4NVTA

Crystal structure of triosephosphate isomerase from brucella melitensis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
249
structure length
249
Chain Sequence
IRPLVAGNWKMNGKGESLTELRAIAAGLSSDLGRKLDAVICVPATLLSRAAETLEGETVGLGGQDAHFKTSGAHTGDISPEMLKEAGATHVILGHSERRTDHHESNKLICAKTEAAWAAGLVAIVCVGETASERKAERALDVIGDQLSGSLPDGVTAENTIIAYEPVWAIGTGLTPTVQDVRAAHAFMREQLIERFGAKGAHLRLLYGGSVKPSNAAELLGVADVDGALVGGASLKAADFLAICETYRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Triosephosphate Isomerase from Brucella melitensis
rcsb
source organism Brucella melitensis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 88
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nvtA00
2W0UA 5I3FA 5D2XA 4HT3A 1C9DA 3T7VA 1LRQA 3UD6A 3LXCA 3LHWA 2QAFA 4NZFA 4NJKA 4ORIA 1M5WA 4LY8A 3W23A 1JVNA 3L9CA 3MWAA 2ZRWA 5G5IA 4O8RA 1JCYA 2E5DA 2A1YA 1OX4B 4JICA 1H51A 3RNDA 1JQVA 3UXAA 1NVMA 5K3VA 5I3JA 5C55A 4ZZ9A 5F2IA 3TV8A 3KXQA 3SGZA 5LNVA 4RLIA 2RKXA 2VENA 2JK2A 2E6FA 3UWWA 3OEXA 3C52A 1JCLA 4TMCA 1A5AA 5J5DA 4MKNA 3C3NA 1KFEA 2A5HA 3I6RA 1SW0A 1VHCA 2V2DA 3PC0A 2QDGA 1VH7A 2W79A 4WXYA 3M6YA 3NA8A 4MYXA 2GVJA 3EEGA 1FDZA 3LCFA 4W9TA 3PS7A 4C1KA 5AOUA 3VFLA 1FCUA 3NQMA 3QPYA 3TW6A 5SWUA 1H63A 4WY0B 1IGSA 5CPOA 5FESA 4EOUA 3E96A 1FXQA 1Q3NA 2NXGA 1K3UA 4LV9A 4YWIA 1NFBA 1O5XA 4MJMA 4H4IA 3TX9A 2QCEA 4JN6A 4PC8A 1LOSA 4UTMA 4NUWA 3MYOA 4NJGA 1LZOA 4Z08A 1NSJA 4CNNA 3FFSA 1VRDA 2ZA2A 1FDJA 3BV4A 3EXSA 3NDOA 1TSIA 3WJWA 1ICSA 4Y9AA 3WFAA 3M5ZA 4YXGA 3TXVA 1KM2A 4JTJA 3F4WA 3LTYA 3GX9A 4E2BA 4UC5A 4Z0JA 3K30A 5K9CA 2YYUA 2ZRYA 1T0OA 2VEMA 4OGZA 3UWZA 3LCLA 5KTLA 2PRHA 4ZQPA 3RLVA 3UZ5A 1ZCOA 3W2JA 3W73A 2Y7FA 4OE7A 2J27A 1AMKA 1XXXA 2JGQA 3P62A 1QMLA 4HNTA 1H7RA 4S1FA 1O60A 5CPMA 2I14A 4BWLA 3OVQA 3W7EA 2TPSA 1J2WA 3PSWA 4TR9A 4NX0A 2GJNA 3E0IA 4IPJA 5E0KA 3GXPA 2UV8G 1HL2A 1KFLA 4O50A 4RXFA 2X16A 4LOCA 3VI2A 1W54A 1MZHA 3FYOA 1T96A 1MXSA 2V2CA 2AAMA 2ZBTA 4FB7A 4O10A 4Y8FA 2GQ8A 1NAL1 4UTKA 1F76A 4BI6A 4DPPA 3KVLA 3QQ1A 3W1PA 3QRHA 1QOPA 3NVTA 1R2TA 1ADOA 3NPUA 1FX6A 3QC3A 4JR5A 4HNNA 5HINA 1KV5A 3UPBA 1OX4A 4X2RA 4JIQA 3MW7A 1ZAJA 4KFOA 3OVPA 3GDLA 4OU1A 4U4MA 3LCHA 3P5ZA 4M6PA 3RU6A 1IXPA 4TIMA 3HGSA 4S2BA 4ADTA 4JX4A 5LHEA 1QPQA 1SZFA 4ORMA 3CM4A 3ZS4A 4H3DA 2C3ZA 3QF0A 1EP1A 4HSNA 2ATMA 1QO5A 1E51A 3W72A 1DORA 3PG9A 2E6YA 4BFAA 2CLLA 3FKKA 3DAQA 1O94A 3E9AA 4OV9A 5DY3A 5FEPA 1SO5A 3MHFA 3A5VA 3ABSA 4N9DA 2YPIA 3QJAA 1KFBA 1OFDA 4M6VA 1I2NA 2J24A 5C5YA 1EWDA 3WK3A 3TSMA 1M7PA 2CLIA 2WV8A 1TPVA 2A0NA 2KZHA 1EIXA 5EKYA 1OFQA 3SIZA 3LDVA 1TPH1 4RZ5A 3B0PA 1JULA 3O6DA 1KM5A 2BX7A 2WSYA 2C16A 4UTTC 2RH9A 3H53A 2G95A 1AW2A 1W5QA 1LM1A 2E1DA 4NU7A 3EX2A 3TMQA 3E02A 3IGUA 5HWJA 3HPZA 5GVJA 2V82A 3E49A 8TIMA 1K03A 2X1SA 4Q33A 1EUNA 5G1YA 3M5YA 3LI0A 5D2VA 2E68A 5F4WA 1YDVA 4IMDA 4ADSA 2A6LA 4H6KA 2WOQA 3W1LA 5AYYA 2ZCGA 2RDTA 1KFCA 1W1ZA 5CPNA 3ABRA 3IV3A 2V0TA 4RXGA 2QJGA 3A23A 2DZPA 4AHPA 3EXTA 4DQWA 2G5WA 3WK0A 1DKWA 2A6NA 3P8JA 4UTLA 2P10A 2YR1A 3RFAA 3G1XA 1GQNA 4XTIA 4IWWA 1KLYA 1D3HA 3DHDA 1THFD 4CQAA 4UFIA 3NXFA 3B0VC 2C14A 2DORA 5U7SA 1ZHAA 1TTIA 4X9SA 3LM7A 1KBIA 3TH6A 1YPIA 1S3HA 5LKYA 3F1QA 4JTHA 4ZQCA 1W56A 3C2EA 2QJHA 3V75A 2PCQA 3M7WA 4JNMA 1OABA 2QCFA 3H54A 5CPLA 1OF6A 3GKFA 3PSVA 2NUYA 2V5BA 2X1RA 3H55A 3AO0A 4HNUA 4CQ9A 3SY5A 4XKYB 4MFDA 3G8EA 3KRUA 3LGEA 3N19B 3LBMA 4R34A 2H3BA 1G4TA 3UPWA 3DKJA 1ALDA 1KV8A 3USBA 3NNTA 4CLMA 1H7NA 5FF0A 4JTIA 2F7FA 3W87A 3W7GA 4PODA 2V8ZA 3TC6A 4YMZA 5TIMA 1DQXA 2YGYA 4XBKA 4AF0A 2NV2A 1BKSA 3GNNA 2H8XA 5E93A 1KM3A 5G2IA 1OK6A 2ZZ7A 4UFHA 1SU5A 4JTFA 3W74A 4XQ6A 2FTPA 3RK8A 2H8ZA 3PG8A 3DKLA 2NUXA 3PB2A 4K39A 1TPB1 4C1LA 4BI7A 2WSQA 1KTNA 2YW3A 5CZSA 1SW7A 3G1VA 5CZTA 3TA6A 5K2ZA 2FPVA 2R8WA 3IEBA 1S5WA 5KZEA 2CU0A 4WQ6A 3OA3A 1JUEA 3A21A 4D2JA 3W2UA 2AGKA 4GFSA 5KSWA 3CEPA 5EYWA 1Z42A 4DPQA 5HWNA 5CSSA 1GG0A 1ZAHA 1L6YA 2YFOA 3W1NA 4PEKA 4WD0A 3ZFHA 1VYSX 3HF3A 1LYXA 3MI3A 1KM1A 3ABOA 4O1CA 1DJNA 3KFTA 1WA3A 4LVFA 5DLCA 3SR7A 4LRSA 1LBFA 2Y7GA 3Q37A 4RCXA 4FNQA 1OFRA 2E6AA 3UY7A 3W7RA 4DBEA 3NQEA 3OHIA 1DBTA 2VKZG 3W7QA 2QAPA 1Q6QA 5TQLA 3T44A 5CSRA 4FNPA 1WDWA 1H7WA 2YDAA 5D38A 5HUOA 1D9EA 4NXKA 3S5OA 4CCDA 1LLWA 4MVAA 2NZLA 3G1FA 1RR2A 1VJIA 3T78A 4CNPA 4LUJA 2HS8A 1FUYA 3PAJA 5EBUA 3YPIA 2OZ0A 3THQA 2WPBA 3M44A 3GZ3A 3NAVA 3O6YX 4PH6A 4MJZA 4GRSA 3FJ6A 1L2UA 1GTEA 3PBVA 3MP4A 3TMLA 4AWSA 4A2RA 4A2SA 1SQ7A 2X1UA 4N4QA 5LNSA 1W5MA 5C2XA 1XDMA 4FXRA 1FBAA 2Y89A 1AW1A 3W71A 4X22A 4AAJA 1LBMA 3DFTA 3OIXA 4WZHA 3TXZA 3W7DA 4JGDA 2GJLA 3NPVA 1R2RA 2CW6A 4IUOA 3ZWTA 3CU2A 3KOFA 3NR0A 4LS2A 3W7NA 4N4PA 4QM1A 4UNLA 2DU2A 4RKAA 5L6UA 2QCMA 1LDCA 3IVUA 1I8JA 1DL3A 3BW4A 2ALDA 2NX3A 4MFEA 5D30A 1DOSA 4Z1AA 3P67A 1MEIA 4JDYA 2LLEA 1YTDA 3A5FA 3NEVA 4WJEA 4NNCA 1X8FA 5D37A 1UJPA 4O0KA 2ZZ1A 5AHMA 3W7LA 2NWRA 3B03A 5LGXA 1Z48A 4UMCA 2NV1A 3T40A 2CZDA 1JR1A 1AL8A 2DJXA 1V7YA 3BG3A 2Z6IA 1I2RA 1RPXA 1W5NA 4Z1BA 1A5CA 4KWVA 2J9XA 3KVJA 3JS3A 2Y85A 3HPXA 3UZJA 4WY0A 4O52A 4UXDA 2B0MA 1OFEA 2BWGA 4IQLA 3DH7A 3MMTA 2GQAA 3VE7A 5AFDA 1TPFA 