4NVTA

Crystal structure of triosephosphate isomerase from brucella melitensis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
249
structure length
249
Chain Sequence
b'IRPLVAGNWKMNGKGESLTELRAIAAGLSSDLGRKLDAVICVPATLLSRAAETLEGETVGLGGQDAHFKTSGAHTGDISPEMLKEAGATHVILGHSERRTDHHESNKLICAKTEAAWAAGLVAIVCVGETASERKAERALDVIGDQLSGSLPDGVTAENTIIAYEPVWAIGTGLTPTVQDVRAAHAFMREQLIERFGAKGAHLRLLYGGSVKPSNAAELLGVADVDGALVGGASLKAADFLAICETYRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Crystal Structure of Triosephosphate Isomerase from Brucella melitensis
rcsb
source organism Brucella melitensis
molecule tags Isomerase
total genus 88
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nvtA00
1JUEA 1KV5A 4N9CA 2FPYA 3ATYA 3F03K 3GIYA 3IVSA 2E68A 1H1ZA 1FDYA 3EXSA 3T55A 4JTFA 3TMQA 1F6KA 3DHFA 3QQ0A 2X1SA 4UTIA 2O7SA 1OVDA 4QSHA 2QCDB 4O14A 1ZAJA 2ZRUA 1OFDA 4EF8A 3STEA 3GB6A 4WD0A 3CEUA 3S42A 3E02A 3TAOA 1TPB1 3C2RA 3BW3A 3LGEA 1TQXA 4PEKA 1MO0A 3EWYA 3LLFA 5J5DA 1SW7A 3W70A 4NX5A 5BMWA 1S5TA 4GNJA 3K30A 1OHLA 1SSDA 5G2HA 5KITA 4OQVA 1F73A 1HUVA 3RF9A 4ZL1A 3QPZA 3W7NA 3P81A 1TPH1 2TRSA 3MJYA 2WSQA 3QSTA 2FTPA 4LVFA 2NV2A 2Y61A 1ONRA 3PSVA 4GUJA 4I9AA 2Y63A 3A21A 1F05A 1TTIA 2C13A 1DBTA 3HJZA 4A3UA 1GTEA 5HNRA 5U7SA 3NO5A 3S1VA 4MZYA 1YTEA 4UFLA 3TE9A 1TSIA 3LXBA 1TYGA 1VJIA 1NVMA 3C2VA 1I45A 1HG3A 3UZ5A 3O07A 1JR1A 1WA3A 2H3DA 2V8ZA 4UTWC 1AW5A 2DZVA 3B8DA 4PL1A 2AGKA 1PCWA 5DXXA 1QNVA 3ZFHA 4JTKA 1Y0EA 3W2MA 1GPWA 5F1VA 4KWWA 4LRSA 4NZFA 1WXJA 2CLMA 3FFSA 1G4EA 3KVMA 3B4UA 2QUUA 4CNOA 1B57A 2CZ5A 3MBDA 3QJAA 1F7BA 1FUYA 2IQTA 3LBMA 5G4WA 2GQ9A 5J5RA 2R91A 3TH6A 4NUWA 2XN1A 4K6AA 2WPBA 2ABAA 3F4WA 3IVUA 1QWGA 3HG2A 5BNKA 2YX0A 5FF0A 3KRZA 1KM3A 3KRSA 3W9ZA 4NU7A 3L0NA 2PC4A 1Z42A 1Z48A 1JUBA 4JTUA 3G0XA 4ORIA 3HOJA 3T44A 4IXHA 3CT7A 2RKXA 3ELFA 1M5WA 4ORMA 3NYZA 4UFMA 3FLUA 4X3ZA 1LRQA 1EA0A 5FI8A 2P10A 2OCZA 2TYSA 1F5ZA 2QCMA 3LCFA 1B4EA 3IIZA 1KM2A 4MZ8A 3TXZA 2X30A 4WOQA 1G67A 3W2UA 3W88A 3W3OA 3IIOA 5CSSA 3NZ1A 3NQAA 4YCOA 5LHEA 5LHFA 4EIVA 4K8HA 3LRLA 4K8EA 3L2IA 2FQIA 1YXDA 1GG0A 4UIOA 2PE4A 5DXYA 3DBPA 3WJWA 3P5ZA 1TB3A 3IGXA 1DJQA 2Y89A 4M6QA 2A6LA 2V81A 1ML1A 2CZFA 2G96A 3TR2A 3W7OA 5FEPA 4YXGA 4O4VA 3W1LA 1LP6A 5CGQA 1C8VA 1GG1A 3NL6A 5HUPA 2H6RA 2LLEA 4QIUA 4HNNA 4I7WA 3BW4A 1X6UA 3NQCA 3P82A 3PUEA 1JUKA 1H62A 4NZJA 1X1ZA 3UWVA 3I65A 3W1AA 1IXOA 4QNEA 3LDVA 5KZDA 1TRDA 5F4XA 5F1UA 4S2BA 3W1XA 2YDAA 1W5MA 4JY8A 3BPWA 3HPZA 3O1NA 5A5WA 3OBKA 4ZQCA 4G1KA 4CNPA 5KZMA 1OFQA 3EXRA 5D32A 3G22A 4DO4A 5LNSA 3EX6A 1K8YA 2UV8G 1VLWA 3L5AA 4FNUA 4Z0JA 1BTMA 1VPXA 2ZZ6A 3BLIA 2QJIA 4YMZA 3G1HA 3GYEA 5K9XA 3W7CA 4O28A 3UWWA 3OVQA 3L0GA 4AVFA 3MI6A 1IIGA 3CTLA 2VFHA 1G7VA 2CLKA 3A24A 4Y96A 3NDOA 3DH7A 4UTUA 3OIXA 4N2YA 3P74A 3LCXA 2A7NA 4OV9A 4UMBA 1AK5A 4WX2A 4PC8A 5AHLA 4FNPA 3W1MA 1F76A 4R53A 2ZA3A 3SZ8A 3UWZA 3GAKA 5IM51 4UNKA 3GDMA 5CZ0A 2ZYFA 3NR0A 5IBXC 4H3DA 1GVRA 3KX6A 1JQXA 3O8AA 3W07A 2WNZA 3W2KA 2FIQA 2F7FA 3E9AA 5F2GA 1IF2A 5K4ZA 4JDYA 1AL8A 1FXQA 3IEBA 3G0UA 3D0CA 1UB3A 4DXVA 2I1OA 2NUXA 3N73A 3L9CA 4E2DA 2VFEA 2NX3A 4U28A 4PL2A 3N9SA 2CWNA 2Z6IA 1ZCOA 5C6MA 1LORA 3LI1A 4MJZA 1NSJA 2YFNA 2ZBTA 5D03A 1TV7A 5CSRA 4MUZA 2NXGA 4U4MA 3P60A 2G5WA 2GUUA 3L66A 4MFEA 1TPUA 3L21A 4M7TA 3SI9A 3GKAA 3TROA 1A5BA 1B3OA 1VRDA 5E0KA 3WJYA 5TIMA 3L5LA 1G69A 1PS9A 1VLIA 3TJXA 1TO3A 5A8GA 3Q58A 2R94A 3DZ1A 1VCFA 4KFPA 1FWNA 1VH7A 5FEWA 5CKSA 1AG1O 2F84A 1L2UA 3N34A 3UWQA 3M0ZA 4JX4A 2CU0A 4MLRA 1OABA 1P5BA 1OYBA 3FJLA 4OE7A 3HF3A 2A85A 1KFEA 3FS2A 2VEPA 2VENA 4EWND 1KTCA 4NVTA 4MYAA 3SW6A 1T99A 5F2IA 3LHZA 1VCVA 2JK2A 1N55A 2QCGA 5EBUA 5KZEA 4IGHA 2HMCA 3ABRA 1I2QA 1TJRA 1LOQA 3M16A 5CZJA 1WX0A 4O15A 1EPXA 1BWKA 3TA6A 1YADA 3NM1A 4BWLC 1QOQA 1W3IA 2A21A 2NZLA 5CZSA 5BOOA 4BK9A 2WJZA 2E5BA 3C61A 4UMCA 1CX9A 4JTSA 4N6FA 3AO0A 1QDSA 2RH9A 3G1SA 5DELA 4LUJA 3GK0A 3MYPA 4BR1A 5LGZA 1RQBA 1LZOA 4PA8A 2NV1A 4ADTA 1P0NA 5D30A 1YPFA 2QUVA 6ALDA 3T78A 4FB7A 5AB3A 4JYFA 1MXSA 5HINA 1KFJA 3QSRA 1Z44A 3EWXA 5DCDA 1W1ZA 3KHJA 4OBTA 4AF0A 1H50A 4NJIA 5D2TA 1FQ0A 1WV2A 1BKSA 3C6CA 3TNOA 4O54A 1EIXA 3E96A 4IX2A 2QEZA 1VZWA 3LV6A 4AAJA 4N4QA 4XTIA 1LYXA 3KOFA 3NPWA 3PSWA 5CG7A 4IQLA 3W7RA 3DENA 4NQ1A 3FYPA 2ZRXA 3BVJA 3BW2A 4LW7A 3W84A 3PG8A 3QYQA 3TSDA 3MO7A 3NQVA 3M5XA 4B5NA 2DU2A 4IPJA 3QZEA 3BGGA 3EEGA 1QOPA 3ABSA 4UTHA 3A5FA 1PHWA 1TIMA 3SR7A 5G2IA 3ZS4A 5K4XA 1QPNA 3BK0A 2ALDA 3F4NA 3LRKA 1RVGA 1EUNA 3W1TA 4ALDA 1C9DA 4LY8A 2YXGA 4LUIA 3QW3A 5I3JA 3W7IA 4RX0A 1RZMA 2Y85A 3MWAA 4XTDA 5DN1A 3M5YA 1MEWA 3LOTA 4RZ4A 3W1NA 1GJPA 2QJHA 4RXFA 3NVTA 4HKPA 4JR5A 3MHUA 2YSWA 3NEVA 2E5DA 4N9DA 3N3MA 1DKWA 3E49A 2VFIA 4KFOA 1OF6A 3NPUA 3G1VA 2DJXA 7TIMA 3HGSA 5FF3A 2FFCA 2GJLA 1Q3NA 1LOSA 2HTMA 4GUFA 1CI1A 1NFBA 5DLCA 1UUMA 1IXQA 2CLHA 4XZ9A 5AHEA 1LRNA 4E38A 1E51A 4DF2A 1Q6LA 5DCBA 2X2GA 1KBJA 2GOUA 4PCFA 4O12A 3IIVA 2CLOA 2CLFA 4MPQA 4Q4KA 2FB3A 1KLYA 1KTNA 2QCLA 2YR1A 3QH2A 1OK6A 4EVZA 1LBLA 4MJMA 5G4EA 2J88A 3QM3A 1OG0A 1VHNA 4LV4A 4O11A 1W8SA 4MVAA 2Z0IA 3NQ6A 1DL3A 3UXDA 4IMGA 4LVBA 4QISA 