNA 1I2OA 1OG0A 1AK5A 1FCBA 2Z1BA 2CLMA 3P82A 4S1FA 3LHZA 1W31A 3PC0A 4N9BA 1QDSA 2DZPA 3Q94A 2ZDRA 3O6DA 4K36A 1EPXA 3S9YA 3L67A 1JR1A 3CIWA 3SFKA 1L6SA 2E68A 2B7PA 1DV7A 3G1SA 2NX9A 2WNQA 5LHFA 1OYCA 2C15A 5LNRA 5L6UA 4MY8A 4DBDA 3TSBA 3LCLA 3TX9A 3EXSA 2C6QA 1JCYA 3WJYA 1R2RA 1KM6A 5KSWA 3C6CA 2E77A 1K7EA 1VLIA 3LCWA 2NZLA 1KM5A 1Q3NA 4NJIA 1WOAA 2QJIA 1KFJA 4KKXA 1QO2A 5FF0A 3TXVA 1BTMA 3OA3A 5J5RA 2CW6A 4NNAA 3DI1A 3W2KA 3S6DA 2NXIA 1PVNA 3N9RA 3WK2A 1ZCOA 2QDHA 4JIQA 2QCMA 1GTEA 4N6EA 5T26A 3KOFA 4Q4KA 3PUEA 1QR7A 5D2WA 3BG9A 2NLIA 4Q32A 5D33A 3DXIA 4GUGA 1EB3A 4NZJA 5HWJA 2Y88A 3ZWTA 1FCUA 4K38A 4RZ5A 3N34A 3W7QA 2BLEA 5CPMA 2ZZ1A 3LBMA 1ZJIA 3MP5A 1TV5A 3UY8A 5D02A 5I3HA 4CCCA 2QKFA 4MZ8A 3USBA 1GQNA 5K9DA 4UXDA 4M5PA 3EWUA 4N9EA 1W37A 1I2PA 1TV8A 3TW7A 3HJZA 4BF9A 3O05A 3HG3A 3NXFA 3W7IA 2YYTA 2WOQA 1H63A 2E6FA 2DZXA 2XFWA 4EF9A 3B03A 2FFCA 1PS9A 4UMCA 4XBKA 5I3IA 1OX4B 4WX2A 2E5DA 2ZRXA 1ME9A 1N55A 4RXFA 4JTTA 3W72A 3W7RA 1TYGA 4XKYB 3G1YA 3VCRA 4FB7A 2JKAA 3C0JA 1TTQA 1W3IA 1XBYA 1L2UA 4LVDA 1QPRA 3B06A 3PS7A 1Q6QA 4AWTA 4Y6GA 3UY7A 3EKZA 1G4TA 4Y96A 4Z08A 2CFFA 1R30A 2ZCGA 4RV8A 1DQXA 5U7SA 1RR2A 3AJXA 3WK3A 4LS2A 3KAOA 4IUOA 3IRDA 3OG3A 4AH7A 3GNNA 3P7YA 4IMEA 3GDLA 3CT7A 1XDLA 3P5YA 1JCXA 4JTSA 2NX3A 3C56A 4O18A 1YDVA 2W0UA 3EX4A 1GVFA 1DBTA 4IGHA 2OX1A 2ZTKA 4DEFA 1S5WA 2CLLA 4DELA 1XKYA 3NQ2A 1QNVA 1P5BA 4IX0A 3NL6A 3O6CA 4R53A 3RMJA 1VHNA 4GWEA 1OVDA 4K8EA 1FXPA 4ZL1A 5KMYA 4TU1A 4GE8A 2VFDA 3I7QA 3PBWA 3L68A 4R33A 2H90A 3MW7A 1WDWA 5FF4A 3TCEA 3HPZA 5D30A 1IF2A 1CW2A 4HNNA 3RLUA 5SWUA 1W3TA 4AWUA 4WXZA 5DCBA 3W76A 4X3ZA 5DBUA 3GNDA 2YPIA 1KFBA 2QCDA 4JTKA 2FLIA 1SFJA 2EF9A 1JQXA 5F4XA 4O52A 5G1TA 3L0NA 4OU1A 4GNJA 4O17A 4ZQRA 5G2WA 1AMKA 1VCVA 3JRKA 1G4PA 2DORA 4M19A 3B05A 2X1TA 3EWXA 1H7XA 1EP3A 5HQEA 1SU5A 1IIHA 4AF0B 5G5IA 5G1YA 2ZFAA 3TFXA 2FIQA 1YDNA 2B7OA 4GXMA 4JDBA 2V81A 5GVJA 1P0KA 3NQCA 1OK6A 3CEUA 3WJSA 1RZMA 3FIGA 4XZ9A 4MY9A 3TSDA 2QUTA 1EX5A 3HGSA 3LGEA 4RZ4A 4KWVA 1SR9A 3QPYA 5DN1A 3P8JA 5D03A 2WSQA 4BR1A 5LKYA 4LTSA 3LTYA 1RD5A 1SO3A 3NQ6A 3CLMA 3W1PA 1M7OA 3V1PA 3LCFA 2RH9A 1G4EA 5D2XA 1TPUA 4RJEA 4QSHA 5G4WA 1LRTA 1O4UA 2A7PA 4Y90A 3ZWSA 3OVRA 5E93A 5DCEA 1M5WA 1VR6A 4JTIA 2NWRA 2HSAA 4HPXA 4MZ1A 3L5AA 4UTTA 3CTLA 3ELFA 2ZRYA 3NPXA 2ZA1A 1X8FA 4JIPA 3UPBA 4JN6A 3W1TA 1ME8A 3LCGA 1FQ0A 3IIPA 2FQIA 2J27A 4IQLA 4RZ6A 3UZJA 1NVMA 1D3HA 3LLFA 3QJAA 1GEQA 2Q3RA 2EAWA 3EX2A 1EA0A 1TPFA 5LZLA 3G8RA 1ML1A 1PL9A 5HWNA 4NZFA 4AHQA 4NU7A 2VEPA 3GR8A 3O16A 3T7VA 3LCHA 4XTIA 1K8YA 1TO3A 2GQ8A 3DAQA 3W6YA 4HIBA 4M6VA 3M43A 4IMDA 4JTEA 1H60A 3HPXA 2J24A 4K39A 1F73A 5FI8A 3TQKA 2QAFA 1ZNNA 1GYLA 3W7JA 2V2CA 3GR7A 1THFD 5AHFA 1H7NA 2DP3A 1TQXA 4LC8A 1LCOA 4PFMA 1TRIA 4CLMA 4KWWA 4PEKA 3EWYA 1K03A 5CG7A 2TRSA 1LORA 1HFBA 2C13A 3BW4A 2P0OA 4O19A 3B8DA 3Q2DA 4CNOA 5AYZA 3TDFA 4ONVA 2HMCA 3EWZA 1LOLA 4O1DA 3SECA 4E38A 3TW6A 3QC3A 3GXNA 4Z1BA 2NXGA 4R7JA 2R94A 1JRCA 3HGRA 2A2IA 4MFEA 3QMRA 1IXOA 1R46A 1K02A 2CLKA 3DHFA 3MI2A 2PC4A 3W1AA 1VLWA 4UTWC 3G3DA 2Y61A 4LS0A 3NPWA 4AB4A 5CZTA 1FDJA 1GVOA 3LCIA 1AL8A 1TSIA 4UNKA 2PRMA 1Q6RA 3G0UA 1TRDA 3W2JA 3G1FA 3WFAA 2ZRVA 1OF6A 1JCLA 4MUZA 4WXYA 1F7BA 2ABAA 4WY0B 3EXTA 3LHUA 3M0ZA 4UTTC 4WJEA 3R2GA 2VXNA 3NL3A 3MMTA 3RNDA 5D09A 3HMJG 4OWGA 5CGQA 4RK8A 1ZFJA 3FS2A 5J5DA 3CHVA 1VHCA 4UTHA 1GT8A 1EEPA 1KFEA 2QF7A 4P2VA 1UB3A 5BNKA 2CWNA 3QW4B 3W7MA 2OT1A 1G67A 1FXQA 3DH7A 5FESA 4O57A 4M6QA 3BPWA 4FX7A 2YGYA 5HUOA 3W7HA 3PAJA 2JGQA 3MWAA 1GZGA 1NSJA 5AC8A 2WO5A 3I68A 3C2EA 1F5ZA 3FJ6A 5G2HA 3S5YA 3ZFHA 3VI2A 2CLOA 5AHLA 5A5WA 4K8HA 1DKWA 2B7QA 4O54A 3W23A 1KTBA 3W74A 3EWBX 3H55A 3ZR4A 4IPJA 2YFNA 4JY8A 1X1OA 2GVJA 4O12A 2FJKA 1LZOA 3VFLA 4EVZA 3V75A 1WXJA 3M41A 3MO7A 2VFHA 4CQ8A 3L21A 3N2XA 4UIOA 1SO5A 3SSJA 2C16A 2ZYFA 5HWMA 1A53A 2E6YA 4JY9A 3NQDA 1XUUA 3TFCA 1H1ZA 5F4WA 2C0AA 4IMCA 3GDTA 3HG2A 1SUXA 4AWSA 3TC6A 1QFEA 2KZHA 4YCPA 3UYCA 2FPTA 3SZ8A 4ZZ9A 1OK4A 5C5YA 1S5TA 3FKRA 1GG0A 1QCWA 5DCDA 3QRHA 3GXPA 3AO0A 2UV8G 5DLCA 3GIYA 4LVGA 1VCGA 5LNWA 4UTIA 3NZRA 4MPQA 2ZQ0A 4FO4A 1LRNA 4MKNA 3STGA 4LVAA 5CKSA 3FEMA 4HSOA 2GVGA 3R8RA 2ATMA 3W2LA 2WPBA 3D0CA 3KHJA 1KM0A 1Y0EA 2YCEA 1U83A 1WBJA 1LROA 4PA8A 1W1ZA 3PG8A 2Y6ZA 2Y85A 3OVQA 2BTMA 3I7SA 1TTIA 3G18A 4LWWA 3THAA 3TJXA 3W2NA 5EYWA 3KFTA 2CZEA 1V7YA 3IIOA 2O7SA 1VYRA 2QCDB 4Y8FA 4JTHA 5AC7A 4FEZA 4O4VA 4UCGA 3NVTA 1QAPA 2P10A 4YLWA 4LNYA 