3U0HA

The structure of a xylose isomerase domain protein from alicyclobacillus acidocaldarius subsp. acidocaldarius.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
279
structure length
279
Chain Sequence
AMEPCLHPTLVDETSLVLYLDLARETGYRYVDVPFHWLEAEAERHGDAAVEAMFQRRGLVLANLGLPLNLYDSEPVFLRELSLLPDRARLCARLGARSVTAFLWPSMDEEPVRYISQLARRIRQVAVELLPLGMRVGLEYVGPHHLRHRRYPFVQSLADLKTFWEAIGAPNVGALVDSYHWYTAGEHEDDLAQLPPEKVVYVHINDTRDAPEDAHDGKRLLPGDGRIPLVPFLRGLYLAGYRGPVAAEVLHETPLDGTGESRARLVRERLEKLIALAKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylose isomerase domain protein
publication title The Structure of a Xylose Isomerase domain protein from Alicyclobacillus acidocaldarius subsp. acidocaldarius.
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
molecule tags Isomerase
total genus 104
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3u0hA00
1XIGA 4HGXA 1A0DA 3BZJA 4YTSA 4YTQA 5AVHA 2HK1A 2XISA 4EAYA 3DX5A 1XLMA 3M0VA 5EMMA 3CNYA 4YTRA 2I56A 1BXCA 3QXBA 6XIMA 2X7WA 4A8IA 4YTUA 4QE1A 3XINA 4GQBA 2GYIA 4G56A 1D8WA 1DE6A 1K77A 3VNLA 1XIBA 4Q7IA 3KBJA 4X60A 4QE4A 3AYVA 5B7YA 1XIHA 2ZDSA 1DE5A 4GJIA 5C9ZA 3ITXA 5FA5A 1XYAA 1XISA 3CQHA 3IUIA 4YTTA 1XLFA 3KCOA 4OVXA 3U3HA 1CLKA 1QT1A 3IUHA 4QEEA 3P14A 2GVEA 3QZAA 4X63A 3KWSA 3ITOA 4XSLA 5H6HA 9XIMA 4QEHA 4LNCA 2QW5A 3FVMA 3QYSA 1XLKA 8XIAA 1DXIA 1A0EA 1XYMA 4ZB5A 3ITVA 4K3ZA 1I60A 3M0YA 3UVAA 2GUBA 1XYLA 4GJJA 3KBVA 1XYBA 2GLKA 3TC3A 2XINA 5XIAA 5B7ZA 1XLGA 3C0QA 1XIEA 8XIMA 2QUNA 3N4AA 2XIMA 4ZB2A 1XLHA 3XIMA 5EMLA 4QE5A 4K1GA 3ITYA 1XLEA 2J6VA 3C0LA 3M0XA 3WQOA 4GLEA 5B80A 3AYTA 3LMZA 2ZVRA 3VNJA 3CQIA 2HK0A 3KTCA 1XYCA 1A0CA 4HHMA 2HCVA 4W4QA 1O1HA 9XIAA 1XIDA 1GW9A 2NQHA 3VNKA 3VNMA 4J4KA 3BANA 3KBSA 3KCLA 3P6LA 3VYLA 5EMKA 1S5NA 2G0WA 1OADA 1XIFA 4PGLA 3BZGA 3XISA 3BWWA 3M0LA 3UA4A 4A8LA 3CQKA 3KBWA 4XIMA 1XLAA 3L23A 1QUMA 4XISA 4XKMA 4EACA 4DUOA 2OU4A 1XINA 3UU0A 1XLLA 3QC0A 4HHLA 3OBEA 5J8LA 1XLBA 3UXIA 3DBNA 1TZ9A 5EMJA 3ITTA 3ITLA 1XIMA 4ZB0A 3GNXA 1YX1A 3TVAA 6XIAA 4HNOA 5H1WA 2NQJA 1S5MA 4US6A 4QDWA 5I7GA 4A8RA 1DIEA 4KW2A 3KCJA 1XLJA 5XIMA 4XIAA 4QDPA 3UA3A 4ZBCA 1XLCA 3CQJA 1QTWA 2QULA 3KBNA 4E3VA 2G4JA 3C0SA 4DVOA 3U0HA 5TNVA 1DIDA 1XP3A 2Q02A 3AALA 3KBMA 1BXBA 1MUWA 3M0MA 4A8NA 1XLDA 1XLIA 5AVNA 1XICA 4XSMA 1XIJA 1MNZA 1I6NA 3AAMA 3IUDA 2QUMA 3M0HA 3NGFA 3VNIA 3JU2A 3CWHA 2I57A 2X7VA 3BDKA 7XIMA 4X61A 4PFHA 1XIIA 2NQ9A 5XINA
chains in the Genus database with same CATH superfamily
3EX2A 3TTQA 9CGTA 3OVQA 1BVWA 1HJWA 4QS6A 1DJYA 3UZWA 5I3KA 3AYRA 2X7WA 4HNTA 4R7JA 4UTMA 2GGHA 4XG1A 3KP1A 1H2JA 4FOKA 4UQAA 1VYRA 2GDUA 4JTLA 3AIBA 2OSWA 1A0EA 1BSLA 1ZTVA 5EGRA 5AHMA 2G95A 1A5OC 4Q8QA 3RLUA 3SR7A 3G1XA 2UY2A 1F5ZA 1BFNA 4C1LA 3OGVA 3GDKA 4J7RA 2ZTKA 4IICA 1OX5A 1B3VA 2PGFA 4P5UA 5F4SA 2PFHA 4HCHA 3GX9A 3BANA 2ICSA 3FYOA 3VUPA 4AY1A 1V3LA 1CGYA 4WZHA 3V0TA 3H2AA 2HRWA 2R1MA 5H8UA 2BGSA 1J0IA 4KGLA 4YCOA 4AHOA 3UR2A 5FOOA 2F6UA 2OG9A 3BGAA 4C6EA 4NZ3A 1GVQA 2J78A 1BYBA 1M41A 4FOUA 2QXWA 2QYGA 4N9DA 4S3DA 5DT5A 1ZB5A 4OIFA 1W5NA 2BHYA 4PSRA 4W8LA 4WKHA 4E3VA 3VILA 5DCEA 3APGA 4A8NA 5AC4A 1HKIA 1EO7A 3GE7A 5A3HA 1JDFA 1PPIA 2YXGA 4WGHA 1YRRA 5AHNA 4MYXA 2A3HA 2OX4A 5LGZA 3H4XA 3PBWA 4UNKA 5KINA 4LVFA 4L64A 3SFKA 4DZHA 3S46A 4FNTA 3S5NA 2OOGA 1WDDA 2C15A 4PRRA 4CU7A 2Z2BA 2ZZ1A 4RZ5A 3E0VA 1NVMA 5AC5A 4GJIA 1K70A 3G0SA 3C3UA 2XVNA 3QGKC 5KMYA 3AJ7A 3BG3A 5DQPA 4IQDA 3W82A 5HJYA 2B7OA 2BY3A 2WQDA 3MZ2A 1LRTA 4AC1X 4S2BA 1W3TA 2GUBA 4GJJA 2G97A 4WLCA 1P5BA 4IHCA 3NL6A 5CSRA 1CGUA 1Q2SA 4G7FA 3EYPA 3NO5A 3S9IA 4GINA 2NSXA 1K02A 2RHGA 3U57A 2HISA 1O5XA 3VUSA 4XIMA 2QPUA 3IARA 3ZMRA 4O53A 4S1FA 1CT5A 1KW1A 2Q8LA 1ISWA 4Z1BA 3G77A 3L0KA 4XB3A 1UG6A 2IXUA 5D8WA 3VKAA 1E6XM 3VCNA 2QULA 2BODX 2Z1WA 3WH9A 1W9BM 5AYZA 3WLLA 1V0MA 3CZ8A 3O05A 4TIMA 3GKAA 3RPMA 4IMDA 4NSBA 4BQ4A 1XBXA 2IPJA 5GJNA 3GC5A 1X98A 5AVHA 4JAWA 1J79A 1VJZA 3ABRA 5HATA 1UWQA 4C5ZA 4RE4A 4A3QA 3BK0A 5LNSA 3P8IA 4AVNA 3F4DA 1BG4A 4MB5A 1GORA 3KWSA 3UPBA 4MY9A 3CM4A 4KCVA 3LCFA 4TX6A 2C6QA 2R94A 2WW5A 3EKGA 5HQMA 4AU0A 5IXEA 1ZZMA 4YCPA 2QAFA 2PWGA 3HJZA 3SCQA 3ZJKA 2C19A 3DHUA 4IUGA 4E8CA 2C0HA 1O1HA 3TLQA 1E1EA 3VKJA 4NYUA 1MQQA 5IHRA 1FFQA 3TYDA 1H7NA 3S2JA 3WLOA 2P88A 3M1ZA 4ICNA 2SFPA 1SZNA 4DYKA 4LUSA 1TIMA 2Y5SA 4XO6A 3TX9A 1SZRA 1X38A 2V5LA 2Z29A 5D32A 1KBKA 1EFZA 3EWXA 2P0OA 1ODUA 4C65A 1TPDA 2D2HA 3LBMA 2O4QA 3HB9A 4JXCA 4UQDA 1YADA 4O1DA 3W74A 3VIJA 3OZYA 5KZEA 2J74A 1VPQA 4DIAA 1VEPA 3OB8A 4QJ1A 5CPNA 4LQ1A 3KOZA 3W1XA 4IIGA 3CUXA 3GAYA 4H41A 4N4PA 3WLRA 5JIPA 1JZ3A 3URAA 3ZSTA 4LFYA 2P3ZA 3T0CA 3SAZA 3Q4DA 1Y7VA 3UPWA 3EA1A 2V5DA 4XBSA 4E3TA 4M56A 9RUBA 2NQLA 4Q7NA 4GY1A 4GCAA 3KTXA 3PUDA 1CYGA 4HCLA 1G5AA 4QISA 2WSPA 4RZ6A 1ADOA 1J11A 1Y5WA 3BQ6A 5LZLA 1RQEA 1L6FA 5MKGB 3HV9A 2PWDA 2VCCA 3LMZA 1IT7A 1FWEC 3BJFA 4F9JA 1EZ2A 1SJAA 2OEKA 3GLCA 3I6TA 2XWDA 1ICPA 2OMAA 2A7RA 5HNTA 2D0HA 2QCLA 2P0IA 4NNBA 1XKJA 3PZNA 3BLFA 4ZO9A 4GO9A 4UTIA 3GVWA 2BVYA 3V35A 2G3MA 2RDTA 3TSMA 3BSMA 3E49A 1QTWA 3WMCA 1G4EA 4LAMA 3AALA 2Z27A 3UG5A 2NV2A 4KWVA 2H8ZA 3TKFA 