2G96A 3M43A 1QOQA 3HJZA 1GVRA 3FOKA 4O0ZA 2PURA 3R8RA 4HNVA 3G3DA 4P61A 3N9SA 2GVLA 2CZFA 2R94A 1TRDA 2W6RA 1MSSA 2Z0IA 2CZ5A 1IXOA 3KX6A 1AL7A 1VHNA 4ZMGA 4I7VA 3S8HA 1J5TA 1OJXA 3S1VA 2BSLA 3P81A 2NWSA 3TFXA 1EB3A 5D33A 2A2IA 4IOTA 4AMAA 3G1DA 2Y63A 4E0CA 3W7HA 5I3IA 2QCNA 4DBDA 1LP6A 3CTLA 3P82A 2VFDA 2QKFA 4IX2A 3W2KA 3UXDA 2ZZ6A 3MP5A 4QIUA 3NQ7A 3O07A 2R91A 3UNDA 5D04C 1O95A 1IIGA 1GVOA 3LBCA 4O16A 1TREA 1EUAA 1OHLA 1W3TA 4NJHA 1TPC1 2FPYA 1SW3A 3DENA 3NQ6A 3M5XA 4WX2A 1WV2A 2DZWA 4LT9A 3GDMA 2FQIA 2VFEA 2VEPA 4O15A 5ABTA 3NL2A 2ZZ5A 3ELFA 2JBMA 3L65A 5EL1A 3TSDA 3F4NA 3LHVA 1WX0A 3TE9A 4UTTA 3LHZA 3BO9A 4XKYA 4UFLA 1VQTA 2OMAA 4FNTA 2NUWA 4WUIA 4JDBA 1LROA 5EMUA 2X30A 4MPQA 3P74A 4LRTA 3W1UA 1ZENA 1TPWA 2VEKA 5BMWA 3IVSA 4IGHA 2GUUA 1B3OA 1PS9A 1GYLA 1GTHA 3LLFA 3TJXA 4FXSA 1TCDA 3DI0A 3N3MA 1TQXA 3DFOA 5AHFA 3S5YA 1NF0A 3GAYA 4LTSA 4A3UA 1TRIA 2CWNA 4AHOA 4E38A 1Q6RA 4WXZA 2QCHA 4XTDA 2ZQ0A 4O54A 4LS0A 1M7OA 4RZ4A 4AF0B 5CKSA 3W2LA 1LRTA 1FCVA 1AK5A 1XUUA 3GR7A 4IJBA 4NT0A 1PL9A 4DO5A 3PBWA 2QCCA 4FIRA 4JX5A 5LNUA 3LRLA 1H7OA 3C61A 2FPTA 1EEPA 3W86A 5K7JA 1W8SA 2C19A 2NXIA 4IXXA 2B7PA 4FO4A 1FWTA 2C15A 2YXGA 4O57A 1UBSA 3LLDA 1O5KA 4JD4A 3CLMA 3EWZA 3UWUA 2QJIA 1W37A 3P7YA 3PM6A 2Q3RA 1R47A 3CIWA 3NQ8A 3WK1A 1H60A 4GUGA 4QSHA 3HPSA 1LRNA 2D73A 3G0XA 3W76A 3P61A 4PTNA 3LHYA 1VR6A 4HKPA 3TUUA 5AN7A 3E12A 5K9XA 4KFNA 4HSOA 4LVAA 3EX1A 3B8DA 3BGGA 3GK0A 3OVRA 5CZJA 5DELA 1EX5A 1GJPA 1L6WA 1U83A 4UFMA 4XUGA 1OVDA 1GZGA 1AG1O 2BXVA 5D2WA 3TIMA 2G97A 2Y7DA 1JCXA 4CCCA 4G1KA 3LXBA 2ZYFA 1HO1A 1GVQA 3QH2A 3W22A 3LOTA 3W84A 2C18A 3BGJA 2O7QA 3NG3A 3UWVA 4N9BA 1G4EA 3GYEA 2NX1A 5FF2A 1VLWA 2ZRZA 1DJQA 1ML1A 1ME8A 2CLEA 3SW6A 2VC6A 3C0JA 3EWBX 2GOUA 1OX5A 3A22A 3LV5A 1RD5A 2BLEA 2CLMA 3B06A 3LI1A 1VS1A 3R2GA 4OV4A 3G1SA 2ZZ3A 1ZY9A 3SZ8A 4JY9A 2HSAA 2A4AA 1VCGA 5KZMA 3R13A 2WJZA 2H3DA 5KMYA 1SZGA 2Z2UA 1X1OA 1BWKA 4DF0A 3DFQA 2C0AA 1JRBA 3W6YA 3GNDA 1MEHA 5FEZA 1JCNA 1A50A 2A7NA 5F2LA 1OG0A 2HS6A 2ISSA 1XC4A 3NPWA 4GUJA 1JCMP 1YXYA 3LHUA 3EWUA 2YYTA 1H7XA 3NM1A 3NZ1A 3EWXA 1SO4A 3PBYA 4LWWA 1BEUA 5BMXA 3BVJA 1ZALA 3LCGA 1H61A 5LGZA 1M6JA 5BW6A 4ONVA 1I2PA 5BNKA 4OT7A 1T99A 3TAKA 5FF3A 4NXSA 1C29A 3A24A 4QJ1A 3PB0A 3PUDA 5DBTA 2EHHA 4O4WA 3TK7A 3HG5A 1TO3A 3ABQA 4BR1A 5IM51 4MZ1A 4GC4A 1OK4A 5A5WA 4P2VA 2DZSA 2XN1A 1PVNA 1QAPA 1QCWA 5G4WA 3C2OA 4N9EA 1K7XA 5H2ZA 3NGJA 3HGJA 2ZTJA 2E5CA 1ZJIA 4Z1CA 2VFIA 6TIMA 4UR8A 1XUZA 2CFFA 1TJPA 4I9AA 1TJRA 3INPA 1FWSA 3W85A 2E6DA 3QPZA 1XBVA 1SSDA 4Z0SA 2WNZA 1TTPA 1GT8A 1YPFA 1EP3A 1I2OA 3W75A 3W9ZA 4JS3A 1G67A 2PC4A 4MYAA 4ZL1A 5G1TA 2OT1A 1SZNA 1YLVA 1W5OA 2P0OA 4LVGA 4IXHA 3MI6A 4M6QA 2V2HA 5AHIA 1WOBA 2WNQA 4EIVA 1SSGA 3L21A 2PRLA 3THAA 2EAWA 3EX4A 5DN1A 5LHFA 4TMBA 2TMDA 3QMRA 1OFPA 3IIPA 4KKXA 2E77A 4NZJA 2CLOA 3NL3A 1LBLA 5EY5A 3O06A 1K8ZA 4L4LA 1KFKA 4QQ3A 2F84A 5C54A 2Z1BA 1TPEA 3MBDA 3QMSA 4JTGA 4UIOA 1S5TA 4B5NA 2FDSA 3NM3A 4JXCA 1RQBA 4LS1A 4JIPA 3STEA 3S1WA 3CWOX 3RLUA 4HN4A 3PUOA 2JKEA 4MOZA 1PCWA 1YYAA 3CC1A 3L68A 4N9CA 3HB9A 3N14A 2CLHA 3GXTA 3R89A 4JX6A 3G3MA 4XWUA 3L5AA 4UUIA 4KFPA 4FEZA 1QFEA 3VCRA 5DCDA 4O11A 1F6PA 3FLUA 3DHFA 2VXNA 2EGZA 2ABBA 3TR2A 5I3KA 1H7PA 3OG3A 1DHPA 1KTBA 2PRMA 5AC7A 2ZDRA 4N2YA 3W2NA 3HBLA 3I7QA 4IMEA 5HMSA 3EKLA 2WSRA 1SPQA 3W1MA 4O28A 3W1XA 4IMFA 2J6XA 2GVGA 3FIGA 3S5ZA 1A5SA 5C6MA 1W31A 3EX3A 5FEWA 1MEWA 1UUOA 2Y88A 3R12A 3DGRA 3M5VA 3N9RA 4QNEA 3W88A 2VEIA 3JR2A 3N73A 3WJSA 3DBPA 1XDLA 1VCFA 5LZLA 1P0NA 4DF1A 3DI1A 1WBJA 4JEQA 3KAOA 1P0KA 2IQTA 4UTIA 2ZRVA 3GDKA 1GYNA 2ZRXA 3L0KA 2C13A 4HIBA 5J5RA 3TW7A 1SR9A 3I68A 1W3IA 4EF8A 1VZWA 2FB2A 1L6SA 1W3NA 1PHWA 1VYRA 5E1QA 4CNOA 4FNUA 3QSTA 1KTCA 3GDRA 2QCGA 1ZNNA 4AVFA 3MBFA 4TU1A 4IMGA 4O53A 3TJLA 3RMJA 7TIMA 4WOQA 3LRMA 2DZTA 5FI8A 3QW4B 4NNAA 1Y0EA 3CIXA 1I45A 2ZZ4A 1LLZA 2VELA 5EA9A 1RQHA 3GR8A 5T26A 3TFCA 1QR7A 3GXNA 3W7OA 1GVFA 1BWLA 1K02A 4UTHA 1PIIA 1IIHA 1OFAA 3BPWA 3CB8A 5L9FA 2Q8LA 2ZA3A 3TU9A 3MUXA 3W1TA 4ZQRA 1WYIA 1ONRA 3ZWSA 1WQ5A 4O13A 5BRBA 5HWMA 1YDOA 2B7QA 3P84A 4L4MA 1ICQA 1OFBA 4RK8A 4GNJA 5G2HA 4E2DA 3S9YA 2WNNA 4LV4A 2QCDA 1B4EA 1KLZA 3FKRA 1XM3A 4ZVJA 3MHGA 3HG2A 1KM4A 1LTDA 1R2SA 1N7KA 1BTMA 3QEZA 3IIVA 4LC8A 4UMBA 4NJIA 2Z6JA 1TQJA 4JTKA 1TIMA 4EF9A 1F2JA 3GIYA 5LNRA 2XN0A 1SO6A 5D2YA 3DFSA 2ZA1A 1LORA 3JRKA 4DO6A 2QCLA 2VOMA 4RJEA 3EB2A 2NX9A 2VFFA 1TV8A 3IIOA 4A22A 3EWYA 4LW7A 3V1PA 3ATYA 1RVGA 5KINA 1YTKA 3BLEA 1U5JA 3PF3A 5AC6A 3Q58A 1TMHA 3I7RA 4MY8A 3NPXA 4XZ9A 5G2WA 5AYXA 3QM3A 2ABAA 3NQCA 1B4KA 3FEMA 4O12A 1XBXA 4N02A 3TQKA 5HR6A 2YFNA 1N8FA 2DZXA 1SO3A 1GEQA 4UFKA 3SECA 1K8XA 3NZRA 1TTQA 3TC7A 3LTSA 2ZTKA 3O8AA 2JKAA 2Q8ZA 3BW2A 1UUMA 5I3GA 3NL6A 4CQ8A 4JY8A 2OJPA 1EA0A 4ICNA 4AWUA 4NQ1A 3UWQA 1YTEA 4O14A 5FF7A 1H1YA 2R14A 1RV8A 4Y6GA 4FX8A 1QDSA 1G69A 1W0MA 3W83A 3MI2A 2C1HA 1IXNA 2I1OA 2EKCA 3NQAA 4FIQA 2RHGA 3PULA 3STCA 3B05A 2YCEA 1VCVA 3EX6A 4OQVA 3I7SA 4JTLA 1QPOA 2B4GA 1QNVA 3QW3A 4K38A 5TBOA 4O1AA 3HGOA 3P60A 3TROA 2HMCA 1WAUA 1B57A 3MO7A 3HGRA 1F74A 1PV8A 4OBTA 4LUIA 3IGXA 