4NVTA

Crystal structure of triosephosphate isomerase from brucella melitensis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
249
structure length
249
Chain Sequence
IRPLVAGNWKMNGKGESLTELRAIAAGLSSDLGRKLDAVICVPATLLSRAAETLEGETVGLGGQDAHFKTSGAHTGDISPEMLKEAGATHVILGHSERRTDHHESNKLICAKTEAAWAAGLVAIVCVGETASERKAERALDVIGDQLSGSLPDGVTAENTIIAYEPVWAIGTGLTPTVQDVRAAHAFMREQLIERFGAKGAHLRLLYGGSVKPSNAAELLGVADVDGALVGGASLKAADFLAICETYRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Triosephosphate Isomerase from Brucella melitensis
rcsb
source organism Brucella melitensis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 88
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nvtA00
2WNNA 2A7NA 1H50A 4TO8A 2QCEA 1FDYA 1UBSA 1VH7A 5DBTA 4Y90A 3W1LA 5FESA 2CLEA 4GUFA 4X9SA 3PR2A 3IVTA 5CZTA 1DJNA 3DI1A 3PG8A 1D3HA 2PRMA 2QCCA 4MYXA 1MZHA 2C19A 2WV8A 3NR0A 4EF9A 1RQEA 3HG5A 1LYXA 2ZA2A 3KVKA 3TV8A 1H7OA 2NWSA 2WSQA 4EVZA 4K8EA 3QH2A 4R53A 3NQFA 4D2JA 3LCHA 4UNLA 2HTMA 4N9EA 2FJKA 1W5MA 3TU9A 5CKSA 2VEPA 2ATMA 3NQCA 4FHAA 2VFIA 3NDOA 4N2YA 4X2RA 3NQ6A 4JD4A 1OFOA 4GUGA 2QDHA 2ZZ1A 4WUIA 5TBOA 4IX2A 3W70A 1JVNA 4HSOA 1VZWA 4LY8A 4ZMGA 3IRDA 3HPZA 1K7XA 3ABQA 4AWTA 4G1KA 2VEKA 4QNWA 1GG0A 1UASA 1FWTA 2CU0A 2TPSA 1D9EA 3FYOA 4LUIA 4FNPA 1KFBA 5LNWA 3DAQA 2RH9A 3LTSA 3M0ZA 5KMYA 3EKLA 2E6FA 1Q45A 1G69A 1A5AA 4TU1A 4O1AA 2QAPA 1OF6A 1XC4A 3T7VA 1B9BA 1UUMA 3MYOA 3W7DA 5DCEA 1AK5A 4MFDA 3I68A 3TKFA 1XBYA 1Z48A 3KX6A 3MI3A 3CC1A 3S5OA 1ICQA 4GNJA 1RQHA 4HNTA 2BX7A 1OK4A 2H90A 4PFMA 3O16A 1KM5A 3OVRA 3V1PA 3ZFHA 1ZAHA 4NT0A 1VLIA 3TSMA 3QPYA 1FDJA 3KVMA 3TQKA 5FEWA 3IGUA 2QCMA 3LHUA 3O6YX 1K8YA 1F76A 6TIMA 3P8IA 4PL2A 1DJQA 5C2XA 1TTIA 5ABTA 5F2IA 2YCEA 1U5JA 2Y6ZA 3W7KA 3AJXA 3W1XA 2CLMA 3WJXA 4LVBA 3DKJA 4K6AA 3WJZA 5EPDA 1KM4A 3FA5A 3STEA 1TPVA 2ZFAA 4UFHA 1XBVA 3UYCA 4ZZ9A 3MBDA 2VENA 4JTEA 3CQ0A 2NX9A 3P67A 1KM1A 2FFCA 3MJYA 3TROA 3MYPA 5MHBA 3CWOX 1IIHA 1QAPA 2B7PA 1MO0A 3NM1A 3PBYA 3OBKA 4X22A 2FQIA 4A2RA 5HR6A 1THFD 1OX4A 3SIZA 3L5MA 1QCWA 3M44A 1QNVA 1L6SA 2TSYA 1RR2A 3B04A 4YCOA 3RU6A 1KM0A 1LBMA 1SPQA 4ZQPA 3NQAA 5AHIA 2RKXA 5IBXA 4JX6A 2I9EA 4DELA 8TIMA 1PV8A 1KFCA 2R14A 1HO4A 5I3HA 3O8AA 3T55A 1OYCA 1OF8A 3JR2A 3NNTA 2V8ZA 1IGSA 2VFGA 1VJIA 1C8VA 3W83A 4N4QA 1H62A 4JN6A 4U28A 1TQXA 2I1OA 3B8DA 4UMBA 3O6CA 2YSWA 4ADUA 4KKXA 2H6RA 4FNSA 2YPIA 4K8HA 3WJYA 1AW5A 2WNQA 1AW2A 3RK8A 1QOQA 5CPNA 5J5RA 1A50A 1GWJA 1GEQA 1LROA 2IQTA 5CSSA 1TQJA 4LS0A 4LRTA 2E6DA 2DZUA 4UXDA 3LRMA 5DCDA 3T40A 3M5ZA 4I7WA 3GZ3A 4A3UA 3LGEA 1W37A 3G1AA 2C15A 3W1RA 4AHQA 1M7OA 2EKCA 3N3MA 2X1UA 1SSDA 2G96A 3OVPA 3BW2A 1X7FA 4WY0F 4LS2A 3NQMA 4O50A 2YGYA 1I2PA 2KZHA 3E02A 3DFNA 1Q6OA 3MP5A 2WJZA 4RJEA 1GG1A 3VI2A 2XFWA 3HGOA 1B4KA 1Z41A 2Z6IA 2PE4A 4EWND 4HPJA 4WD0A 1VGAA 2JKPA 4O4VA 1QO5A 2V5BA 4JYFA 2WOQA 2C18A 5AC6A 2OT1A 4UTLA 2AQWA 1WBHA 1EX5A 1TPEA 1TJRA 3P7YA 3LTPA 1U83A 1XDLA 1VCVA 4UTUA 3DBPA 3PAJA 4JR5A 3F1QA 3GYEA 3GDRA 4IMDA 4AXKA 1S5TA 2ABAA 3A5FA 1LTDA 1PCKA 2FPYA 1T8XA 1FCUA 5TQLA 5KINA 1QWGA 5AC8A 1LOSA 4P2VA 2FIQA 3O63A 1LZOA 2G5WA 1GJPA 1Q6QA 3FKKA 3NL5A 1SW7A 4FNTA 3TDFA 1M7PA 3SSJA 1TB3A 5CZ0A 4K39A 5LKYA 4QM1A 2V30A 1LOQA 3CB8A 2W0UA 1GTEA 1MXSA 2NV2A 3ZS4A 1TREA 5K3VA 1OX6A 3S42A 2ZA1A 2CFFA 3IVSA 2Y61A 5F2GA 2ZRXA 5KZMA 3LB0A 3HG3A 2ZZ7A 1OG0A 3W2UA 4RLIA 3CM4A 4NZFA 4IPJA 3PSVA 3FEMA 1AW1A 4N6EA 3VE9A 4BFAA 4AWUA 4A29A 4CQ8A 1LLWA 3NGJA 5AHFA 3PM6A 4FX6M 2B7NA 2GQAA 5D2WA 2W6RA 1AL8A 4E0CA 3W75A 5LGXA 5E0KA 5AYXA 3GNNA 2WSRA 4O28A 4UFLA 3PS7A 1VYSX 1I2RA 3BARA 3E49A 4HSNA 4I9AA 1I2OA 1PIIA 3EXSA 1AL7A 3L5AA 4PODA 5K4ZA 2CZDA 3CEPA 1FY6A 2GVJA 3HJZA 4U4MA 2AGKA 4NJKA 3KVLA 3NO5A 4NNAA 1BKSA 1SFJA 4MIMA 3W88A 1KFKA 3EWZA 1GVRA 1YXYA 2FB3A 4CNPA 4N9BA 4UCGA 3VE7A 3PVFA 4XBKA 4Q33A 5A8GA 4HN4A 3DENA 1GVQA 3RLUA 3TQVA 1EPXA 5G2IA 1P1XA 4JYDA 3MHFA 4OT7A 3V75A 5HUOA 1OHLA 2PURA 1HUVA 3KRSA 5D02A 3LRKA 4H4IA 3W1TA 1YLVA 3P8JA 1ZAJA 4IXHA 3S9YA 5D2XA 4ADSA 1ZENA 2QCLA 3EWWA 1N55A 3EXRA 5F2MA 1RVGA 4ALDA 1BWLA 1SUXA 1MEHA 2NLIA 5D09A 1GYLA 1LBLA 1H7PA 3S1VA 3PWAA 3IEBA 1G4PA 5F1VA 1ZY9A 1R30A 2X1TA 3G8EA 3LV6A 1XM3A 3THAA 4M5PA 2A7PA 3IV3A 1H7RA 5CPOA 3IIVA 1R46A 3TCEA 4Y8FA 3C2VA 3KAOA 1QR7A 1EP1A 4O4WA 3G24A 3RLVA 4O12A 4A22A 1QDSA 3FLUA 4PA8A 3H55A 3QEZA 4Y9AA 3MHGA 3TFCA 3W73A 1W5OA 3LXBA 2GUUA 4GWEA 4RR4A 3HGSA 4S2CA 2EAWA 2Q3OA 3W76A 3W2KA 3L2IA 4UMCA 3P82A 1K7EA 1TPB1 3WK3A 1KTNA 1DQXA 2ZRZA 3CTLA 3PF3A 4Q32A 5BNKA 1KLZA 2E6AA 5K9XA 1HG3A 1G7VA 2H3DA 2VFEA 1GQNA 3HPXA 3RF9A 2VOMA 3OEXA 2ZRYA 3L9CA 3M1ZA 4NX0A 3WFAA 1OFQA 5LNUA 5G2WA 4NQ1A 1DQWA 1W0MA 4CQ9A 2ZBTA 1QPNA 1IXPA 5I3FA 4PCFA 2X1RA 4MZ1A 3OHIA 1KW1A 1YTKA 5FEZA 2E1DA 2X16A 4RX0A 4O14A 1OX5A 3LCIA 5C55A 4WXYA 2ZRUA 3UWUA 1FDZA 3GB6A 4QIUA 3T4CA 1W8SA 2CW6A 3C56A 2QJGA 4DF1A 3ELFA 3W2NA 4AH7A 3A23A 3NYZA 3P80A 4FNRA 3M5XA 3DFPA 1KFEA 1P0NA 3U2OA 2VFDA 4JTLA 3P62A 3N19B 4QQ3A 1KM2A 4ICNA 2ZZ6A 2JGYA 3NXFA 2WSYA 1F6KA 2BSLA 3B05A 3N2XA 3UPBA 1JCNA 2Z0IA 4O13A 1ME7A 3NPWA 3G0SA 4LS1A 4UC5A 5D33A 2JKAA 4WZHA 