1V02E

Crystal structure of the sorghum bicolor dhurrinase 1
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
484
structure length
484
Chain Sequence
RLSPWEIPRRDWFPPSFLFGAATSAYQIEGAWNEDGKGPSTWDHFCHNFPEWIVDRSNGDVAADSYHMYAEDVRLLKEMGMDAYRFSISWPRILPKGTLAGGINEKRVEYYNKLIDLLLENGIEPYITIFHWDTPQALVDAYGGFLDERIIKDYTDFAKVCFEKFGKKVKNWLTFNEPETFCSVSYGTGVLAPGRCSPGVSCAVPTGNSLSEPYIVAHNLLRAHAETVDIYNKYHKGADGRIGLALNVFGRVPYTNTFLDQQAQERSMDKCLGWFLEPVVRGDYPFSMRVSARDRVPYFKEKEQEKLVGSYDMIGINYYTSTFSKHIDLSPNNSPVLNTDDAYASQETKGPDGNAIGPPTGNAWINMYPKGLHDILMTMKNKYGNPPMYITENGMGDIDKGDLPKPVALEDHTRLDYIQRHLSVLKQSIDLGADVRGYFAWSLLDNFEWSSGYTERFGIVYVDRENGCERTMKRSARWLQEFNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords DHURRINASE
publication title Structural Determinants of Substrate Specificity in Family 1 Beta-Glucosidases: Novel Insights from the Crystal Structure of Sorghum Dhurrinase-1, a Plant Beta-Glucosidase with Strict Specificity, in Complex with its Natural Substrate
pubmed doi rcsb
source organism Sorghum bicolor
total genus 190
structure length 484
sequence length 484
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1v02E00
4ZXOA 4E4PA 4AZ7A 5AC5A 4GINA 2JE8A 2XM1A 4PMYA 4M8UA 2OWCA 4MB3A 1PX8A 2Z1KA 4PEEA 4D6DA 3ALGA 1BHGA 5HBFA 1H49A 3W24A 3OLEA 4ZENA 4E2OA 2WMIA 5A94A 1JNEA 1EDQA 4Z2KA 1H0GA 1SR0A 2VR5A 3PZOA 4YPJA 4CKQA 1EOKA 1UG6A 2D2OA 1MFUA 1V3IA 2J7CA 2XG9A 3WQ6A 3BAXA 2XVGA 1B3ZA 4AD1A 1GOQA 1JI1A 2AOSA 5A2BA 2W92A 1HJQA 5D9NA 1JDCA 4PMNA 1MQPA 1RP9A 2GVYA 3A47A 3II1A 3KL0A 4B9YA 4GQQA 1A47A 1VFMA 1OIFA 4ACZA 2YDQA 3NCOA 2W67A 1J18A 3WL1A 1V08A 5E6ZA 3WDIA 1AQMA 1CXIA 1FOBA 2DH3A 3WQ4A 4TX8A 1ESWA 3W37A 5BXTA 1BSIA 3POCA 1KBBA 1Q6GA 4W8LA 1KXHA 1XH1A 4JCMA 4HTYA 4P7LA 1GNXA 3LPOA 5I6SA 1PX3A 4PCTA 4CN1A 1QOXA 1V6YA 3WEOA 1ISZA 4KWUA 2BS9A 1LL6A 1PIGA 3EDKA 4DWSD 5EFFA 1UR0A 4ML4A 4UOZA 4HZ8A 4TX6A 4HZ7A 1C7SA 5I79A 3THCA 4ATWA 4WKAA 2VRQA 1KBKA 4GPNA 2G8ZA 3S2CA 4F79A 1JYNA 2WB5A 4LYQA 5M17A 2J75A 2ZUTA 2YL6A 2C7FA 1FH9A 3M46A 1NOUA 1OCQA 3RPMA 1B9ZA 4S3JA 1UWTA 3AOFA 4FLOA 3WNLA 2BY2A 2V5DA 4WIWA 2Q8XA 3BAIA 5ABGA 2VX5A 2QV4A 3MUAA 1L8NA 4WK9A 4TVCA 1VJSA 2XSAA 2E8ZA 3WDQA 4AYSA 4RE3A 4GO9A 2WCGA 3MO4A 4CCDA 4P8VA 3WD4A 1E56A 2RGMA 5ABFA 1HX0A 2W62A 4JIEA 3HU7A 4FLSA 1BG9A 3ARWA 1GOKA 3VX0A 5I5RA 1QI5A 1NP2A 5GNYA 2D20A 2CNCA 1TMQA 3GTNA 3W82A 2FH6A 1BF2A 4V28A 3W28A 3T2PA 2OWXA 3PZUA 1ODUA 3VD4A 3CO4A 4X0NA 1HT6A 1HL8A 5A6BA 3F5JA 2WVVB 3WUBA 1OM0A 5DO8A 1V0NA 1NWUA 2ZOXA 3PTKA 1NWRA 2W4XA 2XGIA 4D1JA 3LMYA 4EK7A 1C8QA 4MJ4A 1I1XA 1IZKA 1UOKA 1NOWA 3B9DA 1W1PA 4P8WA 2WKLA 4UCFA 5FL1A 2CCRA 1M7XA 3L4TA 4TUFA 1V0MA 2XFFA 4ATLA 4DM2A 3T0DA 3UR7A 3FAWA 4CD5A 5A6SA 1R87A 1TR1A 1VEMA 5M5DA 3SCUA 3VMOA 3GH7A 1Q6CA 3AMLA 3WDHA 1CDGA 4MNKA 4QCFA 1M04A 2YOCA 4IPLA 1ZBCA 3RO8A 1M53A 1VAHA 4JFSA 1FP9A 3BCFA 2BFGA 1VEPA 2VJXA 4TVDA 4OUEA 1CWYA 3T2QA 5HDRA 2G41A 9CGTA 2FGZA 1K6AA 5GQBA 4QAWA 2MANA 1XSIA 3WH6A 5A2CA 1UQZA 5CG0A 3ZMRA 3A6OA 1JZ6A 4PTWA 4NI3A 3N13A 1CZ1A 2CIPA 4J3TA 2QPUA 1UD5A 4W84A 4WSKA 2QMJA 1UD4A 3WH7A 3GNPA 4M29A 4AIOA 4WSJA 4HP5A 2CITA 1QHOA 3VM7A 3VDCA 3WH8A 3M6DA 1JXJA 1B30A 1VBUA 2ZUWA 4UOJA 3I3EA 1OGBA 1OT1A 3GH5A 2WMGA 3DECA 5A6KA 5CJ5A 2Z1SA 2VZTA 3VIKA 1ZL1A 1J0IA 1KWKA 5D4YA 2ZICA 2CBIA 5FD0A 3AS0A 1B3WA 1R8LA 2DSUA 3ZM8A 4QDMA 1HF6A 3CHFA 2ZXBA 1Z32X 3I3BA 3VINA 4W8AA 3T2OA 3MUY1 4LQ1A 4MNLA 1KQZA 1MWOA 5I2UA 3QHOA 2VURA 4UR9A 3MSGA 1FHDA 4OIFA 3PTQA 5JIPA 3PN8A 4W89A 3WH9A 4W5UA 2O92A 4CD6A 2WVUA 4LGXA 4MTVA 1PJ9A 5JBFA 8CGTA 1ZS2A 2ZXQA 2NT0A 3MMUA 3M7SA 2WC3A 4URIA 4AZIA 1LL7A 2VCAA 3T09A 3BGAA 5IHRA 3SCOA 3VUPA 3AYSA 5LA1A 3WD3A 1CXLA 3NYDA 2E3ZA 1O7AA 2EJ1A 3GXDA 4D72A 3ZJ7A 1GQIA 1JL8A 1XCWA 4CD8A 5BROA 1OIMA 5I78A 3BAYA 1MW1A 3GXFA 1F4HA 1UUQA 4D6IA 5DT5A 5IFTA 1X1NA 3VD7A 3W38A 1V6XA 1OB0A 1GOMA 4YHGA 2F8QA 2DSVA 3UEQA 3ZR6A 3QHNA 1GONA 2PI6A 1GVYA 2BHYA 3ARTA 3W81A 3M07A 3W6MA 5ABHA 2D0GA 3F5KA 4GKLA 3PZMA 1HXJA 3CZ8A 1JYVA 5CPSA 1J01A 1W2VA 1B3XA 2BXYA 3SURA 5E70A 3DHUA 3ZSTA 1OD8A 3S6TA 3CZGA 3OA5A 1V03A 2Y24A 1GORA 4W88A 4MAVA 4AD0A 3SUTA 3WF0A 2G3IA 1VFUA 3HN3A 4CUCA 4AZGA 2VX7A 2VZOA 2CEQA 2Y5EA 3CMJA 1VIWA 1E1FA 2J7GA 1CIUA 3WELA 2XFRA 5I0DA 1RPKA 4J3XA 4H8HA 1V0KA 2J7DA 1SMAA 3ZSSA 2C8NA 3UERA 2GJXB 5IFPA 1CGXA 1UKQA 3TP4A 1ECEA 1LQ0A 3PZIA 5E0CA 1UH3A 2WVVA 3AICA 3BH4A 4UQ9A 4JFVA 4ZE5A 4DUVA 3KEHA 3ZR5A 2D23A 4R27A 1HVXA 4BZYA 3BC9A 3AIEA 4CCEA 2CBJA 2OYMA 1CYGA 1NOFA 5HPOA 3BAWA 1JZ3A 1UZ1A 3NSNA 1E71M 3WFLA 1E72M 4AC1X 3I3DA 3OLIA 5A1AA 5C71A 1ZBKA 1CXFA 3PZ9A 2V3EA 4H8UA 1BQCA 2GDVA 5E9AA 3IJ9A 2J74A 2JIEA 2XVKA 3RJYA 1K9EA 2BNJA 4HU0A 3AIBA 2PWGA 3CUJA 3FW6A 1J0ZA 3CUGA 1UWRA 4WJXA 3VGEA 4LX4A 3OB8A 5IXEA 4WLCA 4Z2GA 2F61A 3TTYA 1N82A 3AXXA 2NT1A 1E5NA 4HZ6A 4RL3A 5CXPA 1EGZA 1WZAA 3CHDA 1K9TA 1KWGA 1GHRA 3TA9A 1XHGA 5CZKA 3U7VA 3DYOA 3VIGA 2EPNA 4D6FA 2OWWA 1NWTA 4U5IA 4LYRA 4MJ2A 2UY3A 3GXIA 4WKHA 3VIHA 4PMXA 3BSHA 2B31A 3EMCA 1H11A 2QMKA 3PZNA 1WKYA 3WKZA 1LF1A 4P8XA 3BAKA 1AVAA 3CPUA 4FLRA 3UESA 1QNOA 1MFVA 1CPUA 4XZWA 1J0JA 3CLWA 4HPHA 3A4WA 3UG4A 1E6RA 1UA3A 1V3JA 1EIBA 