3U0HA

The structure of a xylose isomerase domain protein from alicyclobacillus acidocaldarius subsp. acidocaldarius.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
279
structure length
279
Chain Sequence
AMEPCLHPTLVDETSLVLYLDLARETGYRYVDVPFHWLEAEAERHGDAAVEAMFQRRGLVLANLGLPLNLYDSEPVFLRELSLLPDRARLCARLGARSVTAFLWPSMDEEPVRYISQLARRIRQVAVELLPLGMRVGLEYVGPHHLRHRRYPFVQSLADLKTFWEAIGAPNVGALVDSYHWYTAGEHEDDLAQLPPEKVVYVHINDTRDAPEDAHDGKRLLPGDGRIPLVPFLRGLYLAGYRGPVAAEVLHETPLDGTGESRARLVRERLEKLIALAKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Xylose Isomerase domain protein from Alicyclobacillus acidocaldarius subsp. acidocaldarius.
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
molecule tags Isomerase
molecule keywords Xylose isomerase domain protein
total genus 104
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3u0hA00
5B80A 5B7YA 9XIMA 1MNZA 2QUMA 4XIMA 5EMMA 4GJIA 4W4QA 3CNYA 4G56A 4X60A 4YTRA 1XIIA 1XISA 1TZ9A 1D8WA 1YX1A 1XLAA 3AAMA 3CQHA 3M0VA 4ZBCA 4ZB2A 4EACA 3U0HA 5H6HA 2QULA 1XLBA 1XIDA 2GVEA 3P6LA 4GJJA 4YTQA 3XISA 4E3VA 1XLJA 2NQHA 3VYLA 4A8NA 1XIFA 1K77A 1QTWA 5H1WA 1XLDA 2GYIA 4QDWA 4X63A 4X61A 5TNVA 3VNIA 5XIAA 1CLKA 1XIEA 1A0DA 4OVXA 2QW5A 4QEHA 4XKMA 2G0WA 3VNLA 3CQIA 4YTUA 4YTTA 3AYTA 1I60A 3M0HA 3IUHA 3KCOA 4HHMA 2Q02A 4HHLA 4A8IA 1BXBA 2I56A 3M0LA 1XYBA 3TVAA 3C0LA 1XIGA 8XIAA 1S5MA 4YTSA 1XIJA 2X7VA 4XSMA 1DIDA 1XLCA 2XINA 3GNXA 3IUIA 3KBMA 3BWWA 4LNCA 3UA3A 3BDKA 3UA4A 1DIEA 3LMZA 1BXCA 4KW2A 1XIHA 4GLEA 1DXIA 3ITXA 3DX5A 2ZVRA 3FVMA 3ITLA 1XLMA 4EAYA 4XIAA 3VNMA 3KBSA 1XLHA 1A0EA 1XINA 4A8RA 2OU4A 4PFHA 2X7WA 2HK1A 3OBEA 3CWHA 2NQ9A 4QEEA 3AALA 3QC0A 4A8LA 4HGXA 4K3ZA 3XIMA 4Q7IA 1XYLA 3P14A 2G4JA 3KBNA 5C9ZA 3ITVA 4US6A 4HNOA 3KBWA 5I7GA 3VNJA 7XIMA 1QUMA 3UXIA 3KWSA 3L23A 1XLEA 2GLKA 6XIAA 2XIMA 3UU0A 1QT1A 8XIMA 2ZDSA 3KCJA 5J8LA 5EMKA 3JU2A 5FA5A 3QYSA 5AVHA 4ZB0A 1XYAA 5EMLA 3IUDA 3BZJA 5XIMA 3XINA 2NQJA 1GW9A 1A0CA 4ZB5A 3CQJA 4GQBA 4J4KA 4QDPA 3KBJA 3ITYA 3WQOA 1XICA 4DUOA 3U3HA 4QE5A 1XLKA 2GUBA 1XP3A 4DVOA 3M0YA 3ITTA 1XLFA 3KTCA 3QXBA 4XSLA 1XYCA 2HCVA 1O1HA 2HK0A 1I6NA 3TC3A 1DE6A 3N4AA 3BANA 5B7ZA 4XISA 5XINA 5AVNA 3CQKA 3M0XA 4PGLA 3ITOA 3KBVA 1S5NA 3VNKA 1MUWA 9XIAA 3NGFA 2I57A 2J6VA 1OADA 4QE1A 3AYVA 3KCLA 3C0QA 3C0SA 4K1GA 1DE5A 5EMJA 4QE4A 3UVAA 1XIMA 3M0MA 1XIBA 3DBNA 2XISA 1XLLA 1XLGA 2QUNA 3BZGA 6XIMA 3QZAA 1XLIA 1XYMA
chains in the Genus database with same CATH superfamily
1QATA 3E2VA 1UMLA 3BC9A 3WK0A 2I5QA 1WDWA 1PKMA 2QULA 3HQPA 2CBVA 3DBPA 5H1WA 4ICMA 3VNIA 3CZKA 5HA7A 5MKGA 2Y63A 2ZZ2A 3TIMA 4UQ9A 3CAQA 3GK0A 1YLVA 4WK9A 1SO6A 3V0SA 4FOJA 3O05A 3CTTA 3L5LA 5A6AA 3K2GA 1W5MA 2HXUA 1J93A 1GKRA 1X39A 4HA3A 4OIFA 3GZAA 3M6YA 3FEQA 2P3ZA 3S5ZA 4AWSA 4TQTA 4GH3A 2D0HA 3VIKA 4J35A 3LSBA 1HW6A 4H6RA 4UXDA 1DXFA 1GYNA 3NDZA 1BFNA 3L4WA 4QJ1A 3HQNA 1AA1B 3TYEA 5CC6A 4AH7A 4HN8A 2G4FA 1DWIM 4CQCA 1YDYA 4IMCA 1DWGM 4BEUA 2B7NA 1V0KA 2QNEA 1NIUA 4JR5A 2WSQA 3GWQA 3LCHA 3MU7A 4Q4QA 1EC9A 4QROA 5HJXA 1MQQA 3UPWA 2QLYA 6XIMA 4F0RA 1QPRA 3AMKA 2VC9A 1OHLA 1AQMA 3ABOA 1TTQA 3WK1A 1GK8A 1XH2A 5GNYA 3EPOA 4OWGA 3SN0A 3AIVA 4ENLA 2CETA 4AD3A 2E9LA 3ID7A 3SFWA 4TX8A 3VKAA 1J79A 2O9OA 1DEDA 1RALA 4YYCA 5FJJA 1KO0A 3GU2A 1ZRQA 2V3EA 1XIGA 2VRJA 3UVIA 4UR7A 1V7YA 1ISYA 4MZYA 4WGHA 3AXKA 3MJMA 3NVTA 3BGGA 3ARXA 2AKZA 3WELA 1RLCL 3UCDA 3LLXA 3PJXA 2EO7A 5BXTA 2DVTA 1W5OA 3G1RA 3HU7A 4E8DA 3GYCA 1R0MA 3HG2A 4HP5A 3L0NA 3EA2A 3IJ8A 1IT7A 4GX9A 2DUXA 2O92A 4MSSA 4NL1A 4B16A 5HQLA 4ZXLA 1G67A 2YR1A 1WZMA 2Q09A 5A6MA 5I5RA 3SRKA 2OB3A 5IOBA 1MRAA 4O1FA 3LNMA 4YCPA 3SCRA 2GGEA 1KLZA 3RU8X 4O8RA 4PUWA 2OTDA 3EEGA 2QHAA 4CCEA 4XUGA 3W86A 3WH8A 1HJWA 3TSBA 4K36A 1W1A1 1EBHA 4D6FA 2QUMA 3DXIA 3GZ3A 1QNQA 4GVHA 1S1RA 1IWBA 3GNOA 4Y9MA 3UR5A 3AIQA 1BTMA 4WX2A 1AH4A 3EXRA 2Q3RA 1C91A 1R8LA 1RY8A 3BAXA 4BWLC 4XAZA 3WQDA 2Z2UA 4N6FA 4IGNA 3EB3A 1EJVC 2NW0A 2FH8A 1QMLA 4WOQA 1SU5A 3URBA 1HNYA 5H8UA 5A69A 3SW6A 2PC4A 4I3GA 4JNYA 4IPPA 4AY8A 4H8UA 4A8RA 2OWCA 1FDJA 2QCGA 4R27A 1PWLA 3XIMA 2CEQA 1BWLA 4HNOA 1H50A 3C6CA 2ZX8A 3PFRA 4C6NA 1CGXA 3LBMA 2J47A 1ZCCA 1RCXB 5CSYA 1WBJA 3TE9A 1BAGA 1GT8A 1LROA 4UFHA 3S1WA 2DW7A 3TWAA 4QAWA 5BXPA 4V15A 3MBDA 4LNYA 2PLJA 1OGGA 4M80A 2GOUA 2Y61A 4O57A 1P6WA 4JBRA 4B3ZA 3WYZA 1UUMA 2AOSA 2BHYA 3ZXWA 2OPJA 3ZR6A 2ZQ0A 4H1ZA 1TMHA 3FKRA 3GO2A 2TMDA 2AQWA 4NYUA 3AXHA 1ZBWA 2OO0A 3WH7A 1BLIA 1Q6RA 4ICNA 1QI0A 4JNMA 1YNPA 2PDFA 1HZYA 2D2HA 1EZWA 1E3ZA 3ARZA 3VOIA 3ARPA 4AZCA 3CAVA 1V3MA 1SR0A 2V67A 3M9YA 1A5BA 3M5ZA 2V5LA 3WJSA 2YA2A 1K8ZA 5AY7A 1UW9A 4O0QA 4FX6M 2GJLA 3W7JA 1WP6A 4KW2A 3PVFA 4LBSA 3BQ6A 3IVSA 3L4ZA 3KBSA 1QHOA 1A0EA 3EOEA 1RPXA 1HTIA 3BMWA 4Z1BA 5AC7A 1B0IA 1QFEA 2VEIA 5AECA 3JZEA 5PTDA 3WBEA 3LY0A 2ZXQA 3N2TA 2HNEA 1X97A 4U3CA 2WB5A 3TW6A 3CEPA 3CQJA 3PG9A 3EOSA 2GPTA 3W6MA 4D8AA 3SGZA 3EWYA 1R85A 1FA2A 5TBOA 5JH1A 2Z28A 1E55A 3KW3A 1L6SA 4C7GA 1W3KA 4GWEA 1RHCA 2I57A 3LXBA 1H5VA 1KTCA 3NVDA 1CEOA 4L56A 4HOWA 4C6KA 4Q8OA 1FQ0A 4PMJA 3GBDA 1E70M 4HTBA 2O7SA 4C5YA 1E51A 1ZB5A 4YTQA 4E3VA 1YIXA 3ONBA 3ZT5A 