3U0HA

The structure of a xylose isomerase domain protein from alicyclobacillus acidocaldarius subsp. acidocaldarius.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
279
structure length
279
Chain Sequence
b'AMEPCLHPTLVDETSLVLYLDLARETGYRYVDVPFHWLEAEAERHGDAAVEAMFQRRGLVLANLGLPLNLYDSEPVFLRELSLLPDRARLCARLGARSVTAFLWPSMDEEPVRYISQLARRIRQVAVELLPLGMRVGLEYVGPHHLRHRRYPFVQSLADLKTFWEAIGAPNVGALVDSYHWYTAGEHEDDLAQLPPEKVVYVHINDTRDAPEDAHDGKRLLPGDGRIPLVPFLRGLYLAGYRGPVAAEVLHETPLDGTGESRARLVRERLEKLIALAKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylose isomerase domain protein
publication title The Structure of a Xylose Isomerase domain protein from Alicyclobacillus acidocaldarius subsp. acidocaldarius.
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
molecule tags Isomerase
total genus 104
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3u0hA00
4QE4A 4DVOA 2GUBA 2HK1A 4X63A 3M0VA 1XP3A 1S5MA 3CQJA 5TNVA 1O1HA 2HK0A 4GQBA 2X7VA 1XYAA 1XISA 1YX1A 3DBNA 3DX5A 4XSLA 1XIHA 8XIMA 3KBJA 2GYIA 4XSMA 4A8LA 1XLDA 3NGFA 4XKMA 4A8NA 3TVAA 4EACA 2ZVRA 3M0MA 5B80A 1XYLA 3BWWA 4XIAA 4ZB2A 1MNZA 4ZB0A 2QUMA 2NQJA 3VYLA 1DE5A 1QUMA 4HGXA 3U3HA 2OU4A 3ITLA 4QDPA 2X7WA 3BDKA 1XLGA 5I7GA 2G4JA 4A8IA 5EMKA 1XLKA 3OBEA 1XIGA 1XLFA 2XISA 2I57A 3KTCA 5XIMA 1TZ9A 3ITTA 3UXIA 1DIEA 3ITYA 5H1WA 3U0HA 4G56A 4HHLA 4J4KA 2QW5A 3JU2A 4Q7IA 3M0LA 5EMLA 1MUWA 3C0SA 1XLMA 4YTQA 3QYSA 3KBVA 2ZDSA 3CQKA 5C9ZA 1A0EA 2I56A 3UA4A 4OVXA 5H6HA 1XLJA 1XLHA 1QTWA 4QE1A 1XYCA 2XINA 4LNCA 1XIIA 1XICA 1CLKA 3IUHA 1XYBA 2NQHA 4KW2A 3AYTA 3BANA 5B7ZA 3GNXA 1XIFA 2QUNA 1A0DA 4E3VA 3KCJA 1I6NA 4GJIA 3C0LA 3CNYA 1XIBA 3C0QA 4QEHA 4X61A 3BZJA 3QC0A 2GLKA 9XIAA 3BZGA 1XLIA 1XLBA 3KWSA 6XIAA 3VNJA 3AALA 4QEEA 2XIMA 7XIMA 3ITVA 1D8WA 3VNKA 2QULA 1S5NA 1XLAA 3P6LA 2NQ9A 1DE6A 4QE5A 1XIDA 3QZAA 5FA5A 3CQIA 1XINA 3KCLA 4ZB5A 3AAMA 3CQHA 3KCOA 3QXBA 4YTRA 1XYMA 3P14A 4PGLA 1XIMA 4XIMA 1XIJA 5AVNA 4HNOA 4YTTA 3L23A 3AYVA 4GLEA 3UU0A 6XIMA 5J8LA 2Q02A 4ZBCA 3LMZA 2GVEA 2G0WA 3KBWA 3VNLA 1XIEA 3FVMA 1DIDA 3IUIA 3KBSA 4US6A 3IUDA 1DXIA 4XISA 5AVHA 4K3ZA 4DUOA 5EMJA 3M0XA 9XIMA 4QDWA 3UA3A 3M0YA 3XIMA 3UVAA 4A8RA 1A0CA 2J6VA 8XIAA 1OADA 3WQOA 4GJJA 4PFHA 3ITOA 4YTUA 1XLCA 3VNMA 5EMMA 3XISA 1GW9A 5B7YA 3KBNA 1I60A 1XLEA 1XLLA 3ITXA 4YTSA 3VNIA 3XINA 3CWHA 4HHMA 3KBMA 4W4QA 4EAYA 2HCVA 1BXCA 1QT1A 5XIAA 4K1GA 3TC3A 3M0HA 4X60A 1BXBA 1K77A 3N4AA 5XINA
chains in the Genus database with same CATH superfamily
2HK1A 3GNNA 4UQEA 3M6DA 4YN5A 6ENLA 2X2GA 2Y70A 5D9OA 4JKLA 4I5RA 3C52A 3CM4A 4E3TA 3MZNA 3BGJA 5F4XA 2QF8A 4OWGA 3GU9A 3IS4A 1C7SA 4I8DA 2QXWA 2ODOA 3GYEA 3I3BA 3TROA 2ZBTA 1X1ZA 3U0HA 1EDQA 3B0XA 3K4AA 2X42A 3QV6A 3U2ZA 3ARZA 3CV2A 1GOIA 4D6CA 4GCXA 3NQ7A 2I56A 2AL2A 4A3UA 1Q8JA 5BZAA 1M04A 2FVKA 2RHGA 1L6FA 1FHLA 3EX4A 2QAPA 1K8CA 3NO5A 1HKMA 4O4VA 3U2OA 1OVDA 1TWSA 3EEZA 3WELA 2Z4GA 1E55A 1A80A 1C8YA 3F2CA 3E2SA 1XIDA 5HMDA 1RPXA 1K70A 4ZB5A 3B0PA 1HKKA 3OLGA 3SCUA 1XBXA 3P8JA 8RUCA 2FB2A 4BHYA 1YQ2A 4WDTA 5BCAA 1QHOA 3BARA 4AU0A 4CQBA 3C2VA 4DXKA 5AZ0A 5IHRA 1GGOA 1F4AA 1O60A 1KFEA 1TV8A 3ABSA 1UUQA 1B0IA 3OYXA 6CGTA 5DEZA 3CL8A 3MV01 3MCOA 4U10A 4AWSA 3LHVA 2JKAA 2GOUA 4H6RA 4IM4A 3VDCA 5BW6A 2XIIA 2ZRUA 4JL1A 4JR5A 5AHFA 4K39A 1UR3M 5AHNA 4GZJA 1A5NC 3WQ6A 3WQFA 2J8GA 1OFOA 1HKWA 4L4OA 3WQDA 1NP0A 2IUZA 3QW3A 4UNKA 3N14A 3OGSA 3S46A 2CU0A 1T8QA 2BSLA 2BWGA 3HGSA 2KAUC 3FHAA 3PUOA 4DJDA 1EGZA 4PCFA 1TVNA 2WMJA 2BODX 3GDBA 1XIBA 2AKMA 3C61A 4NZ1A 4H9MA 3UXAA 1CGXA 3UG3A 4H7CA 3KLLA 1KFCA 2TRSA 3PWIA 3UCDA 3KLKA 4DF0A 4A2SA 1WXJA 1P0EA 3BJSA 4LPCA 3VIKA 3RLVA 2P3ZA 1TPEA 4CUCA 4DWSB 1V6YA 2XG9A 4O18A 4RE3A 3CH9A 2WCGA 3WQCA 3V36A 4JHOA 5E93A 3IJ6A 1QNRA 3N4AA 3DOPA 4W7WA 2Z2UA 4EPKA 3MBFA 2WHLA 1YPFA 2QPUA 1GQKA 4GMEA 3D47A 1BVWA 3EKGA 4AZGA 1OEPA 3FEQA 2V0TA 5K3VA 2C1IA 3WH9A 2HE8A 3M0MA 1J0KA 3NGJA 1KXHA 1EF3A 2FTPA 1DJYA 1PBGA 2OMAA 2J9XA 2ISVA 2EKGA 3HMCA 3LHUA 1UR0A 4MZ1A 5EMKA 3T7VA 1TX2A 2DZBA 1TPUA 4O8RA 3U2CA 4MJZA 3TA6A 3BSHA 3VVGA 1FDZA 4AZ5A 1OT1A 4PBEA 1MZRA 5BRPA 3CL6A 3VIPA 2CITA 2HEJA 3GR7A 1UR1A 5EU9A 3ZIZA 4F0MA 4CCEA 3VZZA 1XS2A 1QFEA 1J6PA 3RCMA 4AIEA 3L0NA 5I0DA 4FLOA 4UFJA 1PJ9A 2WC3A 1SU5A 3TLQA 1JDCA 3HURA 1NM9A 4KRTA 2FZMA 1RPKA 4IIEA 3TTYA 2GGHA 1TJRA 1OCNA 3GDKA 4R3UA 2HRWA 4JEQA 3E5PA 4ONVA 4PGLA 1VCFA 2VOMA 1WAUA 3RDKA 3S6OA 2YBUA 4POCA 3DEQA 1L6GA 1OX6A 3LV6A 2HBXA 4LAOA 1GEHA 1GVQA 3UCCA 4NJKA 4S3AA 1CT5A 3O6DA 3FYOA 2X30A 5HJLA 1SYTA 3LLFA 4RDZA 3VNIA 4CD5A 3DESA 3WQ8A 1R3TA 1O12A 3M0VA 4QJ3B 4MNLA 3E0IA 1UKPA 1K7EA 4CNPA 1Q7QA 3EDKA 2R91A 3LXAA 3S1WA 3SCNA 4LSBA 4PMZA 4LALA 1XR2A 5HATA 1B4KA 5FI8A 4H4IA 3SN4A 4U3CA 3RMEA 4LEFA 3T0TA 4UFLA 3GYCA 4MF4A 1WKEA 1RVKA 3ALGA 4DPPA 1Z42A 7TAAA 3TX9A 4QROA 4O12A 1BQGA 4O0QA 2DVTA 1NF0A 4C6IA 3BGGA 4WRHA 5T91A 4K68A 4ZOCA 4BF7A 4KCWA 3A12A 3BZJA 4JQ1A 5D2XA 2TPSA 1ZAHA 2NQ5A 2PCEA 3FA4A 3FFSA 5EY5A 2B7QA 3PFMA 4HA1A 4UTMA 4HCDA 3W7CA 1VP5A 4C1KA 3V3WA 3TQVA 4AXKA 3MQTA 1ZALA 3VZXA 2IW0A 3I10A 5KTLA 3P61A 3CZLA 2BOEX 2H6RA 1OB0A 2YL8A 1EOMA 3OJGA 3ZLHA 