4J27A

Crystal structure of a gh29 alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in a novel crystal form
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three dimensional structure of a bacterial alpha-l-fucosidase with a 5-membered iminocyclitol inhibitor.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 163
structure length 439
sequence length 439
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4j27A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4j27A01
3WMBA 1MWOA 4BF7A 1SZNA 2YJQA 5A2AA 3CZJA 2GK1A 2ZOXA 2VTFA 4BZYA 2CIPA 4B16A 2J7CA 3NCOA 1B3WA 1R7AA 4AC1X 4DUVA 1QW9A 3AYRA 2JALA 5A6SA 5FIPA 1KTCA 1CIUA 5M5DA 1H41A 2J7EA 3ZT5A 1UASA 3BVWA 3VUPA 2JIWA 3L4YA 2DSUA 1KB3A 1JXKA 3IJ8A 1OGSA 2D0HA 1KQZA 5A6JA 1D2KA 1E0WA 1UWRA 1QHZA 4GI8A 2D0FA 3CHDA 3WQ5A 1LG2A 2WHMA 2XGBA 1OWQA 4U33A 4CD7A 2VO5A 3WNKA 4WSKA 2WCGA 3AJ7A 2XTKA 3N1AA 1GHSA 2MANA 3VTRA 3GXDA 1BG4A 2PBOA 5D9NA 7CGTA 3ARZA 1VJSA 3EDKA 4TX6A 1MFVA 1EDGA 2WBKA 3BUPA 3VSVA 1K9FA 4LX4A 3AMGA 3EJRA 1UD4A 4JHOA 5GQBA 4Z2GA 4AMWA 1NP0A 4ZXLA 1ZBWA 3VX1A 4NX0A 1E6ZA 3N9KA 3FN9A 2VMFA 5C8BB 3VU2A 1NOWA 1B30A 2WLYA 3AZTA 2OWXA 4OKDA 3WF3A 3HJEA 1GQKA 3K8LA 1OT2A 3LXCA 2WHKA 2BY3A 5LA1A 2O92A 3VIMA 3DX4A 1HIZA 4ZE4A 3BH4A 1XSIA 4JHZA 3WY2A 1EGZA 4D6GA 1PPIA 2BNJA 5GPRA 2RGLA 1DWJM 3OGSA 1HVQA 3OGVA 3VX0A 4UFHA 5BXSA 3LPPA 1C92A 1Y7VA 1PX4A 5LYRA 4PMDA 3WD4A 1UKTA 1W91A 2UY5A 5EFDA 1CNVA 4UQAA 1BHGA 2VX7A 3DYOA 4QAWA 5C70A 5BYWA 3CMGA 2FDMA 1ISVA 1UWQA 1W3HA 1JF5A 5ABGA 4AYGA 2X05A 3HG4A 1GONA 4OUEA 4HZ6A 5JBEA 3UEQA 2VURA 4MNJA 2GDVA 2ZX5A 2VR5A 4PTWA 2XSBA 2QMJA 5I23A 5HOSA 5GNXA 1H11A 1JI1A 4PSPA 3CMJA 1ZJBA 2XN0A 1UQYA 1AQ0A 1LL7A 4KWUA 4UFMA 2NT1A 3HG5A 3N17A 4GO8A 4B15A 4HMDA 5I3DA 1JYNA 4U5IA 4LYQA 6TAAA 1V6WA 4AZGA 1ZJAA 3BGAA 3VMPA 3VGDA 5CZKA 3GBDA 1XCXA 4JL2A 1J0YA 3K4DA 2ZUSA 2ZUWA 4FMVA 1E72M 3FY1A 2E40A 4WIWA 2J4GA 2YL9A 2QPUA 4M1RA 3SCWA 1QNOA 1EHNA 4PMUA 2OSWA 3NSNA 3BVVA 3WNLA 4GZJA 1V0KA 5D4YA 4JKLA 3MUAA 3WQ6A 1DEDA 1UH4A 2XG9A 4M56A 2WZEA 1Q6GA 4U5KA 1BSIA 1G5AA 5CPSA 4AZHA 1NP2A 4DM2A 4PBGA 1B3XA 5ABFB 5A2BA 3EMQA 1CENA 4X0VA 1YHTA 3H55A 4DWSA 1PEZA 3D50A 2VX5A 2FHFA 1O6IA 3NDZA 2BY2A 4B9YA 3MV01 1MFUA 1LL6A 1CLVA 2EPMX 2J8GA 5A6MA 4EE9A 1BQCA 3II1A 4UNIA 1C8XA 4TVUA 4A3HA 2VT0A 3K46A 1KGUA 3LPFA 5BXRA 3ZO9A 1PZ3A 2CKRA 4JIEA 5JIPA 4J3TA 1GOMA 2XM1A 2IUZA 4BCEA 3CLWA 3CTTA 1FH9A 1HJQA 5A8OA 1XH1A 1TFVA 5E0CA 1OIMA 1NWUA 1VRXA 3SCOA 1HXKA 4R27A 5KZ6A 4HA3A 3PZOA 1GCYA 3MI6A 4AMXA 3VNZA 1V02A 2BV9A 1WZLA 4HOZA 3EJSA 1V3KA 2BHYA 2XVGA 3VSUA 5DF0A 4PSRA 1R34A 3TTQA 4C7FA 2F7QA 3LXBA 5CXPA 1CGTA 4UQEA 2YOCA 1E73M 1HNYA 4UOJA 3BVXA 4D6IA 3BC9A 5M3WA 3SUVA 1LWHA 1JI2A 2VRQA 2D3NA 3WH8A 1OIFA 1KFWA 3EBVA 3LPGA 3VD4A 4LYRA 4PN2A 3UESA 4FNSA 1W1VA 4M29A 2YLLA 4D6CA 2OW6A 4N0RA 4W89A 4CUCA 2WNWA 4PTXA 1W9UA 3CH9A 1HKJA 5D8ZA 3CGTA 4UQCA 1FP9A 1A47A 4HOXA 2G8ZA 1E40A 3CZNA 4UQDA 3WNNA 3D4YA 4TTGA 2XWDA 2C8NA 1WDQA 3EJTA 1SR0A 1UKSA 4WJXA 4A4AA 1GOKA 4H8UA 1BYAA 3ZR6A 4H41A 1AVAA 1JDAA 3SURA 1KWGA 3LXAA 1E5JA 3CBWA 3IJ9A 1GOIA 2AMGA 1GZJA 3BMVA 3UG3A 1GPFA 3T08A 2VI0A 4RE4A 4P7RA 3WDRA 1CTNA 2J47A 4W85A 3HU7A 2XFFA 1K9DA 1HN1A 5I78A 2F7OA 3GNOA 4MADA 4JFUA 3WDHA 3SCNA 5DFAA 1XSKA 3RJXA 3W38A 1JDCA 3A4AA 4NRSA 3SUTA 1BYBA 3AISA 1X1NA 1JIBA 3BUIA 1TG7A 2EPLX 4HZ7A 5ECUA 1JL8A 1JXJA 4URIA 3WF2A 4QFUA 2WMIA 1VENA 4YN5A 3VGFA 2GJXA 3VM5A 1ODUA 1GHRA 1TMQA 2Q8XA 3KL3A 1PBGA 4L4PA 1UOKA 3SEPA 3AYSA 1RP9A 4UTFA 5AYIA 2X1IA 4KRUA 1R46A 2PBGA 4B9ZA 1J0HA 3W81A 3NYDA 4Q22A 1QBBA 2V3GA 1ISZA 3WD1A 2HVMA 4MNMA 1MW0A 1W1YA 5E9AA 1E3ZA 4BA0A 4DM1A 2PWHA 1BLIA 4HU0A 2O9PA 3A24A 1UH3A 1G9HA 1QNRA 4NZJA 3O2LA 2PWGA 4V27A 3VIJA 4ACYA 1CEOA 3A3HA 3FHAA 2DH3A 4BQ4A 5I24A 4U3CA 3TP4A 2XYLA 4OBRA 3RM8A 3BAYA 1MXDA 2BXZA 3WN6A 4AW7A 2D22A 2GJRA 3BCFA 4KH2A 4D71A 2XM2A 1EQCA 5IFTA 3S2CA 1R33A 2DSKA 1CBGA 4FNUA 1ZL1A 3U5YA 1HJVA 3TA9A 2EEXA 1E1FA 2A3BA 4CCCA 4TXEA 2RGMA 3N15A 4MDOA 1MW1A 3THDA 2W5FA 3PZMA 1UD6A 3HG2A 4PEEA 4MTVA 3VKKA 3CZSA 2XFYA 2WYSA 3BAIA 3ARVA 3AFBA 1GW1A 2XJ7A 3ZIZA 3GZAA 4B3LA 2ZUNA 4AXNA 2CHOA 3VVGA 2OWCA 1G94A 1UZ4A 1UWUA 5BROA 3VD5A 3GM8A 5AY7A 3BAWA 2Y24A 2F2HA 1L0PA 3AHTA 1UHVA 2ZX8A 1IZKA 1TR1A 5CG0A 2WXDM 4J27A 5F7UA 1CXEA 5M03A 4GXPA 1JZ3A 1M04A 3NSXA 4MPKA 2VOTA 4DUXA 2DQXA 3GXTA 3A4WA 4P8XA 2JEQA 5DEZA 3N11A 4OOUA 3WY4A 5A8NA 1WDSA 4J3SA 2CPUA 2G41A 5I6SA 3EJQA 2J7FA 3VPLA 3IK2A 3ARSA 2DSVA 3MO4A 1FA2A 1VBUA 1MVYA 4AIUA 2AAAA 3AS2A 3CHFA 5CJ5A 3WFLA 1QNQA 5D9PA 3GNPA 3TTSA 1V3JA 3OBAA 1IZJA 3NSMA 2XVNA 4LGXA 3MUIA 4FNQA 2VZVA 4ZFMA 3LRLA 1JD7A 1JAEA 4MB4A 2QPSA 1JZ5A 3WDQA 2JF7A 3OA5A 4F66A 1VFUA 2YDSA 1MW3A 5E6ZA 1DWIM 3RMEA 3DX1A 2YL6A 3WF1A 1XRVA 3AIVA 2EBNA 1WP6A 1RPKA 2CHNA 2WMGA 1YQ2A 1TCMA 1K9TA 3ARXA 3SUUA 3WD2A 2A3HA 1HKMA 4BQ2A 1WPCA 1B3VA 1CZ1A 3AIWA 5GNZA 4XX6A 2YBTA 4NZCA 1DWHM 3WF4A 3N04A 1V0NA 4GKLA 1ECEA 4ACZA 2YIHA 1OCQA 1BTCA 2CBVA 3WQ8A 3BAJA 3DX3A 4XV0A 1B3ZA 2J79A 4FK9A 2W4XA 3L4WA 4U31A 4CCDA 1IT0A 3EDEA 5ABFA 2GK1B 