1KTCA 3NQFA 2V2HA 3UWQA 1TPVA 4QAIA 3DFQA 2Q8LA 3LHVA 2QCCA 1RQEA 2HS8A 2H8ZA 1F76A 4Z0JA 4ZQPA 3L9CA 4PC8A 5CPNA 4MLRA 3O07A 6TIMA 1JUEA 1LBMA 1XI3A 1YXDA 3LRLA 5EPDA 1RQHA 3GKAA 2A1YA 1ZENA 5D32A 3NQMA 2ZTJA 3DZ1A 4UFKA 2A4AA 1QOPA 1WOBA 2V5LA 1LOQA 2YDAA 4NT0A 3PM6A 3B0UX 4BI6A 4MJMA 3MYPA 3W1RA 3TE9A 2DZUA 3TQVA 3NL5A 4QM1A 3BW2A 4UUIA 5LGZA 3N73A 4TMBA 3SGZA 1JRBA 1QOQA 2BSLA 4PH6A 1FWRA 4UTJA 2OCZA 1MSSA 2YSWA 2FPVA 2WSRA 1LLWA 3PBYA 4FX6M 4C1LA 4UFHA 3VE7A 5CPLA 3CPRA 1YXCA 2EHHA 4XUGA 3NA8A 2V8ZA 1HUVA 3C52A 2JKPA 3G0SA 3I6RA 3FOKA 4CCEA 3DKLA 1XUZA 4DF2A 3K30A 2VFGA 1QO5A 3BLEA 4ZQCA 3TMQA 2FPYA 4N2YA 4GFSA 1T96A 4N02A 1GPWA 1UBSA 1YPIA 3C2OA 4TIMA 5EL1A 2XN1A 2LLEA 2OJPA 2I9EA 3R13A 3GDMA 3N9SA 7TIMA 3TKFA 1I8JA 3JS3A 4OHQA 3UPWA 4CNPA 2F84A 1NEYA 1W5QA 1VH7A 2Y7DA 3HG4A 5K9CA 3NR0A 4YCOA 1FBAA 2ISVA 2VOMA 1VYSX 2GPTA 2Q8ZA 3IEBA 4H3DA 5CZ0A 4YWIA 4A21A 4HN4A 1GTHA 1AW5A 3LXAA 1A5AA 2V9DA 5CZSA 1LTDA 3TK7A 3FYPA 1YLVA 3SJ3A 3S1UA 3FFSA 2Q3OA 2AQWA 1XXXA 3LBCA 3G0XA 3UQNA 5BMXA 1G7UA 1DOSA 5D2TA 2FB3A 3EEGA 2WSYA 2VFEA 4IMGA 3O6YX 2ZRZA 3KX6A 3L5MA 3S1XA 1AG1O 4NJJA 3F03K 1H50A 3CIXA 5HINA 2YFOA 3ATZA 4A3UA 3NQGA 2Y89A 1ME7A 4EWND 2J9ZA 1TPH1 2Y70A 3LV5A 3W7CA 3S8HA 2TMDA 3GKFA 2YYUA 3L2IA 3U2OA 1XBZA 5HR6A 2A21A 3BARA 5C6MA 1MEHA 2H8XA 2B4GA 4UMAA 3DU0A 3S5NA 1WBHA 1OFOA 1TPB1 3BK0A 1KW1A 4LVBA 1TIMA 5L9FA 1KA9F 4XQ6A 1OX6A 3STEA 3NPVA 5K9XA 4JYEA 3M47A 3PVFA 5LNSA 4RX0A 4OE7A 4AAJA 1PCKA 5LNVA 2I1OA 1KM1A 2GJNA 4DF0A 3UXAA 3VNDA 1O95A 3NYZA 2CZDA 4OV4A 5F1VA 3W73A 4O50A 3PSWA 3JR2A 3QSTA 3QQ0A 1FWSA 2DJXA 4NXKA 4DQWA 3DGRA 3ABRA 4DO5A 3A5VA 3OEXA 2ZA2A 1G7VA 4POCA 3UNDA 1D3GA 5BOOA 3UZ5A 1O5KA 3W07A 1JCMP 1VS1A 3HIJA 1I2QA 1XC4A 1HO4A 4NXSA 2YW4A 4PODA 2VELA 2XN2A 3KXQA 3S1WA 1PHQA 4JTLA 3PUOA 3CEPA 2C19A 3DHDA 1OFDA 2NV2A 1SQ7A 2A0NA 4TMCA 1BWLA 2QDGA 3BGGA 4OGZA 4RLIA 1SSDA 1BKSA 5AYYA 2Y7EA 3M7WA 1YADA 4UTWA 3T4CA 2YZRA 1A5SA 3C2RA 3LERA 5HNRA 3W75A 4JDYA 3NEVA 4WOQA 3QZEA 3DENA 3G1AA 3LM7A 3M9YA 4LC6A 3G1DA 3W70A 3ATYA 4GBUA 4OQVA 1KLZA 1LRQA 4WD0A 3R89A 1VC4A 1H7WA 3M6YA 1NF7A 1S5VA 4LS1A 1N7KA 3IIVA 3P80A 4O4WA 2NV1A 4RR4A 3TQ0A 3W84A 5KINA 1OFPA 3QYQA 4ORIA 4KFNA 3W1LA 1TTPA 1GJPA 1YYAA 3ABQA 1KM3A 2C1HA 3P60A 1B4KA 3HQ1A 4RCXA 5DY2A 3P8IA 1HL2A 3QPZA 3HB9A 3BLFA 2VFIA 4O1AA 1JQVA 1IXNA 3QEZA 3W71A 3WJZA 3S1VA 1KFLA 2X1RA 4U4MA 5KZDA 3UWVA 1VCFA 1ZY9A 1SW3A 4JTJA 4YL2A 3U6WA 3B0PA 3GDKA 4JEQA 3IGXA 4O0KA 2X2GA 3L65A 2CLFA 1K8ZA 4NNCA 3TUUA 3SY5A 4DF1A 4X9SA 2ZRWA 2YX0A 4GJ1A 4LV9A 4ZQNA 1PV8A 3MYOA 5LNUA 1TREA 2VKZG 3GK0A 1O60A 3CQ0A 3W1QA 1KV8A 3SIZA 1V5XA 5FEXA 3FJLA 1UJPA 3T40A 3QSRA 2DU2A 3QMTA 4RKAA 3GAYA 1QPNA 4N4QA 3F1QA 5TQLA 4K7YA 2O7QA 4DO4A 2ISWA 3W83A 3C61A 3E02A 1L6WA 3NPUA 5AB3A 1ICSA 3N3MA 1MEIA 5F4SA 5K4ZA 3SW6A 4KFOA 1UCWA 1XCFA 5FEZA 4Z1DA 4IOTA 4UTUA 5E1QA 3QQ1A 1CX9A 3RLVA 2RDUA 4LV4A 5FEPA 2W79A 3SI9A 3DFOA 1EUNA 4JTFA 3TSMA 4JX4A 1BWKA 2PRHA 3W7PA 1T0OA 3QH2A 2Z2UA 2NUYA 1U5JA 1TPEA 3KVKA 3HOJA 2QCNA 2WJZA 2RKXA 3DFNA 3MUXA 3F4WA 3OBKA 3OVPA 1L6YA 3LHTA 1KV5A 5HULA 4PCFA 1XFBA 4GUJA 1W56A 3UWYA 5AHNA 5TIMA 1ADOA 1HO1A 4FNRA 4QJ1A 3CM4A 4AMAA 2ZZ5A 3PBUA 4A2RA 3MHGA 4S2BA 1K3UA 3G1XA 2ZZ2A 2J88A 4FNQA 4O15A 4X22A 1JCNA 3NQAA 2Y63A 1AW2A 4NJHA 3TA6A 1HG3A 4O28A 5DY3A 3LI1A 1K8XA 1XBXA 3E96A 2NWSA 1LYXA 2GOUA 4W9TA 1FCVA 4ADUA 4NVTA 1SO6A 1I4NA 2Y62A 2ZZ3A 5KITA 3GZ3A 5IM51 3C2VA 1W0MA 3W22A 2TPSA 3EX6A 3STCA 1UUOA 4FIQA 4H4IA 1PE1A 1O94A 2CU0A 4CCDA 8TIMA 2BWGA 1KFKA 3KVMA 2C14A 4HNVA 4ADTA 3LRMA 4JR5A 3GVGA 3LRKA 4JX6A 2V2DA 3E9AA 3EKLA 1S3HA 1LP6A 1X7FA 3IIXA 3I65A 1TQJA 1XBVA 4FHAA 2E5BA 1ICQA 4NUWA 5HR7A 1YTEA 5LSMA 5MHBA 5AC6A 3MI3A 4E2BA 2WKJA 5C55A 3E49A 3W7OA 4AF0A 5DELA 2VFFA 5G2IA 1R2SA 1P0NA 1RQBA 1NF0A 1N8FA 2ISSA 4UTLA 4QIUA 3RU6A 4NJGA 2OT0A 3S42A 4E2DA 3MBDA 1JULA 3G1HA 4HKPA 2E1DA 4IWWA 1M6JA 3E0IA 3W7NA 3HG5A 3Q37A 5DXXA 3DI0A 4FNUA 2ZBTA 3TU9A 4LRTA 2GJLA 4XWUA 4AVFA 3TNOA 1JVNA 2YXGA 3MP4A 3P62A 4GUIA 2CLEA 2BZNA 3HF3A 3NZ1A 1Z42A 4PL1A 3TXZA 1KBJA 5F2MA 4BK9A 3GAKA 4WY0F 3LHYA 4ZVJA 4J9JA 3PULA 5EA9A 5AN7A 1YDOA 2F7FA 2RDTA 1EIXA 4G1KA 1H7OA 3NDOA 4DPPA 1DHPA 4IJBA 4JGDA 4L4MA 4JYDA 2A6NA 3ABSA 1LBFA 1TJRA 5FF2A 1I2RA 3LTPA 4CQAA 1H1YA 1YPFA 3MHFA 4N9CA 4BI7A 3IVTA 3P74A 5F2IA 2H6RA 4MOZA 1H51A 3LLDA 3LTSA 1GVSA 3UWWA 5AYXA 4ML9A 5K3VA 1FDZA 3GB6A 5EMUA 4MYAA 4ORMA 1B57A 1PIIA 4E0CA 2BX7A 2V82A