2VFHA 4A21A 3SSJA 1NEYA 4O1DA 4AH7A 4UMAA 3S0CA 1G7VA 2Y70A 4GJ1A 2YX0A 4UTJA 1UCWA 3W7IA 4N6EA 4YL2A 2CLKA 5AHLA 1JQXA 3AJXA 1EPXA 1XFBA 3U8GA 3CEUA 1DV7A 3NYZA 2V30A 5EPDA 2J9ZA 3TQVA 3UY8A 4YLWA 3VE9A 5I3HA 3PWAA 4Y90A 3M9YA 4YCPA 1TYGA 3NL5A 4IX0A 2Y62A 4AB4A 2ZRUA 4GE8A 3IVTA 1C8VA 1KM0A 2DZUA 2C6QA 4DO4A 4ZQMA 2JKPA 3MP3A 3B0UX 1FWRA 2AQWA 1VGAA 3L0NA 3LX9A 2ISWA 4O19A 3NO5A 3S1UA 1X1ZA 2BZNA 3B04A 4UFJA 1SFJA 1GVSA 3GVGA 5CG7A 3N2MA 4UR7A 1TB3A 5KZDA 1YADA 5AHEA 1GPWA 1P4CA 6ALDA 4I7WA 3S6DA 4QITA 4I7UA 3KVKA 1PE1A 3BLFA 3IRDA 4NNBA 1HO4A 3GKAA 4MZ8A 3KRSA 3W1QA 4Q4KA 1NF7A 2QF7A 3M0ZA 1TTJA 3M1ZA 4DEFA 4M19A 1VPXA 4UCGA 1QPRA 5MHBA 3SJ3A 4RX0A 1JUKA 2DJLA 3WJZA 4GBUA 3C6CA 5AYZA 4M5PA 3CHVA 2EPHA 2I9EA 2PE4A 5BOOA 3G1YA 3N34A 4S2CA 3O63A 1Q6LA 4GUFA 1KM6A 2QDHA 2GQ9A 3M47A 3MJYA 3CWNA 5LSMA 2JGYA 4FHAA 3W3OA 4K8HA 3W7JA 5AB3A 5DCBA 1HUVA 4OWGA 1WXJA 2B7NA 3HOJA 3S42A 3HO8A 1Q6OA 4K8EA 1G7UA 3STGA 1CW2A 1MO0A 4WOZA 2YSWA 1H50A 3D0CA 5IBXA 3NQDA 3NQVA 3C8FA 1XCFA 3W7PA 5HULA 1W5PA 3NQ2A 1F73A 2RDUA 4NJJA 3CT7A 3L5MA 2FIQA 4M7SA 1KFJA 4Q32A 1FWNA 1SFLA 3F03K 4KWWA 1K7FA 5FF4A 1FCBA 1HFBA 1HTIA 4MLRA 2Q3OA 1D3GA 2V9DA 4LNYA 3IGSA 4BI5A 3DXIA 2RDWA 2A21A 2FFCA 2FJKA 3MYPA 5D32A 3TSBA 4JTEA 4R7JA 1P5BA 2QUUA 2OT0A 2DP3A 3CPRA 2V5LA 2X2GA 3TKFA 4AHQA 3PVFA 4R53A 3C2RA 2OX1A 3TQ0A 4PCFA 4MIMA 3TCEA 3P80A 4YCOA 4QNWA 5DXXA 4HPJA 3Q94A 4FX7A 4BK9A 1Z41A 4NVTA 3HQ1A 4FNRA 4ZQNA 3SI9A 4OHQA 3M16A 3TNOA 1TV5A 3UQNA 3HG4A 2XFWA 4JYEA 4O4VA 3W07A 3O16A 4X3ZA 1OF8A 4UNKA 4ALDA 4PL2A 1YXDA 3W7KA 1QWGA 4UTUA 2VFGA 1TPDA 5HUPA 4K7VA 1QPNA 1OYBA 1KBJA 4BWLC 4JTUA 3LCXA 3W7MA 3G0UA 3W70A 3L5LA 3STFA 3MHUA 3I65A 3HG3A 3KHJA 3C4UA 3C56A 1A53A 3DU0A 3WJXA 1DQWA 3IIZA 4IMCA 1H62A 3PR2A 3FA5A 2X1TA 3ANYA 3LHTA 5K4XA 4J9JA 2TSYA 2OCZA 4TX9A 4XBSA 2CZEA 2H90A 4DXVA 5KITA 4Y96A 5D02A 1FY6A 1OX6A 2Y61A 1R30A 4AWTA 2A85A 4MLJA 1ZFJA 1ZAIA 1UASA 2WKJA 1WBHA 4MUZA 3G24A 1CX9A 1IF2A 2ISVA 1TPUA 2H6RA 1SUXA 1FQ0A 3TAOA 2ATSA 4MY9A 3SGUA 3U2OA 3VNDA 5K4ZA 2O7SA 4UTWA 2B7OA 3GDTA 1J4EA 3VKJA 1N55A 1PHQA 3GAKA 3FYPA 4POCA 1JUBA 1VC4A 4PL1A 4K36A 4GUIA 4ADUA 5HJLA 2HTMA 4N6FA 3O15A 3BARA 4GUHA 5DY2A 4BF9A 3CQ0A 1XL9A 3G1HA 4TO8A 1V5XA 3O6CA 5CZ0A 3FS2A 3W1RA 3BG9A 4U28A 3T4CA 2TYSA 2RFGA 1DVJA 4PA8A 5CGQA 2V81A 3TDFA 5F2GA 3OBKA 2Y7EA 1T8XA 1YXCA 1H1ZA 3LB0A 4RV8A 4ZQOA 4DF2A 4EWND 4RZ6A 1K8YA 1QO2A 1G4SA 1SZEA 1WOAA 3DZ1A 1RZMA 4UTWC 1ME7A 3NQFA 4LU0A 1XBYA 1JCJA 3N2XA 5AHNA 5D09A 4O18A 1G4PA 1JJKA 3QQ0A 3S1XA 4GXMA 4A29A 5HNRA 3O1NA 3QFEA 3GB6A 2Y6ZA 3WJYA 3PUEA 3KVMA 3G18A 4FX6M 2YZRA 5A8GA 4ML9A 4EVZA 4RR4A 1F7BA 5G4EA 3C2FA 1ICPA 3PY2A 3HIJA 4WY0F 1K7EA 1VYPX 1A5BA 1R46A 3QMTA 2FLIA 5DXYA 4JYDA 3L66A 3Q2DA 1KA9F 1YDNA 3G0SA 5F2MA 5K9DA 2XN2A 1XI3A 4FF7A 4MZYA 1LOLA 3DFNA 2YW4A 3L67A 3G22A 3LV6A 4JTTA 3BW3A 1PCKA 5AC8A 2A7PA 3W1AA 1B9BA 1GWJA 3G1AA 1EP2A 3LCIA 3C2VA 5D2TA 2WO5A 3UWYA 1XBZA 4K37A 4Z1DA 5HQEA 4LC6A 3BLIA 3KRZA 2J88A 3WK2A 1F05A 2NLIA 1IXQA 3U6WA 1AW5A 3LERA 1S5VA 3A9IA 4QISA 3GLCA 2QR6A 3B4UA 3G8RA 1ME9A 3UYCA 2ZFAA 1TV7A 1OYAA 2QCDB 4AXKA 3BK0A 5D05A 2ZZ2A 1FDYA 3LCWA 3HMJG 2WQPA 3QSRA 2NXHA 5F1VA 3LXAA 1FWWA 3EWWA 3L2IA 3ATZA 3ZR4A 5U4NA 1H5YA 1CI1A 3EKZA 1P1XA 1HG3A 3IIXA 3EXRA 5F4XA 4QAIA 3RF9A 2QEZA 1X7FA 1O4UA 4CCEA 1Q45A 3SFKA 1XKYA 4M7TA 4AEOA 3O05A 5DCEA 1Z44A 3T55A 5F1UA 2A7RA 1F6KA 4NX5A 2FB3A 1KW1A 5IBXC 1UB3A 1FCQA 3FJLA 5F4SA 2BTMA 1JRCA 5DBUA 4JYFA 4HHPA 4HPXA 4FNSA 3M41A 4R33A 2P1FA 2DZVA 4O1BA 4K7YA 1RQEA 3PBUA 2J9YA 4GWEA 4O17A 1I2QA 1OFOA 3R5EA 3L0GA 1F5ZA 3W2MA 4MY1A 1EWEA 3S5NA 4IPIA 3QYQA 3LTPA 2QUTA 5LNWA 1GG1A 2TRSA 4LVDA 4K6AA 3P5YA 3NQGA 2E5BA 1LOQA 5D03A 1VLIA 3BG5A 1G6CA 2EF9A 2CLFA 1FXPA 2GPTA 5FEXA 4DELA 1GOXA 3DFPA 3LRKA 3QZEA 3P8IA 3W7CA 4LVBA 1LCOA 3NOEA 4JTSA 1L9WA 1I4NA 5HR7A 2QUVA 1X6UA 4PFMA 2E09A 5H91A 1OYCA
chains in the Genus database with same CATH superfamily
2C1GA 2I7GA 5D2XA 4HT3A 3MPGA 3LXCA 4AD4A 2QAFA 1TWDA 4J3UA 3B9NA 2JQXA 1A5MC 4P7OA 3O0FA 4NL1A 5G5IA 1KR0A 3ZLGA 4XD3A 4CQBA 1VFMA 3RNDA 1JQVA 3UXAA 4PSRA 4RZBA 5I3JA 3S83A 5F2IA 4KQNA 4GYPA 2RKXA 4XVEA 2DH2A 2VENA 3BOFA 5IDIA 1W2PA 4X9YA 1ESWA 4TMCA 3M0KA 1A5AA 3C3NA 3DOPA 1KFEA 2CITA 4S3DA 3UG8A 4MMWA 4C6LA 3AIRA 5XIMA 1VHCA 2W27A 2PS2A 3NO1A 4XZNX 2VP8A 3EMZA 2W79A 1EGVA 4G6CA 2OR2A 2J8FA 4H6RA 3PS7A 3UXIA 5AOUA 2XM1A 2PDWA 3TW6A 5SWUA 4QJ3B 3G5EA 3GNRA 4DXXA 1E71M 3AYVA 3LQGA 1DWIM 3NCOA 3F5LA 2NXGA 3WFLA 1A0EA 4IPNB 1NFBA 3F7JA 4WK9A 4EAMA 3JZUA 4H4IA 4JN6A 3N13A 3I3BA 4MSSA 4NJGA 5A2BA 2BXZA 2VEGA 4Z08A 1TJ2A 1TSIA 3GIQA 4I5XA 1ICSA 4Y9AA 2BOGX 2D2OA 3TXVA 2ZC8A 4CD6A 3F4WA 4S3BA 2E9LA 3K30A 5K9CA 2ZRYA 1DQUA 4H9YA 4LALA 4OGZA 2PDUA 3LCLA 2DSZA 1XPGA 1OD0A 2PRHA 3PP7A 3MCMA 2X40A 3W73A 1V7AA 3OVGA 2OG9A 1EZWA 2DSVA 1OGBA 4HNTA 3TWAA 2VDGA 3ARQA 3CHFA 3W7EA 1J2WA 2PUZA 2PWHA 4NX0A 2GJNA 3CL6A 3GXPA 2UV8G 1HL2A 3A64A 3NXLA 3JU2A 1W54A 3TEVA 3FYOA 3OBEA 2J66A 2ICSA 3WDJA 3UFYA 4HA4A 1UQYA 2AAMA 4FB7A 4O10A 3WX7A 1CLXA 3LSBA 4DPPA 3KVLA 4O8AA 2XH4A 1R2TA 2MANA 