3L21A 4UFIA 5DXYA 1FQ0A 3EWXA 4JY8A 2DU2A 5FF3A 2Z2UA 2G97A 4MJMA 4OGZA 1FCQA 2XN2A 1EUAA 3NEVA 1GVOA 2RDTA 3TNOA 1VHNA 1K7FA 4LVGA 3B0VC 1XBXA 4UR8A 3INPA 4RZ4A 4A21A 3EWBX 1K3UA 1TTJA 3W22A 2WO5A 3HOJA 3K30A 4UNKA 4ONVA 3TE9A 1FXQA 3NOEA 4M7SA 5LSMA 1DKWA 4R7JA 1TSIA 3O06A 1XDMA 2ZZ3A 4M7TA 2P10A 5LZLA 1ZHAA 4DO5A 3R12A 3QJAA 3GAYA 3GKFA 3G1XA 1VQTA 4L4LA 3W07A 1LM1A 3I65A 2EF9A 1OFEA 3BG9A 5KITA 3M43A 4H6KA 3BLIA 3BPWA 2QCDA 4UTIA 1IF2A 5L9FA 3NA8A 2QAFA 3DHFA 4LU0A 4CNNA 3IVUA 2YW4A 3M41A 2W79A 1OFBA 1PVNA 3NG3A 2QCHA 4H3DA 3EX3A 1A5CA 4GXMA 2YX0A 3W1AA 4RZ5A 1BEUA 1VCGA 3LHWA 3UWQA 4GUIA 5E93A 1JJKA 2ZZ4A 5C54A 5LNRA 3W7OA 3DGRA 3LCXA 1Q6LA 1DL3A 3MI2A 5DLCA 4IOTA 5CPMA 2C0AA 3W7PA 3M7WA 4NVTA 1N7KA 3W1PA 3QQ0A 2Q8ZA 4J9JA 2Y63A 1IXQA 2DZTA 5DY2A 1VLWA 1ZFJA 3QW3A 5D32A 5EKYA 1H60A 5FF0A 3L65A 4K7YA 2VELA 3N9RA 5HNRA 4M6PA 5KZDA 3SI9A 4BK9A 4JYEA 3TSDA 1S3HA 3A24A 3EXTA 3S1XA 3HG2A 3C2EA 1TPDA 3DZ1A 4MLJA 1X1OA 3G18A 2QCDB 5IM51 3WJWA 4YL2A 4OU1A 4O17A 3M5VA 3UXDA 3GR7A 3UY8A 1XL9A 4ML9A 1SQ7A 2ATSA 4LRSA 2TMDA 2C16A 1FWSA 3TMQA 5G4WA 1CW2A 1JUBA 3A21A 3BO9A 5AOUA 5J5DA 1TYGA 2OZ0A 1EP2A 4DQWA 3EB2A 3W9ZA 3C2OA 1BWKA 5LNSA 1DHPA 5IBXC 3NL6A 1K03A 3PULA 3TR2A 3LCWA 4EF8A 3S0CA 3F4WA 1SW0A 3DKLA 3ABSA 1YDNA 4TMBA 3L67A 4E38A 1S5VA 3QMSA 5C6MA 1JRCA 6ALDA 3C2RA 1FCBA 3TX9A 4YXGA 1WDWA 1N8FA 3CLMA 4MUZA 1SO3A 4KFOA 4HIBA 1JCMP 1TTQA 3C0JA 1W3NA 1MEIA 3S8HA 3R5EA 1YTEA 3C3NA 2J88A 4FXRA 4MZYA 4E2BA 2RDUA 3W2LA 4OE7A 2QUUA 4GE8A 3CWNA 4I7UA 5U4NA 4OHQA 3UWYA 2B7QA 3G22A 3I7QA 1KV5A 5AHNA 2FDSA 3P74A 3PUEA 4MLRA 4CLMA 2JBMA 4LVAA 2Y88A 4N9CA 3GX9A 3E96A 4UTWC 4TMCA 4DEFA 1PS9A 2ZDRA 2DORA 3TJXA 5LGZA 1WQ5A 2CZ5A 2QCFA 2PCQA 3QQ1A 3SW6A 5I3JA 2YW3A 1EIXA 5AYZA 3P5ZA 4A2SA 4NJJA 1KBJA 4GFSA 1F5ZA 3GXNA 4JTHA 4IUOA 4NJGA 4O1DA 1BTMA 3EWUA 3IIPA 3EX1A 3IGSA 3QRHA 3BLEA 4FIQA 3NQDA 1F74A 3Q37A 4RK8A 4O54A 1NF0A 3CT7A 3S5NA 1QPOA 3H54A 3NZ1A 4ORMA 1T0OA 4M6VA 2V0TA 4FO4A 4UTHA 3TH6A 1O95A 2TRSA 5AYYA 3TQ0A 2J9YA 4N02A 5HMSA 1G7UA 5D03A 1UJPA 2V5LA 1O4UA 1ALDA 1H1ZA 1JCJA 4FNUA 3Q2DA 1T96A 3TC6A 2Z1BA 4AF0A 1EP3A 3GNDA 3WJSA 3UWVA 3LX9A 4TIMA 3W1NA 4XTIA 2OJPA 1SZGA 5DY3A 1AG1O 2DP3A 1LLZA 2B0MA 4Z1CA 3UNDA 3STFA 3O15A 4FF7A 3NZRA 2C1HA 5FEXA 5HULA 1LP6A 3LHYA 4O19A 5D37A 4Z08A 3E12A 1LBFA 3QSTA 4LVDA 5KSWA 2DJLA 2A4AA 4DO4A 4QSHA 4JNMA 3QW4B 2CLHA 2GVGA 3VCRA 5H2ZA 4JTKA 2YXGA 1RD5A 1W54A 4K36A 3ZWTA 5D38A 2ZZ2A 1SFLA 1DORA 4E2DA 4EOUA 2XN0A 4NNCA 2VC6A 2QF7A 3W7CA 4ADTA 5K9DA 2ABBA 5E1QA 3UD6A 2DJXA 1KA9F 5HJLA 1CI1A 1TPH1 4GRSA 1EEPA 3HGJA 3LOTA 5EY5A 5F4XA 4RZ6A 2NXIA 4JTSA 4W9TA 2ZCGA 2FPTA 2E6YA 3G8RA 3PBVA 4R34A 4HT3A 1RV8A 4LNYA 3TMLA 1M5WA 1IIGA 4OQVA 4ZL1A 4C1LA 4ZQRA 1B4EA 3BW4A 3C8FA 4JDYA 4HHPA 4KWWA 1EWDA 1GOXA 4XKYA 3MHUA 4O0KA 4FX8A 1QPQA 5BW6A 3DFQA 3SECA 2QKFA 2CZFA 4LV4A 4WY0B 1ZALA 3CPRA 3GLCA 3LXCA 1TV5A 2PRHA 5CZSA 3T78A 1VR6A 3KFTA 1GYNA 2E5BA 2ISSA 2AAMA 4MJZA 4Z0JA 3HIJA 2BTMA 2VEIA 1TV8A 2VFFA 1UUOA 2YR1A 4JX4A 3CU2A 3UWZA 1X6UA 1XUUA 3YPIA 2C13A 3F03K 4QAIA 4P61A 4AEOA 1SU5A 3F4NA 2E5CA 3TXVA 1K8ZA 2J9ZA 3QMTA 3D0CA 3ANYA 4C1KA 2H8ZA 4WXZA 1ONRA 1SZEA 1YDOA 1NEYA 1S5WA 5K4XA 3OG3A 4UIOA 3LERA 3W7RA 1W56A 1R2RA 1R47A 1YTDA 3EX6A 3W6YA 1EWEA 4JS3A 3SZ8A 4YWIA 3M16A 3GK0A 3DXIA 4AF0B 1W31A 3W72A 2NUWA 3LCFA 3NPVA 1UCWA 3G0XA 3HGRA 3SFKA 3QSRA 1KBIA 3QC3A 3UWWA 5K9CA 1ME8A 1Q3NA 2PC4A 1O5XA 2NX3A 2YZRA 4IMCA 4KFNA 4O1CA 4Y96A 1KTBA 1W3IA 1ZJIA 2FLIA 3L5LA 3W71A 3UY7A 4XTDA 3PG9A 1A5SA 3N73A 3DU0A 4JIQA 5CPLA 3FOKA 2FPVA 4IQLA 1I45A 5AHEA 3HQ1A 1J4EA 1W5NA 4B5NA 3QFEA 2YFOA 4LTSA 4GUJA 1ME9A 4MVAA 3MWAA 1LDCA 5H91A 2DZXA 3LM7A 1TV7A 2GJLA 3ABRA 1VYRA 1HL2A 3S1WA 2GQ9A 3PUDA 1HFBA 4ZVJA 2Y7DA 3GDKA 4PH6A 3VNDA 5BOOA 3L0GA 4UFMA 2CLFA 2BXVA 1H7NA 3LCLA 3LXAA 3PUOA 4UR7A 2WNZA 2FB2A 1WA3A 3IIXA 4JIPA 3BK0A 2WQPA 1QMLA 1G67A 3SJ3A 4JDBA 4IGHA 2H8XA 5CSRA 2O7QA 2ZTKA 3LLFA 4BF9A 3HBLA 1VHCA 3W7JA 4NZJA 4WY0A 2CLIA 1R2SA 3M47A 1VS1A 2E5DA 1OYAA 2RFGA 2PRLA 4BWLA 1UB3A 3NQVA 3IIOA 4FIRA 3W86A 4IWWA 3W1QA 4IMFA 3C2FA 2DZSA 3L66A 1TPC1 3B03A 3ZWSA 3RFAA 3H53A 3OIXA 4UFKA 4O18A 4ZQCA 4IXXA 3W74A 4HNVA 4GUHA 3QM3A 3TW6A 1MSSA 3MI6A 2J24A 3W2MA 2BWGA 2V82A 4Z1AA 1W5PA 5BMWA 1OYBA 1O60A 3EKZA 2J27A 3LTYA 5AHLA 3UPWA 2C6QA 5EBUA 1I2NA 4UTJA 1W5QA 1LORA 2TYSA 1OX4B 4QISA 4PTNA 3UZJA 4MZ8A 4IJBA 3C6CA 3W23A 3QPZA 3CIWA 2QJIA 3HF3A 3KRZA 4NUWA 4OBTA 1YPIA 3PBUA 3NAVA 1L9WA 1JULA 1OFRA 4O57A 3R2GA 1JRBA 4WOZA 4NU7A 1JR1A 4RXGA 4XWUA 2A7RA 4QITA 3R89A 3A5VA 5D2YA 5DN1A 5K2ZA 1RQBA 2QUVA 3JRKA 1OFPA 4BI6A 5HUPA 1H1YA 3THQA 2LLEA 2Y62A 3QZEA 3KXQA 5HWMA 1JCXA 4AVFA 4UTTC 3TA6A 5FI8A 4MYAA 3G0UA 5AN7A 3NQGA 1G4SA 3M9YA 2A0NA 5CZJA 3RMJA 1FWRA 4DBDA 3P5YA 3QYQA 2B4GA 4O8RA 1XXXA 1Z44A 1G4TA 2YDAA 4HKPA 3KHJA 4NXKA 1ZAIA 3DHDA 4DF2A 3E9AA 1TMHA 4JTIA 1DVJA 1TPWA 1M6JA 1PE1A 4JTJA 4K38A 2RHGA 1H7XA 1JQXA 2G95A 1I4NA 1NSJA 4RCXA 5LHFA 1PHQA 3PY2A 3TK7A 4CNOA 4O15A 3FIGA 1ML1A 1SZFA 3O1NA 4FX7A 2V9DA 5D05A 4K37A 1F05A 1WOBA 4NXSA 4AB4A 2V2HA 3PB2A 3LCGA 1GPWA 