3U0HA

The structure of a xylose isomerase domain protein from alicyclobacillus acidocaldarius subsp. acidocaldarius.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
279
structure length
279
Chain Sequence
b'AMEPCLHPTLVDETSLVLYLDLARETGYRYVDVPFHWLEAEAERHGDAAVEAMFQRRGLVLANLGLPLNLYDSEPVFLRELSLLPDRARLCARLGARSVTAFLWPSMDEEPVRYISQLARRIRQVAVELLPLGMRVGLEYVGPHHLRHRRYPFVQSLADLKTFWEAIGAPNVGALVDSYHWYTAGEHEDDLAQLPPEKVVYVHINDTRDAPEDAHDGKRLLPGDGRIPLVPFLRGLYLAGYRGPVAAEVLHETPLDGTGESRARLVRERLEKLIALAKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylose isomerase domain protein
molecule tags Isomerase
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
publication title The Structure of a Xylose Isomerase domain protein from Alicyclobacillus acidocaldarius subsp. acidocaldarius.
rcsb
total genus 104
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3u0hA00
3BANA 1XIIA 4X61A 3VYLA 1XICA 4EAYA 4QDWA 3UA4A 3CQHA 1DE5A 3ITTA 2GLKA 1OADA 2XISA 4DVOA 4XSMA 3CQIA 1XLLA 2NQHA 3ITOA 3UU0A 4A8NA 3M0XA 4ZB5A 4G56A 3KBJA 3ITLA 1XLDA 3CWHA 1DIEA 1O1HA 3TVAA 1S5NA 9XIMA 1XP3A 3NGFA 2GUBA 5I7GA 1XYCA 3VNKA 2QUNA 3BZGA 5TNVA 1BXCA 1QT1A 2ZVRA 1XIBA 3JU2A 3KBWA 5H6HA 4A8LA 2X7VA 2GYIA 1XIHA 1XLKA 1A0DA 3P6LA 2XIMA 5EMKA 4KW2A 3OBEA 3QXBA 3TC3A 5AVHA 4YTTA 2HK1A 3KBMA 9XIAA 3CQJA 3L23A 4XIAA 3VNLA 4GQBA 3BZJA 3IUIA 4QE5A 1XLCA 4YTSA 1XYLA 1XIEA 3WQOA 1MNZA 4HHLA 3GNXA 3KBSA 3KCLA 1XYAA 4OVXA 4QE4A 3ITXA 1A0CA 2OU4A 5XIAA 4W4QA 3XISA 1DXIA 4K3ZA 5B7ZA 1BXBA 3QYSA 5H1WA 3U0HA 1D8WA 3IUDA 4PGLA 1XIMA 8XIMA 2Q02A 5AVNA 3IUHA 2ZDSA 3ITYA 4X63A 1XYMA 1YX1A 4QE1A 1XLGA 1DIDA 2QULA 2NQJA 2QW5A 1XIDA 3KBVA 3QC0A 5EMMA 2I56A 2HCVA 3KCJA 3N4AA 4YTUA 3UVAA 4K1GA 2I57A 4YTQA 3BWWA 7XIMA 2J6VA 2XINA 5EMLA 3DX5A 4A8IA 5B7YA 1XLBA 2X7WA 3C0SA 3M0HA 3AYTA 5J8LA 3BDKA 1XISA 4PFHA 1XLIA 3VNMA 4XSLA 4J4KA 2QUMA 4LNCA 1XLEA 4E3VA 1GW9A 1XLMA 1XYBA 3ITVA 3M0VA 1XINA 1XIJA 2GVEA 3AYVA 4HNOA 4ZB2A 3U3HA 3UA3A 4US6A 4QEEA 4HHMA 5XINA 5EMJA 5B80A 1QTWA 6XIAA 2G4JA 4QDPA 3KWSA 3LMZA 1XLJA 3CNYA 4XIMA 3KTCA 4HGXA 4X60A 1I60A 1A0EA 4GJJA 1XLHA 4XKMA 3VNIA 5FA5A 6XIMA 2HK0A 2NQ9A 5C9ZA 3UXIA 4GLEA 3M0MA 1XIGA 1DE6A 4XISA 3AALA 4QEHA 4A8RA 1S5MA 5XIMA 4Q7IA 1XIFA 3XIMA 3C0QA 1XLFA 3QZAA 3M0LA 3AAMA 3KBNA 4GJIA 1XLAA 4YTRA 1TZ9A 1CLKA 2G0WA 8XIAA 1K77A 3M0YA 3KCOA 3P14A 4DUOA 1I6NA 3C0LA 3FVMA 4EACA 4ZBCA 4ZB0A 3XINA 3CQKA 1QUMA 3VNJA 3DBNA 1MUWA
chains in the Genus database with same CATH superfamily
1IXQA 3RMEA 4JTLA 1UJPA 1DOSA 3GE7A 4X22A 4HNVA 4QSFA 3TQVA 3H55A 1TJ2A 2H8ZA 4GH1A 3HQOA 3WF2A 2ZUNA 4MWAB 4OQVA 2CCRA 4A2SA 2OSWA 2YIHA 4ZMGA 3GY1A 1VS1A 4TTUA 1NFPA 2R8WA 3OVPA 1SR9A 2O4QA 3H54A 4TV6A 4GQ0A 1JEZA 4O54A 1TJ1A 3WYZA 1WKFA 3LTYA 1ZAIA 5M2FX 1EX5A 2Q6ZA 4QCFA 1YBQB 4ROPA 4V2XA 4B5WA 3NXLA 3CEPA 4YTUA 3W7MA 4YU1A 5CAKA 1J10A 3WBXA 1XGEA 4QP0A 2WWDA 2DJXA 1GVSA 4IF2A 4UIOA 5CCZA 1F07A 2BXZA 1GOMA 1XDLA 1EGZA 4Y9AA 3L66A 3CASA 4M5PA 1E43A 3KZPA 2X40A 1FFRA 5I0DA 1OD0A 4K8GA 3N15A 5M3WA 3M0YA 3VMPA 3RCYA 2CHOA 2E25A 1JDEA 3WFLA 5C9UA 4LBUA 1GQNA 2QJNA 2WSYA 4EAYA 3RRAA 4DB7A 1Z89A 4OBRA 1E0WA 1YLVA 1KLYA 3JW7A 3GR8A 1D9EA 3P67A 3UW6A 4Q8UA 2RHGA 3DFNA 2ZICA 5I7GA 3RPMA 1KM4A 4JY8A 5TNVA 4QAIA 3NGJA 2XUCA 4CNUA 2IXUA 4KCVA 2XN0A 4MJ4A 2E6AA 1E56A 3PSVA 2ZUUA 3E0IA 2FPTA 1Q7QA 4ORIA 1QNQA 3IVUA 1NARA 5DBTA 3VPLA 3U0HA 4AY7A 4KFPA 1K70A 4LV9A 5H8UA 4OV4A 5D32A 2Y5SA 2DIJA 4LS2A 2NW0A 3UG8A 3A24A 3SBFA 2Z1BA 2OGJA 3RR4A 3ES7A 4A3RA 3N2BA 2SFPA 2YCEA 4CQBA 3IJ6A 4F0HA 1SFJA 2PSNA 2YSWA 3PJTA 1W0MA 3GR4A 3BL3A 3UJEA 3WH7A 5LA0A 4QISA 3URQA 1VBJA 4AZBA 4DM1A 4MZYA 3PZNA 1A5MC 2H90A 3W7PA 1J11A 2PWUA 2R9RA 5BRPA 3HIJA 4EVZA 3OU8A 2WNZA 1SZGA 4R5EA 2A5HA 2L5HA 4DWSD 4K7YA 3SRHA 3C3UA 4JX4A 1RVKA 2PWHA 1M7PA 3AXHA 5ECVA 3BSHA 3M9YA 4KIRA 5AN7A 1EBHA 4GBDA 3R0KA 1V0KA 4RE3A 5FSDC 2NUXA 1LUCA 2DVUA 2X1IA 5MKGB 5E6YA 4CCCA 1FHLA 2WKLA 4UTJA 1R2TA 3QLLA 1G01A 2BODX 4DF2A 1VJIA 1TWWA 2WLYA 1E72M 1SMAA 1C8QA 4PRRA 1Z69A 4KFOA 4HNTA 2R94A 3UETA 1D2KA 2WPGA 4ZQMA 2IQDA 2A3EA 4B15A 1TO3A 1KBBA 1YW1A 5MF5A 3NURA 1PZ3A 2ZX5A 3NEHA 3MZNA 3N4AA 1J6OA 5REQB 2XINA 1UD3A 1LBFA 1EFZA 3S3GA 3E5PA 3CUHA 1RLCL 2FTWA 2X0YA 3T7VA 3ITVA 4C6BA 3UZWA 1EB3A 4DN1A 2TYSA 3TCSA 3VIJA 2EJ1A 5LNSA 3RYSA 2WW5A 2E8ZA 1K1DA 1NOFA 4XUGA 4URIA 3SUVA 1VEPA 1MZRA 3TW6A 2BOGX 3K30A 2X1UA 4B90A 1K9FA 4KKXA 1BVNP 2DT3A 3WLLA 1EGVA 4FLSA 2E5CA 3XINA 5DO8A 1EUAA 1ESWA 4R27A 4S3EA 1YTEA 5KZMA 4NNAA 2KAUC 4MF4A 3LENA 5AB3A 5TF0A 2CETA 2VELA 4IGMA 3HJEA 4MAVA 4GNJA 4S1FA 3DN5A 3QMTA 1VENA 3O05A 4H9ZA 5FI8A 2PWVA 1V6VA 4GQBA 4LC6A 1OD8A 5I00A 2E0PA 3E2VA 3WLTA 1T6MA 3KRSA 4FLOA 5AC6A 1A5LC 1UG6A 4BWLA 4J2MA 2OOGA 3VKDA 1UKTA 3CH9A 3SY1A 1AH4A 1MEWA 4LEFA 4AMAA 2C1HA 3D5HA 2EPNA 1EF2A 2DIKA 2ISVA 3AS3A 4XSLA 3SFWA 3N9SA 3QM3A 1PBGA 4X9SA 2O9PA 1FWGC 4NYUA 4K68A 2XVPA 3GVRA 2YGYA 1GZGA 3K8KA 3KOZA 4PUKA 4KRZA 3CZLA 3WBWA 3WUBA 4D8LA 2XIJA 5LNVA 4A8RA 5DCEA 3W6YA 4EWND 4JTIA 4CGTA 4DUOA 3VUSA 2ZRVA 2HVOA 4C91A 4ZB0A 1KM6A 3ZIZA 2AMXA 2QDDA 4KWSA 3UA4A 2CLEA 5AC7A 5HMFA 4XBKA 