4J27A

Crystal structure of a gh29 alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in a novel crystal form
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three dimensional structure of a bacterial alpha-l-fucosidase with a 5-membered iminocyclitol inhibitor.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 163
structure length 439
sequence length 439
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4j27A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4j27A01
4TOQA 1C8QA 4W8AA 3A22A 3WNMA 4UTFA 3CUFA 3W24A 3GBEA 4MNKA 3IAQA 4JZ5A 5A6JA 1DHKA 2WC4A 3VGBA 1HXKA 3D4ZA 2JIWA 3N13A 2GVYA 2EPKX 2WM0A 2ZUSA 1QI2A 5DT7A 4A3YA 1JDCA 1EDQA 3FHQA 4W87A 5I23A 4RE2A 3ZJKA 1CIUA 3LXBA 2OWWA 5A6SA 4K68A 3FAWA 4FNUA 3AMGA 2NW0A 3WBAA 4ZENA 1TA3A 2VUYA 2PBOA 4WIWA 1MVYA 3AYSA 5CLWA 3GH7A 4JHZA 3VM7A 4ZXLA 2ZXAA 4LYQA 4DM2A 1Q6FA 3DDFA 3WQ6A 2RGMA 1WE5A 3F5KA 2VTFA 1WDRA 1CLVA 3MMUA 1VAHA 1TVPA 3G6LA 1V6XA 3VGGA 3WY2A 3SUWA 2VCCA 3FNDA 1CENA 1B3VA 2DT0A 1S46A 4GI9A 3DDGA 1XSJA 4AD4A 4WKAA 4AZCA 3MU7A 1BAGA 3NDZA 5C71A 1US2A 3TV8A 5IFTA 1WCGA 3WD4A 3D51A 4ZFMA 1CXLA 4P7OA 1ZB5A 5F7UA 1MQRA 3L4WA 4GI8A 1EHNA 3D50A 4E8CA 3DYPA 1UD2A 4MNJA 5EB8A 3AHZA 2X05A 3BAKA 4JCLA 1MFVA 5FKYA 1NOFA 2A3BA 4CCDA 1CTNA 3WH5A 4PUDA 3WEMA 4PTWA 3O6AA 2Y2WA 4A4AA 2E9LA 4B9ZA 3F5JA 5FL0A 2BHYA 3CHDA 2VL4A 1UKTA 3WDQA 5IDIA 3BLKA 3AS2A 1PX3A 1KWGA 3VGHA 4GZJA 4AC1X 1XYFA 1VBUA 4JCMA 2VRQA 3AS1A 4PMNA 3CZEA 1C7TA 4EANA 3N12A 2ZUVA 2A3CA 3A3HA 4WKFA 5IHSA 3RCNA 1CXEA 5E70A 2V3GA 2ZX5A 1WZLA 3K8MA 4FNPA 1HJWA 2OLHA 2D22A 1W2VA 4A3HA 4D6DA 4UFLA 2D23A 3VU2A 1QHOA 5FD0A 3AMKA 1C7SA 1CLXA 4ACYA 2XN2A 1FP8A 5CSUA 4AZHA 4GO9A 1IT0A 3CUIA 3ALFA 1YQ2A 1B31A 3ZJ8A 3W38A 2GK1B 2Z1KA 4AD0A 2X0HA 3AMDA 2XYLA 1R7OA 5KZ6A 3OLGA 4MB4A 5BXPA 1H5VA 4EKJA 2WHMA 4E8DA 1LQ0A 2A3EA 2VX5A 2WZIA 2ZWZA 3AMLA 2VVNA 2GJRA 2BY0A 4UOQA 3LPFA 2VZTA 1L8NA 1JFXA 3BVUA 1BYCA 2WKLA 2YLAA 2VX7A 4J7RA 2O9PA 3PTKA 4EE9A 2V3DA 3J7HA 3W6LA 1D3CA 1PX4A 2D24A 4JFVA 4NZFA 5D8ZA 5A1AA 3SCVA 2PWDA 3SCQA 3EJQA 5ABFB 4KRUA 3TA9A 4MTVA 1FOBA 1JZ5A 4PMRA 2J7BA 2FGLA 1H0GA 2YIHA 2WANA 4C7FA 4CD8A 1UQYA 4GQQA 3BVWA 1B3YA 1HKMA 3HZ3A 1XYZA 3WNNA 4PRWA 1DWGM 3VMPA 4TVCA 3DYOA 3WNKA 3O9NA 4AMWA 2CITA 4KMQA 4HMCA 4DUVA 4ML4A 5BYWA 4FLQA 3ZOAA 4OJYA 3WQVA 8CGTA 3S6TA 4KRTA 1GVIA 2WCSA 1I1WA 1JD7A 1KCLA 4NXKA 4CVUA 3WF4A 5C70A 1M53A 1A3HA 1W1TA 2IUZA 4CU8A 3NDYA 1CECA 4CN4A 1RP8A 3MV11 1BTCA 5JBFA 3BVTA 3BH4A 3KLKA 2E8YA 4W7VA 3APGA 1VFOA 1PIFA 2CESA 2J79A 5E6ZA 1GOQA 1E73M 3BAYA 1UASA 1Z32X 5JBEA 3QHNA 5DEZA 1UKSA 1JZ6A 3CH9A 4URIA 2WMFA 2JF7A 3F4VA 5A95A 3K4DA 3ZMRA 3SCSA 2IGTA 3QOKA 3VGFA 3UEQA 1KGUA 2EPLX 4PCSA 3RIKA 2DQXA 3SURA 3VMNA 4D6CA 3L4TA 3RM8A 1UUQA 4X0VA 2ZOXA 4OIFA 3L4YA 1TVNA 3MMWA 4PTMA 4U5KA 1W9XA 1UD5A 4W7UA 4H04A 1R86A 1HL8A 4QCEA 3DC0A 4H7VA 3SUTA 1FFRA 1JXJA 4QCFA 4W84A 1GHSA 1V3HA 3VTRA 2ZUWA 5BRPA 1I1XA 2FHCA 1KXHA 4MJ4A 4DO6A 4W7WA 1HVXA 3L4VA 4PMOA 2WHLA 1EA9C 3RM4A 2FH6A 1JNDA 5HDRA 2EEXA 4HPHA 1V0NA 4P7NA 1W9BM 1BSIA 1UD6A 2XM1A 2CYGA 5ABEA 2BY3A 2O9TA 3CZNA 3L4ZA 2DT1A 3ECQA 4H8VA 2IXVA 4UQEA 3WEZA 1PZ3A 2XSAA 3GDBA 1UHVA 4Z2JA 4JHOA 3WQ4A 3A24A 3WMBA 2EXOA 1FP9A 1TE1A 5CGTA 3SCPA 3BUDA 4MNMA 3EMQA 4V27A 1HWWA 1TUXA 2VJXA 4ZE5A 3PZTA 1OT1A 2O9RA 4JL1A 1JL8A 3JUGA 3LPOA 2VC9A 5I6SA 1OINA 2DDXA 1BYBA 1TQVA 3OLEA 1KGXA 4MADA 1UH2A 3N17A 2AOSA 3HG3A 4KH2A 4FNSA 4X0NA 1MQPA 2GDUA 4J3XA 3W81A 4PMZA 4OOZA 4UNIA 1O7AA 1J11A 1HJSA 2XFYA 1UWTA 3GBDA 1UD3A 1WKYA 1KGWA 4PMDA 4D1IA 3VIGA 1J0JA 4IPNB 1B3ZA 3VD4A 2VCAA 1GOMA 4PMQA 3MKKA 3ARTA 1LL6A 1B2YA 5CZKA 2WPGA 3SUVA 4AMXA 1QWNA 3VMOA 3ARXA 3VIJA 4Z2HA 4ZXOA 4CGTA 4B3KA 3VDAA 3WFLA 3WY4A 5A8NA 2PWHA 3F5LA 3WD1A 3SCTA 3WELA 2FDMA 1HNYA 1R85A 1W91A 3I3BA 2CPUA 3BSGA 3KLLA 1J0YA 2WMJA 2ZWYA 1D2KA 1UR8A 5BRQA 3BUIA 1UWUA 4AIUA 5ABFA 1E3ZA 2YL6A 1QBBA 2JF6A 2ZUTA 5AYBA 4AZ5A 3PZUA 3WDPP 4D6IA 3RILA 1V02A 2E9BA 2QMKA 4U3AA 1JYWA 1H2JA 1NWTA 1VJZA 1UR9A 3ZIZA 1MQQA 2WSKA 3WNLA 1JYXA 2DSZA 4GO8A 2O92A 2XSBA 2W63A 4PUEA 3W29A 1LL7A 1V3KA 3VSTA 4Q7NA 2BFGA 2YL9A 4BQ5A 4CU6A 2WC3A 1MW1A 3AIUA 3TTOA 1Q6EA 3FY1A 1UH4A 1E0XA 3CHCA 3N04A 2WVUA 1E56A 3PZ9A 4HZ8A 3SUUA 3NCOA 2YA2A 1LF1A 3A4XA 3D52A 3OIHA 4EAMA 3AYRA 4W86A 1Q4NX 3N1AA 3BMWA 1UYQA 1V02E 3W27A 2OWXA 3AHXA 3W28A 3H55A 3FAXA 2X2JA 2XFFA 1J0ZA 3EJRA 1CNVA 2D3LA 1HN1A 1V0KA 3OB8A 4AD3A 2DT2A 4WSJA 5I2UA 4AEFA 4UQDA 1OT2A 1DWJM 3G6MA 4HMEA 3CZJA 3GXMA 4AIEA 3FXYA 1ZBVA 3GTNA 1KR1A 1CGTA 3ZSTA 1M04A 4BQ3A 1Q6CA 4S3KA 2E4TA 4D6HA 5A2AA 2XTKA 1UR2A 2VQUA 3WL1A 1E71M 4IPLA 4HP5A 4GZEA 1JZ8A 1EO7A 4U3CA 2DT3A 3A4WA 2WB5A 5A6BD 1SMAA 1BPLB 4XX6A 1E1EA 1UZ4A 3SCNA 3UG4A 1CDGA 3AIRA 4OKDA 1CGYA 2XN0A 4NI3A 1DP0A 4LQ1A 2IXUA 1NOUA 3ZSSA 1GQLA 4PSPA 1QW9A 2JFEX 1BVNP 3WD3A 4J28A 4S3JA 1ZS2A 3VO0A 4Q22A 4NRSA 5D9MA 4AD5A 4GI6A 2EO7A 3WL0A 2C8NA 4HPGA 2GFTA 1C90A 3WH9A 3CZKA 3DX3A 4P7LA 3VIFA 4GQRA 4U2ZA 2WK2A 2BVTA 5A2CA 2OSYA 2G8ZA 3WEOA 2XWEA 2D73A 3KE0A 2UY5A 1JYNA 1JI1A 1XH2A 4M29A 4GIAA 4W8BA 1R75A 