3U0HA

The structure of a xylose isomerase domain protein from alicyclobacillus acidocaldarius subsp. acidocaldarius.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
279
structure length
279
Chain Sequence
AMEPCLHPTLVDETSLVLYLDLARETGYRYVDVPFHWLEAEAERHGDAAVEAMFQRRGLVLANLGLPLNLYDSEPVFLRELSLLPDRARLCARLGARSVTAFLWPSMDEEPVRYISQLARRIRQVAVELLPLGMRVGLEYVGPHHLRHRRYPFVQSLADLKTFWEAIGAPNVGALVDSYHWYTAGEHEDDLAQLPPEKVVYVHINDTRDAPEDAHDGKRLLPGDGRIPLVPFLRGLYLAGYRGPVAAEVLHETPLDGTGESRARLVRERLEKLIALAKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Xylose isomerase domain protein
publication title The Structure of a Xylose Isomerase domain protein from Alicyclobacillus acidocaldarius subsp. acidocaldarius.
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
total genus 104
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3u0hA00
1OADA 1XLCA 4QE5A 3IUDA 5EMKA 3U3HA 3UU0A 3IUHA 1MNZA 2HCVA 4XKMA 1XLKA 1YX1A 3IUIA 4X63A 4PFHA 1XLLA 4ZB5A 3N4AA 2NQ9A 4XSMA 1QTWA 3P14A 3KBSA 3KCLA 3M0MA 4A8NA 2G0WA 3KBNA 3M0VA 2ZDSA 1DXIA 2HK1A 5EMMA 1DIEA 4QEHA 3CNYA 1XP3A 5FA5A 1XIFA 2QUMA 1S5NA 3L23A 3BANA 4YTQA 1XLHA 1XLIA 2HK0A 3VNLA 3ITVA 3OBEA 4YTTA 2NQHA 4HHLA 4J4KA 1A0EA 3XINA 1XIMA 3KCJA 3ITXA 3M0HA 4ZBCA 3BDKA 3C0LA 1XLEA 4US6A 3TVAA 3VNMA 5XIAA 3QYSA 2XIMA 3KCOA 1XYCA 7XIMA 3AYVA 4EACA 4X60A 2QULA 1XISA 2I56A 5B7YA 3QXBA 3UXIA 4DVOA 4QE1A 2I57A 5XIMA 5H1WA 1XIJA 3VNIA 4Q7IA 5XINA 3ITYA 5TNVA 5I7GA 4K1GA 2ZVRA 6XIMA 1XIHA 3QZAA 1I6NA 5AVNA 1S5MA 4GJIA 3AAMA 4DUOA 2GUBA 3KWSA 6XIAA 3M0LA 5AVHA 3GNXA 3U0HA 3UVAA 1XLFA 4KW2A 1O1HA 1XICA 1XLAA 4QDPA 3C0SA 4YTSA 9XIMA 3M0XA 1D8WA 3AYTA 4OVXA 3VNKA 1CLKA 1XLGA 3KBWA 1XYMA 2QW5A 2J6VA 3BWWA 5B7ZA 4QDWA 1DE5A 4K3ZA 1I60A 1XLJA 4A8LA 2NQJA 4HNOA 1K77A 2X7VA 3JU2A 3UA3A 4A8RA 4E3VA 1GW9A 1DE6A 1TZ9A 2XINA 4ZB2A 1DIDA 4QE4A 3WQOA 4LNCA 4QEEA 1XLMA 3P6LA 3TC3A 5EMLA 1QUMA 1XYLA 3KBVA 5H6HA 4G56A 4XIMA 4YTUA 1MUWA 4GQBA 3ITOA 3XISA 9XIAA 1XIEA 5C9ZA 1XYAA 3VYLA 3AALA 4XISA 4EAYA 3C0QA 3ITTA 8XIMA 1XYBA 1XIIA 4YTRA 2GYIA 2Q02A 4HHMA 1XLDA 2QUNA 5J8LA 3QC0A 1XIDA 1BXCA 3ITLA 3DBNA 2X7WA 4W4QA 2G4JA 3VNJA 3XIMA 1XIBA 4X61A 3KBMA 3DX5A 3CWHA 3CQIA 4ZB0A 3UA4A 5B80A 8XIAA 3BZGA 3CQKA 1XIGA 4HGXA 4A8IA 4GJJA 3CQHA 3LMZA 2GLKA 1QT1A 4PGLA 1XLBA 3KTCA 3M0YA 4XIAA 3KBJA 1A0CA 2XISA 1XINA 2OU4A 3BZJA 4GLEA 5EMJA 3FVMA 2GVEA 3CQJA 1BXBA 1A0DA 3NGFA 4XSLA
chains in the Genus database with same CATH superfamily
5JU6A 3FOKA 1U1HA 1FX6A 4BF7A 3H22A 5HPOA 2PDHA 3SCWA 2QGYA 3IUIA 1P7TA 4HJFA 1Q6LA 3KW3A 2X05A 4MPQA 3NXLA 3M5ZA 2A21A 4DBSA 1RY0A 3PHAA 1KTBA 3N1AA 1S46A 3JRKA 5CPLA 1DJZA 1C90A 4KRTA 1VRXA 4AHPA 5A6SA 1WDQA 3AICA 1FWHC 3EOOA 3GDMA 2PCQA 2BXZA 4QQ3A 2ESCA 1HQTA 1P0NA 3UWEA 4M6QA 5DMLA 4H9MA 3V4BA 2HJPA 4HA4A 1P0DA 2QIWA 3O9NA 4WSKA 3TIMA 1S3TC 1EF3A 1O1HA 2C79A 5KETA 1Q3NA 1DJGA 1ISZA 2VNCA 4XK2A 4YHGA 2HTMA 1LQ2A 4CNPA 4UQAA 2X7VA 5FSDC 2BY0A 2DIEA 1OFRA 1DJQA 2GGEA 3WEOA 2PDYA 1FP9A 2BMBA 2QDGA 4GOAA 1TRIA 2Z1WA 1F8IA 3KZPA 2C3ZA 3NYDA 1UD3A 1F73A 4DPPA 1RSCA 4BFAA 4HGXA 3II1A 1EQPA 1N8IA 3QEZA 1OM0A 4MM1A 3A47A 1TWWA 2BV9A 2HRWA 1EXPA 4KWWA 4HK5A 4UIOA 5EMKA 3HURA 2J6XA 1KQZA 1DJIA 3STGA 1MXGA 5FF3A 3OYZA 2EPLX 2FPVA 3KCLA 3OLIA 4UQBA 1XC4A 4ACZB 3W7NA 3M16A 5C6MA 1GPWA 5T9BG 1DJWA 2PWEA 3BANA 4DJFA 1S5TA 5CQ1A 4IXHA 3W6YA 1E6PA 1S1RA 1UD6A 1OGBA 2ZX6A 4J28A 2ACUA 3FXGA 5HPCA 1JCYA 2A3AA 1UROA 4BK9A 3LU2A 5CC5A 1V0NA 2BXVA 1XG3A 3BAIA 1FA2A 5HK4A 3WJYA 4ENLA 3FFSA 1V79A 4US5D 3SY5A 3AIWA 4R7JA 3MSYA 1O5KA 4DRSA 1HN1A 2Y2WA 1XLJA 3DFTA 3ELFA 1K77A 3KOWA 3NYZA 4GY0A 4DJED 3P7YA 3TC3A 3U5YA 4B5XA 5D30A 3CIVA 5I2UA 3BGAA 1QBBA 2AQWA 4ZOBA 1LWIA 1VFLA 2E0PA 3E38A 3RRAA 1DWHM 4OV4A 1UD8A 4X61A 3W7LA 4DZ5A 1NWRA 3D46A 4ADTA 1SW0A 1XGDA 3VMNA 2GLKA 1V0KA 3PTDA 1QATA 3LN3A 2OWWA 3T8QA 1K7FA 3VUSA 1J6PA 3ME3A 3NM1A 2E8ZA 3FYPA 4S3KA 4A21A 2GZXA 2P50A 4RZ4A 2WHKA 3GTXA 5DANA 2Z27A 1FCQA 1H11A 2HVMA 4V27A 3MY9A 4A6GA 1DVJA 2EPOA 3B8TA 1RPKA 4MWAB 3N13A 3AWNA 3GR7A 4AIUA 1U5HA 1V3LA 4JCMA 4MWAD 1EP2A 2QNEA 1RVKA 3E0LA 1J96A 2NSOA 3GYCA 5CZSA 2YPIA 1H3GA 1UIPA 2AAMA 3MP5A 2C1HA 5D8ZA 1ITCA 1UR8A 2DZSA 3BLPX 2NX9A 1XCWA 1K8CA 1W8SA 2UWFA 2QDEA 4DVOA 1R9ZA 3UERA 1F3XA 4DZIA 5FJOA 3H2AA 3LS9A 1WDSA 1KGUA 4YXGA 1F4AA 2WZEA 3W7CA 3PBVA 2VC6A 1T0OA 1DQXA 5KZ6A 1ZY9A 3RIKA 3ARWA 1WKFA 1BWLA 1I9CB 4AU0A 3NA8A 1OFOA 3B0UX 2A79A 1JZ8A 4W8BA 4XZIA 2J78A 3W0KA 3HOJA 1HJXA 2OR2A 1G4EA 4AVOA 4O16A 5HDRA 3NQAA 2FVLA 3A4AA 4M56A 4LB4A 3ENLA 3GWQA 3VIIA 4OV9A 3WK1A 1OYBA 3M07A 1IF2A 3V0TA 2XH2A 2ZRUA 3L68A 4IFOA 4A4AA 1AZ2A 1NFPA 3A3XA 4YYFA 3N2TA 2KZHA 2EXOA 3SUUA 1XRFA 1YBQA 3MA8A 2ZE3A 3VDGA 5A6TC 3GO2A 3NZ1A 3P14A 1Z69A 4IFKB 1A3HA 2WK2A 1ZTVA 4H9YA 3RHGA 3GR8A 3O06A 1WE5A 4H01A 1KGWA 4LUSA 4DO7A 3LB0A 2PZ0A 2IQTA 1WDPA 3RILA 5D38A 3TYDA 3BCFA 2OTDA 2UY5A 1O12A 2UY4A 4JAWA 4GKTA 1YYAA 4UTJA 1Q2RA 2AL1A 3ES7A 1RCXB 2C1IA 1PYMA 4WX2A 5CJNA 3NSXA 4UNLA 1LYXA 1UOKA 3BOLA 4Y2WA 1FOBA 5I79A 1SO5A 2YL5A 2QPXA 4FNTA 3FNDA 1SO6A 2NQJA 4JDYA 1VAHA 3DGBA 3ZJ6A 2D0FA 1EWEA 4FLRA 3RM8A 