4J27A

Crystal structure of a gh29 alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in a novel crystal form
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
publication title Three dimensional structure of a bacterial alpha-l-fucosidase with a 5-membered iminocyclitol inhibitor.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 163
structure length 439
sequence length 439
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4j27A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4j27A01
2GSJA 3AI0A 2J8FA 3VIIA 3HZ3A 3MANA 4ZE5A 2J25A 3MUZ1 2DSZA 3B9AA 3WDPP 3WY4A 2G3IA 1QI2A 2CBJA 3WBAA 3BC9A 1FH9A 4BQ2A 1KXTA 1ISWA 1BYCA 1OD8A 2GDVA 4PTWA 4AYSA 1ODUA 2VX5A 3U57A 4UFLA 3TTYA 1V03A 2RGLA 1AQ0A 1UKSA 5IFPA 1QW8A 2VRQA 4JCLA 2VNCA 1M04A 5ABHA 1QI0A 1TMQA 3DHUA 1E0VA 4MB5A 2J79A 3F4VA 2OWCA 2YL9A 4MNKA 3D51A 3ZSTA 1XHGA 1B3ZA 3OGSA 1WZAA 3OG2A 4UFIA 1W1TA 2W66A 5CPQA 4KGJA 1WNOA 5IHRA 1JI2A 2FYVA 2V3EA 3W6LA 2YA2A 4MB3A 2O9RA 4AIUA 1GCYA 2VZVA 3N15A 3HG3A 4JL1A 1J10A 3T08A 4JFSA 3L4UA 3S5YA 1HVQA 1C90A 4M80A 3RJYA 3NSXA 3WD0A 3IAQA 3ZOAA 4GI9A 1ZBWA 4ZFMA 2WVSA 2WMIA 3WDQA 3D52A 5BXPA 1NQ6A 1V6YA 2G41A 1BGAA 4Z2KA 3GXFA 4J3TA 1CDGA 1KTCA 1GQJA 2JEPA 4Q7NA 3UCQA 3WEOA 3AOFA 3K4DA 3G6MA 4BQ5A 3HJEA 3H54A 4MAVA 1EH9A 1G5AA 5E1QA 5E0FA 3T0AA 2OW7A 1JYXA 4DM1A 2BXZA 2UY2A 3K8LA 3PZ9A 2GVYA 5KEZA 5CLWA 1GVYA 5C8BB 3RJXA 3W28A 2WC7A 3L4WA 4JFWA 1VAHA 3K46A 3OLGA 1MYRA 4MNJA 5FIPA 4NXKA 1JZ6A 5DT7A 2YBUA 2CBIA 2WVVB 4W93A 5I3DA 3LRLA 1CXFA 3NDYA 3A4WA 3WDHA 3DDGA 2WKLA 2WCAA 5A6BA 5I78A 1XD0A 2PWEA 1A47A 3CV5A 4JFUA 5A8OA 1CBGA 3A21A 3AMGA 3TOPA 1UA3A 3WNMA 3ARQA 4IUGA 4M81A 2W5FA 4D72A 2WM0A 1Q4NX 4HTYA 1OIFA 3KLKA 3IJ9A 3BCFA 5I6SA 1KB3A 1UKPA 2ZXAA 2D0FA 4GQRA 1FP9A 4MB4A 2XFRA 3DX0A 1KXQA 3MS8A 1V3JA 3HG2A 3BVXA 2J4GA 4AYGA 4GZJA 3HMCA 5E0CA 1K9DA 1G94A 4PBGA 1XRVA 2DT3A 3WUEA 4FLOA 1H41A 4PMRA 3CZEA 4U5KA 1MW2A 5GQBA 4LXFA 3VNYA 3CUIA 4W7VA 1JZ2A 2IXVA 1NP2A 3FAWA 1B0IA 2DT1A 3A23A 3AYSA 3RIKA 1JFXA 1V02E 4ML4A 3S6TA 4GI6A 1KWKA 5E6YA 4CN1A 4OOUA 1FOBA 1HKMA 2GJXB 3MMUA 3SIMA 1KGUA 2BHUA 3VGEA 1OCQA 2OYMA 4P8XA 1RP8A 5ABGA 2ZICA 2GK1A 3AS2A 3B9EA 1TVPA 3LPOA 5AC4A 1IT0A 5GNXA 3QHMA 4NI3A 2DT0A 3PZQA 4TX6A 3ARYA 2ZX6A 1W9DM 3BAWA 2BS9A 1EQPA 3AS1A 1QNPA 3CH9A 3BUDA 3BCDA 1R86A 3M46A 1V6UA 2JFEX 3AHXA 1KGXA 4BZYA 3PTMA 2WKGA 1OWQA 3CHFA 3VGDA 1UD4A 3MI6A 4TUFA 2WWCA 1BYBA 1XH2A 2VX4A 1YHTA 1M03A 3WF1A 4KGLA 1CXHA 3EYPA 1V3LA 1JXJA 4GPNA 1N82A 1E4MM 3W6MA 3AMLA 3ARTA 5KZ6A 2BVTA 1W9VA 1LWHA 2OW6A 2Z1KA 2WMHA 4GZEA 1MFVA 2F1BA 2JALA 1UH2A 3ZR5A 2Q8XA 3EJUA 3TP4A 1XC6A 1GOKA 4PCTA 1H49A 2DSWA 2DSKA 1LL4A 1W9PA 2W63A 3THCA 5HPCA 2VX6A 1KBBA 2D3NA 1CXLA 9CGTA 4AZHA 2V3FA 4DUXA 2D22A 1HJUA 1L8NA 5DO8A 2VR4A 4UQ9A 4Z2LA 2BXYA 5CLTA 1EHNA 3AIBA 2TAAA 3KLLA 4OIFA 1ZB5A 2CETA 1HKIA 1E72M 5A2CA 5A8QA 2JF7A 1E5NA 1KR1A 4IISA 1NM9A 3W25A 1HT6A 3BVWA 3VIMA 4LYPA 5ABFB 2CITA 1GOWA 2Y4SA 2PWDA 1V6XA 2QHAA 4RE3A 1EDGA 4DO4A 1HN1A 1R7OA 3CHCA 1E6PA 1JI1A 4XZBA 1NH6A 4W89A 1KQYA 2PBGA 2WCSA 2F7QA 1UWIA 2J47A 4KWUA 4UFKA 2VRJA 5EB8A 4UQBA 1LWJA 3MMDA 5M5DA 4XUYA 4MJ2A 5DMYA 8A3HA 3W29A 1VBUA 1HJSA 5DFAA 3IK2A 1OGBA 3AIVA 2WHJA 3WQ8A 1E4LA 5A2AA 2JF6A 4ZENA 1K9FA 5I77A 5A6SA 3WIJA 1UD2A 4EK7A 3KL5A 4GKLA 1WZMA 2OSWA 1EIBA 3VTRA 1GZJA 3TTQA 1EOMA 3OGVA 3N9KA 3VD7A 5A6AA 4ATWA 1MFUA 1CLXA 1OINA 3SCUA 3WF3A 1HNYA 1GOMA 4AMXA 2EXOA 2CYGA 1ISXA 5A94A 4PMVA 1J0KA 2QMJA 3T09A 1AQMA 4PMXA 1DWFM 4KRUA 4C7GA 4CD7A 1H4PA 2CBUA 3T0BA 4DO6A 3PZOA 4FLRA 3A6OA 3SCOA 2A3BA 4ACZA 1E56A 1ZBCA 1B30A 4MNMA 1W9UA 3OLDA 2E0PA 3A24A 3SCVA 1JG9A 1GOIA 4AD0A 2D0HA 4ZEPA 4XZWA 4YHEA 4N0RA 4PMQA 3CZKA 5DEZA 3ARSA 1UD3A 4HP5A 2JIWA 1LL7A 3LX9A 1NWRA 4J3SA 4OBSA 3VIKA 3WDJA 3BAXA 1WPCA 3HG5A 2WZIA 4PMZA 2ZE0A 1G1YA 3VD9A 4TOQA 3LMYA 1XH0A 2ZXDA 4H7VA 1JNEA 3EDKA 3WQWA 1DHKA 5HXMA 4CKQA 1KCKA 1R47A 5I23A 4KH2A 2ZXQA 1E6SM 4AD4A 3I3BA 1B2YA 5M03A 2XPKA 3ECQA 4WF7A 3VSVA 4J27A 4PTMA 4CD4A 2FHFA 3BVUA 4NX0A 4GXPA 1QHPA 5BXSA 3ARXA 3VNZA 4AZGA 4AEFA 2E9LA 2CKSA 1UHVA 3AYRA 5CGMA 1UR4A 1R46A 3AIEA 4HMCA 1KFWA 3RM9A 5CGTA 1E0WA 2A3AA 2Z1SA 3T0DA 3VDCA 3GH7A 4UFJA 1PX8A 4URIA 1O6IA 1IZJA 4AIEA 4F9JA 4JFTA 1F4HA 3WELA 1H0GA 3N1AA 4ZE4A 3ARVA 1KXVA 1B90A 3PHAA 4HA3A 3GNRA 1E4NA 4WKFA 2VUYA 2EPOA 4GI8A 4OZOA 1H09A 3L4VA 3M7SA 3WQ4A 1UUQA 2E8ZA 2XTKA 3CZLA 3ZT6A 3RCNA 3VD5A 4FNTA 1EOKA 3A5VA 3EJPA 2X2HA 3PZTA 2CEQA 3WY2A 2OWWA 1CWYA 4AXNA 1R34A 3AZRA 1X1NA 3WH9A 3VKKA 4M24A 1PIFA 4AZIA 4HOXA 3NJ3A 3VMOA 1E1EA 1CGXA 4AC1X 6TAAA 4QDMA 3WH6A 3WL0A 4ZXOA 5IFTA 1YQ2A 1HKJA 2E9BA 4TVCA 5E9AA 4U33A 3U5YA 4LYRA 1MXDA 2XGBA 3AROA 3KE0A 1C8XA 2VVSA 2WBKA 4D71A 3RM4A 1EO7A 2Y24A 2XVLA 3AMKA 4DO5A 5A1AA 1Q6FA 1UYQA 1W3KA 2DT2A 3BUIA 3IANA 3VVGA 3NUKA 3L4TA 1TA3B 2EQDA 2PB1A 2X2IA 3VX0A 1W9XA 4M56A 1CGYA 2FH8A 4C7DA 4X9YA 1J0HA 5GNZA 2DH3A 3AMDA 1C7SA 3FW6A 5FOOA 2PF0A 1CIUA 5A6MA 1J9YA 3A47A 1PJ9A 4AD3A 4D6EA 1ISZA 2W61A 1R7AA 3WMSA 3GTNA 2YDRA 6A3HA 1OT2A 2DIJA 1W2VA 4M1RA 3APGA 3SUVA 4P7NA 1XSIA 