4GFSA

1.8 angstrom crystal structure of the 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 with nickel bound at active site
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
251
structure length
251
Chain Sequence
KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
publication title 1.8 Angstrom Crystal Structure of the 3-Dehydroquinate Dehydratase (aroD) from Salmonella typhimurium LT2 with Nickel Bound at Active Site
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 94
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4gfsA00
4NNAA 2RHGA 3LXCA 1FUYA 3DKJA 2QDGA 3MYOA 5EYWA 2HSAA 4OT7A 4IOTA 1G4TA 3H54A 3F1QA 3QZEA 3EXTA 5HR7A 4QITA 3QPYA 3C8FA 2CW6A 4NNBA 4FHAA 3GNNA 2OX1A 4I7UA 2Q3OA 3FYPA 4M6PA 3WK2A 1QOPA 2CZDA 4NJKA 3EEGA 2ZRXA 2X2GA 1YTDA 3G0UA 5AB3A 4UFMA 1L2UA 3W72A 3LI0A 4M6VA 1DBTA 1QCWA 4ALDA 1BWKA 1EUNA 1LRTA 3LV5A 4TU1A 3PB0A 3OG3A 4O52A 3Q58A 1U83A 1VS1A 2Z6JA 3R5EA 1JCYA 2E6DA 1UCWA 5AYXA 3KAOA 1WAUA 5LNRA 4R34A 2XN2A 2J9XA 3PBYA 4PL2A 2QCLA 3TIMA 1IF2A 3PF3A 4WXYA 3O63A 4QM1A 4TO8A 1FX6A 5HR6A 2V81A 1B57A 3W84A 1LZOA 4XQ6A 4QNEA 3GKFA 4AHPA 1LOQA 1TPC1 2Y6ZA 3TSMA 4RV8A 4DO4A 5DELA 4LU0A 3FS2A 3TKFA 4LVGA 2PC4A 3W3OA 1EP3A 1N55A 4O0ZA 1EA0A 3G18A 1GTEA 2HS6A 5HUPA 4O53A 3CIWA 3OA3A 4MLRA 4NUWA 4JDYA 3I7SA 2QCHA 3BG9A 3L67A 3TW6A 1G7VA 4O1AA 3LTYA 4WD0A 1HTIA 3U8GA 2Y7FA 1UASA 2DJXA 1W5QA 2OT0A 2CLHA 1X1ZA 1I4NA 3QEZA 3S5NA 1I2RA 2I1OA 2YXGA 4O19A 5K9XA 3RMJA 3RU6A 3UY8A 3W7JA 3GIYA 3W1AA 4EOUA 1WOBA 2GPTA 5CZTA 4BI7A 3L65A 2BXVA 2R94A 3GZ3A 5FF4A 4FNUA 5D2VA 3W7LA 2WNNA 1VLWA 3FLUA 3IEBA 2X1TA 3CQ0A 4BI5A 2WKJA 3NL2A 1TV5A 4LW7A 2VFIA 3EKLA 3QYQA 4XKYB 4M7TA 4AEOA 3T40A 1YYAA 5E0KA 3CM4A 4IXXA 3EWYA 2P1FA 5HMSA 4NU7A 2FB3A 4LTSA 4DXVA 3CWNA 4FEZA 1QMLA 5AC7A 4BFAA 1FCUA 4JIPA 3GXNA 1WBHA 3EXSA 1U5JA 3NG3A 2GJLA 3UWVA 3WJXA 2DZWA 4DF0A 2QCCA 5KZMA 1OF8A 1SSGA 1K02A 1FWSA 3LHTA 1VR6A 2R14A 2VXNA 4HNUA 1EB3A 1Y0EA 3LTPA 1IIHA 3NQFA 1KFKA 1T0OA 3NPWA 4ZQCA 2V0TA 2X1RA 1FCQA 2J6XA 4MJZA 1L9WA 4PL1A 3G1VA 4RKAA 1NFBA 5DLCA 3LHYA 4TIMA 3E02A 5HWJA 1LBFA 1I45A 2ZRWA 2WSYA 5AHFA 4XWUA 3QF0A 5KMYA 2BLEA 2DZTA 3QSTA 5K2ZA 3M9YA 3W1MA 2ZZ4A 3CT7A 1P5BA 3E12A 4WUIA 1LBMA 2GQ9A 4FNRA 3L5MA 3HF3A 1LLWA 3W7QA 5CGQA 3N19B 2B7NA 4CQ8A 3MBDA 1I2QA 1JUBA 3LCWA 2A4AA 4N4PA 4GJ1A 1PE1A 1WV2A 4EWND 3MHFA 1ZY9A 4JYDA 1VJIA 1KV5A 1TPFA 2DZXA 4DF2A 4NZFA 1RD5A 1TRIA 1VCGA 4JX4A 3NZ1A 1TIMA 3M5XA 1CI1A 1X8FA 3TFXA 2YPIA 4HN4A 3QPZA 3W2MA 2CWNA 3EWBX 3BVJA 3DHDA 4QQ3A 3S1WA 3GAYA 2FIQA 2H8XA 2EF9A 2CLIA 3DI1A 2QCMA 1KFLA 1N8FA 1YDNA 1MXSA 3S6DA 1O4UA 3G22A 1HO1A 3TA6A 4MYAA 1AG1O 4IMEA 5K3VA 3CB8A 1ZAHA 4I9AA 3A5FA 2YFOA 3I65A 3PBUA 3GR8A 1BKSA 1OVDA 4UTLA 1JCMP 3KX6A 5LHFA 1NF7A 2GVGA 4UFJA 3LHZA 4NXKA 1VRDA 3L0NA 3NPUA 3W7RA 3TFCA 2ZBTA 4O1BA 3QSRA 5D32A 4UNLA 4O12A 2JK2A 2V2DA 4FXSA 1KM3A 1TSIA 5AHIA 3MUXA 4Y90A 3RFAA 4PEKA 2H3BA 4JDBA 4MOZA 1ZNNA 3B03A 3SW6A 6ALDA 1FWNA 1Z48A 5D2XA 1KBIA 4BWLC 2Y85A 1L6WA 2NX1A 1QPRA 3O05A 1OX6A 3GDTA 4RZ4A 1SZFA 1KM0A 3C2FA 4JYEA 4QSHA 1TPWA 3T4CA 1V5XA 2DZSA 4J9JA 1VYSX 3LBCA 4IX0A 4UR8A 5G2WA 3W7MA 1OFAA 3W74A 1W3TA 2Z1BA 3O07A 5AHNA 1DORA 1K8YA 2YW3A 3FJLA 1N7KA 4IQLA 1YXYA 4ZVJA 1WXJA 4LVAA 3LTSA 4MY1A 1GVRA 3S42A 3I7RA 1LP6A 4ZMGA 2NV2A 4N9CA 5LNWA 1S5WA 3EX3A 3DFTA 2YR1A 2CZFA 2QCEA 3GR7A 1JR1A 2A7RA 4M6QA 4K7YA 5D30A 4M5PA 3C2RA 1W37A 1MEHA 4I7VA 4IJBA 3AJXA 1XC4A 3PG8A 3NDOA 4ZQMA 2YW4A 1TV8A 3BG3A 4PH6A 2VC6A 3TMQA 1RQHA 1GVFA 2Z0IA 3NQCA 5A8GA 3QQ1A 2QCDA 3C4UA 1YXDA 4X22A 2FLIA 3VE9A 4UFIA 5AOUA 4Z1DA 3K30A 4MZYA 4GXMA 4K38A 3ABQA 4LY8A 3TC6A 1SW7A 4UTWC 5I3KA 3OVQA 1H63A 2ZFAA 3ABRA 3N3MA 2VEMA 3DGRA 4RXGA 2JBMA 3BPWA 4A2SA 2UV8G 4IMGA 5KINA 4UFHA 1R46A 5A5WA 1OX4B 4CNOA 2XN1A 5FEXA 1W54A 2ZQ0A 3C6CA 1FCBA 4UFKA 3W87A 1RV8A 1WYIA 2BTMA 4AB4A 3G8RA 3U6WA 3CC1A 2P10A 5G1YA 3W7PA 1OYAA 4RX0A 1PVNA 1J5TA 1B4EA 4H6KA 5FEZA 1QFEA 4JR5A 4LUIA 1TYGA 4NX0A 1LM1A 1HO4A 3UY7A 1GG0A 1LOLA 4O15A 3SI9A 5HUOA 4BI6A 2ISVA 1MEIA 2A7PA 2OZ0A 3P84A 1VH7A 3NQEA 3GDKA 4MKNA 1BWLA 2H90A 2OT1A 4O10A 1QOQA 1QPOA 4XBSA 3STFA 1S5VA 2ZRZA 2XFWA 3WK1A 3W7EA 4O13A 5CPMA 4NJJA 1QWGA 3DFPA 2NUWA 3R89A 4HNVA 3W1LA 3M47A 5FEWA 1W56A 1PS9A 1TO3A 2WPBA 4QAIA 3S0CA 3MP4A 2GOUA 1MSSA 1JVNA 3O6CA 5G4EA 1W5PA 1SZNA 3HPXA 3JS3A 1UUOA 4UTTA 3TQVA 3W85A 3ELFA 3OHIA 2Y7EA 3LCIA 1KFEA 1QAPA 4Y96A 1D3GA 3NO5A 1A5BA 2QKFA 1OK6A 2CU0A 5KTLA 1YLVA 3G8EA 3UNDA 3IVUA 3YPIA 3MBFA 3PUEA 4OGZA 3M5YA 4JTEA 3FEMA 1IXQA 4HKPA 3KVKA 3L68A 3DI0A 3HGSA 1UUMA 2E5BA 5K7JA 5EL1A 5TBOA 4DELA 3UZ5A 4KWVA 3L0GA 3KVLA 3P7YA 4RZ5A 3NM1A 2V82A 1GVQA 4MJMA 5D38A 1NF0A 4E2BA 4H3DA 1UBSA 4N9BA 3B0VC 3PG9A 4PFMA 2B7QA 4K8HA 1CW2A 1H51A 1V7YA 4A3UA 1KFBA 4UUIA 1OYBA 4QISA 3LDVA 1NEYA 1MZHA 3I7QA 4NQ1A 4ZZ9A 4MPQA 5CZ0A 3DBPA 1FCVA 1Q6LA 2CZEA 1R30A 5AYYA 1TCDA 3STEA 2DP3A 3LCHA 3R8RA 3P62A 2G96A 3VKJA 1G4EA 1XM3A 1J4EA 4QNWA 4UXDA 1GPWA 1G4PA 4IMDA 2NLIA 1OFRA 1D3HA 5I3HA 3SJ3A 1RR2A 1FDJA 1TPB1 2IQTA 4JEQA 4LS1A 3W7CA 2A6LA 1KFJA 4WQ6A 4LRTA 