4GFSA

1.8 angstrom crystal structure of the 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 with nickel bound at active site
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
251
structure length
251
Chain Sequence
b'KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
molecule tags Lyase
source organism Salmonella enterica subsp. enterica serovar typhimurium
publication title 1.8 Angstrom Crystal Structure of the 3-Dehydroquinate Dehydratase (aroD) from Salmonella typhimurium LT2 with Nickel Bound at Active Site
rcsb
total genus 94
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4gfsA00
2Z2UA 3N2MA 1TSIA 1VR6A 3TU9A 3MBFA 1LRTA 1DL3A 2DZPA 3NQVA 1EWEA 4HHPA 2QAFA 1PVNA 3YPIA 4IWWA 4S2CA 1GVRA 1SR9A 1QCWA 1W5PA 5D03A 2RHGA 2BWGA 2EF9A 3M16A 2ZCGA 5HR7A 3TSMA 5AYXA 4HSNA 4UMAA 1GJPA 1SSDA 2RDTA 3W73A 4FXSA 5BMXA 5LNWA 2CZFA 3VCRA 4UIOA 3QW3A 5F2GA 1LTDA 4LS0A 3KRUA 3PULA 2YXGA 4LV4A 1KV8A 3KXQA 8TIMA 2YYTA 3BLFA 4UTIA 2GQ9A 4UMBA 4TR9A 2E6YA 2FPVA 4O18A 5GVJA 4UTKA 2ZA1A 4QNEA 5DBTA 5FF2A 4UFIA 5U7SA 3TFCA 1A50A 4GFSA 1F7BA 4N4PA 3TE9A 3QSTA 4XBSA 1LDCA 4M5PA 3KRSA 1PS9A 4UTUA 4FNSA 2R94A 3DI1A 1ALDA 3HB9A 3CC1A 4XTDA 2Y61A 4I7UA 1PCKA 3N14A 5D32A 3TXZA 1Q6LA 4WOZA 5FEZA 2V0TA 1ZHAA 2A0NA 3QJAA 4R7JA 1TPB1 2ZFAA 4YWIA 4O54A 2QDGA 3CM4A 3LHVA 3U6WA 4BR1A 4O17A 1F76A 4X2RA 3LCGA 1IIGA 1YTDA 4LC6A 3GYEA 3W1RA 2QCFA 4E0CA 4N4QA 4OGZA 4M19A 1JRCA 5AC6A 2Y85A 2ZYFA 2WOQA 4IGHA 4AWSA 3I7SA 3MP4A 3RF9A 3B0UX 2B7NA 2ISWA 3EX3A 1LORA 3P84A 1AMKA 2V9DA 3MI3A 5D37A 4ZQPA 4QSHA 4QISA 5I3GA 1VS1A 2J9ZA 4O12A 3PBWA 1AK5A 3S6DA 4TX9A 3TAOA 4ZL1A 1YYAA 1JUKA 2CLLA 1SW3A 3P60A 4ZVJA 4DELA 2ALDA 3G22A 1N7KA 3QRHA 2WPBA 4UUIA 3LHYA 1VYPX 3LM7A 4LU0A 3NZRA 3GIYA 3LHUA 3HG3A 2VFHA 1EX5A 2F7FA 1SO5A 5DY3A 2BXVA 4MOZA 4RX0A 2YSWA 3U2OA 2PRLA 1DHPA 4NJHA 3W1NA 4EVZA 3UZJA 1TV5A 5KZMA 2NWRA 3TV8A 3W2UA 3GB6A 3CLMA 4MY9A 3NGJA 1MEHA 4UNLA 4XKYB 3UY8A 1TPWA 2NUXA 5HINA 2H6RA 1DJQA 1B3OA 3LRKA 3O07A 5AC8A 4IXHA 1RVGA 3W1UA 2JKEA 4GNJA 2QAPA 3Q94A 4GE8A 2NX9A 3W1MA 1T99A 1I45A 4K8HA 5DCEA 4EWND 3EWXA 1W5NA 4E38A 1ICSA 3UWZA 3W1QA 1TPVA 1M6JA 3PUDA 4JIQA 4BWLA 3QPZA 3NOEA 5CZSA 3ATYA 4O13A 1NEYA 5C6MA 3G24A 1BWKA 4HKPA 1Z44A 3O8AA 1AG1O 5I3KA 1IXOA 4CQ8A 5LKYA 1W3IA 3LXCA 4OU1A 1TTQA 3W1PA 1TV7A 3UQNA 3RK8A 3SSJA 1O94A 1FCUA 5D09A 3S42A 2NXIA 1KFJA 1PE1A 2DP3A 2WNZA 3P5ZA 2BLEA 5I3IA 3I7RA 2RFGA 4CNNA 1TTIA 3MHGA 2VEKA 1ZCOA 5TIMA 3W7DA 1Z42A 4UFKA 2ABBA 1DORA 2PURA 5E93A 5K4ZA 2HS6A 3JR2A 3M43A 1I2PA 4UTTA 2W0UA 2I1OA 4FF7A 5EYWA 1FWWA 4CNPA 3MI6A 3NO5A 5KINA 1WXJA 5KZEA 4PL2A 1LCOA 1VJIA 3GR8A 4U28A 3TQVA 3OHIA 2NX1A 3MUXA 1G4SA 3E96A 1ZY9A 4TO8A 2Y62A 3NQAA 1LZOA 1NFBA 1H61A 3C61A 3G0UA 2H90A 2X1TA 4BWLC 4IXXA 1TMHA 3O6CA 1FY6A 3KVJA 2VFIA 3W7RA 4RZ6A 3PAJA 3QZEA 3CWOX 4B5NA 1MZHA 3IEBA 2AGKA 2DORA 2W79A 1KW1A 5D2VA 1HFBA 1QFEA 2DZUA 1K7XA 2GQAA 3C2RA 3W87A 4JEQA 2QR6A 2WV8A 4A2RA 2PRMA 2ZRXA 3O15A 2OMAA 2H3BA 4NX5A 1SZNA 1KTNA 1DQXA 2WJZA 4JR5A 4U4MA 4GJ1A 3LRMA 3W7JA 3OA3A 3RNDA 2A7PA 2R91A 1ML1A 3W86A 3LGEA 3W9ZA 3NQDA 2IQTA 2ZRUA 1L2UA 3TC7A 3GKFA 2G97A 4IQLA 3GAKA 1RQHA 4Z1DA 1BEUA 4ZQRA 1YLVA 1MO0A 2QDHA 4UTLA 2ABAA 4N6EA 3DFPA 2GQ8A 2NUYA 4JX6A 2RKXA 4XWUA 1XI3A 1IF2A 3U8GA 4WY0A 3GLCA 3W7EA 1SQ7A 1TJPA 1W1ZA 1MSSA 1G6CA 1A53A 4O1CA 5AHNA 3TX9A 3M5ZA 1KFKA 4UFMA 1QO2A 2QUVA 3BVJA 1JCYA 1UJPA 5C54A 4GBUA 5AHFA 2Q8LA 3A5FA 3C52A 2V82A 2DZSA 4O50A 1CI1A 4LC8A 2E1DA 4O1BA 2A21A 2BSLA 5FESA 3UD6A 1QMLA 3W7CA 1TJRA 3S1UA 4FNUA 3KVMA 1AW5A 1K02A 3TIMA 3DFOA 2VKZG 2VEIA 4N9CA 2YW4A 3TR2A 3W84A 4EF9A 2NX3A 3STEA 3TFXA 5C2XA 1OF6A 1ZAIA 5AHMA 2YR1A 4E2BA 1JRBA 2WSQA 1R47A 2B4GA 3DENA 5AHEA 5D2XA 3PB0A 4OQVA 4O4VA 2P1FA 5A8GA 1NF7A 1Q45A 2E77A 3G1VA 4O1AA 3TROA 2ISVA 3MO7A 5KTLA 1RR2A 4HNVA 2C1HA 3EXSA 5FI8A 1G67A 3FKRA 2GOUA 3NM3A 2FJKA 3M9YA 3TW6A 3GDRA 4R34A 5TQLA 4ZQCA 4PC8A 5LNSA 4UR7A 3B0PA 3WK1A 3M5YA 1RD5A 5SWUA 4O16A 1PL9A 5HUOA 1WA3A 4GUGA 3A22A 1EUNA 1OX5A 3DFNA 1ONRA 3M44A 1OJXA 4KFNA 1B4KA 4JTKA 3NL2A 1SZEA 1G7UA 2G95A 2J9XA 2OT0A 3G3MA 4LNYA 3BLEA 4Y8FA 1UASA 1Z41A 3W7QA 5C55A 1OYBA 1XUUA 2WNQA 3GXTA 2Q8ZA 3FOKA 3HOJA 3TSDA 2GPTA 2E09A 4JYFA 1VGAA 2QCGA 2FPTA 4JGDA 1VLIA 3LHZA 1KM2A 3P62A 4HSOA 3OVPA 1P0NA 2VFEA 4NXKA 2C14A 3QH2A 1K3UA 3THAA 2VENA 1S5WA 2QCDA 1SW7A 1FBAA 1I8JA 2B0MA 4IJBA 4JY9A 2J27A 4NX0A 1D3HA 5DY2A 1LM1A 3LV6A 3NR0A 4RZ5A 4LW7A 4LVAA 1G69A 3LXAA 3UWVA 2GJLA 3BW2A 2KZHA 4JIPA 1B4EA 1JQXA 4RKAA 2PC4A 2Z1BA 3MJYA 3P81A 3GZ3A 2CLEA 3LRLA 3P5YA 4DEFA 1ZALA 1FDZA 3DGRA 3LHWA 4RV8A 1K8YA 1AW1A 3T55A 2V81A 3H55A 1EWDA 2NWSA 4P2VA 2E5DA 5FF3A 1VZWA 1OFOA 1GVQA 3LX9A 3HPSA 1T0OA 4A21A 2QUTA 4HNUA 3G1HA 2JKPA 5BRBA 4NUWA 1H7PA 3M41A 4G1KA 4JTUA 3RLUA 2V2CA 1ZENA 3HQ1A 3UPWA 4WY0F 1GT8A 3WJXA 4GUFA 2DZWA 3CQ0A 1KTBA 4LS1A 3G1DA 4A3UA 3NYZA 7TIMA 3RU6A 4UTHA 1VHNA 4IMEA 4Y90A 2VOMA 2YYUA 2O7SA 1XBZA 4Q32A 3TJXA 3NPVA 1LOQA 2QF7A 3P82A 1W3TA 1H60A 1RQBA 1WYIA 4N9EA 1JUEA 3TDFA 5LSMA 1X1ZA 4DBDA 4MYXA 1LP6A 4MZ8A 4LRTA 1F6KA 4IMFA 