1V02E

Crystal structure of the sorghum bicolor dhurrinase 1
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
484
structure length
484
Chain Sequence
b'RLSPWEIPRRDWFPPSFLFGAATSAYQIEGAWNEDGKGPSTWDHFCHNFPEWIVDRSNGDVAADSYHMYAEDVRLLKEMGMDAYRFSISWPRILPKGTLAGGINEKRVEYYNKLIDLLLENGIEPYITIFHWDTPQALVDAYGGFLDERIIKDYTDFAKVCFEKFGKKVKNWLTFNEPETFCSVSYGTGVLAPGRCSPGVSCAVPTGNSLSEPYIVAHNLLRAHAETVDIYNKYHKGADGRIGLALNVFGRVPYTNTFLDQQAQERSMDKCLGWFLEPVVRGDYPFSMRVSARDRVPYFKEKEQEKLVGSYDMIGINYYTSTFSKHIDLSPNNSPVLNTDDAYASQETKGPDGNAIGPPTGNAWINMYPKGLHDILMTMKNKYGNPPMYITENGMGDIDKGDLPKPVALEDHTRLDYIQRHLSVLKQSIDLGADVRGYFAWSLLDNFEWSSGYTERFGIVYVDRENGCERTMKRSARWLQEFNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DHURRINASE
publication title Structural Determinants of Substrate Specificity in Family 1 Beta-Glucosidases: Novel Insights from the Crystal Structure of Sorghum Dhurrinase-1, a Plant Beta-Glucosidase with Strict Specificity, in Complex with its Natural Substrate
pubmed doi rcsb
source organism Sorghum bicolor
molecule tags Hydrolase
total genus 190
structure length 484
sequence length 484
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1v02E00
3D5HA 5A6BA 3ALGA 4P7OA 4W86A 3G6MA 1ZBKA 1BVZA 1DP0A 4E2OA 2XVKA 3AJ7A 2Y2WA 4WF7A 3FAXA 4Z2KA 5C8BB 3KL5A 5CGMA 3CHCA 1KCKA 1J0KA 1SMAA 1XRVA 3GH5A 3WF1A 2GJPA 3AOFA 2CEQA 2ZUUA 1W9PA 2D23A 3BXWA 5JIWA 4HMEA 4WK9A 3ZJ6A 3WDHA 1V3MA 3GM8A 4WLCA 2WC3A 2VX5A 2UY2A 2XSBA 2CBVA 1NWRA 1FHDA 3CMJA 3L4UA 4CCCA 5E0FA 2FDMA 1LLOA 3SCRA 3U57A 2HVMA 1EH9A 4MAZA 3VPLA 1K9EA 1UUQA 3CIVA 5EFDA 1UQYA 3BAXA 4M29A 4JCMA 2OSYA 3RMEA 5CXPA 4AZBA 2W66A 4YPJA 4R5EA 1CXHA 2GUYA 4LQ1A 5GQBA 4LYPA 3VIKA 1EOMA 1RD6A 1DHKA 4E8CA 1D3CA 1WKYA 4RE2A 5LA2A 2FHBA 3GNPA 3M07A 1K6AA 4GPNA 4MDOA 1UWUA 1V3LA 1W2VA 5A6AA 3VMNA 1J0ZA 1H41A 5AYIA 3N13A 4GZIA 3IK2A 2PF0A 4U2YA 1VRXA 1C7SA 1KGWA 1CPUA 4JKMA 3PTQA 1PBGA 1GORA 1HKMA 3AMKA 3WD0A 1WP6A 3WFLA 2YDSA 4M8UA 3CH9A 4RE3A 3AISA 2OYKA 1HN1A 3NYDA 4Z2JA 4D6EA 2A3CA 5FKYA 4LYRA 1ESWA 3BLKA 3WKZA 4AD1A 1EDQA 1CDGA 4ZE4A 1QW8A 4D72A 2FGLA 3N12A 1OD0A 1BGAA 2WHMA 3KL0A 1OWQA 4PMVA 2OYMA 5I3DA 3DHPA 3WD2A 1NH6A 1TA3B 1CXLA 3WY1A 3ZJ8A 3QOMA 3CZEA 3WSUA 1EIBA 4PMNA 1LG2A 1JL8A 4FLQA 3NCOA 1H0IA 2GJXA 1BTCA 3THDA 1E6XM 4BA0A 2BY2A 1JFHA 2F61A 2WMIB 5A6BD 1PIFA 2WMKA 5A2BA 1NM9A 2DT2A 1CXFA 1EXPA 5A3HA 3L4TA 2EEXA 3W28A 5CSUA 3GTNA 1E1FA 1E43A 1AQHA 2C0HA 2Q8XA 2VX7A 2YJQA 1CXKA 3ARQA 1G9HA 4GI8A 4UFIA 2VR5A 2OSXA 1HNYA 2A3BA 4W88A 1BFNA 1CWYA 1BGGA 4UQ9A 3WUFA 2G4FA 1B90A 5JBDA 3VDAA 5M17A 1JIBA 1FH7A 4JFSA 1JGIA 1B3YA 3N17A 1H11A 3CMGA 1JNEA 2D2OA 3BSGA 2ZIDA 1CENA 1H09A 3I3DA 4CN6A 3ZR5A 5AC4A 3CTTA 5ABHA 5D8ZA 1ITCA 2WVVB 3WH7A 2AAAA 3AXXA 2JEQA 3NSXA 1W91A 1HX0A 2D22A 4PMQA 1HVQA 3F5LA 1V02E 4H41A 1GQKA 1V0NA 3WH5A 3ZJ7A 4KWUA 3EYPA 3K1DA 1QNRA 1GVIA 1CGVA 8CGTA 1EQCA 3VO0A 3UR8A 1ISYA 1FH8A 3VDBA 3KZSA 3J7HA 2E9MA 2DSVA 2CKSA 5AY7A 1VFFA 3VNYA 1SYTA 4KRTA 4AW7A 3MV11 4P8UA 4RE4A 1BF2A 4IUGA 3W29A 4P7QA 3T08A 4PRWA 4AD3A 4KGJA 3FHQA 1CEOA 3WQ6A 2VZUA 1VIWA 1W9BM 1E6SM 3U5UA 4PTMA 3WH8A 2NW0A 3GBEA 1IT0A 2WZIA 4JKKA 3MO4A 3N1AA 4W87A 4CUCA 2W91A 2OWCA 2G41A 4MB5A 2E8YA 4ATLA 4GQRA 4EAMA 4UFHA 3SEPA 1YHTA 1EGZA 4PMYA 1J11A 4BQ3A 2J75A 3K46A 1UKQA 4IPNB 1SMDA 1JG9A 4P7NA 1KBKA 4J27A 4M82A 2QPUA 4UQDA 1E56A 1JDAA 4UFMA 1VB9A 1MYRA 2JEPA 2BHZA 1K9TA 4UZUA 4PUDA 4AZGA 1NOUA 1NOFA 3ARVA 3QHMA 1DWJM 3PZIA 3VNZA 2WB5A 3GXIA 1LF1A 2XWEA 4UQEA 3VIPA 3VX1A 4MB3A 1WDSA 3PZ9A 3W6MA 3VD9A 3ARRA 4YHGA 4KH2A 1H4PA 1UD2A 4P8WA 4QDMA 4EE9A 1W1TA 4X0NA 1H1NA 2E0PA 4PTWA 4PSPA 4HZ6A 3T0BA 1UWIA 1R86A 2VO5A 1XYFA 1KWGA 3TOPA 1UH4A 3VILA 2ZXQA 4QAWA 3GNRA 1R85A 3N18A 4B15A 2VVNA 4BZYA 1HJSA 3A4AA 1CGYA 2Y5EA 3FN9A 1BSIA 2XTKA 3POCA 2PWHA 1PX4A 1QW9A 1R87A 1R7OA 5EMYA 4BS0A 2WLZA 4XB3A 2V3FA 1N82A 1QPKA 4W93A 5A95A 4P8VA 1UZ4A 5E0CA 3RDKA 2XJ7A 3DECA 1CGUA 1VF8A 4AZIA 1UR9A 1C8XA 4AIOA 2WMJA 1CGTA 2ZXBA 4H04A 1TA3A 1HL9A 4AZHA 5DEZA 5M5DA 1E6PA 2MANA 4PYSA 4QLLA 1E72M 1BLIA 1SFSA 1W1PA 3K8MA 3CHEA 4HMCA 1M01A 1XH1A 2BS9A 5DMYA 4UOQA 2DIJA 1X1NA 1VJZA 5D9NA 3WL1A 1YQ2A 2WWCA 3AYSA 2JF7A 4AD2A 3RJYA 2GDUA 1FH9A 1UR0A 4UCFA 3B8SA 4PEEA 1DEDA 3NSNA 2OWXA 4HPGA 3UCQA 1C8QA 1GZJA 3AIVA 3VDHA 4D6JA 1MW0A 1XH2A 5CPQA 1C8YA 1J12A 2XYLA 1J0IA 2YLLA 1LL4A 2PWEA 1V02A 3VGEA 2WLYA 4TTGA 2ZUMA 3PTMA 1Q6CA 2V3EA 3L4WA 2CESA 5D8WA 4MB1A 1HJUA 1ZB5A 2XSAA 4U5KA 4HOWA 3WD4A 4C7GA 1PIGA 1C7TA 2J47A 2D3LA 1U33A 2VCAA 3L2LA 3VIOA 2VR4A 3WUGA 4UFJA 2CIPA 2DSKA 1FFQA 4CGTA 3CPUA 3AIWA 1ISZA 3FNDA 1QHZA 3AS2A 2ZUWA 1DWHM 1C91A 1UA7A 3HN3A 4GKLA 4AZCB 2BHUA 2O9TA 4JCLA 3IJ8A 4JKLA 2D0HA 1WDQA 3PZVA 3L4YA 1WB0A 5A8OA 2EJ1A 1ZBVA 3MKKA 1QHOA 3FAWA 3F5KA 1C93A 1OGSA 3WEMA 5HXMA 1QI4A 4ACYA 1E6NA 1UQZA 2ZX6A 4AISA 2VX4A 4EK7A 2ZICA 3ZSSA 1WO2A 3WNMA 2BHYA 3OLEA 5ABFA 2VMFA 1F4HA 3CHFA 2DT3A 2FH6A 4IISA 1KXHA 1QNOA 2DSWA 4PCTA 2IUZA 3UEQA 1JD7A 4QLJA 1NWUA 1QNSA 2VRQA 4M1RA 3NSMA 5JBEA 2PBOA 1GJWA 4U2ZA 3UG3A 3GH4A 7CGTA 4WIWA 1J01A 1PPIA 2XVLA 2ZWZA 4YHEA 3S2CA 4CCEA 2AOSA 4DWSB 1HJVA 4UZSA 3SIMA 2BY1A 1NARA 4CN4A 2GK1A 3TONA 