1V02E

Crystal structure of the sorghum bicolor dhurrinase 1
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
484
structure length
484
Chain Sequence
RLSPWEIPRRDWFPPSFLFGAATSAYQIEGAWNEDGKGPSTWDHFCHNFPEWIVDRSNGDVAADSYHMYAEDVRLLKEMGMDAYRFSISWPRILPKGTLAGGINEKRVEYYNKLIDLLLENGIEPYITIFHWDTPQALVDAYGGFLDERIIKDYTDFAKVCFEKFGKKVKNWLTFNEPETFCSVSYGTGVLAPGRCSPGVSCAVPTGNSLSEPYIVAHNLLRAHAETVDIYNKYHKGADGRIGLALNVFGRVPYTNTFLDQQAQERSMDKCLGWFLEPVVRGDYPFSMRVSARDRVPYFKEKEQEKLVGSYDMIGINYYTSTFSKHIDLSPNNSPVLNTDDAYASQETKGPDGNAIGPPTGNAWINMYPKGLHDILMTMKNKYGNPPMYITENGMGDIDKGDLPKPVALEDHTRLDYIQRHLSVLKQSIDLGADVRGYFAWSLLDNFEWSSGYTERFGIVYVDRENGCERTMKRSARWLQEFNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DHURRINASE
publication title Structural Determinants of Substrate Specificity in Family 1 Beta-Glucosidases: Novel Insights from the Crystal Structure of Sorghum Dhurrinase-1, a Plant Beta-Glucosidase with Strict Specificity, in Complex with its Natural Substrate
pubmed doi rcsb
source organism Sorghum bicolor
molecule tags Hydrolase
total genus 190
structure length 484
sequence length 484
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1v02E00
3AI0A 1J0JA 1N82A 2EPMX 4ATDA 3RDKA 3BCDA 4JCLA 2WW5A 3AIEA 4GI8A 1E43A 2HISA 3B9DA 1FA2A 1V6XA 3FW6A 4AD0A 1UR9A 2WSPA 4J7RA 3CIVA 3SUSA 3CUGA 4EANA 4CCDA 1E15A 2XVNA 3VD9A 3VKKA 3N9KA 2WNWA 1YQ2A 1UR0A 4MB4A 4PSRA 5A69A 4WKHA 2V38A 1E56A 1QPKA 1UA7A 2DQXA 1E6RA 5I3DA 4H8HA 3KL5A 3IK2A 3AQUA 4TTGA 1RPKA 3L2MA 3ARZA 4PMOA 2G4FA 4KH2A 4WJXA 3MUIA 2XSBA 9CGTA 5C70A 5JBEA 4AMCA 4FLSA 4Z2KA 1JYNA 3EYPA 4PTMA 1MVYA 2VR5A 3I3DA 1W3LA 5IXEA 4HPHA 5M03A 1E6QM 2VRQA 2E9LA 4D6HA 2YL5A 1DP0A 1W2PA 4TVUA 1CEOA 2J62A 4JIEA 4AD1A 1JXKA 3AS2A 1MW2A 4J3UA 3FN9A 3AMCA 1TVNA 3EDJA 1U33A 1TVPA 1HL9A 3VDAA 2BV9A 3BMWA 2PB1A 1MQRA 4PMQA 1V0NA 4EK7A 1G9HA 3W4RA 1V6VA 1UYQA 3TTQA 3WH9A 1MFVA 5JIPA 6CGTA 1K9EA 1NP2A 3VU2A 1JYXA 1XYFA 3W81A 4P7RA 4PTWA 1EDGA 5A6JA 1E4MM 3VPLA 2WZHA 4XZWA 2YKKA 3W6LA 1Q6CA 4DUXA 2OLHA 5CXPA 3N1AA 2YDSA 1C7SA 3AIBA 6A3HA 1JD9A 5ECUA 4X0VA 1NWUA 2YA0A 4U31A 1L8NA 3SCOA 3A3HA 3TTOA 1FFQA 2WCAA 2WSKA 4CU7A 2VI0A 3EMZA 3N11A 5GQBA 2XSAA 2Y8VA 1X6LA 2G3MA 2XWDA 1FOBA 2VX5A 1BYCA 4W5UA 4GXPA 3T0DA 3ZT5A 2WMKA 1TCMA 3VD3A 3KZSA 1OBAA 3F5LA 1JYVA 3BXWA 2DSZA 2E8YA 3SCSA 1UH2A 1DWFM 3VD4A 2WMGA 4MJ4A 3FXYA 3AHZA 1KCKA 2OSYA 4UTFA 3WQ8A 3M07A 2AMGA 2CBJA 3QGVA 1B3VA 1E71M 1VIWA 3WUBA 4HU8A 2J47A 5DO8A 1JF5A 3ZT7A 5LA1A 1BLIA 1GHRA 1DTUA 1FHLA 1CTNA 1ZJBA 2YL9A 2G8ZA 3O6AA 1PZ2A 1QNPA 1E0XA 4W88A 4UOZA 4HA4A 1KR1A 1XRVA 3AISA 1E72M 2XVGA 4D6GA 3WNKA 4NSBA 5F7UA 5LA2A 1CXEA 4AD3A 4NRSA 1QNSA 3T09A 4AD4A 1ZS2A 2WANA 2EJ1A 5GNXA 1KB3A 1CZ1A 3WNLA 1VRXA 2GJXA 3WENA 3WNMA 4UFMA 5IFTA 5FCZA 2J7FA 1EOMA 4HOWA 1OT1A 3WUGA 2E0PA 2EBNA 1CGWA 3WNNA 4LGXA 1PZ3A 3GBDA 3PZUA 4OIFA 2ZX6A 4PCSA 1WO2A 1J18A 4H04A 1UH3A 5A6SA 2VZSA 2VRJA 1EDQA 1JFXA 1C7TA 2BHZA 3K8LA 1XHGA 4L4OA 3SUWA 3UG4A 4YHGA 5D9NA 2BS9A 2V5DA 3RJXA 4PUEA 1HX0A 4P7QA 3W82A 3PZIA 3SCRA 2ESCA 1H4PA 1XD1A 3PTQA 2CHNA 3T0BA 2DSUA 2YJQA 2DDXA 2F61A 3BAYA 4IM4A 7TAAA 1NP0A 4C7FA 5EMYA 1PX4A 2VCCA 1GOKA 2XFYA 1FFRA 2Z1KA 1MXDA 3GH7A 3MV01 2WMIB 3WDQA 3ZMRA 4GO9A 3SCNA 4BQ3A 1HJXA 1QNRA 2PWEA 1E6ZA 3SIMA 2XVKA 3HU7A 1E6PA 4A3YA 3WF3A 3T2PA 4JKKA 5D8ZA 1BYDA 5JUVA 1CXHA 3N04A 2YBTA 5A8MA 1NWSA 1E40A 3I3BA 1V3LA 1OWQA 2F8QA 3WBEA 1EHNA 1RP8A 1XSIA 5JBFA 4D6IA 4CCCA 3LMYA 1XCWA 4A3HA 4OZOA 3VIGA 2UWFA 4JHZA 3W24A 3ALGA 4TVDA 2J74A 2A3CA 1R85A 3KEHA 3VIPA 1B31A 2CYGA 1MYRA 2VJXA 3ZO9A 3VIJA 1O6IA 2J7DA 2YA1A 3ARQA 1OGBA 3ZJ6A 2G3IA 2AAAA 2J79A 1Q6GA 3WL0A 3FNDA 4EE9A 4B3KA 1J0YA 1AQMA 4DUWA 3CHFA 3WDJA 4AZ7A 1GOWA 1ISWA 4BZYA 3VD5A 1I75A 1UA3A 4ATWA 4GI9A 1CGTA 1JZ3A 4UFJA 2QF8A 3KE0A 2BFGA 2DT2A 4AIUA 1ITXA 3PTKA 2YL6A 3WH5A 1K9FA 3NSXA 1OINA 1GUVA 4LYQA 2OSWA 1W9BM 2FDMA 4U2ZA 8A3HA 2G41A 4KRUA 3TOPA 1KBBA 3RCNA 1LL4A 1E70M 3WEOA 3A4WA 5ABEA 1UD8A 1PBGA 3THDA 3WY1A 4UOJA 4ZFMA 2VR4A 3MUY1 3BCFA 1QBAA 2Y24A 4JFSA 2WMFA 2VT0A 5BXTA 1E5NA 2B31A 3W0KA 5A8PA 3EDKA 4BQ5A 3TTSA 1E4IA 2OWWA 1JDDA 1KBKA 3MMWA 3K8MA 1VFFA 2A3AA 5I24A 1CGXA 1XCXA 3GBEA 2XHYA 1VBUA 2CXGA 1BTCA 2FHFA 2JIEA 1JZ2A 4LYPA 3U5UA 1CLXA 3ZR5A 1VFOA 1Q6FA 1V6WA 2RGLA 5E9AA 4R27A 4BA0A 4KGLA 4F8XA 3ECQA 1OGGA 2EXOA 1WP6A 3AYSA 1GORA 3SCQA 3CUIA 5ABFA 4D6CA 1FP9A 4NZCA 2WAGA 1HVQA 1HN1A 1IT0A 1E55A 2XUCA 3VMOA 1SYTA 4EAMA 4UQBA 4H8UA 4AZBA 3LPPA 4DWSA 1P6WA 4RE4A 3CHEA 1ZBWA 2ZUMA 3N18A 1UWSA 2DH2A 2PWDA 1V08A 1B0IA 1CGUA 1FH7A 2YDRA 3K1DA 1KGXA 4DM2A 1WPCA 2BY0A 3GNOA 2FH6A 1BVNP 3CBWA 3MO4A 1KR0A 4IPNB 1WDRA 3NIYA 1HJVA 1ISZA 5M5DA 3NDZA 2WXDM 3WFZA 3GDBA 2A3EA 1UD4A 5I23A 3W37A 3WMBA 5E6YA 3NSNA 2FGZA 2IXUA 3HMCA 1DHKA 4W84A 5D4YA 1M7XA 1QHOA 5CG0A 3WMCA 4AYSA 2HVMA 1R86A 2QPUA 1V3HA 1JZ4A 1KWKA 2ZUTA 1JZ7A 4MNJA 1VAHA 1WB0A 2OWXA 4CCEA 4CN1A 1E3ZA 3AS1A 4CU6A 4LPCA 3L4TA 3BAXA 1NH6A 2W92A 3LPOA 2ZX9A 4IISA 1GVIA 4W8BA 2XM2A 2ZUNA 4H7VA 4CD5A 5A8OA 3WELA 5IHRA 1R8LA 4J27A 2JEQA 2ZE0A 4AZHA 2D20A 3GXIA 3D3AA 2PWGA 2WVVA 1E5JA 3AMDA 3T0AA 5LA0A 2VC9A 4ZXLA 5HPOA 4MPKA 1W3KA 1US3A 1UWIA 