4NVTA

Crystal structure of triosephosphate isomerase from brucella melitensis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
249
structure length
249
Chain Sequence
IRPLVAGNWKMNGKGESLTELRAIAAGLSSDLGRKLDAVICVPATLLSRAAETLEGETVGLGGQDAHFKTSGAHTGDISPEMLKEAGATHVILGHSERRTDHHESNKLICAKTEAAWAAGLVAIVCVGETASERKAERALDVIGDQLSGSLPDGVTAENTIIAYEPVWAIGTGLTPTVQDVRAAHAFMREQLIERFGAKGAHLRLLYGGSVKPSNAAELLGVADVDGALVGGASLKAADFLAICETYRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Crystal Structure of Triosephosphate Isomerase from Brucella melitensis
rcsb
source organism Brucella melitensis
total genus 88
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nvtA00
2FJKA 4TU1A 5EA9A 3KHJA 2J9XA 3ZFHA 1YXYA 3BV4A 2QCMA 3EWXA 3M41A 5HWNA 4K37A 4MFDA 1YPIA 1SSDA 3DFOA 1QR7A 3LCLA 3R89A 4Y8FA 3QFEA 3E96A 1TTQA 4OHQA 4LW7A 3NQMA 1AL7A 4O12A 1OX6A 4ZQPA 1W5OA 4Z08A 3IRDA 3TQKA 1X1OA 4UNLA 1ADOA 4UTJA 3M47A 1OFRA 3P61A 3TJLA 4DF1A 2EHHA 3OVPA 4R53A 1H7PA 2VC6A 3THAA 1KFKA 3PVFA 1OK4A 4QM1A 1EB3A 1PCWA 1DORA 3ATZA 5FEWA 3DFTA 1KM3A 3LHZA 3ZR4A 1FCUA 2YFNA 3W7DA 4IUOA 3W7LA 4XKYA 1JCNA 3PY2A 5L9FA 1SPQA 1JQXA 4XTDA 4JYDA 3G1FA 3P82A 1Z41A 3W7JA 3EXRA 4MUZA 1UUMA 1VCVA 4RZ4A 2ZZ5A 3NEVA 5I3FA 1GG1A 2ZRUA 4XZ9A 1E51A 1ML1A 2Y89A 3ABSA 4IXXA 2CZDA 2C19A 2DU2A 4RK8A 2G5WA 1QNVA 5FEXA 5IBXC 3HPXA 4FXRA 1LYXA 3PWAA 2YFOA 2QAPA 1LDCA 3P62A 3TQVA 2H6RA 3NQDA 4HPXA 4UTTC 4E2BA 2GJLA 3W7CA 4MLJA 4DQWA 2Q8LA 3BK0A 2ZZ6A 1VH7A 1F7BA 2ZTJA 3E9AA 1G6CA 4KWWA 3S5ZA 4L4LA 4BR1A 5D2XA 1GT8A 1F74A 5AHMA 3CEUA 3C2OA 5CPMA 3MYPA 4HN4A 1XCFA 1TQJA 1KFLA 1JCXA 3HGJA 5KMYA 3CLMA 5F4SA 1RQEA 2NZLA 4CNNA 3DI1A 3LHWA 3L2IA 4B5NA 1G4TA 2A4AA 3A24A 3PUDA 5A5WA 5FF4A 3B06A 2GVJA 1TPWA 3O6DA 4XQ6A 3FKKA 2BX7A 4QISA 2E1DA 3NQVA 1OFAA 3TXZA 1FWRA 1BKSA 3L0GA 3W6YA 4FHAA 2Y70A 3DAQA 3NA8A 2VEMA 2V0TA 5CZ0A 4O1CA 4AWSA 4BFAA 1XFBA 4JTIA 4U4MA 3WK1A 1KV5A 1MEIA 3LHYA 2QCDB 2X30A 3G0UA 3PB0A 4A3UA 1HFBA 3NQCA 4UMCA 4BWLC 3STCA 6TIMA 4MJMA 2R94A 2QEZA 4QNEA 1FWSA 3GR7A 3P80A 3HF3A 5EMUA 1GPWA 1WA3A 3L0NA 4YLWA 3MP4A 1DKWA 4IMCA 5LSMA 3GX9A 3AO0A 2VXNA 4GC4A 2ZYFA 5GVJA 5C55A 3FKRA 1ME8A 2RDTA 4CLMA 1LM1A 1Z42A 4UC5A 1ICPA 4QNWA 2Y88A 2B0MA 4AHOA 3HPSA 3S42A 2CLOA 2NUWA 4Y9AA 1MSSA 2RKXA 3TA6A 3I65A 5D02A 1XDLA 1Q45A 3O15A 3W2NA 1SW7A 1B4EA 3NQGA 3KOFA 2C0AA 3BGGA 1FXPA 3LDVA 3A21A 2E6DA 3W7KA 2ZZ1A 1SUXA 4KFNA 3GAYA 5DN1A 4DXVA 2DZXA 2DZSA 3NOEA 4WQ6A 1H51A 3M43A 1DOSA 2BLEA 1PIIA 2PE4A 2YPIA 1TV8A 1VYRA 1VCFA 3WK2A 4JNMA 1WV2A 2R91A 1YXCA 1P0NA 4S2BA 2ISSA 5T26A 1ONRA 1VS1A 1SSGA 3MI2A 4Z1CA 3HIJA 2E77A 2ABAA 1TJRA 4LU0A 3WJYA 1OJXA 3FIGA 1GTEA 2WJZA 1KM6A 4K7YA 1Q6QA 5BMXA 3G1SA 1FX6A 1TPC1 4WY0B 1IIHA 1XBXA 1BWKA 3NDOA 4O8RA 5F1UA 4O52A 1VHCA 3NZ1A 1K8YA 2ZA2A 1EPXA 4O57A 4YXGA 1EA0A 4JY9A 5D38A 4NJGA 4FNSA 1YTKA 3TU9A 3W1LA 5G2HA 3RF9A 3FYPA 3UY8A 3W3OA 4WOZA 1ME7A 3PUEA 2A5HA 5K3VA 1H61A 4MZ8A 1OG0A 2VFEA 3VI2A 3OG3A 4XBSA 1S3HA 4QAIA 3B03A 3N3MA 3W83A 3NAVA 3ZWSA 1K3UA 3L5LA 4MY8A 2CLEA 3T40A 3TSDA 1DJNA 1EWDA 3PB2A 4O50A 3TFCA 5IBXA 3LX9A 1A53A 1QPOA 4IOTA 4A2SA 4RKAA 3NPWA 3SJ3A 3SZ8A 3LCWA 1QPNA 2NX3A 5K9DA 4JIQA 5F4XA 1M6JA 3L67A 3HQ1A 3QMSA 2RDWA 1FDJA 1ICSA 1SZGA 3S5YA 3MMTA 3M6YA 1GVFA 2GJNA 2JGQA 1G4EA 5D2WA 3B4UA 3W70A 1X1ZA 4O10A 4GUJA 3YPIA 3STEA 1H7XA 1SFJA 2E5DA 4IQLA 3DKJA 1L6WA 1KLZA 5K7JA 1SQ7A 1IXPA 3C2FA 3BLFA 3SY5A 2EKCA 3C4UA 3QSRA 4TX9A 3EKLA 1H7NA 3HPZA 1RD5A 3DENA 4POCA 3SGUA 4MKNA 1KV8A 1K7XA 2C13A 3G3MA 1XBVA 2VFFA 4N4QA 5AC7A 4UFIA 4WY0A 3UY7A 2QJHA 1OFEA 3IIXA 3I7SA 3W7MA 1AW1A 1GVQA 3CTLA 1EP3A 4UTUA 3M5XA 5TQLA 1DJQA 3LRMA 4NVTA 1OHLA 5DXXA 1O60A 2V2CA 5KITA 2I9EA 1W5NA 3W2JA 3RLUA 4AF0A 2H3BA 1MZHA 2CLMA 3E49A 2VELA 2KZHA 3KRUA 1MO0A 3L5MA 4JXCA 4DF2A 4ZZ9A 1H60A 1TTPA 2DZVA 3DFSA 4NT0A 2GQ9A 1LORA 3GDLA 3W7NA 2GPTA 3MWAA 1TB3A 4BWLA 1F6KA 3W1UA 4WXYA 3PULA 2WNZA 4PL1A 4RZ6A 4AH7A 1I2PA 1GVRA 3G3DA 1OFPA 4XTIA 5K4XA 4HT3A 4S1FA 5LGXA 2Z0IA 1P1XA 5EYWA 3ATYA 3DKLA 3A23A 1J5TA 5DBUA 3W7IA 3DFQA 4WZHA 2OCZA 1D9EA 1YXDA 3PG8A 2OT0A 1TYGA 2EGZA 2VFIA 3QW3A 1IXNA 4GUGA 3LHTA 1H62A 3CIXA 1QWGA 1CW2A 3EXTA 4N9DA 2C6QA 3N73A 2NWSA 5SWUA 1O94A 3GXNA 4QQ3A 3T7VA 5K2ZA 1GZGA 3K30A 1GWJA 3RLVA 1W5PA 3TW6A 1LRQA 1U5JA 4ZQNA 3W2UA 4TR9A 4MFEA 5U4NA 2YZRA 1DQWA 1YDVA 3GDMA 2I1OA 5KTLA 2FIQA 2QCCA 2BXVA 3NQFA 3HG5A 2XN2A 4KKXA 1QDSA 5CPNA 3NQAA 4LNYA 1TRDA 3VCRA 3RU6A 2XN1A 3P5ZA 1SO4A 2HS8A 4E2DA 1QO5A 3TH6A 4JX5A 2VEPA 1JCYA 2QCLA 4N9BA 2ATMA 1AW2A 3PM6A 3B0VC 4O13A 4MY1A 1GOXA 3FS2A 5G5IA 4OT7A 3GNDA 1H63A 2QCNA 2FPTA 2W6RA 5F4WA 5DCBA 5HWMA 3NNTA 4XKYB 1TRIA 1LP6A 3RNDA 3N14A 4FB7A 3NQ6A 2HSAA 1G69A 4R7JA 3LM7A 2DP3A 1K7EA 3IEBA 4O4WA 2CLLA 2QAFA 4FEZA 3TR2A 1H7WA 1WX0A 1N7KA 4UTWA 1NF0A 4IMDA 4UFLA 3MBDA 5U7SA 3OVRA 4PEKA 3IGSA 4AHQA 3LLDA 1GTHA 3LBMA 3NPXA 3SW6A 4FX6M 4UFMA 1OFBA 3NVTA 4KWVA 3LCGA 4DO6A 2ISWA 1X7FA 4AHPA 1BWLA 1NAL1 1JRCA 1UJPA 2QR6A 2PC4A 4MJZA 3M5ZA 2OMAA 1W1ZA 1ZAHA 2QUUA 1ALDA 1B4KA 1TJPA 4UTMA 1HO1A 1JRBA 1K8XA 5DY3A 3BG9A 5D04C 4UNKA 4Z0SA 3IIZA 3P7YA 