1UCWA 1MEIA 5H91A 2C13A 1X7FA 3NZ1A 4K7VA 5CGQA 2QUUA 4W9TA 3C4UA 1I2RA 3EX2A 2ATMA 1E51A 1KFLA 3BLIA 3BGJA 5D2TA 5KSWA 3IRDA 2QCEA 5IBXC 1XDLA 3GK0A 4DQWA 3PS7A 4FX8A 1WOAA 3HG5A 3WK0A 3FJ6A 4FNRA 5EY5A 3N3MA 3P67A 3ZS4A 1G4EA 4KFPA 3S5YA 3LB0A 4O15A 3ANYA 3RLVA 1W54A 5CZTA 1IIHA 3QQ0A 3QMRA 3DHFA 2A7NA 4ADUA 4TIMA 2CLKA 3ZWTA 4C1KA 2WO5A 3RMJA 3W1TA 4AMAA 4P61A 3W85A 3HG2A 3GDLA 3K30A 3USBA 4BFAA 3NQFA 2CFFA 4LVFA 3MMTA 4WJEA 5A5WA 3SR7A 5AYYA 4Z0JA 5LZLA 4NT0A 2XFWA 3PBVA 4RJEA 1B57A 3W7KA 4IMCA 2TSYA 1S5VA 2E5CA 4OBTA 1H7XA 1C29A 4JTFA 1K7EA 5G1TA 3FS2A 3W83A 1UBSA 3KVKA 2V5LA 1JVNA 1Q6OA 4RLIA 3PY2A 4DPQA 3IVSA 1FCVA 3SI9A 1EIXA 3W2NA 2Z0IA 1L6SA 1LBMA 3PVFA 1WOBA 4AEOA 3O6DA 1R2SA 4MIMA 5G2HA 2BZNA 4AF0A 3NVTA 4K7YA 1HUVA 4MKNA 1OABA 3W3OA 1FX6A 1W8SA 3PG9A 4M6QA 1SW0A 3CEUA 3O06A 4A29A 3IGSA 1LROA 4NJKA 4UTMA 2DZTA 4HN4A 4J9JA 2UV8G 5KZDA 3TKFA 1TTPA 2C3ZA 4UTJA 2YPIA 2I9EA 3PBYA 3M6YA 4MZYA 1SO3A 5ABTA 1N8FA 1MXSA 3L5MA 5F4WA 1L9WA 4EIVA 1T96A 2P0OA 4XUGA 5CPOA 4D2JA 1KFEA 3OVQA 1O5KA 1Q6RA 3NQCA 3CPRA 3DFQA 3DFSA 3W7OA 3E49A 1R46A 2CLMA 4RZ4A 3W7NA 4JTGA 1QPRA 1M7PA 2ZZ4A 5K4XA 4JTTA 1JCXA 3IIZA 5DXXA 5L6UA 3W7PA 1J2WA 4JX5A 5DBUA 1YPIA 2QKFA 3MYOA 4FXRA 1KM6A 3C2FA 3G3DA 5F2MA 3OIXA 4QIUA 4NNBA 3VFLA 1XM3A 4OT7A 2A1YA 4JTEA 4N9DA 3NL6A 1LRNA 1DVJA 1GZGA 1QPOA 3THQA 2LLEA 3IVTA 3G1XA 2W6RA 1H50A 1G4TA 5D02A 2YFOA 3P7YA 1TPUA 1JQVA 3PUOA 1QOPA 3NXFA 1GOXA 5D30A 3O16A 3P61A 1VCFA 1FWRA 1VCVA 3FFSA 2OX1A 3EKLA 1XFBA 4ZQMA 4LOCA 3T44A 5D05A 4HPXA 2YCEA 3PB2A 3L5AA 1F74A 3WJZA 2ZRVA 3GNNA 2FTPA 3EWYA 5AB3A 3SFKA 1K8ZA 4Y96A 5HR6A 5LNRA 5I3FA 2V8ZA 5I3JA 1QNVA 2VEPA 4TMBA 3EWUA 2XN1A 4MY8A 1I2OA 3W88A 1MEWA 3KAOA 2CZDA 2WQPA 4LTSA 4O19A 4KFOA 3OEXA 4OE7A 5LHEA 3D0CA 3C2EA 4O10A 3UWYA 1OFPA 1WBJA 1VYSX 1FXQA 5I3HA 1TQJA 5IM51 3V1PA 1IXPA 4QQ3A 1P4CA 3W6YA 1GPWA 3HMJG 2BX7A 3NAVA 3PSVA 5AOUA 3ABRA 1LYXA 4CNOA 1TO3A 1P1XA 1QDSA 4ALDA 1TTJA 4FX7A 4I7VA 1SFJA 2TRSA 2NZLA 3LTYA 2VFDA 1EP2A 4K6AA 4AAJA 2NXHA 4PODA 2QJIA 3KRZA 3M47A 4ICNA 4Z1AA 1O60A 1V5XA 4AWTA 1FWNA 3M1ZA 4OV9A 2GVGA 3AJXA 4IMDA 3S5NA 2JK2A 2J9YA 1GVOA 1T8XA 3MHUA 5HQEA 3L21A 2ZRWA 4UFLA 1UB3A 1VCGA 3CU2A 3UNDA 4K39A 5CPLA 5CZ0A 1W3NA 1EPXA 2ISSA 5EPDA 3FKKA 1THFD 5DCBA 4WXYA 4CLMA 3MHFA 1X8FA 1VLWA 3DH7A 3CB8A 3S1WA 4H3DA 3B0VC 2OZ0A 3BO9A 4OWGA 2VELA 2QEZA 5G2IA 5FF4A 1GVFA 2FPYA 2X1RA 1A5AA 4WX2A 4LUIA 2FB3A 3AO0A 5EA9A 2C0AA 3JRKA 2ZZ3A 3NL5A 5AHLA 3LBCA 1IXQA 1I4NA 1SSGA 3W1LA 3W2KA 5DELA 3GXNA 3QQ1A 2Y70A 4GWEA 1XDMA 1FWSA 3B03A 4JY8A 4IMGA 5AN7A 3L5LA 4Q4KA 1GYLA 1W5MA 4LVGA 2DU2A 3KX6A 3NQEA 3ABSA 3TA6A 3LI0A 4JTSA 3ZWSA 2NV2A 1YTEA 3MP5A 3DU0A 2B7QA 4IPJA 2EKCA 1K8XA 3TXVA 2ATSA 3OG3A 2J24A 4Y6GA 2FDSA 2GVJA 3DFTA 5FEXA 3S1XA 4MJZA 3WK2A 4M7TA 2ZRYA 4FHAA 4JXCA 1LLZA 4UMCA 5D04C 3DXIA 4LV9A 4K38A 3H53A 3HGSA 1OFAA 4Y9AA 5BOOA 3V75A 3S5ZA 3W2JA 3GXPA 3G1YA 5K2ZA 2EHHA 1H7RA 1JCJA 4Z0SA 2YW3A 3N34A 3GX9A 1SU5A 2FIQA 3S5OA 4OHQA 1NF0A 3HPXA 2AQWA 4DF1A 3SGUA 5BNKA 3M7WA 4UR8A 3NNTA 3SW6A 1F05A 3L66A 4K37A 1N55A 1SFLA 5AYZA 4QJ1A 1TREA 1A5BA 4ORIA 1JCLA 1KV5A 2NUWA 1LOSA 3IGXA 3L65A 4LY8A 5K9XA 1DOSA 3KHJA 4KKXA 1OFBA 1YXYA 1SZGA 3W76A 1FXPA 4KWWA 1TQXA 5LNUA 4I7WA 4R33A 4IX2A 1OYCA 4MLJA 1H1ZA 1PCWA 3DBPA 3PG8A 4Z08A 2R14A 1RPXA 1JCMP 1LBLA 5D2WA 3ZFHA 3I7QA 3NPWA 4UTWA 3TAKA 3OVRA 4JICA 1GTHA 4L4LA 5DCDA 1SPQA 1QR7A 1GYNA 2YX0A 4GXMA 1NSJA 3TMQA 1SUXA 3TMLA 3TJLA 3W2LA 1AL8A 4ADTA 4NVTA 2CZ5A 1U83A 1H62A 5CG7A 5LGXA 5FF0A 3INPA 4BI6A 5G4EA 2J88A 4FB7A 2CW6A 3N73A 2ZBTA 1LRQA 3P80A 4WUIA 3W1XA 3T4CA 1H51A 1OG0A 2H8XA 3BW3A 2ZZ5A 3W7HA 4L4MA 2DZVA 1F2JA 3VE7A 1OX4B 3N9SA 4PCFA 3N9RA 3W7IA 3NG3A 1YPFA 2QJHA 1EB3A 1HL2A 3IIOA 3NQ6A 4GUJA 4IUOA 4AF0B 4DO6A 4RK8A 2YFNA 1TPFA 2CLOA 4AHQA 3NQ8A 3SIZA 4WD0A 4PL1A 1HO1A 1JUBA 3IIPA 1XXXA 1RZMA 4RR4A 4XZ9A 2TMDA 3HF3A 4LWWA 4JTLA 1PHWA 3NQMA 3WJSA 1K03A 3E9AA 4UXDA 4AHPA 4EOUA 5F1VA 5H2ZA 1VRDA 4O1DA 5FEWA 5U4NA 4YL2A 2PRHA 2CWNA 1EA0A 4N9BA 3L2IA 3QW4B 1ADOA 2VEMA 4JX4A 2HS8A 4JS3A 3S0CA 1D3GA 1J4EA 4LS2A 4E2DA 4O11A 1VQTA 2RH9A 3W75A 1YTKA 3VI2A 4O57A 3W2MA 3WFAA 3HGJA 3STGA 3CEPA 3DI0A 4BI7A 4AB4A 1GTEA 3QEZA 2G96A 1C9DA 3QPYA 1X6UA 4RXFA 1ZFJA 2EGZA 3QC3A 1TYGA 4QNWA 5J5DA 3KVLA 2ZTKA 3ABQA 5DXYA 3EX6A 5L9FA 1YDNA 2EAWA 3QMSA 2C19A 1A5CA 4WOQA 2Y7FA 3EX1A 2ZZ2A 4NJJA 5BMWA 3NA8A 1S5TA 3MYPA 2WNNA 1R2TA 4X22A 3HGRA 3L67A 4ML9A 3R13A 1KBJA 3HG4A 1OYAA 3LI1A 5HULA 1IGSA 1DBTA 5EBUA 1BWLA 2HTMA 3G1FA 1F6PA 4LT9A 1ZAHA 3LCLA 2I14A 3HO8A 6ALDA 1K7FA 2DJXA 5IBXA 3LLFA 2FFCA 1XCFA 3F03K 4XKYA 4JYDA 1R2RA 3PUEA 1Q6QA 4LRSA 4M7SA 4YCPA 1F73A 1GG1A 4AHOA 3M5XA 1LBFA 2D73A 5EKYA 3S8HA 1ME9A 3EWZA 3KOFA 1G7VA 5J5RA 3B4UA 4IPIA 4CCDA 4BI5A 1OHLA 1JJKA 3Q37A 5F2LA 2VXNA 4RXGA 3NQ2A 3VE9A 4WZHA 5FEPA 3G0XA 1B9BA 3LBMA 2Q3OA 3IIXA 1TRIA 1I2QA 4EF8A 3RFAA 3QFEA 4XBKA 3VKJA 1WV2A 3E0IA 1OF8A 3NQGA 1Q3NA 2ZZ6A 3HGOA 5C5YA 3JS3A 4IOTA 1FCQA 4M6PA 1OFRA 1KM5A 3HJZA 2CZEA 2QCMA 4DXVA 3UWWA 3EB2A 1YXDA 1AL7A 2G5WA 3CHVA 2FQIA 3EEGA 1QO5A 3UY7A 2P10A 