1F73A 4XZ9A 1TJPA 3USBA 2GPTA 4WQ6A 5T26A 4AAJA 1LCOA 3FKRA 1H51A 3LHVA 2ZTJA 4FEZA 1C9DA 1ADOA 4JTTA 4JXCA 4R33A 3W85A 2HSAA 1TRIA 2QR6A 5G1YA 4UTKA 1YDVA 4MPQA 2P1FA 4NJHA 5EA9A 2ZQ0A 3VKJA 1KFJA 4LT9A 3NPXA 2DZWA 2YFNA 4ZQNA 3N9SA 2GOUA 3U8GA 1R2TA 1EUNA 2YYUA 2R8WA 5G4EA 5DELA 3NQ8A 3G1VA 1QOPA 1GVSA 2JKEA 1Y0EA 2X30A 3UXAA 4KFPA 3LLDA 1KV8A 2NX1A 2Z6JA 1KTCA 5LNVA 3O05A 3W84A 4JTGA 5FF7A 3NQEA 3W7MA 1DBTA 4UTTA 2A21A 3GDLA 4AHOA 4WJEA 4Z0SA 1G4EA 3G3DA 2NV1A 1L6WA 4X3ZA 3GXPA 5FF4A 2F7FA 4LC6A 1HTIA 2V81A 1WXJA 3MP4A 2A6NA 5HINA 3S1UA 1V7YA 2V2DA 3HB9A 3LHTA 5EMUA 5SWUA 2Q8LA 1F6PA 4GBUA 1TCDA 1VRDA 2OCZA 3AO0A 4FNQA 3B06A 4UTWA 3LV5A 2B7OA 1RZMA 3G1HA 1G6CA 4PEKA 5HR7A 4IMGA 3CHVA 2A1YA 3GKAA 1JQVA 5AB3A 3PB0A 5HWJA 4FXSA 3MP3A 3DH7A 2P0OA 1L6YA 2YYTA 3MW7A 1W3TA 3KOFA 1OABA 1SO5A 3UQNA 4KWVA 2EGZA 3W7NA 2R91A 2WKJA 5TIMA 4O53A 1WBJA 3QF0A 3NL3A 3S6DA 4OV4A 7TIMA 1Z42A 3P81A 2NWRA 1PHWA 4O52A 4LC8A 1F7BA 5U7SA 2ZZ5A 4LWWA 5DXXA 3LHZA 3NL2A 5F4WA 3B0PA 2NUXA 4IPIA 3TXZA 3C61A 2WPBA 1HO1A 3C52A 1L2UA 2CZEA 3NQ2A 3TAKA 3FJ6A 2EHHA 3RNDA 1K8XA 5L6UA 3TC7A 5BRBA 1JUEA 1A53A 1OFDA 3W7HA 3MMTA 1AMKA 1VCFA 2NXGA 3O07A 5AFDA 5BMXA 4LW7A 4ZQOA 1EB3A 3L0NA 1QPRA 4WX2A 5KZEA 4DPQA 4RV8A 2UV8G 3GIYA 1YXDA 4YCPA 4TR9A 3BV4A 1B3OA 4JY9A 4O0ZA 3ATYA 3ZR4A 1VYPX 1XBZA 4O11A 1WOAA 3W3OA 4DBEA 5D04C 3GXTA 4JGDA 2DZVA 2HS6A 3G3MA 3Q58A 1IXNA 1VPXA 1JCLA 2I14A 3A9IA 4LOCA 3UZ5A 3A22A 3R13A 3EX2A 1C29A 5I3KA 4QJ1A 4Q4KA 3HO8A 1XUZA 2GJNA 3Q94A 3VFLA 1ICSA 5FEPA 2QDGA 4I7VA 3GR8A 3LBMA 3BLFA 3TFXA 1WYIA 5D2TA 2QEZA 3FS2A 2NZLA 2VXNA 4CCEA 5HWNA 2O7SA 4FB7A 4RXFA 2Y70A 3BG3A 2QCNA 4CQAA 1X1ZA 4LVFA 4M6QA 3W1UA 1WX0A 3W1MA 3NM3A 5A5WA 3OVQA 1FXPA 3W2JA 2Y7GA 1V5XA 4XKYB 4UUIA 1OFAA 3CIXA 3PC0A 5EL1A 2V2CA 1H61A 3NQ7A 4NJIA 2R94A 2OX1A 4DPPA 3P84A 1P0KA 3GDTA 1FCVA 5D2VA 1A5BA 1LRTA 5EYWA 4UMAA 3BVJA 1MEWA 3ABOA 5DBUA 4AHPA 1LRQA 3LI1A 1ICPA 4BI5A 2A6LA 4XUGA 3IIZA 4N9DA 5C5YA 2C14A 1O94A 1H5YA 5DCBA 3DFOA 1F2JA 2CLLA 1DV7A 4MY8A 4DXVA 1FWNA 3G1YA 1FUYA 2JK2A 3WK0A 5G5IA 1P5BA 1IXOA 3GVGA 1FBAA 5AC7A 3FFSA 1J5TA 1Q6RA 4NX5A 4UTMA 1GTHA 5LHEA 3HPSA 3W7EA 3PSWA 1OVDA 1T99A 1QFEA 2C3ZA 3BGJA 3EWYA 2VEMA 2ISVA 4DF0A 4O16A 5AHMA 2ISWA 3LDVA 3B0UX 2Y7FA 4GC4A 3T44A 2CWNA 5CGQA 2ALDA 2Q3RA 3L0KA 4OV9A 5F2LA 2J9XA 2QJHA 2Y85A 4Y6GA 1TRDA 4EIVA 1E51A 3TIMA 3W7IA 3TSBA 3WK1A 4O10A 5I3GA 4QNEA 2BLEA 2F84A 1LRNA 1I2QA 3WK2A 1XKYA 4AMAA 1SW3A 3HMJG 1RPXA 3N14A 5D30A 4YMZA 2CLOA 1FWWA 1KFLA 4MFEA 1CX9A 1JCYA 2HMCA 3G1SA 4GJ1A 1PL9A 1YPFA 4PC8A 3I7SA 3W7GA 3P60A 4LUJA 1X8FA 3SGUA 1H7WA 2H3BA 3TJLA 1EA0A 3PBWA 2QUTA 1VC4A 5K7JA 4OWGA 2J6XA 1W1ZA 3DFTA 4JTFA 3TW7A 4BR1A 1J2WA 2ZA3A 3I7RA 2E77A 1P4CA 1PCWA 1YYAA 2GQ8A 4UFJA 3P61A 4Z1BA 3L68A 4Z1DA 4JX5A 2NXHA 4RKAA 4BWLC 2A5HA 5GVJA 2OMAA 3B4UA 1KM3A 3G1FA 4PL1A 4JTUA 3SY5A 3NPUA 1TIMA 2E68A 1KM6A 2OT0A 4HNNA 4MY9A 4HNUA 1TPUA 1ZCOA 1NVMA 1YXCA 2X2GA 3OA3A 2A85A 1WAUA 4CCDA 3DFSA 5G1TA 3LBCA 4NNBA 5FF2A 4MKNA 4TX9A 1JUKA 2FTPA 3DI0A 5I3IA 1TPFA 2XN1A 3STGA 4O1BA 1H63A 3GDMA 3W87A 2ZRVA 5CG7A 3NVTA 2ZRWA 2VKZG 4ZQMA 2EPHA 1TTPA 1YADA 3TAOA 3M6YA 3MO7A 1WV2A 1NF7A 2VFHA 4XQ6A 3EEGA 3M5YA 3W7LA 3FYPA 4IMEA 2JGQA 3G1DA 2GVLA 4IX0A 2DZPA 3TUUA 1SZNA 3W7QA 1SR9A 1D3GA 3KVJA 3SGZA 4JEQA 3HG4A 3IGXA 3C4UA 3MBFA 3O6DA 4N4PA 4JICA 4XBSA 4S2BA 3JS3A 4BI7A 3N34A 2A2IA 2Y7EA 2QCGA 2RDWA 1SO4A 4WOQA 4K7VA 4S1FA 3EX4A 4YLWA 1DOSA 1GZGA 2D73A 3FJLA 1I8JA 3CEUA 2Y89A 3MUXA 4HPXA 4ORIA 2BZNA 1FX6A 3QMRA 2X1SA 1LOLA 5G2HA 4MY1A 4L4MA 1OK6A 3E0IA 1OJXA 1GVFA 1XFBA 3BG5A 1NFBA 2CLKA 4LV9A 3GAKA 3BGGA 1XCFA 2HS8A 2NUYA 4DO6A 3SR7A 1SSGA 3LI0A 3BW3A 3I6RA 1KLYA 1NAL1 5F1UA 4CCCA 3LRLA 1K02A 3STCA 3U6WA 1QO2A 1B57A 1XI3A 1O5KA 3S5YA 1GT8A 3S5ZA 2E09A 3KRUA 2ZYFA 5KTLA 4M19A 3ATZA 3N2MA 5F4SA 5HQEA 1TO3A 4N6FA 3R8RA 4POCA 4AWSA 4MOZA 1SO6A 1ZNNA
chains in the Genus database with same CATH superfamily
2BHZA 1FDYA 1M1BA 3O9NA 5DBTA 4AZ5A 4W87A 3W1LA 5FESA 2GVYA 4X9SA 3IV8A 2BNJA 4L80A 3OGSA 3URNA 1DJNA 3DI1A 3OGVA 1UA7A 1BRLB 4MYXA 4GGBA 1KFWA 2C19A 4HA4A 4BQ4A 1RQEA 1R9XA 1ODUA 2L5HA 4MNKA 5B7ZA 2CNCA 2D0GA 3KVKA 3WH7A 5M3WA 1Z9AA 4WSKA 1IGWA 2J47A 1VBHA 3LCHA 2ICSA 4N9EA 1UZHA 1W5MA 1C8YA 3SSZA 2BXYA 1WZKA 4FI4A 2Z1KA 3ZJ8A 4HVXA 4FHAA 2VFIA 4N2YA 4X2RA 1S5NA 1FP8A 1X6LA 2V5CA 1JPKA 2YLLA 3NZGA 5T9CE 4WUIA 4OKDA 1WZMA 4MADA 4HSOA 1KGWA 4OECA 3HPZA 4PRRA 4ZB5A 1ZP4A 2VWSA 1EFZA 4QNWA 1WKDA 3QV7A 1FWTA 2F6XA 1D9EA 4FNPA 1KFBA 4MM1A 1K9FA 2J75A 2RH9A 2FJUB 3M0ZA 5KMYA 1P0DA 4O1AA 2V3FA 3BLPX 1B9BA 1UUMA 3MYOA 3W7DA 1XW8A 5DCEA 1AK5A 1IT7A 5CLWA 1XBYA 3CC1A 4V27A 1ICQA 1RQHA 4HNTA 2HROA 2ON3A 1OK4A 2H90A 3O16A 2Y8UA 2HPMA 1D2KA 3V1PA 2FZ9A 3QPYA 3TQKA 3EOLA 1XQLA 1U5HA 6TIMA 4HHMA 3P8IA 1HF6A 1HGWA 2Y5EA 4KT2A 4DZHA 5C2XA 1TTIA 1U5JA 4NZ3A 1H5VA 1E9YB 3W1XA 2CLMA 3MA8A 2R6OA 4Q8QA 1WO2A 4K6AA 3H7UA 3HV8A 2FVLA 3AIWA 3W00A 2FHCA 3CASA 4UFHA 5HANA 3AWOA 1UP3A 2XUCA 3WUGA 5A2AA 1KM1A 2QPUA 1SJCA 2OODA 3TROA 3HFTA 5AY7A 1VFHA 4KETA 2AL2B 5FL1A 4W5UA 3SRHA 2ZWYA 3PBYA 