chains in the Genus database with same CATH superfamily
5C9RA 1JXJA 3BV7A 1TJ0A 2SFPA 4YU1A 2QF8A 3KRZA 1E0TA 4ZTYA 1B4EA 3W1NA 4DBWA 3R1ZA 2ZE3A 4UC5A 4IXHA 4NZ5A 3KLKA 4FXSA 3SQMA 4FXRA 5AHIA 3WNPA 5GNXA 1RK6A 4AU0A 4RDWA 3AIBA 3Q58A 1SO4A 1GPFA 4YJ5A 5CSSA 1NOUA 2OLAA 3GH5A 3EWDA 4PUEA 1XYFA 2WJDA 1QMLA 3O2LA 1C8YA 1B54A 4EAYA 1AL7A 3PBMA 3ONCA 3RX2A 1SZNA 1U1HA 3I4EA 2EBNA 3SCUA 1KR0A 4KERA 1E0WA 1R47A 2QUMA 5EBUA 3WLIA 2WNZA 3QC0A 3AU6A 3WLPA 4GC4A 2OOGA 4NQ1A 4GYPA 4GC3A 4Z1CA 4B5NA 4WY0A 4MM1A 4JFWA 5JBEA 1I45A 1SZFA 4WK9A 7A3HA 3U3HA 3EDKA 4S3AA 5HUPA 2GGGA 4W8LA 3H21A 5CC3A 4M1RA 3G5EA 3REQA 4BQ2A 5AZ0A 2BASA 1TZ7A 2JK2A 1SW7A 4PMUA 2ABBA 4XKMA 3OBAA 3LENA 3NUKA 3VMOA 5KZMA 3VOHA 1T5AA 5LGXA 4D2JA 2J25A 3OPSA 3Q67A 1X8CA 3KVLA 3BV4A 2BFGA 3TC7A 4HK5A 3E12A 1MZHA 1H61A 1TZ9A 2PTWA 5K4XA 1GKPA 3B9AA 3VNZA 5FJPA 3CHFA 4UTMA 4Z2HA 4BI5A 3WLRA 4GIRA 3E5PA 3AZTA 3H2EA 2GVLA 2DV0A 3P6LA 3R12A 4DIAA 1W1B1 3N3TA 1KBIA 3VGHA 2J8GA 4S3FA 3HZ3A 3VA8A 2VCCA 1OC6A 2WHMA 4X9YA 4IIDA 1MDLA 3LPGA 3LB0A 1MRAA 1J5TA 4YMZA 2VWSA 4ZMGA 1IXPA 2A7RA 3DDMA 2DDXA 5G4EA 3DERA 4UFLA 4LUJA 3D47A 5LIXX 3VIIA 1YNQA 2JIWA 4KGLA 4ZB0A 4P5UA 2X05A 2WK2A 1EL3A 2G96A 1JPMA 4MB5A 2YCJA 1XG4A 2PWEA 4YTSA 1QK2A 1LUCA 3TYDA 4XZHA 3ZR5A 1NM9A 2OMAA 1R2TA 4PB4A 5HA7A 3QYSA 1EEXA 3RAOA 1XFCA 4TOQA 2QJJA 4QBXA 4DXVA 4MB3A 2HS6A 5FJRA 3WQ4A 5F2GA 3GNRA 3S5ZA 4MJZA 4OZOA 3HO8A 3M5YA 1UBPC 2ZICA 4IIGA 1TPWA 5HNTA 1ZAIA 3UNTA 1DJNA 2PDKA 4RZBA 3LN3A 5CJNA 4XD6A 1Q6LA 1DE5A 3UG5A 4YYFA 3TIMA 2Z6IA 4CNUA 4D1JA 3VKKA 4LAUA 1VP5A 2ZZ6A 3CYVA 3TAOA 3ZLHA 2J9XA 3A22A 3CV7A 4J5NA 3QR1A 2XH0A 2BB0A 4EOUA 3AZRA 2VL4A 4MY1A 4RW5A 2VEMA 3YPIA 2F2KA 3VIMA 3PUDA 1HN1A 4HNOA 2FZ9A 4GUFA 2QCEA 3ZJ8A 1ODUA 1JZ7A 4H9MA 2D73A 1CLKA 3MQTA 2CLIA 2QMKA 2VC7A 3HPSA 3JZEA 2V38A 4CQ9A 3OO2A 5KZEA 1HZYA 4MVAA 2V67A 1BXCA 1X6UA 4JFSA 4ZQMA 1BYBA 3IVUA 3NO5A 3PB2A 4MLJA 3FVDA 4LUIA 1V3JA 4JXCA 1PZ3A 4C6FA 3G24A 2BHZA 1HTIA 5DRCA 4WJXA 1OC5A 1TMHA 2A7NA 4H6KA 4JD4A 2HK1A 4DZ5A 4S3GA 4F8XA 1CGUA 3GFXA 4L80A 5A2CA 1CLXA 2GGJA 3T1GA 3NOYA 4Q8TA 2FHCA 4JN8A 4LALA 2XH2A 2GQ9A 1UZ4A 3CC1A 1PZ0A 5D38A 3AIRA 1E9ZB 3WL0A 3B40A 1I6NA 4HYWA 5DBTA 2X16A 4X2PA 1MQPA 5A8QA 3WBYA 1NP2A 1UUMA 1D9EA 5AY7A 3AMLA 4QQUA 1ITQA 3RPMA 1XPGA 5LXEA 3WCZA 1MW3A 3EDFA 3CL8A 3EB2A 1Q8AA 5FD0A 3BMWA 3IVSA 3SM0A 1KXHA 1FWNA 3VOCA 1KFCA 1T6MA 2P76A 1AJ2A 2QEZA 4O1FA 4GHRA 3CWOX 1TJ2A 1FKWA 3CS2A 4L56A 1SFLA 1O5QA 2NVCA 4XSLA 1XS2A 1GEHA 2Q01A 1LOSA 3BCDA 2FGBA 1ALDA 4NNBA 3DBPA 4GO8A 3WJXA 3VZYA 1CENA 3GHUA 4W88A 2XIQA 4EPDC 3KBJA 3N4FA 1KM4A 4AIBA 1FWTA 1K7FA 1JYWA 1OQFA 1B9ZA 4H9TA 1S2AA 5C54A 2BY1A 3MKKA 1SSGA 3MPGA 1Y65A 3VD5A 2Z2BA 3VC5A 5I5RA 1CI1A 5KTLA 3SEPA 3AZSA 3P5ZA 4OOUA 1JUKA 1OFRA 2PDXA 5D9MA 3DKJA 3TJLA 2EJ1A 2DVTA 2JF7A 4AISA 4Q6XA 4FF7A 3UEQA 4C7GA 3WK1A 3WUGA 1BQCA 4XO7A 4TX9A 4TVDA 4GLEA 2DSWA 2FB2A 2QCFA 3A5FA 4LY8A 3M16A 4JIRA 3OLEA 1EUAA 1M7JA 1YHTA 2RAGA 2TSYA 3ZMRA 4JTAA 3TR2A 2ISDA 1EXPA 3O0FA 1I2NA 4NSBA 4AHPA 1NQ6A 1GOXA 3AISA 2F6UA 3FHAA 4O1CA 2GUBA 3QV8A 4IT1A 4D8ZA 1TMQA 1BGGA 7REQA 1A5UA 4LJ3A 2OZ8A 4I7VA 3L4YA 2HV5A 4HJFA 3RX3A 4BKNA 3RM9A 2W27A 3OHMB 1MFVA 4TR9A 5U4NA 5BW6A 2Z6JA 4OIFA 2J66A 3PF3A 1B3XA 2I14A 1POKA 1XIMA 3TOYA 3BLIA 1J0YA 1QPKA 4Z2KA 2D3NA 3ZT6A 3CZ8A 1GZJA 4PTMA 2QPXA 1XIHA 4X61A 4KFPA 3LXBA 1UZ1A 2GGEA 2E0PA 3OTRA 3WLLA 2X1SA 3O06A 4GQ0A 2P3ZA 4DJDA 1OWQA 3M5VA 4AMCA 4FNTA 4DLMA 1O1ZA 1VZWA 4OVXA 4XZNX 1XIDA 4GI9A 2OSWA 3WBWA 1JI1A 4J3ZA 1IZCA 3TTOA 3CL7A 1I9CB 3IUIA 3JU2A 1TB3A 2PDUA 1DEDA 1OYAA 3PB0A 1KXTA 2ZWYA 1RSCA 1F6KA 4LX4A 3R7MA 4K7VA 3SCSA 3SUTA 4ADSA 2HEJA 2JBMA 1CXIA 3SCWA 3ABOA 4ACZA 1PYFA 3LDVA 5CH9A 1C90A 4JIEA 3IV3A 1JZ4A 5HQMA 2VNCA 2ZADA 3CIVA 4M82A 3ARYA 3GD6A 3A9IA 1DQWA 4JL1A 1EC7A 3SCVA 1WYIA 2B31A 4IZGA 2BXZA 2PDGA 2A85A 4GZEA 3S9ZA 1I2OA 3I4KA 3Q45A 3P82A 3OODA 2GZXA 1W31A 2CHNA 3G77A 2HROA 3U5UA 2DZPA 3WBXA 3S83A 3GG0A 3L67A 3M0MA 1JR1A 1VB9A 3CIWA 4AD0A 4JTDA 2NX9A 3C86A 4HA3A 5LNRA 5BRQA 3GG8A 4DBDA 1G5AA 3JVAA 4LEQA 4NZ4A 3U2EA 3EXSA 3ZT7A 1JCYA 3C6CA 2E77A 1NQKA 2J47A 2VO5A 1Q3NA 1KFJA 2CEQA 1J01A 1HKIA 1QO2A 1QNSA 4NZCA 2NVAA 3TXVA 2AL2B 3RM4A 3N9RA 4LUSA 3KP0A 4US5A 4B92A 1GTEA 5T26A 3UCDA 4RDYA 1BQGA 4HMNA 1QR7A 1J6PA 3VC6A 4Q32A 2PGWA 3DXIA 4NZJA 3CHCA 3ZZ1A 3ZWTA 2NQJA 1ZJIA 3IACA 1E56A 3MP5A 5D02A 4M3PA 2QKFA 3USBA 4YHEA 3W53A 3EWUA 2ZXBA 