3NPUA 1MQRA 2JEQA 4HNNA 1HN1A 5HINA 3N2BA 4YYCA 3STPA 3T2QA 4FS9A 3OVPA 4JIRA 1Q2RA 3LNPA 5IFPA 3RU6A 3T81A 3HGSA 3I10A 4ADTA 5LHEA 1CYGA 3ZS4A 3CM4A 4H3DA 2ZUVA 3QF0A 4HSNA 3I6TA 5DMNA 4ZSUA 3LENA 3QYSA 3QLDA 1I1XA 1E9ZB 3AWNA 1TWSA 3ABSA 3GS6A 3RR4A 3V5FA 1UROA 1PZ2A 2OSYA 2UY3A 1YIXA 5I07A 2GLKA 2ZX5A 1OFDA 4RPPA 5AZ0A 5C5YA 3TQPA 3BAIA 2EXOA 3VUPA 1M7PA 1KRCC 4FK9A 5BWAA 2WV8A 1OFQA 3EDFA 3H4XA 2C16A 2XHYA 1QRQA 4PRRA 4A05A 1AD1A 4YHEA 3H53A 2QXWA 1GKPA 1A3HA 4MAZA 3VDCA 4WVXA 3HU7A 2PGFA 1UH2A 3HFTA 3IGUA 1XRFA 5HWJA 3AC0A 5GVJA 3DBNA 3WN6A 2FGLA 1CXFA 4Q4OA 3SN4A 1TX2A 3FHAA 2X1SA 4Q33A 1EUNA 3LK6A 2BG5A 4MNJA 4XV0A 3RO6A 2DZAA 5AYYA 5GPRA 4O1FA 1KFCA 5CPNA 3E1F1 2QJGA 2J8GA 3SCTA 3EXTA 5CJNA 5C8BB 3TW9A 5ECUA 4AEEA 2A6NA 3P8JA 4JL2A 4BF5A 3E3HA 5A6MA 3VOGA 4IWWA 5EGRA 2EBNA 3KBWA 1X98A 4V2XA 3RCNA 4G7FA 3B0VC 5FJUA 5J04A 2DORA 5U7SA 3SADA 4I5UA 5A6BD 3TH6A 2QJHA 4HMDA 2ON3A 4JNMA 4UWMA 4XG1A 1ISVA 1OABA 2GFTA 1U5HA 5CAHA 4I5RA 2NUYA 2V5BA 2PDXA 1IEIA 1A3WA 3W81A 3LEPA 4GZIA 3G8EA 2PSNA 3KRUA 1DEDA 3LGEA 1W91A 4AMCA 4L7ZA 1VP5A 3UPWA 1SGJA 2VI0A 3DG3A 5FF0A 4JTIA 2BHZA 3W87A 4AZ5A 4PODA 1UKTA 4HJFA 3TC6A 2OSXA 1DQXA 3B9EA 1XLEA 4XBKA 2HPMA 2QIWA 1BKSA 3GNNA 2H8XA 4HYVA 5FJPA 4AU0A 1SU5A 1RJQA 4DUOA 3VOFA 4ZO8A 1VFTA 3W74A 2FTPA 2H8ZA 4MWAE 4S3AA 3MA8A 1FWEC 3DKLA 2NUXA 4NSBA 3RG6A 3BMXA 2WSQA 1BFNA 5CZSA 1SW7A 3IJ6A 1UKSA 3IEBA 5KZEA 2CU0A 1J93A 2P53A 3A21A 3UCQA 1ECEA 4I90A 3T8LA 4EXQA 3KRBA 1ZCCA 3A4WA 4M1BA 2JF7A 3CEPA 1LL7A 1Z42A 4DPQA 5I06A 3QTPA 2WVVB 4PTVA 1L6YA 3KP1A 4WD0A 4AFYA 5A8MA 3LYEA 4BQ3A 1NARA 1LYXA 3GW0A 1KM1A 4IQEA 3VD4A 1EJSC 2DSKA 1CGXA 3WNNA 3Q37A 4X0NA 3AQUA 3OHIA 2E67A 2O92A 1S1RA 3H7UA 4GJIA 2O55A 3S5OA 1LLWA 2PDFA 1RR2A 1V03A 1VJIA 4LUJA 2HS8A 1FUYA 2QULA 5EBUA 1D3CA 3BC9A 3THQA 2IKGA 1PKLA 3MP4A 2BDQA 3B0XA 4S39A 3N4EA 1CGWA 3CUJA 1AW1A 3SCWA 2J6VA 3R25A 1WDDA 3UZWA 3VM5A 1JDCA 2CZVA 4WSHA 4CD7A 3OJGA 3W7NA 4N4PA 1WXYA 4RKAA 1V0KA 1XRSA 3NQBA 4JHZA 2WBKA 3CZ8A 5AC5A 1DIOA 2XZ7A 5D30A 1DOSA 2WVVA 9RUBA 1X8FA 1W3JA 4FOUA 1UJPA 1LUCA 3VOCA 3FAXA 4GNKB 1ONWA 3K5XA 1BKHA 5BU6A 1XDJA 2FZ8A 4FALA 4FOJA 1HNYA 1BXBA 2JEPA 1Q4WA 4DNMA 1V7YA 3SCUA 3U5UA 4TVCA 1A5CA 3MUZ1 2NVAA 3DEQA 3KVJA 2GK1A 3HPXA 4MF4A 3AS2A 4WY0A 1GQLA 1X39A 4IQLA 3MMTA 5AVHA 4Q8TA 1PEZA 1FWGC 1UC4A 3R8RA 1T6MA 1EJXC 3OYXA 3TZFA 4P61A 3MZNA 2MNRA 2PDIA 3ES7A 1JL8A 2CZ5A 4ZMGA 1VHNA 2ESCA 4ZSTA 3TOPA 5FSEC 4MDPA 4LBSA 3P81A 3TFXA 1EB3A 2BASA 4L1GA 3P3BA 3RX3A 4F2UA 1IEQA 1DJIA 3P82A 4V33A 4A3HA 2ZWZA 3AYTA 3W2KA 3SBFA 1R86A 3WQEA 3BLKA 1OC6A 1GONA 4GGBA 3CAWA 4C6QA 1GOWA 3NQ7A 1K4HA 1KRAC 2PBGA 2R91A 2GGGA 4V1XA 3TTSA 1OM0A 1EUAA 3E5BA 4NP7A 1SW3A 3F4VA 2HK0A 5T8GA 5A8QA 3CK5A 2FQIA 2VFEA 2VEPA 3MSYA 1FHDA 4DWSD 4L64A 3POCA 3AXIA 4U3CA 3JUGA 3UJ2A 1XLGA 2J7DA 4FMVA 2WZMA 4GI6A 5EFDA 1WX0A 3TE9A 4XKYA 1VQTA 2XPKA 3GG1A 4Y9PA 2OMAA 3QKZA 3CZGA 4XD6A 2FTWA 3CH0A 3EA3A 1T5AA 3AMCA 4QAWA 2DZBA 2GUUA 1B3OA 1GYLA 3TJXA 4FXSA 1TCDA 4ERIA 1HXJA 1TQXA 5AHFA 3ZR6A 1RCOB 1HJUA 4PGLA 3CV6A 4LTSA 3CAQA 4A3UA 4C6OA 4UNIA 1Q6RA 4WXZA 1PPIA 6REQA 4XTDA 2ZQ0A 2ZUTA 4GC3A 5CC7A 4RZ4A 4AF0B 2DEPA 1E1FA 1LRTA 1A5NC 1MQPA 3BL3A 1UR1A 1G0CA 1KCZA 3IJIA 3PBWA 4DO5A 2QCCA 4FIRA 5LNUA 1M7XA 1XYCA 1H7OA 3C61A 1XF0A 3NZQA 1EEPA 3E38A 1WKFA 1W8SA 4Z2GA 3URAA 1XPYA 2EPLX 2OZ3A 2B7PA 3OQEA 4FO4A 4J7RA 5FIPA 3B8TA 4IIDA 1F61A 4JD4A 3UWUA 3COTA 5FAJA 3F2CA 3NSMA 3PM6A 4AUBA 2Q3RA 4JOMA 3CIWA 3NQ8A 3FJ4A 3SSZA 5CGMA 3SQMA 3L2MA 4QSHA 1V3KA 4KIRA 1LRNA 2D73A 1XIEA 3P61A 1E40A 2PD9A 4LCQA 3ZZ1A 4KFNA 4F0KA 3EX1A 3B8DA 3ITVA 2ANUA 2ISDA 3QY6A 4YTSA 1LLOA 4UFMA 4XUGA 1LF1A 1B3ZA 9CGTA 5D2WA 2G41A 2PF0A 1RY8A 4JKKA 4A3YA 2ZOXA 2VR5A 1VBUA 4GA8A 3N18A 5DT5A 1EF3A 3W22A 3W84A 3CUZA 5AZ1A 3NG3A 3UWVA 2PU1A 1G4EA 5FF2A 5MKGA 4HBKA 3B8VA 2ZRZA 2CLEA 3C0JA 5GQBA 2FZ9A 2Q71A 3ITOA 1OX5A 1POKA 2INFA 1UC5A 3CUHA 1Q13A 3S47A 3G1SA 4PB3A 4C90A 1ZY9A 1ONXA 1GCYA 1UZ4A 4ZOCA 3ANUA 2H3DA 3UR2A 4RE4A 1X1OA 2Z1VA 5GNXA 4XIMA 4GIAA 1JRBA 3L4TA 4D6EA 5FEZA 4CGTA 4M82A 2BY2A 1EJ7L 4JFSA 3KWSA 1A50A 2Z7GA 3KBNA 1XC4A 1TE1A 3NPWA 1IWBA 1YXYA 3CGTA 3EWXA 3KDOA 1JZ2A 3PBYA 2Y5JA 2Z00A 1GNXA 3BVJA 1IEWA 4OOUA 3LCGA 3KOZA 2HDJA 4DRSA 2UY5A 4OT7A 1EIBA 5D9NA 1E0VA 1C29A 2QPUA 3AHVA 4O4WA 4A35A 1J0KA 2QGYA 4NZ1A 2PZNA 4PZVA 3WFZA 3DDMA 4TTUA 2YBTA 5G4WA 3C2OA 1LT8A 3AXHA 2EPMX 3P14A 3L12A 1MVYA 3AZSA 4GQQA 1ZJIA 1MFVA 2BHUA 4ICCX 3VDHA 4BQ2A 1XSIA 2CFFA 1TJPA 2OLAA 4CQDA 4I9AA 3TTQA 3SCNA 3BZJA 3W85A 4DYEA 1TJ0A 3QPZA 4LANA 1XBVA 4UBPC 2WNZA 4S3JA 1WZLA 2R1LA 5CBJA 1YPFA 1EP3A 1TIWA 4JS3A 3L4UA 1G67A 1AQ0A 1KO0A 3DN5A 1IR1A 1YLVA 3IANA 4IXHA 3MI6A 2GJRA 4M6QA 2V2HA 3RDKA 3EA2A 3V35A 3SJNA 2PDPA 1BWVA 2YIHA 3Q4DA 5TF0A 5A1AA 1K9TA 4AIEA 1Q2SA 1B30A 2YCLA 3NZPA 4S3EA 2EAWA 1C7SA 3EX4A 2TMDA 3QMRA 5CGTA 2DVXA 1OFPA 3MSDA 3WLHA 1VJZA 1W9UA 1LBLA 3FGCB 1Y65A 4A6GA 1DIKA 4QQUA 1XV8A 2YJQA 3VU2A 4H9ZA 4B5NA 3NM3A 5I00A 3WDRA 1XIGA 4L5ZA 1ZQ5A 4GX8A 5I3DA 3CWOX 3RLUA 2JKEA 3LM3A 1UPPA 3L68A 1CGTA 4FPSA 1CTNA 1QT1A 3N14A 1JDDA 