4J27A

Crystal structure of a gh29 alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in a novel crystal form
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase
publication title Three dimensional structure of a bacterial alpha-l-fucosidase with a 5-membered iminocyclitol inhibitor.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 163
structure length 439
sequence length 439
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4j27A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4j27A01
3NSXA 2VRKA 1C90A 3VDAA 3SUUA 3VKKA 1W9PA 1MQRA 1DWFM 2YBTA 2EBNA 4CD6A 1JZ3A 4CVUA 4WSJA 3BUBA 3PTKA 2ZX9A 3A22A 3FY1A 4AZIA 4PN2A 1H49A 4NXKA 2OW7A 3D50A 1E40A 3ARYA 4UOJA 1E0VA 2F7QA 3UESA 4U5KA 3PHAA 4IPLA 3ZT6A 4JFSA 1HKIA 5E6YA 4P7RA 2ZUTA 3CUIA 3W26A 7A3HA 2OYKA 2WLYA 3BH4A 3ZJ7A 1E3ZA 2ZUNA 4OUEA 1QX1A 1US3A 1V6WA 4UFIA 2Y8VA 3VINA 4GZIA 2J77A 3PZNA 5HPCA 1ZS2A 4CD7A 4E4PA 1ZBWA 1R33A 1K9TA 3VGHA 1SYTA 5AC5A 2WMIA 1A47A 4F8XA 2FYVA 4IM4A 5EFFA 4GKLA 3AJ7A 2EPOA 2J75A 2ZICA 1B1YA 3HG3A 4RE4A 1UKSA 4OOUA 4S3KA 3D52A 1EDTA 3PTQA 1UWSA 2WHLA 3EDFA 5A6JA 4TVCA 1FFRA 3VD4A 1CEOA 1W1TA 1JXJA 4W5UA 1GOIA 1YHTA 3EJUA 2X05A 1PAMA 3AZRA 3ARZA 1HVXA 1OGGA 2OW6A 4C7DA 4LYPA 1HIZA 6CGTA 4F79A 3CZGA 4NF7A 1GVYA 4QCFA 3LXBA 4HZ7A 3NIYA 3GNPA 1W9DM 2YLLA 3T0AA 1WPCA 1EO5A 4V28A 5DT7A 2Y5EA 1V03A 4HOZA 4NXSA 1UD3A 1EHAA 4IISA 5D8WA 8A3HA 1JZ8A 3WD4A 5A95A 4X9YA 1TQVA 3WQWA 3VPLA 4GI6A 5IFPA 2BY2A 2D0GA 2GSJA 4A3HA 5A6KA 4AYSA 7CGTA 3VGFA 3MS8A 3WMBA 3VD7A 4BS0A 1E72M 1NP0A 4KGJA 1EQCA 2OWCA 4UQAA 4D1IA 1BYBA 1KCLA 2DSKA 3WY2A 1SMAA 1MFUA 1CLXA 1RD6A 1GJWA 1I75A 2D24A 2GJPA 3WNPA 3GDBA 3WMSA 1IZKA 2D3LA 3WNOA 1ZBVA 2A3BA 1DWJM 3I3DA 3TTYA 1VEMA 1SR0A 1CLVA 1E4IA 3H53A 1LLOA 1JYWA 3ZSTA 4UCFA 4BQ2A 1NQ6A 3RCNA 5I77A 3KWXA 2J7BA 2CIPA 5BROA 1E73M 2WXDM 2WBKA 5C71A 2DH2A 1M53A 4W93A 2J7FA 1AMYA 1J01A 5M03A 2AOSA 2E9LA 2UY3A 3W37A 3OG2A 1MWOA 2F1BA 4JKMA 1XYZA 1GOKA 2IUZA 3KL5A 3UEQA 3ZIZA 2YIHA 4QDMA 3GXDA 5FKYA 2IGTA 3E1F1 3AI0A 2VCAA 3GXIA 3VIPA 4ACZB 4JHOA 3TOPA 4GXPA 3ALGA 2BS9A 4PMVA 5A6MA 1MXDA 1NOWA 4M8UA 3UERA 4QFUA 4WJXA 2X1IA 3I3BA 4AMXA 1UWQA 2JALA 2YFOA 4ACZA 1W9VA 1EIBA 1C7TA 1BYCA 1V0KA 3M07A 1E3XA 4X0VA 3FN9A 4ML4A 2X2YA 2EO7A 1QWUA 1XSJA 2OWXA 2XFYA 3MUIA 4UZUA 2YJQA 2ZWYA 4OIFA 2JEPA 4MDOA 1NP2A 3N18A 1VENA 4OBSA 2ZE0A 1QHPA 3PTMA 1V3IA 4BQ3A 4TX6A 4DWSD 1YQ2A 4CKQA 1GNXA 3AMLA 4MB1A 4PTMA 3UR8A 5CPTA 4BQ4A 4MB4A 3BCFA 2XFRA 3WUGA 1GORA 5EBAA 2JEQA 2BY0A 2VC9A 3OZOA 3AXHA 2D22A 1E4MM 1NWRA 2XWEA 1QNSA 1D2KA 4NI3A 4IPNB 5C8BB 3BVXA 3QR3A 3QHMA 4AZ7A 5E0CA 3LRMA 2XVNA 1HWWA 4HPHA 4M1RA 5A6BA 4GZJA 1V3KA 1UH3A 2O9OA 3AS2A 4JFUA 3CH9A 2XIBA 3CZSA 5TD4A 3AXIA 1B3ZA 1B3XA 3GH4A 3A4AA 1J12A 3DX3A 4PMUA 1QW9A 5ABHA 2WAGA 3HZ3A 3CZEA 4DO5A 4W84A 2VR5A 3CHCA 1J0YA 1HJWA 3KE0A 1CXHA 3AIRA 3GNRA 4FLSA 1NOUA 3CTTA 4PTWA 4CU7A 2WMFA 2DPEA 2UY5A 2Z1KA 1XH0A 2O92A 2NSXA 2DT3A 1V02A 3NUKA 5CJ5A 4HU8A 4UQ9A 3KZSA 3QOKA 1EQPA 3AMCA 1TA3A 4RE3A 4W8AA 3L4YA 3S2CA 5FOOA 2ZX8A 3WH5A 3TA9A 2F8QA 1UD6A 3UG3A 4BCEA 2XVPA 1J0KA 1UASA 3RJYA 2O9RA 1B0IA 2V5CA 2F61A 2UY2A 2D23A 1JFXA 5HBFA 4UFJA 3AIEA 2CBJA 6TAAA 4U3AA 3BAWA 3QGVA 5A8NA 1ODUA 1VEPA 2V3FA 5BWFA 1P6WA 4NZCA 2EADA 2HVMA 4AWEA 3NSNA 2O9PA 3GXPA 1VFOA 4HP5A 2ZUWA 5CLTA 2JF6A 1GOOA 3VOCA 4V27A 2E8ZA 4HU0A 3SUTA 3CIVA 1F4AA 2VT0A 2XN1A 1K9DA 3VIOA 5LA2A 4TUFA 3CPUA 1HF6A 1JF5A 1LL6A 2A3AA 3ZT5A 2J62A 4B9YA 2WPGA 2WMJA 3VO0A 2A3EA 3J7HA 1TE1A 2PF0A 1WO2A 4XV0A 3SURA 1CTNA 4EANA 1JYNA 3W27A 4WSKA 5DFAA 2F1AA 3VMNA 1W9UA 2ESCA 5HDRA 1VFFA 3N1AA 3LPPA 3EMQA 1W1YA 3GH7A 1TQWA 3T08A 4HZ6A 3DYMA 4H8VA 2G8ZA 1KTCA 1S46A 3T09A 2FHFA 1QI2A 4HMCA 2C7FA 4J3UA 4PUEA 4HOWA 4ZE5A 5GPRA 1U30A 2CERA 2BXYA 4Y7EA 3W38A 1CGVA 4M81A 1HKMA 1NH6A 1B30A 3M46A 4ZEPA 3W25A 1JZ2A 3MO4A 1JDDA 5FCZA 4TXEA 3RPMA 4D6GA 2BHZA 2W92A 2PBOA 1B2YA 4P7OA 4W8BA 2GJXB 2OLHA 1XH1A 3CHDA 4A4AA 1RPKA 1ITXA 5LA1A 3WFZA 3BCDA 3VU2A 2PI6A 3MV11 4JKKA 4MPKA 4PMZA 5I2UA 2PWFA 4C7GA 4TTGA 3D5HA 1UA7A 4JHZA 3WDJA 1VRXA 3CLWA 2DDXA 2QV4A 1E5NA 2CKSA 1WZMA 3LPGA 4PUDA 4WKFA 2XGBA 3ARPA 4Z2KA 3MKKA 4PMNA 2WVSA 2XG9A 3AHXA 3VVGA 2YL5A 1R47A 2VNCA 2BXZA 2NT0A 1FH8A 3EMZA 2J74A 4JCLA 5C70A 4NRSA 1G01A 1UR9A 4B16A 1JD7A 4U5IA 1ISXA 4J3XA 3VIKA 1NOFA 3LXCA 2D0HA 1J10A 3WBEA 1UD4A 2G3JA 4AEEA 4W86A 3SCSA 1AQMA 1UQYA 1EGZA 3WDHA 4L4PA 1FA2A 3SCNA 4OBRA 4AC1X 3EJRA 3DX4A 3SCWA 2QHAA 1CXLA 3NDYA 1LL7A 3WEOA 2WC7A 3W28A 5A6LA 3NDZA 1PZ3A 2WSKA 1QVBA 4HZ8A 3H54A 3JUGA 4DUXA 1MYRA 1CXIA 4D72A 2XIIA 3DECA 1LG1A 1B9ZA 1K9EA 6A3HA 1FP8A 1HTYA 4S3JA 1SZNA 3I3EA 3VGGA 3MV01 1BF2A 3WY4A 4Z2JA 3BAXA 5I24A 1E4LA 3GXMA 3PZIA 4MADA 2WC4A 1H0IA 1ZJAA 4D6EA 5JBEA 1LF1A 3MSDA 4H04A 2OSWA 3MSGA 2IXVA 4PYSA 1UD2A 2OYMA 4M82A 2JF7A 1RP9A 3A21A 1SMDA 2F7RA 1US2A 3VGDA 2ZX5A 1OM0A 3NSMA 3BLPX 1Q6FA 1V3MA 2ZXDA 5JBFA 2TAAA 1WKYA 3APGA 3PZVA 3CMGA 3TTOA 1JNEA 3ZQ9A 1M03A 2QF8A 3WNKA 3TONA 3RDKA 1C8QA 3LRKA 4M56A 2DT2A 1OGBA 2W63A 2WHJA 4DWSB 3PBGA 3VUPA 1V3JA 4LYQA 4Q22A 4QLKA 2BVYA 