3WLKX 3WJYA 4EPEC 4ZQOA 3HBLA 3NQFA 1RVKA 3WD3A 5HPCA 3WQ4A 4YTQA 1XGZA 4XZMX 4I9AA 2BV9A 1OFPA 4H6EA 3MI2A 4M80A 3ARTA 1A47A 1A5CA 1HX0A 2EBNA 4Q8MA 4GYKA 1UR2A 1UP3A 2JEPA 4WJ8A 1TWDA 4DJDD 1ZCOA 4Z2LA 3WF1A 4C6DA 1LQ2A 4R27A 3IRSA 2OJPA 3H2MA 4UBPC 3VIMA 2JKPA 3LLDA 1GT8A 4GHRA 3NYZA 1ZCCA 3MO7A 5C70A 2ABBA 2CBVA 2XZ9A 3UZYA 1E4IA 4RUBA 3WL0A 4GJ1A 4QDMA 3VA8A 4PTXA 4PEKA 5HAOA 5I3GA 1BSIA 3DZ1A 4LUYA 1THFD 3N6QA 4JYDA 1QI2A 3AC0A 2EG6A 4W9TA 2D20A 2OYMA 4Z2HA 4UIOA 1L0PA 3AYSA 3NQCA 1K9DA 1TPEA 2EPKX 2ZX8A 4NX0A 1PZ3A 2ZZ2A 2VC7A 4LCQA 1D3CA 4Z42C 1LLWA 2XIOA 4ADTA 4DYEA 1P4CA 4FLOA 5GJMA 1NOWA 5CG0A 1DWJM 1PTGA 5F7UA 4PBFA 3KBNA 2GSJA 3VCRA 4C6KA 2V68A 1DJGA 1TPUA 3UR8A 1W5MA 4AD0A 3Q94A 3KZSA 4DNMA 3WBEA 4AHPA 1QXLA 4D6EA 1XFBA 3TUUA 3DU0A 1KD0A 4IG2A 1XRSA 2J9XA 3FHAA 5D2XA 3QSRA 1W1IE 1CZ1A 1ICQA 5HNRA 5M2FX 3GFYA 3VM5A 2ZDSA 3RPDA 1BF6A 1SGJA 2WC4A 3AU2A 4ONVA 4AX7A 4DRSA 2C1HA 4MB4A 3CXOA 1TVLA 3EKLA 3FGCA 2DZWA 2YCEA 1PKLA 5CZ0A 1IGWA 3W0KA 2GVYA 2VUNA 2UY4A 3UXAA 5T91A 1OGSA 2VDGA 5DX7A 3VGDA 1WUFA 4K38A 3PANA 5CSUA 1FCVA 1HKKA 1S5TA 4ZTXA 4JOMA 2XSBA 4AY7A 1QHZA 4C6BA 2ZZ7A 3LENA 4F4RA 1MRAA 4CNUA 4NASA 1RAKA 5DCBA 2PS2A 3WQ5A 4CQCA 4POCA 4JIPA 2PGRA 2TAAA 4DJED 1OG6A 1ZJHA 3OP2A 4WY0A 1IF2A 4NILA 4LAKA 4PULA 3NDZA 5XIMA 3SN1A 3OG2A 1US0A 1Z89A 1JD7A 1G94A 4W7WA 1MEIA 4PB4A 3VNDA 3MUAA 1XHGA 4WXZA 3AHXA 1BRLA 3ZO9A 2X1SA 3W25A 3HQPA 1P0DA 3KRSA 3G1AA 5FJTA 7TAAA 3VI2A 2YJQA 1OC6A 1TWIA 2EO7A 3HPSA 3QLLA 4L4MA 1IZKA 4RNJA 4HTBA 1IT0A 1JYXA 4LYPA 1GCYA 4KEUA 1PHWA 3EXSA 1U5JA 1JZ8A 5LIWX 3BOLA 1TZ7A 3I3BA 1OQFA 4QEEA 1R3SA 2I9UA 1RV8A 3O16A 2YL6A 2EKCA 5AHFA 4EXBA 1GVEA 4EE9A 3C0QA 4L65A 4L6OA 2I7GA 3FAXA 3PWGA 4X2PA 1CXLA 3FA4A 3IV3A 1NIUA 3NWRA 3EDDA 3QMTA 3A9BA 1CCWB 4GISA 4MWAD 4EANA 2QIWA 3WH6A 4D6FA 1LM1A 2PUZA 3BLLA 5CPLA 3S1XA 4LV4A 3PWAA 4CUCA 3OZMA 1TE6A 3ZT7A 3DESA 1LF1A 1MUWA 4ADSA 2AGKA 3N6JA 4FLSA 4XV0A 3VDBA 1NOFA 1G4TA 5CBIA 2NQ9A 3W00A 4F66A 1TV5A 2AOSA 2HDJA 3VMPA 3CLWA 3HPFA 4GXMA 1F07A 5B7YA 5U7SA 1XW8A 4QNWA 3S2LA 2H9AA 3TSDA 3LXBA 4GUGA 2J6XA 3DG3A 1G0CA 4QGCA 1I60A 1SO3A 2ZUMA 3MQTA 1H7OA 4CU8A 2P76A 3AFBA 4AZ7A 3R6IA 4IMCA 3PTQA 3DI1A 2DUAA 1XSKA 4W7UA 4LUSB 1UH4A 1WQ5A 4EAMA 3P6LA 3NQDA 2PWUA 4TMBA 4UTJA 4W87A 3ORWA 4DM2A 4ES4A 1J10A 1UKPA 3GHRA 1CECA 4FAMA 1EYEA 2EHHA 3V4BA 4NKCA 4MYAA 1VF8A 2V38A 3B4YA 3DC8A 4FXRA 4UMBA 3ELFA 1T0OA 1VR6A 4MDOA 1MZHA 2VXNA 2DPEA 5FJJA 4CVUA 1ZENA 1HJUA 3TTOA 5LHEA 4XD3A 3VABA 5KZ6A 4HZMA 1WZMA 4UTHA 1LORA 3N29A 4MLJA 4DI8A 1DXFA 2GUUA 3BZJA 4A3YA 1EX5A 4A2RA 4PE8A 1KFCA 2AL1A 2Y89A 2CLFA 2HPIA 4AVFA 1JCXA 1FKXA 2XIJA 4Z0SA 3ZS4A 3OBKA 3CQHA 3VVGA 1XL9A 4LXFA 4S3KA 2HV5A 4UQEA 1SO5A 3VC5A 3T0AA 3PSWA 1FWJC 4XVEA 4S3FA 5FSDC 4MFDA 4PL2A 2VRKA 1RBOB 5I07A 3MU7A 1DQWA 5CCZA 5A6TC 1UJQA 1AQHA 2H8XA 5LA2A 3A13A 4MOZA 1TMQA 4EXAA 2QV5A 3E9AA 3E0LA 1E6QM 5ABGA 1YDOA 4DYJA 3RU8X 4L7ZA 4JTAA 1KNWA 2DH3A 4TOQA 1QWGA 1JNDA 4AEEA 2PAJA 3AXHA 2DVXA 3O7UA 1ZSXA 4PUKA 4DELA 3GY1A 2QT3A 3OODA 2Y8UA 1TQJA 1R8LA 4G7EA 3W2KA 2PDXA 2YL5A 2QCMA 3TQ0A 4N9CA 2W79A 1B3YA 4GWEA 1BXBA 2XIIA 3RPTA 1PJ9A 1XDLA 3GDMA 1VYPX 3WLHA 3N9RA 3WLMA 1TRIA 3UP8A 3WLNA 3A3WA 3DYMA 4HJFA 2Z28A 1SJCA 3M0JA 3W2MA 1W9PA 1UR0A 4LJ3A 3DX5A 4R34A 2BB0A 2CZ5A 4NZCA 5HMEA 3EB4A 3BSHA 3VGBA 1LDCA 3R58A 4EWJA 3WENA 2XN2A 1E73M 1OZQA 3QV9A 4GKTA 4IGNA 2E25A 4F0HA 2BY2A 2OYKA 3ZT5A 1DYSA 4O8RA 2P8BA 4I9MA 3AS2A 1IV8A 1LT8A 2PF8A 1P0NA 4LB4A 5K9XA 2CBIA 1W31A 3RFAA 1UWRA 2HEJA 4M5PA 4NJHA 4AWSA 1F8MA 5I03A 1U1JA 2DZVA 4J2PA 4UMAA 2YIHA 3DCPA 4K8HA 4R9XA 3KVMA 1RSCA 3G1DA 3GAKA 1LL7A 1ONWA 2V3DA 3WQDA 3PM6A 4LUTB 4GYFA 1GKQA 5EY5A 1X39A 2OU4A 4YN5A 3R8GA 3C2RA 4BEUA 3PUGA 4PTMA 1J18A 2WMKA 3WJZA 4O13A 4N6FA 2CPUA 1A5KC 1HTIA 5FACA 1UW9A 2VTFA 1XX1A 4NXSA 3T6CA 3TYBA 4FNQA 2YCLA 3R12A 3E2RA 4IG2B 2XH0A 1XLDA 2CITA 1XIJA 2POZA 2X16A 3AHVA 4A3UA 3KW3A 2OSYA 3KAOA 4YYFA 1M65A 4Y9MA 2C1IA 5A8GA 5BOOA 1UZ1A 2FFIA 3W76A 1D7KA 3S6DA 3FJLA 3FGCB 3KEHA 1ISYA 2F2KA 3AIWA 5LNRA 3B8UA 3GG0A 1NWUA 3BW4A 2FVMA 2OEJA 1BYDA 3IGHX 3U2EA 4DF2A 4IIDA 1V51A 2O9OA 2C71A 1YBQA 3HU7A 4U31A 1Q6CA 2X1UA 2J7BA 4U3AA 4CU6A 1KO0A 3XIMA 2A3EA 2AMXA 4FEZA 3EOLA 1CXKA 1MRQA 1R2SA 5AFDA 4FOJA 5KITA 3IIXA 5K4ZA 4FX7A 1YTDA 2A1YA 2G3FA 3OHMB 1TA3A 2FMOA 1D9EA 3UVIA 1B31A 3W7HA 1TJRA 3IVSA 4RV8A 3V18A 2P50A 1MXSA 2OWWA 2ZWZA 1BRLB 4TVCA 3CHCA 1TPC1 4DPQA 1XQKA 1QI5A 2D3LA 1SW3A 3TP4A 8CGTA 1FDJA 1DIDA 3ITCA 1S2CA 3W73A 1Q4NX 4W5ZA 2HE5A 2VZUA 4FX8A 3SO7A 1RP8A 1Z42A 5XINA 4C6LA 3WK1A 3W01A 3J7HA 4H9TA 3JZEA 3IGSA 2JEQA 3GR4A 3OU8A 1J9YA 4O19A 1OFBA 4B2DD 2X0YA 2XWEA 2YX0A 4U4MA 3VIIA 5I3DA 2QCFA 2JFEX 1EP2A 1WXZA 3IACA 1VIZA 2Y2WA 2Y7DA 4GC3A 1EDTA 1JQXA 2C7FA 1RPKA 1BAGA 1WX0A 1REQA 4LBSA 1FUYA 4DPPA 3GFZA 1AMYA 4D1JA 2JK2A 1DJQA 1OCNA 2DT1A 5AHEA 2X1IA 4P7QA 1UQZA 1MI3A 3UF9A 4H9YA 1MZRA 2ZRXA 4UXDA 4HN8A 3EGJA 3WF0A 3PAJA 3CV6A 1F9CA 1HJQA 2ZXBA 2QUVA 2Q09A 5K7JA 1SFLA 2H3BA 3IRDA 4H83A 3CAQA 3II1A 4PR4A 4WRHA 3ZLFA 2OLHA 3PNUA 2ZADA 3FDGA 3TQPA 2B7QA 4I9TA 1FWSA 1LL6A 4D6HA 3EMCA 