3ALFA 4KEVA 1BFNA 3P2VA 4Y90A 3K4WA 1GVSA 1C8YA 3KVKA 4Y9AA 3G2GA 1GJUA 1NFBA 2WC4A 3QSTA 2YXXA 4HOWA 3PWGA 4GX9A 4D8AA 3T09A 4PMJA 2FPYA 2CWNA 2JEQA 1UP3A 2PDUA 4PBEA 4D72A 1KFWA 2RDUA 3A23A 3ZIZA 4JX4A 1FTXA 1E56A 4QP0A 2V3FA 3C2VA 2WHMA 3M41A 4UR9A 2HK1A 3RCNA 1N82A 4HMNA 2QCFA 2YDAA 2INFA 3IVSA 2CZVA 4Z1AA 4JYDA 3ID7A 1MQPA 4N42A 4DB7A 2GJXB 2BHUA 3OHIA 3OZOA 1BYCA 1P0BA 2CWXA 5IDZA 5H1WA 1OJXA 3C56A 2MUCA 1VPQA 3EOSA 3HGJA 3SCUA 2E6AA 2OELA 1AD1A 4HNLA 2JEPA 4PB5A 3W7QA 3FCPA 2VGIA 4NXKA 2VRKA 2RJGA 1YTDA 3ARYA 4LJ3A 4BS0A 3DFNA 3GHUA 1VR6A 1KNWA 4PTMA 3W26A 1J18A 1U5VA 2WMIA 3M1ZA 5F2IA 3CAVA 3H7VA 4PB4A 4C65A 1GOWA 1ZCCA 1TPB1 2FZNA 2Q01A 1HGYA 3ONBA 3BCDA 3W1XA 1TX2A 2F38A 1B3OA 3AZSA 1MO0A 1QNVA 3BXWA 1OYCA 2NLIA 1B57A 3CQKA 3TKFA 1WDWA 4B3KA 1CXLA 4X0NA 3WFAA 1YXCA 3BZJA 5A8NA 2GVEA 1OFBA 1OADA 1E4NA 1KBBA 1GKRA 1C93A 2NWSA 1M53A 1ESWA 7CGTA 2Y8VA 3VDHA 2BHZA 2O56A 2ZIDA 4FNSA 4B91A 1B3XA 3FY1A 3FEMA 1LG2A 2V3GA 5M03A 3WBYA 3TR9A 1L2UA 1I1XA 2A3CA 5EMMA 1JQXA 3TXVA 3B9AA 4IPLA 3VZYA 1DWFM 5I3GA 4NZ4A 3CV2A 1B9ZA 4K36A 1IWPA 4JEQA 3AUJA 3C2RA 3GU2A 5C2GA 4UTFA 3Q58A 4M82A 2ZC1A 2I56A 3UWYA 1PIFA 3ZWSA 3CEPA 1QI3A 2IKHA 4UFMA 4EF9A 3M6DA 4NJKA 4JTUA 5DMMA 5KZEA 2NVCA 4RE3A 3QJAA 3EX2A 4GVFA 4CQCA 3WNOA 1R3RA 1I8JA 1PZ3A 1FWTA 4ZVJA 1DE6A 1ZCOA 3NDZA 2EPHA 1IXOA 4M1BA 2PDMA 1RBAA 5JXQA 3R25A 1WKEA 3OTRA 2ZX9A 4M7TA 2XFWA 1UUMA 1E72M 3N2BA 3LD5A 4P61A 1G69A 1XV8A 6REQB 3WQFA 2YYUA 1BG4A 5I3HA 1PZ1A 3HPXA 3SFKA 3MC5A 3U7BA 3PZMA 3C5QA 5D04C 3V36A 4F9DA 4DX3A 4JHZA 1W1B1 1X1NA 2QCDB 1VBHA 4FIRA 1EFZA 3EWBX 4JIHA 4M6PA 2VEKA 3CZJA 4IGSA 1VFMA 4EXQA 1RQBA 1W5QA 4B16A 1B54A 2E09A 3AWOA 4O0QA 2Z1BA 3GVRA 2ISVA 3NL2A 3PZGA 1BD0A 1VD6A 3UCCA 2B4GA 3ES8A 4RDZA 3DYOA 3HQOA 4O1EA 3GKAA 3RLVA 4OZOA 1XPYA 5DXYA 4D6GA 4I7WA 5CH9A 4K6AA 4I9MA 4DI9A 2A5HA 1IXNA 1EHNA 1XYZA 3QMRA 4JYEA 4B90A 4R9OA 1DQUA 3L66A 5A6JA 3VD4A 4X9YA 2E9MA 4Q8PA 1NOWA 3LCWA 3W2KA 1RA5A 1TWIA 4HMDA 5TF0A 2VQUA 3G1VA 3G1DA 1W1PA 2ZZ6A 1Q7ZA 5M17A 2CKSA 2R14A 4I9TA 4IICA 3W1PA 1QUMA 1A53A 4MY8A 3TK7A 3LHTA 2XWDA 2FZ9A 1LT7A 3ONCA 4Q8OA 3IRDA 5I6SA 2ISDA 5JMUA 4N6EA 3LLXA 5G1YA 1BF2A 3S6OA 4JTGA 4PUMA 3EOLA 5CPMA 3TSMA 4NF7A 4AWTA 4HMCA 1FWJC 5EA9A 2BHYA 1HGWA 2FJKA 1HP5A 1GZ1A 3S9ZA 3DC8A 5I24A 2BVYA 2DEPA 1CDGA 3FAWA 4XSMA 1QFEA 3G77A 1XIFA 2J9YA 4LXFA 2W6RA 1NIUA 2P5NA 5G4WA 3AXKA 4ECLA 4GD0A 2OYMA 3GVWA 4IMEA 4TV6A 5DRCA 1P0EA 3PB2A 2ZUSA 3FGCA 3CHVA 3FVDA 5XINA 4AMAA 3W27A 3VIKA 1IQ8A 1CECA 1F3TA 3W23A 3VKAA 2GUBA 3TU9A 3S4TA 2B7OA 3VUPA 5A6KA 4FX8A 3GG0A 2FZDA 4HPGA 2GUYA 4Q22A 3GBEA 1N8FA 4HPHA 4LC8A 5DMNA 1UD2A 2RJHA 3SRKA 4RW5A 3UGVA 2G37A 4DJDC 4XX6A 1A5UA 1DE5A 3WLKX 3G0XA 4DO5A 4P8VA 5ABGA 3DHFA 1OIFA 3V18A 1DJHA 2Q8ZA 5A2AA 1E0UA 3SUWA 3NAVA 5JBFA 3BGGA 2A3LA 3ARXA 1H4PA 3VABA 5B80A 2VOMA 3M43A 4NKCA 3ZJKA 4UFHA 1RJRA 3BLLA 1L6YA 2OQLA 1HXJA 1S2WA 3HF3A 3PPFA 5BMWA 3MI3A 2R9RA 3H2CA 2VZSA 3I7RA 1KTNA 1UA3A 4XAFA 4ADSA 3K8MA 3USZA 4NX0A 2Y89A 1TZ7A 4O57A 1UPMB 2BOEX 3AC0A 2JBMA 1K6WA 2CERA 3NZQA 2WQDA 4E4PA 2YR1A 3REQA 1F3EA 3F5KA 2J7BA 2QGHA 1JXJA 1VYRA 3G0SA 4J4KA 3TV8A 4AF0B 4F79A 4O1AA 4TMCA 1K6AA 1YRRA 1VIWA 4EOUA 1XYFA 3NQCA 3M0ZA 3AYVA 1BSLA 3PS7A 3P93A 5I0DA 3HG5A 3GM8A 1AL8A 1WOAA 6XIMA 2Y5JA 4S3GA 1PUDA 5A5WA 5JQ9A 2O9PA 4B3ZA 3OGRA 4B2DA 4IX0A 2AOSA 4KGLA 4HA3A 1JR1A 3W7MA 2YZ5A 4ZQMA 1O60A 4E4UA 2BTMA 2RUSA 2A2IA 4L6OA 4K68A 1V7YA 1QNSA 3R8RA 1P4CA 4GVHA 2J13A 1ONEA 1JI1A 1FKWA 5GNXA 5G4HC 4E4FA 4M6VA 1OX4A 1M7PA 3LLFA 1A5NC 1LCOA 4YHEA 1W1VA 3DBNA 3SM0A 1TV7A 3IIXA 2C16A 2DZBA 1W56A 4IXXA 3PUDA 2WHJA 3NZPA 5HQMA 1VEPA 1X96A 4G8TA 1X6NA 1S1PA 4XVEA 3L2IA 1XKJA 3SB0A 4BEQA 1BF6A 2B0MA 2IW0A 3WENA 3T8LA 3UJRA 2P8CA 1KM0A 5EFDA 2O9TA 1JZ5A 3PP7A 4ACYA 2PTXA 1E6XM 2H6RA 3QHMA 5C7HA 1E9YB 1ZUAX 3VM7A 3LHWA 3W38A 3LCHA 4UTTC 1QW8A 5DLCA 4JTFA 2DUXA 5D9OA 4L56A 2DVXA 1IHIA 3QOKA 4UOJA 1LQ0A 4HZ7A 2OEMA 3MHUA 2VP8A 2V3DA 3WMLA 3NXFA 3WH5A 4XKYB 4KW2A 3SRFA 3N9SA 3W2NA 3B9EA 1CLKA 1HKMA 1W3NA 1UP2A 2VR2A 2IQDA 5DMYA 1D3GA 1WAUA 2NQLA 1Q6CA 1LWHA 2E67A 3QV7A 3FJ4A 2GSEA 5G1MA 3EA3A 2ASHA 1UC5A 1CI1A 3PFRA 1XGEA 3BE7A 2G96A 5AKQA 1G01A 1Q7QA 2QJHA 2QVNA 4MKSA 1TE1A 1MI3A 3JUGA 4CQ8A 5BWAA 1RY8A 2VRQA 9RUBA 2FH8A 4Z2JA 3WG6A 3N17A 1X8CA 2PBOA 3L7RA 1LZOA 1M03A 2J77A 5T26A 4O8AA 4GO8A 4ZB5A 3AXXA 5C70A 2NUYA 1TJ2A 2YZRA 2ZUUA 1L9WA 2E1WA 3ANYA 4ZOEA 3WBAA 4HTBA 1XLHA 1YNPA 2WJFA 3ISIX 1A0EA 1TELA 1FWCC 3IIOA 1W5OA 3QV9A 1R47A 2WVUA 2F6KA 5TNVA 3RPMA 3EXTA 4GIAA 2FGBA 1OG0A 4GZJA 3LPPA 3BOXA 3IVUA 4D6CA 2VEGA 5I06A 3K8LA 4LUIA 4F0LA 4YTSA 1KV5A 3BAJA 4WZHA 3CAWA 1RAKA 4AIOA 4H4IA 4GYPC 3WMCA 3UNDA 3TNOA 2V81A 4PMOA 2JGYA 1OFDA 3V5CA 4GUGA 1KLZA 1A4MA 3LM3A 2PDWA 2G4FA 3BV7A 3U6WA 1JCXA 4R5EA 1K8XA 2JFEX 5DXXA 3R8HA 1ZU8A 3VYLA 4JFTA 1W3LA 4RCXA 2WMGA 1UWUA 3SURA 2WPGA 3KS6A 4JKLA 1L0PA 4LBUA 3WF3A 3EZ4A 8XIAA 2DT2A 2WJZA 4TX9A 1EJSC 1PHWA 4HA0A 3AMDA 4H9XA 1SVDA 4GCXA 2Z2BA 2FPTA 3LBMA 4DJFD 3O6CA 1PXGA 3GDTA 4IMGA 2ISWA 5A6MA 2R94A 3A24A 4E2DA 1IEVA 2HBVA 1EEPA 2CBVA 4FNUA 4F0SA 4H6KA 2DSKA 