2VT0A 2XM1A 3V4BA 3NUKA 1E9LA 1KXHA 1VENA 2F6XA 5J5DA 4PL1A 1L6GA 2NV1A 1AW2A 4NRRA 3MUZ1 2J9XA 2PDMA 3P5YA 4S1FA 4BWLA 1XRTA 2WXDM 4O12A 1N82A 1R3YA 1PKLA 4H2HA 2GUUA 1JIBA 4DBSA 1PIFA 1UUQA 2WMHA 2CXEA 2YZRA 3BAYA 3SIMA 2PRMA 1QOQA 2WSRA 3F4WA 5H2ZA 2CNCA 4HIBA 2QZRA 3P93A 2PDGA 1KWGA 1FWDC 3HOJA 3G0UA 4B3KA 3SZ8A 1TVPA 3CYVA 1FY6A 3CHEA 4X22A 1FKWA 4WDTA 2PC8A 4QDPA 4CVUA 4NILA 5BMWA 2GUBA 1IEWA 4AF0B 5BMXA 3G77A 2PDCA 4GRSA 3THDA 1OYCA 2W63A 4YU1A 1VYPX 1GPWA 3LU2A 2XDFA 3V0UA 2XFWA 2ZFAA 2ZC8A 3DG6A 3M0MA 4L1XA 3UCQA 4A3YA 2BOGX 4RDYA 3SFKA 3ZJ6A 1FH9A 1H7NA 2DZSA 2ZZ1A 1GVRA 2Z25A 3OG3A 3TJIA 3BVJA 2Y7GA 3RGTA 4JOMA 4F0HA 4TMBA 2I14A 4X0NA 4DYJA 2E8YA 4H7ZA 3WX7A 3T9PA 3ZLFA 4K7YA 3RFAA 4GA8A 5M03A 3D0CA 1FCQA 4CKQA 3CT2A 1B2YA 3F2BA 3OGVA 2OODA 2EBNA 2VXNA 1RY0A 3W88A 1WPCA 4D2JA 2PB1A 1LCOA 2EQDA 3HGSA 1RR2A 2VFIA 1TMLA 3NPWA 1Z9AA 3VD7A 3H2EA 1DQWA 3B9EA 4N9DA 4HGXA 3SB0A 1O5KA 4Y9PA 2EPOA 1GNXA 2ZUVA 3OB8A 2WWDA 2BNJA 2ISDA 3S46A 4KEMA 1SW0A 1IXNA 1UR4A 4RPPA 2DZAA 3H8AA 4IIGA 3V75A 4U2YA 2EPNA 2W5FA 4TX9A 1KFCA 4RLIA 1EO7A 1Q2RA 2Y5EA 2WZTA 1X1ZA 4J9JA 9XIAA 4PUNA 3P81A 2DFAA 3FY1A 3EMZA 2J7FA 2W4XA 2E09A 2DSZA 5AHLA 3EWDA 4XZWA 4MIMA 2RDXA 1B31A 2YDAA 1IIGA 1VRDA 2XU2A 3S5SA 4AC1X 5F2MA 1H60A 3DUGA 4JL2A 1SW7A 4H9XA 3IAQA 2ZTJA 4DF2A 1NP2A 4REQA 1SSGA 2ZCGA 3GD6A 4UB9A 4C6FA 4Q32A 4FNTA 4JZ5A 3TLQA 5HJLA 4V27A 1S5MA 3W85A 1PB0A 2XVLA 1QO2A 1OFAA 5CGQA 1E1CB 2W61A 1VFTA 2OMAA 1EJWC 3L68A 2IQTA 1H41A 3N18A 5HATA 3U7VA 3PAOA 4EWND 1PVNA 2RHGA 3F4VA 3EDDA 3TNOA 2VX7A 3LI0A 1B4KA 1JDDA 3GR4A 1G69A 4E5TA 2ZRZA 4DY1A 4C1NB 2RH9A 1TPH1 3NXLA 1DYSA 1YPFA 2PTDA 5EMKA 3A5FA 1GYLA 4ES4A 2F2HA 1MVYA 3A4WA 4BZYA 1GW9A 1TPUA 2ABBA 2Z4GA 4O1EA 1ZLPA 1W37A 3LZ5A 1Q13A 5C9WA 1A3HA 4M19A 5C70A 3L65A 1JQXA 1TKKA 4ZSTA 4R9XA 1QPOA 4X9YA 2QUTA 2XIIA 4D1JA 4JFTA 4GIEA 4OOZA 4KF1A 2FPYA 2QUNA 4JTUA 3MY9A 2QCHA 1QNPA 2G8ZA 3EA3A 4GUGA 3ZR4A 3D47A 1XLAA 3OBAA 4W7WA 1OY0A 1U1HA 4N9CA 3SURA 5CCZA 1Q85A 3VIPA 1ODZA 2JF7A 3BGJA 4DRSA 4J3XA 4MFDA 5D38A 5GJPA 4IQLA 1DV7A 5DT7A 4QAIA 4JTJA 2E6FA 1XPYA 4YTTA 2XGIA 1Z69A 3WENA 1BXBA 1XYBA 5JBEA 1OIFA 1J6OA 1R30A 1WNOA 3LSCA 1I45A 2V3DA 2XGBA 4LGXA 1CXFA 1UZ4A 5D8WA 4AW7A 1ZNNA 3Q58A 5D37A 4MGGA 3A64A 3T8LA 3E49A 5AHIA 4EE9A 4M7SA 1POJA 3W02A 1TELA 1PYFA 3VOFA 3I6EA 3TQ0A 3WF3A 3HJZA 5CPMA 3PZTA 1FWRA 1AQ0A 3TEVA 3VDBA 4QJ4B 2ZE3A 3KAOA 3VM7A 1HKJA 3BG9A 2XZ9A 3LHZA 1GZJA 3W7QA 2GQ8A 1P5BA 1Q66A 1UR2A 2HQAA 3RLVA 1JPHA 3GG8A 3INPA 3W84A 3MZNA 1JUBA 2IXVA 3N4AA 3NQ6A 3LXCA 2D73A 1RBOB 3C8NA 2XH2A 1KM3A 1Q4WA 2J6VA 3BPWA 2Z6JA 1MUCA 1V6TA 4GYFA 1IF2A 1ZAIA 3BSHA 3W1UA 5E0CA 3PPCA 2BWGA 4BFAA 2UZ9A 2DZBA 3DFPA 2J9YA 4XWUA 2P8BA 4FAMA 4LUTB 5I3DA 1ZJIA 3OODA 2CU0A 4PULA 1TPC1 2JKEA 5CZTA 1RK6A 1I60A 1H4PA 2R91A 1OABA 4H01A 4HU4A 1EC8A 3NQBA 1K9EA 4IG2A 3RN6A 3SBFA 1QI5A 3VZZA 4ZOCA 3ANYA 4ZMGA 4HOXA 2OZTA 3VC5A 3UGVA 1XINA 4Z1YA 3WUFA 1RP9A 2AGKA 4PUDA 3UQNA 1UOKA 2QQ6A 4DQWA 3O15A 4B5SA 3CHCA 1US3A 3IWPA 2VGFA 5T9BG 1F8IA 3GHRA 1J4EA 4FNPA 2B31A 1R2TA 3G6MA 2QDHA 1GOIA 2UBPC 3H26A 3NOYA 2JEQA 4F2TA 3PJWA 3AZRA 2A3BA 5C2GA 3O8AA 4X2PA 1EX5A 1M7OA 2NT1A 1VCGA 5T9CE 2HE5A 2ZXBA 2C7FA 3ARVA 4IP4A 2ZA3A 1UD3A 1XH1A 2NV9A 2WJDA 4B92A 3AIEA 1Q8AA 1HX0A 2PMQA 2FZ8A 4J40A 3W7CA 1EHNA 1FWNA 1OM0A 5LNVA 2FHFA 4LTSA 3RJYA 2WBKA 5B80A 4A4AA 1TTPA 1ADDA 4MNJA 1PTGA 4XZIA 4XX6A 1TG7A 3FKKA 5AYYA 3H24A 1O5RA 4Q8WA 3A13A 4DJFA 4FLSA 1LORA 3P0XA 2WZEA 3SQLA 1SZGA 4S3DA 2XVPA 3CUZA 1Q3NA 3LG3A 4JPGA 2WSYA 3P80A 4IMFA 4MPQA 4KRZA 1IZJA 3EKGA 1S2CA 3QFEA 1HT6A 3WLIA 4QQ3A 3SJ3A 4F9DA 1EJSC 1LWHA 3W6YA 1HL9A 1K4HA 1KQYA 1XHGA 2DZTA 2VNCA 3POHA 1XIHA 4UZUA 5A8MA 1F9CA 5DMMA 1XC4A 1D9EA 1LRNA 3GTFA 3OP2A 3WL0A 1B5TA 2X1TA 1A53A 2CCRA 4CQBA 4EXAA 1UR8A 1YKWA 2X8RA 4HNUA 3MP3A 4LYQA 1OT1A 1NDZA 4D8ZA 2PDPA 4L4MA 1TX2A 2VENA 3M46A 3C5QA 3N4EA 1UD4A 1E0XA 4ZB5A 1A0CA 5HNTA 1TUFA 4U33A 4C1LA 1ME7A 3AC0A 2OLSA 3OG2A 1JF5A 1XYCA 3IIZA 4R9OA 4WDXA 3QMRA 1E6PA 4B2DA 3DFQA 3V3WA 4N9BA 4KWVA 4QS5A 4QRNA 2JE8A 5DT5A 1ADOA 4O52A 2XISA 1EPXA 3FYOA 1Y5WA 2XWEA 2RGMA 5REQB 3AQUA 4MJMA 3QSRA 4R3UA 5LIYX 3OLIA 4RW3A 4XD3A 3AIBA 5K9XA 2PTZA 3EPNA 4MUPA 4GGBA 4D6GA 1Q6GA 2NQHA 1RQBA 3EAUA 5JMUA 2QGHA 4W7VA 1L6FA 4DO5A 3ZR5A 3LHYA 3P62A 2BGQA 3PJTA 1NOWA 1QPKA 3UG5A 3T7VA 5BRBA 1HL2A 3SUTA 1V3KA 4IT1A 3KL3A 6ENLA 1JDEA 3CUJA 4JY8A 3A12A 3OGRA 1YYAA 4B5VA 1HP4A 3VD4A 4A6GA 1C9DA 2CHOA 3CUHA 3AMLA 2VDGA 2GLKA 2XIMA 2GZXA 3ZYZA 2J8FA 2XYLA 3CO8A 4JCLA 3MMTA 5FOOA 4ZFMA 4G9PA 5HMSA 1QVBA 3WSUA 4S38A 4WZHA 4A2RA 1DHPA 3ITYA 1JAEA 3QFWA 2HVMA 3WD0A 1W3JA 4ZO8A 4N2YA 3GG0A 4NKCA 4HD5A 2Y7FA 4BR1A 4FOUA 4DXKA 4QLKA 4EPBC 5C0QA 1TV5A 1E9IA 1BHGA 3CWOX 3LRLA 4LS2A 3VIFA 3SJNA 1PZ1A 1TO3A 3T2QA 2D69A 2BSLA 4OUEA 2X09A 1LQAA 4E2VA 3PWAA 1BVZA 2QPSA 4A8NA 3NZQA 1XSIA 2Y62A 1EHAA 2VX5A 1CLKA 2HS6A 2REQB 4QITA 3CV2A 3V7PA 2PDJA 4WHBA 4RDWA 2YSWA 4U3AA 5C7VA 1GUVA 1WX0A 3NPVA 4DNMA 3IUIA 4GXPA 2DVXA 3VDAA 3S2CA 4IGSA 1Q7QA 1ZGDA 4YVXA 4GX8A 2FZBA 2MANA 2PCEA 3ZVHA 3THUA 3AIRA 3AI0A 3B4UA 1ZZMA 4KEZA 1GWJA 