1PS3A 2OWXA 1VFFA 3WNPA 4DWSD 4W87A 4BQ4A 4JZ5A 5ABEA 1C93A 5AY7A 3MMWA 5TD4A 4M82A 2HVMA 5EMYA 1FFQA 3L4XA 4B3KA 1DP0A 3WEZA 1UKOA 2XN0A 2CERA 3VPLA 1BFNA 2WC4A 3SUTA 2ESCA 4JKKA 2YA0A 4AD1A 1K9TA 1RD6A 3QHOA 2WHLA 4F66A 1E3XA 2HISA 1UA7A 1Q6EA 1J0IA 3EBVA 2BY1A 1WZLA 3IJ7A 3VO0A 3WDIA 2EADA 3B8SA 1E40A 1H1NA 1WDPA 3UEQA 2ZX5A 3RM8A 2BFGA 1CGVA 2WB5A 5A3HA 3N18A 1PEZA 4AIOA 4TXEA 4UCFA 2YL8A 3EJRA 2ALWA 4UZUA 3CHEA 3FXYA 4LX4A 4PUEA 4F8XA 4MB1A 4Z2JA 4JHZA 3CPUA 3AS0A 1BG4A 1JYWA 3ARRA 4MNLA 1K6AA 1DWJM 3IJ8A 3DDFA 3EDDA 3WUFA 1HL8A 2GJPA 4JHOA 4M8UA 1GPFA 3VSUA 4W85A 3KWXA 3K1DA 1C8QA 2E3ZA 1GJUA 2F7RA 3CLWA 1JAKA 1VFMA 2BVYA 1E6NA 4KRTA 2EPKX 1CENA 1UZ1A 4R5EA 2F7PA 2WK2A 4RE2A 5BRPA 3CC1A 3ZIZA 2CXGA 1C8YA 1KXHA 1FHDA 1BYAA 2J7BA 2WMGA 1HIZA 2YOCA 1QBBA 5D9NA 5BYWA 4HZ8A 3MSDA 1UQYA 2AAAA 3EDEA 2XVNA 4CUCA 3LRMA 1UWQA 4W8BA 4U3CA 1VENA 1VEPA 4A4AA 5A8PA 3QHNA 2WZEA 4U31A 5C71A 2VRKA 2CBVA 4LYQA 2VR5A 1HP5A 4AD5A 4UFMA 1LJYA 2G4FA 2WW5A 3TTSA 3GZAA 2WLYA 2WHKA 1EGZA 1XGZA 2WLZA 1E6ZA 1GORA 1SFSA 2ZX8A 4FK9A 3N17A 2J77A 4D6GA 1TG7A 3OGRA 1MWOA 4CGTA 1EDTA 1HKKA 4UQCA 3W38A 1KCLA 4L4OA 2VZSA 3SURA 1OGGA 3EMCA 4QCFA 1Q6GA 3SCSA 1NOUA 4CCCA 1XV8A 2XWDA 1C7TA 3WBEA 1E71M 4HA1A 2Y8KA 1ZJBA 1OGSA 3VIJA 2WVVA 3SCNA 3T2QA 4B9ZA 1J01A 5FD0A 1HL9A 2YL5A 3GDBA 1LLOA 4FNPA 1VFOA 3WUGA 4Z2GA 2PWHA 1DWAM 5DF0A 3VX1A 3G6LA 2A3CA 4W84A 1B3XA 3KZSA 3I3DA 3K4AA 3L2MA 3FHAA 5AYIA 1ITCA 1T0OA 3GNOA 4EE9A 4JCMA 5M17A 2EABA 5JBFA 2CHOA 4Q22A 2YLLA 1M01A 2VCAA 5FL1A 2ZUSA 1TFVA 4GIAA 4F9DA 2GJRA 3OIHA 3T2OA 4AEEA 4J3VA 2J7DA 2F7OA 1WDQA 1FH7A 5HDRA 1UWSA 1CEOA 3ZO9A 1VIWA 4JFVA 1MW3A 5HNNA 3I3EA 2E4TA 4NRSA 5DT5A 2WNWA 4HPHA 1NP0A 2X09A 1G01A 1JDDA 2F8QA 1GQLA 2GJXA 5A6LA 3BAKA 1PX3A 3LXAA 2J78A 1B3WA 3DHPA 3WL1A 1EDQA 3W82A 1HJWA 4W88A 3UG5A 3WD4A 2BNJA 3CMJA 4J3XA 4BQ3A 1G0CA 1JNDA 1JFHA 1J0JA 1QHZA 3LXCA 2FDMA 3TV8A 4AISA 2XM2A 2ZX9A 4W8AA 1HXJA 3O6AA 1ZJAA 1GJWA 2OYLA 3PTKA 3WFLA 4AZCA 2XWEA 5A6BD 5HPOA 2VQTA 3POCA 2Y5EA 1FP8A 2QLYA 4ATDA 3BLPX 3L4YA 4S3KA 2BVDA 5FKYA 3A4AA 2XN2A 3MU7A 1ITXA 4QFUA 1R33A 2VZUA 5AC5A 1C91A 2XVPA 4MTVA 1XCWA 3PBGA 1CZ1A 1EO5A 4CN6A 3DX3A 1VEMA 5I5RA 1W1PA 4TTGA 2XIIA 1E3ZA 1WZKA 2UY4A 2D20A 1BVNP 2IUZA 3A22A 3KEHA 1CYGA 1W2PA 5JIPA 1FA2A 1UR8A 2FH6A 2IXUA 2WSPA 2X2YA 2WSKA 4JKLA 3ARWA 1XD1A 2WMKA 2YDQA 2YIHA 4FMVA 3AIWA 5BXRA 2O9PA 4UQDA 2ZUMA 3N12A 3UG4A 4AZ6A 4MAZA 3UESA 3PZUA 1UH3A 2V5DA 3FAXA 3S2CA 5A2BA 5D8ZA 5CZKA 4TVDA 1E6RA 4B9YA 4MJ4A 4QCEA 2VC9A 4FNRA 1ZU8A 4UQEA 2XJ7A 4BS0A 4ATLA 1W91A 4PYSA 1EHAA 1OB0A 3DYOA 4GO9A 3W24A 4D1JA 4DWSB 3VIHA 2EPMX 1JD9A 3BLBA 4B3LA 4D6CA 4WSKA 1JZ8A 2OLHA 2XHYA 2J7CA 1H3GA 1I1XA 1H11A 1JD7A 5IHSA 2D73A 3DYPA 3ALFA 2VURA 1VFUA 3D4YA 4UFHA 3N04A 1US3A 5IXEA 2D2OA 4NXSA 4AZ5A 4WJXA 3BSHA 4W5ZA 3BAJA 1V0MA 3VGHA 4AZBA 3WQVA 3OB8A 1I1WA 2OSXA 3CZ8A 5E09A 3BLKA 4P8WA 4PMOA 4YN5A 4OKDA 4GQQA 1XYZA 5BCAA 3TTOA 1QI5A 4W5UA 1IZKA 4EAMA 4H8VA 3SUUA 3UR8A 2DSVA 1E70M 4E4PA 4J28A 2VTFA 5EFFA 2V3GA 3H55A 3RMEA 1XCXA 1TCMA 4DM2A 5JUVA 1LG2A 4UOZA 1UR9A 4OGZA 3BH4A 3RO8A 3W81A 3WD1A 2W91A 3RILA 1QWNA 3VM5A 3LPGA 1MQPA 2J8GA 2E9MA 1VJSA 3MV11 3CZJA 1E43A 1BYDA 3W26A 4CCEA 3GXDA 2V38A 4EKJA 1PPIA 3K8KA 1DWHM 4BCEA 1WDRA 1FH8A 3QOKA 3NSMA 2NT1A 4HZ7A 3BUBA 3LRKA 1V02A 3VD4A 2G3MA 4NZJA 2WBGA 1OM0A 3WFZA 3WQ5A 3MUIA 5CJ5A 3VSTA 2GUYA 2BV9A 2B31A 3CUFA 1Y7VA 5D9OA 2MANA 3SCPA 2XM1A 1W32A 3WMBA 2X2JA 2DPEA 4WKAA 1C92A 4CU6A 2EO7A 1JXKA 3VDAA 5I24A 1CXEA 3VGFA 1W3LA 1K9EA 2JE8A 4QLLA 4K68A 2WAGA 1SZNA 3MKKA 1DTUA 3GXPA 1MQQA 2J7EA 1TE1A 1CGUA 1JIBA 1BHGA 5BXTA 1JDCA 2J7GA 1FHLA 4D6DA 2ZOXA 2DH2A 1JGIA 4LPCA 4TTUA 5FCZA 3BVTA 5D8WA 1EA9C 2FE0A 1RP9A 4N42A 4X0NA 1JZ3A 2JIEA 1WCGA 3WNKA 5BROA 4P7RA 3CZNA 3E1F1 2CKRA 1QW9A 3WNLA 7CGTA 2F61A 2DEPA 1J18A 2X05A 4D6IA 2VJXA 2D3LA 2XIBA 3WY1A 5CG0A 3SCTA 3VDHA 3H53A 5D4YA 4QP0A 4HOWA 2D23A 1PZ2A 3FN9A 1OSEA 1HF6A 1GOQA 3OZOA 5A8NA 1QVBA 3AISA 3GH4A 4RE4A 4UR9A 1E4IA 3BAIA 3HG4A 2AOSA 3GM8A 1AVAA 2XFFA 3N13A 3U7BA 5JIWA 1HVXA 1KWGA 5LA0A 1PX4A 4UNIA 3WH7A 1C3FA 2NW0A 1GHSA 2DGAA 2VX7A 3SUWA 4DUVA 1E6QM 4P7LA 3WENA 4HMEA 3A3HA 5A6KA 2C8NA 4W8LA 3U5UA 3W37A 4J3UA 1ZBVA 5FL0A 1TQSA 3GBEA 1UQZA 3PZNA 3QOMA 2WMIB 2VI0A 2C7FA 3AMCA 1JZ7A 1DWGM 2AMGA 4J7RA 2WZHA 2VZOA 2OYKA 5EFDA 1RPKA 1VEOA 2VZTA 3ZT5A 1TA3A 4IPNB 1UR2A 6CGTA 2EACA 2WYSA 3VGGA 3WNNA 2NT0A 3W0KA 1AQHA 3CUJA 2VMFA 4X0VA 2EAEA 1UR0A 1J11A 1ZBKA 4QLKA 3FHQA 2YKKA 3OA5A 2WMFA 4PRWA 1CXKA 4CU8A 2WANA 4WKHA 1UD5A 5CQ1A 1BPLB 3AS3A 3ZJ7A 1BLIA 4PMUA 4AD2A 2ZUNA 5CPTA 1TZ7A 2EPNA 3BXWA 1CLVA 1V3MA 1OBAA 4PSPA 4GZIA 2BHZA 1SR0A 3CTTA 2WXDM 2XYLA 1V6WA 2ZX7A 3D4ZA 3GYCA 2J7HA 1MQRA 1UR1A 4PMNA 1MW1A 3W4RA 1JL8A 2ZWYA 3UR7A 4TX8A 3WKZA 2CIPA 1UWTA 2BY0A 2ZWZA 2FGLA 4CD5A 1EXPA 3AIUA 1QI4A 1M53A 3CHDA 4IM4A 1ZL1A 3F5KA 3POHA 1E6XM 1V6VA 3F5JA 4V27A 4PTVA 1ZS2A 1I75A 4CVUA 2DIEA 1VRXA 1MVYA 5GNYA 3CIVA 4P7QA 1BGGA 4U2ZA 4H8HA 3D50A 3KL0A 4C7FA 2WVUA 3D5HA 1QX1A 3AFBA 1DWIM 2IGTA 4KMQA 1BVZA 3VIOA 3UETA 1JF5A 3ZJKA 