1V02E

Crystal structure of the sorghum bicolor dhurrinase 1
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
484
structure length
484
Chain Sequence
RLSPWEIPRRDWFPPSFLFGAATSAYQIEGAWNEDGKGPSTWDHFCHNFPEWIVDRSNGDVAADSYHMYAEDVRLLKEMGMDAYRFSISWPRILPKGTLAGGINEKRVEYYNKLIDLLLENGIEPYITIFHWDTPQALVDAYGGFLDERIIKDYTDFAKVCFEKFGKKVKNWLTFNEPETFCSVSYGTGVLAPGRCSPGVSCAVPTGNSLSEPYIVAHNLLRAHAETVDIYNKYHKGADGRIGLALNVFGRVPYTNTFLDQQAQERSMDKCLGWFLEPVVRGDYPFSMRVSARDRVPYFKEKEQEKLVGSYDMIGINYYTSTFSKHIDLSPNNSPVLNTDDAYASQETKGPDGNAIGPPTGNAWINMYPKGLHDILMTMKNKYGNPPMYITENGMGDIDKGDLPKPVALEDHTRLDYIQRHLSVLKQSIDLGADVRGYFAWSLLDNFEWSSGYTERFGIVYVDRENGCERTMKRSARWLQEFNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Determinants of Substrate Specificity in Family 1 Beta-Glucosidases: Novel Insights from the Crystal Structure of Sorghum Dhurrinase-1, a Plant Beta-Glucosidase with Strict Specificity, in Complex with its Natural Substrate
pubmed doi rcsb
source organism Sorghum bicolor
molecule tags Hydrolase
molecule keywords DHURRINASE
total genus 190
structure length 484
sequence length 484
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1v02E00
4W7WA 3CH9A 1N82A 5CG0A 1DWAM 2D0HA 2VQUA 2JFEX 2G41A 4H8HA 5M17A 3SCTA 4IPLA 3WD4A 5BRQA 3MUZ1 4OKDA 2WBGA 3VU2A 2XGIA 1B1YA 5JBDA 3L4ZA 3AOFA 3SCOA 1QI4A 2VL4A 2XTKA 4KMQA 3VIJA 4GPNA 4RE3A 2ZE0A 3M46A 1E4NA 1BG4A 1UKTA 1MQRA 1EH9A 1K9FA 2YIHA 5E0CA 8CGTA 3TTSA 5KZ6A 5BYWA 4P7LA 1VB9A 1E43A 3WQ5A 2GDUA 1S46A 1I1WA 2J74A 4R5EA 2RGLA 1E6XM 3W6MA 4D6HA 2C0HA 3T0DA 3ZR6A 1WPCA 2EPLX 2J8FA 2GJRA 3BCFA 3A4XA 1B3VA 3TTOA 4NRRA 2V38A 2JALA 4ZENA 1GW1A 5A8NA 1R7OA 3OZPA 2WHLA 3THDA 2Y2WA 4J3TA 1UZ4A 4JFTA 5E6YA 4FMVA 4ZXLA 2YL8A 1WNOA 1V0NA 2GUYA 1ZB5A 1RP9A 3CMGA 3K4AA 2JEPA 4CD8A 3U5YA 2BVYA 4HA1A 1ZBWA 3IAQA 1EHAA 1KWGA 2HVMA 1UYQA 4BCEA 1C7TA 3GXFA 3RM9A 2FGLA 3ECQA 4Q7NA 3BXWA 4AW7A 3I3DA 3WUFA 1CLVA 4ZE5A 3SCWA 4D6DA 3WF3A 1V02A 3WDIA 5IDIA 1PAMA 1PJ9A 4LXFA 3PTQA 4MNJA 4CVUA 4WKHA 1LL4A 4H8UA 3VUPA 4AD5A 2EPNA 2VZVA 2BVDA 1IT0A 1ESWA 3CZGA 3PZVA 3CUGA 3NSXA 4S3JA 1PZ3A 1GOMA 1CGVA 1WDRA 2J7DA 2J7CA 1BPLB 3WN6A 4IPNB 3SCPA 3SCUA 1HP5A 1E72M 1K6AA 3WFLA 4AD0A 4AIUA 2CETA 5C8BB 4WJXA 1VEOA 3IJ8A 3OIHA 1G5AA 4PTMA 1R87A 3WEOA 5LYRA 3VIMA 1W3JA 2GK1A 4P8VA 3AIUA 3VM5A 1HP4A 2VTFA 4W8AA 4CCEA 5D9OA 4F79A 4RE2A 3IJ7A 1JYWA 3AS3A 3ZR5A 1HL9A 4HZ8A 1MQPA 4OJYA 3AS2A 1J10A 3M6DA 3CPUA 2XWDA 4CKQA 2XVPA 3VNZA 1OGSA 2O9RA 4MADA 3N17A 2J7GA 1PEZA 1CWYA 5JIPA 3POCA 1HJWA 1W9VA 4ZE4A 1CECA 4E4PA 1GVIA 1OCQA 9CGTA 1UR4A 5ABGA 5F7UA 4W8LA 1QW9A 3D3AA 1FH7A 2OSYA 1H5VA 3L4TA 2DH2A 4AD4A 1B31A 4XB3A 5AY7A 1XSIA 3RM4A 2WZEA 3HMCA 3WH9A 4W7VA 1ZJAA 3T0AA 4M56A 1HKJA 1V3HA 4AZCB 3CZLA 1NWSA 2CBJA 4UQEA 4QLKA 2YDRA 1VF8A 2VZTA 1XSJA 5E70A 2VOTA 2WXDM 5JIWA 1HX0A 2X1IA 2GDVA 3NJ3A 1WCGA 1VFOA 2WZIA 1QNSA 2B31A 3W53A 3PN8A 1QNOA 2D1ZA 1EXPA 1UG6A 2PC8A 5C71A 1J0HA 1WE5A 4BF7A 2BY3A 2WYSA 2CPUA 3CMJA 3AXHA 3WF4A 2BNJA 1JI1A 2CYGA 1XCWA 4CN4A 1LL7A 3L4YA 1CXKA 5LA0A 2D3NA 1RP8A 4CD5A 1PX4A 3SUUA 4OBRA 4GINA 2XVNA 4HMCA 1AVAA 3VIIA 1XCXA 4BQ4A 3ZM8A 5A94A 3N9KA 3CUFA 1UKPA 5A69A 3DHUA 1JGIA 1NOUA 2QPUA 1G0CA 3AS0A 3ARWA 2NT0A 2GK1B 2VX6A 2PWEA 3N1AA 4UFIA 3KWXA 3EDEA 1LL6A 3CLWA 3A4AA 3L4UA 4TVUA 4MDPA 4TVCA 1P6WA 1AQMA 1KXVA 4J27A 1TUXA 2Y5EA 2FGZA 1EDTA 3AHYA 2YA0A 3ZJ8A 3AIRA 4MB3A 1OT1A 1KXHA 2CHOA 2VR5A 4GIAA 3K1DA 1E5NA 1B2YA 3KL0A 1XYFA 3GZAA 1V02E 1HT6A 3AI0A 1I1XA 1LG1A 1V0LA 4U3AA 1TVNA 1NARA 1DEDA 2EPKX 3OGVA 2OSXA 2YL5A 1H41A 5A6LA 2O9OA 1MFVA 4AZIA 1E0WA 4QCEA 4Z2KA 3ALFA 4CD6A 1BGAA 2VT0A 1V03A 1FHDA 4WSJA 2FHFA 1KBKA 4KH2A 2J7FA 4Q22A 3UCQA 2X2YA 3VGFA 1FH8A 4PUEA 1FOBA 3LPOA 3BAXA 3VINA 3CO4A 2ZX5A 1C91A 4AD3A 1UWTA 2VX4A 2CHNA 1WO2A 5D9PA 2WC7A 4ATWA 5CJ5A 3WY1A 4XV0A 1MWOA 3WELA 2ESCA 3I3EA 3EBVA 4M82A 3T09A 5CSUA 3WH5A 2WMIB 3WNLA 3PHAA 1IZKA 3SCNA 3I3BA 2VRJA 3IK2A 4AZHA 4LYQA 2XVLA 1HIZA 2X8RA 4UFJA 5ABHA 3DECA 5C70A 2DSZA 2OWWA 3AFBA 3VPLA 3N12A 2DSUA 4U2YA 3BH4A 1HKIA 2E3ZA 2YA1A 3OB8A 1GOQA 2GVYA 1VFUA 4JHZA 2ZXAA 2W92A 2D24A 1JZ2A 4YHEA 1W9PA 4K68A 2OYLA 5AYIA 5EMYA 1ITXA 1UQZA 2J25A 1OSEA 3WQ4A 2WMKA 5E0FA 1L0PA 1AQ0A 3UG4A 4P8UA 1QHZA 4D6GA 1KWKA 3WL0A 3AIEA 3M07A 2CXGA 5I0DA 2Q8XA 2WLYA 2IXVA 2VMFA 3AMDA 1LG2A 4W7UA 4WIWA 2BXYA 5I24A 5A8PA 1E55A 2G3JA 1HVXA 3L2MA 1TA3A 1W9UA 2Z1SA 1B3WA 2FH8A 3QHOA 3CZ8A 3ARVA 5I2UA 3PTKA 4OOZA 4AZ6A 1MXDA 3CUJA 5A6SA 2VX5A 2E9BA 4URIA 3AIVA 1ECEA 3OBAA 1XC6A 4W88A 3RCNA 2J79A 2XM1A 3F4VA 3CUIA 6TAAA 3ARZA 2WZHA 1OGGA 3O9NA 1EQPA 1I75A 4M24A 3RIKA 4DWSB 5CGMA 4TTUA 4L4PA 4Z2JA 3WMCA 2F8QA 2PF0A 3DYMA 1XD0A 2UY5A 2XIBA 5IHRA 1V6XA 3AMGA 2ZXDA 1ISZA 3VIGA 2A3HA 1C92A 2DSWA 1JDDA 4HOZA 3ZT7A 3HJEA 4OUEA 1JD7A 4XZBA 2CIPA 1BVNP 3QOMA 7TAAA 3RPMA 4ATLA 1MQQA 1XHGA 3II1A 3WD3A 4HPGA 1C90A 3WUGA 1ODZA 1SMDA 3KEHA 1BTCA 2W61A 3L4XA 3N18A 2ZUNA 1W91A 1V3IA 5I3DA 4NSBA 1XH2A 1OD8A 3MO4A 3PBGA 3SEPA 2JF6A 4EK7A 3AS1A 2DSVA 1W9BM 1XSKA 2QMKA 1V6WA 4HP5A 1WDQA 1B9ZA 1CNVA 3ZT6A 1HNYA 1JL8A 1UR9A 4D71A 1ZBCA 1BSIA 3AMKA 3WD2A 3PZMA 4UNIA 1ITCA 1H0IA 2BHYA 4D6IA 2CITA 1UKSA 4HU0A 