3VPLA 1GOQA 1I0BA 4XO7A 1F6PA 1FWHC 4D72A 2R14A 3WQ8A 4B5SA 4QLKA 3I68A 1YXYA 5IFTA 1SJDA 3BDKA 1EXPA 3UD6A 5ABFA 3H54A 1UD2A 4IL2A 3WNLA 1O5QA 2XM2A 5E93A 1W54A 1R5YA 3W1TA 3VZZA 3AHZA 4DJFD 3CIXA 4O8AA 2QDGA 1R6WA 3MP4A 3B06A 3UGVA 5BMWA 3PN8A 1AH4A 1NAL1 3GG8A 3O6AA 3VAVA 2Y5JA 3IEBA 3NTYA 1FWFC 4ROPA 4FR6A 4KESA 4QJ4B 4GZ7A 4WQ6A 1EYWA 1OFDA 2VCAA 1PCWA 3WH5A 4BF7A 4RE2A 4N6EA 1YDNA 2XVLA 1KV5A 2J7HA 4F9DA 4P61A 3B8TA 2GGEA 3RMEA 3PK7A 4GYPC 4Z2IA 3ABQA 3ES8A 3ARUA 1JCYA 1SJBA 4ACYA 1JR1A 1RALA 3EOSA 1KC7A 3AMKA 3NURA 4CQDA 1IXPA 4MHBA 1S5VA 1W9DM 4MJ4A 4ZL1A 1KRBC 4ACZA 4CD7A 3KCJA 4C1KA 2E1WA 2ZOXA 3U0HA 1XG3A 3AROA 2VC9A 4DO7A 3MYOA 4FK9A 5E9AA 2QUMA 1S2WA 1PZ1A 3R94A 3VD9A 2WC3A 1FWGC 3PG9A 3DDMA 3PZIA 1QASA 1N8IA 1TJPA 4XUGA 3UZXA 4L4LA 3UERA 1MW2A 2D22A 1GQIA 3V0SA 1C8VA 3CO8A 3MHUA 1GK8A 5DO8A 5HWJA 2YBUA 3R11A 4WEVX 2PDJA 2XFFA 2Y70A 3NXLA 3R0DA 5BROA 2TRSA 4CN1A 1H11A 1UYQA 1B3XA 3VNZA 3FEQA 3CZLA 1XKYA 1DHPA 2IKIA 1VFUA 1VBHA 4O16A 3IVUA 3NPXA 1N55A 1P6CA 2JGYA 3CEUA 3PS7A 2Y5EA 5D04C 3NNTA 4BS0A 3VNKA 4IF2A 4MF4A 2RH9A 4H04A 2OQLA 4G7EB 3UEQA 4DHGA 1QFEA 2NVAA 4LU0A 1CWYA 4AY8A 2PBGA 3ABXA 3WNNA 3OHIA 2VUYA 4LF2A 1I45A 4Z2GA 3FA5A 1LTDA 5M1TA 2JQXA 5C9WA 1BWVA 5I79A 1VJSA 4HU8A 3ZXWA 4Z2KA 3M0IA 3KWXA 1G01A 4DUXA 4ROQA 2OELA 3QOMA 4RE0A 1J5SA 1I6NA 3WD4A 1WP6A 3LHYA 4A4AA 1J96A 1QDSA 4HHHA 2WO5A 4BZYA 3W7DA 1R0MA 3RO8A 3T8LA 5CG7A 3APTA 1W5QA 1OX4A 4M7TA 4CQBA 2Y88A 1CGWA 4NZ1A 1T96A 1RH9A 3VMOA 1D8CA 2JKEA 1WOAA 2DSWA 1RK6A 1JCTA 1AL7A 4MADA 1KBLA 3ZQ9A 2QJHA 4JTHA 3F2CA 2VCBA 3I7QA 1S2AA 3CT2A 1EOKA 1LLOA 3VOJA 2CFFA 5A6BA 1EA9C 2V5KA 5FJPA 1EWDA 4GO8A 4C6OA 1OK6A 3M5ZA 3SI9A 4DQWA 5C8BB 3EEZA 3KCLA 3GTNA 4GBUA 1B90A 2CLIA 2VL4A 3NL2A 3VD4A 4U3CA 2E67A 1PDYA 2INZA 4ML4A 4JQ1A 4J1OA 1TZ9A 1ZNNA 2PDIA 3W7MA 2VQTA 3P5ZA 4TU1A 1DIEA 1E3XA 2WZTA 1DWFM 4B5VA 4JQ4A 3ARVA 5IRPA 3CB3A 1FWWA 3R0UA 1Z3NA 1DP0A 2ASHA 3RLVA 2BX7A 4M29A 5FEPA 2GGIA 3QVQA 4H1ZA 1H49A 1SO4A 5FL1A 3CHVA 3URBA 4QXIA 2HBVA 1AH3A 1CBGA 4DLMA 1TCMA 1YBQB 1SO6A 4PUWA 2RJGA 4AD4A 1V6WA 1W2VA 4GQBA 4I6KA 4OBSA 4NP7A 4CQ9A 1K7XA 1XUUA 3LLXA 5I3HA 3OW1A 2WZHA 4H7ZA 5FEWA 1OF8A 2GL5A 4H9UA 5I2UA 4I7WA 4MPKA 2OB3A 1EXBA 3LHTA 1ADSA 2ISSA 4E2VA 1XYMA 3MT1A 4LVDA 4LGXA 3S1GA 1QRQA 1XD1A 1XGEA 1TA3B 2X1RA 2WHJA 3IPWA 1ME9A 4O0KA 5A8OA 3BCJA 1EHNA 3VX1A 4AWUA 1FOBA 2PTYA 3GNDA 4PMZA 3A64A 1F6YA 1BWKA 4EF9A 4H8UA 1KCXA 2YKKA 4NT0A 1VFOA 4O17A 2NQ5A 1QW8A 1R7AA 4HHLA 3MTWA 4TV6A 1XLBA 1YNYA 1KTCA 3S1UA 4RLIA 4ERAA 4JIRA 3T09A 4ZQCA 1WCGA 4B5NA 4X9YA 2B4GA 4Q8PA 3UZ5A 1ZU8A 2FPYA 2BDQA 1QK2A 1ISZA 2WSQA 3MJMA 4HNCA 1W9VA 4S3BA 1PS9A 1UQYA 3M7WA 4H6QA 2FZDA 2DSUA 3PFRA 1DHKA 1IWPA 2VWSA 1Q7QA 1HVXA 1C8XA 3ARXA 4WDWA 2XU2A 1U83A 4UFJA 4Q4RA 4Y90A 3ARYA 5EMMA 4M19A 1OGBA 3DN5A 2NVCA 2PC4A 2PDQA 3W2UA 1REQB 3NEVA 1RPXA 3VNLA 4NJKA 3LHZA 2JIWA 1TZZA 4OVXA 3K1GA 4O11A 3M4HA 3UWVA 1GNXA 4AAJA 3MMTA 2DQWA 3KOYA 1A5LC 2ZX5A 1V3IA 3OQ8A 2ZUNA 2F61A 1VC4A 4UOQA 5CPMA 2A0NA 1UH3A 1ODZA 1BF2A 2AQOA 3MSRA 4S3CA 3VNJA 5D2YA 3LM7A 1I2PA 4UFMA 3A23A 1DEDA 5L6UA 5AB3A 1OFAA 2OODA 1OD8A 4O28A 3P5YA 4YHGA 3TR2A 2WM1A 3KLKA 2G41A 3PPHA 1HP5A 3NFUA 1IEQA 2NV1A 3KVLA 1ME8A 4ZOAA 1D3GA 3O6CA 1QBAA 3B3DA 2GJRA 3R13A 3N19B 4X22A 3W75A 1HO1A 1EGVA 2ZUUA 4MB3A 5ABFB 1MDRA 4UTTC 1VKFA 4PMRA 2V63A 4GUIA 4UQ9A 5LKYA 4QCFA 1BWLA 3GIQA 5DLCA 3F7JA 3MCNA 1UWTA 4DO6A 4O0ZA 3OVGA 4GD0A 3REQA 4R7OA 1RHCA 3VM7A 5GNZA 2TMDA 4BF9A 4GFSA 1C91A 4E0CA 1JPKA 1W3JA 4H9XA 5BXRA 2Z24A 4FALA 3E96A 5A2BA 2WHLA 1HKJA 3N11A 3NL5A 4NIRA 4K37A 3GU1A 4JEQA 2YBVA 3F5LA 1I9CB 3JS3A 4X63A 1BKHA 4IFKA 1Q6LA 1F76A 3SZ8A 2QJNA 1V08A 2P5NA 1NEYA 1RUSA 1S38A 4FLRA 1BD0A 3SECA 1NWRA 3P60A 1OYAA 1KLZA 3IAPA 2YZ5A 2YSWA 3W7NA 3IAQA 4K1GA 3ITYA 4FF5A 3DERA 2C16A 2D2OA 2D0GA 2CWNA 1IXOA 2DIKA 5TAOA 4DZ5A 5RUBA 3MUIA 5I02A 3F4CA 4IPLA 1S2UA 3M5VA 2BVTA 4JFSA 4LTSA 4ACZB 1R7OA 2Z25A 3W7LA 5CC3A 1QMLA 3QMRA 3K13A 1E1FA 3GU9A 1J12A 1P48A 1RQBA 4LS0A 5C0QA 3OZPA 3CZJA 3WMBA 3S8HA 3TWBA 1XQLA 3VK5A 4DUVA 5F2MA 3H53A 4JNZA 1MW0A 4JZ5A 3A47A 3CUHA 5ENLA 3VFCA 1BTCA 4B4HA 1FWIC 1BGAA 3QN3A 4M7SA 4AZGA 1HIZA 3NQEA 4DWSD 4UTWC 3RRXA 3PZTA 5BWAA 4YYCA 1HKVA 4XZIA 3L7RA 1FH8A 2Y4SA 5HNUA 4OZOA 4DO4A 3GVVA 3L68A 1WPCA 4ERIA 3Q37A 4ALDA 2XYLA 5DFAA 2FHCA 5KEZA 1JFHA 2HWGA 1H7WA 3A4AA 3BURA 1GOOA 2DZPA 1VPXA 1PWMA 2XVGA 3B9OA 3BGGA 2W4XA 3LYEA 3UESA 3QZEA 3VNYA 1GKRA 2ZBTA 4OWGA 4LPCA 1OGGA 3OO2A 4J9JA 1N82A 4OECA 2CCRA 2IPWA 3T0BA 4GH3A 4IQLA 4ZOEA 1UMLA 3NL3A 3THAA 3AYTA 5MF5A 3ZLHA 3I65A 1Z9AA 3KTCA 3MYPA 4L4PA 2YCIX 4LEQA 2HCVA 2XJ7A 2EGZA 3SJNA 1OX6A 4AD3A 3HPXA 3WL1A 1US3A 3LTPA 1IEWA 4PGLA 4Y2WA 2OSXA 5AYIA 3T4WA 3H12A 1QI0A 5ABHA 4YJ5A 2VFDA 3G0UA 4H3DA 3W7GA 2Y85A 4R9OA 4GUHA 1XBVA 1L2QA 2NQJA 1S3TC 4CD8A 3NUKA 3FVDA 1QOQA 3DI0A 4MMWA 1B3OA 5D38A 1H63A 2NV9A 2DT3A 2F38A 4GMEA 4XTIA 2PTDA 1OX4B 3LN3A 4C91A 2WMIA 3ALFA 3EB3A 3S1VA 2MANA 3CYJA 2WSYA 2VC6A 2V9DA 4ICCX 3FCPA 4QM1A 1DBTA 2WZEA 1TJ1A 1TPB1 1UB3A 2YLAA 2O55A 3KE0A 3TIMA 4J3SA 3MKVA 2I56A 2O9PA 1DTNA 4B5XA 1TE1A 2GGJA 