3H70A 4UFKA 1H7XA 1GYNA 3W28A 2W0UA 3PPFA 3GBDA 4B91A 1K9TA 4C6KA 1YRRA 3N9SA 1XRTA 4DLMA 4GI6A 4A8LA 4U2ZA 2XFFA 2FGLA 3FJLA 1UASA 4IMGA 2Q8ZA 1AUSL 2OTDA 5A6MA 2BP1A 3AIQA 1B9BA 3GTXA 4FNRA 5FJUA 1ECQA 1V0MA 3E12A 4GXWA 3KVKA 4NVTA 4XD6A 2C79A 3B05A 4ACZB 4K8EA 5JMUA 1V3IA 3Q2DA 2OFJA 1JGIA 2PDMA 2ZYFA 4DHGA 1IT8A 4Q7IA 3V5FA 1C90A 2PWHA 2CBJA 2OLHA 2DT0A 4KGJA 1V08A 2XJ7A 3F5JA 4V27A 1G5AA 2JGQA 2Y61A 2ZRVA 2XGZA 3A21A 2YXOA 4GY1A 1P6WA 1AL8A 3GQYA 4GBUA 5CEWA 1IZKA 2PLJA 4DJFC 1TWDA 1UPPA 2Z1WA 3BVJA 2NVAA 2NQZA 4JNZA 1J0ZA 4KGLA 4YWIA 3THDA 3VDBA 3R12A 2CYGA 4IPLA 3S9YA 3PNZA 4TMCA 4QLLA 2HE5A 3ZZ1A 3BG5A 4IHCA 1ITUA 1F9CA 1EX1A 4K6AA 5DY2A 1UIPA 2FHBA 4RCXA 2YL5A 4HK5A 1VFHA 1JQVA 4C6PA 1E4MM 1CGYA 1JNEA 3W7PA 4J3UA 3CIVA 1PPIA 3U9IA 2WANA 2GFTA 3CLMA 4B2DA 2VZOA 1CECA 4EK7A 1XKJA 1R2RA 4KRZA 2ACUA 3GXMA 4AD3A 4OOUA 3RJYA 4HPHA 2CLLA 1JZ8A 3EX1A 3SGGA 4Z42C 1AW5A 2ZUSA 4UZSA 5IFPA 4IISA 1E70M 1W3LA 4O13A 4ZSUA 1LYXA 1UQZA 2OR2A 4QXIA 3CZ8A 4Q8NA 4AZ7A 3VGEA 1BRLA 3N17A 1SFLA 1XDJA 2ONEA 3OU8A 3DXIA 3PNUA 5IHSA 1DP0A 1F3XA 5H6HA 1H50A 3GR4A 4QQ3A 5I3FA 1HGYA 1A5AA 3WMBA 1XIFA 4PCNA 3UXKA 1O95A 1NJJA 1A50A 3AIEA 3LBCA 4B3LA 4TU1A 2GOKA 1P1XA 3S83A 5C5YA 1XLAA 2YR1A 1NARA 3SFWA 1ZU8A 5FAGA 2BB0A 2QCDA 2ZXBA 2X0YA 3AFBA 5FAJA 2POZA 4YS1A 2BFGA 1TG7A 3N2BA 4QM1A 1OQFA 3TC7A 4RZ4A 1UROA 2Y8KA 3AS1A 3QOMA 2GJRA 3GAYA 4DJEC 5EFDA 5HQEA 1R47A 2BXYA 4H7ZA 1ICQA 3M4HA 4GUJA 1KLYA 2A4AA 4DYKA 3A4WA 1OK6A 3R79A 2V2CA 2WV8A 2DUZA 3M7SA 2ZUVA 1G6CA 2CZEA 3E2RA 1D8CA 3APGA 2CW6A 3CMJA 1W3IA 2DSZA 3DFQA 4BQ4A 2VDIA 2DT2A 3SAZA 4JTEA 3GM8A 1PEZA 4XZHA 1FFQA 4IIBA 3PK7A 5I7GA 1KRCC 2J77A 2DFAA 2QLYA 1B9ZA 3VIFA 1PB0A 5I3DA 3AO0A 3DGRA 3UWUA 5M03A 1K6WA 1F07A 1TIMA 3GFXA 3R1ZA 3AXKA 4MB4A 3WJZA 2WJEA 4YWSA 1GYLA 2VMFA 3WD0A 2QCNA 2JF7A 4AWEA 4Z1DA 1K7XA 4FALA 4QJ1A 5AB3A 3BCDA 1Q85A 3ANUA 1RUSA 3E0FA 1L0PA 2ZZ1A 3RR1A 1W2VA 3BZGA 1CYGA 1KBIA 4HJWA 3TA9A 2OQYA 3ICJA 4HA0A 4TOQA 4UMAA 3MTWA 5LSMA 3DECA 3L4UA 4L1GA 4Z08A 4NL1A 3UBPC 1GJWA 2YDAA 4FHAA 2O7QA 3CHVA 4O8AA 1AFSA 4QSFA 3EAUA 1VB9A 1EEXA 1E6NA 4WKFA 5LXEA 1VZWA 2G0WA 3G3DA 3W2LA 1VFUA 3FVMA 3NZPA 1GOOA 4NZFA 3CXOA 4KFPA 1P6CA 2EPKX 2BXZA 3QV8A 2WJZA 3G1SA 4OV9A 3WK0A 3QW4B 2VGIA 2Y8VA 1WKYA 3ANVA 4BCEA 1U1JA 3LTPA 2ABBA 5I77A 4W5ZA 4AVFA 1SZEA 1MXDA 1W5MA 4QG6A 5HQLA 1B54A 4WY0A 2UWFA 2WKJA 4IQDA 5TQLA 1GKPA 3VD7A 2EJ1A 3H2NA 2BVTA 4XAZA 4WF7A 3LCHA 4ZFMA 4D6HA 3OGRA 4MAVA 5CBBA 1LROA 1E51A 5E5CA 3UJEA 1LL7A 4C6NA 4NRRA 5FJOA 4C6MA 1T5AA 3PF3A 4KEMA 1KFLA 5HPOA 1M6JA 1QJWA 5AYIA 2AKZA 3ZQ9A 3NL3A 3LXBA 3ORWA 4W8LA 5C9WA 4EWND 3ARWA 1RY0A 3VPLA 1W54A 2VELA 4Z2IA 4INFA 2ABAA 5A2BA 3LX9A 1WDSA 2X1TA 3UA4A 4E2VA 1SSGA 1V0LA 1JXJA 3ELFA 2NQHA 1VRXA 3C6CA 4H83A 4KWOA 5C9UA 3FK4A 2O9OA 5DO8A 3ZR4A 8A3HA 1HZYA 1MMFA 3HU7A 4DF1A 3W7HA 4B5XA 2DDXA 1E1FA 2R6OA 3FJ6A 4JQ3A 3SSZA 3SGUA 3NIYA 1J11A 3H2EA 3N6HA 1XYMA 2FZ9A 1UZHA 3SBFA 4WSJA 1N8WA 3W1MA 2VHLA 3CUFA 2DSUA 1SGJA 1LT7A 4KCUA 3VM7A 3HQNA 1XD0A 3NQ8A 4XTIA 2GVJA 3R0DA 4J5NA 3S2CA 4CCZA 3VU2A 1Z3NA 3NQBA 2QVHA 1XCWA 2VRQA 4CQ9A 2E09A 2PWEA 2VEPA 3HG3A 3TZNA 4UTTA 2Y5EA 4ZTYA 3WQWA 2G5WA 4AF0A 5TIMA 3W7RA 3VGGA 1W1B1 4RZ5A 3R8GA 1PDZA 2YCIX 4WSKA 4KT2A 1W9BM 3SJNA 2DSWA 4RX0A 1DBTA 3QHNA 1QDSA 3A4AA 5J04A 3NVTA 4PA8A 1C8XA 4OECA 2ZE0A 3WN6A 1TZZA 1KTNA 3K13A 4PC8A 3RPTA 2PP1A 1I6NA 3BLOA 3WLHA 5D8WA 3DCPA 1B3VA 2ZE3A 6XIAA 3AALA 3ZT7A 3UZXA 2ZC1A 1BYBA 3MUAA 4R34A 2I7GA 1RCOB 3RLUA 4L4LA 3VGFA 3W7DA 4LYQA 4OU1A 5D03A 1I0DA 1V02E 2PS2A 1F3EA 5HQMA 4QCEA 4E4UA 2VWSA 1JULA 4FNUA 4ERGA 4HVXA 3UG8A 1XLCA 1T8XA 2W66A 2V69A 2YDSA 2EPLX 4XZBA 3T8QA 4TXEA 2C91A 2ZC8A 1L2QA 3CQJA 1WKFA 1TQJA 1H7PA 3ME3A 1Z32X 3W1NA 4JYFA 4FEZA 4ZQPA 4WHBA 3EX6A 2D2HA 4CKQA 3GVWA 3WK2A 3VIOA 3WUGA 1YADA 4IICA 1K1DA 2Z2BA 1PWMA 1XPYA 1XLFA 3BAXA 2XISA 4O57A 3GNRA 4N2YA 3GH5A 2NXGA 3QR1A 2KZHA 3UERA 1SW3A 1TPC1 4U5KA 4AYSA 3B97A 1B2YA 3GRIA 2XM1A 4N6FA 2YJQA 3P80A 5ABGA 3NPVA 4QNEA 4UTJA 4M51A 1PZ3A 4M80A 3WH8A 4RJEA 1OC5A 4YLWA 5DBUA 2XWDA 3RM8A 5F2LA 4XD5A 5AZ1A 3AAMA 3W87A 5E70A 1MFVA 3RX4A 4YCOA 3S1UA 4L5ZA 3EKZA 3PWAA 4ZBCA 3LMZA 4H9XA 1VEOA 2PDBA 5AVHA 5GNZA 5EKYA 4JTLA 5FJJA 2QCGA 3HM7A 4M6PA 1E0XA 3AIRA 3E2QA 2J27A 5K4XA 2A6NA 2CHNA 1T6MA 1IWAA 2VNCA 3MKCA 4I8YA 1C91A 4WDUA 4EIVA 2YB4A 1ONWA 4FB7A 1XLEA 2PDUA 4GINA 1JUBA 1C92A 5FEZA 2E9MA 3QGVA 4J3WA 4X60A 3B9NA 3S47A 1LJYA 5JU6A 1UD6A 4MKVA 1TE6A 1XC6A 3DKLA 3F4NA 3GDMA 2YL6A 1HL2A 1Q6GA 2NT1A 3OG2A 3WMCA 3PZUA 4I9JA 1E3XA 4GX8A 3B8SA 3MU7A 3I7SA 4GYPA 2VC5A 3DYPA 4AX7A 1FDJA 3Q94A 3NL6A 3R11A 2Y63A 3PZQA 4F8XA 4K1WA 5C71A 2OZTA 3ATYA 3EPMA 4MY8A 4ZQMA 3MY9A 2CHOA 1YTKA 4Q4OA 3M0IA 1HG3A 1Q6DA 1CLKA 4UQ9A 3B0VC 4RNFA 3A9BA 1EZ2A 2INZA 3LSBA 1W5OA 4GJIA 2V68A 3KHDA 5I3KA 3HFTA 1XHGA 2H8ZA 2BTMA 2W92A 7REQA 1XCXA 4I7UA 3LRMA 2Y4SA 1BRLB 5ABEA 1TJ0A 1UZ1A 4AFYA 3NG3A 4QITA 3WDPP 4HOZA 4D9PA 4W86A 2HV5A 2JQXA 4QJ5B 1SM9A 4FF5A 5DT7A 3IJ8A 3UVAA 1N2VA 5I3GA 3BAKA 3C56A 4XK2A 3CV1A 1TCDA 5GNXA 1Q4NX 2QCDB 3LTSA 3LHYA 3IJQA 5C55A 4BQ5A 3E74A 1FCBA 4XZIA 4Q4QA 