3G1VA 5KSWA 4AMAA 2DZTA 1YTDA 3MI3A 2C1HA 1O5KA 5AYZA 2WKJA 3OEXA 4D2JA 1TIMA 3JRKA 4CCCA 2YYTA 4YL2A 4CNPA 1V5XA 4HNNA 3MO7A 1XUUA 5HUPA 1NF7A 4JS3A 4TIMA 4O1BA 2RH9A 5D03A 4Q32A 1YTEA 1W37A 1TV5A 5D09A 2E6AA 3DHFA 4TMBA 5HWJA 5HMSA 1ICQA 3B0PA 5CSSA 4UTKA 5F1VA 3B0UX 2AGKA 3SI9A 5LNVA 4GBUA 3W2LA 3GB6A 4IPIA 1JCJA 4LT9A 3SSJA 4JTSA 3N34A 3ZWTA 4LRSA 4JTKA 3V75A 1FWNA 1GYLA 4A22A 4LOCA 4X9SA 2WQPA 3M5YA 3VKJA 5CZJA 2A85A 4JICA 1WXJA 3C61A 4C1KA 3MHUA 4N6FA 4O1DA 3H54A 4PCFA 2HTMA 3EWUA 3W1AA 3W7RA 2RDUA 4ZL1A 3R12A 1XXXA 5C5YA 3MJYA 1DL3A 3P8JA 1AW5A 1D3HA 4ZQCA 1ZAJA 2FB2A 1I2RA 4HNTA 4ORIA 5LGZA 3I7RA 5H91A 3NL6A 3S5NA 1OFOA 2WSYA 5EKYA 5G4EA 1H7OA 1TPDA 4LVBA 2J6XA 2YXGA 3QJAA 4OU1A 2BZNA 1OVDA 4QJ1A 3F03K 1PV8A 3WK3A 3BLIA 4KFPA 1EWEA 1TV7A 3W1MA 4EOUA 5CGQA 1KTBA 5D2VA 5CSRA 4MYXA 4Z0JA 3EB2A 1W54A 3KRSA 1S5TA 5TIMA 2ZA3A 3IIOA 4RXFA 3M0ZA 3NQ7A 3PS7A 5AFDA 3BW3A 3W72A 1W31A 5G2IA 5FEZA 4GJ1A 3EX1A 2VOMA 2A6LA 2VKZG 2ZRXA 4EWND 3C2VA 3JR2A 1F73A 1DBTA 1Y0EA 1K03A 2DZWA 2QUVA 5CPOA 4AEOA 2V2DA 3ABRA 2QKFA 3G18A 4ORMA 3GR8A 2GOUA 1SO6A 3UZ5A 4JX4A 4OBTA 2Z6IA 3LTPA 1XUZA 4Y6GA 5CPLA 1AL8A 1M5WA 3CB8A 5D33A 3TUUA 1G4PA 2CLHA 3B04A 3O6CA 4N6EA 1SZEA 2H8ZA 3STFA 4JEQA 4HNVA 1HL2A 3DZ1A 3BPWA 4X22A 1QO2A 3SECA 4FF7A 4TO8A 3HG4A 2C15A 3UWWA 2H3DA 3UXAA 4UMBA 1BEUA 1KBJA 4LUIA 3SIZA 1B3OA 2PRMA 2VEIA 4GUHA 4NJKA 1Q6OA 2Y63A 3L65A 5J5DA 3WJWA 5BW6A 3IVSA 5MHBA 3PG9A 3BGJA 4A2RA 3QPYA 3W7QA 5BNKA 5AYXA 1EP1A 1W8SA 2V81A 4FIRA 3DHDA 1I4NA 5HR7A 1SZNA 3A9IA 3HB9A 4RCXA 4JTEA 2PCQA 1VHNA 3EWZA 3TSBA 2ZZ7A 3W7PA 3T4CA 3UD6A 3EX2A 2FPYA 3MHGA 1K7FA 4BK9A 1RZMA 3LV6A 1J4EA 2X2GA 4O15A 4M6VA 3LBCA 3INPA 1NEYA 1MEHA 4RJEA 1VJIA 1RQBA 5CKSA 3OBKA 2OZ0A 1JJKA 1SR9A 1ZENA 3ZS4A 3C3NA 3N9RA 4N4PA 3W7HA 3NM1A 2JKPA 3W71A 5DCDA 3W1QA 3M7WA 1G7VA 3NPUA 5FF2A 1P4CA 4Z1AA 3UPWA 1IIGA 1EUAA 4O4VA 4UTHA 1MXSA 1OYCA 3OIXA 1SU5A 1FDZA 3PUOA 4JYEA 4IPJA 4DPQA 4NJIA 3FJ6A 3HGRA 4N02A 4M7SA 1JVNA 1H7RA 1WOBA 3EKZA 2EPHA 2DJLA 1SW0A 3M44A 3C56A 3GXTA 3DI0A 3QM3A 3GDKA 3VNDA 4H3DA 4IGHA 2BSLA 3D0CA 3QH2A 1A5SA 1KFBA 5LHEA 1FCQA 4AF0B 2YYUA 2ZA1A 4NJJA 4H4IA 3BW4A 3P8IA 2V2HA 4EIVA 2V9DA 3GVGA 4Q4KA 3UZJA 4DF0A 4LC8A 4M7TA 1V7YA 2V5LA 4C1LA 3C0JA 4M6PA 4CNOA 1S5VA 1EUNA 3W9ZA 4UTIA 2E68A 3S0CA 1PS9A 2C14A 1IF2A 3O16A 3KXQA 3M16A 4PA8A 4NNBA 1WBJA 2TPSA 4NXSA 1RR2A 3NO5A 4P61A 3CEPA 1JULA 3OA3A 3LV5A 1FCBA 4UTTA 2TSYA 2QCFA 2RHGA 4K36A 4YWIA 4AWUA 4K7VA 3CM4A 3A5FA 7TIMA 4LRTA 1ZY9A 3L5AA 4FNUA 4PTNA 2X1TA 3CIWA 3EWWA 4K8HA 4XWUA 4ZQOA 1XI3A 2GQAA 3LB0A 4GFSA 2QDGA 2ATSA 2V30A 4I7UA 3HO8A 2A0NA 1SO3A 1FCVA 1EP2A 1F5ZA 3DGRA 2NV2A 3VE7A 3U6WA 5HINA 4O1AA 1LBFA 2RFGA 3DXIA 3S1UA 1NSJA 1RQHA 2OT1A 4Y90A 4LVGA 4LV9A 2ZRWA 5AOUA 1Z48A 4JYFA 3WJZA 3PBWA 1T99A 1F05A 4MPQA 1H1ZA 1KBIA 1DVJA 4IXHA 4ADUA 3B05A 4ALDA 5I3KA 2NV1A 4X2RA 5F2MA 5HUOA 3R13A 1AMKA 2NUXA 3W1XA 3WJXA 3LI0A 3GDTA 1KTCA 3AJXA 1ZALA 5I3IA 1ZJIA 3W85A 2CWNA 4TMCA 2O7SA 5AN7A 2GVLA 1OX4B 3W2KA 3GXPA 2JKAA 3EX6A 1FDYA 2FFCA 1F2JA 1D3GA 2YCEA 3DBPA 3QQ1A 3UQNA 3OHIA 1TPH1 3W7GA 3TNOA 2ZRVA 3TMLA 5AC6A 3CT7A 1HUVA 1P5BA 4AWTA 2VEKA 3FJLA 4WY0F 3HOJA 4OE7A 1XL9A 3HBLA 3LHUA 5CG7A 4U28A 2ZDRA 2V5BA 4IX0A 2XFWA 1QAPA 5L6UA 3UYCA 3PBVA 2DZUA 4OQVA 2OJPA 3IGUA 3NPVA 4KFOA 3GK0A 4JTGA 5ABTA 4GXMA 2CLFA 1G67A 4IMEA 1R46A 3NM3A 4MZYA 1VLWA 3QQ0A 3LXAA 4IMGA 4NU7A 3FA5A 4ZMGA 1JCMP 3LERA 3O63A 1VC4A 3NR0A 5LNWA 2J9YA 1X8FA 2A6NA 3TX9A 3W84A 5KZDA 3R8RA 1LRNA 3OVQA 3C8FA 3CC1A 3PC0A 4X3ZA 3GYEA 2R8WA 3W2MA 2WNNA 1GJPA 1OF8A 1Z44A 4CQ8A 1GG0A 3LCXA 5D05A 3HGOA 2GQ8A 3BLEA 5HULA 2ISVA 4HHPA 3TC7A 1TPB1 4GUIA 1PVNA 1Q6LA 3S1VA 1AK5A 3QMTA 3RK8A 2G97A 3KAOA 4Y96A 5HJLA 2A1YA 1HTIA 3TKFA 2Z6JA 3DH7A 4OV9A 4UCGA 3W1TA 5LHFA 2QJGA 1TSIA 1OFDA 1TPFA 1UCWA 1GYNA 4O0ZA 1ZHAA 3S1XA 1LBMA 2QUTA 1OX4A 4NX5A 4R33A 4LVDA 2E5BA 4PFMA 5EPDA 2ZZ2A 5AHIA 4I7VA 2FLIA 1IXOA 3QC3A 1W0MA 1YYAA 5LKYA 1WAUA 4O16A 1TPEA 4O14A 3W07A 2ZRYA 1H5YA 5AYYA 3LCIA 3S5OA 1I8JA 4O0KA 2I14A 2Y7EA 3LRLA 4UFHA 4XUGA 2A21A 1Q3NA 1T8XA 2E6FA 2YW4A 3U8GA 3G1XA 5DCEA 1KM5A 1O95A 3LGEA 4OGZA 3CWOX 3UPBA 3G0XA 3QMRA 3Q37A 4GRSA 4DO5A 3A22A 1WQ5A 4GUFA 1KM2A 3I6RA 3W22A 1IXQA 1WBHA 5H2ZA 1WDWA 3R5EA 2JBMA 3GAKA 2WSQA 3DFNA 3TC6A 3EEGA 3TFXA 3LXBA 2VFHA 3H53A 4JGDA 1O5XA 2WO5A 3GKAA 3I7QA 4JTUA 1O4UA 3CPRA 1LOSA 1DV7A 3G1DA 5C2XA 3O05A 1OABA 3N9SA 4O18A 3UWZA 2A2IA 3LHVA 2Q3RA 1N55A 2B4GA 4ADSA 1W5QA 1W3IA 1ZCOA 5AHLA 3W1NA 3BG5A 2A7RA 2CZEA 1W3NA 2Y7GA 2CLKA 3LCHA 4UUIA 4RZ5A 1LZOA 1OFQA 3QYQA 1KW1A 4DPPA 2DZPA 4UFJA 4O28A 4E38A 3R2GA 1ZNNA 2WPBA 3KVMA 1TQXA 2E5CA 3TXVA 2FTPA 2Y7FA 4XBKA 1I2OA 1C8VA 4K8EA 1LTDA 2X1RA 2YW3A 4LVAA 4A29A 3G24A 5LNUA 1A5BA 3FEMA 3UWQA 2V82A 1P0KA 3QF0A 2J24A 2UV8G 1XM3A 1TTIA 1YADA 1FBAA 1VYPX 4RR4A 2ZTKA 3Q2DA 4NX0A 2CZ5A 4IJBA 3G1HA 3MW7A 4BI5A 3L68A 5FEPA 4DEFA 3F1QA 2WOQA 4LS0A 3E12A 2F7FA 3F4WA 3FLUA 2EF9A 2O7QA 4WD0A 3BW2A 3E02A 5E0KA 3WJSA 5D37A 3T44A 4AXKA 5FF3A 4WUIA 3KX6A 1VZWA 4LUJA 4CCDA 1SZFA 1XKYA 1T0OA 1TTJA 3NQEA 4FNPA 3V1PA 4MZ1A 