3U5YA 3OLGA 4AZCA 1KCKA 3QOKA 4C7GA 3ARSA 3D3AA 4M24A 1CENA 5KZ6A 2PBOA 1V6WA 1ISXA 1QHZA 1UD6A 4QLLA 2XWDA 3K8KA 3VIJA 1OWQA 4NRRA 3QHMA 1V3LA 3AHYA 1JZ8A 3AXIA 2D24A 2CHOA 1C91A 4AZHA 1WPCA 1CXEA 1HL9A 2BY0A 1QI2A 4P8UA 5I77A 1HNYA 2YBTA 5A3HA 3VIPA 3EDFA 4EAMA 4KGLA 3ZT6A 1GOOA 2XUCA 4PMVA 1WDQA 3VIMA 1PPIA 3EBVA 1VBRA 1OGGA 1U33A 2V3FA 1BGGA 3CUFA 3GNOA 3NJ3A 1W1YA 1XD0A 1K9DA 2VQUA 2WZEA 1EO5A 2QF8A 2WHJA 1HJWA 3N17A 3F4VA 3WMSA 3AIWA 2OSWA 2EPKX 4HMCA 1KGUA 4OOUA 3GDBA 2HISA 3UR8A 1EQCA 2JALA 4ACYA 1BVNP 1C93A 1VJZA 2VMFA 1QI0A 1W91A 2WCSA 3T0BA 1V6VA 2ZWYA 4BQ2A 3WDPP 1WCGA 3TONA 2YA0A 1CGTA 3WF4A 5HXMA 4N0RA 1JD9A 2NW0A 3U7BA 3ZIZA 2WYSA 1W9UA 2GK1B 1E0XA 4HOZA 1YQ2A 3IAQA 1UR2A 1YHTA 1IV8A 4OBSA 1HP4A 4UQCA 2XWEA 1XH2A 2XPKA 3SCQA 1QVBA 3ARYA 1TE1A 1VFOA 1AQ0A 4OKDA 2JEPA 2CYGA 1JF6A 2J78A 4DM1A 3MV11 2J62A 1QW9A 2V5CA 4C7DA 2X2YA 2DPEA 3VDHA 1GUVA 5JUVA 4PTVA 2WLZA 1EDTA 4DWSC 1QI3A 3RJXA 1JAKA 1BFNA 4HMEA 2ZX6A 1JAEA 4M1RA 2G3NA 3RIKA 2XVPA 3VTRA 3UG5A 1GCYA 1UR8A 1MW0A 4UTFA 4CD4A 1WDSA 2E4TA 2WC4A 4YHEA 4XB3A 4KRTA 1U30A 1EDGA 1R7AA 1ZBVA 1KXTA 4M80A 4Z2JA 1WAWA 2EEXA 2JF6A 4U3AA 4JFWA 1QNSA 4AD4A 2WCAA 3WNMA 3AHVA 2XHYA 3N04A 2WWDA 3IAPA 1UH4A 4A3YA 3WMCA 3BAJA 1XSKA 1R86A 2A3AA 2XM2A 5A8QA 3WNPA 3NDYA 4DWSA 1UKOA 3BMWA 1AQHA 3AIVA 5FL0A 3THDA 4B15A 3MS8A 4P7OA 2UY2A 2W5FA 1GQJA 1JZ4A 4QP0A 3OLDA 3AQUA 2J8GA 2JEQA 2BXZA 2D3NA 1GOWA 5JBEA 5D8ZA 1A3HA 5DMYA 1QNQA 1ISVA 2E8YA 2VQTA 1MQQA 3WEMA 3K4DA 2OSYA 4A4AA 3G6MA 1E3XA 2DGAA 1G5AA 1ISYA 2PWFA 1EXPA 1FHLA 1JGIA 3CIVA 1B90A 2PB1A 4FLQA 2D1ZA 2AMGA 4JZ5A 1CBGA 4Z2HA 1S46A 5EB8A 4J3VA 1E15A 4P7NA 3NSXA 4Z2IA 4XZBA 4HA4A 1W9PA 2CESA 4AEEA 4ZEPA 5FCZA 2YLAA 2EO7A 1EOMA 1AMYA 4TOQA 2FHBA 4UQDA 4P7QA 3VM5A 3AMKA 3ECQA 5GPRA 4JL2A 1J0HA 1G1YA 3WD1A 1RH9A 1ZJAA 1P6WA 3PZTA 5A6MA 3J7HA 4D6HA 1CGYA 1TA3B 1OINA 3AYRA 1KR1A 5CLWA 1JYWA 2DDXA 5CPTA 1K9FA 1NH6A 4H8VA 1JDDA 3PZQA 1ITCA 1UHVA 2VOTA 2ZUNA 4UOQA 1TVPA 5E0FA 5BXSA 4BA0A 2V3DA 1L0PA 2DIEA 2VZVA 4B3LA 4J3WA 5CGTA 1WE5A 4U5KA 4FK9A 4UNIA 2PC8A 2BVDA 3L4YA 1DHKA 4KH2A 2YBUA 1PBGA 1E4MM 2ZUUA 4F9DA 1NP0A 1WZMA 5AY7A 3N11A 3VD3A 4TTUA 1X6LA 2UWFA 3W29A 1KGWA 4BCEA 1GVIA 1E6PA 1H3GA 5BWFA 2O9RA 1JFHA 1B0IA 2WMHA 4MDOA 4AZ5A 2DQXA 3KL3A 2E9MA 1XH0A 5EMYA 2WHMA 1KR0A 1BPLB 2WXDM 1XC6A 4MADA 3B9AA 3B9EA 4CVWA 4CN4A 4D1IA 2WZHA 1UKTA 2PF0A 4OJYA 1GQKA 2C0HA 2JIWA 1BYBA 2GJRA 4PTXA 2D3LA 2X0YA 4X9YA 4QCEA 4UZSA 4UFLA 1CNVA 1D3CA 3IANA 4PMUA 1E4NA 4UFHA 4MB5A 3VGGA 5A2AA 5I3DA 2F2HA 1WZLA 4CCCA 2EQDA 2WC7A 3VU2A 3WEZA 1QPKA 3SCVA 3AMCA 3VMNA 2XFYA 3TTQA 3QOMA 3NUKA 1SYTA 1LLOA 4UFMA 1W9DM 3BCDA 2ZE0A 3WQ8A 2WMJA 4Y7EA 2WW5A 3AS2A 4MB4A 2WZIA 4LPCA 2VZSA 1H2JA 4BQ4A 1UA7A 3L4WA 3AZSA 5C8BB 1E43A 3PHAA 4W86A 1BGAA 2BVYA 1W32A 2YA2A 1CGVA 5I24A 3JUGA 4Q7NA 2QPSA 3UCQA 3OGVA 4B3KA 2DT0A 2IXVA 3IJ8A 4D6GA 4QFUA 4WF7A 1UQYA 3CUHA 2VRKA 1E6XM 3AMGA 1E1EA 1CLVA 6A3HA 1WDPA 2Y8VA 1W2PA 5CSYA 4PTMA 4NF7A 3VIOA 4BS0A 5IHSA 1TG7A 2WAGA 1WP6A 2WPGA 1ISWA 2WMIB 4AY1A 1US2A 4CU7A 1XD1A 4PMOA 3WUGA 2ZX7A 2AAAA 3WN6A 1H4PA 2FGLA 1UH2A 1E73M 3ZO9A 3MUZ1 4PYSA 3WFZA 3K1DA 3FHQA 2XVNA 4CU8A 1BYAA 1E0VA 2OYKA 3QGVA 2CETA 2WANA 4IISA 3L4UA 1BG4A 2CXGA 3VGFA 1MQRA 1CECA 3RM8A 4W93A 4AZ6A 4ACZB 1VF8A 1JYXA 2J8FA 4GQRA 3EMQA 2CERA 5BXRA 2X0HA 5D9OA 4JKLA 1UWSA 4N42A 3VNZA 1W3LA 2WSKA 3VMPA 4Q22A 1JXKA 5D9MA 3FAXA 2WHKA 3W53A 3OZPA 3WMBA 1QHPA 5HPCA 1C8YA 2G4FA 4PN2A 1CGWA 2ZX5A 4AXNA 5FIPA 2G3JA 1HIZA 2VUYA 4PSRA 1QBBA 4F9JA 1NQ6A 5E09A 1MW2A 2DSZA 1HJVA 3K4AA 4UZUA 3AZRA 2W63A 3VKKA 4KRUA 3VGBA 1HP5A 5LA0A 2WHLA 3O6AA 3KWXA 4DUWA 1W3HA 2QLYA 5A8MA 4U2YA 4JFTA 1M01A 3BSGA 5DEZA 4J3SA 4F66A 3AI0A 2X1IA 2FH8A 2FHCA 4GZIA 4PMZA 4CGTA 2J7EA 5ABFB 1UWUA 1V3KA 3MANA 3AHTA 4R5EA 4XV0A 4AD3A 1JNDA 3LPFA 1V0LA 3ARRA 2WBKA 1UWIA 3VIIA 3D5HA 4FMVA 1J10A 3ZOAA 2YIHA 1NM9A 4OZOA 1HJXA 1PIFA 2YL8A 2A3HA 1FFRA 1GOIA 2VL4A 4U33A 4TXEA 4L4OA 3EDEA 2WNWA 2WK2A 3QR3A 4ZE4A 1HKIA 2VT0A 2O9OA 2J7BA 4GZEA 2VO5A 4NSBA 3ARPA 3RM4A 2O9TA 4U3CA 4JHZA 4PBGA 2DSWA 3L2LA 4GZJA 4WKFA 5A6LA 3WNNA 1U2YA 2V38A 1GPFA 2YDRA 3VDAA 4A3HA 1GQLA 3GXMA 5IDIA 4HMDA 2EXOA 1JZ5A 1FH7A 1WB0A 2WSPA 5FOOA 2DT3A 1LG1A 3SCPA 1DTUA 3AIRA 1H0IA 1Q4NX 2WLYA 2DT1A 3CZLA 1J11A 1JFXA 1GW1A 4AMCA 3WD2A 2WBGA 4H41A 1UR4A 4H2CA 3MUIA 5FKYA 1BYCA 2VVSA 4PMRA 1CLXA 5A69A 3FNDA 1IZJA 3WQ5A 1V02A 1CEOA 1CXHA 1O6IA 5GNXA 3N12A 6CGTA 5JBDA 1W9VA 4AISA 1PAMA 1LL4A 3GNRA 1KFWA 2OLHA 2X09A 3AS1A 6TAAA 1H41A 3WH5A 1NARA 4P7RA 1W3KA 4ATDA 3A4AA 3ZJ6A 1ODZA 3EMZA 4H7VA 1VRXA 3W27A 2ZXAA 1J12A 3VX1A 2VR4A 2O9PA 1B31A 4ZFMA 5HNNA 4CVUA 4KMQA 5HOSA 1LG2A 3DYPA 1WO2A 3NSMA 3ZT5A 2ZXDA 3DHPA 3W4RA 2WMFA 2J7FA 4NRSA 4GI8A 1PZ3A 2WM0A 3AISA 2A3EA 5AYIA 2IUZA 3N18A 4J27A 4MNMA 2FHFA 1HJUA 3WSUA 3RDKA 2GJXA 1MW3A 3EDJA 3FY1A 1VENA 2XJ7A 5AC4A 1SMDA 3WD0A 1KGXA 1J0YA 4HOXA 1ITXA 5EFDA 5JIWA 4EKJA 3W0KA 3CHCA 3WNKA 2YL5A 1GZJA 2ZWZA 3VGDA 1KXQA 1BLIA 3GBEA 4HA3A 4AZBA 1C92A 4W7WA 3SUWA 3WY1A 1RD6A 4HOWA 3ZQ9A 3O2LA 1QW8A 3VNYA 2DIJA 1R7OA 1C90A 3IJ7A 4RE2A 1H5VA 1JD7A 3DYMA 4UFJA 5LA2A 2W66A 1G01A 2EPOA 1JZ2A 2E40A 