3CHFA 5A3HA 4MNKA 1QNRA 4B9ZA 2XTKA 3BLBA 4RE2A 1I1WA 1Q4NX 2EJ1A 1FOBA 4ATDA 4DWSA 1KQZA 3WUFA 5CPSA 5A6AA 3A24A 4XZWA 4JFWA 4UR9A 5BRPA 3CGTA 3BLKA 4CGTA 1W9BM 1CGXA 3BUPA 1ITCA 1JZ7A 2ZXQA 3POCA 3MMDA 3WH9A 2CNCA 3ARUA 1TG7A 2J7EA 2QLYA 3SUWA 4AIOA 4WIWA 3AIWA 2VURA 1CGTA 1OIMA 4F9DA 3DDGA 2VX6A 5A8MA 1WZKA 3RJXA 4DUWA 2D20A 1TR1A 3AMKA 3BUDA 4PTXA 5D9OA 3VD9A 3K8LA 2E8YA 1C3FA 1XD1A 3NCOA 2E40A 4FK9A 3ARXA 3VDCA 2NT1A 1V3LA 3SIMA 1TFVA 2EPLX 3OZPA 4NZJA 2J7HA 1KGWA 1MW0A 1L0PA 1HT6A 1BGGA 1HJVA 3WMCA 1KQYA 4P7NA 3CZLA 2WBGA 4KRUA 2ZX6A 3F5LA 3F5JA 1EA9C 1HXJA 4MJ4A 2ZXBA 3BSHA 4Q7NA 5A69A 4J28A 3AICA 1UWIA 1H5VA 2CETA 3F4VA 1E1FA 1WB0A 3TTSA 1KWGA 2G3NA 3II1A 2CCRA 3O9NA 1J0ZA 1E55A 1NARA 4MB5A 2A3CA 3ZSSA 1RH9A 4XB3A 2FHBA 3NYDA 1J9YA 3AYRA 3MI6A 1E6ZA 1E43A 4D6HA 2ZWZA 4MNJA 3VIFA 4LPCA 3ZJKA 4EAMA 1OD8A 1PZ2A 3D51A 2BY3A 3GXFA 3WFLA 1MFVA 3W82A 4RL3A 4W7VA 1UZ1A 3PZUA 2WCGA 3WY3A 3WNMA 2BVDA 1I1XA 2G3IA 5E70A 5D8ZA 2PB1A 1C93A 3ZJ6A 1LWJA 3WDIA 3B9DA 3RMEA 4P8VA 4KWUA 1ZU8A 2MANA 1JXKA 5KEZA 3FHQA 1TCMA 1EXPA 1CBGA 2YA1A 4C7FA 4U2ZA 4JL2A 5ABGA 3CC1A 5DF0A 3AHVA 4GQQA 3HG4A 1UR8A 1GOWA 1VJZA 2X09A 5CLWA 5IXEA 4AZHA 2D3NA 3WF4A 4U3CA 2E9BA 1V0MA 4FNUA 5IHRA 4R5EA 4QAWA 1HP5A 2J8FA 1GHRA 4Z2LA 4HMEA 3UG5A 1MVYA 5E9AA 3ZR6A 2F7OA 4M24A 1UKTA 2XM2A 1UQZA 3TP4A 2CXGA 1NWTA 2VRJA 5AC4A 1W1PA 3ARWA 5CSUA 1HKKA 1C8XA 2YFNA 3OLEA 3OLGA 1CIUA 2EACA 1GONA 2WWDA 4QLJA 4J3VA 5KZ6A 1XHGA 5FL0A 4JIEA 2BNJA 1V6YA 1HKJA 1G94A 2J8GA 3LMYA 3U7BA 1V0LA 4JFTA 4FMVA 1VEOA 1TQUA 4Z2IA 4D1JA 4JAWA 2WMGA 4TX8A 1QNQA 1JDAA 1QWNA 1PBGA 2GK1B 2VRQA 4J27A 2DT0A 2J47A 2WCSA 3H55A 3PZGA 1JF6A 2GVYA 1O7AA 1E9LA 1BAGA 2VX5A 2WSPA 2VI0A 5AYIA 2XVLA 3ZR5A 3M7SA 2GK1A 4PSRA 4FNQA 1M04A 1Q6DA 1CYGA 3T2QA 3GTNA 3W24A 3KL3A 5BXSA 1QI5A 3WF0A 3PZOA 4UOZA 3WEMA 2WVVB 2A3HA 3WF2A 4B15A 1MQQA 1JAKA 1QW8A 2CBUA 1PX8A 2EQDA 4XUYA 4PMXA 3PZMA 1PJ9A 3U5YA 5IHSA 5IFTA 3VSTA 1VIWA 3WKZA 3OGVA 3VGEA 3CUGA 4Z2HA 1FH9A 3PZQA 3VIJA 2DSZA 2J7DA 1JGIA 4DM2A 1OT2A 5JIWA 1W2PA 3DHUA 1JYXA 1X1NA 1UH4A 4TOQA 3IJ8A 4UFMA 1W3KA 1ZL1A 3WD3A 3MMWA 4P8XA 1XD0A 2WM0A 3ARRA 3IJ9A 2CESA 2GUYA 1VB9A 1E4NA 3T0BA 1CWYA 4GO8A 1QBAA 2AMGA 1UD8A 3THDA 2PWEA 4M80A 4AD0A 5BXPA 2E0PA 1UWUA 1XC6A 4JKLA 2D1ZA 4PCTA 4B3KA 1GJUA 2YA2A 5ABFB 3A47A 2EPKX 2D73A 3OA5A 4GZEA 3GBEA 2BY1A 3S5YA 3FHAA 4D71A 4CCDA 5ABFA 1CZ1A 1BYDA 3W4RA 2JE8A 4OZOA 4YN5A 3EDJA 3WENA 3AROA 3N13A 1H4PA 2ZUVA 3T2PA 3AMGA 4DO4A 2XYLA 4J3SA 3QHNA 2PBGA 1JZ4A 2C8NA 4PMDA 1HL8A 1BSIA 3EYPA 3WSUA 4FNTA 3KLLA 1MW3A 1CDGA 3FNDA 1WDSA 1K6AA 3AOFA 2PWHA 3GM8A 2VZOA 3VDHA 3L2MA 4W8LA 1UYQA 5HOSA 3ARSA 3CBWA 2XUCA 5M17A 2OYLA 5D4YA 2RGLA 1QHZA 1WDRA 4KH2A 1WZAA 4OKDA 3KL0A 1HXKA 1T0OA 3AHTA 4NSBA 1HJQA 2VMFA 4P7QA 2XSBA 1R7AA 5LYRA 2DSVA 2EXOA 3ECQA 1GQJA 3WBAA 1V6XA 2QPSA 2VVSA 1PEZA 4AY1A 1HL9A 3MU7A 3VDBA 1QI4A 4PBGA 4WF7A 3BMVA 4U2YA 1UD5A 3OB8A 3N04A 3T0DA 1B3YA 3WQ4A 3WDRA 5JUVA 2DEPA 1W3LA 1GQIA 1E5JA 2RGMA 1X6NA 2YDQA 1U2YA 1BVNP 1JFHA 1KXVA 5E0FA 3RILA 4UFLA 1W1VA 1BGAA 4OGZA 1JD9A 4J3TA 1HP4A 3G6LA 1E6XM 1OSEA 3CO4A 3CZKA 2CBVA 3AS3A 1JI1A 2YBUA 1OB0A 3SEPA 8CGTA 3RM8A 2W66A 3L4WA 5E1QA 2BHYA 3VX1A 1R87A 1EO7A 3BMWA 1RP8A 1KBKA 1E15A 2X0HA 1B31A 3L4XA 2YA0A 4ATLA 1KR1A 2BVTA 3IAPA 3WL1A 1W3JA 3SCQA 2XPKA 1HX0A 3LPOA 3A4WA 1KBBA 4PRWA 3BC9A 4UFKA 2GJXA 2QMJA 4UOQA 4AD4A 2XN2A 7TAAA 4E8DA 4HTYA 1WP6A 3AYSA 3BVUA 4UTFA 1R85A 4JL1A 1ZBCA 3WQ6A 3BSGA 5CGMA 1E6QM 1GQLA 1SFSA 3VSVA 1EDGA 2OSYA 4UQDA 4ACYA 4N0RA 1V6VA 5A94A 1B3WA 1Z32X 2EEXA 4LX4A 1HN1A 2XVKA 3IK2A 4PTVA 3ALFA 2WVTA 2J7GA 4FLQA 4NRRA 4W87A 4WK9A 4DWSC 2ZUSA 1G5AA 3RIKA 3ARVA 3HG5A 2WW5A 2J4GA 2PC8A 3WUEA 2WWCA 2F2HA 5I0DA 5I6SA 4MAZA 3N11A 4N42A 5A2CA 3OIHA 2WYSA 3WUBA 3CUJA 3AHZA 2V5DA 4P8UA 2AAAA 5I5RA 1H2JA 1UHVA 3ZT7A 2DT1A 5ABEA 1UKPA 2PWDA 5A2AA 4L4OA 3A6OA 3L4VA 3EBVA 3EJQA 4B3LA 4OOZA 4AISA 3DX0A 2XSAA 1NWUA 4PSPA 4KRTA 1GCYA 1KR0A 3SCUA 3K8KA 2G4FA 1E6SM 2W62A 4CD8A 4F66A 5A6SA 4MDPA 4H41A 4P7LA 3WQVA 2VTFA 4AD3A 3WH7A 4FLOA 2DGAA 2CEQA 2YDRA 2D0FA 3SCVA 4J3WA 4CN6A 2ZIDA 1LG2A 5D9PA 1U33A 1GQKA 4ZXOA 5D9MA 1FFQA 1CNVA 3ZM8A 9CGTA 3K8MA 1ZJBA 2D2OA 4EK7A 4TVDA 1KB3A 1C91A 5GNZA 2WHMA 1HJXA 2DH3A 3WNLA 1ISZA 1HJSA 4CU6A 1W9XA 1E6RA 5E09A 2XFFA 1ZBKA 2O9TA 1VJSA 2EAEA 3CUFA 1E6NA 2CITA 1F4HA 1FHLA 1UUQA 4AEFA 1MXGA 1ZB5A 2WZIA 1TQSA 1E0WA 1TZ7A 2XN0A 3CMJA 1DTUA 1XV8A 2ZUMA 4AZ5A 3DC0A 4D6DA 4AYGA 3HN3A 1G9HA 3WY1A 1R8LA 3B8SA 2VCBA 2GDUA 3W29A 2OSXA 4LQ1A 1IT0A 2VJXA 1LJYA 1WAWA 3K4DA 3VNYA 1DWHM 3BUQA 4GI9A 2WMIB 1Q6CA 1KXHA 4GO9A 4QCEA 3WEZA 4EE9A 1KGXA 4OJYA 1WNOA 1XRVA 4CN4A 3AIUA 3AS0A 3RO8A 1LL4A 3AMDA 3THCA 2XM1A 1EOMA 5AY7A 3AS1A 2WKGA 3FAWA 2UWFA 1QNOA 4WLCA 4AMCA 1PIFA 5GNXA 1VFUA 1BHGA 3MANA 3ARTA 1XCWA 2X2HA 5EMYA 3CHEA 3VM7A 2ZOXA 2W91A 1MW1A 5CQ1A 2NW0A 3VIGA 2JIWA 3CZNA 3QOMA 4MJ2A 1KGUA 4HPGA 3VM5A 1GUVA 3MUY1 1TQTA 2XHYA 3U7VA 4E8CA 3PZTA 4XZBA 4YHEA 4AD2A 2V3GA 3VX0A 4WKHA 5HPOA 4GINA 4DO6A 1WDPA 4H7VA 4P8WA 3IGUA 4PEEA 4BA0A 1UR4A 1KXTA 3GYCA 4U33A 