3T2OA 2FGZA 2PC8A 3VD7A 2OYLA 3VGGA 4K68A 1VEOA 4PMYA 3PZUA 3GYCA 2VRKA 1BYCA 4M82A 1KQYA 3N12A 1UYQA 4H2CA 3AMKA 2IXUA 4CN1A 1OT1A 1PX3A 2W61A 3NDYA 1KXTA 3K4AA 2V3DA 4P8VA 1HJWA 1J0JA 1OD0A 2G3MA 3H54A 4M24A 5HPCA 4XB3A 1UD5A 4DUWA 3RILA 3AOFA 3GXFA 2C7FA 4RL3A 4XUYA 4ML4A 1W9DM 2Z1SA 3VIPA 4U2YA 2WCSA 3SUWA 1MQRA 4D1IA 3PZTA 5A6BD 1UR0A 1Q6EA 3CIVA 3NUKA 2Y4SA 1MQPA 4PMNA 1EH9A 2J75A 2XIBA 3BUQA 1E15A 1UKOA 4JAWA 1GQIA 3QR3A 3WQVA 1E55A 3ZMRA 2VX4A 2CBJA 3DHPA 3MUZ1 3QHMA 4MNLA 2V5DA 4GI9A 2PI6A 4WSJA 2W67A 5IHSA 2GUYA 1GQJA 5E0FA 4MJ4A 4E4PA 1XYZA 3IAQA 2D73A 3L4ZA 1O7DC 1CDGA 2JIEA 1JZ6A 2W62A 4FNPA 3AZRA 4FLOA 1QWNA 3AIQA 2ZUTA 3GTNA 2XUCA 3AIRA 4IPNB 1OINA 1Z32X 1BAGA 4TVDA 4FLSA 3KLLA 4ATDA 5CGMA 1GORA 2VVSA 1VB9A 4LXFA 6A3HA 3VDHA 1KXQA 2FGLA 5AYBA 5CGTA 4CN4A 2EABA 1OB0A 1CYGA 1C3FA 3RO8A 2WMKA 2XVLA 3WQ4A 3CUGA 5A69A 4ACZB 3WEOA 1TQVA 8A3HA 1CXIA 2WLZA 3ALFA 5HNNA 2EQDA 2F7PA 3CUIA 3I3BA 4D6HA 1PS3A 1TA3B 2WWCA 4C7GA 1FFRA 3SCQA 3W82A 5DMYA 1D7FA 5JUVA 2YA1A 2QHAA 3QOMA 2NT0A 3TTOA 1HF6A 1FHLA 1ITXA 1UG6A 3DDGA 2V3EA 3APGA 2WVTA 2PF0A 1CPUA 3WH9A 4AWEA 1B31A 1SYTA 4PUDA 4HU8A 1TZ7A 1FH8A 1BPLB 1ESWA 1UR9A 1GVIA 2WMHA 3WFZA 3D51A 3L2LA 5E70A 3T2PA 5BXTA 1CXHA 2DT2A 3FAWA 3PBGA 2XFRA 1NOFA 3ALGA 5FOOA 2A3EA 1UD8A 5FL0A 1E6PA 2W63A 3VGBA 4A3YA 3ZQ9A 2QV4A 3ECQA 4XZWA 3RIKA 3NJ3A 1U30A 2OW7A 3BLBA 1J0KA 1JDDA 2A3CA 4H8HA 3B8SA 2O9OA 2WVUA 4J3UA 3DYMA 1E4IA 4M80A 2WZIA 3EDDA 3NIYA 1W3KA 3PTQA 1W9XA 1E6QM 4MDPA 4AYSA 1EHAA 3BLPX 3VIOA 2VQTA 3EYPA 4MNKA 4Z2HA 4NRRA 2FHCA 1WZAA 3J7HA 4HP5A 1WNOA 3B9EA 1PAMA 1R87A 4CD6A 3IGUA 4D6EA 3VILA 4Z2KA 1BVNP 2OSXA 1JNEA 2WMJA 5EBAA 2YDRA 1HL9A 1V0LA 1UR4A 1UWSA 2CNCA 3T09A 4AZCB 3VIGA 1JFXA 3AHVA 1GOWA 6CGTA 7A3HA 3WUEA 4MAZA 1HP5A 2ZXQA 2CBIA 3K8MA 1ZB5A 4PTVA 1W9VA 4DWSB 3OLGA 3OZOA 4C7DA 1AMYA 1QWUA 3AMLA 2PWDA 4UFKA 2OYMA 4OIFA 4TOQA 3GXIA 3KEHA 2WSPA 1VIWA 2Y8KA 3CZEA 2EPKX 2IXVA 1EO5A 5LA0A 3AZSA 3PZQA 4IM4A 2VC9A 1FOBA 1V6VA 3WEMA 4S3JA 2BS9A 2CESA 1DWAM 2F61A 2X09A 1I1WA 5I5RA 3VIIA 3T0BA 1QI5A 1WAWA 3CUJA 1WZMA 3CPUA 1E43A 4GPNA 1BYDA 1NWRA 3L4UA 3PZGA 1XD1A 4YHEA 8CGTA 2WAGA 3WEZA 2C0HA 3KL0A 5HDRA 4Z2IA 1CXKA 3HZ3A 5BCAA 1MQQA 1HX0A 4PMOA 2J78A 1E4LA 1KCLA 1W1PA 2VX6A 1C7TA 1MYRA 2FYVA 1K6AA 1OSEA 3W28A 3CUHA 3PZNA 1TUXA 2ALWA 1WO2A 2WK2A 4M81A 3L4VA 1X6NA 2WC3A 3G6LA 1OM0A 4JL1A 3BUDA 3MANA 1E71M 2ZICA 5BXPA 1J10A 2XIIA 1D3CA 2E0PA 4UOZA 1U2YA 4W84A 3KE0A 3CUFA 4AZCA 2OLHA 3AHXA 3UETA 2YDQA 2WMIB 3MS8A 3GH7A 3WF0A 5CPTA 2WVSA 1O7AA 3AI0A 1QI2A 3I3DA 1E6XM 4AD3A 1CECA 1QHPA 5JIWA 5JBFA 4GZEA 2ZUVA 1VFOA 1FHDA 5FD0A 2XN1A 4WKHA 4PTMA 1MXGA 3EDJA 1VAHA 1JYWA 3WD0A 1PX8A 1MW2A 4MB1A 2AOSA 2UY4A 3WKZA 4RE2A 1QNPA 4WK9A 1C7SA 2Z1KA 2E3ZA 2W92A 1CGXA 3ZM8A 1NWTA 1TVNA 4JCLA 4P8WA 3BUBA 4AY1A 4OZOA 3VDBA 3QHOA 4QLJA 2ZXBA 1E6RA 1HT6A 4J7RA 3VIFA 1B1YA 1US2A 1W9PA 2YKKA 1JGIA 1JD9A 5TD4A 2BVDA 4GINA 3B9AA 1R86A 2WMFA 4Z2LA 1F4HA 4DO5A 5HXMA 1E56A 4W8AA 4ZEPA 1WE5A 2CETA 4X0NA 4QLKA 2DH2A 3QHNA 2XGIA 2QF8A 1LJYA 4H8VA 4W7UA 4W5UA 3GXMA 1ZBKA 2WKGA 4HPHA 1VEMA 3FXYA 4J3WA 2DT0A 4PYSA 1Q6DA 3ARRA 3AIEA 4CVUA 1KR0A 3AMCA 4FNRA 3KZSA 3D5HA 2OWWA 5CSUA 4AIEA 2WC4A 1E5NA 3MSDA 1V3HA 4J3XA 5E1QA 2XVKA 3VGEA 1GUVA 1H5VA 2ZUUA 4HA1A 3OLIA 3O6AA 2FHBA 3OB8A 2VVNA 4JFWA 4JCMA 4S3KA 1WDPA 2W91A 1JF6A 4TUFA 1EDQA 1LL4A 2VL4A 4OBSA 4ZENA 2HISA 4W93A 4IUGA 1UD3A 4P7OA 3IJ7A 4KMQA 2WVVB 1HKKA 3OG2A 3MSGA 4HA4A 2G4FA 1EQPA 1TVPA 2Y8VA 3BVUA 1VEPA 4KGJA 4AIOA 1LG1A 2O9TA 2GVYA 3ARTA 1G0CA 1KXVA 2EO7A 4PMQA 2XVPA 5M17A 1HXJA 3F5JA 4WF7A 1Q6CA 3A4XA 3UCQA 4X9YA 3L2MA 3AROA 1W2VA 3K1DA 3WH7A 3N18A 3OGRA 4W7VA 3VOCA 1V3LA 2BXYA 3WMSA 1EXPA 4JKKA 2CBUA 4AZ5A 5FCZA 3WUBA 2WBGA 3FNDA 1R85A 1BFNA 5A3HA 3FW6A 4V2XA 3DX0A 2WPGA 4HZ8A 3WIJA 3QOKA 2VCAA 2O9RA 2F8QA 2ZX6A 1AQMA 1QNSA 1C93A 5D9OA 1HJXA 3GXPA 2WHJA 3WUGA 5EB8A 2VJXA 3SUSA 4W88A 3CV5A 1HVXA 2E9BA 2UY3A 4BQ5A 4JKMA 4CD8A 4PMZA 1E4MM 4FLQA 2F18A 3ZSTA 2A3AA 3ARUA 3VO0A 3A5VA 4OOZA 2GJXB 4GIAA 3CC1A 4GQRA 1V02E 2ZX9A 3BLKA 1TQWA 4AMCA 1US3A 1V3MA 1WDRA 3KWXA 1L8NA 2JF6A 5EMYA 2EADA 2PWFA 3WNPA 4U3AA 3ZJKA 4CCEA 1CGYA 7TAAA 1J11A 2G3IA 4B3KA 5I2UA 1I1XA 1PIGA 5A2CA 4N42A 3RM9A 3H53A 3W26A 5AC5A 3I3EA 2YFNA 3WL1A 2BHUA 1VJZA 1GQLA 1B3YA 1HWWA 4MAVA 3WY3A 2J25A 2WB5A 2BHZA 1V3IA 1XHGA 3D3AA 3RM4A 3VD3A 1CXFA 2D23A 4UOQA 1EDTA 1B2YA 1W3JA 5I79A 3CHEA 1KBKA 3WELA 4GO9A 4NI3A 3AICA 2EAEA 3K8KA 1GOOA 4EAMA 5I77A 2EACA 2V38A 1BF2A 1B90A 3WMCA 1RH9A 1EA9C 2CCRA 3W29A 2JE8A 2VCCA 1XD0A 4BS0A 1NARA 4D6DA 3AXHA 3ZOAA 3VIKA 1ZBVA 1C8QA 1R8LA 4H7VA 2ZE0A 4CD5A 3AQUA 3N13A 1XC6A 2E4TA 1E9LA 3BMWA 5A6AA 4AZBA 1W3LA 1XSJA 3UG5A 1C8YA 1UR8A 2B31A 4MJ2A 5DO8A 4P7NA 3OLDA 3DHUA 1TQSA 1JYVA 1TE1A 5D8WA 5IXEA 1W1TA 4YHGA 3G6MA 1WCGA 2YFOA 3VNYA 4R5EA 4P7QA 1EOKA 2FH8A 1ISWA 3CO4A 2VR4A 3AIUA 4JZ5A 3U57A 4AEFA 5CPQA 1C90A 4TX8A 3AS1A 4LQ1A 4QP0A 3F5LA 3UR8A 3F4VA 1EOMA 2G3NA 1RD6A 1QX1A 4NZFA 4IISA 5AC4A 2ESCA 3RDKA 1U33A 1JNDA 1SMDA 3BSGA 2X0YA 1ZU8A 1CLXA 1GJWA 2CXGA 3PN8A 3ZJ8A 