4INFA 1HG3A 1K9EA 5EFDA 3VD5A 4ASTA 4EIVA 4PMOA 5GNXA 2GJLA 4LCRA 1QPNA 2BLEA 3CASA 5C55A 1QNQA 1SYTA 1TJ2A 4YLWA 3TK7A 1V0KA 4KCUA 2OOFA 3JVAA 3WQOA 1KCZA 3DENA 1VCVA 3PPGA 3CQIA 3L4UA 4FHAA 2IQTA 4CCZA 1XRVA 1MQPA 3WD1A 2A4AA 2MNRA 2V2CA 4IMAA 1KKOA 2BXYA 4BI6A 3BG5A 5HA7A 1JVNA 3MSYA 1PKMA 4H8HA 4TMCA 2D3NA 1XRTA 1SR0A 4KW2A 3NR0A 4XX6A 5D4YA 3ES7A 2DUXA 3UPMA 3RMJA 4FP1A 3AS0A 3C0SA 1PE1A 1CB2A 4GI9A 1W1PA 2XGZA 3W71A 4HMDA 3CUIA 2X2GA 3JU2A 2QVHA 2Y63A 1WBJA 2QCHA 1WXJA 1OFEA 4HNVA 1EB3A 1UUQA 2QCNA 2YB1A 3TH6A 2NZLA 1DJHA 3TC7A 3P0WA 2OGYA 1E56A 1C7TA 5MHBA 2FTYA 2AKZA 4R53A 2OQYA 5C71A 1D8WA 3EPOA 3K1DA 5HBFA 1RBAA 1FCBA 4GUJA 4W93A 4UOZA 1ZJAA 1L6GA 4F48A 3GXMA 3LI0A 4HPGA 4GOAA 1XPYA 1VEOA 2WNWA 1G6CA 1RJPA 3EWDA 1FFRA 2ODOA 3PY2A 4MUPA 2BFGA 3FFSA 3LCWA 4GX8A 1J6OA 1CX9A 4HNNA 4HZ7A 3MV11 1T41A 5FESA 1MVYA 1KFKA 3WEZA 3G24A 4Q4PA 1UP2A 2R1LA 2J7CA 4FF7A 4KCWA 3JW7A 2CBJA 1KM2A 4US5D 1KM0A 3CMJA 3W9ZA 4H2CA 5DT7A 2YYTA 1QBBA 1E4NA 1L9WA 5DY3A 2PU0A 1QUMA 1CDGA 1ZAHA 4PCSA 5A8QA 2HVNA 3LPPA 1CGTA 4UR9A 4ZZ9A 2ACSA 1MW3A 2A6NA 1X97A 1C93A 1D7FA 1FX6A 1Q6QA 2ZA2A 4IOTA 3WJXA 2VP8A 2PB1A 2QIIA 3BSGA 4OV4A 4C7FA 3OYZA 3N6HA 4B3LA 2XN0A 5C9UA 1TV7A 3QFWA 2WHMA 2JF7A 3DKLA 2ZYFA 4IIFA 5FI8A 3KOWA 2PURA 3T55A 3TR9A 2GDVA 4UTLA 1B9ZA 3NPVA 2G8ZA 2J9ZA 2ZUTA 2J7EA 5I09A 4F8XA 3WX7A 5M17A 1K8CA 4QRNA 2YA1A 3URNA 4O1AA 2PDFA 4BQ3A 3STPA 2X41A 5CBJA 2QLYA 3ZVHB 3E0WA 1EC8A 5A69A 5D33A 3LERA 3PJUA 4HSNA 1ME7A 1UWAA 3MHGA 4GKLA 5HUPA 2XN1A 2PPGA 1MNSA 3H22A 3OJGA 5M03A 3EWYA 2PZ0A 1UJPA 5A6LA 3CMGA 3T4CA 1TKKA 3L4ZA 3N14A 2QDEA 3I6RA 1XIDA 3DYOA 4QNEA 3VYLA 1S5NA 3BLKA 3V1PA 3U6WA 3NQ6A 1VFHA 1YXDA 4ZXOA 3NQ8A 5CSSA 3TNBA 3GSMA 2VD8A 2BY1A 3UY7A 4U2ZA 5TIMA 4GXPA 1NF7A 3REQB 4WJXA 1FQ0A 3IJ7A 4LVGA 3UWEA 4L61A 1TPH1 3SSZA 3H2EA 3MI3A 4AEFA 5BMXA 3I4EA 4PMNA 1PO9A 2ZXDA 4D6JA 3SCOA 2ZUWA 2FZ8A 1OD0A 3THCA 5ECVA 1ZALA 2VRJA 4AX6A 2WJZA 4IFKB 1W6TA 1KXQA 1CTNA 4EKJA 2RDUA 3MUXA 4DM1A 1XGDA 1E9LA 2VGIA 4Q7IA 3M5YA 2WCAA 3JUGA 1BHGA 3YPIA 3GDLA 4KFNA 3BAXA 4GX9A 3BXWA 1JULA 2J8TA 2VQUA 3TTEA 5F2IA 4MTVA 2VEMA 4Y9NA 1S1RA 2OLAA 3OYXA 3PBUA 2A79A 8XIAA 2E6DA 4HP5A 3OLDA 4JNYA 2HROA 3EBVA 4CCDA 2VNCA 2VFFA 1PTDA 3DXIA 4HVXA 1HJSA 2FGLA 3LZ3A 1LG1A 1TSIA 1UKSA 4CKQA 1TPWA 2PCQA 4OBTA 2DZXA 1XYCA 3HQNA 1DTUA 1FXQA 3ZR4A 2E28A 3AO0A 3N2CA 3CO4A 4TR9A 4P7LA 4ML9A 1NTHA 2ZXQA 3VX0A 2Z2UA 4DAIA 2B81A 4E2BA 4NUWA 4AB4A 4DUWA 1KRCC 1N8WA 1FWAC 5FJOA 3EX1A 1LL4A 4JHOA 4LH8A 4HMEA 4XQ6A 5AZ0A 4L1WA 2OPJA 3C2VA 1EDGA 4DJDC 2IKJA 5D03A 2ZICA 3MP5A 2EAWA 1NQ6A 1VBJA 4FNRA 2RDWA 2JBMA 1H41A 5DY2A 5GNYA 4JTKA 2D24A 3CPUA 4A6GA 4PMVA 4RX0A 4KGJA 1E72M 1Q6EA 4KF1A 1HN1A 4JFWA 1ITXA 4B92A 3GYEA 3G6LA 4DAFA 4PMQA 3B0UX 3LDVA 3W7CA 2ZRVA 5JQ9A 1ZBKA 3Q58A 4JTSA 5AC7A 1HP4A 4H01A 1KGXA 2BXVA 3RJYA 2C91A 3GR8A 4QG6A 3P3BA 3MB9A 4Z2JA 3TW9A 2GVEA 1I8JA 2FB3A 1R38A 1RJQA 3CU2A 1JUEA 3ANVA 3STGA 2GSHA 2GLKA 1B54A 1LBLA 4IP5A 4V15A 2QJGA 2YDSA 3RM4A 3KDNA 4IWWA 1Z44A 3IK2A 3GXIA 2VR5A 3GWQA 1US2A 1IEVA 1PAMA 1Q7MA 1ZAIA 3MDWA 2UV8G 2QHAA 3KBSA 3MANA 3TMQA 4OKDA 4PFMA 1NWTA 3UJFA 3NG3A 4V33A 4NU7A 1TWWA 4UCFA 1H60A 2WMIB 3OVRA 3GG1A 4KWOA 2Z00A 4HCDA 1GVFA 1MEHA 1KFEA 3K4AA 2TSYA 3H7VA 2Y7EA 1G69A 2RJHA 3SY1A 4JX5A 4V28A 3ZM8A 3VOGA 2BTMA 1RCXB 4D6GA 4Q6JA 5CAKA 2W62A 1PWLA 1JZ4A 4KRZA 1JPHA 4L5ZA 5BCAA 4JX4A 3MV01 2V2HA 1VB9A 4HZ8A 1TMLA 4MKNA 3C56A 2Z0IA 3H2OA 5E0KA 1AD1A 1IWAA 4CCEA 1I2NA 3S5YA 3GVRA 1E70M 3IUIA 4D2JA 5T9BG 4L4OA 5G4HC 3M6DA 4GABA 1TMHA 2QW5A 3LCXA 3CL6A 5HANA 1HGYA 1XF0A 2O4MA 3WBAA 2OWXA 3PZGA 1U22A 4QE5A 3UY8A 4O1FA 7REQB 4O52A 3B8DA 4GK8A 3SN0A 4HPXA 3A22A 1LWJA 3STCA 4MAVA 5D2TA 3BLOA 1EC9A 4XAFA 1Q63A 3KRUA 4YVXA 1PDZA 1UHVA 2PP0A 1XIFA 4GBDA 4IQEA 1AK5A 3CT7A 4J28A 1G1YA 3XISA 4JCMA 4ILSA 4HD5A 1WKDA 2WLYA 1XINA 3QC3A 2D1ZA 3ICJA 3W28A 5I6SA 4RL3A 1OYBA 5DF0A 1ALDA 3NVTA 3RLHA 5LGXA 4GH1A 3TTYA 1GVOA 1WAWA 2J62A 2VM8A 4JQAA 3W02A 2XH7A 3PBMA 3WMSA 2YLLA 2QMJA 2DZTA 1M3UA 3G1FA 3IV8A 3CWHA 2HXUA 1D3HA 2OQHA 1V4YA 1VP5A 1UR4A 2PMQA 2A3BA 3W7OA 3LMYA 3HMJG 3GBEA 3UG3A 1YDYA 3GH4A 1TPFA 3IIVA 1R86A 4H7CA 2AL2B 3R79A 1DPMA 1GW1A 5JUVA 4JY8A 3TAKA 2I5GA 3LB0A 4U2YA 1AMKA 1TFVA 3FNDA 3CPGA 1F3WA 3B8SA 4OBRA 4UZUA 2H3DA 2PLMA 2VX5A 2XTKA 2QCEA 3T44A 1FP9A 2UBPC 4RNFA 2ONEA 3S3GA 1UPMB 2GWGA 4KT2A 4QJ3B 1GQNA 5AHIA 1E15A 1JXJA 1L6YA 2VGGA 3VKKA 2REQA 1UIOA 4J3ZA 3QW3A 2D73A 1WXYA 3GW0A 3OBAA 4C90A 4KIRA 5IDIA 4NF7A 2O56A 1P6WA 2YW3A 3CV2A 2VEPA 3CIVA 1SW7A 3G1SA 3G3DA 3TVAA 2HNEA 2E6AA 2NWRA 4P7RA 4A3HA 3NAVA 3N12A 3RAOA 3HIJA 2IKGA 4QP0A 1T40A 4DBDA 4OHQA 1UC4A 3WFLA 2WBKA 3WKZA 4U28A 3TROA 2G37A 1LOLA 1ZP3A 3VKBA 3WK0A 3O3RA 2OO6A 4GY0A 1KWKA 3WDQA 1GOXA 4S23A 1M7OA 3N2TA 4HU4A 1QJWA 5FD0A 4XUYA 3FKKA 4O4WA 2CBUA 1QW7A 4NL1A 2D0FA 4U33A 3U3HA 3P93A 4IGMA 2OZTA 4ZSTA 5L9FA 3E5PA 4CD4A 1CXHA 3W1MA 2JALA 3SUSA 1W56A 3ITVA 1E0XA 5I3IA 5E0CA 2Q3OA 4K2SA 5C2CA 1GGOA 5HPOA 5BWFA 3LG3A 1WYIA 2XFWA 3K4DA 1VEMA 4HOXA 4XD4A 1RJRA 3PJWA 1HF6A 2Y1HA 2ZX7A 3S47A 1SZFA 4GUFA 3P8JA 3W6YA 3BC9A 2VR4A 1ZJBA 