4FLOA 5CPQA 2YL5A 3T2QA 1OGSA 3RDKA 3PZNA 3GXPA 1EDTA 3ARUA 1LLOA 1CGUA 1E70M 7CGTA 1OM0A 2X8RA 1HVQA 2BV9A 1K9DA 3PTQA 4HU8A 5HNNA 3E1F1 4XUYA 2YBTA 5A6LA 2D20A 5DO8A 3VD7A 2F1AA 1VENA 1TA3B 2YA0A 1MXGA 1TQUA 4AZ6A 3AZRA 1XC6A 1OIMA 3WMCA 1QPKA 3OZOA 1B1YA 4AIOA 1JZ3A 1K9EA 4D6GA 1W9PA 4P8VA 3WH7A 2J78A 3KWXA 5CXPA 2PBGA 2VX4A 3K8KA 1NWUA 3WF0A 1GZJA 3EDEA 2OW7A 3LXAA 3H53A 1JZ7A 4ZE4A 5CLTA 5HPCA 3M07A 4B16A 3WQ8A 1EGZA 2J7CA 3U57A 1UOKA 3A23A 4PMXA 2CKSA 5A94A 1E4MM 4MPKA 2JEQA 2XGBA 5M03A 5ABGA 2ZXQA 3T0AA 3BC9A 1WDSA 3OA5A 1WNOA 1JXKA 1PJ9A 5JIWA 1C91A 4JIEA 1J10A 1E6RA 2ALWA 1NQ6A 1CGWA 4H41A 3BCDA 1AQHA 1E9LA 4N42A 4Z2GA 5C8BB 2ZUUA 2V3EA 5LA2A 4HOXA 2V5DA 2BNJA 1PPIA 4AZCB 3WH6A 3MI6A 3GXFA 4KGLA 1JIBA 1TG7A 4UOZA 3EBVA 3RJYA 5I79A 3THDA 2QPSA 3SUSA 1HJXA 5ABHA 2DEPA 4LYRA 2PF0A 1W1PA 2BVYA 1B3WA 1QOXA 1UZ1A 2F2HA 1GONA 1HL9A 3IJ8A 2EPNA 4BF7A 1GQIA 3A5VA 3WDHA 1ZBKA 3AS3A 2J8GA 3WUBA 4DM1A 1AQ0A 3VDCA 3WY1A 3BUBA 3AIEA 2EADA 1FFQA 2UWFA 2XVGA 3DX2A 2XWDA 3ZR5A 4AMCA 1BG4A 3LXCA 5GNXA 2AAAA 3OBAA 1WDQA 5HBFA 1VFUA 4UFHA 2XIBA 4MAVA 4Z2LA 3TTSA 4OZOA 4JFUA 2O9OA 1HF6A 3M6DA 4BCEA 3CHFA 1BG9A 3OLIA 4H8HA 4FF5A 2WNWA 3EMCA 1C8XA 1EHAA 2EPMX 4QP0A 3W82A 5A3HA 1XCWA 3VIMA 1KQZA 2NSXA 3NYDA 2YOCA 1GVYA 1ISZA 1KCKA 5M17A 3ARSA 1B0IA 4BS0A 4TTGA 2DGAA 1GPFA 2WMGA 1UWRA 1EOKA 2OW6A 1H09A 2RGLA 5E1QA 5HXMA 2CBUA 4P7RA 1PBGA 3WF2A 1NP2A 5EBAA 1G9HA 3LPPA 4LPCA 6CGTA 3S5YA 4YHEA 2QHAA 3VGEA 1CZ1A 4OGZA 4XZWA 1QNPA 1DWFM 3T2PA 2F7PA 3CBWA 2D2OA 2DSVA 2J74A 1H3GA 1XH0A 2ZICA 1DTUA 3ARYA 1FH8A 2G3IA 2G41A 4QDMA 4MDOA 2GJPA 3T0DA 3CUGA 4M1RA 3A6OA 3WNOA 4B15A 3GNRA 4UQAA 3VD9A 2V5CA 1BYDA 1QNQA 3ZR6A 1W2PA 1VB9A 2CBIA 1O7DC 5D9OA 1X6NA 2XVPA 3A47A 2E9MA 1KFWA 2W67A 1GQKA 2YLLA 2F7RA 4CN1A 2VRJA 2MANA 1GNXA 3BSHA 5CPTA 3K4AA 1AMYA 1JDAA 1OSEA 1J18A 3LRKA 3NSMA 4HU0A 3TTYA 3T08A 2C7FA 1UQZA 4AZ7A 1NWRA 4HZ7A 3WDJA 4QFUA 1T0OA 1BQCA 2G3NA 4JKMA 1HTYA 1FA2A 1U33A 3AXXA 1AQMA 1LL4A 2EPOA 5D4YA 1FH7A 3CV5A 1E6SM 3W37A 3DX0A 3VSVA 1ITCA 1MW3A 1E1FA 1BGGA 1KB3A 2VOTA 3BXWA 1NM9A 3AROA 3AOFA 4D1JA 1CPUA 1V3JA 9CGTA 4PSRA 1H41A 1XD0A 4NX0A 1C93A 3QHMA 1M03A 3SCRA 3MUIA 4WJXA 3L4XA 1ZBCA 1W32A 4TTUA 3SCWA 4N0RA 4ATWA 1TR1A 1QI5A 4UFKA 5E6YA 4AD1A 5IFPA 4GZIA 1MWOA 1JGIA 4XZBA 1FH9A 4CKQA 1UH3A 2F7OA 2WBGA 3GXNA 3CZSA 2XVNA 3VDBA 3PTMA 1HJVA 5AC4A 2E3ZA 3N18A 3AHYA 3CIVA 2VMFA 5JBDA 1HX0A 1XH1A 5BROA 3B9DA 2ZX7A 2UY4A 1VEMA 4NSBA 1OIFA 3HU7A 4CD5A 4AZGA 4WF7A 4CD7A 3MS8A 2JIEA 4AEEA 2DH3A 3EDDA 2VR5A 3DHUA 1WZMA 4AYGA 1SZNA 1V6YA 3UG3A 2C0HA 4FMVA 4CVWA 1JI2A 1E4IA 3PZVA 2CERA 1KQYA 3NUKA 5CG0A 2WYSA 3DX1A 3CUJA 2JALA 1QWUA 1QHPA 4HMDA 1IV8A 2QPUA 5CPSA 1R87A 1TMQA 2ZX8A 4XB3A 1KXTA 3GM8A 4Z2KA 1L0PA 2WLZA 1OD0A 2DSWA 4UCFA 1HP4A 1QHZA 4BQ2A 4J3UA 1DEDA 1ISYA 4X9YA 1F4AA 4D72A 4AYSA 1W1YA 3VSUA 4OUEA 3WSUA 1GHRA 3H54A 2EAEA 2WCGA 3ARPA 2WSPA 2XHYA 4M80A 3WDRA 3LRMA 4UFIA 2BHZA 4CD6A 1UA7A 3QR3A 4W8LA 3D5HA 2EQDA 1V6VA 2BXYA 1PX8A 3W4RA 2YJQA 1KTCA 4L4PA 3D3AA 2YKKA 2XN1A 4ATDA 4NXSA 2PI6A 3AISA 1B9ZA 1OCQA 2BHUA 1F4HA 4UZSA 4PTXA 2WMIA 1YHTA 1OBAA 3CLWA 4P8WA 3AICA 3L2LA 1IZKA 1WZAA 1XRVA 3UETA 1E0WA 2WLYA 3BVXA 2FGZA 1SYTA 4CUCA 1V3LA 1EXPA 2J75A 3OGRA 2ZXDA 2JE8A 2CETA 1JG9A 2DIJA 5EMYA 4AW7A 2OYLA 1GCYA 1BLIA 1JZ4A 3K46A 3ARRA 4UFMA 1V6WA 1RP9A 3QHOA 4W5ZA 3GH4A 1DWIM 5FCZA 3AIVA 2WXDM 1U30A 4LGXA 1E3XA 4DWSC 1WAWA 3B9AA 3RO8A 1H0IA 3VX1A 2OSWA 4YN5A 2G3MA 4H2CA 2D3NA 1UWSA 1VEPA 4AD2A 3OGVA 4HA1A 2X09A 3VX0A 3EYPA 1Q6GA 3VILA 4J27A 1OD8A 3OLDA 2VVSA 3IANA 4RL3A 4D6FA 4D6EA 3I3DA 3N9KA 5GNYA 1K6AA 4UQCA 1V0LA 2ZXBA 2OYKA 2DPEA 1B90A 1G5AA 3O2LA 4AXNA 2WMHA 4JAWA 7A3HA 1WB0A 2ESCA 3CUHA 2BY1A 3VIPA 2Q8XA 1ESWA 5ECUA 1QBAA 2PC8A 1E4LA 3UG5A 3KL0A 2A3HA 4L4OA 1UA3A 4OOUA 2WBKA 2VCBA 2ZX6A 2W62A 2Y8VA 1GOIA 3IK2A 1CXHA 3N15A 3CGTA 1W9UA 2WW5A 1OWQA 4AZIA 3VOCA 1VF8A 2J8FA 3CMGA 1JD9A 1G1YA 1W3HA 3LRLA 1UR4A 1CBGA 1QNOA 4BQ4A 2VZUA 2VNCA 1BYAA 2FHBA 1ODUA 3U5YA 2XIIA 1FHDA 1LJYA 1X1NA 3AXIA 4NF7A 3KEHA 1FHLA 1X6LA 2F1BA 4MAZA 1OGGA 2UY3A 3ALGA 3U7VA 5A6BA 3POHA 3WNPA 1ZU8A 4FNQA 1R47A 1ZJBA 4PTVA 3EMZA 5DT5A 1H49A 2V3FA 1E5JA 4QAWA 3TOPA 1VBRA 3IAPA 2CHOA 2WC7A 5LYRA 1UWIA 1C8YA 1LG2A 1UD8A 1W3LA 3M7SA 3ZJ6A 1JYVA 2XJ7A 2D0FA 3VDHA 5E0FA 1DWAM 3WQWA 3NSXA 3GXDA 4F9DA 2V38A 1JNEA 3B9EA 1MXDA 1G01A 1TFVA 1CGXA 1A47A 8A3HA 3MSDA 1LG1A 5JUVA 3VVGA 2ZUMA 5A8MA 2J7FA 5E09A 2Z1SA 1J12A 4UQ9A 1J01A 3WFZA 3CO4A 3W26A 2YDQA 4RE3A 1VEOA 2WMIB 3GH5A 4DO4A 5A69A 3WY3A 3PZMA 5FL1A 5M3WA 3AIBA 4JL2A 1E6PA 2VO5A 2F7QA 3GNPA 1E43A 1WZKA 3EJUA 2WHJA 4UOJA 3K8LA 1GW1A 1JF5A 1GORA 2G4FA 3EJPA 4UZUA 3CZGA 4P7QA 1BVZA 1GOKA 1NH6A 4UR9A 3OZPA 1EQPA 2BXZA 2J4GA 2QLYA 2WCAA 2J47A 1GOWA 1PS3A 4W93A 4CN6A 1E5NA 5DF0A 1Q6DA 3OG2A 1VJSA 3BLBA 3VNYA 3AHTA 5IXEA 1W3JA 2WVSA 5LA1A 3HG5A 1ISWA 3VPLA 2ZE0A 3BAXA 3SEPA 3A21A 3VKKA 1E72M 2XG9A 1XCXA 2VURA 2X0YA 1O6IA 5IHRA 1QVBA 1H11A 1DWHM 2E40A 3VIKA 1E55A 3THCA 1LWHA 1EIBA 5CJ5A 3ARZA 3NIYA 5I77A 2W92A 5JIPA 4IUGA 3BUPA 1W9VA 3N11A 1QI0A 