4GFSA

1.8 angstrom crystal structure of the 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 with nickel bound at active site
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
251
structure length
251
Chain Sequence
KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.8 Angstrom Crystal Structure of the 3-Dehydroquinate Dehydratase (aroD) from Salmonella typhimurium LT2 with Nickel Bound at Active Site
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
total genus 94
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4gfsA00
1SW3A 4JTEA 4CNPA 3F03K 3DBPA 1AG1O 1B4EA 3DKLA 3IGSA 4AHPA 5HJLA 3CU2A 3S42A 4OGZA 4YMZA 4Z1DA 1WA3A 2FFCA 1FWWA 3EX6A 1TV7A 2H8XA 3GXTA 2YYTA 4N6FA 4DO4A 1LM1A 1ZAJA 1L9WA 1SQ7A 4NU7A 2DZPA 2ISVA 3DU0A 3A5VA 5AHNA 3M1ZA 1BWKA 2ZTJA 5H91A 4N9DA 5CSSA 3IIZA 2Y85A 4A2SA 3HG4A 2CLHA 3M43A 4N4QA 5D03A 4XWUA 3OA3A 3A22A 4MUZA 4UMBA 3IGXA 5HR7A 5AN7A 2NUXA 4N4PA 1OFRA 2A6LA 5IBXA 2PRMA 5BOOA 4LC6A 4ADTA 3P74A 4IUOA 3FJ6A 4MIMA 3UY7A 3EWWA 1WYIA 1R2SA 4HPJA 3CLMA 4JD4A 5LNRA 4UTKA 4UTIA 3W85A 1LZOA 1R47A 1LOLA 1QNVA 1YPIA 2Z6IA 3K30A 4R34A 1MZHA 1F7BA 4K8EA 2RDWA 3O1NA 4IWWA 4GUJA 1O94A 1P0NA 4GUHA 5DELA 3LCXA 2E5BA 3GNNA 4ZQOA 1I4NA 3FFSA 4MY8A 2BTMA 1EPXA 3O8AA 3P8IA 4RCXA 2AAMA 3LXAA 1M5WA 3DXIA 3L0KA 1KFBA 4JXCA 3STCA 1WX0A 4K8HA 2TMDA 4FIQA 5TIMA 4LRSA 4CQ8A 4HIBA 5EPDA 3G1AA 5DBUA 1WBJA 3ZFHA 5C5YA 1TQJA 3QSTA 3NQMA 1TTJA 4WUIA 1PHQA 4LWWA 3T7VA 4N9CA 1PCKA 1VC4A 1W5QA 3W7OA 4BI5A 1WDWA 4Y90A 3PF3A 2EHHA 3L5AA 3QEZA 3TC7A 4ADUA 2E6DA 2EAWA 2QCNA 4WD0A 5KZDA 3THAA 4HKPA 2GQ8A 2GQ9A 4GUGA 3W1XA 3L66A 1NF7A 2C16A 4EWND 2QR6A 1PL9A 1Z48A 1G4TA 3DHFA 2ZZ1A 1AW1A 3QPZA 3QRHA 4XZ9A 1T0OA 5L6UA 3GIYA 2E6FA 4O57A 3G1VA 4FX8A 3B05A 5CGQA 4H6KA 1W56A 5A5WA 5D30A 4FB7A 2CLLA 3G1SA 4AVFA 2ZRXA 4O12A 2J6XA 3DENA 1H61A 4LVGA 1I2NA 5F4WA 4MZ1A 2GUUA 4H4IA 3UWZA 3E9AA 4MJZA 1YPFA 4OWGA 1RZMA 1QMLA 1RR2A 1TREA 3LX9A 5CZSA 2E6AA 3C2OA 1KTBA 3W86A 2VEKA 2E09A 3N9SA 4UFIA 1H7XA 5F2LA 1H7WA 3NL6A 3TNOA 3W7GA 3TK7A 2A7NA 5FF4A 3LB0A 5D02A 2Y7GA 3C6CA 3IIPA 4ML9A 4JDYA 2CLOA 1OFQA 1XUUA 3NQVA 3TC6A 1D3GA 4M7SA 3S1XA 4FF7A 1ICPA 2P1FA 2QCHA 3FOKA 3BVJA 1LYXA 4M5PA 3PBUA 3W7JA 3MBFA 1FDJA 5AHEA 1W3TA 3W7QA 1F5ZA 3LBMA 2QUTA 4O54A 2J88A 5SWUA 2X30A 3INPA 1P1XA 3LHYA 4GUIA 1SUXA 1XM3A 4GE8A 2DZVA 4LC8A 3NR0A 1TO3A 3L5LA 1H63A 2ATMA 1J2WA 2RFGA 4LVDA 4EOUA 4EVZA 4JX5A 4QNWA 5T26A 3W2MA 4NT0A 2QF7A 4O16A 4YL2A 2XN0A 3OBKA 4TMBA 3R2GA 2YSWA 3QW3A 2VFEA 3NAVA 1K8XA 2NUYA 5DXXA 4WOQA 4JYDA 5F2MA 4FXRA 1KLYA 3C2VA 5IBXC 1F2JA 4DPPA 4K7YA 1JCXA 2OT0A 3W1NA 4QAIA 3UPWA 2QCGA 3HPZA 4JTIA 2A5HA 1KM5A 2QCMA 2ZTKA 3UWQA 4NXSA 1SFJA 4TX9A 4O1BA 5G4WA 2QCFA 4UFKA 1ZENA 3W73A 1FDYA 3VKJA 2D73A 5G5IA 2FTPA 1RPXA 1GVFA 3WK2A 3G1FA 3IEBA 4P2VA 2C1HA 3TIMA 2BLEA 5DCEA 1EP1A 5EA9A 4XUGA 4MLRA 4PL1A 2QUVA 3O6YX 1FQ0A 4UTJA 4WJEA 3IGUA 5BMXA 4HNVA 2V81A 3RK8A 4PL2A 1QOQA 3ZR4A 2JGYA 3EB2A 1IXPA 3CEUA 4UFMA 3N73A 2YGYA 3BW4A 2HS6A 4UXDA 2Q3RA 3RMJA 3PB2A 3MW7A 3WFAA 3P62A 1HO4A 1XDLA 3WJSA 2WPBA 4E2BA 1BKSA 4O10A 2R94A 3NQ6A 3HGOA 3TFXA 3UWWA 4LUJA 3C52A 3GAYA 4EF9A 2QDGA 2AGKA 3R12A 1YYAA 1FWRA 3U8GA 1H50A 4RV8A 3QM3A 4RKAA 2ZZ6A 4NQ1A 5F4XA 4FXSA 2LLEA 5FESA 3L68A 4CNNA 3P61A 2Y62A 4DF2A 3TROA 1IIHA 2PE4A 2YDAA 1TPC1 1B9BA 3WK1A 2QUUA 1OK4A 4LRTA 3BW3A 4O18A 1NEYA 5AFDA 3GKAA 4L4LA 2NX9A 4MFEA 4LS1A 4M19A 3C61A 1UASA 5FF7A 3DFSA 4WQ6A 1EP3A 1FX6A 4CLMA 2H3BA 2NV1A 1KFCA 1OYAA 1KM2A 1ZAIA 1TPFA 1JUEA 2CLEA 4NX0A 1SU5A 3KRZA 3CB8A 3JR2A 2PRLA 2ZZ3A 3MYOA 1I8JA 1VYPX 1X6UA 1KFEA 1GVSA 1ME9A 1JQVA 1H7NA 2W79A 4NNBA 1LCOA 3MP5A 2TRSA 1OYCA 3O07A 3ATYA 5LSMA 3OVQA 1CW2A 3UD6A 2EPHA 2A7PA 4DF0A 1L2UA 3EWUA 3DI1A 3CIXA 5K4XA 4QJ1A 1GWJA 3SSJA 1K7FA 3CTLA 1LROA 2VFIA 1P0KA 2GVJA 5AHMA 1VLIA 2DZUA 3EX4A 1UUOA 1OFPA 3G24A 3F4NA 3G1YA 1EWDA 3C2EA 4LT9A 4JNMA 5IM51 1MXSA 2ZZ7A 2Y7FA 3IIOA 3S8HA 3R8RA 4K7VA 1KFLA 4FNUA 4WXYA 3WJYA 4JTSA 4MY9A 1PHWA 3FYPA 4K39A 2Z1BA 3LGEA 4O1DA 3L9CA 3HB9A 5D38A 3VNDA 4PA8A 2VEMA 1VJIA 3LCHA 5BRBA 3CEPA 4FNTA 3S6DA 2CLIA 5AB3A 1LDCA 3VE7A 1TJRA 3CWOX 5EMUA 4O1CA 4NXKA 5DY2A 3L2IA 2WNZA 3NL5A 1CX9A 5KZMA 2F84A 4I7VA 3W7MA 1LOQA 2ALDA 2NXHA 2EF9A 4KWVA 3GAKA 4EIVA 5TQLA 3O05A 1FCVA 5DCBA 5I3FA 3QF0A 3TQVA 3NDOA 3HO8A 3QZEA 1SO5A 5F2GA 1K8YA 2BWGA 2ZA3A 4MLJA 2ISSA 3GB6A 2VOMA 5F1VA 3TSMA 1A5BA 2FPYA 1KFKA 3BG9A 2G95A 2NWSA 3TUUA 1H1YA 2P0OA 1VCGA 4LS2A 5HR6A 1R46A 1VCFA 3S1WA 1VGAA 1RV8A 4UR8A 1H1ZA 2ZCGA 3B8DA 3FLUA 2H3DA 4AF0B 4XKYB 3TU9A 1VYSX 3I65A 1U83A 1BWLA 3FJLA 3LDVA 1FCBA 4ZQNA 1EIXA 3O63A 3ZWSA 2Z6JA 3EXSA 4UTLA 1PCWA 2C14A 3CQ0A 1KM0A 3GR7A 1DQWA 1HTIA 4WXZA 4JTLA 1MEIA 1OF8A 4X2RA 3M5YA 2JKAA 2Y63A 2C6QA 3FKRA 5CPLA 4LV4A 1UUMA 3EXTA 4O8RA 2YCEA 4O14A 3LHWA 1GEQA 5E1QA 1Z44A 1LOSA 3SI9A 1XC4A 1EEPA 1KW1A 5D33A 4K38A 4RZ5A 5G1TA 3GX9A 5DY3A 1F74A 2QCDA 4CCCA 3TXVA 4BI6A 3BGJA 1WOBA 1W3IA 2C15A 3O15A 4OU1A 1OJXA 2JBMA 3HPXA 3QW4B 3MO7A 3TSDA 3U2OA 2ZA2A 3IVTA 4NJKA 4PH6A 3PSVA 4AXKA 3NM3A 5EBUA 4UFLA 2CZFA 4W9TA 