1R8LA 1I75A 5AC5A 1I1XA 2QMJA 4QCFA 2XGIA 3VVGA 3VTRA 3ECQA 3SUUA 2VI0A 2VTFA 2CXGA 3HJEA 3WNLA 3RM8A 3NDYA 3WDPP 3SUTA 3AS3A 3WELA 2F2HA 2IXVA 1OIFA 4N42A 3IJ7A 1UKPA 3ARUA 4AD4A 1GQJA 1BYAA 4JFUA 3U7VA 3APGA 3CZKA 1GHSA 1CGXA 5KZ6A 1TMQA 3HU7A 4MPKA 4CVUA 3MS8A 4BQ2A 1B31A 1HJWA 5IHSA 3A47A 3VIIA 2PWFA 5BXPA 5C70A 4ATDA 4CD8A 4FLSA 4W8BA 3A4WA 2CETA 4MJ2A 2VZOA 3BAKA 1PAMA 5A6KA 1E73M 3CUJA 4U5IA 3QOKA 5CJ5A 3EDDA 1VEOA 1B3VA 1LL7A 5BXRA 3PZNA 2CBUA 1EQPA 1B3ZA 3SCVA 4KGLA 3A6OA 1DTUA 4PN2A 1TFVA 1JZ4A 1QVBA 1V6WA 2RGMA 2BVTA 2X1IA 3WD3A 3WNPA 3PZTA 1LQ0A 1BYCA 1E5JA 1V3HA 2DH2A 7A3HA 1QNQA 3CUGA 4CD6A 1QI0A 4XZBA 4AYSA 1HKKA 4H8UA 4P7RA 4TUFA 2WW5A 2J7HA 3VX0A 2NSXA 2VZSA 3AFBA 4W84A 3MU7A 2EPLX 3VM7A 2CBIA 3W26A 3VD3A 1ISWA 2PB1A 3WNKA 3W37A 2ZX9A 5GNYA 4DUVA 5CZKA 3PZMA 1AMYA 1ZU8A 5D9OA 2X0YA 4P8XA 5A8QA 3TTSA 1HT6A 1CXEA 1L0PA 2VUYA 1JAKA 1US3A 3TTYA 4PMZA 1V03A 3VIHA 2W62A 1U30A 1E5NA 5BRPA 4TVUA 4W5UA 3MMUA 1UWRA 2BXYA 1TVPA 1HL8A 5DF0A 2QV4A 3CUIA 2G3IA 3TTQA 3AIQA 4JHOA 1JF6A 5M3WA 3E1F1 2J8GA 3AI0A 2J78A 3EMCA 4WKAA 4X9YA 2XG9A 2FHCA 4ACZB 5HOSA 3KEHA 4D6DA 1JYNA 4DM1A 4IPLA 1UR1A 1E3ZA 1H5VA 4RL3A 3THCA 1ZS2A 2WCGA 4YN5A 4Q7NA 1P6WA 4PTVA 2DT1A 4PMDA 3WENA 3WN6A 2UWFA 3MMDA 1KR1A 1GJUA 3LPGA 3WDQA 4E8DA 4WKHA 2XHYA 4AZCA 2DSZA 4F79A 2X09A 3WQ8A 4CD5A 1J10A 5BRQA 2YDRA 5I78A 4ZE5A 3AIEA 3WMBA 1GHRA 3VUPA 1W1YA 4XV0A 4K68A 1CTNA 2XVGA 2JFEX 4D6GA 2FH8A 2JIEA 2J7DA 2VURA 1MQQA 4D71A 1G1YA 2EPNA 2CCRA 3A4XA 1KB3A 2J7FA 2PI6A 1BQCA 1WZLA 3FXYA 1GOWA 5JUVA 3RJXA 1GOIA 1DWIM 4OZOA 3VIFA 1XSIA 3WQ5A 2VVSA 5EFFA 5FCZA 3GH7A 1RPKA 4D1IA 3CZGA 1W2PA 3EDFA 3EDKA 1UWQA 3ARXA 3AIBA 1KGUA 1BYBA 1WE5A 2WANA 4W89A 1CLXA 3W82A 2DDXA 1NP0A 2WSKA 1HKJA 3ZJKA 1OGBA 1B0IA 1MW3A 2PWGA 4W85A 1UYQA 5D9MA 1U2YA 2Z1SA 2WVSA 2WHJA 2WHLA 4OBRA 2XM1A 1Q6EA 4UOZA 5KEZA 1UH2A 3BAYA 2YA1A 2D1ZA 2Y8VA 5ABEA 1CIUA 3VD5A 3B9AA 2V38A 3N04A 1OGGA 4JL2A 4HP5A 1RP9A 2VQUA 3K8LA 4AIEA 4GO9A 1W32A 3AICA 2DSUA 5IFPA 3SCWA 1JF5A 4V27A 1BG4A 1ZJBA 1V6VA 4R27A 1QOXA 1W3LA 5JBFA 3VIMA 1OBAA 3AS0A 3AZRA 1NWSA 4CD4A 2E40A 5CSYA 3OZPA 4HA1A 4FMVA 3TP4A 3VKKA 3GBDA 1XD1A 3PZQA 5E09A 2BY0A 1IZKA 3GXFA 4W8LA 3PZUA 4ZENA 2EPMX 3UR7A 4NI3A 1HJXA 2G3MA 3RM4A 1PZ2A 1E9LA 1M03A 5HNNA 1E3XA 3CUHA 4AZ7A 1E4IA 1JZ3A 3K8KA 1BPLB 4WSJA 2C8NA 5CLTA 1UD5A 1TUXA 2CYGA 1US2A 2V5DA 1OT2A 4ZXOA 2YL9A 2WVUA 3CGTA 4CN1A 3AQUA 4AZ5A 1V3JA 1ODZA 3W81A 1OIMA 2WMHA 5CG0A 3CZLA 1E6ZA 2W61A 5A8NA 3CUFA 1FHLA 2XIBA 3SUVA 3WMSA 2DEPA 4Z2IA 1MXDA 1Q6GA 4FF5A 4BF7A 4UTFA 4M81A 4AC1X 1JXKA 1CZ1A 1W9UA 1EO7A 4TOQA 1F4AA 2XM2A 4MNJA 1FA2A 3T2OA 3AIUA 1GQLA 4NRSA 4W7VA 3UG5A 4ATWA 3ARYA 4XUYA 2VT0A 8A3HA 1UR4A 4HTYA 1MVYA 3VD7A 3ZT5A 2OWWA 3KE0A 5CGTA 5A6SA 3M6DA 2CKRA 3LPFA 2DQXA 3QHOA 1NWTA 2NT1A 5E6YA 1CGWA 5LA1A 3ALFA 4JFTA 1JZ8A 4F9JA 2ZX5A 3U7BA 3WBEA 1E71M 2ZX7A 1HP4A 4OBSA 4B9ZA 3VMPA 5DT7A 5BXSA 2VZTA 3W4RA 3DYMA 4AD5A 1B3XA 4W8AA 4MNKA 4KRUA 3RILA 5BCAA 3SCNA 3ARZA 3MSGA 5IFTA 1I1WA 4S3JA 5A6MA 2XVNA 3BH4A 2OLHA 4TVCA 3ARTA 4H8VA 3BGAA 2ZUNA 4LYQA 1O6IA 2PWDA 3ZR6A 5A2AA 1XCXA 1VFOA 2J79A 4D6HA 3T2PA 3WQVA 1R7AA 4D6FA 5JIPA 1V3IA 1GW1A 1ODUA 2O9PA 2WMIA 2DH3A 1UKTA 4HPHA 3EDEA 1K9DA 3OBAA 3EBVA 3GXMA 3M46A 4PSRA 2G3JA 4OUEA 1S46A 2OSWA 5A8PA 2Y8KA 9CGTA 1PEZA 1KXQA 4W5ZA 5DFAA 1Z32X 1B30A 2GJRA 2GSJA 1XSJA 3VGBA 4D6CA 1UWTA 4A3YA 3I3EA 4F8XA 4AXNA 2ZXAA 2YBTA 3WMCA 2YL8A 3SCOA 3DHUA 4PUEA 2O9RA 2YA2A 2ZE0A 3IAQA 1CXIA 1UG6A 1ISVA 7TAAA 1KWKA 2V3DA 4ZXLA 5A1AA 5HPCA 4MAVA 3G6LA 1KCLA 4TTUA 2GFTA 1V6UA 4J3VA 3PZOA 2NT0A 2VRKA 2WPGA 1JDCA 2JE8A 3T0DA 1XC6A 2WVVA 5GNXA 3RIKA 2J7CA 1E4MM 1W9XA 2ZXDA 2WVTA 2X05A 3PZGA 2G8ZA 2QHAA 4J3UA 1J0YA 4QLKA 3SCSA 3KL3A 4KMQA 2OYLA 1RP8A 4HZ7A 1E0VA 1KXVA 1LG1A 1VJSA 4UQAA 1AQMA 2ESCA 4F9DA 2WWDA 5I6SA 4JFWA 1ZL1A 5M03A 1O7AA 5A94A 2V3GA 2WKGA 2GJXB 4M24A 3WEOA 3WUBA 3OA5A 4PMXA 2VOTA 4MTVA 1FOBA 4NF7A 5E6ZA 1G5AA 2BFGA 4B16A 3SCPA 3AMGA 3GDBA 1VBUA 1QNPA 4HZ8A 1HKIA 3ZMRA 4V2XA 1MWOA 2XPKA 4A4AA 1H3GA 2JALA 3K4DA 3O6AA 4AWEA 2WCSA 2HISA 3SCTA 3L2MA 1GNXA 4FLOA 1G01A 4Q22A 2CITA 4E4PA 2FHFA 1E4LA 1DWGM 1PJ9A 4PTXA 3N11A 1J9YA 5A2CA 2Z1KA 1KR0A 3AS1A 1X6LA 4ZFMA 1H0GA 4AMCA 1GPFA 5A69A 1HJQA 4GINA 1J0HA 3RPMA 1GOOA 2IXUA 4QFUA 2CHNA 3ZO9A 2J77A 3F4VA 1V6XA 2YLAA 4XX6A 1DWAM 1DWFM 2J7GA 2Y4SA 4L4OA 2YIHA 1K9FA 1MFVA 1CLVA 4H2CA 3UG4A 4H7VA 1GOMA 4NSBA 1KFWA 4V28A 2VRJA 1OT1A 2E9LA 2WYSA 3ZQ9A 1Y7VA 2WAGA 3CHDA 5HPOA 1W3JA 4EANA 1OSEA 1LL6A 1OB0A 2ZUVA 1QBBA 1UD4A 4AZ6A 1GVYA 3MMWA 3AHVA 3AMCA 4P7LA 4UR9A 5IXEA 3W0KA 2WXDM 1ITXA 2VC9A 3AMDA 1KQZA 3QGVA 2WNWA 4GZEA 3CLWA 2CERA 4CCDA 2YDQA 1JYVA 3VGHA 3WDIA 3OLIA 1W9DM 3BSHA 2O92A 3OIHA 1V3KA 4TXEA 1WZKA 5IDIA 1QI5A 4UQCA 1G0CA 3OG2A 3WIJA 4TX8A 1HIZA 2EXOA 3CBWA 1AVAA 2EO7A 4JL1A 1L8NA 3ZT6A 3ZIZA 3GYCA 5I2UA 3ZSTA 1VEMA 1WDPA 3AMLA 6CGTA 4ML4A 1CNVA 3VM5A 2XFRA 1CECA 4J3WA 1JAEA 4QCEA 3ARWA 1EOKA 1B9ZA 3WH6A 4PMOA 4M80A 1Q6FA 2J4GA 3TA9A 1ECEA 5GPRA 2CNCA 1KXTA 2WSPA 4L4PA 4GI6A 2CBJA 2EPKX 3SCQA 4UFKA 3WF4A 2VZVA 4HMDA 5I0DA 1SR0A 2B31A 3FW6A 1OCQA 1UD8A 2X0HA 2J62A 2E8ZA 4M56A 2EPOA 4URIA 