2F2KA 2VOTA 2WB5A 1TPEA 3L4XA 4ZVJA 3PBVA 1SMDA 2OVLA 1GPWA 4IT1A 3NM3A 2XSAA 4XZLX 1V6YA 3UT0A 4IQEA 1AG1O 3FX4A 3TQKA 1JZ5A 3EXRA 3PAJA 4A22A 4UUIA 1HL2A 3WDHA 1QJWA 3YPIA 4WJXA 3WDRA 2XVGA 2A3HA 1XIDA 3GNNA 1UWRA 4MWAC 4Q4KA 3W2NA 3W75A 3H26A 4M1BA 2ZX9A 4ATLA 3TONA 4RK8A 4AQLA 4LALA 2QCFA 5LXEA 1OSEA 3OIXA 4HK7A 4WKHA 4J4KA 5C2XA 4C7DA 3IVTA 3QPZA 2VVSA 4UTIA 1KTBA 1W32A 3FNDA 5D4YA 3L21A 4XAGA 1DP0A 4BFAA 3PWIA 3UPMA 3HG3A 3H2EA 5A8MA 3EWWA 3LGEA 1DJNA 2XZ9A 3GHTA 3MKKA 4I5UA 1F8MA 1Q45A 3EAUA 1JZ2A 3B8DA 1QRQA 2J25A 2AAMA 3GXIA 1PS9A 1U33A 2QT3A 1FCVA 5HINA 3ZR6A 3P7YA 4MWAD 2P3EA 4X61A 3QF0A 2DSWA 4O1EA 3MV01 5REQA 4BQ4A 3OQ8A 3ARZA 7REQA 2ZA3A 3EKLA 3PULA 3W7EA 1CCWB 4XO7A 4L9YA 1MW3A 4A3QA 3BLIA 1DWHM 1V3MA 3SCOA 2RGLA 1YNPA 1DJIA 2PWEA 3ABOA 4IPJA 4DWSA 1E73M 3WNMA 2IKHA 4WK9A 4WQ6A 4A4AA 3F2BA 2POZA 3H8AA 4RV8A 3XISA 4NJKA 4XBSA 2RDWA 4NRRA 2V5JA 3OG3A 2VZOA 4RE0A 2UY3A 5HOSA 2CERA 3B03A 2J6VA 3GH4A 4XAPA 4FLRA 1JZ7A 3B9NA 4LS0A 1XPGA 4XAYA 4KBXA 5CJMA 2ZTJA 3RX2A 1IGWA 2OYMA 3CV7A 3K1GA 2H9AA 3WKZA 4H1ZA 3LCFA 2QUTA 1KGXA 1LL4A 1XBXA 1LYXA 1RAKA 3QYQA 4PEEA 3UWUA 4NSBA 1TVPA 5AYIA 5FL1A 2ZXBA 2Z6IA 4H04A 1TTQA 1XQLA 5D8WA 5FEZA 1DPMA 4GIEA 1K8XA 4M56A 1PJ9A 3TYAA 1FWNA 3NYZA 1MFVA 2JFEX 2VKZG 2VRJA 4C6KA 3KWXA 2YCKX 4EAMA 1LG1A 5BXSA 1TTJA 2YL8A 4AD0A 2OLHA 4N4PA 4LVDA 3M0JA 3ANVA 3A9BA 4WKFA 4ONVA 3K46A 4FEZA 2XHYA 3TSMA 4NZ4A 4X0VA 1J6PA 4J3TA 3LTSA 1FX6A 5CPMA 1GOKA 3GFYA 1S5NA 3G1SA 5HWJA 2ZXAA 3V1PA 3EKZA 4M51A 1QU4A 5HBFA 4ML4A 1QPQA 4HA4A 7CGTA 2ZXQA 3TIMA 4PL1A 3ICJA 2ZCGA 3KVKA 3L12A 2W6RA 4IGHA 1E6ZA 3BAWA 1VCFA 4IMEA 2QMKA 3PTMA 1W5QA 3PUGA 3L5MA 1DJYA 4UTUA 4OKDA 3MS8A 2XFYA 3G0UA 4XD4A 3G1FA 1CECA 1I4NA 4WSHA 1JNEA 3RX3A 3FCPA 4PTVA 1ZCOA 2QNEA 4O50A 4WSJA 1B54A 1XBVA 3LMZA 3AI0A 3KVJA 1TWZA 3ZLHA 1OY0A 2V3GA 1K3UA 1ENUA 1ZL1A 5DELA 1XCFA 1OFEA 3TXZA 4AFYA 3QZ6A 1RHCA 2X0HA 3PM6A 2J62A 3NO1A 2XVKA 4IHCA 1KTCA 3NL6A 1AZ1A 4J3VA 3THDA 3N2MA 4YHGA 1HJQA 3EMZA 5FJPA 2CITA 3V75A 3P81A 4AX7A 4O10A 3AMDA 3WDIA 4JTEA 4JDYA 3CZ8A 2GWNA 1V7YA 2GUBA 3VDCA 4DY1A 4ICNA 4GUGA 3DKLA 4S3AA 3LYEA 1NP2A 3GTNA 3EOOA 2ATMA 1BLIA 3AOFA 1W1TA 3IJQA 4XWUA 3IIVA 2O7SA 3W25A 7REQB 3GK0A 1UA7A 3EX3A 3MDWA 4AZHA 4NILA 3BV4A 3EXTA 4GUFA 4AYSA 3S6TA 3DFPA 3W7GA 1G5AA 6REQA 2BFGA 1V93A 3SSJA 3DFOA 1VC4A 3PY2A 2VJXA 5LGXA 1KKOA 5LIUX 3O0KA 3RG6A 1XYMA 3D47A 2YDRA 2WMJA 4KMQA 1CDGA 1JYNA 3R89A 4JR5A 2EPOA 3T55A 3ENLA 3LCLA 5J8LA 4ZQPA 2G4FA 1M6JA 4AYGA 1DEDA 1TB3A 1AJ2A 2A7PA 3NUKA 1TWSA 3B3DA 1YPFA 4KIEA 1PWMA 1S46A 2IPJA 4OGZA 3F4DA 1M9HA 3DG6A 3LQLA 4DZAA 1AQ0A 1DTUA 4Z1BA 4H4IA 4ADTA 3RUBL 3GX9A 3EPOA 3Q4DA 3G1DA 3DDMA 1AW1A 1WZLA 4FPSA 1OT2A 1EF3A 2FLIA 3TE9A 3AIRA 5FF2A 2QUVA 3RM8A 1VPYA 2CKSA 5AYBA 2BVYA 5HJLA 4N0RA 3KRZA 4DVOA 2BZNA 1IWPA 4MUZA 3A12A 1W37A 4U2ZA 4ORMA 3PPGA 1LWIA 1NP0A 3N4FA 2POTA 4H9VA 3APGA 2OKOA 4U3CA 1XIBA 1P1MA 1J12A 2J4GA 4TMCA 2B0MA 4N4QA 3WEZA 1KGUA 1ZGDA 3UGVA 1X1NA 4JTFA 1EP2A 4RCXA 5HJYA 3CHDA 1QHOA 4AY8A 2CWXA 1YTKA 4H7ZA 1B4EA 2G95A 1RCXB 4MG4A 4IXXA 1C3FA 4GZJA 1O66A 1PEZA 3AZTA 4C6IA 1Q3NA 1QR7A 4UTWA 2NX1A 3ABZA 3DFSA 4BEUA 1V3KA 4KF1A 1L6YA 1ME8A 4MNLA 2PEVA 1JCLA 3JRKA 4UR8A 3CAWA 1OGBA 3GB6A 1WDPA 4QAWA 2CZFA 4JFVA 1G1YA 1KLZA 4N2YA 3EX4A 3EWCA 4ATWA 3NPUA 6XIMA 3AHTA 3THQA 1E4MM 1YEYA 4CD8A 3STEA 3IAQA 1LJYA 4DJDA 1G0CA 3VIFA 4DEFA 1GYLA 3WO8A 8XIAA 4MFDA 1RZMA 2Z2AA 1TWDA 3VD7A 3WQFA 2BHZA 4FK9A 2NZLA 4H83A 4AC1X 1PHWA 3SUWA 3BTNA 5KSWA 2QV5A 2AMGA 3VYLA 4BWLC 4XTIA 3DBPA 1E4IA 2DZSA 4GBUA 4YHEA 3SGUA 4S3BA 1WKDA 3MP4A 3WQCA 2YKKA 4H19A 2QPXA 1K4GA 3T44A 1RXOB 3O15A 3TXVA 1QI0A 1Z3NA 3KRBA 1YPXA 2XGBA 6TIMA 2QDHA 2OWWA 4IMCA 1TQXA 4LVBA 4MADA 2PTZA 3B8UA 3SDOA 2BMBA 1OGGA 3CXOA 5EU9A 4FXJA 1DL3A 4PRTA 3GO2A 4D1IA 1QNRA 1WUFA 3I4EA 3OLEA 2P0OA 1Y5WA 4AVOA 5K2ZA 2GGEA 2QEZA 2FZDA 2ON3A 4YTQA 4MJZA 2VGIA 2ZZ6A 1OX5A 4DO5A 1H11A 2GVJA 3GU2A 1PWLA 1EX1A 4AF0A 5BRBA 1UR0A 3O07A 3H21A 3V5CA 1JZ6A 2FPVA 1OGSA 5AHIA 1NM9A 2BSLA 2DW6A 2I5IA 2ZBTA 3AUOA 2D1ZA 3L65A 2ZZ4A 2R82A 2OT1A 4E2DA 2BP1A 1FQ0A 3PBGA 1ISXA 3P3BA 1TYGA 2D0FA 1BGGA 2EG6A 3OBKA 1QPNA 1H1ZA 3H2CA 4Q8VA 4IICA 1FY6A 4MIMA 4REQA 3NPWA 3UJSA 2TRSA 3G8RA 5G5IA 2JGYA 2YA1A 4KQNA 2FB2A 3T42A 4AY1A 4DJEC 3VZZA 2FZ9A 4TVCA 2WM0A 1CGTA 1OFDA 3CUIA 1TX0A 2X1RA 1YE6A 2XFFA 4QFUA 3QTPA 4AG0A 2NSOA 1XG3A 3DHUA 1BYBA 5AVNA 1CGXA 2REQA 1BWLA 1XUZA 1X6LA 3VKCA 3U5UA 2AQVA 3NZGA 5HPCA 1TMHA 3P61A 2X7WA 4C5ZA 4JYDA 4S2CA 2E7FA 4JIPA 1XCXA 3EDKA 3TOYA 3AU6A 1V0MA 1J93A 4AD4A 2C71A 4IJRA 3TYDA 3OEXA 3UG5A 2OWXA 3CHVA 3SIZA 2QJJA 3HFYA 1BF6A 5EBAA 4ZO9A 1SUXA 3EEGA 1NVMA 2PDHA 1NELA 1B3WA 5I2UA 4C6OA 2V5CA 4YWSA 4XBJA 1WX0A 3T6CA 2DT2A 3WLHA 4GPNA 3TAKA 4Z2LA 2D0HA 1G69A 1XHGA 1KBKA 1H51A 4HNUA 1XYZA 2AKMA 1HVQA 3E02A 3R1ZA 2WHJA 3SCSA 1N8FA 4JQ2A 4DM2A 1G4SA 4A05A 1LQ2A 1EC8A 2DT1A 4AZ7A 3VA8A 2FTPA 4Z2KA 4CNSA 2G96A 3DZ1A 1Y65A 4PL2A 1JRBA 4YTTA 5DXXA 4HP5A 4RDZA 1Y5XA 1B90A 3BJTA 3A9IA 1HTIA 1H3GA 4IP4A 3GNPA 4IX2A 2Q8XA 3OQEA 4JFWA 3DHPA 3D3FA 1FWEC 3BOXA 5I3GA 3T08A 3WK1A 4G9PA 4GYFA 