2Y24A 3RJXA 3BCFA 3ZT6A 1C92A 4AZBA 2WZHA 3SCOA 3BVVA 2XGIA 2CNCA 5I24A 1UD4A 1TQTA 4C7DA 2YA1A 4M24A 5A8PA 1E4NA 5BXTA 3ZO9A 4HZ6A 2EJ1A 5EFDA 3CC1A 2WHKA 3RMEA 4DUWA 4GKLA 5I78A 5FOOA 3WF1A 4JFTA 4U33A 1NOWA 3ZM8A 4DWSD 4HA3A 4BA0A 4HTYA 1E0VA 1R34A 3LPGA 1M01A 2Y5EA 2ZIDA 4E2OA 1V03A 5AC5A 3II1A 4V2XA 4J3VA 1B30A 2YL8A 5A2BA 3PZGA 4IISA 2WWCA 3LX9A 4P8XA 4MDPA 4CD4A 4FNRA 4GXPA 5AY7A 2X2HA 1JDDA 1NWSA 5BXRA 1WO2A 3ARVA 4Y7EA 2Y4SA 3MUZ1 1HKIA 1Y7VA 4CCEA 2ZUNA 1CGVA 4TVUA 3T2OA 2J7EA 2CKRA 1E6XM 4LX4A 5TD4A 3BUQA 1EH9A 3MMDA 4ACZB 4PEEA 5A8QA 3I3EA 1QNSA 1TQSA 4FLRA 3ARQA 4F79A 2CXGA 4GINA 4PMUA 5D9PA 1GOOA 4MNLA 3IGUA 1AVAA 1V3MA 1R33A 1JAEA 1QI4A 1V0MA 3WH8A 3QOMA 1PAMA 4E4PA 3WD0A 2CBVA 1CXKA 4MJ2A 2B31A 3DHPA 4NRRA 3HG4A 2OYMA 4RE4A 1WP6A 2NT1A 1KXQA 3RPMA 1JAKA 1HJQA 4XV0A 3AHVA 2YBUA 1JZ2A 4MB3A 3WQ5A 1WDPA 2YFNA 1V08A 1LWJA 4P8UA 5D8WA 2WMKA 2WZEA 3NSNA 4TUFA 1KXVA 1UKQA 3TONA 1RD6A 3MO4A 3PN8A 2YDRA 4WKHA 3L4UA 1HKKA 2PWEA 5I3DA 4Z2IA 3AXHA 5M5DA 1E40A 3WDIA 4TVDA 1BF2A 1CEOA 1VIWA 2FHFA 5D9NA 4D71A 3SIMA 6TAAA 2GK1A 2DIEA 3HJEA 3WD2A 1UR0A 4F9JA 2VT0A 1J9YA 4F8XA 2XM2A 1BHGA 2WWDA 4AY1A 4UFJA 1SR0A 1K9TA 1H4PA 5CSYA 1HKJA 4M82A 3GXTA 4W88A 1WPCA 3CZ8A 1ZJAA 1ISVA 2G3JA 3MANA 2JEPA 3L2MA 3GXIA 2EBNA 4IM4A 1H1NA 1HT6A 3UR8A 3FN9A 3M46A 3U5UA 4DWSA 1XV8A 7TAAA 2J7DA 1EQCA 3AMCA 4PBGA 3IJ9A 3T09A 2VQTA 1XGZA 2F18A 3TTQA 4OBRA 3HG2A 3S2CA 3ZJ7A 1QNRA 3AZTA 3FHAA 1QW8A 1ISXA 3QGVA 1R7AA 2EACA 4YPJA 4HA4A 1ITXA 3UERA 2E0PA 5GPRA 4CCCA 3ZT7A 2QV4A 3GNOA 2XUCA 2OSXA 3EDJA 3PBGA 2BS9A 3HMCA 5BWFA 5GQBA 4W85A 4QLJA 1EDGA 2EABA 5I5RA 2GDVA 1GJUA 4GPNA 3KL3A 3PZOA 1SFSA 4PMVA 2J77A 1HXJA 1J0KA 4NZCA 2J62A 1TZ7A 1XHGA 1HJUA 3TP4A 2OWCA 1B3XA 2Y8KA 5HOSA 4TX6A 1U2YA 3AZSA 3ARWA 3W25A 3AI0A 1G0CA 4PYSA 3EDFA 3LMYA 4KGJA 3WKZA 4B3LA 2GJXB 1MFUA 4ATLA 1K9FA 5BXSA 4NZJA 1RH9A 4M8UA 1CWYA 2WVVB 1US3A 4J3SA 4W89A 3WN6A 1JFHA 2VZOA 4R5EA 3VD5A 3CZLA 2J7GA 2VRKA 5GNZA 3BAIA 2DSKA 1PIGA 1E6NA 5BCAA 1MW2A 1TQWA 2F61A 2WAGA 2DSUA 1V3IA 3A4AA 2TAAA 2GUYA 3S5ZA 4QLLA 2VI0A 1J0IA 2W61A 1NARA 3VM5A 3GZAA 1GJWA 1P6WA 2CHNA 1NP0A 4HOWA 3VUPA 3AS0A 1W1VA 4PCTA 1XSKA 4MB5A 3EJSA 4OBSA 2CEQA 1E6QM 1QI3A 4ACZA 2NT0A 1VFFA 5AYIA 4AISA 1ECEA 4TXEA 2D0GA 2E8ZA 3AQUA 2WKGA 2J7HA 1N82A 1R46A 3WENA 3EDKA 2CCRA 4WLCA 4C7GA 5A8OA 3WIJA 1MW0A 2XFRA 4LXFA 2PWFA 4U31A 1ZL1A 2VR4A 4V28A 4W5UA 4U2YA 5FIPA 4KWUA 1OGBA 1R8LA 2VZVA 5DFAA 3AJ7A 1XD1A 2XVKA 4WSKA 3UR7A 2HISA 2FH8A 3W0KA 3OGSA 2WVTA 3BLPX 2UY2A 4JFWA 3WUFA 3VIOA 1G94A 1C3FA 2DH2A 3PHAA 5A6MA 3T0BA 2W4XA 2J25A 3RM9A 3W53A 3HN3A 4WK9A 3VGDA 2PB1A 1QX1A 3WBEA 1I75A 2X2YA 4HOZA 4FK9A 4JKLA 3K1DA 1BGAA 5A6AA 2W5FA 4B9YA 1GUVA 3NJ3A 4MB1A 2QMJA 4DWSB 4BZYA 1HP5A 4FLSA 3VNZA 2VZSA 2ZX9A 5E9AA 4PN2A 5LA0A 1UKOA 3MUY1 1UG6A 4U5IA 2YFOA 3WMSA 2FE0A 2CBJA 3BGAA 1HIZA 4UQBA 4LYPA 1CXFA 1W9DM 1KWKA 5KEZA 1UWQA 3GYCA 5CQ1A 5HPOA 2XVLA 3MV01 4D6JA 1KBBA 1CXIA 3VINA 3U7BA 1MYRA 6A3HA 3CHEA 3IJ7A 2X2IA 3VIIA 4EK7A 3EJTA 1GQJA 3KL5A 1KTBA 3KZSA 3VIHA 4R27A 1J0HA 4DUXA 4H8UA 1ZBWA 3DECA 2HVMA 3PZQA 4F66A 1ODZA 1VRXA 2QF8A 3DX4A 1UR1A 3BMVA 2YDSA 2PWGA 1VFMA 3W6MA 3B8SA 5A6KA 4JFSA 3ZQ9A 2W91A 1EOMA 4QLKA 1BFNA 4M81A 4CU7A 3FW6A 5EFFA 1UKPA 4YHGA 3SCUA 2A3AA 4J3TA 2D0HA 3ZT5A 1EO5A 2W66A 4ZEPA 2VX6A 4M56A 1V6UA 3MSGA 3WUGA 1JF6A 1IZJA 1PZ2A 3AIWA 2D1ZA 2F8QA 1CYGA 1OB0A 1W3KA 4J3WA 5DMYA 1D7FA 3AIQA 4JKKA 3UESA 2BVDA 3DYMA 1TCMA 2FYVA 3UCQA 1KR0A 1E15A 3AFBA 5E0CA 2BY2A 4DO5A 2GJXA 2XPKA 3PZIA 3CPUA 2GSJA 3MUAA 4AWEA 4PMYA 1SMDA 1PEZA 1M7XA 3WUEA 3POCA 3WF3A 3D4YA 3BAWA 3CMJA 1XSIA 3BAJA 4TX8A 3CTTA 1RPKA 2AMGA 3VD3A 1KBKA 2CIPA 2X1IA 2WVVA 5I0DA 5CGMA 4FNTA 1E6ZA
chains in the Genus database with same CATH superfamily
3F7LA 4J23A 4TOQA 1LLAA 3FO0L 2DOCA 2XQBL 3SY0B 4HJWA 4M7LH 4KQNA 5JVLA 3WTSA 4GKTA 1E9IA 2Y06H 3I02A 5FGRA 1HE7A 1A5OC 5K9OA 3W24A 1RZQA 3SKUD 2AXFA 3GBEA 1DBJH 4MD5B 1H8LA 2ZQKA 2Z00A 1RJZA 1GIGH 1VYPX 2X6BA 1DHKA 4MJZA 4AIBA 1BFOA 2NX5A 3VGBA 1PSKH 4Y8DC 1BREA 2J5LC 2GVYA 3FB5A 3DK2A 3QFDB 4GRWH 2DVXA 2EPKX 1E65A 1U8QA 4X7FC 2QKFA 6REQB 4G8GA 1XR9B 3KHOA 4H00A 3PM6A 5DT7A 3W1QA 4G9FE 4KDWA 1W0WA 1W5NA 4B4HA 1JDCA 4PRHE 2Q7AA 2FVMA 1T0MB 2A6IA 2W07B 1WGOA 3MRMA 4E68A 4PJ5B 1HHIB 5I0YA 1KSRA 1HHKB 3D85A 3ZJKA 3C5QA 3HI6L 5B7EA 4KS0A 4J4PC 1OG6A 5CJOH 3B8WA 3VNKA 1DL3A 4MF4A 3GS7A 3G9AB 3RPKA 3KYKL 3AMGA 4PJCB 4DY1A 3E3QE 3HUJE 1TT6A 2ZA2A 2E27H 3ZZQA 3H1ZA 3MUUA 5C0AB 3T77A 4KI5D 3WBAA 1TA3A 2VUYA 3ZTEA 1WFIA 1FYHB 1MVYA 1RIHH 3FN3A 4JAMB 4WFGD 1MZZA 5FEWA 1XF4B 4E36A 2BASA 3Q44A 1BRLB 5A8GA 1FYTE 4WDWA 4H8WH 1M7DB 4QKXB 3VM7A 4FQLH 5BUGA 2V6AA 3MPCA 4KKCD 4RZKA 4L3EE 1A5CA 1XICA 2BXVA 3QMTA 3WQ6A 4NS0A 4UOW1 5I17A 1WDRA 1ET5A 2CWRA 3P2DA 3ORJA 3MMUA 4HS8L 4ZMTA 1I3GH 5SWSD 1NBYA 1Y18A 3RWCA 1TVPA 2YCLB 5ENWB 3W7MA 4P2RA 4PRBB 4YH6A 4AMKL 5D5ME 1OM9A 4BCYA 4EKXA 2OULB 3GQFA 1SFJA 1W5PA 4X6BA 1AKJA 4QRUB 3T6WA 4R4FH 3TVMC 3I50H 5J6SA 2NCMA 1RPXA 3SUWA 5HDBF 4LASL 1OAQH 4I8YA 3F62A 2CU9A 1M3UA 5ESAB 1XDJA 4KETA 