3B9DA 1M53A 4F8XA 4DWSC 3WH5A 1V6UA 2VCBA 2BY0A 5FL1A 1BGGA 3W24A 1E3XA 3LRMA 4KRTA 4NXSA 5A6BA 2W66A 3POCA 4ZXOA 3VD9A 5JBDA 1W2PA 4F79A 1S46A 2F1AA 1PJ9A 2DSZA 3AHYA 4D6JA 2YBUA 2QMKA 3PTMA 2Y5EA 4CKQA 4FNTA 5A95A 1NH6A 1WB0A 2DSWA 4D6FA 1GNXA 1T0OA 3E1F1 3BAXA 1QW8A 1H49A 4NXKA 3GBEA 2VRJA 5IDIA 3VINA 1KR1A 1XCWA 1EIBA 3WSUA 4CU8A 4P7LA 2GSJA 1E4NA 3SCRA 4ATWA 2WKLA 3SCVA 3DC0A 3RJYA 4KGLA 2F7RA 1B9ZA 4QLLA 4GZIA 4QCFA 1R7OA 4UR9A 4HPGA 2G3JA 5I0DA 3AHZA 2EJ1A 3TONA 3WUFA 4AISA 1H1NA 4F9JA 2X0HA 3THCA 3CZGA 1KWKA 5E09A 3VM7A 2WW5A 4GI6A 3W6LA 3ARYA 2DT1A 3M6DA 3VSTA 4Z2JA 1UZ1A 2X8RA 4D72A 1JZ2A 1H2JA 4JFVA 1M01A 1CGVA 1KTBA 1UR2A 4PMRA 3ARPA 1VFMA 1Q6FA 2VQUA 2DGAA 2CEQA 2DPEA 2YA0A 1FH7A 5FKYA 4EANA 3GH5A 2BFGA 2WVVA 3VIHA 3VGHA 1V6XA 2D1ZA 1E0VA 2VZTA 1LF1A 3ARWA 4NF7A 4Y7EA 1UWTA 4DWSD 3S5YA 3DDFA 1E6SM 1G01A 2JFEX 2J7DA 5A8MA 4DO4A 1PZ2A 1SMAA 3GDBA 1H4PA 1QVBA 1XGZA 4OGZA 4TTUA 1PIFA 1AQHA 3AIBA 3SIMA 2D0GA 1XH2A 2YA2A 1A3HA 3KL5A 4W8LA 3A23A 1W32A 1H3GA 1B0IA 3PTKA 2WZHA 1VF8A 3ZJ6A 2ZX7A 1HP4A 3A47A 1J01A 4HMCA 4CGTA 2CKSA 1JG9A 1QI4A 1X6LA 2J7BA 1UD2A 2X2JA 1HTYA 1M03A 2GDUA 4YPJA 3W37A 1R75A 4FLRA 4LYPA 1GOQA 1HKIA 3GH4A 2F1BA 2YL8A 3DYPA 3PZIA 3W25A 2D3LA 2VZUA 3FHQA 3MUY1 2CERA 3FAXA 3RCNA 3T0AA 3WY1A 1RP8A 3L4XA 4D1JA 1LWJA 4ATLA 2DEPA 3LRKA 2WM0A 4PMVA 2X2IA 1V6YA 1DTUA 3HN3A 1KGWA 3ZT6A 1QBAA 1JYXA 3LMYA 2XPKA 1KXHA 1ODZA 2D2OA 4AD0A 3WH6A 2Y2WA 2ZIDA 1J12A 1J0ZA 3D52A 3M46A 2V3FA 2XN2A 2OYKA 3WENA 4E2OA 1UKQA 1UKPA 1JZ7A 1TA3A 3U5UA 3VDAA 2VZSA 2GFTA 2ZUMA 1CWYA 4WKFA 1LLOA 3M7SA 3T0DA 1UA3A 1HJSA 1OBAA 3PZVA 1NQ6A 2D24A 3W27A 4OJYA 3W6MA 4JFSA 3AS0A 2PB1A 4H04A 1V03A 2ZWZA 2XHYA 2NW0A 4RE3A 1H0IA 4W5ZA 2XSAA 2BY1A 2EPOA 4XZBA 1QI0A 1QI3A 4FF5A 2JEPA 3S6TA 5A6LA 2FE0A 2J74A 3MU7A 4E8DA 3TOPA 1KGXA 1E0XA 4UZSA 4EKJA 3ARQA 1CGUA 2YL5A 4UFLA 3EDFA 5GNYA 2J77A 4GQQA 1QPKA 4J28A 3EMZA 1NM9A 4JFTA 4LPCA 2E9MA 1JZ4A 5LA2A 5ABEA 1UA7A 2E8ZA 1N82A 4J3VA 3AS3A 3AMDA 3UR7A 3W4RA 5IFPA 5BWFA 3T2QA 2ZXDA 2E9LA 4CN6A 1R47A 1XYFA 3CZLA 4WKAA 3SCTA 1H0GA 4W86A 1E1EA 5CLTA 1F4AA 1BG9A 3EMCA 5C71A 1UH2A 2WWDA 2CYGA 1BGAA 3F5KA 2DDXA 4HMEA 3VDCA 1TQUA 1VBRA 2E8YA 3D4ZA 3W53A 1QOXA 1H09A 2WHLA 4PMXA 4M8UA 3POHA 2PWEA 3MKKA 5A1AA 2UY2A 2J7HA 3MMDA 3AXIA 1DWFM 4AZ6A 3WBEA 4EK7A 3GXNA 1HJUA 3A22A 3KLKA 4WLCA 2NSXA 5IHRA 3EJUA 1E70M 3PZ9A 4UCFA 4PRWA 4Q7NA 1XH0A 4IPLA 3S5ZA 2V5CA 5CQ1A 1BVZA 3O9NA 1OD8A 2FH6A 4MB3A 1P6WA 2D20A 3WNOA 5HPOA 1XV8A 3ZT7A 4UFIA 4V28A 1UUQA 1CXLA 2J8FA 1V0MA 1FP8A 3OLEA 3WQWA 2BVYA 2UWFA 3BXWA 3BVTA 1EO7A 5DT7A 3SCPA 2DIJA 3VMNA 1KCKA 3BSHA 1SFSA 3JUGA 3TV8A 3AXXA 4W8BA 4HTYA 2DT3A 5EFFA 3WL0A 3QGVA 1ITCA 1V08A 2XWEA 4U2ZA 3U7VA 4E8CA 5D9MA 2WANA 4P8UA 4AD4A 3ZR5A 2WC7A 3OZPA 1JZ8A 5HBFA 3HMCA 2EXOA 3TTYA 1ZBCA 1DHKA 1ISYA 3BCDA 4UQBA 3A6OA 2QLYA 5KEZA 1M7XA 4UQ9A 4L4OA 3LX9A 1TQTA 4CD4A 3LPOA 2WCAA 1J18A 5A8QA 4F9DA 2DIEA 4AD5A 2VNCA 5CSYA 1KBBA 3VMOA 5BRQA 2ZXAA 3CHCA 2BVTA 3BAKA 3DX2A 3IAPA 2CITA 3ZJ7A 4AD2A 1K9EA 3DECA 1UWIA 3U7BA 5A8PA 3PHAA 1G1YA 1GVYA 4QCEA 4HOWA 1WKYA 1DWGM 1J0IA 3EJPA 4NSBA 3UG4A 4W87A 3IANA 4W7WA 4ZE5A 2X2YA 1DP0A 1I75A 1Q4NX 1OGGA 1ISXA 4CU7A 3HG3A 1W9BM 2J62A 5ABHA 2OSYA 4PCSA 3WDIA 2GJPA 3W0KA 2VUYA 3SCUA 2IGTA 4MB5A 2J7GA 4UZUA 9CGTA 1WZKA 1GJUA 3UERA 3OIHA 1QHOA 4AD1A 3CZ8A 3MMUA 1FFQA 4AZ7A 3M07A 4AEEA 2EPNA 1IV8A 3WDPP 2WSKA 1ZS2A 5CLWA 3MV11 3SCSA 4UFJA 4CVWA 3WD3A 2YLAA 3WBAA 4BQ3A 3A21A 1OGBA 4CU6A 5E6YA 1HL8A 3L4TA 1J9YA 3MMWA 5A6KA 4TVCA 2X2HA 1CGWA 3WNMA 1E6NA 5A94A 1LQ0A 4QDMA 1UQZA 4PCTA 2VZOA 3WDJA 3CZKA 4DO6A 2ZWYA 1UR1A 2TAAA 4AZIA 3RPMA 5BRPA 1C91A 1VFFA 5DT5A 1NOUA 1NWSA 3ZSSA 3GNRA 1JAKA 4PUEA 1JFHA
chains in the Genus database with same CATH superfamily
4MXQC 5I6KA 1EGVA 3WMBA 4GLRH 4LVHC 1PY4A 4ERGA 1TG8A 1IXOA 1R5VB 3S2MA 3ARGC 4TSCH 1HXMB 4OGYL 1OC6A 2ZOXA 4BK9A 4DYJA 1XGDA 5I0WA 2ICWI 3D69B 4Z7QB 2FBRA 4LL1A 4LQFL 4BZYA 5J89A 3R06B 4L8CB 4K3ZA 3NEOA 4TRPH 4IGBC 4CC1A 1G4TA 3F7JA 2NZ9C 4O4YH 4S2SA 2E7DA 1ZAIA 1ASQA 2OKMA 5T1KA 3NCOA 4U7SA 4AC1X 2ZAHA 2N3JA 4UOW0 3WJLA 1SZFA 1TSRA 1EERB 2X1TA 5AYQA 5IR1B 3S8FB 4K55A 1ZLPA 4S3DA 2RFXA 4AE1A 3G9AB 1EKOA 2YARA 1QG3A 4GB9A 1I2PA 4GYPC 3TOYA 1KM4A 4A8RA 2DFAA 4NAFB 4O9HH 3SKNA 3ZT5A 6PAZA 2VABB 3NJIA 1TLMA 3VUPA 4PHXA 2QVKA 3Q8CA 1I2NA 2JIWA 2Y9RT 2XICA 3IJ8A 4L3EA 1NBCA 2VDRB 1S5HA 3FHEA 1FSKC 1BQKA 1D9KD 1QO3A 2R1YA 3K5XA 4OBTA 5C9JA 1AXTH 2D2JA 1VKFA 3FUHA 1T5KA 3EJYD 3SCMA 2VRAA 3SDDC 1QSVA 1WK0A 3AABA 1QHZA 4DVOA 2E67A 2NQCA 1CFQB 1G7JA 1NPJA 2DI8A 4NLHA 2O6DA 4O51A 4W81A 4DN3H 3BH9A 1W15A 2JH2A 1LG2A 2WHMA 4F8OA 4MYAA 4K3DL 2CR0A 2A9MH 2XGBA 1F2XK 3PGDB 4NN5C 5JHBA 1JZJA 5GHWL 2OCFD 1I85A 4AH2B 3BLDA 4OHQA 3PWAA 2VO5A 3NIGB 5AKSA 3CMFA 1F8TH 5L2KB 3X13A 4M02A 4K3EL 4BXSV 1ORSB 2WCGA 5KVDL 2XTKA 2HRGA 1GHSA 4UM8B 7PAZA 3QQNA 4KY1L 3KS0J 4FKHA 2Q1EA 1BF5A 2WSYA 1IJ9A 4MJZA 2Y3NA 1DSYA 4J8RB 7CGTA 1B54A 1V93A 5D9NA 4ZQPA 3UNTA 1RULH 4Y9AA 3M88A 2GWGA 3EDKA 3EX1A 5JZ7C 5C1MB 2OR7A 4ELMF 4BK5C 5C09D 1EZ2A 4PP1C 