1DP0A 1XYZA 2DT3A 3VM7A 3WDPP 5A6MA 1MYRA 2WCSA 4U5IA 1HJUA 4PMZA 4HMEA 2XIIA 3QHMA 4LYRA 1Y7VA 1BHGA 1L8NA 3AZRA 4Z2HA 2EPMX 4D6EA 4GQRA 1EGZA 3UETA 3EDDA 1UKOA 4QCFA 5CPSA 1BAGA 1C8QA 1CGWA 4DWSD 3N04A 4YPJA 2ZOXA 2WHMA 5A8OA 2XG9A 5HDRA 4CD7A 4PMUA 3K8MA 4P8WA 4UR9A 1US3A 4H04A 1MVYA 4CUCA 3OGRA 1YHTA 1EQCA 3WSUA 2DGAA 1C7SA 4KWUA 1X1NA 3MSGA 1BQCA 2YJQA 3ZJ7A 1W1TA 4PMYA 5AC5A 2WPGA 1WKYA 2GJXB 2WKGA 2VRKA 3CZJA 3UG5A 4AYSA 1B90A 1Q4NX 4B15A 2YL9A 5DMYA 3UERA 5I79A 3GNOA 1BYAA 2VVNA 3VX1A 1YQ2A 3K8KA 4X0VA 5GNXA 4AZBA 5A6BA 3QGVA 2ZX7A 5FKYA 3RILA 4X0NA 3IJ9A 2WMGA 4ZXOA 1NOWA 3VOCA 2VZOA 2HISA 2E0PA 1MW2A 3ARRA 3POHA 4BA0A 1GQIA 1NP2A 3TTYA 3TOPA 4W5ZA 1X6NA 1JAEA 4JIEA 2QF8A 4NZCA 3AMCA 3OLGA 4AZ7A 3WQWA 3WQVA 2YOCA 3VD5A 2JIWA 1D2KA 1UHVA 3NCOA 1JFHA 1C93A 2VR4A 4JHOA 2CCRA 2PB1A 5BCAA 4JL1A 1DWFM 1UA3A 4KGJA 1CGTA 2IUZA 1GOOA 1UQYA 4UCFA 2PBOA 1WZAA 4P7NA 3T0BA 2Y24A 5EB8A 5HPCA 5BXPA 3VGEA 4BS0A 5LA1A 4FF5A 1JI2A 2VURA 1UD4A 3BLPX 6A3HA 4WKFA 2VZUA 2WWCA 3MSDA 1K9TA 4J3VA 1K9EA 5HNNA 1CBGA 4UQ9A 1KXQA 3WBAA 3W4RA 2X05A 5JBEA 1QI2A 1TFVA 4DM2A 1EA9C 1LWHA 5CSYA 4IISA 3CZEA 3ZQ9A 4J3XA 4C7GA 2NT1A 5HOSA 4UQBA 1VEMA 1UKQA 4V27A 2FDMA 2WW5A 2BY2A 4M8UA 1TCMA 1FFRA 2PBGA 3OA5A 1JXJA 1JF5A 3OZOA 1J0KA 2BHZA 3WBEA 1D3CA 4LPCA 1VFFA 4UFHA 4EANA 1XGZA 5BRPA 2W91A 2X09A 2Z1KA 2J7BA 3FY1A 3AISA 2CNCA 1BLIA 3KE0A 1QVBA 3F5KA 1JD9A 1E40A 4W93A 3QOKA 1KBBA 1KGXA 2OSWA 3W38A 2Y8KA 1QPKA 1JDCA 3A47A 4MNKA 2ZXBA 1QBBA 1M01A 1UWRA 1W3KA 1UD8A 1UZ1A 1OBAA 4JFUA 3B9EA 3K4DA 1BF2A 2W66A 1J0ZA 1XH0A 5GNZA 3T2OA 1NOFA 3ARQA 3TP4A 1FFQA 1W1VA 2NW0A 4U3CA 1H0GA 5BXTA 3WDHA 1BVZA 1V0KA 4P8XA 2BY1A 1JF6A 2XVGA 1ISXA 4HOWA 3RM8A 4MPKA 4MAZA 2YLAA 3TONA 2UY4A 3IAPA 1E6ZA 1EOMA 4FLQA 4MB1A 1ZS2A 2X0YA 3DYOA 3HN3A 2WAGA 5CXPA 4DM1A 4FK9A 1IZJA 1V6VA 2EJ1A 5FL0A 4AC1X 3WNMA 3GXIA 1BYBA 4GO9A 5A6BD 1OD0A 1GHRA 1HJQA 1GPFA 1EO7A 1E6NA 1EIBA 4JCLA 2F61A 4PYSA 1GUVA 1CXLA 4F9DA 1QNRA 1JG9A 1PX8A 2ZX6A 2YBTA 4UZSA 1QBAA 2QV4A 1GZJA 2D0GA 2WVTA 1W2VA 2EBNA 1VEPA 3PZIA 3MMDA 4N0RA 1PPIA 2WHKA 3VGBA 2WVUA 1OIFA 2DDXA 4L4OA 2V3GA 4PMOA 2WBKA 4M1RA 1OWQA 4V28A 4F8XA 3NIYA 2C8NA 1KR0A 5A2AA 4DWSA 4HZ6A 4QLJA 2XM2A 3VILA 1J12A 3MUY1 3MUAA 3WDQA 3WF1A 3WMBA 4GZIA 3W0KA 2A3BA 1XD1A 3FHAA 2DEPA 1H11A 3AZSA 3WEZA 4WF7A 1R8LA 3WMSA 2AOSA 3RJYA 3FN9A 3AICA 3MV11 1WDSA 1W9XA 2AMGA 4JFSA 2JEQA 3VMNA 2CBIA 4PTVA 3DHPA 4AMCA 1V3MA 4W85A 2PI6A 4ZFMA 1UWSA 3UESA 1GJUA 3O2LA 1E6PA 1CGXA 3WKZA 5A1AA 4CD4A 4PUDA 1SFSA 3A6OA 1O7AA 2X0HA 2YLLA 4PCSA 3NUKA 2DT2A 2WMIA 4CGTA 1UR0A 3JUGA 3BLKA 5M5DA 3LPPA 3VGGA 1UR2A 2J4GA 1PBGA 4AZCA 2ZUWA 4LQ1A 2VI0A 4MJ4A 1DTUA 3LPFA 3OLEA 4MTVA 3OG2A 1JZ3A 2XFYA 4D6JA 1QHPA 4S3KA 4LX4A 2OLHA 1VRXA 1M53A 2GJPA 1OB0A 4PCTA 1WB0A 1XH1A 3LMYA 4CN6A 2O9TA 2WB5A 5IHSA 2YBUA 3BSHA 3SUTA 3VIPA 1NWTA 1Q6EA 5A6JA 5GQBA 4AD2A 2VC9A 3ZOAA 3VD7A 1ISWA 4E2OA 2ZUSA 2DIEA 1Q6DA 2ZUTA 5BXRA 3PTMA 3SURA 3ARYA 3ARUA 1CEOA 2UWFA 2WSKA 3F5LA 4D72A 1VFMA 3GDBA 1AQHA 4Z2GA 4WLCA 2W62A 3CUHA 2W67A 4U33A 1B3ZA 2CKSA 3OLDA 3UR8A 1H09A 3BAWA 2WM0A 3EYPA 4B3LA 3NDZA 3M7SA 3VTRA 2DPEA 1HJVA 4JKKA 3ZJ6A 1CYGA 3WDRA 1HJSA 2XUCA 3CTTA 3MMWA 3W37A 1V08A 3K46A 3EMZA 5A6KA 5D8WA 3GH5A 4HA3A 4AY1A 2G3IA 5FD0A 1GQKA 3KL3A 1CENA 1MW3A 3MS8A 1M03A 1QI0A 1UD3A 2VJXA 1KCKA 1UH2A 4WKAA 4J28A 5D9MA 2FHCA 1UWQA 1V6UA 5CLTA 4ACZA 4R27A 1W3LA 4M80A 1F4AA 1AMYA 3QR3A 1VJSA 2V3FA 5BROA 4UFKA 4UOQA 5DO8A 4PMDA 4XX6A 5TD4A 3G6MA 1J11A 3ZSTA 1DWJM 3W28A 1US2A 2UY2A 1QOXA 4ML4A 1A47A 3G6LA 1JNEA 1TA3B 4AZ5A 3T2QA 2OYMA 1Q6GA 1VAHA 2WLZA 1JZ6A 3RJXA 1UD6A 2Y4SA 2XHYA 2GFTA 1QW8A 1RH9A 4GQQA 3OGSA 2W63A 5CLWA 2XPKA 1RPKA 1UOKA 4U2ZA 2RGMA 4J3WA 3PZNA 3VMPA 2WNWA 1O6IA 1E5JA 1E70M 3PZTA 1W3HA 4A4AA 5CPTA 3VDAA 5HXMA 3W82A 2J62A 1H2JA 4HOXA 3MUIA 4CU8A 1WZMA 5DF0A 1E6QM 1QI5A 4AIEA 3WH8A 2JE8A 1E0XA 3FAWA 4CU7A 4UTFA 1CXEA 3UEQA 1JIBA 2J7EA 4J3UA 2G4FA 4QLLA 1BYCA 1J0IA 1VBRA 3WH6A 2VZSA 1E4MM 4FLRA 2J77A 3AJ7A 1KGWA 3GYCA 3VMOA 5DT7A 1W1YA 2CBVA 4PMXA 4D6CA 1E71M 3W26A 3RDKA 4LYPA 4A3YA 1WAWA 4W8BA 1QI3A 2Y8VA 4AEFA 1U2YA 1E4LA 1KXTA 1GOIA 3APGA 2WMHA 3AHVA 2EQDA 2YA2A 1IV8A 2E9LA 3VDHA 1HL8A 4HTYA 2J47A 1NM9A 5I5RA 3ZT5A 5FL1A 4BQ3A 2A3CA 2D20A 4PEEA 3ZMRA 2BFGA 3U7VA 1QNPA 2ZWZA 3AXIA 4W87A 1NP0A 1HF6A 2V5DA 4JFWA 1JAKA 3SUWA 5A95A 3GM8A 1GORA 1KR1A 3D5HA 2D0FA 4W84A 2V3DA 5I23A 3U57A 1XRVA 5IFTA 2ZXQA 1PX3A 3WFZA 1ZBKA 1HKKA 1V3KA 3ZJKA 3BC9A 4BQ2A 2WCGA 3B9AA 1V0MA 4GZEA 1FH9A 1E0VA 2WSPA 4DUXA 5A8MA 4CU6A 4YHGA 4HMDA 3NDYA 1ODUA 1SR0A 3VX0A 4EAMA 2VO5A 1EHNA 3GXDA 2QHAA 1TR1A 3GNPA 3AMLA 3CHEA 1X6LA 1TE1A 2IXUA 2BY0A 4PRWA 4QP0A 4AZGA 1M04A 2QMJA 3FHQA 2GSJA 1CPUA 1KCLA 1UD2A 3VD3A 2CEQA 3DC0A 1PZ2A 4E8DA 4GKLA 4TX6A 1R85A 4B9YA 1D7FA 4GXPA 4PTXA 4OOUA 3EDJA 3KL5A 1ISVA 4M29A 1SMAA 3BMWA 3TA9A 3GNRA 5JBFA 3L4WA 1JZ4A 2EPOA 2GJXA 1MXGA 5A2BA 4MNLA 1Q6FA 6CGTA 5IFPA 1JNDA 1PIGA 4C7DA 1W9DM 3VGDA 1HJXA 3AYRA 2WVSA 1GOWA 4HZ7A 1MFUA 2VNCA 2V5CA 2E8ZA 3ARSA 1A3HA 1UUQA 2XSBA 4YN5A 2C7FA 5I78A 1E1FA 4EE9A 4WSKA 5D4YA 1JZ7A 4XZWA 1H49A 4GO8A 8A3HA 3GBDA 3UG3A 3N15A 2VUYA 4KRTA 4AD1A 