4RZ5A 3KVKA 4CNNA 4JTGA 2A2IA 1OX4A 2GJNA 3FA5A 3CWOX 4Z0SA 2DZUA 3TC6A 3MI2A 5AYYA 4DPPA 3GX9A 1VYPX 4ADUA 4YL2A 1C29A 1QPQA 3PBWA 4UMAA 5D33A 3RU6A 1K3UA 4WY0A 4GJ1A 3S1WA 1OK4A 4O13A 3C0JA 4HT3A 1W5OA 3B04A 1DQXA 5FF4A 2B4GA 4N6EA 3C4UA 4O0KA 5TQLA 3TV8A 2BXVA 4O53A 2BLEA 3W85A 1ME7A 1Q6OA 2X1TA 1IGSA 3W22A 1S5VA 4JY9A 1K7FA 5AHNA 2Y7EA 3LI0A 1EEPA 3ZWSA 4NJGA 5LNRA 1SZNA 4MFDA 4O1BA 4BI6A 1ZALA 5DCEA 4HPXA 4TMBA 3TCEA 2W0UA 4AHPA 3I68A 3BARA 1GWJA 4FF7A 3LRMA 3EWWA 4NJHA 4WJEA 3HGJA 3TAKA 2V5BA 3LTYA 2NUYA 3T40A 1OX4B 3KAOA 1SW0A 1KFCA 2ZCGA 1ADOA 1HTIA 3R2GA 2OMAA 4LVAA 5AYXA 2Y70A 4ZMGA 3U2OA 4ONVA 2I14A 1VCGA 5AHIA 4OWGA 1O5KA 4KWVA 5D37A 2VEMA 4GC4A 2V5LA 4HHPA 4FIQA 2HS8A 2Z1BA 2E6YA 1FWRA 4GFSA 3W76A 2OT1A 3NQ8A 1JCXA 1M7PA 3CPRA 2CFFA 2XFWA 1KBIA 3QMTA 3LHVA 4M6VA 1G6CA 3NA8A 2BZNA 2ATMA 1QR7A 1YYAA 1GVSA 2ZRZA 3NL3A 3PB0A 1TV8A 1W56A 2JKAA 2Q3OA 2CZEA 4YWIA 5D05A 1Z41A 3SSJA 4N02A 1NF7A 2VOMA 3Q2DA 2P0OA 2ZFAA 4TIMA 4DF0A 3UWUA 3TQKA 3TK7A 3LTPA 2J9XA 4XKYA 4UTMA 4LT9A 2GVGA 3GDRA 4P2VA 4UCGA 3AJXA 4I7VA 4Z1BA 4A2RA 4ZQMA 2E6DA 4K38A 3TFCA 5AYZA 1JRBA 4NNAA 2VFGA 1F6PA 5AHMA 3W2JA 2A6NA 3G1YA 3S1XA 3LX9A 1OFRA 3QRHA 1SZGA 2E6AA 3DFSA 5I3HA 4A21A 2BX7A 2QJGA 5K7JA 5DBUA 1KM5A 3CIWA 3VCRA 1VHCA 4UR8A 3NZRA 3MI3A 3F1QA 3FKRA 4DBDA 4NJKA 2BSLA 1THFD 2C14A 1J4EA 4BI7A 2VELA 1ICSA 1U83A 4RZ6A 5EYWA 1KFBA 1N8FA 4IMFA 3IVTA 4O1AA 3BO9A 2C18A 1WBHA 3GR8A 3A23A 3DFPA 3VNDA 3UPWA 5EKYA 1ZENA 1HO4A 4DBEA 2Y7DA 3LM7A 5GVJA 2CLIA 3DI1A 4GXMA 4O19A 1H7RA 3RLVA 3WK0A 4YCPA 4TR9A 2OJPA 4GE8A 3PS7A 5SWUA 3WK1A 2ABBA 3W1QA 2HS6A 4N9EA 1XDLA 2RDTA 1LROA 3THAA 2CLLA 1O4UA 3IV3A 2XN0A 4R34A 4BFAA 4IMDA 1KLZA 1H61A 2E1DA 5HULA 3YPIA 3THQA 1ZNNA 1V5XA 1S3HA 3KRUA 4JNMA 3GR7A 4E2BA 3MYOA 3OVRA 5HJLA 2QAFA 1AL7A 3C56A 4Z08A 3W2LA 1X1OA 5FEXA 3UZJA 3R89A 3C52A 5K2ZA 5CPMA 3EKLA 3LCIA 3O06A 1TJPA 3P5YA 3LTSA 5I3KA 3LLDA 1IIHA 5D02A 3TIMA 1JCYA 1LDCA 5F4WA 3SIZA 1OFOA 2ISVA 3UD6A 1K7EA 3NQEA 4XUGA 3VE9A 3W7LA 2QCFA 5EMUA 1ME8A 1K8ZA 3P61A 2EPHA 4X2RA 4P61A 1XI3A 3B0PA 3NQMA 1VYRA 5LNUA 3PVFA 1TPDA 1KV8A 1IXNA 3C3NA 2V9DA 5KINA 3G8RA 5HWJA 1OFEA 4M6PA 3PG9A 4LTSA 3S1UA 1A5CA 2BWGA 1GQNA 3TW6A 2ZRYA 1NAL1 1VGAA 2DZSA 3BLEA 4O57A 4FNRA 3VKJA 2DP3A 4L4LA 4W9TA 4EOUA 2VC6A 1D3HA 3W6YA 3IGSA 4AEOA 5CZTA 4CCEA 3LCGA 4LVGA 1L6WA 1OFPA 1XDMA 3T4CA 2Y88A 2Z6JA 3EX3A 2OX1A 3GNDA 4JX5A 2D73A 3HPXA 1SR9A 4GBUA 3M1ZA 2DZXA 3LV5A 2Y7FA 3W1UA 3WJXA 3QFEA 3HPSA 4M7SA 1LTDA 1VYSX 4UTTA 1H60A 4TMCA 2YFOA 4Z1DA 3MP5A 5HR6A 1N7KA 4XQ6A 1R2RA 2X16A 4Y9AA 5CPLA 3TC7A 1SQ7A 2JGYA 3UXAA 3RNDA 4D2JA 3CWNA 4GWEA 4AHOA 3GAYA 2NX1A 4ZQNA 2ZTJA 1UUOA 2EF9A 3KFTA 4UR7A 2B7NA 4JICA 3FOKA 5FEZA 1M7OA 3GXPA 3I7QA 3NPXA 4A29A 1I2RA 3LXCA 4O1DA 4LRTA 4GUGA 3G1AA 4FXSA 3TJLA 3GVGA 5HMSA 1UCWA 3TDFA 4JIPA 4AMAA 3EWUA 2YYTA 5TBOA 1XXXA 1EP2A 2ZZ3A 1W5PA 1GEQA 2DZPA 1KM1A 3EKZA 4RKAA 4JTEA 3ANYA 2J9YA 3TQVA 2C16A 3NQ2A 5L9FA 3MBFA 3NL2A 1WAUA 1HO1A 1G4PA 1P1XA 2C0AA 3VI2A 1VR6A 3E0IA 3TUUA 3HG4A 4BF9A 3SGZA 2XN2A 2QCEA 2E09A 1SPQA 4IXXA 4HNVA 4NXSA 1X7FA 3W7PA 1FCQA 1H1YA 3G1FA 3CQ0A 3M9YA 4ML9A 1LBMA 3EX2A 1LCOA 3UWYA 1KFKA 2BTMA 5AN7A 3PUDA 2WKJA 3O6CA 3WJSA 3MHFA 3NQGA 4ADSA 5AHFA 3EWZA 4R7JA 2B0MA 4O1CA 1OFAA 1TPC1 1YTDA 2H90A 3EXTA 1Q6QA 3LCHA 3TQ0A 2FPTA 5U4NA 4LS1A 4UC5A 2Y7GA 3BG9A 3N19B 1EP3A 3DAQA 3DKJA 3NOEA 3B05A 1Q6RA 2X1UA 2FPVA 3PF3A 2QCNA 4S2CA 4PODA 3HB9A 4OU1A 2QR6A 5LSMA 3LCLA 3CHVA 3CEPA 1XUUA 3I7RA 1H51A 2HSAA 3MP4A 3O15A 2QCHA 3GXTA 4A2SA 1H7XA 4K37A 4N9BA 3NXFA 1LRTA 1W31A 3LCWA 3DFNA 3LHTA 2DORA 4IPIA 3CM4A 5LNWA 1BEUA 2ZZ5A 4O50A 2ZA1A 1SZEA 2G97A 3C2EA 3L5MA 4UFKA 3UYCA 5BRBA 1W3NA 3B03A 4MLJA 4NNCA 3M47A 1H7OA 1MEIA 3QMRA 4K39A 5DBTA 1YDNA 2YW3A 5F2MA 1EUAA 5D2YA 3UY7A 1YDVA 1JCNA 4QITA 1SO6A 4POCA 3G3DA 3NGJA 4NX0A 2KZHA 1L6SA 3P84A 2I9EA 1KM0A 1FBAA 4K7YA 2ATSA 2P1FA 1WYIA 3O6YX 2NWSA 1SU5A 2E77A 1NF0A 3WK2A 4I7UA 2VEIA 1GTHA 4HPJA 1FCUA 1H5YA 1WBJA 1ICPA 2RDWA 3H53A 3I6RA 2RHGA 4AF0B 1JULA 4HIBA 3WJZA 4LWWA 4JD4A 1TTPA 1FCBA 4QNWA 2ZDRA 1OYCA 1V7YA 3NQFA 1XL9A 2B7QA 3IIXA 3L68A 3SFKA 3QC3A 2AQWA 4O8RA 4RK8A 4AHQA 5EL1A 3A5VA 4HSNA 1PCKA 2TSYA 4ICNA 3C8FA 3S5ZA 4UTWA 2QCDA 3BGJA 3W7DA 2TMDA 1KA9F 1QPRA 3TSBA 4MZ1A 1ALDA 2R8WA 4WUIA 5CPNA 2C6QA 4FIRA 3USBA 3T7VA 1ICQA 2WSRA 3STFA 5AC6A 1QCWA 3N2MA 4H6KA 3W7JA 1ZJIA 5BMXA 4UTJA 4UTKA 3STGA 2EKCA 1LM1A 5G1YA 3W75A 5D38A 2GVLA 1O60A 3M44A 3W7QA 3VE7A 1ZAIA 4ZZ9A 4CLMA 2CLEA 2Q8ZA 4AWUA 1OX5A 1TMHA 4O0ZA 4ZQPA 1G4SA 2W79A 3TW7A 4UFJA 3STCA 4OT7A 5AC8A 4H4IA 5D2XA 4Z1CA 3LBCA 3W74A 4RV8A 4A22A 3BG5A 3PAJA 3GKFA 2R14A 1AMKA 4WQ6A 4IJBA 5C54A 5HUOA 5LZLA 1A53A 1YPIA 2GQ8A 2A7PA 5E1QA 4L4MA 1XCFA 4KFNA 1FDJA 2V30A 1DHPA 5G2WA 1RR2A 1EP1A 3PC0A 3GDLA 3TMLA 2VFDA 3W71A 3BG3A 3W7EA 3DI0A 3N9RA 2DZTA 4CCCA 3G3MA 3P62A 4PH6A 3BV4A 1TV5A 4DQWA 4DF1A 1XBVA 1D9EA 1AW2A 2AAMA 3CU2A 3RMJA 1RQHA 1SFJA 3EWBX 1LLZA 1LBFA 4IOTA 3HIJA 3TSMA 3NM3A 4FNTA 2ISSA 3Q37A 2EGZA 4AWTA 5CPOA 4NT0A 1H7PA 4BI5A 4KKXA 1FY6A 2PRMA 4CCDA 1FCVA 1GZGA 3PWAA 2PRLA 