3R89A 4Y9NA 2QQ6A 2DSWA 4N7QA 2Y0FA 1HVQA 3PPGA 3PTKA 5DCDA 3VD9A 4CU6A 1SFTA 3LPOA 1O6IA 4L6HA 5MKGB 2TODA 3N4FA 3SUVA 3OG3A 1HKIA 1F8IA 1KTBA 2WNWA 5AC7A 3WQGA 1XLMA 4EE9A 1L6GA 2OWWA 4Q8OA 1SPQA 3QY8A 1UIOA 4O28A 3W1XA 1PTGA 3EGJA 3FIGA 2OX4A 3QOKA 1W31A 5FEWA 1MEWA 2OYLA 1QHOA 1UUOA 3R12A 2DV0A 1IZJA 3N9RA 4QNEA 5D9OA 3WIJA 3JR2A 4S38A 2P8BA 1J96A 5M5DA 2HXTA 4AISA 2DUZA 5IDZA 3LMZA 1G01A 1GHSA 4UTIA 3A3HA 1XIHA 1XR2A 4I9JA 2C13A 4A3RA 3T2OA 1VZWA 4DM2A 4CNOA 4IGNA 4Q4MA 2FDMA 4HHMA 2PU0A 4P8VA 4TU1A 4IMGA 3TJLA 3BUVA 1MZRA 5CG0A 2DZTA 3QW4B 4NNAA 1KGUA 1KWKA 1LLZA 5BRPA 3TFCA 3RU8X 2DIKA 3GXNA 2YL9A 3UJSA 1VKFA 1IIHA 1QI0A 2YXOA 4O1EA 2WXDM 5L9FA 3T8QA 4W86A 2ZA3A 1U1HA 2A3CA 3MUXA 4Z1YA 3C5QA 3MKKA 1ONRA 4RNFA 1WQ5A 4M24A 1VBHA 4KCVA 1V3MA 3RITA 5E0FA 1ICQA 1OFBA 4E2DA 2G8ZA 1XM3A 1FWFC 3HG2A 4BEQA 1KM4A 1LTDA 4IUGA 3OZOA 4B5WA 2PI6A 3PBMA 4NJIA 1F2JA 3CV7A 2XN0A 1SO6A 5D2YA 1LORA 3JRKA 2VOMA 4I8DA 3OOQA 4LH8A 4Q4QA 2E9BA 3ITYA 1O5QA 3H26A 2PEVA 4LFYA 3AMGA 3ATYA 4QG9A 2VGFA 3O7UA 1YTKA 4DZ5A 2CWXA 4NAEA 1SMDA 3PF3A 3VGDA 5LIXX 3VKDA 4DHGA 1WZMA 2Y8VA 4XZ9A 1TWWA 1OIMA 3NQCA 2ZXQA 3TQKA 3ZO9A 2VMFA 2W4XA 5I24A 3SECA 2CHOA 3H8AA 4MJ2A 3QVQA 3BW2A 4MNLA 4CQ8A 1K77A 2QV4A 1EA0A 4DLMA 3MT1A 3UEQA 1YTEA 2Z27A 5FF7A 3AWOA 4Q7IA 3VTRA 1CXIA 2GOKA 1G69A 3MI2A 2I1OA 1KQYA 2FH8A 4FIQA 5CEWA 4H1ZA 4IT1A 2PGEA 5T91A 1G1YA 1E0WA 2OOGA 3CYVA 5TBOA 1XHGA 1NH6A 2QPXA 2VTFA 4LYKA 5E0CA 4KBXA 3ARUA 3MMWA 3MO4A 4A21A 3AXKA 3N04A 4AH7A 4HPNA 1OZQA 3W7IA 2WHMA 1E6QM 3U8GA 3RPTA 2XISA 3WDQA 1IE7C 3WQ8A 2R24A 1EGZA 2J78A 1ZBCA 3WD4A 3WUGA 3NL5A 4IF2A 5E6YA 4DO4A 4DXKA 1W1B1 2WC3A 4ZQMA 2JKPA 3AZRA 3LD5A 2CC0A 2O9TA 2ISWA 3DESA 2VDHA 4H9VA 3S1UA 4UFJA 1SFJA 1GVSA 3D5HA 1F8MA 1LQAA 1P4CA 3M64A 4DX3A 3SCVA 3IRDA 1B2YA 4W8BA 3W1QA 5I2UA 4Q4KA 3PNUA 2V38A 2NQZA 3M0ZA 3BQ5A 4EXBA 3M1ZA 4HK5A 4GGHA 1B3YA 5MHBA 4RX0A 2WCAA 4M5PA 1IV8A 3T4WA 2Y8UA 4QTGA 2JGYA 4FHAA 3W3OA 4K8HA 2G3JA 3W7JA 4E2VA 1JPHA 2OQHA 3B0YA 1HUVA 3FHQA 3ZLHA 3HOJA 4PUMA 1YNYA 4W8LA 1Q6OA 1G7UA 1RLDA 1EX1A 3PFRA 3EKGA 5I23A 2YSWA 3IJ9A 1GHRA 3D0CA 5IBXA 3NQVA 4R85A 3BE7A 5HULA 1CENA 2ADAA 3CTTA 3WH5A 4WEVX 2WPGA 1U30A 3CT7A 3L5MA 3Q45A 1U1UA 4GY0A 4Q32A 2RAGA 3VNIA 3ZVIA 1SFLA 4KWWA 4JPGA 1K7FA 1HFBA 5HXMA 2Q3OA 1OWQA 4QE1A 6XIAA 2XVKA 3DXIA 4JFWA 1W32A 1B54A 2RDWA 4MB1A 3DERA 1OC7A 2FJKA 3MYPA 3TSBA 4DWSB 1KBKA 4JTEA 2CBUA 1P5BA 2OT0A 1B3XA 2V5LA 3C2RA 3ITXA 2FVKA 2OX1A 1BSIA 1JFHA 1N8WA 1U2YA 3BCDA 3P80A 3PZMA 1W9XA 1WDQA 5CSYA 3Q94A 4FX7A 3WDHA 2QVHA 3QY7A 4J3TA 4S3CA 4ZXLA 1VFSA 3LSCA 3HG4A 5BU9A 5REQB 4AQLA 4JYEA 3S2MA 4XSMA 1M68A 1JIBA 1KCKA 4AD0A 5LA2A 2AMGA 1TMQA 4LPCA 2O0TA 1QPNA 1OYBA 1KBJA 4D8LA 4JTDA 1WXZA 3ZIZA 2OOFA 4F66A 4FR6A 5EMJA 3H2AA 2JE8A 1AZ2A 3W70A 3MHUA 3I65A 4W5UA 3KHJA 1UR2A 1P48A 4D71A 2VWSA 2OTDA 1O68A 4IMCA 3FEQA 1H62A 2QUMA 3ANYA 2EO7A 3LHTA 1PBGA 5K4XA 3WD1A 3WEMA 3URQA 3VC5A 3K8MA 4DAFA 1R30A 1W1IE 3LY0A 1ZAIA 2OEKA 2BHYA 5IHSA 2WC7A 3HV8A 4MUZA 1IZKA 3BJTA 4EAYA 2IMRA 3V4BA 4L1WA 5K4ZA 1EHAA 4UTWA 1UG6A 1KGXA 2YA2A 1RD6A 1FVPA 3OGRA 7XIMA 2W5FA 1J4EA 4CEXC 4JIHA 1FHVA 3VKJA 1JUBA 1VC4A 3BJSA 2YKKA 4ADUA 5HJLA 5LIKX 4DWSC 3BARA 4BF9A 5DY2A 4DB7A 3CQ0A 1MUCA 1HGYA 3G1HA 3OLEA 4TO8A 4QXIA 3BG9A 4U28A 2NVDA 2TYSA 2E28A 4PA8A 5F2GA 5CGQA 1HL9A 2V81A 2Y7EA 4PR4A 4XISA 3W01A 3RR1A 1QATA 1WOAA 2FMNA 5FACA 3DZ1A 1ME7A 1JCJA 2VUYA 3H2CA 3N2XA 5AHNA 2VX4A 1JJKA 3VZZA 3S1XA 4GXMA 1WDPA 1UWQA 1V6TA 3WJYA 3WLSA 4Z2LA 4XZBA 4EVZA 3EA1A 1OB0A 1K7EA 4D6JA 2OKTA 3QMTA 3WD2A 5DXYA 4WLCA 1QHZA 5F2MA 5K9DA 1NDWA 2XN2A 3IAQA 1XQKA 3R11A 5EFFA 2E25A 5DF0A 1D8WA 3AIVA 5DMLA 3W1AA 1NJJA 1J9YA 3C2VA 2WO5A 1BXNA 4IG2B 3BV7A 3D3FA 1V0NA 3TR9A 4Z1DA 5HQEA 3R1ZA 4LC6A 3KRZA 3WK2A 2NT0A 2NLIA 4LSBA 1PKMA 1TA3B 3A9IA 4ZE5A 5B80A 2ZX8A 3VGBA 4AXKA 2ZE0A 1Q63A 3LCWA 3FXGA 3PBGA 3AMDA 3EWWA 1W2VA 3WD3A 5U4NA 3CV2A 1H5YA 4HYRA 4HOXA 1KNWA 5A8OA 3IIXA 3EXRA 1FP9A 2I5QA 1GKQA 2V69A 1O4UA 1JDAA 1PZ1A 5C71A 1FH7A 1OT1A 4XUYA 4F2TA 4FLRA 1F6KA 5IBXC 1XX1A 1UB3A 2FFIA 2XH7A 3KTCA 1ZUAX 2BTMA 5F4SA 1GVEA 4AVNA 4HHPA 3V18A 3VIFA 2P1FA 4O1BA 1RQEA 3OHMB 3PBUA 4GWEA 3AMKA 4P7NA 3DG6A 3APTA 1F5ZA 2WM0A 3S5NA 2NQ5A 3QYQA 1IZCA 3LTPA 2DGAA 1WKDA 1VB9A 2YB1A 4KGJA 5LNWA 4PB5A 3QC0A 5D03A 1LOQA 4H2CA 1VLIA 4P7LA 2VZOA 2GPTA 2AQOA 4DELA 4DBWA 4UQCA 4U10A 2OVLA 3QZEA 3URNA 3GIPA 3IK2A 1GW9A 3CQIA 1AH4A 2F61A 4PFMA 2E09A 2VQTA 2EJAA 3GR4A 4JTCA 4CEUC 1LJYA 1I60A 1GVYA 3WBAA 3TA9A 4ORIA 4MAVA 1KWGA 3MWAA 4BF7A 2BOFX 1TV3A 1JCYA 3U4FA 2A1YA 3V1HA 4JICA 4B91A 5DFAA 3S4TA 1H2JA 1PDYA 4IJRA 3WDIA 4H19A 1UH3A 1MNZA 1GOKA 4RLIA 1LG2A 4Q7NA 2D24A 3MTWA 3EPMA 3UWWA 2VC9A 3C52A 3RIKA 1O7AA 3I6RA 4REQA 4B5VA 4QDMA 1MXGA 1V0LA 3R8HA 4MYXA 3EEGA 5DX7A 3RCYA 1J0YA 3VFLA 3UJRA 3QPYA 1S39A 4PYSA 1IGSA 1DJHA 2XGIA 3AMLA 1K3UA 4YWIA 1WB0A 3TX9A 1W3HA 1LOSA 4F0SA 2ZUMA 1HJVA 2PWUA 5HQMA 5LIYX 1NWRA 3FFSA 3K8LA 1FDJA 2QV5A 3EXSA 3NDOA 5C2CA 3WJWA 1A49A 4Z42C 2EPNA 1KM2A 4E2BA 5C0QA 4NI3A 1PTAA 3LG3A 2YYUA 3U4AA 5KTLA 4ZQPA 3W29A 2A79A 1TKKA 