4MNLA 3AIVA 1BG4A 1CGWA 1WDQA 3GZAA 5LA0A 4W88A 1EH9A 1J0IA 1Q6EA 5AYBA 5DO8A 1CGYA 3K4AA 1E70M 3W53A 2VX7A 1PPIA 5A1AA 5IDIA 2WMKA 1DWAM 3A4XA 5A8OA 3WQ8A 1BVZA 4H2CA 5D9NA 2X2JA 4CN1A 4ZXLA 1OCQA 5CPQA 3N9KA 1WZLA 1JZ5A 3B9AA 4PCSA 1DP0A 2WMHA 3UETA 4HA4A 3K1DA 5CSYA 1AVAA 4JFVA 2V3EA 1W3HA 1UZ4A 3AISA 1XSKA 3DDFA 4URIA 3L4ZA 3FW6A 2VUYA 5I78A 3BUIA 1JNDA 1UWTA 2ZX7A 3L4UA 5CGTA 2J7CA 3MUAA 1OD0A 1QBBA 3SUSA 2EPNA 2WVUA 2C0HA 2VL4A 1ECEA 3LX9A 4AD5A 4EKJA 3WF3A 2W4XA 1LWHA 4AXNA 2WCAA 2DIJA 2PWGA 1QPKA 1UH2A 4UZSA 1GW1A 3RM4A 2X2IA 5I79A 3D4ZA 3DYOA 3B9EA 3VIMA 1B3VA 2GFTA 1DWIM 3AIQA 2CBIA 1IZJA 4A3YA 5M5DA 2JFEX 3BAJA 1BFNA 5E6ZA 3HU7A 4MB3A 4BQ5A 1BPLB 1G0CA 1V3HA 1JL8A 4AMWA 5BRQA 2WK2A 3U5UA 1VBRA 3SCPA 3UCQA 3U57A 5F7UA 4FNPA 4BF7A 2G41A 1UR1A 4HOXA 4R27A 1UWRA 1GHSA 1MW2A 4QLLA 3ZO9A 2HISA 4GIAA 1V02E 2DIEA 1AQHA 4ZE4A 1HVQA 3EDDA 4AZCB 2YDSA 2FDMA 2J25A 3LXAA 3AZTA 1Q6GA 4PMOA 1R75A 3BVTA 3VMOA 2WC3A 4ZFMA 3W6LA 4D6FA 5EB8A 4AZCA 3WD2A 1ISVA 2CHNA 3FXYA 2F7PA 3IANA 5FL1A 1DEDA 2GDVA 1D7FA 3W0KA 4Z2GA 3VNZA 3N12A 1OWQA 3VIIA 1OINA 1HJUA 4MAVA 4AZGA 4D6CA 2Q8XA 3WIJA 3WQ5A 3A23A 2W5FA 1H3GA 5A8QA 1R46A 1TUXA 2J78A 1H09A 4UNIA 4DM1A 2WLZA 3BVVA 2XJ7A 4HA3A 1E71M 3UG4A 2VO5A 4AIUA 1XCXA 3S5ZA 2Y8KA 3GBDA 2VOTA 5FIPA 3BAIA 1JG9A 2CHOA 4TVUA 4W7UA 3MMUA 4YHGA 4XX6A 3GNOA 1KWKA 4KMQA 5BXRA 3CV5A 2FGZA 4D6JA 4ATWA 1CPUA 1UKOA 2DSWA 5A2BA 1XSIA 5DT5A 4LYRA 2YL6A 2EABA 4UQBA 2FH8A 4F9JA 4JCMA 4UQCA 2WVVA 1D3CA 3W81A 5JIPA 4DUVA 3BGAA 3EJTA 2F18A 4CCCA 1GZJA 1PX4A 4KGLA 2X0YA 1L8NA 2WKLA 1O7DC 2VZVA 1C7SA 3EJSA 2VQUA 2YL9A 4LGXA 3VMPA 3AIBA 1H1NA 3O6AA 2UY4A 2VQTA 1E1EA 1UKQA 3G6MA 2VZTA 3WF1A 3FAXA 2WANA 5I3DA 2X8RA 1TA3B 2VCCA 2YKKA 1TMQA 3VD5A 5FD0A 1W91A 3BAKA 1KTBA 4UFHA 2FHCA 3WN6A 1R86A 4AZBA 5BXTA 3TV8A 1LQ0A 1JYVA 3EDKA 4MTVA 1JIBA 1C8YA 4CD4A 1PX3A 5A8PA 2XVGA 1J18A 1VBUA 4FLRA 2CPUA 4NZFA 3F5KA 4PMQA 3DHPA 1H0GA 3OLDA 3BAYA 1OBAA 1KFWA 2CKRA 3EMCA 3OGRA 3VD3A 4E2OA 1KXQA 1VF8A 1WE5A 3WELA 3UR7A 4HA1A 1GOMA 3IJ7A 4FNSA 4PMYA 1BQCA 3VIHA 3CZJA 3OGSA 2FH6A 1NWSA 3L2LA 4TTUA 1VAHA 1K9FA 1QI0A 2E9MA 3ZJ8A 4CU8A 1H41A 4FF5A 3VGBA 3AZSA 4K68A 4WKAA 4FNRA 5ECUA 1TVNA 5CG0A 1JDCA 3A3HA 2YL8A 4M29A 2Y2WA 1C92A 5CXPA 1CENA 3CZ8A 1PIGA 1V08A 3VILA 2Y24A 4GQRA 3WH6A 1G1YA 4D6IA 5EFDA 2JIEA 2J79A 3N15A 2GJRA 5DEZA 3KEHA 1BLIA 4UQEA 1OGSA 3VSUA 1TVPA 3D3AA 3S6TA 1J0JA 4NX0A 4QP0A 2E3ZA 3BXWA 4YPJA 3CUHA 1CECA 3WH8A 5BYWA 3OLIA 3M6DA 1FP9A 1UR2A 1R34A 3VTRA 2QPUA 2WNWA 3QHOA 5HNNA 3DX1A 1OIFA 3EDEA 3WL0A 1WCGA 3SCRA 4BZYA 4H8UA 1J11A 1UA3A 2DSUA 3AFBA 4W7WA 5HXMA 3DX2A 3TTQA 5M3WA 2E4TA 1GPFA 4CVWA 2V38A 4IUGA 4CUCA 4W5ZA 1X6LA 1UOKA 3O2LA 1QOXA 3POHA 3WD1A 2XGIA 3BVWA 4JZ5A 1OT1A 1DWGM 3WNNA 3PZ9A 1CXFA 4J7RA 1H11A 3WDPP 1CXKA 1JI2A 1BTCA 1UG6A 5GQBA 4CD5A 3SCOA 4U31A 2BV9A 2DQXA 5I23A 2WB5A 3ZMRA 4MNMA 4HMDA 2W61A 3HMCA 1QI3A 2EPMX 2B31A 3AQUA 1XH2A 4W85A 2VZSA 1FHDA 1QHOA 2WZEA 3SUVA 1PS3A 3IAQA 2FE0A 3N17A 3D4YA 2WHKA 5A6BD 5JBDA 1BG9A 1EOKA 3GXNA 3T2OA 2IXUA 1V6UA 2XWDA 4PMRA 1JZ6A 1GOQA 1DHKA 3DYPA 1E6PA 3KLKA 2BFGA 3LPFA 1QNPA 2YLAA 4ZENA 1IV8A 2G3MA 1UR0A 1E56A 3WDQA 1W32A 1A3HA 2Y4SA 1ISWA 4AZ6A 1VFMA 3ARQA 1HNYA 1O6IA 2BHUA 2QMKA 1J0HA 1W2VA 3GXTA 2VZUA 3OBAA 5BCAA 2VVNA 1ODZA 2VR4A 5DMYA 1EDQA 1GVIA 5GNYA 3ZOAA 1MQPA 1XYFA 1AQ0A 1ESWA 3W6MA 1E0XA 2CYGA 3A5VA 4LXFA 4AD1A 2ZXAA 1FH7A 1JAEA 1CXEA 3L4TA 3GH5A 3NJ3A 3LRLA 2ZUUA 1NM9A 5CZKA 2WZHA 1CGUA 1BYAA 4GPNA 2W67A 3AHYA 1V0NA 1M7XA 1M01A 4V2XA 1KCKA 1N82A 3SCTA 1XGZA 4GI8A 3RM9A 2VX4A 4AIEA 1ISYA 2ALWA 2YOCA 3HJEA 1Y7VA 2Z1SA 4W89A 4AW7A 2OWWA 4X0NA 4H8HA 3MUZ1 3EJPA 3WD0A 1R7OA 3PN8A 4CCEA 2V3DA 1EHNA 3HG2A 1B90A 3K46A 3AXXA 2FGLA
chains in the Genus database with same CATH superfamily
4UNVA 4AJYV 1EEPA 4QKXB 2BOCB 4BFEA 1SY6H 2F53E 4HD5A 3Q5YA 3QM3A 2IKHA 3MV8A 4UOJA 1IGTA 3WU1A 3MPGA 3MZNA 4U5KA 1Z9MA 1HKIA 2YGNA 4FA3A 7A3HA 3LM7A 4GS7B 1UXWA 2GIXA 4FQQB 1GW9A 4X6CB 1ZAGA 1ZS2A 5E5MA 3PVFA 4CNOA 3L9RB 2VCOA 3GRWH 3KXFA 3B2DC 4GT7A 3V0TA 1XB6A 3D0AA 2ZICA 3HG3A 4GFIA 4Q3MA 2WZTA 5U4NA 3ANVA 5CM1A 4ZFCA 1I1YB 3GMRB 3EH4B 3KNBA 1EANA 4XBPA 5HHPB 1PAMA 5AVVB 1ZFJA 2DF3A 3CZGA 4QCFA 4E38A 1ZGDA 4HHWA 4HOZA 1PKMA 2H4EA 3RNQB 2YZ1A 5MEOB 4DJEC 5IFPA 2ZDRA 2C9VA 1WFIA 2E67A 2E1DA 3BZ5A 2ERJB 5D1QE 1JP5A 2D3JA 2NCEA 5I1CH 5C0CE 2F9BT 3BUYA 3H2CA 4PJBE 2B7QA 2BWIA 3DTXA 3K2UH 5MENE 1XGYL 4BQ2A 5TH2A 3RHWK 3WD5L 4DVOA 2GSHA 5IR1A 4HD9A 3C5SA 4EIGB 4FXJA 3G77A 1H9DA 4PW3A 4NO0D 4IGMA 4JPSA 3TESA 2J7FA 1FWDC 1DIOA 5I6MA 2F1BA 5DR5L 5DA4A 3FU5A 4UTBA 4XKYB 4E9SA 3BIKB 1ICSA 5E6ID 4IG2B 1OAQH 2JQAA 1T5WB 4ACZB 4K8RL 3HR5B 1NOWA 4XWOC 1WFNA 1CI5A 3ESPA 3LQZB 4AMXA 1KSRA 1BYCA 1N0XL 4KMTH 1XSJA 1NAMH 2AJSL 3MC0A 1FPTL 4UZUA 2DL9A 1T1WB 5HYSA 3JZ7A 2Z4QA 1A5FL 2Z7GA 1GKOA 4OBSA 1MVUA 3M17B 3RX5A 4HS8H 2YAFA 4PJ7F 4D2JA 4CKQA 3H0TB 3PULA 3RVWD 4L4JA 3TN6A 4MB4A 3IK4A 5EBAA 3KOZA 1M57B 2FIKA 1EAOA 3PQYB 3BVXA 4LLVB 5E0CA 3V5OA 4JGNA 2DLFL 4KUCF 1FY6A 3AXIA 3N2CA 1BQHA 3NK3A 3PF2A 1QW9A 3TPUA 