1NWUA 2VRQA 3EDKA 4MNMA 3WUEA 5BWFA 1WZLA 2WC4A 5A2CA 3ZO9A 3ZSSA 3W24A 1J01A 1J0YA 4QFUA 5ABEA 5IXEA 2WKLA 4GI6A 2A3AA 4UOZA 3B9DA 4ZEPA 3VNYA 1GOKA 2QLYA 4TVDA 3TTQA 1V3LA 3WD1A 3WNNA 3VIFA 1ISYA 1XV8A 2XFRA 3VVGA 5BXSA 3BGAA 4PBGA 4CN1A 1WP6A 1G01A 2D22A 4HU8A 1R7AA 2NSXA 3RMEA 3AROA 1LQ0A 3CHDA 3WUBA 1UR8A 4DUVA 3GH7A 5CPQA 2CERA 1NQ6A 3A4WA 3PZ9A 1QHOA 5A8QA 1OIMA 4M81A 1KB3A 3PZGA 3CBWA 1HN1A 1F4HA 3CIVA 3W6LA 2BVTA 3ZIZA 4D6FA 2OYKA 3NYDA 1U33A 3WNKA 5M3WA 4BZYA 3VIKA 4W5UA 4AEEA 2OWXA 1MW1A 2VQTA 2FH6A 5AC4A 3WL1A 3KZSA 2XGBA 3UR7A 4PN2A 4B16A 1HKMA 2ZUUA 5D8ZA 1TG7A 1B3XA 3WH7A 4XUYA 1DWGM 3VIOA 5HBFA 2TAAA 1PIFA 4TUFA 4U31A 4OBSA 4AISA 4CVWA 1UH3A 1Z32X 4HA4A 2JF7A 3WIJA 4JKMA 1OGBA 3VIHA 5AYBA 3NSNA 1E15A 2UY3A 3VD9A 5M03A 1BGGA 2XYLA 4GI9A 4W89A 4BQ5A 3CHFA 2YDSA 1FA2A 5ECUA 4UFLA 3WDJA 4E8CA 2F2HA 1R86A 1H4PA 4MDOA 2PWGA 3SUVA 4PMVA 2XFFA 1LWJA 1KQYA 5FOOA 1CXIA 2WANA 5E9AA 3THCA 1JZ8A 5GNYA 1JFXA 3AQUA 5GPRA 4B3KA 3GXMA 1E1EA 3K8LA 2YKKA 3LPGA 4IUGA 4Z2IA 4AXNA 4OIFA 2EXOA 2G3MA 3PZUA 5KEZA 1CZ1A 4UZUA 1TVPA 3VO0A 5ABFB 4F9JA 4NI3A 2FHBA 3CGTA 2E9MA 3AHXA 1EO5A 4PTWA 3FAXA 3SCVA 5LA2A 3WQ6A 4GI8A 3VGHA 3T08A 3FNDA 1EOKA 4P7QA 4JCMA 4UQDA 3SCQA 7CGTA 3L2LA 3AZTA 4H7VA 3U5UA 1E6RA 3WF0A 3FXYA 1KQZA 3WF2A 3AHTA 2BXZA 3AIBA 2BHUA 4ACYA 4A3HA 4JFVA 2EEXA 1JZ5A 2WMFA 4D1IA 1J9YA 1B0IA 1GONA 2ZUMA 3CZKA 1E56A 1G9HA 4RL3A 3WQ8A 3SCSA 2DH3A 1JYVA 3BMVA 4MJ2A 4P7RA 4Y7EA 1GVYA 1E3XA 1UWIA 1M7XA 3AIWA 1VIWA 3MV01 3VDBA 3AYSA 2XWEA 5I77A 2PWFA 1SYTA 2WMJA 3N13A 2DT1A 3AHZA 1UH4A 5EFDA 2JIEA 2WVVB 2E4TA 1V3JA 1CGUA 2ZIDA 4W86A 3SUSA 1QNQA 1GQJA 5A3HA 4J3SA 1CIUA 1G94A 2J8GA 2G8ZA 1BG9A 1H3GA 4FLSA 1W1PA 5FCZA 1FP8A 1FP9A 5D9NA 3MANA 2V3EA 1TMQA 2WCAA 2ZWYA 5EFFA 1KFWA 4OZOA 1C8YA 3BAIA 2CBUA 5JUVA 1VJZA 1VBUA 5CGTA 2E8YA 2CESA 1LF1A 3VD4A 1GQLA 3N11A 2DT0A 4KGLA 5DT5A 1UA7A 2O9PA 2MANA 2VCBA 3EMQA 2BS9A 4TX8A 4JKLA 3E1F1 1UD5A 2QPSA 5FIPA 3PZOA 4LGXA 3BSGA 4X9YA 1GJWA 3B8SA 4KRUA 1GHSA 1W2PA 3VKKA 1LJYA 2ZICA 2D23A 1E9LA 1CDGA 3J7HA 4NF7A 1JYNA 1J0JA 3IANA 2WHJA 2G3NA 1KGUA 1W32A 2XJ7A 4MAVA 4Z2LA 1K9DA 4AWEA 3WNPA 1E6SM 1J18A 1ZJBA 2D3LA 4H41A 1OT2A 3EDFA 3GTNA 1CTNA 1HVQA 1ZBVA 3BAYA 1FHLA 1GNXA 1DWHM 4CCCA 3BAKA 4N42A 1CLXA 1V6YA 3GBEA 5E6ZA 2DIJA 4ATDA 1LLOA 4JL2A 1OM0A 3BAJA 4TOQA 4CCDA 3CHCA 1E73M 1NWRA 4JZ5A 1WZKA 3A3HA 4WK9A 3SCRA 4H8VA 1NH6A 1H1NA 4PMNA 2VVSA 3WEMA 3NSMA 3WENA 4MB5A 3F5JA 3S2CA 3MMUA 3ARXA 3U7BA 4B9ZA 5HPOA 2YDQA 3OLIA 4PMRA 3ARPA 3VDCA 1JDAA 1RD6A 4ACZB 4C7FA 5I6SA 4D1JA 4TXEA 2BV9A 4RE4A 3ARTA 2WC3A 4UQCA 4QDMA 3AIQA 4TTGA 3SIMA 4DWSC 2ZX8A 1BYDA 1HXJA 2VX7A 2YL6A 2A3EA 2ZUVA 1Q6CA 1UR1A 3DYPA 3PZQA 3RO8A 2XSAA 2EO7A 2D2OA 2O92A 5CQ1A 2DSKA 1JXKA 4U5KA 1WDPA 4PSPA 4PMQA 4IM4A 5EBAA 4F66A 4V2XA 4AIOA 4EKJA 2ZX9A 2J78A 1DWIM 4HPHA 3HU7A 3FW6A 2WK2A 3AXXA 1G1YA 3L4VA 3W29A 3O6AA 2XVKA 4UOJA 3WNOA 1GCYA 2J7HA 2VCAA 2OWCA 3W27A 1TZ7A 2W4XA 1VENA 2PWHA 5CZKA 4PSRA 5E09A 3QHNA 5DFAA 1E4IA 4H2CA 3WD0A 1OINA 5DEZA 2WVVA 1C8XA 2W5FA 3T2PA 3MKKA 1E3ZA 4QAWA 3S6TA 3ALGA 4UFMA 4J7RA 5ABFA 2VCCA 1DHKA 4MB4A 3W81A 1EDQA 4DUWA 4UQAA 1CGYA 2PWDA 1ZU8A 2AAAA 5A6AA 3EMCA 1BFNA 4P7OA 1UWUA 2E40A 1CXFA 1B30A 2WWDA 2J75A 3MU7A 3GH4A 1C3FA 1U30A 1EDGA 1CXHA 1MW0A 4GZJA 3BCDA 7A3HA 4FLOA 1JYXA 4JAWA 2CKRA 1B3YA 3W25A 2DQXA 4NRSA 1ZL1A
chains in the Genus database with same CATH superfamily
4JGDA 1XDJA 1DWAM 4NXKA 4Q6XA 3SY1A 3QW3A 2A6LA 4GRSA 1V93A 2VEFA 2I14A 3PUDA 5LSMA 5SWUA 3E12A 2OGJA 4UTTA 1S1RA 3LRKA 2XGIA 3P5ZA 5EU9A 2QW5A 1L6FA 4HU3A 3SCOA 5D38A 1VPYA 3B03A 4O1AA 4KMQA 1XXXA 6ENLA 4JICA 4GPNA 3HG2A 1V4YA 3B4UA 3TTSA 1QK2A 1ZENA 2ZRZA 3WQ5A 2Q71A 1A5UA 1S46A 2GDUA 3BCJA 4DAFA 2RGLA 3W6MA 1F6KA 2FTWA 2EPLX 1TJRA 2YPIA 3A4XA 3EOUA 4BWLC 1B3VA 2V38A 3VI2A 1GW1A 2WHLA 4AY7A 3THDA 4YJ5A 3M0HA 1UZ4A 2R1KA 4FMVA 2YL8A 3KOFA 5KETA 1V0NA 2GUYA 3IGHX 2R9RA 5CC5A 3CMGA 2A79A 4CD8A 4ICCX 4WY0B 1KWGA 2HVMA 5B80A 9XIMA 4HK7A 1C7TA 3CAVA 3ANYA 1XPGA 2QJGA 1SZNA 4NZ1A 3VKAA 3AXMA 3ECQA 3BXWA 4FXRA 4QISA 4YYCA 1ZTVA 4AWTA 4MWAD 4Q8NA 3WF3A 4JIQA 1PAMA 3XIMA 1PJ9A 4JBRA 1P0KA 3ABQA 3G1SA 3H2CA 1F2JA 4Y9PA 3KBMA 2BVDA 3CZGA 3HTWA 3PZVA 4FIRA 4LUJA 1FBAA 4UTWC 2OKOA 1ALDA 5CSSA 3SCUA 1HP5A 4MFDA 4NP7A 1JDFA 1EC8A 3SO7A 4GYPC 4UR8A 4AIUA 1VEOA 2WO5A 2QVNA 4PTMA 3W75A 1US0A 4P8VA 3VM5A 4KESA 4JTJA 1Q7ZA 4F79A 4RE2A 4IXHA 4GC4A 3KOZA 5ENLA 4LCRA 2OCZA 3AS3A 2QULA 3I10A 1T96A 1KD0A 5DMLA 4HZ8A 2X16A 3CQ0A 1PB0A 1DJQA 1J10A 3C2YA 6ALDA 2XWDA 5IBXC 4LS2A 2UZ9A 1DJWA 2UV8G 1CECA 2P10A 1GVIA 1OCQA 1QW9A 3NQEA 1FH7A 2PDQA 2OSYA 3L4TA 3RXZA 2DH2A 3QZAA 2E5BA 1P4CA 2FZ9A 2X1UA 4ZOAA 3LI1A 2AQWA 2GQ8A 1DIKA 4W7VA 3KBJA 1XYAA 3CZLA 1NWSA 1XGDA 2CBJA 4GK8A 2AGKA 4UQEA 4C6CA 1XIEA 4ILSA 2VOTA 4F2BA 4RNJA 3QPEA 2PDHA 3S5OA 1EGMA 3MQTA 2QAFA 3EOLA 2BP1A 2WZIA 4R88A 1JQXA 4XVEA 5LNWA 4C6MA 1QNOA 2Y1HA 1SZGA 3E3HA 3D46A 4HVXA 1Q8JA 5C71A 4UMBA 1F3XA 2ASHA 3T42A 3KLLA 2BY3A 3F4WA 1IEIA 3CMJA 3VE7A 4UTUA 2BNJA 1JI1A 2OQHA 1XCWA 1OG0A 3L68A 5LA0A 1KC7A 1FWTA 2XVNA 5LKYA 1M41A 6PTDA 1XCXA 1UKPA 3T1GA 1A0DA 4RZ4A 5A69A 3IVUA 4ERGA 3KOWA 