1H4PA 1ZCOA 3W2JA 2Y7FA 1OD8A 4OE7A 2J27A 1AMKA 2JGQA 5D9MA 3WMBA 2OELA 1BQCA 1H7RA 3L23A 4S1FA 1O60A 4KERA 4BWLA 3NTYA 4N0RA 3OVQA 3WNLA 1N2VA 2TPSA 3PSWA 3B97A 1BSLA 4AX6A 2VR2A 4BEUA 1KFLA 4LUTB 3CNYA 3XINA 4RXFA 2X16A 4LOCA 3VI2A 4TVDA 2GYIA 1FWHC 2OQYA 2W91A 4E3TA 2PC8A 3CZKA 2DUXA 1EYWA 1NAL1 4P8WA 4UTKA 4BI6A 1C92A 1Q6DA 1QOPA 1ADOA 1FX6A 3WF3A 1XH2A 4YTTA 4JIQA 3DC8A 2G0WA 4OU1A 3SRKA 3LCHA 3U57A 3G1RA 3P6LA 1IXPA 4TIMA 4AIOA 4JX4A 1SZFA 1V3IA 2ATMA 1KB3A 3AS1A 1E51A 3W72A 1DORA 4G56A 4QROA 2VGGA 4RDZA 2CLLA 1DJXA 2Y2WA 4OV9A 2R1MA 2A3BA 4XD5A 2Z7KA 4AIBA 1OG6A 3QJAA 2BFGA 4A8IA 2X7VA 4EP8C 1I2NA 1NWSA 3WQ6A 3ECQA 1PWMA 4D6CA 1WAWA 1TPVA 1JZ4A 3T0AA 2A0NA 1IWAA 1EIXA 3VO0A 3LDVA 1M9HA 1TPH1 4RZ5A 3B0PA 1JULA 2WSYA 4Q4SA 3IARA 5C7HA 4UTTC 1Q6FA 2G95A 4JIEA 1AW2A 2FJUB 1W5QA 5ABEA 1GJUA 3KBSA 1A47A 1LM1A 1GGOA 4NU7A 4DAIA 3TMQA 3E02A 2IPWA 2V82A 2C8NA 4B3ZA 8TIMA 1K03A 3IUHA 3TCSA 4D6GA 5G1YA 5GJPA 1W9BM 5D2VA 2E68A 5H8UA 4IMDA 3BMVA 1S2TA 1GK8A 2GQ3A 4TTGA 3IV3A 1Q5MA 4LAOA 3A23A 3N12A 2V3GA 2G3NA 3ES8A 3WK0A 1DIDA 3NWRA 4NILA 1YNPA 1V77A 4XTIA 3GU2A 1IR2A 1KLYA 4CQAA 1E4LA 4UFIA 1KXTA 1ZHAA 4X9SA 1Z3NA 1KBIA 1YPIA 1S3HA 5TD4A 4JTHA 3C2EA 3M7WA 1K6AA 3H54A 5CPLA 3GKFA 3LS9A 1W3KA 4CNUA 2XFFA 1A5OC 2IXVA 1DPMA 3K1DA 2DY3A 4HNUA 4DJDC 4XKYB 3B9AA 2OZTA 5A8PA 3N19B 3SQLA 1SR0A 2YLAA 5FJTA 3A9BA 1G4TA 3DKJA 3U48A 1KV8A 4PMZA 3USBA 4ZOAA 1H7NA 2F7FA 1FHUA 4YMZA 2PMQA 3HM7A 4HMEA 4ZXOA 5TIMA 2VURA 3GZAA 4AF0A 2NV2A 5E93A 2RDXA 3B9OA 2XVLA 2VCCA 4B5XA 3M7SA 4DBUA 4K1WA 4HCLA 3RX2A 3PWGA 3GC2A 4XQ6A 4F0LA 5LA1A 3PG8A 3HQNA 4GXPA 4LYQA 1UQZA 3UZXA 3G1VA 4E8CA 4X0VA 3IRSA 1S5WA 3OA3A 5CC3A 4B4FA 4IJCA 2ZADA 3ZT7A 4H8NA 5GJNA 5KSWA 4FF5A 5HWNA 1GG0A 2YFOA 3TYBA 3W1NA 1NM9A 4PEKA 1DJNA 2CKSA 3D46A 4J1OA 2DT2A 1WA3A 4NY2A 3SCOA 1XICA 2P8CA 1KXHA 3SR7A 2J79A 4LRSA 1LBFA 3W7RA 3UY7A 4DBEA 1MI3A 3NQEA 1E0UA 1DBTA 3IACA 3W7QA 2QAPA 3PNZA 2CBVA 1H7WA 2YDAA 1NFPA 1WNOA 4CCDA 4MVAA 3NOYA 4CNPA 2NQJA 4YTUA 3SRDA 2YCLB 4PSPA 3H2FA 3GZ3A 3O6YX 2DW6A 4C6NA 2R6OA 1H0IA 3IUDA 4F2BA 2ISFA 1L2UA 3BAYA 3R8GA 4L9ZA 4CN4A 1IQ8A 1ZGDA 3PBVA 3TMLA 1SQ7A 4N4QA 4JEJA 5C2XA 3N9KA 1FBAA 2Y89A 3SUUA 4X22A 3H22A 3OIXA 1WZAA 4WZHA 5BCAA 3NPVA 1BVZA 2CW6A 4LEQA 3CU2A 2BS9A 1ITUA 3KOFA 4GVGA 3NR0A 4QP0A 4B9ZA 4A8LA 2I9UA 2XDFA 3PPCA 4QM1A 1NOFA 1QHPA 4H7CA 1EJWC 4B15A 4AWEA 2QCMA 1LDCA 3GTIA 1I8JA 2WK2A 3BW4A 2XWEA 4WIWA 2NX3A 5A6JA 4LGXA 3GVQA 1MEIA 3NEVA 4XZLX 1DJZA 4O0KA 2ZZ1A 4FP1A 5AHMA 3W7LA 4AX7A 5LGXA 3WQVA 4XO7A 1FWDC 3WLJA 4IPLA 2AKZA 5BZAA 4UMCA 2YOCA 2NV1A 3A4AA 4KT2A 3EPNA 5JH2A 3BG3A 1HKVA 2Z6IA 1W1A1 1LL6A 3KCJA 1I2RA 2UY4A 1W5NA 1T8QA 2FTYA 1F4HA 4M80A 3VNJA 2Y85A 1AD4A 3VIJA 2P3ZA 4CNTA 1PX4A 2P76A 2ZICA 2GQAA 5FJOA 2VZVA 3VPLA 3NSNA 1QOQA 4MPKA 4DI8A 1GVRA 3FOKA 4GBDA 4KCUA 1LT7A 3TYEA 4J3XA 4HNVA 3VKKA 3H2EA 4QEEA 3SCSA 2GSEA 4QJ5B 4FZIA 2GVLA 4GISA 2R94A 1ONEA 3KTXA 2Z0IA 1IXOA 3KX6A 1AL7A 4NRRA 5M3WA 3S8HA 1OJXA 3TWBA 4KWOA 4DJEC 4Y8EA 5D33A 2VD9A 2Y63A 1UD5A 2QCNA 2PDNA 1LP6A 3GQYA 2VFDA 2VX5A 3ARVA 1XLDA 1EYEA 5A2AA 1AODA 2ZZ6A 3PFMA 4JNYA 4IHCA 1IIGA 1GVOA 4OZOA 4O16A 1M53A 3LBCA 1E6RA 3WBXA 1TREA 1W3TA 4NHVA 2I16A 4I9TA 4KWUA 3MANA 3N6JA 3BSHA 3TN3A 3VIIA 1WV2A 1QOXA 5ABTA 3QQWA 1X97A 4KRUA 3CH9A 2PTZA 2ZZ5A 1Z32X 3ELFA 1S5MA 1JDEA 2JBMA 1E73M 3SFWA 3O0KA 1B31A 4AZGA 3F4NA 3BO9A 2HK1A 3N3TA 4J5NA 2QVNA 2QUNA 4ZFCA 4WUIA 4JDBA 5EMUA 3P74A 1S2UA 4LRTA 3KZSA 1ZENA 4P8XA 1RA5A 2C79A 3M4HA 4R9XA 1F3XA 2PZ0A 1MNSA 3BLOA 2EG7A 1J0IA 1QW8A 4W88A 3DI0A 3N3MA 3V0TA 2FHFA 1RALA 3MCOA 3S5YA 1NF0A 4IL0A 2VZUA 3BLDA 1TRIA 4E38A 3ZM8A 4NAEB 2X41A 4FSAA 4O54A 5CBIA 4LS0A 3U3HA 3EDKA 4AD5A 3EZ4A 2QLYA 4NT0A 5HOSA 1PL9A 4M29A 3AS0A 3LRLA 4LAZA 1I0DA 5FKYA 2F38A 1S2VA 3WQOA 1BVWA 1TE6A 1E4NA 2C19A 2NXIA 3SCQA 5IRPA 2KAUC 1FWTA 2C15A 4O57A 1UBSA 4XVDA 1O5KA 3VX0A 1W37A 4H9UA 3P7YA 5C2GA 3CAKA 2WMGA 4XAPA 3T0DA 2REQA 3WK1A 5I0DA 1BPLB 4QS5A 3WNKA 4GHRA 1GZ1A 3W76A 3AIUA 1OY0A 3CAVA 4KRTA 3ARXA 4HSOA 1RCXB 5DELA 1EX5A 3DHPA 1GJPA 1XGEA 4QG6A 1RK5A 1E3ZA 2GSHA 2QJMA 1OCNA 3R94A 1GZGA 2Z26A 1AG1O 2YBVA 2X05A 3TIMA 5EBAA 2Y7DA 4H83A 4DVOA 1JCXA 4ENLA 4G1KA 2PBOA 2RGLA 4GFIA 1V51A 3WQDA 2UY2A 3LOTA 1F3WA 1C8YA 3KOWA 4N9BA 1TR9A 2NX1A 1EQCA 1Q8JA 1UWTA 1DJQA 1ME8A 4H04A 4F40A 1UWRA 5FL1A 2CLMA 4IGSA 1VS1A 1YNQA 3R2GA 1O5RA 4UQAA 4JY9A 2HSAA 3THUA 2A4AA 1VCGA 2R82A 4QR6A 2BP1A 3K4DA 2WJZA 4LAMA 2JALA 1O1HA 3IWPA 3UXLA 2C0AA 5JQ9A 3GW3A 3GNDA 1MEHA 4ERGA 2A7NA 4TOQA 5F2LA 4Q4RA 2ACQA 4GUJA 1JCMP 2XVNA 3LHUA 3KOXA 2YYTA 3N25A 1SO4A 4B9YA 3ARWA 3LQLA 5BMXA 4M8UA 1M6JA 1XLFA 5BW6A 4ONVA 4C65A 1T99A 3KWXA 3TAKA 5FF3A 3KBMA 4QJ1A 3A24A 1HKMA 3PUDA 2QT3A 5DBTA 3SN1A 1OK4A 2V5CA 4OBRA 3AIQA 4N9EA 1QNOA 1L6FA 3VNLA 3BLPX 4REQB 1ZSXA 4J3SA 4S23A 1UWIA 4Z1CA 1E15A 2J47A 2VFIA 1XUZA 4H9XA 4IM4A 3ALFA 2OQLA 1TJRA 1FWSA 1AJ0A 2E6DA 3S5SA 1BG9A 4L61A 3PN8A 5M17A 2YL6A 1HKWA 3W9ZA 3RRAA 1O1ZA 3W24A 3S9IA 2PC4A 2I17A 4KCWA 3CWHA 2Y24A 4PUKA 1W5OA 2YZ5A 3WLMA 4C6EA 5BOEA 1XC6A 2PWDA 2WNQA 4EIVA 1SSGA 