1NDMA 2V5BA 4RMTA 3VFCA 2CIKB 2EXWC 3CE1A 4FQJL 4RX4D 1MI5B 4WKAA 4DZBB 5GGRA 2DWXA 3BRGC 4IBQA 4JG5A 1BAGA 1BWMA 4X4KA 1M1BA 2OMTB 3TV8A 3C52A 3WD4A 1DYZA 1F3RB 1OFPA 5INDB 2W80C 3D51A 5I0VA 1CXLA 2RJHA 2NUWA 5D7HA 1WF5A 3DG3A 4BK9A 3PJWA 4ZPVA 3F5WB 3B5HA 3RGVC 1N59A 4HK5A 3MFFB 5I74C 5JXED 2E5BA 1OFOA 1YNYA 3VI3A 3WLBA 1P6CA 2XYCA 5T3ZE 1EEUA 2AXJA 5CU9A 5AZ2H 4A68A 4MNJA 3V2AR 5EB8A 5EIIB 1NGPL 5L8JB 4HKBB 4XBGB 3GE7A 3SDOA 2GQ9A 4D9RE 4JCLA 3OKOB 3RVVC 5HYIA 1FDYA 4H5SA 5DJDA 3PV6B 2XQYK 1KYDA 2G97A 1MCOH 2A4AA 2GTQA 5AYZA 1SZRA 3KCWA 4GY7A 1JPTH 5KSAB 1KG0A 1I9JH 2FBJH 3FEMA 3WEMA 2B15A 4PTWA 4CVXA 2CDEB 2CO7A 3W0WD 2YAFA 4NHUA 3U7WH 4B9ZA 3F5JA 4DH2A 5HVHB 3Q3GA 4P5SA 2VL4A 1NA8A 3UYRH 3ZKQD 1B54A 4FP8H 3WIHH 1H3VA 2DTML 1QSZA 3BLKA 3MGTA 2CFFA 2EH8H 1JNHB 4JPKH 3UZQA 5CG7A 4ZXBC 3UJTH 4AC1X 3M1BA 1KLGA 4Q52A 3NBNA 5CJXA 4LLMB 1U22A 2ZCGA 3IEBA 1A3WA 4IMKA 1R3SA 4GLEA 4TTDC 3ULUF 3FT4A 4JRXD 2G2RA 4EUPH 5E1AB 3GRIA 1OX4B 3MROA 2EC8A 4OT1L 1DBML 1GWJA 5E70A 2GIXA 2A38A 2ZX5A 4PJIF 2QSVA 3U6XS 4DTGH 4F3HA 4ZZ9A 2WSRA 4L4VA 3CPRA 3S1UA 3NH7H 1UWYA 4N5EC 5EZOH 3DI0A 5LGHH 3BZFA 4BKTC 2OQYA 3O45A 5EBMA 4PJ5A 1SW7A 4UF7C 5DN1A 1BBDL 3O0KA 1QHOA 3ULUD 2Z1BA 1A4CA 4Y4KA 1JBJA 1CX9A 2B4GA 3VNDA 4TXVB 3P8IA 5E5RB 1SLXA 2HKFH 3LEYH 2XN2A 4HA0A 2NR6D 4J3BA 2VEGA 1F3XA 2BNRD 5LXGH 3VD2A 2EUZA 3KAOA 1NGWB 2VDGA 1C08B 3T0WA 3ZE0E 4K2UL 2IQAA 1FGNL 3X13A 3DO7A 3IARA 4ENEC 4MCNA 5LNSA 3PP7A 5AZEH 2PMQA 1W6LA 1SNRA 1HHGB 5I03A 4OQTH 5KZ6A 3RX8A 3OLGA 4MB4A 4ZMXA 4TUOA 4KK9C 5I8KL 5CP7B 3IACA 2GK0A 1G7LB 4I89A 2PYED 1YUHA 3DETD 1LQ0A 1JK9B 2CCLA 3P3RA 4GRLD 3EGDB 4BZ1H 2PDWA 2VX5A 2WZIA 3H2AA 2ZWZA 5D7KE 1H15B 3S5LG 5IT2L 3TWBA 4F2TA 4L05A 4MZ8A 4PJEE 4Q4MA 3BVNB 1W0VB 2GJRA 3L3KA 4Z3JA 2BY0A 2R56L 3SDYL 1KEMH 1VFLA 2JGQA 4M3PA 1BXXA 1EMTH 5I82A 4ZZKA 4JFXB 2CLFA 2A73B 2C3HA 4EMZA 3VD0A 1L8NA 2BVQA 2YLAA 4XOCA 4KUCF 4EE9A 1H9DA 4MQTB 2F74A 3PBMA 3KNBA 5HYJE 1NLBH 3EB4A 4JFVA 4AH2A 5ICXB 4HXAL 4JY9A 3LRHA 3W39B 1EPFA 4M6NH 4AUYA 4Y8FA 1YEJH 2R2CA 2GKIA 3IS4A 3VDGA 2XZQL 3KRZA 2IDUA 5CS7A 3V79C 3DVIA 2QS8A 3V0VB 2GPZA 3BJTA 1MREH 3MP3A 4LAZA 2ODHA 2W60B 5FI8A 3UC2A 2FB3A 3EJQA 4TUUA 1UJQA 2G95A 3LDBC 4HK0B 3TIDB 2COVD 4WV1A 4HKBA 4XBGA 4Y4FD 4APXB 3LGDA 3TA9A 4ONFH 5CC3A 2A9BA 3WNJA 3VI2A 3VCNA 1XPGA 4KOBA 3EO0B 1BIHA 2APBA 1O5XA 1D7BA 3D69B 5BV7L 1TKKA 4UXDA 5K2ZA 3MHGA 4C7FA 5D2WA 1UQYA 4HF5L 4C4KT 1B88A 1T04A 3ETTA 4NPYA 4R6UA 2DL2A 1HFUA 2WO4A 4ADTA 1QK2A 5D8JL 1HKMA 2Z35B 4QT5B 4D9LL 3MRNB 3QFJD 2R29H 3GBNL 3DFNA 1CICB 3ETBJ 3AC0A 4YVXA 1DLFH 4WY7H 3RVTC 1QPRA 1SSGA 1S7WB 2B4CH 3WNKA 2CITA 1NIAA 3C2AH 3B9NA 1RIUL 4ML4A 1FE8L 2EYTA 2OSLA 4PP2A 3HRZC 2F5BH 1U83A 1RZPA 3C09B 3QGAC 4YL2A 1KPVA 2CXKA 2YC1A 5DFVC 4S2SA 1ZHBA 1GVIA 3II3A 5IQLA 1G69A 3SYAA 4CVUA 3FQNA 2AQPA 2DWEB 3ECUA 5C70A 1M1SA 4FS0A 4R0LB 4U1SB 5EOCL 4TSBH 2QDDA 5GGVL 2DY3A 2FB4L 2IAND 3HZMA 4X9IA 3NDYA 1AGDA 2OCFD 1CECA 1QFWM 4CN4A 5FF6B 1BTCA 4M7ZC 4PUJA 3VUSA 5JBFA 4GJTB 3N41F 1OFDA 1N8FA 3HMXA 3KLKA 1PKMA 4ZFOL 3VRLF 5HJLA 4KC3B 2CESA 5JUEL 4X9FA 5E1IA 4ALAC 3BAYA 4NAEB 5HNTA 1IT9H 1ETZB 4RFNC 4APQD 1XPYA 5HMSA 1OGAB 1EB3A 3DFYA 1D6EB 3UXDA 4DXXA 1VADA 5DEZA 3BJ91 3QHNA 2G30A 4V2BA 3H4FA 7TIMA 2CDEA 4JGMA 5EPMB 3EOUA 4URIA 4NZDA 4MCMA 3ARFB 2JF7A 2ZVIA 1MEXH 2FO4A 3VYNA 3EB3A 3QYNA 3HB3D 3SCSA 1TQCB 3TU6A 5DQPA 3SDCA 3LN9A 4PTTA 2IGTA 3DUSB 4IBWA 3V9EA 2DV6A 1ML0A 3UEQA 4PJAB 4UUJA 5HPMA 1Q6RA 4JS7A 2VFDA 5M2FX 3SURA 3VMNA 4D6CA 4WCJA 4G7FA 2ADJA 3RM8A 2I9TB 1AZUA 1VPYA 5B3NA 3AO0A 3MODH 2YB1A 4GAGH 4YSCA 2Q10A 5EU6E 4OIFA 3SKNA 5I71C 1A3XA 2HT4D 1Q5MA 1KCVL 3UTSE 2A1WL 4CVZB 2GUUA 4QDWA 1N59B 4JRYD 4DJFA 4MAYC 2E7LC 4JANB 1T8QA 1OTSD 2ZSWB 1XGDA 3FDGA 3MMWA 1D9KB 1HOCB 1CD9B 4G59C 3R06A 3LLXA 1HNFA 2HVKA 2NW3A 1XF5B 3AABA 4YXHH 3R8QA 5CO1A 3RTLA 1M1XA 1Z3GL 1ZLPA 2P5NA 3E8VA 2OMTA 3T4AC 4DW2L 5D33A 3FCBA 4HBKA 1FFRA 3L9EA 2E68A 3K81A 4M5TA 2VWSA 5AW9B 5T1MB 3VG0H 4G8AC 3PU7A 4QCFA 4W84A 1V3HA 3L5XL 1VFTA 3VTRA 2ZUWA 3DIFA 4TPRH 1CL7I 4WU5A 2AI0H 2JJUA 4K55A 2K8QA 1WX0A 2QKIC 2FHCA 4X4MA 1R5IA 4URKA 1ZCOA 3ELAT 3FQTA 1N2VA 1DVYA 4WUUB 4C54A 1KOAA 3DMMC 4MJ4A 3ESNA 4NQCE 1CR9L 1LL1A 1UOLA 2F53A 3K2KA 3SZKC 4C59B 2O4EA 4DO6A 5B3JF 4Q6IB 2FTWA 4NZ3A 3MLSL 2G4GA 3QUKA 1HVXA 5T5NG 1WVZA 1OM3L 1YQVL 4NQDB 1EA9C 3HVNA 2UZ9A 1J6PA 3RM4A 4OGYL 5KYWA 5HDRA 2EEXA 2VLJD 4HPHA 1OEPA 2V5TA 3G6JB 4G6KH 5A2LH 4YJ5A 3ETSA 3IGAA 3BN9C 4LIQL 1ZWIA 2J4WL 5GGQH 3OZMA 4LUTB 3ULVH 1E2VA 1P53A 3O45B 1EK3A 3LKPA 5E9NA 2XM1A 1G7IB 4BI5A 2JB6A 1K8IB 5E8PB 3PXJA 1Q7MA 3L5MA 1NKRA 1L0QA 4KRPB 4LCUB 1DQML 2TODA 5J5RA 5EEZA 2PTYA 2XZ9A 2W4XA 5JW5A 4DKEH 2DQHL 3PAYA 4UV4H 2RH9A 1S7QB 4BZ2A 3HURA 1MIEH 4D0BA 4W68A 1KBWA 2XGZA 3J2PA 3ULVC 4H9MA 1F6LL 1HILA 2IPJA 5L9DH 3VK5A 4LNRB 2QQLL 4FZIA 3EJZC 5IMMA 1JPDX 3DKJA 2MMXA 1SHXA 3OKDA 3NEXA 1BMWA 1EAQA 3D33A 2P8MA 2IVFC 3AREC 4DAGL 2I1OA 3ZTNH 2TRSA 4IHCA 4MNMA 5FO2A 4V27A 1VZHA 5ISZD 5DVLA 1SRDA 2VJXA 4OFYD 5C08E 1VHNA 1FFNB 4Y2DA 5D4HA 4K3ZA 1OT1A 1WT5C 