1HP4A 1UKPA 3RIKA 3VIIA 5FOOA 2JE8A 4TOQA 4ATLA 1W9UA 1CXKA 5ABGA 1D2KA 2DPEA 2GK1A 4PN2A 3A47A 4MB1A 4UQ9A 4AIEA 1R7OA 3PZMA 5I77A 4W7VA 1E1FA 2GFTA 3WF4A 2EO7A 3UEQA 1PEZA 2J25A 3GXFA 2WHLA 2EPKX 2VZUA 4Z2HA 1UG6A 5BWFA 2G3JA 4HMCA 4TX6A 4ACZB 5IFPA 1V6UA 1TA3B 1MW1A 1Q6EA 3IJ7A 4KGJA 2QV4A 3SCTA 4P8UA 4Z2LA 1C91A 1BGAA 4P8XA 4UZUA 1UKSA 4MB3A 1HF6A 4XB3A 2VNCA 1EDTA 3W27A 1QI4A 2PI6A 2CITA 3L4VA 4R5EA 2UY3A 3AROA 7CGTA 1A3HA 4M80A 3AFBA 4U33A 2ZXQA 1HKJA 1M53A 3G6LA 3BH4A 5IDIA 2D23A 3M7SA 5A2BA 2XWEA 1VFMA 3CUHA 4Z2GA 4MADA 4DUVA 3A4AA 3CZJA 2WPGA 4HU0A 1OIFA 1S46A 1G1YA 3AZSA 5A6KA 4W5ZA 1H3GA 2VUYA 4W89A 5LYRA 1DWGM 2DT3A 2V3GA 4MNLA 2WCGA 2XIIA 1ITCA 1CDGA 5EB8A 2Y4SA 4GINA 1QVBA 1LG1A 2J8FA 1K9TA 3TA9A 3UR8A 1XSKA 4CN4A 2GDVA 1PX3A 5CPSA 4AC1X 1KQYA 3ZJ7A 1FH9A 2X0YA 4J3XA 4UOQA 1CNVA 4GZIA 3VGEA 3U5YA 2VVNA 1Q4NX 1J0ZA 2FGLA 1V3KA 4CD6A 1OGSA 1CXIA 1MQQA 4MNMA 3TONA 5AC5A 2DSVA 3AMGA 3II1A 2WLZA 1IZJA 1CLVA 3WFLA 2WB5A 3CZKA 4TTUA 4AZ5A 3PZNA 4QCFA 3VUPA 1EGZA 1RP9A 4E2OA 3RO8A 4Q7NA 5A3HA 4P8VA 1M04A 3F5KA 4BF7A 2C7FA 3AXXA 3NUKA 2WMHA 4AZCB 4J28A 1EQPA 1UWRA 3FY1A 3GH4A 2GJPA 4C7DA 2VZVA 3ARVA 1IV8A 1X6NA 1H11A 3FHQA 1BYBA 3AXHA 5JIWA 3DYPA 5I78A 1ISYA 4PTVA 1EOKA 2CBVA 1GOIA 1QBBA 1CENA 5AC4A 1WKYA 2ZWYA 4DWSC 1VEOA 1LL6A 4AZGA 1GCYA 1KQZA 1DWAM 2CBIA 3L4WA 2YL8A 2VOTA 4WKAA 1CXLA 3S2CA 3WDIA 2CPUA 1DEDA 1QNOA 3ARSA 2CETA 1OIMA 2CNCA 1KGUA 2A3HA 3AMKA 1WDSA 3AIUA 1H0GA 2EQDA 3UG3A 4CD8A 4JKLA 1H49A 4PMUA 3OIHA 2X2YA 4WK9A 3TTYA 3PZOA 5DF0A 5A6MA 1GNXA 3WN6A 4PRWA 4MJ2A 3MSGA 3WL1A 4FLRA 4CD7A 1CBGA 3K4DA 2WZEA 2WVUA 1F4AA 3WDRA 4RE3A 3WSUA 3UCQA 2E9BA 1MFUA 5A1AA 4H2CA 3AS0A 2XM1A 3POHA 1AQHA 3VTRA 3U7VA 3CPUA 1UD2A 4KMQA 4J3SA 2C0HA 1GJUA 2J8GA 3W26A 3LPGA 2Y5EA 4PCTA 2VX6A 1V3JA 4UCFA 4HPGA 1XH1A 4HOZA 4XUYA 1OD0A 1WE5A 4EKJA 3GNPA 2ZUWA 3WQ6A 1W1TA 1UHVA 3CTTA 3MS8A 2GDUA 1BYAA 3RILA 4UQCA 1C8XA 3HN3A 4PMYA 4Q22A 4WIWA 1LG2A 3E1F1 2J77A 4UFIA 3U57A 1ZB5A 4OUEA 2W66A 3RJYA 1B90A 1CGYA 2BHYA 4F9JA 3OB8A 4PMXA 5A6AA 4MNKA 1BSIA 1J0KA 3VDCA 4W93A 1QW9A 4U2YA 1J0IA 3VM7A 3AIQA 5KZ6A 5E6ZA 4PMVA 4P7LA 2WM0A 1LLOA 1XV8A 5BRPA 1H09A 1QHZA 2X0HA 2XFRA 1TUXA 3ZJ8A 2YA2A 1AQ0A 3PN8A 3QHNA 4LYRA 4P7NA 3WUEA 3D5HA 2VL4A 4OKDA 2J7BA 3VD7A 5JBDA 3RMEA 4OOZA 1KFWA 4Y7EA 1BAGA 4B9ZA 2DH3A 3DECA 4NF7A 1JI2A 4ACYA 3AXIA 3SCUA 2WYSA 5M3WA 1GJWA 3CHCA 1CPUA 1D7FA 4D6DA 3W29A 1HJWA 5TD4A 1UWTA 3OZOA 2CKSA 2PWFA 2GUYA 3VGDA 3W38A 2ZWZA 3BAIA 2WVTA 4UFHA 1ZBKA 4V28A 5CLWA 4YPJA 4M24A 4P8WA 2JALA 2ZX7A 5BROA 2V3DA 1SMDA 1G5AA 4AISA 5DFAA 5A6BA 1J10A 1UD6A 4TX8A 2NT1A 4IUGA 1QHPA 1OB0A 1VJZA 1W9XA 5ABHA 1XYZA 1J12A 3CZLA 4BS0A 1JGIA 1LL7A 3IAQA 4QLKA 5I6SA 3ARXA 1W9VA 2GJXB 3EMQA 4WLCA 5HPCA 1EIBA 5GNYA 4URIA 1W9DM 1HKIA 1NARA 4D1JA 4QDMA 1JZ5A 2MANA 2UY2A 5I5RA 3L4XA 1FH8A 1WZLA 2E4TA 3MV11 3OZPA 4W85A 1W3HA 2YIHA 1TG7A 2NT0A 2BY2A 3WDPP 2DSWA 4PMDA 1E4NA 4M81A 3VIOA 2V5CA 4M29A 3VIKA 4AZ6A 3ZSTA 3UERA 1HP5A 4M82A 1QW8A 1JNEA 2O92A 1KCLA 3UG5A 1V02E 3PZ9A 4PYSA 3VGGA 5FL0A 5HNNA 2Z1SA 2WKGA 3VOCA 2VX7A 3GNRA 4U5IA 1LWJA 3BMVA 2IUZA 4MDPA 2EPNA 2O9PA 3VNZA 4NRRA 2WHJA 2UY4A 2VMFA 2E8ZA 3VDBA 4CN6A 3O9NA 5EBAA 3WQWA 1UD5A 1HKKA 1UKOA 1PAMA 4GPNA 1JYWA 2J7CA 4AXNA 4PUDA 1UWQA 1TE1A 2ZUSA 4HA3A 1JAKA 3N17A 1C8YA 3FAWA 1GOQA 1UR4A 1VEMA 2PWHA 5C71A 2D24A 2WMJA 2WVSA 4OBRA 2XPKA 3SCPA 1AMYA 2W4XA 5FIPA 3SCWA 1M03A 2DIJA 2O9TA 2V3EA 1KXTA 3WIJA 2WCSA 2WC4A 4W86A 3AYRA 5D9MA 5HDRA 1E0VA 1EA9C 1VBRA 2W63A 3WQVA 1J11A 5CQ1A 4WSJA 1VFUA 1UR1A 4F9DA 1JZ6A 3GXDA 5A2CA 1G0CA 1LWHA 1JIBA 2EPOA 4L4PA 1E4LA 4CVWA 1KXVA 4N0RA 1TMQA 3EDEA 4AEEA 4NI3A 3CZGA 1ODUA 2WWCA 3FAXA 3VGHA 4ZENA 1E6NA 4D71A 6TAAA 4V27A 3VX1A 5DT7A 1E73M 4ZE4A 3W6MA 5CGTA 4JAWA 3VMNA 3IJ9A 2CIPA 3GXMA 2NSXA 1V6YA 3AHTA 1PPIA 3MMDA 4S3JA 1LF1A 3CGTA 3VO0A 1W1VA 2XVLA 4HZ6A 3MU7A 4XX6A 2ZXBA 1NWRA 3WMSA 3NDYA 4UQEA 3OA5A 4F79A 1QI5A 4HMEA 4OOUA 3WD3A 1B3ZA 1JXJA 2WC3A 1I1WA 3TP4A 3WQ5A 4PMZA 3BAWA 5FD0A 3VGBA 2CBUA 1R7AA 2XYLA 4GKLA 3WBAA 2CESA 5M17A 3BC9A 1MW3A 3L4YA 3ZIZA 1PIFA 1RH9A 3OLEA 1W32A 3CZ8A 2PF0A 1WNOA 4RL3A 5DT5A 3WEMA 3UESA 1FP8A 3WF0A 1OM0A 2VX4A 2W5FA 3RPMA 3JUGA 2C8NA 1G01A 2J7EA 4MAZA 1VENA 1ZU8A 3AIRA 1TFVA 4GQRA 4F66A 1XH2A 2CCRA 4S3KA 5C8BB 1MW0A 3J7HA 2XVPA 3MMUA 4U3AA 3WH7A 5CPTA 2QMJA 5A8NA 4J3WA 3PZVA 3AHXA 2BXZA 3SCVA 5CJ5A 1VJSA 4QFUA 1ODZA 2X05A 1H1NA 5KEZA 1R87A 1UD3A 4N42A 1K9DA 3N12A 4W87A 4CGTA 4E8DA 1QI2A 1W3JA 1PX8A 1GQKA 1FHDA 2JEPA 2W91A 4DM1A 1WZMA 1I1XA 1DWJM 1UOKA 1BQCA 4GIAA 1MQPA 4BCEA 2JF7A 5I2UA 1V0MA 5A94A 3WUFA 4J3TA 3VM5A 1UQZA 2XGBA 1BPLB 1Q6DA 2OYMA 4JFUA 1UUQA 2WK2A 3CLWA 3PBGA 1H2JA 4V2XA 4PSPA 5ABFB 1JF6A 4J3VA 2BVYA 4W8AA 3M46A 1OSEA 2E40A 3AHVA 4JFTA 3OLIA 3VILA 1EXPA 4DWSB 5D9PA 1HJSA 1BF2A 2JFEX 2XGIA 3KL3A 1NWTA 1WZAA 3EDFA 4MDOA 3WF2A 4X0NA 2QMKA 3WH8A 3VMPA 2J7HA 3QHOA 5A2AA 1JDAA 2YLAA 3AJ7A 2BY1A 3PTMA 3VVGA 4U3CA 2BXYA 2VZOA 1UKTA 3NYDA 3AMLA 2XIBA 2D0GA 4HMDA 2YLLA 1OD8A 2WMIA 1J01A 2FHBA 1EQCA 3T2OA 4JHOA 3ZQ9A 3WH6A 2F2HA 1MXGA 1CIUA 3IANA 3L4ZA 2V3FA 3W53A 3MANA 1QI3A 1GW1A 3W28A 3OGSA 1SR0A 3AICA 1QOXA 