4RE3A 1EQPA 2G0WA 3BZGA 1A5BA 2OTDA 4JIQA 2WWDA 3A24A 3N9KA 1W3LA 3DGBA 2Z6IA 4FXJA 3E5BA 3OBEA 1V93A 4HNOA 5H1WA 3HOJA 3IS4A 1XUZA 4IPJA 3PTDA 1GQLA 5EKYA 3UETA 2VZTA 5CZSA 3LTSA 4GZIA 1OK4A 4TV5A 3VZYA 3IJ8A 5I00A 2Z1SA 4N2YA 1V3HA 5FKYA 4L9ZA 1E55A 1XIGA 2CZFA 1MEWA 3W7EA 4YTSA 4HA0A 1UD4A 2FLIA 1GZ1A 1YPFA 1FWCC 4E2DA 1KXVA 4HOZA 1WDPA 3AXMA 5K9CA 1QT1A 1ISVA 4FLQA 3RHGA 4L9YA 3PSVA 2ZXAA 1M68A 1RD6A 3NA8A 3CHEA 1VFTA 2CERA 6ALDA 1L6SA 4E5TA 4UNLA 1Q6FA 1ESWA 3QRHA 3WDHA 3MMDA 1OCBA 4QLLA 4EPKA 4LAOA 1JDAA 2E4TA 1VBGA 1LP6A 4HBKA 3AHYA 4H6RA 1SZEA 4JTUA 2WVSA 3GDRA 5BYWA 3L21A 3GO2A 5C2XA 2FGBA 3SCWA 1L2UA 3SB0A 5GJPA 4V27A 5BXTA 1LWIA 3W86A 3TZFA 4C6FA 1IT8A 3E02A 3VFLA 1W1ZA 3QV8A 7XIMA 5IOBA 1JJKA 1BGGA 3NEHA 4QQUA 2PODA 3ARRA 1AD4A 1VHNA 2WCGA 2PSNA 3TFXA 3G2GA 1W3NA 4Q4KA 3LGDA 4JTEA 1AW1A 3W84A 2ZX9A 1IEIA 1A80A 3TNOA 1AH0A 1F74A 4TO8A 4Y6GA 3KVJA 3UFYA 3W1RA 4PODA 1JRCA 3T0TA 4KS0A 1OVDA 2Y7FA 4JCLA 3TYEA 4NQ1A 3MWCA 2XZ7A 1EEXA 4IL0A 5EMLA 4HK5A 1VJIA 1TV8A 4I3GA 1Q13A 1MSSA 3RG6A 5HJXA 4W4QA 3MVIA 4HZ6A 1WE5A 5EU9A 3PAOA 1MXGA 4N7QA 3D0CA 2QUUA 3G1RA 2VZVA 1POJA 3W27A 2YCJA 3CPRA 3QBUA 3AXIA 6REQA 5J8LA 3RGTA 2E6YA 1C3FA 1K03A 2PDNA 3NO1A 1F05A 2NX9A 2Y24A 3LGEA 2DV0A 4MB1A 2CWXA 4LBUA 1AL8A 1EC7A 3R1ZA 3U7BA 2DIJA 3S5ZA 3OLEA 1LOQA 2DW6A 4FI4A 2E5BA 5A8PA 1IXNA 3LX9A 2OR2A 1EJXC 2HSAA 1I4NA 5HINA 5FF0A 3N2XA 4IX2A 5CSYA 2I16A 2I5IA 2CLLA 5I24A 3L4TA 1KTNA 3V3WA 2QGHA 4NX5A 4D8LA 3CMFA 1OIMA 4PUNA 3U2CA 4ZXLA 5K4XA 1J93A 1O7AA 4AIUA 3N18A 2XPKA 5F1VA 4DJDA 3W83A 3ABZA 1K7EA 4LUIA 3PG8A 2NT0A 1EJSC 4R5EA 5A8MA 4UNIA 3E6EA 3GIPA 4D6CA 3I3DA 3H23A 2IXVA 1XDJA 3TJ4A 1V6YA 4CN6A 3KBVA 1UBSA 1R87A 4ECLA 1IQ8A 2W63A 4JTDA 2BMBA 4R33A 1YKWA 4HT3A 1P7TA 4W88A 1XFCA 3TWAA 1HKWA 3C0LA 5EL1A 3UWQA 1GYMA 2KZHA 2PE4A 1H7PA 2FFCA 3BAJA 2IKHA 3DGRA 2DSKA 5HNNA 1IGSA 2IPGA 1RZMA 4DY1A 1K4HA 5G1YA 4UFKA 2GDQA 4JN8A 2INEA 3UA4A 1R9YA 1VBUA 1OF6A 3TU9A 4ZFMA 3M64A 1KRMA 3B9EA 3CAWA 3CAVA 5FL0A 3ZSSA 3NQ2A 3RCMA 2YOCA 1FKWA 2DSVA 1XG4A 1XC4A 5KZMA 1BVZA 2QCCA 2UZ9A 2XM1A 4PUEA 4IFRA 5FAGA 5DRCA 2BP1A 7CGTA 1QO2A 2X42A 3SCPA 3TYZA 3BG9A 3O06A 5TNVA 1FHVA 3C2EA 2X0SA 4B4FA 1G67A 3IIZA 1UOKA 4ZO8A 2NW0A 3W7QA 4OFCA 2YGYA 2C79A 2PDPA 3ZR5A 2L5HA 1QO5A 3FA3A 3GXPA 1XBZA 2ISFA 2TPSA 2OYLA 2VYOA 3WUFA 4MIMA 1JNEA 3ZJ7A 5CGMA 4YHEA 5A5WA 1KFBA 4UTKA 4TVUA 4FPSA 4A3RA 1W1YA 3GC2A 4KEVA 4ZOBA 3M6YA 4XVDA 2REQB 1OIFA 2B0MA 3ZIZA 5F1UA 4S3EA 1A5MC 1ZGDA 2DZSA 3IGUA 1KFJA 1JQVA 1EWEA 3V5OA 1MO0A 4GIRA 4YPJA 2DFAA 1BEUA 1UD8A 4MJ2A 5H91A 4JPGA 3PZUA 3LV6A 5FAJA 3TAOA 2DT2A 4OU1A 3S0CA 1KA9F 4TXEA 3BWWA 2J4GA 1YHTA 1E0WA 2X05A 3KBWA 1AJZA 2BASA 2EJ1A 3MUY1 3W29A 3WD0A 4DJEA 1E6SM 2GQ3A 3WQVA 1W1A1 2IMRA 4BEQA 5FF2A 3CYVA 3H8AA 4LT9A 1RP9A 3M43A 3L2MA 3NQGA 3QJAA 2Y8KA 4S39A 3QTPA 3K46A 3DG6A 2R24A 3WD2A 4Q22A 3GH7A 3Q45A 4JNMA 1FRBA 1KQZA 2IUZA 1U1UA 3M47A 2E0PA 2CLPA 5J5RA 1V3KA 3GM8A 3EWUA 1J2BA 3WF3A 2R6OA 3SRHA 2PDHA 2KAUC 5CC7A 3OLGA 1E4LA 3XINA 1PBGA 2DGAA 2CZVA 3AYVA 3TN4A 1XM3A 2V67A 3OG3A 3MZNA 2XUCA 1J4EA 3UG8A 1ZAJA 2BOGX 2FZ9A 4AW7A 5HMDA 1V5XA 1T8QA 3CS2A 1U33A 1YQ2A 2PBOA 4REQA 1KGUA 1QR7A 2QDDA 3TYUA 4ZO6A 2E8ZA 3W7PA 8XIMA 1ZQ5A 3CIWA 2BXZA 1W17A 1LLZA 4Q4MA 4TTGA 1PVNA 4DXXA 4Z1CA 4LNYA 1JIBA 1BYAA 4IPNB 3PTKA 1WUEA 3N73A 5IM51 4XZWA 2BWGA 5G1TA 9XIAA 2QKFA 3T05A 4MWAA 3AIEA 3MCOA 4L6DA 5DMNA 4CD6A 1ADDA 3HPZA 4YL2A 1XLLA 2J77A 5JH2A 3N4FA 1GEQA 3S6TA 3N04A 1S46A 3SQSA 3LCIA 1W37A 2DEPA 1W8SA 4H2HA 1A4MA 3NM1A 3WELA 3BOXA 3VOHA 3MY9A 3NZQA 2F2HA 3PBVA 1ZL1A 3WNOA 4GIEA 5ECUA 5LHFA 4UFHA 2ZZ6A 2ACRA 2PWHA 1VQTA 5A6MA 1DWIM 1PV8A 1H1ZA 4GA8A 5ABTA 4K7VA 4GQ0A 2A6LA 3LY0A 4HPJA 2VFGA 4P8XA 1LQAA 5HQEA 3L5MA 3W37A 2PDKA 1XRFA 4C6MA 4BI5A 4Q8UA 1O5KA 4DZAA 2YXOA 3HV8A 9XIMA 1OZMA 2WMFA 4DLFA 4NI8A 4W7VA 2FHFA 2FGZA 4J35A 1G4PA 2J7GA 4XK2A 1PZ0A 1HZYA 5DEZA 4XBKA 4WX2A 3ABSA 3O0KA 3QPYA 1QNPA 3B9DA 5C54A 2B7NA 3EDKA 1QNOA 1E9YB 4G1KA 1TX2A 4XAYA 3GNRA 1JPDX 3MPGA 4CNOA 3EWBX 3ITTA 1J0YA 1M03A 1S5MA 2HS6A 5LXXA 2VFEA 3KS6A 5AYXA 1O68A 2G4JA 8TIMA 5FCZA 2NUYA 1SVDA 4WIWA 3BJTA 4GNKB 4E8DA 3O2LA 1H1NA 4HGXA 3LQLA 3WLPA 1FTXA 4M6VA 4KKXA 3LS9A 4WKFA 4RW5A 5T8GA 1XCXA 4A8IA 2HMCA 1EP3A 3W1LA 3LHWA 1Q85A 3KS5A 1GVSA 3W23A 5KETA 1QCWA 3LZ5A 3Q67A 5HJLA 2WANA 1KKRA 4YVPA 3LBOA 2F6KA 3TFCA 3S6OA 1BPLB 4Q8OA 3W1AA 4LY8A 4OGZA 4G5DA 2ZQ0A 3SGGA 3AMLA 1DJXA 1W0MA 3QHNA 3LA4A 2ADAA 3GIYA 3ZR6A 2V5BA 4C7GA 4E4PA 1GJUA 4DI9A 3K2GA 4OV9A 6REQB 1S2VA 3N3TA 3EPMA 3F2BA 4OTKA 1I1XA 5C7HA 4GZJA 1EIBA 1LBFA 1JCMP 1UUOA 4MUZA 4JD4A 1DIOA 1X1ZA 3IGXA 4QBXA 3QOKA 1QAPA 3R25A 3PZOA 4IXXA 1SW0A 1QNRA 3O15A 3K30A 3CBWA 1IR2A 4B5UA 4GQQA 4O1BA 3DHDA 4P8UA 3IUDA 4TX8A 2WNNA 4FSAA 2X7VA 3TN6A 2CW6A 3TE9A 1KR0A 3WNPA 2I14A 3O63A 4Q7BA 4GE8A 2VR2A 1IXQA 2O92A 1V02A 1HXJA 1HT6A 2OCZA 3KP0A 2WB5A 1Z32X 3PJTA 1GHSA 1P7TB 3AQUA 3FX4A 1K3UA 4RDVA 1EJ7L 4UTFA 1PKNA 3AUOA 1K8ZA 3RX2A 2OT0A 3WH7A 1YDVA 4W8AA 3ZLGA 1MWOA 3UGRA 1XYLA 3M0ZA 1EJUC 4IP4A 3U4AA 4J3TA 1PL9A 4FXFA 1WZLA 3W88A 3WF4A 1UWUA 1LUCA 4E6MA 3TCEA 5AYYA 