1XL9A 3G1VA 3IV3A 4UTLA 1WDQA 5FESA 2XN0A 1YTDA 1MEIA 4EACA 1B30A 3RHGA 2GWGA 2PTZA 4HGXA 1QI2A 4DYJA 4GQQA 4EPDC 3N6QA 2EPNA 2DZWA 3LCGA 1TUFA 2VZVA 4FA3A 1LWHA 3K1GA 4HTYA 2OB3A 3WEZA 3EB4A 3U2EA 4WXZA 3RRAA 1R30A 3V5OA 1YPXA 2VKZG 1PDYA 5IDZA 3LGGA 1KWKA 1NFPA 5KZDA 4JKMA 3ZWTA 2E40A 4JAWA 4N4PA 3BGAA 1ADSA 5IBXC 3B8TA 3KCOA 4LVGA 1J0IA 4H6KA 1FP9A 1WXZA 3GK0A 1H1ZA 4S3FA 1LQ2A 2QMJA 1TPVA 2QF7A 5DFAA 4IJRA 1JG9A 3EDEA 3TYDA 3KOYA 3CB3A 4K8HA 3VNMA 2GSJA 3KZPA 4MLRA 4NJHA 2IKGA 2VR4A 3U4FA 1K77A 3RYSA 3AYSA 3C2FA 4JIQA 4GY0A 3W88A 3EEGA 3A23A 3P5ZA 4IUOA 4M3PA 1FWJC 3W9ZA 1HJWA 2X0HA 5CC7A 1LWJA 4NNCA 1VLWA 3NGFA 4MNJA 4G7EA 4MJMA 1QU4A 2W9MA 4AZ6A 4UTIA 1UG6A 1MDRA 2C19A 4AXNA 1CDGA 1RZMA 3SCQA 1W91A 2B0MA 3LPPA 3VC5A 4ROQA 5CPLA 4Y9NA 5AHLA 1FWDC 4H7VA 2Z6IA 1Q3NA 4RNIA 3QY6A 3WLRA 1DTNA 1UD2A 3WK3A 1AVAA 2I5GA 4GVGA 2REQA 4DUXA 1QOQA 2ZWZA 5CSSA 3AJXA 1REQA 2FVMA 1Z6KA 1RJPA 4HP5A 1VYRA 1TPFA 5E6YA 4D1JA 2J62A 1RBAA 1W3KA 5A6KA 3WLTA 5M2FX 1TR1A 1HP4A 3Q65A 4IFKA 2OXNA 4HK6A 3TWAA 4TQTA 3DDMA 2PPGA 3IIZA 2HROA 4LW7A 1UP2A 2DZAA 1FKXA 2RDTA 5G1MA 4PTNA 1XX1A 4H41A 4LF2A 2ISFA 4MWAB 2VJXA 3S5OA 4S3BA 1PKNA 3QKZA 3G8RA 4S3GA 2DW6A 4PULA 1JFHA 1XDMA 3BW3A 1WDWA 3DC8A 4CEUC 1KM4A 2PLMA 3I4KA 3S42A 2R14A 1GVIA 5E0FA 4DX3A 3T2QA 2H3BA 2O4QA 2V2HA 3T4WA 1ELSA 5MF5A 1R7AA 4LB3A 4UR7A 4HNLA 1UWUA 4ORMA 2X1UA 4N7QA 4O1BA 4ZXOA 4CU7A 1PXGA 4PUJA 1LTDA 1QNOA 1VCVA 1BYCA 3TEVA 3JRKA 5AECA 4H1ZA 1DPMA 1BXNA 3BDKA 2WZTA 2J7EA 1MZHA 2I57A 4W84A 3G6MA 3TN3A 1OWQA 1GONA 3OZYA 4AF0B 2QJJA 1TVPA 4OVXA 1XIIA 3N2XA 2J4GA 3OQEA 1ZTVA 3II1A 1V93A 1BAGA 4FOJA 2YCLB 2GGEA 3CPGA 4JQ2A 1QCWA 4YHGA 1WUEA 1AH4A 1VFLA 4LAKA 2VFEA 3DFNA 2NV9A 1UR2A 4RDYA 2QJMA 4NXKA 3ZVHA 3W7OA 4U28A 4P8UA 3MWCA 1UHVA 3A64A 4GVHA 1YEYA 2C14A 3CO8A 3IRSA 2GJPA 1U5HA 4Q7NA 1F73A 1AQFA 3MANA 3FSTA 3KBMA 4Z0JA 2J8TA 3WQ4A 4TTGA 5D04C 1A4MA 2XFWA 2X09A 5CXPA 1WX0A 3IJIA 3QMSA 1JGMA 2C7FA 2JE8A 4ZQRA 4CQAA 3TVAA 3W73A 1EHNA 2WNNA 1KCXA 5E9AA 3UXDA 1W9DM 2FGBA 1XLKA 4C6BA 3KRSA 4M56A 4HT3A 2FGZA 4NJIA 4B15A 1V3MA 2D20A 4OTKA 4EXBA 2FZDA 3P7YA 5FF7A 5CGMA 2OZ3A 3MUZ1 2TAAA 4OQVA 2O9RA 2PTWA 3D6NA 4GNJA 1I4NA 4JTUA 4EXAA 2BBFA 3LPOA 4HB7A 5LIXX 3F7JA 2DZSA 4JDYA 1IV8A 5BWAA 1NQKA 4J3XA 2NQ9A 1F8IA 2NUWA 1TV7A 1AJZA 3DIPA 4YVPA 3NSNA 3GVQA 4O14A 2QDEA 4WKAA 4BWLC 2INEA 4BI5A 3PN8A 4YTTA 3KFTA 2D22A 1E43A 2YXGA 4V1XA 4C90A 3TTOA 2EG8A 3O7UA 4BI6A 3DFYA 2QJIA 3MSDA 4JTHA 5ABFB 1GCYA 1MQRA 1AH3A 1VEMA 3VDGA 3I7QA 5FJPA 5FL1A 4NAEA 1E5NA 4ZO6A 1MXGA 5LIUX 3PZ9A 2VDGA 3WQVA 2GGGA 3E02A 3P0WA 2V9DA 1XIHA 2UY5A 4O17A 2WMIA 4B3ZA 3VXGA 3C8NA 2VCAA 2VCCA 2VXNA 1RALA 1MXSA 1ZY9A 3QVQA 5K7JA 3U3HA 5AN7A 1Q6LA 1DWHM 5DN1A 2R1MA 5GVJA 1XBZA 2PTXA 4V1YA 5CZ0A 3N73A 3TE9A 2J7DA 1P6BA 2NQLA 3M07A 1YNPA 4F2UA 1S2UA 1CCWB 1KRBC 1RVGA 3HV9A 1PX3A 5EBUA 2A6LA 1IEIA 5GJNA 4LYPA 3MCNA 3DGBA 3VOIA 2DEPA 3AMLA 1J0YA 3C0QA 1TMQA 4ACYA 3KX6A 2X1RA 2QQ6A 2PGEA 1NH6A 3T09A 3GB6A 3ITVA 3UP8A 1KM5A 3HPZA 1C93A 4N9BA 2Z6JA 3U8GA 4GYFA 1OFBA 5J8LA 3WUFA 3WFLA 3B06A 2F6KA 3KAOA 4A4AA 4B5UA 1NOFA 1U2YA 3VTRA 2FHCA 2GK1A 5A6SA 4M6QA 4X2PA 5BOFA 5LIWX 7REQB 2ZRYA 1JUEA 4ZXLA 3GD6A 1H2JA 1TV2A 3GZ3A 1I60A 1FH7A 2BLEA 5LNRA 1Z89A 2EJAA 3O06A 3GH7A 1F76A 3QHOA 2PDYA 1JDDA 3CK5A 2FDMA 2Z1SA 3AMDA 5DF0A 3VD3A 3QF0A 1R9YA 1B3YA 1E6SM 2BVWA 2Y6ZA 2ZICA 4AZCA 1TPH1 3PZTA 3P2VA 2PZNA 2XVPA 4FXFA 5EFFA 2QS8A 3W4RA 3W53A 3LENA 2HVNA 3VIGA 1TVLA 2V81A 2PDJA 3THQA 4BS0A 1OCBA 2ZDSA 1O7AA 5DXYA 1Q2RA 1W17A 2XINA 3W7LA 1O4UA 4PR4A 2BGSA 4UTWA 2NXIA 4NILA 3CAVA 4UTFA 3L67A 4MPKA 1UR4A 4JKKA 4D72A 4W93A 4HMCA 1KWGA 3SY8A 5GPRA 2D0GA 3QBUA 1W5NA 3L65A 1QHPA 1M1BA 1CX9A 1W1YA 1S2AA 2PDQA 1V0KA 3QRHA 3T0BA 1J6OA 1M7XA 4MADA 3NXLA 2CKSA 2EO7A 3WBWA 3RILA 4QLKA 5IRPA 2YOCA 3E3HA 1U22A 2JKEA 3M0YA 5H8PA 1UP0A 2WXDM 3CHCA 5J5DA 1J10A 3U7BA 3DFSA 1JEZA 3W6MA 4GK8A 4X0NA 4W4QA 1DJIA 4NAFA 3FY1A 3LERA 1VGAA 2XH7A 2QCEA 4ADUA 4EF9A 5FKYA 4R53A 5H2ZA 3LN3A 3ECQA 4CNTA 1EWEA 1TV4A 5B80A 2VFFA 1WUFA 1V3JA 5T9CE 5FCZA 2A1YA 5BXSA 4XV0A 1F2JA 1VFOA 4J27A 3VX0A 2DORA 4NG3A 5C8BB 1N82A 3AXXA 2VC6A 3SQSA 2FZ8A 2PLKA 1XLJA 2X16A 3RUBL 3UZJA 4WOQA 3AMCA 1MUCA 4ATDA 1KBKA 1NIUA 4RL3A 3SSJA 3EYPA 3KTXA 2REQB 1IR2A 4KCVA 2CIPA 5M3WA 1T0OA 1REQB 1XIMA 3LY0A 3ZO9A 3HIJA 3OO2A 3TYUA 1DQUA 2IS7A 4M7SA 3PM6A 3T9PA 3GXIA 2TODA 3WNLA 3ZT6A 2QGYA 1XYFA 4UTUA 2CESA 4IIFA 4AMCA 1VKFA 2OCZA 4C6OA 5AHEA 2QHAA 1KM6A 1JD7A 4IFKB 1P7TA 3DG7A 4C6QA 1SFJA 1TCMA 2NUYA 2D3LA 2D73A 4FLQA 4IL2A 3GNDA 3WMSA 5FJTA 1PX8A 3NNTA 2Q8LA 1E6RA 1KRMA 4CQDA 1J0JA 1NEYA 3DBNA 1IXOA 1KV5A 1JF5A 3BLFA 3EOLA 1X1NA 5HR7A 1SQ7A 3W71A 1ZPTA 4MYXA 1XKYA 2OOFA 3I4EA 4JHMA 4LUYA 4O16A 4MUZA 3AS0A 1GOKA 5EPDA 5KZEA 1BVNP 1S39A 4REQA 2XPKA 2OZ0A 4RK8A 4GY7A 3GX9A 3FSUA 4JQAA 5A8NA 4J3SA 3LLDA 3GG0A 5L9FA 5G2IA 1TIWA 2BV9A 2VUNA 5B7ZA 5AHIA 2XH0A 5BXTA 4AIBA 4PMJA 2CPUA 3EX3A 1FWRA 1OFPA 4DZ5A 1HT6A 3OA3A 4O1CA 3FAWA 2BHZA 1H0IA 4ZTXA 4J35A 1Q7MA 3P93A 2DQXA 1BD0A 3KCLA 4XD4A 1HL8A 4RKAA 1KCKA 2GUYA 2VFHA 1F6KA 1M3UA 1JQXA 4ZODA 3VNLA 3ZMRA 