1DWHM 1K6AA 1D3CA 4KWUA 1U2YA 5CLTA 1HT6A 1GQIA 2EPLX 2BY3A 1UR8A 2VO5A 1W2VA 2JF6A 1UZ1A 4YN5A 5AYBA 1WDQA 3CH9A 3NSMA 3RM9A 1LJYA 1V3IA 1M01A 4CVUA 4Z2IA 4JFWA 1JZ8A 1NQ6A 2GJRA 3OGVA 5HOSA 5D9OA 2VURA 2WVVB 2VCAA 4QLLA 5AYIA 3SUUA 4GZJA 5CGMA 2ZIDA 1KWGA 4A4AA 3OG2A 2BHUA 3ZT6A 3ZJKA 2WLYA 5E0CA 3K4AA 1EHAA 1HJUA 1C90A 4MTVA 3MKKA 1CECA 5A8QA 4D6EA 2GK1B 3GYCA 1UKQA 1W9PA 1H41A 1VB9A 3WQ4A 4D6FA 2O9RA 2DIEA 4GO8A 3VNYA 4B3LA 1WCGA 3MUAA 1C3FA 2JIWA 5E0FA 3PZGA 2BVDA 3ARWA 4W7UA 3MSDA 4ZEPA 3KWXA 4UR9A 3CUFA 3VDHA 4AEFA 4BQ4A 1PJ9A 1X1NA 4C7GA 1QI0A 2ZICA 4LX4A 1E6XM 3I3EA 2CKRA 3CZEA 4HZ7A 3WD2A 2ZX5A 2DT1A 3ZM8A 4MAVA 1UWUA 1JNDA 2BVTA 4WSKA 4PMRA 3VIFA 3SUTA 2DGAA 3RM4A 3RM8A 4P7OA 3APGA 3SURA 2D3LA 4CU8A 2Y8KA 5CSYA 3WF1A 3ZR6A 4PBGA 2W61A 5D8WA 1GHSA 2DT0A 3OBAA 2PC8A 5CPQA 2WZIA 5FKYA 1ZBVA 1VEPA 1V02A 1B3XA 4B16A 1BG9A 3BLKA 4JFVA 3WKZA 1HJQA 2PBOA 4HOXA 5BCAA 1A47A 4AD5A 1ECEA 4W8LA 4HA1A 3FHAA 1C92A 5DMYA 1HIZA 1XSJA 1UZ4A 1F4HA 2D0FA 4PTXA 3VGFA 2ZX8A 4AZIA 5GPRA 1US2A 4LQ1A 1Z32X 3CUJA 3ARRA 1KXHA 2IXVA 2CEQA 1B3YA 1PIGA 4UFKA 2W67A 3PZTA 1XD0A 1XC6A 3DHUA 2D2OA 4FMVA 4X9YA 4TUFA 1ZBCA 4FF5A 4UQDA 1E6SM 3DHPA 1GQJA 3AIVA 2VRKA 3AS3A 3DYMA 2UY5A 5CSUA 3WNPA 3IJ8A 4AY1A 4AIOA 3BSHA 1NOUA 3OLDA 2DSKA 4BQ2A 1JFHA 3AOFA 1KGWA 5HBFA 3EBVA 1HL8A 2ZUUA 2BNJA 2D22A 2QPSA 3N15A 3GH5A 2J4GA 1HNYA 3N13A 1CXFA 3GZAA 5FL1A 2EEXA 1GONA 4HTYA 3PZQA 1GVYA 2NW0A 4CKQA 1GOMA 2YOCA 3CMJA 4FLOA 1WAWA 2VCBA 3T2QA 2G3NA 5AY7A 3WEZA 1J9YA 3OGRA 4M8UA 4TVCA 3G6MA 1RD6A 4QAWA 3MUZ1 1OT2A 4PMNA 1NOFA 4H41A 3A6OA 3POCA 1ZL1A 3M6DA 3F4VA 4ML4A 1JI1A 2WKLA 4HZ8A 3QR3A 3ARTA 1XGZA 1WDPA 3THCA 4CUCA 3BAKA 1GOOA 1YHTA 2VQUA 1E1EA 3PHAA 4JZ5A 4E4PA 4OBSA 1BHGA 2ZXAA 5A6LA 1ISVA 3CO4A 1CWYA 4YHEA 1OCQA 1IZKA 1MWOA 2D3NA 2J7GA 1GZJA 1JL8A 3VIHA 3GTNA 1W1PA 4E8CA 3VX0A 2DEPA 3UETA 2J78A 1ESWA 3B8SA 1UH4A 2OSXA 1EO5A 2QLYA 1B1YA 2E3ZA 4K68A 3IAPA 2XTKA 2OYKA 4D6JA 2RGMA 3WD1A 2VVSA 2W62A 4Z2JA 4UQAA 1B9ZA 3GM8A 4QLJA 3BGAA 3BSGA 1H0IA 2QHAA 4LXFA 2WHKA 1U30A 4JL2A 1JDCA 3AZTA 2TAAA 4QCEA 5EFDA 5CZKA 2X8RA 4TXEA 5A95A 1GQLA 3VINA 4IPLA 3ZSSA 5BXRA 1C93A 3OLGA 2Q8XA 3NJ3A 4W7WA 4ACZA 3ARYA 2XJ7A 3QHMA 1LQ0A 1TA3A 1VF8A 3EDDA 5E09A 3B9AA 1SMAA 1NM9A 5BYWA 5A6BD 1E3XA 5GNZA 3NCOA 2WBGA 1JG9A 3BAJA 1C8QA 3CHDA 2X09A 4UNIA 4ZXOA 3AHYA 1HKMA 3U7BA 1CYGA 3WNOA 1BFNA 1V03A 5BRQA 1TZ7A 4MB5A 3VIMA 1EH9A 1ISXA 2FH8A 1BVZA 2WC7A 4CD4A 5EFFA 2CERA 3DYOA 4FLQA 4AWEA 3ALFA 2D1ZA 3O2LA 8CGTA 3SUVA 4FK9A 3LPFA 2X1IA 1B30A 4D1IA 1DWIM 2AOSA 5E70A 4PEEA 2GVYA 7A3HA 1EO7A 3ZOAA 2Y2WA 4B9YA 3UR7A 5IHSA 4AW7A 3DC0A 1E9LA 1QNQA 2VZTA 4WKFA 4B15A 3BLPX 1BG4A 3K46A 1UR2A 3WD0A 3QOMA 5BXSA 1B2YA 4H8VA 1G94A 2WHMA 2FHCA 3SEPA 2CHOA 3CMGA 4JL1A 4XZBA 3ARPA 1WZKA 3WDHA 2YDQA 4RE2A 2WWDA 1JD7A 5BXPA 4UZSA 2XG9A 4M1RA 4U5KA 5DEZA 1JAEA 3L2LA 3K8KA 2GSJA 1CGVA 2VTFA 4JCMA 3L4UA 5I0DA 3WD4A 1HVXA 4GI6A 4QP0A 4HP5A 4UFLA 2ZXDA 3EMCA 1BGGA 2E9MA 2J75A 1NOWA 4ZE5A 1V3MA 4D72A 4DWSD 3S6TA 4KRTA 1V0LA 2A3BA 2O9OA 3KL0A 4JKMA 3HJEA 3W25A 1V0KA 2XFFA 4XV0A 2YBUA 1W91A 1AVAA 1ZJAA 2WBKA 4GQQA 3AIWA 2VQTA 3A4XA 3AZRA 1B3WA 1UQYA 1XH0A 1TR1A 3ARUA 2ZUVA 3QOKA 4GZEA 4AD2A 1Y7VA 1O7AA 1KXQA 1GPFA 5I79A 4AZCA 1H5VA 2OYLA 1J0HA 1E0WA 3T08A 1L0PA 4M56A 1SFSA 3B9EA 2PBGA 4OJYA 3F5JA 2OWCA 1W1YA 5HXMA 2D0HA 1HXJA 2ZOXA 4WF7A
chains in the Genus database with same CATH superfamily
3AALA 1JCNA 1SO4A 3BZGA 4NJHA 3G1XA 4RZ5A 3QYSA 2QUUA 3AIEA 4DAIA 4B2DA 1Q13A 4MUPA 2WSPA 3CAKA 1M7JA 4HYVA 3UJ2A 2VOMA 3OTRA 1R2TA 2IW0A 2NQ9A 3EA3A 1UR0A 2V38A 3OVQA 1TUFA 3A21A 1KV8A 2DQXA 1E6RA 1DJZA 3IK2A 1FXQA 3AQUA 1R6WA 1RPKA 3SADA 2OGJA 4PB4A 2I14A 1VPQA 3C0LA 1SJCA 2G4FA 4KH2A 4L80A 5C70A 3ZXWA 2JK2A 5JBEA 4PUUA 2PDUA 4DJDA 1MVYA 2Y88A 7XIMA 1IF2A 1YYAA 1K4GA 2Y7GA 4TVUA 2J62A 4AD1A 2G96A 3PUOA 1HL9A 2BV9A 4MYXA 4D8ZA 3SRHA 2PB1A 3BO9A 4JNYA 4C1NA 1Y0EA 1XL9A 4AC7C 4PMQA 4C6PA 3W4RA 4E38A 4JOMA 4LALA 3RAOA 5AHLA 5FEPA 3VU2A 4JIHA 4NYYA 4P7RA 3IV3A 3VOGA 2PDHA 4EWND 4IP7A 3SI9A 4JY8A 5FJUA 4H4IA 4NHVA 3BURA 3VKAA 1Q6CA 3V4BA 3KUMA 2OLHA 3W76A 1C7SA 3AIBA 1VHNA 2HRWA 3SCOA 4U31A 1L8NA 4CNTA 3LXCA 3NQAA 1X1OA 1XKYA 4RXFA 4LV9A 5GQBA 1XRTA 2XSAA 3T40A 1VYRA 3C5QA 4GXPA 3T0DA 4XSLA 1JPMA 3A5VA 3M5VA 2XDFA 4G7EB 4Y9NA 3VD3A 3KZSA 3NNTA 5LIKX 2P1FA 4TMCA 1UH2A 1YTDA 1RLCL 2J9YA 3FXYA 4K2SA 1KCKA 4XD5A 5HWNA 2VDIA 1F76A 2WZMA 3NO1A 1EX1A 1EF3A 5I03A 3GKAA 3DERA 5CBIA 1E71M 1VIWA 4JTCA 1BLIA 3N73A 4JGDA 1CTNA 2PDCA 1L2UA 1PZ2A 1QNPA 4W88A 3LM7A 2VFEA 3IWPA 3MCOA 1QNSA 1S5TA 1MZRA 2DZVA 2WANA 2EJ1A 1KB3A 1RQBA 4Y9AA 3S47A 3CQIA 1EYWA 3TWAA 3NQBA 2OB3A 2R1PA 1C9DA 2DZAA 4ORIA 2YBVA 1EOMA 3U9IA 4HOWA 1FWRA 1OT1A 4XZMX 2QYGA 3WUGA 2EBNA 3GR4A 1PZ3A 3GBDA 3LCFA 1KBLA 5TBOA 1WO2A 3A3XA 4H04A 5A6SA 2VZSA 3GG1A 4HNTA 1WUEA 4O1CA 2BHZA 1XHGA 5DCBA 3OOQA 1TV7A 1R2RA 2PDLA 2Y62A 1M7OA 3H7RA 3BGJA 3PZIA 1H4PA 5FSEC 4YVXA 3C2YA 1OG0A 3N4AA 4EXBA 3MI6A 2F61A 2HPMA 4C1NB 5EMYA 3KTSA 3KBVA 4CNOA 3DKJA 5C9UA 1MXDA 3GH7A 2DVTA 3MV01 4HK7A 2Z6IA 2CZEA 3ZMRA 3APYA 1VD6A 1XLBA 2HS6A 3I4EA 1QNRA 2PWEA 3H4WA 3L66A 2QCNA 4FSAA 1E6ZA 