4RDQG 2WAGA 3TWYA 4JPGA 3ZE1E 4NC1E 4K9EC 3DOPA 4CU7A 3FIGA 5CBAA 5EBWA 1O75A 4YSOA 3W9DB 4YSAA 4UMAA 5CP7B 4RZCB 2VDRL 4J4PD 1BQGA 2FGWH 3B4YA 4C6JA 2J4WL 4RE3A 4Q9RL 4JRYD 2ZX8A 4YO0A 4HZAA 3REVB 1P2CB 1AZNA 2WUBL 3D39E 3CCHB 5EBGA 5LN4A 3N50A 4RA0C 2E76C 1IBZA 4NPJA 3QARA 2J6VA 4H20L 1SO3A 1AYOA 4JGMA 5CEZL 1IEHA 3NXFA 3ASOB 4CQDA 3KEDA 3Q2NA 4V2BA 3SY8A 3WBYA 4AG4H 5IOPB 2ZKMX 2YBGA 1XGDA 4NJ9L 2WPGA 3OWRA 3MA7A 1TE1A 5DK3A 1JYNA 3H7BA 3BIBX 5C2BH 5HDRA 4DHLA 1KGJA 2PCPB 1I8IA 4HZ6A 3DYMA 2CO2A 3NFPA 2ICSA 2GGHA 4QNPE 2PDQA 4QHMB 4GVHA 3M46A 4Z08A 3GZ3A 1SJCA 1QYGH 4LAQH 3VI3A 3FTGA 3JQOB 3DX8A 4XI5D 2EE2A 1AD0B 4PI2A 5KMYA 1Z0NA 2PWFA 4JXCA 3TSMA 4L9LA 2PP7A 1NAMB 1OW0A 4GRMB 3ME0B 1OTTC 4GUOA 1S2TA 3LPGA 5E8OB 3AQDA 3AHXA 1FH8A 1EEXA 5KZMA 1YEEH 4Y8AA 5FF2A 2BZDA 4GIOA 2IPKA 4XBEH 4OGQC 1JHKL 3GHSA 1NOFA 5D55A 1P4CA 2YSSB 2IXQB 4OQVA 5E93A 4F8PA 1AQMA 4FSAA 5ESQA 1JULA 3ECVA 3N06B 3TO4A 2UYLB 3NEOA 4MNGB 3V5HB 5D93B 4OUOA 3D1MC 3QB7C 4F2ME 1KM0A 3EGDB 4CILA 4F5CE 1EJSC 2VFDA 6A3HA 4X99A 4PJGA 4W9ZA 3ZDZB 1IMHC 1ECZA 1SRDA 2OZ3A 5DJCB 3GXMA 1HEZB 1H0IA 2JSFA 4YCOA 3O8XA 2PTVA 1T22A 1XSOA 5F7NC 1P84K 5HPMA 8XIAA 4OW6A 4JO2H 5KS9F 4FTVE 1U8QA 4RFEB 5BW7C 3DFTA 2YRPA 2AQ1A 1I2OA 4IBLT 4JBSA 3ZL2A 3VG0H 4RNRB 3IMSA 3QO0B 3BLPX 2CO3A 3GNML 5DRXB 4LTSA 2AQOA 2GSIA 3T1FB 2QF8A 4HK5A 5T1KA 3LCXA 3SE3C 4C56B 1NANH 2QDHA 3KPSB 3T3PF 4LWWA 5C9RA 2F58H 1QU4A 5I6OA 4HUXB 1QG3A 3N9RA 4O52A 3WQGA 2NY2D 5A6AA 3Q1EA 4MWAC 2KERA 3BJFA 3UTSB 3ATZA 1G69A 2X6BA 2BX7A 4N24A 4F0SA 1TR1A 1XIEA 2PD9A 4R5TA 3F5WA 2Q5BA 5B7YA 3W0WD 4XP5H 5KYYA 4ZK8A 3I02A 3OAUH 1A2YB 2NXZC 3RVUD 1OTUC 4EXPX 2O6DA 3HZMB 4AX6A 5IHZA 4FQ2L 3WIHA 3MCYA 1IE4A 4BWTA 3AUWB 4QDPA 3N44B 3OKMB 1DLFL 1N2VA 1J0ZA 1HH6A 4JY4B 4DEFA 1ZEAL 2C9PA 1TQBC 1JUFB 5LWYL 2PU0A 4NZUH 2Z00A 4ZFZB 2NW3B 3NH7L 1QZ1A 2DM4A 2KUTA 5AFAA 3AYRA 3MI6A 4KIEA 1R3JB 4EIZC 3ZJKA 4NRXB 4PJFA 3S4SG 2ZJSH 2IADA 3GXFA 3ZVIA 4OM1L 2ITDB 1SBBA 3AWFA 4EN3B 4FQXD 1FDYA 4HS6B 4LANA 3U7YL 2DKMA 3W23A 3WDIA 5G55A 1UWGH 5DO2D 2AXJA 3CV6A 5KEZA 4W4OA 4BFGA 1EXPA 2DZSA 3HUJF 1ZD6A 2CZVA 5DF0A 3AU6A 2X09A 3IBOA 3URNA 3QWOB 4U3CA 1BMZA 2E9BA 4NKMB 4B60A 2O61B 5F7YC 4W9KC 2YUVA 1NCCL 4I3RH 3ZR6A 1RV6X 1AS6A 1UKTA 1YYML 4PJ6A 5E95B 1YRKA 1AZBA 4QXGL 4QOKE 3QSKB 1SGJA 2V69A 4JIEA 1BM3L 4FEIA 3WK0A 5GSRB 1S7QB 4P3CL 3VKDA 3B1UA 4PL2A 4X4YA 3VFNB 4J27A 2IH3A 2ZSVA 2L0DA 1GGCL 3VXPA 3W1ZA 4DJMA 4ZTYA 2AVFA 2XVLA 2CJTA 5DY2A 2XLLA 4RZ6A 3HMXL 1TMHA 4X6DB 2KI6A 1A6ZB 3PZOA 5LJYH 3TZVB 2A9BA 3UYPA 3T4WA 4D9RE 3QWQB 5C2UB 4LCCC 4PP2B 1P9MC 1KELL 3VSTA 1QACA 3TN0B 1OF8A 3S6DA 1I3RB 1ZGLA 3RK8A 1KLGA 4RAHA 3EPOA 4HK3J 2G3XA 5KYUA 2OOGA 1OT2A 4Z3HA 2OT0A 1M3IA 5A3ID 3QXDB 2P49B 2FRGP 4AXWB 1ZL1A 1E9PB 1MREH 4OLYL 3QH2A 4PJDF 5HHQA 1E0UA 4Z1AA 4HQQH 3VD2A 2YAQA 2FLBT 3GI8H 2F15A 3TJLA 4H5SA 1FBIL 3D05A 2D31A 4FG6C 5I1GL 1K1DA 4OSUH 1F58H 1Q8AA 3COOA 4LSBA 4L29B 1GAFL 1HDMA 2CCWA 2D69A 5C0BD 4OZOA 1OP5H 2ZZ7A 1W5QA 4H83A 4QGYA 3AMGA 3ZTNL 3SQMA 5G1TA 2C8NA 4ZI8A 3L54A 3QNXB 3GM8A 2VZOA 4TOYH 4MMXC 1SYSB 3J2PA 5ABAA 1BZ8A 1BLNB 1JGUL 2C4FT 1RSYA 4AKQA 3RR4A 1JF1A 1JV2A 3D85D 4KHTH 1ZLEA 2EXOA 3GPSA 2HVBA 1RUKL 2IO5A 3LN3A 3RIFF 4RRPM 4XNYH 4IHOA 1MEIA 3FN0H 2IWEA 4YSDA 1TT6A 2HN7A 2Z6FA 1OSYA 2B15A 2VAAB 4OD1H 4PRAA 3B5GA 1MCEA 4BI6A 4LOUC 4GMSH 4Z8FH 3F4CA 1MEHA 3SEPA 4F2BA 1EAPB 5XIMA 3JUYA 1RJQA 3C2VA 4G9DA 4UM8A 3V4PA 3AB0C 4Y7OC 1CI1A 5JXEA 1P7TB 4UMSA 1HEJC 3TROA 2HTLD 4H9XA 3II2A 3X1NA 1AQ8A 1GRWA 2BRQA 1D2PA 3AYSA 1U8HA 4GKNB 2CNYA 1FAIH 2ADJA 4B9PA 5BPPA 3KM1A 4JTFA 4NN7B 4U6YA 3QZBA 4DK5A 1HILB 1ZT7B 3DSNB 4W87A 3S3BB 4GRLA 3IVSA 2WJ5A 1ID5I 4J9JA 2PTUA 3EPMA 3P9LB 2IMRA 2PW2A 5CGQA 2H32H 1JDEA 4X6CE 5BOJA 3L1OL 3PSWA 5I5RA 5IB4A 3S5LB 3H26A 4O11A 4LBUA 4L4OA 5HWNA 3EBVA 4B3LA 3UWZA 4PGDA 3DX0A 35C8H 5HDQH 3CU2A 4Y7MA 4TMBA 1MI3A 3MBEB 2W9DH 3RLGA 4WSHA 1YNTA 1E4HA 2WSRA 1OGTB 3HV9A 4M9OA 3QIBA 5T5NF 5D7EA 5F88B 2KZ1B 1UUQA 2F5AH 4P99A 1QA9A 1VHNA 5ETUA 1RK5A 1NBCA 3EEZA 5E2UL 4N02A 3ILQC 2Z1WA 2ZYIA 4KWWA 2XWBA 3AS0A 1LL4A 3KUMA 4FIRA 3OPUA 1T20B 4WLCA 4JFFB 3VFUB 4BH8B 5E1HB 4H01A 3NVQA 1BHGA 3MANA 3WS3A 4L1BA 4HW6A 4E41D 1A21A 1XL4A 1PVHA 3BE7A 4DAGL 4ORGB 4L4LA 3RHGA 2V3GA 5CPMA 5HPOA 4JX4A 3O6LL 4IU2A 5LXXA 4PEEA 5KOMC 1A64A 2QHLA 1HHHB 5JHBA 4HFUL 5J06A 1V54B 4DF0A 1S2CA 1WDQA 4Q2ZB 1EH9A 2Y62A 1TENA 4AT6A 1TTQA 1DQJA 1ZMYA 3C6LA 5AAMA 3L3OC 4M7KL 3FVMA 5DQDL 2XYCA 3B9OA 5E8EA 1CD8A 5C0IA 3CWOX 1RD5A 3L5WA 4HHLA 5AYQA 3DDFA 3W87A 1GVSA 3R19A 4PHXA 2R82A 2IC2A 1JNDA 2YC1B 3L4UA 3MUAA 2QDWA 3PHOA 2GQAA 3M5VA 5I82A 5EH1A 4HIXL 2W65A 2XI9A 3NOIA 5EWIH 3IJSB 2YD8A 4ZODA 3S37H 4ZUTA 3T4CA 5E7FA 4QROA 4I48A 4ANKA 5MEPB 5I79A 2WXIA 1BCIA 1G7QA 2QV2A 3PQYE 3SKMB 1T7ZA 2ZKWA 2V7HB 2IH1A 1QFPA 3K71B 1BXUA 2X4SA 3OMAB 1SVCP 2DZUA 4JRXB 3AWOA 1AACA 3MV9A 1N5AB 5EUKA 2OSLA 1BWVA 2EDRA 1AL7A 3S1UA 1YNQA 5EB8A 2K3HA 1CLYL 4A55A 1NKOA 3ARED 1D7FA 2CK2A 1HIMH 2XFXB 2X2UA 1OAZH 2VUOA 3W71A 4MFDA 4WWKC 4FDWA 1ES0A 4GUIA 3UC0H 4ELKA 1FE8L 4K5NA 