1KM0A 1EP3A 3GDMA 5F1UA 1YXCA 2Y88A 2BTMA 2C18A 5TBOA 3TW7A 4GUHA 3LCFA 2ZZ1A 1TV8A 5LNVA 2Y7EA 3F4WA 4UTWC 4R53A 5BW6A 3UPBA 3B04A 3W7MA 4LVDA 4N02A 3GDTA 1ICPA 4AH7A 2H3DA 3STFA 3LOTA 5F4SA 4S2BA 2X1UA 1GVSA 5CSSA 3CIWA 2X1SA 1KBIA 3SECA 3I6RA 4HNTA 1CW2A 2GVLA 1TPEA 4YCOA 4GRSA 4NNCA 4CCCA 3T78A 4O52A 1EUAA 1W37A 3BG9A 4ZQOA 1XBYA 1L6YA 4M6VA 4HPJA 1SZFA 1R30A 4BF9A 4ZZ9A 3CT7A 4QM1A 3L9CA 3IIVA 5AC7A 5HWMA 2ZTJA 4MVAA 3W71A 3OBKA 2CLHA 3BK0A 3EWWA 1VPXA 2R8WA 4JDBA 2WSYA 3R8RA 1O95A 3C8FA 3M5VA 3LDVA 2QCDB 3LERA 4IX0A 4QITA 5HWJA 2V2DA 2V30A 5LHFA 5EL1A 4YLWA 1I2NA 3IGUA 4Z1CA 3W74A 2ZDRA 4XTIA 4Z1BA 3QMTA 4O4WA 4NU7A 1Y0EA 1QOQA 3NPUA 3A21A 5G5IA 4CQAA 4NZJA 2E6FA 4O8RA 3BARA 2Z6IA 2ZA3A 3H54A 1ICQA 2VC6A 2FLIA 3DAQA 1QWGA 2JBMA 1TPC1 2Z6JA 4FIRA 1KM3A 1VYRA 1KM4A 4AVFA 3G1AA 3GVGA 1V7YA 2A6LA 4ORMA 3ATZA 1OFQA 2QCLA 3Q58A 3W7LA 4NJIA 3GDKA 3L0NA 1QPNA 2A6NA 4POCA 3P8IA 3F1QA 1ME8A 3NQ7A 1TPDA 2HMCA 4FNTA 1HTIA 1GG0A 3TNOA 3BGGA 1PHQA 1W5OA 3VNDA 1KLYA 4HIBA 2CU0A 3FEMA 3MI2A 4JTJA 3DHDA 5E1QA 5T26A 5D2YA 2NV1A 3LCXA 4JYEA 1OK6A 3WJWA 3W1AA 3F4NA 4O28A 1O4UA 3NEVA 2PE4A 4CCEA 3GNDA 2ZQ0A 1U5JA 1FCBA 1ME7A 1W56A 2VFFA 3W23A 1KA9F 4FX6M 3STCA 1GEQA 1JCNA 2V5BA 4DF0A 2A4AA 3B06A 3IV3A 4OV4A 4N6FA 1WX0A 3HPZA 2Y89A 3L68A 3TSBA 4ZMGA 1UUOA 1YDOA 2GUUA 3FYPA 3HIJA 5CKSA 3A23A 5HJLA 3MWAA 3QM3A 1BKSA 2VFGA 3SJ3A 2ZA2A 4NNAA 4K8EA 4MFDA 3SY5A 4DO5A 4JD4A 1H7WA 1NVMA 1W5QA 3O63A 4O14A 4FO4A 1OVDA 4N2YA 5G1YA 3BV4A 4FNQA 2H8ZA 3DKLA 2NLIA 1XKYA 5MHBA 4C1LA 3B8DA 1JULA 3TK7A 4NQ1A 1WDWA 1A5SA 4FEZA 3GAYA 4MFEA 3SGZA 2A5HA 3DZ1A 5E0KA 3TUUA 3MBDA 1KFCA 1H63A 1P5BA 1HG3A 2OCZA 3MW7A 1KLZA 4O0ZA 1L6WA 4FNPA 4K36A 2NXGA 4UTTC 4O0KA 1C8VA 3EXRA 3FIGA 2OT1A 3C0JA 1M5WA 2RDWA 3N19B 3W70A 1UUMA 4DO4A 2XN2A 3A9IA 4LUJA 4Q33A 3G8EA 1PIIA 3FYOA 2XN0A 2YZRA 5LGZA 1WAUA 1ZAJA 2YGYA 3TQKA 4H6KA 3PM6A 1OX6A 3O05A 3UXAA 3P74A 1RV8A 4A22A 2E6AA 3CIXA 3LHTA 3G8RA 1Z48A 3PC0A 1OFEA 2C6QA 3WK3A 4TU1A 5K9CA 4BK9A 4ZQNA 4UFHA 3G0SA 3C56A 1XBXA 1HO4A 3NDOA 2GJNA 5G4WA 1OX4A 4UC5A 1WQ5A 3LV5A 3UXDA 3FJLA 4ONVA 1YDVA 5HMSA 1XUZA 2OJPA 3R5EA 1IXNA 2Y6ZA 1FDJA 1SO4A 5F2IA 3L0GA 3G18A 4HNNA 3PSWA 5CSRA 1SO6A 4GUIA 4RCXA 4A2SA 1QPQA 5D33A 2YDAA 2QJGA 3C2VA 1W0MA 2QCNA 4MUZA 2X30A 2Q3RA 3A5VA 3N2XA 4TMCA 2TYSA 4WXZA 3QSRA 5K7JA 3ZR4A 3UWUA 1GWJA 3QYQA 2O7QA 3PF3A 1M7OA 3NL3A 3C2OA 1KM1A 4NZFA 2A2IA 3LCIA 3O1NA 2RDUA 2E5BA 4JTHA 2C15A 1FQ0A 3DKJA 4CQ9A 3R2GA 2WSRA 5KMYA 1DV7A 4GC4A 5CZJA 4H4IA 5DN1A 5CPNA 3UWQA 3W22A 2F84A 4I9AA 4PTNA 1H5YA 3B05A 2JGQA 4O53A 1X1OA 3S9YA 3TC6A 5K9DA 1KTCA 1XL9A 2ZRZA 1RQEA 4DPPA 3W7GA 1G4PA 3PR2A 1CX9A 4WY0B 4PFMA 4MPQA 4PEKA 1H7NA 3BG3A 1DJNA 2B7PA 3T7VA 1LOLA 3W72A 3C6CA 4ADSA 1EP1A 3NM1A 3CTLA 1KFBA 4UFJA 1PV8A 4MYAA 4HT3A 5AHIA 3E02A 3BG5A 5F4XA 3EWBX 3IVUA 3EKZA 1NAL1 3PBUA 2DZXA 2CLFA 1OFDA 4YXGA 2AAMA 4QAIA 3ELFA 2EPHA 2HSAA 1FDYA 1FWTA 3R89A 2QCHA 6TIMA 2X2GA 2CLIA 1GQNA 1D9EA 5HUPA 5EMUA 1F5ZA 1TCDA 3O6YX 3UYCA 4UNKA 3C3NA 3LXBA 4UCGA 2C16A 3ABOA 5HNRA 4YMZA 1DQWA 3I65A 1VC4A 4MJMA 3TQ0A 3UZ5A 4XQ6A 3BPWA 2B7OA 1ZJIA 2QCCA 1VHCA 1H1YA 2E68A 5K3VA 2TPSA 3P8JA 5HWNA 3S1VA 1YADA 3R12A 3TCEA 2ZZ7A 3W07A 2FB2A 3LCHA 1WBHA 4FIQA 5AFDA 1ZNNA 1W31A 4JDYA 3LLDA 4DBEA 4JTIA 2JGYA 5G2WA 5DLCA 5FF7A 3M0ZA 5KITA 4PH6A 1XBVA 2Y63A 3FA5A 3L0KA 5D38A 3Q2DA 3EXTA 3GR7A 3BW4A 4NJGA 1FUYA 3TH6A 4JNMA 3HBLA 3KFTA 1TPH1 4DF2A 3A24A 2DJLA 3CWNA 5CPMA 3NPXA 1O5XA 4MY1A 3LTSA 3PWAA 2J6XA 2Y7GA 1VH7A 2E6DA 1XC4A 2JKAA 3GKAA 1DKWA 4MLRA 3LTPA 1OK4A 3G1SA 1P0KA 2PCQA 3T40A 4KWVA 3WJYA 1TRDA 2A7RA 2Y7DA 1H7OA 4MZ1A 2A85A 3SZ8A 4WQ6A 4AXKA 3FLUA 4X9SA 2WKJA 1QAPA 3LCWA 1AW2A 4S1FA 4JN6A 1S3HA 2V2HA 1TIMA 3E12A 3EX4A 4PA8A 1BTMA 4NXSA 4X3ZA 2X16A 1J5TA 4LVBA 1LLWA 3I68A 3QF0A 1EEPA 1TB3A 1JR1A 3MP3A 4AWUA
chains in the Genus database with same CATH superfamily
2Z2UA 1TUXA 1N82A 3RM9A 2WZTA 3YPIA 4IWWA 4S2CA 1QCWA 5LA2A 5ECVA 3GTIA 5GQBA 2FZBA 2Q71A 4E4FA 2WVVB 1GJPA 3VCRA 3O7UA 4S3GA 8TIMA 1PZ1A 4D1JA 2FPVA 5GVJA 5DBTA 1JAKA 4GFSA 1ZLPA 4PMVA 2P76A 1WNOA 1WDSA 4M5PA 3CV1A 4ROPA 4YTUA 3SEPA 2R94A 1ALDA 3TONA 2ZE0A 3U3HA 4XTDA 4I7UA 1EGZA 1PCKA 3E0WA 1IZCA 1Y5VA 4AVNA 3PPCA 5FEZA 1ZHAA 2A0NA 5BXTA 2XGBA 1TPB1 5D9PA 2ZFAA 5CAHA 4O54A 1V08A 4DWSA 2VOTA 1XIJA 3H2OA 4X2RA 3WG6A 1V8EA 1YTDA 5FACA 2G8ZA 3GVQA 3GYEA 5A69A 2CERA 4N4QA 4KEUA 3KEHA 4NASA 3L2MA 2ZYFA 3I7SA 3RF9A 2WMJA 5IRPA 3ZQ9A 3I6EA 1XQKA 4QSHA 3M07A 5I3GA 4O12A 1ODZA 1AK5A 3VXGA 4LAOA 1YYAA 2GSJA 3NZQA 2WZIA 1RD6A 3CZ8A 2WPBA 5HNTA 3LM7A 3GIYA 3LHUA 4DWSB 1QNQA 1EX5A 2F7FA 2PGFA 1BG9A 4IG2A 2YSWA 3U2OA 3AALA 4EVZA 4J3WA 1UMLA 3TV8A 4ATDA 3GB6A 1CGXA 1LQ0A 3BWWA 4XKYB 3DG6A 3L7RA 1DJQA 3RU8X 2BS9A 5AC8A 3CUFA 4YS1A 4GNJA 4EXBA 2V63A 4DJFC 2DPEA 2NX9A 1XYAA 1E43A 2Q02A 3W1MA 1XS2A 2I57A 3S3GA 3H26A 1QNSA 3PZOA 2PDIA 4E38A 2CLPA 1M6JA 1UWSA 4IM4A 4NKCA 1NEYA 2PAJA 4WSKA 3H2MA 3SRDA 6REQB 3O8AA 1DJIA 1NQ6A 4CQ8A 5EBAA 3SIMA 3UR7A 3UQNA 3SN4A 4H01A 4AW7A 2WC4A 4LUYA 5D09A 5J8LA 3AFBA 2I9UA 4JPGA 1PE1A 2DP3A 