3N15A 2V5CA 3OLDA 2UY4A 3L4ZA 4X0VA 4CU6A 3DC0A 5DO8A 1GOKA 3W38A 3T0AA 5D9PA 4HA4A 1J0JA 3NDZA 4A3HA 1W9VA 3WDJA 2WMFA 4JIEA 4DUXA 4C7DA 1NOWA 2GVYA 5GNZA 1EHNA 2F8QA 5I77A 2QPSA 1JZ7A 1LWJA 1XH0A 4DM2A 4MDPA 5AYBA 4AEFA 3GXDA 2DIEA 4J3XA 1WDRA 3W27A 1VFUA 4LGXA 3WNOA 1JYWA 4CD7A 4OOZA 3ARPA 6TAAA 3HMCA 1EO5A 3BC9A 4MJ4A 3EDJA 3RM9A 2WC7A 1EA9C 3ZM8A 3SURA 2ZOXA 1ZJAA 3W6LA 4Y7EA 1QBAA 2VL4A 1XYZA 2G3NA 3PN8A 1WCGA 1A3HA 1TCMA 3AXHA 5D4YA 2WZEA 1GONA 1GOQA 2RGLA 1BG9A 1MFUA 4XZWA 2X2YA 4UOJA 1E0WA 3FY1A 3IAPA 3W24A 4GXPA 3VGGA 4HA3A 4S3KA 2W63A 4FLRA 5I24A 4U33A 1XSKA 1ZBWA 3QR3A 1QHPA 4U3AA 1XD0A 2Y24A 4U31A 5EBAA 1D7FA 3II1A 1D2KA 3VDCA 5BROA 3CO4A 5ABGA 3AHTA 4D6IA 4DWSA 1E6QM 1HP5A 2WC4A 5HBFA 2VQTA 5EB8A 3WQWA 4OJYA 5BWFA 4ZEPA 2QLYA 2WBGA 3AROA 1PX8A 4OKDA 3F5JA 5A8MA 1EHAA 1JFXA 3QHNA 1KGXA 1WZAA 3D3AA 3PHAA 4DWSC 2UY5A 3VIGA 5FL1A 1B1YA 3BMWA 3VD4A 2YBUA 4JFVA 2DPEA 1G94A 1MQPA 1UWSA 2WHKA 5BXTA 1VBRA 3LMYA 2X8RA 3IJ9A 2XWDA 3UETA 5E70A 3GZAA 3MUY1 5I23A 3KWXA 3PBGA 3RCNA 4BQ5A 1W1VA 3BCDA 4MNLA 2ZWYA 4B3KA 3VIJA 4MNMA 3EMZA 4GQQA 6A3HA 2O9OA 2E3ZA 5FOOA 4JAWA 3ZOAA 3SUWA 2W5FA 5C71A 2C7FA 3NUKA 2DGAA 2WM0A 3BAJA 4HU0A 2QF8A 1QI3A 3DYOA 3OZOA 3CZ8A 4W7UA 2YL6A 3K4AA 2W4XA 4LX4A 3WF0A 5ABFB 5FIPA 3O2LA 3JUGA 3M7SA 1C92A 1W3HA 2XFFA 2JIWA 3BAWA 4J28A 2ZUTA 1XCWA 2VCBA 3O9NA 1M7XA 4PMRA 3EMQA 4FK9A 4MADA 1V0MA 1JI1A 4JZ5A 4TVDA 1FP8A 3WL0A 3LPOA 3W25A 2A3HA 4CKQA 3OLGA 1KQYA 1GCYA 4J7RA 4GZJA 4LPCA 3VOCA 2GK1B 1V0KA 4Z2GA 1Q4NX 4BCEA 3VINA 5IHRA 4AD0A 1UHVA 1VEPA 3BLPX 2W92A 3L4VA 2A3EA 2XIIA 2YA0A 1ISXA 4B9YA 1C90A 4PBGA 1TVNA 2WK2A 2EBNA 3S6TA 1E1EA 4Z2HA 1JDDA 1GUVA 2WMGA 3B9EA 1UOKA 3FHAA 4PCSA 1JZ6A 3MANA 1UH3A 2J8FA 2CPUA 1UR2A 2YL5A 1QI2A 3WQ4A 4WSKA 4EKJA 4J3SA 3T2QA 4HU8A 1C3FA 1JI2A 2UY3A 1V6YA 5I79A 1E0XA 1E4NA 2ZX8A 2E9BA 3RO8A 3IANA 4MB4A 1JZ5A 3UERA 2J7EA 1PZ3A 2JF6A 1EDGA 4WJXA 3MV01 5F7UA 4ACZA 3AYRA 2VX6A 3LPPA 1KBBA 4F66A 1JZ2A 4Z2LA 3W53A 3OGSA 4HOXA 3WDRA 1VAHA 2BXZA 2WCAA 2WKLA 3AHYA 3OGVA 1UD6A 1OM0A 3GNOA 4W7WA 3WEZA 4DWSD 2WZHA 1UZ1A 2J25A 3I3BA 3T09A 3WD1A 1BHGA 2WBKA 1LWHA 4LXFA 1PX3A 2QMKA 4AIUA 4IM4A 2BVDA 1X6NA 5I5RA 2AMGA 1M04A 1J18A 4QP0A 3VU2A 1CBGA 3ZT7A 1UR8A 1VFMA 1UD3A 1MW2A 3A3HA 4H8HA 1H2JA 4DUWA 4U3CA 5HDRA 1H49A 2W67A 1EDTA 3NJ3A 1VENA 1A47A 1Q6DA 2J7BA 3B9DA 5TD4A 4JHZA 2XFYA 4OIFA 2D3NA 1HF6A 1WAWA 3AIRA 3BMVA 2FGZA 1TE1A 4OOUA 1WNOA 2ZUSA 1CYGA 1OINA 1V0LA 2VJXA 4TX6A 3WUEA 3AZSA 1XHGA 4J3TA 1JD9A 4CVWA 5E9AA 1XV8A 1JYXA 2XUCA 4GI9A 1XGZA 1FFRA 5FL0A 3WF2A 3N9KA 4UNIA 1UKOA 1E40A 3VMOA 4UQBA 1BAGA 1ZBCA 4BQ4A 2D24A 1MW1A 1LJYA 3BCFA 2A3AA 4AEEA 2BNJA 5LYRA 4AY1A 1W3KA 4HOZA 4CU8A 2PC8A 4UFLA 3POHA 3NIYA 3WF3A 4WKFA 3BAIA 1HVXA 3MSDA 5A6JA 2XVPA 4GO8A 1WPCA 2D20A 1UA3A 3L4XA 3OGRA 4CU7A 1JNDA 3U5YA 1E6RA 1FP9A 2DT0A 3MUZ1 1E15A 3AZTA 3WH9A 1MXGA 1E70M 1B3WA 1BYDA 2YOCA 2CHOA 2GDVA 3VGDA 1TZ7A 3WBAA 3AHXA 5BYWA 3MUIA 1GQIA 3SUSA 2E4TA 4NRRA 3UESA 5FD0A 2VCCA 3SCUA 1HXJA 2D0FA 3WFZA 5ECUA 4D1JA 1OD8A 3VGFA 2BV9A 1UKSA 1TR1A 3AHZA 3OB8A 1AQ0A 5CPSA 2TAAA 1BVNP 2YKKA 1MQRA 1NP2A 1JXJA 1TG7A 5LA0A 4C7FA 5CPTA 2D0GA 3MUAA 4NZCA 1B2YA 2VNCA 3WNNA 1IZJA 2PBGA 3PTKA 3AXIA 1IV8A 3TTOA 2BVYA 3ARSA 1RH9A 1V08A 1E55A 1NQ6A 5DT5A 5A6LA 2XGBA 4N0RA 2BY3A 1WZMA 3DYPA 2J74A 3CZJA 1M53A 4PMUA 4B3LA 5CQ1A 4GIAA 5CLWA 2EQDA
chains in the Genus database with same CATH superfamily
2HVOA 1IIHA 5A6BA 5H8MA 3LXCA 3AXMA 3G6MA 1BVZA 3HPAA 1PO9A 4TMBA 1GK8A 3B8IA 5F4WA 2E09A 4GUIA 5I03A 1KCKA 1XRVA 4OUIA 4KEMA 2GJPA 2BTMA 4IIHA 2CEQA 2ZUUA 4LJ3A 1X8CA 3W2KA 2D23A 3BXWA 3JS3A 2YW4A 4ZB5A 1V3MA 4EXBA 5T26A 4UTMA 4WLCA 1EC7A 4LCRA 3K1GA 1ALDA 3UY8A 1Q7QA 1NWRA 3PSVA 1FHDA 3B8TA 4INFA 3SCRA 2ZBTA 3W7NA 2IQ0A 1V7YA 1UUQA 1EWDA 1RBAA 3BAXA 2OSYA 4IQJA 4LF1A 4YPJA 2AGKA 3Q65A 4KETA 3KWSA 1A5NC 1FWIC 3RLUA 4KCTA 2R91A 2PDUA 4DNHA 2WZMA 3RO6A 1D3CA 2ONEA 1VFHA 5FEPA 1S1PA 1A5KC 3M07A 4KFOA 2YXXA 1WBHA 2ISWA 1W2VA 3R43A 3VMNA 4REQB 1S2CA 3N13A 5FJRA 2PDFA 1EF2A 3IK2A 2PF0A 5CGQA 1JQXA 4Z1AA 5DY2A 1TRDA 2REQA 1IQ8A 1FWNA 1XLLA 1I2NA 4PC8A 3WFLA 4E2BA 2YDSA 4LS2A 1F3TA 3AISA 3MZ2A 2Z1VA 1FWSA 3NYDA 3W86A 4PR4A 1EJ7L 4D6EA 5FKYA 3OZMA 3WKZA 1EDQA 3B0VC 1B3OA 3D47A 1YRRA 4MZ1A 1BGAA 3QY8A 1VLWA 1LQAA 1LT8A 3DUGA 3E2RA 1I0BA 4PMVA 3TXVA 4FNPA 4AF0A 4QGCA 5I3DA 1ADOA 3W2MA 3QBUA 3WD2A 1CXLA 3SQLA 4RNFA 3WSUA 3OIXA 4O50A 4PCPA 2VXNA 5LKYA 3ZWSA 1JFHA 1VFSA 5A6BD 3KS5A 1Q7MA 3W1PA 1MUWA 4ZO6A 4C5YA 5CSUA 1F74A 5LZLA 1E1FA 4GJ1A 3SSZA 1AQHA 2Q8XA 2VX7A 1KFBA 3ARQA 1G9HA 2EG7A 4GI8A 3H70A 4UFIA 2VR5A 1HNYA 4Y90A 2PPGA 1WXJA 4N9DA 5T8GA 2OEJA 2VGIA 1CWYA 1BGGA 3REQA 2HXTA 4UQ9A 2DFAA 1BKSA 1XWYA 4B92A 3UWYA 1U22A 1XI3A 3QGAC 4Z0SA 1TIMA 2RH9A 4UXDA 3ATZA 1SSGA 3H53A 3CTTA 5D8ZA 3LI0A 2AAAA 5U7SA 2G0WA 3A22A 3KW3A 3NPXA 2EG8A 2D22A 4LWWA 1F8MA 3KXQA 1HVQA 3RLHA 1DBTA 5FEXA 2DW7A 2CW6A 1TPDA 3CMFA 4LUTB 1A5LC 3TC7A 3ZJ7A 2F84A 3EYPA 4KW2A 1L6SA 1IR1A 8CGTA 3VO0A 3MYOA 2Q8LA 3UR8A 2ZFAA 2XSXA 2O56A 1VZWA 3CQ0A 3VNYA 4KRTA 4AW7A 1JUBA 1NU5A 4P8UA 2NV9A 3ZVHB 4CCZA 4IUGA 3UBPC 4LUSB 4KGJA 1OX6A 4XSMA 1W9BM 3U5UA 4H6RA 