5L6UA 2JBMA 1TTQA 2JGQA 3G8EA 5T26A 1T96A 4RR4A 4GRSA 4O17A 3MMTA 4JGDA 5K3VA 2EAWA 4E0CA 1RQEA 3MHGA 3TKFA 2WQPA 3L65A 3GXNA 1WOAA 4WY0B 3FYOA 1WOBA 4FNSA 5D04C 1SW3A 2ZZ2A 2FDSA 3P80A 5HR7A 3CB8A 5BW6A 1QFEA 1LLWA 2VEKA 1TTJA 5MHBA 2B7PA 2JKPA 3R12A 4AXKA 5KTLA 1OFBA 4HN4A 3DFQA 5C55A 1SO3A 1FWTA 4IUOA 4WZHA 3PY2A 3JRKA 3GDKA 1EWEA 2GQAA 5EY5A 2WNQA 3P67A 2DJLA 8TIMA 1EWDA 3DXIA 3NL5A 1I2PA 3S5YA 1LOLA 3L0KA 3R5EA 4CQAA 3W86A 1OYAA 4JEQA 1TQJA 3DKLA 3ABOA 5G1TA 2FB2A 2RDUA 4DELA 1G7UA 3QMSA 2PURA 4FEZA 1L9WA 1SFLA 4DEFA 1TPVA 2FLIA 3FJ6A 2ZQ0A 2QDHA 4JN6A 2QF7A 1I2NA 3A22A 1PIIA 2CZDA 3IRDA 3L67A 5LGXA 4N4PA 4GUIA 3FEMA 2V2DA 1A50A 1FXPA 1R2TA 1WQ5A 2QAPA 1NEYA 1CW2A 3DHDA 4UFIA 4S1FA 2H8ZA 1VS1A 2WOQA 3W2NA 1FWSA 3M5ZA 3BLFA 2EHHA 4FX7A 3CIXA 5FESA 1XBZA 5IBXA 4JXCA 4JYEA 4XKYB 1JJKA 3PUOA 3TX9A 3O05A 4QQ3A 2NXIA 2G95A 5E93A 3FIGA 1D3GA 2OZ0A 3RFAA 3GDTA 1A5AA 2Q8LA 1QMLA 3TU9A 4RXGA 3O63A 2X1RA 1J5TA 4O52A 1H7NA 1W54A 2V82A 3A9IA 2JKEA 3NAVA 4LC6A 1OF8A 5F4SA 3W7KA 5AC7A 1VC4A 1GVQA 5I3FA 4IX0A 3M5VA 2C15A 4MY1A 1VQTA 5K9DA 1UJPA 3QF0A 1FDZA 1F74A 3MW7A 4C1KA 4QM1A 2C3ZA 5D09A 2Z2UA 4O10A 2QDGA 5I3GA 3N14A 1S5WA 1I4NA 4LS0A 5HQEA 4HNUA 2E6FA 3OVPA 4O4WA 4Q32A 3LXAA 2NLIA 2A0NA 1A5SA 2C19A 4JTJA 3HG3A 4MYXA 4X9SA 1W37A 2PCQA 3GNNA 4TX9A 2Y62A 3JS3A 3EB2A 4DO6A 3NQ7A 4UUIA 3IIPA 5HWMA 3JR2A 1RV8A 1RPXA 2A1YA 3I7SA 4MY8A 1JCJA 1J2WA 3KVJA 1W5NA 2Q3RA 2WV8A 3LHWA 3FKKA 1G4TA 3PBUA 1SSGA 4FXRA 4TU1A 1L6YA 4FHAA 2W6RA 1XBXA 1XC4A 1JVNA 3PULA 4ZQOA 1ZAHA 4Y90A 4JTTA 3DFTA 1F2JA 3OG3A 4UNLA 3U8GA 4JX6A 2GPTA 3DGRA 4YLWA 4ZQRA 5HWNA 1K03A 4K36A 2A4AA 2V2CA 4JS3A 1SO4A 4QAIA 2H3BA 3NNTA 1XUZA 3ABQA 3R8RA 2VXNA 1GVOA 1AW1A 3OHIA 4LV9A 1IXPA 4JTIA 5KSWA 2J27A 2FJKA 3ZWTA 5FF2A 4IMCA 1R30A 1XFBA 2ZTKA 3PB2A 4BWLA 2YZRA 1QPOA 3PR2A 1GYNA 2YGYA 4R33A 4NJJA 3MP3A 4M5PA 4MY9A 3WK3A 1TREA 4AWSA 4RCXA 1OX6A 3C2OA 1JCLA 3C2FA 5EA9A 3WFAA 2NWRA 3RK8A 3HG5A 3LERA 2RFGA 1YTKA 1WDWA 3O16A 4MOZA 1ZHAA 3E12A 1ZY9A 3VFLA 3SGUA 5AFDA 1FX6A 3UY8A 3HMJG 3S5OA 2ZRVA 3M43A 1DVJA 4IWWA 1DV7A 1B4KA 1YDOA 1UBSA 3QPYA 4JYDA 5D2VA 1KFLA 2ZZ1A 3U6WA 1YXYA 4HNTA 1DQWA 4QJ1A 3TFXA 3HQ1A 2WO5A 2H8XA 3V1PA 3CC1A 2J9ZA 2V0TA 5D2WA 3QEZA 1K02A 3G0SA 4WOZA 3W7MA 2E5CA 3MUXA 3M7WA 1W5QA 1TPEA 3P8IA 3H54A 1M6JA 1R46A 3G1XA 3QQ1A 4ZVJA 1YLVA 3EX4A 1GYLA 4LS2A 1RD5A 4OV4A 4LNYA 1P4CA 1OJXA 3O6DA 1TCDA 1YXCA 1JRCA 3S0CA 3GZ3A 1HL2A 2CW6A 1EB3A 3HGOA 1H63A 1W3TA 4AB4A 4EF9A 1GOXA 3NPVA 3NQDA 1MEHA 4LOCA 1P0KA 4FX6M 3S9YA 5ABTA 5EPDA 1X8FA 2NX9A 4TO8A 1SZFA 2VFFA 3OA3A 4DPQA 4JTHA 3ZR4A 4LVDA 1H7WA 5I3IA 2ISWA 2YYUA 3SJ3A 4PTNA 1TPFA 1SO5A 4XBKA 3S6DA 3HGRA 3UQNA 3DFOA 3GLCA 2DZWA 1PL9A 1EX5A 2QUTA 5FF7A 3M41A 3HBLA 4JIQA 3V75A 1K8XA 2J24A 4UXDA 1JCMP 4WXYA 4XBSA 4XWUA 1DJNA 4K7VA 2ZA2A 3B0UX 2V2HA 2WNNA 4M19A 3R13A 2NUWA 1ME9A 2WSYA 1MSSA 3PM6A 4UTTC 3G18A 4DO5A 1JQVA 1TRIA 2YW4A 3W1PA 3KVLA 6TIMA 4JDBA 2TPSA 1PVNA 5LNVA 3OEXA 4WY0F 3DU0A 2C1HA 4C1LA 3B0VC 3LHUA 4IMEA 1UASA 4LU0A 3EX1A 1W0MA 5H2ZA 1T8XA 4Y6GA 5AOUA 2B7OA 2OT0A 1QO2A 4AH7A 5C2XA 4Z1AA 2A7RA 1DOSA 1PV8A 4Y8FA 5K9CA 1KW1A 3W83A 1O94A 4O16A 1XBYA 1DORA 4OGZA 3S8HA 1FWWA 2O7QA 3SECA 4O18A 3TXVA 3G1DA 2GVJA 4J9JA 3NG3A 1QAPA 4JTLA 1PE1A 1BWLA 4MKNA 1R47A 4FNQA 1QO5A 1O5XA 2ZRWA 1KTBA 4UFHA 5KMYA 4FX8A 3B06A 1Q45A 4FO4A 3W1RA 5H91A 3IGUA 2VKZG 2J6XA 3QW4B 1O95A 2PRHA 4WXZA 3S5NA 3UPBA 3LB0A 2Y6ZA 4RLIA 2ZZ4A 1PHQA 4UTLA 1HFBA 2QKFA 3PBVA 2ZZ7A 3G24A 3HO8A 3N2XA 3H55A 5C5YA 1KM6A 1MZHA 2NXHA 3PBYA 2YPIA 1SUXA 5DY2A 1U5JA 4PFMA 3KXQA 1XKYA 3CLMA 3P7YA 1XM3A 2QCCA 3P8JA 1T0OA 2YCEA 3Q94A 1ZFJA 4OHQA 3UNDA 4MIMA 1K7XA 3W87A 4Q33A 5F2LA 4GUHA 4LC8A 1KM4A 1I2OA 5LKYA 5DY3A 3INPA 3W72A 1R2SA 4X22A 3ATZA 4NNBA 2A5HA 4RJEA 4CQ8A 3W7GA 1GVFA 4NXKA 3LHYA 3W23A 3W73A 3SY5A 1TPWA 5G5IA 4CQ9A 1I8JA 3RLUA 3W7HA 1GT8A 1B9BA 3M6YA 4HSOA
chains in the Genus database with same CATH superfamily
1PX8A 2C7FA 4YHEA 1REQA 2UY3A 3IVSA 2E68A 1E0TA 5D4YA 3EXSA 2ANUA 5IXEA 1QHPA 2AGTA 3K4DA 3IK4A 4EPKA 2O7SA 1TFVA 3WLMA 3WLJA 4TQTA 3GB6A 3E02A 2X0YA 3UFYA 3C2RA 4EAYA 4PEKA 3QLDA 1DIOA 1MO0A 3EWYA 3UWEA 1E1EA 5E0FA 1ONWA 1JZ4A 3E0LA 4GNJA 3K30A 1SSDA 5AVHA 2EBNA 1F73A 2W63A 3EOSA 4GYJA 1HUVA 1DPMA 1UQYA 2WC4A 3U57A 1A0CA 4IIDA 3W7NA 2R1LA 2PLMA 3QSTA 1HQTA 1AZ1A 1ONRA 2JALA 4GUJA 3VOHA 5BCAA 1WKDA 1POJA 4JN7A 4DWSB 3W0KA 1DBTA 5I2UA 2DVTA 3HJZA 1R3SA 1J6OA 3UCDA 3ENLA 4URIA 1YNPA 3LXBA 3HQNA 3OZPA 1UOZA 1WA3A 5FSEC 3BICA 2BFGA 4C90A 1OBAA 1PUDA 3ZFHA 4JTKA 3KOZA 1Q6EA 1PAMA 4PFHA 3FFSA 4K68A 1GZ1A 4YU1A 2OX4A 1MYRA 1B57A 2CZ5A 2Z25A 3MBDA 3H7UA 4C5YA 2BGQA 1FUYA 3NCOA 1QHZA 5IOBA 4Q4PA 2OR2A 2YL9A 3MO4A 2W4XA 3CS2A 3TH6A 2BGNE 2QXWA 2PPGA 4K6AA 2NQJA 4F8XA 3F4WA 1QWGA 5BNKA 3ANUA 3E5BA 3F2DA 2VRJA 1KM3A 4KEUA 3W37A 3W9ZA 3U5YA 3L0NA 1KGWA 2PCEA 1TVLA 1Z48A 3WLLA 4UZUA 1UWTA 3T0CA 3ZJ6A 1FH8A 2PTWA 4IXHA 3VNMA 3CT7A 2EJ1A 1KFWA 4GI4A 4GINA 3LLXA 4X3ZA 2OCZA 3LCFA 2QCMA 3VGDA 1B4EA 3IIZA 2PF0A 4WOQA 3W2UA 1FWCC 1R3RA 4YCOA 1CXEA 1MXDA 3L2IA 4AZCB 1M53A 2PE4A 