3ARZA 1HJVA 3ZMRA 3CUGA 5C70A 3WF0A 3WUBA 1NWSA 1UG6A 1W9BM 3VINA 1IV8A 1MXGA 4LQ1A 4CCDA 4YPJA 1UWRA 1QI3A 3B9DA 4H04A 1U33A 5IDIA 5A6JA 3LXBA 3T2PA 4H8UA 3OLEA 1BTCA 4P8VA 4F79A 4YHGA 3VILA 4ZXLA 2EJ1A 5CSUA 7TAAA 3L4ZA 4OOZA 2ZUTA 2O9TA 4V2XA 1V3KA 4UZSA 1V0LA 2GK1B 2GFTA 1R75A 4B15A 5JBEA 4AMCA 4BA0A 3W27A 3MO4A 1AMYA 3WD3A 2O9OA 3CMGA 1XH1A 4UOJA 1GUVA 3DYMA 4H2CA 4XB3A 1WE5A 2D1ZA 1ECEA 4L4PA 2J74A 4WLCA 1S46A 4HA4A 4D6FA 3EMZA 4H41A 3NCOA 1Q6CA 1QWUA 3NSNA 2X0HA 3SUSA 2BHYA 2J7FA 4R27A 1V3HA 2G8ZA 2BY2A 4HPGA 4U5IA 1CPUA 1TQVA 4M29A 2QMKA 4CVWA 3SCQA 3VUPA 2EEXA 4PSRA 2XVGA 2A3EA 1CGWA 5HOSA 3OBAA 3MV01 1HJQA 3WEMA 2EBNA 1U30A 1B9ZA 1CTNA 4OUEA 5EBAA 1NWTA 5I79A 1H0IA 1TUXA 3AICA 1HX0A 4QAWA 4PMYA 4P8UA 3ARUA 3CGTA 1F4AA 1HJXA 3N11A 3WH8A 4HZ6A 4AMWA 1SYTA 4AY1A 2EPLX 2OSYA 1W3JA 1GQIA 1E9LA 2CESA 3VU2A 3EMQA 3BMVA 1QBAA 3LPFA 4NZFA 2WC3A 2VOTA 1GHRA 2WWDA 4IPLA 2V3DA 3ZT7A 1GW1A 2GDUA 4AZCB 1RH9A 4EANA 1TVNA 1LL6A 1J0ZA 1QNOA 3DX2A 3UERA 2D0GA 5A69A 1J0YA 4AW7A 1HWWA 2VO5A 2J75A 3WSUA 3K8MA 4MDPA 1H5VA 1B1YA 4WIWA 5LYRA 2VCBA 4U2YA 1E73M 1JZ5A 4U3AA 2WPGA 5D9PA 2O92A 1D2KA 3WY3A 4JL2A 1BQCA 1SMDA 5D9MA 3NIYA 2E8YA 3EJTA 5F7UA 1KTBA 2ZUUA 3WF4A 3BGAA 5BRQA 2QV4A 2PC8A 4DUWA 2FHCA 4FNUA 4NZCA 1KR0A 1JAEA 4PUDA 4LGXA 3DX1A 2FGZA 1NOFA 3WN6A 2VVNA 3AXIA 1L0PA 4GINA 4CN4A 3EJQA 2XUCA 3ALGA 3RPMA 4BF7A 3EJSA 3IAPA 2FHBA 1XYFA 4HMDA 2W62A 2YA1A 3WF2A 4Z2IA 3SCRA 4D1IA 2PWGA 1ODZA 2YLAA 3M07A 4A3HA 1VF8A 2XFYA 3AQUA 2F1AA 1O7AA 3HN3A 3II1A 5HBFA 5GPRA 3AZTA 1U2YA 3GBDA 3PTQA 3KL3A 5I2UA 2VL4A 1OIMA 1V0NA 1P6WA 3WDRA 1E0XA 3TONA 1NWUA 2PBOA 1WP6A 1VJZA 4W7WA 3L2LA 3D3AA 4ACZB 1D3CA 4FLQA 1GNXA 3UG3A 1Z32X 1VB9A 1HTYA 4D6HA 3VIGA 3AHTA 3ZM8A 1W3HA 2W92A 4V28A 2CHNA 1TQWA 1UH4A 1E5JA 4D6JA 3MSGA 3CZSA 2YJQA 2UY5A 1X6LA 1QNQA 2ZUWA 1R85A 5CPSA 4PN2A 7A3HA 3CZGA 4WK9A 3O9NA 1V0KA 1A3HA 2G3JA 3ARPA 2XG9A 4S3JA 5ABFA 5LA1A 4RL3A 2DSUA 3AHYA 3MUAA 3ZR6A 1PZ3A 2DDXA 2CNCA 2ZXBA 2PI6A 1OT1A 4HOZA 3WQ6A 2X1IA 4XV0A 3VD3A 4P7OA 4Z2HA 5AYBA 2WHMA 1PBGA 4Y7EA 3GNPA 1UASA 1PAMA 1OD0A 1KQZA 4B16A 3GH5A 3OZPA 3GXNA 2Y8VA 2DQXA 3LPPA 4PEEA 1TQUA 4WSJA 1TQTA 3AIQA 1UKQA 3O2LA 8CGTA 3THDA 1UZ4A 4HU8A 1GOOA 2PWFA 4MPKA 3U7VA 1B3YA 1BSIA 1Q6DA 1EQCA 4W86A 4FNQA 3DX4A 1ISVA 3W53A 1TR1A 3AXHA 1FFRA 2X8RA 1JF6A 4NRRA 2A3HA 3M6DA 3VOCA 1DEDA 1QHOA 3AJ7A 1E55A 1QNRA 3BAYA 4CD6A 1B3VA 3WMCA 3BMWA 2J62A 1NARA 3QGVA 3PN8A 3OLIA 3ZJ8A 2XSBA 2JEQA 3GXTA 2QPUA 3VMPA 3WNOA 1ESWA 1V08A 3F5LA 5I0DA 2F18A 1W1YA 2E40A 1M7XA 1O7DC 4JAWA 4DWSA 4HU0A 4TVUA 1JDAA 5BWFA 4MADA 1UOKA 3GXMA 1WAWA 3ZSSA 1G9HA 1QOXA 3VMNA 2XVKA 5A8MA 4UOQA 2W4XA 1E1FA 2WMJA 3SCWA 1UD6A 4CU7A 1R87A 2Y2WA 2QF8A 4UTFA 1VBRA 4FF5A 4QLJA 1UKTA 4E8CA 3NDZA 1D7FA 1GQKA 1HP4A 1CECA 1PIGA 5E70A 3JUGA 3PZGA 5CXPA 5LA2A 3TA9A 1LF1A 3CO4A 1KGWA 3DC0A 3PZMA 4PMDA 4ACYA 3IGUA 4AZ7A 2X0YA 2XSAA 1XSKA 3AXXA 1XSJA 2D24A 3SEPA 1UWUA 1BF2A 3BVVA 3CBWA 3ZQ9A 3PZVA 5M3WA 4OBRA 1QNSA 2YFOA 2W67A 1WKYA 3VIFA 1NOWA 2RGMA 2ZIDA 1JYNA 4PCSA 3EDJA 1V3IA 3BSGA 5E6ZA 3GXIA 1GONA 1W1VA 4MDOA 4UQAA 4PTXA 3MUY1 1JZ4A 3VDBA 4OJYA 2UY3A 3EDFA 1R8LA 4NF7A 3FY1A 4XX6A 3NYDA 1BAGA 1KBKA 4FNSA 3A4XA 1GVIA 4E2OA 2V5CA 1ISYA 1X6NA 4DWSC 3AIRA 3WH5A 1HXKA 1SMAA 1WDSA 1J12A 4NSBA 3J7HA 3RDKA 2UWFA 1BG9A 2YBTA 4GO8A 3HU7A 2YDSA 1WO2A 2G3NA 2WCGA 2CCRA 1B31A 2WVTA 3QR3A 4A3YA 1MW0A 3AHZA 2F2HA 1UD8A 3CUHA 1CXIA 1WB0A 2XGIA 3PZIA 2QPSA 2YFNA 1QPKA 1CNVA 5ECUA 3VM7A 4E8DA 5CSYA 3BUQA 1E15A 1LQ0A 1CGTA 1JYVA 4AWEA 4J3WA 2NSXA 3VIPA 2C0HA 2VQUA 4CD8A 3ZJ6A 5JBDA 3VGBA 2ZUVA 2YL6A 4JIEA 1US2A 3BUPA 5A95A 2VCCA 2CPUA 4JKMA 1H2JA 3AHVA 3FNDA 2VT0A 2XN1A 2BY3A 3AZSA 3S5ZA 4W7UA 1LG1A 3DECA 3WD2A 4FLSA
chains in the Genus database with same CATH superfamily
4AH2B 1DN2A 2FPVA 3MUZ1 2WNZA 5JNYA 4NL1A 3F83A 3CN3A 3Q8CA 4KFZC 1L0YA 5BMXA 5IFPA 1MWAL 3RWFB 3H42H 1MLCB 1PG7L 2HAZA 3KYMB 3P84A 3KR3L 2VH5H 2J88A 3M0LA 3SY5A 4TUOA 4GEJA 1K8DB 4AENB 1PKOA 3R0UA 4YH6A 2A6DA 2BDNL 2V3EA 1M9SA 4NKQB 3S5YA 1HVQA 4NP4L 4M80A 3TN0B 4NAJA 1L9OA 1BOGA 4GY7A 1KTCA 4AQ1C 1XW8A 4R7DB 2RA1A 4L8DA 1LDPL 4PJDE 4HEPA 3MDUA 5E9DE 5DQJB 5KS9A 4Z3JA 1Q0YH 2OR9L 4CSZA 4BBWA 1HW6A 4O58L 2G2RB 3G1RA 1UXWB 4BV1A 4P2QB 3TBWB 1BQGA 3T8VA 4KDTA 3GSXB 3QIUB 3Q2WA 2EO9A 1L2QA 1CBGA 3AMGA 4WEBH 4IUGA 1GG1A 3C8FA 1Q4NX 5D1ZA 2HKHL 1L0QA 3U36A 4Z1PA 5KVFL 5BV7L 4JICA 4GQRA 1BZ9A 2VKZG 1PDKB 4U7KA 3MCKA 5I30L 2J4GA 1T4KA 3S1WA 2PDUA 3ITLA 2D7TL 4GP4B 5C0IB 4AFYA 3ARED 2IXVA 1M1XB 4BI5A 3B1TA 1AHWC 1S5HB 1MSSA 3W22A 3RIKA 1I7TA 3XINA 3S6TA 5DMGD 1KWKA 4YAQA 5D1QB 3B7UX 1VR6A 3QIBA 4W9FC 3QW4B 2GK1A 2NY6B 3PZQA 1I9RL 4KEZA 2PTXA 4L1XA 3D0CA 2PODA 1HL5A 1LMKA 2Z9TA 3CHFA 1GTHA 3VGDA 4PRPA 4C47A 2OCJA 3EGDA 4L4TD 5ECVA 5TAOA 3QWOB 5BOZG 1QRKA 4IQDA 5IGXH 1JPIA 1S2AA 5FUCE 3M43A 2AMUA 2DZSA 4QTIH 1A6ZB 1EUAA 3VC5A 4X7CC 1SRDA 2W63A 2QSVA 4E0RA 2BRRL 4N90D 2V3FA 3ARDD 2GABA 3WFHB 1A6WL 4QG6A 2OJEA 2POZA 1AFVH 5TE4H 1JUBA 4JFZH 4HWNA 4L80A 5HVHC 1E5NA 4KO7A 1B4TA 2Y2YA 3T1WA 2DRUA 2CITA 2AJSL 1OHQA 