4PTMA 5LHFA 2NW0A 3MO4A 3N1AA 3SY1A 4HT3A 1XYMA 1FCUA 3FK4A 4U28A 4JTLA 3NZPA 4EAMA 3I4EA 4MG4A 3IGUA 5KZEA 1KBKA 1J6OA 2HJPA 3H2EA 1A80A 1JDAA 3GUGA 4IZGA 1MYRA 2QVNA 1N2VA 4R34A 2G97A 4UZUA 5CC6A 3RGTA 1ICSA 1NOFA 3QHMA 2NVDA 3HGSA 4HGXA 5C9XA 4ZMGA 4PTDA 1LF1A 1HQTA 4O0ZA 3B3DA 3VD9A 3ARRA 1NDZA 3GDKA 1H4PA 1W1TA 3PUDA 1P0EA 4IP5A 2YPIA 1OFOA 2NQHA 4HZ6A 1TTIA 3T0BA 1UWIA 4C90A 4FALA 3S9IA 1UH4A 1RK6A 1BRLA 3S46A 4O0KA 3QLDA 1K8CA 4LB3A 4C6MA 3WK2A 1BSIA 4HHLA 1R87A 1HKVA 2CLKA 1L6FA 3RPDA 1Y5VA 1QPKA 4FX8A 4W93A 1V8EA 3TW7A 3LV6A 4H6EA 4P8VA 3NL5A 2ZRVA 4BFAA 1CGUA 2PWUA 3PNZA 1CGTA 5K7JA 4JYDA 3MUCA 1K8ZA 3MBFA 4XZIA 5M5DA 4PYSA 4IGSA 4NVTA 1SFSA 3K8MA 1TJ2A 4GA8A 4UOQA 1KFLA 5D9NA 4CNPA 1H51A 1REQB 3AAMA 4AEOA 4C1KA 2GDUA 4Q4QA 1W5MA 2E1DA 1R3VA 5EMMA 4BF9A 2OWXA 4HPGA 1C8QA 2PF8A 1L2QA 4HD5A 1GZJA 3MT1A 4D6JA 4A3RA 4WGHA 5AZ0A 2DVUA 2AGTA 1LOLA 2YLLA 4GKTA 1LL4A 4F0KA 2V69A 2ZUMA 4KCUA 2Z24A 1GVRA 3KVJA 3KRUA 2VWSA 4C7GA 4NI8A 1W0MA 1KV5A 5FF0A 1C7TA 3LTSA 2XIOA 3L2LA 3L7RA 3W07A 3UA4A 4K7VA 2Z1BA 2DSKA 1KKRA 1EJVC 3WQCA 5BMXA 1Z3NA 1ISZA 2ZUWA 1C91A 1KFJA 4AZCB 1NFBA 4JCLA 1DTNA 1WB0A 3E49A 5HNTA 4LUJA 1P1MA 1XIFA 5FF3A 4ZA0A 1C93A 5HXMA 5CJNA 3OU8A 2Z25A 3SECA 4WDUA 2VX4A 1AQFA 2ZICA 1Z44A 3CHFA 2FH6A 1B4EA 1QNOA 4PCTA 2IUZA 5AOUA 5JBEA 1EPVA 2PBOA 3GH4A 2ZTJA 4WIWA 1XX1A 3WLKX 1O4UA 1PPIA 2ZWZA 3S2CA 4CCEA 1YPXA 2AOSA 2AAMA 2A4AA 1IXPA 4UZSA 1D3HA 4QJ5B 1NARA 4CN4A 2QJHA 1XBYA 2QMJA 1RAKA 3VTRA 3ECQA 2CXGA 3WNLA 1P0BA 4NZ5A 4Z1DA 3U2EA 1FWEC 3UY7A 3IJ7A 4C6KA 3TE9A 3ARUA 4AD4A 3VOHA 1GHSA 3EB2A 5LIWX 1GQNA 3T0TA 2JGYA 2HBXA 3G1AA 2VC5A 5FA5A 1Q2SA 3A47A 2ZKMX 4IXHA 3CB8A 1S3TC 2I57A 2HBVA 1ZNNA 4W8BA 3KP1A 2VZOA 1XLKA 3BAKA 1A5SA 1E73M 3U0HA 1QU4A 3VCCA 4E5TA 4YTUA 5CJ5A 1B3VA 3PZNA 1VFTA 1B3ZA 4KGLA 4F2BA 4CNTA 1TZ9A 1POJA 4UTTC 4MKSA 5LXEA 2P8CA 2PGWA 1US0A 1V6WA 3AC0A 3UJSA 2X1IA 3WD3A 4A3QA 3V0UA 2I5QA 3L66A 4QX4A 1YDYA 1E5JA 4JX4A 4AXKA 3ZXWA 4H8UA 1XIEA 3HQNA 5AVNA 2WV8A 3GTFA 1GOXA 3TN3A 2EPLX 1TIWA 2NSOA 3ZLHA 1ISWA 3OPSA 3KS6A 4UNLA 5GNYA 1OQFA 3U2CA 3PZMA 1UJPA 4JTFA 4N6EA 1Q5MA 2X0YA 4P8XA 4UB9A 3TTSA 4C1NA 5C9RA 4DO4A 2UV8G 1UMLA 2WSRA 4GWEA 3V5CA 4JY9A 1AW1A 1E5NA 1PTAA 5BRPA 4H9TA 2GWNA 3O05A 1O94A 2GQ9A 1TVPA 4GVHA 3GG0A 3R0KA 1B54A 1S39A 3AIQA 4PODA 3AI0A 3EOOA 3EMCA 4MIMA 3A5FA 3UD6A 3MYPA 1YXDA 3W2NA 4D6DA 4DM1A 3GAKA 4GACA 3ERPA 4ICNA 4E2VA 3FA5A 1R2SA 1EBHA 4UTJA 4KWOA 3QQ1A 3LTYA 2R94A 1P6WA 4XUGA 4NILA 1I2RA 2UWFA 5EA9A 3MMDA 1KR1A 3UWEA 1LOSA 3WDQA 4E8DA 4GFIA 5K9DA 2DSZA 4F79A 4X3ZA 1G6CA 7ODCA 4L1GA 3WQ8A 1J10A 1PV8A 3G1SA 5BRQA 4OT7A 3AIEA 3STEA 3FCPA 3VUPA 4XV0A 1XISA 1BF6A 1XBZA 1OFQA 5CC7A 4D6GA 1XPGA 2V81A 3W1RA 3TZFA 2WQPA 3M7WA 3H4XA 2CCRA 3SGGA 2J7FA 2PI6A 4WDWA 1WZLA 3LB0A 1ZP3A 1GOWA 3FXYA 5DELA 3RJXA 5JUVA 1GOIA 4OZOA 3VIFA 1XSIA 1KRCC 2VEPA 3JVAA 5EFFA 5G5IA 3LZ3A 1RPKA 4KWVA 4D1IA 3M0XA 1LCOA 1FRBA 3KCJA 1B5TA 4DAFA 4LFYA 3PBUA 2DDXA 1NP0A 1XS2A 1HKJA 1MW3A 2QZRA 5D9MA 3CV6A 1FWWA 3UGVA 1BWLA 4OBRA 1Y5WA 4PL2A 5HA7A 3K13A 2D1ZA 5ABEA 4CEUC 3GS6A 3N04A 1OGGA 4HP5A 3HV8A 3WLRA 2PRLA 1O60A 4ZTYA 3U9IA 2CZEA 3TZNA 3GSMA 3PWAA 3DN5A 3UXAA 3M0LA 1B57A 1CLKA 1G4SA 2JKPA 3M43A 2AL2B 3CS2A 1W5OA 4LVFA 2OTDA 2IQTA 3VIMA 4XIAA 3GVVA 4DJDC 3AZRA 1NSJA 2YXGA 2BWGA 2J8TA 5CSYA 1CI1A 4IF2A 1XIHA 3TP4A 1B9BA 3VKKA 1JEZA 1S5NA 2DU2A 2BY0A 4O1DA 3ITVA 4OGZA 5BOEA 2VGFA 3UXKA 3F4DA 3QM3A 1GJPA 2CLMA 1FCQA 1TREA 1QRQA 1H7WA 3IIPA 1TQJA 2UBPC 1UD5A 2V6AA 1US2A 2V5DA 2XZ9A 4ZOBA 2GL5A 3DZ1A 3SDOA 3G77A 5BU9A 4AZ5A 4XVEA 3CV7A 1S2VA 3VNKA 1E6ZA 2JKEA 5T91A 4FI4A 2DQWA 3A12A 5DX7A 1FKXA 3WMSA 2DEPA 1MXDA 4GX9A 1M1BA 4QEEA 4QNEA 4UTFA 4AC1X 3MJYA 1JXKA 2XH4A 1CZ1A 3UWUA 3GU2A 1KBLA 2KZHA 1FDYA 4O19A 1FA2A 3T2OA 3LBOA 1EEXA 4W7VA 3ARYA 4XUYA 4HTYA 3TX9A 3LTPA 3A3XA 3EX1A 3H2OA 1MVYA 2H6RA 5C7HA 2X16A 2BGQA 5A6SA 2Y1HA 3QW3A 3CU2A 1E0UA 3GC2A 5E6YA 5KZMA 5LA1A 3ALFA 4JFTA 3W22A 3GE7A 1BWKA 4MUPA 4OU1A 2XISA 3VMPA 5DT7A 1K7FA 1OYBA 4W8AA 1V4YA 2RJHA 1OCNA 3UFYA 3CJPA 3ARZA 4K39A 5IFTA 1KFKA 4MLRA 3BLEA 2GDQA 4S3JA 2OT1A 2OLHA 4N4QA 4LNCA 5FF4A 2OT0A 5FF7A 2ZUNA 3N29A 3T7VA 2H3DA 3FS2A 1O6IA 3DOPA 1XCXA 4LW7A 2J79A 4ZR8A 1TJPA 3QC3A 4H9UA 4D6FA 4JTRA 4IJCA 4HPHA 3CTLA 3LNPA 4GUJA 4LRSA 8XIMA 2ODOA 5LNUA 1K6WA 2OSWA 2ATSA 1K02A 5H1WA 4FR6A 1F05A 3QY7A 1Z9AA 1B30A 4NNAA 1ZHAA 2FZ8A 1XICA 2QKFA 1DQWA 4B90A 2REQB 3WMCA 2YL8A 2BOGX 4AIBA 2ZC8A 1TJ0A 4FA3A 2ZE0A 1UG6A 1MNZA 1OYCA 2GQAA 4N2YA 5HPCA 1HW6A 3OO2A 1KCLA 4TTUA 4J3VA 2WPGA 4RE0A 4F2TA 3T0DA 1UWAA 1XC6A 5BU6A 2WVVA 3EX3A 2J7CA 1W9XA 2P1FA 2ZXDA 2X05A 4A29A 2QHAA 4DJFA 3VOJA 3V16A 4AF0B 4KMQA 3WLNA 3JR2A 2ESCA 4BWLC 4F9DA 2WWDA 2XN0A 3QH2A 4IHCA 2WKGA 4GMEA 3OVPA 3WEOA 3I7QA 3OA5A 3BGJA 5E6ZA 3QV7A 3SFWA 1KLZA 3SRDA 4JNZA 1SUXA 1FCVA 1S5MA 1QNPA 3S6OA 1HKIA 3U4AA 1TWZA 3RXZA 4PUUA 1AL8A 2XPKA 4EWND 1H3GA 2JALA 1YTKA 2WCSA 3SI9A 3NM3A 5AYXA 3SCTA 5HULA 4RNJA 3L2MA 5IM51 3STPA 3NEHA 3PK7A 1VYSX 1Q2RA 1E4LA 1PJ9A 4IQEA 3IVSA 4NJHA 2ABAA 3TQ0A 4MLJA 1X6LA 5C6MA 4ZFMA 4AMCA 4NJKA 3GFXA 4Q33A 3NVDA 4Y8EA 5I3IA 3KOFA 1OJXA 3A24A 2GJLA 5G4WA 1IYXA 