2BWQA 2Z92B 3KPSB 4N9GA 3LI0A 3SFWA 2NR6A 3SIZA 4I0PB 2PP8A 3LV3A 1BQHA 4JL1A 3B2UC 3VXMB 1EJRC 4NC1C 3SBWA 3HAEH 3KUMA 4N1CA 5HNRA 3F2CA 2VDIA 1P7KA 2Z93B 4XE5B 4G9FA 1TQVA 3OLEA 4R4ND 1RIVL 5DCEA 1YYLH 1CR9H 4CL7A 2XETA 3ILQC 3PV6A 1L9WA 3M8OH 2ALDA 4FIQA 3FO1A 4W9GC 3UFIA 3MZ2A 3N17A 1N26A 2V2XA 3GMRB 4Z7UB 1YECL 3VFPB 4ZMLA 1B4EA 1IR1A 5F4SA 4H44C 2OR2A 4GKSA 1JTTA 2OZ4A 4A67A 4K94C 1IGIH 2GQ8A 2BC4A 2YWZA 3WIAA 3FU5A 4FMKA 2WAQA 3H3KA 3TEWA 2GDUA 3Q9QA 4NN7B 1KJ2B 3PS6A 2FTAA 2Y5SA 3W81A 4PMZA 3HS8A 4WEVX 4MQXD 4TF4A 1HYSC 1H62A 1EEYA 1JGMA 4R90H 4ERIA 1TZIA 4ZFOA 4ROQA 4L3EA 1RSYA 4MTMA 1KGWA 3ATZA 1BKHA 4EIVA 1KBGL 1KCVH 2B9BA 3BWAA 3QR2A 1VFSA 3MV9D 1YN7A 3QEQE 2PRLA 2GPTA 1KLGB 3HS9A 4PJEF 4LKXB 4P2AA 4PMQA 3MKKA 2R8SL 4NAFA 1XGUA 3X3GH 1IXQA 4A7GF 3T1GA 3ILPA 5KS9A 2YZRA 1AK5A 4JQXA 3NJLA 4JTQA 4ZMNA 3SUVA 5ANMA 2EDRA 3L7EA 3HV8A 1UFUA 4ZXBA 4BEIA 1RJQA 4M1BA 2ZA3A 3VTAA 2L7QA 3VDAA 4DEFA 1PG7H 3WFLA 5IW1B 4KVNL 1Q1JH 5I19L 3GNML 3F5LA 1ETZA 4XK2A 5U7SA 3WD1A 1RCOB 2Y7EA 4PJAF 3PS7A 1BQGA 3VXNB 2A6DB 4LB3A 3WELA 1NC2B 5LXEA 3WUWA 5FGBA 1W91A 2CPUA 1KLFA 4C6NA 2VN4A 2HTLC 4LLAA 1G7VA 2XBZA 1B4JL 4UYPA 5SWZE 1O6SB 5BZWA 3S5LA 1S7SA 1L9TA 3T9WA 1FNFA 1DVSA 3BUIA 4ZYKA 1UR8A 3D0LB 5JR1H 5DHDA 2NXGA 2P76A 1FNAA 1HWHB 2BIQA 1QUNA 4M6MH 3LCHA 4AIUA 2Y69B 3PP3H 3TM6A 4MJ5A 1PDYA 2X16A 1NCOA 3KWTA 3UZZA 3RILA 3I6KB 5LXVA 1V02A 3ZU8A 2E9BA 4U3AA 3WLTA 2WXQA 2VLMD 1XB6A 5AN7A 3WS3B 2CLEA 1VJZA 5B38B 1TSIA 4Y1TA 3OKKA 2BSEA 4NRZB 5IM7B 4P4RA 2WSKA 3NGBC 1JYXA 4NI6A 4HUMB 2D3VA 3GJFA 3ZLHA 4IDJL 3IJHA 5HYFA 2F5BL 5CH9A 5F70A 2FAUA 1JS4A 3FFCE 4AQ1A 1RBLA 2V4LA 4G7SB 5FYLD 1YEDB 2X5PA 2ZDSA 1V3KA 4JO4H 4Y5VA 1ZD6A 4CC1A 3E74A 4UWMA 4WX2A 1CFSB 5FO9A 5T1KD 3FT2A 4BQ5A 4CU6A 1PKOA 4XAKD 4BINA 5DANA 1QUMA 2H6UA 5DZPA 1Q9WA 4LE8A 1MW1A 1WC7B 1S3TC 4XVDA 2NXZB 4OCNC 4QD2E 3W1PA 1USZA 2ROXA 4XN2A 5FYJD 4ZS7L 1ME8A 1XYBA 1E0XA 4QGYA 3PZ9A 4F9LC 3EOAB 4XMKL 4ZK8A 1E56A 4W9IC 2HXUA 2BS71 5IB4A 3P4LA 2RAGA 3TVMA 1E0OB 1LGVA 2R1PA 1MEWA 3KXQA 4RXFA 1LF1A 3CQJA 4E3VA 1V7YA 2Q6WA 4YCPA 4AQ1C 5SWZA 2C16A 2ZOKA 1AXTH 3GK0A 1DDHB 4IJRA 5ESVA 4ODBD 4U5KA 3FU8A 1IIHA 3AYRA 3TYEA 1QBLH 2F19H 5DRWA 5DZLA 3PFMA 1MCWW 7REQA 3TEXA 1ZWIB 5KZDA 2CJ3A 3O4OC 4L4VE 3LKOA 4X98B 1Q4NX 3QZNA 5ELIA 4JQ3A 5IVZB 3W27A 4JHAH 2IPKB 5KANG 3V7MA 2CR3A 2OWXA 3AHXA 1EJWC 2XACC 5EO9A 3TEVA 3RVXD 4K94H 4MKMA 2AJ3A 3SGKA 4HJ1A 1LQ2A 4ZNEE 2AEQH 2J9XA 2F53E 3EA2A 3BYYA 4LLWA 1NANH 2EDMA 3TLLA 4LUTA 3OKYA 3LB6C 4GG9A 3HMXH 1J0ZA 2HT3D 3EJRA 3Q48A 1W31A 4P7QA 1BYOA 1V0KA 2R9HC 4Y4FA 4HAGA 2EEAA 2MJWA 2A79A 2XTLA 1R3RA 1EPXA 4Q8TA 3LEXB 1DJYA 1N3NA 1YEFH 3LEVH 1AQFA 4DGWC 1GKRA 1XEDA 2VR6A 4IBYA 4JN2B 1E4XI 2WXIA 1KCRH 4WSJA 4CC4A 1SFTA 2ACUA 4CADA 5IT2H 3COOA 1TZIB 4ZFOB 2VISB 5D5MF 4HMEA 4KESA 1RZMA 5D4JA 3Q2LA 3STCA 4XZ4A 4JN1L 2HBVA 3FTGA 2J6EL 3B37A 2CAKA 4RIRB 4IJBA 2Z64C 2ERJB 2GJZA 4JY6B 2RKXA 1OIOA 2Q7NA 2ZSWA 1T20B 1KA9F 3ULSB 1ZBVA 4HU0A 2YXGA 5AG9A 4XHJD 3N2CA 4XCEA 1M04A 2IQ0A 4HH9A 3ASNB 1Q6CA 4BQ3A 1JWMA 5D6DC 4GUHA 2AZUA 5JIQA 3AT9A 5FDWB 4HEMA 5A2AA 3GLZA 4GBUA 1EGJL 2WIMA 2XQ0A 2A9DA 1U58B 3W70A 3PGCB 4X6CE 4IPLA 2ZYIA 4HP5A 1Z5LB 4U4IA 4FQHA 3T3PB 4L1GA 4IRSC 3VFOA 1A1OA 1NUFA 2VDLH 1ZHLB 2W9EL 3WJLC 2DT3A 4Q56A 1FGVL 1W0WB 5JIKA 3SJVB 1IQWL 2UZIH 3TQVA 3CAVA 4X6EB 2DQGH 3FO9B 5E24E 3TSBA 3QE5A 3K5XA 1UZ4A 5LKYA 4ZFFA 1J1XH 4EOUA 4PJEB 3Q2DA 3P93A 4WZ9A 2OTWA 3EO1A 1A3ZA 1SXSA 3KBEA 4MKSA 1GW6A 5D1ZI 1NOUA 2YD9A 1GQLA 4FFVD 1IWPA 4PSPA 3P8JA 4ICMA 3BDXA 4XBEH 3RO6A 3V4PH 2JFEX 1A7NL 3SOTA 4JLRA 3WD3A 5J0BA 4IIQB 3CFMA 4HHMA 3M0XA 4NRSA 1MCPH 5JIIA 5IG7A 1SO4A 2EO7A 3WL0A 1SY6H 2C8NA 4XI5C 2GFTA 2WB1A 1TTRA 1VHCA 1XCFA 3REQB 3W76A 3P54A 3IVKB 2QGEA 4D0BB 4BXVA 4GQ0A 4JREC 3O0RH 5ERWB 3V7PA 2WK2A 1CE1H 3EGSB 2V9RA 4DGYH 2BC4B 2OSYA 4WXYA 1J8HD 3BRDA 2QULA 4ZS6C 4R7NA 1SFDA 1T7VA 5F72S 1LP9B 3RU6A 3O07A 4MJIB 2R4SL 3SY1A 3VA8A 1IAIM 3LIZH 1XF3B 2YD3A 1XH2A 2ADGA 5I1DA 5KSAC 1KENL 1MH5A 1YY8B 1R75A 4LDEB 3RLUA 4HH8A 1A6WH 4ZXBB 1TJ0A 1M9WA 3MJ9A 5A2IH 1XJBA 2REQA 2N01B 5GRVK 3VFUA 2CLRA 1HNGA 4QRQA 4Y8EA 4LAQH 3PZNA 2AFNA 3GXPA 3KYAA 4QRRE 1NIBA 4GG8B 5FEBA 1U93A 4AL8C 4A35A 1H6EA 4NC2B 3PG2A 5FA4A 3THML 4XZIA 1OFBA 3OHMB 4EI6B 2F53B 4LARH 4F9LA 5L8LB 2I14A 3HE6D 1GMEA 3TOYA 3JZEA 3FKUS 1FWSA 3FHEA 1J9CT 2X8RA 3QIWC 1OKEA 4ANWA 3C9NB 2PLCA 3W71A 1EEYB 5FJJA 3KVPA 3NL2A 1QFEA 1RUQL 3BLDA 2EIDA 3AWFA 1TVHA 2B59B 3E1F1 4FRWA 4WZHA 4AX3A 2W60A 2W0FA 4ES9A 4PV9A 3EYQD 4XUYA 5D96B 1BTMA 3TA4D 2MOGA 4GKSB 5C9KA 1LP6A 2DUZA 1GYNA 3TNBA 5A6LA 3UZYA 3GIYA 3TS8A 3VI3E 2MQ0A 1TTIA 3MCOA 2F1AA 3T0EB 3FU7A 1VENA 2D7MA 2H0EA 5MENE 4U0RC 1GGTA 2P44B 4AKQA 1CT8A 2J8UA 4ZXBD 2AW2A 3QCUL 4UNVA 1N3NB 3P2VA 3ZFHA 1OAQL 1NFIB 4GXFA 4ZZFA 3FVMA 4AKPA 3QSRA 4XZUB 1WUZA 3WMCA 1Q85A 3FA5A 2GJ6E 3MBXH 4OD3H 1G7MB 3WMPA 4AIOA 2B2XH 1JZ3A 3H2PA 1X98A 1UWFA 1AMXA 3UVAA 3H2WA 4MQ7A 3N25A 4P8VA 3BPNC 1W2KT 3OAYK 3PGFL 5DHVH 5BUAA 4HKXA 1JRBA 1YNTB 3EX2A 3RGTA 2R1WA 4OGXH 2I60L 2F9RA 4HG4K 4WTZG 1GZJA 