4ZVJA 4IGHA 4L1XA 3WLJA 3EAUA 5DBUA 1Q8AA 1EZWA 1GOWA 1I2RA 2DP3A 1QATA 4XZLX 3E2QA 4JGDA 2ZKMX 5HOSA 3CQKA 3LU2A 4KMQA 3AIVA 5TBOA 3VE7A 3WFAA 1WO2A 1MMFA 4OOUA 3CK5A 8RUCA 4B3ZA 3GQYA 3AU6A 4DBWA 4QFUA 3QFEA 4BY3A 3A4JA 4US6A 3SRKA 3IIOA 3EMQA 1NY1A 5LXEA 4UOJA 4M6UA 3CZGA 4CEXC 2GOUA 1XWYA 4TTUA 5JBDA 2WVUA 3LEPA 1TG7A 2YPIA 4EPDC 1O12A 2I57A 5M5DA 3GHUA 4X61A 1X7FA 5HULA 2GUYA 3B0YA 4RKAA 2AQWA 1V0LA 3SN4A 2YR1A 3ENLA 1E1CA 4QE1A 3WMLA 1Q7ZA 3C2YA 2BBFA 1F7BA 1O4UA 1EPVA 3CL8A 1EGMA 2YA0A 3W6MA 3W81A 6TAAA 5CZJA 1XSIA 1EUNA 1GHRA 4HNLA 4LNCA 4LC8A 2QDHA 3RUBL 4R88A 1UR8A 3CL7A 4B5TA 1E0UA 2BOEX 2XINA 3CEPA 4JTQA 5G4WA 4D6IA 3LQGA 3BAWA 1CGXA 4IZGA 3QR0A 1JXKA 2V30A 2D69A 3WFZA 2WV8A 3W1PA 1A0CA 2X1TA 1ZPTA 1H4PA 1FWBC 1NDVA 4PMJA 1VAHA 1O6IA 3KVKA 4A21A 3M0LA 2J7FA 4UC5A 3BH4A 4E4FA 5IBXC 4AD2A 1IYXA 2Z1VA 3KL3A 2NUXA 4XZNX 4F2BA 1KV8A 1LG2A 5SWUA 3MJYA 4MJMA 5IHSA 3C52A 3W3OA 1TVPA 1AW5A 1XCWA 2XGIA 3WEOA 1HW6A 4AH7A 1OC5A 4JICA 4IIEA 4AZBA 1H51A 2WHKA 3LGGA 1JGIA 4ENLA 5A95A 3AAMA 5KSWA 5MKGA 4JYFA 3A3XA 1XSJA 2Y62A 3MC5A 4Z08A 4QS5A 3QH2A 4J3XA 3CNYA 5D05A 2HS8A 3GFXA 1FWNA 3AMCA 6A3HA 1B0IA 4REQB 4B2DA 3G0XA 3KBJA 1MDLA 3BMVA 3WCZA 1SFSA 5DMYA 3W38A 2Z7GA 1VYSX 1D2KA 3WBXA 2J47A 3S4TA 4K6AA 1UPPA 1MFVA 2GGGA 1KXTA 5M3WA 3MUZ1 3M0YA 1X8FA 3B8WA 3VZXA 3S83A 3SCRA 3L0GA 1NSJA 1XLHA 1WDQA 5HWNA 2XG9A 3GTHA 3TYAA 4AEOA 3WBWA 2V82A 1PX4A 3W4RA 4U10A 1S5WA 3NSMA 4LCSA 1UCWA 3NSXA 2CXGA 3B8IA 4DWSC 5E1QA 2OFJA 1EJWC 4EACA 3LK6A 3RCYA 1MYRA 1RLCL 1IEXA 4LALA 3QHMA 5HUOA 4YXGA 1E9ZB 1QNVA 4YU1A 2POTA 3FHQA 3LHUA 1B1YA 2Q6ZA 3T42A 3UWWA 1AW2A 1YW1A 2JE8A 3UJ2A 1EH9A 4I6VA 3URQA 1KBBA 4XSMA 3SBFA 1E0VA 3G1HA 5DXYA 3ARWA 5EFFA 3IJIA 1V03A 1PX8A 3LD5A 5JBFA 4LBRA 1DORA 3CZKA 3PUOA 3T2QA 1RQHA 2GWNA 4LAUA 4EAYA 2WMJA 4XZBA 3B4UA 4WR3A 3RU6A 3C5QA 4DJFA 1X8CA 4G56A 2FPTA 4LVBA 5G2IA 1X6UA 4HSHA 2WJEA 1JPMA 3ZZ1A 3AHTA 2Y6ZA 3WUBA 3ECQA 1KLYA 1KM4A 4WY0B 1KBIA 1JZ5A 5D9PA 3QZ6A 3VDAA 1P6BA 4C6NA 3I10A 2W91A 2D23A 1BVNP 1F2JA 1UROA 3A4XA 3L4VA 3U7VA 4H7VA 1CLXA 4GNVA 2ZWYA 3RN6A 4I7UA 3MI6A 4A05A 3HO8A 3DYPA 3DFHA 2VVNA 2F8QA 2GPTA 4CNSA 4Y9OA 3PFMA 3CH0A 1Y5XA 5E5CA 1ITQA 4ZQRA 1ICSA 3SUTA 3O0FA 1VENA 1W91A 4JL1A 1N2VA 1ZP4A 2ZTJA 4CGTA 3QSTA 4JTJA 2ZVIA 3VIPA 2CLMA 1UD3A 2OZ8A 1CXEA 4Q6XA 2NLIA 5FEXA 3GNXA 5GVJA 6XIAA 2PDMA 3DFPA 4F2UA 1XR2A 2O0TA 1NQKA 1PIGA 3L2LA 1PXGA 1XP3A 3BCFA 1TUFA 4AXKA 3LXCA 4QIUA 5CC5A 4JX6A 1C8YA 2P53A 4GIAA 1J0ZA 2DSZA 2YL9A 4PUJA 1F8IA 1U1HA 4IFOA 4HN4A 3R4IA 3BAYA 3SGZA 1I1WA 3UQNA 1C9DA 4JFTA 3AIUA 3DBPA 1XIBA 3SY8A 4B9ZA 1R30A 2P3EA 4O57A 3A6OA 3ONBA 4DB7A 5C9ZA 3L0NA 3SW6A 5AN7A 3S5OA 4DN1A 5H6HA 1JUBA 3BQ5A 3GDBA 4OUIA 4LVAA 4PBEA 3TC3A 3CC1A 1OFOA 1W3IA 2IW0A 3R5EA 2VOMA 4ZFCA 3LNPA 2AKMA 1KB3A 2HBXA 2PWVA 5I3JA 2GQAA 1OC7A 4NNAA 3MS8A 3R89A 1XBYA 2YA2A 1CENA 2VDHA 2WSRA 3WBYA 1TR9A 1VLWA 4D8ZA 3BUVA 2AMGA 3EDJA 2EXOA 3SCVA 2V3GA 1Y8BA 4QSFA 2C18A 3MMWA 2OKOA 1WNOA 1ZUAX 4M81A 2DT0A 1JDEA 1NDYA 4H19A 5CBBA 3C4UA 2H9AB 2XGBA 3VOIA 2PP3A 1ONRA 4WY0F 4HIBA 4DF1A 5LA1A 2E77A 5CZKA 4G2DA 3VD3A 1GUVA 1OJXA 1JL8A 3VKDA 5TD4A 3WQCA 3OEXA 1B5TA 2O9TA 1UR3M 4GYJA 3HFYA 2X8RA 3QKZA 5JU6A 1DOSA 1W32A 3T08A 4MY8A 3SY5A 1K6WA 3CTLA 5KTLA 1VIWA 1H7XA 4AZ6A 3PZMA 3NM3A 3LXAA 1EPXA 4NXKA 3LRLA 5AY7A 3NQBA 1XV8A 3PTMA 3WYZA 4R85A 1LUCB 4QTGA 5LYRA 4E38A 3QV6A 3G1VA 3FVMA 1TTPA 1JCLA 1DXIA 2DDXA 2NXIA 3QEZA 4P7NA 4GQRA 2DZUA 1PB0A 4NHVA 4IMFA 3V0UA 3PULA 4DNHA 1SPQA 3EOEA 3BMWA 3KUMA 1PIIA 1OBAA 5JXQA 1X96A 4PB3A 4MNLA 1OADA 3RRAA 4F79A 2XFRA 3W53A 1Q5MA 4IH3A 1AJ2A 4AWEA 4WSKA 4EXQA 1F4AA 4AF0A 1O5RA 1RA0A 3C8NA 5D9NA 3WK2A 4NNCA 5JBEA 4QG8A 3N17A 2HJPA 3L4YA 4FX6M 2FZNA 3SDOA 3COTA 2ZC8A 4DWDA 1X7IA 2DZAA 3OQEA 1VPYA 2H90A 1XC6A 3PWIA 1WA3A 2PDYA 1EBGA 2J13A 1DWGM 3G18A 3MSGA 1JUKA 4O10A 1E1CB 4S3AA 5H8PA 2JIEA 3VGGA 1OABA 3CWOX 4N9BA 3ATYA 4AVOA 3NGFA 1R3TA 1GOMA 2VMFA 2A3LA 2EPOA 4DF0A 1H0GA 4PCTA 2CHNA 5AOUA 3HTWA 2Z6JA 1Z6KA 4PUMA 1U30A 3FAWA 2FDSA 2H6RA 3C2FA 4AFYA 4XWUA 1WB0A 5BRPA 4Z17A 4QJ5B 3D47A 4NRRA 3SUWA 4JDYA 2GYIA 2DJXA 3HQ1A 1BKSA 3ALGA 1GQKA 2NQZA 1QK0A 2G50A 3SCUA 2YFNA 3KDOA 3H24A 1M7XA 1RR2A 5D9MA 3W6LA 4I7VA 5CLWA 1KCKA 2O7SA 3WQPA 3T40A 4K68A 1VGAA 4F0MA 3W87A 1TPVA 2YB4A 4C6QA 2V3EA 2VKZG 3SFWA 1OT2A 4I8YA 3PF3A 4M8UA 3S9YA 4NZFA 4BWLC 4M24A 2NX3A 1I2OA 3KHJA 1XS2A 3B0XA 4LRTA 4GRSA 4RNIA 2AQVA 5BRBA 1OG0A 4TQTA 4IPPA 3QC0A 3NDOA 1M53A 1B3ZA 1E5NA 4RZBA 3GB6A 5K9DA 2Y8VA 4HHPA 4QAIA 3F4WA 3GTIA 4QAWA 1UUMA 5DANA 1VCGA 1NWSA 3EA2A 2PDGA 3FIGA 3USBA 3M16A 2Q71A 2VOTA 4AISA 1ZHAA 1Z7AA 3SCTA 3TN5A 4PEEA 2Y0FA 4E2OA 2DQXA 4GFIA 3M0HA 1TREA 3KHDA 4G8TA 3BLPX 2VGBA 4MZ8A 3FN9A 2OLSA 3VCCA 3LPOA 1JCNA 1PUDA 4HNUA 2F7FA 3ITXA 1TIWA 1UOZA 4MZ1A 1FDZA 1TTQA 4YWIA 2X40A 1A3WA 3LRMA 2XDFA 3FJNA 2BOFX 2D2GA 4J27A 2YCLB 4J3WA 3GXDA 4PMUA 2V81A 1PYMA 4ATDA 3CJPA 4M51A 1A5AA 1UA7A 1YE4A 2ZCGA 4WHBA 4HA1A 3O6DA 4B3KA 2Q8ZA 4GXWA 4B5WA 3P0XA 2YW4A 5HR7A 1DWAM 1V77A 1JEZA 1PTAA 4PCNA 1DJWA 1SMAA 2W6RA 3GD6A 4IJBA 2XSXA 4ATLA 3ISIX 4HJWA 2W3ZA 1OEPA 