1GOOA 2IXUA 2JKAA 2CHNA 3B40A 1V6XA 5BOOA 4XX6A 3P67A 3GC4A 1V51A 4AWTA 4A8RA 2XZ7A 1UIPA 3UG4A 1UCWA 1GOMA 1DIDA 1IF2A 1JCJA 1RLCL 4V28A 3RU8X 4IMCA 2VRJA 2WYSA 2WAGA 3TJ4A 1LRNA 1OSEA 2ZUVA 2ISSA 3VKAA 5PTDA 3AMCA 3LHYA 4GQBA 3BWWA 1ME9A 1TV5A 4HZMA 3QGVA 1OADA 5MHBA 1X96A 3QSRA 3YPIA 4IT1A 4CCDA 3S2NA 2HPMA 2YDQA 1JYVA 4H01A 7ENLA 2AKZA 4H19A 4Q8NA 2AL1A 1WZKA 5D03A 1V93A 3E0WA 3H4GA 1G0CA 3OG2A 3L9CA 1HIZA 3N2BA 1AVAA 2EO7A 4BI6A 4F3HA 3WQFA 4UR7A 1J2BA 3O63A 3ISIX 1L8NA 3ZT6A 2FVLA 2HTMA 2O55A 3BJFA 4C6IA 4CNSA 4IQLA 3W7GA 3ES7A 3GYCA 3BTNA 3AMLA 3FSUA 4PH6A 1CNVA 3HO8A 3VM5A 2XFRA 1TV4A 1CECA 1QPOA 3ANUA 4J3WA 4DJFD 1DJZA 3VKDA 1EOKA 4JYEA 2WSPA 1DQUA 2EPKX 4UFKA 3GK0A 2VZVA 3EX6A 4L61A 4YTSA 4HMDA 3FOKA 5I0DA 5CPNA 3U48A 2X0HA 2ZA3A 1GT8A 4M56A 2HS8A 3HJZA 1PKMA 3UXDA 3L4ZA 4X0VA 4WRHA 2ISDA 4CU6A 2EG6A 5IOBA 3QW4B 4QG8A 1BRLB 3WDJA 4C60A 4JIEA 3G0SA 3FVDA 2VEKA 3KLKA 2P0IA 4K37A 1JZ7A 1XH0A 3C0LA 4DBUA 7XIMA 1GWJA 4JTTA 4MDPA 3UVIA 4AEFA 3T44A 3BLIA 3LM7A 2QS8A 1WDRA 4LAZA 5CEWA 4LCQA 3QVQA 4CD7A 4OOZA 3HZ3A 5ENLA 5EY5A 1H63A 4QDWA 4H9ZA 5HAOA 2PGFA 3W01A 1LUCA 1DIKA 3OBKA 3SURA 3C0JA 5EU9A 2XH0A 4H9VA 2G3NA 1A3HA 4NJGA 2PLMA 1GONA 1MZRA 4NZ3A 3O0FA 1BG9A 1G7UA 4LBRA 4Q8PA 2Q01A 2Q3RA 3KCOA 3P81A 2X2YA 3IJIA 3IAPA 2Y61A 5F1VA 2WNQA 4HA3A 3R8GA 2IKJA 2P3EA 1VCFA 2QJJA 1AA1B 1S1RA 1M5WA 3QR3A 1IEQA 2F9RA 3URNA 4U3AA 5HMDA 3EKGA 4U31A 4AWSA 3BW3A 3O3RA 4ZQCA 4FP1A 3LBMA 4JY8A 3NA8A 3AHTA 1ML1A 5HBFA 1NVMA 3R79A 5CJMA 2Y7GA 1EJWC 5BWFA 3UZJA 2Y62A 2C16A 1TCDA 2WBGA 3AROA 1PX8A 4OKDA 3EB3A 1JFXA 3QHNA 1KGXA 5LGXA 4QHRA 2EPHA 2RUSA 3PHAA 3WLTA 3DENA 2EHHA 5FL1A 1UOZA 2D2GA 1G94A 1OC6A 1OFAA 2IPGA 5BXTA 3LMYA 2Y7EA 2XWDA 3RU6A 2B7QA 2PSNA 2PZNA 3SJ3A 3KWXA 4BQ5A 1W1VA 2ZWYA 4B3KA 4GQQA 4DX3A 2O9OA 2ACUA 3R94A 1TSIA 2PDMA 3ZOAA 2PTXA 2W5FA 5HUPA 2Y63A 1K03A 4OV9A 3NEVA 2PDGA 1TV8A 4LV9A 1QI3A 3W6YA 3IEBA 5DRIA 3CZ8A 3QR1A 4PB3A 3G1HA 4LX4A 4PUKA 2B7NA 3WF0A 3O2LA 3LSCA 1W3HA 2DV0A 3BAWA 5D02A 1T96A 1MUCA 2VCBA 2R1MA 4F0MA 4HU4A 4G7EA 4DI8A 3EMQA 1AW5A 1RALA 1V0MA 2PDXA 1JI1A 4JZ5A 1GPWA 3FEMA 4S39A 1FKWA 5D33A 3PB0A 3OLGA 1EJSC 1FHVA 3B9OA 5F4XA 3WCZA 3G3DA 6ENLA 2QW5A 3LQGA 2ZZ6A 3FDGA 1E9ZB 3R11A 1GVEA 4KBXA 3PS7A 2Y89A 3S6DA 4BCEA 3RRAA 2DZTA 3EPMA 5IHRA 1UHVA 2Z7GA 4IMEA 1ISXA 1C90A 6REQA 2ZA1A 4Z2HA 1E1EA 3FHAA 4M3PA 2FIQA 3ENLA 2QJMA 3P5YA 4JTKA 5LNVA 3GQYA 4GE8A 1N8WA 4QITA 2CPUA 3T8QA 1XUZA 4Q6XA 2PEVA 1QI2A 4WSKA 4IL0A 2FZDA 3KTSA 2E5CA 1MEHA 2UY3A 4AX6A 1GEQA 4DVOA 1PKYA 3WK0A 4YIWA 3TYAA 3G0UA 4QM1A 3TYZA 3IANA 1JZ5A 2J7EA 1H62A 1PZ3A 2JF6A 1EDGA 3MV01 2CLFA 4P2VA 3AYRA 1M68A 2H8XA 3LPPA 1GYLA 3ZLFA 1JZ2A 2BOEX 3W53A 4DWDA 2IKHA 4XAYA 1JGMA 1VAHA 2D69A 2WCAA 3BUVA 4X22A 3RR1A 4W7WA 4LUIA 4FSAA 1UZ1A 3QKZA 4RUBA 4GD0A 1EGMA 1IEXA 4LXFA 1PX3A 2PP1A 3O7UA 2QGHA 4AIUA 3TKFA 4IM4A 2AMGA 3RLVA 3VU2A 4ML9A 3E6EA 1MW2A 3A3HA 4H8HA 5DBUA 2HSAA 3NJ3A 3HF3A 2A21A 3OVQA 2PS2A 1LYXA 5K9XA 4FX6M 4A05A 5TD4A 4IMDA 4WVXA 4JHZA 2XFYA 5LNSA 1VH7A 5SWUA 1XP3A 3PC0A 5D2VA 4Z0JA 4XIMA 2ZUSA 3NQ7A 1CYGA 3WUEA 2AKMA 3AZSA 1JD9A 2A79A 2Q3OA 4QE1A 2DVXA 1EEPA 3HURA 3WF2A 4GJJA 1UKOA 1ONEA 1ZBCA 4BQ4A 3BCFA 3T6CA 3UZZA 3SR7A 3Q58A 1W3KA 3TN5A 1HKWA 4HCLA 3QEZA 4GYJA 3BAIA 1HVXA 4RPPA 4IIFA 5A6JA 4GO8A 3B8UA 2D20A 1UA3A 3LCXA 4CU7A 1PTGA 1VCGA 1FWCC 2X2GA 1P0DA 1A50A 4JYFA 1ELSA 1E15A 3AZTA 1QW7A 2IMRA 1GG0A 1IEWA 4ES4A 4MY8A 4DJFC 1B3WA 1BYDA 2CHOA 3GAYA 3VGDA 4OWGA 3NL6A 3I68A 5LIYX 3MUIA 1GQIA 3RAOA 3S5YA 3NOYA 3IIOA 2VCCA 1KCXA 1F3XA 3VGFA 1TR1A 3OB8A 1YDNA 2CFFA 1MQRA 1NP2A 1JXJA 4WDTA 4LV4A 2D0GA 3PTKA 3HPXA 3A5VA 3CH0A 3E0VA 4LVAA 3BSMA 3W88A 1YBQA 1FDZA 3RNDA 4HNLA 3ZS4A 4PMUA 3IIVA 4M51A 4Y2WA 2QULA 4ICCX 4EWJA 3BLDA 5KZDA 3HGOA 1ICPA 3MI6A 4A8NA 3A9IA 2GSHA 2GVLA 5CZSA 1BVWA 3F7JA 3ALGA 4P7OA 4ORMA 2PD9A 1RBLA 1XINA 1BKHA 1DP0A 3A23A 2XVKA 3VNDA 5CAKA 3DKJA 3CL8A 4GCXA 3BURA 1J0KA 1SMAA 5EKYA 3WF1A 5EBUA 3LHTA 2DJLA 3LD5A 4WGXA 4WK9A 3DC8A 3LCLA 4KRZA 3GO2A 5TAOA 3WDHA 3ZJ6A 4JTQA 3W23A 2CLPA 2KX9A 1YE6A 2R82A 1AW2A 2WC3A 4Q4SA 1OEPA 4BK9A 2DZSA 3OG3A 1PL9A 2XSBA 4CCCA 5E0FA 4JDYA 2FDMA 4XQ6A 4H9YA 3TR9A 1R46A 2HVMA 3GHRA 3F2DA 3P74A 2PMQA 3TYCA 3NO5A 4PL1A 3OJGA 5EFDA 1UQYA 1VRDA 4IP4A 3KOXA 3UZWA 1DVJA 3DU0A 3MPGA 1P0NA 3GTHA 3WLOA 4R5EA 2GUYA 4LQ1A 4DYKA 4YVVA 2XIQA 4LYPA 3VIKA 3CPGA 4ROPA 3HPSA 1XBXA 4LB4A 1VIZA 5T9BG 2POTA 4FNRA 1JCTA 5HMEA 4MDOA 4KIEA 2PRMA 1V3LA 3MHGA 2JQXA 3L68A 3NQ8A 3IK4A 4IWWA 2QCHA 1J0ZA 1H41A 4I5UA 2FB2A 2OVLA 3B8VA 4IMAA 4J2MA 1A5OC 4QR6A 4DXVA 2E6AA 3PG9A 4U2YA 3BARA 1C7SA 1KGWA 3PTQA 1PBGA 3LQLA 3AMKA 3K2GA 3SSJA 2BGSA 3WD0A 5HUOA 1EJTC 1TPWA 2X1SA 3PBMA 4LALA 3QQWA 3VFCA 4JIRA 2B7OA 3GWQA 3N19B 4DZIA 1HN1A 3L5MA 4Z2JA 3LXBA 1NY1A 4IG2B 4AD1A 3QFWA 1X6UA 2FGLA 1OD0A 3VE9A 1OWQA 4K36A 1GGOA 3KBWA 4N9BA 1LM1A 4JR5A 1LOQA 3CZEA 2OB3A 1EIBA 4PMNA 2ZZ3A 1LG2A 3ZYZA 1JL8A 4FLQA 3ABOA 4DBDA 2GGEA 2GJXA 5D2YA 5BMWA 4Y96A 1E6XM 4BA0A 1AZ1A 1VJIA 2WMKA 3MCOA 1NM9A 3FLUA 1DXIA 4GNKB 1CXFA 1K8YA 3B0PA 4Q8TA 5XIMA 3L4TA 3M0IA 3S3GA 5MKGA 2WPBA 4HNOA 4V1XA 3BW4A 2NQJA 1E43A 4NAFA 2C0HA 9RUBA 3B03A 