2WNZA 4GXPA 3P5ZA 2R1PA 2RFGA 1E6QM 2WMGA 5AZ1A 1CPUA 2WBKA 1UD2A 4Q6JA 5TIMA 4UFKA 5E93A 2NT0A 2C7FA 1YIXA 1LWHA 2I1OA 2BOGX 4FF7A 4OECA 4CNPA 3NO5A 3KBVA 4S3AA 1WXJA 1SMDA 1DWIM 1UZ4A 3AS0A 5JU6A 3OLDA 4DZHA 2PSNA 2CC0A 2Y62A 2W67A 4C6KA 1BYCA 1W2PA 3GSMA 2XG9A 4BWLC 3UVIA 4H9UA 3O6CA 4AUBA 1MQPA 3W7RA 3NO3A 4OOUA 3ZJ6A 1A80A 3RO6A 3PAJA 4Q7NA 2OQYA 1T7LA 1S2UA 3CWOX 1MZHA 2VD8A 3IEBA 2AGKA 1VFLA 2W79A 3CXOA 3RRXA 1HFBA 2GQAA 4JEQA 1A5NC 2QR6A 2WV8A 2X41A 5FSDC 4NX5A 4N7QA 1WKYA 1KTNA 4JR5A 4U4MA 3WDRA 3LRMA 3W7JA 2OEKA 1OQFA 2A7PA 1ML1A 3W86A 3LGEA 1DYSA 3NQDA 1BXCA 3TC7A 4RE0A 3ARUA 1V6VA 2WAGA 1AH4A 1R87A 5EGRA 3DFPA 1DIKA 2NUYA 3M0XA 6XIAA 4WY0A 3VZYA 3BZGA 3W7EA 1SQ7A 4Y7EA 1W1ZA 1MSSA 1A53A 4O1CA 5AHNA 4D8AA 3RCNA 3CTTA 3PPGA 4UFMA 1QO2A 2QUVA 1JCYA 1UJPA 4QE4A 4GBUA 5AHFA 2Q8LA 3C52A 4O50A 1CI1A 3AWOA 3LY0A 4G7EB 3S1UA 4D6HA 4FNUA 3GHSA 3KVMA 1OC7A 4RE3A 4I9JA 4N9CA 1UYQA 3W84A 1JAEA 2NX3A 2ZUVA 1OF6A 1Z69A 3HU7A 2P1FA 4PCNA 4Q8UA 4ATLA 4HNOA 4R9XA 3G1VA 1OEPA 5M2FX 2EJAA 4OUIA 4LB3A 1HVQA 3LPOA 2HWGA 2WHKA 3H70A 1G01A 1U1JA 2O9RA 4PBGA 1KBKA 3THDA 4EE9A 1OGBA 4M82A 4I9MA 4FOJA 1QI0A 3FA3A 1VFMA 4W93A 2YXOA 2W62A 3A64A 2GK1A 4FALA 2G3JA 1UQYA 4DAIA 4Q4SA 1EJUC 1EUNA 2ZUNA 2C1IA 1OJXA 4KFNA 1E4NA 1B4KA 1J10A 4JTKA 1F3TA 1VFOA 2DT0A 2OT0A 3G3MA 1DJZA 3CAKA 3NIYA 4Y8FA 1Q6CA 5EMLA 1KR0A 4QE1A 3MMDA 1XH1A 2VVNA 2XFFA 2FPTA 1T41A 5IOBA 3S6OA 2VFEA 4PBEA 1VIZA 1FBAA 1I8JA 2B0MA 3LEPA 4NX0A 8CGTA 4IIGA 3NFUA 4RZ5A 4LW7A 4LVAA 4AIEA 1G69A 3WEMA 2CETA 2GJLA 3BW2A 1DXIA 4ICMA 1B4EA 4RKAA 4GIAA 1J18A 3LRLA 1ZALA 3DGRA 1PKMA 1N2VA 2V81A 4KWSA 3N2OA 2E5DA 1FP8A 1OFOA 5FIPA 1GVQA 4HN8A 4DNMA 3ABZA 1T0OA 4A21A 3RCYA 5FJPA 1H7PA 3M41A 1ZENA 3FSUA 4GUFA 1R3TA 1MFUA 2JIEA 1KTBA 3ZJ7A 4B5TA 4DJDA 2XH2A 3ARWA 1VHNA 2O7SA 1TA3A 4JHZA 3VIGA 3WF1A 1XRTA 4N9EA 3T4WA 3TDFA 2ZC1A 5LXEA 2F2KA 2P8BA 1Y7VA 3H7RA 5C7VA 3QQWA 4FLQA 4ES4A 1E5JA 2C13A 3GTXA 2YBUA 9XIAA 3CGTA 3N4AA 3WNNA 1FP9A 3NCOA 2ATMA 3SJNA 2VRKA 2XIIA 1KFLA 1FKXA 3IRDA 1WZKA 1BSIA 2QCEA 3B8TA 3GK0A 3UFYA 1ZRQA 4LUSB 1SFTA 3DEQA 3VUSA 1N8IA 1WOAA 3HG5A 3WK0A 5C2GA 2BY1A 1NDWA 3FJ6A 3JVAA 1BGAA 1GVEA 5DRCA 3S5YA 1JCTA 3LB0A 4PTMA 1FWDC 3CQIA 4PFHA 1CGUA 1W54A 4J28A 3SCWA 3QMRA 4ADUA 4B3ZA 3ZWTA 2E4TA 4EPDC 1H0GA 2FGBA 3MSDA 4LVFA 3EBVA 4TXEA 3WH6A 4NT0A 3PBVA 3T08A 3BMVA 4XISA 2C79A 3W7KA 6XIMA 3K8KA 4GZJA 2QUMA 2D2HA 4A35A 1S2CA 2IPWA 4JTFA 3UJ2A 5G1TA 4LCRA 1XRFA 2V5LA 2PWVA 2WC7A 1EO5A 3PY2A 4XZNX 4DPQA 3IVSA 2PTWA 1FCVA 3E74A 2J62A 3MZNA 2XVKA 3T2PA 3SB0A 4HHHA 3VA8A 4L4PA 4G7FA 2NSOA 4K7YA 4ZTYA 3VD7A 1W8SA 4DZ5A 3BUVA 2PP1A 1M68A 3NQBA 1SW0A 3PHAA 3CEUA 5JXQA 4GA8A 4UTMA 4NJKA 4HN4A 4ZO6A 3N11A 1TTPA 3NEHA 1AQMA 4UTJA 3W4RA 3OZOA 4YYFA 4LPCA 1SO3A 3CLWA 4GINA 3WLJA 3CAWA 1G0CA 2CCRA 1H11A 4B5SA 4LF2A 4C7GA 2P0OA 4XUGA 5BXPA 2PPGA 4GACA 1QTWA 1AVAA 3FEQA 1KFEA 4F4RA 3OVQA 1PKNA 3NQCA 2DSZA 5GNYA 3W7OA 4ZO9A 4RZ4A 5M3WA 3W7NA 4AWEA 1PPIA 4JTGA 1IZKA 3T9PA 5GJMA 5K4XA 4D1IA 3F5LA 3EMZA 3RITA 3ITXA 3VFLA 5CGTA 4IICA 3WNLA 1F4AA 1Q8JA 4JTEA 1LRNA 2VUYA 1VEOA 1QPOA 3THQA 3IVTA 4X61A 3XIMA 3G1XA 3IPWA 2YFOA 1TPUA 4EK7A 3PUOA 3EZ4A 5D30A 3G6MA 2OO6A 1VCFA 4ZBCA 4P7LA 2P53A 3FFSA 2OX1A 1XFBA 5DANA 2PLMA 2ZRVA 2NV9A 1MXDA 4JFSA 3EWYA 5AB3A 1FWCC 1K8ZA 5HJYA 5I3JA 1GGOA 1UP3A 3LPPA 2Z4GA 2XN1A 1ZBKA 2GVYA 4GO9A 2CZDA 1ZJAA 4LTSA 4O19A 7REQA 4KFOA 5LHEA 3D0CA 4PUNA 1JPHA 4JQAA 1TQJA 3IRSA 1P4CA 4KWUA 3F4DA 5CC5A 1GPWA 1KGXA 1UR2A 3PSVA 1B30A 3KZPA 1P1XA 1TTJA 4FX7A 2ANUA 3VDBA 1XPYA 3T0AA 2HBXA 2TRSA 3HQNA 1EHNA 3LTYA 3AYSA 4K6AA 4AAJA 5LIXX 3UZXA 2QJJA 1EJRC 2F8QA 4PODA 3QBUA 3M47A 2J66A 1SYTA 3FHAA 3DECA 4AWTA 3M1ZA 2G4FA 2BVDA 2BODX 4HCDA 1FFRA 2PF8A 3LPFA 3UCCA 4WJ8A 1T8XA 3ZLHA 4PMXA 4UQCA 2QIIA 4K39A 3VNMA 1UKTA 2HVMA 4D6JA 5DMYA 1THFD 4H04A 5DCBA 4MG4A 1X1NA 4IQDA 4H3DA 3BO9A 2VELA 2QEZA 2XVPA 3AI0A 4WX2A 3AO0A 1YPXA 5EA9A 2FGZA 2Z7GA 3DG7A 4AZ7A 3ZO9A 5DELA 3MTWA 1XDMA 1FWSA 3B8IA 4XZHA 4Q4KA 3P0WA 2ACRA 3NQEA 3HZ3A 3TA6A 3CS2A 3DU0A 1V77A 2GGIA 4IPJA 1UWQA 2PDCA 3WQCA 2ATSA 4Q8TA 4B4HA 3UR5A 4Y6GA 1KKOA 3WK2A 1FWGC 4MB3A 2ZRYA 3BLDA 1LLZA 1J11A 3CL7A 1H09A 2D24A 3HGSA 5BOOA 3V75A 3S5ZA 3ITYA 4FLSA 3AAMA 3SURA 1EDTA 3U7BA 4CNUA 3U0HA 3WUEA 4JBRA 2OZTA 1VENA 4Z0SA 3A3XA 5DX7A 3SGUA 4Z2IA 2Z29A 3EWCA 4UR8A 4DY1A 3ZLFA 4C60A 1CWYA 5AYZA 3PN8A 4QJ1A 4EXAA 1TREA 1YNQA 5D8WA 1LOSA 6PTDA 2UBPC 4H9TA 2VDHA 3SCVA 1DOSA 4KKXA 3S9ZA 1NWSA 1FXPA 3RX2A 9XIMA 4I7WA 3K2GA 4R33A 1B31A 3QV6A 4KRUA 1OYCA 3PJTA 5HMEA 1H1ZA 1PCWA 4CD8A 3PG8A 3W81A 1GK8A 1ITUA 4B5UA 5D2WA 3PZGA 3I4EA 3MCNA 4Y2WA 3MUIA 1GTHA 1MNZA 1XHGA 3GHRA 5KZ6A 3C8NA 1D3CA 2PDMA 1SPQA 1AL8A 1EFZA 4NVTA 5FF0A 1UD8A 3INPA 3WQ6A 5CLWA 2ZX5A 3PNZA 1QNRA 4HNLA 3N73A 3EA2A 1LRQA 3P80A 2H8XA 4LQ1A 3GW3A 3W38A 3EDJA 1GW9A 1F2JA 3E5BA 3QR1A 3ZOAA 2O4QA 4X2PA 2VWTA 3LENA 1E0WA 4FMVA 3GNPA 1UWAA 4DO6A 3D5HA 4RK8A 2YFNA 3DYPA 4AHQA 5DF0A 8XIMA 1M3UA 2WWCA 4WD0A 3N17A 1NY1A 1WUFA 4MDPA 3MMWA 1A5KC 4RR4A 4DWSD 4JTLA 1W3HA 3NVDA 4M80A 1PHWA 3RR4A 2ZX9A 