1U1HA 4DJEC 2VX6A 2PWEA 3KWXA 2OGYA 4UBPC 3CLWA 3A4AA 3LBMA 4TVUA 1MNSA 4PFHA 1GPWA 2YW4A 1AQMA 3F1QA 4J27A 3OJGA 5EBUA 2DZWA 1AJ0A 1EDTA 3N2MA 4JTEA 3PJXA 1L2QA 4NZ5A 4KEVA 5DN1A 1KXHA 4EAYA 3UXAA 3M43A 3ABZA 3K1DA 2IPJA 3PAOA 2JGYA 3P93A 3UVIA 3PBYA 3UBPC 1QWGA 3Q67A 4X22A 1P0EA 1UUMA 1DEDA 4L1GA 1M68A 1PVNA 3BLOA 4XBKA 1TPFA 4JQAA 1A5KC 5A6LA 3PNZA 4DJDD 3UWZA 2BBFA 4DJED 5AOUA 2RAGA 1PTDA 2H3BA 1TREA 4KWSA 4Z2KA 2OOGA 3ALFA 1JCTA 5BNKA 1WKEA 2ZRUA 1V03A 3M5VA 5CPMA 2DUZA 5XINA 3V5CA 1VRDA 1FH8A 3LPOA 3VINA 1QOQA 3EX3A 2WC7A 4IMCA 5CJ5A 1EUNA 3WY1A 3E2RA 3QMSA 3KRUA 4NI8A 2ESCA 2C1GA 3I3EA 3TYUA 3WELA 5CSUA 3WH5A 3I4KA 5FESA 2L5HA 1FCQA 2VRJA 4YVVA 4US6A 3IK2A 4UB9A 1YX1A 1S5NA 3W01A 1IEWA 4DHGA 2OB3A 2X8RA 2HRWA 2DSZA 2OWWA 1LTDA 3AFBA 3N12A 3ZZ1A 3BH4A 4YMZA 1F8MA 3GRIA 2CZFA 3RF9A 2A7NA 4JHZA 2ZXAA 1IWAA 2PDKA 5EMYA 1ITXA 4RUBA 2J25A 1KM1A 1W5OA 3E0IA 4K6AA 1S2VA 3WL0A 4GJJA 4H9ZA 2OT1A 5MF5A 4NZJA 4I7UA 3LHYA 1OZMA 4O4WA 5DMNA 3P7YA 1E55A 2NVDA 1HVXA 1ICPA 1TA3A 3W74A 3S6DA 5D04C 1TRDA 2ISWA 2Z1VA 4C1LA 3S46A 2DW6A 4INFA 1UR3M 2V5LA 4BWLA 4G6CA 3KBNA 2EG6A 3CUZA 1FWRA 4CQCA 1W8GA 3F4VA 1W37A 1F07A 6TAAA 3ARZA 1OGGA 3O9NA 5FJPA 1B54A 1Q45A 2A21A 1I75A 1XRTA 3LEPA 4YTUA 4LS0A 3NQBA 3AUJA 3GLCA 3H12A 4Z2JA 3WMCA 3I6TA 2X2GA 3AO0A 3UR2A 1EWEA 4K1GA 2PD5A 1XD0A 1A49A 3ANVA 4NKCA 3TSDA 2G4JA 3TYAA 4N4QA 2ZXDA 1IXQA 3ERPA 4CQ8A 4KKXA 1KM2A 4MLRA 1S1PA 2Y7GA 1DJZA 4C60A 1BVNP 1PKMA 2TMDA 3RPMA 4JTDA 3RO6A 3ES7A 3CJPA 1ODZA 3KEHA 2W61A 3L4XA 4DBDA 2FFIA 3B3DA 1DIOA 1W91A 2VGBA 3LY0A 4PRRA 2Y8UA 3FSTA 5HMFA 2ACRA 3AS1A 2ONEA 1ADOA 1UW9A 1AZ2A 1VBHA 1IT8A 1HNYA 4X2PA 2PODA 1BSIA 3AMKA 1ITCA 2BHYA 2CITA 1F9CA 1EJSC 3NR0A 4TU1A 3T0CA 3LHUA 1XYZA 2R1NA 2QUTA 2V2HA 3VM7A 1JR1A 4HPXA 3CQHA 5A6MA 4GOAA 3DHDA 4HMEA 2XIIA 5JVLA 2GWNA 4S3CA 4LYRA 1BHGA 3AZRA 1W3TA 2EPMX 1E0UA 4K7VA 1EGZA 3EDDA 3TWBA 4CNOA 1CGWA 3ZS4A 4ERAA 2WHMA 5A8OA 1IIHA 4C6PA 4PMUA 1W3NA 4UR9A 4M5PA 4G1KA 1YXCA 1BQCA 2YJQA 3KXQA 3ZJ7A 2Y6ZA 2E6FA 4PMYA 1TO3A 3R10A 1WKYA 2WKGA 3CZJA 4D2JA 3GDMA 4A3RA 2DZUA 4NAEA 4LFYA 4MLJA 5DMYA 2VVNA 1YQ2A 4X0VA 1E0TA 1PTAA 5GNXA 4WOQA 4AZBA 3YPIA 3RILA 4X0NA 1KV5A 2VZOA 1VKFA 1MW2A 1Q63A 5HNTA 5LXXA 1JAEA 2B7NA 1J8VA 1VBGA 4JIEA 4EACA 1TIMA 1QFEA 5CPOA 2ZKMX 5BMXA 1TYGA 3TEVA 1D2KA 4KBXA 4JIRA 4JHOA 4XKMA 5BCAA 4JL1A 1XDLA 4IX2A 2QUVA 4KGJA 9RUBA 2IUZA 1J5SA 2C18A 3V18A 3ITVA 3O05A 2HE8A 2WQPA 3SZ8A 2Y24A 3GFYA 3VZZA 4KEZA 3BLPX 4I6VA 3UW6A 1NSJA 2WSQA 4HU4A 4HYWA 5HNNA 5K3VA 3M5YA 3UWVA 4UQ9A 1KXQA 3L23A 1TFVA 1VFTA 2VFHA 3R58A 1FWCC 4RXFA 3S1WA 2QDGA 3R79A 3S42A 3TC7A 1VEMA 5AZ0A 3DG3A 1TCMA 8TIMA 4D8ZA 4ZMGA 1W5PA 5FJIA 3G24A 1ZP4A 1JXJA 3U4AA 1I60A 3MUXA 2BHZA 4XAYA 4WGHA 1D3CA 4O17A 1XGZA 3UXDA 1XF0A 3THQA 4FNPA 2I5GA 3FY1A 1UWAA 1EJ7L 3F5KA 5HAOA 1JD9A 1A5CA 1FWFC 4O16A 1IHIA 3QOKA 1C9WA 1KBBA 2OSWA 2Y8KA 1QPKA 3A47A 1QBBA 4KWVA 1FWEC 1W3KA 3BV4A 4O11A 3UNDA 4JFUA 3B9EA 3V1PA 4JEJA 5D33A 3H6OA 1RA5A 3ARQA 5CSRA 1FFQA 3Q94A 1W1VA 2NW0A 1H0GA 4P8XA 1JF6A 1ISXA 4JTGA 1ZJHA 1EYWA 1NY1A 4WX2A 2YLAA 3TONA 3E2QA 3HM7A 1PZ0A 2QIIA 5C7HA 5DX7A 1LDCA 5CXPA 4DM1A 4FK9A 2REQB 3QYSA 5FL0A 3UF9A 4HN8A 3M0XA 1YKWA 1EO7A 3LQLA 3DHFA 3N2XA 1PX8A 3JZEA 2YBTA 4RDVA 2P88A 4DJEA 2QV4A 1SVDA 4FNRA 4MWAB 2WVTA 3ATYA 1T8XA 3H7VA 4FF7A 3PSWA 5KZEA 5FF4A 2GVGA 3APYA 1E1CB 3W7NA 3PZIA 1GTEA 4LAOA 5DXYA 3EKZA 1Z3NA 5F1UA 3VGBA 1H61A 3PFRA 1SM9A 4C6EA 1W31A 1FX6A 4GBDA 2PDNA 2WBKA 2VENA 1KO0A 4F8XA 5G1TA 2C8NA 3CASA 3WX7A 1OG6A 3ES8A 3PULA 3LXCA 5A2AA 4DWSA 2RDWA 1ZALA 3IRSA 4QLJA 2XM2A 1I45A 2CZ5A 3MUY1 1O5QA 3VKDA 1JVNA 2CLKA 1TR9A 3GY1A 5A5WA 2IPGA 2V82A 3DENA 2J27A 3FHAA 1UJPA 3W1MA 4WF7A 5KZDA 1R8LA 3TLQA 4KPLA 3RJYA 1H5YA 3HGOA 1WDSA 3WLJA 4JFSA 3TQVA 4AMCA 1V3MA 3B04A 2PI6A 3WQCA 3HIJA 4N02A 1GEQA 5D05A 2ZFAA 3ITGA 1CGXA 3NOEA 4PUDA 1W1ZA 3DFHA 3SRHA 2DT2A 3W2KA 1SUXA 4XZIA 1UR0A 3JUGA 2ZZ6A 3WFAA 4RW3A 2TPSA 4G2DA 3C3UA 5M5DA 3LPPA 3VGGA 4JNMA 5IRPA 5G1YA 3KDOA 1PBGA 4AZCA 2HXUA 4OV4A 4BI7A 1TPB1 4LQ1A 1BXNA 7ENLA 5LIXX 3GVWA 2VI0A 4MJ4A 3NEVA 3OLEA 5AFDA 1JZ3A 2QPXA 2XFYA 3LB0A 1FHVA 3B0VC 2F38A 2Z6JA 4S3KA 3LQGA 2OLHA 2P0OA 3COTA 1XH1A 1V7AA 4CN6A 3BSHA 3SUTA 2DZPA 1LORA 5HK4A 3GNXA 5A6JA 1O1ZA 4MGGA 3VD7A 4ZOBA 4E2OA 2NLYA 1EJVC 5BXRA 4LS1A 4KFOA 1AL8A 1IT7A 4UNKA 2WSKA 1PHWA 2BODX 1KFCA 2HSAA 4EOUA 3MWAA 1UB3A 4WLCA 2W62A 3CUHA 4GXMA 4JIHA 1DKWA 3OLDA 4B5TA 1H09A 4LAMA 4GVFA 1UP0A 3DUGA 2ZE3A 4JKKA 4ZL1A 4G8TA 2YCLA 1ONWA 1THFD 1UMLA 1MO0A 2PD9A 7PTDA 1FWIC 4U4MA 1D3GA 1GQKA 3KL3A 1OX6A 2ABAA 5FAJA 1KCKA 2P3EA 4WKAA 5D9MA 2FHCA 5LHEA 5JH2A 3CC1A 3IIVA 4IUOA 4HSHA 3ONCA 4M80A 3KW3A 4UOQA 1PKLA 4PMDA 1JPMA 4XX6A 1M7OA 2FZNA 2ZRVA 3QV6A 1US2A 1QTWA 3B8DA 6XIMA 1TA3B 1IXOA 3DFYA 4W4QA 4IP4A 4DIAA 1G7VA 4LV9A 2I56A 1UD6A 1QW8A 3OGSA 4U2ZA 3MT1A 3LRMA 4QROA 4O0KA 3VMPA 1VS1A 3DH7A 3S2NA 1O6IA 2OR2A 2W79A 3S5ZA 4F0KA 4A4AA 3ZLHA 3EZ4A 4L6OA 3QEZA 3DFPA 1IEVA 4S3BA 1WZMA 3NL2A 4GJIA 2ATSA 4NQ1A 2WJEA 3TX9A 3WH8A 2JE8A 1E0XA 1YW1A 4CU7A 1CXEA 1B5TA 5HJXA 1E4MM 3LOTA 1KGWA 3NO1A 3DIPA 3P67A 3VMOA 4E8GA 1A5NC 3SY8A 1FKXA 1A3WA 2CBVA 4A8LA 