3BWWA 3NPVA 3CV2A 3G18A 4GUIA 1PSCA 1EIXA 3L4UA 5CZKA 2GPTA 1TX2A 4QG8A 1LBMA 1FWJC 3SM0A 1O68A 4Y9OA 5E70A 5T91A 5LA1A 5A6TC 2PDXA 5CJ5A 4PTNA 4S39A 1RY0A 4LEQA 2V82A 2WJZA 3UY7A 3SUSA 3SURA 2W79A 3SCWA 1MEIA 5I3JA 3FAWA 5FKYA 1Y0EA 5LIXX 4IXHA 3W85A 2WZIA 4XB3A 4D6CA 1K77A 1EA0A 1TV3A 4IIBA 2PTDA 1FWFC 2VDIA 3V18A 3TU9A 2W63A 3WF0A 4PB5A 5JXQA 2HS8A 2R1MA 1ECEA 5EB8A 3DC8A 1GOIA 3IJDA 3KP1A 3O06A 2XM1A 4QTGA 4ML9A 1QBBA 1M7OA 2PZNA 2YFOA 1VF8A 2VYOA 3GIPA 4GY7A 3W1QA 3KFTA 5CQ1A 4NAFB 3ALGA 4PUMA 3GBEA 4NJJA 3WF1A 3WNNA 1QW8A 4TO8A 2QR6A 1CXFA 4AD3A 4GK8A 3QKEA 3ISIX 3L2MA 1CGUA 1J96A 1HL8A 1W9VA 4Y9MA 3OVGA 5T9BG 2ZX6A 3QH2A 1U83A 1Y8BA 1QWKA 3PPCA 2G3JA 3MWCA 2BY2A 1R6WA 3DFTA 1WB0A 1BHGA 1PB0A 3DGBA 4YJ5A 1H5VA 4HBKA 1WBJA 1SM9A 4Y6GA 2HBXA 3W2UA 2RFGA 2PA6A 1J2WA 4GVHA 2YL9A 1VFSA 4LCSA 4WR3A 5E93A 4MMWA 5IDIA 2WHLA 2PBOA 1ZBCA 3OG2A 1DHKA 3W1LA 4CQCA 2J13A 2CZVA 4GXPA 4IFKB 3WDPP 1UR4A 2OZTA 3SSZA 3MKCA 1R2SA 3AXKA 1M7JA 4IG2A 3PTDA 4F0SA 3U9IA 2OYLA 3DI1A 1ZRQA 1IXNA 3TLLA 3BG5A 2V30A 2DSZA 2X2YA 3TN3A 4NAEB 1BYCA 5LYRA 5CBIA 5EFDA 3KBSA 2R1NA 3C2FA 1ZENA 4E4FA 4FMVA 2ZDSA 3ITYA 1EP3A 1KA9F 1HKMA 4I7VA 3CIVA 4XX6A 4K38A 3HB9A 1PKYA 2A3BA 2C1IA 4C6PA 4FR1A 4C6DA 2PDGA 3VI2A 3VNYA 1UP0A 3ZYZA 3EMCA 3KAOA 3MY9A 1NEYA 1FVPA 4HTBA 3EDJA 1Q65A 4LVFA 1CZ1A 1S2AA 1F4AA 5CPNA 2JGQA 2J7FA 4DYEA 4ZO7A 4W8LA 1GUVA 2PDIA 4RNHA 3W1TA 1H4PA 1W9PA 3M6YA 4L9XA 4HN4A 2E40A 1UP2A 2HE8A 2OYKA 3MO7A 1JR1A 3P14A 4MJMA 4O18A 4ZQNA 2DP3A 1O94A 1EKOA 3CQKA 3O2LA 3DBNA 3TTYA 2BXVA 2A79A 4NI8A 1J0YA 2NQHA 4L4OA 2XIBA 4UQAA 1I2RA 4CD7A 3MVIA 2AL1A 3NQAA 1KR1A 3W83A 3I7QA 1UROA 1AQHA 3UXLA 4M0XA 4LW7A 2GZXA 4AZIA 3T40A 4LAOA 1FDJA 2W67A 3GW3A 1F6YA 1JPDX 4DQWA 4LTSA 3FSUA 3WLQA 3V0TA 2CEQA 1UKSA 1F6KA 3LHWA 4XZNX 2GDUA 5H1WA 5CG0A 2IQTA 4KERA 2A2IA 1HGWA 4GUJA 1EEPA 2P8BA 3KBVA 3MV11 2DFAA 2H8XA 4IP5A 1OF6A 3LZ3A 1MO0A 3O16A 3NQ6A 2ZQ0A 4Y9PA 4KWWA 3VZYA 1OB0A 3MO4A 2D3NA 4MKVA 3LHUA 4C6CA 4EPDC 3MCMA 4PYSA 3W70A 1L9WA 5A6AA 4XZMX 4DZHA 3SN4A 3XIMA 2VFHA 4GI8A 1TTPA 1YRRA 2PLMA 2IQ0A 3MHGA 4EPEC 4L1WA 3BAYA 4YLWA 3U6WA 3ZVHB 1ME9A 2C3ZA 1FH9A 1QNPA 3SO7A 4LAZA 3V35A 5A2AA 3ABRA 4RPQA 1P0BA 3A22A 2ISSA 3T81A 3K8MA 4R9OA 3HOJA 4IJCA 4S2BA 3IGHX 2BWGA 2QGYA 1X38A 3W23A 1TV7A 3RX4A 1ZP4A 3R8GA 5IBXC 2A4AA 3UEQA 4LOCA 1OEPA 4R7WA 3GNXA 4B3LA 3LHZA 2ZZ2A 4P61A 4CVUA 1OYBA 5CSSA 3PTKA 4MPKA 3W29A 2QULA 3S83A 3WELA 3E12A 3VGFA 1FP9A 4A8IA 3NQEA 1XW8A 2D2HA 4FI4A 5I03A 4R3UA 3S47A 5D38A 1O5XA 2DUXA 3CBWA 4QEEA 2NUWA 1AW2A 4GG9A 1Q6FA 3CHFA 1I1WA 1JYWA 4W8BA 4KGJA 4LB3A 2VR4A 3KTCA 1LWHA 2BX7A 4WXYA 3T0TA 1FWCC 4XISA 1J4EA 1TRIA 3CWNA 5I06A 3LU2A 3GXPA 2EBNA 3STPA 2X42A 3RFAA 3CHCA 1D3CA 4BF7A 3AUJA 4P7OA 1UH2A 4Z42C 3ERPA 1HKJA 1C7SA 4CCZA 3QHNA 4F9DA 1TFVA 3OGSA 1JFHA 2FZNA 5FAJA 2E09A 1UWIA 4G56A 2PI6A 1VFFA 1FP8A 2HBVA 3O8AA 3B8VA 3M5ZA 3HF3A 1EC9A 3NFUA 2ACUA 3WBEA 2W5FA 3A4WA 1P43A 2WCSA 1J5SA 4LPCA 1EHAA 3MSYA 2HK1A 1HJVA 3RITA 5C55A 4H6RA 4IMFA 1JPHA 1U1UA 2HV5A 3G6LA 4WX2A 5SWUA 1J0IA 3T2QA 3LRLA 1QBAA 2VEIA 2FYMA 4JTHA 4JAWA 2VC5A 4HNLA 2VX6A 2VL4A 1ISWA 3T0CA 4WDUA 4UNKA 2QVHA 2Z1WA 4L5ZA 1W8GA 2G3NA 4Z2IA 4W8AA 4U4MA 1BXNA 3Q2DA 4AHOA 3CIWA 4LYPA 3L67A 2IXVA 3FDKA 3UWWA 4JNZA 4BJHA 1KC7A 1SR0A 3EOUA 2PF0A 2G37A 3R0UA 3URBA 4UOZA 1CX9A 4FP1A 1RR2A 4GVIA 1DE6A 1OFBA 1S1RA 5DLCA 1D3GA 1XIFA 4J1OA 3HGOA 3KDOA 4O19A 2QV4A 1CGVA 1JUBA 3KS6A 4GZEA 4WHBA 1R3TA 4ZSUA 1GTHA 4L65A 1PTAA 5U4NA 1E1EA 3N19B 3NO5A 3WQGA 2YBUA 1XKYA 1QPKA 1EXPA 4L6OA 3ELFA 1DIEA 3VM5A 1V51A 3LRKA 3LV6A 3VINA 4ADSA 3B9OA 2HVNA 5D03A 2Q71A 2DSUA 3E96A 1AZ2A 4C7FA 3P6LA 3TV8A 3WLNA 3FK4A 3EMQA 4PSRA 1Q6CA 1MXSA 4HZ7A 4S3GA 1CIUA 3SB0A 3HJZA 2BLEA 1AODA 1VP5A 1D3HA 1LORA 4GNVA 3ME3A 4O1FA 3VKAA 4DNHA 2Q8LA 3LSCA 1GOQA 3NL3A 4AHQA 3SQSA 1P0KA 2DV0A 2VRKA 3MA8A 4GI9A 5EFFA 5I78A 3A64A 1TPVA 4DJFC 1US0A 2I7GA 3M64A 4W86A 3AMGA 4DXKA 3FFSA 1E9ZB 2HXTA 1M65A 1YXDA 4U10A 4AZCA 1PTDA 3CO8A 1WBHA 3S5NA 3MHFA 4RV3A 5KINA 3AYSA 3GW0A 2V3FA 3VMOA 5I24A 3AZSA 3W86A 3ONBA 1UWQA 4JEJA 3UWYA 3GLCA 3S2CA 5CSRA 2GK1B 4D72A 2HE5A 4IQLA 2GQ9A 1EA9C 2VO5A 2OR2A 3LXAA 5HUOA 1GQJA 2EKCA 4EOUA 1XRSA 5D9OA 3UYIA 1JXJA 1LP6A 3MVTA 3W22A 2V8ZA 2Z0IA 1JDDA 5CC5A 1WAWA 4Q6XA 3CZJA 2XISA 3GXMA 3T8LA 3T0BA 3CQIA 5IM51 3UU0A 2Z28A 1Q5MA 3GDKA 5BWAA 2PB1A 1CB2A 4Z1AA 4Q8QA 4E4UA 3VD9A 1MXDA 1E1CA 4ALDA 5LIWX 3SFKA 3ANYA 1XLKA 2WSRA 3I7SA 5FF7A 2J47A 4JX5A 3WNKA 2OZ3A 1W3KA 2VC7A 1FWIC 2XVNA 3I7RA 3W0KA 1GEQA 4TX8A 2DIEA 5L9FA 3RILA 1GHRA 4FXSA 1GVEA 4AZ5A 1BWVA 3WDQA 3P60A 4X0NA 5JIWA 2E6YA 2XDFA 4Q7NA 4PFHA 1K6AA 4HVXA 4H9MA 1B3ZA 5JQ9A 5JBFA 3A23A 3M16A 2CBUA 2OEJA 1LF1A 3VU2A 4B4FA 3HPFA 2AGTA 2C19A 1A0EA 4GJJA 4XD6A 1DWFM 2XTKA 3H2MA 2CXEA 4PBEA 2Y7FA 1KB3A 4RDWA 5A6MA 4H7CA 2XU2A 5ABFB 4DZ5A 2ZUSA 1EJSC 1R9XA 2V63A 4UXDA 1Y7VA 3MUIA 1JAEA 3M6DA 2NSXA 4C60A 1S2WA 3P84A 3CAVA 4CN1A 2PF8A 1YXYA 2VZTA 1QI2A 3HA1A 3W82A 4ZTYA 1ITCA 1F6PA 2PDQA 4IIHA 3MSRA 5FF4A 2D24A 3MWAA 5EGRA 2W0UA 1RP9A 3CLWA 4EWJA 4G1NA 1Q7MA 5CPOA 3VIHA 2ZZ7A 3W76A 4J27A 4H3DA 1R38A 