3UT0A 1XCFA 2OEMA 4W5UA 5G4EA 1EJRC 1E71M 2EG8A 2X09A 4MNJA 1V3MA 1XLIA 1W8GA 3BAKA 4LYQA 2J8GA 1MNZA 1FHLA 3OTRA 2CZEA 2C8NA 3L2IA 2WC7A 4XD6A 4QITA 1KM3A 3NYDA 3TW7A 5IBXA 1RCOB 2CIPA 5D30A 4CNTA 4LUTA 5A6JA 2PGWA 4Q8VA 3H7UA 1GYNA 1R3RA 3HGSA 4PRWA 1JZ6A 1SM9A 1YTKA 1XPGA 4MSSA 2R1NA 4YTTA 4P8VA 2O9RA 3DECA 2QQ6A 3L12A 4PB5A 3N9SA 3ZJ8A 3NPUA 2BGQA 2QNEA 4NZ4A 3ID7A 4D71A 1WKEA 3BW3A 4XZ9A 1KCLA 2OWCA 4MJZA 1TWZA 4I90A 3TLLA 2CKSA 4LY4A 2XIBA 1YTEA 4KWUA 1QI3A 1FH7A 1GW9A 4J2MA 1WAUA 2WNZA 3GTFA 2WBGA 3HG2A 1J0JA 1EJVC 4XKMA 1MQRA 2EJAA 3LSBA 5CPOA 1CIUA 1SSGA 2V3FA 3LNMA 2BG5A 2RGLA 4PMDA 4FMVA 3BCDA 1LRNA 3W2NA 4PZVA 3N2BA 3RR1A 2X2YA 3WUEA 1R3WA 5BOFA 2Q02A 1ELSA 1OCQA 2R1KA 4JIIX 3RITA 2WJDA 3WG6A 4O50A 3GUWA 3AIQA 1JYNA 4KETA 3U48A 1AODA 4L9XA 3S1WA 4DWSA 3UXDA 1GVRA 3HN3A 2Z26A 4BCEA 3GG7A 5I5RA 2FZMA 4O12A 1VS1A 1A3XA 4CD5A 7A3HA 3W1NA 1HJVA 2J9YA 1A4LA 2A21A 2NLYA 3VIGA 1AQFA 4U5KA 3LLFA 1XLKA 5G1MA 1K8YA 4C6IA 3I4KA 3UBPC 4ZTYA 3OLIA 4H9ZA 1O60A 4WXYA 4HYRA 1JF6A 1E6NA 5CC6A 3RDKA 3B40A 1QPQA 4M6QA 1O95A 1Q6GA 1OFQA 2PA6A 1P1MA 2EQDA 2FVKA 3QGAC 3ZWSA 2LLEA 3AZSA 1FP8A 3UWZA 1HNYA 4D8AA 3MA8A 3OA3A 3PC0A 1N7KA 2Y7GA 1TQXA 1XI3A 4CNNA 3EX6A 3GH5A 2ACUA 4O1EA 1EF2A 1B57A 3B05A 1SSDA 4FS9A 1RXOB 4AQLA 5HWMA 1NDZA 4ZQMA 4QX4A 4A2SA 3V5FA 1B4EA 3CQJA 3GXNA 3CUZA 4Y8FA 2I5QA 3LV5A 2E6FA 2IS7A 1XICA 3T9PA 4L6HA 3VOCA 4HPHA 1Q6RA 1K6AA 3USZA 1W3HA 4G1NA 4D6DA 4WK9A 5HMFA 5D9OA 1T7LA 1RY0A 3BGJA 3BOFA 1U2YA 2NWSA 3A12A 1BQGA 3QY8A 4GVHA 3IJQA 1YMYA 4HPNA 3SQLA 5FA5A 1TWSA 1UKQA 2WOQA 1HL9A 6CGTA 3V36A 1Q2RA 5CH9A 3M41A 2GVLA 3AUJA 5D2WA 1RA5A 3QTGA 5ABEA 4CCCA 2B31A 3GW3A 2QF7A 2QGYA 1XXXA 4S3GA 2A2IA 5G2WA 3EZ4A 2ZRZA 1EKOA 4AG0A 5F2GA 4MFEA 4HQVA 1K4GA 3VDGA 1JI1A 4YIWA 1EHAA 2R1PA 3GKFA 3WDIA 4AF0B 2PF0A 4UCGA 4AMAA 1UMYA 3CB8A 3WK3A 1WBHA 3FSUA 4UFIA 4C1NA 5EA9A 4ZA0A 1O94A 2CC0A 1L6WA 4KRTA 1NARA 4M1RA 4DX3A 1NU5A 3B04A 1G9HA 3DFNA 3G6MA 4ZB0A 4P8WA 4I5UA 2EPHA 2DH2A 1QHPA 4ZR8A 3MHFA 4LANA 3P67A 2VENA 4Q4QA 1HQTA 3M44A 4JKMA 4GVIA 4NRSA 5E6ZA 5CQ1A 4KRUA 2A7NA 1S1PA 4XD5A 1GJPA 4LSBA 1FH9A 4EF8A 5J5DA 3T7VA 4UFLA 3VU2A 3EOOA 2QCGA 3P82A 3DKJA 3D5HA 1VRDA 1M9HA 4Y7EA 1W1B1 3F5KA 1SUXA 1X6NA 4S3JA 1FDYA 2DVUA 1KBJA 1UR9A 3V75A 4GVGA 4W86A 5GQBA 1S39A 2DIEA 2VO5A 2VI0A 5F2LA 4ZE4A 4RXFA 3P14A 3CH9A 2PTXA 3P62A 1T5AA 1VLIA 3ARQA 4NJJA 5AYBA 5FSEC 4K3ZA 2CYGA 1RCQA 4NAEA 3PJXA 1UBPC 2C13A 1X6LA 2PLKA 4JKKA 3HMCA 3RCNA 2P1FA 1P1XA 4ZQPA 4LYRA 3TN3A 3AIRA 2GJXA 4FO4A 2WPGA 3C3NA 2HQAA 1UZHA 3FEMA 4J4KA 1CPUA 5DELA 1B9BA 1Z41A 2ZRUA 4US5A 3E1F1 4WKAA 1VD6A 2GOKA 3PZVA 3S9ZA 2QMKA 2J88A 3WNMA 3VIFA 4B15A 1EUAA 4JFVA 3WQWA 1OCJA 3UXIA 1XD0A 4ZENA 1B3WA 1KM1A 1SU5A 4QDWA 4Z0JA 1Q65A 2BVDA 1OINA 2YDQA 4NJGA 4B91A 3WQEA 3PHAA 2PP1A 2WWCA 4B90A 4RCXA 1JZ2A 4PCFA 3TZNA 3DFTA 2HZGA 5JVLA 4B16A 1DXEA 2ZUVA 3PUEA 1EJTC 1YNQA 2Q8XA 3TCSA 3LHVA 1YXCA 2C3ZA 2CHRA 2W9MA 4BA0A 2VX4A 3POCA 1JAEA 2XVPA 3DFSA 4KWSA 5F4WA 3ZWTA 3TONA 4LF1A 3KX6A 1R9XA 3EWWA 1K77A 3R43A 4KFOA 3SADA 1W5PA 3W2JA 4K8EA 3G3MA 3ZJ6A 3UR5A 2OO0A 5T26A 3DUGA 5CJNA 3PP7A 3AXXA 3FYPA 1AG1O 3AMDA 3RM9A 3L67A 4ZGYA 2ZUSA 3GHSA 4YS1A 3IK4A 5JMUA 2VEKA 4HKPA 4QCEA 3IJDA 3GXFA 2W27A 3THDA 1KFLA 5B80A 1GQJA 3UYIA 3KXQA 4HYWA 2J8FA 3M9YA 3CHDA 1DL3A 2EPNA 4JTFA 4O0QA 3CWNA 4G9PA 1V7YA 4RXGA 3O07A 4KCTA 4Y9PA 3LSCA 5D2VA 2G4FA 1HVQA 2JKAA 4J3UA 3THUA 3N4EA 2EF9A 3WF2A 3RM8A 1R3VA 4ORIA 5A6SA 1FHUA 4QDPA 1XH0A 3VIOA 2HVMA 3V5CA 5G2HA 2E3ZA 3V7PA 4TUFA 4Q4OA 4BWLA 3QQWA 3KTSA 4URIA 2PRHA 4IQJA 1GG0A 3UCCA 1A5UA 2V8ZA 1LYXA 2PDUA 1SMDA 4IUOA 4HU3A 1ITCA 3ABOA 1HO4A 2PU1A 5AHLA 3M7SA 4MKVA 1C8QA 5TF0A 4BFAA 3KOXA 2G3JA 2G3IA 1Y0EA 4QLJA 3GUGA 2PDLA 1F3EA 4FZIA 3LCGA 4X0NA 4ZMGA 5HDRA 3SM0A 4YNGA 1XIHA 4PC8A 3HZ3A 1G7UA 4NZ5A 3ONCA 1XLFA 3EMZA 4WOQA 5C9XA 2PLJA 1NFGA 3QF0A 3F2DA 4GI6A 2GJPA 3L4XA 4JTRA 2AAMA 3L5LA 3W22A 3OA5A 3EWCA 2ABAA 4UR8A 2CEQA 1UIPA 2QUTA 1H0IA 3OOQA 2FB2A 4UQCA 3VIHA 3FV9A 1MXDA 3C8FA 3R8HA 4XKYA 5CAHA 2BY0A 3DHPA 4I5RA 2INFA 2UY5A 3GC4A 3SIZA 1WOBA 1C7SA 1UC5A 2ATMA 4F0RA 5EMUA 4Q8WA 2PRLA 3HF3A 3BJSA 2R9RA 1OWQA 3ZFHA 2F84A 1XIMA 4H9MA 4RDZA 4DWSB 3HPAA 3L65A 1IZJA 1M6JA 2PD9A 1Q3NA 4RV3A 1GJWA 2AAAA 3TA6A 4DEFA 4EK7A 4FIRA 1EBHA 3CGTA 3B97A 1C92A 3RX4A 4HOWA 3GK0A 1TV3A 3PPCA 1UKOA 3ZVIA 3B8VA 3C6CA 1TELA 1SR9A 1DJNA 4MDPA 3MVTA 3FLUA 2ANUA 1Z48A 1GPFA 3M0VA 1PCKA 3CAKA 4K36A 3HG3A 3HG5A 5AZ1A 3HA1A 2OZ0A 4FIQA 1VRXA 2R82A 1H3GA 1EP1A 1M1BA 4ZCWA 1GYLA 3KZPA 4MGGA 2DJLA 2O7QA 1POKA 3P84A 2A3AA 2ZE0A 2CLHA 2ZE3A 1J6PA 4HMNA 1T8XA 4DBSA 1TB3A 5I23A 5J04A 3B9NA 1FCQA 3T8QA 3HGRA 5C9RA 1E40A 3QM3A 2J6VA 3NXFA 4A29A 5BW6A 4CQAA 1ZBCA 1XDMA 3G8RA 1TX0A 4PBGA 2GFTA 4D1IA 2ZZ4A 2DU2A 3SIMA 2WKJA 1RY8A 3STFA 2E9BA 3U9IA 2C1GA 3IJLA 4UR7A 3FY1A 2FPVA 4G6CA 5F4XA 1E43A 3UA3A 1JYWA 2W0UA 3LPGA 4DVOA 3GNPA 1P43A 4MY1A 3WJSA 4F3HA 4GCXA 2NT1A 4IX0A 3FXYA 1J8VA 3GVQA 1Q6DA 5A6KA 1XIIA 3R2GA 5PTDA 3GR7A 1TV4A 3W07A 4WF7A 5BXSA 1OSEA 2NXHA 3BV7A 3AXKA 4WGXA 3GZAA 2QR6A 4FNPA 3R10A 3SSJA 2HE8A 1CLKA 1TTJA 1WDRA 1QOXA 