4HPXA 1EGMA 2OKOA 4QDWA 4S3DA 3M1ZA 4MB3A 4HZ6A 3H23A 1H63A 3LRLA 5E1QA 4WCJA 2PC4A 4AIUA 2NLYA 4IOTA 4P7OA 4A6GA 2Y2WA 3CT2A 3ZVHB 2G37A 5AC7A 3MVIA 3OB8A 4LCQA 4PMYA 1KQZA 2ZZ3A 3HV8A 2C0HA 1F5ZA 3DH7A 1LUCA 4FNSA 2J75A 5AKQA 1JZ6A 4HYRA 3QTGA 4WY0F 1AODA 2OG9A 2UY2A 1FA2A 4PUWA 4BKNA 5BRBA 9RUBA 4E6MA 4PYSA 1G69A 4RLIA 3B9OA 5RUBA 1POJA 4S2BA 3F4WA 5A3HA 4MGGA 4MY9A 4GABA 4UUIA 1SMDA 1UW9A 2OPJA 3SO7A 3G77A 4DF2A 4GIEA 4BR1A 1M9HA 2WKGA 2YBVA 5FEXA 3HBLA 3T07A 3UJRA 3W74A 1TTJA 4JS3A 5D9NA 4WZHA 4RXGA 3UR2A 6TIMA 1JRCA 3GTFA 1EZWA 5CZTA 3ZXWA 1RP9A 2A7NA 3N29A 1X96A 4D71A 4A35A 5E0CA 5AFDA 3TYCA 3GG7A 4TX9A 2DVUA 3KBNA 5A2AA 3QMRA 2I17A 1XRSA 3OBKA 1VBGA 1DQWA 4OT7A 3IJLA 1PUDA 3APTA 3RO8A 5SWUA 2DH2A 3PC0A 1UA3A 2PU1A 4LUSB 4ZA0A 4I5UA 5DT5A 5CSRA 2R8WA 3H26A 5F2IA 5T9BG 1J12A 1GOQA 3AYRA 5BMWA 1GVYA 2NXHA 3ES8A 3U5YA 1FBAA 4LBSA 2DY3A 1XH2A 1M53A 3NQ2A 1ISWA 1SO6A 3LEPA 1XFCA 2YDQA 3Q45A 1US2A 4C7GA 3FYPA 5AYBA 3N9KA 3PANA 2WMIB 1T99A 3ES7A 4M6VA 5BXRA 3M47A 3WH6A 4PODA 1C3FA 5GNYA 4XZ9A 2Q6ZA 9CGTA 3KVJA 4HCHA 3A24A 5D38A 3T8LA 3WF1A 3NZQA 1EXBA 3CNYA 4C6LA 1RBLA 4DY1A 4ASTA 3VOHA 1LOQA 4JY8A 3NXFA 5BU6A 1AD1A 3L5MA 4PMNA 4YIWA 1HNYA 1EH9A 2AL1A 3CQIA 4JFSA 3C4UA 4Q32A 3ABZA 2EAWA 4JIRA 2XIOA 1P4CA 1MYRA 3C8FA 4V28A 5FSEC 4KEUA 4AD5A 5LKYA 1I2QA 2J6VA 1ISVA 4IT1A 1K02A 1T40A 3TN4A 5I23A 3GLCA 2AQWA 3QSRA 3O05A 1NDWA 1FY6A 4Y9OA 3PUGA 1BXCA 1KTBA 1BSLA 1O1HA 4M1RA 3B8DA 1LRNA 2NWSA 1XISA 4XSLA 2GK1B 3MW7A 2Q01A 4L9ZA 1V03A 2ALDA 3RITA 3LG3A 2ADAA 3C86A 1EC8A 1W3NA 5BROA 1ONEA 1A3WA 3IJ7A 4DJDD 1UR8A 4M24A 1E1CA 2FIQA 2Y7EA 2QYGA 3W85A 4UXDA 2EXOA 3EWXA 3W24A 3GNOA 4Y6GA 5HMEA 1WDRA 3W38A 4AISA 2ZA2A 3ZLGA 1PCWA 4QSHA 4D6GA 2ZKMX 1JPIA 4RPPA 5CPMA 3ARQA 3TK7A 3L2IA 4AZCB 1M7PA 3FCPA 1HJXA 1LP6A 3TTSA 1EDGA 3TLLA 1GJUA 3K1DA 2L5HA 2OYLA 1XINA 1FXPA 2ZUNA 4R33A 4MNMA 1IXQA 1OGBA 4MFEA 2YFNA 1NDYA 1SO5A 3BLEA 4NUWA 2OZ8A 3G1FA 1YLVA 4QLJA 4WGXA 5DCBA 3B40A 2GVGA 2RJGA 3GTIA 5DELA 1WYIA 3R89A 2WVSA 2AGTA 3V75A 4AWTA 1ENUA 3FLUA 3H4WA 4CD8A 1SW0A 4Q8TA 4YXGA 4JGDA 4LUTA 7TIMA 4UOJA 3VO0A 3C2OA 1N8IA 3PZNA 4QAWA 4QE4A 5HUPA 2E9LA 4JX5A 4JX6A 2OSXA 4Q7BA 2VURA 3FYYA 3AXMA 1G94A 3TYBA 3WF2A 3UY7A 4GVIA 3PJWA 1XLDA 4NIRA 1V7AA 3LPFA 3U48A 1AMKA 3TN5A 2MNRA 4Z2GA 2ZTKA 3SGZA 4LUJA 4CNOA 1DXEA 2JF6A 3NQMA 4NAFB 1YHTA 4PMUA 5TD4A 1UMYA 3W1QA 3OPSA 4QQUA 1KFJA 3MHFA 4KRUA 4JICA 5MKGB 5DQPA 4LAUA 1ODZA 4L65A 3MHUA 4CD6A 2H9AA 5EL1A 3TFCA 1ONXA 1GKQA 4KMQA 4K2SA 3B4YA 4AY7A 5CPNA 1CXLA 4K7YA 2XYLA 1UZDA 4DI9A 1BF6A 2TSYA 5BWFA 2PDPA 2E5DA 4NZ5A 3PPCA 3EDDA 2W91A 1BGAA 1CLXA 4OBRA 1OSEA 1KTCA 3NEHA 5AVNA 4K37A 2WZEA 3NQEA 4ICNA 1X6UA 1WOBA 2UZ9A 3MJMA 1XSIA 4IQJA 3R5EA 3TAOA 2ZCGA 1SR0A 1PAMA 4BZYA 1GORA 1IE7C 1J9YA 4GBDA 2VC9A 3ARVA 3ZSTA 3R8HA 2P88A 5D02A 3SQMA 1G9HA 3OZMA 2BY0A 4XVDA 4L9XA 4YHEA 1ESWA 3EWBX 3WUBA 1P7TB 1QPRA 4GVFA 4P7LA 3O6YX 4QCFA 1KW1A 5I78A 4L6DA 1XRVA 5K9CA 1GPWA 4HZ8A 5JBDA 3H54A 4EF8A 4GO8A 3B04A 3HG4A 4LBRA 1KB3A 4Y96A 2GVLA 5F1UA 1EYWA 4IQLA 4KWUA 1Z9AA 3L5AA 4BY3A 2FPYA 3A5VA 3AMGA 5A6JA 1PYFA 2C1HA 4W7UA 4B5VA 3GHRA 2WHJA 2ZXAA 4C6FA 4BJHA 1KFWA 1RCQA 1DYSA 4REQB 1R87A 2C13A 1RD5A 3LA4A 4U5IA 4W9TA 4XUYA 1E6XM 3FA5A 2CZVA 1ITXA 3UJ2A 3W1UA 3N04A 1BTMA 3H4GA 2DIJA 3LV5A 1CENA 4FPSA 4H01A 4CVWA 4E38A 1M65A 3V0TA 1Q6FA 4URIA 2I5QA 1H51A 4DWSC 1BKHA 2CERA 4OBSA 2QUTA 2WSKA 2GJLA 4TMBA 1BYDA 3UQNA 3DBPA 4WEVX 4U2YA 4GG9A 3L9CA 3OLEA 3CGTA 4AMAA 4LCSA 3STPA 5DMLA 1E5JA 1YNYA 1J8VA 3PAJA 4NQ1A 1I9CB 4XUGA 4JQ4A 1QAPA 2HJPA 1BPLB 1EBGA 3JW7A 1XBVA 4UC5A 4KWVA 1V5XA 3QPEA 3W1AA 4MDOA 3L2MA 2XIBA 3BLPX 4JEJA 3KDNA 3PVFA 4GHRA 3W00A 1QPKA 3AIBA 5A5WA 1SJDA 1KLZA 4HU8A 2VZTA 5JBFA 4PBGA 1XGZA 3PBGA 4M8UA 1SW7A 3L4WA 5D09A 1LUCB 2ZX7A 2YA1A 4UR8A 4GC4A 2HNEA 4GKLA 2VX7A 3IV8A 4N42A 3W7JA 1E73M 1W8SA 3RIKA 4S3KA 1VYPX 2XGBA 4U33A 4TO8A 1QPOA 4H8NA 1R3VA 4D8AA 3UNDA 3U4AA 3GR8A 2AGKA 4F40A 1AL7A 2F38A 2OQLA 2GDQA 4UBPC 4W8BA 4LV9A 3LZ5A 1X38A 1LRQA 4ADTA 3KBSA 4MJ4A 1WZKA 3KRBA 4PMOA 5LHEA 1W5QA 5K9XA 2XTKA 2QAFA 4IPNB 2IQTA 1EJSC 3NAVA 5HK4A 4TUFA 1TMHA 1R85A 5BOEA 3VOJA 1D3HA 4GUGA 2IXUA 1QT1A 1S3TC 3QV9A 4IJBA 3TNBA 3TC3A 3ZJ8A 4FIRA 3PZMA 4GYKA 5EA9A 3CUGA 5A6BD 3K4DA 1A5LC 1IEWA 3V1PA 1MNZA 3MDUA 1JXKA 4GD0A 3STEA 2PWVA 1LBLA 4UWMA 3VKCA 1ADDA 2AQOA 8TIMA 4A22A 4L6HA 3M0LA 4AUBA 1DHKA 5G1YA 2EKCA 1TSIA 3WNMA 2F6XA 4DXXA 3IACA 1E4NA 3H8AA 1PKLA 3RM9A 3DZ1A 1VHNA 1EC7A 4NJGA 3UY8A 2OVLA 2ZZ5A 2DW7A 1GTEA 2VP8A 4GX9A 5C2CA 4X9SA 1R2TA 3ARYA 4QE5A 1ALDA 3VNYA 4C7FA 2QDDA 4FZIA 2W5FA 3NQ6A 3FXYA 3W2JA 2DUAA 2BXVA 4XBKA 3VKDA 1H7RA 2R1KA 2E6FA 2J9YA 4PZVA 3S8HA 3AXHA 9XIMA 3BXWA 1KC7A 2VVNA 2XFYA 2JBMA 4PTMA 3GHSA 4GOAA 4B5NA 1BG4A 5GJMA 3A4JA 3GS6A 4FF7A 3GVRA 1D9EA 3RX3A 1FWHC 2CZ5A 4P8WA 3WDHA 5D2TA 1JUKA 1G1YA 3BMWA 4UQAA 4I3GA 3TAKA 3WH5A 2HVOA 1QVBA 3IVSA 1HKVA 5JH2A 4FNPA 3PBUA 1UD8A 3VKJA 1W6TA 3EA2A 3FEMA 3RMJA 3UPBA 4JTKA 1QUMA 4LOCA 1FH9A 3TMLA 1V79A 1Q13A 5XIMA 5JQ9A 1M68A 1E1EA 5H1WA 4QFUA 3POHA 1CXEA 4LEQA 3PBVA 5CQ1A 1UUMA 3NSMA 1GVRA 5HNTA 2VENA 1YNQA 