1JAKA 1LRQA 1QW9A 1H7XA 4ZZ9A 3ZOAA 1PEZA 5J5RA 2Z7KA 1FY6A 1XCFA 3POHA 4HK7A 2VDGA 1A5MC 5HULA 3GU9A 4J3SA 3PK7A 2NVDA 4MKVA 2QULA 1W32A 3MMWA 2GGJA 1D7FA 3CB3A 1Q6DA 4FNRA 1GEHA 2DY3A 3ABZA 1V03A 2GVJA 1H60A 1JF6A 2NV1A 1GYMA 4ZXLA 3W7PA 2OYLA 1GVFA 3EXSA 3WD3A 4AW7A 3LG3A 1ONXA 3AIUA 5EL1A 3URQA 2CU0A 1B31A 4PCPA 5A8PA 2QLYA 1GVOA 2FJUB 2WSRA 4A8LA 3H6OA 1EO5A 2CBJA 1JCLA 3JR2A 2D3NA 4QM1A 1PDYA 2V5DA 3W37A 1RP9A 1PX3A 1MUWA 1FH9A 3QC3A 4ZEPA 3VD9A 3WIJA 1OYAA 4E8CA 1L8PA 4U10A 2DZAA 4GGHA 3MMDA 4R7OA 4G7EA 4DY1A 3MWCA 4GFIA 4FOJA 3C3UA 1KGXA 1XINA 2VEMA 2GJNA 5D2YA 2IKIA 2DZWA 3MCNA 1M68A 1NF0A 2IPFA 3T2OA 1FWNA 2PDFA 3RX3A 3L4YA 3W2UA 1TMLA 3GC2A 2XIOA 3JS3A 4O4WA 1FHLA 3KFTA 4TTGA 3S2NA 4C6NA 1WNOA 1WPCA 4DF2A 5HMFA 4MNKA 7ODCA 1DIOA 1TVLA 2XDFA 4AWEA 2DORA 3SGZA 2CEQA 4JTJA 1NQKA 3IRSA 1PDZA 4GUHA 1JDDA 1FQ0A 3AXHA 3MV01 1F6YA 4WK9A 1I0DA 4PL1A 1JQVA 2FKPA 2UV8G 2YL9A 5FCZA 3EOUA 4LUJA 2VGBA 1SYTA 4YU1A 2X0YA 3O3RA 4L6DA 5CC7A 1HKKA 2CFFA 1WDDA 3WQ8A 4Q8MA 3OVPA 3WQCA 4ZO9A 4U31A 3KXQA 4H1ZA 4Z2IA 1J0IA 4XUGA 3PUGA 3BMWA 3MO7A 3VC5A 5AC5A 1YBQB 1EH9A 5CJ5A 4DLFA 2QJNA 1ZRQA 1XUUA 3N6HA 1EJWC 3PWIA 1T96A 3LGGA 2E9BA 1XD1A 3IVTA 1RV8A 3VU2A 3EPOA 3MP3A 5C54A 4HYVA 5AHMA 2Z2AA 3ZVHA 4KH2A 1G9HA 3PN8A 1FH8A 3I7QA 1ELSA 2J8GA 3GXPA 2ZQ0A 1WB0A 4ZQRA 2G3NA 4HNTA 5E6YA 5JIPA 4QCFA 2QCLA 2PA6A 3SCRA 3HGOA 5DFAA 1GTEA 1UH2A 1D3HA 3C0LA 3W73A 4H9TA 3ARSA 4LEQA 3MUY1 4DEFA 1CXKA 4CUCA 4J3VA 4PN2A 3GIQA 5LA1A 2WC3A 4HU4A 2PUZA 2XH7A 3OVGA 4GJIA 3IIZA 1IT7A 4XZHA 1REQA 1G4TA 4H7CA 1IR1A 4JPGA 2EJ1A 1QCWA 2QW5A 2A6LA 3N73A 1AK5A 2L5HA 4DJDA 2V8ZA 3WQGA 4DYKA 3WZ0E 3MMTA 3ITTA 1PKNA 4Q8UA 1R8LA 2PURA 5CBBA 3F03K 3WDHA 1F74A 2IKGA 3VDBA 3IV3A 1TVNA 2HNHA 3QFEA 5IDIA 2CHOA 1JZ3A 1SFJA 3WUFA 2OU4A 4KWVA 3CQJA 1HZYA 3UPBA 3HMJG 5LA2A 3P62A 3WDIA 3W72A 3WJZA 1FWIC 1GOXA 3EEGA 4PFHA 4L6HA 1NJJA 5GQBA 2BOFX 3E12A 2CKRA 4PCTA 3KRBA 3NCOA 4A3RA 4OUEA 3L4ZA 4MJZA 1GOIA 2BG5A 5IXEA 3SDOA 2RKXA 5ENLA 5AC4A 4UB9A 1RR2A 3WNNA 3NVTA 4CU8A 4L9ZA 4MDPA 4NJHA 1GNXA 5JH2A 2WO5A 1UR2A 1JPDX 5XIMA 1QI5A 1S2TA 4UTLA 3TSBA 1RCQA 1I6NA 2WMIB 1M1BA 1BYBA 4F2TA 4Q8QA 5D9PA 1EZWA 1W9DM 2DV0A 3FSTA 4U3CA 5LYRA 1OFPA 3N2OA 2QHAA 1XYMA 1B4KA 5H91A 1MRQA 3OODA 2E6DA 1UUQA 3AYSA 5E6ZA 3MDUA 1XHGA 1V6WA 2EF9A 4BWLC 2QPUA 4N02A 1EUNA 1T5AA 4IIEA 3C0QA 4D6HA 4PUWA 2ACSA 2VMFA 1XLDA 1H62A 4FP1A 4GYFA 2ZXBA 2VZTA 1QHZA 1TTJA 3WQ5A 3B8IA 3BO9A 5DEZA 3MDWA 1CWYA 2OKOA 1ZFJA 5DF0A 5A8OA 3FN9A 1OIMA 3P8JA 3NGFA 3R79A 3VI2A 1PWLA 1SR9A 1US2A 4D6JA 1YX1A 2V5KA 1N7KA 3I7SA 3QZEA 4C7GA 1GUVA 1FXQA 1VLWA 3D0CA 2A7NA 3P5ZA 2OSWA 3HTWA 4NZCA 5FL0A 2R1NA 3UZ5A 3H23A 4NJIA 3BSHA 3S3GA 4PTNA 4AZBA 3UFYA 9CGTA 1E1CB 2HISA 4JBRA 3V3WA 3QXBA 1JRBA 1XIJA 1SO4A 2OOFA 3TR2A 1EF2A 4S39A 2WAGA 3C2FA 3NZGA 4QAWA 1XLFA 2XSXA 2QJJA 5FEWA 5DBUA 1D3CA 3N2CA 4HTYA 1QHOA 4HIBA 2Q8XA 3MW7A 4Q4SA 3M5XA 2NXHA 2VGFA 5TAOA 2PDBA 4PUJA 3RF9A 3CEUA 4ZTYA 3H2NA 3NNTA 1AQFA 5L9FA 1UWTA 4RK8A 1SFLA 1TV5A 4HHMA 1EYWA 2C18A 3R89A 5DT5A 2I5QA 2OSXA 2PC8A 1TUFA 1HNYA 4NRRA 4LF2A 3W88A 2AMGA 3PZUA 4Q8TA 4D6FA 2O9OA 1RVGA 1QNPA 5KINA 4S2BA 1EC9A 2DSUA 1TB3A 4BZYA 1MUCA 2VZVA 3W29A 1ZALA 3P61A 1BGAA 2YCJA 3NOEA 4H8VA 3PJTA 4ERIA 3GUWA 2RH9A 3PTKA 3WO8A 3B0YA 4NHVA 2VDHA 3CB8A 3KP1A 2YL6A 3SCOA 2Y62A 4GNVA 1IEWA 2G3JA 3LRMA 2H9AB 2FZ8A 1EQCA 2O7SA 2VCCA 4DWSA 4R34A 4ICCX 1AL7A 1K8YA 1EPXA 1YW1A 3HFYA 1UZ1A 2NW0A 3D3AA 8A3HA 3N9KA 1K02A 1PZ2A 2FTPA 5LIXX 3GUGA 4V1XA 3GU1A 1C7TA 5AB3A 4WQ6A 1SSGA 2I9UA 4O15A 3WDPP 1LQAA 4JKKA 5B7ZA 1LT8A 3NEVA 3GZ3A 5ECVA 1WZLA 3BW2A 3E2RA 3O16A 1ZJIA 3MJYA 3G18A 3UYIA 3W7JA 4RKAA 4TVUA 4DXVA 4AY8A 4Z1YA 2DSWA 1ISWA 2X8RA 1QOPA 4B3LA 2DW7A 1QI2A 1H0IA 2X1UA 5LXXA 3O0FA 4E0CA 3DX5A 1WQ5A 2ZDRA 2YX0A 2YDRA 3ARUA 3ITGA 3VGHA 4DUVA 1F6PA 5C9XA 3H2FA 3HN3A 4PH6A 4QISA 3EKZA 3MI2A 5HAOA 3WX7A 1YXYA 3T2PA 1KQYA 3MBDA 1BQCA 2W5FA 3IAPA 4GC3A 3FGCB 3QFWA 1BVZA 4FZIA 2FB2A 3L0GA 4EK7A 4GY7A 1F9CA 4GIEA 7PTDA 2GSHA 2IXVA 4JQ1A 4KIEA 3P0XA 4GKLA 4NZ1A 1DWIM 5FACA 5F1VA 2Z2UA 2ZZ1A 4LS2A 1A5LC 3IV8A 1CYGA 4DWDA 5EKYA 4A3YA 3WF1A 4XZLX 1KM6A 4AYSA 2PU0A 3QLLA 3BW3A 3S0CA 5I03A 1RALA 1Q8AA 1O5RA 3W7GA 4M24A 4QDPA 3CAKA 3KM8A 5G4EA 9XIMA 4ATWA 1KRMA 2J24A 3DG7A 1TX0A 1BYAA 3TC7A 3ARVA 1X7IA 3DYMA 3ZT7A 3E5BA 3Q4DA 3QR1A 3R58A 1MW3A 1JFHA 4LPCA 2X41A 2CLEA 4UFLA 1E15A 3B0VC 3G3DA 1UKQA 1NDYA 2GOKA 2POZA 4JICA 3S6DA 1EBHA 1XIDA 2D69A 2PLKA 1VS1A 2QMJA 1VZWA 2V0TA 3DG3A 5BRBA 2FVMA 3REQB 1A0DA 3TEVA 3C86A 1K1DA 5C0QA 3QQ0A 3GXDA 4PCNA 1KV8A 3DCPA 2VD9A 4UBPC 4AIEA 1KXHA 2Z4GA 5CGTA 1T8XA 1NY1A 4B2DD 2DZVA 2VYOA 3BPWA 3DGRA 5FIPA 2VC9A 2NVAA 4WXYA 3WQEA 3D6NA 1MNSA 3ITXA 1IEIA 2RDXA 2WMJA 3BJSA 4IQLA 1RBLA 4UUIA 3DZ1A 1KM3A 2PI6A 3UR8A 5AC6A 1E6SM 3H53A 3YPIA 3V16A 2D20A 1VFFA 3W1AA 3NL5A 4PBGA 3W00A 1YDYA 2J4GA 3B8VA 3M0XA 1OX4B 2HE8A 1Q85A 2H3BA 3GFYA 3QY7A 4A3UA 5LHFA 3ZT5A 4Z08A 1EDTA 3T6CA 1QRQA 4IUOA 3WEZA 1MDLA 2ZZ3A 3RJXA 1Y5WA 2KX9A 1Q8JA 3IIPA 2REQA 3B06A 3GFZA 3TC6A 4PL2A 2OZ0A 2PDXA 2PDGA 1DWGM 3WF2A 4B9ZA 1ZBVA 2F6UA 2GWGA 1V6XA 