2A0NA 4GWEA 5LNSA 2ABBA 4GC4A 3UXAA 2DU2A 4Y9AA 4A2RA 1F2JA 3BLEA 2Y61A 3JRKA 5BNKA 4GRSA 2TPSA 4UTJA 3S5ZA 5F1UA 2VFGA 4IMCA 5IBXA 3DFSA 3TJXA 4UR7A 5I3GA 2KZHA 1SO4A 3VI2A 4WY0F 2E6AA 3HQ1A 3LCXA 1Q45A 2QAFA 1T8XA 2NWSA 3P61A 4WOQA 3JR2A 2E09A 5BRBA 4NVTA 1T99A 4AAJA 3TNOA 3L5LA 5F4SA 3RK8A 1UJPA 3NZRA 2V2CA 3P67A 4R53A 3B0PA 2QJGA 3QM3A 3C56A 1K8ZA 4CCEA 3B06A 1LCOA 5LGXA 1VLIA 3HGJA 2YYUA 3MWAA 3PUOA 1VGAA 3T7VA 3W7DA 3Q37A 4JY8A 1W5NA 1O94A 1X6UA 1GJPA 3NEVA 1DL3A 3FKKA 5AC6A 3KRZA 3HPZA 3NQAA 2ISWA 2WV8A 1C9DA 3M43A 2HMCA 2FDSA 3G1FA 4JICA 4ADSA 2WNQA 5D02A 3ABOA 1XBXA 2EPHA 1GOXA 4UNKA 5EY5A 4LS0A 1SUXA 4JTKA 4K36A 3EX1A 2LLEA 3W7HA 3TC7A 6TIMA 1I2PA 5CSRA 3NPVA 1QDSA 2PRHA 1C29A 4E0CA 4OU1A 4WJEA 1KM5A 5U7SA 3PVFA 2HTMA 2BSLA 2E5CA 3T78A 2DJLA 2YGYA 1DJQA 3CHVA 2ZRVA 3DXIA 5FF3A 1I2NA 3PWAA 3W83A 3GDMA 4AH7A 4EF8A 1XL9A 1VZWA 2YFNA 4N2YA 3STGA 3TUUA 1KM1A 2TYSA 1DQXA 5K4XA 3WJZA 1P1XA 2Y89A 3G1SA 5E93A 3W22A 3W2NA 1SR9A 1D9EA 1T96A 1YXCA 3TE9A 3A9IA 1TQXA 4Y8FA 4O0KA 2Q8LA 2X1SA 3USBA 1P0KA 2PURA 3F4WA 2CLLA 1Z42A 3VCRA 3S1XA 4JTLA 5TIMA 4NJIA 3OVPA 3CIXA 3CLMA 3BV4A 3WFAA 2E5DA 2Y62A 2GQAA 3C2OA 1H61A 1H1YA 1GVSA 2ZZ7A 1O5KA 1TPH1 3UPWA 3TK7A 1OFOA 4CNPA 2NXHA 1Q6QA 1LROA 3QW4B 4EVZA 3NL3A 5KITA 4E38A 3BW3A 3HG4A 2RDWA 2VKZG 3HOJA 2NUYA 1G69A 1XDMA 3SIZA 5L9FA 3IGUA 1W8SA 2VEPA 3FA5A 3L0KA 1H5YA 5LHEA 1PV8A 2DZUA 1DVJA 2ZRYA 3U2OA 4GUIA 1DQWA 3N73A 3UWQA 3NQVA 3SGZA 1FDYA 3MP5A 4R7JA 3UPBA 1IXNA 2RDUA 4GUJA 1W0MA 5CSSA 1FXQA 2P0OA 3TW7A 4YL2A 4O28A 5AC8A 3BW4A 5BOOA 4DPPA 1XKYA 4AWTA 2EKCA 4W9TA 5KSWA 3N14A 7TIMA 1LRQA 1W31A 4UFLA 1YPIA 3WJSA 3MI2A 3CPRA 4CCDA 4AHOA 1PHQA 1JCJA 1JRCA 4ICNA 2E6FA 3G24A 1WOAA 1A5SA 3TV8A 4AWSA 3PC0A 3NA8A 3GDRA 1FY6A 5BMXA 1HL2A 3SGUA 3F4NA 4KFNA 4WY0A 5LNVA 1ALDA 1ONRA 2C1HA 1P0NA 3ANYA 4BR1A 4OWGA 1LYXA 1VYPX 1AMKA 2E6YA 4RK8A 1NVMA 1XUUA 1AL8A 3LLDA 4M19A 3HG2A 4JNMA 1IIGA 2YYTA 1VHNA 4LVBA 5HINA 1FWTA 4FNQA 4MFDA 4GBUA 1ICPA 3QW3A 1M5WA 1Z41A 5CG7A 4DO5A 5D33A 1QR7A 4ZQRA 1SQ7A 4JTFA 3GVGA 3L66A 3W1QA 4L4MA 4N6FA 3E96A 1RQBA 3WJYA 1TPUA 5DXXA 3T55A 1LLZA 4Z1AA 1VYRA 3NQ6A 1TREA 1M7OA 2QCFA 3EWWA 2HS8A 2VEKA 1G4SA 5DBUA 3R2GA 5AFDA 3QH2A 1PCWA 4AXKA 2V2HA 4ZQPA 1GYLA 1W3NA 2W0UA 4S1FA 4FO4A 3W75A 4C1LA 2ATMA 2X30A 2WSRA 1IXPA 3EXRA 3NXFA 3W1UA 3GKAA 4JS3A 5CPLA 3S1VA 3A21A 2R91A 3UWYA 4NT0A 4S2CA 3IIXA 2GQ8A 5FESA 4KFPA 3GDLA 3HIJA 1QNVA 4YCOA 2ATSA 3TAKA 1X7FA 4LVFA 1PHWA 4HSNA 2A5HA 3BGJA 2ABAA 4FIRA 3W70A 4LV9A 4RCXA 2QJHA 2A2IA 1H7RA 4JN6A 4JTTA 4JD4A 3NPXA 2B4GA 4Z1BA 3W2LA 3CU2A 1P4CA 3TH6A 4AMAA 3M1ZA 3AO0A 3P5YA 1C8VA 2W79A 3QJAA 4GUFA 5LNUA 1ME9A 2FJKA 3FOKA 4O57A 2J24A 3TSBA 3KVMA 1SW0A 2RDTA 2QUTA 3C2VA 3G0XA 5D2WA 1SO5A 4JTUA 5FI8A 5EMUA 1OFPA 4E2DA 1TTJA 4K37A 8TIMA 4HT3A 2ISSA 5LSMA 4TMCA 1TQJA 3WK0A 1WX0A 4FF7A 3NQMA 3PSVA 2C13A 1VC4A 4U28A 2YDAA 1THFD 2QCDB 1ZAIA 1L6YA 1A5CA 3TR2A 4H4IA 3THAA 1KM4A 5H91A 1SW3A 3EKZA 3EX4A 1OJXA 4FX8A 4FX6M 3W07A 1LDCA 3SFKA 1TTPA 4TMBA 4O18A 4AF0B 1B4KA 1WDWA 2H6RA 4FX7A 2JGQA 4WX2A 5EPDA 3B0UX 2EGZA 3O15A 4UTTC 5C5YA 2B7PA 3EX2A 5F1VA 4Z0SA 1KTCA 3W7KA 5DCEA 4UCGA 5D2TA 3ATYA 2GJNA 3P81A 5T26A 2XN0A 1OF6A 4ONVA 5MHBA 3MYPA 3G0SA 4ZQOA 2Y7GA 3A24A 3TAOA 2JKPA 4U4MA 2ZZ6A 4UC5A 5DCDA 1F6KA 1ADOA 3BW2A 2ZZ5A 5I3IA 1H60A 3G1XA 4UTKA 4UTIA 3W9ZA 2DZPA 1DV7A 1GG1A 4KWWA 3G1YA 5G5IA 3GB6A 2AQWA 5K9DA 3NQ8A 1RVGA 3M44A 4AHQA 5CZSA 2VEIA 3QQ0A 4QIUA 3W76A 4UTUA 5GVJA 3HB9A 4TX9A 1FBAA 5C55A 3L2IA 1H7PA 1WA3A 3TX9A 3MW7A 2V5LA 4JY9A 5H2ZA 3A23A 2CZ5A 3BGGA 4MYXA 1DHPA 2ZYFA 3E0IA 1GT8A 2PE4A 3PULA 5F2LA 3M0ZA 1YDOA 4LUJA 5G1TA 2J27A 1XFBA 3MMTA 1LORA 1VCVA 2YZRA 2QEZA 1QO5A 1ZENA 5AHEA 4K39A 4G1KA 1F05A 4MY8A 1KW1A 4RR4A 3UXDA 1XDLA 1EX5A 3HG3A 1TJPA 2Y88A 4DPQA 2BWGA 3HPSA 3B8DA 1LTDA 2A6NA 1H7OA 3C2EA 5E1QA 3NNTA 1XXXA 2J9YA 3S5OA 2BX7A 3GAKA 2C6QA 5HQEA 1OK4A 3LRMA 3EWXA 3L5AA 5DBTA 1QPNA 5BW6A 4HSOA 3GXPA 3LBMA 1VCFA 3LI1A 4DO6A 5IBXC 2ZZ1A 4HNNA 4ZL1A 2E77A 4N6EA 2JKEA 3GLCA 3W73A 3QRHA 2QF7A 5AN7A 3PB2A 1OYCA 5IM51 3G1HA 1R2RA 1YTKA 3PR2A 4ORIA 1F74A 4O8RA 3TSDA 1VPXA 3BO9A 1JUKA 2B0MA 3V1PA 2BZNA 3IVTA 4CQ9A 3L21A 1PCKA 4JTGA 1XBVA 2ZRUA 3HJZA 3NAVA 3A5VA 3QMRA 4IGHA 2GVJA 3HGRA 4Z1CA 3NL5A 3LGEA 4LVDA 2X16A 1G67A 3UWWA 3W2KA 1EUAA 2H8ZA 3LCFA 3FYOA 1XI3A 4LT9A 3P60A 4O1CA 3Q2DA 2WO5A 4PTNA 4OHQA 3H53A 2C16A 3KXQA 3NQ2A 3O6YX 5G4WA 1JRBA 5L6UA 1EWDA 1M7PA 4JTJA 1YPFA 3W1NA 3S9YA 4GNJA 3EWUA 2DORA 3W23A 4GE8A 3PS7A 1PIIA 3MI6A 3SSJA 4P61A 1GWJA 3N34A 5AHLA 3HBLA 5D05A 1ICSA 3Q94A 4GFSA 4WXZA 2ZA3A 4D2JA 1GQNA 1H1ZA 1E51A 3O1NA 1BTMA 3C0JA 3UWZA 1SZGA 1FWWA 2A7NA 2ZZ3A 2ZCGA 2QJIA 4A22A 4CNNA 1Z44A 3P80A 4X2RA 4N9EA 3W2JA 1G6CA 3I6RA 3O06A 4X9SA 2WJZA 1H50A 4ORMA 1JCLA 1K8XA 1R2TA 4NJHA 4JX6A 5F4WA 4IXHA 3IIZA 2Y70A 1ME8A 5DY2A 1OFDA 1GEQA 2OMAA 3W6YA 3S8HA 3MO7A 4XZ9A 4LC6A 3P82A 4K8EA 3QC3A 1K03A 2V8ZA 3SR7A 2NWRA 4LC8A 5HWNA 1H7XA 1Q3NA 3M7WA 4XTIA 3DFOA 4KKXA 1F73A 1CX9A 5G2HA 3N2XA 4C1KA 3HMJG 3DAQA 4ADUA 1ME7A 3RLUA 1JJKA 3MP3A 4FNPA 