5FI8A 3HGSA 2CU0A 1PE1A 1OF6A 2B7QA 1NFBA 3C52A 4BI7A 5KZEA 3Q58A 2XN0A 4CQ9A 4PL2A 3CWNA 1QMLA 3U2OA 4AB4A 4HPJA 2BTMA 3IV3A 3CU2A 3UXDA 2OX1A 3VE9A 1RPXA 2NLIA 4AAJA 1CI1A 1U83A 4NJHA 1TPUA 3PF3A 4M5PA 5FESA 3EWYA 3S6DA 3M5VA 1RVGA 5EL1A 4K39A 1JUEA 3ABOA 3C2RA 4UXDA 1GVOA 4FNRA 5AHEA 5I3GA 1PCKA 2Y85A 1ZFJA 3FYOA 4NZJA 2WSRA 4WOQA 3W73A 2JGYA 3TSMA 2QCGA 1LOLA 4UTLA 4S2CA 1AG1O 4L4MA 2J88A 1H50A 1EEPA 2PRLA 5FF7A 1M7OA 1F76A 3N2XA 4O19A 2P10A 3PSWA 1THFD 4QIUA 2GVGA 3PSVA 4OWGA 2X1SA 4UR7A 1TREA 5BOOA 1PL9A 4HSOA 4MLRA 2HS6A 4LS2A 3SGZA 2F84A 2CFFA 1MEWA 5TBOA 2GUUA 5G4WA 3MP5A 3P5YA 3W86A 1W5MA 3TJXA 3NYZA 4MYAA 1PHQA 1I2NA 4JIPA 5G1TA 3NGJA 4QITA 1PHWA 3FOKA 5K9CA 1KM4A 2NWRA 3MI6A 4I7WA 2ZRZA 1VR6A 2EAWA 2H8XA 2W0UA 2Y6ZA 3L66A 1UUOA 2B7NA 3PBYA 4IWWA 4LVFA 1XDMA 4O53A 1L9WA 4CCEA 2H90A 3NL3A 1Q6RA 3M1ZA 4NXKA 1J2WA 4ZVJA 4EF8A 3HJZA 3P60A 3KVKA 3CQ0A 2NXIA 4UMAA 1RV8A 4DBEA 5I3HA 4BF9A 2HMCA 1L6SA 3W7EA 4OV4A 4R34A 3GKFA 4I9AA 1WOAA 4UIOA 4CQAA 5C6MA 5AC8A 3BVJA 5D30A 1KM0A 3GLCA 3P81A 1TCDA 3PAJA 4HNUA 1FY6A 4DELA 1LRTA 2YX0A 3O06A 1UBSA 1GQNA 4NNCA 1LLWA 1VCGA 4RLIA 1XBYA 2PRHA 3NZRA 3NL5A 3P67A 4MIMA 3ANYA 5LNSA 1I45A 1NVMA 2B7PA 3LCFA 3LRKA 5EBUA 4GE8A 1VPXA 1K02A 5A8GA 1A5AA 3BG3A 3BARA 3SFKA 1X6UA 2P1FA 2DJXA 1QPQA 1HG3A 1VQTA 3N19B 3MYOA 3G1YA 3P84A 3MBFA 4BI6A 5LZLA 1WYIA 4K6AA 4JTLA 2NXGA 4M19A 5DY2A 2DORA 2ABBA 3FFSA 3TE9A 5F2IA 3USBA 1B9BA 3A5VA 2LLEA 2YR1A 2C18A 2QCEA 1DQXA 2V8ZA 1ME9A 5CZSA 5E1QA 2VFGA 4QSHA 3LTSA 3O07A 3IGXA 2C3ZA 2QCDA 3MHFA 3SR7A 5G1YA 5G2WA 4ZQMA 3GZ3A 4FX8A 4WX2A 3W76A 3QPZA 4RX0A 5CZTA 4HIBA 1YPFA 4NNAA 5DLCA 2AAMA 2X16A 2Q3OA 3TCEA 1EIXA 3UNDA 4ONVA 1LBLA 4Z1DA 4FXSA 1OYAA 4UTWC 1T96A 1KM1A 1FWWA 4O17A 3QEZA 3ABQA 4FIQA 3WFAA 4N9CA 3I68A 1K8ZA 1VLIA 1VYSX 4O54A 1TPVA 3IIVA 4JTJA 1OX5A 4ML9A 2QCHA 3C2EA 3UWYA 3W87A 3NG3A 1FQ0A 2R14A 5C54A 1A5CA 1R30A 4GNJA 5IM51 3KFTA 1JCLA 1JUKA 4MOZA 3QW4B 1TO3A 3DU0A 1CX9A 3HMJG 3G22A 5EY5A 2CLIA 1BTMA 3O1NA 1C9DA 4IX2A 1OYBA 3L21A 1W56A 3VFLA 2TYSA 2FDSA 4EVZA 1YDNA 2P0OA 2YSWA 3QRHA 1H1YA 2TRSA 4NUWA 1GEQA 2NX9A 5J5RA 4MY9A 5KZMA 4UR8A 2CW6A 2JK2A 3STGA 2Z1BA 2AQWA 2X1UA 3G0SA 4ADTA 1FXQA 3S1WA 8TIMA 1S5WA 2ALDA 3KVLA 3LOTA 1IGSA 1TMHA 2NUYA 2Z2UA 2E09A 5K9XA 5HR6A 1KTNA 5DELA 4W9TA 3Q94A 4LV4A 4PODA 4JTHA 1B57A 5F2GA 3L0KA 1HO4A 5AB3A 1YDOA 1JQVA 1XC4A 2QDHA 4Q33A 4NQ1A 4LTSA 1EX5A 5HQEA 3LTYA 3EWBX 4YCOA 3S8HA 2Q8ZA 1VGAA 4P2VA 1L2UA 1QOPA 1KA9F 4JTTA 5E93A 3W75A 4JDBA 1YLVA 3UWVA 4FO4A 1KLYA 2FQIA 3PBUA 3TQ0A 2A7PA 4PH6A 1SFLA 1G7UA 4FNQA 3EXSA 3B8DA 2ZBTA 2ZCGA 4LS1A 1R2TA 1KFCA 5KINA 3G1AA 1QCWA 5D32A 3KRZA 5I3JA 1F6PA 1SO5A 4M6QA 1W3TA 4JX6A 2B7OA 2YDAA 4AVFA 5HNRA 3N2MA 4WJEA 4JR5A 2PURA 4FNTA 3KVJA 1I2QA 5D2YA 3G8RA 4ZQRA 3E0IA 3CHVA 4YCPA 2ZZ4A 3MP3A 3TIMA 4LY8A 2Y62A 3GDRA 2G95A 1R2SA 3RMJA 2QF7A 2JKEA 3TV8A 5DXYA 2ZFAA 3DFPA 3TW7A 1FWTA 3HG3A 3UWUA 5LNRA 1KFJA 1LROA 4LC6A 4E0CA 3LXCA 4ICNA 3T55A 3IVTA 3ELFA 3GIYA 4K38A 6ALDA 3TAKA 1C29A 3S9YA 4PC8A 3GNNA 3H55A 3TDFA 1A50A 3TMQA 3NQ2A 2W79A 2NX1A 4JN6A 4DO4A 3HG2A 5FF0A 3QSTA 5BMWA 3QZEA 1DHPA 3TK7A 1JR1A 4JD4A 1GVSA 1M7PA 3G8EA 2Y61A 1R47A 3O8AA 1KFEA 1FUYA 2QJIA 4N2YA 4WXZA 1G4SA 4LWWA 2WV8A 4HSNA 1QOQA 3W1RA 3EX4A 2C16A 5D2TA 4N9EA 3P74A 2BWGA 2J9ZA 5DBTA 4MVAA 4JTFA 3M9YA 5K4ZA 1ZAIA 1QFEA 4JY8A 5BRBA 3NQ8A 2E6YA 1L6YA 2VENA 1XBZA 1QPRA 4HKPA 5AHNA 5F2LA 3TROA 3TAOA 3T78A 4DBDA 2YGYA 3MUXA 4GWEA 4EF9A 1LLZA 3C6CA 4YMZA 4RV8A 4Z1BA 2ZZ3A 3NXFA 2ZQ0A 3W7OA 2Y7DA 4UFKA 4FX7A 2IQTA 3BO9A 1R2RA 3W1PA 3NL2A 4H6KA 1LCOA 2FPVA 4J9JA 4RXGA 2WNQA 2VFDA 3THQA 1N8FA 3O6YX 3RFAA 4NZFA 4JDYA 3LI1A 2J27A 3W23A 2FB3A 3W74A 1LOQA 5AHFA 1UB3A 3F4NA 1UASA 4O11A 2CZFA 3IVUA 4IMFA 2NXHA 1VRDA 3EX3A 3IIPA 2TMDA 1OK6A 3LLFA 3JS3A 1SW3A 2D73A 3PR2A 4A21A 4G1KA 3WK0A 1JUBA 2G96A 3L9CA 3W88A 2A7NA
chains in the Genus database with same CATH superfamily
2WMHA 4TU1A 1XSJA 5EA9A 2J9XA 3ZFHA 4C6IA 1YXYA 2QCMA 3M41A 3GIPA 1E9YB 1HW6A 3IACA 4GVFA 4B4HA 4V1XA 2FMOA 2DY3A 1WZKA 4ZQPA 2GVEA 1W5OA 2OYKA 3OBEA 2ACUA 1ADSA 2E67A 4OBRA 2PWVA 1OFRA 3TJLA 4R53A 1H7PA 4TOQA 1KFKA 4P8WA 1EJTC 1DORA 3URBA 4E8GA 1K4HA 1KM3A 1SGJA 3GM8A 1E70M 4IUOA 5D9MA 3PY2A 4NRRA 3BZJA 4QDPA 3ONCA 4EPEC 4JYDA 5A1AA 1Z41A 3EXRA 3KCOA 4MUZA 1UUMA 3ABZA 4IIEA 1E0UA 4GY0A 4RZ4A 3NEVA 2ZRUA 3ABSA 4PUWA 2Y89A 4CD4A 2G5WA 1QNVA 3U2CA 4JL2A 3URAA 1LYXA 3DERA 3UVIA 3PWAA 3P62A 1WKDA 4A8RA 3T2QA 4U5IA 5DX7A 4KH2A 2UZ9A 4UTTC 1LLOA 1TKKA 2C7FA 3W7CA 1Q65A 2ZTJA 3E9AA 3HQPA 1XV8A 3S5ZA 3MB9A 1GT8A 2V5CA 3GY1A 5E0CA 3U57A 3TLLA 3THUA 1HVXA 2XZ9A 5AHMA 3CEUA 2W66A 4HN4A 1XCFA 4KIRA 5LYRA 4Q7BA 4DRSA 4BHYA 2Z29A 1RQEA 3VNJA 4NAEB 4B5NA 1G4TA 4MSSA 1JEZA 4FLOA 5A5WA 2FJUB 2HWGA 4KGLA 4I5RA 3ITLA 3W29A 4MUPA 4UQAA 2I7GA 1B3XA 3PZIA 2E1DA 3NQVA 3TXZA 3S1GA 4B5TA 3L0GA 2JIWA 2IUZA 2VOTA 1TE1A 3DAQA 3I6EA 2V0TA 4N7QA 3I3BA 4YVVA 4RDVA 3NSMA 4AWSA 2X0SA 1CB7B 1VENA 4U4MA 4EE9A 1KV5A 1MEIA 4DYKA 3G0UA 1QNQA 1HFBA 2CLPA 1CNVA 3NQCA 3ERPA 2W5FA 1W9BM 4UMCA 4EAMA 1ZJAA 2HZGA 3EMCA 