4O17A 4TO8A 3TMQA 1XKYA 2Z2UA 5DN1A 4BWLC 5LHEA 3N14A 3E96A 4O15A 4UTUA 3MP3A 4E2DA 4NX5A 2ZRUA 3PVFA 2ZYFA 4RK8A 5FEXA 4Z0SA 3VCRA 3KVLA 3WJXA 4AAJA 5LHFA 3B4UA 3NA8A 4MKNA 1OFAA 1QPQA 3KX6A 3W22A 1EB3A 1S5WA 1UCWA 3TAOA 4DPQA 2DP3A 1D3HA 2E77A 2OMAA 1H7PA 4HT3A 3I7QA 2ZZ2A 3ABOA 3P60A 1I2RA 4LW7A 4H3DA 5KSWA 2OT1A 1N8FA 2Y7EA 3P5ZA 1UBSA 1W5MA 3LHUA 1THFD 2P10A 3Q94A 3QJAA 1TTQA 4ZQRA 3G18A 2J9ZA 3N2MA 4K36A 4YCPA 3B04A 2Y6ZA 1XBVA 4M6VA 1N55A 3ELFA 4IMDA 3PWAA 3W7EA 4NZFA 2YPIA 3H53A 1GOXA 3IRDA 1TCDA 5FI8A 3PBWA 3FS2A 5G2HA 4IPIA 3A21A 3NL3A 3PBVA 1YTDA 4IMEA 2H90A 5FEWA 1NAL1 4HNTA 3OHIA 5I3GA 4N2YA 1LRQA 1NF0A 3ABRA 4TMCA 2WOQA 4EF8A 4RX0A 3N34A 1KA9F 3RLVA 4I7UA 3S5OA 3TJLA 3M5VA 2GQAA 1SZFA 4IXXA 2RHGA 3HG5A 2Y70A 1K7XA 3CT7A 1FXPA 2V82A 3TW7A 5CSRA 3GKFA 2QAPA 3NYZA 3GK0A 1FWSA 2DU2A 2I14A 1YADA 3UWVA 1QPOA 3GR8A 1NVMA 3O16A 3STEA 3TE9A 4YCOA 3O6CA 5AYZA 1DBTA 1MEHA 4Y6GA 3UPBA 1ZCOA 4LUIA 2YW4A 3C0JA 2CLKA 3GVGA 2QCDB 2YW3A 1IIGA 3G8EA 3S5YA 2WJZA 4WY0A 1IF2A 1H7RA 2DJXA 2VEIA 1MO0A 3KRSA 3WJZA 5DXYA 3PY2A 3W7IA 2FB3A 2V5LA 3W2LA 4JTUA 1L6SA 4JX6A 1TQXA 4RJEA 1W54A 1XFBA 3RLUA 3ZWTA 1FUYA 3W72A 4RZ4A 3NQEA 4JGDA 4UIOA 1EX5A 3W9ZA 4DO5A 2FIQA 3W1MA 1KM3A 3L21A 4NNAA 3R89A 5E0KA 1X7FA 3NQAA 1QAPA 4PTNA 3S9YA 2Q8ZA 3NPUA 1OX4B 5CZJA 4IPJA 3T44A 3S5NA 3OIXA 4UTWC 3W7DA 4WZHA 3IVUA 1IXNA 2WKJA 4R33A 2PCQA 3TMLA 3UNDA 1M6JA 3L0GA 2NLIA 4BFAA 3THQA 2TSYA 2YXGA 4DXVA 3QC3A 3NQGA 3LV6A 4GNJA 3TAKA 3L0NA 3W71A 3W7LA 1OVDA 3SR7A 4TU1A 2CWNA 5K9CA 2ZFAA 5HINA 5E93A 2V5BA 1O5KA 2H6RA 2X16A 4U28A 5K7JA 1KV8A 2HS8A 3CHVA 1TV8A 2E5DA 2VFDA 2A21A 1O4UA 3HBLA 1LRTA 4IQLA 4QITA 3HQ1A 4HSOA 3C8FA 3DZ1A 4GBUA 4Q32A 3EX1A 4MVAA 3V75A 3GDRA 3EWBX 3PG8A 2QJGA 4JX4A 4LV9A 4O50A 3TCEA 3LM7A 4YLWA 3BK0A 2PURA 3HJZA 2GVLA 2CLMA 3LCLA 3T4CA 4JYFA 2PC4A 3GYEA 3TXZA 4X22A 3CM4A 4JTJA 5CKSA 4POCA 1JCYA 1TPDA 5HUOA 1IXQA 3U6WA 3G1XA 4D2JA 3EX3A 1GG1A 4Z1CA 1SZNA 1YTKA 4MYXA 1I45A 1TPH1 1Q6OA 2C13A 2ZRYA 1H7OA 3IV3A 3TW6A 3A9IA 3TQKA 1KFJA 4O0KA 3FA5A 4X3ZA 1ZJIA 4UTHA 4Q33A 5LNSA 5LNWA 2VFGA 3HF3A 4KFNA 4ADSA 3UXDA 4JTHA 2JKPA 3LXBA 3BGGA 1KM4A 3L5MA 2HSAA 4LTSA 3F4WA 3NQ2A 4NNCA 4BK9A 1JQXA 1Q45A 4KWWA 4YXGA 1RQEA 2XFWA 3LCWA 1SPQA 5AHFA 3GDMA 5K4ZA 3V1PA 3M41A 1CI1A 1XBYA 1OHLA 4XQ6A 2VKZG 4ZMGA 1OX6A 4FNPA 3W1LA 4MYAA 4RZ6A 3W7RA 5KMYA 4Z0JA 1DL3A 4JICA 3BPWA 3B0VC 1X8FA 2WNNA 5AC7A 2BXVA 3RFAA 4IOTA 3Q37A 2V0TA 4J9JA 3PC0A 4JTTA 1I2PA 4ONVA 4HPXA 4UFHA 5D2TA 3GXPA 1YXDA 3NPVA 5FEPA 4R53A 3HG3A 3A5FA 2B7QA 1SO3A 1KBJA 5D2XA 3TJXA 1J5TA 4HHPA 4S2CA 5I3KA 4UMCA 2WSRA 4OQVA 4LVFA 5MHBA 3PM6A 5DLCA 3G0SA 3DI0A 1VLWA 1XI3A 2B4GA 3KRUA 1KTCA 3P81A 4ZQPA 4FHAA 1K3UA 3M0ZA 1YDVA 3LTSA 2A85A 4O0ZA 4XBKA 2VELA 3SIZA 2NV2A 4XTDA 3C2FA 2DJLA 2QJHA 3B03A 2FJKA 3W3OA 5HMSA 2QKFA 3G22A 3UWYA 2Y89A 1EP2A 2PRHA 2EKCA 4FIRA 1OX5A 1T8XA 3E49A 4JN6A 3SGUA 3RU6A 3QQ1A 3SY5A 3SZ8A 2NUWA 3ABSA 3SJ3A 3DFQA 3HOJA 4HSNA 5FEZA 3R5EA 5KZEA 4GRSA 2BZNA 4DEFA 1A5SA 2XN2A 1DOSA 3PUEA 2A4AA 3I68A 1DQXA 1SZEA 4UTWA 2CFFA 4Q4KA 3NM1A 3DHDA 1LBMA 4ICNA 3H54A 3DFOA 5FF3A 1WQ5A 1H51A 3C56A 3M9YA 4R7JA 1JCNA 4O28A 2YR1A 5C2XA 1WAUA 1SR9A 2I1OA 7TIMA 1VS1A 1G67A 3PR2A 2CLFA 5HWJA 5C54A 1PE1A 4FO4A 5C6MA 4DBEA 4K6AA 4O53A 1FY6A 1SO4A 5HQEA 2CZEA 1SSGA 1N7KA 3PS7A 3UY8A 4JTGA 3G0XA 3AJXA 1SO6A 4JYEA 4NJHA 1Z41A 5LNUA 4UMAA 4OT7A 1RD5A 3SECA 4IGHA 1G6CA 5I3JA 4PODA 2ZRZA 1JJKA 3LCIA 2QCLA 1KLZA 3S1UA 1FBAA 3LCFA 1Q3NA 3P67A 5CZTA 3VI2A 4CCEA 1Z42A 4IMGA 2WSYA 1C29A 1EA0A 1O95A 2C3ZA 1VRDA 3EEGA 3STFA 1H62A 4AF0A 3P80A 3CPRA 1G4PA 3NQDA 4O1AA 4IX0A 4HNNA 4QQ3A 1OYBA 1FXQA 4OHQA 3W7CA 3UZ5A 1A5CA 5LZLA 3JS3A 1ALDA 3W74A 5CG7A 3M47A 3KVMA 4AB4A 2FQIA 3EXRA 1YDNA 1TV5A 2YZRA 1ZALA 4FNRA 8TIMA 3KOFA 2G96A 3T55A 2ZRWA 2B7OA 1LORA 5D2WA 1VCVA 4JY9A 1HL2A 3M5XA 1GYNA 3TR2A 4UTMA 1T96A 1P5BA 1UB3A 2YX0A 1TIMA 4BWLA 3BLIA 4LVBA 5BMWA 1D9EA 1I2QA 3VFLA 2A2IA 3W1PA 3BG3A 3DFNA 3N3MA 3G1HA 2BX7A 1SZGA 2VFFA 3QFEA 4CCDA 4TR9A 3BARA 1DORA 5D04C 1JCJA 2YFNA 5EY5A 4ZL1A 4O13A 4WX2A 1M7PA 1OFBA 2X2GA 1F73A 3LHZA 1LLZA 4FNSA 3PUDA 1X1ZA 3MHGA 3VE9A 1OABA 3UQNA 2DZSA 3MYPA 1HO1A 2UV8G 2OCZA 3DKJA 1BTMA 3BLFA 1NSJA 3CIWA 3YPIA 4C1LA 1RQHA 3HGSA 1XCFA 1PV8A 2V2HA 1WOAA 3NVTA 2VXNA 4JDBA 1V7YA 2NXGA 3HMJG 3G3DA 4QISA 5AYYA 3N2XA 4IJBA 3GNDA 1VZWA 1PIIA 4O4WA 4O4VA 1S3HA 1XXXA 1OX4A 4QIUA 1Y0EA 4E0CA 5CPMA 1C8VA 1X1OA 4DF1A 3MI6A 3NXFA 2E6YA 1ZFJA 3QMRA 3W84A 3PULA 4L4MA 5KITA 5D2VA 3W1QA 2R91A 4IMFA 1QDSA 4N9BA 3W2UA 1JUBA 1DKWA 1L6WA 2J9XA 1YLVA 5F4SA 4U4MA 1R30A 1GVRA 3W6YA 3MBDA 4CNOA 5BNKA 2RKXA 1SW0A 3ABQA 4O19A 2QAFA 4JTFA 2V30A 4OE7A 2FPVA 1VR6A 3W2NA 3EKZA 2NX3A 3LBCA 3S0CA 1C9DA 3W1RA 3AO0A 1W5OA 4OV9A 3E0IA 3W87A 3LLDA 4QNEA 4RR4A 1TTIA 2V2CA 1DHPA 3GLCA 3NO5A 2CZ5A 1Q6RA 1OFEA 2JKEA 2ATSA 5DCDA 2KZHA 3UZJA 5U4NA 1G7VA 3KFTA 4Z1AA 4DO6A 4KFOA 3ATZA 3NEVA 3NQ8A 3MHFA 3LTPA 5LKYA 1QPRA 2C0AA 4GXMA 3W1TA 1NFBA 4LNYA 3W7KA 3CWNA 1TPWA 3TQ0A 1B3OA 5HWMA 1TPB1 4AEOA 2YFOA 1LBFA 3NNTA 4XTIA 1KTNA 1P4CA 2ZBTA 