3KLHD 4GVGA 1M41A 1Q1JH 3QZLA 3M43A 4HMNA 4FHJA 1FZKA 4ZTXA 5C7ZA 3CV5A 2NQ3A 1YNPA 2AQVA 5KZCD 3N1PC 3Q58A 4JVUA 2QS8A 4F9JA 2WXRA 3ULSB 1VD6A 5JIPA 4DUVA 4TNEA 4XUGA 1HXMA 3QPXL 4MJ5B 1PY0A 2PF8A 5D05A 5E9DD 1TFPA 3ZQXA 3ITVA 4BUQA 2YBVA 2UZPA 3EYQC 1HCVA 4CDHA 3SFWA 1NMCB 4FOMA 5C9UA 1UXSB 3C8KB 3MJYA 4UC5A 3NIFB 4X8JB 3FU7B 4KBXA 1KO0A 4K5LA 1JIBA 4CD4A 1AC6A 1BFOA 1C12B 2Z6IA 3SSGA 1VIZA 1VF8A 4FMKA 3AY4A 5I1HL 2HFEB 5FAJA 2A9NH 1BQCA 3WGVB 3MTXA 1MAMH 3R0MA 4BM7A 3HMWL 1TJGH 2WLIA 1V5JA 1MHHA 1T83C 5HMDA 4YBQD 1JN6A 5EO1A 2OV0A 5LG1A 2C7UB 4GLRH 3TVMA 4J3OC 1GIGL 4BK4A 4O2CB 5I3KA 4Y4HA 1V8HA 4L8SC 4N25A 2N56A 1AANA 1GGIL 3MRJA 3WEBA 1E51A 3UDWC 1MFDL 2DQUL 5FPIA 1M68A 3KCLA 1EHXA 1LK3L 1UA3A 3VWJA 1Q38A 2AQRA 2B4GA 1MLBA 3DG3A 4ONHA 1FNGB 3ZKND 3X2QB 3P40A 2TMDA 3QBTB 4ANUA 2XY1A 3POHA 4DY1A 3BVWA 3GKAA 4CA4A 3MRRA 4GY0A 4M43L 5AD0A 1WXZA 4MNGE 3HFTA 2C34A 3BKML 4PB3A 5D7IB 2A9DA 3HLAA 2EPMX 2O55A 1S9XA 3X12B 3ZDZE 3W2KA 5C0AD 4I9MA 4KK5D 4GOAA 3SUVA 1SY6L 3KBVA 3QG6B 1WBYB 3GXNA 1DORA 5TNVA 1O9VA 3VXSA 4PR5A 4ZUSA 2NQLA 5ICZA 8TIMA 4PRDB 2YD2A 1DJIA 2XWZA 1JZEA 4MKMA 5AW2B 5I8EA 1R3LB 5CAHA 3C60A 1KCBA 4C56E 3MJGX 2ADFH 3GRWL 4Y5VC 3KPSE 4DYKA 4PLOB 1G43A 4LCYB 3VXNA 4MJHA 2B59A 3PC0A 1GYCA 4C4KT 1ZLSH 1YTDA 5REQA 3U9PH 3OXRA 2HJKA 3AU1B 4R34A 4U1NA 4XOEA 3UTSE 2R8WA 4PLJC 4AW7A 2Z2AA 2BC4A 4P4KD 2CLZA 1C90A 1A7RL 3CAQA 3PHQB 3SDDB 3UWUA 4PB0L 4FXTA 3RX4A 2XPYA 1E40A 1P53A 4IPLA 3O6FD 1C9SA 2RFGA 4PS4H 1JVKA 2OXHB 3IVUA 1LNUB 3KCPA 5EEWA 1Q65A 5GJMA 1E3ZA 5I1CL 1FIGL 1US3A 5I5JA 2Y8VA 4O5LH 4J8RB 4LNRB 5F2MA 5ECGA 3K2UL 2EDTA 1F11B 2OS7A 4PCPA 2WWMC 3ARFB 2NSOA 2QIIA 1HOCB 2CLVB 1EDTA 3C0LA 1T80A 2WHLA 3NPXA 4CKVX 1Z6KA 3UJEA 2JELH 3BP6B 5KSVA 4MKVA 3RZCC 1P0DA 1GKQA 1HIZA 3D0VA 3IEAA 1GVYA 2BCMA 3MLZH 4OLVH 4OCSH 1S4IA 3HFFA 5CZXC 1EK3A 1UD3A 3TVAA 1ZY9A 1OAQL 3WD4A 4BRJA 3U0PB 2XIOA 1OB1A 1UP0A 3EO1A 4MA7L 2EYRB 2XXFA 4KEMA 5K1VA 4I0CC 4NRYB 5F9WB 3JBG7 2C9XA 3Q43A 1F41A 1AS8A 2APSA 4H25A 1NAML 3MA8A 3SGKC 4PRPB 2UXGA 3QDJE 3QUYC 4HS8L 4TNVK 5DHYB 4LHQB 4UCFA 4X5QA 1I7TB 3N41F 3OJMB 3M45A 4DIXA 2ARJA 5FC9A 1OTSC 3P5YA 4PRBB 5TDOA 4JNYA 3E0GA 4NT6B 2H3KA 4LU5L 1Q7ZA 1SBSL 1PDZA 4MMZA 3FVDA 4X6DE 3TV3H 2FX7L 4OLXL 1AG1O 1I8MB 3LLDA 1X7TA 1PWLA 1ZA6B 2F8XC 1SJDA 2H2SD 4WQOA 3G1FA 4G72B 1DVFB 5SX4H 4D2NA 4BQ9A 3WKMH 4GH1A 1UWQA 3HPXA 4PUJA 1ZDQA 4RGND 1OF0A 1IU1A 3GJEB 4NQDD 1G0XA 2WAQA 4TLKA 4IRJB 3H9SB 2IPFA 2IQAB 3GNNA 5HJGA 1RPXA 3MRLB 1GNXA 5D7SL 3JZUA 2HSIA 2HROA 1IEAB 1LBFA 2XFRA 3WBWA 1J9TA 4JQXC 4ZMPA 3S3JA 3ZIYA 1NCWH 1N7MH 3TW9A 4C1NA 4HC1A 4HIEA 4E8GA 4AG4L 3K2MC 4PMUA 1DQVA 2O6PA 3N4EA 3TYBA 1Z66A 3KPLB 3F84A 3NFNA 4IQJA 1RA0A 2NSXA 5C2BL 3GRIA 4S11A 4QEEA 2CCLA 3QOKA 4NN6C 2AQSA 2CMRH 3IIZA 4RRPA 4XG1A 5DJXA 3LKQA 2FLRT 1RJPA 3Q48A 2BNQA 3IRSA 3WQDA 2WIMA 2V5CA 4ZRGA 1G9ML 1NPJA 4LAQL 4N87A 3DIVA 3SE8H 2NY1B 3V79C 1NGQH 1HQ4A 1WWCA 2CU9A 4RWYH 1IGFH 1OV8A 3BUVA 4JHMA 3ZGIA 4H4NA 3P9MA 2R91A 3MLUL 3VE0B 1CBVH 4FL4B 3T4AA 4XZUA 3VIOA 2QJJA 1OD9A 3ZE1B 4Z7OB 4Z1YA 1ZNNA 4RMSA 3NJGA 1F4WH 4MLJA 3OM3B 3LZPA 4G6AC 4IBZA 2X7VA 4A38A 3EADA 3W27A 1OK6A 1DFXA 4D7BA 1HE8A 5EOCJ 1W9UA 1S5WA 4GRWH 1EFXA 2CLIA 2K4WA 3T9WA 2DB8A 3C5JB 1N59B 4ZD3L 5DANA 15C8H 3O4OC 5FYKD 1YDYA 2C7FA 2K1MA 3AADB 4PUEA 4YGAB 1F42A 4DZ5A 4MA8H 2FJKA 3ARBD 1Z7JA 1R3HA 1NH6A 4IHBA 3MR9A 1EEUA 3TEZA 1AIFA 5ENWB 2UXTA 4R33A 4LHJB 4AYFB 1IT7A 1CICA 3MRMA 5I6LA 3GR7A 3CHDA 2PI6A 3UJRA 5I2UA 1G7HB 4O58L 1LO4L 4K38A 1ITBB 1TXKA 2QKIC 3LHWA 1BX2B 2GPTA 1VRXA 3VABA 4KAQH 5DURD 4WKFA 2XGBA 2XXMB 2XXCB 1RJZB 4KX7A 2NQDA 5C70A 3WYRA 3DRTA 1SJHA 5ERWA 2HTMA 3CDZB 1RJYA 3QZWB 4UTAL 2YPKB 1UD4A 2FPVA 4B7LA 1SW0A 1L9MA 3W7MA 5FOJA 1X98A 4PGCA 2H9GA 2RAMA 2NYZA 4L0ZA 4LVAA 1LDPL 3T0ED 4DQOL 3R58A 3VQLA 3LH2H 1TB3A 5A6LA 2ITFA 1U9KA 4HZ8A 2FEEI 4G7RB 2X9WA 4JFFE 4MYPA 1EBGA 5IFAH 4LSQH 3ABGA 5LAXB 4Y1AB 3CU7A 1YEYA 1QFWH 4YHLH 2C9RA 4KI1A 4RV8A 4MAYD 5LG6A 3OZLA 4TLSA 1MNNA 4PGBB 4GSDH 4RAVA 4XP5L 4MDRA 4M4RA 1DJXA 1UXMA 4HGKC 1RY7B 3ES7A 1CVSC 1KV3A 2HYMA 2HRHA 2P8PB 1H7NA 5CD5C 4QYAA 4X5XA 4O10A 3GMMA 1H19A 2ODOA 5DC4B 2PA6A 4LYQA 1JUBA 4HUWA 5K39A 4IBYA 4B9ZA 1I1WA 2EINB 2MNWA 1QPRA 3ARGA 4Y2DC 4S2CA 1DQDL 3SZKC 4EDXB 5BRPA 2WUCH 3NCYP 3VGAC 4YX2L 1FCGA 3UY7A 3V55A 1C5BH 3F64A 2ZJSL 3ZS4A 2J7EA 2QLYA 4DZBB 4F9DA 3QDAA 3PFRA 1WZKA 4GRWB 3VU1A 1O94A 3GHEL 2HVJA 1UWGL 4N85A 3WGUB 3E7JA 3PBYA 3K8LA 4PWEA 4ZX3A 1RZFH 2NXIA 1S7VB 2SODB 3NCOA 1RQEA 3FTWA 4HFWA 1KLUA 3QJAA 1ICTA 1IEVA 3HNTH 3AGWA 4N9BA 1HT6A 2R0WH 2NR6A 1P48A 2VR7A 3S36X 1QW7A 2GAZA 3U4EB 4I3RL 6REQA 5A69A 4JRXE 5KBPA 4E68A 1DE5A 3ZTEA 1FXQA 4MB5A 3SY1A 4XODA 1FL3B 2HVNA 5DUBB 3BQUD 1Q72H 4PJ8D 4JVPA 3ZE0F 1T3FA 1EJVC 2MH4A 2Z35A 1SEQL 2QJHA 3PIQA 1ZTXH 3QA3A 1HTIA 2AP2A 4RNIA 4MJID 2D7QA 3O06A 2K7PA 2R59A 2BSRB 2Y7DA 4DBEA 3FFDB 1FHUA 1YUHA 2CBOA 5D1ZD 5IXEA 5IJVB 2NXZB 2B3RA 2R2HA 5IHRA 5HHMB 1JZGA 4P23B 2OX1A 4CVZA 4EZMA 5FF6A 2ZOKB 1GHRA 4E9LA 1MREL 1UP2A 4WUUA 2WMPA 5K4XA 4HQQL 2WWDA 1LMKA 5AZUA 2IOIA 