4I9WE 1QAWA 1N8OE 4JFYA 2H2PC 2HNHA 2VFHA 1IC5H 2OW7A 4RLIA 1IAMA 3P81A 3H53A 4IEFB 4ZE4A 2AP2A 1QRKA 4PJGB 3H2OA 3V5FA 1LDCA 1WBZB 3NCBB 1J79A 3ZDYF 5T3ZD 4HD5A 4HIHA 1DJWA 3M6YA 3WQ8A 3GSOA 2PPFA 1L9OA 4OF0A 5CP3H 5GS0H 3UPRA 3DN5A 2G5BB 5FESA 5I8CA 3OVQA 4AY7A 5C7VA 1ONRA 4F80A 4LF3A 4NZTL 1TENA 1YYCA 1U8CB 2ODOA 3A23A 3CV7A 1URLA 4RFNB 5AW8B 4Q6YA 4ZFZB 2R1YB 4FFZH 2XGBA 1QEWB 5CGYC 3B8DA 4YXLH 4JO3L 4N5UA 4P2OA 3S37X 1IXPA 1IGTB 3IDNB 3BCJA 4ZPTB 1RH8A 3DTDA 3TBCA 3LZRA 2YPLB 5AAMC 3V3WA 3E49A 3EYVA 4NFDA 5REQA 5H94B 4AQEA 1WNOA 1AZBA 3THUA 1JXKA 5CJQL 4DGUA 1KRBC 3U0WH 1A8ZA 3V10A 3H2FA 3PR2A 3ZL4H 1H61A 3OB0K 2YGPA 3QHZH 3QJQB 1JCVA 4XCNB 3UCRA 1LWIA 4JJ5A 1NFGA 1XUZA 1LK3L 2NXIA 4Z9KB 2VGGA 4MQXC 3BD5A 4B5XA 5C8BB 2BSRB 4JFOB 5E1AA 1SVDA 3BIBX 4GG6E 4B53A 3BQUA 2Z7KA 4OZHA 5ID1A 1D5RA 4NQDE 4QUOA 4X6DB 4XRCA 4HQQL 4AZCB 5FK9B 4R7DB 1DQQA 5KSAD 4IKIA 4UYQA 5EFIA 3M5VA 5F0LB 4GK8A 4BUGA 1KNOA 4GYFA 5D30A 1O66A 1M7OA 3W7KA 4MS6A 4MHHI 3R58A 3PHQB 2IQDA 4KX7A 1MY7A 1XF5A 4GBXD 4RBPK 3PHSA 4FQQB 5JORA 4MYXA 3RJYA 5L7XL 1S78D 4G7YH 2CO6B 2R2HB 3ZN6A 1DSYA 1HL4A 2QPSA 2DW5A 2YBRA 4L64A 3THDA 4N2EA 3DX5A 1T2QH 4KCTA 1WFNA 2VXUH 2Y0SA 3P4OB 5D2NA 2X6VA 2PF0A 1ADDA 1RBOB 1W1PA 3ECVA 4GJJA 5HD8C 5FJPA 2NZ9C 3NACH 4AH2B 3ULUE 1H1YA 1AXSA 1ZA6A 4HWUA 5CZRA 1B3WA 4LAKA 4Q7BA 6PAZA 3BJLA 1TU2A 5EIIA 2YR3A 2IADB 5I8OH 3MVTA 1GQNA 1MJ7L 2RJMA 3UCCA 3UGRA 3HRZA 3BN3B 3IJ8A 5F71A 4N9DA 3T78A 3ARED 3CXFA 1JWSA 3MJMA 2LABA 1SLUA 2ESVB 2I07B 3EJZD 1IGML 1XIWA 2ORBL 1LM8V 3NIFF 4L1SA 4UT9L 4XCCL 2NW2A 3B3DA 4LCWE 3PNZA 4G1KA 3V5OA 3WY1A 2D7NA 4JZJC 2PW1A 3HG1D 5LBSL 1IT8A 3PQYD 2UWFA 5T5NF 1D8CA 2XVGA 5AB2A 3U2ZA 5J57B 1INQA 2Y1VA 1VSCA 2GBVA 3MNMA 4H9TA 2A2QT 2AGJH 2ITEA 1BG4A 3Q01A 4QMEA 2Z4GA 3N4EA 3LNDA 1XXFC 1GVEA 1JCLA 5I1DB 3OBAA 1WDQA 2NY3B 4WO4B 2ICWB 2Q1EA 2PGFA 1VFUA 1GYLA 4MAVA 5E6ID 3W1AA 4Z2LA 4PJ9B 4MNHA 3CPLB 1LP9A 2IH1B 3C5ZC 4OZOA 4RISH 3BN9D 5BWAA 3T44A 5JMRA 3IDJA 3CHFA 1ZHNB 4PJFE 5C2GA 2PYFB 1X5YA 3OLIA 2QCCA 3K2MC 2IS7A 3WTVA 4FF5A 2WNWA 4KTGA 4ZRGA 1HKFA 3K6NA 3EMCA 4JIHA 1AD9A 4GIPD 4Z3IA 4HDIA 1EHAA 5C8JA 4Q8WA 1UXLA 3CB8A 4YU1A 1Q2SA 1Y0EA 1XCWA 3MXWL 3VIMA 3OM3B 5TGBB 4O00A 1VIZA 3A6CH 5CPOA 5C0AD 2DP3A 5DD5L 2Y1ZA 3BTNA 4ROPA 2Z0UA 2X9ZA 1MUCA 1VBHA 2WSYA 3H85A 3K4WA 4M1DL 4NT0A 1GPFA 1AH4A 4GY0A 4UTMA 2W81C 3QI9D 4Z7WB 1UWRA 1G0YR 2GCYA 1IM9B 1SLWA 1KJVB 2HJFA 4K8RC 8FABA 1F9CA 1XF4A 4FEZA 1KIPB 3B1TA 5MEOB 4AW4A 1UT9A 2Z9TA 3HE7D 4DJFC 1F61A 5E1QA 3ALPA 2B08A 4PUBL 4P9MH 1MMFA 1WAEA 3VFGL 2B1OA 2P80D 4MZ1A 2Z2AA 2QHRH 3O8XD 1CI5A 4Z7VA 3AWNA 3UACA 2NY6D 2GK2A 4GG6B 4QTGA 2XICA 2YXWA 3EGDA 1W56A 4PW4A 2CK0L 4CNNA 4RMVA 1OCZB 1HKLH 2DQIL 4X8XA 5IROA 2QHAA 1X8CA 4QHMB 5TE6L 1P0DA 2P7TB 2VDNL 4UM8B 3D09A 1WOBA 4XZWA 2K6WA 2K9UA 4E2BA 4EWJA 5HWMA 3NESA 2B0SH 1FA4A 1QNPA 2OMXB 2A7RA 2ADIA 4X4XA 4DBDA 1RK1B 4I5XA 2P88A 3GHBL 1BKSA 3EYSH 3BQUC 5MENB 2IGFH 1JHKL 3LZOA 2R94A 2F7PA 1XLCA 1QFOA 2WV8A 4PZVA 3EYFB 4O28A 4QITA 5D7JD 3KNBB 1H3GA 3MZTA 4QRRA 2DSVA 2J74A 1SXCA 1FDJA 1OB1B 5LO7A 3C5SB 4OLZH 2Z35A 3KVJA 4R9OA 3PL6B 2CM6A 1EDYA 3FRPA 3IS1X 4GRLA 4LF2A 4MDOA 4RDVA 4UNKA 2HZGA 2VFIA 3IDYB 1D7KA 1DSWA 4HIHB 5C7HA 3FVDA 3IU3B 3E7JA 4X42A 3LKNB 5AL0A 2AL2B 3HNVL 2D2GA 4C47A 4AJWA 2CZFA 2Q6ZA 3I68A 4LYKA 4YMZA 2G5BA 3GMQA 4BFIB 1E5BA 3QC5X 3IPWA 5DC0A 3G1HA 4MKTA 3EZJB 4UMGA 3UTSA 1R9YA 3RG1C 1KCUL 4U6VH 3MX0A 5D9OA 2DQTL 5DFTA 1GQIA 4GOAA 5ALBH 3PAZA 4PWIA 4Q9RL 3GFXA 1YNTA 1TPFA 1CFMA 2QXWA 3DSFL 1JN6B 1SBSL 1D9KC 2W67A 1OHLA 2VMDA 1U8MB 4CN1A 3NGFA 4N0FA 3BSHA 1GNXA 5CPTA 3CH0A 5I8EB 1LMKA 2BWDA 3LRKA 2GQ3A 4CW1B 5FYJL 5ABTA 4AZ7A 3PB2A 3DROB 3MI2A 2JKLA 3LKQA 1KRCC 1YNPA 1NWRA 3KPRA 4JQAA 1F3DJ 3GR4A 3MUGB 3RAJH 2QUUA 4EZMA 5KJ7E 1T0OA 5JH1A 1ZLDA 2I9EA 1HTYA 3PYCA 5KS9F 4H40A 1DJSA 1U33A 2MWCA 1BZQK 3PWNB 4AMAA 3EGSA 5FYLH 4F0LA 4PS7A 3EOEA 1FH7A 4TUJB 3W7CA 1OSPL 3KBMA 1NELA 3GXUB 2VKXA 2ZZ6A 4PBXA 4X6CF 1VLWA 1QFPA 1MW3A 3JVGC 4ZSOE 4NUJB 5EU5A 1XBYA 1NM9A 3AROA 4UDTB 2CO6A 2R2HA 3RX9A 1ADQA 1TMLA 2JKTM 3AOFA 3SCQA 4KKNA 3U4BL 1Q9OA 2Q87A 4NCDA 1UM4H 3QQ0A 3ARBB 4WNQA 4BUHA 3MV9B 9CGTA 3ULVE 3NQ6A 2AMXA 1PIIA 4LQFH 2W1NA 4Q6KA 2ZONA 1H41A 4HZLB 3ULSA 3HFYA 1M03A 3T9PA 1KC5L 5T91A 2XY2A 1X5HA 4XRCB 4GY1A 4HIBA 5TPWH 4TULL 4Z7QF 3NDOA 1GGIH 2COQA 1MPAH 4ALAH 3PRZA 4AJVA 4K39A 4JN7A 2ED9A 2VDQL 3MZGB 4TOYL 4OF7A 3RY6C 1Z42A 5D7LD 1QI5A 3CWGA 5E6YA 3MRJA 2J6VA 2AQ1A 2HJLA 4S3FA 3CK0H 1S9XB 2Q8BH 3W72A 4ODHL 4RNJA 1N6QH 4NB7A 5F7NC 4N6EA 1DJZA 1WA1X 4Y5XB 2MCMA 3VH8G 1O9VA 4DF0A 1A1NA 3BW9B 3UJJH 1RZKL 4O02A 4WQOA 4ABVA 2QV5A 1MDRA 4OQ1A 4XXDB 1IHIA 3FBQA 4H6KA 5I07A 4DPBX 3GXNA 3U83A 4F8NA 5HBBA 2XVNA 5MEPB 2ICWJ 3FJLA 3KDMB 4QEHA 4IQJA 3W1ZA 4Z5RB 4WI0B 1U8PA 1HJVA 2F2KA 4OUOA 1BYPA 4PMFA 5HI5C 3AHYA 3GTXA 3GLDA 3VFLA 1ZT7B 3KGRA 2VMFA 3TR9A 1J8HA 3HZYA 4R8WH 1JF1A 5T1LB 3SGJC 1I7TB 2FO8A 1Q90A 1NCCL 1V05A 2AQ2A 2BCMA 2ZX7A 3NGBB 4GQPH 4JFFD 4RFEB 4YE4L 3W56A 2EYRB 4GO6B 3WLWD 1S5WA 4LY4A 4IOTA 1AG6A 2DQFB 3RTQA 2PPGA 3M41A 