2Y7DA 3EWZA 4NJGA 3WK0A 3W1AA 1QR7A 1F6KA 1TPVA 2G5WA 4LU0A 3N19B 1GG0A 3I7RA 1AW2A 2O7QA 3MI3A 3H55A 1QO5A 3L67A 1K7EA 1AL8A 1YXYA 4O11A 1KM6A 3A23A 4HNUA 4QSHA 1W37A 2FDSA 2WV8A 1WBHA 1W5PA 2AQWA 4AHQA 3EKLA 3GDTA 5HUPA 5LGZA 3MWAA 3M6YA 1YDOA 4MZYA 1L6YA 3M5ZA 2A6NA 3NPXA 2E5CA 5EYWA 4A3UA 1TSIA 2Q8LA 2C19A 2V9DA 3PBYA 3TSBA 5BW6A 1HFBA 2ZZ5A 4NVTA 3W1UA 1GYLA 4MJMA 3DFTA 3EWYA 1TPEA 3NZRA 4IXHA 5HNRA 1AL7A 3MP4A 3C4UA 4A21A 4GC4A 4M6PA 3N9RA 1WV2A 2B7PA 5TBOA 5KTLA 4M7TA 3LOTA 1ME7A 3ZS4A 4ALDA 5G2WA 1IXOA 3T78A 1JR1A 1QO2A 3FKKA 3QYQA 1GJPA 5A8GA 2CW6A 1OFDA 3FEMA 1SSDA 1G7UA 1TRIA 3LHVA 1R2RA 1FCUA 2ZQ0A 5H2ZA 5D32A 4ZVJA 2X1UA 1A50A 3PSWA 2X1RA 1TYGA 2QCEA 3Q2DA 1W0MA 3BLEA 3OG3A 4B5NA 5DBTA 1DJQA 4MFDA 3W07A 4RLIA 1ZHAA 4FEZA 3STGA 4JIPA 4Z08A 1V5XA 2WSQA 1AMKA 1VQTA 2DZWA 1ICQA 4YWIA 4E38A 1F76A 3PB0A 4NJJA 4AWSA 1F05A 2Y61A 1RQBA 1EUNA 2Q3OA 5D05A 2DZTA 1A5AA 5EKYA 4XKYA 4GFSA 3LRLA 2IQTA 4WOZA 3CC1A 3D0CA 1OFOA 3NL2A 3G8RA 3TKFA 3MJYA 1EUAA 3IIVA 2OZ0A 2ISWA 2ABAA 3GDLA 4MY1A 1JCLA 3P7YA 4UUIA 1G69A 5CPNA 2A0NA 2ABBA 3NGJA 3B0PA 2J9YA 3BV4A 1TTPA 2ZRVA 1KV5A 3UYCA 2CZDA 5K9DA 3L65A 3PUOA 4KKXA 3G1DA 2W6RA 3W70A 1XL9A 2W0UA 3G3MA 4IMCA 4UR7A 3BO9A 4AWUA 3KAOA 3GDKA 2NWRA 1VPXA 3OEXA 2VEPA 3DAQA 1MSSA 1DJNA 3M16A 1GVQA 2GOUA 2R8WA 3W88A 1HG3A 5F1UA 2E1DA 3R13A 1F6PA 4IX2A 4GUFA 3HG2A 5I3HA 1YXCA 3QSRA 4MOZA 5K9XA 4C1KA 2Y88A 2NXIA 3SW6A 4DELA 1M7OA 2ZDRA 4UCGA 1W5NA 5K3VA 2GJNA 1SFLA 2GJLA 3TX9A 2B0MA 4Y8FA 3WK3A 3M7WA 4UTTC 6TIMA 1YTEA 3LRKA 3BW2A 2B7NA 2VC6A 3DGRA 4ZQCA 4PCFA 3I7SA 1G4EA 4JEQA 3SFKA 5D09A 4PEKA 1B4KA 3NPWA 5L9FA 1JRCA 1QPNA 1TPUA 4O52A 2O7SA 4OBTA 4BR1A 5J5DA 1LTDA 3NOEA 3QPYA 4PC8A 4S1FA 1KBIA 1Q6LA 3MHUA 1QFEA 3T40A 4N6EA 1ZY9A 1GQNA 3F1QA 2HTMA 4PFMA 1LP6A 5AC6A 3DH7A 3TA6A 4P61A 4UFJA 2WNQA 2I9EA 4HN4A 3KXQA 1TB3A 2Z0IA 4MPQA 3A24A 4TIMA 1VHNA 3O6DA 3C2RA 4A29A 2QEZA 2J24A 2X1TA 2XN1A 3MI2A 4FNQA 1K8ZA 3E12A 1XBXA 3QMTA 4JIQA 3P8JA 2VFHA 5G1YA 1MEWA 5GVJA 1WXJA 3UWUA 5CZ0A 3Q58A 5K2ZA 4BI7A 4GJ1A 2TPSA 4Z1BA 3W23A 4ORMA 3HGRA 1B57A 3TDFA 3LXCA 3B06A 4CQ9A 1FWTA 3LCGA 1TJPA 1KM1A 1TRDA 3G0UA 4K37A 3M44A 3MMTA 5FF2A 2FB2A 4N9EA 5ABTA 2V2DA 5LGXA 4FX6M 1ML1A 2OJPA 4WY0B 3KHJA 1GVOA 3WJWA 2JGQA 2GPTA 5F2IA 4WY0F 1JRBA 5AOUA 1OF6A 4X9SA 4QM1A 1LLWA 1W3NA 3QQ0A 1S5VA 3NQ7A 3EX2A 1DV7A 4OV4A 3LTYA 1IGSA 2FPTA 5I3IA 3USBA 2A1YA 1Q6QA 5LNVA 4RXGA 5C55A 2DORA 2G97A 2QCCA 5CPOA 2DZXA 1BEUA 3TFCA 3O06A 3FYOA 4G1KA 4JTKA 3C3NA 3W76A 1DVJA 1ADOA 3TH6A 4JR5A 1OK6A 3OVPA 2FLIA 4FX7A 4Y9AA 5EL1A 3RNDA 3W75A 3JRKA 4AWTA 1T99A 1HUVA 1W8SA 3LV5A 2ZZ4A 5AYXA 3W7PA 2CU0A 3I6RA 4UNLA 4A2RA 4ORIA 4I7WA 2TYSA 5U7SA 4GWEA 1RVGA 1PVNA 4Y96A 4M6QA 4AMAA 1VHCA 1LBLA 3HPSA 3W2JA 2EGZA 3LERA 2NZLA 5AC8A 3E02A 4NUWA 4AH7A 1K02A 4ZZ9A 1GTEA 2J27A 3W83A 1GPWA 4NJIA 2RDTA 5FF0A 2A7RA 3EWXA 3QH2A 1QOPA 5D2YA 3HGJA 4AHOA 3TV8A 1R2TA 1GTHA 3B0UX 1G4SA 2GVGA 3OVRA 6ALDA 1XDMA 4S2BA 3KVKA 5HWNA 2VENA 4MZ8A 1XUZA 1JVNA 3LI0A 1SW7A 4XBSA 4UTTA 1FWNA 1QCWA 1I2OA 3KVJA 2YYUA 3QMSA 2X1SA 1O60A 1TMHA 3MUXA 1ZNNA 2RH9A 4KFPA 1PS9A 3S1VA 2E68A 3IIXA 5G2IA 3NQFA 3IVSA 1J4EA 3HIJA 3LLFA 2F7FA 2HMCA 1ICSA 1ZAHA 1VYRA 5D37A 1A53A 5AHIA 3W7HA 4JY8A 1AK5A 1ME8A 4LS0A 4N02A 3LI1A 2BSLA 3DFPA 1EWEA 4ZQMA 3SGZA 1QWGA 3GXNA 3W7NA 1VH7A 1U5JA 4CQAA 1K03A 2C18A 3S5ZA 5G4EA 2RDUA 1JCMP 3ANYA 3RF9A 1ONRA 2H8ZA 2OX1A 3P82A 3UXAA 2ZA1A 4DBDA 1GZGA 1AW5A 3LRMA 3P84A 4UC5A 3GZ3A 1O5XA 3PG9A 3W2KA 3NG3A 1H60A 1S5TA 4UNKA 4LY8A 1H5YA 1UJPA 2NX1A 3LHTA 2V8ZA 2QDHA 1XBZA 3BG5A 2QJIA 4LOCA 1OG0A 4DQWA 2R14A 4BF9A 1FDZA 4I9AA 5AHLA 1GT8A 2WO5A 1FCQA 5J5RA 3PAJA 1JULA 4A22A 5KINA 4JS3A 4NZJA 3NZ1A 3FIGA 1JUKA 2JK2A 3NQCA 1LRNA 2WQPA 1W1ZA 3P5YA 4LVAA 1E51A 4RXFA 1W31A 5HULA
chains in the Genus database with same CATH superfamily
1SW3A 4JTEA 4EKJA 3DG7A 3AAMA 4AHPA 3NXLA 1AH3A 3AXMA 2VC7A 4D9PA 4DWSC 2BVYA 2FFCA 1TV7A 5IFPA 5CH9A 4N6FA 1S1PA 1EQPA 4PB5A 5H91A 4N9DA 2Y85A 3HG4A 2CXEA 5D03A 3VIKA 1D3CA 4HPHA 2O4MA 2BMBA 5HR7A 5AN7A 6PTDA 1OFRA 1WDDA 5BOOA 2ZICA 4LC6A 1RUSA 2FH6A 1VEMA 1R2SA 1ISZA 4X2PA 3GC4A 1UWUA 1XSIA 1V03A 3W85A 1LOLA 4KCVA 1V6WA 2PDXA 5E9XA 2YL8A 4A3QA 3CASA 5BOEA 4R34A 4PMRA 1F7BA 4K8EA 3H2NA 3T42A 1E6XM 2VZVA 4ZSTA 5DELA 4AEEA 4JIRA 4NYUA 4GJIA 4I9TA 3B8WA 1K9TA 3P8IA 4FOUA 3WBWA 3LMYA 1OADA 4DJDC 3L0KA 1KFBA 4JXCA 4FIQA 3O7UA 4LRSA 4HIBA 5EPDA 5DBUA 1WBJA 1NWRA 1Y5WA 5C5YA 1TTJA 4Z2IA 3KRBA 4N9CA 1XX1A 3UPMA 5IRPA 2QCNA 3NDYA 4WD0A 1IEIA 3UJ2A 1XYBA 1HL8A 3U2EA 2DT3A 4REQA 3TYDA 3L66A 1NF7A 2C16A 4M80A 2QR6A 5MKGB 2WB5A 4UQ9A 4CEXC 4RE4A 1FWDC 3M07A 2WSPA 4IFOA 2AKZA 3V5OA 3DIPA 2DSUA 4FB7A 3G1SA 4AEFA 1H2JA 5F4WA 4YTRA 3WF2A 2J7FA 4H4IA 3UWZA 3E9AA 1XRFA 4PB4A 1OSEA 3LX9A 5CZSA 2E6AA 3F4VA 3NVDA 3ARUA 3UR8A 3N9SA 4W7VA 5I78A 1H7XA 2VDHA 1C93A 5FF4A 1AA1B 1UIOA 2CLOA 1OFQA 1FWEC 1XUUA 1LL7A 4C1NB 1P48A 2CXGA 1ICPA 2FH8A 4R3UA 3FOKA 4C7FA 3BVJA 4JAWA 2ZX6A 3U9IA 1JIBA 2QUTA 4O54A 4H83A 2X30A 3TP4A 1XIHA 1SUXA 3APTA 4Z2HA 1XM3A 1QI4A 3EDEA 3XINA 4JBRA 