3WELA 3B9AA 2QEZA 1CLVA 1KCLA 4F66A 1V6XA 4H9TA 4RPPA 2PGFA 3P80A 4CQBA 4TVCA 1W1VA 1GPWA 3SDOA 4YLWA 1R6WA 1CBGA 5HAOA 3GX9A 2VXNA 1ME8A 5CJMA 1L6GA 1H2JA 2ZE3A 4XD5A 1ZUAX 2CLOA 4Y9AA 4JIHA 1R3RA 3PHAA 1BG9A 3AS1A 1VJZA 3W28A 3WL1A 4IL2A 1QT1A 1XDLA 3BE7A 3O15A 2X7VA 3ZT7A 1WPCA 2ZKMX 2FFIA 2C0AA 1DXEA 4NAEA 2E6DA 3W7KA 4FAMA 1SUXA 1NQKA 3GAYA 1MRQA 3H2EA 3M43A 1DOSA 2BLEA 2OGJA 4GZ7A 2PTDA 3MA8A 3CV6A 1WV2A 1LG1A 2NVDA 3GG8A 1YXCA 3CB3A 5T26A 2DT0A 1VS1A 3THCA 4S3DA 2E77A 3OLGA 3FIGA 2PDWA 1ADDA 1ISWA 4QQUA 3H24A 3XIMA 1TPC1 1ITCA 1Z89A 7TAAA 1VHCA 1K8YA 1UH4A 3NZ1A 1JZ8A 5BXPA 3W1LA 4H8NA 5G2HA 3QV7A 2CWXA 3SY1A 4Q7IA 1E0XA 3P2VA 5K3VA 1H61A 5GQBA 1E6ZA 4Y7EA 1S3HA 4B5XA 1R87A 2ZC8A 2FVKA 5LIXX 3KW3A 4JTDA 3L5LA 4JQ2A 5CZKA 4O50A 3TFCA 3WBWA 5IFPA 1GVEA 1FWAC 4NY2A 5IBXA 2OTDA 3MJMA 3LX9A 1ENUA 2XM1A 5HMDA 4YU1A 4A2SA 4IOTA 1T41A 2G0WA 4I3GA 4HN8A 4JIQA 2FTYA 3VIJA 3PTDA 3S5YA 3SCUA 3LS9A 1UWTA 1G4EA 2XFRA 3B4UA 9XIAA 4MPKA 2GUBA 3ZSTA 1SFJA 3HPFA 1KLZA 4QE4A 2ZWYA 3SY5A 4MDPA 4TX9A 2JQXA 3EKLA 3K8LA 3WEOA 5I5RA 4POCA 5A69A 3SGUA 1KV8A 4CGTA 1K7XA 1K9FA 2VFFA 3FGCB 4UFIA 5DEZA 2AAAA 3H2CA 2ZXQA 3I7SA 3CTLA 2OVLA 3FA4A 4UTUA 5AZ0A 3GG1A 4NVTA 2YL6A 4EX4A 2V2CA 7REQB 5KITA 2XVPA 1AZ1A 4C6LA 4C65A 1S2WA 4DF2A 1XLFA 2EQDA 1H60A 2GQ9A 3MWAA 1TB3A 4BWLA 2BVYA 1OCQA 4PL1A 1X38A 4J3WA 4RZ6A 4LEQA 4IFKB 1GVRA 1OFPA 5LGXA 2FZNA 3CAVA 1DWAM 1W3LA 4LUTB 1UD5A 1D9EA 1YXDA 3PG8A 2E3ZA 1K1DA 1ZBWA 1H62A 3BAIA 3CIXA 4CVUA 4DZIA 3VAVA 4Q8NA 3RX2A 3K1DA 3BLLA 1U5HA 3RYSA 1KRBC 4RDWA 1W5PA 4AZHA 1LRQA 1U5JA 1F4AA 4KW2A 2XVGA 4MFEA 3M64A 3AMDA 3HG5A 4LY4A 2POZA 3AXMA 2XN2A 1DTNA 3QN3A 4S3FA 4LNYA 1E71M 1XX1A 4KCTA 4DAFA 2HEJA 4G56A 2HS8A 3TH6A 1UKPA 1TMQA 3F2DA 5CPTA 4H7VA 3WF2A 4ZO9A 2ATMA 3PM6A 3B0VC 4PSRA 2G3IA 1GOXA 2EPKX 3FS2A 1AH3A 3EWCA 3VNIA 3WDJA 7REQA 5HWMA 4WDUA 4W8AA 2Y5JA 1W9XA 2WC7A 1P6BA 3NQ6A 2OKOA 1G69A 4LJ3A 1E5JA 2CC0A 3E2SA 4M81A 1H5VA 4JQAA 3N4AA 1GGOA 2CERA 2CLLA 4JAWA 4XZIA 4B3KA 5GPRA 3MANA 4URIA 4B2DA 2XPKA 3OVRA 4LUTA 3WLLA 3IGSA 3GHUA 4H83A 3M0LA 3V0UA 2YXXA 3RRXA 3LLDA 3T2PA 3NVTA 4KWVA 3LCGA 2ISWA 4AHPA 3E5PA 1NAL1 1KKOA 1JRCA 4CEUC 3HV8A 2PC4A 1W3JA 4PUJA 4J3TA 1XP3A 1ALDA 4QLJA 3ZJ8A 2VP8A 1JPDX 3AZTA 1TJPA 4UTMA 1JRBA 5DRCA 3GVWA 5D04C 4Z0SA 3EMZA 4XAGA 4AMAA 1YTDA 3MI3A 4C6PA 1EPVA 1JZ7A 4P7RA 1DJYA 4D2JA 1TIMA 1CXEA 1UIOA 1XF0A 2Q02A 1Q6EA 4K1WA 2A3CA 3T81A 5D03A 5CPSA 4Q32A 2YL5A 1RPKA 3FHAA 5HWJA 3PTKA 5HMSA 5C2CA 1ICQA 4MTVA 4ZSUA 5C8BB 3UCDA 3Q65A 1XLHA 5G4HC 4HA4A 3GB6A 1JCJA 1CLKA 3WBEA 1SZRA 1Z7AA 4JTSA 4YVXA 3ZWTA 4JTKA 5D8ZA 3V75A 2OQLA 3VZZA 3ARXA 4MNLA 5M3WA 3WQGA 1HP5A 5CGTA 1EC9A 4GPNA 3XISA 4ZCWA 1UA7A 3OQ8A 3H54A 4PCFA 2D24A 1EH9A 1R85A 2I16A 3KBMA 1ZBVA 3W1AA 2RDUA 4ZL1A 4DB7A 1XXXA 3P8JA 1AW5A 2FB2A 1UPMB 3I7RA 3S2CA 4D1IA 3AHTA 2AMGA 3S5NA 4S3EA 3FXGA 2DIKA 5EKYA 1H7OA 4GYKA 2J6XA 3W4RA 1E5NA 3MUY1 3F03K 4HCHA 4GNKB 2JEPA 4KFPA 5JIPA 4Z2KA 1TV2A 3AHYA 3HQNA 1O5QA 1KTBA 2BBFA 3GWQA 4J3XA 1XIJA 1S5TA 2V6AA 3MDWA 5EFFA 2VMFA 4L61A 1PB0A 4J3UA 1PTDA 5E70A 2WC4A 4L4OA 3U4AA 3W72A 1EGZA 3DOPA 5G2IA 5TAOA 4GJ1A 3OP2A 2A6LA 2EO7A 3VX1A 2GUYA 3VGBA 3ES7A 5DO8A 2ZRXA 3CGTA 2H9AB 2DZWA 5CPOA 2V2DA 3ITOA 4B15A 2GOUA 4JX4A 3HURA 2Z6IA 3CL6A 2PDLA 3LTPA 4Y8EA 4XAPA 1UR3M 3B04A 3OTRA 1SZEA 1OY0A 3T08A 4E4PA 1H11A 4QJ4B 4JOMA 4JEQA 4L4PA 3CH0A 4HNVA 2DVXA 3CUFA 4GVGA 4E4UA 4FF7A 4TO8A 3UWWA 3CK5A 1E72M 1KBBA 1KBJA 4A6GA 3U3HA 4DUWA 4KCWA 1NFPA 2Y63A 3BSHA 4XG1A 3MCMA 3D6NA 3IVSA 4LAUA 2I17A 3BGJA 4DWDA 3D3AA 4QBXA 3QPYA 5BNKA 4F3HA 3HB9A 1FA2A 3DESA 4RCXA 2NV9A 2PCQA 3W53A 4D6DA 1M7XA 1BXBA 3UD6A 1CDGA 1E6XM 4LF2A 2CEQA 2FPYA 1XPGA 1K7FA 1J12A 3LV6A 4O15A 4M6VA 4QE5A 2OQYA 5D9NA 3IV8A 1RQBA 3UG3A 3AYVA 1JJKA 2DSVA 2CCRA 2JKPA 4YHEA 4D72A 3M0JA 1P4CA 2H9AA 2V69A 4MM1A 1A3WA 4DNHA 1XLJA 3B9OA 4JCLA 1SU5A 3LPPA 4F48A 3EA1A 3GVQA 4IPJA 3VOGA 3HGRA 1TA3B 1OADA 4DJEC 2HE5A 2OZ3A 4QP0A 4QG6A 3DHPA 5E5CA 3RM9A 1CGTA 1F3XA 5LXXA 4RW3A 3QM3A 3QH2A 1A5SA 1KFBA 4AW7A 5JVLA 4DJFD 3ARRA 2ZA1A 1B1YA 2UY2A 3BW4A 3P8IA 2V2HA 1IZJA 4EIVA 1ODZA 3UZJA 2VUYA 4LC8A 4M7TA 4HPGA 4U5KA 4CNOA 4IGSA 1SJCA 3W9ZA 3N13A 1CPUA 4WSHA 2GGGA 3IPWA 3M16A 4KWUA 2BHYA 2TPSA 4I8DA 3UR5A 3R8HA 1XIDA 3ZO9A 2CNCA 3JVAA 4M6UA 4UTTA 2TSYA 2RHGA 3R6IA 2V3DA 3WNNA 4K7VA 2PD5A 1IHIA 4FNUA 4PTNA 2X1TA 1Y7VA 2WCAA 1XI3A 2GQAA 2W67A 4GH3A 3KP0A 4ZOCA 4G2DA 4YYCA 2VWSA 4I6VA 3G2GA 1U1HA 1EKOA 1TUXA 3SCTA 3U6WA 5C2GA 3DXIA 3UG5A 3BMVA 2OT1A 3VC6A 2ZUTA 5KETA 2WQDA 2ZRWA 1TA3A 5AOUA 4AY1A 1R9XA 1U30A 2G50A 1MXGA 3AUOA 5ABFB 3EWDA 1J8VA 2NV1A 5F2MA 5AC4A 2ZOXA 3F5KA 2WVSA 7A3HA 4JTCA 1MMFA 1ZALA 4RPQA 1ZJIA 2CWNA 4XB3A 3KLKA 1FDYA 3FHQA 1MI3A 2YCEA 1NWRA 3UQNA 5A8QA 3FW6A 1B54A 5CLWA 3OHIA 1UR1A 3W7GA 1QASA 3TMLA 2NLYA 2G41A 3CT7A 3TR9A 4C1NB 1P48A 4EK7A 3PZMA 1HKJA 3MUZ1 4AWTA 3WH6A 3FJLA 3HOJA 1I6NA 1KR1A 5ABGA 4QCEA 4TVUA 1H0IA 3SURA 2V5BA 3L23A 3VKDA 4HU4A 1N2VA 1J0HA 3QLLA 1RP9A 2XFFA 3PBVA 4D6EA 3M0HA 4JBRA 3N4EA 1B3VA 4B5UA 1UP0A 3WLNA 5ABTA 1WB0A 1TCMA 3WNLA 4IMEA 1R46A 