2FDSA 1F3WA 4UOZA 4JFVA 3LX9A 3GNPA 4XV0A 3TN3A 2ZWZA 4GQGA 1O4UA 4TTGA 3S5YA 5FD0A 2J4GA 2GVJA 2VR5A 1KBJA 3CHFA 3LLDA 2E0PA 5ABGA 3S2NA 1R2SA 3GSMA 3U48A 2HISA 1SFSA 4CNTA 5E5CA 1JULA 5IDIA 1UIOA 2A6LA 1A5MC 4JQAA 4R53A 4CQAA 4I7WA 5CBJA 4DJDA 2ZIDA 2QPXA 1PV8A 2Y0FA 1J9YA 1MNZA 2CITA 3O6YX 1PEZA 1VZWA 4JTKA 2W3ZA 2B0MA 2Y8VA 2VDHA 4K6AA 4V1XA 1JZ7A 4GH1A 5DX7A 4U4MA 4KWUA 3W28A 2HZGA 5I2UA 1CCWB 1JD9A 3CB3A 2XFFA 4DWSB 3IAPA 2XFYA 5CAHA 4ERIA 3GXFA 1CGVA 4EANA 3UNDA 1CXEA 4FIQA 4JL1A 5D2WA 3O63A 4FLOA 3UPBA 4W89A 1K02A 4UFKA 4CUCA 1SO3A 1DJQA 4BK9A 4Z0SA 4O17A 4QG9A 1SJCA 1AZ1A 1CYGA 1KM5A 4O1CA 4DXVA 3CL6A 3N04A 3KL5A 2PUZA 4PFHA 4P8XA 3AMDA 4CEXC 1DTNA 3UG8A 3A3XA 1JDAA 3R89A 3DKLA 4HNLA 3P84A 1E6SM 4IM4A 3E0WA 7XIMA 3CAKA 4LOCA 3WQ6A 2QMJA 6PTDA 2ZVIA 1DJZA 1X8FA 3GH4A 2A2IA 4XQ6A 3S6TA 2E25A 1XYAA 3VE7A 3PTDA 3TDFA 1W9PA 1A4MA 4W7UA 1E4IA 1TIMA 3WJZA 2X0HA 4FXSA 2XGZA 1XR2A 4GCAA 1A3WA 3T0DA 1J0IA 2O9TA 1XFCA 4XKYB 1E15A 3WUBA 2V3GA 4Y8FA 1KGWA 1H3GA 1XIBA 1JD7A 3L0GA 3CGTA 3SCVA 3VO0A 4UCFA 4V33A 4AIOA 1SJBA 4IOTA 1FCBA 3WLPA 3KOFA 5CJMA 3LUTA 3ZVIA 1OFQA 5H91A 2YCLA 1WBHA 1KFKA 1TPDA 4JIRA 3UWWA 1OX4B 3QKEA 2PWDA 5A6LA 3EEZA 5DCBA 3APTA 3FFSA 3VOGA 3S1XA 1MMFA 2HNHA 4PTMA 3GTNA 3UA3A 1V4YA 1FTXA 1W8SA 1X7FA 1Z44A 1TJPA 5LIXX 5I00A 2E68A 1FFQA 1I0BA 1NM9A 4FZIA 1LBFA 1IGWA 1X8CA 1U1JA 4JEQA 3DZ1A 3V36A 3OVPA 4KGLA 3ITVA 3KBWA 4MKNA 3CH0A 3VGFA 1UP0A 3BE7A 1AQHA 3K13A 4KETA 3PUDA 2A3CA 3TFCA 4MJ2A 1T6MA 3DYOA 5FSEC 5RUBA 1J2BA 2A3LA 4UFJA 1K7XA 4DVOA 2IMRA 3UF9A 1EF2A 2HK0A 4NI3A 5IBXC 1XF0A 3PBWA 3VPLA 3PR2A 3GDMA 3PBGA 5FAGA 1THFD 2H6RA 4Z2KA 3CV6A 1HKWA 2VFEA 3T42A 1TR1A 4MB3A 4W8LA 1M3UA 2ZKMX 4ROQA 1UD5A 3W2UA 2Q8ZA 1BF2A 3PTQA 3CQHA 2VZSA 4GABA 3STCA 1NP0A 3RLGA 1EXBA 2QW5A 3R7MA 2GL5A 4H8NA 4C7DA 3UNTA 3E3HA 1BD0A 3UW6A 4H2CA 2ISWA 4P7NA 4NVTA 1KA9F 2JEPA 1E6RA 2NQ5A 3LBCA 2D24A 1BXCA 5KZMA 4UQAA 3DHFA 3N25A 3DC8A 4J3UA 1M04A 2ADAA 3SCNA 3NNTA 1RPKA 1XCXA 4WIWA 2FMOA 2F61A 1JPDX 4GQ0A 2KAUC 2VD8A 3KL0A 3M7WA 4EXQA 3H12A 1BG9A 1Z3NA 3ZJKA 3G5EA 3PZVA 4MB5A 2WMIA 4GKLA 3N3TA 4ZA0A 3R8GA 3VNDA 4KRUA 4WF7A 2EJAA 5E09A 3WFZA 2W91A 1UWIA 3MP4A 1X6NA 4NX0A 3U2OA 1XG4A 1M7XA 1LBMA 4MZ8A 3P61A 3P8JA 1KFEA 3TX9A 4B91A 2PU1A 1EDQA 2QV5A 4JYEA 1ELSA 4WEVX 3RNDA 1F3EA 3O9NA 4L61A 4IZGA 4PCTA 1Q5MA 4DWSC 5CZSA 2R1KA 3Q37A 3HF3A 4KCTA 1US2A 1VAHA 3N4FA 3OHMB 4GJJA 4H9ZA 3WFLA 1RUSA 3P0WA 4ORIA 2OR2A 1HKVA 1YEYA 2CPUA 1PZ3A 4O54A 5CSRA 3F7JA 2F6KA 4TIMA 1B3WA 1MYRA 4J3WA 5HMDA 1OINA 3CUFA 3KBMA 4Y7EA 2HRWA 2VUYA 2C0AA 3IVTA 3ZOAA 5AC6A 1UKPA 4MYXA 1K7EA 1K6WA 3DAQA 4GLEA 1LUCB 3P82A 4RZ6A 2OO6A 1E43A 3VNMA 5H8PA 3R1ZA 1JJKA 4KCVA 3TA6A 3M41A 3F4DA 3BCFA 4AHPA 4FR1A 2ON3A 3WF0A 4ZE4A 5BNKA 5FJRA 3HG5A 2C79A 1FP8A 6XIAA 3DGBA 1U30A 8TIMA 1WDDA 1KCXA 2VVSA 7TIMA 3KDNA 1AMKA 3GNRA 3Q4DA 1BVWA 5F2IA 2YCEA 3FOKA 1KLYA 1XJBA 1KXTA 4BF7A 3FW6A 4BKNA 3EZ4A 1DL3A 2VRQA 3SAZA 3PULA 1TB3A 3FV9A 2G96A 4AHOA 2NUYA 2FVLA 1UWRA 4HZ8A 5CAKA 1ECQA 3RMJA 4S3JA 3G18A 4ECLA 4PMRA 5IBXA 2OKOA 5F1UA 1XIIA 3FEMA 3TKFA 4EOUA 4QSFA 4Q33A 3A4XA 4GXWA 2WVSA 3BXWA 4LYKA 3W2MA 2ZX9A 1WUEA 3K4AA 5D9MA 2ALDA 4GFIA 4JIIX 1N2VA 3U4AA 3ECQA 4HZ7A 1PZ2A 2A6NA 3CIVA 3GNDA 1TWWA 1KRCC 4C6IA 2X2GA 1B3XA 2W6RA 3TTEA 3MKCA 1O12A 1J2WA 4LRTA 4UOJA 4Z08A 4JTIA 4UQBA 2W62A 3W1RA 3MZ2A 5E0KA 2XN0A 4NAEB 3AYRA 3ARYA 2YBTA 2PDBA 4UMAA 3W25A 1OG0A 5U4NA 1YNYA 4UTUA 4IQJA 4H41A 3G8RA 1YQ2A 1IWPA 3ES7A 1V6UA 2WWCA 4DBDA 1YE4A 4ZZ9A 3S1UA 1LQ0A 1TA3A 4JGDA 1CGTA 1W2PA 3RX3A 1QO5A 1BRLA 3T09A 5HAOA 4DYKA 4WJ8A 4PYSA 4LYPA 3QXBA 1KV8A 5AZ0A 1XH0A 4BA0A 4K38A 2WC3A 4HJFA 3M0JA 1L6WA 3V5OA 2PPGA 3NSXA 4CD7A 3A22A 4NUWA 1OGBA 5DCEA 1E1EA 3CUXA 5EU9A 1L2UA 1Q45A 1C93A 1FWWA 1X6UA 1VFLA 2FVKA 2C14A 4F2BA 5CLWA 4I6VA 3G6LA 4AUBA 1D8WA 2EGZA 5G4HC 1ENUA 2XSAA 1JG9A 1HVQA 1TV7A 4DZAA 4QHRA 1VF8A 1EA9C 4NZFA 3DKJA 4Q7NA 2G3JA 3IUHA 1SJDA 2ISVA 2PFHA 3C3NA 1VFHA 9RUBA 1D7KA 1VH7A 3URNA 2EKGA 3M4HA 2PGWA 4RNHA 1BYAA 4R34A 4B9YA 4IJBA 2YA0A 1MXDA 4MJ4A 1LF1A 3K5XA 3SSZA 5TF0A 3BAWA 1E3XA 3MB9A 1HUVA 2R14A 1E0TA 2V0TA 3WL1A 5DMLA 1BSLA 1V3JA 1ITXA 4WXYA 1Q7MA 3HFYA 3CMFA 2HDJA 4JD4A 4OT7A 5M17A 5I3KA 3TQKA 5JU6A 3WMLA 3WQEA 1UD6A 4Q22A 1GG0A 5HUPA 1KFJA 3SO7A 4DJDC 3OYXA 4L5ZA 1WDPA 1E4LA 4YLWA 1M41A 3NQAA 4AIBA 2QJGA 3L4YA 3ORWA 4J27A 3R10A 3RXZA 3KCLA 2Z7GA 1VIZA 1BSIA 1UH3A 5J5RA 3UXKA 5A8OA 3H70A 5A6BA 4HA4A 4LANA 1RA0A 2OSXA 2VUNA 3NGJA 3VIHA 3BLEA 4YIWA 1W1TA 1E6XM 3BLFA 4PC8A 4CQ9A 1T5AA 1BVNP 2D3LA 1EP2A 3DFYA 1LBLA 4G5DA 3CXOA 1QRQA 1QNRA 4RE2A 3C2FA 2Y24A 4BI7A 4Q4KA 3TVAA 4Y8EA 1W9UA 7REQB 2OQHA 5FF3A 4ML4A 3LB0A 4NIRA 3MHUA 3AIWA 1VIWA 1Z41A 2PP3A 4B9ZA 5FL1A 1JL8A 3SUUA 2GQ9A 4AD4A 2GWGA 3GG7A 2ZRWA 4OKDA 3QKZA 2I1OA 4OZOA 4QP0A 3TTOA 2PF8A 3M07A 1YW1A 2DH3A 2FIQA 2BB0A 4XAYA 3L2MA 1EDTA 1DP0A 4MTVA 3UXIA 1UQYA 4O0ZA 1B9BA 4PMUA 1BEUA 3ERPA 4YWSA 1AJZA 2E40A 3QYSA 3TZFA 3IANA 3QHNA 4NJIA 4KCUA 3U8GA 2UY2A 4XSLA 1D3GA 2FMNA 4A3HA 3NCOA 3ELFA 3M47A 4E2BA 1RBLA 1GZ1A 3UY8A 2FPTA 3TR2A 4UTTA 2INFA 4GC3A 1OD0A 3IRDA 2I9UA 