3SUTA 1OZMA 3GC4A 3QR0A 3RLUA 2D0GA 2EJAA 4NI3A 3K4AA 2R91A 2X09A 3B97A 1ZS2A 1AJZA 2WNQA 3LY0A 3ABSA 2DZXA 3W1XA 4DJDD 3E74A 5HA7A 2GUYA 2F84A 3LBOA 5AHFA 4IP7A 4AIEA 2KX9A 1BWKA 3CK5A 5ABHA 1I0BA 1D8CA 3NXFA 2WSPA 4PSPA 2JKAA 1F73A 4LQ1A 1DJWA 2RUSA 3C2YA 2PC8A 2R1PA 1FCBA 1FKWA 5AC8A 3SQMA 3HG2A 1LQAA 4RXFA 2R14A 3UXDA 1TWIA 2VR2A 1RPXA 4E2BA 1OK4A 4JZ5A 1WA3A 3VGGA 2I5GA 3W2JA 1VH7A 4XTDA 3OHMB 3ZJ6A 4F2TA 1A50A 3J7HA 2INFA 2XIIA 1JULA 3ALFA 5DANA 4OOUA 2DQXA 3UQNA 1TPDA 1YIXA 3FS2A 3AIWA 3H7VA 4DUWA 2XG9A 1VJSA 3W1MA 5BZAA 2YW4A 4LRTA 4ZOBA 3R10A 3NGFA 4ZQOA 4WUIA 3L5AA 4GKLA 4IUGA 1THFD 2F38A 3SCTA 1MQRA 1TR9A 1W31A 1P6WA 2W91A 2QCDA 3TQ0A 4HNNA 3WQ8A 4HOZA 3K4WA 1TKKA 4ICMA 4XZHA 4B2DD 2O4MA 1J5TA 3GUGA 4XQ6A 1GVRA 1YDYA 3BPWA 4V27A 2WCGA 1Q8JA 1AFSA 1ZTVA 1K7XA 3RM9A 1DIDA 1DVJA 4ILSA 2WMIB 3WD4A 3SRFA 3E2SA 5HULA 3TJ4A 4TX9A 4QG9A 4NYYA 3VGDA 3LZ5A 1XIJA 4GIRA 4O1CA 3UJ2A 3WK2A 1S2CA 4US6A 3WMLA 1S5VA 4LH8A 1VLIA 1TSIA 1UR3M 4XKMA 4PUWA 1A4MA 4JQ3A 1GVQA 3CHEA 1B4KA 1W9UA 1JDFA 3WD3A 1UUMA 5J5RA 3GS6A 4J3ZA 4IIFA 3UESA 4IOTA 1F3XA 3LA4A 4DI8A 3GBDA 4GHRA 3BLEA 1S2TA 3HFTA 1M41A 3RLVA 3V4BA 5JH1A 5FJUA 3VDGA 4EF9A 3BLDA 2YCJA 3JZUA 1C92A 3ITLA 4XKYA 1R3QA 4EXQA 4CQ9A 3AHYA 2ZA2A 2GYIA 3GVVA 3TTQA 2BGQA 3W1UA 4M7TA 3IJLA 2YDSA 4PMQA 3NVTA 5F4XA 3UZYA 1QMLA 5HMEA 5EPDA 4OFCA 3NQCA 2ISDA 1C9WA 1X97A 4AEOA 4QE4A 4UFKA 5CZSA 2D22A 3S6DA 1BXBA 3O63A 3CGTA 1WUEA 1BTMA 2W9MA 3EDDA 4EIVA 3TLQA 4IUOA 1RH9A 4Z17A 4QCEA 1FUYA 3BOFA 5A6KA 3L4TA 4FNRA 4Z1YA 4MAZA 2Y63A 3IPWA 4C6EA 4FS9A 4ZB2A 2OSYA 1ISYA 3LNPA 4GISA 2ACQA 1TUFA 2VX7A 3KWSA 2PLCA 3CM4A 4JPGA 4Q4OA 2EQDA 3HPAA 3QV9A 1C9DA 2EPLX 2X8RA 4IPIA 1G94A 4DAFA 1GYNA 3TN6A 4FF7A 2RAGA 2VM8A 5EY5A 1A53A 3F7JA 4UTWC 1IEIA 3H12A 4O8AA 1R3YA 1BYDA 1B2YA 3GHRA 3TSDA 3HMCA 3W7LA 4GA8A 3FVMA 3L2IA 4HKPA 3UWEA 3VKJA 4ZE5A 3RR1A 1A5NC 1VD6A 3TMLA 1NDZA 3S9IA 3F2DA 1REQA 4DO6A 2GVYA 5HQEA 1XD0A 3F5LA 1UR8A 3IAPA 3JU2A 4HA1A 3W1AA 3TFXA 4QJ1A 1WZMA 3ZLGA 2OXNA 1CGYA 3NDZA 3NIYA 4PBGA 3WL0A 3GZAA 3TR9A 1R86A 5DEZA 1CXHA 5FJTA 3VGHA 2ZADA 3KCLA 4OHQA 3HQNA 3WEOA 1XUUA 4MYXA 5XIAA 1P7TA 3GAYA 1WDWA 3OLGA 1OINA 5HQMA 4W9TA 4WVXA 1W5NA 3LPOA 2XWEA 4K39A 4DLFA 2Z7GA 2B7PA 1SZEA 4TX6A 4LU0A 1C8XA 5MHBA 4D1JA 1QO5A 5IRPA 2CZEA 2G3FA 3UPWA 3MMWA 1DWIM 2OO6A 2V69A 4UZSA 3PSWA 4WJ8A 4GIYA 3LCIA 1ZJHA 1QOQA 5A3HA 3OGVA 3DFHA 3IIPA 4H6KA 1QWGA 4D8ZA 1XLJA 2VFIA 5F2IA 4MDPA 1AH0A 4L61A 2PDNA 1VZWA 3IARA 3DOPA 3WD2A 3EPNA 3VDAA 3PR2A 3G1YA 4QIUA 4DO7A 3M46A 3APTA 1HP4A 1NQ6A 3S1XA 4L9ZA 4JL2A 3I6TA 5G2IA 2YCIX 2V5LA 1JZ8A 1HUVA 3EX2A 4IPNB 3U48A 3VNJA 3RHGA 1GPFA 2ZA1A 3AYRA 1FWTA 2Y61A 5TD4A 2ISFA 3NQMA 2QDEA 1LTDA 1XYCA 3W71A 2OCZA 4D6FA 4GD0A 4A8LA 2BV9A 4BI6A 1CW2A 2D69A 4MNKA 1UQYA 1IZKA 3AMLA 3OBEA 3QPYA 1R2RA 4UTFA 2DZUA 1EZ2A 3SCQA 1R0MA 4PCNA 1W3JA 3USBA 1XM3A 1EOKA 4ERAA 4NZ5A 4LYKA 4QNEA 4PB4A 1VCVA 9CGTA 1ZFJA 1A5KC 1WZKA 2YCLA 3DUGA 3ZT6A 3UBPC 3LCWA 2ZRUA 1XLBA 3NAVA 4CU7A 2FZMA 3ZWSA 3N2CA 4RDYA 1UPPA 1B3YA 2E6DA 2GVEA 3S9YA 4TV5A 3DGRA 1HKVA 2V81A 2UV8G 4XK2A 2J7BA 3WENA 3GVGA 2X05A 1OCNA 2QGHA 3EZ4A 5KMYA 1T99A 7A3HA 4DWSC 4QEHA 3NQ8A 1XQKA 3ZO9A 4KGLA 2G3IA 3AAMA 3FGCB 2G0WA 3ANUA 4NZJA 1KFJA 3B8SA 3N17A 1Z44A 5AZ1A 2JF7A 1NWTA 4EPBC 4YMZA 2J77A 4O12A 4S3CA 4Q8OA 3UWQA 1GZJA 3QW4B 4CCEA 2NX3A 4MY8A 1JCMP 3UR8A 1UC4A 3M0XA 2PLKA 1UZDA 4HHHA 5FF3A 2WQDA 4HCDA 3OTRA 4D9PA 3QOMA 2ZVRA 3H4XA 1TPC1 1ITXA 2FFIA 1DJHA 4HZMA 1L8NA 5C5YA 3CB3A 3P5YA 3S5OA 4PCPA 1HJWA 3GKAA 3I3DA 3GTXA 2Z24A 1H49A 1E0UA 3BCFA 3TOPA 5A8NA 3NG3A 4XG1A 3H70A 3KP0A 1WAUA 3NDYA 3W3OA 3L68A 1DKWA 5DX7A 2FIQA 5EMLA 2WYSA 1NAL1 1GWJA 4RNJA 1Q8AA 2J66A 3IV8A 4IH3A 2ABBA 1LRNA 1HF6A 5D05A 2CXGA 3IACA 3FOKA 3HPZA 4GCAA 4XZ9A 2F8QA 3LK6A 3NQFA 1A5OC 3W6LA 2NQ9A 4POCA 4FAMA 2YXOA 1E71M 4Q7BA 1JIBA 4J9JA 2PDWA 4GJ1A 4CEUC 3W84A 2VVNA 1WV2A 1DWJM 2J7CA 1CLXA 4MDOA 3UNTA 1TPH1 1MW0A 4W89A 1W1A1 4LJ3A 4JTUA 3V3WA 1OBAA 1QUMA 5G4EA 3ARRA 3FJLA 3GXTA 3BSGA 3HGRA 3V36A 1OWQA 4TTGA 3N11A 2PU1A 4QS5A 3UZZA 3APYA 2TMDA 1OC6A 2HZGA 3FAXA 1NTHA 5EMKA 3W1NA 3FA3A 2TAAA 3H2FA 4DJEA 4N6EA 1QPOA 5F4WA 1XC4A 2OKTA 5TQLA 1IGSA 1R9YA 2XVLA 3TQPA 4CKQA 1R7OA 2ZUWA 4HJFA 3GYEA 1H61A 5FEWA 3VOGA 4AIUA 1B9ZA 4UMCA 3E2QA 3NOEA 1RY8A 4P7LA 5T9CE 1FKXA 3TJLA 3NQ2A 1ISVA 3ARPA 3ZVIA 3GDLA 3FXYA 1GNXA 2V5DA 4HYWA 2RGMA 4HA0A 4KH2A 5FIPA 1JPIA 3CNYA 3ARWA 1E70M 5JVLA 3PZMA 3WLKX 1NU5A 5C9ZA 1IZCA 4AIBA 3MB9A 3E0VA 4WDWA 4U28A 2NXGA 4FR6A 3GH7A 3PP7A 3WUGA 2PS2A 4IMDA 3B4YA 1EQPA 2QCLA 1OCJA 2ZDRA 4ZCWA 2VENA 4LUSB 3M44A 1M01A 2P53A 1MI3A 5CLTA 3SRDA 4F3HA 4QDWA 2O92A 3VIGA 2NLYA 1M5WA 3B8WA 4MYAA 5BXTA 3R0DA 4QR6A 3C52A 1O1HA 1ZJAA 1YDOA 3TYCA 2Y1HA 4YIWA 3LNMA 3HN3A 1VB9A 1XIHA 1RD6A 1E6SM 3PBYA 3WZ0E 3QGVA 1MW1A 1CGWA 3MW7A 2XGIA 1OG6A 3U2ZA 4JXCA 2RH9A 3QBUA 1X8CA 3RNDA 1YBQA 3CT7A 2E9LA 2PGFA 3QYSA 1XSIA 3OODA 4GC3A 4GYJA 4X63A 3OBAA 2OZ8A 3TUUA 3R8RA 1R46A 2A6LA 2WOQA 1HG3A 1P4CA 1TPB1 2FDSA 1PV8A 3WF3A 4Z2JA 5A6JA 4O28A 4NL1A 1O1ZA 3ZSSA 2E3ZA 3RMJA 3CAQA 1IF2A 2VFGA 3P74A 1QAPA 3MCOA 2CW6A 