1MXGA 4KGJA 4AIUA 4HPGA 3CUIA 1D2KA 3UG3A 1HN1A 3RILA 2VTFA 2WVTA 3G6LA 3N15A 1UWQA 1KQYA 1XGZA 2UY4A 2X05A 2VI0A 2BVTA 1WZKA 4W7VA 1G9HA 2PWHA 5DT7A 3VPLA 4OBRA 1US3A 5CGMA 1EH9A 2CPUA 1EO7A 3HJEA 3T08A 1LWJA 4D6JA 2EPLX 3FXYA 3POHA 2VNCA 3WENA 7A3HA 5BYWA 3VILA 3PTMA 3GZAA 4NZCA 2V3GA 4M82A 1UKSA 5F7UA 3FHAA 1X6NA 3GM8A 2Y4SA 4K68A 4DUXA 1OGSA 5CPQA 5A6BD 1UD3A 3OZOA 4AD5A 3WF2A 4YN5A 1PEZA 3RM9A 3VGHA 1R85A 2VX4A 3AHZA 4L4PA 4M81A 2BHUA 2Y2WA 4XX6A 2D22A 3BLKA 3ARUA 4AEFA 5LYRA 4W85A 4IM4A 3A4XA 2XIIA 3VOCA 2E9BA 4MB1A 3RCNA 1XYZA 1E6QM 2EPMX 4D71A 3N1AA 2Y8KA 2YJQA 1TVNA 4U2ZA 3VD9A 1F4AA 2DSKA 4PCSA 3WDRA 2PWEA 3ZT7A 3WQWA 3PZGA 3CBWA 5BCAA 4GIAA 2J4GA 1LJYA 3L2MA 2YDSA 3CMGA 3PBGA 3AMDA 3WUEA 4B16A 3SIMA 2D0HA 2CBUA 1E9LA 4CU6A 4EE9A 4D6CA 1Q6FA 3ARVA 4AW7A 3GH4A 2ZUSA 3NDZA 1HJSA 3O9NA 3WBAA 1W1TA 1Q6DA 1W9BM 3OGRA 3AZTA 3ZJ8A 4JHOA 4MDPA 2CBVA 3CZJA 2BV9A 1BVZA 2HVMA 1FA2A 2WVSA 1W9XA 1QNRA 1E6NA 3F5LA 1RP8A 4OOZA 1E5JA 3LPGA 3LPPA 4FF5A 1IT0A 1SFSA 1MYRA 3AROA 1CTNA 3B8SA 1HVQA 3KL5A 1BAGA 1H09A 3DC0A 1PX4A 3BLPX 1JF5A 3TTSA 4H04A 2VX6A 3L4ZA 2GK1A 3CH9A 3AIUA 1BYDA 1EQPA 3WF1A 3N9KA 1VB9A 3VVGA 1G94A 2DT2A 4F8XA 2XGBA 2DEPA 3SCNA 1NWSA 1HKKA 3SCTA 3CGTA 1C7TA 4MAZA 3ALFA 4AZCB 1B3VA 4HU8A 1OT2A 1E6SM 2NSXA 1UD8A 2CHNA 1JIBA 3TOPA 1MVYA 5ABEA 1QNPA 2OYLA 1W1VA 4EANA 1CGUA 1QBAA 4CN6A 5I23A 3AJ7A 1E4IA 7TAAA 3SCWA 1HKMA 2VVNA 1J9YA 1DWJM 1JZ7A 1HKJA 2ZX9A 5CLTA 1V3MA 5A8NA 1UD2A 1WDRA 4M56A 3T0AA 3U57A 4AIEA 3U5UA 1TUXA 1DWFM 2J25A 1GJUA 4IPNB 1UR1A 2CKSA 4UFKA 4XUYA 3W25A 2QHAA 3SUUA 1M03A 4LYPA 3GYCA 2CKRA 3CZEA 4PMQA 2J79A 3E1F1 2A3BA 1E70M 4Z2LA 3EDDA 1DWAM 4MNJA 3L4XA 5AYBA 1OD0A 4PUEA 2ZX8A 2VC9A 5D9PA 3MKKA 5CQ1A 4CD7A 1Y7VA 3HMCA 1XYFA 2TAAA 4TTGA 3RMEA 3MSDA 5CSUA 5DFAA 1W3JA 3ARXA 5BRQA 1G0CA 3AS3A 4C7FA 3MU7A 5A8OA 3GBDA 2JF7A 4B9ZA 3WNOA 4BQ5A 2BHZA 3CHEA 3BXWA 2BY1A 2GFTA 2GSJA 4GXPA 1I75A 1H1NA 1DEDA 2E0PA 2W61A 1J0KA 3W6LA 1OBAA 1GJWA 2ZUVA 1C3FA 1KB3A 4GO8A 3VIFA 4E8CA 3CZKA 3WUFA 1D7FA 2YLLA 3ZJKA 1V02E 2J7HA 2GJPA 1KCLA 4JCLA 2OSXA 1JDAA 1TFVA 1UR9A 3NIYA 8A3HA 4PRWA 5ECUA 5A6JA 1QI4A 4W7UA 4GI6A 4V2XA 5A95A 3TTOA 5M03A 4AD2A 1XV8A 2PWDA 1JG9A 1TA3A 1PZ2A 4U31A 4V27A 2FDMA 3AHXA 4JAWA 3IK2A 2X8RA 1BTCA 2XIBA 4LXFA 5TD4A 3SCSA 1ZU8A 3WIJA 5BRPA 1MXDA 1E6ZA 1UKPA 1B3YA 3VD5A 4TVUA 5A6AA 2XTKA 5D8WA 4JKKA 1E0WA 1UYQA 4DWSB 1FFQA 2ZUMA 3EYPA 1EA9C 1LWHA 1XSJA 1ZJBA 2ESCA 3KZSA 3SUSA 2EBNA 1FP8A 2VCCA 3WQVA 2XSBA 1V6UA 3OGSA 5GNZA 1VEOA 2VZUA 4GI9A 1UZ4A 4UFIA 2BY3A 3MMDA 2YL9A 1E55A 4W87A 4RE4A 3ARZA 1Q6EA 1DWGM 3SCRA 4UQAA 3K8MA 2XVLA 5E6YA 4UQEA 5C70A 4D6EA 3WF3A 4QLKA 4X0VA 4J28A 4IUGA 2YKKA 1WNOA 1DP0A 1ZB5A 1XCXA 2A3CA 2VRJA 1E4LA 3AXHA 1B1YA 1GHSA 5M3WA 3VDBA 1E3ZA 1EHAA 1V3HA 4BQ3A 7CGTA 4PUDA 3A3HA 1DWIM 5KEZA 2PBGA 2GUYA 4PSPA 2GDUA 1EHNA 1FH8A 1TCMA 3AFBA 3APGA 5BXPA 2VCBA 1DWHM 1VFFA 4E8DA 2ZIDA 3FN9A 3W26A 4ZXLA 3K46A 2DH2A 2YA1A 1JI2A 4AWEA 2UY5A 2G3MA 2WKGA 1XRVA 1I1WA 3WBEA 5EBAA 3MV01 3VO0A 4QLJA 4W5ZA 3MMWA 2D0FA 2J77A 4MPKA 2XYLA 1TZ7A 3ARQA 2W91A 4UQBA 3KE0A 2E9LA 2IXUA 1E40A 3L4VA 4JKMA 4S3KA 4W8BA 4JFUA 2WMKA 4J7RA 4JL1A 1C8XA 3WDJA 5DF0A 2JFEX 1CXKA 3UETA 2WWCA 3AIQA 1KXVA 2J47A 2RGLA 1OSEA 1B2YA 3SEPA 3OBAA 3WL0A 3BMVA 4HA1A 4J3UA 5A8PA 3OG2A 3PZVA 3SUVA 4PMDA 1ZBWA 3CTTA 3K8LA 4BF7A 3OIHA
chains in the Genus database with same CATH superfamily
4ZXOA 4O53A 4PRRA 2R8WA 5AB3A 4AZ7A 4GINA 3WK1A 4EF8A 2REQA 1PWLA 1PX8A 3ALGA 4OV9A 6REQA 3KFTA 1EDQA 1OFRA 4Z2KA 1ZCOA 1SR0A 5LIXX 3TSMA 2OLAA 4CKQA 5IBXA 1D8WA 3QYSA 3AJXA 3HPSA 2C16A 3VFCA 3BAXA 2XVGA 3T42A 1JI1A 5A2BA 1RP9A 2GVYA 4MWAE 3A47A 3BL3A 3II1A 3KL0A 1A5NC 3BQ5A 3U6WA 1TR9A 4LUIA 2YDQA 3A12A 3O1NA 4O4WA 5C7HA 1J18A 3RR1A 4JTCA 4DO6A 1V08A 3IK4A 2B0MA 4AAJA 1P0KA 1AQMA 1QTWA 1CXIA 3TZFA 3WMLA 4TX8A 5BXTA 1Q6GA 4W8LA 3E0VA 4JCMA 4P7LA 4B5NA 3MHGA 3G24A 1Z9AA 4PCTA 3TJXA 4CN1A 2DZXA 1PIGA 1FBAA 1UR0A 2BGSA 2FFCA 4M6PA 4LT9A 4UOZA 4H00A 1M7JA 4HZ7A 2VEMA 1IEVA 2C1GA 4N4PA 3LZ5A 1KBKA 2G8ZA 2EKCA 2QUVA 2HDJA 4D8LA 3TE9A 2WB5A 4LYQA 5M17A 4DIAA 3TR2A 2C7FA 1FH9A 1OCQA 3QMTA 4O17A 4JTJA 3FA4A 4FLOA 2BY2A 2V5DA 5CC6A 3VKAA 4AHQA 3OQ8A 3SRDA 3MUAA 3H7VA 5L9FA 1U1UA 2E8ZA 4CNNA 2GVEA 3ZXWA 3R1ZA 1RXOB 4GO9A 1ZHAA 4HYWA 4XTIA 2A7NA 4P8VA 5DXYA 4JIEA 3NOYA 1BG9A 1XYCA 4PUUA 5I5RA 2Z25A 1NP2A 3LERA 5GNYA 3PWIA 3TFXA 2PRLA 2FH6A 4MWAC 2DZBA 1AH0A 3T2PA 2CC0A 1ODUA 5DY3A 1HT6A 2DUXA 3EOEA 3FIGA 3GC5A 3Q2DA 3Q94A 1OM0A 1Y65A 2ZOXA 2DV0A 3KS6A 2C1IA 2XGIA 1MUMA 2IQTA 4EK7A 4Q8WA 1UOKA 1NOWA 3B9DA 2A7RA 2WKLA 3EOOA 3S1XA 3DOPA 2G3FA 4TUFA 1NTHA 3ABXA 4H9UA 3MKVA 1F3XA 3T0DA 3UR7A 4LSBA 3ANYA 5A6SA 1EJWC 3I68A 1R87A 3HQOA 3VOIA 1VEMA 1Q6CA 4QAIA 1CDGA 4MNKA 3URQA 3NPWA 1EZWA 1EJ7L 3BCFA 3H2EA 4TVDA 1P0NA 5KSWA 1L6SA 2E68A 4RZ5A 4WCJA 3HGSA 2PF8A 5I3HA 1LORA 1C29A 5CG0A 3ZMRA 4F0HA 4JYEA 3A6OA 4NI3A 5C0QA 3W7EA 2GUBA 4DO5A 2QPUA 4IZGA 2I5QA 2SFPA 3NGJA 4LJ3A 5CJMA 4Y9MA 3V7PA 1AQFA 1SJDA 1JR1A 3HA1A 3KVLA 4R7OA 3GUWA 3FEQA 3P60A 4HP5A 3RLVA 2CITA 4XD6A 2BOEX 1QHOA 3NM3A 3WH8A 4F3HA 1TTJA 3DI1A 1B30A 3F03K 4UOJA 3I3EA 2J9YA 1OGBA 