1EIXA 1JEZA 3C3UA 5I24A 1NTHA 1JGIA 3OQEA 4X0VA 2PU0A 1KXVA 1J18A 3CNYA 4Q8TA 3T08A 2XFRA 3GFXA 4B5UA 1F5ZA 4H6QA 3NSMA 4WKFA 3ARTA 3R43A 4MY1A 1OFDA 3QHMA 3LHTA 4LCSA 3QY6A 3IJ6A 1FWFC 1QNSA 2FHCA 2OELA 4K1WA 4QIUA 4W84A 3THCA 2NV2A 3FSUA 2FQIA 2IKJA 4GY0A 4XSMA 1A49A 3CYJA 1T99A 1DIEA 1E6ZA 3S5OA 3GFYA 4F8XA 4OV4A 2WCAA 5E0FA 1L8PA 1GVYA 1GOWA 1P0EA 3E9AA 2ZWYA 3W23A 3PBYA 3TSDA 1K7FA 1QNOA 2WNQA 2J77A 4ADUA 3ZLHA 3T2OA 1GKQA 2FGBA 3T55A 1UD8A 3RLUA 4FHAA 3R12A 2ZUMA 1NEYA 4PMOA 1SSDA 2QAPA 1B1YA 4P7RA 1EFZA 3TXZA 1GQNA 3LPFA 1F6PA 2CBUA 1LWIA 3QV7A 1GOXA 1KM1A 1QWGA 1QNVA 3MMUA 5I07A 3BURA 1UBPC 3GIPA 4G7EA 2ZXAA 2WNZA 4K1GA 5D02A 4P8UA 4XZ9A 3GAKA 3K1GA 3OZMA 4KPLA 4ACZB 2OKTA 3GXIA 4BY3A 3VK5A 4JAWA 3TCEA 5EMMA 1LLZA 4GY1A 3U2ZA 1TZ9A 3E0LA 1J10A 3CMJA 3VKCA 4TO8A 2H9AB 2ZUNA 1WB0A 2WYSA 3CIWA 2GGHA 1V0NA 4OUIA 2PLCA 1NOFA 3RM8A 1UMYA 3LGEA 4UOQA 2IQDA 3VM5A 3GDRA 3W7RA 1GVQA 5AC4A 1TJRA 4PMYA 2XINA 3BDKA 2JALA 2V9DA 1GOMA 3OVQA 1HKIA 1UC4A 1GQJA 3PWIA 4FLQA 3USZA 2XZ7A 2QCMA 1LOSA 3NJ3A 1OD8A 2AMGA 5BXRA 1GHRA 4AISA 3WLOA 4Q8NA 1V0MA 1XM3A 4GG9A 3UYCA 3AOFA 1WXJA 4KKXA 1S2TA 5CKSA 4RNFA 1GJUA 3BCJA 3RU6A 1SW3A 4L6DA 3HFTA 5A8NA 1C3FA 5BXSA 3S3GA 4F66A 3OYZA 4FS9A 5EMUA 2PGRA 3RDKA 1BGAA 2PLKA 1HXJA 3VOCA 3ITTA 3GH7A 3NL2A 1OG6A 4RK8A 4UBPC 2WSKA 2ZA2A 2VFHA 4GUJA 3NZPA 2BHUA 2XH4A 2Z6IA 4NJJA 3DFTA 1L0PA 2PDLA 3RG6A 4C90A 2X1RA 5HPCA 3RK8A 2QMKA 4S3EA 3W7NA 4F0MA 3KEHA 4JN6A 1QOXA 2RFGA 4UQEA 1G7VA 1O94A 4CN6A 1UG6A 1PIIA 3C2VA 2CW6A 5HR7A 1JCLA 1S38A 2Y7DA 4TXEA 3M5YA 3ITGA 4QTGA 6TIMA 3SUSA 4RNJA 4O0KA 1GQIA 1JRCA 4XZBA 4NNBA 2ZZ4A 3B8TA 1WDSA 2OU4A 1G4TA 1X96A 1DJHA 2ZZ6A 3NXFA 1FVPA 5FF7A 5F7UA 3HPXA 4UNLA 1ZSXA 2HBXA 5C6MA 1J0HA 3EWBX 4US6A 1CGWA 3W7GA 4L1GA 2O4MA 1POKA 3EWXA 1V08A 3OA3A 3S8HA 4MMWA 1KCKA 1QJWA 3KOXA 1Q2SA 2VEGA 3TN4A 1DORA 1Q8JA 1ZJAA 3R58A 1MW0A 4HA1A 3K1DA 1ITCA 5T8GA 4HMEA 3STFA 1A4LA 3MV11 3QN3A 3FXGA 2NUXA 1JDFA 4UR9A 2V38A 1OYBA 3PNZA 1I9CB 3OOQA 4E4PA 3TYCA 3FAWA 4NXSA 5E9XA 3NR0A 4R85A 4GJIA 4C6JA 2XIOA 1GCYA 3M43A 4GXMA 3G8EA 5HWMA 5LXEA 4AMAA 4O10A 3VOJA 3E74A 5HANA 1K3UA 5CPSA 1OWQA 2E28A 2CLKA 1SMDA 3E5BA 4HNCA 2D2JA 3T4WA 4B5NA 1UKSA 4GKTA 5AC5A 1B3OA 4PUKA 5D09A 4YPJA 4JYFA 1GHSA 2P50A 3FJ6A 4F0LA 3HB9A 4DJED 5AFDA 2BBFA 4H9VA 4KMQA 5E1QA 4GQQA 3GB6A 2NX9A 3LCWA 1Q65A 2QJHA 3WDPP 4NU7A 4YWIA 3MVIA 5AN7A 4PMDA 1LUCA 4A35A 2DSKA 2YKKA 4DUXA 3LD5A 1H62A 2PEVA 3WLRA 4XKYA 3N9RA 4L4LA 4ML9A 4I90A 3EWZA 3S83A 3N2BA 1NFGA 3U3HA 1JI2A 4LAOA 3WFAA 1W9BM 1M01A 1A5KC 1PTAA 3URAA 4M51A 2PI6A 4J7RA 3TMQA 2A4AA 3TUUA 1EEXA 5DO8A 2NXIA 4E4FA 3MT1A 1OEPA 4Y2WA 3H4GA 5H6HA 3LENA 2Q01A 4LUTA 4CU8A 4AYGA 2QCEA 1V02A 1FX6A 3DENA 4UFLA 2IKHA 3BW2A 5DCDA 1GTHA 4REQB 2Z27A 3C4UA 2HPMA 1UR1A 2W27A 3H55A 4AZCB 5CQ1A 3KUMA 1JPKA 3W76A 4CGTA 3GE7A 1L9WA 1I2QA 1QPNA 3MTWA 3ITXA 2ZVRA 3IIXA 1R7OA 2WLYA 2PRHA 4EAYA 1MW2A 5I3FA 3WF2A 2FLIA 4GD0A 3W73A 1CWYA 1KTNA 2OSYA 1W3LA 1XUZA 4PTNA 2OGJA 5FAJA 3MCMA 1PYMA 3EDKA 3MJYA 3NYDA 1M03A 3VMOA 4GFSA 3ZS4A 4H7VA 2PGFA 4O4WA 3GFZA 1D8CA 1OCNA 3HQOA 1W91A 1DE6A 2O4QA 4LFYA 5HQEA 3MV01 3W74A 1OIMA 1O95A 5HXMA 2OZ0A 1VFUA 1UWQA 3AYVA 3HM7A 3POCA 1ZQ5A 3LCIA 3UJSA 1N55A 3CEUA 3R8HA 3RX2A 3AHTA 2PD9A 4O50A 2X41A 3UXLA 5LA2A 1W17A 1KCZA 2NVAA 4WY0B 3ZSSA 3RLHA 3EOUA 1KD0A 1ONWA 3CUIA 1L6YA 3B06A 2UWFA 4F4RA 1GVFA 3GS6A 4EACA 1ZY9A 3MI3A 4DO7A 3NDYA 4UNKA 4ZEPA 4MWAE 1E73M 1UC5A 3RJXA 2QCDB 4EPDC 1T8QA 5A6JA 2BFGA 3NEVA 3GKFA 3K4DA 3N14A 1G1YA 3H2CA 2F2KA 1LDCA 3PZIA 3BSGA 5LHFA 3TQVA 1FXQA 3GAYA 3F5LA 1C8YA 5CJ5A 3VVGA 5A2AA 3UZJA 3K8LA 4LNCA 3GY1A 4GVFA 2YLAA 5FJIA 3WLLA 2C1GA 3GVVA 1EDGA 4CCCA 5CZJA 4O15A 4QSHA 2BZNA 4WSHA 3AXIA 4UZSA 4DJDD 1J0YA 3F4CA 5D04C 4JIEA 2KX9A 4HPGA 2POZA 3N3MA 5DY2A 3ARQA 1U22A 5AHMA 3A9IA 4M8UA 4DZ5A 2CLPA 3LHVA 3K4WA 4PH6A 1TV4A 2WKJA 1KV5A 4Q8MA 2VC7A 5DELA 4O16A 4LVBA 5GJMA 3S1VA 4GVGA 3UEQA 2QR6A 2F9RA 2ZX5A 3DI1A 4DBEA 1AUSL 1CTNA 2R82A 3FYPA 1J0KA 3H23A 1DXEA 3NL6A 4CNUA 4WVXA 2E7FA 3WNKA 5REQA 1GZGA 3KTXA 2VI0A 3HMCA 2WHLA 1O5XA 3FA3A 2TYSA 3UP8A 3SIZA 1H61A 4BJHA 5HPOA 1A5UA 4QG6A 4M0XA 1KFWA 5EFDA 1OJXA 3IV3A 3QQ1A 2E67A 4FMVA 4PN2A 1DJIA 1KQZA 1LL7A 2J8GA 3S1GA 3NL5A 1NDWA 2DJXA 2J7DA 3RCNA 2I56A 1O60A 2PBOA 4UTIA 1ITUA 3MWAA 3L7RA 1GOQA 4GINA 3BWWA 4J28A 1VRXA 1EKOA 3TV8A 2XIBA 5LZLA 3AHVA 1PX8A 4NHVA 4FNUA 5LGZA 2BODX 3QGVA 2NQ9A 3PM6A 5K3VA 1K03A 4UTWA 4A8LA 3FA5A 4NZ1A 2PZ0A 3G0XA 4PTDA 3WEOA 4DZHA 1Y5VA 4MDPA 3S5NA 4HQVA 1XYZA 1E1CA 1PAMA 1TPVA 2DW6A 1Z7AA 3ZFHA 1AVAA 1W5PA 3PHAA 4GYJA 4IJCA 4CU7A 3C56A 4H4IA 4MY9A 3KBJA 5IFTA 1NWTA 5DRIA 5M5DA 2CHRA 1LL6A 3PAJA 1XLFA 3VMPA 1JQVA 2YYTA 1O1HA 3VD5A 4GI6A 2RDUA 3S9YA 4BEQA 1H5YA 1FRBA 4CD4A 3K46A 2DGAA 1IGSA 3GVQA 3QC3A 2QIIA 3P74A 4YL2A 5FSDC 4LC6A 1G9HA 3R0UA 2QV4A 1U33A 5CPTA 3KVJA 3N13A 5A8GA 2G3MA 1K77A 4KIEA 1JCNA 1H09A 3EKZA 2Z1WA 4WXZA 3W01A 1FUYA 4LCQA 4YTUA 2OX1A 1H1NA 3ARSA 3MI2A 1JRBA 3QF0A 4CCDA 1AW5A 1DQUA 1SM9A 1UH4A 2WM0A 4Z2HA 3LMZA 5CXPA 3S9IA 3GVRA 2V2DA 4IQEA 2DZVA 1GW1A 1OF8A 2RJGA 2PWFA 2C0HA 3T44A 