2GGHA 3WELA 1RUSA 3L5MA 4U3AA 4E3VA 1QCWA 1U22A 1RR2A 5HA7A 4YCOA 4GQ0A 3RU6A 2WB5A 1KM0A 2W61A 2Z25A 1A5MC 5IBXA 3TTSA 4DNHA 3LN3A 4C6EA 1J10A 2VEGA 2E9LA 4HJFA 1DXFA 5I3HA 3NIYA 1OYCA 5HAOA 1J0ZA 3JR2A 3OZPA 4AY1A 3BOLA 3KTSA 2V8ZA 1C8VA 4REQB 3W83A 4XZHA 1B90A 4QE1A 4P8UA 3L4XA 2I1OA 2YSWA 4OUEA 4ADUA 5IFTA 1XKJA 2IXUA 2YPIA 4K8HA 3WF0A 3F4VA 1AW5A 4DYKA 1M7XA 2C71A 6TAAA 1GWJA 1LROA 2IQTA 1RBLA 2GSJA 3CUZA 5DCDA 1VFTA 1H0IA 4PUKA 2DT0A 2DZBA 3W1RA 1XYAA 1O5QA 1R3YA 1X7FA 4WY0F 2ZUSA 3BLLA 1CDGA 5DEZA 1I2PA 3M46A 3E02A 3MP5A 4GJIA 2XFWA 1NP2A 4HPJA 4WD0A 4O4VA 5HMFA 4J35A 4JIIX 1H41A 1QO5A 1M65A 2V5BA 1EC9A 1I9CB 2Z24A 1EX5A 5CGTA 1X7IA 1J0HA 4DUWA 3DYMA 4NYUA 1JI1A 1Q7QA 1TVPA 2HPIA 1XDLA 4AIEA 4JR5A 2VOTA 3VDBA 1JAEA 3UA4A 4DWSC 1XJBA 4HOZA 4IMDA 1ELSA 3RX3A 2IPWA 5CJMA 3A5FA 1R86A 4C6NA 1PPIA 3T2PA 3O63A 1VFOA 2G5WA 1JPDX 1V03A 1Q6QA 3PJWA 4Q8UA 2OFJA 2PTXA 4PZVA 4NY2A 5E0CA 1TB3A 4KEMA 5AC4A 4LQ1A 3PZ9A 1MXSA 3ZS4A 2ZE3A 3BAJA 3H24A 5K3VA 2CFFA 4C6DA 2Y61A 1YBQA 5F2GA 4CQCA 2ZRXA 3LB0A 4GH3A 1OG0A 1KCLA 3VIPA 1DIOA 2QV5A 3FEMA 1AW1A 3VE9A 4BFAA 1YKWA 4X0NA 1E9ZB 2QS8A 4RNIA 4M6UA 3HQNA 3GNNA 2VRJA 2WSRA 4O28A 4PUEA 1VFFA 3PS7A 1I2RA 1YEYA 4HSNA 2OWXA 4PODA 4GFIA 3HJZA 4IIGA 1J01A 5IXEA 4QGCA 1BKSA 1SFJA 1RCOB 2HE5A 1M9HA 3SB0A 3W88A 4V1XA 1GVRA 1YXYA 4N9BA 3UERA 3PVFA 4XD4A 1U30A 1GVQA 4ZO8A 3SN4A 1EPXA 2QF8A 5G2IA 2YOCA 3WQ8A 1IR1A 3HU7A 4OT7A 1V93A 2FHBA 7TAAA 4MGGA 1HUVA 1LL6A 2Y8KA 1HJVA 3W1TA 3QPEA 1ZENA 5ECUA 3ALFA 3FHAA 1C93A 2VWTA 3EXRA 3GTFA 4YVPA 3A13A 1WDPA 2DFAA 3NZQA 1MEHA 1KQZA 3XIMA 4C1NA 2PA6A 2GUYA 4G1NA 5HJXA 3IEBA 3F5KA 2X1TA 3AI0A 3G8EA 3LV6A 3IAPA 1E9LA 5HBFA 1R46A 2PBOA 4AX7A 3C2VA 3KAOA 1EP1A 1QU4A 3G24A 4ASTA 2XGZA 2WCAA 2OELA 2OU4A 3ZR5A 2GUUA 2VZTA 2DQWA 3M0XA 3KWXA 1H1NA 3AAMA 2EAWA 2WYSA 4DYEA 3S46A 2FH6A 4C7GA 2ZRZA 3CTLA 4AY8A 4Q32A 2VURA 5K9XA 1IR2A 2VFEA 3GNRA 3OEXA 2ZRYA 4J27A 3L9CA 2RJGA 5LNUA 1OFQA 2J8GA 5G2WA 4NQ1A 1DQWA 3KW3A 1AH0A 2ZBTA 3PZNA 3SY8A 4ATDA 5I3FA 4PCFA 3NO1A 4MZ1A 3OHIA 1YTKA 3O0FA 2E1DA 1FWGC 3IS4A 4LAMA 3D6NA 4LXFA 5C55A 1FDZA 3GB6A 2CW6A 3UCQA 4DF1A 4P7QA 1J79A 4MNMA 2NQZA 3W2NA 3S2LA 5I78A 3A47A 1XRSA 3T81A 1XPGA 2HEJA 4HHHA 1EXBA 5CGMA 5D9PA 1EJWC 1P0NA 4DWSA 1NQKA 3NSXA 4V1YA 3QZAA 3NXFA 1F6KA 3RM9A 3B05A 3NUKA 4OZOA 3MVTA 3N2XA 1JCNA 2Z0IA 2JE8A 1SGJA 5FIPA 5CCZA 4UC5A 5D33A 3FX4A 1LT8A 2J7FA 2J8TA 3ARZA 4FOUA 4WZHA 2XINA 5BXRA 2J66A 4JY8A 3EDKA 4MJMA 1FCQA 2J7BA 1EUAA 3NEVA 3GZAA 2RDTA 1ZBVA 4GXWA 1K7FA 6CGTA 1OWQA 1RLDA 3MSGA 4F66A 4G6CA 3H6OA 2FGZA 4NZ4A 2FGLA 1CXLA 3WQVA 3INPA 3HOJA 4PMVA 4CU8A 3TE9A 1FXQA 3WQOA 4M7TA 4Q4MA 4WDWA 3GO2A 1E0XA 1K9DA 1PIGA 1JYWA 2FMNA 4NAFA 3W07A 3I65A 2QZRA 2PS2A 3FY1A 4J40A 4ROQA 3BPWA 1IF2A 3NCOA 2QAFA 3DHFA 4LU0A 4CNNA 3IVUA 4MKSA 2OEJA 2YW4A 3WQDA 3TCSA 3BOFA 1TMQA 2V63A 1PVNA 5RUBA 3I4EA 2YB4A 1K9EA 3EX3A 1A5CA 4GXMA 3GXMA 2X2YA 1P7TB 1Q13A 3BLDA 4Q4QA 3NYDA 3VNIA 3UWQA 1POKA 4GUIA 5E93A 1AH4A 3W7OA 1FHVA 3RJYA 4B91A 3QYSA 1R3SA 1WXYA 3W1PA 3GG7A 4H8UA 5DY2A 1Q4NX 3WLOA 3QW3A 1EDQA 1V3MA 1H60A 2XIIA 5BZAA 1NOUA 2VELA 5HNRA 1E4IA 3B9AA 4IL2A 3MZNA 1EXPA 2VD9A 3A24A 3ZT6A 3EXTA 3S1XA 1X39A 1CCWB 4S3FA 1TPDA 3DZ1A 1X1OA 3AOFA 3LQGA 2XIBA 4ZGYA 2XU2A 4O17A 3M5VA 4P7RA 2ATSA 3QHOA 5G4WA 4CNTA 3BO9A 5J5DA 1Q6CA 2OZ0A 4JQAA 3DX5A 1V6XA 1NH6A 5LNSA 4GYPC 5IBXC 2J7HA 4GHRA 5FSDC 1PTDA 3LK6A 3TR2A 1GOQA 4ACZB 2X42A 1KD0A 2BGQA 4NRRA 3ABSA 1A5LC 2W9MA 2VO5A 2PCEA 3BCFA 4EPBC 2Y5JA 1JCMP 1KR1A 3C0JA 3MT1A 2FFIA 1UZ4A 4HZ7A 2P88A 4HZMA 3W2LA 5CBIA 1A0EA 2P8BA 2EPMX 3I7QA 2E9MA 2XH2A 3PUEA 1E0UA 4LVAA 4CD4A 2WVTA 3OZOA 3E96A 4TMCA 3ZVIA 5LGZA 1WQ5A 3SW6A 1BXCA 3MWCA 3PK7A 3DCPA 3WD1A 1EIXA 3Q67A 1KBJA 4Z2HA 1ZP3A 2WC3A 3LLXA 1P6BA 4YWSA 4JKKA 4L6DA 1MQPA 4WVXA 1F74A 3AQUA 1NF0A 5BROA 1S2WA 3QKZA 5DX7A 2VX7A 2C1IA 4M6VA 5HOSA 4FO4A 4C7DA 2PP1A 2NSOA 1GW1A 4UOJA 2X7WA 1VIWA 3H8AA 4Q4SA 3U2EA 3T42A 2YA2A 2F61A 3TQ0A 3A9BA 5D03A 2V5LA 3LUTA 4P7OA 4PB4A 1TWDA 1TV3A 1PTGA 1V02A 3UWVA 3LX9A 4HNOA 3SUWA 4TIMA 4DNMA 2DP3A 4Z1CA 1K70A 4Z1YA 3IJDA 2C1HA 3RILA 3E12A 4PUDA 5KSWA 4BQ3A 2OG9A 1ISVA 4IPNB 3TN3A 3ITXA 3ZZ1A 4QSHA 2GVGA 3VCRA 3RPDA 4PUJA 4K36A 5GQBA 1EBHA 2J13A 2NQLA 4E2DA 1O6IA 2VC6A 1V8EA 3KM8A 2DQXA 2AMGA 2GWGA 1W9VA 3WQ4A 5LA1A 2D23A 1PDZA 2FGBA 3QV6A 4PUWA 3UNTA 5EY5A 3ZO9A 4RZ6A 2NXIA 3WBWA 1L6FA 2WNWA 4R34A 3G8RA 3LSCA 1U1UA 4LNYA 1M5WA 4JHOA 1IIGA 2XIMA 4OQVA 4XO6A 1GOXA 1W2PA 3MY9A 2YCLB 2WKGA 5CC7A 3H7VA 4LCRA 3DFQA 3LGGA 3CB3A 5A2CA 2CZFA 4B2DD 1ZALA 3CPRA 1MYRA 4RZBA 4GI6A 3KFTA 4ERAA 2E5BA 4Q6JA 4MJZA 2BTMA 1GYMA 4HMCA 1HL9A 1VEMA 3UWZA 1ZJBA 2C13A 3F03K 1TMLA 3GFXA 2ZVIA 3ID7A 3FDGA 4ZSUA 3TXVA 2J9ZA 3QMTA 3RM8A 2NV9A 3VGEA 1NWSA 1A3XA 3GH5A 3ARUA 5K4XA 3OG3A 5IRPA 1CIUA 1EBGA 1JIBA 1DJYA 1AZ2A 3EX6A 4QDPA 3W6YA 4JS3A 4CU7A 2WM1A 4BQ2A 4AF0B 3LCFA 3G0XA 8CGTA 5BCAA 1KBIA 1ZBWA 3EMQA 2EEXA 1TV2A 1ME8A 3U3HA 1O5XA 4QP0A 1SM9A 2YZRA 3ZR6A 2CCRA 4XZNX 4IMCA 3N15A 2Y2WA 1W9UA 1VKFA 2J8FA 1BRLA 2FLIA 4OFCA 1XIFA 4XTDA 3DU0A 5ABHA 3DGBA 4IFOA 2JFEX 