1OT1A 2PAJA 3QV7A 3GVRA 1J0IA 2PLMA 1KWKA 3U8GA 5D4YA 3E74A 4QBXA 2ZICA 3IIXA 5FD0A 3P2VA 4DZIA 3S6DA 4PGLA 1OX6A 5FJIA 4QDMA 1HF6A 2ZDRA 3T2OA 3LEPA 2IKHA 3QHOA 3EX3A 4UR9A 1FHDA 3V5OA 3MW7A 1KRMA 3QF0A 4W89A 1OX4A 4LGXA 4MTVA 1YPFA 1GK8A 8CGTA 4O16A 2OGJA 2WC3A 4URIA 3UT0A 4AZIA 2VCAA 4K39A 3BGAA 5IHRA 4LYKA 5HUPA 4AF0A 5LA1A 3WD3A 2Q8LA 1CXLA 1W1B1 2EJ1A 2WNQA 4D72A 1GQIA 2UV8G 5BROA 2BLEA 1RALA 3BAYA 3GFXA 1MW1A 4DNHA 1F4HA 2R1PA 5T9CE 3S5OA 3BGJA 4D6IA 1ME7A 5DRCA 5IFTA 1FCBA 1W17A 2HRWA 2ONEA 3W38A 3MI3A 3P84A 1OB0A 1GOMA 3S9IA 5J04A 2ZKMX 1GONA 3G1SA 2JGYA 5I3FA 3N2OA 1A5UA 3DERA 4Y6GA 2E6DA 1GWJA 4GKLA 3SGZA 5HNRA 1HXJA 2WM1A 2CLPA 3SURA 1DIKA 2W27A 2PDBA 3DHUA 5E70A 1ICQA 3BV7A 4EPDC 3UY7A 2Y24A 3EPNA 4W88A 3UP8A 1PTAA 3WF0A 2ZC1A 1HGWA 1SUXA 4CUCA 2FTYA 3TROA 1WKDA 2Y5EA 2FVMA 4ORMA 3MBDA 3WQPA 4J3XA 1V0KA 3FK4A 2Q8ZA 3AUJA 2C8NA 2GJXB 3TP4A 4LV4A 3CAQA 1LQ0A 2A85A 5TIMA 2WVVA 3FV9A 3TKFA 3CQ0A 4S38A 4UQ9A 1PHWA 3D0CA 2V5BA 1SZEA 2YXXA 1TPB1 4Q4SA 4DUVA 1FUYA 2D23A 3EPMA 4FNSA 1GKPA 3AIEA 2ZZ5A 1NOFA 5HPOA 2FVKA 1M7OA 2VR2A 3WFLA 4S3CA 2GGEA 4NZ5A 1LQ2A 2NXGA 5C71A 3PJWA 1JCJA 3URBA 5LHEA 1ZBKA 1GEHA 4PUKA 2V3EA 4H8UA 2P3EA 2GDVA 2PD9A 3CH0A 5E9AA 3IJ9A 4Q8VA 2XVKA 1B4EA 4FS9A 3LTSA 1K9EA 4IQLA 2BNJA 3THAA 5I3KA 4HU0A 3EWDA 3CK5A 5C2GA 4DZHA 3AIBA 1EF2A 3CUJA 3E0FA 5IRPA 1XXXA 4WJXA 1EP1A 4LX4A 2AMXA 2QV5A 4Z2GA 3Q58A 4HJFA 1OF8A 1SQ7A 3C0SA 3TTYA 5PTDA 4L1GA 1N82A 3AXXA 4HZ6A 4ALDA 1HO4A 1S2VA 5C9XA 3MI2A 5JQ9A 3PUOA 5HQMA 5FSDC 5CZKA 3M0MA 7PTDA 1ZFJA 2NV9A 3PAOA 2GGHA 1F6PA 1NWTA 4L6OA 4DZ5A 3WLMA 4U28A 4C6PA 1V7AA 4UTJA 4IJCA 5FESA 4PMXA 2PDCA 2ZRXA 1XG3A 3P14A 1MEHA 4G1NA 3PZNA 1WKYA 1LF1A 1YTEA 4EWJA 3VZYA 3L66A 4UNKA 1YEYA 4X60A 4XZWA 4HPHA 1E6RA 1KM6A 2POZA 1UA3A 3GO2A 4Q6XA 4FALA 3U5YA 4AZCA 3S47A 3QOKA 1XLIA 2XN2A 1M41A 3A21A 2OPJA 4A8LA 3CEUA 3L23A 3QHMA 3AHYA 4IIHA 3N19B 1N55A 3GW3A 1YDYA 2AL2A 1S38A 1CXEA 2BY0A 1QI2A 1Y5WA 4UR8A 3TYCA 4MWAB 5AYZA 3R13A 1Z42A 3VIPA 3NVTA 3EDFA 3EX1A 4KCTA 1O68A 5C54A 1MRAA 3O7UA 4HCDA 4W4QA 3EBVA 3Q67A 3GKAA 4GH1A 4REQB 1IXPA 1W1YA 1XD0A 4JBRA 4NZ4A 3W2LA 1K77A 4FX8A 3FVMA 3N17A 1VLIA 3F4VA 3WMSA 3TC3A 2EPKX 3GSMA 5FJPA 3T0BA 4E4FA 1A50A 1V6VA 2WSQA 2ZWYA 4BQ2A 1ZJIA 3SQSA 2NW0A 2GOKA 4HHLA 1JCXA 4HOZA 2GK1B 1YQ2A 1VYRA 4C6EA 3O15A 1QVBA 3ARYA 1SJBA 3A3XA 3PULA 1AQ0A 4OKDA 4XZIA 2JEPA 3BWWA 1JF6A 3NL6A 3MZ2A 5EMMA 1XKYA 1JEZA 3TUUA 4C7DA 2X2YA 3UZZA 3CEPA 2Z27A 3I10A 4DWSC 2ZX6A 2NUXA 2PDNA 4TO8A 3VTRA 3G5EA 2GQ8A 3KVJA 1WDSA 3NL2A 3OG3A 4M80A 4ZO9A 4Z2JA 1R2RA 1J8VA 4JFWA 1QNSA 3CJPA 3RRAA 4AD4A 2V68A 2B4GA 3AHVA 3XISA 1R86A 3B97A 1IT8A 5A8QA 2VGIA 1NDWA 2CU0A 3P8JA 4DXVA 3T7VA 3MP5A 5F2GA 3M4HA 5FL0A 4DJDC 5CAHA 3S5SA 4WR3A 1JZ4A 3OLDA 2JEQA 1GOWA 4MZ1A 5D8ZA 1G4SA 1TTQA 1QNQA 4MM1A 2QQ6A 3WEMA 3K4DA 4I5RA 1P0EA 3TA6A 3KHJA 5AOUA 1ISYA 2PWFA 3E0WA 4UMAA 1EXPA 1WV2A 1FHLA 4FLQA 1F76A 3HG3A 3QFWA 5C9WA 2PWVA 3M0LA 3W74A 1CBGA 3PBUA 3E5PA 4DXXA 2A79A 5XIAA 3PJTA 5EB8A 1UP0A 3T40A 1E15A 3NSXA 2ZA3A 2Z00A 2I16A 1FWHC 6ALDA 2KAUC 1GEQA 4Q4MA 1UP3A 2PA6A 3WBWA 1V6TA 3E0LA 3DBNA 1AMYA 4H9TA 2PP3A 1KBIA 2HE8A 4DYEA 5C9RA 3WLOA 3VM5A 3PBVA 2GJLA 5GPRA 2IS7A 1OK4A 2V5KA 1C9DA 3NQBA 2NVCA 2UBPC 3G1RA 2OJPA 1EPXA 4V15A 1TV4A 3EWXA 4MFDA 1JYWA 2DDXA 1K9FA 1UJPA 5DANA 1R6WA 4JTLA 3O0KA 1VCVA 1K8YA 3VNDA 3QH2A 1UHVA 2ABBA 2VOTA 4UOQA 1A53A 4R85A 3TSDA 1TVPA 4YYFA 2DIEA 2VZVA 3R5EA 4QRNA 4GVHA 4J3WA 1C8VA 4L64A 2BVDA 2VFFA 3WQGA 1LT7A 5AY7A 1TJPA 1Q45A 3N11A 1X6LA 1ALDA 3W29A 1GVIA 1E6PA 1H3GA 4O10A 3UJFA 4QE1A 4IMAA 4MDOA 4CQBA 1R9ZA 2DQXA 1XH0A 2WHMA 2E5BA 3TIMA 4C60A 3MHUA 3P80A 3STCA 3BG9A 2WXDM 1SJAA 2JKAA 4YWSA 4O12A 3B9EA 4CVWA 3GNNA 4OJYA 1SO3A 4G8TA 3VOHA 2C0HA 1BYBA 1QJWA 1S3TC 5LNVA 2D3LA 2OR2A 1TJRA 4X9YA 3VKJA 2Z1BA 4Y9PA 2NVDA 1FWEC 1D3CA 1YDNA 3NO5A 4WDXA 3E2RA 4PA8A 1WXYA 2F2HA 4HSHA 4UTLA 1WZLA 4R9OA 4BKNA 2V63A 2OKOA 2R1MA 2NX9A 1OCJA 2ZCGA 4PCPA 1GYMA 5LXXA 4CEXC 3NUKA 4NUWA 5GVJA 5HR7A 4L61A 2WMJA 1H7NA 4Q4PA 3NQ2A 4LRTA 4Y7EA 2WW5A 3ABZA 3AS2A 4MB4A 1R47A 2YCEA 3BQ6A 4ZOBA 3ZVIA 1H2JA 2NZLA 4AB4A 3B0VC 1IXQA 3L4WA 3AZSA 5HULA 4N9BA 3LM7A 3TW7A 6PTDA 1E43A 4JTQA 1TUFA 2XU2A 3D6NA 1BGAA 2QCGA 3WBYA 1CGVA 3CQJA 3TVAA 5I24A 3HPAA 2QPSA 4NVTA 3UCQA 5D09A 3UZ5A 4B2DD 2NUWA 4EACA 1JUBA 1DHPA 4GIEA 1E6XM 4IX0A 1WDPA 2Y8VA 3VC6A 4NF7A 4BS0A 2JGQA 2CWXA 3O6YX 1FHUA 2WAGA 2OOGA 4GBUA 3E9AA 1XD1A 4PMOA 3OEXA 3MVIA 4DZAA 4N9DA 1OJXA 2AAAA 3LHZA 3WN6A 4NL1A 1H4PA 2FGLA 3HJZA 3UW6A 4M3PA 3MUZ1 4OBTA 4PYSA 4I6VA 4ADUA 3WFZA 3N29A 5JH1A 5KETA 1FX6A 2BGNE 1PYMA 4GD0A 3R8HA 4IISA 2WNZA 1MQRA 1UR3M 5LNSA 2FTPA 3RM8A 3S4TA 3SB0A 1IWBA 1JYXA 4I8DA 3V35A 4L1XA 3EX2A 3QC3A 4XUGA 2ZADA 1UPMB 3EMQA 4LEFA 3S9YA 3THQA 2CERA 1W5NA 5CG7A 2BMBA 4XBKA 5BXRA 2X0HA 4NQ1A 1Z44A 4DJFC 3WLIA 5D9OA 4JKLA 3R58A 2WSKA 3BARA 5AZ1A 4Q22A 1JXKA 1VPYA 2V69A 4BI6A 5D9MA 3DUGA 3FAXA 2C15A 3CB8A 1QPNA 2WJDA 4US6A 5HPCA 2NQLA 4UTIA 2ZX5A 4AXNA 5FIPA 1HIZA 1VR6A 5E09A 3L7RA 3W00A 2GUUA 3H54A 2DSZA 3K4AA 4PZVA 5LA0A 1HKVA 3CWNA 3T44A 3OP2A 3KWXA 1TPVA 1DVJA 2QLYA 5FEPA 4PTDA 4J3SA 3N9SA 3GAYA 