3E9AA 4BA0A 1E4LA 4XO6A 4GMEA 5U4NA 2WMHA 2CWNA 1E9IA 1EA0A 4N9BA 3L2IA 4AD2A 2CHNA 1XC6A 1ADOA 1M65A 4JX4A 4LS2A 2ZUTA 3VIPA 4K2SA 3T42A 3MCMA 1JNEA 3CEPA 4CQDA 4PMYA 5G4HC 4AB4A 3QEZA 3FV9A 1C9DA 1X6UA 4RXFA 1BXNA 1ZFJA 3QC3A 3DFHA 3E6EA 3WLIA 5L9FA 2VL4A 1A5CA 3EX1A 4QDWA 3VNYA 1HJWA 1XIMA 3WMCA 2FKPA 4ML9A 3R13A 1KBJA 1OYAA 4IPNB 1RJRA 4CQBA 5D8ZA 4FA3A 4F8XA 1BWLA 6ENLA 4LT9A 1ZAHA 4G2DA 3LCLA 1JIBA 4QEEA 1K70A 1VFHA 2PLJA 2WLYA 1E6SM 3ID7A 1A5LC 1DPMA 1ONWA 1XCFA 3IK2A 4HJWA 4JYDA 2W3ZA 4JIEA 1PWMA 2PP0A 1F73A 1XYBA 3MVIA 3GNRA 4DB7A 4DN1A 1D7FA 3CHCA 1RSCA 1BFNA 3B4UA 1PXGA 4CCDA 1OHLA 1NIUA 1JJKA 3QHMA 4RXGA 4WZHA 2X0SA 3G0XA 1XH2A 3LBMA 1BTCA 1OSEA 1BF6A 3CUGA 1Q66A 4HZ7A 1NOFA 1BQGA 2ZWZA 5A6LA 1CXEA 3E0IA 1IEWA 3LMZA 4JNZA 5I03A 3NQGA 2I5QA 3BCDA 3HGOA 5C5YA 4ACZB 4IIEA 4M6PA 4ZOCA 2CZEA 2AL2A 1FVPA 2QCMA 3AMGA 4W88A 3OO2A 4WSHA 2FQIA 3EEGA 2MANA 2W9MA 2P10A 2ZX6A 1CLKA 1EP3A 1VEMA 1US3A 3AXKA 1H0IA 3BAJA 2Y88A 4D6EA 5TBOA 3TYBA 1DIEA 2ZZ1A 4MMWA 4IHCA 1EKOA 1UIPA 4UTWC 5BW6A 1UR9A 3HQOA 3W7MA 4AEEA 1ICPA 4AH7A 2H3DA 3STFA 3KWSA 3P0XA 2XIJA 5CSSA 4IFKB 4QFUA 5LIYX 1KBIA 5C8BB 4L6HA 1TPEA 1GUVA 4GRSA 3NSMA 3PPHA 4O52A 3AYTA 4RZBA 4PTVA 1XBYA 3ZYZA 1L6YA 1OT2A 1RK5A 1IGWA 1SZFA 4BF9A 3CT7A 1IT7A 3IIVA 5AC7A 3DYOA 5HWMA 1I60A 3PBMA 2O92A 4MVAA 2ACUA 4B9YA 1W9PA 3BK0A 3EWWA 1VPXA 1RBLA 2R8WA 2B81A 1JDFA 4UR9A 5AVNA 2QCDB 1DIDA 4QITA 2V2DA 3B9EA 3N4EA 3W6MA 5LHFA 1JZ2A 1I2NA 3W74A 4GYPA 2ZDRA 2X8RA 3QMTA 3OPSA 1XIHA 4MB1A 5I2UA 3THCA 3A21A 1QK2A 3ZVHA 2Z6IA 3KP0A 4J2PA 3DAQA 5EFDA 4HPGA 3FYYA 1TPC1 2Z6JA 4FIRA 2G3MA 3GVGA 1XCWA 2QCLA 2O9OA 1E9LA 2DSKA 3SUSA 2KX9A 1S2VA 5CPSA 2QF8A 1TPDA 1QWKA 4A05A 3BGGA 1W5OA 4L4OA 4PSRA 4AC1X 3MI2A 4KIRA 4I8YA 4QQUA 1E0UA 1CECA 3DHDA 5A94A 5E1QA 3LCXA 4JYEA 3BC9A 1V0NA 5JVLA 4O28A 3WQFA 2CKRA 3P14A 2DSVA 1ME7A 4JHMA 3F4VA 1W56A 3S9IA 4DUWA 4DF0A 2WJEA 3AHYA 3TYEA 2Y89A 3L68A 5M17A 3AIRA 3WLKX 4ZMGA 3FYPA 1ONXA 2INFA 3A23A 1B3VA 3WBEA 3MWAA 1YHTA 2R82A 3QM3A 3SJ3A 1O12A 2O9TA 2WZEA 2ZA2A 2BOFX 2Y8KA 4HQVA 4JD4A 2W63A 2DSWA 3CYVA 1W5QA 2I17A 3O63A 4G8TA 2WHJA 2EPKX 4P8VA 4KGLA 4F0MA 1R7AA 3HV9A 3EDEA 4FNQA 2H8ZA 4MNLA 1ZGDA 2NLIA 4C1LA 3TK7A 1JULA 1RHCA 2VRQA 4WKFA 1WDWA 4X60A 4D8LA 4GIEA 2ZIDA 4CU6A 4U33A 3SGZA 4TX8A 3HFYA 5T91A 4P7QA 1Q7ZA 1H63A 4O0ZA 1WCGA 4FNPA 4EPKA 2Q01A 3B40A 3GTFA 1WAWA 1C8VA 1V3JA 2XUCA 1UOKA 2WCSA 4HPHA 3N19B 3W70A 4LJ3A 4H9XA 3MPGA 5FAGA 1BF2A 2XN2A 4AG0A 5EU9A 4Q33A 3SAZA 4AY8A 3CO4A 1V6YA 2WWDA 3H22A 1H49A 1WAUA 4Z2KA 3R8GA 4O0QA 2DUXA 3P74A 2E6AA 4JQ3A 2OPJA 4Z42C 1I9CB 2J6VA 4DNHA 3CO8A 2OQHA 5G4WA 1OX4A 3LV5A 1PIGA 1J0ZA 1YDVA 3GE7A 1E4MM 3RMEA 2Y6ZA 1E73M 1JZ6A 5F2IA 1MW1A 3L0GA 3WDQA 3G18A 1XISA 4MADA 5AC4A 3M0JA 3QGVA 2VR5A 2FZ8A 3BLOA 4D6CA 3C2VA 2OKTA 2Q3RA 3A5VA 3N2XA 3T09A 2DSUA 1GKQA 9CGTA 3UWUA 4GCAA 3QYQA 3PF3A 1G94A 4CQCA 1CGVA 3TW9A 1DV7A 1ISZA 5CPNA 5FD0A 1H5YA 3TN4A 1XL9A 4C7DA 2Q6ZA 3MU7A 4Q4PA 1DJWA 4DPPA 3PR2A 3OLIA 4W86A 4WY0B 4PFMA 4MPQA 1H7NA 1KR1A 3GQYA 2B7PA 3T7VA 4ROQA 1T8QA 3CMJA 3W72A 3K46A 4JIIX 4GISA 1PV8A 3O2LA 5LYRA 4MYAA 4HT3A 5AYBA 3E02A 1L8PA 3EWBX 3OZMA 4WGHA 5JQ9A 4B5WA 4QAIA 3ELFA 1FWTA 2QCHA 2CLIA 1GQNA 1BVNP 4V33A 2FZNA 1RK6A 3UYCA 2VGIA 4Q8MA 1VFUA 3BQ6A 3C3NA 2C16A 1E6PA 2Z00A 1UD6A 2PZNA 1QU4A 1DQWA 5FA5A 4MJMA 1A49A 2QJMA 2B7OA 3E0VA 2QCCA 4PMUA 2E68A 3R10A 3WD3A 3P8JA 2PDQA 3EDDA 1OGGA 3V35A 3H6OA 2FB2A 2ODOA 1LWJA 5REQA 3W01A 1F6YA 2PLCA 3WNPA 1QHZA 3ALFA 3LLDA 3RPDA 1GVYA 4JTIA 3FVMA 3KUMA 5C9UA 3M0ZA 5KITA 4UNIA 1K1DA 1RA5A 3ITTA 3UJRA 2WANA 1EYEA 1MMFA 1YW1A 4JNMA 2HVOA 1TPH1 3DESA 5BCAA 3OTRA 4CN6A 3ZM8A 5CPMA 3NPXA 4KBXA 4FPSA 3ITLA 2Y7GA 4NRSA 2JKAA 3GKAA 1DKWA 2QXWA 3N6QA 3GRIA 3CIVA 1C8YA 3T40A 3PWIA 1BD0A 1NP2A 4KWVA 4NI3A 1TRDA 2ZUMA 2Y7DA 4H00A 1RBAA 3A47A 2DVTA 4WQ6A 1TWSA 3FLUA 4H9VA 3S2LA 2WKJA 1AW2A 1FA2A 2Y24A 3J7HA 4JN6A 1JZ4A 2V2HA 4DLFA 4PA8A 4LB4A 3KOXA 4W87A 2X16A 1J5TA 1XFCA 2YCKX 3VDCA 3ARPA 3TWAA 3UT0A 1XIIA 4IMAA 3REQB 5FJRA 1X39A 4IL2A 4C1NB 3AHTA 1TSIA 2PZ0A 1RVKA 2YA1A 1LRTA 1XICA 4DBWA 1ZBVA 1EWEA 1ECQA 2WHLA 2QAFA 1PVNA 4AMCA 1SR9A 3GNXA 1R0MA 2EF9A 3CQJA 4J27A 3TSMA 3MY9A 4HSNA 4UMAA 4MAZA 5C71A 2RDTA 1SSDA 1PX3A 5BMXA 5LNWA 2CZFA 4AVOA 4B5VA 3KRUA 3VINA 1IEIA 2YXGA 1KV8A 3K4WA 4W5UA 3BLFA 4UTIA 4TR9A 1C93A 2ZA1A 4GJIA 3QXBA 3B97A 4QNEA 5U7SA 1NWRA 3TTYA 3TN5A 1UD4A 3KCJA 3PANA 3KRSA 4UTUA 2XINA 3LPGA 3TYDA 1TJ1A 1JZ3A 3HURA 1PTGA 3WFZA 3CC1A 2YBVA 4NAEB 5D32A 3WLSA 2VZOA 5BZAA 4WOZA 2YL8A 3M4HA 3BSMA 2V0TA 3GR4A 2WQDA 2Z1WA 3LHVA 3U6WA 2D2OA 4O17A 1HX0A 1F76A 1ADDA 3TA9A 1IIGA 4LC6A 3UA4A 3W1RA 2QS8A 4OGZA 3WQEA 4HU3A 1JRCA 2Y85A 1CZ1A 1F3XA 2J75A 4ZXLA 1LORA 1XG3A 1ONEA 3GH4A 1W17A 1MW2A 2FTWA 1JUKA 2CLLA 2E25A 3CBWA 1S46A 4A3YA 2V5JA 4ZVJA 3A6OA 1E9YB 4ZE5A 4UUIA 1Q4NX 3LHYA 1VYPX 3NZRA 1E15A 3BICA 1BYBA 1GOMA 1JPKA 3MDUA 4C5YA 3VZXA 5DY3A 2BXVA 4FXFA 1DHPA 4NJHA 3W1NA 3VABA 2PB1A 2RAGA 1B3XA 5RUBA 4JFTA 3NYDA 4MY9A 3UG3A 1RY8A 2CEQA 3UGVA 4H19A 3WNMA 4UNLA 3UY8A 1TPWA 1XIFA 5DRIA 2GDVA 2H6RA 