3IIOA 4HHPA 4LNYA 3NGJA 1KTNA 2DZVA 2PRMA 2QUVA 3CWOX 3DENA 4EIVA 3UYCA 2GVLA 2Z2UA 5DXYA 4IX2A 4DF1A 1SPQA 5D04C 1NSJA 3L9CA 3QMTA 3W7IA 4A21A 1KA9F 5C6MA 3NM3A 2AGKA 2FTPA 3CEUA 1JQVA 4N4QA 4LWWA 4XKYA 3SZ8A 2JKAA 2R8WA 3LHUA 1W5OA 3DFNA 3BARA 4MUZA 3LLFA 2NXGA 3TU9A 1TRDA 4DEFA 4DQWA 4ZQNA 1ML1A 4PA8A 5D09A 1KM2A 4HPXA 4MY9A 1DJNA 1HG3A 2NX3A 3DH7A 5DN1A 4NXSA 4N9DA 5CPOA 4CCCA 4Q32A 3M6YA 1WQ5A 2CLOA 3E49A 3WK3A 4OBTA 5F4XA 3D0CA 2A1YA 1JUEA 1R2SA 5ABTA 4OE7A 3PAJA 3F03K 3LHWA 5KZDA 3W7OA 2NUXA 4L4LA 1RQEA 4JTSA 2G5WA 3VFLA 5I3JA 5EKYA 1OFBA 5FF7A 5SWUA 3C52A 4JX5A 4QJ1A 2CFFA 4NJGA 3BK0A 4K7VA 5DY3A 4MIMA 3TQKA 2FPVA 1TTIA 4YXGA 1J2WA 3W86A 2JGYA 1XBYA 3TMLA 1KLYA 3C61A 1B3OA 2Q3RA 3O8AA 1VQTA 2ZA2A 5HNRA 2OCZA 1IXOA 4MZ8A 3GYEA 2ZA1A 1OG0A 4IPJA 1GTHA 2CLMA 3PY2A 1FDZA 1GZGA 2FPYA 1KTBA 2I14A 4HPJA 3UQNA 3W1XA 4KFOA 2A21A 1MEWA 2CLKA 3THQA 1R47A 1KFCA 5J5RA 3DZ1A 2A85A 5HJLA 3UD6A 2VFHA 3PBWA 4LOCA 1TPVA 2FFCA 4YWIA 2C0AA 4WY0B 3MI3A 3B4UA 3IRDA 1L6SA 2ZTKA 4EF9A 3I68A 3LXBA 2C18A 3PSWA 1HFBA 1SU5A 2TRSA 4A29A 5C54A 3EB2A 1LOSA 1XCFA 2O7QA 1W3IA 1YADA 4FNTA 4JIQA 1KLZA 4HNTA 4UMAA 3W1TA 5CKSA 5K9CA 2ALDA 4FB7A 3RLVA 1X1OA 3KFTA 1HUVA 2C3ZA 4UTMA 1JULA 2QAPA 1ZCOA 1EP2A 2V5BA 4XBKA 5HWMA 3LRKA 3G1DA 4NNCA 1KBJA 1KM6A 3EWZA 4O54A 3ZWTA 2C15A 5D03A 3A22A 4XUGA 1H7WA 4ADTA 3NQGA 3NVTA 2Q8ZA 5F2MA 1JCXA 1W1ZA 3TXZA 2V9DA 1RZMA 1H7NA 4UIOA 3N2MA 1EIXA 1JQXA 3KOFA 2AAMA 3CTLA 5F2IA 1JCNA 3IIPA 3NL6A 3W88A 2TMDA 4AWUA 2WOQA 4O4WA 3W1PA 3LM7A 1A5AA 1H62A 2EHHA 1AW5A 1OHLA 2PCQA 3MHGA 3CEPA 3N9SA 4GUGA 4O14A 3V75A 3O16A 2Y63A 3QMSA 1Q6RA 1AK5A 4MLJA 3NQDA 3R13A 4Q33A 1ZJIA 3P74A 4WZHA 2Z6IA 2QUUA 1UB3A 3M41A 1AL7A 1QPQA 1EP1A 1B9BA 1TV7A 2QDHA 5U4NA 1LBLA 3TQ0A 3UZJA 2WQPA 3MHUA 2VENA 3IGXA 4CLMA 2E68A 4NX5A 3P8JA 3SECA 4DBDA 3KHJA 3IGSA 4M7SA 3EX6A 3LCGA 2QR6A 1ICQA 5I3FA 4AVFA 1Q6OA 4UMBA 4UMCA 3UWUA 4O50A 1TPDA 2F7FA 3ZWSA 1YTEA 3MJYA 5LZLA 2FB2A 1EEPA 1FQ0A 2C19A 3W7GA 1TJRA 3QFEA 1KV8A 2VOMA 3W1RA 5J5DA 4Y6GA 5D37A 4BF9A 4FNSA 3NQ7A 3PBVA 2FQIA 2C14A 1BEUA 4R33A 3ZR4A 5AYZA 3GXTA 4B5NA 3LOTA 3VNDA 2Y7DA 4LRSA 2V30A 4RZ6A 3NOEA 4O4VA 3P5ZA 3OEXA 1MO0A 2E1DA 3G3MA 2NX9A 3HO8A 3GX9A 3IVSA 4BWLA 3LV6A 4FXRA 1K7EA 4HIBA 2O7SA 4IWWA 4OV4A 4PC8A 1GYNA 1WBJA 3BLFA 4IMFA 3TJLA 5FEPA 4JXCA 1EWEA 3DHFA 3DKLA 3B05A 1TMHA 3G1AA 1SFLA 3RNDA 3OIXA 2VFDA 1O60A 2YCEA 4AF0A 1RPXA 3P8IA 4MFEA 5DCBA 3RF9A 1K7FA 2NV1A 4X3ZA 3S5YA 3LRLA 1OX4A 4IUOA 5KZEA 3DU0A 2WNZA 1VHCA 1ZFJA 4RLIA 2RFGA 5FF2A 4O11A 4O16A 5FF0A 3NR0A 4OV9A 4PCFA 3FJ6A 3FIGA 4O1DA 1DKWA 2FPTA 1OFEA 4NZJA 4O17A 4JGDA 4YMZA 1O5XA 4FIQA 1F7BA 2F84A 3O6DA 1ZAJA 2VFEA 3FKRA 3ABSA 3ZFHA 1AW2A 4PODA 1S3HA 2EAWA 4K6AA 3LHVA 3LX9A 5TQLA 1F76A 1K3UA 3IV3A 3STCA 1I2OA 3G3DA 2ZZ2A 4RXFA 3KVJA 3NYZA 1EPXA 5LGZA 2D73A 1SFJA 2ZDRA 1XBZA 3FFSA 3M5VA 4POCA 3WJWA 4YCPA 2GUUA 4GUHA 1A50A 2ZTJA 5C2XA 3R12A 4MZ1A 4TR9A 2G95A 3KRUA 3TCEA 1F6PA 2B7OA 2NXIA 4RJEA 4UTWA 3VE7A 3PUDA 1A53A 2YSWA 1W5MA 2J9ZA 1OABA 3GK0A 4P2VA 1ZHAA 4MVAA 3LERA 5G2IA 3T44A 4Z0JA 4XTDA 1AW1A 4JTIA 2CLFA 4LS2A 1FWRA 3ATZA 3IIVA 4Z08A 1IGSA 1QO2A 4OQVA 3BLIA 4ML9A 2VFFA 2G97A 4BK9A 1I8JA 1TTQA 2H3DA 3W71A 1PL9A 1SO6A 3GNDA 5HULA 3PM6A 1M6JA 1O95A 5EA9A 1DOSA 3HGOA 2RH9A 3INPA 1YDVA 3S1UA 1ZALA 3BG5A 3W7NA 1OFQA 3LCLA 1TPEA 3LB0A 1SO3A 2W6RA 5BMWA 1NAL1 4UTHA 4S2BA 5K4ZA 5EBUA 3ZS4A 3M5ZA 5CPNA 3LXAA 1FXPA 3TXVA 2X1UA 5F2GA 4CQAA 4Q4KA 1XUZA 2CLEA 4N02A 3TROA 5LKYA 1K7XA 1OX5A 1SSDA 3W2UA 1GVOA 1TB3A 4DBEA 3TDFA 1SZEA 3E9AA 2I9EA 2QCNA 5CZJA 3OBKA 2J88A 3SY5A 2NZLA 3C3NA 4LV4A 1LRNA 3OVRA 2TSYA 3H55A 2YX0A 3B04A 3M16A 4IPIA 2PRLA 4JTHA 5AHMA 4JYFA 1F5ZA 5D2YA 3HG5A 3KRSA 3N9RA 1G7UA 2WSQA 2OJPA 2VELA 3DFQA 4I7WA 4WOZA 1S5TA 4YLWA 2RKXA 2QCGA
chains in the Genus database with same CATH superfamily
1E3ZA 2WVTA 1FUYA 5EFDA 5EYWA 3VIKA 3SRKA 4OT7A 3QZEA 2WNWA 3A12A 5CPTA 4NNBA 5CAKA 4FHAA 4QCEA 3E0WA 4M6PA 1QOPA 4NJKA 1YTDA 3WQVA 5DMMA 2OLAA 1WDQA 2VTFA 3A13A 2EPNA 3UF9A 3BAJA 3LV5A 4DWDA 1RALA 1JCYA 2BBFA 3KAOA 2VGBA 2JF6A 4GK8A 1REQB 3AIWA 2CIPA 3MSRA 3N4AA 4PL2A 2QCLA 1A5KC 3O63A 4TO8A 3OLIA 5CLWA 3V36A 3EDEA 4IJRA 3RR4A 2OKOA 1CNVA 3JW7A 1LOQA 1B54A 4LU0A 3QY8A 2OSXA 4LVGA 2PC4A 3LD5A 3G18A 1NQ6A 3CIWA 1U22A 4A3YA 3RPDA 4NUWA 4ECLA 3L67A 1WXYA 3TW6A 2UY3A 4KGJA 3U8GA 2WZMA 3JU2A 1UASA 1W5QA 2OT0A 1JF5A 1SZRA 2WC3A 1KB3A 2I1OA 3W7JA 3W1AA 4EOUA 5CZTA 3SUUA 1MQRA 3SRFA 1TJ2A 3GZ3A 4GQRA 5MKGA 1VLWA 5HQMA 3K8LA 5E6YA 3UJFA 1XQLA 3AHVA 2PWUA 4ZE5A 5CQ1A 3SCUA 1TV5A 3LYEA 3MUAA 4GI9A 2V69A 3PP7A 3WYZA 3EKLA 4M1BA 4M7TA 4GI4A 4MF4A 3HV9A 3WMSA 5E0KA 3V7PA 1WKFA 3CM4A 1W9VA 2J7GA 3CASA 4NU7A 1SM9A 2ZUNA 3H2EA 3B3DA 3CZLA 4TV5A 2PDKA 3GXNA 2J4GA 3NG3A 5BU9A 2DZWA 2QCCA 3P0WA 2QDDA 1FWSA 4PMRA 2R14A 2RGMA 2CZVA 5LIYX 1KFKA 1UOZA 2PC8A 1NQKA 3NO3A 1OZMA 3N04A 4PL1A 1X97A 2GGJA 2QXWA 4E4PA 2HISA 5DLCA 3TW9A 4TIMA 3E02A 4KRTA 4TQTA 1GQKA 4XK2A 2WSYA 5AHFA 4CGTA 3TTEA 4XWUA 4GVGA 3PPHA 1KKOA 4XB3A 5K2ZA 4GBDA 4ICMA 1JPDX 2VZVA 2ZZ4A 1LF1A 1JXJA 