3OW1A 5A6KA 3QQ0A 1RP8A 2X8RA 1Y5XA 3LXAA 1LJYA 2ALRA 3FA5A 4ZMGA 1BF6A 3O63A 3LERA 3FSTA 2J8TA 2J9YA 2BNJA 3AIQA 3R8RA 1A0DA 3C8FA 3CC1A 4M82A 4X3ZA 3GYEA 2WNNA 3SUVA 1GG0A 3SRDA 2QGHA 3HGOA 1KGUA 1ECEA 3NEHA 1KBLA 1DHKA 2YB4A 1PBGA 3WD1A 1GQKA 3TNBA 5ABFA 4GQGA 5HJLA 5TD4A 1HTIA 2D1ZA 3Q67A 3TKFA 1PX4A 2ZX9A 4OV9A 4WDTA 3V4BA 1TSIA 4E5TA 1GKRA 1ZHAA 1LBMA 2QUTA 1SMAA 2Y5EA 4IJCA 5EPDA 4HPNA 2RJGA 4HBKA 3AWOA 5AHIA 2FLIA 4AIOA 1IXOA 3N12A 1OSEA 3IANA 2MUCA 3CBWA 2CBJA 2INZA 1WAUA 3W07A 2WVVB 1NOWA 3S5OA 4GQQA 4J4KA 3U8GA 5DCEA 5A8NA 3WNPA 3EOEA 1Q85A 2VZVA 3G0XA 4DO5A 1IT7A 4GUFA 3W22A 1IXQA 1MUWA 2OB3A 4Z2JA 5H2ZA 3R5EA 1JG9A 3TFXA 4UWMA 1OCJA 4JGDA 4MB1A 4DM1A 3GKAA 1LQ0A 3I7QA 4ACYA 1GQLA 3ITYA 2FHCA 1PKMA 2G3FA 3WEZA 3RX4A 4ROQA 3W1NA 2D22A 3K4DA 2CLKA 5CXPA 3SN0A 1BQCA 4XZLX 2BY2A 1XRFA 1KW1A 4DPPA 2FDMA 4RE2A 1AMYA 4NRSA 2WPBA 3KVMA 2R6OA 1JPKA 1BQGA 2PTXA 3L4VA 5BCAA 1TIWA 2W62A 3VIKA 4GD0A 4P8UA 3CASA 3UZYA 5LIUX 1W9PA 1P0KA 1EXPA 2B81A 4UQ9A 2GGJA 3WFLA 3LSBA 4S3JA 4IJBA 3G1HA 3F1QA 4LS0A 2CHRA 2F7FA 2WZHA 1I60A 4UB9A 2I5GA 2XIQA 4FLQA 5D37A 1R38A 3T44A 1FP8A 6XIMA 4TV5A 2QMKA 1VZWA 1XKYA 3ITVA 3BQ5A 2W63A 4UQDA 1PUDA 1NH6A 1U2YA 2EG8A 3HGSA 4GK8A 2XSAA 4JN8A 1NFBA 1QJWA 1Z69A 1XG4A 4BI7A 5KZEA 2VCCA 1QMLA 3U2OA 3A12A 1QK2A 4HPJA 1FWJC 6A3HA 1HVQA 3UXDA 1GW9A 2XGBA 4MF4A 4GINA 3VE9A 3MT1A 4AAJA 1OC5A 4NJHA 4Q8MA 3EWYA 4K39A 3UZXA 5E6ZA 2P5NA 3C2RA 4NP7A 3XINA 1GORA 4UXDA 1V6TA 4S3AA 2FZ8A 3DBNA 2QPXA 5I3GA 2Y85A 4QGCA 4NZJA 2WSRA 3W73A 1PKYA 3TSMA 4S2CA 1AG1O 1YNQA 1EYEA 2P3EA 2PF8A 4U3AA 3V0SA 2P10A 5HA7A 3B8SA 4OWGA 4H2CA 1TREA 5BOOA 2CKSA 1HGYA 3BC9A 3CHCA 4D6HA 3BCDA 4JEJA 5TBOA 1JD9A 1J0ZA 1XSIA 2PDXA 4MADA 2CETA 3B9DA 5LA1A 2Q8XA 4JIPA 5G1TA 4AQLA 4QITA 4QFUA 3ITTA 3IUHA 3H2AA 4FOUA 2NWRA 2F61A 2ZRZA 5B80A 2HNEA 2H8XA 1F4HA 2W0UA 3L66A 2CYGA 1R7AA 1ZLPA 3PBYA 1KCXA 2AGTA 5DRIA 2KAUC 3U2EA 4CCEA 1XLBA 2EJ1A 2H90A 2J74A 4ZVJA 2JFEX 2CKRA 3CZKA 4RZBA 3CQ0A 4WK9A 4PB5A 3LK6A 2ON3A 2UY5A 4I9AA 5C6MA 3R58A 4IL0A 3PAJA 1TCDA 4HNUA 3W6MA 1LF1A 4DELA 3WF3A 2ZX6A 4EPKA 1YBQA 1FH7A 4QLLA 2DVTA 3DECA 1XD1A 1ITQA 4K68A 4RLIA 2J7CA 4RV3A 3PUGA 2PRHA 4ZOEA 3T9PA 1JI2A 3VNMA 1E1CB 1GQIA 4PMQA 3ZR6A 5LNSA 3A64A 1NVMA 3LCFA 1VPXA 1ZJHA 1K02A 2W92A 4YIWA 3H4GA 3LU2A 1JZ4A 3T0DA 2P1FA 1HG3A 2REQB 3MYOA 1V02E 1OEPA 5LZLA 1J18A 1TR9A 1BFNA 2ABBA 3GBEA 2GL5A 4L6HA 4UQBA 2VNCA 3QXBA 4R7OA 3TYZA 3A5VA 2YR1A 1WZMA 2C18A 2QCEA 2GWGA 2Y5SA 2DGAA 1I1XA 1VPQA 3O07A 7ENLA 2WSPA 4AY7A 2QCDA 4I9JA 5G1YA 2YDSA 4EKJA 4FX8A 4WX2A 5CZTA 3QZAA 4AZ7A 2HK0A 1YPFA 3F2CA 1S3TC 5JH2A 3KTCA 3QHNA 1IV8A 4KEZA 2ZXBA 3IGHX 1LBLA 3WQWA 4Q4MA 4UTWC 1FWWA 4ICMA 3CZLA 2O9PA 1C8XA 3VOJA 3ABQA 1KQZA 4LAZA 4N9CA 4J40A 3I68A 1K8ZA 1W17A 1VLIA 1VYSX 4O54A 1TPVA 4Q8VA 4JTJA 1OX5A 1QBBA 2DT2A 3OG2A 3W87A 5CBIA 3M0XA 2R14A 3VKCA 2HV5A 1A5CA 4HZMA 2WSKA 3HMJG 1CX9A 3G22A 5EY5A 2CLIA 3O1NA 3S4TA 1FKXA 2FZBA 1W56A 7XIMA 2OOGA 2TYSA 1E1CA 1AD4A 1ITXA 2P0OA 2YSWA 3VD9A 2YL8A 1Y65A 4KWSA 5J5RA 4MY9A 4I9TA 5KZMA 3WQCA 2IXVA 4Q4SA 1FXQA 3EMQA 2QJMA 3KVLA 5AZ1A 1QWKA 2AKZA 2Z2UA 5HR6A 2ZX8A 4W9TA 3Q94A 3PAOA 2D23A 2D0HA 1HO4A 4W8LA 1W1PA 1POKA 1JQVA 3VIFA 3ZT6A 5HQEA 1BYCA 2HXUA 4J2MA 4NHVA 2ZUVA 1VGAA 3FA3A 2JF6A 4AD5A 2PBOA 4FO4A 3TQ0A 5LIWX 1SFLA 1XYLA 3PTMA 4D8ZA 4FNQA 4FXFA 1A4MA 4IPLA 3B8DA 3E2QA 1ISZA 4EPDC 5I3JA 3QPEA 2A3LA 2WJEA 4PRWA 4JX6A 2YDAA 2YA0A 3OOQA 4AVFA 3WMCA 1PIFA 1I2QA 4YVPA 4E8DA 3HA1A 2BXZA 3WNMA 4US5A 4YCPA 2QYGA 4Q4QA 2Y62A 2J66A 2QF7A 1X98A 2JKEA 5M17A 1KO0A 4CEXC 3KUMA 1C93A 3ENLA 1UOKA 5LNRA 1KFJA 1LROA 1KXVA 1V3KA 2WMIB 4ICNA 2QMJA 3NDZA 3IVTA 2NSOA 1JXJA 4PC8A 3OGVA 1RSCA 4LGXA 3A4WA 1EFZA 1SR0A 2W79A 2NX1A 2BS9A 4DO4A 3GXFA 2BOFX 1OZQA 3GTHA 5BMWA 1DHPA 3RG6A 3TK7A 1JR1A 4YTUA 3G8EA 2Y61A 2QJIA 4CU8A 4WXZA 5A6BD 5E9XA 4DJEA 4HSNA 2VX5A 4PMZA 5HQLA 4U31A 2J9ZA 4DY1A 5FSEC 5K4ZA 2R9RA 3BLPX 3AIEA 5BRBA 4GZJA 2E6YA 1FHVA 2VENA 3BMWA 3TAOA 2GQ3A 3MUXA 3DYOA 1VBUA 1CIUA 4EF9A 3C6CA 4YMZA 3OODA 5I79A 3W7OA 4ICCX 4D6IA 4Y2WA 1GPFA 2C8NA 4FX7A 3MSGA 1E6PA 3QV9A 4BEUA 3T8QA 1N8FA 1U22A 1ZB5A 3CXOA 1KQYA 3RFAA 4NZFA 4AMCA 1PTGA 3VDCA 3NQBA 2J27A 4GFIA 3TTEA 3W74A 1LOQA 4IMFA 2G3NA 4CD6A 3S6OA 3JS3A 2Z1XA 2G96A 1H41A 1KXHA 1T40A 3BV4A 3WD3A 5IHRA 5HWNA 4K37A 2OOFA 3RM8A 3EPNA 3GDBA 4IQJA 3LCLA 4Y8FA 3QFEA 4TX6A 3LPFA 3WYZA 1TTQA 4OHQA 2OLHA 3AJ7A 3PJTA 4O12A 1OX6A 1MW2A 2X42A 1FTXA 4O0QA 2QT3A 3MUIA 3UJRA 1X1OA 1RCXB 3FCPA 4UNLA 1VBGA 3P14A 3UT0A 1PX3A 2V38A 2A3EA 4R85A 4CKQA 3THAA 4XSLA 1HXJA 1UIPA 2J7HA 1EB3A 4C6BA 5FEWA 5CAKA 4Q8QA 4E8CA 3EDEA 3ZR4A 2YFNA 3W7DA 3W7LA 4XKYA 1FWFC 1JCNA 2I56A 1JQXA 1DE6A 4LAKA 3P82A 4HU3A 5I3FA 4IXXA 1NELA 1FWHC 2DU2A 5FL1A 2XVKA 5FEXA 4P7NA 5I07A 1W1A1 4QHRA 3EA3A 3PNUA 4E2BA 2GJLA 2PD9A 4C6KA 4ASTA 1G6CA 2IKJA 4KWWA 5BRQA 4BR1A 1YE6A 1F74A 1VEPA 3C2OA 3MV11 5E9AA 1KFLA 5KMYA 3CLMA 5F4SA 4CNNA 3LHWA 3GU1A 4AYSA 1US0A 3H7RA 3AIBA 2NQ5A 1YHTA 1HX0A 3WQEA 1GOOA 5FF4A 4PCNA 3B06A 3KTSA 1P0BA 4L6DA 1OFAA 1FWRA 1PO9A 3W6YA 3AHXA 5C9UA 3BSGA 