3W0KA 2ZC8A 1W91A 3FGCB 1Q6DA 4AX6A 3Q94A 1DTUA 1KD0A 1V3LA 3ALGA 3SCRA 1M7XA 1I45A 4K8HA 1W5NA 3AQUA 4C6MA 3W1QA 1P0BA 4GHRA 3PUDA 4JIQA 4BWLA 1B3WA 3NOEA 5CZSA 3ATYA 3RX4A 4AY1A 3WNKA 5A3HA 1KQZA 1JFXA 3BJFA 3ONBA 3UPMA 1Z44A 2CNCA 5I3KA 1IXOA 1QW9A 3KDNA 4U5IA 3W1PA 3N2BA 1TV7A 4Q7IA 1O94A 4MNMA 2J7CA 3ONCA 1E6XM 3S42A 1C7TA 3PJXA 2BLEA 5I3IA 2G4JA 1TTIA 3GBEA 1IE7C 2VEKA 4Q4QA 3W7DA 2ABBA 2IPGA 4CEUC 1XSIA 4JTAA 4XBJA 3AS1A 2X42A 2W0UA 2WZHA 2FHCA 5EYWA 1FWWA 5T8GA 5HA7A 4PL2A 1LCOA 3GR8A 4U28A 4L56A 4YN5A 2VDIA 3AZTA 4ZODA 5EFFA 1LZOA 1NFBA 3AJ7A 1H61A 3G0UA 4ZOBA 2X1TA 4V28A 3VCNA 5AZ0A 2DT1A 4LBSA 5CBJA 1TMHA 1FY6A 4J3XA 2VFIA 3WDPP 3U48A 3WLPA 1GOKA 4I90A 3R8HA 3UJSA 2L5HA 4B5NA 3HPAA 1NDYA 4JTDA 4QG6A 5D2VA 3C2RA 3COTA 3BV7A 4LEFA 1YE6A 2PRMA 7REQB 3O15A 2H3BA 5C7HA 4YJ5A 1SZNA 2DEPA 1DQXA 2WJZA 4AIUA 4B5XA 2HE5A 3FJ4A 3OA3A 4F0HA 3AC0A 3ZJ8A 1ZB5A 2ZRUA 1L2UA 2G97A 2D23A 4Z1DA 2J7BA 1Q2RA 2PWEA 4S3BA 4QLJA 2QDHA 1QI3A 4UTLA 1FHDA 2ABAA 1RJPA 1ZBCA 4GKTA 1WO2A 4XAFA 4GI4A 4XWUA 3GVVA 1XI3A 1IF2A 4IGSA 1TJPA 2D0FA 4Q7BA 2E7FA 1OT1A 2J7HA 3BVJA 1NH6A 3L23A 1FWJC 2DZSA 1HIZA 1UW9A 1EC9A 2HK1A 2FGLA 2BSLA 5FESA 3UD6A 1XLDA 5B7ZA 3W7CA 1TJRA 1ZP4A 4YTRA 4TTUA 1AW5A 3GU2A 2VKZG 4HK7A 1WZLA 2YW4A 1FWEC 1QW7A 1A5OC 3GVRA 4PUUA 3K8MA 3STEA 1GKPA 1A0DA 1HJXA 4NHVA 2WSQA 4A8RA 3M7SA 1F8IA 3PB0A 5I07A 3CL8A 3H12A 2ZKMX 4U2ZA 2E77A 4L64A 2RDXA 3TROA 3V3WA 2GDUA 1E55A 3MO7A 2BOEX 2OLSA 5JH2A 5FI8A 1B90A 1G67A 1W3LA 3IJ8A 3NM3A 1V79A 2HDJA 3M9YA 3TW6A 4R34A 3IJ6A 5TQLA 5CPTA 4IIHA 3NZGA 5LNSA 3JUGA 1UH2A 3VDHA 4XZWA 3WK1A 3SDOA 1RD5A 4WKHA 1TA3B 1PL9A 1WDPA 4HU0A 4GUGA 1F61A 1OD0A 2WCGA 3A22A 3CMGA 3MT1A 4J7RA 2ESCA 5FL1A 1SZEA 1G7UA 3LZ3A 4W7WA 4DWDA 2BGQA 2XVGA 4L9XA 3BLEA 1CIUA 1EJTC 1TWWA 2CXEA 2WNQA 3GXTA 1AH0A 1BPLB 3FOKA 1GOQA 2HPIA 3TSDA 3GC5A 4IP4A 1E1EA 4JYFA 2PDYA 4GX8A 1NOUA 2JALA 1VLIA 2PWFA 4PSPA 3LHZA 1KM2A 3P62A 4E8CA 1VF8A 2ADAA 1P0NA 3AYRA 2J79A 2VENA 4IJBA 3WO8A 1D3HA 3LV6A 3NR0A 3UWVA 2EXOA 1ISWA 4JIPA 3L12A 5A2BA 2VT0A 2CLEA 2Z2BA 5I7GA 3MS8A 1LLOA 2VR4A 3LHWA 4RV8A 3HM7A 1IEXA 5HMDA 4LFYA 3H55A 5BWFA 1TMQA 4RDZA 1EZWA 4P2VA 1MVYA 4WKAA 2PDBA 2BG5A 1VZWA 1DXEA 2QUTA 5B80A 3G1HA 3GZAA 3PFRA 4NUWA 1OWQA 3WF3A 3RLUA 2V2CA 3WJXA 4R7WA 1V3HA 4LS1A 1EZ2A 1EEXA 2XSBA 3G1DA 4A3UA 4IMEA 1JYVA 2XIOA 4D72A 1K6WA 2OELA 2QNEA 2GK1B 5EMJA 1XBZA 3WH9A 5CEWA 4M3PA 1P6BA 3FVDA 5LSMA 2HK0A 4PCTA 3ZMRA 2C91A 2OX4A 2X09A 4DBDA 3WX7A 4PUMA 4RPPA 4GQ0A 1UCWA 3UXKA 4PMDA 5JH1A 3H8AA 5H91A 3NZ1A 4ML4A 1TKKA 5CGQA 4W9TA 2QUUA 3C4UA 3EX2A 3I3DA 3H4GA 4FZIA 1EOMA 4DRSA 3FHQA 5I78A 3UG5A 2TODA 2X05A 4DQWA 1J96A 3PS7A 4AEFA 2VC7A 3BOFA 1SJCA 8A3HA 1R7OA 4HOXA 1MYRA 3ZS4A 4KFPA 4O15A 3RLVA 1IIHA 2XM1A 4L9ZA 2A7NA 4HTYA 4TIMA 3RMJA 4MWAD 4AMAA 4P61A 3GDLA 3K30A 2FHBA 3USBA 2W91A 1BSLA 5KETA 2WXDM 3MMTA 4I5UA 3WYZA 4HK6A 3GIQA 1SR0A 5LZLA 3QN3A 4YHGA 2TSYA 4DXKA 1GONA 2E5CA 4OBTA 1I0BA 3BLKA 3XINA 2PCEA 1Q6OA 3PNUA 4RLIA 4LAUA 2XGIA 2Z0IA 1L6SA 1LBMA 1KGUA 3Q45A 1W1VA 4AEOA 3O6DA 2BZNA 4GNKB 4AF0A 3T81A 3DHPA 2ZX7A 1XYZA 3MUY1 2V5KA 2J8GA 3WQVA 1LROA 2PWHA 2O55A 4J9JA 5A6AA 3EMCA 4LYQA 3PBYA 1CLVA 5ABTA 3L5MA 1AJZA 4LCSA 4DYKA 2C0HA 4D2JA 2E9MA 3C5QA 3MV11 3WUGA 3N6JA 1Q6RA 1RCOB 4LUSA 3CPRA 3LQGA 3DFSA 4W84A 1ZSXA 3SY1A 3K4DA 1QPRA 4JTTA 1JCXA 4AZHA 1YPIA 3AS3A 1KM6A 3C2FA 4FXRA 1Y5XA 1XCXA 3LU2A 3OIXA 1XM3A 2VJXA 4OT7A 2A1YA 4UOJA 1LG2A 3W28A 2HVNA 3NL6A 1RLCL 2LLEA 1G4TA 5D02A 1GOXA 3O16A 3OZPA 3P61A 1FWAC 1P1MA 3VIFA 1POJA 2YCEA 4MWAA 3PB2A 1HJUA 3VFCA 4EWJA 1UROA 4IL0A 3QTGA 3OG2A 3AIBA 3CB3A 5LNRA 1QRQA 1O5RA 3IJ7A 4OIFA 5A6TC 1EL3A 3EWUA 2RGMA 3KAOA 3OEXA 2PA6A 2ZADA 3F5JA 4HSHA 4K3ZA 4O10A 4Y9MA 1REQB 3UWYA 1VYSX 4L61A 5I3HA 5IM51 3V1PA 1IXPA 1V02A 2HRWA 4PRTA 3R4IA 5AOUA 4QJ5B 1TO3A 4LF1A 4ALDA 2W66A 1JD7A 4I7VA 3IUIA 4GZIA 2NZLA 3V0SA 1Q65A 2FZDA 4JKKA 2F9RA 1ZL1A 2AKMA 1IHIA 4OOZA 3DX5A 3KRZA 1O60A 1V5XA 1FFQA 4F2TA 2J25A 3L21A 2ZRWA 1HKMA 1UB3A 1VCGA 1UIOA 5CPLA 1W3NA 1EPXA 2ISSA 1GNXA 4P8UA 1CLXA 4WLCA 5BOFA 1VLWA 2V3FA 4H41A 1ECEA 4S3JA 2Z7KA 4D9PA 3S1WA 4A6GA 3B0VC 1XYLA 1IWAA 5FF4A 2O56A 1GVFA 2FPYA 1A5AA 4LUIA 2C0AA 1RJQA 2EPNA 4Z17A 1SSGA 3GXNA 3UNTA 3QQ1A 4JY8A 3B03A 3BH4A 3KS6A 4IGNA 2CYGA 5AN7A 3KBJA 1FTXA 1GYLA 3UF9A 5AECA 1W5MA 3RDKA 4IUGA 4JTSA 2PTZA 4EANA 4NG3A 1YTEA 4GI9A 2B7QA 1K8XA 4AD3A 3OG3A 2J24A 3AZSA 2GVJA 3S1XA 2X7WA 4HCLA 4FHAA 1D8WA 1WDQA 3DXIA 5A8NA 4Y9AA 5HMFA 3GXPA 5K2ZA 2EHHA 1MDLA 1O7AA 3EDKA 3EOLA 1SU5A 2DIKA 2FIQA 3AXIA 2DUAA 2FHFA 1AA1B 2AQWA 1EF3A 4DF1A 5BNKA 4GVHA 4XZMX 3SW6A 2WMKA 3NNTA 3HPFA 2D2JA 2KAUC 1F05A 1JI1A 1QJWA 1SFLA 1TX0A 1P6WA 1E71M 4ORIA 2BXYA 3UCDA 2NUWA 2WMIA 5ABHA 1S2TA 5K9XA 3QY7A 3TN6A 4GYPC 2FZMA 1UOZA 1YXYA 3W76A 2ALRA 1MWOA 1OG6A 3I3EA 3DBPA 4A3HA 3WH5A 3RX3A 1RPXA 4NZ4A 4BF5A 4LSBA 3A3WA 4W5ZA 1H1NA 3NPWA 4EKJA 1FWFC 3OVRA 2OLAA 3KDOA 4JICA 4YVVA 5EMKA 4DO7A 3F2CA 2YJQA 4L4LA 5DCDA 1HJSA 5JMUA 3CV2A 1QNOA 5HATA 4GK8A 4KEMA 4KEVA 3TJLA 2DH2A 4Q22A 4ADTA 4HMNA 1JDDA 2CZ5A 2E1WA 4JQ1A 