2MUCA 3HZ3A 2YBUA 3PB0A 3E12A 4NNCA 4GHRA 4AF0A 2GOKA 4WGXA 4XO7A 5I7GA 1EB3A 4DAIA 4IIFA 2ZADA 4HK6A 1P43A 4C1NA 1PIGA 3PP7A 1YBQA 4JXCA 4ZSUA 2YXXA 4NAEA 3CPGA 2ZDRA 1H1ZA 1PUDA 5I3HA 2WNNA 3IGXA 2AMXA 1DTUA 3IJQA 1PZ0A 4PGLA 4AEFA 4E4UA 2L5HA 5IRPA 5G2IA 5FACA 1WOAA 1RV8A 1A5SA 2WZMA 2XN2A 2OEMA 4Q8UA 1CXIA 1ZP4A 3VE9A 2RJHA 1XFBA 5MF5A 2ONEA 2PWEA 2H3DA 1EX1A 2VCCA 5CC7A 2RDWA 4O19A 4WDUA 3LV5A 2DSVA 3AUOA 3C61A 3OW1A 3VKBA 3CASA 1RQEA 1UR9A 1ZAHA 4E6MA 4MF4A 2GJXA 3ZWTA 2BHZA 2C1HA 3WBYA 1A3XA 3HQ1A 2UV8G 1AZ2A 3NQGA 3BICA 4NAFB 1NAL1 3GDBA 1MZHA 4O13A 4AD1A 4PB3A 3WLTA 1CX9A 2Y7EA 2DORA 3AICA 1Q4NX 3SCTA 2VGIA 5I06A 4KFNA 2WAGA 3W1AA 4IG2B 2ICSA 1PHQA 3A3WA 4CCZA 4FF5A 4H9TA 1XDJA 4MG4A 4DI8A 4IIBA 2XIJA 1IQ8A 3TONA 4GNVA 4D8LA 2Z1KA 3PBUA 1E5JA 1TPWA 4I5XA 3VX1A 1MEHA 4M24A 1H7OA 2IKIA 3E0FA 3CL8A 9CGTA 1DBTA 3N12A 1H1YA 4BCEA 3M7SA 2H90A 3CB8A 1JGMA 1RD6A 3UERA 8A3HA 5CC5A 3HV8A 2Y88A 1HF6A 1IEXA 2G5WA 1F7BA 3WBWA 1UP2A 2RUSA 3JW7A 3SY8A 3H6OA 4B5XA 1XYMA 2D2OA 2V2HA 4CQDA 3WLKX 3N15A 1KW1A 1XIDA 1UB3A 1E1FA 1JVNA 4RX0A 1XPGA 5I3JA 5A2BA 1PPIA 3JUGA 3WBAA 3O1NA 3LTPA 2ACQA 1VKFA 3JRKA 4XZHA 4HJWA 1W0MA 3TYZA 2YIHA 5C71A 3W3OA 1J8VA 2WOQA 3M0LA 1MZRA 3IIOA 4S2CA 3GBEA 3I6TA 3IIPA 3AWOA 2W0UA 3EOLA 4DIAA 3AS0A 1UPPA 1FWBC 3FNDA 4DF1A 3PN8A 1RJQA 4AIEA 1F76A 1QPQA 1EEPA 2GJRA 3Q67A 1VBGA 3UJEA 1XYLA 4ZQCA 3APGA 1XLEA 3GC4A 3CV1A 1S2VA 3AISA 5GNXA 1W1B1 2E3ZA 4GBDA 4L6OA 1ICPA 5K4XA 2NQJA 3PS7A 4MYAA 5MHBA 4QLJA 3MDUA 2PURA 3NQVA 2FTPA 2PZNA 3H53A 1JCMP 4KEVA 2HJPA 2JKPA 3LQGA 4MLJA 3E2SA 4S23A 4UQCA 5EMJA 2X0YA 4QCFA 2EHHA 4P5UA 1VFOA 3VDHA 4LUSA 2ISSA 1QI3A 4L9ZA 2ZX6A 2PDIA 1XISA 2BVTA 3B3DA 2A7NA 1FWSA 4TTUA 4IQDA 4GACA 4JQ1A 2B81A 1WOBA 4OTKA 4I7VA 4IFRA 4OVXA 1G7UA 3W7IA 1DVJA 1QAPA 1EJXC 1W1IE 1UHVA 1K9TA 2YXGA 3VIOA 1NJJA 4KWOA 1R86A 1EP1A 2F84A 4KWWA 3HPAA 3R2GA 2VWSA 2J75A 2YW3A 1YXYA 2R6OA 1UKOA 2WZHA 3O07A 4L9XA 1EH9A 3ZT6A 4CD5A 1CT5A 3GU1A 1JAKA 3G0SA 1YADA 1W1PA 3E0VA 1Z8AA 1YRRA 5FEXA 3L23A 4Z17A 3WLSA 3NOEA 1YBQB 5BRPA 1R3SA 4LAMA 3DFNA 3A23A 3UJFA 1GJPA 2GJPA 5D4YA 1IE7C 4OHQA 5JIPA 3B4YA 4IMGA 7A3HA 1IT8A 3CZGA 1JPMA 4CNPA 2XWDA 4L80A 1T40A 2WZIA 3OIHA 4OGZA 4HYWA 1E4MM 3STPA 3TTYA 2HMCA 2EPMX 4XUYA 4HMDA 4S3BA 3SRDA 3G24A 5CC3A 2C18A 2DIEA 4LB4A 1LZOA 5FEPA 4DZIA 1Y0EA 4PBGA 1DPMA 3D3AA 2DT0A 3DCPA 4A21A 6A3HA 1WXYA 3R13A 3W1NA 1R9ZA 2EF9A 3B9NA 3ZIZA 5B7YA 5DQPA 4HPHA 1PKYA 1W3NA 3AAMA 3ZZ1A 1XLBA 3N6HA 3UR7A 2BP1A 2D3NA 3SCUA 1YTEA 4G1NA 4GNKB 3LOTA 1F07A 3VIJA 5DBUA 3MWCA 2ASHA 3OPSA 5A8PA 3II1A 3U57A 5DY3A 2WVUA 4GZEA 4AQLA 5K9DA 3CS2A 1P0BA 1OC6A 2NXHA 2H9AA 3RRAA 3UZYA 3CZLA 2QVNA 3I65A 4H19A 3WDQA 5T26A 4Y6GA 1VYRA 3F2DA 4ZQPA 4QM1A 4XD6A 3BLKA 1Q6QA 1VJIA 4OECA 1F6KA 3UWQA 4GVIA 1Z6KA 1HFBA 2GFTA 4JFSA 1RK5A 3OGSA 2G4JA 1R9YA 4HSNA 2A7RA 3NPXA 3LZ3A 4ZQNA 4P2VA 1M6JA 1ITQA 2WJFA 3B8DA 3N17A 4PA8A 2WMFA 1WKDA 1CBGA 1TUXA 1NVMA 3KRSA 4Q4PA 1TIWA 3RHGA 3K8MA 1DJGA 3NZRA 4G6CA 1AL8A 2WCSA 1OADA 4QE1A 1IIHA 3M0ZA 1H7WA 4CNNA 5E70A 3ZJ8A 4LF2A 4D72A 4WDWA 1F4AA 3KP1A 4MWAB 1V0LA 3MKKA 3N11A 4O28A 1H63A 3QGKC 4AZ6A 5EBAA 2RDTA 4MNLA 3R5EA 3OLEA 4UFMA 5A1AA 3MS8A 3WCZA 3L5MA 3I6RA 4GE8A 2PTXA 2YDSA 1A0DA 3PNUA 4OJYA 4XAPA 3JZUA 1HJSA 3HURA 3BOFA 2X7VA 3B0PA 1P7TB 3QW4B 2QDEA 1OB0A 4JKLA 2V5JA 1X7IA 2OYMA 4IGMA 1RD5A 2J88A 3VFCA 4FO4A 5HWNA 1S2AA 4I6KA 3MQTA 1YTKA 4D6EA 3LDVA 4WUIA 3WY1A 3MI6A 4AMCA 3D46A 1QBAA 4J3SA 3IJ9A 3M16A 3QPZA 3MBFA 1E6QM 1JCYA 3CK5A 4WSJA 1GEHA 5AYXA 4NG3A 4R7JA 3BW3A 1TMQA 2Z1VA 1UKTA 1XS2A 3TYUA 5CGTA 2O55A 1IT0A 2BXYA 3O6CA 1UZDA 4ACZA 4LUSB 1O5QA 4Z1AA 5IFPA 1KFLA 3MYOA 3PZGA 4U10A 1TPEA 2FJKA 1QDSA 4D1IA 1U5VA 4FX7A 3PANA 2A85A 5EMYA 2GWNA 1QTWA 2IQ0A 1ME8A 3PZNA 4C5ZA 4EF9A 3DHPA 1J6PA 3R0DA 5JQ9A 1DKWA 3C0JA 3LMYA 1D3HA 2GVGA 1DIOA 3RMEA 5I77A 3VGGA 2V6AA 2QKFA 4GCXA 2DEPA 3ABSA 3R8RA 1BQGA 4LRSA 4FX8A 2ISFA 2NVDA 1CENA 1JNDA 3EDFA 1FKXA 1UWTA 1KKOA 5A5WA 4XIAA 5F4SA 1FWHC 4EX4A 1U83A 2DSUA 3VZXA 2J9ZA 3IJLA 2DV0A 3K30A 2J78A 2Q8LA 2EEXA 2BTMA 4LWWA 5CG7A 2J24A 3VIMA 2BX7A 3VD9A 2VCAA 2FFIA 4AZ5A 3U9IA 2GSJA 1OFEA 2YPIA 3DESA 4LVAA 3WNMA 3FLUA 1YXCA 5C8BB 4PODA 4W85A 1SQ7A 1KR1A 3M0YA 5HBFA 4QJ3B 3L5AA 3UWEA 3F4NA 4NNAA 4HHHA 3T8QA 1UCWA 4Y90A 3MO4A 4IJRA 2YL8A 5BOFA 1UZHA 5LHEA 3IACA 4H8HA 1XLGA 4GIRA 2FDMA 4AYSA 3TCSA 4UUIA 4AWUA 3WLJA 1KM6A 4TV5A 4DNHA 4YVVA 4PCFA 4Q4MA 3N2CA 4LY8A 4R7OA 4ROPA 3BAIA 4FNSA 4G2DA 4GPNA 3BG3A 1W1VA 3D6NA 2ESCA 3ZVHB 2FZMA 3REQB 3E5PA 2VFFA 2HROA 1J96A 4Q8PA 1DIDA 4CEUC 1I1XA 2E5DA 1V02E 3RM9A 4FSAA 3B40A 3MVTA 1EPVA 3R11A 2Y89A 4G7FA 3DDMA 2J66A 2WC4A 3GXDA 3KRBA 2ZZ7A 3OBEA 4QEEA 4U2ZA 3AALA 4K3ZA 4AXNA 5D33A 4DHGA 1QASA 4FIRA 4O14A 5CZKA 4A2SA 4W88A 3WNOA 1XGZA 1U1UA 3MUIA 3S42A 3PG8A 4AZIA 1HO1A 2E5CA 2J13A 2C8NA 4LAUA 3W4RA 1RJRA 3LHWA 4EWJA 2R1MA 4JHZA 3BANA 2G50A 3IS4A 2H3BA 4WSKA 5A3HA 4JTTA 4ADSA 4ZODA 3QEZA 1KBBA 1TV8A 5BW6A 1I2NA 2VX4A 2DT1A 1VBJA 4GK8A 1A5OC 2JF6A 3GTHA 9XIMA 4G56A 3B9OA 4ZQOA 4YYFA 4IIDA 4C7FA 5JBFA 4W9TA 3I68A 1V77A 1OGSA 1VP5A 3E2RA 2DDXA 1ONEA 3DN5A 