1E6PA 4XZBA 4BD4A 3NFPB 3FKRA 2P42B 1KELL 2V8ZA 2XH7A 4PGEA 3IEAA 4TOYL 1BEXA 2Z7GA 2O4EA 1GW6A 4PJAA 1BG1A 3ABGA 5BMFL 4XB7A 4HLEA 2RALA 2LE9A 3DO7A 3DVIA 3SE6A 1FUNA 2ZT9C 5G1TA 1E5AA 2ZVRA 1OFAA 3ZGIA 5I15L 1DJNA 2Z00A 3WTUA 2BVUA 5DFVC 1BF5A 3LRHA 1Y0LA 3CV2A 1K8ZA 1I7RB 4FLRA 4H01A 4BKNA 2YPVL 5JO5A 3MOAH 4DBDA 2C4FT 4Y90A 4JGNA 1JHTA 3ARSA 4K71B 3NVQA 1AUSL 2JIWA 1HQRA 2XQYG 3RWDA 4WSHA 1E9PA 1NFAA 2B1AH 2PNDA 3DXAD 4MMYB 2ZE0A 3VD9A 5IB4B 5GSRA 1BXAA 1LYXA 1XBRA 2BGQA 1PD6A 4G6MH 4AVJA 1M3UA 2HT3D 4CD4A 2UYLA 2H3XC 5GS2H 2HCZX 6PTDA 4GSDH 1A7QL 1YPZA 4X4ZA 5MERA 2CKSA 3NA8A 3KYKH 5C0RL 5BRBA 1Z9OA 1OYCA 3RM9A 3WEAA 2OYPA 2C1IA 4JFTA 4RGNC 3E8UH 1QO2A 3TK7A 5JZ7C 1P4CA 1AG1O 5CD3A 1L9WA 2N7BA 3N43F 1H09A 4G7RB 4JTUA 3FCBA 4RDQG 3S8FB 3CZLA 4AJVA 4WI4A 1HAUA 4YHIA 2OWWA 3VKKA 4F0HA 4XHJD 3L81A 2D31B 4DHLA 1VH7A 1FA4A 3CO8A 5GHWH 5AW4B 1GVEA 1B2WL 5E9AA 4J4PC 4MAYC 3NRFA 1WXJA 3AROA 5E6SB 1ME8A 3DI3B 3MLUL 3N42B 1GSMA 5I0WA 1QTPA 1XIIA 3C3UA 5CINH 3IANA 1JXFA 3O3BA 3QUKB 4M56A 4GBXA 4HSQA 5T8IA 5DJ6B 3BP6B 4I3GA 4PJGA 4NAQA 4Q14A 2I7OA 5FOOA 3NP4A 3HPLB 1OM3H 1A65A 4FCHA 12E8H 4HSNA 1XSIA 2J57A 4G1MB 3SZKC 4DWSD 3CSYA 5E5CA 4BFEA 1P0SE 4M82A 5E4EC 3OZKA 5HULA 5DFTA 4PB5A 2JXMA 3H3PH 2DU2A 3VPLA 5DBUA 2YS4A 3FQTB 4GABA 2YA0A 3HE6A 3V0FA 1YMYA 4GLRH 3IJHA 2HISA 2G3ZA 4N6FA 1WJ3A 1UUNA 1XL6A 1UB3A 1IUZA 1CGVA 4XO3A 1YC8A 5JQ6L 1NF7A 4AIOA 4TXEA 1RL1A 5AVNA 1GXEA 4XD6A 1JVNA 3S2NA 1J2WA 4GFIA 2FLRT 4PULA 1OC6A 3CSPA 5AVQB 5EEZA 1QRQA 2J55A 4JANB 5IFJA 1IU1A 3EH4B 1HL8A 2H3DA 4N4QA 1JPSH 3VSUA 4PCKA 3K1GA 3A4FA 5FHAH 5CZJA 4PLKC 3GPSA 1SYVA 1FAIL 1V8HA 1C8YA 4X42A 3LSOA 2OLSA 1NJJA 4TSCL 1HIZA 5F7FA 1T2XA 3CT7A 1Y07A 3SY0B 3FRUA 3VQLA 3RZCB 4HC1A 1HCVA 2ZCHL 2WZEA 4AX6A 1PTZA 2YMOA 2PDIA 1MFCH 4LSUL 5HYSG 5D38A 2BW4A 2DS4A 1XFBA 4I85A 2QDEA 2F74B 4JHAH 4OGYH 1X5LA 1ZS8A 3OQ3B 3OGRA 3LU2A 3EKLA 2V5MA 1MWOA 1CFVL 3CL8A 1EDTA 3EGXB 5EUKB 1O7VA 5HHNA 3EHBD 1UM4H 3W0WE 4F0SA 2R0WH 4XPBH 1EJ7L 1SBSL 3A0OA 4TVPD 4A3QA 3KYOB 4B9KC 3WLBB 2DEWX 3BVNB 4HLZH 3GDBA 4PAZA 4U1SA 3VX1A 3QUYC 5GISH 3W76A 3OEXA 1PCSA 3MBWB 3V7MA 2VXTH 4JCMA 4NQXA 4AQAB 2Q76B 4RMQA 4LLWA 2JKEA 1SVZA 3UJ2A 4QXGL 2J8TA 1E9YB 2OP4L 4LWWA 1XG3A 3I3EA 1RSYA 3PPSA 3JS3A 4LE8A 3C2VA 1UBPC 1E7VA 1MG2C 1T89A 1UYWL 4Q6JA 1LK2A 1HH9B 2AK4D 3W82A 3SM0A 3OHXA 1L9PA 4RDZA 1TVHA 1JFHA 5A2IH 1U1HA 3LHPH 5HJDA 1UM6H 2XM2A 4DI8A 5K9OA 3W6YA 1NY1A 2Y5EA 1F6AB 2NQJA 2DIAA 1XLJA 3R7MA 3KDPB 4HS6B 4DGVH 2COQA 2VZUA 1YG9A 3P02A 3P77A 1OB1A 5A16B 4MXQC 1DQXA 3P8JA 2G5WA 1WZKA 2D20A 1A0QH 4J3OH 1S9YB 3VFUA 3TYFA 3WLWC 2P8LA 4UT6H 3SCMC 1VBGA 3O07A 3MA7B 3OZYA 3DIFA 3L4CA 1MFBL 2I26N 2YIHA 4H9MA 3NSYA 3CVHA 1ZLVK 3FRPA 4BSJA 1BIIB 2PEVA 4TVDA 1E6RA 3QJVB 4QRRA 4C4UA 5IIEB 1ZU8A 1WS8A 5CZXC 5BRZE 2DQMA 4ATLA 3O6FB 1UA6L 4F0MA 1AH4A 5EY5A 3UJIL 3UW6A 5E94B 2VFIA 4RNRA 1T41A 1CE6A 1OE2A 1VFLA 4QNWA 2O61A 2VSCA 3AB0C 3NK4A 3RX3A 4OZGA 4XGZA 4ZDHA 2FX8H 3BAJA 5SX5H 3I2CH 2P9RA 3IDIB 3UC0H 3LBCA 1I1WA 1XLGA 3IGAB 4L4VD 5JQ9A 1EEZB 3CZ8A 4V33A 2G97A 1NMBL 4IMGA 2YD9A 4LARL 1IEQA 4W5UA 4R2GC 5I66A 4JFEA 5EFFA 1UUMA 5IHWA 2R82A 3Q5YA 3NDYE 1XCXA 4OD1L 5F9WC 3SSGA 1QNZL 4BFRA 1U3ZA 5AOUA 1ZEAH 2BVQA 4YSCA 2E6FA 2VC6A 1MQPA 2I5YH 2ITFA 1TJGH 1NF0A 5T8GA 2UZYA 4KTYA 2YD6A 2J8UA 3MNWA 2Q09A 1HGYA 1HEZA 2WKJA 2NY7H 4PI2A 3D6GA 1A0CA 2KZKA 1QK0A 1UVQB 2BWGA 1LM1A 4IOFC 3FYYA 4JVPA 3I75B 4WR3A 3S3CB 4OZFH 3GSUB 5HJ3B 5JH2A 3IV8A 3WEXB 1VFBA 1JIBA 3VDGA 2NW3A 4HIHB 4NNYA 4RRPM 1G9NC 2DH2A 2IH8A 3IDJA 2FVKA 1KIPA 2VIRB 3BCJA 2MRYA 3DFQA 1JPDX 2VITA 3MV8B 3BQ5A 1QEWB 5HDLA 1DJGA 4IBUA 2V2TA 3L17A 1K7XA 2WXFA 1P0KA 2BHFA 2WYTA 2GOKA 4NCC1 5E1HB 1U1JA 4IPPA 4PBWD 3P1VA 4F1ZA 2Y9RT 4F57L 3FIGA 3GM8A 2XFFA 1A9BB 4XVSH 3AW5A 1HINH 3L3IB 1TE6A 1WWWX 4P7LA 4UBDC 5DMIL 3S3PA 3RVTC 2Z65C 1UWXK 4W4OC 5LVEA 4B96A 1AO7E 3QRHA 5AAPA 4ELMB 1TETL 2UY7A 3UXLA 4NAFB 4K3GA 2XRAL 5BOEA 3BMXA 2AMGA 4YUEL 3VQMA 2Q02A 4IRSC 1WZ1L 2YKKA 3KM1A 1TX0A 3RUGE 4H83A 5CC3A 4HK3J 5G2IA 3P9MB 4NQDD 5I8KH 3V1HA 3TC6A 1KEGH 4ZO6A 1BAWA 4P5KA 1MN4A 2F53D 3T78A 3WJWA 2GITA 1ZVHA 1UWTA 3IFNH 3NNTA 3NQBA 2ZWZA 4NX5A 1BZOA 3QZLA 3QZPA 3CHDA 4W6YB 5F4WA 4XBEH 4K3EL 5DC9B 4RAHA 4EPBC 1EPFA 1MJUL 4DO7A 4AYFB 2WVUA 3P2DA 1AY1H 1TMCB 3WBDA 4X7TB 4IMEA 3QS2A 1JCLA 5AHMA 2QCDA 4HWEH 5SWZA 1T66D 5K9JL 1ZT4B 2ALDA 3GNNA 4GAJH 3GY1A 2JELL 3WUBA 1MNNA 4Z0JA 4GB9A 1EHKB 1E5ZA 3VXUB 4JNXA 3OMZA 5I1CH 4ADIA 2Y06L 4BA0A 2IH9A 2GEEA 1XH1A 2FJHB 2CLIA 3T07A 1TTAA 4LEEA 3PY2A 4QRQB 1EC8A 5K9DA 4QUOA 3DX6B 1N3NB 2VW4A 2XH4A 4R27A 4JTQA 4QS6A 1BGXL 2QMKA 3WSQH 2G30A 2XVGA 4OV9A 1MI3A 2A9MH 4Q8BA 1NDGB 4IMDA 5EBAA 3B9KB 4YFLI 3E3QE 5BS0B 4Y1AE 2XZAH 2ZYRA 4Y5YB 2PTTA 3DWTA 1TV2A 3TESA 2GGGA 5B39G 3V0VB 4GYPA 3LK6A 2DUXA 3P14A 5JW3H 2HJLA 1KN2L 5I75B 3PWPA 3LYRA 4JM2A 3HRZA 5D1ZC 4JQ2A 3CPLA 4TRPL 2F58H 1MDAA 4L9LB 3FBKA 4TV6A 6XIAA 1OYBA 2J75A 3FDGA 3TVMA 1MFEL 5D6CA 3RR4A 2VCBA 4MJJA 5KYUB 3H9ZA 1O12A 4R4NC 5E0QA 1ID5I 5DJYB 2BC4B 4PUDA 2VSMB 3MSYA 2OSLB 4GINA 4UV7L 