1CXKA 3USZA 2OSXA 3NGFA 3H7RA 3RX3A 5AHFA 1X7IA 2V5KA 4FEZA 2INFA 1FH7A 5M2FX 3N17A 1NQKA 2R1NA 3CMGA 3OQ8A 3LENA 2VFEA 2ZIDA 1N55A 2QUVA 1W1ZA 1CENA 3PJWA 3R2GA 5TIMA 3I3DA 4CN6A 5AC4A 2R6OA 1ITCA 2WVVB 3IJQA 3V35A 1DHPA 1KKOA 1XYBA 1HX0A 2H9AB 1FWAC 1R3TA 1WA3A 3SN1A 4UIOA 4C6QA 3N34A 4XISA 1R6WA 4H41A 1V0NA 2HROA 4KWUA 3K1DA 2PA6A 4GVFA 2J9ZA 2E1WA 3BK0A 3KX6A 1C29A 3VDBA 1YXYA 3KZSA 3TSBA 1VFFA 1RCXB 1SYTA 4RE4A 3NQBA 3W29A 3MP3A 4AD3A 3WQ6A 2VZUA 2YCJA 4FXJA 4R3UA 2XIJA 2NXIA 5F4SA 5HQEA 3E38A 3C2RA 3C5QA 3SAZA 2E8YA 3VCRA 4RZ4A 4M0XA 4GQRA 1YHTA 1H7NA 3UPWA 5GVJA 4JIHA 4DELA 1SMDA 4EOUA 3UWWA 4J27A 4M82A 2Z4GA 2L5HA 2RAGA 1R9YA 3W85A 3P82A 1K9TA 2NV2A 3RR4A 4PUDA 3FKRA 3ARVA 1EWEA 1SO4A 2QDHA 4J4KA 1C9DA 3PZIA 3VNZA 2WB5A 1W5PA 1UIOA 1IGWA 1MEIA 3VABA 2PP0A 4JS3A 5CG7A 4MJZA 3H6OA 2CZ5A 2EAWA 2YZ5A 2MNRA 4REQA 4MB3A 4K2SA 3XISA 1DJQA 4YHGA 4KFPA 1LBMA 1M9HA 4GXWA 3V0TA 4Q32A 1O5RA 1L2UA 2VO5A 5G1MA 4YXGA 1KLYA 2AMXA 3IRSA 2HMCA 3GNRA 2XU2A 4CNNA 1R85A 3KRSA 3N18A 3D3FA 4BZYA 4ZB0A 2ZVRA 3EWDA 3EXTA 2Y5EA 5DMLA 3POCA 4PULA 2WLZA 2C71A 4XB3A 2V3FA 4DO6A 5A95A 1UZ4A 3BJTA 2NLYA 4XZHA 3RDKA 3DECA 1VF8A 3VA8A 4I7VA 1EJRC 5K4XA 4H04A 2QCNA 3QKEA 3KVMA 4JTUA 1V79A 4GHRA 5HJYA 4C6NA 1E72M 1BLIA 3LU2A 3CHEA 4HMCA 1M01A 1KBIA 1FTXA 5DMYA 2HS6A 3E0IA 1YQ2A 2WWCA 3W02A 3TROA 2C1GA 1VCVA 1Y8BA 3RJYA 4AD2A 1X1OA 1VR6A 1ADDA 1UR0A 3GY1A 4PEEA 4A6GA 3LGDA 3WQPA 3CYJA 3AIVA 3VDHA 1YDVA 4L7ZA 3MJMA 2V8ZA 4Z17A 5CPQA 1J0IA 3V1PA 2PWEA 2A0NA 1V02A 1RV8A 3UJRA 2FPYA 1I2QA 5FJOA 1Q6CA 2V3EA 3L4WA 5D8WA 4MB1A 4HOWA 3WD4A 1OABA 3TAKA 2X1UA 3GR8A 5A6TC 1U33A 3VIOA 3WUGA 4PTNA 3P93A 1DIEA 3TJIA 3FNDA 2ASHA 3SBFA 5HATA 4GKLA 4MM1A 2YCEA 1WDQA 3INPA 2QUNA 3L4YA 4G56A 5LIKX 5A8OA 2EJ1A 3BQ5A 3M41A 2DJXA 4LUTA 1OVDA 3WLQA 3F5KA 4IFOA 4C1LA 1DJGA 2GQ3A 2C13A 4FR1A 4ONVA 1W1B1 4ACYA 3R8RA 1M65A 1UQZA 4HNNA 4ZOAA 4QXIA 4DF2A 5C9WA 3I7SA 2ADAA 3OLEA 3ZVHA 2VMFA 2DT3A 4LANA 2DSWA 1IT8A 3KOZA 3S5SA 1WUEA 4LUSA 3SW6A 1DJYA 4M1RA 1JUKA 3NSMA 3LCHA 4U2ZA 1GJWA 1JRBA 1BXCA 2BP1A 1DIOA 4MYAA 5AVHA 1J01A 3P8JA 3CLMA 2XVLA 1RCOB 2A1YA 2J9YA 1J8VA 1HJVA 2BY1A 1WYIA 2GK1A 1IEIA 1QATA 1I75A 3NVTA 1W17A 5AC5A 3VVGA 1ICQA 3G2GA 3CB3A 2VI0A 5D38A 3V5FA 1HGYA 4JQ1A 5HANA 2YR1A 4LC6A 4MJMA 2IXVA 4Q8WA 4GG9A 3V1HA 3TEVA 4H7CA 3U6WA 1GQJA 1BYAA 1RY8A 3APGA 3CZKA 3N2XA 4KT2A 4S3DA 1TMQA 4MPKA 4PCFA 5CPOA 1B31A 3TU9A 1HJWA 4X9SA 1OC7A 4I90A 1J6PA 5C70A 4ATDA 1W1A1 4FLSA 2O7QA 2G37A 4RXFA 3QY6A 1PWLA 5A6KA 3CUJA 3UXIA 3ABSA 3EOEA 4A8IA 4U5IA 2QPXA 3LZ5A 2CBUA 5E5CA 1EQPA 4D2JA 3A6OA 5I7GA 4EF8A 1DTUA 2VYOA 4NG3A 4RDWA 1IIGA 1BXBA 1X7FA 4I3GA 4PN2A 3T1GA 1QVBA 4G7EB 2RGMA 2BVTA 4WY0B 1XLBA 1H7XA 3PZTA 1Z48A 1EC8A 5REQB 7A3HA 3HFTA 3DFNA 1YMYA 2POZA 3PUGA 1XUUA 1QI0A 4XZBA 4AYSA 3C8FA 4TUFA 2YCIX 1O5QA 2J7HA 3VX0A 2W79A 4GYPA 2QDDA 4A2SA 4W84A 2BASA 1OHLA 4YTTA 3R8HA 3DERA 3V4BA 4NYYA 2PB1A 4RNHA 3UWVA 3WNKA 1SO3A 5CZKA 1AMYA 1ZU8A 1REQA 6TIMA 3PM6A 1HT6A 4Y9OA 3OQEA 3MHFA 1US3A 4V33A 3TTYA 4PMZA 2Z2UA 1V03A 2W62A 1U30A 5J5RA 4PUJA 3P3BA 1CT5A 4TVUA 4W5UA 3CUIA 2BBFA 1YNYA 3V0SA 1L8PA 3BL3A 3UCCA 5L9FA 2Z2AA 4AFYA 3KEHA 4BEQA 4H6QA 3CAQA 3OVGA 1XBVA 2PDBA 2YCKX 3V5OA 3G1VA 3IJLA 4S3CA 4QDPA 3OODA 3DBPA 1ZS2A 2WCGA 3H2AA 2E5BA 4YN5A 1EP2A 3HPFA 1I6NA 5AZ1A 6PTDA 4PMDA 2ISVA 3TN4A 3WENA 4JQ2A 3C61A 4M6QA 3LPGA 4X63A 4AZCA 1BEUA 3C3UA 4CD5A 4ZE5A 2QAPA 1A3XA 2WNNA 2OO0A 2JIEA 2J7DA 4MWAA 2F38A 2VURA 4D71A 1G1YA 2EPNA 2QJIA 4L6HA 1RD5A 2VENA 1S3HA 3HG3A 1XC4A 2X7WA 1DWIM 2VVSA 4HNTA 2BVWA 3EDFA 1UWQA 4ZVJA 1W8SA 3GC5A 5B80A 3BCJA 1CLXA 4NXSA 4B5SA 2GVJA 1SFJA 1UYQA 2WVSA 2WHJA 2WHLA 5DMMA 1JDFA 3GFZA 4UOZA 1UH2A 1QMLA 3BAYA 1PYMA 3A13A 1CIUA 1P43A 2INEA 3B9AA 3CIXA 4O12A 3A9BA 4JQ3A 3B8WA 2QEZA 1MDLA 3B4YA 1Q3NA 3AICA 2YFOA 3IJDA 2DSUA 1JF5A 3C2OA 3O6CA 4V27A 3TSDA 1ZJBA 1ZLPA 2C1HA 3S1GA 2Y0FA 3PBWA 3AS0A 2G50A 1GTHA 1J5TA 3T9PA 4C6EA 2E40A 4XZNX 1WXZA 3E0LA 3LCWA 4GFSA 4HA1A 2QR6A 3V3WA 3PJUA 1SR9A 1XD1A 1EZ2A 4ZENA 4NI3A 2C79A 1P48A 3RM4A 3Q37A 4PE8A 1Q13A 1XG4A 1M03A 5HNNA 1EJUC 2ZDRA 3NTYA 4RK8A 4WSJA 1LQ2A 3GHSA 5CLTA 4ZBCA 4YTRA 1LP6A 1ENUA 3AWOA 3CGTA 4ZXOA 4TR9A 4EXAA 3CIWA 4QAIA 1V3JA 4FPSA 1ODZA 1YBQB 1AJ2A 5CG0A 2W61A 5A8NA 3CQJA 4H9XA 5BZAA 1ADSA 1TYGA 1YDOA 4HJWA 1FWFC 4JQAA 4K6AA 3FYOA 2HE8A 1XIIA 3SUVA 3VKCA 2R1LA 3IIZA 2VFIA 4BF7A 5IBXA 5CPMA 1GZ1A 1DJWA 1EO7A 3T42A 4TOQA 3UCDA 3GNXA 1JJKA 4B3ZA 5CC3A 1TWWA 4DQWA 1MRQA 3W7PA 4S2BA 2FPVA 2OWWA 5CGTA 3M6DA 3LPFA 4O16A 3QHOA 1NWTA 1RJRA 3TXZA 2WKJA 4F9JA 5EMUA 2NXHA 4MWAD 3M4HA 3R5EA 4N9CA 4AYGA 4GC3A 4XAFA 3S5OA 3DYMA 5GJMA 2CLLA 1NAL1 3S2LA 5FAJA 3S1WA 2D2JA 3GR7A 4AX7A 4I7WA 3QRHA 3NZQA 5A6MA 4WY0F 2PDIA 3G3MA 1P5BA 1GKPA 3WJWA 4TVCA 4G1KA 3TCSA 3ARTA 4PFHA 4H8VA 3BGAA 3UQNA 1W56A 1OZMA 3UF9A 1SW7A 1AODA 3ZR6A 1VFOA 3T81A 3F4NA 4D6HA 2MUCA 5KINA 3TW9A 4HPXA 1AJ0A 1XDJA 2WMIA 1K9DA 3E2VA 2Z2BA 3OBAA 3EBVA 3GXMA 3ITYA 3MP5A 4JGDA 1MUMA 1PEZA 4F0HA 1KXQA 4W5ZA 5DFAA 1Z32X 1XDLA 4LBUA 4ZQMA 4ZO7A 4OBTA 3PANA 4A3YA 2DZBA 3I3EA 3MWAA 2FJKA 4N4PA 4AXNA 3BDKA 2ZXAA 3NO3A 2YBTA 2Z26A 3CPRA 3DHUA 1TR9A 6XIAA 