1C7SA 2GYIA 3BH4A 1V6XA 1CGUA 4PEKA 2NSXA 1FCVA 1QK0A 1ZFJA 3EMCA 4MB1A 1PX3A 1H0IA 3KFTA 4M81A 3RR1A 2CBIA 4RZ4A 1P7TA 3UZWA 2FYMA 1GG1A 1VLIA 3UA4A 3WNPA 2VZOA 5HMEA 4F9JA 4AY7A 3WLNA 4LALA 1V79A 3VDGA 4A3RA 4GIYA 4CN4A 1RH9A 1ZL1A 2YFNA 2P5NA 4DO4A 3BJFA 1JYWA 1SO5A 5EY5A 3IV8A 1RVGA 3I3DA 4POCA 1F3TA 3NIYA 4LCRA 4C6PA 1RBAA 3UU0A 3EB4A 4JFWA 4INFA 5LKYA 1OQFA 1JYNA 3URQA 3W1XA 1JUEA 3TR9A 3EXTA 1RZMA 4B2DD 5C2XA 3UJRA 3T0CA 2C91A 1T8XA 4Z1DA 1BXNA 2V82A 3T05A 2OYLA 4PMXA 4P7QA 2DQWA 3R94A 5G5IA 3T1GA 4I9TA 3UZZA 1OZMA 2PDWA 4WY0F 1HVXA 3ZO9A 3U6WA 1MEWA 1ISWA 1UP3A 2CLLA 1V6WA 4IX2A 3M0VA 2GK1B 3NQFA 3N34A 1VLWA 2EXOA 4UCGA 4R7WA 5MKGB 3VABA 2OLHA 1GORA 1N8IA 1YNQA 1UIPA 2C3ZA 2OGYA 3PBVA 3KS6A 2CLFA 3HMJG 1L8NA 3SECA 1S39A 4DPPA 3WBXA 2JBMA 3DG7A 2GGIA 1FHUA 1M9HA 3WNLA 4Z2IA 3RUBL 5DBTA 4IXHA 5CJNA 1AH3A 4GJ1A 3VI2A 4N4QA 4EVZA 3ZWSA 5G1MA 4ZR8A 4C6OA 1K8CA 1UUOA 5FIPA 1TSIA 2DP3A 2ABAA 3WF4A 3A5VA 3QPEA 2ZDSA 4JIQA 3VILA 4NJHA 5D9PA 3O2LA 2ZYFA 5A8QA 3QR1A 2P53A 3WJXA 1W9DM 3L2LA 4C6DA 4XISA 3QR0A 4PMQA 1ODUA 3KS5A 3ARRA 2ACRA 5LYRA 3B8WA 4S3FA 4R33A 1BKHA 3RCMA 1UROA 1PXGA 2KZHA 3U7BA 4JN7A 2FH6A 3O6DA 1V93A 3BUVA 4LT9A 1ISVA 2CXGA 1XDLA 3HPSA 2D23A 1REQA 4PMZA 2CLIA 3QH2A 1RCOB 4ERAA 2XM2A 2BXVA 2HPIA 3U5YA 5I0DA 1TV2A 4O53A 1VEPA 1IXOA 3IGSA 1DWFM 1PX4A 4LH8A 4HHLA 4K68A 1IEQA 1XIJA 5HNRA 1OZQA 2CWNA 2PF0A 2YLLA 1WUFA 3H7VA 3BL3A 3W24A 4JN8A 2WMJA 4DWDA 1CXHA 1XBXA 3OLGA 1XBVA 1OFOA 4NRSA 4S3AA 5DFAA 1ONRA 3PK7A 5HINA 3NQEA 4RZBA 4PMNA 1W5NA 1M65A 5CBBA 4OFCA 1EJUC 2PDQA 2V3FA 5XIMA 1ICSA 1AD1A 2PS2A 4LUIA 4AC7C 1X1OA 3SY5A 2DUAA 3L2IA 2PSNA 3S2MA 1CDGA 1GONA 2HVOA 1LYXA 1D2KA 4PFMA 1N8FA 3EBVA 4JTLA 3UETA 2XVGA 1OFRA 4PUMA 4CLMA 1NFPA 3RPMA 3DHUA 2QCNA 1JI1A 3W70A 4GC4A 5FCZA 3MKVA 1XG3A 4BF9A 1JR1A 2J25A 4NF7A 2EKCA 2VGGA 4UTTC 2AAMA 4L6HA 5C9XA 5FJUA 4M6UA 3H2NA 3OJGA 1W9XA 3SQMA 7CGTA 1QK2A 3OVGA 3D3FA 1SFLA 4IMAA 3FN9A 1IEVA 2Z24A 3VNLA 3AYTA 2ACUA 4A29A 3PUGA 4HHMA 2Q8XA 3T78A 5FF0A 1RSCA 3TYBA 1XLCA 1EGZA 3VGEA 2QF8A 1VPXA 2BGSA 3LPGA 3CV7A 1JCJA 4TR9A 1VS1A 2XVKA 4GZJA 3SADA 4I7UA 4AB4A 1UWSA 4WJXA 3W37A 5IM51 3CJPA 4DN1A 2YYUA 3TYDA 2PGEA 2HSAA 3S6OA 3V5CA 4AY1A 1WXZA 2E9MA 2OEKA 2P88A 2XHYA 3KM8A 3Q45A 2WVVB 3WH6A 2WO5A 5TD4A 1TRIA 3BZJA 1Q6EA 1BPLB 1A5NC 2IS7A 4Y9AA 4GQBA 2OYKA 3QVQA 2IPGA 5HWJA 3QRHA 3KTCA 2HCVA 3P5ZA 4GISA 1Q6CA 3BQ5A 2OCZA 1IZCA 3FK4A 1WZAA 2D1ZA 3BMXA 1J0ZA 1J5TA 3TOYA 3B0XA 3B04A 3L4XA 4M82A 2WHKA 3B0VC 3W1PA 1P1XA 3TU9A 2FZ9A 4W4QA 1U2YA 4LJ3A 1H7XA 4L9YA 1ZBVA 3UGRA 5BROA 1K4GA 2YA1A 2QJJA 3ABZA 1ONXA 3Q94A 5ECUA 4IF2A 1H2JA 4LVGA 3WJWA 4KEUA 3LM7A 1H7RA 3KVMA 4H8VA 3W75A 1IXPA 3TNBA 1PDYA 2CFFA 3FAXA 3T4CA 1XKYA 3KDOA 3MC5A 5C9RA 4AVOA 3LEPA 3UWVA 1PO9A 3W29A 3PZ9A 3RYSA 4MM1A 2QIWA 4P61A 1Q6DA 3AXMA 5DMYA 4LF1A 4O1AA 2J6XA 4JDBA 1I2PA 2WM1A 2HWGA 5BOEA 5U7SA 4ZQRA 1UKQA 3SN1A 1HIZA 1FWJC 2ZZ5A 5EPDA 2QS8A 5B7ZA 1TVLA 1VEMA 4IIHA 3VUSA 3E2QA 1QCWA 1ZU8A 1K70A 3LV6A 4NASA 4FOKA 4CQ8A 1TV3A 1GVEA 1F8MA 3CL7A 4QE4A 4ACYA 2VR4A 1KKRA 3FDKA 3CUGA 5CPNA 3VAVA 2Y85A 1TWSA 4HT3A 3KOWA 3V16A 1REQB 5E6YA 3TJXA 2VZUA 4JIPA 3E1F1 1NSJA 3ZMRA 3FDGA 4C1KA 3VGBA 4C65A 3RILA 3NQMA 1XV8A 5CPQA 2RGLA 4DUVA 1SPQA 5HDRA 1JXKA 1TCDA 4JX4A 4CD8A 1EJ7L 1FCUA 3GIYA 1VJSA 3PPFA 3GXMA 2DQXA 1CXLA 3DFSA 1HP5A 3RIKA 3MMDA 4PCNA 1KBKA 2GSEA 1XYFA 3N9SA 4MY8A 3HA1A 2PTYA 1XBZA 3QMTA 4BS0A 3CHVA 1G5AA 1JFXA 4G1KA 2VEFA 5L6UA 1SMAA 1J12A 2WJEA 4UR8A 2HBVA 1XGEA 2WV8A 3MW7A 3SCOA 4C6LA 4DBUA 4I5UA 5E9AA 1VBRA 3L67A 1O6IA 1BGGA 2V2CA 4HNVA 2QVHA 4L7ZA 4XZNX 5AVNA 3ITOA 3QJAA 2B7PA 1XUUA 5L9FA 3ZM8A 4AX6A 3O7UA 2PCQA 1XLLA 4AFYA 3DGRA 3ANVA 3DFOA 4ERGA 1K1DA 2PWHA 2YL9A 4JDYA 3USBA 2FB3A 1R9XA 2R8WA 4ZBCA 1KWKA 2FGZA 1P0KA 1TWDA 3J7HA 1T7LA 3VZYA 3ZJ7A 5G2WA 3UG3A 5F2GA 4Q6JA 3JR2A 4D6DA 2CBJA 4RDZA 2BOFX 4LYRA 4TVDA 3GTIA 4L4PA 3WD4A 3FCPA 3KWXA 3GM8A 3LS9A 4WQ6A 2G0WA 4IISA 1W54A 4AD0A 4NQ1A 4PE8A 4TU1A 1DWJM 4RJEA 3DERA 3DYPA 3TFXA 2BY0A 4QJ5B 3SSJA 1OSEA 4AU0A 2FB2A 4IFOA 4S39A 5IHSA 4CU6A 1RXOB 2XSBA 3O0KA 4OQVA 2W67A 1CI1A 3N9KA 5C9ZA 3KBNA 4NYYA 4C60A 1CIUA 2GGGA 1LOLA 1PCWA 1B90A 3HBLA 2FGLA 2OX4A 3R6IA 3SM0A 8XIMA 2O9PA 2WBGA 2OFJA 3VGHA 1XWYA 5AHFA 2DVUA 4J4KA 1VPYA 4N42A 3VDCA 1DOSA 3LERA 1B30A 2HXTA 4HA0A 1P6BA 4MOZA 1KNWA 4HZMA 3GUWA 4ZVJA 3BSMA 3CZEA 5HULA 1CB7B 1KFBA 2OQYA 1XCWA 3W2NA 3NQ8A 1C8QA 3NQ7A 4HU0A 3S4TA 3UCCA 4FXJA 5SWUA 4J5NA 3TWBA 3RX4A 4GI4A 4AZ7A 1YE6A 5LIKX 1HG3A 3NO3A 1J01A 3C86A 4JIHA 4DJEC 2ZRYA 3P60A 4JTHA 1Z89A 4MADA 2QCDA 4DWSA 3BOLA 3AMGA 4DAFA 4FK9A 4HVXA 3TK7A 1AMYA 3FXYA 4XO6A 1TJ1A 1MXGA 3W72A 4GO9A 5KZEA 5LSMA 1EYEA 4H6KA 3RRXA 4QGCA 3VXGA 1W1YA 4MVAA 4CD6A 4AZBA 1R5YA 2WK2A 1R46A 3PZMA 3WDIA 3E96A 5IHRA 1UR3M 2MNRA 1A80A 3G1AA 3MUXA 2VO5A 3IK4A 2BXZA 4RW5A 2J8TA 4PUUA 4WJEA 4DXXA 2DZUA 5A6SA 3LA4A 1R3TA 6REQA 3HG4A 2VM8A 2Y6ZA 4ZE5A 1BYBA 2BGNE 1OF6A 4K8HA 5KZ6A 3NURA 2WNWA 3RF9A 3SDOA 1XGDA 3W38A 2NWRA 1VBHA 3AMCA 3NM3A 2UY4A 1XI3A 1TR9A 3UVAA 1R38A 4B5WA 4UQDA 2NWSA 1YHTA 1NFBA 3FIGA 4XIMA 4KCWA 2BV9A 4EKJA 