4PB4A 5DN1A 4LB4A 4TMBA 3M0IA 4IIHA 4NZJA 4HNCA 5T9BG 4RUBA 1A5UA 2CEQA 4XAGA 1RP9A 3VZXA 3MBDA 1XWYA 3QMSA 4A8RA 5I77A 4UIOA 1Y8BA 1S5TA 1XLBA 1RQBA 1A80A 4DIAA 3S1WA 1BRLA 4MOZA 1PCWA 3CC1A 4W84A 1PYMA 3MSRA 3GXTA 3HFYA 2W66A 3PK7A 3L7RA 4UUIA 2H9AB 4AC1X 4FEZA 3PWIA 4O11A 9XIMA 4XD4A 1R3RA 1HP5A 2J7CA 3N2OA 1P6WA 1RJRA 3TR2A 4HA0A 3N2CA 1QXLA 1P1MA 1XP3A 1ISWA 3WLOA 1FWCC 2PRMA 2ZDRA 4N2YA 1W17A 1NY1A 3HBLA 3I7QA 1RJPA 3EKLA 2WSRA 1HGWA 1PXGA 2WMFA 5A6BA 1HW6A 2BY1A 4IMFA 3K4WA 1R3YA 4WJ8A 1PKYA 4CQCA 4HMCA 2REQB 4BY3A 2AQVA 4NZ3A 2HE8A 3PAOA 3N73A 3M6DA 4NG3A 1XLHA 2ZUNA 3BAXA 3WJSA 3NEHA 2DIEA 2E8YA 2R1NA 3NO3A 1ZJBA 6CGTA 4DF1A 4JEQA 3KAOA 3BZGA 4AZ6A 5C9ZA 2IQTA 2PF8A 1J79A 2YL8A 1GYNA 2ZRXA 3L0KA 3VNYA 1U5VA 1W9DM 1SR9A 1V93A 3F5JA 4HU3A 3RM9A 3AOFA 2FB2A 5E1QA 4YVPA 1JD7A 1UR0A 4HK7A 5B7ZA 1NP2A 4IH3A 1E6NA 3GDRA 1X7IA 2QCGA 4AVFA 1PDZA 3MBFA 4O53A 4IQDA 1D2KA 1DIEA 1HKKA 3ONCA 2PDYA 1B90A 3KL3A 5FAGA 3PANA 3CIXA 1V8EA 2ACRA 4H00A 2FVLA 4IFKB 1RQHA 3CMGA 4QX4A 2E1WA 1GVFA 4HPHA 4J2PA 1E6PA 4GQGA 1PIIA 3TN5A 3BPWA 4JTQA 2QJNA 2Q8LA 4QEHA 4ZQRA 3GG7A 1EHNA 2CYGA 3XISA 4H6EA 2EQDA 4RDYA 2QMJA 1EXPA 3G77A 1FWJC 1NTHA 5RUBA 2PDCA 4DZAA 4RK8A 4GNJA 3S9YA 2NV9A 4LV4A 3W6MA 1RY0A 8CGTA 3QR1A 4HQVA 4ZVJA 1CXEA 3MHGA 5BWFA 1GQKA 3C0LA 2IXUA 3VNZA 1N7KA 3WUEA 1KCXA 4M51A 4DJFC 1AJ2A 2WYSA 3QEZA 4JTRA 5JXQA 3GC5A 2Z6JA 1TQJA 1V6YA 2J13A 3NVDA 4YS1A 3GIYA 1NIUA 5AYIA 4G7EA 4DO6A 4MKSA 2OXNA 4UOZA 3EB2A 2NX9A 2OO0A 5AKQA 1KRBC 1BYCA 1D7KA 4YIWA 4LW7A 1OBAA 3V1PA 1RVGA 1EJRC 5KINA 3BLEA 5ENLA 4PN2A 3VDGA 1RK6A 4MGGA 3I7RA 3LLXA 4MY8A 4QCFA 3VGEA 5G2WA 5AYXA 2PLMA 1EL3A 3QM3A 4KH2A 4W93A 4O12A 2PTWA 2DT0A 5CQ1A 2EJ1A 4GOAA 1P7TB 4UFKA 2GJXB 1RP8A 3NZRA 3LTSA 2JKAA 4Q8QA 2VR4A 4AXNA 1UUMA 5I3GA 2X09A 1YEYA 2OZ8A 4TV6A 4E6MA 3MKVA 2B81A 2R14A 2XH2A 3FYYA 1RV8A 5XINA 1BLIA 2HVNA 6ENLA 1QDSA 3QR3A 3W83A 1IXNA 4TX6A 2EKCA 3NQAA 2RHGA 1RAKA 1C8QA 4X61A 2J25A 3CUIA 2YCEA 3UG5A 1VFUA 3I6EA 4MNMA 1AFSA 4TQTA 3I7SA 4JTLA 1QPOA 4GIEA 4EPBC 1Y5WA 3HGOA 3OYZA 4DY1A 3P60A 2HMCA 1HZYA 2G37A 4V15A 5I02A 1F74A 1PV8A 2VFHA 3SSJA 1NEYA 3S0CA 4YVXA 4GJ1A 4NZ5A 3UZZA 1XFBA 4ZBCA 3GHUA 1DV7A 3NYZA 1OC5A 1CGVA 2TAAA 1MRQA 3THCA 2ZVIA 4PMVA 3TQVA 2V6AA 4YLWA 3RMEA 1XD0A 3M9YA 4IX0A 4U33A 1PKNA 2JIEA 3IUIA 4AB4A 4GE8A 1C8VA 2DZUA 2WAGA 4DJED 1FH8A 1FWRA 2AQWA 1VGAA 3VD5A 1SZRA 4O19A 3ITGA 1R85A 3N2MA 1Z8AA 3H2OA 4WR3A 6ALDA 3PJXA 4MDOA 1JAEA 1WDRA 4KIEA 1OGSA 1TR1A 3GXMA 4I7UA 3EAUA 1MWOA 3KVKA 4WDWA 4NNBA 4HGXA 3GKAA 2Q6ZA 4MZ8A 1ISXA 2J4GA 4MWAC 1UR9A 3VGFA 5A3HA 4Q3MA 1P0BA 2J74A 1R9XA 3WF0A 4UCGA 1A0CA 3BSGA 1B5TA 1NQ6A 3GDBA 3SJ3A 2O4MA 4CU7A 4LB3A 5JU6A 4GBUA 3AZTA 7REQA 3IJ8A 5BOOA 3N34A 3VUSA 4JN7A 1SFSA 4GUFA 1XJBA 1M01A 1JZ7A 2QPSA 4OWGA 1WXJA 4W7VA 3S42A 3WLTA 4K8EA 3STGA 1MO0A 3IV8A 4LUYA 2PPGA 3CV1A 5LIUX 4LNCA 1E1EA 1LUCB 1UA7A 3DFHA 4LCRA 1BD0A 2HEJA 3NQDA 1HJXA 1XCFA 3W7PA 4QFUA 4IP7A 4WDXA 1LQ0A 1F73A 2RDUA 4NJJA 3V5OA 3PZQA 3FNDA 5FF4A 2WSKA 3LUTA 1HP4A 1ECQA 3H4WA 2A21A 2FFCA 3GUGA 3EYPA 5D32A 4N42A 3N11A 1KGWA 3ZQ9A 3E2RA 4XZWA 2BVWA 1J6OA 3L4WA 3VXGA 3KL0A 3PVFA 4LJ3A 3TQ0A 3CQKA 4C6JA 3LGGA 3H6OA 1R87A 4PMUA 4FNRA 4OHQA 3U7VA 3WYZA 2WMKA 2GZXA 1EH9A 1WP6A 4O4VA 3LPGA 3UA3A 1OF8A 4UNKA 1UP2A 3UWEA 4PTDA 3CMJA 4PL2A 2CERA 4QDWA 3BCJA 3WL1A 1QWGA 5HK4A 3VMPA 5HAOA 1EQPA 2O9RA 4BWLC 3KTSA 3LCXA 4ZO9A 3STFA 2BY0A 4C5ZA 3HG3A 4UCFA 1FH9A 3C4UA 4IFKA 3WJXA 1JZ8A 3PR2A 3TOYA 2X1TA 4WSKA 1GOQA 5CJMA 1ITQA 1SYTA 2VWTA 3GH4A 1XCWA 1X38A 2WC4A 4DXVA 1XYMA 4Y96A 3UR8A 4ML4A 5D02A 1J0JA 1FY6A 1RBLA 3MMUA 2W63A 3ITLA 5LXEA 1QTWA 1ZFJA 2XGZA 2QS8A 4CU8A 1CX9A 2ISVA 1TPUA 1SUXA 3CHEA 4FOKA 4D6DA 2ATSA 4MY9A 3VNDA 2O7SA 6PTDA 1UJQA 3W00A 5H1WA 1N55A 3GAKA 4X63A 3DC0A 1UPMB 4POCA 2GSJA 4GG9A 4K36A 4GUIA 4HTBA 4N6FA 3O15A 5JBFA 3GVRA 3A4JA 1C93A 1ELSA 1AQHA 5FD0A 1HJQA 3W1RA 2J75A 3T4CA 4F79A 4H2HA 3TN4A 1QUMA 3OQ8A 1DVJA 3TDFA 3USZA 1T8XA 1CWYA 1YXCA 4R9OA 4IG2A 4DF2A 2I5IA 4RZ6A 3GXIA 1TZZA 3H12A 1W8GA 2XSBA 4XZMX 3NQFA 4LU0A 4J28A 1R8LA 3VD3A 1S2AA 3AU6A 4O18A 4PUEA 1ISYA 4A29A 2WKLA 4Y9MA 4FXFA 3GB6A 3G18A 4ML9A 1OQFA 2HPIA 4GJJA 2OWCA 3HIJA 3GBEA 3K4AA 1R46A 2FLIA 3L66A 1UD3A 4GVFA 1Q6GA 1R5YA 1HJSA 1DJWA 4US5A 1XI3A 1LOLA 1ISZA 3C0QA 2WWCA 2RUSA 1YBQA 4G7EB 3KE0A 1RVKA 4GCAA 3G1AA 4G1NA 1EP2A 3LCIA 4DZIA 3UWYA 3HV9A 1XBZA 2GDQA 3T08A 2J88A 3KCLA 2DH3A 3U6WA 1XKJA 1PO9A 3ARYA 4UZUA 3G8RA 3T9PA 1DTNA 2ZFAA 1C8XA 4GD0A 2QCDB 1EJUC 2ZZ2A 1FDYA 5DRCA 2XUCA 2WQPA 2NXHA 1CZ1A 4Q8NA 5F1VA 3W6LA 3ZR4A 2PTYA 1KRMA 4Q4PA 1P1XA 5F4XA 2PCEA 3BAKA 3SCPA 3K2GA 4WGXA 1XLAA 7TAAA 4CCEA 4M7TA 3RJXA 3MV11 5DCEA 1TVNA 3O2LA 1Z44A 3MDUA 3R0DA 1DE6A 2FB3A 1FCQA 2PWVA 3FJLA 5GNYA 1JRCA 4YWSA 3AUOA 3EDDA 1K6WA 3WF4A 4HPXA 4FNSA 4R33A 4QGCA 3HZ3A 3R5EA 3CIVA 1EDGA 3U2CA 4Q22A 5AC4A 3OG2A 3RN6A 1XG3A 3PZVA 3GBDA 1CLVA 4GKLA 1KCLA 3R0KA 3L4YA 3FDGA 4H7ZA 2MUCA 3LPPA 7REQB 1I4NA 1IHIA 8XIMA 2HBXA 2DQWA 4E3VA 3O6AA 1OYCA 2AMXA 2F8QA 1C9DA 3T7VA 3SM0A 1MQQA 4ZB2A 4ACZB 4NJKA 4LY8A 1CPUA 3W23A 5IFTA 