5FL0A 1KFKA 3SR7A 3CPGA 4DBWA 2CLHA 1O60A 3PZUA 4GY1A 3VVGA 4LUTB 4RL3A 4DIAA 1KTNA 4FSAA 3T09A 1XBYA 4Q32A 4I5RA 3PUEA 3LSBA 4PR4A 1N55A 4IIEA 3W24A 1RQBA 3QFWA 3VGBA 4FALA 2VI0A 2D2OA 2DSVA 3PPHA 1LG2A 5CBJA 2C0AA 2MNRA 3KBJA 1JNDA 1UIPA 2A3AA 2AQWA 3CZGA 3MUCA 1CB7B 1H1NA 3S42A 3LCGA 1A0DA 5CZJA 2HPIA 2HWGA 2WZTA 1IXOA 3VNLA 4NAFA 4C6FA 3ZJKA 2E9MA 3KHJA 2QLYA 4BCEA 1JJKA 2BXYA 1EJWC 4H8UA 3T2OA 3E3HA 2B4GA 4AVNA 3M0KA 3T1GA 1P1XA 2PMQA 1JG9A 3BXWA 1HQTA 1IYXA 4FOUA 1LOQA 3GU1A 5D30A 4AWSA 1FWAC 1I2PA 3PBWA 5H91A 2Z4GA 1CENA 3BMWA 4W85A 4A6GA 3FJNA 4IMGA 2WWCA 1BYAA 1XD1A 3C0JA 1Q6GA 3GWQA 5D2VA 1UZHA 2BHUA 3G1HA 1U5HA 2BASA 2NT1A 4G1KA 3W37A 1S3HA 3RO8A 3N04A 1FWSA 1ZZMA 3ARSA 4D6EA 3WLJA 1OX4A 3RU6A 5D04C 4BQ3A 2Q09A 2X30A 2ZZ1A 2PDMA 4UNLA 1QVBA 1W3TA 3H4WA 3KTXA 3N6JA 4NVTA 1RBOB 2IMRA 4DYJA 4Y8EA 4YVXA 1WKYA 4WIWA 4H2HA 4JTQA 5LKYA 3RJXA 1RJPA 4A3HA 3UG4A 3F4CA 4L80A 2HJPA 1UOKA 3NA8A 1UYQA 4KPLA 1XYAA 3LB0A 5C2CA 1EIBA 3SCVA 4RPPA 1KO0A 1XIMA 1DJQA 4GGBA 2CLOA 3BLOA 2J88A 1WOBA 1GQKA 4FNPA 3B9DA 4DNMA 1Q6RA 1BQCA 4RZ5A 4JICA 4CEXC 2Y0FA 4UCGA 5C7VA 4KESA 1KM5A 1PKMA 1E6PA 1VPQA 2WANA 2BVWA 3MDUA 4YN5A 4M8UA 4UOQA 1J9YA 4HSHA 3U2CA 4UQDA 3UWZA 2GVGA 3LTPA 3WH6A 4R9XA 1XLHA 4Y8FA 1A3XA 1ZAHA 2CWNA 2PP3A 1H5YA 4MFEA 3A3WA 4OTKA 1K9TA 5FACA 5TIMA 4IMAA 3RN6A 1PDYA 3CL6A 5A5WA 1J0KA 3C0QA 1B31A 1Z9AA 3LXBA 2EKGA 3AQUA 4C6MA 6TAAA 2C7FA 3FEQA 2OELA 1AL8A 3EEZA 5E5CA 1TELA 2GJPA 2RKXA 4R33A 4NU7A 4XUYA 3OIHA 3URAA 2WMHA 3KL0A 1L2QA 1M1BA 3DFYA 3NDOA 3AIEA 3RCNA 2WBGA 1RQEA 3LCHA 3U2EA 5KETA 2YZ5A 6ENLA 4AHPA 3KX6A 4F66A 2OWCA 4PMOA 3BMVA 4M19A 2V2HA 3UZJA 1X98A 1V08A 5C8BB 3AXXA 4H8HA 3PJWA 5CBBA 1ZSXA 3PZGA 4HHLA 1BGAA 1W17A 3AIBA 1WP6A 3P8IA 3G1AA 3FN9A 1E6XM 2E1WA 2PDFA 5A94A 1JZ3A 4CU8A 2FFCA 4JCMA 5AYXA 3OP2A 4C65A 2DGAA 3TX9A 2IPFA 1UWAA 4NIRA 3G3DA 3W2KA 4ZE4A 3CTTA 4S3FA 2A7RA 1SO4A 4M82A 3AHXA 4MHBA 1QTWA 2PU0A 1JQVA 3P62A 4LAKA 3MQTA 4UR7A 1NDWA 4GLEA 4O1DA 1VPXA 3ZVHA 3R11A 4NG3A 4HZ6A 2Y7DA 1T5AA 5A6LA 4O1BA 1G4EA 4FXRA 1QW9A 3W88A 3BW3A 1W54A 1MVYA 4L64A 2P50A 3CV1A 3F5JA 2IKIA 4O0QA 1H63A 1S2VA 1PAMA 3BQ6A 4PE8A 2ZC1A 4FLQA 4BI5A 5E0CA 3ZFHA 5BROA 1O5RA 3USZA 5CLWA 3BZGA 2GQ8A 1A3HA 4Q8PA 3WEMA 3LLDA 1UR9A 4RE4A 2D20A 2WVVA 4TMBA 2G8ZA 4LY4A 3GDRA 5C9WA 4YVVA 2WPBA 2EEXA 5DT5A 1GYMA 1DBTA 1GJPA 4WDTA 3THUA 2ZRZA 1V5XA 1UR1A 1XKJA 1D7FA 3W26A 3QC0A 3IJ9A 1XGDA 4E2OA 3NQDA 1GKQA 1LM1A 5D2TA 3OO2A 1GQIA 3BDKA 4AIOA 5C7HA 4MSSA 4GFIA 4D2JA 3E9AA 4HNOA 3WK3A 5LIKX 2QS8A 1XPYA 4QJ4B 1A5UA 1B30A 2NX9A 2Y88A 4B3KA 3WLMA 4HSOA 4TUFA 3Q94A 3LXCA 1FXPA 4K7VA 3V5OA 3QZAA 3P93A 1I0DA 1NH6A 3RIKA 1W3HA 4XZIA 4MM1A 5A1AA 1JD7A 2XIOA 4OJYA 1EWEA 4AD2A 3GIQA 3C2OA 1E1FA 1R3RA 1ZUAX 3UNDA 1EJTC 3OPSA 4GXWA 1ZJIA 2JKPA 4MJ2A 2QAPA 4CD5A 1NWUA 2GL5A 4M1RA 2D23A 2FHCA 3AS2A 3M47A 3T78A 4CNTA 2F61A 5D8ZA 2VMFA 3UJFA 3Q58A 4NP7A 1O6IA 1V6WA 4C6QA 3H6OA 3KVMA 1ZCCA 3ABXA 1PYFA 1CWYA 1AD4A 2EAWA 4JQ4A 1W56A 1CTNA 1W5MA 2FGZA 3S2NA 2J27A 1Q2RA 4DBEA 1HJUA 2WSKA 4I90A 4QE1A 5DN1A 2FH6A 3W7CA 1G4PA 3W81A 1Q2SA 4DO4A 1SFTA 1ODZA 1UKQA 4XD5A 4NXSA 4WD0A 2YB4A 3G5EA 3COTA 2Z1VA 1OCBA 4W87A 1H7PA 1IQ8A 3ARQA 4E3VA 3I68A 2E5DA 3I6RA 2VX4A 4LCRA 4KRTA 2VFDA 3T0AA 4W7WA 2V0TA 4UQCA 1TPFA 1RCQA 2FJUB 3UXIA 1UWTA 3LPPA 3OA5A 4CQAA 4C7GA 2BDQA 5FF0A 3LX9A 5DY2A 3ZR5A 2IUZA 3P0XA 2V9DA 3BARA 3FJ4A 2CZDA 4U5KA 3KXQA 3F1QA 1R85A 4GX8A 1KM0A 2E9BA 4FA3A 4G6CA 1X8FA 3FXGA 2PRMA 1TV5A 1HGYA 4OU1A 4AX6A 1DIKA 1GOXA 4A29A 3PZTA 9XIMA 4UZUA 3U8GA 4Q8WA 3G6MA 3FIGA 4Q8MA 3N4EA 2YX0A 3EOSA 4KW2A 1US2A 2QCNA 2UZ9A 3FLUA 9XIAA 4MB4A 2QKFA 4GVGA 4FB7A 3ONCA 4YTSA 2YR1A 4NHVA 3EWZA 1QCWA 4B9YA 1Q66A 1S3TC 1TJRA 1P6BA 3BG3A 3IIZA 1UWSA 2UWFA 2Z2UA 1C90A 3NWRA 1I9CB 4QXIA 1G7UA 1GW9A 4N6FA 1E0TA 4US5A 2Y8KA 1M03A 3HGSA 3UZ5A 1GKPA 3BK0A 3EWYA 4HMCA 4AZCB 5A8GA 5D9MA 2B31A 2QPUA 7PTDA 4OUIA 3TYUA 3MANA 3MZ2A 1VBHA 2DH3A 5I02A 4BF9A 2P10A 4IFKA 1F05A 3FDGA 2XH0A 3EA3A 5RUBA 4PULA 1N8IA 4H9XA 5CC7A 1RK6A 1IIHA 4H6EA 2OEKA 3FGCA 2PDKA 3N2OA 3UERA 1DXFA 4OZOA 4A2RA 2TSYA 3O1NA 1WNOA 4UBPC 1TIMA 2NV2A 2FKPA 1ONWA 2QJMA 5HANA 5CAHA 1H60A 4PUUA 3B06A 3WJXA 5J04A 1ITQA 2D2JA 4HU0A 3PB0A 3GIYA 3QV8A 4JDBA 1DHPA 2OQYA 4I9AA 1AQMA 2Y5JA 3GHUA 3CPUA 1F5ZA 3PG9A 2WZHA 2NVDA 4KEMA 4ZXLA 4YCPA 3ZT5A 2PP0A 1U1HA 3QV6A 3IRSA 2PDPA 1PL9A 1TA3B 4QS6A 2XWDA 1QHZA 1LBLA 2PDJA 3LMYA 3QGKC 3GTHA 4DWDA 2OOFA 1DXIA 2OEMA 3VC6A 4NJIA 4H9TA 1D8WA 3S0CA 2C14A 4MNJA 8XIMA 1J0HA 2GQ3A 1XFBA 3B0YA 5BXRA 5G2WA 2C91A 3THAA 3VIIA 1UUQA 5CXPA 3PF3A 3WQVA 3M0HA 4V1XA 5AHMA 3VCNA 3DHDA 5FD0A 3GG0A 3NZQA 3G24A 2QXWA 3IGSA 1H7OA 2WVUA 4ERGA 3SY8A 4H9UA 4Q8NA 1JUKA 5I3FA 2GJLA 3CS2A 3QKZA 3FVDA 2HNHA 1OHLA 1GCYA 2I16A 5A6BD 1OG0A 4Q33A 3MHUA 1KWKA 1SJAA 2ZRWA 2D73A 3NJ3A 2EO7A 1K7FA 3WQDA 4PMRA 2GJRA 3UD6A 3MSGA 3VCCA 2V5KA 1YNQA 3C0LA 1KBJA 2BGSA 3O6DA 3MBFA 1AMYA 1KV5A 3IVSA 2PTXA 2WJDA 1TV8A 1IEXA 4QLJA 2FHFA 1C29A 1OADA 3W7RA 3A4XA 1GVOA 3TR2A 4NZ3A 1O5QA 1KQYA 4LSBA 3T0DA 5K3VA 1E5JA 4PZVA 2VTFA 4JTCA 4AXKA 2VEKA 4OIFA 1G9HA 1KR0A 3KBMA 3RM4A 