4XAFA 1EF3A 2PDKA 4F40A 4WRHA 3MCNA 5AKQA 2J79A 2G3FA 1E0WA 3CT7A 3KHDA 1FDZA 4IGHA 4U31A 1LT7A 4KIRA 2D2GA 1YTDA 3KZSA 2GK1A 3HJEA 2C71A 2YDQA 2V63A 3GR8A 1EP3A 2FHBA 3AWNA 1P0NA 2R1LA 1CW2A 4IWWA 4LV9A 3FGCA 1DXIA 1C8VA 4MFEA 4FB7A 2HV5A 1GJWA 2XH0A 2XG9A 1ZAJA 2QJIA 1LL4A 3NWRA 3PFMA 2QPUA 3QMSA 4UFIA 5M2FX 1YDOA 2W9MA 4FLRA 3KXQA 1VPQA 4RZ5A 1QT1A 3EOOA 5AYZA 2Y70A 3ALGA 3CWNA 2XJ7A 1EUAA 2QCFA 5AZ1A 4ZOAA 3UJ2A 2XPKA 2BVDA 4MZ1A 1PKNA 5FEZA 5KZDA 1SFJA 2E5BA 5D30A 1P1MA 4NX5A 2E8ZA 4OBTA 2J74A 3R79A 4NY2A 3GIQA 5KEZA 3TLLA 4F0SA 2BS9A 1K8XA 4W5UA 1W1ZA 4Q8VA 3NO1A 3ZLGA 2ZUSA 4PTVA 3DHDA 3OZOA 1OX6A 5HOSA 3M1ZA 3ATZA 1VFMA 4IPLA 5DF0A 2Y4SA 5ENLA 2DUZA 2OQLA 3MUCA 3AS3A 4WKAA 4QDWA 3BJTA 1J5SA 3H4XA 2OOFA 3EB2A 4JTCA 5C7HA 2QUVA 3BLLA 4XG1A 3RO6A 1JF6A 3THQA 2C6QA 4YTSA 3TC7A 4DB7A 2DIKA 3OQ8A 3DH7A 1U5HA 2IPWA 3IIVA 2E1WA 2NT0A 2R94A 1MSSA 2CZVA 3W07A 4C6EA 3CLWA 2X1IA 3NM1A 3FA4A 1W2VA 3EX2A 4GQRA 4NXKA 5A94A 1JNEA 5KINA 3NG3A 7PTDA 1V3IA 4D9PA 1C9WA 2DT3A 3P67A 5LNWA 3V1PA 1VCVA 1I2RA 3DU0A 3QBUA 2O0TA 3SRHA 4OU1A 3UY7A 4UTWC 1BQCA 3FJ4A 2WMIB 4Y96A 3OBKA 3ATYA 1EJRC 3BJSA 4RPQA 3PZUA 2YCJA 3AHZA 3N19B 4PB4A 1SZFA 3LPPA 5K9CA 3S47A 3UD6A 4R5EA 3TW9A 1GGOA 2NLYA 3L9CA 3PUOA 4PTXA 2CLHA 2TRSA 3AJ7A 1M7PA 3QOKA 3W7DA 3F5JA 3H2FA 2YJQA 2ZUTA 2CERA 1VCFA 2OG9A 5IDZA 2FZDA 1NWSA 2CZDA 5DRCA 1PJ9A 1XIFA 3D5HA 4JKMA 4QQUA 2FTYA 4ZFCA 5FF4A 1E56A 1OK6A 1G4EA 3LTYA 4UMCA 3A47A 1FWGC 3C0LA 1W3IA 3AU2A 3GXTA 3W1MA 3F03K 1FWCC 4J2PA 2I16A 2ZA1A 2EG6A 1TTJA 2EG8A 5F1VA 1EQCA 3B0YA 2TODA 4X3ZA 3DIPA 3GW3A 1GTEA 2Y5JA 4HPNA 1VD6A 3IVUA 5CG0A 2YB1A 4Q7BA 3QZEA 4IUGA 4OV9A 3GQYA 8RUCA 5FI8A 1CXKA 4DELA 1TQXA 3MYPA 4DJFD 1E4NA 8CGTA 1UA3A 3U2EA 2JK2A 5EB8A 4DWSD 2BY2A 4PSPA 1XP3A 2VL4A 1W31A 1DIKA 4PCSA 4QX4A 3IJIA 2JKAA 4B4FA 3LRKA 1DJWA 3EGJA 3N2XA 1ESWA 1EGVA 3LQLA 1PS9A 2HS8A 4W93A 2F38A 2PRLA 3MPGA 3LCGA 4JTGA 4EPKA 4K7VA 1FHVA 3I4EA 3OO2A 3G3MA 1V3HA 3KP0A 3NDOA 3G1DA 2CESA 3NEHA 3W7EA 2X1SA 1FWAC 1YX1A 4JNZA 5J04A 1O7AA 4UTFA 3AO0A 2GQ3A 2V69A 2GVLA 2GUYA 2Z26A 5XIAA 3A3HA 2VD9A 4F2UA 4GUFA 4LAKA 4GZ7A 4BHYA 1ISXA 2V5KA 5EL1A 2FVMA 2GGJA 4JTAA 1K9FA 1VHNA 3FHQA 4YS1A 3PPGA 4PZVA 3KOZA 4I9MA 2CLEA 3NTYA 1EC7A 4ZL1A 1PTDA 3AU6A 1B57A 3EX3A 4TX6A 1LLOA 3T6CA 2R1PA 4DLFA 3PZOA 4L64A 1UR0A 4GMEA 3RCYA 2J7GA 5GVJA 2ODOA 3EWUA 1I4NA 4F0KA 3R4IA 1UA7A 1YPXA 1TREA 5D03A 1IR2A 3TN6A 2WPBA 1EXPA 4HYRA 3KCJA 3BO9A 4Y9NA 3VIGA 5E6ZA 2UY3A 3H2OA 4GUIA 7TAAA 4ILSA 3FJLA 4JHMA 3WQFA 4QFUA 1S5VA 5DANA 1TVNA 2Y2WA 3NQCA 1XICA 3VGDA 1QHZA 3IJDA 3QQWA 3SCQA 4B15A 4ZTYA 4S3GA 4LVDA 3UXDA 4IICA 3NGFA 5GPRA 3WD2A 3QGAC 4AWEA 3WUEA 3PSVA 4PRWA 4LXFA 1FFRA 3DI0A 4ASTA 3W81A 3U2CA 2PP1A 1X38A 3QV9A 3W71A 5I09A 2ZRXA 3W53A 2Z1SA 4C6BA 4QLLA 4GZIA 4EPEC 3OZPA 2XUCA 2G97A 2PTWA 1W32A 1Z42A 2ZXDA 3HO8A 3I7QA 3QTGA 4YHEA 1S3HA 2YBVA 4PRRA 2AKMA 2VQUA 4S3KA 2Z00A 3BOXA 4MDOA 4HMCA 4KS0A 2YCKX 1RVKA 2YB4A 2PP0A 1A5CA 3QPYA 2OT0A 1O66A 1BWVA 1YDVA 4PMVA 2O7QA 3VA8A 1FH7A 3Q65A 1RP8A 3DECA 3OLDA 2B7QA 2ZOXA 4V28A 1EQPA 3TW7A 3T07A 3S6DA 1B3ZA 4E2DA 5JVLA 3F5KA 4ATWA 2QYGA 3E6EA 4W87A 4JX6A 1QUMA 3BLPX 1TX0A 2W66A 1WCGA 5I02A 4J3ZA 4Q8QA 1NU5A 1Q6FA 2J7CA 4J3VA 1NF7A 5LA1A 1ZS2A 4L1WA 5JXQA 1RQHA 3OEXA 4EXBA 2ZZ3A 1D7FA 3CQKA 3BW4A 1SZNA 3VNKA 2INZA 2GDQA 4HK7A 1SUXA 4WCJA 4RXGA 1IV8A 4YVPA 3CC1A 1M1BA 3W1TA 1AW1A 1XLIA 1ECEA 3KTSA 3TMLA 1IR1A 1GVSA 1R47A 2JIEA 4FEZA 4JS3A 1XRVA 3VKDA 2DZPA 4D6CA 1O68A 3UR8A 1XL9A 4I8DA 5C2CA 1F2JA 3VINA 2VR2A 3NZ1A 4BI5A 2D20A 1E0UA 3AYSA 4TV6A 1VGAA 3LNPA 1EL3A 1NY1A 1HKMA 4P8VA 4UTHA 3C52A 4XZLX 1E5NA 5BZAA 4IIEA 2XTKA 2Z1BA 4QBXA 4AIUA 1ZBCA 1P48A 1NDVA 4NAFA 4HSHA 3GHTA 3ITLA 4TVUA 4URIA 3GLCA 3AUJA 2WVVA 2D0GA 1BYDA 3E02A 1K8YA 4TVCA 2X7WA 2VOMA 5CZ0A 5D2XA 4HOZA 2Q6ZA 2ATMA 2VP8A 2NXGA 5CH9A 3BLIA 5FJTA 2YW4A 1VR6A 4QXIA 2OSWA 1F3XA 5J8LA 3JU2A 5AVHA 2POTA 1YMYA 3XINA 2WLZA 3PUEA 4ATLA 4WR3A 5C5YA 1UOZA 3GHUA 4GYKA 3VKJA 5I3IA 2NQLA 1MEIA 5XINA 5BOOA 5D8ZA 3M0XA 4L4OA 3MSGA 1A5AA 3IK2A 1PCKA 3PPHA 3NFUA 4C6MA 4C6CA 4RXFA 4NT0A 1SZRA 4AEOA 4XVEA 2CZFA 5C9UA 1SGJA 1LTDA 4AVNA 5AYIA 4AEEA 1HKKA 4FF7A 2Z29A 1PSCA 4FA3A 1W3HA 3ZSTA 2A0NA 1SO4A 2YCLB 1FH8A 1DQXA 3G3DA 1FHDA 1MO0A 2R1NA 1XLJA 4K8EA 2BG5A 1WQ5A 1T96A 1WKEA 3CLMA 1NH6A 1XLDA 4HN4A 4X61A 1OX5A 4AG0A 2YX0A 2GJNA 3S2LA 3KRUA 4LAZA 3T2PA 1MQPA 2WKLA 2V5BA 3GVGA 4PTWA 4DX3A 2A3HA 3BGAA 3V1HA 2PBGA 3N1AA 2DZWA 3PTKA 4ZCWA 3MUY1 4E38A 3IEBA 4LEQA 1HGWA 5K4ZA 4AD5A 1JYVA 3N29A 4JTEA 5HJYA 2HK1A 3S9ZA 4HCHA 4FR6A 4BF5A 3ONCA 3T81A 5GJNA 2Z2BA 3VNJA 3W6LA 4HHPA 2PE4A 3G1HA 1MDLA 4XD4A 2Q3OA 1S2WA 3CPUA 1CECA 3H4WA 1M7JA 1Y5XA 3WLMA 2VYOA 1GPFA 3M44A 1RAKA 4AXKA 4WY0A 3WQWA 2ZC1A 1JDCA 2WKGA 5DEZA 1OK4A 1JZ5A 4LUJA 5CPOA 4PB5A 6REQB 4TOQA 4E8CA 4QNWA 4Z2JA 2NQZA 5CGMA 1CGYA 4YHGA 3UBPC 4NJKA 3EMQA 2TSYA 4CNOA 3FX4A 4AHQA 2TAAA 5HMFA 3L0KA 4LUYA 3WDHA 2PD5A 4ZB2A 1XD1A 3MHGA 2VCBA 2FZNA 4F48A 2VMFA 1QBBA 2OZ3A 4IMDA 1S5TA 5AOUA 1OCBA 2DT2A 3PJUA 5HK4A 1WAUA 2GVYA 3NAVA 4BQ4A 2C16A 5E93A 3P3BA 2YGYA 4KQNA 3W7KA 3QOMA 