1EJWC 2D2HA 4DYEA 2WVUA 1NDVA 5CZ0A 2AOSA 4OTKA 4O1CA 4P7LA 2A79A 4BFAA 1XFBA 4QDMA 3BAWA 2O4QA 3PB0A 3WLKX 4C60A 2IW0A 3ALFA 4LEFA 3NOYA 1T6MA 2FH6A 6TIMA 3RRAA 3ZJ6A 2R94A 2VD8A 3LGDA 3OYZA 1VBJA 5J8LA 1OCNA 4O1FA 3UYIA 2VGFA 8A3HA 3ZLHA 3HF3A 2VZSA 1A47A 4PTMA 5I2UA 4Z1YA 4IMCA 1OC6A 5ECUA 4ZBCA 3TN5A 5GVJA 3FKRA 2HBXA 3CL8A 2WWCA 2PP1A 1GZJA 1GOIA 2XGZA 3QR0A 3HPSA 1NOUA 1DYSA 3S42A 4YN5A 4AD1A 2PBGA 2QHAA 3I65A 5CBJA 4B91A 1FKWA 3L12A 1DWFM 3W2NA 3LPGA 1J6PA 1B4EA 3NQGA 3KOFA 3WQVA 3A21A 5CH9A 1MNSA 1NP2A 4DXVA 1ONWA 2DZXA 2QGYA 2DZSA 1A0EA 4HMDA 4WJXA 3WK2A 4JNMA 1HL8A 4NILA 4S2BA 1TVLA 1SSGA 4Z1CA 1RY8A 2ABAA 1TJRA 2DZAA 3OB8A 5FD0A 3WJYA 4B2DD 1OJXA 1GTEA 5C9XA 1NWSA 2PC8A 1KM6A 2GDQA 2VX6A 2W27A 3QQWA 1YE4A 5BMXA 1FX6A 2DUXA 2PS2A 3NDOA 4GZIA 4O8RA 4O52A 4HZ6A 1EPXA 4D6JA 3MY9A 1XR2A 3HM7A 2PDJA 4FNSA 3AXHA 1YTKA 5BROA 5C9WA 3B3DA 1NTHA 3PUEA 3LUTA 4YWSA 4RNFA 4AD2A 5J04A 2XHYA 1OG0A 2EG6A 2VFEA 1YX1A 3OG3A 5FJUA 5T8GA 4QAIA 3I4KA 2P3ZA 3N3MA 3EYPA 5M5DA 3W83A 2VC7A 3ZWSA 1FWEC 3T42A 1K3UA 4NG3A 4CNTA 3CTTA 1FHLA 1AZ2A 3UF9A 2INFA 1BRLA 4RNHA 3IUDA 3C3UA 4IFRA 4PMUA 3SJ3A 3SZ8A 3S9ZA 3AHZA 4ZB2A 4GC3A 2NX3A 4IJRA 3ZSSA 2DIEA 5F4XA 3L67A 5A8PA 2ZWZA 4W87A 2RDWA 1ICSA 1IEVA 5I78A 2PSNA 5D2WA 2CBIA 1EYWA 4GOAA 4GUJA 1OIFA 2WMFA 4BQ3A 1W9DM 1E6NA 3HPAA 3VGFA 4V33A 1RH9A 1WCGA 1IXPA 3C2FA 4S3CA 5D9PA 3WLTA 1O6IA 2NQ9A 4YPJA 2EKCA 3C4UA 1RD5A 3A47A 5IDIA 4UOJA 2C13A 1XRVA 3WO8A 1XBVA 4N4QA 3LLXA 1RCQA 4IIGA 3IIXA 3W7MA 1AW1A 3SCOA 3M5XA 1LT8A 1OHLA 2OWXA 3UESA 2I9EA 1KNWA 1W5NA 2WLZA 4NZ1A 4AF0A 2H3BA 1MZHA 3KRBA 4ATDA 4H04A 2VELA 2KZHA 3KRUA 1K6WA 1QHOA 4JXCA 3VNZA 1UKTA 2DZVA 3DFSA 3KLLA 4NT0A 3GS6A 3GDLA 5BXTA 2G3JA 2AKMA 3W1UA 2Z7KA 4B16A 4WXYA 2WNZA 4PB4A 1WO2A 5BU6A 4PBGA 2CITA 1WZLA 3G3DA 2J4GA 1R9YA 3A3WA 4S1FA 1X6NA 5EYWA 4IIFA 5H8UA 1J5SA 3DKLA 2PFHA 4OJYA 3VFCA 4WZHA 3V5OA 1DPMA 2ZUMA 3R10A 4IZGA 4IIDA 2VFIA 1TWWA 1IXNA 3LHTA 3B8VA 1QWGA 1CW2A 3VTRA 4W93A 2NSXA 1XS2A 2C6QA 4ROPA 2NWSA 2DT1A 5SWUA 1LWIA 2VQTA 3C8NA 3RLVA 1WKYA 1V6VA 1KWGA 4PMXA 1EBHA 1DQWA 3ID7A 1U33A 4D6CA 1TJ0A 2I1OA 1GVIA 2QCCA 2CBVA 2BXVA 1T5AA 2VZOA 1FWGC 4KKXA 4J7RA 5CPNA 3NQAA 3JZEA 1CB2A 3RU6A 1SO4A 3E5BA 2VEPA 2VEFA 2VWTA 4DLMA 3KS6A 2QIWA 4MY1A 1PX8A 4OT7A 5E09A 3BDKA 3ARPA 1C90A 2FPTA 5F4WA 3IS4A 5A6JA 3NNTA 4Q4OA 3AISA 4DZ5A 4PZVA 4C90A 4WGHA 4AISA 2HSAA 1TFVA 4OOZA 1TWZA 3URQA 4R7JA 3CS2A 2BY3A 2QW5A 1GZ1A 3STPA 1LL7A 2YCLB 3JZUA 4OUEA 4O4WA 1E6SM 4R9XA 2QAFA 1ESWA 4M80A 5FCZA 5LA2A 1WX0A 1N7KA 4UTWA 1QW8A 4UFLA 5U7SA 4PEKA 4GG9A 2BMBA 3MUAA 1GTHA 3LBMA 3SW6A 2AL1A 4V27A 2Z28A 4FX6M 4UFMA 4FR1A 2VYOA 4US6A 4LUSA 4MWAA 2BV9A 1NDZA 1UJPA 3C86A 4XVDA 3WF4A 1CGVA 4AVNA 3M5ZA 2OMAA 4TTUA 2QUUA 4AFYA 4LX4A 2NQLA 3SUTA 2QUNA 2R1KA 3M7SA 1UWQA 1K8XA 3C0QA 3H2FA 4I5UA 4L1XA 1V3LA 3E1F1 1LWHA 1O5KA 2C1HA 4QEEA 3H23A 3QGVA 3WLOA 3WFZA 1E15A 4KCVA 2QQ6A 2BB0A 4I6KA 5HUPA 3ECQA 2F38A 1NF7A 2OO6A 3MDUA 4JS3A 4IGMA 3N1AA 2EPOA 2IKGA 1T8QA 1W37A 1TV5A 2J7DA 4TMBA 4GIRA 1RBLA 1E9ZB 3QBUA 3B0PA 1AODA 4HHLA 1TV4A 2AGKA 4A8LA 2QPSA 5LNVA 3HN3A 4GBUA 4LCSA 4IPIA 1UQYA 3SSJA 3SGGA 3N34A 1QBAA 4JHZA 4LRSA 2OSXA 5JH1A 3BMXA 1TJ2A 4KEMA 4PCPA 1GJWA 1UZDA 2YCLA 4JICA 4C1KA 4L56A 4N6FA 4O1DA 1KXTA 2HTMA 1K9TA 3EDFA 3W7RA 5AYBA 2YXOA 2PTYA 2RJHA 3R12A 1D3HA 4ZQCA 1G1YA 1EDQA 2VRJA 1V6YA 4HNTA 4ORIA 2OFJA 1QPKA 2OR2A 4HHMA 2XVNA 1OFOA 3E3HA 1PZ0A 3QJAA 4OU1A 1PV8A 3WK3A 3AS0A 3W1MA 4UTFA 3WD0A 3WLHA 5D2VA 5CSRA 2HK1A 4Z0JA 3EB2A 4ATLA 5TIMA 2ZA3A 3NQ7A 1MW0A 4Q4PA 3UETA 5FEZA 1FOBA 3U2ZA 3EX1A 1EOMA 3HFYA 1FHUA 2PWFA 1RUSA 3GR4A 1X6LA 4BJHA 1DBTA 1S5MA 3H8AA 4XZMX 1K03A 2QUVA 3WIJA 4AY8A 3BCFA 4Q6JA 2PGRA 4JIIX 2PEVA 4ORMA 1GNXA 2OO0A 3GR8A 3UZ5A 2A3BA 4EXQA 5CPLA 3HQOA 1M5WA 3CB8A 5D33A 3TUUA 4N6EA 2H8ZA 3VX0A 3BOFA 4FLRA 4D6FA 1HF6A 1VFOA 3BPWA 4X22A 3ZYZA 1QO2A 3HG4A 5IOBA 4ERAA 1QI5A 3UXAA 3SQMA 3KOWA 4QG8A 4TX8A 2G37A 3PTQA 2J75A 2ZVRA 1RBOB 1XLLA 3VMPA 1KXQA 4NJKA 1B90A 5J5DA 5MHBA 1M53A 3WUBA 4A2RA 5AYXA 1EP1A 1UUQA 3TLQA 3RM4A 1W8SA 3PZQA 2V81A 2VGGA 3KBSA 3FDKA 3CHDA 2PGEA 1C8YA 1UR9A 5HR7A 1CXLA 1B3WA 1SZNA 3BQ6A 4TVDA 1S2UA 3RITA 3RCYA 1N8IA 2D0FA 2ZZ7A 3NVDA 2XVLA 3T4CA 4K1GA 3EX2A 4RW5A 3MHGA 1B3YA 3SSZA 1EA9C 4FOKA 4WLCA 2PDPA 4HOZA 1BGAA 3INPA 1AUSL 1NEYA 1XICA 8XIAA 1E1EA 4ZA0A 1VJIA 5CKSA 3TYBA 1E4NA 3OBKA 2D69A 2DSUA 3ZS4A 4KBXA 2YOCA 1YKWA 4N4PA 5HJYA 2R1LA 3IRSA 5DCDA 3W1QA 1G7VA 3HU7A 4HZ7A 3QTGA 4GVIA 4U33A 3OIXA 2HXTA 3I3DA 2JIEA 4JYEA 4DPQA 4LCRA 1DJXA 2VRQA 4N02A 1JVNA 1XD0A 4XVEA 3I10A 1M68A 1NJJA 1AQFA 3IJIA 4BQ2A 3VKAA 1PTAA 3CT2A 5E6YA 2DJLA 1LQAA 3TJ4A 3WDQA 2O0TA 3RPMA 3M44A 3OZPA 5DMLA 3C56A 3GXTA 1AVAA 4H3DA 4IGHA 4YTRA 1XHGA 1D3CA 1HKWA 1FCQA 2PPGA 1EGMA 4NJJA 4H4IA 1V6WA 2PU1A 4CUCA 3B8IA 2V9DA 3SCVA 1QTWA 3B0YA 4DF0A 5MKGB 1XGEA 3PPCA 5GNZA 4LF1A 1IEIA 2E68A 3S0CA 1MZRA 1IF2A 4H1ZA 3O16A 4DJFC 1WBJA 4NXSA 5XINA 1RR2A 3NO5A 1JULA 1KFWA 3V35A 3RDKA 3LV5A 2QCFA 1YIXA 2V5DA 4K36A 3CO8A 3WLIA 2GK1B 1WXZA 3CM4A 4MNMA 5REQB 3SADA 4BA0A 3W00A 3BXWA 2CXGA 