3KDNA 2XVKA 3HU7A 3W7DA 4IG2A 2I16A 1AW2A 1W5PA 2Z6JA 4MGGA 3BQ5A 3DAQA 1TREA 3CEUA 2VELA 3H2MA 4RCXA 5D8ZA 1BYDA 5JUVA 3N04A 3L0GA 1RP8A 3R43A 1LUCA 4D6IA 4Y9OA 4CCCA 3LMYA 2JGQA 2UWFA 3TAKA 2J74A 3VIPA 1B31A 3LENA 3ZO9A 3IIOA 4Z1AA 1O6IA 4M1BA 1OGBA 3URQA 2G3IA 2J27A 3WQGA 4EE9A 4B3KA 3NQVA 3GK0A 4Z0JA 4K3ZA 2ZZ6A 5CC7A 1FBAA 4WJEA 1YXDA 1PCKA 3W00A 3H6OA 4QBXA 4XD6A 1QOQA 1QAPA 1CGTA 3EPOA 2XGZA 4AIUA 3WFAA 3KCJA 1ITXA 1IGWA 3VKJA 3GDLA 5HQMA 3I6RA 3NSXA 3CPGA 4XO7A 2OLAA 3MKVA 3QMSA 2W27A 2FDMA 4U2ZA 3LNMA 2HS8A 5BOOA 3TOPA 1P7TB 2WKJA 1KBBA 2A4AA 5AVHA 1PXGA 5I3KA 4AH7A 1WAUA 4UR7A 1M1BA 3BSMA 3WY1A 4ZFMA 4GBUA 4XD3A 3ES7A 2NWSA 2I9EA 3KAOA 1E5NA 1K1DA 4HHMA 4O1FA 3R79A 4TIMA 1KA9F 5K9CA 1JDDA 3UR2A 1J6OA 2HMCA 1ZP3A 4L56A 3SSJA 3OVGA 4GY0A 2A3AA 1C8VA 1XCXA 4KCVA 1Q6OA 1VBUA 3L68A 1UCWA 2G97A 2CXGA 3S2MA 1XFBA 2JIEA 3STPA 2PWUA 5FF3A 3URAA 2FJKA 1V6WA 3UNTA 4IGHA 1XLAA 4ERAA 1KM4A 4LAUA 2NV2A 2FIQA 3SCQA 4GMEA 4LF2A 1K8ZA 4WUIA 3ABRA 5K4ZA 2PDPA 5FA5A 1TX2A 1HVQA 1FWFC 3LHVA 3KVJA 4XKMA 1SYTA 4QQUA 1NELA 4UQBA 5BZAA 1LOLA 4MJZA 3MKCA 1EJTC 1PHWA 2PRLA 5AC8A 4LS2A 2ZUMA 1UWSA 2DH2A 2PWDA 4DBWA 3G3DA 1V08A 1FH7A 3K1DA 2V30A 1ICQA 3HPAA 4US5A 3LCHA 5FESA 4RNHA 5XIMA 2VFDA 1KTNA 1RBLA 1I4NA 4GIEA 2FH6A 1VPYA 3IJQA 4IPNB 1KR0A 5HUPA 3PBUA 4QG8A 1B5TA 1ICSA 1QPNA 5J5RA 1QCWA 1HJVA 3F7JA 3UWUA 4Q33A 2WXDM 1FDJA 5I23A 3NZGA 3W37A 3WMBA 2G5WA 2ZC1A 2FGZA 2IXUA 4O52A 4L6OA 4K37A 2RFGA 1M7XA 5CG0A 1U5HA 1XQLA 3UFYA 4ALDA 4ZFCA 1PKNA 3THAA 2Z28A 3ZR4A 1NF7A 1KWKA 1JJKA 2HCVA 3OO2A 5TQLA 1EKOA 2ZUTA 4MNJA 1VAHA 3STEA 2OWXA 4CCEA 3AS1A 5HJXA 3L4TA 3W71A 1RLDA 3LPOA 4W8BA 2XM2A 3SAZA 2PLMA 4FI4A 5REQB 4LVDA 4J27A 4C1LA 1FTXA 3WLHA 4AZHA 3VKCA 2CLKA 4ZVJA 2C0AA 1GVFA 4ZXLA 3B03A 5FF4A 1US3A 1L6YA 5D37A 3MWAA 3VIIA 2JE8A 4ATLA 1YPXA 3A24A 4PN2A 4MB1A 4UQ9A 3N2XA 1E1FA 5CC3A 4HNUA 3CAVA 3WF4A 2EO7A 2J25A 1IZCA 1EC8A 1RJQA 4NJGA 1SGJA 5BWFA 3I10A 4TX6A 1V6UA 2PDMA 1TA3B 4X2RA 5LNRA 3PVFA 1ECQA 1G6CA 3T07A 5DQPA 3IUHA 1O1HA 4F4RA 2Z27A 4L1XA 1C91A 1BGAA 4MB3A 1HF6A 4XB3A 1QI4A 2PI6A 2CITA 3TH6A 3L4VA 1K77A 2FZ9A 1VQTA 3LS9A 5CSRA 1Q3NA 1A3HA 4M80A 3VCCA 3AFBA 2PDXA 5D03A 5IDIA 3NURA 3CJPA 2BDQA 3SW6A 1EXBA 2A79A 1XS2A 1S46A 1RXOB 3GHRA 5TIMA 4W5ZA 4B2DD 2OLSA 1JULA 2CZ5A 1ZUAX 3UVIA 5D02A 3LV5A 1SZEA 1ZTVA 1A53A 3A9BA 2E67A 1K9TA 2WOQA 3A9IA 4CN4A 2GDVA 1PX3A 5K2ZA 1OC7A 5ABTA 3R89A 1WV2A 1DQUA 4C60A 4RW5A 5LNWA 2DUXA 3H2EA 4ECLA 3RNDA 9XIAA 1OGSA 4Q4PA 1CXIA 4LYKA 4MNMA 1MMFA 2OQYA 3ELFA 4XTIA 2V69A 1IZJA 4NNAA 1CLVA 4TTUA 2GGIA 1UR3M 3LDVA 5GJMA 1A5KC 4QCFA 4GY7A 3EB2A 2NWRA 1EGZA 4PRRA 3XINA 3RO8A 1X97A 4QJ5B 4CNUA 3P61A 4NUWA 4HNNA 3AXXA 4DBUA 1NF0A 3TNBA 4FAMA 3G1SA 1FWIC 3BDKA 3AXHA 5I78A 1BXNA 4S23A 3ID7A 1WDWA 2NQHA 2ZWYA 4Q6XA 2PDGA 3C2FA 1LL6A 4H9ZA 1GCYA 1UZDA 5IRPA 1V5XA 3L4WA 2YL8A 3L2IA 1CXLA 2CPUA 3NXFA 1QASA 4LUIA 2GL5A 2P53A 4PL2A 4H9YA 1OIMA 3Q94A 3WLMA 1KGUA 2A3HA 2EQDA 1HW6A 3QFEA 4ZOEA 2VKZG 4PMUA 1Q66A 4WDUA 4ADTA 1ONEA 4G7FA 1R46A 3QY8A 1F3TA 3EKZA 4PRWA 2ZRYA 4OU1A 4MJ2A 1NAL1 2VFFA 2GGHA 4O8AA 1CBGA 3B0VC 2WZEA 4JTJA 5HA7A 3GZ3A 2PTZA 5D09A 2GWGA 5CZ0A 4C90A 3EX1A 4LB3A 4I5UA 5FEZA 4B5VA 3FEQA 3AS0A 3LHUA 2Q8ZA 2EF9A 4KMQA 4PMJA 1X96A 9RUBA 2F38A 2OZ0A 4JR5A 1X8FA 3F4DA 3V5CA 1O4UA 1KM0A 4OVXA 4JQ2A 4HPGA 1V93A 3NWRA 1OD0A 1XLGA 1PKYA 1O1ZA 3O0FA 3USZA 3B06A 1W1TA 5ENLA 1AK5A 2GDUA 1P0KA 2ACQA 2NUWA 3R8RA 2FPYA 4H9UA 3QV6A 1O95A 4PMYA 3WJZA 5LHEA 4GKTA 1LG2A 5AB3A 3E1F1 4I9MA 4ZA0A 4OUEA 4O13A 1B90A 2BHYA 3WLJA 3WQDA 5A6AA 4MNKA 1OJXA 3VZZA 1J0KA 1S2TA 3N6JA 3VDCA 1QW9A 4U2YA 1SO3A 1J0IA 1XLDA 3QN3A 1UJPA 5TAOA 4Q4OA 1XPYA 5BRPA 1H09A 2FJUB 1TUXA 1AQ0A 1R38A 3DXIA 4QXIA 5DELA 3WUEA 3ABOA 5D2WA 2VL4A 3VD7A 3RK8A 1TPC1 4OOZA 1ZRQA 4HJFA 1KFWA 4GX9A 4Y7EA 1XJBA 4UTUA 3I68A 1M7PA 4HU3A 2CXEA 3P74A 4WGHA 1FWAC 4LS0A 3AXIA 5M3WA 1YXCA 3PUEA 2D69A 3L7RA 1E9IA 4D6DA 1XFCA 1UWTA 3BAIA 2FZDA 1ZBKA 3G3MA 3P0XA 4V28A 4H6EA 4M24A 2HE5A 2YB1A 5E5CA 4AISA 1UD6A 4TX8A 2NT1A 2YR1A 1Q4WA 4YXGA 4IIGA 4FHAA 4PB3A 4IIBA 1R9XA 3K1GA 3N2BA 1H5YA 1OX4A 5I6SA 4L65A 4PGLA 4C6CA 4A05A 3LY0A 4M6PA 4KEVA 1EIBA 2VFGA 1W9DM 3NL3A 1HKIA 1YE4A 1JZ5A 4G56A 3DBNA 5AFDA 4HCDA 2PPGA 2KZHA 4OFCA 2IKHA 3M41A 4KEZA 3AYVA 3HG5A 1EJXC 1E4NA 5HMSA 3VIOA 5KZDA 4AZ6A 2VEPA 4MY8A 2O92A 4LV4A 1V02E 2J9ZA 4QEEA 4REQA 3SN0A 4U5IA 1LWJA 3TMLA 3B9OA 4JNMA 1UP2A 3DENA 2O9PA 3VNZA 3KVMA 2P8BA 3WQWA 1HKKA 3MW7A 1UKOA 2J7CA 1F6YA 4AXNA 1YBQA 3MDUA 4PUDA 1UWQA 3LOTA 3U3HA 2VUNA 3ITXA 2WVSA 1ADOA 4OBRA 4UWMA 3SCPA 3W87A 4GFIA 5FEWA 4HD5A 1AFSA 4XKYA 4KERA 3MVIA 1DJIA 4NL1A 1T8XA 1XUUA 2WCSA 3UYCA 2WC4A 2YFNA 3LCLA 3S5YA 4AU0A 1ZENA 3CL8A 3ES8A 4A22A 5CQ1A 2WSRA 1GQNA 4BWLC 3VCNA 2VD9A 2OPJA 3GXDA 4LSBA 5A2CA 4CVWA 1TMQA 4FZIA 5HMDA 4E3VA 3KTCA 1UPPA 1XBYA 4NI3A 1H61A 3IVTA 4ZENA 3S8HA 6TAAA 3UZ5A 3W6MA 2QJGA 4AXKA 3M64A 5I7GA 1UPMB 8XIMA 1A3XA 3VNIA 1V6YA 3N29A 1IQ8A 3W88A 1KKOA 1PS9A 2Y5JA 4HZ6A 4O1EA 3HURA 3S1GA 5I06A 1QI5A 4R88A 1B3ZA 3GRIA 3VCRA 3SBFA 5AZ1A 3G0UA 3K2GA 1IXOA 1HL2A 2I56A 3QQ0A 1OF6A 4LEFA 4Q4QA 4J5NA 1OQFA 1V8EA 2CESA 1UUOA 5M17A 4US5D 