5A8GA 2VOTA 2QIIA 1QNQA 1J4EA 3CQKA 5C9ZA 1B4EA 1KKRA 1UWQA 1R8LA 2V3FA 5BU9A 1E1CB 3QC3A 1E3ZA 1XM3A 2D0FA 1TREA 5HAOA 5KSWA 4LRTA 3HJZA 2CLFA 1J2WA 1J2BA 3RN6A 3GBEA 4Z1AA 1UWRA 2OKTA 4TVUA 4KKXA 2OLSA 5A8MA 3LCWA 1PIGA 4QIUA 1FH8A 2YA2A 4LC6A 5DRCA 3AIWA 2FB3A 3RPMA 4DUOA 1BWVA 4TV5A 4I5XA 1HXJA 3PBMA 3SUSA 3N15A 4C91A 4XVEA 3DI0A 2V3GA 3N18A 3FDGA 1FCQA 3MDWA 4NT0A 2W63A 3MWAA 1EP2A 5I06A 3FJ4A 1IGSA 4GNVA 4L80A 3W1XA 1XWYA 1V51A 4H9YA 4AG0A 1K4GA 1WCGA 2I16A 1QW7A 3BJFA 3CHDA 3JZEA 4MWAD 4PUUA 4LUTB 3W3OA 3OW1A 1TA3A 4O15A 1EQCA 2F7FA 1MRQA 3MPGA 2YLLA 5JH1A 3GO2A 1S2WA 3GIQA 2YGYA 1JAKA 3BURA 3P3BA 2Q3OA 1LLOA 4LT9A 5LIYX 4M81A 3UVIA 3LXCA 4PSRA 2DZPA 5LGZA 3DU0A 4AX6A 1J79A 4GC3A 3NYZA 2BOGX 1Q6CA 4HMDA 1X8CA 2H9AB 2GJXA 4D6IA 3CT7A 5AYYA 1IWPA 1EL3A 2RGLA 1AJ2A 1TJ1A 2BNJA 1GOWA 1JZ7A 1JCYA 4UMBA 1I45A 4YVVA 2CZFA 3S5ZA 2MANA 3NQVA 3R58A 3CUHA 2HVMA 1L8NA 1Z69A 4MM1A 3IIVA 2AMXA 5G5IA 1OC6A 3IIXA 2HMCA 1UCWA 4LXFA 3DFPA 1K8XA 3NJ3A 2J7GA 4DQWA 1R2SA 5DY3A 2R9RA 2Y5JA 3FJNA 2XH4A 4OHQA 2G96A 1OK4A 2XGIA 4JNMA 2HK0A 4UNIA 3LYEA 3W0KA 3R43A 4JN6A 5BYWA 4AHOA 2NWRA 3CV7A 2J9ZA 3VK5A 1UJPA 3OVQA 2BGNE 3BOXA 1NF7A 4XZNX 2GQAA 4DI8A 4ATWA 1ZSXA 3F03K 4IMCA 4O1FA 3KOWA 4S2CA 1IT7A 4UTKA 1M01A 3CUXA 4G56A 3KS5A 3L7RA 1UOZA 4AQLA 1XLMA 3UGVA 4LV4A 4YTQA 4LVBA 1Q6EA 2EG6A 4WLCA 4FLRA 3RG6A 2O4MA 5T26A 3RM4A 2OLAA 1OD8A 1HN1A 2V6AA 3AS3A 3NO1A 1LBMA 1YE6A 3UR8A 1DE6A 2J78A 2F61A 2WMFA 3QHMA 4P2VA 1K9DA 5I07A 3TOYA 1LG2A 4IGNA 2QNEA 1VENA 3LGEA 2WK2A 3URAA 8CGTA 3C2YA 3SRHA 2BY1A 3FKKA 1QXLA 2ACRA 2Z00A 4DJDC 3NM1A 3ZYZA 4AEEA 2Y8UA 2C16A 4XG1A 4MFDA 4Z17A 3ERPA 1NOUA 5DMNA 2VM8A 3H6OA 3OYZA 3I3EA 3TR9A 4O19A 3JVAA 2W4XA 2HCVA 1I1XA 3M0HA 4UOZA 1HP5A 4DVOA 3EMCA 1W1VA 3CAWA 1CZ1A 4G1NA 2PDWA 1BSIA 3NA8A 4RXFA 4F2TA 1WQ5A 5C7HA 5ENLA 1FWEC 2PDXA 2PBGA 3A22A 3E2VA 2WHMA 3N2OA 2C1GA 2ASHA 3WENA 4WDWA 2CBIA 3K8LA 4UQBA 1RD6A 1ZB5A 4IQEA 1J0HA 4G6CA 1W3TA 1FXQA 3CS2A 4EKJA 1MUMA 3KBVA 3G2GA 3KOXA 4HMNA 1K8YA 4S38A 1ONRA 4QE1A 2F8QA 1EJRC 2R82A 4ZO9A 4LVFA 5D33A 3SIMA 2DU2A 4XBJA 1ME8A 3AZRA 5U7SA 3WJWA 2Q8XA 1Y5WA 2NT0A 3TWBA 1AW1A 3RJXA 3RAOA 1HVQA 2FYMA 3N4EA 3MYPA 5HANA 2GVEA 3OIXA 3O6AA 1MVYA 2IPFA 3AOFA 4BEQA 3PB2A 4PCTA 3T42A 1G7UA 2Z24A 1RV8A 1U33A 1TPB1 4S3JA 3QSTA 3KM8A 1UKQA 5FL0A 1ZJBA 4MTVA 4G2DA 3BICA 2Z25A 3EOSA 3ALFA 3W7NA 3PZIA 3WNKA 1FFRA 1ML1A 1YTEA 5AC4A 4BF5A 3Q67A 4XTDA 4AVNA 2RKXA 4AZHA 3GE7A 4AEFA 3E5BA 5FD0A 3GG1A 4K36A 3LI1A 5ABTA 3ZM8A 3BJTA 3AJ7A 2FPVA 4JTRA 3T55A 4H00A 1VJZA 2OGJA 2ZX9A 4HHLA 1ZNNA 4ZVJA 1QNPA 3OGVA 3TCSA 3VUPA 5HUOA 1LBFA 1KBLA 3NL2A 1VH7A 1MI3A 3QQ1A 4NY2A 3U5UA 3TW7A 2WPBA 1SO4A 3I7RA 3B0UX 3LCXA 2QDHA 2WB5A 2OWXA 1SO3A 1WZLA 3LQLA 4JTSA 2NSXA 1OFAA 1Q4WA 2D2GA 3IGHX 4I9MA 4OUIA 3RXZA 3PB0A 5CG0A 4GYJA 5ECVA 1QASA 5CJMA 1OHLA 1PTDA 3VIJA 4GPNA 3CPRA 3DG3A 3P14A 4H9ZA 3MBDA 4PMRA 1OF8A 3GC5A 1LM1A 1ZJIA 3EDJA 2VD8A 4RDVA 3M43A 1GZJA 1VPXA 1A0CA 2YYUA 2WSQA 3VOGA 2WPGA 3NZ1A 1OADA 3UCQA 4UR9A 3I3DA 3EMZA 1CGVA 1UD3A 4S3CA 4JFUA 1MEHA 2Y88A 1EJVC 1X97A 4DZIA 4MUPA 2PD5A 3BTNA 4GUHA 5HULA 2H3DA 4LYRA 3PR2A 2AOSA 3VGDA 3AU6A 4N9CA 2QUVA 3SCSA 3VCNA 3ITLA 1RCXB 4FOUA 1XPGA 3F2BA 3GTHA 2A3EA 4QNWA 2HNHA 2V5KA 1J5SA 5HDRA 3A3XA 1V02A 5CKSA 1OGGA 1FOBA 1H5YA 3RCNA 5JUVA 3QGAC 2XM2A 4O1AA 4W5UA 1X6LA 3URQA 3MI6A 4DAFA 1SSDA 2FKPA 3WLIA 4HU0A 4IX0A 3WIJA 1VFFA 1BYAA 1GUVA 1HO1A 2XIQA 3S2MA 1Z7AA 4YTRA 3BMXA 4IIGA 3CPUA 3IANA 1VS1A 3AWOA 3AHVA 3FV9A 6XIMA 1QR7A 5CPOA 4AEOA 3OLIA 4R7JA 3ABOA 5EMJA 4AD1A 4F2BA 3OG3A 4FNQA 2YZ5A 4F0LA 4U3AA 2IPJA 3CMFA 1JDAA 3T2OA 1JD9A 3HOJA 2JIWA 2RDWA 1GW9A 3MB9A 1HF6A 1OYAA 1GEQA 4JNYA 1V77A 3CEPA 4JTDA 1W56A 1EKOA 4BQ2A 4DO6A 3OIHA 2XH2A 3BL3A 4OV4A 3SCRA 1LZOA 2QMKA 3IAPA 4GUIA 2PF0A 5A6BA 2BMBA 4XQ6A 3CWOX 4PUDA 3G1YA 3ZT5A 3L66A 5FF4A 3QV7A 4P5UA 4CN6A 5CBIA 4D6EA 2ZUMA 1ZBVA 1NDZA 3UFYA 2O7SA 4HOXA 4LB4A 2X2YA 1OINA 1TA3B 1H61A 1TRDA 2QUNA 3GWQA 4O4WA 3MI3A 3W1TA 2R1PA 1EOKA 1FUYA 3FOKA 3LM3A 3EKLA 1E72M 3R7MA 2VEKA 4Q4RA 3HO8A 1GQNA 2D23A 5I03A 2WNQA 3HGRA 4GIRA 1RLCL 1O94A 1RAKA 1GW1A 3UNTA 4HNOA 3FDKA 4A21A 5H91A 1TO3A 3TW6A 4XISA 3AHYA 2J79A 3XIMA 1EJTC 4M29A 1EIXA 4PBFA 4UFHA 3UWVA 1JRBA 5D2VA 1KM3A 1OIMA 2GJXB 1UP3A 5AC5A 3G1XA 1YW1A 4IWWA 3G18A 1PS9A 4Z2HA 4J28A 1B3ZA 2VZSA 2D0HA 3BWWA 4PUNA 3W81A 2WCAA 3GW3A 3GDRA 4P8VA 1S1RA 4CVUA 1OY0A 2G4JA 1KNWA 3FNDA 3KTCA 4UCFA 3KP1A 3GVVA 1XG3A 2FVLA 4N9EA 2JIEA 2WVUA 4ZOAA 5C6MA 2GPTA 3M64A 1G4SA 4UTHA 1U1HA 2DT1A 3G24A 2XZ9A 1E0VA 3H53A 4JYDA 5EYWA 4ZSTA 1DEDA 4PUMA 4Q4PA 1VJSA 3K30A 2BS9A 4RV8A 2ZRZA 1QBBA 3UWQA 3EWYA 3PSVA 1W37A 3ARSA 4JPGA 1PYMA 1NAL1 2QJHA 1XUUA 3F4VA 4Z1BA 4IMEA 4Q3MA 1JYNA 3E38A 3WD4A 4TR9A 4Z2LA 4G1KA 1E9YB 3MUXA 4GNKB 3UZ5A 1PO9A 1KM2A 3ABXA 3KZSA 3QN3A 2ATSA 1PZ1A 3F4DA 4DPQA 2DPEA 2PZ0A 3AWNA 4N0RA 4DO7A 2PRMA 3B9DA 3JZUA 3T44A 1WZAA 1AK5A 2P76A 2VRJA 1MO0A 4F9JA 4J2PA 2ZXQA 4HZ7A 2Y5SA 3L68A 3NWRA 4NI8A 4RE2A 3S2JA 4M5PA 4FIQA 2QGHA 2ZZ7A 2ZVIA 2ZA1A 3IGXA 3GDTA 1EA0A 1G01A 4LY8A 1XYLA 3E9AA 3NOEA 3MMWA 3VAVA 4E5TA 1TWIA 