4D6CA 3W26A 4YCOA 1M3UA 4DVOA 2PDBA 3MYOA 4IJBA 3PAJA 1PHQA 3RRXA 3EWCA 4W8BA 1KLZA 3UPBA 1E4LA 1KXTA 4XO7A 1ZRQA 2QJMA 3APGA 5AC7A 4XSLA 2E9LA 3MW7A 5I5RA 3ZT5A 3KX6A 5FL1A 3BE7A 4XUGA 4RZBA 4IXXA 2ZWZA 4O1BA 1JQVA 4RJEA 3GU2A 3QKZA 1VYSX 3PF3A 4W87A 2V5DA 4JFWA 1OC6A 4LUTA 1SO6A 3GM8A 3PR2A 1GORA 1Q6QA 3UCCA 4W84A 5I23A 2ZC1A 3U57A 3NO3A 3UA3A 4GMEA 3S9ZA 4DJFD 2DP3A 2C79A 3IWPA 3ZJKA 1EF3A 3LK6A 3MKCA 1D9EA 3H23A 4G1NA 1P5BA 3EPMA 4QIUA 1VC4A 5F4SA 2E77A 1SO3A 4YHGA 3UJSA 1ODUA 3SI9A 2HTMA 2YB1A 4FR1A 2VO5A 2Z0IA 3NGFA 4QS6A 4DY1A 1TWIA 1RBAA 1NDVA 1TR1A 3AMLA 3CH0A 1TE1A 2IXUA 5D09A 1OFRA 4GYPA 4XAGA 1PZ1A 5H8MA 5HUPA 4I9MA 1KCLA 1FWJC 3DERA 5G4EA 1PZ2A 1AD4A 4TX6A 4B9YA 4WRHA 3UFYA 3ME3A 3FK4A 3TA9A 3L4WA 4IT1A 1VLIA 5A2BA 4MNLA 4KERA 1XINA 1Q6FA 1X38A 6CGTA 4Z1BA 1JNDA 1PIGA 3LGEA 1SW3A 4FI4A 2GGJA 2WVSA 1B9BA 3KBSA 3NZQA 2PU1A 2FQIA 4JNYA 3WQFA 1MFUA 1R38A 2V5CA 2E8ZA 5D2WA 2C7FA 4Y96A 1E1FA 4EE9A 4PCNA 3A3XA 2TODA 4Q7IA 3GBDA 3UG3A 3NEHA 2VUYA 2FVKA 4H3DA 1RLDA 5HULA 2VEIA 3B8VA 5ABEA 3GG0A 1NDWA 1E1CA 4IMEA 3BG9A 3P8JA 4EWND 3ISIX 3WLQA 3TCEA 3G1AA 3INPA 3DFSA 4JXCA 1XIIA 3WNNA 3VE9A 3MI3A 4GNKB 2Q3OA 1DJHA 3F03K 2QUNA 4H8NA 2D22A 2NSXA 1R3QA 3RMEA 3CHDA 3WUBA 1UR8A 3T40A 4DUVA 3VCCA 5CPQA 3C8NA 3A4WA 4UIOA 4XO6A 3CLMA 3GHSA 3WYZA 3CIVA 3WLSA 1DVJA 2Z2UA 2ISSA 3WNKA 5M3WA 4W5UA 3QR0A 1GVEA 4KW2A 3WL1A 1UZHA 2PGFA 5DBTA 2ZUUA 4XUYA 1YYAA 1AL7A 3VIOA 4DBEA 4AISA 3K2GA 3PUOA 3EKGA 3KVLA 4Z42C 2RDUA 3WIJA 2BDQA 4OV9A 3IV3A 4JKMA 5CBJA 1BGGA 4GI9A 2OLAA 1LQ2A 4BQ5A 2YDSA 2PTDA 2EJAA 1KM0A 4GH3A 3PFMA 4E8CA 1JUKA 3HFTA 3GC4A 3LCWA 3OO2A 2BX7A 3UZ5A 5FOOA 3H53A 1JFXA 5GPRA 4B3KA 1GYMA 1N8WA 2VC6A 4JYEA 4EWJA 2D73A 4QNEA 4AVFA 4Z2IA 1R3SA 4OIFA 2G3MA 2PDLA 4UZUA 2PDYA 1TVPA 4ZOCA 5DRCA 1W5MA 2FHBA 3BW2A 2ACSA 3QBUA 3N2BA 4HYVA 1LZOA 2C13A 4KEUA 3AHXA 2HBVA 3WQ6A 4GI8A 4OFCA 4JN6A 3FNDA 1EOKA 3MCOA 1RQHA 3L2LA 3HV9A 3U5UA 4GFIA 1E6RA 1QWKA 1SZRA 3THUA 3WF0A 4ORMA 3KRSA 1KQZA 4GUHA 2FPVA 2BXZA 3IIOA 2QCDA 1U5JA 4WXYA 2WMFA 1CW2A 1UIPA 2W27A 3HA1A 1EC7A 5EMKA 2ZUMA 2NV1A 2PWUA 1E56A 4RL3A 4QQUA 3WQ8A 1JYVA 2PZ0A 3AU2A 4C91A 4P7RA 1E3XA 4A21A 1XX1A 1BF6A 3AIWA 3VDBA 2XWEA 5E0KA 2PWFA 4I3GA 4EPKA 3WQPA 2WMJA 3N13A 4HNUA 1F6PA 2IPFA 4I7WA 3HGRA 5HJYA 1QNQA 3GR7A 1IR1A 1GQJA 3QMTA 4TX9A 5A3HA 1CIUA 5HWMA 2NQ9A 5H91A 4GKTA 4FLSA 2ISVA 3GVRA 2ZC8A 1XLDA 5D9NA 1BKSA 3HPXA 3UU0A 3ZYZA 4NAEB 2ZWYA 4JN8A 3M1ZA 1KLYA 1PUDA 3R12A 3B0YA 5F4WA 5LGZA 3GDRA 1OQFA 3W6YA 3I4EA 3G1HA 2GDQA 1UA7A 3N3MA 3WLHA 3D0CA 3VOHA 4DEFA 1PKNA 3PWGA 3T44A 2DW7A 2GUUA 4X9YA 3M0YA 3QC0A 5FSDC 3B8SA 2HMCA 4FNSA 1AD1A 1FKWA 4KT2A 3SN4A 3W1QA 1RK6A 3LRLA 3MZNA 4E2BA 4NF7A 4S3AA 5HA7A 3GNNA 2G3NA 4FOJA 4MAVA 5FF2A 1A5OC 4AWEA 2GVLA 1HUVA 3VUSA 2WJZA 2OZ0A 1ZJBA 4UNLA 1OT2A 3EDFA 2J9ZA 1ZBVA 5E5CA 3BAYA 2ZRXA 4LB3A 1O68A 4H6RA 1MEWA 5C2GA 3GNDA 4Z1YA 4H2HA 2RKXA 3BANA 3NZPA 5GVJA 4JL2A 2Y62A 5BWAA 1O94A 4B90A 1XJBA 4JZ5A 3TDFA 4H8VA 1VH7A 1H1NA 2VVSA 1RA0A 1XBZA 4MB5A 1SQ7A 3MMUA 2Y70A 3U7BA 3OLIA 3ARPA 1JDAA 3RITA 5CPLA 1Q2SA 5C7VA 4C1KA 2BV9A 4NZFA 3BARA 3E9AA 2DJLA 5I03A 4LH8A 1MDLA 3SIMA 4DWSC 2ZX8A 3G1XA 4JTSA 3W1NA 4UR7A 1S2CA 2ZUVA 4B5VA 1IF2A 2ZDSA 1SR9A 2D2OA 3RR1A 1E51A 4A8IA 1BWKA 3H4XA 4Q4OA 1C29A 4EKJA 3FW6A 1SFJA 1TTQA 3NVDA 1G1YA 5I3FA 3KS5A 3O6AA 1WOAA 1P6CA 3GG1A 2F9RA 4MWAE 3QMRA 5FJUA 4B5SA 1ENUA 1NVMA 3TVAA 3V7PA 1QAPA 3GO2A 3QHNA 2V6AA 5DFAA 4H2CA 4UMCA 3WD0A 2XGZA 4PZVA 3FYPA 2W5FA 3G1YA 2VCCA 5LHFA 3SSZA 5A6AA 3SB0A 1GZ1A 4K8HA 2POZA 3TCSA 1BFNA 3N2CA 1CXFA 3NOYA 1EJTC 4HNVA 4GXWA 3GH4A 3BGJA 4RDZA 3ITCA 4PUUA 1MW0A 4ZTXA 7A3HA 4R85A 2B7PA 3FDGA 2A85A 2VWSA 1HGYA 4QXIA 8RUCA 4RPPA 3W7OA 4W7WA 2VEMA 1XUUA 1YRRA 2I5QA 2D0HA 2C1IA 5G2WA 1Z8AA 4C6FA 2G41A 4H8HA 1MNZA 3A21A 4IPLA 1LRQA 3WJWA 2C0AA 2O7SA 1B1YA 3AOFA 3OEXA 2VL4A 4PB5A 5K9XA 1E4NA 4HNLA 1EH9A 1RBLA 1MQRA 2YIHA 5E0CA 3TJ4A 2ZZ3A 1NAL1 5KZ6A 2H3DA 3KOXA 3IJ6A 1M7JA 2WV8A 4PRTA 5AKQA 4AF0A 3QGAC 4LSBA 2J74A 4LNCA 4R5EA 1A3XA 1ZGDA 3T0DA 5JQ9A 2J8FA 2HZGA 4JYFA 3NZRA 1LOQA 4NRRA 4ZENA 3MKVA 1R7OA 3OZPA 3PWIA 1O12A 4J3TA 5E6YA 2YBVA 3H54A 1U1UA 3O6CA 4XZNX 3TXVA 3W02A 4WDTA 5F4XA 2ICSA 2CLOA 3W7LA 3SFWA 4QEEA 2JEPA 4DZ5A 2BVYA 1SPQA 3KBVA 4HA1A 2VEGA 4CQ9A 1H1ZA 1UYQA 4BCEA 3NA8A 1I8JA 3RM9A 2FGLA 2DZVA 2ZVRA 1XCFA 2NZLA 3GR8A 3WUFA 1KM6A 5K4ZA 4U28A 4LAUA 3SCWA 2NV2A 2GYIA 1YE6A 4XD3A 3HB9A 3ZWTA 1TV2A 4UTLA 5DMMA 4WKHA 3TQPA 4K39A 1LL4A 3O0FA 1EZ2A 3CV7A 3V5FA 2JGQA 4ADTA 1PZ3A 1GOMA 3QPZA 1CGVA 2JKAA 1WDRA 2J7DA 3H26A 2J7CA 3SN0A 2QUUA 3SCPA 4Z1AA 2OQLA 2ZVIA 1BTMA 2W0UA 5C8BB 1BVWA 3IJ8A 3OIHA 3ELFA 4J5NA 4WDXA 2A4AA 3PBVA 4L9ZA 5LYRA 3VIMA 2QJNA 3KUMA 3NQDA 3HG4A 2OODA 1BSLA 3RGTA 3ABRA 1C8VA 4PA8A 3H21A 3VNIA 3VDGA 3BJSA 5FAGA 3A4JA 1ITQA 2JK2A 2B7OA 3QV9A 3EWBX 3CPUA 4XSMA 3CWHA 3N17A 3POCA 4M6VA 4O50A 3OIXA 1HJWA 3G22A 4ZE4A 4Y9NA 2OEKA 3H8AA 3T8QA 3QV7A 5ABGA 5F7UA 5DELA 4W8LA 3L21A 3LN3A 4OE7A 3R0UA 5AHFA 3IJLA 3AUOA 3LERA 3LXAA 1TZ9A 3GC2A 4AD4A 3G1FA 1HTIA 1ZP3A 3GD6A 3VNLA 1EB3A 1MRAA 4JTLA 3HMCA 5EY5A 1FWNA 1RHCA 3WH9A 1ZJAA 4NJJA 5HUOA 4FNTA 1TV5A 4M56A 1V3HA 