4H6KA 4HPNA 4DYEA 1OK4A 1EPXA 1XG4A 1PIFA 3CT2A 4ZGYA 3TC7A 2OOFA 2PF0A 3CV2A 4RL3A 5DT5A 1FP8A 1SUXA 1U1JA 3RPMA 3ABXA 3JUGA 1G01A 4MAZA 3BLFA 3GAKA 3OVPA 2ATSA 4F66A 2CCRA 4S3KA 1SQ7A 3J7HA 3TFXA 2XVPA 4WOZA 4U3AA 1THFD 1P0EA 2QMJA 2REQB 5A8NA 2QJIA 4JTRA 2HJPA 3AHXA 4DLFA 5XINA 2RUSA 2D73A 4QFUA 1EC9A 1N8IA 3GDRA 3VYLA 3N12A 1OHLA 1W3JA 1Y5WA 2ZFAA 2JEPA 2Z24A 4JD4A 3FX4A 1DWJM 1XINA 1BKSA 5I2UA 3ITGA 1V0MA 1YDYA 4IX2A 3AJXA 3QTGA 5T9BG 1YBQB 3KRSA 3T05A 4NJKA 1ME8A 2W0UA 4ROQA 1E0TA 4PSPA 4J3VA 3SFKA 1WQ5A 2V67A 3NQFA 2EGZA 3CQHA 1EXPA 4MY1A 3HGSA 5G1YA 1EJSC 1BF2A 4DXVA 4O1BA 1WZAA 3BL3A 3MZ2A 4NZ1A 1KFEA 1I0BA 4V33A 3VMPA 1Q45A 4UTIA 4RNJA 1JDAA 3C0QA 2CW6A 5G2WA 2F6UA 2YDAA 1UKTA 1XIHA 2D0GA 1YEYA 1EQCA 3ONCA 4ZO6A 2FVLA 3T0TA 1CIUA 4NYUA 3L4ZA 2V3FA 2V2DA 3A4JA 2ZZ3A 1QO2A 1SR0A 4XQ6A 3IUIA 4IP4A 5CLTA 3NPVA 3H2OA 4HYRA 1M6JA 2BY3A 4Q8OA 1GVOA 1IWAA 3B8UA 1W2VA 1VH7A 1EBGA 3MO7A 4UMBA 5AYBA 4LVAA 1M01A 1XGEA 4I90A 3P62A 4F2BA 1A4MA 4N9CA 5D9OA 2OVLA 4B90A 3B4UA 3MI3A 3HFYA 1N55A 1RSCA 2DZTA 3PUDA 1BWKA 3K4AA 1EHAA 1HJUA 1XR2A 4MTVA 4XAPA 2V0TA 3PF3A 3GYCA 4J2MA 4D6FA 4R7WA 2IKGA 4AWTA 4B3LA 3MUAA 1C3FA 3PZGA 3UQNA 3R11A 3W6YA 4W7UA 3TZNA 4Y8FA 2CLIA 3MSDA 1RVKA 4UR9A 2ZTKA 1A5MC 4BQ4A 3DI0A 1A49A 1UC4A 1X1NA 4C7GA 4HZ7A 2QCLA 2DT1A 1K8CA 4HNVA 5CCZA 5FAJA 4MAVA 3NVTA 2A6NA 2BVTA 4WSKA 3SUTA 1XBZA 3RM8A 3APGA 2F7FA 3SURA 3WF1A 2DT0A 3HMJG 1ZCOA 2O7SA 1EGMA 1B57A 3CASA 5CPQA 3SECA 1W1B1 1TWSA 2VR2A 1WBHA 1B3XA 1QPOA 3V0TA 1HJQA 4HOXA 5H8PA 1YNQA 5BCAA 1IXQA 1FXPA 4LUSA 2R1MA 4GC4A 3N2CA 3FHAA 3P7YA 3CV1A 4KIRA 2TODA 2UV8G 3QZEA 1DXIA 1H1ZA 4BEUA 4AZIA 5GPRA 4LQ1A 1LM1A 1Z32X 3CUJA 2OX4A 1LRTA 4IMCA 1N7KA 4YCPA 5D30A 1ENUA 2D2OA 2ZRWA 4X9YA 3GIQA 4TUFA 4UQDA 3E0VA 3NYZA 1R3SA 5CBJA 4GXWA 1GQJA 1SZNA 2VRKA 2E68A 4LC6A 3DYMA 2UY5A 4CEXC 3WNPA 3IJ8A 1AZ1A 1NOUA 1FX6A 3G2GA 5FJJA 2YCLB 1JFHA 2VYOA 4NAFA 1HL8A 4ZOAA 2BNJA 2D22A 4HPXA 3QRHA 2A3LA 2X7WA 3DGBA 3GH5A 5I07A 2PU0A 2HZGA 1GZ1A 1RK6A 3BLDA 3G77A 5JH1A 4HTYA 3PZQA 1GVYA 1WAWA 2VCBA 4LBRA 5AY7A 3WEZA 1J9YA 1WKEA 3UWVA 3MUZ1 1OT2A 1QK2A 1XIFA 1EUAA 2QAFA 3F4VA 4E6MA 3PSWA 1JI1A 1EZWA 2AGKA 1PKLA 4MWAA 3LXAA 1GOOA 4INFA 5K9DA 1YHTA 5HK4A 4JZ5A 2VQUA 1E1EA 3C4UA 4C65A 5CZTA 3CWHA 3NXLA 4QJ4B 5A6LA 1EJVC 1CWYA 4YHEA 2IKJA 2D3NA 4ZB2A 2EAWA 3KLLA 3Q45A 1KFBA 2X16A 4NXSA 4K6AA 2DEPA 4DIAA 4KETA 1UH4A 1SJAA 4V1YA 2FMNA 5G1MA 1T99A 4Q8TA 4DHGA 4K68A 5ECVA 2XTKA 3O06A 4GYPC 3TN4A 1ZAHA 4Z2JA 1XC4A 3OPSA 5EMLA 3BGAA 3R5EA 3BSGA 1XYLA 3OBEA 5HR7A 1P5BA 2QHAA 3TC3A 3P0WA 1RJRA 2UZ9A 3VNLA 4QCEA 5DCDA 1K03A 3VXGA 2VFIA 1B54A 3WK3A 3NDOA 4CNPA 3GD6A 3R1ZA 3NM3A 2G3FA 4ZTYA 1YW1A 1L8PA 5SWUA 3AUOA 3T55A 3SY1A 3B8VA 4KCTA 1AG1O 3O6CA 3CL6A 3BAJA 3CHDA 4IMDA 3RU6A 3O07A 3VOIA 1SM9A 3WLNA 1TYGA 3MZNA 2HDJA 1V03A 1VRDA 3RPTA 1VCGA 3GNXA 1ISXA 3EA2A 3WO8A 1OABA 5EFFA 3DCPA 4YLWA 2XH0A 4AWEA 1QFEA 1HQTA 1OY0A 8CGTA 4DEFA 2XINA 2YGYA 3LPFA 1OFBA 3UXAA 4Y96A 1DWIM 5TF0A 5E70A 2GVYA 7A3HA 2PP0A 4IQDA 2AKMA 2X40A 3QF0A 1QNQA 2VZTA 3BLPX 3FKKA 2C16A 3GSMA 4HQVA 4I7VA 1L6WA 3MY9A 3EX2A 1G94A 2WHMA 4RPPA 3BARA 4UMCA 3W2MA 4FR6A 1QMLA 4XSMA 4XZBA 4JTTA 3TYDA 1YMYA 1XKJA 1ZAIA 3HOJA 4LVBA 3LN3A 2WWDA 3PNUA 2X30A 2XG9A 4NASA 1D7KA 4GUGA 3D46A 2PLKA 1NIUA 3MHGA 1J8VA 4L9ZA 4ZOCA 4DF0A 3GQYA 4O10A 4QP0A 3UJEA 3TX9A 3TROA 4HP5A 3L23A 4UFLA 5F4WA 3WBYA 4MWAB 1XYCA 2VEMA 2GOUA 3TIMA 5CPMA 2O9OA 5EYWA 6TIMA 3F03K 2NQJA 1XIIA 3BLOA 1SSDA 1UP3A 3W25A 1V0KA 2XFFA 4XV0A 2H8XA 2VP8A 1Z9AA 2R24A 1AVAA 2Z4GA 1LTDA 1R3QA 4GQQA 3AZRA 1XH0A 1MEWA 1TR1A 3LNPA 2ZUVA 4AD2A 1ZQ5A 1GPFA 4AZCA 1H5VA 4JN6A 4A8NA 3CPRA 2AGTA 3I6TA 2XN1A 3HM7A 3T08A 2G37A 4XVEA 4M0XA 1FWTA 1JCYA 3BW2A 1FWEC 1HXJA 3MHUA 4N6EA 4WF7A 3ONBA 1N82A 3SRFA 2PODA 4PUMA 3W84A 1DVJA 3RLVA 3TQ0A 1E43A 4O57A 2HISA 3B9DA 1FA2A 1XWYA 3FW6A 1UR9A 1PZ0A 4RX0A 3M0ZA 3D47A 3SUSA 1F3EA 1E15A 3VKKA 3W01A 9XIMA 3H7VA 1KTBA 5A69A 3BLIA 4WKHA 4UNLA 3CB8A 1UA7A 3FJLA 1Q7MA 4N7QA 2OT1A 4BF5A 4H8HA 4B5XA 1TZ9A 4GACA 4CQBA 3GVWA 1UBPC 4JICA 1T96A 6XIAA 4KT2A 4FS9A 1HGWA 3G0XA 3RPDA 1G4TA 4U10A 3KRBA 3MUIA 2XSBA 3VK5A 4AMCA 2NX1A 4FLSA 4GVFA 4PTMA 1ZAJA 3EKLA 3I3DA 5IXEA 1T0OA 1VZWA 4HPHA 2J6VA 3P2VA 2C15A 4D6HA 3DG7A 3P81A 3SY5A 2VC7A 4ADUA 3AS2A 5LHFA 1MW2A 4J3UA 4IMEA 1F61A 1TVNA 1KFCA 4NU7A 3VDAA 3EWZA 4U4MA 4JTGA 1NTHA 1V0NA 4EK7A 2AL1A 1G9HA 4HN4A 1MFVA 4HMNA 3RF9A 4Q4RA 1K9EA 1NP2A 3H55A 2YCEA 3AYTA 4RXGA 5A6JA 4HT3A 1EYEA 2ISWA 2FB3A 4DUXA 5C9ZA 1B9BA 3N1AA 2PURA 4NX5A 4DLMA 1VIZA 3PTDA 3SQMA 1NWUA 3TTOA 5EL1A 1FFQA 2WCAA 3KDOA 2VENA 1VR6A 2VI0A 3EMZA 1Z89A 2OFJA 4K1GA 5EKYA 1FOBA 3S2NA 2Z2AA 2GQAA 4ADSA 3NQEA 1G69A 1TCMA 1PE1A 3GKFA 1LQ2A 2X1TA 3XISA 2DSZA 3EWWA 1IE7C 4LBSA 4ZBCA 2QVHA 1DWFM 2QDHA 3VD4A 4MJ4A 1KO0A 2ISVA 3ANUA 3LYEA 3L0KA 2OSYA 3WQ8A 3M07A 1DL3A 3RUBL 4H01A 2ZZ2A 3QY6A 3LUTA 4Q4MA 1S5NA 1AL7A 1W3IA 1G4SA 4HU8A 5DO8A 3CV6A 4JTLA 1LP6A 1ZJBA 3H4XA 3KBMA 5L6UA 2X1RA 4EXAA 1RV8A 4UOZA 3AISA 1IEVA 4D9PA 1TR9A 2PZ0A 5KITA 4XO6A 5GNXA 2BBFA 1CZ1A 3WNLA 4DZ5A 2QCMA 2GJXA 3QSRA 4UFMA 2INZA 1XYBA 2B7OA 4Q8NA 5I3IA 4DO5A 1ITQA 1TRIA 3ITTA 