4A8NA 3P5ZA 1TB3A 4I5XA 3PJTA 1DJQA 2Y89A 2WZEA 4MB1A 4M6QA 2A6LA 2CKSA 5FEPA 2PWGA 5JIWA 4HTBA 4YXGA 4N7QA 4QSFA 1XRFA 2P0IA 5CGQA 5DMMA 1UD5A 4ZENA 3B0YA 5HUPA 2H6RA 1DE6A 3LZ5A 4C6PA 4QIUA 4FAMA 4HNNA 3SGGA 3BANA 1HX0A 4PEEA 1JUKA 2D3LA 3NZGA 2BMBA 3I65A 1IXOA 3CL6A 3LDVA 1S46A 1NWSA 5F4XA 3TTYA 1KBKA 1E9IA 4S2BA 3W1XA 1W5MA 1IWAA 5A5WA 1BWVA 2AMGA 2AQVA 3G22A 5LNSA 3LM3A 1H3GA 1VLWA 4QROA 5HDRA 1AQFA 4FNUA 4Z0JA 2QULA 4PSPA 2PWFA 4I90A 1VPXA 3BLIA 1RK5A 2OYLA 2RDXA 3RAOA 3L0GA 4AVFA 3MY9A 2ALRA 3GG8A 3DH7A 4UTUA 2XJ7A 4W84A 1QBBA 2A7NA 5HNUA 3W1MA 3F5KA 3SZ8A 3GAKA 4LEQA 2E28A 3U7BA 2PU1A 4I9MA 1GOQA 5IBXC 5BWAA 2VP8A 1LG2A 3OQ8A 1JQXA 4B9YA 2VX5A 2PTXA 3W07A 3KBNA 3W2KA 3RU8X 4F9DA 2FIQA 2F7FA 2WHKA 4JDYA 1AL8A 5EB8A 3G0UA 3N9KA 1UB3A 4DXVA 2NUXA 2WSPA 4MMWA 4K1GA 3G5EA 4PL2A 2BVDA 4X60A 3VNZA 1JDEA 1V0MA 3DIPA 2YFNA 2ZBTA 4JL1A 1BYDA 2PB1A 3RO6A 3I4KA 2Y8KA 3IK2A 3L21A 3SI9A 2FFIA 4GYPA 3I3DA 1MWOA 4GZEA 1B3OA 2EPOA 4OFCA 3WJYA 2EG8A 1PS9A 1VLIA 3QY8A 4PN2A 5A8GA 3CUGA 1K9TA 4AU0A 1VCFA 3MSRA 2WVVA 1M9HA 1KXQA 1RPKA 1P0BA 4JX4A 2AKMA 3SQMA 4OE7A 4DBUA 2A85A 3VYLA 2DGAA 4WDWA 3MMWA 1KTCA 4NVTA 4MYAA 4QLKA 2QVHA 3UPMA 3BE7A 2QDDA 3LENA 2YDRA 4IGHA 2HMCA 3ABRA 3M16A 5J8LA 4UTFA 1XV8A 3H2AA 1WX0A 2DSWA 1E9LA 1BWKA 3TA6A 4AVOA 4BWLC 3A47A 2NZLA 5CZSA 2PWEA 2PWUA 3VMPA 3EBVA 3ONBA 4CU6A 2P3ZA 4N6FA 5RUBA 2RH9A 2Y5JA 3QR3A 4BR1A 2RJHA 5HJYA 1P0NA 3ARZA 2J7DA 1QHOA 4FB7A 5HINA 4OUEA 1KFJA 1SJBA 3W6MA 1B3WA 4H9UA 1ISXA 3EWXA 3KHJA 1E4IA 2XU2A 4NJIA 1BKSA 1CB7B 3SN1A 5H8UA 4KRUA 2VO5A 4O54A 4IX2A 1E72M 4K2SA 2QEZA 1QW8A 1YW1A 4K1WA 5DT7A 3FAWA 3KDNA 2WMIA 4PUMA 1GHRA 3KZPA 4BQ4A 4IQLA 3DENA 2G50A 2VD9A 3BW2A 4G7EB 3W84A 1CXIA 3QZEA 1ZZMA 1XYLA 1XPYA 4WVXA 4UTHA 3A5FA 3AAMA 3SR7A 5G2IA 5K4XA 2HV5A 1E1CB 3LRKA 3WKZA 2PTZA 1RK6A 1C9DA 4AZ7A 4LUIA 2OLHA 4JTQA 3W7IA 3VKCA 5IHRA 3R11A 3KBWA 3XIMA 1M68A 2UY2A 1BRLA 4XTDA 3M5YA 4P7NA 2GK1A 2QJHA 5JQ9A 1V0LA 2J25A 4W86A 2PP3A 3R25A 4DI8A 3W28A 4AC1X 3GHTA 1GOKA 2VFIA 1XYBA 4LAKA 4E2OA 4MWAE 2DJXA 5LXXA 4EAMA 2VZOA 2FFCA 1CI1A 2ZUUA 1XIDA 1UZ4A 2EO7A 4M6UA 1XDJA 3WH8A 1E51A 1AH4A 2XM1A 5DCBA 1KBJA 2GOUA 1HVQA 4S39A 2TODA 1KLYA 2YR1A 3WNNA 4MJMA 2J88A 4J3XA 4CU8A 1N8WA 5MF5A 1GOMA 4PMZA 3CK5A 3KVKA 4JTGA 1OX4A 4OBRA 3AHYA 2Y5EA 4MTVA 2WMGA 1VYPX 4YTQA 4YL2A 4AVNA 4UMAA 5D33A 3OGVA 3OGSA 5AY7A 1ZBKA 3GH5A 4FR6A 4O13A 1DQXA 1MUMA 1KGXA 3TYZA 5TQLA 1JZ2A 2BXVA 4O53A 2W92A 3K13A 1S5VA 4JY9A 1J0HA 1EEPA 3M6DA 1O5QA 4BI6A 1MW3A 2D3NA 1DJYA 3M07A 4JHOA 2IW0A 2WMFA 1XD1A 1K6WA 3BURA 4FF7A 4WJEA 3HGJA 4G2DA 3M4HA 3QTGA 3H2MA 2P53A 4DM2A 2Y24A 2ZCGA 1HTIA 5AYXA 2Y70A 2NQLA 2ZUMA 2AOSA 1W9UA 5XIMA 5M17A 3FSUA 4GACA 3VIJA 1YDYA 4ZO8A 4FIQA 4LANA 2Z1BA 2E6YA 1R0MA 1HJWA 3AIEA 5HMDA 2CFFA 3T0AA 2XFWA 1KBIA 3LHVA 2EPKX 3A3XA 1E6RA 2ATMA 1AQMA 3PB0A 1TV8A 3S6TA 1Z41A 3Q2DA 2ZFAA 8XIMA 3CIVA 5D9OA 3VTRA 4DF0A 3IS4A 3LTPA 2DIKA 3LPPA 4P2VA 1OC7A 4I7VA 4MWAC 1B54A 3S2LA 4A2RA 3HN3A 2W66A 5AYZA 1JRBA 3LK6A 5AYIA 4AUBA 3AS1A 4E4UA 4K3ZA 5AHMA 4HK5A 1CGWA 3QRHA 3DFSA 1B3YA 3EZ4A 2BX7A 2VTFA 2QJGA 5K7JA 4MAZA 3BMVA 3WNPA 1KM5A 2R1KA 3CIWA 4Y8EA 3NEHA 3F1QA 4H6EA 1THFD 4BI7A 3CTTA 1U83A 4RZ6A 1G5AA 1N8FA 3B8IA 4O1AA 4G6CA 1WBHA 3GC4A 2XFYA 1YHTA 3CUIA 5JBEA 3LPFA 3PZIA 4C6LA 1QNPA 4GJJA 1ZENA 1HO4A 1QI2A 3IJ7A 3LM7A 2CLIA 4GXMA 1LL7A 3WK0A 2ZICA 4BCEA 5SWUA 2ABBA 3W1QA 1U1HA 4HA4A 4H7CA 2HDJA 3RCMA 3SUUA 2NQ9A 3ZT7A 5A2BA 3W00A 2QJNA 3THQA 1XHGA 1S3HA 4XAYA 4JNMA 3ITCA 4E2BA 3MYOA 1E4LA 2ISFA 1F9CA 3WBAA 1Q8AA 3PJUA 4BHYA 2NVCA 5FEXA 3UZJA 3R89A 3C52A 1AJZA 4L56A 3N2OA 4O1EA 3P5YA 2VEFA 3LTSA 5I3KA 1IIHA 3PZ9A 4HSHA 1RBOB 3DHPA 2XGBA 4JTCA 2ISVA 4OTKA 2C0HA 3VE9A 2PDFA 3P61A 3MUZ1 3B0PA 3PTMA 4DAFA 3AXHA 2D1ZA 1F3TA 2OEMA 3L2LA 4QR6A 3GBEA 4WIWA 4M6PA 4LTSA 3LUTA 1GQNA 2QW5A 1VGAA 3OZOA 2CBVA 3WL1A 2FZMA 4XZHA 5C70A 3GG7A 4EOUA 3UG8A 3F5LA 3ID7A 3IGSA 5A94A 4P5UA 1JZ6A 1L6WA 2ZX7A 3T4CA 1O68A 3EX3A 3HM7A 4IP5A 5A8MA 3QVQA 3U2EA 1CGUA 4GBUA 3M1ZA 3EDEA 3LV5A 3II1A 4M7SA 2GOKA 1B9ZA 3C5QA 3L23A 4C1NA 1B1YA 5A8NA 5HR6A 1N7KA 4XQ6A 1R2RA 1MDRA 4JFSA 2JGYA 1EH9A 2NW0A 4D2JA 3CWNA 4L6OA 4M0XA 4EWJA 2NX1A 3W29A 1OZQA 4JICA 4M80A 3FOKA 3GXPA 3U3HA 1XGZA 1E1FA 3NPXA 5LIUX 3VGHA 5A69A 3LXCA 1QTWA 3G1AA 4FXSA 4NY2A 1ODZA 2VRKA 3WY1A 4MSSA 3N18A 4V27A 4UR9A 4GHRA 1XXXA 4HOZA 1KQYA 2ZZ3A 1W5PA 2IQ0A 3EKZA 4ROQA 4F2UA 3TQVA 2C16A 3S6OA 4U2ZA 1UIPA 4GD0A 4NZ4A 2O56A 2V3EA 5BRQA 4NAEA 4X0VA 3HG4A 3BC9A 1HKKA 3VIGA 2XN2A 2C79A 5AECA 2KX9A 3ZO9A 1X7FA 4ACZB 3W7PA 1FCQA 1WDRA 1RALA 3SN0A 2Q09A 3UWYA 5MKGA 4CQCA 1XFCA 1KFKA 5I6SA 5BROA 5AN7A 2WKJA 4MWAD 1OQFA 3IJ9A 3MHFA 4W7WA 5AHFA 4PTMA 2C8NA 3H21A 1A5OC 2P3EA 2FZDA 3CHCA 1OFAA 1TPC1 3TQ0A 3QV8A 1XP3A 4UC5A 1LL4A 3BG9A 3N19B 3WUEA 1OCQA 1J11A 3NOEA 4BZYA 3NZPA 3PF3A 3GU1A 1M04A 4S2CA 4ZOAA 4QE4A 4PODA 3WLQA 5C9ZA 1M41A 3A64A 3K1DA 5LSMA 4GO9A 4Q8QA 3I7RA 3VFCA 5A1AA 1CXLA 2QCHA 4JAWA 3BCJA 3R43A 3S2JA 3AFBA 1LRTA 1W31A 3DFNA 3TWAA 3LA4A 2JE8A 1R38A 2DORA 7REQB 3V18A 5CAHA 1GKRA 1QI4A 1TJ1A 4QDPA 4ES4A 