4HN8A 2DZVA 4MKSA 1TO3A 4LVDA 1J2WA 3B4YA 4U5KA 4JX5A 2QF7A 4O16A 2XH2A 1R0MA 3PTDA 3UFYA 4TMBA 4TVDA 1VFTA 4DN1A 3SY8A 1LF1A 3PBGA 4FXRA 4PBFA 1JYNA 2Z2AA 2DFAA 3UBPC 1PWLA 1YBQB 3HU7A 1H5VA 3QZAA 3OO2A 4QAIA 3II1A 2PSNA 3W24A 5CC5A 1O66A 3HPZA 6REQA 2WXDM 2A5HA 2ZTKA 2B31A 3T08A 4FALA 3RAOA 4M1BA 3WLKX 3WUEA 3FAXA 2Y4SA 3QV7A 3MV11 2C1HA 5A2CA 1GOIA 2BLEA 3DBNA 4ACYA 5EA9A 4MLRA 4PL1A 4D8ZA 3IGUA 4YNGA 4PL2A 1QOQA 2JGYA 3MUAA 4J3WA 2BHUA 2XYLA 4PFHA 2HS6A 3CLWA 5H8UA 1FH7A 1XLHA 2ACQA 3MW7A 3ZT6A 2QJMA 3AHZA 2JF6A 2R94A 3QV8A 4GVHA 4DJEA 1LLOA 1NU5A 3GAYA 4EF9A 1QUMA 5E6YA 1GHSA 1CB7B 2POZA 2ZZ6A 3L68A 4IG2B 4DF2A 3TROA 1IIHA 1SFSA 1BQGA 4GKLA 1V6VA 1Z89A 2YDAA 1TPC1 1U1HA 2ALRA 2BVWA 1QI0A 1NEYA 5G1MA 5AFDA 3GKAA 3LPFA 4XZNX 1P0EA 5EMMA 2F38A 4M19A 5A1AA 1UASA 4P7QA 2R1MA 1C9WA 1G01A 3WFLA 1KFCA 5FJJA 1KM2A 1ZAIA 2E25A 1JUEA 1VYPX 2FGBA 4EANA 1D7FA 1X38A 4NNBA 3MP5A 4YTSA 3H24A 3ATYA 2AMXA 3OVQA 5HPCA 2A7PA 2OSXA 1TX0A 2ASHA 4JN7A 1FWHC 3DCPA 3RCMA 3PZUA 4QJ1A 1SGJA 2XVKA 4GIAA 3M64A 1K7FA 1GKPA 3DUGA 2FZBA 5A6BA 2IKHA 1UUOA 1OFPA 1UG6A 3G1YA 2OOGA 5AC4A 1NDVA 3C2EA 4MF4A 1S5MA 2GGEA 2BBFA 2EPOA 3R8RA 4BEUA 3AHXA 4GZ7A 1JYVA 2E8YA 2Z1BA 3HB9A 5D38A 5CPTA 4FA3A 3LSCA 4PA8A 1VJIA 3LCHA 3EB3A 1TR1A 1XS2A 1R86A 3S6DA 1W32A 4H9XA 1LDCA 1TJRA 1CX9A 4U10A 1VB9A 1LOQA 3VDGA 3RR1A 4DJFC 5TQLA 1AZ2A 1FCVA 5DCBA 4QLJA 5I3FA 3SBFA 4MM1A 3BSMA 4TVUA 3QZEA 5E9AA 5F2GA 4H6EA 1JF5A 1KFKA 2G95A 4W8AA 3EWDA 4A05A 2QVHA 3M0YA 1DXFA 3B8VA 4IT1A 1VCGA 3OGRA 5JUVA 2EPMX 5HR6A 3S1WA 1H1ZA 3B8DA 3FLUA 3MDUA 4AF0B 5BXPA 4REQB 3I65A 3LDVA 2XZ7A 4EE9A 1XISA 2ISFA 1TMLA 2VQUA 3UGVA 4RDWA 4TX8A 5CJNA 3ZWSA 3NEHA 2OO0A 2C14A 2QDEA 1QHZA 4L9XA 4AYGA 3IK4A 4JTLA 4S3EA 1OF8A 4PUDA 3RPMA 3P0XA 3M5YA 4KESA 2JKAA 4KEVA 2Y63A 4Q6XA 3MQTA 2WNWA 3FKRA 1UA7A 4KWUA 3W01A 4O14A 1Z44A 4S3JA 1EEPA 4OKDA 1KW1A 5D33A 3DERA 5G1TA 1F74A 3LM3A 1IWBA 3TXVA 4BI6A 2CEQA 2JALA 5EFDA 3O15A 3V1HA 1O1ZA 3PPGA 3MO7A 1IWPA 1XYCA 3WUGA 3GFZA 2QPSA 5EBUA 2ZKMX 4P7NA 3RGTA 4C7GA 1UH3A 5LA2A 3ZIZA 4BWLC 1JDAA 2AMGA 3CAKA 3N14A 1B3XA 4GMEA 3KE0A 3PVFA 1VFMA 1BHGA 1SYTA 3KVLA 5LHFA 2PTXA 3B4UA 1NOUA 4F2BA 3NA8A 4MKNA 4NG3A 1QPQA 4ROPA 3ZLGA 1V51A 3KX6A 1UCWA 1EB3A 3POCA 3VX1A 3GH7A 2DP3A 2E77A 4IIDA 3SFWA 4HT3A 1B1YA 5HPOA 4RE2A 5KSWA 4XB3A 2OT1A 1N8FA 1IZCA 3P5ZA 1W5MA 4W5ZA 1THFD 2YIHA 4XO6A 3WQEA 3MVIA 1IEQA 3URAA 2QIWA 4ZQRA 3N2MA 4C6JA 2Z25A 4YCPA 1ISVA 1U2YA 5C71A 2YPIA 1PTAA 2NQZA 3A4JA 3OLEA 1OGGA 3MKCA 3KW3A 3T8QA 1R3QA 1QBAA 1BF2A 3BOFA 2F6XA 2NQLA 4IMEA 2H90A 5FEWA 3V0UA 1F9CA 1F61A 3RRAA 5DANA 5AZ1A 3ABRA 4TMCA 2WOQA 3N3TA 1EDTA 4E4FA 4EF8A 1Q63A 4RX0A 2HV5A 3ARPA 1TKKA 1VBUA 3VOCA 5M3WA 1FWGC 1HKVA 3M5VA 2I56A 1RXOB 4AWEA 1B3ZA 1IQ8A 3MCMA 4JTDA 4CCZA 1E0XA 3SCQA 4PGLA 1ZRQA 4KERA 4HU8A 3GK0A 2PDWA 3N6JA 4XD3A 2I14A 3TTSA 1NQKA 3JW7A 2FFIA 3STEA 1GZ1A 5B7ZA 2XWDA 1MRQA 4R9XA 3IWPA 3PZGA 5FSDC 2YW3A 3S5YA 3WLNA 1U22A 2WJZA 2YCLA 1IF2A 3SCPA 1V02E 5DXYA 3W7IA 2FB3A 1H4PA 3GTXA 1H1NA 3EDJA 1L6SA 2JFEX 5GPRA 1Q6CA 4RJEA 1LWJA 4RZ4A 5DRCA 1BPLB 4PRWA 4KQNA 4WRHA 3W1MA 1M7XA 4GY7A 1X7FA 3S3GA 4PTNA 2Q8ZA 1A49A 3N12A 4HPGA 3FA4A 4QLLA 3T44A 5BYWA 3W7DA 3IVUA 4B3LA 2PWFA 1TFVA 1M6JA 3MMDA 4E2OA 3THQA 1E0TA 2YXGA 3NQGA 1IZJA 3TAKA 4DZHA 5BXTA 4V1YA 2PZNA 2A3EA 3OG2A 2V5BA 1UJQA 4LANA 3BAYA 2H6RA 3LPPA 3QGKC 5DF0A 3WBEA 1N8WA 2HS8A 3CHVA 2E5DA 1HF6A 1UMLA 4H9YA 4QITA 3HQ1A 4Y8EA 3G6LA 3DZ1A 3OVGA 4MVAA 2VGBA 4PCSA 2IW0A 4CD5A 3CYJA 3GDRA 4ERGA 3W0KA 2UY3A 4O50A 2ZUWA 3LM7A 4LB4A 3QY6A 2AGTA 4G8TA 1HGWA 4PYSA 3TYBA 2PLMA 1EF3A 2XISA 1VAHA 1CTNA 1FRBA 4HA1A 3CM4A 4JTJA 5CKSA 3ITCA 2UZ9A 1I1XA 1MI3A 1EXBA 3DDMA 4ML4A 2XH7A 4BCEA 4D2JA 3EX3A 4Z1CA 3V5CA 2YCKX 1ISWA 2GFTA 2C13A 3EA2A 4PSPA 4V1XA 5H6HA 3W81A 1H0GA 3WEZA 4HK5A 1KFJA 3IRSA 2FVLA 1GPFA 2HJPA 4UTHA 4Q33A 4EAYA 4KFNA 4ADSA 3S46A 3NZQA 5JU6A 3ONCA 1MMFA 5I06A 3N9KA 3ICJA 1B31A 3BGGA 2HSAA 4BK9A 4WF7A 2FDMA 3WIJA 2J62A 4H7ZA 2PU1A 3E0VA 4HVXA 2YA0A 5K4ZA 3ITLA 3M41A 4G6CA 1FWBC 2RAGA 5J04A 1S2UA 5KZ6A 4D8AA 2E8ZA 4B4FA 3AIUA 3CHEA 2JF7A 5M5DA 3QBUA 1MNSA 3B0VC 2JEQA 1CWYA 3FAWA 2WNNA 2BXVA 1QNQA 3B9DA 4AZBA 1TWIA 4H41A 4UFHA 1WO2A 3NPVA 3HV9A 5FEPA 3C2YA 3PZVA 1F07A 2B7QA 3R79A 4S2CA 4HMNA 4NHVA 5REQB 4OQVA 2OZ3A 3PM6A 1CGVA 2GJXB 5DLCA 3ZVHB 1XI3A 3WX7A 3CZ8A 4FHAA 1K3UA 1YDVA 1TMQA 3V7PA 4LALA 2VHLA 2VWTA 3AICA 2AQOA 1CXLA 1Z32X 3B03A 3L4XA 3KZSA 5FD0A 1IHIA 2QKFA 6A3HA 3AISA 1U5VA 2PRHA 4J5NA 3VMPA 3SQLA 1BF6A 3E49A 2WK2A 1G94A 3SZ8A 3ABSA 2O9OA 3KTXA 3HOJA 5XIMA 4B4HA 5FEZA 3CS2A 4XZBA 6REQB 5M1TA 4GRSA 1HIZA 4DEFA 2XN2A 3T4WA 3V0TA 4CU8A 4ZENA 1MQPA 2CERA 3NM1A 1GHRA 2HBXA 3GVRA 3DFOA 2Q8XA 1BXBA 3CNYA 3I3BA 1WQ5A 1Q65A 3C56A 1DTNA 4R7JA 1JCNA 3S6TA 1XIBA 1F8MA 1SR9A 5A6MA 4NYYA 4IUGA 2VOTA 1PE1A 4UOZA 4KF1A 1S38A 3BQ5A 5HQEA 1P43A 2PWHA 2CZEA 4MB5A 5A3HA 3EOOA 4IJCA 4JTGA 4JYEA 1Z41A 4MGGA 3VIHA 4LAOA 5LNUA 4OT7A 1J0ZA 4YHGA 3SECA 4IGHA 4YVPA 1EFZA 1D8CA 1V6YA 1UP3A 3L2MA 4FLOA 4F3HA 4PODA 4QXIA 2ZRZA 3VKCA 1ZPTA 3AJ7A 2ACSA 