4HU8A 2VC5A 1I1WA 3NQ2A 3CH9A 1LT8A 5F4XA 2GJXB 4H6EA 3WNNA 2F8QA 4ZTXA 4XBJA 1IXQA 3GDTA 1EJTC 4ZO6A 2EJ1A 2E6DA 3T0AA 3T0BA 1Y65A 2E9BA 3AIUA 2CZEA 4B5TA 4OOUA 2EG7A 3FGCB 2WSPA 4GUHA 3EDEA 3QSTA 2P8CA 5EKYA 1ZTVA 3NO5A 1B4EA 4HB7A 2V5CA 1Z32X 1HL8A 1ZJHA 3CZJA 1XW8A 4HK5A 3CPRA 4X9SA 4XK2A 3VIIA 3C0QA 4OBRA 4QNEA 5D05A 1RJPA 4RL3A 2VGBA 1ZHAA 3BZGA 3WG6A 1WO2A 3QZAA 1TPFA 4KT2A 2VRKA 3TZNA 1XDMA 2OZ8A 3AJXA 3MANA 4PUEA 4K37A 3O6AA 2QJMA 5I3GA 3EX1A 1C7TA 1DWHM 2Y5SA 3KRZA 4MAVA 1BTCA 1VQTA 2BVWA 3QLLA 4PRTA 1C92A 3LBOA 2FTWA 1BWKA 1SVDA 2X16A 3ABXA 3I3EA 4NZJA 4NP7A 3GYEA 1CZ1A 4KESA 3UESA 1MW3A 4ZGYA 2A3EA 2X30A 3FVMA 3IARA 3TQPA 2REQA 4DPQA 4JQ3A 4DUWA 1XRFA 3G2GA 2CKRA 4O1DA 4D6IA 4RR4A 4LS1A 4N0RA 4QDMA 3BMVA 2E77A 1GVOA 1NWRA 4EK7A 5BCAA 4Y9OA 3FS2A 3A6OA 1KTBA 5EMLA 1P0DA 1KRMA 2IW0A 3QM3A 3AZSA 4HPJA 1IZKA 4QE5A 1KGUA 4DBWA 3U5UA 3I7RA 1H7PA 1YXDA 2QF7A 3P8IA 2CIPA 4A05A 5BRQA 3STEA 4N6EA 5ABFB 2JGQA 5HNNA 3GHSA 3M0KA 3DBNA 3LHUA 3CHDA 2WHMA 3JVAA 3LCLA 3A4AA 4TUFA 3IGHX 1R7AA 4KH2A 1GOKA 1LM1A 4GNJA 5T91A 4H00A 1B9ZA 2PLMA 4P8WA 5G1YA 3LN3A 2AL2A 2IXUA 3VKKA 1C29A 1QOPA 5BYWA 2P3EA 3VFLA 4HNTA 3K8KA 4ALDA 4XTIA 4HYVA 4AAJA 2D0FA 2DZXA 1MFUA 1SFTA 5AHNA 1Q6OA 4Q4RA 4YCOA 2CZ5A 2E6AA 3G1SA 1QR7A 2DSWA 5BU9A 1FXPA 2ZRUA 2DY3A 2C15A 3W1LA 3W2LA 4Q4OA 3M64A 2QDDA 1CLXA 5TAOA 1W56A 4C6QA 4LY4A 3BV7A 4Q7IA 3LCXA 4BI6A 3WMCA 2ZX7A 3TN5A 4N7QA 1PL9A 3WQ8A 4ZXOA 4ORMA 3EWWA 3PY2A 1QW7A 4V2XA 4QR6A 5LA0A 3TC3A 4U5KA 1UYQA 2D22A 1F74A 5F2LA 4JTFA 5I6SA 4RKAA 4HTYA 4O1BA 1SJAA 1QU4A 1E71M 5A6BD 3UG4A 3N6JA 1TRDA 1FOBA 2Y8UA 4JTQA 1P4CA 5CBIA 3COTA 1ZBKA 2XIQA 1ICQA 5ABTA 1UZ1A 4E3TA 3G1VA 5TNVA 4X63A 1LG1A 1FBAA 5A95A 1KCLA 5GQBA 1N8WA 2J7EA 2CLOA 3NQDA 4N4PA 4F79A 3HG3A 3H2AA 2G41A 1FWTA 4D71A 3BAJA 2NVCA 3SN4A 2EPKX 2A3AA 2F6UA 3H22A 3P7YA 1TQJA 2PWVA 3DYMA 1E9ZB 3VCRA 1BYCA 1ZP3A 3WLHA 4O18A 3STGA 3C2EA 5ECVA 3RO8A 3L21A 5JH2A 1V6YA 1ZENA 2OVLA 3I4KA 3B9DA 1KRBC 3DOPA 1OBAA 5KMYA 3SCWA 4B4HA 2IUZA 2I7GA 1NDYA 1G6CA 4I8YA 4PUJA 1HGYA 5D2YA 5AYBA 3S2JA 5HNUA 3B8IA 3IUDA 2F7FA 1HJVA 5CPLA 3T40A 3H54A 1IWAA 3IJ7A 4MWAA 3AHYA 5C55A 1I6NA 3KHJA 2VWTA 4D6JA 3IGUA 1R87A 2A5HA 1JZ2A 4LW7A 2OOGA 4O11A 1TCMA 1TJ0A 5M3WA 4B3LA 1R3RA 4I9JA 3SI9A 1TZZA 3P2VA 3N2OA 4MNKA 1KM2A 5A6KA 1D3CA 1K6AA 3GDKA 4E2OA 1VHCA 3KLLA 3WEZA 4ADTA 1LG2A 1ZPTA 3WF1A 4US5A 1QXLA 2VVNA 2QCLA 3TJLA 5HR6A 3TTQA 1E72M 4LBUA 1MNSA 3OVRA 3KCOA 3TA9A 4O4VA 3PZQA 4FPSA 3TC6A 3QZ6A 3GNXA 4V1YA 1FWEC 2WHJA 4IPIA 3QY7A 4WLCA 3WLQA 1XX1A 3BCDA 3ICJA 2Z7KA 1CNVA 1TZ7A 3BK0A 3M0IA 4GI9A 1SYTA 4GOAA 2QGYA 4GIAA 4UTJA 3MO7A 3GTXA 2DPEA 4U28A 3JS3A 1ADSA 1VYSX 2ALRA 3E38A 3F2CA 2XSXA 3W00A 3S0CA 1AD4A 3WQOA 2VFDA 3VC6A 1GKPA 1Q6LA 3AS1A 1X98A 2DIJA 3SGUA 3SY1A 2Q71A 5LNUA 3KBVA 4IL0A 1GEQA 3DFHA 1DHKA 1C8XA 2B7OA 3QLDA 3BLOA 1NF0A 3TOPA 4PBEA 3C2YA 3VUPA 1JYXA 3QW3A 4JKKA 4UC5A 2GVEA 3E0IA 2OJPA 2AL2B 3ME3A 3AXXA 4RV8A 1OCJA 2X2YA 2P10A 4KRTA 1RLDA 3TP4A 2WVTA 1VB9A 5AB3A 1WYIA 5K2ZA 4R88A 1I2OA 4I5RA 3W27A 3WQCA 4XBSA 2O56A 2W79A 1KC7A 2VC6A 2X0SA 1DJYA 1PE1A 3NSNA 3NZGA 4QG8A 1QW8A 1QW9A 2OXNA 4LC8A 5D9NA 2WCGA 3W1QA 2A79A 3KE0A 1VBUA 4RDVA 1VJZA 4JCMA 2C1IA 2VDIA 3B8UA 2OEJA 3WUGA 1A47A 5FL0A 5TIMA 1GYMA 4E8GA 3UR2A 4WKHA 1OCQA 7ENLA 5KETA 1EGMA 3GC2A 2I17A 2JFEX 4S2BA 2WJZA 4LV4A 3KVLA 1GOOA 2FFCA 1EZ2A 4JQ4A 2QXWA 3GNNA 3LGDA 1JZ4A 1OFBA 2J7BA 3B03A 1JCXA 4KFPA 1WDRA 2RAGA 1MW1A 6ALDA 1XLKA 3FYYA 1KGXA 3OA5A 4G7EB 1BG4A 1J0JA 3A4JA 1SR9A 1IYXA 4L65A 3MSRA 1XIMA 2OLAA 3VNZA 3VD3A 4DJFC 1X6LA 2Y1HA 1LLWA 1EUNA 4DJEA 5I78A 4RCXA 3HGOA 3G1XA 4M1BA 4UIOA 1KM4A 3WH9A 1Q63A 4UWMA 1XRSA 4IPNB 1G4SA 4M1RA 1R6WA 3ISIX 4GYPA 1N7KA 3M0HA 4GY7A 2QDGA 1UQZA 4YN5A 2BY1A 4P7LA 2AQOA 3W7OA 2NLIA 2INEA 3VCCA 1T41A 1JUKA 4YJ5A 1WA3A 3VTRA 4BQ3A 3LYEA 4DF0A 4JTRA 5DXXA 3W7HA 3QYQA 2WQPA 4A22A 4NJGA 3REQA 1R3VA 1O1ZA 1XSJA 3B97A 1XBYA 3G22A 2BMBA 2PDHA 4LSBA 1WE5A 3U4FA 2VKZG 2YL5A 1MWOA 3CZ8A 1NARA 3MA8A 2VOTA 2YFOA 1DJXA 3EPMA 1Y7VA 1JFHA 3W2KA 2J27A 1MDRA 3WQ5A 4HSOA 3NPUA 3GKAA 3HGJA 2PDUA 3O3RA 2V81A 3HPFA 5LNSA 1W3TA 4DYEA 1LRQA 3SUVA 1C90A 3PC0A 1OC5A 3THAA 3EYPA 4NZ4A 3C2RA 3WDJA 3B8VA 5D32A 4MJZA 1S5WA 2YXOA 1MFVA 1F61A 1CB2A 4UNIA 1E0VA 4FNQA 4IHCA 3TJ4A 4NZCA 1EOKA 1TJ2A 3I7SA 1G0CA 1AJ0A 3CM4A 2CHNA 4Q3MA 2BOEX 1A50A 3M6DA 4CVWA 2ACSA 2YDRA 3WH5A 2VEKA 4NZ3A 2NSOA 2OWXA 2G3NA 4A8IA 2I5GA 3QV8A 1CPUA 1XSKA 1AK5A 2X05A 4XVDA 4AZHA 1IEIA 5BWAA 4PL2A 4UTKA 1EO5A 3WEMA 1HJXA 5KTLA 1XC6A 3APYA 1XLMA 2PDYA 3W7PA 3HN3A 2VFGA 2WMKA 1BF6A 2E1DA 1WDQA 2I9EA 3AS2A 2BASA 5FJOA 1TFVA 3OTRA 4S3CA 3R25A 1PWMA 1KR0A 3QV6A 3LTSA 4Z42C 3RITA 3LLFA 4OE7A 3R0KA 1U5JA 3WIJA 1YPIA 4M7TA 1XXXA 3UT0A 1UWUA 4P7OA 2DH2A 3VNYA 3A9BA 4EF8A 5I03A 1ALDA 1R3WA 2BVYA 3GH5A 1HJUA 4KFOA 2HEJA 2PWGA 1MUWA 1JZ6A 3TTSA 4JQ2A 1DE5A 3EXSA 5DLCA 1IHIA 2GQAA 4FI4A 4EAMA 5DMNA 1CLVA 1WKYA 2UY5A 3W7MA 3TYAA 2CWXA 1F05A 4IH3A 4H83A 3WZ0E 4K8GA 3B05A 2ATSA 1UJPA 3WKZA 4O8AA 1A5LC 1OX4A 3EA1A 5LXXA 1V03A 1Q7ZA 2XN1A 5LIUX 5I79A 3CQIA 1V5XA 3TSMA 2Q02A 3ITCA 1QI4A 2B4GA