3S83A 2G97A 5EMMA 5BRBA 2QYGA 2RUSA 1W3NA 1NY1A 4JBRA 3M46A 3WBWA 2F2HA 2WWCA 1TJ2A 1NIUA 4ZE4A 3U4AA 3KBSA 3VIKA 3DFHA 1YDVA 1IEXA 1SMAA 2I9EA 1KM0A 1PWMA 3O6YX 4DZIA 1OSEA 3KL3A 5CSYA 1GTHA 1WBJA 3ONCA 1Q6CA 1ICPA 4AXNA 1AZ2A 1RP9A 4AF0B 4S3GA 4HIBA 3WJZA 4JTRA 1X98A 1UOKA 1NELA 5LIYX 5I00A 3WN6A 3L68A 4XSLA 2WZTA 1VFOA 3SFKA 4RK8A 1PCKA 4NHVA 3H2FA 1P1MA 3KOWA 2BASA 2QCDA 2ZDSA 4OIFA 4AG0A 4DJFC 2PDNA 1HKIA 3L7RA 4WUIA 5JBDA 1TMQA 3USBA 2XSXA 3AWOA 3M0VA 3STFA 4H6KA 5BMXA 5AC5A 4UTJA 4AD3A 4UTKA 3STGA 2EKCA 4JFTA 3W75A 2GVLA 1O60A 3M44A 3CL8A 3A4AA 3ARPA 3PNZA 2CLEA 3PZGA 2VQTA 2GGHA 4AWUA 1GNXA 1MRQA 3M0XA 4O0ZA 1G4SA 4HA1A 4OT7A 3CUZA 5AC8A 2Y2WA 1BD0A 4H04A 2Z1WA 4IJBA 3V5FA 2G3IA 2GWGA 3QGAC 2GQ8A 5E1QA 1XCFA 1CDGA 3VX0A 3GDBA 1W32A 2GJXA 1V02E 3QY7A 2ZE0A 3VCNA 3W7EA 3WH6A 2ZUWA 4DF1A 2L5HA 3CMFA 1MQRA 1SFJA 3EWBX 2J6VA 1SYTA 4IOTA 1GK8A 3VKKA 3MPGA 3MT1A 2OZ3A 3NQBA 4ZA0A 3Q37A 4AWTA 3W53A 4Y9OA 3CO8A 4TVCA 2D2JA 4KKXA 3VOGA 2Z2AA 4FLSA 1GZGA 4IH3A 2PRLA 3AXIA 3ZM8A 3V0TA 2ZX9A 4U3AA 2JGQA 2BY1A 4O17A 5CJMA 3PJXA 3W81A 1FWEC 1WOAA 4H00A 4F79A 4FNSA 1KKOA 4J3SA 1P6BA 2FDSA 3BAJA 3P80A 4W89A 3GIQA 1E6XM 2HXTA 2DH3A 1L6GA 2VEKA 5C7VA 1TTJA 2B7PA 2JKPA 5KTLA 3S4TA 3SBFA 2DY3A 1P0EA 4NG3A 4D72A 4QQUA 3KP1A 3BMWA 2GQAA 3WQGA 1HGYA 1BF2A 4HHMA 1N82A 1O66A 2DJLA 3DXIA 4NAFB 2WKGA 3NL5A 3S3GA 1EQPA 1ZS2A 3MUY1 3KTXA 1EC9A 4DNMA 2EPMX 5JH2A 3F2CA 3WLPA 5IFPA 4D6JA 3WQFA 1IQ8A 3QMSA 4FEZA 1L9WA 1KO0A 4DEFA 2FLIA 2QMJA 2QDHA 1WNOA 3QV6A 3IRSA 4GKTA 1Z3NA 3A22A 4PMNA 4D6DA 2XIMA 3L67A 2ZKMX 4N4PA 4KEMA 1ZB5A 3VIIA 5CJ5A 3CPGA 1A50A 5A6BD 1LG1A 1XSIA 2Y8UA 4XAPA 3EOLA 3W2NA 3V0UA 3GNPA 3GW3A 4IICA 3M5ZA 5E6YA 5DX7A 1O6IA 4L1GA 4FX7A 1KCZA 4GYFA 3OG2A 1DYSA 5IBXA 5I3DA 3TX9A 3AYRA 4H7ZA 3ARSA 1KRBC 5HAOA 3TN5A 1V0NA 5ECUA 5E93A 4IF2A 3VGBA 1XICA 1L2QA 4XD6A 5FJUA 4O52A 3UR2A 3JU2A 1WDQA 3IWPA 3NAVA 1OF8A 1VC4A 2INEA 2C15A 2FDMA 3GG0A 1BFNA 3UCCA 4C1KA 5BXPA 5D09A 2Z2UA 4O10A 4IPPA 3UBPC 3BJFA 3EWCA 2XSAA 4FSAA 1XINA 4HNUA 3OVPA 1VAHA 4CEUC 1QNQA 3H12A 2NLIA 3WLTA 5CPTA 4UOZA 3EDFA 1W37A 2PCQA 3GNNA 2Y62A 3EB2A 3HPFA 1GKPA 3LQLA 3CXOA 3MUIA 2VX6A 2A1YA 1JCJA 1J2WA 4DJFD 3KVJA 2Q3RA 3NURA 2WV8A 3FKKA 1G4TA 1BVZA 4W5ZA 3KLLA 4CUCA 4FHAA 4ZBCA 1VIZA 1ZAHA 4Y90A 1S39A 3D3AA 1F2JA 4UNLA 2D2HA 3UF9A 2RAGA 1GONA 4PRRA 1PZ1A 3R8RA 2OLAA 3OHIA 1O7AA 2BOGX 4CQBA 4NZ5A 1NWUA 2ZTKA 1YQ2A 4BWLA 3VGGA 3KS5A 4R33A 4NJJA 3WK3A 4AWSA 1JCLA 4UZSA 4OECA 2FKPA 3RK8A 2PDLA 1C93A 1WDWA 4HK6A 3WD2A 1F6YA 3VFLA 3HMJG 3SCPA 3S5OA 1QRQA 3M43A 1DVJA 2FZ9A 2BY3A 3VZYA 4AD1A 1M3UA 3QPYA 3U6WA 3EEZA 1D8CA 4QJ1A 3HQ1A 2H8XA 3GTXA 4KRZA 4HA0A 3W25A 3QEZA 1K02A 3W7MA 4KRTA 4FI4A 1FFRA 2WB5A 1TPEA 4G7FA 2ZOXA 4FP1A 5D8WA 2VURA 1WKEA 3N2BA 4ZVJA 4KCVA 1S2AA 3EX4A 3M0JA 4A3QA 4OV4A 4LNYA 1OC5A 1EIBA 1F8MA 4ZGYA 1L0PA 4KCWA 1CGTA 1TX0A 3ALGA 1JD9A 1W3TA 3ITLA 1E9ZB 2G37A 2D69A 2D22A 4QJ3B 3PZQA 2YDSA 2QQ6A 3EGJA 2OEJA 1HL8A 1RP8A 2HCVA 4RNHA 3WNMA 3FA3A 1XD0A 3L4ZA 2VFFA 3OA3A 5JU6A 4S3DA 4PTNA 1ZTVA 1XCXA 1NWRA 4R5EA 1S1PA 4LAUA 3DFOA 4GY0A 1PL9A 2FJUB 5T8GA 1W6TA 3OJGA 2A79A 5FF7A 1K8XA 5FJPA 1I1XA 2PLKA 4QXIA 1PKNA 3WENA 2NT1A 3BSGA 1DJNA 2ZA2A 1XQLA 4PMXA 3UJ2A 1C91A 3R13A 1J9YA 1ME9A 3L4WA 4CGTA 3U2ZA 2IMRA 5HATA 3U7VA 1J01A 1UD3A 3UW6A 1JQVA 3NXLA 3FDKA 4QLLA 4V33A 4CD6A 1XLDA 6TIMA 4GQBA 5LNVA 2C1HA 5JXQA 4L4PA 1J0KA 3FCPA 1QO2A 4AH7A 1EO5A 2A7RA 4Q8NA 5K9CA 3W83A 3S46A 3WQWA 1DORA 2XIOA 4Q4RA 3S8HA 3TN4A 3SECA 1JDAA 2GVJA 4RDZA 1BWLA 4ZE5A 3MSGA 4IZGA 5HA7A 3IJDA 1E0XA 1OM0A 4AY1A 2OSWA 3L4YA 3UPBA 1H41A 3IV8A 3VOJA 1PHQA 3MZNA 2GSEA 3MQTA 1HFBA 1CXHA 2ZZ7A 2VCCA 3BH4A 4CNSA 4CNUA 3HO8A 3H55A 3EDDA 2NXHA 2AAAA 1DJZA 1XKYA 3P7YA 4GQ0A 3KXQA 2QCCA 1T0OA 3MU7A 4W8LA 2PMQA 2QNEA 2AL2A 4QS5A 4LC8A 3VIPA 3INPA 4P8VA 4X22A 3ATZA 2A5HA 3W7GA 1JAKA 3KTSA 4A05A 4C6CA 3W23A 4HU8A 3KEHA 3RLUA 4GJIA 3VIOA 1GT8A 3EPOA 1UD6A 3ZXWA 4HSOA 1Y8BA 3ATYA 3THDA 1QI5A 3CGTA 4MWAA 1AQ0A 1FDYA 3T55A 7TAAA 4JTFA 2ZVRA 5DRIA 1IZKA 5E6ZA 1F4HA 3EMCA 2X1SA 4UCFA 4UTIA 3PZTA 4XD5A 4O14A 5TNVA 1WXYA 3CEUA 2YLAA 3S42A 3TAOA 4FLOA 2Y0FA 3A4XA 3BW3A 3C0QA 3LGEA 5KETA 3GE7A 3H6OA 3W24A 1ELSA 3W70A 4BA0A 1WDSA 3MSDA 3PNUA 5KITA 3AYVA 4QG6A 3QPZA 3P81A 3MJYA 4XG1A 1CIUA 4JHMA 3EYPA 4LVFA 2NV2A 2Y61A 3NSXA 3PSVA 1H4PA 3A21A 1XLJA 4FA3A 2B81A 1TTIA 2C13A 3PBMA 3FSTA 1DJGA 5HNRA 2JEPA 4Z2IA 3A12A 2DIEA 1EHAA 2PDMA 4KH2A 1EHNA 1HG3A 3O07A 3GXMA 4W93A 3B8DA 3AIQA 5DXXA 2NVAA 3EAUA 3WLOA 2POTA 3MCOA 2E3ZA 3W2MA 2XH4A 5FL1A 3CZLA 1OGBA 2FZ8A 1ZJBA 4Q6XA 5FJTA 2BG5A 5F1VA 3THCA 9RUBA 3KVMA 2PODA 2V5DA 4UNIA 2QUUA 4CNOA 4XD4A 3BLOA 4PRWA 4IFKB 2ACQA 2F8QA 4PMOA 2VYOA 1E71M 2YCLA 3WD3A 1R3TA 3A13A 2WPBA 2Z24A 3IVUA 3QKZA 5ABGA 2CKRA 3ZJ7A 3DESA 1E40A 4GY7A 2R1NA 1U5VA 1UUQA 1AJ2A 4ORIA 4LNCA 1MNZA 1F61A 3BTNA 3HOJA 1E4MM 2C91A 3ELFA 1Q6GA 2JFEX 3TP4A 4P8WA 4AZHA 2GYIA 4HU4A 3TONA 1EJRC 2AKZA 3NYZA 4UFMA 5FI8A 2P10A 2X0HA 4WDUA 1MRAA 3WMBA 4D6FA 1F5ZA 1R3WA 3GC5A 1KM2A 3GVQA 3OYZA 4E4PA 1LT7A 3PHAA 3KOXA 1G67A 1I75A 5CSSA 3NZ1A 5LHFA 