3GIYA 1FHUA 1QWGA 4CQ9A 3RK8A 5HWNA 1KWKA 4R7JA 4MPQA 1V6UA 4GYKA 2NT0A 2VRKA 2V63A 1LZOA 1PWMA 1YTEA 4FNTA 1XIJA 3N9RA 5GNXA 4WXYA 1E4MM 2WVTA 2G8ZA 4OTKA 1FWTA 4XO7A 3C6CA 2FTPA 3KBJA 1FDJA 2FTYA 4AQLA 2ZRZA 1E0VA 2O0TA 1KXVA 3M5ZA 1VJSA 1AQMA 2PCQA 4JFWA 1WV2A 5M03A 3I6RA 2FZBA 2V3GA 4ERGA 3EB4A 2GJXB 1HFBA 5J8LA 3WUBA 3LM3A 4RV8A 2AL2A 5EMLA 4F0LA 4MTVA 1E0TA 4NF7A 4XZ9A 4MGGA 5CZTA 3UNTA 3QPZA 3AMGA 4QROA 3HV9A 2PDHA 3IIXA 5MKGB 1K8XA 1LLWA 1FWBC 4V2XA 3N4FA 5HJLA 1H60A 4A4AA 4NZJA 1F3EA 3EA2A 4H4IA 4R9XA 1Z42A 2CITA 6ALDA 4N6FA 2ON3A 4MUZA 3OHMB 4PTXA 4WJ8A 3O16A 4O1AA 1QCWA 3P14A 5FF2A 5TQLA 3GHTA 5A2CA 3LN3A 2OMAA 2WJDA 3VZXA 1HJQA 3RPTA 3NO1A 3OYZA 5G1TA 4AC7C 4HHHA 4QFUA 2J77A 3E02A 4HNUA 3DI0A 4H83A 2YLAA 2I5IA 4HN8A 1GZGA 1DWAM 1DWFM 4L4OA 5CH9A 3QV8A 1CLVA 4DLFA 2A3LA 2YCLB 4ZQPA 4H7VA 4OVXA 4NSBA 1KFWA 2P3ZA 4RDZA 1E9IA 1OT1A 4N7QA 3ZQ9A 1Y7VA 3B4UA 1W3JA 4EANA 4C6CA 1LL6A 2FB3A 4JX6A 1XYLA 3AHVA 3PUEA 3R25A 3W7IA 1WDWA 3W0KA 4CLMA 4GIEA 1YADA 3E12A 3VDGA 3AMDA 5FJTA 2ZDSA 2OGJA 1JPHA 3H26A 3GNDA 2QCDB 3DKLA 4KEZA 3VGHA 2Z0IA 4GY1A 2GZXA 2YBVA 3LGGA 1V3KA 5HQMA 1QO2A 2QDGA 3WIJA 4TX8A 4Y9NA 3V75A 2AQOA 4RZ5A 3ZSTA 4GJIA 3R6IA 1WDPA 3ITXA 1DJHA 4GQ0A 2IKIA 4AVOA 4KESA 4F0RA 2VDIA 4KERA 1B9ZA 1OFBA 4PMOA 2J4GA 1WOBA 2CNCA 1DPMA 3WLPA 3TJLA 4E4FA 1QK0A 3EOUA 4FIQA 4V15A 4Q4MA 3MTWA 1VP5A 4AHOA 1Z89A 1B4KA 4UMAA 4ZQNA 2E8ZA 3FX4A 2EPOA 4URIA 3N15A 3PWGA 3OLDA 2UY4A 2V2CA 4K8GA 3DC0A 5DO8A 5D9PA 5G4EA 3EKZA 3QPEA 3FYPA 2E6FA 1DXFA 2WMFA 4DJEA 1NOWA 2GVYA 2X40A 3E2QA 3K4WA 2F8QA 5I77A 1XLMA 4Q6JA 5DLCA 1S2UA 3EWWA 4C6DA 5DCEA 3KUMA 4J3XA 3AU2A 1XLGA 1VFUA 3A21A 2OEKA 4PFMA 2R24A 1TPFA 6TAAA 5CAHA 3CL6A 4ASTA 3EDJA 2WC7A 4JNYA 3ZM8A 3QGKC 1C8VA 2IQDA 4WXZA 4JIPA 1H1YA 1XYZA 5B7ZA 3LA4A 1FWGC 4NKCA 3ONCA 5CZJA 1GOQA 2RGLA 1MNSA 4GCAA 5D2TA 3WQOA 2HQAA 4YYFA 4G5DA 2P5NA 3LHVA 1KM6A 3S1VA 3DG3A 4ERAA 5LNRA 3NPWA 4S3KA 5I24A 4U33A 5GJNA 1QHPA 1XD0A 2Y24A 3S9ZA 1OYAA 3II1A 1SJAA 5BROA 2QF7A 2PODA 3AYVA 3CO4A 1YNPA 4HYVA 4D6IA 4MY1A 4DWSA 3FJNA 4D9PA 2NX9A 4QEHA 2VQTA 4C6LA 3CV1A 2A7RA 1F07A 4TIMA 2QLYA 3URAA 3F5JA 1M7JA 1VHCA 4L4LA 4DYJA 1WZAA 1UB3A 4GNJA 2UY5A 2CU0A 2PLKA 3BMWA 5DXXA 4JFVA 4RZ6A 2FFIA 1MQPA 1UWSA 4H2HA 1Y0EA 1NJJA 3T8LA 3MUY1 5F1UA 5J04A 5I23A 3PBGA 3RCNA 4I7UA 2V67A 2J27A 4GISA 1JCMP 3BJSA 4MNMA 4P61A 2OQHA 1OX4B 1XLEA 2BG5A 2E3ZA 4GUHA 4JAWA 3GR4A 5FACA 3THAA 4ERIA 2WM0A 3HBLA 4L5ZA 4M1BA 3OZOA 3ABXA 2YL6A 4HNVA 4TX9A 2PFHA 1KNWA 3JUGA 1KRBC 1C92A 3GX9A 2XFFA 3T78A 3MDUA 3LXAA 3QC0A 4J28A 2Y8UA 4ADTA 1XCWA 4MADA 4TVDA 1FBAA 4PB5A 3LPOA 5I3JA 4E4UA 4QS5A 4DJED 4IOTA 4BHYA 3QYSA 4CKQA 4NP7A 2ZA2A 4KQNA 2YYUA 1KQYA 4JTGA 5CZ0A 4J7RA 1GCYA 4WX2A 2C0AA 2PDLA 4LPCA 2GK1B 1Q8AA 4EPEC 2VUNA 2B81A 1HO1A 3M1ZA 4Z2GA 1Q4NX 1RVGA 3EA1A 3ZFHA 3VINA 3QV6A 1XW8A 3GU1A 2QDEA 3MUXA 4AHQA 1VLIA 2PD5A 3BLPX 2NQLA 3L4VA 4B9YA 1VKFA 2R1PA 1XCFA 1JDDA 3B9EA 4PCSA 4FAMA 3CWOX 2RDTA 3EAUA 1ECQA 3DFOA 4Q8QA 1F9CA 1KFEA 1VBJA 3THQA 1UR2A 1R2RA 3WQ4A 4IFRA 3T2QA 4B5XA 1JI2A 1EXBA 2P0OA 3GTIA 1P7TB 1E0XA 2ZX8A 2QIIA 3W70A 3RO8A 4KEVA 4FB7A 1JPMA 5FI8A 4HMNA 3FXGA 3UERA 2DORA 3N14A 4UTWC 1QUMA 2CLHA 3M44A 4WR3A 2VX6A 4Y6GA 2Z27A 4OV4A 1EC9A 3W72A 1AH0A 3S8HA 1Q66A 4O11A 1P6CA 3IPWA 2Y70A 1SJBA 3OGVA 1UD6A 3KZPA 4Y8FA 1OM0A 2ACRA 1KRAC 3WEZA 4DWSD 1TQXA 2A7PA 2J25A 1A49A 1AFSA 1Q6RA 4M6VA 5I5RA 4QP0A 3DFSA 3W2JA 1VYRA 2OLAA 3ZT7A 1UR8A 1VFMA 1UD3A 3NNTA 1H2JA 5DQPA 2QV5A 5HMFA 1EDTA 3KFTA 3VCNA 1VENA 1N7KA 3WLIA 3BANA 4HTBA 1ZP4A 1N8FA 3KTCA 4OIFA 1TV2A 1O66A 3LLXA 3W7EA 3BMVA 5BNKA 4OOUA 4DXXA 1TRIA 1XIDA 1V0LA 2VJXA 3DG6A 1S2TA 1G69A 4CVWA 5H2ZA 4ZOCA 4GI9A 1T5AA 4J5NA 2V5JA 1FFRA 4UNIA 1E40A 3VMOA 1U5VA 4UQBA 2D24A 4PZVA 3BG3A 2A3AA 4AEEA 5LYRA 3BW2A 4R9OA 3K30A 4WCJA 4CU8A 3HGRA 1W1IE 1FUYA 3QSTA 2XVPA 4M7SA 1WPCA 3L4XA 3L0KA 1UPMB 4DI9A 3U5YA 1FP9A 2DZXA 3MUZ1 1R9ZA 3D0CA 4XAPA 4RDYA 1UZDA 2I5GA 2CZVA 4MYXA 3LRLA 3KBNA 5E0KA 3E0FA 4MHBA 2OZ0A 2F6XA 3M5XA 5C55A 5G2WA 1O1ZA 3UA3A 3W7DA 4UTHA 1JCNA 2NLIA 3PFMA 1D3GA 4JTHA 4PRRA 1HXJA 2D0FA 1F8IA 4MWAB 2NWSA 3EXSA 1R0MA 3AHZA 4EVZA 5FJJA 1GVFA 2YKKA 5CPTA 3MUAA 3WNNA 1LDCA 2PBGA 5CPLA 3FFSA 3TTOA 2WSYA 1RH9A 1NQ6A 5DT5A 2QCMA 2E6DA 2XGBA 5M1TA 5A6LA 4N0RA 1WZMA 3EOLA 3VYLA 1TJ1A 3UW6A 1JQVA 5CQ1A 1XLHA 4I9TA 2FDSA 4GIAA 1IWBA 4ZSUA 3UJ2A 3D5HA 2SFPA 4S3AA 5ABTA 2HWGA 4W86A 2VEGA 4W4QA 3STCA 1X97A 2FJUB 3FV9A 2W27A 2ATMA 3AJ7A 2B4GA 4WF7A 4Z2KA 2HXUA 5C8BB 3KL5A 5CGMA 3B9NA 3TR2A 2UZ9A 3GH5A 3W76A 4C91A 2YW3A 1T0OA 2Z7KA 4W9TA 3U8GA 3TUUA 2HK1A 3W7MA 1KD0A 3SRKA 2X30A 4HMEA 4Z1CA 4IX2A 2Y5SA 3PAJA 2PLJA 4OQVA 5LIXX 3EZ4A 3TQPA 1Q6LA 3W87A 2X41A 4MKNA 2VX5A 2ZZ1A 3MA8A 1KM2A 1XG3A 3L4UA 2FTWA 3S47A 1VPYA 2Q8ZA 3U57A 1QO5A 3N25A 2QJGA 1K9EA 3CIVA 3L5LA 3P8IA 3RMEA 1QTWA 2CLOA 1A5MC 3D46A 3SY5A 4YWIA 4BY3A 2PDYA 4AZBA 1PXGA 4YCOA 1UBSA 2HK0A 4B5VA 1EOMA 1OK6A 3NR0A 1LBFA 2WSQA 5D30A 1DE6A 4UMCA 3VFLA 4FIRA 4CQ8A 3M16A 2FHBA 5H6HA 1K6AA 3URBA 4Y9MA 3CNYA 5A6AA 3W2UA 4PCNA 4F48A 2QUUA 5EYWA 2YXOA 1KFCA 1TV3A 3IVUA 4AB4A 1CPUA 4JKMA 2HZGA 4RV3A 4P5UA 3E5BA 1WP6A 5HK4A 1VPQA 