3GC4A 2AJSL 4DP0X 2XOTA 4ZFZA 1CICA 1YJDL 1FGNL 3NCBB 2PPGA 5GQBA 4XISA 3IIXA 1M6JA 4AMWA 3F2LA 3ESMA 5DHMC 5FX3A 4KKLD 1CLOL 1F74A 3L2IA 2O0TA 3REVA 4R26L 5GISH 4S10A 2I26N 4LARH 4UMGA 4NX0A 4Z6AT 1R3QA 1TVHA 4B0MM 4WCJA 2EDEA 1E6ZA 4GRWF 2BSSA 3TJLA 1E9OB 3V5KA 4QROA 3U2OA 3WTVA 5LQBH 4PJHA 1ZK9A 3CVHB 4QBXA 5ABDE 2AJYL 1K3ZA 2V30A 3DHFA 2GY7B 4FQHB 3WF3A 1KIRB 2ZTJA 3HJEA 1YAIA 4WHCA 3CWGA 5A40E 2AS5M 4JG1L 3WN5C 1Q65A 1SF5A 3FS2A 3V4VL 4LKXA 4KY2A 5AW8B 4KQNA 2WIMA 4IRZA 4JCWA 4OLXL 4R4FH 2MQ3A 5LO7A 4DW2L 5EG6C 2ITCA 4KRPC 1D5BA 3TXAA 3DX4A 1HIZA 1KFLA 3PXLA 1Y0LB 4URTB 5SX4I 1CE1H 3T4CA 3HRZB 4LLQA 3BH4A 5HJDA 4YVPA 3TJPA 3DROA 4OCSH 4GXVH 3OR7A 1ZP3A 3REQB 4U49A 4MXQD 1O6SA 3DBXA 3HZYA 5H94A 4NQDE 3RPIB 4B95C 3FEMA 1DCEA 1OOWA 1WBYA 4FQIL 3QQ4A 4XRCB 3KYNB 2QVNA 2NY6B 5F21B 1OAYH 4HLJA 2W59A 4NPJA 4ZFOA 1B4KA 2XXFA 4KJPC 4RIRB 1C92A 2Y1HA 1PX4A 3ANYA 3M47A 2CPCA 2X4TA 4JPKH 3WD4A 1UKTA 1W91A 2WAQA 2V33A 4UBDC 2OAAA 1X38A 3LLDA 3P84A 5REQB 4A2SA 4N2HA 5IFJA 1BHGA 2F5BH 2FX9L 4ZPVA 3L3HB 1CCWB 1D8WA 1WA3A 3LEPA 1ZE3H 3DYOA 2NNAA 5MKGA 5EEZA 1TPH1 5IBLD 3LYEA 1XSOA 3UEZA 3NCYP 3G5WA 4YXLL 2QGHA 4PCNA 1JF5A 4MA1B 4M7LL 5CC6A 5IQ9B 5ABGA 5GGQH 5LXVA 3QNYB 3UC0H 1O5QA 3HG4A 1EJOH 1TTGA 2J6XA 4Q6IA 4Z17A 1GZHA 2RFXB 2WXKA 2C9VA 5CEZE 2QGYA 3SI9A 4TSBL 3WYZA 4QRPA 2J9YA 4C56A 3A9BA 3K2MC 2GDVA 2ZX5A 2VR5A 3O4LA 3WJSA 1IM3A 1D9KC 2XSBA 5IB5A 3NFUA 4FALA 3CVBA 2XSXA 1F1DA 3EJYC 3CN3A 4Q4SA 3MBXH 3T1FA 5KZEA 4BHUA 3UNDA 2E09A 3VRIB 5EUKA 4ZMTA 3CMJA 1UT9A 1HSAA 4NDMB 4DP6X 5HVGB 2KHAA 1WAPA 4P06A 4G2DA 1NMAH 2V5SA 3LAFA 3ITTA 2J5WA 3MFFB 2P80D 5IHUH 4WHBA 5D03A 2K78A 3HG5A 3PDOA 1TWWA 2W6RA 1SXBA 1PNDA 5TPWL 1QXLA 3F6LA 3VH8A 2PLMA 4Y2WA 3QNZB 3TEVA 3L3KB 1JYNA 4N24A 2E77A 1BAFL 1YYCA 2NX5B 2VLLA 3H4HA 5MEPA 5IVNA 1W31A 3N6JA 4PUKA 2Q7YA 3IWVA 2J5LB 3NEXA 5D1ZD 5BVJB 4AVKA 3GFZA 1SJMA 3WKYA 1HHHA 3BGAA 3VNJA 4AZGA 2ZWKA 4YUEH 1IVTA 2XV0A 4PJ7E 4ZD3H 3W1PA 1NIAA 3V2AR 3RAJL 1XCXA 4DWHA 4KWOA 4JGUA 3PJTA 4BWUA 3I02A 2QDWA 5DS8B 5FUOH 4WW1B 2V68A 3FY1A 2VN6A 4S38A 5BZWB 4GRLA 4LUSB 2DD8L 4WIWA 3GNNA 4ODTL 2HZHA 2QPUA 1BBDL 4N0UA 4M1RA 5LXGL 2QJMA 2OSWA 2Z27A 3PWJB 4B9KC 1T66D 3WNLA 4EUPG 5CIPB 5DURB 1Q63A 1VFBB 2AXFA 3FL7A 3NEHA 3L5XH 4FL4C 4UB9A 4TULH 4GZJA 2EYRB 5D4YA 4I9JA 3P30L 2PW2A 3EWCA 3WQ6A 3B9KB 2XG9A 3DU0A 4WEBL 4YDJB 5DJXA 2IIJA 4U5KA 3MRNA 5AZEL 1E3FA 1F56A 3OVPA 1U4FA 3E7JA 1MJ8H 1BWVA 5I1EL 2WYHA 2HTKC 2VXQA 1ZSDB 4HNOA 5BU6A 4ZMNA 1QTWA 3VE0A 5XIMA 1OZMA 3EMQA 3NCFB 5IHBA 4X0VA 3WD5L 3DLQR 3SN1A 1FF5A 1LK3L 1AQKH 4DWSA 5CD5C 1YPIA 2FHFA 3D34A 1O6IA 1OSZA 4WI0B 2R8WA 1W6WA 3KXFB 5HI4C 3TWYA 1QFWI 5MEQB 5G2NA 1CFNB 3NDZA 5KVEE 3PPGA 1UJPA 2F53E 1R9ZA 2OB3A 3IBEA 3VXME 3MV01 3QA3A 3FDKA 4XMLH 3JZEA 1MFUA 4Y2LA 1LL6A 4QRPB 2EPMX 3SPIA 4G1MB 3BP4B 5D7LE 5DRZA 4N28A 5DVPA 1BQCA 1S1RA 1YYLL 3PREA 1S9VB 2NZLA 1SVBA 1C8XA 2FR4A 4P3CL 3H9HB 3MRMA 4A3HA 2NUPB 2X6BA 4CSSA 4NN6C 2VT0A 3LPFA 1E4XI 2O72A 4OD3L 3P80A 3UXLA 4HHWA 3VRIA 1E5BA 3V0VA 3ZVHA 4YL9A 2ANUA 2IH8A 5CR8A 3LKQB 3QCTL 2WLMA 3RWDB 3IDIA 4XP5L 1T6VN 2YUVA 4Y4FC 4JPKL 1AHWC 1GOMA 1T4KA 2XM1A 4TX9A 3FB7B 4IOIB 3QH2A 4PBDA 5C8JA 4FFYH 3TZVC 1GSKA 3MLTB 1HKVA 4HN8A 3HAEG 4WI7A 3QQ3A 5BV7B 5K9JL 1A4AA 1CI1A 4MQ7A 4PFHA 1SMOA 1WWBX 4FXGB 3P3YA 5IVXF 1IT7A 1RAMA 1NM4A 4DEPB 2CFFA 3TN6A 1YAZA 3CLWA 3V1HA 3OX8B 2QFPA 3C5XA 4G70B 4FQXC 3QUZA 4P4KC 5FYLE 1EB3A 2Z6JA 1T3FB 4ZUSA 3KPOB 3RY4A 4ENLA 5DVLA 3V1PA 5H8MA 5IY5B 2J71A 4MNHB 3V4VH 3NCMA 3MP5A 3H9SA 4XC1H 2ED7A 4FEMA 4XMZA 1U3JA 3PJWA 1Q0YH 3WO4B 4OY9A 1Q9KA 3HNTH 1OIMA 4GH1A 1WFIA 5E0CA 6XIAA 4RAUA 2J8UF 2IO5A 3I9GH 1VRXA 4AWUA 4R27A 3TO2B 1P7KB 4Q6XA 5KZ6A 2ZTKA 3FTXA 4E5XA 1PKOA 4AVJA 1BYPA 3MI6A 3UTTA 1W2KT 1NOAA 2PP9A 2MFNA 4AMXA 1WZLA 5EF3A 4KEVA 4EVNB 2BH0A 3CZFB 1CICD 3DSNA 3TO4D 2L7UA 4K5LA 2FEEI 1VHPA 4N2FA 4JE4B 4DEWA 5D33A 4PVMA 1MWAH 2A77H 3KGUA 4PS8A 4M6UA 3QDGD 2E9WA 1GZ1A 3FB8A 2EIBA 2P4AB 1E73M 3BVXA 1F97A 2GQHA 2LGNA 3BC9A 1G9MC 2YPLD 4OTXH 2G0WA 3QJAA 5M3WA 3SUVA 3G6JE 3SPGA 1JI2A 1QPQA 2I1OA 1AIFB 1YEKL 2D3NA 3IKCB 4FNLL 4XAFA 5C0JB 5I71C 3MA7A 3CVIL 4FYTA 4MLIA 2TYSA 1Q9OA 4FOMA 4K07A 4Q0XH 1SJHB 1TQXA 3LPGA 1NUDA 4NZDA 5FLUA 3KOWA 1AC0A 4P2VA 2GPTA 1CDCA 2DWSA 4HCFA 2D4FA 3BIBX 3HTLX 1OW0C 4LYRA 3NJMA 3FSAA 4OJFH 4PWKA 1U36A 1XUZA 4P23A 4AX6A 4YBLB 5ADPH 5DRIA 3TN3A 4WY0A 2WO3B 5LCVH 4FZIA 3C3UA 4Y0GA 5D2NC 1RJPA 4LHJB 2D3JA 5EDSA 1OF0A 3QIUA 4Q9QL 1QWGA 4FX8A 1ADDA 1ZRUA 1JPFB 1VZHA 4HIJB 3DOIA 2ZOOA 5DVKA 2P3ZA 2EXYD 2OW6A 3DJTA 1M71B 3QHTC 3CDYA 4MJ6B 1CBVH 4JIPA 5D6DC 3MLWH 2HTKD 3FSWA 1MRFH 3B0UX 4PTXA 4N86A 1W9UA 2PFHA 3PJLA 1QP1A 5A16B 3RVWC 7TIMA 1FWBC 4MTMA 2WSRA 3HCVB 3WFEH 3MYJA 4EEEA 3CU7A 4LSPL 3B34A 3V9FA 1NBZB 4DPCX 1A47A 2XC8A 2IF7A 5D5MA 1AI1H 1GCFA 4DIAA 4RX0A 2G8ZA 3CZNA 3B7SA 4M48L 1DXEA 1AD9B 2FEDD 4WJ5B 3WNNA 2IC2A 3GPSA 3WLKX 2C8NA 2SEBB 3H9YA 2PF6A 1Z5YD 1YMMD 2WLLB 4IBQA 4FI6A 3RWEA 4M51A 4LAKA 3MRDB 2FQDA 4YSAA 3V5CA 4NZTL 1RQ5A 2AQOA 4X4MA 2IWGA 1K4CB 1SRDA 1AMXA 4F37F 1HZKA 