3AI0A 1R5YA 4GFIA 1PSCA 2FHCA 5H8UA 4E4UA 4CGTA 2C91A 1FCUA 4R5EA 4AFYA 3N4AA 3I7RA 3UZJA 2RJGA 3LPFA 3GIYA 2CZEA 4FMVA 4XAPA 2QAPA 2YIHA 2OEMA 2YL8A 2A3HA 2JK2A 2QDDA 1V79A 1ML1A 3W7JA 4L4OA 2J6VA 2FTWA 2PLJA 2VT0A 2O9OA 2VO5A 3BZJA 4JHZA 2IPFA 1OABA 3TW6A 3H21A 3EXSA 2O56A 4GX8A 3CT7A 2QJNA 3GXMA 4KERA 4HMDA 2EXOA 1JZ5A 1FH7A 3WQCA 5HMDA 3HG5A 1H50A 2C19A 3AIRA 1K7EA 3LRKA 3FDKA 1J11A 1GW1A 4XZ9A 2VWSA 1DOSA 3WD2A 1LLWA 4H41A 4I7UA 4H2CA 1ADSA 3OQEA 1BYCA 1G4PA 1CLXA 2O7SA 2IKIA 1V02A 2Z2AA 5HAOA 3W76A 4NASA 1QXLA 1S39A 3N12A 2X7WA 1KBLA 4P5UA 4AISA 3F2BA 3R25A 3TMQA 4J9JA 1OY0A 2GDQA 4MKVA 4JN7A 4IJRA 2YCJA 3NAVA 4H9XA 3K5XA 2X09A 3AS1A 4GQGA 3TC6A 6TAAA 4US5D 3E3HA 1R2TA 3DG3A 2CZFA 2VD9A 1ONRA 3ZJ6A 1XIBA 1OHLA 1F61A 3WJZA 2ZXAA 5D32A 3PPHA 3LHWA 3MJYA 1C9WA 3NZQA 8XIMA 4LAUA 3S5YA 5REQB 2OXNA 3C0QA 3LCWA 2VC6A 3HTWA 5HOSA 1WO2A 2ZXDA 3W4RA 3GU1A 1TV8A 4DO4A 3N18A 4J27A 3N2BA 1HL2A 4DPPA 2FHFA 1I2OA 3C2OA 2NX3A 1AG1O 1XLMA 3W75A 3K2GA 1RAKA 2GJXA 3G0UA 3WD0A 1KGXA 2OU4A 1J0YA 1ITXA 3R12A 3OZYA 3VXGA 1EFZA 1KXQA 1BLIA 4HA3A 3CPGA 4AZBA 5FF3A 1C92A 1TV3A 3QQ1A 4DB7A 3L65A 2YXGA 4XVDA 3UYCA 3O2LA 2HPIA 1X7IA 4C6NA 4RE2A 4LFYA 1G7VA 1GQNA 1OFAA 1LYXA 3CL6A 1JD7A 3DYMA 4IFKB 4ZQCA 4NG3A 1G01A 2EPOA 1JZ2A 2PU1A 1MXGA 5XIMA 3CUIA 1P4CA 1D2KA 2QCFA 5I06A 9XIAA 3EWYA 1ZAIA 1KQYA 3HGRA 3PBMA 2UY4A 4LVDA 4G56A 1VP5A 1WZKA 4OTKA 1US3A 4Q32A 5BWAA 3W2UA 1EH9A 1LWJA 4QG6A 2EPLX 4RNHA 3WENA 5BYWA 3PTMA 5LNUA 4WOZA 2B7NA 1Z48A 1R3WA 3HBLA 1CW2A 3ITGA 5F7UA 3GM8A 3HB9A 1AZ2A 1X6UA 5A6BD 3MJMA 3WF2A 4ZVJA 3WLKX 1R85A 1NU5A 2QVNA 3AHZA 1CX9A 3AALA 4M81A 2BHUA 4F0KA 5CEWA 2Y2WA 3C2RA 4W85A 1XLFA 1ZENA 4IM4A 2E9BA 1E1CB 5FJUA 3A22A 1W8GA 4QJ5B 2DSKA 2ATSA 5BMXA 3T55A 3DGRA 5FF2A 3MPGA 1ICPA 3XIMA 4L5ZA 1UMYA 2OO0A 3CBWA 1LT8A 5K9DA 2AGKA 3H4GA 3T78A 3L2MA 2Z28A 4LF2A 1O94A 2QDEA 4C6CA 5F1VA 4ERIA 2VEGA 3IJLA 4DBEA 4MWAA 4RK8A 3WUEA 4B16A 4XIAA 5T8GA 3SIMA 1ONWA 5HATA 4EE9A 4LNYA 4D6CA 3WLLA 3U3HA 5AHLA 2ZUSA 1HJSA 3QGKC 2VFGA 3BZGA 4PL1A 4WJ8A 4DPQA 2PDMA 7TIMA 2H9AB 4REQA 3GR7A 3UGRA 3RX3A 3CZJA 2BV9A 1O12A 2HVMA 2I57A 3EOSA 4O1CA 1W9XA 3S1VA 1QNRA 1ADOA 3KBSA 1S3HA 4DI8A 1WKEA 3KLLA 2DW6A 3A3WA 1GYNA 1VJIA 3LPPA 3AWNA 1YBQB 3GXPA 1IT0A 2PCQA 5AHEA 1I8JA 1CTNA 3BGGA 3DZ1A 3BANA 1BAGA 2R82A 3R4IA 3KXQA 2P50A 4L56A 4IMCA 3BLPX 3TWAA 5RUBA 4H04A 2X30A 5HMSA 3OTRA 2GK1A 3AIUA 1EQPA 4J35A 2QR6A 1U1HA 3IARA 3FSUA 1VB9A 1G94A 1BRLA 3LV5A 4PCFA 3BE7A 2XGBA 4GY1A 3RCYA 3SCTA 4ES4A 2HNEA 3BDKA 3NZGA 1K6WA 5AYYA 3HIJA 3V5CA 3EKGA 1E6SM 4Y9AA 1JIBA 2BB0A 3TOPA 2GVJA 7XIMA 1MVYA 5ABEA 1PKMA 1CGUA 4CN6A 1FKWA 3AJ7A 3GTFA 1QATA 4LBSA 3STFA 3ATZA 4KWVA 3RHGA 1A5OC 1E9YB 1HKJA 1V3MA 3L68A 1UD2A 4QQUA 1VGAA 3LHUA 1SU5A 3ES7A 3EB2A 2Z7KA 2A6NA 1WDRA 4MKNA 2INFA 1Q6LA 3SRHA 4EXBA 3W25A 1GOXA 5ABTA 4PMQA 3E1F1 2A3BA 4S3DA 1M5WA 5AFDA 2PZNA 3N2MA 3CXOA 4MNJA 1I4NA 4QIUA 3CB3A 4PUEA 2ZX8A 4X22A 5GJPA 1PB0A 3NQGA 4CD7A 3HMCA 3VYLA 3F2DA 3RMEA 3MTWA 5G1TA 4CNTA 5H91A 4C7FA 3MU7A 1VYSX 3AXKA 4ZQOA 5LGXA 5EMLA 2X7VA 3WNOA 1IWPA 4X3ZA 3FXGA 2PGFA 1SO4A 3DAQA 2GSJA 4B5VA 1XYLA 4LVAA 4C1NB 1GJWA 3M64A 4B5SA 2VGFA 1V8EA 2CLKA 4YS1A 1U5JA 4JNYA 1JCLA 2RKXA 4OHQA 3WUFA 2E25A 2J7HA 2GJPA 4UUIA 2NUYA 2FMNA 2OSXA 8A3HA 4PRWA 1QI4A 4GI6A 1TWWA 3KX6A 4AD2A 4S23A 1T7LA 2PDFA 4AHPA 4XAGA 4D8ZA 5ECVA 1ITQA 4D8AA 1PZ2A 1J5SA 2HK0A 4IP7A 4Z0SA 1KM5A 3U2OA 1TQXA 1ZP3A 2FDMA 3MQTA 1AW1A 1TE6A 5EKYA 1KFLA 4ZTXA 4O14A 4WGHA 1WKFA 3H2AA 4Q3MA 4U10A 4ZO6A 4TVUA 4C5ZA 1E0WA 4IPJA 1FFQA 2ZUMA 1OCBA 4KPLA 3F7JA 3KZSA 3RMJA 2EBNA 4RNJA 1YDOA 7ENLA 2PODA 3UWQA 3MUCA 4HNVA 2Y7EA 3UZWA 3LCGA 2VZUA 3QV9A 3H26A 1UZ4A 2WJEA 2BOGX 2YL9A 1Q6EA 1DWGM 3KOZA 3CWOX 4UQAA 1W5MA 1QR7A 3ITCA 3PSWA 3GNDA 1DP0A 5H8PA 1XCXA 1NFBA 2VUNA 1KNWA 1W5QA 1T99A 1E3ZA 3BLEA 3P82A 7CGTA 4WHBA 5KEZA 2PBGA 2I5GA 2GUYA 4JHMA 1EHNA 4LBUA 4R7WA 3WYZA 4RV3A 3B03A 3GAKA 3W26A 4ZXLA 1LUCB 4DLMA 2NXIA 2UY5A 2YW3A 3JZEA 3PFRA 4EPEC 4QLJA 2D0FA 5F2LA 3ITVA 4MPKA 2XH2A 2GWNA 1TZ7A 3T81A 3LXBA 3O63A 2QCDB 2V0TA 4UQBA 2E9LA 4MZYA 2IXUA 4WY0F 4E2VA 3L4VA 3NQVA 3KRUA 4KRZA 4S3KA 4E38A 3LMZA 1C8XA 4YU1A 3WDJA 5HJXA 4FP1A 4FPSA 3K4WA 4C91A 3RK8A 1KXVA 2RGLA 3WK3A 5HR6A 4PB5A 2HNHA 3BMVA 3W7PA 2ZVIA 3SRFA 4N4QA 4PMDA 3LS9A 5HJYA 3UWYA 4PL2A 5J8LA 3K8LA 2IQDA 4QX4A 5HINA 3OIHA 3BMXA 4WX2A 4E4PA 3KOWA 3H12A 4HD5A 1ZNNA 3S83A 2XM1A 4IXXA 3LCIA 4PMYA 4K36A 4I3GA 3QPEA 3NNTA 4D6DA 4PEEA 4MVAA 1D9EA 2CHRA 2QDHA 4ZENA 4QSHA 1L2QA 3RLGA 2B7OA 2YZRA 2VGBA 1PTGA 1EOKA 3B8UA 4P61A 3OYXA 3KRZA 4FIRA 1PS9A 5D02A 2XG9A 3GVVA 1AMKA 4AD1A 4H6EA 5LHFA 1GOQA 3GFYA 3E2SA 2W92A 1HJQA 1RSCA 1JDCA 1MQPA 1BKSA 3B9NA 5G1MA 3SJ3A 3CAVA 4B9YA 4GQQA 3VABA 1A47A 1JQVA 3WL1A 4BFAA 2AL1A 1TTPA 5C55A 3U4AA 4BK9A 1ESWA 3TNOA 3O0FA 5CC3A 4AVNA 1EEXA 2E77A 1KXHA 2PDQA 4HTYA 4L9ZA 5I6SA 2LLEA 1N2VA 1V6YA 1ISZA 1OG0A 1KW1A 4YWIA 3SY1A 4KIEA 4ML4A 3MMTA 4A2SA 1TIMA 4HZ8A 3T0CA 3N9RA 4TX6A 3L5LA 4GUHA 4DI9A 2QJMA 3APYA 1XRFA 2GGGA 4JN6A 2Z29A 1JYNA 4S3EA 1Q65A 3PAJA 2J75A 3PFMA 1EX1A 3M5VA 3I6RA 5CZ0A 3E38A 4O1DA 1B9ZA 1UWTA 2OO6A 3BAIA 1XS2A 2QV4A 3H2MA 4TVCA 