1FBAA 3V5FA 4XD6A 5I24A 3LCFA 1Q3NA 3P67A 1Z42A 2HISA 2DVXA 3IGHX 4LJ3A 5ENLA 2ZUMA 3LMZA 4IMGA 2WSYA 3T0BA 1C29A 4M29A 2KAUC 2HROA 1VRDA 2YA1A 3RUBL 3D6NA 4D71A 3EEGA 3STFA 3HA1A 1H62A 3K2GA 4AF0A 1DJGA 3CPRA 1G4PA 3F5KA 1X97A 5A8PA 4IX0A 1OYBA 4Q7BA 1XWYA 2XG9A 3LY0A 4FF5A 3BAWA 4QCEA 1L8NA 3CPUA 3U0HA 2C7FA 3F4CA 3VDCA 3KVMA 2OOFA 3EXRA 1TV5A 3KEHA 1XLKA 2GWNA 1IV8A 4YYCA 3RPDA 3MA8A 2ZRWA 1OCJA 3KDOA 4BHYA 1MDLA 4UOJA 4DBWA 3HM7A 1VCVA 1FKWA 2Z1XA 1GYNA 4UTMA 2FMOA 5BMWA 1VBHA 4B16A 3W1PA 1QU4A 1KXQA 2PGWA 3HTWA 5E0FA 5D04C 2O92A 3NDZA 5BZAA 2YFNA 4WX2A 3R4IA 3SJNA 3ECQA 1HKWA 2E67A 2X2GA 4JQ1A 3CB3A 4FNSA 1X1ZA 4XZLX 1UWRA 3UQNA 2WC7A 3MYPA 2UV8G 3THUA 4YTTA 1BTMA 2ZX7A 2PLJA 3BLFA 1K9FA 1RQHA 3HGSA 3WF0A 5FCZA 1PV8A 4A3RA 4C6CA 1V7YA 4W8LA 6CGTA 2NXGA 2HE8A 1XG3A 1EPVA 3V18A 3ZYZA 3N2XA 4LPCA 3W37A 2YOCA 1PIIA 4O4WA 4O4VA 2DW7A 3GXMA 4ZE5A 1X1OA 3MI6A 2E6YA 4DWSD 3W84A 3URNA 1QTWA 4WGHA 3P2VA 4E3VA 5D2VA 1ECEA 3PANA 3QLDA 2J9XA 2W62A 5AVNA 3VNZA 1YLVA 3GRIA 4HZ7A 5F4SA 1R30A 3GTFA 1MRAA 3W6YA 4D1IA 3MBDA 1UQZA 2VGFA 3GFXA 3ABQA 1IR2A 1UHVA 4YTQA 2OTDA 3LBCA 3S0CA 4QS5A 3OA5A 3FJNA 3W87A 3LLDA 1VPYA 2FZDA 1TTIA 2V2CA 1DHPA 3GLCA 2PWGA 2XTKA 2XSXA 3UG3A 1TWSA 2C1GA 3CT2A 4IICA 4GI6A 1AODA 4KFOA 4N0RA 3ABXA 3DC0A 3MHFA 3LTPA 3VNJA 4FOJA 4YJ5A 4FR1A 5E6ZA 4GXMA 4E2VA 3WMLA 5JBDA 1RLCL 4ZFCA 3AYTA 1AZ1A 3TQ0A 5HWMA 1LL4A 1X6NA 4AEOA 2EQDA 5HJYA 3AQUA 2WC4A 3TWBA 3WUBA 1UZ4A 3LS9A 3O2LA 2ZBTA 3MY9A 4NJGA 2QV4A 3WK0A 1TPVA 3TZNA 3AHTA 4UNIA 3N19B 3I7RA 4L6HA 2O7QA 3WMBA 3MI3A 3AUJA 2WHMA 3GNXA 1PUDA 4HNUA 4QSHA 1W37A 4AD5A 3P3BA 1C8YA 5LGZA 3ZJ8A 3MUZ1 4F0RA 2E5CA 3D46A 5JBEA 1TSIA 3OU8A 2C19A 3ANUA 4U3CA 3GC2A 3TSBA 3WLJA 5BW6A 1HFBA 1JZ6A 3R1ZA 3IJ8A 4RW3A 3UZYA 3DFTA 1JDDA 1TPEA 2D22A 3A3HA 4XAFA 2AL2A 1E40A 2GZXA 4KETA 3TNBA 4A21A 1C3FA 5TBOA 2ZADA 3UU0A 3LOTA 1PX3A 1XIMA 1JR1A 4LAMA 4E4PA 1GJPA 3KZPA 3QKZA 1RA0A 4MNMA 3CUGA 2X1UA 4A6GA 2FHBA 3SURA 2H9AB 1CNVA 4PRRA 1W0MA 4AVNA 5ECVA 5DBTA 1DJQA 4M1RA 2W67A 4GABA 3O3RA 4C60A 1V5XA 4YN5A 2O4QA 1MUWA 2WZEA 3C86A 3UGRA 1J9YA 3UYIA 1RPKA 1MW1A 1VP5A 2Q3OA 3AS2A 4HA4A 1V4YA 4GGHA 5LXXA 4QG6A 3NL2A 1NDZA 1NOFA 4HCDA 4UUIA 1G69A 1XF0A 3D47A 1VBRA 1ODUA 2WMIA 1TTPA 4QFUA 2F8QA 1LT8A 3L65A 3PUOA 1W9VA 2BDQA 4MSSA 3V16A 3W4RA 2BFGA 5A6SA 4HQVA 3FEQA 1UKPA 3CTTA 1MSSA 4UR9A 4AW7A 1HG3A 1IEWA 2WVSA 5C9ZA 2F9RA 1KNWA 3ISIX 3QSRA 2DSZA 2OLSA 2GJPA 5K9XA 3PBMA 1E0WA 1M7OA 4EPKA 2ZDRA 3P0WA 4UCGA 1H3GA 2GJNA 2WKLA 1SJCA 3WSUA 3QC0A 4UTTC 6TIMA 3RRXA 3BW2A 4X0NA 2B7NA 3I7SA 3RHGA 3SFKA 4PEKA 4F48A 2NQ9A 2OELA 4GQRA 1JRCA 4KCUA 4OBRA 4OBTA 1Q2SA 4GK8A 1OIMA 4BR1A 4EWJA 4DHGA 3MHUA 3QOMA 1JG9A 1ZY9A 4I5RA 1JZ3A 3WQ5A 2HTMA 2BHZA 3RCNA 4H2CA 4UFJA 3BOLA 3Q4DA 1NP2A 3O6DA 2X1TA 3E0LA 3MI2A 4C6BA 4CGTA 3H2OA 1T40A 3E12A 1XBXA 3HN3A 3ZOAA 3A4AA 1ZQ5A 4MAZA 2A3AA 4OECA 4Q22A 4GJ1A 2IPFA 1M65A 3H12A 2IKJA 3HGRA 1AVAA 1B57A 2C8NA 4PCPA 3TC3A 1DJIA 5AECA 3LCGA 1TJPA 2ANUA 4DVOA 1KXHA 4GH3A 4DWDA 3OZYA 5FF2A 2FB2A 4N9EA 7REQB 4D8LA 1ZS2A 4WY0B 1GVOA 2E1WA 2JGQA 4US6A 1JRBA 4QAWA 4Z17A 1OF6A 4QM1A 2CKSA 2BY1A 2E4TA 2OQHA 4DX3A 1UPMB 3H2EA 4A8LA 3TTEA 5C55A 4Q7IA 3N13A 1T8QA 3QR3A 3H21A 1XKJA 3FYOA 3ZJKA 3C3NA 3S5SA 1ADOA 1CT5A 4HYVA 4GC3A 3MSDA 1A5NC 3RNDA 1ZJAA 4W87A 2CLPA 1HUVA 1W8SA 1GOOA 1RHCA 3QYSA 1JYXA 2CU0A 4A2RA 2HZGA 2ISDA 5DO8A 1BFNA 5U7SA 2P8BA 1PVNA 2DSWA 1VHCA 2VM8A 4ES4A 3Q45A 2EGZA 3LERA 3IV8A 2NZLA 3TN3A 3E02A 3AYSA 5LXEA 1K02A 4GNVA 2INFA 2J4GA 1AJ2A 1WUFA 2W61A 3EWXA 3QH2A 3KOZA 2XGIA 5D2YA 1VEOA 2V67A 4V33A 3TV8A 1GTHA 4S23A 1L6GA 1R38A 1XSJA 1DWAM 1J6OA 1AQFA 4FSAA 2VQTA 3ARTA 4DUVA 2G3FA 4MZ8A 4L7ZA 5E09A 2PDGA 1SW7A 3VKBA 5A8OA 1FWNA 1E43A 2BASA 1OT1A 3G2GA 4JTCA 5MF5A 1I2OA 4GHRA 3CAWA 4YVXA 1O60A 1TMHA 3MMWA 1PS9A 2ZXQA 3CQIA 3S1VA 4L80A 1UQYA 4L61A 1HP4A 2OEKA 3IVSA 1J4EA 4ILSA 4IPLA 1PTDA 3R43A 5BXRA 1LWIA 5D37A 3W7HA 4HMCA 4LS0A 4PMNA 1DE6A 4HNCA 3GWQA 3PJUA 1S46A 3OGSA 4C6IA 3EMCA 2D2GA 1J8VA 1K4HA 4CQAA 2C18A 1XHGA 1ZU8A 3AIEA 3RX2A 2OX1A 3WDQA 1GZGA 1XJBA 3LRMA 1S39A 4D6FA 1FWFC 1O5XA 3TJ4A 3PG9A 3W26A 3NG3A 1C7SA 1O5RA 3UVIA 2QPXA 4H8VA 1PDZA 4GH1A 2V8ZA 3FV9A 1ZTVA 5FSEC 2ZE0A 5DRIA 3CV6A 3QY7A 3GBDA 5J5RA 3PP7A 4UBPC 3S2JA 1LWHA 3A4WA 4IH3A 4X9YA 3FK4A 3NQCA 2Q01A 1E5NA 2WQPA 1U33A 1W31A 1M3UA 1W1PA 2YBUA 1B4EA 4GYPC 1L2QA 2ZXAA 4HMEA 1IZKA 1UOKA 3S42A 2VD8A 4OGZA 4Z1DA 2VGGA 4UCFA 1ITUA 3PUGA 1BG9A 5T91A 3GXTA 3E0WA 1LM1A 3GG1A 2ISVA 4LFYA 3A5VA 3M1ZA 1BWKA 1V0KA 5CSSA 1TV2A 4A2SA 1Q4NX 2CLHA 3M43A 2RGLA 1N8IA 4GZJA 3VOFA 5CJMA 1NIUA 2NUXA 2ZUUA 4N4PA 4F79A 3A3XA 5A6TC 1GQIA 2OSWA 1JD7A 1GEHA 4HD5A 4PMZA 3TOYA 4ADTA 4OOZA 5IXEA 4IUOA 4PR4A 3VD3A 4JD4A 3WQ4A 1I9CB 4L9ZA 2R9RA 1LZOA 1VRXA 2A3CA 1BXNA 1QNVA 1J0HA 1HX0A 2RDWA 3O1NA 3B8TA 4IWWA 5FOOA 2AL2B 2WM1A 2E5BA 1AQ0A 4ZQOA 1I4NA 4L64A 4MY8A 3CYVA 2PAJA 1E9ZB 4S3KA 1EJTC 3LXAA 1M5WA 3E2VA 9RUBA 2ZVRA 3STCA 4DXXA 4S3AA 3VIMA 3RLGA 5TIMA 3NYDA 4CQ8A 3MS8A 4ICMA 4UQAA 2R1NA 2DZBA 3B8UA 3NQMA 4WUIA 1XDJA 4LWWA 3T7VA 1W5QA 