1LNUB 3LN5B 3FDWA 2ZNWA 3ZGHA 3JQOB 4HJJL 3FO1B 1E5ZA 1JDAA 1VZGA 1NCTA 3SY0A 3L1FA 2EUVA 3SURA 4XC3H 1XR2A 1COBA 4H0LC 5B8CC 2AMGA 3KYOA 4H4NA 4HYTB 2XISA 1CYWA 2XWCA 2P50A 3BMVA 4TKWA 3UG3A 3FB8B 1EFZA 1YTKA 3WMQA 2OS7A 2YPVL 2YUZA 1MJ8L 2YC1A 4PRBB 1EAQA 4CNIB 2JCCA 3MP3A 4YZFE 3T08A 2PR4H 4I18C 2CCWA 5ECGA 1R3IL 4W85A 2PW1A 3KP1A 3BK0A 4HIIA 1KJ2A 1IM9B 3GNOA 5EC2A 1W37A 5I8OL 1J8HA 3FT3A 4YDZA 2JI1A 2MTAA 2XA8L 3GRBA 3WLJA 4ZOCA 5I7GA 3SCNA 1FAIH 1AO7D 1CZ8H 1LO3L 4K2UL 3WFCH 3HNSL 3FQNA 1OGAB 4AM0Q 4DTGL 2Y62A 2X1XR 4OFCA 1S3RA 1W1IE 3W38A 1WKFA 7XIMA 1A5OC 3VZXA 1VSCA 3A4AA 1E4WH 5KVEL 5DDHA 3F12A 3N6QA 4LRNH 2WXRA 5B39A 4WUUA 4C4KO 4PBVC 3KPOA 3T40A 4HZ7A 5ECUA 3RLHA 1U3HD 4X2PA 4XBJA 3RZCD 1BMWA 3EIFA 1N9PA 1KFEA 2G75A 4G3YL 2C18A 4QFUA 1R3VA 3TYAA 4L29A 1R4XA 2GHWB 1Q85A 3BOFA 1PLAA 1KGJA 3DV4A 5D1XC 4LCYA 3VGFA 5HK4A 3V16A 3V52L 3VM5A 4ZUVA 1I2RA 1NCNA 3ISIX 4NNPL 4Y2DA 2B1OA 4LY8A 3FC8A 4K1GA 1PZ5A 3MLRH 4HCRA 5EZPA 5ACLA 4L4PA 2X6MA 1FCCA 2JKIS 1LO4H 3SEPA 4L3EB 4HUVB 4TVPH 3EYUH 3AYSA 4Q8WA 1UXSA 2JJWA 2Z6FA 4UTFA 4KRUA 2P28B 1K6WA 3L13A 4R3SA 2Y61A 4WGKA 1RVFH 1C8VA 1X9UA 4OLUH 3R8QA 3VFNB 4PJCB 5L88H 1PJWA 3ESNA 1PTDA 4HCHA 4X6CA 1SXNA 4JY6B 2B7DT 2BMBA 3EF7A 4QO1B 5EU4B 4AUYA 2V3GA 4GYBA 4P9HC 2YCEA 4MNMA 2I5QA 3JYBA 1YIXA 3NQ2A 3T3PF 4NO0B 5DWUH 2NDGA 4BA0A 3DDMA 2PWHA 1BLIA 2FAUA 4Q2ZB 3T77B 4HU0A 1A14H 3V0GA 5BV7L 4P05A 3QYNA 1GW6A 4BV1A 1WA1X 4RGMB 1PKMA 2WJ5A 4QIRA 2J13A 1RUML 1U3NA 2L7EA 2E68A 1ZVHA 4YSQA 4M5SA 4HBKA 4ODXA 4AKQA 3A3HA 3NOYA 1ZANH 5C86A 4LOCA 1ZVSA 1ZT7B 4L4TA 2W5FA 5F4SA 3EYFB 1VGKB 3TP4A 3WFEL 3IN2A 3RVVC 2WY3B 3FQTA 4XN4A 1CE6A 2GJ6D 3BAYA 4MMXA 2CIKA 2I27N 4QHMB 1HHIA 5KWYC 4RZ6A 1JPGA 2FMNA 4PJIA 4A2FA 4P46A 1E9PB 1FZJA 2OSLA 2ZCLL 1SZGA 2ZZ5A 4DFIA 2EZ0C 1INEL 3TESA 3VE0B 2BSTB 1RK5A 4D71A 1TSIA 2OMYB 4N8CL 2RIKA 1S5WA 5DCBA 1R33A 4M7KL 3RKPA 4NUWA 4FNUA 1U8CB 4ORZC 2B4GA 3W11D 2ROYA 1V7ML 5F9WC 3WEBA 3TA9A 1FY6A 3ETSA 1G9NC 4YGVA 4KI5D 3N15A 4OCWL 1YNYA 2WBJC 5AVWB 1IGSA 4S3BA 4NY2A 4PMFA 1D3GA 3KYOB 4FFYA 3O3RA 1I1AA 2RTTA 3NIDE 1RZKC 3H3KA 3NK4A 3PP3H 4Q4IA 2Z0IA 4W9FC 3VXSB 3AGWA 5EORH 1FKXA 2IMMA 1DSFH 2XG4B 2IW0A 3QRGL 5B4MC 1RI8A 2WZ5A 2XFYA 3G1DA 1OOAA 3W7CA 5K39B 2R0ZH 3GIVA 4L9YA 3HB3C 2GIXA 4ZOBA 3UTPE 3ARVA 4M1GH 1C08A 5AW0B 1OAZH 4AQ1B 1I3GL 1PS9A 3ZHKA 5FW7A 4E3TA 1A6ZB 2R39A 1A9BB 1MFMA 3STZB 3RCYA 3VVGA 3HVNA 1AXIB 4NHCH 3B2MA 1UZ4A 2OGJA 4RDWA 3VD5A 5ACZA 1P0EA 4OGXH 4N20A 3TH2T 4ZB0A 3HZVA 5AY7A 4US5A 3IFNH 1F11A 5INCB 1GKQA 3EGXB 3W7LA 3EG9A 4HG4J 1UHVA 3WFBH 2O5YL 2ZX8A 2G5BB 3CK5A 3CEUA 4KZEL 4DCQB 5CBIA 2EINB 1JZFA 3M44A 2FO4B 4FZEL 4J27A 3R19A 5FYKL 1J5OH 3CFKB 3O8XD 2V63A 4RMRA 1CXEA 1BP3B 1FL6A 2EIKB 3W2DL 4ADSA 1OTTC 5DEGB 4ODVL 1KYAA 2R0LL 2TRYA 5ALBH 5FUZL 3UJIL 1JZ3A 2V9DA 1QLEH 3AALA 1UA6H 4Z08A 2VLJE 3ZRSA 1RXOB 2VXQH 4L4LA 4R7WA 1JNNL 3HMWH 3ZHNA 4H9TA 4RFOH 4W9KC 4NWTL 1X4ZA 2J1XA 3CE1A 2DQXA 5D1QB 3DG6A 4P61A 2F6KA 4P8XA 4YDVB 4Z77B 2JEQA 4KRPB 5DEZA 1T1YA 2HT3C 3KGTA 4N0FB 3N11A 5FJPA 5IQ9A 4KH9A 1ZWIB 2P88A 4PV8B 5BU9A 4K7PY 4GUPA 3IF1B 4BUQA 3AWOA 3OP2A 1TUFA 2ED8A 4JHMA 1QMUA 5D1XA 4DK3A 5LNDA 2XN9B 3BUYA 3OKKA 1IILE 3QORD 3ZTCC 4EVNA 5IB3B 2J7FA 2HJFA 4N1EA 4MZ1A 4RCXA 4TN9A 3C3NA 2H6UA 9XIMA 4G43B 3U4KA 3BV4A 3MO4A 1UXMA 3R11A 4A2RA 3D1MC 3LZFH 4OGQC 2H26A 3IJSA 3TYFB 1JPTH 3AS2A 4L48A 4R7DB 3TO4A 3RDJA 3WBDA 5I8CA 3EOTH 1FCUA 3TBVA 3ZL4H 3QQ4B 4XRCA 1YG9A 1DQJB 4GAYB 4MDIB 3GNPA 3U9UB 1IRAY 2CHXA 3OBAA 2JK5A 2XBTA 4GJTB 5DJ2A 3T0ED 3GDLA 1YPZE 3UR5A 5FHAL 2NQJA 3ISWA 3MUIA 2R29H 4FNQA 3FRPG 4PJGB 5CZRA 4V1DE 1JD7A 2DOCA 4BZ1L 2F54D 2FBJL 3A6CH 4ZX3A 1JZ5A 5KSUB 1LK3H 4KVCH 1K4HA 4XAKE 1VFUA 3LS5L 3BWAB 3WEAA 2YDSA 3I6EA 1WBZA 2B4CC 5LDSA 3G24A 4XPAH 2HSIA 2YL6A 3WF1A 3FTGA 3HC3L 1OFPA 3AIVA 4GYFA 3TAKA 1HZLA 4Q32A 4LSTL 2XIDA 2YQ3A 5LGHH 1RPKA 4GKNA 3VFWB 4M6OL 4N0YL 2WMGA 3R06A 1BZ7B 3I9GL 3W11C 1IWAA 4MZIA 3GFYA 3GR7A 2GUOA 3UZQA 4KWVA 3V4VB 2C19A 3FA3A 4IJBA 3FB5A 5F3HA 3UYPA 1FH2A 1FO0L 1B3VA 2NVAA 2APFA 5B38G 4XVEA 4JPWH 2Z4GA 3UTTD 4FL4B 5EHFA 3QIUD 1NDYA 1IHIA 4XX6A 3U2IA 1TQJA 4FA3A 3BJ91 3ZZ1A 1SU5A 3WF4A 2VFEA 3DI1A 1J05A 3N04A 5HJ3A 4GKLA 1ECEA 4YSRA 1BSLA 4GRWH 4DFHA 1EHLH 2CZVA 4ACZA 2YIHA 1OCQA 4LKCB 2J8UE 3F6JA 1AL8A 2WN2A 5JOFA 2AW2A 4MSWA 3WQ8A 1MWAA 3RBSA 4QRAA 2OPJA 3ITLA 3GJEB 4JG5A 4FFYL 1XXXA 2CQVA 3WQPA 4BFBD 3N4AA 3L4WA 3OVQA 5EMMA 1GAFH 1H3PL 4U31A 3ZRCC 3SKJL 5K1JA 3EDEA 2EVFA 4PD4K 1JZGA 3GIVB 1VHNA 1KEGL 4W4OC 3SCMB 2PDMA 4MF4A 2PC8A 2OULB 5CHNB 1ZTXH 4OZGE 3RHWF 1PKYA 2HRPL 3QIWD 5K1NA 1A3QA 4GBUA 4HNLA 4K68A 1IIIA 5GRUH 4E38A 1HHKA 4PMYA 3NAVA 4G8GA 3NFPA 4XBKA 3WLIA 1G7IA 1I8IB 1BYCA 2J1YA 5F6HI 4EXAA 2NY4C 4QF1B 4GUCA 3SRFA 3LCWA 1OTSD 1QFPA 5CSSA 3TEZA 2C3GA 3BQ5A 3CHPA 3N12A 3PJXA 5KTEL 3FTSA 2NX5E 1OEPA 4N0UB 2IXUA 2VMCA 2UV3A 1TKWB 4M8QB 1FPTH 3M43A 3C60B 5EZIL 4NQSA 5A2FA 3C60C 1AD0B 5KYUA 4ROPA 2UWEB 4WHTB 2W61A 1CB4A 2VXUH 3DUUA 1ZJHA 2E5BA 4QS5A 4M24A 1S9YA 1SEBB 1UD5A 3QSKB 3C2VA 3AOFA 3GXFA 1PCSA 5H91A 2A9NH 