1VJSA 3HM7A 1BVWA 3KWSA 1HQTA 4AYSA 3C0LA 2WCGA 1K7FA 3WD4A 1E56A 1HX0A 3ARWA 4DO7A 5BU9A 2D20A 4GFSA 4AU0A 1TMQA 3GTNA 3W82A 1TZZA 3CT2A 2HCVA 3LBMA 1QCWA 3W28A 4Y2WA 2C14A 4NAFB 3PUDA 1UBPC 1OYBA 4LF1A 1EIXA 2NVAA 1V0NA 3E6EA 3UF9A 4AHOA 2W4XA 3RCMA 2YB4A 3EXTA 4D1JA 4MJ4A 1I1XA 1IZKA 3W7OA 4FX6M 2IPWA 5CPMA 1W3TA 3E49A 3JW7A 3L4TA 2QVHA 1V0MA 4HJWA 3H6OA 3FAWA 4F0SA 2E28A 4LUYA 4UWMA 4GKTA 2QNEA 3VMOA 3GH7A 5D30A 3WDHA 2G97A 1MNZA 3RX2A 4I90A 1FP9A 3ID7A 3HMJG 3DXIA 1J93A 2X1SA 1WAUA 1CWYA 4XZLX 3TQKA 1R38A 5HUOA 1D8CA 4LAMA 1IGWA 2MANA 2Z1VA 3BLOA 1EL3A 3N13A 1CZ1A 2IKJA 4WSKA 4I6KA 1VHNA 3VE9A 1JJKA 3BICA 4FHAA 4H83A 1OADA 1XCFA 4AIOA 4FF7A 2Q71A 2E6FA 3VM7A 3VDCA 2BBFA 5REQA 2PS2A 2DZUA 1DV7A 2ZUWA 1GPWA 2KX9A 3DECA 4NKCA 3IJQA 3TAKA 4B4HA 4GCXA 2A7PA 2KZHA 3KLKA 3W1XA 1R8LA 3ZM8A 4R88A 2XIJA 2QF7A 3VINA 3R43A 4EWND 3MUY1 2PGRA 4LQ1A 4MNLA 4AVOA 1MWOA 5I2UA 5HMFA 1L6WA 4OE7A 3W22A 5JIPA 2I9EA 1QAPA 3DDMA 5EY5A 3W72A 5FAGA 4KWWA 1FWCC 5JBFA 4ML9A 3ES8A 3UY8A 1KFJA 3ITYA 3MMUA 4N02A 4NZJA 3WO8A 4S3FA 1PTDA 3VUPA 3GXDA 4IFKA 1JPDX 1JL8A 2YDAA 4CD8A 2YB1A 4PBFA 3L5MA 5I78A 3GXFA 4R53A 4IWWA 1NF7A 3KBWA 4DX3A 1XISA 5DT5A 4L7ZA 3TV8A 4DUOA 5IOBA 1L6FA 3QHNA 1MDLA 2PI6A 4JTRA 3W81A 3M07A 4YVVA 3W6MA 5ABHA 2VENA 1Z7AA 3NPVA 3R8RA 3F5KA 3CZ8A 1UUOA 3OHMB 4JQ1A 4IP4A 1S2AA 1J01A 1W2VA 2BXYA 2P0OA 1V77A 1BXBA 3OA5A 2YXOA 1UW9A 1V03A 3VNIA 3GLCA 4IIGA 1GORA 4AEOA 4EVZA 4AD0A 3G3DA 2G3IA 1DJGA 1VFUA 3HN3A 2G0WA 2VZOA 2CEQA 4YMZA 2D69A 1GVOA 3CMJA 1PDYA 1K4HA 1VIWA 3WELA 5I0DA 1ELSA 3OODA 4ICCX 3FJLA 1TTIA 1GG0A 4LOCA 2O4MA 3LCXA 3URAA 2Z2BA 5E0CA 1UH3A 3AXMA 4TMCA 4DF0A 4HYRA 3P7YA 5MKGA 4B91A 4JFVA 4GLEA 4ZE5A 4GVGA 1RVGA 2PTZA 4R27A 4BZYA 1WOAA 2OVLA 4IFRA 3VZZA 1SZFA 3WFAA 2RAGA 4PULA 1CYGA 3HPZA 1M68A 3BAWA 5D2YA 5FF4A 3NSNA 4OGZA 1E71M 3H24A 5A1AA 5DMNA 2OQHA 1N8IA 3JVAA 3KOYA 4JX5A 3BG5A 1EC7A 2PDLA 1P6CA 4O50A 4PFMA 1XLEA 4C6FA 1UBSA 3OB8A 2OG9A 4QJ1A 5FEWA 2WSRA 4O0QA 4JTTA 5D04C 1YTDA 4DJFA 3ZFHA 4RL3A 3UPMA 5CXPA 3DFYA 1WZAA 2QDGA 1KWGA 2ISSA 3TA9A 1XHGA 3DYOA 1YBQA 2VP8A 1NJJA 4EOUA 2VKZG 4GQ0A 4U5IA 4UTHA 4A3QA 2R94A 4LYRA 3GXIA 3GK0A 3N6HA 2VDGA 3EMCA 3GVWA 3QZAA 4RR4A 1IGSA 3WKZA 4NX5A 4P8XA 1QFEA 3CPUA 4FLRA 3UESA 2R9RA 1AA1B 1MFVA 2RFGA 1IXOA 2EG7A 2PMQA 1R3SA 1EIBA 4KW2A 3HPXA 4EP8C 1KCKA 3GU2A 3P0XA 4M24A 1CENA 1V6WA 4F40A 1G4TA 3LNPA 2PZ0A 6XIMA 1DJYA 4NHVA 3AXIA 3PJUA 2D24A 1TJ2A 3WLJA 3W02A 2IPJA 5I77A 3FDGA 2YBTA 4LY4A 5KZDA 1K4GA 4QNEA 3ZZ1A 3ZT6A 1GOOA 1IIHA 4JGDA 2JKEA 1RBOB 4DAFA 3EWCA 2PGEA 1WDQA 2I14A 3DFTA 3TYBA 3VIMA 1X98A 1VBRA 3CC1A 4GBDA 2V3FA 1H7RA 7ODCA 1RLDA 3KBJA 3GNOA 1O95A 2VQUA 2C13A 1EO5A 3PF3A 4PUNA 3W1LA 5I3IA 4FNQA 3QLLA 5CBIA 2C6QA 4NJKA 3UJ2A 2E5CA 1KGUA 2HISA 3UR8A 1EQCA 4ACYA 9RUBA 2X1UA 1Y0EA 2Z7GA 5I3JA 2WJFA 2WCSA 4DF2A 4CQ8A 3TONA 2YA0A 3LQGA 3WF4A 4BF5A 3U7BA 5D2VA 1DIDA 2WYSA 3ANUA 4L1WA 5K4XA 1IV8A 4OBSA 1HP4A 2P10A 4E5TA 4AWUA 4H2HA 5F4XA 1FXQA 4DM1A 3KAOA 3VNKA 3GNXA 2DPEA 2OQLA 4GZ7A 4CNPA 1JAKA 1JAEA 2G3NA 4IJBA 4C6QA 1J5TA 1HFBA 3UG5A 1GCYA 1Q4WA 1XDMA 3TN5A 4UTFA 4YHEA 2E4TA 2ON3A 4KRTA 2PP1A 3I65A 4S3GA 2EEXA 3G1YA 1P5BA 1DXFA 4U3AA 4CQCA 1EC9A 2PU0A 4JQ3A 3DFQA 3USZA 3A4JA 3LI0A 4RNFA 4GG9A 2WWDA 3IAPA 1UH4A 1X39A 3KOFA 3LG3A 3CL7A 4EXAA 1IT7A 1ZJHA 2XM2A 1DORA 1SO5A 1I6NA 4LAOA 1AQHA 1UKOA 1W5OA 3ENLA 3THDA 4A3RA 4DY1A 2VEPA 5D2TA 4QP0A 3AQUA 2DY3A 2J8GA 2BXZA 3RAOA 4EF9A 5IDZA 1ISVA 2E8YA 4GK8A 1MQQA 1W37A 4XKYB 1G4EA 4A4AA 1RVKA 2C3ZA 3G6MA 2DGAA 5G2WA 1G5AA 3FJ4A 2AQWA 1LROA 3CL8A 3VK5A 2PUZA 3CIVA 2PB1A 4GOAA 2I56A 2W3ZA 4RDWA 1EJVC 2D1ZA 1EX5A 1SFTA 5DRIA 4JZ5A 1XIIA 4Z2HA 4N6EA 3TK7A 1KO0A 2FZ9A 1S46A 4P7NA 3VKCA 4YTRA 4Z2IA 3LXCA 1H1YA 5EMUA 3QXBA 4Q4RA 4MZ8A 2HROA 1A5CA 3F1QA 3HURA 5FCZA 2G95A 3BURA 3W7GA 1EOMA 2WO5A 5LGZA 2FHBA 1LUCA 3IRDA 3ECQA 1J0HA 1GGOA 3WD1A 2PURA 1ZJAA 1P6WA 3KM8A 1SGJA 2MUCA 3L2IA 1CGYA 1KR1A 5CPTA 2L5HA 1MRQA 1QPQA 3N14A 2QCDA 3MY9A 2E6YA 2E5DA 4Q4KA 3PZQA 4GYKA 3C2VA 4DVOA 4B3LA 4LANA 4GX9A 4N7QA 2PC8A 3L5AA 5CPNA 2YBUA 3RITA 1E4MM 2ZUUA 4MF4A 4C6BA 5DMMA 3T0TA 3VD3A 1M7PA 3MWAA 2Y0FA 3SN4A 3WK2A 2UWFA 4C90A 2TYSA 3PB2A 4OFCA 1IEQA 1PCKA 2IPGA 3DKLA 2G50A 4E2BA 1B0IA 2WMHA 4RLIA 4AZ5A 2J9XA 3VNJA 3JZUA 5I02A 1KR0A 3B4UA 2PCEA 5BOFA 4HMNA 3T1GA 3B9AA 1NFGA 1X1ZA 3DH7A 1RY8A 1UKTA 4ZO7A 1GQKA 2JIWA 1N7KA 3BLLA 3SSZA 1YLVA 4QCEA 4UZSA 3DU0A 2NX1A 4GNKB 1CNVA 4Y9NA 5E1QA 4LV9A 4PMUA 2I17A 2VFIA 1E4NA 1MUCA 1EJTC 2EJAA 3VGGA 3A13A 4K3ZA 2C79A 3WBXA 3FSTA 3NQDA 3R8GA 2ABAA 1NF0A 3AMCA 3SFKA 1UPPA 2B81A 1H51A 3O6CA 1FCVA 4LVFA 1IEXA 3BJSA 2HWGA 1UC4A 3P67A 2C1HA 1XFCA 3GWQA 4BQ4A 1UA7A 4ZZ9A 1XLLA 3W2JA 4JQ4A 4ILSA 3VOFA 5C8BB 1XUUA 4G7EB 4W86A 2YA2A 3C2FA 2NWSA 1XW8A 4B3KA 1QPRA 3HZ3A 4ZCWA 2XISA 5K7JA 4H9MA 1KV5A 4H9YA 5G2HA 4QFUA 3HG2A 1CLVA 1DBTA 5CSYA 4O57A 4PTMA 1SZRA 1WP6A 1ISWA 2WMIB 4ASTA 5CAKA 3OZMA 3C3NA 2FZNA 4CQDA 3QPYA 4WDUA 1UH2A 1E73M 1XPGA 4IGSA 1OYCA 5I07A 3PM6A 1LBLA 3K1DA 2XVNA 3C2YA 5M1TA 1E0VA 3PK7A 2F38A 2PDJA 3NM1A 1XP3A 1EGVA 2FYMA 4NAFA 5MHBA 1H7PA 2ZRZA 3KRBA 1JPIA 1CECA 2Q3OA 4ACZB 4AZ6A 3SQLA 4B90A 