1QNVA 3R7MA 1HFBA 2MUCA 4TQTA 1XLKA 4V1XA 4IQEA 3GB6A 4HQVA 2YCKX 2GDVA 3NJ3A 4DJFA 1WCGA 4L5ZA 4NASA 4O1DA 4E2DA 1AK5A 4MZ8A 3W53A 3QV8A 4IQLA 1VD6A 4HN4A 2D2HA 2FB2A 1GTHA 2D1ZA 3CNYA 1C9DA 1J0HA 2QCLA 2DZBA 4S38A 1SW7A 1YPFA 3V0UA 4CN4A 1TZZA 3L4YA 1X96A 4FX6M 4X61A 1RP8A 4CD5A 1PX4A 3SUUA 4OBRA 4GINA 2HE5A 4HMCA 1AVAA 3VIIA 4DNHA 1TCDA 4GVHA 2IMRA 2NX9A 3P2VA 3DU0A 4C5ZA 3B97A 2QPUA 1YE4A 3AS0A 3ARWA 2GK1B 1TJ0A 3HO8A 5CC3A 5DY2A 1DXIA 4Y8EA 5TAOA 2PPGA 1HL2A 1Z7AA 2Y61A 3ZJ8A 4MB3A 1OT1A 4XZHA 4OBTA 3KL0A 3GZAA 3QC3A 1EX5A 1V02E 1V0LA 4U3AA 3SY5A 1NARA 5C9XA 4Q8WA 3K1GA 4QE4A 3UZYA 4MYAA 2YL5A 4FEZA 4F0SA 1NFBA 5CZ0A 1MFVA 2QCCA 3M9YA 3FGCA 1XRFA 5IDZA 1SSGA 3T07A 4CD6A 1H62A 1FHDA 4WSJA 1KBKA 2J7FA 3H22A 7ODCA 1FOBA 3STGA 3LZ3A 3E6EA 1C91A 3W2JA 3PG9A 2VX4A 2CHNA 3HPSA 1WO2A 4ATWA 1MWOA 1V51A 3LCGA 3T09A 4XKYA 1Z41A 2WMIB 3WK3A 3WNLA 3PHAA 4CNPA 5C0QA 1IZKA 5BU6A 3GSMA 1UP3A 2XVLA 4M6QA 5C70A 5ABHA 5HMEA 5FSEC 4DQWA 1PTGA 3LM7A 4U2YA 1IWBA 2R8WA 1HKIA 3OB8A 4AG0A 1GOQA 1O5XA 2W92A 2D24A 5CJNA 1JZ2A 3GR4A 4IG2B 4K68A 1F6YA 3S5NA 3DXIA 2JKEA 1OSEA 2OT0A 4F40A 2ZA3A 1UOZA 3UWEA 1RVKA 1AQ0A 3EB4A 1QHZA 3LBCA 4D6GA 1FWGC 5I0DA 4MWAC 2IXVA 1ONXA 2RJGA 1QT1A 2BXYA 5I24A 2GGIA 4H19A 1LCOA 3L2MA 2Z1SA 1OYBA 3VKJA 4O28A 2HVNA 2R91A 4LF1A 3WG6A 4QG6A 3CZ8A 1I2NA 1XLLA 4AZ6A 5A6SA 4URIA 1IGSA 1W5NA 3RCNA 1T40A 2XM1A 4HSOA 3P6LA 4C6KA 3OP2A 2QEZA 3UGVA 4GX9A 4F2TA 3NAVA 1JJKA 1K8XA 3B4YA 4YCPA 4M24A 1SSDA 3RIKA 5CGMA 1EZWA 4R34A 4L4PA 2R14A 3QPYA 4A2SA 2F84A 1JGMA 3TZFA 2B0MA 3DYMA 2UY5A 1O66A 2IW0A 1RPXA 1X39A 1V6XA 1KFLA 1AODA 1ISZA 1KTBA 2A3HA 4ONVA 1HQTA 1QRQA 4GH1A 1V79A 3W70A 3L7RA 2YZRA 1H7XA 3QOMA 4ATLA 1DXEA 1BQGA 3ZFHA 1XHGA 3S9YA 2HEJA 3SFKA 5C2CA 2J24A 3N18A 2PGEA 4GJ1A 1OCBA 1XH2A 2QCHA 1OD8A 3PBGA 3SEPA 4PTNA 1H1YA 2VEKA 2DSVA 2PGRA 1XSKA 4NJHA 4HP5A 1WDQA 1B9ZA 4Y8FA 1CNVA 3ITLA 1JL8A 4D71A 3ID7A 3GYEA 3WD2A 3VNMA 4IWWA 2XU2A 4G9PA 3ICJA 2GL5A 1DJYA 1AA1B 3H7UA 1FXPA 4LANA 1DP0A 1J2BA 4Y2WA 4OQVA 3C3NA 1MYRA 1P43A 4U5IA 1HJUA 4KETA 2Y5SA 4Z2HA 5AECA 4M1BA 2GVEA 4D6EA 4GQRA 5LNUA 1Q6LA 1UKOA 4QCFA 2YW3A 7TIMA 1C8QA 2Q02A 1SO4A 4DWSD 1RJRA 4IIEA 4JY9A 4GUGA 1FTXA 4TMBA 3K8MA 4P8WA 2QCMA 1X97A 1FWBC 5FACA 3AXKA 4FALA 3PC0A 3QFWA 2VD8A 3WSUA 4KWUA 1TPUA 3U6WA 1W1TA 2VDGA 5EMMA 5AC5A 2V5KA 2GJXB 4MY9A 2DZAA 3BGGA 3BPWA 3TKFA 3GHUA 3GNOA 1BYAA 3S1VA 3VX1A 3Q58A 5A6BA 4O53A 2ZX7A 3UXLA 2CWXA 2J6XA 2V0TA 2HISA 2E0PA 4HK6A 2GGEA 1QPOA 1X6NA 2PLKA 3AMCA 3M0JA 4AZ7A 2ZCGA 1KBIA 3B8IA 3WQWA 4Q8OA 4O8RA 4ALDA 4E5TA 3VD5A 2FLIA 3SGGA 2OLSA 1UHVA 3NCOA 2VR4A 2PB1A 3BLDA 2IQTA 4Q4RA 1LLWA 1OC5A 3IUIA 4UCFA 2IKJA 2PBOA 4L1XA 4M6PA 2QYGA 4P7NA 4O1FA 1I6NA 3QTPA 3VGEA 1RVGA 3BJTA 1H60A 2VURA 1AZ1A 5HINA 4CCZA 5AHLA 2WWCA 2REQA 1K9TA 1ZY9A 2PU0A 4ZB5A 3T8LA 4V33A 3IGXA 3C2OA 1QI2A 2DZSA 4DM2A 1EA9C 3PG8A 5CSYA 1ONRA 3CZEA 5HJLA 3ZQ9A 1KA9F 2NT1A 3C2RA 1UKQA 4Q8PA 1N2VA 2FDMA 3GTFA 2WW5A 2BY2A 5J04A 4JN7A 4IMFA 2PRHA 2BGQA 1FFRA 2HPMA 4I9TA 5CGQA 4J4KA 2PBGA 3OA5A 2FJUB 3FS2A 2PDXA 5I7GA 3SGUA 2W91A 5FEPA 3P5YA 3NQ6A 2XZ7A 2CNCA 1BLIA 3LTPA 1TWZA 1ONEA 4GGBA 3KS6A 3B40A 4XWUA 3W7CA 1KGXA 1SZEA 3W38A 1F3WA 3D47A 4MNKA 2ZXBA 3NPWA 3GXPA 3G1VA 3L0GA 1UZ1A 3EPOA 4DYEA 2WQDA 3K4DA 5FJRA 1XH0A 5I06A 1M5WA 1NOFA 3DC8A 1XG4A 4U3CA 1V0KA 1QOPA 2XVGA 3LHZA 4HOWA 3RM8A 4MPKA 1AJZA 1GVOA 3IAPA 1T8QA 1EOMA 4MB1A 3DYOA 3EOOA 4UUIA 1WV2A 5CAHA 3N2OA 3JW7A 2ZRYA 2EJ1A 1IR2A 3VKBA 2Y89A 3N9SA 6TIMA 5LNSA 3WNMA 3GXIA 3KWSA 4Q33A 4GO9A 5A6BD 3VABA 1GPFA 3SN1A 3ZXWA 1A80A 1OFPA 1EIBA 3DI1A 2F61A 1GUVA 4HMNA 4S2CA 2HS8A 1QNRA 2CZEA 1JG9A 3UPMA 2YYUA 2ZX6A 3AALA 3DGBA 4AVNA 4FSAA 1FXQA 2FZ8A 2NVAA 5T8GA 4HCLA 4QGCA 2QF7A 1A0CA 1UROA 4L6DA 3MJYA 5CZSA 4N0RA 2WHKA 3GIYA 1N8IA 4B2DA 2WVUA 3MY9A 4L4OA 3V75A 1M7PA 2IKGA 2V3GA 4M1RA 1OWQA 1KR0A 3ITXA 3S5YA 1J12A 4CLMA 3WDQA 3WF1A 4RPQA 3WMBA 4GZIA 3GFZA 1XD1A 1V5XA 3M0VA 2H9AA 1GJPA 3DGRA 3AZSA 3BLLA 3OTRA 2NSOA 4DZAA 3BW4A 3TSBA 3WMSA 1R2RA 3OVRA 1IGWA 1D3HA 4LUSB 3FN9A 3MV11 4ZZ9A 5H8UA 3W7HA 4PEKA 2PF8A 1P1XA 1XFCA 1EC9A 2IQ0A 3LUTA 1UWSA 4BI6A 3B9OA 1E6PA 3NWRA 1KTNA 1SFSA 4PCSA 4AF0B 2VXNA 1KRMA 2WMIA 5K2ZA 1LROA 4CGTA 2PZNA 4H6EA 4MJZA 3WK0A 3G18A 3RCMA 4H00A 2NQZA 3HQNA 3EXRA 4H9TA 4AAJA 4ROPA 3FA5A 3LPFA 4KCUA 1TJ1A 3L2IA 1M53A 1U5VA 1WB0A 3GG7A 1OJXA 4HPJA 1MEHA 2WB5A 4L1WA 4MKSA 5IHSA 3OVGA 5KSWA 4JTAA 1WXZA 2QS8A 4QSFA 2XDFA 4EP8C 1ISWA 4WOZA 2E7FA 2ZUTA 3TAKA 3IGUA 1X7IA 4PFMA 3ARYA 1CEOA 4ZTYA 1X8CA 2W67A 3V3WA 3GC5A 4U33A 3GUGA 2XINA 1S5VA 1XYCA 5CBBA 2WM0A 1MEIA 4B3LA 4EIVA 3NDZA 3VTRA 4DBSA 3CTLA 3WDRA 1HJSA 5K9CA 3CTTA 1YTDA 3M41A 1V08A 2DQWA 3VOGA 1R47A 3K46A 3PPHA 3EMZA 5A6KA 3GH5A 3TNBA 2PTYA 4I9JA 2QZRA 5FD0A 1CENA 1MW3A 4MG4A 4ZSUA 3GFXA 2QNEA 4KWWA 2WPBA 1XLAA 4HK5A 1KNWA 4J28A 3GDTA 3BK0A 5CLTA 3GTHA 4R27A 1W3LA 2Z2BA 1UUOA 4NIRA 1TJPA 1PDYA 3QR3A 1SU5A 4UFKA 4ROQA 1JEZA 1NF7A 4C90A 4Q4SA 5TD4A 2AQVA 4NNCA 1XLGA 3W28A 1GVRA 1GVFA 2BB0A 4NG3A 4OWGA 3HQ1A 4LYKA 1KCZA 2WLZA 1JZ6A 3RJXA 1T6MA 5B7ZA 3QLLA 4MY1A 2GFTA 2P8BA 1RH9A 2W63A 4Q4PA 2XPKA 1RPKA 1UOKA 1G6CA 1T5AA 3MI2A 