3N11A 2VR4A 2BNJA 2FFCA 2Q3RA 4IMAA 2DGAA 3LOTA 3C52A 4EKJA 1BXBA 3L4XA 1L6SA 3EX1A 1LF1A 2PC4A 2Y0FA 1E9IA 1EGMA 2QR6A 4LCRA 2NQ9A 2BFGA 4H00A 3UJEA 2C15A 3ZWTA 4A3HA 4YL2A 4F2BA 2HPMA 4HHLA 2PWVA 4IZGA 3PY2A 5FESA 1UPPA 3ZT6A 3TJLA 1LLZA 1OG6A 1X6UA 2R6OA 1XYCA 3CYVA 4HCLA 3VZXA 3WLOA 2PRHA 2DUZA 3A3HA 4M6UA 4K1GA 2X42A 2VD8A 3ATYA 3DERA 3UZWA 3VGEA 4GYJA 3VGGA 1R9XA 3PFMA 3AJ7A 3RU6A 3Q2DA 1Z32X 3W25A 1JPMA 5G5IA 5AZ1A 5IBXC 5HQEA 3UJ2A 1VFHA 5C71A 3L9CA 1AUSL 4HU3A 1SMDA 3LMYA 5TQLA 1X8FA 3RCYA 4Q6JA 4H9UA 1XLMA 3PBWA 4JTTA 1FP8A 4MPKA 3BAKA 4CCCA 4AD1A 1RP8A 5H8MA 2ZFAA 4CVUA 3WSUA 1J4EA 5A8GA 2OQYA 3OIHA 4F0HA 1MW2A 3B8UA 4R85A 3U2ZA 2QPSA 1XBXA 4JN7A 1BVNP 1XQLA 4ICMA 1V6YA 2OZTA 1LL7A 4JNYA 3RM4A 3ABSA 2ZYFA 3KL5A 2OEKA 3KLLA 3UNTA 3BG5A 3UW6A 5FF7A 2PDIA 3LQGA 3DFHA 1XLCA 3BURA 2YFNA 3N29A 4W5UA 1UB3A 4S2CA 5HJLA 3COTA 3WUGA 4AX7A 1PKLA 3S5SA 2D0GA 3CIXA 2PS2A 4H9VA 4HNCA 3WNMA 2VEIA 1UUOA 1KRBC 5BWFA 3CM4A 3M0VA 1ZP3A 3BLIA 2WANA 4JN6A 4QITA 1DIEA 1E51A 3T81A 1VBRA 4TMBA 4DF1A 3U8GA 1R3VA 4J5NA 3L5LA 4XG1A 3T0TA 1JPHA 3KVMA 3AROA 4LW7A 3VIHA 4N2YA 1XISA 3M64A 4LALA 2D2HA 5GJNA 1R3TA 4HNNA 1TMQA 3SW6A 3G1AA 3RLGA 2BGQA 3MJMA 4KFPA 3P74A 3ZVIA 3WUEA 4JNMA 2QJMA 1G6CA 1QXLA 4W8AA 5HQLA 1HJQA 5AHIA 3WF4A 1JEZA 4CCEA 4AXKA 4TXEA 1A49A 3TYZA 4ZQPA 1RUSA 2FH6A 5I00A 3MMUA 3GD6A 1LBMA 4IMCA 4DPQA 5LKYA 2XIBA 1V6UA 3VKJA 3THDA 1UJQA 3A21A 3WH9A 4GZ7A 4LSBA 3CAQA 1V3MA 4JQ2A 2SFPA 4B5VA 4CNSA 4FO4A 4DBUA 2PTDA 3C8NA 3HPAA 3CZKA 4N9EA 3OVQA 3OP2A 5K2ZA 2P76A 2G3IA 1NU5A 3PJXA 1SZEA 4JHMA 4PA8A 4Q33A 1UIOA 1XLLA 3FK4A 3N18A 4RPPA 1YLVA 6CGTA 3W6LA 1XSJA 3AIQA 1W3KA 3TQ0A 3STPA 1PO9A 4OU1A 3IEBA 5KEZA 5HBFA 1MDRA 3BDKA 2CXGA 3KCOA 5M5DA 3TYBA 1XKYA 3OZMA 1OHLA 1PSCA 1SQ7A 1CCWB 5HWMA 3AQUA 1JD7A 1VBGA 4PODA 1MZRA 1KM5A 1BKHA 1W3HA 2A7RA 5BCAA 2ON3A 1HVQA 3LYEA 1PAMA 2JK2A 4M8UA 3S2CA 2NQZA 3M46A 3G8EA 3GG7A 1H7NA 1GTHA 1KXTA 1EJ7L 3B97A 5JH1A 2J6VA 5EPDA 1R2TA 2X40A 4G7EB 2VR5A 3JU2A 3RLHA 2W27A 2E25A 3T4CA 4ZB2A 4F8XA 4WGHA 2QUVA 5H6HA 4H6EA 1ICQA 4LS1A 3SRDA 4GVGA 4D1JA 1SZFA 3R0KA 3B3DA 4ADUA 2C13A 2J9ZA 2WCAA 4WD0A 4KCUA 3PWAA 3QC0A 3R12A 2RDWA 3MSRA 1ZJHA 2HS8A 2PEVA 4W8LA 3P84A 3EA2A 3LCIA 3WDJA 2PBGA 4QS5A 5C9RA 2OODA 4AWSA 4L1XA 4FI4A 4D71A 4IPPA 3S5OA 2YA0A 3DI0A 5TIMA 2E3ZA 2QVHA 5HA7A 3Q45A 2W92A 4LUTB 3H2OA 3GBDA 3WL0A 4UTKA 4B5WA 5FA5A 4MSSA 4RXGA 2NT1A 4EP8C 3RX4A 4RE2A 3TXZA 2W91A 5DT7A 4FR1A 1H61A 4EPDC 2QDHA 4EACA 3A9BA 1LOQA 2GDUA 3SI9A 2Y7DA 2JGQA 5TBOA 4MY9A 3DYPA 1QVBA 5AVNA 3GHSA 1ADOA 2B7NA 3CIWA 1XW8A 3BTNA 2XSAA 1TUXA 4PBFA 2QCNA 2FGLA 1QPKA 4PMDA 2ZA1A 1OFAA 5LNUA 2V5LA 4WHBA 3Q37A 3BOFA 5CPQA 1HKJA 3VILA 1XI3A 3H24A 3HM7A 4JDBA 3BL3A 3HQPA 3M6YA 1VGAA 2QCEA 1EJXC 4RUBA 2F2HA 1OCBA 2C0HA 4WOZA 1XJBA 3LPFA 3T0BA 3AI0A 3A5VA 3PBUA 4KWUA 1IZCA 4I5UA 1UR0A 3LDVA 1VFUA 2PF8A 3ZVHB 3E0VA 1VPYA 3GXMA 3UZYA 4CLMA 3VIFA 4WY0B 3T40A 2QCMA 3N15A 1QNRA 4WKHA 2BVWA 2XISA 3PG8A 1T6MA 5F2MA 3WFLA 1YXDA 3WLJA 3R2GA 1E43A 3ZJ8A 1H50A 4DJEC 4AX6A 3TX9A 3LPGA 4IQDA 2Z28A 1DQWA 3TMQA 3T05A 1TREA 3GRIA 4RR4A 1OT2A 5IRPA 3AUOA 1REQB 3NPUA 4AD5A 1QK2A 5FJIA 1W37A 5A8QA 3DEQA 2WB5A 1DJYA 1VFTA 1SZNA 1XLEA 1E0VA 2YIHA 4ALDA 4D9PA 3PSWA 4QR6A 3IJ8A 2CLKA 3H7UA 4K1WA 4Z17A 3IIVA 3LV6A 4IP4A 4DJDD 2OG9A 3SO7A 3BSMA 2G97A 2GQ8A 1XLAA 1TWZA 3W1UA 1EL3A 4O1FA 4W7WA 5HUOA 3BWWA 4MWAC 1EOKA 1PCWA 3W1NA 3AZTA 3PTMA 1R7AA 3RX2A 1LTDA 2V3EA 1XGZA 4F9JA 3L4UA 1C8XA 2V9DA 3ATZA 1SJDA 2DU2A 5C9ZA 4O53A 2X1RA 4FNQA 2WCGA 3W86A 4N9BA 4U5KA 2VX4A 1ADDA 3CBWA 2WNQA 4I6VA 2QDDA 3CQHA 1PKMA 1P6WA 2ZX7A 4J3XA 3W74A 4I9AA 4IPNB 2OSYA 4HVXA 3MHFA 1AG1O 4ZA0A 1CGXA 1PE1A 1L2QA 1MFUA 1NH6A 5CPTA 1F76A 4JQ4A 1YDOA 3RNDA 1RD5A 2VX6A 4WEVX 4Y8FA 1TJ1A 5LHEA 3T08A 3GFXA 1CEOA 3W1LA 2VT0A 4JKMA 2XIMA 4Y9MA 4B4FA 3GE7A 1MVYA 4LVFA 3CL6A 1VQTA 1YMYA 3T4WA 2ZRWA 3I6RA 5C55A 2O7QA 3DBPA 1JDCA 1S5WA 3RO8A 4IIBA 4QG6A 5I3DA 3U0HA 2EAWA 4IF2A 1XH2A 3S1XA 2I7GA 5FI8A 1U22A 1O94A 1AMKA 5MKGA 4JTKA 3F4NA 1KFLA 2CNCA 4JEJA 3GTFA 4HOXA 2RHGA 3GH5A 4RW3A 1TTQA 3VC6A 4J3ZA 3W2MA 3BG3A 3NPWA 3SR7A 1DXEA 1VCGA 1TZZA 2FVKA 2FQIA 4ZR8A 3CH9A 4TX8A 3S5ZA 4UTUA 2GGGA 1ITUA 3BUVA 2ICSA 2V82A 1W1YA 1AD4A 1JUBA 1JL8A 2HWGA 3E5PA 3ICJA 4O1CA 5K4ZA 1WUFA 1Z6KA 4PUKA 1UZ4A 4MLRA 1A0CA 3HGRA 1ML1A 5HANA 4GLEA 4QLKA 1V6TA 2Y63A 1GK8A 3OQEA 7REQA 1W54A 4C6MA 3CUGA 1FWEC 1OCQA 4B5SA 1KCZA 1RD6A 1JYWA 2CITA 4YYCA 5E0KA 4PR4A 4FNPA 3ERPA 3RO6A 4AD4A 2QUTA 3RXZA 3KE0A 1XLIA 1LM1A 3NSMA 5MHBA 4Y6GA 3NDYA 2OO6A 3DHDA 1GVYA 1DJNA 1OX5A 4FLSA 3W7KA 5I5RA 3TQPA 1KD0A 3AFBA 3PZOA 3KWXA 3AHXA 4YCPA 3WNPA 1HKIA 4FMVA 1KC7A 1UH4A 1KCXA 3MVTA 3OYXA 2FYMA 4KIRA 4BQ2A 3STEA 3U2EA 1O7AA 1YQ2A 2X09A 3FKKA 4HNOA 2Y8KA 4LH8A 4U4MA 3HG2A 1JYNA 4IL2A 3FX4A 3QHOA 4O1BA 1MXSA 2VUYA 4QE4A 3TQVA 1XPGA 5H2ZA 3BLKA 4L61A 3U4AA 2R1LA 4AFYA 3PPHA 2QUUA 2ZADA 5EBUA 3S5NA 3LHUA 2P8BA 1Q6QA 3PPCA 2YBTA 3KHJA 3BLEA 1L6WA 3FJ6A 5HNRA 3UGRA 1ODZA 1PKYA 3RPTA 4UOZA 3CHDA 1NM9A 4DWSB 3GB6A 4DWSD 4E3TA 3CASA 1Z41A 2OQHA 1TWSA 3F4VA 1G67A 1HTIA 1C8VA 1IEXA 3N2MA 