1QATA 4FOKA 1G67A 1GEHA 1UH4A 2OG9A 4GUHA 1KXTA 1MNZA 2DUZA 4RZ6A 1S39A 3GXNA 3OVQA 1FDZA 1HNYA 1A3WA 3N25A 4WY0F 4JCLA 3P8JA 1QW7A 2HROA 5FEXA 3EA2A 3ARVA 1KW1A 3PJUA 2OFJA 2QIIA 3AU2A 3W7OA 2ZUTA 2OJPA 1PUDA 5I79A 2QMJA 4EP8C 2DY3A 4P7RA 1VGAA 1XLEA 3OZPA 5GVJA 3LS9A 4CLMA 1MW2A 3CO4A 2Z7KA 4P8VA 1EJ7L 1DIOA 3BJSA 3N6HA 3MUZ1 4LRSA 4F79A 3W27A 3ZJ7A 4DLMA 5DRCA 2YLAA 1Q13A 3QHOA 3P5ZA 1JCTA 2DZTA 2W66A 4GO8A 3H24A 4C6NA 1PZ0A 3M0IA 3IGUA 2G50A 4RXGA 4GX9A 2BNJA 4WJEA 2FGLA 1AQFA 1IHIA 1H7WA 2NLIA 4HT3A 2F6UA 3AWNA 5C9RA 3PZOA 3TW9A 1PX8A 5HQLA 1XH1A 3LN3A 3CWHA 2FVMA 3SN0A 4LX4A 4JS3A 4PMVA 3EYPA 1T7LA 3WLOA 4AEEA 3URNA 2X7VA 2Q3OA 4PODA 4IGSA 4Z1DA 1MDLA 1FH8A 1CLVA 4NXKA 1K7EA 4C1NA 4U3AA 1F8IA 3NQ7A 1UB3A 1Z7AA 1V02A 1VRXA 3TZNA 1AA1B 2PUZA 1H09A 3W7HA 2EPMX 3A3HA 3BE7A 2XN1A 4AVFA 2V3EA 5BNKA 5FESA 8TIMA 2VGGA 3N9KA 4F8XA 4Y90A 5CGTA 1H7NA 4J3WA 5F4SA 2A6NA 5ENLA 2IPWA 3ITGA 1J2BA 3N6QA 1ZU8A 3L4ZA 4NKCA 1RJQA 3HURA 3RO6A 3CIXA 4X9YA 1F3TA 1QNVA 3REQA 1XLFA 4LY8A 2YB1A 1TZ9A 3VOJA 2VCBA 5IXEA 3GTIA 3MUXA 4HQVA 4HK6A 4DPQA 1SFSA 2JIEA 3W7NA 4K8HA 1PDZA 3CT2A 2W61A 4ZQCA 1JUEA 5E09A 3DI0A 1W3IA 1POJA 4DPPA 1TIWA 3SZ8A 3H7UA 4LVAA 4XZWA 2F7FA 4GYKA 1R47A 2GGGA 4TOQA 1KXVA 1EWDA 2J8TA 4WGXA 4PMXA 1MFUA 4BHYA 5FSEC 4PTMA 4UTTA 3JR2A 4JNMA 1V4YA 2HSAA 3TP4A 5HNRA 3ZLFA 4E2VA 4U2YA 3II1A 1RBLA 2WMFA 2NXHA 1XSJA 3GXFA 4HK5A 4CQDA 1NFGA 4ADUA 1E5NA 3H22A 2VURA 2HCVA 3AWOA 5FCZA 4HN8A 2B7NA 5HATA 3SUUA 2VEMA 3QGAC 3IV3A 1PPIA 4WF7A 2ZRXA 4M24A 3UYCA 3BGGA 1J79A 3D3AA 4H9YA 2YYUA 1TV2A 1ALDA 1HL9A 3B0XA 3EWXA 2WC7A 3OGRA 3MI2A 5IFPA 3CTLA 1CPUA 2HISA 1YTDA 2YBTA 5G1MA 3VIPA 3ARTA 1OC5A 4BF5A 4I3GA 1BF2A 3NEVA 2QCGA 4LB4A 1BAGA 4B5UA 2DZBA 3G3MA 5JH2A 2E5BA 1VBGA 5DMMA 4MWAE 3OA3A 1XDJA 4HPNA 2C79A 3GQYA 3BC9A 1F3EA 2J75A 4HZ8A 1XIIA 3S1GA 2FGBA 2CFFA 5BOEA 4DBDA 2J7EA 3DYOA 1ECQA 2OLSA 3W28A 1H41A 4U33A 3CLMA 3AIVA 2ODOA 2PODA 3WD0A 3E6EA 4F0KA 5HWNA 1R3SA 1E55A 2PP1A 3VZXA 5TBOA 4B5NA 1LRTA 2C0HA 5F2MA 4IZGA 1UCWA 3QQ0A 4BY3A 1HFBA 1VKFA 3TROA 2YA2A 4RW5A 4OV9A 3WBYA 5BOOA 4S3KA 4LUIA 2WK2A 1CYGA 3VO0A 2Z1KA 3CL8A 4AU0A 1HN1A 1SVDA 4QNWA 3WLRA 1WO2A 5K4XA 3UVAA 1W9XA 1SZNA 2Y70A 3OJGA 4MZ1A 5C0QA 1I2OA 3MCNA 4JKKA 1Q6QA 1IR2A 1N8WA 1B3VA 3LLXA 3VFCA 3SJ3A 2VZVA 4AD1A 1F76A 3W72A 4I8DA 3POHA 1ZJBA 5AOUA 4ZOAA 2VZSA 2W27A 1SO3A 1G6CA 4PB3A 5G4WA 4DJED 5FJOA 3W1RA 1BVWA 4R7JA 3LM7A 4EF8A 2WXDM 3RK8A 4I8YA 3AICA 4A3UA 3RPDA 3FW6A 3GHSA 2PDYA 3NNTA 2E6FA 3SAZA 1IE7C 5K9CA 1XLLA 4F2UA 2CLMA 2DT0A 4K36A 1XGZA 2E77A 1PIIA 3B4UA 2VEPA 3VNKA 2QUNA 4ICCX 3D6NA 1HIZA 4Q6JA 2PGWA 3T07A 1HXJA 2FB3A 3VIOA 2F2HA 3KLKA 1SO5A 1A5AA 3IK2A 4C6LA 4QE5A 3FSTA 4DAIA 3LQGA 3UFYA 1GORA 4GVFA 3AC0A 1LWJA 1WYIA 1FWWA 3QR1A 1G7VA 1P0NA 1TE6A 1EDGA 4GZIA 3RAOA 3KL3A 1UWUA 4JN7A 4LBSA 2JKEA 3F03K 5AYZA 2A21A 3MP3A 4W7VA 4D71A 3VABA 2ANUA 2PDLA 3NL5A 2A7NA 4JNYA 2P76A 4UFLA 4F48A 1GONA 3UCCA 3KE0A 3EKGA 1LDCA 3B9EA 2DVXA 2YOCA 1MQQA 3KL5A 5DQPA 2WV8A 1NJJA 1SU5A 3AXIA 1MUCA 2P0IA 4L4MA 1RUSA 3P80A 3LV5A 1TA3A 1EZWA 1OQFA 4GWEA 3N3TA 1WOAA 4CNPA 5AYYA 3F4WA 5HAOA 5GJPA 4K6AA 4S3JA 4X3ZA 2HMCA 3NQGA 3UJRA 1XH0A 3WQ4A 2PWGA 4ZQRA 4LANA 4D8AA 3B0PA 2C16A 1I1XA 4PFMA 3VILA 5BU9A 4ZFMA 4HOXA 4P8UA 4ZL1A 1RJRA 2CBIA 3VX1A 4LBRA 2HVMA 3IJ8A 3TTSA 4GYPC 2AQOA 3JS3A 1X6NA 1V79A 1W2VA 1MUMA 2WSQA 4ENLA 3PK7A 5DY3A 2WLZA 4GIAA 4DX3A 4RE2A 1RQHA 4HNCA 2QDGA 1ZQ5A 5I3DA 2P8CA 1FBAA 1TV4A 3W01A 3LI0A 4UR9A 1SJBA 3M5XA 1PE1A 4JFSA 4NQ1A 2D2GA 3GU9A 2QJHA 3N2XA 5G1YA 3U4FA 3BG9A 3AFBA 4NT0A 5FOOA 1TE1A 3RDKA 4EX4A 1JRCA 3ZS4A 3T4WA 2QJGA 5PTDA 3ZR4A 3QSTA 1FWRA 1UIOA 1MQPA 4E8GA 2J24A 1KM3A 3W2MA 1GHSA 4Q3MA 4UTTC 1HKKA 3QMSA 4PTDA 5JBDA 2ZE3A 1NOWA 2BGNE 4FIRA 1DTNA 2XFRA 3VDHA 1PKLA 1LOLA 5FA5A 3GDTA 1W3LA 4AZ6A 1JQXA 1KRMA 4JN8A 4NZ1A 3K4DA 6ALDA 5IOBA 2ATSA 2JEQA 2J78A 5GNZA 4C1NB 3BQ5A 2GVLA 4OECA 3NOYA 1WPCA 2ICSA 3M4HA 4H00A 3VKKA 4BK9A 3VE9A 1EQCA 1IT8A 4LNYA 1R8LA 3T05A 2VWTA 2EXOA 4JFUA 2D3LA 3UR7A 2P88A 2GUUA 4WEVX 3GTFA 2BVTA 3CUGA 4G5DA 3GSMA 4LYRA 2J8GA 4MB3A 4XSMA 2UBPC 4E8DA 1J18A 3OOQA 3WNPA 4V33A 2W62A 1K6WA 4B3ZA 5C6MA 1VFMA 5H8MA 4TXEA 4GKTA 1EDQA 3WF4A 3DU0A 4D6JA 1ISZA 2QQ6A 1E15A 1HJSA 4DZIA 1SZRA 3KW3A 3B8IA 1B0IA 2Z2BA 1EO5A 1MMFA 4PA8A 4GQRA 3K13A 1XYLA 2JK2A 2CLFA 4I7WA 2OU4A 5LNWA 3H53A 2OZ0A 4HPXA 1PVNA 3CMJA 4HPHA 4LWWA 1EH9A 2GGJA 3R5EA 4XAFA 3KCJA 4UCFA 4NX5A 5L6UA 1OM0A 2UY2A 3PC0A 3T4CA 1ZLPA 5GNXA 5LNRA 4IQJA 3BW2A 4EANA 2HXUA 1KCKA 5GJNA 1U5VA 2GGIA 3PUOA 3WCZA 1X7IA 1UD4A 3M43A 1F7BA 2V2CA 1ZB5A 4G7EB 1X1ZA 4O11A 4QQ3A 4F4RA 4NZFA 3D46A 4UTHA 3AALA 3TAOA 1NQKA 3Q37A 3KUMA 4PTXA 5A95A 1OX6A 4O53A 2I5QA 1FFQA 2V3DA 1PKNA 1MRAA 4ZGYA 1TRDA 1BEUA 2DORA 3BOLA 3QW3A 3ZOAA 3SQLA 2PCEA 5HR6A 1UHVA 4UNIA 1F4HA 4G2DA 1OT1A 3VTRA 1OYAA 4FX7A 2YL5A 3PUDA 2GDVA 2V5BA 4PMZA 3W07A 3CUXA 3VOIA 2QCHA 3DXIA 2YL6A 1LUCB 1FWHC 5T26A 4AISA 3FHAA 7ODCA 2DPEA 3MU7A 2ZOXA 3C5QA 5ECUA 2OB3A 1F3WA 4FNUA 1Q6DA 1UBPC 2YYTA 5B7ZA 1OFRA 1DV7A 4H7VA 2DZPA 1EHNA 3ORWA 1IEQA 4YWIA 4K1GA 2PRLA 3CAKA 4AZGA 4FO4A 2XH4A 