4L64A 3EWWA 4XWUA 4ZQOA 2OYMA 4LH8A 3FSUA 2D20A 2V30A 4I7UA 3RU8X 3QC0A 4A3RA 2A0NA 2JF7A 1EP2A 1F5ZA 1RJPA 3DGRA 3VE7A 5HINA 1OG6A 4O1AA 1LBFA 3S1UA 1H3GA 1RQHA 4WF7A 4Y90A 4PTXA 4C6DA 1HN1A 3L4WA 1Z48A 4JYFA 3WJZA 3BLKA 1HJQA 1UWIA 1H1ZA 1VIWA 4MPQA 3HV9A 1S5NA 1R3YA 3VUPA 2PP0A 1AMKA 2NUXA 1KTCA 3AMLA 3AJXA 1TELA 3CUJA 3W85A 6REQA 3QVQA 4PTVA 2V67A 3E2RA 2GVLA 3GXPA 2JKAA 1BG4A 1D3GA 3AIVA 4OBSA 3TZNA 1JF6A 1LT7A 1TPH1 4Z2GA 3TNOA 2ZRVA 5MKGA 3SCPA 5AC6A 3ZQ9A 4PMNA 4L9XA 5FAGA 4GLEA 4WY0F 3DFYA 3VIOA 3HBLA 3QV6A 5AYIA 4IX0A 2XDFA 2XFWA 1HZYA 5XIAA 3NYDA 3GRIA 4OQVA 3IGUA 4KFOA 3GK0A 4JL1A 4GXMA 4MMWA 4GYPC 4MZYA 2GK1A 1VLWA 1R7OA 4JTAA 5A2AA 4MWAE 4IMGA 3HFTA 4XD4A 3ABXA 2OKTA 9CGTA 2XM2A 1CGXA 5LNWA 4LYKA 5BWFA 2A6NA 4IG2A 4P7QA 2R82A 4C7FA 1WDDA 4EWJA 4CQ8A 5H8MA 1EOKA 2VR4A 5D05A 3CUXA 1DIOA 2QDDA 3A13A 3N29A 4HK6A 5HULA 4HGXA 4H9ZA 4HHPA 1ZTVA 3N6JA 4GUIA 1MYRA 1VFTA 2A1YA 3THDA 2Z6JA 4UCGA 1XGZA 5LHFA 1OFDA 1EEXA 1UCWA 4DI9A 1EJXC 3CUIA 3M0IA 1GYNA 3S1XA 1KR0A 4ZOAA 3DIPA 5CJNA 4NX5A 5JIWA 4LVDA 4PFMA 5H1WA 2ZZ2A 1DXIA 3SCWA 2GDVA 4B5VA 2VUNA 1KRMA 1ODUA 1DWJM 3N6HA 1TPEA 3BJFA 5AYYA 2VC9A 1FVPA 3LRLA 2Y7EA 4MJ4A 2A21A 4N0RA 1ITUA 2YW4A 3H7UA 3E2VA 3EZ4A 1O95A 4QXIA 3LBOA 1M7JA 2YL9A 2GGIA 1WQ5A 3V18A 4GIAA 2BVTA 4LXFA 3WENA 1SYTA 1JPIA 2QVHA 1BXCA 2E40A 3EEGA 1MUMA 2VFHA 3H53A 1O5XA 3CZJA 2G4FA 4DWSD 4JTUA 1O4UA 3GC2A 4PEEA 4DLFA 1DV7A 3WMSA 2A2IA 3LHVA 1WUFA 2Q3RA 4ADSA 5FJRA 1W5QA 4HYVA 1V3MA 1W3IA 1EJSC 4GY1A 4GO8A 3BG5A 1W3NA 2Y7GA 4JTQA 2IMRA 4UUIA 1OFQA 3QYQA 1UA3A 1IEXA 4R88A 4CN1A 2POTA 1ZNNA 3TXVA 3BICA 5I0DA 1UC5A 2X1RA 5M2FX 2PB1A 3CAWA 3PZOA 4LVAA 4J27A 2PLCA 4H8VA 3EOUA 3QF0A 2J24A 3VIMA 2PTZA 1EO7A 3U7BA 2RGMA 2ZTKA 2Y4SA 3Q2DA 1S2TA 3LEPA 1VKFA 1GHRA 3MZ2A 2HBVA 5DANA 2WYSA 3CV1A 3L68A 5FEPA 1I0DA 3IK4A 3F4WA 3BW2A 3E02A 4GKLA 3GFXA 2HROA 3BTNA 5A94A 4DUXA 5FF3A 2ONEA 4D71A 2FH8A 4ZFMA 4LQ1A 4CU6A 3R8GA 2W9MA 3KS5A 4CCDA 1SZFA 1CYGA 1T0OA 1TTJA 4Q4RA 4FNPA 4H9XA 1NOFA 4AXNA 1Z3NA 3SN1A 5CQ1A 4UQEA 2Y2WA 2VTFA 4OECA 4BY3A 1HKIA 4FR6A 4PL2A 1J9YA 1Q5MA 3CWNA 4W88A 2XH7A 2HISA 4N42A 2BTMA 2ZUSA 1D2KA 1JDCA 1ZGDA 3ISIX 3N18A 4QDWA 1VFMA 1MW3A 2NLIA 3RN6A 1UZ1A 5FESA 2SFPA 3M5VA 1K9EA 2XYLA 3RPTA 3ABOA 1GVOA 3PZNA 1C8QA 5AHEA 5AVHA 3TWBA 1PCKA 2XIMA 3R25A 3R7MA 3T09A 3IJ6A 4WOQA 2QCGA 1LOLA 1L8NA 4UTLA 4H9MA 2J88A 4LBRA 1EEPA 5FF7A 1M7OA 1F76A 3PSWA 1THFD 3LPOA 4QIUA 2GVGA 2PDFA 1DWGM 1PL9A 1Q2SA 4GZEA 2Q09A 4ZO7A 1UR0A 4MLRA 1TG7A 1UZHA 2F84A 2WM0A 3UR2A 2GUUA 3S6TA 2YBUA 3PZ9A 3P5YA 5FA5A 1W5MA 2F6XA 2WZTA 2D2OA 5TF0A 1P0DA 3O0KA 1KCZA 3CZEA 2PI6A 3K8MA 4PMYA 2PDIA 2XZ7A 3MI6A 3E0WA 4LAMA 3G6MA 2WHMA 3U5UA 2IPGA 1QHZA 4IWWA 2E9LA 2R1NA 4F40A 1OD0A 1E9IA 4GY7A 1J2WA 4J28A 3G1RA 3P60A 4XAZA 4UMAA 1CXFA 1RV8A 1L6SA 3W7EA 1IZKA 1O5RA 5D30A 1DP0A 5C9ZA 3P81A 4C6MA 1C92A 4GIEA 2XTKA 3O06A 1GQNA 1UPPA 3RLGA 3ZOAA 1TUFA 4DJED 3KL5A 1LLWA 1DQUA 4F0MA 5I23A 1JAEA 2C79A 3MPGA 3NZRA 4XZHA 2VGIA 2Z2BA 2IXUA 4JNYA 3EPOA 3PZTA 1C91A 4YYFA 1A5AA 3BG3A 4Q3MA 3BARA 1X6UA 2DJXA 1QPQA 1VQTA 4NKCA 4H00A 4GHRA 3MUCA 4NAFB 2E1WA 4K6AA 3VNKA 2XIOA 4Q8UA 4AZIA 1HP4A 2ASHA 1UD2A 1BXNA 3SO7A 3B8UA 2YJQA 5JU6A 1V3IA 3LG3A 1ME9A 5CZSA 1QXLA 4HOXA 1EHNA 4F9JA 1XLIA 3LTSA 3IGXA 2V68A 3MHFA 4PMDA 1EJUC 4ZQMA 1JPHA 2VL4A 4KS0A 3TQPA 2AAMA 4ZO6A 4GNVA 5C0QA 3S2NA 2WMKA 4Z1DA 1HJUA 3VNYA 4DM2A 2YKKA 2J7BA 1KM1A 3QEZA 4FIQA 3M0YA 3WFAA 1YQ2A 5ECVA 1Q66A 1EXBA 5CSUA 1S1PA 3CUGA 1WDPA 2XIIA 3RR4A 3CPUA 4DX3A 3AWNA 2QZRA 2QCHA 3C2EA 5FJPA 4YS1A 2VRKA 4HNLA 3EDKA 1FQ0A 3WX7A 4GNJA 3ZLFA 3TC3A 5F7UA 1JCLA 3QW4B 1TO3A 4DXXA 1VFFA 1OYBA 3L21A 4BKNA 3VFLA 2VHLA 2FDSA 2EPLX 1H1YA 3MO4A 4NUWA 2PP3A 2WAGA 4IM4A 3V36A 1GEQA 2E9MA 2X1UA 3G0SA 2DT3A 4M3PA 4ADTA 3FJNA 3S1WA 5FJJA 1S5WA 5G1MA 1ISVA 1E56A 4C91A 2O55A 2E09A 3SUWA 3EOOA 4LV4A 4JTHA 2QDEA 1K6AA 3VD3A 2VEGA 5EGRA 2DEPA 4R3UA 4JFSA 4NQ1A 4LTSA 1EX5A 3EWBX 4YCOA 2YA2A 4QCFA 4XX6A 3VZYA 4P2VA 1QOPA 1KA9F 3USZA 4H8HA 5E93A 2CIPA 1W1YA 1OGSA 1Q7QA 4BQ4A 1OBAA 4QRNA 4Q8OA 1QU4A 2AL2B 2A7PA 5CC3A 4PH6A 2UY3A 1XQKA 2ZX7A 1VF8A 3QKZA 4KEUA 2ZBTA 4XBJA 1R2TA 2AQVA 1KFCA 2VGBA 4C7GA 1XLCA 3OGSA 4A3HA 4G6CA 4U10A 1F6PA 1JD7A 3B40A 4M6QA 4Y9NA 2YBVA 4Z2IA 3P3BA 3CZGA 3F2BA 5CEWA 1DXFA 1UWRA 4GKTA 2QLYA 3G8RA 5KEZA 3CWHA 3E0IA 3WCZA 3CHVA 4C6JA 4PYSA 1E0TA 2G95A 1XIFA 1R2SA 3RMJA 3TV8A 2VJXA 2GLKA 3TW7A 1K4GA 3HG3A 2CHOA 1Q4WA 3UXLA 4B9ZA 5A6AA 3GIYA 1UWSA 3LSCA 3TAKA 3SY8A 2OSYA 1OGGA 1M04A 2I5IA 4JN6A 4UNIA 3HG2A 3R43A 3PBMA 3PFMA 4AX6A 4PGLA 1GOKA 3EDJA 3QZEA 4JD4A 1M7PA 1YNYA 3QY8A 1EJ7L 3F7JA 3FGCA 4WSJA 3KZSA 1WDRA 1QOQA 3OLIA 3W1RA 2C16A 1W6TA 3JUGA 3MSDA 4J35A 2XH2A 3CV7A 1F3WA 2AL2A 3UGRA 1QI4A 3VILA 4JY8A 2PWUA 1MWOA 1L6YA 1EDGA 1XBZA 1NDWA 1OD8A 5F2LA 1AQMA 5HK4A 1W3HA 4B5SA 1CXHA 2YGYA 3VCCA 1LLZA 4RV8A 1J93A 4DXKA 3DHUA 9XIMA 3W82A 1XYAA 1J0IA 1XLKA 2Y7DA 5CG0A 1IEWA 4IFKA 2QUMA 1XIHA 1CLXA 1TMLA 4H6KA 1O68A 1HT6A 2IKIA 2FPVA 4DN1A 4J9JA 4ZEPA 3DYPA 2WNQA 3T1GA 4HK7A 1K8CA 1J0YA 3W23A 5FL0A 3AS3A 1DWIM 1VRDA 