1LQ2A 3VOJA 3PWIA 3EDFA 2VX4A 3U4FA 2ONEA 1XD1A 3D3AA 2BOEX 4AD5A 4YS1A 2R1NA 4MM1A 3MC5A 4DI9A 1HQTA 4AY1A 2A4AA 1HP5A 1ZY9A 2PSNA 4JYDA 1VJIA 1KV5A 5A6JA 4DF2A 4GNVA 3E2SA 3T2QA 3P93A 2PZ0A 5HNNA 2AMGA 1X8FA 3TFXA 4HN4A 4GPNA 1OSEA 2O9PA 1NOUA 2OQYA 4AZCA 2XH0A 3W2MA 4M1RA 2VRJA 4MWAD 2QUMA 3DHDA 4X60A 2ZX8A 2INEA 3ZMRA 1ZBCA 2EF9A 4UQDA 1O4UA 2J78A 3TA6A 4IMEA 5DQPA 1FWHC 3CB8A 4I9AA 3ZZ1A 4GO8A 5C2CA 1M03A 1B30A 8XIAA 3IJ9A 4YHGA 4XZWA 3EA1A 1JCMP 3KBNA 5FJRA 4B9ZA 1NF7A 4UFJA 5I0DA 3W7RA 4MGGA 2BODX 4O1BA 5H6HA 2J66A 4UQAA 4W93A 4D71A 4JPGA 1GKPA 3FVDA 3S5SA 1XYBA 4LXFA 4AD1A 4PE8A 3NZGA 3ID7A 3B03A 5DO8A 3SW6A 6ALDA 1AA1B 1US0A 1CENA 3RAOA 5CBBA 1QI3A 1L6WA 1A0CA 1OX6A 4RZ4A 1KM0A 3FA3A 3V0TA 2DZSA 3K2GA 3LBCA 3W7MA 1W3TA 4L4OA 3MZ2A 5AHNA 2W67A 2YW3A 3U57A 2JEPA 3A9BA 4XAGA 3FJLA 4HSHA 4DUOA 4IHCA 1UPMB 3GO2A 4LANA 4MY1A 4HQVA 1Q2RA 3TYDA 3K4WA 3VDAA 2A7RA 2YA1A 4L1XA 2ANUA 4M6QA 5A69A 2X1IA 4I7VA 4IJBA 1KGUA 1T6MA 2RGLA 4E2VA 1XC4A 3NDOA 1XIEA 4GYPC 1TV8A 1V0MA 3BG3A 4JTRA 2GJXA 1KQZA 1RQHA 2P8BA 1CXEA 2O4QA 4FLOA 2JEQA 2QCDA 1HKJA 1M7JA 5E6ZA 3VE9A 3KLLA 4DYJA 4UFIA 5AOUA 3STPA 3K30A 4I9JA 1JI1A 4K38A 1E0UA 3ABQA 3WEOA 2WAGA 2OQLA 4RXGA 3LGGA 2DSVA 2VC9A 2Q8XA 2HROA 2V5JA 5KINA 1UKPA 3GBEA 1S2UA 4X0NA 3K4DA 1IWAA 4CNOA 5FEXA 2XSAA 4V2XA 1W54A 1E4IA 3MZNA 3R6IA 1CXKA 1RV8A 2BTMA 1JI2A 1QHPA 1SMAA 2VX5A 3CC1A 2P0IA 2V3EA 1HZYA 1TWSA 4RDVA 3SY1A 4H6KA 1EHNA 1IEXA 4LUIA 4D6IA 2QUNA 2OLHA 1AD1A 5REQB 3UY7A 1GG0A 1QXLA 3AISA 3M64A 4S3AA 3UR2A 5HUOA 4BI6A 2ISVA 1MEIA 3R0UA 3P84A 2OZ0A 1VH7A 4MKNA 2VMFA 1QPOA 3N11A 1S5VA 1TR1A 2ZRZA 3GTHA 5CLTA 4EPKA 3ZJ8A 4Z2IA 3W1LA 1DJWA 5FEWA 1W56A 2C1GA 4D8ZA 1TO3A 3PFMA 1XDJA 2YCKX 4QAIA 3W82A 5G4EA 5B7ZA 4BQ5A 1SZNA 2Z27A 3UWEA 3JZUA 2R1PA 3OHIA 3EMQA 3MMUA 1LWHA 2Y7EA 3M6DA 3SN1A 1D3GA 1A5BA 4JCMA 4MUPA 3TOPA 3IVUA 3YPIA 4EXAA 4OGZA 1XLKA 1QI2A 3M5YA 3MS8A 3B97A 1IXQA 4HKPA 3VIOA 3L68A 3DI0A 1IYXA 3PPGA 1E4LA 4HJWA 3KHDA 4L9XA 4LBSA 1XSJA 4TOQA 3F4CA 1Y5WA 1E0XA 3UZ5A 2HDJA 3KVLA 3NOYA 4WIWA 4AW7A 3NM1A 2V82A 1VBHA 1NF0A 4N9BA 3SN4A 3ERPA 3B0VC 4FR6A 4ZFMA 4PFMA 4X0VA 5DMNA 4UQ9A 4L5ZA 2C7FA 3GU9A 3S2CA 4UUIA 1D8CA 4QISA 1NEYA 1MZHA 5CZ0A 3DBPA 4HA1A 1R30A 3L4UA 2R1LA 5FAJA 3STEA 3AHXA 3P62A 4K68A 5JQ9A 1G4EA 1XM3A 4DNMA 4IMDA 1E0TA 3CV2A 1EJRC 1XV8A 1D3HA 5I3HA 3SJ3A 3HPAA 1J96A 1XRSA 1RR2A 1CXIA 1TPB1 2IQTA 4JEQA 4LS1A 3W7CA 5A95A 4LRTA 1C8QA 4AIUA 2G41A 1QASA 3XIMA 2DU2A 4Y9AA 3N2OA 5BNKA 4GRSA 4UTJA 3S5ZA 4DJED 5F1UA 5IBXA 3DFSA 1OWQA 4AZIA 1BF6A 2KZHA 4X61A 2Q71A 1Q45A 4GX9A 2JFEX 3QV8A 2E09A 4INFA 3TNOA 3L5LA 1EA9C 3BJTA 4R53A 4LYPA 4CCEA 3WQGA 1JCTA 3HGJA 3MWAA 2F38A 4GXWA 3S4TA 1W1A1 3R43A 3G5EA 4JY8A 1O94A 4I5RA 1X6NA 3FKKA 2C0HA 2VVSA 4Q4OA 3KRZA 2ISWA 3NQAA 2HMCA 4J2MA 2GDUA 4W8LA 1JZ2A 1SUXA 3BLDA 2LLEA 4E4FA 1MFUA 4UOJA 5KZ6A 4MB3A 4UQCA 1QDSA 4L4PA 1ITXA 1XRTA 3H22A 1FHVA 1GZ1A 5U7SA 1DJGA 4QXIA 2BSLA 2E5CA 4HZ6A 2GLKA 2YGYA 3DXIA 4QJ3B 4BS0A 1S3TC 5FF3A 1I2NA 3PWAA 5MKGB 2ZUTA 4AY8A 2XZ7A 3AU2A 4Q3MA 2YFNA 3TUUA 2TYSA 3WJZA 2Y89A 3WD2A 1D9EA 1YXCA 1PZ0A 3BCDA 1TQXA 3SQLA 2X1SA 4U2YA 4PSRA 1IEIA 3F4WA 2CLLA 2WMFA 5HMDA 3PJXA 3A4WA 4LAUA 1J0IA 2CBVA 1UIOA 3OBAA 3C2OA 1GVSA 1O5KA 3TK7A 3WDRA 1OFOA 1O1ZA 3UT0A 4CNPA 2NXHA 1M3UA 4AZBA 1AMYA 1OZQA 4E38A 3H21A 1PX3A 2RDWA 3MPGA 2A3EA 1K6AA 1EF3A 2E67A 5A94A 1DJYA 1XDMA 4XO7A 1UR4A 3L0KA 1H5YA 2WHMA 4QROA 2ZRYA 2EXOA 3U2OA 1H09A 4GUIA 1DQWA 3NQVA 4H6RA 3MP5A 1E5NA 3TNBA 2P0OA 4YL2A 2QGHA 4KRUA 3UG8A 3BW4A 1JPMA 2WXDM 2EKCA 3HPFA 1LRQA 1W31A 4UFLA 1YPIA 1EJWC 4CCDA 2CNCA 1E70M 3BCJA 3SCOA 1JRCA 2E6FA 2GWGA 2OWCA 4RNIA 3EZ4A 3TV8A 3GDRA 1HL2A 2HNHA 3SGUA 2PLMA 1AD4A 1ALDA 2C1HA 4BR1A 4GHRA 2DQXA 1XUUA 4PMOA 4AZCB 4GO9A 2CXEA 4M19A 3HG2A 4JNZA 2FZDA 4JNYA 1IIGA 4KWSA 1VHNA 4ZEPA 3N17A 1FWTA 2Z4GA 2DT0A 5G4HC 2D69A 1NWTA 4AYSA 1Z41A 2PLJA 5CG7A 4DO5A 4ZQRA 3RLGA 1SQ7A 4J4KA 4PMNA 4IPLA 4V1YA 1RQBA 2F6XA 3T55A 1VYRA 1V3LA 3VGFA 3LS9A 3SFWA 1G4SA 3R2GA 5AFDA 1BPLB 1PCWA 4UQEA 4ZQPA 2W0UA 3T0CA 1ZS2A 3CHFA 4R3UA 1IXPA 1MDLA 3NVDA 3ONCA 4S3GA 3GKAA 2CETA 3A21A 3UWYA 4JTAA 4DJEA 4CCZA 2R82A 5FESA 4KFPA 3HIJA 1BGAA 1QNVA 5A6AA 1X7FA 2OYLA 3O7UA 4H7ZA 4JIEA 2E3ZA 2ABAA 2ZUWA 3UNTA 4ZENA 4FIRA 4P7OA 4LV9A 1CGYA 2A2IA 4JN6A 3BDKA 4KF1A 1FOBA 4Z1BA 3QGAC 3CU2A 4GOAA 1V6TA 3OYZA 1NTHA 3TH6A 1TZZA 3WLJA 3AO0A 1BYCA 1JPKA 2WCGA 3I4EA 1C8VA 3QXBA 1JFHA 3QJAA 2PDQA 1ME9A 3ARXA 5BXSA 1SW0A 2C71A 2QUTA 2RDTA 4KGLA 3H8AA 1RY0A 4HT3A 5C7VA 2PFHA 3APGA 5LSMA 2GJXB 3UVAA 3PZMA 4FA3A 3WK0A 4TMCA 4KEUA 1GQIA 2XFFA 2C13A 1OY0A 4U28A 2QCDB 2DT1A 1L6YA 3S2MA 4DUWA 1A5CA 1PWMA 1UWTA 2HZGA 3ARPA 1YE4A 3W07A 3CT2A 3SFKA 1TTPA 2PGEA 4O18A 3ARZA 2IS7A 2JGQA 5FAGA 2IQDA 2OGJA 3EX2A 5JVLA 4M0XA 5F1VA 3GM8A 3WY1A 4DLMA 3BC9A 1KRCC 4L80A 2VDIA 3W7KA 4YYCA 1GVYA 4RDZA 2BY1A 3AOFA 4JKKA 5D2TA 3P81A 2G3JA 3H2AA 4E8DA 1HL9A 3N13A 2XN0A 3T9PA 5MHBA 1GONA 2DH2A 3WUBA 3G0SA 3VIFA 5TAOA 2Y7GA 3OLEA 4DZIA 1ISYA 3WH8A 1UD8A 2D2OA 4HU8A 4UC5A 1CGWA 1F6KA 1ADOA 3AALA 2ZZ5A 5HATA 