1QHZA 2A79A 3DHUA 2XZ7A 2FQIA 4MWAA 5KITA 4O54A 3UYCA 1XIGA 2D2OA 2VEFA 1CXFA 3I6RA 4HU4A 3BV4A 2OGYA 3RU8X 1KXVA 4KBXA 1QMLA 5H8MA 3WF3A 1EO7A 4YL2A 1PTGA 1FQ0A 2O0TA 3REQA 4AAJA 3BE7A 1PSCA 5IXEA 3KL0A 3V4BA 1I75A 4L6OA 1MW2A 1UC5A 1NWTA 1Y5XA 1D8WA 3WJYA 3WJXA 3HPSA 4XZWA 3G0UA 3BMVA 5CJ5A 4XAPA 1U1UA 1YBQA 5A6AA 4ICMA 3T08A 4WQ6A 1JPMA 4NX5A 4NYUA 2VO5A 4GFIA 2Z27A 1MDLA 4PEEA 1TMLA 1AZ1A 2PP3A 1T41A 1R9ZA 4IMFA 5DRIA 1ZL1A 2CWXA 3W7KA 4YNGA 1DKWA 2YCLA 4OKDA 2XVKA 3GFYA 4B9YA 4EANA 3V16A 1CXIA 3I6EA 4MZ8A 1NWRA 2IQDA 1UR9A 4A8NA 3UZWA 2WQPA 3M5ZA 2PTYA 4IFRA 1M5WA 2Z0IA 2J7CA 4LYKA 3BLIA 4XWUA 3WLSA 2ZA3A 3EOEA 3LBMA 5GQBA 3VX1A 4A3RA 3WEOA 3LBOA 4R85A 2C0AA 4K38A 1JCJA 5HBFA 3GXNA 4Q8WA 3FN9A 3EGJA 2EPOA 2CNCA 1VFMA 2Z26A 2XSXA 5A6TC 1XH1A 4UTTC 3P74A 1DV7A 5FJRA 2ISSA 4YU1A 3UWEA 2IKIA 1XYBA 1IXPA 4RZ6A 2PLCA 2NX9A 2G3IA 4JFTA 2DV0A 4DJED 5A94A 6REQB 4MMWA 1BVZA 3L4XA 3UG4A 4MHBA 1HKJA 4A05A 2OO0A 3AS2A 1WBJA 3GFZA 4IXXA 1US0A 4UB9A 4AD0A 3M0XA 4HCLA 1QK2A 3VIMA 3W86A 3CUIA 2OEMA 4WJEA 4J1OA 1SZGA 1U5JA 1E6ZA 2QIWA 3P8IA 1ZLPA 4MLJA 2O56A 1GPFA 3XINA 1PL9A 1W9PA 1LCOA 3EXRA 3NDYA 2WLYA 2RGMA 3AQUA 2XSBA 3A9IA 4KWWA 2DP3A 4E8CA 4IIDA 3LQGA 3HZ3A 1WV2A 5JIPA 1KRAC 1XSJA 4XO6A 1PTAA 4S3EA 3LSCA 7ENLA 3WDJA 4HN8A 1VIZA 1HJSA 4YCPA 1HQTA 3O2LA 3SDOA 1PV8A 3DN5A 1I0BA 1FHDA 5DCEA 3T0DA 5ABFA 4QR6A 2OEKA 3BG3A 1OABA 5KMYA 3ZR5A 1TX0A 3UXLA 4DRSA 4RV3A 3PZVA 2A5HA 2QCLA 1GK8A 4HNUA 5C9RA 3D0CA 3QQ0A 4KEZA 5FF0A 1AQHA 3K4WA 1C9WA 1GZ1A 5FACA 3TYZA 3CYVA 2B31A 3NPUA 1SJAA 4Q33A 4Y9PA 5IDIA 1E15A 2ZADA 4QX4A 1GHRA 1KM1A 3SEPA 2HSAA 4WR3A 1HTIA 1W3JA 2WWCA 4LF1A 1IZCA 3V5CA 4NJJA 3IGSA 2Z1VA 1LLZA 3WQEA 5I3IA 4IX2A 2YLAA 1RA5A 1R5YA 2QV5A 3RU6A 1O68A 1YDVA 4HPNA 4Q8OA 1TPDA 1A5CA 2OSWA 1CW2A 4LX4A 2O55A 1QI4A 4W89A 3WMLA 1QBAA 1UJQA 3IEBA 1T96A 2QKFA 1HX0A 1XDLA 1EDTA 2CZDA 3W23A 1CB7B 2LLEA 3THCA 1SZRA 3MT1A 1D3GA 1K9EA 2DQWA 4I7WA 1IYXA 1TB3A 2X7WA 1RQBA 4HNCA 4WK9A 3DC0A 4MAZA 3P67A 4CN1A 4HNTA 4I7VA 4M1BA 4ML4A 1DWJM 3O6CA 1UMLA 1LOLA 4HZMA 5F2MA 1VRDA 3MUCA 1KO0A 1IIHA 3TSDA 3AI0A 1UH3A 1X1OA 3UETA 3IPWA 4KW2A 1S2VA 2PUZA 2RAGA 4F9DA 1LOSA 3UPWA 2PGWA 4K7VA 4GYPC 2RJHA 2C71A 3DG6A 5M1TA 2DZXA 3QYQA 1UWTA 2F84A 3E6EA 5J5RA 2PDFA 3LB0A 3KE0A 4F0RA 4EAMA 3O3RA 4Y2WA 3FW6A 1B3OA 3S4TA 5REQA 3KS6A 2GVYA 2Q09A 3TTEA 2WVVB 3VDHA 1VIWA 2C3ZA 4RNHA 3S3GA 2CBVA 1OD0A 1QWGA 3GG8A 2DVXA 3O1NA 5CBJA 3VI2A 2ACSA 1NFGA 4FP1A 2R24A 2D1ZA 4DUWA 3C5QA 4E8GA 4L9YA 3E1F1 1R0MA 2Y85A 4F4RA 5TNVA 1NDVA 3N11A 3G1HA 4FS9A 4OGZA 1XYAA 3WLOA 4RW5A 1RBOB 3G3MA 2JFEX 1ZQ5A 4FX6M 4A3YA 3VE7A 3CZEA 1MW1A 2P8CA 4XIAA 4HK7A 1TPWA 2E6DA 4PB4A 1CBGA 1DJXA 3KRZA 4NP7A 1XLGA 3MP4A 1P5BA 3WNOA 3USZA 1OG6A 3VZYA 3F1QA 3NUKA 4ZE5A 4GO9A 5DANA 2WYSA 4AC7C 3IJ9A 1MUWA 1C7TA 3S9ZA 3T2PA 1N8FA 2PGRA 3ZOAA 5AC8A 2CETA 4MWAE 5C2GA 2I5IA 3UWYA 3KVLA 3GNXA 1TJPA 1UYQA 3CAKA 3C0LA 3S5SA 1UD4A 3RCYA 2WKLA 5HWMA 3STGA 5D8ZA 1I2NA 3GC4A 3GDLA 3DFOA 4TTUA 3TXZA 1EPVA 1S5NA 3DYMA 1V6TA 1YDNA 2WSYA 4DO5A 3BAWA 5D9MA 1SPQA 1XFBA 3MO7A 3BAJA 4O0ZA 3M0ZA 3SUUA 1FWNA 3R8RA 3VGBA 3ARPA 4EXQA 3L12A 1A5OC 1QNSA 4MB5A 3MMTA 1E0UA 1J96A 4QG8A 2QV4A 5FJIA 1EUNA 2Y7GA 3RF9A 1DJQA 4HSOA 5AY7A 3YPIA 4MKNA 5B7YA 3H2AA 4JIIX 2ZUTA 3ZJKA 2BASA 4WD0A 4IG2A 3HTWA 1E71M 2AAAA 1GG0A 1Y5VA 2VI0A 2E9BA 3WY1A 2VRKA 3P0XA 4H2CA 2I9EA 2FFCA 3QH2A 4B16A 5A8PA 3TJIA 3GXPA 3MP3A 3N2TA 4ZR8A 4AVOA 5DX7A 3W2NA 3SRDA 4L64A 3TP4A 3RGTA 1JI1A 2B4GA 3ZR6A 1TTQA 1W9UA 6PTDA 1QK0A 1R3RA 4FAMA 1BFNA 4PH6A 3N1AA 1M03A 3HMJG 2QW5A 1LORA 4LFYA 1V0NA 4O0KA 3SCPA 4ZEPA 4CLMA 3LMYA 1ZRQA 4L4MA 2P50A 4LNCA 3VD9A 3OA5A 5T8GA 2IKHA 4HN4A 4ZO7A 2P0IA 4Z2JA 2JK2A 3ZSSA 2W61A 3VD5A 2CXEA 4UFIA 4ZOBA 5TBOA 2ZUWA 1GHSA 3GY1A 2YCEA 2W62A 4QP0A 2G3NA 3W07A 4NHVA 3REQB 1P0NA 1FWGC 4FMVA 4W88A 1G4EA 4E2BA 5U4NA 1ICPA 5A8OA 1XQKA 4GWEA 4DYEA 2J6XA 3AICA 3RX2A 3ZJ7A 5M5DA 3M5VA 3CAQA 5K2ZA 4FLSA 1Q8AA 1YBQB 3THUA 1Z41A 3BPWA 4JBRA 2PWUA 4HOWA 2VTFA 3GNPA 2ZOXA 3WO8A 3BAYA 1S1PA 3W75A 3P60A 4RE0A 1BGGA 2WSRA 1ECEA 3CTLA 3EPOA 1NY1A 3B0YA 5TF0A 3SQLA 1WE5A 1UKSA 3RO6A 4H9VA 2PDNA 1M7JA 3KP0A 5I3HA 2H8XA 4MY1A 1I1WA 5EMLA 1ICSA 1ZBKA 1QATA 2WZIA 5D4YA 4GZ7A 1OIFA 1G0CA 5DXXA 5I3JA 3LNPA 2VT0A 2ZRXA 1LWIA 3BAIA 4JTCA 3KOFA 1RSCA 4ZGYA 3VNJA 7XIMA 2CXGA 4KFOA 1SFTA 1QW8A 4LS2A 5FA5A 2DZVA 3OVRA 4JN8A 1BG9A 2QCMA 3TUUA 2J66A 1W1PA 4CNSA 1UQYA 4TX6A 2QCFA 4DN1A 4H8HA 1ZAIA 2DT3A 2J7BA 1AD4A 4UOQA 2VZUA 2YKKA 4GI4A 3TJ4A 5KINA 2OYMA 5A1AA 2A3HA 3FKRA 4US5D 2G8ZA 2Y62A 2NV2A 3BV7A 5C0QA 4PRRA 1K7FA 4JTGA 5CGQA 4C6JA 1MFUA 4I6VA 3UYIA 1OFDA 5DBTA 4X9YA 2HS8A 2EHHA 5HXMA 1QI3A 8XIMA 2GYIA 2D69A 1D7KA 5D9PA 4A3QA 1W8GA 3W7EA 4D2JA 1X6NA 3G1RA 1DWAM 3QPYA 4FR1A 3K2GA 3VOCA 5K9DA 1GQJA 1AQ0A 1OYBA 4DJFA 1JCTA 1GVOA 4DBDA 2OQHA 2ZQ0A 1VAHA 4IL0A 4JOMA 2PE4A 7PTDA 1ZZMA 3STFA 2EEXA 4RPQA 1TQXA 4GISA 2PDHA 3PTMA 1VBHA 4JZ5A 3IARA 4Z0SA 3TQ0A 3PPGA 3SUWA 2A0NA 3AYTA 2YXXA 1W1IE 4IPJA 3SRKA 1I2OA 4H3DA 1CI1A 3H7VA 2OODA 3WL1A 2QT3A 4LUSA 4NX0A 1RH9A 2UV8G 3FA3A 1UBSA 4C1LA 3C0JA 5FEPA 4KS0A 4JIPA 