4LGXA 3GNDA 3GXPA 2Q6ZA 4JX5A 3PZUA 4OIFA 3UXLA 2ZX6A 3NEHA 2HQAA 4J4KA 1J18A 1XRFA 3D3FA 4Q32A 3TQVA 2VRJA 1JFXA 2XZ9A 3CYJA 5C5YA 5D9NA 1C9WA 3RJXA 3VNMA 5DY3A 3DG3A 4P7QA 3NTYA 5T91A 3REQB 3TCSA 2NQLA 1XD1A 1JPHA 1TJ0A 2ZZ7A 3M0VA 1V77A 2YJQA 2DDXA 3BAYA 2R1LA 1UJQA 7TAAA 3IGHX 1NP0A 4XAYA 4Q7IA 1ONWA 1PX4A 5C9WA 2XFYA 2HE8A 3V0UA 3SCNA 2QGHA 2P76A 4BQ3A 1HJXA 4BFAA 1O60A 2NV9A 1OADA 3SIMA 1XF0A 4C6DA 4DZIA 2I57A 3OBKA 1JCJA 3BOXA 2NX9A 3L21A 3W7JA 1CXHA 1WX0A 2Z7GA 3V35A 5A8MA 1BXCA 1Z48A 2F2KA 2ZKMX 5JBFA 1DXEA 1XCWA 4LTSA 3VIGA 4HHPA 4JHZA 4E3TA 2E5DA 3TTEA 2E5BA 2NQZA 2A3CA 1R85A 4DPQA 3KOXA 2YA1A 3ARQA 3TOYA 4IF2A 2AAAA 2WZTA 1I8JA 1PUDA 3TW9A 3V36A 3OYXA 1DQXA 4PTNA 4QSHA 3WDJA 1ISWA 1CX9A 3VD5A 1I75A 3CIWA 3KE0A 4UC5A 2DT2A 3C2VA 4RNFA 3FDKA 5I3GA 3HG3A 3PTKA 2OX1A 3WH5A 3GYEA 2I9UA 1IEQA 4YWIA 3NZQA 1FRBA 2IQTA 2GYIA 4HGXA 1ZZMA 2OSWA 1ADDA 3T7VA 4GJIA 8A3HA 4S38A 1GG0A 4KRUA 1ONXA 3RX2A 2HPIA 3RCNA 1TPWA 4LCRA 3WLKX 1LRQA 3S9YA 4JYDA 3TW6A 1UD8A 4G1KA 4MWAD 1LWIA 2VR4A 3MUY1 3PAJA 2V2HA 3GC4A 4AB4A 3U2ZA 1QWKA 3OODA 1W17A 1FKWA 4UBPC 1A5LC 4QROA 4Y8EA 1E4IA 2Y7DA 1OFQA 1F9CA 1YNPA 2NXHA 3K8MA 5CEWA 1H60A 1OCBA 2YYTA 3KM8A 3BICA 2XHYA 4OUIA 4ZQOA 4B4HA 5C55A 1JZ2A 4HSOA 3W7HA 4IQLA 1CLXA 5AVNA 3ZR5A 1VFOA 1Q6FA 4ZQNA 2OZ3A 5E9AA 4AWUA 4DZHA 3WLIA 3SQSA 4DRSA 4F8XA 3ECQA 1OGGA 1AH3A 2EXOA 4WY0A 4DXKA 3DDMA 4LS1A 4I6KA 5ABFA 4IX0A 1EEPA 1TPFA 3TK7A 3E2VA 1HN1A 1E55A 1GTEA 4KBXA 4EAMA 3S42A 2RDXA 3WJYA 1IHIA 3PPHA 1P6WA 4RZ4A 4JTHA 4RE4A 3MT1A 2NVDA 1B0IA 5I09A 2PDIA 3QV8A 1E51A 3H2NA 2BVWA 1X8CA 3STFA 5GJNA 3MO4A 1D3HA 4FOKA 1JEZA 4HCHA 1K8XA 2AQOA 3NDZA 3WFZA 3GDBA 2A3EA 1UD4A 4Y90A 5C7VA 1I2PA 5E6YA 3HMCA 3MP3A 5D4YA 1PYFA 4AYSA 5L9FA 2J9XA 3A3WA 3QEZA 2XIMA 3TSDA 3ZLGA 3R2GA 2BWGA 3AWNA 1JZ7A 3MQTA 4R9XA 1WB0A 4LUTA 4CU6A 3EWBX 4XISA 2ZA3A 4A2RA 3DOPA 2W92A 4IISA 1GVIA 4A8LA 2ZUNA 4H7VA 2EKGA 3HV9A 4BKNA 5A8OA 1NFBA 4EOUA 3WELA 4GNKB 2JEQA 1WOAA 3M5ZA 1BRLB 5LA0A 1XG3A 1YTEA 4DELA 3CXOA 1W3KA 3W86A 4PULA 1VHCA 3RX3A 4RE0A 4L4MA 1W9UA 1A5CA 1D2KA 1GVRA 2DPEA 2GK1A 1TPUA 4C5ZA 4AIEA 3PZMA 2P3EA 3S4TA 4QE5A 4DBSA 2GFTA 5AYZA 2HVNA 1PEZA 2WHLA 2EPKX 3CWOX 5D2VA 3EWCA 4L1WA 1MI3A 3ITCA 2QV4A 3SCTA 2FZ8A 4O28A 4P8UA 2YFOA 2QUTA 3VNKA 2A1YA 4IOTA 4R5EA 3RRAA 7CGTA 3CEPA 4X60A 5HJLA 3VNDA 5IDZA 3EAUA 3G6LA 3GDMA 3C61A 3HIJA 1GGOA 2QCEA 3W74A 4K7VA 2XWEA 1TTPA 1VFMA 5G4HC 4Z2GA 4MADA 4QRNA 3TXVA 2BB0A 1CT5A 2Y8UA 3CK5A 2MUCA 3OEXA 5JMUA 1OIFA 3HFTA 2B0MA 2FMOA 1ME7A 3AZSA 1ADSA 4AHQA 1TJ1A 4K7YA 3UA3A 3CIXA 5LYRA 4JHMA 2QUNA 3PWIA 4GRSA 1R3YA 4RDWA 3E74A 1TJPA 2XIIA 1ITCA 3A64A 3ZWSA 1Z3NA 5EB8A 1QVBA 2J8FA 3TA9A 1OFRA 3UR8A 3LK6A 3LZ5A 5CPSA 5MHBA 5JXQA 2P0OA 1KQYA 3ZJ7A 4LW7A 3B8WA 4JNZA 3VGEA 1MNZA 3RLUA 1L9WA 1SPQA 2VVNA 3B3DA 2FGLA 4PODA 5AC5A 2IQDA 4MZYA 4XAZA 4FALA 1YTKA 3AMGA 3Q67A 4PR4A 3AC0A 3NPUA 4C6JA 4E5TA 4AZ5A 4O11A 3R6IA 3VUPA 4HK5A 3KS5A 4E2OA 6ALDA 5A3HA 3R12A 3LHTA 1J4EA 3VABA 1YE6A 3S6DA 4HN8A 4J28A 3T1GA 1RALA 2QDDA 1UWRA 4I8YA 1PDZA 4C7DA 3BVJA 2VZVA 4DX3A 1X6NA 3W2NA 2Y7EA 2X41A 3M0YA 4OHQA 3BE7A 4F2UA 1GOIA 3FOKA 2CZDA 4MKNA 1QBBA 1CENA 4BR1A 1DWAM 4BWLA 3E0LA 2CBIA 3G1DA 2FVMA 3CB3A 3XIMA 4JIRA 1XLFA 1K70A 4ZCWA 1QNOA 4NIRA 3WYZA 1JRCA 1PV8A 3OHMB 1E1CA 1RCQA 2AAMA 2BGQA 3TQKA 3H22A 1BTMA 1WDSA 3G1AA 1H7XA 3UG3A 4LC8A 3PJTA 3SN4A 4S2BA 4WCJA 4JTAA 3TTYA 4AIBA 3PZOA 1L6SA 4FNUA 1MDRA 3WN6A 2X1UA 1O5RA 2CLFA 3F2CA 1UASA 2FPVA 3C52A 4YJ5A 1F4AA 3PUGA 1HKWA 4AAJA 1N2VA 3E12A 4NAEB 4RE3A 3MP5A 1MFUA 5A1AA 4H2CA 3W73A 2Y6ZA 3LHYA 3VTRA 3CPUA 5DMNA 3B8TA 4L1GA 1GJUA 2J8GA 3MA8A 3W26A 2Y5EA 4PCTA 3MB9A 2PU1A 1V3JA 4UTMA 4JQ4A 3O1NA 3JZEA 4EKJA 1QPRA 4OV9A 3GTIA 3CTTA 4WXYA 2QPXA 3MYPA 1DYSA 2A7PA 3HN3A 2XH2A 5PTDA 4WIWA 2J77A 4UFIA 1S38A 1QRQA 1ZB5A 1CGYA 3S83A 1RBOB 1BSIA 2BASA 4W93A 2ABAA 2NXIA 2Y89A 2WNZA 4HNOA 2NZLA 3L0NA 1LRNA 1KD0A 5E6ZA 3W7MA 4AYGA 2V82A 2WM0A 1QHZA 2YA2A 3NOYA 3QHNA 4LUJA 3C8FA 3GUGA 4GVGA 3O63A 1GVEA 2Q01A 5JBDA 4MKSA 2CLEA 2DH3A 1JDEA 5D05A 1GEHA 1F5ZA 4ACYA 2JBMA 3SCUA 1QR7A 1GJWA 2PWVA 1D7FA 1P48A 1HJWA 3R13A 3UXKA 3OZOA 1EB3A 1U22A 2GUYA 4CLMA 1TZZA 2ZWZA 2WVTA 4O4WA 1FCBA 5CLWA 2Z1WA 2ZX7A 5BROA 4LY8A 3UW6A 3G1YA 3TLQA 1S2VA 1UP0A 1J10A 3IIZA 3SJ3A 4QIUA 2OQHA 1W9XA 1XYZA 1JCXA 1W3NA 3CZLA 4BS0A 1Q63A 5TNVA 2PZNA 4C6FA 4G9PA 5LKYA 3ZVHA 4XG1A 1W9VA 2OELA 4WLCA 2ZDSA 3QQWA 1NARA 5AYYA 2PGFA 2R91A 4QISA 4QNWA 1LBMA 2MANA 2YXXA 4ES4A 5D2TA 5U7SA 4I8DA 3OZPA 1W3HA 2PMQA 3WDPP 5AKQA 2DSWA 3BV7A 1TIMA 2A85A 2V5CA 1WBJA 2HK1A 3VIKA 3FVMA 4M82A 4O0KA 5LSMA 1JNEA 5LGZA 3UG5A 3G8EA 3PZ9A 4PYSA 5HNNA 2Z1SA 2WKGA 3VOCA 4L9XA 4GQ0A 4O15A 3IACA 4QGCA 1Q8AA 2EPNA 2UY4A 3PC0A 2MNRA 2E8ZA 4LBUA 1MRQA 3VDBA 1GW9A 4Q8MA 1PZ1A 4JEJA 3QC3A 1HTIA 5LNVA 1C8YA 3FAWA 2NX3A 1D8WA 2EKCA 1XBXA 2GOKA 1VEMA 2PWHA 5AOUA 2WMJA 1P6BA 2XPKA 1FWWA 5FIPA 3SCWA 1A80A 1K02A 1O66A 2PE4A 3S1XA 5HDRA 2GGJA 1E0VA 3C2OA 4A2SA 2QCCA 3WQVA 1VFUA 1KCXA 4UTWA 4QDPA 1LBLA 1W8GA 1JZ6A 4PUNA 1G0CA 1FUYA 4AEEA 1K7EA 3HQPA 3RR1A 1A5BA 3A22A 3PAOA 1ODUA 4JTUA 3FAXA 4GISA 3U48A 1JPDX 4V27A 3EXTA 1E73M 3W1QA 5CGTA 