1EZ2A 1IQ8A 3W9ZA 3WDQA 2DZPA 1OCBA 1GG1A 4F0LA 5K9DA 3NQ8A 3M44A 3C86A 4GIEA 2VEIA 1RD6A 4QIUA 1CCWB 1XYAA 2I16A 1SJCA 4BKNA 5GVJA 3SURA 3RLHA 1HKIA 5HANA 3F4DA 2CZ5A 2D1ZA 2Y5JA 3E0IA 3WG6A 3PULA 3VMOA 3B9AA 1K4GA 4DWSD 1B3VA 4C6LA 1VCVA 2IXUA 2YZRA 4F0KA 1QO5A 1ZSXA 1ZENA 5AHEA 3QPEA 5BWAA 3B8VA 3H2FA 4MY8A 3R8GA 1I6NA 1DXIA 3AYTA 4GXPA 2AKMA 2BWGA 4W7WA 3VK5A 1FWIC 3WQCA 3B8DA 3AC0A 2HCVA 3W81A 1XYCA 3S9IA 2ZIDA 3LRMA 2OQHA 3LBMA 4LF1A 1ZL1A 1OINA 2WK2A 2XG9A 4EP8C 1RCQA 1VKFA 5IBXC 3CK5A 3SEPA 2FHBA 4HNNA 4N6EA 3GLCA 4QHRA 4Y8EA 3HV8A 3FJ4A 2E40A 4J3ZA 2PLKA 5DT7A 1R2RA 2YDRA 1UD3A 3WLMA 4H9MA 3PR2A 1F74A 1AFSA 4CVUA 1GHRA 3N6JA 4US5D 1H41A 4M82A 1U1JA 1UKQA 2B0MA 2NVCA 3V1PA 3WH7A 2BZNA 3PZQA 3POCA 3L21A 2DUZA 4IP7A 4JTGA 2ZRUA 3VGBA 4AISA 3QMRA 2VC7A 3EPOA 3NQBA 1AZ1A 3LGEA 3VGDA 3HFTA 2X16A 1LG2A 4GKLA 1DHKA 3FEQA 1W1TA 2WC4A 1JAEA 3LCFA 1HJQA 4LT9A 1Q4NX 4O1CA 3Q2DA 1SFSA 1U30A 3KUMA 1CYGA 1KCZA 3GH4A 3O6YX 5L6UA 1M7PA 4HHLA 1MUWA 1S2CA 2XSBA 1IR1A 4FPSA 4GNJA 1BGGA 3EWUA 2YBUA 1GWJA 3RJXA 4HCHA 3CL8A 3HBLA 4GFIA 1ICSA 4WXZA 1MRAA 4TX8A 1GQNA 2XM2A 4S3DA 4H9YA 2VCCA 3W2JA 3M0VA 3O06A 2O56A 3WLOA 4ORMA 4PTVA 5EMMA 5A6KA 3NJ3A 1KQYA 1JNDA 2Z1VA 5F4WA 3TZFA 1ME8A 2YCJA 4HK6A 4PGLA 5FIPA 2HXTA 2EPLX 2R24A 2V8ZA 2RAGA 3RUBL 2Z29A 1Q3NA 4I6KA 3WD0A 2WSKA 1GUVA 4KQNA 1W2PA 1QJWA 4OFCA 3RLUA 1JJKA 3MP3A 2CPUA 3LM3A 1L2QA 4U5KA 3IIOA 3ITCA 4AWEA 2BS9A 4H01A 1C92A 4XIAA 3CWOX 3UG4A 1XLLA 3DENA 1O66A 2Z2UA 2HE5A 4DIAA 3EPMA 1GVEA 3L9CA 2PD5A 1AJ2A 3W7IA 4MWAE 2AGKA 4N4QA 4XKYA 3BMWA 2R8WA 3LHUA 3M4HA 2XVNA 1O7AA 3VGEA 3LLFA 2Y8UA 4G56A 4MG4A 1XLGA 2ZX5A 3WD4A 4W5UA 1TIWA 3VIJA 1TR9A 4MKSA 5D09A 2CBIA 4HPXA 1M41A 1HG3A 3DH7A 3U7VA 4ZOEA 4N9DA 4J28A 1WQ5A 3MUCA 3WK3A 4OBTA 2E9BA 4OE7A 1V02A 3F03K 2G5WA 5CBJA 1MW1A 5EGRA 1GVIA 3HQNA 3KBJA 4NJGA 3BK0A 4MIMA 1BXBA 2FYMA 2FPVA 3QC0A 3ITVA 4DWSA 3LNMA 4EWJA 1KLYA 3BE7A 3GHUA 1W9BM 4R27A 1M1BA 5F7UA 1ADDA 1D7KA 1NM9A 1F8MA 2OCZA 3WH5A 3GYEA 1E6ZA 1OG0A 5LIKX 1JZ8A 3M0IA 1GTHA 3PY2A 2OGYA 3MDUA 3CNYA 3WBYA 4KFOA 1MEWA 1R47A 2QV5A 4FLSA 4B92A 2AL1A 2J74A 2PCEA 4JEJA 1WUFA 3UD6A 2VFHA 4KCTA 2FFCA 1WB0A 2FJUB 2XDFA 2O92A 3RR1A 1BG4A 4DJEC 3GH7A 2ZTKA 2HQAA 4EF9A 1Q4WA 4CD5A 4BJHA 3PSWA 3H12A 2Q01A 1DEDA 4KRZA 5C54A 1Q8JA 3EB2A 1X1NA 1W3IA 4FNTA 2WWCA 3PZ9A 1FWCC 4DYKA 5K9CA 1V79A 3RLVA 3AS2A 3N1AA 4GYKA 3L4VA 2C3ZA 3HQOA 1GW1A 3PZIA 1DE5A 3AIQA 2V5CA 5FL1A 1EP2A 2V5BA 5HWMA 4GI8A 1VFTA 2QV4A 4C1NA 3EWZA 4O54A 5JXQA 3ZWTA 4Y9OA 4B2DD 3CHEA 3NQGA 3NVTA 5FD0A 3WUEA 1JCXA 4F0MA 1QU4A 4IFRA 2IUZA 2WANA 3N2MA 3KP1A 4P7NA 1ZU8A 5CH9A 1JCNA 1CGTA 4PEEA 3WQOA 3W88A 2TMDA 2NLYA 1OC7A 2D0GA 3W1PA 3RXZA 4PMJA 4B16A 4MHBA 1A5AA 1ZGDA 1H62A 1AVAA 2EJAA 2EHHA 4GZEA 1XICA 1EGMA 1EDQA 3MHGA 3VD4A 1PKMA 1E9YB 4GUGA 1A4MA 3UEQA 1H1NA 1PUDA 4AZ7A 4D6CA 1V8EA 1R86A 3M41A 1QPQA 5ENLA 3WCZA 4GCAA 1LBLA 3UZJA 2RJGA 3UCCA 2VENA 1CGVA 2E68A 3P8JA 4Q8VA 1PYMA 1XCXA 2P50A 3GIPA 2W5FA 5I3FA 5A8PA 5KEZA 1FH9A 4UMCA 4O50A 1VPYA 1XINA 2F7FA 5LZLA 4K1GA 2AGTA 3W7GA 2VOMA 4Y6GA 4PUMA 3TN3A 1BYBA 2PLCA 3L4WA 4BF9A 4FNSA 2FQIA 2YOCA 3NSNA 2PU0A 1XLMA 3EB3A 3E38A 2BHZA 4P8VA 1KWGA 2OPJA 5I2UA 2D3LA 2HRWA 2WQDA 1E72M 3LZ3A 4J35A 1RJQA 2F2KA 1QBBA 3TTOA 3G3MA 3IVSA 4HIBA 3BLLA 3KL0A 1KRMA 1GYNA 3BLFA 4DHGA 1S5NA 1W3KA 4JXCA 3DKLA 3F7JA 5I77A 1E6XM 2HVMA 3IJ8A 3RNDA 3OIXA 3B4YA 2VFDA 1O60A 4FLQA 5BRQA 3O6AA 3P8IA 4MFEA 3S5YA 4X3ZA 2GGEA 4LAKA 1GZJA 3URQA 1DPMA 3EA2A 1OM0A 5FF2A 2PP3A 4QCFA 5I09A 3VNZA 1GJWA 3GHRA 3FIGA 4O1DA 4H8VA 4OUIA 4NZJA 1OFEA 1O5XA 4FIQA 4CUCA 3N2TA 2CHOA 1ZAJA 5A8OA 3HA1A 4PUJA 4PODA 4TVUA 2CC0A 4HTBA 3VNKA 3I6EA 1KCXA 4HMEA 3NYZA 3WBWA 2OOFA 2WVSA 1C9WA 2D73A 2Y4SA 1XBZA 4XZMX 3IV8A 2GGIA 3P0XA 1MW0A 3WJWA 1X39A 4K2SA 2ZTJA 2VM8A 4AX6A 1W3LA 2G95A 4ACYA 3R0KA 4AZHA 1F6PA 2NXIA 4UTWA 3VE7A 3ANUA 4ZCWA 1A53A 2YSWA 4WDWA 3W01A 1OABA 3TN4A 3PPCA 3LERA 4XTDA 4E6MA 3GXFA 4LS2A 3MY9A 3UYIA 4NP7A 3ATZA 1SJBA 3REQA 1QO2A 4ML9A 1I8JA 2H3DA 2Z1XA 4AEFA 1O68A 1M6JA 1DWHM 5EA9A 1DOSA 3WMCA 1OD0A 5A2BA 4PRTA 1VJZA 3BG5A 4F9JA 4S3FA 5DMLA 1NAL1 1RY8A 3B8UA 3PAOA 2X0HA 3TXVA 4N02A 3TROA 1K7XA 2WMKA 3W2UA 1TB3A 1SZEA 3GG7A 4QG8A 5JU6A 5CZJA 2IPWA 3PFRA 2J88A 3OU8A 3OVRA 3VOCA 3H55A 2YX0A 3M16A 1UUQA 4IPIA 5D2YA 3KRSA 2WSQA 2OB3A 4I7WA 2RKXA 4ZXLA 4NNAA 2PDJA 2DV0A 1QTWA 1BRLA 4LYKA 2QDGA 4MNMA 4XUYA 4LH8A 5HR7A 4I3GA 4IT1A 3FY1A 2W66A 4R5EA 1CB7B 2Z00A 2Q3OA 1DWGM 3FYPA 2J77A 2CZDA 3EEGA 2ZRXA 3IUIA 4GIRA 4UFMA 5DX7A 1P6CA 1UZDA 4ALDA 1EUNA 2ACQA 4TU1A 3PB0A 3OG3A 2V63A 4FOUA 3Q58A 4HMCA 1HJUA 2E6DA 5IXEA 3VDHA 5LNRA 3SCSA 1XIDA 2DIJA 3FHQA 4JFTA 5AC5A 3WLRA 3DX5A 1IF2A 2DSWA 2ZE3A 4CN4A 4DXXA 1HJSA 1AODA 4QM1A 1FX6A 5HR6A 2V81A 3W84A 4NY2A 3GS6A 1KXHA 1LZOA 4XQ6A 1ELSA 5FL0A 4AEEA 1V6YA 3TSMA 4BF5A 2DZAA 4U31A 5DELA 4S38A 2XH4A 3SDOA 4B3ZA 4F48A 3FS2A 4F2BA 2ZUUA 1GOQA 3ARSA 4JFSA 1WCGA 1W32A 2DDXA 1N55A 1EA0A 1BYDA 2HS6A 2CESA 2XH2A 4WDUA 4GZIA 1VFLA 3BG9A 4Q8PA 1G7VA 4KCWA 3LTYA 4WD0A 1EO5A 3PTMA 4Z17A 1UBPC 2Y7FA 4LEFA 