1JPHA 4MKSA 2A6LA 3BOLA 5FI8A 4Z1YA 3SADA 3MSYA 3BOXA 4N42A 3KCOA 4TQTA 2XINA 1CLKA 3MO7A 1E0UA 1KV8A 4FXRA 2G4FA 1F8MA 4PN2A 4DWDA 3PC0A 3NA8A 3PPGA 2PDUA 1QBBA 1NQ6A 2Q6ZA 1VS1A 1MW2A 4XIMA 1HJVA 1OQFA 2W63A 1JPKA 3VKKA 4KRUA 3VGBA 3W87A 4ERGA 3LENA 5EPDA 4HPJA 3BK0A 4DUWA 3CHVA 5A8MA 1AL7A 4L4LA 1SSGA 2FZBA 2FMOA 1GTHA 5EBUA 2FH8A 1ZAJA 3UJRA 3G0SA 3HF3A 1I2RA 3S3GA 1V3KA 3GC2A 3MANA 5GJMA 4XV0A 4RW3A 4AD3A 1JNDA 4YTQA 1K8ZA 1J10A 1EXBA 1O1HA 2ADAA 1NM9A 2Q09A 4OZOA 1HJXA 1QK2A 1FFRA 3M0HA 4U33A 5KZEA 1US0A 3LGEA 4TXEA 5JU6A 1PE1A 2FZ8A 2WK2A 3N6QA 1B9BA 3EAUA 3PY2A 3ARPA 2B7PA 4U3CA 1GVQA 4O11A 4PBGA 1YXYA 4RPQA 4I9MA 4LC8A 1Z6KA 1KM3A 3MP4A 2QULA 1LBMA 4PB3A 1X1OA 2DVUA 1WB0A 3EWBX 2WSPA 3UPWA 1DTUA 3CZLA 4FZIA 3GU9A 4UC5A 4B5WA 3WQOA 4N9EA 4QNWA 3H4XA 3MUIA 4PMRA 3FNDA 3WQ5A 2R6OA 3UG8A 1CEOA 2MNRA 1O6IA 4RZ6A 2G5WA 4DHGA 5JBDA 1MI3A 1QK0A 2ZBTA 3GNRA 3L9CA 4Q7IA 4BI7A 4J3ZA 4AG0A 3FFSA 4O1AA 1N8WA 3G1XA 1H41A 3WH5A 1W5PA 1NARA 1LBFA 3LY0A 3CV6A 4V1XA 4X2RA 2CLMA 3S1GA 4M0XA 2AAMA 4JIRA 1T40A 3EMZA 3AYTA 3U2CA 1J12A 2O9PA 3W1NA 1B31A 4G7FA 4QS5A 4YVXA 4NI8A 4KMQA 1LG2A 1TB3A 3DYPA 3T05A 2HVNA 2J7FA 4GI8A 2WM0A 3AISA 4A21A 4XK2A 5AYIA 1Q6QA 1VYPX 4O1FA 2IUZA 4MNMA 3S6OA 1TO3A 3R89A 4QJ4B 3LRLA 1F7BA 3WSUA 2GJNA 3FY1A 3KUMA 4ENLA 1VENA 1A5SA 4XTDA 4GUJA 2PE4A 3CHCA 3WNKA 1GZJA 3VGDA 5AKQA 2NV2A 3LX9A 5HJLA 4EX4A 4W7WA 5LKYA 3SUWA 1QW8A 1R7OA 1EJSC 1J96A 1A5AA 4XZNX 2QUNA 4H7CA 2J6XA 1H5VA 2ZZ7A 1K70A 4DXKA 4UFJA 5LA2A 4GYPC 2W66A 2P8BA 3KW3A 3M43A 4H9VA 4KGJA 4AIUA 3GDKA 1QUMA 3UG3A 1HN1A 3EKZA 2WVTA 3G6LA 4L9YA 5KZMA 1XGZA 4HPNA 2X05A 5H1WA 2BVTA 3HQNA 4QE5A 4W7VA 1XDLA 3OU8A 2VELA 2X2GA 3W1PA 5CGMA 4ZOCA 2CPUA 3QFEA 3DFPA 3FXYA 3POHA 1RR2A 7A3HA 3QZEA 3ITTA 3VILA 3NDOA 1P1XA 2Y7DA 4ZQMA 3CUZA 3DGBA 5G2IA 4MIMA 2ZZ2A 3CLMA 4M82A 1UKSA 4X63A 3FHAA 5U7SA 1X6NA 3KCLA 3LYEA 4B5UA 3I6EA 3F4CA 4DUXA 3TYUA 1LOSA 2FKPA 3OZOA 4YN5A 1PEZA 2GPTA 4ZTYA 3E0IA 1HO1A 3QR1A 1FWBC 4I9TA 3KBVA 4LAZA 4XX6A 3ARUA 1I0BA 3NURA 3PVFA 2E1DA 3A4XA 2XIIA 2Q3RA 3KTXA 1XYZA 1E6QM 4D71A 3REQB 3P93A 4KS0A 3VD9A 1SPQA 2CZDA 3WDRA 2X1TA 3R10A 2PWEA 5CC5A 1M6JA 3SFWA 3WQWA 1EC8A 5JXQA 1P6BA 4YNGA 4J4KA 2J4GA 4XO7A 1LJYA 1U22A 1AH4A 3AYVA 1TWIA 2OELA 3PBGA 3AMDA 1HGYA 1FWTA 5TNVA 1RD5A 1RJQA 2CBUA 4K7VA 3IGHX 3ELFA 4LRSA 1TV5A 3ARVA 4AW7A 1AD1A 3GH4A 4WOQA 1FCQA 3M44A 4DAIA 2P5NA 3AZTA 3ZJ8A 1MDRA 1XIJA 3STEA 1KBJA 3FJNA 5H6HA 2CBVA 3KRSA 3NL3A 1DPMA 4PB4A 3QSTA 2WVSA 3G1FA 3LBOA 1RP8A 4ZB5A 3F4DA 3CQHA 1M3UA 3WCZA 4FF5A 4GGBA 4GNVA 2CLOA 2O7QA 3AROA 1S2UA 3G1AA 4XZMX 4L65A 1H09A 3DC0A 3S2JA 1KFBA 5DLCA 4POCA 3TTSA 2VX6A 1BF6A 3L4ZA 3WJYA 1NDVA 3CH9A 1PHQA 5EA9A 3WF1A 3VVGA 5A5WA 3NYZA 1FWDC 4F8XA 1DJNA 4XAZA 4Y8FA 3CGTA 1C7TA 2Y8UA 4MLJA 3LHVA 2P8CA 2V6AA 1VFHA 1XG4A 1O5RA 1PV8A 3H70A 1SSDA 2WPBA 2YFOA 4GXMA 4UTMA 2ZE3A 2OYLA 3GG1A 4EANA 3UPBA 1QBAA 4RXGA 1MO0A 1OC5A 4J2MA 1DWJM 4C6DA 1O1ZA 2ZX9A 3NZRA 5CLTA 3TFCA 1IXNA 4GHRA 1GVSA 2ODOA 1FWJC 4JTFA 4M56A 3T0AA 4HTBA 5HWMA 5DBUA 1GJUA 2CKSA 3UWWA 4YCOA 3GS6A 4QE4A 2WNNA 4IXHA 3CAWA 4XUYA 4H6KA 3SUUA 4IICA 3GYCA 2CKRA 3LA4A 3XINA 3O3RA 4N6FA 1Y8BA 2BWGA 4GC4A 4M19A 2ICSA 3KOXA 1OD0A 1XLBA 1A3WA 5CQ1A 4A8IA 3ZR4A 5DFAA 3GXNA 3A24A 3PUGA 1XBYA 2W0UA 4H19A 5A8OA 3B0YA 3V1PA 4IF2A 4B9ZA 4BQ5A 2QCNA 4PEKA 4UIOA 1O4UA 1AW5A 4E2DA 2GFTA 3TNBA 1DEDA 1PWMA 3TXZA 2E0PA 2QJHA 1T8XA 2GQAA 3B9OA 2ZUVA 1DE5A 1KB3A 1F05A 4E8GA 3VIFA 1R9YA 3R2GA 1ME8A 2YLLA 3ZJKA 1SVDA 1EJRC 4JCLA 4NU7A 4AY8A 1JDAA 1PZ1A 3K1GA 4V2XA 8RUCA 3V3WA 5A95A 3NGFA 1XYAA 2PWDA 4GUFA 2Y85A 5DCDA 4YIWA 3G22A 5HWNA 5DCBA 4CQAA 1EB3A 4NNBA 3IK2A 3FX4A 1KTBA 5DX7A 2H6RA 2X8RA 1BQGA 4FXFA 1DL3A 4IQJA 1SFLA 3OVQA 5TD4A 3AAMA 3SCSA 5BRPA 1XBVA 1B3YA 2DW7A 1O60A 1LLZA 5A6AA 1XQLA 1FY6A 4IP5A 4JKKA 1UYQA 3EYPA 4RDYA 1EA9C 5LSMA 1UROA 4ZB0A 1XSJA 1ZJBA 2ZDSA 3SUSA 2Q02A 4BI5A 2VDIA 2VCCA 1EP2A 3DN5A 2PEVA 3TEVA 4ZFCA 1V6UA 3C52A 2ZZ6A 3OGSA 5GNZA 1VEOA 2FQIA 3G3MA 1DJWA 3DEQA 3UNDA 4W87A 3W7HA 4RDZA 3SCRA 3ZYZA 2V30A 2X1RA 4RX0A 3RUBL 4UQEA 1EF3A 5C70A 4O54A 4J28A 1ZB5A 2VRJA 2GSEA 1B1YA 1F3EA 2ACSA 3EEGA 3USBA 4D2JA 3B8IA 3BSMA 4JD4A 1FDZA 2PTXA 5LZLA 2GDUA 3CWHA 4E3TA 2V2DA 4C6IA 3APGA 1VFFA 4O18A 5CKSA 2DZPA 3K46A 1TVLA 1WDWA 4QHRA 2DZTA 3TN4A 1UC5A 3MV01 4IIFA 3VO0A 2XYLA 5L6UA 1W3IA 4NJJA 1YKWA 3ARQA 1WOBA 2BGQA 2HBXA 3KE0A 5T91A 3H7UA 4GC3A 4JFUA 4J7RA 5SWUA 4WVXA 1TRDA 1YDVA 3BLIA 1LQAA 4KQNA 3AIQA 3WL0A 1VC4A 1XKJA 4G7EA 4HA1A 5A8PA 1ADDA 1TMHA 4GXWA 3PZVA 3B3DA 5DY2A 4ZQPA 3SUVA 1UCWA 1ZBWA 4BF7A 1VRDA 2GVGA 1RJPA 3K13A 5I3GA 4M8UA 2OWCA 4MB3A 2Z1KA 4K37A 3LV6A 1H49A 2PDPA 3HGOA 1VBGA 3MUXA 4E2OA 2WMIA 5A94A 1JNEA 1OFPA 4G5DA 2QAFA 3QY6A 3UJEA 4KT2A 2PLKA 1OFDA 3PZOA 4US5A 4YPJA 1IR1A 1UG6A 1MFUA 1NSJA 1ENUA 3BW3A 1XIGA 3IPWA 1XIFA 3PJXA 1T0OA 1MUWA 1YYAA 1P7TB 4JTUA 4LS2A 5D9NA 5DXXA 3HO8A 4BJHA 1VFMA 1DE6A 4ACZA 3G1VA 4Z1BA 3NCOA 1BEUA 2HVOA 4X2PA 2NQHA 3WDIA 3ABOA 3IRSA 5E5CA 1BSIA 4HNOA 5LIWX 3POCA 3TQPA 1KTNA 5KITA 4YL2A 3S1WA 1PX3A 1X96A 2BVWA 1QOXA 3WEOA 4JTEA 2EG8A 2BS9A 1LL6A 1KM1A 3W86A 4DWSD 3W7RA 1UMLA 3AU6A 4CQ9A 