3MV7E 4N90E 4HJEA 5AL0A 2PO6C 12E8L 1RXLA 1BEUA 1NJJA 1F6FB 4HT3A 3QQ3B 3UJJH 2F6UA 4M7LH 4NCC2 5DK2A 3SUWA 1DVYA 2H8PB 4AIBA 4OI8A 3MRPA 4DZAA 3AZUA 1NCJA 4D1IA 4H20H 3T1GA 2ZE3A 4WDIB 1PAZA 1Z48A 1PLBA 4BQ8A 5J13C 3PTDA 4QRBA 2XGZA 4TOYH 3I6LD 1U8JA 3CIVA 3P14A 3QGAC 3FRUA 4OU3A 5CSZA 2HVJB 2Y4SA 3ARBA 4BE5A 1SQ7A 2Z1PA 3I9AA 1EQWA 4F93B 1SO6A 5G2HA 3QCUH 4YS1A 4I4WB 4XO4A 3EEZA 4LOVA 3WQVA 3ROLB 1H15B 2CBJA 3THMH 4YHOH 5DSCB 3HPXA 1S9VA 3IDXH 4GI9A 1YLVA 3ZE2F 4PW4A 2HK1A 4FR6A 3BPOB 5I18H 3IBOA 3BWUC 3NIFE 4Y19D 2WXPA 2W67A 1IE5A 1UZDA 2R1LA 4FIQA 1W5NA 4NWUH 1GA2A 1GQJA 5E0FA 2YD5A 1NF7A 5FJRA 2FMOA 3U7AA 1Q6RA 4AYID 2ZC1A 1EPVA 4LSQH 1KO0A 3TYBA 1T0NA 2D73A 3L4ZA 3BLIA 4LUYA 2UX7A 2J27A 3S0CA 1JUEA 1DORA 1CDGA 2TSAA 3EAKA 5I19L 3CL8A 2Q3AA 3HBQA 1JZ6A 2EH8H 1NAML 5KVGL 4QTGA 4JGJA 4BZ1H 1JPIA 1M57B 1OXYA 4XNDA 3RL2A 4X4ZA 4YYFA 4LNRA 4U3SB 2KZHA 4BQBA 4YLBA 4PJDA 2H47C 4F1ZA 3RY6A 2D7TH 1NEYA 3D06A 4Z8FL 1I8MB 3C0LA 3LKRB 1KTRL 3QDGB 1XGTB 2BOLA 2W8CA 1Z32X 4XX1E 4B27A 1DYSA 2BVWA 3LBOA 5EU7E 5AOUA 1NTDA 4GQZA 4H40A 4TVDA 1H3UA 1HH6B 4LOUD 4MM1A 1QR1B 2EUXA 1A4KA 4A2DA 2YAFA 2AQWA 5DD0L 2QQ6A 2CRYA 4ATDA 3C6SB 1GMEA 1VLIA 1DQTA 3EFFB 3FXIC 3TN5A 2A2IA 2IPJA 4L8SB 3US0A 5IT2H 3OMNB 4NQSB 2AL2B 4AMKH 4BKTC 1KXQA 4ZW8A 3CDFA 4HWBH 1RZJH 1IR1A 4XWOC 4ERSH 4UV4L 3SDYL 1CDHA 4GRLC 4HKZA 1KCUL 2J88A 1WUFA 3FQ4A 3P77B 1OP3K 3O8XA 4JPQA 3N2OA 1OB0A 2UZXB 2V2HA 2ENPA 4NQQA 6REQA 1QTYT 2XIJA 2LFGA 3A13A 1EJ6A 2WGXA 2NY6C 3B7RL 4D9RE 5DZJA 2FECL 1LP9B 1M05B 2VITB 5EF2A 3WQ4A 4P2QB 3QFWA 4BA8A 4ACZB 3WEOA 1TQVA 1OWRM 5A7BA 5HNNA 2WLZA 5D5MB 4BI6A 5CHNA 8A3HA 4N2MA 2F7PA 1OCRB 1GGIL 3EHBD 1P0KA 4FXSA 5SWZA 4D6HA 3CVHH 1XIHA 4FCAA 4R96A 1L7TH 1RCXB 5DJ0B 4F20A 1EGMA 1TA3B 5I1HL 2Z9TA 1H9VA 1CZ8L 2PYEB 3FN0L 5FDYA 4KQ3L 5IHHA 1BD2A 2BCKB 1YEJH 2HT2C 4CCZA 4I3SH 1FO0H 3QOMA 2NT0A 4M7LT 3K71A 5JTWA 3QCTH 2YD7A 2Z8RA 4AMAA 2MHAB 3TCLB 2V3EA 4JNZA 3VNKA 4X9FA 2HX9A 2ZAIA 1VPXA 3D0AA 3F65A 2JK2A 4JTQA 4LSVL 2VWEC 1CPUA 1ESOA 3RRQA 3N2BA 2BNQD 5E9XA 1IE4A 4QXTA 3A4EA 1B31A 3P62A 1TU2A 1YPZA 5IW6B 4Y5YB 4PUDA 3D3VD 1HNGA 4KCTA 1SVDA 1TTUA 3D48R 3H3BC 1YECH 2MIZA 5AYUL 3W00A 1KEMH 4B7LA 3MYJB 3WFZA 3D51A 5CINH 3O2VL 3BDYH 3KPSA 4CEUC 5E70A 1A1NA 4L9LB 3QW9A 5BXTA 2G2RA 1KCRH 1A6TB 1KB5L 1QLFA 3WKML 2R7EB 2NX3A 1CL7H 3C6LA 4JFHD 2H7WA 4TV3A 5KANI 3AXMA 4BRVA 5EF1A 2DLFH 3N42F 3NFSL 3V8OA 5FOOA 3MC0A 1ULVA 2H2SC 2VDMH 3UZVA 4BF9A 1CD8A 4B9CA 2K6ZA 4XVUD 3VGBA 4KK9D 1U9KA 2DQUH 4M1CC 1AJZA 2GFBA 1L5GB 2HE5A 5D9SA 2GBUA 4TUJA 4BJHA 3ECQA 1GGBH 4NRZA 4Y4HA 3KLQA 3ZDZF 4DK5A 4XXDA 3BVJA 1CF8H 3NJ3A 1VADA 2GBVA 3CBKB 4IU3B 4NNXA 4M6NH 5FJIA 2OW7A 3BLBA 1J0KA 5CJQH 5DA4A 1GTHA 4FX7A 4KRMB 3D85B 1ADSA 4C6KA 2HZGA 5JPMC 3WEXA 1TV3A 1CTOA 2R1YB 1RCYA 1QLRB 1YEIH 4P2RE 4R7NA 2DV0A 1MJUH 4X98A 3SE8H 1BJ1H 1U3HB 4LGRB 5DJ8A 5T1MA 4JFXA 2ADAA 2E25A 4IHCA 3EDDA 4M80A 4IGNA 2Q86B 4WNQB 4PMJA 3PTQA 5C0GB 4C5YA 4H9YA 1JPST 2NXZC 1E6QM 4AYSA 4MWAC 4NAFA 5DY3A 3PQYE 4U1JB 3BLPX 1XGTA 4GI4A 4B9JA 4W9GC 3K2GA 4WUIA 4G8FB 1NINA 4W9HC 4A1RA 4C91A 3MLVL 3LMJH 3GF8A 2NW2A 1G7LA 4FG4A 1WZAA 4JVWA 5CZVH 5E5RB 3DKJA 4IP5A 4JR9H 4Q8UA 2BSEA 3HEIB 1T2JA 3INOA 4HP5A 3U2CA 1BQ5A 1U8IB 3RVXC 1PQZB 1MFNA 4CD6A 4D6EA 2V37A 4LLAA 2VMDA 1E0TA 3P9LA 3MOAL 5EBAA 4APQC 3Q58A 2YDRA 1BQRA 1UR4A 1UWSA 2CNCA 3QHFL 2W60A 1X5KA 4RAVA 1Q9KB 4MMXB 4QHMA 1D5XB 4AZCB 4Y4FA 1MCLA 5JPMB 1JFXA 1GOWA 3SODB 1NDMA 4ZMQA 6FABH 3O7UA 4ALAL 3WUEA 3H9ZA 4NM4H 5EN3A 1XPYA 1IKOP 3FUJA 1DSFL 4EXKA 1V27A 3STLB 5CAYB 3UG8A 2DJXA 1VBGA 1L0YA 2F53A 4N3TA 2JKNA 2VQ1B 2YS4A 3MJ9A 3W9EA 2E74C 4ABQA 2AXFB 1LO5A 3KVLA 3N9RA 1SN0A 2IDFA 5KSVA 4Z0XB 1LORA 4IOFD 4DWSB 3O6DA 2H2PD 3E3QE 3OLGA 2Z31D 1AMYA 1F7BA 4HKZB 1IEQA 4C7DA 4HUVA 1VCBC 2D7PA 4D8AA 4NZ5A 4EF8A 4BH8B 3IVSA 3P3BA 4OIFA 3MBWB 4TOQA 3KEHA 3TJXA 4CLMA 2P10A 5CJOH 1MJ7L 5FW8A 1WIUA 1Q2RA 1L9MA 1P5VB 4I18B 3AU1B 1M7IA 4UB0H 1U6AL 3FT4B 3PDGA 5IIEA 5F1OB 3VD2A 4U1HB 2E5DA 3PZQA 5DBUA 5IMMA 3UU0A 1XINA 1E4HA 1X8FA 2VC9A 1B0RB 1FOBA 3QUYB 3TJHD 3WEMA 3TEYA 2YQGA 3BKYL 5EO1A 2C7UB 1U92A 4G8EB 2K6YA 4KTEL 3IPWA 1HIMH 4HSCX 4TMPA 4XPHL 1I1WA 1XDTT 3WIHL 2DIBA 1EVUA 3AJXA 4AIXA 4LC6A 1VCFA 1NZRA 2JKLA 4UAOC 3EOUA 4F7MA 2HCVA 4H2AA 2RQEA 4M4RB 1GOGA 1XF3A 5BW7C 2F54A 1NWRA 1RLDA 4DPAX 2VFIA 3LMZA 2AEQL 5MEND 4ALAC 3VKBA 2PU0A 2WAGA 4X2RA 2VEFA 3KL0A 4PRHE 4GSQA 2NNFA 2VLRB 3SBRA 4I48A 3APYA 3RTQD 1MF2H 2X4RB 2G4JA 3QEQA 1N3NA 3WCYA 3H8NA 1HX0A 3FCGA 1FBIL 3P4MB 3PWNB 3MPGA 2APWA 1IC5L 2AEPL 1C7TA 4H9VA 1TJMA 3MLYH 2FYVA 2X12A 3MRFA 3EUDA 2HWZH 3QNYA 2BINA 4XCNB 3LKNA 2APVA 2OLDA 4GISA 2AJSH 3CUHA 4RK8A 3FMGL 1TUXA 2B4CH 3LHTA 4O58L 2XH2A 3TIEB 3EOTL 2KMWA 2WK2A 4HHPA 1UP3A 3R0MA 1UUSA 4ZMGA 1XLEA 3O4LB 1EZVX 4IKNA 2NNCA 4IICA 5LIKX 5C3LD 4Q58C 4JHBA 3G04A 1Z7AA 5C2XA 2JXMB 1BVWA 3UBXA 5F88B 3QO0B 1PCKA 3JZUA 1MCQA 2RACA 3VXMB 4HJFA 1J10A 5D9SB 4NJ9H 1GPWA 1V7NH 2BSCA 2G5WA 4OLWL 5C09B 4ZMYA 3W5NA 4E9WA 1E90A 3H7BB 4HMNA 3RG6A 1D3CA 2E0PA 2HRPH 4UOZA 3OBEA 3R6IA 3O6FC 1OPGL 