1FKXA 3W7OA 5A8NA 4BI5A 1J96A 4H00A 3U3HA 2E6DA 2EO7A 3W02A 1BVWA 3TYUA 3THCA 2GQ8A 2GQ9A 3QN3A 3W1XA 2PB1A 3M0HA 1KO0A 1PL9A 3DHFA 4LB3A 1HQTA 3WMSA 3QRHA 2XGZA 2BB0A 3GIYA 2E6FA 4DUWA 4LAKA 3OLGA 1Z9AA 6XIAA 3ALGA 3WL1A 3NJ3A 1W56A 3CQHA 1Y5VA 2CLLA 4AVFA 4GY1A 2GUUA 1DWGM 1RR2A 1TREA 1WUEA 3WD1A 4UFIA 2WM0A 3HQPA 5F2LA 2O0TA 3TNOA 4GCAA 3SQMA 3W7GA 4PTWA 2A7NA 5DMMA 8CGTA 5LIYX 2DY3A 4J7RA 3LB0A 4G7EA 5D02A 5CEWA 2Y8KA 4W5UA 3C6CA 3VIOA 4CN1A 3CAVA 1JXJA 4B9YA 3S1XA 4FF7A 5D9NA 2J79A 2ODOA 3EB4A 3P6LA 3W7JA 4AZCA 3NZGA 1F3EA 1FDJA 5AHEA 1W3TA 3IANA 3K4WA 3PZOA 2OGJA 2PDHA 3INPA 1P1XA 3LHYA 2XH0A 3AC0A 2VUNA 4XZHA 1NJJA 3SSZA 4GQ0A 4FK9A 1H63A 3WL0A 2RFGA 4QNWA 5T26A 3NCOA 3W2MA 3VGEA 3APGA 3OBKA 1ITXA 1OZQA 5CJ5A 2X1IA 3R2GA 2YSWA 4LSBA 4LBRA 3NAVA 1B2YA 3LNPA 1K8XA 2XVGA 4JYDA 3AMDA 2PLKA 3G1RA 1BYDA 5IOBA 3UXIA 2OQYA 3P14A 1Y7VA 3IJ9A 1W1TA 4KBXA 4PUNA 4NXSA 1SFJA 4O1BA 5G4WA 2QCFA 3KBNA 3VKJA 1CECA 2D73A 5G5IA 1QNOA 3DHPA 4AIEA 3WK2A 3G1FA 4P2VA 1HJSA 3TIMA 1C8XA 3DG6A 3GVVA 3FVDA 3DYMA 1FQ0A 4WJEA 2G3JA 2V81A 3CZLA 4WDTA 4HYWA 1K70A 4AQLA 2YGYA 2HE5A 3CH0A 4YS1A 4UXDA 1ZBWA 2PCEA 3RMJA 2XFFA 3PB2A 1A80A 3MUY1 3P62A 1HO4A 1FTXA 1XDLA 4ZXOA 3WDHA 2ZE3A 3M0IA 2CETA 4O10A 2PDPA 3KM8A 3TFXA 2YL5A 5LIWX 1UIPA 4PSRA 2Z29A 3WH9A 2B81A 1K4GA 4DNHA 1FWRA 3ES8A 1L6FA 3ZR6A 4C5ZA 3WEOA 3QM3A 4Q6JA 5CAHA 4QBXA 2QUMA 1CPUA 4CNNA 3FNDA 1KC7A 1UKTA 1B9BA 3WK1A 2XVPA 2QUUA 1OK4A 4LRTA 2VRJA 5D9OA 3RJXA 4O18A 3BXWA 2NX9A 4MFEA 4LS1A 1PAMA 4Z2JA 1BXCA 5FF7A 3DFSA 1OWQA 3UZZA 1V93A 2NV1A 1JZ5A 1I60A 1SU5A 4QE5A 3CB8A 2PRLA 4PTXA 1KFEA 1GVSA 4MWAD 1H7NA 4M82A 3ARSA 3WLIA 2PEVA 4IIFA 1LCOA 1QK0A 3O07A 5LSMA 1DJXA 1CW2A 3UD6A 2VC5A 3GYCA 4DF0A 4PMOA 3PJWA 1MXGA 3OZMA 3PJTA 1Q6GA 3PNZA 3AS0A 4AX7A 4ZGYA 3DI1A 3CIXA 4NZ5A 4WVXA 2W27A 4J3UA 4Q4QA 3CTLA 2VFIA 3CUIA 2D20A 2GVJA 3AYVA 5AHMA 5A6JA 2DGAA 1KD0A 4S3DA 3WG6A 3G24A 1EWDA 2PDQA 4LT9A 4B3ZA 5IM51 1MXSA 1E6SM 2D0FA 3ZO9A 1OC5A 3S8HA 5I02A 1X8CA 4GI9A 5I77A 3G6MA 4WXYA 2YA2A 3FXGA 4JTSA 2ZWYA 4GD0A 1BLIA 1PHWA 4LY4A 4MY9A 4NSBA 1M7JA 1IGWA 4O1DA 3OBEA 3VNDA 4H2HA 3HPAA 1W9BM 2X40A 4FNTA 2VCCA 1RALA 4KEMA 3SN4A 2FHCA 4I9JA 2Z27A 2YLAA 3L2IA 5GNYA 5KZMA 3W7MA 2ALDA 4B9ZA 1FFRA 3KLLA 4C6PA 3V36A 3PTMA 3PFMA 3NDOA 2WWDA 3HO8A 1K8YA 4ZO6A 3GB6A 5F1VA 1VJSA 1A5BA 2XPKA 4P7RA 4ZFMA 1H1YA 4D6JA 4LS2A 4K1GA 3PWGA 1VCFA 1VGAA 4GVFA 1WPCA 4GYJA 5DMNA 3VD5A 4DI8A 4UR8A 4GOAA 1B54A 2H3DA 1HJQA 1U83A 3B8SA 2VT0A 1QJWA 1RA5A 4ZQNA 4ASTA 3N4EA 3VILA 2VVSA 1R9ZA 4CU6A 3EXSA 2VZUA 1JGIA 3GR7A 3VDAA 1LQ0A 4X2RA 4F9JA 3W28A 2HWGA 4XV0A 3O9NA 3VIFA 1QATA 2O9PA 4LV4A 3GG8A 3LGDA 3NOYA 3EXTA 5LIXX 2HPIA 1GEQA 2EJ1A 4BKNA 4JCMA 4V15A 3SI9A 4HOXA 3RX3A 1P0BA 3FGCA 2Z7GA 1JF6A 2QCDA 3TONA 4OU1A 5AYBA 1OJXA 4NAEB 2JBMA 3MZNA 3V3WA 3PN8A 5HNUA 3AIQA 4CQCA 2YB4A 3PSVA 4AY1A 1OGSA 2NLYA 3EPMA 4O17A 1RCXB 1XKYA 1LL6A 1FHVA 1GQLA 3MP3A 2ZRUA 4RK8A 5FEXA 3KCOA 4AAJA 5H8PA 4J4KA 3ARVA 4Y7EA 1GK8A 2G8ZA 4HU3A 4IFKB 3GUWA 1S5WA 1E9LA 2XDFA 4AIOA 4JKMA 4DPQA 2OMAA 4KGLA 3KBVA 4LX4A 4JEJA 3AUOA 4P8WA 1JAKA 4H8UA 4QG9A 1X6LA 1KGXA 2P10A 3Q94A 3M6DA 4OBSA 3QJAA 1TTQA 3CL6A 3B04A 2Y6ZA 1XBVA 5BU9A 4PMQA 3ELFA 2P3ZA 3EDKA 4TX6A 1EDGA 4OUEA 4D6DA 3W7EA 1VPQA 2F6KA 4NF7A 1JFXA 1R7OA 2HK1A 1KRAC 1TCDA 5FI8A 2IS7A 3PBWA 2Q6ZA 3FS2A 4XAPA 3FSUA 4IPIA 1K8CA 2Z00A 4UQBA 3C3UA 4HNTA 2GSJA 5I3GA 4WDWA 3VGHA 3M0MA 1MQRA 1PB0A 4AIUA 4XSLA 4LYKA 2PDLA 2FTWA 4HB7A 1RBAA 3RLVA 4Q8VA 3GG7A 1GOWA 3S5OA 1AH4A 4WLCA 2GQAA 1SZFA 2RHGA 2Y70A 1WE5A 2WMKA 1R5YA 3STPA 1FXPA 2WMGA 1XLMA 3GKFA 3NYZA 2DU2A 4GBDA 3UWVA 1QPOA 1NVMA 3O16A 2C0HA 2WCGA 1ZCOA 4PMUA 4S3BA 2YW4A 1FWJC 1DJWA 3C0JA 1IIGA 5I0DA 5CLTA 4WY0A 2DJXA 9XIAA 1AFSA 2VEIA 4F40A 4DBUA 2A3BA 3O0KA 3SO7A 2A79A 1DEDA 3R10A 4J1OA 3W2LA 4JTUA 3RLUA 3W72A 3T0AA 3HQOA 3WZ0E 3NQEA 4DO7A 1H0IA 3IJIA 2FIQA 1KM3A 2W5FA 3L21A 3R89A 4C6EA 3AS3A 1QAPA 1UZHA 1XQLA 1F6YA 3UJEA 3SCSA 1A5MC 2X0SA 4INFA 3OB8A 5CZJA 1XD1A 1FHDA 2DUZA 3S5NA 3OIXA 1KGUA 1IXNA 2V6AA 2WKJA 4R33A 3OTRA 3TMLA 3UNDA 3L0GA 1GNXA 1CYGA 3UCDA 3KDNA 3QC3A 3LV6A 3JZUA 3L0NA 1EZ2A 2D24A 3W7LA 1G9HA 3AZRA 3I4KA 3K46A 4MPKA 2ZFAA 4D6GA 3GH4A 1E0UA 5E93A 1F3TA 1O5KA 3M46A 3IJLA 4B5TA 4U28A 5HQMA 1V6TA 1KV8A 3VZYA 2J8TA 1O4UA 3HBLA 1A4MA 1XYFA 4GBUA 4Q32A 3EX1A 3PFRA 2AOSA 3SUWA 3WNLA 3PG8A 3KLKA 3LU2A 2PURA 1WKYA 2ESCA 1OBAA 3LCLA 3T4CA 1BSIA 3MT1A 1WNOA 7ODCA 1MUCA 1P6CA 4AX6A 3R7MA 3VIGA 5HUOA 3BSGA 3G1XA 1VFHA 1ADSA 4GYPA 4IQDA 2PC8A 1YTKA 2VZOA 1I45A 1Q6OA 3IV3A 3A9IA 3L4TA 1KXTA 4O0KA 5C7HA 3QVQA 1K6AA 4ZO8A 5LNSA 3TJIA 5LNWA 1RSCA 2VRKA 3WH8A 1PZ2A 4OZOA 3FW6A 4JTHA 4LYPA 2CITA 1M04A 1REQA 1Z8AA 2J78A 3F4WA 3NQ2A 1R3YA 4KWWA 1XLGA 1SPQA 2E28A 3BCJA 5AHFA 3E1F1 3V1PA 1CI1A 1OHLA 4ZMGA 1EF2A 2PUZA 1OX6A 4FNPA 3DESA 1K9EA 4YWSA 2YLLA 1G5AA 4Z0JA 2P5NA 4RNFA 2XU2A 4WDXA 1X8FA 4L65A 3KS6A 1NWUA 1O1HA 3ZZ1A 2PF8A 3RFAA 1BYAA 4J9JA 4C6KA 3ZLFA 2BGSA 3LLXA 3GXPA 1YXDA 3NZPA 2PGRA 3A5FA 2ZX9A 5D2XA 1KBJA 3CHFA 4J40A 4R5EA 3TJXA 1J5TA 1YDYA 1IT8A 4HTYA 