3IPWA 2G3IA 3CQIA 2DJXA 3KZSA 2CLHA 1X1ZA 5IOBA 4QS6A 3SCPA 2O9RA 1I2RA 2YXGA 5J8LA 5K9XA 1LWIA 3UY8A 1J0KA 1F4HA 2Y2WA 4BI7A 1AQ0A 4H1ZA 2BXVA 4CNSA 5FF4A 5D2VA 3W7LA 4ASTA 4DWSC 2WNNA 3TYZA 1BF2A 4GYJA 3FLUA 2NSXA 1W9PA 3CQ0A 4ILSA 4F2UA 3FW6A 3NL2A 4HPNA 4LW7A 2VFIA 4LAOA 3QYQA 4XKYB 4G5DA 1FWFC 4IXXA 3EWYA 2FB3A 4FEZA 2HVOA 4GGHA 4JIPA 3QTPA 1WBHA 3UWVA 4B3KA 3WJXA 4NASA 4DF0A 5I7GA 1K02A 1P48A 5CSYA 1VR6A 2VXNA 3CZGA 3AUJA 3B8TA 2YCLA 4XD4A 4FS9A 5GQBA 4WKFA 4EPEC 1E4MM 1JIBA 4ZQCA 3NXLA 4LNCA 4ZA0A 4HU4A 2NQ9A 1FCQA 1XPGA 3DUGA 4RKAA 4PUEA 4DWSB 5HWJA 4Z1YA 4ZBCA 3ECQA 5BU6A 1UC5A 1NDZA 3IK2A 3N9KA 5AC4A 2PDLA 1RJPA 1ZP3A 3AWNA 3T07A 1MXDA 4Q6XA 2VDHA 2PEVA 4WUIA 3N4FA 4FNRA 2GQ9A 2OO0A 3L5MA 3A3HA 4GIYA 3G6LA 2ZXQA 5CGQA 4AD2A 3MBDA 4Q4QA 4GJ1A 4LF2A 3ZM8A 3WUFA 3GUWA 2PDUA 2CBUA 4NZFA 3TJ4A 1E6RA 5EFFA 1TRIA 3VU2A 3NZ1A 2EKGA 3M5XA 3SN0A 3U48A 1CI1A 5ABGA 1JDEA 2J8GA 2YPIA 1FKWA 2PDGA 2ZUSA 3MUIA 1GOKA 3OG2A 3QPZA 3ZYZA 2DIEA 3EWBX 3GU2A 4CQCA 2J8TA 3BVJA 3HFYA 4QQ3A 4IGMA 2FIQA 2H8XA 2PA6A 6XIAA 1XGEA 3ICJA 1YDNA 1MXSA 3S6DA 1HO1A 7PTDA 5IHRA 3IJ6A 4C6NA 1A3WA 1VRXA 1MQPA 3A5FA 1JPHA 3KCLA 3L4XA 1UPPA 3P2VA 2KAUC 3PBUA 3P3BA 3BJFA 5BROA 3TLQA 5E9AA 1OVDA 1NP0A 1X8CA 4WSKA 3LHZA 1PAMA 4CN1A 4NXKA 3L0NA 3NPUA 2REQA 3TFCA 3G1RA 2XZ9A 4IFKA 3QSRA 5T91A 3G6MA 5ABEA 2V2DA 4J3XA 5A8MA 1S1RA 4XV0A 2OXNA 5FA5A 5AHIA 1R85A 1UKOA 3VIHA 3PZVA 3P14A 4WJXA 1ZNNA 3CBWA 1Z48A 5D2XA 2P8CA 3IK4A 3VABA 1L6FA 2Y85A 3QV9A 4IGNA 7REQA 3O05A 1SZFA 3RRAA 3VKKA 1BQCA 1V5XA 3BURA 4IX0A 4UR8A 5G2WA 5CXPA 1OFAA 1DJIA 1CB2A 3PZGA 4JAWA 3S2JA 3VAVA 3O07A 2ZUVA 2VEFA 1JDCA 4H2HA 3OZOA 4PB4A 1YXYA 3RGTA 1B3WA 2PP1A 4ZMGA 3H23A 2J8FA 1ECEA 1EO7A 2OSWA 2HXUA 2MANA 2XIBA 3DFTA 1GOMA 2CZFA 2BXZA 2PDFA 5C9RA 1TUFA 4LSBA 1UKTA 3PG8A 3UU0A 3W28A 1HKKA 3LPOA 3IANA 3UG5A 2VC6A 3WNMA 1FP8A 2EPKX 3QKZA 1XLJA 2Z0IA 2CHNA 3WELA 3NQCA 5I79A 3SQSA 3QQ1A 3C4UA 3PZUA 1GCYA 4L61A 1YXDA 1HVXA 4X22A 2FLIA 1XG3A 1W9XA 4LY8A 1SW7A 4UTWC 1R38A 3OVQA 1QATA 1PKNA 1B3YA 4MB5A 3N3MA 3TONA 4E3VA 4TV6A 3DGRA 3SJNA 1WPCA 3UGVA 5A5WA 1VBGA 1ONXA 1X6LA 2XN1A 2GGGA 1OIMA 4UFKA 2VUYA 2VCBA 1RCXB 3GQYA 4ZGYA 3KW3A 2P10A 2HK1A 3GFZA 4DBUA 4RX0A 3WFLA 5BWFA 1PVNA 1J5TA 1SJAA 4Y2WA 1XW8A 1QFEA 3NSMA 1HO4A 4FXFA 1XG4A 3EAUA 3SI9A 1DWAM 1M04A 4JZ5A 4U3AA 5GNZA 1OC6A 4O10A 4XBSA 3CPGA 3K4AA 3STFA 3HJEA 3WK1A 2XFWA 1QUMA 1VIZA 2FGLA 5HNUA 1WDDA 3W7EA 5I06A 4NJJA 3DFPA 3THCA 1PS9A 2WPBA 3S0CA 2L5HA 2VWSA 4C6BA 3KOWA 1UUOA 1S38A 2VNCA 3W85A 4D9PA 1VFOA 3ELFA 6CGTA 4ZSTA 1O12A 4GI6A 2OTDA 5BXPA 4Y96A 1XC6A 1E9LA 1PZ3A 3EGJA 3REQB 2IKGA 1YLVA 4Z2HA 2W91A 2ZKMX 3E5PA 1E6QM 4JQ2A 1NDYA 4DM2A 1TZ7A 3BZGA 3PUEA 4H2CA 3PK7A 3PNUA 2I56A 3CLWA 4J3TA 4PUWA 3GU1A 1UR3M 3UJSA 2E5BA 4FMVA 5EL1A 3BQ6A 3QN3A 4DELA 4KWVA 3L0GA 3RCNA 3SY8A 4C6IA 5CBIA 1UBSA 2YB4A 1RH9A 5DFAA 4K8HA 3S3GA 3BLOA 4LX4A 3ZR5A 4XAFA 2VURA 4MJ4A 4X2PA 4A3UA 3NYDA 3DYPA 2FMOA 3CV1A 4ZZ9A 1FCVA 2D20A 3S2LA 4PMZA 1BRLB 3EB4A 3UJEA 3LCHA 4DX3A 3VKJA 1GPWA 1YQ2A 3B0XA 3B9NA 3ITTA 1OFRA 1N2VA 1FDJA 2J79A 3OHMB 1XSIA 1EC8A 4WQ6A 1UH2A 3GNXA 3CZJA 4YPJA 4S39A 2PBGA 3UXAA 1E3XA 1TG7A 3OZMA 1P6BA 4WGHA 3CH0A 5I5RA 2J13A 3TJXA 4KEVA 1SO4A 3WBXA 1HP4A 2CYGA 2F9RA 5D9OA 3JVAA 3P61A 2ZVRA 4QSFA 5B7YA 4O1EA 1R0MA 5M3WA 1T99A 5F4SA 4A8LA 4NYUA 5FSDC 3NZRA 1BQGA 2QJGA 3H6OA 2P53A 4YVVA 3C56A 3B06A 1LCOA 1V7AA 2YYUA 4M24A 3KTCA 1NOFA 3KZPA 4XZNX 3W7DA 3Q37A 4LJ3A 3MT1A 3UA4A 3NEVA 2X42A 3CAKA 4MNJA 5C70A 2Z2AA 3FA4A 1UKSA 2QVNA 3HPZA 2WV8A 1C9DA 3OLDA 1XBXA 4UNKA 5EY5A 4LS0A 4K36A 1W91A 4NILA 3AS1A 6TIMA 3NPVA 3K13A 3APTA 1C29A 3L7RA 3R4IA 4AD3A 1K77A 1KM5A 3PVFA 4UOQA 3T78A 2FGZA 2O4MA 3ONBA 1JYXA 3CHVA 3T2PA 3GRIA 4CNTA 3W83A 4M81A 3BV7A 4EF8A 4N2YA 1A49A 1KM1A 1J8VA 1RJRA 3U0HA 4PB5A 1GOIA 4QLLA 1RSCA 2QGYA 1ZCCA 3W22A 1T5AA 5JH2A 3OA5A 1S5MA 1NIUA 3VCRA 3S1XA 4JTLA 4US6A 3OVPA 3IJQA 3CIXA 2E5DA 1AQHA 2ASHA 4L9ZA 3USZA 4LB4A 3M0XA 1LROA 4EVZA 3NL3A 2YCLB 3BWWA 5KITA 3C2YA 1PX8A 2NUYA 3T0DA 3VOHA 1G69A 4CU7A 3SIZA 3UG3A 1K8CA 4KIRA 3FA5A 1PV8A 4R85A 2VRQA 3BMXA 1JDAA 1DVJA 3D47A 3SGZA 5IFTA 1FDYA 1ITQA 2BASA 2QPXA 2VVNA 1EXBA 5CSSA 1MNZA 3RX4A 3TW7A 4O28A 5AC8A 3VDGA 5BOOA 5A6SA 3KTSA 3AFBA 2FH6A 4W9TA 4AWTA 3N14A 4WKAA 3WJSA 1J0ZA 3E0FA 3CMFA 1PJ9A 4ICNA 4Z2KA 2PDWA 3W6MA 1CGXA 1FHLA 4XG1A 1A5SA 2BOFX 1ODZA 1V3MA 4AWSA 1UMYA 3ITXA 4NL1A 4S3KA 1VAHA 1ONRA 3TVAA 1XLAA 1P7TA 3G77A 3HTWA 4GJIA 2OWWA 4AY7A 1B31A 1VYPX 1EGVA 3LLDA 4JNMA 1UD6A 3TR9A 3WNOA 1NU5A 1S46A 3WQ6A 5HINA 4FNQA 2GDQA 1ZP4A 2PWFA 3VUPA 3C5QA 4PMYA 3L66A 5XINA 1UP2A 3E96A 3OVGA 2ISFA 2R6OA 4NZ5A 4QJ5B 4Z1AA 1ITUA 2XWDA 1UWQA 5I02A 3NTYA 2REQB 2V2HA 4NI3A 4IFKB 3FDKA 1E1CA 3UCQA 3HN3A 1VENA 2BY2A 4QRNA 3TQPA 1WZAA 2HNEA 5CPLA 4QTGA 2R91A 4I6VA 5I3DA 3OLGA 4NT0A 3WL1A 4GA8A 5CSUA 7REQB 3WEZA 3IAQA 4GVFA 3TAKA 2PB1A 1XIMA 1LQ0A 2AL2A 2GOKA 1OB0A 2HPMA 4B4FA 2PWEA 4HSNA 2A5HA 3G2GA 3CUXA 4XD6A 2GK1A 2FGBA 4MNKA 4ERIA 4HHMA 1Z89A 3AXIA 3VDBA 3RM9A 3CV6A 2B4GA 1W9UA 2O0TA 2CKSA 3DGBA 4AMAA 