1QI2A 5A8QA 1EXBA 3MB9A 4OBRA 1TZ7A 2G41A 5G4EA 4FB7A 1U22A 1FH9A 2GJPA 2ZBTA 1MI3A 1IEQA 1H51A 3QV9A 5CH9A 1C91A 5D9OA 3W7HA 3W37A 1GYMA 3VE7A 4PCFA 3N9RA 4X63A 4DYJA 3NG3A 1YPFA 2JFEX 1T6MA 1UR0A 1E0TA 1EB3A 4GUJA 4P7NA 4IUOA 5CZKA 5MKGB 1KFWA 1TPFA 2CLOA 3NQ8A 1GORA 3SIZA 1RAKA 1XXXA 1JPIA 1JPMA 1Q63A 4LWWA 4F9JA 3LLXA 2GL5A 2VCBA 3NQMA 1K03A 2OWWA 4EOUA 3CUXA 3E2VA 4BEUA 5F1VA 1LQ2A 1VRDA 2GJRA 4KIEA 4O1DA 5FEWA 3R58A 4E3TA 5A6JA 1HZYA 2GJXB 4YL2A 3UZZA 3P3BA 3EA1A 4ZR8A 3EB4A 3RLGA 4JS3A 3S0CA 1J4EA 4IPLA 4O11A 1PX8A 4S38A 2ACQA 4N42A 1QT1A 2V5CA 3DI0A 4BI7A 1RP9A 2G96A 3LYEA 2EGZA 5I79A 5J5DA 5DMNA 3U9IA 5I77A 3ABQA 5DXYA 4ZOAA 4HB7A 2C19A 3UW6A 4KS0A 3MCOA 3RIKA 2PGRA 3ZZ1A 4NJJA 3AZRA 5BMWA 3MYPA 2WNNA 1R2TA 4CD6A 4X22A 3HGRA 3L67A 4ERIA 5H8MA 4XSLA 5C9WA 1GHRA 2QPXA 3LSBA 1JYWA 1DBTA 4LNCA 4MNJA 1SJDA 1F6PA 3GXDA 2I14A 3OQEA 2OGYA 5IBXA 1XF0A 2PDHA 2FFCA 2FFIA 4WIWA 4HA1A 1JG9A 1R2RA 1BVZA 4P7RA 1Q6QA 4LRSA 1RY0A 4PRWA 2ZVRA 1HKIA 1GQKA 1LBFA 2D73A 1BWVA 5EKYA 3S8HA 1ME9A 5E0FA 1RA0A 2OZ3A 3EWZA 4GCXA 4EP8C 2ISFA 1G7VA 4PUJA 1KWKA 3ZSSA 4IPIA 2VXNA 2JIWA 3AHVA 3VIOA 1B9BA 4QBXA 3ITGA 3VD3A 3VIJA 4K1GA 4EF8A 3GD6A 1XD1A 3SCSA 2XFYA 2V5DA 3PTQA 1Q3NA 3CNYA 1SZRA 1L6GA 3QY6A 1BAGA 3JS3A 4M8UA 1RP8A 4IOTA 1F3EA 4IQJA 4HTBA 4F0LA 2J74A 1RALA 3A4WA 3CMFA 3UWWA 1YXDA 1AL7A 3CHVA 1YBQA 2PWUA 1V4YA 1QO5A 2WK2A 4DJEA 2V69A 1KM0A 3TTEA 1XIDA 3R7MA 1YXCA 2WVVA 2C18A 3TW7A 1TZ9A 3GG0A 3K1GA 4RNHA 2FH8A 3VM5A 4G1NA 2Y7EA 4HHLA 3QVQA 3H23A 4LVDA 4AZ6A 5F4SA 2GSEA 3I4KA 3CIWA 2GVLA 4GI8A 4XKMA 3LS9A 2Y1HA 3R25A 2YL6A 3H2NA 1EQCA 3LM3A 2OWXA 5BYWA 1W37A 3ZLGA 3BG9A 4KRZA 4GKLA 1Q13A 4M6VA 1R30A 3LG3A 3L9CA 4IGMA 4LUTA 2ZTJA 1XSKA 3W02A 2EKGA 3TWBA 4UQDA 3W71A 1US2A 2VNCA 2WSYA 1O95A 3C8FA 2V3EA 4Q8PA 3LDVA 4PUEA 3LERA 3WD2A 1IWPA 1NU5A 1UR1A 5CQ1A 2UY5A 5J04A 3V0TA 1EC7A 3IGUA 4C6BA 4Z1BA 2VQTA 4MGGA 3H21A 4NU7A 5G5IA 4NZJA 1J93A 3NWRA 3H2FA 1ICQA 4L6OA 4ZE4A 1KM3A 2QULA 1NTHA 1VYRA 2PC8A 1KM4A 3I6TA 3R94A 1WZMA 2WVUA 2B31A 3FX4A 3W7LA 4NJIA 3GDKA 3OGVA 4POCA 4IZGA 5DT5A 3TYUA 4FNTA 1GG0A 1PHQA 4QEHA 3REQA 5M03A 2J7EA 1XLGA 5DMMA 3NZPA 2CU0A 4HIBA 3FEMA 4ATWA 5BRQA 2WM1A 1J8VA 4UZUA 3E2QA 3E38A 5T26A 2NV1A 4QR6A 2DVXA 1ZBWA 2BDQA 1JDAA 3W1AA 2YL5A 1O4UA 3NEVA 2VHLA 4UBPC 5HK4A 4CCEA 2ZQ0A 3AIVA 3PWGA 1U5JA 1U5VA 3T2OA 3W23A 4JFUA 4JAWA 1GEQA 1VJSA 4MWAE 3IV3A 1UJQA 1M04A 3GO2A 4HA3A 5AY7A 3LA4A 1LUCA 2GUUA 3L4VA 2C71A 5CKSA 5HJLA 4YNGA 1K4HA 2VFGA 2VI0A 3SRHA 4NNAA 3V36A 4M29A 2V3GA 4MFDA 4GQRA 2VTFA 4DXXA 4O14A 4WSJA 3WLNA 1OVDA 3VUPA 2YLLA 1O6IA 3GU1A 3KL3A 4QTGA 1E6RA 1XKYA 5MHBA 1V6UA 3CUZA 4Z1YA 1GQLA 1A5SA 3Q67A 3NXLA 4U10A 3TUUA 1KFCA 3H2CA 1O66A 1OIMA 4WRHA 3WELA 4XAZA 4W8LA 3IV8A 4GVIA 4LAMA 3FIGA 3MO4A 2H9AA 2OXNA 1RUSA 5CC6A 1UUMA 4DO4A 4WR3A 3G8EA 3BAKA 5F7UA 1PIIA 2YZRA 5LGZA 2YGYA 3TQKA 1K9EA 4H6KA 3W25A 3GDBA 4BZYA 3O05A 1CXHA 1GW1A 4GQBA 4CN1A 1AQFA 2DUZA 4B16A 1GZ1A 3G8RA 2Y0FA 1Z48A 1UPPA 3PC0A 3S1GA 2C6QA 3EDFA 5K9CA 1PBGA 4TVCA 3BAIA 5BRPA 3VMOA 2Y8VA 4H8HA 1X7IA 1HO4A 2JF7A 4C6IA 1NQKA 2VZSA 1UR3M 3USZA 4ONVA 1VBHA 5CPQA 4KGJA 1JFHA 1XUZA 4U2YA 4AIBA 1W9BM 3AMCA 3FGCA 4QX4A 3QR0A 3TJ4A 4XV0A 5PTDA 1CBGA 2VX7A 2VWSA 4S3FA 9RUBA 1DIOA 4A8NA 4D8ZA 4RCXA 4A2SA 2GQ3A 5D33A 2QJGA 1W0MA 2X30A 4UCFA 4TMCA 1VEPA 4WXZA 3QSRA 1MXGA 4FSAA 2E67A 3FSTA 3IJ9A 1J0YA 1R9YA 3NL3A 2EEXA 4H6RA 3LGGA 4MPKA 3P6LA 4NF7A 3WD0A 3DKJA 3M0YA 3R2GA 3PZNA 1HL8A 5KMYA 3AICA 2XJ7A 4H4IA 5BU6A 5DN1A 5JIWA 3UWQA 2F84A 4JKLA 2JGQA 2X0YA 4QP0A 3S9YA 3TC6A 4J4KA 7A3HA 3MSYA 3W7GA 1CNVA 3CV7A 4PCPA 4AD4A 2BVTA 2ZUSA 4E8GA 2BGNE 4ADSA 1EP1A 3NM1A 3CTLA 1KFBA 2WKLA 1TUFA 1A4LA 3IVUA 1NAL1 3APTA 2VZUA 4YXGA 1TMLA 2XM2A 1UR8A 1VBJA 5I06A 2EPHA 1K4GA 1FDYA 3R89A 4MF4A 1D9EA 1Q2SA 5EMUA 4UNKA 1HGYA 4F48A 3LXBA 4C6EA 4AZCB 1XLMA 1JXKA 3WBAA 1R3YA 3I65A 4R27A 3UZ5A 3GUWA 4ASTA 1P7TA 1ZJIA 3KCOA 3MC5A 4LANA 1H1YA 3CH0A 2TPSA 1L0PA 3TCEA 3JW7A 2ZZ7A 3W07A 1DTNA 4GLEA 1XYCA 5C0QA 3PZTA 1PZ2A 2R24A 1KXQA 4CNTA 1RH9A 3VC5A 3NSXA 5DLCA 5FF7A 3MZ2A 2VR2A 1A3HA 2FH6A 2Y63A 3FA5A 3PZVA 4MUPA 4ZTXA 2YIHA 3L0KA 2VDGA 3BW4A 3EPOA 1S2AA 3TH6A 1ZQ5A 1DJXA 4NIRA 1PSCA 5M1TA 4JL2A 2QV5A 3EOEA 1Z32X 2QDEA 2PDKA 3BSGA 3IJQA 4KEZA 2F61A 1O5XA 1C92A 4JFVA 2FZ9A 5HQMA 2XIQA 1VH7A 3R0UA 4QDPA 1EC8A 3CUJA 3TTQA 2YDQA 3LTPA 1IR2A 3VD9A 4CCZA 2DGAA 4G56A 1TE6A 3ARZA 4HJFA 3WJYA 3DOPA 4FAMA 2E3ZA 4TUFA 1PYMA 2WVSA 5I02A 4E2VA 4IFKA 4RL3A 2PBOA 1S3HA 1EGVA 4UWMA 5HXMA 4NXSA 1V03A 1LLWA 1J6PA 3I68A 4GY0A 5IDIA 3V7PA 3ZR5A 1TB3A 1Q6EA 1JR1A 3WMLA 4AWUA 3GXIA 2FVMA 3CHDA 3N2MA 2VC5A 1W3KA 4H83A 3MBFA 1DL3A 3NQVA 2QMKA 2PDXA 1QHPA 1WXZA 1S5MA 3UXLA 1VBUA 1MRQA 2GUYA 4YVPA 1XDJA 5D03A 3APGA 2BWGA 2Y5SA 4PUDA 1ZU8A 2ZCGA 3M16A 5HR7A 1YNPA 3TEVA 1YKWA 3W73A 5D9NA 4UIOA 3QW3A 2PDJA 2JEQA 2XISA 3KXQA 3OGRA 4O18A 4UTKA 4DLMA 5FF2A 4UFIA 1CENA 1XPGA 3KBWA 4RV3A 1F7BA 4N4PA 5CSYA 1X6LA 4AZ5A 2XTKA 4XBSA 1LDCA 2CESA 3ARXA 1PS9A 3M0KA 3U57A 4J35A 3UXIA 2NQHA 2Y61A 1R3QA 2CBVA 4L1GA 4DYEA 4R7JA 3CM4A 4BR1A 4HA0A 