3TJIA 3HPFA 3NQ2A 5EMLA 2WNWA 3LS9A 3PZTA 3GE7A 3VDAA 5CKSA 3W82A 1H2JA 5CEWA 5K4XA 3B8TA 5LIYX 2NLIA 3CB8A 1XLMA 1XLJA 3GXNA 2WM1A 1DIEA 2Z1BA 1EYEA 1E6QM 5DF0A 3TUUA 4TR9A 4GA8A 4NYUA 3FAWA 5BU9A 1JIBA 1P0DA 2B81A 3WH6A 2VZSA 4R9XA 4FLRA 4GY1A 2J77A 3AJ7A 3GYCA 7REQB 1FQ0A 3IVTA 4FO4A 1E71M 1DE5A 4LYPA 2ODOA 1EFZA 2E67A 1J2WA 1QI3A 4AEFA 1QW7A 4I5UA 1YIXA 1F61A 4H9MA 5TNVA 2WMHA 2AL1A 4ZO9A 2I1OA 3AHVA 2YA2A 1IV8A 2J47A 1NM9A 3RYSA 4HPNA 1TPWA 2D20A 3MP4A 1LP6A 2BFGA 2HK1A 2PRMA 1QNPA 1HW6A 2OX1A 2YCLB 4PMJA 1EIXA 3APTA 3A5VA 3VFCA 1NP0A 1HF6A 3UQNA 3W2MA 2XIJA 1NQKA 3SUWA 5A95A 3MYPA 3MPGA 1YBQB 2ON3A 2D0FA 5FI8A 4LC8A 2QXWA 2GPTA 4JDYA 1ZBKA 3H2EA 1V3KA 3RU8X 1M65A 4BQ2A 4R3UA 1A0EA 2WCGA 5HATA 3H2FA 4NX5A 5FEXA 2VWTA 1GG1A 1FH9A 1E0VA 4DUXA 4CU6A 1PS9A 4HMDA 3NDYA 4EAMA 1EHNA 3EOEA 2QHAA 2Y7DA 1Y5WA 3UT0A 5C55A 3CHEA 3ORWA 1X8FA 3FHQA 2GSJA 1SGJA 3FJNA 1B57A 5D2TA 3W7IA 2ZZ1A 1WKFA 4IMDA 1PYFA 1PL9A 4GKLA 1R85A 1VCVA 3IK4A 2O0TA 4PTXA 3CV2A 2X1RA 4LVFA 3T55A 1OK4A 2XISA 3TV8A 3BMWA 3TOYA 3NQAA 2V5JA 2EPOA 4DZIA 4NY2A 2GQ9A 3UA4A 4A35A 4C7DA 1W9DM 3KCLA 2TSYA 4M3PA 2DY3A 1GOWA 4HZ7A 5C9ZA 4IIGA 2OG9A 3TROA 1PCWA 1IYXA 1KTCA 4YN5A 4RV8A 5I78A 2QDEA 4A3QA 1JZ7A 1H49A 5LNVA 8A3HA 1F74A 1PCKA 3TLLA 1NWUA 2VRQA 3EDKA 1R5YA 5I3HA 3WUEA 5BWFA 4IFRA 3TR2A 3FIGA 3W24A 4JQ3A 3E0VA 4QFUA 5IXEA 4GI6A 2JKPA 3W7EA 3EEGA 1CB7B 4ZEPA 1VIZA 3HMJG 3G77A 4FOUA 3ZWSA 3W7PA 4TVDA 5F2GA 2X42A 3TTQA 1V3LA 3CV6A 3LGDA 4J40A 1TVLA 3VVGA 4UXDA 3BGAA 1RV8A 1WP6A 4MKNA 1KRAC 4LEFA 1MDRA 1LUCA 4QE1A 4FZIA 2CERA 1QHOA 4O10A 4O1CA 4LAKA 1G4TA 2EKCA 4LAZA 4GACA 1QPQA 2BVTA 3ZIZA 2OYKA 3NYDA 2G97A 1U33A 2Q01A 4BZYA 2VQTA 4TV5A 3KZSA 3RK8A 2XGBA 1L9WA 1XLCA 1N8FA 1S39A 2KAUC 2WJFA 3TC3A 3WH7A 4PTDA 3S47A 2TAAA 4TUFA 4U31A 1Q3NA 3QW4B 4O12A 4OBSA 4CVWA 4DN1A 1TWWA 4XISA 1QUMA 2ISDA 3VIHA 4J3ZA 3TJLA 3NSNA 3T9PA 2MNRA 5M03A 2XYLA 3A24A 2QGYA 1XKJA 1FA2A 5ECUA 1OFQA 1H4PA 1WYIA 1ME7A 3WJXA 3SUVA 4PMVA 3T81A 3W1PA 1LWJA 2X41A 3VOIA 3KP1A 3PBWA 1KQYA 4MJMA 1S5WA 2WANA 1DPMA 5E9AA 1JZ8A 3VC5A 4D8AA 3BLEA 5GNYA 3AQUA 5CZTA 3R13A 3CQIA 1X7FA 5HNRA 1LUCB 5AYXA 3NYZA 4IUGA 1OFAA 4AXNA 3N29A 3I68A 4CQDA 4QITA 2J9XA 3H7RA 3O6DA 1LT7A 1RZMA 1EO5A 3FAXA 1GQNA 1FCVA 3VGHA 4LY8A 1V77A 5AYYA 4JCMA 1RALA 3LCHA 4LJ3A 5AHMA 4H7VA 1ZAHA 3P74A 1QR7A 4O52A 3IVSA 4K2SA 3TU9A 1UC4A 3AHTA 4GIYA 4Q7BA 2XIMA 2QR6A 1QK0A 4O1EA 1EPVA 4JFVA 1IXNA 1JZ5A 4YWIA 2NVCA 1K4HA 1CI1A 4XVDA 3N34A 1B0IA 3CZKA 2OKTA 5MKGB 3BMVA 4Y7EA 1GVYA 1UWIA 1ADSA 3QFEA 3AYSA 3WBWA 1SYTA 3SSJA 1YTEA 3MSRA 3AHZA 4UMAA 5EFDA 2I5IA 4PUJA 4V1YA 5G2IA 2E4TA 1V3JA 3SUSA 4EXAA 3KTXA 1YDYA 4J3SA 2RHGA 4WZHA 4O8AA 3M0LA 1BG9A 3PANA 5FCZA 4F0HA 2BLEA 4YVPA 1PO9A 1TMQA 4QHRA 2WCAA 3KRBA 4HCDA 4R53A 5EFFA 1KFWA 4F0RA 3UYIA 1KBJA 5KZMA 1VBUA 2OQYA 2E8YA 1JDEA 4C5YA 5U7SA 3VD4A 5BRBA 3N11A 4RR4A 3NXFA 4KGLA 5AC6A 2O9PA 2VCBA 1BEUA 1RK5A 4GUJA 1UD5A 2QPSA 5FIPA 2IPWA 4IGSA 3W2NA 3MA8A 1YADA 3HPZA 4MSSA 4I6KA 1GJWA 4DJFC 4QS5A 4C6IA 4O15A 2G95A 4J1OA 4LVGA 1FDZA 3S9IA 3VKKA 2D69A 2D23A 5DCDA 2HBXA 3IANA 2WHJA 3OYZA 3BICA 4F48A 4Z2LA 3QZEA 1K9DA 1E6SM 1OF6A 3H2OA 3VK5A 4H41A 2B4GA 1GNXA 1YPXA 5FEZA 3GBEA 2A0NA 2DIJA 1LLOA 4GC3A 1TELA 3M4HA 3FEQA 4DJDA 3E2VA 3CHCA 3O0KA 1E73M 1WZKA 3SCRA 4WD0A 1NH6A 2CLEA 5I02A 2DZXA 4GZ7A 1DYSA 2XSXA 3NSMA 3VKCA 3HOJA 4P5UA 3ARXA 3O15A 4B9ZA 5HPOA 5GJNA 5J5DA 1TKKA 2Z1WA 5BW6A 1PV8A 3W1UA 1NDZA 1I0BA 4MYXA 4DO6A 1W6TA 4D1JA 2XH4A 3ITYA 3ARTA 4K1WA 2WC3A 4UQCA 3EPNA 4LW7A 1XM3A 3AIQA 1AH3A 3QSTA 1BYDA 1SZFA 2A3EA 3L0KA 5E1QA 1TX2A 3PZQA 3RO8A 1UZDA 3NDOA 3BZJA 3I6EA 4U5KA 5AHNA 4JQ4A 3DEQA 4BFAA 4PUWA 3SECA 2BG5A 4JX6A 4DF1A 3HU7A 4N7QA 2OZ3A 2WK2A 1GT8A 4QR6A 2P53A 4UOJA 3WNOA 1IQ8A 2J7HA 3A9BA 2P3ZA 3MCNA 3Q2DA 4HKPA 1K6WA 2VFGA 3N3TA 2SFPA 3PWAA 1KM5A 1TPDA 2GQ3A 1G4EA 3QGKC 3URAA 4CQBA 2WVVA 1C8XA 3T2PA 3MKKA 3S6TA 3ALGA 1EDQA 4DUWA 4X60A 4IP5A 2AAAA 4FA3A 3WJZA 1EPXA 3CIWA 1M1BA 3O16A 2AL2A 2VDHA 5D37A 2E40A 1XIBA 2WWDA 1WBHA 2Q3RA 1IZCA 2ZZ4A 3BOXA 3P82A 5L9FA 1EDGA 2W9MA 3QTGA 1ML1A 3WQGA 3UWWA 7REQA 3U2OA 3FV9A 1B3YA 4Q32A 3I7RA 1ZL1A 4YTSA 1GOXA 3CH9A 1K8ZA 1T0OA 2V63A 1N82A 3U2CA 3D3FA 4JY8A 2VQUA 4LBRA 2JFEX 4L9XA 4C6NA 3MUZ1 3EB2A 3NZ1A 2PDUA 1OCNA 2P0IA 2WBGA 2YB4A 3VU2A 3L4ZA 1TWDA 1QI4A 1RAKA 3V0SA 4RE3A 3M46A 4WVXA 1K9FA 1PXGA 1TRIA 2OMAA 4K36A 4JX4A 3OQEA 2VFIA 8CGTA 4IPIA 4DI9A 1I2RA 4DBWA 4P7LA 1N55A 2PP1A 2ZRWA 1VB9A 1E43A 2DFAA 1HGWA 4R7JA 2VELA 1E6XM 3D6NA 2NXHA 2EGZA 3GDLA 3ZLFA 3ZR6A 1WPCA 2IQDA 4OTKA 2GJRA 3DFQA 4Y9AA 4IPPA 3TTOA 2E5DA 1FWHC 1Q4WA 5A8NA 3A9IA 2QCDB 2Y2WA 1XPYA 3WLKX 4JFTA 1IEXA 4G5DA 4ZXLA 1EGVA 4S23A 2O7QA 3JR2A 3SQLA 4E0CA 4HA0A 4ZCWA 2E6DA 4GVIA 2J9YA 1ZB5A 4ZGYA 1XLBA 4DBUA 4LUSA 3U5YA 2HNHA 1E9YB 3W7DA 5FF3A 4HNNA 3RLGA 1RJQA 2CLIA 4LEQA 1EX1A 4O0QA 5C54A 3E74A 2C19A 4AW7A 1MXSA 4QG9A 4D6DA 1VFHA 4QRNA 3N9RA 3U8GA 4MNJA 3PTQA 4CVUA 2ALDA 3KCJA 4AQLA 2PWVA 2EPNA 3FFSA 1U83A 1ESWA 3H2NA 2YGYA 3EWYA 3NSXA 4XD4A 3SRKA 2J6VA 5H1WA 3WN6A 4J2MA 5FJJA 4N2YA 1S3HA 1VCGA 4OU1A 3WFLA 4AD0A 2CETA 3PPCA 3GG8A 2CXEA 1G5AA 4LVAA 1R87A 3WEOA 2GK1A 