2E75C 4KUCD 2IPKA 1ASQA 3EWXA 1KC5L 1VPQA 5I5JA 1F1AA 3QIBC 2PTZA 1I1AA 3LZPA 3EO9H 3OPUA 4IRJA 4FG0A 4AZ8B 2FB3A 3MP5A 1IGJB 2OMNA 3AZTA 4NBYB 3US0A 3ME0A 3EH5B 1P6WA 3LHYA 4H6QA 2R0LL 3VWKC 3W7OA 4FLQA 1GNXA 1IB5A 4OM0L 2EHHA 5I06A 1MCDA 4G5AA 2E5EA 2ZUXA 4HAKA 3KVJA 4W9ZA 4WVRA 3MX0B 3QDGD 1W72L 2NLIA 4ALAH 4IIQB 5SWQA 4UMAA 2BSTA 5E2TL 1E3FA 3MRHB 3UWQA 3BLOA 4NS0A 2OZ4H 3BANA 1OAKL 1CS6A 3ZR6A 1PZ3A 3W2DL 2PI6A 3C2EA 3GIZH 4PRAB 3WQ6A 5DVMA 1YNTB 2CDEA 5A3IC 2FEDD 3LPPA 4PEEA 2EE3A 3AIQA 1OFQA 3MRFB 4JPSA 4MPKA 5D7HA 2R2HB 4XWGH 4JYEA 4TL5A 1ISVA 5LNGA 1J86A 5J11C 4IRZL 4M93B 3NQIA 2A3HA 3VOCA 3RPIB 5SV3A 1HHKA 1EBHA 1Z89A 2IDTA 3PN8A 1MKFA 3GXTA 4OJFH 4A37A 2BNUA 1J1PL 2APXA 4E41B 1MJJA 2WLIA 3O3RA 4W4NA 2KZHA 35C8H 3U0TB 4O2EA 4EAEA 5A8MA 3EX1A 1J87A 2ISSA 2YCIX 5ADOH 3MLSL 4MMXC 4IDJL 1VBJA 1U91A 5J0BA 4GIPD 2PLCA 2PZ0A 1UKTA 5C0CE 4F5CE 4K5PA 4L0PB 2G5UA 5CXPA 3PZMA 1B5TA 3IGUA 1BRLA 4N1HB 1XSJA 3MPCA 3TA3B 3BVVA 4HDIB 3CBWA 4V1DE 3PZVA 4A6YL 4Y9MA 2QFPA 1KLZA 3S2AA 3VIFA 2ZIDA 2CGYA 4E5XB 1CYXA 4N87A 3MUY1 3N6HA 3SDDD 1K2DB 2P0OA 1MCBA 3QIWC 3TYGL 1Y0EA 4I3RH 4E9WA 5DMKB 4ZTOL 1NCWL 1N7KA 2APVA 4GSQA 4AQ1B 3GTXA 2YBTA 5TDOA 3KOFA 4HCGA 3JZ7A 1GH7A 1MW0A 5AZEH 3NZHL 2QCLA 2QUVA 2GPZA 1WB0A 4F7TB 5L7XH 3TO4D 2ESVB 3D39E 3NJNA 2YFNA 3RX4A 3EEZA 3DV6B 3MCG1 7FABH 3O3DA 3DVGA 4CD8A 4JY6A 5JBDA 1FL6A 4FI7A 5CNHA 2AQQA 3BUPA 3S5LA 2VCCA 2CPUA 4TMBA 1KYUA 3QCTH 2EP6A 1EHXA 5EDXA 2JCWA 4D9RE 1SFHA 4FX6M 4N9GA 2IQ0A 1UP2A 4W7UA 3JZYA 1E6OH 4WI5A 4BK9A 4NCDA 4LVOC 4RNJA 4MNGB 2INFA 1CICB 4GCXA 1YZZA 3WKQA 3T55A 3C52A 4L1WA 3L5WA 5DJ8B 5AYUH 1MJ7H 3FA3A 3T6ZA 1KPUA 1R3JA 3RO6A 4BINA 4O12A 1SY6A 4GIYA 4X5RA 2Z92A 2NQ9A 1FWNA 2AGJH 5I73C 3TFKC 3MFGB 2P8PA 3P30L 1F2JA 5BZZA 1YEKH 2WCPA 1XHGA 5MEPB 1IAIL 3E0VA 3BG9A 4PTTB 3G7TA 2FYVA 1ZVSB 4GBXC 3KLSA 5J1AA 3Q2VA 4JL1A 4R90H 2YPLB 3O3AB 5A2LH 5BXFA 5HR6A 3B7SA 4JHVA 1NQ6A 1H50A 3LDBB 3QH3B 4U1NA 2VDGA 2HNEA 4O02L 2WQXA 5TDPB 2PDCA 3DHJA 3GGWA 1JWUA 3BT2H 1QZ1A 4O15A 3FPXA 4LU0A 1G5AA 3G0SA 2PP1A 1U8QA 1AHWA 4LDLB 4Z3EA 5LUMA 2PCPB 1GVYA 4Z23A 3AACA 1VAHA 3AU1A 3IMTA 3MJGX 3CQIA 4I2XA 2GAZB 3ULUD 4PJ8A 1OAYH 1TMLA 4K3ZA 1DSWA 5A8OA 1NLDL 2NVCA 1WBJA 2WM0A 4HT1L 4GQ9L 4HTYA 1OIFA 3A64A 3BCFA 4PL2A 1KB3A 3QCVH 5GIRA 2OKMA 4X2PA 3MS8A 3QEZA 4AYGA 4P06A 2PDWA 3LTSA 3MRKA 5HWMA 3QQ4A 1BFOA 4AGPA 4PRNB 3UTSD 3LS9A 2ZZ4A 4WI7A 2WSDA 1MIEL 4ML4A 5DXYA 5E6RB 5JVLA 1UG9A 2K4WA 5B1KA 1R19A 3NP3A 1T1ZB 3ELFA 1G84A 4QNEA 4NHCL 4HX1A 1Z1WA 5HDQH 2WNKA 4FXJA 2B1OA 3B9EA 2X6MA 2WKOF 3U0PB 2OEMA 4WO4B 4ERSH 1ZHLA 4MYWB 2V2HA 4Q8VA 1AG6A 5EU6D 1GW9A 3QNYB 2WWCA 3VUSA 4Z0XA 3JV0A 2P47B 4G8IB 5C0AD 4P49A 3WS3B 3UTZB 2D69A 4AV5A 1N82A 2Q6ZA 3IUHA 3E3HA 1RA0A 3B4NA 3MN8A 3LKPA 4IKNA 5EZJB 3A4DA 1IRAY 2Y7SA 1H6EA 3GS6A 3D25B 2GWNA 4M7LT 4E5TA 2D3NA 4H44C 1TLKA 1RPXA 1HJUA 3K6OA 1FX6A 1A64A 3B8UA 3A67H 4DQOH 4U1HA 1KCXA 1VFSA 3M17A 5CLTA 1T1WB 1C9DA 1NDVA 5E8PB 25C8L 1EDYA 4RAVA 5I1JL 3HAEH 2ISWA 4WHTB 1EDGA 1E0UA 3CHCA 1XIMA 4K8RH 1I0DA 2VUKA 1NAMH 3BWSA 2AAMA 2ZADA 4KWUA 4JFYA 3QNZB 2VN4A 3P3TA 2A79A 4X6FB 4EN3D 2G5BB 3H3KA 2WHJA 4RWYH 3HMWH 1ZTXH 1K9FA 2BSCA 5IW1A 4EK7A 4WWID 1T89C 4XCNB 3WJJA 2GEQA 3OGVA 2WWOA 3FFCA 4PJ5B 1CLXA 4JBSA 4NJAL 2FLIA 1MMFA 3UT0A 3HHSA 2GI7A 3EYUH 4JY5H 2CDGB 4ZOAA 3PZOA 3ZDYB 3SCOA 5I1KH 1OWWA 2EXSA 4ADGA 4HQVA 3M0KA 2B2XL 4QOKE 4XXWC 4YHEA 3CDGA 2IQAB 3QARA 4DPBX 3UGRA 1E4KC 3FJ4A 1MRCL 1ZDQA 4C6JA 4X9BA 1AXIB 4EXKA 4HSHA 3SSZA 4O16A 4JS3A 4PA8A 5L6UA 4XZNX 1LL1A 3PREA 3ZYOA 3MBXL 3C3NA 1KCKA 4KH2A 4FFYA 4UZGA 2P52A 3CBJB 5M03A 5EIQA 1CDJA 3DX8A 3VSVA 4J27A 1QNVA 1GYNA 4B2DA 3D33A 4OIIH 4ZO8A 4AZGA 3NM1A 1WFOA 3NTYA 1P1MA 4OQVA 2JTYA 3IAGC 4UCGA 4N5ED 4IOSA 4O4WA 4F9JA 4I9AA 3NN8B 4TNEA 1V55B 2BBFA 3JWOL 3PHAA 2ZPKH 1CK0H 1EJ8A 2J4WL 5CR1A 1TPC1 1CBVL 3KS0H 4HHWA 3QC0A 1MCKA 4JDYA 3SBWC 1XIGA 3TYCA 1BX2A 5HMFA 5D7KD 2DMGA 3VXPA 1AIZA 2QT6A 3DUHA 4B0MM 4ONFH 3TWAA 2OK0L 2R94A 2EC9T 4M24A 1SHSA 3EWCA 1CGXA 3VGAB 1WFTA 3CU1A 3KJ4B 1QD0A 4WU5A 4ZXOA 5IFTA 4D9LH 1NMCC 1NL0H 3D2UB 3PUUA 4JFDA 3H4WA 3TMLA 4U33A 1MXDA 3V5DB 4YK4C 1HIML 2PRHA 4LUTB 3V5FA 2OTWB 3K74B 5HUPA 1ENUA 2PDLA 5E03A 1J5TA 3QUMB 3PHOB 2X2IA 4FA7B 1Z8AA 2FH8A 5JH1A 4HUCA 3KPPB 1S5MA 3RG6A 4XRCA 3R4IA 2EIDA 4XI5C 3HGJA 3FUFA 5D7IB 1X4YA 3LMJL 1OT2A 2ACSA 3VE9A 1CCWB 3SUVA 2Y6SD 1JCKA 2AJXH 2YGPA 3HC3H 3N2XA 5KVMC 5CGQA 3LNIA 4TMCA 5C09A 5IVXB 1TOXA 2Y1VA 2VYRE 3O8XB 3VI2A 1DIDA 1CL7I 1MHHB 3CIAA 1RAMA 2VZ1A 2YHGA 3D48R 3CH1B 2OMZB 5FJRA 1K9TA 3CH8A 4JN1H 5EN3A 4EZMA 3DZ1A 4IMCA 4XH2B 3HPXA 3BKMH 3KVDD 1DN0A 4FQPA 1HFBA 1BZDA 3QEGH 3VO0A 3SKNA 4Y16D 3C8NA 1V51A 2VSDA 2QBWA 3GG1A 4PRBB 3SN6N 3S47A 3EYOB 4LY8A 1CB2A 4MB1A 2BINA 1NQBA 2GPTA 3AJXA 1SR9A 4KEVA 3F4DA 3EDDA 1RUPL 2GY5A 1JPFA 3W1ZA 3L7FB 4K37A 2EIBA 4PGBA 4F7KA 4WI3A 1OTUC 1KN4L 1IL1B 4Q8PA 4NJKA 1WHOA 2C5DC 1ZALA 3THML 3VXGA 1J5OH 3FCUB 1LP6A 2GBTA 2XVNA 3QUYA 4H8WC 3BRDA 3WO4C 4E42A 4X7EC 1VFAB 3KOZA 1NSNL 1IAIM 1JVLA 3GZAA 4HXAL 5F97E 4G5ZL 4TS6A 3IGLA 5EOQH 