3LLFA 1SW3A 3UJEA 2Z00A 3W02A 4WDWA 3NTYA 3ARZA 1MDRA 1YPIA 1EO5A 3DFOA 1QR7A 4Y9PA 3R89A 1PKNA 2GJXB 4H2HA 1AL7A 5EBAA 4XK2A 2QV4A 1RY0A 3IRDA 4DUVA 5HQMA 3M47A 3P61A 3AMKA 2EHHA 1TZ7A 2BOEX 1H49A 3GH4A 3T2OA 1Q2RA 3H21A 1M3UA 1OK4A 1VFSA 4QM1A 1PCWA 3ATZA 1J79A 3UG8A 3DFTA 3N04A 3VXGA 3LHZA 1FCUA 4PR4A 3V16A 4XTDA 3WG6A 2DIJA 3W7JA 3TW9A 3PPFA 1E9LA 4HJWA 1GG1A 4ZE4A 4XZ9A 4ZE5A 1E51A 2CZDA 2V3EA 4RK8A 4QLKA 2VX4A 1I0BA 3WQFA 5IBXC 3TN6A 3HPXA 1QNRA 1Y5VA 3CLWA 3H2MA 4HZ8A 2YFOA 1IR1A 1Q4NX 1AA1B 1JF5A 3OZYA 4Z2HA 2H6RA 4KIEA 3NQDA 1Q8AA 3S2JA 4DJDA 1EIBA 2PWEA 3KHDA 1REQB 2IPJA 1EC7A 1VH7A 4RNJA 3COTA 2BODX 4PRRA 1XIGA 4ZTYA 4GYPA 1SFSA 3UEQA 4L4LA 5D2XA 1VEMA 4B4FA 1HJWA 4XO6A 1UR4A 3MSYA 5CPMA 4EXBA 3MYPA 4W4QA 3FXYA 1EX1A 2FZ9A 2NZLA 2OEJA 3WMLA 2A4AA 1E4LA 1U1JA 4AX7A 2PDNA 3D5HA 1W9UA 2GVJA 3FEQA 3PJUA 3QGKC 1V4YA 2ESCA 3TJIA 1BKSA 4CD7A 1XYZA 4NZ3A 3NA8A 4CD5A 2VEMA 1XLMA 1GW1A 3TTQA 1PZ3A 2I57A 4HOWA 3WK1A 1UD4A 1YNPA 2X30A 1IZCA 4A3UA 1UR8A 3WNOA 1TVPA 2WMJA 4BWLC 3STCA 4E3VA 4GVHA 5AKQA 1CCWB 3O2LA 4QNEA 4AVOA 3APYA 4GABA 1UZ4A 2J77A 1XRTA 4LUYA 3UW6A 3GR7A 2FGLA 1DJGA 4Q7NA 4RE4A 1BVWA 1LUCB 1N8WA 1RK5A 5LSMA 3AO0A 4GC4A 2ZYFA 2PF0A 5C55A 2PLJA 2RDTA 4GXWA 1S2AA 4CLMA 1Z42A 4UC5A 2Q6ZA 2I5QA 2WJFA 2OG9A 4AHOA 4A4AA 2NUWA 5E0FA 3WKZA 1CZ1A 1R3TA 2GSJA 3G77A 3TA6A 5D02A 4M1RA 1SW7A 4XISA 1NIUA 3AU2A 2HVMA 1FXPA 3LDVA 2ZZ1A 4KFNA 5DN1A 3AQUA 3LYEA 4B3ZA 3QOKA 3VA8A 1FP9A 1PIIA 1MDLA 2YPIA 2R91A 4ENLA 1ONRA 2J7FA 3R79A 4DVOA 3PP7A 1XPYA 4IPPA 2WJZA 1HNYA 4JQ3A 4K7YA 2C0HA 1Q6QA 4DBSA 1MFVA 5A2BA 4WY0B 2Z27A 1XBXA 3MU7A 3KBWA 4MWAD 3BGAA 3NO3A 1JDEA 4O57A 4YXGA 4JY9A 5DMMA 1F8MA 2WZEA 3TU9A 3KE0A 4UOQA 1Z6KA 3DC8A 1BSLA 3RF9A 4JHMA 3T05A 4WOZA 1WDSA 1LUCA 1ME7A 4IP5A 3AIRA 2X05A 2WBGA 2A5HA 4HB7A 4MZ8A 1P0EA 3WD2A 3VI2A 3REQB 1V3JA 2DSKA 4JKKA 4BCEA 3NAVA 2CLEA 4Q8PA 5I24A 3S3GA 1PZ2A 1QPOA 1R5YA 4YJ5A 4RKAA 3CMJA 3SCNA 4Q8WA 1YPXA 3VKBA 3N2BA 2BY0A 3QMSA 1XLAA 5FKYA 3MMTA 3L7RA 1GVFA 2GJNA 2JGQA 3PPHA 3W70A 1X1ZA 3H12A 4A05A 4DBWA 3YPIA 3NGFA 1H7XA 4GXPA 2E5DA 4IQLA 1L6WA 3P93A 3L2LA 4AIUA 2VC5A 1JGIA 5K7JA 3B8TA 4L9ZA 3BLFA 4X60A 1TVNA 3QSRA 4PBEA 1H7NA 1UYQA 3IJDA 3HZ3A 3N2CA 4AZCB 1MQQA 3V0TA 4PE8A 4TUFA 5AC7A 2BGNE 4WY0A 3UY7A 4HYWA 4IHCA 4C6EA 1J11A 2DV0A 1G94A 5TQLA 2IPWA 3BURA 2PWDA 4AC7C 5TNVA 2A3AA 5FSDC 2ZXAA 3UNTA 5A6MA 3RIKA 3W2JA 2V3GA 4Z42C 1OT1A 2CLMA 1ECQA 5A6SA 1ZP4A 3GIQA 5IFTA 1MO0A 4ZZ9A 2VQUA 4MB4A 3AROA 3W7NA 2E8ZA 3WLJA 1JIBA 4M0XA 3PULA 1MXDA 3RPDA 3V1HA 4AH7A 1I2PA 1TWDA 3T0BA 1W3KA 3WQDA 5K4XA 1TWSA 1NQ6A 3WH7A 1VJSA 4L1GA 1VAHA 3A23A 5DBUA 3DFQA 2OCZA 4WDXA 2OT0A 1QI3A 4GI4A 2E9BA 3QW3A 3U0HA 1Q7ZA 3FX4A 1UKQA 4UZSA 4ML4A 3ARWA 2GZXA 3EXTA 4N9DA 4H6QA 3GXNA 3T7VA 5K2ZA 1CENA 1GWJA 1HJSA 4IT1A 1GOMA 3TW6A 3W2UA 4QROA 4TR9A 3IJLA 3FVDA 2YZRA 3F5JA 1YDVA 3N2TA 3NQFA 1CWYA 1PXGA 4ZO8A 4KPLA 1L6FA 4MNKA 1E1FA 3VCRA 4DIAA 2DVUA 4NI3A 1XIBA 2QPUA 3T07A 4AG0A 4FA3A 4LFYA 3EOLA 1JCYA 4N9BA 4O13A 5G5IA 5IDZA 4MG4A 3LMZA 4C6QA 1H63A 2QCNA 5EFDA 4Z2LA 2PZNA 1GONA 1QW7A 1LP6A 2VR2A 1TZZA 3WMBA 1AJ2A 1D8CA 3N14A 3ITXA 1VBHA 3VIIA 2HNHA 2NT1A 5A95A 1A5LC 1E40A 2RAGA 4C1NA 3GVVA 1PJ9A 2GWNA 3TR2A 1NF0A 4IF2A 4IMDA 3I4EA 1PIGA 2NT0A 3KWSA 4H8UA 4AHQA 3U4FA 4IIHA 3OIHA 1A5UA 4R7WA 1BWLA 2EG7A 4FF5A 3E74A 1SJBA 5A2CA 3GHTA 1ZAHA 3GHSA 3SFWA 3VYLA 3VDBA 1GQJA 1HO1A 3C0SA 4G9PA 3BG9A 1D8WA 4UNKA 3IAPA 3DGBA 2J79A 3P7YA 1EQPA 3VVGA 2WKJA 2F6KA 4BEQA 1N82A 1P6WA 3N3TA 2IS7A 1QVBA 3JRKA 4CCCA 2YYTA 4JHOA 1HJVA 4HNNA 3MO7A 1MW1A 4NSBA 2WPGA 1XUUA 1ZP3A 4S3BA 1IE7C 5I00A 3K2GA 1D7FA 3BOLA 2MANA 3LA4A 3DHFA 3S47A 2GYIA 5CSSA 1VP5A 5JBDA 3RILA 5F1VA 3B0UX 1V79A 4LT9A 3DG3A 1S39A 4KCUA 3K4WA 4HP5A 1JYVA 2YCKX 2XU2A 1FWNA 1OZMA 4LOCA 4X9SA 2WQPA 5CZJA 2A85A 3R11A 1OM0A 4B9YA 5IHSA 2WVVA 1WXJA 1FFQA 3EWUA 1LL4A 2Y8KA 5C5YA 1JYNA 1DL3A 3R1ZA 2YCIX 1R0MA 1ZAJA 1E4IA 3VO0A 5H91A 2WLYA 2HE8A 3ARQA 2E4TA 5G4EA 4C7DA 2BZNA 1OVDA 1DTUA 1GJUA 2WHLA 1TV7A 3PPGA 2V5JA 2NVCA 5CGQA 4ZENA 1WXYA 2PDKA 4LAOA 4AD4A 3IIOA 2PUZA 3SCSA 3S5SA 3K5XA 2CHNA 2OZTA 1MVYA 3BW3A 4AYGA 4Y9MA 3GW3A 1XG3A 2EBNA 1W1IE 5LXEA 4GCXA 3H2NA 2VKZG 4EWND 3C2VA 3RCMA 4AEOA 2QKFA 1OIMA 3DEQA 2ZDSA 1JFXA 1XSKA 2ZUWA 1CT5A 1XLGA 4PSPA 3UVAA 1XUZA 3D3FA 4W85A 1YW1A 1Q63A 1G4PA 2CLHA 3BAJA 1R9ZA 3O6CA 1TX2A 3STFA 4PUUA 1HL2A 1IEQA 2WVTA 1V77A 3SECA 4AIEA 3QYSA 3CYJA 3WY1A 1BEUA 4LUIA 4ZOBA 3SIZA 1CGWA 2ZX5A 3AUJA 2VEIA 4J2PA 1KD0A 1Q6OA 1RA0A 1R3WA 3L65A 1KRCC 2NVAA 3M07A 2PWHA 4ZR8A 3M0KA 2YIHA 3PG9A 3IJ9A 3TYEA 3WUEA 4FLSA 2ANUA 1X39A 1I4NA 3QV8A 4JTRA 3A9IA 5A6BA 3TONA 4JTEA 1UQZA 3EWZA 3TSBA 5KZ6A 5DMNA 2J47A 1RZMA 3CMFA 2WBKA 4C6FA 2XUCA 3BANA 3UCQA 4HMCA 2I9UA 4UOZA 3PZUA 1RA5A 4IQEA 4IPNB 4LALA 3RGTA 3AYSA 4LBUA 4YTTA 3MV01 2OZ0A 1ZENA 1ZJBA 2TAAA 3N9RA 2WANA 3NM1A 4C6NA 3M7WA 4RDYA 1LWJA 3U7VA 5FF2A 4M24A 3WLRA 4Z1AA 2ODOA 1EUAA 3DYMA 4O4VA 3EKGA 5BZAA 4CU7A 1IWBA 4QS5A 4GACA 4W89A 1FDZA 1GKQA 4JQ1A 3FJ6A 4AD3A 2P76A 1H7RA 3LMYA 3EKZA 3HJEA 3RLHA 3S9IA 3WQ6A 2J8FA 3DI0A 3GDKA