3QPXH 3FCTB 1AD4A 2GUBA 3KVJA 4RSYA 1GC1L 1FO0B 1MAML 3TYGL 4F9LA 3TBVB 2OOFA 3UMNA 3CK0L 2BB0A 4YHIA 5D1QD 1B3IA 3MPCA 5FSDC 1NFIA 3QEQE 4DBDA 1BEYL 4JZJC 1OPOA 1M9SA 4XN9A 3VQMA 1WDDA 4PJGA 4ICCX 4WWKB 4BUGA 3NJHA 3ABZA 1NBYB 3OZLA 4KOBA 5HDQH 4A67A 5MHSD 1QI2A 3IUHA 5RUBA 1QHPA 2ASHA 4YHMH 4CQBA 4LU5H 1KOAA 3U9UA 1FHDA 5FD0A 4A39A 3CT7A 3UYIA 5D6CB 2NDFA 1HEHC 1UM5L 1ZANL 4JHVA 2Z8VC 1EGJL 4N0UE 4W9CC 5I1DB 4U4MA 1VAHA 5BUAA 1X6UA 4O28A 5A16A 1JYWA 4QOKA 4W9JC 2PDXA 3R7MA 4F0LA 1SZRA 4X9BA 1MVFA 3DFYA 5E6IB 2GYIA 3QUKA 3U0PA 5LXXA 1IBGH 4X6FB 1LP9E 1W8EA 5I71B 5I74C 4PODA 1H6FA 4YDLC 4Z1DA 5DFTA 4HKPA 1WBZB 1HL2A 4H1LH 4NO0D 1JERA 5EO0A 1C7SA 1F42A 3OZ9L 3TIDA 4P9MH 4LP5A 4RXFA 3HPLB 4DKTA 5K9KA 4I5UA 4XMKL 1N2RB 3WO3B 4F0SA 3BP5B 2QL1A 4FULA 1C9WA 2VDPH 1TVNA 5FDWB 4C59B 3V4VA 2FVMA 3BFWA 4UTAA 4YN3A 3T4YA 2HLFD 3S2LA 4OZOA 1M7DB 2PP1A 2QPEB 4N2IA 3QXVA 4PRHA 5J6GA 1JULA 3ZE0F 2ZXBA 1SYVB 4EF3A 1HT6A 3X12A 3SY0B 5L4IA 1XIEA 2Q3OA 1EZWA 4NRRA 2J20A 3X14A 4K5MA 4N8VG 1US2A 1T03L 1OCOB 1W9PA 3DETD 3GEFA 3MUGB 5EEYA 2YKKA 2R4RL 1WIOA 3GHEH 4ONFH 1YMYA 4A2MA 1S9XB 3EOYG 5TD4A 3QCVH 2VLME 5EULV 2DW7A 2IPGA 6ALDA 1U8NA 3SPCA 3TM6A 5SWZB 2BVDA 5FEZA 4MAYC 2ZVRA 1POKA 3UBXI 2P5WE 2WTPA 1L6YA 3MXVH 3HZMB 3LZ5A 1SHMA 4JAMA 3UJTH 1XYMA 4M4PA 2OT0A 2WMFA 3B83A 1MSPA 2J2ZA 4Q8TA 1F0LA 5BUGA 3MKCA 4W8AA 5L4MA 2CETA 4FC3E 4M7ZB 4GA8A 3D3VE 2Z8SA 2ADJB 4OCNC 4UTAH 2EXWD 1XIDA 2QHRL 4O00A 3SKUD 4X0NA 1RZFH 4ISVA 4MQ7B 4QRPE 3NO3A 3CM4A 4KNSA 2VLJA 1P5UC 3UX9B 3HI6L 2QGCA 3CT2A 1UC6A 4GVGA 5AAPA 4PYHA 2QLVB 5EU5B 2DWXA 1ZLWK 3RURA 2FCBA 3NIFB 3G1AA 3PFUA 3RJQB 3GMQB 3N25A 2CK2A 1Z41A 5JXAH 4W7UA 1NKRA 1ZBKA 2ZKWA 4GIPD 5FYLD 3BIAX 4BFKA 5HYIA 1M5WA 3FQWB 3OGCA 4MYWB 1O94A 2DT0A 2B9AA 2BVQB 4NS0A 1DN0A 3ARRA 4W68A 4CVUA 3Q48A 3SBQA 1EX1A 2XZQL 3KCPB 1NLBL 4KC3B 5GGSB 4FNRA 3AMCA 4MKVA 2AXJA 3BFQG 4X4KA 3Q6FB 5EU6A 4Y4KC 4DP4X 5I3HA 1CWVA 2VXSH 1FYTE 2IWKA 3V6ZB 2CO1A 5CSUA 3DFHA 2WC4A 3DSNB 2Z91A 2JB6A 1E5NA 1KYFA 1TEFA 5E1QA 2XVKA 3VGEA 3C2SA 2GJLA 2PZ0A 4XNZC 3EKGA 1RIVL 4TLUA 4Z8FH 3CFJA 1HCFX 5ID0B 3W1LA 1P7KA 4S11A 4GIRA 3LRSB 5FJOA 4NQCD 1XB6A 1MCSA 1ML1A 3AC0A 4UUIA 2P8MB 2ZPKH 5F96L 1XAKA 2IH3B 3N5AA 1TJ1A 5DMJB 2F6AA 2FX7H 1WQ5A 2QVIA 3ITXA 4OBSA 4WHYH 2ITFA 4NZ1A 4O50A 4AQEA 1ICTA 3MCKA 4ZQTA 4QJ3B 4W93A 5FACA 3JVFC 3VGAB 4Y4HD 1V77A 3ZBMA 3NXFA 1TFHA 4JQ3A 3IPEA 2QW5A 1AQDB 2P9RA 2XNAA 3W7OA 2E9JA 3MLZL 1AYOA 2WVVB 2Y7QB 4XCCH 1G6RH 5I15L 3ILPA 4MXWL 1A4MA 3MRRB 3ATDA 3SO3B 5IQ7L 4HA4A 4AZ8A 3PBUA 1I8MA 1S9YB 1CURA 4H6EA 4HV8A 3BVUA 3TBWA 3D0VA 3S8WA 4LHUG 4FXKC 4TNFA 4C83A 4X5PA 4X8JB 1QO3B 4YHPA 2O9TA 2GVYA 3ERXA 3OZKA 1DVTA 3CLEL 4XVJH 4ATTA 3SDOA 3URNA 4ECLA 1G0CA 1IJNA 1JCVA 4NCDA 2JKAA 4R4FL 4Y90A 1K7EA 1T6BX 3NGBB 1FFPB 3MRGB 4PJIB 3UJ2A 2ADIA 2J5LC 4BFRA 3F5JA 4B6ZA 2P8PB 4X9YA 3PABB 3AROA 2I07A 2VDML 4WCYL 4XBSA 1YUKB 3QXAA 3KEDA 3N18A 1YPXA 3VOCA 3WHXB 3B8TA 2OMWA 4AC2A 4U6HA 1MCHA 1IL1A 3TT3H 5IB2B 5K2ZA 5A6IA 3NCWA 4JKKA 1EXPA 3FFCD 1VD6A 5FCZA 3FQXA 3G5VA 2XV6B 3KYMB 4ODSH 1DFXA 5DMGD 3I65A 1BFNA 2VD8A 3KOZA 3MSYA 3WLTA 2GCYA 5FEWA 3GSMA 1XGYL 2HXAA 2EH7L 3Q6GH 3WIJA 4ZQRA 1MHHA 2HKFL 3QOKA 5BJTA 1BGXH 5CLYA 3NAAH 2O9RA 1A6UH 3SIZA 4KVNH 3WG7B 1XVSA 4JS3A 2HVKA 4WFFE 1HJXA 5MF5A 2WHJA 2VR8A 1CVSC 1JVOA 2BVPB 4LAJH 4NQEB 4F15B 2OT1A 1TZ9A 1SFTA 5EB8A 2VJXA 3X11B 5DQPA 2EXWC 3PG9A 2RDXA 4MMWA 2DTML 4U1HA 2DKSA 2Q71A 2AJZB 3MV7D 4BQ5A 5M2FX 1RD5A 3RHGA 4YTRA 3MBEA 4FLQA 3ZSTA 5HMSA 4N87A 4PRIB 2EXSA 4UC5A 1YXCA 3V0JA 3A5VA 2GJXB 5EU5A 4OQTH 5CKSA 3BX7C 1YDPA 4MKTA 2RJHA 3BWAA 4A63A 4V33A 2XWZA 5ECJE 3KS0H 1F58H 2APTA 3U1SH 4ICMA 1X7TA 5EOCL 4AMCA 2H6OA 2H0FA 2VAJA 3PAZA 3SBFA 1Z44A 1DUZB 1FNEA 3OHIA 1WDRA 3KLAA 1H3WM 1AJ2A 4H8NA 1L8NA 3KBVA 2A6DA 5HGAB 5DJ2B 5CJMA 3QIWB 1KJVB 1OAKH 1A5FH 3FONA 1BAFH 3K6FA 2I9TA 5FUZH 1LDPH 2R56H 3ZJKA 3GMQA 1XJBA 1UWAA 1CGYA 4N2CA 1BOGB 5DANA 4JREB 3ALXA 1ADWA 5I2UA 1BFVH 2YPLA 4PUNA 4F58L 3RFAA 5E4EC 4RUBA 4LF3A 1T1XB 4Z7OF 1RUPH 2GI0A 4A68A 2UZPA 5KBLA 3MJYA 1BQSA 3SRKA 2DWEA 3RM9A 3ARFA 3H53A 3UTZB 1I4NA 3KD4A 2BHUA 4OV9A 3NP4A 2AABL 2CGRH 1HWWA 2IGLA 2HFFB 4LPXA 5B39B 4C6QA 1U95A 4HW6A 1Q8MA 4H13C 3UZVB 4NVTA 4PWGA 1V3IA 3TKFA 1XHGA 4YHZL 3D3AA 2R83A 3KHDA 3Q67A 1TPB1 1GYNA 4BF5A 3MOAH 5IV2A 3OC5A 2OK0H 3RUGE 2X4SA 4G8AC 1EDTA 1B2YA 5ID0A 1U3HA 4RH4A 5T1MB 4PWHA 1F6YA 2H6RA 3W1AA 3QW4B 5AZEH 1KENH 4PJBB 3ZL4L 4Z1AA 2ZYSA 4GO9A 4NB7A 3J2PA 4GAAA 4MSWB 3T65A 2XN9A 3BUYB 3RHWK 5A2LH 3UTSD 3VQLA 4OSUH 4BSWB 5C0JA 1KLUA 3UADA 1EXGA 4HT1L 5IW6A 1GOOA 3V5KB 3IDJB 1U5HA 3LA4A 3HOJA 4Z7VB 2VC2H 4B96A 4IFOA 2X4UB 1SO4A 5EPMB 4BZ2H 3DERA 3AWGA 3REWA 2C4FT 3SBPA 2HS6A 3EX4A 3ANUA 3FZUC 4GVIA 1XGRA 4K9JA 3RYSA 1J8RA 1PY0A 4MJMA 4NRXA 5C09E 2VCCA 3GTFA 1X9QA 3QKEA 5ILTL 1GW9A 1H8LA 5I1LA 2XFXA 3RXZA 4BS0A 2PF8A 5FUOL 2Y7EA 3VIKA 1C8QA 1NAKL 3VWJD 4I0PA 5CAKA 3U0PB 3HNSH 4DTGH 3AQUA 4R0LA 3L3GA 3N13A 4X9IA 2E4TA 1E9LA 1URIA 5I3IA 3CN0A 4CQCA 4HJTA 4G42A 2V2WB 4LPYA 3FSVA 3EYSH 5EOTB 4GX9A 1UZ8B 2OZ8A 