4MPQA 2D2GA 3S0CA 3LEPA 1XRSA 3GDTA 4MWAE 2CIPA 3GXMA 4RPQA 3AHTA 1XLIA 2CZFA 3GO2A 5IBXC 3IJDA 4S3JA 1LF1A 3CGTA 4YMZA 2PUZA 3VO0A 1W1VA 2XVLA 3MU7A 4EPDC 4WDTA 1X38A 3QGKC 4HMEA 4OOUA 3WD3A 4H9MA 1W31A 1I1WA 3BUVA 4K1WA 3UPMA 3WQ5A 2ICSA 3VGBA 2CBUA 3EX6A 3GNNA 1XIEA 4GKLA 4G7EA 1F73A 3WBAA 2GZXA 5M2FX 4RW3A 3BC9A 1MW3A 1N8WA 1MNSA 4MKVA 2I5QA 3DHFA 3S1WA 3FIGA 3CZ8A 3W85A 3A5FA 1S5MA 3V1PA 3H23A 2VM8A 1AJ2A 3H53A 3UESA 2ZZ1A 1OM0A 5F2MA 2VX4A 1EL3A 2C8NA 3N9RA 3FLUA 1EJRC 1KBJA 1YPIA 2A7NA 1ZU8A 1IR1A 1TFVA 3AIRA 4GQRA 5C8BB 1MW0A 1H1YA 3P6LA 4MJMA 3MMUA 2GVLA 3T0CA 1A0DA 3QMRA 1LOSA 2R1NA 2E25A 4LUYA 3GX9A 2P5NA 2CFFA 1H1NA 5KEZA 1R87A 1UD3A 4WQ6A 1T6MA 1K9DA 4W87A 4E8DA 2FZNA 1GQKA 4LJ3A 4PH6A 2YW3A 1BQCA 3GU9A 4QEHA 2JF7A 5J5DA 3W1RA 5I3JA 3WUFA 1VFLA 4X3ZA 5HNRA 1JVNA 1S2UA 4EVZA 1Q6DA 2OYMA 4JFUA 3EEZA 4MWAC 4V2XA 1Z7AA 4DJED 1JF6A 3VFLA 4IT1A 4W8AA 3M46A 4H9TA 1JDFA 4JFTA 1BWVA 5BOFA 4UNKA 3N2MA 1AJZA 4DWSB 3KOFA 4M7TA 1HJSA 1NWTA 3EDFA 1LOQA 1JCLA 4GYPA 4UUIA 5C54A 3DFSA 4DJFC 2BY1A 3VVGA 2AL2B 4RLIA 4U3CA 2VZOA 5MF5A 4HMDA 1OD8A 3KFTA 5T8GA 4IJBA 3I7SA 2H9AB 5D04C 4DUOA 2F2HA 3W53A 2TSYA 3DESA 3M0IA 4H19A 5FF7A 4Z42C 3P5YA 3W28A 3RO6A 1QOXA 1DWHM 1K6AA 5KSWA 1D3CA 1DPMA 1XP3A 4KWUA 1U2YA 4QQ3A 5A6TC 1GQIA 2QCHA 2Y0FA 2ISFA 5BU6A 3DHDA 4FEZA 4YN5A 1Z44A 2FKPA 3LQGA 3NSMA 2CU0A 3WLLA 1LJYA 4NZ3A 5KZMA 1V3IA 3T4WA 4JFWA 5U4NA 3WMLA 1UMLA 3OGVA 4EPKA 3B0YA 1BKHA 3F4CA 2WVVB 7ENLA 1F07A 2VCAA 4O18A 1I60A 5C7HA 5DY2A 4LWWA 2ZIDA 4GQGA 5CGMA 3OG2A 1XIGA 4Q4KA 3PM6A 3FXGA 5A8QA 1A5OC 2OQLA 3FYPA 3TN6A 1UKQA 1P1XA 5DMLA 2DIEA 3WQFA 4GO8A 3NM1A 2I7GA 1BQGA 5E0FA 1HO1A 3B04A 4KWOA 1TB3A 3GHTA 3ARWA 3KWXA 4LB4A 3CUFA 3QYQA 1XLJA 4PUWA 3I3EA 2CKRA 1K6WA 2E1WA 4MLJA 3WD2A 3BCJA 2H8ZA 3PFMA 1P7TA 5EA9A 4ZTXA 3ZM8A 1CLKA 1ZSXA 2PGEA 3T42A 4PMRA 3TSMA 4CU8A 1GEQA 5E93A 1MEIA 1RR2A 2FTYA 3STCA 3WX7A 2JKPA 4ENLA 3GY1A 2WNNA 5FKYA 3W7QA 2ZTJA 3GB6A 3CU2A 3WG6A 4B16A 1BG9A 1NFPA 3IGUA 1OX6A 2ZRZA 3NQ6A 3W7GA 1FDYA 2DZUA 4Z0SA 2E09A 4HVXA 1JCMP 4ZODA 4HA1A 2OTDA 1C92A 4PA8A 3PNZA 2Z26A 3LV6A 3VGFA 3UZZA 2HV5A 1B3YA 1PIGA 2WSYA 3PZTA 3M44A 4FF5A 3DHPA 1D3GA 2DJXA 3AIVA 3MSYA 2CWNA 4IHCA 3QW3A 3IJLA 1DJHA 3RRXA 4AG0A 2QCDB 4KEMA 1KGWA 3H26A 3N15A 3QGAC 5FI8A 2J4GA 5DBUA 4S1FA 1TWDA 3IJ6A 3O8AA 3KWSA 1CXFA 3LLXA 1GONA 4N02A 4MHBA 4BI6A 1NU5A 3NQDA 4IFOA 5HULA 2YOCA 1CCWB 1JUEA 3OGRA 5DBTA 2VDHA 3C2RA 3AO0A 3NPWA 1RD6A 1Y5VA 4H41A 3A6OA 1ZL1A 1V7AA 2Z1XA 4ML4A 4L9YA 4HZ8A 3QR3A 3FGCB 3WLSA 4CUCA 4LOCA 1OFAA 5K9XA 2BOGX 2ZXAA 3QFWA 4JS3A 4N6FA 4GJ1A 2O0TA 5B7ZA 2FVKA 3N19B 1UIOA 3KP1A 4AF0B 1PB0A 3BW4A 1W1PA 3VX0A 1FWBC 2GLKA 3UETA 1S2CA 2ZVRA 1ESWA 2FFIA 3BPWA 2OSXA 4QM1A 2QLYA 1B1YA 2E3ZA 3G1FA 3LTYA 1PIIA 5LIYX 1TTQA 5REQA 3WD1A 1TO3A 3URBA 1VP5A 4RZ6A 3P67A 3V0SA 3HPFA 3TYAA 4B3ZA 4LXFA 1HFBA 3UGVA 1OEPA 4FIRA 8TIMA 2TAAA 4HIBA 4XTDA 5EFDA 4Y2WA 1O5XA 1VCVA 3OA3A 1AW5A 3W3OA 3VZYA 3ZSSA 2WV8A 1S5VA 4O12A 2Q8XA 4RDYA 1EP3A 2F9RA 5C9RA 4W7WA 3GDKA 5HNTA 1TA3A 2P50A 3C86A 2IPGA 1SMAA 3VAVA 1VGAA 3TYUA 1I0DA 4GE8A 1JG9A 4HHHA 1C8QA 4UTKA 1DJXA 1CYGA 3W7OA 1FWNA 1SJBA 3M4HA 1J96A 2FH8A 1TPH1 3GR7A 2OO0A 3JVAA 4AY7A 4FLQA 4RZBA 3ALFA 3R8GA 4FK9A 3HPSA 3UG8A 1QUMA 1B30A 4D1IA 4WXZA 2AOSA 2VGGA 4L7ZA 3A23A 4C6OA 1PTAA 5IHSA 5E9XA 4B15A 3ITOA 1FHVA 1X6UA 3N6QA 3WD0A 3QOMA 1I45A 4PCPA 2ASHA 2BP1A 2FHCA 2QV5A 3EEGA 3IIPA 2XN0A 1QTWA 1R47A 3WK1A 1GYLA 4YTRA 4AFYA 1V4YA 1WZKA 2C18A 3CUXA 1IXNA 1S2WA 3E2SA 4U5KA 1QO5A 4DI9A 3K8KA 2GSJA 1CGVA 3AU2A 2O4MA 2PCEA 5HQEA 5I0DA 1IIGA 1YLVA 1HVXA 2WNQA 1OYCA 3NQGA 3PG8A 3UJRA 4XIAA 3EMCA 5HUOA 2YPIA 3WBXA 2PTXA 2E9MA 4NZFA 2J75A 4DWSD 1MSSA 1TMLA 2OG9A 4KRTA 1V0LA 3K30A 4JKMA 3W83A 1VYSX 3U4AA 3LTSA 2YBUA 4B4FA 2VGIA 2O56A 3QMTA 4N9BA 1ZJAA 2WBKA 4ZR8A 3N4FA 2VQTA 3CT7A 3T8QA 1R5YA 1UQYA 2E7FA 5CZJA 2EPHA 4GZEA 3MVTA 2Y70A 5HWJA 3LQLA 1J0HA 1E0WA 2ADAA 3CHVA 3EX3A 3LX9A 2HNEA 1SFSA 1QXLA 3W7KA 3B9EA 4TV5A 2PBGA 3F5JA 1Q85A 3P60A 3LRLA 3PJWA 3RCMA 5HXMA 4GIRA 1J5SA 4NZ4A 4ZMGA 3AI0A 1J0JA 1GPWA 2EPMX 2PDBA 3RDKA 2BODX 3ABQA 3BCDA 4JCLA 1W54A 4LFYA 3MWCA 4GI8A 5CG7A 4RDZA 1FWGC 1Q7ZA 4J7RA 2ATMA 4EANA 1Q2SA 4CCDA 2XVNA 3N9KA 2WNWA 1YQ2A 3L5AA 4MB4A 1WUFA 1E56A 2GSHA 1NDZA 4JIPA 3ZYZA 1H50A 4TTGA 2QXWA 3QTPA 3SQLA 4HK6A 2E6AA 3ARZA 3DC8A 1LQAA 2C1IA 5LIXX 9CGTA 1CW2A 4GX8A 4Z2KA 3EYPA 3I65A 4V15A 1SZGA 1K3UA 2VR5A 2WJDA 3M47A 1W3LA 3CQ0A 5M03A 2VRQA 2E9LA 6REQB 2YL5A 3UP8A 4BHYA 1W2PA 1KW1A 4JIEA 1JXKA 2E28A 1BVWA 2AQVA 3FN9A 2JKEA 1KM3A 1U33A 1TVPA 4F40A 3OP2A 2FTWA 4ZQRA 1MQRA 1RD5A 1DIOA 4Q8VA 2KAUC 4A29A 1VS1A 1V6VA 1UYQA 2GDQA 3GVRA 3TTQA 1OZMA 1W8SA 5DXXA 2OOGA 3BTNA 4MMWA 4TX9A 2RHGA 1SJDA 5LGXA 1RZMA 3PBYA 2ZC8A 1KFJA 2H90A 2WM1A 1JYXA 2NV1A 3P80A 3W1LA 5HMEA 1EDGA 2CLHA 1E4MM 3VPLA 2WZHA 2R94A 4UTTC 3FDGA 2YKKA 3UBPC 2EG8A 2YDSA 3HV8A 1XQKA 3C3NA 1VFSA 3BQ6A 3A3HA 3NQ8A 3UF9A 2WSKA 4YTTA 4GLEA 1TKKA 4CU7A 3M9YA 3TKFA 3N11A 2Y8VA 2G3MA 2XWDA 2VX5A 1BYCA 4W5UA 1S1PA 1RY8A 2DZXA 4DZAA 1EFZA 3UWWA 2ANUA 3EB3A 3QKZA 2BLEA 2WMKA 1EX5A 1JQXA 1OBAA 1TX0A 1MXSA 3GFYA 4HHLA 4JTIA 2ZYFA 1G4PA 1W56A 