1J0JA 2WSRA 5CC3A 5A6AA 1XV8A 1A3HA 1UOZA 3AHVA 3BUVA 1VLWA 3KRUA 5C70A 1YE4A 1KTCA 3P81A 3GW3A 2DDXA 4K1WA 2VDIA 2YKKA 1GW1A 4QS6A 3LTSA 4O0ZA 3N1AA 2I5GA 3NURA 3SIZA 2DJLA 2QJHA 4QX4A 2FJKA 1TELA 2ZC8A 3S4TA 4IFKA 2J8FA 2F2HA 1TWZA 3FXYA 4FIRA 1OB0A 1OX5A 3LGGA 4R88A 3OQ8A 4I8DA 2W3ZA 1EO7A 3SY5A 1J6PA 2BHYA 2IPJA 4F0MA 2NUWA 3DG3A 1O12A 4LEFA 3R5EA 2BZNA 1SZEA 4UTWA 4O1EA 1W9XA 4Q4KA 3GTIA 1MW2A 1PKNA 5EBAA 3DHDA 1LBMA 3H54A 2NVCA 4LH8A 4X60A 1H51A 3WDJA 3QTGA 3TZFA 3AIWA 1VS1A 4C6FA 1W1IE 3B9EA 1G67A 3BAJA 5HBFA 2CLFA 5HWJA 5C54A 3FHAA 4DBEA 1FP9A 3MDWA 4GJJA 4RDVA 3UY8A 1DJZA 3G0XA 1BKHA 4WKHA 1PKMA 2PFHA 1RD5A 2JIWA 3QHMA 2BY3A 2ZUTA 1W1A1 4C5YA 1OG6A 3CL7A 4JFSA 2DSKA 1AD4A 3S1UA 3GHUA 4R9OA 1TWWA 2X05A 1XSKA 1KCZA 2OVLA 3SN1A 3R11A 3ITXA 1IYXA 3LA4A 1EH9A 2DW6A 4AFYA 3TYEA 2RJGA 1K6WA 2OYMA 4XVEA 4A8IA 3P80A 3NQBA 1N82A 1SM9A 4QQ3A 3W38A 4LQ1A 3UZ5A 4C65A 1A5CA 3JS3A 1ALDA 3W74A 4RE0A 4PCTA 2BOEX 3ENLA 3N6QA 4FNRA 1WZKA 2G96A 1IT7A 1UWTA 1U1JA 2NW0A 3IJQA 3NSXA 1HL2A 3M5XA 4E6MA 1T96A 1P5BA 4F66A 3BLIA 3VOJA 3RG6A 2JE8A 3H70A 1A0CA 2BX7A 1RBLA 4IMAA 4WJXA 1KCXA 3L4WA 1CGTA 4ZL1A 5EY5A 2DV0A 4B5UA 3B9NA 1I1WA 1PEZA 1Q85A 1EOKA 2VX5A 1B30A 1JPIA 1LLZA 1DHKA 3MCNA 3QV6A 1A5KC 2GK1A 3CMFA 4WSKA 3VKAA 1OABA 4GX8A 1EJXC 1VIWA 4NRRA 1EYWA 1AQMA 3CIWA 3JZEA 3R6IA 4ECLA 1HNYA 4O1FA 4PULA 1V7AA 2DT2A 1EC9A 5BWAA 1BG4A 3G3DA 4QISA 5AYYA 3VKDA 2IPGA 5AC5A 2J77A 1OX4A 4JFWA 1Y0EA 3GY1A 1ENUA 1TV3A 2NT1A 1TE6A 4KIEA 2J6VA 3N04A 1KKOA 5KITA 4JFVA 2YDRA 3R94A 4N9BA 1J01A 2VURA 1HP5A 1GVRA 4B90A 2P0IA 4GISA 4CU7A 1TZ7A 4U31A 4CNOA 4D6CA 3H7VA 5A8QA 2QAFA 1RAKA 4JTFA 2FPVA 1VR6A 2W66A 1KWGA 3OPSA 2NX3A 1XLDA 2V3GA 1WDQA 2EXOA 5CQ1A 3IARA 4QNEA 1QWKA 2ZOXA 1Q6RA 1TUFA 2JKEA 2OEJA 2ATSA 3OIHA 1G7VA 4DO6A 1XPYA 3NEVA 3NTYA 2A3LA 3GE7A 2BVTA 1QPRA 2F61A 3A9BA 3U7BA 1TA3A 4BQ4A 1BSLA 3CGTA 1UR4A 3GU9A 1LBFA 1DXIA 2OX4A 3W1AA 4PE8A 2PGEA 2PDFA 2G5WA 4LU0A 3UZWA 1WB0A 4AMCA 3V4BA 3SDOA 2QGHA 4HSHA 1K7EA 1AL8A 5CZKA 4PMYA 5REQA 2OGYA 2FDSA 1FWAC 2AQWA 1W5PA 2WV8A 4EK7A 4C6LA 3OODA 3M5ZA 3O0FA 2A6NA 4A3UA 2O56A 3WBXA 3PNUA 4F4RA 2V9DA 3AYRA 3PBYA 1WCGA 1RVKA 2ZZ5A 3VNYA 2FMNA 4DWSB 1GYLA 5ABGA 1UWSA 5HMEA 1UR8A 2OYKA 1PDYA 4IXHA 2UY4A 1EO5A 3VD9A 3MP4A 2QJNA 3BLPX 1MDRA 1CDGA 1JNDA 4M6PA 3N9RA 5GQBA 4JQ4A 4Q8TA 1V3IA 3LN3A 2XIMA 1E6NA 5G2WA 3WLHA 5FKYA 4F0KA 1JAEA 5A8GA 4RUBA 2CW6A 4GFIA 1OFDA 1SSDA 1TRIA 3LHVA 2VC9A 3BCFA 2V3EA 2V5DA 4QCFA 1OCBA 2ZQ0A 5D32A 1T7LA 3T9PA 1A50A 1TVPA 3PSWA 1V6UA 5I7GA 4JZ5A 3BLEA 3OG3A 3NFUA 4B5NA 2OXNA 3RILA 1NP0A 4RLIA 4LUTA 3STGA 3EZ4A 4V2XA 3NUKA 4H9VA 1XW8A 1AMKA 1VQTA 4E38A 1LUCA 1F76A 3VA8A 3IJDA 1FFQA 1E6QM 1GOMA 4GYKA 1YRRA 3BL3A 2Z1WA 1RQBA 3WD0A 1K77A 4XKYA 3LRLA 4F0LA 3ZT7A 1OFOA 2PF0A 5JXQA 3OYXA 1M01A 4TV6A 4H19A 2ABAA 5EB8A 2WVTA 4P7LA 3GDLA 1JCLA 3WKZA 4HHMA 2A0NA 1TR9A 1WDPA 5CLWA 5DT5A 1GZJA 3UYCA 4LUSB 3VNLA 1W2VA 1CGWA 1H09A 1VFUA 3B8IA 1T5AA 3MSYA 2W0UA 1HXJA 4IMCA 3SUSA 4UR7A 2EPKX 3GDKA 3GW0A 2NWRA 3FSTA 1VPXA 1XR2A 3FHQA 2VEPA 1DJNA 1XYMA 1GVQA 2PBOA 4FMVA 3QHNA 2QNEA 3R13A 2OPJA 4IX2A 3IUIA 4ZR8A 1BYBA 3ZVHA 1SMDA 3BWWA 3OQEA 2D69A 4C1KA 1V08A 3ABZA 2PTWA 1W5NA 4W7UA 5K3VA 1SFLA 3LENA 3VZZA 1ONWA 2B0MA 4Y8FA 3WK3A 1AJZA 5A94A 4RPPA 1YTEA 3LRKA 3DGRA 4PCFA 1G4EA 4EPEC 4JEQA 4QJ5B 3VDHA 3RPTA 3VM5A 2O7SA 3AXXA 2WZTA 2UWFA 1LTDA 1Q6LA 4TV5A 3LZ5A 2TODA 1GJUA 3F1QA 2O9RA 4PFMA 3TA6A 3NIYA 2WNQA 4HN4A 4E3TA 1TB3A 4B91A 3S2LA 3MKVA 4E4UA 1CCWB 3BANA 3TLQA 1K8ZA 2RUSA 3BMXA 3PPCA 2WZMA 5G1YA 5GVJA 4BJHA 2QGYA 3UWUA 1MZRA 5CZ0A 5A95A 4BI7A 3BE7A 3W23A 1WZLA 2D3LA 2PDMA 5HAOA 4I3GA 1GVEA 3UJSA 3G0UA 1KM1A 1TRDA 4UB9A 4HA0A 2ZXBA 3MMUA 5ABTA 4FX6M 1HKMA 2EBNA 1V8EA 1AJ0A 3KHJA 4QE4A 2GLKA 4WY0F 4W93A 3H2CA 2D0GA 4ZEPA 1KB3A 3H2FA 4ZXLA 3WO8A 5BU6A 1P7TA 3NQ7A 1AH0A 2PTYA 3EX2A 3EOSA 3UG4A 3RO8A 2FGLA 5I3IA 2A1YA 3GM8A 2XINA 1F4HA 1Q6QA 5LNVA 4L5ZA 2CPUA 4H04A 5CPOA 4Z2KA 1C92A 2X41A 2Z26A 1MUMA 1DVJA 2PWEA 4Q8WA 1YHTA 2W63A 2XSBA 3BZGA 1OK6A 2FLIA 4FX7A 4RDZA 3EKGA 5EL1A 4NKCA 3JRKA 4AWTA 3LV5A 4B5WA 2PDNA 2ZZ4A 3W7PA 1BQCA 4OVXA 4B5SA 2QZRA 4Y96A 4CNSA 1L8PA 1W17A 3W2JA 5AC8A 2VR4A 1LUCB 4ZZ9A 1GTEA 2BP1A 3W83A 1GPWA 2W91A 2CZVA 4NJIA 2RDTA 4JL2A 2OQLA 3VC5A 2EKGA 4G7EB 4JL1A 5E5CA 3B0UX 1H49A 1UP2A 4K3ZA 4KGJA 1G4SA 7XIMA 6ALDA 5M03A 1UWIA 1XDMA 4AY7A 2VYOA 2G3MA 3MZ2A 4HK7A 2VENA 1JVNA 2EPNA 1UWQA 4XD4A 3F5JA 2Z28A 4HCHA 1YNQA 3KVJA 1OINA 1ZNNA 4C6OA 4AIBA 4LF1A 2EG7A 4IQJA 3VINA 5G2IA 3NQFA 4MUPA 4F8XA 5A2AA 1UPPA 2F7FA 2HMCA 1VYRA 3TCSA 1AK5A 4N02A 4KEUA 2BSLA 1Q4WA 1EWEA 3T07A 1YNYA 4ZQMA 3UERA 2WBGA 3GXNA 1VH7A 3LK6A 5LIKX 1UR1A 3H4XA 3EDDA 2HNEA 2H8ZA 3VDBA 1DIEA 3QXBA 4DBDA 1AW5A 3P84A 4FLRA 2OO6A 3S1GA 1Q2RA 2OFJA 4GZEA 1HKJA 1S5TA 3B0YA 3VZXA 2PD9A 1GCYA 2NX1A 4BF9A 5AHLA 1GT8A 4WSHA 1TV4A 2DUXA 3PAJA 3R8HA 1FWIC 1ESWA 4HU4A 1KBBA 3ZSSA 4C6NA 5KINA 4NZJA 4EXAA 3NZ1A 1B3WA 4QRNA 1JUKA 3AMCA 2Z4GA 1LRNA 4PUWA 3KOYA 3GG0A 4PUKA 5GJPA 3SRKA 2BOFX 3P5YA 4PRTA 4LVAA 1E51A 4RXFA 1CXEA 4CNPA 3F03K 