1E9ZB 2BOFX 4AY8A 1ZENA 1ISXA 2BDQA 2TYSA 5CZSA 2ESCA 4MPQA 1BLIA 5HJXA 1KBBA 3MVTA 3NSXA 1A5SA 4ZCWA 4YVXA 2BG5A 2CLMA 1K4HA 3BW4A 3WEMA 2RDUA 4Z1YA 1QI5A 3T40A 2V5LA 2PTDA 4LAZA 4IGMA 4NZCA 4PL1A 4JTQA 2ISWA 4I90A 5EMUA 4LJ3A 2PURA 3LS9A 4PMDA 3RR4A 1H5VA 5PTDA 3TFXA 4LBUA 3PS7A 4JL2A 1XXXA 4B4HA 1JZ2A 2EQDA 4M7TA 2YPIA 3TQPA 4B4FA 4CCDA 3EWDA 3ZLFA 3WDRA 2WMHA 1DOSA 5AOUA 4C65A 3T0AA 1KA9F 3A3WA 3BC9A 5HPCA 2VX5A 4HMEA 2OT1A 4ZMGA 3AZSA 1MNSA 2G97A 1OT2A 3F2DA 1XLHA 2KX9A 1TV3A 5F7UA 3M5XA 1MWOA 2FJKA 4Z2KA 3W83A 4PMVA 3VD4A 3IGUA 2HTMA 2I1OA 1LT8A 2IKJA 1ZJAA 4B92A 4DJEA 1IEXA 3EZ4A 1UIOA 4GGBA 1UH2A 2QULA 1SZNA 3UEQA 3T4CA 4BF9A 2HQAA 5D2YA 3KXQA 3EOUA 3F5KA 3HN3A 4CD7A 7CGTA 4MSSA 2NX3A 2WQDA 2OX4A 2OX1A 1YMYA 3IWPA 5MHBA 4Y7EA 3FS2A 2P8BA 3CEUA 4XKYA 3WNPA 3A13A 3OEXA 1Q66A 3LPGA 2E77A 1LF1A 2ZDRA 4YTUA 1US3A 1HJVA 4MJ2A 5ECUA 4CU8A 2AL2B 3OZPA 1XUZA 3PG9A 3NFUA 1IQ8A 5CG7A 1CGWA 5REQB 1H3GA 3BOFA 1YX1A 4H6QA 4ADSA 1J93A 2HZGA 5G2WA 3BSMA 2PWDA 2NVCA 2ZFAA 2XVLA 2R94A 1VCGA 3ITGA 2QJGA 1UBPC 2Y89A 4ZB2A 1S3HA 3MV11 1O5XA 3PZGA 2H90A 1DVJA 1WPCA 3HB9A 1IWBA 3E49A 1FP8A 3WCZA 3N19B 3GKAA 1TV5A 2HDJA 1IEQA 3O63A 2X40A 3EWCA 3GZAA 2FTWA 2WM0A 1NWUA 1RP8A 3LM7A 5E09A 2Z2AA 5I02A 3LTYA 3DENA 1A0DA 2VL4A 3NDOA 1PHQA 4AY1A 4JTIA 2PDIA 3LCFA 1VF8A 3MA8A 2V82A 5HA7A 1KBJA 3TZFA 2FH6A 3QR3A 2Y0FA 2CC0A 2V63A 3WNNA 4J3TA 3CHEA 1C29A 3CQHA 1JCXA 3B8VA 3K8KA 3E96A 3WQ5A 4HSNA 2P1FA 2W3ZA 5F2GA 3P84A 2E4TA 3G6LA 3PSWA 4UTWC 2VX4A 4K3ZA 1A3XA 5MKGA 3LHWA 2WVTA 4P7QA 1RJRA 3NQGA 4B9ZA 1OBAA 2G50A 1V8EA 2WHKA 4R9OA 3WQOA 2JKPA 2ZZ6A 5EMMA 1OJXA 2X1IA 1XLLA 5DLCA 2QVNA 4BQ3A 3KRUA 1W9XA 5XINA 4CEXC 3COTA 1EEPA 1JPDX 1EJUC 5JIWA 3Q4DA 3DHDA 4Q8PA 3WQGA 2Y1HA 4ML9A 1GQIA 3MO4A 1HFBA 2NSOA 1GWJA 4IXHA 5C54A 4N02A 1LDCA 4MDPA 3OQ8A 3S6TA 4DIAA 1G67A 1HIZA 2PP0A 1LQ0A 1JCLA 4IG2B 5A69A 2B7OA 4N6EA 3BLLA 3N3TA 3AZTA 3JU2A 3L21A 2ZRWA 1UWIA 3AROA 3QY7A 3WD2A 3MHGA 2J7FA 4PB5A 3WDIA 3IAQA 1P1MA 2YX0A 1NELA 2QPXA 3S9IA 2GQ9A 4O53A 3EDFA 4LVAA 1NOWA 3WK1A 4L4PA 1ZFJA 2PSNA 2VFIA 3MKKA 3RPDA 3N2MA 5HNNA 3DAQA 3P82A 4WJXA 1XIJA 3ZS4A 1UKOA 5D37A 3VMOA 3CTTA 3MSGA 3N2CA 2OYKA 1D7FA 1DTUA 1JR1A 1SR9A 3CIWA 4Z1CA 3QFEA 3W02A 4E4PA 3K5XA 2HPIA 3W7GA 3GU1A 3TYEA 2Z28A 5LNVA 1PKYA 4YTSA 3MJYA 3CV6A 3EOOA 5JBEA 1NQ6A 1ZP4A 3UT0A 1P43A 5K4ZA 4JHZA 1PWLA 2Z29A 4U31A 2HISA 3OHMB 1BWLA 4FXJA 3R0KA 1GOXA 3MS8A 1NWSA 4GA8A 4I9TA 3N12A 3O07A 5H8UA 3L2LA 1B1YA 1Q6RA 1DXFA 3W37A 1TRIA 3IVTA 1GYMA 3NEVA 4KIRA 4CN4A 4GKTA 3H4XA 4KQNA 4DZHA 5I79A 1WOAA 4AWUA 3HGOA 2B7PA 4BK9A 3HJEA 3NCOA 1VLIA 1U30A 3UJFA 1D2KA 3ISIX 1NP2A 1BWKA 5CGTA 3TIMA 5FF2A 4KPLA 1O66A 4MG4A 3W2KA 2E5BA 3BCJA 3VFLA 4WX2A 4E3VA 4JY9A 1AMYA 1HKIA 3D5HA 4ZQNA 3WF4A 1GQLA 2NW0A 1AQMA 4HTBA 5AYXA 1E9LA 1KQYA 3EMQA 3CQ0A 3GC2A 2OWWA 3NOYA 1CWYA 1WZMA 4MVAA 4GRSA 4H8UA 4PTDA 4DBWA 2Q02A 5CC5A 2YFOA 3CASA 4RNJA 4N9DA 5KETA 2V2DA 4F48A 1R3SA 3VKBA 3LI0A 1H09A 2V8ZA 3B8IA 4DBEA 4H19A 3UWZA 1UUOA 5AC6A 3I65A 4JIHA 1U5VA 4UQCA 3AMKA 4F3HA 4KCTA 3AISA 4NF7A 3UD6A 4IMDA 4HKPA 4QHRA 1FRBA 3FX4A 3WD3A 4F66A 3CL7A 3SB0A 2YL9A 2DH3A 2OELA 1JNDA 1W2PA 3UF9A 5LXXA 1Q5MA 2QUMA 3NDZA 2PGFA 5I6SA 1DE5A 2ICSA 4R27A 4JN7A 1JYVA 3T81A 3W6LA 3ITYA 4J3ZA 1P0KA 3S1GA 2VGBA 1HVXA 3WD1A 3SR7A 1CXHA 1VEPA 1WNOA 2G3JA 3PG8A 3IUHA 1XG4A 4QS6A 3W29A 4H2HA 5EGRA 3QLLA 3KW3A 3ZVIA 2RFGA 3TMQA 3JS3A 3CIXA 1P0BA 1KKOA 3P6LA 4Q6XA 3D3AA 3B8WA 4V2XA 3UG5A 5I2UA 3WX7A 3KL3A 3CUZA 2WOQA 4MIMA 2C18A 1GVSA 3OTRA 3TKFA 3G0XA 3OHIA 1EO5A 1XIEA 1UH4A 1DXIA 2E5CA 5CC3A 3M0KA 2ON3A 1TWWA 2XU2A 2Y7DA 2ZXDA 3KEHA 3BLDA 3CMGA 3VKAA 1TZ7A 4Q6JA 4HHPA 3DI1A 4QTGA 1F4HA 4WJ8A 1RA0A 4WUIA 3HPXA 3ITXA 3K8MA 5JXQA 4HIBA 2Y24A 3WLKX 3CUJA 5C9XA 4O28A 4LC8A 5KZMA 3TNOA 2VYOA 3MP5A 3R13A 2BHUA 3THAA 3ABQA 2ZVRA 1O1ZA 2HS6A 4GACA 3STCA 4PRWA 5I09A 4DNMA 3BG9A 2FMNA 2PCQA 1AG1O 2WM1A 3R10A 1JZ5A 3PAOA 1TTPA 2YDRA 3AUJA 4KIEA 1VBUA 2W79A 4LQ1A 1JJKA 1E0TA 3B9AA 3CO4A 3HQ1A 3LCLA 1OX5A 2CLPA 5KEZA 3TJXA 4O50A 4CNNA 5HR6A 4LRSA 3SRFA 1IF2A 1FHVA 2O9PA 1H0GA 4QISA 4DBUA 2GDUA 3VCRA 3VIHA 4HU3A 3BH4A 4UFMA 2BVDA 2D2JA 5F4SA 3QGKC 3NPWA 4H8VA 1UZ4A 1VYSX 2XUCA 3SURA 3IUIA 3H2MA 3LLXA 1V3KA 4Q8VA 2ZTJA 1RLDA 5I00A 4PSPA 1W31A 4US5A 3BLKA 3PHAA 1JDFA 3MMDA 3VUSA 4JFWA 4O1DA 3B4UA 4GZEA 3NPXA 3CWHA 1XGDA 4HYVA 1R6WA 1J18A 4FSAA 1DQXA 1F8MA 2X7VA 1EQPA 2FLIA 4GGHA 1K3UA 3WZ0E 3DX5A 4AC1X 4XKYB 5G1TA 3ARTA 1WDPA 1JF6A 3PJTA 3CJPA 3GVGA 3QOKA 3UWWA 3NQCA 1FWIC 3MMUA 2P3EA 4E8DA 1NFBA 4M6UA 2IPWA 5A8QA 2DUXA 5LNUA 3VC6A 1WXYA 2PF8A 3QJAA 4J4KA 5IBXA 3B3DA 2WCSA 2WSPA 4IH3A 1DWIM 3TC6A 5A6LA 1YKWA 2NX1A 2HBVA 3N6JA 1VQTA 5EMYA 1CEOA 3OP2A 3K46A 1FX6A 2Y7FA 3H55A 2YIHA 1W1A1 3NQFA 2GGIA 4IF2A 4AIOA 4X61A 4OUEA 2CLIA 2ZZ2A 2A3CA 3GIPA 4AD2A 4PB3A 1R3YA 2E8YA 4I9AA 4J3VA 4OBTA 3LDVA 3H2CA 5TAOA 3IIOA 2GGJA 4YMZA 5CCZA 1S2TA 1L6WA 3NR0A 1WO2A 3USBA 4ZFCA 1GZGA 1Y8BA 7ODCA 2JEPA 4D8LA 2J24A 1KR0A 2WZHA 2RDXA 1PX4A 3VNZA 1QPNA 2X41A 1KXQA 4MYAA 3W2UA 1LG1A 3TSMA 1OYCA 3CB8A 4PUKA 4Q8MA 2EBNA 2PAJA 1YDOA 1YXDA 3J7HA 4X63A 