1C7TA 1W1PA 3O05A 1JD9A 3NXFA 3S6OA 4LAOA 4NHVA 4YN5A 4EF9A 5CBIA 2FFCA 2V5KA 4WX2A 1QBAA 2PD5A 4RXFA 4JTTA 3MJMA 1XICA 4IHCA 3EPNA 3IGHX 4R3UA 4YVXA 3VGFA 2JKAA 2ODOA 2FZMA 1W3IA 3M0VA 5HMFA 3ZM8A 3PS7A 1Q6QA 4AWTA 4Y6GA 3ZSSA 3DX5A 1G4TA 4MGGA 3QOKA 4Y96A 3VINA 2VRQA 2PF8A 5FAJA 5U7SA 3GFZA 3RUBL 1JZ6A 4LS2A 4DWSA 4X63A 3KAOA 3IRDA 4LGXA 3UERA 1EXBA 1XC6A 4IMEA 4W4QA 3GDLA 2VEFA 3APTA 3HQOA 1UIPA 4JTSA 1JF6A 4M8UA 4FLRA 1NWRA 4P8XA 2W0UA 1GVFA 2V3DA 4MAZA 3LYEA 4IUGA 1R3RA 1ZP3A 4J1OA 2P8CA 3NQ2A 4AIEA 5FJTA 4IX0A 2YA1A 2OVLA 1DIKA 4GWEA 4ZL1A 3OZMA 5CPSA 4TU1A 4WLCA 3I7QA 1B2YA 3L68A 4R33A 4D6EA 2H90A 5C9XA 2YZ5A 1ECEA 4F2TA 5CXPA 1LQ2A 1CW2A 3BAJA 3ITYA 3TTEA 3RR4A 4AWUA 4X3ZA 5DBUA 4H9ZA 3UYIA 2QCDA 4JTKA 2FLIA 2FVKA 3KM8A 3TN4A 1WZLA 3L4UA 4DJEA 5BXRA 2CBVA 3TN3A 5BRPA 2DORA 3NURA 2FTYA 5CZKA 3EWXA 1EP3A 3S46A 1Y5VA 5G5IA 4FR1A 1XKJA 2FIQA 2A3AA 4GXMA 3NQCA 4XZ9A 3DBNA 3RU8X 4WGXA 1J8VA 1FWJC 3T0TA 4RZ4A 3QPYA 1EO5A 3P8JA 3WD2A 3V5FA 1H49A 4F40A 5ENLA 3FX4A 1E15A 3CLMA 1AH4A 5XIAA 2D24A 4RNHA 2RH9A 4GVIA 2P53A 2VX4A 4QSHA 4U2YA 4M29A 2ICSA 4WEVX 4B4FA 5BOFA 2PDYA 1QBBA 2HSAA 4MZ1A 1G01A 3BJSA 2ZRYA 3NPXA 2A3LA 3MUZ1 3QZ6A 1DYSA 1Z9AA 3IIPA 3M46A 2J27A 1PO9A 3A64A 3CHDA 4HHMA 2GDVA 1MI3A 2J8TA 3KOXA 1GEQA 1NOFA 4HK6A 2DPEA 3AIVA 5I6SA 2ZXAA 4DXKA 2VEPA 4HTYA 4H04A 1XDJA 1DPMA 4IIBA 4GJJA 4HPNA 2REQA 2J24A 3OLIA 3UGRA 5JQ9A 1F73A 3BLOA 3QHMA 4IQDA 1THFD 2VZOA 1LJYA 1LCOA 4PFMA 4CLMA 1V6UA 3VPLA 5FSDC 1K03A 3PFMA 5CG7A 5EMLA 3UR7A 4AD5A 3NSMA 3TTQA 4O19A 4C5YA 1HKMA 4JTCA 4CNOA 3HFTA 4L1WA 1QOXA 3W38A 1IT8A 1LOLA 4IGSA 2QYGA 3DEQA 3TW6A 3E2RA 3LSBA 3QC3A 3GXNA 3HGRA 1K77A 4ZO7A 3WZ0E 1VLWA 3OW1A 2VUNA 3RRXA 4F9DA 2PP3A 2MANA 3BAIA 1GVOA 5JVLA 3LCIA 1EJ7L 3PWIA 1PX4A 1PJ9A 1TRDA 4WKHA 3T2QA 1FWCC 2DUXA 2A3EA 5BYWA 4IICA 2XYLA 1BF6A 3LHUA 3M0ZA 4UTTC 3EMQA 4IFKA 3MMTA 1J0HA 3U57A 5J5DA 3B8UA 1W1A1 1VHCA 4GOAA 1UP2A 3CASA 2QF7A 1UH2A 3SCNA 4PMZA 2OT1A 3UR5A 2PWUA 2FH6A 3CMFA 3VM7A 2HQAA 4FX7A 2YGYA 5AYBA 4GK8A 3K4WA 1ITXA 3QLLA 4XK2A 1ZU8A 5A6LA 1PKNA 3RO8A 2WO5A 1R6WA 2BDQA 2WHKA 2WMIB 3C2EA 1A5OC 1F5ZA 1U5VA 3CV1A 5G2HA 3S5YA 1PIGA 4HBKA 2OKOA 4AYGA 3QLDA 3WLKX 4K8HA 1UWSA 4FALA 4C6NA 3EWBX 3H55A 4U3CA 1RA0A 3H6OA 1XQKA 2CHOA 1OT2A 1UZHA 1OM0A 1EJTC 2GVJA 2P0IA 4M51A 1F61A 4I6VA 3M41A 5JBDA 3WQWA 2OQLA 1PAMA 2CITA 3AC0A 4UIOA 1SO5A 2Y5EA 1JIBA 2OGJA 2HK0A 2E6YA 4JY9A 4D6DA 1H1ZA 5F4WA 1YPXA 2J7DA 1ADSA 4PRWA 1RHCA 5REQA 1CXLA 2ZUSA 3NZPA 1QCWA 4QX4A 3H7UA 3GXPA 5HPCA 4WCJA 2UV8G 3WELA 5DLCA 3C0LA 4LVGA 1RVKA 5EU9A 1IEWA 2WZEA 4GH1A 2XINA 1KRAC 1LRNA 1WDDA 2NT1A 2PDIA 1OEPA 2WC3A 1QJWA 3VABA 4JTQA 2EQDA 2ATMA 2OEJA 2WPBA 1F3EA 3PJTA 3TOPA 2R9RA 1JDCA 1M53A 4C6BA 1K70A 3OZPA 3RILA 2W5FA 2Y6ZA 2O4MA 2WVVA 3LMZA 4D72A 3OVQA 1J96A 2BTMA 3PAOA 4TV6A 4I8DA 2HBVA 3OB8A 2OOFA 1V7YA 4WIWA 4BA0A 1C91A 1MW1A 1UR2A 5AC7A 4UCGA 1GHRA 4J28A 2DIJA 1E71M 1E0XA 3TN6A 3V18A 3UWQA 4PMYA 3CK5A 1TPVA 2Q8LA 3WDIA 4FAMA 2QCCA 1F76A 2P5NA 3GU2A 1D8CA 5CPNA 4MLRA 3VDAA 2BGQA 5JUVA 3CO4A 1BFNA 1YXDA 3LUTA 1S1PA 3AMCA 3QGAC 3WLNA 4Z1YA 3DZ1A 3NQMA 4L4PA 4Q7BA 4HCHA 2PCEA 2AMXA 1UR8A 3QR0A 3B9DA 2V5LA 2CBUA 2YDAA 4B4HA 3CJPA 3B0UX 4HOWA 4UTFA 3MYPA 3W1RA 2BHYA 2DZUA 4ZB2A 3KL5A 4UUIA 1QHOA 2G0WA 4TMBA 3SGZA 1BRLA 1QOQA 5DO8A 3RDKA 4UTJA 1UJQA 2YSWA 2R82A 4C1LA 4R5EA 4P7QA 5CPLA 3CPRA 3IJDA 4GX9A 2W9MA 3NA8A 4BHYA 1CYGA 1XYBA 3GZAA 3DKLA 4ZODA 2Z4GA 4ZQCA 5FSEC 2XVLA 4N2YA 2G3IA 1S38A 1XH0A 2WYSA 6XIMA 2FH8A 4TIMA 3LNPA 2XN1A 2ANUA 2ZDSA 4FP1A 3EMZA 4XD4A 3EA2A 3UPWA 1NDYA 1NEYA 1VH7A 3WL1A 2Y7DA 4PCTA 1QNQA 2XIIA 2ISVA 5DF0A 4HK7A 1Q4NX 5CZ0A 4HN4A 3H2FA 3IK4A 5IHSA 4FOUA 1DIDA 1LTDA 3FYPA 1YLVA 3S3GA 3FFSA 3AJ7A 1P6BA 3M0YA 2AQWA 3N11A 5GQBA 2FMOA 3D3FA 5BMXA 4GG9A 5HANA 2YBVA 3WQVA 3EEGA 2WSYA 5TAOA 2BG5A 2H9AB 4IMGA 5H6HA 2V5JA 4W7UA 3TYAA 2C1GA 4F9JA 3AS0A 1AG1O 4NJJA 3CIXA 2XVNA 4A3UA 4TTGA 4ZOBA 3WLHA 3NQGA 1ME7A 3L2IA 1XBZA 3GNPA 3TONA 4B3ZA 5C6MA 5GJNA 3S5NA 1OFOA 1L6FA 4LVBA 1QATA 3VOIA 5L9FA 1KA9F 4L61A 4F0HA 4XZBA 3STEA 2V5DA 5K9XA 4PCPA 5LNSA 2Z29A 1PUDA 4RX0A 4AAJA 2OEKA 1IR2A 4J3XA 2I1OA 2EEXA 3UXAA 3MWCA 3VUPA 4IPNB 4E5TA 4GYPC 2O9RA 2HXTA 3QQ0A 1FWSA 3IV8A 3CMGA 4NXKA 8A3HA 1G94A 4JKMA 1UWQA 3A5VA 3WG6A 3K8KA 2WKLA 4AZ5A 1CGVA 2F8QA 1KC7A 4S38A 3W07A 1F8IA 1VS1A 5H8UA 4L6DA 4NXSA 4PODA 2XN2A 1FWBC 2X09A 2ZWZA 4ATLA 3PUOA 1TX0A 2OSYA 2A0NA 1HJQA 4PUJA 