4XN4A 4UT9L 1W8NA 4L0YA 2IPJA 4GAYB 4XQ6A 5BO1H 3EMCA 1UACL 2EXYC 4CW1B 1DV7A 2WVVA 3SCNA 4TQIA 1KGIA 4UT7L 4RPPA 1F3DH 5TNVA 4A2FA 1C5CL 4PC8A 3DGCR 5FI8A 4UINL 1FZJA 4F8PA 1IIHA 4NSKB 3OYZA 4X5LA 3L2MA 4NAMA 5F0PB 1NKOA 3HGOA 4P9ML 1Q9KB 3B8IA 1KYAA 4TUKH 4IFRA 4ZW7A 2HS8A 4KY1L 1CDUA 3X1NA 3UCCA 4OU3A 5DU7A 5C0ND 4PJCB 2C18A 1WAPA 3WG7B 2AF2A 4HKJB 3SCMA 4FYRA 4PMJA 1I1YA 2VDMH 5FYLH 1WXYA 3PQYA 2GJXA 1U8LB 4KOBA 2KT6A 1Q8JA 1PX3A 3FUKA 1KG0B 3RPDA 4AM0Q 3T65A 5CO1A 3WLJA 4WUUE 2MKLC 4GUPA 2RJGA 4OQTL 4U1LB 3D0AA 3O0LA 3ZRSA 1OCZB 1ZJAA 1BKHA 4YSEA 5HPOA 4YO0B 3POCA 3WN5B 2WIMA 4R8WH 2HV5A 4L7ZA 1ZPUA 2GUOA 5AC5A 4EF9A 4BI6A 3CSBA 3BAEH 2ZTKA 5DUMH 4P61A 4JPIB 3OPZL 1DDTA 1ZTXE 3TNNB 3HRZC 3KEHA 3BZEB 2WJ5A 3NL3A 2G4JA 3VNKA 4DCQB 4YXGA 1OF2B 1R3QA 4KX7A 1DL7H 5HQLA 2D9CA 3T4YB 2R2BB 3OIXA 5JIKA 5LG1A 4TF4A 3WTWA 1AW5A 4EI6A 1EHAA 4QWWD 1QPOA 1OVZA 3B8VA 3GHEL 3O1NA 3SDAB 3RN6A 3F5WA 2HFFB 3ZGHA 1KLFB 3RNDA 5MEOA 1TENA 3DYPA 4L4TE 4IRJC 1YDNA 5IJDC 2IAMC 1ZXKA 1XO8A 1US3A 4LLDB 3MOQA 5I9QC 4IBSA 3V0IA 3NAVA 3G8EA 1KA9F 3S5SA 1FSKC 2QDHA 1DE5A 5JXED 4ECNA 3LCWA 5D33A 1KYFA 4J28A 3ZRFC 2GVEA 4X6BB 4LRNH 5AHFA 1KV8A 2FGWL 5M1TA 4QRPD 2J8GA 1YXYA 2VR2A 4LHUA 3SKJL 4CRPA 3VXMB 3KXFD 4WNQA 5ICYB 1O4UA 4MVAA 1E7UA 3U83A 1TZGL 4XNMB 4JFFD 5I1GH 3LRKA 1MCWW 1A3RH 4PLNC 5C07E 1MI5B 4H20H 3MV9A 3NQEA 1X9LA 2NDGA 4FTVB 5A7BA 1GHFH 3QBUA 3VI3F 1W32A 1L5GA 4X9HA 2IG2L 2AJYL 4S1SL 3PPCA 4WKAA 3N5AA 5I24A 5I0YA 5HJXA 5JDSB 1NGPH 4W4OA 1NTHA 2VDOH 4RMVA 4AT6B 2GFBB 4KNQA 5FUOL 2X9ZA 4A7TA 2ZAHA 1CLCA 4QLRA 4WZHA 2YLKA 2DQUL 5JNYB 1FLRH 3W1LA 4IRSA 4YQXL 3VCLB 3DOHA 1FO0H 3TBSA 3ES8A 4C59B 5GZNA 5FFGA 4JR9L 5I6XC 2ZZ1A 4KAQH 4PGDA 4TUOB 3BAIA 1JK8A 4J23A 5E2VL 1FH5H 2V5KA 3IJYA 3TF4A 2A6DB 5D93C 1PO9A 2MCAA 1FWDC 1E6QM 4ZD3L 2PN5A 3OGCA 4XVJL 1SMOA 1F6YA 1N6QL 5D70L 4G82A 3P5ZA 4JTJA 2WXRA 3AMCA 2WZHA 2OYKA 3KPRA 1BOGB 1NEZA 5LCVH 4HPOH 3WNNA 4FQCH 4L8DB 2ZRXA 2EAEA 2DWYA 3FHQA 4IIDA 3GIYA 1P0EA 3VKDA 3TS8A 4OIBA 1BPLB 4M00A 5KS9B 4PMUA 5HWNA 2ZUNA 4FQQA 4BJLA 1AGCA 4ENLA 3PUGA 2I5GA 4KWSA 4E9SA 2B1HH 1V6WA 2J7HA 1MQRA 4J3OC 5EU7C 1O68A 3UR7A 4LT9A 1IM9A 1RIUH 2VP8A 3S2JA 2HEJA 2QGHA 2H45A 4I18C 3H8NA 3ARBC 4N9DA 3P9WB 4KRLB 3VD2A 1C8PA 1ZSXA 1ZK5A 4ODHH 5D1ZB 4OKVA 4Z3IA 3PC0A 3U36B 4CVUA 1MVYA 3V9EA 3MCKB 1ACZA 2WP3T 4GQGA 4HIBA 1T4KB 1QX1A 4AZUA 2O4QA 4H8NA 1JMZA 4KMQA 1F58L 1JF5A 1HJVA 5TDNA 3WF0A 4EX4A 5MI0C 1ZLSL 4LQ1A 4RV8A 3EYSH 1NCGA 1I7TB 2GYIA 3OLEA 4MWAC 1A7NL 4YAQB 3SB3A 2VDKH 4G6FB 3MWAA 2WLMA 2VOMA 4PB9H 3QIBB 2GK1B 5BQ7A 1D7CA 2GJZA 4PHZA 3Q6FA 5H37H 4S1DC 2CAKA 3QYMA 3UP8A 3MODH 4H2CA 2KH2B 3GO1L 2QCCA 4D6FA 1XF4A 4PRPB 1A2YA 3CFNA 2BY2A 1RZKH 3EGDB 1LP9F 1TQVA 4X61A 4G7SB 3T05A 4DGYH 2QVKA 1CGWA 4XNBA 1B3OA 1H7PA 1ZJHA 3ILQC 1YNKH 2ZCLL 2BG5A 4PMYA 1WAAA 1WDDA 1G69A 4PJ8C 1SYTA 5HMSA 2FIKA 5GS3A 1FG9C 4E0RB 3OKNA 2CESA 3BMVA 1LQAA 3W86A 2K6WA 2VOTA 2NX5A 2OJEB 1GHRA 1WG3A 5FYLE 3UO1H 4AUUA 1D9KA 1FWSA 1PKQE 4Q2ZA 4PYHA 3VWKA 4TYUA 2C79A 1L4IA 1CL7L 1A5NC 4Y6GA 3E0GA 2GGEA 1F3XA 4JPGA 4OECA 2WPGA 4FQ1L 4JL2A 1YYAA 4WY0F 4O54A 3NIYA 3SDXF 4PGEB 4ODSH 2CJUH 4PJAB 1BXNA 1T5KA 2VVNA 1DBBH 1A9EA 1NDMB 3NZ1A 1A5FH 3DROA 4J2MA 3DO7B 2E9IA 4NFBA 2VRAA 3SCRA 1PWMA 3AZUA 4Z18A 3M07A 1TTFA 4A3HA 4QHKI 5GGVH 1ACCA 2A6KA 2WQSA 3PTQA 4MOZA 4KUCF 4TVPE 3D0VA 1FNGA 1Y0LB 1NEPA 3IDMA 1TU2A 1A6VH 1L7IL 3B9NA 2OR2A 2ICSA 3GS0A 4D6HA 5FYKL 1DIOA 5JO5B 3AHTA 3EXJA 4MZ3A 3EYVA 1JHTB 1HQRB 4GQBA 1UIOA 2V2DA 1B4JL 3RWDB 1E9PB 4PN2A 3FA4A 3EB3A 3FTXA 1UUOA 1KM1A 1XGEA 5GSRB 1EFZA 3T8LA 3AHYA 1TPB1 4GQ0A 1AD1A 4PJDA 4NIKB 1RUMH 2UYLB 4MMXA 1OCJA 4XMKH 1NELA 3OZPA 3UTTA 1YPZB 5C0BA 5B38A 4WOQA 1DQQA 1TQTA 1UKQA 5XINA 4FXFA 4RESB 1UZ4A 4LGPB 3T44A 2QQNL 3GU2A 1Q6DA 5IMKA 4C6KA 1RJZA 4BDVA 3NSCA 2YGNA 1YKWA 2X8RA 2EINB 3VCCA 1H8SA 3FSZA 1D2OA 3S9ZA 2WPBA 4MF4A 2CDFA 5FUZH 2XN9A 4CNIA 1JSYA 1V5XA 3D5OF 5CD3B 5EIIG 1NBVH 1W1YA 3QIWA 1LK3L 2EDEA 3WJJC 3RVVD 1KB5A 1J93A 1IGTA 3LRGA 1J8KA 4CA4A 4YHIB 3QGAC 5K3VA 4WHCA 2AEIT 2NXYC 4DJDD 2PW1A 3ZR4A 1F00I 3JWDH 4N2AA 3Q06A 1BXVA 2EIMB 5E70A 3SPIA 2MMXA 4HALA 1MCOH 5GRUH 1JR1A 2YAFA 1W8GA 2BXVA 1MJ8H 4R96A 4RMUA 4PGCA 4AJWA 3O3BB 1F02I 5KSBF 3GXIA 4PJGB 2VD9A 5HYEA 4FNSA 2CU0A 1X6NA 3FX4A 1HXKA 3D06A 1SMAA 5CU9A 1J12A 3GUTA 3JT2A 1X7QB 1I9JH 1KLUA 3PNRB 4IWWA 3CSYB 4HN4A 7ENLA 4LJ3A 4I87A 4OU1A 1S7XA 1LROA 3BP7A 1LQ0A 2JXMB 4L4VE 4PJHF 1XB8A 3ARGB 3HE6B 5D4IA 1A6AA 1MEIA 1CD0A 3T6VA 3IJHB 4M19A 3TAKA 3MRLA 3T3PF 4AVKA 4OCMC 2VW7A 3U0WH 3VIIA 3MANA 3SQOL 4FF7A 4P57A 3WY4A 2DLIA 3WZ0E 5EB9A 5I1AA 3IM1A 3ZLQC 4GMSH 5LGYA 4YHNA 3VI3E 2VXVL 4LSTH 3TN6A 5IFJB 3UP1A 5DJCA 3DHUA 3FULA 4MB5A 4DVBA 3K2MC 2ZSWA 4LRIC 1BQLH 4TQEH 2VXQA 1S1RA 3IDXL 3IRZA 3LNEA 4LF1A 2YRLA 3CFDA 4Y8DC 4QG8A 1YAZA 1SYVB 4ZXBD 3LSOB 1A9VA 3RA7H 4YXHH 5BW7A 4YXKH 3FRUB 4ZTEA 4Y4FD 4HWUA 5BXPA 4Y2DD 4UNUA 2VABA 2ZZ7A 4GAGH 1IC5H 2QAPA 2QPFA 4M6QA 5H2BA 4A2SA 3HQNA 1U5VA 1T5XA 1HHHA 1KFGA 2H41A 1BWWA 3U2CA 1DQJB 1ZS8B 5A6TC 4IBTA 4DEPC 3V7PA 5F6HJ 1JV2A 