4QR6A 4H6QA 3THCA 4ATWA 4WKAA 2VRQA 1F3WA 1EEPA 3S2CA 1RHCA 1RCQA 1I2PA 4QROA 3C56A 3RRXA 2YYTA 2YL6A 2QJJA 1X7FA 1NOUA 1X8FA 3RPMA 3P8IA 4LUSB 4S3JA 3AOFA 4ZQNA 4WIWA 4GVIA 2FIQA 2VX5A 3EB4A 3LGGA 3NR0A 2WOQA 2VYOA 1Q85A 5C2CA 1XDJA 3P81A 3MO4A 3DFNA 4DJDD 4FLSA 2DUZA 1O5XA 1GOKA 3KVMA 1FWWA 2OT0A 1QI5A 4IMGA 4C65A 8TIMA 1BF2A 4V28A 4HIBA 2AQOA 3WG6A 1XF0A 3M47A 4DJED 1I9CB 1A5KC 4CCZA 5A6BA 2WVVB 4EAYA 3SW6A 3WUBA 2JQXA 5DO8A 1Q3NA 1TX2A 3CV1A 2X16A 2A4AA 3E5BA 2XN0A 1W1PA 4P8WA 1YE4A 4UCFA 5FL1A 1Y5VA 2CCRA 1M7XA 2QEZA 1O5KA 2VM8A 2XFFA 1A4LA 1CI1A 4DM2A 1EBHA 5DQPA 2GL5A 1JDEA 1RQEA 2FPTA 4K1GA 1TR1A 5M5DA 3SCUA 3AMLA 4QCFA 3D46A 1EKOA 2YOCA 1ZBCA 4PRTA 1QDSA 1M53A 1SFJA 1VAHA 4JFSA 5CZSA 1OFOA 2BFGA 2Z4GA 2OQYA 1D3HA 3MDUA 2VJXA 4OUEA 2QIWA 3DX5A 3UCCA 3VCNA 3T2QA 5HDRA 2G41A 3FA3A 2FGZA 4OECA 3WH6A 1XSIA 4IMEA 3LOTA 1TX0A 1JZ6A 1XX1A 2NXHA 3E12A 2CIPA 4J3TA 1UD5A 2QMJA 4NX0A 1F74A 2HS8A 3GNPA 1MNSA 1WUEA 2BXVA 4WSJA 3VCCA 5AHFA 5CC7A 3ORWA 3OPSA 4I5UA 4ZB2A 4MJZA 5CGQA 4CEUC 1W3NA 2RUSA 3PNZA 4Q7BA 2ZC8A 1VBUA 3E02A 2DJXA 1TIWA 5A6KA 1QMLA 5CJ5A 1ZL1A 2NQ5A 3AS0A 1B3WA 3NQFA 3O06A 3IGSA 3UJSA 1OCNA 3I3BA 5HWJA 2P0IA 1L2UA 3EOLA 2GLKA 4R3UA 2FDSA 3PN8A 4D9PA 4W5UA 3GIPA 4QS6A 3IJ6A 5TF0A 3UWZA 1YNYA 2VEIA 2ZXQA 4ZA0A 4HU3A 1LL7A 2PRHA 3P61A 4IG2B 4C1KA 3AYSA 3NYDA 3NFUA 1OX5A 2E67A 4JOMA 3Q37A 3UU0A 1XCWA 3MBFA 3SR7A 3CYVA 3G1HA 4AC7C 2FPVA 3BV4A 1OF6A 4QEHA 4FO4A 3VD7A 4KCUA 2F8QA 3ZR6A 1ZTVA 1G7UA 2X41A 3H53A 1H63A 3ARTA 1XLAA 3TTEA 4MPQA 3EWWA 3DG6A 1JYVA 1S5VA 2PWUA 3EGJA 1BKHA 1KRBC 2YGYA 1B3XA 1Y5XA 4FIQA 2PDYA 3OBEA 4HCHA 3PSVA 3ZSTA 1SJCA 1OD8A 3S6TA 3CZGA 4O0ZA 1RUSA 3BW2A 3PG9A 2YX0A 2PLCA 4FEZA 2VX7A 1E1FA 3WX7A 3WLHA 3GVGA 1SMAA 2TSYA 3ONBA 1JCTA 1ZLPA 3UERA 3REQA 3IJDA 4DBDA 4K8EA 1ECEA 1R30A 2XIOA 3BJFA 4HN8A 4GJJA 3KEHA 3ZR5A 1O5QA 3QKEA 1DJZA 1SZGA 3UD6A 3W1AA 2OYMA 4A6GA 4HK6A 4XG1A 1JZ3A 1UZ1A 2G37A 3C6CA 4O8RA 3APTA 4MYXA 1JVNA 1YNQA 1CXFA 2QCHA 3PZ9A 5B7ZA 3SJNA 2PDWA 1EYEA 2J74A 4HGXA 3RJYA 2ALDA 1XLDA 4WXYA 3BW4A 2PWGA 4KEZA 4IHCA 1J0ZA 1WDDA 4FR6A 3VGEA 4XVEA 3P0WA 3PANA 3TYEA 3CV7A 3QLDA 3P3BA 2F61A 3CASA 3A23A 3EKLA 2R14A 3COTA 4JPGA 2NT1A 1E5NA 1EGZA 3CHDA 4O19A 1AD4A 1K9TA 3U7VA 3VIGA 3MB9A 3I4KA 2GOUA 4LCRA 1NIUA 3EB3A 3NQMA 5I00A 4HSNA 1YTKA 2UY3A 4WKHA 3VIHA 1IF2A 2B31A 4DBSA 2W9MA 3QBUA 3BAKA 1AVAA 2Y61A 2W6RA 1J0JA 1IHIA 3SY5A 3KBNA 1K03A 3OLGA 1VKFA 4MUPA 4C7GA 2PDXA 3ARSA 1BTMA 1ISXA 5AYXA 4AX7A 1UD6A 4QLLA 2XWDA 3K8KA 3W88A 3CTLA 4NRRA 1V3LA 1W1IE 3TX9A 3NVDA 2CHOA 1WX0A 1WPCA 3BLDA 4P8UA 1HNYA 4AIBA 1F73A 5A3HA 4ZO8A 4ECLA 1ITUA 4KGLA 4WGXA 2DP3A 3C8FA 3D47A 4MY8A 2XUCA 4JIPA 5C7VA 3EEZA 3WLRA 3GQYA 4JIQA 1OGGA 3MYPA 3M0XA 3TCSA 1IQ8A 2PGWA 3LBCA 2QYGA 1K9DA 4NJGA 2WZEA 3GRIA 1R3TA 3S2MA 2QF8A 2WHJA 3IJIA 4KEUA 3S46A 1HJWA 1HTIA 4G2DA 4LUTB 4NXKA 1AW2A 5MF5A 4L6HA 1QWGA 3CMFA 4GE8A 4HMCA 2HV5A 3GDBA 4OOUA 1ZSXA 1BVNP 3P5ZA 2VMFA 1W91A 3TWBA 3WDPP 1WCGA 3GD6A 1CGTA 4N0RA 3OBKA 1YX1A 3ZIZA 4KESA 1YHTA 4UQCA 1B3OA 2XWEA 3CPRA 3SCQA 3GVQA 2OZTA 3BCJA 1TE1A 3T9PA 1VFOA 1KLZA 2EHHA 4QITA 2CYGA 1LP6A 4NZ1A 1M9HA 1FDYA 3MV11 2J62A 3LCLA 1QW9A 2FZMA 3L21A 3VDHA 1HG3A 4IIBA 1GUVA 3KHDA 4HCLA 2HTMA 3B0UX 5JUVA 4PTVA 3RJXA 1BFNA 4HMEA 3SN1A 3RIKA 3UWVA 4I7WA 5LXEA 1UR8A 1MW0A 3IWPA 4XB3A 1GZ1A 1EDGA 1R7AA 3A9BA 1WAWA 5DELA 4UXDA 3GE7A 2X42A 3WLPA 1Q66A 4M6QA 3U4FA 2XHYA 4A3YA 3WMCA 3BAJA 1XSKA 4OT7A 4HHMA 4Q33A 1KKOA 4UR7A 3WNPA 2XZ7A 4BF9A 3NDYA 2R24A 4BEQA 4B15A 1TWDA 2W5FA 1GQJA 3CQKA 4ONVA 4WD0A 3GY1A 1VH7A 5DMYA 4IOTA 3CM4A 2OSYA 2ISVA 2IKGA 1G67A 3WQDA 1I0DA 3M1ZA 3QN3A 3IUDA 2JBMA 3TDFA 1JGIA 2AMGA 4GYPA 4J40A 4CNUA 2WQDA 1JPMA 4GY0A 1MZRA 2V9DA 3RXZA 4J3VA 3UQNA 3UXIA 1UIOA 4XZBA 4HA4A 1W9PA 2CESA 4AEEA 4FOKA 2YLAA 2BG5A 5D03A 1DJHA 4TOQA 4UQDA 2PTYA 3MCMA 1TPH1 2Y7FA 2FJUB 1PDZA 3DKJA 3J7HA 4UB9A 3NG3A 5E93A 4YLWA 3AUOA 1OINA 3AYRA 5CLWA 1GJPA 4IL0A 1GW9A 1NH6A 4H8VA 1YPXA 1JDDA 1ECQA 3W7LA 4O52A 3CYJA 5E0FA 4BA0A 3W1TA 4BY3A 3AO0A 5CGTA 4FK9A 1QNVA 4AYGA 3L4YA 5LNWA 1T6MA 1DHKA 4KH2A 3UBPC 3NEVA 1PBGA 1NDYA 3HFTA 4F9DA 1WZMA 4NAEB 5DBTA 1MSSA 4TTUA 3IS4A 2HZGA 1WA3A 1KGWA 5BWFA 5M2FX 1BXNA 1JFHA 1R46A 3ZLHA 3C0JA 2ZVRA 1BWLA 3GUGA 3KL3A 2E9MA 5EMYA 5KINA 4C1LA 1BPLB 2RDWA 4XSMA 2NLYA 3V75A 4CN4A 4D1IA 1BXCA 1F6YA 3MYOA 2GQ3A 3LRMA 1ZALA 4PTXA 3QM3A 3IEBA 2V5LA 2X0YA 3S5NA 4UFLA 2GQ9A 3H2OA 1P7TA 2OX1A 3IV8A 3CUXA 4QQ3A 4UFHA 3HFYA 4WY0B 1T96A 4LTSA 2EQDA 3WEZA 4TIMA 3SCVA 3FA5A 2OZ0A 3VMNA 3TTQA 3QW4B 1SYTA 1LLOA 1W9DM 3BCDA 1JCYA 2QCLA 3TJLA 2ZE0A 3WK0A 3V4BA 3C3UA 5G4WA 1UP2A 2BTMA 3ITOA 4O15A 2WZIA 4LPCA 2VZSA 3C2EA 3M16A 2E6AA 1TREA 6ENLA 3F4NA 3R79A 2EG6A 4HNUA 2BVYA 1W32A 4KCWA 3JUGA 1H61A 5T9BG 4K8HA 4IIDA 1NY1A 1W1A1 2DT0A 4QISA 1KFEA 4Q8QA 1XBXA 4D6GA 2H90A 1XGDA 1WXJA 2R1LA 1AUSL 4WF7A 1UQYA 1XLHA 3CUHA 1DJQA 2VRKA 4G6CA 4XBSA 4LUSA 2I9UA 4X9SA 3Q45A 3UWUA 4H3DA 4HN4A 5IHSA 2WPGA 2Y63A 3TN6A 4OU1A 4ORIA 1S2TA 1US2A 4AY1A 4CU7A 1XR2A 4WQ6A 3WUGA 4Z1CA 4XO6A 3GW0A 3B0PA 5JVLA 4OV4A 4C6MA 1Q2SA 3F2CA 3ZO9A 1TMLA 3H8AA 3FHQA 2EGZA 4CU8A 3QJAA 5EMJA 2OYKA 3QGVA 3IVTA