3APYA 3L7RA 4OGZA 4RLIA 1SSDA 1BKSA 2YB4A 4ICMA 4UTWA 3T4CA 4RW3A 5HNRA 4JDYA 4DRSA 3NEVA 1OGSA 4WOQA 2WWCA 3DENA 4LYQA 3U2ZA 4OECA 2Z1SA 2VC9A 1VC4A 4W7WA 4BCEA 2PDNA 3KOYA 2FVLA 3CYJA 4H8NA 4O4WA 2PUZA 3P2VA 1V8EA 1J0KA 3QYQA 2I17A 4ORIA 3W1LA 3E2QA 1YYAA 3P60A 1B4KA 3E0LA 4L9XA 3UCCA 1U1UA 1LL6A 2PWFA 1XD1A 2E4TA 3P8IA 3GWQA 3ARTA 4O1AA 4EX4A 1IXNA 1KFLA 2ZC1A 5KZDA 3WH7A 1VCFA 1UD6A 4JHOA 4JTJA 2AL2A 4JEQA 3PZOA 4O0KA 3GQYA 2CLFA 3TUUA 2Y2WA 4GJ1A 1ZL1A 4AQLA 3MB9A 5JIPA 3MYOA 3UETA 5LNUA 3BQ6A 1TREA 2IKJA 4R7WA 3QTGA 2VOTA 3L4XA 3CQ0A 1KV8A 4JQ3A 2GJPA 1OGGA 4HD5A 2QVNA 1IEQA 2XISA 1NH6A 4HN8A 3WD3A 1JZ5A 4RKAA 2W92A 4G8TA 5A8MA 2CZVA 3PZUA 4B2DD 2GLKA 3TLLA 1VFTA 1MEIA 1E40A 5K4ZA 3A4JA 4MMWA 4KFOA 3UJFA 1K9DA 4IP4A 5CAKA 4M24A 4C5ZA 1MW2A 3I6EA 4IJRA 3NFUA 3RLVA 1MXGA 4LV4A 3SI9A 1EUNA 2D20A 4JTFA 4JX4A 4U3AA 3N2TA 1T0OA 1TFVA 1U5JA 2Z26A 1TPEA 3L23A 3DFNA 3MZNA 2ALRA 3MUXA 4IFOA 1L6YA 3CAWA 1F4AA 1MRQA 1TVPA 2BOFX 1P7TB 4HMDA 1W56A 1VBRA 5TIMA 1HO1A 4FNRA 1FHLA 1GQLA 1SYTA 3MHGA 7ENLA 3CXOA 4GMEA 1ELSA 3VZXA 2ZZ2A 4FNQA 3NQAA 3CUFA 4L6OA 1AW2A 1A3HA 2NQHA 5DY3A 5CG0A 4W9TA 1FCVA 1IEVA 5DEZA 1HNYA 1E72M 4D6IA 1FWEC 4ADUA 4K68A 4EXAA 3QXBA 1I4NA 4XAZA 3WLJA 3C2VA 1W0MA 3FJ4A 3EWCA 4FIQA 3EA1A 4H4IA 2XG9A 8TIMA 2BWGA 2O4QA 3VIFA 2OQYA 5JBFA 3EBVA 1TR1A 3IIXA 1TQJA 4FHAA 5FL0A 2E5BA 1XYLA 3BE7A 3P14A 1F9CA 5HR7A 1AA1B 2NW0A 1HQTA 3GXFA 2VFFA 4WF7A 4HA0A 1RQBA 2PGEA 3T6CA 1VPYA 3FA4A 2WSKA 1GYMA 1JI2A 3QY8A 2OT0A 4NJGA 3MBDA 4F0SA 3F4VA 3W7NA 1TZZA 4PCSA 3DI0A 4FNUA 1HJWA 4LRTA 1J0ZA 4AVFA 2PDFA 3TNOA 3AIEA 3U9IA 3P62A 2QDEA 1O7AA 1Z42A 3AHVA 2QV5A 3TXZA 3WNOA 3NO1A 3LHYA 3PZTA 4ZVJA 2PU1A 1XHGA 4G6CA 2NSOA 2F7FA 4XZMX 1EIXA 1SM9A 1G1YA 3ABXA 1WKFA 5LIWX 2JEQA 1DHPA 4MWAE 3AYVA 2FMNA 4UWMA 1PKLA 4PTDA 1C9WA 5FF2A 3OZOA 4CQAA 1YPFA 4N9CA 2QVHA 4H00A 1M03A 2IXUA 4IP5A 5EMUA 4MYAA 4MUPA 4E0CA 2V82A 1H5YA 1ZBKA 1VIWA 1GKRA 1UWAA 4AEOA 3CV2A 2ZIDA 3L4WA 3N2MA 4KW2A 3H12A 2NSXA 1LM1A 1TVLA 1AUSL 1J4EA 2X8RA 1WQ5A 2X7VA 2V63A 4D1IA 4WSHA 2E1WA 2VRJA 3FA5A 1IXQA 3W1MA 3N4EA 4QS5A 1F3WA 5D9OA 3SB0A 5KEZA 1H7PA 2OYMA 1K4HA 5M1TA 4NKCA 1GHSA 1W9UA 3WF1A 3RJXA 5DRIA 2XJ7A 4RPQA 3K5XA 1G6CA 3GM8A 3W81A 3W2MA 4JEJA 3EWWA 3SN4A 3B8SA 3MKCA 1SFTA 4W89A 3RN6A 2GWGA 4PE8A 1HL9A 2XVGA 1LWHA 1WZMA 4LBUA 4AW7A 4WZHA 1HGWA 1JZ8A 4W7VA 2PRLA 3WNNA 3ZR6A 2Z0IA 4PB3A 2VENA 3BMXA 2NT0A 3ES8A 1W5MA 3WKZA 2ZXQA 5FOOA 3QM3A 2D2HA 4QE4A 1H0IA 1W3NA 3VGGA 1W5OA 2PWDA 3S4TA 4H1ZA 4GY1A 3URAA 1UWTA 1XH1A 1QNPA 4ENLA 3KRUA 4HNUA 4DYKA 1F74A 1ICPA 1FCQA 4GCXA 8RUCA 1P1XA 3UCQA 4MZYA 4PMDA 4FNPA 4HCDA 1XR2A 2C3ZA 1ONRA 2Z1VA 3NZQA 4F3HA 1UMLA 3VIOA 3P84A 1EZWA 3H4XA 4HPJA 4RL3A 1TVNA 2HZGA 4DUVA 4EPEC 5D04C 2OLSA 3FW6A 2XZ7A 3LX9A 3E0FA 1IV8A 2CZ5A 1T41A 2EXOA 2F9RA 2VTFA 2PCQA 3JUGA 4YTQA 1MXDA 4HP5A 1PB0A 4GQQA 1HP5A 3TCSA 4HTBA 3UWUA 3WF2A 2BV9A 5I7GA 1GK8A 2YB1A 1BSIA 1Q6OA 2PAJA 4QROA 4KWUA 4UQ9A 1UR9A 4O53A 2IPFA 1E0VA 1GORA 1TUXA 4C6QA 4NAFB 5HJXA 3CHEA 1XL9A 2ZZ4A 3TTYA 3UA4A 1HKJA 4QDMA 3I7RA 4S3JA 3DYOA 3W01A 3FN9A 1QI4A 3RMEA 2XGBA 3EDJA 4B9ZA 4W87A 1SW0A 1IEIA 3BG5A 3VU2A 4YXGA 4NI3A 4BFAA 3LS9A 3AS3A 4GABA 3PZ9A 2PP1A 9RUBA 1LT7A 4LXFA 2BS9A 1L9WA 3MSGA 2D3LA 1MUCA 2I7GA 3S2NA 5ABTA 2PURA 1V6XA 5IBXC 4IMAA 1W3JA 3VE9A 1LDCA 1KKOA 4KWOA 3MY9A 1EQPA 4AIOA 1Q63A 1UA7A 2J7CA 3QMSA 3RCMA 1UD8A 1V6TA 1UKTA 2P88A 3T55A 3O15A 2JFEX 1Q2SA 3U8GA 2VGBA 2G3MA 2QJHA 1WNOA 2PEVA 1L8PA 1WAUA 2CXEA 3URQA 1VGAA 3EYPA 3AHTA 1EWEA 3GS6A 1Q66A 5FL1A 4RXGA 4V27A 2AGKA 5HJYA 1SJCA 5C9WA 1GJUA 5ECVA 1GYNA 4QR6A 1MXSA 1WA3A 3FVMA 5HJLA 2VYOA 4C6JA 1FY6A 1TWDA 1OFQA 4N4PA 4NX5A 4BWLC 5FJJA 1M7PA 2DZWA 4ZOAA 2WWDA 1V0NA 3SIMA 3RLGA 1VQTA 3PR2A 3LBOA 4O8RA 1X38A 4C6EA 5T8GA 1RALA 3L4TA 4XZLX 1VAHA 2VEIA 3V5OA 4DWSC 4XBSA 1VKFA 4DJFC 2FFIA 4GGBA 4XAYA 2QCGA 3A47A 3AS1A 1G69A 5E0KA 3N13A 2IQ0A 4HYRA 4EACA 3BXWA 4O10A 3W7GA 2HVNA 5AC5A 3I3EA 3MKVA 3SCOA 1KGUA 2J62A 4NZ1A 3L12A 3P61A 1O1HA 3E38A 3ARWA 1M68A 1YMYA 1G4SA 1BVWA 2XZ9A 3V35A 3G3MA 3MUAA 1GVYA 2B0MA 4H83A 2GJXA 2PDHA 1IGSA 5H2ZA 2OB3A 2ZUMA 3HA1A 5AOUA 3NG3A 1VEOA 1FP8A 1OX4A 2WBGA 3TROA 2J9YA 3NM3A 4ZOCA 1WDSA 4WHBA 3VFCA 3ANUA 1GCYA 3MCMA 1JYVA 3KS5A 4FX8A 4UFIA 4DI8A 4Q4QA 2NVDA 3EX1A 2H9AA 3BO9A 4E2OA 4GXPA 3KE0A 2G5WA 5A6BA 4LT9A 3IK2A 2DZSA 3L0GA 2JIEA 3N6JA 4UR8A 3FSUA 2Y5JA 3FLUA 4MDPA 3VNIA 3MP3A 3C2YA 4M6PA 1MVYA 2E6AA 2PWHA 