1WAUA 5CSRA 3DGRA 4NX0A 4ZTXA 3CH9A 4LEQA 4RE3A 1QPQA 3EWXA 3E74A 4R88A 1Q45A 2ISFA 3R58A 5DCBA 1ESWA 3BLKA 3APYA 2PWVA 1CDGA 4ZE4A 4H6KA 3RYSA 1MI3A 3N12A 2WHMA 3DXIA 3C3NA 2BLEA 2I14A 3GYEA 3BG5A 4AY8A 2OYMA 3DHPA 2BZNA 1IHIA 1TA3B 3ZJ8A 1TTQA 2P50A 3FKKA 4H1ZA 3WJXA 1H0IA 3WX7A 3SJNA 3THDA 4NX5A 3S2MA 2F61A 2WMIB 3O15A 3NQGA 1PIFA 2X7VA 2DT2A 3IWPA 1K7EA 1XKJA 5AECA 3WJZA 1EXPA 5A3HA 2I7GA 3W28A 3GTNA 3LERA 1PDYA 4ADUA 1F73A 2A3BA 1HTIA 2PU1A 2G4FA 3IJ6A 3NZ1A 1B90A 5JBDA 4K7YA 4O1CA 3VDAA 4GYFA 2PDWA 5M17A 1LROA 5F2GA 3C56A 1JIBA 1R9XA 1ONWA 4LSBA 1B3YA 3COTA 5CBBA 3LOTA 3W1QA 3KVLA 2D2OA 2WJEA 3BSGA 2RHGA 3RUBL 3LNMA 3ZR5A 3LYEA 1RBOB 4E8GA 4POCA 3WH7A 2PDPA 3AXXA 4GX8A 3NSXA 2RFGA 3W7QA 3RX4A 4LEFA 2OQLA 3TJXA 5K3VA 4NNBA 2PUZA 3MI3A 1OFRA 3PBYA 3NQ6A 1GQKA 2EJAA 3WH5A 2IKGA 1L9WA 1QNRA 3EX2A 3TH6A 1GVIA 1EQCA 1S2WA 3GB6A 1ISYA 3ANVA 4HKPA 5F2IA 2DSVA 2CKSA 5AY7A 2DIKA 1M3UA 4QS6A 4ICMA 5G2IA 1LORA 3MV11 3W1UA 1FCBA 1BF2A 3MVIA 4IP7A 4LYKA 1EX1A 3GG8A 3T08A 2NX1A 3PG8A 3T4WA 1CEOA 1UPPA 3CEUA 3FHQA 1VIWA 3MDWA 1SW0A 1I0DA 3HPZA 5I3GA 1IT0A 2WZIA 4JKKA 1XLJA 1EBGA 3PP7A 4CUCA 4S3GA 2OWCA 2G41A 3LRKA 5AHNA 4JEQA 4RX0A 1J11A 2QAFA 4IPNB 1JG9A 1CCWB 4P7NA 2VM8A 3W9ZA 1XL9A 5HMSA 1VB9A 3TC6A 1VD6A 3E3HA 1SSDA 1XIBA 4LOCA 4HCHA 1R5YA 3B97A 1BSLA 3GXIA 2XWEA 3VIPA 3WFAA 3VX1A 4XG1A 3PZ9A 3W6MA 3ITCA 3LV5A 3B06A 5CCZA 4KH2A 5CKSA 1G7VA 2C91A 4QDMA 4EE9A 4F4RA 1H1NA 4QQUA 4Q4OA 2OQYA 4PTWA 1SO5A 3NYZA 1XYFA 2WJZA 1KWGA 4KKXA 1EF3A 3PF3A 4M7TA 4QAWA 1H50A 3QMSA 3WG6A 2VVNA 4CQDA 1SFLA 2OELA 1Z6KA 3R10A 1W3NA 4IQDA 2XTKA 4IG2A 2YZRA 4JTSA 3W1MA 5EMYA 1N82A 1BD0A 1FY6A 3U4FA 1XRSA 2CHRA 2XJ7A 2TMDA 4Q8UA 2ZRUA 1UR9A 1C8XA 1JULA 1HO4A 1U5JA 4AIOA 2WMJA 2ZXBA 1U83A 4B4HA 1J4EA 4KF1A 5DEZA 2MANA 3BV4A 2DZUA 1EP1A 3VI2A 4O13A 1XIMA 1XH1A 1X38A 4JNMA 3OA3A 3UGRA 2DIJA 1X1NA 4IJRA 3GG1A 2OKOA 1VJZA 3WL1A 4QE4A 3AYSA 3CC1A 3M47A 1HGWA 4YTQA 4LBSA 3TLLA 3B8SA 1DEDA 3BOLA 3GDRA 3N6QA 3UCQA 5I00A 2X1RA 2PRHA 2JK2A 3NAVA 1MW0A 1QPRA 1XH2A 1VC4A 3LEPA 1J12A 5I09A 4HN4A 3S4TA 5H91A 1KM0A 3DAQA 1XFBA 2BODX 1WKFA 2WLYA 3G22A 4TTGA 3C0QA 3KHDA 3PTMA 4NZ1A 3PSWA 1HJUA 2XSAA 1A5AA 1R2TA 1VBGA 4R33A 1PIGA 3DHFA 2J47A 2D3LA 4B5WA 4LH8A 3UP8A 4DHGA 4A35A 3IV3A 1FFQA 1QOQA 3NL2A 3AS2A 3TSMA 3QFEA 3BMXA 2BHUA 2YGYA 2O9TA 2H9AA 4IXXA 2D0HA 3P60A 3RCMA 1ZBVA 1SJCA 2GVGA 1QHOA 3MKKA 4I5XA 3FAWA 3HA1A 3Q45A 2VC6A 1QI4A 1E6NA 2ZX6A 4J40A 4AISA 3UYIA 3I10A 3ZSSA 1NTHA 2NX3A 2CC0A 1WO2A 3WNMA 2BHYA 4TV6A 1QDSA 1DJXA 5ABFA 1F4HA 1KXHA 1Z8AA 2I9UA 1JD7A 4QLJA 4CEXC 2VRQA 3PJTA 1G4EA 1K7XA 4EXQA 3HOJA 3CM4A 3CYVA 3JU2A 4IIDA 3BE7A 3EEGA 2JBMA 1ITUA 3CT2A 3MCNA 4DWSB 3MO7A 3LI1A 2BMBA 1KA9F 4Q8VA 3N2OA 3MKCA 4S23A 1R8LA 1I1XA 1SGJA 5EGRA 3SUUA 2VTFA 1ZAIA 3AU6A 4XTDA 3NDYA 1YTDA 4HYWA 3WDPP 1XQKA 2F2KA 3WELA 2F2HA 1OIFA 4RLIA 4E3TA 3EWCA 3E5PA 4RZBA 1OFPA 1TJRA 2DZPA 3U7VA 5KZ6A 3HU7A 3KAOA 3QR0A 3CQHA 4S3FA 4RCXA 2DVTA 3QN3A 3DFHA 4FHAA 2PWFA 1A5CA 5BXPA 5DN1A 4CD8A 1THFD 2CETA 3LLDA 1ZZMA 2G95A 3OBEA 2B7PA 3FIGA 4UTTA 2C19A 4DYEA 3QOKA 1DE5A 1T41A 1YNQA 2WM1A 1KTCA 1VEOA 1LL7A 3U2OA 3SCVA 3S2JA 3QZ6A 1LT7A 2RJGA 3KBSA 1I9CB 4JX5A 1WDDA 2HNHA 4A3UA 2BGNE 2PU0A 4KPLA 3HGJA 3VAVA 1BYCA 1V3HA 2ZZ5A 3IS4A 4YS1A 1XLDA 4WOQA 3OYXA 1XM3A 4P7RA 5C7VA 3LCIA 3W7LA 3FJ6A 1EFZA 2VZSA 2IS7A 3MU7A 3VM7A 3M0VA 2CBIA 3W26A 3VD3A 4DUVA 3WQDA 5D9OA 1D8CA 3S5ZA 4B91A 2VUYA 4L1WA 1SU5A 3GXTA 4YYCA 3PJXA 2A85A 1NF0A 3VIHA 1LRTA 2OJPA 1WXYA 4DZAA 1O95A 2BXYA 1W54A 3T4CA 1HL8A 5DF0A 2G3IA 4PUNA 1DV7A 2NXGA 5M3WA 2J8GA 2J78A 5KMYA 1I2PA 4X9YA 2VFFA 3GDMA 5HOSA 1SZRA 4GRSA 2NUWA 1JYNA 1UR1A 3GU9A 4WEVX 1A4LA 4IFKB 3LG3A 3M0JA 3P2VA 5CC5A 3O1NA 1SVDA 4O52A 3THCA 2PDJA 4DZ5A 2GWGA 3T07A 2DT1A 3P0WA 1GJUA 3DFTA 4WKHA 2GOKA 4K3ZA 2XHYA 2X09A 3JW7A 2ZVIA 2J9XA 5I78A 5TNVA 4YWSA 3WMBA 2HE5A 3O8AA 5D2XA 1W1YA 4GVIA 4XZLX 4X61A 4K68A 1CTNA 2ZZ2A 4UUIA 2XVGA 2JFEX 1MQQA 1TZZA 1UC5A 3F03K 4Q8OA 4AH7A 3WQ5A 5FCZA 4XAZA 2OXNA 3GH7A 2W0UA 3CZGA 3EDKA 1KGUA 1BYBA 2A6NA 1WE5A 4Y9AA 2Q71A 4HB7A 2WSKA 4R7WA 1OGBA 5AC7A 3NQ2A 1B0IA 4MF4A 1U2YA 2Z1SA 2ALDA 2Y6ZA 4RDVA 5L6UA 1TWDA 1J5SA 3FGCA 2YA1A 4GIRA 5K4ZA 3VD5A 1N8IA 4WJEA 1NDVA 3H2MA 2FFCA 1AD4A 3R13A 1O5KA 1PHQA 1RP9A 2VQUA 3W7JA 4AIEA 4K8EA 4DJDA 1W32A 2R1KA 1XXXA 1LRQA 5IFPA 3SCWA 2C3ZA 4K8HA 3PB2A 4FNQA 1BG4A 5HJXA 1W3LA 5JBFA 3IGSA 1OBAA 1IWPA 4PB4A 2W9MA 3LUTA 1JCXA 1IEVA 4PEKA 1IZKA 4H7ZA 4W8LA 2EPMX 1UP2A 1UASA 5E9XA 1XF0A 1E3XA 3PPFA 4NYUA 5E1QA 1E4IA 1JZ3A 3K8KA 1BPLB 5DBTA 3HIJA 3CV2A 3FJ4A 4PGLA 1OT2A 1RVKA 3AQUA 4FO4A 3OVRA 2GGIA 4I9AA 3W81A 1XR2A 1OIMA 3PTDA 3CZLA 1TB3A 4NAEA 4WY0A 4DBWA 1FHLA 2OX1A 3QZAA 3VOGA 2XIBA 1G4PA 5REQA 2X0SA 3LY0A 3ITGA 1Q6GA 2AQVA 1WX0A 4M81A 4YCPA 1MDRA 2HRWA 4BF5A 4KFNA 2XM2A 3DH7A 3AIUA 1GQLA 1IXOA 4NRSA 3NZGA 3UG5A 4ATWA 3W75A 2FLIA 2VT0A 4O15A 8A3HA 1IGSA 1UR4A 1VS1A 1UBPC 4AVFA 3VD7A 4NY2A 5D05A 1OX5A 2GVEA 2CKRA 4X2RA 2DQXA 5H8UA 2OEMA 2NT1A 3G18A 3VNJA 5KTLA 5I02A 3U7BA 4R53A 3WBEA 1E71M 2ZX7A 1YPFA 1HP4A 3NPUA 4OBSA 2NWRA 5JH1A 3GNNA 1PUDA 2PDNA 1A5BA 3W4RA 1V5XA 4F0SA 4AD5A 4MNKA 4JN7A