4F2UA 2PTDA 1XG4A 5AHEA 3HQ1A 1J4EA 2JIWA 2REQA 2EO7A 4MVAA 3LM7A 2CEQA 1TV7A 2GJLA 2OOGA 1RJRA 4UBPC 5E6YA 3S1WA 2E67A 2W66A 3PUDA 4K1GA 4UFMA 4I9JA 2CLFA 1UQYA 4UR7A 2NLYA 1S39A 3TP4A 1EJRC 4PMXA 2WQPA 4QHRA 1G67A 2YCJA 5LIXX 2ZUTA 4IGHA 2HVNA 5CSRA 2O7QA 4B90A 3SQMA 1MI3A 3CAVA 4H6EA 2Y0FA 1OYAA 1QW8A 3QQWA 1KCZA 4FIRA 4IFKB 4GQGA 3AU2A 2D2GA 2WSPA 3OIXA 2CBJA 4KWOA 3WZ0E 8XIMA 4D6EA 4QLLA 3W74A 4HNVA 2YL9A 4FMVA 4GUHA 4JFWA 1E6SM 4LBRA 3VYLA 3TW6A 2J24A 1AODA 2BWGA 2CC0A 3UPWA 2C6QA 4MWAA 2PGWA 2IPJA 1OX4B 3S2CA 1UZDA 3ERPA 4UQDA 3UZJA 1W3KA 2NSXA 3ZSSA 4PMNA 3W23A 1FWFC 4IF2A 2QJIA 2DZAA 3HF3A 4TXEA 3KRZA 4NUWA 4OBTA 4CU6A 2VVSA 1AJ2A 1OFRA 3ARSA 3VIKA 4WOZA 3WNLA 4RXGA 1U1JA 1R0MA 4S3BA 4S39A 4JN7A 3R89A 4C6OA 3A5VA 2V3GA 5DN1A 5K2ZA 3NVDA 1B54A 1WZLA 1OFPA 4BI6A 1A4LA 4F2BA 4IQJA 3IPWA 4Q7IA 1K77A 3QZEA 2DEPA 2VC5A 2OOFA 3TA6A 3AHYA 4G7EB 5FI8A 1B2YA 4W7VA 2PF8A 2WBKA 3M9YA 1ZJHA 3S2NA 4JTIA 1TMHA 1CGTA 1JQXA 3PZVA 4LYRA 1NSJA 3SRFA 2PDHA 2JF7A 4QJ3B 4HYRA 1PHQA 1RP9A 3TK7A 1FFRA 4CNOA 3ZJ7A 3O1NA 4FX7A 2V9DA 1NDYA 1WKFA 1A3HA 5A6MA 1DP0A 3BDKA 4AB4A 4XZ9A 3PB2A 5FJRA 4QE4A 4GI9A 1LCOA 3LHVA 4R3UA 1B3XA 3PN8A 4FEZA 1ADOA 2BS9A 1RK6A 1FWBC 3CV1A 1NM9A 2P1FA 4NJHA 2WWCA 3VKJA 1KFJA 3H2FA 1AQ0A 3RLHA 2CIPA 3N9SA 4G7FA 3TTOA 1W1A1 5DELA 3H4GA 3G1VA 3PTQA 1EIBA 3VOJA 4F8XA 3MCMA 4JTGA 1W32A 4E4FA 1DBTA 4A8NA 1DXIA 3GDLA 3G3DA 2E40A 4EPKA 1FFQA 3ANUA 2A6NA 1V7AA 3S1UA 2V2DA 5EMUA 5CEWA 1F6YA 1TCDA 2WVSA 2ZXDA 4DBUA 2SFPA 3BSGA 3AICA 1S38A 1C92A 3LV5A 1XH0A 3UJSA 3O6AA 5B7YA 1CECA 2WAGA 1G6CA 2A1YA 2QMJA 3GVQA 4YPJA 4XD3A 2O55A 5FOOA 4MJ4A 5HWJA 1BQGA 3DH7A 4ILSA 2P0OA 3T0BA 3L4WA 3MW7A 3KOFA 2OSWA 4IGSA 4KWVA 2XGIA 1D8WA 3W7NA 2WKJA 2AL2A 2ISFA 2PD5A 1WBJA 4LBUA 4OV4A 7TIMA 1PHWA 1XYBA 2JEPA 1ZRQA 4O52A 4B9YA 2ZZ5A 3IUHA 1I6NA 3TYDA 4ZO6A 3NL2A 3H26A 5F4WA 2VI0A 3BWWA 2XIOA 4CEXC 4GIAA 4EAYA 3PJXA 3C52A 1L2UA 4B4FA 3FJ6A 3VM7A 1K8XA 1R85A 3TC7A 4HMNA 3N4FA 1JUEA 3GHUA 1GZ1A 2Z1XA 2NXGA 5BMXA 4ZQOA 1CYGA 1QPRA 2PZ0A 1YXDA 2ONEA 4YCPA 4V33A 1ZU8A 1B3OA 4HNLA 2YL8A 4O11A 4XD6A 4K2SA 4L1GA 2ZICA 4G7EA 3N2CA 4E4UA 3DYPA 3GXTA 4JGDA 3N17A 5XIMA 1ITQA 2DZVA 4Q8NA 1IXNA 2XFRA 4LOCA 1XUZA 3WD0A 3PZTA 5H8PA 1MUWA 4I7VA 2QNEA 2YCKX 5MKGB 3TFXA 3KBWA 2QEZA 1XLGA 3AS3A 2NZLA 4XZWA 5BRQA 4PN2A 4CCEA 3EDJA 4RXFA 1UKPA 3EB3A 2BG5A 1X96A 2G3FA 4R27A 1YDYA 3E5BA 2HDJA 3AXXA 2Y7GA 1MFVA 4XKYB 4E4PA 3RG6A 1OD0A 1VPYA 3EB4A 4JIRA 3CPUA 1RAKA 1TV4A 4BF5A 3GDTA 2INFA 5EYWA 3VGGA 5A6AA 4UMAA 1MEWA 1NWTA 3CJPA 1T5AA 3PPCA 1XDJA 4XUGA 4N9DA 3WX7A 3KOZA 2XTKA 4AQLA 1G01A 2AKZA 5DCBA 3DFOA 4XIAA 1RALA 4LUSB 4DXVA 3N2BA 1J2BA 3RX2A 3PTDA 3BAWA 4LX4A 1FUYA 2PLCA 1BYCA 2Z29A 1P5BA 1IXOA 1FBAA 2F8QA 3WCZA 4G5DA 4OOUA 1W9PA 5LXXA 5LHEA 3EWYA 3BGJA 2REQB 2VEMA 3VDAA 2ISVA 2HE8A 5AHMA 3PBGA 4Y9NA 4B15A 1XX1A 2MANA 5A69A 2R1PA 1YMYA 1VBUA 4Q4RA 4OV9A 3MQTA 3CAWA 5CBBA 1PSCA 3PZIA 4EIVA 2VDGA 1E51A 4AD0A 2VCBA 4O10A 2QUMA 1LRNA 1I2QA 3WK2A 1LQ0A 2ZX9A 1XKYA 2I17A 2IPFA 1X6NA 3LS9A 1IEVA 4EK7A 1RPXA 3B8IA 4D6JA 1KFLA 4GKLA 1CX9A 1PL9A 3PNUA 3W6MA 3W7GA 4ZTXA 4RDZA 3P60A 3UR5A 4D1JA 3ZLHA 1B3YA 3TJLA 3WEOA 2GK1A 4XV0A 3PBWA 1UHVA 2QUTA 1XIDA 2J6XA 3DFTA 2PDUA 4KF1A 1J2WA 1JF6A 2E77A 2Z7KA 1YYAA 2GQ8A 4Z1BA 3P61A 1H49A 2NVCA 4A4AA 2A5HA 2HNHA 2VJXA 5FD0A 4QXIA 4PL1A 4JTUA 1OIMA 1KM6A 4HNNA 3RYSA 1KRMA 3FSTA 1JZ6A 2GZXA 1PX8A 2A85A 3OA3A 4CQBA 3VGDA 3RO6A 2VM8A 1J0IA 4CCDA 3WH5A 3ORWA 5D4YA 5G1TA 2GLKA 2ADAA 2JALA 3HPAA 3M07A 5FF2A 4MB5A 2CXEA 4GMEA 4TX9A 3ARTA 3DI0A 2G0WA 1B5TA 2WLYA 1PWLA 3GDMA 3W87A 1FH8A 5CG7A 4CN4A 3NVTA 2AL1A 1TTPA 1YADA 4P5UA 1XGDA 4A8RA 5CXPA 3H21A 2VFHA 3EEGA 3FYPA 4IMEA 2JGQA 3G1DA 3A64A 4IX0A 4IMAA 4A6GA 2DZPA 1SZNA 3W7QA 3KVJA 3AYTA 3EDDA 1UWIA 2QLYA 4DJDA 3IGXA 2X05A 3C86A 4B5WA 3O6DA 4N4PA 2E25A 3VD4A 2DT1A 4B5VA 1FHDA 4F9JA 5AKQA 4C6FA 2Y7EA 4IP7A 2QCGA 4WOQA 4K7VA 4S1FA 3QR3A 1PTAA 1PZ2A 5AZ0A 3WQCA 1DOSA 1GZGA 4KWSA 3EA3A 4F40A 2PLKA 3MUXA 2BZNA 3WNOA 1NTHA 4S3JA 1LOLA 5AECA 1OK6A 3UWEA 3GS6A 1BYDA 4XBJA 1XCFA 2NUYA 4GXPA 3FV9A 3E0LA 3BW3A 3H70A 5EMYA 4LAKA 2G8ZA 3AMKA 3KP0A 4CCCA 3LRLA 1J5SA 3STCA 3U6WA 1XD1A 1XI3A 3S5YA 1BVWA 1GT8A 3TYCA 4PMZA 4AUBA 1IWBA 3UVIA 3R58A 2QMKA 4M19A 3K46A 4F48A 7CGTA 1Q66A 1DTNA 5HQEA 1NARA 4AWSA 1SO6A 3U0HA 1ZNNA 2I16A 3VNLA 2A7NA 3PZMA 1PKMA 2QCEA 1UMYA 2OQHA 2XIJA 1UBSA 4PUNA 2R1LA 3S6TA 4C6QA 4GUFA 1GONA 3PR2A 3IVTA 1OG6A 3ITTA 3CLWA 1YNPA 3FK4A 4JZ5A 3M0KA 2QCCA 1MZHA 1DIKA 3DESA 1PB0A 1PDYA 3SCPA 4NAEB 2P3EA 1A5OC 1OBAA 3VUSA 3TV8A 1H7OA 3ISIX 2BDQA 3L4ZA 1KBLA 2GJXA 3KZPA 4K8EA 1JZ8A 4R53A 1DHKA 1PKNA 4HK5A 3VDHA 2OEMA 4ZE5A 4IJCA 1J8VA 2FJKA 3TU9A 5CKSA 3HMCA 2VEPA 1W91A 5XIAA 1XYZA 4EAMA 3ZT5A 2BASA 4JD4A 4WHBA 4IIDA 3ARVA 3GU1A 3PTMA 2A3LA 2X0YA 2RGMA 1UPMB 3W70A 1V6TA 5M1TA 1JVNA 4EP8C 1FWIC 1PKLA 4E5TA 4F0MA 2VEKA 2CU0A 3VZYA 1WP6A 4WRHA 3CTTA 3GR4A 3L2LA 3DAQA 3VIIA 3LTSA 3EKLA 1A5AA 3EKGA 2ZC1A 1XC4A 3T7VA 4TX6A 5CPTA 4BKNA 3ALGA 4V28A 3TKFA 3TYZA 1DE5A 1F9CA 1Z48A 3KX6A 1EX1A 3QN3A 4QBXA 2BX7A 2ZUWA 2Y5SA 