4OJYA 3FAWA 4GRSA 4AZGA 3PNUA 3CAQA 2CWXA 4NAEA 5FJUA 4MHBA 4FIRA 4O1EA 3C0SA 1XGEA 3REQB 2HISA 5MKGB 3RR1A 1FHDA 1WUEA 5EKYA 2BXVA 2F6KA 3AUOA 4N6FA 3WIJA 4K8GA 3W87A 4FK9A 1TA3A 3G1VA 3BJTA 4FNSA 4PTWA 1ZAJA 3VIGA 4GVGA 1JGMA 2H3BA 1OFEA 1LLZA 1PDZA 1UPMB 1TKKA 1XISA 1R87A 3L66A 3HGOA 2V30A 4D71A 1GVEA 1C9DA 1Z44A 3O7UA 3WK0A 4Y9NA 5I3FA 1CTNA 1M3UA 4IJCA 5DMMA 2XU2A 3VK5A 3W7EA 3SCTA 1R38A 1Q6DA 1NAL1 2VEKA 1JGIA 2E6DA 4TUFA 3MSRA 3LY0A 3ZS4A 1A3XA 1DORA 1VPXA 1NFPA 4QG9A 4ALDA 1W1YA 3CBWA 4I7UA 1IIGA 4A3QA 5BU6A 5TBOA 3N18A 4YWSA 1V3MA 3RRAA 2XVKA 4ILSA 4DO6A 1EF2A 1CPUA 1FX6A 1UHVA 4I8YA 1RPKA 3CL6A 2V5BA 4G2DA 1LF1A 3WFLA 4F4RA 2OKTA 2E5CA 4JFVA 1R3WA 3MMDA 1VEMA 4PTVA 2VHLA 1LUCB 1TUFA 3LQGA 2AMGA 1D8WA 2X40A 2WMGA 3BLPX 1W1TA 3B8VA 2YCIX 4FZIA 4HHPA 4DBEA 2R1LA 1VFMA 4RE0A 4JS3A 3DOPA 1JPKA 2V3GA 2VVSA 1M04A 4H9UA 1Q7QA 2FZNA 1YE6A 3SBFA 1EYWA 2Q6ZA 2V6AA 1X1ZA 4E4FA 5C7HA 4K37A 1EJUC 4KMQA 1CXKA 3K8MA 1E3ZA 4JQAA 3UFYA 5HXMA 2NUWA 3R94A 3UZYA 3KDOA 2QCLA 5T91A 1E73M 5F7UA 4FLOA 2ZUNA 4ROPA 3VUSA 3T07A 2Z25A 4CCZA 1OG0A 3RITA 1FCBA 1ZQ5A 4S1FA 4AZHA 4C90A 3K1DA 2PDCA 2X41A 1QDSA 4H6EA 1QNOA 3RCYA 3O6DA 3S9YA 2E7FA 4GY0A 2B7PA 1UC5A 2AQOA 2WNQA 4F0MA 3BOFA 2C15A 2BY3A 3DFHA 5L6UA 5ABHA 1W3HA 4MY8A 3TSBA 3E74A 3LCLA 1QI5A 4DI9A 3BCFA 5B7YA 4JNZA 3P93A 3WJYA 2ZUTA 5KSWA 4I5XA 1EOKA 5LXXA 1P43A 2NZLA 1PXGA 1QI3A 2OR2A 3T0DA 3HPFA 4XIMA 2OGYA 4KKXA 1W9XA 1NDZA 1I0BA 4G5DA 1BTMA 3WNKA 4LUTB 3BICA 5ECUA 3BSMA 3S6DA 3IS4A 2QW5A 2XH7A 4N6EA 3T05A 4L7ZA 3PUEA 1Z6KA 2NLIA 2Z1WA 5D33A 3KCJA 3GUWA 3BCJA 3GTFA 4GUGA 2Y88A 4P8UA 4K38A 1DXFA 4YS1A 2BLEA 2ZZ1A 1K9EA 5H8MA 1CCWB 3SDOA 4CCCA 4MZ8A 3CPUA 1WZAA 4N9EA 1W37A 3FXGA 3PP7A 2OO6A 3MDUA 5AVNA 3TW7A 3HJZA 4BF9A 2XH4A 2XHYA 1KB3A 1WDQA 2E9MA 2QIIA 2WOQA 1H63A 2E6FA 1EPVA 4UMCA 3MSYA 3SSZA 3C5QA 3BSHA 2XFYA 1V3HA 3W7RA 1TYGA 4HYVA 1QXLA 3Q4DA 3PZMA 6CGTA 1K9TA 3GTHA 3PZGA 4DJDD 4B5SA 3NVDA 2PFHA 1W9VA 3EKZA 3AROA 3BZJA 4Z08A 1R30A 3V0SA 1JZ2A 1B3WA 1S1RA 2WMFA 3AJXA 4IUOA 3PPHA 1M9HA 1XRVA 3GNNA 2PDQA 4ML4A 3P5YA 2NX3A 3C56A 4O18A 5E9XA 1J2BA 1YDVA 2OX1A 2ZTKA 2ADAA 1S5WA 4DELA 3ARPA 1ODZA 1UPPA 1B5TA 3M0IA 4R53A 4QLKA 3CQJA 1UWIA 1S2CA 1KGXA 1FWFC 2VFDA 2WMHA 2NQ9A 5FF4A 1U5HA 2Q09A 2J7FA 4UQBA 1IF2A 3ZVHB 1D3CA 1CXEA 1W3TA 3GVWA 1EO7A 3FGCB 2XWDA 3W76A 2VQTA 1ZJBA 1KO0A 4M6UA 3GNDA 3PBGA 2EF9A 4MJ2A 4ZR8A 4O52A 5G1TA 3L0NA 3VX0A 5IHRA 3ARQA 1NWSA 1BLIA 3B05A 7REQB 2QUNA 4W93A 4INFA 3NIYA 5CGMA 1SU5A 1IIHA 2DUZA 1ZJHA 5G1YA 1EDGA 2GSJA 2ZFAA 4RNIA 3TFXA 2HE5A 5GVJA 4RUBA 1P0KA 3TSDA 1VF8A 4MY9A 3HGSA 1KWGA 1D7KA 5JIWA 3ZXWA 5LKYA 3LTYA 4ZGYA 1FFRA 1RD5A 4DWDA 4B16A 3W1PA 4XZWA 1M7OA 1E6RA 5D2XA 1EQCA 4LAKA 4E8GA 4US5D 5DCEA 4Q4OA 5C70A 3HV9A 4DHGA 4HPXA 1P0DA 1X98A 4UTTA 2VC5A 5A8PA 1ISZA 2ZA1A 3KCOA 4WSJA 3W1TA 4JIIX 5TNVA 1ME8A 1FQ0A 8XIMA 4HPGA 3UZJA 2BOGX 4MNJA 2XSBA 1HVXA 4A8RA 1H1NA 4JKKA 1EA0A 3MUY1 5LZLA 1U22A 2XFFA 4ACZB 1V0LA 3E3HA 4NU7A 1BXNA 3GR8A 3O16A 1AODA 6XIAA 2ZXDA 4XTIA 1OADA 3ZLGA 3DAQA 1TO3A 2GQ8A 4AFYA 3VD3A 4HIBA 1I75A 2JQXA 2G50A 3H4GA 4OUEA 4Z2LA 4S3EA 3W7JA 3VNMA 3FA3A 4GIAA 2DP3A 1TQXA 1A5NC 4AWEA 5CJMA 5HPOA 4PEKA 3UPMA 4JHMA 3VILA 1U1JA 1LORA 3GC5A 3BW4A 4PBGA 3Q2DA 5AYZA 2ZKMX 4TXEA 4CQBA 2QNEA 3DYPA 5BXTA 3NDYA 3SECA 1BD0A 1JRCA 5CCZA 2W91A 4MFEA 2J77A 5DX7A 1L8NA 1VFSA 1R46A 1K02A 2CLKA 4V33A 1LL7A 4UQEA 4UTWC 2Y61A 1ZBWA 2E9LA 3KTSA 5CZTA 1YW1A 1FDJA 1A0CA 1UD3A 3SCRA 4UNKA 1OINA 4IG2B 1EBHA 2OX4A 3WFAA 4HZ8A 2ZRVA 1OF6A 2PI6A 1F7BA 2AQVA 4X0NA 3IARA 1HX0A 2P8BA 2PTDA 3F4DA 4UZUA 3K13A 2VXNA 4CD7A 3XIMA 2KX9A 1XD0A 3RNDA 2AOSA 4J27A 1GT8A 1N2VA 5E09A 1UB3A 5BNKA 3W7MA 1G67A 2O92A 1AZ2A 2CYGA 1Q4WA 2YCLA 1CGWA 1PIFA 2JGQA 3BLKA 3MWAA 4MNKA 5AC8A 3I68A 4B3LA 4ERAA 4B5TA 1ISVA 4W8AA 2E8YA 4Z42C 1KTBA 1Y5XA 3N6HA 3N1AA 3MANA 4JY8A 4PMJA 3T9PA 3TTSA 1M7XA 1X1OA 3T0BA 2FGZA 3KWXA 2FJKA 4WDTA 1LZOA 3V75A 1WXJA 2BVWA 3NYDA 1JEZA 3ERPA 2IKIA 2POZA 1A53A 5G1MA 1VBHA 3NQDA 4F0KA 5BOEA 6TAAA 2X1IA 1XIFA 4CVWA 4H8UA 3GDTA 3WQ6A 1I0DA 4IL2A 4AWSA 1RUSA 1IWBA 4YCPA 3AALA 1IEXA 4DWSB 2FPTA 4FPSA 1Q2RA 3W6MA 3SZ8A 4ZZ9A 2WLYA 5BXPA 1XSKA 1GG0A 1O68A 1N82A 3QRHA 2HE8A 3BOLA 3IJQA 3PJUA 5LNWA 3NZRA 1MFUA 3D6NA 4FO4A 3MTWA 1TWWA 4MKNA 3STGA 4LVAA 4JIHA 3FEMA 3LSCA 4ZSUA 2GVGA 3R8RA 1E3XA 3OYZA 3KHJA 1KM0A 3OA5A 2VDGA 1SFSA 2X42A 1P48A 2Y85A 2Q02A 2QGHA 2AAAA 1BG9A 4HB7A 2HWGA 2GDQA 