1XP3A 1H7NA 1TE1A 1IXNA 1L6YA 2QUUA 3NTYA 1X39A 2EPMX 1GOMA 3WF0A 3TW9A 3N4FA 1H1YA 3GKFA 2FPTA 4MOZA 2VEMA 3GIYA 2V38A 4C6EA 2J74A 3O9NA 3A47A 3UW6A 5IFTA 3FIGA 3ITTA 4MZYA 3KL5A 1Y7VA 2ACQA 4IZGA 3W70A 5KZ6A 4H04A 1RK5A 3CH0A 3WBYA 2PBOA 4QS5A 2BZNA 1DHPA 2DJLA 1HUVA 2G41A 3WBEA 3QKEA 3URNA 1VC4A 4LAMA 4WY0B 2EF9A 3QC0A 1FDYA 3ZJ6A 2E6AA 1IZJA 3M44A 3TTQA 2VQUA 3KWSA 2VDHA 3QZAA 3MCMA 3MI2A 2CEQA 2E0PA 2QR6A 2POTA 3ENLA 3O16A 1JZ4A 4M0XA 2WC4A 4FOKA 3EXSA 1V3HA 4KH2A 3IUDA 2F2HA 2ZIDA 3MUIA 2XIJA 2Q71A 1OZQA 3CWNA 3WH7A 1XV8A 3L4ZA 4K1GA 2FMOA 1F6YA 5HMSA 1XF0A 4JD4A 1N55A 3KUMA 1KGUA 1ZHAA 1IT0A 3O15A 2FH8A 4ZOEA 4DM1A 3V0SA 2J47A 1S38A 3M6YA 1V7YA 1K6AA 3TJLA 4Q4MA 3VOFA 4JCLA 3EX2A 2A7PA 2J88A 3V7PA 3AUOA 4S39A 4WOZA 1EWDA 3GXFA 2CLOA 3HGJA 1WA3A 4FK9A 4F0SA 1AW2A 2P53A 3D46A 3LCIA 1S5WA 3SI9A 1E6QM 1CGUA 2QEZA 4EPBC 1KM0A 3IIPA 1GTHA 1QW9A 3KCJA 4IPIA 2DIEA 4I6KA 1QNVA 4JTTA 4U4MA 3AXIA 2GLKA 4AYGA 1FVPA 2MUCA 3CC1A 4WSHA 3ARRA 3S2NA 4JTAA 3S1VA 3MC5A 3P5YA 2WLZA 4FXSA 1I8JA 2QJNA 2DJXA 3JR2A 3N34A 4DWDA 5FEWA 2DSVA 2XDFA 3L4VA 1A5MC 1R86A 5LGXA 1JL8A 2IMRA 4WVXA 1EP3A 4UCGA 2DSKA 3U7VA 3IK4A 1WP6A 4IJCA 4EPEC 1F7BA 2DIKA 4PRTA 3GUWA 4CU6A 2CKRA 5LYRA 5CZKA 4RUBA 1R38A 4NZ4A 3SCWA 1TWZA 1OFQA 3PBYA 3T0CA 2PEVA 1UC4A 3V18A 4CCCA 1H62A 4C1NA 4S1FA 1OFEA 1YXYA 2PFHA 3W1LA 5G4EA 5D2WA 3PTQA 3GH4A 2OU4A 1NSJA 2X8RA 2XSAA 1CLVA 3NYDA 4KFNA 2WNWA 1TZ9A 4ECLA 2PMQA 4XD3A 2UY3A 1W5PA 3CZGA 3ATZA 4BWLA 3WDQA 3F5LA 3SFKA 4R7OA 3PTKA 4X0VA 1CXKA 1W9VA 4L1XA 1O5QA 1ZS2A 1HO4A 3G8EA 2WZMA 3W7IA 4W87A 1EBHA 1CIUA 3C2RA 4CD4A 2QPSA 1X8FA 3UR7A 3V1HA 1UPMB 3QFWA 2A21A 3S6DA 3CU2A 1JVNA 4BA0A 2ALRA 1R3QA 1AJ0A 1RQEA 4PTXA 1OF6A 4ZQOA 5CAKA 1I2RA 1DIDA 3N25A 4US6A 3TV8A 1TFVA 4UIOA 3S5YA 4P61A 3WLNA 1ITCA 8XIAA 3H24A 4LU0A 3TXVA 4WIWA 4PFHA 4E4FA 1OFRA 1MRAA 4Y8FA 1MQQA 1A5UA 1F74A 3G5EA 3S0CA 2XFRA 1EUAA 1HW6A 4O10A 1W0MA 1E4IA 3EWWA 4NKCA 4JDBA 4FNTA 3M9YA 4G7FA 4P7RA 3N9RA 3WG6A 2GWNA 3ARUA 4IFOA 2P0OA 4LH8A 1V6XA 3W1RA 1XYZA 4B90A 4HNVA 7A3HA 1FWAC 3VFCA 3NZGA 3QPZA 1GJPA 3QZ6A 4B5SA 3WBAA 4ERAA 3LU2A 4Q22A 3GHTA 3IJDA 4UMCA 4H6EA 4NNBA 5HJYA 1W1ZA 2PRHA 1GKRA 5CJNA 1MSSA 3LK6A 4GH3A 4LNYA 1UKTA 1VD6A 3HA1A 3NZRA 1GVEA 5A2CA 1KV8A 4EP8C 1Z8AA 2RUSA 1G4PA 2FJUB 1S2CA 3FGCA 4X2RA 2E6YA 4F0KA 4ZO8A 3CHFA 3SY1A 4IGSA 3LRKA 4AZIA 4N4QA 3Q37A 1H11A 2X0SA 3EA1A 4WXYA 3WLQA 1QOPA 3ZWSA 3NQDA 1L8PA 2CCRA 4Q8QA 3M5YA 3XISA 1H7WA 4KERA 1ZJHA 2NLIA 3PPHA 4QBXA 2JALA 1YDYA 4JFVA 2ISDA 3WQPA 4QAIA 5A95A 1KCZA 1JPHA 1ISZA 2YYTA 4C6CA 4E0CA 1JI2A 4ZB0A 4FX7A 2A3BA 4LVDA 3DYOA 3OVPA 1YXCA 4LUIA 2EPHA 4EVZA 4OIFA 3T1GA 2YZRA 3UXIA 4XAGA 3NL5A 1Q6QA 1ZBWA 4HJFA 2XVNA 4JTJA 5CSYA 3W26A 1F05A 2WC7A 1A0EA 1S5TA 3W22A 1UD5A 4J9JA 1QTWA 3C3UA 1XYCA 1FWBC 4DWSD 4Y9MA 1Q2SA 1XRFA 1V3LA 4PTWA 2CBUA 1H7OA 3H7RA 4JIEA 4NNAA 2WW5A 1MW3A 2XHYA 4RDWA 5BOOA 4W85A 4TVDA 1PZ2A 1M41A 3JUGA 2NV1A 2F2KA 4HNNA 4DUVA 2GZXA 1B3XA 2QDGA 3SCOA 2OOGA 3VE9A 4OJYA 4GLEA 3ANYA 3F4CA 1IEVA 2DZTA 2J7HA 2PDKA 3RLGA 2Z1XA 1ITQA 3M7WA 2YCKX 3HG5A 1DWGM 3RRXA 4D6FA 1UOKA 1WDDA 3W01A 1SZFA 4MB1A 2G3FA 4JXCA 1HL9A 1VPYA 2QZRA 3WYZA 1EFZA 3SJ3A 2F9RA 2ZX6A 1XD1A 4M82A 4F79A 3R25A 3E0LA 4GQGA 3PJUA 3H12A 3H22A 3B9EA 1A5KC 3VYLA 3LUTA 4HPGA 2Z1BA 3L5LA 4B5WA 4PEKA 1EYEA 3LHZA 3WKZA 4XAYA 3VKKA 4PTVA 3R0UA 3MZ2A 5FOOA 3L4TA 2E8ZA 5LNWA 2WNZA 3W7QA 5F1VA 1FWCC 2YA0A 2GQ3A 4LGXA 1H1NA 3L0KA 1XLBA 2IPGA 4QEEA 2XIMA 2C6QA 3LD5A 4GH1A 4IP7A 4GI8A 1B90A 1YIXA 1EA9C 4G7EB 5BNKA 1DJGA 1VBRA 1RY8A 1O6IA 5G4HC 4WGHA 5AHMA 1BHGA 5BMXA 3UU0A 1Y0EA 5CAHA 4HPJA 4CQCA 2AAMA 4ERIA 3KHJA 1DJZA 5CLWA 4Q8UA 3R94A 1E0WA 4JYEA 1WB0A 3QQWA 4GFSA 1W1TA 4EAYA 3BQ5A 1XSKA 1WKDA 1X7FA 1PE1A 2VFGA 2W67A 2GUBA 4CNUA 4DELA 3SN1A 2QCHA 4XSMA 4H9TA 1TYGA 2OJPA 5IOBA 4ALDA 2W6RA 1P0DA 1OZMA 4TVCA 4GCAA 4DB7A 1T7LA 2PC8A 3GU2A 1KFBA 5LHFA 4R7WA 4JTFA 1HGWA 5C70A 5C2XA 4O11A 1FCUA 1ISYA 2YSWA 5I5RA 2OSYA 4J7RA 1IIGA 1DORA 2YBTA 1Q6OA 2YW4A 4HBKA 5DMYA 2XN1A 2AMGA 3EWUA 3UZZA 4QEHA 3TCEA 4G8TA 5CPSA 4HHHA 2V5DA 1Q63A 2VQTA 2Z1KA 1ZCCA 3L4YA 3MUY1 4O1EA 4A2RA 1EPXA 4R88A 3GTNA 1KGWA 1NVMA 2E28A 1K9FA 2YW3A 4B5TA 4FX8A 3PUDA 1O5RA 4DNHA 2WBGA 1B3WA 1TR9A 1GG1A 4P7NA 2V3DA 3WSUA 1PZ0A 1OC7A 1E4LA 4XZLX 4OFCA 1OX4A 1QO2A 2VWTA 4LS1A 3QZEA 3SN0A 1L6SA 5CPTA 2PDCA 2Z7KA 1S5MA 1JAEA 4RZBA 2B7NA 4ORIA 4KF1A 5CSUA 2BY2A 4L56A 2GDVA 3LGDA 4L7ZA 1Q45A 4DM2A 3R6IA 4ZE4A 3BO9A 4G9PA 2INFA 1XGEA 4J2MA 4Q4SA 3ZFHA 3MSYA 4UNLA 1KD0A 3TR2A 5IM51 2OEJA 4MKSA 2O9TA 2JEQA 1R3WA 1UA7A 3WJSA 1ZGDA 5HNUA 2XN2A 3IK2A 4JX4A 1LRTA 2I14A 4C1NB 3EB3A 1WAWA 4DEFA 3BANA 1D3CA 1OCQA 3BW2A 1Q65A 4X22A 4LANA 3SCVA 9XIAA 1Y65A 3EPNA 1A4LA 1V6UA 4NXSA 4ATLA 2CLEA 1GVFA 3VNKA 1KR1A 3W6YA 5I24A 4GQ0A 1L2UA 4HA4A 1FTXA 2E25A 1VBJA 4XIMA 3L23A 1YE4A 1FWSA 3H2FA 3CZKA 2CLHA 2J8FA 1K03A 4E2OA 4ENLA 4QG9A 1PCKA 4M19A 2ZX8A 1FWTA 2YCJA 1DJHA 3A6OA 4MNKA 5CPQA 3OZOA 4NSBA 3ONCA 3QEZA 3G1DA 4ROPA 1AZ2A 2VUYA 3O0FA 4GI9A 6TAAA 3R4IA 4V15A 1JCMP 1C8VA 1IGWA 2GUUA 2X05A 2VC7A 2V5CA 4IMAA 6REQA 4GQBA 4W7VA 4UZUA 1ME7