3OIXA 4IP4A 1G94A 2J8GA 3RL2B 1V0LA 1U93A 3NIFE 1OVDA 3W70A 1SM9A 1F58L 3PZGA 3ROOB 4V33A 3S5NA 3GLCA 2EUWA 4FIQA 4MJ6A 4D0CB 3GW0A 3GMOA 4O8RA 2VDLL 1K72A 3TYGH 2A3HA 2WYZA 5IHSA 3EOBA 3VGEA 3PLYA 3DVGB 4A66A 1IBDA 2V9RA 5HI5C 3FULA 1MG2C 4FQLH 3PAUA 3G1DA 3FN0L 1XPYA 4Y9FA 1SJEA 3DRQB 4UFMA 3C6CA 3N0AA 1E5ZA 2JQMA 1CWYA 3UXAA 1GPOH 1CC3A 2H26B 7FABH 3KHOA 3THDA 2PWEA 4GK8A 4GMSL 5KAQG 1UWUA 3DGCR 1IO4C 2HG0A 3P77A 1OF2A 5LN8A 3LNDA 4HU4A 3ULUD 2VR8A 3KPMA 2P5NA 1JRHI 3BQ6A 3W4RA 3C5ZC 3TW7A 3EBGA 1H4PA 4WO4D 2X53A 3N14A 2VGIA 2CUIA 4OJFH 3I10A 2MCAA 1WDSA 1F3TA 1LE9A 3J27A 1R9YA 4XZIA 2IJ0C 1XR9A 4OKDA 1RULH 2EXWC 1P5BA 3OPSA 4NM4H 4AY1A 1SDYA 4WF7A 2IPGA 3CQFA 1ILUA 1BFVL 1CFQA 3WDRA 1W3LA 2VJ8A 3JWDH 1U2YA 2D7MA 3NPSB 3QPZA 1UWAA 1U3HD 3ARDC 3GSOB 1AQDA 4IBTA 1PV8A 4B9FA 1B3IA 3BWUF 3FT2B 1FWNA 4N5EC 4M19A 2W9DL 3EBHA 5C8JA 2JKTM 4HH9B 1XIIA 4PB5A 3SCQA 2YCLB 2GJXA 4KRZA 4E8DA 1JK9A 1XAUA 2E68A 4XNZB 2EDQA 1XF3A 4B5TA 1RZ8A 3TC3A 3CFDB 2VFGA 4EAYA 4LUJA 2BRRL 1NIUA 2IALA 2FWOA 4C83B 5JMOC 1AP2B 4DWSC 3L08A 4XBGB 3RIKA 4APQD 1CDCA 3B9KC 3V4BA 1H3VA 2FSDA 2Y70A 4FXSA 5C0JB 3X1EA 5EKYA 3OJDB 3N11A 2BNRA 3OIHA 1K6QH 3GSRB 4BSVB 2J44A 4U6HA 3FYOA 2AAAA 2Y1ZA 4ZCWA 2HG5B 2PWDA 1I3VA 3MLXL 5JOPE 4UUJA 2DZBA 2MKLC 4AISA 4LSPH 1Q13A 1MFAL 3B2XA 2VYRE 3LBCA 4N0FA 3AB0B 4FYRA 4R0LC 1DFBH 4HJEA 4J8QA 1MCCA 1IGSA 4CMMB 2R7EB 3AABA 3QCTH 3MLRL 4OFYD 2RAGA 3L13A 4WGHA 4YAQB 4RZBA 1FWEC 2AQQA 4TSCL 4HVBA 5FGBC 4ZXBC 2ZZ6A 4F7KA 2XN0A 1B0GA 3LN5B 3WO3B 3DC0A 5I0ZA 1PYWA 4OR1A 1ZGLP 4UF7C 2MMXA 3NQKA 3IGAA 2Q71A 3K4DA 3L3JA 2WMIB 4UOW0 4M3HA 4R7WA 3BEVA 3DV4B 5J6GA 3S5SA 1P1ZA 1EPXA 1JVNA 4JFHD 4PRPE 3M0JA 5AY7A 4IKNA 3KCJA 3FO9B 4Y5YC 5HJ3A 3G6DH 5EWIL 3S37L 1YPZA 3E0IA 4JPIB 1ADQA 3IDJB 1YN6B 4ADTA 4GG6A 4FQCH 3APNA 1D6EB 1O5QA 1KXTB 3EZ4A 5C6TH 3M5XA 3NWRA 4L6HA 1UR4A 1OAKH 4M6NL 2E3VA 4D3CH 1X4YA 4Z7VB 4AVHA 3FFOA 2VX7A 3DXAA 3ZUCA 5A8OA 3WQ8A 1O7VA 2DEXX 3SRFA 3CN1A 1N9PA 4JGJA 4HA4A 5CZRA 5CSYA 2Y7FA 1YEHH 4S38A 3FW6A 2VUYA 4IIFA 1ACYH 4R4FH 3NACH 4YK4C 3NZSA 1GGOA 4Y2OA 3H9SE 2EPNA 3UC0L 1L9OA 3MLVH 4G1NA 1Q1JL 2R1XA 3FXGA 4AM0A 2VQ1A 3RNDA 1IAKA 4G6MH 4PJIF 4B9GA 5C6WH 3V4VA 3QC0A 1GTHA 2PW1A 2G60H 3GD6A 3VNLA 1H63A 3E3QC 1XG4A 3K80A 1IE5A 2OYPA 3HU7A 1RZIA 2ZC1A 5GRXG 2N1KA 1W72H 1NCDH 2G41A 1HG3A 3BG3A 4HOXA 2H41A 2DMHA 2DV0A 3RUBL 1BZOA 1M7PA 3ZYZA 5BU6A 2PLKA 3EDDA 2YDSA 3LXAA 3QEQD 3L3OB 4PMOA 2NV2A 4YGVA 4L37B 4JTHA 4WU5B 1G7LA 3G6AA 3PS6A 3W83A 4U1MA 5IJKC 1OP4A 4RSVA 3NAAH 3EB4A 4TS6A 2ZCLH 3GSNA 3NCJH 4IRZH 2ZCKL 4H8WL 4J3OH 4IQEA 3U25A 2L7UA 2HJFB 4JJ5B 2A9NL 2F0CA 2GJZA 5JA8B 2IPUG 5C86A 1F6FB 3UOAB 1SZRA 1Z5HA 1TJGL 2YXWA 3KLAB 1J48A 4RPQA 5DHMC 4QHUA 1IZCA 2SEBB 3DA0A 4O14A 4M3JA 3LDBB 4Q4MA 3LM3A 2CA4A 1R3KB 4P57B 4Z7OE 4CC4A 2YL9A 4RNHA 4QJ4B 3VMPA 1KB5A 3WLBA 3AIBA 1MPAL 2DAVA 1WDAA 5FJPA 2DVXA 5A8PA 2YAEA 3F8UB 3NZ8A 2FB4H 5INCB 3NJFA 3TLQA 2ZKHL 5DS8B 1WE5A 2JCCA 4B50A 3UR7A 1UA6H 1JGEA 2HS8A 3VIHA 1KZYA 4TTUA 2YK1H 3CAVA 1XQLA 4J39A 4FNRA 1YDPA 5ECUA 5EU7C 1M6UA 3QUMH 3DTDA 4D8AA 2ZT9C 4RK8A 3VILA 1JXFA 2Q6ZA 5C2CA 2CO6A 1ZVSA 5HUOA 4YPJA 1OYAA 2ADFL 4LL4A 3U9UA 3V1HA 1O5KA 5TTRA 3O3DA 3TTQA 1TLMA 1GYAA 2OMUB 1QLFB 3ITCA 1VYPX 4V1YA 2OMBA 2VKWA 4NKDB 4K15A 1LP6A 2F54B 5FYKU 1S2WA 3QIUB 3WLRA 4A04A 1DQLH 4ZUWB 4G43A 3TBWA 3LMJH 4KO6A 3B40A 4Y1AE 4ELMA 3L45A 3THMH 2WZEA 5F3HB 3UJSA 1JCKA 3BEWA 4G3YH 4I5BB 3CL7A 2ATKA 3OVUB 4S3EA 5I15H 4NQEA 4KPHH 1JZ6A 3WLHA 1SN5A 2CAKA 1RSFA 5TFSH 4PS4L 2MTAA 2FR4B 3QXWA 1GHFL 3AC0A 2W60A 2Q7YA 4O5LL 4AEIH 2A0LD 2W07A 2CYGA 4I90A 4IU3A 4UYPA 3HCVB 1FZMB 4WFEE 1IM9D 4MM1A 5C9WA 3QVAA 1KRCC 1R5VA 1Y1DA 3L95A 4NERA 5GZOD 4DK3A 2BP5M 4QX4A 4JUTA 4HIHA 1KLZA 4JX6A 1Z89A 2GEEA 4AIEA 5EC1B 4G11A 1LUCA 4OCLC 1DXIA 1LD9B 5E4EC 2OWWA 1C1EH 3LEXA 2FD6H 2QL1A 4XXCC 4OCSL 5CJ8A 4GRWE 3ML8A 2E7LC 2DQHH 3PANA 3OZKA 4CGUB 1H49A 3FT4B 3SOBH 2JJTC 5FO7A 4N1HB 4RMWA 1QSED 4IICA 3QMSA 3WFEH 1PSKL 4JX5A 2OI9B 5A16B 3PZNA 3TJPA 4GY7A 4IH3A 4CD7A 1D5ZA 2MPVA 4RISH 4NAEA 4NEHB 4FXFA 2Q8LA 1G6RA 3QUMB 1NDMA 1OGAB 2NX1A 4K94C 4OHQA 2OX4A 4KKLC 3CFKA 2BSDA 1U8JA 3F4DA 4XE0A 2HLFC 3D52A 4IDJH 3PTQA 1J6PA 4PS8A 2X05A 2X1QA 1KRMA 1FDZA 1Q9KA 3QYSA 3VZYA 5K59E 4JICA 5JHAA 4B3EA 2X4TB 3JV6A 1IBBA 2Y5EA 5LLIC 1HZYA 3IJDA 2Y7QA 4G9FB 4WHTB 2X4OB 1I1FA 4DF1A 3SDAD 4DN3H 4GI6A 2DVTA 5BMFH 3P0XA 3C56A 2QVFB 4LCVA 2EO9A 5AYUH 4KKAD 4ETQA 5HHME 4NCC1 1WRFA 1EKOA 2AK4A 1TQCC 4WRHA 3IDIB 3TTYA 1SR0A 3ECUA 2IANA 4HOMA 5F3FA 4KDWA 2NX5B 5HBBA 4ETYA 2YD7A 3NCCB 3DVNB 2OCFD 4IIQC 4P2RD 3GJFA 5JPMB 2CIPA 1NCWL 5BROA 2BCKA 3MKVA 3M9YA 4P59L 3RL1B 3RZCB 3P2TA 3H3PH 1HGWA 2CDEB 2I56A 3UR5A 3OGOE 4Q32A 1ICQA 1GA2A 3L7EB 1ZHBB 2FCBA 1CLCA 1P69B 1PTGA 4E9XA 2VCAA 5CSZA 3O4LB 4YH6A 5C0ND 1UXLA 5KBLA 1E7VA 4WDIB 4HJIA 1TKWA 5ISZD 5F1IA 3WK1A 2CMRL 5E9NA 4NSKB 4OIAA 1ZJIA 1E65A 1A4LA 1XIJA 2JB6A 3QIWA 3OMZA 4I0PC 3QDJB 3NBNA 4KZCA 5F2GA 5A8GA 2DJ4A 4HYWA 4M8QA 2L04A 2AK1L 4C6IA 4YHPA 1L7IH 2IMNA 3OO2A 2CGRH 2CDFB 1NGQL 1E4MM 2Z31D 2R6OA 5IOKA 