4WJXA 5HOSA 4NQ1A 2Y5SA 1SFSA 2Y70A 1QAPA 5IM51 1EEXA 1F2JA 2VFIA 4QLJA 1Z44A 2FMOA 4N0RA 5K3VA 4XO6A 1TPDA 2G3FA 5XIAA 3D3FA 5F2GA 2DP3A 3KUMA 4GI4A 2C19A 1KA9F 2PDNA 1TCMA 1K9TA 3VNIA 1G94A 4F66A 4OIFA 3AIBA 3SBFA 1PTGA 2HSAA 4AZCA 4JHOA 2TYSA 4XAYA 1OEPA 1E6NA 1XBYA 2ZICA 3F4DA 1LBLA 3KDOA 3GXTA 3RUBL 4GH3A 1GKPA 3G1HA 4HHHA 3S1VA 3W81A 3ZLGA 2F9RA 1G4PA 4AZ7A 2J47A 1N55A 3ABOA 5AYIA 4L4LA 1DL3A 2BVDA 3CO4A 3H21A 3TTEA 3BC9A 1OB0A 4KWSA 3E02A 4KF1A 4CCDA 3HPSA 2FHFA 4PEKA 4XISA 4G6CA 1UD5A 2D1ZA 2BOGX 4DUWA 1H1YA 4BY3A 4D8ZA 3VOGA 3XIMA 4UZUA 4DI8A 1GOKA 3VKCA 4LY4A 5KTLA 4PTVA 3TH6A 1H1ZA 1QK0A 2VX5A 4XIAA 3THAA 1W91A 2PODA 2F2KA 2YDQA 3PJUA 5A69A 3B4YA 2BGSA 3V0UA 1MNZA 5HNTA 5FF2A 1G0CA 3N4AA 1E1EA 1FWGC 4PTWA 1EC8A 1UWIA 3UCQA 1W3JA 5I3KA 3HGSA 4ICNA 1WKYA 1VFSA 5M3WA 4NP7A 4PMUA 2B81A 1R6WA 3SCSA 5D2TA 1J10A 1B2YA 3PM6A 1KFJA 4HOZA 4XBKA 3QZ6A 4CQDA 3QPYA 3C61A 4Z1CA 2XGIA 4PC8A 1NFGA 4BEUA 5CZTA 1NDWA 1K9DA 1XRVA 5M1TA 4V1YA 1UH3A 2BDQA 1XG4A 2Y88A 3SUVA 1CBGA 4KESA 4L4MA 1LOLA 4AB4A 4E38A 1TPC1 2J8TA 2QF8A 1VBUA 3GDLA 2VTFA 2VZUA 4TUFA 3C3NA 1Q45A 1BRLA 1ZAHA 1BTMA 5C9WA 1JDEA 1NELA 1OK4A 5D2WA 3EDFA 5K9DA 3KTXA 3DFQA 5BXTA 2P3ZA 4FHAA 3FVMA 1QWKA 1Y5VA 2DW6A 1V3IA 3BLDA 2DJXA 2C1GA 3OA3A 3V5FA 3PZVA 4JY8A 4IP7A 4S23A 1IIGA 5FOOA 1OF6A 2JKEA 1SSDA 3IAQA 3R8GA 4AYGA 5BRQA 1LL4A 1KXVA 2X1IA 5DX7A 4QCEA 3MUXA 3B0PA 8TIMA 1S2AA 2ZBTA 3SSJA 1F8MA 4GNKB 3UG8A 3KEHA 1SW3A 2PGWA 2VFDA 3W24A 2J79A 1E0TA 3WQDA 3WLMA 2REQB 3CV7A 1GVQA 4KCWA 4AC7C 4H04A 4M3PA 1BLIA 4IHCA 4NZJA 4LX4A 3G8RA 2DIJA 3N6JA 4KFOA 5ECUA 1TWDA 4BCEA 5K7JA 1A5OC 3CT2A 3TMLA 4KS0A 4ML9A 2FDSA 3FAXA 3RCMA 2J7EA 2MNRA 2P53A 2VEPA 2XINA 3VCRA 1OY0A 3BSGA 1EA0A 4H9ZA 1VF8A 4G56A 3XISA 2CETA 3UWQA 3DIPA 3H55A 4A2RA 2PDCA 4I9JA 2YDSA 4KCTA 3NEHA 1N2VA 4KPLA 1SPQA 2ABAA 1OX6A 3OQ8A 4DM1A 1TR9A 1M04A 4U2ZA 8RUCA 7TAAA 4A05A 3AO0A 1X97A 1PJ9A 4GK8A 3PNUA 1RQEA 3WF0A 2BS9A 4H7VA 2H8XA 3TDFA 1TTIA 1ZAIA 2WLYA 3BICA 2CCRA 5LZLA 1K7XA 5HWNA 3GW3A 1TG7A 1GOOA 3HMCA 2VI0A 2GJPA 3CZEA 3LI1A 5BROA 3W75A 2PMQA 1E5JA 4G5DA 3BJTA 2Z6JA 4A29A 1Z7AA 1XCXA 1B5TA 1E5NA 4DELA 3N14A 1JCNA 3LTPA 1M6JA 3GY1A 3ARRA 3GNXA 4C6JA 4RV3A 3CPRA 3DKJA 1H2JA 2EG8A 1CNVA 5BYWA 1XSKA 2B7PA 5D32A 4Q4RA 3EGJA 4WIWA 1H5VA 3UG5A 5BOOA 5AHLA 2ADAA 5CSSA 1M7XA 3HV9A 4K8EA 4XBJA 1UYQA 3E1F1 3B05A 2Y4SA 3QYQA 4AVFA 2E40A 1GEQA 2A1YA 4ZOCA 3R5EA 2G4JA 4OE7A 5FF0A 2BY2A 4C7DA 2YL8A 1O95A 3MUZ1 3OLGA 2YXGA 1S3HA 1K4HA 2J7FA 1VHNA 3L5AA 4WLCA 1ADSA 3KHDA 5I09A 3CUZA 5DQPA 3M5VA 1T40A 3M9YA 3WNKA 2QJGA 5LIWX 2POTA 4G1NA 2PPGA 3K13A 3APGA 3NQEA 3GHRA 1Q2SA 2JKAA 1AQMA 3ZSSA 1MQQA 4R88A 5BW6A 1P1MA 3T2QA 2Z29A 1XUZA 2WMKA 1DJXA 3L4VA 4AH7A 3QGVA 2Q71A 3MUAA 4I8YA 4WDXA 4QJ3B 3FIGA 1IZJA 3I6EA 1E6RA 3S2LA 1D8WA 1P43A 3A4WA 4HU8A 1XRTA 1RLDA 3I4KA 1TCDA 2IXUA 1WXZA 5KZMA 2HVNA 3C2YA 4N4PA 3MYOA 1E70M 2TMDA 5I23A 3JVAA 4P7QA 4LGXA 1KWGA 4GH1A 3THQA 3BARA 2GYIA 4CVWA 4CQ9A 1BKSA 4E2VA 1NTHA 3ITLA 2ZUWA 3BZGA 1W17A 3HIJA 1QR7A 2EO7A 1QJWA 2ZZ2A 3LCLA 4FOUA 4AISA 4OT7A 1AMYA 3N9RA 3PULA 1KKRA 2YBVA 2J74A 3CZ8A 2DJLA 3TW9A 3MSGA 4M29A 3LLDA 5I77A 3C0JA 3LA4A 3RFAA 1JYXA 3DOPA 4Z1DA 2HPIA 3LI0A 1ZAJA 4JN8A 3BLOA 1IEQA 3VTRA 2A7PA 4GUJA 1SJCA 4YIWA 2NQ5A 3SIMA 2ZVRA 4JTIA 5BXSA 2BXYA 2FGZA 5IHRA 4S3BA 4YWIA 4QGCA 7ENLA 4WDWA 3BW4A 2CIPA 3DFPA 4GI6A 2VVNA 1GQKA 4LRSA 4NVTA 6A3HA 1UQYA 3WK2A 3ZR6A 1JZ2A 5RUBA 3QSRA 2D73A 3M0JA 3KS5A 2GVGA 3OIXA 4ERAA 4H19A 2WQPA 1TA3A 1EX1A 1KLYA 4ZL1A 4QQUA 1ICSA 2GJXA 4W4QA 1VENA 3GW0A 4YWSA 5LNWA 4TR9A 5F7UA 4D2JA 3R10A 1FDZA 1X98A 1RXOB 2GK1A 1UG6A 3FYYA 3ZSTA 1U33A 2WPBA 3J7HA 3W7HA 3OEXA 4PMQA 2W4XA 3ZQ9A 5HJYA 3MTWA 2INZA 2QV4A 3CUIA 2RDTA 2PCEA 4C6BA 2CBIA 2OZ8A 4LQ1A 1XRSA 1IGSA 3CWNA 3I6TA 3NFUA 6ALDA 4DJFC 4FS9A 5LSMA 3KOZA 4AIBA 1OC5A 2J88A 2XYLA 4Y8EA 5FAGA 2VUNA 2PWGA 3IACA 5D09A 3E2VA 4LS0A 2PAJA 1F61A 3GXFA 2J7DA 3M7SA 4X2PA 2XUCA 1D2KA 3QMSA 1D8CA 1C3FA 5JBEA 3HJZA 1M5WA 3W53A 4LVBA 4LNCA 3TJ4A 1R3WA 5G2IA 3W1TA 3V1HA 3WJXA 1YE4A 2A3BA 1XIEA 2I17A 4NAEA 3W22A 2WMHA 5I78A 4MB4A 1QMLA 2HS6A 3AJXA 4PSRA 2ZUVA 3NQGA 3PSVA 3HQ1A 4DF0A 4B5NA 5A2CA 1VCVA 3JZUA 4HU0A 4Q7BA 5A6BA 1H49A 5GJMA 4LV4A 3O0KA 5EMJA 2IPGA 1GQIA 4ZFMA 2XN2A 1WDRA 2D2JA 3MVIA 3HPZA 1JG9A 1ZJBA 3MS8A 1C7SA 4MKNA 2FFIA 1R38A 4C5ZA 2VENA 3N12A 2PLMA 3HFTA 1KM4A 3S1UA 1W9UA 3OLEA 7TIMA 1RBOB 4FXSA 4J7RA 1TFVA 1GG0A 3AHTA 4C1KA 1DORA 2CBUA 5AYXA 3GHTA 3ZS4A 1CB7B 3SJNA 2DVTA 1HJSA 4JYFA 3SN4A 3ANUA 4RNHA 6PTDA 3N2XA 7XIMA 1LROA 3TYCA 2QF7A 3ABXA 3UF9A 3ITYA 1J79A 3ARTA 4QAIA 4ZO8A 3PB0A 1GZGA 4XAPA 5F4WA 4G9PA 1ISYA 3LGEA 2XN0A 1Q6RA 2CLHA 4LT9A 3SUTA 3QY8A 1JVNA 3LK6A 3BAWA 4INFA 3TTOA 1AVAA 1EZ2A 2W62A 1A80A 4NASA 3QHNA 3GZAA 4GBDA 4IMFA 3WLQA 4K2SA 1R3SA 5JIWA 1F7BA 4WJEA 1KCKA 2XH4A 5HNUA 3EB4A 1S2CA 1VC4A 3DUGA 1J93A 4IFRA 4MG4A 1UOZA 2OWXA 1JULA 1TV2A 1T99A 1RCOB 1V51A 3RJYA 3SY8A 3PZQA 1B3YA 3W76A 1C9DA 4GI8A 4OWGA 1Q5MA 3G1RA 4S3JA 3ZMRA 2DZTA 3FHQA 4NYYA 2WXDM 3B9DA 3VGFA 1AH4A 1FUYA 4IT1A 3FV9A 3BAXA 2B31A 5MKGB 3NQ8A 2WYSA 3AU6A 4O10A 