2LAGB 3ULUC 4HKPA 2W88A 1OCJA 1D3HA 3MS8A 3L3JA 1KTKE 5EBWA 2O72A 3HJZA 1A4KA 5BRZB 4TQIA 3OMNB 4Q6XA 4JZOA 2D9QB 2F8XC 2CU0A 2NV1A 2VR5A 3DHUA 1SDYA 4OJEH 4YBLB 4BI7A 3D85D 2C4FU 3TJEH 1VS1A 5EC1A 5F1IA 1Y5WA 4JB9H 4YHZH 3UG3A 4RNRA 4LOVA 3VZYA 4CVWA 3TPKA 5I0ZA 2JIXA 1HW6A 4QNWA 2FDSA 2HK1A 2VMCA 5E2VH 4NGHL 4OSUH 3KBVA 3AB0B 3ZDZE 3MJ7A 5AUMA 2DQMA 2WYSA 4N26A 3FSWA 4N0UA 2QCGA 1KN4H 2LGNA 4FTVB 3DX1A 3LNFA 4HIIB 2APXA 4PD4K 5CIPH 4XVJL 3VQ2C 4MDJB 5CD3B 3CUJA 1G43A 3MLVL 2JALA 2R2EA 1QWUA 1QHPA 8RUCA 1BJ1H 3F7RA 5ABZA 2XIQA 4AQAA 1UG9A 3WJLA 3ABQA 3S4TA 3EWDA 5CPSA 5DGRA 5F1UA 4AXWA 4NNPL 3IDMB 1KFBA 4A2EA 4RE0A 3L54A 1T1ZA 3GM8A 1QP1A 1ZDSA 2CCVA 1L0PA 2LE9A 4EUPA 5G4WA 3TSMA 3RA7L 1OD0A 4IMKC 3SQOH 2FX8H 4LB4A 1QTYT 2DSWA 2QSTA 3FNKA 4XCNA 3T1WA 1G4MA 2XWBA 4DYKA 3KWSA 2BSSA 1R7AA 4J3UA 4BQ2A 3IMTA 4E3TA 3R89A 1O12A 3WTTA 3MV9E 4X9YA 3V0UA 2QQKH 1W1YA 2D31A 2W27A 1J88A 4LP4A 3BESR 1VPOL 6TIMA 1UJ3A 1YNKL 4IS6A 2WCGA 4QRUA 4I18C 4O57A 1M7IB 2P28B 5E7BA 5ALCH 3WDRA 3LZNA 3LRMA 4MJID 2WLIB 5T3XH 1NCTA 4UFIA 4X2RA 1KCSL 4UT6A 3BZJA 4I9MA 1KCBA 1UA7A 1UC5A 1Y6MR 2NXHA 3D5HA 4Q58C 4YNYA 1XG3A 1S4IA 3FFDB 4GW4A 4XN8A 3GUTB 4HCLA 3CHRA 5KVEL 1V6VA 4I3RH 3QXTA 1ZIAA 2A4EA 3KVQA 4GKNB 4ZMQA 2YJQA 1ZTVA 1KTCA 1T22A 1NCWH 5CCGE 3D3AA 5IB4B 3O1NA 5KETA 2ZNXA 3PNWB 2BHUA 4PWGA 2NOYA 5FYKD 4M43L 1P4CA 1UJ3C 1WRFA 4ORGA 3RWDA 2FECL 4UZSA 5GZOD 32C2A 2BP0B 4Z7VE 1EZUA 1A6TB 2VN5A 4GIYA 4QXGH 1OBAA 1KT2B 4LUIA 2UBPC 3AICA 1G0DA 1DXIA 1NEUA 1X3DA 1YO4A 3MOAH 1BFSA 1A4JA 3MREB 3NJIA 4UU9B 3TNNA 1IM3D 3ZE1E 4KQ0A 4YIQA 1ITQA 1PTDA 5F6IC 1MFNA 1WZAA 4LL4A 4Z1DA 3STZB 2WLYA 5FB8A 5EH1A 3BP7B 1N5YH 1CI1A 1E0WA 1OAZH 2NSQA 4JG1L 2EDKA 4N0CD 3ATEA 3R18A 3CX5J 5ETUB 3UDWC 3ESUF 3O2DA 4CDGC 1FJ1A 2FL5B 2BS8A 2J75A 2VXQH 2YSSB 3THAA 2VL5B 3HE7C 4TSAH 3IIOA 1J5OL 4XUGA 4DJFD 5MF5A 4O58H 4M0XA 5ICZB 2NZLA 4HAFA 4D8AA 4HJIA 4PP1D 2R0LH 2OYLA 4X7TA 1VPOH 1BLIA 1CQKA 4RNHA 5BRZE 3ARRA 4N6RA 4MXVE 3T4YA 4J12A 5C0GB 5HATA 4GBXA 4IIQC 2EE2A 4EN3C 2Z91A 3CCHA 3Q3GB 4FG6D 5DEJA 4F8LA 1V6WA 1RP9A 4QT5A 3TURA 3QHOA 1TJRA 4UFMA 1UUOA 3EX4A 3CMOH 2POTA 3AU1A 3GB6A 3DO3A 3VXUA 3FEQA 2ICES 2WXDM 3PDOA 2NPLX 9PCYA 4HG4J 1FH5L 5IHHA 3RZCD 3KPOA 1E3XA 5FYJE 2INEA 3M0MA 2EDJA 3CMFA 1YLVA 1RK5A 4GFTB 1T21B 1TV5A 4ACPA 3MV7E 4LBAA 5HY9B 4YIWA 1S7SB 4A7TA 2IWGA 5D70L 4LNCA 3CEUA 3FRUA 4A05A 1Z5HA 3HC3L 1VEPA 4J6RH 4OIIH 1AI1H 4JY4A 3ZKXB 4DGVH 2L8AA 1NC2A 2N1TE 2OELA 5FM5O 3LMJH 1A5LC 2OJZL 2XH4A 4JQ4A 3NQBA 3OKEB 2JSFA 4NQEB 5DHYA 1F3EA 1FWEC 3OLDA 1ET8A 4KKZA 2WSDA 3X3FH 1JJKA 4AV4A 4MM1A 1J6OA 4FOKA 4FFVC 4OUIA 2PTVA 1VH7A 4OECA 3TF7C 4Y4FB 4HIJA 1A6PA 2I32A 1R3HB 2CBOA 3APNA 4MCYB 2KUTA 4YVNA 5E00A 4V1DE 2OYKA 3CFQA 3RGVB 3VYPA 2V2TB 2DPEA 1B90A 1PDKB 4JDBA 4QHMA 3ARFA 3W87A 4ONVA 3HZVB 3CNKA 2HX7A 3QSTA 3ZVHA 1MRAA 3MBWA 1UOZA 3O2LA 4AXNA 1KV7A 1ZT4B 2BOEX 2WMHA 7A3HA 4HISA 4KRMB 3ZE2B 2AZAA 3LQMA 4G80B 3M5YA 1IQDA 4FCHA 4NYLB 3CO8A 2NZ9D 2QVTA 1KM3A 3M0IA 2ARWA 2XA8L 2R1NA 3NR0A 5ECUA 1QBAA 4FNLL 1ZHBB 1Q6QA 4ZUSB 1THCA 2C3WA 2PCFB 4XPTH 3V0FA 2Q9OA 3X12A 3UWUA 2CK2A 1J5HA 2UZYB 1NCJA 2JELL 3BKYH 3EX6A 3W6MA 1UWEH 1RK0A 1UA3A 2OMWA 3CVCA 1OPOA 2Q6WB 3H2EA 1NUGA 5FA3A 5J1AA 5SV3A 3W3BA 5IIEA 5D7IE 2V2WA 3EADA 1TO3A 3LKNA 5IW6A 2CC0A 1I8KA 1IEXA 2OQHA 2KZKA 3U36B 1LE5A 5BO0D 4U1KA 3MUJA 3CGTA 1A14L 1W9UA 1QQDB 2CDFB 3GUGA 3GDMA 5AVSB 1RA5A 5DMMA 1VF8A 4I9XA 1P7KB 5HGBB 1QVOA 2X2UA 3EFFB 1G1YA 5BOPA 2MKWA 3CXHK 1AZ2A 1DE6A 4BK5A 2UWEA 2JF1A 2Q76A 3JVGA 2HP4A 3SE4C 2QJHA 4GMEA 1QPOA 2B7OA 4P23C 3QO1B 1MPAL 2WXRA 3MOQA 2H3KA 2Y3AA 3PG8A 3CFEB 3RUGF 3U0TA 4ENED 3TF4A 2IG2L 4F27A 2B8OT 3SBPA 1M2VB 5CD5D 4IZGA 4X9SA 3U5YA 3V0VA 1INDL 4FXKC 4MXQC 1FHDA 1A7OL 1HOEA 4RWYH 4O1AA 1ENUA 3PIQB 3IDMA 2XV3A 3TYUA 1ZMYA 1RY0A 1P7HL 3LH2H 3ZGIA 2DJSA 4LSSH 3KBHE 2BFVL 2OA9A 2R39A 4RX4A 4U1IB 3RDTD 3F7KA 1GTNA 1Z7AA 2WQUA 4WSGA 1G7IA 1UM6H 1YPZB 2UYLA 5IKCB 2DZUA 3KS0J 4N5ED 1E5JA 3I10A 1WEJH 2GAZB 3G04A 1YBQB 3HPLB 2GG1A 5BW6A 2J8UB 3EH4B 3JV6B 1LD9B 4YO0A 5GJTH 3QIUB 1DCLA 4AQ8C 1VBRA 3DXIA 3QVQA 4QG8A 1ZLSL 4WOQA 2IJ0C 2N0MA 5DWUL 1NF7A 2ARJA 4UTAH 4WDIA 1L6PA 2CLIA 1BBJA 4H01A 1N7KA 4N8CH 3SRHA 3ZJ6A 5JZ7C 1S38A 1BSLA 2FZNA 4FO4A 2VERA 3R12A 4RMQA 3FFCA 4J6RL 5FYJH 4BBWA 3FQTB 2DZTA 5AVZB 4MWAC 3NO1A 3P6LA 4M7LT 2VSMB 3ES7A 4WFHE 4JFED 5TQ2H 3QK0A 3JU2A 5CAHA 3O6DA 1G01A 1AO7B 1W8GA 2W5PA 1CGXA 5EWIH 4M4RA 1MHPL 4U1JB 4D9RD 1U3HD 3MSDA 1LG1A 1SJAA 3SECA 4JDEB 4TV3A 4JVPA 2ZUMA 4Q4PA 3SGGA 4NENA 2IH3A 5LGJB 3SKJL 4FX7A 4AHOA 2Y3NA 3BRFA 1R30A 4YLQT 2J7FA 4AY0A 4MWAD 5E09A 2Z1SA 1MLCB 3QWOA 4M3HA 4UQ9A 5TAOA 4CQ9A 3WFZA 4LBSA 3PABA 4X7TB 5JIDA 4HS3A 4I1PA 5I1HL 4ALDA 5JZ7D 1NGWA 3RB7A 3MFGB 4DK3A 2Q2EB 4NZ5A 3CO4A 4LLVB 3W26A 2YDQA 5I1KH 1JPKA 3SADA 4QAIA 4XBKA 4TSAL 3CFJA 1RZJC 2NY4B 4MJIA 3ITGA 2DQEH 2JTYA 1U3HA 2WXHA 3TBVB 2I24N 3U2JA 1E0UA 1ZHKB 1JHKH 2F7QA 2Y63A 3BUVA 1TMHA 3HE6C 4FIRA 5B22A 1WZKA 3EYOB 3RBGA 4X4YA 5MEQA 3K8LA 4N90D 1GW1A 3NA9L 4JRXE 1EFQA 3C60A 5IJBC 3U7YL 1XYCA 