1KM5A 2WW5A 2V3DA 5ABGA 1ZAHA 4NT0A 4FR6A 4PMYA 3BMWA 2AQVA 4IHCA 5FEWA 3LHUA 4AEFA 3BQ6A 1F76A 2WHKA 4L64A 1X1NA 2WMFA 5C9XA 2YCEA 1V3IA 2Y6ZA 1V6VA 5EU9A 3WLLA 1LQ2A 4ZOEA 3WJXA 1R6WA 2JQXA 4LVBA 3DKJA 1GKPA 3STEA 3UYCA 3WF2A 1HJWA 4JTEA 3CQ0A 2W91A 2QW5A 3VC6A 3MJYA 4HGXA 3PJTA 3CWOX 4JKLA 5CJ5A 3APTA 3NM1A 1EH9A 3UBPC 2FQIA 3UXIA 4A2RA 2YIHA 5HR6A 2QHAA 3M44A 1H0GA 2TSYA 4HN8A 3VOHA 3T6CA 3VMPA 3WQFA 3V5OA 2UBPC 2QPSA 2RJHA 4JX6A 2I9EA 4DELA 3NJ3A 1MUMA 8TIMA 2R14A 1HO4A 2PBGA 2PTWA 3T55A 1IGSA 2VFGA 1PWMA 2GGEA 3OVGA 4U28A 1TQXA 3B8DA 4UMBA 3DUGA 4S3EA 4FNSA 2EQDA 2QULA 3GXIA 3E6EA 5CPNA 5J5RA 5CSSA 3KTXA 1A5KC 2ZIDA 2A3HA 3M5ZA 4I7WA 1XYFA 3LGEA 2D1ZA 2NW0A 1FH7A 2A79A 1Q7ZA 4U33A 4AHQA 3NFUA 3N3MA 5H6HA 1DYSA 1LG1A 4DJEC 2G96A 3VNJA 2WJEA 4AZBA 4AZ6A 1BYAA 3KUMA 4PGLA 4O50A 2YGYA 2OSYA 3DFNA 1Q6OA 2WJZA 4BCEA 3HGOA 2WK2A 4DJED 1Z41A 3NZPA 2PE4A 4EWND 3O2LA 2JKPA 4CCZA 1Q5MA 4DUOA 2INEA 1IWPA 4JYFA 3STPA 1C91A 2XYLA 4XZIA 1Z32X 3CL6A 4RUBA 4QG9A 4AMCA 4DXKA 4HU0A 1U83A 1LWIA 3RMEA 1QI0A 4UTUA 1A3WA 3F1QA 1LQAA 4AXKA 5KETA 1FCUA 5TQLA 5KINA 5AC8A 5EMKA 1LOSA 4NILA 3CHEA 1DPMA 1ZTVA 1T8QA 1GJPA 1JPIA 1SW7A 4FNTA 1M7PA 2PLJA 5CZ0A 4K39A 3WD2A 1REQB 4JOMA 1LOQA 4JQ4A 2W0UA 2HWGA 2NV2A 1L0PA 1TZ7A 1TREA 3I10A 2IUZA 2ZA1A 3IVSA 3WQ5A 1HXJA 3OLDA 3LNMA 4HU8A 3HG3A 2ZZ7A 4PFHA 4FXJA 4JTQA 3ZSTA 2D3NA 4AWUA 2VCAA 4CQ8A 1LLWA 3NGJA 1U1HA 3QC0A 4ZENA 1VF8A 3DDMA 3H4WA 2IQ0A 4WLCA 2W6RA 5JVLA 4E0CA 3W75A 5LGXA 5E0KA 1I2OA 1PIIA 3L5AA 1AL7A 3OQEA 5K4ZA 4AYSA 1NDVA 4HZ8A 1FY6A 3BMVA 4WKFA 2GVJA 3W4RA 3ZXWA 2BP1A 3KVLA 1GKRA 2XVGA 2WPGA 2EJ1A 4MIMA 3TTQA 2AKMA 1KFKA 1AH3A 1NJJA 1S2AA 1B3VA 1PX4A 5DMYA 1E55A 3GVVA 3VE7A 4XBKA 5A8GA 4H9UA 3DENA 2BY3A 1B30A 2GK1B 4LNCA 2O4MA 3GG1A 2PEVA 5D02A 4H4IA 3FYYA 5D2XA 4ADSA 2QCLA 2XH0A 2QDEA 3SRDA 4IGMA 1GYLA 1UR9A 4L9YA 1E56A 1WUEA 3B8TA 3VD3A 1UR0A 3USZA 3THAA 2PDQA 5LA2A 3IV3A 3IIVA 3TCEA 2OZ8A 4QQUA 2DUXA 4ZB0A 3RCNA 2PGFA 1LWHA 4KEVA 1NDZA 4DWDA 4AY7A 3FLUA 4AWEA 4C6BA 3H55A 1MW3A 3E38A 3W73A 4W84A 3LXBA 1BXNA 1KGXA 4RR4A 3CUJA 3HGSA 4MKVA 1QASA 3N6QA 2Z2AA 3RUBL 3W76A 2OZTA 3L2IA 4FLOA 2PFHA 1QI5A 1EQPA 4GQQA 3P82A 1TPB1 1AZ1A 3MV11 5BYWA 4YTRA 5BNKA 3FXYA 6XIMA 1KLZA 1ONEA 1HG3A 3UZYA 3BC9A 2H3DA 3HPXA 1V0KA 2VOMA 2P5NA 3M0MA 9CGTA 5D9NA 3PZOA 4BY3A 1IXPA 4GC3A 4WJXA 3FN9A 4EE9A 5EBAA 3F4DA 1Z8AA 4DYJA 3UWUA 5ECVA 4QIUA 3VA8A 3VPLA 5DF0A 4GH1A 4DI8A 4INFA 1ZQ5A 4LJ3A 4HYWA 3ELFA 1WPCA 2VR4A 3EPMA 3C0QA 5GJMA 4D6HA 1N2VA 3SUVA 2OWWA 3M5XA 3DFPA 3R7MA 4DLFA 4F0SA 1LF1A 3U2OA 4JTLA 3P62A 3S3GA 2XSXA 4OBRA 1J12A 2PDKA 4Q8TA 1XCWA 1E5NA 4O13A 1ME7A 3G0SA 3TYBA 2JKAA 5TAOA 1UKTA 3L21A 1FQ0A 5FF3A 2Z2UA 1IT8A 2XN2A 3CYVA 3CNYA 2J7GA 4F9DA 4LVGA 4E8CA 1FWAC 1VIZA 3KOYA 1A0CA 4UR8A 3VGBA 4RZ4A 3EWBX 1DJIA 3W22A 4M1RA 4Y9OA 3GTXA 3ARWA 4HPNA 1HJSA 1DKWA 1E6ZA 1TX2A 3OYZA 2E3ZA 1ZHAA 3REQA 4DO5A 3RR1A 3GAYA 3G1XA 4LEFA 4RNJA 4RL3A 2OZ3A 2VQTA 1OGBA 1NELA 3AS0A 3BG9A 5KITA 3M43A 4H6KA 3BLIA 2Q01A 3NA8A 3ABXA 5EFFA 2XFYA 6XIAA 3ITLA 2VD8A 4JTAA 2ACQA 3NG3A 3LNPA 1DJGA 3W1AA 4RZ5A 4GKTA 3CUHA 2ZUUA 3IJ9A 1VCGA 1FP9A 4H00A 3U4FA 1DWGM 3Q45A 2ZZ4A 5LNRA 1J0KA 3WD4A 3IRSA 3LCXA 1JFXA 4HU4A 3UVAA 5I6SA 3MI2A 1RJPA 4FPSA 5CPMA 3M7WA 5G4HC 2VQUA 5CC5A 3OOQA 4DI9A 1WZAA 1CGYA 2Q8ZA 4J9JA 1O12A 2DZTA 1IEWA 3HJEA 3RX4A 4PULA 5ABFA 4NI8A 1MZRA 3KWSA 3RAOA 5EKYA 1KBKA 4TQTA 3N9RA 5KZDA 4JYEA 1S3HA 3HG2A 3C2EA 3T0AA 4MLJA 3SGGA 2HZGA 1F3WA 1M53A 3UXDA 4ML9A 1SQ7A 4LRSA 2TMDA 1FWSA 3WH9A 5AOUA 1LL4A 1FHUA 3EB2A 3W9ZA 3JVAA 2XWDA 1BWKA 1DHPA 4DVOA 3NL6A 3PULA 3LCWA 3TJIA 4FK9A 4IL0A 3S0CA 4RE0A 4S3KA 4WDTA 3B40A 3L67A 2ALRA 1VD6A 4G56A 3K8MA 1S5VA 5C6MA 1Y5VA 6ALDA 5C9RA 3C2RA 4FOKA 2C91A 4YXGA 1N8FA 3AYSA 4R88A 1F8MA 1WDRA 2VUYA 2IPGA 1HL8A 4FXRA 4MZYA 4E2BA 2FZDA 4OE7A 2W62A 4NRSA 5E70A 2GFTA 1CXKA 2GL5A 3T0TA 3G22A 5AHNA 5C2CA 1E1CA 3I6TA 3WSUA 1DWHM 4ZODA 3KHDA 4DEFA 2D69A 1DWIM 1PS9A 2ZDRA 1XLJA 3TJXA 3BLOA 4BS0A 5AYZA 3P5ZA 4NJJA 9RUBA 1DIDA 4HK7A 1DJZA 1YPXA 3GXNA 1UD5A 4JTHA 5KEZA 2DPEA 3WBAA 3IANA 3SY1A 3UPMA 1JZ5A 5AZ1A 4L4PA 3QTGA 3IIPA 2X7VA 3EX1A 3QRHA 3CWHA 2BVWA 3NQDA 3H2CA 3Q37A 4DM2A 1QPOA 3NZ1A 4ORMA 1R3TA 4F79A 5D8ZA 4TV6A 4UTHA 2TRSA 1UWUA 1AQMA 5AYYA 1A4MA 5BXTA 3TN4A 4U31A 1KRCC 3CV2A 3BAKA 1G7UA 3A4WA 4FNUA 3WMBA 3TC6A 2Z1BA 2CPUA 3PZUA 4GI4A 4LALA 1TG7A 3OHMB 3UNDA 5FEXA 1G1YA 1LP6A 3LHYA 5D37A 3SUUA 3QSTA 4TUFA 2R82A 1QNSA 1GHRA 2DJLA 2A4AA 1P48A 1R3VA 4DO4A 1DJXA 3DHPA 2YXGA 3QZ6A 3B9NA 4B92A 5HXMA 4EOUA 2XN0A 2QF7A 5DQPA 2XIQA 2ABBA 1XRVA 3GFYA 2DJXA 3WDJA 3WN6A 5HJLA 1WE5A 2RGLA 3LOTA 1V0MA 2O4QA 1XLLA 4JTSA 4S38A 3W01A 3PBVA 5HMEA 4ZQRA 4DRSA 2QGYA 1JDAA 3RGTA 1IEIA 4KWWA 1EWDA 2EG6A 4O0KA 4YYCA 5FJPA 4I5XA 3M7SA 2VGBA 3TLLA 3K5XA 1JDEA 3T78A 1VR6A 1W1IE 4C6KA 4FP1A 3PP7A 1Q6GA 1TV8A 2GDVA 1TE1A 2QPXA 4GIEA 1XUUA 4A3HA 3T05A 2D22A 4JKMA 2VDIA 2E5CA 1F3TA 1NFGA 1FKWA 5CH9A 1K8ZA 2PWGA 3D0CA 4MSSA 2H8ZA 3C0LA 4I8DA 1NEYA 1UD8A 3GC5A 3WLTA 3TNBA 4UIOA 3W7RA 4PYSA 3IAQA 1Q6FA 3IGHX 1EKOA 1W56A 3GTIA 4KIRA 1NOWA 