4H8NA 3UR7A 5TD4A 1HO1A 1JZ6A 4N7QA 4PB3A 5D4YA 3OLDA 4NT0A 4HHPA 1WAWA 3SFWA 1CGVA 3TFCA 2X0HA 2OGJA 1QI4A 3B04A 2QS8A 3TOYA 4A22A 3C4UA 3UESA 5I02A 3W01A 1Q65A 3WLIA 4GVIA 4M81A 3T55A 2EQDA 4E8GA 3IK2A 3VD5A 7REQB 4YVXA 4QNWA 2X7WA 1KB3A 3L0NA 3LQLA 2D2GA 4HBKA 1HL8A 2P10A 4GZEA 3CV1A 4MIMA 2LLEA 2WHLA 4HK6A 1GW1A 4TX6A 3EAUA 3PF3A 3GG1A 1W6TA 1ZZMA 4LU0A 2GQAA 3I3BA 2Z24A 4JTLA 3LCGA 3OJGA 1LRTA 4RX0A 4ZODA 4GWEA 4HCDA 1I2OA 3TNBA 2W63A 4Q8VA 4BQ3A 2ZA3A 1G7UA 2IUZA 1WCGA 4CEXC 2INEA 1ME7A 2GL5A 3WLLA 4C5YA 2WZIA 4UWMA 4JOMA 4I7VA 3KCJA 1UR1A 2VVSA 4IISA 5LIUX 2YW4A 5EYWA 2P88A 4Q7IA 4FK9A 2CHNA 1UMLA 2V69A 4IM4A 4O8RA 1MEHA 4NIRA 4C1NA 3MO4A 4P5UA 3SEPA 1NAL1 3TJIA 3QW4B 1RZMA 3N3TA 1KRCC 1J9YA 1NP2A 4E3VA 2ZXAA 3TTSA 4FAMA 3W7OA 3IANA 4PMYA 4U28A 2Q8LA 3VIMA 4HPXA 4POCA 1XC6A 2ISFA 3D47A 4H8HA 4UNIA 5C8BB 1GORA 3U5UA 3VOIA 5BZAA 5AYBA 3MUIA 1I2PA 2PGEA 1P5BA 1WXYA 3ZZ1A 1J12A 1R3YA 3LRKA 4OECA 2V2HA 1YKWA 3UYCA 1NWSA 1YEYA 2E4TA 3BQ6A 4L7ZA 1PTAA 4GC4A 4E8DA 1AQ0A 3TLQA 2O55A 4NAFB 1UHVA 2CXEA 1GHRA 1RHCA 1OABA 1P6CA 4JCLA 1TVPA 4AZCB 3QGAC 2ZX8A 4MB3A 4HKPA 5CPNA 2WBGA 2VGGA 1UR4A 3MHGA 4GI9A 4GIYA 4PTXA 1Q6OA 4GPNA 4HQVA 1G1YA 3WQPA 1NOUA 3MWAA 1UKTA 3KL3A 3B8DA 5C2CA 4H41A 3URNA 2WSPA 1HO4A 1JYVA 3UXLA 3CUXA 1Q6EA 2ZWZA 3C0SA 3OA5A 4QNEA 2YCKX 1WZAA 1B0IA 4AZ5A 1P7TB 4LUYA 1GQJA 2VFEA 5CZKA 4BQ4A 2E9LA 4AAJA 1DTUA 2GUUA 4IGNA 1Q6FA 2V30A 5E5CA 1XYLA 4U5IA 3E6EA 4M80A 1I4NA 3A64A 1V4YA 4MF4A 5G2WA 3FYOA 3EX3A 3LSBA 2R1KA 4LBRA 4WVXA 5L6UA 2WM0A 3WLHA 1E6QM 3CZGA 3H70A 4QG9A 3WMBA 3T78A 2GFTA 4XD4A 1A5AA 1OT1A 4CNNA 2XU2A 3NL6A 1J0ZA 2BVTA 1S2VA 3TYAA 3QR0A 5G1TA 1GYNA 2V5JA 4LVAA 3GVQA 3TLLA 2XH0A 4DXXA 1H7PA 4P8XA 3T0AA 3WD0A 4K8HA 3TAKA 3QV8A 1V02E 1DXIA 4UCGA 4W89A 2XVGA 3URBA 3PUEA 4MWAE 4JFUA 2X0SA 1EDGA 1O4UA 1PX8A 1XSIA 4GACA 3NUKA 4LAMA 3RR4A 4O12A 3B9NA 3W02A 2HMCA 1K03A 1RPXA 3FJLA 3AIEA 4W87A 1UKSA 3KAOA 1IXQA 1DTNA 3TN6A 3HU7A 3NTYA 2J27A 1V0MA 3UCDA 3OOQA 4QXIA 1SFTA 3BCJA 4PRWA 3DXIA 4J2MA 4F0RA 1W5MA 2UBPC 4PMVA 3VCNA 4FSAA 3WH7A 1O5QA 3AYTA 2VL4A 1DPMA 3A9IA 1BRLB 2QEZA 1D9EA 4PYSA 1XF0A 3AIRA 5EBAA 1AZ1A 4V33A 5BRPA 3TWAA 1IXPA 1XDLA 1CGWA 3KRZA 3WBXA 2V63A 4J3WA 3OBKA 4GNJA 2ATMA 1XR2A 4K39A 4C60A 2BASA 4ATLA 3W28A 3GNNA 2QAFA 3ZR5A 2AKZA 4GX8A 4NJGA 2GPTA 1TYGA 2VDIA 3CC1A 3NQBA 1CIUA 3CLMA 1UZHA 1HJVA 3QKZA 4NZFA 2C6QA 3GNPA 3LNPA 2PWDA 1KWKA 4X63A 3N04A 2CZ5A 3G24A 3O2LA 2ZTJA 3ABRA 3M7WA 4GQ0A 4O4VA 2E5DA 1J5SA 2DZUA 2A85A 3POCA 3B9OA 4ZBCA 4M0XA 3LZ3A 2EG6A 4IJBA 2TSYA 4EIVA 2Y1HA 5U4NA 2J66A 3KTSA 2VQTA 4DM2A 2GVLA 2XM1A 5D05A 2A3HA 1Q7MA 4JTEA 4QDWA 3AHVA 4JIRA 5AYYA 4FX6M 2NV9A 1Z8AA 3GK0A 1OCJA 2HE5A 4CD6A 5HUPA 1YPXA 4Y9NA 3AHZA 4GE8A 3L21A 2W61A 1FFQA 2F6XA 4TOQA 3MCOA 3FS2A 3CS2A 2IS7A 2Y5EA 2AKMA 2R24A 3VGDA 1A5CA 3UPWA 4JFWA 4RE0A 3W1QA 5CLTA 1WBJA 4RZ5A 3CT7A 4WDTA 3S46A 3DFYA 3KBJA 1KBJA 4GUIA 2YA2A 3O15A 4JNZA 5F4SA 4GCAA 1J0HA 5JUVA 2CYGA 4QSFA 3T9PA 1LG1A 3IJLA 1POKA 3WUBA 1SM9A 2OX1A 3F4WA 2V68A 4JQ3A 1QPQA 2QXWA 3GNDA 3WDRA 5LIKX 3IJ9A 2Z1SA 4RV8A 1VLIA 1GVIA 1TQXA 4GYKA 2NWRA 1V8EA 3U2OA 3GAKA 3LXBA 1Q63A 4WF7A 4M51A 4MDOA 2EJAA 3DFSA 3W83A 3WD1A 1AFSA 1V77A 2WZHA 1XDMA 2Z1VA 4R7WA 3RMEA 4URIA 4KRUA 3DU0A 4J1OA 1MW1A 1ZBCA 1HL2A 4Y7EA 3UA3A 4IPJA 5FEXA 1B30A 5DCBA 4CQAA 4LUSB 5T91A 1VKFA 1P48A 4KQNA 1UR3M 4J40A 1EJVC 2PTWA 1LBFA 1I75A 3R11A 4MNMA 1CXFA 1EYEA 2BGNE 4KMQA 5EGRA 4CNTA 2P0OA 4JS3A 2OPJA 3TYUA 1PHQA 4MADA 3SQSA 2DT3A 5CPSA 3LSCA 1W2PA 3RITA 2WLZA 4AUBA 2YW3A 4CKQA 4E2BA 3UVIA 1NWTA 2Q3OA 2Z1XA 4Q4PA 4QDMA 2YYTA 4PUEA 2O0TA 1SO3A 4HNUA 4G2DA 4CN4A 3NM3A 2BSLA 5FEPA 3KRSA 1XX1A 2NQHA 2CZEA 1AW2A 5FF4A 4FPSA 1WO2A 2CLFA 1IR2A 3NDOA 4WR3A 2I5IA 1G7VA 3LUTA 5CAKA 4A35A 2XWEA 1S5MA 3TONA 2DDXA 1H5YA 3SGGA 4DHGA 3WD4A 3VKKA 4QJ4B 3SCPA 1HKVA 1TE6A 4HYWA 3DHPA 2Z26A 4AG0A 3VM5A 2C71A 3S9YA 2XHYA 4B92A 2Z6IA 4PRTA 4KEUA 1DP0A 4BR1A 4KWOA 4IIFA 4QEEA 4HSNA 4I6KA 4GQBA 1P1XA 3GC5A 3ITOA 3L0KA 3BG9A 1XWYA 2Y7GA 2RAGA 2XVPA 3AMKA 3EYPA 1FCVA 4ZO6A 5CSUA 3PZNA 1PTDA 4D6DA 1J0KA 1ZPTA 5M2FX 2CLMA 1DHPA 1LDCA 3KTCA 4GXPA 4K7YA 1UC4A 4MY1A 3W85A 2J7CA 1A5KC 4LAKA 3G22A 3O7UA 3VINA 2EHHA 4OTKA 3JW7A 4MAZA 1OK6A 2ISSA 3CYJA 4XZ9A 3IUHA 3WNLA 2J75A 2WVSA 4BKNA 3GAYA 4DN1A 3W82A 1JPKA 2R8WA 1W3TA 3QKEA 1QPOA 1XH1A 2CLOA 2XFRA 3L2MA 1GHSA 2W9MA 3ZLFA 4UQEA 4Y9PA 4NRSA 2PTYA 4S3EA 1QO2A 4JZ5A 2Z25A 2J62A 2OLHA 3EWXA 1VH7A 4AZ6A 3K1DA 3WMSA 4MZ1A 3TW6A 3NQ7A 4I3GA 4CEUC 3W71A 3TCSA 1W2VA 1Y7VA 3CL8A 3CLWA 1MSSA 5LGXA 1ZNNA 1WZKA 4HN8A 4Q4KA 1IT8A 1SJBA 1QHPA 3PAOA 2DFAA 3NIYA 6XIAA 2BBFA 4KETA 1H09A 3UWZA 4XD5A 5D2VA 1DBTA 1TA3B 1GONA 4UMAA 2GOUA 3PANA 5C9UA 2NX3A 3N34A 4XAGA 1JD9A 3KX6A 3T44A 3UBPC 4H83A 2IPWA 1H51A 2ODOA 4HPJA 3K8KA 3K46A 1A4LA 5K9CA 1JFXA 4AEFA 2PRMA 1ZJAA 4P7LA 2GK1B 6TAAA 5D2XA 3T7VA 4EANA 1U30A 2OMAA 1JCTA 5BNKA 3N6QA 4HNVA 2Q6ZA 2WSKA 2OKTA 3PAJA 3QVQA 3BGJA 3BJFA 3IARA 3KVJA 3P5YA 1M3UA 3MI6A 5EFFA 4B15A 1CZ1A 1J2BA 3MCMA 2PP1A 3GVGA 1H7RA 3VD3A 2EG7A 3BMXA 3P0WA 4DZAA 3FHAA 1TPFA 2DZPA 4UTTA 3SZ8A 3UZZA 3ZJ7A 