4K8HA 1TR9A 1TV4A 3LRLA 4K8EA 5AZ0A 2FQIA 3SY8A 1YXDA 4UIOA 1H1NA 3E3HA 4TUFA 3IGXA 3SUWA 3UETA 3IUDA 4H9YA 3WD1A 1ML1A 4W85A 2CZFA 2BHYA 4CNTA 2G96A 1HT6A 4JTAA 1SM9A 1JPKA 1PXGA 2Y1HA 1LP6A 4RE0A 4FOKA 1C8VA 1GG1A 1IYXA 3OW1A 4I7WA 4BEUA 2E67A 3NQCA 1IEQA 3KL0A 3PUEA 2VT0A 1GW9A 4DUXA 2FVMA 3UXKA 4B5VA 3W1AA 2PDWA 5FKYA 5A8PA 3OHMB 1R5YA 2YDAA 2CIPA 3FA4A 4PCSA 4JY8A 3BPWA 3O1NA 3RPTA 4B3KA 3B3DA 4D8LA 4E5TA 1IT0A 1NTHA 4CNPA 5KZMA 3NSMA 1OFQA 4GX8A 4LQ1A 1OD0A 4DO4A 1Z32X 3TTOA 1ECQA 3L4UA 2Y4SA 3L5AA 4NILA 2CPUA 3CHDA 3G1HA 4IPLA 5K9XA 4O28A 5C2CA 1IT7A 3OVQA 3HPAA 1BVWA 1TJ0A 3MI6A 3VXGA 2CLKA 6XIAA 4HU3A 1FWJC 1GVIA 2BB0A 1DQUA 3ZVHA 2IKJA 3NDOA 3W82A 4NI3A 4EANA 5IM51 3GDMA 1R7AA 4R7OA 5FD0A 2IS7A 1GVRA 1JZ3A 3KX6A 2V67A 5CXPA 2VHLA 3MV11 3QPEA 3IAQA 1EF3A 1EDGA 3E38A 5K4ZA 3D0CA 4DUWA 1DXIA 1BAGA 2VFEA 4V15A 2DT2A 3N9SA 2Z6IA 4UBPC 1LORA 3AROA 4MJZA 4DBWA 4CD8A 3SCNA 1MW0A 1TV7A 4MUZA 4H8VA 4LUYA 2O9TA 1XW8A 1NQ6A 4IQJA 4IG2A 4MFEA 1J2BA 4M7TA 3WQVA 4C60A 3GKAA 2PD5A 3TROA 4IQDA 1EJVC 1HIZA 1UR2A 8A3HA 1J93A 1DIEA 1TO3A 4EPBC 4QEHA 5GNZA 1A49A 5CKSA 1L2UA 1DJXA 3UWQA 3M0ZA 3BCDA 3N2CA 2CU0A 3SQSA 5GPRA 4MLRA 1P5BA 1C7TA 4V2XA 2X8RA 2PDXA 3FS2A 4HJFA 4Q7BA 1ZJHA 4EWND 1WUEA 2EQDA 1J79A 3MMUA 3USZA 4IPNB 2JK2A 1N55A 3WD0A 2E4TA 1LOQA 5CZJA 4DJFA 3EMQA 1QOQA 1IWPA 5A6TC 3UZZA 4UQCA 5TD4A 1T41A 4U31A 3AIBA 1JL8A 4JTSA 3REQA 1DTNA 4GISA 3MYPA 1R87A 1OZMA 5GJPA 1RQBA 4HU0A 4PA8A 1RHCA 4US5D 1FH7A 1YPFA 1UKPA 4KCTA 6ALDA 3T78A 4YN5A 4LJ3A 4JYFA 1EYWA 2HK0A 1LUCA 3FW6A 3BUVA 5DCDA 1EJ7L 1FQ0A 3ZJKA 3IJ8A 2UWFA 3PZMA 1US2A 3AIWA 3E96A 1I60A 4M3PA 4UQAA 1QNRA 1VZWA 3QLLA 2OU4A 5JBFA 3KOFA 3NPWA 4DZHA 4LYRA 2MUCA 3W7RA 1CZ1A 1UMYA 3SRDA 3UZYA 1S2CA 3TSDA 4U3CA 4B5NA 1UR4A 3BGGA 3EEGA 1XLFA 3ITXA 1TIMA 1WZMA 1Q5MA 3AXKA 3H22A 3UXIA 4I9TA 4AY8A 4DXKA 4GZ7A 3QW3A 4A4AA 2JIWA 3FJ4A 1RZMA 1EC8A 1XLAA 4JZ5A 4RZ4A 4AZBA 3NVTA 3VNJA 3PPGA 2PDIA 5HMFA 5AC4A 3EMZA 2E5DA 1DWJM 3ZT5A 4P7QA 3UG4A 2EG7A 4N9DA 1ZPTA 1A3HA 4KESA 4L9XA 1NU5A 4GUFA 1XLBA 4DHGA 1N8IA 4HMDA 1UUMA 2CLHA 5CEWA 5I77A 4E38A 1HGWA 4DF2A 3DOPA 4XVEA 4C6BA 4PCFA 5HQMA 2CLFA 4MPQA 2QCLA 4LFYA 4F0RA 3PPFA 1JAEA 3QH2A 5CG0A 1OK6A 1LBLA 5H8MA 4Q4MA 2O9PA 1OG0A 2BVWA 4O11A 3NFUA 4MVAA 4IMGA 4LVBA 2MNRA 4RZ5A 1W1B1 2Z00A 5JIPA 2ADAA 3GX9A 1OINA 2J7FA 3OBEA 4ADUA 1KKRA 1QPQA 2F2KA 3URBA 3SURA 3RU6A 1K3UA 5FCZA 6REQA 4X0NA 1BPLB 3NYDA 1UC4A 1V6UA 2B4GA 4W5UA 1LLOA 4XVDA 3TQPA 1R9YA 1QVBA 2DUZA 4O0KA 3TV8A 1Q6OA 5CC5A 2JF7A 3EB3A 1CENA 4RDWA 4L6HA 4FS9A 4PMRA 2GJRA 3ABZA 1K7FA 1EOMA 3LI0A 1REQB 4ZFCA 5KZ6A 5LNRA 1ZALA 5DCEA 4TMBA 2D20A 3N6JA 3VKBA 1AH3A 3GS6A 3I68A 3BARA 2PUZA 1GWJA 3LRMA 1QK0A 1GW1A 1B3VA 3RM9A 3LTYA 2NUYA 3KAOA 3BWWA 1ADOA 1V02A 2OMAA 4LVAA 2CLPA 5CBJA 2I14A 5AHIA 3VNYA 4OWGA 4PTXA 2V5LA 1CPUA 2OKOA 4F2TA 2HS8A 1FWRA 3NQ8A 3G6LA 3GH4A 3CPRA 4NSBA 2I16A 4AZ6A 1TWZA 4M6VA 4DZAA 1QUMA 1G6CA 5BXRA 2BZNA 4NZ1A 1W56A 4QLJA 4D71A 2CZEA 1U2YA 3OLEA 3SSJA 2OQHA 1YNYA 2VR5A 1D3CA 3UWUA 3WQ5A 4LT9A 3FYYA 2GVGA 5A3HA 4UCGA 1NDWA 3S1GA 4G5DA 1VRXA 2E6DA 3W4RA 3TFCA 3FNDA 4S23A 2A6NA 3G1YA 5DMLA 3S1XA 3BXWA 1W9VA 2PDCA 1Z7AA 4H9VA 3P0WA 5EU9A 1Y7VA 1V3KA 3APYA 3GZAA 2HQAA 2QV5A 4UR8A 3NZRA 4C91A 1UH4A 2BSLA 4XIAA 2C14A 4D1IA 3JVAA 1J4EA 4LYPA 2VELA 1ICSA 4MDPA 3ITYA 4CD5A 1KFBA 1ONEA 4NASA 3P2VA 1NARA 2FH8A 2PGEA 3GR8A 4MM1A 5C0QA 3AU6A 1PX3A 3FN9A 4F2BA 3GXDA 3E2VA 3MMDA 1CTNA 1VENA 2Y7DA 5GVJA 5CPSA 1TWIA 2OO0A 4O19A 3PWIA 2VWSA 1UC5A 4C6IA 4GE8A 2FHBA 4OOZA 2PDBA 2OQYA 1HKJA 1LROA 5HMEA 2WJDA 4HZ7A 4ZO6A 3IV3A 4LCRA 4EKJA 4IMDA 2PDJA 1KLZA 2G8ZA 2E1DA 2AL1A 1TA3A 4BKNA 1F3XA 5HJLA 2BVTA 1UKTA 3RYSA 2QAFA 4KS0A 5CH9A 1AL7A 3C56A 4Z08A 1X1OA 4S3KA 5K2ZA 3EKLA 1LDCA 1IT8A 5F4WA 1OFOA 4MPKA 4GQGA 1EA9C 1VD6A 2BGSA 4ZTYA 3URAA 3EA2A 4LB3A 2W9MA 3R94A 2EPHA 4X2RA 1XI3A 1W1A1 3TEVA 2CZVA 2Z1KA 3PTQA 1IXNA 4LPCA 3CBWA 2W62A 4IUGA 3S1UA 1A5CA 2BWGA 5TAOA 1FHVA 2PDUA 2OYKA 3SCTA 1UA3A 1S5NA 1ZQ5A 3GW0A 4HHHA 1JYVA 3PZOA 2V63A 1RLCL 4FNRA 2J8GA 4GA8A 4A8RA 2DP3A 4L4LA 4ZFMA 2VC6A 1BQGA 3OQEA 3W6YA 4PBEA 4AEOA 4IL2A 1TE6A 4DX3A 2BNJA 5BU6A 1OFPA 1XDMA 2YDQA 3HFTA 3VOFA 4KQNA 2Y88A 2Z6JA 3GNDA 4JX5A 2Q8XA 3GUGA 1SR9A 4KT2A 3W1UA 1Q6DA 4KGJA 3HPSA 3WLIA 1LTDA 1VJZA 4I5RA 1Z8AA 4Z1DA 2J62A 5E9XA 2CHRA 3TLQA 4L9YA 2AMXA 5CPLA 4Y9AA 2AQOA 4LAZA 1XCWA 3LG3A 1TX2A 2F9RA 3GTFA 3VD9A 4ZQNA 2ZTJA 1UUOA 5FJOA 1EO7A 4HOXA 3KFTA 1XGDA 5FEZA 1B3XA 2G3JA 3E0FA 5M5DA 1E4NA 3ORWA 3AMKA 4A29A 3AYTA 2CESA 4GUGA 4GO8A 3TJLA 1RAKA 3TDFA 4LF2A 3OP2A 2YYTA 3GXIA 5TBOA 1RD6A 4UOJA 2OOFA 1GEQA 3GUWA 2CNCA 4HD5A 1UJQA 6A3HA 4WSJA 3MBFA 3O6AA 2DW7A 2GLKA 2C0AA 3VI2A 4PE8A 1VR6A 5HJXA 4DNHA 3SGZA 3SRHA 1IE7C 2QCEA 4RW5A 4HNVA 4ZSTA 5E5CA 1JF5A 3A4WA 1A3XA 3V1HA 3ITGA 2DQWA 1V7AA 2ASHA 3RR1A 3NDZA 4XO6A 4WK9A 3NQGA 2PU0A 1Q8JA 2CEQA 2ZUNA 1YTDA 3EXTA 1A5UA 2V3DA 2FPTA 2WVVB 3RJXA 1XR2A 2PTDA 4XISA 2X1UA 2FPVA 4GVHA 2QCNA 3SCUA 2WHJA 1O1ZA 1V6YA 3VPLA 5FSDC 2UY4A 3CHVA 3W6LA 1XUUA 2CYGA 2HSAA 1H2JA 3GY1A 3GXTA 4N9BA 3NXFA 3H70A 3K2GA 