4RWYL 1IGFL 1F76A 5IB2B 4NJIA 1NFDA 2RACA 3UADA 1X9UA 5C07A 5HVWA 3S3SA 1E4XI 1PLBA 5KBNC 5BW6A 1F4WL 4PG2A 4APQA 3WIFA 4QGTA 4GP5B 1FF5A 3RVTD 1E27B 3DPBA 4KRPC 1Y65A 3WBXA 3SOTA 3STZB 2WCPA 4N0UB 3SSZA 2WBJC 3BSZA 3D9AH 1ZTXE 3QHFH 4G7VH 3F58L 3V5KA 1J1PH 2XGZA 15C8L 3NSYA 4PWKA 4W8AA 4MA8L 4E0CA 4JRLA 3P2DA 1GGBH 1MHEB 3JV5A 4PVMA 5HGDA 4S0SD 4HKPA 4PCYA 5HJDA 5B80A 1OPGH 1RCOB 2IEPA 3THAA 1HHKB 1ULVA 1AXSA 4LBEA 2VC2H 4B6ZA 2J9ZA 4HU0A 4BZ1L 4KAQL 3SDYH 5LNUA 1YW1A 4YHKH 4HWBH 4DERA 3ZT5A 3W85A 3TWCH 4WY0A 3P62A 3B5HA 1AFVH 1IYXA 5SWSD 2E1WA 3S0CA 2C4XA 4GIRA 1GGUA 3QUHA 4QR7A 3TBYB 1GKPA 3BVNA 3BJTA 2E6YA 4LSUH 4M6MH 4AQEB 1OG0A 5C09D 2Y5TB 2YN5A 1U30A 3U36B 3NABH 3GS6A 1NY1A 2ZVRA 4L4TB 4IBSA 3QWNA 5KSBB 5IFAL 2CALA 1B2YA 4XHJD 2EICA 4W4QA 1BAFL 3LB6C 1SQMA 2ZTKA 5EO0B 1O1HA 1WCQA 3MBFA 3P81A 4P2AA 4NWTH 1KFBA 3RGVD 4XTRD 5I3GA 5LDSA 2F6UA 3CL6A 4R8WH 4JCLA 2Z1XA 1ECYA 4C65A 5CKGA 1JD7A 2FJHA 4ZT1A 2DEWX 4PVBA 4N2DA 2FZBA 2CUHA 4QLRA 4LS0A 4O51A 3ZGHA 3GUTB 1NGXA 2LVEA 5LDUA 2UWEA 2WXLA 2BVOB 4PJCF 2ADYA 5E8PA 1CXLA 4DPQA 2JTDA 5DMJB 2WUCL 3V9FA 1WFMA 5DMLA 4GW4A 4S1DC 4PH8A 1ZP4A 1C5CL 4JDEB 2Z93B 3DV6B 1F4YH 5JORB 2DMBA 2B0MA 4NO0A 3R06B 3I3EA 3VXOA 5EN3A 1X5GA 4US5D 3CU1A 1QKZH 4MADA 2GJ6D 1ZJAA 3N43B 1OCBA 3CLFH 4M62H 1RZFL 2HXAA 3MSGA 4PYSA 4QT5B 2QKIB 5E6IA 1M7OA 3HNTL 2DU2A 5EOQL 5DMMA 4PUWA 2R0WL 4N90E 4TIMA 1TJ1A 4OV5B 4OD2B 4Z7VE 1BRLA 4O13A 4U1JA 4U1LA 5CILH 2E6AA 3TONA 4PJHF 2DT2A 2VC2B 3Q1SH 4Z76B 3B97A 4LCRA 4NYLB 1E8YA 5D7LD 3CHFA 3KYNB 1QNRA 4KXAA 5DRNA 3DI1A 4PEKA 5LGHH 1J5TA 3RWEB 3P74A 4I5RA 3E49A 2V68A 4YDLB 2ZZ4A 5G4HC 4Y96A 4B5WA 5RUBA 4FS0A 2NNXA 1NIEA 3JV4A 3V0IA 1EDHA 1ITCA 1CYXA 4E3VA 1ZTXL 4HN4A 4Q8VA 3AIWA 4KZ0A 3T9PA 3BOLA 2VMEA 4ENED 4REQB 2G9HA 5IIEB 4IGBD 5EOTB 2I9TA 3WJXA 2E40A 1ZHKA 2HPIA 2NT1A 1YPFA 2L3BA 4LP4A 5DLCA 2DKUA 3F7YA 4WGWB 4GBXC 4ML9A 2X70B 5FF0A 1QR4A 3HF3A 5EFIB 2GK0A 4WJ5B 1U3ZA 1YEJL 2D8KA 4IYKA 4J4PA 3E8VA 5H35A 5SX5K 2I7SA 4MWFA 1OHLA 1SOSA 4NFCA 1A4KA 1T5XB 3SN4A 4JRYA 4DJDD 1VKXB 5F7LB 5CBBA 2NLJA 3ZSSA 4S1FA 3PWNA 4PJXB 4NQCD 5B3JF 4F7PA 2YXXA 4KETA 1WIPA 4DNLA 3PJSB 3L1FA 1T04A 3N42F 2K7QA 1EZWA 1PD0A 2XZCH 2WWNA 4L8CA 3GAKA 3EYVA 4LKXB 3VFTA 5FS5A 5D8ZA 5KVEH 3MRHA 3GSXA 3U1SL 2PTTB 1GK8A 2OQJA 3DFHA 3DK0A 2PWUA 1S9VB 2J1KA 2H32B 4JBRA 4WKZB 2VISB 3ES6B 3E0VA 4AUJA 1KIRB 4HMEA 2V5LA 1RK1A 3KDNA 3E5PA 1GPOL 1C8XA 2EACA 3F7VB 1GONA 4J3VA 3FFSA 2VUKA 1XBRA 1JPFB 2FUTA 2WNQA 1OYCA 1MNZA 5C0RL 2JXMA 1S9YA 3P93A 3IU3A 3K6FA 1BAGA 4A39A 4PV9B 1A6UH 5J9PA 4H7CA 5AYIA 1IARB 1KFEA 1HQTA 2CKNA 1G4TA 1SJBA 3EW3B 4IOSD 1KN4L 4LVFA 3E2HC 4OJFL 3UEZA 2DQGH 1ZANH 5BQ7B 2N0MA 2IKJA 3CFBA 3WKZA 2IWGA 2JK5B 1JGIA 2CK0L 2Y3NA 2WIIA 1W2PA 4PJAA 3QW3A 3MHGA 3IJ8A 1JJKA 2NQZA 1VHCA 1CG9A 2CESA 1FWTA 5EPMA 3JWDL 1E28B 5KN5A 1PS9A 1YYLH 5GZOA 4CJ1A 5BXPA 3E6FB 4EPDC 2P5WD 2D1ZA 3OA3A 3MUXA 1COBA 5CEZD 4GZEA 4JKWA 2BY1A 3S5YA 1X44A 4N2OA 1SM3L 2Q8AL 3BP5A 1RQ5A 1E1CA 3WNJA 2FQGA 1PZBA 3JV0A 1IIKA 3V7MA 1JWSA 2F54E 4KJWC 3UC2A 3ABQA 2D7TH 2CLPA 3MWCA 3V6FA 2A4AA 2CIIA 4G83A 3NA9L 3U6XA 3S1GA 3ETTA 1WC7B 5E4IA 3UZEA 1IF2A 3SDCB 4V1DD 2D03H 1YE4A 4M48L 3N25A 2Q0ZX 3GB6A 2DSVA 5AYYA 4LVNC 3MU7A 1F9CA 4BFNA 1W31A 3K2KA 5D1QD 4WENB 1BF5A 5AC6A 2OPCA 4OD3H 5B1BB 3WS6A 1KXVA 5JNYA 4JNMA 4I1RA 1VGEH 1OSEA 2Q3AA 1RMFL 2PNDA 1U8PB 2WHVA 3T42A 2VFEA 3D4CA 4Q8WA 4LSPL 4YFEA 3WTTA 1A3LH 1N70A 2MJWA 3VX1A 2WBWB 3G5VB 2ADIA 3ONBA 4L4VD 4AY0A 5E1GA 4JPWL 4XTDA 5B1JA 1YY9D 1KR1A 5AHEA 4DETA 3WL1A 3QRGH 2XPKA 3LPOA 1HFBA 3BC9A 4UFKA 2VLLA 4AD4A 4WI5A 1WP6A 3W0WA 1Y0LB 1ZBCA 4QHLB 4WHCA 3T65A 1GQLA 4JN1H 4L3EB 2NNRA 1EDGA 4PREB 2I25N 4K5MA 1JPEA 2EEXA 2R9HC 3NIGB 1YEKH 5F9OH 4N8VB 3RLHA 5BVPH 4LLYA 5B8CA 4P5MA 2ZUSA 5FJRA 3ARVA 4ENLA 3S8FB 2F2KA 2WW5A 3U1QA 4U3SA 2IF7A 2XICA 3HS0C 3WUBA 1ADSA 2ENQA 2IBZX 3VH8G 4K8GA 2ON3A 1OGAE 3P0GB 3BFOA 3ARDB 5F4XA 2VB5A 1UKPA 2J24A 5AHNA 1ZRUA 1BVOA 5AB3A 1G7JB 4X4ME 2Y69B 2DTMH 3PP3K 5AWNH 4FABH 4FQXA 1XIGA 3LKPA 5H4ZA 3IDMA 3QUZB 2CEQA 4Y4KC 2GBVA 3GMLB 4QRRD 2V2WA 2IDSA 3PPGA 2P1YA 3HPFA 1OAKL 4P2CG 3DX6B 2J9YA 4D3CL 3SODB 1E6NA 3C3UA 5IHWA 4G9FE 3P0WA 2WZIA 5SV3A 1DQXA 3A64A 2GT9A 3DX9B 2YEQA 4IFRA 3IE4A 1XF2B 3LQGA 4GI9A 1YEHL 3URAA 4QCEA 1FL6A 1ACYL 4R4FL 3GG7A 3NACL 3LV3B 4MZ1A 4CN4A 4G8GB 2E6JA 1EOMA 5FYJH 3CFEB 2OU4A 2WOBA 4XPGH 1JSYA 5M95B 4O0KA 1T66D 2VLRB 2NX5E 3KLQA 3MXWH 4IQLA 4G6ML 2MTPA 5KSUA 2DZPA 1QEWB 3D39D 3HVNA 4R7NA 5FHAH 1BAWA 1J8KA 1TDQA 5KVGH 3PUEA 1GUVA 5DVNA 1DJWA 5BWAA 4LNYA 4FQ1H 3QGKC 3MQIA 2PCFB 3VX0A 4NO3B 4GINA 2PLMA 3HAEA 4Q7BA 4C4UA 4YTQA 3LIZH 1US0A 1UP3A 3CFNA 3FS9A 4X7EC 5C55A 4BWLA 3MUHL 1X7QB 2NUYA 5AYBA 4JFPA 2O6CA 2APBA 5ITBH 4M6PA 4AFYA 5LGYA 3O4LE 4ZB2A 4H13C 1H1ZA 2BP0B 3B9AA 1J9QA 1DO5A 3K1DA 4KMTL 2Y5QA 5FJIA 3RWFB 4W81A 1XC4A 4DF2A 1G1CA 4KJQD 5CGTA 4IRZL 4JN8A 2VL4A 4K9EH 4ANVA 5C0BA 4UTWA 4BJLA 2YEZB 3RM4A 4UYQA 4ZBJA 3VIMA 1MRQA 3S2JA 1MSSA 2YPVH 3SPJA 4POZD 5H2BA 1SOQA 1G0CA 43CAA 2R1KA 4FF9A 2GCYA 4H19A 2R1YA 5GGSY 3W02A 3D85A 