3GFYA 3CVHA 3R8RA 1LEKB 1WITA 3CZFA 3P0GB 2YPIA 3BQUB 4G83A 1GOKA 4NAQA 1YEGH 3UJSA 4M43H 2V68A 2UVFA 4XNYH 2FSEB 5H2ZA 2NNAB 1NGZA 3SGEH 4C56D 2KLSA 5H4ZA 1EQPA 2J4GA 2WCAA 1YMHB 2DLFH 1NC4D 2X1XR 2Q7YA 3CDFA 2J47A 2F8OA 5D6DA 2Q02A 4A2FA 1PS3A 4HPXA 3CX5K 1VFAB 4W93A 5BS0D 5KVEH 1EJUC 3MBED 4OLVL 1W8SA 1YY9C 4NKOA 4LKCB 3R13A 4NKCA 5SWSB 4AIZB 1IBHA 3NSCA 4JMXA 3C5XA 1GJPA 1DANT 1K6QL 5L0QB 1W3JA 4WY0B 4K38A 4M1DH 3KM2A 4LVHC 5LA1A 1QEWA 1HIML 1YNKH 2DIAA 1ZK9A 3BAXA 4X6CA 4HHGA 1LUCB 1V8HA 4GQBA 4WKZB 4WUKH 5D55A 3A21A 2E47A 1E72M 3ABLB 3FONA 4HJSA 2NQ5A 5ACZA 3V52L 2H0PA 5H8DA 3EHBB 1XYLA 4B27A 1H11A 3QNXB 1C8PA 4D8LA 1E55A 2WN2A 3VXUB 4YK4C 4PRPE 5CJ5A 3K72A 1J1PH 2H9GA 3LKQB 4JDVA 3WEXA 3NIYA 5CINL 3CL8A 4QO1A 4LF3B 1P4IH 4P46B 4XOAA 3TFBA 4RW3A 1NGYB 4NNPH 4ANXA 3T4YB 2WV3A 4JFFA 3MYPA 4I5BB 4ZUUB 3V18A 1C92A 4HCRL 1O95A 5D2LE 3MFFA 3MLZH 2X7LB 4F9PA 3SCOA 3SE9L 1FQ0A 2Y2TA 3NA9H 3TR2A 1LD9A 4YO0B 1TQTA 4K3JL 3T8XA 2VRAA 3MLYL 4LAMA 3Q6FA 4N2AA 3DIFB 1CBVL 2NY2C 3GSRB 4HGKC 3O6YX 5A8PA 2F58L 2VFGA 4IX0A 5CSBA 3ZO9A 5IESH 4ZBCA 4BSWA 3UAJC 3B0XA 1UCBH 2R1WB 4OZFH 3CC1A 5BU9A 3BFOA 2CNYA 3BE1H 1KYAA 1MCLA 5D1XE 3OKMA 3RMEA 3KS0H 2J5WA 3UVIA 4J1UB 4HUWB 2J6EA 2PXYD 5B80A 2Y7QA 1A7QL 3MGOA 5BQ7B 1RMFH 4P06A 4ORGB 2G9KA 3FB7B 3L0NA 3WI9A 3NACL 2EDLA 2MFNA 2F0CA 3CLFH 3GTFA 3VWJD 5DRIA 1IM3B 1TPXB 1JGEB 2ZOKB 3SE9H 4J5VA 3QJFA 4XSLA 3ISRA 4EI5A 4BR1A 2ZOTA 3ARFD 4Z7OE 1C1EL 2NY1D 1TO5A 1ZEAH 2QTVA 2IMNA 2ZIDA 3EWXA 4RMRA 3II1A 4G8EA 4JPQA 4Z3TA 2RDXA 5F1VA 2WZPA 1P4IL 3MNZA 2JQAA 5T9BG 6ALDA 3PLYA 5EWIL 2C3ZA 3EKGA 4WHBA 3RLGA 1U6AH 2AAVA 5MKGA 4O0ZA 2VLLB 4DGIL 4IISA 3GVVA 3HC2A 4HWBA 5MP6H 1XM3A 2WWCA 1YMMB 1TWDA 3GC5A 1BFTA 1R3WA 1Q38A 3D2TA 3SM0A 1Q8JA 4Y5VB 4I77L 1N5AA 3QDMD 2ZP8A 4S1SL 5FKPA 1ZVYA 4Z1BA 5KTLA 2DQCL 1XIWC 4S1QH 3TK7A 4Z23A 4P8XA 3NCXA 4ZO7A 4R7JA 4PVLA 1S3KH 4C90A 4G8FA 4PJ8A 5DLML 4FPSA 4OM0H 1GRWA 1JDDA 2ZKWA 1NCHA 4JHVA 2GGGA 4J8RA 3STLA 4LS1A 5TQLA 5J1SC 1GTHA 1LQAA 5HGGS 2GEQA 1PLCA 5AW2B 4YGAB 2XKNA 5GGTL 4AEIH 2HVJB 1OTSC 3PWUA 5C7XH 3FQUA 2E5CA 2QSQA 4L6HA 4YXLL 4ATTA 1AQ8A 2W9MA 1P1ZA 3UIZA 3VJ6A 4NN5C 3ABMB 3MUZ1 2AANA 4YBQD 2XIOA 3VXUD 3S48A 1XBXA 1N4XH 3NJFA 5IJKA 1A9EA 4LLUB 5EPDA 1JWMB 1UA6L 3JYBA 1IKOP 2G3FA 2NVAA 4H9YA 3GJFK 4Y7MA 1QPNA 1F6AA 4JQXC 1BWWA 1NEZA 2CKRA 2PTXA 1RURH 4LX4A 4QJ1A 4UBPC 3LQGA 5TD4A 2K0RA 3DARA 5IQ9B 2WZTA 3ARDC 3MMDA 4ACZB 4HS3B 1INDH 4ODTL 3F05A 5L2KE 2ZDRA 2YAOA 5TE7H 1HQRA 3SPHA 1GCFA 2L4OA 1A0EA 4X6DF 1YKWA 3GIQA 1QNSA 3RWIA 1SYSA 1TQSA 3NZUA 5HHNA 4O8RA 5SV4A 4QOKB 1P7QA 3RNQB 4F7CA 3ARQA 3MLUH 1GVOA 1I4FA 1QRNB 3S7GA 3F12B 3BOFA 4QXTB 2V17H 4WK2B 3LEXA 3S34H 4MNLA 2PS2A 2V5LA 4OY9A 1P7TB 3ALWA 1X97A 2CH8A 4KU1A 3ZX1A 1KFAH 2ZCKH 3BWAB 4RGMB 3BP5A 3KPQB 4I2XE 3BYTA 4PJ7B 4PJBA 5C09A 5JHLH 4LCIH 2Y1YA 1WDWA 3WH8A 2ZTBA 5AAMA 4BQ8A 2BNQA 2X4QB 4RDBA 1PAMA 1UXWB 1OX6A 3X14A 4I9AA 1TJ2A 4MJ2A 1CXKA 1OF0A 3B2MA 5HHOA 2OJEA 2OT0A 1RZ8B 4LF1A 1JZHA 5DUBA 3DHPA 4JRYE 3NVQA 1NCGA 3RL1B 4KTEH 3RF9A 2P0IA 5D1XB 1Y07A 5KYYB 1WP6A 3T6ZA 4DN4L 2JB5L 5EC2A 1SLVA 5FOBB 2ARJB 4MB3A 3DSNB 3C5ZD 5EIVA 5IVXF 1MHPH 4A22A 1XGRB 4JZNA 2YFNA 4U6VL 3W1XA 4PH8A 5D8WA 3MCLH 2XPGB 2BNQD 2EKSA 3QORD 4ANUA 2WINA 4Z7OB 2FIQA 1PKQB 4IU3B 3P9LB 1XG4A 1JSYA 1PKYA 1LWRA 1SXZA 3K3QA 3VVVA 1SR9A 3KJ6H 1A25A 3BG3A 1JP5A 5GZOA 3HRPA 3O2DL 1XIEA 2VR2A 3FT9A 1IBFA 4IJ3C 4UIKH 1LYXA 4HUUA 4ERSL 1UP3A 2OB3A 4FJZA 3UWZA 3AXHA 5IOKA 4PJHF 5A7EA 5M5DA 1OVZA 1G7JB 3WDIA 3GLCA 1MJUH 1GOHA 1XEUA 3IGFA 3THMH 3W57A 1AYRA 3B0VC 1KJ3L 3UG8A 3C3UA 1U3HB 1QD0A 1FXPA 2ZQ0A 3RR4A 4PCNA 1U8IB 1WISA 2FHFA 3VXGA 3XINA 2NY1C 5AW7B 2PF8A 4AC4A 4GXWA 3SIMA 1PHWA 4NYYA 3RFAA 2NVDA 4EI5C 5D1ZA 4PP2B 4ZOEA 4C65A 4KHXL 3QY6A 1AI1L 1TWZA 2OX4A 2OK0L 1AHWB 5TE6H 1J9YA 2AJ3B 2Z6FA 4KKAD 4Y7OC 2VKZG 2FGWL 3VFVB 3V5CA 5D70H 3HS0A 1O6VA 4N24A 4GAYA 4BWWA 1T99A 2OTUB 4JTLA 1TUFA 4XWOD 3CDYA 1SR0A 1TG8A 1H4PA 3UBHA 4Z7WF 4G42B 1K5NA 4OCSH 5CSYA 1PNCA 2VM9A 2WWMD 2OR8A 4H8NA 3KXFD 5I6LA 1WPCA 3DRQA 1RAMA 1QZNA 2AKZA 3F7YA 3HG1B 2J88A 4LBRA 2VDOL 2YZ1A 3VI4A 5IZ7A 1WBYA 2KQNA 5AVTB 3MHFA 1OAYL 3NOEA 2AK1H 3PP3K 2VW7A 4IM4A 3A4JA 3JUZA 1OE2A 2QPDB 3A67L 4KK6D 4YDZA 5FO8A 4L9XA 2E1DA 3FN9A 4LCYA 2A9NH 9XIAA 3WJMB 1K2DB 4JTJA 3A6CL 4P5TB 4LU0A 4C57C 3ESMA 3QFJA 1EP1A 4FX6M 1KV3A 5F3HA 5FGCB 2H26B 2C4XA 5HI3C 3P62A 3GO1H 4WUUA 3P3SA 2HSAA 1XGZA 4M02A 4XVEA 4C6LA 5JHMA 2Y62A 2F18A 3S2NA 3UZVA 1FNEA 1I9RL 4LVOC 4JG1H 4KRPC 1SZEA 3MRPB 3QV7A 4D9PA 2LU4A 5CHNA 2ZF8A 5KITA 1VYRA 3SN4A 5T1MA 4DBEA 1QW8A 4JY4B 4QG9A 5IBTL 5J7CC 4ZSUA 4PBFA 1VGEH 2WWKT 1DQLL 3QXAB 4FTVA 1IWAA 4S0SD 1KM4A 1QK0A 5F96H 1W72B 3QS2A 4YPJA 5PAZA 4QCIB 3X17A 4PFMA 4EP8C 2JFCA 3V0GA 3H22A 1P7QB 3UERA 3DKLA 3LZLA 4N2OA 5GPRA 5BXTA 3MO7A 3SRDA 1IZCA 4CCCA 2HRPL 3I9GL 3GNOA 4F2MB 2PDUA 1YAZA 2PO6D 2V63A 25C8L 2IPTL 2ZCHL 1IE5A 4JY5L 2PGRA 1PXGA 4UT6L 6PCYA 1W1A1 2F6XA 3BHBB 2VLRD 1ZAHA 5AHLA 4HNOA 1GQKA 3HMCA 4BWLC 3QCVL 4NJGA 1E67A 2OL3B 3NDZE 4W85A 1KCSH 4DP4X 3T6VA 3H7LA 3PWPE