3MVTA 5KEZA 3IJIA 1J0IA 5LNWA 3I6EA 4R9OA 3WDRA 2DV0A 5E9AA 4NNCA 1GUVA 2GDUA 7ENLA 3QMRA 1CEOA 3VD3A 1JPIA 3T2QA 5C2GA 3OZMA 3N1AA 4NL1A 3P0XA 1SO6A 4POCA 3NGJA 1L6SA 2KZHA 3FVMA 1KXVA 3CYVA 4ZOBA 1FBAA 2E25A 2XH0A 2ATSA 3EB4A 1WYIA 3GHUA 2OODA 1KWKA 3IPWA 2XGIA 1SU5A 3WK2A 4HPJA 1FCUA 3VIFA 3ARXA 3WH9A 5I79A 1CYGA 3PBGA 3ARRA 3MKCA 4H9ZA 1XC6A 1V7YA 2HPIA 3QBUA 1XL9A 4O8RA 5EL1A 2P76A 2NV9A 1V03A 1EF2A 2WMIB 4ICNA 1E0VA 1GYMA 2TMDA 1QPRA 1IZCA 4MZ1A 1ALDA 1YNQA 4ZTXA 3U0HA 4FIRA 3GYCA 2TAAA 4V1XA 4L5ZA 1QCWA 3N2MA 1GGOA 4HMEA 3W7JA 3GVWA 1XLHA 1ZJIA 4BF7A 3RLHA 3T81A 5G1YA 3I3BA 2XZ7A 1HF6A 1ZAIA 4YJ5A 2NLYA 1BRLB 4AIEA 1TMHA 1ZUAX 4Q4OA 4Z2GA 4ZQPA 4YVPA 4OBSA 4BQ5A 1C8YA 3N13A 2A3CA 4GGBA 1GQIA 1BXNA 3BG5A 3PAJA 4H83A 4A22A 2R14A 1GEHA 4WQ6A 4C6DA 3CASA 5LZLA 1RA0A 4A3YA 3UZWA 1YPIA 4FF5A 2A7PA 2RJGA 1D7KA 1X6LA 4US5A 3V16A 4CEXC 4IP7A 4EXQA 4QFUA 1UWUA 1DJWA 2PP0A 3PC0A 3GDLA 3ZIZA 2VFDA 3W71A 2W3ZA 5FAGA 4PCNA 3BG3A 1WKYA 5HNTA 2DZTA 4XZWA 4CCCA 4PH6A 4EXAA 1PWLA 1XBVA 1D9EA 1AW2A 5A8OA 4B9ZA 3CU2A 1W91A 4PUKA 1LBFA 2J77A 1V0KA 4W87A 3NM3A 3TTSA 4FNTA 5I07A 2ISSA 4C7FA 3T2OA 2PRMA 4CCDA 1FCVA 4B5SA 3PWAA 4KEVA 2I5IA 3VA8A 3ITOA 5T26A 4RR4A 4GVIA 3MMTA 2QJJA 5K3VA 2YOCA 3V35A 1EGMA 1RQEA 4QDWA 3GG1A 3WDJA 4DLFA 5T9BG 3FYOA 4AFYA 4KERA 5D04C 1JPHA 4XO7A 1H11A 4AD0A 1QFEA 4AIBA 3RM4A 3R12A 4IUOA 2HROA 1K4HA 4WZHA 3PY2A 3PANA 3FY1A 3JRKA 3QFWA 2FZBA 3GDKA 1DXEA 4IISA 3SCQA 2WNQA 3CUXA 1LQAA 3S5YA 1LOLA 4LX4A 3T1GA 3C86A 1OYAA 3IUHA 4JEQA 2Z28A 4RE2A 3QR0A 5FA5A 2FB2A 2RDUA 4JFVA 3WQ6A 3PWGA 4PCPA 4AWEA 2BY0A 4J3WA 1V3HA 2YA2A 1LL6A 2QF7A 3CPUA 2XTKA 4GUIA 6PTDA 1RVKA 2YKKA 3SB0A 4GI9A 3N2TA 4R9XA 5BWFA 2EHHA 4GZJA 5FESA 3UVIA 1GJWA 1JJKA 4DUOA 3WFZA 4Y2WA 1RA5A 4QQ3A 2G95A 1A0DA 1D3GA 1KR0A 3RFAA 1V93A 3MVIA 3NJ3A 1H7NA 1RJQA 3B9DA 1W54A 2V82A 1A5MC 2JKEA 4J3ZA 2PBGA 2O4MA 4MY1A 1I1WA 2J4GA 4L1XA 1EOKA 1VQTA 1S2VA 5K9DA 1F74A 3MW7A 2C3ZA 3CT2A 4E3VA 3SO7A 1ZGDA 5I3GA 3N4EA 3N14A 1S5WA 4IHCA 4R88A 4PYSA 4HJWA 3XINA 3SUSA 4Q32A 3LXAA 3TJ4A 1YEYA 5IDZA 1ENUA 4JTJA 3UJRA 4GVGA 2Z2BA 4TX9A 2XWEA 4DO6A 3NQ7A 4UUIA 2Q71A 1V77A 3JR2A 4ZB5A 3W26A 4PB5A 3DYPA 1JPMA 2WMHA 2I5GA 3SADA 3PBUA 4TU1A 3TTEA 4N0RA 3PULA 2V38A 2BBFA 3D5HA 2GPTA 3DGRA 2XG9A 2DDXA 4RNFA 3E1F1 1HJUA 2R1MA 3EOUA 3BQ5A 4QAIA 2HXUA 1POKA 3ABQA 3UJEA 2VXNA 1RY8A 5D9PA 5KSWA 2J27A 2SFPA 5C71A 2NQHA 1EEXA 4PMDA 2NQ5A 1R30A 1XFBA 1RSCA 2YZRA 6ENLA 2D2OA 4WJ8A 3MP3A 5CC6A 1TREA 2VC5A 4G56A 4RCXA 1OX6A 5LIKX 1H5VA 1GOOA 3C2OA 3GNXA 3WFAA 4E8DA 2UBPC 3HG5A 4WDTA 2J47A 1YTKA 3E12A 3KWXA 2P88A 3KM8A 1VBGA 1UZ1A 1C8XA 3HJEA 3S5SA 5AFDA 3UY8A 2VZVA 3DGBA 4EE9A 2ZRVA 4EX4A 3MS8A 3WD4A 3WLHA 3ITTA 3AOFA 4J2MA 4IWWA 4ATLA 3BZJA 1XH2A 1YDOA 4WCJA 4JYDA 2ZWYA 1TR1A 2QIIA 2ZZ1A 4YVVA 1YXYA 4HNTA 5E0CA 1DQWA 2WVUA 3V1PA 1TZ9A 3CC1A 2J9ZA 2HPMA 3B9AA 3G0SA 4WOZA 3WQCA 1AD1A 3MUXA 3ZVIA 2YA0A 1W5QA 3N4AA 4QS6A 2VZSA 1TUXA 2XHYA 2H9AA 3KLKA 4QCEA 1R46A 4NI8A 3DEQA 3SFWA 3AJ7A 1OADA 1HP5A 3JW7A 1W3LA 1W3JA 4C1NB 1YXCA 1UR9A 4F0LA 1VFSA 3KL5A 4IIGA 1HJXA 1EJXC 3AZTA 4DIAA 1WDPA 4ATWA 3POCA 3NPVA 1E6NA 2YL5A 1MEHA 1UZDA 1EXPA 3H2NA 4LOCA 1P0KA 2DW6A 1RCXB 5EPDA 1WZLA 4A6GA 4UOQA 5I23A 2FHCA 1SZFA 4GFIA 4DPQA 3ZR4A 2YCKX 5I3IA 1XLKA 1MDLA 4MG4A 1TPFA 4ZR8A 2GUBA 1J5SA 3BJTA 3HV9A 9XIAA 3S2MA 1XWYA 3GLCA 1EX5A 1HZYA 4M8UA 4HNCA 3GFZA 3HBLA 4JIQA 3T05A 1KCKA 1QNOA 3MDWA 3WYZA 4DYEA 3B0UX 4NAEB 3B8TA 2WNNA 3C3UA 2WSYA 2YB1A 4B16A 3KCJA 1MSSA 2WC3A 2GGEA 4UTTC 3G18A 2D24A 4O1FA 2ZXBA 2PWDA 1VEPA 3AZSA 2BHZA 1EZWA 4LBRA 2FTYA 1PVNA 3Q4DA 3OEXA 5MKGB 2CERA 4LU0A 1W0MA 5H2ZA 2QMKA 4I8DA 4Y6GA 1E6SM 3F2BA 3RILA 5C7HA 1WCGA 4Z1AA 2XH2A 1GZJA 3KP0A 4XZLX 4Y8FA 4K8GA 1KW1A 4X2PA 5AYBA 2VGGA 1XBYA 3BDKA 4HTYA 2O7QA 3P6LA 3G1DA 3LSBA 1QAPA 5ABEA 1PE1A 4MKNA 2DUAA 1B3ZA 3ARWA 1KTBA 4UFHA 5KMYA 3QHMA 1CGXA 5EFFA 1Q45A 3W1RA 2YL8A 5H91A 2VKZG 2BHUA 3LEPA 1X7IA 2PRHA 3B8UA 1R7OA 4FR1A 3VVGA 3LU2A 1MUWA 1VPQA 3G1RA 4UTLA 2UY5A 2QKFA 4PMVA 1O1HA 4QBXA 4C5ZA 3G24A 3O2LA 3N2XA 1W1IE 3AI0A 4ASTA 3SEPA 2VI0A 2YPIA 2YBTA 5DY2A 4D6IA 1U5JA 4GK8A 4PFMA 1IEIA 3WBXA 4WSKA 2YCEA 2Q02A 2FH6A 4GIAA 1R85A 1R3YA 5ABFA 3W87A 1Y5XA 1E9YB 2OZTA 1KM4A 3VCCA 1ZP3A 1HP4A 3TJIA 3N17A 4KWOA 1R2SA 3KBJA 4RJEA 3UR8A 1DXFA 1W2VA 3LHYA 4HB7A 2VR4A 2C71A 1YMYA 3W73A 5I78A 1TPWA 5G5IA 4Q6JA 1I8JA 1JD7A 1MW1A 1BLIA 4ZCWA 4AX6A 3M6YA 5CGTA 1JUEA 4N9CA 3VGEA 3TW9A 3EDKA 3AMGA 4LUSA 2YZ5A 2QV4A 1UP2A 3F03K 2IPWA 4JNZA 2VR2A 1PIGA 1RJPA 1F6KA 3DHFA 4L80A 1RCOB 1GHSA 3QQ0A 4KWUA 4RUBA 2YL6A 1ZL1A 2X05A 2QCDB 1ZAJA 2OB3A 4B5XA 1TG7A 4EP8C 4JKKA 4HVXA 4EF8A 3STEA 2VZTA 1DHKA 3TYCA 1TPB1 4C65A 2J8FA 1TQXA 3LLFA 4L1WA 1SW7A 3K8LA 1VEOA 3AS0A 3TZNA 1OHLA 2J74A 5G2HA 4F48A 3W01A 1KQZA 4OQVA 1BHGA 4C6MA 1BQCA 1E6QM 4ZL1A 3G6MA 2TRSA 2WW5A 3GR4A 1B31A 1A47A 2FTPA 2J7HA 4ML4A 4I9AA 2Y63A 4I3GA 1PZ2A 3N11A 1B90A 2XIJA 4MHBA 4H01A 1W8GA 1D2KA 4A3UA 5U7SA 4CVUA 3UCQA 3S1VA 4MZYA 3TE9A 1Y5WA 3GO2A 1J0JA 3BV7A 4HPNA 1TYGA 3BAKA 4DM1A 1VJIA 1VBJA 3C2VA 3KCLA 4FK9A 2H3DA 4UTWC 