5G4HC 4CU6A 5J5DA 3NM1A 1EOMA 1JDAA 4H8VA 1Z32X 2FHBA 1WE5A 3UG3A 1FWDC 4EKJA 3BO9A 5I3HA 4PMDA 1TREA 2JBMA 3M41A 1S5MA 2ZZ5A 1QASA 3KOWA 4LUTA 3BLKA 2G5WA 3SECA 2UY5A 4YPJA 1I6NA 2Q3RA 4DJDC 4F0LA 5IDZA 1W5PA 1Q85A 4HYVA 2O0TA 3N12A 1V8EA 3V0SA 1HKIA 1E6NA 4ES4A 4UTMA 1RCOB 4ZB5A 1XLDA 2YLLA 4LFYA 3L0GA 1YMYA 4ZO6A 4GFSA 2AL2A 4DBSA 1GG1A 3MT1A 1W9DM 3S9ZA 3C61A 3NSMA 2VOMA 3C8NA 1EJVC 2JALA 3TA9A 3SEPA 3N1AA 4YYFA 2J6XA 1H2JA 1KV8A 1D7KA 4LVGA 3S4TA 1E51A 4U5IA 3HV9A 1R3WA 2W4XA 1XRFA 3P0WA 1FDYA 2E1DA 3CMGA 1JD9A 3MYOA 4IIDA 1XI3A 1E0VA 1PIFA 4ECLA 1TQJA 1UUOA 4BKNA 4EE9A 2JQXA 3WG6A 3R8HA 5C71A 4CD6A 2INZA 1IT7A 2NT0A 4UFIA 4Z08A 2XSXA 4J35A 1QDSA 4JTAA 3VOCA 5G2HA 3L0NA 3G22A 5DMNA 3QY6A 3V7PA 3A13A 3L4YA 2VQTA 1UR2A 1GJWA 1XL9A 2C8NA 1UJQA 3QRHA 3ATYA 2X0SA 2ZX7A 5D2XA 4MKNA 4UTLA 3WK0A 3KOFA 1W5OA 1KM1A 4PUEA 4K1WA 1ICSA 4AMCA 1TUXA 4E38A 3BH4A 3EX6A 3L4VA 4JYFA 1WXZA 2V68A 3VCRA 3CMFA 3T8QA 2O9TA 1TJPA 3DYMA 1PX4A 1HX0A 2QUUA 4HCLA 3MKVA 3S8HA 5E6ZA 1B1YA 4PC8A 2VRQA 4GI6A 3WUEA 1U1JA 2HEJA 2RJHA 2XM2A 4XKYB 3CYVA 2AGKA 4UFHA 3WMBA 4B5VA 1WCGA 3DESA 4JKMA 4I6VA 5A69A 1IWAA 1R9ZA 8A3HA 3WQPA 2C6QA 2ZKMX 4B16A 4FNTA 3AROA 2W92A 2Z6JA 2PDCA 4I6KA 4GY0A 4AH7A 2PZ0A 3AXMA 1H7XA 1V3JA 3N14A 1KFLA 5D2WA 2HRWA 5B7YA 1UA3A 4HIBA 1EP1A 1BSIA 3B0VC 4ZA0A 1GOOA 4C5YA 1OJXA 1TCDA 1WDSA 1QO2A 4TQTA 3RLHA 2RDXA 1SW3A 3CEUA 3EB3A 3Q65A 3QVQA 1ADOA 3NSXA 2PE4A 3VNIA 3C2EA 2IKJA 4MVAA 3UR5A 4JN6A 3QPEA 4UQEA 1BG9A 3W1PA 3ZWTA 3AHVA 4EXBA 4BQ5A 1YADA 5KTLA 1OCQA 4HTYA 1QNSA 2AOSA 3GDMA 2VFEA 1V6XA 3PZQA 3FV9A 5CGQA 2HS6A 1M53A 3ARUA 4ASTA 1MUWA 1XYFA 3SCRA 4US5D 1FWBC 3M07A 3UXKA 1OIFA 1HJXA 1SW7A 3R13A 1CXIA 2WVVB 3ZM8A 3AIUA 2Y85A 4CCDA 1K9DA 1OFQA 1L8PA 3NPXA 1OFOA 2VEFA 4GQQA 1H0IA 3Q67A 5K7JA 2ZRYA 1UW9A 2J7DA 1E9LA 3DIPA 5CEWA 3MUAA 4RW3A 3DECA 3FHQA 4NJHA 1X1OA 3IUIA 5D02A 3R12A 1XIEA 1T0OA 5D2YA 3R6IA 4GACA 3MMTA 5LHFA 1XXXA 3WUFA 2Q02A 1VFUA 1JL8A 1KWGA 5A2CA 2ASHA 1IXPA 4GC4A 1W1PA 4Q4PA 3AYTA 1O95A 3VNMA 3WJYA 4ZOEA 5EMJA 5CC3A 2BOFX 2OTDA 1IT0A 5HNTA 1TZ7A 3L9CA 2IPGA 3PJXA 3KS5A 5CSUA 5I07A 3B0UX 1A4LA 3C2RA 1IIGA 1ADSA 2VC6A 1FTXA 1QFEA 3BAIA 2BBFA 3SRKA 3P2VA 1XLAA 4DHGA 5BRQA 3REQB 1E4NA 3FY1A 1CXEA 2NWSA 4FNQA 1ODUA 3KHDA 5LIYX 2ZE0A 1W1ZA 2W3ZA 3GFZA 4JIHA 4A35A 3R79A 1XC6A 1M68A 4Y2WA 4JTSA 4PTWA 1KBIA 8RUCA 1HZYA 3VM7A 3LG3A 2Y6ZA 3S2LA 4LAUA 4DYKA 3W7KA 4D6DA 4FIQA 3OB8A 4DI9A 3FYPA 4AAJA 3THCA 1K8YA 4JTTA 1LLZA 3O9NA 3F2CA 1EYWA 1CNVA 2O55A 2C13A 4L7ZA 1VFLA 2O56A 2NVCA 3HO8A 4KWOA 3BAXA 2CHNA 1A0CA 3VC5A 3W2LA 1UMLA 3STFA 5HPOA 4PCSA 3W4RA 4YNGA 1PZ2A 4FX6M 1NF7A 2WQPA 5DXYA 1UD5A 5I09A 3I3EA 5IFTA 3VFLA 3QZEA 3I3BA 1V6UA 3BURA 3PFMA 2R24A 3DC0A 2OX4A 4O17A 3I10A 2FDMA 4RNFA 4IQDA 1ZPTA 5EYWA 3MSDA 4IFOA 2DU2A 3IANA 4FX8A 2VP8A 3O3RA 2Z1SA 4PBFA 3GNDA 1CLKA 2H3DA 3N73A 1PO9A 3UXAA 3RF9A 3BLFA 3HPXA 4EACA 1PIGA 1NOUA 1TPWA 3K1DA 4RKAA 3N34A 4UFMA 4JQAA 2WMKA 1XICA 4J3UA 3W6MA 1M04A 4DF1A 4ATDA 1IEVA 4A8NA 2WBKA 1H7RA 4NAEA 4FHAA 1LLWA 1L6GA 4BEQA 1JFXA 4MZ8A 3KBWA 6A3HA 1DQXA 2V2DA 1ML1A 2Y89A 2WMGA 2DQWA 2YJQA 1KNWA 2WCAA 5HWMA 3W38A 5E1QA 1EPXA 2TODA 2XPKA 2ZXDA 3WBAA 1S5TA 3TN4A 3NVDA 2V6AA 2ZIDA 4JTRA 2P5NA 3FEMA 1TTIA 1H0GA 1JCJA 3S1WA 2QW5A 1GVIA 3VNDA 3V1HA 1W1YA 3AZRA 3HM7A 4WOZA 3LD5A 1E9IA 1Q63A 2YW3A 3MTWA 3BAKA 3AHZA 3TDFA 3VNZA 4I9MA 1XLIA 3RCMA 1Q4WA 2WZEA 2QUMA 4DUVA 4QRNA 1A5SA 1XYBA 1XINA 4UC5A 6XIAA 3CUFA 1VEMA 1SGJA 4L1GA 3PFRA 4UFJA 3W73A 2R1LA 2JE8A 6REQB 1XBZA 5JIPA 1S38A 2WKGA 1JGIA 2DZAA 1BPLB 3C3NA 3WLPA 5I3KA 4YTRA 4QJ3B 1SJDA 3VIMA 1W9BM 2FQIA 3M7WA 1GVFA 4JEQA 1XX1A 1Q6OA 4PN2A 1ZNNA 4RJEA 3BW4A 4DBUA 3CJPA 1OK6A 4UMAA 5BCAA 2VT0A 2V38A 4PMJA 1EO7A 2BY3A 5GQBA 3S2JA 5LGZA 2ZYFA 3SCPA 3NSNA 4M6PA 5KZEA 1NF0A 4HU4A 4WOQA 5C2GA 3U57A 2BHYA 5KEZA 1CXLA 3VKBA 2G3MA 3CQJA 3E0LA 3L23A 1U5JA 4I7UA 4H8NA 4F40A 4O14A 1DXEA 3O6CA 4HCHA 1OX4B 3GZ3A 3I6EA 4MY1A 2ZUMA 4LF1A 3IUHA 1EJRC 3LCXA 1JZ4A 1VYRA 4C90A 4C1LA 1JYVA 3TWBA 4QBXA 5KITA 1WKEA 5BU6A 4R34A 3UR2A 4IL0A 1TMQA 1HO4A 1AK5A 1V0LA 4MWAA 3HPSA 4M6UA 4HU3A 3M7SA 1V77A 2BVDA 3E5BA 3CUZA 2WC4A 4B92A 4YXGA 1T96A 5ABGA 5AECA 5DCDA 1B5TA 3EDFA 1R87A 4W5ZA 1N82A 4B91A 2OGYA 3RJYA 4ZENA 3FYOA 1AJ0A 5HUPA 2H9AB 3PVFA 4TU1A 3HV8A 3KBNA 3NYDA 3LBCA 4LF2A 1IWBA 2VGBA 4JTGA 5K9XA 1O7AA 2A3LA 2VR5A 2FMOA 3HMJG 1NIUA 1LZOA 1DE5A 5EL1A 3LHYA 1PTGA 3B8TA 3EB2A 4GE8A 5C70A 3QC3A 3WJWA 4RZBA 2DJLA 4KWUA 2EG8A 3TSBA 1LLOA 3C8FA 1GKRA 3MI3A 3ID7A 2OX1A 2EF9A 1UZ4A 3UP8A 1BSLA 1W1B1 4J28A 3QHMA 4J40A 4GGHA 3E38A 3BGJA 1VRDA 2QCDB 4ZFCA 1UBSA 5FJJA 4ZSTA 3HQ1A 3VD5A 2PDUA 3L4WA 2BS9A 1JAKA 1FHDA 3D0CA 3SN1A 1HW6A 4A21A 5C9XA 1FCQA 5CPTA 3K5XA 1PYMA 4W84A 1WQ5A 2XN2A 1TVNA 3EA1A 2P1FA 4PUDA 2FPYA 1B3XA 3WSUA 2G4JA 4O1AA 3QR3A 4PEKA 1BD0A 2NV9A 2DUAA 3BCDA 1KRBC 2PAJA 1FHVA 4OT7A 1XIGA 1UQZA 2ZVIA 4IPLA 3KVLA 4WSKA 3GXDA 1GVYA 1CT5A 4E4PA 3WD1A 1XDMA 3I65A 1US3A 2A3CA 5LXXA 1V7AA 1VFOA 4B2DA 1T8XA 1ZALA 4LAMA 1P6CA 4ZOCA 4FNSA 2VD8A 4Q4RA 1HVXA 5HJXA 2IS7A 3CPRA 1M7XA 3TJIA 6CGTA 1VAHA 5LHEA 4GCXA 1PHQA 4Z0SA 