1XP3A 3P80A 4YNGA 1E6ZA 3T0DA 4TVCA 3ITVA 3C6CA 3NVDA 3PR2A 4KT2A 1CXIA 1CPUA 3QYSA 4JTSA 1JXKA 5B7YA 1WP6A 5E9AA 1Z89A 2I57A 1XBVA 1VB9A 3VDCA 4BI5A 1E4LA 1FH7A 1BAGA 3TROA 1ISVA 2NUXA 2VC7A 4R9XA 3ARQA 6TIMA 3O07A 1A3XA 1K9FA 3M0LA 4NAEB 1TV8A 1VYPX 3TN4A 4LCSA 3GH7A 4OBTA 4MUPA 1N8WA 3EMQA 2IKJA 3EDEA 3AZRA 2I1OA 2ZCGA 1VEOA 4ZE4A 2R91A 3NR0A 2AMXA 5A6BD 2E6FA 3IJIA 3GR4A 1CXHA 1QNQA 4WOQA 4L1WA 5DRIA 1UZDA 2D0HA 3TUUA 4LF1A 3R13A 1VP5A 2VFFA 4NNBA 3MV11 3WL1A 1E1CA 1QASA 1FWDC 2ZUNA 1ISXA 3STFA 3IPWA 2YLLA 4Q8WA 4S1FA 3ZXWA 5I3IA 2WVVA 2QCGA 5I3JA 3PJWA 3VE9A 4JTCA 3TZNA 1QOXA 2HCVA 1U2YA 4XKMA 3W07A 1G4SA 2FMNA 4HPNA 3E9AA 3R7MA 2VM8A 3NG3A 3FDKA 1K4GA 4DO4A 3OPSA 2HK0A 5GJPA 4AWUA 4F0MA 5LNVA 5CBIA 4P7RA 3P82A 2ZOXA 1NDVA 3INPA 3DC0A 4HSOA 2CZFA 4DLMA 4MZYA 1ZL1A 2WSQA 1T41A 3FXYA 4HSHA 3W7EA 4M5PA 2QCHA 4UFJA 3H2EA 4GYPA 3LZ5A 3D5HA 5HMDA 3DAQA 4DNMA 1RJPA 2YOCA 4CN1A 2YA1A 1EBGA 4LVDA 5LNSA 1EXBA 1TV4A 5CZ0A 4NL1A 3VZZA 2VC5A 4UFKA 4BA0A 3EWWA 1F07A 3PG9A 4C6PA 3SCTA 1YTKA 4A8RA 3CUJA 1U83A 2YB1A 1ZHAA 2C91A 1M7OA 2OB3A 3EMZA 4YMZA 1TTPA 1H0GA 3AS0A 2V6AA 2H9AA 2E77A 3UR5A 4LVGA 4RE4A 4Z1BA 2OGYA 3UWWA 1R3QA 1TIWA 1XD0A 4DAIA 3UA4A 4EVZA 2YBUA 2IQ0A 4QRNA 1PX4A 5KSWA 1XS2A 3VX1A 2HBXA 3MPGA 1EP3A 4X9SA 3KDNA 1B90A 4L9XA 4NYUA 5D8WA 3NURA 4EWND 3E49A 5E93A 3FA4A 1EHAA 3LCFA 3S6TA 3VOFA 1EPVA 2AL2A 2E5BA 2XM2A 1JPIA 1K7EA 1XIMA 2EPNA 3M0HA 3CHFA 4US6A 1JDAA 3BV4A 4NNAA 5E0CA 2NLYA 1C9WA 5I7GA 4XTDA 1RK5A 4XV0A 3V7PA 1O5XA 3NQVA 3CU2A 1SZRA 4DUOA 5HNNA 2VEFA 4GUFA 3ECQA 4DAFA 1E0XA 1JGIA 3VNKA 3WFZA 3V75A 3TAOA 4HT3A 3QQWA 1OD8A 2WZTA 1V7AA 2NX1A 4W86A 2F61A 3S2MA 2W66A 1ZSXA 3WH6A 3F1QA 2XFYA 4NZ3A 4OBRA 3WQ4A 4YVPA 5GPRA 1FHVA 3UP8A 3FSUA 4H6QA 1FCUA 1V6VA 1LWJA 2NV2A 4KFNA 1GOQA 2XGBA 3GG8A 1MYRA 1E9ZB 1VJIA 2OVLA 1H7OA 1M01A 1JCJA 1EOMA 1R46A 3IUDA 2E1DA 4R33A 1WOBA 1CX9A 3OGSA 3P81A 3PBMA 3WELA 4JD4A 3OBAA 3A3WA 3HQNA 2WM1A 1UKPA 3NJ3A 4C1NB 5BMXA 4WKAA 3IJDA 4GQRA 1TRDA 2J25A 3G6LA 4LANA 1YDNA 5DN1A 4CD7A 1R2RA 3CH0A 2ATSA 1TJPA 1J5TA 4E5TA 4X60A 4EXBA 1JGMA 1PIIA 5FAJA 3IJQA 4XVDA 4IGHA 4ZQCA 4S3DA 5REQA 4XB3A 3U2CA 1UP0A 5IFPA 3UVAA 5AZ0A 1MQRA 1NDZA 4YN5A 4W9TA 4PULA 1BWKA 2E68A 2WC7A 4O14A 3WQWA 4K3ZA 3NZRA 1LOSA 4WSHA 4YJ5A 3UQNA 3M44A 4LBSA 3C8FA 1R5YA 3RRXA 1ZS2A 4GHRA 5A8MA 4PMRA 4XIMA 1YPIA 2H8ZA 3CHEA 4H2HA 3L67A 1DKWA 4Z2KA 2UZ9A 2GDVA 3TZFA 3IWPA 3AYRA 3QLDA 2FTYA 4MMWA 3P3BA 2GQ9A 2GVYA 3HV8A 3U4FA 3TJXA 3KP0A 5CSRA 2PTZA 3BVJA 3MYPA 3MZNA 2DQXA 1W5PA 2ZE0A 2GWNA 3S2JA 1D7KA 2V2CA 4GZIA 4Q3MA 1S38A 1W5NA 1FWBC 2ZRVA 3IK4A 4PCSA 5PTDA 3GVVA 2Y7FA 3AS3A 3M0KA 1K8ZA 5A95A 4JTHA 2PF0A 1NOFA 3E74A 4JX6A 4YCOA 1KTCA 3PVFA 3UZJA 4R3UA 5LA0A 1U1JA 1DHKA 4WJ8A 2FHBA 2I5GA 4X22A 3MQTA 2JKPA 2B7QA 4WRHA 3DDMA 1XICA 2RGLA 5LGZA 3N4EA 4JXCA 3GH4A 3UWVA 2CPUA 2XZ9A 1HL9A 3V5OA 2YJQA 4ILSA 1FFRA 1ME8A 2OT1A 2GDQA 4CU6A 3DENA 4XZBA 1OC6A 4WXZA 3Q67A 1X1ZA 4MNJA 3O1NA 3TE9A 3KVLA 2Y6ZA 3CPUA 3NQDA 3IJ6A 1RK6A 4ZFCA 3R94A 4O54A 4KCVA 3CK5A 4WDUA 1I2NA 5CBJA 2NZLA 5CLWA 1VBJA 1V93A 3AU2A 3DG6A 1QBAA 4G7FA 1G5AA 1L6FA 2OYKA 4F40A 4O0ZA 4M19A 4OGZA 1KM2A 2NXIA 4B5TA 1NF7A 2F84A 3UD6A 1LLWA 4P2VA 2G50A 5LXEA 1Q6GA 1RA0A 4DBDA 2OZ3A 3VPLA 4JIQA 2PGRA 1JUKA 3GX9A 1EA9C 2BP1A 1U1UA 5DCEA 3N25A 4EXAA 4I7UA 3Q65A 3PZTA 3W1RA 4JFVA 2XIJA 2XTKA 3ZM8A 4Q4MA 2EBNA 5AYZA 3NPVA 1UW9A 3QZAA 3LHZA 3E2QA 4DWSC 1JDFA 5AFDA 3F2BA 3PNZA 3VGBA 5HXMA 1TMHA 1WZMA 1Q66A 3G0UA 4BWLA 4D6IA 4P8UA 3LXCA 2XVKA 2WJDA 1DIDA 3KOFA 2BY3A 2WKLA 1PZ0A 1LJYA 1R86A 1LORA 1XYAA 2XFFA 3AALA 4EAMA 3LNMA 5FL1A 3IGHX 4OJYA 1V0LA 3W84A 3KBMA 5BOFA 3CWHA 3VDAA 1KFBA 4S3CA 4H7ZA 1UASA 2ABBA 3CQ0A 3EXRA 2ZZ5A 1KBKA 1E73M 3G5EA 3K30A 1PCKA 4Z0JA 3RN6A 1RH9A 5FKYA 3WJWA 3M4HA 1A5SA 3TTYA 2ZRZA 3UG3A 4HJWA 3VOJA 2C7FA 5KMYA 2G5WA 4UFIA 4U33A 4AY7A 3ZFHA 3H54A 3LV5A 2E7FA 1VRDA 4O11A 3RDKA 1HX0A 4DIAA 4TTUA 2BX7A 2YLAA 3ALGA 3QTPA 1GJWA 3UXIA 3VXGA 1I1WA 4O19A 4QBXA 3UY8A 2W67A 3MSDA 2OWCA 3EX4A 1LUCA 4UXDA 5HJXA 4BI7A 5DY3A 4GINA 1UWQA 4ZXOA 2W79A 5CXPA 1CXEA 1BGGA 1SU5A 1TQJA 1QI0A 3WQOA 3GDKA 4RDYA 1CT5A 4NNCA 1IGWA 4AC1X 1E1FA 3K1GA 3OZPA 1AQHA 1SUXA 5H8UA 4BJHA 4AZIA 2D3LA 4B9YA 2QAPA 3QR3A 3GNRA 1ME9A 4RNFA 3SAZA 5FJRA 1ZP4A 1XM3A 5BOEA 4KERA 2HROA 4DBWA 1FWRA 1DWAM 4XAZA 3MKCA 1XLBA 1X1OA 1M7JA 4HB7A 3V35A 3W7IA 3AOFA 3QN3A 2G41A 3QQ1A 2AAAA 1O66A 4DZHA 1SMAA 1E4MM 3MKVA 4UTWC 4JL2A 3PBGA 4WY0F 5CC3A 1MMFA 3BQ5A 3OB8A 3RM9A 3GLCA 4NJJA 4K37A 1CLVA 1BSIA 1NARA 4GABA 4HN4A 4V28A 3RMJA 3GYEA 3WBWA 1Z9AA 2D24A 4S3FA 1FDYA 3OGVA 3UJFA 3G1SA 1IWAA 3OW1A 1ONRA 3PPGA 4MYXA 5ABFA 2ZVIA 4REQA 5DBTA 2ONEA 3FA5A 1VJSA 2JF6A 4QS6A 4R27A 1IT0A 3EB3A 4PZVA 1GPFA 2QT3A 4GMEA 4A2SA 3UXDA 4W7UA 3S5YA 1M41A 2X30A 1ZBWA 1ONWA 2PGFA 2WSYA 4XTIA 3IGSA 4I5RA 4OVXA 5DCDA 2FTWA 4HZMA 1JZ4A 4F4RA 3VKDA 4LUTA 3UEQA 1TKKA 2J8FA 4GXWA 2PLJA 3UWUA 3O6DA 3NSNA 3RG6A 2X2YA 4AEEA 3VIGA 4GO9A 3VNYA 4AVNA 4UMCA 1OC7A 4JTQA 2Q02A 4K8GA 1AJZA 1EGZA 3E0IA 4RJEA 2QMKA 1KBIA 1EDQA 1I2RA 3OZYA 1QT1A 5FJJA 2HXUA 1VHCA 3TSDA 2CHRA 3VNZA 4O13A 