2ALRA 4WCJA 1H7RA 4C1NB 1GTHA 3AZTA 2F6XA 1H50A 1ECQA 4HU0A 3E38A 3OIHA 4N02A 1XIEA 5EBAA 5I77A 2GVGA 4ERGA 1KGWA 5DRIA 1DVJA 2IPFA 1PYFA 2PDCA 3T07A 1DIKA 2J24A 3VNMA 4LEFA 3MSDA 3M07A 2QF8A 1JI2A 3DIPA 3V16A 1GOIA 2VHLA 1VHCA 3E2SA 4JDBA 3UJEA 3UW6A 2DZBA 4EX4A 5C6MA 1J0HA 4JHMA 2ZFAA 1NFBA 3TJXA 4KPLA 4AZIA 2WMGA 1A5SA 4E4UA 5FJRA 4DBUA 4HA3A 3VC6A 3PNZA 4AYGA 4O4VA 1PHQA 4FNUA 1OYCA 4N42A 2HNHA 1TTIA 2I9EA 4K8GA 2PI6A 1UKTA 2CETA 3QV7A 5A2AA 4BR1A 1J2WA 3IVTA 4JKLA 1A0DA 3WY1A 4BK9A 1WDWA 1OM0A 3TC6A 1CB7B 1TUXA 2VD9A 3R8RA 3UR7A 5EPDA 1NF0A 1Q4WA 1ML1A 6XIMA 3C61A 3KFTA 3SURA 4NAEB 4RZ4A 3UYCA 3RK8A 1GEHA 1AQMA 1E4MM 3H2NA 2NVDA 1P0KA 3WNKA 3QZAA 2FVLA 1NP2A 4HK7A 1NP0A 2GJXB 2RGMA 1W9XA 2A7PA 5BOEA 3NSNA 4WVXA 3LBCA 3GBDA 5B7ZA 2PCEA 4AUBA 3TJIA 2BSLA 2DORA 3EA3A 3N3MA 4FA3A 2FH6A 5C7VA 1XYFA 3M0XA 2Z1XA 3FSTA 2Q3RA 4HYVA 2CESA 1ENUA 3LCLA 3EB2A 1E6RA 1LROA 2NQHA 1VFSA 3RIKA 5HQLA 2CLKA 4RR4A 4DO5A 3TQVA 2WK2A 1GZJA 1L8PA 5A94A 5D8ZA 3D3FA 4H4IA 3M5XA 4RPPA 5A8NA 3UCQA 1Q6OA 4F0LA 3LM3A 5E0FA 3W7JA 2WNQA 2QJMA 3A5VA 3W1UA 2ZZ5A 3ITGA 1KM5A 2FIQA 1YLVA 5H2ZA 1H5YA 2Q01A 3BL3A 3FYYA 2UY3A 3EOUA 4AZCA 3U4FA 3AWOA 3UWUA 3O1NA 4RK8A 4KEZA 3VDHA 2FZBA 2A85A 2DUZA 4AC7C 4HSOA 1QW9A 4OE7A 3H7RA 3H4GA 3W24A 1AFSA 1CXIA 2GSEA 3RXZA 4IISA 4JTGA 3TYCA 4DJEC 1AA1B 2W67A 1J01A 1M04A 4HK6A 1GTEA 2ATSA 5A1AA 4AD5A 3QHOA 3NJ3A 2Z7KA 1Z8AA 3RNDA 3W2LA 3N25A 3BMXA 4LRSA 5BU6A 3K5XA 4EWND 3UZJA 1XLGA 2WAGA 2X0HA 4ZOCA 1EX1A 1E6PA 3QY6A 4OT7A 1OT1A 4LYKA 3UZZA 1V79A 3MP3A 3E3HA 4M82A 4ADUA 5EMKA 4LW7A 4M1BA 3IANA 3GNOA 4KERA 5DCDA 2RUSA 3ARZA 4P7OA 1V7AA 1EOMA 2RDXA 3GVGA 1ZRQA 1JZ7A 1TYGA 3ITLA 1NH6A 1RK5A 2VWTA 1J5TA 3DAQA 4PTNA 3OZOA 4NG3A 2JGQA 3GS6A 4JEJA 4QG9A 2VX6A 4IP7A 4BF5A 1MUCA 4MWAC 4Y96A 2ZRYA 4JTTA 3N1AA 3N2OA 5I3FA 4A8LA 4IMEA 1XH2A 2ZX6A 3FK4A 3QQ0A 4UQBA 4CEUC 2VZOA 4JL2A 4S38A 1HL2A 4X60A 3UJRA 4E8GA 5LA0A 3SUVA 4O54A 4OUEA 1NFPA 4WSHA 2OX1A 4X3ZA 1LCOA 2QAPA 3N34A 5KZDA 2NSOA 1V6VA 5DN1A 3WO8A 3T78A 3P2VA 5T9CE 2YDRA 1UASA 4AWTA 3H55A 3UNTA 2I1OA 3PR2A 2WQPA 3UNDA 3G5EA 4ZO7A 4XKYB 1JD9A 1B30A 2BNJA 2OT1A 1M01A 2XIMA 2FYMA 4M0XA 5BU9A 2Y61A 5D37A 4GIYA 1UR1A 3U2ZA 2IQ0A 5DMLA 1Y65A 3ZYZA 1XJBA 4X9SA 3WSUA 5BZAA 5CPQA 3AJXA 3F4NA 1VFFA 3F1QA 4AYSA 5C5YA 4DUOA 1JPIA 1HJXA 1DQUA 1VBRA 3AS3A 1AQ0A 1SZGA 1AJ0A 4XIAA 3HFTA 5JH1A 3T0DA 3VDCA 3RYSA 1YEYA 3KBMA 2QCDA 2BZNA 1RBLA 3W1QA 2VJXA 3ATZA 4HMCA 1KRAC 3P74A 1J0KA 3NQVA 1WZAA 4IMGA 3PZQA 5C2GA 7ODCA 3VIKA 2DVTA 1UWIA 2HK1A 3UXKA 4QQ3A 3FXGA 4X2RA 3U5YA 4H9VA 3CLMA 1ZBVA 2W5FA 1HUVA 3LOTA 5LNVA 2I17A 4KWWA 2PTZA 4L80A 3VXGA 3P80A 2WZMA 2WYSA 2J27A 4OQVA 4P2VA 2E9LA 3AOFA 3EWZA 3CUJA 1A49A 2WVVA 2FTPA 4MAZA 3EDFA 2ALDA 1XYBA 4C6CA 1XH1A 5FIPA 1A5NC 3QLDA 4PTVA 4WD0A 5A6BD 4S2CA 1IE7C 3GDTA 3M0KA 3FS2A 3SGUA 2CLOA 4R3UA 3BVJA 1QPKA 1BG9A 1F61A 1NJJA 3IJ6A 4ZSUA 3NGJA 2XFYA 3F03K 4W84A 3ANYA 3TOPA 1GWJA 4MM1A 4MKSA 2FKPA 4Y8EA 2RAGA 1PIFA 4NJIA 1EDQA 3MWAA 3AICA 1KXHA 3B0PA 2GZXA 5I7GA 3SEPA 3KRZA 3ZVHA 4TVDA 5CJMA 4YMZA 2GQ8A 3MUCA 4H8VA 4JR5A 3WUGA 1FWRA 4JIEA 3LRKA 2E9MA 1F3TA 5FF3A 3EX3A 1ZBWA 4IXHA 4RPQA 1CLVA 2WLZA 3P61A 2IQDA 1JYVA 1QPRA 3NZRA 3SRFA 3F5JA 3B0VC 4QE4A 4PYSA 1F4HA 4EOUA 3H4WA 3EX4A 3ARPA 3C2OA 4IGSA 2V2DA 4GC4A 1L8NA 1JFXA 4EVZA 4GQGA 1YPIA 1SFTA 2QUNA 1JG9A 5BNKA 3STEA 1PSCA 2FQIA 5E9XA 2HK0A 2CNCA 3A9IA 3HQOA 4IIBA 4PUUA 4QHRA 4PCPA 1BQCA 1JCJA 1FWTA 3JZUA 1CNVA 4HB7A 2G96A 4QSHA 4J40A 4CN4A 1BTMA 3TA9A 1KQYA 2PZNA 4Q8NA 4WSJA 4LV9A 2EPMX 4MLRA 3ME3A 2X30A 2PTWA 4I9JA 3QYQA 5LIKX 4NAFA 1DWHM 1R85A 1K9TA 3RLGA 1MUMA 3W72A 1GZGA 4WDXA 2PGEA 1KM6A 2CKRA 2GVJA 1LT7A 3D46A 4F40A 3N2MA 3VNIA 5DMMA 1TV2A 4XISA 4JQ2A 5FJUA 3GYCA 2FH8A 1ZFJA 2C14A 1PZ2A 2XISA 1H09A 3OIXA 2PC8A 4GNJA 4WDUA 1E5JA 1O1ZA 3CTTA 5CEWA 5LIXX 2NXGA 2EPLX 2VVSA 2R8WA 5CZTA 3MCMA 3MBFA 3VKCA 3AZRA 5AC8A 1VZWA 1WDSA 1V6UA 3IUHA 1Q8JA 2R91A 3PVFA 3BPWA 3VOFA 5I0DA 3QR3A 1A50A 1H5VA 1R3YA 2VRQA 4JN7A 2EG7A 1M5WA 3WN6A 1GPWA 2GQ9A 1ISXA 3UCDA 1XLEA 3QKEA 3U2OA 1YIXA 4ORMA 2ZVRA 2V69A 2WKLA 2VC5A 2E09A 1FVPA 2J79A 4A35A 3TTSA 3T1GA 5FJIA 2CLEA 3IJ9A 3VTRA 3NOYA 4C6JA 1KR1A 1V6TA 4AZCB 3POHA 4MWAE 1KFWA 2XHYA 2ISWA 4HA4A 1N8FA 4C7DA 4XBJA 6PTDA 3MMUA 1XLJA 1NM9A 3BARA 3V1HA 1JDDA 1RLDA 1WKFA 2BHUA 4D9PA 3JR2A 3K4WA 3VD7A 2Z4GA 4M3PA 2PLCA 1C9WA 2B7PA 3D6NA 1ZJIA 2E7FA 4PFHA 5BRQA 3HG4A 2GK1A 3H21A 2CU0A 3W26A 3O6YX 1R47A 3VGFA 2ZDRA 3B9AA 4XAZA 3A5FA 2VEFA 2E1DA 3OGSA 1XISA 4GYPA 1CXFA 1IR1A 2J66A 4QEHA 4N9EA 1FCUA 3HGJA 1QU4A 1DQXA 4ATWA 2VT0A 4AZHA 3RR4A 3PPFA 1P0BA 3DFYA 3MBDA 3VO0A 2QZRA 1FA2A 1EGZA 2E68A 2XH2A 3FW6A 3R0KA 2NUWA 4O18A 4X0VA 3T2OA 5CLTA 4NYYA 1MFUA 3S5SA 1GVYA 4U5IA 3E74A 3PBGA 1R46A 3FDKA 3VINA 3UG4A 1T99A 4H00A 4M6PA 1UA3A 2QVNA 3IWPA 3I6EA 1I2QA 2V0TA 1H1YA 4A8RA 1S2TA 2VELA 3G1YA 4V1YA 1K9FA 2VDIA 3ZOAA 3TMLA 5CGQA 5JIWA 2FJKA 4CVWA 2PWEA 1C90A 3KLLA 1A3HA 3CHFA 3RILA 4QROA 2NX1A 3SCNA 1EIXA 7REQA 1KWGA 1W1VA 3MKCA 4GACA 1B2YA 3NZ1A 1OHLA 4HTYA 2Z1BA 1R2RA 4JQ3A 3CUGA 5REQA 4IJCA 3H70A 2VEGA 1UP0A 1Y5VA 3C86A 2E40A