3THAA 3TNBA 3IJLA 3RIKA 5EYWA 3UGVA 3SCPA 4QLLA 3KLLA 1UKSA 2QCDB 4Y8FA 4F0RA 3NVTA 1QAPA 3ARUA 2P10A 1UUQA 4LNYA 1KTCA 3CB3A 4QAIA 3DFQA 3THUA 4ZO6A 2H8ZA 4JAWA 2WCGA 3DGBA 3U0HA 3CUXA 4OBSA 3H22A 2MNRA 6TIMA 1JUEA 2OSXA 5EPDA 3UP8A 4W86A 2ZTJA 3KUMA 2V3FA 2A4AA 1QOPA 1WOBA 3MUCA 4V15A 3KS6A 1LOQA 4RPPA 4NT0A 2YL9A 1SJDA 3TE9A 3TQVA 1GQJA 4KIRA 5LGZA 4PRRA 3BL3A 2PZNA 4FXFA 3HN3A 8CGTA 4UFHA 5BWFA 4D6CA 1RY8A 1YKWA 2G37A 2XGIA 3TN5A 1KRMA 1NTHA 1JG9A 3T8QA 4AY8A 3GSMA 3I6RA 1XUZA 3MVTA 3TMQA 4GFSA 3UXKA 1FWIC 1T96A 2EO7A 1UBSA 1YPIA 3C2OA 1IT7A 3EA3A 2OJPA 3ARSA 2I9EA 4M1BA 4DVOA 4CGTA 5MKGA 2RGMA 2DFAA 1I8JA 4GIEA 2PU0A 4OHQA 3GTXA 3PPFA 2WVUA 2QZRA 2F84A 1W5QA 2QXWA 4XZIA 3MA8A 5K9CA 4LNCA 2REQB 4YCOA 3H7RA 1CIUA 2VOMA 4GVHA 4H3DA 3E2VA 4YWIA 4A21A 3WUEA 4C60A 1GTHA 2R1MA 1MUMA 3WQPA 4L64A 3LXAA 5A2AA 2QPUA 5CZSA 4JQ1A 5AKQA 3VIKA 4UOJA 3S2JA 3SJ3A 3S1UA 1O5RA 2EPNA 2PDBA 3ITVA 5EMJA 3KZPA 3LBCA 3MMWA 3G0XA 1NARA 5DANA 1DOSA 3MV11 2FB3A 4AZ7A 3OVGA 4C6IA 1OC7A 4QFUA 4HOZA 3S1XA 1ESWA 3F03K 2YFOA 5FJOA 3VD4A 4J40A 4UCFA 1TPH1 3LV5A 4JL2A 1AH0A 4H7VA 1B3VA 3IUDA 1I1WA 3AHYA 2R24A 3QR3A 4L6HA 1US0A 2YLLA 4G56A 1MEHA 3TWAA 5AECA 1OD8A 3DU0A 2OWWA 1TPB1 3BK0A 2DIEA 1KW1A 4DLFA 3GH7A 1OX6A 1LQAA 3S6TA 1GONA 2J7EA 3M47A 4IFKB 4OE7A 4KCTA 1G9HA 1E1CA 1KM1A 2GJNA 4GD0A 2CZDA 5F1VA 4S39A 3KL0A 3OLDA 4O50A 2GGIA 3PSWA 3JR2A 1AZ1A 3QSTA 1EYEA 2G3NA 4DB7A 1A0DA 3FY1A 4DO5A 1F07A 1Y7VA 3OEXA 4ZBCA 1G7VA 1D3GA 1XLEA 3WQDA 3S2LA 4MKVA 3HIJA 1I2QA 1XC4A 2YW4A 4GFIA 2DZBA 4ZO8A 1S5MA 2F6XA 1NP0A 3LNMA 4JTLA 3DHDA 3OLGA 1SJBA 5A6TC 3ZJ7A 3RJYA 2QDGA 2Y7EA 3M7WA 4ACYA 3AICA 2YZRA 5IXEA 3LGGA 5A8OA 3QZEA 2DSUA 4GXWA 4GINA 4HMCA 4ZO9A 3M9YA 4LC6A 3R89A 2QQ6A 1OG6A 1H7WA 5REQB 1CT5A 4LS1A 3DYMA 3P80A 4J3WA 4QDPA 2NV1A 4RR4A 1RP8A 2GL5A 5KINA 4KWSA 1J10A 3ZOAA 4KFNA 1GJPA 1CGTA 4JCMA 5HMEA 4LB4A 4DNHA 1KRBC 1JNDA 1XYCA 2VX5A 1TV4A 1LG2A 2EPMX 1EDQA 3QPZA 3HB9A 1EA9C 3WQCA 2VFIA 3NSXA 3W71A 3S1VA 4LUTA 4U4MA 1ZY9A 1SW3A 3WDHA 3U6WA 4DBSA 4KGJA 1M1BA 3IGXA 4NP7A 2X2GA 3BGAA 3L65A 3LA4A 4NNCA 4U31A 3O3RA 1BPLB 3SGGA 3SY5A 3WDJA 2YX0A 2WVVB 3TQPA 1PX8A 1EHNA 1W9DM 3GK0A 5HQLA 1AQ0A 1O60A 2HVMA 3W1QA 2NQZA 1V5XA 2WCSA 1Q6EA 2Y8KA 3OBEA 1AQMA 1Q65A 3N25A 1UJPA 3T40A 3ES7A 3NEHA 1CGXA 1X39A 4AEFA 2YJQA 5TQLA 4K7YA 5FIPA 5E0FA 2O7QA 3E02A 1T8QA 2WB5A 5F4SA 4KCUA 3SY1A 3SW6A 1XCFA 4UTUA 1JDFA 1CX9A 4EWJA 2JEPA 1J11A 4RDVA 3ZIZA 1BWKA 2NUYA 3A4AA 3KVKA 2QCNA 2WJZA 2RKXA 4AD4A 2C7FA 3FNDA 4A3RA 4W85A 4PCFA 1XFBA 1BRLB 5AHNA 4QJ1A 3CM4A 4AZBA 3LMYA 4Q4RA 3NQBA 4Q8MA 4A2RA 3W27A 2BHUA 3CUGA 3TA6A 3MT1A 2CETA 1PTDA 4Y9MA 3QV7A 2NWSA 1EDTA 5EGRA 2A79A 4PBEA 5D8WA 1CEOA 4IH3A 4NVTA 1PSCA 1SO6A 5HAOA 1W6TA 3VIJA 4BF5A 3ZVHA 3GZ3A 5IM51 1H3GA 3IJ8A 4QHRA 3FGCA 2TODA 3STCA 1KQYA 2ZX5A 5HATA 1O94A 2CU0A 2JF6A 1KFKA 1IWAA 4HNVA 4JR5A 3GVGA 3LRKA 2PP0A 3E9AA 3R79A 1R9XA 1S3HA 1AJ0A 2Q8XA 4MWAC 2FDMA 3VO0A 3QPEA 4S3CA 4HU3A 5LSMA 5AC6A 1SVDA 1MZRA 2Z1KA 3MI3A 1R0MA 3B97A 2YDQA 4HGXA 4ECLA 3ITGA 5HDRA 5JXQA 2IXVA 3AIQA 1NF0A 2UY3A 1GNXA 1RH9A 3M0HA 3AYTA 1QWKA 1N8FA 4MADA 3PTDA 1DWHM 3PZIA 3RU6A 2INEA 3GVVA 2ZC8A 4HKPA 1NY1A 4IWWA 1M6JA 4B9YA 4U10A 3E0IA 4HA4A 1TJ1A 2NV9A 2GJLA 3G2GA 4XWUA 3N15A 3EOUA 1VD6A 3VDBA 3MP4A 4N0RA 3N17A 4AX7A 2A3BA 1A5KC 2BZNA 9XIAA 1H2JA 2VT0A 1VBUA 3M6DA 5LYRA 5CPTA 4V1XA 3M4HA 1W2VA 3MMUA 5F2MA 3OQEA 3GXIA 4PMQA 3T0AA 4J9JA 3PULA 2VX7A 1YDOA 1KCXA 1ISXA 1XLCA 2RUSA 4G1KA 4C1NA 5C71A 4HJWA 3WMSA 2GFTA 4XVEA 4JYDA 4DUOA 1TJRA 1I2RA 4Q4MA 2DEPA 2FJUB 5DMLA 4ERGA 4GI4A 4BI7A 1VFLA 3OYXA 3IVTA 2ZUVA 4JFUA 3WQOA 1CB7B 4PUUA 2Z28A 3ZO9A 4FSAA 3TA9A 1PKMA 4G7EB 5K3VA 3GB6A 2Z2AA 1BHGA 2OWXA 5C0QA 1PIIA 1FRBA 2BX7A 4QLJA 4PZVA 4OKDA 1K7XA 1R8LA 5HNNA 3T44A 3DHPA 4XAFA 1WCGA 4S3KA 4EKJA 2PC8A 1VFUA 1CECA 2UBPC 5FEWA 5H91A 2QHAA 4S2CA 5A6KA 3GBEA 1DL3A 1EP1A 4K6AA 2ASHA 2GUYA 2W61A 3WENA 2DJLA 3BZGA 4QXIA 4IPPA 1V08A 2XWEA 1FH7A 4DPQA 3T4WA 1PPIA 2J74A 2ESCA 4Z0SA 3WNLA 5K2ZA 4KT2A 1V02E 1YIXA 2DW6A 2W3ZA 3GX9A 5KZ6A 3TZFA 1BEUA 5CPOA 2D1ZA 4UZSA 4L4OA 4G7FA 4IG2A 2BVTA 4DXXA 4H2HA 1E51A 3LHWA 5B7ZA 5FF3A 1AW1A 1GQKA 5FJIA 3VKDA 3WQFA 4LB3A 3SRDA 1H7RA 1EWDA 4X0VA 3W85A 5IBXA 3W7DA 2VVNA 1AD4A 3AS2A 3GO2A 4HHHA 3U7VA 1OABA 1Z48A 4M7SA 4P7OA 2XSAA 3GNXA 4MIMA 3LD5A 4LH8A 2Z27A 4MB1A 4LCQA 4CNNA 3F4NA 4GACA 3H54A 4C6DA 1DXEA 2G97A 5HMSA 1BF2A 3ITOA 4E2VA 1VFOA 1VRXA 