1AG1O 3DKLA 3RM9A 3CU2A 3IPWA 1FWWA 3UJFA 1VFLA 2GUYA 4WR3A 2I5QA 4DO4A 1SQ7A 4OJYA 4NU7A 2DZPA 4US5A 3DU0A 5AHNA 2ZTJA 1M9HA 4W84A 1QW7A 4N4QA 1A5LC 4XWUA 3A22A 1W8GA 4MUZA 4UMBA 3IGXA 1O5QA 2A6LA 2PRMA 3P74A 4LGXA 4HPJA 4U5IA 3CLMA 4Y9PA 2FYMA 4UTKA 3RXZA 3I3EA 1PYFA 1YPIA 3PK7A 3AU6A 3K30A 4Q4RA 1X96A 4TTUA 4RL3A 3CV7A 3RX4A 4GUJA 1P0NA 4GUHA 3K13A 3LCXA 3GNNA 2WW5A 2BTMA 3A3WA 4RCXA 3WN6A 2AAMA 3S47A 3DXIA 1ZJBA 2BGNE 1WX0A 4FS9A 3VMOA 3MWCA 3VKKA 3WLMA 5D8WA 3QSTA 4JHOA 1QI2A 2PD5A 1PHQA 1HJUA 3D3AA 1ITQA 3PF3A 4PMDA 2QYGA 3L5AA 3QEZA 1EJ7L 3TC7A 4ADUA 2OWXA 4V28A 5KZDA 2FZ8A 1NDWA 4HKPA 4Q7NA 1ZZMA 4EWND 3A6OA 5HMDA 3EA3A 2X0HA 5A6BD 1T0OA 4AG0A 1PPIA 5L6UA 4TOQA 1FH8A 2XUCA 4O57A 4S38A 4FX8A 3B05A 5A5WA 5D30A 4JTQA 3N17A 2J6XA 3E2RA 4X0VA 1GUVA 4J2PA 1ZBCA 4MZ1A 4GKTA 1L0PA 4XD5A 3WFZA 2QT3A 2Z24A 4MJZA 4OWGA 3ALFA 1S5NA 4JPGA 1US0A 3C2OA 1KTBA 2VEKA 4Z42C 2Q02A 1XG4A 2E09A 2J47A 4JIEA 4XO7A 2DT0A 4I8YA 2WJFA 1H7WA 1UC4A 1CLKA 3U7VA 2Y7GA 4DY1A 3NQVA 1V0NA 2INEA 1D3GA 2DH2A 3TC6A 4M7SA 1OGBA 2P1FA 2WANA 4BQ5A 4WHBA 4XIAA 1LYXA 4M5PA 3PBUA 1XICA 1AQHA 2XGBA 1EOMA 1R8LA 2QMKA 1YPXA 3VYLA 1PWMA 2VTFA 1F5ZA 2L5HA 3LBMA 3HMCA 5SWUA 3R0KA 5TF0A 1W2PA 2PDCA 1CIUA 3HZ3A 4CN6A 4GUIA 1EGVA 2RDXA 1PXGA 1LT7A 3VNMA 4LC8A 4HZ8A 3L5LA 2ATMA 3S6OA 4EOUA 4EVZA 4NT0A 3COTA 3DEQA 2IKIA 1V02A 3SEPA 3DOPA 3UR5A 3QW3A 3VNKA 2VFEA 2C1IA 1JCTA 4DAIA 2NUYA 5DXXA 3GHRA 4PMJA 5F2MA 1JPHA 1KLYA 1F2JA 3TQPA 4H6QA 5TNVA 2J7GA 3ZVIA 3WNKA 3W1NA 2CBIA 1ZP3A 1XIFA 5I79A 3BLLA 4JTIA 3VGFA 3MSGA 1S2WA 1KM5A 4PMXA 2QCMA 3VIPA 1ZENA 4XK2A 1TJ2A 7PTDA 2VL4A 3UA4A 1GVFA 4AVOA 3N18A 4C7DA 5DCEA 1EP1A 3PTKA 3O6YX 3OLIA 5BMXA 2ACUA 5HNTA 3RK8A 3T81A 1KBKA 3MUCA 2QHAA 4UFMA 3N73A 3BW4A 4O8AA 2X09A 3BMVA 1BD0A 2E9MA 2MNRA 3HGOA 4DRSA 3UWWA 3MU7A 4E8CA 2I9UA 3LQGA 4RV8A 1DTUA 3GIPA 2R6OA 4NQ1A 4AD4A 1GKRA 4FXSA 2LLEA 3JUGA 2C91A 3M4HA 2PDJA 2PE4A 3RJYA 3BW3A 3VFCA 3M0XA 2NSXA 3AI0A 1TZ9A 3UP8A 5C9UA 1EP3A 4CLMA 3T0TA 2H3BA 4MG4A 1NFGA 1UA3A 1TPFA 2WHJA 2CLEA 4NX0A 3KRZA 3JR2A 2ZZ3A 1I8JA 1O68A 1X6UA 3GXIA 4ZTXA 1P7TB 4XAYA 1ME9A 1JQVA 3CZJA 3B0XA 2FZMA 2HCVA 1KWKA 1V3HA 1L2UA 2WPGA 3EWUA 1XPGA 3UA3A 1XP3A 4RDYA 1IR1A 2VGIA 1M41A 1E5JA 3K4DA 2Y1HA 4E8DA 3RITA 1VLIA 3QPEA 1LG2A 2GVYA 3FN9A 4JNMA 4YHEA 1S1RA 3HQNA 5I00A 4JNYA 1J93A 4K7VA 3AIBA 4FNUA 4QJ3B 3WJYA 1ODZA 2C79A 1DWHM 3LGEA 2OKOA 2VEMA 5BRBA 2PA6A 3GDBA 2GSHA 4MJ4A 3N4AA 5AB3A 1EQCA 5ABFB 3VE7A 5I23A 3CWOX 4LAUA 4O1CA 4NXKA 5DY2A 3NL5A 4ZB5A 2F84A 2CC0A 2NXHA 4EIVA 3QF0A 3TQVA 3DN5A 4W85A 1R3WA 2WZHA 4MLJA 2ISSA 2VOMA 3TSMA 3BG9A 3TUUA 3CZEA 2J7BA 2P0OA 1FH9A 3RM8A 1GW9A 1UZ1A 1RV8A 1WZAA 5E70A 1JD9A 3MB9A 4MMWA 1MQQA 1UR9A 3TU9A 4PN2A 1Q8JA 3FJLA 1V0MA 2EG6A 1EIXA 1QI5A 5HDRA 2WHKA 2Z6JA 1HTIA 4WXZA 3ARYA 2C6QA 4KPLA 5CPLA 3VC6A 1UUMA 3L2LA 2BOGX 4O8RA 2YCEA 3ONBA 4TQTA 3LHWA 3DFYA 4V27A 3SAZA 4DLFA 5E1QA 4M81A 1LOSA 3GNRA 4TTGA 3REQB 4M3PA 1VD6A 2E9BA 4K38A 4K8GA 4RZ5A 3GX9A 2BXZA 2R1LA 2IXVA 3WQWA 1TE1A 4CCCA 3GD6A 3QTPA 2C15A 2GDQA 4HZMA 2D0HA 4LBSA 3QW4B 1C7TA 3CJPA 4L4PA 4AXKA 1XIIA 2CZFA 3AMKA 1SVDA 3WQCA 3TMQA 4CD4A 4J2MA 2GUBA 5DN1A 3K1DA 3E96A 3VD7A 3I10A 3SN0A 3UG8A 2XFYA 4NAEA 4XIMA 3VCRA 5EMKA 1HJWA 3WJXA 4MNKA 4XKMA 2X7WA 2V68A 4B2DA 1E1CB 4IL2A 1OFAA 1NQ6A 4JHMA 3VX0A 3TAOA 3VGDA 1H7PA 1US3A 1ZJHA 3ARWA 2Z2BA 3I7QA 3O6AA 1VIZA 3MVTA 1P0DA 1JZ4A 1I2RA 2CYGA 4H3DA 4IL0A 1CXFA 4FZIA 1JDFA 1JDEA 1UBSA 1E55A 3VD4A 3T1GA 1NTHA 4Y9MA 1EL3A 4ERAA 1LQAA 2J9ZA 2QXWA 2G4JA 2BV9A 3WLOA 4M6VA 4FI4A 4ZODA 3DC8A 3IK2A 4LUSA 4IMDA 1W6TA 2DZAA 4CKQA 3SRFA 1QI3A 4UZSA 3IRDA 4GIEA 2GGJA 5TD4A 5G2HA 1YNPA 3A21A 4L6DA 3NL3A 1SFTA 1XYLA 1JPMA 1NAL1 3E0FA 3OHIA 4G7FA 1UKQA 1UZDA 2DVUA 4D1JA 4NRSA 1J11A 2UY2A 2PP1A 5FIPA 2RJHA 3LQLA 3PAOA 2CHNA 3L4YA 2FZ9A 3WUFA 3TJLA 1DPMA 4IXXA 3F5LA 4ZO7A 4QROA 1YX1A 5I3DA 4ATLA 4ERIA 3SCTA 2QAPA 2TAAA 1DP0A 1FWSA 4LCRA 3CXOA 3GR8A 3O6CA 1DBTA 1MEHA 4Y6GA 7TAAA 1DWIM 4F9DA 2CLKA 4JIIX 5GNXA 3E74A 4C6MA 1H7RA 4AUBA 3WJZA 3PY2A 5CGTA 2V5LA 1DIKA 1PJ9A 4MWAA 1YQ2A 3UT0A 1W54A 2AAAA 3ZWTA 1FUYA 3MANA 3E2QA 4IP7A 4JGDA 1EX5A 4DO5A 4JCLA 2YDQA 3R8GA 2UBPC 5CSYA 3E6EA 3NQAA 1VBGA 2HXTA 3CMJA 3NPUA 3UR2A 1OX4B 3ARXA 4H7VA 4IPJA 3GVWA 4PB3A 2PCQA 3DFHA 2NLIA 5EU9A 4IZGA 4DXVA 1KQZA 3TEVA 5ABHA 4GNJA 3UJRA 4TU1A 5K9CA 5HINA 1RK6A 3REQA 2QW5A 2D2JA 4CD7A 2AL1A 5EMJA 1OM0A 4ZO9A 3WNPA 2VFDA 2A21A 1LRTA 4XVDA 5B80A 4ZBCA 2G3IA 1ZGDA 1GJWA 2RGMA 3THDA 4AZ5A 1GVYA 4MNLA 5JVLA 2IUZA 4LV9A 3TCEA 5JBFA 3BK0A 3HJZA 3MC5A 2GVLA 1QNPA 1V3KA 2CLMA 2ZUSA 4YTUA 1UD4A 1WXYA 4JYFA 4H8NA 1I75A 3LBOA 3WQ8A 3VOGA 1JEZA 1TPDA 1DE5A 4NP7A 1XD0A 1SZNA 4EACA 1S2AA 4XX6A 1TPH1 4ZA0A 3TW6A 3OJGA 3TQKA 4WEVX 3FA5A 3TWAA 5C9RA 1V3JA 2JIEA 3SCWA 1VFSA 3DGBA 2VFGA 5LA1A 2JKPA 3VAVA 2GGHA 3L5MA 4LTSA 4XAGA 3VUPA 1JQXA 5BRQA 1S3TC 4YXGA 1FP8A 3WD4A 3LCWA 3SUUA 4A3YA 7REQA 3NO3A 4LUYA 5J8LA 5H8MA 2WCAA 4LCQA 4MYAA 3OZPA 4H9MA 3W7RA 5KMYA 2VX7A 4WIWA 5AC7A 3TN5A 1XH0A 3Q37A 3PC0A 3UW6A 1I2PA 4DJFD 4ONVA 2NSOA 4HPXA 1J5SA