3N40F 1S3HA 2NY4D 1S7WA 3RWGB 1ETB1 4R27A 3D34A 1MFEH 4GIAA 4ZUVA 1AQHA 2J8UA 4O1BA 5I6NA 3CN0A 4L5ZA 2R2BB 2GQHA 4I4WA 4BK5C 2AQWA 2PN5A 4UIMB 4N0UE 1AG0A 2VLJB 3QT2A 2FGWL 5I0WA 1ZIBA 3DJ9A 3E2RA 4MAVA 1U2HA 4AENB 3L67A 5A8QA 1UA6L 3P4OA 1BD2B 4XN5A 1JMXA 1XAKA 3OX8A 3BVVA 2D4FA 1XLLA 2YK1L 4PJGF 5JIIA 2QVHA 2VDMH 5AOLA 4XX6A 3MRDB 2IKIA 2JVUA 4DBSA 5JZ7C 3QUML 4FFWC 1XF1A 2Z6JA 5F71A 3L7RA 4OZIA 4UQCA 2LHAA 2V8LA 5DD5H 5FUCE 4GP4B 5SV4A 3V5CA 1HXYB 4PU2A 1NFKA 1F05A 5JLZA 3O6AA 5CC6A 5FKAA 2E6PA 3RY5A 4KW2A 2X1TA 1XLEA 2WXPA 3QDMB 4BQBA 4BI7A 2OKTA 1QSFB 1XKYA 1BQLH 3M64A 1W91A 3X13B 4UFHA 3WN6A 3TXVA 1AHKA 2F7FA 1A5LC 2J3SA 1J18A 4FLRA 2AERT 1VGKB 4A2MA 1BKSA 3FB6B 4L4TE 2GJ6A 1HESA 3GG0A 1QYGL 1DQLL 4IOIA 3L2LA 5KSBE 2QPXA 1N8OE 3VGBA 3WHE0 4OV4A 1MUCA 3A3HA 2YL8A 1FH2A 4G3YL 2GZXA 1IR1A 3Q13A 4KKNA 5I15L 4FXGC 1DUZB 4OUIA 1UQSA 3LRGA 5TFSL 3G6JF 3EH3B 3C8FA 3PYCA 5E99H 3GSWB 1JTOA 4YTUA 1SHWA 3BXWA 4JHBA 3OMNB 1YEEL 3B0XA 4XBEL 3D12B 3Q44A 5C7XH 3EDEA 1MCSA 1J88A 3N29A 3BWWA 2Q76B 5ID0A 2OGJA 2E4TA 4CVWA 1HHGA 1K8CA 4HBKA 1UOKA 3CSPA 4JFDD 3H4WA 3RX2A 2N59A 2GTZA 3CVHH 4N22A 4E41A 1CXKA 1BTCA 5GQBA 1RZPA 5JH2A 2HFFA 1RZJC 1U8NA 4DIAA 4PJFF 4RIRA 2FFCA 1C1EL 2FEDC 2VDGA 3TE9A 1QAPA 1LROA 4KI5C 4WEEA 3ESOA 1PS3A 3FJTA 2G37A 2BTMA 5I17B 1RHCA 4JO2L 3G5EA 4AY8A 1D7BA 3VG0L 3SCMD 3M1OA 1ISWA 4AZ6A 2GITB 1BBDH 4HGWA 1WBXA 4C6PA 1A65A 3VKBA 3D09A 4X80H 2CO7A 3MNZA 4L1GA 4AD1A 2F58L 1NCAH 1EGVA 2BERA 4KPLA 4QOKD 2WZHA 3QJHB 1M7IB 4IDJL 3UQNA 2H8PB 1JHLH 2GUOB 3QQDA 4GI8A 2RHGA 1VRDA 2VX4A 2FMNA 2Z1SA 3UYCA 1CN4A 3V0GA 1R7OA 4GY1A 3STLB 2FVNA 3OP2A 3VKKA 1UUMA 5BXFB 3W7OA 4LCUB 4WSJA 3MSRA 4Q6IA 5DXXA 3A22A 1ZHNB 2B20A 2W0FA 3G0SA 3OAUL 1NBZB 4FR1A 2XG5A 3L17A 4JANA 3UESA 4L8DA 4NPYA 2WLYA 3ZJ7A 4JK0D 4JFYB 5I26A 1D7KA 3T1GA 1JNLH 3AREA 2WXKA 1A4BA 4Z3IA 3H9HA 4GKLA 3DUUB 2ZTBA 3SQSA 1K4DA 2NWRA 4NZUL 2BP8B 4PJXE 1SFHA 2V0TA 4RFOH 4NUWA 4B9JA 4F33A 1U8LA 3F4NA 3ARZA 3VTTA 2APFA 3H3PL 3CG8A 3NSDA 3ZL4H 3NJKA 3PK7A 4JTTA 2NY3C 4GSXA 3NURA 5E9DA 5E8DH 3ATYA 1HYSC 5AVHA 2YEVB 3CVHB 3VFWB 4A3HA 5LIYX 3BE1H 3CFTA 7CGTA 2OEJA 5HA7A 4KGJA 3F6IA 3AU2A 1ORSA 2GFBB 2NYYC 1ZA3B 4H2AA 1ZBVA 3FRUB 3MGOB 1LWIA 2R23B 4P46C 1NSNH 5HMSA 4JDVA 1CLVA 4AE0A 4Y16D 2DWEA 3ZSTA 2Y85A 3EJZD 2YD4A 2CGRL 1FVDA 4MWAB 5BZAA 4MXWH 4Q0XH 1X97A 1R19A 5IVXA 2D2CC 2R29A 3F4WA 5C71A 1EVTC 2CLFA 4HETA 2YRBA 5M03A 3R0UA 2AXFA 2E9LA 3FN3A 4EI0A 3PL6D 4AIXA 3RNKA 3VJ6B 3IS1X 1Y6KR 3G1VA 4Q4RA 2QUTA 3LVTA 3UG8A 4OI8A 1P5UC 1D5MB 5GRWA 2AC0A 2K0RA 3SYPA 3D9AL 3LHTA 3QHFL 4G7VL 2EVJA 5CAKA 1J1PL 4WHDA 4YTRA 3OR7B 3OBEA 2OWXA 1TQCB 2UY7A 1MFBH 4MTMA 3V0SA 2ACUA 3UROR 5LAPA 4F7MB 3CN2A 4JZNB 3GI8L 1NP2A 4L4VA 3KOWA 1GGBL 1TQBB 1TVBB 1QT1A 1U8IA 3AMLA 4O50A 1CWVA 4OSUL 3HE7C 3TQVA 3TN3A 5C0AA 1QO2A 1YNTF 2HT3C 3QI9C 4QUOA 4HPHA 2ZSWA 2GKIA 1KGIA 3NGFA 4LARH 3OQ8A 3SDYL 2AAMA 1J8HB 3S3GA 5DZJA 4TOYL 4YHKL 2VR5A 4HWBL 1B4RA 1SLVA 3LKOB 3TWCL 1QR7A 2WMFA 3E6HB 1AFVL 3I9AA 4KHTL 5HYJB 2XWTA 3CPLB 4HU8A 4XNYL 4LLWB 3EYUH 4LSUL 4M6ML 2OMNA 5B39B 3L4YA 5KVEE 1VCGA 3NABL 2N1TE 4OD1L 1JGDA 3QZPA 1CYWA 3VOGA 5CJMA 4Z8FL 4Y2NA 4GXUN 5GS2D 4F37K 1KBWA 4H40A 1TV5A 3RKPA 1KIUA 3O6YX 6TAAA 4P4KA 5DJ8A 2V3FA 5HAOA 4HP5A 5H2ZA 2J5WA 4NWTL 3KYOB 1GVFA 2OCCB 1TTPA 3VZXA 3S9DB 4O00A 3GSQB 5C0GB 3W84A 1FAIL 3OJVC 1T89A 2BBFA 4Z5RA 3O6FA 4R8WL 4L3EE 4LCCB 2J62A 1T40A 4WU7A 3NIGE 4Z77B 1F6AB 4JEQA 3QBUA 3QG7H 3C5XA 3S96A 1XG3A 3AXKA 3APFA 3L1GA 5HGHB 5K9OB 4WHYH 3B43A 1DJGA 2OTUB 4MX7A 8FABB 4J3UA 1QMUA 3W7GA 3EHBC 3BG9A 5CD3A 5GPRA 3MRBA 4MD4A 1F4YL 3IDXH 3G5YB 3PGCB 35C8L 5HDQL 2PKDA 1DE4A 3OW1A 3EWCA 1QKZL 1VFAB 4XCCH 4ABWA 4JKKA 5I1EH 1JZJA 1T2QH 4G9PA 4K2SA 2GY5A 3VI4B 2XZZA 1YY8A 4A2HA 1E5NA 3L3GA 4HCIA 3PJUA 4WW1A 4HKJB 4DP1X 4PMNA 1H6EA 4A7TA 2F5AL 4MMXB 1TZ9A 1PG7H 1UR9A 3RDTD 1IKOP 3PWJA 1PD6A 1WXYA 4U5IA 5CILL 3HN8A 2XX1A 3HGRA 4F91B 5G4EA 1F3XA 4PW9A 3RWJA 3UZXA 3RO6A 5EF0A 1RJRA 2K4AA 4PAZA 2GYSA 3FDKA 3IIXA 2OMYA 5KVFH 3BIAX 4G8GE 1GT8A 1FFNB 5IHHA 3JUGA 3HRZC 2VLRE 2ACQA 5C6PB 1HTYA 4XSMA 4QPEA 2VWTA 3L23A 4QRAA 3FO2A 2C1OA 3NQFA 5LHFA 1KBIA 2Y6TE 1NGWA 4F80A 1AHWC 2WJZA 3PWVA 5IQ9B 4IJBA 1S38A 1KYOJ 2G75A 1M65A 1G5GA 2TAAA 3SO7A 2ITEA 3FOLB 4AH2A 3L6FA 1RVFH 4NQDA 1KIPB 3RZWA 4QLKA 2BVYA 2J88A 4X83A 2EJ1A 4JM4H 4XN9A 3S5LG 1HYRC 5AZ1A 5ABDE 1ROCA 8XIMA 1JZ7A 2C1PA 2EKGA 3TO2A 1YYAA 3BPWA 4O18A 3V10A 5JHMA 5FDYA 3BYTA 3RWHB 1QPQA 4OLWH 4PTXA 1VC4A 2P8LB 1WH0A 3ZDYF 3LS4H 4XD4A 4G71B 4KNSA 4LPXA 4HPJA 1H61A 1T96A 2IG2H 3JTSA 1TF4A 1RHFA 4F0RA 5EU3B 4P7NA 1IE7C 2OFJA 4KRUA 4NO2A 1EA9C 5FEPA 3D0LB 4ZS6D 3BO8A 4XPTH 3MI3A 3IJ6A 2Q01A 2VLJE 3B6SB 4S1QH 2ILLA 1G0DA 3EYOA 4QRUA 4B2DD 1XLFA 1HIML 3UPRA 3MKCA 4BKLB 2CE6A 3WV0A 3SGJC 1OAZL 1IIGA 1F1GA 1Q6LA 1I4NA 1A6UL 3WHXB 1BD2E 1H7RA 4YHIA 4A35A 1EC8A 3WNMA 3GEFA 1P6BA 1MLCB 2I5GA 1ZANL 4KWUA 4L48A 2FZDA 1ELSA 2MFNA 4WV1A 3MJ9A 4R7VA 5D2NC 2CGZA 2R56H 3C9NA 4GBXB 5FYJE 2QVMA 1VJZA 4YR6B 4YBLC 1I2QA 1HKLH 1TG8A 1UB6B 5TDPB 3OB0K 1TTFA 1DIKA 4N2NA