2EG8A 3SZ8A 1VFUA 3MS8A 3GK0A 4W8BA 2NUWA 3NPVA 1ZB5A 1UCWA 2E9BA 4QTGA 3B0XA 8RUCA 3QSRA 2HVOA 1Q7MA 1E6PA 4HCDA 3TJ4A 3UWWA 2QJMA 4U3CA 4GQBA 1ZBKA 3BLKA 2NX3A 3N18A 3IJ8A 4DX3A 1Q65A 1OCBA 4Y96A 1KTBA 3DG6A 1HKVA 1ZJIA 2DV0A 2UY2A 5F7UA 2D2JA 3FEQA 3L23A 3UY7A 5FAJA 3ICJA 4K68A 4QS5A 1QRQA 3QR0A 3ONCA 1W5NA 5IDIA 1J96A 1W3JA 2H9AB 1ENUA 2YFOA 4LTSA 4GI8A 2IXVA 1ME9A 3E0VA 4W86A 5E9AA 3K8LA 3MWAA 2V38A 3KDNA 2DZXA 3WQPA 2PDWA 1UW9A 4H04A 2J7EA 2GQ9A 4YS1A 1HFBA 3VCNA 5JIWA 2Y7DA 3VNDA 1EJSC 2BXVA 3MANA 3K4DA 3LCLA 2WNZA 3F2BA 3MUY1 3IIXA 4ZO7A 1ADDA 3KOXA 2XDFA 3R94A 5EFDA 2ZTKA 3K1GA 3P93A 4BF9A 3F2CA 1VHCA 4NZJA 3VXGA 5I5RA 4E3TA 2F2HA 4QR6A 4NKCA 4ZA0A 1VS1A 1HKJA 3UP8A 4HNCA 3WLRA 3QY6A 2RFGA 4BWLA 4IWWA 3AMDA 4IMFA 3U5YA 3QHMA 2INZA 4UFKA 2FZMA 4ZQCA 4IXXA 2Q09A 1MSSA 4NYYA 1J0YA 3F2DA 4Z1AA 4US5A 1CXIA 1UIOA 5BMWA 3H12A 1I2NA 4UTJA 5GJPA 1LORA 4YTUA 4PTNA 3CZEA 1NY1A 1JZ2A 3C6CA 3A3HA 4UCFA 3CIWA 1GW9A 2D20A 2GSEA 3LSBA 4O8AA 4O57A 4TVUA 1JDCA 4NU7A 7REQA 3LGDA 4ICCX 4C6CA 1W3HA 4KRTA 1RQBA 2OKTA 2GGIA 4ACZA 5HUPA 3KBSA 1J93A 2LLEA 3KXQA 5HWMA 3AIVA 4KCTA 1JCXA 4AVFA 4UTTC 3PFRA 4AXNA 1G4SA 4D8AA 3RMJA 4C1NB 3SCOA 4DBDA 3P5YA 3S2JA 3UGVA 2B4GA 4O8RA 1OCNA 1Z44A 1G4TA 3KBMA 2ODOA 1QTWA 4NXKA 4G9PA 3UETA 4DF2A 5HNNA 1DVJA 1D3CA 1JYXA 1XP3A 2UY4A 3AYRA 1PZ0A 1M6JA 3OBEA 3SCWA 1PE1A 4Z2KA 4RDWA 1U2YA 4L6OA 5DO8A 1WDSA 3BH4A 2VGIA 3PY2A 1OEPA 4O15A 1ML1A 1SZFA 1FWEC 3AHXA 1Z89A 4K37A 1C8QA 1ZUAX 4GD0A 2YLAA 1PIFA 5BWFA 3L4UA 2V2HA 1F73A 3VUPA 4OUIA 3THUA 2GPTA 5T26A 4AAJA 5ABEA 5GNYA 1K6WA 4GK8A 1XYMA 4ZO9A 1C9DA 2BHYA 1K9TA 2QR6A 5G1YA 2J62A 1TR1A 2CLPA 3VABA 3V0UA 5I02A 4RPPA 3TR9A 1RHCA 4YU1A 3U8GA 3V5FA 4UOZA 3E2QA 3MMWA 1EUNA 3SN0A 5G4EA 4PUUA 3N4AA 1QOPA 2EPNA 2OYKA 4KFPA 4XAGA 5LNVA 2NVAA 3W84A 3GE7A 4DZAA 3NQEA 3W7MA 5I23A 2A21A 4H41A 4Z0SA 4MWAB 1G4EA 1UBPC 3GXPA 3EDEA 2F7FA 2V81A 3M0YA 5HINA 5C9ZA 2ZADA 4UQCA 2V3EA 4GBUA 1UC4A 1VRDA 5A8PA 5CAHA 7A3HA 2WVVA 4I9TA 2CKSA 2Y24A 2B7OA 2PC8A 1KWGA 3U4AA 3PHAA 3OYXA 3GWQA 2OTDA 4JL1A 4ERGA 3E2RA 1JPMA 4FXSA 3S9ZA 4YIWA 3GTHA 1W3TA 3VCCA 3BAIA 1IZJA 2R91A 1XICA 3MMDA 2ZX6A 1EDTA 3AALA 1UWAA 4GVHA 1VBGA 3S6DA 3AYVA 2W27A 4LWWA 1GJWA 3VM5A 2PDFA 1Q4WA 2NUXA 4BEQA 3C61A 3ZVHB 1ZCCA 4EKJA 2NQ5A 3NQ2A 2CZEA 3VINA 2BOGX 3LENA 4C6LA 1QT1A 4MDPA 3RNDA 1EL3A 5L6UA 5I0DA 5D9OA 4LY4A 1A49A 3MSDA 4J3SA 4B5SA 1A53A 3W7HA 4MWAD 3AS2A 5KZ6A 1AMKA 4DJFD 2PP0A 3O07A 1KB3A 1EB3A 2PTYA 1DEDA 3CUFA 3V5CA 4WX2A 3GD6A 2GWNA 4RV8A 2UV8G 4A3RA 2ACSA 4JY9A 3WMCA 2BFGA 3ATYA 3KDOA 3SQLA 4A35A 1XBZA 3W3OA 1JDFA 1EF3A 4QSFA 1IZCA 3G3MA 3Q58A 1JCLA 2I14A 2WZHA 3UZ5A 4JQ2A 3WUFA 4XSLA 4QJ1A 3DIPA 4H19A 3B97A 4QJ5B 1UKOA 3Q94A 1V6YA 1UKQA 3SCSA 5I77A 5FEPA 4IG2A 1BHGA 1XIMA 3LBMA 2VZVA 5D2TA 3LG3A 1CXFA 3N13A 3VIJA 2VXNA 4XD5A 3WF3A 1V6WA 4DJEA 4FB7A 1GUVA 1G0CA 3MKKA 2Y70A 3BG3A 2QCNA 3B9DA 3VX0A 3NQBA 4LVFA 4ACYA 4FR1A 6A3HA 5A5WA 3KS5A 4PTWA 2GDUA 1V5XA 2HXUA 1XIGA 3G6LA 3FXGA 3WD3A 3QLDA 3PC0A 1ISZA 5EL1A 4LB4A 2R94A 3DG7A 3K8KA 4DPPA 3P84A 1P0KA 1N8IA 1EZ2A 1RVKA 4H9MA 4YTQA 3RCMA 3BVJA 3FA3A 4AHPA 1TWIA 4KRZA 1I1WA 3OO2A 4BI5A 3GTNA 2AGTA 4J3XA 3HURA 2NT1A 1UH2A 4J1OA 2C14A 2PMQA 1BF2A 4NSBA 4ZFMA 1DV7A 1FWNA 1YHTA 3G1YA 3H2EA 1RA0A 4WKHA 5G5IA 1E6NA 4AZ7A 1OSEA 1CXEA 5AC7A 2YXXA 5C70A 1O1HA 2BOFX 4NX5A 3H7RA 1GTHA 4B4HA 3IJIA 1SFTA 4NZ5A 3LPPA 2ISWA 1QXLA 3PBMA 3B8UA 1AMYA 4GC4A 3AMLA 3T44A 2CWNA 3WL1A 4EXAA 5CGQA 4ZXOA 3UZWA 4LSBA 2J9XA 3L12A 1R7OA 3AIQA 3WMSA 2Q71A 4B16A 4GIRA 1SVDA 3TIMA 3W7IA 2NQ9A 1XV8A 3WK1A 5REQA 3LMZA 4GJJA 1XLAA 1DE6A 4L9ZA 3HMJG 1CWYA 3N14A 2NQJA 2I5IA 4YMZA 1QVBA 1L8NA 2BY0A 4JIHA 2E8ZA 3QY8A 4MFEA 3G1SA 4GJ1A 2O9TA 2GJPA 2DUAA 1ONXA 3SGUA 4Y7EA 5A8MA 4W4QA 3WEZA 1SJDA 3UEQA 3A3XA 7ODCA 2FDMA 5H8MA 4HK6A 3N04A 4BQ5A 2E7FA 3F7JA 4KPLA 4M29A 1PXGA 1GZJA 1W1ZA 3TW7A 3T9PA 4BR1A 5HATA 4GG9A 1PCWA 4S23A 1B1YA 4BJHA 4C91A 1ITXA 1F61A 2X41A 5M03A 3SY5A 2E68A 3ES8A 3CQKA 2OO0A 4YHGA 4QJ4B 4I3GA 1ZCOA 2X2GA 1WAUA 3DFSA 2NVDA 2PDMA 4NNBA 4CNSA 1GPFA 4QFUA 4PTXA 4MKNA 1JUKA 5DT5A 2FTPA 2WHJA 3TZFA 4GQRA 1H63A 1KQYA 3C3UA 1XH2A 2BXZA 3W53A 2EPLX 1XS2A 2QIWA 2VKZG 1TX0A 2EPHA 1WDQA 5FSEC 2P8CA 4L1XA 1UWQA 2G4FA 4P8WA 4PUMA 3OU8A 4RW3A 3SGZA 3PWGA 3W25A 5C71A 3W28A 4JEQA 2Z28A 1Q6DA 2YDSA 3MSYA 3T2OA 4WF7A 4XBSA 1R87A 4KBXA 1EC8A 3TC3A 3EX4A 4YLWA 3UCCA 3FJLA 3CEUA 3C0SA 4NL1A 1HJQA 1FX6A 4D71A 2X1SA 4I5RA 1OJXA 3XINA 1GVFA 2X8RA 1XFBA 1L2QA 2CLKA 2I9UA 3EOUA 4RNFA 3DC8A 3MVIA 1H09A 4DO6A 3SR7A 1SSGA 1BYBA 3SEPA 2WCSA 3R8GA 1KLYA 3M64A 2CYGA 1CB2A 2DVTA 3MTWA 4UQEA 2BODX 2E0PA 1K02A 3KS6A 4J3WA 1HNYA 1QO2A 4C60A 1M3UA 2HXTA 3WLKX 2JIEA 1EJVC 3NURA 2A3AA 3KL0A 3N25A 3BUVA 4POCA 1W9XA 3WDRA 5FA5A 2IW0A 5DANA 3N2OA 4W8LA 1H50A 4TO8A 4JAWA 1A5NC 2CLEA 3V4BA 4M82A 4DXXA 3PG8A 3VIOA 5H8UA 4LYQA 1QOXA 1AD4A 5D8WA 3CZKA 4DLMA 2WV8A 3FVDA 4OBSA 3HG5A 3AMCA 4JL2A 2ZA2A 3T8QA 2NWSA 4EVZA 2XVPA 2PLMA 4ZFCA 3VOFA 3QH2A 3EEZA 3NQFA 1XIEA 1NQ6A 1NP0A 1T40A 2ATMA 3EWCA 1IZKA 2OGYA 3EMCA 3NDOA 2IKHA 4CUCA 3HQPA 4GUGA 