1H62A 1MYRA 3C2VA 4GYPA 4N7QA 7TAAA 4MB1A 4J5NA 2WAGA 2CBVA 1QOXA 1BTCA 5EBUA 4IG2B 1MXGA 2H6RA 3T9PA 4DF0A 2QCEA 2GQAA 3CWOX 3RXZA 4V1YA 4QROA 5CGMA 4O13A 4F0MA 3S46A 3MPGA 3MUY1 3H7RA 1JCNA 2CLKA 3H2AA 4AD5A 2DZVA 5G1TA 3WJSA 2AKZA 3IEBA 1YQ2A 3SGGA 3SIMA 1E3XA 2J9ZA 3HG5A 4M6VA 1NFBA 2YDQA 4HJWA 2OT0A 4LUYA 3W7DA 3TYZA 2YCLB 1RBAA 1DQUA 5XINA 4CNOA 5HMSA 1I60A 2CU0A 3DHFA 4RZ4A 1VLWA 2ESCA 3GG1A 3M0MA 3KEHA 1A5CA 3MBDA 4YS1A 2FZ8A 2Q01A 1NDYA 4Z2HA 3EBVA 1RV8A 3VK5A 5AC5A 1X7FA 1DJXA 1ZHAA 1CXKA 4HMEA 1TPUA 1FA2A 3STCA 3RRXA 4HOWA 5JUVA 3ITTA 2PRHA 4E0CA 5BOFA 1E3ZA 2OSXA 1E0XA 2F9RA 5H2ZA 4KEVA 3CZKA 2FVLA 1NSJA 1ELSA 1PCWA 2C1GA 3QLDA 3BLLA 4NX0A 4CD4A 1P7TB 2NQ5A 4UOJA 2I1OA 3V0UA 2DH2A 1W91A 1UC5A 4WY0B 4GABA 1EDTA 3BZJA 4D6IA 1TG7A 4H6QA 4I9TA 4QQUA 4BZYA 5GNYA 4ZR8A 3KOYA 1EEXA 3RPTA 1LRQA 3N18A 4GQGA 5E0KA 2J79A 3LDVA 3FKKA 4ZZ9A 3DG3A 5CZ0A 1ME7A 1ZP3A 2GFTA 4ZXOA 3KLLA 3TKFA 2ZZ3A 1UD8A 2FTYA 3W53A 1QK2A 2AL2B 4RR4A 3M0VA 3PB2A 3AS1A 4HHPA 3UGRA 4JQ1A 4ACYA 1K4HA 2XYLA 1TVLA 3CYJA 1DYSA 5CJNA 4OBTA 1IZJA 1I2NA 4NF7A 4FF5A 1L6SA 3NO3A 4TVUA 4LUSA 3FYYA 3WN6A 1VBRA 3KCOA 3QEZA 2OO0A 1ONRA 3M1ZA 4OUEA 3B40A 1KXHA 2E67A 4JOMA 4NJGA 2DVTA 2GOKA 1G4TA 3ITOA 3F4VA 4JX6A 4MKSA 2OPJA 1JYXA 4L56A 3WH9A 3G8EA 1KGWA 1TZZA 4M7SA 4HMNA 3C4UA 3A3XA 1M3UA 1AVAA 1Y5VA 4L4LA 2VXNA 3EX1A 4KWVA 4E8CA 1C93A 3A21A 3PHAA 4JYEA 2RDUA 2BTMA 1Z41A 2J9XA 3NZRA 4R88A 3P82A 4NZCA 3TMQA 3BJFA 4AW7A 2GSHA 1W2PA 3VD3A 1VHCA 3VOHA 1OFPA 2FZBA 3GUWA 4JHOA 4IGNA 3N3MA 4O52A 2VCCA 2EG7A 4QGCA 4Q4QA 4JHMA 5A8PA 1XISA 1AW5A 4OOZA 4KCTA 3V16A 5A8OA 2Y8VA 3WLIA 2F6XA 4UB9A 5B80A 3IJ7A 3O6YX 1WXJA 4XD3A 2Z27A 1XH2A 1P48A 4EPKA 1B3OA 4JY9A 3BLPX 4JFTA 1XSKA 3STGA 3U2OA 4PH6A 4MGGA 4QSHA 3R7MA 3TNOA 1E40A 2WHMA 2QHAA 1SZFA 2O9OA 4L6DA 1SQ7A 1VFHA 2CNCA 4JHZA 2PCQA 4JIIX 3TTOA 1CBGA 3I4KA 5EA9A 2WMIA 1A5BA 8CGTA 2HNEA 4KCWA 4RNIA 3PWGA 5F2LA 5CKSA 4GI4A 2QAFA 4N9BA 3ABQA 1QT1A 1P5BA 2XZ7A 1E9YB 1RVGA 1HP5A 1NY1A 2Z25A 3PPFA 1IV8A 4AUBA 4GH3A 9RUBA 1RA5A 1VJZA 1QI3A 3GYCA 3V5FA 4PMYA 3BUVA 5AY7A 3ZT7A 2E28A 4PGLA 4CN6A 5A6BA 3M0ZA 3GFXA 1AMKA 2F6KA 1SSGA 3ZZ1A 1RA0A 1BFNA 1Z42A 3LM3A 4PUNA 3CUJA 3LGDA 3TN5A 1H50A 3BCJA 1IEWA 2Z26A 2Y8UA 1Z8AA 4QG6A 5A2BA 4BS0A 2QF8A 2NUYA 3OVRA 2ACSA 3GH5A 2HK0A 2CPUA 5E0FA 3N29A 4B5SA 1UKOA 1UMYA 2ADAA 2CHRA 3VMNA 4CQ8A 5ABTA 6PTDA 4KEUA 2GJXB 2REQB 4C6JA 1VR6A 1OVDA 1V0NA 1UKPA 3SY5A 4Q4SA 4R85A 5EMUA 1GW1A 5CPQA 3GRIA 3EOEA 3UCQA 3IK4A 2G41A 3B04A 1JCXA 1XR2A 2YA0A 3GC5A 4H2CA 4YVPA 3OZMA 3EXSA 3TVAA 4MLRA 1KFEA 4JIQA 1Z6KA 1O4UA 4O15A 3JUGA 5TAOA 3SGZA 4OBSA 3ARXA 1EL3A 1TJ0A 3GM8A 1TMLA 1V03A 2WNNA 4GINA 1O12A 2VNCA 4HMDA 3WL1A 5D09A 3PS7A 2VEGA 4QLKA 3A6OA 1T41A 1QI4A 1MEHA 2GJXA 2I56A 3IGXA 2FMNA 1K9EA 2I57A 2I9UA 3AJXA 3C0SA 3PG8A 3OHIA 1EUNA 4LC8A 2HPMA 3OW1A 1SW0A 1XRVA 3Q45A 4GO9A 4UQ9A 4HHMA 4K37A 1HKWA 2Q8ZA 2PWDA 3TW7A 1E6RA 4HPJA 1JDCA 3GVQA 4EXAA 4QDMA 3EOLA 1VYPX 1MSSA 1ITUA 3WX7A 1FOBA 2HDJA 3LBMA 4QX4A 4QM1A 3PN8A 4ZO8A 1BKHA 1GGOA 1FH7A 1BQGA 4OE7A 3VOFA 1R5YA 4AWUA 3IWPA 3TYEA 1WZAA 1RPKA 3S5SA 4XO6A 3LOTA 5DBUA 3M5VA 4DWSB 3VDBA 4KCUA 3AIQA 1TCMA 2KZHA 1X39A 2V67A 4KS0A 2QYGA 5H6HA 1B9BA 3QJAA 4LYQA 1T8QA 1J0ZA 2B81A 2Z29A 2B7QA 2A0NA 3WLSA 2ISWA 5CPLA 2VWSA 1JI1A 1E4LA 4LGXA 3GR7A 4NNBA 4CVWA 2WJFA 4W4QA 4X2RA 3TA6A 3S5YA 3CV6A 1ZBVA 2BY1A 2QJIA 4M29A 3HBLA 5HMDA 1V6TA 1YX1A 1YDNA 1GZ1A 3ECQA 4M6QA 2HQAA 5F1UA 4WLCA 4NY2A 2DW7A 3FA5A 2FVKA 3U7BA 2CLIA 4NUWA 1EC7A 2J7HA 4B4HA 3WMSA 5AHLA 1R3VA 3K8LA 5D37A 2QZRA 3HQPA 3QY7A 5BYWA 4RX0A 4B5TA 4J3SA 3PWAA 1YNYA 2CBJA 4JTJA 4H41A 1JF6A 2GGHA 4MUPA 4Q7IA 2A85A 3ZSTA 1IR1A 3G1XA 4WY0A 1GOWA 3TJXA 3U7VA 3R43A 2MUCA 3VXGA 2QCMA 1L2UA 1FXQA 1YKWA 2G97A 4M81A 4L4PA 4HD5A 1L6WA 2CYGA 5K9DA 1VCGA 1W6TA 3AJ7A 2EGZA 4KRUA 3KTSA 3VD4A 4V15A 1F9CA 5LNUA 3G1RA 3QQWA 3G0SA 1ZY9A 5DCBA 5CC6A 2I17A 1EXBA 4R53A 4ACZA 5F2GA 4Y7EA 3E0FA 5CH9A 3ZJ8A 3GC2A 1X96A 4FZIA 1V3IA 5E9AA 4MPQA 1YDVA 2CKRA 3IRDA 4E5TA 1K8CA 3NR0A 3UY8A 4IWWA 4JL1A 2E8YA 3UZXA 3WQ5A 1N2VA 4ZEPA 5DRIA 1PZ1A 2B7OA 3NQVA 2J7GA 5U7SA 4S38A 1VIWA 3ZMRA 4S3DA 5I77A 2ALRA 3S6OA 1AUSL 2WNWA 1E6QM 2PLJA 2Y5EA 1SYTA 1I75A 4HGXA 4DELA 5EMYA 3NZ1A 2VC9A 4MY9A 3EWUA 4O8RA 2XSBA 3IS4A 3OLDA 3RLGA 3M0LA 5DMLA 3G2GA 2YPIA 1OFAA 1E1CB 2VFFA 1QK0A 4UQBA 1RALA 2GSEA 2QIWA 2JEPA 1DORA 1SO6A 3CQHA 2OMAA 4O4WA 2R1KA 1ICQA 3DKJA 4HSNA 5KZ6A 4JIRA 4N9EA 2PURA 2QCCA 2ACRA 1W3NA 1BXCA 5AHNA 4GRSA 4K2SA 4Z1CA 2PTYA 3MP5A 5C54A 1VEOA 1KFWA 3KZSA 3R4IA 5CPSA 1JVNA 3A4JA 4R7OA 4P8WA 2Y7GA 3VGEA 3LHTA 2XFWA 5K4ZA 1C7TA 3HG4A 1EJUC 4PMUA 5AFDA 1XG4A 2VHLA 3QFEA 4BQ2A 3LPGA 3PBMA 4WZHA 5DF0A 3PANA 5LA2A 2Z00A 3AMKA 5BMWA 2BOEX 2ALDA 4RLIA 4LNCA 4PMNA 5M17A 3WFZA 3AYVA 5IHRA 2ZC8A 3BGAA 3SCUA 1C8VA 4BI7A 1KBLA 3S5ZA 4GXMA 2YXXA 3EB4A 4XIMA 5BXPA 3AISA 4QJ5B 1R30A 1K8ZA 1JF5A 3H2OA 4LV4A 5AHEA 5BW6A 4LUJA 4WKAA 5GJMA 1U2YA 2WC3A 3E49A 3SADA 1KD0A 5ABEA 2EPKX 2C18A 4PRWA 3QY8A 2PWFA 4UMBA 2Y24A 4E6MA 2VDHA 3CU2A 4AF0B 4Z0JA 5HDRA 1I45A 1LOSA 2Y62A 3TK7A 1XP3A 1JXKA 1YYAA 2ZTKA 2X1S