2AV7A 4M4PA 3HG1D 3C60C 5HHNB 2Y2TA 1FE8H 2VFHA 2V9QA 5TH2A 1HYSD 3OLGA 5J6HA 3A4JA 1PZCA 1W1IE 4YHKL 4MA7H 1QSZA 4DKDC 4Y7MA 3TOPA 5HUOA 4HJEA 2MIZA 3B7TA 4U1SB 2CQVA 1FF5A 1JHLL 1IIGA 2FBJL 2XFRA 4NQXB 4JFOA 3ESOA 1NCDH 4IOIA 3IIZA 2EE6A 2NY1D 4G71B 5GQBA 5T1LD 1HZYA 1RERA 4O4YH 5IMMA 1NP2A 3S98A 4N8VG 4FG6D 4D8AA 3NEVA 1OAUL 2IH1A 4M6MH 2QSTA 5F2LA 1LK2B 1NFIA 3HPFA 2XSKA 2DYSB 2F53E 3OHXB 3ZXAC 2EDWA 2ITEA 4TX6A 3UY8A 3ARYA 4JJOA 3BUYA 1ED3A 2P8BA 1L9MA 4TNVK 4CNUA 2RBLA 2VLRE 2YCEA 2VLKA 1HOEA 2V69A 1GKOA 1SZEA 5CILH 3HMXH 3V6OE 1XH2A 4XP4H 4OUOA 3NEEA 3EYPA 5ISZE 3P77B 3FK3A 1JXJA 1OB1B 3SGDH 4DJFD 5CD5C 4LPVA 3VFUB 3TYFB 4FIRA 4XKMA 5GRWA 2P8LB 3UBHA 3BZGA 1PYWA 1XC6A 3ELAT 3DIFB 4YHML 2GJLA 4M1DL 1A7RH 3QWNA 4DUXA 3WYZA 1HKLL 1YY9D 3W88A 3CVHB 5CUSL 3MSPA 3FRPB 2D2HA 5IRPA 3CVCA 1AZNA 5CN1A 2QGYA 4QRRB 3MLZH 1LP9E 3AAZA 3A13A 1EZ2A 4HUKB 3BI9X 3WTYA 1KTDB 4DW2L 1S3TC 1HN1A 1JI1A 1TWSA 4YHLH 4XXWA 1VGEH 3M88A 1X5HA 2J47A 5A43C 3L9YA 2R4RL 5F44A 2PRMA 4BWWA 4RNRB 3LV6A 5EB8A 1E4KA 1CE6B 2O61B 1VBUA 4OZGB 5DXXA 4OLWH 4XGZB 5CWSA 3QR1A 4ZDHB 2CUMA 4ZMOA 2A2IA 2IQ9L 1JQVA 4ATWA 1BF8A 3VZYA 2BMKA 1FC2D 4LPTA 1UMLA 4Q97A 2VDNB 1F4YL 2XFGB 4PMVA 4JFEB 1RURL 5IFAL 5DFWH 3SDXE 2QKSA 4ACZA 2BVQB 4YK4B 3JTTA 4LH8A 4QHPA 1VGKA 3G6JA 3U2JA 4LQFL 4JFHD 3L3KA 1IAII 2UZYB 3RF9A 1QRND 2J8UB 3MU3A 2F0CA 3MNWB 5LXGH 4KY2A 4C5ZA 3SBWA 4PMZA 4WQOA 2WZ0A 1HEZB 1QTWA 1JNEA 2C3XA 5HXMA 5D8JH 3I3BA 3NFNA 3VYLA 1RUAL 4YDIH 1F4XL 2WLNA 5HHXH 4MJHA 4A39A 4NX0A 5D2VA 1AJ2A 3NCYP 1CTOA 5IT2L 1VFBB 4L1HA 3NGBB 4TUUA 2NW3B 3R1ZA 3JZEA 4NNYB 4L6OA 3MYJA 5LKYA 3GAKA 2UX6A 3WXVH 3BGFC 2P1FA 4F37K 1B90A 2VITB 2IGFH 3X1EA 4XPHL 1E4NA 2V2TB 1OSPH 3NM3A 3HQPA 3DFHA 2DQEH 2GC7C 3QDGE 5FGSA 3ZT6A 3PWVB 4X7SH 3D4GA 1CWYA 1H8LA 5KANI 3N85H 2X9XA 5TQ0L 4AZIA 3B4UA 5CSBA 4F0LA 5C7VA 4N20A 2NW2A 3W2KA 4RIRB 2XGBA 4JRYA 5KSAB 2VVSA 2UY7B 3UVAA 1KFBA 1KXVC 1W9XA 5LNDA 5C0DA 3SKOA 1U8MA 1CGYA 9RUBA 2E5CA 4JJ5A 2WJFA 5F8RC 5KTLA 3WO4B 5I00A 4RNIA 3X1BA 5AVUB 4NB7A 4FHAA 4LCWD 3WNPA 4P5KB 3SE9H 2QUMA 3CHOA 3DCPA 4OD2A 3KYAA 4YLQT 3MMWA 2CLVA 3QXDA 2GITB 3NA9L 2ICWI 5KSBE 1CW2A 2C34A 2X2GA 3EKGA 3STCA 2ZONA 5DRNA 5LGHL 1E3XA 2AQRA 4M3PA 3LEVL 4JQIH 3CZUB 4LF3A 2ORBH 5GZNC 1TQCB 5BRZA 2NCMA 2NUPA 2APTA 1EFXA 2QCDB 4E8GA 3DI2B 2VR8A 4K8RC 4FFWD 3AS0A 4LC6A 1E9ZB 4RV3A 4W4QA 1EB3A 4Q4EA 2UVFA 1PSKL 4PJHE 4N2IA 5I1HH 3S3BB 3S83A 3HZKA 5T5FL 3H70A 4GY4A 4W85A 3C6EA 4HEME 3KWXA 3T3PE 1C8QA 2J1XA 1XLMA 1ADQH 1CVRA 4UIKH 1JOIA 4LRSA 4X6EA 3GMNA 1AKJD 3RWIA 2F38A 1WWCA 5C7XH 2XDFA 1AR2A 4PWEA 4P3DA 1KXHA 2I16A 2Z31D 3SE3C 4GD0A 4Y8FA 4J2QA 1X7IA 3JSSA 3UYCA 1A4MA 1TTBA 5DMJB 2YQBA 4IKLA 4HNOA 1SLVA 4ONGH 2I9LA 4XCFH 2AAVA 2PFHA 5MP6L 4GVGA 3VXOA 2PTTB 3K6SA 4K73A 1X7SA 4AC2A 4UQCA 2W6RA 2A1WH 3U7YH 5BW6A 2HJLB 1OXYA 4QCFA 3PWPB 4JM2B 3CPLB 3BQ6A 4ZUSA 3BIAX 5C6TH 3TVMB 5D6CB 3WIIL 1N9PA 5KVDE 2YK1H 4Z2GA 1DWAM 3MT1A 2HJKB 4NASA 2VDLL 4YIWA 1ZANL 5IF0A 4HQQL 3I85A 2MQ3A 1DVYA 3E6HA 3ERPA 4RFOL 1H3PL 4LKXA 3GVVA 5SV4A 1YEJL 2Q8AH 5B7ZA 1VF5C 2IPKB 4JIPA 3DMMC 3LHTA 4AEEA 1I1AB 3ZE1F 2VEPA 4IRJB 1FH7A 5E2JA 1VIWA 4UB0L 3WAKA 3UWZA 5IUSA 2VWEC 3LQGA 1GQLA 3ME0B 3P3YA 2MUCA 3ZQWA 5GGUA 1X7TA 2WQPA 2BNJA 4BQ3A 4MNQE 2C1GA 1AO7A 3BKCH 4GMEA 1LEGA 5FIEA 3FO2A 5HI3D 5SWQB 3DI1A 3J27A 2BSTB 2XVPA 4ICMA 1F8TH 3ZDZB 3AY4C 3NFSH 5F7MC 3RUGA 2IAMA 1OP4A 4RFNB 1CQKA 3UBXA 2CDEB 1YMME 3MUJA 5AZ1A 1D9KC 1FA2A 3UTSE 4J6RH 1HL4A 4Y4HC 2X2YA 1NM4A 4JKLA 1JV5A 4ZPVA 2WMKA 5BXRA 2QKFA 3UG4A 4X5PA 1WA1X 3PNUA 5ALBL 2PTWA 4IGHA 1EZLA 1KYOK 4KI5D 3ZTCC 2EAWA 4UAHA 1HHKB 1R24B 4UQEA 1MY5A 2V81A 3M0YA 4RUBA 3F1QA 2QSCL 3NQDA 2BNUB 1MJJB 5EU6E 3GSMA 2WLIB 4LVHB 1JD9A 2W38A 2ZRUA 4Z1YA 4Y9GA 4PS7A 4C6CA 2PO6A 4O2EB 1UQSA 4FFZH 4MGGA 5DA0B 2R6OA 4FXLA 1G7JA 5D7LD 4HPXA 4GXWA 4X22A 1D7KA 2IALA 4L1SA 3RWJA 3L3DA 4QMEA 3QQXA 3QXAA 1DLFL 2QZRA 2AEQH 1G4TA 3BH8A 5CLZA 5D93B 4P3WA 4R88A 2YKLL 4NYLA 3QA3A 5L4MA 3NCBB 3L23A 2NXZC 1BD2D 3CZJA 1DQML 2XZZA 1BW8A 1RK7A 4PVNA 5TDOB 3QSRA 3TIMA 4Z1DA 5T1KD 2CJTA 4PJXA 1V02A 3WFZA 3O3EA 4UMSA 3VSTA 4JUTA 4Y1AA 4IYKA 3MMEA 5J5RA 1EEXA 1Q2RA 2X2JA 3O3DB 5CGYC 3DVGB 3JWNG 4JY6B 4PJEF 1FL6B 3QZWG 3BEWA 3B03A 1KFKA 4HNTA 4JN7A 2Y85A 4D6DA 1JGIA 4G7VL 1TITA 2K8QA 3L5WB 1L6YA 3KPNA 4L3AA 4HG4J 3HG0A 1MAML 2F61A 1RXOB 1KPUB 1R3JB 1C08A 3T9WA 2Z92B 4AL8H 4KK5D 1CGSH 2Y07L 1X39A 3EWDA 1DBTA 1TUPA 4PQXA 1E4IA 4AWTA 1MCJA 4TNFA 4KFPA 3HPZA 1NPNA 3SE8H 4QEHA 4UT6A 4I18A 3ARBA 3DGRA 5J1AB 4MVBC 4WGWB 5C2CA 2WB7A 5FEZA 3WQDA 1TQSA 4KTEL 5BXFB 3PZNA 2EIZA 2XV0A 2C9RA 4U1NB 4JM0A 2VZTA 1VRSA 3MRQA 3P2VA 2Y7DA 4HVBA 3GGWB 4PW4A 2KERA 1DQIA 4NO0D 3LKSA 4G8TA 4AD2A 1U8QB 5D7KE 1AHWB 2D3VA 4MQSB 4MWAA 3AU1B 3CTTA 4I2XB 2FD6L 4PJ8B 1GY2A 3ONBA 3AIUA 3GHUA 4X99A 2BNRE 2C13A 4UTJA 1ZS2A 4P2CG 4N0UB 1JGVH 1W3TA 3L5XL 5FO2A 5JU6A 5GIRB 5I19L 2YEZB 2HXUA 5CAHA 1Q38A 4IZGA 3MRKB 4GUCA 4FJYA 3QQ4B 1BFOB 4XPFL 1IV8A 2E46A 3VILA 2IKIA 4UUIA 3LKNA 1P7KA 2AKRA 4HX1B 4OLVL 1MREH 2V2CA 3B0PA 2DQIH 3B3BA 3R5EA 5BW7C 