3R0DA 3M1ZA 1EFZA 3P5YA 2W79A 4WEVX 3VNLA 3SADA 3TN5A 5LNUA 2FJKA 3LA4A 3FOKA 4AIBA 4O57A 4H8NA 3TSBA 3KVMA 2J6VA 3SRDA 5D2WA 1SO5A 2J7BA 3KBWA 3ORWA 4JTUA 3RM4A 5EMUA 4K37A 8TIMA 2WSPA 3IJ7A 5E0CA 3OGRA 3NQMA 3PSVA 4W84A 1VC4A 4DB7A 2YDAA 1THFD 3BCFA 4HZ7A 1F3XA 5FJTA 3THAA 5H91A 1SW3A 3EX4A 1OJXA 4AD0A 4FX6M 4CU8A 5E9XA 1J93A 4IQJA 3SUWA 1ISZA 1NH6A 4AF0B 2YJQA 1B4KA 4WX2A 5EPDA 1G0CA 2VUNA 5C5YA 2B7PA 2PUZA 4P8WA 2XISA 3CV7A 1FFQA 1RA5A 4PMVA 5DCEA 4E5TA 1EXPA 3ATYA 2GJNA 1HJWA 2EG7A 4ZB2A 4ZQOA 4J3UA 4IFOA 2GUYA 4U4MA 2VDGA 3PPFA 3C0SA 3BW2A 5GJMA 3OO2A 1OGGA 2G4FA 4F79A 3SCQA 5G5IA 3GB6A 1RVGA 4QLJA 2D2HA 4GQ0A 2IPGA 4UTUA 3HB9A 4TX9A 3I3EA 1FBAA 3ALGA 4S23A 1H7PA 2ZADA 5H2ZA 3A23A 1MMFA 3IWPA 3VD7A 1GT8A 5HA7A 5ABHA 5HMFA 5A8NA 1E6SM 1KGWA 4H19A 1LORA 4IIFA 1PIFA 2QEZA 3BZJA 4K39A 4IIDA 4G1KA 1KW1A 4RR4A 3QR0A 4L6OA 3VO0A 3HG3A 1EX5A 4DPQA 3IRSA 1OBAA 4HN8A 2WBKA 3LMZA 5EMYA 1AJZA 1OK4A 1H4PA 3EWXA 3L5AA 3MVIA 3AS0A 1QPNA 3OJGA 4CQDA 1VCFA 2BFGA 4YTUA 3TYAA 1EZWA 2ZZ1A 4ZL1A 4HZMA 1CT5A 2J25A 1ENUA 3I10A 2POZA 2QF7A 5AN7A 5IM51 3G1HA 4HK7A 4C6OA 2INFA 4V15A 2WMGA 2XIIA 3J7HA 4IP5A 2HWGA 3UW6A 2PWHA 4O8RA 4QG6A 3LEPA 3ZO9A 1VPXA 1BSIA 3FGCA 3BO9A 1UP0A 3WBAA 4BEQA 3ITOA 1JUKA 2QW5A 4HGXA 4ATDA 4MNLA 1UMLA 4IGSA 3N6QA 1S2TA 1XBVA 1HJXA 1XCWA 2X7WA 4Z1CA 3NL5A 4XBJA 2IMRA 3BAYA 1G67A 3UWWA 3W2KA 2H8ZA 3V4BA 1XIIA 1GPFA 2UZ9A 2PTYA 4W8AA 2OVLA 3M0LA 4OHQA 4H04A 3EOSA 4RZBA 2C16A 2EEXA 3NQ2A 5EMJA 3GYCA 3UFYA 1BYAA 3HZ3A 1CBGA 2G4JA 3SB0A 2B81A 3MSDA 4B90A 3UR5A 3S9YA 2CBJA 1XGZA 3CXOA 1VBUA 1KXTA 2YA2A 4GE8A 1BG9A 5HPOA 3MUY1 4QE5A 4Q4MA 5C7HA 2ZA3A 3ANVA 4MJ2A 2O9OA 1QW7A 1H1ZA 1E51A 3O1NA 2OWXA 2A3CA 3UWZA 1FWWA 3B9OA 3T2OA 1RP8A 2ZCGA 4A22A 4CNNA 3P80A 4X2RA 3CO8A 4N9EA 1G6CA 3I6RA 2WJZA 1H50A 2Q02A 4NJHA 5DMYA 3AIBA 5DT5A 1VJSA 3V3WA 1UR9A 5DY2A 1GEQA 2OMAA 1PPIA 1TELA 3KOXA 3S8HA 4LC6A 5C8BB 2NWRA 4LC8A 1F73A 1CX9A 5G2HA 3N2XA 2F6KA 2ADAA 3DAQA 4ADUA 3AJ7A 3Q4DA 3GG8A 3THUA 3DECA 1PZ1A 2BGNE 3SRHA 4L65A 3ALFA 2HPIA 3VIGA 4GQGA 3OGSA 3WNLA 3UYCA 2PWDA 1R3RA 2XFYA 3S6TA 1SPQA 1XHGA 3GD6A 3QMTA 5H1WA 1RK6A 4HTYA 2R1MA 3MJMA 4LWWA 4ZODA 5CJ5A 3H4WA 3IS4A 1W5OA 3BARA 1OGBA 1SVDA 4G2DA 4MUZA 1EQPA 4ZQNA 2PPGA 2OYMA 1DJNA 2NX3A 5DN1A 3EDDA 3MSYA 5CPOA 1TKKA 2CLOA 2A1YA 1JUEA 3OP2A 3LU2A 2PGWA 1V77A 2GL5A 1R5YA 4PR4A 1KR1A 7TAAA 5FF7A 3POHA 4QJ1A 2OODA 1QNOA 4K7VA 5DY3A 3TQKA 4GIAA 4LGXA 3UXLA 3W86A 1VBJA 2Y5EA 2JGYA 3C61A 4ZTXA 3CL6A 2Q3RA 3PZTA 3BAWA 3O8AA 2FMNA 2ZA2A 4LBRA 5HNRA 1LG1A 1IXOA 3WLTA 2J47A 3GE7A 4B5VA 2BMBA 5JH1A 4IPJA 2CLMA 3C8NA 4HPJA 1E9IA 3W1XA 1RAKA 2FZ9A 3T8QA 3OOQA 4XX6A 2A21A 3UZXA 2WCAA 4H9ZA 3IUHA 2A85A 1QPKA 1TPVA 4YWIA 2C0AA 1P7TB 4PTWA 1SJDA 2NVAA 2WZHA 3I68A 4A3RA 1DIEA 1SU5A 2TRSA 3FN9A 4RNJA 3ITGA 3L2LA 3R58A 4HNTA 4JCLA 4UMAA 3EOLA 2BNJA 5CKSA 2ALDA 1X1OA 3DYMA 2QQ6A 1ZLPA 1FH7A 5FJOA 3T0BA 1J12A 1ONEA 1JULA 4OTKA 3LRKA 4ERGA 4JIRA 1KM6A 4HCLA 5D03A 2HBVA 4XUGA 2Q8ZA 4C6FA 3TXZA 5B80A 2V9DA 4JQ3A 3BJSA 1E1CB 3D3FA 3EMZA 1EIXA 3TLLA 4QQUA 1IEWA 2AAMA 3CTLA 2XJ7A 1NJJA 2QIWA 5ABFA 1DTNA 1KBBA 2PDBA 3GTFA 3IIPA 3LQLA 4TUFA 2WOQA 4O4WA 3ARRA 2TODA 3LM7A 1OHLA 2PCQA 3CEPA 4J40A 3MKCA 3I3BA 3V75A 1XWYA 1V0LA 3O16A 1VFFA 2AL2B 4MLJA 3NQDA 1ZJIA 2Z1WA 4B3LA 2GK1B 1AL7A 4MTVA 3TQ0A 5CC6A 1CZ1A 1TV7A 4GG9A 5LA2A 3MHUA 4NX5A 4P8UA 3SECA 4IMAA 3IGSA 2VEGA 2QR6A 1ICQA 4AVFA 1Q6OA 1I0DA 4UMBA 3P6LA 2SFPA 1US3A 3V35A 1FRBA 3UWUA 1YX1A 2JALA 3LY0A 1TPDA 4HYVA 2PTDA 4QDWA 4H41A 3V18A 2WCSA 3MJYA 1ADSA 2PODA 1EEPA 2C19A 2ZOXA 3RM8A 3AIUA 4HA4A 3W1RA 4KWOA 5D37A 4XKMA 1B1YA 2OFJA 3PBVA 1US2A 5I07A 3GC5A 1M01A 1W1YA 1DIKA 2D22A 1S2WA 4KESA 3ZR4A 4I8DA 3GXTA 2G37A 1CWYA 1TJ1A 2E8YA 4S3BA 5AZ0A 3VNDA 1PYFA 4XD3A 2Y7DA 3AXXA 4LRSA 2V30A 3OZYA 3P5ZA 3PJTA 1W6TA 2E1DA 2NX9A 1UD5A 4BWLA 3LV6A 1K7EA 3DG7A 1R3VA 1R3YA 4L56A 5BRPA 1CLKA 4U33A 4IMFA 4RV3A 1DJZA 1EWEA 2EPMX 3NUKA 3VNIA 5A2CA 3G1AA 3BLPX 3ARUA 5HK4A 2WVVB 2PGFA 2NV1A 1OX4A 4IUOA 4JFUA 5KZEA 5CC7A 1VHCA 1JZ7A 4RLIA 1DP0A 4PCFA 3AQUA 5HOSA 2FPTA 1XRFA 2QVHA 4DJFD 4JGDA 4YMZA 2F84A 4HOZA 1PZ2A 3WSUA 4WF7A 3ABSA 3ZFHA 2POTA 2P88A 5BZAA 2AQVA 3LHVA 5TQLA 1F76A 4AXNA 4PRRA 3H2CA 2JQXA 1QW8A 1IT8A 1I1WA 1SFJA 4NI8A 3FFSA 1E4NA 3HQPA 2GVEA 3VIPA 4YCPA 2WPGA 3VA8A 1A50A 5C2XA 1A3HA 1H49A 3TCEA 3TWAA 4EACA 1M68A 4Q4PA 3PUDA 2QHAA 4LCQA 2XFRA 4WKHA 4ACZA 2J9ZA 4JQ4A 3GK0A 4P2VA 1BSLA 3IJDA 1XLEA 3ITYA 4KW2A 4Z0JA 3I6TA 4JTIA 3OODA 3R8HA 1FWRA 4JTCA 4KH2A 3IIVA 2GDVA 1IGSA 3VD9A 2VFFA 3F2CA 2XIJA 1TMQA 1SO6A 2VL4A 3GNDA 4IL2A 5HULA 2W9MA 3ARQA 1O95A 3HGOA 2RH9A 4K8GA 4O8AA 1YDVA 4B15A 2AQOA 1ZALA 1F8IA 2VC5A 1BFNA 1YDYA 3EOUA 1XIBA 3M5ZA 1FXPA 5GJNA 3TTQA 2X1UA 2CLEA 4DBEA 3TDFA 3E9AA 4LCSA 5D9MA 4GY1A 4A8NA 4YWSA 1WKYA 2NZLA 3B04A 2HEJA 3OPSA 3FGCB 4JTHA 1F5ZA 3HG5A 3SCWA 4XAYA 3N9RA 4F66A 4C6CA 2OJPA 2DVUA 3SCTA 3QV7A 1FP9A 1Q5MA 1ZZMA 3DFQA 1S5TA 2NQHA 1ESWA 4RXFA 2RHGA 1ZTVA 4C6PA 1J18A 5IHSA 3LXCA 3VCCA 3QBUA 2QPUA 1ZBWA 3RIKA 1MDRA 3MYOA 3BQ5A 1ITCA 4W88A 1JDFA 4QITA 