3U25A 1XSJA 2HNEA 4IGBD 2TPSA 4X5WB 4PJXF 3CJJA 3U6XA 1DVZA 7FABL 3JRKA 4UM8A 4HJUA 1A1MB 4MJ2A 4AENB 1GVFA 2B31A 3AREC 4Q6YA 1XRTA 1A21A 1HNFA 2VIRA 3F83A 3DHUA 2ITEA 2A6DB 3MNWA 5DT1H 3AREA 5FA4B 1JHLH 4I1NB 5EIIA 1TE1A 1JTOA 1W1TA 2PDWA 4GACA 1JS4A 1NCAH 1P4LA 5JVLA 4LO9A 3QWNA 4PJ5D 4EBQL 1UCBH 5F7DA 4Y8EA 5ALCL 5DVNA 4ACTA 3VDGA 1EOKA 3ULUE 1NDWA 4R90H 1QR7A 3OD3A 4YDIH 2KL6A 5JR1H 3L3OB 2FLMA 2AGJH 3SDXE 4HNCA 4IPJA 1Q9WB 4AEFA 4PY8J 5DU7A 1C90A 5CJXA 1KPUB 3EKCA 1DOSA 4LQ1A 2JNZA 4IBTA 3VXTB 3KTCA 4HD9A 3QY7A 1EOMA 2G3NA 2CO4A 1YN6B 3SDDD 1Z42A 3B05A 2Y25A 2BSSB 5C9WA 1LK2A 2P24B 3N1MC 3A5FA 2V7HB 5GRJL 3GAKA 5AUMA 1R17A 4PH8A 1SMDA 3BSGA 4QRRB 4MA3A 2FBOJ 1ZU8A 4C1NB 4TNEA 1I9JL 1GJWA 3BN9C 1CLXA 4PTUB 2F6XA 2OJPA 1MJJB 4AIZB 3B9DA 5AG8A 1FKWA 5I30L 2QPDB 2HAZA 1AODA 5LN4A 2J56A 3P9MB 3IJEA 4F8XA 3RAOA 3W01A 3H42H 1I8LA 1J6PA 3WH5A 1BXCA 2VLRA 1E2WA 3G7TA 3MRJA 4D0DA 3K4ZA 2JQXA 2QKFA 3W24A 4KK5C 2E5CA 3LRMA 2L4OA 4IJ3C 1A5FL 4WWPA 5AD0B 5FLVA 4NXSA 2VW7A 1X96A 4B3LA 3QE5A 5A6BA 1OE1A 1OCBA 2FUTA 4ROQA 3B6SA 4AY7A 2J6VA 3MB9A 4NGHL 2BRRH 1S46A 2F1AA 1H60A 4PRAB 1O4UA 1KACB 2YBUA 1DEEA 1K4DA 5D2LB 3IVUA 1HC1A 3SB3A 1PLCA 4RGNC 3HZVB 1AGDA 3CHOA 1A64A 1BVLA 3ULUH 1F3TA 3NM1A 1EMTL 2Y5EA 3L54A 2YWYA 4CKQA 4FSAA 3OVUB 4RR4A 4HS6A 2IWFA 3CFQA 1NH6A 5A95A 3QW3A 2GKIA 4FQPA 4FQJL 3ZFHA 4K9EL 3UPBA 1T0OA 2W0PA 4RISL 3BAXA 5E56A 1UMLA 3O45B 4KBXA 1QW8A 3KPLA 1H49A 5CBEB 3LCGA 3WXVL 5IBTL 3AU1A 1MCEA 4HNUA 3WFBL 1OD9A 3DENA 1BIIA 2VRJA 3F7QA 3WLPA 3DFPA 3P0VH 3IXTB 3VINA 4US6A 2D3VA 5GSVB 1TCRB 2ATSA 3K6SA 5F4XA 1UFUA 2ERJB 3RE0A 1FWTA 2P52A 3GQYA 5D04C 5DZAA 3H23A 4CADA 1EJ7L 2XWJA 4KFZC 3SGGA 1KGYE 1T5AA 2WQUA 1QFUL 1GYMA 1K02A 5HD8C 5HHNA 3TNOA 1RZMA 2WKLA 3DC0A 3RJYA 3NA9H 3T78A 2FR4B 4R3SB 3GNDA 3IV3A 3KPMA 1LUCB 4IHOB 1D7DA 2F7RA 1GT8A 4KEMA 3T8MA 5AOLA 5ANMB 4RZCB 4O1CA 3S5OA 4CQ9A 4WK2B 2P44B 1UZHA 3GTTA 3AXLB 4PJAF 2K70A 4RWYL 4LNRB 4PGDA 4HGWA 5IVOA 1LQ2A 1YEEL 2X5PA 2G3JA 5I0DA 2A79A 1AC6A 3P4NA 3TONA 3AHZA 1QCWA 4YSEA 4PLNC 1LMKA 1BMGA 4AISA 4NZTH 5I17A 3JTSB 1U4EA 3FT3B 4HK0A 1H1NA 4JQXA 4HC1H 4I2XE 4MHBA 1KXQE 1VACB 4YSSA 2C1IA 5AWNH 4LEBA 1PIIA 3CZGA 4KJYB 1K8DB 2BOCA 3WN5A 4LDCA 5HHMB 3ARYA 4KF1A 5LKNA 1JZHA 1S2VA 2OJZH 2WLIA 2I07B 5D7HA 3MWCA 1JFQL 1RZKH 5FGBA 3WTTA 5E08H 2FEEL 1LT8A 4XIAA 1BQLH 1YY9D 4FXGC 5F0LB 4LK4A 1JZ2A 3OQEA 3W39B 3LRHA 5F3HB 2WPBA 5HYSG 4BQ6A 2BWGA 3B3IB 2D03H 1HHGA 4HJWA 2A1WL 1KTBA 2VEKA 3UJFA 1BG1A 1EHXA 2X3BA 2KDYA 4AYMC 2G0KA 4HXAL 3RKDD 1I9IH 1VFMA 2SODB 3DI2B 3IE9A 4RFOL 1Z89A 2WJEA 3CH0A 4X80L 1UATA 4LEXH 1YNKL 4ZUVB 3HQ1A 3MODL 2YMOA 3F7LA 3QXAB 1W5PA 5I8EA 2YA0A 3MO1A 1RZPA 4N2AA 3LKPA 4AGPA 1SJEA 5I8OH 3LTPA 5FKYA 4EANA 1BLNA 2BP0B 3NH7L 5F0PB 4ZXBB 2QCGA 3CFEB 4L4MA 3VIHA 1CU4L 3QRBA 5T5FA 1V6XA 4M6OH 5A7EA 4DPPA 1OGTB 3V4BA 3BN9D 3HMXH 1WGVA 4M62L 1XIIA 2X4PA 3QZWB 4NF7A 2OO6A 3MTRA 2H3XC 3P81A 4DEPC 3MV8A 3SYCA 1NF0A 1XUUA 4OIAA 2NNRA 1BAWA 2X41A 4XPGH 5EWIL 4YLWA 3UA4A 3V5OA 5CGBA 3F8UB 3RP1A 3M41A 1MFDH 3G1HA 1ZT4A 1XGZA 4X6EA 2V6AA 3U4FA 4TTUA 1AQHA 4X8CA 3OIXA 3R0UA 1LILA 3OKMA 1MFAL 1XH2A 2YA2A 1A3HA 1TJ0A 1LEIA 2A6KB 4Z9KB 3E38A 4TVPL 3NZHL 4P46D 1MNSA 1FDLL 3A23A 1W32A 1D5XA 5F89A 5GGQL 3QFJB 4EZJA 1SDYA 3VI2A 1YY8B 4U3XA 3LG3A 5J5RA 2BASA 4HPNA 1UWXH 1OQXA 1HP4A 1ZV2A 4YK4C 4QHUA 5FEBA 5EV7A 5SWZD 3FQWA 5EO0B 2CKSA 1BFTA 4KV5E 1L6ZA 1S7QA 2EG8A 4QITA 1KTDB 2ZZUT 3WBXA 2K3TA 1PZSA 4FE9A 2H1XA 3P0GB 5DEGA 3WUWG 1A02N 2GEQA 1T6MA 4LRNL 4ZL1A 3Q1SH 1J8SA 5IM7B 1QYGH 1KYDA 3LQZA 3SOBH 1HTYA 5E8DL 2GDUA 2ZOTA 4LIQL 3QDME 4ELMB 3TW7A 4IGBA 3GWQA 5L9DL 3QPZA 1BV8A 4JN7A 4YWSA 4F0RA 4L4VA 1R75A 2VLKA 3DMMD 5IQ7H 3CAWA 3VI4B 4FG6C 4EUPH 3DV6A 2EDHA 1GOQA 2QCLA 4OD2A 1HKIA 2CUIA 4TTDD 1QFWL 1H7WA 4KK8D 2ACSA 1HXYA 3L0NA 4Y96A 4H8WH 2VZUA 1CQYA 3MUY1 1I7TB 4RGMC 4PJBA 4Y1AE 4YBLC 1E0UA 3UTTB 3MUHL 4HQVA 2CH8A 3T0AA 4H9XA 3MR9B 1Z9AA 1FLTX 4E42B 5JW4R 2DTMH 1YEEH 3P0YH 1WKEA 5T5FL 1OQFA 5DCDA 1LWJA 4A2HA 4KCVA 3OAWA 5F1KC 4XSMA 2ZSWA 3Q94A 1V6YA 1X8CA 1DTUA 2YK1L 3VOFA 2NW3B 1JNLH 3TC3A 4OZGF 5FS5A 5I2IA 4LUIA 1J88A 5I74B 4EIZC 4A3QA 1A6AB 3PV6B 4MQTB 5AVSB 1ZOXA 1NANI 2XBZA 5INDA 1V4YA 7REQA 2R4SH 1ED3B 3VA2C 4QXGH 2AKZA 1LYXA 3CWOX 5PTDA 1KXHA 1XKJA 4IJTA 4HH9A 4AD0A 1LO2H 3HJ0A 5AFAA 2NY3D 3D52A 3KDMB 4X3ZA 2XV3A 4KI1A 1M71A 4MJ6A 5D2LE 2ED9A 5H6HA 5LHDA 2V3FA 1KGCE 2OYKA 2HKHH 4KDWA 1UXWA 1GGYA 2OZTA 5EEXA 4NRXB 4HHAB 3DZ1A 1NAMH 5D5ME 1BFVL 1UKQA 2ZSVB 2DIKA 3AXKA 4JTUA 4I8DA 5FJJA 1N70A 1AE6L 5DI8B 4O2FB 4X80H 2IAAC 5E2WH 2FJKA 4AF0A 2X40A 1YY8A 1MKFA 3RU8X 3TA3D 1FWJC 5EF0A 3QDJA 5TE7H 3TUUA 2OQLA 3ILEA 4XAGA 2IMRA 4L3FA 5JLZA 1ACZA 2K4AA 3MBED 4S0TD 2GSEA 1DYZA 1N3NB 1CICB 5KBKA 1IXPA 1I0DA 3EX6A 3M7SA 3ZX1A 1UA3A 3WI9A 5ERWB 5HP5A 1OBAA 3DJRA 1KZQA 1ADQA 1MMFA 2BOFX 4LOEA 3PZVA 1ONRA 4IRJA 3QUMB 2X1PA 4YHOL 5I9QB 3PPFA 1OM3L 3DTUB 4KXZH 3HPZA 4REQA 4D0CA 3C5QA 1MPAL 2FJHB 4DVBA 1HTIA 4AZUA 3MV9B 4ZMLA 3E0LA 2A73A 1DQDL 2CE6A 4JDZB 1NDVA 2F2KA 2VP8A 4WDUA 4P2QA 2OJEB 3AS0A 1IAIL