3OODA 5EYWA 1BQSA 4F5CA 5HVHB 3BICA 1DJIA 4G7FA 3RP1A 2V9TA 1GUVA 3DETD 1WE5A 1ZHLB 2J8HA 4OZFA 1GA2A 4FS9A 4L4PA 3V4PH 2QIIA 1G4SA 1ANUA 3U1QA 3AYTA 2V8MA 4P5RA 1QWUA 4OFQA 4Z0XB 4NUGH 1FUYA 2P24A 1V3HA 1VIZA 4S1FA 2PDNA 3PPHA 4CVWA 1DLHA 4XWOC 3HBPA 2F84A 2EBNA 5ALCL 3BZ5A 1IBDA 2F6UA 3EH1A 1YEFL 3EA3A 4HNVA 1C12A 2FATL 5LDUA 2QQKL 1IGFL 2XIMA 1DBMH 4OT1H 1X6UA 4U1HB 4NZFA 3M17B 1KRMA 2UWEF 3LQZB 4L0ZA 3HBQA 1P4IH 2VR9A 4LLVA 3TC7A 3IRPX 3UERA 1M5WA 4AW7A 2HLFC 3RTQA 3V55A 2IDCA 3NGJA 4JFYB 1FFNB 3QW9A 3TOYA 2NDFA 4BA8A 2E8YA 4DESA 4MLIA 3PWUA 4UTBH 2LR4A 2OV0A 4JG1L 3BQUC 2X89A 1H3VA 2FHCA 4XPGH 1E2VA 1T5WA 1V93A 5GJPA 3RHWK 4LGXA 3IJSA 4M5ZH 4AV0A 5D09A 1U22A 5IW1B 3IAPA 1HSBA 4N0YL 3FFCB 5JQHC 3HHSB 3I7QA 4J5VA 2R39A 3KL3A 1MDRA 4ICXA 5DURB 2AI0H 4KVPA 2A9DA 1XLHA 1VB9A 4RGNB 2A4AA 3ZE0B 3I50L 3WO3B 2W92A 4V28A 3O6ML 3CDGB 2EH7H 5HHQA 2YJQA 2CO4A 1A1NA 3GHTA 2ZKYA 3VXRD 3ZE1E 4L9ZA 3QFJD 4DKFL 7A3HA 4AEIH 4OLEA 3ITTA 1YQVL 4RL3A 2PU0A 2C3HA 1FVDB 2Q8BL 4Y0GA 1GZGA 2ZXBA 5AW3B 3DX8B 2EUVA 2PRLA 1YNQA 1FPTH 2Y8VA 1PIIA 1AGBA 4GI4A 4MAYB 3LSBA 2KPNA 1BSIA 3ZMNA 4FNQA 1FFRA 1WH0A 1J96A 5EC1B 3TZFA 1TJMA 2RCSH 1IAOA 3CWNA 3OLIA 3C9NA 1TVLA 1MNUH 3WHXA 1TZZA 2E40A 4IU2A 5FJPA 2Q3AA 2XA8H 1B88A 3TCXA 1BX2B 2DB8A 4O5LH 4C83A 4ZW8A 2ABBA 3GW0A 2VLJD 4WU5B 5E4EB 3P2BA 2CCVA 5ANHA 4JFDB 4N2LA 5GGTH 3QEQA 3VRIA 4ACYA 3NABL 1RR2A 2CALA 2WXQA 1JYNA 2X16A 3GLEA 5C55A 4XBGA 3EZ4A 4OJYA 1R8LA 4XRCB 4Z7WF 1GVIA 2UUDK 4N9OB 4G42A 1M2OA 2UWFA 3O2VH 2VCOA 1M7PA 5CZSA 5F9OL 5C09B 1LEIA 4LRIA 1JGEA 3K2IA 4DEPB 3PZIA 1UOWA 1DJYA 3S4SG 4DAFA 5IMOB 3F7QA 4W6WB 4AWEA 5KYWA 5AUMA 5DJZA 3EJYD 4QKTA 3D8MA 3S8HA 1PJWA 3FNKA 4WD0A 2A38A 1Q7MA 3FH7A 5DCDA 5E9XA 1DN0B 3FNDA 1E9IA 3IGXA 2ZQ0A 5EOTA 3SKNB 4XBJA 4NUWA 4HSCX 4CL7A 4PTUA 2J8FA 5IB3A 3VNIA 2J25A 3W00A 5KBNC 4E2VA 4M7JL 2PYED 4QTHA 4BQ2A 1PQZA 3ZE2B 4RPQA 3IUIA 4GYFA 3KXFE 3TTYA 3L48A 4PUMA 3PFQA 4PJEE 1M04A 2ZTBA 1E0VA 1JPFB 3C60A 5EBWA 4MKNA 4KHTL 2OZ4A 2G0WA 4BFAA 4PGBB 4Q7IA 1U8NA 4M4RA 4XO5A 1HOCA 4A2DA 4KDWA 3APYA 1D8CA 5K33A 3T0TA 1NCCH 1HZHL 1IR1A 1W1A1 2YBGA 5EBUA 1YPIA 3GVQA 3QUYB 4E42B 4RWHA 4WI6A 4HKPA 1S7QA 3KOXA 5JHDD 1JF1A 4N7QA 4L8CA 1NFDF 3MRBB 3IARA 3NJKA 4QOKA 5FGCE 2QEJA 2Y62A 3UTPD 5IR1A 3QY8A 3NPSC 4CNNA 2A9BA 4K3JH 1S3HA 2UY6B 1Z69A 3KXQA 1ETB1 1ZCRA 1FWCC 4N2CA 2TRHA 5I18H 2KUTA 3V0AC 1DO6A 5KEZA 2VDPB 1VPXA 1O5QA 3RJXA 3L4WA 5AKRA 2BJML 4RMRA 2QKIA 1Q7QA 5D1XD 4ATTA 1V79A 4O57A 2YBUA 1P43A 4TR9A 2WVVB 3FU3A 5HNTA 2P4AB 4M48L 2VFDA 4J1OA 3M0HA 1UA3A 4X3ZA 1EGJL 4TO8A 1UKPA 3QCUH 4LHJB 4APXA 1RIVH 3WCYA 4YGVA 5G2WA 5CG7A 3SJNA 5GGRA 5F3BA 5EZOL 3M64A 1YX1A 1CURA 4KPHH 2JQZA 4PVMA 1KJ3H 3SCMB 3I68A 1NMAL 1I1YB 1N7MH 3NH7L 4X0KA 5E6YA 3PQYB 2GJXB 5T91A 1EUTA 4P8XA 3AUWB 3T65B 2ZXCA 2JH2A 1YRKA 4GUPB 4G1NA 4RETB 3QHMA 2UV8G 4US6A 2L7JA 1C5DB 1QNPA 1NCBH 1Z41A 2ZA1A 4GXVL 3LCFA 3BIBX 1KJ2H 3S96A 1XM3A 1JZJA 8FABB 1F2XK 1UD4A 3HO8A 3B06A 2FR4A 4GH1A 2GUOB 4KW2A 1H3WM 3U1SL 3AB0B 3ARTA 1Q6OA 2PP9A 2Y89A 4GZEA 3QG6B 3BXNA 5DWPA 3QVQA 4KRZA 3FU9A 3GAYA 3QV9A 9CGTA 3HN8A 3QLLA 1P6AB 3KBMA 4G43A 2W60A 4GC3A 4R2GB 1EHNA 3KLLA 4OLUH 4F24A 5F9WB 4IISA 3AXLA 3RKDD 1V6XA 2K6YA 4GZ7A 2R9HC 5LHEA 2CZNA 2B5IC 3NXFA 3F5WB 1J1OH 3DESA 2KLTA 1YECL 5MEOB 2GJJA 5BQDA 1JXGA 1BF6A 2X0SA 2UWEE 1E4LA 2PW2A 2JF6A 4ZENA 3GMOA 4Y1TA 3HN5A 3RJOA 4TVPH 3VTRA 2FZDA 3L66A 1OINA 4HFUL 1TYGA 4A2MA 3T09A 2P50A 4KXDA 1DWFM 3A4EA 2GT9A 3WLTA 2K4AA 1S5IH 3T0BA 4DO6A 3A6OA 5EEXA 4C6OA 4AD0A 4LHUB 1INEH 1EFQA 4N0RA 1S7UA 3TH3T 3SZ6A 4WNQB 3ECUA 1UROA 2OMVA 1NWRA 2K1MA 4YSAA 3Q94A 5EU9A 1CE1H 3NL6A 1DHKA 2ZRWA 1XJBA 3MV9B 4N90E 4C6QA 3VD0A 1L5GB 1SLUA 2NUTA 1ELSA 3CAQA 5BXSA 3IJIA 3MV7D 1QMLA 4L1GA 3RRQA 2Q3OA 4IEFA 1LE5A 3KPLB 4DGUA 4IGBC 3LEYL 5ANMA 2Z1SA 2Y7EA 3VDCA 1VFTA 5ADPL 4K7FA 2JSFA 2ISVA 2X7WA 1KXVA 4JMNA 2PO6C 4IRSB 4HA3A 1SN5A 2YB4A 2PURA 3TBSB 3SGEH 3WQ4A 5JHAA 4X4MA 3LI0A 1I9IL 1IBGL 1EOKA 2IADA 2XPYA 5C2XA 2OZTA 3NMEA 3P40A 4PGDB 4XBMA 1MPAL 4AXNA 4RRPG 1JK8B 1B4RA 1ZAHA 3IJYB 3BKJH 1KT2A 3GBNH 5G4EA 3OGCB 1HSAA 2ZP9A 3HFML 3U5YA 1XF2A 1ZLUK 3FKKA 2BIMA 4D0BA 3TA4D 5T3ZL 4O2FA 4ZG1A 3UIZA 1FTXA 2CFFA 3S1XA 3KPRB 3HPSA 1NEZB 2K70A 3RUBL 5A7EA 4XTRC 1LT8A 4P5TC 3HAEA 3VFNA 4X9YA 3DXAE 3AMDA 1I8KA 1NAMA 3KOWA 3WK1A 2FRGP 3EOBA 4FQQB 3E3QC 3GTNA 3KBSA 1AGCB 3APGA 4UNVA 4GUHA 5IQ7L 4Z7NB 5D2XA 5DQ9A 1OJXA 1C93A 1IM9B 5HD8D 5DK3A 3I6RA 4Z0BH 1A14H 1C1EH 3SZ8A 4QXIA 3S6CA 4AD1A 4OKVB 2WQ8A 4Z7WE 5LG6A 3SE3A 4FCAA 3SW6A 4OI7A 3B8SA 4WNSA 1EDHA 4LEXH 3WJZA 2ZJSL 5TDNB 3TBVA 1T0NA 4HNNA 4HJUA 2LVCA 1UT9A 2NY4D 2O1AA 3QNXA 5BQ7B 2GJZB 3WFDH 5J8LA 3Q6FB 1CLKA 2QTEA 1UZDA 4UR7A 4LSVH 1BZ9B 3D0LA 1J05A 1RH8A 4OIAA 1A3ZA 1N26A 5AW9B 1A2YB 4WGKA 2V5RA 4LFHG 1AQ8A 4U6TA 4Z77A 3QHNA 4ZS6D 3KM2A 2CBVA 1ZV2A 4YLWA 5CJMA 5HHPA 1XBVA 3THAA 4F93B 4ENZA 4LSPH 4Z7IA 1X9RA 3DMMA 4FK9A 3SDYH 3AALA 1ZAIA 2FIKB 3RITA 3OKNB 4G9PA 7PAZA 4JPKL 3DRQA 4PJBA 3W38A 2NX5B 5C07A 1NCNA 4AITA 1D9KB 4Q2ZB 2DVTA 3VWKB 4DQAA 1NFDE 1FL5A 1J01A 1ECYA