1KC7A 1K4HA 3C8FA 2CW6A 1EQCA 1IT0A 3GNNA 2OX1A 4K1WA 3WK2A 1GORA 2YDSA 3AMKA 2V6AA 3G0UA 3AI0A 3W72A 4M6VA 1W8GA 1DBTA 1QCWA 1LRTA 1PO9A 4CKQA 4O52A 4HNCA 3N18A 4Z2LA 1VS1A 3WLQA 2Z6JA 3IUDA 4HPGA 4J1OA 1JG9A 1UCWA 3CS2A 5AYXA 5GJPA 2VR2A 4H6QA 2XN2A 3PBYA 1OCJA 4YTSA 2NV9A 2UY2A 3PF3A 1BTCA 4WXYA 4MKVA 2Y24A 4QEHA 4IIHA 3LUTA 1ODUA 4JN8A 4BY3A 4AHPA 1TPC1 2Y6ZA 3O9NA 4RV8A 1T40A 4DO4A 1IT7A 5XIAA 4F0RA 3QFWA 1V0KA 4IUGA 3TKFA 1A4LA 3WH6A 1CLVA 4L7ZA 3W3OA 1EP3A 4O0ZA 3T0AA 2E4TA 3W24A 1MYRA 3OA3A 2PAJA 4Q4SA 2VZOA 5JBDA 7XIMA 1Z69A 4H7VA 1NWSA 3CZ8A 2AKZA 1XS2A 1A5MC 3RRXA 1I4NA 5A1AA 1QNSA 3S5NA 1ZJAA 2XYLA 5RUBA 3KE0A 3RMJA 3GIYA 1WOBA 4LCRA 4BQ3A 1HGYA 1XH1A 2DW7A 3L65A 4I90A 2R94A 3WEMA 4CNUA 3C3UA 4W87A 1Y5VA 2BOGX 3IEBA 4E8GA 2X1TA 1F4AA 4HOXA 2JIWA 3BXWA 4NIRA 3N2BA 5CZKA 4AEOA 1TZ9A 3BLKA 2V67A 1QNRA 4DUVA 4CD6A 4KMQA 5IDIA 4LTSA 4DJFA 1TE1A 4WVXA 3CWHA 1QMLA 2HV5A 3L12A 5AC7A 5HDRA 3QOMA 3APYA 3EKGA 1EPVA 1SSGA 5A2AA 3CTTA 2OG9A 3TYBA 2GSHA 1XQKA 1CEOA 1IIHA 4RL3A 3SGGA 3KWSA 3MWCA 1K9DA 1T0OA 3N25A 3NPWA 4G7EA 1C7SA 5CGMA 4MJZA 1L9WA 3WQ5A 3G1VA 3O0KA 1C7TA 3LHYA 5HNTA 1Q8AA 3WMBA 3EMCA 4Z42C 1LBFA 4C6QA 1I45A 2ACRA 3QF0A 5KMYA 2BLEA 2VOTA 4AIOA 4KCVA 5TNVA 3QQWA 3C0QA 3VZZA 3M9YA 4YYFA 4GABA 5FJUA 3DG3A 3CIVA 1LBMA 1P0BA 3XINA 3HF3A 1LLWA 4QLKA 3W7QA 3N19B 1N8IA 4MPKA 4CQ8A 1I2QA 4DO7A 1JUBA 4NZCA 3LCWA 3VOFA 1D8WA 4PMQA 3WLIA 1U5HA 3ZSSA 1PE1A 1ZJBA 4EWND 3MHFA 4F0HA 2QPSA 1RD5A 4IIEA 5FJIA 4DY1A 1AH4A 2C8NA 1TIMA 2ZC1A 5EMKA 1D2KA 2CWNA 4IZGA 1Q63A 2CHRA 4QEEA 3PTQA 4NZ1A 4EANA 1PTGA 5J04A 3CJPA 3CZKA 3S1WA 4OVXA 4U3CA 1Q7ZA 2QCMA 1KFLA 1N8FA 4MYAA 1AG1O 4QDMA 5K3VA 3E1F1 1ZAHA 2X0YA 4PCTA 1YKWA 2YFOA 3ZOAA 4C6MA 3KX6A 2GYIA 5LHFA 5ABFB 4RNFA 4YVXA 1QK2A 2J75A 4DM1A 3UPMA 5D32A 4UNLA 3MQTA 3DEQA 1B3ZA 1KM3A 1TSIA 1ZB5A 4Y90A 3RFAA 3R10A 6A3HA 2H3BA 4AU0A 3QLDA 4HU0A 2HK0A 1FWNA 3BSGA 1TX2A 4BWLC 2XPKA 2NX1A 1XH2A 4AVOA 1QPRA 3GDTA 3C2FA 4F40A 3T4CA 2J7DA 3KCJA 2NQZA 1VYSX 4ZOCA 3WF4A 4AX7A 1FKXA 4EX4A 4L6DA 2WLZA 4Q8QA 3OB8A 5M2FX 4ZVJA 1WXJA 4LVAA 2WKGA 3FAWA 1VFUA 3S42A 5FJJA 2NV2A 5LNWA 1S5WA 3VC6A 2YR1A 2QCEA 3GR7A 1JR1A 4EXBA 4HMDA 1TV4A 2FHFA 4FK9A 4M5PA 5D30A 3KP0A 1NARA 3AJXA 5AECA 4TTUA 4KT2A 2CEQA 4ZQMA 2FFIA 2BVDA 3LPGA 1R3SA 3Q67A 4J3VA 4PH6A 1OT2A 1VEPA 1Q66A 3NWRA 4JFWA 3RU8X 5A8GA 2PDXA 4B5WA 3WDPP 4XAPA 3M7SA 4Z1DA 1HT6A 4MZYA 4GXMA 3CUZA 3OTRA 2ZFAA 3ABRA 2VEMA 3Q45A 3QLLA 3BPWA 2UV8G 1R46A 1OX4B 3UP8A 2ZQ0A 1FCBA 2WM0A 1QI5A 1KBLA 3W87A 4AB4A 1EJSC 3U6WA 5E09A 3W7PA 1VPQA 3B8IA 1I9CB 3JUGA 5KETA 4JKLA 3W26A 3NGFA 4C6EA 2PF8A 1EKOA 3B9EA 1TYGA 1E56A 3B8SA 2A3BA 4ZE4A 2A7PA 2WZIA 3CZEA 3NQEA 2OT1A 1QOQA 3E6EA 4Z2JA 3AYRA 3WL0A 2IW0A 3IGHX 4HMNA 1R9ZA 5I23A 4O13A 5JUVA 2OSYA 3D46A 4HNVA 4REQA 3M47A 3GC4A 1B0IA 4JN7A 1EOMA 1MSSA 4ACZB 2Z7GA 4UTTA 3TQVA 3LCIA 3QZAA 3DCPA 5AKQA 3W25A 1KFEA 3NO5A 5LA0A 1FWEC 1HL8A 1OK6A 5KTLA 1QBAA 1BVZA 3G8EA 3UNDA 1UQYA 2OELA 3VOIA 1MW2A 3MBFA 1GGOA 1XGDA 3FEMA 2XGZA 1UR0A 3NZQA 3KVKA 3H4XA 4Q8TA 4R88A 1UUMA 2V3DA 4H9UA 4XZLX 3A64A 3T8LA 4A4AA 2PZNA 3MV11 2Z25A 1EF2A 3UGRA 1I60A 2I17A 3AICA 4WRHA 3BAIA 3GXDA 2J62A 2JIEA 4MJMA 5CPQA 2I5QA 1JNEA 2XSXA 4E2BA 3L2MA 3IACA 4AUBA 1GW9A 4MADA 2IPFA 3KTXA 1CW2A 3CUJA 3AZTA 1V7YA 2NSOA 1TMLA 1OYBA 3LDVA 4NQ1A 2R1KA 1K9TA 1Q6LA 2CZEA 3R8RA 1PTDA 4UXDA 4WDXA 1G4PA 4AZ5A 4RUBA 2VJXA 2YZ5A 4C6DA 1XLDA 1JPIA 1KFJA 2HVNA 1IE7C 2A0NA 5LNSA 3CAWA 3DIPA 3JRKA 2PWVA 3WDIA 4BZYA 4FP1A 1K9EA 3QGKC 3BSHA 3DFYA 2E6AA 3HQ1A 3LCXA 1UIPA 2QAFA 4KETA 2NWSA 3GIQA 2VX6A 1VEOA 1Q6EA 3JR2A 3TZNA 1C91A 1MW3A 4FOKA 1ZJHA 4AAJA 3ZJ6A 3RK8A 1ISVA 4PMXA 1UJQA 3WUGA 2V2CA 3P67A 1V93A 1X98A 3VD5A 1EHAA 3Q65A 1K8ZA 3VD3A 5T9BG 3H24A 3RO8A 3PUOA 4DJDA 4WSHA 1TVLA 1VGAA 3F4VA 4I5UA 4ZSUA 1W5NA 2G3MA 1X6UA 1GJPA 4DJFC 1DL3A 5AC6A 4NAEA 4IG2A 1MUMA 1E55A 3M43A 2FDSA 4JICA 4ADSA 1VB9A 1DTUA 1GOXA 3VZXA 4XZBA 1ZPTA 2WLYA 4HNLA 1SR0A 2VI0A 4E3TA 3PANA 4JTKA 3GC2A 5DRIA 1EBGA 1I2PA 1RLDA 4B5UA 4QR6A 2PRHA 3FJNA 4OU1A 1FWJC 3WMLA 1R3TA 3OW1A 1H5VA 2ZRVA 1EGZA 4M3PA 1MRQA 3GDMA 3MKKA 4G7FA 1VZWA 1LL6A 1W1B1 3E2RA 3I4KA 3U4AA 5K4XA 1GEHA 1P1XA 5E93A 3W00A 5FKYA 1SR9A 3A9IA 3WZ0E 4Y8FA 4O0KA 3CL7A 3USBA 1P0KA 1TCMA 2DIKA 1Z42A 4CD8A 5TIMA 4D6EA 5CAHA 1J6OA 4NJIA 4YJ5A 2F8QA 3CLMA 3WFAA 4NAFA 2Y62A 5D8WA 2GQAA 1TPH1 3UPWA 3CQJA 1Q6QA 3QW4B 3QGVA 3WIJA 4W86A 4DZHA 4G7EB 2VRKA 3H7RA 2VKZG 3HOJA 1TX0A 4IISA 4CD7A 3GWQA 1D3CA 1PDYA 5L9FA 4E8CA 3IGUA 1W8SA 2VEPA 1EJXC 1YBQA 5LHEA 2IKJA 1FWDC 3N73A 2BGSA 3LPPA 4IF2A 1MZRA 3UPBA 1IXNA 2RDUA 3NO1A 1W0MA 4GUJA 1FXQA 1YE6A 4C6JA 1QW9A 4EXQA 2W63A 4M51A 3HMCA 3N3TA 2I9UA 5LIWX 1XKYA 2X8RA 4RNHA 5KSWA 3KS6A 4HD5A 3GVVA 3CMJA 1CXFA 3WF2A 3CPRA 3MI2A 5MF5A 4TVDA 8A3HA 4AHOA 1ISXA 1J2BA 3G24A 2PGRA 4EK7A 2ACSA 3A6OA 3NA8A 4HB7A 3QHMA 3F4NA 4CD4A 4WY0A 5LNVA 4PYSA 4OZOA 1RHCA 4OWGA 3AMGA 1LYXA 1AMKA 1XJBA 4RK8A 1NVMA 3SUVA 1GOOA 1R9XA 1S2VA 2WM1A 2CLPA 2PTXA 4LVBA 1OG6A 4NRSA 3QYSA 3IJIA 1JYWA 1E40A 3VM5A 1QR7A 1SFTA 3GVGA 9CGTA 3W1QA 4TTG