2VGFA 4BS0A 3UU0A 3RPTA 4E4PA 3GXTA 3NGJA 2E09A 4EF8A 1AD1A 1GZ1A 2X1UA 5I07A 3M44A 1S46A 1F4HA 1YXYA 3HU7A 1S2WA 2DT2A 5EBAA 3NL2A 4MYXA 3OHIA 3A21A 5I3JA 4IPLA 1XCXA 1DWFM 5A8NA 4BWLA 3TV8A 4DAIA 3S9IA 2YXOA 4BEUA 1W9BM 2O9OA 3M0JA 1TTJA 4KRZA 3NQVA 3ALGA 5AC4A 2HTMA 4JNMA 1MO0A 1EJXC 4DZAA 5D05A 3DFPA 3HGJA 3M07A 1V3LA 4GQBA 4IMFA 1I60A 4XV0A 1Q6GA 4UFMA 5DXYA 4DJFA 4J7RA 3N2OA 1LWIA 2YW3A 2YOCA 4I5UA 4QDWA 1OZMA 1PWMA 1E4MM 4PEEA 3MV01 3XINA 1S5NA 2NXHA 1XLGA 3EXRA 3O1NA 3PG9A 3W37A 4JYFA 5FKYA 1DIEA 1ZTVA 3UWZA 3H23A 4GI8A 1B3OA 2PDJA 4W8BA 3WEOA 4GYKA 4TVUA 5BMWA 5EY5A 2DT1A 3ISIX 4U5IA 5I00A 3GYCA 2OYKA 1S39A 1KGWA 3WD0A 1DWIM 5CBBA 3UD6A 4MFDA 5CAHA 1RBAA 1RBOB 1C8VA 3APGA 1EOMA 4LU0A 5D2VA 5LHEA 2IS7A 2OZ0A 3MSDA 2OZ3A 4LOCA 3G8EA 1W8SA 1B30A 5AFDA 1IGWA 3ALFA 2GSEA 1IYXA 3UWEA 3I3DA 3S0CA 1MQRA 3WEZA 1JNEA 1W5PA 4HQVA 2O0TA 2R14A 1W17A 1C8XA 4GKLA 4TV5A 3W7KA 4B3KA 1EF3A 1SZGA 2PTYA 2C8NA 4LANA 3W2UA 3TW9A 1UG6A 1H4PA 1Z41A 4OBTA 3QW3A 2WQPA 2ZZ7A 1OCNA 3MJYA 2EPOA 3LV6A 2A5HA 4QCEA 4OV9A 1RD6A 4C6CA 1XYZA 4J35A 3GDBA 4CQCA 4D6FA 5LIYX 3FSTA 5ABEA 1A5BA 3G6LA 4US6A 4LYPA 2D0FA 4CU7A 4QTGA 4OT7A 3B04A 2WV8A 5IRPA 4H7CA 3DFTA 3QY6A 5BROA 1UQYA 1GOOA 2Z7KA 4XTDA 3PSVA 4QCFA 3ZT5A 1TR9A 2E3ZA 4D9PA 3VYLA 1OBAA 4GGHA 2XFRA 1OT1A 1SZEA 2OZTA 4KRUA 1LLOA 1NFGA 2W62A 4O13A 1MDRA 3N12A 4YTUA 3NM1A 2CIPA 4P7RA 3VKJA 2R91A 3NGFA 4L4LA 1P6WA 2J6VA 4LVFA 2EJAA 3LXCA 2CHRA 2H3DA 1UD4A 3CWNA 3CU2A 3NQ7A 4F79A 4KF1A 3KVJA 4XO6A 1GWJA 1Q5MA 1VJIA 3T2PA 4PTXA 2VQUA 4Q8VA 3A3HA 2HVOA 4XKYA 1FVPA 1SR0A 2FKPA 1OYBA 1DXIA 3KL3A 3C2FA 1A80A 3PY2A 2EKCA 1US3A 3QQWA 2P1FA 2QCHA 1DJGA 4ZQOA 3M1ZA 3O63A 3THDA 1T8XA 1TE6A 4C7FA 3LCXA 2PBOA 2IQTA 2Y7FA 3W1UA 1RY0A 2DVXA 1AQHA 2CC0A 2R8WA 3WNMA 5I79A 3H70A 1F8MA 5C9UA 4PFHA 5I02A 1DJQA 5LA2A 2NQLA 4R9XA 3T2OA 2QLYA 2G41A 3DHUA 5EMYA 5D37A 3B9OA 2WSPA 1P4CA 3POCA 2QAPA 4IXXA 2EGZA 1VEPA 3H53A 3W00A 1WE5A 5A6SA 1REQA 4RE4A 1EJWC 3BW3A 4YTTA 4UBPC 1KBBA 2D2GA 2XIMA 4HZ6A 2VI0A 2VC6A 4A2SA 3XISA 4Y9AA 1XDMA 2YBTA 2RHGA 2EKGA 3MHUA 2XGZA 4LQ1A 4PL2A 4KPLA 3BAWA 3IIZA 3VGBA 2RJHA 2JALA 3TMLA 1CWYA 4EAMA 4ZE5A 3ANYA 4QISA 1UKQA 4R34A 1J9YA 2P3EA 4JX5A 3A23A 5AHMA 1FHUA 1FWWA 4UMBA 1TWSA 1OCBA 2QUUA 3R0DA 4U28A 5D2YA 4QAWA 2V0TA 4WOZA 1WUFA 2AL1A 4DX3A 1EJSC 3UT0A 3BG3A 3A9BA 4Q4SA 4ZE4A 1W54A 4PYSA 4M7TA 4XVDA 2GQAA 4PB5A 3AAMA 1BGAA 2IPJA 5H1WA 3P81A 2NUXA 2J6XA 3AXMA 1DWAM 1KCKA 3W24A 4IQJA 4HNTA 5ABFA 1JUBA 1PHWA 4AHOA 3CWHA 1XRSA 1WKDA 2PLJA 3BVJA 4HSHA 2VRKA 4XX6A 3QN3A 2OODA 1A50A 2WQDA 3QFEA 3AMKA 3M7SA 3W7LA 4TVCA 4JTUA 3SRHA 4EK7A 5I3GA 2Y7GA 3W9ZA 1KRCC 3W88A 3MC5A 3R25A 1OFAA 3M0XA 1RPXA 2ZA3A 3DFSA 2VWTA 5JU6A 2Y24A 4PBFA 5KETA 1FTXA 4GH3A 4I7WA 4DYJA 2ZX9A 3BGJA 1QI2A 2GDUA 2DZVA 4XBJA 2PA6A 3OIXA 2Z24A 1R9ZA 1TJPA 1W2PA 2DSVA 3A24A 5E70A 2VP8A 3B0VC 3NQEA 2J7BA 4UFJA 1RJRA 4E8CA 3SY8A 5BRBA 3B4UA 1WKYA 4TX8A 2BVYA 2DT0A 1X7IA 4P61A 5I03A 1ONEA 3EX3A 4WQ6A 1S2VA 1TPC1 1CLVA 1E9LA 2WVSA 4F0LA 2Z1BA 1KXVA 2PF0A 5A6BD 3S2CA 3PC0A 4N9BA 1BKHA 3Q94A 2ZDRA 2C0HA 2GK1A 4K36A 1EPXA 2DY3A 2C1IA 3SFKA 1PTGA 2E68A 1DV7A 3SN1A 3S47A 2VDHA 1J18A 4NG3A 1V79A 5CJ5A 4Y9PA 1E4NA 1R2RA 1VLIA 1DJHA 3IJIA 4PMVA 1BYAA 1KM5A 3U48A 1RXOB 4PUMA 2PGFA 5FF0A 5I2UA 2BXYA 3W2KA 2NXIA 2D2JA 2QDHA 4JIQA 4ICCX 1GGOA 1KD0A 4AVOA 5D2WA 3RG6A 3FEQA 4Z2GA 3QV6A 5EFFA 1FCUA 1V3KA 3GU9A 3N34A 2DQWA 2O56A 1YBQB 4QG6A 3W7QA 1O6IA 2CKRA 4HZMA 4N42A 3UY8A 2EG8A 3NTYA 5I3HA 1XLJA 1NELA 2VZSA 5CSUA 1GQNA 5K9DA 4MWAB 4UXDA 3GG7A 1TV8A 1WDRA 1JPIA 3ARZA 3HG3A 1ZRQA 2QJNA 3W02A 2GJXB 4L1XA 3W7IA 2YYTA 2DZXA 1MMFA 4P8WA 3A6OA 3B03A 4FI4A 2PSNA 4LYRA 5I3IA 1OX4B 4GBDA 2E5DA 2ZRXA 1ME9A 1N55A 3R8HA 2AKMA 3EOOA 3W72A 1TV2A 3WSUA 3VCRA 1O66A 4FA3A 1NOWA 2YL8A 3C0JA 2ACUA 1TTQA 4MF4A 2ISFA 4NI8A 3BANA 5DFAA 3B06A 1QHPA 5D9PA 1RCQA 2D0GA 4RV8A 3EDDA 1DQXA 3GVQA 1RR2A 3CLWA 2XVPA 3OG3A 1EKOA 1K4GA 3P7YA 5IDIA 1XDLA 4EPBC 3UZXA 2VX6A 1R86A 3EX4A 2QGYA 4IGHA 4DEFA 2XIOA 2CLPA 2WANA 1EZ2A 4EP8C 1OVDA 4NAEB 4K8EA 1FXPA 1LG1A 2X0SA 4J3UA 2WMKA 2R6OA 4KEZA 2YKKA 4GE8A 1EBGA 4TQTA 2RDXA 1RA5A 3TCEA 1IZJA 3WMLA 3HPZA 2RJGA 4FOKA 5D30A 3HMCA 2OEMA 1QK0A 4HNNA 4L1GA 4QSFA 4WXZA 4C6PA 1TA3B 2D69A 4PCNA 4ZSTA 3H2MA 1B3ZA 2X0HA 4ERIA 3THCA 2YPIA 4GJIA 1KFBA 1NDWA 2I56A 1SFJA 4DN1A 1RBLA 1P0BA 4PSPA 2Y8UA 4OU1A 4GNJA 4O17A 1E1FA 1KNWA 4G7EA 3JRKA 1AMKA 1G4PA 1FH8A 4M19A 2X1TA