1FHDA 8XIAA 4HYVA 4UQDA 2DZVA 4PL1A 3IUIA 1OD8A 4NZCA 2GJXB 1PCWA 1CECA 1QNVA 2OLSA 1Y65A 1FWFC 1EGVA 1GPWA 1FWBC 4KWWA 3UERA 4LRSA 4NZFA 3WEOA 2CLMA 3D46A 2KAUC 3B4UA 2C1IA 3F7JA 5G1MA 3QJAA 3CV2A 1JCTA 1F7BA 3AYSA 5CPQA 3EDJA 1E73M 3LBMA 4YTUA 5J5RA 2R91A 2WZMA 3ZLHA 2P5NA 1QU4A 3B9EA 2XN1A 3LY0A 2ABAA 4DWSC 3HG2A 2YX0A 3UESA 5FF0A 3KRZA 3KRSA 4ZO7A 3W27A 2BDQA 1PBGA 1ZBCA 1AFSA 1Z42A 4JTUA 3FHAA 1OB0A 1YX1A 3T44A 4CN4A 1Q7MA 2ZWZA 1IEVA 4YVXA 3MTWA 3COTA 4J27A 3TOYA 3ZLGA 3FLUA 1LRQA 4NRSA 1EA0A 4GNVA 1ODUA 1W9PA 4LAMA 4BJHA 4ICCX 2VC7A 1JFXA 3N04A 4H8NA 3IIOA 4YPJA 2JF6A 3NQAA 3ICJA 4H9TA 4EIVA 3R58A 1SGJA 1QW7A 5A8QA 1AD4A 1MI3A 1HNYA 3WJWA 3RN6A 3CYJA 2VC9A 4HCLA 3AALA 3DG6A 1S1RA 1E5NA 2V81A 2BV9A 1XIFA 4LYKA 4D6CA 1NDVA 2V3FA 2PSNA 3W1LA 2R1PA 2OGJA 3NL6A 3L4XA 1L6FA 1UYQA 3B97A 2QPXA 3P82A 2WQDA 1H62A 4NZJA 1AH0A 1ITCA 2F6XA 5KZDA 1TRDA 3UXLA 2D23A 3AHTA 4JTDA 3ECQA 1UMLA 4ZQCA 3H8AA 5D32A 4NF7A 4REQA 3H24A 1CLKA 1J0ZA 3G2GA 1K8YA 4AMCA 3ZLFA 3P14A 4HOWA 3GU2A 3QGKC 1E43A 2XFFA 1BTMA 3VGFA 3IGHX 1GJUA 1TIWA 4HQVA 4O0QA 4MDOA 3GYEA 3UWWA 2EJAA 1IIGA 1WE5A 1G7VA 1JGIA 2W91A 3A24A 6CGTA 2FVLA 4WGHA 3LZ3A 4I6VA 3AUOA 3OIXA 3P74A 4LALA 1GQKA 5DQPA 4IL0A 1QNSA 4WX2A 4PC8A 4FNPA 1F76A 2ZA3A 4FALA 4UNKA 3UVAA 5CZ0A 1VBHA 5IRPA 2OKTA 1LJYA 1ZU8A 5M03A 4R3UA 3TOPA 4GXPA 3LYEA 4BY3A 5CC3A 2WNZA 3E9AA 5F2GA 4S3BA 3V7PA 1FXQA 3IEBA 4IFRA 2WNWA 2FMOA 2I1OA 3L9CA 4RV3A 2NX3A 1V3MA 1UPPA 1ZCOA 5C6MA 3LI1A 1HJSA 4XB3A 3B9NA 5CSRA 1SFSA 3MB9A 1ISYA 3CZ8A 3P60A 2G5WA 2ON3A 1TPUA 1KRMA 1PKLA 2ZVIA 4S3EA 1A5BA 2XVGA 4X9YA 3I3EA 3NIYA 5E0KA 5HANA 3L5LA 3WQPA 4QTGA 2R94A 2XDFA 3DZ1A 2J75A 3UU0A 4KEZA 3PZNA 2DEPA 4FXFA 3R8GA 3N34A 3C0SA 1OIMA 1H0IA 4WKAA 3J7HA 1OABA 3WF2A 1HJQA 5HQLA 1YRRA 3B8VA 1KFEA 3RXZA 4F0KA 4IM4A 3VNLA 3RCNA 3SW6A 3QHNA 1T99A 3OLDA 4GCXA 2OTDA 2HNHA 3B9OA 2QCGA 4WR3A 5KZEA 4KWSA 3R1ZA 2WLYA 2R9RA 3POHA 3GU9A 5BYWA 4O15A 1YADA 3E74A 4DWSD 2WJZA 4D1JA 2E5BA 4LEFA 3C61A 1LWHA 1JXJA 3AHXA 4YTTA 4UMCA 1CX9A 2G4JA 3AO0A 1QDSA 1OT2A 3WF1A 1YBQA 4F0SA 5DELA 4LUJA 4Q8TA 3GK0A 4ATDA 3FV9A 2NV1A 3QR1A 3PTDA 3AHZA 5AZ1A 1SR0A 4J4KA 1JNDA 5AB3A 3QSRA 2VJXA 1Z44A 2PDPA 3DCPA 1QT1A 1TZZA 1W1ZA 3EPNA 1H50A 4IT1A 3SCOA 1XKJA 3C6CA 1XRTA 3TNOA 1OCNA 4YYCA 4JIIX 1P6CA 3MDUA 4P7RA 2WZHA 4AAJA 1LYXA 3HU7A 4HBKA 1RY0A 3D47A 1VKFA 1KRAC 3PSWA 2IKHA 5CG7A 4QJ4B 1XYMA 1UR8A 2ZRXA 3BVJA 1K9DA 4KPLA 2JEQA 4NYUA 3PG8A 3AC0A 3QYQA 3MO7A 2ICSA 3NQVA 3M5XA 2DU2A 4JQAA 1NDYA 4IPJA 4I5UA 1QOPA 3ABSA 2VDHA 5DRCA 1DJIA 1QPNA 1V6VA 4JIEA 4LY8A 3JUGA 5I3JA 4KCUA 2G0WA 2Y85A 2HK1A 4XAGA 3MWAA 5DN1A 1MEWA 3RMEA 4RXFA 3UZXA 1GQLA 1OGSA 4Z2HA 3NEVA 8RUCA 3N3MA 1DKWA 4NYYA 3E49A 1OF6A 2PLJA 3G1VA 7TIMA 3HGSA 1Q3NA 1LOSA 2WCSA 4Z17A 5DLCA 1VBRA 2J7BA 3RM8A 2P8CA 5AHEA 3I6TA 3QY6A 1LRNA 1ISVA 1W1PA 3W38A 4Q3MA 4IGNA 2J7EA 4O12A 3IIVA 2QJMA 4HYWA 2FB3A 4UWMA 5EFDA 3MUCA 3DX5A 4EVZA 3ARYA 1UH2A 3QM3A 2IKGA 3AISA 3MSYA 3ISIX 1W8SA 2ODOA 3NQ6A 1DL3A 1OGGA 2A2IA 2GJNA 4GZIA 3RDKA 3UGRA 3FA5A 1NH6A 3PZUA 4Z0SA 2OELA 3MI2A 5AYYA 2AL2B 3ALFA 1JYXA 1C29A 3M64A 4JQ3A 2QZRA 4LY4A 2I5QA 3I10A 4WY0A 3UA4A 2YCJA 3LQGA 3S1WA 3C0JA 4HT3A 3B04A 4QCFA 4XZIA 2YJQA 3CUFA 2BLEA 3W85A 1IGSA 4C7GA 6XIMA 4WKHA 3RHGA 5AHNA 1OG6A 1SZNA 4MWAB 4HPXA 1ADSA 3TCEA 1K77A 3B0XA 4Z2JA 2OGYA 1F8IA 1A4LA 3EWWA 1E15A 3TAKA 3FGCA 3OTRA 3T40A 3TYBA 4GH1A 2XVKA 1V3IA 2VL4A 1KFCA 1TWSA 3R2GA 3GD6A 3U2OA 4ONVA 3RPDA 1O5KA 4KWVA 2VEMA 2OXNA 3O3RA 4J40A 3DERA 4GFSA 2OT1A 5E09A 3WELA 1W9DM 4PB3A 1M7PA 3TZFA 4C7DA 4IIEA 2F6UA 1B2YA 1OC6A 2XIQA 5LA0A 1QR7A 1YYAA 1GVSA 2ZRZA 4Q8PA 2ZADA 2ZXQA 2Q3OA 4YWIA 5D05A 1PEZA 1WB0A 4N02A 2VOMA 2P0OA 3WL0A 4HHLA 2XH7A 4TIMA 2PGWA 3TK7A 2J9XA 4XKYA 3GDRA 1QI0A 1VIWA 3R7MA 2XVNA 3H7VA 3AJXA 5A2AA 3NOYA 4ZQMA 3UEQA 2PWHA 3WNKA 3BOLA 1F6PA 2Y8VA 1IV8A 1OFRA 5ECVA 4XAZA 1SZGA 2E6AA 5I3HA 3S2CA 1LWJA 5DBUA 3VCRA 4AIUA 4MJ2A 3FKRA 4DAIA 4HP5A 4Q8UA 5EYWA 2VGIA 4US6A 1K9EA 3IVTA 2REQA 1HN1A 2VVNA 1S3TC 3L12A 3R79A 1Z6KA 4B5TA 3DFPA 5A6LA 3VNDA 2YCLB 3GBDA 4AZIA 3VU2A 3OLGA 3T8LA 1XPGA 1XIHA 1US0A 1PO9A 4TR9A 3SRKA 4GI6A 1UG6A 2I17A 4N9EA 3VIMA 4CCZA 3OU8A 3THAA 2IPGA 1V3LA 2J13A 2XN0A 4R34A 5M3WA 3U5UA 1H61A 5HULA 3YPIA 1V5XA 3N25A 2W67A 1Z69A 2VZUA 3GR7A 3OVRA 1OCBA 3LGGA 1B0IA 3GC2A 4DO7A 1J12A 5XINA 1TVPA 2QIWA 4H6QA 3H4GA 2EPLX 2YLLA 5CPMA 1I0DA 2WLZA 3AXMA 5D02A 1XH0A 1XLCA 1JCYA 1P7TA 3T8QA 3BAIA 3NO1A 2Z7KA 4S3FA 2WSKA 3SIZA 3WDQA 1MMFA 2O4QA 3UD6A 1K7EA 3HQPA 4PBFA 3LMYA 2QCFA 2OSYA 2WMKA 1ME8A 1K8ZA 3AMLA 3NQMA 3WNLA 1VYRA 5LNUA 3PVFA 1M7XA 1QATA 1TPDA 1KV8A 2CXGA 3C3NA 1K1DA 2V9DA 3G8RA 5HWJA 1BGAA 1ITQA 2A3HA 4RPPA 4C6QA 2DZSA 4FOJA 4P7LA 1GOIA 4DLMA 2OEKA 1TELA 2HEJA 1IR1A 1ZJAA 3VKJA 4B4FA 1KXTA 1D3HA 5CZTA 4CCEA 4LVGA 5IHSA 2QF8A 3EKGA 4GVFA 3ZZ1A 4QE1A 2D73A 1FA2A 1FKWA 4L7ZA 3WMLA 1FVPA 2Y7FA 3WJXA 1LF1A 3T9PA 1VYSX 4UTTA 1H60A 3QTPA 1V4YA 2YFOA 1QBAA 3MP5A 2OPJA 1H0GA 3LNMA 4IIBA 1SQ7A 2W5FA 4B15A 4B90A 5C8BB 3RNDA 3GAYA 2BODX 2X41A 2EF9A 1XH1A 1OEPA 2B7NA 3I7QA 2W61A 1I2RA 3ZVHB