1JVNA 1RXOB 3VMNA 3L9CA 2XH0A 1P6BA 4O8RA 2E5DA 2VM8A 1XG4A 1H41A 1N8IA 3C0SA 5D8ZA 4C6CA 5ABFB 4JQ1A 4AIUA 9XIAA 2F2HA 3EBVA 5C55A 2YBUA 3BMWA 3KXQA 3TV8A 3QLLA 5LNVA 4D8AA 3K1GA 2WMIA 1SJCA 2E6FA 2FGBA 4JQ3A 1R3TA 4MKNA 2DFAA 1F4AA 3S3GA 4UQEA 1SW0A 3PC0A 2V2DA 3PJUA 2QDGA 1VH7A 1QNRA 4WXYA 3NA8A 3WENA 4I9MA 1UZHA 2GVJA 2ODOA 1FDZA 4CD4A 1US2A 2UWFA 3FXYA 3F5KA 1H63A 4WY0B 4DYKA 1F3EA 1VFLA 5FESA 4EOUA 3E96A 1S2WA 1Q3NA 4LV9A 3WLPA 3DYMA 1O5XA 4J40A 4ERAA 2KX9A 1GQIA 2QCEA 4UTMA 1XLJA 4QSFA 2PWEA 2VCBA 3SY8A 4NUWA 3P93A 3MYOA 3R79A 1NSJA 4CNNA 1RA0A 1BYDA 5C9XA 2NSOA 1TA3A 2ONEA 1NELA 5DQPA 3WFAA 3M5ZA 2FYMA 4JTJA 3LTYA 3OODA 3POHA 1W1PA 2WZIA 4Z0JA 5HATA 1V3HA 4OUIA 1T0OA 3UWZA 2Z2BA 2VRQA 2QW5A 3S9ZA 3JZEA 1IEVA 3I4EA 1HX0A 4XB3A 3OP2A 3P62A 1W3LA 2QMKA 2HQAA 4HK6A 1DXFA 2I14A 5BOFA 4F9JA 4GI4A 3GTNA 3V0SA 4TR9A 3PZIA 5E9AA 3RYSA 4LAUA 4M1RA 3E0IA 5E0KA 3ZR5A 1CXLA 4O50A 3U0HA 1VBRA 4AD3A 2OGJA 4AG0A 1T96A 5F7UA 1MXSA 5A6AA 3DYOA 1P7TA 2V2CA 2ZBTA 4XK2A 2GQ8A 3LZ5A 3SUSA 4JNZA 3BLLA 2J8TA 4QDPA 3W1PA 3QC3A 2PP3A 3UPBA 1OX4A 3ICJA 4RDWA 4X2RA 4BQ4A 4RNJA 3T0BA 1BHGA 3MW7A 4M6PA 4IIGA 1UIPA 5DO8A 2C3ZA 1PYFA 3S2LA 4CN6A 1VAHA 1QO5A 1BGGA 4HD5A 2E6YA 3GHRA 1O94A 1LWIA 3E9AA 4AEFA 5FEPA 1SO5A 3MHFA 4C7FA 3A5VA 4N9DA 2VYOA 4XZIA 3UG4A 5IXEA 5TAOA 1KFBA 1HQTA 2J24A 3EOSA 3WNPA 3TSMA 3REQB 2F2KA 1RUSA 1JF5A 1EXBA 1HKJA 2CLIA 1ZL1A 1JNDA 2KZHA 3SIZA 4PUUA 3SUTA 1A4MA 2BX7A 3O6DA 4U5KA 4C7DA 3HN3A 1ODZA 1GOOA 2IPJA 5CPTA 1J6PA 2C1IA 3KP0A 4YJ5A 3KLLA 2E1DA 5AVNA 3EX2A 3RILA 1HT6A 4FA3A 1L8NA 2C71A 3HPZA 4MNKA 3E49A 3F2BA 1VEMA 4D8ZA 1Z9AA 5CXPA 3M5YA 2GVEA 3LI0A 2XIBA 1DTUA 1YDVA 2A6LA 2WOQA 1DJGA 2ZCGA 2D69A 3ABRA 2V0TA 2DZPA 2OLHA 4GCXA 3F4DA 3VM7A 4AHPA 4DQWA 3CMFA 1DKWA 3QGVA 2YR1A 2ZDSA 3RFAA 3MVIA 4BKNA 3FX4A 1H1NA 1D3HA 3GG8A 4C6FA 4RW3A 1AH0A 1TTIA 3KBVA 3LM7A 4RDVA 4TVUA 2WLYA 3VABA 3F1QA 5EMLA 2PCQA 3AROA 3UT0A 3K46A 1OF6A 3WEZA 3BANA 3SO7A 1E5NA 3URBA 3WLKX 4F8XA 2W67A 3MWCA 2X1RA 1P0EA 3AO0A 1UOZA 3H55A 1K9FA 4CQ9A 1A4LA 4MFDA 4HCHA 3BOLA 2OGYA 2Z4GA 2GGIA 5HJYA 3NNTA 5CPQA 4CLMA 3LPFA 4JCMA 2V8ZA 5E09A 1XISA 1EEXA 4DWDA 2FZBA 4IIEA 1OK6A 2ZZ7A 4UFHA 3UU0A 3EOOA 3VX1A 4EPDC 2X0HA 4JTFA 5HNTA 5ABFA 2PDJA 3RK8A 1K9EA 4H01A 3GNOA 3AISA 3PB2A 6TAAA 1TPB1 2Q01A 1UD2A 4BI7A 1CECA 2IKJA 3TA6A 5K2ZA 2FPVA 2XG9A 4WQ6A 1M03A 4D2JA 3W2UA 3R43A 3IAPA 5C9RA 4AW7A 3SEPA 4GFSA 2GGEA 4Q8MA 5EYWA 4NAFA 4GI8A 1ZAHA 4GY1A 1UH4A 1VYSX 3HF3A 2J7HA 3ABOA 4AY8A 1R3VA 1ZS2A 3L4XA 3KFTA 5EB8A 1WCGA 1PIGA 1DWAM 3I3DA 3WF2A 3ZVHB 4JFTA 4FNQA 2V3EA 3O3RA 4HOZA 4ASTA 2YXXA 1Y5VA 1Q6QA 3RLGA 4DJDD 5TQLA 3T44A 5CSRA 1FKXA 1WDWA 3MUAA 1XGDA 4QS6A 5D38A 1D9EA 2CLPA 1CCWB 4PMRA 3G1FA 1V6WA 3D3AA 2IS7A 3T78A 5HMFA 3PAJA 1NFGA 2XZ9A 3YPIA 2WPBA 3M44A 7CGTA 3VYLA 3WLLA 4MJZA 4H8UA 4QLLA 1GTEA 3NDZA 4AWSA 4A2RA 3NJ3A 4A2SA 2X1UA 5LNSA 1W5MA 1XDMA 1KXQA 3GH7A 1R7AA 3L4ZA 2PGRA 4YVVA 4PUNA 3W71A 2BVDA 3VK5A 4M81A 3ISIX 3BAWA 1UP0A 4IUOA 4DJFD 4U2YA 4LS2A 5CLTA 4UNLA 3S1GA 2DU2A 5L6UA 2Y5SA 1MXDA 3IVUA 2V63A 1UWUA 4JCLA 3AUJA 1F3TA 3AU2A 3N1AA 4PMJA 1P0DA 4Z1AA 1TWIA 3A5FA 4NNCA 1PZ0A 2D2JA 3RM4A 5D37A 1EGMA 2NWRA 3VIGA 4LX4A 3B8IA 3ONBA 3VC6A 1Z7AA 1BF6A 4EXAA 3VKCA 3S6TA 5CJ5A 2A3HA 4H9MA 5ECVA 1AL8A 2DJXA 1JYVA 4YTRA 4AZHA 4Z1BA 4KWVA 4O52A 5HA7A 1OFEA 2GWGA 1JI2A 1GZJA 2BWGA 4IFOA 1MRAA 1VD6A 2C0HA 2G96A 3M43A 3HJZA 1WKEA 4O0QA 2PURA 3EWCA 4ZB0A 3F4CA 2XYLA 3N9SA 2QHAA 2CZFA 3ZJKA 1TRDA 2W6RA 1MSSA 3N2TA 1UD8A 1EJVC 3ZSTA 4GVIA 1J5TA 4OKDA 1D7FA 2BSLA 3OA5A 1VIWA 3KCOA 5JMUA 2NWSA 1XRVA 2A2IA 2NVCA 4IOTA 3G1DA 4E0CA 3VKAA 5I3IA 4KEZA 4DBDA 3CTLA 2XVPA 4JTAA 3VDBA 4IX2A 1QNSA 1DWGM 4EANA 1R3QA 4LY4A 4KW2A 4AVOA 1C7TA 5D04C 1O95A 3GH5A 1V79A 2HROA 1OHLA 4QJ4B 4NJHA 1JEZA 1PZ3A 3DENA 3NQ6A 2BB0A 3M5XA 4WX2A 1JFXA 1LQ2A 2IKIA 4NKCA 4O15A 1IT7A 3NL2A 2Z1WA 3N29A 4RNIA 3ZJ6A 1M41A 4BJHA 5EL1A 4PRTA 2J7FA 1ITXA 3LHVA 5E9XA 4UTTA 1TFVA 3H24A 4MB4A 4UFLA 3IJDA 4L6OA 1VPQA 1UYQA 5CAKA 4FNTA 1UR3M 3GVVA 1RBAA 2NUWA 2X30A 4MPQA 2I56A 1TPWA 2VEKA 1XIDA 5BMWA 4OVXA 3IVSA 3ZYZA 4ZE4A 4IGHA 3II1A 1GTHA 2WJDA 2IUZA 2FZNA 2NQHA 1U22A 3WQ5A 3ZMRA 2XIOA 2XM2A 3GXFA 4B3LA 1AQMA 2J77A 1M7OA 3WQPA 1FCVA 3GFYA 1XUUA 4PFHA 1JPDX 3R0UA 5BRQA 1X96A 5JIPA 3NUKA 4C6MA 1KBBA 1NU5A 1U33A 4K8GA 3UETA 1ZTVA 1JCTA 2HZGA 4MG4A 3HPAA 4L4OA 3SY1A 4JAWA 1UMLA 2XFYA 4IXXA 4CUCA 3UR5A 2V3DA 3LLDA 6A3HA 3B3DA 4Q7BA 3EWZA 4H8HA 2D0HA 2C7FA 5LYRA 1K1DA 1M65A 3EOUA 4F9DA 3RHGA 1Z89A 3NYDA 3SRFA 4PTNA 1CB2A 1VR6A 3E12A 2OB3A 4LVAA 1TVLA 1ZJHA 2PAJA 3GK0A 3OVRA 5CZJA 1YE6A 4JHMA 1L6WA 1U83A 3QHMA 2VOTA 3WZ0E 1UHVA 2G97A 3ITCA 1M1BA 5I7GA 5A6KA 2ZYFA 1GVQA 2WVTA 4HVXA 2O7QA 3M0MA 3GYEA 3K8KA 1TJ1A 3EWBX 1FRBA 2GOUA 3A22A 3EOLA 1RD5A 4MADA 3M0YA 1WPCA 1EBGA 1OCBA 3S2NA 3AFBA 1REQA 5BYWA 3GFXA 2ZZ3A 2XGBA 3SZ8A 3W38A 3GYCA 8RUCA 4DUWA 3WD0A 4YPJA 5I79A 5KZMA 3TONA 3W25A 3VGHA 1UZDA 1SZGA 2OFJA 2Z2UA 1BWKA 3AXMA 4DF0A 4J3WA 4E8GA 1QW9A 3DFQA 3W6YA 1JXKA 1TWZA 1SJBA 1JCNA 3L2LA 3WUBA 2HS6A 2W3ZA 3EEZA 2ISSA 5HNUA 3THDA 5FL0A