1Q6GA 4GYFA 3ZJKA 3LCGA 1A3XA 1TE1A 4M19A 2VRJA 1QK0A 1OZMA 4ZFMA 5AC6A 4IGHA 4HMCA 3IAPA 2I5GA 3RN6A 2B7NA 2QIWA 3WQWA 3R79A 4ZQPA 3MKVA 3E0LA 1VAHA 4QISA 1VS1A 2J9ZA 2IQDA 3RJYA 3PBWA 3S6DA 2PDPA 1F4HA 5EB8A 1SJAA 1SW3A 4Y9NA 3P60A 1AFSA 4WF7A 4DELA 2ALDA 3VOFA 1N7KA 1XJBA 3V4BA 4WDTA 1R9XA 4D71A 5CGMA 2J7DA 3DC0A 3HG3A 2VFHA 1SO5A 3PJWA 4GY1A 4Z2GA 3DYMA 4RX0A 2PRLA 3DUGA 1QUMA 1AMYA 1DE5A 4PMZA 3GYCA 3UZJA 1TV5A 4GVFA 3W2UA 3CLMA 4XO7A 3TCSA 1LF1A 1R9ZA 3CZKA 3CL6A 5HINA 3BCJA 4CKQA 3LRKA 3KS5A 5D9MA 4IXHA 3BURA 4P8WA 1BGGA 1UKQA 2JKEA 4E2OA 3URQA 2PDFA 1B5TA 1T99A 3T0BA 4PGLA 2ASHA 2HISA 4EWND 4R85A 4LCQA 1AD4A 3U5UA 5LIWX 1KRBC 1TPVA 4QG8A 3UWEA 1QBBA 2QUNA 4IQEA 4O13A 1UQZA 3G24A 1BWKA 1TVNA 4HKPA 5AYIA 4AZCA 1OC6A 3LXCA 3UERA 3RK8A 1FCUA 4PMNA 1D2KA 1WZAA 4CNNA 2GZXA 3WIJA 1PDYA 1ZCOA 4UOQA 5ENLA 4C6OA 4UTFA 3QOMA 2PURA 4CUCA 5K4ZA 2ZXDA 2HS6A 1UZDA 3JR2A 5C9ZA 3M43A 4H7VA 2W92A 3MI6A 4JTCA 1VBGA 3TQVA 4C6CA 2NX1A 1K9DA 4TO8A 2BVYA 1TR9A 5D4YA 3C61A 1A0CA 4XZIA 3EPNA 2W61A 4IXXA 1Z9AA 4AFYA 4H1ZA 1MQRA 3WBYA 1ISXA 2A3BA 1V51A 3ANVA 1FWIC 3OIHA 3RPTA 3R43A 1K7XA 3ES8A 3VIIA 3W87A 2YCJA 1MUWA 3M0IA 4AZGA 2OMAA 1V0LA 1OCJA 3OW1A 3O0KA 3RNDA 5KEZA 1PWLA 4IFOA 4GXWA 3W9ZA 1AZ2A 1R85A 3WQDA 1U30A 3C0QA 4IQLA 3GAKA 1RQHA 4Q4MA 3SO7A 1BEUA 4ZQRA 3OQ8A 2XZ9A 2TAAA 1M41A 1HKKA 1YLVA 1MO0A 1TVLA 2IKJA 4JX6A 2RKXA 1UD5A 1S2WA 3GLCA 1H3GA 3UZWA 1G6CA 4BCEA 3VNZA 3L4UA 1EBHA 1R3RA 2E8YA 3U4FA 3TOYA 4QLKA 1JGIA 2E1DA 2A21A 4FS9A 1U1HA 3TTOA 2D3NA 1QMLA 3KE0A 3TIMA 3LBOA 4HZ6A 3ARRA 4F66A 4W4QA 3S2MA 2VEIA 1IZJA 1ISVA 4X9YA 2BP1A 4GQQA 4FOUA 3TFXA 1A4MA 1ZAIA 2EPMX 1VB9A 5AHMA 2YR1A 4E2BA 3UZYA 3WZ0E 3MJMA 4F9DA 2B4GA 3DENA 5AHEA 5D2XA 5LA0A 1B1YA 1IEVA 2AL2B 1NF7A 1Q6FA 4NRRA 2PTDA 2CPUA 3E3HA 1Q45A 4J3SA 3QV8A 1X97A 1PB0A 5LXXA 2OYLA 1PKYA 3U7VA 1NP0A 3T2QA 1RR2A 4HNVA 3RRAA 4FF5A 1J0IA 2QDDA 4NZ3A 3EXSA 2GOUA 4WGXA 2OVLA 1HW6A 1EYWA 3M46A 3GDRA 1S1RA 4ZQCA 4PC8A 3AHXA 4UR7A 3B0PA 3OLEA 4YVXA 4BY3A 1E56A 2AQOA 3WSUA 4UOZA 4S3EA 4YWSA 1OX5A 2XU2A 3NL2A 2WPGA 2YB1A 3II1A 4LNYA 1E1CA 1KGWA 2HE8A 1UASA 1Z41A 1IT8A 3U5YA 2J7GA 1OYBA 3PP7A 3CHFA 3WLQA 1XUUA 3QFWA 2Q8ZA 1MW0A 3DG3A 3H2EA 2VP8A 4P8XA 3EYPA 2GPTA 2OYMA 2E09A 5FJOA 2QCGA 4JGDA 3ARTA 3APYA 4HSOA 3FN9A 3OVPA 1AZ1A 1WKFA 2Z1SA 3NGFA 4NXKA 1UWRA 1UA3A 3THAA 2HCVA 3A4JA 3ITOA 2QCDA 3A3HA 1KCXA 3M0VA 3SUTA 5DY2A 1LM1A 1QW8A 1WDDA 3LXAA 3GUGA 4J3TA 4L7ZA 2KZHA 1GJWA 3MJYA 3QKZA 4BQ4A 3VKBA 3P5YA 4DEFA 3WEOA 3S2NA 3E2RA 3FAXA 1EWDA 4PEEA 3UA3A 2JE8A 4RPQA 2A3CA 3HPSA 4ZSTA 4NYYA 4QGCA 4CD4A 2Z28A 2JKPA 3R0DA 4G1KA 4JTUA 4ZA0A 3HQ1A 2FVKA 1V0KA 3T0CA 2OKOA 4WY0F 5I24A 4S3DA 2HJPA 3GXFA 5CJMA 3NYZA 1OCNA 3RU6A 4UTHA 1TFVA 3POCA 1UKPA 1V3KA 2NQJA 2VOMA 3S2JA 5JBDA 1W9UA 3TJXA 3P82A 1CYGA 1H60A 1RQBA 1ZZMA 1WYIA 4EXQA 4I6KA 1HGWA 3FDKA 2PWGA 1X1ZA 5AVHA 4MYXA 4K1WA 4MZ8A 1F6KA 2GGHA 3LZ5A 4IMFA 2ZXBA 2GOKA 3BAYA 5XIAA 3W29A 3UR8A 2G50A 3BLIA 2PLKA 3BGJA 3N9KA 4XB3A 5D2TA 4ENLA 4BHYA 2RUSA 5IBXC 1ITQA 1XDLA 2G3FA 1CTNA 3V5OA 4HPNA 4H2CA 4FX8A 1OB0A 3L4XA 4WVXA 4FNRA 3N3MA 3P67A 3PUGA 3E5PA 3W27A 3ANYA 2OFJA 4IIBA 3C3UA 4PTWA 3SQSA 2PUZA 3D46A 3OP2A 1YEYA 2ZUWA 4BFAA 5HBFA 5H1WA 3NQFA 2CFFA 3A4XA 3L4TA 4WJEA 5A5WA 5AYYA 2ZVIA 4Z0JA 2CKSA 5HANA 1ZP3A 4C6QA 2XFWA 4YTTA 4AQLA 5FSEC 1B57A 2BASA 1S5VA 3VMPA 2F2HA 2FDMA 1K7EA 3FS2A 3W83A 3AU6A 3CT2A 1JVNA 1NARA 1SJBA 2A3HA 4B2DD 1RCQA 3W2NA 3BTNA 2CHOA 1X98A 3PVFA 2BHYA 1WOBA 1R2SA 1U5HA 5G2HA 3KM8A 3OGSA 3BAXA 3WL0A 3VZZA 3NVTA 1HUVA 3ARYA 4MKNA 1OABA 3VOJA 3W3OA 3PG9A 3O06A 4QE5A 5KZDA 3TKFA 2P50A 5CSUA 4YIWA 3BSHA 2I9EA 3M6YA 4MZYA 4ILSA 4I3GA 1ELSA 1N8FA 1MXSA 1E5NA 3EAUA 3F4CA 1L9WA 4H7ZA 1E70M 4Z2HA 2BB0A 1T96A 3K4AA 1O5KA 3PZ9A 3D3AA 2GVEA 2PGEA 5IFPA 2RJGA 1R46A 2OWCA 4JEJA 4V1XA 4AIOA 1UZHA 2Q09A 3U2ZA 4LYRA 2ZZ4A 1TCMA 4YYCA 1EJWC 3IIZA 5L6UA 5DXXA 3W7PA 4JX5A 5DBUA 3CPUA 1M1BA 4OVXA 5F2MA 4QIUA 4NNBA 2QW5A 4ZEPA 1Y65A 4ICCX 4HOWA 1S3TC 1DVJA 1GZGA 2W6RA 2I7GA 2WMFA 4A8IA 3P7YA 1JQVA 3IK4A 1QOPA 3NXFA 4S23A 1VRXA 4H8VA 4QSFA 1FWRA 1VCVA 3VKKA 3EKLA 2IPJA 3AXMA 4LOCA 3T44A 3N4FA 3PFMA 1JEZA 1PEZA 3HTWA 4JTRA 1LL7A 2F6XA 3L5AA 4HYVA 3WJZA 3GNNA 3OVGA 6REQA 1WDRA 3SFKA 2YA0A 3SFWA 3Q4DA 3RR1A 5HR6A 3KL0A 1R86A 2V8ZA 3UGRA 2VEPA 1G5AA 2Z1XA 4MY8A 4PB4A 1MEWA 3VGHA 2YLAA 4GZEA 2WQPA 4UQBA 3K13A 4OE7A 4ZSUA 4H9ZA 1WBJA 1JZ5A 1E72M 3N12A 4QQ3A 2HXTA 1M53A 3OHMB 3QOKA 2BX7A 3PTMA 2OODA 3NAVA 2BXZA 3ABRA 3VDGA 2EG8A 1QDSA 4NI8A 4DUOA 4IIDA 2J4GA 2REQA 1L2QA 1SFJA 1SM9A 1EP2A 4DVOA 1Z89A 3VMNA 3AIEA 2NXHA 1OY0A 1TX2A 4LGXA 5DMLA 4ICNA 4Z1AA 2A79A 1FWNA 1Q85A 2GVGA 2X40A 3AJXA 1XYMA 3P2VA 2JK2A 2J9YA 3BANA 3KL5A 3KWXA 2SFPA 2QZRA 2BHZA 3MHUA 4A4AA 4UFLA 3ECQA 3KRBA 4OZOA 3V0UA 4K8GA 3NDYA 4XD5A 2PFHA 4CLMA 3MHFA 2QJNA 4E5TA 3CB8A 2WM0A 2D2GA 1BXBA 2VUNA 4OWGA 5HOSA 5G2IA 2X1RA 4OJYA 1MNSA 2FB3A 1C9WA 2FJUB 3B9NA 3TJIA 2ZZ3A 3NL5A 5AHLA 2QMJA 1I4NA 2Q8XA 1SVDA 3W2KA 4HYRA 3K1DA 2Y70A 2QGYA 1OBAA 3L5LA 1GVIA 1W9DM 1J12A 1LQAA 4LVGA 2DU2A 4W89A 3G2GA 2PD9A<