2IPJA 2E8YA 3QW4B 3AHZA 3SZ8A 4DNMA 4YWSA 4GC3A 2AMGA 2HTMA 2VGFA 1I2OA 2CBJA 1B3VA 3MJYA 5MKGB 3M16A 2J47A 1JF5A 1GHRA 3UY8A 1DTUA 1FHLA 3UJSA 4ICNA 2G8ZA 4GBDA 3W75A 4HA4A 5IM51 1KR1A 1XRVA 4D6GA 1L6FA 3WNKA 4NSBA 5F7UA 2FFCA 2PGWA 4G1NA 4NT0A 1CXEA 1NDVA 1AMKA 4NRSA 3STGA 3T09A 4AD4A 1ZS2A 4F0SA 3OZMA 3KLKA 2ZZ5A 2HK0A 1A50A 3WNMA 2DVXA 3AU6A 1Q7QA 1TPEA 2QIIA 5FCZA 4QS5A 2J7FA 3MBFA 2BOEX 3ME3A 3TUUA 2E0PA 4LRTA 1CGWA 3WNNA 1RA0A 3E0IA 4AY8A 3ITVA 1UMYA 3LG3A 4FX8A 2XH4A 4DBEA 1XYMA 4C6IA 4R53A 1O5KA 2Y5SA 3LU2A 3OYZA 1EDQA 3K8LA 3UG4A 4YHGA 5KTLA 2LLEA 2E6DA 1HZYA 1HX0A 2G95A 3ZLFA 2ESCA 2H6RA 3M5YA 4EPBC 1WKFA 2PEVA 3PTQA 2DSUA 6PTDA 3H8AA 4IM4A 3TVAA 2PC4A 3FJNA 3WK2A 1Q6LA 2VCCA 5EMMA 5FJIA 2WMIB 3CO8A 3WDQA 1KRCC 4GO9A 4M5PA 1IWPA 3LBOA 4W4QA 4L5ZA 1E6PA 4DJEC 3WF3A 1DQWA 3MP4A 3T2PA 3EPMA 2GPTA 1VBHA 3U2CA 4K39A 1W5OA 3CH0A 4P2VA 1NWSA 1E40A 1ZJIA 1OWQA 1S39A 2F8QA 1EHNA 4LAMA 7REQA 4WHBA 3LA4A 3PANA 4OZOA 4B91A 2QDGA 3ALGA 2BGSA 1JPKA 5H91A 4FXRA 4MYAA 4C6MA 5EMJA 3WJWA 4PE8A 3E02A 4FP1A 1KFLA 4X9SA 1PKMA 3BOFA 1ZY9A 3GU1A 3C8NA 1J0YA 3LBMA 4IFRA 4M6UA 4DUWA 3KXQA 3CHFA 5BOEA 1POJA 4AZ7A 1GOWA 3DFPA 4BZYA 2GUBA 4IFKA 3TXZA 4UCGA 1JZ3A 4UFJA 2QJMA 2BFGA 5GJPA 3P82A 4YS1A 3OG3A 3W1PA 5CKSA 3N3MA 3DU0A 3NZRA 4JTQA 3BLLA 3DGRA 2B7QA 4H2HA 3JRKA 2HWGA 2DQWA 4GHRA 4WX2A 4Z1DA 1H7NA 3A4WA 5ABEA 1FCUA 2C19A 1PBGA 1TPB1 3THDA 3BCFA 1RQHA 1QBAA 4GWEA 2HXUA 2WMFA 2VT0A 4S3CA 3W0KA 2REQA 5A8PA 3EDKA 4MF4A 1TPVA 3FSUA 2OWWA 1Z41A 1KBKA 3E3HA 3R7MA 2QNEA 1A0CA 2H3DA 2NUXA 3GBEA 4LY4A 5F1VA 3KZPA 2FHFA 2ZRVA 1NY1A 4KEUA 4LYPA 1KNWA 4P61A 1IT7A 5EY5A 1NJJA 1XCFA 2GJLA 4GVHA 2RGLA 4R27A 3DFTA 4LT9A 3LM3A 2DW7A 3W1UA 3LCXA 2OGYA 3AYSA 1GORA 3WLRA 3SFWA 1YNYA 4WSHA 2DZSA 4D6CA 4MFEA 1FP9A 4HA0A 1O5QA 1IT0A 3CQKA 2XUCA 2DFAA 3U2OA 4AZBA 3CHEA 3QY7A 4LCQA 4BF9A 4N9DA 4E2VA 4O14A 5C2XA 1T40A 2YDRA 3CLMA 1W1A1 3S9IA 1KGXA 4PZVA 1WPCA 2BY0A 2QUMA 3GNOA 1I6NA 5JU6A 3G1VA 1BVNP 7REQB 2OEJA 3M0LA 2BX7A 3NO5A 4KCUA 1T5AA 3MBDA 1O68A 3EOLA 1PCWA 4TU1A 5AC6A 1DXFA 1DHKA 4W84A 4PFMA 3S5OA 4IZGA 1QHOA 3GTXA 5F2LA 2HVMA 1JZ4A 7TIMA 3M7WA 3B05A 3ZVIA 4C6EA 3IPWA 1SFJA 4ZQCA 3MYOA 3M1ZA 2PLJA 1AD4A 4IFKB 4LPCA 1NH6A 3KCOA 5CH9A 3A12A 4GI4A 1IR2A 2IMRA 2ZX9A 4CD5A 5IHRA 5CAHA 1R8LA 4O53A 3HQ1A 4CNSA 4GUHA 1DHPA 3GXIA 2RJGA 3D3AA 2PWGA 5H1WA 3AMDA 3T0AA 3BMXA 4IMAA 2VC9A 5T26A 1Z8AA 2HROA 5XIAA 1UWIA 1HP4A 1UKPA 2BTMA 4DAFA 3T8LA 1EP1A 5ABGA 4RDVA 1F05A 1OG6A 3KVLA 5I3FA 5I77A 4W7VA 3BJFA 3UEQA 3GXFA 4FX7A 2VZUA 4HNCA 1UG6A 2HXTA 2V5LA 2G3JA 4F0RA 4HMCA 4ACZB 5IFPA 3FS2A 3EWXA 1NQKA 2QR6A 3CAQA 4Q8WA 4Z2LA 3RMJA 4P8XA 4UZUA 4IXHA 3FA3A 2VNCA 1EDTA 3DUGA 4O8RA 4JIIX 3W1NA 2UY3A 3AROA 3OW1A 3E5PA 3H24A 3R58A 4FNSA 4QHRA 3PR2A 5BNKA 3R0KA 3M7SA 4IJCA 5A2BA 2DP3A 2EJAA 2P3ZA 4NY2A 1TCDA 1YDOA 3CZJA 2WPGA 4HU0A 2OMAA 3SIZA 1TSIA 4YU1A 2BOFX 4GNJA 5FAGA 4NXKA 5EBUA 1US0A 2ISSA 3GAYA 5A6KA 1TTIA 4OWGA 1H3GA 4WGXA 4W89A 4WY0F 4IXXA 4IGSA 3BGGA 2DT3A 3L65A 1EUNA 1W5MA 3BW3A 1CDGA 4OT7A 4I7WA 1UWAA 1LG1A 3UZYA 4IJRA 3GG0A 4GH1A 3UWZA 3QZ6A 2W6RA 2Z25A 4AC1X 2PDFA 1BEUA 4J3XA 2VEIA 4UOQA 4GZIA 2YCLA 2INEA 3HB9A 2QEZA 3ABSA 2CLOA 4C6BA 1VBJA 4PBFA 3NGFA 3T81A 4CD6A 4YVPA 3GU2A 1SW7A 3SGZA 3N6HA 3TONA 3LBCA 2DSVA 4A3QA 2KX9A 1NEYA 8RUCA 2BXVA 2ZQ0A 3GVGA 3WFLA 1JCTA 2WB5A 3CZKA 3PZNA 1D9EA 3M6YA 2WQDA 1RP9A 3UJFA 4Y9MA 4Q7NA 4F0MA 4P8VA 4S39A 4MG4A 1M04A 2FB2A 2C7FA 3NUKA 2WMHA 2RDTA 1EQPA 3GH4A 1POKA 1OFPA 3E2RA 3ARVA 1IV8A 4DN1A 1LT8A 1NSJA 3DYPA 1T41A 1ISYA 4PTVA 3TJIA 1XYAA 1QJWA 3WLQA 4IIDA 4HB7A 2PLCA 3P84A 1WKYA 4DWSC 1KM1A 4JN7A 2EG6A 2RH9A 3KBNA 3UZWA 2NXGA 3ICJA 1K8YA 2VOTA 4WKAA 1DEDA 4UTWC 4OBTA 3ARSA 3R25A 2CETA 2CNCA 5RUBA 3U0HA 3AIUA 2AQWA 1H49A 5DRCA 3R0DA 3OIHA 1XGDA 4WK9A 5DF0A 1GNXA 3UPBA 3OQ8A 3MSGA 5IBXA 4FLRA 3IRSA 4CD7A 2WVUA 4GQBA 3KP0A 3ENLA 3VA8A 4EWJA 4AHOA 1GT8A 2ODOA 2E9BA 3CL7A 4DYKA 4RV8A 2XM1A 3POHA 4A8RA 1AQHA 1MUMA 5FF0A 1UD2A 5AHFA 2C0HA 3DFYA 5IOBA 1OF8A 4O0ZA 3T78A 4XZNX 3T4CA 1W1IE 2GJNA 4UCFA 4GXMA 4W9TA 3FYOA 4L61A 4XUYA 1WE5A 3GNPA 3PS7A 4UIOA 2ZUWA 3C2EA 3MMTA 3MS8A 1BYAA 1C8XA 4Q22A 3IRDA 1PL9A 4F0HA 4ONVA 4FA3A 3EOEA 1ELSA 4HSNA 2OU4A 2W66A 5HINA 1ZJHA 3OB8A 4JX6A 4GD0A 5KZ6A 4P7LA 4KQNA 2ACRA 1TWWA 2C6QA 1XV8A 2XFRA 2X0HA 1PHQA 3ZJ8A 2A6LA 3PN8A 4LYRA 4NKCA 4LAOA 1JUKA 4P7NA 2J7BA 3MI2A 1R9YA 5H8MA 2PA6A 3MHFA 3W7LA 5KMYA 4S2CA 1BAGA 4B9ZA 4NF7A 5C6MA 1NFGA 4H9XA 3W29A 5TD4A 1XISA 5AZ0A 2GVJA 3KOZA 2PTYA 4J1OA 2CKSA 2PWFA 3PP7A 4IIEA 4IQEA 4J3ZA 3W38A 1IXPA 4YPJA 1GKPA 4LF1A 1SMDA 3FCPA 4CEUC 4OTKA 4PUKA 4JTDA 1XW8A 3UCCA 2Q3OA 3APTA 1OB0A 4QE4A 5ABHA 1J12A 4GGHA 1JGIA 2BSLA 1LL7A 3IAQA 4K38A 4DJFA 1IIHA 3JR2A 1SVDA 5HPCA 1S5WA 2W3ZA 1V6TA 4TV6A 1YADA 2PDNA 4FX6M 4DF1A 3PB0A 2UY2A 5I5RA 3L4XA 4CQAA 4B5UA 2E4TA 4W85A 1TG7A 3L5LA 1RCXB 3E6EA 3SR7A 2BY2A 1Q6RA 4A35A 1UBSA 2QQ6A 3UERA 1HP5A 1Q8JA 4WOQA 2A7RA 3GNRA 3QSTA 2IUZA 3RU8X 5H8UA 2WHJA 4TO8A 1W5NA 3O9NA 1Y65A 4V1XA 4CN6A 5HATA 1YDVA 4GPNA 1PAMA 1FCVA 4XBSA 4AHPA 1TE1A 2ZUSA 2ZA2A 1TV5A 3N17A 1TMHA 4RKAA 3UWEA 3EGJA 3B40A 2D24A 3F4WA 2FPTA 1AMYA 4GIYA