4FALA 2A3BA 5TBOA 1CB7B 1XCXA 4IX2A 1VZWA 1EC7A 1BWVA 3IRDA 2BHUA 3ITYA 4G1KA 1JXJA 1XISA 2BVDA 1GG0A 1UASA 2PWFA 2UWFA 1S5MA 1V3LA 4AFYA 2YBVA 4E8DA 1MMFA 3DYOA 2E6FA 3BTNA 2QAPA 1OF6A 1E5JA 3CH9A 4AIBA 4MFDA 3I68A 3BCJA 3S5OA 4GNJA 3CAKA 1DXEA 4PFMA 4W89A 3OVRA 3VNYA 2IQDA 3ITCA 1EGMA 1OZQA 1VJSA 3VKBA 3IGUA 2QCMA 3O6YX 3W38A 3N6JA 1FWDC 3LU2A 1JCTA 1DJQA 3C5QA 5ABTA 5F2IA 1RCQA 3W7KA 2QYGA 3AJXA 1IE7C 4GACA 3WDQA 1HZYA 2G3NA 5CLTA 1FWHC 5BXSA 3FA5A 3QVQA 2ZFAA 4GY7A 1XBVA 2NX9A 2X40A 3NDZA 2Z1WA 3R10A 2FFCA 1T41A 1TUXA 2PGRA 1S2VA 3T07A 4KEUA 1QAPA 3BCDA 3URAA 3OBKA 1E3XA 4X22A 1OX4A 3SIZA 3U7VA 2CXGA 5FJIA 3WDIA 4F0LA 1L6SA 5EB8A 3B04A 1GK8A 1RY0A 1Q85A 4ZQPA 3EBVA 2RKXA 4DJFA 2X0HA 1UR4A 1PV8A 1KFCA 3O8AA 3R8HA 1OINA 3GG0A 1OF8A 2PDJA 3A4AA 2ZXBA 3S9IA 1UWTA 2HNEA 4JTRA 4LAOA 3O6CA 4J2PA 4IFRA 4KKXA 4IICA 3RK8A 2F2KA 3PZQA 4MJ2A 5JMUA 2E8YA 1FA2A 4PSPA 4PRWA 4LRTA 2E6DA 2DZUA 3LRMA 1W1VA 4A3UA 5DRCA 4GA8A 1PYMA 1W37A 1JZ3A 3TEVA 2YJQA 5FJJA 3WMLA 1SSDA 1TVLA 3CQIA 3NQMA 1RBOB 4GIYA 1Z7AA 2WZEA 2D0FA 4RJEA 1HW6A 2AAAA 2XM1A 1GOIA 1VGAA 5I79A 3DERA 4WK9A 1IWAA 1OM0A 5AC6A 4UTLA 2AQWA 1WBHA 2PD9A 1TPEA 2PZNA 1TJRA 3P7YA 3VIFA 3LTPA 2O92A 3M0JA 1M03A 1VCVA 3DBPA 3PAJA 1XLKA 4YJ5A 4GO8A 3GYEA 3GDRA 1XFCA 1E43A 3MKCA 4F4RA 1S5TA 3SQSA 1NOFA 4HA0A 3CGTA 2ABAA 1LTDA 1PCKA 2VP8A 4AC1X 2FPYA 3FW6A 1T8XA 3BXWA 4P2VA 3QBUA 1K1DA 1GNXA 4IP4A 1LZOA 2R1KA 3G2GA 3LPGA 3G6MA 3R4IA 3NL5A 1CLXA 4WJ8A 3TDFA 1CLKA 2FHFA 3SSJA 1BKHA 3JW7A 5LKYA 4QM1A 3CB8A 1GTEA 4MTVA 3GDBA 1OX6A 4JTCA 3S42A 3W26A 5CZKA 1EEXA 3L7RA 5KZMA 1W9DM 4FAMA 4RLIA 1KKOA 1W3LA 4IPJA 1V3JA 4IZGA 5HK4A 4N6EA 5I24A 3GIQA 1BFNA 4GNVA 2CBVA 4FXFA 3PM6A 4U2YA 3TYUA 4FX6M 2B7NA 2GQAA 5D2WA 5AYXA 3NGFA 3S5SA 3V7PA 4UFLA 3BARA 5MF5A 2QXWA 2PDGA 3OJGA 1GORA 3HZ3A 1Y5XA 1RA5A 2AGKA 4Y9PA 4J28A 1US0A 2I7GA 4AZCA 1F4HA 2OKOA 1Z6KA 1CGUA 2FB3A 4CNPA 4UCGA 4Q33A 2BY1A 3RLUA 5JIPA 2DW7A 3BANA 2P3ZA 3S6OA 1B0IA 3W02A 1L8PA 4HA3A 4JYDA 3MHFA 3V75A 2JF6A 2PDLA 5HNUA 1F07A 3KRBA 5JH1A 3UCDA 1TUFA 3CBWA 3LRKA 4PMRA 1YLVA 3P8JA 3S9YA 3Q65A 3ITVA 3EWWA 1N55A 4KGLA 1Q8AA 1E40A 3L2MA 3AIUA 3UT0A 4ALDA 1BWLA 2OQLA 1SUXA 3UG8A 3II1A 4KCWA 1RPKA 5F1VA 1R30A 1F4AA 3AHZA 3SM0A 4UQBA 4GVGA 3CMFA 1NFPA 4M5PA 5LXEA 1H7RA 5CPOA 3O0KA 4Y8FA 1MW0A 5I09A 4O4WA 4O12A 2WC7A 2XGBA 4PA8A 3GQYA 4Y9AA 3R43A 1P0BA 1W5OA 1RD6A 4GWEA 3ME3A 2YL5A 3U9IA 1RBAA 4IPPA 2Q3OA 3W2KA 3P3BA 5T91A 2Q6ZA 1BG9A 3NO3A 4UMCA 4JFTA 1K7EA 1Y7VA 4ZCWA 3WK3A 1KTNA 1YX1A 1V77A 3PF3A 2OSXA 4W8AA 1G7VA 3PUGA 1PAMA 2HQAA 1GQNA 4CD5A 1J9YA 1TWWA 2RUSA 3RF9A 3T1GA 3L4TA 1CGVA 4NX0A 3M1ZA 4C90A 1MWOA 3HV9A 1N82A 3VC5A 3ZM8A 4U2ZA 1W0MA 5AYBA 2W4XA 2X1RA 1KW1A 5JH2A 2XWEA 1SR0A 4DIAA 2X16A 5CQ1A 4RX0A 3VD7A 5AVHA 3LCIA 1OC5A 4AVOA 4L7ZA 2Y1HA 4L65A 1W8SA 2ANUA 2WMKA 3QLLA 1XSKA 3BAYA 3VTRA 4UZSA 3UA3A 1NIUA 2VZOA 4AH7A 1W9BM 4EANA 4S3DA 4XAPA 2EKGA 3M6DA 4NASA 1YW1A 3OP2A 1QPKA 2VFDA 1KM2A 2ZZ6A 2JGYA 2V5DA 3GW0A 3KP1A 3WENA 3NPWA 1EPVA 4IISA 2WLZA 3E74A 4H9XA 2CHNA 4PMOA 1EJXC 4UFIA 3URBA 3EWXA 3KCJA 4OGZA 4PCNA 4Z17A 1EYEA 1GVOA 3A4JA 3WFZA 1XBXA 3CL7A 1B3WA 4J3VA 4DY1A 3WFLA 4A21A 1K3UA 2Z00A 4FF5A 2WJFA 4KCUA 3K30A 4F2TA 3P0WA 4ONVA 3UFYA 3NOEA 4M7SA 4MWAC 5LSMA 3O06A 1POJA 4RE2A 2ZZ3A 1GOOA 4DUXA 3WUBA 1TFVA 2WHMA 3QJAA 3GKFA 4WDUA 4L4LA 4PEEA 4C6IA 3WUEA 5H1WA 1LM1A 2ZOXA 2EF9A 4FLSA 1R3WA 4J3UA 2WVVB 2WMIB 1OFEA 4XSMA 3BQ5A 4H8VA 4E6MA 4KCVA 5L9FA 3M41A 2W79A 3AMGA 1KO0A 2YX0A 4NIRA 4DJFC 5AC5A 9XIMA 3L4YA 1HGYA 3E0WA 1YQ2A 1BD0A 1JJKA 2OEKA 3MU7A 1SZRA 4A8IA 3CH0A 1Q6LA 4IOTA 2FMOA 3CHFA 1PEZA 1GOMA 4AD5A 1VLWA 3JU2A 3WLNA 4JHMA 2NT0A 1PZ3A 3QOMA 1EDGA 4BK9A 3FCPA 2BMBA 3TSDA 3VO0A 1VJZA 5C9WA 5A94A 3W82A 4Y9MA 3GG8A 6REQA 3WBXA 5IM51 3GR7A 3GBDA 3UY8A 1XL9A 1UD6A 1E71M 1E4MM 3ECQA 3T09A 3CQJA 1K03A 3TN5A 4MAZA 2OQYA 1DIEA 1SW0A 3DKLA 5GNXA 4TMBA 4E38A 2Z4GA 3BICA 4GY1A 4AIOA 1WDWA 1SO3A 1UR2A 2UZ9A 5CBJA 3B4YA 3UJFA 1MEIA 3S8HA 1NWUA 3PAOA 1YTEA 4GINA 1GQKA 4ES4A 1FVPA 2QUUA 4GE8A 3CWNA 4OHQA 3NSNA 2PU0A 2Z7GA 2WXDM 3UJEA 4GCAA 1TJ0A 1TJ1A 3FGCB 2FDSA 5JQ9A 3P74A 4MLRA 4PR4A 4IQDA 2JBMA 2Y88A 3GX9A 3RRAA 2C1GA 4HCLA 4YTTA 4DBSA 2DORA 2QCFA 4XVEA 3QTPA 2YW3A 4A2SA 4MB3A 1UH3A 3NDYA 4RE4A 3LBOA 3IK4A 1PBGA 3FGCA 3VOCA 2QUNA 2Z1SA 3GC2A 3I3DA 3SIMA 3UR8A 3IGSA 3VVGA 3WEMA 1JYVA 2E4TA 3BLEA 4FIQA 9XIAA 3SADA 3RU8X 3CT7A 3S5NA 1FH9A 2V0TA 4N42A 3N3TA 3TH6A 3VX1A 4Q8MA 3TN6A 1O95A 3AZRA 3AUJA 1MNZA 2J9YA 4N02A 1NU5A 1V6UA 2VHLA 4XZLX 1H1ZA 1JCJA 3Q2DA 1T96A 1DJHA 1LLOA 1EP3A 3GHSA 2GVEA 3WJSA 4CN1A 2DSVA 4XTIA 2OJPA 1SZGA 2KX9A 5DY3A 1AG1O 4H9VA 2B0MA 3MJMA 4CGTA 1QK0A 2O9RA 1OB0A 1BSLA 4NI3A 5LIYX 4S3AA 3WF1A 4LFYA 1E1EA 4LVDA 5D9MA 2VNCA 4JNMA 3QW4B 1V3KA 4ENLA 3NSMA 3M4HA 2PP3A 1RD5A 2AQOA 1W54A 5D38A 3T4WA 4GYFA 4MHBA 5E5CA 4ADTA 3EPOA 2XZ7A 4NAFB 5E1QA 4ZE4A 3UD6A 1ZBCA 1CI1A 1TPH1 1EEPA 3HGJA 3EA1A 3PANA 3QV9A 4W9TA 3ZLFA 3SRKA 2FPTA 2E6YA 3WNNA 4HT3A 1M7JA 1BXBA 3IK2A 4KS0A 2DW6A 3U2ZA 3BW4A 2J79A 3C8FA 3B8SA 3GH4A 4HHPA 4XKYA 1ESWA 2BOEX 1JDDA 3CT2A