3ABQA 4JY9A 4C6LA 3TYEA 2ZTKA 5HR7A 4J9JA 4BQ5A 1EWDA 3DHUA 2VWSA 1NQ6A 2WW5A 4TIMA 1V08A 5BXPA 3B0XA 2PDJA 2NXGA 1KR0A 1UJPA 4HCHA 3DESA 3NQFA 3CMFA 1J11A 4KEMA 4LNYA 2VOTA 1C29A 1L8NA 2Y8UA 2X2GA 3VNLA 4Q4QA 4E2OA 5CEWA 4XZNX 4ASTA 1BQGA 1W9BM 3TVAA 2XVLA 2VKZG 3B8SA 4QLLA 1E55A 4C6FA 2FB3A 1UMYA 4WY0A 4UCFA 1KFCA 2E6YA 4UTHA 2DT0A 5GNYA 3L4TA 1AW1A 1OF8A 2X1TA 4MVAA 4Z42C 2WVTA 5HWJA 4NU7A 2ZRYA 1MUMA 4RL3A 1I60A 1HG3A 1FHDA 2W3ZA 4JIIX 3A4XA 4DYJA 3A13A 3SGUA 4IPIA 3K4DA 3TOPA 1POJA 4LC6A 3WD2A 4CNOA 3S8HA 1XIIA 5D37A 2VJXA 4QJ1A 2QKFA 3EDDA 3F2CA 3S83A 4PGLA 2WNNA 4JFSA 1Y0EA 4F2UA 4J35A 3F2DA 2PWHA 3TP4A 1EO7A 1GVEA 3R0UA 1EX5A 4FXRA 4N9CA 2H90A 3RYSA 1E4IA 2OXNA 4ZTXA 5A2BA 2Z7GA 1OINA 5KZDA 4RPQA 4KEZA 4PMZA 3W2JA 2J7GA 1MW0A 4C6KA 4UMBA 1BHGA 1HW6A 3AMCA 2VXNA 5G2HA 3UXKA 4QEHA 2UY2A 3GTIA 4PUUA 2V5BA 3ZLHA 1S5VA 3EWCA 3A22A 4A3QA 2EGZA 1FWSA 4M7SA 1GT8A 4JQAA 4TVDA 3CO8A 3SCNA 2UY3A 4WKFA 2GGHA 3EB2A 5EY5A 3O63A 2I9EA 3LY0A 1PBGA 3T0CA 5C7VA 4GXMA 2YSWA 5SWUA 1EGVA 4C7FA 4DBEA 3KLKA 4IJCA 4EX4A 3N3MA 3OVRA 4ZCWA 1HT6A 5FEZA 2VX7A 4IH3A 2PDPA 3TA9A 1XLGA 1L6GA 2DSZA 3LEPA 1US0A 2TODA 1FWAC 2YB4A 1JNEA 5CAHA 1SJAA 2WBKA 3CHCA 4OKDA 2VO5A 4AD2A 3MU7A 3QW3A 4JL1A 1GQLA 1AW5A 4KRZA 4IQJA 3ZYZA 1K3UA 3CZLA 3OO2A 2PDQA 4DUXA 4GJJA 3M0YA 2GSJA 3GNOA 4NX5A 3MP4A 4ZE5A 3LX9A 5AHFA 3AHYA 5CKSA 4AQLA 3PTQA 3U48A 4S38A 1W9PA 3QV6A 1QO5A 4B5UA 4OHQA 4Q32A 2ZDSA 2KAUC 2QCCA 2XN1A 4O17A 1HJUA 4YTQA 3CXOA 3OBEA 3SJ3A 2FHCA 3EPMA 1YNQA 5E0FA 2HDJA 4Q4OA 3EBVA 2C8NA 1EIXA 4OBSA 4QE1A 3EWZA 1VPXA 3PZIA 4AHOA 3F7JA 1R87A 5IBXA 1AODA 3VD7A 1HIZA 3LBCA 1KBLA 3AXMA 1F05A 3EWYA 5AVHA 2V38A 3LM7A 5FSEC 3BK0A 2AGTA 3QOMA 4L9YA 1BVWA 3WLTA 2DQWA 4LYRA 4YS1A 5CGQA 1DV7A 3VIPA 4R53A 3VE7A 3UJSA 2VFHA 2YCLA 3VOHA 2NT0A 2WVVB 5EMLA 3DFOA 1R30A 4L4PA 4NI8A 4V15A 1PL9A 3VVGA 3H8AA 4XWUA 3GQYA 4XQ6A 3G1FA 2QUNA 3I68A 4O52A 2ALDA 3VO0A 4DYEA 3RR1A 1R9YA 3SSZA 1JJKA 3HZ3A 3HA1A 1BTCA 2TAAA 1OZMA 4JTAA 1YE6A 4N9DA 1S39A 1V3HA 1LLOA 2IPJA 2VELA 4IP5A 2WOQA 4TU1A 3FW6A 5HMEA 5HMSA 2VWTA 4EF8A 2QV5A 5DELA 3WYZA 5IHSA 2G0WA 1AJ2A 4IG2A 4MB1A 2R1PA 3W87A 1DYSA 4FXJA 2IMRA 3UXAA 1H63A 2OX4A 1UQZA 5D9MA 4C90A 4K7VA 3EA1A 3UT0A 4L80A 3CMJA 4IGMA 1R7OA 3PUOA 4TQTA 4QROA 1XDJA 4JR5A 3L4WA 1WV2A 1VYSX 5MF5A 1XL9A 2FLIA 5CG7A 3SN0A 2FDMA 3OHMB 1XIHA 3K2GA 4RDVA 5IOBA 1FBAA 1Q13A 4PCFA 1WYIA 1W9VA 1B9BA 4FALA 3SY1A 3LHVA 4HD5A 4H6RA 3I3EA 3E2SA 3W3OA 4LV9A 4ZSTA 4H8UA 5E1QA 3WN6A 4X3ZA 4MGGA 1KRAC 4XUYA 4NXSA 1OD0A 5A6AA 3A4JA 3UY7A 1M9HA 2PRLA 2E5CA 3NO5A 4W7VA 4GGBA 2PE4A 4WSJA 4EAYA 4O28A 3RAOA 1KO0A 3CL7A 3FJNA 3S1WA 5J5DA 2JQXA 4MJMA 4HA1A 3GXIA 1EIBA 3NOYA 1UWRA 1WA3A 3SN1A 2AL2B 2Y24A 1SW7A 5I3FA 3LMZA 2OEJA 2YGYA 1FRBA 4F48A 2CLIA 2W0UA 1B1YA 1ECQA 2HNEA 3NL3A 4FIQA 3HG4A 4TV5A 1UA7A 3EPNA 1WX0A 2G3MA 2O4QA 1UBSA 5HATA 1YHTA 1IYXA 3P67A 3WK0A 2OOGA 4A8NA 3Q94A 4DNHA 4IUGA 2Y85A 4FXFA 1C8QA 3WLSA 1PS9A 5AECA 3B4UA 2XSBA 2ACRA 1KFKA 3MUCA 4LAZA 5HR6A 3QBUA 3VX0A 2DH2A 4ML4A 2TRSA 2WNWA 3RK8A 3T07A 3VMOA 1O1ZA 4QTGA 1BG9A 2ZKMX 3GSMA 3RPDA 4MZ8A 4C6DA 2Z00A 3IGXA 3GIPA 1EP1A 1UKOA 3KWSA 3HG3A 3NWRA 4C91A 2XG9A 3V0SA 1HJWA 1W31A 1VJZA 3GDRA 2MANA 1KM1A 3ITCA 3AXIA 2P0IA 5A3HA 4FB7A 2BY1A 4FEZA 4L1GA 2I16A 1K9EA 4MAVA 1Y8BA 4XBSA 3WDQA 2ZC8A 3NQ2A 4TO8A 1OCNA 4AY1A 1TPEA 4UQDA 4J3UA 3W7DA 3NGJA 3LCXA 1TJ0A 3TCEA 1TV3A 4D6EA 3OU8A 1HP4A 1Y5XA 4QIUA 4LCQA 1O6IA 2A6NA 2FZBA 3DH7A 2XVNA 4HYRA 4AD0A 4Z2HA 5LNRA 1X6LA 3B40A 1BXCA 3IGUA 2HZGA 5CG0A 3OG3A 2PFHA 4WCJA 3ZO9A 1BPLB 3TFXA 4NI3A 1OGSA 1C92A 4F3HA 2VCAA 1XBZA 2VRJA 3AMLA 3UU0A 1Q4NX 4MNLA 2YCEA 2ZUMA 4I5XA 4O1DA 4JTRA 1F5ZA 2DZXA 4UTWA 3S9IA 5F4XA 1THFD 3THCA 4XO7A 5REQB 2PDLA 1S5NA 3L23A 3SUSA 3I3DA 4MB5A 1JNDA 3SQMA 1EJUC 2P3EA 4U2YA 3WQVA 5C2XA 3GDBA 2Z0IA 3DKLA 4NILA 1R85A 2X16A 1HFBA 3HPFA 4ACZA 4DQWA 1LRNA 2WCSA 5JVLA 4CD5A 1M65A 3W2LA 4C6OA 4CQBA 3EX6A 4UQ9A 5FD0A 4NZ5A 4WUIA 1J2WA 3BH4A 4KGJA 3H4WA 3TQKA 5IFTA 2BZNA 3RGTA 1OWQA 4I8DA 3EOEA 7A3HA 4GG9A 4EWJA 2D2OA 1TR1A 3NO1A 3MKKA 4O18A 1JZ7A 1P6BA 4US5A 1B3WA 1R0MA 1WXJA 4P7NA 1NSJA 1OVDA 4PMNA 3B8WA 1GYLA 2EKCA 1H41A 1XIBA 4DJEA 4CNUA 2VHLA 5I07A 1SGJA 2A4AA 3GTNA 4PTDA 4UTMA 3FKRA 1XFBA 1XFCA 4XZWA 3E0WA 1MEWA 2WV8A 4LRTA 1Q4WA 1A47A 5A6LA 3CUFA 1U5JA 4MOZA 2ZZ4A 3GTHA 3TTQA 6ENLA 3QF0A 2QYGA 3M0MA 4G1KA 2WNZA 3KBNA 1ZBKA 1DXFA 2XZ7A 3SADA 1QPNA 4CD4A 3CNYA 1IE7C 4AMCA 4YTTA 4GJ1A 3N4FA 1IV8A 2RFGA 1ENUA 3VMPA 3QY6A 2WKJA 2XIIA 2O9RA 1CGTA 3UETA 1X39A 2OJPA 3H12A 1V02A 1OGGA 1TIMA 4EPBC 3LXAA 1DEDA 1JUEA 4MWAA 4LWWA 4ZOAA 2E28A 3AAMA 1A50A 1PIGA 3G1YA 3PC0A 4PMXA 4U3AA 1ITQA 4RNIA 4FR6A 4IIGA 1PVNA 2OLSA 1GW9A 5E09A 4V2XA 3UR2A 2I14A 4YVVA 1J6OA 3IJ7A 4XD3A 4W84A 3UPMA 4NUWA 4QG8A 4ERGA 3WLPA 5T9CE 5C5YA 5T8GA 2BB0A 2DSVA 2Y61A 3G3MA 2YKKA 5EB8A 2XJ7A 2CZDA 1NVMA 4Z0SA 5K9XA 1ICPA 1EJRC 1PYFA 2FIQA 3APTA 8XIMA 4F0KA 3VIOA 4MJ2A 4OOUA 1E3XA 1GQNA 3C2OA 2A0NA 2PLCA 3STCA 3V1PA 3LTSA 4GBUA 4IOTA 5FJUA 4MYAA 3M47A 3CJPA 4ATDA 1ALDA 3R6IA 2DH3A 4LYPA 4O50A 3WH8A 3FA3A 4EPKA 3LHYA 2EKGA 2E8YA