1R2SA 3T7VA 3NNTA 1F3TA 3EWUA 4W8AA 3AYTA 3GDKA 5D9OA 3ABOA 3BTNA 3IJ7A 3BG3A 1F76A 2PMQA 3W07A 3DESA 1DQXA 4X3ZA 3IPWA 3UJRA 2GUBA 1MQPA 4I90A 3MP5A 3O3RA 3PK7A 3GKFA 2XVPA 1OGSA 2O9RA 2VC7A 4MOZA 2FIQA 2J7GA 1PEZA 1CWYA 5JIPA 3BJFA 2GJLA 3C52A 4C6QA 1Y0EA 1EBHA 1UR4A 5CC7A 2ZBTA 3ONBA 4EPDC 3D3AA 1BKHA 3C86A 3TA6A 3LENA 1H5VA 4ZA0A 3VYLA 4L56A 1XYMA 4XB3A 4L61A 2WZEA 4Y6GA 2V68A 4NUWA 4RDYA 1HKJA 2AKZA 1DHPA 4I8DA 3OYXA 4NZ3A 4QLKA 4DLFA 3TQ0A 4AWSA 2VZTA 3FJLA 3NM1A 2Z2AA 2WXDM 5JIWA 5G1MA 1HX0A 4FXSA 2X1IA 4DNMA 3XINA 1S2WA 4F0MA 3OBEA 4GYFA 3PN8A 1PDZA 3NL3A 2FPTA 3VOFA 1UC5A 3ITTA 3EEZA 2PC8A 3CPRA 2CLFA 3IIPA 3O7UA 1WE5A 3LSBA 4C1NA 3AXHA 4HZMA 4CEUC 1NF0A 3UWQA 2CYGA 5IM51 1LL7A 3HGJA 1K4GA 2VFDA 3EA3A 3P84A 4Z08A 3GQYA 5CZJA 3CUFA 3DHUA 1JGIA 1NOUA 5TIMA 1LL6A 3HBLA 4MDPA 1P6WA 1J4EA 2Y5EA 3BOFA 4IQDA 1FWSA 5LNRA 3DKJA 4D8LA 3NVTA 3STFA 4LV4A 2WSYA 4B92A 4C6DA 3AIRA 2OO0A 3KOYA 3E0WA 2VR5A 3G3MA 1B2YA 3SJ3A 3A64A 3EX4A 1HO1A 3AI0A 4XK2A 1TPEA 3G1DA 2Y85A 2EPKX 4LRTA 2OZ8A 3WLPA 2E68A 3OGVA 5CJMA 4HBKA 4IL2A 4JD4A 2H9AB 4Q8UA 1UJQA 4NJKA 2WOQA 4AZIA 1E0WA 4FAMA 2EKGA 2E1WA 1BGAA 2QV5A 4JS3A 4KFPA 3UCQA 4B3ZA 2Q09A 4PUEA 3S0CA 2ZX5A 4AD3A 4PCFA 4WHBA 4XV0A 1QDSA 4M82A 3RPTA 4IFOA 4EVZA 1YTKA 1S2TA 2FVMA 2PS2A 3FSUA 2PLMA 3IIZA 4AZHA 4NU7A 4LYQA 1HIZA 4UFJA 4HHMA 4RK8A 4JTUA 4AWUA 2OZTA 3VPLA 1WXJA 3GTIA 1TPH1 1EJXC 1S3TC 5HQLA 2YA1A 4L80A 1ZHAA 3LD5A 3B8WA 1QPNA 1Q65A 4L9YA 4AXKA 2GOUA 3PS7A 3WQOA 4YHEA 5AZ1A 1VQTA 2OYLA 3CAQA 5AYIA 1TJ2A 3WQ4A 1WBJA 2WMKA 3BDKA 1Y5XA 3QRHA 5E0FA 3MBDA 3AIEA 2CXGA 2Q8XA 4ZBCA 2VMFA 3AMDA 1LG2A 4PL2A 5KITA 3LG3A 3Q4DA 5A8PA 2G3JA 2YYTA 1W9UA 5DBUA 1XLEA 4O14A 3QHOA 1ITUA 4Y9OA 4QG8A 1DE6A 3ARVA 2GWGA 2HPIA 3PTKA 1MXDA 3UYCA 2XIQA 2E9BA 3OBKA 4FB7A 3UPWA 3R8GA 3MI6A 3W86A 3UWUA 1WAUA 3GVVA 3CUIA 1QO2A 4MFEA 3WQDA 2WZHA 1LYXA 4JHMA 1EQPA 3V36A 2IKHA 1W5QA 3WLNA 4FNUA 3BL3A 4RKAA 3KVJA 4IIDA 3P14A 2IKIA 2CU0A 2XIBA 2A1YA 4F3HA 3AMGA 3T4CA 2ADAA 4KWOA 3TYBA 3N14A 3VIGA 3H55A 2Y7FA 4AB4A 4OUEA 1JD7A 2CIPA 7TAAA 3B0XA 4ZO7A 1MQQA 2OXNA 3II1A 2V2CA 2OOFA 3WD3A 1PWLA 4HPGA 4ADUA 3WUGA 5CAKA 1SMDA 4BY3A 1OADA 2INZA 1Z44A 2BTMA 1WX0A 3G0SA 2JF6A 3FDKA 4RZ5A 4N9EA 2PGWA 4M19A 1EJUC 1UPMB 3ZT6A 3IS4A 5HQEA 5I3JA 1ZBCA 1ZFJA 3OVPA 4NHVA 1H0IA 3E02A 1UKSA 3TFXA 1K7XA 2QIWA 2WCSA 5DQPA 4AX7A 3URQA 3SQMA 3QQ1A 4QQ3A 4S3DA 3K5XA 2V30A 1I2PA 4MHBA 5C2XA 4OGZA 4GQGA 4TO8A 2NXIA 3PNUA 4NAFB 2ZTJA 5CPSA 4KQNA 4NL1A 4R7WA 3C56A 3N04A 4YPJA 4B91A 2F6KA 2ZOXA 2BOFX 2ANUA 3W84A 4XAPA 5HDRA 3NPVA 4H04A 2PTWA 3PUGA 1MVYA 4CUCA 3MVTA 2DGAA 1YBQA 1BXBA 1X1NA 3MSGA 3KTCA 4YTTA 5JMUA 3NQMA 1EKOA 4OECA 3UG5A 1P0BA 2I16A 1B90A 1Q4NX 1YMYA 4AH7A 2I9EA 3K8KA 4FXJA 1JPIA 3NQFA 3QGVA 5T26A 4F4RA 2AMXA 5EMUA 4HHLA 1YLVA 2Z26A 3ZVHB 3VOCA 4IQJA 1GQIA 3TOPA 4CEXC 5EYWA 3M0ZA 1RD5A 3AJXA 3KAOA 1W1B1 3QR1A 4UTHA 3VNKA 4IIBA 1HO4A 1EA0A 2YOCA 2JIWA 1JFHA 1C93A 2Q8ZA 2ACQA 3LCFA 1DWFM 1Y8BA 2Z4GA 1UA3A 3T4WA 3WLLA 1EBGA 3S6OA 1CGTA 1R6WA 2GQAA 1UQYA 3P61A 1XLHA 5M1TA 5I09A 3O6YX 1WZAA 2PP3A 3EA1A 1MRQA 5A8GA 4JIIX 5HPCA 5BXPA 4GWEA 4BS0A 5LA1A 4NX0A 1UD4A 6A3HA 1S38A 4WKFA 2VZUA 3MSDA 4QJ4B 3EWZA 1A50A 4XKYB 2PDMA 4AMAA 3W4RA 4YU1A 2X05A 4RNIA 5JBEA 1LWHA 4IISA 4YLWA 4J3XA 3MTWA 3OQ8A 2HNEA 4C6OA 5HOSA 5LIKX 4V27A 3S2MA 4M8UA 1LBMA 1Z42A 2Z29A 2A7RA 1EF2A 3STEA 3NG3A 3FYYA 1JF5A 4WDWA 1J0KA 3WBEA 1AQFA 4LPCA 1VFFA 4UFHA 4HTBA 4EANA 5BRPA 4LC6A 3F4CA 5D2YA 2OTDA 2Z1KA 2J7BA 1XICA 2QJHA 3AISA 3CQKA 4OVXA 4HHHA 1QVBA 4C6LA 1E40A 5XIMA 1SFLA 3CWNA 1JDCA 2XN2A 3GIPA 1AH4A 1TUFA 5HMSA 2VD9A 3SJNA 4CNTA 1M01A 3WBYA 1UD8A 1GYNA 1BF2A 2W66A 3W87A 4ZQOA 3T2OA 1KFBA 3TYCA 4K8EA 3TP4A 4JYDA 3NFUA 2QDDA 3GTXA 5BXTA 1BVZA 3W7GA 4H9UA 5DRIA 3EWXA 2QGHA 3R43A 8XIMA 2DVTA 1E6ZA 1ZS2A 2X0YA 1DOSA 2WAGA 2PSNA 4IICA 4XZMX 3Q45A 1J93A 4WCJA 1IZJA 1V6VA 4GGHA 1K8CA 4RDWA 2I57A 4A8NA 2BWGA 4PB3A 3LTSA 1HJQA 3FGCB 1YDVA 1E6NA 4IH3A 3SRFA 4JCLA 4PYSA 2ATMA 4F9DA 1KW1A 1Y5VA 1F7BA 1JRCA 4UZSA 1UASA 1RUSA 1TWSA 3BG5A 4J35A 5AN7A 4MIMA 2R82A 3W00A 4JX5A 2OEMA 1W2VA 2EBNA 3DDMA 4LB4A 1VEPA 5MKGA 2G0WA 3MMDA 4UCGA 1EP2A 3TN5A 5FF0A 1VJIA 4H6QA 1GKRA 2DDXA 1TV4A 3BZGA 3QF0A 1GGOA 3MUAA 4LBSA 4ICNA 3W0KA 4HGXA 1A5SA 4IJRA 2VFFA 4YIWA 4LWWA 1BWLA 1EUAA 2DEPA 2GSEA 2PDFA 2RJHA 3NXLA 5GJPA 3MHFA 4GVGA 3SQSA 4US5A 1NJJA 3K30A 3WEZA 3QY6A 3FLUA 3SR7A 1TV3A 1ZPTA 9XIAA 1AUSL 1V6TA 4E2VA 4EPBC 2VM8A 1W9XA 4LALA 2VYOA 1G4SA 3LU2A 3GXTA 1XP3A 1MZRA 3DX5A 3AWNA 2XIOA 3UESA 2PTXA 1GJUA 2R94A 3OZYA 1J79A 4CD4A 2HK0A 1R3WA 2A2IA 3R8HA 3PB2A 1KFEA 1QU4A 1J6OA 1XWYA 1KFJA 3TYZA 1Q6OA 1ZQ5A 4DF0A 3M5ZA 3DFTA 1UR2A 2KZHA 4LT9A 4XBSA 1R9XA 2IS7A 2Z1XA 2CC0A 1NFPA 4ZB0A 1DTUA 1NEYA 4D6JA 1QHPA 4JTFA 3MSYA 3VAVA 1OF8A 3CUXA 4LX4A 4DZHA 1H50A 3B0PA 3LMYA 2H8ZA 2YBUA 3KLKA 4XZLX 3VIPA 2FDSA 1Q13A 1NWTA 4XQ6A 1Q6EA 3HJZA 3MMTA 4GYJA 3ZOAA 5CCZA 1NIUA 2VGGA 2ZUSA 2DIEA 2QVHA 4EXBA 1LRTA 2XN0A 3PTMA 4NVTA 1X1ZA 4HNTA 3WZ0E 2UWFA 1YNYA 3ZR4A 1H7PA 3GDBA 4Z2GA 3VCRA 1B3ZA 3HQOA 2CKSA 2ZADA 3E2SA 2O55A 1WUEA 3R1ZA 3BAWA 3EYPA 3MZ2A 3M7SA 2DPEA 3ZJ6A 1CYGA 2BSLA 2XUCA 2PDCA